2NO5A

Crystal structure analysis of a dehalogenase with intermediate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
224
Chain Sequence
b'LVDSLRACVFAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-2-haloacid dehalogenase IVA
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Hydrolase
total genus 88
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no5A01
5A3RA 4KNVA 4JB3A 3QUTA 2R8XA 3ET5A 3AR4A 2C88A 2AMYA 3QYPA 2HF7A 3E81A 2G06A 2HO4A 3WKAA 4HAIA 3OCVA 1RRCA 5IT4A 1O08A 2MU2A 4OCZA 4RETA 1QQ6A 3FPSA 2HCFA 4UASA 3OCYA 3N07A 3L8HA 1Z4IA 2JAWA 2JARA 2I6XA 3MN1A 4ZEWA 3DDHA 2R8ZA 4UM5A 4Y2UA 2OA0A 4YCLA 3NASA 3KD3A 4UAVA 3KZXA 4HGOA 2ZOSA 4F71A 3AR7A 1T9ZA 2B1RA 3DAOA 5AKJA 2C8LA 2EATA 3F9RA 3DV9A 3NAMA 3PGLA 3QUBA 3OCXA 5ALGA 5AVVA 1J97A 4IG4A 4YCMA 3QU7A 3R4CA 5AK3A 3QNMA 3N1UA 1Q92A 3K1ZA 5AW7A 1RMTA 3UM9A 4G9BA 4EX6A 3EWIA 5AESA 3U7HB 4FYPA 3U26A 5ALMA 3PGVA 4AS2A 1YJ5A 1S8OA 2C8KA 5AW0A 2PR7A 5ALDA 5IT0A 4L6CA 2I55A 4DFDA 5AVQA 1YNSA 3SD7A 3WK4A 3N8GA 3ZX5A 2GMWA 3KOOA 3MMZA 3WGVA 2B8EA 2HHLA 3D6JA 2GHQA 3ZUPA 4UU1A 1TE2A 1YMQA 5AW2A 3CZ4A 3L8GA 3ZW7A 2YMLA 2ODAA 1PW5A 2HOQA 2WF5A 2AUTA 5AKEA 3P96A 1Z5UA 3ONNA 2G1AA 1Z4KA 1SWWA 1NRWA 2Q5EA 4UW9A 1QH9A 1U7PA 3NUQA 3SF0A 4EX7A 4EZEA 2YY6A 3FPBA 4BX2A 1Z4PX 5AI4A 2R8EA 1RMYA 2B0CA 3ED5A 4EEKA 3NALA 4J2TA 4Y2VA 2IOFK 4QJBA 1XVIA 2HI0A 2EARA 4I9GA 1ZD4A 3A1EA 3FGOA 5AM0A 1TJ5A 4OHFA 3A1CA 5A3SA 3R09A 1ZJJA 2QYHA 3W5BA 2W11A 1L7NA 1ZOLA 3KBBA 2YN4A 1WR8A 2WHEA 3WK7A 5AVYA 2FEAA 3I76A 2YFYA 3HLTA 4AP9A 3OCWA 5ALFA 3OPXA 3WKEA 4EELA 1EK1A 2I7DA 4UMDA 5ALRA 2YJ6A 1QQ7A 2FI1A 5ALUA 5AI0A 2Q4TA 3WK8A 3OCUA 2HSZA 5AW8A 3RF6A 2IOFA 2IOHA 1TJ3A 4RESA 2WFAA 2OM6A 3SMVA 1L6RA 3A1DA 2CN1A 2ZBEA 1VFPA 2VKQA 4XQ0A 3QU2A 1Z5GA 3E84A 3NANA 3FZQA 5AIBA 3ZTYA 4DCCA 1Z4NA 4KX3A 1L8LA 4E88A 2ZXEA 3WK9A 5AW9A 1ZRNA 1WVIA 3B8EA 2WM8A 4NAVA 2GO7A 4J03A 2RAVA 3RFUA 5AKZA 4CF5A 1YDFA 3CNHA 4KX5A 2FPWA 2ZG6A 4OD0A 3TLMA 4BEWA 2W43A 1RKQA 4H1WA 1NNLA 5AI9A 2RARA 4BNDA 5AI5A 3SHQA 2P27A 3QX7A 3KDPA 4BX3A 1ZD3A 1XPJA 2FUEA 4UAUA 3N5KA 4XE5A 3AR5A 4PNHA 5ALEA 1RMQA 1Z4QA 3ZVNA 3W5CA 2JGAA 4YH1A 2YMMA 1SWVA 2X4DA 5JJBA 5AK5A 5ALLA 5T41A 5AKXA 2NO4A 4HGQA 2P11A 3L1VA 5ALYA 3L8FA 3UMGA 5AI6A 5AICA 4EENA 4GIBA 5AK4A 2C9MA 4HYTA 3WKBA 4DWOA 3PDWA 3N28A 2IYEA 5ALPA 1LVHA 5AW3A 3QLEA 4F72A 3WK6A 1EK2A 2B30A 3ZWDA 4HGNA 3E8MA 5AVXA 4YCNA 1FEZA 2FPRA 3WK5A 3DNPA 3QGMA 5ALHA 2O9JA 2YJ5A 1RQLA 2P9JA 2WF7A 3ZVLA 3OTQA 2ZBFA 1RDFA 1WPGA 2FPUA 2RB5A 3M1YA 3W5AA 1TJ4A 2HEGA 3FVVA 3IRUA 5AVWA 3EPRA 4YIKA 1L7PA 5AVTA 4KN8A 2FPSA 5IS2A 3IJ5A 2MSNA 4I9FA 4YGYA 3OCZA 2EAUA 1N9KA 2D2VA 3M9LA 3GYGA 3MPOA 3U19A 2NO5A 5FP0A 4XOUA 1Z88A 3QXGA 1Z4MA 3AR8A 1LTQA 5AW4A 2G0AA 1K1EA 3ZI4A 5AHXA 2FPXA 1T5SA 4UMFA 2JAUA 4L57A 3L5KA 1U2TA 1X42A 4DW8A 5AM3A 4UARA 2GFHA 3E58A 3AR6A 4KYTA 3QU4A 4NABA 2YBDA 4B6JA 3U7FB 5AM1A 4MWOA 2QLTA 2C4NA 1U7OA 1RLMA 2NYVA 2CFTA 2PQ0A 1ZRMA 5AKHA 4CNQA 3PCTA 1JUDA 4C4TA 5ALIA 3VAYA 5ALJA 2I33A 3I28A 5AKLA 5AKKA 2RBKA 4C4RA 4UMVA 4NWIA 3QU9A 2G08A 2HDOA 1RC8A 1L7OA 4FFDA 1U02A 2HX1A 5ALXA 5A3QA 2BDUA 1IWOA 1O03A 2B1QA 2P69A 3A3YA 5AK6A 3EF1A 2FUCA 4BEVA 1CQZA 5AVZA 1S2OA 5E0OA 2IA5A 4UMEA 2GHTA 3AR9A 5AIAA 3ZU6A 5AKGA 4CF3A 5AVUA 1F5SA 2FDRA 2YMQA 4IFTA 3WKDA 4FE3A 1ZD2P 3ZVMA 1NF2A 4YIHA 2B82A 4ZEXA 4ZEVA 4JDPA 5AM2A 4MUMA 4BKMA 4G63A 1U2SA 3L0BA 4UM7A 4CE6A 1ZD5A 4NV0A 3SLRA 5AI8A 1WZCA 5ALQA 5AW5A 4Y2XA 4Y2TA 4NFLA 5ALNA 1Y8AA 3B9BA 2OYCA 2G09A 4OFZA 1Z4JA 1J8DA 1TA0A 1RLOA 2R8YA 2I54A 1L7MA 2ZBGA 3U7EB 1RLTA 2I34A 3SKYA 4Y2RA 5ALKA 1CR6A 4C4SA 1VJRA 3L1UA 1L8OA 2WF8A 4BX0A 3I1YA 5AM4A 1RKUA 4Y2YA 4UU0A 3L0CA 3U7GA 3MC1A 2B8JA 5ALVA 3I6BA 3S6JA 4BNDB 5AVSA 3NRJA 5ALSA 3SKXA 1RKVA 3W5DA 4L6AA 2G07A 3IB6A 3UMBA 3ESQA 1RQNA 3ZTWA 4BYGA 3QUCA 2W4MA 3ZWKA 5AKIA 1SU4A 2G80A 2AH5A 4XPZA 2HF2A 1YS9A 4O8CA 2JAOA 1MH9A 1VJ5A 5AVRA 2PKEA 1KYTA 2CFSA 4AS3A 3R9KA 1N8NA 2YJ4A 3L7YA 4QQFA 4KNWA 3WKCA 3BWVA 3BA6A 3WGUA 1Q91A 3ZX4A 3NIWA 5ALTA 5AW6A 1Z4OA 2YMPA 1XP5A 2MU1A 1ZS9A 3ET4A 3U13A 3KC2A 3UMCA 2WF9A 3EF0A 3HYCA 4GXTA 1T5TA 3AR3A 2OBBA 4Y2PA 5ALZA 3AR2A 3ESRA 2CFRA 4Y2JA 2BDEA 2Q4RA 3L0YA 1RPZA 5AKYA 5AM5A 4BBJA 4UATA 4Y2SA 2DQSA 2WF6A 3B9RA 1QYIA 1YV9A 4HGPA 1Z4LA 3J7TA 3FM9A 2ZBDA 2BY4A 4HGRA 2O2XA 1QQ5A 4CF4A 2YJ3A 4Y3UA 3QUQA 3L8EA 3QU5A 5AW1A 4Y2QA 1AQ6A 5ALOA 5ALWA 2AGVA
chains in the Genus database with same CATH superfamily
1JIJA 1KJIA 3D0OA 1YXMA 2XE4A 1LPPA 2LRHA 4KVFA 2RKWA 2G06A 1ZGGA 4KO8A 2VAXA 3LC7O 4RWEA 2GN8A 3RRMA 2YBEA 4QKQA 4O2BF 4JJAA 4FJ0A 4TUYB 3H0RB 3F9RA 5ALGA 1GGEA 1AXRA 2QZZA 2P8JA 2QT9A 3VSEA 1KEKA 3M83A 2CXQA 3EEFA 1E5DA 1DJPA 1TTPB 3PV0A 2WBLC 1HE1C 2KVSA 1AKTA 1TI7A 5AW2A 4R6XA 3ZDXB 4TKVB 4RHXA 3JALB 4E7OA 4C14A 5M7EA 4B6RA 1DJOA 5SY4A 4P4UA 1ZUHA 1UC5B 5GJWC 1GIAA 1FRNA 2CL6X 4E2YA 5IW8A 3U39A 2AJBA 4BV9A 4DIUA 3QENA 4M7RA 2IXEA 5I9TA 4M0KA 4NMHA 1OBOA 3M1IA 5C51B 3LQ1A 1TC1A 2QVYX 3W8RA 2I1WA 2ZYHA 2GLUA 4P4GA 2B34A 3I8XA 1J70A 1DELA 1NNLA 3S70A 3AB8A 5EWJA 3M6ZA 5HR6A 5FULA 1QCKA 5CX1B 1U94A 4ZT4A 4BIIA 3UK7A 1ISIA 1DJNA 3S5JA 3QPDA 1Y7IA 2X5OA 4LHSA 4V0SA 4UUOA 1IBCA 1AKRA 4CF6A 4LCEA 3PX2A 1II0A 4NCKA 1P29A 1RSZA 5JJBA 1GPWB 4EF4A 1X38A 3IQEA 3VHRA 1P4RA 3ZV7A 1BG6A 1XQ1A 4BN5A 2OC9A 3HY4A 4HMOA 2R48A 9ICUA 2DR0A 1NONA 3KV1A 5KFBA 4CN9A 1QP4A 3VDMA 3DLIA 1OV6A 3IP1A 4LYJA 2YRXA 1Z3CA 2IP2A 1Z56C 5K3CA 1N9KA 3RYHB 4IIEA 3SS7X 1QYDA 1E0AA 1C4KA 3OQIA 1D2MA 1Y8QA 2CVQA 3QXGA 4K3VA 3F6SA 2PIAA 5CVDA 1TAQA 4GE3A 2GHIA 3OHAA 4MVCA 3MTEA 5HZGA 1G5PA 1IDN1 2R97A 1E6KA 4WKNA 4YMTA 3MT8A 1Y33E 3OHMA 3DZJA 3ORYA 2WIKA 4JJEA 1F6DA 2JLCA 4OYYA 4RZSA 1YACA 2XA2A 2BQ3A 3D6HA 4RY0A 1IWOA 1R9MA 1GFZA 1IBKB 1EFUA 4MP3A 5SV2A 3NV9A 2XBMA 5A1JA 4XPIB 9ICHA 3NTOA 3UJAA 3TPFA 2JLSA 3EIEA 3F9IA 1QHXA 1E1RD 1NVEA 1ZSVA 5THKA 2PZAA 1KKLA 3H3XA 4P2BA 2R1UA 2R2GA 4Z99A 3VU9A 2BGIA 1WCXA 4Q6BA 1TU4A 2L69A 1TVCA 3CYFA 4G9EA 3IQZA 3I6BA 4JBIA 5GONB 3TLAA 1RKVA 3AF0A 3PDIA 2HK6A 4XVRA 3TNFA 2Q29A 5EAIA 4TWAA 5A0LA 4D0GA 7ICTA 3LHSA 1XTSA 1XF9A 4C3UA 4JT4A 3QVOA 4CQNA 5KFVA 4ENUA 1ZOIA 2WM2A 4KODA 1W30A 4BVFA 4HNUA 1SXPA 1E7RA 4J8PA 3WP0A 1DO8A 2FPMA 3JQ9C 4LI0A 4INAA 1AY0A 3CISA 4QRIA 3QVKA 1WDMA 5ALTA 3GVIA 1QE0A 4BNTA 4WEQA 2YMPA 4RTKA 5KT2A 4YJDA 2BZSA 1UKVY 4GEGA 3WWZA 3K8ZA 7ABPA 5HKOA 1U5BA 1MH1A 4RU1A 2GZ3A 2DR3A 5IVKA 3E8XA 1X1BA 4Q82A 5IXSA 2HJSA 1K8RA 3RSGA 2XMZA 3J81A 2WTFA 1QYIA 4W8OA 3X1XA 2V7QD 2PS1A 2H5EA 3SJCA 4EOGA 2C3YA 3PJEA 2Y9PB 1F4LA 4ZT2A 2VFAA 3QYPA 3RS7A 4RT2A 2QTRA 3K0EA 4RABA 4W1SA 1K8ZB 2KJ8A 2JARA 3ZD6A 1BWSA 1ZQKA 1NIJA 3NOXA 2ORWA 4TTPA 3VQTA 1KQOA 4Z53A 4G26A 1BVRA 1M7GA 1XRLA 3EG9A 1SB3C 3D64A 1S97A 1Q92A 4Z54A 2GWRA 1ORIA 4Y8VA 1HDZA 3MQ2A 4WAUA 4RZXA 4QVIA 4U2CA 4UNQA 3AF3A 2E8PA 2NG1A 3PFIA 1V1JA 2O7NA 3O2QB 1C5KA 4HDOB 5GTDA 3ZHRA 4TMFA 1PD0A 3AQ4A 1IBRA 3WGLA 1WMBA 4ER3A 3BWBA 3QW2A 4IIXA 3U2QA 4LZDA 4YQFA 2DGZA 3H8WA 3ZHQA 1N2BA 1FZTA 7AT1A 4PZUA 2TMKA 1QBKC 1C4OA 3EFOA 2X0FA 1Q44A 1IXRC 2E8OA 3BZCA 2FAXA 3BMNA 4YD2A 1NW7A 5B37A 4FZMA 3PIDA 5B1YA 4FQ8A 5EG5A 4P4OA 5DBCA 4WT7A 4JROA 5EWEA 1TZMA 2LCQA 4JU9A 3HO1A 1HETA 4Z6EA 3FPFA 5BUQA 4MTCA 1IK6A 4JJIA 1WCNA 5J1SB 1PV4A 3GGPA 2X9VA 4GMKA 1N57A 3HXLA 4NS4A 3TIIA 4UVDA 3S27A 3EX7C 4Q7KA 5JNWA 3GVPA 2HIHA 3RR7A 3KOYA 3C8MA 1UDBA 2QJWA 5H3LA 2XMSA 3KO8A 4IZHA 1LFDB 1DZ3A 1G63A 3MAJA 2A1IA 2W2KA 3SQLA 3Q10A 2BFWA 2YVLA 1VE9A 1PR9A 2FX2A 3ACDA 1QIKA 2RBGA 2G1UA 3OTQA 5ES4B 2VG8A 1NN5A 3PNLA 3NETA 3GFKB 1SGWA 3VH2A 4TS3A 5CJJA 2C0QA 1N3YA 1N60A 1TQHA 1DHRA 1WKCA 4P4LA 2W8ZA 1J00A 4XVQA 2A8YA 5HMLA 2QPLA 3DKIA 3N70A 3NOQA 3MUNA 4R2IA 3F4KA 3DGEC 2OKGA 2GFQA 1N0VC 2AFHE 3SYLA 4L57A 4TS9A 5I01A 5EQTA 1NK5A 4ZZIA 5DB6A 3GPIA 2FW0A 3HJCA 4WIAA 2O8EB 1T5OA 2YL2A 3I0MA 3GD7A 3EZLA 3ACCA 4MB6A 4FFBA 4XDHA 2IYZA 1H93A 3H0MB 4X1OA 4PINA 5C7YA 1UXIA 2JJ2A 1SG9A 1XMVA 3L4KA 4RQTA 1IWBB 2LR0A 3U40A 3M9WA 2J5KA 1YQUA 2E6KA 4QBTA 1DUSA 3VR4H 1CUVA 4ONEA 3KJQA 3OX1A 3UOAB 7ICSA 2PD4A 5CFPA 3FOBA 3TD2A 4JI1B 5F9LA 1SRRA 1ADBA 4KPYA 1FRZA 4C7JA 3F3YA 2EXXA 3G13A 5IZCC 3OKPA 2KJ5A 2WHPA 4OHMA 3HYRA 1SZPA 1H4QA 1C14A 4AMVA 3KVOA 4AF8A 3F8TA 1XRSB 2JFQA 3TOCA 1HZZA 1Y3AA 4IRCA 2XR1A 5EKDA 3T3GA 4GZ3A 2CZCA 2YNMD 3MR6A 1JYFA 1QSGA 4QGFA 4R1OA 3H05A 2COEA 3IP5A 4JI6B 2SICE 1IHOA 5FD8A 1GPDG 4IJWA 4CIXA 4MLDA 4FMCF 2Q2QA 1U3DA 1B8UA 2AC2A 4YYZA 1N62A 4Y2PA 3QBVA 5L3ZA 4RVHA 4OPMA 5LDGA 3TCNA 1I9CA 5FTWA 2EAMA 1O96B 4Z0HO 1SA0B 2OB2A 2JXJA 1I3OA 1JLLB 2E5SA 1YDGA 4JUFA 4B3CA 4KNVA 1U7WA 2BW0A 4I1VA 2O14A 2GK3A 1B0PA 2BUBA 5FNVB 1YVPA 4NZMA 2IFTA 5AVOA 2QX7A 2X41A 4B7ZA 2YUIA 3HO8A 2R6DA 1RJ9B 1KEZA 4GC5A 4MX8A 4DL2A 2BGTA 4TMTA 4DC1A 4BX9C 2FQYA 3BSFA 3T0IA 1H2RS 3QU7A 3NWBA 5CGZA 3VUFA 3I1JA 2J1LA 1QDEA 2LVBA 1JEYA 2C8KA 2J4CA 1BS2A 4B6GA 5IT0A 3PFNA 3LA8A 4C6RA 4CL0A 3VSBA 5A02A 3T99A 2TSYB 3G82C 1I2MA 2ISQA 1Z4KA 4QGHA 4IX1A 2EZYA 3FPBA 1A5SB 3C5WP 2W37A 3TFRA 1WDLA 2WTEA 1W35A 1KJQA 1FJXA 4F3TA 3IMCA 3USZA 1KORA 5IK2D 4MI9A 1OGIA 5AMXA 4MJ7A 1ZNZA 2FWIA 4S3MA 2P78A 2PLFA 1NVVQ 1NVFA 3FNBA 4JT8A 3SQIA 1BAPA 4KMOA 2RHLA 3WWDA 3ML1A 4DSUA 3R3JA 2VYCA 4P08A 1XGKA 2Y4NA 2E0IA 2BHRA 5DMXA 4K6HA 3MEQA 5HG0A 1CY0A 4XQ0A 5AIBA 2EP8A 1BWPA 1VE6A 2QXUA 1YUNA 4DL5A 1K5HA 3T9BA 5CA0A 3RJ5A 1RACA 4RV9A 3PE4A 4PPGA 2G5GX 1R16A 4DS5A 1MX3A 4OMUA 1Y80A 2FSGA 1C0KA 4ZVNA 4DUGA 1DJQA 4QARA 3GOQA 2C0CA 4I29A 2HSWA 2JHAA 2B9VA 4IJMA 5HRUA 4FC7A 3GB9A 2BHTA 1GTG1 4ITVA 4GXNA 2ZIXA 4DIMA 1NUUA 4Q21A 4V0LA 4LHZA 3R0QA 1I0IA 3AERA 3UXYA 5I9IA 2FPUA 3CW2A 1GY8A 2H2WA 3O90A 1G2QA 4ZO4A 1QLWA 5JNUA 2G36A 2HPHA 4PQGA 3IAXA 3AOEC 3MINB 3AMVA 5KL8B 2F8MA 3GC6A 1OTXA 4BRZA 4IHQA 4C0KA 4MQMA 5T8KC 4WRRA 4UMFA 5CG1A 2YC2C 1AF7A 4EF5A 3WHLA 5AP9A 1QV7A 4CMGA 2NYVA 3GEGA 1JGTA 4TUPA 1B43A 3LXMA 1RP7A 5G1PA 3V4OA 3SYZA 1RQPA 3QMPA 1SIWA 1Q7BA 4BE7B 4D7AA 3BFJA 1N2XA 3NP9A 2HLDA 2GCOB 3DFMA 3OZSA 3DAGA 1UJCA 3PUIA 2JATA 1QSSA 3EA4A 4P0PA 4AO8A 3JQ6A 4FE3A 3GLSA 4ER6A 2IPAB 1NF2A 3ZXYA 2IU3A 4MGKR 4N0EA 5G4KA 1VCMA 5AOBA 3GU3A 4D4IA 3E1SA 3S40A 4YI5A 4LGMA 1TF7A 1G3RA 4MV3A 4MEXA 3NS1A 2JFVA 1EVQA 5FFFA 4O8ZA 3I4LA 3S44A 4NESA 1H85A 4J49A 1I0ZA 4WCDA 3RTVA 3EXHC 4KMSA 1IH8A 3A4NA 4MK4A 2B8JA 3LSTA 4O4IA 1CZHA 4HH4A 1GG5A 2RGXA 3IX7A 1R27A 3CE6A 4ZDKA 1SCQA 4X6YA 1M10A 3TIGA 3L0OA 1VJ5A 3OURA 3MJVA 5LNK1 1NZFA 3W5HA 5J0XA 4OBXA 8ADHA 2C99A 2VP6A 1NU6A 1Y5MA 4J9VA 2XCUA 3T1NA 9ICXA 4I3GA 3ZK9A 1A7JA 4LXUA 4H7HA 4B9AA 1TD9A 2AX4A 3FB4A 3HVRA 5NULA 1DXHA 1NDHA 3ODGA 2NAPA 1X66A 1T7PA 2IIVA 3LW8A 3FM9A 2CYBA 2IVFA 1TK9A 2Q62A 4XVCA 4PTYA 2W6MA 1VHLA 4M2YA 1OOEA 3RYIA 1V3UA 3PUWA 4IMIB 2VS1A 4MS1B 3AONB 1GV0A 3FAZA 1LKYB 3PEUA 3I2IA 4G5SA 4Y2UA 1J07A 4O0MA 4E11A 3NASA 4HH1A 3R3VA 4OY3A 4AQYB 2JK0A 2BKLA 5C0YA 4DIOA 2EATA 4N1AA 4C08A 1RCFA 3FTDA 2WUDA 1MXFA 4JYCA 1NJWA 4LVNA 4OHCA 5LR6A 3K05A 3U60B 3ITDA 1ULHA 1CUJA 4G09A 1FFVA 1GL3A 3UXMA 1YTUA 2GKGA 3HU3A 4MKZA 1WSDA 2Z0MA 1DWPA 1J2YA 1LY1A 2ZP1A 4O3RA 1RHJA 3SR6A 2PKXA 1TT5A 2FVYA 1D7AA 3K9LA 1EX9A 4AN4A 2V98A 3JWJA 1WCIB 2FLLA 4F2PA 4FD3A 1G60A 3JWGA 1X0XA 1QUEA 5DHQA 4OREX 2PMWB 4M4SA 2IEDA 4I28A 4F6RA 2M6LA 5TQ2B 3GPLA 4M88A 4RIGA 5J2TF 4YMOA 1OU4A 1SBTA 2B78A 1XA3A 2Y68A 4E1VA 1KFJB 2ERXA 4G2TA 4F3KA 1ZMBA 3R7AA 2CRXA 1SZDA 1HGXA 2QUKA 2H2FA 3UMYA 4I5GA 4DV7B 4OQEA 4GP6A 1GQQA 2WQ7A 3TR0A 4F5EA 2YV2A 2Z4SA 3C3XA 1IVSA 3K1AA 1A9XB 5COAA 4CV2A 4JITA 1NZJA 1PLJA 1Z0KA 3ELBA 3DDCA 3KXPA 3DZGA 4IQTA 4IRDA 3IUSA 3GCWA 3FDSA 4PWZA 1AKWA 4BU1A 3GLGA 3J80A 4M9RA 3VZRA 4TTSA 3SX2A 4MGYR 1SC1A 3AKYA 5DYGA 2VTVA 3DEEA 5AXBA 5BWNA 1NF8A 3DXYA 4KYIB 4DOMA 3A9WA 3DVQX 1W6UA 4MGHA 2H3HA 1WQ4A 4HJRA 1NN3A 2EX4A 2YR0A 2DCUA 4Z4HA 3CLTC 1FDWA 2BQRA 5KYWB 3O8LA 3W6ZA 4WH0A 4OJOA 2X0KA 2DKXA 4EZIA 1JEQA 4PCVA 4FFOA 5B57C 5DFAA 3LT0A 4EA9A 4IJVA 1V4VA 4WXRA 3EXG2 1T0PA 2W04A 2AZXA 1JUDA 2OG2A 4XSHA 3SYKA 4ZJZA 3VR0A 2VTBA 1FQKA 4IVQA 2Y3IA 1U98A 4F4JA 2W7TA 2AT1A 1T6YA 3PXBA 1HYQA 4D96A 1OAOA 2GHTA 3TW8B 4CMCA 2XRFA 4KLUA 3U9SA 2C84A 2XT0A 2D0DA 1UPFA 1WF3A 4PFJA 5JS6A 5HFAA 2G70A 4HNRA 1J9ZA 2NQTA 4OFZA 3O8OA 3Q8PB 4HFRA 1GPNA 3RFVA 3AVTA 3G5LA 1KMHA 3GJ5A 4CVNA 1B0UA 4D4KA 4KBGA 2YFKA 1SCJA 1ODJA 2JKZA 5LZ7A 2LGJA 3DOJA 5PNTA 1OZ0A 1CR6A 3VO8A 1IPEA 2PZLA 3F1KA 9MHTA 3M4XA 1GRCA 3TJZA 2BFDA 1KEWA 4XUGB 1YGPA 3KYJB 1JG6A 2RC5A 4EVIA 2GNOA 1X2BA 4IDHA 2QD1A 1PYGA 2OLEA 2OXFA 3VO2A 1HRDA 2VI5A 1NPYA 4F5ZA 3KSMA 3PW2A 4YC7A 3PJFA 3SM9A 4PX5A 5I5EA 3U3JA 2OUKA 1RTTA 3GPBA 3A1TA 5HOEA 4WI1A 3FSGA 4M8IA 1YMVA 4R9NA 2VUUA 1KQNA 1RYYA 1LBHA 2O7VA 4MA4A 3LT2A 1DBWA 5K3SA 1SUEA 3MGVA 3EQ9A 4M53A 3CU5A 1PZMA 3N2YA 5JNTA 4M47A 3TLYA 3KSRA 2VPZA 4TL9A 4JAVC 4IDFA 5FDFA 1W25A 2DRIA 3K6JA 4NBKA 4ZQEA 3T3OA 1BHQ1 1DARA 4U8GA 9ICQA 4LOJA 3WDSA 3EBOA 3PNVA 4H1VA 3U1TA 2KEYA 1K06A 2RBEA 3VR5D 2V55B 5B4VA 2UZAA 1TEHA 3BHJA 5J2BA 3MT7A 4V03A 3WRYA 4PGHA 4YT5A 5L6MB 1RAEA 5TMDA 1P0FA 1PV1A 1SXJA 4CEJB 3WK4A 2W6ZA 4ZT5A 4KLQA 3UH0A 2REXB 1BFUA 2BPOA 2ZXHA 4QT0A 5ENZA 1ZGCA 2IZ5A 1QDUA 2WAQC 4Q05A 5T4FA 1UEJA 1N8KA 4MO2A 5EIOA 2GEBA 4CT0A 4GPAA 1NKVA 5B2ZA 1RYSA 4J9LA 4PZAA 2GJKA 8ICFA 1N7IA 1ZJJA 3O9VA 3TUIC 2FPIA 5IF9A 4M9NA 4BO8A 3EVBA 5BT8A 2GEFA 3F7MA 3N75A 1IQRA 4BCDA 2PU7A 1J4AA 5FV4A 4KLFA 1R88A 2QAGB 2DE0X 1Z6QA 4IHJB 2YICA 2KW5A 1W19A 4BJ1A 2QN3A 2ETXA 6GPBA 3W6PA 2ZRPA 4JJFA 5L3SA 1VMEA 2DECA 4MULA 1ND6A 2YOGA 4MVJM 3RARA 1I4LD 2OV1A 2BD0A 1MLDA 3W2IA 4F45A 2Q7XA 1Q1NA 4Z7QB 1NI4B 3DLPX 1DDGA 5ALLA 3DHVA 3M5PA 3CH7A 2OPHA 4OSPA 1OLUB 2CZGA 2J9FB 3KHKA 1LVHA 3FUTA 3VI4B 1RBYA 1H0KA 2CLSA 5F7ZA 3M7DA 4EG4A 2C2YA 3HCNA 1TM7E 4EABA 3O21A 2C3MA 1QB7A 3FCAA 2ZAOA 2BH2A 2KTQA 1Z00B 2IK8A 4MWZA 4NZ9A 3E4CA 3OOWA 1MQ2A 3H9BA 3CZPA 4G41A 1IQPA 2UVRA 2FPKA 4B4VA 2WU4A 3RAGA 1NJGA 2AXPA 4BUZA 3EMVA 5DB8A 1HL3A 3ZS9A 2FE9A 1UIRA 1VLVA 4M3NA 1U0RA 3ZJ4A 4D9MA 5EIEA 3RASA 3D2BA 4FKBA 5ALJA 4ARCA 4TROA 4UHEA 5AKLA 5LZ8A 2WIJA 4ZOCA 3IG8A 2G8NA 3EGDA 2BV3A 2AJLI 2I6UA 1PFQA 3VV2A 3BC1A 2RHFA 3FGZA 2XADA 5HW0A 5DX1A 2IA5A 3D4LA 3AUFA 4FBUA 2J6IA 4UBBA 4B8ZA 3OZRA 3EUWA 1KFDA 4ZC1A 4LYGA 2GESA 3UKJA 1JJ7A 3GFSA 4D44A 4RNOA 5DG9A 3A6DA 3DJYA 1THZA 3AL0B 4DQSA 3TAHA 1LF5A 4PNEA 4G5OA 5BSFA 4IF4A 3DBLA 4QO7A 1ZG3A 2P65A 1JLRA 1ZM2A 2I03A 4M1WA 3I1YA 4UREA 2ODBA 1FF9A 4FWIB 1GGKA 1ZGZA 5KCZA 4HL6A 4DQ0A 4PGGA 9ICCA 4EW2A 2NU9B 3SAFA 4ZHQA 4FHEA 5J2AA 1MOZA 1RD4A 3WKCA 4Q9IA 1N56A 1X6JA 2JGFA 1K2WA 4W82A 3Q41A 4MQEA 2HHVA 2PS0A 2ZB2A 3HNOA 2DBZA 3VBCA 1PHRA 5CR0A 5JY6A 3UC9A 3OZIA 3WBFA 4D8VA 1KETA 1ZOPA 1HMPA 2I1LA 3GEIA 3U9LA 4PN3A 3IVAA 1RRGA 3GUCA 4KPUA 5TGDA 2GZDA 1YZTA 2JJMA 3IPLA 3D2SA 1PR5A 1QKIA 4KSBA 2HO4A 5JJCA 1GNLA 2AR9A 4DXAA 1DSSG 3QHAA 3PC8A 4A6DA 4O3OA 2OA0A 2X40A 4DLZA 4S1PA 3IG5A 3GVCA 2I99A 4XCVA 7ICPA 2Z83A 4KB5A 1T5BA 2VZEA 5JMWA 3UATA 3QYFA 4S1VA 4ESVA 3IE0A 4GOMD 3G7UA 5AHOA 5F64A 1EGMB 5JTUA 4TXNA 3HA3A 2ISPA 1W2HA 3DBHB 4WKCA 5EHIA 3RWBA 4ZA2A 3U7JA 4ND4A 3UAYA 1Z39A 1FS6A 1KO7A 2I4OA 2QSYA 2GMWA 3D4PA 3QV2A 1V39A 5JAMA 1NMQA 1PVOA 4O2AF 3DOHA 3WC4A 2I4NA 1NVXQ 4MH0R 3E6AA 2IHJA 3PX6A 2B21A 2ZJ3A 3EUFA 4DIBA 2P6UA 4HUJA 4I9GA 1TJ5A 3DEIA 2HDNB 2GKSA 1KJYA 4HDRA 4CODB 5BVGB 3L1HA 2ZS8A 2V9ZA 2IYVA 3NUZA 3SNKA 4YRAA 3OCWA 2EANA 1S3GA 1SC4A 4FW8A 3ES9A 1VBMA 4JJ4A 3CN7A 3TRIA 4XUDA 4DA0A 1XHLA 1KRHA 4E3WA 4HDQB 2AKEA 1WVIA 3PC6A 2XGOA 1W4BA 2CB9A 3ZZNA 5JASA 4LNUB 5LLDA 4R8UA 3ESDA 2DBYA 1EP9A 3Q8KA 3IT3A 4XWKA 4XFKA 5B7NA 1LDGA 4TV8F 2WD7A 4KQGA 5KFYA 1HH4A 2PS9A 4JLSA 3EJWA 1QMGA 3HXKA 4KLGA 4PBTA 3TQ1A 1E61A 4K9NA 2B98A 1P1BA 2ST1A 3L8FA 1ABFA 2ILVA 2XGSA 2FW8A 4BTVA 4DR5B 1HMYA 3DUFB 2RIRA 3LC2O 2VZ0A 1XTQA 4I2IA 3LOPA 5KTRA 1L7PA 3A6ZA 4QTUB 4C8KA 4BO6A 5EUBA 1W0JA 3LP6A 4JCOA 4CV0A 3GLFE 4WKBA 4J9KA 3WNDA 2CY0A 4HK4A 1CEQA 3TLBA 3Q88A 1RIFA 3HI6A 4RIEA 1PT6A 3RC1A 1VA4A 4NYJR 1WY5A 4FXOA 4MP8A 2Z3VA 1OX4A 2CVPA 4URZR 3H9QA 1NXSA 3QFTA 4GL4A 4L2IA 2F62A 2QUHA 3KJXA 1IY1A 4P34A 1EDBA 2EV9A 3N2LA 3KTAB 1QHNA 3S1AA 4YMUA 4FFDA 2YRWA 3SYRA 4MPPA 1JXMA 4G0UA 5J0OA 4YAEA 1Q0LA 4JL6A 1A0OA 4N18A 3NDRA 1WX1A 4BC0A 4IFTA 1I7LA 4KJZA 5IIOA 1WBDA 5GY7A 4WOKA 2R7MA 4UBKA 4ZV9A 4GP9A 3U7QB 4EHKA 5EMKA 1G21E 3R6WA 3H86A 1TA0A 4ERNA 2IYTA 5CFQA 1FX0B 4WCFA 2INGX 4AICA 3U7EB 1H94A 2XIJA 1U2GC 4P83A 1NG9A 1KMQA 1BCRB 1I10A 3FYHA 2O2CA 3IEVA 3W7VA 4MEBA 2F77X 5JYDA 1J2TA 2HHTA 1J5EB 1XKTA 2GBCA 5CDSA 5JR3A 2HIGA 1LNSA 3EGIA 3R24A 2J85A 1T3TA 1Z28A 5FBZA 1E99A 3FVTA 4MUYA 2CWWA 1J09A 1A8SA 1VG9B 2JHGA 3EWAA 5C7OO 4X91A 4Q4LA 4TN1A 3BQ9A 1XNRB 1E32A 4GNKA 1H69A 1ZJWA 2VRCA 2DPIA 3AYXB 1XHEA 3LI2A 4ZICA 2O2DA 4F0JA 3QLUA 3Q2IA 5IJAA 4MA5A 4FKMA 3FHOA 5JW6A 3K96A 4Q3CA 1QF7A 4C06A 4AJEA 4KR6A 3RSHA 5JJLA 2GLXA 1ZNWA 1GOTA 2DBRA 4RKWA 2OK7A 2VSNA 2OXRA 1GVNB 3T8YA 1B3RA 1KDTA 1Y3IA 2Z58A 3G0IA 4EYGA 4R40A 2HIMA 1P2TA 3LLSA 4I4TA 2B6NA 3H7AA 3OQ6A 2DC1A 2JEZA 3HL0A 4P5EA 2ZSUA 2XZDA 3D2AA 1APBA 1FYVA 2JGNA 3QNMA 4URWR 5KTQA 4AJ4A 5AH0A 5HF5A 2W2PA 4UBMA 1QKJA 1E0SA 3ZLVA 4YJGB 2D4HA 1KJWA 4O2AA 3ENKA 1HE3A 4AJPA 2KLBA 4S04A 3SD7A 3PXXA 4G56A 1YQWA 1AMNA 1ZESA 3ASZA 4E2WA 3U6BA 1RCTE 1MJGM 5DNEA 4O3FA 5D3QA 4E6EA 2JCBA 2YUTA 1DRVA 7ICGA 2DFVA 3OMXA 4UHJA 1L5LA 3LBAA 2GA8A 3H18A 4L4SA 4TXMA 3M5WA 3UJHA 4DABA 3S7TA 3DE2X 2RGRA 5FL3A 2GPYA 3NHZA 1EK1A 5DYYA 4LRTB 4FBLA 1G21A 4KE7A 4A4DA 2KN7A 1UBRS 5LQKA 2OXCA 4E6PA 3M4JA 4UOEA 1C7YA 1GN8A 1WM1A 2QNRA 4NARA 2JJ1A 4F50A 4MV0A 5SY6A 1F4PA 4U7JA 3RE1A 4WOCA 1XVTA 3NV7A 3ER6A 4DAOA 2QE7A 3B5IA 3UYKA 5JXWA 1IATA 2NUBA 1JN3A 3ONEA 1L5RA 5HCIA 1AO3A 3QKWA 2OXTA 5JSFA 3E03A 5E2AA 1V9CA 3WQSB 4TKUA 1E9AA 4A6XA 4H7FA 3KRTA 1G7TA 1GAQA 2KNJA 1RM0A 4PAWA 3DR5A 3LVQE 4EHJA 2BM0A 5KWJA 2REBA 4BAUA 3PI6A 6PFKA 2HGZA 4DM3A 4PX2A 4KDCA 5IXJA 2PT5A 3KP1A 5JFGA 2JLAA 4E21A 2F9FA 5IEJA 5G0TA 2R8BA 4WLOA 1BTOA 5CA1F 1KEUA 1DC5A 2XNDD 4FM9A 4HSEA 1PDWA 1UFVA 1EFRD 3RH6A 4OI0A 5J4KA 5H5JA 3QLTA 5FLXA 2JFPA 2FWJA 4KLJA 2DPJA 2CL5A 3UA3A 3QVMA 4D98A 1U3GA 1Y1QA 4I6EA 1XCBA 2I33A 3OZEA 2XRMA 1E1DA 2BTQA 4JVLA 2BFOA 5CU7A 2I4RA 4A27A 3MYYA 1R6XA 1JAZA 2CYCA 3BIXA 5JALA 3GYBA 4QXQA 3OSUA 1N5LA 4QNRA 1TO1E 4GE0A 1SQFA 5J2UA 5DNWA 2Q1SA 3TEFA 3NU1A 1OUQA 1EDOA 4ETWA 4MUBA 3ZWVA 1WZCA 1GG9A 4Y2TA 3B9BA 2PH5A 3UWDA 3QBJA 3KHSA 5DHFA 3DFIA 4BJQA 3AVXA 1Q77A 3GRRA 3NVYA 4HMPA 4HQKA 3RSQA 3OQMA 4IRKA 4B48A 1RKUA 3MC1A 2ZCUA 1C3OB 2ZROA 3D8SA 4M55A 5BSGA 1MMFB 4UZEA 2O5CA 5C81A 1I2BA 1NATA 1JPUA 3TSWA 3KLPX 2IS1A 4BLSA 1R3DA 2WUWE 1ZJYA 2O8BB 5JG7A 4ZQHA 1IC6A 2I9GA 1S10A 4WBXC 3RS5A 1DPFA 1Z4OA 3ENQA 5L3VA 5B66U 1JMVA 3AEZA 4LE1A 4CLOA 2HK7A 4AURA 4I55F 5KDLA 7ICKA 1DT5A 3O7WA 2B7BA 3E9ZA 1JL3A 4XD7D 3QPUA 3QU5A 2BWJA 1TMKA 1DUIA 2TRSB 4F4UA 1NG1A 4QPCA 3CNBA 2Y1JA 1NYQA 1MPTA 1TAMA 1NV8A 4LJSA 1ORRA 2C9CA 1XELA 5DT9A 3PGXA 2CFCA 3HCAA 5CFMA 6REQA 5F9FA 4JY7A 1M7BA 2P5SA 4LYAA 3OWOA 5CEEA 1IM8A 1P45A 3H87A 2M1ZA 9ICOA 2FEPA 1N9GA 4HR7A 2MSWA 4S1NA 1E79A 5AOAA 4PZ0A 1HDCA 4X97A 4N12A 1PDVA 3QVVA 1TEVA 1VBNA 2ZYAA 3IEMA 1PNTA 4NRDA 4CQMD 2B8EA 3OHPA 1P4GA 5ELXA 4BIMA 5JVDA 1U48A 1CUAA 4D81A 5J9FA 1NRWA 1IIBA 4MS3A 1NGSA 2KM1A 5D2CA 1E18A 1YIDA 4PPQA 4KO4S 5BPCA 4FQ7A 5EXPA 3EBPA 3U3XA 1LS6A 2P2DA 5FBQB 3DOOA 1V5EA 4AIIA 3WB0A 4OKIA 3JVVA 3V9PA 3KTFA 3AM9A 1TAUA 5ULLA 5K3BA 4EHDA 4EJSC 4HXYA 5F9HA 1KFSA 3SEFA 1Q1ZA 1GRVA 3OQHA 3JQCA 3QFRA 1H3EA 1C81A 4Q3BA 2DH5A 4B3TB 1OGYA 3B38A 5DRTA 3MTAA 4LJ9A 2OZLB 1UIMA 2YQEA 5LQCA 2IZ7A 3WZMA 2A0UA 2BONA 4UAWA 2AEJA 2FZEA 3EOBI 4BX3A 3ZY4A 1VA5A 2W2QA 1IHUA 4MRMA 1XPJA 1RXUA 3ZBQA 3ZVNA 7REQA 3UWMA 1EFHA 1O4VA 4OLBA 4RAQA 4JEHA 2ONCA 5CP8A 1KF0A 3GWZA 3GMTA 1PRYA 2JH1A 4E4RA 3V6JA 1P3Y1 4RQ2A 2WKRA 3BQ2A 3QUSA 5KG3A 1A5BB 4ZQGA 3HQ4O 4RV4A 3WK5A 1JR3D 1P2BA 2GXSA 4GWKA 2H2DA 1CY8A 3UT5A 3ENNA 1TGYA 4GZLA 4E15A 3T5CA 4HAZA 5T3YA 1DK2A 2MSNA 2AV6A 2XQFA 2ZJ8A 1X2EA 4A8PA 2VSYA 4LUCA 5AFSA 3P9IA 3HB7A 4HAWA 1I9GA 1C7ZA 1NNI1 4BDPA 1L5UA 1LVGA 4K0RA 5JRDS 3BH6A 1TVKB 1K7XB 1DAMA 1ULTA 4QU8A 2HMYB 3AQEA 3ASYA 4Y6SA 4CMEC 1F5NA 3LRPA 1EVYA 3LYSA 5H9VA 4YMNA 1UK8A 1A9SA 1XCPA 1PSDA 3L49A 4A5SA 3AUSA 3JAWA 3JYNA 3AY3A 2XYRA 2JI6A 3ZJUA 5I7WA 2FPGA 3H5NA 3TB4A 3IOBA 1CIPA 1D8LA 3WL4A 2HC9A 4GOND 3QEOA 2A1AA 2PUFA 1VKZA 1PR1A 3ITNA 2KBEA 2O4UX 5J0YA 4O2BA 4S2EA 3ZE0B 4TZ6A 2C9DA 2UVPB 1Q0QA 1EX7A 3WL8A 1E59A 2ZPAA 2OBLA 5MFZA 5K4HA 3ZNOA 4S0ZA 5REQA 4DQVA 4Q7LA 2QL7A 1HKHA 4N9WA 2IDJA 2VP0A 3RO7A 1CXZA 3VDNB 1IEWA 1AK2A 3MTQA 3HRDD 2B2XA 2FSPA 3F4BA 2V5VA 5AJYA 4BXOB 1UKBA 3FOWA 2XYVA 5FWXA 3G6WA 3T1VA 4EBCA 1NAIA 2P6PA 3O1HB 1X1SA 4CLRA 2JFNA 3RUFA 5B58C 2GERA 4CM9D 3RT7A 4I55A 5K6RA 4NFSA 4WXEA 3CUEF 1B93A 1OYYA 5JC8A 3AQFA 4D0NA 1V9LA 2V4QA 3HXQA 3ETRA 5HQJA 3EGXA 4F11A 1I3KA 1Z2DA 3NBKA 3NT5A 1DU4A 2HADA 3GELA 2FLVA 2IDKA 2AFIA 2DQZA 2X0NA 4URYR 3RKUA 3ESZA 1J0DA 2GO1A 5DBAA 2P1ZA 3IDAA 4KQJA 2CVFA 4LI3X 3V00A 5BV7A 1GAXA 3EA5A 1DBSA 2R8ZA 4IGEA 2Z98A 1M54A 4L9AA 1CUGA 4YCXA 3DKPA 5KTTA 4IXNA 1L8QA 3SJUA 3U3OA 2DUYA 8OHMA 3P9RA 3AEXA 5FJJA 4A0HA 5KOYA 1SEPA 4ZD6A 4BDTA 4B47A 3F53A 2MCFA 3IBFA 2WA2A 4QDXA 3VR2D 4Z0NA 2C9YA 4UJ3A 1X94A 3KOXA 4HTFA 4P80A 2C61A 4LJ4A 1KYQA 3LD9A 4UJ5A 5E2IA 3DE3X 4U0KA 5CTAA 4Q7QA 4DARA 3UAOA 1A5AB 4IDBA 1XEAA 2DHDA 1QPGA 4F93B 2KK0A 2W4IA 1F60A 2W5UA 2ODGA 3UMRA 4TV9B 4L0MA 1OBFO 4DWJA 9ICKA 3IO3A 1XE3A 4F9EA 3FFWA 3HLTA 1CY1A 4K2AA 3BQMB 4M8KA 3L9WA 2JV3A 1OJLA 5EWGA 4YS6A 2IIQA 3UJ9A 3LQFA 1S4MA 2YN0A 3T52A 3MJRA 1EFLA 2CL0X 5C8YF 3VM6A 5A9SA 1Z37A 1CB7A 1PK8A 4NCAA 3DHWC 3ZWYA 4KK3A 1DS6A 4X8HA 2Y1XA 1VHQA 4D8UA 3LV8A 3AR5A 4PYQA 3VZBA 2W7PA 3LHKA 1TT7A 3IAAA 2QL6A 4GKAA 1DBIA 5FV7A 1LQ2A 4O3MA 2GAOA 4D9BA 3EDMA 4YLEA 1VL6A 1FSSA 4KH0A 5TPWA 1L2TA 4FDMA 2V7PA 4MYHA 2BM1A 1G3IA 3RTGA 1Z5NA 2ZI9A 4KGVA 5AYVA 1C30B 1UAGA 4RFSB 4ENVA 2B4TO 3O73A 4Q9HA 4X85A 1COOA 1P31A 3O92A 1RXWA 1E3WA 3QLVC 4PHCA 5DHSA 1KEVA 3I6IA 4EUEA 2CNKA 3JRXA 2AW5A 5CFNA 1AC5A 1VE5A 4RPYA 4FWBA 3MTBA 4C87A 4RQ6A 2LYAA 3MRSA 4CG1A 2JMGA 1P8AA 3AETB 3C3EA 2AUNA 4WQMA 1EBFA 3B6MA 1O77A 5IVHA 5KOJB 3I32A 4C5CA 3AIKA 3MGIA 5CLQA 2G5CA 4MR8B 5IRCD 4D43A 4LGVA 3PVXA 3LRXA 1UQTA 2DQKA 3WRVA 2D2XA 3RAEC 2WSYB 4YR2A 2Q0QA 1BDJA 5DDMA 1XRPA 4L78A 2OXEA 3TD9A 3WJ1A 1ZQEA 4ZYTA 1U2SA 5G41A 4HRYA 3S81A 3C39A 2AZMA 2WJPA 1H8ED 4CCYB 2CJPA 4C7VA 3I37X 4I1YA 4JI7B 3RGGA 5DGHA 2ZJ0A 3F2DA 2V7GA 4UNRA 1E1CB 4NL4H 1QQBA 2BPGA 2C4KA 3G9QA 4UPDA 2NUAA 1HLDA 2QAGC 5E7JA 4LBZA 3UMBA 5FOWA 2QVXX 4UTZA 2OHVA 3L4SO 5AKIA 1MO4A 1G20E 4KFUA 3PWKA 2G40A 5LBTA 1P5FA 1ISFA 4RTOA 1RYUA 4NLZA 2HF9A 2Y71A 1KN5A 3JR7A 4M9LA 1RZRD 3RC8A 1O7JA 4CTOA 1P8JA 1P2VA 1JSXA 3I8SA 1BW9A 3DO5A 2YJ3A 5EA2A 1KKXA 3PSHA 2DUWA 3R76A 1PTJC 1F1JA 4O08A 1U4NA 1JN0A 2Y99A 3VC2A 3AUUA 3W5JA 4KZPA 3HL4A 4OK6A 1BDHA 1UBUS 5P8WA 2A5FA 2KWIA 2HTFA 4BNHA 4DA8A 5K3DA 1I2CA 3ZGXA 4LF9B 3DV9A 2BUCA 5IC4A 2IYFA 1A96A 3CY6A 1ESMA 2O06A 4ELUA 3C41J 9ICSA 2FP3A 2VBFA 1TA4A 5LJIA 2XSZA 2C9ZA 4E09A 2HU7A 3LW7A 1ZRHA 3AJRA 3ZHYA 3I6YA 3T61A 3GRUA 5E1BA 1N2IA 1I6MA 3BUSA 1QVVA 2HV9A 5CLHA 3IOEA 5KSOA 3FDZB 4EMTA 4GOXA 4X62B 1GD1O 2Q9AA 4QJBA 2P9CA 1OIVA 1R0ZA 2HJGA 1UZMA 4DCOA 1CZUA 1EXMA 1HE8B 2YN4A 2XRZA 3AF4A 2CLDX 1EESA 1JQ5A 4GX1A 4G3XA 4LVSA 3U0VA 4Q5IA 5DGXA 2PY6A 3AL0C 5C8YA 1UXOA 2XY6A 2V6JA 2G1JA 3PHCA 3LDGA 4FEGA 2OGUA 4OFBA 2CMDA 4R3WA 4ZAVA 1SXHA 1R0LA 3B8EA 1EFDN 2RAVA 1YDFA 4RQ3A 9ICEA 2GYYA 4DANA 1G20A 4BP3A 3BB3A 4UDXX 2GEKA 3HXPA 5DCUA 2I4TA 4A8HA 4ZODA 3GRFA 3C2MA 2PZGA 5AJTA 5E9JA 4RMGA 4UHKA 1NW8A 3SX4A 2LKYA 4EJSB 1TU3A 4U2BA 2GCNA 1XD2B 3V2GA 2HBRA 4W5HA 1UDRA 4WKOA 3R2JA 4N3GA 1TM2A 2II6A 1RWXA 1PJLA 1DLIA 5DDIP 1K98A 2AVNA 1OX5A 4E5VA 4J1TA 3H4MA 2H1WA 2JS7A 2V65A 2HWWA 8ICEA 3UNXA 2BE7A 3SSNA 4QYWA 5L3QA 2D06A 5I9BA 2EBFX 2NADA 2HBLA 3LH5A 1T4CA 3EHEA 5IM5A 3TLZA 1J2EA 2HA0A 3AR8A 521PA 2UZ0A 3DQZA 5IUKC 2YZKA 3RVQA 1HQKA 1ZQ1C 5KNDH 1LXCA 2YWRA 4XGIA 3DTVA 4RV5A 8ICQA 4BLUA 2PQ2A 3GLGE 2C20A 5LQSA 3LQ2A 4DV0B 5BUZA 4LF8B 2CCKA 4UB8U 4TT8A 2VCYA 2RGEA 4I4LA 5EP3A 2PMZF 1DG9A 3WGJA 2N3ZA 4BFZA 4IIJB 4P7KA 4DV4B 1G19A 3QFFA 1TMOA 4P6VF 2J0UB 3OESA 4EHIA 3H99A 3FHCB 1ZD8A 4J6FA 1JXEA 1VRWA 4QOHA 3OCJA 4ZVSA 4UNPA 4QTYA 4LYYA 4XM2A 1UZNA 3X0DA 4ANFA 5KEIA 3LVFO 2RMKA 3R5XA 2YNMC 1I6LA 4GR4A 2FRDC 3WL7A 4KWEA 4DLTA 4L6AA 1FP1D 2WJHA 2ZK7A 3ZQ4A 3X2FA 2ZBPA 2G80A 4WKPA 3LLMA 2Z08A 2WFMA 2F90A 2CFSA 2Q3CA 4QQFA 2QJRA 1KI6B 2JPDA 3NEAA 3V1YA 3LYHA 1PL8A 1BMFD 2JIRA 3UICA 4WZBE 3UMCA 3HYCA 3RUAA 5KT7A 2CDNA 3H6HA 4O4HF 3SEZA 4FFSA 4KV9A 2WF6A 3G2QA 4P98A 4D46A 5GZ6A 2YIMA 5HE8A 4ZEMA 3LP8A 5FLEX 2QW8A 3CZAA 2QX4A 3STYA 2BELA 3C6QA 1JECA 2Z1MA 2PHZA 3NIGB 4ZI2A 1AQJA 1QV6A 4O4LB 3JPQA 1YQEA 2WJIA 2DUNA 1CJUC 4HWRA 4M1KA 2RHOA 4ALLA 3AFIA 4BHTA 3DW1X 2F4VB 4E13A 1WUHS 3NI2A 2VK2A 2X0EA 3TG8A 1L4GA 5FLYA 5DWQA 2QRUA 1I33A 4HZIA 3FGPA 2J4DA 4ZCIA 1QRSA 1AUPA 4DMGA 5GVRA 4LXYA 2HMTA 4IXDA 3N3AC 3H2HA 3U7HB 4NL9A 2CV2A 3IVRA 4QQ8A 4V0QA 4GRDA 4OHBA 1GPAA 1ZNXA 3EVGA 4L85A 1U8CB 4HZUB 2WVAA 4IDCA 3G49A 2C2OA 4B7AA 1T4BA 1CETA 4PSKA 1YHZA 1FQOA 5JSHA 4GPIB 1G2PA 4OI2A 3ONNA 4LRYA 4JMUA 1KK1A 3SZGA 3L7JA 4HAOA 2LNDA 1NV9A 2BFCB 3C7TA 5KWVA 4JC4A 1FY2A 2BJVA 3W5BA 1OV4A 4U7DA 4RNNA 1TKCA 2C1ZA 1W8DA 4LZNA 4YRLA 5IJ9A 4DUZB 3D8RA 3FYUC 2XZOA 1ZIYA 1ZAYA 4LC0A 3WDMA 4OOEA 3JU3A 4GLBA 4GHWA 5K6AA 2JGJA 4QUJA 3K2EA 4IPTA 5IDWA 1SXJE 2DYKA 4KRXA 4CU2A 8ICBA 4CETA 3C6BA 5DPMA 4ZCTA 5HK8A 2Q5JA 3TGWA 3BSWA 2QPOA 3OM9A 3KJHA 1UBGA 3KZKA 2DKZA 1IVYA 4UHCA 2QB0B 3KEGA 3LK6A 2JLXA 1KWKA 3EMBA 1T9DA 3VOSA 3MR3A 5DGCA 5KVVA 1QG6A 1I5RA 4WZBA 4GZMA 3OPQA 2Y1IA 3WAGA 3FSRA 4AYBF 2VZLA 2ZM6B 5DYNA 5DGIA 1D8AA 2VEDA 2QDKA 4Z7JA 3R8XA 3KETA 5GM2A 3D4BA 4HYTA 1PK7A 1XLVA 5JCJA 3DOCA 4IS3A 7ICIA 3NRWA 4HGNA 2ECPA 1MAUA 4DS4A 4G0OA 3VOAA 2FKAA 5EVCA 2OCEA 3IVXA 3K92A 4YRSA 2P2GA 3OCZA 3Q8WA 1NUAA 5FUYA 2PMKA 4EFKA 3L8ZA 3A1SA 5FI5A 2FUNB 2FPXA 1GKKA 1XDUA 3V8RA 1Q7GA 5K03A 4M8SA 4TS4A 2QZ4A 3N2ZB 3G5MA 2AN4A 1J8FA 3OE1A 4MW5A 1JU4A 1U9JA 3DAYA 5TQVA 1JIKA 3GEPA 1JBKA 2K4HA 2NSYA 3N58A 4MO9A 1M2EA 1WDTA 1GUZA 3EIWA 4NJMB 4NDAA 1Q1GA 2IEIA 4KXVA 2CMKA 1JBQA 3KB8A 4LJKA 1P0PA 4PR0A 4ED3A 3RUDA 1QGUA 4ILEA 5HK9A 4Y6GB 3ZWQA 3RTEA 2D62A 3AY6A 2PD3A 4IUDS 4JP8A 3RBVA 5DI3A 3COJA 4JV0A 3DM5A 2BGNA 1WTAA 1NJZA 1VIAA 4NFLA 4F4WA 2QARA 4UTVA 5JYBA 1NKBA 5JS2A 4BNMA 1U7UA 4YPFA 5A05A 3WB2A 4E5KA 2I8LA 4C8LA 2YHSA 4F21A 3OEHD 1Q21A 3TXAA 3DWFA 4YBRA 3QVSA 5KTPA 2X8JB 2ZRBA 4KIWA 4RS4A 9ICWA 3L0IB 3NG1A 4DXDA 2VJCA 4KXWA 5D00A 3BK1A 2E9SA 2GZMA 5DHRA 2H17A 3WGUA 2OMKA 3FG9A 4RSGA 1ZQFA 3MGCA 5K8TA 1EM6A 3ET4A 5J2TA 3T7IA 3AI2A 2WUFA 3GZNA 4EJ6A 4GVLA 4A0RA 4CHTA 1E6WA 1TL7C 2W6IA 5LQAA 3QX3A 3QRWA 4FDAA 2CSXA 3AF1A 4ACBA 1U7XA 4C0BA 3ROFA 3VKUA 5BSUA 3WFZA 4B3MB 1EEXB 3MBKA 1SBIA 2QJOA 3IGFA 3SHFA 1OA0A 2EIHA 1MIOB 4CKXA 3TLEA 4WXYB 3ZOKA 1NN1A 4K86A 2O3QA 4B9NA 3KCQA 3OETA 3SS9X 3OCXA 1N3LA 4WE3A 1N7GA 2FXVA 2VAMA 3D1LA 4GWLA 2X5KO 3RHFA 3RVMA 4FIDA 4WERA 5DV9A 1O95A 2EH9A 2BEKA 4TUSA 2Q5QA 3RIEA 5B5EU 4Z4EA 1XZIA 1RZTA 3TRHA 4DYDA 3F6RA 3D59A 4WASA 4QT4A 3VZQA 3RRNA 1NVDA 3UB4A 2XT6A 3RLFA 1SPBS 3T5TA 2BMEA 1B6RA 5D3MA 2XMPA 1VPWA 4ZAGA 2WF5A 3SXJA 2BGGA 2C5FA 1U7PA 1NJSA 2YY6A 4HWKA 5FPHA 1GARA 2AOTB 3GFVA 1EWQA 3JQBC 4EPYA 4KQ1A 3MG9A 3BD9A 2FYTA 4RHEA 4QZGA 3IIJA 1M2GA 3U4AA 1BSVA 2CF5A 3CH5A 1GCIA 3UFXA 1DBQA 4PHAA 2ZE7A 2Y77A 1OC2A 1DRGA 4HWGA 2ZRCA 1NRXA 2NOAA 3OCUA 3UJBA 3AUYA 1XG5A 2QF7A 2VKQA 2Q9UA 2Y9MB 4UD2A 3V6HA 4M1TA 2PGLA 4NH4A 4CF5A 4P7FA 1ZQNA 4QLBA 1BXZA 2DHCA 1U45A 2NXJA 2W2LA 1XLUA 3B7WA 5D3ZA 2RARA 5FADA 3H1GA 4TRNA 2YXEA 2XZLA 2OO7A 2M32A 3CKLA 1NTOA 5DASA 3R0VA 1NLUA 4Q12A 2J45A 4QJ3A 2VJMB 1O97D 3OWXA 2V4ZA 4OB8A 2QRHA 2MR5A 4RCVA 1VPLA 1BCSA 1ZINA 3FHTA 4RTPA 2O3SA 5E6RA 4J7AA 1A9QA 1U3UA 4DTCA 1F3LA 3SJAA 1NMZA 3GA7A 4F38A 2HGSA 4RXTA 4WK4B 2NRWA 1JYEA 3ER9A 5DM0A 1UM9B 3GP8A 3U19A 4BNGA 5HSGA 1XZEA 2R8RA 1VP3A 5FFMA 4EMUA 1OXUA 4EMSA 4EHNA 4OQXA 3EDRA 4E3ZA 3QNWA 5AXAA 2BBOA 1KZ9A 1HEUA 2OV2A 5J4YA 3BKWA 2F1HA 1QX4A 3HABA 4EQ6B 3KPUA 5FOVA 4TN5A 5FKJA 1Y9EA 4L5YA 2NU7B 3MERA 4N7MA 1DGJA 1B1CA 2HBZA 4URVR 4FOPA 2QJTA 4KO3S 2RK6A 1PW7A 5CBPA 3E1KA 4DYVA 1HORA 4RO0A 2PSDA 4AYXA 4O4JB 1J2UA 4EG8A 3ISDA 5JSKA 3SLRA 3F1LA 2ZBVA 2J08A 1PL0A 3QG5A 4HVAA 2P3LA 4DDMA 4N8DA 1Z8NA 4LRWA 3VYVA 1PN3A 4NBSA 1S9HA 1E8MA 1JZSA 3ONWA 2ZFUA 3OQJA 4FMDB 4ILKA 1BD4A 1HEIA 3WMWA 4G0VA 2FUG6 3QPCA 1EB9A 4L9RA 5J8YC 2EZZA 1L5GB 2DPHA 3KHLA 1XSLA 3HSSA 4KNWA 3PPXA 2KIWA 1UPXA 4C0WA 2EJUA 4TQ9A 1H4SA 1I36A 2Q7DA 1RQXA 4MAAA 4M1ZA 3MWGA 4NBRA 3C6KA 1H2XA 3WGTA 1PR0A 1NOMA 5EJ2A 2P6NA 2ZUDA 2I71A 5L95A 4TMWA 1W9MA 4XTCS 4B43A 3ZHBA 2W9BA 4MJLA 1KP3A 2DTDA 2IELA 4MI3A 1E92A 5JO0A 5IIKA 2P4QA 1BU5A 3T7CA 1WXIA 3R3WA 3D6TB 4CR6A 4PGAA 3PUVA 5FHRA 2FQ1A 2OQ2A 4B7XA 1WKBA 4A91A 2JLWA 1LI5A 3P2IA 5IVPA 1XVVA 3FFXA 1TYBE 3RVRA 2KFZA 4W7HA 4L3WA 1E69A 5ARBA 1LQTA 3V7LA 1ZHOA 4R71A 2C78A 3KSDO 4Q9JA 3ZZMA 3LCUA 4AG6A 4AZ0A 3AJAA 2JEYA 5TGZA 2OO3A 4MW9A 3GRAA 4JU8A 1XD8A 4WA7A 4Y98A 2ZYSA 5JDIA 1H05A 5F1OA 1E2IA 3W3AA 4HDKB 1F2VA 3TSAA 5LOVB 2LYBA 1VG8A 4HNGA 2KJ9A 3WGOA 5M2QA 4GS5A 2IT1A 2IY9A 4MJ3A 4RK4A 1YJCA 3R09A 1Q46A 1GFSA 2XDYA 3BXEA 1WR8A 4HN4B 1X7XA 2B4AA 3HUTA 3WRXC 1I7SB 1FUIA 5HKBA 2UV8A 5HGXA 4FGJA 3NWJA 3UT6A 3L6UA 2WWVD 1A7UA 4YALA 3GBVA 2IXAA 4EAQA 3THXB 4CN8A 1YR8A 5KFQA 5EFOA 3ZWCA 1Q83A 1Z34A 1Y6FA 1XWFA 3L4EA 4BQIA 1KZHA 4K8RB 1LS1A 4C4YA 2QS9A 2F3RA 2VQEB 1U81A 2NNLD 3LBIA 4AJ2A 3OOSA 1A9RA 3FYUB 1MTOA 5KAPA 3DDSA 3IBGA 3MUEA 4RKYA 4B73A 1HRKA 3KSBC 1ZGBA 1O9HA 5CDUA 2EGUA 3IVCA 3A9RA 1YJ8A 4H31A 1ZI6A 3L1IA 4G5RA 1E7WA 3ECCA 1CX9B 2BGJA 4L4XA 5KQPA 1ZUNB 3AF2A 2UYQA 3OJ0A 2DPGA 2O2JA 4OXIA 3L7LA 4HX5A 4D25A 1JFFB 3B52X 3W6OA 3OT1B 1P72A 4P54A 4GWGA 4DILA 3L4JA 4EHHA 3DDUA 1JIHA 5HCNA 1M72A 3PA8A 3A4TA 5CFOA 1XIVA 4XLZA 4NXMB 1T13A 5AM3A 3KUXA 1T24A 1ZSYA 4KUHA 4B6JA 1JI0A 2VHTA 3SVTA 2VJ4A 1DQZA 4DR7B 2JGIA 4QGBA 3QBTA 3NHJA 5C37A 3OFJA 3P0IA 2NXCA 3I0NA 1L7BA 2E3TA 5GOZA 1Q19A 3V2UA 2XGMA 3B85A 3KVRA 4LECA 2BP7A 5K8IA 4V0KA 1SOUA 3NIFB 2A19A 4Q3LA 3JD0A 4IH9A 1EHYA 5AIAA 1KO5A 1XXHB 2EJBA 5A7GA 5FAXA 1N63A 3ZE2B 4CL3A 3HS3A 1A98A 3VMMA 4OQLA 1R4NA 4DLGA 3F3SA 3PSPA 1QQTA 3QY0A 1Y82A 1JDTA 3SGLA 5KTOA 3SYNA 1YBVA 5BOLA 1U8EA 3I64A 2W8LA 2OUIA 1N2ZA 1V35A 1LC0A 1PFWA 3G8YA 3JQAD 2EZUA 3TKYA 4BRUA 3RUIA 1C9KA 3V3TA 3BK2A 3E7DA 3SKXA 4YI3A 1X14A 1SHKA 3RBEA 2UYOA 3Q85A 3WGIA 3JQGB 4K4IA 5HR5A 2D3TA 4ARBA 4IIDA 1O0BA 2NU8B 2OILA 1E1QA 4LYFA 3KS9A 4FDVA 5KDOA 1G8HA 4DQDA 1J24A 2YWFA 1P9NA 3ZVRA 4Y2JA 3GJTA 4QTZA 4QTTB 2D2IA 3COWA 4UATA 3NHYA 3DOUA 1QG4A 2YV1A 3CF4G 2CXSA 3ZC3A 4Q1FA 3TZBA 3LT4A 5KFLA 1L7QA 2OTCA 5IC6A 3CGWA 4HGZA 3ZWNA 4CHGA 5DM2A 4REMA 1Y1LA 2J3IA 4Q9LA 5JLAA 1LPBB 5C8DA 4QWMA 4TV8A 4KOAA 1F7UA 4A8EA 2QTFA 4DZTA 1YZQA 3DWEX 2LMRA 1YK0A 4ON9A 3EIHA 1TO2E 2WB4A 1BN7A 3IAS6 2BCVA 1C1DB 1AS2A 3RWOA 2BFPA 1L4YA 1ST2A 4Q48A 3MCWA 1FP4A 2X5XA 2AIRA 5E6UA 3V8VA 3FYSA 3OBIA 4MHVA 4Y2GA 3ZHVA 2ZUSA 1AE1A 2O7SA 2P8SA 3VHXB 1OZFA 1CF4A 5EZSA 2C29D 9LDBA 1NLYA 2XTAA 2J46A 3NKFA 1MJNA 3QQ5A 1XBTA 3WOVA 3N4MB 5K20A 1Z8DA 2KICA 1NUSA 2E1PA 1O6FA 4OHFA 1SC9A 4ZOQI 3EA0A 1DOAA 2XWSA 2Y67A 2NVUB 2WU3A 1IPHA 3O8NA 4ZVMA 3GRZA 4DMFA 1ISPA 1OTHA 1NBMD 1QHFA 2FKNA 3FLAA 2APJA 2PR2A 5ALRA 1TM5E 2KIVA 2VP5A 2HSGA 3GLIB 2R25B 1TV9A 3OAAA 2HSJA 4IKOA 2Q5HA 4QXRA 4X94A 5KVAA 4DA9A 5JH7B 2YWDA 2GWHA 3MPUA 5KFIA 3W9SA 5DXJA 3BDIA 2JZCA 3MGGA 3KHGA 4IXMA 4BE4A 1TUIA 1U0LA 2ZJ2A 4IQ8A 2C4VA 3ND7A 4JBNA 3MJCA 1EA7A 3U9TA 4A1OA 2VYNA 1A71A 1D9FA 3MWEB 1JNYA 3PKIA 1RNLA 4F9GA 3UEOA 1HLPA 5JRZA 4QRHA 4G8CA 4IIBA 4B76A 1KFEB 4EB3A 3S68A 3QWIA 3DLTA 2ZRQA 2YJ5A 3S2YA 3H0CA 1YA4A 1WPGA 2ASDA 1YHYA 2ADFA 3FVVA 1Z6PA 4JLDA 1DTWA 3HKBA 1H2AS 4CI0B 2XY4A 4OGWA 4ZZ2A 1PJZA 3SIWA 3ZE1B 2W8BA 1ZH4A 4QWBA 3AVPA 3VX3A 4MYTA 5AW4A 4V38A 1RPNA 1H2BA 1JZTA 1MGPA 5DSTA 1YZ7A 1HQDA 1M2VB 4YACA 4RKRA 3NJ4A 4QSHA 5C80A 1ZL2A 2IY8A 4Y18A 4AMBA 1GZVA 1HUQA 4C4TA 2ZU0C 3CPEA 3FMOB 3G5UA 2HL6A 4RPHA 2A3RA 3CWQA 2WHQA 4HWSA 2FFHA 1BXGA 3HK2A 3AZOA 4ARUA 3IQFA 5FUWA 1XYYA 1K9SA 3DNMA 2FSVA 4Y9SA 3RJZA 3KPVA 1F0MA 4NJOA 1Q0ZA 1GG8A 2WSLA 3ISCA 1Z2OX 3ZVMA 2O50A 4DQUA 4JI2B 5GONF 4HLCA 4KAAA 1HDEA 4ND8A 1H9BA 5GMOA 2GNAA 4K6GA 3F2BA 1R6VA 5JAQA 4RA9A 1XZMA 3AFMA 4IZOA 1TK0A 1TJPB 1A7KA 2HFJA 4RPLA 3V48A 3HVKA 2ZM5A 4DWVA 4IOJA 1L7MA 2W42A 4Y2RA 4RKFA 4D6YA 4O3PA 5MHTA 4MW1A 1K7SN 4QDUA 3TQTA 3JZIA 4F04A 3S6JA 1Z22A 3W2FA 1M1NA 5KJ1A 4HD8A 3C29A 4QZ9A 2X6QA 1W85B 5KFFA 3NGXA 2UZ1B 1SU4A 2PL3A 1QC5A 2M1XA 1Z6ZA 2OT3B 3O0FA 2C2KA 2G7MC 3WGHA 5EJEA 2A0YA 1S7GA 4EPVA 3H8VA 3NH6A 4YROA 4KQKA 1NM5A 3SE0A 3C16C 2B36A 1IZ9A 4DXHA 1U0HC 5MN6A 3R9IA 3P4XA 5CW1A 2BR4A 3TTTA 4D1YA 1V47A 2UZ4A 3EOZA 4TT3D 1H6DA 1A8UA 3S2UA 3STUA 4P0TA 1JVNA 3ZWXA 3IUBA 1H0HA 3IQDB 1E2KA 3K30A 3W9BA 5LP1A 3C21A 2G9RA 4K6OA 2L82A 5T4BA 1H6BA 3VH4A 2NAFA 2QVLA 2GK6A 5J5CA 1U0TA 3PSAA 5DSZA 4ED6A 4ZCLA 4P4SB 4B40A 2ZOSA 4OI1A 4NEQA 4UZSA 4KQFA 2V9CA 2UXBB 4O63O 1IULA 3U26A 4OJQA 3GJZA 3PJRA 1SKMA 2WPDD 1OGJA 1HE2A 4LZAA 1YA8A 1SUWA 4DZZA 3I39X 3PHJA 3WGVA 2IS6A 1RP1A 1PQWA 4DNQA 2IKQA 1PT9A 2AFIE 5FNZA 4BO2A 2VN8A 1WNFA 4B75A 3B7GA 2FX5A 3II6X 4OXXA 3SX0A 2YRFA 3FZNA 5CA1A 1RMYA 2FZCA 1VE1A 4KRGA 4BZPA 5HZHA 9ICTA 5DCYA 2ON6A 4ICIA 1AGPA 4MVJF 3GJ6A 4ZHSA 2F8SA 3OFKA 3PHGA 2IHZA 3F5SA 3AH8A 4PAGA 5BNIA 4LIPD 2V1UA 3DVSX 2P4EA 1V8DA 4M9HA 1JMYA 1S6YA 3ZTTA 4UXHA 1C4XA 4WV3A 1E2MA 2O57A 4DLUA 1EK6A 5K3FB 1LK0A 1YB1A 3EEBA 5BV8A 7ICFA 1KMMA 5HKLA 1I1HA 1YK1A 2OCPA 3DZIA 5FPQA 5LDHA 4KREA 1KMCA 3RU3A 4XA5A 1M3SA 3PHLA 4LPSA 4ZYZA 1VECA 3PY8A 1IN6A 3V33A 1KERA 1L4FA 1WSWA 5EXDA 3K32A 3N8HA 4EDFA 2NSDA 3TZ6A 3VYWA 3OIVA 3IT0A 4COKA 1Z1VA 3C7DB 3UQ0A 1R8JA 3AM1A 2Q3LA 4YXFA 4BO4A 1YZUA 2JIZA 3IKVA 2O3UA 4IDNA 4JJ7A 2WF7A 1FFCA 1UOQA 3I2JA 1FIQA 1N0UA 4KZKA 1YR2A 1QMPA 4AVYA 2EJVA 2KSOA 3O8RA 3BGOS 4EGJA 2Q3EA 3WJ7A 5F5LA 3FGNA 4EUSA 1SQGA 4MUIA 3R5JA 4GL2A 1RW4A 2PRZA 3RSCA 1I7NA 2AWOA 1V11A 1GSHA 2JAUA 4D79A 3V55A 2VF2A 3GGCA 4G89A 3X1YA 3TEMA 2GAAA 3NYIA 3ILSA 2YJNA 1N6LA 7YASA 4LV5B 1SPXA 1JI7A 5AKHA 3ZE8A 5F4BA 5M34A 2X9GA 4QQKA 5TV2A 4F97A 2EZXA 2QMUA 1N4AA 2NPFA 1X70A 2YX1A 2H07A 3KLOA 4BEBA 5B64A 4Z49A 4X71A 3TLGB 3TSYA 3G6VA 4Z4FA 3A3YA 5JAUA 2YKGA 3A04A 4ZI5A 2FP4A 2BJWA 1Z12A 2X22A 1IK4A 2W6JD 1PTKA 5AKGA 1I94B 1B2LA 4US1R 1M0WA 1PL6A 4OXNA 5JWOA 1XAIA 3L4BA 3AP2A 2A30A 2FFJA 3UHJA 2WIDA 3SV3A 5C5JA 2DH6A 1XZQA 2H51A 2OYCA 5DP1A 5JBIA 2H65A 2YVAA 2X9QA 1ZHFA 1Z33A 2PUVA 4QUGA 4PU0A 1XEWX 1C7QA 4JUDX 2FB9A 5HTOA 2Y1OA 4DLWA 3KELA 4EHLA 3V7UA 2H1RA 2ZIUB 1D1TA 3W5DA 2R96A 4ZMSA 3TJRA 2D5AA 2JD2A 4S24A 3AIOA 5HF6A 3AX6A 4WCVA 3C23A 5FNVF 2RJNA 4I5IA 1OBCA 1S0VA 4IJKA 1WPXA 5ENVA 3WSWA 4AJHA 1WMAA 3STXA 5ERGB 1J33A 2UVWA 3E7WA 3ZDQA 2WWRA 2K4EA 5G0VA 3ENVA 4J3JA 3PCRB 2CXTA 2AQKA 4Y1GA 1SK9A 4NNPA 3Q6IA 1UR5A 1ONNA 2O07A 3KZMA 5DB9A 5KPDA 5SYMA 3PL5A 1KNQA 2OYSA 3MJ4A 4I4CA 4RD2A 2W03A 2BTEA 3L9XA 4FDTA 2DLNA 1W1IA 5CCBA 2OPBA 1MW8X 1H0RA 1D1PA 3T5HA 2ZCVA 2OO5C 5CLLA 1WXGA 2VSOA 5E95A 3D4IA 1GSIA 4V02A 4BMPB 5KFHA 3KKZA 1J97A 4JS0A 5K2MA 4W5JA 1FYDA 2G6TA 2R7KA 1ZM4A 1PR6A 4G9BA 3CFYA 3BJYA 7ICNA 1O5TA 2PUDA 3WLEA 1D6MA 3KXIA 1ZEJA 3FCEA 3NRZA 2VJDA 1YNSA 1KFBB 1H5UA 3KHTA 4LDRA 1R4MB 4O1MA 4X1YB 4OK5A 4EEZA 1J0CA 3BMCA 1X9WA 1EFTA 4MVJA 4XX0B 1XCLA 2D4AA 1PFGA 2C7RA 4NCXA 4UTNA 4AY4A 3V6MA 1SL0A 3FNHA 4B9LA 1CDZA 3DEJA 5DNAA 1VSBA 3LY9A 4YJKA 4CR8A 2ZQZA 4TL7A 2XMBA 3S8YA 5KG1A 4RM2A 5JOQA 4K9QA 3FWPA 1K6JA 4RPIA 2QZ9A 5ESRA 2P62A 2R1VB 1P4SA 2QV7A 1Y5NA 2CC2A 3TW6A 2RB4A 5KFZA 4CRXA 5A4IS 3GJQA 1WE2A 1DKMA 2HWUA 2A1TR 1OE0A 1QAQA 3O8DA 1RM5A 4L4ZA 1DDIA 5E1MA 2OENG 2VHJA 1KL9A 2A86A 2VBCA 3OOEA 4FZJA 3U16A 2HOIA 2XB4A 2BLLA 4X90A 4FNOA 1ODFA 1EBUA 1YZFA 3MSXA 4AL4A 1PFVA 4JENA 3D5EA 3WMRA 4NQRA 3PMNA 2HK9A 5KG7A 3OTOB 1YRLA 4A23A 4D3YA 3CX7A 3TSZA 3EBLA 4B8WA 3AYZB 3LQKA 1ICIA 1YJAA 1NP7A 5F7XA 1G16A 2D1SA 3KT8A 2HA2A 3TGLA 4M87A 4ZAXA 4PZOA 3ROKA 2XBLA 2VOJA 1TM3E 1RLJA 1KS2A 1WUDA 4IY1A 1JKJB 5KFJA 1M2NA 2C2DA 1EFVB 2W00A 1IRIA 3ADKA 3EGVA 1RPAA 2O8CB 2OGTA 2XKAA 3U7FB 3P52A 4KQEA 5TQJA 2VXYA 5A4DA 3JXEA 4I6JA 2CK3A 4PZNA 4A10A 5JS8A 1K27A 3OQPA 2WAMA 4RHUA 2VTDA 4H16A 4GBED 3RK1A 1MX5A 3SM3A 1NURA 1IN4A 3CB2A 5IIIA 4GRIA 1E7MA 4TTTS 1HTTA 4BUCA 1F5SA 4OQMA 5ICCA 2CGEA 3NNNA 2O2IA 1DCMA 5BMVB 1T4MA 2PN1A 2IHUA 3NBZC 4NDNE 4Q4JA 3OFND 3A06A 3T7JA 3TOSA 1Q74A 1FNNA 2VL7A 3FLBA 2P5UA 3MWYW 3DAHA 3HJEA 1E2HA 2H29A 2R8OA 4L72A 4LTNA 3WHKA 1GKLA 2PEYA 4X61A 4B4DA 1HNWB 1WDKA 1NVKA 6ABPA 4IMJB 4DKJA 2XE7A 2O59A 1Z9BA 2I2AA 5EL0A 1PQPA 1X86B 3AVWA 4QXAA 1PEDA 5C52B 1OSNA 3K16A 2N42A 3ZBPA 4J90A 4L4YA 3WIDA 2IP4A 4NF2A 3VAAA 4UAJA 1M73E 1T0BA 3HCPA 2EQAA 4I4IA 3FAKA 1AB5A 4R9UC 3U1BA 1XDSA 3DJFA 2VEOA 2P35A 2XKJE 4JGIA 4NX2A 5EJ5A 4D45A 2FSHA 4Q4CA 5LQUA 2Z04A 4PR3A 2FLWA 1CRPA 3TAUA 4PC6A 2HPAA 4UFNA 4G0YA 4YJHA 1EFKA 4AECA 3E4DA 3KVNA 5LC1A 2AR7A 1KDVA 3S2SA 4XWGA 3G5AA 4MVJP 2UXCB 3TANA 3K4HA 3UJNA 1W5BA 1RRMA 1Z7EA 3WTBA 4LXGA 4IVNA 4W5OA 1IZYA 3OJFA 3O47A 2HRZA 5CR9A 1GFIA 4M0PA 3LVWA 3ZDEA 1GUFA 1W5SA 1E9EA 5CXSA 3H5IA 3A26A 5CXUA 4RZQA 2E4VA 1FVOA 1JTVA 3BN3A 1O8BA 3RRFA 3L6CA 3S29A 2BN4A 2G1PA 4CQJA 4DA6A 4WBNB 2GXUA 4YECA 5KYYA 3CZ4A 5LZ4A 4ZKEA 2XIDA 4OHYA 2VLBA 1JHXA 1VBFA 2Y2UA 5IMSA 4TRRA 2WKSA 3RANA 2VUHB 3NT2A 3JQAB 3SQXA 2R6JA 5CHYA 3X1WA 3EISA 3QJGA 1CWUA 5JQGF 5KX5F 3GUUA 1KC3A 3ZD9A 1MPXA 3FTNA 3QKSB 4FZVA 4URHA 4PGFA 3VPXA 1OB5A 2V5AA 1TJ3A 2F3TA 3I2GA 2ZJ4A 4RF4A 1V1RA 3TFQA 4RNDB 2I1QA 3H4VA 4I1RA 2Y76A 3DW3X 5IBCA 2EKBA 1CPYA 3CNHA 4U5QA 4RZ2A 4MINA 4QELA 2OSBA 3AJ8A 3L07A 4Q39A 3EQ6A 3SHQA 3BGSA 5AK0A 5B1DA 1T43A 5C5DA 1YS6A 1GAJA 1T9GR 4IDEA 2P9GA 1Z5ZA 2NYAA 1MVNA 621PA 1CS0B 3FE2A 4LY6A 4EH1A 2BHLA 2ZYWX 3OM1A 5BWBA 1CY6A 3UWKA 2ZWOA 4OO1J 3H6KA 3BFVA 1EP3B 2IF2A 4BNIA 4O5EA 3GEHA 1EX1A 1G0OA 3PDWA 2QL9A 3ZWDA 3PGKA 2JCYA 3N2EA 1CB0A 2CLEB 5F51A 2KQUA 5I7HA 4DRYA 1R8SA 4U7FA 2ONKA 1OA1A 3K9FC 3B3AA 1UM8A 3KWLA 4ALKA 3LWNA 4XFJA 3GQBA 4DC9A 4AYTA 3QKTA 3KB1A 5TQ0B 1SD5A 2GCEA 1Q84A 3P71T 4C6HA 1IUOA 1DIGA 3RSLA 2V3CC 2PFNA 3AEYA 3EVAA 1KY3A 2CBZA 3COVA 3TBKA 4N8EA 9ABPA 4NG4A 3JPYA 4OVKA 3RUEA 3V8BA 2WYHA 2Y9UA 3BEDA 1OF1A 3PSFA 2O5VA 3IEXA 4DB4A 2X2OA 1RE0A 2PGDA 3K0FA 5JHHB 2BMJA 4YRTA 4IGIA 9ICMA 4PVDA 1V1MB 4XYGA 1AA6A 1F8YA 1GSOA 4I8IA 2V97A 5LYJB 4R2HA 3M6XA 2VJPA 4RLSA 2ORVA 4QZFA 2BFEA 1AKNA 2KE7A 3ZW9A 4FR2A 2QLLA 1EIZA 1LK7A 3AU6A 5GJCA 2QRVA 2XOKD 2WNSA 3ICXA 5B3JC 5EWMA 1W1WA 2WF8A 3CUSA 1ADYA 2HO5A 1I32A 1C7IA 4OU4A 4NHEA 4WEOA 3SS8A 1QK4A 2Z6AA 1D8TA 2PL5A 1XTUA 1GZ3A 5C1IA 1DP4A 4O9MA 1AGXA 1KGSA 3JQ9A 3HT3A 3FRIA 2OM2A 4RK0A 4CEIB 4C20A 1PNQA 1FMFA 3BM5A 2BSAA 4TQSA 4HPJB 3AR3A 4C0ZA 1SXIA 1BWQA 3L41A 4CDGA 1OC4A 1Z07A 5T6BA 2Q41A 2BGKA 2ZB7A 2BZGA 2VKTA 2K7FA 1MJGA 2GVDC 1M6WA 2C7PA 4L16A 4FSDA 4X1KB 3QELB 1R0CA 3ELDA 1K3TA 5TMBA 5K0LA 3PLAE 2J0QA 1Y3DE 1Z4IA 2I6XA 1EQUA 4UAVA 3AWDA 4LRQA 1RRKA 5LZ9A 4X6UA 4HYYA 4RTQA 1WA5A 1CDDA 4P3NA 1PJAA 2IH5A 4RHFA 4P0QA 1LEHA 1D5WA 3HA5A 3FKSD 2V7XA 3B36A 3R3UA 4MYRA 4XGRA 2DT5A 1JSZA 1VPTA 1KTQA 5ALDA 4ZI7F 4KGDA 4J29A 2ZYGA 1B8PA 1NI3A 2R18A 2HZ7A 3D7SA 3L8GA 4DAEA 4JYPA 3U37A 3SF0A 3WYEA 9ICIA 5JQGA 5KX5A 5A0FA 4RY9A 5TS3A 2BF4A 4IHJF 3W3ZB 2WUEA 5SYAA 3ZJ5A 1PJ8A 4F2DA 3TZQA 4Y6PA 4CQMB 4D0SA 1VIDA 4ITRC 2KHZA 3D7KA 5CB1A 4KR0A 3LUBA 2ZUCA 3RHSA 3WIBA 2CXXA 4EIWA 1UEIA 3HDVA 2B0JA 4BQEA 2DQYA 3GA0A 5HZKA 2Q4DA 4DJFC 3PRHA 5JECA 4NLLA 4H59A 2GD6A 2XUFA 1YUBA 1JG1A 2FJ6A 5BOSA 2IH4A 4DOAA 2PZEA 4XDGA 2GHRA 2CLCX 3D8TA 4F46A 2FMFA 3EASA 4BNDA 5HA5A 3I2KA 1SKWA 2R5FA 3ZKWA 4KN6A 3Q8SB 4IWNA 4WN9B 4RPZA 3IQGX 2YXLA 5BN5B 1UPHA 2EDAA 1JFTA 3REOA 3L7CA 1G8PA 2YCBA 4B3FX 1XQXA 2BR0A 1YNOA 2G88A 4BNWA 1R0XA 2WMOB 3MQFA 3L8YA 3F78A 2BFAA 4R1TA 3LHIA 2IYEA 4KC0A 5CFZA 2CSUA 2M6KA 1B6TA 5JXIA 4YMIA 4L8GA 1SKAA 1TEZA 4H9GA 4I50B 4NMWA 1XZGA 2NYUA 4WY5A 3ZHSA 3A9TA 2YB4A 2EC5A 1XLTA 2Y6VA 4EG7A 1OH6A 3D2QA 1HYBA 4Q4HA 3B0XA 4O4HA 1X77A 3ZDRA 6YASA 1PNRA 2WUVA 2XITA 4JI3B 1W5EA 4UARA 1IM5A 2GFHA 1DOQA 5CX4A 3LUFA 1DAKA 1P44A 2EZ9A 5C5EA 2QM0A 2E85A 1LLFA 1T0IA 2HZBA 5CK5A 3K0HA 5ECDA 4HUTA 3GMIA 2WRZA 3OX2A 2KB0A 3U4CA 3T3FA 3EQZA 2AHRA 1BNOA 5LP6B 4NYJQ 2ROQA 2DWUA 2FWRA 4G25A 4ZPXA 2FGJA 1XKQA 1T5DX 2DQNB 2ZW9A 2C07A 2VAWA 4QUHA 5HRAA 5AI8A 3JQ7A 5HXAA 8ICPA 4ROSA 4H7JA 1CDOA 3OX3A 1TEXA