1NK4A

Guanine-guanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk4A01
3TI0A 1NK9A 4ED8A 3JPTA 4M9NA 3RB3A 4ECUA 9ICFA 1TGOA 2BHNA 1RYRA 8ICTA 1VSMA 5HMMA 1MC8A 3VQPA 1U9LA 1UA1A 2IHMA 1EXNA 2J6TA 4Z6CA 1KLMA 4P4OA 4EP4A 4PGYA 4NY8A 3Q8KA 4CJSA 1ZQYA 4I2DA 3DLKA 2EHGA 3I0SA 4O5CA 4KREA 1KCFA 1IKYA 4C8MA 4EYHB 4ED6A 3QEVA 5L1IA 4KLJA 1D9DA 5KG3A 4DEZA 1ZQEA 3PV8A 1HYVA 4O5EA 3O3HA 1NK7A 4FO6A 1A77A 2JEFA 4E7JA 5J2HA 3RRHA 4CJKA 4OLBA 4CJRA 1NKCA 2YKMA 4CEZA 1JIHA 3K5LA 3PW7A 4CIFA 2R7YA 2BDPA 4FBUA 4F8RA 4CJTA 3RH5A 1TL1A 2Z1HA 3TAQA 1RDDA 4TUSA 4PA1A 2UVWA 4GC6A 4GXKA 4KHUA 3PW0A 2O4IA 3M8QA 4RZRA 1SKSA 1ZYQA 7ICQA 4HTUA 5FRMA 2DTUA 4R8UB 1XO1A 3C2MA 1NJXA 3AVKA 3RRGA 4CGIA 3KLIA 3OYFA 2NRZA 3ZSWA 3KLFA 2AU0A 3HP6A 9ICBA 2O4GA 3MAQA 3TQ1A 1X9WA 1IKVA 4R65A 1C0UA 3KK2A 2E4LA 5K14A 4CFAA 5KFJA 3DM2A 3RJGA 2JEJA 4I2QA 1TV6A 4DF8A 4FJNA 3Q8RB 2G8HA 4NYFA 4KV8A 1RZTA 3O3FA 4DTNA 4OJRA 4N76A 4YD2A 3V81A 1U04A 4O3QA 1IG9A 3RMBA 3BQ0A 4KB1A 4YD1A 1YTUA 1TV9A 4IRDA 3SQ2A 3ZDEA 5HP4A 3M9OB 3T19A 5DBCA 1R0AA 2FBTA 3L3UA 4O44A 3ZSYA 4CJVA 2BCVA 5JS1A 3QEXA 3EW9A 2FPMA 2OZSA 9ICTA 4DS4A 4W5RA 5KFWA 2ISPA 3M8PA 2XC9A 3HXMA 4F92B 3JPNA 3RJEA 3M8SA 3VQBA 2P5OA 4AILC 4F2RA 3KK1A 2AJQA 4DSKA 2BQUA 1H38A 3Q8QB 3SCXA 4KKOA 4LZGA 1ZQBA 1PZNA 4FCYA 4CEOA 3N4MB 1GOBA 5KFVA 3L2VA 2MUTA 3MXJA 3H7IA 3LDAA 4BXOA 4DTPA 4ED1A 4KPYA 2ALZA 3SUPA 3V6DA 4KN4A 4ICLA 3ZT1A 3G6VA 4NYNA 1KTQA 4OKJA 3RWUA 2B4JA 4I2BA 4FXDA 2A1JA 4HVJA 3QNOA 3H8SA 4DS5A 3Q8LA 5KG5A 2AGQA 4B9UA 3RB0A 3D0PA 4KLFA 5CJ7A 4K4HA 2P6RA 1XHXA 3P5JA 1QLNA 1FXXA 1ZBHA 4R64A 3F9KA 4MQ3A 3V9WA 4DMNA 1ZQIA 3CM6A 1HNVA 3PUFA 2W9CB 4RQ6A 3F73A 2XY8A 1ZBFA 2NRVA 5DB6A 4MEXA 3O4NA 4RQ3A 1W0HA 8ICJA 4B3OA 4MFAA 4RW9A 1WCLA 2PFPA 4IBNA 2VA8A 4WE1A 3LAKA 3FYHA 1S6QA 1ZQUA 1S0NA 3UXPA 3OYGA 4KI4A 3ZD8A 3HSTB 2BQ3A 4RNMA 5KT3A 2FLNA 3TARA 3OS2A 3PVXA 4CJUA 5J0XA 5KFQA 2PFOA 2FLLA 4YR0A 3OYHA 5IIIA 4DTOA 2XY7A 3LZJA 2FPLA 1EKEA 2IC3A 4UAYA 3PMNA 4CFDA 4Q8FA 4YNQA 1IH7A 2VANA 2BKEA 1HYSA 1VK0A 4I2CA 4RW4A 2GV9A 5J0UA 4Y1CA 2FMQA 5HBMA 1SL2A 4M3ZA 4IRCA 4FW1A 4MFCA 2VWKA 4IQWA 1TAUA 3OYEA 3L2WA 1JLEA 5CB1A 2E6MA 3B0XA 3HM9A 4QZIA 4LSLA 3HP9A 5CYQA 4Z4FA 4KTQA 4LH5A 1S0MA 1TK5A 4M04A 4Z6DA 3D45A 5KGWA 3RJKA 3NHGA 2A1SA 3GIJA 1NJZA 3LK9A 2MUTB 2JLEA 4AHTA 3V9XA 2ISOA 3PR4A 3C2KA 5EWEA 4PY5A 4QZHA 1ZQXA 3MDCA 3QEIA 4RW8A 1BISA 4FLWA 1CLQA 4FM0A 3AA5X 4F5OA 2PZSA 5KG4A 2AGPA 3NAEA 3CG7A 3WNEA 3ZSXA 2G8IA 4DTXA 4HHTA 1HMVA 3PY8A 4KMUA 2C2EA 1HRHA 4KHNA 3QEAZ 2FMPA 4K8ZA 4ELUA 1D8YA 1ZBLA 3IHQB 3HX0A 2BGWA 4IFYA 2VA3A 3V1RA 4C8NA 2ZUCA 1QSLA 4BDZA 4FJGA 1KVAA 2RPIA 1QS4A 1V9PA 2ZTCA 4R5PA 4UB4A 1REVA 1S0OA 4PWDA 4Q0BA 4YMMA 3WNFA 3TABA 2NRXA 5CHGA 2QKKA 1LAVA 3DLHA 1D8LA 5IIJA 4YFUA 3TR8A 4CHQA 5HHIA 1BQNA 3S3OA 2ATLA 1X1PA 3QEBZ 2ZTDA 1EXQA 1RNHA 3BJYA 4R63A 3RBEA 2OYQA 1IXRA 3OYIA 4DQRA 1B22A 3RBDA 3FDSA 3U3GA 4F4YA 9ICMA 1T4GA 3VQEA 1CXUA 4C8KA 4KLTA 1NKEA 4DL2A 5KFDA 3HPGA 4F91B 8ICWA 5DQIA 1LB2B 2KTQA 3V6HA 3OSPA 1CZBA 4B8CA 2X74A 5IINA 4CIGA 2KFNA 4GXIA 4EBDA 1BCOA 4FLZA 1N6QA 4M9LA 4QZDA 1T05A 9ICUA 1HJRA 4QWCA 2C2RA 5KFEA 3GIIA 3Q8SB 1A5VA 1RTIA 8ICAA 4FK0A 1K1QA 4CEAA 1KEJA 4MF2A 4KLLA 3AO2A 4PHEA 1Z00B 5HRSA 3RAQA 5DLFA 2G8KA 4KN7A 4KTWA 4W5OA 4M6WB 5CZ2A 3OVNA 4CF2A 2ZJ5A 1NK4A 1RTDA 4QW9A 4QZEA 1JLCA 5DQGA 3AV9A 4KLMA 4DL7A 3T5JA 3RH4A 4H4OA 1SKRA 1RT1A 5KI6A 4FJMA 4PHAA 4LVSA 3HK2A 7ICPA 3M9NB 4XQ8A 3AVGA 4QWAA 2B5JA 4UAWA 3GFKB 4CGGA 3RB6A 1DOQA 1IKXA 1RDAA 1B43A 4UQGA 3DRRA 3EPIA 4GXJA 4F5QA 3CYMA 4YG2A 3KHRA 1N56A 4KLUA 4J9OA 1U45A 1ZQCA 4F4KA 3RH6A 4FM1A 3DRSA 4FLYA 2XO7A 3L3VA 4I2HA 3VQ9A 4FJ5A 4B9NA 3DOKA 2P51A 4G3IA 1S1TA 4F5RA 4B9VA 1T03A 2NRWA 3ORYA 9ICKA 1RBSA 4J2DA 2I5JA 2ZJ8A 1WSHA 4QZ9A 4CF1A 3NH0A 1QQCA 3RJHA 4DLEA 1JLQA 3O4QA 3NDKA 2YNFA 4UB5A 1RXWA 4I29A 4M45A 3KIOA 3OSNA 3PW4A 3ZT4A 4J9SA 3CFRA 3JYTA 4CGJA 3RR7A 4XRHA 8ICUA 3AVJA 3OGUA 3EY1A 1KFDA 3B6OA 2PYLA 2QKBA 4DU4A 2HHUA 2WTFA 2ASDA 1ZQGA 3AVCA 2BANA 4IR1A 3AU6A 3PX6A 2XGQA 3MR5A 1C1CA 2BCUA 2KZ3A 4EEYA 3QESA 5DDYA 2Y1JA 3JPRA 4J9LA 1JLGA 4NCGA 5L1JA 3TAGA 4DSJA 1BPXA 3L2RA 3V1QA 1NOYA 8ICFA 3QEPA 3OHAA 2HHSA 3HPHA 3VQ8A 5IIOA 4DL5A 1BQMA 5J2CA 5D4BA 2HNDA 5DKWA 5DGAA 4CFBA 5D49A 4FYDA 5KFNA 8ICPA 3VQ5A 4UBBA 3V1OA 1HQEA 1UA0A 3RB4A 7ICRA 1EETA 5DG8A 1MQ2A 3HW8A 2BPCA 4RT2A 9ICPA 4Z4HA 4MF8A 2DFEA 4LSNA 3WNGA 1S9EA 5EWGA 2C2DA 1KFTA 3SUQA 4OPKA 2HHWA 4KLIA 3LP0A 1Q8IA 4L8RB 1S1XA 3B6PA 3B0YA 4XA5A 4E7HA 3MR6A 4O3SA 3TFSA 3K58A 4KAZA 3OS1A 1WSJA 4Q45A 4I2IA 5SWMA 4DQIA 5C24A 4ECSA 4HUGA 2BPFA 2IA6A 4FVMA 9ICSA 4UB3A 4PHPA 5CR0A 4RUCA 4FS1A 4DFPA 4Z4CA 1RT5A 4IQUA 1JLFA 1ZQZA 2XY6A 5CWRA 4KLOA 4NCBA 4DSLA 3I0RA 4UAZA 4YXMA 4YQWA 4DSIA 4NM2A 4P4MA 3ZDCA 4M42A 2IGIA 3GV5B 3VQ6A 3A2FA 4CFCA 3KK3A 1HPZA 4CJQA 2PY5A 5J0RA 2HHXA 1FKOA 3VQ4A 1RT6A 3MABA 5DQHA 3C95A 4O3PA 4K4IA 1GOCA 3E01A 2ZTEA 5D46A 5KG0A 4ECQA 4J9MA 1VSIA 4MFBA 4CJLA 3ZT3A 3K2PA 8ICLA 5KFHA 1IM4A 3AVIA 3MFIA 1Q9XA 4M3WA 1QSYA 2IAJA 1WAJA 3HO1A 4QZAA 1SZPA 3TANA 3MEEA 5EWFA 4RPZA 2VG5A 3K59A 4RPYA 2P66A 2VG7A 4K4GA 1W9HA 2V4QA 4CEBA 2FLPA 3OYKA 2W9AA 3SYZA 3G6XA 1ZQTA 1G15A 3M8RA 1K1SA 4DQQA 2WONA 3AVLA 4X5VA 3G0ZA 4QWBA 1NOMA 1BVSA 4JWMA 9ICAA 3OYNA 3QZ7A 4FLXA 4QCLA 1YTAA 2D0CA 4M3TA 4FLTA 4O3OA 1KFSA 5J2KA 4F3TA 2IMWP 5CZ1A 2B21A 4CK2A 4YMOA 4UB2A 2QK9A 1S6PA 2PFNA 8ICXA 3T3FA 3DLRA 3KKSA 3AA3A 5DK5A 4FJ7A 4F4ZA 4OKKA 4AHSA 4KI6A 5J0QA 4JWNA 4O5KA 2BE2A 5J0PA 4KB0A 4FZXC 5KFBA 3LWMA 5HROA 3V9ZA 4RUAA 4ED7A 2W42A 1L5UA 2W8KA 4E3SA 3T5KA 4O5BA 1D5AA 3L8BA 2G8WA 5J2JA 4EZ9A 8ICYA 4Z4GA 3K4GA 4AHCA 3V6KA 4O3NA 1F21A 9ICQA 4RQ4A 2JEGA 4B9MA 3QEWA 4ELTA 3Q8MA 3ISCA 1U48A 4H8KA 4CJPA 3V9UA 3GILA 1WLJA 4C8LA 3PX0A 3MDAA 3UIQA 9ICRA 4ED2A 1BPDA 2IOCA 1RTJA 2V4RA 5CYMA 5BOLA 4TQSA 1ZQOA 3MBYA 3MFHA 4RG8A 3C6UA 3ZSRA 4JRQA 2BR0A 1TAQA 1Z25A 4E7LA 9ICEA 3NBPA 5J0SA 3C1ZA 3K5OA 1RYSA 4O55A 5HMLA 3T1AA 3JSMA 4TUQA 1Y88A 1Z3EB 2BQRA 1ZQJA 4YXJA 1C0MA 2HB5A 1LWCA 1S97A 3CM5A 5KFKA 4ECRA 3UQ0A 4J2BA 2NUBA 3ZCMA 4NXZA 1J9AA 3MGIA 4E1NA 7ICOA 1TKDA 4DTRA 1JKHA 2Q3SA 4Q44A 1Z26A 1KDHA 2J6UA 2HHTA 4ZH4A 1CUKA 2G8FA 5KFRA 4XIUA 5KFTA 3DMJA 4DWIA 3ZSVA 1ZQPA 1S76D 4FLVA 3GV7B 5CY4A 4CJFA 1ZQHA 4RW7A 8ICRA 3KD5E 3QE9Y 1HJPA 3NE6A 2NRTA 4CHPA 2FBXA 5KRTA 4CHYA 3K75D 2PFQA 4F93B 1RCHA 4DF4A 9ICJA 1JXEA 4FJJA 4CGFA 1NOZA 4C8OA 1LW2A 2H5XA 1IKWA 2I9GA 4BXOB 5EOZA 3SQ1A 4CF8A 2XRIA 4ED3A 4OVLA 3GV8B 3ZSOA 4ECTA 4ZTJA 1BPZA 1ASVA 2UVUA 1ZQFA 2KW4A 2A1JB 4M3UA 8ICMA 5J2EA 1MQ3A 1BPBA 3IRXA 5D3GA 4FZZA 5C5JA 4NLKA 4YMNA 3FFIA 4BWMA 1VSFA 5KFXA 1AROP 3BQ2A 4I2EA 2ETJA 2ZJAA 1XI1A 5KG7A 3V6JA 7ICIA 3SPZA 5KT2A 4I28A 1RDCA 3H4BA 2PXIA 4FW2A 1ZQWA 3C1YA 4NLNA 3QNNA 3V7KA 3RR8A 3NGYA 2ATQA 1BPEA 2KZZA 3OHBA 2IS3A 3NH2A 4IQVA 2FPKA 5J2DA 5L1LA 3SV4A 5J2FA 2G8UA 2KQ2A 3ALYA 1BIUA 4M3RA 1RT3A 5KFUA 3AVNA 4F4WA 1NK5A 4DU1A 5J29A 3IG1A 1TL3A 5F9NA 1S1WA 1ZQRA 1JL1A 3H8JA 5KFFA 1CXQA 3V7LA 2DPIA 4IG0A 4BDYA 5KTQA 5DGBA 5DG7A 1NKBA 4KLSA 4JUZA 1I3AA 4KTZA 1XSNA 2OPRA 3MECA 3VQDA 5KFYA 7ICEA 4DL3A 4BE2A 2Y1IA 1VSJA 3ZDAA 2UVRA 2ZE2A 3SV3A 3ISBA 2DFLA 5KG6A 9ICCA 2F96A 4Y1DA 3NGDA 2BGGA 1YVUA 1TKTA 3O3GA 3H4DA 4QZCA 1ZQMA 4ECWA 1HQUA 4YR3A 1NK0A 2V9WA 2RKIA 4KLDA 4IFVA 3HT3A 4DFKA 3EPGA 4LH4A 3RTVA 5KT5A 7ICSA 4E7IA 2P1JA 4BDPA 1VSHA 4CHOA 4CESA 1RTHA 4M2YA 5E41A 4KLEA 2R8GA 2DFHA 5DBAA 3HL8A 4FJLA 1JLAA 1FK9A 3OYAA 1Q9YA 3C5FA 7ICFA 4I2PA 3T5HA 2FBYA 4EP5A 4M9HA 1ZJMA 4IKFA 7ICJA 4QOZB 2HVHA 4DG1A 4QZGA 5KFLA 4F5PA 3QZ8A 4ECYA 4GLXA 1UWBA 8ICNA 2YNHA 3WNHA 5HRPA 3KHLA 2OA8A 4NLGA 2ZD1A 5KFIA 5DB8A 3ZDDA 3NF6A 4QZFA 1CEZA 1LV5A 4O3RA 4F4XA 3ITHA 4IR9A 2BCSA 4MFFA 4B9TA 2J6SA 1IO2A 2I1QA 3U3YA 2W8LA 4BWJA 3IM1A 3UXOA 3BDPA 2DFFA 4N47A 5DDMA 3DLBA 4YP3A 3E2EA 4J2AA 1K6YA 4AHVA 4FS2A 4YR2A 3PMLA 2FBVA 1TKXA 1SKWA 1ITGA 4M9GA 2QXFA 4LZDA 3ETLA 3GDXA 1RXVA 5J0WA 3NTUA 7ICMA 2PYJA 2IDOA 4FZYA 5KG1A 4G1QA 3THVA 3OYBA 1JLBA 3TAEA 1LAWA 3ZSZA 4N41A 1GOAA 1ZETA 2R8KA 1XSLA 5KFCA 4W5QA 3JPPA 3GQCA 3SI8A 4I2GA 2XHBA 3RAXA 4KHQA 4R8UA 2E6LA 2P5GA 4CK3A 4ZTFA 5J1EA 4FJIA 3S3MA 3OYLA 1NK8A 3V4IA 8ICBA 1WSFA 1WSIA 1WCNA 1SUQA 3L2QA 3AO4A 1RBRA 2VG6A 1BIZA 4MEYA 4FJ9A 4M41A 9ICLA 1C0TA 4RNNA 4PPXA 5L1KA 4B8AB 2YNIA 3HYFA 1COOA 4IQTA 9ICXA 9ICOA 3VA0A 3DRPA 8ICQA 1X9MA 1O1WA 3NF7A 2ZQBA 3RJFA 4HYKA 4N5SA 4HUEA 4AH9A 3ASMA 5HRNA 2AQ0A 1S5JA 4W5NA 1DTQA 3KHGA 1S0VA 4B9LA 3CFPA 1JN3A 3QETA 3QINA 1LWFA 3LAMA 4DOAA 1S9GA 1RBUA 4DTSA 4M9JA 4B08A 2JZBA 1B9DA 3KTQA 1LW0A 3VQCA 4E89A 1XU4A 5J2IA 2XGPA 4F3OA 2F8TA 3G10A 1S10A 2W9MA 1S1UA 4Z4EA 8ICKA 2XCPA 1EX4A 5KFZA 1JL2A 1XS9D 3NF8A 4YN4A 2AGOA 4GW6A 3TAPA 2EX3A 3PW5A 4E19A 4M47A 1ZBIA 2ASJA 4JS5A 1NJYA 5TZVA 4CEFA 3HWTA 3TFRA 1YT3A 5CA7A 3VQ7A 3VQQA 1KRPA 4CK1A 4I9QA 3NFAA 1FKPA 2KZMA 1VRUA 4RQ8A 3KKRA 4YCXA 7ICGA 3AO3A 4JLHA 4RQ1A 2WOMA 3MXIA 4HCBA 2RF2A 4Z6FA 3QIPA 5J2GA 1JXLA 8ICSA 2BCQA 1L3SA 7ICHA 4AHRA 5DB9A 4QZ8A 2IHNA 3DOLA 1KLNA 4CHZA 3EZ5A 9ICHA 2W9CA 4E0DA 4FM2A 2JEIA 5JUMA 4CEEA 2OPSA 5IIKA 2F1HA 4BGDA 3EYZA 3GIMA 4J2EA 2Z1IA 4CE9A 2YHBA 4CEDA 4JS4A 2Q0ZX 4CIEA 1RILA 1T3NA 8ICOA 3OY9A 4LY7A 3PO5A 1TK0A 2HVIA 3P83D 3HVRA 7ICNA 4PGXA 4DO9A 3JPOA 2DPJA 3DYAA 8ICVA 2B6AA 4DFMA 1RPLA 3VQAA 4QAGA 2RN2A 1JXBA 4I9LA 3C23A 3OYMA 5J2PA 3C94A 2FC0A 3QIOA 3OYJA 4CJ3A 5KGXA 2KFZA 3OJSA 3AVHA 1UT5A 2HHVA 4JV1A 1C6VA 5JS2A 5I3UA 1UT8A 5KFOA 3KD1E 4Z6EA 2W9BA 2JZBB 3RJJA 9ICGA 3DI6A 1L3TA 4J9KA 2HW3A 4CCHA 3ULDA 4OGEA 4CERA 1ZBUA 1ZQKA 7ICLA 1XC9A 3ISNC 4DLGA 4JRPA 3GIKA 5J2BA 1KVCA 1XWLA 4J9PA 3QO9A 4IRKA 4K8XA 3DLGA 3C21A 3NGIA 4PUOA 4FK2A 4FLUA 3K5MA 4CGHA 4QW8A 3I8DA 8ICGA 2HHQA 3ZT2A 4ZHRA 3CFOA 3QLHA 3RMCA 2GUIA 4FJXA 4KHYA 4TURA 1UOCA 5C25A 5DLGA 2PI5A 8ICCA 4RU9A 4N56A 4DTMA 2R8JA 4DQSA 2C22A 4GVMA 1JX4A 3AU2A 3Q8PB 3OYDA 2UVVA 1SL0A 3U6FA 4GC7A 4Z4IA 2HNZA 3NF9A 3LP2A 3LP1A 3VN5A 2F1JA 4M3YA 3C2LA 1BPYA 4CHNA 4OLAA 3SQ0A 3SZ2A 4O9MA 1ZQQA 3LANA 1WNSA 4EBCA 1HUZA 1ZQSA 3AO5A 4RQ2A 5BPCA 2G8VA 3PR5B 4TQRA 5KT6A 1BCMA 4UB1A 2M9NA 1B9FA 4DOCA 1TVRA 1WN7A 2FMSA 1L3UA 9ICVA 4O4GA 4CJWA 3KHHA 4Q8EA 2YV0X 4J9RA 8ICZA 3ZD9A 4DL4A 2GWSA 4H4MA 5C42A 4KO0A 4ECXA 5J2AA 1J5OA 4P2HA 1S77D 1DLOA 4FJKA 2W9BB 2P6UA 8ICIA 9ICNA 1ZQDA 4I2JA 4O0JA 2Z1JA 4CJEA 1S1VA 4Z0UA 4EZ6A 4BE1A 3ZDBA 3S3NA 4YFKA 3LZIA 4IG3A 2ASLA 1HYZA 3QERA 4M0AA 5DBBA 3AVAA 3H40A 3NGZA 5KFPA 4RNOA 5KFSA 4ECVA 1JMSA 4TSXA 3PO4A 4I27A 1RT2A 4B9SA 1BI4A 1Z00A 2LYHA 1VSKA 1VSLA 1U4BA 1A5XA 2ITGA 1HUOA 4M6WA 4I7FA 7ICUA 4F2SA 1SV5A 4FJHA 3M9MB 3OS0A 2MAXA 4KITB 3PX4A 3NCIA 1QHTA 3P1GA 4OKEA 4NM1A 2R8HA 2F8SA 2F1IA 2JGUA 4ELVA 4R66A 3LALA 1MSWD 3UQ2A 3UPQA 4FK4A 4DOBA 3PW2A 4F5NA 1S9FA 5EU7A 3IAYA 5FRNA 3V9SA 4P4PA 2D0BA 1MU2A 1I39A 5HRRA 5I42A 2HMIA 2OZMA 1X9SA 5KFGA 1BGXT 1TK8A 5J0OA 1RT4A 5HP1A 4JV0A 3LDSA 1N48A 1KVBA 4NCAA 3ISDA 1TKZA 1NK6A 1VSDA 3HPOA 4NLZA 1C1BA 4Q43A 1ZQLA 1WSEA 1U49A 2Z1GA 3RMDA 1ZQNA 4F50A 3KLEA 1T8EA 5FDLA 3DLEA 3AVMA 4RPXA 4JV2A 1J53A 4RW6A 4AHUA 4O0IA 2VA2A 3V7JA 1U47A 1A5WA 5KT4A 1RT7A 2OPPA 3SUNA 4KHSA 4DTJA 3SI6A 1ZJNA 1DGSA 2RDIA 1ZQVA 3NH1A 2ZUDA 2OWOA 3OYCA 1XHZA 1A76A 5F9LA 4KRFA 4DQPA 1DTTA 3OJUA 1LWEA 5DMRA 2YHAA 3C5GA 4Q5VA 3KLHA 1HNIA 4PHDA 3RMAA 1XSPA 4HCCA 9ICIA 5DG9A 4OGCA 4QWEA 5J0YA 2YKNA 4BACA 4RT3A 3LPTA 4PH5A 2R8IA 3K5NA 3BQTA 2C28A 3AUOA 3C6TA 3IS9A 1CZ9A 4RQ0A 4CF0A 3H08A 3MEDA 1WSGA 3HVTA 2RDJA 3LPUA 2BCRA 4QWDA 1RDBA 4ECZA 4CJ5A 1T7PA 1VSEA 4KHWA 1D9FA 1QE1A 1VRTA 5CP2A 1BI4B 4W5TA 1L3VA 3SPYA 3T5LA 1RBTA 4DSEA 4DL6A 2X78A 4YVZA 3MEGA 3TAMA 3RJIA 3VA3A 4DU3A 3SJJA 5KG2A 4KLQA 2DY4A 3ZSQA 3V72A 2ZUBA 1BHLA 2OPQA 1EP4A 5HLFA 4QZBA 2BPGA 4XUSA 5DB7A 4DSFA 5T7BA 4ED0A 4J9NA 5J2NA 2XCAA 2HNYA 3SNNA 4CJ4A 3TWHA 5J0TA 5HHHA 5FROA 5HNKA 3AA2A 8ICEA 3MR2A 4RQ7A 3LWLA 3UXNA 4I2AA 4I2FA 2YNGA 4KLHA 4OPJA 3SQ4A 3MXMA 3BGRA 9ICWA 4BE0A 1ASWA 4E1MA 5J2MA 4FBTA 4LD0A 4DFJA 3S9HA 5BOMA 5KFAA 1QTMA 4JK1A 3ZT0A 4ID1A 4ID5A 3SUOA 7ICKA 7ICTA 3K57A 5KFMA 3AVFA 4PQUA 1QSSA 2KN7A 3CQ8A 1KSPA 5L9XA 5KT7A 1UAXA 1TFRA 1SL1A 2XY5A 5J2QA 4CECA 3EWAA 4UBCA 3L2UA 2IBKA 4FJ8A 1WAFA 4IDKA 3TAFA 4PGQA 1J54A 5IILA 2LSNA 4KFBA 2A1RA 4HUFA 3H8WA 3KLGA 3MGHA 2VWJA 2AQ4A 1N5YA 1TVAA 2D0AA 3PNCA 2D5RA 3AA4A 3G6YA 5SZTA 2X6SA 3LP3A 4J9QA 3JPSA 5IIMA 5KRSA 1BL3A 7ICVA 3AVBA 4EYIB 4EBEA 1C1AA 1ZQAA 2PI4A 8ICHA 1NJWA 4M3XA 3AO1A 4CF9A 1X2IA 2X6NA 4CEQA 4E7KA 4RQ5A 1ASUA 3MR3A 4KLGA 4TUPA 3BQ1A 1C7YA 3HJFA 3N97B 3JPQA 1B92A 1RBVA 3KJVA 4DTUA 1Y97A 2GBZA 4CGDA 4GMJB
chains in the Genus database with same CATH superfamily
4NASA 4MLEA 3JPTA 4M9NA 4ECUA 1UWBB 4L76A 3EJMA 1MC8A 1M90T 2R7VA 1UA1A 1RHKB 3M2UA 2F4VJ 1ATSA 2J6TA 4Z6CA 3J7YP 4P4OA 4EK2A 4PYAA 2KM8B 1Q18A 4DHVA 4KREA 3PZPA 4EYHB 4ED6A 5L1IA 3BUZB 2V4JA 2NUUG 5KG3A 4LT6A 5KL1B 3PV8A 1HYVA 2IBOA 2JEFA 4OLBA 4C2MA 1HBMA 2YKMA 1JIHA 3PW7A 1XQSC 3MM7A 3OTEA 3ETOA 4XH4A 3U7JA 1NPRA 4I6WA 4CJTA 3RH5A 1TL1A 3OUYA 4PA1A 3CQXA 2O8BA 2I8EA 4IOCQ 2E29A 3BF3A 5AXLA 1ZYQA 4L3NA 5AQHA 2HBYB 3AVKA 2CA9A 2NRZA 2AU0A 4X4VA 9ICBA 1X6IA 5ITHA 2Y1LB 1YG0A 4FXWA 1MMNA 3TQ1A 5AICA 3PHEA 5AQTA 4R65A 4P74A 2JH7A 1C0TB 4ATNA 2RLTA 5K14A 1Y3JA 3PRVA 3FSIA 2E8PA 1TV6A 1AYEA 3Q24A 3SBTA 4FJNA 3R5JB 4CF4A 4X4PA 2MY7A 4C8YA 3O3FA 4GKKF 4K4UA 3R1HA 3OFFA 3UDCA 3VEZA 4OJRA 4YD2A 3V81A 1U04A 1IG9A 2QI2A 3ZDEA 5HP4A 3H42A 2VJUA 5DBCA 3FMWA 3A3NB 3KJVB 1R0AA 2FBTA 2MQMA 5AKKA 1S9GB 1RWMB 5BYRA 5JS1A 4PRFA 2BUPA 3JSRA 2FPMA 3OW2M 2QGFB 2CNNB 2F9JA 3LW5C 1H3DA 4W5RA 4DV2F 3TUJC 4P75A 1OY6A 3BQ7A 1HBNB 4IH6A 1C0FA 4F92B 3JPNA 2P5OA 3A8EA 2CVEA 4WP8A 1YITN 4KSEB 1JJ2M 1IKYB 4A2AA 2YXLA 2KG1A 1FEHA 2HZAA 4UY8T 1Z4UA 1NI3A 2RU9A 1GOBA 2QB0B 3CCUN 2OMOA 4IZ9A 4DTPA 1N33K 2A40A 1W7AA 4BR9A 3CCSN 5T41A 3W1YC 4R79A 3OFEA 2PO4A 4ZLLA 2G2YA 5ALGA 4P52A 2NUHA 5A0YA 4NYNA 3HOTA 2L9DA 2RP5A 5GIPA 3RWUA 1FKPB 4FPIA 5JRTA 3DFEA 1BWEA 1N36K 2LM4A 4HTJA 4P9SA 1RDWX 2F2AB 3Q8LA 2WOMB 3ATUA 2AGQA 3D66A 4NEZA 1KS2A 3TSPA 1MNEA 2CH6A 4KH0B 2DY9A 1HNXJ 4KLFA 3M8WA 4OI6A 3EKSA 5FJ4A 4E8UA 1ZBHA 4R64A 2H48B 2CFXA 3DOLB 4M5KA 3CM6A 4BUGA 2BE7D 4RQ6A 2E7XA 5F8GA 2XY8A 2NRVA 3O4NA 1FJGF 3THXA 3NWGA 5DO2A 1NJIT 3KG0A 3VETA 4NMXA 2ZZTA 2VA8A 4WE1A 3JQKA 1ZQUA 5C2GA 3GMGA 3BKTA 4RNMA 2FLNA 2MTLA 1R43A 3OS2A 4IO8A 2M9KA 2KRBA 2JL9A 3RBXA 4FZNA 2W4CA 2FPLA 5HQMA 2IC3A 3D2WA 4DUZF 3J81U 1IH7A 5M1OA 4YUDA 5AK3A 2R9LA 2XNQA 1MN7A 2PA8D 1U1PA 2DR6A 2BYCA 3L7UA 5J0UA 4Y1CA 4G1PA 2LKYA 3L2WA 3F2CA 3E51A 2PIIA 3SR6A 3HM9A 4FOEA 4QZIA 1U8SA 1U26A 4HHHA 2Z4PA 3IBPA 3OXGA 4M04A 1TK5A 5AI6A 4DR1J 3KOAA 2ES6A 5KGWA 3QUTA 3RJKA 1CJKB 4LRBA 2EDUA 1NJZA 3LK9A 3DV9A 3H7HB 4AHTA 1WBDA 3HTVA 3K9JA 4PY5A 4K50A 3MDCA 4WU3A 4RW8A 2O8CB 4FLWA 4FM0A 1ZAVA 3WNEA 2YQ3A 5C25B 2C2EA 1Y9OA 2KKHA 3IR5B 3TTDA 2DTJA 1MWMA 1EKSA 3QEAZ 1YJVA 3UCUP 4X2BA 4K8ZA 5H1SV 2ZHAA 1ZBLA 3BZCA 3HX0A 1M5HA 4IFYA 4BDZA 1BUPA 2B4PA 5AI8A 2HPUA 1RP5A 1QS4A 2ZTCA 4R5PA 3CJQA 4LIWA 3CDWA 3GSIA 4UB4A 1REVA 1HNVB 1KQSM 1TMJA 1TL4A 1Q82O 1YJNS 1RZMA 1XQIA 3EGVA 2ASMA 3CCQN 3L7OA 4RW9B 1LAVA 1F5BA 2VJVA 1PK3A 1D8LA 5IIJA 4YFUA 3TR8A 1BQNA 5AI0A 2ATLA 3FE1A 2ZJPQ 1EXQA 4KB7A 4I56A 1S8OA 2IM1A 4DV2K 4JD2B 3OYIA 2W6LA 1WYGA 1RA7A 1TVRB 3H1QA 3FDSA 2MHEA 3U3GA 1S7IA 2JVRA 3R2CJ 1CXUA 4X4SA 1ZBTA 8ICWA 5E2QA 1LB2B 2V6AA 5E7OB 3UMCA 1RUSA 4MJKA 3D9BA 4RW4B 2VPYB 4FLZA 1N6QA 3T1HK 2C3MA 4YN3B 4M9LA 3W9IA 4QZDA 2ZXIA 3ZTQA 1HNWK 4FWRA 1SJRA 2K4IA 4LFBJ 3VESA 1VQ4S 3IM9A 2V8GA 3Q8SB 4F9OA 8ICAA 4A57A 5CH7B 3WXIA 3C28A 2RILA 4FK0A 2V2ZA 3RF9A 4P0PA 2X3DA 1H98A 3NGKA 3CCVN 3AO2A 2KL8A 3AM9A 3RAQA 4K5RA 4F0KA 2YHXA 2WBRA 5EGYA 4I7FB 2OCEA 3OVNA 4CO1A 5U47A 2ZJ5A 1RTDA 3T5JA 5GTIU 2EFNA 3GP9A 1RT1A 2KOBA 1UZDA 3SJHA 5KI6A 4PZOA 1FJGK 3VAGA 3HK2A 1FJEB 1VQKS 3M9NB 4XQ8A 4QWAA 9RUBA 2OTJN 4NYOA 1IKXA 1T9UA 3DRRA 3EPIA 3L0QA 4MMOA 2MKHA 3KHYA 1RT4B 2IOHA 3CYMA 1N56A 3HHKA 1U45A 3MM5B 5LOQA 5EE1A 5AQLA 4OJOA 4FLYA 3L3VA 4B9NA 3FCHA 4OV1A 4M1KA 4F5RA 2AF6A 2R3VA 4WZQA 4LF4F 2NRWA 3EX7B 3MMAA 3ORYA 2DVIA 4J2DA 1HLWA 2ZJ8A 1WSHA 1PIEA 3H98A 4U95A 3VALA 3PEHA 3FLCO 1OH7A 5CAAA 1JQGA 5LSLA 3NDKA 2YNFA 4UB5A 3JS6A 3OSNA 2YWFA 1QVFM 1U0HB 2F4FA 3JAMO 2DGTA 1UVKA 3PCOB 1UWAA 1RAOA 4CGJA 5JTIA 5ALSA 1YVFA 3OGUA 3EY1A 3FRYA 1KFDA 1T44A 3HM8A 4DR7J 2QB1A 4DU4A 3MCMA 2HHUA 2ASDA 3G4SN 3MCOA 3ICLA 1Y5NB 3PX6A 1HNIB 3MR5A 2RS2A 4EEYA 2WB4A 1VJQA 3IDWA 5DDYA 2Y1JA 1SVDA 3R5AA 1MN9A 3D0IE 4A47A 3ENQA 2GGPA 5AM0A 3HHLB 4H4KA 2X1AA 4O23A 1K0TA 3V1QA 4GFJA 2YX1A 4C0OC 1NOYA 2XEXA 2HHSA 4K0KK 4WQ5C 5IIOA 1Q8KA 4NLCA 4HH0A 1WC5A 1WDTA 5D49A 4CZCA 3HSZA 1MW7A 2Y0SF 2RE1A 4FYDA 4ICAA 5AQOA 3V1OA 1XEZA 3VQSA 1SPBP 3T79A 5DG8A 3HW8A 2ZOGA 3FC9A 3MAAB 2WTUA 5BN9A 9ICPA 4RBVA 2GVDA 2YI1A 1EP4B 2IIHA 3CCLN 3J7AP 3CF5Q 1JCGA 5EVZA 1Y11A 2C2KB 2A41A 3MR6A 4O3SA 1RKJA 2HOQA 2YX6A 1ZD2P 4JBCA 3OS1A 2L9WA 1SH3A 3D1OA 4U7CA 2VCPA 2ADBA 4I2IA 1GX5A 3C6AA 4Y2IA 5SWMA 2EWHA 1GK8A 1NGAA 2MZTA 3NL0A 4MO5A 2BPFA 5A0LA 2IA6A 1QQ5A 1NNDA 2VASA 2Z2LA 1G2EA 4RUCA 4DFPA 1ZQZA 1FF2A 1V3RA 1OKJA 3ISND 4NCBA 1T03B 2OFHX 3OQ2A 5AQFA 4UAZA 4YXMA 1IQZA 2A0FB 5DDQC 2IGIA 2EVZA 3EDRB 3VQ6A 4CFCA 1OJ4A 5F8MA 1YZ7A 4NZ7A 5AKZA 5J0RA 2ZH7A 5AQIA 3C95A 4O3PA 2NZCA 3E01A 3HD2A 4ZIVA 5CZVA 1IXKA 3O1BA 4CLWA 4CJLA 3I6PA 3B82A 5KFHA 4EWTA 3P49B 4M3WA 1WAJA 2X51A 1SZPA 3OW2R 4ZMMA 3TANA 5M2UA 3OL7A 2BANB 4Q2LA 2P66A 5HMXA 4HKQA 1C1CB 2ZWOA 4CEBA 3C29A 3AAWB 2KHCA 2F65A 1Y5LB 1G3OA 4DV4K 2ZGYA 4Y2JA 4CVNE 1JLGB 2CJQA 9ATCB 2ASOA 2C3PA 2P9NA 3NVWA 1K1SA 4ZPBA 1TZ0A 2D6FC 3AVLA 3MK6A 3I28A 4A8SA 2FVQA 3IG5A 3RUBL 3G0ZA 1NOMA 1BQMB 4IO9L 1S59A 2ODGA 2Y0SC 3QZ7A 2BBEA 2ZIWA 1F9FA 1VQ7S 1HQEB 1FO4A 1ZRMA 1KQQA 1FRJA 4O3OA 5J2KA 1EETB 5K8OA 4WFNQ 2B21A 3D54A 2XULA 1NZAA 3KKSA 5K8MA 5DK5A 1S9EB 5AQKA 3CCSS 2VKQA 4OKKA 4AHSA 3LA0A 3C7NA 2K4HA 3I0SB 1N33J 3UKUB 4LF4K 3LWMA 5HROA 2H65B 3V9ZA 3SXLA 1KXPA 1RE1B 4Y2TA 2JFDA 2E44A 1N36J 2JV3A 5J2JA 1VQON 4PZVA 5BN8A 2U2FA 1YJ9S 1X66A 5AQYA 2AJFE 1BMQB 1S12A 3QEWA 4DCHA 4ELTA 3EVOA 2FVRA 3C46A 5FD1A 1IN0A 1WLJA 5A8WA 1RTJA 1NCLA 3FVYA 4A48A 3MFHA 4RG8A 3GL1A 2P9PB 1KD1T 2VGNA 2ITMA 3ZSRA 2WF5A 1OYEA 2BR0A 2EFVA 4YOUA 1TAQA 4WP9A 3A8YA 1R7IA 2CWXA 1TR0A 2DXDA 3MTJA 3JSMA 1J2MA 4MAKA 4TUQA 1SZ2A 2VFVA 2BQRA 4PG7A 1C0MA 2ABYA 3H59A 2JWKA 2VC1A 3TJAA 2G0AA 4HR2A 2Z2ZA 4ECRA 4I6YA 3UQ0A 3UDLA 2GIRA 3GJTB 4M95A 4MLHA 1BLUA 2DNYA 1WWHA 4A59A 1ZPWX 2YVSA 4DTRA 2HOFA 2E8MA 4F3MA 2QW9A 5HMYA 4UOGA 1KDHA 1X5TA 3D6RA 1NHUA 2J6UA 1FESA 4PCQA 3TNVA 2FZGB 1V4SA 5KFRA 1HBUB 2C1EB 2LQ5A 3DMJA 4F36A 3H3NO 4WK1A 1K47A 4GO5X 2QM1A 4US8A 3GV7B 5BRDA 4BRIA 1JJ4A 4U67L 3IG8A 3QE9Y 3KD5E 2MQOA 2ZBIA 2PFQA 4ZN1A 4JYAF 2QARA 3NLCA 3MUVP 2BE2B 1UETA 3B54A 1WORA 2XSFA 3NG8A 5BPLA 3KFWX 4Z7YA 4CTAB 4RTFD 4A2BA 4PL7A 3PACA 1LW2A 3ENWA 1KQSR 1VMBA 3GFZA 4I1TA 2DJWA 1FA0A 4CF8A 5ALKA 3VAKA 4ACOA 3GV8B 3G96A 4ZTJA 2RU3A 5HATA 1BPZA 1SXDA 2KH9A 1ASVA 2EZZA 1RJJA 4R25A 2RQCA 2O8FA 2CADA 4FZMA 1P8GA 2CZ4A 3SMPA 2HBRB 5D3GA 1BPBA 2D41A 4EMDA 3W63A 3CHWA 3FFIA 1WEYA 3CJ0A 5KFXA 1GT8A 1C20A 3QGHA 2GO8A 3O1WA 2ETJA 3SSSA 2ZJAA 1RWUA 2CQ0A 4JKGA 4NXNK 1TYQA 2DO4A 3H4BA 1WJ9A 1KQFB 4FW2A 5BR8K 3HRDD 3DOMB 2BOAA 3V7KA 3TTFA 1WD6A 3RR8A 1OPZA 1HD1A 4DV2J 4LFCF 4B3OB 2GVZB 2KZZA 4ZVOB 4JAXA 4FOIA 4RR5A 2ZH2A 3MC1A 3SV4A 5J2FA 1H7XA 3C15B 3CJ8A 2KQ2A 1LVHA 4M3RA 2EWSA 2UU9F 2V68A 1FDNA 3QSYB 3H8JA 1MROB 4IG0A 1KWMA 3JTPA 4JI5K 3PIPQ 3T1HJ 1UVIA 4R0JA 1HNWJ 4JUZA 3CQYA 4DCCA 1VDVA 3TR5A 2PFFB 4DL3A 4BE2A 1VQMN 1HYSB 1VSJA 4HDHA 2W1BA 2DFLA 5KG6A 3GLJA 3M4XA 1EWQA 4WF9Q 3G87A 1RGIA 5C12A 1DARA 1JLEB 4H0OA 4QZCA 1HQUA 4YR3A 1AFJA 4NLYA 1NK0A 4IFVA 4LSLB 5CYQB 1MA9B 3HT3A 3EPGA 3RTVA 5KT5A 7ICSA 4JKEA 5ALPA 4X62K 2OTJS 1FJGJ 4GVBB 3VEVA 1RTHA 5E41A 3QFPA 1D3WA 2R8GA 3HL8A 4N8OA 3OYAA 4FZLA 7ICFA 2XMJA 2FBYA 4EP5A 5HAOA 3GCXP 1KBUA 1IG6A 2QTDA 1KVKA 4IH7A 3CJRA 4DG1A 4EHTA 3UMGA 4GLXA 2DNRA 8ICNA 3PYDA 2OA8A 2HBQB 2J0QD 1QVFR 2G5IB 3PFOA 4BRDA 4CJ7A 4C3MA 2F7VA 2XVTA 3E8OA 3NOCA 4MFFA 3Q23A 1IO2A 3U3YA 3QATA 3R9KA 5HL7L 2WF9A 2KXHA 2ZOFA 5E3AA 4J2AA 3HVWA 3OXFA 3E9LA 1HI1A 2JXJA 5TISU 4AHVA 5ETMA 1IUJA 5LMUK 1ITGA 3TPQA 3TEGA 1KKXA 3BR9A 1YI2S 2DHXA 1YRXA 2HAFA 4UZBA 4NRUA 5F41A 2EZYA 2RJZA 4NL5A 3NTUA 3HFVA 7ICMA 3G4SS 5LSOA 1DGKN 1RT3B 1KQGB 4G1QA 2YY6A 3OYBA 4CLYA 4BRNA 1ZETA 1P8ZA 2QYGA 2DRBA 3Q86A 3NGTA 4X84A 1B99A 3BKFA 2PFUA 3DAWA 4KHQA 3OD2A 4M8LA 2FGOA 2P5GA 4LJMA 4K0KJ 4Y2VA 2OPRB 4USWA 2Z56B 1RWVB 3V4IA 8ICBA 1PO6A 1SUQA 4OYPA 3FR0A 3AO4A 1RBRA 3CDEA 1X4HA 1BIZA 4MEYA 3I4HX 3CO9A 2XMUA 4FJ9A 4BQLA 1FXDA 1T05B 4RNNA 4K41A 1TKTB 4K7QA 3VVTA 4OZJA 4M5GA 3RRKA 4IOAL 2HVDA 1IBKF 1OY9A 9ICXA 4BR5A 9ICOA 1UPHA 4NA1A 3Q89A 1X31C 1WEZA 3DRPA 3UR3C 2JDJA 8ICQA 1N4LA 3GU3A 1X9MA 3NF7A 2KJ8A 1HW9A 4N5SA 2E5SA 4BRCA 1HKBA 3MCAB 3EDQB 4AH9A 2CXEA 1JLAB 2F44A 1ZM3A 3J80Y 1S5JA 3QETA 4TY9A 3R97A 3LAMA 4FYVB 2O67A 4UT4A 3KJFB 4DTSA 2J9DA 4AT1B 2GJIA 4B08A 4LQ9A 3MM9A 4LFCK 2B5JB 2BEFA 3C65A 4DUTA 4ZP6A 4E89A 3M6WA 5AJ3F 5DM6Q 2JHDA 4DV6K 2VOOA 2WC9A 2XMVA 1NAQA 2HVEA 3WHIA 3G10A 2XCPA 2ZDOA 2VODA 2CGJA 1RACB 2L9NA 2ZEJA 2ZBQA 3OLAA 5ALTA 3EVWA 4XPCA 3OPKA 1RWNB 4JS5A 1B4SA 5TZVA 2AYGA 4CEFA 3TTCA 5AHXA 1YT3A 5CA7A 1NU4A 1LKZA 4TY8B 2N4CA 4FN5A 4I9QA 2Q31A 2KZMA 1VRUA 3HJVA 4YCXA 2FY1A 4XDCA 1PBAA 4X4TA 3Q83A 3NRWA 3AO3A 4JLHA 4RQ1A 2FHJD 4DV4J 8ICSA 1HW8A 3FAHA 2RMLA 1F3VA 1L3SA 1FNMA 2MMYA 1XMQJ 1GFWB 7ICHA 5DB9A 4QZ8A 1KLNA 3M32B 3T6BA 2B9EA 3LH2S 4FM2A 4ZCMA 1WUAA 4CEEA 2F1HA 4WU2A 3UD5A 3GIMA 4J2EA 4CE9A 4OYXA 2KXFA 2YHBA 3FBBA 4LY7A 3P83D 5D77A 3TU5A 7ICNA 1C4CA 1VFJA 1R31A 1U09A 3CETA 3DYAA 1H73A 4DFMA 3RW7A 1HI0P 2RN2A 2W43A 3D6FB 3I56S 4I9LA 4ERDA 1EARA 2FC0A 5FPNA 5GAGI 4LF4J 2WAQF 2AHOB 2BE9B 3OJSA 1I94K 2HHVA 4B1ZA 4K59A 2IFXA 2E2QA 4GVEA 2WW8A 1ECWA 3SFGA 5KFOA 1FW6A 1VQOS 2DNGA 4KYZA 2JZBB 4XAKA 2VOPA 2FUG9 3DI6A 4TYBA 1LW0B 4OPAA 3ULDA 3J81Y 4LF7F 3MUMP 1ZQKA 7ICLA 2QLXA 4A61A 4DLGA 4JRPA 3G9CA 1RADB 3AY0A 3J81j 2HFVA 4KHPK 3QO9A 4JI3F 4K8XA 3KLVA 1A6SA 5B7WA 4PUOA 2LA6A 1N61A 1N88A 5LSRA 2BV3A 1JK9B 4FK2A 2VUGA 3FQKA 3M7VA 3K5MA 3D2QA 1X5SA 2KB2A 2IJFA 4QW8A 4KX5A 1X4CA 8ICGA 2HHQA 5A2QU 4BG9A 3K7RA 1FKOB 3K9KA 5AQVA 1UOCA 2HRUA 3CERA 2PI5A 3ZEUB 4Z2XA 3KZIU 1BE4A 2R7TA 2RF2B 5F2RA 3DU6A 3VEWA 2VU5A 4GVMA 1D09B 1OQ3A 3AU2A 1RLDA 3Q8PB 3MEEB 3OYDA 1JNRB 2HNZA 3TSQA 2A19A 4BRQA 1DURA 3LP2A 1XNRK 4M7YA 3D3CJ 2F1JA 1ULRA 2RHKA 3N28A 2P9UA 2YKAA 4JI7F 1BPYA 2VDIA 2E7VA 4PQAA 3S7RA 2OHDA 2QLJB 2HK2A 3LANA 2W24A 2B6AB 4M7XA 2HK3A 3VQTA 5C2FA 4RQ2A 1RBLA 4PL1A 5AJ3K 4AM6A 1QY7A 1BCMA 3H5XA 2M9NA 2WAQC 1NGBA 4DOCA 1WN7A 3IBFB 1UFLA 4QIGA 3N6LA 1TFWA 2YV0X 4HT7A 3A0BU 4F02A 1OO0B 3U27A 3AJ1A 4H4MA 1IVZA 4KO0A 4ECXA 3KG4A 4UOFA 2DL0A 2BKOA 2LHTA 2CQPA 4FJKA 2XSJB 1VRQC 8ICIA 9ICNA 4ILJA 4U96A 1FRIA 5H9FK 1GLLO 3ZX2A 1R89A 2Z1JA 2DR9A 3SD7A 2YMLA 3TZWA 4JI6K 4AL5A 3AA8A 1JUDA 3CJCA 3BS9A 4JOUA 3QERA 5I9EB 4M0AA 1ZD4A 1XJWB 2CG4A 1YTYA 3H40A 2ZWHA 4KE5A 4RNOA 4NXNJ 1GEHA 3PO4A 2HHHF 4B9SA 5FLXU 1Z00A 2LYHA 1BI4A 3ZZYA 1A5XA 2MQQA 2DB1A 2ITGA 2JR5A 5BR8J 4M6WA 3BV8A 5A76A 2HQCA 4FJHA 1VK3A 2KVCA 3M9MB 5AI5A 2MAXA 3FFKB 1SQKA 3J7ZT 2LYBA 4OKEA 2F8SA 3H5SA 3NVYA 4FKXA 4R66A 1P7DA 3LALA 4URSA 1MSWD 5B0EA 1DBDA 1WUUA 4DOBA 1S9FA 3THWA 5EU7A 2LU1A 1W26A 3LGHA 5K5MA 2GH1A 5AQUA 1CC7A 5FRNA 5JJBA 3J7AN 1SV0A 3BS7A 5I42A 2OZMA 2ZZMA 3QUBA 3R5BA 1AZSB 2FXUA 1VLBA 2HBJA 4JV0A 4OYOA 1KVBA 1HR0F 2G06A 2HSEB 2LMIA 4JI5J 1TKZA 3MDFA 1ZM9A 4NLZA 3CJ5A 4Y2XA 1ZQLA 1WSEA 5IT9O 3CXCM 4JKDA 1JCFA 3SQIA 4F50A 1ZQNA 3US5A 3KLEA 4RCHA 3DLEA 2ZIXB 3AVMA 2UUBF 4WYLA 1VBKA 2ZBCA 2GX9A 4O0IA 2OANA 1XR6A 2A18A 4BC9A 1FD2A 1N34F 5A8RA 1OUQA 2OPPA 4LF7K 2HSZA 1QD1A 3SI6A 1PC5A 1LKYA 2YX8A 2ZHOA 3CD5A 1Q78A 4QIWF 2C3UA 3NGSA 4H5WA 1A76A 2CPZA 4RWTA 2AMCB 4KRFA 3VEXA 2CKWA 2R4FA 4A46A 2N1RA 3BF1A 4JI3K 4X62J 2AEMA 1C2PA 5B0CA 3C5GA 4Q5VA 3KLHA 3SSQA 2MY8A 3UN5A 1XSPA 4HCCA 9ICIA 3UDVA 4OGCA 1X3NA 3ET6A 4LRFA 2V2KA 2M3DA 1UPMB 3VF2A 1IR2A 3BBCA 4DV7J 1H2TZ 4P73A 5AE3A 3AUOA 3DXBA 1U6BA 2A6MA 2RHQB 3RVCA 1RHQB 3HVTA 5CZXA 3MWTA 2H3VA 2E1RA 4ECZA 2EFPA 3IMQJ 4CJ5A 1D9FA 4PXCA 2XLKA 3UNGC 3Q0AA 4DL6A 3G2XA 4YVZA 3MEGA 4WFBQ 4KLQA 1Q3UA 1BD6A 3WU2U 4QZBA 3SLCA 3L3CA 1HUXA 5LMUJ 1B7FA 5T7BA 4J9NA 2DHGA 3SNNA 4CJ4A 2CJKA 3KG1A 3TQEA 4F4AA 5HHHA 2R7RA 4GV3A 4K4XA 5EDWA 1RFQA 2JRSA 3MR2A 2EKNA 1YJWN 4I2AA 2A3ZA 2YNGA 2VKZG 3HVAA 2BABA 3F2DA 1IR1A 9ICWA 4BE0A 1CRXA 1MU2B 2HMIB 2KT3A 4FBTA 1KW4A 1RTZA 3QAEA 5BOMA 3CW2C 2ZUAA 2MA1A 3TW0A 2YB1A 3F5TA 2HF3A 3QT7A 1OH6A 3CD0A 2QSFA 1Y7PA 1OVQA 3ZT0A 3OBWA 4ID1A 5LJVA 4Y0WA 4ID5A 4CM2A 2O3DA 2D3ZA 3K57A 5KFMA 5KNIA 3CQ8A 1KBRA 3CSKA 2BH1A 2WB1F 2Y9UA 1CQMA 2XYGB 5B0GA 1KKHA 2B0GA 5C15A 2XY5A 4NJ8A 3EWAA 1J6ZA 5BREA 4CZKA 4IDKA 4RLEA 2E1MC 4PGQA 3CPWM 3H8WA 3NY0A 3MURP 1N60A 3OTOF 3ILIA 3LYSA 1OMSA 2D5RA 2OAUA 3AA4A 1F0XA 2X6SA 4J9QA 3JPSA 5IIMA 1SJ4P 5AQSA 3AVBA 4EBEA 4Z94A 3MR7A 2QT7A 1F9EB 1AUSL 3AO1A 1X2IA 2ZBPA 3BP8A 2GNKA 3MR3A 5ETRA 2VFSA 4DV6J 4K4ZA 4PXDA 1ATRA 3KJVA 4GMJB 3GFYA 3OBYA 2H4WB 9ICFA 3TAMB 2CJ9A 5HMMA 2OXOA 3VQPA 1IV0A 2R7SA 1X4AA 3TUZC 4C4WA 1Q82T 4RL1A 1KLMA 2Y0SD 1HR0K 1B7YB 3FRZA 3Q8KA 3SCKE 1ZQYA 2HNYB 3CJ7A 1V97A 4U7UK 1VQSA 3W0LA 4W90B 1IKYA 2UUBK 2MJUA 4DV0F 1D9DA 4L3QA 4CW7B 4DR2K 4DEZA 3HDSA 4UQTA 1L8LA 5ALRA 5E3QA 1A77A 5J2HA 3RRHA 1PG5B 3E58A 4DV1K 4JNEA 1NKCA 4EIAA 3R3LA 2DNZA 4CIFA 4CZMA 1QUPA 4FBUA 5I4MA 4ZKAA 2Z1HA 4WXWA 1RDDA 1OY8A 5ADXH 2K89A 3CP8A 3A5OC 2VQFF 3CD7A 5JVHL 4H0XB 2EH9A 2P35A 1FTRA 2RB7A 4H5TA 1DEJA 1DKGD 4KHUA 2WB1C 1SKSA 7ICQA 5FRMA 1WC1A 2H3EB 3BR8A 2DTUA 2BUNA 3GFXA 1NJXA 2HQFA 3G25A 3AD9C 4HTIA 2MZJA 3DHWC 3KLFA 2VBYA 1SQFA 4B6JA 2O4GA 3MAQA 1N5YB 3ZZZA 5GMKa 4DV5F 1C0UA 3KK2A 2LYAA 3EZUA 4CFAA 2EK1A 2YNIB 3RJGA 2MEWA 4JI8F 1I94J 3T9NA 3Q8RB 1R59O 4UASA 2G8HA 4NYFA 4KV8A 2DF4B 2M0GB 2MKIA 4NLVA 1Y4ZB 4CNQA 1Q86O 2XMKA 3S6EA 4AE5A 3CD6N 2IRXA 5D15A 4RX6A 2V67A 2DT9A 4IRDA 3FQLA 5LM7E 1O13A 5LJWA 1T11A 4RBTA 3M9OB 2H3IA 1VQ6N 2EFGA 4OYZA 4O44A 3L3UA 3ZSYA 5B8HA 4CJVA 2QLTA 1RAAB 4KHPJ 3R3TA 1KAYA 3QEXA 3AH6A 3QT6A 9ICTA 3MMCB 4RQNA 3M8PA 2XC9A 3HXMA 3OL9A 3RJEA 3D2EB 4K8RA 5ALHA 4AILC 2AJQA 2P9LB 1H38A 3ENBA 3ZTSA 2VD3A 2J8SA 2OD6A 4LZGA 1PZNA 2XB2D 1CJKA 5KFVA 1PJ5A 2D3O1 3MXJA 3Q8YA 1L7PA 4BXOA 4ED1A 4DI6A 4XTTA 3KKFA 3SUPA 1NGGA 4IXCA 4KN4A 2O8CA 2V69A 3IMXA 3ZT1A 4RPFA 1WC4A 4QNLA 1KTQA 4ETZA 2WF6A 2PC6A 4I2BA 3CJ9A 3E1YA 2MPUA 4HVJA 1XMOJ 3H8SA 2LP4A 1XNRJ 3ILJA 3OA9A 3QIPB 1UTAA 2UUAK 4NL9A 4HL9A 3RB0A 5CJ7A 1DQAA 4MYTA 4K4HA 2P6RA 3P5JA 5B0BA 3RGIA 1QLNA 1FXXA 4CD1A 2ZWPA 3N5FA 3F9KA 3V9WA 2KNJA 4M5DA 1HNVA 3PUFA 1NM1A 1K44A 1ZBFA 5DB6A 1W0HA 5AJ3J 2CRLA 8ICJA 3P45B 2JC1A 1WCLA 4RW9A 5EX3A 3G6ES 3UXPA 3OYGA 3HSTB 2G9OA 2BQ3A 2DKOB 4JD2A 3TARA 5J2PB 1NMDA 2BACA 4TU7A 4FWPA 2FC8A 3W5XA 4Y6IA 3PVXA 4CJUA 5KFQA 2DGUA 2FLLA 2XI3A 1EJ7L 5H9FJ 2ERRA 1N8RT 4BG8A 3WZ0A 3L4BC 5I3UB 2IJRA 3PMNA 4JI6J 2CVIA 4Q8FA 3O0FA 1HHQA 3D7EO 4DR3K 3LUYA 2YWWA 1Q8BA 5JLFA 2M8DB 3IA0A 4RW4A 3IXQA 4BJQA 5IFMA 3NUQA 2VV5A 2FMQA 1SC3B 1SL2A 4IRCA 3OTQA 4DR6F 2VWKA 4IQWA 3OYEA 3BSCA 3QFHA 5D4NA 2WUSA 3ETRA 2YWGA 2VQFK 2NNWA 1YJUA 1S0MA 3LVWA 1WKJA 4Z6DA 5H9EK 3D45A 3NHGA 1NO8A 2NCKL 1P9QC 3GIJA 1KN5A 2JLEA 3FEYB 1UHUA 2E8AA 3CXCR 4QZHA 1A0PA 2F63A 2J9CA 3QEIA 5I3QA 1BISA 4U8VA 4ICLB 1Z1BA 2DH8A 3ZXWA 4F5OA 3DDNA 2AGPA 1XIQA 4CI6A 4CRXA 3IKMA 4DTXA 1TMMA 3PY8A 2CQ2A 4RWXA 5IV3A 2XHWA 3OVSA 5IWAF 1BO5O 4DU7A 3I5BA 4IEIA 5T7LB 5AM4A 1V5VA 5LJ3Y 4ELUA 2CXYA 1Y0HA 2ASYA 2KD1A 3HSDA 2BGWA 4C8NA 4DX8H 4FJGA 1Q3VA 1KVAA 3ZETA 3MM5A 1V9PA 4NXMF 1LXJA 3ETMA 4DX6A 1WACA 3MF5A 2KV2A 3SCJE 2AZ3A 4M5LA 4LF7J 4BBYA 4JI0F 1FHTA 3D6HB 2QKKA 4CZIA 3OR1B 2LFVA 1HKGA 3M1VB 2SXLA 1OH5A 4IOCL 4KC5A 1VBYA 2FJAB 4CHQA 5HHIA 1QJHA 3H2UB 4JI3J 1X1PA 2MDAA 2ZTDA 2GIQA 2NSCA 2Q66A 1U0HA 2BVZA 1IXRA 3M30A 4DQRA 1K8KB 3EZWA 3K1RB 1B22A 2AP6A 2F4VF 1E4GT 2Z7JA 3NMUA 4KLTA 3LQVA 1NKEA 4KHMA 4DL2A 4L6V3 3OVBA 3HPGA 4QR1A 4WFAL 1G99A 4YDDB 4C11B 2DY1A 3WKCA 2X74A 2HBKA 3HHLA 3Q7BA 4FWKA 4LREA 1BCOA 3NVKA 4GRSA 2H3ZA 2BMBA 5HBMB 1LOUA 1HJRA 4QWCA 2C2RA 2I38A 1L3KA 3IN5A 2KT5A 2VPZB 2OEJA 4CEAA 5AM5A 1WG1A 3GJQB 4KLLA 4QS8A 4HWIA 4PHEA 2Y3YA 2G8KA 4KTWA 3V5RA 1XC3A 4QJFB 4YDXA 2YWEA 3WEEB 4DR5K 5CZ2A 4CF2A 2ZIUB 4AL7A 5DDRC 2HQDA 1VHXA 1NK4A 3CE8A 4QW9A 4QZEA 5F8HA 3AV9A 4PWWA 2HURA 2N3LA 1YDLA 1SKRA 2MQ8A 4A8OA 1RI7A 4OI2A 1NGJA 1HMVB 1KNZA 5ETVA 1K73O 4UAWA 3GFKB 1CS4A 1TUYA 3H1VX 4WFZA 1DOQA 4DL0C 4TU9A 4FO0A 1UFKA 3CPWR 3UDEA 3CJ4A 3KHRA 4UY85 4USKA 1NH8A 3NXZA 4HVZA 2YX4A 4ES1A 5HQ8A 3UB5A 3EXCX 4LVOP 2NLWA 3UKRB 4I2HA 3GOIA 3VQ9A 3DOKA 2GC8A 1TFYA 2UZAA 3M2VB 3BGUA 1T03A 1BU6O 2AEFA 2OGUA 4DUYK 4OHVA 3ILLA 1VQ5N 4PKDB 1NNLA 1XBWA 3NH0A 1QQCA 2MZ1A 4GIBA 4DLEA 4YY3K 3O4QA 3MHYA 2PGCA 4CO4A 1RT7B 2QSWA 4M45A 1EQYA 1X4BA 1FKAF 2CQBA 2QFJA 2K1RB 3F9MA 3EUB2 3NS7B 4XRHA 4OZ3A 2Q3PA 4M63A 3B6OA 1QAXA 2PYLA 5FIIA 3A5LC 3DEEA 1LWEB 1ZZNA 2BANA 2Y9HA 1VQNN 1C1CA 3AHPA 3A3OB 2KRRA 4FWOA 3AD7C 5A6WA 3GYXB 4NWIA 1GXTA 1JLGA 3L2RA 2V5HG 1VHFA 5ALQA 1JXVA 8ICFA 3OHAA 4F72A 3VQ8A 4DL5A 1BQMA 5J2CA 1G7CB 3MEDB 4CDGA 1RTIB 4A5BA 2HS3A 1HR0J 1NH7A 5KFNA 8ICPA 4UBBA 3F2KA 2DHAA 3ZFVA 1HQEA 4IOXA 3RSEA 1DZ5A 5FP0A 2FJVA 2VB6A 1EETA 4M5HA 4K4SA 4BR7A 2BPCA 3N01A 2V8HA 2UUBJ 2P9SA 4ILLA 3H8MA 4DFDA 4Z4HA 2BTFA 4NXMK 1SWVA 4MF8A 1JLCB 2BA9A 2BJ7A 4PWUA 4DR2J 1HNXF 1T6CA 2DFEA 3WNGA 5GAGU 4OJ5A 1S9EA 2OP5A 4H4OB 5EWGA 3LP0A 1S4EA 4DV1J 1Q8IA 1DJ0A 3B6PA 4E7HA 4FYYB 3TFSA 3K58A 1OSCA 4X4NA 2XZTB 4Q45A 5D4PA 1HLUA 1RA6A 4ECSA 1FRMA 2NZTA 2EK6A 2E1EA 4FVMA 1SH2A 4KGXB 4U9RA 1WBBA 2Q2RA 4NE9C 1RT5A 5KPTA 2VL1A 4ZJLA 5CWRA 4ED5A 3D2NA 2HBMA 2F76X 2UXBF 4QU6A 4RJVA 4YQWA 3EMTA 4NM2A 2WHOA 3ZDCA 1SCJB 5HVFA 3KK3A 1JLQB 2Z0GA 4BRKA 1FRHA 5GVQA 2DRDA 2R2RA 2GA7A 2CQIA 5DQHA 4MK9A 5A2QY 1W2BR 4FF2A 3BY5A 1GH8A 4ECQA 2N4DA 4J9MA 1VSIA 5ALOA 1VQPN 3ZT3A 8ICLA 3QU7A 3GCWP 4HI2A 4YOEA 4JP8A 4TLQA 1IJFB 4H54A 4FF4A 4YHHK 4QZAA 3NCQA 4RPZA 1VK8A 3K59A 5ALLA 4USMA 4K4GA 1VQ6S 1MMDA 1S4FA 5GAHI 3EICA 2W9AA 3G6XA 3M8RA 2WONA 2LEBA 4FF1A 3FEXB 2E1PA 4L72B 1BVSA 4JWMA 1YTAA 2D0CA 4M3TA 1HBUA 2QL9B 1KFSA 1F5SA 5CZ1A 2MQPA 2F5GA 3WQTA 4MT1A 3UN2A 1LNQA 2NO4A 3M2UB 2JLGA 3C19A 3KD3A 3CC2S 8ICXA 4LSNB 3MXHP 5IOLA 1J97A 3N5BA 1U2FA 1DRZA 4O5KA 4OYMA 3FSYA 2WZ1A 2BE2A 1TAMA 4H5RA 5J0PA 4CTAA 4FZXC 5CA5A 2V4JB 5FPDA 4ED7A 4J03A 1X6JA 3WK6A 1BXNA 2W42A 5SUHA 2HQIA 3T5KA 1A9NB 1PAUB 1KR4A 2G8WA 8ICYA 3M8YA 4AHCA 4Z4GA 2UUAJ 2G0IA 4CLFA 4P0QB 3N79A 3JSBA 2H9ZA 9ICQA 1TL1B 2EW9A 4RQ4A 2JEGA 1JLFB 4YDUA 2F77X 2CQ3A 1NUEA 1RCOB 1FO1A 1SIZA 3G82B 2O8BB 3ISCA 3SENA 4BROA 3JXOA 5FLXY 4C8ZA 4AXIA 3MDAA 4UB8U 3IFEA 2LEAA 9ICRA 4C4RA 3R1LA 4DPWA 2V4RA 3AL0B 4DBQA 5BOLA 4TQSA 2ZIVB 2W6KA 2B9WA 2AA4A 3ZX0A 4BR4A 2CPRA 2VFTA 4PPDA 1KL9A 3VTHA 1F5CA 3DOMA 4E7LA 9ICEA 3NBPA 4MFBB 5J0SA 3BSOA 4O55A 5HMLA 4C7ZA 3C0BA 5DM7L 3T1AA 4LFBF 3VAMA 3U8XA 2ROPA 3D28A 1Z3EB 2BJDA 5G5GA 1ZQJA 4YXJA 4OX6A 5K14B 3LOUA 1LWCA 2HB5A 2HIYA 2QA4G 3C15A 2E8NA 1Z1ZA 1LOTB 5IC4B 1O08A 4NXZA 1J9AA 3MGIA 4TVAB 3V81B 4DR3J 4CBXA 5G4DA 1MROA 4Q44A 2CJYB 1Z26A 3FZFA 4ZH4A 2B0CA 4K2XA 1ZC6A 2A10A 4E2FB 4EELA 3FCVA 2LLZA 3ZSVA 1S76D 2DHHA 1TUGB 1FD8A 2VQFJ 4QZVB 1S6PB 4USVA 3QFUA 2DRAA 5AM1A 1HJPA 3A8JA 5H9EJ 1CJUB 4YS2A 2FBXA 3L4IA 5KRTA 2KJ9A 3KUGA 3K75D 3G71N 2HKEA 2VF3A 3PTWA 2YWHA 4WKRA 2DNKA 5TKYA 4ZPAA 1DAXA 1PCAA 2UXBK 2LQ8A 2HRTA 1VQLS 4I6MB 1NOZA 4OX8A 1WWUA 2H5XA 1IKWA 3MZIA 1SJQA 5G0RA 1V4TA 6FDRA 5EOZA 2A2DA 2CAJA 3WC2A 3CF5L 3PHTA 3FZBA 4OVLA 7FD1A 2CUYA 3T7ZA 5A0YB 3K0JA 1XO0A 4M3UA 1MQ3A 5C5JA 6FD1A 3MGVA 4YMNA 2QA4N 4DR7F 3BQ2A 2HHPA 2V63A 3OHRA 2HS4A 3DHXA 3CI5A 2AIRB 2M4MA 5KG7A 7ICIA 3R5CA 3SPZA 2XZDB 4I28A 1RDCA 1S6UA 3D1HA 3HRGA 3F44A 4LR9A 2QA1A 2UUCF 1RLCL 3C1YA 3IC1A 3C66A 2HGLA 3GG1A 3DXMA 2OEMA 1UVJA 2EG1A 2ATQA 1BPEA 4WJ3B 4WE1B 5GAGP 2YQEA 2AXTU 2IS3A 3W3DA 5D0EA 3NH2A 5J2DA 5L1LA 2G8UA 3KMQA 1B64A 4HI1A 2L3MA 1RT3A 5KFUA 4DU1A 1KC8O 5J29A 1TL3A 5F0UA 3EGZA 2OTLN 3DU5A 2K7KA 1JL1A 2X1GA 1Q7YO 1JKHB 1L6NA 5DG7A 1M1KT 3WT0A 3N7RC 1WG4A 4U7UD 1KDNA 4OYIA 1I3AA 2QV6A 2HF4A 4BRAA 2LCWA 3DDHA 2OPRA 4NYPA 3CJTA 7ICEA 2PSZA 1YAGA 4OMFG 1SKUB 2UVRA 4RW7B 3ISBA 2BW2A 2FD2A 1C4AA 2DR7A 2F1FA 3T1YK 3CNQP 4Y1DA 3NGDA 4CO5A 3QMLA 1SC4B 2QIFA 1TKTA 4USUA 2LA4A 4DR5J 3O3GA 3H4DA 1U6ZA 5IQQA 4PHTX 4LC9B 2PBDA 3QWUA 1FX4A 1HWKA 5AQMA 3HI0A 2P1JA 3BGOP 3W2VA 2ZH3A 2QJ3A 4KT0C 4CESA 4M2YA 1REGX 1YIJN 4P2FA 3KKAC 1LK5A 2R7WA 1YJTA 4FJLA 1JLAA 4KIAA 3C5FA 2H3GX 5L1MA 4IEEA 3QBCA 3SBMA 1YVNA 4M9HA 1ZJMA 4IKFA 2Z2YB 2CYYA 4F5PA 3QZ8A 1UW9A 5HRPA 2RQKA 3KHLA 1Q0NA 3K17A 1R6VA 4J91A 4NLGA 2ZD1A 4IUFA 4QZFA 1QAYA 3UVJB 4UAVA 4F4XA 5THWA 2IYIA 4FSVA 4DUYJ 1GTEA 3MDQA 3AJDA 2I1QA 4BWJA 3UXOA 2FTRA 1PGZA 4N47A 2DFFA 3NS1A 5DDMA 1REVB 5E5NA 3E2EA 4YY3J 1K6YA 4FS2A 5K8PA 1TKXA 3LO3A 4M9GA 3DN9A 3UM9A 4LZDA 3ETLA 1TUUA 2LEPA 5CHIA 5DS7A 4CZJA 2IDOA 4IC9A 4QR2A 4FZYA 3ENHA 4JI4K 5AKEA 4ES2A 3QWPA 1JLBA 1T6DA 3TAEA 1LAWA 1S1WB 2VIHA 1TTHB 4W5QA 4DKWA 1TUWA 4USJC 4CLLA 4I2GA 2MLZA 2XHBA 3RAXA 4R8UA 2E6LA 1N33F 2CNLB 4NZ6A 3Q2TC 5J1EA 4FJIA 4UATA 2XS2A 2HS0A 3OYLA 3AOAA 2BRKA 1NU0A 3AQEA 5IT9Y 1WSIA 3ONNA 1YWXA 3L2QA 3EGWB 2VG6A 1HPMA 2BJ9A 3MMBA 9ICLA 2MQNA 5M1KA 1FFWB 1PBUA 4PPXA 3HYFA 1FRKA 1WF1A 2PKEA 2RKIB 1TP7A 2PAVA 1GNKA 3VA0A 4OX7A 2RRDA 1NSPA 1NJIO 5E26A 2NXNA 1S22A 2NRHA 2RVJA 2DR8A 3RJFA 2GLEA 1KQKA 2D69A 4HUEA 4USAA 3H8YA 4OJPA 5KQDA 1RDFA 2DCLA 1DTQA 3NGRA 2H3FA 2UUCK 3QBWA 5LJ5Y 4XH5A 4WQ5A 1JN3A 4DOAA 2LXFA 2JZBA 1RHUB 2YNHB 1LW0A 3VQCA 3O3LA 4YEAA 4NZ0A 4F3OA 2F8TA 3DRRB 3I55S 4KGKA 5K4LA 1S10A 2W9MA 2ADCA 3B4DA 3BKUA 2CZ9A 1UCVA 5KFZA 4P2SA 3DLLQ 2W25A 1JL2A 1XS9D 3B8AX 1OW5A 2KSOA 3WK8A 4DZ6A 4GW6A 2BJEA 1GMWA 3CWJA 4E19A 4BRHA 1ELOA 2ASJA 1NJYA 4FPRA 3TP2A 1SJ3P 3WC0A 1FFVA 3HWTA 3FBEA 5CQGA 4B3SF 4YHHJ 3TADC 2EG2A 4UW9A 2FSNA 1KRPA 2YNFB 3ZTRA 3W9HA 3TACB 4US9A 3ULEA 3ZEUA 2XQCA 3K8VA 4HCBA 3AJ2A 2RF2A 5ETLA 1JXLA 3S6JA 3NEKA 3EVMA 8ATCB 1Z6RA 4QIEA 1BUXA 3A5MC 1T9WA 3MMVA 4GVLA 4CHZA 2F8EX 2XI2A 1RKIA 3AEVA 1WSRA 2NXUA 4ZVGA 2W9CA 3A0IX 1COKA 1WF0A 1KHVA 5IIKA 4G1IA 3CJBA 3LM9A 5RUBA 3GPAA 2Z1IA 2MLXA 2BM0A 1GMUA 4BREA 5AZIB 1Q8LA 2HGNA 3OTBA 3R7NB 8ICOA 3D2FA 3FGUA 3OY9A 2J5AA 2VKRA 4CT8A 4FWQA 2CPXA 5GIOA 8ICVA 2B6AA 1RPLA 3VQAA 5JMVA 1JXBA 2FYXA 3OYMA 3C23A 2F9DA 3J80U 1PKUA 3OYJA 4CJ3A 2CQ1A 3H45C 1V3SA 3BM7A 2DR5A 1B0TA 4LF5J 4BVPA 3AVHA 1W25A 4JV1A 1C6VA 5JS2A 4CLUA 1LWFB 4Z6EA 4DZDA 2D4WA 4CYUB 4CDIA 2BKNA 2CQHA 1WOSA 2L08A 1SBRA 4BC3A 1L3TA 4J9KA 4KAIA 3CC7N 4OGEA 1ZBUA 1BY9A 1SXLA 4JKHA 2KKZA 2HQ3A 3GIKA 1FE4A 3MUTP 4J9PA 4ER8A 2FB0A 5HL7Q 4H5VA 3ZO7A 2FJDB 1UVLA 2W7PA 3CNHA 4L75A 4EEKA 5ALWA 3VGKA 3AXKA 4CGHA 2CPDA 5DETA 1VBXA 3T1HF 3CJKB 1HNWF 4ZHRA 1WC0A 4WXOA 3VEOA 4BGBA 2GUIA 4FJXA 4KHYA 5HMWA 4TURA 2W2MP 3E01B 1Q81O 3HSGA 4DTMA 3KDOA 3NVZA 3FCWA 4C6AA 2E5LK 4J9VA 2GZOA 1AZSA 1FNOA 3NOGA 5AQPA 1SL0A 3U6FA 4GC7A 3F41A 1R0BG 4FL9A 1WWVA 4RO0A 1FT8A 2ATCB 1SXEA 2KVIA 1N32K 3NASA 2V9KA 2OPSB 1WOQA 4M3YA 3C2LA 2ZIXA 3IRUA 4U8YA 4ZPCA 3KOOA 1QQ6A 2FHKA 5DJBA 3G71S 4IOAQ 4EBCA 1HUZA 4X4QA 3DGPB 1ZQSA 3AO5A 4B3MK 3PR5B 4TQRA 5K20B 4UB1A 2XS5A 3T69A 2UXBJ 4WP3A 9ICVA 2B56A 4YOTA 2DKZA 3KHHA 4MKBA 4PYDA 2PMHA 2GWSA 4LF9K 1PYOB 1E6YA 5K9FA 2W9BB 1ZQDA 2JH1A 4NLWA 1JCEA 5ETPA 4Z0UA 4EZ6A 4Z37A 2IMOA 3SMZA 2GTDA 4DMZA 4B3SK 4WK3A 1Z19A 3LZIA 1ACMB 1DK3A 1Z2ZA 3VERA 2ASLA 1HYZA 5DBBA 3AVAA 1IBCB 3NGZA 5KFSA 5JXSA 1H6KX 4ECVA 4I27A 3TJ8A 1VSKA 2I7NA 3SAHA 2D1KA 1SV0C 2F3NA 7ICUA 5A8WB 5DM6L 5AI9A 2X3GA 3EKUA 2FVSA 3OS0A 5LY3A 4KITB 3PX4A 1RTJB 3P1GA 2RRNA 2F1IA 1UAWA 2EZXA 2WSFC 4K0KF 5KAKA 2HEKA 1NHVA 1H72C 3UPQA 4IYQA 4WTOB 4ZP9A 4CGZA 3FKBA 1MU2A 2HMIA 3JSMB 2DWQA 5KFGA 1BGXT 5J0OA 2R2UA 2KHVA 4LFAK 1UZHA 1N48A 3POTB 2G2ZA 2UYTA 3ISDA 4IOBA 2A1BA 2KMDA 1YHQN 1SB6A 1SB3C 1VSDA 3GYGA 2X1FA 4Q43A 2CWKA 1PUZA 3O9UA 3RMDA 1ZXIA 1T8EA 2W7AA 4RPXA 4JB3A 1V38A 1BWVA 2W54A 4JV2A 1J53A 4DCPB 1SH0A 4AHUA 2CRXA 3V7JA 5DDPC 3T1YJ 1U47A 3E9PA 5J8YA 5KT4A 3QSIA 3SUNA 2VQEK 1R8HA 4NLSA 4MN4C 5F1XA 1ZJNA 1DGSA 1NBEB 3DMJB 3VAIA 2OFGX 3OYCA 4UTGA 5F9LA 1K8AT 4EX6A 4O4GB 1L7NA 1X7VA 1DTTA 1R27B 2ZC3A 3CMEN 5C42B 3TX0A 5DMRA 2K8AA 2FF3B 3O8WA 2QARB 2ZH1A 2OYYA 3CJSA 4YB5A 2ASPA 3I4PA 1NM2A 2RDDA 5J0YA 4BACA 4DPUA 3HULA 3A8IA 4PH5A 3W8PA 5HVHA 4AD6A 4M5NA 3K5NA 4O8UA 1WC3A 3IS9A 1JROA 1CZ9A 4RQ0A 4CF0A 5E84A 4K42A 4JK9A 3MCSA 1RDBA 1T7PA 4KHWA 5CRXA 5CP2A 1M1HA 3UNYA 1RT2B 5F3TA 2DEIA 3M6UA 4CD3A 2QWMA 1NZBA 1RBTA 1EQ0A 3TAMA 3CCRN 3L4PA 3RJIA 1XNQJ 3SJJA 2DBYA 2DY4A 1SV5B 2HFNA 5E33A 4LMZA 3ATVA 3ZSQA 4DV4F 3GU0A 4NLUA 4OJLA 1XTZA 1BHLA 4A8MP 1XMQF 4C7QA 2BM1A 5J2NA 1TYQB 2HNYA 2LECA 2NR0A 5FROA 3L9ZA 1CJVB 1CJTA 4CZHA 4RQ7A 2J0WA 3UD4P 4ISEA 4E98A 4OV6A 2IDLA 2ACMA 4ILHA 1N0VC 3BGRA 4JI4J 3CGIA 1HBOB 3SQOP 3QFWA 5J2MA 2N7YA 4MO4A 3DJCA 1RU2A 4DFJA 2D0PA 3A3PB 3BZKA 2XLIA 5M1NA 4JK1A 2CG8A 1WEXA 1S7HA 3B8HA 2UXDK 1AFIA 1KP6A 3SDEB 7ICKA 7ICTA 3LDQA 3OR2A 2V2QA 4AL6A 3CT9A 4IG0B 3ID6A 1X8DA 4EI2A 4RW6B 4NX9A 5L9XA 1D8ZA 5T14A 2HGMA 3SSRA 1TFRA 1I3OB 3HHNB 4CECA 2VH7A 4UBCA 1HEKA 5IT4A 2IBKA 1J54A 3CB4A 2ACYA 4C3LA 4LF8K 4HUFA 1N5SA 3KLGA 1N5YA 5ALUA 1FWLA 1CC8A 5AFUH 4DX7A 1IQTA 5D0GA 4OI4A 3G6YA 2WW4A 1S72S 1KD1O 1BL3A 4KHRA 2DIUA 4C98A 7ICVA 3QPIA 2BOPA 3PRDA 1HQUB 2V0NA 1K9MT 1ZQAA 2UUCJ 2PI4A 1FFGB 3TWZA 4JK8A 3LPEA 2FC9A 2YKNB 3FZHA 4CF9A 4Y2MA 2OSRA 2KIVA 1RTHB 4CEQA 4YB6A 5GAHU 2PEHA 3G8TA 1ASUA 3I9ZA 2GAHC 3JPQA 1B92A 1Y97A 2GBZA 3TA1A 3JQMA 2FDRA 3PIOQ 1NK9A 1BDGA 4DG1B 2BHNA 1TGOA 1WSVA 1VSMA 3HF5A 3MMCA 3M1FA 4DQ8A 4Y2UA 2IHMA 3KZXA 4PGYA 3D3BJ 4NY8A 2ZM6J 3MPDA 2NXCA 3D2EA 2JJ4D 5L9NA 4O5CA 1XR5A 1SJ1A 2V2VA 4MIBA 2R42A 3KYLA 4X4UA 3KDNA 1Q5VA 1VGYA 2IRUA 4KLJA 2PT0A 3HSJA 4GMKA 4UF4A 2E9TA 3BSNA 4CBUA 3O3HA 1NK7A 1BC6A 3VVUA 1T02A 3MCNA 2DUYA 4CJKA 2DCUB 1I6JA 1N62A 2XLJA 3WQPA 4CJRA 4CEZA 3K5LA 1FVSA 1IBLJ 4ZA1A 4F8RA 2ZH6A 2ZJRL 1JNZB 4TUSA 5DZ7A 2HVZA 2OEKA 2OELA 4C97A 2CNKB 4ZCKA 3J7Z5 2E66A 3ZYYX 4PQUB 5C0YA 2O4IA 3WX8A 4RZRA 2GIFA 4AQYJ 4HTUA 4WJBA 3C2MA 2QN6B 5J2QB 3OYFA 3ZSWA 1QAIA 2ZVSA 5AQZA 3HILA 1RAJA 2KDOA 1SUQB 1X9WA 1IKVA 1WF2A 3WK5A 2MKJA 2ROEA 2E4LA 3S8SA 4FNIA 5KFJA 1N5TA 2QMXA 4QR0A 2G09A 4I2QA 5CHCB 4ZDNA 2Z30B 2JZ5A 4PG6A 4NXNF 2NQPA 3C6HA 2QE5A 1IR0A 2KE7A 1IJJA 1R8BA 1JJ2R 4DTNA 3ENOA 1V3ZA 5BR8F 1XMQK 5G5HA 4N76A 3L3FX 3RMBA 3BQ0A 1SS6A 3W5YA 4LR8A 1GLFO 4CLPA 3SQ2A 5HK4A 3CO0P 3T19A 2JFKA 1F2GA 4PXEA 1X4EA 1FDAA 3H5UA 1YITS 2XMMA 2FJ6A 3CCWA 1J5EK 1DXSA 2HWTA 2J76E 1RQNA 3EW9A 3MM9B 3U26A 3PKYA 4IFEA 3KWMA 4DS4A 5D4OA 3WIUA 3CCUS 3GZ7A 3M6ZA 1UEUA 2UV8G 2ISPA 2J0XA 3NKYA 3M8SA 3DLKB 3VQBA 5D8HB 4CF3A 4DSKA 3Q8QB 4JI5F 3I9V9 2AH5A 4G6VB 1JMTA 2DGOA 3GTYX 3N4MB 5AKGA 2BJ1A 4K4YA 3F56A 1L7MA 3CUNA 5B66U 3LDAA 4NL9C 2GHWA 4L74A 2RAQA 3LVVA 3V6DA 1KAXA 3UD3P 1MG7A 3NMRA 4ICLA 2E5LJ 2QC3A 3MCPA 2B4JA 3BBFA 1VRUB 2A1JA 5JVGL 4B3RK 3I1YA 5KG5A 2PN6A 1N32J 1X4GA 3BN4A 5T7LA 4NA2A 4X62F 2MQLA 4CQ1A 3M8QB 2MZSA 2IY5B 3P38A 1XK8A 2YKQA 3KFUF 2C2MB 3WK7A 3U9ZA 4H0YB 3KLIB 1AXQA 5HOOA 4F25A 3H20A 3F73A 1BHNA 4DV7F 4B3MJ 1P27B 4MFAA 3HZ6A 2PFPA 2DNOA 1HD0A 2R7QA 3DM2B 4Y34A 3FYHA 3JAMU 4EFHA 1VJ5A 2IOFA 3I33A 3DYAB 3VAFA 4LF9J 3ULHA 1OQ6A 5KT3A 2I0XA 1NDCA 2KJVA 1K8KA 2LMRA 5J0XA 4DOZA 2PFOA 1R0CB 2AKWB 4AM7A 4YR0A 1HKAA 3D7SB 1X9XA 4RUBA 4DTOA 2XY7A 4WBFA 5LMUF 1R6YA 3SIPB 3LZJA 2KVQE 4FYXB 4B3SJ 4UAYA 1VCTA 4WCEQ 2E1AA 1X3MA 4C11A 2GCFA 1KVJA 2VANA 2HI0A 1FDBA 4QS7A 1NGEA 4I2CA 3OLBA 4LF1A 4PL8A 2VBXA 2QTWA 2CJXB 4C3KA 4ITSA 5HBMA 4FW1A 1WHXA 3K8WA 4HACB 5CB1A 2MSTA 5H1SQ 3KK1B 4L3KA 2DGVA 4RBUA 1MLAA 4KKOB 2JH3A 3HP9A 4Z4FA 4KTQA 4CLTA 4OLOA 4O8KA 3A0HU 3LDNA 2MUTB 3DWLA 4J8FA 2Q6BA 2F40A 2ZIUA 5BXIA 2ISOA 2V51B 4J37A 5EWEA 2UV8A 4IS7A 4A4JA 4KH4A 4B9QA 2B9YA 5KG4A 2I7PA 2JWLA 4ZP7A 2W7OA 3CG7A 4LFAJ 3ZSXA 2G8IA 1YHQS 2YMQA 1HMVA 3SAGA 5EX5A 2UUWA 2E1FA 2FJEB 1HRHA 3L5KA 2DNHA 2FE9A 3QU9A 3AARA