1NK4A

Guanine-guanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk4A01
3LPUA 3ZT3A 1ZQZA 4E19A 4YN4A 3RJEA 4FO6A 5KG7A 1A76A 2DFHA 3RMAA 1DLOA 1U49A 2G8FA 4Z4HA 5KI6A 5J2DA 4ECTA 4KI4A 3RB0A 4Q45A 4R66A 4J9RA 5KG4A 1D8YA 4CEQA 4C8OA 3G6XA 1KFSA 4ECZA 8ICLA 3QETA 2JLEA 5EOZA 3TAEA 3OYNA 3PW0A 1MU2A 4J9PA 9ICSA 2DFEA 3GFKB 2NRXA 4ICLA 1A5XA 3Q8PB 2AGPA 4YR2A 4E0DA 4G1QA 2ZJ5A 4ED0A 2HW3A 3JPOA 3HXMA 1FKOA 1GOBA 4ECUA 9ICNA 4YP3A 4Z4IA 3TAPA 3SQ0A 5J2CA 5IIOA 2P6UA 3V9WA 3VQ4A 4FJIA 3AVCA 4KV8A 7ICOA 1RBUA 3SUPA 2AQ4A 4CK2A 2V4RA 1ZBHA 5KFOA 4ECRA 4DSKA 2VG6A 3C2KA 2W9CB 1TVAA 4BXOB 1RBRA 4O3PA 4F5OA 2UVVA 4KLTA 2GV9A 4RT3A 3VQCA 4HUGA 1ZQFA 1TAUA 1Z25A 4FLWA 1QE1A 4CHNA 2I9GA 4DU4A 3KJVA 1RPLA 1KEJA 4UBBA 5D3GA 2B5JA 2FMSA 5KFEA 2Z1JA 2RPIA 4K8ZA 2PY5A 2UVRA 3H4DA 5C5JA 8ICFA 4RU9A 4C8MA 1RT5A 2RKIA 2ZE2A 3OYCA 4HCBA 3HM9A 3RB6A 4I2QA 1HRHA 1WSEA 3AVKA 4OPKA 4Z4EA 4DOAA 2BDPA 4G3IA 4CGHA 4KLIA 2FMPA 1D9FA 2DPIA 1RILA 2W9CA 3ALYA 2YNFA 2Z1HA 2C2EA 4BXOA 3QEIA 2I5JA 1VSEA 4ED1A 4ZHRA 3TAGA 3VQQA 3SPYA 2R7YA 2ATQA 5CY4A 3KK1A 1LAVA 4UAYA 3DLEA 5IINA 4CJEA 4X5VA 4ELTA 3QINA 3P1GA 1S1XA 4PQUA 3RH4A 3NBPA 1BQMA 1ZQMA 1HYZA 4M45A 1N48A 1S0OA 5J0QA 1DTQA 2M9NA 3NH1A 5KGXA 3WNHA 4J2DA 3M9OB 3MFIA 1S0VA 3ZDEA 8ICYA 1XC9A 4FS2A 3WNGA 1YTAA 4RNMA 1S1WA 4DL3A 2ZUCA 1UA0A 4NLZA 1RDCA 2ZUDA 1H38A 4F4ZA 1RBVA 3GV7B 4FJ7A 3K59A 1B9FA 3LANA 1ZQEA 2O4GA 3LWMA 2E4LA 4DQPA 3AO2A 4IKFA 2BGWA 3RH5A 1WLJA 3DOKA 4RW6A 1ZQUA 2YNIA 4RQ5A 4MFAA 3LDAA 3H7IA 1N6QA 3KLIA 4ED7A 1QTMA 3B0YA 4O55A 3NFAA 3LP3A 3OYDA 3HL8A 3HYFA 3PO5A 1VRUA 4JV2A 1K1SA 1B92A 2DFLA 1ZJNA 1GOAA 3OS1A 4P4OA 5CR0A 3KLHA 2RF2A 3V7JA 4JK1A 4H8KA 1WSJA 5KFDA 1NJYA 4FK0A 4FW1A 4YQWA 2BCQA 1QSSA 4IRDA 4TUPA 2HNYA 1A5VA 3TFSA 4LSNA 3JPRA 1FK9A 4I2CA 1NK9A 4GVMA 4CJRA 3HW8A 4Q5VA 3RJGA 1TGOA 1JX4A 4HTUA 1S1VA 3QE9Y 1EXQA 1HPZA 4I2BA 4OVLA 3OJUA 1COOA 4RQ0A 4E7KA 3MAQA 1JIHA 1A5WA 5DB8A 1CZBA 4E7HA 1VK0A 1TL1A 2ISPA 4CF8A 2F8TA 3V9UA 1RXVA 1KLMA 3G0ZA 1G15A 4DSLA 4B9TA 3UXOA 2HMIA 2XRIA 3RB3A 1HYSA 3VQPA 2XCPA 3DMJA 4OKKA 1HUZA 4F50A 5J0UA 4YFUA 3TAMA 4CGGA 3DLHA 1IKWA 4GC7A 4PHEA 4QWEA 5DBAA 4ED3A 5EWEA 3IG1A 4F4KA 4J2EA 4BACA 4YCXA 2BCRA 1U04A 5DG8A 9ICIA 2JGUA 3VQAA 4RG8A 3AA2A 4EZ9A 4QW9A 4DL7A 4CJ3A 1N5YA 3HPGA 5KFMA 4DFJA 3SUQA 4BWJA 4XRHA 1D8LA 3MDCA 4I9LA 1XHXA 2XY5A 3JYTA 2VA8A 5CJ7A 4DOCA 4DSFA 2HHSA 1J54A 3OSPA 4RW8A 4MQ3A 3NF9A 5CHGA 1RBSA 4RW4A 4CE9A 3SYZA 4ECSA 2ZTCA 1QLNA 3DI6A 5IIJA 5J0TA 4B9LA 5L1KA 3RAXA 5KGWA 3SQ4A 4CJUA 2X6SA 1PZNA 4E3SA 4EBEA 1RYSA 4RQ8A 3NF8A 1J53A 5HNKA 3OYMA 3FFIA 3ZSRA 2OPPA 3C2MA 4KO0A 7ICPA 2VA3A 4DL4A 4DS4A 4O9MA 3OGUA 3QEPA 2UVWA 1Q8IA 3ZSWA 3TABA 4W5TA 4DQSA 2ITGA 1NJWA 3PMNA 3ZT2A 2IA6A 2UVUA 4CHPA 5HRPA 5J2AA 2P6RA 4NLGA 1JXEA 1BISA 4CEAA 5J2JA 2V9WA 3PX6A 2ATLA 2D0BA 4O3SA 3F9KA 5J2MA 3QO9A 4KFBA 4DTJA 5SZTA 3OYGA 4O5CA 8ICOA 3KK2A 4DSIA 3VA0A 5KFBA 1NK6A 4N5SA 1KCFA 4ID5A 1MQ2A 4CJTA 5CA7A 5HLFA 4IQTA 2F96A 3FDSA 4Z6CA 4R8UB 4IRCA 2C2RA 5HRSA 3QEVA 4P4MA 3IRXA 3SCXA 2PI5A 3ZSOA 4KTZA 1JMSA 4IFYA 4RW9A 1U47A 2PYJA 4PHDA 1RT7A 1XS9D 3GIMA 5KFYA 3L2VA 4CJVA 1HUOA 3MABA 4YMMA 4M2YA 4C8LA 3KHGA 1HMVA 3V9XA 3NH2A 2GUIA 3SI8A 1IKXA 3NTUA 3G6YA 4BE1A 4GXIA 5JS1A 4UQGA 2G8KA 4R63A 2PYLA 4FLYA 3RRHA 3PX0A 3I8DA 4R8UA 4FYDA 5L1JA 2IC3A 4JS4A 2C2DA 3ZSYA 3LK9A 4Z4FA 3MR5A 4F3TA 1UAXA 2RDIA 4CJSA 3QEXA 4Z6FA 1WCNA 4CK3A 1TAQA 4M6WA 1CLQA 5BOLA 3RJFA 3KKSA 4O0JA 3SJJA 9ICAA 4RUCA 4M42A 5C24A 1VSLA 4KMUA 4CF1A 3MEEA 1VSDA 4MEYA 3K2PA 4I27A 4JV0A 4Z6EA 2FC0A 4RQ1A 4FK4A 9ICWA 1NK8A 8ICIA 8ICMA 8ICVA 1A77A 4UAZA 4LZDA 4E1MA 5J2BA 1T05A 5CYQA 4JUZA 1SL2A 2J6TA 1YTUA 5FRNA 4KLLA 4B8AB 1K1QA 4F4WA 4M3YA 5FRMA 1RT2A 3ZDCA 1S6QA 2A1JB 4CGJA 1ZQTA 4FLUA 5KG3A 4CF2A 3HVRA 2PFOA 2J6SA 1WCLA 4KITB 2OWOA 4N56A 1ZQAA 4EYHB 2NRZA 1VSJA 3T3FA 4CJ5A 1B22A 2HHWA 8ICHA 1WAFA 3K4GA 1UWBA 1KFDA 1LV5A 1JKHA 3M9NB 4J9KA 2FBVA 3BGRA 3VQBA 3HO1A 1SUQA 2DPJA 1JLGA 5J0YA 2ZD1A 3RWUA 7ICQA 1CXUA 3QZ7A 3MECA 3ZT4A 3PNCA 4KHWA 3H4BA 2ZTEA 3KD1E 3RJJA 4QWBA 3M8PA 2A1JA 4NYFA 4GXKA 3HX0A 5J2EA 1ZBLA 4CHQA 1WSFA 1FKPA 3AVAA 5J2KA 3PR4A 3BQ0A 3L8BA 4M3TA 2E6MA 3LAKA 4CJFA 3JPTA 4OPJA 5DB6A 3IS9A 8ICZA 3D45A 1B9DA 1KDHA 3GILA 2Y1JA 2VA2A 1DGSA 5EWGA 3OYBA 5J2HA 4AH9A 4KLMA 5HP1A 3DRPA 4YNQA 2YHAA 1BGXT 4PPXA 2FPLA 2R8JA 4BDPA 3MXJA 7ICUA 1NOMA 3ASMA 4UB5A 3CYMA 3AVIA 4ED2A 2KZMA 3M8QA 4IFVA 3JPPA 2QKKA 4CJKA 2IS3A 3SV4A 4DMNA 1TVRA 4KHNA 4ZTFA 3C21A 1BPYA 3AVJA 4CF9A 4OLAA 3VQDA 2HNZA 5IIKA 1KFTA 5DB7A 3HT3A 4PGXA 1RTIA 1ZBFA 4C8NA 4PA1A 4DTOA 1Z26A 2W9MA 1JXLA 4JS5A 3RMDA 3KLEA 3V6DA 9ICMA 2YNGA 2ZUBA 3K5OA 3L3VA 3NGDA 3LWLA 2AGQA 1ZQRA 4Q8EA 2XY8A 3OYIA 3OYAA 3QESA 4HHTA 4W5OA 5DBCA 1RT4A 4FLXA 3MXMA 4F4YA 2BCSA 1MSWD 3B6PA 4DFKA 3RR8A 1S0MA 3JSMA 5J2IA 4FM2A 5CP2A 4DTSA 3HPOA 1I39A 4CJLA 1C1BA 1ZQWA 4DSJA 4PGYA 3T5LA 5KFCA 1RZTA 3L3UA 1EETA 4FJLA 3PW7A 1NKCA 1S9GA 4NLNA 1X9MA 4FJGA 2GWSA 1BI4B 4YG2A 4MFBA 1ZQHA 4TSXA 1S76D 4NLKA 1GOCA 4M3ZA 4QZFA 2JEJA 3VQ9A 4XA5A 4PHPA 4ED6A 1MQ3A 3U3GA 4DTMA 2Z1IA 4QZIA 4DO9A 3JPSA 4DWIA 2OPSA 3V6KA 3RMCA 5KFKA 2XGQA 5DLFA 4YXMA 3AVGA 3KTQA 2FPKA 4KREA 1HYVA 4ELVA 4EEYA 5JUMA 2LSNA 4DTUA 4R64A 1JLCA 3RH6A 1RDBA 3RJHA 3ZDDA 4QZGA 3OSNA 2ETJA 3QERA 2E6LA 1BQNA 4QZHA 4J9QA 1VSHA 4M3WA 4RQ2A 2EX3A 1BI4A 3MEGA 3S3MA 2QXFA 3ISNC 1L3TA 3TR8A 3VA3A 1ASWA 2EHGA 2QK9A 5DGAA 3OYLA 4O3QA 5DMRA 2B4JA 4P4PA 4IDKA 4DQQA 4FJKA 1XU4A 3GDXA 5L1LA 1L3SA 4OLBA 1RBTA 1EP4A 4RW7A 1KLNA 4LD0A 3O4QA 4LH4A 1CXQA 2BHNA 5DB9A 4FJNA 3ISBA 4M3UA 4FJ8A 1N56A 2QKBA 1B43A 4B9SA 4JRPA 3RJKA 4ECWA 4OGCA 4J9LA 5TZVA 4FBTA 5IIMA 4IQVA 3QNNA 3S3NA 1S77D 5C42A 5J2PA 4YR3A 3DLBA 1JL2A 2G8WA 2RN2A 3KLFA 4Y1DA 1SL1A 5BPCA 3NH0A 3NGIA 4EBDA 2FLNA 1VSKA 1C1AA 1Q9XA 5DK5A 5T7BA 4KLHA 1ZQCA 4RUAA 1UA1A 4CGDA 1AROP 3E01A 2FLPA 3C6UA 3CFOA 3AA5X 4DTNA 4DLEA 1S5JA 3Q8LA 5FDLA 4F5RA 4BGDA 2BCUA 2VG5A 3ZSVA 3H8WA 3NHGA 5HHIA 4Q43A 3QZ8A 1BL3A 3KLGA 2PI4A 2HHUA 4CEOA 5J0RA 4Z0UA 1RT3A 4ZH4A 3BJYA 3ZSQA 5CZ1A 3RBDA 1Q9YA 4CHZA 4LSLA 3T5JA 4FJ5A 1NK0A 3PUFA 1BCOA 3JPNA 4CECA 7ICFA 5HRNA 1LWCA 2W42A 2XC9A 3DRRA 4K4GA 4AILC 3IM1A 2DY4A 2YHBA 5KG0A 1NK4A 1XSPA 3ETLA 1ZQYA 4IG3A 4CFBA 3F73A 4YXJA 1TK8A 5KG5A 1L3UA 5J1EA 4DFMA 3KD5E 4QWDA 4FZYA 2AGOA 3C94A 2ISOA 5HMMA 3NF6A 4CESA 4DLGA 4CIFA 1QHTA 3AO3A 3DOLA 4CEDA 1RNHA 3H8JA 5J0OA 5JS2A 3MR3A 4YD2A 3LZIA 3ISDA 4DL2A 1JLBA 4DQRA 3AUOA 5DDYA 1RYRA 4E7IA 3AV9A 2JEFA 3GIJA 1BVSA 1QSYA 3MR6A 4FJJA 2XGPA 4IR1A 2D0CA 5J2QA 5CB1A 1T8EA 3ULDA 8ICKA 2IMWP 4R65A 3LAMA 3H08A 3CFRA 3I0RA 7ICLA 2OA8A 3IHQB 1IH7A 1TKTA 5KRTA 5KT6A 2KZZA 4RQ3A 5KFUA 1TK5A 1LWFA 2XY7A 4GC6A 4RPYA 3PW4A 9ICQA 2HB5A 3H8SA 4NCGA 5BOMA 1MC8A 2G8VA 4Z6DA 3EWAA 1T7PA 3QEAZ 4QOZB 4RNNA 4KLQA 1JN3A 3MDAA 1JLQA 3EPGA 1TV9A 4M3RA 4AHSA 4QW8A 5CWRA 5DQHA 1TKDA 2HHTA 2P51A 2BGGA 4DU1A 1WNSA 2XHBA 2VWKA 8ICJA 3LZJA 3QIPA 4CEZA 8ICWA 4MF2A 2P5GA 2KW4A 2C22A 3LALA 5D4BA 5KFTA 4RT2A 4QZEA 4HCCA 3G10A 3V7LA 4FM0A 3AU6A 3G6VA 3DRSA 2MUTB 4FBUA 4TURA 3UPQA 3HPHA 4B9MA 4O4GA 5KT5A 5DBBA 3MEDA 9ICKA 3QEBZ 4I9QA 3V9ZA 3KHLA 5KG1A 2ZQBA 3TANA 2W8LA 4W5RA 3OHAA 4MF8A 2KQ2A 4O5BA 4FXDA 4H4MA 4O3OA 2P1JA 4W5QA 1REVA 2HHXA 2OZSA 2IGIA 2PFNA 2PFQA 9ICUA 4M6WB 4FS1A 3V1QA 3C6TA 1TL3A 3CQ8A 3GV8B 4I2EA 3Q8MA 1S97A 4FZXC 1JLEA 3AVHA 3NE6A 4WE1A 3C1YA 4QZCA 4K8XA 2MUTA 2W9AA 1IKVA 3DLRA 1X2IA 4O3NA 7ICEA 3C1ZA 8ICAA 4ED8A 3K5MA 1WSGA 2WTFA 3PMLA 4QWCA 3M9MB 1BIZA 3HSTB 4CIEA 4KLUA 1RDAA 2OYQA 2BKEA 1ZBIA 1T3NA 4OGEA 9ICEA 5J2FA 2Z1GA 4DQIA 1EKEA 1S1UA 3OS0A 2I1QA 5J0WA 4QWAA 9ICRA 4I29A 3T1AA 2JEIA 4YMOA 4F92B 3S3OA 3DLGA 3LPTA 4QAGA 2VANA 2IAJA 3HP9A 3EZ5A 4HYKA 4PHAA 3RJIA 9ICGA 4FVMA 5HP4A 1ZQSA 1X9WA 4O44A 4CJPA 5KT4A 2FMQA 4I2IA 3SZ2A 4BE0A 5DG7A 2OPQA 5CZ2A 1S0NA 3RTVA 4CEEA 5I42A 4YMNA 1SKRA 4NCAA 2KFZA 4KAZA 4ECYA 2X78A 4B08A 3ZSXA 3QNOA 1ZQNA 4CCHA 2AQ0A 5D46A 4KRFA 4F3OA 4K4HA 4ECQA 5SWMA 2DTUA 2MAXA 4XUSA 5HRRA 2NRWA 4EP4A 4F4XA 8ICTA 5KFWA 4KLDA 1UOCA 3AVLA 3VQ6A 4FJXA 2BANA 3KHHA 5CYMA 3QEWA 5L1IA 1BPXA 2VG7A 5KRSA 4EBCA 2A1RA 4CFAA 4NY8A 4UBCA 4MFCA 4H4OA 3HK2A 3PR5B 5DLGA 5KT7A 3UXNA 2VWJA 4DF4A 4QZDA 3P83D 3ZDBA 4GLXA 1TKZA 3N4MB 2BQ3A 2HHVA 5HBMA 4FJMA 4BE2A 1NOZA 5J0XA 3THVA 5KFJA 4I7FA 1FXXA 5EWFA 1S10A 3AU2A 3RAQA 4N47A 1XWLA 4DTRA 7ICKA 1IM4A 3L2RA 3SQ2A 8ICUA 5IILA 1WAJA 4ZTJA 3PV8A 4EP5A 4Z4GA 3VQ5A 4CEFA 4RQ6A 3T5HA 1CUKA 1RXWA 4FJHA 3D0PA 3CFPA 3LDSA 3V6HA 4F2RA 3V6JA 4PY5A 2IBKA 1TK0A 2R8HA 1YT3A 4NM2A 3Q8SB 4R5PA 5L9XA 4KHSA 3RB4A 3K58A 1LB2B 1IO2A 2WONA 2WOMA 1HNIA 3AA3A 1U4BA 4KLEA 1W9HA 4GMJB 1JL1A 5F9LA 3PO4A 4CGIA 5KFXA 5KFGA 8ICRA 1LAWA 1ZQDA 4YR0A 1NJXA 3AVMA 1K6YA 4NYNA 3NDKA 2BPCA 4IBNA 2YNHA 4FZZA 4Y1CA 3IAYA 5KFZA 5D49A 3O3HA 3SQ1A 3MBYA 5EU7A 1KVCA 4UAWA 4I28A 8ICEA 1W0HA 4JWMA 3L2QA 4AHCA 3SNNA 4EZ6A 9ICHA 1L3VA 4TQRA 4M9LA 4PWDA 9ICVA 1F21A 4I2PA 5KFFA 3OVNA 3ISCA 4J9OA 5J2GA 4DF8A 2IHMA 4MFFA 4IQWA 8ICBA 3DLKA 5KFNA 2R8GA 3TI0A 1ASVA 4CGFA 4KB1A 3PVXA 3HVTA 2XY6A 1BPEA 1XHZA 4F91B 4AHRA 1KTQA 2HHQA 9ICLA 4E7LA 4YD1A 3VQ7A 1RTHA 3BDPA 5J0SA 3MFHA 4JRQA 1R0AA 3DM2A 4FK2A 2FLLA 4DG1A 2FBXA 2F8SA 4KKOA 4J9SA 1C0MA 1VSIA 4LZGA 5I3UA 1T03A 3V72A 4F5QA 3JPQA 1ZQLA 9ICPA 3AO5A 5KTQA 4Q0BA 4I2AA 1J5OA 2B6AA 3WNEA 4TUQA 4TUSA 1JLFA 4I2HA 2D5RA 1U48A 2OZMA 1CEZA 8ICPA 9ICFA 1RCHA 3GQCA 1ZQKA 5KFPA 2P5OA 1DOQA 4B9VA 1ZJMA 3OJSA 1ASUA 1HQEA 1KSPA 1VRTA 4KLJA 1BIUA 2ASDA 2IDOA 4O0IA 1C6VA 4CJWA 2B21A 4PUOA 3MR2A 5KFRA 2YKMA 2LYHA 1X9SA 7ICJA 3L2WA 3V9SA 3EW9A 7ICGA 3FYHA 8ICQA 3NGZA 4NM1A 1NOYA 4AHUA 1VSFA 1KRPA 3UXPA 1U45A 1TV6A 3HJFA 4UB2A 5KG2A 4FCYA 2BR0A 4M04A 1CZ9A 1QS4A 4J9NA 4NCBA 4M9GA 3EYZA 1VSMA 1YVUA 2PZSA 1ZQIA 1SKSA 4HUFA 2W8KA 3M8RA 5F9NA 4JLHA 1Z00B 2F1JA 1QSLA 1SL0A 1DTTA 8ICCA 2ASJA 1S1TA 1UT5A 1WSHA 3CM6A 3BQTA 4N76A 3TAQA 2KN7A 2A1SA 4KLFA 4M3XA 3HWTA 1ZBUA 4HVJA 2ZJAA 3PW2A 5KT3A 4M9JA 4CFCA 4FLTA 4LH5A 2G8HA 3VQ8A 5HMLA 3TFRA 3T19A 1ZQGA 1S9FA 1UT8A 1WN7A 3OS2A 3PY8A 3SPZA 1JXBA 3MXIA 1HQUA 1ZETA 4F93B 4PH5A 1HJRA 5IIIA 4KHYA 2ZTDA 1BCMA 1Z00A 2F1IA 5FROA 3NAEA 5DG9A 4Q8FA 4OKJA 3S9HA 1Y88A 2V4QA 1V9PA 4P2HA 5J29A 4JV1A 7ICIA 3AO4A 5KFHA 3K75D 3NGYA 4B9NA 2BPGA 7ICVA 3C23A 1ZQBA 3QIOA 3RRGA 3ZD9A 4CIGA 3GV5B 4KN7A 4Z4CA 3T5KA 4ELUA 4ID1A 4B9UA 5KFLA 3AO1A 4IG0A 9ICJA 1LW2A 1RTJA 3ITHA 4UB3A 5KFVA 2BE2A 4DL6A 4JWNA 1C0TA 4CHYA 4OKEA 1TFRA 2G8UA 3C5GA 4M9NA 3K57A 3V7KA 3AVBA 3CM5A 3Q8QB 3TQ1A 1XI1A 2Q3SA 4C8KA 5HROA 3BQ2A 2ASLA 4GXJA 5KT2A 3O3FA 1RT1A 3KK3A 3MGIA 4AHTA 4RPZA 3TAFA 1ZQOA 3WNFA 4CK1A 4CF0A 4CERA 4E89A 2D0AA 1HNVA 4DEZA 4DS5A 2G8IA 2HVHA 4XQ8A 8ICNA 4I2GA 2XCAA 3OYHA 3M8SA 4RQ4A 2FPMA 4F2SA 2NRTA 1QQCA 3V1RA 3ORYA 2NUBA 4E7JA 3ZT0A 4FLVA 1L5UA 2KFNA 3OYFA 3MGHA 3LP1A 4IR9A 2KTQA 5DKWA 3AA4A 4I2FA 4O5KA 1RTDA 1XO1A 4O3RA 4W5NA 4QZ8A 7ICRA 5KFAA 2W9BB 1BPBA 4UB1A 3V1OA 3OYJA 4QZAA 2IHNA 4DU3A 3RBEA 1RT6A 4B8CA 2BQUA 3CG7A 4CFDA 4QZ9A 1JLAA 2DFFA 1NK5A 4DTXA 1U9LA 1NJZA 2OPRA 4J2BA 3ZCMA 4RZRA 3OHBA 3SUOA 3U6FA 3V4IA 1IXRA 4LY7A 1C7YA 4M47A 3A2FA 2AJQA 5HHHA 1X1PA 4QCLA 2PXIA 4ECXA 2W9BA 4IRKA 7ICSA 3SI6A 3P5JA 4FM1A 3C95A 5C25A 9ICBA 4L8RB 4KLSA 4XIUA 4Q44A 2ALZA 2ZJ8A 3PX4A 8ICGA 3KKRA 4KN4A 3SUNA 2X6NA 4KB0A 1Y97A 4RQ7A 4HUEA 3B0XA 4YFKA 3AVNA 4K4IA 2Y1IA 3OYEA 7ICNA 1D5AA 3K5NA 5DGBA 7ICHA 4OJRA 4KLOA 4DTPA 1TKXA 1I3AA 4FJ9A 3LP2A 3PW5A 3BQ1A 2X74A 3OY9A 3U3YA 4BDZA 3L2UA 3E2EA 3GIIA 4N41A 3DYAA 1HJPA 4UB4A 2Q0ZX 2XO7A 4F8RA 3Q8KA 3VQEA 4M9HA 4LVSA 1ZQQA 4KLGA 2AU0A 3GIKA 1IG9A 4CEBA 1WSIA 4DSEA 1BHLA 5DQIA 5E41A 3TWHA 5KFIA 1EXNA 4J9MA 4M0AA 4KHQA 1ZQXA 2BPFA 3I0SA 7ICMA 4M41A 8ICXA 1J9AA 3QLHA 2R8KA 5DDMA 3UQ2A 1O1WA 2FBTA 4KHUA 4RNOA 2GBZA 4KI6A 5KFSA 3KHRA 2C28A 1SV5A 3K5LA 9ICXA 3ZD8A 2J6UA 3O4NA 3RR7A 1IKYA 2YKNA 2IOCA 2JEGA 1KVAA 2RDJA 1Z3EB 4NXZA 3HP6A 4KTQA 1SKWA 1T4GA 1RDDA 1BPDA 1ZQVA 4DFPA 4YVZA 1C0UA 3OYKA 5J2NA 4FLZA 4I2JA 5KG6A 2HNDA 4CJQA 3ZT1A 2JZBB 2YV0X 4TQSA 3SV3A 4KTWA 4BWMA 3B6OA 2HVIA 7ICTA 3NF7A 4F5NA 5J0PA 4DOBA 3VN5A 3C5FA 1LW0A 4RPXA 1NKEA 4IQUA 9ICTA 1XSLA 1NKBA 4GW6A 1S9EA 4O5EA 3Q8RB 4AHVA 4DL5A 4E1NA 1ZYQA 5DQGA 4J2AA 3O3GA 4QZBA 3UIQA 4B3OA 8ICSA 4I2DA 3N97B 4ECVA 3ZDAA 1LWEA 1ZQJA 2FBYA 4CJ4A 3NCIA 5K14A 4KPYA 3RMBA 3C2LA 1NK7A 2JZBA 4FW2A 4EYIB 3H40A 1KVBA 2KZ3A 4F5PA 1D9DA 1XSNA 1ZQPA 5KFQA 2BQRA 3TARA 3AVFA 2NRVA 3KIOA 2BCVA 3V81A 1BPZA 2P66A 1EX4A 4PGQA 3EPIA 2R8IA 2O4IA 9ICOA 4CHOA 3UQ0A 2PFPA 3EY1A 3ZSZA 1ITGA 1S6PA 2H5XA 9ICCA 1SZPA 3LP0A 2F1HA 4BDYA 1C1CA 4MEXA
chains in the Genus database with same CATH superfamily
4FVUA 3KLVA 2M0GB 2CQ2A 2KYZA 2VB6A 1NGAA 5E84A 3AQPA 2DFHA 1DLOA 5F8MA 1U6FA 5KI6A 1EQMA 4LRDA 4USHA 2VD3A 2WSFC 2P2CB 2JRSA 3FBCA 1X9JA 4ECZA 3QETA 2VG6B 2DJWA 2DIVA 1TTHB 1XNQJ 2Z2LA 3ENBA 3R3LA 3OYNA 3TAEA 3DRYA 5EN1A 3HM8A 2BJ8A 2OFGX 9ICSA 2I6WA 2F3NA 2DFEA 4ICLA 1IJEB 3MCAB 2W6KA 3KFWX 3R7SB 4B9QA 2BV3A 2EFGA 3B54A 1AA1B 3TEGA 4C1NK 2HW3A 3HXMA 2UU9F 3O9RA 4QR1A 3VEWA 2B5JB 1N32J 1GOBA 1CS4B 4RNHA 2CH5A 3GWCA 1UJ6A 9ICNA 4Z4IA 5AIAA 1NBEB 2CGKA 2VJUA 4BRFA 2HPUA 2ZH2A 4FJIA 3HJEA 4BGAA 4YOEA 3SUPA 3VVTA 4I2QB 1OPIA 3MWTA 2E7WA 1NNDA 4XH5A 2VG6A 4C3MA 1G99A 2W9CB 2XSFA 2FJXA 2HGNA 3BPSP 1SAZA 1ZQFA 1TAUA 2P9SB 4M5GA 2Q31A 3LF0A 1T6DA 4UBBA 3KK1B 2B5JA 3DLEB 1B3TA 3OA9A 1YSJA 4CH7A 1EKRA 1IIPA 1B0VA 3QJPA 4PQUB 5E7OB 3NCQA 4ILRA 3TJ9A 1FNXH 1RDFA 2Y0SD 2ZM6J 3E8OA 4I2QA 3O5TB 2BDPA 2AEMA 1KQKA 1SC1B 4LQ3A 2W9CA 1S1WB 2C2EA 4BR9A 2I5JA 2KYXA 1SJ3P 1TU0B 1ZQ1C 1RM6C 4QIWF 1RQ0A 2P9SA 1VQOS 4RX6A 3EZWA 2BZ2A 3SPYA 4NWBA 5ETQA 2R7YA 3OTQA 1OXJA 3GJSB 3KK1A 1RGIA 4NMXA 3DLEA 3A8EA 4CJEA 4X5VA 2B56A 3QINA 1I94J 2YNIB 1OSDA 3I6PA 4PQUA 2LEAA 2IVNA 1VJWA 4UASA 1N6QB 1M1KT 4M45A 4DPXA 2WVDA 1N48A 1Q82O 1WUUA 1DK2A 2M9NA 2JX2A 1BC6A 3WNHA 2DTJA 3M9OB 3MFIA 1VRUB 2CKWA 3WNGA 1YTAA 2QA4N 1S1WA 1UA0A 2FSJA 3O44A 2R18A 3K59A 1B9FA 2EDUA 3LANA 4MKVA 4PR6A 4OPAA 3PIPL 2WTUA 3TA0A 3LWMA 2ACYA 3E0FA 2JC1A 2AHOB 3R8YA 3TUIC 2ZKTA 2H3ZA 3BQ7A 3TWZA 2IVOA 2YNIA 3I1YA 2AYMA 4RQ5A 1JQGA 1H7XA 4HH1A 2VQEF 4QR0A 3NXZA 5HQMA 1N6QA 1FD8A 4ED7A 4KGXB 1VQLN 2GW8A 5LJ3Y 4FNHA 1SH2A 1XNRK 3AXKA 2XULA 3T7ZA 1VRUA 2QKQA 1RDWX 4NWIA 2I7NA 8AT1B 3N5FA 1ZJNA 3GZFA 5A2QO 3ZNJ1 4CO3A 2L3MA 5BPLA 4DV1J 3KLHA 4J37A 3V7JA 4ED4A 2XQCA 2F63A 5HQ8A 1B7FA 2HMIB 4H8KA 5KFDA 2D8CA 2JVRA 2VKQA 4FW1A 4C6AA 4K4YA 3VGUA 1YG0A 3LM9A 1A5VA 3NRWA 3OLBA 4GKJF 1Q8KA 4I2CA 2ATCB 5DM6L 1QZ6A 3VC8A 3CP8A 4WP3A 4CJRA 2GO7A 1IM6A 4CF5A 4O5FA 2DH7A 4DR7F 4I2BA 5F3TA 1X3NA 3VVUA 1JIHA 1CZBA 3H1VX 2XMKA 2F8TA 3U02A 1VS3A 1C20A 1K9MT 4I6WA 3VEOA 1RXVA 3G0ZA 3AJ1A 2QI2A 2HMIA 2EPIA 4CT8A 1D0EA 2OAUA 4RW4B 2F1FA 1HUZA 2BW2A 1CVJA 4YFUA 2RQCA 5DBAA 4ED3A 5EWEA 4J2EA 3UN5A 4BACA 5I4MA 2QX0A 5KAIU 1HX1A 2JGUA 4DV0J 5HR6A 5C10A 3FFIB 4PEOA 1V9OA 3IWLA 1UZHA 1YX2A 3POTB 4M95A 3AT1B 3WX4A 1VQ8S 3WXIA 4ANEA 2WCXA 5AQYA 4IOCL 2XY5A 1RHRB 2ZH1A 5E5NA 4C98A 1J54A 3PHEA 3V4IB 1CBKA 4CBWA 1OY6A 1FRIA 5CHGA 1R7IA 2ACMA 1RBSA 2ZIXB 2WB4A 4RW4A 3M8WA 3JAMU 2XB2D 4H0TB 4ECSA 4MT1A 5IIJA 1J27A 5J0TA 4B9LA 5L1KA 5AFUH 3SQ4A 3AM9A 4CJUA 2X6SA 1PZNA 3UWTA 4EBEA 3BN7A 1NSAA 4RQ8A 3NF8A 5HLFB 2YI1A 1J53A 5HNKA 5MAOA 3E51A 3FFIA 3FFKB 1FIQA 1N33J 3T79A 2E5LJ 3M32B 2F5GA 4DL4A 2R42A 3POTA 3SLCA 2IRXA 3N79A 1N36F 4LF7J 1Q8IA 2IRUA 3M6XA 3BEXA 4FZMA 4PL7A 4DV5J 3ZT2A 2FTRA 5J2AA 2ZC4A 1IV0A 2WAQF 5TISU 2ZIXA 2H5JB 4USUA 3SAHA 3PX6A 3UNYA 2A0FB 5CZVA 5K4LA 1IKXB 5GAEU 2VHGA 1KKXA 2LP4A 4N5SA 2IJFA 2HS0A 5JVGL 5CA7A 5HLFA 5AR0A 4B3MK 2DO4A 4Z6CA 2KOBA 5HRSA 2VBZA 3M32A 5ALJA 1JMSA 2ZH6A 4YORA 1Y5NB 3R5GA 5L38A 3W9IA 4PHDA 3D2EB 1FXLA 2YWWA 2CJ9A 4C7ZA 3MM5B 3FRZA 2KHDA 3L2VA 3ZTQA 1NHVA 3MABA 3G87A 1O13A 2AYGA 3AJDA 3QT5A 3IGVA 3W62A 3UCZP 3IMQJ 3SI8A 1IKXA 2DRDA 4EMDA 3FZMA 1A0PA 4FO0A 4AT1B 2Z2MA 4R63A 2A42A 3PX0A 2H3VA 5BPNA 2AF6A 4JS4A 4LRCA 3LK9A 2HBYB 5GIPA 4DQ8A 2RDIA 3D2EA 3FSIA 2G09A 2ZFHA 4JI2F 2Z0GA 3DU6A 2QWRA 5BOLA 4RO0A 3TA1A 3ZI4A 3KKSA 4JI5K 3WK5A 4IJAA 3NLCA 2HBRB 1XMQF 3IKMA 4A8MP 4MEYA 3QQCD 4JKGB 4FK4A 3PIPQ 4LF9F 3TPQA 5DETA 8ICVA 3VPZA 1ZD4A 4MYUA 5ALFA 1FRLA 4IJNA 3IBPA 3VF4A 2MKYA 4OJGA 2RIJA 3JS9A 3J8AA 2HQGA 4F4WA 4EO6A 2UXBF 3HVRA 3PSIA 4TU9A 4EEKA 1T94A 4PXBA 5AE3A 3UD3P 3CCZA 2UUBJ 4U7BA 3AL0B 4O3MA 3QUCA 3MDFA 4GO5X 1B22A 2W2NP 4JKGA 4RTFD 2KXHA 1S3XA 1ZD5A 5J8YA 2LU2A 2UXDJ 3T1HK 2FBVA 2FUG9 5J0YA 3H8YA 5DRKA 1CXUA 3QZ7A 5DM6Q 3ATUA 7FDRA 3H4BA 2QMXA 3DHWC 1T3VA 3HX0A 4N77A 1M5KC 4BR2A 1JCFA 2EI5A 3DGPB 1X4EA 4X66J 3PR4A 1CPZA 2V2KA 3L8BA 3D6RA 2F76X 1UVLA 4LFCJ 1VQMS 2E2OA 1BOTO 3PSFA 1VQPS 4NO7A 2GQQA 3SD7A 5DB6A 4JAXA 4IL6U 1KDHA 2Y1JA 4C0ZA 3OYBA 1NNEA 1YHQS 2YNGB 3BSAA 3NG8A 5GINA 3JAMO 3MN9A 2O8BB 5ALYA 5JRTA 2GJIA 4UB5A 2OEJA 4ED2A 3PACA 2YB1A 3CWJA 4O8KA 3AB2B 4I1TA 2QKKA 1Z4UA 2DGXA 1YZ6A 2FJVA 5FPMA 3DGPA 4WU2A 1N62A 4DR5F 3E9PA 4NLRA 5I3QA 5DB7A 4MMOA 3AQOA 4NA1A 4IOCQ 3KJVB 4LF4J 4X64F 4PA1A 4DTOA 1Z26A 2QM1A 3CETA 1JXLA 5ALVA 2YTCA 4WK1A 4JS5A 3RMDA 4HHJA 5ETOA 3D28A 5DDOC 1F0MA 2YNGA 4FYWB 3K5OA 4DR2J 3DOMB 4NLQA 2AGQA 4MFBB 5CA5A 3OYAA 1UFKA 4MK7A 4HHTA 1S57A 5C2DA 2LQBA 1MSWD 3B6PA 2Y0SF 2J0SD 4WZMA 5CABA 4WFZA 3L4IA 3G71S 5C7PA 2GTDA 1DT9A 3HPOA 1I39A 1T6CA 4CJLA 1JLCB 5CE3A 3NOCA 2JJ4D 4H54A 3QU5A 3UE2A 1U8WA 2OTLN 3J7YU 3O4WA 4KH1B 2UXCK 2H3QA 2GWSA 3NGUA 1BI4B 3DOMA 5BYQA 4MFBA 1ZQHA 2DXFA 4USTA 4ZJOA 4ZLNA 4M3ZA 1GOCA 1YJTA 4XA5A 3AD8C 5ALZA 4X4VA 4OHYA 4DTMA 5JVGQ 4QZIA 1FJCA 4GO7X 1GO3F 3JTOA 2YMMA 3V6KA 3G8SA 2FJBB 2XICA 2EFPA 1KBUA 1GFWB 3KTQA 2OANA 3BREA 2LSNA 4OX8A 5D78A 4BRDA 1JLCA 1F44A 1RDBA 3RJHA 4QZGA 1H2TZ 2FZGB 2DRAA 3OL7A 5D15A 2F3JA 3P4IA 3EE8A 4P7VA 1CJKB 2F8HA 1BI4A 1FVQA 2MEWA 3BDEA 2QXFA 1L3TA 2R7WA 2PBDA 4OYPA 5J2PB 4F0MA 3OYLA 1S22A 2RHKA 2MQMA 2NXNA 4O3QA 2AYBA 4P4PA 2RUSA 2MQOA 3O8MA 1U1QA 3OFFA 3CUNA 1X66A 1XU4A 1YITN 1LEOA 4BVOA 2BUNA 2CRLA 3EVWA 3O4QA 4LH4A 4FJNA 2M8DB 3ISBA 4M3UA 4A8KA 2QYCA 3QMQA 4OJLA 5FDLB 4LFAF 2VG5B 1IBMF 1CJKA 1HNZK 2VKZG 4X65F 4OGCA 4J9LA 4X84A 4FBTA 3DC2A 5C12A 4IQVA 3KLGB 6AT1B 1OH6A 1UWAA 4L6V3 5J2PA 4QS9A 3DLBA 4M5IA 1WF1A 1SL1A 2HQIA 4K41A 1WC3A 4EBDA 1QHAA 3DRRB 1FX2A 2G13A 1C1AA 5ALOA 1Q9XA 3ELHA 1SQKA 2E8NA 4RUAA 1UA1A 2X3GA 2ZH4A 4K4VA 1H7WA 5HATA 3VZIA 4OI4A 4WKYA 3IP0A 4JKAA 5FDLA 3IG1B 4F5RA 2VG5A 2D3OR 1RE1B 3DOLB 4Q43A 3KLGA 1RWMB 5ETMA 2PI4A 1PGZA 4KGKA 5CZ1A 3NASA 3CCSN 4CHZA 5AK6A 3T5JA 1Z4OA 1VI7A 4WBFA 4FJ5A 3PUFA 4K50A 1BCOA 1SPBP 2B4OA 2XC9A 3DRRA 2AA4A 4K4GA 2WW4A 3MOJB 3I0RB 2JOQA 2YHBA 1I1GA 2HOIA 1XSPA 1ZQYA 4ENOA 2HKEA 3TTCA 2W1BA 1NXIA 2MJUA 2MQNA 1RDRA 2AT1B 4X4NA 4P2FA 2ISOA 1OMSA 1RG6A 4IYQA 4DBQA 3UMCA 3CHWA 4JI7K 2JH1A 1Y64A 1SQFA 2VFRA 1KKHA 4DX8H 3DOLA 3AA8A 3EICA 5JS2A 4YD2A 4DQRA 2YX4A 1RYRA 3C16B 2WBRA 3GG0A 1B0XA 1L7PA 3FMBA 3GU3A 2GVDB 1Y4ZB 2OHDA 4FJJA 2D0CA 5CB1A 1T8EA 3V5RA 1XNRF 2IMWP 2OO4A 3TTDA 3M5RA 1RGVA 3I0RA 2O8CB 3PIOL 1DARA 1JWWA 4OX9F 2BKPA 4JI4J 1JUDA 4J03A 1TK5A 4USJC 4RPYA 1WWUA 1PIEA 1GXUA 1QVGM 4FZNA 2PFDA 4ZKAA 5J8YC 3KOAA 4Z6DA 1T7PA 4O4GB 3TYTA 2D74B 3VTIA 1VQ7S 4QOZB 4RNNA 3RFAA 1N52B 3MDAA 4USAA 2NYIA 3C16A 1IWAA 4QW8A 1DAXA 1SC3B 2GVDA 1JALA 5DQHA 1TKDA 2P51A 3PYEA 2K7JA 4P6QA 4UUWA 2CQ0A 1WNSA 2VWKA 8ICJA 2D7SA 3UI3A 4HKQA 2O8CA 1PBUA 4OHWA 4NL5A 1N60A 1XERA 8RUCA 4QZEA 1ZAXA 1RTZA 3V7LA 2K06A 4L3KA 3RUBL 3KVGA 2RAQA 6FDRA 4O4GA 1NZ8A 3H2UB 3BO4A 4CZLA 2ZKUA 2YPYA 4EI2A 5HK4A 3PSPA 2ZWPA 1GNKA 1UL3A 4EU0A 1JJHA 2OZSA 4TN2A 2K8CB 2PFNA 3CXCR 3BF1A 2PFQA 2E2PA 4ITSA 3HX9A 2HIQA 4M6WB 5F3ZA 1NMNA 2B9XA 2H54B 1QM9A 1T0TV 1IBLF 3NE6A 3C1YA 2A19A 4K8XA 2W9AA 4NLYA 3GBTA 8ICAA 1KOOA 3KDOA 1WSRA 3MPVA 4IO8A 2OPQB 5I42B 3M9MB 2MA1A 3I82A 1RDAA 5JXSA 2IVPA 1ZBIA 1T3NA 5J2FA 2Z1GA 3D3BJ 4DQIA 1EKEA 3OS0A 2XMWA 4QWAA 1PJ7A 3T1AA 2JEIA 4F92B 3S3OA 3JTNA 2WB1D 1IR1A 1FDDA 2MU2A 5AM2A 2DY9A 3LPTA 1XO0A 2UUCJ 2VANA 1TUWA 3BZKA 3I56S 3WK6A 3EZ5A 1L7OA 4MN4C 4PHAA 1VC5A 1HWIA 3JSBA 2R7OA 9ICGA 2D3O1 1GLEG 1B7YB 5HP4A 4CJPA 1URRA 2R7VA 2W24A 2HWHA 2YTUA 3EN9A 1VK3A 5JMNA 3SZ2A 2QWMA 4K4SA 3W8PA 2VG7B 5DG7A 1A7GE 2OPQA 3KKFA 3C3LA 3IG5A 3RTVA 5I42A 1SKRA 2EKYA 4B3MF 1RAIB 5KAKA 2FDNA 1UVIA 3ZSXA 2XYHB 4C0OC 3RF9A 4MIAA 4CCHA 3JSRA 1Q79A 3F2KA 2AQ0A 2P9GA 2BW7A 2O3DA 2VQFK 4F3OA 4I7FB 3ENOA 4AYBD 4PL1A 4K4HA 4ECQA 5SWMA 2CQCA 4KGZB 2LEPA 4XUSA 3PDNA 3HRDD 1SB6A 2HAIA 3EVOA 3O3LA 2F7VA 3EMTA 1YI2S 4OJ3A 2Y1RI 1PYTA 4F4XA 8ICTA 4EP4A 2HVEA 4I69A 1YJ9N 4FJXA 1RHUB 1SC6A 2VG7A 5KRSA 2A1RA 4EELA 4UBCA 1SS6A 5DLGA 4JV5J 2AP1A 3UXNA 1PYOB 4ZJQA 4QZDA 4A46A 4IFVB 1NSQA 1VIOA 4B1ZA 2EK1A 2UU9J 1WOPA 1NOZA 3R6MA 3QGHA 4JP8A 5KFJA 4I7FA 3GL1A 2DITA 5E33A 2YVSA 1ZA1B 2ZH5A 5EWFA 1S10A 1R43A 2GS8A 3AU2A 2NZTA 3HVAA 3SQ2A 3SR6A 8ICUA 1NPRA 4ZTJA 3PV8A 4JI5F 4OYIA 2XEXA 4RQ6A 2QLJB 1VJQA 3T5HA 2C3PA 4H5RA 2UZAA 4DPOA 3D0PA 2G0IA 3VQTA 3LDSA 4CZGA 2XLIA 3M6UA 3P39A 3V6JA 4M5MA 4PY5A 2IBKA 3X3UA 3MM8B 3F41A 3J80U 5L9XA 3ZFVA 1RLCL 3T41A 4UZCA 4KLEA 5FLXO 2QN6B 2QA2A 3R9LA 4CGIA 5KFGA 2EAOA 3H0MB 1ZQDA 4YR0A 5AXLA 4K7QA 2DNZA 1K6YA 1VQSA 4UAVA 3VCDA 5C2CA 2KRBA 3JQMA 2P8IA 2G2OA 4CT9A 1T3QA 3IR6B 3PIOQ 3O3HA 1MROB 2X1BA 1R0AB 3UR0A 4FZLA 1SIZA 4UAWA 2D9PA 4JWMA 1Z2ZA 4NEZA 2KEYA 4EZ6A 2WMMA 2BM1A 4M9LA 2HLTA 3MM8A 3G8TA 4YOWA 1FDAA 3IRWP 5GMEA 4G6VB 2B6AB 3ISCA 2FHOB 2IOHA 4OZJA 1GXTA 1R3NA 5B0EA 4DV6K 1BPEA 4AHRA 1KTQA 2A1BA 9ICLA 5GAEP 1PVPA 1Y5IB 2HSEB 3N9UC 1IR2A 3MFHA 3NY0A 3EGVA 4F3MA 4JRQA 2VPWB 1R0AA 4K0KK 3GSIA 1Y9OA 1HKCA 2A2DA 3WT0A 1C0MA 5EVZA 3CNQP 1VSIA 2GZOA 4JK8A 3V72A 4F5QA 3JPQA 4ZVEA 2ZNZA 2KK0A 5FIIA 3PJ9A 2B6AA 3VEZA 2VPYB 4OZ5A 4PZNA 3O08A 4HL9A 3HZGA 5LMUK 3ILOA 1UZDA 2W2OP 1CEZA 2G08A 2DCLA 1ZQKA 5GAGU 2V8PA 1K73O 3THYB 2VBYA 5JVHQ 3DNCA 4KLJA 4U96A 2JHEA 1BIUA 1N34K 1KQSM 4CJWA 2ZGYA 3FSYA 4PUOA 1C4AA 1PILA 1KAYA 4I0WA 1S1TB 4EGLA 2YX7A 3E1YA 3RAMA 5HMWA 3EW9A 2VUGA 3VF2A 3ZLJA 2OGUA 4DCPB 1F5BA 5IWAK 3WKBA 4NM1A 1NOYA 1VSFA 4MDBA 2XWYA 5AQXA 3ETOA 4GKJJ 3WIVA 4TKTA 5K8NA 4ZPWR 5HMXA 2WBMA 1HQUB 4DR6K 1VC0A 3P8BB 4M9GA 3CD0A 3THYA 2DNLA 4DR7J 3EYZA 2QARB 3M8RA 3QGGA 2CZ9A 1SL0A 4B6JA 4RL1A 3CQXA 3ONNA 3HHEA 2ASJA 1S1TA 4Y2KA 2GIRA 2UXCF 3TAQA 1UPMB 3QU9A 4KLFA 3HWTA 2PDAA 3S6JA 4OPHA 5L39A 2OIHA 3BY5A 5DM7L 1JJ2R 3TFRA 3I96A 5AZIB 1ZQGA 3J81j 1OUQA 1ZAWA 3HHLB 3OBYA 3SPZA 1Q4RA 1QZ5A 2JFDA 3MXIA 1HQUA 3CTRA 3HKZD 1ZETA 4JB8B 4NLXA 2UYTA 1MWZA 4KHYA 4HT7A 4OHVA 2F1IA 1YAGA 2QZ8A 3NAEA 2Q43A 2QLFB 2GMJA 3S9HA 1Y88A 5HANA 3IGNA 3MF5A 1HNWK 5AJ3J 7ICIA 3N0VA 4WXOA 5HROB 1DBDA 2LBOA 3K75D 3GCXP 2F8MA 4B9NA 3U9DA 7ICVA 3R97A 3NUQA 5AZIA 1ZTTA 3A12A 5AKHA 3HHLA 4BR7A 4KN7A 4URGA 4ELUA 2CQIA 4ID1A 1VAZA 2DL0A 3F2DA 4A8QA 3AO1A 4URSA 3FRYA 2PMZC 1L7MA 3FR0A 4CHYA 1WB9A 1RADB 4OKEA 2G8UA 1N36J 2NPFA 1HKAA 2OTJS 3AVBA 2GNKA 2PSZA 3TQ1A 5HROA 2JV3A 1HNZF 3MAAA 3PKMA 1ZD3A 2DEJA 3FBFA 4AHTA 2R7XA 4RPZA 2D3ZA 3TAFA 4X4UA 1KQGB 1ZQOA 1HHTP 2VFTA 2AX0A 1DQ8A 2HVHA 1NGHA 1NRKA 4I2GA 3OYHA 3GPAA 4FWPA 5L1MA 2VC0A 4N7TA 2N7CA 2NRTA 1FFWB 3QT8A 5HVHA 4FLVA 4UY8T 1L5UA 2KFNA 2LQ9A 3OYFA 3J7AP 2QLXA 3MMAB 5LJVA 2J76E 1UFLA 5IZHA 3AA4A 4O5KA 1S6OA 1BWEA 4O3RA 4QZ8A 1CZAN 2I5HA 5CHIA 4CLLA 2F4VK 3Q23A 2DWQA 3EXCX 5K8OA 4IZ9A 3VTHA 2QV6A 2VJ4A 4CF4A 3MTKA 3VR1A 2GWKA 1KW4A 4OYMA 2GIQA 4C4WA 3LL3A 3CCJN 3TQEA 2VF3A 4QZ9A 1V5IB 2MMYA 1NK5A 4XO0A 1U9LA 3J7YP 4WK3A 5D4PA 4YOUA 4RZRA 1KQFB 3GG1A 3U6FA 3LP2B 1V5VA 3MMAA 1NZPA 1C7YA 1D09B 4NLSA 4UUXA 2J5AA 2KKHA 3G8QA 2WF7A 2PXIA 4JI7F 4C4SA 2ZDOA 4KPCA 5K8PA 3P5JA 2PGCA 3C95A 1R27B 1M1GA 4KLSA 4Q44A 1NH8A 3A8KA 2ALZA 3KUGA 4QIFA 2V34A 3PX4A 2C2KB 1XMQJ 3CCVN 1X60A 4ZPTR 3QBWA 3KKRA 4KN4A 2AKWB 4P10A 4KB0A 4LF9J 1Y97A 4RQ7A 3UDCA 3D2SA 2SXLA 3OYEA 2Z58B 1U1KA 7ICNA 1X5OA 4DV3K 5AQQA 5DGBA 7ICHA 4OJRA 3TSUA 1VLBA 2DR8A 1I3AA 4FOIA 3LP2A 4OLOA 2AD9A 2PA8D 2X74A 5F41A 2FC9A 3U3YA 2KM8B 1IBKF 2YHWA 3WQTA 3GIIA 4C0HA 4QIWC 3CDBA 3FUYA 2CXEA 4F8RA 3VQEA 4LF6J 2RE1A 4CEBA 4JI3K 2YMQA 3KG1A 1T9UA 4M0AA 4KHQA 3N4PA 1ZQXA 1D1UA 2W01A 1H74A 3LPEA 4M41A 4QQBA 2X1FA 2OYYA 5DDMA 2YN4A 1RCXB 2FBTA 4PABA 2A1AA 4JNEA 3TKAA 4ILGB 3D2NA 2C28A 4US8A 4QIGA 3NL0A 2DGSA 3ZD8A 1QUPA 3I9ZA 4M5NA 3NVKA 4H4OB 3IWXA 2ALYB 3C19A 4PKHA 1UW9A 2M2BA 3GJQB 2RDJA 4WYWA 4KTQA 1LWEB 2YWHA 2ZITA 3QSYB 1UFWA 5TKWA 2EWHA 3CD6N 5JICA 2QMWA 3OYKA 4B3TK 4FLZA 4EAHD 5KG6A 2HNDA 2V67A 3F5EA 2PA3A 4QIVA 2FPHX 1UHUA 5DM7Q 1F2HA 2VONA 3GU0A 4LR9A 4AE5A 3B6OA 2HVIA 3KD3A 4F5NA 3PYDA 5J0PA 4DOBA 4NJ8A 5JLHA 2H3EB 4X2BA 2K4EA 3J7Z5 3ZC4A 2XBPA 1NKEA 1SGGA 2Q79A 4EFHA 1VJ5A 3VMFB 4O5EA 3RSEB 3PCOB 3M7DA 1ZYQA 3LP0B 2RMLA 1BG3A 2XO6A 3R8EA 4F25A 4QZBA 2EVZA 4WP8A 2KJ5A 1M1KO 3ZDAA 1LWEA 4DR5J 5HVGA 3TUJC 3WK7A 4X64J 1S8OA 2KL8A 1WTFA 3UR3C 4M63A 5C2FA 3S41A 3C2LA 1A0OB 1BQXA 3CPEA 1VFJA 3H40A 4F5PA 5T41A 3LDOA 1VQNN 1BLUA 1NPPA 3TARA 3AVFA 2NRVA 3LW5C 5IFMA 1BPZA 4LF5K 1RHQB 1P9QC 4ZVQB 3VGLA 1E4FT 1M90T 2YCHA 5D0GA 2WF8A 3EY1A 2KNJA 1WHVA 1S6PA 3RSEA 2HLUA 4TY8B 3LP0A 4BDYA 3OQ2A 3AVNA 2RRNA 2A3VA 2EFOA 4C3KA 2FJWA 5DDQC 1ZQZA 5IC6B 3D54A 1CSJA 4FO6A 5KG7A 1F1BB 3DLJA 2CPFA 2ZXHA 4A62A 1RWOB 4NMLA 3RMAA 4WFBL 5AQZA 2G0JA 1VHFA 4USMA 2D3DA 4Y6IA 4R66A 4UTGA 4K8RA 3R5AA 5AQSA 5D0RA 2R7TA 4J9PA 4CO4A 1M1HA 1A5XA 2AGPA 4DR4K 1U6BA 1B99A 1QE1B 1X7VA 2ZJ5A 4TY8A 5H1SQ 1N5SA 2O66A 4ECUA 3KKAA 5E3PA 4Q0BB 3OTBA 5K9FA 3CJ8A 5J2CA 2P6UA 1RT5B 1ZXOA 3VQ4A 2ZE2B 3G86A 1HI0P 5F8HA 1IN0A 2XI3A 4WTOB 1K9MO 2DQNB 2P9IB 4DR1F 2AP6A 4TY9A 2V4RA 1VHXA 5KFOA 5CXTA 4DSKA 1WC0A 2PAVA 3C2KA 2YNFB 4BXOB 3WC2A 2UVVA 4RT3A 2VASA 2EH9A 2ZJQL 1KXPA 4FLWA 1QAXA 1QE1A 2HQFA 4CHNA 4DU4A 3R5DA 1KEJA 2IOFK 2FMSA 2WAQC 2Z1JA 5AQKA 2B9WA 2EKNA 4K8ZA 3TP2A 2PY5A 4JI6K 2UVRA 2Q66A 4RU9A 1RT5A 5IC4B 4U7CA 2ZE2A 4HCBA 1BQMB 3NNHA 2NLXA 2D69A 3HM9A 3AOBA 1DTQB 4NLWA 2QJ3A 2LEBA 1IBMJ 2P9IA 1WWHA 2ABYA 1L8OA 1HRHA 4UOGA 1OYEA 1S79A 3QPIA 4ZOHC 4KLIA 3O9SA 1N5VA 1D9FA 4UZBA 2DH9A 1RILA 3OD2A 3ALYA 2YNFA 4BXOA 1NGGA 3OXFA 2ZJRL 4DV2K 2J9DE 2DXDA 1KAZA 2WVFA 5CY4A 1T9WA 3CJKB 1FNMA 4ETXA 4BRQA 2CQDA 2CRXA 1R59O 3QB0A 3NBPA 2G06A 5E2QA 1BQMA 1ZQMA 2AJ4A 4A5BA 4JN4A 3B8HA 1DTQA 1HNXK 2GELA 4C3LA 1J2VA 1ZRNA 4J2DA 5HAOA 2J0WA 1S0VA 2WB1C 3ZDEA 8ICYA 1XC9A 4FS2A 4QYZK 4BRLA 3WUHA 2ZUCA 4NLZA 1Z19A 5ALQA 5C2GA 2ZUDA 4DV6F 4F4ZA 1RBVA 1Z2LA 4U8VA 3GV7B 4FJ7A 2I38A 3ULHA 2ZF5O 1M5VC 5IQ6A 3HKZF 1WG5A 2H5EA 4GY2B 3N7SC 3CJKA 4RJVA 4AM6A 2K2PA 2BGWA 4F7VA 4K0KF 1WLJA 4LSNB 1ZQUA 3U7JA 2ZM6F 4FPBA 3CIMA 2Z57B 1PKUA 4UOCA 3MEKA 3LP3A 1JRPA 4Y2QA 3HL8A 4UOHA 2FIUA 2EQYA 2KIWA 3PO5A 4FWNA 1XUPO 1B92A 2X3DA 5LMUF 4J91A 4JI1K 3H20A 3OLAA 4P4OA 1RXOB 8ATCB 2QWQA 4J8FA 1HYSB 1NJYA 3LDNA 5CR4A 3P5TL 2GJ2A 3DMJB 4FK0A 2W04A 1XNRJ 5IXUA 4B1YB 3TAMB 1IXKA 3TFSA 1N34F 4LSNA 1FESA 1YBTA 4OX9J 3H98A 4CLSA 3HW8A 4Q5VA 1WBBA 1QCKA 3A5NC 1S6UA 3WHIA 4F67A 1IBCB 4ZPBA 3GE1A 3LM2A 4IO1A 2ISPA 1AYEA 3IG8A 3V9UA 2DNNA 3JYTB 1G15A 4M7YA 3UXOA 2ZOGA 3D5MA 2XRIA 1HYSA 4QR2A 4RNFA 2KM8C 4RW8B 4DR6F 3NVWA 3EKUA 1YJ7A 3DMJA 1AW0A 4OKKA 3OBWA 5J0UA 3TAMA 4GC7A 2OH2A 4QWEA 2OLWA 3FZFA 4F4KA 4RKUC 3GR0A 3IBWA 3CCLN 1VCTA 1UW4A 5DG8A 3VQAA 4WF9Q 4FDFA 4RG8A 3AA2A 2YXLA 1WDTA 3DXBA 3TADA 4QW9A 4DL7A 2WVCA 4RQMA 3CJ7A 3ZTOA 2HQDA 4F26A 1D8LA 1RP5A 2OP5A 3JYTA 3QWUA 4KT0C 5CJ7A 5K8MA 3R1XA 4A8EA 2Q1LA 2VPXB 4RW8A 4MQ3A 1VR6A 1ZXIA 2OSQA 4CE9A 3SYZA 1VQ6S 4CBUA 1VQ4N 2ZTCA 3DI6A 2NZ4A 5KPTA 4KFBB 2ZUAA 3FEZA 2Q36A 3VAMA 2V9KA 2BEFA 4QPTA 5GAEI 4CLFA 4M63C 2H3FA 4ANCA 1Q78A 3C2MA 3CCSS 7ICPA 3C14B 4DV4K 3CT9A 1GMWD 3IRXB 3OGUA 1MWQA 3QEPA 1HBOB 4WCEL 1Q3UA 3ZSWA 4RW9B 2XNRA 2ITGA 3K7RA 1NJWA 3PMNA 3SAGA 4CHPA 2P6RA 4NLGA 3SBTA 1U8SA 3MMCB 3ZNUA 2QMUB 2V9WA 5A2QY 3IR7B 4B3SK 3NNAA 3HD1A 2BA9A 3DYAB 4KFBA 4DV0F 1DRGA 4O5CA 8ICOA 2R2UA 2EG1A 4DSIA 3VA0A 3VAIA 5ALEA 5KFBA 3CCRN 2LVWA 4NI2B 3K9JA 4IQTA 4BRMA 2HHHF 3C14A 2C2RA 3Q7CA 2EZYA 3IRXA 2DR6A 5GAGP 2PI5A 3ZSOA 1HBOA 2KD1A 4JI0K 4RW9A 2YB4A 1XS9D 3NMUA 2QLWA 3NGRA 1YJNN 3HF5A 2NYVA 5KFYA 3MMCA 4NLTA 4B3MJ 2CVIA 1W2BM 2O8DA 3BS7A 3CCWA 2YQ3A 1WC4A 2WHEA 4YHHK 4C8LA 4CLYA 3NH2A 3KKAC 3L09A 4X4SA 2ZJRQ 1YQHA 2CPDA 3AH6A 4E98A 1Q1KA 4BE1A 5JS1A 4NI2A 4PZOA 4MHVA 2PYLA 4FYDA 4O0NA 2ZBPA 2C2DA 3ZSYA 5B0FA 2ROEA 3DU5A 3J81O 3MR5A 1F3VA 4LF2A 4F3TA 1FWPA 2F9JA 2E9ZA 2Y1LB 3QEXA 1HA1A 3CDEA 5IS2A 4A61A 2Y9UA 2GO8A 4GVBB 4X4OA 1J5EK 3RJFA 3MUVP 4O0JA 1E3MA 2OFHX 4WQ4A 2AZ3A 4M42A 4GV3A 2NO4A 4JV0A 2FC0A 1X4HA 9ICWA 1UWBB 1W7WA 3NAIA 4A4JA 3DKDA 2KG5A 4LUBA 2BUPA 2QLBB 3C0BA 4LRBA 1MW7A 4JI5J 1NZAA 1YTUA 3MECB 2B7BB 2MZJA 4B8AB 2D6FC 3ENWA 3QUTA 3HSDA 3MM7B 3M8PB 5FRMA 3ZDCA 4CGJA 1WC6A 4FLUA 4CF2A 1W7AA 3R2CJ 3KZXA 1ED1A 1WCLA 4KITB 4GVBA 4OZ0A 2AJ0A 1IWGA 2QW9A 2XMTA 1ZQAA 4EYHB 4NRTA 4DV3F 3GYNA 1S4EA 2ZHAA 2YQEA 3MHYA 2LMRA 4KBOA 3QFPA 2HHWA 1WAFA 3K4GA 1UWBA 1J2MA 3K0SA 4YB5A 3CMAN 4KR0B 1VISA 3VQBA 3IUCA 1AXQA 1JLGA 4Y2RA 2E1ZA 1ATNA 3RWUA 7ICQA 3MECA 2GHVC 4ZDNA 2GUPA 1TP7A 2ZTEA 3RJJA 1J6ZA 3MM7A 3M8PA 4FYXB 4NYFA 1PCAA 5KAFU 3MX5A 4B02A 1WSFA 5ELZA 1HW8A 4K2JA 1N5QA 3T1HJ 1TZ0A 4LSZB 2XI9A 2IM2A 4HDHA 2E6MA 2ZC3A 1W97L 2XHCA 5A0LA 1SB3C 1RTIB 2JNJA 4OPJA 4PWWA 1RWWB 3HCXA 1UKUA 5GTHU 4F9OA 3KLEB 3GILA 4HHUA 1XNQK 1NI3A 2G0CA 4IS7A 4X4TA 4B3RK 2FPLA 3FZ2A 1NGFA 3MXJA 1U7LA 3OR1B 4XDDA 3ZX0A 2MLXA 5GIOA 4Y2VA 2VC1A 4DHYA 3ENAA 4WJ3B 2YWGA 4BGBA 1GLDG 5M2RA 3ED5A 1RT4B 3AFGA 2PFFB 5D0EA 3K89A 1BPYA 3TVYA 1YXQA 3VQDA 3JSMB 2HNZA 5IIKA 2XS2A 1FXDA 5M2PA 1ZBFA 4PGXA 1RTIA 1HBNB 1WG8A 2BKNA 4ISGA 2LI6A 2HI0A 3KLEA 1BUPA 2F40A 2Q6BA 5J1NA 1YJ9S 3IFRA 3ICXA 2WFAA 1H2UX 2F9WA 2GHWA 3MAHA 4NXNK 1S9GB 3J7YI 3M6GA 2D1KA 3L3VA 3NGDA 1W2BR 3F0NA 5LOQA 4Q8EA 1BY9A 2XY8A 1QQ7A 3OR1A 5H9FK 3EKSA 3KJQB 1RT4A 3MXMA 4OZ3A 2ROGA 5L8RC 4KHRA 4ZN3A 4WCEQ 2H1YA 2NXCA 3JSMA 1AUDA 4FM2A 5CP2A 1FDNA 3C66A 1Q18A 2AWZA 1HBNA 1V38A 1ZQWA 5AKXA 2GIFA 4PGYA 1T95A 1P1TA 2KI2A 3PW7A 1F3FA 4H5TA 1S9GA 1FE4A 4FJGA 3DDHA 4YG2A 3TADC 5AI5A 3VQ9A 4PHPA 4ED6A 4H0PA 3TUZC 4JOUA 2CG4A 3FC9A 2HEKA 2XGQA 3L7UA 2R7SA 2AV5A 1CJUB 4JYAF 3A8YA 1SV0A 3FZBA 3ZETA 2UXCJ 3KMQA 2KT3A 1HYVA 4EEYA 1EIYB 4RW7B 3RRKA 4DTUA 4R64A 4FN5A 3ZDDA 2WF5A 3OSNA 2ETJA 2CQGA 2ROPA 4Y2XA 2P5VA 1G2EA 3EJMA 4LBHA 4M3WA 2IBOA 1OY9A 3EDRB 2EX3A 1GH8A 3S3MA 2MKCA 3ISNC 2BMBA 3TR8A 2O01C 2QEXN 1T9YA 3SXLA 1F0XA 2B4VA 5CHCB 3NVZA 1Q95G 3MM6B 3BH7B 1BA0A 2DHXA 2HRUA 3FKBA 2LLZA 1CJUA 3MGVA 3GDXA 3WKDA 4OLBA 3O1WA 4XAKA 4BQZA 4RW7A 4CD3A 3UNGC 3M3ZA 3E01B 5DB9A 5HL7L 1KS2A 4WIIA 4FJ8A 1N56A 2Y8YA 2OJ3A 4F02A 1B43A 5GAHU 3TJ8A 2C3UA 5AXKA 4XDCA 4GMKA 3TX0A 5IIMA 1QTNB 1GEHA 2KN4A 3BP8A 2B7CB 2FC8A 1JNZB 3NVMA 1X31C 4R0JA 5H2FU 1JL2A 1SJRA 3MM6A 3G9CA 2G8WA 1TUUA 4Y1DA 4W4MA 1S99A 1NEEA 3OL9A 2OEKA 3ZTRA 3BBCA 4LVNP 5DK5A 1HNZJ 5T7BA 4HWIA 2VL1A 1UP1A 3ZTPA 4ZN1A 2IM1A 1ZQCA 2LA4A 3IRUA 1T9TA 1H3DA 3E01A 2FLPA 2ZH7A 5JLFA 4I67A 4DTNA 3FGUA 4DV2F 3QNWB 1VBYA 2E1PA 4RR5A 5HHIA 2DY1A 2P9UB 2HHUA 2RRBA 4CEOA 5J0RA 2NPIA 1Q9YA 1JCEA 5RUBA 2MQ8A 1SVDA 2FSKA 4BRHA 1SJFA 5HRNA 1LWCA 2G2ZA 3M1VB 3NS1A 2RT3A 3IM1A 2Z8QA 1HKBA 5KG0A 3FEXB 4WQ4C 1NK4A 3FJ2A 4IG3A 3F73A 4YXJA 1HD0A 1TK8A 4CM0A 5SUHA 4PPDA 5ETSA 2A3JA 3NCPA 5HMMA 1K0TA 1WBDA 3NF6A 5BRDA 1NGIA 2QT7A 4YN3B 2A5XA 1S5ZA 3H8JA 1NB2A 1BWVA 5E79U 5J0OA 4WKRA 4PKGA 3LZIA 4DL2A 2CPYA 1KD1T 3WEEB 3AUOA 1DXSA 5DDYA 3P96A 1P90A 3CCMS 4A8SA 3MR6A 2AJFE 4JI7J 1WHYA 3I28A 3M1VA 3H08A 3QIPB 2DNHA 2FVRA 3IHQB 2ZOMA 5KRTA 1PAUB 3BEGB 3NMAA 2RH3A 1BE4A 2P9LB 4MJKA 2G8VA 3W5ZA 4OJ1A 3MEDB 1RWXB 1VRQC 3QEAZ 4Y2IA 3KWIA 3CJ2A 1WHXA 5DZ7A 1JN3A 1X40A 1YJUA 3WEEA 3EPGA 4M3RA 4PPZA 4WJBA 4RWXA 4H4MB 5THWA 1IBKJ 4DU1A 2XHBA 4OMFG 3W63A 3QIPA 3BZCA 2KW4A 2C22A 2B51A 3LALA 2CPIA 2MTLA 4MLEA 5KFTA 4RT2A 4FWSA 4FM0A 1R0BG 3AU6A 1WORA 3MPDA 2MUTB 2P9LA 4TURA 4YDUA 4KX3A 2GX9A 1WG1A 2DK2A 3MEDA 3SQOP 1OO0B 3QEBZ 3CMEN 3V9ZA 3OFEA 3THXB 3KOOA 1U2FA 2OD6A 1X5TA 2FJEB 3H8MA 5KOXA 2W8LA 1Q81T 4JBCA 3CDAA 2KQ2A 4OJPA 4FXDA 5GADP 3A1YG 4H4MA 4O3OA 2F7TA 5BYSA 9ICUA 3C6HA 1QJHA 4ZCLA 2K60A 3CCUN 4WPAA 3LVWA 3RYLA 4AFFA 3CQ8A 3Q8MA 4Y2YA 3DLGB 1NB7A 1VQ5N 4FZXC 2F8LA 1EHWA 3AVHA 3AY9A 4FWRA 2A18A 2MUTA 3PZPA 4O3NA 4O44B 3C1ZA 2R9LA 1SV4A 3THXA 1P9YA 4DL0C 3HOTA 4MIWA 3BR9A 1H0HB 4QWCA 2FHJA 1SH3A 1SQEA 3HSTB 4CIEA 2LQ5A 2CGJA 2BKEA 3CCJS 4DV4F 2C1EB 1TMMA 5CD4A 1YRTA 4USVA 2ZHBA 1U1RA 4M5DB 1D8BA 2E3TA 1EZZB 2E66A 2VH7A 3DLGA 4AQYK 3QRRA 5AKLA 4HYKA 5ALDA 3D6JA 3WIUA 4IEEA 3FQKA 4FVMA 3T9ZA 4O44A 1X9WA 3TVKA 4B3SF 5AI8A 5HL7Q 5M1FA 4K59A 3WX8A 3UN2A 2E5IA 4BR5A 3QAEA 2FGOA 4BVPA 5ALWA 1HHQA 4NCAA 4YMNA 1NGCA 2ZWHA 3CCVS 4B08A 4DX5A 3LTOA 3OFHA 1SV0C 2HBLA 1FRKA 1HI1A 1RHJB 1VBKA 5LM7E 4CLKA 1RJJA 4M5DA 1JJCB 5HBMB 4NEYA 2F44A 3VHQA 4JI0F 4HI2A 4KRFA 3MPUB 4OYAA 1W25A 2EFNA 2E9TA 2DNOA 4OZ2A 2HMXA 1KBRA 4FKXA 2MAXA 1DHMA 3I4HX 2CQPA 1ZS6A 4HTJA 1RAAB 4OIXA 2NRWA 3B82A 3U26A 3MOZA 4KC5A 4YOXA 4YHHF 4X66K 2N3LA 1UOCA 1WC5A 1Q8LA 3KHHA 3QEWA 5L1IA 5LT5A 1VBXA 1O6XA 3QYYA 4EBCA 1RWPB 1TAMA 4NY8A 2GO9A 4MFCA 2VQFJ 3ZX2A 1WG4A 1OIAA 4BRCA 4FXVA 3TJAA 4DF4A 1ATRA 4V19S 2VKRA 3P83D 1RSCA 4PHTX 4DUYK 3R1LA 1UETA 2WONB 3N7PD 1LQ9A 3W8GA 4AL6A 5HBMA 2KO1A 4FWKA 4BE2A 2ZBRA 1U1NA 4DUZK 3UMBA 4ZVOB 2NUHA 5ITHA 1QH9A 3RAQA 4FF1A 4N47A 1J5EF 4C80A 4DI6A 3VGKA 4EP5A 1K47A 4M5JA 4Z4GA 1G7CB 1Y7PA 2ASMA 1JCGA 4BS2A 1DFDA 3K1ZA 4ZVTB 3AHPA 2EWSA 4WFYA 2LQJA 1HWLA 2R8HA 3OW2R 2LKZA 3CD6S 4PWDB 4U9RA 3RB4A 1LB2B 1VHIA 3RVCA 1FFUA 2WONA 1SXDA 1GLAG 1JL1A 2NCKL 3BKUA 5KFXA 2VICA 5F8JA 1E6YB 3FBEA 2FVSA 2F65A 2HRTA 3ZZUA 1S48A 4IBNA 1VOMA 4Y1CA 3NRZA 3T9NA 3WKAA 1P6TA 5D49A 1RAGB 4JV5F 3DM2B 2MSTA 3MBYA 1KVCA 1A6SA 4YOVA 1R8CA 4DG1B 1FX4A 2OI2A 4KKOB 3SNNA 1RAOA 1L3VA 4UOFA 1R0CB 3VF6A 4PWDA 4LVOP 1OKJA 1VDVA 1JLFB 5G0RB 2KIVA 2JGAA 3MXHP 2CPRA 2R8GA 2E1MC 1E6YA 4CGFA 3PVXA 4OZNA 2HFUA 4E7LA 3VQ7A 2CJXB 5GAGI 1VRTB 3DM2A 5EX5A 1T44A 5KL1B 2Y9HA 4CO0A 3VCBA 4DG1A 1XJWB 3CDUA 4KKOA 1O08A 4J9SA 1FDBA 2E88A 3DDIA 1R31A 1PK1B 4DV6J 4KJIA 3CJBA 1CS4A 9ICPA 3W2WB 1LKZA 4B3RF 5KTQA 4YY3K 3WNEA 4TUSA 1JLFA 2CJBA 5G0RA 4NB4A 5AM0A 5E0OA 4AP9A 1UMJA 4K0KJ 3PEJA 3ID6A 2YKOA 4ZJLA 2GEMA 2OZMA 8ICPA 4L75A 1HHSA 1RCHA 4UY8O 4OX7A 4EENA 5KFPA 2P5OA 1DOQA 3CI5A 3PKYA 2VWBA 4OYBA 4PRFA 1VRTA 2EBGA 4CWBA 3KXDA 3M8YA 1LK7A 5LMUJ 4O0IA 1I51B 2IDOA 3Q8YA 3AOCA 3CC7S 1PK1A 4WU3A 1ZM4A 2N4DA 4NXNF 4BREA 3W2WA 3L2WA 3MCNA 2HFOA 3WXLA 1O5JA 2J7KA 4DXLA 1WELA 4M5KA 3CEDA 1N34J 4GKKK 1H1VA 4I4BA 3HJFA 2PMHA 4CD1A 3L4BC 3AGRA 1S7HA 2Z4PA 1FF2A 4M04A 1URNA 4YDUC 4KBIA 5FLXY 5AQUA 2GQCA 1VSMA 5F9NA 4JLHA 5ALPA 1F9HA 5KL8B 2X1GA 5IWAJ 1FRJA 4ZOSA 4BRIA 1YZ7A 2W2QP 2HBQB 5TKYA 4CZJA 1UT5A 4ZPVR 2E5HA 1HARA 2ASYA 4DR6J 1ZBUA 2ZJAA 2C2OB 4M9JA 4CFCA 4FLTA 2QE5A 4LH5A 2G8HA 3VQ8A 4ZITA 2V7YA 2MXYA 1KTVA 3AODA 3I5BA 1S9FA 5BXIA 4H5NA 3AOAA 4DCOB 1HJRA 4BRGA 2ZTDA 2E5GA 2FGCA 1BCMA 3ITHB 2K3KA 2BE2B 5LJ5Y 5FROA 1SCJB 5DG9A 1ATSA 4BC3A 1RU2A 2V4QA 4Y2JA 3M6VA 1AUSL 2CFXA 4QPXA 4X4QA 4P2HA 3QT7A 4EX7A 1PJ5A 2RS8A 2X51A 1WC1A 1RT1B 3AO4A 5EGYA 4O8UA 4NL9A 1YBUA 1NLKL 3MX2A 3PEHA 3LVVA 4BRAA 2BPGA 3C23A 1ZQBA 2DHGA 3CJ5A 3Q0AA 1XQSC 1HNVB 3GV5B 3VERA 2CJAA 1UTAA 2HZVA 2KSOB 2FY1A 4M94A 2XS7A 3QSIA 9ICJA 3CJ4A 4OI0A 4BR4A 2Y0BB 3ITHA 1HR0K 2BE2A 2MSSA 2D9OA 3IWNC 3T1YF 1RK8A 3SCKE 4Y28C 3HSGA 3TRGA 1HIYA 3CM5A 5B7WA 4I6YA 3BQ2A 4P75A 3O3FA 5KT2A 1RT1A 4C4TA 3MGIA 3PXGa 3RBXA 3C46A 2EAPA 3A8JA 5EE3A 4CERA 3MURP 2D0AA 1HNVA 2Q0RA 1RT6B 3B4DA 2JXJA 3N6NA 4CI0B 1JXVA 8ICNA 2KSOA 4XQ8A 3D0GE 1V4TA 2XCAA 1DGJA 2HHHJ 3CERA 3K0JA 5LMNK 2DEIA 3V1RA 2BABA 1IR0A 5AJ3F 4FE3A 2JHDA 1S5LU 4OI3A 1RI7A 3HJVA 4RPFA 1SWWA 5AQIA 1CG2A 4X4RA 4W5NA 4IOXA 4LMZA 4FF2A 5KFAA 2JDJA 2J7WA 2VFSA 5EOYA 2W03A 3IAM9 2IHNA 3BGFA 2VCPA 4PXDA 1O8BA 4P7TA 3RBEA 1RT6A 4B8CA 2BQUA 3C6TB 2A6OA 3A5LC 3FEYB 1FRMA 1ICEB 2DNKA 2YBVA 1U1PA 2MY8A 2CQ4A 4CH0S 4DPTA 1U0HB 4PYDA 1GTEA 1M90O 5BYRA 3OHBA 2JFKA 3SUOA 1TKXB 3Q8VA 4KY3A 3V4IA 1IXRA 4LY7A 1VLYA 5GTIU 4M1KA 1X1PA 2IDEA 4P74A 2OELA 3R27A 1DK3A 3F5AA 4QOTA 4Y2TA 2IM3A 4H0OA 3TACB 1F6TA 5EE0A 1EO1A 4L8RB 1MN9A 2RU9A 5ETPA 5B0CA 4URQU 4A2AA 2RSQA 3SUNA 2OCEA 1JB0C 3I0SB 3I55N 4HUEA 3SDEB 3ETMA 3DLLL 4MO4A 3CJ0A 3CD5A 3H42A 1U0HA 1Q46A 2DGZA 2NUUG 4DTPA 1TKXA 3PW5A 4Q2LA 3BQ1A 3LGHA 5AM5A 1VQ4S 3L2UA 3CNHA 2UUCK 4UB4A 3MDQA 2YKNB 4A5AA 2XO7A 4M9HA 3C65A 4DV3J 3VOVA 3GIKA 2HVDA 2M0NA 1WSIA 1C0UB 3TWHA 5KFIA 1VQKN 2BPFA 4ZA1A 4F4AA 3W65A 3I0SA 1WNEA 7ICMA 2JH7A 2I8EA 3SDEA 4BG9A 2I2YA 2R8KA 3UQ2A 1RUSA 3Q83A 3DRXA 5GVQA 1VQMN 4KI6A 5GAHP 5KFSA 3MM5A 5KQDA 4AD6A 4BRKA 4PG5A 3O2IA 4V19X 4ZCIA 2E44A 2RD5C 2IJNA 4XPEA 1S9EB 2BVZA 1YHQN 5AM4A 2DHSA 2NYHA 2YKNA 2Z56B 2P9NB 4KGVB 4B3OB 3HP6A 4NXZA 2DNPA 2N4CA 3VAJA 1T4GA 3LA0A 3PYGA 1RDDA 1BPDA 1ZQVA 4DFPA 1C0UA 2W4DA 3PNIA 3ZZYA 2CQ1A 3VZHA 3R5BA 2CPZA 1DZ5A 2YV0X 4IH6A 1GT8A 7ICTA 3CMQA 1YJNS 1FRXA 3F5TA 2Q2RA 3VGVA 3GFZA 3WQPA 1RQLA 4IQUA 1XSLA 4GW6A 1S9EA 3VAGA 4LF6F 2XYGB 2BDUA 4AHVA 1SJ1A 1ZRMA 5E3QA 2P9NA 4PZVA 2XTJP 4OI6A 1D4XA 4B3OA 4FWQA 4ECVA 1WI6A 1ZQJA 2KG1A 2F8EX 4DX7A 3IDWA 4IUFA 1RWNB 2PC6A 4Z7YA 4P72A 1NK7A 3PTWA 2X1AA 4EYIB 3NWRA 1D9DA 3R9PA 1XSNA 2QTDA 2BQRA 3KIOA 2CVEA 2E2NA 2PMWA 4CNYA 1EX4A 4PGQA 2HG4A 1FJ7A 3EPIA 2Z7JA 2R8IA 1MU2B 3UW1A 4AQYF 3EGZA 4NPOA 2PFPA 3MN5A 1QD1A 2GMHA 3THTA 2H5XA 4G1QB 4BC7A 5AKEA 4MEXA 1C2PA 4H0XB 1FKOB 3LPUA 1COKA 3ZT3A 2PMZD 4YN4A 1N54B 1X5SA 1ACMB 3HFKA 4LF5J 4FWMA 1BU6O 4H0YB 5D0HA 3EE9A 3BYRA 4Z4HA 1S4FA 3DLKB 4KV8B 5J2DA 2W25A 3RB0A 4CEQA 5KG4A 2JL9A 4FFDA 4ZP6A 4C8OA 3G6XA 2F4FA 2MZTA 4LREA 2EZZA 2JLEA 2C2MB 5EOZA 4QS8A 3PW0A 1MU2A 3CF5L 1Q86T 2UV8G 3OPXA 4E0DA 3WC0A 3SMVA 4G1QA 1KL9A 1LVHA 3UN3A 3HVWA 3KNAA 4JYAJ 4NL9C 3JPOA 2FXUA 5D3GB 3QGPA 4Q2MA 1FKOA 2MLZA 2VOOA 2YY6A 2GX8A 3TU5A 3CMAS 3UFCX 1EWQA 2CWKA 1R89A 1KDNA 4K42A 3SQ0A 2CG8A 3V9WA 2GOLA 3THWB 3AVCA 2NS1B 1NHUA 5AQGA 3B4MA 4KV8A 1C0GA 3SCIE 2O8BA 4QBUA 4NASA 3NEKA 4DUYF 2AQ4A 4CK2A 1ZBHA 2D0PA 1RYUA 3CO9A 1TVAA 2E8OA 2EXUA 4O3PA 4F5OA 3HHKA 4DUZF 3NMRA 2QL5B 3I5AA 5GADI 2GV9A 3VQCA 2W54A 4HUGA 4KSEB 4ZHRB 2CQHA 1NH7A 1L3KA 1Z25A 2I9GA 3KJVA 2VQEK 2V4JB 1RPLA 4GRSA 5D3GA 1N0VC 5MLCQ 3G4SN 2LYAA 4FF4A 4P2MA 4AUKA 1BDGA 3QUQA 8ICFA 2MYFA 3BBFA 1NJIT 3THWA 1U6ZA 4DPWA 1YWXA 5FD1A 4QU6A 3LH2S 3RB6A 4RWWA 1WSEA 4BROA 4OPKA 4DOAA 1WJ9A 4CGHA 2FMPA 2V2VA 4EUVA 5BR8K 5G4DA 1RLDA 4JI6J 3W7BA 1UAWA 1VSEA 4ED1A 4ZHRA 3TAGA 4CZHA 4GKJK 4J7CA 1YJVA 5M1NA 1GX5A 3Q89A 4CYUB 3B6BA 2DGQA 2GCFA 3DOKB 4ISEA 2DNQA 3H0PA 4NZ0A 1ULRA 1S59A 1MMLA 5ETVA 4DB3A 2BRLA 2XM3A 3D6TB 1W2IA 1QAJA 4BQLA 2B3TB 3KLIB 1Y5LB 1HYZA 2FJAB 2D41A 4DV2J 4QIWD 1AB8A 2QSFA 5EX3A 3NH1A 1WWVA 5KGXA 1F9EB 4L72B 3VAFA 1F2GA 5AKKA 2DISA 3BN4A 3CC2N 2LM1A 2RJZA 4L76A 3FE1A 1UEKA 4ILHA 4WZQA 3D2FB 1XMOK 2MZSA 2RF2B 1MA7A 1H38A 3MMBB 5F8LA 3CRXA 1EB0A 5ADZA 2K8GA 3WKEA 1ZQEA 2G5HB 2O4GA 5EY4A 2E4LA 4DQPA 1X42A 2KKZA 3AO2A 2MB0B 1PO6A 1ZM9A 2XMVA 3DOKA 4EHTA 4QYZJ 4ID8A 5ALRA 4MFAA 3LDAA 3W3DA 3KLIA 5HMYA 1Q8BA 4DKWA 1QTMA 4O55A 4K4TA 3NFAA 1XQIA 3CC4N 2LHTA 3HYFA 1U2RA 2AJ2A 2EEYA 1TL1B 2V8VA 1GOAA 3OS1A 4OLPA 1XR5A 3D2FA 1KLMB 2RF2A 2MY7A 4C7QA 2CUYA 4LF8K 2JRZA 2ZUGA 1HWJA 3CDWA 1WSJA 3SMZA 1XR6A 5ALKA 2DKZA 3SENA 4YQWA 2BCQA 1QSSA 3GP9A 1VQ7N 1IKWB 3HHDA 2KHQA 1QAYA 3OTDA 4JI1J 3JPRA 4DU8A 4LJMA 1YVFA 4GVMA 1NU0A 3RJGA 2RQ4A 2QEXS 3UD5A 1TGOA 2L9NA 2Q6CA 4HTUA 2O8FB 2JH3A 2JWNA 3J7ZT 4ES3A 3OJUA 4RQ0A 3GE9A 1YJRA 3MAQA 4OL8A 1YIJN 1A5WA 5DB8A 1VK0A 1TL1A 4CF8A 3OPKA 1KLMA 4RBUA 5CEHA 2QO3A 1WSVA 2VIXA 4DSLA 1M0SA 3RB3A 2W7OA 3VQPA 3HSZA 1DQ9A 1REGX 5BN8A 3P6YC 4F50A 4NX9A 1IKWA 2DGWA 4ERDA 3QBCA 4LJXA 3A4TA 5EUHA 3IG1A 4YCXA 1FW6A 3EGWB 5CH7B 3RJMB 3QU7A 2RE2A 2O8FA 1Z05A 4MYTA 1EARA 2VFUA 4RU2A 2MPUA 4CJ3A 1NDPA 5KFMA 5D6GA 2HZCA 1YF5L 3SUQA 4BWJA 4DFDA 3MDCA 3SSRA 1XHXA 4DR3K 4DSFA 2HHSA 1KC8T 3OSPA 3EDQB 3WXKA 3NF9A 3EUB2 1RKJA 1V3RA 4CZFA 3L9ZA 5J2MB 2WZ1A 4AL7A 1SZ2A 1QLNA 3SMPA 3QO9B 2ZH9A 2NRRA 4IH5A 3CF5Q 3RAXA 5KGWA 2A10A 2XZDB 2F9DA 3WXMB 5B8HA 5JJBA 3ZSRA 2AZ1A 4PKIA 4NLUA 1QQOA 2VA3A 4DS4A 4JI2K 4HAIA 2UVWA 3MCPA 2CJQA 3TABA 2E2QA 4W5TA 2GQ2A 4DQSA 2CH6A