2NO5A

Crystal structure analysis of a dehalogenase with intermediate complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
225
structure length
224
Chain Sequence
LVDSLRACVFAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords (S)-2-haloacid dehalogenase IVA
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
total genus 88
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no5A01
1S8OA 2FUEA 2WF9A 4I9GA 2OYCA 2I7DA 5AI9A 2G09A 3OCXA 3WKAA 2R8EA 2B30A 2FDRA 5AKYA 2HI0A 5AW7A 1JUDA 3U7EB 2ODAA 4UM7A 3ZWKA 2IOFK 1L8LA 2YMQA 2HF7A 2W43A 2CFTA 3AR2A 4XE5A 2WFAA 4BX2A 3NAMA 4ZEXA 2HHLA 2P69A 3MMZA 3SHQA 1O08A 4OFZA 3U26A 2ZOSA 1RLOA 4Y2PA 2WM8A 4EENA 2I33A 3WGUA 3E81A 1AQ6A 3PCTA 5AK4A 1WVIA 3PGVA 4BNDB 5ALSA 1XPJA 5ALXA 2ZBGA 2C88A 2G08A 3UMGA 2VKQA 4UASA 2HOQA 5A3QA 3KD3A 3QU4A 5AM5A 3WK8A 4Y2VA 4YCNA 3BA6A 3IB6A 4NWIA 5AW4A 3W5AA 4CE6A 3F9RA 3NRJA 3WK7A 3E84A 2R8YA 1TE2A 5ALMA 4Y2JA 4KX5A 3OCZA 1IWOA 2FPSA 3EPRA 3M9LA 3ZW7A 4YGYA 4Y2QA 1TA0A 5JJBA 3WK4A 3I28A 3NIWA 1ZS9A 1YS9A 4Y2YA 5AW1A 4C4RA 4NFLA 3SF0A 3E8MA 2AUTA 3FVVA 3L8EA 1RQNA 4BYGA 4BNDA 3D6JA 5ALJA 4C4SA 1EK2A 2EARA 4DW8A 2QLTA 5AI6A 5AHXA 3ET5A 1RC8A 3UM9A 2ZBEA 2CFRA 4UM5A 4UMFA 1Z4PX 2YMMA 1L7NA 5ALNA 2JGAA 3A1DA 2YFYA 3RFUA 3NALA 4CNQA 4FE3A 3N1UA 2ZBFA 1U2TA 1ZOLA 3B9BA 4UMEA 4DWOA 4JDPA 4HGOA 1QYIA 4KNWA 2YJ3A 2AH5A 3N07A 3L8HA 3U19A 3WK9A 4HGRA 4KNVA 4OHFA 2ZXEA 2B8JA 2Q5EA 3QXGA 2DQSA 1CR6A 3QGMA 1U7PA 4RETA 2YBDA 3PDWA 1EK1A 1NRWA 2BDEA 3ET4A 5AK5A 1L8OA 3ZX5A 4YIHA 5AM2A 1ZD5A 2HO4A 5AIAA 3HYCA 2NO4A 3W5DA 3AR9A 4Y2XA 2C8KA 1ZD2P 1Z4JA 3OCYA 1CQZA 4XOUA 4QJBA 3NASA 4BEVA 4EELA 3SKYA 1K1EA 2WF5A 1SWVA 1Z4NA 5ALEA 4FYPA 3IJ5A 3QU5A 4NAVA 5AKXA 1S2OA 3OCUA 5AVQA 3U7GA 5AKGA 1RMYA 1O03A 4E88A 2OBBA 2C8LA 2RAVA 3R09A 4JB3A 4ZEVA 1J8DA 4GIBA 2QYHA 2R8XA 2P9JA 3ONNA 5AVXA 3OCVA 5AM4A 2CN1A 4HGPA 1N9KA 4H1WA 5ALFA 1RDFA 4DCCA 3L1VA 1MH9A 5AI8A 3L7YA 4HGNA 2NYVA 4FFDA 3J7TA 2RARA 4UW9A 3OPXA 5AESA 3R4CA 3FPBA 4O8CA 2EATA 5AK3A 1Z4QA 2FPXA 2IA5A 5ALIA 4J2TA 4EX7A 3B9RA 3ED5A 1TJ4A 5ALPA 3HLTA 5AVYA 5AK6A 2GHQA 3FM9A 2HX1A 1NF2A 4BEWA 4YCLA 3E58A 1RMTA 4NABA 3ZVMA 4UAVA 1Q91A 1U02A 5AKZA 3P96A 2FUCA 3B8EA 4BKMA 4KYTA 3A1EA 3EF0A 4HGQA 1LTQA 3OTQA 5ALOA 5AVTA 3I6BA 3FZQA 1VJRA 2PKEA 2W4MA 5AKJA 3I1YA 3SD7A 4UU1A 2I54A 5AW6A 3W5BA 3MN1A 4L57A 4J03A 1SU4A 3N28A 1NNLA 3IRUA 1RKQA 3AR3A 1KYTA 1QQ7A 3L8GA 3QLEA 3QU7A 2G1AA 4Y2TA 1XVIA 1L7PA 5IT0A 4EX6A 2Q4TA 4EZEA 5AM0A 1XP5A 3CNHA 5ALGA 4Y2SA 2YY6A 5AVWA 3AR8A 5ALUA 2PQ0A 1U2SA 3ZI4A 1WPGA 2B0CA 2P11A 4GXTA 2D2VA 1ZD4A 1Z5GA 1RQLA 2JARA 4KN8A 3AR6A 3ZUPA 5E0OA 1T9ZA 2MU2A 3DNPA 2RBKA 3NUQA 5ALRA 2FPRA 2GFHA 4ZEWA 3ZWDA 1YMQA 1Y8AA 2IOFA 1J97A 4CF4A 4PNHA 5AVVA 4MUMA 4UU0A 4UMDA 5IT4A 5AW8A 5FP0A 3WKCA 1ZD3A 5AKKA 1N8NA 5A3SA 3QUTA 3TLMA 3QUCA 5ALHA 2B1RA 3FPSA 1ZRNA 1L7MA 1Z4MA 2YN4A 2HF2A 2G06A 2Q4RA 3A1CA 5AIBA 4Y2RA 1F5SA 1Z4IA 1RPZA 4KX3A 3KDPA 3WK5A 2I55A 2I34A 2O9JA 1FEZA 2WF6A 3KZXA 2YJ4A 3I76A 1ZRMA 3N8GA 2G80A 1Z4OA 2R8ZA 3S6JA 2AGVA 2HEGA 4G63A 2AMYA 1YV9A 2G07A 4BX0A 1QQ5A 2B8EA 5A3RA 4L6AA 2BY4A 3W5CA 4Y3UA 3L5KA 5AI4A 3QUBA 3CZ4A 2G0AA 1PW5A 1YDFA 4NV0A 2YJ6A 2I6XA 3ZU6A 3QNMA 2ZBDA 5ALQA 4L6CA 2JAWA 5AVSA 2MSNA 5ALZA 5AI0A 2FI1A 4YH1A 3ZVLA 3SLRA 3SMVA 3ZTWA 5AKHA 3VAYA 2YJ5A 3BWVA 1TJ3A 2YMLA 5AVUA 5ALYA 4BBJA 4BX3A 1Z4LA 3WKDA 1YJ5A 3KOOA 2GMWA 2O2XA 2RB5A 5AW5A 1LVHA 1RKVA 4DFDA 1RLMA 4G9BA 3GYGA 3QU9A 3WKEA 1VFPA 2FPUA 3ZX4A 4YIKA 3MPOA 2B1QA 1Z4KA 3WKBA 3EF1A 5AKEA 3U13A 1RRCA 1RLTA 3NANA 2OM6A 5ALVA 4CF3A 1X42A 4HYTA 2WF8A 2B82A 2BDUA 5IS2A 5ALLA 3DV9A 1YNSA 4Y2UA 3N5KA 1U7OA 3AR5A 4HAIA 5AKIA 3FGOA 4AP9A 1QH9A 3ZVNA 4RESA 3A3YA 2PR7A 4OD0A 1SWWA 4OCZA 3WGVA 2JAOA 5AM3A 3KBBA 1WR8A 5ALWA 5AM1A 2GHTA 1L7OA 3U7HB 3M1YA 3ESRA 2OA0A 2HDOA 5AKLA 5AVRA 2IOHA 3L1UA 2FEAA 3UMBA 4EEKA 4AS2A 2ZG6A 3L0BA 3QUQA 1Z88A 3OCWA 3SKXA 3QU2A 1RMQA 4UMVA 4UATA 2IYEA 2EAUA 2WF7A 1ZJJA 4F72A 2JAUA 3ESQA 4XQ0A 2MU1A 2WHEA 1T5SA 1WZCA 5AVZA 4QQFA 2P27A 5ALKA 4IG4A 1L6RA 2X4DA 4UAUA 4MWOA 3MC1A 4B6JA 4C4TA 1VJ5A 1QQ6A 2W11A 3AR7A 3R9KA 2NO5A 4I9FA 3U7FB 1Z5UA 2HCFA 1T5TA 4XPZA 5AICA 4CF5A 3DAOA 4IFTA 3L0YA 5AW0A 2YMPA 2HSZA 5AI5A 2C9MA 3AR4A 2GO7A 4F71A 3QYPA 3UMCA 2CFSA 4YCMA 2FPWA 3KC2A 5ALDA 3WK6A 4AS3A 3L0CA 5ALTA 2C4NA 5T41A 5AW9A 1Q92A 3ZTYA 3K1ZA 3PGLA 5AW3A 5AW2A 3QX7A 4UARA 1RKUA 3DDHA 3L8FA 3RF6A 3EWIA 1TJ5A
chains in the Genus database with same CATH superfamily
5LWHA 4K86A 4UHHA 3LFTA 4KGVA 1I5RA 4CKBB 2XNDD 5TSDA 1TCBA 4CG3A 3D2LA 3T4UA 5AWFC 2Y67A 4QQ8A 3F8WA 1GTVA 2ZRKA 4N8SA 4YT8A 3LNTA 2AE1A 3OOSA 4IS3A 4BAUA 4YCAA 2QM0A 1UC5B 2RCYA 4G0OA 2WTXA 4IRXA 3KFUF 4DMLA 3PNOA 3PCXA 4FHZA 3OIYA 3FJ1A 5M29A 3ZWCA 4AURA 1ZK4A 2IZ1A 1E1MA 3ME5A 3QHQA 3HSYA 2DLCX 2PGNA 4FYJA 1C2TA 4F3NA 1WWUA 4IKPA 4GPEA 4ENRA 1UEXC 4JYMA 4L5BA 3RHZA 5HFJA 5L3ZA 1GPMA 1HTBA 1CWUA 1HZZA 3BQNB 4GRDA 2BDEA 1G38A 2NU6B 3HJEA 1JQ3A 4DWIA 4V0MA 3JYQA 3MS2A 3GJRA 2GNOA 2GBLA 2VJBA 1Z2OX 2C5BA 3JZAA 1GRCA 3TANA 4XD7A 3VR3D 4IS7A 5KTMA 4BQNA 5FV7A 3LZDA 2YCBA 1PUXA 2H2GA 2WYUA 3H04A 1HYGA 4FXPA 4OFXA 1JT2A 2AMJA 3UWDA 1JDVA 1M2VA 3DE5X 2YFHA 1TEHA 1YIAA 1G3UA 2NAPA 3C3XA 4E3ZA 2K8AA 3CO5A 1E18A 4RXUA 5DW3A 4E2FA 4JLVA 4DM4A 4BP9A 1PFWA 4ECRA 2QYSA 1RYNA 2F9FA 3HVIA 2W8KA 1POWA 2JKVA 1YFJA 4TT3D 4JXZA 3QVWA 4I6GA 3LAWA 1ZGCA 1KL7A 2ASLA 3IERA 3HCFA 3UTCA 3EPIA 2HHTA 1UWVA 4G3IA 4L22A 2AJBA 2ASDA 1WHSA 5HZKA 2PRSA 1UPBA 2ZJ8A 3SIPA 2CSUA 5L40A 1S01A 4HVAA 2PGXA 4D9JA 1L4BA 3GK3A 1EYZA 2JRLA 4C2UA 4ZCLA 1XTZA 3FZYA 2DHEA 3HWTA 1AF7A 1OAAA 5K4LA 1WD7A 3RM3A 2XB9A 1XU7A 2R86A 2Z04A 1T9HA 1MRNA 4YT2A 4HAUA 5FPSA 4B82A 2R60A 2RHLA 3SLGA 2KVSA 3AV0B 3BQ9A 1V45E 4XRHA 3ZUGA 1K3UB 3PHIA 4EB0A 1QIHA 5TMDA 3BZBA 1EDEA 4JKIA 2PKCA 2VA9A 3GROA 2RJOA 3C3CA 2P75A 4UQGA 1C0LA 3RAXA 1J1UA 2XCIA 1L5UA 1FYEA 1YFZA 4NF2A 2YDXA 3LIIA 7ICQA 3DV0A 4KTTE 4U7PB 3LFHA 2GN4A 4BMOB 3CEMA 3RYIB 4JBHA 5EIXA 3TW4A 2IKSA 3G7UA 1UQTA 4P7KA 4DIFA 3URMA 1S9FA 2G04A 1QAOA 2NV2B 3C7AA 4QW9A 5GIPE 2AIRA 1USKA 5AOVA 4S24A 4F9TA 4RT2A 3SE0A 4RZIA 5CLHA 2IYLD 1NF9A 3SQXA 1LA2A 3RQIA 4FS1A 4KN9S 3BK1A 4QZHA 2V0NA 3K05A 1ZL2A 3N2EA 3U6BA 5A2GA 2P6UA 4XIFA 2G4LA 5ARBA 1RMQA 1MX3A 3PSPA 2RJNA 5J5CA 2A57A 2C9BA 1PVVA 3OM1A 1X1RA 1F1BA 5FR2A 2ZTEA 2BGLA 2GD1O 1N1EA 2OFFA 4ZGWA 5D00A 1CQPA 4F71A 4MINA 2OXIA 1Z8FA 3USES 5C1PA 3NDIA 2G8NA 4MPDA 4B3MB 2R48A 5ALTA 4I55F 4FSHA 1MV8A 2Q41A 2P9TA 4YAIA 1LNSA 1K4MA 5FTKA 4DWJA 1O97C 3IOEA 4ED1A 3GPBA 1BIFA 3JU3A 1P2GA 3OTIA 2QZ4A 2FN4A 5AOAA 5A9TA 4MB0A 4NCAA 2CCGA 5DZSA 2ADOA 1B8PA 1DKLA 2ZM6B 2IYRA 3L3BA 3OPYA 2OSBA 1QZ3A 1NG9A 5J58A 3NIWA 4MKZA 1YI8A 5KKCA 3IHLA 1LJ8A 2IV2X 1C4WA 5C9ZA 4I5GA 4XD7D 4M8IA 2OYRA 4C4SA 2OHHA 4H7PA 1OW3B 4I4IA 3TLBA 4BFXA 5LMZA 4NBTA 1K7CA 2BHRA 2KZMA 5JBNA 3LKDA 5JPCA 5IASA 5H3CA 3JPQA 3WLTA 1CVLA 1NSYA 1R8QA 1JDNA 3IG8A 2AN9A 2FPGB 1ZI6A 2BT4A 2HSEA 1R9JA 5KZMB 2DYKA 1US8B 4O3RA 3NYRA 3O92A 5CG1A 5DBOA 2VL7A 2Q3HA 4KN6A 3ZOZA 3PFIA 4HAWA 3FE2A 2SNIE 1T43A 1RRFA 1BRTA 4ED7A 2HV9A 5I4KA 1VYVA 4PL2A 5JNLA 1S0MA 5C2JB 3ZNPA 1U2DA 2P9ZA 3RUEA 1BCSB 3UXEA 3MF4A 3KOWA 3K2IA 5DGDA 3VHQA 1EFUA 4TZKA 1NRXA 3ROEA 1XAHA 4KFUA 2FZWA 4KV7A 1N2SA 3HU5A 2BBWA 3NC4A 2IW1A 4TQGA 4CYMA 4ZMSA 3HKBB 2OZEA 3PGMA 4C5BA 3AILA 2VQFB 1K7FB 2ZATA 3ES9A 3DAHA 1YAHA 4H16A 2ZREA 2W4MA 2Z2ZA 3T1HB 2YNMC 5GY7A 3E9NA 4JOSA 4GMGA 1A9XA 2REBA 4HPXB 2YWGA 3CR7A 1TNDA 2QGFA 3VVCA 2QEQA 1SXEA 3ZIDA 3KAQA 3O73A 3GVIA 5LMCA 5BR7A 5CR0A 5EA2A 2XAAA 4ALNA 2JLWA 1HKHA 3HP1A 1T1IA 2QD2A 3WRWA 5KYNA 3H9BA 4EHFA 4B3FX 1W0JA 2Q5IA 2DBQA 1BEUB 1S0UA 3DW3X 5B3AA 2QAGB 4QIWC 4LYJA 4ZT5A 1H0HA 3BWEA 4FGSA 2H18A 4KMOA 1GL9B 3MB5A 4QTXA 3ILHA 4ZCQA 3AJEA 4GP9A 2QRUA 4I08A 3BF7A 1P7PA 4EA6A 3RIXA 2RHCA 5EIOA 5H3HA 4M9HA 2RGRA 4M4SA 2PXHA 4JXJA 5ICEA 3PXUA 1S0VA 2G71A 2CL0X 5ALQA 4YP5A 3X1JA 3DD5A 5ALZA 1GGFA 1H0SA 3LUCA 2QVCA 1J2UA 5ECGC 3SX0A 3WJAA 1UAGA 1KTVA 3I4LA 1OFUA 4MUXA 1D0VA 3GYGA 1FTGA 1VFPA 1QP4A 4K9RA 4F5PA 3L40A 3AF0A 3NR2A 2I2CA 4M21A 5DOVA 4AM8A 4MW4A 1PGJA 5DM1A 1P6XA 3JVIA 2J3DA 2W00A 2OWEA 3RIGA 3PA8A 2IA6A 2CLHB 2GCIA 2ROQA 3BG5A 3GELA 5A4FS 1DBQA 2I3AA 5LBTA 5JFOA 3EZYA 4F72A 1P5JA 4R2JA 1LTKA 1BE0A 1OCEA 2Q1SA 1YL7A 1RQPA 4RF4A 1I6WA 4ILKA 4BDTA 4F2DA 1Q19A 3KZIU 4ZVNA 2Q6OA 1ZP6A 3R76A 1E7WA 5HX7A 1IZ8A 4ZO9A 3BZWA 1KQ3A 2P1ZA 1UF9A 4A0FA 2I71A 4RZSA 3WHLA 1O9GA 3FUTA 1PVRA 4NESA 3PR2B 1DPGA 4NVRA 3CWZA 5BSTA 4IUDS 3NT5A 1T2CA 2VQEB 2A78A 4XUCA 3EWIA 5ULLA 2HWKA 2IYFA 2BTOA 1KJYA 1YZNA 3T9DA 1WEHA 2ZTSA 1MX1A 1N2BA 5FWYB 1GSAA 3EEBA 1MO4A 2CXHA 1QYDA 3FFBA 5KDOA 1SOMA 3WYNA 3CPEA 1MRSA 3BWBA 3VR6H 4MP6A 1TKCA 3FMGA 3G2JA 2J7KA 1W52X 2BFFA 1O2DA 2WK1A 3AN1A 4YJHA 5EJMA 4G9EA 4CFSA 4RVOA 1FPMA 1YDMA 1PL0A 5ALMA 1EFCA 3RASA 5DO9A 1DEOA 1Q95A 3V97A 4JDUA 5KL8B 3I5XA 2WJYA 1EA7A 5BY2A 2J6HA 4MUGA 1N60A 1U5BA 2BMJA 4DVGA 4GP7A 1M2NA 3UQZA 1ZIYA 4EABA 4NK4A 2X7JA 1S97A 1I2AA 2UVPA 3L7JA 1VHDA 4ANFA 3OLZA 2FG7C 2L2QA 3QE2A 1FW6A 1FL9A 4OIMA 4MS1A 2XOKD 2X8JA 4TLBA 4LF9B 3RAEC 2BZ0A 3MCUA 2LW7A 4R98A 2PSHA 2PGOA 5JADA 3SM9A 1LEHA 4JVSB 4TMKA 4FQ8A 4HQ0A 2GA9A 4P4OA 3I8OA 4BMZA 3LY8A 3FOCA 2NRXA 3SOPA 4RPCA 4G5GA 4IQ0A 3B1YA 2Z6UA 4UM9B 1A4XA 3FWZA 3A0UA 3SAFA 3ETLA 3DVQX 4RXTA 1GN9A 3QBJA 1DFHA 3EGXB 4X00A 1T8RA 1GL7A 1TV9A 5G5HA 4DCCA 5AI8A 2B21A 3UATA 4MRPA 2PPLA 1P3JA 3FRIA 1O94C 4FZMA 3ZBUA 5B36A 1M0WA 2XDQB 3K9NA 4RUAA 1GTL1 2Z58A 3Q72A 5FUQA 4KE8A 3HUFA 2HMXA 3AU2A 4EG8A 4EMTA 3P96A 2NQ8A 4CMBA 2XKKA 3EF0A 3PWSA 5LR6A 3CWQA 2Y76A 4ARIA 4UD6A 3UK6A 1ZETA 3W78A 3W34A 4Z7QB 5BQPA 1P2SA 5LIRA 4QBFA 5COAA 2VP4A 4N3NA 1AMNA 4DSIA 2H5XA 3WYEA 3ZKWB 3U44B 4BO2A 1IVYA 2XRMA 3A6HA 4G0VA 1XWLA 4QLBA 2F1RA 4G5FA 1GRVA 2IUYA 3FRJA 5FNVB 3DNFA 4M2YA 3GP8A 4KO3S 2R47A 2VNIA 1RQ2A 5B55A 2OG2A 3L8CA 1M5TA 3SIXA 4BWMA 4RW0A 1ESCA 4OB8A 3A1CA 2JASA 4EECA 2Z56A 1WM1A 3G1WA 4QTZA 3B5EA 1LKYA 3DXZA 1CUIA 4C0KA 3WA6A 1E3QA 2I4RA 3BJMA 4Y6PA 4G8BA 2RQ5A 3RSOA 2PN1A 1KYZA 1L5WA 2GOYA 5JHHB 5F9HA 1S2LA 4U7DA 4RQ4A 5EZQA 2KYRA 3RTBA 3JSAA 1NATA 4YCCA 3PJFA 1ABFA 2BFCA 4NCIA 5KFAA 2HA4A 2YWJA 1B6RA 3VKUA 3D1LA 2OLKA 2GM5A 2ERYA 2PWBA 3UG6A 5D4BA 2E49A 2AFHB 3C5EA 5B12A 3FTFA 4W8OA 4D8VA 5F1OA 4B6RA 4I29A 4KIWA 2QX4A 2E18A 4QDKA 3UFXA 3ED1A 4PXAA 4H77A 2JFZA 1TAUA 1MZVA 1G7TA 2CB9A 5F2NA 5LQRA 4LHZA 4QUBA 4EYEA 4O4IB 6REQB 1GSHA 4C3VA 4RFSA 3SXUB 4JR2A 3ZLBA 3C29A 1EZ1A 2UYYA 3VYWA 3KWJA 4R1SA 2Q3CA 5KI6A 3Q3GE 2YHIA 2Q4OA 2ZYIA 2EF1A 2FEMA 1QUFA 1Y8QA 1UMBB 3L02A 3NETA 3QA9A 4WZAA 4NYMQ 3QP9A 1JIJA 3VV2A 4XYLA 3PICA 2ONYA 3GLGB 3RF6A 4E51A 2F48A 4MYTA 2RAUA 2C2KA 5KB3A 1DNPA 5A9SB 2IHVA 3DZDA 3JR3A 2J3QA 2KFZA 1OV6A 4LBWA 4KR3A 1HDGO 3E61A 2KSOB 3PCTA 4H7EA 1XPJA 1TPZA 1YBMA 3LW7A 2BCGY 3C5FA 2A5GA 1KQQA 3NPMA 3AOEA 1RWMA 3TXXA 1TD1A 3IB3A 3QPBA 2H2DA 1PK7A 2PH3A 2Q5LA 3G0HA 1COWA 2AXQA 3WNQA 5K03A 3CG0A 4EPTA 3ND7A 1CJSA 4CMAA 1Q2UA 3FX2A 2Y6VA 1GGJA 1VKOA 2OWOA 3BRCA 5INTA 1I2DA 1QIDA 3M6XA 4M0PA 4NBLA 1TTQB 2Q5EA 4QICA 2DQSA 1BHSA 2AXTU 2EDUA 3DOFA 1F8XA 1YHZA 1E4VA 2Q9CA 4J9QA 2G8LA 3L7AA 4M0CA 3HEBA 4XVUA 3E2MA 5B7NA 2RJ3A 1S8FA 3L6EA 4B3SB 5FD8A 2C9YA 3HP4A 2ZJ7A 3BE8A 4OK6A 3I83A 4KO4S 1OB5A 2Q2WA 5KYTA 2A0UA 4DXAA 1LI5A 1NMSA 2IDKA 4ZP1A 1I01A 2MYTA 4EJSA 3FOFC 1N5IA 3DA8A 5CEHA 4K9SA 1RDFA 4KPUB 2BBOA 4KWCA 4QXQA 3DEYX 3BXXA 3C87A 2EQBA 1FTWA 3ZWNA 3VH1A 3KT3A 1QHEA 3KUXA 4XTCS 1SGWA 1YUMA 4QO7A 5DYNA 4GRIA 3EZ2A 4YRSA 1G19A 4BO6A 3ZNOA 4FYYA 5ALOA 1G20B 5DNDA 2J0UA 2MT9A 5L7WA 3EXIA 5AR1A 1YI0A 3JARB 3T9FA 1U0GA 1JTFA 5LU8A 4LXXA 3HJTA 1QM5A 2GLXA 3RRJA 1U1GA 4HQOA 2GPSA 1PRYA 2V03A 5E0OA 1G8GA 4HFMA 2AZ4A 3OM0A 3NHBA 3IFSA 4WZBB 4BRSA 1T6XA 1Z45A 2I4IA 1ZQLA 2WSMA 4B9SA 2D8CA 2YR0A 3EIFA 1JNXX 2E5WA 3U3ZA 1EFVA 1CQIB 4AY2A 3L1JA 1PS8A 2A1IA 3DDCA 1RYRA 4FGWA 4XARA 2WJHA 5I3CA 5K3FA 2GQ0A 2FOXA 2UDPA 1U0NA 2B4YA 5KG4A 1K5OA 2ZBDA 4X7MA 3ASVA 1ZVJA 4YPVA 1A50B 2OBFA 2VRWA 4P4PA 5JD4A 1FQKA 4D97A 5H80A 3I2YX 3LD9A 4HLDA 1NY6A 3E4CA 4MVJP 2FU5C 3PL5A 2IPOA 3EVTA 4QTUB 1PVOA 4YASA 4LY0A 3E0XA 7AT1A 4JJZA 5M5BA 3D1VA 2UVWA 1QP7A 1K5GA 1W88A 5EXPA 2Q5OA 4AI6A 5CIWA 2R11A 5TXGA 4NOJA 3F46A 4DR7B 2GN9A 4RK1A 1KIMA 2JJ1A 3PRHA 4H35A 3GJSA 3MS7A 2IV7A 4PWYA 3VPSA 2QXYA 3LECA 1OTXA 2LV8A 2IYYA 4CQLB 3AVXA 1TQHA 4WUTA 2X6RA 2XWJI 1NLUA 4JJ4A 4E2ZA 4RD2A 4XFJA 5GZ3A 3CCFA 1JEAA 3TNJA 4ZREA 4B4KA 1PUJA 3ZYZA 1COWD 2JGEA 1T6ZA 4H15A 5EWJA 2O05A 4B7XA 3RB3A 1TM3E 2F76X 3FPEA 4Q12A 3IG5A 1V9LA 4FD2A 2GCGA 1YAJA 1ZQQA 4DZTA 3FR8A 5FUWA 2ZIUB 4GI1A 2O4UX 2VLIA 5B4TA 1IXYA 1TTTA 3NRJA 4H6WA 4M53A 1SFRA 3ABOB 1Y48E 1I8TA 2CXQA 1J2JA 3ROPA 1FFXB 1NUAA 2GBFA 2RDMA 5IKXA 3WWDA 2PXXA 2ENUA 1TGYA 5C1IA 1S1CA 1CR4A 4LJ9A 7ICRA 1J1IA 3KQUA 4B3RB 2RIRA 3SP1A 3X1WA 4MYSA 3EZ7A 5B2FA 3VHLB 4F4DA 4EB8A 3ZQ6A 1RI5A 1S9DA 1SIWA 2PKWA 1HURA 3PJDA 4U00A 3VPBA 3D2BA 3ZU2A 2OY0A 1PX2A 1XZDA 2I3GA 4US2R 4XWGA 5HR5A 5DJ5A 4OJYA 2ORIA 4X95A 4MCAA 2AD1A 3BHJA 3ICOA 4L3VA 3W5DA 1ZM4A 4EKIA 1N6RA 3BSFA 3K4QA 4OBEA 4RK0A 4JUDX 2QAIA 4DHEA 3SYTA 5IP5A 3ZGNA 4PSVA 1JAXA 5TQ0B 3EGEA 3QX3A 4QTYA 1G5HA 4TUPA 5IJAA 2NUTA 1JDBC 8OHMA 1SKBA 2CSXA 2MSKA 2D2XA 3GLHA 3AXTA 2WHRA 4B6QA 1QQAA 4G67A 2GN8A 3PRKE 2QOEA 2CMDA 3TFSA 4M9QA 4IJWA 5IM4A 1BX3A 2X9VA 5F98A 4KXQA 3RLIA 4DFKA 1UC9A 4J0QA 2QMOA 3DVLA 1K6EA 5K0FA 3JV7A 1Z83A 4WCFA 3VV3A 1QIIA 5AUQA 5IF3A 4A0HA 2ET6A 1GADO 5AJVB 2C00A 4RV4A 3HGQA 3KWLA 2GZRA 2VFAA 3BMNA 1EA5A 2PE5A 3U9LA 3X3HA 3MA0A 1WB5A 1LTHR 3HZHA 1KQNA 3H1PA 1DLJA 4R05A 5EXDA 1EJ2A 4JU8A 4MQBA 2VA8A 1YE5A 4EOGA 5CLLA 2J0SA 4HDOB 4XSGA 4RWEA 5A3SA 4CM8B 2YQ5A 1YU9A 2J9FA 1N6NA 4ZDWA 4EVSA 1W36B 3AF1A 1U1EA 3TTUA 1ZYQA 2AKAB 5AIBA 4FI3F 3NBKA 1RC0A 1PVPA 1IU9A 3DOJA 2VDNB 2O9JA 2YJ4A 3LYHA 2RONA 1FMTA 2FSUA 4DDKA 2CNWD 1E60A 3LBAA 2ORVA 3TIFA 3HJAA 1OLXA 2GT1A 4KDRA 1ATZA 4MUKA 1KI1A 4FFSA 3GDHA 5BWCA 1PR6A 5F3XB 4TTJA 3FNFA 3L84A 3PV8A 2CLSA 2JJ1D 4JI5B 2CF6A 3BXGA 3ZX4A 2WIJA 4HB3A 4V2UA 2QRVB 5DN9A 4BUZA 4OY3A 4EFDA 3G1UA 4C22A 3ETHA 4MAAA 1VP3A 1ZC3A 2OLEA 4WXMA 3SK0A 2ZIXB 1P1IA 3NVWA 3WX0A 1SD5A 3WZ2A 3RU3A 1UBRS 4AG3A 4HTFB 1V5FA 2ZYAA 3EWNA 2PUFA 1T8TA 2OBXA 1YZ7A 4NQZA 4HEJA 2IY9A 2NU8B 2ZXIA 3MVEA 4DMRA 5C8VA 5FRDA 4BV9A 3I53A 4IG4A 4IRMA 1OGIA 7YASA 4I2NA 4ZAWA 2AQHA 3B3AA 5EZSA 2RDIA 3GUUA 3IBGA 1C50A 4D45A 1P8AA 1A2BA 1NSFA 4LOAA 3DUFB 1J5PA 4LY9A 3WMFA 5BR1A 4BU0A 4MI9A 5IIIA 3RG8A 2DY1A 1ZQRA 3G2NA 3SZMA 4ZZIA 2AC4A 4EFLA 3WDKA 1LLUA 1HK7A 4JD5A 2HHJA 4K1LA 3ZCRA 1EG2A 4N7JA 4HAOA 4Z6KA 3QFSA 1T8PA 4JLOA 5LQDA 2C2YA 2I4OA 5IX8A 3K9QO 2WPNA 1A77A 1F14A 1TA9A 5MHTA 4C21A 3W3ZB 2ACWA 3AFHA 3V1YA 1B0XA 2BVNA 5J2AA 3WMXA 3UNXA 2C28A 1JG1A 4L9RA 3QEMB 4CEJA 4AG5A 4MVWA 1IDOA 4BVHA 2AR9A 4BNHA 1R74A 5BN4A 4ZYZA 3M4ZA 4CM6A 2VJ5A 3DT9A 1SIJA 1B73A 4UM5A 4K5QA 1CEQA 1V2HE 4NU5A 4XX0A 2C2OA 4M36A 2ZR7A 3UVEA 2FPIB 1L3SA 2BKAA 1UH5A 1E8DA 3MGVA 4K8OA 4EPRA 1KZHA 1L5RA 1U7UA 2QM8A 1H38A 4FE4A 4DLLA 3NWOA 3SMQA 5KCZA 3IKJA 2P1RA 1JU9A 4R68A 1GZUA 4PGXA 5LLSA 1GUAA 2RCNA 1JX4A 4NJEB 1C80A 1DG9A 1MB9A 3AVPA 1TK9A 4P7BA 1HE5A 5IFLA 1UFRA 1YI1A 3TF5A 4FUTA 3PMLA 1G5FA 4DEXA 4IQFA 3OQNA 2R8XA 1R4AA 5GWXA 2J5RA 3HZOA 2C4TA 4HBZA 4ZHQB 2WOOA 4CQNA 1RCFA 4DAOA 5KYUB 3PX4A 3OWXA 3GDGA 4L16A 3AUTA 4BFUA 3QMWA 5B3JC 1QJCA 3AETB 3PLAE 1WXGA 2EYUA 1U94A 2YW9A 3MGAA 4DLXA 4H7KA 3MCZA 4YCLA 3ML1A 4AMUA 5BUZA 4LRTB 3HA2A 1ZUD1 5F9MA 4MUHA 1XLTA 2I3DA 5AHKA 3LP8A 2NNLD 2AJ8A 4LECA 2I6UA 5DYGA 2PV0A 4OM7A 4F60A 3QU7A 4UB8U 1TTHA 2ZTHA 2CWDA 2BCVA 4GZ6A 1VLQA 1K5PA 4Y30A 5JV5A 5G4KA 3DMNA 2KJ5A 4M99A 3OZBA 1USVA 4XB6B 1Z2DA 4O2BF 4PU0A 4PYRA 2YXNA 4G1VA 2HL6A 1GSIA 4G4SO 3Q7SA 3ZWDA 3ZJ4A 4HLUA 3WBKA 4B09A 4TQ9A 3WLQA 3HKEA 5DM0A 1Z5WA 3MMPA 4UMDA 4NI5A 2ZAIA 4DYHA 4O02B 1Y5NA 1HDXA 2QMYA 2IXFA 5L1KA 2J0QA 2WTMA 2QLNA 2UZ3A 3SFTA 3TQIA 2BLNA 2GSDA 1G16A 1Y1SA 2H08A 3AEYA 1T9CA 1WMFA 2PWZA 4X0EA 4RKEA 2HJHA 1S2NA 3E3AA 1RP1A 4ZT6A 3PLNA 5K8IA 4O5OA 5G3ZA 2NNWB 3SJAA 2FFBA 5KMGB 2CXXA 1CIPA 4CMCA 4OAOA 2H5EA 5JU5A 1T2EA 3C6KA 4YRKA 4U7JA 2D00A 5KFGA 3UGJA 4P31A 3EMDA 3JPWA 3OQJA 4RVNA 4EFNA 1XFAA 4BO9A 4RESA 2PR7A 2JAOA 4QWWA 2O1SA 2XY4A 3U7HB 1G3MA 4YV7A 4EL0A 2IU6A 4AAYA 3EVBA 2Q7OE 1PV2A 2AUMA 2JFGA 2ZZNA 3HPRA 4AJEA 4XJVA 5L9AA 2W8ZA 1PNQA 3H3FA 4QULA 1CP2A 1TU0A 4K26A 4YT4A 4W1PA 2WJ6A 1LZLA 5CAEA 2W11A 1IN5A 1DSSG 5B5EU 2A3RA 2YBEA 1U7XA 3W5IA 3ZK7A 4BCCA 4R40A 1U3WA 3MTAA 1QP8A 2ILVA 1T36B 4W8HA 3H5AA 4GX2A 1DIBA 3GNQA 3W9UA 3RAFC 4GGMX 4LYDA 4LBZA 1XD9A 3E3NA 1JUDA 4WY8A 3VNQA 4AP5A 4XWKA 2C3UA 5EGSA 2A9OA 3R7WB 4L27A 1SKSA 4AZ3B 3D64A 2CYCA 1ZGHA 1VL8A 4PHDA 1HDOA 1KY5A 5IULC 4E4RA 2C2BA 3R0XA 2BR5A 3OZRA 2YWDA 3G9ZA 1ZOSA 4M7WA 2DUUA 2ONKA 2H1OA 1ZQFA 3F5MA 4YA6A 4A10A 8ATCA 4C01A 2AJDA 2XBUA 1Z62A 4WLVA 5C7YA 2BELA 1G17A 4RENA 1PR1A 4OGLA 4DUZB 1TVMA 1W44A 5BRNA 3CR3C 3B48A 1FFCA 4KH1A 1XTKA 1XCJA 1I3NA 4USAA 3M5CA 1YQEA 2ZXEA 1IN6A 3IQGX 4I27A 1E98A 1ZIOA 2V0CA 4MWDA 4TLDA 4WXHA 3CZCA 1CUDA 3G17A 1E6CA 5FFMA 1T4CA 3TIGA 1XZGA 4BLOA 3GZNA 2PFPA 2G82A 4W7IA 3AHEA 5DLDA 1N7HA 1NW6A 5KSWB 3KU1A 3TZQA 1H4TA 2P3SA 3KJQA 3ZNQA 5CITA 2P91A 4WZ6A 5EJ8A 5K05A 5FOTA 4YJ3F 4FGUA 3SZRA 1YHNA 3L49A 3LUDA 3WYCA 1U31A 5K0ZA 4YJ2F 2JFVA 1SIUA 1GCIA 2VQ6A 4UUMA 4BNMA 1SHJA 4FFDA 5TVGA 2QL7A 1WXHA 3FPBA 2B5VA 5ED4A 1IC6A 3QBVA 4KSBA 3H5IA 1ZUIA 4J1TC 3VKGA 1N0VC 3KHHA 3RRXA 3HBLA 5FO1A 5H1YA 3GNSA 3D43A 2VKTA 2QARA 4ND6A 3O4VA 2CXRA 3TVDA 4LDQA 3O95A 2Q28A 5F3RA 2WJWA 2ZBVA 3O75A 1W8IA 1S7GA 2XR1A 3ADPA 4C20A 3V00A 4X24A 5I4CA 4UBNA 3TW6A 4WDRA 1NDHA 2IY7A 3VAZA 1EIWA 2CRXA 1UOOA 1JIKA 1R9MA 1OIXA 1Z6ZA 2QPAA 4LXTA 4FWBA 2VXYA 4QFCA 4Y6GB 1BWPA 3WOHA 3PUHA 1R0CA 1GDTA 4GMKA 4AL4A 4MDYA 5DT9A 4HWSA 3UT6A 1MA0A 3EHDA 1UBHS 4O3PA 4OB6A 1GTJ1 4NBSA 1ISFA 1KAEA 2KSQA 1Q0UA 5BSRA 3FNQA 2G1UA 4H6PA 4P7JA 5HTOA 2NUPB 5BRJA 4I1YA 4A36A 2G07A 3TLZA 1RAIA 1RLIA 1RTTA 1WIWA 1W94A 3IAM1 1QJ4A 4KPEC 4JCCA 4BGUA 1RAAA 3ITEA 1TKAA 3B2NA 6LDHA 1JYSA 2GTHA 4FW9A 3F3SA 4ER6A 1RTKA 2IXTA 3DTVB 1XI2A 3RI3A 3QVTA 2YMLA 3D0QA 2GCNA 2HJGA 4AKHA 4ED6A 1FJXA 2M6RA 4X3PA 5HQ3A 5DTEA 3N5KA 4C03A 5C4GB 2ZI5A 2DFKB 1PT6A 2HU5A 3M1YA 3P4YA 3MWLA 5E4FA 2BJHA 5TJHA 3EHEA 1A8UA 1RU3A 5DH9A 2KE7A 3CONA 5SZHB 4XGNA 3FSRA 2OLJA 4YAFA 1HYEA 1FDVA 3VMMA 2KWIA 2H5LA 2PGJA 4MI6A 4FFNA 2ACEA 3Q3EA 1BXRA 3O83A 1TZKA 5I7SA 1L4EA 3PFNA 2BI7A 1QH0A 1USUA 3GNTA 1YDGA 2VCHA 3LSTA 1Y98A 2YN0A 4D8YA 3P2KA 1VJGA 1MH1A 4HAXA 2G83A 4Q3NA 3IIJA 3VKWA 1RI3A 1CPYA 2QP3A 4BO8A 4K87A 3KETA 2B8NA 2AYXA 2OYCA 1BCRB 3OCXA 1LSUA 1Y1RA 3UJ3X 1SGGA 3QKWA 4FJ2A 2GLUA 4ZZ1A 2V6MA 1GQRA 1MV5A 1W47A 5J2GA 2FR8C 2N0SA 1E9SA 1A1SA 4P4SA 2Z1DA 1BPDA 2VKQA 2O1EA 4GNRA 4YCNA 3FYDA 3IP3A 2ASVA 5JSQA 1G64A 3C16C 1WW3A 1A96A 4K03A 2EBWA 3CH4B 5HKOA 9ICIA 2W0SA 1Z6QA 3UJ9A 2JLQA 4DHWA 4GM0A 2PMKA 4QG3A 3M5WA 4GKAA 3BILA 2P6PA 5JXIA 4OI1A 4YG2A 2FYTA 4LHSA 1KSPA 2JD1A 2M32A 2W9AA 3OUZA 3TZEA 4BO4A 1ZK1A 4BFVA 4ABYA 1SEVA 3TKAA 1AUOA 4TZ0A 5C0OE 4CT5A 2C54A 3TQQA 4J75A 1P4HA 1U0TA 1LDEA 4DWVA 1JHAA 4CTNA 2HQBA 4U2KA 5AM2A 4XVRA 1HY3A 2FQ1A 4CR8A 1DAPA 3D5QA 1QGAA 3JQBC 3R7BA 2REXB 4LRWA 3DZ8A 1N5DA 3VRHA 5JU6A 2QSZA 3JQCA 1CUCA 1Z07A 3PKZA 1MO2A 2RAVA 1E2EA 4M1TA 3RNLA 1VHJA 5KYVA 1VBNA 5SICE 3GLIB 1WB4A 3OPXA 2O2IA 1IK6A 1WOYA 3LZCA 4LNUB 3BF8A 2I67A 1B23P 1NAIA 2WMOB 1O5TA 3EOBI 2QZ9A 4TTIA 5F4BA 3PNCA 2HX1A 2QN6A 3NRBA 4H2DA 3V8NA 3ZEIA 5DB8A 2DH6A 1EE9A 1TC2A 1Y9JA 1P19A 4MWTA 4OI0A 3MBKA 4Q7LA 3UICA 1JW9B 3GRKA 3KLNA 4F84A 4ZICA 4D74A 3UMJA 2BEVB 4J9VA 5HJ2A 3I3SR 2C5SA 3GLKA 3ZCQA 2V7TA 4DLGA 3LQRA 4H7HA 2P11A 2EFEB 4W5WA 2WWRA 1YOVA 4N49A 2JIRA 5IAKA 3EXHB 3DPSA 4RF2A 1EQ2A 1YBFA 3VO1A 4NE2A 3R75A 2C29D 1EGVB 2GUWA 4AW9A 1R10A 1Q7RA 2VNSA 1XRSB 7ICNA 4YYEA 2HF2A 3TSWA 3RV4A 5A7GA 4S1NA 1TLFA 4P0QA 2O06A 5TIIA 2OUIA 1KR2A 3QOXA 1YV9A 3TD9A 4MKXA 4EY5A 1F8YA 3DAGA 2HREA 3CH5A 4XLTA 5C5DA 1K3TA 3K2BA 3VSAA 1HM5A 1ACMA 4KLMA 4RY9A 1JLSA 4CDRA 4BUCA 3VO2A 3QXHA 5BYJA 2AXPA 4EYHB 1XZ8A 2EJUA 2ZT5A 4BNVA 1ZR4A 1UFOA 3Q40A 5I7UA 4JV0A 5CNKA 2GXQA 4NM2A 1QSLA 1H94A 3HP7A 4R1PA 2PXIA 3ZNNA 2JPDA 1P60A 1YBAA 2Z4TA 3IQXA 3C39A 2ZRMA 4DMCA 4TN5A 4QPPA 4LF8B 2AQ4A 4HG2A 3C2MA 4B8YA 4FNMA 1G5IA 4Q37A 2Q0ZX 1CNEA 1RWKA 1T26A 4M83A 1W0KA 2COKA 4ZQFA 3O4JA 2QN9A 4J94A 4KACA 2VJMA 1T9DA 2IHZA 1EP9A 3ZDFA 1VQ1A 1K9SA 5IIMA 1VG1A 4HNVA 2VZ8A 4OI4A 4TKUB 1PFVA 5BP7A 3KZKA 3V7UA 1N2HA 4NEQA 5JAOA 4BEJA 4ZCPA 3B85A 1OXMA 1QVWA 1CRQA 1NR5A 1LPNA 3ORFA 5D5QA 3NVDA 1C3OB 4YMSA 2W7PA 1V43A 5CYPA 2Y1EA 2B98A 1S2IA 2RSLA 3QSGA 3UV6A 1YZYA 5FHQA 4LUCA 2WFLA 4MQ4A 5CBPB 3A25A 2ZSIA 5U4QA 3A1UA 3WB1A 2QVLA 3J81k 1JG2A 4O33A 4F92B 5BPCA 1U8AA 3MMZA 1YS2X 3CXRA 1LGYA 3GU3A 3NBZC 3LVWA 2H0AA 1ONNA 4XPIB 2CVZA 4YRNA 3B53X 3VI3B 1YDEA 2ODGA 1PJZA 4YB8A 5M34A 1NBIA 3E1SA 3OCZA 3DLPX 3C48A 3WRXC 4PPNA 1HFEL 2AZMA 1A7UA 1FSSA 1RAHA 2VH5R 5H16A 4XGIA 4EGAA 1Z7YA 5JASA 2QLBA 5J2IA 2RH8A 2X58A 3BRWA 4QM6A 1F44A 1PSZA 3EYZA 2O2EA 2D54A 3O4HA 3KSZO 2VSNA 2VP9A 3ZXUB 3Q7IA 4RCZA 1MQ9A 5KSZA 1D5WA 4DQVA 1PWHA 4UMEA 3N3AC 1AXEA 3W79A 3UT5B 1D04A 1BA3A 7MDHA 2NVBA 3AESA 4C8KA 1F0NA 3O0DA 1J09A 5CNIA 3WLLA 4CEIB 3ZWAA 2ZWMA 1NRWA 5K7SA 2OV2A 4GRAA 4N1AA 2ES6A 2WABA 1AKUA 1WW8A 2PUTA 3DL4A 5FPTA 3OZSA 2GK7A 4ARCA 4PG6A 4ZQEA 3OEEA 4UPVA 3LGXA 2E8OA 2I76A 4ARZB 2G1JA 1RYYA 1D4AA 1XZPA 3EUB2 3D2CA 2AN3A 4LJ4A 2H63A 2QUHA 2C4UA 3FPJA 1SVIA 3D8BA 4OUDA 1JECA 2Y9TA 4R0NA 2HBMA 1SVOA 3EXEB 3KYCB 5CVCA 4FZ5A 1ZQJA 2D1QA 3PDJA 4QYWA 3GMDA 1SCBA 1MFPA 4K9MA 1B8OA 4RZ2A 3NCTA 1U8CB 2MMGA 1UBGA 1POXA 4V03A 1A7AA 3NTRA 2HRRA 2NO6A 5KFXA 1W4RA 1F20A 4MV7A 1OYVA 5TX7A 1ISIA 3EEFA 2DERA 4UJ5A 1APBA 1FNCA 4CUZA 4M98A 4W4TA 4C7XA 1ZFNA 3Q85A 1QIJA 3N2LA 4B1FA 2HOFA 1O96B 2CFIA 1AKNA 1UAYA 1M34B 3OBIA 1RT9A 4YJKA 4EB6B 1UCFA 4RH0A 1PG2A 2HHWA 2C8VA 1YVUA 4I3GA 2XCUA 5DFAA 2HGZA 1U6IA 3UB2A 4RLQA 5A5GA 4OQ4A 1IVNA 1KSJA 4U0KA 4AF8A 4FMCF 2XRYA 1JB1A 2H3QA 4KQ1A 4OK5A 2Q4RA 6CHYA 1E9EA 3NCHA 2AZDA 1KFSA 1WCYA 2DUNA 2GA8A 4HWGA 4TMZA 3A14A 1REQA 4PJ0U 2HK6A 4BX0A 4L6AA 1G8YA 1WLYA 4B0PA 1NXTA 4H7IA 2GZDA 3EVNA 1W0KD 4A5OA 2JHCA 4J91A 3T4PA 2JFQA 1QHHB 2YXBA 3BMXA 2B5OA 4X5OA 4BX3A 2HFJA 4ZU1X 2R1TB 2BUAA 3H99A 3LHIA 4IWXA 5BMVA 4JY7A 3SZ3A 2WI8A 1FFVA 3NANA 2H8KA 5C0YA 1LBTA 3MQ2A 2WF8A 3NU1A 3EXAA 1JQAA 1QHNA 5JBIA 3I12A 3WADA 1ZQYA 1ZIDA 2OEPA 2WIBA 3ZWVA 3N8DA 3HDVA 4E2XA 1KI9A 3OOYA 1BZYA 3S8EA 3I8SA 8ICIA 2JH3A 4FCVA 1JXAA 1PEDA 5I7HA 4D82A 3W4JA 1MQ2A 4C76A 2WJ3A 5DLQC 3PFKA 3MHPA 3KHTA 4I1PA 1SCNE 4ECWA 4YAGA 4RQMA 1VI5A 4Y8VA 3V7FA 3I0ZA 4DQQA 5HPYB 1IZ7A 3CVYA 1D8AA 4E7OA 1NN3A 2YN2A 4F5NA 4IDEA 3L8MA 2IF0A 2B30A 3D2AA 1EUDA 5B30A 3BRWD 1JT9A 1XV5A 1T3QA 4LEIA 5EUCA 5LNK6 2X8BA 3U4AA 4DN6A 3HG7A 1UXOA 1KOLA 3N39C 3PGVA 3GFQA 3U80A 1ZVMA 4QIHA 2YWCA 5BSWA 3WK8A 3V1TC 3K0EA 1W0JD 3LCRA 5DX0A 4NYJR 4AROA 3L06A 1RVV1 4MYHA 1X77A 5H82A 1N9GB 1IN1A 3RREA 4UUBA 3LP6A 4RD0A 4G5XA 4JI0B 1G5RA 1SC3A 4DCVA 5AVJA 2AX3A 1ZJNA 1VHWA 1V11A 3OEED 2WAMA 1BMDA 5AI6A 2I6FA 1OH7A 2ADMA 1Z29A 2Y1WA 4O63O 2DFVA 1K7EB 3NT4A 5KX5F 4G07A 2PFGA 4FKBA 4YAWA 3N07A 1Y9EA 3TGPA 2I1LA 3RSFA 3VTZA 3MCTA 1Y3BE 2AB0A 4NE7A 3IM1A 2Z5VA 2VTVA 1HEUA 2RC6A 1ZD2P 3JALB 5DK6A 3T7EA 5BQ5A 4NJ8A 1IM5A 5LWQA 4P0PA 721PA 2DQYA 4LFCB 4NZPA 2YHSA 1QS0A 1JH8A 1MHTA 2MYNA 4EBCA 3LJKA 5DX8A 3OETA 5DIFA 2W2LA 3UB3A 2R6ZA 3MRTA 4BZPA 2EATA 2SICE 3C4QA 1L4GA 1UOQA 4LMBA 5HCIA 4ED9A 1FU7A 5TV2A 1E0AA 1BGVA 3W1VA 1CUGA 1NBMA 1G42A 2E8NA 3VDMA 3ZE1B 1Q3HA 2R6R1 3GRCA 8ICWA 3HPOA 4N6NA 2VBIA 3WWCA 1YRAA 3DE3X 2OH2A 4Y1RB 3WAJA 5KX5A 4UU1A 4HSGA 1AT1A 3IJEB 2GM4A 4RVSA 3M0EA 1XQ6A 5JEEA 3M49A 3ISDA 1M75A 4GC7A 3S2YA 3LRTA 1C8BA 4RHYA 1RYSA 4XAQA 4BJ5A 2QLLA 1XMIA 2MOKA 1GA4A 4MPPA 2O7VA 1Q1ZA 3NP9A 3K8YA 4ER3A 1EFKA 4G4SP 4TS3A 3PZBA 1VMDA 4YR2A 3ABRB 4L3OA 3ZBPA 4UNQA 2C82A 4IIYA 1V3TA 3X1KA 2I2XB 4JEHA 1FVOA 1Y3FE 4JX9A 1AX9A 4ER7A 2QKQA 4P36A 1MABB 2B8TA 2J3EA 2WWHA 2ZCVA 4XUGB 2UVRA 3IMKA 5BW5A 1B43A 3AB3A 4DOCA 3GXBA 4F93B 3OESA 4MIOA 1PYGA 4BP1A 3D6VA 2B36A 1B76A 5FA6A 2Q5FA 2IJGX 3COWA 1GPDG 3KSAC 3ZTWA 1JXOA 3S5UA 3MIIA 5E1DA 3OLQA 4WIAA 4IJUA 2CHVA 3GARA 3PC8C 1I9CA 1EUZA 3UT0A 1RLMA 3GJ4A 1X7XB 4HUQB 2QUIA 3T6KA 1PZNA 3PNKA 3NEPX 4H3HB 3WNBA 3GFPA 1LC0A 3PXXA 2KZ3A 2DQ4A 4MHOA 4D9BA 4E0DA 1M0SA 3EPJA 1QH1B 1J2YA 3C5HA 1NYQA 3M9OB 1TYEB 2Z3ZA 4LWQA 3KKKA 1Y80A 3QJYA 1QBKC 2N1BA 2IELA 2BEJA 4HWOA 4WE3A 1UT6A 3HUDA 1ISPA 2EEZA 4UB2A 4RDXA 4NMXB 4JR0A 1G2PA 3I39X 5GZ1A 1SPBS 5A0LA 2WG2A 1RWXA 4LC0A 4CUKA 2NO5A 2VDUE 3KKNA 2P2GA 4C07A 1J0XO 4IFTA 3MT7A 3N0WA 2P40A 3B78A 3TLGA 2NSJA 4L15A 2CFSA 4PQRA 4F11A 3KZNA 2IPAB 2ECKA 2ZT7A 2QD5A 3O8DA 3HB1A 5J4YA 5GQSA 4L7QA 3L8FA 3F6SA 2W4QA 4YRGA 2HA6A 2PT7A 3B1VA 3UJ8A 1GZDA 3RHTA 5CT6A 5DGCA 1VB5A 1N2IA 3QF4B 1D2HA 3NTVA 2RKOA 4KQJA 3DO8A 2I33A 2VF8A 1PF7E 5KOJA 4Z6EA 3PGA1 1N9ZA 1VYUA 3JQ7B 3JQAA 3N2ZB 3I72A 3E84A 3S2SA 1I1HA 1JE1A 4MVJM 1JPVA 2A1UA 4JJ6A 1RM6C 2ZVJA 4RKFA 1S4QA 3MWKA 5J5VA 3STYA 3QIVA 3IUYA 3WLSA 4B2IA 3DAYA 4LVCA 3PFHA 1UR5A 2CL7X 2O57A 4F1WA 1SG9A 3VU8A 3LQYA 5JZBA 2W2PA 2RGNC 3G9XA 2VYCA 4WEQA 3RH0A 2EKPA 3GOQA 3WGOA 3JWPA 3WGGA 2WWGA 1T6BY 3VO9A 2ZRPA 4XQGA 4RETA 1FRQA 4KQXA 4DLKA 3UK2A 2HSWA 3IV9A 5JUMA 1FUUA 1NBMD 1A9ZA 4KI0A 3V8MA 1LXCA 4TVKA 1JJAA 3VOBA 1GP2A 3GIIA 1NM5A 4TTAA 4O4HA 5CMLA 1FU4A 5ENVA 2ZT6A 3KB2A 4QSHA 2H2AA 4IMIB 1P9NA 1AVTA 1U5CA 3VZSA 1SBQA 2DWPA 5CCDA 2AI1A 3H4VA 1YZ6A 2AHRA 2R4TA 4NCKA 3IP9A 5L1JA 1NKBA 4PYMA 1P2BA 1HQKA 3WY9A 4MUAA 1JZQA 4ZCMA 5DT2A 1JFTA 1XXHE 2WC1A 4MS3A 1H2HA 5CPFA 1ILEA 4MP3A 4GICA 4NOLA 5KG7A 2XTZA 1GL3A 2QTNA 4A23A 4MV5A 4D5EA 1DEXA 4IIGA 4OH1A 2F8SA 2FUCA 1Q1QA 4E1AA 2IKQA 4LVOA 1EVJA 3M83A 3GY0A 3KTDA 5E0KB 1N3IA 4LYFA 5DNYB 4QHSA 2XUGA 1U8YA 3AEZA 1NTRA 1Q0SA 1S96A 3RYHB 2CXTA 5U4XA 2Q6VA 4UZFA 4Y2SA 1E2FA 1JLMA 3OCJA 1L4NA 2CJWB 2B0CA 4JI2B 1ED1A 1U6KA 3IELA 1JEEA 3W2HA 4X91A 2O7QA 2V58A 1GCGA 3N2IA 4GQBA 4KLEA 1V4NA 4FEAA 3JASB 4OLJA 2BFOA 3VM6A 5HQTA 1F5SA 1MFZA 2XCLA 1R88A 5IBQA 1ODJA 4C3OB 5IBPA 3IBCA 4C14A 5DXFA 2VZ0A 4AUNA 3W5CA 2WEKA 5ESDA 4YO8A 4YQFA 3OTWA 4LN1A 4I3FA 5IDXA 3CRZA 1JQEA 3K70D 1YVPA 1KGDA 4HNGA 2OQ2A 3FGNA 1LDBA 1XRNA 1EXVA 9ICFA 3H8VA 1JR2A 4MRSA 2WUGA 1EAYA 4EI9A 3T1YB 1OWMA 4I2VA 2J08A 4CXMA 3DZHA 4MPRA 3PYLA 2XUJA 2IHYA 2CZCA 3ECCA 3VPHA 1DJLA 4MCJA 1XTJA 3M3DA 4Y9RA 3QMVA 2J46A 3Q2OA 1B74A 4LNHA 4UNRA 3RRMA 3AU6A 1VYHA 1R0YA 4JEIA 5IM4F 1WMAA 1BVUA 1JNYA 3VOTA 2GVZC 5F76A 3RKUA 5DLEA 2RKBA 2BIFA 2VJYA 3NVYA 4U9IS 1T13A 1TCVA 3N0VA 2JLVA 3Q5DA 4BB9A 4C7OB 1RZ3A 4AQ7A 1T1GA 3W8RA 1DV2A 1SHKA 3A1FA 4DF8A 8ICFA 3JQAD 3M6ZA 4NFSA 1WUHS 1RW4A 1NE2A 4C5AA 4B76A 2MUTB 2RGEA 2W90A 1F8GA 3PGLA 4ELUA 2BD0A 2HDNB 2NT4A 3KSUA 1SCKA 1FP1D 5KTNA 2VZLA 1C1DB 5K0EA 4O4JB 2E4ZA 4RKYA 4UXJA 2FQWA 4PGQA 1CLUA 4MQUA 1P0QA 1ZGJA 3KHUA 4OFZA 2Q0HA 1U9IC 1VA5A 2H2WA 1R64A 4IEEA 4RM2A 4AUKA 2FVXA 4XYEA 3F5DA 2X0RA 3LF2A 1D7AA 1JEQB 3QKSB 2VHQA 1QR6A 1GZ7A 1PQWA 4Q00A 1E5DA 1P4JA 10MHA 3N87A 4RV9A 1Q6ZA 3MMSA 2PSEA 1ORRA 5JJBA 4YRMA 5CJJA 2NLOA 4TL6A 1Y4AE 3R44A 2MSLA 4N7RA 2W2KA 2UZ0A 4AO6A 4HFRA 1RC8A 3GFOA 2BGUA 3UCFA 4M1EA 1EINA 1BOOA 2YFYA 1ZDMA 4PRZA 3SHVA 2L17A 3RFCA 5J4HA 4DWOA 3G85A 3I0MA 2BDPA 3LWDA 2BEWB 1R0ZA 1BS1A 3EA0A 1H5NA 4D4KA 2PKXA 1CUWA 2BFAA 3GOHA 3NKLA 4W6QA 5H59A 2V59A 3WHPA 5EJIA 3AEUA 1ZD5A 1B42A 1RWWA 5GOZA 3ADOA 4YWHA 4ZU6X 1I5OA 2G0TA 3V6KA 1L1QA 3DFIA 1NZBA 3Q7PA 3LC7O 4IDGA 1J8VA 5FL7A 2Z6VA 2C8LA 4PLWA 1E2IA 4BNGA 1PR0A 1VI2A 2I1WA 4HNUA 1O4WA 3H2SA 4MVYA 4FZ3A 2XWPA 3QELB 4XGRA 5DK4A 3AYXB 3A6ZA 1BKYA 3GUYA 1EAMA 3IUEA 1CC1S 2UZAA 3ACBA 5IXYA 5DRTA 2Z2XA 4NJOA 3KXKA 3OC6A 1P5ZB 5M3BA 3JR7A 4DCPA 1RABA 4NU6A 5HJ5A 4MR7A 5DQIA 3SVLA 5KFKA 3HLYA 1GG9A 3Q9SA 1OI3A 1AO3A 3FN4A 4C87A 4FFRA 4RJJA 1X7GA 4DLVA 5I6DA 1QE0A 5EWLA 5FWDA 3T9CA 1CIJA 3QEBZ 4FFBB 3MJ4A 1IOZA 1FX0B 2PSDA 3UHPA 1D1SA 5I5GA 3CSSA 1B16A 1XTPA 3O8OB 5FP0A 3LT1A 3ABQB 2ETXA 3M4XA 1P72A 4BFWA 4IPTA 1GQOA 3LQ4A 3HCCA 1V3QE 4DNQA 3L6BA 3OPYI 2F1JA 2ONZA 3C24A 2FFJA 2CNBA 1N2EA 1JAYA 3ZTTA 1CY4A 1I24A 5IJ0A 5CA0F 2Q2VA 1N4DA 4GEKA 3BEOA 5JC8A 2SHKA 4GT1A 2Q2QA 5IZCC 3K0CA 2H57A 1MXFA 2B4KA 3U40A 1DQPA 4JI4B 2G9NA 5DBHX 2YHBA 2H59A 2Y9MB 4MAFA 3EOAI 1DWOA 4ZKEA 4G9BA 3GLTA 4U2BA 4TROA 1QHGA 2XYVA 3MJVA 3G23A 1I7PA 2X2EA 2B1GA 2OXTA 3F90A 4B74A 3AR5A 2XZOA 1SOVA 4QDXA 3L4EA 4KODA 4MKRA 2DECA 1NOKA 2D5IA 3PEEA 3DKPA 4J9NA 2J85A 5CVTA 2HHXA 1IBSA 1Z88A 2AA3A 4UMVA 4NX2A 1RXEA 4KDFA 4ND8B 1UBFA 4CKCB 3UXMA 3FUWA 3QM1A 3OF2A 4OMCA 3I62A 1GR0A 2WIGA 3INGA 4F7WA 4XPZA 2EIXA 3IQFA 1YQTA 1V25A 1SXJB 4YFYA 1NW7A 4MVXA 5IH7A 2PJRA 1J49A 4Y9DA 4ESEA 1IVSA 3LYLA 5CA0A 2QX7A 1U3UA 4INZA 1P17A 4OP1A 2HUNA 5IIJA 5CGZA 2KHQA 1CEZA 4M9GA 4LX8A 2F9MA 1EWYA 5IKEA 1YL5A 4DANA 3G79A 3Q0IA 3ONWA 3FMPB 1GRNA 4R81A 1MJGA 3R0ZA 1URPA 4GMFA 3K35A 5T57A 4Q24A 1SA0A 1XR3A 2OUKA 3SC3A 4DLRA 3VX4A 4EH1A 2WV9A 4X1KA 1GNPA 1FYWA 3HB7A 1GAXA 1T1RA 4M9LA 1T5DX 4G8DA 7ICHA 1X6JA 1DLIA 1AC5A 4G4GA 1IWOA 5KG6A 1WCIB 2V6FA 5CXSA 3T7CA 4GR9A 5B66U 3KSBC 4R9RA 3WDSA 4PZNA 1X7WA 5GINE 5AT1A 1ZMXA 3B1FA 3O4GA 5A5FA 3MM4A 3LY5A 5A9RA 2G5HB 5FL7D 2WNSA 1RAFA 3RTEA 3LW8A 4GL4A 3OURA 1BN6A 4HLQB 4DR4B 2VHTA 2HU7A 1WX1A 1UIMA 1GUYA 3QV2A 3UF0A 4IRCA 2EKBA 1NOMA 3BGSA 1AHHA 1L8OA 2VAXA 4MFFA 5JJKA 2XZDA 1UOPA 4D57A 5L7TA 2FZKA 4MV8A 2IH4A 4Z3OA 1YR7A 5KFMA 4QRHA 3BRQA 4QQRA 3V9PA 1JMVA 4K6OA 5I9NA 1M6VA 1GG2A 3E82A 3NFYA 3DZGA 2A9VA 3A58B 2C0CA 2HGSA 1J0EA 3JQ9A 2PX0A 2PKQO 4FQ7A 5HKKA 2ATCA 3F53A 4MV3A 5EIEA 1QO9A 1YJQA 4NY8A 2JHGA 1J9ZA 3T8YA 4TZ6A 3SQLA 2I65A 4L2IB 4DQDA 2XCSB 4JI1B 4B3BA 5C8XA 3B8EA 1O1YA 3R5FA 2X8AA 3G5LA 2ZYDA 2W4IA 3RDPA 2ZI4A 3SYRA 3UW3A 3FF1A 4Z49A 2PR2A 1ELOA 3C3EA 1NK0A 1M1UA 3UH0A 2PI4A 1XSLA 5AJYA 5K0JA 4Z3DA 4S1WA 4HX5A 3KRTA 4NNOA 2EFCB 3ELWA 1I36A 1NP6A 1NF3A 1NP7A 4JC4A 3KYJB 1W76A 3V4PB 1JQLB 4ZCIA 3CNEA 2YFKA 3K4GA 2Q4EA 1MQ3A 3NDPA 3P9YA 4WKGA 1AY0A 2DPLA 1QZTA 2WNHA 1BVYF 3ZWWA 4QPZA 3KZXA 2O8BB 1YJAA 3HKCB 1CZOA 4Y7CA 3GRVA 2WIAA 3RUHA 4OB7A 3TQSA 2ZVDA 4L4SA 4A15A 4I8IA 1EK6A 2IZZA 4FFWA 2BKLA 5TMEA 1A27A 2FHPA 5EY5B 4JOCA 2OZLA 5AI0A 2GZ2A 4W6ZA 3I23A 5H0IA 3LY7A 2X7HA 2FMTA 1MJHA 1MC1A 4ZRMA 3AUUA 4QASA 1E1LA 1RRGA 4HYTA 3EW9A 3D0OA 4BOYA 1EBUA 4XZ3A 3E7PA 4AP9A 3VYSB 4KDCA 3VYVA 3RODA 4G0NA 3V80A 3LDFA 1KVSA 2C84A 5J0YA 3K0FA 4ZTBA 3PNLA 3NHSA 2CDNA 5D6OA 2NZ8A 2XTMA 1NUSA 4NYIR 821PA 2IE0A 2AJTA 2JI6A 3IESA 3CBGA 1Y4ZA 1DOQA 4KHPB 1K7YA 2ZB3A 1QTNA 3FOEC 4FKZA 3O21A 4ITRC 2V3VA 4G89A 3SR6A 1AGRA 1HMYA 4I66A 2OXRA 4AS3A 1V5IA 3LUPA 4V24A 3MJRA 1E58A 1MVLA 2C03A 1GPLA 4KQ2A 1AGPA 3IPLA 1G5TA 1OTHA 3B3GA 4F2PA 5EQJB 4W82A 1BVHA 4TTPA 4S04A 1FLAA 3MYYA 3QBDA 2Q5CA 3N2NA 5H2FU 3D5EA 3RUFA 5DNVA 2COEA 3G2PA 4EVQA 4EENA 4CG2A 4A8JA 5F21A 3ANSA 5BUCA 4Z6CA 1B8UA 5E6UB 4IFEA 1EP3B 4NBVA 2WZBA 4D56A 3BTSA 1SK8A 5DE3A 1JA0A 2F9LA 5LQSA 1JDSA 1OFIA 4L5AA 4QJ3A 5HFNA 2O19A 2VHVA 4DLZA 1E79A 3UKOA 1YOBA 4OQLA 3OOWA 2JAPA 3L4PA 3Q8RB 3B0YA 5I3ZA 5B3LA 1XL0A 1NQUA 3ZWXA 3ZHBA 4WNAB 1P7DA 1XTUA 4V1CA 3EZ9A 3FPLA 3GJ3A 5HKKD 3IIMA 4LZPA 1ZH6A 4AECA 5CLJA 2XYPA 2LI6A 4V2IA 2NO4A 4JVOA 2QXUA 1BPYA 3R8CA 1DZ3A 2R1UA 2Y05A 4KGZA 4IIHA 1KH2A 4NZMA 3H5VA 4L95C 4FFMA 5EERA 3EISA 1XQ1A 4KZPA 2AK3A 1MAVA 2QG4A 2VHYA 4OYHA 4UOZA 1T9GR 4Y7DA 4M1YA 3GJQA 3U4MA 1PTJC 4F4XA 4F4WA 5JXHA 3CMCO 3G0GA 1IN4A 1N9KA 1U8TA 1LLDA 4IUYA 3L6CA 1P2UA 2NYVA 2BFMA 4TS1A 4A16A 1HL7A 4B4WA 2KJQA 3CJTA 4L78A 3K73O 1ZLYA 2HWUA 4MXDA 5F7OA 3U3RA 3ZHVA 3G5UA 3FCOA 4R69A 3NMUF 3DZKA 1Q0TA 1A5BB 4YAKA 1Q91A 4DJFC 2G25A 4WKBA 2GZ3A 1SM4A 1KK0A 1U90A 2VK8A 4FC7A 5KYWA 3GGOA 1CRLA 1TYCA 4DUPA 4CV2A 1CVIA 1E32A 3MHTA 1SXHA 3Q5EA 2I7VA 1Q3VA 5DKWA 5I7RA 2EX1A 4DM3A 9ICWA 3Q4GA 2CZGA 4RHTA 4ZQBA 3HEMA 3BN3A 4PEVA 4UQOA 5DXJA 4IRKA 4JV5B 3QVGA 4A1OA 2VVTA 4TURA 1KRPA 4E1BA 4UHFA 5HOQA 3D8RA 2HCJB 1LI7A 3HL4A 3OJWA 3IMEA 4IMPA 4KXLA 3HKZC 2ENWA 4EYOA 1ZCFA 4Z7NB 1XAJA 4Y2RA 4S2EA 4POAA 1HE2A 1BDJA 1L3IA 3KDPA 4O9MA 3LL4A 3MT8A 4B84A 2AGVA 1W29A 2DBYA 1E5LA 4BVAA 1ZQSA 3D2SA 2X8LA 4G5RA 1Z34A 2QQEA 5KT7A 3QXSA 1E1DA 3ZDBA 4WERA 1TZBA 4F6RB 3HN2A 5IANA 3OQPA 4BMCA 1GPNA 2RGDA 4WLEA 5JSZA 3H7AA 5LXTF 1BHO1 1QRTA 2QI9C 3BWVA 1R9NA 4JYAB 2BI4A 1BS2A 7GPBA 4DQPA 2QMQA 1AS3A 3BOSA 1X92A 2KICA 3HWRA 2H2IA 1SVMA 3T38A 2X9QA 3C3BA 4IGAA 1Q7TA 4GBGA 3HBNA 3OJ0A 4ZYLA 5AKIA 4ZMBA 2P1DA 2JLCA 3QWIA 1SUWA 1JS1X 3C15C 1WEKA 2RHGB 2XVZA 4OK3A 1T5HX 2WYVA 1DWPA 2QNRA 1PZXA 2QJOA 4GGPA 1YCFA 4XIIA 4C4TA 4BLRA 3T3OA 1OWOA 3NAGA 3K8OE 3MWFA 1ZGZA 3SPXA 3DFUA 8AT1A 2OT3B 3CRVA 3SX4A 3LKZA 1RHQA 2EWMA 2W98A 5L7YA 2AHOB 5IUKC 5LXTA 5HIMA 1JDJA 3OIWA 2I91A 1EE1A 1V35A 3HGMA 5KJ6A 1E79D 3VO8A 2PH7A 1O6ZA 4EF6A 1T0JB 1M6EX 5LSAA 1MX5A 2WQ7A 4MA4A 3E9CA 1AJEA 4KAFA 1Q50A 2AOXA 3OJOA 4PZAA 4NWIA 1G3RA 2WAOA 3H87A 2VQ3A 4Q1DA 4QDUA 3WL3A 3D0RA 4RABA 3BTVA 4X63A 4GE3A 2JMGA 2Q7DA 4MR8B 2M0NA 1VXOA 2HADA 2ZTMA 3N8KA 4E5VA 2P4HX 3NP7A 1A4UA 3I1IA 3NTLA 3NW9A 3QRWA 1RI2A 5E9JA 1R27A 1N0UA 3CEJA 2PQMA 4F5OA 5J8YC 2VQSA 5K0SA 3TEMA 2XT9A 1ORDA 2NP7A 4EI2A 1DJPA 1V7PC 4V0SA 1D6JA 3ZU5A 8ICKA 2O23A 2WTNA 1GPKA 4IQWA 2VYQA 1P7ZA 3DXXA 5C8YB 3OC0A 5AIAA 4ESVA 3Q8PB 3V4ZA 4W5RA 1TDJA 3OCYA 5SYNA 4CR7A 4LAFA 1SQSA 4L5JA 4IG9A 4ZZ0A 4KLSA 2QB0A 3PSIA 2XQKA 3QU5A 1U0EA 3PR4A 2NN3C 1EKXA 3U62A 5AVKA 1MVNA 2EBFX 2LPEA 3C74A 4P92A 3TDNA 3FDSA 5JFTA 3L1VA 4R8UB 3AUXA 4NV1A 3LXRA 1I0LA 1K98A 4AJHA 1O0CA 3OQ6A 5DIZA 4D4IA 3P71T 3B9RA 2B7BA 3HZRA 2FEOA 5IINA 2DCUA 4WN3A 4AMVA 2YV2A 4KXMA 1MAWA 4L4UA 1IRIA 2XT6A 2JI7A 3IT0A 4Z8YA 3D7RA 5FO0A 4IQUA 3FOWA 2GZAA 4Y9UA 2V98A 3MGBA 1Q1AA 1O5IA 5EJ4A 4LOKA 1I1OA 1BXKA 3BB4A 3L92A 5JIBA 1EPUA 4CKEA 3CVVA 4G0YA 3MGIA 2A59A 2FN8A 2NGRA 1HDEA 4Q4JB 4BQPA 5KCMA 1F8FA 5F12A 1E1CB 1NUTA 5T4FA 3SQWA 3CVUA 3PCRB 3IOYA 3RYCB 3LVQE 1M8JA 1II8B 3V2IA 1F0YA 4B3GA 1PNRA 2EGGA 3Q1KA 5CHEA 4KLOA 1ZZEA 4AQYB 4DLNA 2GPTA 3A70A 5JAMA 4BNJA 1AHNA 4NAUA 4K88A 3D3NA 3PQ4A 3WGJA 2AGOA 3VR1A 5HA5A 2A1JA 1ZQHA 4P4UA 1NULA 121PA 4E09A 3HYSA 5KNCA 3RUPA 2YIJA 1NKVA 5KTTA 3YASA 1YQUA 4HMQA 2Z8ZA 1P74A 1SL2A 2UVDA 3QNMA 4CQJA 3IH5A 4HEA1 5CYOA 1SCAA 1W5TA 1Z00B 2P3QA 1X66A 4U6NA 2DPMA 4LZAA 1X9MA 5LB2A 5AVUA 4QZBA 1KFCB 2CUZA 4FDMA 1FTQA 3W9YA 1ZM9A 1ZN8A 1NBAA 2ZUCA 1DGQA 1UFVA 2J6CA 2AWOA 5IMSA 2JBAB 3F6CA 1UXHA 1A98A 4O25A 3THWA 1FW8A 3I0NA 1GA1A 4DR1B 1GAJA 1MB0A 3U7QB 1U65A 1VE5A 4XCVA 1OVMA 4WUVA 2CHEA 4OQQA 3MFHA 3CUUA 4HH0A 2FP3A 3OZGA 4AX8A 1IZZA 2P9BA 3RWOA 3ZW9A 4HDQB 1PX0A 2IUFA 1E2KA 3LP5A 4MWOA 3R0VA 4JBNA 3UAZA 2P2CA 4ZI2A 1C9MA 2YMPA 1DBVO 2H1HA 3SOZA 2KM1A 3AEQA 1E69A 3C3JA 4FR2A 2O5RA 3M4JA 1KZYC 1DIGA 2DX7A 2VDWA 1CUAA 3EC2A 1OH5A 1S8OA 2FUEA 1H2WA 3C1OA 2XA9A 3EGVA 4EJ2A 3RJJA 3TB6A 4MLCA 3NDJA 5REQB 4C8LA 2WWWA 1RKBA 2ZTDA 1SCIA 2YOHA 2MA1A 3UMGA 3MGCA 4BWVA 3KEMA 2JI9A 2PIAA 1YRQA 1U28A 2X3FA 1GNSA 3PGJA 2WQZA 1TE2A 3K8QA 2A7XA 1TA0A 3VH4A 1D2AA 3B12A 2FMHA 2WSYB 2O8CB 5AHRA 1NUPA 1SKQA 2LYAA 1SUSA 2IP1A 3QKIA 3UM9A 3P27A 3VU9A 4J6EA 3K5HA 5BMVF 3LZ6A 1ZQBA 3Q7QA 2PMZF 2W2QA 4BLQA 4RKQA 4D9GA 2GARA 4GUAA 1SXIA 3MCVA 1HFJA 2V55B 3BWCA 3F78A 1AGNA 2X1LA 2YBDA 1GVNB 4L0QA 4PF1A 3NTXA 3VYUB 5H7XA 3ACCA 1V5EA 5T8KC 1OZ0A 5FBLB 1E2JA 4DREA 5FORA 2H7YA 2QQGA 1MXHA 3K0AA 2E3JA 2FN9A 4ENTA 4I36A 2WP0A 2OZKA 2O6LA 1OLUB 3AVQA 1PO7A 5L3QA 1Q11A 3I1FA 3PMNA 5ICSA 5ALFA 4YRBA 4FOTA 4UDYX 4UFPA 2OB1A 4NV3A 4AKGA 3PSAA 2FDCA 1QUEA 4M0FA 4EX7A 2QAGC 2QRGA 3GJYA 4GG1A 4A91A 2NZYA 4URYR 4AK9A 4LCEA 4UTZA 3EASA 5E6SB 5G53C 4KRXA 1XSPA 4IZHA 3NDBB 4D2IA 5KPJA 4EEYA 4NG5A 5CGQB 1E61A 2XW6A 1R18A 1ESMA 3ESYA 1QGUB 3BK2A 4FFLA 5IT0A 5BQXA 4DTCA 4AZ0A 5FTLA 2AN5A 2JK0A 3LC1O 1GFSA 3C3MA 1PFQA 4F2SA 2PGLA 1FFEA 8ICOA 1XC7A 1P3Y1 1VIAA 4ED8A 4L0CA 1ZVKA 3IHQB 4Q9JA 4JXKA 5J2FA 1X80B 5E9WA 1L1RA 2WD9A 4FHDA 2MYUA 3AZQA 3PXCX 2QZZA 5BR8B 2DTDA 1N1GA 4RX1A 2OE2A 4EK9A 9MHTA 3MLAA 4BTVA 2O0HA 2ZETA 2ZJYA 5CB6A 2OV8A 4ZHSA 5EWGA 3OT1A 3ZHRA 3E6AA 4X20B 5KYYA 4KL8S 1HLGA 4KWIA 3TIIA 4KBGA 1HF3A 1OGJA 4UHBA 5GAJA 4E07A 4WKOA 4O2RA 3V3KA 1CZNA 1TRHA 2VDPB 2ZJ2A 5HQJA 2H48A 2ZUFA 2OMEA 1JEYB 1JXQA 3TM5A 1GQ2A 2PX4A 3LQFA 5K3CA 1URJA 4DFDA 3F3YA 3ZLVA 1SV4A 2ATIA 2VJDA 1VLVA 5DCWA 2VT6A 5BPFA 1JF8A 4AZSA 3K75D 1E4OA 4KLLA 1Z6YA 2RHHA 2WJPA 2ZDQA 2G36A 3KBBA 3UC5A 5JDCC 4DSLA 2PH1A 1EM6A 3C0KA 5ECDA 5CCEA 5EWMA 4RHCA 3ZWOA 3AT1A 2IQ5A 1NXOA 4S1VA 3FCSB 3EEYA 5KAIU 4Q8FA 1FP7A 4MZXA 3CPHA 4ZU3A 1BOFA 2FMFA 4EM6A 1P7VA 3H2GA 5FTNA 2J6UA 4ENPA 1VJ5A 5CYFA 2CGEA 3DZCA 5TB5A 2JGJA 2NTEA 4RFLA 3HRKA 3TLJA 1DAOA 3OU6A 4L8GA 3KQHA 4DV2B 2QTFA 2Y3IA 3EDYA 1SIOA 5EMKA 1JG4A 3GAAA 1J2RA 2EV9A 1V1JA 5IJ9B 3IQWA 5G5GA 1E8NA 2BPGA 2IL1A 2YIDA 3AMZA 4K9LA 4PBTA 4RJIA 2H1SA 4CT0A 1QIEA 1YS7A 2VXOA 1L2TA 2WU4A 4UTOA 4FS8A 3PE3A 1U2ZA 2GYYA 5K6AC 2GRJA 3ESBA 1J2MA 1IUNA 4B3HA 1HOTA 5KFIA 2Z9DA 1MQSA 4DQRA 1RBZA 5TS2A 3I9V1 3Q3VA 4YRJA 5JQGB 3AL3A 1DP4A 3O5AA 4AKSA 4AX4A 2XXJA 3IPAA 1J5EB 1VHQA 1ECFA 5B1EA 1SOAA 1EVQA 1W5AA 2ZPUA 5G0UA 1U3VA 4DFPA 1C7JA 2JK1A 2R00A 4IQGA 1E3LA 2FSHA 2VPYA 5JVDA 3UXNA 2PMDA 3KQQA 3GIDA 5CDUA 3NKFA 1W6RA 2R6GA 2BKXA 4HN9A 3KZVA 1T0BA 4JWMA 1V39A 4CNQA 1NN5A 3TOZA 2BMWA 2FH5B 4CIAA 1AKTA 1QYIA 4Y2GA 4D46A 4QJIA 4I50A 1T25A 3ZLJA 4QGGA 3HDHA 1Z1VA 3ENKA 4CLOB 1KKUA 3O4IA 3A2LA 3CT4A 3RIHA 3UQ2A 4NNJA 1PP4A 3U4GA 1DK3A 4K6GA 3P0IA 2XUZA 4DMMA 5EE3A 3U3KA 4E88A 3T1TA 2D6FA 3B13B 3IAM6 3NBUA 5JOQA 4GIBA 4PV7A 1U2PA 4DT1A 2XLCA 4DNOA 4H1WA 4BQOA 3V1UA 3L7YA 5SV2A 2IDJA 9GPBA 1XZQA 3C8UA 3HKDA 1BMFA 3CISA 4HOYA 5IYZF 1FC0A 3BGOS 5A4DA 2PKQP 3DVAB 3TE6A 3H19A 1E4EB 3TFRA 4REQB 2UZIR 1E2QA 3UG7A 1FYXA 1LF0A 1QHIA 2ZTVA 4I1UA 3FYUA 4Z9FA 3TNYA 4IZOA 2OC4A 5I8ZA 3O3CA 3G2OA 1G8PA 1MOZA 4IJVA 3SG0A 4DY4A 3JAKA 3UOAB 1G66A 3EXFB 4X1IA 1JEDA 3D4BA 2FWBA 5KEIA 3V9AA 4MRAA 4DCJA 2DFNA 4KXUA 2V6GA 2PMBA 5T6BA 3NHPA 3KR0A 1A2OA 5ELLA 1DX9A 3HGTA 3DP9A 2GVDC 5E95A 2BLLA 2QQ5A 4Q1EA 2PS0A 3ASUA 4X1YA 2Z5FA 4PR0A 4RNCA 3X43A 8ICMA 2VF7A 4PHPA 8ICUA 7ICSA 3HU3A 3QPAA 3JPSA 1MUUA 1ZHHA 4N8EA 1LCIA 4C0WA 1YJ8A 3EZXA 4NK5A 3O31A 5E38A 4IDPA 1V1MA 3KTAA 3K92A 5IUNC 5IYZA 2VK4A 5LOVA 2REQA 2FCRA 2ZRIA 4RV5A 1IZ9A 4TSFA 2H07A 3CINA 5CFZA 4HDKA 3IPXA 3LLCA 3ZU6A 1VHLA 4LGYA 4QWBA 3GT3A 4RZUA 2XODA 1YUNA 1C0EA 2OCIA 1E9AA 3M81A 4IAOA 2H16A 4RK4A 4KH0A 4Y6QA 3CUVA 4O4HF 2B3DA 1J7JA 1M66A 3DMTA 4LZWA 1U11A 3CO0S 1HA3A 4BX9C 3NHRA 5B37A 4TQAA 1FUEA 1YZ3A 2GNPA 1ZQUA 3X2EA 2OM6A 3P19A 3EQ8A 4BLPA 4R71A 2CNKA 3N76A 1DDOA 1E3DA 5KKNB 5KWIA 5DKFA 5ALLA 3R5SA 3PTAA 3AJRA 1VMAA 4OH7A 5BV2P 2CWWA 2EP8A 3HYTA 3LU1A 3PU6A 2O8EA 2OFOA 1N6LA 5DEOA 3G68A 3TNLA 1HUOA 4OV6B 1SELA 3K9WA 1NVEA 4JK3A 3LLSA 3NUGA 1WBJB 4DFMA 3NHWA 3KJHA 1GFWA 1DKNA 4MWBA 4PBRA 2X14A 2CLMB 3VDRA 2W2LD 3ZJYA 1T15A 3EZLA 3M7IA 5K8TA 2A7QA 4CI0B 4KQFA 3SV4A 3COPA 2J6TA 1IG0A 3I6QA 4M87A 1QB7A 2R8RA 4XRRA 4KFTA 2EP7A 4RK6A 2PO7A 3WK6A 1SU8A 3HS3A 3WICA 3ICXA 3OAAA 2BPFA 3BQ1A 1YASA 4DXHA 3WP1B 4M54A 4IIJB 1ZI9A 4NIMA 2CL6X 4QZAA 2RK3A 4UE3S 4ZEXA 5GJBA 2MR6A 1XAGA 3C4JA 1N57A 4W1QA 1I7DA 3ZZ1A 4IYJA 5HW0A 3GT7A 2HHAA 4D1YA 5KINB 4V1CI 3R41A 4UNNA 1RBMA 2II6A 1XNQB 2WICA 1SC1A 4B3DA 3BB3A 1GU1A 1DEKA 2LPMA 1L5NA 2C2MA 3MRVA 4TMXA 1M1XB 4UEOA 4UNIA 1MEJA 1LPSA 2B6HA 2NUBA 3EPRA 3GN2A 4AJPA 3RK0A 2I62A 4BASA 4RTKA 5JDIA 1U99A 1VMEA 3FWYA 3DOOA 2OHIA 2JGDB 2HA0A 5A06A 4A2PA 1DO2A 3GP5A 3EMBA 4DL3A 1A0PA 3IEKA 1QK4A 1M5UA 4AMBA 4Q4LA 2FAXA 1ZGAA 2Q1XA 2AQKA 1HDZA 3BZKA 2QTGA 3WL4A 1BMFD 1KAQA 1QTIA 2A88A 1UP7A 3P0FA 2CKMA 4FBLA 2WNIA 4YACA 2WWTA 1YFKA 3INTA 4Z0TA 2AL7A 4IDCA 3R7NA 1Z4NA 4KYUA 4RS3A 4LQCA 2X13A 1FY2A 2PWAA 4TMWA 1FRNA 3K30A 4D79A 1X19A 2N42A 7MHTA 3K1AB 4CBVA 2PL9A 2PT9A 4Q4AA 3D3WA 1JG7A 5FBRB 5SY6A 3D1JA 1GOTA 3L82B 4OAQA 3PDUA 2AYYA 2KBFA 4CLRA 2BRUC 3RSLA 4CQMB 2BHLA 5KNLA 4US1R 1U0JA 3TRJA 1EGHA 1NG1A 3ZHYA 4LWPA 1JG6A 2AF4C 1V95A 3NRCA 4GI3A 2AR0A 2IGTA 3ITKA 1GGNA 1NWCA 3MJFA 3KPWA 2AFIB 3PEUA 4PZZA 3BQ7A 5EZYF 3VPFA 4PHGA 1T5BA 3RR8A 3EFBA 4F6CA 1QQ7A 3L8GA 1E1NA 1SKUA 5TLSA 1QNLA 8ICTA 1J56A 4F4UA 4XKJA 2W2OA 4Q1AA 4EHNA 5IWAB 2EFJA 4QYIB 3UY4A 3LX5A 1GR1A 4CETA 1U2SA 4TSFD 3RBDA 5CVDA 2YB4A 1TJPB 2HWXA 4ZK2A 2QSJA 7REQB 5CT9A 2YOFA 2G6BA 4FT4A 3NVVA 1D03A 3W04A 3O8QA 3K20A 3T0GA 4OATA 1YB5A 2JJ8A 4EJ6A 1N6IA 4W9RA 3P26A 1TZJA 1UK6A 3QQ5A 5CNJA 3ZE6A 5EJ7A 1NE7A 1SB8A 4S0XA 4LISA 5DB9A 1ORTA 1KWGA 2D8MA 4R3WA 4YRFA 4E4TA 4YVZA 4CKXA 1K5HA