1NK4A

Guanine-guanine mismatch at the polymerase active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk4A01
3BDPA 3TR8A 2QKKA 1LAVA 4DSKA 3CM5A 1ZQVA 4DL3A 4F91B 3D0PA 3ZT1A 4F2RA 1RBTA 3MDAA 3PX6A 2KZMA 4DQIA 4RQ4A 3IAYA 5J2EA 4PGYA 1ZQWA 3QEAZ 3BGRA 1I3AA 5J0PA 3AV9A 1Z00B 5IIOA 4I9QA 4FXDA 4R5PA 3Q8PB 4XQ8A 4J9SA 4B9MA 3SUNA 3RJFA 5KFYA 1WAJA 1FKOA 5BOMA 5IIMA 1RBUA 1B92A 2ASJA 4CJLA 4CFCA 4CJ5A 4N41A 4PUOA 3OVNA 2ISPA 3RJJA 3THVA 7ICSA 3T1AA 4ECXA 1HJRA 4J9NA 4Q5VA 5KG0A 5KFVA 2DFFA 4BXOA 3UIQA 3I8DA 4EP5A 5J29A 2W9CA 1KLNA 4HVJA 4CIEA 2ALZA 4CHQA 3KLFA 2UVWA 4B9SA 8ICWA 4FJJA 4BE2A 5TZVA 3RMDA 5DBBA 4OPJA 1XO1A 1CXQA 1U45A 3NFAA 5J0RA 3Q8RB 2ZTCA 1HYVA 3NHGA 9ICMA 3ZD8A 4YG2A 4P4MA 4ED3A 3Q8LA 4Z4EA 3AU6A 2B6AA 4O3NA 4QZDA 1TK0A 8ICZA 7ICLA 1C1BA 1X1PA 1ASUA 3SUOA 2KN7A 1BPBA 4CFDA 1A76A 2FMQA 3T5KA 4R8UA 1NJWA 7ICIA 4H8KA 4AHRA 1BI4A 2VA3A 4EZ9A 3HP9A 4B8AB 4R64A 4OGEA 2VWKA 4KLMA 3VQ9A 1L3TA 1TK5A 4OKJA 3TAFA 1BIUA 1TKDA 2H5XA 2J6TA 3P5JA 2KFNA 2JZBA 5HNKA 3RRGA 1S76D 1JLAA 5DBAA 4FM1A 5KFRA 2WONA 1TK8A 3NGYA 4LH4A 4BE0A 2FMPA 1QLNA 1TFRA 1R0AA 2YNGA 8ICKA 1ASVA 4KREA 3PY8A 3V9WA 1HMVA 2IDOA 1NJYA 4DF8A 3TAMA 3L2QA 2MUTB 4CCHA 1SKSA 2AGPA 5DGAA 2HNYA 5KGWA 3D45A 1MSWD 5J2CA 4B08A 1ZQNA 5J0SA 4Q44A 3K75D 2X78A 4KN7A 4MFFA 8ICLA 5I42A 2NRXA 1RILA 3V6JA 1JN3A 5DK5A 2G8WA 3QEIA 4KHWA 3IRXA 3GDXA 3O3FA 2AQ4A 3KHHA 2PFPA 2F8TA 1S9EA 4DSFA 5KFTA 3PVXA 3V1QA 5DG7A 1NK5A 3B0XA 2Y1JA 4JS5A 4RT2A 4LZGA 3EZ5A 4EBDA 5J0XA 4N5SA 2PFOA 4KLDA 9ICTA 2G8FA 1N5YA 4RZRA 1VRUA 4QOZB 2ZQBA 4FLXA 2FBYA 2W8LA 5FROA 4N76A 2ISOA 2KZ3A 5J2DA 2P6RA 3MAQA 4C8NA 3OYMA 4TUPA 1CZBA 1XS9D 4BDPA 3SI8A 4IQVA 1JL1A 2WOMA 1S97A 3EPGA 2C28A 4I2DA 3HPOA 4YN4A 3DYAA 5HRPA 2Q3SA 4CGDA 5J2MA 4OGCA 3ZSQA 3LDSA 3SV4A 3PUFA 3ZT0A 3EPIA 1EETA 1TGOA 1HQEA 2FLLA 5KG2A 4OJRA 1ZQXA 3ZSYA 3SPYA 3V9UA 4FZZA 1S1WA 4BGDA 4DL5A 1ZQPA 4KLIA 7ICMA 4CGJA 4FK4A 4HTUA 5KFBA 4KTQA 1U04A 9ICKA 3V4IA 1VSHA 3OS1A 3VA3A 2HHQA 1Z25A 4CHZA 5J2PA 1Z26A 4IBNA 4M9HA 4DFKA 2Z1JA 3EW9A 4KLHA 1KFSA 5F9LA 4YXJA 3RJGA 5KFSA 1XU4A 1HNIA 2RKIA 4MF2A 4R65A 2VANA 1S1XA 4JRQA 2HB5A 2IOCA 3MABA 4KLJA 4MEXA 9ICIA 4M9NA 1ZBLA 2BCRA 3V9XA 4ECZA 2LSNA 1ZQUA 4I2JA 3QO9A 3GV8B 4M04A 8ICAA 4KTZA 3BQTA 8ICFA 4CHNA 5KT6A 3LANA 4C8LA 4F8RA 4ECVA 3AVBA 3V9ZA 5KFKA 4KHUA 3TAPA 2BQ3A 4EYHB 3NGDA 1X9SA 2ATLA 4IG0A 3RJKA 1RNHA 3WNFA 4F4WA 5CY4A 2OWOA 1BGXT 3OYNA 4NM1A 1YT3A 3A2FA 4GXKA 3RBEA 1T03A 3V6KA 7ICRA 1QSLA 1YVUA 5EU7A 4CK2A 4KB1A 3PW5A 9ICXA 4XA5A 2A1JB 2AGQA 3ASMA 4RW6A 4CJKA 4M3RA 3ZDCA 3AO4A 2JEJA 7ICEA 1KFDA 3OYFA 4O55A 4YQWA 1NOMA 2YKNA 3KLHA 1N6QA 2OZSA 3JPPA 1HRHA 3ZDDA 3NAEA 1VSKA 1U48A 1NK7A 5L1LA 3C6TA 1SL2A 3LK9A 9ICQA 3K5LA 4LZDA 4CGFA 5J0QA 3GIKA 1D5AA 5KFIA 4J9QA 3AA2A 5HP1A 3DLGA 4Z4FA 4IRDA 1D8YA 3IG1A 3JSMA 3KD5E 4FJGA 3AA3A 3ZCMA 4KLFA 3T3FA 2JEFA 4BWJA 1JKHA 1I39A 4Q0BA 1TAQA 4W5OA 4RQ8A 1X9WA 1BL3A 3AO5A 4R63A 4QAGA 2HMIA 5KFOA 3CFRA 3PO5A 8ICMA 4YD2A 3BJYA 1PZNA 2IGIA 4RW4A 5DLGA 3K59A 4E3SA 3NDKA 1ZQKA 3HWTA 5KT2A 1RYSA 4FW2A 4DL2A 4M6WA 2FBTA 1JLQA 4CGGA 8ICYA 3LAKA 4K8XA 1NKCA 3VQ5A 5KI6A 3C21A 3ZT2A 4QZ9A 3MR5A 2HHTA 2XGPA 4UBBA 5HMMA 5HHHA 4RPZA 2BGWA 5HLFA 1ZQTA 1ZYQA 2XCAA 3SQ0A 1WSIA 3AVMA 4I27A 5IIKA 4FJKA 5K14A 4Z6CA 5KFEA 4TQSA 3HVRA 1KRPA 4QCLA 1HJPA 4HUFA 4Y1CA 1S6QA 3QINA 2I1QA 1LWCA 3ZSWA 5D4BA 1RTJA 4AILC 4PGXA 4OKKA 4UB4A 1J53A 2XO7A 2PZSA 3Q8KA 3KK3A 4F5OA 2HNZA 1AROP 4DFJA 9ICAA 2VA2A 3SNNA 3ALYA 3ZDAA 1NJZA 5C5JA 5KT7A 4HCBA 3PNCA 1SUQA 3QEWA 1RBRA 5DMRA 3H4BA 2Y1IA 4UB2A 1WAFA 3LZIA 1FKPA 4F5RA 1IO2A 3HL8A 4FJIA 2FPLA 2RPIA 4UAWA 1TL3A 2V4QA 3RMCA 3MXIA 7ICPA 3DI6A 2X6SA 4I2EA 8ICEA 2D5RA 5JUMA 2IS3A 1JLBA 3AO3A 1S1TA 1VSLA 3PV8A 4B9UA 2YNIA 3HT3A 3QNOA 2C2EA 4DOCA 4IG3A 5J2JA 1HYSA 1S1VA 4EEYA 4RW7A 1BPEA 8ICVA 9ICPA 2R8IA 5IILA 1XI1A 4K4HA 4GMJB 2FBVA 1KSPA 1A5XA 4DTJA 1LV5A 4RUAA 4DTMA 4I28A 4KAZA 3ISDA 2BE2A 5DG9A 4E7KA 1CLQA 1W9HA 3JPTA 2YHAA 3PR4A 1Z00A 4CJQA 5DB9A 2HVIA 4DQSA 3DLBA 4BE1A 8ICUA 1LB2B 4AHSA 5DQGA 3OYJA 4AH9A 3I0SA 4E7JA 2ZUDA 5KG6A 3HX0A 2HW3A 5KFZA 1WCLA 4FJ7A 1B9DA 4PHDA 3TFSA 4HUEA 2PFNA 3VQDA 4QZBA 2DFEA 4CF2A 1EKEA 4O44A 3RH5A 3T5LA 3KJVA 4I2AA 4KKOA 4ECRA 2QKBA 4PY5A 4KHYA 4F4ZA 4J9LA 4ED0A 3RBDA 1RDAA 2IAJA 3G6YA 5KFHA 3MR6A 3BQ2A 5FRMA 2IBKA 4O3QA 5KG7A 2OPRA 2C22A 3RJEA 4JV2A 3H08A 3V7LA 5KG3A 1XSLA 3DRSA 1FXXA 3AVNA 2XY7A 4RNMA 3HM9A 4BDYA 1NK6A 4FZYA 4FLTA 4CJWA 5EOZA 4UB1A 3VQ7A 4CK3A 3VQBA 4Z4GA 3N4MB 4FVMA 3MECA 5CYMA 3GIMA 1RT1A 2P51A 4RPYA 4IKFA 4MF8A 3G6XA 1ZQGA 5KT3A 2PYJA 3TI0A 4CEEA 4KLSA 3B6OA 1FK9A 3NH2A 4CK1A 1IXRA 1QS4A 3L2VA 7ICTA 4DG1A 4DOBA 4CE9A 2G8VA 3OYAA 1RT7A 1BPZA 1ZQFA 3OSNA 8ICSA 4LSLA 4YR3A 4FLZA 2YHBA 3P1GA 4DEZA 4CJEA 1IKYA 4Z6EA 1ZQHA 1S77D 3ISNC 4LY7A 5KFFA 4UAZA 3TAQA 2R7YA 2P5OA 3RTVA 4DSJA 4KI6A 4KRFA 1EXQA 1GOBA 3JPRA 3AU2A 4DF4A 3VN5A 4QWCA 4GC7A 1ITGA 2F96A 4O5BA 3EY1A 4JS4A 5KFGA 5SZTA 4I2HA 5KG1A 2F1IA 1QQCA 1RT2A 2W9BB 4FJXA 4BWMA 1B9FA 4CEFA 4LH5A 4CGHA 4DMNA 3QETA 1BPDA 2A1SA 4RQ0A 4EBEA 4F92B 5KFNA 4K4IA 3RB3A 2P5GA 4QZFA 4DOAA 1MQ3A 1BISA 4ED8A 2J6SA 2MUTA 4E7LA 1WLJA 4RQ5A 1NK4A 4W5RA 5SWMA 5J2HA 4DSEA 4PHEA 1ZBFA 3LDAA 8ICCA 4I29A 3UQ2A 4I2BA 1KCFA 4RQ7A 3OYDA 3RR7A 4KLTA 3SZ2A 1SV5A 4TURA 3AVKA 1SL0A 4FM0A 4UB3A 4DU3A 5DG8A 1IH7A 4CEBA 2ZJ5A 4KLEA 1T8EA 1GOCA 9ICRA 4QWBA 1COOA 1EP4A 2GV9A 4I2IA 4DLGA 4RNOA 3BQ1A 4E19A 4YMOA 4FZXC 4CEOA 4KPYA 1JLCA 3KK1A 3ZSVA 5HMLA 4JLHA 4J2AA 4RG8A 4O3RA 5J0OA 3FDSA 4IFVA 3K57A 4EZ6A 1ZQIA 3EYZA 4M2YA 4MFAA 4IQWA 3L2WA 2BCVA 9ICOA 3KIOA 5CJ7A 3ETLA 3S3OA 1WSGA 3RRHA 4CGIA 5EWEA 1Q9XA 3HO1A 3AUOA 3SQ1A 4KHSA 1KDHA 4NCBA 4GLXA 4YFKA 2BGGA 3OYCA 2XY8A 4ELUA 4JV0A 4DQQA 2BHNA 3ZSZA 2JLEA 2QXFA 2XCPA 1KTQA 1UOCA 3GV5B 2NRWA 3B6PA 2OPQA 4Q45A 4F4KA 1X2IA 2X74A 3RH6A 3AVAA 3NH1A 3KD1E 3GFKB 1WCNA 5F9NA 4QWDA 4Z6DA 1ZQSA 5KGXA 4RW9A 4FLUA 3DRRA 2DTUA 3L2UA 3PMLA 1D9DA 4TSXA 3QEXA 4DTNA 3ZT3A 3QZ7A 3PW4A 3AVHA 7ICQA 8ICIA 4CESA 3JPQA 4YNQA 5BPCA 1B22A 4C8MA 3SCXA 3DOLA 1T7PA 2XRIA 4M9GA 4FBUA 4YP3A 3L3UA 4M47A 5CP2A 4NLKA 1JLGA 4DFPA 4J9KA 7ICUA 4ECUA 2D0CA 3MEGA 4M3WA 3MDCA 2RF2A 7ICFA 4NLNA 3QEPA 3MXJA 4HHTA 4ECQA 4F93B 4Z0UA 2XHBA 1DOQA 2OZMA 3ZDEA 3LWLA 2MAXA 5KG4A 4FLWA 3M8PA 1BPXA 3QLHA 1VSEA 1XSPA 4CF0A 4QWEA 4E7HA 3CFPA 4CIGA 2IC3A 4JRPA 3NF8A 4H4MA 1UWBA 4DL6A 3UPQA 4YMMA 1G15A 2ZUCA 1RZTA 1KEJA 2A1JA 1CZ9A 5DQIA 2Q0ZX 3PO4A 4M3TA 2O4GA 4JK1A 1ZQDA 4CECA 3WNHA 5KFJA 4MFBA 3C2LA 2V9WA 3U3YA 4B9VA 4AHCA 1W0HA 2NRZA 3TARA 3SJJA 3ISBA 4GXIA 4DQRA 3H40A 7ICKA 4B9NA 4M9JA 4FJMA 1KLMA 2I5JA 4ED2A 5DKWA 3DOKA 3JPNA 2BDPA 4KLOA 4N56A 2R8GA 4GW6A 4CJ4A 5E41A 3HVTA 4CF9A 4FK2A 3C94A 2FLPA 4M3XA 1HPZA 3AVIA 3S3MA 5EWGA 4O5EA 4FCYA 5J0WA 4KMUA 3KHGA 4CFAA 4Z4HA 1RTHA 4NCAA 3VQ4A 4TUSA 4IQUA 1L3UA 2P6UA 1VRTA 4CEAA 3OJUA 1U9LA 2UVRA 2O4IA 5L1JA 5CZ2A 5D49A 4CHYA 1XWLA 4O3SA 4P4OA 3GIIA 1D8LA 3ZSRA 3KTQA 3MR3A 4OKEA 1L3SA 9ICEA 1C1CA 1J54A 5L1KA 3SYZA 4DS4A 3T5HA 1RBVA 7ICJA 3RAXA 2J6UA 2BPCA 3RMAA 4PH5A 1S0MA 5HBMA 1C0MA 4RQ1A 5L1IA 3T19A 4ID5A 3Q8QB 5DB8A 1L5UA 1LWEA 4DSIA 1VSFA 4XRHA 1C0TA 3CG7A 3OYBA 4O0IA 4KN4A 3MXMA 1S0NA 2F1JA 3SQ2A 4CHPA 4PQUA 4CEZA 3KK2A 4QW9A 4RU9A 5KTQA 4E1MA 3JYTA 4CEQA 5J2AA 3NE6A 1Q8IA 3OYLA 1RDDA 3AVFA 4DTSA 2C2RA 5I3UA 5CB1A 1JIHA 9ICGA 8ICJA 3HW8A 3AA4A 4PPXA 4KHNA 5DDMA 5IIIA 3HYFA 1A5VA 2BCQA 3Q8SB 4MQ3A 4DTPA 2ZTDA 1RBSA 2W42A 2PXIA 4DFMA 4XUSA 3OYHA 1S10A 3RB6A 2FC0A 2Z1GA 2W8KA 3HXMA 2XGQA 2BANA 4P2HA 3WNEA 4XIUA 4Q8FA 3PW2A 3SI6A 2IHNA 4UAYA 3UQ0A 1DTQA 4GVMA 1SL1A 9ICNA 3UXPA 3K5NA 3K5MA 8ICQA 3O3GA 2F8SA 2PYLA 4C8KA 4TQRA 5CR0A 3MEDA 3V7KA 5J0TA 1QTMA 1BQNA 1NK0A 4F4YA 1N48A 4M3ZA 2WTFA 4DTUA 1LWFA 4AHUA 4B9LA 4KLGA 4KO0A 2P1JA 3NGIA 2PI5A 1RDBA 4ECSA 3ITHA 3TAGA 3NF7A 1L3VA 3M8SA 4FLVA 3PR5B 2BCSA 4YR2A 3ISCA 1ZQJA 4MFCA 1KFTA 5J2NA 4N47A 4CJVA 4B9TA 3CQ8A 2KQ2A 3QIPA 4NCGA 4KFBA 5D3GA 3QERA 4E7IA 1N56A 5KFXA 4QZEA 1NOYA 3T5JA 4NY8A 3PX0A 4GXJA 3RWUA 1RT3A 4ZH4A 4CJTA 3PX4A 4CIFA 3VQ6A 3HK2A 3N97B 3VQQA 5FRNA 2UVUA 1IM4A 1MQ2A 4ID1A 1F21A 3B0YA 1JXLA 1C0UA 3ULDA 4QZHA 3Q8MA 3MFHA 2G8HA 3BQ0A 2QK9A 3VA0A 1J9AA 5J2GA 3OYKA 3JPSA 4KI4A 1GOAA 4O3PA 4IDKA 4QZ8A 3M9NB 1H38A 4O3OA 4K8ZA 4OLBA 8ICTA 3GQCA 3RR8A 3RH4A 2A1RA 4YCXA 1QSYA 3MEEA 2DPJA 2B4JA 4JUZA 2HHWA 1Q9YA 3QEBZ 1VK0A 5KFCA 4QZIA 3OJSA 1TAUA 8ICGA 3KLIA 4ECYA 4C8OA 4K4GA 2AGOA 4EYIB 3LWMA 3G6VA 1VSDA 5CA7A 2KW4A 2YKMA 4CHOA 4IFYA 4HCCA 4FYDA 4FO6A 1TL1A 5HP4A 1CEZA 1YTUA 5KFMA 1NOZA 3GV7B 1XC9A 3SV3A 1QSSA 4EP4A 2W9BA 1CXUA 3H8JA 4IQTA 4RNNA 1U49A 4ELVA 3V6DA 3PW7A 1ZQZA 4YMNA 4EBCA 3QZ8A 3AA5X 1UT5A 3AVGA 3AO1A 4PHAA 2YV0X 3O4QA 4I2PA 4X5VA 4W5TA 3LPTA 4DL4A 4F5QA 1VSIA 3RAQA 5J1EA 1RTIA 2RN2A 8ICRA 1JL2A 3M8RA 3G10A 3OYGA 4AHVA 5DQHA 3SUPA 4PA1A 4F4XA 4KLUA 3MGIA 2BQRA 4RT3A 2ZD1A 1S1UA 3ORYA 3EWAA 3RMBA 4RUCA 3CYMA 4W5NA 1TVAA 4JWMA 4LD0A 4PHPA 3KHRA 3DLKA 4F5PA 2ZJAA 4P4PA 1ZQRA 4FBTA 4QW8A 3FFIA 3VQ8A 3VQEA 4LVSA 3QEVA 3M9MB 4FM2A 4NLZA 4FJ5A 2D0BA 2FPKA 5KFPA 2OA8A 4O0JA 9ICCA 2ZJ8A 2LYHA 3V6HA 3S3NA 4QZCA 3TWHA 3QNNA 1A5WA 3F9KA 5J0UA 2IMWP 4DL7A 4I2QA 3LP0A 3MBYA 1HUZA 2XC9A 5DB6A 5J0YA 5DLFA 4J9OA 3OS0A 2VG6A 5J2IA 4I9LA 4FS1A 4HUGA 3DRPA 3VQPA 9ICFA 2E6LA 4BXOB 3MFIA 3IS9A 4DU4A 4L8RB 4DTXA 1X9MA 1ZQMA 1KVCA 5CZ1A 3GIJA 2W9CB 1BCOA 4Z4CA 1RYRA 3KKSA 3NCIA 3E2EA 3H8WA 4WE1A 4DO9A 2XY6A 2AQ0A 3DLEA 5J2KA 1O1WA 2KFZA 2G8KA 9ICLA 2YNFA 3HSTB 1JXBA 9ICJA 3TFRA 2FMSA 4NM2A 1C6VA 1UA1A 4FLYA 1WSEA 3I0RA 1ZQCA 4DTOA 4KTWA 4O4GA 4FJLA 3K2PA 3KLEA 2DY4A 3LZJA 4RPXA 1ZQEA 4CF8A 4CJFA 4B8CA 1VSJA 1S0VA 1RCHA 3F73A 4ZHRA 1BIZA 4R8UB 3GILA 2BPGA 2ITGA 3VQAA 2X6NA 1ZBUA 4F5NA 1BCMA 1BI4B 3AVLA 5HRNA 3LPUA 2RDIA 5J2BA 1D9FA 4OLAA 5CWRA 1EXNA 4HYKA 1JMSA 3K4GA 3HPGA 1K6YA 4UBCA 2JZBB 1S0OA 5KRSA 1NK8A 2NRTA 1UA0A 3OY9A 2GWSA 4RW8A 1YTAA 1UT8A 3L3VA 5BOLA 5J2QA 5DBCA 4Y1DA 3V1RA 1RT6A 3RJIA 2DPIA 4YXMA 4I2FA 5C25A 1TV6A 3C1ZA 3V7JA 4CEDA 5C42A 1ZQQA 1CUKA 1SZPA 4Q43A 3OHAA 1HUOA 3VQCA 3WNGA 2VWJA 3V81A 1ZQBA 3K5OA 4F2SA 2IA6A 2ASDA 2NUBA 1DLOA 4CJPA 5KT5A 2BKEA 4W5QA 4YFUA 3ZT4A 2OPSA 5CHGA 1RTDA 4UB5A 2F1HA 4J9MA 1S9GA 8ICXA 3DMJA 1ZBHA 1K1QA 3TABA 4CFBA 1RXWA 1RDCA 5KFWA 5DB7A 4RQ6A 3O3HA 3TQ1A 2JEGA 4J9RA 1QE1A 1ZBIA 1ZQAA 3HPHA 1SKWA 2G8UA 1IKVA 1DGSA 2E6MA 4J2BA 4UQGA 5CYQA 1NK9A 5DGBA 1VSMA 5IIJA 4I2GA 1DTTA 4CERA 4CJUA 5KFDA 2E4LA 3AVCA 1C1AA 2KTQA 3KHLA 4O9MA 4Q8EA 1IKWA 4FW1A 3C2MA 2GUIA 4RQ2A 5KFUA 2OPPA 1ASWA 3ZSXA 2B5JA 2Z1IA 1MC8A 1MU2A 4PWDA 1XHXA 1RXVA 1S5JA 3UXOA 4F3OA 4KV8A 4Z6FA 4KLQA 3QE9Y 4LSNA 1KVBA 1JX4A 3V1OA 3TAEA 8ICHA 4QZAA 1Y88A 4IRCA 1LW2A 4FK0A 4TUQA 1RT4A 2GBZA 9ICUA 3RB0A 5FDLA 1WSFA 4ELTA 1HYZA 4ED7A 4E1NA 1BQMA 3E01A 1Z3EB 1TKZA 1WSJA 2FBXA 5KFQA 2AU0A 4AHTA 7ICOA 1TVRA 4CJ3A 3G0ZA 4NLGA 1U4BA 4I2CA 1TV9A 1U47A 4QZGA 2W9MA 1C7YA 2HVHA 1RT5A 4ZTJA 2R8KA 2Z1HA 3QIOA 4Z4IA 2DFHA 5DDYA 8ICOA 4M42A 2PFQA 5JS2A 2UVVA 2VG5A 2FLNA 1WN7A 1B43A 3NGZA 1K1SA 3RJHA 3MGHA 2R8HA 4J2EA 1SKRA 1J5OA 3KKRA 3JPOA 2ZE2A 2YNHA 4IR1A 4QWAA 4KLLA 4KITB 2C2DA 5KFLA 2PI4A 2JGUA 4DSLA 7ICNA 2VG7A 3U3GA 3C23A 5KG5A 3PW0A 4CF1A 4NXZA 3LP1A 4M3UA 3DM2A 2M9NA 1ZJNA 3PMNA 9ICHA 2ZUBA 3MR2A 4O5KA 3NTUA 2HHSA 2BCUA 1JLEA 4FJ8A 5D46A 1NKEA 3NH0A 3L8BA 1T3NA 2AJQA 2BPFA 3LP3A 4YR0A 1WSHA 3LAMA 4FS2A 4JV1A 9ICVA 1JLFA 2VA8A 4J9PA 3OSPA 4OVLA 2JEIA 3H8SA 1ZJMA 1BVSA 3CM6A 2ZTEA 2ASLA 2HHXA 4O5CA 5KRTA 2ETJA 5L9XA 4NYNA 5JS1A 4RQ3A 4ICLA 7ICGA 5C24A 1LW0A 3C5GA 3P83D 4MEYA 3UXNA 4DS5A 9ICBA 4ECTA 4I7FA 2DFLA 3HP6A 2NRVA 5HRSA 2ATQA 1Y97A 4H4OA 4CJRA 4G3IA 4OPKA 2I9GA 5J2FA 3M9OB 3SPZA 2R8JA 1TKXA 4GC6A 4G1QA 4M9LA 2PY5A 3DLHA 1XSNA 3NF6A 2BQUA 4FJNA 1NKBA 2W9AA 4M45A 3V72A 3NBPA 3S9HA 4J2DA 2FPMA 3AO2A 3O4NA 1KVAA 2HHUA 3IHQB 3L2RA 4JWNA 1ZQYA 8ICNA 3M8QA 1A77A 3QESA 1RPLA 4KB0A 3C2KA 3CFOA 3C95A 1S6PA 1TKTA 3LP2A 3ZD9A 5HHIA 2EX3A 3OYEA 4M6WB 3IM1A 1IKXA 5T7BA 3HJFA 1REVA 1NJXA 1T4GA 5KFAA 4CJSA 3C1YA 4M0AA 4DTRA 2HHVA 4R66A 3H4DA 2OYQA 1IG9A 5HRRA 1V9PA 4DWIA 3FYHA 2G8IA 4BACA 4FJ9A 5IINA 3NF9A 4E0DA 1JXEA 2D0AA 1LAWA 1ZQLA 4B3OA 9ICWA 4ED1A 3OS2A 8ICPA 4KHQA 3SQ4A 2EHGA 3OHBA 3RB4A 2KZZA 3SUQA 1HQUA 4PGQA 1QHTA 2HNDA 2IHMA 3KLGA 3U6FA 5EWFA 5KT4A 3C6UA 1ZETA 4BDZA 4M3YA 1T05A 3LALA 3DLRA 2V4RA 4IR9A 3H7IA 1BHLA 4DQPA 2B21A 4FJHA 3TANA 2P66A 3OYIA 4F3TA 3C5FA 4DLEA 4YVZA 5HROA 7ICVA 1S9FA 3AVJA 1XHZA 4M41A 1UAXA 2RDJA 3OGUA 1BPYA 3ZSOA 1EX4A 2BR0A 4IRKA 2XY5A 3V9SA 4ECWA 1HNVA 1ZQOA 4F50A 4ZTFA 4YD1A 7ICHA 4NYFA 1WNSA 4DU1A 8ICBA 3ZDBA 4E89A 3K58A 9ICSA 4ED6A
chains in the Genus database with same CATH superfamily
4OJOA 2E1ZA 4PCQA 3HKZC 4OCZA 1YX2A 4DSKA 2ZKUA 2JRZA 1ZQVA 3TEGA 3WK5A 3CDUA 3ZNJ1 4JI1K 3D0PA 1RBTA 5ETKA 3L09A 3PCOB 2R7RA 3OFHA 1P90A 3BEGB 4PGYA 3FCVA 2OHFA 4EO8A 1I3AA 2L9WA 3EGNA 3OTCA 1W7AA 4ZS6A 5AKGA 2FLOA 3HFVA 1HIWA 2GZOA 1IBLF 1URNA 2KG5A 3FM9A 3ULEB 1WG8A 1OVQA 3O08A 5AQVA 2P9UB 3WXKA 1D4XA 3MAAB 4CJ5A 4N41A 3LGMA 4O0NA 1NRKA 3THVA 1RWXB 5AJ3K 2A5XA 4KKOB 4ZLJA 3FQLA 3T1AA 3KOAA 4WFBL 3FUYA 1RU1A 2HGLA 3UIQA 5AXLA 1FT8A 2DO0A 2DH7A 4ZDNA 3TTFA 4HVJA 1Q5VA 4MK7A 1N62A 3DV9A 1N88A 2O6KA 4LFCF 2K60A 3UPFA 3D2FA 5DBBA 3R2CJ 1HJOA 2Y8WA 3NFAA 1U45A 1O0PA 5BYSA 2R4FA 2K8CB 3TACB 2ZTCA 2FJWA 1ZC6A 4JI8J 2AJ0A 3ZD8A 4YG2A 4ED3A 3Q8LA 2AMCB 4P72A 4Z4EA 3O2IA 1YDLA 5CYMB 3CJ9A 2DGZA 1PYOB 1Q79A 4RUBA 5AR0A 7ICLA 1C1BA 3UNYA 1QAIA 1ASUA 1BPBA 2HSEB 1RTIB 2QB0B 2OEJA 3T5KA 5E84A 7ICIA 2BDUA 1EJ7L 5AQLA 3L7PA 2KU7A 4M7XA 3MM8A 3HP9A 5E79U 1FCAA 2HPUA 1IKYB 4GV3A 2ZD1B 1BIUA 3BKFA 2ZF5O 2W4CA 1YITS 2H5XA 3IRUA 4L3NA 1WD6A 4DZDA 4GKKK 1Q86O 2JZBA 2D41A 5HNKA 1S76D 1SQFA 3I82A 5DBAA 4UATA 1DKGD 4GIBA 1O51A 2FMPA 1TFRA 2YNGA 4B3RJ 3V9WA 4JD2A 3TADA 1R6VA 2HBQB 3L2QA 3WZ0A 1SKSA 1YJRA 2HNYA 2J4RA 5KGWA 3AA9A 4B08A 1FD8A 5J0SA 2X78A 4CNQA 3T6JA 1SXLA 3CCQS 2QIFA 3OQ2A 3AQOA 1RAJA 1JN3A 5DK5A 1S8OA 3IRXA 2QT7A 3LVVA 2AQ4A 1PSDA 2QWLA 5LMUJ 2MJNA 3VOVA 1NNLA 1IR1A 3W3DA 3H3NO 5HR7A 3P4UB 3R5DA 3NUQA 4N5SA 3P45B 4FPAA 2PFOA 3MM5B 4K4WA 3A8YA 3BO2A 3PTWA 3AMZA 1N63A 2BACA 2ZQBA 2FBYA 2IJFA 1K8KB 5B09A 4MIWA 2XQCA 5LL6Z 3EICA 4TUPA 1J2NA 1UPPA 3EUNA 2MQQA 1S97A 2D4WA 3HPOA 4ZITA 4R79A 2HQCA 4CGDA 3OV7A 7FD1A 3L4BC 3HHLC 4P74A 2UUCJ 4BRPA 2Q2RA 3PUFA 2KL8A 1ZQXA 1KC8T 3V9UA 4FZZA 4LJXA 3ETOA 2E2PA 4DL5A 4KLIA 1HIYA 4EX7A 2VFUA 4FK4A 2KHOA 1QHAA 4KTQA 4K4SA 1BE4A 1BQXA 1RFQA 3OS1A 4CHZA 3RBZA 4BGAA 4M9HA 3M32B 4DFKA 2Z1JA 1L8OA 4TLRA 2VZ9A 3CCEN 5TKWA 4KGVB 1KFSA 3T6BA 2PC6A 4YXJA 3WKDA 2G2OA 3RJMB 4RCHA 1VAZA 2VANA 4WFZA 5AKJA 3FMWA 3D0IE 2D1KA 1DRZA 2VOOA 2HG4A 4I2JA 2CQ3A 5BRHA 1VK8A 4OPHA 4DV1F 1N36F 2W6KA 2JH3A 4OI6A 3R9PA 2UXBK 2E9TA 4DV4K 4CZKA 4UARA 4F8RA 3BZCA 5M1NA 3NAHA 1WC3A 3TYTA 2GEMA 3FZHA 1X9SA 1RAGB 4IOCL 3ZZPA 1RNHA 5CY4A 1VQLS 4EWTA 2OUGA 1BGXT 2QWPA 1YT3A 2F76X 1UWBB 5A8RA 3A2FA 1Q8BA 3HT0A 4YB6A 1DBDA 4CF5A 1T03A 2W25A 2B43A 4CK2A 4KB1A 1P9YA 1SWWA 2J76E 4CJKA 1H3DA 5ITHA 1KFDA 5A0YB 3G8QA 2K4HA 4C1NK 3OYFA 3CDEA 2ZNZA 1T3OA 1HRHA 1VSKA 2H1YA 3IR7B 4KYZA 1UJ6A 2N82B 4C3KA 2D3OR 1SQKA 2VC0A 2B51A 4C7YA 1T44A 3QYPA 1D5AA 4DUYF 3AA2A 2AZ3A 5CXTA 3HVTB 4Z4FA 1B70B 3GU0A 4WTYA 1NSPA 2M70A 3QSIA 4UW2A 4V19J 3M6ZA 3T3FA 1V85A 3DXMB 3FEZA 1C0GA 2LQ9A 1JKHA 2I0XA 3UR3C 1VRTB 2DD8S 3WDOA 4IO8A 4QAGA 2KKZA 5KFOA 4P75A 4WQ5C 3PO5A 4NWIA 8ICMA 5AKLA 2MZRA 1GO3F 1Q46A 3AJ1A 1PZNA 2G4BA 1C1CB 2Y0BB 4RW4A 2YJFA 2G06A 3K59A 4O8UA 3H90A 4OIXA 3HKWA 4BLGA 2VWBA 4E3SA 2J0XA 3WT0A 1G99A 1ZQKA 2L9DA 2AA4A 3THWB 4Y2PA 4YDXA 4U7CA 2FBTA 2H9ZA 1YXQA 3ZT2A 2DGOA 4QZ9A 3MR5A 4DOZA 4UBBA 5AKZA 2UU9K 3G71N 1FRKA 3SQ0A 4A8MP 1ZM9A 2WSEC 4FJKA 4NLSA 5KFEA 4Y2RA 3BBFA 4BRQA 5DRKA 2MY8A 4Y1CA 2JGAA 1CSJA 5D4BA 1GXUA 1Z4UA 1C4AA 3T69A 4I6MB 1HBOB 4K4TA 4F5OA 1ZRNA 1Q7YT 9ICAA 2VA2A 1X4FA 5C5JA 2HFOA 1OKJA 2YH1A 2YQ3A 1RBRA 3SAFA 1CQMA 3QX7A 4LVOP 4B1WB 3PLAA 1U2VA 2J8SA 2ZH1A 5EX3A 1MN9A 2V63A 3FBBA 3THYA 1IO2A 4Y0WA 3HL8A 2EC2A 3RMCA 7ICPA 2X6SA 2XTJP 3HI0A 1UJ4A 4JI6F 2D5RA 3RF9A 4A48A 1G6BA 2GV1A 1HWIA 1WC1A 3AO3A 1S1TA 2Y1LB 2ZEJA 3PV8A 2Q31A 4B9UA 3TTDA 2HDOA 4P2MA 2C2EA 1WF0A 2ZM6K 4IG3A 3FBEA 3BS7A 8ICVA 4HLBA 9ICPA 3B8AX 5IILA 4A62A 1QQMA 4K4HA 1KSPA 1LV5A 3A12A 1ZD2P 2ZH9A 3AQEA 3SMVA 1BQNB 4K5RA 3GZ7A 4X64J 1CLQA 4URQU 3CGIA 3JPTA 4KO0B 4HHUA 3OYJA 4AH9A 2OI2A 3FEXB 3AN1A 3HX0A 4AUKA 4KSEB 3PSFA 3ULEA 3NGSA 4UOHA 4PHDA 3D3CJ 3TFSA 4RBVA 2FVSA 3MAAA 5ALUA 1N5VA 4QZBA 1EKEA 1CJKB 3RH5A 3QIPB 2XMWA 3KJVA 4I2AA 1FJGK 4KKOA 6AT1B 5LSLA 3RBDA 4BC7A 3G6YA 5KFHA 4USIA 2WSFC 3JS6A 2Q6BA 4YS2A 2MZJA 4JV2A 3H08A 3N28A 4JI3K 4EI2A 3AVNA 1ZD5A 4W92B 4IOBA 1VQYA 3I5BA 2EG1A 4LREA 2VGMA 1HQUB 1WWVA 3VEWA 1LXJA 3HLUA 5AZIB 5CYMA 1QAYA 3BSOA 2D9OA 3C6UB 4ZVSB 4IDKB 1SCJB 5ETOA 4DV2F 4IKFA 3G6XA 2B0CA 4KLSA 1N0VC 1Q53A 1IR0A 1QS4A 2QB0A 7ICTA 2HURA 2MQ8A 2ZBCA 4CE9A 4XO0A 2G8VA 3DU6A 4CBXA 1N33K 4K59A 1KOOA 3CCJN 1S22A 4FLZA 2KH9A 4DEZA 1IKYA 3ZLJA 2CJ9A 4LY7A 2BW7A 4HTJA 3QT8A 3UN5A 2IVFB 2YKMB 2DR5A 5BR8F 4JKFA 4XH4A 1VLYA 3QNWB 4KI6A 4GKJK 1EXQA 3AU2A 4H5TA 1JRPA 3TVKA 1YVFA 1WDDA 2OTLN 1RWPB 4JS4A 5KFGA 2AKWB 5SZTA 4I2HA 3MGJA 3OFFA 1K9MT 4FJXA 3N79A 5EDWA 2W7OA 3F0NA 2W01A 3EVOA 5TISU 4E1JA 4QZFA 1MQ3A 1XNQF 2J6SA 4Z2XA 4AM7A 1RGIA 2BKPA 1P27B 1L7MA 2OXOA 4USAA 4R5PB 1HNZJ 5J2HA 4DSEA 3MHYA 3BDEA 4LF7K 1ZBFA 8ICCA 4I29A 2GLEA 3MMAB 4I2BA 3D6TB 2ODGA 2KMDA 1R6YA 3AVKA 4O4RA 4FM0A 4UB3A 4DU3A 2A6AA 1Y10A 4HT7A 4CEBA 9ICRA 2DNNA 2VPYB 2E5LF 3ZYYX 4QIEA 3FFIB 4I1TA 4J8FA 2XI9A 2PMWA 4USMA 2VBZA 3MM5A 4OHVA 3K8WA 4M5NA 4CEOA 4DR6F 2G0JA 3J7AN 1HNXJ 5M2UA 4JLHA 4J2AA 2R9LA 3J81U 4RG8A 1RK8A 3FK4A 1UCVA 1RE1B 1WKLA 4RQNA 3MDQA 3H25A 1FFGB 1G7CB 2R18A 3KIOA 5CJ7A 1U2CA 1WSGA 1Q9XA 5LMNF 3HO1A 4BREA 3P5TL 3H2VE 4UUXA 4YN3B 4NCBA 3W5XA 3CT9A 4LQ3A 3OYCA 2VOPA 3IS9B 1V9OA 4DQQA 5AM2A 4FF4A 1O5JA 4IDHA 3DAWA 3UB5A 2HMPA 4JKCA 3O9QA 2F7TA 3PACA 3NH1A 2OH2A 4K4ZA 4FWSA 5F9NA 3M32A 1ZQSA 5BPMA 2DTUA 2DNGA 3I1YA 3NS6A 3L2UA 1D9DA 4TSXA 3OVSA 1FJCA 3VR1A 3JPQA 2QI2A 4H0VB 1ZOLA 2DGVA 3D2WA 4B1XB 4C8MA 2KNJA 2LEAA 3QGPA 2M8DB 2XRIA 5HVGA 4YP3A 3L3UA 3NGTA 1KHVA 1CJUB 2IVPA 3EJMA 4J9KA 4C4RA 7ICUA 1UVNA 3D2EB 5M2PA 3VESA 3MCMA 1VISA 7ICFA 2KM8B 4NLNA 2E1PA 2LXIA 1DOQA 2XNRA 5D77A 2LQJA 4WXOA 4RPFA 1S72S 2XZWA 5HANA 1RT6B 4F3MA 4E7HA 4CIGA 2KJ9A 1MG7A 1UWBA 1ZAXA 4WU3A 5C42B 4BJQA 3UDEA 4CYUB 2ZUCA 1VRUB 5F8HA 1YWXA 1GNKA 1HLUA 1ZA2B 2COLA 4TNOA 1CZ9A 1WHWA 2Q0ZX 2D9PA 1YLXA 1N32F 3CCZA 2O4GA 2VODA 4CZJA 1ZQDA 4BX9C 3WNHA 1G4CA 3QU4A 2HVEA 4MFBA 2A3VA 1R7IA 3DMJB 2WVFA 4B9VA 4LF5K 4AHCA 1UPMB 4ITSA 1WEZA 3EWGA 3ISBA 3VAGA 4B9NA 1U0SA 2Q36A 3D9BA 1WUDA 3CEDA 2E9RX 2LP4A 4DR5J 4NEYA 1KLMA 1VHFA 3FZ2A 1SGGA 3DOKA 3JPNA 3QB0A 5ALEA 3ENQA 3HVTA 4FK2A 1PK3A 1IKVB 2FLPA 2QWQA 3A13A 5KOXA 1HR0K 2XI3A 5IC4B 2QG9B 2GELA 3KHGA 2QE5A 2MB0B 2GO8A 3DU5A 1EX8A 4DPYA 1VRTA 2PEBA 4XH5A 4CEAA 3OJUA 2UVRA 4CO4A 3M6VA 4LF6J 3MPUB 4P4OA 3GIIA 4MDBA 2E8NA 3KTQA 3JAMU 2HGNA 3H0LB 1FRJA 2FIUA 1C1CA 3CIMA 3AJ2A 4Y0FA 1ZM2A 1RBVA 3ICXA 1VQ4S 1RP5A 2WAQD 2DGTA 2P6SA 2O01C 4P7TA 4K7QA 4DUZJ 3CD5A 3D6JA 4OJ5A 1XQIA 4EU0A 2XI2A 2W2PP 2DY1A 2YHXA 2O8EB 1HLWA 3NWGA 5AQSA 3CG7A 3KFWX 4O0IA 2KK0A 2AX1A 3MXMA 1S0NA 4C1NI 2F1JA 3C16B 2G07A 3O9UA 3CWJA 4CEZA 1FRIA 1YBTA 1NGCA 4I6MA 1BNPA 2ZBIA 2B8QA 2YX1A 1TL7B 1HBOA 4CEQA 1VC0A 1NB2A 1CC8A 3TX8A 2YMQA 3WU2U 4J37A 5B8HA 3H59A 2CNNB 3RVCA 3CIZA 1NNEA 2KRBA 4ES1A 3AA4A 4PPXA 5DDMA 5KAIU 2PMZD 4XH1A 3HYFA 4UOGA 4OI4A 1N6QB 1A5VA 5IXUA 3Q8SB 4MQ3A 1J5OB 4DTPA 3H5YA 1YJVA 3EX7B 1FWPA 3AOBA 2PSZA 2ZGZA 4QYZK 5D4PA 1X9JA 3IMXA 2YXLA 2N4DA 2B56A 3LP1B 3N0VA 3M30A 4B3TJ 5ALDA 4KBOA 1NGJA 3DLGB 2LQBA 3QWPA 2GMHA 2NUUG 1R0BG 2DWQA 3FEYB 4RKUC 2VIHA 2P9KB 3UQ0A 5ETPA 3O6QA 4PZVA 2DRAA 2YVSA 1SL1A 8ICQA 1CZAN 3G6EN 3TUZC 4WZMA 2V34A 2MQPA 4C8KA 2L48A 4ILGB 2DHSA 1YIJN 1NGHA 5EN1A 1QTMA 4USWA 1BQNA 2WF6A 1VJWA 4LF8J 1KQKA 2NZTA 1LW0B 3BKUA 3PDNA 5CHIA 1N34J 2WVDA 4DTUA 4KO0A 2M7SA 4U8YA 4WK1A 4FLVA 1D0EA 3L7UA 5AQGA 3VAIA 1YZ7A 1SS6A 4MFCA 1KFTA 4EIAA 4CJVA 1TKXB 1SZHA 1SJFA 2YJEA 3LDLA 1CJKA 3J7ZT 4B9TA 1GX5A 2KQ2A 3CQ8A 3QIPA 1KVKA 4RX6A 4LRDA 3TVYA 3I5CA 5AE3A 5KFXA 5AQMA 4PJ0U 4QZEA 2G5IB 3J80O 4GXJA 4WJBA 3O1LA 4V1Ak 3VGMA 3SAGA 3A8JA 2QV6A 2GJIA 2HNZB 5FRNA 2UVUA 3NVWA 4M5DB 1JXLA 2IM0A 4QU7A 1TKTB 3C7NB 5AZIA 2GHWA 2R7UA 3LTOA 4CLLA 1GOAA 3TZXA 4IDKA 2DCLA 1H38A 4YY3K 4FFDA 3A0IX 8ICTA 2KOBA 1REVB 1QSYA 3M6XA 1OQ3A 3ENVA 1SVDA 1TAUA 3QRQA 3SENA 4PYDA 2GWKA 2KG0A 5CEHA 2AGOA 4EYIB 1JJ4A 2CPXA 3M1FA 3PSIA 1VSDA 5CA7A 3RZAA 2YKMA 4QIWF 2Q97A 3WK4A 8AT1B 1CRXA 3GSDA 2NLXA 5HP4A 1S79A 1DFDA 2QLJB 3GZFA 1H74A 5AJ3F 5D6GA 2KEYA 2KN4A 3NVKA 3UQSA 4EP4A 4OJHA 1ZH5A 4ZPAA 3TA0A 3PW7A 1BA1A 3PSPA 3TSQA 4CLKA 3AVGA 3RAQA 1VCTA 2RN2A 3MD3A 4AHVA 1J5EJ 4LR8A 1U6ZA 4OYBA 4GY2B 5E26A 3KG4A 1VQMS 3MMAA 3BR9A 1I5OB 4DX7A 1VHXA 4O44B 3C28A 4W5NA 5F3TA 1TVAA 3LH2S 4LD0A 4PHPA 3KHRA 4CLFA 4JKAA 1IBLJ 3OTQA 1OYDA 4IEIA 2D3O1 2ZJAA 4P4PA 1ZQRA 3B6BA 4F9OA 2ROEA 3OTOF 3FFIA 2J8AA 3VQ8A 5F8GA 3FGVA 4NLZA 2D0BA 3DRSB 3PG9A 1H73A 3T1YK 4CLZA 3CMAS 4O0JA 3GFHA 4ID8A 3S3NA 1RJJA 3TWHA 3QNNA 3OVAA 2QWMA 3SEOA 3SXLA 1YRXA 3C3LA 3MECB 1FKOB 2E7VA 2YQEA 3AD7C 5LL6d 1YJ9S 4NA1A 4J9OA 1WKJA 1XO0A 3EE3A 3ILLA 1YAGA 4I9LA 4FS1A 4HUGA 2F8KA 1LK7A 1XR6A 4LMZA 3J7A1 2H51B 3D54A 2E6LA 3QAUA 3IS9A 3MFIA 4L8RB 5AT1B 4CW7B 3GIJA 2W9CB 1BCOA 1OPIA 4LT6A 3KKSA 1RUSA 3VEXA 3E2EA 3H8WA 2HQGA 1B0VA 3K9JA 1F5CA 1O1WA 2KFZA 2Z56B 4X66K 2OGUA 4RWXA 9ICJA 5H9FK 3NP5A 3RG6A 5A0LA 4NM2A 2H48B 3TSPA 3NCRA 1VIOA 1ZQCA 3SMPA 2KVIA 2K89A 5ALLA 1JB0C 4O4GA 1BU6O 3W2VB 3MUTP 3LZJA 4B8CA 1RCHA 2D3ZA 1XNRK 3GILA 3VQAA 4F5NA 2H5EA 3OPKA 1BCMA 1NB7A 1NH8A 1CJUA 2EK6A 1NSAA 3SMZA 2YWFA 1FA0A 3CCVS 3MPVA 3TJAA 1EXNA 1FEEA 2H3EB 1JMSA 3AB2B 3CDWA 3D2EA 3I9V9 3HF5A 3GG1A 3PIOQ 2VPWB 4UBCA 5KRSA 4UZCA 1F9HA 3K0JA 5LSRA 5LT5A 2GWSA 1YTAA 3L3VA 1RU2A 4C97A 2FHMA 1MWQA 3TZZA 1RT6A 3RJIA 2DNRA 2EKNA 2MQMA 2FDNA 2MKCA 5C42A 1ZQQA 1CUKA 2V94A 1HUOA 2XWYA 3CMQA 1SPBP 4CYUA 2Y0SC 4NL9C 2HQFA 4FWRA 4CF3A 3MR7A 2I6WA 1IJJA 2JLFA 2ASDA 2NUBA 3PRDA 2YHWA 2BKEA 4W5QA 4MYTA 1B0XA 3SFGA 3ZT4A 4GVBB 5CHGA 4PAAA 5I42B 4EAHD 4WF9Q 4UB5A 3TQEA 5ETVA 3BV8A 2F9TA 1MWKA 3DMJA 3HHEA 3BGOP 3PKYA 1ZBHA 1K1QA 4Y2XA 3TABA 1SC1B 3N4WA 2CVIA 5I4MA 3TKAA 2HFSA 2XLKA 2WRMA 1N2XA 3BYPA 3HSCA 2GIRA 4RQ6A 3CCMS 1RM6C 2D8CA 4J9RA 1NGGA 4OL8A 1SKWA 2UXBF 1IKVA 5HJXA 3PYGA 5GTHU 3M4XA 1WOOA 3AFGA 5DGBA 2F3NA 4QS8A 2G1DA 1DTTA 4CD3A 4CJUA 3PZPA 2HAIA 1C1AA 2ZNYA 1WC4A 1ZRMA 3IWNC 2F65A 2XMUA 3ZSXA 2W11A 3DYAB 2Z1IA 4DR7F 1XHXA 2OEKA 1GH8A 3DOLB 4OI0A 2ZIUB 3VAFA 3SSQA 3UXOA 4F7VA 2H3QA 4CI0B 1EETB 2M52A 4PG4A 4OI2A 3PSTA 3CC4N 3KFUF 1EKSA 3V1OA 3D28A 3JSRA 3R8YA 4JK8A 3TAEA 3UD4P 4IRCA 4WFYA 1X7VA 2F4VK 2AZ1A 4XDCA 3V4IB 4TUQA 1QQ5A 3SSSA 3K0SA 5IM0B 1N36J 2O8EA 4YDUC 3W61A 4EHUA 4ED7A 4DV3K 2YH0A 3CW2C 2PDAA 2XLJA 4JHDB 7ICOA 5DJBA 2ZITA 4YEAA 1EARA 1N5XA 4NZ6A 4NLGA 1UEUA 4WCEQ 1RDFA 1C7YA 4DUTA 1S1XB 1TL7A 3AB4B 1SWVA 4S0MA 4FN5A 3NMUA 2FJXA 2DFHA 3W63A 2AJ1A 3GYGA 5M1OA 1V3RA 5FLXU 3KZBA 5ALFA 2R8HA 3MGHA 2GQ2A 4FVCA 1SKRA 5E3AA 1ECWA 1J5OA 3NVMA 4KLLA 2C2DA 2RHSB 1RWWB 5KQ8A 3C23A 5KG5A 1MN7A 2HRUA 4CF1A 1OPZA 2CKWA 3LP1A 4X4OA 2E2OA 1T94A 3VGVA 4O5KA 1Q95G 4IO9Q 4FJ8A 3CCWA 2OSRA 1OH6A 3U26A 1T3NA 2P9KA 3KK7A 2YPYA 2GVDB 4ZCMA 3B4DA 4DUYJ 3OSPA 2RU9A 1BWFO 2P9NB 3NOCA 3KDNA 2ZTEA 2ASLA 3KLHB 3OW2R 1DZ5A 2OCEA 5KRTA 3TVZA 2WK4A 3QJPA 3T1HK 1HKBA 4UOFA 1NGBA 3UVJB 7ICGA 1LW0A 3ENOA 3Q8VA 5CE3A 2AYGA 2FHKA 4I7FA 4QPXA 2DFLA 3HP6A 1E6VB 5H1SQ 1Y97A 2XYGB 4CJRA 1UFLA 4DJBA 4BRHA 4O3MA 3HKZF 5HP1B 1ILYA 1TKXA 4CH1A 3KVGA 1R89A 3DLHA 4X62K 3W65A 1IBCB 1WEYA 3ENAA 1NKBA 4M45A 1XMOJ 3UCZP 4ZPBA 4QPTA 3ED5A 4KC5A 4BR4A 3AO2A 3O4NA 5ALVA 4IWVA 2E8AA 1Q0NA 4P2SA 1X3MA 3HM8A 4C3MA 4JWNA 1D1UA 4DU7A 1ZQYA 1AZSA 4KB0A 3F41A 3FVYA 4M5DA 2XBPA 2EKYA 1TKTA 3C7NA 4F4AA 4FWOA 3KUEA 4BRLA 1JLQB 2V4JB 3IM1A 3IFRA 3HJFA 2E3TA 4NXNK 1REVA 3OVBA 2B9WA 2BYCA 1WUUA 2HHVA 3H4DA 3N01A 1V9PA 3DLJA 4OZ2A 3FYHA 2G8IA 2ZOGA 4BACA 2HBMA 2L5YA 1S6QB 4E8UA 1RTJB 4A8WA 1G1XA 1RAEB 4ED1A 3K89A 2DXDA 1PYTA 1FJGF 4JI6J 2KI2A 2O8CB 2DR9A 1LEOA 3SCKE 4U8VA 2ZIWA 3U6FA 3PM9A 3PJ9A 4ALZA 3I4PA 1RAFB 3DRYA 4K0KK 2ZZNA 2V4RA 1TUWA 3H7IA 3KUGA 4JI3F 3BM7A 4DQPA 2BE9B 1KKXA 3C5FA 4DR4K 4DLEA 4YVZA 5ALTA 1SB6A 4ZVGA 1UAXA 3OGUA 5GTIU 3V9SA 2QEXN 5HOOA 1HNVA 1ZZFA 1JLBB 1WOSA 4YD1A 5GAHP 4NYFA 2AYMA 1WNSA 2H3IA 1WTFA 2N7CA 4B9QA 9ICSA 2EXUA 3CPWM 3BDPA 3TU5A 3TR8A 1S1VB 2VKRA 4RW7B 3CVKA 2CNOB 1ZXIA 4F91B 1E4GT 4WIQA 3ZT1A 3PX6A 2H4WB 1RLCL 5J2EA 3QMLA 4WQ4A 5GMKa 4RBUA 2DB1A 1GLEG 1FD2A 1HW8A 1BNOA 2NXEA 2ZUAA 2LEPA 4IXCA 4EHTA 5IIOA 4FXDA 2BABA 3O80A 3Q8PB 3SUNA 5ELZA 1C0UB 4W98A 1SH2A 1YK9A 4H0XB 4E2FB 1FKOA 3CHWA 1PBUA 2NREA 2JMGA 2QSFA 1RAAB 2DNKA 1VJ5A 5B0EA 1T9WA 3OVNA 4OPAA 4UAUA 1D9AA 4NMXA 2ISPA 3E51A 2YTUA 4CI6A 4OI1A 1KHWA 4OZ5A 3EXCX 2CPRA 4Q5VA 5KFVA 2IAJB 5T7LB 3JAMO 4LF7F 5HMZA 2QTDA 2GQCA 5J29A 2W9CA 3I56S 1NSQA 4NOHA 2IYGA 2UVWA 8ICWA 3QBCA 4BE2A 1TL1B 1K8AO 3E58A 3LOUA 3CPWR 4YB1P 2QLFB 5J0RA 3Q8RB 4KHPJ 5AI5A 5AKEA 1HYVA 1PIEA 3TR5A 4P4MA 5BR8J 2DF4B 1YTYA 1F9FA 1HHSA 1NEEA 3U7JA 4ZPCA 2KHCA 3W2VA 4OD0A 3SUOA 2KN7A 4CFDA 1A76A 4I68A 3CD6S 3N9UC 4MKBA 4AHRA 4UT4A 1XNQJ 5AQTA 1I51B 4KLMA 4C23A 1NHKL 2F4FA 2J6TA 2A19A 2KFNA 3W2WB 2OSQA 1FXRA 4QJFB 2EH9A 4HTLA 4L6V3 2JX2A 3BYRA 1NJIO 4CZLA 2LU2A 2P35A 2CNLB 4ISEA 3P3DA 1DGKN 1B4FA 2ASOA 3C29A 3EGVA 2RHQB 2GO7A 5A6PA 1HMVA 4NLXA 3CJ4A 4A2AA 2V2VA 2IDOA 4DF8A 4AL5A 2E5LJ 4B3RK 1KXPA 2QA4G 5DGAA 1MSWD 5A76A 1EIYB 3CCUN 3I9ZA 3P6YC 2RQ5A 1YZ6A 4GVBA 4H0PA 5I42A 4DR6J 3H8YA 1TAMA 1RILA 5D4NA 4F0KA 2E66A 1FRHA 2OFHX 1FEHA 3TTCA 2G8WA 4KHWA 1SV5B 4PL8A 3CJKB 3O3FA 3FLCO 2PFPA 1P1LA 4D3GA 4DSFA 2K8AA 3V1QA 2OKQA 4JS5A 3MMCB 4IFEA 3N6LA 1ZTWA 4RT2A 3IUCA 4LZGA 3EZ5A 4B3MK 4DV7K 2XM3A 3AA8A 1N5YA 1JLCB 3KK1B 3NASA 2F8MA 1WG1A 4FLXA 2K3IA 2W8LA 3IWLA 4N76A 2E1YA 5J2DA 2NZCA 4X4TA 4PRFA 3MAQA 3ID8A 1CZBA 1XS9D 3PIPQ 3SI8A 2GQQA 1JL1A 2O8FB 4UY85 3EPGA 3OL7A 1RTZA 3DYAA 2OD6A 4Q2LA 2V51B 3MGVA 5J2MA 2PFDA 4OGCA 2ZIUA 2VQEJ 3SV4A 2C3MA 1EETA 1NHUA 1X4DA 2E29A 3ZSYA 3SPYA 2MEWA 3ENBA 2UUCK 4IC9A 5E2QA 4FKXA 3KWMA 4BGDA 2PEHA 1ZQPA 4XEIA 2UUAF 2K1RB 4L76A 3NVYA 4HTUA 1W97L 2WHOA 3AQPA 3V4IA 3HHLB 1GTEA 2I7PA 1HNWK 5IM0A 4DR2K 1YJWN 2CA9A 2HHHK 3DRRB 2IFXA 3DWLA 4OJ1A 1YJ7A 4JHDA 2I7NA 2B6GA 2P9PB 2NV3A 3RJGA 3CCSS 1XU4A 2DITA 3MOJB 2GFFA 4KHMA 2MZQA 1S1XA 4QIVA 5AXMA 1NGAA 2LYAA 3A5OC 4FF1A 9ICIA 1ZBLA 2BCRA 4ECZA 3CJ1A 2QJ3A 2D7SA 2DHHA 3J7Z5 4ZLNA 2DH8A 3MEGB 4KTZA 1GMWD 2CPZA 4LF4K 5AM0A 2HFNA 3BQTA 5KT6A 3PIOL 5BPNA 3LANA 4KAIA 1HWUA 4OZLA 3V9ZA 4KHUA 1NMEB 2YX7A 3R3TA 3TAPA 1LOUA 4MAKA 2ES6A 3WNFA 4F4WA 3QLHB 3OYNA 2FJEB 2ROPA 4NM1A 2YKPA 5TKYA 4H4MB 4GXKA 1QSLA 4B6JA 2M9KA 4JKDA 2GVDA 2A1JB 2PGCA 3ASMA 2JEJA 2P9NA 4RWTA 1C20A 4WF9L 1UFKA 3KLHA 2V2ZA 2F3JA 1ATNA 3BPDA 4JI7K 3UVJA 4K50A 1NK7A 3UWTA 2Z58B 2CQCA 1AB8A 2FJDB 3K5PA 3NL0A 1JCFA 3MCPA 4U67L 3CCVN 3ILIA 2I5JB 3SAHA 3GIKA 2HQDA 4J9QA 2UXCK 4K42A 5HP1A 5KQDA 4KY3A 4BR7A 1YRTA 4DV0J 1LW2B 2H65B 3TRGA 3ZCMA 3H1QA 5ALNA 3CD6N 2J7KA 4AXJA 1V5IB 3VPZA 4Q0BA 1TAQA 3DOMB 4I67A 3M7VA 3IG8A 3C66A 2VFRA 2WBRA 1PBAA 4MKYA 1NBWA 1LKZA 4I0WA 3BJYA 2B9YA 3F2DA 2ATCB 2IDLA 3J80Y 2LECA 3LDNA 3BBCA 4ES3A 5DLGA 1FNMA 2YWKA 3QSYB 3S8SA 3UW1A 2NXUA 1HBUB 3HWTA 2HBLA 4FW2A 3X1LB 1JLQA 1E6YB 2V4JA 4CGGA 5HBMB 8ICYA 5IOLA 1IUJA 1AT1B 3OR2B 5HMMA 4WZQA 2V8PA 5HHHA 4RPZA 4ZP6A 2ZHOA 1HKCA 1ZQTA 4OQJA 1ZYQA 4LR7A 1WSIA 3V4MA 3AVMA 4I27A 1QY7A 3RUBL 3ZZOA 4TQSA 1KRPA 4QCLA 1HJPA 2BZFA 1VJQA 2QFIA 4HUFA 1I94K 1WHYA 1S6QA 4PQUB 3ZSWA 4OYWA 1RTJA 3KG0A 4PGXA 1OY8A 3DHXA 4OKKA 4WCEL 4UB4A 4NLDA 5AQUA 2PZSA 3Q8KA 2ADCA 1AROP 4FWLA 3WUHA 2MA1A 2O8CA 4HCBA 3QEWA 1LOTB 1IQZA 5DMRA 3IBPA 3H4BA 2CQ0A 1XMQJ 4UB2A 2SXLA 3VALA 1WAFA 2AEJA 2MKHA 2W4PA 3IN5A 3MPYA 1C4CA 2RPIA 4UAWA 1SC4B 2HBZB 2IY5B 2V4QA 3MXIA 5HATA 4ATNA 1AYEA 1IWAA 8ICEA 1OQ6A 3KD3A 2O5DA 1VQ6S 2EFPA 1JLBA 2WW8A 4Y3CA 1VSLA 1S4EA 3D3BJ 5AM5A 1S1VA 4RW7A 4GV9A 2AJFE 4LIRA 1A5XA 3M2VB 2BUPA 4C4TA 3GONA 4I28A 2KHQA 5JVGQ 1KQGB 2YHYA 1JNZB 3C65A 5CAAA 5DG9A 4E7KA 5CD4H 1P1TA 4ZVOB 2LYBA 1FESA 2YHAA 4P2FA 1WACA 1XNSA 3OLAA 4A8KA 3NVZA 3HULA 3DLBA 3BF1A 8ICUA 1LB2B 5AFUH 5DQGA 1KN5A 4E7JA 2P9IB 3UDCA 3H0MB 2FJVA 2D0PA 1WC6A 2ZIXA 2WSCC 1IBMF 2CQDA 2PA3A 3G25A 2ZHAA 1KW4A 2PFNA 3VQDA 4IYQA 4NZ0A 4CF2A 1BXNA 1ZD4A 3CJ7A 2C3UA 2H5JB 4KFBB 4JI1J 1BG3A 1B4SA 4PY5A 4RNHA 4KHYA 4ED0A 2ZH8A 2IAJA 5T7LA 2IBKA 4O3QA 3SCIE 3OT9A 4BVOA 2GAGC 3N7SC 1DAXA 4M5KA 2MJUA 1LWXA 3FZFA 4GVLA 2EQYA 2ZBQA 3LYSA 1FXXA 4A57A 3PFEA 3NS5A 2XY7A 4BDYA 3H7HB 4USJC 4FZYA 1PYSB 1VS3A 1F0XA 3UR0A 5EOZA 5AQYA 3VQ7A 3C19A 1LFPA 3VQBA 5BYRA 2JLGA 2E1FA 4C9DA 2PYJA 1ZQGA 5AJ3J 3TI0A 1VHIA 2ZZMA 4CEEA 4M8LA 3SBMA 5HR6A 3NH2A 3G4SN 1IXRA 1NMDA 3MEEB 1HBNB 2KXHA 3SCLE 8ICSA 4CLSA 4YR3A 3PRBA 3VGTA 1W2IA 3KLIB 2YHBA 5AI0A 4P10A 3KNGA 3ISNC 3VV2B 4FF3A 4JOUA 3PFOA 2BMBA 1RLDA 3TAQA 1RQNA 4IFYB 2R7YA 1Q82O 2P5OA 3W2WA 1JJHA 3JPRA 1GOBA 4PL1A 1ITGA 2F96A 4O5BA 3EY1A 1UZDA 5KG1A 3I33A 3O3LA 1QQCA 2HK3A 4BWMA 1B9FA 3QETA 4LH5A 4RU2A 4X65K 1VQKN 4EBEA 2GH1A 3V6DB 2LPEA 1ULRA 2P5GA 3D7EO 4Y2CA 3F44A 3R27A 1X31C 2DNZA 3EEQA 1RCOB 3OTOJ 2GVZB 2HS4A 2X1AA 1NU4A 1YSJA 2WFAA 4G6VB 1W2BR 4GKKJ 2YTCA 4RQ7A 1LK5A 4KLTA 1SV5A 4TURA 2C1EB 2ROGA 1SBRA 2LKYA 3EDQB 1QDUB 1VQ9N 4CVNE 5DG8A 1RHMB 1T8EA 3SSRA 4QWBA 3MMCA 1COOA 1EP4A 5CYJA 2HIQA 3HOSA 4A59A 3TJ9A 4RNOA 2YKAA 3TO8A 4E19A 5GAHI 3H46O 4YMOA 5M1QA 3CO0P 4FZXC 3MPDA 1QVFR 4KHRA 1P8ZA 3TJ8A 1JLCA 3KK1A 3ZSVA 5HMLA 4ZVTB 2ZVIA 3NS7B 1VQ7S 4V19S 2KV2A 5J0OA 1S5LU 3FMBA 2JH7A 1P6TA 4LF2A 4OHXA 1WORA 3EYZA 2X1BA 2BCVA 2AIRB 1C1BB 4CQ1A 3HSJA 4M63A 4JI5K 3RRHA 5DETA 5EWEA 1B0PA 5IT9O 3AUOA 4WKRA 5H1SV 3DRPB 3NXZA 5CCLA 2ALYB 4ELUA 2BHNA 3ZSZA 2JLEA 2QXFA 1WEXA 4ACOA 1KTQA 4QIFA 2K1RA 2NRWA 3THXB 4CWBA 1KL9A 4Q45A 5ALGA 3BEXA 3HHLA 1X2IA 3DNCA 3ZTSA 5JICA 1YJNN 2YNFB 1GLFO 3TUPA 1XR7A 3D67A 3ZZ0A 2CWKA 3QMQA 3W9HA 4PKGA 3DRRA 4FLUA 2O67A 3I0RB 3PMLA 4FF2A 2P9PA 3ZT3A 1MWYA 3KMSA 3AVHA 2XMMA 7ICQA 1F0MA 1RABB 8ICIA 1YHQN 4QR2A 3CB4A 1L3KA 4YNQA 4DN9A 4ZHRB 5BPCA 1B22A 2HNYB 2NXCA 1T7PA 2WFBA 3FCHA 2YX4A 4M47A 5I3QA 5CP2A 4NLKA 4NO7A 2LYVA 5EX5A 3GIRA 4C0HA 3AXMA 3MEGA 1A9NB 1NPPA 2D0CA 3MDCA 4K8RA 1OXJA 2HGMA 4XAKA 5B0GA 3QEPA 1AQ6A 3U1LA 3MXJA 4A2BA 5M1FA 2WW4A 3P49B 1RCXB 3ZDEA 3LWLA 2MAXA 2LDYA 4A8SA 2DRBA 3HSDA 2E20A 4Y2IA 1FTRA 3W1YC 3M8PA 1NGDA 2PAVA 2I8EA 3QLHA 1VSEA 5C25B 1TV6B 4CF0A 2IC3A 4JRPA 2KKHA 4H4MA 2H3VA 4CH0S 4DL6A 3UPQA 3V81B 4YMMA 1G15A 4JI4F 1SZ2A 5B0AA 3BGFA 3CJ2A 2HRYA 2GA7A 2A1JA 2DXEA 4FKYA 4LIWA 3MCSA 3PO4A 3NNHA 4DV3F 2UXBJ 5L46A 2VCPA 1M5HA 4DCOB 1U09A 4DV4J 1PK1B 4DR5F 2DNQA 4P6QA 1S9GB 2V9WA 4QS9A 3VZHA 5GADP 3CDAA 4ZIVA 2GCFA 4DQRA 7ICKA 1NGIA 4B3SK 5ALOA 1FFUA 4FJMA 2MY7A 2I5JA 4ED2A 3UM9A 1M1HA 1SIZA 1KBRA 1YVNA 4N77A 1KD1T 2ZXIA 4JKHA 4ZCKA 3C94A 3DJCA 4O5EA 2G08A 5CYQB 2OANA 2MYFA 2DR6A 3L3FX 4NCAA 3QWUA 2PFFB 1H6KX 3FZMA 3BREA 4ZJLA 1TL5A 4QS7A 1S57A 2M8HA 3DOMA 4OX8A 1S59A 2O4IA 5HQMA 4KB7A 5L1JA 3M6KA 3PIPL 1XWLA 2CGJA 3ZZZA 2G2YA 5IV3A 4PWDB 1RHQB 4LF6K 2WTUA 2NO4A 4DUZF 9ICEA 4KIAA 4KV8B 5K20B 3SYZA 2KVQE 2POKA 4DS4A 2HZVA 3FRZA 2HS0A 2CQ2A 1E6YA 5HBMA 5CA5A 2W03A 2BTFA 4WQ5A 2F44A 1OVYA 3T19A 5DB8A 1L5UA 4DSIA 4LUBA 3WXJA 3LQVA 1U1QA 5AKXA 2CG4A 2A10A 1X4EA 1TVRB 4PQUA 4AE5A 2NPFA 3KK2A 4WPAA 4E1MA 1RT5B 1BO5O 1F6TA 3AVFA 3SQOP 2G13A 4DTSA 2C2RA 4QR0A 4LVNP 3N6MA 8ICJA 3KDOA 4QZVB 1DK3A 4NJ8A 2RUGA 1NWKA 5IIIA 4OX9K 2DBYA 4FNHA 4H5RA 2CZVC 4CZCA 2UU9J 1Q18A 4ZKAA 3WXIA 4L75A 4DFMA 4K25A 3FFKB 5AXKA 3UMCA 4UASA 2VG7B 2FC0A 2KSOB 2JRSA 1RHKB 3R8EA 5U47A 3HXMA 1DT9A 5IT4A 1U2RA 4P2HA 1I1GA 1KNZA 4QIWD 2O3DA 4XIUA 4Q8FA 4Y65A 4ANCA 4NXMK 2Y9UA 4EEKA 5GAHU 4UAYA 3UDLA 2NYVA 9ICNA 3UXPA 4AQYK 1JLFB 1CPZA 4HWIA 4X84A 3ISZA 4Y34A 5GMDA 3CIPA 3M2VA 1N34F 4ZP7A 1CS4B 2P9GA 5ALYA 1NU0A 2HSTA 4F4YA 4OHYA 2F8HA 1T95A 1ZTTA 3GFYA 1N5WA 2KB2A 4LF8K 1ZOTA 2P1JA 2P9IA 2R7TA 3TZYA 2YCHA 5JMVA 3M8SA 4DHYA 2BCSA 4P0QA 2WHEA 3CSKA 1FVSA 4YR2A 3ISCA 2KHVA 2ZM6J 4K0KF 1W25A 4KFBA 2OTJN 4DR4F 2Z57B 2V8GA 3JS9A 3DGVA 4EGLA 1NOYA 5D15A 5L38A 4NY8A 5LJVA 4ILRA 3I6PA 2QO3A 4CJTA 3PX4A 3J81j 4RQMA 1IIPA 3MI7X 4NWBA 3WHIA 4UAVA 2Y9HA 2J7UA 4WTOB 3N97B 1YI2N 4BQZA 1VQPN 4J03A 3WKAA 4ID1A 4H4KC 3JAMY 1F21A 4LRFA 4A8YA 3VEYA 1HEKA 1T9UA 2APOA 2H5IB 1BA0A 2OMLA 4CO5A 5C2GA 5J2GA 3OYKA 3JPSA 3D2QA 4O3PA 3CCTA 3WKEA 4K8ZA 2IOFA 4O3OA 1IKXB 1FJGJ 4YOYA 4OLBA 3GQCA 2A1RA 4YCXA 3MEEA 1HBNA 2ADBA 3TA2A 2DH9A 3QEBZ 2E88A 3DXKB 5KFCA 4QZIA 3OJSA 8ICGA 2UUBK 3KLIA 4C8OA 4JK7A 1MLAA 4JI3J 1LXNA 3LWMA 3G6VA 3GCWP 1AW0A 5MLCQ 1RWKB 1S1TB 2CZ4A 4IFYA 4RJVA 4CHOA 4HCCA 2BJDA 1V38A 4FYDA 2QL7B 1V5VA 2VQFF 2CAJA 2M0GB 2QGFB 1YTUA 1NHVA 2HF3A 3I4HX 4YB7A 3GV7B 1XC9A 1WOQA 2K06A 1CXUA 3H8JA 4C11A 3KLGB 1J5EF 1U49A 3PNIA 3HRGA 3V6DA 2E7WA 1T05B 5AQZA 1TE2A 1KC8O 1ZQZA 1F44A 4EBCA 4DPOA 3AA5X 2IRYA 3EUB2 3WXMB 1N33J 4NLPA 2LBOA 1JL2A 2BJ9A 2GVZA 5DQHA 5IQQA 3SUPA 3R9LA 4F4XA 2NR0A 4UF4A 3QUBA 3S41A 4B1ZA 5F8NA 2VYPA 2BA9A 1QVGM 4GKJJ 4I6YA 2BRLA 2QYGA 1N52B 4N7TA 5THWA 1HL6A 2GAHC 3ORYA 4EELA 1R59O 1JWWA 4ZOHC 3RMBA 3R5BA 5C0YA 2CJKA 3D6RA 3KJVB 4TYBA 3H6EA 3SJHA 3DLKA 5ETNA 1VQ8S 1FJEB 5L8RC 2BKNA 1KVIA 1X66A 3HD1A 5ALPA 2LMIA 3VQEA 1RBLA 3GFXA 2G0CA 2KKPA 3NG8A 3Q2SC 1RDRA 4PKHA 2FPKA 2L08A 4K41A 5JVGL 5KFPA 3GDQA 3D6FB 3R6GB 1RXOB 4ICAA 3AGKA 2WB1C 2H54B 4YDDB 1QD1A 2MQLA 4LF7J 1FNOA 3V6HA 4WP3A 2ZWOA 3AT1B 1M5SA 4QZCA 1Z2ZA 3DEEA 3BZQA 4I6WA 5J0UA 3CCRS 3P39A 1GMVA 2F1FA 2IMWP 1T3QA 3MBYA 1HUZA 2XC9A 4BRGA 1PG5B 2MLXA 2GNKA 4LFCK 2CPYA 1F2GA 4Y6IA 3ZXWA 5D0EA 3OS0A 2FJ6A 3WEEB 4NYOA 3DRPA 5HJYA 1AFJA 9ICFA 1FWKA 3K1ZA 1XR5A 1L7PA 4QJVA 4DU4A 3S6JA 2P9EA 1X9MA 4DTXA 5CZ1A 1QVGR 4Z4CA 1VQ6N 3THXA 2AQ0A 1LNQA 4NV0A 2G8KA 2NSCA 9ICLA 3VVTA 2YNFA 3HSTB 1JXBA 3TFRA 3MCNA 1HW9A 5EGYA 3S01A 2FMSA 1C6VA 2YQ1A 1WG4A 3FZBA 3I0RA 2B6AB 1JALA 3VETA 1XJWB 4MT1A 2MDAA 2A41A 4B3MF 3K2PA 3MWPA 4FJLA 1J2VA 3QJLA 3O5BA 4WWSA 4ZHRA 5E3PA 1BIZA 4LFAF 5K8MA 2ITGA 1RG6A 1GMUA 5IV4A 3N4PA 3AVLA 4FWMA 2LDIA 2RDIA 3TZWA 1BWEA 1GLCG 5KPZA 2K8GA 3HPGA 3D4JA 1JCGA 1K6YA 1JLAB 3CJTA 3H20A 1SJ1A 2WONB 3GBTA 1UA0A 5ADZA 3OY9A 4PWWA 3I87A 5LOQA 5J2QA 2BEFA 2KJ5A 1R0AB 2RJZA 5C25A 1TV6A 3C1ZA 3V7JA 4X4PA 5J1NA 3OHAA 3V81A 3WNGA 4OYOA 3TNVA 3TAMB 4K43A 4KT0C 2DNYA 1FX4A 3U27A 2IA6A 2GWJA 4G65A 4I64A 2RH3A 3D2NA 1N61A 1M90O 2V50A 4YFUA 3AJDA 1PK1A 2F1HA 3ZZYA 3GTYX 2AHOB 5ADXH 1S9GA 2E5GA 1VBKA 2AP1A 2ZGYA 3DCAA 3QU7A 4NYPA 2KT5A 2FY8A 5KFWA 1S9EB 1IG6A 3BS5B 3ZNUA 2DEIA 1NBEB 4J7CA 1RAHB 1EKRA 4A8XA 3MN5A 2HOIA 3CJCA 2EEYA 4PXDA 1Q7YO 4USHA 3FGUA 2JEGA 4CD1A 3SEIA 1QE1A 2CPEA 3CNQP 4LF4F 4RBTA 2E6MA 4J2BA 5CYQA 3SR6A 3L4QA 4DPWA 1VSMA 1RKJA 2AXTU 3R2DJ 2XMVA 2YMMA 3BR8A 2UUAJ 3AVCA 4O9MA 1MMLA 4LF5J 4Q8EA 1IKWA 1H2VZ 3C2MA 2WOMB 1K8AT 2GUIA 1ASWA 4OZNA 1Q8KA 4PWDA 2D69A 2ZH4A 3H0PA 1S5JA 2V6AA 4ETXA 4KV8A 4KLQA 2Q4TA 1KWMA 1S12A 3V5RA 4ZCIA 3F2BA 1S1WB 2X7IA 3HRDD 2PKEA 3HKZD 4QZAA 4CLUA 4CM2A 1JXVA 1SB3C 2QWNA 4FK0A 2Y8YA 1TL4A 1OMSA 1REGX 4M1KA 3KLVA 2BBEA 2VJVA 1Z3EB 2FBXA 5FPNA 5KFQA 2W7PA 4DV1K 2IVNA 1TTHB 1TVRA 4CJ3A 5JRTA 2UXCF 1NJIT 1U47A 4QZGA 2BOPA 4AXIA 3C14A 2HVHA 1RT5A 3WQUA 1PO6A 5AQNA 4B1YB 4Z4IA 1U1MA 5DDYA 3G82A 4M42A 1IV8A 2P9LB 4ZVHA 2FLNA 1B43A 3RJHA 5IC6B 2ZC3A 4PYAA 2LXFA 1HHTP 4MFBB 1U24A 4IR1A 1N5TA 1TMJA 4CTAB 4IJNA 4A8OA 5KFLA 1KVJA 2PI4A 3HHDA 3P31A 2EBEA 2VG7A 3U3GA 4BG8A 4H0TB 3U8XA 3HMJG 4M95A 4YORA 2KSOA 3H0RB 3GE1A 4DQ8A 3SMSA 4B02A 1WOPA 1KLMB 4IG0B 1VBXA 1FFVA 3DOKB 4NXZA 2CQBA 4ZP9A 1ZJNA 2KDOA 3PMNA 9ICHA 1YQHA 1YRUA 3M2RB 2Q79A 2EFOA 3NH0A 3L8BA 1EQYA 5ALWA 2KXNB 2AJQA 4H5WA 3LAMA 4JV1A 4RW6B 1JLFA 2K3KA 2VA8A 2CRXA 2QL5B 5J8YA 2JEIA 4WP9A 1CS4A 1KBUA 3CM6A 5DO2A 2KIVA 1I94F 1WF1A 4UOCA 3L6QA 2VH7A 1TFYA 2VJ5A 4QYZJ 2KFYA 4IUFA 3P83D 4MEYA 2YN4A 4DS5A 1U1OA 5IQ6A 3Q24A 2P9SB 2Z2MA 5D4OA 4MK9A 1XMOF 1FF2A 4LRBA 1N60A 1X4BA 1K9MO 4OJ6A 3SPZA 2JR5A 5GADI 2MKJA 4CBUA 2PY5A 1FDDA 4HHHA 3NF6A 4MKAA 4F0MA 1NM1A 2JOQA 2W9AA 4JNEA 2RDDA 4C48A 2HLUA 3S9HA 3H5XA 5AQOA 3BZKA 2NYIA 2QMWA 2WUSA 1QUPA 3VF6A 3A5MC 3E8OA 4ZP8A 2YWHA 4YOEA 1M5VC 4XDDA 3FRYA 1A77A 3QXGA 4TLQA 3NY0A 4TYAA 3ETRA 4HVZA 2EI5A 1M5PC 3OYEA 4DZ6A 1M1KT 1IKXA 4L73A 4CJSA 2F5GA 1YGYA 4R66A 5HLFB 2KVSA 3DKDA 1IG9A 3DXKA 3RSEB 3FNNA 5K14B 2ZJPQ 4DWIA 4IO1A 3M30B 5JTIA 4FE3A 4FJ9A 5IINA 4WBFA 3B8HA 1A6SA 1LWCB 2OEHA 2D0AA 2EANA 2FI1A 1DGJA 4MMOA 5FJ4A 3VGLA 1FO1A 1HWJA 4US9A 4KHQA 3I8BA 2HZAA 3SQ4A 2EHGA 4LR9A 2PMHA 1QHTA 4HT5A 2D6FC 4KH4A 3KLGA 1GEHA 4YY3J 3CO9A 5EWFA 3K7RA 2RHFA 2Y9TA 3HHLD 4BDZA 1T05A 3FSXA 1WWHA 5F3XB 2K4PA 1YF5L 4FJHA 1K47A 4C3LA 5F0XA 2B4PA 1FJ7A 4DMZA 1TL3B 4AFFA 5DDPC 4G9BA 3AD9C 3DI6B 1WSVA 1UJ5A 4URGA 1EX4A 2CQ1A 2XY5A 4ECWA 1ZQOA 4F50A 1TUYA 3SDEB 1ZA1B 4LRAA 3K58A 2Q0UA 3C8YA 1IBMJ 1LAVA 5JVHQ 4DL3A 3HOTA 4F2RA 3KMQA 3CMES 3MDAA 1RB0A 3SIPB 4RQ4A 3GR1A 3IAYA 2BE2B 2I5HA 1S5ZA 5J1PA 1ZQWA 4TVAB 3CDBA 5B0BA 3W66A 5B66U 5J0PA 3AV9A 4OZJA 1GTHA 4G1IA 2JWKA 4K2JA 3LGNA 4I9QA 2BV3A 4XQ8A 5KFYA 3I0SB 1WAJA 3BSNA 1HBMB 2J0WA 1FHTA 2Z0GA 1VLBA 2A1BA 4ZPDA 4X65F 2NSBA 4O23A 2ASJA 4HAIA 3F56A 3RBXA 4CJLA 4CFCA 4PUOA 4M5GA 2JL9A 4URSA 2V2KA 2N3LA 5BREA 2WVEA 3WEEA 4NLBA 4OV6A 2BZ2A 1SJRA 7ICSA 3OR1B 2C3OA 4J9NA 4RO0A 2DFFA 4KHPF 2OPRB 3LDOA 4Y2AA 1KLNA 3G2XA 3T1YJ 4TN2A 4CIEA 4DV2K 2ALZA 5IT9Y 4TY8B 3RMDA 1SH0A 4OYXA 2KICA 2OP5A 5ADXA 2I6XA 2ZBPA 3HHKA 3CC7N 1TFWA 1OH8A 3NHGA 4I6AA 9ICMA 2JSXA 3A5NC 3J7AP 5I9EB 3NRZA 1PCAA 2B6AA 4O5FA 3U9ZA 4O3NA 4QZDA 8ICZA 1X1PA 4K4UA 2ABYA 2ZZTA 2M2BA 1UW9A 2UZAA 1F2HA 2MU2A 3Q7CA 3OTDA 2FMQA 4DG1B 2EFGA 1NJWA 3LM9A 5F3ZA 4DV6K 2VA3A 4EZ9A 4LSLB 4B8AB 1Z05A 2AV5A 3BUZB 2E44A 1L3TA 3O44A 1TK5A 4K5SA 3TAFA 3OBIA 1TKDA 5AQPA 4NLCA 3OL8A 5AE1A 1XNQK 3P5JA 2ZDOA 1WKKA 4AYBC 1JLAA 5H9FJ 4JI5F 3O8MA 5KFRA 1WNEA 2HZCA 2WONA 2YPZA 3CXCM 3JXOA 5BRDA 2XNQA 2JVRA 4YOUA 1P9QC 2IA0A 3FBCA 3E9OA 5G0RA 4LH4A 3QNMA 4KBIA 1FO4A 1SXEA 1WWUA 1QLNA 4DV5F 4RR5A 2LKZA 1R0AA 4UZBA 8ICKA 3PY8A 3NLCA 3A8EA 1XNRJ 3TAMA 1FKAF 3QJJA 2MUTB 4CCHA 2OM6A 2AGPA 4NLTA 3ZC4A 3HJVA 5AXNA 3D45A 1ZQNA 3K75D 4OHZA 4MFFA 1VQOS 2VKZG 2NRXA 3H98A 2RSQA 2Q0RA 2I1RA 3VEZA 3K8VA 4J91A 3QEIA 3QAEA 4OX6A 4X4RA 4BRMA 3GDXA 3TW0A 3KHHA 2V0NA 5GADU 2F8TA 4RWWA 1S9EA 1DXSA 4OI3A 3BS5A 5KFTA 3PVXA 3HZGA 2FC9A 1NK5A 3B0XA 3CP8A 4H5VA 1Y5IB 1NZBA 2FTRA 1TUVA 4KLDA 9ICTA 2JJ4D 5LMNK 1S7HA 4NLQA 3C6AA 2J9CA 3FC9A 4MO4A 2LXUA 2VUGA 3NGUA 3CERA 4QOZB 3IAS9 4WK3A 5FROA 2DISA 5ALJA 2GJ2A 5IWAF 3J7YP 2VQEF 1V4TA 1OIAA 2P6RA 2RS8A 3OYMA 1FTCA 4IQVA 2WOMA 4O4GB 2C28A 4I2DA 5ALIA 4A5BA 5HRPA 4ZN3A 4CZFA 1R27B 3UN2A 2ESEA 2FXUA 2MSNA 1GQEA 4KH5A 3ZT0A 3EPIA 3LPYA 3G71S 3HBTA 2FLLA 4ZJOA 1B3TA 3O8WA 4JI0F 1MNEA 1S1WA 2OD4A 4JYAK 4F72A 2NCKL 2KO1A 4P9SA 3L0QA 3EKUA 2OPQB 1WBDA 5KFBA 1NUEA 1U04A 3QBWA 1VSHA 3VA3A 2HHQA 3PEHA 1Z25A 1Z26A 3HFZB 4H0OA 3GJQB 4IBNA 3GOIA 4B3SF 4NRUA 1V4SA 3EW9A 4RW9B 4DDFA 4KLHA 1Q82T 3U1NA 4Z94A 5EXWA 2RLTA 5KFSA 2KYXA 3R5CA 2R2SA 1HNIA 1FRLA 4OFZA 4F26A 4WFAQ 4JRQA 2HB5A 2IOCA 3MABA 4KLJA 5AE2A 4LBIA 5AQRA 4YDUA 3N7RC 1FXLA 2HI0A 3R3LA 4M9NA 3VERA 2IRXA 5FPDA 1OO0B 3BGUA 2P9LA 1ZQUA 3AHPA 4NPOA 3O9RA 3GV8B 8ICAA 4JI4J 2A18A 2F63A 4CTAA 2QMXA 3D6MB 3OPXA 4DV3J 3AVBA 2FD2A 2V2QA 3PYEA 2NNWA 4FPRA 5HVHA 2BQ3A 4EYHB 2C3YA 3HFKA 5MLCV 3NGDA 1CBKA 2HBKA 1PC4A 2IVMA 1RSCA 4IG0A 3RJKA 1N32K 1JCEA 3M8WA 2HFZA 1V97A 1YITN 1VYAA 2VICA 4YHHK 3M2RA 2DGQA 4WYLA 7ICRA 2W24A 1VRQC 5EU7A 2O1PA 3PW5A 1DTTB 4YOWA 1IR2A 2U1AA 4RW6A 5GIOA 4Y2QA 4M3RA 1YKWA 3ZDCA 7ICEA 4KX5A 2DKXA 3NMRA 1QM9A 5KOWA 3QFHA 4YQWA 1NOMA 2OZSA 3VAHA 2IDEA 3ZDDA 2N7YA 1FI4A 3A0HU 5F41A 2XS5A 3DDKA 4LF1A 1U48A 1MROB 5L1LA 1SL2A 3W0LA 4DV0F 3LK9A 1Q3VA 1BMQB 2P9SA 3IV6A 1X4CA 3CULA 2K4IA 3CCQN 4C7ZA 5J0QA 5FPMA 3BP8A 4LFBF 5KFIA 2NRHA 4C4SA 4KPCA 4WFNQ 2NXJA 1D8YA 4KLFA 4L3QA 4JAXA 4F3QA 4PPZA