2RRDA

Structure of hrdc domain from human bloom syndrome protein, blm
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
GIPEFKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the HRDC domain of human Bloom syndrome protein BLM
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords HRDC domain from Bloom syndrome protein
total genus 26
structure length 101
sequence length 101
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rrdA00
2E1FA 2HBJA 3SAFA 2HBLA 2RHFA 4QIWF 4CDGA 3SAGA 2CPRA 2KV2A 4NLCA 4OO1J 4CGZA 2HBKA 1D8BA 1YT3A 1WUDA 5C0YA 4O3MA 2HBMA 1GO3F 3CYMA 2E1EA 3SAHA 2RRDA 2MA1A 4QJFB 2DGZA 4NLBA
chains in the Genus database with same CATH superfamily
1NZPA 5L1JA 2WF9A 1PVQA 2GWSA 5ALEA 1S0VA 2ZUCA 3UQ0A 3ZDDA 1L7OA 1FFUA 8ICHA 1BPEA 2A1JB 4DSFA 2W03A 3RFAA 1ZQSA 4DQQA 3IG8A 2QB1A 3I1YA 4DLEA 2YMMA 4O3SA 9ICUA 8ICJA 3D2QA 2FDRA 2P6RA 9ICTA 3JPNA 4B9VA 1ZQDA 1JI7A 3EZ5A 5DBCA 1HUOA 2Y0SF 4NJ8A 4YMNA 1RQNA 1JALA 3SQIA 2Y0SC 5ALWA 2KK0A 5IIKA 4GC6A 4RNNA 2E8MA 1ZQPA 2OH2A 3M6KA 1KQQA 4JV0A 1KLNA 5CB1A 2BZFA 3C5GA 2D3DA 3HT3A 4CGZA 4B9NA 2DQNB 1K1SA 4RQ5A 4C7YA 9ICRA 3ICXA 2F1IA 4RNMA 5AIBA 3BQ7A 3TFRA 1TAQA 5J0SA 1SB3C 3RTVA 2K8BB 4Z6EA 4RQ7A 2LYHA 1RDFA 3M6ZA 3FC4A 4Y2VA 2EZXA 1X9MA 4BX9C 4P4MA 3A0BU 1Q46A 2JV3A 2F8KA 5K4LA 1RQLA 2P6UA 2VA3A 2W9CB 8ICGA 3PZPA 4PHEA 3OGUA 2NRXA 4RPXA 4Y2TA 3E2EA 4UAZA 1SIJA 9ICXA 4DFMA 2IMWP 2E5SA 2K89A 4CE6A 4YFKA 3RJKA 2ISOA 4UBBA 3OJSA 1U9LA 4PZOA 1T8EA 1SKRA 5AKGA 4YVZA 3I28A 4DEZA 2KN7A 1D9DA 2E1EA 1S76D 4I28A 5HMMA 2BPCA 5KAIU 4O5CA 9ICOA 4PPXA 3RJGA 4IQVA 2JZBA 4EZ6A 1PUZA 5KT3A 1JN3A 4DL4A 2FLPA 5BOMA 1MQ2A 1ZQMA 1RYSA 3H8JA 1V38A 9ICMA 3SZ2A 3RF9A 4R66A 1Z1BA 4AYBF 1T3NA 4F2SA 5KT5A 1PZNA 2G07A 3M9NB 4IR9A 2P66A 5KFZA 3GU3A 3GZFA 1ZQTA 2ASJA 3LVWA 1T4GA 4YG2A 4QZFA 1NK8A 5KFIA 4DFKA 3NASA 5EWEA 4ELUA 5D49A 4UAVA 3PV8A 5H2FU 1PK1B 1L7PA 2AJQA 2W43A 5KFRA 4JV1A 2E8NA 3Q8RB 3Q8MA 4F5NA 5AK5A 4ECTA 3UMCA 3ISCA 5J0WA 2BDPA 4LJXA 4R8UB 1K1QA 8ICAA 3HRDD 4UAWA 3RB3A 5EWGA 3UPQA 4DSJA 1X9XA 2KTQA 7ICOA 3N4MB 1KSPA 1KEJA 4R8UA 4PHDA 3KHRA 4RQ0A 4UB4A 1U48A 4CF4A 3Q8QB 7ICSA 4EYHB 4O3PA 5KT2A 3FYHA 1TK0A 1JRPA 4OJOA 3GIIA 2KEYA 2ASDA 2R8HA 2KFZA 5KFAA 3C29A 1WWUA 2ZUDA 3RJHA 1OW5A 1VJ5A 1XU4A 3S6JA 2ZG6A 4FO6A 5KG3A 4RQNA 2AGQA 4DSLA 4CCHA 2Y9UA 5KFXA 4QWBA 2W9BB 3TAPA 1SWVA 3U26A 4C0ZA 2H3ZA 4PJ0U 4FBTA 3UXOA 2XC9A 5KFOA 5CEHA 1S97A 4J9RA 2JMGA 1IG6A 2DUYA 4MFFA 3E0FA 2MU2A 1D8LA 2W7OA 4YR3A 1RYUA 4O5KA 3UM9A 1Q3VA 5KT7A 4JUZA 4EYIB 3ED5A 3LDAA 2XGPA 1NJZA 2K4PA 1ZRMA 2F2AB 5AI6A 3N7SC 4QZGA 3B9JA 1C7YA 1UCVA 2K4IA 5KT6A 3BDPA 5J0XA 4DO9A 5KG5A 3QU9A 2ZIUB 4F4YA 4K4IA 3GIMA 4F5PA 3QE9Y 3BQTA 2ZJ5A 4NY8A 3MDCA 3G6YA 1MC8A 4BXOB 4GXJA 3H40A 4QJFB 4O0IA 3PO5A 3SAGA 4M04A 2A1AA 1ZD2P 4UASA 4P2HA 4KLTA 2H3VA 9ICIA 2W3RA 4F93B 1HEKA 4KLGA 1L3TA 4DFJA 5J2GA 4QWAA 1ED1A 1UA1A 1NKCA 1JUDA 5BPCA 3C2LA 4BWJA 2H3QA 2W04A 1RM6C 3CW2C 5KT4A 2QLTA 1ZQ1C 4ED2A 1KW4A 3GDXA 5J2JA 3RBEA 3JPSA 3NVYA 4DF4A 4I2CA 5HHIA 5J2EA 3V7LA 5KFBA 3MR3A 3WKEA 2C22A 4DSKA 3H4BA 2OWOA 3KTQA 4RU9A 4QW9A 5KFMA 8ICPA 4KLLA 4IR1A 2W55A 3TACB 4YCXA 5FP0A 3ZD9A 1VLBA 1B43A 1QCKA 4Y2PA 3GFKB 5AKIA 1COOA 2ES6A 4J9NA 1JMSA 2W9MA 3B0XA 1GO3F 2R18A 4YQWA 2ASLA 3NRZA 4MHVA 4Q8EA 1MQ3A 5J2AA 2KZ3A 1KDHA 8ICZA 2B21A 2WAQF 4QIWC 2KV2A 1A0PA 3HP6A 4Y2SA 2C28A 2FPLA 2H3IA 1QLNA 4EELA 1XO0A 2FMPA 4I2GA 4JK1A 4DL7A 5GTHU 1URJA 2K60A 2DL0A 5J2FA 7ICHA 2ZTEA 1NKEA 5ALFA 3WKDA 3MDAA 1ZQUA 1JXEA 2AGPA 2WFAA 2Y9TA 5J2HA 2Y1IA 3N28A 4YMOA 3ETLA 4KN4A 2R8IA 4NLGA 5IIJA 2HHQA 4C4SA 2W54A 3UXNA 4JMUA 3LYSA 4RUAA 3MFIA 4I2HA 4KN7A 1NK7A 4RQ2A 3HKZF 3PX4A 3LK9A 5KFVA 1T94A 5DGAA 3WK7A 1RYRA 7ICQA 1VDVA 3QYPA 3UMGA 1S9FA 3EYZA 3NVWA 2BR0A 2W8LA 1X66A 7ICTA 1X40A 1FFVA 3QUCA 4DL5A 2BCUA 4NLBA 3FAHA 2PI4A 1SV0C 4E0DA 2G09A 3ZDBA 2YMQA 2KIWA 2BPGA 4LVSA 1A6SA 5AKJA 2OYYA 5KFHA 1L6NA 3H8MA 1WG8A 4MEYA 2QARA 2VIXA 4O3MA 2PFQA 4ED7A 3L4PA 5ALTA 1ZYQA 7ICVA 5J0PA 4I2JA 2YQEA 1Y88A 2D6FC 3KFUF 1DGSA 3SAFA 3AN1A 4Y2RA 2XICA 1Z19A 2HHSA 4F4KA 3OTQA 1C20A 2XIDA 4F91B 2FMSA 2F44A 4UATA 2CN1A 2FI1A 3PSTA 3QXGA 2BGWA 2JXJA 2ODGA 1UT5A 4DL2A 2XY7A 3H4DA 4RQ8A 1NK0A 2E8PA 4BDPA 1V97A 3Q8SB 4WJ3B 3JPTA 2J6TA 2EANA 1TKDA 1JXLA 2KVSA 2A1JA 1A77A 4HYKA 3Q8PB 3HPOA 2EAMA 5ALOA 1BPYA 3AU2A 7ICFA 3D2SA 4OJLA 3F2DA 2N1RA 3WU2U 3BZCA 3PMLA 4NLNA 3RJEA 3WK8A 8ICNA 1S0OA 4I2DA 2ZIVB 5A0LA 4ECQA 4B9UA 5KG7A 1S8OA 2HBKA 2FE9A 1NJXA 3K1RB 2DFLA 2MRLA 1NZBA 4C8MA 4ICAA 9ICKA 5KAFU 5F3XB 5AI4A 1X9WA 4Y2YA 1N56A 4I27A 3T3FA 1F44A 4YXMA 1ZQEA 4O3RA 2BCQA 4DOAA 3H0LB 4EEKA 2WB1C 2D8CA 2YB4A 5HHHA 1EXNA 1HJPA 8ICOA 9ICWA 5AHXA 3GV7B 3AUOA 5J2CA 1IM4A 1HIWA 3KZIU 4BUGA 4BXOA 4Z6CA 1X2IA 1RXWA 9ICCA 2HW3A 1AQ6A 8ICYA 4RQ4A 3TAQA 2W9BA 1KTQA 5J8YA 3PW4A 4EENA 1SL1A 5ALRA 1JX4A 5KFTA 2LM4A 2IOFK 3GV8B 3RAQA 1JIHA 2HVHA 3FDSA 2LBOA 5CHGA 3Q8KA 4C8NA 2LYAA 1RZTA 3UXPA 4UQGA 3DEEA 5DBBA 4Z6DA 3SI8A 3PW0A 3ZDAA 3F5EA 1SGGA 3QU7A 2C2RA 2IBKA 9ICEA 5KFWA 2VJ4A 3F2BA 1ZRNA 4O3QA 4M9JA 3K75D 3RR7A 1N2XA 1KL9A 1IV8A 4B6JA 4G9BA 1ZQHA 1TE2A 5AM2A 5EWFA 4KLUA 9ICAA 2ALZA 1NK6A 5DB9A 5JTIA 2KMDA 4R64A 5AKYA 5G5GA 4TURA 3T5JA 3AMZA 4FZLA 3D6JA 5J2BA 3KOOA 3K4GA 4CNQA 4Q45A 1ZJMA 8ICKA 1ZQIA 1BPXA 3OSPA 5KG6A 2O6KA 2PMZF 4P0QB 5L9XA 2HI0A 4I2AA 2G0AA 4QZDA 2YY6A 5DDMA 2ZXHA 4USAA 4F92B 1A76A 4GC7A 4ECZA 5ALLA 5JU5A 1U47A 1TAUA 3QU5A 4KMOB 3GILA 5IIOA 1KN5A 4PGXA 4QIWF 5E79U 7ICLA 8ICIA 1TAMA 1F0MA 3RB0A 2BQUA 1KFSA 2LI6A 9ICFA 2UVWA 3AU6A 1WUDA 1ZETA 8ICBA 5G5HA 5ALVA 5DB7A 4O3NA 1XSLA 2ZIWA 3MGHA 5TZVA 4DFDA 2WAQC 5J0OA 3WK4A 3L5KA 8ICTA 2KIVA 3PX6A 4FZNA 7ICGA 1BPBA 2DPIA 3PW7A 3IP4B 1ZQAA 2JHDA 4NL9C 1QQ5A 2IOHA 1OXJA 2KICA 2ZJAA 1NNLA 3WK9A 2AQ4A 4AP9A 4F8RA 1S5LU 2KSOA 5DBAA 1L7MA 5DG7A 3SENA 2WF8A 2JH1A 3PW5A 1DXSA 2K4EA 1B4FA 2VA8A 2YN4A 8ICXA 2RDJA 2KJ5A 1UA0A 4EBDA 9ICLA 8ICWA 3UMBA 5ALQA 1ZQVA 4RT3A 3BQ0A 8ICVA 2BCSA 4TQRA 2W11A 2H5XA 2F77X 2BHNA 4IL6U 1AROP 2Q4TA 5EE0A 3V6HA 2HSZA 4ED6A 1NJYA 3QUQA 2EAOA 1B22A 3PR5B 4CRXA 1N5WA 3AQFA 1TFRA 2EZZA 3QX7A 4KMUA 9ICBA 2ISPA 4PL1A 3C2KA 3OPXA 2JGAA 4GFJA 3A0HU 4US9A 3BZKA 5F9NA 2HMXA 2BCRA 3BJYA 4CF5A 1SV0A 2OCEA 2NYVA 2KD1A 4ED3A 1UT8A 8ICEA 3DDHA 1CUKA 4NWIA 5AM5A 4YR2A 4MFAA 3RJJA 3PR4A 2L5YA 3MBYA 4U6PA 2E1FA 4XRHA 5DB8A 2VANA 2ZTCA 2WTFA 4DQIA 9ICQA 2K8AA 4UAYA 1UQVA 2XCPA 5ALDA 3M9MB 2HHUA 4FS2A 2NRWA 5KFJA 3QUBA 4ECSA 4A8EA 3HW8A 2QB0A 5AKHA 1BNOA 3SD7A 2HHXA 1J2MA 5L1IA 5KFUA 5AKEA 1X6IA 4QW8A 5HMLA 4O5EA 1L5UA 4DQSA 1L3SA 2LMRA 1ZQFA 1NKBA 3CNHA 2OHFA 3QEAZ 2KHQA 2AH5A 5ALSA 4EX6A 5AI9A 4Z6FA 3SMVA 4FBUA 2W7PA 2PI5A 1D8BA 3RB4A 4JV2A 4PGQA 1L7NA 2BDUA 2A19A 5AKLA 3BS5A 5B66U 2ESEA 2R8JA 3EW9A 5GTIU 5L1MA 2W8KA 4R65A 3KKAC 3V7JA 5KFGA 4K4HA 4EX7A 2LPEA 4QNLA 4UARA 2I9GA 4ED8A 2GH1A 5B5EU 5C0YA 5J29A 5ALJA 4NV0A 1N60A 4FFDA 2BQ3A 4KLDA 4DS4A 2MUTB 2CXYA 4PL2A 3SAHA 1QSYA 4J03A 4IC9A 1N63A 2EZYA 3TARA 3VC8A 1DRGA 2HBLA 3F53A 4DOBA 3HILA 3SEIA 3T5LA 3PY8A 1XO1A 1PVPA 4NL9A 1HUZA 5KFSA 3JPQA 4C8LA 3MR2A 4NLZA 1MN8A 1ZQXA 5BOLA 1N62A 2MUTA 5AI5A 4QZHA 2HHVA 3G6VA 4DSEA 2W9AA 2V9WA 1WWVA 1CRXA 2K8CB 2CPRA 2ZTDA 3IM1A 4YP3A 4AYBC 4F72A 1SKSA 1PK1A 1JROA 4EBCA 2ZIXB 4KTQA 3V7KA 4Y2UA 4F2RA 4MF2A 5AM4A 3TANA 1D8YA 1ZQCA 4Y2JA 2PKEA 2I5HA 4JWNA 1TVAA 1YZ6A 5DG8A 5AM0A 4KX5A 4DCCA 4IS7A 1M6YA 4IRDA 4UB8U 4YXJA 8ICUA 2VA2A 2HOFA 3OHAA 2QARB 5AIAA 1L8LA 2NRZA 1UHUA 1ZJNA 1ZQWA 3MGIA 3ZDEA 2VKQA 3EUB2 3RJFA 2KSOB 4GIBA 2QKQA 2UVUA 4KLIA 2LM1A 1RPLA 4FE3A 4M9LA 4RPYA 2Z7JA 4ECWA 2F1JA 1T3QA 2RHFA 1SL0A 4J9KA 3JPRA 4JB3A 2K4HA 4OO1J 4KLOA 3Q8LA 4P4OA 9ICHA 4ECUA 4DOCA 2ATLA 5KTQA 4DF8A 1ZQRA 3CP8A 3LVVA 4ELVA 2ZIWB 4LZGA 5KFKA 5J2IA 4F5OA 1TK5A 3R9KA 2MSNA 5ALUA 4TUSA 2M9NA 3QU2A 4KLHA 1Z4OA 3VCBA 3RJIA 5JRTA 3TADA 3F5AA 1X9SA 5L1KA 1ZQKA 4RQMA 2QB0B 2XGQA 2M0NA 1ECWA 3C1YA 4ECXA 4IQUA 5HR6A 4F3OA 3ZI4A 2EH9A 2C2DA 1X42A 3H8WA 1BPZA 5ALXA 1ZQBA 2HVIA 5IIMA 2R8GA 3H8SA 1ZQGA 3G6XA 1N5XA 2HOIA 3H0MB 1U49A 4TUPA 3ISDA 2YX8A 5J0YA 5DLGA 2HBJA 4UB6U 5T14A 4J9OA 3H7IA 1ZOLA 1QTMA 1Z4NA 9ICJA 1COKA 1DGJA 7ICRA 2GO7A 2FPMA 3QU4A 5ALNA 1TV9A 4O3OA 4QZBA 3MC1A 4BJQA 3C2MA 4TUQA 3IG5A 3OJUA 2XY6A 2HHWA 3T79A 4PZNA 5HR7A 5AM3A 3TADC 4IRCA 3PNCA 4UW9A 4F5QA 3KZXA 2B6GA 2MAXA 2J6SA 7ICMA 5KG1A 8ICFA 2HCFA 4RQ3A 3C1ZA 2GLEA 5JUMA 4NLKA 1BPDA 3PO4A 3SR6A 4B9LA 3QZ7A 3IDWA 1PVRA 1V9PA 1P7DA 2OXOA 3LWLA 4RQ6A 4DQPA 3NTUA 5J2DA 3EWAA 3PVXA 4PH5A 5CA7A 1U45A 4B9MA 1LVHA 2BPFA 2WF5A 3RB6A 3NGDA 3TI0A 3M1YA 4I2FA 5CR0A 4I2EA 2XI9A 1BGXT 3AM9A 4DFPA 5KL1B 4FS1A 2XCAA 5AK4A 3T5HA 5D46A 3JPPA 3N97B 3PMNA 5AKKA 3OSNA 5DGBA 3M8RA 2KNJA 5IIIA 2KVCA 5ALKA 2WF7A 2XO7A 5IINA 4J9SA 3RR8A 2E3TA 2WB1F 5J8YC 8ICCA 2WHEA 4DLGA 4K4GA 3IV6A 2ZJ8A 1SZPA 4KLMA 3OHBA 1NK9A 3J81j 5AKZA 1ZQYA 8ICLA 3RBDA 1ZXIA 2PFOA 4ZOHC 1D9FA 4TQSA 3TQ1A 4KX3A 2FLLA 3N7RC 5KG4A 3THVA 2NO4A 5L1LA 4XA5A 5KFNA 1CI4A 2F3NA 3RRHA 2AHOB 4KITB 2GOLA 3ONNA 1Z00A 4KLJA 4ELTA 3RH6A 3N7PD 5J0UA 3O0FA 8ICRA 2IOFA 4F5RA 4F71A 9ICGA 3HX0A 1J2NA 4Y2XA 4NM1A 4KLFA 2YMPA 4M9GA 3ZDCA 2JZBB 2LYBA 5KFPA 4U7CA 4FZMA 4RQ1A 2YTUA 4YD1A 1IIPA 2KOBA 2C2EA 4CDGA 2NO5A 5KFQA 1XSPA 4M6WA 3D2NA 2RQ5A 4UB1A 4UBCA 4F4ZA 1FEZA 9ICPA 1ZQZA 2LKYA 2UVVA 2KHVA 5ALGA 4J9MA 2HHTA 4ACOA 5EOZA 1ZQOA 4DSIA 7ICEA 3K1ZA 1ZQNA 2EQYA 5ALYA 1PK3A 1DK3A 9ICSA 2IA6A 3BQ1A 4QZIA 3MR5A 1LKYA 2HOQA 1SZHA 4G3IA 1WCLA 1ZD4A 2IHMA 4OJ6A 3DV9A 4US8A 1XNSA 9ICVA 2NV3A 4I2BA 4IQWA 1KBUA 4EEYA 1QSLA 4C8OA 3HKZC 4YD2A 2JEIA 4RNOA 4MF8A 1MA7A 2DKXA 5KFDA 1N61A 1KFTA 3WKAA 1ZD5A 3H0RB 3KHHA 1F5SA 4QZ9A 4YMMA 1BVSA 3KD3A 1N48A 2A3VA 1DK2A 3GIKA 3RRGA 4GXIA 3C23A 4B9SA 2LHTA 5AI0A 2CRXA 5KFCA 1QSSA 4RZRA 3ZD8A 4Y2QA 4BGDA 2ZIVA 3PX0A 4C4RA 4O9MA 3V6KA 1Q8KA 5J0RA 3B0YA 2EDUA 5F9LA 4RPZA 4QZCA 3NVZA 1ZQJA 3NS1A 3AEVA 3QNMA 3T5KA 1ZD3A 4MFCA 5ALZA 1UPHA 3WK5A 5AICA 4RT2A 1KFDA 1SWWA 3HJEA 2JEGA 4R63A 4M9HA 4QZ8A 2AGOA 4F50A 5HP4A 2DKZA 2PXIA 5KG0A 1H38A 5IILA 3E58A 2E8OA 5AK6A 3ISBA 4DQRA 4P4PA 2RDIA 4ECRA 2DWQA 5ALHA 5DG9A 2FMQA 2KKVA 5D4BA 4IRKA 1NI3A 3V6JA 1K5OA 4BWMA 2HBMA 1YZ7A 1XC9A 3NUQA 3M8SA 4UB2A 4UB3A 1KRPA 5KL8B 5AM1A 2OEHA 4F4XA 1S10A 2KJ9A 3M7DA 1U4BA 3BS5B 3CRXA 8ICSA 2OM6A 4YR0A 2KZMA 2PFNA 4EZ9A 3BQ2A 3BS7A 5DQGA 4QWEA 7ICPA 1O08A 4ED0A 4IQTA 1SV4A 4KLEA 4C4TA 3MGVA 5DDYA 3SV4A 1L8OA 2BCVA 1XSNA 3V72A 4OCZA 2KZZA 2DPJA 2AXTU 1SKWA 4UAUA 4NLCA 1OUQA 1SXDA 3UQ2A 7ICIA 3HWTA 5EE1A 4ED1A 3FM9A 1T7PA 4HAIA 1LB2B 4YN4A 2KKPA 1SXEA 2XVTA 2FJ6A 5KFYA 3GV5B 5KFFA 3IHQB 5EE9A 5J0TA 1J97A 2JEJA 5AK3A 3QUTA 2G5HB 5ALPA 2JH7A 2J6UA 3EPIA 7ICUA 2PMZC 2KE7A 4QWCA 4I2IA 4M0AA 2B0CA 3SV3A 5DQIA 3ORYA 4OJ5A 2G5IB 4J9LA 5ALMA 2NRTA 3NVVA 3M9OB 7ICJA 4P0QA 3C28A 2VJ5A 1DOQA 3AQEA 4Q43A 2DGZA 2I1QA 4P0PB 5KNIA 4GLXA 3WKBA 3MFHA 2G06A 3GQCA 5HNKA 2NRVA 2AU0A 2H3FA 2RLTA 3KHLA 1LV5A 3WK6A 4PGYA 4DWIA 2KP7A 3IN5A 3CYMA 4QZEA 4F4WA 8ICQA 4OD0A 3L3FX 4NM2A 2UVRA 2Q0ZX 2XY5A 4C80A 2JR5A 2F8LA 1Z3EB 1NJWA 5DLFA 1CEZA 5DB6A 4QWDA 3RH4A 1ZQLA 4C7ZA 4ZH4A 3PSPA 2W3SA 1SL2A 4PHPA 1S0MA 2YMLA 1S77D 2RRDA 3TKAA 3KHGA 2BQRA 3PSIA 2F76X 4LZDA 1QH9A 7ICKA 1S0NA 1WCNA 4Q8FA 4NXZA 3RH5A 4ECVA 1WYGA 3EPGA 4M47A 1XWLA 4JWMA 4QZAA 1NK5A 4P0PA 4J9QA 5C5JA 7ICNA 4B9TA 2EAPA 2F1HA 1NK4A 1RXVA 2ZIXA 2ZUBA 1L3VA 3I76A 5TISU 4DL3A 5J0QA 3C21A 4I29A 4XUSA 2BKEA 3IRUA 3TFSA 2AQ0A 4RUCA 4OJPA 5ALIA 3QEBZ 1TK8A 5CP2A 4M9NA 3F2CA 3ALRA 4GXKA 2KFNA 5KFEA 2FPKA 1IXRA 4ECYA 2IHNA 5J2KA 5KG2A 1QQ7A 1KKXA 1Q3UA 1NOMA 4MEXA 4DS5A 5CJ7A 5KFLA 2YB1A 2KJ8A 2HDOA 3WKCA 1XS9D 2WF6A 3ETRA 1QQ6A 5CWRA 3JPOA 1Z1VA 2V4QA 4DL6A 9ICNA 4M2YA 2Y1JA 1FO4A 2DBYA 4J9PA 3C5FA 8ICMA 3PSFA 2G08A 2FLNA 2DF4B 2JRZA 5AI8A 1Z00B 2ZIUA 4M6WB 5EE3A 2R8KA 1LKYB 3PW2A 2RP5A 3KBBA 4CF3A 1L3UA 3MABA 1RG6A 2I6XA 3NRWA 3GIJA 5DKWA 2W9CA 1BNPA 1ZQQA 1FIQA 4Q44A 5AKXA 3MR6A 1MSWD 3AL0B 2KG5A 2P35A 4KLQA 2PFPA 4C8KA 4X5VA 5DQHA 3LWMA 1YT3A 3SYZA 3KKAA 4PHAA 2JEFA 1X6JA 3QZ8A 2ZXIA 1O03A 3RAXA 5CRXA 1B0XA 4XQ8A 1V85A 4EBEA 4UB5A 2V4RA 2MA1A 4KLSA
chains in the Genus database with same CATH topology
2E1FA 1IIPA 3DEEA 2KOBA 1CRXA 2G5HB 1PVQA 4CDGA 1UPHA 2K8CB 2ZIXA 4FZNA 2JH7A 3F5EA 5KL1B 3SAGA 2CPRA 2E5SA 2PMZC 2K89A 3IP4B 2JHDA 2K8AA 4AYBC 2ZIXB 4WJ3B 4OJ5A 3D2NA 2H3VA 2W03A 2KNJA 3RFAA 2VJ4A 2G5IB 3F2BA 2KICA 1HEKA 2HOIA 2LKYA 4OJOA 3IG8A 4OJPA 2KVCA 2KEYA 4U6PA 3D2SA 4A8EA 1ED1A 3H0MB 4OJLA 3F2DA 2E1EA 2KHVA 2N1RA 4P0QA 4ACOA 3C28A 2VJ5A 4KX5A 3F2CA 4JMUA 2YX8A 3ALRA 3LYSA 3D2QA 2WB1F 3AQEA 2DGZA 2H3QA 2W04A 3K1ZA 3C29A 2HBJA 4P0PB 5T14A 3HKZF 1ZQ1C 1T94A 2JH1A 2G06A 2ZIVB 5A0LA 1Q3UA 2HOFA 2ZG6A 2HBKA 2KKVA 2KHQA 2K4EA 2MRLA 2Y0SF 2KJ8A 2YB1A 4FZLA 3SMVA 2H3FA 2W7PA 1NZBA 2HOQA 2VKQA 1D8BA 1SZHA 4ICAA 2BDUA 4BJQA 3IN5A 3SQIA 2KJ5A 4OJ6A 2HBMA 3IG5A 3CYMA 1XNSA 3T79A 2Y0SC 5HR7A 3RF9A 2NV3A 2D6FC 4FE3A 3NUQA 3L3FX 1KBUA 4C0ZA 2H3ZA 2Z7JA 2OH2A 5KL8B 1Z1BA 1F44A 4KX3A 2F8LA 3M6KA 4NLBA 3N7RC 4AYBF 3PSFA 2G08A 3HKZC 3KZXA 2G09A 2PMZF 3H0LB 2RHFA 4P0QB 2DF4B 2WB1C 2KJ9A 3M7DA 2G07A 2YB4A 1MA7A 3AL0B 4QNLA 2K4HA 2KIWA 3CRXA 2F77X 4OO1J 2JMGA 2OM6A 3GU3A 3GZFA 4CGZA 2G0AA 2Q4TA 2ZIUA 3H0RB 1DRGA 2DQNB 2GH1A 2OYYA 1L6NA 3PSPA 3E0FA 3ICXA 3LVWA 2VIXA 1HIWA 5C0YA 4BUGA 2ZXHA 2RP5A 3CP8A 4O3MA 2GOLA 3LVVA 4NV0A 3MGVA 2W7OA 1GO3F 2A3VA 4CRXA 3ONNA 1P7DA 2R18A 2ZIWB 4PL2A 3SAHA 3NRWA 2K8BB 2RRDA 3AQFA 1Q3VA 4KMOB 3M6ZA 3N7PD 2LHTA 3O0FA 4IC9A 2CRXA 3PSIA 1PVRA 3VC8A 4PL1A 2HBLA 3F53A 2F76X 3SAFA 3OPXA 4QIWF 4BX9C 2JGAA 2WAQF 4GFJA 2OXOA 2F2AB 4QIWC 1TAMA 2HMXA 2KV2A 2ZIVA 3N7SC 1A0PA 4NLCA 3VCBA 1PVPA 2XICA 1OUQA 1Z19A 2H3IA 2K4IA 3F5AA 1XO0A 1YT3A 1WUDA 2KD1A 2XIDA 2KKPA 2XVTA 2ZIUB 3PZPA 2M0NA 2ZIWA 1URJA 2ZXIA 4NWIA 1ECWA 2CN1A 5CRXA 3KFUF 3PSTA 4P0PA 2LBOA 1A6SA 5HR6A 2LYBA 4U7CA 4FZMA 2WAQC 2MA1A 4QJFB 2XI9A 2LYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1F A;  2HBJ A;  3SAF A;  2HBL A;  2RHF A;  4QIW F;  4CDG A;  3SAG A;  2CPR A;  2KV2 A;  4NLC A;  4OO1 J;  4CGZ A;  2HBK A;  1D8B A;  1YT3 A;  1WUD A;  5C0Y A;  4O3M A;  2HBM A;  1GO3 F;  3CYM A;  2E1E A;  3SAH A;  2RRD A;  2MA1 A;  4QJF B;  2DGZ A;  4NLB A; 
#chains in the Genus database with same CATH topology
 1NZP A;  5L1J A;  2WF9 A;  1PVQ A;  2GWS A;  5ALE A;  1S0V A;  2ZUC A;  3UQ0 A;  3ZDD A;  1L7O A;  1FFU A;  8ICH A;  1BPE A;  2A1J B;  4DSF A;  2W03 A;  3RFA A;  1ZQS A;  4DQQ A;  3IG8 A;  2QB1 A;  3I1Y A;  4DLE A;  2YMM A;  4O3S A;  9ICU A;  8ICJ A;  3D2Q A;  2FDR A;  2P6R A;  9ICT A;  3JPN A;  4B9V A;  1ZQD A;  1JI7 A;  3EZ5 A;  5DBC A;  1HUO A;  2Y0S F;  4NJ8 A;  4YMN A;  1RQN A;  1JAL A;  3SQI A;  2Y0S C;  5ALW A;  2KK0 A;  5IIK A;  4GC6 A;  4RNN A;  2E8M A;  1ZQP A;  2OH2 A;  3M6K A;  1KQQ A;  4JV0 A;  1KLN A;  5CB1 A;  2BZF A;  3C5G A;  2D3D A;  3HT3 A;  4CGZ A;  4B9N A;  2DQN B;  1K1S A;  4RQ5 A;  4C7Y A;  9ICR A;  3ICX A;  2F1I A;  4RNM A;  5AIB A;  3BQ7 A;  3TFR A;  1TAQ A;  5J0S A;  1SB3 C;  3RTV A;  2K8B B;  4Z6E A;  4RQ7 A;  2LYH A;  1RDF A;  3M6Z A;  3FC4 A;  4Y2V A;  2EZX A;  1X9M A;  4BX9 C;  4P4M A;  3A0B U;  1Q46 A;  2JV3 A;  2F8K A;  5K4L A;  1RQL A;  2P6U A;  2VA3 A;  2W9C B;  8ICG A;  3PZP A;  4PHE A;  3OGU A;  2NRX A;  4RPX A;  4Y2T A;  3E2E A;  4UAZ A;  1SIJ A;  9ICX A;  4DFM A;  2IMW P;  2E5S A;  2K89 A;  4CE6 A;  4YFK A;  3RJK A;  2ISO A;  4UBB A;  3OJS A;  1U9L A;  4PZO A;  1T8E A;  1SKR A;  5AKG A;  4YVZ A;  3I28 A;  4DEZ A;  2KN7 A;  1D9D A;  2E1E A;  1S76 D;  4I28 A;  5HMM A;  2BPC A;  5KAI U;  4O5C A;  9ICO A;  4PPX A;  3RJG A;  4IQV A;  2JZB A;  4EZ6 A;  1PUZ A;  5KT3 A;  1JN3 A;  4DL4 A;  2FLP A;  5BOM A;  1MQ2 A;  1ZQM A;  1RYS A;  3H8J A;  1V38 A;  9ICM A;  3SZ2 A;  3RF9 A;  4R66 A;  1Z1B A;  4AYB F;  1T3N A;  4F2S A;  5KT5 A;  1PZN A;  2G07 A;  3M9N B;  4IR9 A;  2P66 A;  5KFZ A;  3GU3 A;  3GZF A;  1ZQT A;  2ASJ A;  3LVW A;  1T4G A;  4YG2 A;  4QZF A;  1NK8 A;  5KFI A;  4DFK A;  3NAS A;  5EWE A;  4ELU A;  5D49 A;  4UAV A;  3PV8 A;  5H2F U;  1PK1 B;  1L7P A;  2AJQ A;  2W43 A;  5KFR A;  4JV1 A;  2E8N A;  3Q8R B;  3Q8M A;  4F5N A;  5AK5 A;  4ECT A;  3UMC A;  3ISC A;  5J0W A;  2BDP A;  4LJX A;  4R8U B;  1K1Q A;  8ICA A;  3HRD D;  4UAW A;  3RB3 A;  5EWG A;  3UPQ A;  4DSJ A;  1X9X A;  2KTQ A;  7ICO A;  3N4M B;  1KSP A;  1KEJ A;  4R8U A;  4PHD A;  3KHR A;  4RQ0 A;  4UB4 A;  1U48 A;  4CF4 A;  3Q8Q B;  7ICS A;  4EYH B;  4O3P A;  5KT2 A;  3FYH A;  1TK0 A;  1JRP A;  4OJO A;  3GII A;  2KEY A;  2ASD A;  2R8H A;  2KFZ A;  5KFA A;  3C29 A;  1WWU A;  2ZUD A;  3RJH A;  1OW5 A;  1VJ5 A;  1XU4 A;  3S6J A;  2ZG6 A;  4FO6 A;  5KG3 A;  4RQN A;  2AGQ A;  4DSL A;  4CCH A;  2Y9U A;  5KFX A;  4QWB A;  2W9B B;  3TAP A;  1SWV A;  3U26 A;  4C0Z A;  2H3Z A;  4PJ0 U;  4FBT A;  3UXO A;  2XC9 A;  5KFO A;  5CEH A;  1S97 A;  4J9R A;  2JMG A;  1IG6 A;  2DUY A;  4MFF A;  3E0F A;  2MU2 A;  1D8L A;  2W7O A;  4YR3 A;  1RYU A;  4O5K A;  3UM9 A;  1Q3V A;  5KT7 A;  4JUZ A;  4EYI B;  3ED5 A;  3LDA A;  2XGP A;  1NJZ A;  2K4P A;  1ZRM A;  2F2A B;  5AI6 A;  3N7S C;  4QZG A;  3B9J A;  1C7Y A;  1UCV A;  2K4I A;  5KT6 A;  3BDP A;  5J0X A;  4DO9 A;  5KG5 A;  3QU9 A;  2ZIU B;  4F4Y A;  4K4I A;  3GIM A;  4F5P A;  3QE9 Y;  3BQT A;  2ZJ5 A;  4NY8 A;  3MDC A;  3G6Y A;  1MC8 A;  4BXO B;  4GXJ A;  3H40 A;  4QJF B;  4O0I A;  3PO5 A;  3SAG A;  4M04 A;  2A1A A;  1ZD2 P;  4UAS A;  4P2H A;  4KLT A;  2H3V A;  9ICI A;  2W3R A;  4F93 B;  1HEK A;  4KLG A;  1L3T A;  4DFJ A;  5J2G A;  4QWA A;  1ED1 A;  1UA1 A;  1NKC A;  1JUD A;  5BPC A;  3C2L A;  4BWJ A;  2H3Q A;  2W04 A;  1RM6 C;  3CW2 C;  5KT4 A;  2QLT A;  1ZQ1 C;  4ED2 A;  1KW4 A;  3GDX A;  5J2J A;  3RBE A;  3JPS A;  3NVY A;  4DF4 A;  4I2C A;  5HHI A;  5J2E A;  3V7L A;  5KFB A;  3MR3 A;  3WKE A;  2C22 A;  4DSK A;  3H4B A;  2OWO A;  3KTQ A;  4RU9 A;  4QW9 A;  5KFM A;  8ICP A;  4KLL A;  4IR1 A;  2W55 A;  3TAC B;  4YCX A;  5FP0 A;  3ZD9 A;  1VLB A;  1B43 A;  1QCK A;  4Y2P A;  3GFK B;  5AKI A;  1COO A;  2ES6 A;  4J9N A;  1JMS A;  2W9M A;  3B0X A;  1GO3 F;  2R18 A;  4YQW A;  2ASL A;  3NRZ A;  4MHV A;  4Q8E A;  1MQ3 A;  5J2A A;  2KZ3 A;  1KDH A;  8ICZ A;  2B21 A;  2WAQ F;  4QIW C;  2KV2 A;  1A0P A;  3HP6 A;  4Y2S A;  2C28 A;  2FPL A;  2H3I A;  1QLN A;  4EEL A;  1XO0 A;  2FMP A;  4I2G A;  4JK1 A;  4DL7 A;  5GTH U;  1URJ A;  2K60 A;  2DL0 A;  5J2F A;  7ICH A;  2ZTE A;  1NKE A;  5ALF A;  3WKD A;  3MDA A;  1ZQU A;  1JXE A;  2AGP A;  2WFA A;  2Y9T A;  5J2H A;  2Y1I A;  3N28 A;  4YMO A;  3ETL A;  4KN4 A;  2R8I A;  4NLG A;  5IIJ A;  2HHQ A;  4C4S A;  2W54 A;  3UXN A;  4JMU A;  3LYS A;  4RUA A;  3MFI A;  4I2H A;  4KN7 A;  1NK7 A;  4RQ2 A;  3HKZ F;  3PX4 A;  3LK9 A;  5KFV A;  1T94 A;  5DGA A;  3WK7 A;  1RYR A;  7ICQ A;  1VDV A;  3QYP A;  3UMG A;  1S9F A;  3EYZ A;  3NVW A;  2BR0 A;  2W8L A;  1X66 A;  7ICT A;  1X40 A;  1FFV A;  3QUC A;  4DL5 A;  2BCU A;  4NLB A;  3FAH A;  2PI4 A;  1SV0 C;  4E0D A;  2G09 A;  3ZDB A;  2YMQ A;  2KIW A;  2BPG A;  4LVS A;  1A6S A;  5AKJ A;  2OYY A;  5KFH A;  1L6N A;  3H8M A;  1WG8 A;  4MEY A;  2QAR A;  2VIX A;  4O3M A;  2PFQ A;  4ED7 A;  3L4P A;  5ALT A;  1ZYQ A;  7ICV A;  5J0P A;  4I2J A;  2YQE A;  1Y88 A;  2D6F C;  3KFU F;  1DGS A;  3SAF A;  3AN1 A;  4Y2R A;  2XIC A;  1Z19 A;  2HHS A;  4F4K A;  3OTQ A;  1C20 A;  2XID A;  4F91 B;  2FMS A;  2F44 A;  4UAT A;  2CN1 A;  2FI1 A;  3PST A;  3QXG A;  2BGW A;  2JXJ A;  2ODG A;  1UT5 A;  4DL2 A;  2XY7 A;  3H4D A;  4RQ8 A;  1NK0 A;  2E8P A;  4BDP A;  1V97 A;  3Q8S B;  4WJ3 B;  3JPT A;  2J6T A;  2EAN A;  1TKD A;  1JXL A;  2KVS A;  2A1J A;  1A77 A;  4HYK A;  3Q8P B;  3HPO A;  2EAM A;  5ALO A;  1BPY A;  3AU2 A;  7ICF A;  3D2S A;  4OJL A;  3F2D A;  2N1R A;  3WU2 U;  3BZC A;  3PML A;  4NLN A;  3RJE A;  3WK8 A;  8ICN A;  1S0O A;  4I2D A;  2ZIV B;  5A0L A;  4ECQ A;  4B9U A;  5KG7 A;  1S8O A;  2HBK A;  2FE9 A;  1NJX A;  3K1R B;  2DFL A;  2MRL A;  1NZB A;  4C8M A;  4ICA A;  9ICK A;  5KAF U;  5F3X B;  5AI4 A;  1X9W A;  4Y2Y A;  1N56 A;  4I27 A;  3T3F A;  1F44 A;  4YXM A;  1ZQE A;  4O3R A;  2BCQ A;  4DOA A;  3H0L B;  4EEK A;  2WB1 C;  2D8C A;  2YB4 A;  5HHH A;  1EXN A;  1HJP A;  8ICO A;  9ICW A;  5AHX A;  3GV7 B;  3AUO A;  5J2C A;  1IM4 A;  1HIW A;  3KZI U;  4BUG A;  4BXO A;  4Z6C A;  1X2I A;  1RXW A;  9ICC A;  2HW3 A;  1AQ6 A;  8ICY A;  4RQ4 A;  3TAQ A;  2W9B A;  1KTQ A;  5J8Y A;  3PW4 A;  4EEN A;  1SL1 A;  5ALR A;  1JX4 A;  5KFT A;  2LM4 A;  2IOF K;  3GV8 B;  3RAQ A;  1JIH A;  2HVH A;  3FDS A;  2LBO A;  5CHG A;  3Q8K A;  4C8N A;  2LYA A;  1RZT A;  3UXP A;  4UQG A;  3DEE A;  5DBB A;  4Z6D A;  3SI8 A;  3PW0 A;  3ZDA A;  3F5E A;  1SGG A;  3QU7 A;  2C2R A;  2IBK A;  9ICE A;  5KFW A;  2VJ4 A;  3F2B A;  1ZRN A;  4O3Q A;  4M9J A;  3K75 D;  3RR7 A;  1N2X A;  1KL9 A;  1IV8 A;  4B6J A;  4G9B A;  1ZQH A;  1TE2 A;  5AM2 A;  5EWF A;  4KLU A;  9ICA A;  2ALZ A;  1NK6 A;  5DB9 A;  5JTI A;  2KMD A;  4R64 A;  5AKY A;  5G5G A;  4TUR A;  3T5J A;  3AMZ A;  4FZL A;  3D6J A;  5J2B A;  3KOO A;  3K4G A;  4CNQ A;  4Q45 A;  1ZJM A;  8ICK A;  1ZQI A;  1BPX A;  3OSP A;  5KG6 A;  2O6K A;  2PMZ F;  4P0Q B;  5L9X A;  2HI0 A;  4I2A A;  2G0A A;  4QZD A;  2YY6 A;  5DDM A;  2ZXH A;  4USA A;  4F92 B;  1A76 A;  4GC7 A;  4ECZ A;  5ALL A;  5JU5 A;  1U47 A;  1TAU A;  3QU5 A;  4KMO B;  3GIL A;  5IIO A;  1KN5 A;  4PGX A;  4QIW F;  5E79 U;  7ICL A;  8ICI A;  1TAM A;  1F0M A;  3RB0 A;  2BQU A;  1KFS A;  2LI6 A;  9ICF A;  2UVW A;  3AU6 A;  1WUD A;  1ZET A;  8ICB A;  5G5H A;  5ALV A;  5DB7 A;  4O3N A;  1XSL A;  2ZIW A;  3MGH A;  5TZV A;  4DFD A;  2WAQ C;  5J0O A;  3WK4 A;  3L5K A;  8ICT A;  2KIV A;  3PX6 A;  4FZN A;  7ICG A;  1BPB A;  2DPI A;  3PW7 A;  3IP4 B;  1ZQA A;  2JHD A;  4NL9 C;  1QQ5 A;  2IOH A;  1OXJ A;  2KIC A;  2ZJA A;  1NNL A;  3WK9 A;  2AQ4 A;  4AP9 A;  4F8R A;  1S5L U;  2KSO A;  5DBA A;  1L7M A;  5DG7 A;  3SEN A;  2WF8 A;  2JH1 A;  3PW5 A;  1DXS A;  2K4E A;  1B4F A;  2VA8 A;  2YN4 A;  8ICX A;  2RDJ A;  2KJ5 A;  1UA0 A;  4EBD A;  9ICL A;  8ICW A;  3UMB A;  5ALQ A;  1ZQV A;  4RT3 A;  3BQ0 A;  8ICV A;  2BCS A;  4TQR A;  2W11 A;  2H5X A;  2F77 X;  2BHN A;  4IL6 U;  1ARO P;  2Q4T A;  5EE0 A;  3V6H A;  2HSZ A;  4ED6 A;  1NJY A;  3QUQ A;  2EAO A;  1B22 A;  3PR5 B;  4CRX A;  1N5W A;  3AQF A;  1TFR A;  2EZZ A;  3QX7 A;  4KMU A;  9ICB A;  2ISP A;  4PL1 A;  3C2K A;  3OPX A;  2JGA A;  4GFJ A;  3A0H U;  4US9 A;  3BZK A;  5F9N A;  2HMX A;  2BCR A;  3BJY A;  4CF5 A;  1SV0 A;  2OCE A;  2NYV A;  2KD1 A;  4ED3 A;  1UT8 A;  8ICE A;  3DDH A;  1CUK A;  4NWI A;  5AM5 A;  4YR2 A;  4MFA A;  3RJJ A;  3PR4 A;  2L5Y A;  3MBY A;  4U6P A;  2E1F A;  4XRH A;  5DB8 A;  2VAN A;  2ZTC A;  2WTF A;  4DQI A;  9ICQ A;  2K8A A;  4UAY A;  1UQV A;  2XCP A;  5ALD A;  3M9M B;  2HHU A;  4FS2 A;  2NRW A;  5KFJ A;  3QUB A;  4ECS A;  4A8E A;  3HW8 A;  2QB0 A;  5AKH A;  1BNO A;  3SD7 A;  2HHX A;  1J2M A;  5L1I A;  5KFU A;  5AKE A;  1X6I A;  4QW8 A;  5HML A;  4O5E A;  1L5U A;  4DQS A;  1L3S A;  2LMR A;  1ZQF A;  1NKB A;  3CNH A;  2OHF A;  3QEA Z;  2KHQ A;  2AH5 A;  5ALS A;  4EX6 A;  5AI9 A;  4Z6F A;  3SMV A;  4FBU A;  2W7P A;  2PI5 A;  1D8B A;  3RB4 A;  4JV2 A;  4PGQ A;  1L7N A;  2BDU A;  2A19 A;  5AKL A;  3BS5 A;  5B66 U;  2ESE A;  2R8J A;  3EW9 A;  5GTI U;  5L1M A;  2W8K A;  4R65 A;  3KKA C;  3V7J A;  5KFG A;  4K4H A;  4EX7 A;  2LPE A;  4QNL A;  4UAR A;  2I9G A;  4ED8 A;  2GH1 A;  5B5E U;  5C0Y A;  5J29 A;  5ALJ A;  4NV0 A;  1N60 A;  4FFD A;  2BQ3 A;  4KLD A;  4DS4 A;  2MUT B;  2CXY A;  4PL2 A;  3SAH A;  1QSY A;  4J03 A;  4IC9 A;  1N63 A;  2EZY A;  3TAR A;  3VC8 A;  1DRG A;  2HBL A;  3F53 A;  4DOB A;  3HIL A;  3SEI A;  3T5L A;  3PY8 A;  1XO1 A;  1PVP A;  4NL9 A;  1HUZ A;  5KFS A;  3JPQ A;  4C8L A;  3MR2 A;  4NLZ A;  1MN8 A;  1ZQX A;  5BOL A;  1N62 A;  2MUT A;  5AI5 A;  4QZH A;  2HHV A;  3G6V A;  4DSE A;  2W9A A;  2V9W A;  1WWV A;  1CRX A;  2K8C B;  2CPR A;  2ZTD A;  3IM1 A;  4YP3 A;  4AYB C;  4F72 A;  1SKS A;  1PK1 A;  1JRO A;  4EBC A;  2ZIX B;  4KTQ A;  3V7K A;  4Y2U A;  4F2R A;  4MF2 A;  5AM4 A;  3TAN A;  1D8Y A;  1ZQC A;  4Y2J A;  2PKE A;  2I5H A;  4JWN A;  1TVA A;  1YZ6 A;  5DG8 A;  5AM0 A;  4KX5 A;  4DCC A;  4IS7 A;  1M6Y A;  4IRD A;  4UB8 U;  4YXJ A;  8ICU A;  2VA2 A;  2HOF A;  3OHA A;  2QAR B;  5AIA A;  1L8L A;  2NRZ A;  1UHU A;  1ZJN A;  1ZQW A;  3MGI A;  3ZDE A;  2VKQ A;  3EUB 2;  3RJF A;  2KSO B;  4GIB A;  2QKQ A;  2UVU A;  4KLI A;  2LM1 A;  1RPL A;  4FE3 A;  4M9L A;  4RPY A;  2Z7J A;  4ECW A;  2F1J A;  1T3Q A;  2RHF A;  1SL0 A;  4J9K A;  3JPR A;  4JB3 A;  2K4H A;  4OO1 J;  4KLO A;  3Q8L A;  4P4O A;  9ICH A;  4ECU A;  4DOC A;  2ATL A;  5KTQ A;  4DF8 A;  1ZQR A;  3CP8 A;  3LVV A;  4ELV A;  2ZIW B;  4LZG A;  5KFK A;  5J2I A;  4F5O A;  1TK5 A;  3R9K A;  2MSN A;  5ALU A;  4TUS A;  2M9N A;  3QU2 A;  4KLH A;  1Z4O A;  3VCB A;  3RJI A;  5JRT A;  3TAD A;  3F5A A;  1X9S A;  5L1K A;  1ZQK A;  4RQM A;  2QB0 B;  2XGQ A;  2M0N A;  1ECW A;  3C1Y A;  4ECX A;  4IQU A;  5HR6 A;  4F3O A;  3ZI4 A;  2EH9 A;  2C2D A;  1X42 A;  3H8W A;  1BPZ A;  5ALX A;  1ZQB A;  2HVI A;  5IIM A;  2R8G A;  3H8S A;  1ZQG A;  3G6X A;  1N5X A;  2HOI A;  3H0M B;  1U49 A;  4TUP A;  3ISD A;  2YX8 A;  5J0Y A;  5DLG A;  2HBJ A;  4UB6 U;  5T14 A;  4J9O A;  3H7I A;  1ZOL A;  1QTM A;  1Z4N A;  9ICJ A;  1COK A;  1DGJ A;  7ICR A;  2GO7 A;  2FPM A;  3QU4 A;  5ALN A;  1TV9 A;  4O3O A;  4QZB A;  3MC1 A;  4BJQ A;  3C2M A;  4TUQ A;  3IG5 A;  3OJU A;  2XY6 A;  2HHW A;  3T79 A;  4PZN A;  5HR7 A;  5AM3 A;  3TAD C;  4IRC A;  3PNC A;  4UW9 A;  4F5Q A;  3KZX A;  2B6G A;  2MAX A;  2J6S A;  7ICM A;  5KG1 A;  8ICF A;  2HCF A;  4RQ3 A;  3C1Z A;  2GLE A;  5JUM A;  4NLK A;  1BPD A;  3PO4 A;  3SR6 A;  4B9L A;  3QZ7 A;  3IDW A;  1PVR A;  1V9P A;  1P7D A;  2OXO A;  3LWL A;  4RQ6 A;  4DQP A;  3NTU A;  5J2D A;  3EWA A;  3PVX A;  4PH5 A;  5CA7 A;  1U45 A;  4B9M A;  1LVH A;  2BPF A;  2WF5 A;  3RB6 A;  3NGD A;  3TI0 A;  3M1Y A;  4I2F A;  5CR0 A;  4I2E A;  2XI9 A;  1BGX T;  3AM9 A;  4DFP A;  5KL1 B;  4FS1 A;  2XCA A;  5AK4 A;  3T5H A;  5D46 A;  3JPP A;  3N97 B;  3PMN A;  5AKK A;  3OSN A;  5DGB A;  3M8R A;  2KNJ A;  5III A;  2KVC A;  5ALK A;  2WF7 A;  2XO7 A;  5IIN A;  4J9S A;  3RR8 A;  2E3T A;  2WB1 F;  5J8Y C;  8ICC A;  2WHE A;  4DLG A;  4K4G A;  3IV6 A;  2ZJ8 A;  1SZP A;  4KLM A;  3OHB A;  1NK9 A;  3J81 j;  5AKZ A;  1ZQY A;  8ICL A;  3RBD A;  1ZXI A;  2PFO A;  4ZOH C;  1D9F A;  4TQS A;  3TQ1 A;  4KX3 A;  2FLL A;  3N7R C;  5KG4 A;  3THV A;  2NO4 A;  5L1L A;  4XA5 A;  5KFN A;  1CI4 A;  2F3N A;  3RRH A;  2AHO B;  4KIT B;  2GOL A;  3ONN A;  1Z00 A;  4KLJ A;  4ELT A;  3RH6 A;  3N7P D;  5J0U A;  3O0F A;  8ICR A;  2IOF A;  4F5R A;  4F71 A;  9ICG A;  3HX0 A;  1J2N A;  4Y2X A;  4NM1 A;  4KLF A;  2YMP A;  4M9G A;  3ZDC A;  2JZB B;  2LYB A;  5KFP A;  4U7C A;  4FZM A;  4RQ1 A;  2YTU A;  4YD1 A;  1IIP A;  2KOB A;  2C2E A;  4CDG A;  2NO5 A;  5KFQ A;  1XSP A;  4M6W A;  3D2N A;  2RQ5 A;  4UB1 A;  4UBC A;  4F4Z A;  1FEZ A;  9ICP A;  1ZQZ A;  2LKY A;  2UVV A;  2KHV A;  5ALG A;  4J9M A;  2HHT A;  4ACO A;  5EOZ A;  1ZQO A;  4DSI A;  7ICE A;  3K1Z A;  1ZQN A;  2EQY A;  5ALY A;  1PK3 A;  1DK3 A;  9ICS A;  2IA6 A;  3BQ1 A;  4QZI A;  3MR5 A;  1LKY A;  2HOQ A;  1SZH A;  4G3I A;  1WCL A;  1ZD4 A;  2IHM A;  4OJ6 A;  3DV9 A;  4US8 A;  1XNS A;  9ICV A;  2NV3 A;  4I2B A;  4IQW A;  1KBU A;  4EEY A;  1QSL A;  4C8O A;  3HKZ C;  4YD2 A;  2JEI A;  4RNO A;  4MF8 A;  1MA7 A;  2DKX A;  5KFD A;  1N61 A;  1KFT A;  3WKA A;  1ZD5 A;  3H0R B;  3KHH A;  1F5S A;  4QZ9 A;  4YMM A;  1BVS A;  3KD3 A;  1N48 A;  2A3V A;  1DK2 A;  3GIK A;  3RRG A;  4GXI A;  3C23 A;  4B9S A;  2LHT A;  5AI0 A;  2CRX A;  5KFC A;  1QSS A;  4RZR A;  3ZD8 A;  4Y2Q A;  4BGD A;  2ZIV A;  3PX0 A;  4C4R A;  4O9M A;  3V6K A;  1Q8K A;  5J0R A;  3B0Y A;  2EDU A;  5F9L A;  4RPZ A;  4QZC A;  3NVZ A;  1ZQJ A;  3NS1 A;  3AEV A;  3QNM A;  3T5K A;  1ZD3 A;  4MFC A;  5ALZ A;  1UPH A;  3WK5 A;  5AIC A;  4RT2 A;  1KFD A;  1SWW A;  3HJE A;  2JEG A;  4R63 A;  4M9H A;  4QZ8 A;  2AGO A;  4F50 A;  5HP4 A;  2DKZ A;  2PXI A;  5KG0 A;  1H38 A;  5IIL A;  3E58 A;  2E8O A;  5AK6 A;  3ISB A;  4DQR A;  4P4P A;  2RDI A;  4ECR A;  2DWQ A;  5ALH A;  5DG9 A;  2FMQ A;  2KKV A;  5D4B A;  4IRK A;  1NI3 A;  3V6J A;  1K5O A;  4BWM A;  2HBM A;  1YZ7 A;  1XC9 A;  3NUQ A;  3M8S A;  4UB2 A;  4UB3 A;  1KRP A;  5KL8 B;  5AM1 A;  2OEH A;  4F4X A;  1S10 A;  2KJ9 A;  3M7D A;  1U4B A;  3BS5 B;  3CRX A;  8ICS A;  2OM6 A;  4YR0 A;  2KZM A;  2PFN A;  4EZ9 A;  3BQ2 A;  3BS7 A;  5DQG A;  4QWE A;  7ICP A;  1O08 A;  4ED0 A;  4IQT A;  1SV4 A;  4KLE A;  4C4T A;  3MGV A;  5DDY A;  3SV4 A;  1L8O A;  2BCV A;  1XSN A;  3V72 A;  4OCZ A;  2KZZ A;  2DPJ A;  2AXT U;  1SKW A;  4UAU A;  4NLC A;  1OUQ A;  1SXD A;  3UQ2 A;  7ICI A;  3HWT A;  5EE1 A;  4ED1 A;  3FM9 A;  1T7P A;  4HAI A;  1LB2 B;  4YN4 A;  2KKP A;  1SXE A;  2XVT A;  2FJ6 A;  5KFY A;  3GV5 B;  5KFF A;  3IHQ B;  5EE9 A;  5J0T A;  1J97 A;  2JEJ A;  5AK3 A;  3QUT A;  2G5H B;  5ALP A;  2JH7 A;  2J6U A;  3EPI A;  7ICU A;  2PMZ C;  2KE7 A;  4QWC A;  4I2I A;  4M0A A;  2B0C A;  3SV3 A;  5DQI A;  3ORY A;  4OJ5 A;  2G5I B;  4J9L A;  5ALM A;  2NRT A;  3NVV A;  3M9O B;  7ICJ A;  4P0Q A;  3C28 A;  2VJ5 A;  1DOQ A;  3AQE A;  4Q43 A;  2DGZ A;  2I1Q A;  4P0P B;  5KNI A;  4GLX A;  3WKB A;  3MFH A;  2G06 A;  3GQC A;  5HNK A;  2NRV A;  2AU0 A;  2H3F A;  2RLT A;  3KHL A;  1LV5 A;  3WK6 A;  4PGY A;  4DWI A;  2KP7 A;  3IN5 A;  3CYM A;  4QZE A;  4F4W A;  8ICQ A;  4OD0 A;  3L3F X;  4NM2 A;  2UVR A;  2Q0Z X;  2XY5 A;  4C80 A;  2JR5 A;  2F8L A;  1Z3E B;  1NJW A;  5DLF A;  1CEZ A;  5DB6 A;  4QWD A;  3RH4 A;  1ZQL A;  4C7Z A;  4ZH4 A;  3PSP A;  2W3S A;  1SL2 A;  4PHP A;  1S0M A;  2YML A;  1S77 D;  2RRD A;  3TKA A;  3KHG A;  2BQR A;  3PSI A;  2F76 X;  4LZD A;  1QH9 A;  7ICK A;  1S0N A;  1WCN A;  4Q8F A;  4NXZ A;  3RH5 A;  4ECV A;  1WYG A;  3EPG A;  4M47 A;  1XWL A;  4JWM A;  4QZA A;  1NK5 A;  4P0P A;  4J9Q A;  5C5J A;  7ICN A;  4B9T A;  2EAP A;  2F1H A;  1NK4 A;  1RXV A;  2ZIX A;  2ZUB A;  1L3V A;  3I76 A;  5TIS U;  4DL3 A;  5J0Q A;  3C21 A;  4I29 A;  4XUS A;  2BKE A;  3IRU A;  3TFS A;  2AQ0 A;  4RUC A;  4OJP A;  5ALI A;  3QEB Z;  1TK8 A;  5CP2 A;  4M9N A;  3F2C A;  3ALR A;  4GXK A;  2KFN A;  5KFE A;  2FPK A;  1IXR A;  4ECY A;  2IHN A;  5J2K A;  5KG2 A;  1QQ7 A;  1KKX A;  1Q3U A;  1NOM A;  4MEX A;  4DS5 A;  5CJ7 A;  5KFL A;  2YB1 A;  2KJ8 A;  2HDO A;  3WKC A;  1XS9 D;  2WF6 A;  3ETR A;  1QQ6 A;  5CWR A;  3JPO A;  1Z1V A;  2V4Q A;  4DL6 A;  9ICN A;  4M2Y A;  2Y1J A;  1FO4 A;  2DBY A;  4J9P A;  3C5F A;  8ICM A;  3PSF A;  2G08 A;  2FLN A;  2DF4 B;  2JRZ A;  5AI8 A;  1Z00 B;  2ZIU A;  4M6W B;  5EE3 A;  2R8K A;  1LKY B;  3PW2 A;  2RP5 A;  3KBB A;  4CF3 A;  1L3U A;  3MAB A;  1RG6 A;  2I6X A;  3NRW A;  3GIJ A;  5DKW A;  2W9C A;  1BNP A;  1ZQQ A;  1FIQ A;  4Q44 A;  5AKX A;  3MR6 A;  1MSW D;  3AL0 B;  2KG5 A;  2P35 A;  4KLQ A;  2PFP A;  4C8K A;  4X5V A;  5DQH A;  3LWM A;  1YT3 A;  3SYZ A;  3KKA A;  4PHA A;  2JEF A;  1X6J A;  3QZ8 A;  2ZXI A;  1O03 A;  3RAX A;  5CRX A;  1B0X A;  4XQ8 A;  1V85 A;  4EBE A;  4UB5 A;  2V4R A;  2MA1 A;  4KLS A; 
#chains in the Genus database with same CATH homology
 2E1F A;  1IIP A;  3DEE A;  2KOB A;  1CRX A;  2G5H B;  1PVQ A;  4CDG A;  1UPH A;  2K8C B;  2ZIX A;  4FZN A;  2JH7 A;  3F5E A;  5KL1 B;  3SAG A;  2CPR A;  2E5S A;  2PMZ C;  2K89 A;  3IP4 B;  2JHD A;  2K8A A;  4AYB C;  2ZIX B;  4WJ3 B;  4OJ5 A;  3D2N A;  2H3V A;  2W03 A;  2KNJ A;  3RFA A;  2VJ4 A;  2G5I B;  3F2B A;  2KIC A;  1HEK A;  2HOI A;  2LKY A;  4OJO A;  3IG8 A;  4OJP A;  2KVC A;  2KEY A;  4U6P A;  3D2S A;  4A8E A;  1ED1 A;  3H0M B;  4OJL A;  3F2D A;  2E1E A;  2KHV A;  2N1R A;  4P0Q A;  4ACO A;  3C28 A;  2VJ5 A;  4KX5 A;  3F2C A;  4JMU A;  2YX8 A;  3ALR A;  3LYS A;  3D2Q A;  2WB1 F;  3AQE A;  2DGZ A;  2H3Q A;  2W04 A;  3K1Z A;  3C29 A;  2HBJ A;  4P0P B;  5T14 A;  3HKZ F;  1ZQ1 C;  1T94 A;  2JH1 A;  2G06 A;  2ZIV B;  5A0L A;  1Q3U A;  2HOF A;  2ZG6 A;  2HBK A;  2KKV A;  2KHQ A;  2K4E A;  2MRL A;  2Y0S F;  2KJ8 A;  2YB1 A;  4FZL A;  3SMV A;  2H3F A;  2W7P A;  1NZB A;  2HOQ A;  2VKQ A;  1D8B A;  1SZH A;  4ICA A;  2BDU A;  4BJQ A;  3IN5 A;  3SQI A;  2KJ5 A;  4OJ6 A;  2HBM A;  3IG5 A;  3CYM A;  1XNS A;  3T79 A;  2Y0S C;  5HR7 A;  3RF9 A;  2NV3 A;  2D6F C;  4FE3 A;  3NUQ A;  3L3F X;  1KBU A;  4C0Z A;  2H3Z A;  2Z7J A;  2OH2 A;  5KL8 B;  1Z1B A;  1F44 A;  4KX3 A;  2F8L A;  3M6K A;  4NLB A;  3N7R C;  4AYB F;  3PSF A;  2G08 A;  3HKZ C;  3KZX A;  2G09 A;  2PMZ F;  3H0L B;  2RHF A;  4P0Q B;  2DF4 B;  2WB1 C;  2KJ9 A;  3M7D A;  2G07 A;  2YB4 A;  1MA7 A;  3AL0 B;  4QNL A;  2K4H A;  2KIW A;  3CRX A;  2F77 X;  4OO1 J;  2JMG A;  2OM6 A;  3GU3 A;  3GZF A;  4CGZ A;  2G0A A;  2Q4T A;  2ZIU A;  3H0R B;  1DRG A;  2DQN B;  2GH1 A;  2OYY A;  1L6N A;  3PSP A;  3E0F A;  3ICX A;  3LVW A;  2VIX A;  1HIW A;  5C0Y A;  4BUG A;  2ZXH A;  2RP5 A;  3CP8 A;  4O3M A;  2GOL A;  3LVV A;  4NV0 A;  3MGV A;  2W7O A;  1GO3 F;  2A3V A;  4CRX A;  3ONN A;  1P7D A;  2R18 A;  2ZIW B;  4PL2 A;  3SAH A;  3NRW A;  2K8B B;  2RRD A;  3AQF A;  1Q3V A;  4KMO B;  3M6Z A;  3N7P D;  2LHT A;  3O0F A;  4IC9 A;  2CRX A;  3PSI A;  1PVR A;  3VC8 A;  4PL1 A;  2HBL A;  3F53 A;  2F76 X;  3SAF A;  3OPX A;  4QIW F;  4BX9 C;  2JGA A;  2WAQ F;  4GFJ A;  2OXO A;  2F2A B;  4QIW C;  1TAM A;  2HMX A;  2KV2 A;  2ZIV A;  3N7S C;  1A0P A;  4NLC A;  3VCB A;  1PVP A;  2XIC A;  1OUQ A;  1Z19 A;  2H3I A;  2K4I A;  3F5A A;  1XO0 A;  1YT3 A;  1WUD A;  2KD1 A;  2XID A;  2KKP A;  2XVT A;  2ZIU B;  3PZP A;  2M0N A;  2ZIW A;  1URJ A;  2ZXI A;  4NWI A;  1ECW A;  2CN1 A;  5CRX A;  3KFU F;  3PST A;  4P0P A;  2LBO A;  1A6S A;  5HR6 A;  2LYB A;  4U7C A;  4FZM A;  2WAQ C;  2MA1 A;  4QJF B;  2XI9 A;  2LYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...