The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
225
|
structure length |
224
|
Chain Sequence |
LVDSLRACVFAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
(S)-2-haloacid dehalogenase IVA
|
| publication title |
Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb |
| source organism |
Burkholderia cepacia
|
| molecule tags |
Hydrolase
|
| total genus |
88
|
| structure length |
224
|
| sequence length |
225
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.8.1.2: (S)-2-haloacid dehalogenase. |
| pdb deposition date | 2006-10-24 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00702 | Hydrolase | haloacid dehalogenase-like hydrolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | Putative phosphatase; domain 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HAD superfamily/HAD-like |
