2NO5A

Crystal structure analysis of a dehalogenase with intermediate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
224
Chain Sequence
LVDSLRACVFAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Hydrolase
molecule keywords (S)-2-haloacid dehalogenase IVA
total genus 88
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no5A01
2C8LA 3M1YA 3L8EA 3R09A 3W5DA 1ZOLA 3PGLA 3NALA 4DWOA 4UATA 3QLEA 1N8NA 4OFZA 1RPZA 3WGVA 1EK2A 3KDPA 3SF0A 4DCCA 2JAWA 3DV9A 3MMZA 2YJ4A 2WHEA 3WGUA 4Y2TA 2HOQA 3ET4A 2BDEA 2B82A 1U7PA 1Z5UA 5AVTA 2W4MA 1FEZA 4NV0A 4DFDA 3OCXA 3RFUA 4UASA 2R8XA 3WKEA 4G63A 4AP9A 3ZU6A 3BWVA 3UMGA 1QYIA 1U02A 3NIWA 3A1CA 3F9RA 2I6XA 5AVYA 3ZVNA 3B9BA 5AW4A 3NASA 1YS9A 1T5TA 2AGVA 4F71A 4BEWA 5AVXA 3N5KA 3L8FA 1VJ5A 1RQLA 2Q4RA 4UM5A 3A1DA 2ZBFA 1Z4IA 5AKLA 3QYPA 5AI0A 1EK1A 3EF0A 3QU7A 2ODAA 4YIHA 1QQ7A 3OCZA 5AI8A 1S2OA 4C4SA 2Q4TA 5AKKA 3WKCA 5ALGA 1RMTA 4NFLA 5AVUA 5ALHA 5ALQA 2GO7A 1ZS9A 5AIAA 3K1ZA 3P96A 4XQ0A 2C4NA 1RQNA 4CF3A 5AHXA 4EELA 3QUQA 2YY6A 1L7NA 1T5SA 1U2SA 3I76A 4GXTA 5ALEA 3MPOA 2ZG6A 5IS2A 1U7OA 3MC1A 5AW7A 2YN4A 3AR8A 1QQ5A 1X42A 3FVVA 4YGYA 4EZEA 2YMQA 3IB6A 3WK8A 3AR3A 2I55A 3IJ5A 5AESA 4BNDB 3MN1A 3OTQA 2NYVA 2GFHA 1JUDA 5A3SA 5AW0A 3OCUA 3SMVA 3L8GA 2FPWA 4ZEWA 1ZD3A 5AKYA 3WK6A 4OCZA 2HCFA 2NO5A 1Z4PX 3U7EB 5AVVA 4EEKA 4F72A 5AVWA 3ZI4A 2HDOA 2FPSA 1RMQA 1Z4KA 1QH9A 5ALKA 1RKVA 1Z4OA 4UAVA 4PNHA 5AI6A 1NRWA 4BBJA 2YBDA 2WF8A 3E8MA 3IRUA 1RLTA 2X4DA 2GHTA 3TLMA 2P27A 2YFYA 2WF9A 1CR6A 4EX6A 2HEGA 3L1VA 3W5BA 3N1UA 3NRJA 1Y8AA 1XPJA 4AS3A 2C9MA 3I1YA 4J03A 1RC8A 5ALFA 5AKZA 4UARA 5AK6A 1TE2A 2ZXEA 3AR7A 1ZD4A 3ZW7A 3E84A 2G0AA 1N9KA 4HGPA 3QXGA 1Q92A 3L7YA 3WKAA 1AQ6A 2W43A 5ALVA 3GYGA 1NF2A 1ZRMA 3OCVA 5AI4A 1Q91A 3DAOA 3QU4A 1L6RA 3QGMA 3E81A 2G80A 3UM9A 4I9FA 3L8HA 5ALZA 3FZQA 4O8CA 5AW6A 2MSNA 2G06A 2VKQA 2ZBEA 3ZVLA 2I54A 4B6JA 4HGQA 3ZVMA 3WKDA 2P69A 1F5SA 2OM6A 4YIKA 2IOFA 5ALOA 4Y2VA 2WF7A 2G08A 4XPZA 4ZEXA 4CF4A 3HYCA 4Y2RA 4QJBA 1L7PA 3N28A 4C4TA 2EAUA 3ET5A 1CQZA 5ALWA 2YMPA 2HHLA 1MH9A 2IOFK 1NNLA 4G9BA 1IWOA 3U7HB 2I33A 3U13A 4BX3A 2FI1A 2I7DA 5AKXA 4E88A 4JDPA 3AR4A 4KNWA 3DDHA 1Z5GA 2MU2A 5AK4A 5AM2A 2RAVA 1ZD5A 1RKUA 2G1AA 1J8DA 2HI0A 3EF1A 1SWVA 5AM4A 3ONNA 5AW3A 4RESA 3N8GA 4NWIA 5ALMA 2HSZA 3OPXA 3QUTA 4HAIA 1Z4JA 3J7TA 2Q5EA 2B1QA 2O9JA 3ZX4A 3WK7A 5AICA 5AVRA 3SHQA 1Z88A 2DQSA 3AR2A 3WK4A 2P9JA 2PKEA 2YJ3A 5AI9A 5JJBA 2FPXA 5AVSA 2RARA 5AKGA 4Y2YA 2FPUA 5E0OA 1RRCA 3EPRA 5A3RA 1YJ5A 2HF2A 4UMFA 5AK5A 3SD7A 1O03A 5AK3A 1Z4MA 4UMVA 3OCWA 1WZCA 4L57A 2YJ5A 3QU2A 4YCLA 3ZTYA 1QQ6A 2HX1A 2JGAA 4YH1A 1TJ3A 5ALDA 2OYCA 2B8JA 2JAUA 4MWOA 3U26A 4KX3A 3PDWA 5FP0A 5AM3A 1PW5A 4I9GA 1Z4QA 4NABA 1K1EA 4CNQA 3E58A 2RB5A 5IT4A 2B30A 5AW2A 2WF6A 3ZTWA 5AVZA 2IOHA 3FPSA 1TJ4A 4BNDA 3L0CA 5AW1A 1ZRNA 5ALNA 3U7FB 3PCTA 4HYTA 3EWIA 2IYEA 3L0YA 5AM1A 3NAMA 4KYTA 4OHFA 2YMMA 2CFTA 1RKQA 3QU5A 2ZBGA 4KX5A 3WK9A 4ZEVA 2OBBA 3L1UA 2NO4A 2WM8A 3QU9A 4KN8A 1TA0A 3R9KA 4AS2A 4C4RA 5A3QA 4CE6A 3R4CA 4EENA 5ALSA 3HLTA 2GHQA 4BX2A 1VJRA 5ALIA 5AVQA 4UW9A 3DNPA 1WVIA 1L7OA 5ALUA 1RDFA 2I34A 2C88A 2PQ0A 2YMLA 5AIBA 3I28A 2FDRA 2AMYA 3W5AA 3W5CA 1RLOA 5ALJA 4UU0A 2MU1A 1Z4LA 2AH5A 3WK5A 3KC2A 3CNHA 3ZWKA 5IT0A 2C8KA 3KBBA 1Z4NA 1SWWA 2OA0A 2JARA 5AKHA 1ZD2P 3ZX5A 3FGOA 1TJ5A 2B0CA 3ESRA 2EARA 2IA5A 4FE3A 5AW5A 5AKEA 4KNVA 3NUQA 4GIBA 2B8EA 1XVIA 3BA6A 2W11A 4HGRA 4XE5A 1YMQA 5ALLA 3KZXA 3QNMA 1RLMA 2O2XA 4UMEA 2CFRA 3D6JA 4EX7A 2WF5A 2ZOSA 1YV9A 1T9ZA 3AR5A 4YCNA 5ALPA 1L8OA 2AUTA 4L6CA 2B1RA 2R8ZA 5ALRA 2RBKA 3L5KA 4RETA 3VAYA 1LTQA 4BYGA 3FM9A 3ZUPA 2JAOA 3CZ4A 3S6JA 2FUEA 4XOUA 1O08A 2G09A 3SKXA 4L6AA 3QUCA 2R8EA 5AM0A 1YNSA 1WR8A 3AR6A 2PR7A 3B8EA 4YCMA 5AKJA 1VFPA 4MUMA 4OD0A 2CFSA 5T41A 4UU1A 4BEVA 3I6BA 4UMDA 4HGNA 3A1EA 3QX7A 4FYPA 2FPRA 2CN1A 2GMWA 5AM5A 3ZWDA 4Y2UA 3SLRA 5AW8A 3A3YA 3ED5A 3U19A 2FUCA 2QYHA 2R8YA 3SKYA 3L0BA 3QUBA 4IFTA 2QLTA 4Y3UA 3UMCA 3U7GA 4BKMA 5ALYA 4CF5A 4J2TA 2HO4A 1KYTA 2D2VA 3KD3A 3M9LA 1J97A 1ZJJA 3FPBA 3B9RA 1XP5A 4Y2SA 3WKBA 3AR9A 3N07A 1WPGA 4QQFA 2ZBDA 3ESQA 3RF6A 4IG4A 4UM7A 3NANA 1L7MA 1YDFA 4NAVA 4BX0A 4HGOA 4UAUA 1L8LA 4DW8A 2BY4A 3PGVA 2WFAA 1SU4A 2G07A 1U2TA 4FFDA 4Y2QA 2BDUA 1S8OA 3OCYA 2HF7A 3KOOA 4H1WA 4Y2JA 4Y2PA 5ALXA 1LVHA 2EATA 4Y2XA 5ALTA 2FEAA 5AW9A 2P11A 1RMYA 3UMBA 5AI5A 2YJ6A 4JB3A 5AKIA
chains in the Genus database with same CATH superfamily
1Z0IA 1Y3HA 5COQA 3CG4A 4RA6A 1OI7A 3TWOA 2GJ8A 3N6RA 3RT7A 2PSSA 1CVRA 1LTKA 3N87A 3DOJA 3MTAA 1W5EA 4J1TC 5KYUA 3ONWA 2HBJA 4FFSA 4UATA 4DFJA 2JJQA 4I4NA 4MLDA 3PDHA 4F4UA 5KYYA 4HJRA 2G9VA 1NUUA 2Z5FA 2VDUE 3EAFA 3F9IA 3KG2A 4YYZA 5DJ5A 3CJRA 4ZHQB 4F5WA 1PZHA 2CEKA 4C4OA 3AF2A 3SS9X 3T1VA 5FWYB 4TZTA 4MZXA 4CCYB 2RSLA 1GT6A 3EH1A 8ICCA 3L79A 3PFGA 3LW7A 4ZT3A 3HN2A 2V9WA 1FS4A 3GAAA 2RG7A 4DKJA 1PFUA 2BC9A 2RHLA 4M55A 4NV0A 2PMWB 1WHTB 3LLCA 4UASA 4R64A 2R8XA 3WKEA 5FTNA 4G63A 1P7YA 2J30A 5F9MA 2J4DA 3DE4X 3WNQA 3ZIUA 621PA 2I0FA 4HDOB 5K4HA 3K5HA 2ZJ7A 3ZJTA 4F3OA 3Q2OA 3A1CA 3V8QA 1FS6A 4YECA 2VTKA 3WWZA 3ZWWA 2RH8A 1RYDA 1NOJA 4GBED 1A9PA 4Z1MA 2C8JA 2IU3A 3FW1A 3EWNA 2ZT7A 2K7ZA 4HVCA 1J9EA 1PWZA 1XZHA 4OP1A 5IUNC 1HDGO 2WJWA 4RLQA 3NXKA 3ZGZA 2O07A 3AUSA 4OKSA 4F3TA 2J07A 1L5RA 3OF3A 2ECFA 2MIIA 2QRVA 3CO5A 3MOIA 4AKTA 4OL9A 1IK6A 2VNAA 3D0RA 4PZDA 2LZ0A 2V7VA 2WZQA 3UXEA 1Z4IA 2GA9A 3NHPA 2BGUA 2EBUA 1KK3A 4DR5B 4LRYA 4JLWA 1UK8A 3C1AA 4TS3A 5A1JA 1T8RA 2W2MA 2ORED 2PUGA 1UXOA 4ACBA 2Q0ZX 1KDRA 1VKOA 4FO6A 3RF9A 2CMHA 2SICE 4RMHA 4A82A 2WIDA 1JYFA 2FK8A 1TVMA 5T8KC 4NFLA 1ZQIA 2FFJA 2ZTEA 2J8ZA 2IBMA 4PAQA 1XALA 4E2XA 1DB3A 1NNEA 3P2OA 1E1DA 1FQKA 2QLFA 3K5WA 3PIRA 3I45A 1G63A 2M6KA 4DA8A 2NUTB 3CX8A 4BATA 5LA6F 3DOHA 3WNCA 1T5LA 4DJDC 1AQUA 1TCBA 4ISBA 2KIVA 1JIKA 2JBAB 3CGGA 3LW8A 3B5JA 7GPBA 2ZG6A 1GAEO 1TEVA 2ZS9A 1L3CA 1Z13A 2MMCA 1YFKA 4ACOA 4JI1B 3C3KA 3AJ9A 3KP1A 1IWBB 1VSVA 1QBGA 2JH1A 3D6FA 2IS6A 4I9HA 3I62A 2I55A 3UK2A 3T3HA 4XA8A 1MEJA 2Q6OA 1JT2A 3IUMA 4PYRA 4BVAA 4F2SA 3G6YA 4PGHA 2WNSA 5BW6B 2XE4A 2PD4A 2C2GA 3TQ1A 5AVJA 1ZQJA 4WOCA 4H7KA 1AS2A 1Y3CE 4B6FA 1IPEA 4FWIB 1T10A 2Y9TA 3G02A 1IIRA 3JV7A 5JVDF 3KUKA 3G59A 2NO5A 2QX8A 1Z4PX 3JRNA 2Z5VA 3KVVA 4RJ2A 3T9CA 3CVOA 4BTEA 3V9PA 1J5EB 2A6PA 4CF6A 1M2OB 3S1SA 4QWAA 1X1DA 4PYMA 4LI3X 3VDQA 2KB0A 2YRFA 3TIFA 4CTNA 1DGJA 1PVRA 2P2CA 1ZVJA 3VM6A 1P5FA 1M1UA 2GFIA 4G0OA 1H0KA 4L4XA 5K4LA 2QL9A 2V7XA 3S1AA 3KHKA 4F8EA 2RI1A 3I2JA 4V38A 1IXYA 3IBFA 4W1QA 1BWPA 3SK0A 5KCZA 3HKBB 4L8FA 2KZ3A 4BPBA 4RU9A 1W93A 1Z34A 2RH4A 4K8OA 1Q3KA 1G19A 3OSZA 3RU9A 2GJ9A 2K2WA 4X20B 2NV6A 3G2PA 4EB3A 4TMZA 1A5AB 1PR9A 1ZNXA 3JPRA 5DM0A 1XPJA 5ULLA 1EFRD 2H1LA 4C43A 8MHTA 2AOTA 3N9IA 4Q02A 4KXFB 1GFIA 3JZIA 1NMQA 4JFAA 1T5BA 4PCUA 3SZ3A 4A0SA 3C8UA 3QHPA 1ZVQA 1XCPA 1YE5A 3DA8A 4PZLA 5CA0F 2WD9A 5KFLA 4IIJF 2XICA 4GX1A 2ECOA 2VWPA 4FJ0A 5U9CA 3V6LA 4O9MA 3DBIA 3JSAA 4JC5A 4XDHA 3CCCA 2YV2A 3FNFA 1A8HA 1UJNA 1GEGA 2BAGA 4UFOA 3VZCA 1F8YA 5EKTA 4PR0A 3TK1A 3G8YA 1E3EA 3GG9A 2J6IA 3L8ZA 3U3MA 1SIBE 3DAFA 3FYUC 3JVUA 4MRMA 1JMYA 2BDPA 1QDEA 5MFZA 4JXXA 4IDCA 2QTFA 4O3SA 2EVWX 1B8UA 2WU0A 3A6EA 1VJ0A 4WMLA 3A26A 5E6RB 2J3KA 1XA3A 2VF4X 3ABIA 2WQ7A 5CK4A 1PR1A 4YAOA 5AW6A 3QK7A 4K05A 1TAQA 1X7XB 1BE0A 1U2GA 1SV0A 3RB6A 1V4NA 3NQ41 4N0QA 3WHPA 4KMMA 1X9SA 1F38A 2FWPA 2ZYGA 1M33A 2XOKD 2Y1CA 5GZ3A 5J29A 2WPDD 2NW6A 1MJFA 1F7UA 3FXAA 3KTAB 2VDQB 3PUYA 1NXVA 5BN1A 3VYTB 1E9AA 1L5LA 3N28A 1JAYA 3AF3A 2BISA 2EAUA 5C46F 2Y9PB 3AU9A 3WB2A 4JELA 4Q24A 2E87A 1E2GA 1EB8A 1NK9A 3FDJA 1J23A 3LBNA 4OXYA 1XRQA 3NHFA 3WGTA 3UGJA 5BPFA 2G1KA 4YHBA 1FSSA 1ZR2A 1FO4A 2C2WA 1RWXA 4AM8A 1BJKA 3VOSA 5CEFA 3SHWA 4US0R 1Q44A 1LU9A 3U62A 3QYFA 1VG1A 2I6QA 4JSYA 5KQRA 5L1IA 2DOKA 3Q7TA 4FFRA 4RTRA 1Q0ZA 2I80A 2I29A 1PT6A 2PKXA 1J56A 2SECE 1XO1A 2V4ZA 3I6YA 4ZYTA 4BUGA 1U7XA 4QODA 4LZOA 3LFTA 3UMFA 4KR3A 2CE7A 4KLDA 3CN7A 3D4OA 3PHGA 1G7RA 4H3VA 1JEAA 4G2TA 2QKYA 2C59A 4KR6A 4PSUA 4Q01A 2ZKIA 3UMJA 1UMDA 1CRWG 1NYRA 1Q7EA 1U1IA 2I99A 4MCAA 4E5MA 1NBEA 4TN1A 4DSIA 1YB7A 2XWPA 4MVCA 4DMFA 3LGAA 1Q14A 1KXJA 3OPXA 4B8WA 1CDDA 1UXKA 4PF1A 1WQ3A 3R3UA 2A57A 3KOWA 3CF4A 5AICA 5D7NA 5AHRA 2DP4E 1RXVA 2JR5A 1PTJC 3CZRA 1GPNA 3CVVA 1UBKS 4UB3A 2ODWA 1N3IA 3AVXA 2XVTA 1MRZA 3QFFA 5IIKA 3CH7A 1CRZA 1L4HA 5K0BA 4NFSA 3EGWA 1TM4E 2YJ3A 3CW9A 5CHGA 4FGJA 1ZJZA 4MVYA 4WZZA 4XYMA 3VZSA 3NBQA 4OL0A 5U1PA 4B0OA 3FPCA 1IN1A 5JAZA 1PX2A 4OLBA 3PKJA 3NVAA 4J6FA 4UDXX 5AOAA 4RQ3A 4Y2YA 1EQAA 1I4WA 1QYWA 3QBTA 3GHHA 2UUCB 5B1IA 3HFSA 3ZCVA 5DLGA 1IJFA 4QHSA 3W4JA 1T3ZA 1IZYA 1X7DA 4U8GA 4A6XA 2IYTA 4I9UA 5KL1B 4BECA 2QB0A 1Y7HA 2FSVA 2OBNA 5LD2B 5D5QA 4EG5A 1LC3A 4XIIA 1KFJB 1NUAA 2IDZA 3QMWA 2AJLI 4MQUA 4OO3A 4W1PA 2X0RA 1PP4A 1DWUA 1RM0A 1KMCA 3DFKA 3LT2A 3HWTA 3MTGA 3IKJA 1AA6A 2FGJA 3H3JA 3G9QA 2GCOA 3OD5A 1KVRA 3I64A 4INPA 4ZYZA 2DTEA 3H8VA 1I8TA 2A1IA 2RB5A 3PYLA 4WJLA 1TKBA 3BCSA 1V16B 1NJGA 3NPMA 2QX7A 1DCTA 5C7IO 1OMOA 5AVZA 1D04A 1JA0A 2QXYA 3AUTA 1S2IA 3HWWA 3L7MA 1BDHA 4EYQA 2VZLA 3H19A 3SSMA 4CLRB 2FLLA 1UP4A 1ZL2A 3NDIA 3NFYA 1SCJA 1N92A 1Y4UA 3PHCA 3VI4B 1JNXX 4FWTA 4ZZ3A 1R3DA 2H7YA 1WXDA 3RCBA 3PFBA 2RRDA 1A7JA 1VGRA 3UMVA 3VU9A 2VI5A 5DGHA 1OC4A 4LHWA 4EWLA 4KLTA 1RKQA 2NUTA 1SM4A 1NLUA 3OZSA 3ZU4A 4HK4A 3UY4A 3W9UA 4CYMA 3HJNA 5B6IA 2J87A 4ZAVA 4FFMA 3O38A 5KYGA 3R44A 3B13B 3K1AA 1KBZA 2C9CA 4ZCMA 3ZN2A 4KN8A 3RB4A 1HL3A 2CJPA 2OYYA 2C5BA 2QX4A 3OQJA 1G7SA 3ICOA 3M5PA 2BZSA 1I7DA 1WCLA 4JV5B 3V5NA 4WK6A 1V9PA 2X6RA 1N6PA 421PA 4B82A 4DMRA 1EE2A 1BD3A 1T8UA 1JKMA 1H6CA 4RE5A 2GF0A 4WJZA 3H65A 2QPTA 1R50A 1ZBQA 4CU5A 1G4HA 3AEXA 4A8TA 1GPUA 3B3QA 3I9V1 2P5UA 2VJKA 2YMLA 3GLRA 4LYJA 4P22A 4QYTA 4Z6KA 2QN8A 5H80A 4BMVA 4EKNB 4P5EA 1P9NA 3EEIA 1NTOA 4I14A 1CUKA 2IYZA 5KG6A 2RHHA 4H16A 1X1SA 2GTHA 4TKVB 3OUUA 1Z4LA 3CHYA 2DG2A 2B1GA 2ZE5A 4W6QA 4OKNA 1J6UA 5EZYF 3PGKA 3CNHA 3D0OA 2GEDA 4J1TA 3VC1A 2C5EA 3TPCA 1ESEA 2VDNB 3S1AB 3T0GA 2R2GA 1FMJA 1TJ5A 4ETMA 3I4CA 5A7HA 4GSKA 1JAXA 1GYRA 1J22A 1GLNA 2EARA 2XOKA 3BDVA 1TRKA 4JIMA 3PV0A 3LVWA 5C0YA 4KUGA 2PY6A 2POCA 4LK2A 1LJLA 2H3IA 1EWRA 1RFLA 3PUHA 3ISDA 3VU9B 4D92A 3D2LA 4EFDA 1VA4A 1H8EA 2VSQA 2LW7A 5KG1A 1GJRA 2EQ5A 4S1WA 5JQGB 1EBFA 1H9AA 2W11A 1P1CA 4NYJQ 5C5EA 4QECA 3TLCA 2J9YB 1SK8A 3FTNA 4DUGA 4MV0A 5L9AA 5KNDA 1L5MA 2P65A 1NE2A 3VR4D 2JIZA 4B9VA 1G8AA 1L6IA 2VA9A 2W2NA 2Z8XA 4K9SA 4O4JF 4U02A 5H7XA 1OOEA 5EC8A 3SQXA 2W9XA 4L72A 3T4UA 5LKAA 1NQAO 4EHDA 4LYEA 4HX9A 5HMLA 2X8WA 3EWSA 2WJVA 2H8GA 2PUVA 2RBKA 1YS6A 1EMDA 1JQ3A 1PLJA 2H1FA 2JEYA 4TSFD 1KEEB 1GU0A 3ND9A 2GDZA 4O4LA 5CPFA 1VKNA 2DRIA 2FFRA 2R6HA 3ZUPA 5BSGA 9ICOA 3H1GA 2IPNA 2F1JA 2UVPB 4AUNA 4AUMA 2EJUA 1IXRC 4B0PA 1TYCA 3HTXA 3TH5A 1CF9A 4KODA 5IJXA 2TMDA 2XNDA 4HWRA 2BMWA 5FUXA 1YNSA 2HU8A 3RR2A 4D6YA 4CKBB 3QYJA 3C1OA 4V2IA 4ECXA 4HLUA 3D8HA 3ZIDA 3P45A 2ZIUB 2P0AA 4GW3A 4FDVA 2DVMA 4NPCA 3WL3A 2R6CA 4GUAA 2HA7A 1SVWA 4X90A 3KJIA 1ZH2A 3AQIA 4ZVNA 2D2EA 1RR6A 3L6BA 1PL6A 3PC8C 1SBIA 1U3FA 4HQFA 3H2JA 3U4IA 2ZCUA 4NYMQ 1LD3A 1JXEA 4RV5A 4TTPA 2GF9A 4CLEA 4FM9A 1N6OA 3K05A 2J0QA 1DRGA 4PANA 4S1TA 2ZS7A 1V97A 1RYHA 2F59A 1L8XA 4UJ3A 1BXRB 3CR8A 1L4UA 1NJ5A 2PUWA 4E2ZA 1MRNA 4NBWA 1T3LA 1C2TA 3T94A 4F4HA 4E13A 1PGQA 1DS6A 3A3YA 3H2YA 3KPWA 4U2FA 5HFNA 4ZC1A 3RD5A 1BTOA 4FSDA 4EUKA 3W2IA 1C20A 3PMNA 1EWVA 1PUXA 5FBRB 1M6YA 1U28C 4EZIA 4ZCSA 4Z4HA 2RHRA 4YRKA 2Y4OA 1KL9A 1NZJA 2JEOA 2EGHA 4DCNA 2UKDA 1N3BA 4BKMA 3ETHA 1NW7A 1JZSA 2YXLA 3DXFA 3SFZA 4AJ1A 2BGNA 2C0PA 3UNXA 3VKUA 4F50A 4QA9A 5JISA 3IIMA 3OEYA 2WUDA 1NNUA 3SX2A 2XDAA 4OI4A 1E66A 1Y7PA 2HNBA 2W8ZA 2F90A 4C87A 5A0LA 4ZI3A 1OH8A 2AR7A 2O0MA 3FCXA 4DR1B 2YWBA 3BBPA 1QU3A 4UAUA 3ESCA 3S2GA 4AFNA 4H59A 3DW1X 4OXXA 3FWYA 3KDAA 5FEUA 2X2FA 1V1RA 2BMFA 2QOEA 3BKXA 4IDBA 4WNYA 4WN9A 1GRCA 1QIKA 2O7QA 2W9CB 2XA1A 4BNWA 1Z0DA 3LX4A 1UCFA 1Y4AE 1L3SA 5B37A 3VPCA 1SA0A 3HV2A 3ZJUA 5JJLA 5HIAA 4ND1A 3HCPA 1H4VB 3V7WA 2ODPA 3M6XA 3OQPA 1XELA 1V8PA 1ISJA 1QO0D 2DFVA 2OGZA 3RYTC 1I2MA 4J0GA 3SXUA 1NUTA 1HNWB 4QU5A 1ISGA 4X24A 2QQGA 4C1BA 3IKTA 3RVJA 3GHYA 5BWBA 2RI6A 2KTQA 3G7SA 5EP1A 3UT5A 4IHJB 3U1VA 3ALRA 1CZNA 1KHTA 1AA9A 1S3SA 2RCNA 3H6GA 1H5NA 3HR7A 3IIIA 3JD4A 1G16A 4GOMD 4UJ5A 1QTQA 3HPRA 3LYUA 4F91B 1Q74A 3B7GA 5ESXA 4JN6B 5H68A 3RUCA 3CISA 3O4HA 1DK3A 4JB2A 3TI0A 2WHQA 2Y1DA 4AKIA 1V8DA 1NJ6A 5EJMA 3TANA 2XIJA 4UEJA 4KP7A 4DG9A 5EUBA 3HNOA 1MGPA 1P2SA 4R83A 3WGVA 3BK7A 1DGQA 2GCOB 3PV8A 1C0PA 1BDBA 4LX8A 1I2AA 3ZQ6A 4YS6A 5CB0A 3AFGA 4URYR 4U7CA 5H4GA 1YTLA 3AJDA 2QMQA 4ID9A 3U09A 3BZWA 2BBTA 5EMLA 1MOQA 2VRBA 4QBHA 5LOVB 2WTEA 4JLJA 9LDTA 3JCZA 4UXHA 2C7PA 1ZI9A 4Y1RA 4QUBA 3RSLA 4IUCS 4IL6U 1TF5A 3H5VA 2MJLA 2O1SA 3KJZA 2DR3A 1H2ZA 3WV5A 4YJ2A 1NR5A 2X1LA 3EQ2A 4IDDA 4UBIA 3I04M 1W2HA 8ICLA 1I3LA 4MRAA 1A2QA 3TD9A 3NIWA 1FFWA 4Y2HA 4HN4B 2JIDA 3Q3EA 1BPDA 2WD7B 3H9UA 4MQBA 4QIHA 4X7BA 4NULA 1OXVA 2X2PA 3CZCA 1BD4A 5I8ZA 1V1JA 1T5TA 1HT2E 4M21A 1G20B 4HNAA 2H5JA 2UZ3A 2BUAA 4ZIRA 2G83A 2WWHA 1PG0A 3UMRA 3HKBA 4MEBA 4KE8A 1KI8A 2JAHA 3SZLA 5AVXA 1H3EA 3JR3A 1WBBA 1JF8A 4QPZA 5KDLA 4DIBA 4EB8A 3ZV4A 1E1CB 2IZ1A 4TMKA 3RUHA 1G8MA 3EMKA 1T0JB 3GDHA 1X9XA 1YRYE 4RPHA 4UM9B 3A9CA 4PTZA 3WZMA 1K6EA 5KFUA 3VU1A 2FEMA 1S2OA 4MFCA 4QUHA 1URJA 5KTMA 4YAJA 2QIOA 3WKCA 1PQ4A 3LZ6A 3RT1A 3SVZA 1ZQSA 3OE1A 3MDAA 3O90A 2PI4A 2DQNB 3H8MA 5TPZA 4YN4A 1Q0PA 3EHEA 1WZIA 1JQLB 1N5JA 2W6NA 4XFJA 5HQJA 1AGXA 1EXNA 1ZETA 5KWVA 4X62B 3QKWA 5KZMB 1B74A 4B6QA 5DTRA 1N0IA 1U7DA 1AMUA 2Y93A 5DP1A 1GUAA 3AIMA 1EFVB 1NIJA 1VLLA 2HNAA 2IF2A 3T7SA 3UHJA 1U2SA 3JTEA 2V6FA 2XVMA 3HCFA 3TLGA 1PYOA 1TJNA 3CLRD 3X1XA 3GOHA 4NM1A 3N6VA 2PAFA 4F84A 1GEEA 3D54D 5IVKA 3IDWA 3ICXA 3KZIU 2QVLA 2IQIA 5JXHA 1CEYA 1I4DD 2QB1A 2JGDA 3S28A 1X7WB 1DG1G 2PZBA 2EX4A 7ADHA 1FW6A 1KAEA 1SULA 3FUWA 4LF6B 1BCSB 3MJHA 1VHTA 3M33A 1G8YA 2VAXA 3KTOA 2JFFA 2IS4A 2PH3A 1C0EA 3I6MA 3L8GA 2FPGB 4Z9AA 2NM0A 3MINA 1BGVA 4LISA 1EINA 1CIPA 3DO6A 3ZU2A 2HAEA 4AG5A 5DSTA 4WY5A 2MSKA 1ADFA 4OCZA 1ODFA 2Q9BA 4AICA 1P75A 4BMYA 2J9FA 1C7QA 1ZD9A 4QFMA 5GPBA 4ELUA 4F3YA 1RYYA 5DSZA 5J47A 2FR0A 3VUEA 3Q8QB 5JAHA 2XGMA 4DDTA 1M54A 4GVLA 2OCLA 4HWKA 2XCTB 1QSSA 1CY2A 3PNYA 4HRYA 2UAGA 4E1VA 3VSBA 5HQ3A 1JIXA 2W71A 2UXBB 3WWPA 3B78A 1COWA 4B79A 4LW8A 1E7WA 4NZZA 1XQ6A 3LHSA 4TVBA 2OESA 3KR1A 4ZVLA 5TPWB 5JD3A 4URVR 2BGLA 4DL5A 1ZJYA 3EMDA 4Q12A 4TX1A 4DLRA 1PVQA 3P0FA 1UXIA 2GYWA 1GKKA 2P27A 3P1JA 2AFIE 3TLMA 3V1KA 1RKXA 1UQRA 1X0XA 3HEAA 4LGVA 3PLNA 2HEGA 1ACLA 2QUBA 1LCIA 3ZHSA 2EDAA 1D6SA 2X8JB 1FE8A 2Z9DA 1CE8A 4R7GA 2NU8B 1ZO8A 2NACA 2QRNA 4ZT6A 6AT1A 3IJEB 1K5OA 4K9DA 1NNSA 1U99A 4URHA 2FX3A 1IOLA 4M1MA 1D2CA 4R2XA 3TSOA 5KFJA 1Z1BA 1U0TA 4IIXA 1GQSA 1P9RA 3ZW7A 1EM8A 1Y5LA 2PG3A 2G0AA 4U2KA 4A1FA 3V8VA 1AM4D 4JD5A 4KCGA 3K96A 4C76A 4M1QA 2PX3A 1A4IA 3RAFC 1GU7A 4YB8A 1KMMA 3KQLA 3R5TA 4JLSA 1O96B 1AQ6A 5JWHA 1BHQ1 3E0XA 4L0QA 2VNHA 2V1XA 4LTDA 3PGXA 3UH0A 5C3MA 3OCVA 2CYCA 2N47A 3DP9A 4XCXA 4O0IA 3SSAA 2AQHA 4QGAA 1Y9AA 3EQ7A 2J32A 4JQSA 4QNNA 4Z3KA 5D2CA 4JVOA 1M34E 3DG9A 1YUNA 2LKCA 1XTTA 3AGPA 1FB5A 4R6XA 5KFYA 2BEKA 4PHDA 1W1UA 4RHXA 3CLTD 4M53A 3W5VA 3P2IA 2IV2X 4D1YA 2W9BA 1J7KA 1H65A 1XSPA 2ANCA 3LT1A 4JA0A 2HMXA 2PVCA 2H0QA 2QRGA 1Z36A 3GLFE 3DQQA 1GN8A 1KYQA 3RS3A 4B6JA 1PV2A 2C20A 3VX4A 3E0FA 1OAOC 3RC7A 2XSZD 4D80A 2OM6A 3CP8A 5AMXA 2H59A 3OMWA 4RUKA 2FN3A 1YZGA 1CNFA 3NBAA 4NDNE 4BFWA 4F38A 4TUSA 4US1R 1J8YF 4AJ2A 3BVPA 4CIVA 1SR8A 1QIIA 5KFDA 1D2AA 3BB1A 3QVGA 4KDEA 1L4YA 4L8WB 3VX3A 3PDCA 2XC9A 4W5HA 3AB3A 3RRZA 3E9DA 1OFTA 2GPWA 3NRZA 5EMMA 5F1YA 1MH9A 3OE7D 1KI4A 1NP6A 3PDIA 3FNBA 1IWOA 5HF9A 1JMVA 1DRVA 2QAGC 2I33A 1KP9A 4BAGA 3KYBA 3KHUA 3KWMA 3ZCUA 2Q27A 5FQNA 2X4LA 4RLHA 2VJCA 1KE2A 4DR2B 4F21A 3IR7A 4V0MA 5AK4A 3T7DA 3M9XA 5HOEA 2XT6A 2CB0A 2AYYA 3O91A 3AHDA 3HEBA 5K3SA 4BVFA 5ARDA 4BP1A 1OCEA 2LXNA 3GJ5A 2NIPA 1VE9A 1XMQB 1YWGO 2VTDA 1EP9A 2H4ZA 5LZ5A 3A06A 2KMDA 4RTKA 4R8SA 1TQHA 1ULAA 3T12A 2J0SA 1OLOA 1TYEB 2XRFA 4ZARA 2DH6A 1NHWA 1UOEA 3SF8A 4FKMA 5B1EA 4BXOA 4FGSA 3HKZF 1B14A 1WXGA 1BKDR 2JB9A 2GASA 1IB0A 1CX9B 2Q5EA 1ZIPA 3BWCA 4OUDB 3V8BA 2F9LA 1CDZA 2I1LA 5TQ2A 4NK4A 3RS7A 3WRXA 4AG6A 1N5WA 6ABPA 2O7RA 1SBCA 2BEWB 2IZ6A 4DCSA 1Z38A 2YQ5A 2DQSA 1P31A 1FIQA 3PRHA 3U7JA 1DO0A 3QLVC 1RJFA 4RH3A 1TMOA 3OSNA 1ZH0A 2W55A 4M22A 5B3JA 3ZHOA 1XSLA 1YFZA 3DVSX 3LUFA 2F43A 4GNRA 2O6LA 4IIFA 4RZSA 2CVHA 3EVEA 3GYBA 4PWYA 2ORYA 4X1KA 5CHYA 1MX5A 3GJQA 1NVDA 1HL7A 3PRJA 2VJOA 4ZOCA 4P54A 1D7OA 2I4TA 1VRWA 5CEEA 1R3UA 3KQMA 2C61A 4FGZA 3EPRA 4OHPA 1LWNA 3D4IA 3HVJA 1QGUB 2GVZC 3VSAA 4R0VA 3B36A 4XIFA 4NEQA 4I4LA 3JPTA 4JWTA 4R8LA 2C99A 2DU8A 3OCWA 4UB5A 3KKKA 4R2WA 4BN0A 3LQ1A 4EG4A 3CS3A 3KOZA 4D56A 1YS7A 1G98A 5E95A 3DJFA 4C6TB 3B2QA 4K6OA 5K6AA 3Q8LA 4ZHQF 5GOTA 1ZQCA 1PW5A 3KT8A 3W77A 4FUQA 4FYHA 1TA9A 4BUZA 1Y3DE 1ZHHA 2LKDA 5IJ0B 2FJPA 2Q6LA 5BMVB 1RWPA 4F5QA 2FW8A 4IGIA 4Q4JB 3OE4A 3SF8B 3WRWA 1RVDA 2QTHA 2VCYA 2CRXA 1W4RA 4JEMA 4N7JA 1TQ6A 1V4BA 2VJNA 1YR3A 3FJOA 4NSNA 4TV9A 3A0RB 4X1OA 4Z9FA 4DABA 5LQMA 2AI3A 4IOJA 4FFOA 4MUBA 3S2EA 4L15A 5FFFA 5I7SA 1JXLA 4C7OB 3ZR4B 4BB0A 2JJ2D 2WAAA 1LXCA 1JLRA 2UZ0A 3L0YA 2YHBA 1SMKA 2PA3A 5EE0A 1X87A 4ZQBA 2GB4A 4YUXA 2AIRA 1UDRA 4DLVA 4BFVA 2Y1LA 1JEOA 4WBNB 2NXWA 6GPBA 4JUCA 4O6VA 3QMPA 4CM9A 1I3CA 3N86A 2OBBA 4O1HA 4R1LA 5JSZA 4BTVA 5T3YA 3T7AA 2QW1A 4CLOA 2OLJA 3GMSA 4QYSA 4EPRA 3HRHA 4O5AA 4DUYB 1T35A 1OFGA 4CKEB 3F8TA 1ESNA 1CJTC 1I2CA 2VS1A 3P32A 1YKFA 3ICQB 4NMMA 4U00A 2M2IA 2AS0A 2P66A 3STWA 1ZOPA 3ECAA 4TM7A 4OHZA 1IOWA 1DAKA 4E33A 1X7HA 1A5BB 2PGNA 2YQ4A 1IATA 3QNWA 4KQKA 4O2RA 3ZDRA 5BSFA 4TLCA 4D9NA 1ZMBA 2ZIFA 2YDXA 1XRSB 4P3NA 4G5HA 4H6VA 3A28A 5TJHA 4F4KA 3O4JA 2IS1A 4CM6A 1A1SA 1PS0A 2Z1DA 3W5CA 2A1JA 2P35A 4W7IA 2F55A 5KFKA 1T6YA 5TR9A 1UM8A 4QYMA 4G5RA 3TBKA 4JJ4A 2C8KA 1T13A 2BEJA 5P8WA 1SWWA 1OLXA 1PG5A 2FFBA 4LBZA 3W7AA 3ENQA 5TPWA 4E4YA 1TB4A 2EEZA 821PA 2B6HA 2OHXA 3GRVA 1BFDA 2AI2A 2WAQC 4RANA 2IU6A 1CFJA 4X3PA 5CG1A 2XSZA 2D3TA 4MGYR 5AKEA 2Q2QA 4MF2A 2H2DA 3ND5A 2PEYA 5K0ZA 4BLSA 3MR2A 1B15A 4FLFA 1L4GA 2G04A 4NCJA 4TWIA 2AKEA 4QOHA 5K3FA 4MULA 3LLSA 1PVDA 3TADA 5JI3E 3KZXA 1L5VA 2R8HA 2QLLA 4B43A 3CUSA 2ZRLA 1FJHA 2ZSAA 1VJGA 7AT1A 4EX7A 2KVSA 1ZQMA 2QGNA 3JATB 2ZVQX 4DMKA 3Q8SB 2DLNA 4WDQA 4CLOB 3A14A 3BS5A 3PPXA 4JWNA 5AXCA 6LDHA 5E1BA 1WMDA 2YVAA 1YQDA 1NKCA 1DFHA 1N1MA 2WWIA 1RZ3A 2NZ8A 1GCIA 1WIWA 1KQ3A 5EERA 5FBLB 4A2PA 4D02A 3EOAI 3VAYA 2V5UA 3PVSA 1JA9A 4JQYA 3EYWA 3O4IA 3PFHA 1UK9A 3FM9A 5IPFA 1B4DA 2JAOA 5JWRA 1U2QA 4OJLA 3I6ZA 4LJRA 1BVRA 5J58A 3CJTA 4OHRA 4Z53A 1UAGA 4K87A 1F0MA 2PO7A 4GZ3A 2Z8YA 3SJCA 5KYWA 2AEEA 3NHAA 1FU4A 4GPIB 1BWRA 1FF9A 3FF1A 3MGAA 3QVLA 3QWBA 4TSRA 4CPDA 8AT1A 3TTSA 3H4VA 1VCNA 3NPAA 3RRNA 2GEKA 1KI6A 4DMMA 4DSNA 4L9WA 4EI9A 3HI4A 3BSSA 1VFPA 3MOSA 1FDTA 1IZ8A 1CR0A 4N3AA 3CLVA 9ICUA 1DKRA 1KEUA 4AK9A 4ITUA 3RFVA 3GGOA 1TT5B 1Q7BA 4IRXA 3LXUX 4HNSA 1XCMA 2Q0HA 4GI2A 4DRXB 1ZQZA 2C78A 1FDOA 1IU9A 3FWPA 1IG0A 4CCSA 3PX4A 1YOBA 4DOMA 5EJ8A 1T8EA 1UT6A 4JBIA 3RVDA 3PC3A 4P7GA 4A0RA 4MQEB 4UKDA 3TSAA 2V4QA 2JAQA 4PC7A 4GXKA 1DDGA 2Y6UA 3FX2A 3OZAA 4R8UB 3RRHA 4PRLA 2MYPA 2NPOA 3K9LA 3EZLA 4N82A 4P4NA 2QW0X 3GWZA 3G89A 1NKBA 3L77A 2A1TR 2ACEA 1R10A 2WDZA 4P81A 4RQ2A 4RKQA 1VTKA 1QHFA 4A8JB 5LXTB 1AC5A 3M82A 1AHNA 3L9XA 4NU6A 1B6TA 1MXFA 3RVBA 2D2VA 2X6QA 3FOWA 1O54A 2DFTA 3IQZA 4C78A 5JH7B 3LDAA 1YZ7A 4CM4A 3IV6A 1WHSA 2D1RA 4BQIA 1WW8A 3BJIC 3AEKA 3ZNPA 4YVFA 5DNWA 3QOFA 1BKYA 2AOUB 3BK1A 2CXUA 3BRWD 1KVQA 1V8OA 1XI2A 4I6JA 4RY2A 1K7FB 3K20A 2O2SA 1RD4A 1YR6A 1RZVA 3NONA 2WZCA 1E2NA 5EVCA 2J59A 4L5YA 4NZ9A 4YP3A 4CVNA 1L5QA 1K7YA 1XZJA 3AVOA 3COVA 3UJ8A 2IPOA 2W58A 1JALA 4FW9A 5FPTA 3VKFA 2HPHA 5J40A 3OQOA 1XA4A 3AW9A 3CV3A 3M83A 5GM1A 1IPHA 4BJ3A 5F23A 1POXA 1TU0A 1YDHA 5HJEA 1W1IA 1R4NA 3L7NA 4C8NA 4ZAXA 1X7XA 4XLTA 4TVOA 1GZ4A 4QW9A 2J4FA 3RS4A 1XNQB 1O5OA 4C0LA 2HCRA 3HRDD 1EVKA 1K6MA 5JPIA 5D6NA 1EZ1A 4ZN6A 5DGAA 1FFUA 2QJOA 2R87A 3C3WA 3IIEA 4MYTA 1JPUA 3T3GA 1QGUA 4RZHA 1SA0B 3IMEA 3DMPA 2OZVA 3W5DA 3EBLA 1NF9A 1Z2PX 4ZODA 3OFKA 2FMPA 5G2OA 5BMOA 3V46A 3OWXA 4G56A 1Y1SA 2NZWA 3CLUC 1E58A 3O2NA 4Q1FA 2D1SA 5DBBA 2P68A 4KRYA 1MA0A 4BN5A 5HGXA 1MJGM 3EGIA 2GBLC 1PQYA 2PZJA 2X1VA 3RU2A 3ZHXA 2OHJA 1VYHA 2A33A 2E21A 2B92A 2JAPA 4DBLC 1JQKA 2ADMA 3S5UA 1LI4A 1VLJA 1JG1A 4GOXA 4B9TA 4HZUB 3WGLA 4GOJA 2VQ6A 1C1XB 2VWGA 3JQBA 3K92A 4QD3A 2HOFA 4C9BA 5KT5A 4MEJA 3FFTA 2D3WA 5HS4A 3F74A 5KFFA 4N8EA 1P29A 5FI5A 4AWAA 1ELOA 1Z5UA 2H9IA 4F2RA 1EFDN 2UDPA 3EJ6A 4V02A 5KWIA 3E1SA 1G4AE 1OFVA 1SXPA 1FSZA 4G85A 4DANA 4TV9B 3RKRA 3QA3E 2XLBA 4II3A 1GADO 2Q29A 5DGDA 4ZTBA 1CC1S 4FSXA 4TWZA 3A05A 1NRIA 3LKDA 1YS9A 1V1MA 3GMTA 3L6CA 3BL6A 4AYTA 3D1JA 1XRPA 3IILA 1HE1C 1OTYA 4UHFA 4I4TF 2RDMA 4CMIB 4HFRA 3BAZA 1GY8A 3IESA 3KR9A 2HHXA 3NU1A 4PLFA 1BDIA 1XQ1A 3QTTA 1TF2A 2QD5A 3D4PA 4IDAA 5CCDA 5L3SA 4F92B 4MDEA 1G6HA 1O5TA 4YPVA 1BPXA 1BQEA 1P7CA 3D02A 3A1NA 1L1EA 3ESDA 3H5RA 1ORTA 4QG7A 5P21A 1ICIA 2XDQA 4LGCA 4UE6A 4BMCA 2HT1A 1SELA 1P80A 3R3WA 4I2DA 3F53A 4X3CA 9ICNA 1PVPA 1UF9A 4JBNA 1Q17A 4UAZA 5E4TA 2X7XA 2B36A 1V5GA 2O2EA 1Y3FE 1DC4A 3FY4A 5KDOA 5B4VA 3L0OA 5DB6A 1NBIA 2Z04A 3MF4A 2R8JA 1JIIA 2B5VA 2O6KA 2H7XA 1CUZA 1SUAA 2MINA 4Q9HA 4D8VA 4P3XA 3U4AA 3M6MD 2KBFA 3HJFA 4JI8B 3B20A 4Y9SA 4FJ2A 3BQTA 2V6BA 1QQ5A 3GIWA 1Q1QA 1ZXLA 1SCKA 1GA6A 1S8FA 4Y7CA 1ZZEA 2ZPTX 3DUFA 3IB6A 1G4UR 4MVJD 3ZI7A 4B4DA 3R0JA 5KCMA 2RGNA 3OIUA 3DLCA 1EFVA 1ZUIA 2HF9A 3N74A 4PM4A 2RGGA 4KLHA 1JUDA 1CUGA 2PGLA 1BE1A 3CZ5A 2VATA 1MABB 2VQDA 3CT4A 4WNCA 4E94A 1DDIA 2AG0A 4P2HA 5CYOA 3GU3A 3GR6A 3A6DA 3LCRA 2XIDA 1AKRA 1QIDA 4L75A 4AU1A 4EFLA 3JPPA 2CLSA 2JS7A 2C9ZA 1HLFA 1A2OA 4PJ0U 5AJYA 5AVKA 2XECA 3T5CA 2LI6A 4IV5A 4R16A 5L3SB 2QP3A 2WWRA 4BV3A 2A30A 3JVIA 4P98A 2XUQA 3H9QA 1H2FA 2V8OA 3G17A 2XV1A 4RGBA 1GG8A 1YA4A 5LQKA 3ERCA 3IBYA 2P3OA 5IXJA 1AQJA 1P39A 2CV0A 3KJXA 3FMPB 4K9OA 4F9TA 1JEDA 1M0SA 1R0BA 2W2QA 3F3SA 4Y67A 3RVPA 3SZOA 2VLIA 3K35A 4MR9B 4REQB 4TLEA 2O3UA 3QE0A 3B6JA 4L85A 4ZCLA 4QEZA 1Q83A 2F2AB 2VSXA 5KDDA 3NBFA 1BE6A 4BV2A 1AURA 2OC4A 1NN1A 4YRPA 3MCAA 2ZI4A 3MZ0A 1GCGA 2O4UX 3VU8A 3GRPA 5CB4B 1BC5A 4O3RA 1H05A 2ORIA 2P4SA 4CDGA 2QSYA 3AR7A 4X91A 2P1RA 5KMGA 1SEPA 3A37A 2C2MA 4DLKA 2OBLA 1F51E 5J0PA 1WU7A 3WQRA 1TK5A 4FFNA 4JYMA 1PR3A 3LF1A 4KBFA 4GH5A 3LVRE 3GROA 1NONA 2HA5A 1RTKA 2FZLA 3H5LA 3C2LA 3KZKA 4KO4S 3UFXB 1UZLA 1FTWA 4R54A 1S3IA 1VHWA 2ZSEA 3KZOA 5DWQA 3CC8A 3TZKA 4IJKA 3TW0A 4EGQA 1QYCA 3DMRA 3SOZA 5KAFU 3S4YA 2VJQA 4I5DA 1L5UA 1AXRA 1RZUA 1WNFA 2CLHB 1TZ2A 2H18A 2OGUA 3D7SA 3E81A 3R24A 4QM6A 1BS9A 5DNAA 1PLLA 1TVKA 4DJAA 1ZIYA 3QA9A 3FOAA 4UDYX 1GM5A 4BCCA 5DXAA 2GN6A 1R64A 1UBTS 1XCOA 3ASVA 3UZUA 3BXOA 4F86A 4WBSA 1BMQA 3IQXA 5F5LA 2I54A 4ENSA 3ZJ5A 2DPGA 7MDHA 2AXEA 3DE6X 2ATEA 4D3ZA 4P80A 2YICA 4HLNA 4XD7A 4YIKA 2AJTA 3C2KA 5JMTA 1TEXA 3U0BA 2H4XA 5KOHA 1B76A 3E35A 2DBVO 4GYWA 4JROA 2WD8A 5K05A 1WV0A 3LL7A 1ADCA 4C4TA 3EVFA 3WI7A 4E22A 5ALWA 4S35A 3J81k 2YMPA 5SY4A 4KQEA 3KM0A 1K88A 4CV2A 3IUEA 4RM3A 3R9WA 4HCJA 2XQFA 2ZIWB 2FI1A 1NJZA 1CBUA 1OJLA 4R2JA 1Z8FA 4Y8VA 1BXKA 2PX8A 2I7DA 5B3LA 5AKXA 1KEPA 4MVJA 3K31A 2QROA 2Z1MA 4P0PB 2PZGA 3A32A 5CFZA 4USAA 4JUFA 2LWIA 4UPVA 4H60A 2MU2A 4KACA 4GQIA 4WAUA 4AIRA 2RAVA 3NI2A 5GIOE 3N2IA 4GMDA 4OP2A 3LOUA 5EP2A 1UEXC 4P31A 4MIYA 5F4ZA 2B34A 3ZNQA 4Q4AB 4MS4A 1QH0A 4RZQA 3JQDA 3FTFA 4JXZA 4BFTA 2LUOA 4XGKA 4RVUA 4WSOA 2PIDA 5F3DA 5CVCA 1EHIA 1DKMA 1PR0A 2FHPA 3EN0A 5DBHX 4D9FA 2QLNA 1LBSA 3Q0EA 2P0YA 3PQ3A 4X92A 5A4FS 2CV2A 5GJBA 3DT9A 4KOEC 2JW5A 1SD2A 5DBAA 3HNRA 3J7TA 4MGZR 3R6GA 3ROGA 2IBKA 2BGTA 1H6BA 1TOAA 4GE0A 4NPHA 1TVCA 1D2GA 3AHHA 3KLPX 3L04A 2HRZA 1ZA1A 3T8YA 4F4FA 1IE3A 3EGXA 3OA2A 3ANNA 1G2IA 1WVMA 3IHQB 3AR2A 4PRKA 5EJ2A 1VPWA 2RJ3A 3C48A 5H8WA 4JC8A 4PHGA 3KSZO 4M9UA 4WOPA 1DJPA 4BXOB 4FFLA 3P4UA 4Q1DA 1Z6ZA 3TD6A 5AXAA 1IN5A 5BWOA 1ZEMA 3CBQA 3F6YA 2FPXA 2MYTA 1JN0A 2P2LA 3T5KA 2Q45A 4O33A 4W7SA 4X00A 3ZWPA 2JVIA 1WUHS 3PNCA 3LM8A 5BN5B 4F12A 4RTNA 2XDWA 5FUQA 3FPEA 4DHWA 1YS2X 3PHLA 3T7KA 1ZQBA 2UZIR 5IC5A 1HE8B 3THSA 4BQSA 4KZKA 1MHTA 1SZDA 3DWGA 1NSYA 4RFLA 1BX0A 1XBTA 4LMBA 4YJGB 1YJCA 4AZ3A 4BVBA 3EZXA 5FLYA 3CEHA 4PPGA 3I5MA 5EKUA 2V7BA 3IP8A 2QMYA 1D6NA 1PDWA 3PNBA 1T3HA 3QXXA 3CF2A 4YR7A 1JLHA 3ER8A 3NVZA 3QU2A 3VZBA 5C1OA 1HM5A 1KIAA 4EGCB 3EC1A 5CLQA 3C87A 1P17A 3GZNA 4H1HA 2AD5A 1BVYF 1KPIA 3UPUA 3Q6IA 2XOXA 1CUBA 1MP0A 3ZDYB 1NY5A 3EDYA 2BMAA 3KOYA 4FE7A 2ZREA 5EWLB 2NYAA 2GCPA 4KB5A 5F1PA 1Z4QA 2ZAIA 4Y9DA 4A5OA 1ICEA 1SQ6A 1CKEA 2D2XA 1ORHA 4A16A 1RYRA 1HTWA 4G5QA 2QARB 5EXSA 3BMOA 3GP5A 2JFWA 1SXDA 3K72B 3T7IA 2ON6A 4U3JB 4XR4A 3WXBA 1DP4A 1V43A 4JODA 2Z2YA 1CEXA 4CM9D 2QPOA 2YQEA 3VNVA 1EFTA 2ZTMA 3FMGA 3SX0A 5TZVA 1H3FA 4RPXA 3PGA1 3RK0A 2ABWA 2R4QA 4L1KA 1AIPA 4QNLA 3LBAA 4DG5A 2R5NA 2ZJ6A 3JWGA 2O57A 3TTTA 4PGYA 2EJTA 2C7RA 2V1UA 5CXUA 3FUCA 3MBOA 4ZVPA 3AK4A 2UVRA 1JU9A 1MAVA 1ZLXA 2PH5A 3CKKA 3QU5A 1PJTA 1RHKA 1QTIA 1CQWA 1JDNA 1JQEA 2O2DA 3NTXA 5EKDA 1CRQA 4YWJA 5TXGA 1PUIA 5K3CA 2HUPA 5B58C 3FPLA 4H0FA 3EG9B 3ASZA 4OJMX 4MS3A 2ZP1A 2XEDA 5T14A 2JFHA 4G1UC 3VZRA 4Z1MD 4DAOA 5JMOA 1UZMA 1TA0A 4JSTA 1R88A 3ZE6A 3WLFA 4PH5A 5DQIA 4C4RA 2LGJA 2PT6A 3L1HA 1XTUA 4ZO4A 3U40A 4YUAA 5HFJA 2IC5A 5JPCA 2GCEA 5JI2E 3SAGA 2PSDA 4OH1A 2UYOA 4B3GA 1I80A 4M1TA 3GEDA 3WGHA 4C01A 2BDTA 3QEMA 3PS9A 3FBGA 4WBNA 5TQ0B 5BWCA 2I9PA 3KFUF 3G5LA 2IITA 5FBVB 5IDXA 1S10A 2WUFA 2QRUA 2V3WA 2X41A 3CLKA 4I3HA 5FOSA 3IVRA 1B0AA 1WQ1R 1C3EA 1K68A 3I2KA 2X1MA 3WGKA 3HV0A 1VL2A 1Z29A 1NDQA 3HUEA 5F3RA 3W2HA 3AVWA 2GAFA 5ALJA 1KOJA 4G5YA 4XWAA 4DCMA 2XXAA 2RDJA 5GP1A 3LT0A 1JI0A 1SO8A 3EEYA 1OFIA 4EB0A 1G20A 3PYMA 4X93A 4TL9A 1TPYA 4AULA 4W1SA 2RK3A 4QEDA 2C96A 3TSCA 1XWIA 1ODCA 3NVMB 1P4RA 4XR9A 4NL9A 5G40A 3PXGA 2Q5LA 4C0WA 4ESHA 1D9XA 2XUIA 3LX5A 1VKZA 4YMVA 1L5HA 1V3TA 3O3CA 5ERGB 3OFSA 5B57C 2D8MA 3WGNA 4TMXA 4LQCA 4YBRA 5CJJA 3RIHA 1E1RD 3GO4A 4KNVA 1P19A 1GGVA 1PV4A 3F6SA 1Z3IX 1ZQYA 4D9KA 3AWDA 1COZA 2PR2A 5DHPA 5EKSA 3R74A 4A8HA 2D1YA 5KPJA 2VWHA 4PZZA 4TUYF 2BFFA 2VHVA 1GPYA 1PW7A 4XZ3A 4MWGA 5ES4B 3CNEA 4ZALA 1N62A 8ICGA 3D8UA 2OV4A 1QH8B 4QUGA 2ZOSA 5IHPA 3OZCA 3D7KA 2J67A 2QJWA 4HLQB 3SM9A 2G7ZA 3G6KA 4B45A 4Z3OA 2O8DA 1PT7A 2H48A 1QFZA 4L6CA 4TKLA 2XKBA 1PHPA 3LUCA 1W88A 4U7WA 5FWNA 1ECLA 10MHA 4L27A 3JYLA 1CZKA 3GIMA 2PWZA 3W9SA 3CW2C 7ICJA 1FFXB 1PWXA 2WFMA 3O9VA 3WOVA 4YRNA 1CJMA 1SXIA 2IXEA 3KT6A 3F4BA 2VHJA 1TCCA 3ZJYA 5DHQA 2RK4A 8ICFA 1FSGA 2OOKA 3HB1A 3HDTA 4YLEA 1AKWA 5LB2A 3W06A 1XD9A 1V6CA 4MPPA 1NULA 4WKPA 1F1JA 1VECA 2JD1A 2VXBA 2AXQA 2WA1A 3OG9A 4AJEA 4NCXA 4XSVA 4BO7A 3VNQA 4EY6A 3QFRA 2Q8NA 4PU0A 2OMEA 4NAUA 3L7OA 3WBKA 3DV2A 1QXSA 2JLXA 4M1YA 4RVSA 3E7FA 5ECGC 2XE8A 1NK8A 2GT1A 4NL4H 5J2DA 1SUBA 3IPRA 3IVCA 3JQRA 3MINB 5CT6A 3ZCTA 4BU1A 4EHHA 4GFDA 4MUJA 2YWEA 4IVQA 3C2MA 2QTGA 3VSCA 3RBXA 1KVTA 1G42A 2XCAA 1IC6A 3N3AC 4UOQA 4TZKA 1ONOA 1S1MA 1KZYC 2Q0QA 1VMEA 3I6BA 1MDBA 3MEQA 2KJ9A 4J9QA 3CONA 3LLVA 4UMDA 3GDWA 3M9MB 2F3QA 3NC1C 2TYSB 2CXNA 1U47A 4RZ2A 2GNAA 3C6ZA 3IEUA 2CJYA 3R5SA 3GZJA 1WDWB 3LT4A 2V8BA 4RQ8A 1EGHA 4L3OA 3O3NB 5EP4A 3SIRA 3GJYA 2GLXA 4KO2S 1H0RA 1GTMA 1LPPA 2NZXA 3IQEA 3ED5A 4CEHA 4LXQA 4P0TA 2W48A 4MVJI 4YXWA 2R8YA 4QBFA 2Y4NA 4MI6A 4Z4IA 3C1UA 3ZZ0A 3WQHA 4DJFC 4FBTA 3FA2A 2QLTA 4BQQA 3UMCA 1SNYA 2BE9A 2QMUA 3MFQA 4X41A 4B4VA 3AY6A 3UJCA 2AN3A 1FBTA 2PM8A 3A2KA 1U1DA 3GJRA 3PEEA 2E55A 3A11A 4MF8A 2QENA 4FHDA 4E11A 1OT5A 4OO1J 3K4PA 4G0VA 4CEJA 1J97A 4MJXA 3HWX1 4I2CA 3W9BA 3JD2A 4IL5A 1Y37A 1U0BB 5IYZF 4ECEA 4BLRA 4F2DA 3EULA 1U31A 2AA3A 2SCUB 2D5IA 2JKYA 2QA5A 3B8HA 4C2BA 1C30A 5GOZA 3IA7A 4Q1VA 1DIRA 2X5OA 2NVUB 1YDFA 2OBXA 1GTZA 4BAZA 3IOYA 1X1EA 1OLUA 1VSUA 4LJ5A 5KTRA 3TZ6A 3BG5A 3ONEA 1MN6A 2GM9A 3GJ7A 3PX6A 4H4EA 3TUJC 2ECKA 4QJFB 3IMCA 2OOSA 1O58A 2GEVA 2XR1A 3CWZA 4BAUA 1E6KA 1BS1A 4S1NA 1KOGA 3ZWVA 3T1YB 4YTEA 1J90A 3DWIA 1IONA 2QPLA 4HDAA 3QFSA 1QOZA 4KQFA 1TYDE 5FWXB 3QXCA 3QIVA 1XXHB 1LDYA 2NZYA 9ICSA 1KGSA 3O8LA 1CZRA 3BEDA 4HUTA 4DWIA 1W5BA 2FR8C 5ALTA 1U1FA 2E3JA 4IRKA 2QVGA 2YY7A 3EXFB 4LHXA 4MINA 1P6UA 3STUA 4TZ6A 1ZK4A 4U9HS 1K9SA 2F1KA 4MYCA 1V8FA 4RLFA 2XKAA 5IBQA 1N2BA 3LC1O 3NBMA 3WV4A 5L3VA 5T7BA 5AKIA 3VO9A 3VPFA 4CF7A 5B66U 1Y1QA 4YJGA 4J9LA 2IXFA 4IJMA 3ZV5A 2G36A 4XRRA 4COOA 4CU2A 4JL5A 2ZVPX 1TL7C 4N6NA 3S5JA 3BREA 4BO8A 1TQ8A 2OZLB 5L1KA 1PL8A 2J6BA 1IXRA 1C9EA 4GBGA 4OI2A 1H8HA 1WWUA 3NS1A 3DE3X 3Q0IA 1LNSA 2FMHA 4UBLA 2VAWA 1W4ZA 2PWYA 5JS2A 4CT5A 4DWOA 1M0EA 1UFOA 4CRXA 2AI1A 1ZD1A 1CP2A 1K1QA 3CLSD 1G7CA 1WCIA 3BMXA 3OTHA 3H13A 5JNLA 1EK2A 1O77A 2OXRA 1G7TA 2HBRA 4FMDB 1UK7A 5IM4A 3MJTA 2CKMA 4U5QA 3QXSA 5J2KA 4J9RA 1PG2A 5TGDA 2HOQA 2N0SA 3NETA 1X1RA 3AZQA 2IV3A 3UATA 1SKRA 1KPHA 5KX5B 2V0GA 4JV0A 2I3AA 3SR4A 2I1QA 2Y77A 1UPAA 1T2VA 3SQOA 1I3MA 1ACJA 3L7LA 4ML3A 1IJBA 1MPTA 1UFQA 2KLBA 2QK4A 5DCYA 1ZAYA 5A3JA 2NV0A 2XMRA 4HZUA 2VJPA 1ZUHA 4RK5A 3DV0A 3E03A 1A0PA 2OHHA 3JQAA 1QHXA 3CNLA 3O4GA 4ECAA 3JQFC 5IJWA 3NASA 4CG1A 3LY9A 4FDUA 5ECDA 1M0TA 4U4AA 1ZIOA 3PC2A 5I4BA 5G1OA 1DX4A 3MBKA 4REQA 3UA3A 1P4HA 1A50B 3ANTA 4C30A 4WESA 3RM3A 3ZOKA 1N2HA 2XX3A 1RHUA 4QM7A 1SUSA 1M1YA 4QPNA 4Z9BA 1WB9A 1ISHA 2NUAA 5IBPA 4PZ9A 5E1DA 3ZW8A 5HF6A 2OCXA 3KXIA 1EK1A 3EIFA 3NJ8A 1F2VA 3DCNA 4V0LA 3TD2A 3A7EA 1FRVA 4FQ8A 5BOVA 4YCXA 1JSCA 2I2BA 3X2EA 5AKKA 3QEMB 2W7PA 3OJ0A 1GDDA 3CSSA 4OJYA 1UDAA 1VL5A 3ZKWB 1C7EA 2WIGA 3AYXB 5GV8A 2ILTA 4P8RA 4WN3A 1YOVB 4R81A 4RVFA 4L8LA 2ZSJA 3PW5A 2V03A 2ROQA 1O9BA 2WAXA 1FP6A 4M4SA 3BBLA 4GKJB 4B74A 1B0ZA 4YRBA 2ZYSA 4PO9A 1JB9A 3HL0A 5AHOA 4DIEA 4TS9A 4ESEA 1PKEA 5JUMA 3IT1A 1GG2A 1K3UB 1MAWA 4BLVA 3ZE2B 4Q03A 2PZEA 2OV1A 4ZOBA 3N7AA 4C0BA 4J16C 3FVTA 1G60A 1U1EA 1W94A 2ZYVX 2YN4A 4K9KA 4EZEA 1QRRA 5KQSA 1CB0A 4QUIA 2FY8A 3THYA 2VHYA 4AX8A 3EH2A 2BGJA 1YBVA 2C9DA 1NA5A 3CIOA 2FW6A 4WA8A 2QZZA 3LX6A 4IUYA 3MN1A 4LWPA 3OTQA 3RSCA 3OE7A 3B6MA 1JEEA 4Q4JA 1PI3A 2Q46A 3AF0A 4NJEB 4IJVA 5L95A 5M7EA 1U2DA 2VYVA 1CUCA 4LVNA 4EG6A 2ZJFA 3DZJA 4FVTA 1HT3A 1WCWA 3DQPA 3TSZA 2BFFB 1D2RA 4RNCA 1SN7A 4D4HA 3LC7O 1ZHFA 2I8LA 2NQ8A 2WDPA 1W8DA 3UPDA 1MR3F 4R8MA 2PXIA 1Z6GA 1Z9BA 3O83A 1Z45A 3EVNA 3W2EA 4DEYA 1QPBA 4LE0A 4X95A 1LUAA 4GLXA 3JD3A 4DSAA 1IVSA 2JLWA 1RKVA 3WDMA 4M46A 3FC4A 3IV9A 4AO8A 4LZAA 1GZDA 1IUKA 3OMXA 3L7KA 5DB9A 3U44B 1D4OA 2ISOA 4F5OA 3JAWB 4YJHA 5BSKA 4Q9AA 5DCLA 2ZIZA 2BGMA 2ID7A 4GOLD 4LE2A 2M9MA 4U6NA 5IZ4A 1M8FA 1OFHA 3K0CA 4P3OA 4BVLA 4C0HA 2ZANA 9ICGA 2QNIA 2OORC 3G9UA 4Q4AA 3BH0A 4ZU6X 5EOVA 1ITZA 4D43A 4KXXA 3OFJA 4BKQA 5B2EA 1I7LA 4UVDA 1QCZA 2R2AA 2ZR9A 4ZYWA 5CLGA 1D8LA 2YL2A 3M3HA 4LZDA 4OJ6A 2VSNA 9ICMA 3PKZA 2IZ7A 3WNZA 4ND7A 1ZD4A 1EGQA 1H6AA 2LVBA 2VPIA 4O1IA 1FUKA 1WBDA 3JQGA 4OMDA 1MCZA 5D87A 2W9MA 5JCOA 3SC3A 2FOLA 4JAVC 2WUGA 3GK3A 2ZTHA 4WI1A 2A4KA 5TS3A 1WUTA 3D5TA 1O8CA 1AQNA 1DX6A 4IQWA 4WOKA 4QDOA 3UENA 3YASA 1SQFA 4CIBA 3BKWA 4RMIA 3BDAA 4KAJA 1K08A 4D2IA 2NSHA 2IDMA 4LXXA 4Q3BA 4R8RA 2ZTSA 2EJWA 1Z2NX 3QGMA 4CTOA 5IJ9A 1M0WA 4O2BF 3VC3A 1QX4A 3MR3A 1P9LA 1UKZA 5FUBA 3VNAA 4WACA 2WYOA 2Q50A 2Z3ZA 1Y4ZA 4I8DA 5IIJA 3E3NA 3MAAC 3TMAA 2AQ8A 2WFLA 5C1PA 1XDBA 2GCNA 3BXHA 4KXUA 4QELA 2HPVA 13PKA 5ER9A 4Z8XA 1QH1A 1KNXA 4ABYA 1B0PA 2R44A 3C8ZA 3TEMA 5L1LA 1P0PA 3IX7A 4MDHA 4ZI7A 2V7PA 2J33A 3GCGA 2RH5A 1KDHA 3GDOA 4UHEA 4ZEXA 2HQRA 2OGWA 3T5MA 1RI3A 3DB1A 3ND7A 1L4KA 1UKVY 4Y2RA 4FE4A 3VR3A 4BMXA 1N48A 5JDIC 1PZNA 3I5XA 3PP8A 4F2GA 4KDCA 4FOLA 1HWYA 1RJGA 2PNJA 1UC4B 3OLQA 5D3ZA 1UBLS 5HA5A 4BO2A 5F9FA 1A2KC 1W85A 3V33A 4EECA 2WIFA 1RPAA 3F71A 4XJTA 1WDMA 4OYLA 1T6BY 4UNPA 3TZQA 5SZKB 3REQA 2JA1A 3INTA 1KI1A 3F5QA 2WJYA 1U9JA 2VVTA 4ZOEA 5E79U 1B6RA 1EFKA 1Z17A 3Q40A 4PYOA 5DMHA 1N6RA 5AM2A 1TKCA 2P9TA 4QXPA 4NY8A 2C1XA 4X1IB 1E2FA 4Z0PA 1FDVA 2XMDA 4Z9XA 4NFHA 2FV8A 3JALA 3OQIA 4F1WA 4PCLA 2VQSA 1Z0KA 2GLTA 4V0KA 3SR0A 5CAEA 2CDBA 4Z5XA 5B3JC 3OGUA 1ORVA 1Z5OA 1M1YE 4LVCA 1REQB 5JSYA 1I94B 5CTJA 4GDFA 2ZBUA 1XMPA 1JX4A 2YV4A 4HYYA 4MJ3A 3SSOA 3UHOA 5BW5A 1ZQXA 2R47A 5BURA 5EUCA 2DE0X 5BN4A 1R8XA 4PTYA 4RIHA 1GILA 1IYZA 3ES9A 4I19A 1CIJA 2LIVA 2HZBA 4EYGA 2FE9A 3BEOA 4BMSA 3F6RA 1XEFA 1NF8A 1U3DA 2HMYB 5IIIA 2IY8A 3ZGYA 3CVJA 3PFWO 1QHEA 3SR6A 2COUA 3L7BA 1YFLA 3IQFA 3KLBA 3ZY3A 3D2NA 1M7GA 3FNHA 3IE1A 4WINA 2FRXA 3WGYA 2VH1A 1CIVA 3R3SA 2QRPA 1K98A 3G5AA 4GPAA 4NBKA 3UV7A 3NAGA 2GJAA 1WW2A 1WXFA 4K40A 1ID8A 4CN9A 1OGYA 2IIBA 2JGDB 1EK0A 3D8SA 2NO0A 1NZFA 1QDUA 1D4ZA 1M6EX 1ODTC 2GAIA 3HC7A 3IXQA 3K0EA 3KEFA 2HF2A 2BEUB 3O82A 4MSUA 3KV3O 3LQKA 1RBZA 3F3KA 3RRFA 2XXAB 1E94E 5G53C 4MARA 3CNBA 4C2AA 5J4YA 3ZYZA 1WHTA 1DGSA 2FSFA 5DM2A 3WADA 2GS9A 1EFPB 1HLGA 3KKQA 1YU6A 1DRKA 1QIHA 2B25A 2I4NA 4L78A 4BGVA 3BGIA 2C83A 2JJ1D 4IQUA 1CUIA 1RYZA 1Z2AA 3F96A 3HB7A 1DQZA 4H4CA 5FXMA 3NX4A 5EQTA 2EZUA 3M1LA 4C7YA 2NO6A 4JU9A 2WABA 1RWMA 1QLHA 1QZTA 4ZEMA 5KNBA 4IO1A 5F3XB 2CV1A 1Y1LA 3BGSA 3HJEA 1ULHA 1REQA 1ONPA 3DVQX 4FZNA 3KS9A 2IOHA 3QOXA 2WK1A 1D4AA 3MLBA 4G0PA 4DSFA 4KIUA 2K8AA 4KK3A 3GMIA 4TYQA 4XQEA 5EFOA 3W04A 2RC5A 1KAQA 3Q4GA 1ZRNA 1QH8A 3EYZA 1TIPA 3WLOA 5BRJA 2PS1A 5KJCA 1K7EB 1JXMA 1KI7A 2AT1A 1DE0A 1N6KA 4JCOA 4S0ZA 4KPEC 3U7FB 3HO6A 2BFMA 2O3SA 3GH1A 3C3AA 4FEEA 2EZZA 2RGBA 4BO9A 4GP7A 4B75A 3ADCA 1V9CA 1X14A 1Z35A 4N3NA 4QQRA 2JIQA 3MTJA 1P0IA 1PSZA 2PCJA 2HM7A 3VCBA 4TURA 1I1QB 3JQFA 2DGDA 2ZBVA 4EY8A 5FJIA 4DM7A 5EN4A 2GK6A 4CKEA 2H2GA 1DJOA 1MVNA 3G85A 4ZWNA 2QN9A 3AKZA 9ICWA 3NWBA 1RNLA 5K0TA 4PZYA 1Y6RA 4LG1A 3T5GA 1YU9A 5KFPA 1NLFA 1OKKA 2D5LA 2FN4A 3LHDA 3B1XA 4KWCA 2FTKE 3IURA 2ZTLA 2NYUA 3HYRA 3LUGA 4M0UA 1AU9A 1X39A 4RD1A 2DULA 4DSLA 3FFBA 4IXTA 5EZYB 4UW9A 3SFTA 4ZHSA 3DNPA 3GRFA 1FJGB 4QZ8A 1CUWA 3MJVA 4IFEA 1W6UA 2RHGB 4ZOHC 1JKIA 2YJTD 5LNK1 2ZJBA 3CE9A 4J91A 2MSLA 1Q77A 1U0EA 1R5BA 1RLOA 3CM0A 3N2NA 4JMUA 1P3Y1 2VLBA 3QIAA 3H2SA 2HQ1A 3LHIA 2AH5A 5AXDA 3KJGA 4E08A 3EDOA 1NZPA 2DQ4A 1R6DA 4LJXA 1QCCA 3EBPA 4FCVA 3EQ6A 4X71A 2FHSA 5IT0A 1IN8A 3FLMA 3SEAA 1GL9B 3G7UA 3ZWBA 1RHQA 2RAUA 1LV7A 4REMA 3UICA 3H0RB 4CEHB 5TMBA 3W5AA 1PFVA 4XWYA 3JAWA 5DKWA 1QB8A 3R5HA 5L6LB 3U81A 2WLTA 5BR4A 3GPIA 1ZM7A 3MTIA 4ED1A 1Z08A 1NJ1A 4UQOA 1AMNA 4KLSA 3UKDA 4NLBA 3TKAA 2B7CA 5BWMA 4FHCA 4PL2A 2GWHA 2X3UA 1NVWQ 1NT2A 2TRSB 4JS0A 1VCMA 4LDNA 4RQAA 4PPQA 5LQSA 3WX0A 2RAPA 4Z7JA 1YMQA 2AC7A 4B3BA 1NF3A 3SCZA 2NX2A 3A4VA 3TYXA 1E1YA 3FAHA 4NK5A 4X6UA 1OBOA 4PFJA 5IU6A 2CJFA 2WSBA 2EP5A 1C8LA 4GNKA 1IDN1 4HH1A 5E7MA 3VSDA 4CKWB 3RAGA 3RI3A 1JIUA 3HE3A 3QKTA 3QPDA 3I9V6 4WNIA 3TSYA 1Y48E 1IM4A 5DLPA 3NVDA 1RLIA 1X66A 5C31A 3FSJX 4WKNA 2KOBA 1THMA 4W5RA 2Y27A 4W5TA 1F12A 2GCGA 3BX1A 3GEHA 1PV1A 3LHKA 4RW0A 2UVQA 3GLTA 3JTMA 1NP7A 2OXEA 4HPJB 4BYGA 2ZCVA 5LMZA 2JLYA 3LUAA 5MDHA 2Z58A 4FBLA 4AZTA 1L9KA 3FCOA 4MIEA 4FS3A 1ZQEA 4IQVA 4FHEA 1DINA 2H57A 3UK7A 4LEIA 4CMEA 5GTDA 3DD5A 2Q9UA 4PV7A 8ICZA 2H2HA 2QQ5A 1EDEA 3TQIA 2XUAA 2VXYA 5IEBA 3FOBA 1JG4A 4IR9A 2VHCA 3AHGA 1W88B 3N8DA 1BGWA 3OPQA 2IHKA 3QENA 4PYKA 4WEQA 4R0MA 1M5UA 4EBDA 1XT6A 3KKOA 5I7UA 4A8EA 3VNSA 5FULA 4HDRA 5TARA 3LKBA 1JHZA 3JYNA 4GT1A 4LCBA 1O0SA 5LMNB 3OICA 3AL0C 4UTRA 1WLYA 3QFCA 4V0ME 1Q95A 1UKYA 1G5IA 1WLSA 2OZLA 4NZPA 5BUZA 1CRPA 1KY4A 2V6IA 5HM6A 3TX6A 2QZJA 4R9VA 5KIAA 3TZEA 1ULTA 3H6KA 1YZKA 1CQXA 5EIFA 2WT9A 1EAMA 5KJ1A 1NUSA 4YDHB 1R66A 2JIPA 4QZ9A 5A7FA 2TECE 4P4UA 2BPCA 3QW4B 4MOWA 1HYBA 4JI0B 5CBPA 1FRFS 2ZUSA 3NYRA 3NFRA 5FUWA 2IHYA 1CY1A 2CNBA 1F5NA 4Q3OA 4ZCRA 1T43A 2C00A 3D5QA 3LVVA 3OOYA 3Q3IA 3C43A 4KREA 3G3EA 5BVHB 3G2IA 5DN6A 3LK6A 2N42A 4A0QA 2DB3A 3HFJA 2EANA 3I8OA 3AEQA 5E2BA 3QRWA 1X0VA 4MWDA 2HJGA 1S8AA 4N6GA 2ZJ1A 3KV1A 3OJXA 1G8FA 5EJ7A 4J2TA 1R74A 1Q2UA 1YONA 1AQIA 5ADWA 1XMXA 5KEIA 5LYYA 4UAJA 3ZJVA 1L5YA 1UZAA 3N2EA 2XMPA 5E4JA 2G63A 4PYIA 5FD8A 3WDSA 2X4GA 4AMVA 2O8FA 3JR7A 3V8PA 4EARA 3HPQA 2X15A 1HSOA 2WB1C 2J9XB 2B4YA 3BXEA 3OEHD 1FPMA 1KBOA 3MQ2A 1OD6A 3FG9A 2DWOA 2H1IA 4IUBS 3WMXA 2VDWA 1EFRA 4N5MA 4WK0B 4UM9D 1EDBA 1Z22A 3ZWAA 3QX8A 2A1AA 1EVZA 1LF5A 4Q7EA 1RI2A 2R25B 2WYWA 1MPXA 2G0NA 1SXJB 4H7IA 4JLNA 2ZB8A 3BSFA 1W36B 1U2TA 3MR6A 3PRKE 4FFDA 5HHTA 5J4KA 2CUKA 3AEZA 2HWUA 3MDCA 4R40A 1JB1A 2IYYA 3M6FA 2R5FA 3MVEA 2BDUA 1S8OA 2HHUA 1TMKA 3NWOA 2HMTA 2D5CA 3OEWA 5HIJA 3EUB2 2AZ4A 3IAS6 2R8GA 4OQEA 4QXQA 5G4KA 4QDZA 5EQJB 3EZ2A 2GN8A 2UU9B 3TQSA 3LYLA 5KJFA 1N2SA 2VYND 3DZKA 4EGJA 5AW9A 1WBJB 2P11A 3VPGA 4MQ6A 5AI5A 2R8IA 3PKIA 5BXQC 2CPRA 5JAIA 2HQBA 4C8MA 5DOZA 5E7JA 4JC0A 1FQJA 3LBIA 1O94C 5J0OA 3EPPA 3RUIA 4MR8B 1VMDA 3DEAA 2BH9A 2YIDA 3S0JA 4QFDA 4M7RA 3SN6A 3FUXA 3GUHA 2WW8A 4H1VA 2E4VA 1I5EA 3QJ5A 2FN9A 3ZBUA 1ZRHA 1MBZA 2HBMA 4KYVA 5F33A 2RLTA 1VCOA 1W87A 5C8ZA 2PLWA 2PGJA 4CEIA 4KQWA 3WGUA 1E7RA 1HUQA 2YJ4A 4IDPA 2A9FA 5I47A 4AXBA 3IDSA 1YACA 3DFZA 1NJXA 3DT8A 4GEKA 1UBSB 4MQ4A 2KVCA 3SC6A 4B46A 1U7PA 1Z0JA 1S2LA 3RSGA 1L8QA 3HN7A 2R6R1 3UG6A 5LD2C 1FEZA 2FPPB 1VPEA 3CEAA 3DPSA 3FSEA 3ORHA 1SD1A 3N75A 1DQPA 4K03A 3ODPA 1N3YA 4KGVA 5DHUA 1JDBB 4KO1S 1MTOA 2P9YA 1BPEA 2OK8A 3I4FA 1S2MA 3UJHA 5HJ7A 4ND6A 1NN5A 1A72A 3FHLA 4IC9A 4PG6A 4XGNA 2QUJA 4JNKA 4K9MA 2BFOA 3QQ5A 2V3CC 2NO1A 3TZBA 4DIFA 5K8TA 1YT5A 5JRTA 2CWDA 1U8UA 3B85A 2ALJA 3RHZA 3HDYA 4OOFA 4QWBA 3LNTA 4OREX 3LHFA 5HUQA 3GRRA 2NPFA 4BQOA 4DLZA 5B5EU 2CNLA 4QRIA 1R6XA 2PUAA 4II2A 1UMCA 5IH7A 4R3WA 3DYIA 1ZQAA 9ICQA 3DMNA 3REOA 2IY7A 4DQXA 1EUYA 3DOEA 3QYPA 1QYDA 1RBQA 2GXUA 1BE8A 1T2FA 1ISRA 2A0FA 2B8NA 3PQFA 4A03A 1QQ7A 3HXKA 4EO7A 4J0CA 3BORA 2CF6A 4C4SA 1L7XA 2QV0A 1NVTA 3HZOA 3LNCA 3O9ZA 4OI1A 2ZRBA 4WESB 4DCGA 2D4HA 1GAJA 2IU0A 3ZXSA 4JKIA 4B7AA 1NLZA 2B98A 1POWA 3LCJA 4KQIA 2M6RA 4XQ0A 3EGDB 3C7TA 1U81A 3EC2A 1OILA 1R8YA 1O4WA 3KLMX 1E89A 4CFYA 3UWDA 1FZTA 4DDWA 2R9VA 4AJ4A 4HF7A 4OSEA 4C0KA 1L7NA 1RXSA 1MU0A 2CDCA 1BXRA 1JWBB 3C3EA 3SDBA 3K9CA 1PK3A 1P72A 4PFQA 5CVEA 4PIPA 3N2KA 2UYCA 4XYEA 3G0GA 5H83A 4Y6RA 4AT1A 3DUFB 1F7VA 3THWA 1EQ2A 4B7UA 4Q45A 1U49A 1IHUA 1LRKA 2EIXA 1X6IA 2DL0A 2HXYA 2QRLA 4K2HA 5EA2A 2PFNA 3U1TA 3LUDA 3IMFA 4D0RA 4LC0A 3WK8A 5KNIA 3CWCA 3IJ5A 2F6RA 2GPJA 1JBEA 3DVAA 1IWPB 4RJKA 2GFHA 3UF0A 1BNPA 3LBYA 3P2EA 4P7FA 4AJJA 2C7VA 4P84A 4RZ3A 3SZ2A 4D9GA 4K28A 4MYRA 4NXZA 3NORA 3WISA 4KYUA 1ZN7A 4JWMA 1WVGA 5BNFA 4JI5B 4IWYA 2WPDA 5CT5A 2GF2A 2GZ1A 2XRZA 3IOCA 3VVLA 1RVV1 3Q7RA 3HDHA 2W6MA 4AY3A 2Z5LA 1P62B 1KFDA 2WTBA 3AG5A 4IIGA 4C89A 2XRYA 4QNRA 1CJKC 1U2EA 1KFSA 4C7XA 4G5FA 5BN3A 2IHZA 4CW7A 1SVLA 1S2GA 1TX4B 3WVNA 3I0ZA 4N48A 3RH6A 2YN0A 3E5MA 1PZEA 5DYTA 2IKQA 4HSEA 3VOBA 3G8BA 2DFPA 1L4EA 1M34A 3EGDA 5DF1A 5CLJA 2PT7A 5CA1F 5B53A 1KMQA 3E9CA 4EG1A 1P8JA 4K46A 1YS1X 5CX1B 4BB5A 3L1VA 5KOYA 2DPLA 3E23A 5F9HA 1Q7TA 3P0JA 1IRXA 3DYVA 4RH1A 2I62A 2BCRA 1Y8AA 5E9WA 1YJ8A 5EIAA 1E8DA 1OGIA 2AG6A 2FWAA 3ZXXA 3SAHA 1O9GA 1F60A 5KVQA 2OGSA 2ZQ5A 3REGA 1TE2A 4I1RA 3R3YA 4QPJC 5DB7A 2LD4A 3PXEA 4TLDA 3ORSA 3U4GA 3ZWYA 2C7OA 2LYHA 3IMGA 3VJKA 5D51S 1YI0A 4JYAB 2NMVA 3PW7A 2FZGA 2RP5A 1UANA 1CRLA 2JFNA 1A27A 4H7DA 4TSFA 3SYRA 5ESDA 2FW0A 4GEGA 2AHOA 2RGDA 4BZQA 2W43A 3F5FA 1S0OA 3RAQA 1AUQA 1BS2A 3JQCA 4WLVA 1MXHA 1NBOA 2HV8A 5G0SA 1ZNYA 5CXXA 1P0MA 3JQ7A 2ESRA 1CWUA 1NWCA 3QXHA 4MW2A 2XHEA 2CUZA 1GCUA 1JDZA 2A1UB 4MKRA 5I4CA 1IIBA 4IGAA 1A7AA 4S3MA 1MG5A 3L8HA 4KMSA 1OXUA 1S9FA 1ANKA 1P73A 1PD1A 1XHLA 3WIVA 1CF4A 1ZZGA 4OK6A 4YDSA 2G06A 5IMBA 3I5UA 1N6LA 5EHGA 4DQDA 2BSQA 1NJ2A 1M74A 4GZ6A 4W9MC 3TUIC 4P4LA 2GRAA 3ZE9A 4O3QA 3WKDA 1C1XA 4I50F 1EP3B 3TR5A 3VTKA 2VNSA 3ZOZA 4E7PA 3Q87B 4I2EA 5JZ9A 1CD5A 5TMPA 2XGOA 4IDQA 4L28A 3G0IA 1NBWB 2JVKA 4JGGA 4QJBA 3HSSA 5H0IA 1ZUD1 2C2EA 3EMBA 3SEFA 3NTOA 3NYQA 2XMCA 4J0IA 4HDCA 3F2IA 4PY2A 1C9MA 1ECBA 5AR1A 3GJTA 5JJ5A 3U4MA 2VIIA 2VDWB 2A0YA 1UH5A 3ROQA 1I1HA 4RWZA 5BR8B 4RTSA 3NATA 4M54A 3C15C 1E5DA 1W35A 5CFMA 1IJEA 3RSFA 4R1UA 1D1SA 4ENQA 3AXTA 3LLUA 2ZB7A 4PGXA 4KNWA 2P9EA 1MW8X 4EP1A 4ZT7A 4Z54A 5KJ6A 1QOQB 4KVZA 4LJ4A 1GRNA 2MSCB 1LNQA 2K7FA 2AOWA 2BCVA 1ZMOA 4R1QA 1JPJA 3IP5A 5EFZA 4IAOA 4ZOLF 3IO3A 4E5KA 1RM6C 2KPOA 2QP9X 1XYYA 2PZ8A 4NIMA 4ZGGA 3D43A 4M1OA 4ND5A 1JDJA 1MZVA 5LLTA 4EABA 2ZRAA 4RKRA 4GBMA 2B7BA 1SB9A 3RFXA 4Z4CA 2PZLA 4FZLA 4L3WA 5DI3A 1UA1A 3CUYA 1MB0A 5L53A 1C50A 5A9SB 2GTIA 1ZK1A 2QD4A 4H7FA 3BXZA 4HR7A 4S0XA 1QO7A 3GNLA 4TTRA 4D9MA 3CX7A 4FCWA 2WNHA 4OQYA 4HVTA 3SHQA 2ZRIA 1DZ3A 1T8SA 3A3NA 2OLKA 2NNLD 4UB6U 1YVPA 1ODKA 3G68A 4CL3A 5I7WA 1ONNA 3DBHB 2PT5A 3BAFA 4TTSA 2P8JA