1NK4A

Guanine-guanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk4A01
3QIOA 2Z1HA 4AHUA 3CYMA 1Z00B 2BKEA 5KG5A 1NJWA 4BWMA 3TARA 3V4IA 4Z4CA 2RN2A 1WLJA 5DB9A 3PR5B 3TR8A 2ZUCA 4CIGA 3NDKA 4J9OA 3V81A 2O4GA 3MR6A 2AGQA 3GV5B 3RB3A 3AA3A 3SJJA 1XC9A 5SZTA 2A1JB 4CHZA 3QZ7A 1HPZA 2FBXA 5J0XA 5DDMA 3HYFA 1S9GA 3MFHA 3PW0A 4F91B 3MEDA 1AROP 7ICOA 9ICRA 2E6MA 3V1RA 1IKWA 3DLGA 2ZTDA 4PHPA 2YV0X 4OGCA 3MDCA 1ASWA 4CHNA 4RQ5A 5JUMA 4DMNA 4CJSA 1NOYA 4WE1A 5CZ1A 3K4GA 4F3OA 5KTQA 4ECXA 1TK8A 3BGRA 3ISCA 1REVA 3QEVA 1HQUA 3B6PA 2VG7A 3Q8MA 5J0WA 4B9NA 2P6UA 4W5OA 4M9NA 3RMDA 4QWEA 2G8HA 4FJXA 3TAFA 1VSEA 4CJPA 3GV7B 2H5XA 1ZQIA 3HP6A 4I2BA 3RJJA 2XY7A 1BL3A 5KFQA 3PUFA 2W9CB 3SV3A 4OLBA 4FJNA 1XO1A 1Z26A 2RDIA 4QZBA 2Q3SA 3OYEA 3M8QA 1ZQNA 4RT2A 1KLNA 4RU9A 1QQCA 2ZJAA 4LSNA 9ICIA 3OYIA 3RB6A 4RPXA 2FPKA 5KFNA 8ICLA 3RBDA 5DBAA 5KFFA 5J2KA 4PH5A 1S9FA 4RQ4A 2XCPA 4J2BA 8ICOA 1D8LA 2GV9A 4E7LA 4CFCA 4DTSA 1XSNA 4IFYA 4DO9A 1D5AA 2VG6A 2ZUDA 3AVMA 1ZQPA 2NRTA 4YR2A 3DLBA 4I29A 4KLGA 4IRCA 4EBCA 2BGWA 4NCAA 1LWEA 4BWJA 4ED2A 4IQUA 9ICPA 4N76A 7ICNA 4O3PA 1T3NA 4I2PA 1RT1A 1KFSA 2WOMA 3ORYA 1S9EA 3AVFA 2C22A 4IDKA 1W0HA 4JRPA 1ZQTA 1MQ2A 1TV9A 5KT7A 1YVUA 2P6RA 3PNCA 2B4JA 4DL5A 7ICGA 4E1MA 2IBKA 4TQRA 2IS3A 3O3GA 1C0UA 7ICKA 7ICMA 3SCXA 1ZQYA 4IKFA 4DOCA 4ID1A 1TAUA 3MGHA 1ASUA 4F4ZA 1X9MA 2D0AA 3RJKA 3G10A 4DLGA 4UB3A 4GXJA 1WSGA 5DDYA 2YNGA 3O4NA 3OGUA 1S0MA 1CUKA 4XQ8A 2PYJA 1ZJNA 4FJ5A 4CJEA 3OYHA 1SV5A 4I2JA 4G3IA 2DFEA 4CJ4A 8ICKA 4FJIA 8ICBA 4KPYA 1JIHA 3IRXA 1S0NA 4GMJB 4LH4A 4DQIA 4GLXA 1EXNA 3QEBZ 2G8UA 4FBUA 4J2AA 3I0SA 1TL1A 3S3NA 4M3YA 5TZVA 4QCLA 5J2HA 3UXNA 1NJYA 3SQ2A 3H08A 4HYKA 1VSKA 4FLWA 1ZQFA 1F21A 2ATQA 3TAMA 4XUSA 3HK2A 1CLQA 2ZTEA 4B3OA 1JLEA 5CYMA 1NOZA 3PMLA 3GFKB 3VQQA 3QINA 2C2DA 1QE1A 4RNNA 3PW7A 3UXPA 4DTOA 1MC8A 4KLDA 3RH4A 4AHRA 1GOCA 4N41A 1R0AA 8ICSA 3M9MB 3H4BA 3DM2A 1BPXA 4YP3A 4N56A 2EX3A 1COOA 4QZAA 4KHSA 2HHXA 4CJUA 1NK5A 3JPSA 5J2CA 1C0TA 2BQUA 4JS4A 4KREA 2PI4A 5KG2A 4R8UA 4DQQA 3NH1A 3V9SA 2ASLA 9ICCA 4QWDA 4JUZA 4AH9A 3N97B 5D4BA 3AVIA 1Q8IA 2BCQA 4DSIA 4CGIA 3EW9A 4RQ8A 3LWMA 1RT7A 4FM2A 1WCNA 3JPOA 3H4DA 4L8RB 2FBVA 2KQ2A 3OJSA 3HVTA 4B8CA 4FLXA 4KMUA 3DRRA 3V1OA 4PY5A 3G6VA 4KAZA 4PPXA 4DFKA 1VSIA 4F4WA 3E2EA 1NK8A 5HROA 1VSFA 4FJ7A 3DRSA 4KLUA 1RYRA 4PWDA 1RNHA 3NFAA 2JZBA 2PXIA 4B9TA 4CF1A 4FJGA 3NF6A 5J2QA 4JRQA 3V72A 2VA8A 3ZT4A 3K5LA 4CESA 3RMCA 2X6NA 4UB4A 3HW8A 4M3TA 2ISPA 2UVUA 2GWSA 2XY8A 3MBYA 4DFMA 4DFPA 1A5VA 3TQ1A 1RXVA 2FMSA 3V7KA 3ZSXA 1C0MA 2PFPA 3OS2A 5EU7A 5L9XA 3HWTA 4AHCA 4AHSA 4NYFA 5J2MA 2JEJA 4QZIA 2XC9A 1B43A 2AJQA 3O3HA 3RBEA 4OJRA 2ZJ8A 3BQ1A 4AHTA 3EPGA 4DL3A 1CXQA 4O4GA 4K4HA 2I5JA 1LWCA 2XGQA 4CGFA 5KG3A 3VN5A 3OY9A 4I27A 3PV8A 4FW1A 4JS5A 4TUSA 4F5PA 1O1WA 4NYNA 4W5TA 3V9ZA 1L3TA 1ZQXA 5J0RA 2YKNA 2WTFA 5IINA 4YVZA 1TVRA 4KO0A 4RT3A 4LZGA 4J9LA 4NLKA 2BQ3A 4I2EA 2VG5A 4GW6A 4F2SA 3LANA 1S1WA 1BCOA 3TAQA 7ICTA 5CWRA 4YXMA 2BHNA 3HP9A 3T5LA 3OYCA 4PGYA 5EWEA 4F5NA 2G8KA 2IGIA 5CHGA 1ZQQA 5J2NA 3L3UA 3C94A 4YD2A 5JS1A 3FFIA 4MEYA 5L1IA 4F4XA 4Z4GA 4HUGA 9ICAA 2XGPA 1KVAA 1U45A 4F4YA 3CFOA 3C1YA 4M3UA 5C24A 1X2IA 4NLZA 4E7KA 4I28A 5DBBA 2UVVA 9ICSA 1VSLA 1L3SA 5CY4A 1RDCA 4YN4A 3OYMA 5KFTA 3GIIA 5J2FA 4MQ3A 4CJWA 5KFSA 9ICMA 4FJLA 3OYGA 4O3SA 2XHBA 2GUIA 3AV9A 4P4OA 4H4OA 4DSEA 2JGUA 5KT6A 4PGQA 3S9HA 4ID5A 3T5KA 5D3GA 4Z4EA 2BQRA 5J0SA 2D0CA 3VQ8A 3NE6A 3CM6A 7ICVA 9ICVA 4DTNA 3THVA 3AVJA 1TL3A 4N5SA 1RZTA 5I42A 1A77A 1ITGA 2C2EA 3V1QA 1BPEA 4QWCA 3BQTA 5F9LA 5HHHA 4KB1A 2DPJA 7ICQA 3AO5A 4M9HA 4KLJA 4R8UB 4M9JA 2PFOA 4O3OA 3RJFA 3TABA 3ZDDA 4O3RA 4KFBA 1RYSA 4K8ZA 1MSWD 1WSJA 3M8SA 3I8DA 3E01A 4RW8A 4IQWA 1TGOA 1JL2A 4BDYA 7ICUA 3K57A 4F4KA 4NLNA 4QWAA 2YKMA 1Y97A 4KV8A 9ICKA 4EP4A 5KFWA 3KK2A 4KLLA 3OYLA 2W9MA 2J6SA 1KVCA 1X9SA 2JZBB 4F8RA 3ZSZA 1XHZA 4CGHA 1HJPA 1ZJMA 3GV8B 2OPSA 4NLGA 3EZ5A 2ITGA 3OYKA 9ICBA 3ZDCA 3SV4A 4FS2A 4EP5A 4KI4A 1DOQA 2AGOA 3JPQA 3H40A 3ZD8A 5CYQA 3Q8SB 4QZHA 3KLEA 2JEFA 4UAWA 4ZTFA 1RBSA 3QETA 4DEZA 4QZ8A 3OYDA 2W42A 5IIKA 4RW4A 4GC7A 3JPTA 5E41A 4CJ3A 3TAGA 2HW3A 1HYSA 3CM5A 3OSNA 4CEDA 4DU4A 1ZBFA 1QLNA 4JWNA 4LZDA 4MF2A 3T19A 4B9SA 5KT3A 4O0IA 4M3ZA 4FLUA 3RR7A 4PGXA 4JWMA 3PVXA 1ZYQA 4Q44A 2EHGA 4HUFA 1J53A 1KVBA 4XRHA 1BIUA 2KN7A 4CK2A 3PX0A 4IR1A 5J2DA 4RW6A 3LP2A 5I3UA 4M6WA 1HUOA 3GIKA 4LY7A 4YNQA 4K4IA 4ED6A 3C5GA 2R8GA 4RZRA 4BXOA 1S6PA 1JX4A 2FBYA 4KLQA 1ZBUA 2A1RA 2C28A 3A2FA 8ICVA 4P4PA 2ALZA 2RKIA 4TURA 5DKWA 3ZSQA 3AO3A 4ED3A 1KLMA 3ZDAA 1RILA 1LWFA 1DGSA 4C8OA 2M9NA 5CR0A 1XWLA 1T4GA 3VQ9A 1RT2A 1XHXA 1DTTA 4GXKA 4Z6CA 2RPIA 5DK5A 3BDPA 4CJKA 1WCLA 4KLFA 4CJVA 3QZ8A 1ZQLA 4B9UA 4EZ9A 4IRKA 1Q9XA 2AU0A 1D9FA 2ZUBA 4IQTA 4FYDA 1RTIA 1W9HA 4QZDA 2PFNA 4RPYA 2W8LA 3PY8A 3LP3A 3CG7A 3TWHA 3V9XA 4JV0A 4W5QA 3RJEA 4BACA 4O55A 3K58A 3TAEA 4TUQA 4B08A 5EOZA 2AQ0A 5HP4A 3QO9A 4CEQA 1ZQUA 5DB7A 1TKXA 1WN7A 1YT3A 5F9NA 1IKYA 1S76D 3MXJA 2W9BA 3HL8A 3UQ0A 3OYJA 3JSMA 1JLBA 1RBTA 2G8FA 1HYZA 1FXXA 3RB4A 2HHWA 4Q8FA 7ICSA 4C8KA 5KFLA 4ZH4A 4JV2A 5CP2A 3VQEA 3AO4A 2UVWA 2AQ4A 2UVRA 1RPLA 4DG1A 3KK3A 5T7BA 4RQ7A 2YHAA 2I1QA 4J9NA 4FLYA 4OLAA 5K14A 3ASMA 5DG8A 3QLHA 4TQSA 3RAXA 2FMQA 5DG7A 4FK4A 2BPGA 1SUQA 4JK1A 4DF8A 4CJLA 2O4IA 1SKSA 1S1UA 1EXQA 5J2GA 1U48A 4CEZA 5SWMA 4B9MA 4OKJA 1UT8A 1BQNA 3U3GA 4DFJA 4KHNA 2QKKA 1C7YA 2E4LA 3FYHA 2ZTCA 3ZSYA 4J2DA 3QEXA 3B0YA 4IQVA 3C5FA 1XU4A 1Z25A 3PMNA 1ZBIA 2R8JA 2XCAA 2DY4A 2NRXA 8ICGA 3DRPA 1VSDA 5L1KA 3AVNA 1LW2A 4YMNA 4CK1A 4ZTJA 2ATLA 5J29A 2KZZA 3MEGA 1K1QA 2FC0A 3NH2A 1IM4A 3SUOA 2OPPA 3RMAA 4QWBA 1BCMA 2HHSA 3QE9Y 2Y1IA 1J5OA 4UAYA 4IG3A 1Y88A 4M6WB 3PR4A 9ICOA 2J6UA 2HHTA 3SPZA 3RH6A 4M9LA 2J6TA 5EWGA 4DSLA 3NGDA 4Q8EA 1SL0A 3G6YA 4I2GA 1RBVA 4KTWA 4EBEA 1ZQEA 1BQMA 3S3MA 4NM2A 1KRPA 2BDPA 1NK6A 2KW4A 4ECYA 9ICUA 3EWAA 2I9GA 4XIUA 2Y1JA 1ZETA 1JKHA 5KGWA 3QNOA 4QW8A 4NXZA 3T5HA 4LVSA 5KFRA 4ECSA 1TK5A 3C6TA 1EX4A 1D9DA 2JLEA 3L2RA 2P51A 3Q8RB 4JV1A 3HPHA 4RNOA 9ICFA 2A1SA 4Z4FA 3KLGA 1WSEA 4DL4A 8ICQA 2HNYA 2DPIA 5HRRA 5DBCA 2P5GA 5DQHA 5KG4A 1UOCA 4RQ1A 8ICXA 1IXRA 3CQ8A 3GILA 1VRUA 3CFPA 1GOAA 1BHLA 5KG6A 2VWJA 1IH7A 1TK0A 8ICMA 3RR8A 1ZQAA 3GIJA 1BPZA 3Q8QB 4Z6FA 4DTMA 4YQWA 5KFCA 7ICHA 8ICRA 2B21A 1ZQSA 5J0PA 4B9VA 1N5YA 2LSNA 3PX6A 1S10A 1I39A 3SUQA 3KLIA 1C1AA 4R63A 3G6XA 1N6QA 2VA3A 4PQUA 4YFKA 3RH5A 4I7FA 4YR0A 3EY1A 3UIQA 4Z4IA 3K5OA 3Q8PB 3JYTA 4CEBA 4EBDA 1FKOA 2IAJA 4ED7A 3RJIA 3QEAZ 7ICJA 3PX4A 3Q8KA 3GDXA 1CZBA 4CF8A 4HHTA 3KIOA 1ZQKA 3WNHA 2BE2A 5FDLA 1QSYA 4CECA 2Z1GA 4FJHA 4ED1A 1JXBA 2R8IA 4IG0A 9ICXA 1TAQA 3UQ2A 7ICPA 1ZBLA 1HJRA 1ZQCA 3HXMA 1HQEA 3VQBA 1U04A 3MR5A 8ICPA 2C2RA 1ZQOA 2R8HA 4J9KA 3SYZA 5CJ7A 1NKBA 1T05A 3VQPA 2LYHA 3ZSVA 4UBBA 5J2PA 3P5JA 1LAVA 4DTXA 3LP1A 4BGDA 4M2YA 5J2JA 4CEEA 3HT3A 1D8YA 2ZE2A 1SKWA 2W9AA 4IR9A 3ZSWA 3KHLA 5KG7A 1B9FA 4FO6A 3IHQB 4DTUA 4MFBA 5D49A 3L8BA 3IM1A 1JN3A 4M04A 3QEPA 3HM9A 1N56A 2QXFA 4B8AB 2YHBA 2DFHA 4ECWA 5J0OA 4LD0A 7ICLA 4DS4A 4CJTA 4FCYA 2OYQA 4GC6A 1JMSA 4AILC 2ZD1A 3UPQA 3VA0A 4KLHA 4F92B 1G15A 2YNIA 4DSJA 4DWIA 9ICHA 1VSHA 8ICWA 2X6SA 4LH5A 3AVCA 4ECTA 5JS2A 3OHBA 3ZT2A 3H7IA 1NJXA 3RRGA 2FPMA 1RCHA 2BCVA 2FLPA 3IAYA 4H4MA 1HYVA 1SKRA 3C21A 4PHEA 2HMIA 3D0PA 1LAWA 3AA2A 4NCGA 3NCIA 4Q43A 1VRTA 4HUEA 1S0OA 2B6AA 4KRFA 3AA5X 4E7JA 4UQGA 3V6JA 1S1TA 4ECZA 4O44A 3S3OA 2HNZA 3KD1E 5J2AA 3U6FA 1NJZA 4HCCA 5KFGA 8ICZA 5CZ2A 3DLRA 3P83D 2V4QA 4R65A 2W9CA 3MR3A 4ELTA 1QSLA 3HPGA 1MU2A 5KFPA 3ZD9A 3PO4A 2HHUA 4K8XA 1ZQRA 1JLCA 4UAZA 1RTDA 3N4MB 8ICIA 3T5JA 4I2CA 3DLHA 4DS5A 1B22A 3EYZA 1TFRA 1A5XA 4AHVA 8ICYA 2ISOA 4KHYA 1CZ9A 4RUAA 2IOCA 5KFIA 4Q45A 1I3AA 4YG2A 2AGPA 3ZT1A 2RDJA 3SZ2A 2YNHA 8ICHA 4DOBA 4E19A 2F8TA 4C8NA 2RF2A 5KFVA 3T1AA 1DLOA 2ASJA 4DTRA 4RQ3A 3AU2A 1ZQJA 3AVAA 3MECA 3QEWA 2OPQA 3VQCA 4W5RA 2HHQA 1ZQVA 4KN4A 1UAXA 4FXDA 3GQCA 3MXMA 4M3WA 4FBTA 2OA8A 3HX0A 3LAMA 4PUOA 3C2MA 3LPUA 5BOLA 4J9SA 4F5QA 3ZDEA 4EEYA 2YNFA 2BPFA 3VQAA 3SUPA 1A76A 1X9WA 3LP0A 2KZ3A 4FLTA 3OHAA 3NF7A 2Q0ZX 1JLQA 3KKRA 3MAQA 4FM0A 2NRVA 4YCXA 3OJUA 3H8JA 9ICEA 3V7LA 4CE9A 1QS4A 3NF8A 3RJHA 1V9PA 3DMJA 2P5OA 4M45A 1VSJA 1HMVA 5DMRA 4OPJA 4R64A 1RTHA 4FZXC 4F3TA 1S5JA 3DLKA 4ED8A 3KHHA 3AU6A 2X74A 4RW7A 4F2RA 4KLMA 4DQPA 1S1VA 3KLFA 4E7IA 3Q8LA 3KK1A 3NH0A 4R5PA 5HMLA 3BQ2A 4I2FA 3V6DA 3DLEA 5C42A 4FM1A 5IIJA 1NK9A 1ZQWA 3ZCMA 4O5BA 2PZSA 4JLHA 1C1BA 3DOLA 4J9MA 1NK4A 4RNMA 4CGDA 1BIZA 3BQ0A 4MFCA 4I9LA 4QZEA 3IS9A 1JL1A 3KD5E 4BE2A 2PYLA 4FLVA 4KTQA 1TKZA 3AVBA 2NRWA 5KG0A 2Z1JA 3LDSA 3C95A 4CEAA 1KTQA 2IHNA 2KFNA 4F93B 4DQRA 4ELUA 4I2HA 4NY8A 4I2QA 3M9OB 3MR2A 8ICAA 2ETJA 4MEXA 2KFZA 5KGXA 3NGZA 3SPYA 2BCUA 4DLEA 2V9WA 3RJGA 1X1PA 4DSKA 4Z6DA 4Y1CA 2V4RA 2HVIA 1IKVA 4RQ0A 4OVLA 5KFMA 5CB1A 3RTVA 1NOMA 1SL2A 3VQ6A 3KHRA 1KEJA 2JEIA 1T03A 9ICTA 5IIOA 9ICGA 1QHTA 1XI1A 4EZ6A 3DOKA 3GIMA 1EKEA 2XRIA 4UB1A 3L2VA 4C8MA 1RT3A 2G8WA 4M41A 4HCBA 5DGBA 1YTUA 3PW5A 3RMBA 2FMPA 4Q0BA 7ICEA 1ZBHA 3FDSA 3NTUA 3V9UA 1UT5A 3NBPA 4FK2A 3PW4A 3AO2A 1XS9D 1KSPA 5HBMA 2HB5A 4CERA 1WSIA 4FW2A 4M3XA 3VQDA 1SZPA 5HNKA 5BOMA 3LALA 1BI4A 5J0QA 4P4MA 8ICCA 1J9AA 3SI6A 2IHMA 9ICQA 3BJYA 1GOBA 4M0AA 3LZJA 4MF8A 4M9GA 3MABA 3ITHA 4O5CA 1L3VA 3ETLA 3U3YA 3NF9A 3O4QA 7ICIA 1ZQZA 4YMOA 5J0YA 1TVAA 1LV5A 1B92A 1L3UA 1WAFA 1BPDA 1WAJA 2F1IA 4BE0A 3OYBA 4DSFA 5KG1A 5C5JA 4DOAA 4RPZA 5FROA 3K5MA 4I2AA 2MUTA 4J9PA 3WNFA 8ICUA 4C8LA 2FLLA 4QZFA 1RXWA 1LW0A 3AVLA 3C2LA 3TFSA 4ELVA 4CEFA 1S97A 4CF2A 1HUZA 5KFZA 1KFDA 1UWBA 1WNSA 1L5UA 4YFUA 3ZDBA 5J2EA 4N47A 4FVMA 1BGXT 3TANA 2F1HA 4F50A 2BCSA 8ICTA 1Z3EB 2D5RA 2NRZA 5DG9A 4F5RA 3JPNA 1QSSA 4CGJA 4I2IA 4CHYA 4KN7A 1ZQGA 8ICNA 3MGIA 1FKPA 2F96A 2IC3A 4DF4A 4GXIA 5J2IA 3ZSOA 2HHVA 4M47A 1Q9YA 2B5JA 3H8WA 4B9LA 1S77D 5C25A 3L2QA 3K2PA 4I2DA 3TAPA 3V9WA 2WONA 4IFVA 4J2EA 1CEZA 2VWKA 3SQ0A 4FZYA 4YXJA 3V6KA 3V6HA 2E6LA 4E1NA 5KFEA 1RTJA 4BXOB 3F9KA 3HPOA 4G1QA 5IIIA 1B9DA 2FLNA 2DFLA 4DTJA 2OZMA 2PY5A 1RDAA 3ZT3A 3ULDA 4NCBA 2NUBA 4PA1A 4CJ5A 4EYIB 2VA2A 4UB5A 4RQ2A 1WSHA 3H8SA 1IG9A 4Y1DA 4NM1A 4DU1A 5DQIA 3RAQA 2BGGA 1ASVA 3B0XA 4P2HA 3VQ4A 4Q5VA 3VQ5A 5DB8A 4K4GA 1A5WA 4CF9A 2G8IA 1T7PA 1JLFA 3JPPA 4CFDA 4O5EA 3LPTA 1XSLA 1C6VA 1S6QA 1PZNA 3LK9A 4FK0A 3O3FA 4CCHA 1MQ3A 4CF0A 1VK0A 3NHGA 4QZCA 2DFFA 3RWUA 1ZQDA 3QNNA 4ZHRA 3B6OA 1EP4A 3F73A 4DL6A 5EWFA 4FJMA 4M42A 4ECQA 2VANA 4MFFA 4E7HA 5KRSA 2PFQA 4XA5A 3HSTB 1KDHA 2D0BA 4UBCA 1RT6A 1UA0A 4CHPA 1K1SA 1RT4A 5KT5A 1HNIA 3KJVA 1JXLA 2ZJ5A 4KHQA 5DB6A 5KFAA 3OS0A 2IDOA 4ECRA 1TKTA 2W9BB 3SI8A 4OKKA 1ZQMA 3QIPA 5HP1A 1U47A 2BR0A 5FRNA 4CK3A 5HLFA 1NK7A 1VSMA 2G8VA 4YR3A 4DL7A 4TUPA 4J9RA 4DL2A 3PO5A 3C6UA 1HNVA 4CJRA 1SL1A 2W8KA 4J9QA 9ICWA 3ALYA 1BPYA 1H38A 3C2KA 3L3VA 4H8KA 9ICJA 1BI4B 2X78A 3KKSA 3P1GA 4X5VA 2ASDA 4O0JA 4CJQA 3HO1A 1KCFA 5FRMA 3MFIA 4ED0A 5KFUA 5KT4A 1BPBA 2OWOA 3DYAA 1ZQBA 3AA4A 4CFAA 5IIMA 4O5KA 1TKDA 4KHWA 3LAKA 1DTQA 8ICEA 5KFBA 5KFDA 2R7YA 2MUTB 1HRHA 2HVHA 4Z6EA 2KTQA 3OYFA 4KLIA 5KRTA 4CHQA 2QK9A 2IA6A 3IG1A 1XSPA 1Z00A 2XY5A 5D46A 2BPCA 3JPRA 3G0ZA 3WNEA 4BDPA 4KTZA 1JLGA 3MDAA 5KFKA 5HRSA 4PHAA 5KI6A 4OPKA 4KB0A 5DLGA 1C1CA 4E89A 1CXUA 7ICRA 4CGGA 3LWLA 2R8KA 4KLEA 5DQGA 3SQ4A 4CHOA 1U9LA 4FJKA 1BISA 2P1JA 1EETA 2Z1IA 3HJFA 4QOZB 2A1JA 5KFHA 4CIEA 3M8RA 3QESA 3OS1A 4LSLA 1FK9A 4RUCA 3WNGA 3ZSRA 4FZZA 1ZQHA 3ISNC 3TI0A 3SUNA 3OYNA 9ICNA 2BANA 1IO2A 4KHUA 4OKEA 3RB0A 4KLSA 3SQ1A 2DTUA 3K5NA 4M3RA 5KFYA 4GVMA 3C1ZA 1JLAA 4BE1A 3UXOA 5KFOA 8ICJA 4HVJA 3EPIA 4KITB 3QEIA 5HMMA 1JXEA 4KLTA 2KZMA 5HHIA 5CA7A 2OZSA 7ICFA 3CFRA 4O3NA 2F1JA 3NGIA 1LB2B 1RDBA 2F8SA 4CFBA 1S1XA 3VQ7A 1T8EA 4YMMA 2GBZA 1N48A 4Z0UA 4QW9A 3AUOA 1U4BA 3OSPA 1RDDA 1RT5A 3M8PA 4Z4HA 4E3SA 2PI5A 1WSFA 5KFJA 4O3QA 2XY6A 3OYAA 3T3FA 3LDAA 3QERA 4CEOA 5BPCA 3AVKA 4KI6A 1J54A 5HRPA 4RQ6A 4YD1A 2JEGA 4TSXA 4HTUA 1BVSA 4I9QA 4W5NA 3HVRA 2BCRA 2P66A 4QZ9A 1NKEA 4MFAA 4FJ8A 3M9NB 5DLFA 4DTPA 5L1JA 2MAXA 2QKBA 4OGEA 4BDZA 4F5OA 3D45A 1NKCA 4DU3A 1NK0A 1QTMA 1UA1A 3MEEA 3TFRA 2FBTA 3ISDA 3I0RA 4O9MA 4ICLA 4FJJA 3V7JA 5DGAA 3OVNA 3K59A 5L1LA 4UB2A 5KT2A 1IKXA 3LZIA 3NAEA 3L2WA 2FPLA 8ICFA 3MXIA 2HNDA 3AO1A 1RBRA 5J2BA 4IBNA 3RRHA 4DQSA 4ECUA 3ISBA 2ZQBA 3AVGA 2XO7A 1KFTA 3AVHA 4PHDA 4KLOA 4QAGA 3NGYA 3C23A 5J0UA 3KHGA 4FJ9A 5J0TA 3DI6A 1RBUA 4IRDA 4RG8A 4R66A 3KTQA 4CJFA 3VA3A 4EYHB 1U49A 4ECVA 4CIFA 5IILA 2OPRA 3L2UA 4FLZA 3K75D 2IMWP 5KFXA 9ICLA 5J1EA 5HRNA 1YTAA 3SNNA 1S0VA 4QZGA 4RW9A 3ZT0A 3KLHA 3PW2A 1K6YA 4E0DA 4FS1A 4KKOA 1TV6A
chains in the Genus database with same CATH superfamily
3CIPA 3R27A 2WF6A 3P3DA 1NSPA 1HJOA 1N8RT 4HVZA 3NGKA 2AYEA 2HWTA 3TARA 1WLJA 3C14A 4P75A 3PR5B 1ZM4A 1UJ6A 3JQKA 3V81A 2RDDA 4KHRA 1VQ9N 4JD2A 3VZIA 4WZQA 4LR8A 2HHHJ 3OFEA 3AA3A 2YWGA 3SJJA 1XC9A 2E1EA 1UMJA 4ZP7A 3VV2B 5SZTA 4CHZA 3IGVA 2IRUA 3QZ7A 1VQLS 2V8HA 1U6ZA 3EGZA 3G82B 1E6YB 1FK9B 1LWXA 3R5CA 1S48A 1NI3A 4W92B 4YB1P 2BANB 3DHWC 4WCEL 1YJ7A 4K4YA 1IKWA 3DLGA 2ILYA 3OR1B 2A3JA 5JUMA 2D41A 3W2WA 4DV5J 4CJSA 1VQPN 5KTQA 5C15A 3BGRA 3QEVA 3ISCA 1REVA 1R8CA 1UTAA 4U95A 3M2UA 2VG7A 1FERA 3K0SA 2RQ4A 1PUZA 3JSRA 2YB4A 5GAEP 4OX7A 1GTHA 5THWA 4DR2K 2XS5A 1OYDA 3RMDA 2HNZB 3AJ2A 1PC4A 2G8HA 4FJXA 1ZQIA 2JC0A 3KMQA 1FDDA 3D6HB 2R7VA 4DUZK 4KE5A 2ROEA 4DXLA 3KDNA 2OKQA 2R7SA 1L7PA 2W9CB 2PEBA 2E2OA 3QUTA 2Q3SA 3FVYA 3I6PA 3AXKA 5ETKA 4RT2A 4KGXB 4RU9A 4MKBA 5FJ4A 5E26A 3OXFA 1XR5A 2GELA 3QFPA 8ICLA 2MSSA 3ZTQA 4DN0A 3WXJA 2EFNA 1NH7A 2AYBA 1FXLA 2P9UB 4J2BA 3OA9A 1D8LA 3D2SA 1BWVA 1QVFM 4L72B 4I69A 3KWMA 3MEKA 5A8RB 3FSIA 3R1LA 3KLVA 4LFAF 4DTSA 2WC9A 1QUVA 4UOGA 1XSNA 4IFYA 5AI8A 2HHPA 2ZUDA 4NL9C 1ZQPA 4NYOA 1HD0A 2Z7JA 3DLBA 1X4AA 4IRCA 4EBCA 4IOBA 1Y11A 3CGIA 4BWJA 4UOFA 3G71S 1R31A 2IY5B 1AT1B 7ICNA 3LGNA 1Q8BA 1Q81T 1JJHA 1T9XA 1XBWA 3CO9A 3W64A 1ZC6A 1KFSA 2JWKA 1S9EA 5IFMA 4B1WB 5JRTA 3QNWB 2F2AB 2WW8A 3CJ9A 2W4DA 4A48A 1L8OA 4JRPA 2KKZA 3VF0B 4OYWA 4KX5A 2IBKA 1V5IB 4TQRA 2RUSA 3UKUA 7ICMA 4IKFA 1QAIA 3MGHA 4LRBA 5L38A 1ASUA 2AH5A 2XEXA 3FGUA 3OGUA 2N3LA 2RQCA 1CUKA 2PYJA 4OX9J 2BEFA 3P45B 4CJEA 1X5OA 3CJ4A 3AJ1A 4D3HA 4FJIA 4FZVA 4R5PB 3BSAA 2JNJA 2RJZA 1IBKK 1EXNA 3V81B 3I0SA 4FF3A 5IWAK 4EFAC 1F60B 2MQOA 1EWQA 4M3YA 1MMDA 5J2HA 3UXNA 4Y0WA 1C1BB 4MHVA 2M0NA 5E3PA 3NCPA 5LL6Z 5E3RA 3QUQA 4FLWA 1F21A 4XUSA 3MI7X 4UASA 2PFUA 1NM1A 1NOZA 2BJ1A 4YHHF 3VQQA 4C0BA 2OH2A 4TU8A 3BY5A 2FVCA 4MDBA 4TN2A 3W7BA 1IKWB 3DLGB 2CNKB 8ICSA 4DB3A 2D3UA 3DM2A 3W2WB 4N56A 4JB8B 3NVVA 2GMLA 2C3UA 2CRLA 3HHLD 2ZJPQ 4QZAA 3BGRB 4YN3B 3FC9A 1COKA 2BQUA 2VG7B 5ETLA 5D0GA 2PI4A 4WF9Q 3W3DA 4BC9A 1NGGA 4U67Q 2QTDA 2HPUA 9ICCA 2D3O1 4QWDA 2JRZA 3QFHA 4WTOB 3MOJB 2OANA 3Q7CA 2NXUA 3MCOA 2X3GA 2VDIA 3W66A 4L75A 5F0XA 2J0WA 1T3VA 4YY3J 3V1OA 1XNRK 4IYQA 4ES2A 3RU0A 2XZTB 1RHMB 4CLTA 3DRSA 2MZQA 4JI1F 1SXDA 3O44A 3R7SB 1RNHA 3NFAA 2JZBA 4CF1A 1NNEA 2YX7A 3MHYA 5KQ8A 4P73A 3V72A 3L0QA 3RMCA 4CESA 2X6NA 4BGBA 4YHHK 1XJWB 4IFYB 2XY8A 3CPWR 3ZTSA 2ZIXA 1R7IA 4DFMA 2BKPA 3TA1A 1ZH5A 4JI7K 3K0JA 3S41A 1Z1ZA 1SC1B 2E1ZA 3TEGA 2Z56B 2D0PA 2KEYA 3GFXA 4NYFA 4NI2A 2XC9A 2AJQA 3J81Y 1N62A 2KOBA 2D0OA 1C2PA 2ZJ8A 4AHTA 1XMOF 1CXQA 1LWCA 2AXTU 3GG1A 2OFHX 4DR2J 5BN9A 2WF7A 3D1QA 2Y3YA 2KJWA 4DOZA 4NYNA 1BNOA 1L3TA 1VQOS 4DUZJ 3DU6A 1D8BA 3UKUB 2VIHA 1YZ6A 4NLKA 3N9UC 1DK2A 4BC3A 1RWXB 1D8ZA 3SQGA 2HIQA 1BCOA 3TAQA 1YSJA 4OX8A 3MUVP 4ILMA 3CD6N 2WVEA 3DRXA 4IFVB 2G8KA 3QNMA 2XS7A 3L3UA 3C94A 1VJWA 4K4VA 4B1VA 2FZKB 1T95A 5L1IA 4Z4GA 3KKAC 1UVJA 1DRGA 3QXGA 2LU1A 5FIIA 4NLZA 5C24A 2IJNA 4I28A 3I0SB 4ILGB 2UVVA 1VBZA 3P8BB 1RDCA 3IFRA 3OYMA 2DKZA 5J2FA 2AJ4A 5KFSA 4FJLA 1XMOK 1OY8A 2I38A 2P9CA 4H4OA 4DSEA 4IO9Q 4UY8O 3ONNA 1D9AA 1SJ3P 2EZZA 3VGLA 1K0TA 1N5QA 3T5KA 1Z4OA 1BQXA 2BQRA 2A6OA 4BRKA 2O5DA 5ALVA 2O67A 2JRSA 3QAEA 9ICVA 2H9ZA 1KHVA 1TL3A 3DM2B 4N5SA 3V5RA 4X4SA 1RZTA 1BA1A 1A77A 2GTDA 5F9LA 5HHHA 2DCLA 5AQQA 4USVA 2ILZA 1LFPA 4CLSA 3GWCA 3AO5A 3ENHA 4PYAA 1QQ5A 2E7WA 2EXUA 4PZOA 2DF4B 2DH9A 3RJFA 2DNQA 4C9DA 2FHJD 1FEZA 1RT4B 1VQ7S 5ETRA 1PJ7A 3M8SA 2V63A 2BW7A 1VQYA 3MM6A 1PCAA 1TGOA 3R9LA 2MSTA 2WK4A 1SQGA 3DNCA 2KXFA 2UUBF 4Y2MA 2R18A 4QWAA 1Y97A 9ICKA 5CEHA 4NLRA 4DCPB 3PYEA 2P9SA 1JNRB 2FDRA 2VJVA 4JKFA 4KLLA 1IBKJ 5HOOA 3DRSB 1OVQA 5IWAJ 2JZBB 1C20A 3ZSZA 4CGHA 2OPSA 3EZ5A 2ITGA 3OYKA 3QSIA 2EZXA 4FS2A 1DOQA 2V2VA 3O1BA 4LFBF 2RH3A 2FLOA 2ZIXB 3OTEA 1JROA 2KHDA 1RBSA 3VGTA 3QETA 4DEZA 5IT9Y 3IAM9 1KHWA 4KRWA 3JPTA 4CJ3A 1I94K 1OSCA 2UUTA 5E7OB 4NI2B 3OSNA 5ETPA 4DU4A 4MF2A 4LZDA 1FRHA 3T19A 3DDHA 4NLYA 3CJTA 4JK9A 3CCZA 3O9SA 3Q24A 4JWMA 3TRGA 3CUNA 3BBBA 4QOTA 1ZYQA 3KUEA 4MYTA 1SBRA 1J53A 1KVBA 1NGDA 4XRHA 2HSTA 3PX0A 4RW6A 4AXJA 4M6WA 1HUOA 4K4ZA 3GIKA 1C1CB 3DDIA 2BX6A 4YNQA 4K4IA 3F2CA 2LQJA 3EKSA 3KUGA 1HPMA 3UDCA 2YMMA 2ZGZA 3C5GA 3OFFA 3PSTA 3SQGB 1WOSA 1ZRMA 1CQNA 4DCHA 1JX4A 4KLQA 1TELA 3NS6A 1RAFB 5AKJA 4P4PA 5CD4H 4V19X 3ALRA 1V97A 4TURA 2B8QA 2R7UA 2BM1A 1UJ4A 2Q31A 4NMLA 4KR0B 5D0HA 3DFEA 1XWLA 2KM8B 4YHHJ 2NO4A 3VQ9A 3UCZP 1XHXA 3QBXA 1DTTA 2UXBF 4JI7J 2B6GA 3AY0A 1YVNA 1WCLA 2D3DA 3SDEA 1VBYA 4EZ9A 2KKPA 1T11A 5HQ8A 1Q9XA 2AU0A 1RB0A 1U24A 3ZETA 1WKJA 1Q7LB 3QAUA 4H4OB 4PJ0U 3HSZA 4I0WA 4C4TA 3TSUA 2Y0SF 2PFNA 1CBKA 3HHLC 5BPNA 2EKNA 2QWNA 3CG7A 3R8YA 2W40A 4ISEA 4NEYA 1UVLA 3RJEA 4W5QA 5LJ5Y 1H3DA 4BACA 1TL3B 4AFFA 1VOMA 3CC2N 1R27B 4AXIA 4B08A 1FD8A 5ALOA 4PXBA 3DWLA 4H0XB 5F9NA 4C8ZA 4DCJB 1NPKA 3UQ0A 4BRHA 4J03A 3BO4A 2G8FA 2P9IA 3OL6A 1TP7A 4A47A 1HYZA 2OEJA 3RB4A 1Y0HA 4Q8FA 7ICSA 5KFLA 3W8GA 4B1YB 3MM6B 3UDVA 2NXJA 2GVZA 4UTGA 2RP5A 4WQ5A 1MROA 3IRWP 4JV5F 4IL6U 1OUQA 2PMZF 1YJ9N 3VAGA 3AD7C 1TL5A 3M7VA 4OLAA 5KPZA 5L9NA 5AFUH 4TQSA 3RAXA 5F3TA 1SUQA 1HR0K 2OPSB 3F41A 1WHXA 2DKXA 1IUJA 1SKSA 2NQPA 3G96A 1XMOJ 3M1FA 5SWMA 2KN4A 3O4WA 3AQPA 5HVGA 4ZDNA 2JC1A 2ZXHA 1FIQA 4KJIA 3U3GA 4KGKA 4DFJA 5AK6A 2F5GA 4C0ZA 3R1HA 4PRFA 1XUPO 2HDOA 3QEXA 4BLGA 3B0YA 4URSA 3Q89A 4XAKA 1RAIB 3AVNA 4CK1A 1NG9A 5J29A 2KZZA 5AZJB 1IM4A 1K73O 4WYWA 3SUOA 3RMAA 4QWBA 2ZXIA 1BCMA 5B0FA 3CCUS 3WK8A 3ID8A 2CVEA 4MYUA 4ZVOB 3K1RB 4RW6B 5AQRA 4UARA 4M6WB 1Q78A 2DITA 1KDNA 3NNAA 3CSKA 2AHOB 1NAQA 2JH1A 5EWGA 2CJYB 2VZ9A 5AKKA 1RBVA 2HBJA 2MRLA 3AOBA 4K2JA 3PYFA 3IG8A 1RU2A 2GO9A 4MH8A 3S3MA 3TYTA 1KRPA 2BDPA 2AJFE 3NGSA 4H0PA 2AEJA 2B7BB 1VK8A 3GOIA 3QPIA 2I9GA 1ZETA 1TYQB 2A6MA 4PR6A 3CO0P 2ZBRA 2OAUA 4ECSA 1S9GB 2YKQA 2QWMA 5G0RA 4USMA 1GX6A 1GMWD 2P51A 3HPHA 4RNOA 4Z4FA 2CZ9A 1T94A 2VBXA 3P5BP 4DL4A 1WELA 2XLKA 5HRRA 5DBCA 3I32A 4ZCMA 1I94J 1RHKB 5E3CA 2P5GA 5KG4A 3ZETB 3FUYA 1UEKA 5KQDA 3UCGA 5AQSA 5A0YB 3CFPA 4DMZA 4Z7YA 5IT0A 5KG6A 2VWJA 1TK0A 4GV6A 2B4UA 4UOHA 3SK3A 4CNYA 3DCAA 1LXNA 2YBVA 2RQ5A 4BRMA 2HGNA 2IFXA 1BUPA 3IP0A 2BOPA 2HQGA 4ZVUB 3RVCA 8ICRA 5B0CA 1ZQSA 3GZ7A 1MWYA 5ETMA 1I39A 2YHXA 2UUBJ 5IQ6A 1N6QA 2BMBA 4I7FA 5EDWA 3P4IA 3EY1A 3D54A 3Q8PB 3O80A 3JYTA 4CEBA 4JI3K 5AI0A 3KMSA 3PX4A 4O8KA 3H3NO 3Q8KA 1ZOLA 1ITPA 4S0MA 3UMCA 2RLTA 3CMAN 4CF8A 4HHTA 2HGLA 3WNHA 3PJWA 2GVZB 1N63A 3W63A 1MROB 2XVTA 4IG0A 4A8KA 1LWEB 3KYLA 2F9DA 1ATSA 1PK1B 3MF5A 1YX2A 5L1MA 1CSJA 5JXSA 1VLYA 7ICPA 1ZBLA 5K20B 1S22A 1VC5A 4LF6K 1HQEA 3MR5A 2C2RA 3A8EA 4NLQA 4XH5A 2QEXS 1Q4RA 2HAIA 4NXMK 3CJ2A 5D0RA 5J2PA 1YHQS 3MPVA 2CQPA 2BH1A 3LP1A 3PACA 1NGIA 3LYSA 4I6AA 4K50A 2CWXA 1SKWA 2W9AA 4H5WA 4USKA 3KHLA 4DV0K 4FOEA 5D49A 2RHFA 4K43A 1JN3A 3QEPA 4LR7A 3HI0A 1N56A 2QXFA 3EGVA 2NSBA 3ZZUA 1C0FA 2DFHA 1A6LA 3C16A 2KHVA 3QDKA 2M8HA 5J0OA 4FCYA 1SC4B 2YNGB 3HD1A 3VA0A 2E1PA 3M6GA 3WXMB 4KLHA 2QL9B 1G15A 3OW2R 4LBIA 4LR9A 4JKAA 3CETA 2QWRA 1PBAA 4ZLNA 1WB9A 3VMFB 5E0OA 1VRQC 3AVCA 4ECTA 4RNHA 3U9ZA 3G6ES 4USJC 3HHKA 3T1HK 1NJXA 2N4DA 3N7PD 4CZIA 2O3DA 4G1IA 2E8NA 1GLBG 3H2VE 1ZA2B 1LAWA 3CCLN 3NCIA 4HUEA 5U47A 2E1YA 1S0OA 4QIWF 3ETOA 4KRFA 2HFSA 1NMEB 3NRZA 2XMAA 3UN3A 1HR0J 5G0RB 1QE1B 3CRXA 1YJUA 2RS8A 4BQZA 3S3OA 3KD1E 3GCWP 5J2AA 1NGJA 1P7DA 3GJRB 3I8BA 1H0HB 3U6FA 2FIUA 1HL6A 8ICZA 2RMLA 5AQUA 2XB2D 3SMSA 5CZ2A 2D1CA 3LM2A 3N5BA 3AB4B 2D1KA 2B7CB 4QIVA 5ITHA 2MZ1A 3MR3A 4ELTA 1SI9A 4DV4K 5KFPA 3PO4A 2BRLA 1T3OA 4DS5A 1B22A 4OLPA 4AHVA 5ALRA 4KHYA 1X6JA 1Q8KA 2CIMA 3J8AA 3E51A 4JEPA 4RUAA 2NV3A 4YG2A 2ACYA 4OZ2A 2AGPA 2KJ5A 4JV5J 1IBLK 4OYAA 4CP5A 3CJCA 1N6QB 4ZVQB 2YNHA 4I7FB 2CZVC 2QKQA 4YDUC 4E19A 3OLAA 5KFVA 3T1AA 2KG1A 2ASJA 5J2QB 4CWBA 4IOAQ 2G2YA 1X4GA 3TR5A 2HHQA 3HZ6A 3Q8VA 4K4WA 2CJAA 2FJ6A 1UAXA 4WK1A 1YIJS 3GQCA 1A9NB 2A5XA 3Q7BA 1RLDA 4JI0F 4M3WA 4CGZA 4FBTA 3WXIA 3HX0A 4YUDA 1VC6A 3C2MA 5BOLA 3ZDEA 1Q86O 3KFUF 3WQPA 5F8HA 4QYRA 3IWLA 3A0HU 1X4DA 1X9WA 3CQXA 1HQEB 2EQYA 2EBEA 2R7WA 3PRBA 3NF7A 4JI6F 1HIYA 4BR9A 2O8FA 3GZFA 9ICEA 3V7LA 3FCWA 2D9OA 1T9WA 3RJHA 1OVYA 2IYIA 2OLWA 1HUXA 3D6TB 3MN7A 2Z4PA 1KKXA 1HMVA 4R64A 2CWKA 1RTHA 4FZXC 1V6HA 1EB0A 4OYBA 2XMWA 3FRZA 4RW7A 2X74A 3BEXA 2CNLB 4OZ3A 5CAAA 1HI0P 3EZWA 4XDCA 2G13A 4LFCF 3Q8LA 4KMOB 2R7QA 4MKYA 3C16B 2CNNB 4WQ4C 2ZOFA 5HMLA 4I2FA 4A5AA 1NDPA 2VBYA 2J76E 5C42A 4DHVA 2PIIA 1DQAA 2XI2A 2ZG6A 1NK9A 3ATVA 1VHXA 4JLHA 1ED1A 2KU7A 1QUPA 1NZBA 3FZKA 2V8VA 4TVAB 3O6WA 4MFCA 4Y2TA 4ISGA 1YXQA 1TKZA 4GNIA 2C3MA 4CEAA 1TMMA 3GFYA 4F93B 3BZQA 5E79U 1RGVA 2YY6A 3EDRB 4I2QA 4NY8A 1OQ6A 1I5OB 2JXJA 3DXKA 2UXCF 3NNHA 2QLWA 1HBNB 2IVPA 2ETJA 4X66K 4MEXA 4LVOP 3WIVA 2Q6BA 1AQ6A 1Y3JA 4FYXB 3L3FX 3NY0A 4ID5B 4C6AA 2P2CB 1KS2A 1X4EA 4KSEB 4GV3A 1BHNA 4NXMJ 2Y9HA 5AM1A 5CB1A 2GAGC 4DV2K 2DNGA 2DEJA 3P31A 3I56S 3KHRA 1VJ5A 1KEJA 2P9EA 3UMBA 1IBCB 3G8SA 1EKEA 3I87A 1U1KA 3IWXA 4LFCK 1NGCA 2G8WA 1YRTA 4AT1B 4M41A 1KL9A 3PYDA 1YTUA 3PW5A 1QVFR 3H2UB 2B56A 3D68A 1X60A 2MZJA 1RQNA 7ICEA 1ZBHA 5AI4A 3FDSA 4LF8F 2F77X 1XR6A 3VEOA 4EO6A 2HB5A 2M4MA 4CERA 4K8RA 2YMLA 2A19A 3TVZA 1ZM2A 4FW2A 5EVZA 5ETSA 5GVQA 1BI4A 4P4MA 4KH6A 2YNHB 1U1QA 3M32B 2YPZA 1GOBA 2UXCK 3T1HJ 4MF8A 4M9GA 3ENAA 1JCEA 4O5CA 4GKJK 1L3VA 3ETLA 3W60A 3THPA 3U3YA 4ACOA 3CCVS 5J0YA 1L3UA 5ALHA 3FSYA 1WTBA 4DSFA 5C12A 2HFZA 4I2AA 4R0JA 1PIEA 2MUTA 2GNKA 2QL5B 2LBOA 3AVLA 2ATCB 3TFSA 4ELVA 1NHKL 4CF2A 1W7WA 4QU6A 1UWBA 1L5UA 3P96A 3CCEN 3ZDBA 1W2BM 2ZGYA 4H4KA 3TANA 4YOEA 2D5RA 1ZD2P 2NRZA 3KFWX 1QSSA 2Y8WA 1Y5IB 2CFXA 4ZVSB 5ETOA 2G5HB 3BS5A 3RSEA 3J7Z5 2DISA 3SR6A 3HKZC 3R5GA 4M47A 4RO0A 3WKAA 3L2QA 4Q2MA 4GO5X 2KM8C 4NLVA 1FE4A 2V6AA 2MJNA 2HK2A 3V6HA 3ENQA 2E6LA 3GE9A 5KFEA 3DGPA 5F3ZA 3F9KA 3M05A 1XNSA 1NBEB 3ZNJ1 1VQ5S 1HLWA 3CC7N 1VDHA 2OZMA 2QG9B 4OO1J 1ZOTA 2E44A 1CVJA 2C3PA 1HFEL 2W4PA 5C42B 2CN1A 3QFUA 1RP5A 4NCBA 2Q0UA 3QFWA 5GAHU 4KH5A 2XO6A 3ZZYA 1IG9A 4Y1DA 4U7UD 4P0QA 2ZH5A 3CCMN 4AUKA 5BYQA 1TKZB 1F5CA 2HBRB 3BBFA 3ID6A 2H3EB 5AM5A 3DAWA 2LEPA 2J8SA 1FWLA 3DXKB 1S6UA 2W41A 1C6VA 3QUBA 1X9JA 3LK9A 5M2RA 3CDAA 1J97A 3A1YG 1MQ3A 3LDNA 4CF0A 3NHGA 3RWUA 4MLHA 1F0MA 4RU2A 1KQSM 2HF4A 1DGKN 3F73A 2K2PA 2A42A 4M42A 2RQMA 2XNQA 4BC4A 5ETQA 3HTVA 3HOTA 3OTDA 5BPLA 5KRSA 2PFQA 4XA5A 2D0BA 1FDBA 3CE8A 1UA0A 5GMDA 1XC3A 4ES1A 5JVHL 3ZX2A 1TKTA 2KVIA 1RLCL 1GLFO 3SI8A 2AIRB 3PHEA 1HBOA 4LF7F 1M5HA 2GWJA 3QIPA 2Z0GA 3FE1A 5HLFA 1WDDA 3CEDA 3D2FA 2Q1NA 4OL8A 3CXCM 4DL7A 4P2MA 7FD1A 4CJRA 1YRXA 1SL1A 5ALFA 2W8KA 4J9QA 5CE3A 3L5KA 4JI0J 5ALMA 3N7RC 4ANEA 9ICJA 1BI4B 4YEAA 4M7XA 4WCEQ 2DPNA 3FBBA 3HMJG 4KBOA 3CJBA 3M8WA 3UE5A 2ASDA 3HO1A 1KCFA 5FRMA 1S3XA 1FNOA 1S1UB 2OWOA 3DYAA 1ZQBA 3BR8A 5IIMA 4BHQA 5C2CA 1RWUA 4F26A 1DTQA 3OV7A 4JI6J 1KW4A 8ICEA 3QYYA 3TEHB 2BM0A 3BS9A 2LVWA 5KFDA 2MUTB 3D3CJ 4Z6EA 4ZLJA 3TKAA 3H2LA 4DV2J 2XMUA 3F2KA 2HFUA 3GE1A 1UWBB 1FRJA 4JKDA 5CHCB 1Z00A 3JPRA 2BPCA 3CJ1A 1JLGA 3MDAA 1RA7A 4PHAA 3KJQB 1R8BA 5KI6A 1UCNA 4RBUA 4LFCJ 2CUYA 4FDFA 2R8KA 3BH7B 2F4VF 3BS5B 4LQ9A 1BISA 2P1JA 2G0IA 3FQLA 2Z1IA 5C0YA 3C6AA 3B82A 2FSJA 2LMRA 1LEOA 2P9GA 3P4UB 3M8RA 3L09A 1U1LA 3MPUB 2HK3A 2BA9A 4G6VB 4RUCA 3ZSRA 1RKIA 4JI5F 3N28A 3OYNA 3JS9A 3DGPB 3TADC 4OKEA 4DPOA 3SQ1A 2DTUA 1PYOB 1SS6A 3AXMA 2JMGA 2RIJA 1JLAA 4GVMA 3UXOA 3VAHA 2UXCJ 4KITB 4GKJJ 3MPYA 1X0PA 4KLTA 2VODA 5C10A 2OZSA 5KAKA 1CS4A 1GMUA 4ZKAA 3N4PA 4XH1A 2G0CA 4P0QB 5BJRA 2GEMA 3VQ7A 3RZAA 2CKWA 3BPSP 3U1LA 4LF4K 3TZWA 1N48A 5IXUA 5A8WA 1U4BA 2OSRA 1RT5A 2JJ4D 4Z4HA 2PI5A 1DY3A 2XY6A 4O3QA 1QZ5A 4ZVTB 2CADA 4RQ6A 1MA7A 1FXRA 3IMXA 2NR0A 1XO0A 4WJBA 2BCRA 2P66A 4MFAA 5AI6A 2CPXA 2QSFA 4F5OA 2YTCA 2DNMA 4LF8J 3V4MA 1FJGF 1U1MA 1NK0A 1QTMA 1N5YB 4LF1A 4WQ5C 2B8PA 2XWXA 2P6TA 4EK2A 3MEEA 3TFRA 1V4TA 4I68A 2MMYA 1TKTB 4ICLA 4FJJA 2YMQA 1RISA 3V7JA 3TJ9A 3ADAC 3K59A 4H0YB 4ZOSA 1FKOB 3QIPB 3H5XA 3AOCA 1IKXA 5HLFB 2HFOA 3D2FB 2W2OP 2CQGA 2FPLA 1V38A 2HNDA 2CA9A 5AXNA 5EOYA 1RHJB 4BVPA 3KBBA 1EKRA 5C7PA 1S6OA 3N4QA 1KFTA 1OYEA 3AVHA 3BV8A 1UVNA 3JAMY 1M1GA 2G09A 1RBUA 4R66A 5E3QA 1U49A 1HA1A 4ECVA 3VQTA 4CIFA 3M8ZA 2OPRA 3T9NA 2DNNA 3O2IA 1TL7B 3L2UA 3K75D 2IMWP 2CGKA 4FWMA 3DYAB 1ELOA 5J1EA 5I4MA 2ERRA 5HRNA 2ZBCA 1YTAA 1BLUA 4EEKA 3D67A 1TFWA 1DTQB 4RW9A 1HWIA 1O13A 3NP5A 2QZ8A 2WBNA 3MMAA 1VCTA 4I6MB 1FVSA 1Y00A 4GFJA 4KKOA 4QS7A 3IKMA 4P10A 3LOUA 4AHUA 4QBUA 2E1CA 2RVJA 3AY9A 2G0JA 3K9KA 1Z00B 4X4RA 5KG5A 1NJWA 3OBIA 4BWMA 1S12A 4HDHA 4MT1A 1JLGB 3V4IA 4Z4CA 3TR8A 3MCNA 2ZZNA 3NDKA 3HDSA 1XR7A 1VJQA 4IQXA 3GV5B 3VERA 5J1NA 3SBTA 4RWWA 1NGEA 2FBXA 4EHTA 2BXJA 4WFNL 3BKTA 4OPAA 2P9PA 2QMWA 3PW0A 3MEDA 1KP6A 4QIGA 1U09A 2E6MA 3V1RA 4JYAF 4J9UE 2ZTDA 1JLAB 1ASWA 1EARA 4CHNA 3H8YA 4DMNA 1NOYA 1LOUA 2Y0BB 3O5BA 4ECXA 6FD1A 3B6PA 3D6FB 1CS4B 2ZUAA 1P8ZA 1IVZA 1KONA 4OZ5A 4W5OA 2EK1A 3PJXA 3IM9A 2B9YA 4AQYK 4QWEA 3OXGA 1QAJA 3GV7B 2H5XA 4C97A 1U0HA 5A8WB 4I2BA 1P1LA 1RT5B 2AYMA 2GQQA 2V67A 5M1KA 1EJ7L 2XY7A 5DZ7A 3CCQS 1FI4A 5KFQA 5GAGP 4F04B 1MNEA 2E1FA 2ZOMA 4FJNA 1IJJA 1OH8A 3NS1A 4USIA 7AT1B 4PG8A 4PQAA 4E2FB 3M8QA 3OYEA 2ZJAA 4LSNA 4Q7AA 1Z05A 2R9LA 4LF7J 9ICIA 3OYIA 2OI2A 4JI4F 2FPKA 3MM9B 3AAQA 3MAAA 3RBDA 1UPHA 5DBAA 4CZGA 3IM8A 4ILRA 1S9FA 2PMHA 4CO0A 3HSDA 4LF5F 2XCPA 3ELHA 8ICOA 4ED4A 4JI2F 5J8YA 2KL8A 4LF2A 3MEEB 4B3TF 3IUCA 5D4LA 3NWGA 4JYAK 4ICLB 3PFEA 2NRTA 4BROA 2XMKA 2L9DA 4YR2A 2MQNA 1SC6A 2V5HG 4NCAA 3VETA 1CJUB 2RRAA 1IKXB 4IQUA 3R3LA 9ICPA 1Z6RA 4M5IA 3X3UA 1JMTA 2HNDB 2F1FA 4ZPDA 3NMRA 2WOMA 3I5AA 3TA0A 5ALWA 3HLUA 1NU4A 2Z57B 1Y9OA 2BVZA 5ADZA 4B1UB 1FT8A 3GP9A 5F0WA 1WTFA 3KZXA 1MQ2A 3PNCA 2B4JA 2WTUA 1ZBTA 2OPRB 2IS3A 1C0UA 5CXTA 3SCXA 1ZQYA 5J1EB 4DZ6A 1V85A 3I82A 4JI4K 4X4UA 4RW9B 4X4VA 4F4ZA 3D2NA 2I0XA 3VQSA 2F4VJ 5KPTA 4CNZA 2QGFB 1G99A 3G10A 2FVSA 3WK5A 4DLGA 4LF5K 1Y10A 4NLUA 2NYVA 1KR4A 3O4NA 4JI2K 3G71N 4DR1F 2E1AA 1S0MA 3PIPL 1ZJNA 4FJ5A 3O9TA 3OYHA 1Q82T 4QPXA 2ZDPA 2B4PA 4JI5J 4CJ4A 3V4IB 1WEZA 1NDLA 1SV0A 3MM8A 4LH4A 2Z58B 1TFYA 4ANDA 4FBUA 2UU9K 1SB3C 1FX2A 3J81O 3SMPA 4DR7K 2PE8A 3GU0A 4QCLA 3HJVA 4FOIA 2WBMA 3SQ2A 1VSKA 2J9CA 2DXFA 4B3OA 5M1FA 2M52A 2P9PB 5ADXH 2ZZMA 1PJ6A 3U27A 2C2DA 4X64K 2WAQC 3UXPA 3RFAA 3L4QA 2MKKA 1GOCA 4N41A 5GAEU 1HBUB 2BJ7A 2B43A 2Y0SC 1NK5A 4KB7A 1IKVB 4NZ7A 1B7YB 4B1ZA 4R8UA 4DQQA 2VICA 2ASLA 1T03B 4AH9A 4DR1K 5A2QU 1U0HB 1Q8IA 4FZNA 1FJGJ 3OTOK 5LJWA 2YMPA 4RQ8A 1RUSA 1Q53A 1RT7A 4U9RA 3JPOA 1GLCG 4OI1A 3HVTA 4B8CA 2DB1A 4GRSA 1YBAA 3S8SA 4PY5A 5EE0A 3M8QB 4US8A 4IWVA 1WF0A 1VSFA 3M7DA 3EMTA 4KLUA 3J80Y 2NPIA 1RYRA 3NBPB 4PWDA 2DTJA 2XYHB 1UVKA 2KIVA 2MEWA 2E5GA 2VA8A 2HMXA 3LM9A 4KPCA 2M88A 2E2NA 3R5AA 4NLCA 3MTJA 3MBYA 2OIHA 5AQNA 3ITHB 2LEAA 1NRKA 2HVEA 1KD1T 3KNAA 3ZSXA 2FJAB 3OS2A 3HWTA 5CZXA 4AHSA 2YQ0A 4ZJQA 5J2MA 2JEJA 3KHYA 4QZIA 3CPWM 4JBCA 3RBEA 4OJRA 3TSQA 4DX7A 5JMVA 1AUDA 2WOMB 5D15A 1PAUB 2I5JA 5KG3A 4TY8A 1NLVA 2F63A 3IMQJ 4FW1A 4JS5A 2DGZA 4OYIA 3CC4S 4K5RA 4C1NI 4K2XA 1YJWS 4UZBA 4W5TA 5DETA 3V9ZA 1SZ2A 2M70A 1RDFA 2WTFA 3AEVA 3AGRA 3CT9A 4DPWA 1TVRA 3KWIA 1C0UB 4ZOHC 3NG8A 2Q97A 3LANA 1RGIA 1QAYA 7ICTA 2BHNA 3HP9A 1DQ9A 3PRDA 2JLGA 3ZZRA 5EWEA 4DR3K 3DOMB 4NV0A 2PFFB 2IGIA 5CHGA 1OW5A 1VBXA 3AH6A 5JS1A 3VEYA 3FFIA 5IT9O 2H3VA 1UFWA 4F4XA 1NSAA 4IEEA 4NL5A 1N2XA 1U45A 3CFOA 3R6GB 5AKIA 3MM8B 1RE1B 1IJEB 3BSNA 1W7AA 4TYAA 4E7KA 3B8AX 4JYAJ 3EXYA 1WSVA 1L3SA 3X1LB 4LF9K 4AP9A 5AK5A 1N0VC 1FNXH 4MQ3A 3NS5A 5CD4A 1FFSB 1CPZA 3AV9A 1SH0A 3S9HA 2BJEA 3Q2TC 4Y2AA 3C28A 5EUHA 4E1JA 2EAMA 2CZ4A 1CRXA 4IH5A 2D0CA 3VQ8A 7ICVA 3THVA 2MZRA 4EWTA 2HURA 4BUGA 4A59A 4ZA1A 4DCOB 2ZH1A 5HO4A 2ROGA 5HL7L 2C2EA 3PHTA 1GLLO 3M1YA 3QT6A 3HULA 5BXIA 4M9HA 4R8UB 2HCFA 4M9JA 4M8LA 3TNVA 5EX0A 3Q83A 4JI4J 4OJHA 3TABA 3W9JA 2WHOA 3ZDDA 4O3RA 4YOXA 1HNIB 4L73A 2HQDA 4UT4A 4LF5J 4JNEA 3GYXB 1N34K 3I8DA 2OMOA 4JI2J 4IQWA 4CRXA 3HVTB 4B3TJ 1XNQF 7ICUA 3K57A 3BR9A 4NPOA 1EQMA 2W9MA 2J6SA 5LMUF 2UU9J 5EGYA 4PWDB 4AF1A 3C6UB 4A2BA 1HD1A 4FFDA 3SFGA 3K8VA 3ZDCA 3SV4A 2V2KA 4EP5A 4KI4A 4M5KA 1MW7A 3Q8SB 4QZHA 3R5DA 2FJDB 4UAWA 1UETA 1NU0A 3FK4A 1PC5A 4U7UK 3PSPA 1CI4A 5IIKA 4DV7F 4GC7A 1I3OB 2XHCA 3FBEA 1WC3A 3OTCA 1VQ7N 2CPEA 5J2MB 1B4SA 1WF2A 3FBCA 5AFUA 5KT3A 5B0AA 3QBCA 4O0IA 4M3ZA 3GJQB 3AQEA 2MLYA 2ZH9A 4FLUA 1PVPA 2I5JB 5LMNK 4BVOA 2EVZA 4TY8B 1ZXOA 4NA3A 1WBBA 5AQKA 2ADCA 3CCSS 1SV4A 3LPEA 4CLYA 2NRRA 1AA1B 3U1MA 2KN7A 2W11A 4CK2A 1RKJA 2H1YA 5J2DA 4DR1J 3QMLA 2GIQA 3R1XA 2QWOA 3NGTA 1TVRB 4LY7A 2B0CA 3VVUA 4BC2A 4RZRA 3WUHA 1GTEA 4JP8A 1ZBUA 2A1RA 3A2FA 3G25A 2XM3A 3P38A 3EKUA 2ALZA 4LSLB 3NL0A 5AKHA 4FWPA 2X7IA 1VI7A 2QW9A 2XTJP 3SIPB 1KLMA 2FY1A 3FFIB 1SJRA 4C8OA 4HHJA 5CR0A 1T4GA 1SKUB 2PEHA 4DKWA 1ESVA 4DV7K 3U7JA 4B3MF 4RCHA 4GXKA 4Z6CA 4HKQA 3BDPA 4FWKA 4CJKA 5BREA 2DRBA 5GAHP 2AMCB 2XSFA 2FJEB 4X4NA 3JTNA 2DNPA 2PA3A 1R43A 1N32F 4KY3A 1NDCA 2D9PA 3US5A 1S1XB 2G0AA 2ZUBA 1S59A 3A8KA 5AKEA 1O6XA 4NYZA 2QC3A 3L4BC 3H59A 2BBEA 5E3AA 3CJ7A 2YX4A 3NVWA 1X4BA 4RPYA 4M95A 4GVLA 4DCCA 3PY8A 4J5OA 1SJ4P 4JV0A 3DLLL 4UY85 3K58A 3TAEA 4NWBA 4ZPAA 4PKDB 1M90O 4B3RK 5ETNA 4CNQA 2AQ0A 4Y65A 1WN7A 1FE0A 4Y2SA 2H3QA 1S76D 4F36A 2J0XA 1SIZA 1B7FA 5K4LA 3OHRA 5AJ3F 1REGX 5HQLA 4DZDA 1JLBA 2PFDA 3MOZA 1RBTA 4YOTA 1N52B 4FSVA 5TKYA 4OI3A 3K8WA 2V2ZA 1QHAA 4DR3J 4JV2A 3FNNA 3VQEA 3AO4A 2PT0A 5JICA 4KIAA 2AQ4A 4B3MK 5ALXA 3BZKA 3NCQA 5FLXY 5HATA 5BRHA 1WKKA 2JOQA 1JCFA 4FLYA 5K14A 5DG8A 1KVKA 3I76A 8RUCA 4HH1A 2KICA 3CJRA 2JX2A 2O4IA 2NZTA 5HR7A 2PBDA 2ZM6F 2KHOA 3GYNA 5J2GA 4CEZA 1F2GA 1MMNA 2ZITA 3THWA 1QQOA 3TP2A 1IG8A 1LKZA 2O8EA 3CF5Q 4Y2UA 2KDOA 3MUMP 2ZBPA 3C5FA 3U1NA 1Z25A 3PMNA 2MQ8A 3NOGA 1RACB 2DY4A 2NRXA 3EO3A 3DRPA 1VSDA 3KLHB 1LW2A 1URJA 2KMDA 4YMNA 1MWZA 2D4WA 2E5LK 2ATLA 4C4RA 2FDNA 3HZGA 3MEGA 4PPDA 5CQGA 3EZOA 1KQQA 1U2FA 4OHVA 3QE9Y 4WKYA 2K60A 3FQKA 5BR8F 3TX8A 4E98A 1CLFA 1V3RA 1Y88A 1KAZA 3QUCA 2MB0B 3G4SS 9ICOA 2J6UA 3RH6A 4OHXA 4DSLA 3NGDA 1SL0A 4I2GA 1WEYA 4J91A 2Z2YB 4DUTA 2YWHA 1MWMA 1ZQEA 5HSPA 3MCSA 3CHWA 4FVUA 3NGUA 2BTFA 2KW4A 1TAMA 3N6LA 1OY6A 1JKHA 2QA4S 4L3NA 2EWHA 3EGWB 3T5HA 5KFRA 1TK5A 2FI1A 1KLMB 4CZLA 1HNZK 1W26A 4C80A 2LYAA 3FZBA 3BM7A 4BJQA 3SENA 1R6VA 4P2XA 4X65F 2GZOA 9ICFA 4MN4C 2MY8A 1J6ZA 3A5MC 2XZDB 4P6QA 2NLXA 3CCUN 1N33K 4Y2XA 1DJ0A 4Y34A 1HQUB 4YOYA 8ICQA 1WC5A 2HNYA 4BS2A 3WQUA 2DPIA 4U96A 3AHPA 3F9MA 4QJFB 4ZVPB 1EHWA 4PEOA 3G86A 2ZF5O 2DGQA 5D6GA 1HNXF 1VRUA 5B8HA 3GU3A 1YJVA 2D74B 1BHLA 1X4CA 4RUHA 3RR8A 3ZI4A 1E6VA 3Q8QB 1GT8A 2OTJS 4YQWA 3HHLA 5ALLA 2MA1A 5KFCA 2G2OA 5J0PA 1S10A 3G6XA 3VALA 3RH5A 2RHQB 4BRNA 1O5JA 1ZM9A 5F8NA 2KV2A 2HHHK 5A76A 5LMUJ 1JLBB 2EFVA 1X5SA 3QEAZ 2VJ4A 3H46O 1S57A 1CZBA 2MKCA 2IVMA 1G7CB 1GQEA 4C2MA 2BE2A 5FDLA 3CD5A 2Z1GA 3ATUA 5LSLA 1Z19A 3CD6S 9ICXA 2WZ1A 2VC0A 4DV7J 5K14B 4DV5K 4YB6A 3GR1A 5JLFA 1RT1B 3R2DJ 8ICPA 1K8AT 1NH8A 2RQKA 2R8HA 1NKBA 3PDNA 2QO3A 4W4MA 3ZSVA 4FZLA 3ICXA 4IDKB 4UBBA 3P5JA 3THWB 1LAVA 3EJMA 5MLCQ 3VAKA 5J2JA 5F8MA 3NNCA 3HT3A 1D8YA 2ZE2A 4IR9A 2O8EB 2EH9A 2DQNB 5D4PA 4UF4A 3JS6A 4OHZA 1A7GE 3IM1A 1EKSA 1IR1A 4M04A 4NASA 5AQFA 2XIDA 1X31C 3DRPB 1F5AA 3CJ3A 1LW2B 2E7XA 4LD0A 3PJ9A 4DS4A 1KTVA 4GC6A 2IOFK 1G1XA 5JLHA 4C3KA 2EPIA 3CCRS 3MM5A 3MCAB 2UV8A 5RUBA 3ENOA 2YNIA 3UCUP 3D66A 4H0VB 1KVIA 1JUDA 2CH6A 1SAZA 4DQ8A 3DXMA 3IRXB 5IS2A 4ERDA 5ALIA 2RAQA 2X6SA 2QEXN 2OJ3A 2E5HA 3NKYA 2DXEA 2VWBA 2QB1A 1TL4A 2FJBB 3H7IA 4B3MJ 4ER8A 3RRGA 2FPMA 1RCHA 1OWXA 2FLPA 4L3QA 3OW2M 1V5VA 3CQYA 3C21A 3LDPA 3CIZA 4A8MP 4LBHA 4KGVB 3OR1A 1N32J 3AA2A 4NCGA 4Q43A 1JKHB 1PO6A 5EX5A 4NLBA 3OR2A 5CYMB 2MQPA 3N01A 3AA5X 1HEKA 3AAPA 3F44A 3TJ8A 2AJ2A 1S1TA 3DN9A 2HNZA 5D4OA 1U0SA 2KH9A 1RHQB 1RHRB 4A8XA 1BC6A 1S72S 4HCCA 5KFGA 1WHVA 2HNYB 3O08A 1V9OA 3P83D 2IA0A 2W9CA 2VV5A 3RW7A 4DX8H 3HPGA 2M0GB 3F2BA 3G6EN 1Q95G 1EIYB 3AB2B 1VRUB 2MQLA 2H3FA 4UAZA 1RTDA 2E5LJ 3N4MB 1N8RO 3T5JA 2K4PA 4I2CA 3DLHA 1UJ5A 1SQKA 1TFRA 3D6MB 1E6VB 3WK4A 2ISOA 2QWPA 3DRRB 3HHLB 2I5HA 5MLCV 2PMZD 1TUUA 4HH0A 2IOCA 5FP0A 1KC8T 1PBUA 4K7QA 2RDJA 3SZ2A 2KG5A 3UR3C 1IQTA 4RBTA 1FRLA 4C8NA 2RF2A 1DLOA 1IXKA 3BS7A 4NXNF 4DTRA 3AU2A 3MECA 5A0LA 1WI8A 2OPQA 2VQEF 1RCXB 1ZQVA 4KN4A 3G8QA 1GX5A 4FXDA 3QWUA 2BKNA 3FZMA 3H0MB 2ZM6J 1QM9A 5FDLB 5D8HB 2LYVA 4OFZA 2E3TA 4XEIA 1HNWK 3QGPA 3LAMA 4PUOA 3LO3A 4F5QA 2YJFA 3A8JA 4GMKA 3QWPA 1YKWA 4EEYA 2BPFA 2DR7A 4NLPA 3M6XA 4FLTA 8ATCB 1JLQA 1VQNS 4M63C 3QYPA 4FM0A 2DNLA 3H8JA 4EENA 1GK8A 3VVTA 4I64A 1AFJA 3B78A 5LOQA 3QJLA 3DMJA 2HRUA 2OUGA 2ZE2B 2ZNYA 1HWLA 5DMRA 3VPZA 4ALZA 2CG8A 3LA0A 1S5JA 2QXLA 4ED8A 1SV0C 5JVHQ 4F2RA 4FWSA 4DQPA 3IN5A 1VQMS 1YIJN 4YY3K 5KAIU 3SEOA 3HKZF 5AQZA 1SPBP 3WEEB 4R5PA 3J81j 3CJAA 3M30B 3BQ2A 3R9KA 2W24A 1J2NA 3SMZA 2MHNA 3MM5B 2VQEK 3THTA 5EHHA 3G8TA 2KKHA 4CBUA 2YNIB 2PZSA 3L6QA 1C1BA 3DXMB 1NK4A 4PG5A 3DEEA 3WKBA 4RNMA 4I9LA 4QZEA 1JL1A 2JWNA 3MDFA 3HSGA 4FLVA 3AVBA 2OO4A 5KG0A 1LFWA 1N4LA 3BYRA 1NHVA 3C95A 4BRQA 2UUCK 4DI6A 4PG7A 2KFNA 2P9NA 4OIXA 4CZKA 1Q81O 1N5TA 1KQGB 1XK8A 2JVRA 3MR2A 3F53A 4RPFA 1Q46A 2AZ1A 3EN9A 4NCGB 4LBPA 4DLEA 1WACA 1X1PA 3NVKA 1YJ9S 5B66U 3OR2B 1UFKA 4Y1CA 3JQJA 2I7PA 3CMES 2QARA 2I7NA 2V69A 4OVLA 5KFMA 1J5EF 1S1TB 1VC0A 3KG0A 2FPHX 1NOMA 2P8IA 4ZPVR 2R2SA 4OZ1A 3N79A 1M5KC 2NXEA 4C7QA 1ZXIA 4IQMA 4LRFA 4ITSA 3M6WA 5IIOA 9ICGA 2GWKA 4LJXA 4HR2A 3O1WA 3GIMA 4EX7A 2XRIA 2MU2A 3MXHP 2W7OA 5DGBA 4LRAA 4NRUA 2ZH4A 3W8PA 3RMBA 1B99A 2AYGA 1QQNA 1RTDB 3K17A 3BPDA 2HRYA 3V9UA 1NCLA 1OSDA 3NUQA 5AM0A 4URQU 3UNGC 4K5SA 3GSDA 5HBMA 1BOTO 4FVCA 1H98A 2NREA 5E84A 4G9BA 4BR2A 5HNKA 5BOMA 2R7XA 3LALA 4HLBA 4KBIA 5J0QA 3O8MA 2HKEA 3U9DA 3SI6A 3R8EA 2IOFA 2RF2B 3I56N 1DLOB 2DHSA 3MGJA 7ICIA 3IRUA 3MECB 3O1LA 1B92A 2OPQB 2IBOA 4DU7A 4YDUA 5DM7L 1BPDA 5AQOA 3MMJA 3JSBA 2OHFA 3RG6A 4F3MA 4IDHA 3OYBA 2GUPA 2BV3A 4OJ6A 2CQHA 2AZ3A 5IV3A 3WNFA 8ICUA 3SMVA 1IBMF 2DRDA 4C8LA 1LW0A 4PUOB 3KK7A 3C2LA 2HZAA 1S97A 1HUZA 5KFZA 4YFUA 4N47A 3PSIA 3VEVA 2F1HA 2BCSA 5D78A 3THXA 5HMXA 2R2TA 4CGJA 4I2IA 4KN7A 1ZQGA 5LXRA 1S7IA 1JLQB 8ICNA 2L5YA 2F96A 1NSKL 4DF4A 4AYBC 1YI2S 3KUHA 4CZMA 5ALPA 3H8WA 3DMJB 1ZD5A 1ZRNA 3OL7A 3K2PA 3TAPA 3V9WA 4IFVA 3M2RA 3C66A 5BPMA 2DD8S 3SQ0A 2F8EX 4LFAK 4QS9A 2VD3A 4E1NA 1PYSB 4BXOB 2JZ5A 1Q3UA 2CG4A 4HI2A 1S6PB 2W25A 5I3PA 4F9OA 2Q0RA 2GJ2A 2A6AA 5IIIA 5ALKA 5ALNA 1OJ4A 2GS8A 4X84A 1H74A 3B6BA 4QIWD 1RDAA 3ULDA 3QMQA 1GAOA 2NUBA 4UB6U 1RSCA 4CJ5A 4EYIB 2DR8A 4WFBL 4WQ4A 2ZOGA 3A5OC 2GGPA 4DU1A 3EE9A 3B0XA 4P2HA 3VQ4A 2C2OB 2A10A 3QQCD 2QLJB 2DVIA 3VQ5A 2Q36A 3R7NB 4NOHA 2G8IA 1IIPA 1HNWJ 1MMLA 2P9NB 2UUAF 4CFDA 2PDAA 3C46A 2E8MA 1XSLA 4A8OA 2CJBA 4P7TA 1PZNA 2CQIA 4FK0A 1P90A 3O3FA 1T44A 4M7YA 4CCHA 2RT3A 2KP7A 4DV3F 4QZCA 3PRVA 1M5OC 1ZQDA 1GMWA 2W01A 4ZHRA 1EP4A 4J37A 2HLUA 2QARB 5TISU 2HVDA 5EWFA 2LFVA 4FJMA 2Q43A 1VQ5N 2VANA 1GLDG 4OJLA 4EO8A 3TTCA 2ZIWB 4NRTA 3BBCA 2RUGA 1ZAXA 1KDHA 3ZNUA 4CE6A 1RT4A 3VOVA 5BRDA 4H5NA 1SJ1A 3OS0A 1DHMA 2IDOA 2W9BB 1WSRA 2LDIA 4RR5A 4EUVA 4OKKA 1ZQMA 1HBMB 3JSMB 5AT1B 4UATA 5HP1A 2WUSA 4KT0C 4CVNE 1UL3A 1NK7A 3G2XA 1VSMA 2G8VA 2M7SA 3R6LB 3PO5A 2VQEJ 5HBMB 2ZIVA 3ALYA 1R0BG 2VKQA 4WFNQ 3C2KA 4MK8A 1UPMB 2HWHA 3C3LA 4H8KA 4M5NA 4PL1A 2UUAK 3P1GA 3VAJA 2XLJA 5AI5A 2UUCJ 4Y3CA 3D0GE 2HFNA 4QR2A 4BRIA 4DV3K 3AM9A 1UZHA 3AA4A 3BQ7A 1CJKA 1TKDA 3I31A 3E9PA 3CWJA 4FO0A 4NO7A 3BN4A 2KTQA 2R3VA 4KLIA 3CJQA 5KRTA 4DR5F 1LW0B 1X9XA 1XERA 5D77A 2QK9A 4FF1A 3IG1A 2LPEA 2KXHA 3OVSA 1XSPA 3WNEA 1WC1A 2A1BA 5KFKA 3THXB 1W25A 4OPKA 2EDUA 5DLGA 1C1CA 1RK8A 1XN9A 1UP1A 1CXUA 4A46A 4KLEA 4CHOA 3N7SC 1U9LA 4FJKA 2PKEA 1QQ6A 4HT5A 4JI1K 1FDNA 5EXWA 3OS1A 3M2RB 2AA4A 3HILA 3WNGA 3IP4B 1N5XA 3AJDA 3JAMO 3WX4A 4YOWA 4FPRA 1IO2A 4GVBB 2W6LA 4KLSA 3BGLA 4CLUA 4A8FA 1Z1VA 3K5NA 4M3RA 4LMZA 3C1ZA 4BE1A 5H1SQ 5KFOA 4HVJA 5EE9A 3EPIA 4M1KA 4A61A 2OYYA 1JXEA 2GVDB 3N5FA 7ICFA 1X6IA 4O3NA 4QPTA 2B9WA 4ZVHA 2GGPB 3CULA 2QYGA 3BKUA 2UXDF 4JKCA 4H5VA 4E8UA 4YMMA 3KWGA 4Y28C 4ZS6A 2H3ZA 1RDDA 2F8HA 3PIOL 2P9LA 3MMBB 1YITS 5BPCA 4CEOA 2KJVA 5HRPA 3MPDA 2D7SA 3FR0A 4CZJA 1H72C 2FC8A 3HVRA 4ZHRB 1EP4B 1HLUA 5L1JA 2QB0A 2E2PA 3D45A 1T9TA 3H8MA 2B4VA 4MLEA 3TPQA 2HFVA 1VHIA 3PIPQ 2CPFA 2FBTA 4X4TA 4OYZA 3ISDA 3PYGA 3CMQA 3ZZZA 2NYHA 2FE9A 1IQZA 2JFKA 4LFAJ 4G1PA 3TUZC 2F8LA 3UDEA 5M1QA 3Q2SC 5DGAA 2K1RA 4NLSA 2IM3A 3OVNA 1RG6A 4DR6F 5HP1B 1PVQA 4UB2A 2VYPA 5KT2A 4O23A 3LZIA 5ALYA 3NAEA 2DKOB 2OFGX 4CTAA 1U8WA 1K47A 2VC1A 4ZP6A 3L2WA 2DCUB 3A8IA 3MXIA 3K89A 3S6JA 3FEYB 2QA1A 4DBQA 3NS7B 2FY8A 4IBNA 3RRHA 4K4UA 2ZIVB 3ISBA 2ZQBA 3AVGA 3MCMA 2XO7A 3M1VA 4KH0B 4YORA 1XQIA 4CD1A 4QAGA 5GIPA 1IBMJ 4NEZA 3P5TL 5J0UA 3KHGA 2FUG9 5J0TA 3DI6A 3WK9A 4IRDA 1OH6A 3RYLA 1JQGA 2RRDA 5IILA 3TVYA 1ATRA 2ZH2A 5IV4A 2QI2A 2MKYA 3OT9A 5H1SV 1CJKB 4OJPA 3SNNA 1S0VA 4WFYA 2VPXB 5AQPA 3ZT0A 2L48A 1PG5B 4P52A 5HI7A 1O0PA 1K5OA 4RJVA 2WF9A 4WIQA 3QU4A 4E0DA 5AZJA 1TV6A 1VQSA 4QR0A 2NLWA 3QIOA 2Z1HA 3IG1B 3CYMA 3VCBA 3VR1A 2BKEA 2BACA 2GLEA 5ALEA 4CO3A 2DGWA 5DB9A 1RDWX 3BDEA 2UUBK 4CIGA 2CJKA 3ISND 2O4GA 3FBFA 3RB3A 3KG1A 1ZAVA 3Q0AA 2RB7A 1OMSA 3UB5A 1Q16B 3R2CJ 1WWVA 4K4XA 1HPZA 1O51A 5J0XA 4FYVB 2KD1A 3LUYA 1MN9A 1TYQA 3OL8A 1XTZA 1R0CB 3HYFA 1S9GA 4LFBK 2W3SA 2FXUA 3ISZA 4CI6A 4MK7A 2DNRA 2WW4A 1QH9A 5HANA 1QQ7A 4PHPA 2YV0X 3MDCA 1LK5A 4RQ5A 2UUAJ 5M1OA 3TADA 4F3OA 4OV1A 4AM6A 1YJRA 2LYBA 1UVIA 1RI7A 2WAQF 5CHIA 4B9NA 2E1RA 5ETVA 4KC5A 4AL5A 1DGJA 4DV3J 1CJTA 4M9NA 3J7ZT 2QMUB 2CPRA 2EI5A 3OUYA 4NX9A 3R97A 5A0YA 3W5XA 3J80U 5ADXA 3UVJA 5H9EJ 1BL3A 3NVMA 2K7KA 2P9LB 4USWA 2Q79A 1IWGA 4OLBA 5AQVA 2MKJA 1E4FT 1Z26A 1Z2LA 3VGSA 1IM6A 1ZQNA 2IIRA 5AXLA 4QR1A 1QQCA 2VOOA 3RB6A 3D7EO 4RPXA 2B9XA 4YMEA 1HI8A 3BGFA 3UN2A 2QB0B 4CLWA 4CW7B 4PH5A 1WD6A 2ZWHA 4JI1J 3G9CA 4RQ4A 4ILHA 5LL6d 4GVEA 2VQFF 4IC9A 3SAGA 1XQSC 2HQCA 4DO9A 5DJBA 1T02A 1D5AA 2VG6A 2P9KB 3AVMA 4N7TA 2E20A 1RCOB 2CPDA 2CJQA 9RUBA 2ZZTA 4I29A 4KLGA 2K1RB 2UXBK 5GAHI 1LWEA 1RJJA 4ED2A 4M5JA 2ZUGA 4USTA 1PK1A 4CTAB 4DV1F 3U4LA 4O3PA 3H0PA 4OI0A 3S01A 4I2PA 1N61A 2RS2A 2H3GX 4EAHD 2XG8A 4DX5A 1ECWA 1ACMB 3AVFA 3HFZB 3M1VB 3IBWA 1P9QC 4DR5J 3WK7A 3QT8A 3DI6B 3I5BA 1ZQTA 3QIDA 5KT7A 1YVUA 1EO1A 3CCMS 4DL5A 2OTLN 2AX0A 1PGZA 4UB8U 3O3GA 4QS8A 5HL7Q 4DOCA 3ZTRA 3J80O 4ID1A 2KE7A 3M6KA 2F3JA 3FMBA 3E1YA 1X9MA 1YVFA 3D3BJ 3RJKA 4BRFA 3HFVA 4UB3A 2MLXA 5DDYA 1TV6B 2QSWA 2YNGA 1LKYB 2MZTA 2ZWPA 2K06A 2VQFK 4IH7A 1NZAA 3UM9A 4I6WA 2V50A 4XQ8A 2HF3A 3GLJA 3KLFB 2WVFA 4I2JA 4G3IA 4KPYA 1JIHA 1YF5L 3KDOA 3WHIA 1QCKA 2N3OA 3PEJA 4GMJB 4JV5K 3LGHA 4DQIA 4GLXA 3QEBZ 2VHGA 2G8UA 1F3VA 4JKGB 4J2AA 3ETMA 4ICAA 4USAA 3VZHA 1TL1A 3S3NA 2DO4A 2N1RA 5HJYA 4DV1K 3CD7A 1NJYA 3OTBA 2FVRA 4HYKA 4C0HA 3GSIA 3OBYA 2FB0A 1HPZB 1ZQFA 3L7OA 3TAMA 4DPYA 3HK2A 1NM2A 5C2GA 1AW0A 2UXDJ 3PMLA 3GFKB 1KBRA 2VU5A 3QINA 5HVFA 1QE1A 5F1XA 4DTOA 3OD2A 1MC8A 4KLDA 2CDRB 4B17A 2C42A 1JK9B 4JKHA 1BPXA 1L8LA 1OS5A 4X62F 1COOA 4C98A 2Z8QA 2ZJQL 4KHSA 2EANA 2WFAA 2KLAA 5BRFA 4PKGA 5L8RC 3JPSA 1C0TA 4JS4A 2KYZA 5AK3A 2VJ5A 1CJTB 1U1NA 2HRTA 3W5YA 1RAJA 5GAGU 3V9SA 3OUYB 3VGMA 4JUZA 3N97B 2CQCA 3KZBA 5D4BA 1Q7YT 3DU5A 2BCQA 5LM7E 3UVJB 4QU7A 4CGIA 3EW9A 5LY3A 4Y2QA 3LWMA 4FM2A 2FBVA 2KQ2A 3OJSA 2Q1LA 4AL7A 3FAHA 4FLXA 4KMUA 3M4XA 3SSRA 2HQFA 1HHSA 3GG0A 2ASMA 1GH8A 3G6VA 3CDEA 2G4BA 4BG8A 4DFKA 3AMZA 4F4WA 1NK8A 3E2EA 2LQBA 5T7LA 4F25A 5HROA 4DR6J 5B0BA 4CZEA 5AE3A 5GADP 3IXQA 4EHUA 4DR4F 2YQEA 2PXIA 3CVKA 5M1NA 3NF6A 4X4QA 2U2FA 2GHVC 5J2QA 5IOLA 3TTDA 4JRQA 2LCWA 3K5LA 4UB4A 2EFPA 5ALDA 3HW8A 2GWSA 4DFPA 2VG6B 4ZCKA 2YJEA 3TQ1A 1RXVA