2RRDA

Structure of hrdc domain from human bloom syndrome protein, blm
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
GIPEFKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HRDC domain from Bloom syndrome protein
publication title Solution structure of the HRDC domain of human Bloom syndrome protein BLM
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 101
sequence length 101
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rrdA00
4OO1J 2HBMA 2DGZA 4CGZA 2HBJA 5C0YA 2HBKA 4QJFB 2CPRA 2KV2A 2RRDA 4O3MA 4QIWF 2E1FA 4NLBA 2RHFA 3SAGA 1GO3F 1D8BA 4CDGA 2HBLA 3SAHA 3SAFA 1WUDA 1YT3A 2E1EA 2MA1A 4NLCA 3CYMA
chains in the Genus database with same CATH superfamily
4C0ZA 3OHBA 2OHFA 2M9NA 4PJ0U 3M8SA 1ZQUA 3KHRA 3BS5A 3EWAA 1XO0A 4YMMA 4DF4A 5ALPA 5EOZA 2BDUA 4DQPA 2ZG6A 3TI0A 2BPCA 2KZ3A 5F9NA 1KKXA 2KTQA 2BPFA 2D3DA 1QTMA 1RXVA 1X9SA 4I2JA 4Y2QA 4P0PB 3GV8B 5EE0A 3C21A 4F5OA 4DSLA 4DQQA 4F50A 1TK0A 3A0HU 2G09A 1A76A 1JALA 4QWEA 2HHWA 3F5EA 3BDPA 2VANA 4DOBA 4TQRA 2YN4A 2Z7JA 3ZI4A 5CWRA 2E8NA 5G5HA 2JEIA 3FM9A 4O3PA 2EZYA 9ICLA 4GXIA 4ACOA 4F5QA 3EYZA 5AM5A 5AKJA 2F1HA 3BQ2A 1ZQVA 1DK3A 4Y2UA 3QYPA 2RP5A 1HIWA 1S8OA 1DRGA 5IILA 4O5EA 4QZ8A 4U6PA 1CI4A 2BR0A 2W9CA 1Q3VA 1ZQGA 4GXJA 2HHUA 2KFNA 3LVWA 4F91B 1NKCA 3PW7A 1ZQNA 2A19A 4NLBA 4EYIB 4QWCA 1PZNA 5L1JA 3V7JA 7ICRA 4Y2JA 5AI0A 1VDVA 2PMZF 3ISBA 1YT3A 3UM9A 4J9RA 5ALIA 2IHMA 1A0PA 3PSFA 3Q8KA 1QSYA 2RDIA 2F77X 2VA2A 3Q8MA 3QUCA 2RRDA 3SYZA 2H3ZA 5HHHA 5DGAA 2ISPA 2C2EA 2ZIXA 3OHAA 3RB0A 4R8UA 3T5LA 4C8LA 4TURA 2E8MA 1F0MA 1JI7A 1QCKA 4NM2A 4TQSA 4B6JA 2IMWP 4OCZA 2JV3A 2G5IB 3LDAA 4P0QB 1UT8A 4RZRA 4PGQA 3HT3A 5DQHA 1KTQA 1JROA 1NI3A 2KHVA 5AI9A 4J9PA 4I2FA 2FMSA 5ALDA 2LM4A 1J2MA 4PL1A 2HOIA 1U4BA 3MFIA 2NRVA 2DFLA 3GIKA 1JXEA 2HBKA 4Y2YA 2YQEA 1UCVA 3M9NB 2K89A 4PGXA 4RNOA 5AIBA 2R8HA 1NK5A 1JMSA 3L5KA 1X9WA 2PFPA 2Y9TA 5IIJA 1BNOA 3T3FA 1HUZA 3LVVA 2FLNA 4DSEA 1Q46A 1COKA 2ALZA 5JRTA 2EANA 2WFAA 4NV0A 5ALVA 4JV0A 2B0CA 1X6JA 4KLHA 1XSLA 8ICPA 4QZIA 9ICOA 1XSNA 4ED0A 2GWSA 3PNCA 1FO4A 2J6SA 4JV2A 4B9MA 3QU2A 3WKBA 2HHXA 3NVYA 1B43A 4O3RA 8ICBA 3F53A 2AQ4A 2KNJA 2ES6A 2WTFA 2VIXA 2ZTDA 5J29A 5J2HA 7ICVA 5ALOA 4DS4A 3TFRA 1NK8A 3IHQB 4QZEA 5AKYA 3MR5A 7ICMA 2RDJA 3H8SA 4M6WB 3C5GA 4X5VA 4MEYA 4C8OA 4OJOA 4O3NA 4QW9A 5BPCA 1KRPA 1Z19A 5ALSA 4KLLA 1ZQHA 2R8GA 2QARA 3K75D 1LB2B 1ZQEA 2KZZA 4DQIA 3NVWA 5J2EA 3MR3A 4MFFA 4EZ6A 2B21A 5AIAA 1Q8KA 5D49A 5J2IA 2FJ6A 1HEKA 2Y9UA 4JWMA 3PMNA 1JUDA 1ZQKA 2JXJA 4J9SA 3SV3A 4B9SA 5AM1A 2OWOA 5AHXA 1J2NA 4YG2A 3QUBA 4FO6A 1SKWA 2K4IA 1SL0A 9ICVA 4O3OA 2YB4A 4QZHA 4I2AA 1ZYQA 3ZDAA 4NXZA 1UPHA 4M9NA 5KT7A 4K4IA 3I1YA 1SV4A 3ISDA 2WAQC 7ICGA 4YN4A 2IHNA 1DK2A 2O6KA 4KLFA 3MDAA 1ZJNA 5DLGA 2K4EA 2AHOB 5KL1B 2ASDA 2YMLA 2KHQA 1D8LA 3NVZA 5KG6A 9ICWA 9ICAA 2HBMA 1Q3UA 3B0XA 5DLFA 2ZJ5A 4KLIA 5J0PA 4P4OA 5KT5A 1PVPA 2H5XA 1ZQTA 3SAGA 3C2KA 5ALQA 4QZ9A 4RT2A 4IRKA 2W04A 9ICQA 4KLUA 4YXMA 3OJSA 4B9VA 4IC9A 3M9OB 3QU5A 4QWDA 4NLZA 4M9GA 1JX4A 3QU9A 4DFKA 4EX6A 1XNSA 3MABA 1VLBA 4DF8A 4QWBA 2KVSA 3NTUA 5IIMA 2IOFK 1X42A 1U47A 4J9LA 3HKZF 7ICQA 2G07A 2H3QA 3PSTA 2XCPA 1M6YA 4CGZA 1U49A 4XUSA 3D2QA 5CHGA 4P0PA 2JZBB 5ALLA 2NV3A 1L7OA 5KFEA 2RHFA 4F2RA 5ALRA 2HVHA 4UB2A 1NOMA 1N56A 2BCSA 3V6HA 4ECUA 2UVVA 3EPGA 3N97B 4AYBC 2V9WA 3SI8A 3GU3A 2AJQA 4QZFA 2HVIA 3KZXA 8ICKA 4FS1A 4NM1A 1ZD5A 4ED1A 1T8EA 4FZLA 3SENA 4F71A 3JPTA 1TAMA 5AKGA 4Y2SA 2KMDA 3RH4A 2AU0A 1UT5A 1SKRA 2E1EA 1ZQXA 4Z6DA 2UVWA 5DGBA 4A8EA 3KHLA 2LYAA 1Z3EB 3IN5A 3HRDD 4BGDA 3S6JA 3CP8A 1TVAA 4J9NA 5KFPA 3K1RB 4USAA 3EZ5A 2Y1JA 3ZD9A 2Y0SC 1ZQ1C 8ICXA 2VA3A 3OSNA 3GDXA 2DL0A 1ZETA 4UB8U 3M7DA 2BHNA 4I2IA 3ETRA 3RBEA 1H38A 1S5LU 5ALTA 3A0BU 4RQ3A 3M6ZA 1C20A 5BOMA 1EXNA 3JPRA 4B9NA 3M9MB 2KKVA 1NJZA 4DEZA 5KG3A 5DG8A 3IDWA 4I27A 2YX8A 3Q8SB 4P0QA 2CPRA 3CRXA 5KFAA 2JMGA 2E1FA 1QQ6A 2NO5A 2KP7A 1D8BA 4Z6EA 1ECWA 7ICNA 4YR0A 2KOBA 1WYGA 5TISU 2AGQA 3C2MA 5KFMA 1N48A 9ICIA 3TKAA 1X66A 1LKYB 3WK4A 3CW2C 4O3QA 3QZ7A 2W7OA 3QNMA 4P4PA 3PW0A 3WU2U 3JPOA 1BPBA 4GC7A 1S97A 2DQNB 4BXOB 1T7PA 5IIKA 5KFBA 3TADA 2K60A 2KD1A 1NKBA 4IRCA 3PW5A 2W54A 3QZ8A 5ALEA 3PMLA 8ICOA 4RT3A 3THVA 9ICJA 5DG9A 2BCVA 1RM6C 4RPYA 2H3IA 3DDHA 3EUB2 3BQ0A 2F1JA 5AI5A 7ICOA 5KFFA 8ICUA 4LZDA 3PV8A 3ZDBA 3FDSA 5KG0A 9ICRA 5J8YA 2DPIA 1LVHA 4IQTA 3V7LA 1F44A 5KFUA 2GOLA 4PPXA 5DQGA 3V6KA 5J2AA 3MGIA 5CR0A 2LKYA 4M9JA 3MBYA 4F5NA 9ICHA 4J9KA 3H4DA 3SEIA 3SAHA 1QQ7A 1ED1A 4IQWA 4FS2A 5AKXA 3R9KA 4KLJA 4M6WA 4R65A 4XRHA 1U48A 3H7IA 9ICPA 3G6VA 4NWIA 3UMBA 5KFIA 1V9PA 2QB1A 3GV5B 1ZQWA 3PW2A 1FFVA 1UHUA 1ZQYA 1ZQMA 2IOFA 4F4KA 4TUPA 4Q43A 4PGYA 9ICMA 2MAXA 5EWEA 1T94A 4O0IA 2ZXHA 2KG5A 3BQ7A 1V97A 2WAQF 4DQRA 5EE1A 4I2EA 4EBDA 4ZH4A 1ZQZA 4HYKA 2QB0B 5AK5A 4ZOHC 4F92B 5ALNA 4EEKA 2OYYA 5J2DA 2HSZA 1KL9A 3AUOA 3RH6A 3UPQA 3RJFA 1SWWA 7ICFA 4Q44A 1SL2A 2HHSA 1TAQA 2WB1C 4GLXA 5AKEA 5KFZA 1TAUA 3DV9A 2I5HA 1JXLA 1FIQA 1PUZA 2V4RA 4CE6A 4Y2XA 1CRXA 4RQ1A 2LYHA 3OSPA 3E2EA 3KKAA 1N60A 4RQ4A 4PHEA 4PL2A 1ZOLA 1YZ7A 2MU2A 3T5HA 3M8RA 2HOFA 4IL6U 4CDGA 1ZQOA 5DB8A 4JUZA 1SKSA 1SB3C 2FDRA 4BDPA 1SXEA 3QUTA 4UBBA 2XCAA 4EEYA 3BJYA 3H8JA 2NRZA 4JV1A 4US8A 3BS7A 1L7MA 4QW8A 2JEFA 2XO7A 5DB7A 5J0TA 4DS5A 4CNQA 2PFOA 1BGXT 3N28A 3HILA 4QZDA 1UQVA 2ODGA 4BUGA 1X9XA 5KFLA 3QUQA 3IG5A 5HNKA 3WK7A 2W8LA 5KG1A 4C8NA 4DL2A 2H3FA 4QIWC 2FLPA 9ICGA 2FI1A 3IV6A 3NUQA 2Y1IA 1MSWD 5KFSA 4AYBF 3QX7A 5KFHA 5HP4A 5DB9A 3HJEA 1JRPA 3VCBA 2JZBA 3GILA 4I2DA 4J03A 3UXPA 4KLSA 1NK6A 4UAVA 4Z6FA 5DQIA 4UB6U 3VC8A 1K1SA 4R64A 5J0WA 4OO1J 5T14A 4UAZA 1SIJA 4RNMA 2YMQA 2PKEA 4ECTA 1L7NA 2HHTA 4AP9A 2Q4TA 3HP6A 3MGHA 5BOLA 3D2SA 2JR5A 3ETLA 2NRTA 2OXOA 5J2KA 8ICTA 3KZIU 4DOCA 1D9DA 1SWVA 4Y2PA 4UAYA 1S0MA 1WWUA 5KNIA 1IM4A 5AI6A 3RJEA 5HHIA 3TARA 2R8JA 4M47A 1PK1B 3ZDCA 3HPOA 4KX5A 1WCLA 1L8LA 3CYMA 2KJ9A 5FP0A 5CEHA 2BDPA 2ESEA 2FE9A 5EE3A 2W3SA 2EZZA 5ALXA 3TFSA 3OGUA 5AKHA 2KVCA 1Z4OA 2VA8A 8ICFA 5L1MA 5ALKA 2W8KA 1B22A 4RU9A 3SR6A 5B66U 1OXJA 1TV9A 2BCQA 4DSIA 3N7SC 2F44A 3KFUF 4ELTA 2UVRA 3RJIA 4F4ZA 4RUAA 8ICAA 2FMPA 5AKLA 2YMMA 3PO4A 1HJPA 4KLDA 3I28A 4NJ8A 1O03A 5GTHU 3LWMA 7ICTA 2EH9A 1QLNA 3QEBZ 2E8OA 4J9QA 8ICMA 1J97A 4M9LA 3SAFA 7ICHA 5KT2A 4Q8FA 1D9FA 4YR3A 2HOQA 2EAOA 1SV0A 1X40A 3OJUA 4MFCA 4FZMA 2ZIUB 2CN1A 2RQ5A 5CA7A 1B4FA 1RYUA 7ICPA 2K8AA 3Q8QB 1RG6A 1A77A 1LKYA 5K4LA 4DLGA 2LPEA 5JTIA 3C28A 4KLGA 4EENA 4BXOA 1V38A 2ZIVB 3BZCA 2DPJA 1C7YA 3H8WA 3AU2A 5D46A 2BPGA 4O9MA 4C4SA 4ELUA 5AKKA 1NJXA 4WJ3B 2XY6A 4NLGA 2G06A 3J81j 8ICVA 2KIVA 5ALHA 1T3QA 5KT6A 2XGQA 2QLTA 3NRZA 1BPXA 2XVTA 1JIHA 4RPXA 3QEAZ 2NO4A 3ORYA 1SZPA 2OM6A 4I2GA 1HUOA 2ZIXB 3RFAA 1TKDA 5J2FA 5ALFA 1JN3A 1COOA 4ECYA 2HW3A 3IG8A 4F3OA 2F1IA 1MQ2A 4QNLA 1IV8A 2J6UA 4UB5A 4ED8A 1LV5A 1KFSA 3PR5B 4Y2RA 2W9AA 5L1LA 5KFWA 1OUQA 1DGJA 3AMZA 3LYSA 5J0UA 3RB3A 4JB3A 4NY8A 5J2GA 3TQ1A 5KTQA 3V6JA 5HMMA 1L3SA 4KN4A 2UVUA 1XWLA 5J8YC 5HMLA 1FFUA 1CUKA 4UW9A 4UARA 3C1ZA 3V72A 9ICSA 2I6XA 2GO7A 3WK6A 2GH1A 1P7DA 2BCUA 4KLMA 2LHTA 4FBUA 1S0VA 4U7CA 4B9UA 4C80A 2F3NA 1S9FA 4LVSA 2ZIWB 4RQMA 3PZPA 3BZKA 4ED2A 2ZJAA 2WB1F 4RQ6A 2OCEA 2BQRA 9ICBA 2JEGA 4FE3A 1KW4A 4RQ8A 4YQWA 2Q0ZX 3OTQA 2ASLA 2QB0A 4PZOA 1X2IA 2E8PA 2WF7A 7ICSA 4GFJA 4ECRA 5L1IA 1S0NA 1RYSA 1ZD3A 2P6UA 1DXSA 4UBCA 1QQ5A 4PHDA 4QZGA 1XU4A 3HX0A 2XY7A 2FLLA 2R18A 8ICLA 9ICFA 3MC1A 4C8MA 3JPPA 2V4QA 4KMUA 2C28A 4MHVA 2KEYA 3WKEA 4DL4A 2LMRA 4RNNA 4OJLA 4ED3A 3KTQA 3C5FA 4B9LA 4DL3A 4ECXA 1UA0A 2C2DA 1XO1A 2R8IA 8ICZA 5DB6A 2VKQA 4YD2A 2C22A 1X9MA 1AROP 3SD7A 1PVRA 3AN1A 7ICUA 8ICQA 5AM0A 2HDOA 4Q8EA 3TACB 2W43A 2W9BB 4I2BA 4DO9A 2WHEA 5J2CA 2CXYA 3PX0A 4IR1A 3UXOA 4KLEA 3G6XA 3OPXA 3ED5A 1SGGA 3KD3A 3T79A 3C29A 4IQVA 5HR6A 2KFZA 3KKAC 3RJJA 4DWIA 1XC9A 8ICSA 1ZD4A 3AM9A 4F2SA 1TFRA 3E58A 4NL9A 3H40A 2DGZA 1N61A 3AQFA 1Z00B 2KSOB 4DFMA 5DDMA 4UAUA 5J2JA 8ICNA 3C1YA 1IG6A 5KFXA 5TZVA 4ECWA 3L4PA 5A0LA 4UB1A 2ZXIA 5CP2A 4F4XA 8ICEA 3E0FA 9ICKA 1TK5A 3RAXA 4EZ9A 3ZDDA 2EAMA 2LI6A 4O5CA 1NK9A 3ONNA 1Y88A 4UASA 2D8CA 1L8OA 1ZQDA 1DOQA 4XQ8A 1QH9A 2AGPA 2YB1A 2JRZA 2MUTB 4IS7A 4DSKA 3ALRA 1ZJMA 5ALJA 5AM3A 3PY8A 4ELVA 3GIMA 4DOAA 1KLNA 3NGDA 3T5KA 4MEXA 3CNHA 3F5AA 5ALZA 1WWVA 5IIIA 4LZGA 1PK1A 2XIDA 2IBKA 3MFHA 5DKWA 3QU7A 3UMGA 3QE9Y 1NK7A 2DF4B 1BPDA 5KFJA 2AH5A 3G6YA 4DFPA 8ICGA 5KG7A 4DL7A 1U9LA 5EWFA 3RR7A 2EZXA 1S0OA 1NJYA 1ZQIA 4KLOA 4QZCA 3N4MB 2I9GA 2ASJA 3PVXA 2KJ8A 4RQ5A 3WKCA 4IR9A 1MN8A 3DEEA 2XGPA 4M04A 9ICCA 1L6NA 5C5JA 2F76X 2KKPA 1L7PA 1SZHA 3NASA 3AQEA 5J0XA 4DL6A 4RQ7A 3PR4A 2A3VA 1ZQPA 2K4HA 3HKZC 2EQYA 3FYHA 4FZNA 1DGSA 2C2RA 5AI8A 1KSPA 4QWAA 4MF8A 3BQTA 1KBUA 3NRWA 2J6TA 2E3TA 5KFVA 3MR6A 1ZQLA 5AKIA 4OJ6A 2YY6A 2ZIUA 2ZTEA 4CF3A 1XS9D 3HWTA 2DKXA 4C7YA 1NZBA 5AM4A 3FAHA 2JEJA 4KLQA 3WKAA 4R63A 1URJA 2ZIVA 1YZ6A 3C23A 4IQUA 5DDYA 4JMUA 2FPLA 5ALGA 4PH5A 4BWMA 5CRXA 5ALWA 1N2XA 4ED6A 5KFQA 1ZXIA 1F5SA 1RQNA 4EYHB 1SV0C 5B5EU 4BWJA 3RRGA 3H8MA 4KMOB 5JUMA 2EAPA 2JH1A 1OW5A 4ECSA 4UQGA 4ECVA 3SZ2A 4J9OA 5KAIU 4DQSA 2KE7A 5J0YA 3M1YA 4Y2VA 1SL1A 3RJGA 3K4GA 2ZUBA 5KG2A 1CEZA 1WCNA 1KEJA 4K4HA 2DBYA 4YD1A 2CRXA 4GC6A 4MFAA 3WKDA 5EE9A 4EELA 4F72A 2R8KA 2A1JB 1UA1A 1O08A 2OEHA 4KTQA 2M0NA 2XY5A 9ICNA 1IXRA 2F8KA 4M2YA 2DKZA 2VJ5A 7ICIA 2K8BB 4OD0A 4C4RA 1U45A 9ICXA 1T4GA 4DL5A 4F5RA 1ZQRA 2P6RA 2ZIWA 8ICYA 4R66A 5CB1A 1S10A 4UB3A 2VJ4A 4ICAA 1AQ6A 2N1RA 2Y0SF 5AK3A 1N5XA 1RYRA 4QZAA 3EW9A 1L3TA 7ICEA 4YP3A 1B0XA 3B0YA 4O5KA 4FFDA 4J9MA 9ICEA 3Q8RB 2JHDA 3PSIA 4JK1A 3F2DA 1S77D 5KT3A 4I29A 2PFNA 4ECQA 1L3VA 4PZNA 4DFDA 3JPQA 3KHGA 1S76D 2K8CB 2W3RA 3PW4A 2FPMA 3BS5B 4KX3A 4Z6CA 2HCFA 3RH5A 2E5SA 2KK0A 3IP4B 4YFKA 4XA5A 3KBBA 2AQ0A 1RDFA 3HW8A 2F2AB 1GO3F 2QKQA 3Q8LA 5J0OA 4M9HA 3GV7B 1ZQJA 1IIPA 1MA7A 2KICA 3LWLA 4ECZA 2F8LA 2LM1A 5KFOA 2W9BA 2KN7A 1X6IA 3FC4A 3H0MB 5CJ7A 1NKEA 5GTIU 4G3IA 2PXIA 5DG7A 4DSJA 5KG5A 4EBEA 5AK6A 3RB6A 1NK4A 7ICLA 2WF6A 2HBJA 1FEZA 1K1QA 4TUQA 3F2CA 5AKZA 4ED7A 1L5UA 4RQ2A 1Z00A 2KSOA 3K1ZA 1Z1BA 2GLEA 4PHAA 5KFTA 1BPYA 3H0LB 8ICCA 1N5WA 3JPNA 2HHQA 1ZQFA 3PO5A 3SMVA 3QXGA 3RBDA 8ICHA 2W9CB 5KFDA 1D8YA 4NLCA 4F4WA 3GIIA 2KZMA 3IM1A 4F8RA 1Z1VA 3L3FX 4YCXA 3RAQA 8ICRA 3Q8PB 9ICUA 3IRUA 3UXNA 5J0SA 1V85A 2AGOA 3AEVA 3F2BA 1XSPA 3ZD8A 2H3VA 3MR2A 3RJHA 5L9XA 5F9LA 5KFNA 2HHVA 2IOHA 4MF2A 1WG8A 4I2HA 1WUDA 4NL9C 4YVZA 5F3XB 2BQ3A 3MDCA 5ALUA 1QSSA 4O3SA 2W9MA 4DLEA 2MUTA 5KG4A 1NJWA 1ZQSA 4CF4A 3N7RC 2MRLA 4R8UB 3TADC 1PK3A 4K4GA 1ZD2P 4RUCA 2DUYA 5KAFU 3BQ1A 3PX6A 2ZTCA 2PMZC 3H0RB 2HI0A 5H2FU 1ZQAA 5KFRA 2NYVA 3N7PD 3TANA 1ZRMA 4I2CA 5DBCA 2NRWA 2W55A 2PI5A 2BQUA 3RF9A 3SQIA 4KN7A 5KFGA 3RR8A 8ICJA 3I76A 5AM2A 2PFQA 2ISOA 3RB4A 8ICIA 5DBAA 1TK8A 4CRXA 4YXJA 2P35A 4CF5A 5KFKA 3H4BA 1KQQA 2XI9A 2BZFA 4CCHA 5C0YA 4QJFB 3KOOA 2LYBA 4C7ZA 5J0RA 4EX7A 3AU6A 4Q45A 4NLKA 1RPLA 8ICWA 2LBOA 2AXTU 4TUSA 3B9JA 3U26A 1ZQCA 1VJ5A 2BGWA 4UATA 3AL0B 2K4PA 3WK9A 4IRDA 4M0AA 4OJ5A 2G08A 3TAPA 2G5HB 3M6KA 2IA6A 2MSNA 2NRXA 2I1QA 3T5JA 5J0QA 3EPIA 4RQNA 4DCCA 2WF9A 5AICA 5ALYA 4GIBA 1KN5A 1N63A 5KT4A 1Z4NA 1MC8A 3C2LA 3UQ2A 3NS1A 3WK8A 5HR7A 2DWQA 2EDUA 4DFJA 3KHHA 2YTUA 9ICTA 4UAWA 3QU4A 3D2NA 3GIJA 2OH2A 1RZTA 1RQLA 2KV2A 1BVSA 1L3UA 4O3MA 4BJQA 1A6SA 5ALMA 2FMQA 2A1AA 1N62A 4KLTA 4F4YA 3PX4A 2BCRA 2ZUDA 3RRHA 1KDHA 2HBLA 1BPEA 2ZJ8A 4NLNA 2P66A 5EWGA 5KFYA 4F5PA 5AI4A 1BNPA 5IINA 2WF8A 2QARB 1NZPA 7ICJA 4C8KA 2B6GA 1SXDA 2HMXA 4YMOA 1BPZA 5IIOA 4E0DA 4QIWF 2W03A 1NNLA 4EBCA 1ZQQA 2XC9A 2KIWA 3ZDEA 3ISCA 1NK0A 4BX9C 3PSPA 5KL8B 3O0FA 1T3NA 4UB4A 4GXKA 4OJPA 4PHPA 5E79U 2PI4A 5DBBA 3D6JA 4Y2TA 4F93B 5G5GA 4P2HA 4YMNA 5L1KA 1KFTA 5J2BA 1ZRNA 1K5OA 4US9A 3MGVA 1KFDA 3LK9A 3JPSA 4I28A 4HAIA 2A1JA 3SV4A 2YMPA 4LJXA 3V7KA 5D4BA 3UQ0A 4B9TA 2W7PA 3NVVA 1RXWA 2XICA 1ZQBA 4P4MA 2ATLA 4C4TA 3GFKB 2JH7A 3UMCA 3RJKA 2L5YA 4DSFA 2RLTA 2BKEA 5AK4A 1PVQA 3GQCA 1TE2A 2G0AA 2MA1A 4RQ0A 2FPKA 2KJ5A 2ZUCA 2W11A 4JWNA 3RTVA 2WF5A 4G9BA 7ICKA 4RPZA 3TAQA 4KITB 4YR2A 3ICXA 1MQ3A 3GZFA 1QSLA 4FBTA 2D6FC 4QZBA 5KFCA 2JGAA 5JU5A 3WK5A
chains in the Genus database with same CATH topology
4FZMA 2ZIUB 4C0ZA 1P7DA 2CN1A 2HBMA 2OYYA 2H3IA 3F53A 2KNJA 3RF9A 2KJ8A 4A8EA 1Q3UA 5T14A 2F77X 2DGZA 2HMXA 2LHTA 2K8AA 3AQFA 2KICA 2VIXA 1MA7A 2F8LA 2LYAA 3DEEA 4U7CA 3SQIA 2RRDA 2H3ZA 3IN5A 3C28A 1XO0A 4QIWF 2WB1C 2W03A 2ZIWB 1L6NA 3PZPA 3H0MB 2ZIXA 1PVPA 2BDUA 2F76X 2KKPA 3CP8A 1SZHA 2WB1F 2ZG6A 3AQEA 3SAGA 2Q4TA 2KIWA 4BX9C 2A3VA 3PSPA 2ZIVB 4FE3A 3VC8A 5A0LA 5KL8B 2K4HA 2W04A 3HKZC 2Y0SC 2M0NA 2ZXIA 1ZQ1C 3D2SA 4CRXA 3O0FA 4FZNA 4OJOA 2G5IB 2OXOA 1CRXA 4OJPA 1KBUA 3E0FA 3NRWA 4IC9A 1Z19A 1F44A 4P0QB 2VJ5A 3M7DA 4WJ3B 2GOLA 2K8BB 2XI9A 4P0PB 4GFJA 2HBJA 5C0YA 3F2CA 4OJ6A 4QJFB 2ZIUA 2G06A 2LYBA 2KHVA 3ONNA 1XNSA 4PL2A 2G09A 3K1ZA 2LKYA 3M6ZA 2LBOA 1Z1BA 3MGVA 3H0LB 2HOFA 2ZIWA 4CDGA 1NZBA 2R18A 3F5EA 3SAHA 1HEKA 4PL1A 2KKVA 2YB1A 3SMVA 2HOIA 1ED1A 2Z7JA 3AL0B 4KX5A 4NLCA 2XVTA 2VJ4A 3CYMA 2KJ9A 1URJA 2ZIVA 3PSFA 4OJ5A 3HKZF 2G08A 2N1RA 2Y0SF 3ALRA 2G5HB 4ICAA 2G07A 2YX8A 3M6KA 2H3QA 2W7PA 3PSTA 2KEYA 2OM6A 3L3FX 2ZIXB 4ACOA 3RFAA 4CGZA 2XICA 4P0QA 2HBKA 4NWIA 2CPRA 3D2QA 4OJLA 4JMUA 3CRXA 2JMGA 2KVCA 3F2BA 4P0PA 2E1FA 5CRXA 2JH7A 2K89A 2H3VA 2NV3A 2VKQA 2K4IA 2RHFA 3IG8A 1D8BA 3F5AA 1ECWA 2JHDA 2KOBA 5HR7A 3PSIA 4BUGA 1PVQA 2RP5A 2YB4A 1HIWA 3F2DA 3N7SC 1DRGA 3KFUF 4QNLA 3IG5A 1PVRA 1WUDA 2G0AA 4KMOB 4U6PA 2MA1A 1T94A 1UPHA 2XIDA 2ZXHA 2K8CB 3LVVA 1Q3VA 3D2NA 2JH1A 4AYBC 2W7OA 4OO1J 2H3FA 2KJ5A 4QIWC 1OUQA 3GU3A 2OH2A 2WAQC 3N7RC 4KX3A 3LYSA 3NUQA 2MRLA 3LVWA 2E5SA 3IP4B 3KZXA 2DF4B 2KV2A 4AYBF 4O3MA 4NV0A 4BJQA 1A6SA 2DQNB 2WAQF 4NLBA 3OPXA 4FZLA 2F2AB 3H0RB 1GO3F 2PMZC 3ICXA 3VCBA 3T79A 2KD1A 3C29A 5HR6A 2HBLA 2K4EA 3GZFA 1TAMA 5KL1B 3N7PD 2PMZF 3SAFA 2KHQA 2D6FC 2HOQA 1YT3A 1IIPA 2E1EA 2JGAA 2CRXA 1A0PA 2GH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 J;  2HBM A;  2DGZ A;  4CGZ A;  2HBJ A;  5C0Y A;  2HBK A;  4QJF B;  2CPR A;  2KV2 A;  2RRD A;  4O3M A;  4QIW F;  2E1F A;  4NLB A;  2RHF A;  3SAG A;  1GO3 F;  1D8B A;  4CDG A;  2HBL A;  3SAH A;  3SAF A;  1WUD A;  1YT3 A;  2E1E A;  2MA1 A;  4NLC A;  3CYM A; 
#chains in the Genus database with same CATH topology
 4C0Z A;  3OHB A;  2OHF A;  2M9N A;  4PJ0 U;  3M8S A;  1ZQU A;  3KHR A;  3BS5 A;  3EWA A;  1XO0 A;  4YMM A;  4DF4 A;  5ALP A;  5EOZ A;  2BDU A;  4DQP A;  2ZG6 A;  3TI0 A;  2BPC A;  2KZ3 A;  5F9N A;  1KKX A;  2KTQ A;  2BPF A;  2D3D A;  1QTM A;  1RXV A;  1X9S A;  4I2J A;  4Y2Q A;  4P0P B;  3GV8 B;  5EE0 A;  3C21 A;  4F5O A;  4DSL A;  4DQQ A;  4F50 A;  1TK0 A;  3A0H U;  2G09 A;  1A76 A;  1JAL A;  4QWE A;  2HHW A;  3F5E A;  3BDP A;  2VAN A;  4DOB A;  4TQR A;  2YN4 A;  2Z7J A;  3ZI4 A;  5CWR A;  2E8N A;  5G5H A;  2JEI A;  3FM9 A;  4O3P A;  2EZY A;  9ICL A;  4GXI A;  4ACO A;  4F5Q A;  3EYZ A;  5AM5 A;  5AKJ A;  2F1H A;  3BQ2 A;  1ZQV A;  1DK3 A;  4Y2U A;  3QYP A;  2RP5 A;  1HIW A;  1S8O A;  1DRG A;  5IIL A;  4O5E A;  4QZ8 A;  4U6P A;  1CI4 A;  2BR0 A;  2W9C A;  1Q3V A;  1ZQG A;  4GXJ A;  2HHU A;  2KFN A;  3LVW A;  4F91 B;  1NKC A;  3PW7 A;  1ZQN A;  2A19 A;  4NLB A;  4EYI B;  4QWC A;  1PZN A;  5L1J A;  3V7J A;  7ICR A;  4Y2J A;  5AI0 A;  1VDV A;  2PMZ F;  3ISB A;  1YT3 A;  3UM9 A;  4J9R A;  5ALI A;  2IHM A;  1A0P A;  3PSF A;  3Q8K A;  1QSY A;  2RDI A;  2F77 X;  2VA2 A;  3Q8M A;  3QUC A;  2RRD A;  3SYZ A;  2H3Z A;  5HHH A;  5DGA A;  2ISP A;  2C2E A;  2ZIX A;  3OHA A;  3RB0 A;  4R8U A;  3T5L A;  4C8L A;  4TUR A;  2E8M A;  1F0M A;  1JI7 A;  1QCK A;  4NM2 A;  4TQS A;  4B6J A;  2IMW P;  4OCZ A;  2JV3 A;  2G5I B;  3LDA A;  4P0Q B;  1UT8 A;  4RZR A;  4PGQ A;  3HT3 A;  5DQH A;  1KTQ A;  1JRO A;  1NI3 A;  2KHV A;  5AI9 A;  4J9P A;  4I2F A;  2FMS A;  5ALD A;  2LM4 A;  1J2M A;  4PL1 A;  2HOI A;  1U4B A;  3MFI A;  2NRV A;  2DFL A;  3GIK A;  1JXE A;  2HBK A;  4Y2Y A;  2YQE A;  1UCV A;  3M9N B;  2K89 A;  4PGX A;  4RNO A;  5AIB A;  2R8H A;  1NK5 A;  1JMS A;  3L5K A;  1X9W A;  2PFP A;  2Y9T A;  5IIJ A;  1BNO A;  3T3F A;  1HUZ A;  3LVV A;  2FLN A;  4DSE A;  1Q46 A;  1COK A;  2ALZ A;  5JRT A;  2EAN A;  2WFA A;  4NV0 A;  5ALV A;  4JV0 A;  2B0C A;  1X6J A;  4KLH A;  1XSL A;  8ICP A;  4QZI A;  9ICO A;  1XSN A;  4ED0 A;  2GWS A;  3PNC A;  1FO4 A;  2J6S A;  4JV2 A;  4B9M A;  3QU2 A;  3WKB A;  2HHX A;  3NVY A;  1B43 A;  4O3R A;  8ICB A;  3F53 A;  2AQ4 A;  2KNJ A;  2ES6 A;  2WTF A;  2VIX A;  2ZTD A;  5J29 A;  5J2H A;  7ICV A;  5ALO A;  4DS4 A;  3TFR A;  1NK8 A;  3IHQ B;  4QZE A;  5AKY A;  3MR5 A;  7ICM A;  2RDJ A;  3H8S A;  4M6W B;  3C5G A;  4X5V A;  4MEY A;  4C8O A;  4OJO A;  4O3N A;  4QW9 A;  5BPC A;  1KRP A;  1Z19 A;  5ALS A;  4KLL A;  1ZQH A;  2R8G A;  2QAR A;  3K75 D;  1LB2 B;  1ZQE A;  2KZZ A;  4DQI A;  3NVW A;  5J2E A;  3MR3 A;  4MFF A;  4EZ6 A;  2B21 A;  5AIA A;  1Q8K A;  5D49 A;  5J2I A;  2FJ6 A;  1HEK A;  2Y9U A;  4JWM A;  3PMN A;  1JUD A;  1ZQK A;  2JXJ A;  4J9S A;  3SV3 A;  4B9S A;  5AM1 A;  2OWO A;  5AHX A;  1J2N A;  4YG2 A;  3QUB A;  4FO6 A;  1SKW A;  2K4I A;  1SL0 A;  9ICV A;  4O3O A;  2YB4 A;  4QZH A;  4I2A A;  1ZYQ A;  3ZDA A;  4NXZ A;  1UPH A;  4M9N A;  5KT7 A;  4K4I A;  3I1Y A;  1SV4 A;  3ISD A;  2WAQ C;  7ICG A;  4YN4 A;  2IHN A;  1DK2 A;  2O6K A;  4KLF A;  3MDA A;  1ZJN A;  5DLG A;  2K4E A;  2AHO B;  5KL1 B;  2ASD A;  2YML A;  2KHQ A;  1D8L A;  3NVZ A;  5KG6 A;  9ICW A;  9ICA A;  2HBM A;  1Q3U A;  3B0X A;  5DLF A;  2ZJ5 A;  4KLI A;  5J0P A;  4P4O A;  5KT5 A;  1PVP A;  2H5X A;  1ZQT A;  3SAG A;  3C2K A;  5ALQ A;  4QZ9 A;  4RT2 A;  4IRK A;  2W04 A;  9ICQ A;  4KLU A;  4YXM A;  3OJS A;  4B9V A;  4IC9 A;  3M9O B;  3QU5 A;  4QWD A;  4NLZ A;  4M9G A;  1JX4 A;  3QU9 A;  4DFK A;  4EX6 A;  1XNS A;  3MAB A;  1VLB A;  4DF8 A;  4QWB A;  2KVS A;  3NTU A;  5IIM A;  2IOF K;  1X42 A;  1U47 A;  4J9L A;  3HKZ F;  7ICQ A;  2G07 A;  2H3Q A;  3PST A;  2XCP A;  1M6Y A;  4CGZ A;  1U49 A;  4XUS A;  3D2Q A;  5CHG A;  4P0P A;  2JZB B;  5ALL A;  2NV3 A;  1L7O A;  5KFE A;  2RHF A;  4F2R A;  5ALR A;  2HVH A;  4UB2 A;  1NOM A;  1N56 A;  2BCS A;  3V6H A;  4ECU A;  2UVV A;  3EPG A;  3N97 B;  4AYB C;  2V9W A;  3SI8 A;  3GU3 A;  2AJQ A;  4QZF A;  2HVI A;  3KZX A;  8ICK A;  4FS1 A;  4NM1 A;  1ZD5 A;  4ED1 A;  1T8E A;  4FZL A;  3SEN A;  4F71 A;  3JPT A;  1TAM A;  5AKG A;  4Y2S A;  2KMD A;  3RH4 A;  2AU0 A;  1UT5 A;  1SKR A;  2E1E A;  1ZQX A;  4Z6D A;  2UVW A;  5DGB A;  4A8E A;  3KHL A;  2LYA A;  1Z3E B;  3IN5 A;  3HRD D;  4BGD A;  3S6J A;  3CP8 A;  1TVA A;  4J9N A;  5KFP A;  3K1R B;  4USA A;  3EZ5 A;  2Y1J A;  3ZD9 A;  2Y0S C;  1ZQ1 C;  8ICX A;  2VA3 A;  3OSN A;  3GDX A;  2DL0 A;  1ZET A;  4UB8 U;  3M7D A;  2BHN A;  4I2I A;  3ETR A;  3RBE A;  1H38 A;  1S5L U;  5ALT A;  3A0B U;  4RQ3 A;  3M6Z A;  1C20 A;  5BOM A;  1EXN A;  3JPR A;  4B9N A;  3M9M B;  2KKV A;  1NJZ A;  4DEZ A;  5KG3 A;  5DG8 A;  3IDW A;  4I27 A;  2YX8 A;  3Q8S B;  4P0Q A;  2CPR A;  3CRX A;  5KFA A;  2JMG A;  2E1F A;  1QQ6 A;  2NO5 A;  2KP7 A;  1D8B A;  4Z6E A;  1ECW A;  7ICN A;  4YR0 A;  2KOB A;  1WYG A;  5TIS U;  2AGQ A;  3C2M A;  5KFM A;  1N48 A;  9ICI A;  3TKA A;  1X66 A;  1LKY B;  3WK4 A;  3CW2 C;  4O3Q A;  3QZ7 A;  2W7O A;  3QNM A;  4P4P A;  3PW0 A;  3WU2 U;  3JPO A;  1BPB A;  4GC7 A;  1S97 A;  2DQN B;  4BXO B;  1T7P A;  5IIK A;  5KFB A;  3TAD A;  2K60 A;  2KD1 A;  1NKB A;  4IRC A;  3PW5 A;  2W54 A;  3QZ8 A;  5ALE A;  3PML A;  8ICO A;  4RT3 A;  3THV A;  9ICJ A;  5DG9 A;  2BCV A;  1RM6 C;  4RPY A;  2H3I A;  3DDH A;  3EUB 2;  3BQ0 A;  2F1J A;  5AI5 A;  7ICO A;  5KFF A;  8ICU A;  4LZD A;  3PV8 A;  3ZDB A;  3FDS A;  5KG0 A;  9ICR A;  5J8Y A;  2DPI A;  1LVH A;  4IQT A;  3V7L A;  1F44 A;  5KFU A;  2GOL A;  4PPX A;  5DQG A;  3V6K A;  5J2A A;  3MGI A;  5CR0 A;  2LKY A;  4M9J A;  3MBY A;  4F5N A;  9ICH A;  4J9K A;  3H4D A;  3SEI A;  3SAH A;  1QQ7 A;  1ED1 A;  4IQW A;  4FS2 A;  5AKX A;  3R9K A;  4KLJ A;  4M6W A;  4R65 A;  4XRH A;  1U48 A;  3H7I A;  9ICP A;  3G6V A;  4NWI A;  3UMB A;  5KFI A;  1V9P A;  2QB1 A;  3GV5 B;  1ZQW A;  3PW2 A;  1FFV A;  1UHU A;  1ZQY A;  1ZQM A;  2IOF A;  4F4K A;  4TUP A;  4Q43 A;  4PGY A;  9ICM A;  2MAX A;  5EWE A;  1T94 A;  4O0I A;  2ZXH A;  2KG5 A;  3BQ7 A;  1V97 A;  2WAQ F;  4DQR A;  5EE1 A;  4I2E A;  4EBD A;  4ZH4 A;  1ZQZ A;  4HYK A;  2QB0 B;  5AK5 A;  4ZOH C;  4F92 B;  5ALN A;  4EEK A;  2OYY A;  5J2D A;  2HSZ A;  1KL9 A;  3AUO A;  3RH6 A;  3UPQ A;  3RJF A;  1SWW A;  7ICF A;  4Q44 A;  1SL2 A;  2HHS A;  1TAQ A;  2WB1 C;  4GLX A;  5AKE A;  5KFZ A;  1TAU A;  3DV9 A;  2I5H A;  1JXL A;  1FIQ A;  1PUZ A;  2V4R A;  4CE6 A;  4Y2X A;  1CRX A;  4RQ1 A;  2LYH A;  3OSP A;  3E2E A;  3KKA A;  1N60 A;  4RQ4 A;  4PHE A;  4PL2 A;  1ZOL A;  1YZ7 A;  2MU2 A;  3T5H A;  3M8R A;  2HOF A;  4IL6 U;  4CDG A;  1ZQO A;  5DB8 A;  4JUZ A;  1SKS A;  1SB3 C;  2FDR A;  4BDP A;  1SXE A;  3QUT A;  4UBB A;  2XCA A;  4EEY A;  3BJY A;  3H8J A;  2NRZ A;  4JV1 A;  4US8 A;  3BS7 A;  1L7M A;  4QW8 A;  2JEF A;  2XO7 A;  5DB7 A;  5J0T A;  4DS5 A;  4CNQ A;  2PFO A;  1BGX T;  3N28 A;  3HIL A;  4QZD A;  1UQV A;  2ODG A;  4BUG A;  1X9X A;  5KFL A;  3QUQ A;  3IG5 A;  5HNK A;  3WK7 A;  2W8L A;  5KG1 A;  4C8N A;  4DL2 A;  2H3F A;  4QIW C;  2FLP A;  9ICG A;  2FI1 A;  3IV6 A;  3NUQ A;  2Y1I A;  1MSW D;  5KFS A;  4AYB F;  3QX7 A;  5KFH A;  5HP4 A;  5DB9 A;  3HJE A;  1JRP A;  3VCB A;  2JZB A;  3GIL A;  4I2D A;  4J03 A;  3UXP A;  4KLS A;  1NK6 A;  4UAV A;  4Z6F A;  5DQI A;  4UB6 U;  3VC8 A;  1K1S A;  4R64 A;  5J0W A;  4OO1 J;  5T14 A;  4UAZ A;  1SIJ A;  4RNM A;  2YMQ A;  2PKE A;  4ECT A;  1L7N A;  2HHT A;  4AP9 A;  2Q4T A;  3HP6 A;  3MGH A;  5BOL A;  3D2S A;  2JR5 A;  3ETL A;  2NRT A;  2OXO A;  5J2K A;  8ICT A;  3KZI U;  4DOC A;  1D9D A;  1SWV A;  4Y2P A;  4UAY A;  1S0M A;  1WWU A;  5KNI A;  1IM4 A;  5AI6 A;  3RJE A;  5HHI A;  3TAR A;  2R8J A;  4M47 A;  1PK1 B;  3ZDC A;  3HPO A;  4KX5 A;  1WCL A;  1L8L A;  3CYM A;  2KJ9 A;  5FP0 A;  5CEH A;  2BDP A;  2ESE A;  2FE9 A;  5EE3 A;  2W3S A;  2EZZ A;  5ALX A;  3TFS A;  3OGU A;  5AKH A;  2KVC A;  1Z4O A;  2VA8 A;  8ICF A;  5L1M A;  5ALK A;  2W8K A;  1B22 A;  4RU9 A;  3SR6 A;  5B66 U;  1OXJ A;  1TV9 A;  2BCQ A;  4DSI A;  3N7S C;  2F44 A;  3KFU F;  4ELT A;  2UVR A;  3RJI A;  4F4Z A;  4RUA A;  8ICA A;  2FMP A;  5AKL A;  2YMM A;  3PO4 A;  1HJP A;  4KLD A;  3I28 A;  4NJ8 A;  1O03 A;  5GTH U;  3LWM A;  7ICT A;  2EH9 A;  1QLN A;  3QEB Z;  2E8O A;  4J9Q A;  8ICM A;  1J97 A;  4M9L A;  3SAF A;  7ICH A;  5KT2 A;  4Q8F A;  1D9F A;  4YR3 A;  2HOQ A;  2EAO A;  1SV0 A;  1X40 A;  3OJU A;  4MFC A;  4FZM A;  2ZIU B;  2CN1 A;  2RQ5 A;  5CA7 A;  1B4F A;  1RYU A;  7ICP A;  2K8A A;  3Q8Q B;  1RG6 A;  1A77 A;  1LKY A;  5K4L A;  4DLG A;  2LPE A;  5JTI A;  3C28 A;  4KLG A;  4EEN A;  4BXO A;  1V38 A;  2ZIV B;  3BZC A;  2DPJ A;  1C7Y A;  3H8W A;  3AU2 A;  5D46 A;  2BPG A;  4O9M A;  4C4S A;  4ELU A;  5AKK A;  1NJX A;  4WJ3 B;  2XY6 A;  4NLG A;  2G06 A;  3J81 j;  8ICV A;  2KIV A;  5ALH A;  1T3Q A;  5KT6 A;  2XGQ A;  2QLT A;  3NRZ A;  1BPX A;  2XVT A;  1JIH A;  4RPX A;  3QEA Z;  2NO4 A;  3ORY A;  1SZP A;  2OM6 A;  4I2G A;  1HUO A;  2ZIX B;  3RFA A;  1TKD A;  5J2F A;  5ALF A;  1JN3 A;  1COO A;  4ECY A;  2HW3 A;  3IG8 A;  4F3O A;  2F1I A;  1MQ2 A;  4QNL A;  1IV8 A;  2J6U A;  4UB5 A;  4ED8 A;  1LV5 A;  1KFS A;  3PR5 B;  4Y2R A;  2W9A A;  5L1L A;  5KFW A;  1OUQ A;  1DGJ A;  3AMZ A;  3LYS A;  5J0U A;  3RB3 A;  4JB3 A;  4NY8 A;  5J2G A;  3TQ1 A;  5KTQ A;  3V6J A;  5HMM A;  1L3S A;  4KN4 A;  2UVU A;  1XWL A;  5J8Y C;  5HML A;  1FFU A;  1CUK A;  4UW9 A;  4UAR A;  3C1Z A;  3V72 A;  9ICS A;  2I6X A;  2GO7 A;  3WK6 A;  2GH1 A;  1P7D A;  2BCU A;  4KLM A;  2LHT A;  4FBU A;  1S0V A;  4U7C A;  4B9U A;  4C80 A;  2F3N A;  1S9F A;  4LVS A;  2ZIW B;  4RQM A;  3PZP A;  3BZK A;  4ED2 A;  2ZJA A;  2WB1 F;  4RQ6 A;  2OCE A;  2BQR A;  9ICB A;  2JEG A;  4FE3 A;  1KW4 A;  4RQ8 A;  4YQW A;  2Q0Z X;  3OTQ A;  2ASL A;  2QB0 A;  4PZO A;  1X2I A;  2E8P A;  2WF7 A;  7ICS A;  4GFJ A;  4ECR A;  5L1I A;  1S0N A;  1RYS A;  1ZD3 A;  2P6U A;  1DXS A;  4UBC A;  1QQ5 A;  4PHD A;  4QZG A;  1XU4 A;  3HX0 A;  2XY7 A;  2FLL A;  2R18 A;  8ICL A;  9ICF A;  3MC1 A;  4C8M A;  3JPP A;  2V4Q A;  4KMU A;  2C28 A;  4MHV A;  2KEY A;  3WKE A;  4DL4 A;  2LMR A;  4RNN A;  4OJL A;  4ED3 A;  3KTQ A;  3C5F A;  4B9L A;  4DL3 A;  4ECX A;  1UA0 A;  2C2D A;  1XO1 A;  2R8I A;  8ICZ A;  5DB6 A;  2VKQ A;  4YD2 A;  2C22 A;  1X9M A;  1ARO P;  3SD7 A;  1PVR A;  3AN1 A;  7ICU A;  8ICQ A;  5AM0 A;  2HDO A;  4Q8E A;  3TAC B;  2W43 A;  2W9B B;  4I2B A;  4DO9 A;  2WHE A;  5J2C A;  2CXY A;  3PX0 A;  4IR1 A;  3UXO A;  4KLE A;  3G6X A;  3OPX A;  3ED5 A;  1SGG A;  3KD3 A;  3T79 A;  3C29 A;  4IQV A;  5HR6 A;  2KFZ A;  3KKA C;  3RJJ A;  4DWI A;  1XC9 A;  8ICS A;  1ZD4 A;  3AM9 A;  4F2S A;  1TFR A;  3E58 A;  4NL9 A;  3H40 A;  2DGZ A;  1N61 A;  3AQF A;  1Z00 B;  2KSO B;  4DFM A;  5DDM A;  4UAU A;  5J2J A;  8ICN A;  3C1Y A;  1IG6 A;  5KFX A;  5TZV A;  4ECW A;  3L4P A;  5A0L A;  4UB1 A;  2ZXI A;  5CP2 A;  4F4X A;  8ICE A;  3E0F A;  9ICK A;  1TK5 A;  3RAX A;  4EZ9 A;  3ZDD A;  2EAM A;  2LI6 A;  4O5C A;  1NK9 A;  3ONN A;  1Y88 A;  4UAS A;  2D8C A;  1L8O A;  1ZQD A;  1DOQ A;  4XQ8 A;  1QH9 A;  2AGP A;  2YB1 A;  2JRZ A;  2MUT B;  4IS7 A;  4DSK A;  3ALR A;  1ZJM A;  5ALJ A;  5AM3 A;  3PY8 A;  4ELV A;  3GIM A;  4DOA A;  1KLN A;  3NGD A;  3T5K A;  4MEX A;  3CNH A;  3F5A A;  5ALZ A;  1WWV A;  5III A;  4LZG A;  1PK1 A;  2XID A;  2IBK A;  3MFH A;  5DKW A;  3QU7 A;  3UMG A;  3QE9 Y;  1NK7 A;  2DF4 B;  1BPD A;  5KFJ A;  2AH5 A;  3G6Y A;  4DFP A;  8ICG A;  5KG7 A;  4DL7 A;  1U9L A;  5EWF A;  3RR7 A;  2EZX A;  1S0O A;  1NJY A;  1ZQI A;  4KLO A;  4QZC A;  3N4M B;  2I9G A;  2ASJ A;  3PVX A;  2KJ8 A;  4RQ5 A;  3WKC A;  4IR9 A;  1MN8 A;  3DEE A;  2XGP A;  4M04 A;  9ICC A;  1L6N A;  5C5J A;  2F76 X;  2KKP A;  1L7P A;  1SZH A;  3NAS A;  3AQE A;  5J0X A;  4DL6 A;  4RQ7 A;  3PR4 A;  2A3V A;  1ZQP A;  2K4H A;  3HKZ C;  2EQY A;  3FYH A;  4FZN A;  1DGS A;  2C2R A;  5AI8 A;  1KSP A;  4QWA A;  4MF8 A;  3BQT A;  1KBU A;  3NRW A;  2J6T A;  2E3T A;  5KFV A;  3MR6 A;  1ZQL A;  5AKI A;  4OJ6 A;  2YY6 A;  2ZIU A;  2ZTE A;  4CF3 A;  1XS9 D;  3HWT A;  2DKX A;  4C7Y A;  1NZB A;  5AM4 A;  3FAH A;  2JEJ A;  4KLQ A;  3WKA A;  4R63 A;  1URJ A;  2ZIV A;  1YZ6 A;  3C23 A;  4IQU A;  5DDY A;  4JMU A;  2FPL A;  5ALG A;  4PH5 A;  4BWM A;  5CRX A;  5ALW A;  1N2X A;  4ED6 A;  5KFQ A;  1ZXI A;  1F5S A;  1RQN A;  4EYH B;  1SV0 C;  5B5E U;  4BWJ A;  3RRG A;  3H8M A;  4KMO B;  5JUM A;  2EAP A;  2JH1 A;  1OW5 A;  4ECS A;  4UQG A;  4ECV A;  3SZ2 A;  4J9O A;  5KAI U;  4DQS A;  2KE7 A;  5J0Y A;  3M1Y A;  4Y2V A;  1SL1 A;  3RJG A;  3K4G A;  2ZUB A;  5KG2 A;  1CEZ A;  1WCN A;  1KEJ A;  4K4H A;  2DBY A;  4YD1 A;  2CRX A;  4GC6 A;  4MFA A;  3WKD A;  5EE9 A;  4EEL A;  4F72 A;  2R8K A;  2A1J B;  1UA1 A;  1O08 A;  2OEH A;  4KTQ A;  2M0N A;  2XY5 A;  9ICN A;  1IXR A;  2F8K A;  4M2Y A;  2DKZ A;  2VJ5 A;  7ICI A;  2K8B B;  4OD0 A;  4C4R A;  1U45 A;  9ICX A;  1T4G A;  4DL5 A;  4F5R A;  1ZQR A;  2P6R A;  2ZIW A;  8ICY A;  4R66 A;  5CB1 A;  1S10 A;  4UB3 A;  2VJ4 A;  4ICA A;  1AQ6 A;  2N1R A;  2Y0S F;  5AK3 A;  1N5X A;  1RYR A;  4QZA A;  3EW9 A;  1L3T A;  7ICE A;  4YP3 A;  1B0X A;  3B0Y A;  4O5K A;  4FFD A;  4J9M A;  9ICE A;  3Q8R B;  2JHD A;  3PSI A;  4JK1 A;  3F2D A;  1S77 D;  5KT3 A;  4I29 A;  2PFN A;  4ECQ A;  1L3V A;  4PZN A;  4DFD A;  3JPQ A;  3KHG A;  1S76 D;  2K8C B;  2W3R A;  3PW4 A;  2FPM A;  3BS5 B;  4KX3 A;  4Z6C A;  2HCF A;  3RH5 A;  2E5S A;  2KK0 A;  3IP4 B;  4YFK A;  4XA5 A;  3KBB A;  2AQ0 A;  1RDF A;  3HW8 A;  2F2A B;  1GO3 F;  2QKQ A;  3Q8L A;  5J0O A;  4M9H A;  3GV7 B;  1ZQJ A;  1IIP A;  1MA7 A;  2KIC A;  3LWL A;  4ECZ A;  2F8L A;  2LM1 A;  5KFO A;  2W9B A;  2KN7 A;  1X6I A;  3FC4 A;  3H0M B;  5CJ7 A;  1NKE A;  5GTI U;  4G3I A;  2PXI A;  5DG7 A;  4DSJ A;  5KG5 A;  4EBE A;  5AK6 A;  3RB6 A;  1NK4 A;  7ICL A;  2WF6 A;  2HBJ A;  1FEZ A;  1K1Q A;  4TUQ A;  3F2C A;  5AKZ A;  4ED7 A;  1L5U A;  4RQ2 A;  1Z00 A;  2KSO A;  3K1Z A;  1Z1B A;  2GLE A;  4PHA A;  5KFT A;  1BPY A;  3H0L B;  8ICC A;  1N5W A;  3JPN A;  2HHQ A;  1ZQF A;  3PO5 A;  3SMV A;  3QXG A;  3RBD A;  8ICH A;  2W9C B;  5KFD A;  1D8Y A;  4NLC A;  4F4W A;  3GII A;  2KZM A;  3IM1 A;  4F8R A;  1Z1V A;  3L3F X;  4YCX A;  3RAQ A;  8ICR A;  3Q8P B;  9ICU A;  3IRU A;  3UXN A;  5J0S A;  1V85 A;  2AGO A;  3AEV A;  3F2B A;  1XSP A;  3ZD8 A;  2H3V A;  3MR2 A;  3RJH A;  5L9X A;  5F9L A;  5KFN A;  2HHV A;  2IOH A;  4MF2 A;  1WG8 A;  4I2H A;  1WUD A;  4NL9 C;  4YVZ A;  5F3X B;  2BQ3 A;  3MDC A;  5ALU A;  1QSS A;  4O3S A;  2W9M A;  4DLE A;  2MUT A;  5KG4 A;  1NJW A;  1ZQS A;  4CF4 A;  3N7R C;  2MRL A;  4R8U B;  3TAD C;  1PK3 A;  4K4G A;  1ZD2 P;  4RUC A;  2DUY A;  5KAF U;  3BQ1 A;  3PX6 A;  2ZTC A;  2PMZ C;  3H0R B;  2HI0 A;  5H2F U;  1ZQA A;  5KFR A;  2NYV A;  3N7P D;  3TAN A;  1ZRM A;  4I2C A;  5DBC A;  2NRW A;  2W55 A;  2PI5 A;  2BQU A;  3RF9 A;  3SQI A;  4KN7 A;  5KFG A;  3RR8 A;  8ICJ A;  3I76 A;  5AM2 A;  2PFQ A;  2ISO A;  3RB4 A;  8ICI A;  5DBA A;  1TK8 A;  4CRX A;  4YXJ A;  2P35 A;  4CF5 A;  5KFK A;  3H4B A;  1KQQ A;  2XI9 A;  2BZF A;  4CCH A;  5C0Y A;  4QJF B;  3KOO A;  2LYB A;  4C7Z A;  5J0R A;  4EX7 A;  3AU6 A;  4Q45 A;  4NLK A;  1RPL A;  8ICW A;  2LBO A;  2AXT U;  4TUS A;  3B9J A;  3U26 A;  1ZQC A;  1VJ5 A;  2BGW A;  4UAT A;  3AL0 B;  2K4P A;  3WK9 A;  4IRD A;  4M0A A;  4OJ5 A;  2G08 A;  3TAP A;  2G5H B;  3M6K A;  2IA6 A;  2MSN A;  2NRX A;  2I1Q A;  3T5J A;  5J0Q A;  3EPI A;  4RQN A;  4DCC A;  2WF9 A;  5AIC A;  5ALY A;  4GIB A;  1KN5 A;  1N63 A;  5KT4 A;  1Z4N A;  1MC8 A;  3C2L A;  3UQ2 A;  3NS1 A;  3WK8 A;  5HR7 A;  2DWQ A;  2EDU A;  4DFJ A;  3KHH A;  2YTU A;  9ICT A;  4UAW A;  3QU4 A;  3D2N A;  3GIJ A;  2OH2 A;  1RZT A;  1RQL A;  2KV2 A;  1BVS A;  1L3U A;  4O3M A;  4BJQ A;  1A6S A;  5ALM A;  2FMQ A;  2A1A A;  1N62 A;  4KLT A;  4F4Y A;  3PX4 A;  2BCR A;  2ZUD A;  3RRH A;  1KDH A;  2HBL A;  1BPE A;  2ZJ8 A;  4NLN A;  2P66 A;  5EWG A;  5KFY A;  4F5P A;  5AI4 A;  1BNP A;  5IIN A;  2WF8 A;  2QAR B;  1NZP A;  7ICJ A;  4C8K A;  2B6G A;  1SXD A;  2HMX A;  4YMO A;  1BPZ A;  5IIO A;  4E0D A;  4QIW F;  2W03 A;  1NNL A;  4EBC A;  1ZQQ A;  2XC9 A;  2KIW A;  3ZDE A;  3ISC A;  1NK0 A;  4BX9 C;  3PSP A;  5KL8 B;  3O0F A;  1T3N A;  4UB4 A;  4GXK A;  4OJP A;  4PHP A;  5E79 U;  2PI4 A;  5DBB A;  3D6J A;  4Y2T A;  4F93 B;  5G5G A;  4P2H A;  4YMN A;  5L1K A;  1KFT A;  5J2B A;  1ZRN A;  1K5O A;  4US9 A;  3MGV A;  1KFD A;  3LK9 A;  3JPS A;  4I28 A;  4HAI A;  2A1J A;  3SV4 A;  2YMP A;  4LJX A;  3V7K A;  5D4B A;  3UQ0 A;  4B9T A;  2W7P A;  3NVV A;  1RXW A;  2XIC A;  1ZQB A;  4P4M A;  2ATL A;  4C4T A;  3GFK B;  2JH7 A;  3UMC A;  3RJK A;  2L5Y A;  4DSF A;  2RLT A;  2BKE A;  5AK4 A;  1PVQ A;  3GQC A;  1TE2 A;  2G0A A;  2MA1 A;  4RQ0 A;  2FPK A;  2KJ5 A;  2ZUC A;  2W11 A;  4JWN A;  3RTV A;  2WF5 A;  4G9B A;  7ICK A;  4RPZ A;  3TAQ A;  4KIT B;  4YR2 A;  3ICX A;  1MQ3 A;  3GZF A;  1QSL A;  4FBT A;  2D6F C;  4QZB A;  5KFC A;  2JGA A;  5JU5 A;  3WK5 A; 
#chains in the Genus database with same CATH homology
 4FZM A;  2ZIU B;  4C0Z A;  1P7D A;  2CN1 A;  2HBM A;  2OYY A;  2H3I A;  3F53 A;  2KNJ A;  3RF9 A;  2KJ8 A;  4A8E A;  1Q3U A;  5T14 A;  2F77 X;  2DGZ A;  2HMX A;  2LHT A;  2K8A A;  3AQF A;  2KIC A;  2VIX A;  1MA7 A;  2F8L A;  2LYA A;  3DEE A;  4U7C A;  3SQI A;  2RRD A;  2H3Z A;  3IN5 A;  3C28 A;  1XO0 A;  4QIW F;  2WB1 C;  2W03 A;  2ZIW B;  1L6N A;  3PZP A;  3H0M B;  2ZIX A;  1PVP A;  2BDU A;  2F76 X;  2KKP A;  3CP8 A;  1SZH A;  2WB1 F;  2ZG6 A;  3AQE A;  3SAG A;  2Q4T A;  2KIW A;  4BX9 C;  2A3V A;  3PSP A;  2ZIV B;  4FE3 A;  3VC8 A;  5A0L A;  5KL8 B;  2K4H A;  2W04 A;  3HKZ C;  2Y0S C;  2M0N A;  2ZXI A;  1ZQ1 C;  3D2S A;  4CRX A;  3O0F A;  4FZN A;  4OJO A;  2G5I B;  2OXO A;  1CRX A;  4OJP A;  1KBU A;  3E0F A;  3NRW A;  4IC9 A;  1Z19 A;  1F44 A;  4P0Q B;  2VJ5 A;  3M7D A;  4WJ3 B;  2GOL A;  2K8B B;  2XI9 A;  4P0P B;  4GFJ A;  2HBJ A;  5C0Y A;  3F2C A;  4OJ6 A;  4QJF B;  2ZIU A;  2G06 A;  2LYB A;  2KHV A;  3ONN A;  1XNS A;  4PL2 A;  2G09 A;  3K1Z A;  2LKY A;  3M6Z A;  2LBO A;  1Z1B A;  3MGV A;  3H0L B;  2HOF A;  2ZIW A;  4CDG A;  1NZB A;  2R18 A;  3F5E A;  3SAH A;  1HEK A;  4PL1 A;  2KKV A;  2YB1 A;  3SMV A;  2HOI A;  1ED1 A;  2Z7J A;  3AL0 B;  4KX5 A;  4NLC A;  2XVT A;  2VJ4 A;  3CYM A;  2KJ9 A;  1URJ A;  2ZIV A;  3PSF A;  4OJ5 A;  3HKZ F;  2G08 A;  2N1R A;  2Y0S F;  3ALR A;  2G5H B;  4ICA A;  2G07 A;  2YX8 A;  3M6K A;  2H3Q A;  2W7P A;  3PST A;  2KEY A;  2OM6 A;  3L3F X;  2ZIX B;  4ACO A;  3RFA A;  4CGZ A;  2XIC A;  4P0Q A;  2HBK A;  4NWI A;  2CPR A;  3D2Q A;  4OJL A;  4JMU A;  3CRX A;  2JMG A;  2KVC A;  3F2B A;  4P0P A;  2E1F A;  5CRX A;  2JH7 A;  2K89 A;  2H3V A;  2NV3 A;  2VKQ A;  2K4I A;  2RHF A;  3IG8 A;  1D8B A;  3F5A A;  1ECW A;  2JHD A;  2KOB A;  5HR7 A;  3PSI A;  4BUG A;  1PVQ A;  2RP5 A;  2YB4 A;  1HIW A;  3F2D A;  3N7S C;  1DRG A;  3KFU F;  4QNL A;  3IG5 A;  1PVR A;  1WUD A;  2G0A A;  4KMO B;  4U6P A;  2MA1 A;  1T94 A;  1UPH A;  2XID A;  2ZXH A;  2K8C B;  3LVV A;  1Q3V A;  3D2N A;  2JH1 A;  4AYB C;  2W7O A;  4OO1 J;  2H3F A;  2KJ5 A;  4QIW C;  1OUQ A;  3GU3 A;  2OH2 A;  2WAQ C;  3N7R C;  4KX3 A;  3LYS A;  3NUQ A;  2MRL A;  3LVW A;  2E5S A;  3IP4 B;  3KZX A;  2DF4 B;  2KV2 A;  4AYB F;  4O3M A;  4NV0 A;  4BJQ A;  1A6S A;  2DQN B;  2WAQ F;  4NLB A;  3OPX A;  4FZL A;  2F2A B;  3H0R B;  1GO3 F;  2PMZ C;  3ICX A;  3VCB A;  3T79 A;  2KD1 A;  3C29 A;  5HR6 A;  2HBL A;  2K4E A;  3GZF A;  1TAM A;  5KL1 B;  3N7P D;  2PMZ F;  3SAF A;  2KHQ A;  2D6F C;  2HOQ A;  1YT3 A;  1IIP A;  2E1E A;  2JGA A;  2CRX A;  1A0P A;  2GH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...