2NO5A

Crystal structure analysis of a dehalogenase with intermediate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
224
Chain Sequence
b'LVDSLRACVFAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-2-haloacid dehalogenase IVA
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Hydrolase
total genus 88
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no5A01
5AI8A 3NANA 4UASA 3QUBA 1T9ZA 2GHTA 2EARA 4NV0A 5AVRA 5AVUA 4BX3A 3WK4A 2G06A 5AW5A 2IYEA 5AKEA 2AGVA 3PGLA 4YIKA 2QYHA 2ZBEA 5AW8A 1RKUA 1RMTA 5JJBA 2YY6A 4EX7A 5AW1A 2I7DA 4EENA 5AICA 5ALRA 1PW5A 5AI4A 2PQ0A 3SKYA 2RBKA 1EK2A 4XPZA 5ALNA 1VFPA 3QU9A 1J97A 1X42A 3NIWA 4XOUA 2C8LA 3HLTA 3MMZA 3AR2A 3MC1A 3GYGA 4UU0A 3L0BA 3D6JA 3VAYA 2FDRA 4UM7A 3IB6A 3EF0A 4FE3A 3NRJA 1EK1A 4HAIA 2PKEA 3UM9A 3U7EB 3FPSA 2AH5A 2HX1A 3FVVA 4KYTA 5ALXA 4EELA 3M1YA 3E81A 4Y2TA 3WKAA 5ALOA 2OA0A 2JAUA 5ALQA 4UM5A 3UMBA 4JB3A 2FPRA 2G0AA 2HEGA 1Z4IA 3QUQA 3W5DA 2CN1A 4UAVA 3U7FB 3I1YA 2CFSA 2FEAA 3DDHA 3WK7A 3NAMA 1Z88A 2QLTA 2W4MA 3W5BA 1WZCA 4C4SA 2W43A 3NASA 3OPXA 3EWIA 2WF7A 4Y2RA 3K1ZA 2P9JA 1CQZA 3L0YA 3L8FA 4Y2XA 2BDEA 2HF2A 2FI1A 1CR6A 5ALEA 4HGRA 3AR3A 3KD3A 3ZVLA 1ZD3A 2HHLA 4BX0A 3WGUA 3WKDA 2CFRA 2MSNA 1Z4OA 5AVTA 4HGOA 3ZW7A 1ZD2P 2FPXA 2IOHA 1ZD4A 2GO7A 4QJBA 5AM2A 2YMQA 1Z5UA 1RRCA 1U2TA 5AHXA 5AVXA 3A1CA 3I76A 5AM5A 1RLTA 3A1DA 4YCNA 5AW3A 5AKXA 5AW7A 4B6JA 1Z4PX 5AVZA 2WHEA 3W5AA 3WK8A 5AESA 3QU7A 4Y2UA 3OCVA 2B8JA 5T41A 5ALKA 4BNDA 4C4RA 2CFTA 2WF5A 2HO4A 5ALHA 2HOQA 4G9BA 1QQ5A 3OCWA 1RKVA 2NO5A 2IA5A 4UARA 3A1EA 4AS2A 3I6BA 4DWOA 5AK4A 4F72A 1Z4LA 4AP9A 4ZEWA 1O08A 3ZVMA 1L8OA 3OCYA 4BEWA 1XVIA 5AIAA 4DW8A 3CNHA 2WF9A 3TLMA 4UAUA 4YIHA 4DFDA 1ZRNA 2FPSA 2IOFA 3R9KA 4F71A 3N07A 3ONNA 2C4NA 3PDWA 5IT4A 2OYCA 2MU2A 1L7OA 3P96A 1RQLA 1RKQA 3ED5A 3L0CA 2ZXEA 3ZX4A 3B9BA 2B1RA 1RMYA 5A3QA 1NF2A 5AM0A 2I33A 4YCMA 1U02A 1RLMA 5AVYA 4OFZA 3QXGA 2FUEA 3QU2A 5ALFA 4L6AA 3QUCA 1YS9A 2WM8A 2C88A 5AVWA 1MH9A 3ZUPA 3R4CA 4UATA 3SHQA 2D2VA 4BKMA 3SKXA 4OD0A 1J8DA 2P11A 1U2SA 4RETA 4CF3A 3U13A 1SWVA 2B30A 3U19A 1VJ5A 3M9LA 3L1UA 3WK6A 2P69A 4EEKA 1IWOA 3QU4A 3WKEA 2RB5A 3WKBA 3A3YA 4G63A 3QUTA 1ZOLA 5AKGA 3WGVA 3ET5A 4IG4A 2NO4A 2GFHA 3NALA 3I28A 4XE5A 1YMQA 5AM4A 1N8NA 3FPBA 3L5KA 1LVHA 1Y8AA 3QNMA 2JARA 2YJ5A 4GIBA 4KN8A 5ALZA 2HCFA 4YCLA 2WFAA 3ZVNA 2Q5EA 1T5SA 5ALPA 1Z4KA 2RARA 3KZXA 3BWVA 5AVVA 3ZTWA 5ALYA 2YJ4A 3MN1A 2YMMA 1K1EA 4FFDA 4CNQA 1T5TA 3IJ5A 1NNLA 4J03A 4Y2YA 4ZEVA 4OCZA 3ZWDA 3L1VA 4L6CA 3RFUA 2AUTA 3F9RA 2YFYA 4CF5A 1WPGA 3WK9A 2IOFK 4E88A 1TJ5A 3ZWKA 1YNSA 1Z4MA 2WF6A 4JDPA 3L8EA 4Y2QA 4NAVA 1YJ5A 5AW4A 3ZX5A 1RDFA 5AK3A 3ET4A 3QYPA 2R8XA 3IRUA 2EATA 4H1WA 5ALDA 2B1QA 3EPRA 4HGNA 5AW6A 4UW9A 3FZQA 4UMEA 3HYCA 3B9RA 3ESQA 5E0OA 3DNPA 4UMVA 3FM9A 2ZG6A 3OCXA 1AQ6A 4I9GA 1Z4NA 2PR7A 4XQ0A 2OBBA 3N1UA 1Z4JA 2ZBFA 5A3RA 2HI0A 4MUMA 3BA6A 1L7MA 1F5SA 4UMDA 1YDFA 3OCZA 3U7HB 3B8EA 3WKCA 2GHQA 2MU1A 1JUDA 2P27A 5AKZA 1RC8A 3ZU6A 2FPWA 3R09A 5AI0A 1U7PA 3CZ4A 1ZJJA 2VKQA 5AKYA 3EF1A 1L6RA 3AR4A 3L8GA 1L7PA 5ALWA 3FGOA 1QQ7A 2JGAA 4BYGA 2ZBGA 4BBJA 2B8EA 4MWOA 4NWIA 5ALTA 3NUQA 4HGPA 1RLOA 2JAWA 3L7YA 4Y2PA 4KX3A 4NABA 5AKLA 5ALMA 4YH1A 1Z4QA 3QGMA 5AK6A 4QQFA 1Q91A 3PCTA 5ALJA 1ZD5A 4EX6A 5AW9A 4CF4A 5AM3A 2ZBDA 4FYPA 4NFLA 2BDUA 2YMLA 4YGYA 5ALVA 5AIBA 3AR9A 2OM6A 3SLRA 4BNDB 4ZEXA 3SMVA 2G07A 3DV9A 4Y2JA 4RESA 4BEVA 4HYTA 3QU5A 2WF8A 1LTQA 5IS2A 4KNWA 1QQ6A 2B0CA 1TJ3A 2C9MA 2GMWA 3WK5A 4EZEA 5AI9A 2FPUA 5ALGA 3SD7A 5AKHA 3AR6A 4PNHA 1KYTA 1SU4A 4BX2A 1TJ4A 1RQNA 3QX7A 3L8HA 4Y2VA 1RMQA 3AR7A 1ZRMA 3QLEA 2YN4A 4C4TA 1XP5A 1O03A 1S2OA 2R8ZA 1Z5GA 3E84A 1L8LA 2HF7A 1S8OA 1VJRA 5ALIA 5ALLA 5IT0A 4L57A 1U7OA 3KC2A 5AW2A 3J7TA 3OTQA 2BY4A 1TE2A 1TA0A 4CE6A 4KX5A 5AK5A 4HGQA 2ODAA 2R8YA 1NRWA 5ALUA 3UMCA 2FUCA 2YJ6A 1WVIA 3MPOA 2X4DA 3S6JA 4Y2SA 3AR5A 5AKJA 3ZI4A 4O8CA 3RF6A 1FEZA 3UMGA 5ALSA 2AMYA 2G08A 5AVQA 2YBDA 4OHFA 2I34A 1ZS9A 1XPJA 2I55A 3U26A 1N9KA 2ZOSA 3KOOA 3E58A 1WR8A 3KDPA 2W11A 4GXTA 3ESRA 2YJ3A 5AM1A 5AI5A 3U7GA 2Q4RA 2NYVA 5AI6A 4IFTA 3OCUA 5AKIA 2I54A 3DAOA 2G09A 1QH9A 2G80A 5FP0A 2R8EA 5A3SA 1L7NA 3PGVA 2O2XA 5AW0A 2Q4TA 4I9FA 3W5CA 3N5KA 1QYIA 3N28A 2HDOA 4Y3UA 2RAVA 2B82A 4UU1A 3AR8A 3SF0A 2I6XA 2JAOA 2YMPA 3E8MA 2DQSA 4AS3A 2HSZA 4J2TA 3ZTYA 5AVSA 4KNVA 3KBBA 2EAUA 1Q92A 2C8KA 1YV9A 4DCCA 2G1AA 1RPZA 4UMFA 2O9JA 1SWWA 5AKKA 3N8GA
chains in the Genus database with same CATH superfamily
4WKCA 4TSRA 3OKFA 4UDXX 2O2YA 2CF6A 4HATA 3MNFA 2XPCA 3KV3O 5EKUA 2HCTA 4WGGA 3KR9A 3UCXA 1AKVA 3NV9A 2BR5A 1QJCA 3FYTA 2XBMA 4E7OA 3EBPA 5AI4A 4HZUA 4BNVA 2H4XA 1YZYA 5TVKA 2DERA 3ACCA 2OMEA 2HD4A 4MS3B 4CG3A 1JEYB 1T6ZA 1ZC4A 1PEDA 3IL2A 4ICAA 3ETDA 1XTVA 1YFZA 1Y8QB 2YWFA 1V11B 3M1YA 3T6KA 2C78A 1Y4AE 3H3JA 2IMWP 2BUCA 4D9KA 1UM9B 2QTWB 4XA8A 4JLNA 1NSFA 3CWZA 4COKA 4ZO7A 3F98A 4I1VA 3BJYA 1IPFA 4ZMBA 2A78A 1J0DA 2Y76A 1NZJA 1C7FA 1EP1B 4HX9A 4J4TA 1FTWA 5AO9A 5L1LA 4X54A 1ZD4A 3THYA 3M1LA 2WWXA 2ZBRA 3TVYA 1PT5A 1W36D 2GESA 2AKEA 2I7TA 2QL9A 3UHPA 5JALA 1IBLB 1MB0A 1EG2A 4BN5A 2ZYGA 1JDNA 4WXEA 3WRXC 1TCVA 4MQBA 2WZCA 2AOXA 1X15A 5CVVA 4B3SB 2H7CA 4DQRA 1LI5A 4I4IA 3TQQA 1FNMA 1L7EA 3CLKA 1J70A 2ZI7A 3PXDA 1D5CA 4F4KA 2WVHA 5KFNA 4C87A 1MV8A 1R1DA 1RM5A 3HVIA 2XE8A 2AZMA 2BGIA 2FMKA 2QT9A 3VU9B 4X61A 2Q27A 1OVMA 2JJQA 5GAJA 1JROA 1KJWA 1LLCA 5A7GA 2CRXA 1IVSA 1VMKA 3VJKA 4KN6A 4OUKX 4RQBA 3BJEA 5BRNA 1AHHA 3PHLA 1SWVA 1E1RD 4F4FA 4Y9DA 4O5CA 4RQ4A 3QUTA 4Z5XA 1ZOLA 5D01A 1WDKA 3K2IA 1KI2A 1LPPA 4CKZA 3TTYA 2IY7A 5BWOA 1V9LA 5DM0A 4HYYA 4M0MA 4I2JA 1VL0A 3GDOA 1SXPA 5BO5A 5CNJA 3GJ3A 4LE1A 3UATA 3RQIA 5E2AA 1YE8A 1JPJA 1DARA 1C0KA 3K8YA 3IP6A 4ZQFA 5FNVF 2QE7D 3TZLA 4FCCA 4BN4A 2O3QA 4TM8A 3ZHQA 2PA0A 4AQYB 3NAZA 5EJGA 4FT4A 4H7DA 2AI3A 3QMWA 5BXYA 2O4UX 2WKSA 2FN4A 2PV0A 2VBFA 3KYCA 3D2NA 4Z0TA 1ZM4A 2UVVA 1KPGA 3RVRA 4PN3A 5F5LA 5F12A 4N6OA 1M33A 3QKIA 4QQFA 1GXSB 4XUDA 2FN9A 5CBPB 2ECQA 5BN3B 4ZI3A 3C5VA 4K9SA 2DECA 2QRLA 5JSHA 4NONA 3LWNA 4NENA 1JRLA 4E1AA 2C7BA 3SD7A 2YUTA 1TFUA 3TL6A 4ZU1X 4AM8A 4FHDA 2OO5A 1NK9A 4YP9A 1S5PA 3Q7TA 1GWNA 2FE1A 4MAMA 5KPJA 1M76A 4DQSA 4JWMA 3GGCA 2A1AA 1G7SA 4CE6A 3COWA 4OFXA 2E87A 4YJ3B 2PWPA 4DL9A 2EGUA 1ZJYA 1T25A 1QP0A 3OD1A 2H4ZA 2AB0A 4GW3A 4FEGA 5CFMA 4GLFA 5B6IA 1M6VB 2C4MA 5HXAA 4TXMA 3U0VA 1QHEA 2QGZA 2F2TA 3PW2A 5BVGA 1P17A 4W5QA 4WOKA 1NWCA 4ECWA 2Q4DA 1P7ZA 4TXLA 1HMYA 2LUOA 2RKWA 3OPMA 1SG6A 1NSTA 1H5QA 5IBRA 3QEJA 4TTJA 3QUBA 1VE1A 1T3LA 3QH4A 4E5UA 3O3CA 1U8UA 3WK4A 3MF4A 3SICE 1ML4A 4P9NA 4IV8A 4K6CA 5BPCA 1ZXLA 4NFHA 1Z75A 1I7SB 8ICMA 4CMEA 1GP2A 4DOMA 5EE9A 4KR6A 4DANA 1U1IA 4WH0A 4E22A 3SC4A 2M6KA 2OHJA 4RNDB 4WK0B 1MAUA 1FSGA 2H48A 5GM1A 3A4MA 2OFPA 4EHBA 1FZQA 2F4NA 2IBSA 1WUJS 4P4LA 4MQFB 5M04A 3G9UA 1CU1A 3QUQA 2ZCVA 3BIOA 4A2CA 3AG6A 3LZDA 4JOCA 3GDXA 3NAMA 1TGYA 2RFLA 3BDIA 2YIJA 3UXPA 3BVPA 1G16A 3ELDA 3KEGA 4HAWA 3TFOA 3AUFA 4GO1A 1Z5UA 3V32A 2WKWA 1NE7A 4UPDA 2Q9CA 5DG8A 2XIJA 1DKRA 2V7QA 3EVTA 4XM1A 4DFJA 3BPSA 3M9OB 3CU5A 2CUTA 4HR7A 4MO2A 4CCWA 3MM4A 1H0KA 4HQFA 1J2NA 1P7CA 2J9YB 4G01B 2XDWA 4JT4A 3D02A 4RSGA 4ZKEA 1T0BA 2Q28A 3T54A 3DOFA 3OMLA 2ZYHA 2IHYA 1X80B 2BFCA 2N75A 3F4BA 4RS4A 4ZVKA 4S0ZA 4I3HA 2CLFB 2EZ9A 1FUEA 1JDSA 3STXA 2HDHA 2H3EA 2NTNA 4OYRA 2H63A 3ZHBA 3GV8B 1KOJA 4KYVA 1O5TA 3AM5A 1QIEA 3COZA 3U56A 4R51A 1E0KA 1NNUA 2BI4A 4BZWA 1QO0A 4TTAA 2GS9A 4PQRA 1R8QA 1V16A 1MC5A 1EVQA 1ADBA 3ZZMA 1L3TA 4U0JA 3JWGA 1JIHA 1J8FA 4MDEA 5ITVA 3DQZA 4ISCA 3WO0A 2WKRA 3RYIA 4B6EA 1Y7IA 2ILTA 5DHRA 4RY0A 3F2CA 4ZT7A 4MINA 1CF2O 1NOIA 5I7VA 4EUHA 1VMDA 3I6MA 5KYYB 1U0TA 4PWZA 4LOJA 1UBMS 1I2ZA 5D51S 5L3VA 1ENYA 1TVEA 1ZEJA 3VNQA 2WZDA 4J90A 4JUFA 2OGWA 3PQ7A 2FG6C 2GCOA 4H77A 4P86A 5J0OA 1CE8B 1XQYA 4QWBA 4PW0A 4FEYA 4PG5A 3RAPR 3ADPA 1F7VA 1S8FA 3NFRA 3Q1LA 3V7KA 1M0SA 3IP9A 4LCBA 4ECSA 3G8YA 1PVRA 4MVJH 4OF4A 1NW9B 3UNXA 4P4OA 4U63A 4AD8A 4IINA 2LYHA 1AB6A 5EQDA 4U2CA 1IU9A 1M2GA 5A9SA 1QKJA 3HCDA 1XEWY 1ZVQA 4HLQB 3C8UA 3IUSA 5B58T 2ZANA 5LQAA 2HNBA 3UMCA 3OIGA 4WKBA 3NEJA 1X9IA 2Z09A 1NN1A 1RPTA 2PTGA 3DO5A 3GNQA 4WFJA 2QTHA 3E3MA 2VDMB 5L95A 1SCNE 1XZCA 1VLMA 3KJFA 1OR8A 3NHPA 3WV5A 1ZEMA 3SJCA 2QM0A 2JFYA 1VYTA 2POQX 1KMNA 1PFWA 5DTMA 4P5DA 3BOSA 1RCTE 2EKPA 4LY6A 1V8PA 2ZS8A 2ZI5A 4XWGA 3LY9A 4PR0A 2VDUE 4ENVA 2I6TA 5JD4A 1WY7A 2JEFA 2EGGA 1OAOC 1KMIY 3PE6A 2YC2C 5K3BA 2XCOA 1R0WA 1QRTA 5JROA 1HI9A 3D7SA 5CYOA 3G2HA 1TTQB 4B3MB 1RPLA 1SXJC 5ALRA 3ZLBA 3TJMA 3H4DA 5TPZD 5ALNA 5DCWA 2F8SA 2YQ4A 4LDNA 3PRYA 2YY7A 3KD2A 2BHNA 2G8NA 4AX4A 2P1RA 1JHXA 3WGHA 2PKWA 1UCVA 3D6UA 1E4YA 3E9QA 2DBYA 3HILA 1Z8FA 5C5EA 5DBHX 3FUUA 2EFJA 2Q5LA 2JCXA 2R8JA 2IP1A 5DLFA 5EWMB 2Q1UA 1FTQA 3JPPA 1U2EA 4PONA 5H16A 2SICE 3ETJA 4UU7A 4TTVA 1DMRA 1UJMA 3TZQA 1J5EB 3GLIA 1HH4A 3GJXC 1LQTA 4CDNA 2OOKA 4ADSG 4YN3A 1XCBA 4TN1A 2JDIA 4HZIA 2GLEA 3FYUC 1E79A 4GR5A 1K88A 1U80A 5C1DA 4R41A 3N2IA 4WADA 4U3JA 1EVKA 3ZDFA 1XZGA 4GKBA 4BEWA 2BZ0A 3VR3A 9ICHA 2F17A 2GTIA 4J0EA 3TD2A 2KEYA 1FDVA 3PV8A 3P2EA 1OGJA 1ACMA 3QJGA 2Q2WA 1KI6A 3MB5A 4HAVA 5JG7A 2RSLA 3ASVA 2H5LA 2H8GA 2YVUA 1TKRA 3NVDA 2I7VA 1WAMA 2RJOA 3KTAA 1EWVA 1SO8A 2KJ8A 2DQKA 2PNJA 3EZ2A 3PZRA 3CPHA 4RK6A 3JWEA 4EUFA 4EPRA 1C1HA 1Y3FE 1R2QA 5BV2P 3AL0C 4L72A 1SD1A 1X6VA 1YRQA 1TYCA 1P4SA 5EG5A 4RX1A 3WO1A 3DMNA 4PZAA 2JZNA 2JD2A 4YT4A 3AZQA 3P2KA 4YAEA 4X3OA 4DBLE 3LHKA 1DC3A 3QWBA 4D5EA 3ZQJA 2XTMA 3A36A 2C99A 4TMVA 1Y63A 4YASA 1F51E 1NXTA 2AKYA 2EZUA 3L8EA 5BOVA 4E2YA 3OH8A 1NK6A 2OCAA 5HM6A 2LE0A 2DWOA 1PR3A 5AH0A 4HGZA 4KFRA 2XCSB 1KZGB 4G36A 4WLNA 2O6KA 2QUHA 5K0JA 2EBHX 4GBED 3BRWD 2JC3A 2XRZA 4EVQA 2YV3A 2ZIUB 2XY7A 3P0EA 2O07A 1PBNA 3EMDA 4Q4CA 1SOAA 2TYSB 1HETA 4AJOA 4BGUA 1DZ3A 9ICEA 2K4PA 2R8IA 1PN3A 1BCSA 1ZUWA 1VE5A 1XD2A 4B09A 3PQ2A 4M0DA 4QYMA 3LT4A 2BI7A 1U3TA 2Z9BA 3CLVA 2C3MA 2XE4A 4OV6B 4FSHA 4ED0A 4K2HA 3MJDA 2C9MA 4P4SA 2A8YA 1MG0A 1UOPA 3I5UA 1YFJA 5G5HA 3OUTA 4QQRA 3QVUA 3A27A 1BGVA 2WFMA 3QXSA 5ABPA 4I46A 4FFBA 2I9GA 3OM0A 4EF5A 2O5CA 4S1TA 3EOBI 2LNDA 5CB4A 1ZO8A 1WU8A 3IIMA 3ZHCA 5B2ZA 2H1LA 2DUYA 4ZKDA 2OTCA 1WUKS 1PYDA 3AR5A 3ZWWA 1JMKC 1JMYA 1FEZA 1FTNA 3OY7A 5KKAA 3HHEA 5TV2A 1SD2A 2QR2A 2YTUA 1GSIA 2P9TA 4N6NA 3MQ4A 4YR7A 1JN0A 4UB1A 1DQNA 1ZZGA 4FFOA 1NL3A 4PO1A 1E6EA 1R8JA 1SB3C 1ZNXA 1GAXA 1KL9A 4X41A 1V5WA 4O5OA 1ZCBA 3DWFA 1C4KA 521PA 2VQFB 4EBCA 2GD2A 1ZCJA 1QIJA 5IJXA 2JEZA 3OEHA 2UYOA 4MRVA 4FOSA 5JATA 3S2IA 4HD8A 4NATA 5JDCC 1O6ZA 2G06A 5K6AA 2BE7A 2WG2A 4XD7A 2Q8NA 4NLGA 4KR2A 4FZ3A 1E89A 3Q0TA 3CPJB 3QPCA 3IURA 1ZINA 4PGGA 1FMTA 2JA1A 3GRRA 2OVBA 3PQ5A 7ICIA 4UPEA 2WVGA 4MVJI 2DPLA 1EI9A 1HYGA 1CUZA 4JP1A 3F6PA 1LSOA 1PLLA 3LPLA 1V8OA 2D0DA 1PQWA 1UMDA 8ADHA 2XKAA 4JB3A 4YJKA 1PR5A 1NLYA 3FGPA 5LQJA 2C1XA 1WM1A 1QAOA 3K7EA 4R63A 1GPJA 3C6QA 1UH5A 2QT1A 4ZT2A 4A9AA 1UF9A 1HE2A 3AJDA 1LB1B 2CY0A 2ECFA 4DRXB 3DBRB 5D6NA 4PM4A 2DUMA 5K0ZA 3F53A 3X1YA 2Z8ZA 121PA 1L8AA 4OL0A 3CBGA 3G2LA 5K6RA 3OAAA 3QVJA 4QBHA 1KBZA 4RJTA 3S2YA 2XCPA 3QYFA 3KQKA 4JXKA 1IPEA 1XCJA 5EWLB 3HGMA 4JBXA 1KKUA 5AUQA 5AK0A 1NN0A 3UJ6A 1BXRB 5F4ZA 5JQGA 3I5MA 3PB3A 1I1QB 1AKEA 2J09A 4IGKA 1Z0UA 3W4KA 3VHXB 2OEHA 1S4QA 3KKEA 1OXXK 1Z7EA 2LIVA 4IVQA 4BE7B 5LMNB 5J2AA 3GAMA 4QJ3A 2FUEA 1N5LA 5T5QA 5ARBA 4GXRA 4CWAA 3W3AA 2P11A 4BTLA 5BSEA 3ROFA 1J7KA 3F6CA 2J9FA 4ARZB 2H6EA 2GXQA 1V6SA 5LCXA 1Z3EB 3N2ZB 3RB0A 5DN9A 4G5YA 3PMNA 3AEQB 5DYYA 1MC8A 4JXJA 4QTUB 4C30A 3WBJA 4DEXA 3FOWA 1RI4A 5TJHA 3C1OA 3RJGA 4DS4A 3ORRA 3GP8A 3WMGA 3G2MA 3BS5B 4NEGA 1NV9A 3ND9A 4QOHA 1PNRA 1QQAA 2XB4A 5H3HA 2W55A 3ROQA 1BRMA 2IY9A 2EL9A 3EPRA 3FMVA 5LLDA 4UW9A 2IHBA 3FWYA 2QDKA 3T7IA 2C00A 3UMMA 5AXDA 4BRWA 5EFZA 2P66A 3T4EA 3C29A 4K4HA 5H2FU 3E8XA 4FGJA 1U9IC 4NBLA 1Y37A 2GEDA 2FV8A 1ZJJA 5AQ1A 2W5UA 1L6RA 2JCBA 2Q7XA 4ZYTA 5FHQA 3O47A 4DE5A 3FGOA 1TM2A 1XRPA 2P75A 1YZNA 4BYGA 2J9XB 5JBNA 3VVMA 3KLOA 4G5XA 1GGNA 4OOEA 5JXHA 3EXIA 2NX2A 1S0MA 2ZWOA 5ALJA 4BMDA 2DH6A 1C8KA 3RSCA 2FWNA 3D8TA 5LLSA 3JWIA 3MJ4A 1O96A 4G89A 2XF8A 4ZT3A 1PVQA 4CV1A 4BFVA 4BNIA 1BWSA 2GMWA 2OLJA 4EPVA 3GQBB 4PH5A 4MEBA 4U5QA 4E32A 1KR5A 2R00C 1GA1A 4YP6A 1CX9B 2OC4A 3TDMA 5ALIA 3AM3A 3QENA 4TZ6A 4EQ6B 1C3EA 1KC1A 1AIPA 2FUCA 1PE0A 4YJ2A 5MHTA 4O8CA 4QYWA 1NVDA 1ZS9A 3DYVA 3E58A 3A0HU 2R6AA 3RNLA 2XJ9A 1ZQVA 2QN9A 4FUTA 2PGIA 3INTA 4Q19A 3LM8A 1TV9A 4XXHA 4O2LA 1YR1A 1TUEA 1NRXA 2V6GA 1YWGO 1P2VA 1Z37A 1KRXA 3E8MA 2C4UA 1GPWB 3RJMA 5KFGA 3HRIA 2FZCA 4GPEA 3BQ2A 1JU3A 4J9NA 3MBIA 1YVPA 2VNIA 4LBVA 4JC4A 3PFWO 2NAPA 3IP3A 3M6IA 2IU0A 3I09A 4NYJQ 2VT2A 5L1KA 1HFJA 3CONA 1HRKA 1C9MA 3IEKA 3CIOA 3CJTA 3M2PA 5LMZA 1WKCA 5AICA 4YUWA 1XZFA 1C0LA 1U4BA 4L7QA 4IDBA 3WSTA 4I5IA 5IEBA 3D4IA 3SIWA 2P6OA 2P78A 5EQJB 5LP6A 4JYAB 4TTRA 3C0KA 4RF3A 5DFAA 3RS5A 5A5VA 4NK4A 2BC9A 2WHPA 2O6LA 3BD9A 1UADA 3V3KA 1WBJB 5P8WA 5CHGA 1A1VA 3G02A 4L4ZA 3LMKA 4FIZA 2HYIC 5KFOA 2RHOA 1X7XA 1RXVA 1S0UA 4RFSA 2EGHA 1KQFA 4NZ9A 1CF9A 5K0SA 1K0FA 1GTG1 4L73A 1V1MA 4D9CA 3BM5A 4YMGA 1JZQA 2IC5A 1WCNA 3A1CA 5KJ6A 2XWQA 5BR1A 2ODGA 3PLNA 2OFOA 3WDSA 2I4LA 2ENWA 4WK4B 3O4GA 2QUJA 3RS0A 2H00A 4NCXA 2HMXA 3FVQA 1M2VB 3SU8A 5C5DA 3H84A 3J81k 1KI7A 3W5JA 1ZQXA 4IF6A 1UPXA 3DOJA 2VJBA 2PZJA 2ZE5A 3EGVA 1XT6A 5L6LB 3VTAA 1HWYA 3K35A 2UZ4A 2KZMA 3H6HA 5EWGA 2HHXA 2ACEA 5IT4A 1XHLA 1PUXA 4ZOAA 3UA4A 5I8ZA 5G0SA 4WN9B 1JQEA 2VWPA 3L0CA 3I05A 3EAQA 3PEYA 2CYAA 2QLMA 3ENQA 4PICA 5EKDA 1XNHA 2D0IA 2GO1A 1OZFA 5BMVB 4E5NA 5C8DA 3QBTA 1WZNA 5FI5A 3GLVA 3MGVA 3JQAD 1G9XA 1JEDA 1E1KA 3RHFA 3W8FA 2O8DB 1MQ3A 1UJ2A 2DPMA 1YS7A 4I4TA 2GDJA 5JXIA 2P35A 2IF0A 1OI2A 4EY3A 1JKMA 4US1R 1WCIA 4A8JB 3DH0A 3I28A 2I4MA 4W6ZA 2BKVA 4PEVA 1YE5A 4WZBA 4GIBA 1T8PA 1NV8A 4J29A 2DAPA 3X2SA 4AQDA 3GUVA 2QZ4A 5JO0A 2I1LA 2YNMD 4CYMA 2Q1SA 4K5QA 3I9LA 3IPXA 1XF9A 2UZIR 1NY5A 5CTAA 1B1AA 4H1WA 2A0XA 2PMEA 3B1WA 3U4AA 2HK6A 1OLSA 1C2TA 3GAZA 4PSKA 1MXFA 5KNCA 5ER9A 1WUDA 3JPQA 3LQKA 2ON6A 5HF6A 1PZNA 3FI9A 3HA7A 2J3DA 1JR6A 4FWBA 3AESB 3VGPA 2WHQA 2QB0A 3CZ4A 2VKQA 1CUGA 3GB9A 1KJIA 4KXLA 3BE6A 4B6GA 2P6NA 1W0CA 2DFLA 4D4LA 2O7SA 3PUKA 3FYDA 1H3FA 2C59A 4KMUA 5KFEA 2YZ7A 3SMQA 7ICJA 3RR7A 3JQPA 4O3NA 5JASA 4ZD6A 4YR9A 1Y88A 2GZ1A 3J7AC 3SK0A 3RVJA 2WF8A 1POXA 1XFDA 3RLFA 3WLAA 5DZSA 5EMNA 4F9EA 3QLVC 2WI8A 1P77A 2CLLB 5BQ5A 4K8OA 1EINA 2PU5A 4QGBA 3DXFA 2HF7A 4QRHA 4PCAA 2WSSA 1GOTA 4OYYA 3A70A 2ZXFA 4MA4A 1T9CA 3E5NA 4ZCQA 4YT5A 1GPNA 2QN6A 1N0WA 1PP4A 5ES3A 2IQIA 2EP8A 3WP1B 1KL7A 4FQ7A 2E48A 2W2NA 4OMFG 3E27A 3WDMA 3TGPA 4B45A 4MVJF 2YJ3A 1KVQA 2UZ1A 2Q4RA 5ULLA 4EPTA 2NYVA 4E46A 4PC3A 3CLSC 2X5XA 3REQB 4OBWA 3PICA 4U9HS 4EY4A 3WMEA 2FG5A 4GXKA 1HEIA 3DTVB 4L5BA 1QSLA 2YYZA 5TISU 4Q44A 4Q3KA 4FP9A 2NO1A 4ED1A 4HL6A 3GARA 2B37A 1QU3A 3N7UA 1SQSA 3KBBA 3GIJA 4AJJA 2WVJA 2P91A 3AHGA 3CF2A 1COOA 3GJTA 5K0CA 1PIWA 4ITUA 1X7DA 3QVSA 4YP3A 4ZU6X 3V55A 4IOJA 2Z2KA 4DB2A 4WBNA 4GP6A 2VYCA 2AWOA 1I1HA 2RGAA 3JATA 1SG0A 5K8CA 3V34A 4EM6A 3NIWA 1I10A 4JKYA 5CVJA 3VAYA 5AJTA 1VMEA 3IB6A 3JXEA 1EK1A 3Q1KA 1U1EA 3RKUA 4BNKA 2C92A 1T7PA 3ZXYA 4Q4LA 4BVBA 5HS4A 1V48A 5CFRA 1XEWX 1B14A 3H5VA 1R6BX 2FSFA 1QB8A 1O5IA 4BFTA 1UM8A 1YACA 2NXJA 4G2NA 5DTQA 1XI2A 1A8UA 5IDWA 4OJMX 5KNBH 2BFPA 1SQ5A 1GR1A 4UDYX 2OK8A 5AVTA 1Y1SA 2ZTMA 4QWEA 1XJQA 4HRXA 5CHEA 1LF5A 5HVNA 5EC8A 4GQAA 2ZB2A 4CFSA 3VZPA 3G9XA 2DKNA 2QZ9A 1WMDA 4C0QC 3N0XA 3KT6A 2HNKA 1X38A 1T9GS 3KSBC 4X1IB 3ZCRA 4CU2A 4D97A 4EITA 1V97A 1RWVA 1XK7A 3ICXA 5KINB 4RZ3A 1IHYA 4ND8B 3WGZA 2I0FA 4E7PA 4R3UC 3D81A 2P9FA 3U5TA 2BM9A 5EIBD 4OAOA 4NFSA 4X62B 4LUCA 3E5MA 4FB4A 4Y67A 3CIFA 3HYLA 4CM6A 1XWWA 3DV0B 3R8FA 2MSEB 3PX6A 4C3ZA 1TQ8A 1UQTA 3SHOA 3LY8A 3R5XA 3HRKA 3LRXA 3ZUPA 2DP4E 5L3RA 2DG2A 5DW3A 1GZ3A 4DABA 4GGOA 5F4BA 1MX3A 1P2GA 3H9QA 1X94A 4C8OA 3QMMA 4YJHA 1A72A 1X7YA 4QD3A 3WRYC 1LPBB 3CX8A 3DD1A 1AV7A 2DWPA 3IJ5A 3M83A 4WJZA 4PYKA 3BJMA 3H04A 4JGGA 4XLZA 3TSYA 3C3EA 3K1AA 4JDPA 1YJ5A 2JF0A 3QBJA 1COWD 5K0NA 2EQAA 2JCYA 1AX9A 2QPLA 4YQYA 3DNPA 4OP1A 1A2QA 2ZK7A 2NO0A 3HRDD 4NEHB 1XZKA 3A0RB 3A37A 2H4WA 4LE2A 1OF1A 3MBYA 1L7AA 2P27A 3WIDA 4IIGA 3EAGA 1YMVA 2I4RA 5AI0A 2WWHA 5F3XB 2KFNA 3QNWA 4ASUA 5JT1A 2JVJA 4WXPA 1L5SA 2D7JA 5K09A 3KE9A 3TLGA 1N5XA 3DR3A 4OLFA 5AW9A 4QO7A 1MRNA 3NWEA 4RT2A 4FYPA 5DB9A 4IIFA 2BJHA 3LGAA 1X1SA 5GGYA 2I65A 2OWEA 1XN4A 3HWSA 8ICCA 5EHIA 2IEAA 3AM1A 2XB6A 5BUQA 1KJ9A 3H13A 5E9QA 1YBFA 3R7AA 3V4SA 4MUJA 1X1RA 2C9YA 3HGQA 1GNQA 2Y1CA 4OI1A 3K5PA 1DWQA 1WQ1R 3J7TA 3SE0A 4ER3A 1EUCB 4KN4A 4F4XA 2W3SA 3S2SA 5CPBA 3T7DA 4Z54A 3STUA 5C2JB 3TLKA 2VPIA 4R1TA 5EZQA 1G8AA 2NZYA 4OQNA 5JO9A 2AL7A 2EEPA 3OSNA 1XZJA 4GP7A 2IYXA 3VZBA 7GPBA 1L5FA 4CM3A 2EAMA 3Q7SA 1TKBA 5FBKA 4K6HA 4D8WA 3LHIA 3EQ7A 5FTJA 1TAGA 2WDZA 3FYSA 3EEYA 2IWRA 1WD7A 4N47A 4FCVA 1E2GA 2EQ5A 4QOFA 4HDOB 3ZTYA 3JQFC 3L82B 4A5OA 4DEVA 1PZMA 1QKKA 1ZK1A 4QX6A 3UMRA 4IH1A 1XO0A 2UUCB 1E3QA 2YXNA 1E98A 2D1RA 1K5HA 2WWGA 2RHRA 3G7NA 4ZRMA 2OZEA 4BLTA 4O08A 4W1RA 2FWPA 2HKIA 4YMOA 2ZP1A 3P2YA 1X1AA 1SVKA 5FWNA 2XT6A 1IBMB 2BP7B 2CD9A 3DGEC 1T5BA 3FX2A 3FVVA 4HQ0A 4YDRA 1M67A 1ILWA 2EHDA 1FVXA 3UTCA 4YAJA 2R7MA 2VWHA 4AO7A 1HLFA 1ZD8A 2H18A 3O21A 3DDHA 1JB1A 4QT0A 3ZXUB 1OE0A 3FYCA 3NT5A 5JSZB 2J3KA 3OQ1A 3CW2C 4GH5A 2QRGA 1OQAA 2X8AA 4NPCA 4I2GA 4D46A 1QHSA 3I0NA 2KMDA 2CFRA 5A5EA 4KLUA 5CAEA 2B9VA 4TMXA 2VR1A 4RJIA 4B8YA 1FQJA 1GDTA 1C81A 4KXQA 3OP1A 4OP3A 1PL7A 2M1ZA 2HSWA 3WYAA 3DA8A 3IHQB 4IFIA 2CFTA 4NAHA 3NVYA 2HRBA 1DE0A 4LFBB 3OEWA 2H65A 3CP8A 2FPPB 5E2BA 3LKZA 3H9CA 3ITEA 4P84A 1DAOA 3W05A 1Q14A 3D6NB 3N2GB 4R9VA 3TG8A 1E3TA 4F0JA 1AOXA 3O1HB 3FCCA 4PBSA 1RKQA 1Y7PA 2A9OA 4XJSA 1OHHA 2ZVJA 1DT3A 3P2OA 5AOBA 1P7VA 1V95A 1JR2A 4Q18A 4RD2A 4L6AA 3QUCA 4KLNA 3OE1A 3U09A 5L3SB 1PDWA 2O8BA 5IWCA 4DRZA 2QN7A 3FR8A 4AZVA 4W1SA 3S68A 1N9GA 1U63A 3QU4A 1TAMA 2CF5A 3K1JA 5KKNB 1B0UA 5CA1F 3OQJA 1MQ9A 1UJNA 5HIMA 3WDKA 1LVHA 2ILVA 5BSKA 3K70D 3A4VA 3JU3A 4HZUB 2IEYA 2B25A 4NL9A 3TZKA 1C9YA 2WJYA 2HU7A 1BVSA 4F4CA 4UTOA 1RWBA 5B53A 4AI6A 3T41A 3VSEA 3FVWA 2DUWA 3V1TC 3RVMA 4Y1RA 3RFUA 1WB6A 4FNMA 2BF7A 3BQ0A 3ZWKA 1B3BA 1IN5A 1VCMA 1DKLA 4IJMA 5KOYA 3NVAA 1UCFA 4RZXA 5JZVA 2G70A 5G1NA 1A7AA 2GZ3A 2QTVA 3EFEA 3GLKA 3K16A 3VBEA 1N8SA 1PJ8A 1BDBA 5I9LA 1I3OA 5B12A 3SS7X 4F2DA 2Z98A 5FOQA 1GCUA 3GILA 1TK0A 3THYB 4M38A 3BFXA 4FMDF 5JWRA 4RDIA 1UMCA 1QK3A 2NT3A 1TM4E 1G5HA 2AFVA 2QX9A 2QF7A 1CWUA 5E1BA 4E08A 1VB5A 3QEBZ 2FSSA 2GAFA 3CXUA 1WXGA 3UOGA 2REOA 1C14A 3UKJA 5ALGA 2G67A 4CCHA 2E4YA 4DPMA 4OK6A 2Y6VA 1YJQA 2V8BA 3PFKA 3C3CA 3BN3A 5AT1A 1Q3UA 5AK5A 3QW4B 1CY8A 2N1BA 4KGVA 4DL3A 3VMFA 1LK0A 2OK7A 4DLGA 2VANA 2JJ1A 2RGXA 4K87A 4ZFNA 1IFXA 3FHTA 2XT0A 4BO1A 4RZQA 4HS9A 2I54A 4V03A 3T5HA 3FPHA 1Z6PA 1C9KA 3AF6A 1C8VB 1P44A 4H9GA 5K8VA 1UWCA 2JFOA 3NBZC 5DXFA 3U44A 4J2TA 3EMKA 3TOZA 4PO3X 1B6TA 2WIDA 2GK6A 5FPKA 3JR3A 4HDMA 3LKBA 3H5NA 2QU8A 5DB8A 1NJZA 1P4RA 3NCHA 2GVNA 4DR5B 1UXKA 2O3UA 1RZRA 4FMPA 3OX1A 2EP7A 3D5TA 1UODA 1SOMA 3CW8X 4XVUA 3R0IA 2PX2A 2VRWA 4GMXA 1I5RA 3WLEA 1SUAA 4XCXA 1PK8A 5EWJA 1XQWA 5F7OA 1YZQA 2FW8A 3CVUA 4ODIA 2HCRA 3VVCA 3FPSA 3KYCB 1IEWA 4MIEA 4W8GA 5ALXA 4NHEA 2EG5A 4FK8A 1U2GA 5ICFA 5DBAA 4DYHA 3LAWA 3PX2A 2H51A 4FTWA 2FRDC 4MJXA 1GGHA 1MTOA 2PS1A 4XRRA 1WZCA 1T5IA 3DLBA 3E2MA 2YV4A 2W9XA 1ZLXA 3L0YA 3VR6H 1PNTA 2W7PA 2J5RA 5CK4A 1LV7A 4NENB 1WMAA 1KY5A 1XDSA 2XYQA 2H1RA 4CHTA 3BQMB 1Q7RA 1J0CA 1GL9B 2YRFA 3B7WA 4UC0A 1XMXA 1YF3A 1W5BA 5CG2A 5BV1A 1FTYA 1OU0A 3ZWCA 1JBKA 4DLNA 1BXGA 2HOQA 4KH1A 4G9BA 3ZC3A 4YB8A 2X0DA 4WSOA 1QIHA 2PMBA 4R9RA 3IBFA 2W6ID 2B8TA 3QE0A 1ZSNA 4FX5A 3NKLA 1N6RA 4R0VA 3H75A 3RRJA 1NA5A 4JITA 4RHYA 4DLTA 9ICTA 3HE3A 1PNOA 5JUWA 3ED5A 1ZN9A 3ZX4A 5BVGB 8GPBA 1MAHA 1N1EA 5EERA 1L3CA 3IDZA 3ID6C 4U6NA 3UMVA 1BHQ1 4TZ0A 1Y8RA 4GR9A 1NJWA 3AWIA 1KP9A 3R4CA 4MV4A 4RQTA 4X97A 4UEOA 3LCJA 5HEKA 1MAAA 3PWZA 3ZUGA 4RV4A 5KT3A 3BL5A 3FAHA 4IZ6A 1SCJA 2JL1A 1A5BB 3QV2A 3CQ9A 1LWOA 3S99A 3ND7A 4W5TA 2FR0A 3G8DA 3AINA 3CLTD 4FVTA 1J1ZA 3EPGA 3MN1A 4PHTA 3LTEA 3GT0A 1UT8A 4RU1A 3I92A 4IJKA 5ESRA 1ND6A 2Z58A 3QFHA 4DNPA 2Y1OA 4A0FA 1RABA 1J2EA 1FDSA 2HI0A 5EHQA 3AEZA 3U9SA 4BP3A 4RMGA 5JH7F 5BP7A 5AKZA 5DV9A 2VYVA 5C32A 1WOYA 2HPVA 4ER0A 4BBJA 1KH2A 5IC4A 1O0SA 1BU8A 2CFIA 4A4DA 3KPVA 2ST1A 1XD9A 1USWA 1AUVA 1U04A 4UCQA 4UDNA 1FW6A 1UAGA 1UBRS 1OWLA 2SCUA 2WAOA 3CVJA 5JTUA 1HEYA 1G5RA 1P9WA 1Z34A 2PYDA 3KP1A 3PX3A 2VZ9A 3D8UA 3RODA 5LQKA 1YE3A 4B87A 3EXHC 1RBQA 4DSLA 1LK5A 1P1BA 4PHCA 4QXAA 2QP9X 4C4TA 4CMAA 4AMVA 1VSBA 1G4UR 4JJKA 3CRMA 3UHAA 3HN2A 2BFCB 4X20A 1T8YA 1ZLYA 2J4CA 2ZJ6A 3GDGA 5K3SA 1BOFA 1QCZA 2F67A 5LZ9A 1NULA 4UFPA 4AW9A 4AB1A 1XVVA 1SL2A 3OFNA 3W2HA 4E12A 2BH9A 4BKRA 5J0TA 3SC6A 5I3ZA 5EZYA 4L8GA 2B82A 2PH1A 1D2RA 4H3HB 1V16B 1KFKB 1ISGA 1W8DA 3K1RB 1O95D 2ISQA 1WB5A 5AKKA 2CHQA 3O9MA 5DWQA 2ZRPA 2VYNA 4H3KB 1V8FA 4ZXFA 4CM9D 4INPA 5BRAA 3KJHA 5J1SB 3I9OA 3LZ6A 3RYIB 5J0XA 5C81A 1HLDA 5CCDA 3Q8RB 5EMKA 2JFBA 1RD4A 2W2LD 2JAPA 4P82A 1J2JA 4N12A 3PEUA 2XYHA 3VPXA 4BB6A 5CIYA 4LJ4A 2ZDHA 1KYYA 2GCOB 2HA6A 1V8BA 4L51A 2IPOA 2C95A 3PJFA 3OPYA 4RIIA 3ZCXA 3LC7O 2OGSA 3K72B 3CM0A 2GF2A 3OO0A 5I51A 4C0KA 1XRNA 4RLSA 4BBAA 2PZGA 2ZYIA 1ZI9A 3JZIA 2MUTA 3X1ZA 4RW0A 3A1UA 3BDPA 3AMZA 3T5CA 5F98A 3WGUA 1SBIA 1HQDA 3CURA 3RIXA 4RKRA 4IG9A 2FMPA 2YXBA 1DQPA 3TAXA 1SB8A 2H1HA 1XSPA 5A9SB 1DV2A 2Y1LA 1XCLA 2X14A 1VYUA 3DAHA 1KETA 4OQMA 2BCEA 3ZK9A 3L3FX 3VYTB 3AKCA 2HYDA 1JMVA 1V7CA 3DE4X 4DWOA 1QX4A 3RJ9A 3VU1A 4L8FA 4LZWA 4UAUA 2ZRNA 3COSA 4NU6A 1QTIA 3ESZA 3CEHA 3KOWA 1S77D 2Q5OA 2XNSA 3B3QA 4GM1A 2Y05A 4H0CA 3KHRA 3NEPX 3HN6A 5HR5A 4INAA 3HBMA 4DXHA 4Z99A 4QIWC 1GSAA 1YQTA 1AHPA 1XNQB 4R3NA 3BE8A 4AY4A 4EG7A 1CHDA 1E5XA 1Q84A 5AYVA 4LEIA 1M1XB 3SQWA 1ZK4A 2QX8A 4YMUA 5BN1A 4PLPA 3BXOA 3ZBUA 4N7BA 2CVHA 3U19A 4K4IA 3T5GA 1NONA 5D6OA 3LYAA 4PINA 2SKEA 4P2HA 3RT7A 2ZE6A 2GCIA 1OY1A 2ECKA 1F2VA 4FSDA 1QIMA 4DZRA 3C5WP 4TUQA 2RARA 3B60A 4DNXA 2RHTA 5KREA 3VC1A 4RDHA 3WWPA 3W4IA 2C2DA 2PXIA 2NGRA 4FZNA 5DG7A 4DR4B 4MLPA 3ER9A 2IK8A 1SC1A 1LLUA 4PX3A 2JI4A 1IZYA 1VG9B 3BSWA 4Z9YA 2YDXA 3SXJA 1Q0HA 3OCXA 2Q0ZX 1Z4NA 3ZHUA 1RU3A 2BR4A 5JIBA 1Z7WA 3BORA 2R85A 4YC7A 2B7LA 3IDSA 3IQFA 4JAVC 1R0RE 2HZBA 1PJTA 4RPCA 5KU1A 4B34A 4BWFB 3RC9A 2B8EA 4RUCA 2ZSDA 2Z43A 3T1VA 4X3PA 4YN4A 1TYEB 4YJDA 1PJ2A 4I2CA 1IIPA 1OXKB 1UKEA 3GLIB 3RTEA 3CBQA 2E4AA 1LJLA 4E3WA 3EDOA 4BRUA 4JVMA 4WPGA 1ZQHA 4IR9A 1Z3IX 5GQSA 2F1HA 2JLYA 6AT1A 2B0CA 1Q5PA 4U3JB 4XVRA 4FXPA 1FXWF 5KAIU 5D5HA 1UBLS 2A57A 3R7NA 2Q6IA 3DQPA 3L7NA 1Z5GA 4P80A 2QLJA 3ROXA 5MGNA 1ZQPA 1KI6B 1N36B 2FZWA 5JAOA 4BKPA 2QJRA 1U3UA 1V41E 1B26A 3NM4A 3KTAB 2JRCA 1X6JA 3ZI4A 4HLDA 4IGIA 4RF2A 1BMQA 1FJXA 1NR7A 6NULA 2KHZA 2AG6A 4Z4EA 3PC2A 1VGRA 3N8KA 2MSKA 5LFAA 3ZGVA 3FNEA 3GFFA 3FDSA 4DWVA 5FP0A 3ICVA 3TUIC 4R8VA 3Q3IA 2HPAA 2HDOA 3PCXA 2VHEA 2OAP1 2DU8A 1W5TA 4DY4A 1FP2A 4II3A 4DL5A 2RGBA 2A35A 3ITKA 2YV1A 2Y66A 1XRJA 2NV2B 3HK2A 4B32A 4BCDA 4DLAA 1QGZA 4V0QA 2J6SA 1DAIA 1LDNA 4EW1A 3HCFA 1M1YA 3OJXA 4C1BA 3Q2OA 5FA5A 3HFJA 2W03A 1TX4B 4H3VA 3BXPA 2UVQA 2VH2A 2JBHA 1JPUA 3F5QA 2QL7A 4GI7A 2MJLA 3FNGA 1IN7A 1KE1A 5I47A 3UOWA 4TRNA 1J5XA 1BCSB 1GKLA 1XD2B 3HVRA 2CKDA 2L18A 4UAGA 1FU4A 4IGFA 1FIQA 2PD6A 1U28A 3PWKA 1E0DA 4KKVA 4EKYA 2HLDD 4K9DA 2IHTA 2ZYRA 3QG5A 8MHTA 3R6GA 3HO1A 2FX2A 1K7CA 3KUXA 4P4SB 1TT5A 4YY3B 4JDUA 4RGBA 2OCXA 2AGPA 5DB7A 4YCAA 2CL6X 2O50A 2HR1A 4FFBB 1RTKA 1SUEA 4F5WA 1EA7A 4HQRA 5DYNA 1B42A 5CB4B 1TYDE 3ZDRA 4L6IA 4MMYB 4KE7A 3PWTA 4L95C 5F35A 1DKOA 3NAGA 2MHCA 2ADFA 4I1PA 4IDEA 5FWAA 3RRFA 2C4NA 2A9KA 5LD2C 4M37A 4P33A 3KHSA 4L08A 2AR9A 1YRHA 1J24A 2ZM5A 1Z16A 3K0HA 5EE5B 1Q0PA 2YRWA 1SVIA 1AKQA 1BAPA 1NF9A 3BDVA 4ZV9A 2RGYA 3O8QA 4ZAZA 3W2TA 5BR4A 3C4QA 1S9DA 4PNPA 2A14A 3ROEA 1F6BA 1BEUB 3L1JA 3BXZA 3ISJA 3A3YA 1S3SA 2HHCA 1U11A 1KH3A 3ET5A 2A5FA 1AGRA 3HM9A 4V0ME 5ILQA 1EE2A 2QQ0A 1A8HA 3T3NA 2GZAA 2OD7A 3U6BA 3EMBA 5DLPA 3KQNA 1UBUS 2GTPA 3U60B 3WS7A 4OI2A 1U2DA 4BVEA 2HHTA 3JPRA 2YFYA 4ME6A 3IEPA 2EJCA 2HA3A 1UMDB 2Q6KA 4BN0A 4RPHA 1TEVA 5K01A 3NRZA 2VQSA 4XDZA 3DJFA 1YOBA 4YCSA 1Z8HA 4KPYA 5J0SA 4DQDA 8ICAA 1B8PA 1W85A 2DEUA 2RGNA 4DR7B 1LLFA 3SV3A 1RC8A 1SBTA 4FMCB 2OHXA 4Q93A 1YFLA 4OLBA 4ETNA 3EF1A 3RTAA 4P6VF 2QMUA 1TMYA 2Z2IA 4DPKA 1U0HC 5LMCA 4QZBA 2C9DA 1G19A 3BFJA 1Z18A 2ZB7A 2R4QA 3OT1A 4QJ4A 3L07A 4XB6B 1R8SA 2JHAA 1TTHA 3EIFA 4QULA 4RSHA 5DASA 1EEXB 5LKAA 3OIYA 3P26A 3IA2A 2IS6A 1PG2A 1V25A 2UYGA 1M1NA 5JQGB 2FQ1A 2PGXA 3D8NA 2AJTA 1L7QA 2QYOA 4EARA 4P83A 4Q0MA 3KYDA 5IVHA 2WLSA 1FLDA 2P67A 3AHCA 2ZRIA 1JEQA 2BHLA 3BMCA 3REFA 4TLCA 2OH2A 3VAAA 5J4LA 4PG4A 2G08A 1KNQA 1OWMA 3NC0C 1ISFA 4IP0A 4X84A 2JFHA 4U6PA 5KJEA 3HP4A 3BWCA 1U7HA 2J9FB 2VLIA 4K6MA 1YZVA 1ELOA 4OJPA 3FWKA 4O29A 4RC9A 2RAVA 1UFKA 4J9UE 2NT4A 3IBGA 4H08A 3ZDBA 3NV7A 3G17A 2IYQA 5K8LA 2OXEA 8ICEA 4YGXB 1JDBB 1NKBA 1HK7A 3L43A 3BMQA 1BYIA 5GIOE 2PS9A 2QUKA 3TNJA 5HCIA 2PBRA 4KLGA 3ESBA 5C7YA 4XAQA 4JBWA 1PJLA 3K9CA 4RWEA 2VHJA 3NFYA 3TTWA 3L05A 1RI1A 1PR9A 2PUWA 4DQXA 2ARKA 4BNLA 2CLIB 3F5AA 3R23A 3MC1A 3H83A 4JJ7A 2J33A 3DLTA 4H1UA 1Y1QA 4RZUA 3NT4A 4QYIA 1U48A 5ER6A 4TXNA 3IAS6 1R16A 2Z4SA 3BE4A 3W5DA 3C2MA 5ERYA 2GYYA 3EXIB 3EGEA 3FKSD 2W6MA 1QC5A 3WNVA 3VTKA 3RADC 4C03A 1JG2A 1NJ1A 1AMOA 3U3OA 1NU8A 3LKVA 2RHGB 4URXR 3TI7A 2WPDD 1ZU4A 4Y2RA 1O96B 1JECA 1AHIA 1ZD3A 1S9HA 4DDWA 1BE8A 3VH1A 2CDNA 2PLNA 3VQTA 1M54A 3OJLA 4KLZA 5AW7A 5TXGA 1KAMA 5IDQA 4YRBA 3AWDA 1P0IA 3H1FA 3T5AA 9ICMA 4BLWA 4FOOA 1E2LA 4M47A 4YJ2B 3TLXA 3T79A 2VCHA 3HJEA 2PCLA 1E2PA 4IFEA 3A2LA 2XMSA 1I30A 4XX0A 5G4LA 4Q9HA 4UJ3A 4HWRA 1RADA 4RTOA 4RVDA 4JUZA 1YJBA 3DW3X 5A3QA 1C7ZA 4ARSA 4ZCLA 3RFFA 4TURA 3BERA 4IDDA 4LBZA 4FDAA 1PYGA 2A1JA 1M6EX 1L5WA 1RRPA 5FULA 2Y1KA 4HB0A 1US8A 3UYLA 2BELA 4UVDA 3U4CA 1CPYA 2HHHB 2FW1A 1ZQIA 4QHYA 4I7EA 5J29A 3L2OB 4G0UA 1TPYA 2FLPA 1OBFO 2XVMA 1I32A 5DF1A 2Z56A 4F5YA 1FX0A 4PS0A 2O2CA 4LWOA 1VKHA 1QOPB 5LP6B 1K06A 3ESXA 3LOUA 3TMYA 1UDWA 4YR2A 3AF4A 1G8KA 2WHPB 2ZR9A 4ACOA 3HJUA 2D3TA 3UA3A 4XZ3A 2EX1A 2FSVA 3AKEA 3AJRA 4RHEA 1X7XB 4H7HA 2NYUA 3B70A 4ED3A 4RFSB 1KDTA 3DEIA 4WOJA 3DEEA 4B9MA 2F64A 4Z0NA 1Q1NA 1P6XA 3IX7A 3DZHA 1NG9A 1V1MB 3OEED 3D0OA 5LN1A 2QRVA 2B21A 2YQEA 2FPLA 4C8LA 2JFWA 4AO8A 4WESA 1OXSC 2ZJYA 2AFHE 3D1JA 4KAJA 3COPA 4RVUA 3VTZA 3VR5D 1XKXA 1FP4A 5KFPA 4NQZA 2FWMX 3VX3A 4F91B 3IUNA 4Q5IA 1HT2E 1R6DA 5H82A 5K7SA 1HIWA 2CLSA 2I3DA 2O2ZA 2OAEA 2VJDA 4BQNA 1G4AE 2W8BA 5KCZA 2JATA 1IONA 5CDHA 3Q6MA 5JNTA 1XHEA 4OX9Y 4YJ3F 5I8WA 1LPAB 3HM2A 4UNRA 4HDAA 4RF4A 1ZQGA 4P54A 3F73A 5AMXA 4EGCB 2ZWPA 1DI0A 3N0TA 3Q6IA 3P0RA 4BDPA 3A2MA 4I4TB 1DK3A 2OT3B 2LZ0A 1M34E 2AJLI 4WUVA 1KU6A 1WCIB 5A3SA 1NQUA 2CHVA 1H8HD 4GMFA 3OZIA 3O2NA 4WZBB 3I6ZA 5E1MA 5CLGA 3DPIA 2A88A 5CCEA 3OP4A 3RU9A 2BPGA 5IP5A 1TRHA 4GMDA 2ZRGA 5F9MA 3FTPA 3V00A 3LHFA 5CFQA 4FNGA 3ICEA 1SKQA 4BX3A 3M6AA 2GYVA 2PL9A 3RVKA 2PA3A 2V0GA 2MR6A 1X66A 2VAXA 2WYVA 1R9MA 1OLSB 3NM5A 3C3YA 2YZNA 2WTBA 3WTBA 3D8HA 1SBQA 4EFDA 4HEJA 4UU0A 1UXIA 4R1QA 1K9SA 1ZP6A 5I4BA 2BFOA 2QB0B 2GUGA 4B33A 5EJ7A 3LLUA 2E5SA 4UAYA 3VYUB 1F3LA 2EFYA 3MBOA 5KQGA 5ALQA 2W42A 2AZTA 1USGA 3KB1A 4PAMA 3Q9NA 2JIDA 4A15A 1DHTA 5I7WA 4ZTBA 5FWYA 4GF5A 3HU1A 1G6HA 2GERA 1FS5A 2YNMC 4HGRA 4CM8A 4JXZA 1SXGA 4JC5A 2FPXA 5JI2E 1GG2A 1KK1A 1PR1A 1K7XB 3FH0A 2VNKA 3EXEA 2ZWVA 5AM5A 3KNZA 5BSRA 2GFIA 4BLQA 5JWHA 1FFEA 2IZ6A 3V6LA 1PT6A 4QDOA 3QELA 4MRMA 3LJKA 4ESEA 1DQSA 2QM3A 4BX9A 1PBTA 2D1QA 3L01A 1Q44A 2I62A 3BL6A 3PKZA 4PF1A 4JHLA 1W0KD 2WZBA 4XVQA 4DSZA 4YCBA 5A3VA 2UZ1B 3MMPA 4J1NA 1L5UA 3N07A 3C97A 1U7ZA 1PGOA 1J21A 3AVPA 3RVNA 1ZI8A 1KE2A 3TVDA 4CCYA 2AX4A 4C6HA 1N6KA 1CUKA 1VRVA 4OBXA 4IZIA 5FA8A 4Y6RA 2D0PB 2I6GA 4E15A 4JJGA 2A3VA 1ZQQA 3WLLA 3H4VA 4CG0A 4XUGB 2IXAA 3PXXA 5CEHA 4O3FA 3O03A 3PHIA 1M2OA 5WRFA 4MQ4A 1TF2A 2Y0PA 1ZH4A 1T3GA 2XGOA 3KXIA 4JV1A 4XJXA 3EOZA 4WBNB 2P2YA 1G8PA 3HUTA 3N7PD 4C4YA 2G4LA 5EVJA 1QZUA 3G89A 8ICIA 3JATB 3QNMA 3U4MA 2KHVA 2Y9MB 3R8XA 4Q7MB 3TW8A 1R3DA 5DP1A 1TU3A 4R6WA 4M7WA 4PIVA 4M9NA 3V72A 2YIVX 3HBNA 4ROTA 4RK0A 5LMUB 2CVFA 4RHTA 1VXOA 5DGAA 3WICA 5IK2D 4QZFA 3ZS8A 5ALDA 1CVLA 1GRNA 1X0VA 3DP7A 2NVWA 1FFXA 3H2YA 3ECAA 1LPNA 2O1SA 4RH3A 5J2HA 3MWKA 1JSRA 4Y1GA 1GU7A 1SG9A 4C8KA 4FIDA 1E3EA 3OIDA 3VTFA 4L5JA 3L92A 4UUAA 1FOEB 3UAZA 4NQRA 2QLLA 4G07A 4EHNA 3V1YA 1YS4A 1JWBB 2QV7A 1B74A 5JD3A 3L4PA 4XYGA 4KQEA 3VHRA 1ZD5A 3JYLA 4MCIA 1L6IA 5I7UA 4Q1FA 3O7MA 2JFPA 4GLBA 1DXQA 3ABQB 2J6CA 4RIFA 1B0PA 1QX3A 1AS3A 2H0RA 3FPJA 3H40A 2QUAA 2OYRA 1L5NA 1ADJA 2FW6A 4J9OA 1URPA 1ES9A 1XEFA 3LYUA 2VTDA 4OHWA 3HUUA 4YREA 1EB9A 9ICWA 1TA0A 3NHKA 4AZSA 4BZPA 3R9IA 1WCYA 3MPOA 3AY3A 1QF7A 4RE6A 3A4YA 3RF6A 3NM6B 3IUMA 5KG5A 4NOKA 3HH8A 4FWTA 1IL0A 4YALA 4MA5A 4Q39A 4KIGA 4EB8A 4IIYA 1JG6A 5EUBA 3DVLA 4YJHB 1DEOA 3VR2D 1X7YB 1T0IA 4ZGWA 4XSGA 3GAFA 5EEGA 3NRWA 1G2PA 4KNVA 1M3SA 3JVVA 4R2WA 1RYDA 1YKSA 2WA1A 3GGSA 5EIBC 4P4GA 4TTIA 5JAZA 5KTNA 3GPIA 3K1AB 2OUIA 3P97A 2PVCA 2W98A 5JSKA 5INTA 5FTMA 5ICEA 3NNDA 3WQRA 2DKOA 1CJSA 2GB4A 5KHOC 5DSXA 2QWXA 5J2UA 2RBKA 4LZJA 1EK2A 1ZXIA 5DWVA 2O2GA 3GROA 1CERA 3UCEA 1PNVA 3PA6A 5IZCC 2OD2A 1CUXA 2GRAA 3I1JA 2GM3A 3WB0A 3KQTA 2D06A 4CHGA 4ZDWA 2G0AA 3PD0A 1AF7A 4L8WB 3TLGB 3S8MA 4V0NA 5F1PA 3O74A 1BH6A 2AN9A 1RM4A 1SAYA 5AUOB 4E5VA 4JVOA 3SSMA 2IHVA 1GL7A 4KR9A 3SIXA 3K0AA 2YMQA 2IHJA 3ZV5A 5AW3A 2ZQYA 4FDLA 3QVLA 4FW8A 1EPUA 5AESA 4ZO9A 2BMWA 3FCUB 1CK4A 5COBA 3PXAA 3PC4A 4TXHA 4I1IA 3CE9A 1OXUA 3RV4A 1NDQA 2DFNA 4NJOA 1F0KA 5KU7A 4DPLA 4IRUB 3NOXA 4JYZA 1ZI6A 4L1KA 5LU8A 1FXUA 3ZK8A 1QQBA 1T29A 4A92A 2HJRA 1JBQA 3PDWA 3R3ZA 1TF7A 4QGFA 1PWEA 3MPUA 4YUYA 2OQRA 3KKOA 4EG5A 3N70A 1VTKA 4DM4A 2Y1WA 3DOOA 3RAQA 2GAAA 4M0PA 2MYNA 1P29A 4NLCA 1SHZA 4RK1A 5BSFA 3UV6A 3CINA 4ILKA 3U17A 2XUGA 5JJIA 1DAEA 3FJOA 2AQ8A 1CUFA 2GRJA 5HIAA 3D43A 1ANKA 4Z9FA 2CMFA 1I4DD 4OOFA 4Q34A 4D9FA 2WUFA 4LYHA 5B5EU 2FYTA 3IOCA 3A0BU 3RTVA 3MWJA 1N61A 1Z68A 3QTLA 2NZWA 3W8DA 3ZGLA 4OP2A 4LWQA 2PH3A 5IG2A 4RFLA 2ZYUX 5IKMA 1BDMA 5B57C 3ADOA 4D43A 1DBRA 3LLCA 1S2NA 3OQHA 5EA2A 1QRAA 1KLNA 2I2AA 4YJFA 5ADWA 2RHHA 3PI6A 4LF4B 3H5IA 4QRDA 3N7TA 3P32A 4G25A 2A92A 5KWEA 4PAQA 5CDFA 1PSWA 2XHEA 1T91A 1MX9A 2CSUA 3ZOZA 1EGHA 2A59A 4DG5A 5CAEB 5K20A 2KN7A 5CNMA 3BQ1A 2BDTA 3ECCA 3TW4A 3BJIC 2QW1A 4U02A 1Y6GA 3KBOA 2CJXA 4EX6A 1BCRA 4ZVTA 5D8DA 1PK1A 1Q3HA 4PHPA 2RHCA 4S1NA 4F1KA 3HZZA 3SZMA 1NZDA 1UUFA 3QWHA 1WPQA 3K5WA 2R8PA 2NYRA 1W59A 1GNVA 2PBLA 2A9VA 1QBKC 2QXYA 5C8XA 3WNCA 2Q7DA 4MHSA 4I81A 3PXEA 1R0XA 3F90A 2E18A 2QG6A 3R44A 5K1ZA 1ZM7A 4KEAA 4BNYA 2QAIA 4BJ6A 5BQPA 3GBPA 4YS6A 4I14A 2X77A 2O8BB 2O5VA 3I5YA 3EC7A 4IIJA 3A9VA 2JKVA 5IBPA 1N9GB 1JQBA 3QWAA 5KFKA 2GYWA 3ONDA 3LYLA 2BBWA 2RAFA 2EV9A 4Z4IA 1F6DA 4JV5B 3MJHA 1NNSA 5C18A 1SBNE 4Q9AA 5ITZA 1LQUA 2ZIWA 4XOIA 3KJIA 2C8KA 1T6XA 4O1MA 1G3IA 5K4LA 4Y1RB 4BATA 1ZH8A 5AJWA 2APJA 3H2ZA 1ULUA 1EQ2A 4MHVA 2J7PD 3CR7A 1KI1A 4DDUA 3MFQA 4WIAA 3RS3A 1GO2A 2ZT5A 2HV9A 2QTVB 4BCCA 1BMFA 3ISCA 2XAUA 1Z25A 3IAHA 3UUEA 1VIVA 3F5FA 3SNKA 4YP0A 2WFZA 4X8MA 2OSBA 5KG4A 1BH2A 4DL6A 2NOAA 2AXTU 4P93A 3OFKA 4N5HX 3ELUA 2H4FA 1ZNWA 5FWXA 1QCKA 2ETXA 4RVFA 1FDWA 1QLNA 1W29A 1HE1C 3K70C 2AZ4A 1UMCB 2BT4A 2OCYC 1B6SA 2PJDA 2R7LA 3MTAA 1RW4A 3QXCA 5ALEA 2Z5FA 3CVVA 4O2BA 2GLXA 1UZUA 3ILYA 4RH0A 3GEDA 3DVQX 2V58A 4HI0E 5HFNA 4DN6A 3FC4A 5DI3A 3I0ZA 5DDMA 5HK8A 5LB4A 4LY3A 3KTQA 3FFXA 2QVYX 3MDAA 1XYYA 1EVEA 4FD2A 3ONWA 1PJQA 3JSAA 2IHUA 2RK4A 1KDYA 4DTIA 4XQEA 4JBIA 1R6VA 4CGYA 3NKFA 1WG8A 3SE7A 1PL8A 4FBLA 4EJSA 1ZG3A 5JW6A 1ZR2A 1WW8A 1XS9D 4NJMA 3MOGA 2KHQA 1LSSA 4RSMA 2R62A 4HDMB 2EOAA 1RYHA 4L2IA 4JWTA 1C3JA 3EVAA 1H93A 1UAYA 4RA9A 3CUKA 1TC1A 2RJ3A 3FNRA 1LU9A 3U81A 2NVBA 1OXJA 3UMFA 1IZ8A 4EVIA 3M89A 4BE9A 1COZA 4HFNA 5C9ZA 5EWJB 1L5OA 2P9ZA 3GLIE 3SR0A 4IJ6A 1Z4KA 1P31A 4FPXA 5IFKA 5AOVA 2HHSA 2IVFA 3CSUA 4BUJA 5LUAA 5EINA 3RYCA 3A6PC 4R8MA 5FB3A 3I4FA 1Q17A 2OE2A 3B6KA 4IFBA 4Y2QA 2FUKA 1ZOPA 1E2NA 2CXUA 2HDWA 3OQMA 1W36C 5FPSA 2PD4A 4KLEA 1V3QE 2ZG6A 3TSZA 4F8RA 1OFUA 2IUYA 3DBIA 4YUXA 2OEPA 3EW7A 1VLBA 2YOFA 3MYYA 4Q3DA 4ECQA 2O52A 4DHWA 5J4KA 3PTLA 4YDQA 1XVUA 2HIAA 1T26A 4G97A 4TMFA 4J1QA 1H3NA 3L7YA 2XRYA 4YH1A 4RUKA 1XJWA 1P33A 4HLUC 5AK6A 2PZLA 1JT9A 2H3HA 1DUIA 3AOEC 1Z6AA 2XI4A 3PUHA 5E4TA 1FB5A 4PCVA 3TARA 1J8MF 2PPVA 3O73A 4RTNA 3AL2A 5K3AA 1GHTA 1BXGB 1BMDA 2FOXA 1PK9A 4KNWA 1JR3A 1BKDR 1OH6A 1ZQFA 4PG6A 3ISTA 2SHKA 1OFIA 4IWXA 1OPRA 3Q8XB 4B44A 2N1MA 4RY8A 2Z6VA 1SKWA 2K89A 1S8OA 2VDQB 1OTXA 3HI4A 3G5TA 4AJLA 3G0BA 4R2IA 2JIMA 7ICTA 1DQRA 1WCWA 1T2VA 3LF1A 3P7MA 1LDEA 2HXYA 3FFWA 2RHJA 4Z8XA 5CBKA 2J0SA 1OA1A 4KLCA 5DHQA 3ZJTA 1Y8RB 2RH4A 5D7BA 5FCDA 4DA4A 4ED6A 5LJLA 2Q6VA 4QIHA 3N53A 3C1TA 1M75A 3BQTA 1YRYE 4U7GA 4AJHA 1P1RA 2IUFA 1SM4A 4QXQA 4C14A 3H9BA 3WWCA 2Q4TA 1V5GA 1L7XA 2OORC 1Z13A 2FR8C 4B40A 3FD8A 2Q2NA 3ILHA 4UTVA 7REQA 1D2EA 4DUGD 4ND4A 3QZ7A 1CUJA 2OHHA 3HWWA 3IDQA 4KWIA 4Y1EA 1SFRA 4MZDA 4JI1B 1C50A 9ICFA 3NH9A 1Y6ZA 421PA 4HQNA 2WJHA 2UYCA 2WEKA 3GGGA 5DM4A 4BVKA 5AOAA 4CN8A 1KSPA 4RCYA 1E0AA 1E7SA 3LG2A 2NTEA 3GLUA 3ODPA 1WMEA 1E3IA 1SU7A 3NHBA 1U5AA 5AP9A 4P08A 3SENA 1HO3A 2MYUA 3O3MB 2GWSA 4DAOA 2XUZA 2XEDA 2W71A 4R1LA 4L4SA 4W8OA 3M6VA 3OHBA 3W7VA 1CB0A 1GZ4A 2WE8A 3KQSA 1PFYA 5FUMA 2G5HB 2HU2A 3CLTC 3R5FA 4DV1B 8ICZA 1GRCA 2DHQA 2SCUB 4LMBA 3N74A 1LFAA 3W2GA 4KTTE 2OKCA 4KDRA 4C08A 3L7JA 2ZTHA 3H17A 2BR0A 1ZL0A 1F38A 1R9GA 1ZD2P 5KWIA 5BRJA 3PI7A 1S2DA 1ZX1A 3NJRA 4AULA 5FV4A 4FC6A 4ZYVA 1UXHA 1Y5MA 3I9FA 1BJTA 2HV8A 3LV8A 5LQDA 4YQEA 5DNAA 2R79A 4M0EA 4WZZA 3H19A 3NT2A 3TR5A 2LI6A 2OFXA 4HN9A 4X20B 3EIOA 4J7AA 1CDZA 3GFOA 3FPFA 4UDOA 3WSWA 3SJUA 1ZUIA 1Q2UA 2FPSA 1U0FA 3STHA 5H81A 5KNDA 2HHVA 1YR8A 1JHRA 2EX4A 1NBOA 3WMWA 3B85A 2QZSA 3UAGA 2I33A 4FFVA 5EZYB 4YCMA 2EX0A 5TS3A 4Q43A 4QECA 4HFMA 7ICGA 5HKLA 1HORA 4UCWA 4GLJA 2NO9A 1N5RA 3IAM1 4DNOA 3TS1A 3N2NA 1ABFA 3QKTA 2FP3A 2C3YA 3B1VA 1U6KA 4IDNA 1R6UA 3GZ4A 4XE5A 1OX4A 2FMFA 3F96A 5EXEA 3GCWA 4MHTA 4KITB 5K2OA 5A4FS 4MULA 5T8KA 1T5OA 3P9QA 4CU5A 4G1VA 2C9OA 4B4WA 2FGKA 4QOIA 1NYLA 1NVKA 2PUVA 2EZYA 3OZAA 4UCFA 4KQMA 5LDHA 2QT0A 5CITA 3KAPA 4YCJA 3V1MA 2D3DA 1WO8A 3IRUA 1Q7EA 3OPYB 4OQPA 3LBAA 3SYNA 3NNNA 3FPKA 2J4DA 1O95C 4UMDA 4LSGA 3IPLA 1LVUA 4OSOA 3GUCA 3Q15C 2MUTB 1U2RA 1KK3A 3OZSA 1OB5A 5JOQA 1YZHA 9ABPA 5F9LA 3HR4A 3RQSA 1JQ3A 1M5TA 2CJYA 1MVOA 3QFSA 2ZREA 3E1GA 3Q0IA 4MQ6A 4BMSA 2ZGVA 5HG0A 2J3IA 3MUFA 5ECWA 5BN4A 5DSZA 3OT5A 4X24A 1KDPA 1DG9A 4Q9KA 2JZBA 1T36A 4K3VA 1PV1A 1GIAA 2FPUA 2WUGA 3PLRA 4M53A 4GVLA 5JYCA 1ZJWA 1M6WA 4QWAA 3RVLA 5HZGA 3DDOA 1B76A 3PR1A 4DY6A 1KGSA 1V26A 1V9SA 3RANA 3BL8A 4HX2A 4NYIR 2JFNA 3YASA 4GX1A 3L0PA 5EFOA 3TR6A 1J1IA 2ZSIA 1LV5A 1E59A 1LVGA 4OKNA 2DTEA 4N5MA 5HJEA 1E6UA 4NYMQ 2C83A 1NJYA 5KYNA 3LBHA 4D9EA 3C6YA 2GZMA 3F46A 1W44A 2XMBA 1KYWA 1KJZA 3V2GA 2RGUA 1ZRHA 1ZH6A 1HL7A 1O0BA 1KA9H 1UAAA 3VR4A 4UUBA 1AXEA 2C7QA 2DPXA 2EFDB 2PI5A 4EHLA 1E2EA 2XX3A 4DLSA 3RWBA 2GZDA 5CDSA 1E4VA 1DXSA 5CFOA 4JL5A 4DLEA 1N3LA 3VH4A 4ZOQI 1L3UA 4XPZA 5JFOA 1AUPA 4KLHA 1MB9A 1P39A 1SC4A 2QR5A 3ZHTA 3V7WA 1O9HA 1Z26A 3ZWMA 2WD8A 3OOEA 4X7BA 1S5LU 1UBHS 1EQUA 3G1TA 1RXSA 4ZZ3A 3TFSA 1QGUA 2JA2A 3FIUA 1OFGA 1RLJA 2VTBA 5K0GA 1KDVA 1X8KA 5TMBA 4GRIA 5IKPA 4JMUA 2PKCA 4DLRA 4H15A 4EECA 1JVBA 3T5JA 4N5IX 1MA7A 4LJKA 3IPAA 1TD1A 2WSIA 3P45A 4K86A 2G5CA 3CZQA 3PT9A 3TTVA 4OYLA 5FDFA 1MHTA 1E5VA 1T9KA 4TVBA 2DHRA 5CCBA 3ZY3A 5L9XA 4I2IA 3JYNA 1QXSA 4G24A 4DQUA 1S9FA 2JZOA 2ZTUA 4XQ9A 2OLKA 1RRKA 5KOIA 3QF4A 1L4GA 2PMCA 4E2ZA 1DTEA 4BQEA 4G65A 4JLJA 4I55F 2VUHB 3VR6D 1GNPA 2JCSA 4TKUA 1P91A 3MT0A 3MSCA 3CUYA 1YQWA 4GHWA 3JR7A 1IJBA 1OUQA 5G3ZA 2EEZA 1D2NA 3KPYA 3SKXA 1S8NA 1LJ8A 3CO5A 1ZICA 2P69A 3NGXA 2DWCA 3W0LB 2WRZA 1FFWA 1VLJA 2ORED 5CLHA 2F3UA 2OBFA 2D13A 1M1YB 5KT7A 1EXWA 3LC0A 5C31A 5ILGA 2WTNA 5ETJA 3U2QA 3PIDA 4CKXA 2OP0A 4RQUA 1I3NA 1KBUA 3AU9A 2H59A 3DKPA 4QTTB 4PXYA 3EIUA 2CXRA 4IQWA 4HDQB 5I7RA 1Q1BA 5LL6P 3PYXA 2Q0HA 3WR5A 4D02A 4YMWA 1IM5A 2PO5A 4TT3D 5EIHA 1C0IA 2EP5A 1PT9A 1TT5B 3KAJA 2O59A 5B6PA 4BV2A 2VAVA 4P0PA 2EC5A 2RAUA 1POWA 3G2QA 4RLHA 4QBGB 1XAGA 3GEHA 4HMQA 4ZOCA 4FEAA 3FCOA 4CF4A 1U4SA 3RFVA 2REBA 4XDGA 3IQHX 4UUMA 2UVPA 4F3YA 3ZE2B 4EPYA 5EJ9A 3CRVA 1T4MA 1NZPA 4KXXA 1N4AA 1IC6A 2H3QA 2PYIA 3BH0A 4ZYXA 4IS7A 5GJVC 5LDGA 5C37A 3RSQA 3FGNA 3UGTA 1H9AA 1CUBA 4Q24A 3SLKA 3PMLA 3OHPA 3ROMA 3IP5A 5CDTA 2FETA 1FQWA 1TVCA 3ZHXA 1B8UA 4CIDA 2GN6A 5E8JA 3UHOA 2VXOA 4D3ZA 2AW3A 2BE9A 2NPIA 2N46A 4G4JA 5IF3A 2FOLA 2C5EA 4W7HA 3O8QB 3GPLA 3RGWS 4Z0PA 4BZQA 2RIRA 2CHFA 3MWEA 4QPPA 1GA4A 3ABRB 4IX1A 1RYMA 4DQ0A 5H68A 1UMKA 1XKTA 3MDCA 2F3RA 1L7NA 4EUSA 1KTVA 3JAKA 3D3QA 3EJ6A 4M7RA 1QTMA 2K8CB 2XHZA 1SZCA 4XRHA 5BNZA 2QMEA 4WINA 3GRPA 4D25A 1UPAA 1U7WA 3NI2A 1F48A 5MN6A 5L45A 4L15A 3KJXA 2I71A 3UJPA 4Z6CA 3OKAA 2AR7A 3OHSX 2DY1A 4Q16A 3BDAA 5EE3A 5EUCA 1EVYA 1P9RA 3C16C 2ZB3A 3ADBA 4LV8B 1A77A 4AWXA 2FZLA 2W22A 4Z49A 3EA0A 3GPCA 4U7TB 4WEQA 3JRXA 1W85B 1XTRA 3TSOA 1CB7A 2J7KA 1ARZA 3RSOA 3RT1A 3MS4A 5GMOA 3AEKA 3I2FA 5TS2A 4F1JA 3AF5A 5GM2A 4OSPA 1QHNA 4G0QA 4URYR 3OT1B 2M6SA 4XYEA 3CZ5A 4EYGA 1ZSYA 4TLDA 3O83A 3C4VA 7ICQA 1YAHA 1DKQA 3OZEA 2Q50A 5DLGA 3SQDA 1ESDA 3EPKA 1V39A 2KMLA 4FGLA 4LQ4A 3I76A 4P8RA 1M1NB 3FETA 5I9SA 2WHXA 4OQQA 3QLUA 4DS3A 3KYDB 3CH4B 1OPXA 5DQIA 3LQ4A 1QIGA 1JEQB 4QUKA 3HWTA 1IY2A 3BMCB 2YN2A 5E79U 3OCWA 3A1EA 3DDNA 4Q03A 4ZDIA 3PF9A 1SPXA 3Q9SA 1KQPA 1GPH1 4GC7A 1XVIA 2WF9A 1R6XA 1ULZA 2JJ8A 1TU4A 1X8XA 3CNOA 4LK2A 1LNZA 5J0QA 1D4FA 1WVGA 2GDZA 1YGYA 4BWMA 4B6RA 4CL2A 3BYZA 3PEWA 3SYZA 2V4QA 1V5EA 1JA0A 5JISA 4GWLA 3SDSA 3G8CA 1YFKA 2C0CA 1P75A 2B99A 2ZIAA 1XRLA 2NRWA 4JI8B 3BMQB 3KZCA 1FRNA 1SH7A 1CJCA 4H4CA 4PQEA 2QORA 2JAHA 2GFHA 1SR8A 3HMQA 5AM4A 3H05A 2F3NA 2B92A 1QUFA 3EG9A 3S4YA 1X7ZA 1X8JA 3SX4A 3HWRA 3TQOA 3C74A 4ZHSA 1NLZA 1BS1A 1CY4A 2VZEA 2XOEA 1WXQA 4QYIB 1O94A 3M34A 4ZO8A 4E88A 4QLOA 1L1EA 2JH8A 3PFNA 1UP6A 2FRXA 1CUAA 3EN0A 2WAQF 3CGGA 1T1GA 2BMFA 1QC5B 1E2BA 2GN2A 4ZGGA 4MVJD 1E2UA 1E7RA 1IB6A 1H0HA 3OBBA 4PFSA 4QFCA 4C0WA 1BFKA 3GJRA 1KOFA 3RJ5A 3TIVA 3RB3A 3MCAA 5L53A 1JIVA 4Q9DA 3GIMA 3O2SB 3N2EA 4D9HA 2P6RA 3PNSA 4V2IA 3MWDA 5AJXA 3AI2A 3Q3GE 3RDPA 4XQGA 3WHPA 3C45A 1A0OA 2V9CA 2H07A 3ETEA 2ZBPA 2BMAA 4DCOA 4LPSA 3IAUA 3NP7A 1Y5NA 1ZQDA 1OC4A 3OOSA 3QE9Y 3PW4A 1YOVA 1KKXA 1TJ3A 3E61A 3L6CA 4U2DA 3M5CA 1P9OA 2RG7A 3I58A 3HC7A 1E5QA 5CJ7A 2ID7A 4XX0B 1JIQA 1JQAA 4Q3OA 1O03A 4NJ8A 1BRTA 4UTRA 3GLGA 1DL5A 1TEXA 5ALLA 2CNBA 5DXJA 3B1JA 4P3XA 2H31A 2Z5LA 2VSFA 3HA3A 4DM7A 3OURA 3BGVA 1YVDA 3A32A 1DGQA 4YRLA 4YFYA 1ZGZA 3WI7A 2A1JB 2BSXA 3T38A 1JRPA 2YUIA 1AA6A 1US8B 3UJ9A 3GJ8A 2P4HX 1UA1A 3GDFA 1RBMA 4P1ZA 2GTHA 4JLOA 2FJUA 4JUBA 4USAA 3OCUA 4F4IA 4GYJA 1FFBA 5JSYA 1Q22A 1YL5A 1PVVA 2H1SA 1BZYA 1FP1D 2PVPA 2Q9BA 1VPVA 4L9RA 4OA8A 1LRKA 1X9HA 3AI7A 1FX0B 2HRQA 1J2MA 4ELUA 3KSRA 3BFKA 1PR4A 2FSGA 3TIGA 1BXZA 1T9ZA 1VIAA 3F7OA 1Q0SA 3A8TA 3EFHA 4YDHB 3D0KA 2OLEA 2YQ5A 5DOZA 1PSZA 4JJ6A 2PWBA 3LC1O 4M1KA 4AUMA 2PQ0A 4KLRA 4PGQA 3W7AA 4I5EA 3KSMA 1SZDA 4L07A 1ZGBA 3MJTA 4XOUA 1UWLA 3BCRA 1BTOA 2CLEB 3JTEA 3EE6A 3IAXA 2FGJA 5IJAA 3W90A 2LYBA 1O4VA 4M9LA 2AN5A 4RLFA 1PGPA 4JASB 2QRVB 2PMFA 1CG6A 1K0UA 5GVSA 2WD9A 2FPRA 3OFVA 1N2JA 4RKEA 4WESB 3LLSA 3PR4A 2ZUDA 3W77A 2VP4A 1G6OA 2FEWB 1MT3A 1E6CA 3PUWA 2HHUA 1FP4B 4PRKA 1GITA 4X1OA 1DJPA 3AJ8A 2IEZA 1I7LA 3SEQA 4P3PA 3ZCTA 2MSNA 2VDKB 1RM3A 1PNQA 1FK8A 2WOOA 3P2IA 4JYMA 3SF8A 2H92A 2XUFA 1Z4PX 5AVZA 3NXKA 3UC9A 1L0BA 2BMDA 1WCV1 2VF4X 1EFRD 3FTQA 3UWOA 1RM6C 1ZGGA 1PR0A 1DCFA 3T4PA 4BNDA 4COOA 4F5DA 3D4OA 1OSNA 3WQHA 3DLPX 5BW8A 4PRLA 2BPFA 4ENTA 2V0NA 4RV9A 1CRLA 4R2JA 2A4MA 5CUQA 1U3VA 2E4UA 3GRFA 3JD0A 5HCNA 4M83A 5CGQB 1NR1A 4FQ5A 5F52A 2LGJA 1TAUA 2WJPA 4OPMA 1X9WA 2OP1A 3ZZ0A 1GNLA 1F8XA 2YVQA 3V46A 4CUKA 1R7RA 3TZEA 2RKOA 3PRHA 2C2XA 4HMOA 1BD3A 4BHTA 1YZFA 3KZVA 4QUGA 3GV0A 1B8VA 4B75A 3IVGA 1NW3A 1T10A 4WW0A 1CD5A 3WNBA 5EJ5A 1QNLA 3WKEA 1DBPA 4UB8U 3NWPA 2V7BA 1J0EA 5EP4A 2FUG1 3OTWA 3L5KA 4KYIB 3RD5A 2KYRA 4HVCA 1FXSA 1BFUA 1YH3A 3M70A 4DMFA 3IR5A 2XUPA 3RJTA 3FNQA 4KN5A 4B3IA 5BW4A 1W88A 3JTMA 2PLFA 4BMZA 2R1UA 3P9YA 4DLZA 1BNPA 4HDSA 1W5AA 4NBWA 3MZ0A 3JPSA 2QXTA 3WQBA 2F7SA 3ESQA 5MFPA 2BEWA 2OBBA 3PVSA 3IILA 2QVZX 4NCBA 2YHAA 1HE5A 5FWYB 1W581 4NLKA 5B1IA 1WMBA 5HR7A 1NKVA 4UTZA 4X00A 4CM8B 4OBBA 3G5AA 1G0OA 5H9WA 1DJNA 5ESXA 4KZPA 1ZJNA 1M5UA 1Q46A 1QYDA 1WQ4A 4IHKA 3EXEB 1CYEA 4U7HA 4XSHA 4V0KA 1W1WA 1SU8A