2RRDA

Structure of hrdc domain from human bloom syndrome protein, blm
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
GIPEFKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HRDC domain from Bloom syndrome protein
publication title Solution structure of the HRDC domain of human Bloom syndrome protein BLM
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 101
sequence length 101
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2rrdA00
2KV2A 4QIWF 2E1FA 1GO3F 2HBKA 2CPRA 3CYMA 2HBMA 2HBJA 2MA1A 1D8BA 4O3MA 1YT3A 2E1EA 1WUDA 3SAFA 3SAHA 4OO1J 3SAGA 2RRDA 2RHFA 4CGZA 5C0YA 4NLCA 2HBLA 4NLBA 2DGZA 4QJFB 4CDGA
chains in the Genus database with same CATH superfamily
4US8A 1L3TA 1SL1A 3M6KA 2E8NA 4PGYA 4QZEA 1SV0C 1Y88A 9ICMA 5KFYA 1RQNA 3WU2U 1FO4A 3BQ1A 5L1MA 2ZIUA 5D4BA 2KG5A 5KFVA 5KFOA 2K8CB 1WWVA 3H7IA 7ICFA 4EYIB 2JEJA 4M2YA 1IM4A 5DG8A 2F2AB 2V9WA 5CR0A 2VA2A 3RR8A 1RZTA 1TK5A 1ZQ1C 4I2DA 2KSOB 4QZ9A 4KN7A 5AI8A 8ICMA 4B9TA 1FFUA 4O5CA 1Z4OA 1X9WA 4KX5A 1KSPA 1LV5A 1JRPA 2M9NA 4DOAA 2UVWA 4K4IA 4PZOA 1JROA 1IV8A 4IRDA 2ZUDA 2BHNA 5KG7A 4ED2A 3IG8A 4NL9A 2H5XA 1JXEA 3Q8RB 9ICUA 3NS1A 5DGAA 2I1QA 3CNHA 1X9XA 3UXPA 1S0VA 3MABA 3UPQA 2HOQA 4KLMA 2KHVA 2FPLA 5KFFA 5AKEA 4FBTA 5HR7A 5J0SA 2BCVA 2DPJA 2P35A 5AM0A 3PMNA 1V9PA 2HBMA 3B0YA 2AGOA 3WK7A 1SWWA 2K8AA 2FLLA 3SEIA 4DQQA 2HHWA 1ZQBA 3GV5B 2YTUA 2LM4A 3QEAZ 4ED6A 1SKRA 2VKQA 3RJJA 2Y9UA 4NY8A 4U7CA 4F91B 3CRXA 2QARB 4FZLA 3ICXA 4MEYA 3TARA 4DQPA 4NXZA 3C29A 3K75D 1K1QA 2KHQA 1ZQDA 4DL3A 4DF8A 3RJFA 3SV3A 4F2SA 7ICPA 4YN4A 3UM9A 1ECWA 1PVRA 2PFPA 2FLNA 4F71A 3KKAC 2I9GA 1ZQLA 3MR6A 5ALOA 1UA1A 2HHQA 1D9DA 1WCLA 1NJXA 1UT5A 4J9NA 4QZDA 3LVWA 1T94A 5AI5A 2NRXA 2Y0SC 2JZBB 5KFGA 1A76A 1SZHA 4UATA 2WHEA 4NM1A 5DBAA 5CB1A 1OW5A 4F4KA 1NK7A 4IS7A 2OEHA 5KT4A 1BGXT 4CF3A 4Q44A 3D6JA 3F53A 2W8LA 1BPZA 4B9UA 5CRXA 2WB1C 2H3QA 1UHUA 2LYBA 2ZIXB 3O0FA 5J0QA 2W8KA 3PR4A 2KVSA 4LVSA 2FPKA 1D8YA 2HHVA 1RDFA 1MQ2A 5AKYA 3IG5A 3OSNA 2JXJA 5B66U 3JPPA 1LVHA 3SI8A 4YD2A 2ZIVA 4B9VA 1YZ6A 4O3OA 1HUZA 3RJKA 4KLDA 1UA0A 2B0CA 2WAQF 1A6SA 2E8MA 2MUTB 1MN8A 3C2MA 2QB1A 4NLKA 3LK9A 2LI6A 1A0PA 5GTIU 3G6VA 1N61A 5KFXA 3D2QA 3MFIA 1TV9A 3EUB2 4ECTA 8ICVA 4M9HA 1KN5A 2F1IA 2BGWA 4P4OA 2E8PA 1S0MA 5J2JA 1N60A 5AI4A 4F93B 5KFMA 4R63A 4F5QA 3PX4A 8ICZA 4HYKA 5DGBA 4PPXA 1ZQUA 4EBCA 3LVVA 3NGDA 4Y2TA 1ZQFA 4C8NA 4M9JA 2KZMA 5EE0A 3DEEA 3RBEA 8ICYA 3QYPA 4HAIA 5DG7A 5GTHU 3LYSA 5D46A 1DXSA 4DL5A 3H0LB 1X9SA 5ALRA 1MQ3A 3RJEA 1N5WA 4MEXA 3KHHA 1DGSA 5KAIU 2KMDA 2NO4A 1C7YA 1KDHA 5DQGA 1ZQCA 1RPLA 2CRXA 2JEFA 4RNMA 4PHEA 9ICSA 2EQYA 4PGQA 5ALUA 5BOMA 4M04A 3PW2A 4LZGA 4Z6CA 4EEKA 4F50A 2Y1JA 2XGQA 2LYAA 2WF7A 4QWDA 2W04A 1FFVA 3ETLA 3RFAA 2GOLA 4UAYA 5ALGA 1BPYA 5J2EA 4DCCA 5C5JA 1U48A 3SD7A 4UB5A 2RQ5A 3RAXA 3A0HU 3QZ7A 5ALLA 5KFCA 4R8UB 7ICGA 3RRHA 4P0PB 2J6SA 2G08A 2ZXHA 4UB2A 7ICKA 1JX4A 3SV4A 4B9SA 1L6NA 3QE9Y 3PSPA 5AK4A 2LM1A 3TADA 3AL0B 5EE1A 4DFMA 2HOFA 4B9LA 1ED1A 4C4RA 4Y2XA 4Y2PA 2YB4A 3R9KA 3RH4A 1ZQIA 5KNIA 1HIWA 5DBCA 4RQ3A 1V38A 3RH6A 3F2CA 1LB2B 4Q43A 5ALVA 2LMRA 5IINA 1PK1B 2XVTA 3BQ7A 4USAA 3GIJA 4RQ1A 1QSLA 2W03A 1SXEA 9ICKA 2W43A 4DQSA 4M0AA 2WTFA 2FPMA 3EW9A 1TFRA 2EDUA 3FM9A 4DLEA 3SENA 2NRTA 8ICSA 1OUQA 4OJPA 1YT3A 1NI3A 4YVZA 2XO7A 3UMGA 4O5KA 5ALSA 8ICJA 5DG9A 4JWMA 4F4ZA 2EAOA 3DDHA 5KG3A 8ICBA 3NTUA 4O3NA 1J97A 2PMZC 2KKPA 4ECWA 1ZD3A 4DSEA 2AGQA 4I2CA 1Q46A 3M1YA 1Z00B 2ZIVB 4J9KA 1S10A 3OJSA 2BKEA 3A0BU 1ZOLA 3HJEA 4I2IA 1ZQSA 2HW3A 3UQ0A 2J6TA 4DL7A 5KT6A 3JPQA 8ICWA 1ZRNA 2IHNA 1ZD4A 4M9LA 5J0YA 4GC6A 4NLNA 5ALTA 1U49A 1S8OA 4UB6U 3PZPA 1IIPA 4BXOA 2XC9A 4BJQA 2KNJA 3ONNA 5K4LA 4NM2A 5ALYA 5J2FA 4FBUA 4BX9C 3ED5A 5CWRA 4Q8EA 4MHVA 3G6XA 2XCAA 2Y0SF 4XUSA 3KTQA 2P66A 2A19A 3C5FA 3GU3A 4F5OA 7ICTA 3Q8KA 3RBDA 5KT3A 2CN1A 1L8OA 2ZTEA 4Y2YA 3GIKA 3OHBA 2DWQA 2WB1F 4XRHA 1ZD2P 4RQ2A 3AU2A 1KL9A 4IRKA 3MR2A 3Q8MA 2F1HA 2Q0ZX 7ICRA 1BVSA 4ELVA 3K4GA 2YX8A 1CRXA 9ICFA 3C21A 1AQ6A 3RTVA 2KVCA 2YN4A 5J2AA 5DB7A 2F8KA 1LKYA 3V6KA 4ICAA 4O9MA 9ICCA 8ICXA 4EELA 2A1JA 1SGGA 5KFNA 3ISDA 2IOFA 4UASA 4TUSA 2B21A 4Y2QA 1PK3A 3LDAA 4PHPA 4C7YA 3N28A 5KT7A 1RG6A 1RXWA 4F4WA 2WF8A 3M6ZA 3Q8QB 2FDRA 3KHRA 3BS5A 3I76A 5F3XB 1KQQA 2R8IA 5ALNA 4ECXA 1U4BA 2ZTCA 5BPCA 3GV8B 3V6JA 3H4BA 4F5RA 3I1YA 4ECQA 2KFZA 2VJ5A 5KL1B 3GV7B 4KLIA 1QCKA 1L7OA 3C1YA 2BQ3A 9ICVA 4RUAA 1Z19A 1FEZA 1X66A 1CUKA 2NV3A 5AKZA 4EX6A 1X42A 2F76X 3MR3A 3S6JA 3RJGA 4QZ8A 2V4QA 4E0DA 3H8SA 3SZ2A 4KLQA 5J2GA 1ZETA 3N97B 2K60A 2A1AA 1ZQAA 4FS2A 3HWTA 5CA7A 3WK4A 3Q8LA 3UXNA 4I2GA 5KG0A 4LJXA 1JIHA 3H4DA 1TK0A 3NVWA 2FJ6A 4Z6EA 4DS4A 2EZZA 4KTQA 1CEZA 3HKZC 4JV1A 2AH5A 5KTQA 4KMOB 3PO5A 2MSNA 3TACB 5KFBA 3AQEA 4XQ8A 3DV9A 5KAFU 2KP7A 1T4GA 1JMSA 3UMCA 5KFIA 4YR0A 1RYSA 2UVUA 5EWEA 1C20A 4IQTA 4BWJA 4ECZA 2H3ZA 1TVAA 9ICJA 3OHAA 4RUCA 1IXRA 2Y1IA 2PFQA 5KL8B 4RT3A 1S0NA 3QU5A 7ICHA 3B0XA 5A0LA 3IRUA 3CYMA 5DB9A 3M7DA 3JPNA 3KD3A 1D8BA 3MGIA 1KTQA 4Z6FA 2NRWA 4QWEA 2BCQA 3HPOA 3MBYA 2C2RA 5AKGA 2W54A 4O3SA 4C80A 1DRGA 5ALXA 3WK6A 5HHHA 3H8JA 5J0PA 5KG2A 5J0UA 2XY6A 2F8LA 1QTMA 5AICA 3H40A 5EE9A 8ICLA 4O3MA 9ICTA 1O08A 4GXIA 2Z7JA 3PR5B 1QH9A 4IRCA 4JWNA 2HMXA 5IIKA 3U26A 4FFDA 5G5GA 2K4IA 5DQIA 3V7JA 1BPXA 2BCUA 8ICUA 2KN7A 2VJ4A 5JRTA 4I2HA 3F5EA 1SV4A 4R66A 4NV0A 4YMMA 3AQFA 5J0WA 4EBDA 1NKCA 2GWSA 1ZQOA 5ALMA 3EYZA 4GXKA 4YR2A 4IR9A 4AYBC 2PMZF 3PVXA 8ICOA 5HMMA 2IHMA 5L1IA 2KIVA 2DBYA 2KV2A 2KEYA 2K4EA 2IOFK 5EOZA 4I2FA 1IG6A 1LKYB 4PH5A 3V6HA 5IIOA 4MF2A 5KFLA 1TAUA 4BUGA 2A1JB 2KJ8A 4TURA 4DSLA 3QU2A 5IIMA 2FLPA 1U45A 4DSFA 1WG8A 3MDAA 2JHDA 4DFKA 3MGVA 2W7OA 1L7PA 2YMPA 2DPIA 3QNMA 7ICOA 1SV0A 5DKWA 3TAPA 3BS5B 1S77D 2BPFA 1X40A 3N7RC 3EPIA 4EENA 3WK5A 3KHLA 3SAHA 5J2IA 5J2CA 3WKAA 4C4TA 3QU4A 1UPHA 1NKEA 2P6RA 1L3SA 2F1JA 4RNNA 4Z6DA 1NZPA 2YMLA 3PW7A 2W9AA 4MFCA 2RHFA 3EWAA 2KZ3A 3M8SA 3MC1A 3PW0A 5AI6A 1ZQVA 3C2KA 2ZIUB 1TKDA 4J9RA 1XU4A 5L1LA 1U47A 9ICHA 5AKKA 4JUZA 3WKEA 1SKWA 4CCHA 5AKHA 3MFHA 2ASLA 1RM6C 5F9NA 3K1ZA 8ICNA 4J9OA 5E79U 5EE3A 1ZQWA 4M9NA 2JR5A 2G5HB 5IILA 2W3SA 3HW8A 2FI1A 4QZIA 8ICRA 3TANA 3C23A 4RPZA 4GC7A 4RQNA 1Z1VA 2PKEA 5KFHA 1XWLA 2ZJAA 1ZQRA 2J6UA 2I5HA 1NK6A 5J2BA 5IIJA 2ODGA 1B4FA 2VIXA 2H3FA 9ICQA 2I6XA 3QXGA 4Y2UA 4A8EA 3OJUA 4YCXA 4KMUA 2NO5A 3HRDD 5CEHA 3PW5A 3IHQB 8ICIA 2GLEA 3THVA 4OO1J 5AIAA 1N56A 3AEVA 2H3IA 4RT2A 5KG6A 8ICHA 1XO0A 3ZDBA 7ICVA 3KKAA 1MA7A 7ICMA 1T3NA 4FO6A 3KBBA 4DS5A 2K8BB 1L5UA 2DQNB 4UB8U 2ZG6A 2XGPA 2WF6A 1ZD5A 1D9FA 4DSKA 1O03A 3JPRA 4US9A 2EZXA 4F2RA 2DKZA 2JMGA 4ACOA 3L4PA 4J9LA 2FMSA 2LYHA 1F0MA 1B0XA 5KFEA 2RLTA 4NJ8A 2CPRA 3SQIA 1NK4A 2DF4B 2XY7A 4I2AA 5KFPA 4ZOHC 5KFRA 2ALZA 2IA6A 2JEGA 4K4GA 3JPTA 1TAMA 4IL6U 1V97A 4QZBA 2EH9A 4IQVA 4DQIA 2KJ5A 4F92B 2BCRA 4J9MA 5DB8A 4P0QA 3RB4A 2D6FC 1JUDA 3TAQA 4QZFA 2K89A 4J9PA 3JPOA 2C28A 2KZZA 3RAQA 4BWMA 2YY6A 2R8KA 4F3OA 2DUYA 3H8MA 5DB6A 5J2KA 5L9XA 1ZQPA 2L5YA 1NOMA 2EZYA 4RPYA 2IOHA 4F5PA 4OJ5A 4KLUA 4NLCA 2KSOA 1NK9A 3ZDCA 1Q3UA 4RQMA 1ZQZA 5ALIA 9ICBA 5J0OA 1HEKA 1FIQA 1ZQJA 8ICAA 4I29A 4KLSA 3MGHA 1UT8A 2QLTA 2G06A 4P2HA 4Y2RA 1UQVA 2QB0A 1RYRA 3FAHA 4UAZA 1NZBA 1S76D 2VANA 2O6KA 1XSPA 2C2DA 2HI0A 2WFAA 3C1ZA 3PSIA 3WK9A 5AM4A 2XIDA 4UW9A 7ICJA 5KG5A 5ALDA 4UAUA 2AHOB 2R8JA 3LWLA 1TK8A 1K1SA 3D2SA 1ZQTA 1M6YA 1PZNA 3OSPA 2BZFA 1KBUA 4EZ9A 1QQ6A 5J2DA 2KK0A 4MFAA 4OJLA 3B9JA 2FE9A 5CP2A 4MF8A 3MR5A 2DFLA 4NL9C 5AK3A 1L3VA 3QZ8A 1NJYA 5DDYA 4FS1A 4DL2A 2LBOA 4KLTA 1JALA 3GILA 1SZPA 1ZQHA 4J9QA 2KKVA 5ALKA 1KFSA 4ECSA 4I28A 4AYBF 3H0RB 3ISBA 2W3RA 3J81j 5KT2A 2KJ9A 1U9LA 1KFTA 4P4MA 2JH1A 5ALJA 1XC9A 3IP4B 2HBJA 2MA1A 1JN3A 1D8LA 1XSLA 2IBKA 5EWGA 3V7LA 1KFDA 2ASJA 3TFRA 4C8LA 3VC8A 2LHTA 5DQHA 2RRDA 1COOA 1XS9D 4ECUA 1DK2A 4NLBA 4QZAA 4QWAA 8ICCA 4M9GA 7ICUA 2E3TA 1SXDA 4CE6A 1QLNA 5ALQA 2WF9A 3C5GA 3RH5A 1BPBA 4JK1A 4UAVA 2XCPA 4YXJA 1RYUA 4BDPA 1J2NA 5JU5A 5CJ7A 3OPXA 2CXYA 3E2EA 1N2XA 2MRLA 1EXNA 3TQ1A 3RF9A 5KFTA 3FC4A 4FE3A 2NYVA 4ELUA 2R18A 2ZIWA 5AKIA 3M8RA 4DEZA 7ICSA 3SMVA 2G07A 4XA5A 1XO1A 2UVVA 4UBBA 1SL2A 4UB3A 3G6YA 2OHFA 3NRWA 3N7PD 2HDOA 3AUOA 3KFUF 5ALFA 5HHIA 4B9NA 2KTQA 2NRVA 4OCZA 2DL0A 4CDGA 4Y2SA 2ATLA 9ICLA 2JGAA 2OYYA 4K4HA 2RDJA 2JH7A 3NVYA 4IQWA 3ZDAA 1L7NA 4EZ6A 1ZQMA 8ICGA 2GO7A 1S9FA 4ELTA 1QQ7A 5L1KA 3PO4A 4Q8FA 2UVRA 3ZD9A 1WCNA 5C0YA 8ICQA 2XI9A 4NLGA 2V4RA 4ED8A 4LZDA 4QZCA 2GH1A 4QZHA 2HOIA 3L5KA 1B22A 4G3IA 4RQ7A 3E58A 4DFJA 4J03A 3HILA 3E0FA 4F4XA 1ZQEA 4P0QB 2JV3A 3NASA 4M47A 2D8CA 5H2FU 2G5IB 5AM3A 2W9BA 2H3VA 2HHUA 2W9CA 4QIWC 4QW8A 1RXVA 2WF5A 3QUCA 4KITB 3QUTA 4KLHA 3GFKB 9ICNA 2ES6A 5KFQA 2AQ4A 3RB0A 4ECYA 1VLBA 1NK0A 4PHDA 4X5VA 5EWFA 5D49A 3SR6A 3SYZA 4KLEA 2QB0B 1XSNA 3NVZA 1Q8KA 2AJQA 1J2MA 5B5EU 2A3VA 3V7KA 3OGUA 4I2EA 4U6PA 4GLXA 3IDWA 3UMBA 4G9BA 2HHTA 3Q8PB 4F8RA 1B43A 8ICEA 4BXOB 3QX7A 3F2BA 1PUZA 3H0MB 4PZNA 1SWVA 2BQRA 1DK3A 3WKDA 2R8GA 3RRGA 1BPEA 1MC8A 4AP9A 1F44A 1KRPA 4F72A 2E1EA 1S97A 4ED0A 2RDIA 4DFPA 4ECVA 4DLGA 4R8UA 4P0PA 1YZ7A 1Z3EB 3AM9A 3NUQA 2E5SA 1N63A 2OCEA 4CF4A 3GZFA 2HBKA 2C22A 1TE2A 3T5HA 1ZYQA 4YXMA 2LPEA 3IN5A 3WK8A 1OXJA 1ZJMA 2B6GA 5HR6A 4ED3A 5KG4A 2OH2A 5KFDA 2C2EA 9ICGA 4F4YA 2KD1A 4OD0A 1XNSA 5AM1A 4C8KA 1ZQGA 2NRZA 2DGZA 2JEIA 1N5XA 1S5LU 3AN1A 4KLGA 2PXIA 2HHSA 3TKAA 3V72A 4DSIA 5AKXA 1NJWA 3M9NB 1PK1A 3T5JA 4YQWA 2YMQA 2ZUBA 3TADC 1ZRMA 3ALRA 3AU6A 5AHXA 8ICTA 9ICXA 2KOBA 3RR7A 2W7PA 3TI0A 4R64A 1F5SA 4QZGA 4B9MA 2PFOA 4RNOA 4PL2A 5J29A 1JI7A 4TQSA 4IC9A 4PJ0U 5J8YC 5TISU 3CP8A 2E8OA 9ICWA 7ICQA 4DF4A 4UBCA 4FZMA 2ZIWB 2BQUA 3KZIU 3IM1A 5HP4A 3N7SC 3UXOA 1KLNA 1Z00A 1X2IA 4JMUA 3PX6A 2FMQA 1KW4A 3RB6A 2AU0A 9ICIA 1GO3F 2KFNA 2PI5A 4ED7A 1NK8A 3RB3A 3CW2C 2XY5A 3C2LA 9ICRA 3FDSA 3PSTA 3QEBZ 2AXTU 3T5KA 3BQTA 4UB4A 2G0AA 3SAFA 5ALPA 4GIBA 5AKJA 5IIIA 3PX0A 4NLZA 4RQ8A 2F3NA 2IMWP 1HJPA 3H8WA 2DKXA 3F5AA 2ZJ5A 2FMPA 1WWUA 1T3QA 2EAMA 4CRXA 4F5NA 5AK6A 5AM2A 2YMMA 1SL0A 1L7MA 3QU7A 5ALZA 3SAGA 4B6JA 4QWCA 5J2HA 4DOCA 1ZQXA 3HT3A 1URJA 5HNKA 2M0NA 5G5HA 1QQ5A 1P7DA 2Y9TA 3Q8SB 3TFSA 3D2NA 2K4PA 4O3PA 2W9BB 4M6WA 4O3QA 5ALWA 5TZVA 4DFDA 2W9CB 4YD1A 3KHGA 1ZQYA 1SKSA 5AIBA 1RQLA 4C7ZA 2BCSA 4I27A 4KLLA 3GIIA 5KFUA 2W11A 1ZQNA 3ORYA 2YQEA 1VJ5A 4YP3A 4P4PA 2KICA 3RJHA 5DDMA 5KFSA 3BQ2A 1UCVA 4ED1A 5FP0A 4UQGA 7ICEA 2ZUCA 4GFJA 5AKLA 4DQRA 3RJIA 2QKQA 1T7PA 2MAXA 1V85A 3WKBA 3I28A 4UARA 4KLFA 4C0ZA 4I2BA 3QUQA 4KN4A 4BGDA 1COKA 4RQ6A 3QUBA 4I2JA 4O0IA 3T5LA 1Q3VA 3ZD8A 2D3DA 1KEJA 3IV6A 5KFAA 2F44A 4KLJA 2HBLA 2YB1A 1ZJNA 4O5EA 4IQUA 3PSFA 4YG2A 4EBEA 2ZTDA 2W55A 3AMZA 4OJ6A 1ZQKA 5KT5A 3PY8A 3ZI4A 2BPGA 2AGPA 1QSSA 2P6UA 4RQ0A 3ZDDA 1T8EA 1DOQA 4TUQA 3M9OB 4RQ5A 5T14A 2R8HA 1NKBA 3HKZF 4YMOA 8ICKA 2VA8A 1TAQA 3PNCA 3KOOA 5ALEA 4QIWF 5L1JA 5J8YA 1DGJA 4ECRA 5AI0A 2PI4A 2XICA 4ZH4A 2HCFA 3HX0A 5DLFA 4RPXA 1WUDA 2VA3A 1Z4NA 2EAPA 4KLOA 3OTQA 4EEYA 5JTIA 4QJFB 4RU9A 2ZXIA 5CHGA 4RQ4A 1BNPA 2N1RA 3VCBA 1A77A 2KE7A 4DSJA 4JV0A 3NVVA 1NJZA 5J0XA 2HSZA 4C4SA 2W9MA 4WJ3B 4OJOA 5KFWA 5KG1A 5J0RA 3C28A 1SIJA 5DLGA 2JRZA 4YMNA 4DL4A 1Z1BA 1N62A 3WKCA 4PL1A 4QWBA 5F9LA 5AI9A 1QSYA 3N4MB 4DWIA 1X6IA 1NNLA 3KZXA 3GQCA 3K1RB 4C8MA 5BOLA 5KFJA 4DO9A 3BJYA 9ICOA 4PGXA 2BDUA 1PVPA 2PFNA 5DBBA 4EYHB 1ZQQA 3QU9A 2BPCA 2WAQC 2OXOA 2F77X 2QARA 4EX7A 9ICEA 4Q45A 4DL6A 3UQ2A 1HUOA 4CF5A 2ZJ8A 2ESEA 8ICPA 4IR1A 3LWMA 2MU2A 3NRZA 3FYHA 3BDPA 5KFZA 4CNQA 5HMLA 3ZDEA 1KKXA 2HHXA 2E1FA 4MFFA 1PVQA 4YR3A 2BR0A 2ISPA 2G09A 4QW9A 1X6JA 4Y2VA 1AROP 4YFKA 4Y2JA 9ICAA 2EANA 4R65A 4CGZA 4M6WB 1K5OA 2JZBA 4RZRA 1SB3C 5JUMA 3HP6A 7ICIA 4DOBA 3L3FX 3PV8A 1S0OA 5KFKA 3PMLA 1ZXIA 2ISOA 3MDCA 3GDXA 3BQ0A 4O3RA 4GXJA 1MSWD 4C8OA 4J9SA 2RP5A 1WYGA 1NK5A 3BS7A 2ZIXA 1H38A 1N48A 3JPSA 4PHAA 7ICLA 5AK5A 3GIMA 4JV2A 1BNOA 4QNLA 5ALHA 3T3FA 4UAWA 1L8LA 4NWIA 3PW4A 1BPDA 1X9MA 4TUPA 1L3UA 4UB1A 2ASDA 3T79A 2HVHA 1JXLA 2OM6A 4FZNA 4JB3A 1VDVA 2MUTA 3F2DA 5J0TA 1CI4A 3BZKA 2LKYA 3ISCA 2AQ0A 3BZCA 2Q4TA 8ICFA 2KIWA 5AM5A 3EPGA 9ICPA 3M9MB 2K4HA 2HVIA 2OWOA 3ETRA 4KX3A 7ICNA 4TQRA 3EZ5A 2BDPA
chains in the Genus database with same CATH topology
2M0NA 2VIXA 3MGVA 4FZLA 3ICXA 3M6KA 2W7OA 5A0LA 4QIWF 2E1FA 4QIWC 2H3FA 3CYMA 3M7DA 3C29A 1PVQA 2KHQA 1P7DA 1D8BA 1HEKA 3D2NA 4P0PB 2G08A 2ZXHA 2XICA 4A8EA 3N7RC 2G09A 3ALRA 1L6NA 2KOBA 3PZPA 1IIPA 3PSPA 1WUDA 1ECWA 1PVRA 2ZIUA 2G06A 4BJQA 2KNJA 3ONNA 3SAHA 2W7PA 3OPXA 3AL0B 4OO1J 2H3IA 2K8CB 2MRLA 1NZBA 1XO0A 2HOFA 3RF9A 4CGZA 1ED1A 2VJ5A 1DRGA 4FE3A 2ZXIA 2YB4A 5KL1B 4QJFB 1MA7A 4PL2A 4BX9C 2KICA 3LVVA 2R18A 3PSIA 2ZIWA 4IC9A 3L3FX 2F8LA 1HIWA 1UPHA 2F2AB 2XIDA 2K8BB 1T94A 3CP8A 3LVWA 2N1RA 3SMVA 2G07A 2DQNB 2Y0SF 2Y0SC 2ZG6A 1Z19A 3VCBA 1ZQ1C 2NV3A 3F2CA 2A3VA 1SZHA 3NRWA 4FZMA 4GFJA 4O3MA 3DEEA 2ZIWB 4U6PA 2Z7JA 3GU3A 2RP5A 3D2SA 2F76X 3LYSA 2ZIXA 3N7PD 3KFUF 4WJ3B 4OJOA 2RHFA 2XVTA 4KX5A 1KBUA 2JMGA 3N7SC 2CN1A 4ACOA 3C28A 4OJLA 2HMXA 4C0ZA 2W03A 1Z1BA 2K4IA 3F53A 4CDGA 4JMUA 3H0LB 5CRXA 2WB1C 2WB1F 4PL1A 2H3QA 2VJ4A 3F2BA 2LYBA 2ZIUB 3H0MB 2ZIXB 1GO3F 4QNLA 1Q3VA 2CPRA 3O0FA 3SQIA 2JGAA 2OYYA 2DF4B 2JH7A 3IG8A 4NWIA 3F5EA 3PSTA 2LBOA 1OUQA 4OJPA 4NV0A 2YX8A 1YT3A 1F44A 1CRXA 3AQFA 2E1EA 2KVCA 2G0AA 3SAFA 1TAMA 3KZXA 2KKVA 3IG5A 2HOQA 2CRXA 4AYBF 3H0RB 4AYBC 3K1ZA 3HKZC 2KHVA 4P0PA 5C0YA 2HBLA 2KJ5A 2YB1A 2PMZC 2PMZF 2XI9A 4ICAA 2OM6A 4FZNA 3T79A 4KMOB 2KKPA 5HR7A 2BDUA 2KJ9A 2E5SA 2ZIVA 3NUQA 1PVPA 2GH1A 2KV2A 3GZFA 2KEYA 2K4EA 3PSFA 2G5HB 3F2DA 4P0QA 2HBKA 2JH1A 2HOIA 3F5AA 3IP4B 3AQEA 2HBMA 2HBJA 2D6FC 2MA1A 4CRXA 2K89A 4OJ6A 2WAQC 2K8AA 2LYAA 2WAQF 2OXOA 2LKYA 3IN5A 1A6SA 2ZIVB 2W04A 2F77X 5HR6A 2Q4TA 4BUGA 3E0FA 2KIWA 2KJ8A 4P0QB 2OH2A 3RFAA 3VC8A 2KD1A 2LHTA 3SAGA 2RRDA 2H3ZA 5T14A 2GOLA 1XNSA 2VKQA 1A0PA 2K4HA 3M6ZA 4NLCA 2G5IB 3HKZF 4OJ5A 4NLBA 2DGZA 5KL8B 4U7CA 2H3VA 3D2QA 4KX3A 1Q3UA 1URJA 3CRXA 2JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KV2 A;  4QIW F;  2E1F A;  1GO3 F;  2HBK A;  2CPR A;  3CYM A;  2HBM A;  2HBJ A;  2MA1 A;  1D8B A;  4O3M A;  1YT3 A;  2E1E A;  1WUD A;  3SAF A;  3SAH A;  4OO1 J;  3SAG A;  2RRD A;  2RHF A;  4CGZ A;  5C0Y A;  4NLC A;  2HBL A;  4NLB A;  2DGZ A;  4QJF B;  4CDG A; 
#chains in the Genus database with same CATH topology
 4US8 A;  1L3T A;  1SL1 A;  3M6K A;  2E8N A;  4PGY A;  4QZE A;  1SV0 C;  1Y88 A;  9ICM A;  5KFY A;  1RQN A;  3WU2 U;  1FO4 A;  3BQ1 A;  5L1M A;  2ZIU A;  5D4B A;  2KG5 A;  5KFV A;  5KFO A;  2K8C B;  1WWV A;  3H7I A;  7ICF A;  4EYI B;  2JEJ A;  4M2Y A;  1IM4 A;  5DG8 A;  2F2A B;  2V9W A;  5CR0 A;  2VA2 A;  3RR8 A;  1RZT A;  1TK5 A;  1ZQ1 C;  4I2D A;  2KSO B;  4QZ9 A;  4KN7 A;  5AI8 A;  8ICM A;  4B9T A;  1FFU A;  4O5C A;  1Z4O A;  1X9W A;  4KX5 A;  1KSP A;  1LV5 A;  1JRP A;  2M9N A;  4DOA A;  2UVW A;  4K4I A;  4PZO A;  1JRO A;  1IV8 A;  4IRD A;  2ZUD A;  2BHN A;  5KG7 A;  4ED2 A;  3IG8 A;  4NL9 A;  2H5X A;  1JXE A;  3Q8R B;  9ICU A;  3NS1 A;  5DGA A;  2I1Q A;  3CNH A;  1X9X A;  3UXP A;  1S0V A;  3MAB A;  3UPQ A;  2HOQ A;  4KLM A;  2KHV A;  2FPL A;  5KFF A;  5AKE A;  4FBT A;  5HR7 A;  5J0S A;  2BCV A;  2DPJ A;  2P35 A;  5AM0 A;  3PMN A;  1V9P A;  2HBM A;  3B0Y A;  2AGO A;  3WK7 A;  1SWW A;  2K8A A;  2FLL A;  3SEI A;  4DQQ A;  2HHW A;  1ZQB A;  3GV5 B;  2YTU A;  2LM4 A;  3QEA Z;  4ED6 A;  1SKR A;  2VKQ A;  3RJJ A;  2Y9U A;  4NY8 A;  4U7C A;  4F91 B;  3CRX A;  2QAR B;  4FZL A;  3ICX A;  4MEY A;  3TAR A;  4DQP A;  4NXZ A;  3C29 A;  3K75 D;  1K1Q A;  2KHQ A;  1ZQD A;  4DL3 A;  4DF8 A;  3RJF A;  3SV3 A;  4F2S A;  7ICP A;  4YN4 A;  3UM9 A;  1ECW A;  1PVR A;  2PFP A;  2FLN A;  4F71 A;  3KKA C;  2I9G A;  1ZQL A;  3MR6 A;  5ALO A;  1UA1 A;  2HHQ A;  1D9D A;  1WCL A;  1NJX A;  1UT5 A;  4J9N A;  4QZD A;  3LVW A;  1T94 A;  5AI5 A;  2NRX A;  2Y0S C;  2JZB B;  5KFG A;  1A76 A;  1SZH A;  4UAT A;  2WHE A;  4NM1 A;  5DBA A;  5CB1 A;  1OW5 A;  4F4K A;  1NK7 A;  4IS7 A;  2OEH A;  5KT4 A;  1BGX T;  4CF3 A;  4Q44 A;  3D6J A;  3F53 A;  2W8L A;  1BPZ A;  4B9U A;  5CRX A;  2WB1 C;  2H3Q A;  1UHU A;  2LYB A;  2ZIX B;  3O0F A;  5J0Q A;  2W8K A;  3PR4 A;  2KVS A;  4LVS A;  2FPK A;  1D8Y A;  2HHV A;  1RDF A;  1MQ2 A;  5AKY A;  3IG5 A;  3OSN A;  2JXJ A;  5B66 U;  3JPP A;  1LVH A;  3SI8 A;  4YD2 A;  2ZIV A;  4B9V A;  1YZ6 A;  4O3O A;  1HUZ A;  3RJK A;  4KLD A;  1UA0 A;  2B0C A;  2WAQ F;  1A6S A;  2E8M A;  2MUT B;  1MN8 A;  3C2M A;  2QB1 A;  4NLK A;  3LK9 A;  2LI6 A;  1A0P A;  5GTI U;  3G6V A;  1N61 A;  5KFX A;  3D2Q A;  3MFI A;  1TV9 A;  3EUB 2;  4ECT A;  8ICV A;  4M9H A;  1KN5 A;  2F1I A;  2BGW A;  4P4O A;  2E8P A;  1S0M A;  5J2J A;  1N60 A;  5AI4 A;  4F93 B;  5KFM A;  4R63 A;  4F5Q A;  3PX4 A;  8ICZ A;  4HYK A;  5DGB A;  4PPX A;  1ZQU A;  4EBC A;  3LVV A;  3NGD A;  4Y2T A;  1ZQF A;  4C8N A;  4M9J A;  2KZM A;  5EE0 A;  3DEE A;  3RBE A;  8ICY A;  3QYP A;  4HAI A;  5DG7 A;  5GTH U;  3LYS A;  5D46 A;  1DXS A;  4DL5 A;  3H0L B;  1X9S A;  5ALR A;  1MQ3 A;  3RJE A;  1N5W A;  4MEX A;  3KHH A;  1DGS A;  5KAI U;  2KMD A;  2NO4 A;  1C7Y A;  1KDH A;  5DQG A;  1ZQC A;  1RPL A;  2CRX A;  2JEF A;  4RNM A;  4PHE A;  9ICS A;  2EQY A;  4PGQ A;  5ALU A;  5BOM A;  4M04 A;  3PW2 A;  4LZG A;  4Z6C A;  4EEK A;  4F50 A;  2Y1J A;  2XGQ A;  2LYA A;  2WF7 A;  4QWD A;  2W04 A;  1FFV A;  3ETL A;  3RFA A;  2GOL A;  4UAY A;  5ALG A;  1BPY A;  5J2E A;  4DCC A;  5C5J A;  1U48 A;  3SD7 A;  4UB5 A;  2RQ5 A;  3RAX A;  3A0H U;  3QZ7 A;  5ALL A;  5KFC A;  4R8U B;  7ICG A;  3RRH A;  4P0P B;  2J6S A;  2G08 A;  2ZXH A;  4UB2 A;  7ICK A;  1JX4 A;  3SV4 A;  4B9S A;  1L6N A;  3QE9 Y;  3PSP A;  5AK4 A;  2LM1 A;  3TAD A;  3AL0 B;  5EE1 A;  4DFM A;  2HOF A;  4B9L A;  1ED1 A;  4C4R A;  4Y2X A;  4Y2P A;  2YB4 A;  3R9K A;  3RH4 A;  1ZQI A;  5KNI A;  1HIW A;  5DBC A;  4RQ3 A;  1V38 A;  3RH6 A;  3F2C A;  1LB2 B;  4Q43 A;  5ALV A;  2LMR A;  5IIN A;  1PK1 B;  2XVT A;  3BQ7 A;  4USA A;  3GIJ A;  4RQ1 A;  1QSL A;  2W03 A;  1SXE A;  9ICK A;  2W43 A;  4DQS A;  4M0A A;  2WTF A;  2FPM A;  3EW9 A;  1TFR A;  2EDU A;  3FM9 A;  4DLE A;  3SEN A;  2NRT A;  8ICS A;  1OUQ A;  4OJP A;  1YT3 A;  1NI3 A;  4YVZ A;  2XO7 A;  3UMG A;  4O5K A;  5ALS A;  8ICJ A;  5DG9 A;  4JWM A;  4F4Z A;  2EAO A;  3DDH A;  5KG3 A;  8ICB A;  3NTU A;  4O3N A;  1J97 A;  2PMZ C;  2KKP A;  4ECW A;  1ZD3 A;  4DSE A;  2AGQ A;  4I2C A;  1Q46 A;  3M1Y A;  1Z00 B;  2ZIV B;  4J9K A;  1S10 A;  3OJS A;  2BKE A;  3A0B U;  1ZOL A;  3HJE A;  4I2I A;  1ZQS A;  2HW3 A;  3UQ0 A;  2J6T A;  4DL7 A;  5KT6 A;  3JPQ A;  8ICW A;  1ZRN A;  2IHN A;  1ZD4 A;  4M9L A;  5J0Y A;  4GC6 A;  4NLN A;  5ALT A;  1U49 A;  1S8O A;  4UB6 U;  3PZP A;  1IIP A;  4BXO A;  2XC9 A;  4BJQ A;  2KNJ A;  3ONN A;  5K4L A;  4NM2 A;  5ALY A;  5J2F A;  4FBU A;  4BX9 C;  3ED5 A;  5CWR A;  4Q8E A;  4MHV A;  3G6X A;  2XCA A;  2Y0S F;  4XUS A;  3KTQ A;  2P66 A;  2A19 A;  3C5F A;  3GU3 A;  4F5O A;  7ICT A;  3Q8K A;  3RBD A;  5KT3 A;  2CN1 A;  1L8O A;  2ZTE A;  4Y2Y A;  3GIK A;  3OHB A;  2DWQ A;  2WB1 F;  4XRH A;  1ZD2 P;  4RQ2 A;  3AU2 A;  1KL9 A;  4IRK A;  3MR2 A;  3Q8M A;  2F1H A;  2Q0Z X;  7ICR A;  1BVS A;  4ELV A;  3K4G A;  2YX8 A;  1CRX A;  9ICF A;  3C21 A;  1AQ6 A;  3RTV A;  2KVC A;  2YN4 A;  5J2A A;  5DB7 A;  2F8K A;  1LKY A;  3V6K A;  4ICA A;  4O9M A;  9ICC A;  8ICX A;  4EEL A;  2A1J A;  1SGG A;  5KFN A;  3ISD A;  2IOF A;  4UAS A;  4TUS A;  2B21 A;  4Y2Q A;  1PK3 A;  3LDA A;  4PHP A;  4C7Y A;  3N28 A;  5KT7 A;  1RG6 A;  1RXW A;  4F4W A;  2WF8 A;  3M6Z A;  3Q8Q B;  2FDR A;  3KHR A;  3BS5 A;  3I76 A;  5F3X B;  1KQQ A;  2R8I A;  5ALN A;  4ECX A;  1U4B A;  2ZTC A;  5BPC A;  3GV8 B;  3V6J A;  3H4B A;  4F5R A;  3I1Y A;  4ECQ A;  2KFZ A;  2VJ5 A;  5KL1 B;  3GV7 B;  4KLI A;  1QCK A;  1L7O A;  3C1Y A;  2BQ3 A;  9ICV A;  4RUA A;  1Z19 A;  1FEZ A;  1X66 A;  1CUK A;  2NV3 A;  5AKZ A;  4EX6 A;  1X42 A;  2F76 X;  3MR3 A;  3S6J A;  3RJG A;  4QZ8 A;  2V4Q A;  4E0D A;  3H8S A;  3SZ2 A;  4KLQ A;  5J2G A;  1ZET A;  3N97 B;  2K60 A;  2A1A A;  1ZQA A;  4FS2 A;  3HWT A;  5CA7 A;  3WK4 A;  3Q8L A;  3UXN A;  4I2G A;  5KG0 A;  4LJX A;  1JIH A;  3H4D A;  1TK0 A;  3NVW A;  2FJ6 A;  4Z6E A;  4DS4 A;  2EZZ A;  4KTQ A;  1CEZ A;  3HKZ C;  4JV1 A;  2AH5 A;  5KTQ A;  4KMO B;  3PO5 A;  2MSN A;  3TAC B;  5KFB A;  3AQE A;  4XQ8 A;  3DV9 A;  5KAF U;  2KP7 A;  1T4G A;  1JMS A;  3UMC A;  5KFI A;  4YR0 A;  1RYS A;  2UVU A;  5EWE A;  1C20 A;  4IQT A;  4BWJ A;  4ECZ A;  2H3Z A;  1TVA A;  9ICJ A;  3OHA A;  4RUC A;  1IXR A;  2Y1I A;  2PFQ A;  5KL8 B;  4RT3 A;  1S0N A;  3QU5 A;  7ICH A;  3B0X A;  5A0L A;  3IRU A;  3CYM A;  5DB9 A;  3M7D A;  3JPN A;  3KD3 A;  1D8B A;  3MGI A;  1KTQ A;  4Z6F A;  2NRW A;  4QWE A;  2BCQ A;  3HPO A;  3MBY A;  2C2R A;  5AKG A;  2W54 A;  4O3S A;  4C80 A;  1DRG A;  5ALX A;  3WK6 A;  5HHH A;  3H8J A;  5J0P A;  5KG2 A;  5J0U A;  2XY6 A;  2F8L A;  1QTM A;  5AIC A;  3H40 A;  5EE9 A;  8ICL A;  4O3M A;  9ICT A;  1O08 A;  4GXI A;  2Z7J A;  3PR5 B;  1QH9 A;  4IRC A;  4JWN A;  2HMX A;  5IIK A;  3U26 A;  4FFD A;  5G5G A;  2K4I A;  5DQI A;  3V7J A;  1BPX A;  2BCU A;  8ICU A;  2KN7 A;  2VJ4 A;  5JRT A;  4I2H A;  3F5E A;  1SV4 A;  4R66 A;  4NV0 A;  4YMM A;  3AQF A;  5J0W A;  4EBD A;  1NKC A;  2GWS A;  1ZQO A;  5ALM A;  3EYZ A;  4GXK A;  4YR2 A;  4IR9 A;  4AYB C;  2PMZ F;  3PVX A;  8ICO A;  5HMM A;  2IHM A;  5L1I A;  2KIV A;  2DBY A;  2KV2 A;  2KEY A;  2K4E A;  2IOF K;  5EOZ A;  4I2F A;  1IG6 A;  1LKY B;  4PH5 A;  3V6H A;  5IIO A;  4MF2 A;  5KFL A;  1TAU A;  4BUG A;  2A1J B;  2KJ8 A;  4TUR A;  4DSL A;  3QU2 A;  5IIM A;  2FLP A;  1U45 A;  4DSF A;  1WG8 A;  3MDA A;  2JHD A;  4DFK A;  3MGV A;  2W7O A;  1L7P A;  2YMP A;  2DPI A;  3QNM A;  7ICO A;  1SV0 A;  5DKW A;  3TAP A;  3BS5 B;  1S77 D;  2BPF A;  1X40 A;  3N7R C;  3EPI A;  4EEN A;  3WK5 A;  3KHL A;  3SAH A;  5J2I A;  5J2C A;  3WKA A;  4C4T A;  3QU4 A;  1UPH A;  1NKE A;  2P6R A;  1L3S A;  2F1J A;  4RNN A;  4Z6D A;  1NZP A;  2YML A;  3PW7 A;  2W9A A;  4MFC A;  2RHF A;  3EWA A;  2KZ3 A;  3M8S A;  3MC1 A;  3PW0 A;  5AI6 A;  1ZQV A;  3C2K A;  2ZIU B;  1TKD A;  4J9R A;  1XU4 A;  5L1L A;  1U47 A;  9ICH A;  5AKK A;  4JUZ A;  3WKE A;  1SKW A;  4CCH A;  5AKH A;  3MFH A;  2ASL A;  1RM6 C;  5F9N A;  3K1Z A;  8ICN A;  4J9O A;  5E79 U;  5EE3 A;  1ZQW A;  4M9N A;  2JR5 A;  2G5H B;  5IIL A;  2W3S A;  3HW8 A;  2FI1 A;  4QZI A;  8ICR A;  3TAN A;  3C23 A;  4RPZ A;  4GC7 A;  4RQN A;  1Z1V A;  2PKE A;  5KFH A;  1XWL A;  2ZJA A;  1ZQR A;  2J6U A;  2I5H A;  1NK6 A;  5J2B A;  5IIJ A;  2ODG A;  1B4F A;  2VIX A;  2H3F A;  9ICQ A;  2I6X A;  3QXG A;  4Y2U A;  4A8E A;  3OJU A;  4YCX A;  4KMU A;  2NO5 A;  3HRD D;  5CEH A;  3PW5 A;  3IHQ B;  8ICI A;  2GLE A;  3THV A;  4OO1 J;  5AIA A;  1N56 A;  3AEV A;  2H3I A;  4RT2 A;  5KG6 A;  8ICH A;  1XO0 A;  3ZDB A;  7ICV A;  3KKA A;  1MA7 A;  7ICM A;  1T3N A;  4FO6 A;  3KBB A;  4DS5 A;  2K8B B;  1L5U A;  2DQN B;  4UB8 U;  2ZG6 A;  2XGP A;  2WF6 A;  1ZD5 A;  1D9F A;  4DSK A;  1O03 A;  3JPR A;  4US9 A;  2EZX A;  4F2R A;  2DKZ A;  2JMG A;  4ACO A;  3L4P A;  4J9L A;  2FMS A;  2LYH A;  1F0M A;  1B0X A;  5KFE A;  2RLT A;  4NJ8 A;  2CPR A;  3SQI A;  1NK4 A;  2DF4 B;  2XY7 A;  4I2A A;  5KFP A;  4ZOH C;  5KFR A;  2ALZ A;  2IA6 A;  2JEG A;  4K4G A;  3JPT A;  1TAM A;  4IL6 U;  1V97 A;  4QZB A;  2EH9 A;  4IQV A;  4DQI A;  2KJ5 A;  4F92 B;  2BCR A;  4J9M A;  5DB8 A;  4P0Q A;  3RB4 A;  2D6F C;  1JUD A;  3TAQ A;  4QZF A;  2K89 A;  4J9P A;  3JPO A;  2C28 A;  2KZZ A;  3RAQ A;  4BWM A;  2YY6 A;  2R8K A;  4F3O A;  2DUY A;  3H8M A;  5DB6 A;  5J2K A;  5L9X A;  1ZQP A;  2L5Y A;  1NOM A;  2EZY A;  4RPY A;  2IOH A;  4F5P A;  4OJ5 A;  4KLU A;  4NLC A;  2KSO A;  1NK9 A;  3ZDC A;  1Q3U A;  4RQM A;  1ZQZ A;  5ALI A;  9ICB A;  5J0O A;  1HEK A;  1FIQ A;  1ZQJ A;  8ICA A;  4I29 A;  4KLS A;  3MGH A;  1UT8 A;  2QLT A;  2G06 A;  4P2H A;  4Y2R A;  1UQV A;  2QB0 A;  1RYR A;  3FAH A;  4UAZ A;  1NZB A;  1S76 D;  2VAN A;  2O6K A;  1XSP A;  2C2D A;  2HI0 A;  2WFA A;  3C1Z A;  3PSI A;  3WK9 A;  5AM4 A;  2XID A;  4UW9 A;  7ICJ A;  5KG5 A;  5ALD A;  4UAU A;  2AHO B;  2R8J A;  3LWL A;  1TK8 A;  1K1S A;  3D2S A;  1ZQT A;  1M6Y A;  1PZN A;  3OSP A;  2BZF A;  1KBU A;  4EZ9 A;  1QQ6 A;  5J2D A;  2KK0 A;  4MFA A;  4OJL A;  3B9J A;  2FE9 A;  5CP2 A;  4MF8 A;  3MR5 A;  2DFL A;  4NL9 C;  5AK3 A;  1L3V A;  3QZ8 A;  1NJY A;  5DDY A;  4FS1 A;  4DL2 A;  2LBO A;  4KLT A;  1JAL A;  3GIL A;  1SZP A;  1ZQH A;  4J9Q A;  2KKV A;  5ALK A;  1KFS A;  4ECS A;  4I28 A;  4AYB F;  3H0R B;  3ISB A;  2W3R A;  3J81 j;  5KT2 A;  2KJ9 A;  1U9L A;  1KFT A;  4P4M A;  2JH1 A;  5ALJ A;  1XC9 A;  3IP4 B;  2HBJ A;  2MA1 A;  1JN3 A;  1D8L A;  1XSL A;  2IBK A;  5EWG A;  3V7L A;  1KFD A;  2ASJ A;  3TFR A;  4C8L A;  3VC8 A;  2LHT A;  5DQH A;  2RRD A;  1COO A;  1XS9 D;  4ECU A;  1DK2 A;  4NLB A;  4QZA A;  4QWA A;  8ICC A;  4M9G A;  7ICU A;  2E3T A;  1SXD A;  4CE6 A;  1QLN A;  5ALQ A;  2WF9 A;  3C5G A;  3RH5 A;  1BPB A;  4JK1 A;  4UAV A;  2XCP A;  4YXJ A;  1RYU A;  4BDP A;  1J2N A;  5JU5 A;  5CJ7 A;  3OPX A;  2CXY A;  3E2E A;  1N2X A;  2MRL A;  1EXN A;  3TQ1 A;  3RF9 A;  5KFT A;  3FC4 A;  4FE3 A;  2NYV A;  4ELU A;  2R18 A;  2ZIW A;  5AKI A;  3M8R A;  4DEZ A;  7ICS A;  3SMV A;  2G07 A;  4XA5 A;  1XO1 A;  2UVV A;  4UBB A;  1SL2 A;  4UB3 A;  3G6Y A;  2OHF A;  3NRW A;  3N7P D;  2HDO A;  3AUO A;  3KFU F;  5ALF A;  5HHI A;  4B9N A;  2KTQ A;  2NRV A;  4OCZ A;  2DL0 A;  4CDG A;  4Y2S A;  2ATL A;  9ICL A;  2JGA A;  2OYY A;  4K4H A;  2RDJ A;  2JH7 A;  3NVY A;  4IQW A;  3ZDA A;  1L7N A;  4EZ6 A;  1ZQM A;  8ICG A;  2GO7 A;  1S9F A;  4ELT A;  1QQ7 A;  5L1K A;  3PO4 A;  4Q8F A;  2UVR A;  3ZD9 A;  1WCN A;  5C0Y A;  8ICQ A;  2XI9 A;  4NLG A;  2V4R A;  4ED8 A;  4LZD A;  4QZC A;  2GH1 A;  4QZH A;  2HOI A;  3L5K A;  1B22 A;  4G3I A;  4RQ7 A;  3E58 A;  4DFJ A;  4J03 A;  3HIL A;  3E0F A;  4F4X A;  1ZQE A;  4P0Q B;  2JV3 A;  3NAS A;  4M47 A;  2D8C A;  5H2F U;  2G5I B;  5AM3 A;  2W9B A;  2H3V A;  2HHU A;  2W9C A;  4QIW C;  4QW8 A;  1RXV A;  2WF5 A;  3QUC A;  4KIT B;  3QUT A;  4KLH A;  3GFK B;  9ICN A;  2ES6 A;  5KFQ A;  2AQ4 A;  3RB0 A;  4ECY A;  1VLB A;  1NK0 A;  4PHD A;  4X5V A;  5EWF A;  5D49 A;  3SR6 A;  3SYZ A;  4KLE A;  2QB0 B;  1XSN A;  3NVZ A;  1Q8K A;  2AJQ A;  1J2M A;  5B5E U;  2A3V A;  3V7K A;  3OGU A;  4I2E A;  4U6P A;  4GLX A;  3IDW A;  3UMB A;  4G9B A;  2HHT A;  3Q8P B;  4F8R A;  1B43 A;  8ICE A;  4BXO B;  3QX7 A;  3F2B A;  1PUZ A;  3H0M B;  4PZN A;  1SWV A;  2BQR A;  1DK3 A;  3WKD A;  2R8G A;  3RRG A;  1BPE A;  1MC8 A;  4AP9 A;  1F44 A;  1KRP A;  4F72 A;  2E1E A;  1S97 A;  4ED0 A;  2RDI A;  4DFP A;  4ECV A;  4DLG A;  4R8U A;  4P0P A;  1YZ7 A;  1Z3E B;  3AM9 A;  3NUQ A;  2E5S A;  1N63 A;  2OCE A;  4CF4 A;  3GZF A;  2HBK A;  2C22 A;  1TE2 A;  3T5H A;  1ZYQ A;  4YXM A;  2LPE A;  3IN5 A;  3WK8 A;  1OXJ A;  1ZJM A;  2B6G A;  5HR6 A;  4ED3 A;  5KG4 A;  2OH2 A;  5KFD A;  2C2E A;  9ICG A;  4F4Y A;  2KD1 A;  4OD0 A;  1XNS A;  5AM1 A;  4C8K A;  1ZQG A;  2NRZ A;  2DGZ A;  2JEI A;  1N5X A;  1S5L U;  3AN1 A;  4KLG A;  2PXI A;  2HHS A;  3TKA A;  3V72 A;  4DSI A;  5AKX A;  1NJW A;  3M9N B;  1PK1 A;  3T5J A;  4YQW A;  2YMQ A;  2ZUB A;  3TAD C;  1ZRM A;  3ALR A;  3AU6 A;  5AHX A;  8ICT A;  9ICX A;  2KOB A;  3RR7 A;  2W7P A;  3TI0 A;  4R64 A;  1F5S A;  4QZG A;  4B9M A;  2PFO A;  4RNO A;  4PL2 A;  5J29 A;  1JI7 A;  4TQS A;  4IC9 A;  4PJ0 U;  5J8Y C;  5TIS U;  3CP8 A;  2E8O A;  9ICW A;  7ICQ A;  4DF4 A;  4UBC A;  4FZM A;  2ZIW B;  2BQU A;  3KZI U;  3IM1 A;  5HP4 A;  3N7S C;  3UXO A;  1KLN A;  1Z00 A;  1X2I A;  4JMU A;  3PX6 A;  2FMQ A;  1KW4 A;  3RB6 A;  2AU0 A;  9ICI A;  1GO3 F;  2KFN A;  2PI5 A;  4ED7 A;  1NK8 A;  3RB3 A;  3CW2 C;  2XY5 A;  3C2L A;  9ICR A;  3FDS A;  3PST A;  3QEB Z;  2AXT U;  3T5K A;  3BQT A;  4UB4 A;  2G0A A;  3SAF A;  5ALP A;  4GIB A;  5AKJ A;  5III A;  3PX0 A;  4NLZ A;  4RQ8 A;  2F3N A;  2IMW P;  1HJP A;  3H8W A;  2DKX A;  3F5A A;  2ZJ5 A;  2FMP A;  1WWU A;  1T3Q A;  2EAM A;  4CRX A;  4F5N A;  5AK6 A;  5AM2 A;  2YMM A;  1SL0 A;  1L7M A;  3QU7 A;  5ALZ A;  3SAG A;  4B6J A;  4QWC A;  5J2H A;  4DOC A;  1ZQX A;  3HT3 A;  1URJ A;  5HNK A;  2M0N A;  5G5H A;  1QQ5 A;  1P7D A;  2Y9T A;  3Q8S B;  3TFS A;  3D2N A;  2K4P A;  4O3P A;  2W9B B;  4M6W A;  4O3Q A;  5ALW A;  5TZV A;  4DFD A;  2W9C B;  4YD1 A;  3KHG A;  1ZQY A;  1SKS A;  5AIB A;  1RQL A;  4C7Z A;  2BCS A;  4I27 A;  4KLL A;  3GII A;  5KFU A;  2W11 A;  1ZQN A;  3ORY A;  2YQE A;  1VJ5 A;  4YP3 A;  4P4P A;  2KIC A;  3RJH A;  5DDM A;  5KFS A;  3BQ2 A;  1UCV A;  4ED1 A;  5FP0 A;  4UQG A;  7ICE A;  2ZUC A;  4GFJ A;  5AKL A;  4DQR A;  3RJI A;  2QKQ A;  1T7P A;  2MAX A;  1V85 A;  3WKB A;  3I28 A;  4UAR A;  4KLF A;  4C0Z A;  4I2B A;  3QUQ A;  4KN4 A;  4BGD A;  1COK A;  4RQ6 A;  3QUB A;  4I2J A;  4O0I A;  3T5L A;  1Q3V A;  3ZD8 A;  2D3D A;  1KEJ A;  3IV6 A;  5KFA A;  2F44 A;  4KLJ A;  2HBL A;  2YB1 A;  1ZJN A;  4O5E A;  4IQU A;  3PSF A;  4YG2 A;  4EBE A;  2ZTD A;  2W55 A;  3AMZ A;  4OJ6 A;  1ZQK A;  5KT5 A;  3PY8 A;  3ZI4 A;  2BPG A;  2AGP A;  1QSS A;  2P6U A;  4RQ0 A;  3ZDD A;  1T8E A;  1DOQ A;  4TUQ A;  3M9O B;  4RQ5 A;  5T14 A;  2R8H A;  1NKB A;  3HKZ F;  4YMO A;  8ICK A;  2VA8 A;  1TAQ A;  3PNC A;  3KOO A;  5ALE A;  4QIW F;  5L1J A;  5J8Y A;  1DGJ A;  4ECR A;  5AI0 A;  2PI4 A;  2XIC A;  4ZH4 A;  2HCF A;  3HX0 A;  5DLF A;  4RPX A;  1WUD A;  2VA3 A;  1Z4N A;  2EAP A;  4KLO A;  3OTQ A;  4EEY A;  5JTI A;  4QJF B;  4RU9 A;  2ZXI A;  5CHG A;  4RQ4 A;  1BNP A;  2N1R A;  3VCB A;  1A77 A;  2KE7 A;  4DSJ A;  4JV0 A;  3NVV A;  1NJZ A;  5J0X A;  2HSZ A;  4C4S A;  2W9M A;  4WJ3 B;  4OJO A;  5KFW A;  5KG1 A;  5J0R A;  3C28 A;  1SIJ A;  5DLG A;  2JRZ A;  4YMN A;  4DL4 A;  1Z1B A;  1N62 A;  3WKC A;  4PL1 A;  4QWB A;  5F9L A;  5AI9 A;  1QSY A;  3N4M B;  4DWI A;  1X6I A;  1NNL A;  3KZX A;  3GQC A;  3K1R B;  4C8M A;  5BOL A;  5KFJ A;  4DO9 A;  3BJY A;  9ICO A;  4PGX A;  2BDU A;  1PVP A;  2PFN A;  5DBB A;  4EYH B;  1ZQQ A;  3QU9 A;  2BPC A;  2WAQ C;  2OXO A;  2F77 X;  2QAR A;  4EX7 A;  9ICE A;  4Q45 A;  4DL6 A;  3UQ2 A;  1HUO A;  4CF5 A;  2ZJ8 A;  2ESE A;  8ICP A;  4IR1 A;  3LWM A;  2MU2 A;  3NRZ A;  3FYH A;  3BDP A;  5KFZ A;  4CNQ A;  5HML A;  3ZDE A;  1KKX A;  2HHX A;  2E1F A;  4MFF A;  1PVQ A;  4YR3 A;  2BR0 A;  2ISP A;  2G09 A;  4QW9 A;  1X6J A;  4Y2V A;  1ARO P;  4YFK A;  4Y2J A;  9ICA A;  2EAN A;  4R65 A;  4CGZ A;  4M6W B;  1K5O A;  2JZB A;  4RZR A;  1SB3 C;  5JUM A;  3HP6 A;  7ICI A;  4DOB A;  3L3F X;  3PV8 A;  1S0O A;  5KFK A;  3PML A;  1ZXI A;  2ISO A;  3MDC A;  3GDX A;  3BQ0 A;  4O3R A;  4GXJ A;  1MSW D;  4C8O A;  4J9S A;  2RP5 A;  1WYG A;  1NK5 A;  3BS7 A;  2ZIX A;  1H38 A;  1N48 A;  3JPS A;  4PHA A;  7ICL A;  5AK5 A;  3GIM A;  4JV2 A;  1BNO A;  4QNL A;  5ALH A;  3T3F A;  4UAW A;  1L8L A;  4NWI A;  3PW4 A;  1BPD A;  1X9M A;  4TUP A;  1L3U A;  4UB1 A;  2ASD A;  3T79 A;  2HVH A;  1JXL A;  2OM6 A;  4FZN A;  4JB3 A;  1VDV A;  2MUT A;  3F2D A;  5J0T A;  1CI4 A;  3BZK A;  2LKY A;  3ISC A;  2AQ0 A;  3BZC A;  2Q4T A;  8ICF A;  2KIW A;  5AM5 A;  3EPG A;  9ICP A;  3M9M B;  2K4H A;  2HVI A;  2OWO A;  3ETR A;  4KX3 A;  7ICN A;  4TQR A;  3EZ5 A;  2BDP A; 
#chains in the Genus database with same CATH homology
 2M0N A;  2VIX A;  3MGV A;  4FZL A;  3ICX A;  3M6K A;  2W7O A;  5A0L A;  4QIW F;  2E1F A;  4QIW C;  2H3F A;  3CYM A;  3M7D A;  3C29 A;  1PVQ A;  2KHQ A;  1P7D A;  1D8B A;  1HEK A;  3D2N A;  4P0P B;  2G08 A;  2ZXH A;  2XIC A;  4A8E A;  3N7R C;  2G09 A;  3ALR A;  1L6N A;  2KOB A;  3PZP A;  1IIP A;  3PSP A;  1WUD A;  1ECW A;  1PVR A;  2ZIU A;  2G06 A;  4BJQ A;  2KNJ A;  3ONN A;  3SAH A;  2W7P A;  3OPX A;  3AL0 B;  4OO1 J;  2H3I A;  2K8C B;  2MRL A;  1NZB A;  1XO0 A;  2HOF A;  3RF9 A;  4CGZ A;  1ED1 A;  2VJ5 A;  1DRG A;  4FE3 A;  2ZXI A;  2YB4 A;  5KL1 B;  4QJF B;  1MA7 A;  4PL2 A;  4BX9 C;  2KIC A;  3LVV A;  2R18 A;  3PSI A;  2ZIW A;  4IC9 A;  3L3F X;  2F8L A;  1HIW A;  1UPH A;  2F2A B;  2XID A;  2K8B B;  1T94 A;  3CP8 A;  3LVW A;  2N1R A;  3SMV A;  2G07 A;  2DQN B;  2Y0S F;  2Y0S C;  2ZG6 A;  1Z19 A;  3VCB A;  1ZQ1 C;  2NV3 A;  3F2C A;  2A3V A;  1SZH A;  3NRW A;  4FZM A;  4GFJ A;  4O3M A;  3DEE A;  2ZIW B;  4U6P A;  2Z7J A;  3GU3 A;  2RP5 A;  3D2S A;  2F76 X;  3LYS A;  2ZIX A;  3N7P D;  3KFU F;  4WJ3 B;  4OJO A;  2RHF A;  2XVT A;  4KX5 A;  1KBU A;  2JMG A;  3N7S C;  2CN1 A;  4ACO A;  3C28 A;  4OJL A;  2HMX A;  4C0Z A;  2W03 A;  1Z1B A;  2K4I A;  3F53 A;  4CDG A;  4JMU A;  3H0L B;  5CRX A;  2WB1 C;  2WB1 F;  4PL1 A;  2H3Q A;  2VJ4 A;  3F2B A;  2LYB A;  2ZIU B;  3H0M B;  2ZIX B;  1GO3 F;  4QNL A;  1Q3V A;  2CPR A;  3O0F A;  3SQI A;  2JGA A;  2OYY A;  2DF4 B;  2JH7 A;  3IG8 A;  4NWI A;  3F5E A;  3PST A;  2LBO A;  1OUQ A;  4OJP A;  4NV0 A;  2YX8 A;  1YT3 A;  1F44 A;  1CRX A;  3AQF A;  2E1E A;  2KVC A;  2G0A A;  3SAF A;  1TAM A;  3KZX A;  2KKV A;  3IG5 A;  2HOQ A;  2CRX A;  4AYB F;  3H0R B;  4AYB C;  3K1Z A;  3HKZ C;  2KHV A;  4P0P A;  5C0Y A;  2HBL A;  2KJ5 A;  2YB1 A;  2PMZ C;  2PMZ F;  2XI9 A;  4ICA A;  2OM6 A;  4FZN A;  3T79 A;  4KMO B;  2KKP A;  5HR7 A;  2BDU A;  2KJ9 A;  2E5S A;  2ZIV A;  3NUQ A;  1PVP A;  2GH1 A;  2KV2 A;  3GZF A;  2KEY A;  2K4E A;  3PSF A;  2G5H B;  3F2D A;  4P0Q A;  2HBK A;  2JH1 A;  2HOI A;  3F5A A;  3IP4 B;  3AQE A;  2HBM A;  2HBJ A;  2D6F C;  2MA1 A;  4CRX A;  2K89 A;  4OJ6 A;  2WAQ C;  2K8A A;  2LYA A;  2WAQ F;  2OXO A;  2LKY A;  3IN5 A;  1A6S A;  2ZIV B;  2W04 A;  2F77 X;  5HR6 A;  2Q4T A;  4BUG A;  3E0F A;  2KIW A;  2KJ8 A;  4P0Q B;  2OH2 A;  3RFA A;  3VC8 A;  2KD1 A;  2LHT A;  3SAG A;  2RRD A;  2H3Z A;  5T14 A;  2GOL A;  1XNS A;  2VKQ A;  1A0P A;  2K4H A;  3M6Z A;  4NLC A;  2G5I B;  3HKZ F;  4OJ5 A;  4NLB A;  2DGZ A;  5KL8 B;  4U7C A;  2H3V A;  3D2Q A;  4KX3 A;  1Q3U A;  1URJ A;  3CRX A;  2JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...