3TAQA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3taqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3taqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3taqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3taqA01
4DQQA 2KZZA 3OJUA 1B9FA 2DY4A 4JWNA 2W9BA 3WNHA 3O3FA 4CF2A 5J2IA 4Y1DA 1LW0A 3NFAA 3TAGA 2DTUA 5J0WA 4PWDA 4M3RA 4OPJA 7ICVA 3WNEA 2F8SA 4OKEA 1IKXA 4FJLA 3FDSA 2BHNA 5IIMA 1JXBA 1NJWA 4CGDA 4TQSA 4B3OA 3QZ7A 2QKKA 4CEZA 2PFNA 3OYLA 7ICHA 4O5BA 5C24A 3AA3A 1JIHA 2NRXA 3GV7B 2Z1GA 4B9VA 4J9MA 2JZBA 4ED7A 7ICFA 1UOCA 2B21A 4YN4A 3QIOA 4DMNA 3ZT0A 2XC9A 5J2PA 4EYIB 4Q0BA 2HVHA 1NK9A 4DFMA 2Y1IA 1LWFA 1JLAA 5FDLA 4OGEA 5FRMA 1JLBA 4NLGA 1BHLA 5DDMA 2M9NA 3AVFA 3DI6A 4YR3A 1MSWD 2VWJA 4KLSA 1S0VA 3LK9A 3MGIA 3JPQA 5DGAA 4CEQA 2F8TA 4I2BA 4MF8A 4CGGA 1RDCA 1LV5A 3ZSQA 4DQRA 4NLNA 4QZIA 1J5OA 2OPRA 3M9NB 1QTMA 3H4BA 4KLLA 3UXNA 5CB1A 4GW6A 1TAQA 5DQHA 3MGHA 4H4OA 1C0TA 1JLQA 2XO7A 1TGOA 3G6YA 3GIKA 2BCUA 3PW7A 4YFKA 4KPYA 4W5RA 2Q0ZX 1D5AA 4JS5A 4KLQA 1K1SA 3RJFA 4LY7A 5CP2A 3QE9Y 2HNYA 3RRGA 4DU3A 1ZQUA 1NJYA 5CWRA 3KK1A 5KFSA 4PUOA 5KFFA 3QNNA 3NGZA 3MEDA 4CIEA 4AHVA 3JPNA 4CGJA 4CHNA 3U3YA 4DTRA 2PFPA 4F4YA 4MEXA 3UPQA 4PHPA 1XSLA 2KFNA 4DS4A 5KI6A 5DBAA 1A5VA 5D46A 3HL8A 4DWIA 5L9XA 1K6YA 2VG5A 1WNSA 4CEFA 5DB6A 5DK5A 3O4NA 2MUTA 3RB0A 4O3NA 1EX4A 2P1JA 3QEVA 2PFOA 3K58A 4KLUA 1S9EA 4QWCA 4R64A 3MEEA 5KTQA 1KEJA 3BQ2A 2DFHA 5I3UA 3JPRA 5BOLA 2KFZA 3D0PA 5KFEA 3OYFA 2AGQA 3Q8RB 1N6QA 1KFTA 4QZCA 4ED6A 3K57A 4PGQA 3JPOA 3M8RA 4E7KA 3QEAZ 4UAWA 3PMNA 1IKVA 2FPMA 2R8JA 8ICVA 3TAMA 4W5OA 5KFOA 4I28A 2D0CA 2XRIA 8ICPA 4CF1A 4Z0UA 1T05A 4HYKA 3L2RA 3IS9A 3V7LA 1MQ3A 2VA2A 2HHVA 3MR3A 2XY7A 1TL1A 1Z26A 2F1JA 5D4BA 5J2JA 4KV8A 4O44A 4FK4A 1IG9A 1WCNA 4QWBA 2V4RA 2BPFA 3L2UA 5J2KA 5DKWA 4GC6A 5DQIA 1LAWA 3K5NA 4RQ3A 3RMBA 4AHCA 2XY6A 5HRPA 1S1XA 5KT6A 8ICQA 4CJFA 4DLEA 3B6PA 3RJGA 1C6VA 4J9KA 4FYDA 2IHMA 1CXUA 2YKMA 2ATQA 4ECZA 3PX4A 2ZUCA 4JK1A 1X9WA 3RR7A 5KFQA 3Q8QB 4I29A 3ZSZA 4KB0A 1BPBA 4CJ5A 4N76A 2G8IA 4TUSA 3OYGA 3PO4A 4QZHA 1RNHA 4J2AA 4M04A 3LAMA 1O1WA 1IKWA 1WAFA 4CE9A 5BOMA 4RQ7A 2HHXA 1DTQA 3OSPA 2EX3A 4HTUA 3RBDA 4KLHA 3V6KA 4LZGA 3TWHA 1WSFA 1U04A 2OPQA 3ISBA 1RXWA 4RPYA 3LALA 3B6OA 1QSSA 5KFBA 4E7JA 7ICNA 5C5JA 2OYQA 1ZQHA 4Z4HA 3SI8A 1SL2A 3LP1A 2ASLA 4YR2A 2BCQA 3HX0A 4ZTFA 5KFVA 4PHDA 5KFWA 1A77A 4UBCA 3VQEA 2IA6A 4IFVA 2P5GA 4QW9A 3UQ0A 9ICNA 4CK2A 1BIUA 3NTUA 1RDBA 1KVBA 8ICXA 1U47A 5HBMA 3GQCA 4O0JA 3OSNA 1BPYA 4KO0A 4YMNA 4B9MA 1S6QA 4ELUA 4M2YA 4ZHRA 5KT7A 2NUBA 2ZD1A 3F9KA 4KHWA 3H8WA 1ASUA 3ZT4A 4CERA 1S6PA 4RNOA 9ICCA 2ZJ8A 3ZD8A 4FO6A 1Q9XA 3T5KA 1SL0A 1J53A 4DFKA 1BPZA 5F9LA 4R63A 3RB6A 5KG1A 1RT1A 1ZQYA 1UT5A 2WTFA 1JLCA 2J6SA 1HUZA 4PGYA 5KFMA 4FK0A 1T4GA 3ZD9A 4QW8A 4BDYA 4DQPA 5KGWA 3QLHA 4IQUA 9ICVA 3CFPA 1YVUA 1S1UA 5KFCA 3S3NA 4IKFA 9ICEA 5HMLA 3THVA 2OPSA 4QOZB 3V6DA 5KT3A 1VSJA 4HUFA 1N56A 1FKPA 2A1SA 1ZQNA 3RH6A 4ECXA 3ISCA 4CEBA 1JXLA 9ICBA 3AA5X 2ASJA 3M9MB 1JX4A 3IRXA 3C1ZA 1CXQA 4HCBA 4RT3A 1BISA 1X9MA 1Z25A 3SI6A 3DLBA 4FW2A 4ID1A 3MBYA 3CFRA 4IQVA 3V6HA 4C8OA 4W5TA 5KG2A 5KT4A 3Q8KA 4NYNA 2RF2A 4NM1A 2LSNA 4FLUA 1VSIA 2UVUA 4RG8A 2V9WA 4M3UA 3MABA 2RN2A 3DRPA 5HRNA 3H7IA 3NGDA 2NRWA 2HHSA 3LZJA 4I2AA 2G8FA 4IRCA 3MECA 3DLKA 5JS2A 3N97B 4CJKA 5KFPA 8ICZA 2YV0X 1JN3A 1XS9D 4ED8A 3KLFA 1ZBIA 4N47A 5I42A 1YTAA 2BE2A 5DMRA 3TAFA 4B9NA 4M9HA 3V4IA 1RBSA 3EPGA 4MQ3A 1HUOA 4CHYA 8ICIA 2HMIA 3KD1E 4FW1A 1KFSA 4MFAA 1TKDA 2R8GA 4CHPA 9ICPA 3KD5E 1A5XA 2QXFA 4FK2A 3AV9A 1RBUA 4KHQA 5KFJA 3L2VA 8ICUA 3I8DA 1NOZA 7ICRA 4G1QA 2ISPA 2C2DA 5KG5A 3AO2A 3NH0A 4J9PA 8ICSA 1RT5A 5IIKA 4RZRA 1TVRA 4ED2A 3L2WA 4DLGA 2LYHA 1HMVA 3PY8A 3Q8LA 1TAUA 2VANA 5KFXA 2WOMA 1ITGA 3SQ1A 3HK2A 4ECSA 4NY8A 5L1IA 3SV4A 3KIOA 4RT2A 3B0XA 4CJ3A 4OKKA 4KKOA 4XIUA 3D45A 3AA4A 2ASDA 1TVAA 2VA8A 1NK4A 4BWJA 2WONA 4EBCA 5L1LA 3O4QA 4HCCA 4UBBA 3TAQA 4I7FA 3SQ0A 3MXIA 1ZQPA 3VQPA 1T03A 4DTUA 4F5QA 4KMUA 4UB5A 1XU4A 3AVMA 3PR4A 4CF0A 3DOKA 5KT2A 1EP4A 4ZTJA 3SCXA 4O3QA 4QZGA 4KTWA 4YD1A 2BCRA 2PXIA 2C2RA 2XHBA 4BACA 3C6TA 2BQ3A 4CK1A 3O3GA 4DFPA 5J0PA 3MXJA 3K5LA 2FLPA 4DF4A 5DG8A 3UQ2A 8ICKA 5TZVA 4BE2A 5J2BA 1C0UA 4DL6A 2W9AA 3NH2A 1Y88A 3E2EA 2XCPA 4DSFA 5KFUA 2IHNA 8ICEA 4YXJA 1XC9A 1HYVA 5KG0A 4DG1A 3HYFA 5KFIA 4FJ7A 3K59A 1TK5A 3CG7A 4FZYA 1NK8A 3K4GA 1JL1A 2FMSA 4KFBA 2A1JB 3PVXA 1S1TA 4RQ0A 4CK3A 3NHGA 3SUQA 2E6LA 3IHQB 4CECA 4DL3A 3QESA 1RT6A 5C25A 3LWMA 5DLGA 1ZQZA 5HP1A 1JLEA 5J2HA 4LH4A 4Q44A 2FBTA 4E7LA 4DO9A 4Q8FA 4Z6EA 4YCXA 2RDJA 3RJEA 3VN5A 1W9HA 4X5VA 1TKTA 4JWMA 4F8RA 8ICLA 4P4PA 4LSNA 3VQ6A 3LDAA 4HHTA 4NCBA 3LAKA 4FLTA 3QETA 4B9TA 3RJJA 4FJNA 4QAGA 3KHGA 4OLAA 2R8HA 4IFYA 4RW7A 4F3TA 1B92A 3PX6A 2BR0A 4LVSA 1ZQXA 4AHSA 3TI0A 3MFHA 2KZMA 3V7KA 2ZJAA 3MEGA 4CHOA 3BQTA 4RW8A 2NRZA 4PPXA 1KCFA 3QZ8A 8ICTA 2FBYA 2C22A 5J2FA 1BVSA 3QEXA 5EWGA 2IGIA 1L3UA 2HHWA 2F1IA 4F4XA 1Q9YA 2VA3A 1WN7A 8ICNA 2XGQA 4QZ8A 3TARA 3C1YA 2FMPA 3OS1A 4I2HA 4I2JA 3ZDDA 5T7BA 2FPLA 3GILA 2ITGA 3HPHA 3HVRA 4DFJA 4CGIA 1MC8A 4YP3A 4BE1A 1NOMA 4AHUA 2FBVA 4I2PA 2AGPA 4TQRA 4FM0A 3H08A 5DQGA 4R8UB 3RBEA 3AO5A 2RPIA 3F73A 5FROA 3ISDA 1JLFA 3Q8PB 5JUMA 2ALZA 4KHUA 1HYSA 5IILA 1RILA 4JUZA 2VG6A 4QCLA 4CESA 4BWMA 3SUOA 4N56A 3V9XA 5DG7A 5J1EA 4QWAA 1S10A 3ETLA 3V6JA 3SZ2A 2ZTEA 1S9GA 4BDPA 3K75D 2W42A 3B0YA 2DFLA 8ICCA 1RYRA 1BQNA 1J9AA 1Y97A 5D49A 1Z00A 3NF7A 3WNFA 1JKHA 4MF2A 1UA0A 4OGCA 2RKIA 3PV8A 4MFBA 3DLRA 3V9WA 4EBDA 4QZEA 4W5QA 4RQ1A 4K8ZA 3LP0A 1S1WA 4CJUA 3FFIA 4O55A 2JEGA 1U49A 2I9GA 4DSIA 1NJZA 1KDHA 4R5PA 4F2RA 3JPTA 5K14A 1YT3A 3VA3A 2XGPA 1ZQGA 3RWUA 3PW2A 5J0TA 3A2FA 3AVNA 5J0OA 4KLIA 4FS1A 1RBVA 3T1AA 4DTNA 4E7IA 1KLNA 4M6WA 4B9UA 7ICKA 3ULDA 4DOCA 4B8CA 5KFZA 2AU0A 3NF6A 3T19A 4BXOB 5HNKA 3TFRA 4FM1A 1WSJA 1VSLA 4DL2A 1S77D 3NGYA 3IG1A 5KFNA 5J2EA 2JGUA 4FJ5A 4Z6FA 1ZJNA 4QWEA 4O5EA 2D0AA 5DLFA 4QWDA 4CHZA 1R0AA 1EXQA 1BI4B 4O3SA 3AVLA 1RPLA 1TKZA 4DTOA 2XCAA 2KTQA 3RJHA 4NLZA 4O5KA 3HP9A 1ZQSA 4KB1A 3HSTB 1L3TA 2MUTB 1KVAA 1BPDA 3E01A 4M45A 4FLZA 4HVJA 4IG3A 2E6MA 3AVHA 4H8KA 1HNIA 3C2MA 1RDDA 4J9RA 4PH5A 1WSHA 1KSPA 4F93B 5J2QA 1QHTA 4FLYA 3K2PA 4AILC 4M3TA 3OYEA 4CFDA 4N5SA 2D5RA 2BPCA 4FJ8A 3EYZA 3MR6A 1EKEA 4GC7A 3G0ZA 4ECTA 1K1QA 1C1BA 1C1AA 4DL4A 1IXRA 1SKRA 3TFSA 1SV5A 3DMJA 9ICOA 1CZBA 1N5YA 4C8MA 4GXIA 2X6SA 1KVCA 5J2NA 4YVZA 1AROP 5CYMA 4DU4A 5KFRA 3NAEA 1RDAA 3JPSA 3AVKA 4IR1A 2FLLA 3MR2A 4CGHA 4RW9A 4KITB 4CEDA 2P6RA 1TK0A 1VSFA 2HNDA 4JRQA 4E7HA 4FJHA 4NLKA 4CEEA 4FS2A 4QZDA 4CJEA 4B9LA 3NDKA 7ICMA 2IOCA 3M8QA 4FLVA 1C7YA 3LANA 3QO9A 9ICXA 9ICQA 4E1NA 4Z4FA 4F91B 5KFHA 1RTHA 5J0RA 3PX0A 1RYSA 3I0SA 4N41A 1DOQA 4RQ2A 1B22A 2AJQA 4KN7A 4J2EA 2FPKA 1BIZA 1I39A 1TK8A 3ZT1A 5KFKA 2YNIA 4RUAA 3OS0A 3ORYA 1VSHA 4DSEA 4C8KA 1TFRA 4FZXC 5J0XA 1D9FA 1NK6A 5L1JA 4M42A 4DTXA 1IH7A 1GOBA 4RPXA 4I9LA 4CJQA 2NRTA 3PUFA 5KFAA 4O0IA 4R8UA 4RUCA 3C5GA 4ED3A 5HROA 3VQAA 4KHYA 4R66A 4CF8A 1DGSA 2PI5A 4TSXA 3O3HA 5KG4A 1KLMA 2VWKA 3QERA 5FRNA 1CZ9A 2IC3A 3SQ2A 2PFQA 1KRPA 4CJVA 4DF8A 4JS4A 4O3PA 3SPZA 2YKNA 1WAJA 9ICWA 2C2EA 3HXMA 1RT2A 1ZQMA 2DFEA 3EW9A 4YG2A 4E0DA 2MAXA 3FYHA 3Q8SB 3QEWA 2P66A 4RQ5A 1X9SA 4FJMA 4YMMA 1DTTA 2X74A 3AVJA 1UA1A 3P5JA 1D8YA 3H8JA 3AVIA 1D9DA 2UVVA 1REVA 3VA0A 5SZTA 3L2QA 2UVRA 2G8HA 4IQTA 4DSKA 3K5MA 2DPIA 3U6FA 3SUNA 2QKBA 1XHXA 1JMSA 4I2IA 5CA7A 1HNVA 1HPZA 1U4BA 4NYFA 2XY8A 1ZQIA 4K4IA 4M47A 2VG7A 2I1QA 4F5NA 3PW0A 2O4GA 3ZSRA 4I2CA 4MFFA 1A76A 5CZ2A 4Q45A 4QZBA 4OKJA 3UXOA 3KHRA 4FJIA 4PA1A 3V1RA 3ZT2A 2BKEA 1CUKA 4O5CA 2IS3A 2P6UA 1S0OA 4DOAA 1BI4A 1RTIA 3L8BA 4PGXA 1CEZA 4J9NA 5SWMA 3CM6A 2Z1HA 3AVGA 1WSGA 3HW8A 3PR5B 3MDAA 1WSIA 1IO2A 3ALYA 5DB8A 2W8LA 3KK3A 4CEAA 1XWLA 4TUPA 1S76D 2NRVA 9ICAA 4DSJA 4GXKA 4CIGA 4UQGA 3T3FA 4KI4A 4EP4A 5DBBA 2ZUBA 8ICMA 3EY1A 4M6WB 4EP5A 9ICMA 3H8SA 2PI4A 4KI6A 4XQ8A 4J2BA 1ZBFA 4DTSA 4CJPA 3DLGA 1LB2B 1SKSA 2OA8A 3H4DA 3GV8B 2J6TA 4KLFA 1GOAA 2HHTA 4LD0A 3QEPA 1LWCA 4Q8EA 1XHZA 3DYAA 2AQ4A 4IQWA 4EZ6A 3AO3A 5DB7A 1F21A 4MFCA 1B43A 4KLMA 1RZTA 3OJSA 1VSDA 3QEIA 1BPEA 4KREA 5DDYA 3OVNA 1D8LA 4RU9A 4JV2A 4CJTA 2E4LA 5DG9A 4J9SA 4M3XA 4LZDA 2BCSA 1W0HA 2RDIA 3AUOA 4UAZA 3RMAA 4ELTA 1ZBHA 3UXPA 1J54A 2I5JA 3PO5A 4GMJB 1ZQVA 3S3OA 2H5XA 8ICGA 3ZSVA 3BDPA 2IBKA 2HVIA 2W9CB 3MAQA 4AHRA 4FBUA 1IM4A 1L3SA 4HUGA 4JV0A 1WCLA 4RPZA 2R8IA 2ZQBA 4I27A 5EWFA 4O4GA 1ZJMA 3OYKA 2Q3SA 5KG3A 7ICUA 4LSLA 7ICJA 4ECWA 4DQSA 3MDCA 3NF9A 1EXNA 2GV9A 3AU2A 1NOYA 2FLNA 2G8KA 5J2GA 4I2EA 1ZQJA 4CCHA 4BGDA 7ICQA 8ICWA 1HQEA 3NH1A 3TQ1A 5J2MA 2KW4A 3OHBA 3DRSA 1BPXA 1XI1A 4KTQA 5KGXA 5J2AA 4FLWA 4QZFA 3VQDA 4KLJA 4NCAA 2X6NA 3OHAA 3OYIA 3OS2A 2ZTCA 4YNQA 4FM2A 9ICIA 1NKCA 2ATLA 4Z4EA 3BQ0A 4HUEA 3HPOA 2ZE2A 3GIJA 2R8KA 4IRKA 3BJYA 4DTJA 3RAXA 2IAJA 2JLEA 3BQ1A 3L3VA 4DS5A 1S5JA 4CIFA 3NBPA 5HHHA 3MXMA 4B8AB 3L3UA 8ICOA 5D3GA 4GVMA 5CY4A 7ICEA 3GFKB 3P83D 9ICLA 1T8EA 3S3MA 1HYZA 3VQ7A 3ZSXA 3V9UA 3SNNA 7ICSA 3VQ9A 3NF8A 1VSMA 4ECQA 9ICFA 2IMWP 3ITHA 1ZETA 2P51A 3KLHA 4BE0A 2O4IA 1NKBA 4AHTA 4IR9A 3V9SA 4XRHA 4GXJA 1ZQEA 4PHEA 1QS4A 2W9CA 4RW4A 3K5OA 5KRSA 3S9HA 3JSMA 2R7YA 4K8XA 5C42A 4TURA 4FCYA 3OYMA 3HT3A 4QZ9A 1UWBA 5EOZA 1JXEA 4NXZA 1ZQOA 3TR8A 3LPUA 1SUQA 2A1JA 2OPPA 1ZQQA 1RBRA 8ICHA 3C23A 3V1OA 1DLOA 4O3OA 2J6UA 2BGGA 1ZQDA 3PMLA 3C94A 2YHAA 1XSPA 1QSLA 1QLNA 4F50A 4ECUA 3ZSOA 2JZBB 4K4GA 4JLHA 2B4JA 3HPGA 4CF9A 3KHLA 1FKOA 3VQ5A 2G8UA 5KFDA 5EWEA 3AVCA 2HHQA 1S97A 2YNHA 5E41A 3DLHA 4KAZA 2DPJA 3JPPA 4M0AA 1ZQAA 1BL3A 5KFTA 2HW3A 4I2QA 3JYTA 5J2DA 4KLTA 3VQCA 3ASMA 4FZZA 4M3ZA 4CJRA 4R65A 4FBTA 2G8WA 3T5LA 4M9NA 4CFAA 9ICJA 1LAVA 4E89A 2D0BA 1Z00B 4EBEA 2BQUA 4ECVA 4PQUA 1ZQBA 5DBCA 1MU2A 4CEOA 1WLJA 3LP3A 4OVLA 3OYBA 3HO1A 5KG6A 4DTMA 4I2GA 3BGRA 4FVMA 7ICGA 1XSNA 5IIOA 4F2SA 1V9PA 3OYAA 4KLEA 2PZSA 3V81A 1QSYA 3V1QA 4NCGA 1UT8A 4M3YA 4FXDA 5J2CA 4OPKA 2W9MA 4Z6CA 3ZSYA 4P4MA 5DGBA 4XUSA 4DTPA 1T7PA 2BGWA 4E1MA 1Z3EB 4F4ZA 3SUPA 4J2DA 3EWAA 1TV9A 3HVTA 3VQ4A 2PYLA 4CJSA 4P4OA 2ETJA 3OYNA 1VRTA 4KRFA 4RW6A 4YXMA 4UB3A 2B5JA 9ICHA 2YNGA 4DL7A 5J29A 4F92B 4ELVA 3H40A 2OWOA 9ICUA 4I2DA 4P2HA 1RCHA 3N4MB 1ZYQA 4IDKA 2W8KA 3TANA 9ICGA 5KFYA 3G6XA 1X1PA 2FC0A 4CHQA 1RBTA 1KFDA 2BQRA 3G6VA 3KKRA 3M8SA 3TAPA 2JEIA 3DRRA 4FJKA 1PZNA 3RH5A 1ZQKA 1NJXA 3RJKA 4RQ6A 4KHSA 4FJ9A 3TABA 3I0RA 1B9DA 4EEYA 2ISOA 1KTQA 2IDOA 3RB4A 1HJRA 4ID5A 4OJRA 3KLGA 4RNNA 5KT5A 4KLGA 4Y1CA 2OZSA 2GUIA 1QE1A 4XA5A 3EPIA 1BGXT 5IIJA 2ZUDA 1Q8IA 4FJJA 4ZH4A 2X78A 3GDXA 3HM9A 4F5RA 1GOCA 4I9QA 3GIMA 2UVWA 4JV1A 4RQ4A 4CJ4A 5HRRA 2GBZA 1TV6A 1S0NA 3GIIA 2C28A 3ISNC 1S0MA 9ICRA 4F4KA 3NGIA 4OLBA 1CLQA 1ZBUA 4M41A 3IAYA 8ICRA 4YQWA 4E19A 1FXXA 5F9NA 3RAQA 4F3OA 3QIPA 3ZSWA 4QZAA 2JEFA 3QNOA 4IRDA 1FK9A 5KFLA 4H4MA 5CHGA 1L5UA 4CJLA 1HQUA 5KRTA 1ZQLA 3LZIA 4RQ8A 3RJIA 5CYQA 3KKSA 8ICJA 5DB9A 5J0QA 4CGFA 5KFGA 3RTVA 4W5NA 2QK9A 3C21A 1X2IA 4MEYA 4ED1A 3AU6A 4EYHB 2BDPA 4CFBA 3EZ5A 3KHHA 3KK2A 1U45A 1S1VA 1VSKA 3DOLA 4ECRA 1ZBLA 4J9LA 3PW4A 3VQQA 7ICPA 4Z6DA 5JS1A 3RRHA 1ASWA 3G10A 1COOA 1VK0A 3ZDAA 5HLFA 8ICAA 3TAEA 4O9MA 4FJXA 4ECYA 3AA2A 4Z4CA 3CM5A 1BCMA 1IKYA 1N48A 5KG7A 4B08A 3T5JA 1G15A 1ZQFA 1RT7A 1NKEA 1C1CA 5CJ7A 1RT4A 1A5WA 3OGUA 3AVAA 5IINA 2A1RA 4C8LA 1HJPA 3LP2A 3GV5B 4I2FA 1SZPA 2YNFA 3SPYA 2EHGA 3KLIA 4E3SA 5J0UA 4KLDA 1YTUA 1NK0A 1ZQRA 4UB4A 2YHBA 2B6AA 4EZ9A 3PNCA 4Q43A 4KN4A 2F96A 3U3GA 2AQ0A 4UB2A 4DL5A 3RR8A 2Z1JA 4M3WA 8ICFA 3SQ4A 1ASVA 2Y1JA 7ICLA 4J9OA 1TKXA 4CJWA 3C2KA 4IBNA 4KLOA 2HB5A 3ZDEA 1RTJA 3T5HA 1LW2A 4DEZA 3OYHA 1QQCA 2KN7A 3OYDA 7ICTA 1S9FA 3P1GA 3CQ8A 2KQ2A 4DOBA 2BPGA 1BQMA 3C5FA 3ZDCA 1JLGA 3AVBA 1RTDA 4YD2A 2FBXA 4M9LA 2V4QA 1RXVA 3VQBA 4AH9A 2HHUA 4K4HA 4NM2A 4J9QA 3SV3A 3RB3A 1JL2A 3VQ8A 3NE6A 3HJFA 3RMCA 2PYJA 5BPCA 5J0YA 4DQIA 4L8RB 1U9LA 4PY5A 5IIIA 1ZQTA 4WE1A 3KTQA 3V9ZA 4M9JA 3DLEA 5HRSA 1H38A 4FJGA 4M9GA 3RH4A 4G3IA 3QINA 3LWLA 4DSLA 1L3VA 4F5OA 4Z4GA 4F4WA 7ICIA 2Z1IA 1RT3A 1T3NA 2OZMA 4O3RA 3KLEA 5J0SA 4YR0A 2ZJ5A 2JEJA 3Q8MA 2P5OA 4ED0A 8ICBA 5L1KA 1LWEA 2ZTDA 3M9OB 3KJVA 3OYCA 3OY9A 3WNGA 3V7JA 4CFCA 2KZ3A 4UB1A 3AO1A 4KHNA 1ZQWA 3SYZA 1ZQCA 5CZ1A 3LDSA 1TL3A 5HMMA 3CFOA 9ICKA 3RMDA 2XY5A 2AGOA 1NK7A 3C95A 3HP6A 3HWTA 3SJJA 4KTZA 2G8VA 9ICSA 4DU1A 1EETA 1SL1A 7ICOA 5HP4A 4F5PA 1I3AA 4RNMA 1VRUA 4TUQA 4YMOA 2BANA 1XO1A 1HRHA 4JRPA 3ZDBA 3MR5A 3M8PA 3DM2A 3OYJA 2FMQA 2PY5A 4GLXA 2BCVA 3C6UA 1C0MA 3ZCMA 5HHIA 4B9SA 4PHAA 3LPTA 1VSEA 2DFFA 4IG0A 4LH5A 1WSEA 2F1HA 9ICTA 1UAXA 3CYMA 4Q5VA 3UIQA 4UAYA 4ICLA 1SKWA 3QEBZ 1BCOA 3PW5A 2GWSA 3NCIA 1NK5A 3IM1A 2W9BB 4YFUA 1U48A 4FLXA 4Z4IA 8ICYA 3MFIA 5CR0A 1MQ2A 5EU7A 3ZT3A 3V72A 4BXOA 3C2LA 4BDZA 2HNZA 3AO4A 4C8NA
chains in the Genus database with same CATH superfamily
1SJ4P 2EC0A 2IOFK 4ERDA 1K8AT 2DY4A 3BREA 1N5TA 1N33J 4BR9A 2VQEJ 3O8MA 1TR0A 2EAMA 2BE9B 3JYTB 2GZOA 5J0WA 1ZXIA 2IBOA 2F8SA 1IKXA 4A48A 1HNZF 5MLCQ 1HWUA 3FDSA 3POTB 1HPMA 3BSNA 3Q2SC 4MYUA 3R5DA 1JXBA 2LU1A 1NJWA 1NNDA 4TQSA 3WK5A 1M5PC 4OMFG 3GL1A 2QKKA 2NREA 2CQBA 7ICHA 2L9DA 4JI2K 3THTA 2IDEA 4F3QA 3R3LA 3M1VA 2Z1GA 1K0TA 1PCAA 3VETA 2YWKA 4DPOA 2OHFA 2HQGA 1PVPA 2B21A 1TYQB 4DMNA 3ZT0A 2VB6A 2RRBA 4OJ3A 4LJMA 4USTA 4YB5A 1NK9A 2R2SA 2IVYA 2UUAF 2Y1IA 2GGPB 1B64A 1Q7YT 5AQFA 5KPZA 2B5JB 3SSSA 1PJ5A 1X4FA 5EHHA 4YOVA 4KLSA 3FEZA 1Y7PA 4LF5J 3J81O 5DGAA 4FWLA 3PHTA 3EGNA 3PFEA 4MF8A 4CGGA 1LVHA 4KKOB 4IH7A 3ZSQA 1C0GA 4U67L 4LF8J 5ALGA 2CJQA 3M1VB 3UD3P 4ZP6A 4Y3CA 1TTHB 2FJXA 3H4BA 1WNEA 3F0NA 4KLLA 5JVHQ 1TL1B 2GMLA 3K8VA 5F41A 3KZBA 1C0TA 1JLQA 2XO7A 4UY8O 2MKYA 4QNLA 3WK6A 3GIKA 2CPXA 1EB0A 1U1QA 4KLQA 4LFCK 2Y0SD 3SD7A 2HNYA 2V2VA 2RHSB 2DHSA 3NMUA 2G5IB 3B4DA 5KFFA 4NLYA 4O8KA 3NGZA 3QNNA 1T9TA 4FXWA 1LFWA 4NZ7A 2AP1A 2XHCA 3GBTA 2DVIA 2XMUA 3U3YA 3VAHA 4B3MJ 4DTRA 2PFPA 2H4WB 1FFWB 2V69A 5KI6A 3GCXP 3WKCA 4L3KA 2YB1A 5C0YA 2O6KA 2GQCA 3R1HA 1VK8A 3B8HA 2DIVA 2E1MC 3CCES 1HNIB 2AJ0A 2G0JA 1U1LA 1N62A 2LEBA 5ALWA 1S7HA 2AJ2A 4YDUA 3C16A 3VCBA 2BYCA 4MKBA 3K58A 3DRPB 2PFUA 3SMVA 5KTQA 3BQ2A 3CO0P 1NI3A 1GAOA 3WXKA 1WOSA 3JPRA 4NLXA 1LOTB 1N6QA 3Q8RB 5E3RA 1G7CB 2NYIA 3QU2A 3M8RA 5AZIA 3ATVA 3QEAZ 1K5OA 3SCKE 4ZVSB 4K0KF 4W5OA 4JD2A 3U9DA 4NLVA 2G06A 1SIZA 4YHHF 1XNRF 2XRIA 2CG4A 4FNHA 1T05A 3TEGA 4WFAQ 1PC4A 5H9EJ 2OPSB 1ZC6A 4A8YA 2XY7A 1Z26A 3L0QA 3CPEA 3NMRA 3LDPA 3V4IB 1TZ0A 3ZXWA 1BXNA 5J2KA 1PBUA 1MWKA 2LQ9A 4LBIA 2Q6CA 1NXIA 2DIUA 4TYAA 1V4SA 5HRPA 5T7LA 4MFBB 3B6PA 3RJGA 2WW4A 1VQ5N 2HK2A 2P2CB 2Q31A 5I3QA 2IHMA 3OTOK 2YKMA 3SAGA 3NGSA 2VQFF 2VQEK 1X9WA 3D6MB 1I3OB 3ZSZA 5EN1A 3GTYX 4N76A 1NPPA 5GAGI 2HS4A 3CMAS 3PO4A 4QZHA 3KJFB 1RNHA 3IDWA 4M04A 5BOMA 3QFPA 1DTQA 3AQPA 4OYMA 4IEIA 3EICA 2NSBA 1WSFA 2AEMA 5EX3A 4HT7A 4DR7K 3B6OA 5ETKA 1QSSA 5AM5A 5KFBA 4LF7K 5IM0B 5C5JA 1ZQHA 4K4ZA 1SL2A 3HX0A 1SCJB 3N6LA 3KWIA 4HHUA 4PHDA 1YSJA 2MPUA 4UBCA 4IFVA 2R2RA 1Q8BA 4F4AA 4QW9A 4CTAA 1RDBA 2CQ2A 4OV1A 2YPYA 3FSYA 3GQCA 3QU9A 2HSZA 3CJ0A 4JYAK 2K4EA 1GLDG 3TUPA 3PJXA 3ZT4A 4CERA 5KQ8A 4FWPA 5GMEA 9ICCA 1C1CB 2E1EA 3DNCA 3ZD8A 4FO6A 4Y34A 1VQKN 3I5AA 3ENBA 1IG6A 1R6YA 3G4SN 4FF2A 4B6JA 3TUJC 3BM7A 4YS2A 4Y2KA 5KG1A 1ZQYA 3RJMB 2JFKA 2RU3A 2VFVA 4PGYA 2P5VA 4V1Ak 2G2ZA 4PYDA 5ETQA 1VGYA 3CFPA 4M7YA 3G82A 2QXLA 1S1UA 2M70A 5HMLA 2UUCF 4JI3K 1H74A 1UMJA 4KGKA 3ULEA 1FKPA 4AFFA 2AYMA 2R7SA 4ECXA 3HT0A 1JXLA 1IN0A 4CH7A 3FE1A 4JK9A 4QIWF 2QLBB 4KGZB 3C1ZA 1GMUA 4EENA 3MUTP 4RT3A 3U1LA 1QQ7A 2GH1A 2WVBA 4ETZA 1X9MA 4ZIVA 1Z25A 3HRGA 2PMZC 2UUAJ 3QU4A 3EWGA 4IQVA 4C8OA 5BR8K 1BE4A 5KG2A 2J7KA 4NYNA 2W7AA 4WYWA 2DR7A 1B7FA 3D2NA 4FLUA 5AICA 1RTJB 1U0SA 3R5AA 1VSIA 4CYUA 5B5EU 2XWYA 3MM8B 3MABA 3G96A 2RN2A 3G6ES 5HRNA 4CO0A 2QKQA 1M5HA 4IRCA 3HHLB 1VYAA 3MECA 4I2PB 1XS9D 2G1DA 3KLFA 5I9EB 2RUSA 3ZZTA 3CRXA 3EVMA 2P9SB 2BE2A 2AH5A 2GEMA 3TAFA 4M9HA 5HL7Q 1RBSA 3EPGA 4MQ3A 3VGTA 1ZAVA 4Y65A 3I4HX 1K73O 4LF4K 2ASPA 1BWFO 1HBOB 4CHPA 2QXFA 3LPEA 2WB4A 4F72A 1N5YB 2YQ1A 5CHCB 3TU5A 5K5MA 2HLTA 3SMSA 4KHQA 4DCHA 3H5SA 2LYBA 3WXJA 4YMEA 2YNGB 3L2VA 8ICUA 1BWVA 3I8DA 1NOZA 3UMGA 7ICRA 2W3SA 4G1QA 2C2DA 2AV5A 3UI3A 1RT7B 4ZHRB 3NH0A 8ICSA 1XMQF 2FY1A 2VBZA 2G2OA 4QZVB 7FD1A 5IIKA 1T94A 1NGBA 1IBKK 1HLWA 1WACA 2KT5A 2P9EA 4ED2A 4WK3A 1CS4A 1TUUA 4UTGA 1U1PA 2C3MA 1TAUA 4LREA 3SQ1A 3L09A 3JXOA 4NY8A 5L1IA 2YY6A 5DDRC 2QT7A 2BJ9A 3KWMA 3D45A 3AA4A 1NB2A 2CQ4A 4NEYA 4BWJA 1EHWA 4AQYF 5L1LA 4I7FA 3MXIA 8AT1B 4FWKA 2FSJA 3FBEA 1RT5B 1HI1A 3CPWM 3K89A 4KMUA 3ZTRA 1RWOB 2QB1A 2P9IA 4DN0A 4ZTJA 1RT4B 3SCXA 4PQUB 3SCLE 4KH0B 4QZGA 3J7YP 1A0OB 4BACA 5ETLA 3C6TA 3HKWA 4Y2MA 2HGMA 4CK1A 3O3GA 1YITS 2MU2A 1D1UA 4DF4A 2E7XA 4NO7A 5ETSA 4LVOP 3IGVA 3QATA 2WTUA 5J2BA 1C0UA 1URNA 4WPAA 2C2KB 3A8JA 2W9AA 1X5SA 2HZCA 4DV5J 1FA0A 3NG8A 3IDHA 3QMQA 4K2JA 2JHEA 1VBZA 1X8DA 4USJC 2V68A 5DDQC 2VDHA 3CG7A 2RRNA 1NK8A 1HD0A 1HBNB 4X65F 2HF3A 4DR6J 1JL1A 1K9MO 4QQBA 2JRSA 1S1TA 4CE6A 4RQ0A 4A61A 2WFAA 2CQDA 1RTDB 3DLLQ 3D2SA 2MDAA 2E8MA 2E6LA 3IHQB 3AQEA 1E6VB 4KYZA 2VL1A 4DL3A 5HO4A 1RT6A 2FJVA 1D4XA 3MAAA 1X40A 2HRYA 1HYSB 1JLEA 4QPXA 3MMVA 4QR1A 4LH4A 3LDLA 3E3XA 4DX6A 2H3VA 4B3MF 3CCTA 4WIQA 3M2RB 4DZDA 4QS7A 4KRWA 4DO9A 2X1FA 4NXMK 5FPNA 2RDJA 3WKEA 3LDNA 3G2XA 4IOCL 1CPZA 4JI6J 5FPDA 4LSNA 3LDAA 3N5FA 3HD1A 3FUYA 4FLTA 3QETA 3QLHB 3RJJA 4NLUA 1DK3A 1F2GA 3GWCA 2OHDA 2H51B 2R8HA 2MLZA 4IFYA 1RWMB 1OPZA 2BR0A 2GIQA 1HI0P 2CNKB 1CULA 1ZQXA 3Q7CA 4AHSA 3MCPA 1HBUA 3DXBA 4TU8A 3BQTA 3E9LA 3UDCA 2NRZA 2KV2A 4ZPAA 4ZS6A 2EKYA 5AE1A 3IN5A 1OKJA 3HSZA 1V5IB 4ED5A 3GFZA 2VFTA 4C3MA 3QEXA 5BR8J 3UFCX 2XLJA 2O1PA 1TQLA 2LEPA 2ZH2A 4IO9L 1N0VC 2RQ5A 2Z56B 1J97A 4U6PA 5ALUA 2Z58B 3C1YA 1RAIB 5AXNA 3J80U 1KONA 1WKLA 4I2JA 4BR2A 1TE2A 3GILA 3OTBA 5GAGU 1XNSA 1ZD3A 3DLKB 4NXNF 3WEEA 1MC8A 4YP3A 3ILJA 5IC6B 3IG8A 4I2PA 5F3TA 3LP1B 3G71S 2MKCA 2GO8A 3VGUA 3OVAA 3M30A 2DB1A 1JLFA 1SI9A 3SR6A 2MZSA 1J27A 2J8AA 1WDDA 4FO0A 1RILA 4C0ZA 2ZWHA 1RT6B 3BEGB 3R5BA 1S3XA 3V9XA 5CE3A 1UVIA 1VQNN 2B56A 4ZP8A 1S10A 3V6JA 4WXWA 1MROA 1QUVA 1DBDA 4NLWA 3IAS9 2I9SA 3HX9A 4CZHA 1Y97A 1Z00A 3D6HB 3WNFA 2XYPB 1UA0A 1EAYC 4C23A 2NXCA 2RKIA 1YVFA 3PV8A 2FJDB 3FNNA 3HOTA 3R97A 5EE0A 4ZLJA 1DK2A 3UN2A 1GMVA 3LP0A 2DH9A 2CPJA 4O55A 1U49A 1ZQ1C 1NG9A 1KDHA 4AUKA 3ENVA 4LT6A 1YT3A 3CTRA 1HNWK 4ILLA 5J0TA 3NL0A 5K8MA 1HBMA 1KLNA 1XTZA 4DV6K 4F0HA 2E5LK 1YDLA 3MPVA 1ZM4A 3AARA 4BXOB 1N5SA 5FPMA 5HNKA 3R2DJ 2O8EA 2I7NA 3NCQA 1VSLA 4DL2A 3CJAA 5A8RA 5KFNA 4Z6FA 5K20B 4QWEA 4O5EA 5DLFA 4URGA 5F1XA 3EMTA 1R0AA 2J7UA 1Z4NA 4MIBA 2K8GA 1BI4B 3VTHA 1AZSA 2OO4A 3UVJB 5GAGP 5AQTA 4BREA 3KUGA 4BBYA 3JTNA 1VQ4S 4DTOA 3I5CA 1UJ6A 2DRDA 4NLZA 5HANA 3W8PA 2D3UA 2NLWA 2MUTB 1KVAA 3C65A 1LQ9A 2ZH6A 4H8KA 4J9VA 1HNIA 2K8CB 1FHTA 1RQ0A 2HVEA 4J9RA 2H9ZA 2V8PA 5AR0A 4RWWA 5J2QA 2N3OA 8RUCA 3T1HK 4M3TA 2HDOA 4HHHA 1KR4A 2XZWA 2WSFC 3NS5A 4RWTA 3QRQA 4BRQA 1QM9A 1SVDA 3WX8A 4Y28C 3CD6S 3NNHA 3G0ZA 1N32J 2XYGB 1WC3A 5H9FJ 4RW8B 1SKRA 5BN9A 2AP6A 4KFBB 4DFDA 1XNRK 9ICOA 1CZBA 4BR4A 5AKLA 2PEHA 5F8MA 1KVCA 1QHAA 2NR0A 4YVZA 5ELZA 4YDXA 5RUBA 4WP8A 2DXDA 4WQ4A 4DPTA 4B3MK 1QZ6A 4K4XA 3SQOP 1MWQA 3KBBA 3W0LA 3CD5A 1BWEA 3HHEA 2NYVA 4RW9A 1YIJS 4KITB 3W3DA 4CF5A 1RHMB 5AQGA 1T9WA 2Q79A 2G08A 1REGX 5AIBA 2CDQA 1NZ8A 3NDKA 3MM7B 3KFWX 2IOCA 4HDGA 2PO4A 4FLVA 3QO9A 5ADXH 9ICXA 4E1NA 4F91B 5KFHA 4EO8A 4TNOA 5J0RA 1RA7A 5A2QY 1RYSA 2Q6BA 1UETA 3KKAA 4C11B 2OPPB 4J2EA 2FPKA 3ZZ0A 4DHYA 3BF3A 1TK8A 4CZJA 3NXZA 1DARA 1SC1B 3OS0A 1B7YB 1TFRA 1DGJA 4FZXC 5AT1B 4D3GA 1DGKN 5B66U 4JMUA 4CJQA 3CMQA 3VR1A 3MHYA 3H2LA 2VFSA 1BOTO 2VWBA 3C5GA 2ZC4A 4KHYA 4I64A 1FWLA 5J8YA 4DUYK 4Y2UA 2CQ1A 4C8YA 5D0GA 3NVYA 1N0UA 2HQDA 3I96A 5FRNA 4CJVA 1VDVA 1KS2A 4LF1A 4GVEA 3SPZA 5F8JA 2YKNA 4ZVPB 3CMAN 9ICWA 1CJTB 1X4GA 2C2EA 4DR5J 2U1AA 1RT2A 1ZQMA 4QU7A 3WIUA 2DGWA 3BGUA 4E0DA 3FYHA 3Q8SB 1YJRA 4RQ5A 2UXCF 1XNQK 4B3TF 1CI4A 3P5JA 1MG7A 2FDNA 1RHRB 3AVIA 3VA0A 4LSZB 4LFBF 3L2QA 4EI2A 2UVRA 2V52B 4IH5A 5L8RC 3A8KA 2Q97A 1YRUA 2G8HA 4BRCA 1OY8A 4CZCA 3SUNA 5HQ8A 1FWPA 2HS0A 4WU3A 4I2IA 5CA7A 3H98A 5AXKA 2G2YA 4NYFA 2XY8A 3AB4B 5F3ZA 4EELA 4BC4A 2AZ1A 4B1WB 3TADA 2QV6A 2WB1D 4KY3A 1GFWB 5BR9A 1VIOA 4PR6A 3PRDA 7FDRA 4OL8A 4OX9J 2PDAA 1OVQA 4Q45A 4P75A 2ZHOA 5ALKA 3EZWA 3PYDA 4OKJA 1EARA 2GJIA 1FVQA 4NI2A 1RACB 2BKEA 1CUKA 4FPAA 1DTQB 1S0OA 3L8BA 1CEZA 3MR7A 3CM6A 4K5RA 2Z1HA 4F02A 4OPHA 4MHVA 3HW8A 4Q7AA 3CNHA 4CRJA 1WSIA 2V2QA 2N82B 1HARA 4DJBA 3KJQB 3KK3A 3WC0A 2LXIA 1XWLA 1S76D 5H1SV 1L3KA 1U2VB 1D0EA 1JLAB 4ZPBA 4CVNE 3TADC 3O0FA 4KI4A 3QGIA 3CCEN 1FKPB 2DXEA 4M6WB 3SCJE 1IXKA 3H8SA 4RQMA 3FR0A 3DYAB 3CCLN 3DLGA 3SDEA 1L7MA 1LB2B 4PJ0U 1YJWN 2OA8A 4LF8F 4KLFA 2F4VJ 5CD4H 2HHTA 3L7UA 5D78A 2HKEA 3IP4B 2AQ4A 1Q8LA 3QT6A 1V3RA 1B43A 1RZTA 4BRLA 4AP9A 2ZJQQ 1VOMA 3VZHA 3OVNA 4C4TA 1D8LA 4RU9A 4JV2A 3WZ0A 4ANDA 2GO7A 4CJTA 5LMNF 3O9QA 1W0HA 5LXRA 4X66J 4ELTA 1QDUB 4CLSA 3UXPA 2QTDA 1RFQA 4WFZA 1OY9A 2I5JA 3FK4A 5C42B 2PAVA 1SIWB 1VQNS 4C80A 3WXIA 3CJ1A 2YWFA 3A5MC 1T3OA 3V6DB 4JV0A 2KVQE 2E20A 4K4YA 1S7IA 2VONA 1ZJMA 3OYKA 3JAMU 1FI4A 4UUWA 2Q3SA 1A0PA 4DUTA 7ICUA 2YWWA 4ECWA 3ILOA 3DXKA 1ZD4A 4JHDB 1U1OA 3NP5A 1UVJA 4H5VA 1NO8A 3QJJA 4I2EA 1NPRA 1KQSM 4P72A 2CQ0A 4BGDA 3VGLA 2ZM6F 3C6HA 2F2AB 3CCQS 1C4AA 2F63A 4UOFA 1H2TZ 3A0BU 5AM3A 2XBPA 1QCKA 2KW4A 2Q1NA 3ID6A 2BANB 1XI1A 4LF6K 4B3TK 1Y4ZB 3AMZA 2W2NP 3GJRB 4FLWA 4CO3A 2O8BA 3GSDA 3HSDA 4NCAA 2UUAK 4DUYJ 3D1HA 2KJ8A 5B0FA 4BRKA 1NKCA 2ATLA 2YB4A 2C3PA 1Y00A 3L3VA 2KEYA 4NASA 3UWTA 1CG2A 4EHTA 3LGNA 3MF5A 8ICOA 5B0CA 3J7ZO 3P83D 4KGMA 3CQYA 4JB8B 5GMDA 1N52B 3VQ9A 2CJKA 3NF8A 4ZK7M 3VAKA 2FGOA 4ECQA 3ITHA 4WQ5A 2CVIA 4NL5A 2P51A 3EUNA 4AM7A 3FBCA 4BE0A 1VQON 2XIDA 3V9SA 4CLFA 4GXJA 4X65K 3M8ZA 3M6GA 3R9PA 2BZFA 3D1OA 1WHYA 3JSMA 2R7YA 3DI6B 5C42A 4WBFA 1CSJA 2CRXA 1XQSC 2JWNA 3OYMA 4TY8A 2WVFA 1GX6A 1QY7A 2J9EA 5CAAA 1IV0A 1N2XA 2DHHA 3TR8A 4LRBA 2SXLA 1ZQQA 2ZIUB 1VQYA 1ULRA 4DV2J 3MMCB 5C2GA 3C94A 3HMJG 1J2MA 5AFUA 4F50A 4K4GA 2OI2A 1VBXA 4NYZA 1T9YA 1PGZA 5BPLA 2V8DA 2A1AA 3KHLA 2XLKA 4CZIA 4E98A 3CJ3A 3U27A 4USUA 3A5OC 1F1BB 3JPPA 4DUYF 4M0AA 1QE1B 3WUHA 4Y2XA 2HZAA 5ALMA 1Q0NA 2HW3A 3DDHA 2R7VA 5J2DA 3DLEB 4FZZA 1Y9OA 2EQYA 4M3ZA 2XB2D 2O66A 3OL6A 2QZ8A 4LFCF 2ZE2B 4LF6F 1LAVA 2D0BA 1VJQA 4EBEA 1WEXA 2AZ3A 3AOCA 2VJVA 5DBCA 3C8YA 2BRLA 3L7OA 1MA7A 1X5OA 4GO5X 5KG6A 1ZOLA 3GJTB 4OQJA 3TA1A 3UO0A 7ICGA 3D0IE 1VQ9S 4HAIA 4KJIA 1N33K 4BR0A 4OYOA 2MMYA 2MXYA 4OX8A 3DRYA 2VOOA 1RG6A 5T41A 3CXCM 4ZLNA 3V81A 5J2QB 2QARB 4M8LA 2IDLA 5J2CA 3HKZF 2HSEB 3TUIC 2W9MA 4Z6CA 1F3FA 3ZSYA 4P4MA 4X84A 1I5OB 1QH9A 2KKPA 4YOTA 1A7GE 1OSDA 4E1MA 4M5MA 4PL1A 2QN6B 1TUVA 3SUPA 4J2DA 4NB4A 3EWAA 3KUEA 4FZNA 3VQ4A 1UL3A 2BBEA 4KRFA 1LKYA 2E5LF 5E33A 4CH1A 9ICHA 2YNGA 2UXCK 5BJRA 3QT7A 4F92B 3UMBA 2OWOA 3QFHA 5HVHA 3NVVA 2RLTA 4P74A 3AY9A 3ETRA 3ICLA 3TANA 1F5BA 2W7PA 5KFYA 4WTOB 1DXSA 3O80A 3N7SC 2YBVA 1VHIA 1IKYB 4CHQA 5CZVA 3KKRA 3TAPA 3RH5A 3CJQA 3ENWA 4CLUA 2OLWA 3E8OA 2FZGB 4FJ9A 3TABA 1KTQA 2IDOA 3RB4A 3AB2B 4RNNA 2IJFA 5AQQA 2YVSA 2HYIB 1RKJA 3EPIA 5IIJA 2ZUDA 1YF5L 1X4DA 2X78A 3A5LC 3HM9A 1GOCA 2C2ZB 2UVWA 5E3AA 3N5BA 1TV6A 1S0NA 5A0LA 5GADU 2HFZA 3I76A 4OI4A 4F4KA 2Z30B 4OYPA 3NGIA 4OLBA 2M88A 1U25A 3DDKA 1ZBUA 1QVGM 5LMNK 5AKKA 4YQWA 2DGOA 5F9NA 4F3OA 2HQ3A 1MWZA 3FSIA 4UUXA 2NLXA 2EFGA 2XNRA 2QFJA 2Z2YB 3VTIA 1SQKA 2E9RX 4I6AA 2HOQA 2BX6A 2E44A 3LZIA 3BGFA 1KW4A 3M8QB 5DM7Q 1JWWA 1BA1A 2Q43A 5ETOA 4DR3F 2XZDB 1KXPA 4W5NA 3DJCA 1FIQA 4MEYA 3HVWA 5LMUF 4ED1A 3PHEA 3KHHA 2HBZB 2VZ9A 3G6EN 2HNDB 3TVKA 7ICPA 4Z6DA 4UASA 1UFWA 2CVEA 1I94F 1LW0B 2IA0A 2XMMA 2ZZMA 3AA2A 4I69A 1S79A 2C3UA 1CQNA 4BC2A 2VV5A 1I51B 1N48A 3G4SS 4U7BA 5KG7A 3BR9A 5BREA 2YMQA 5CJ7A 3S1TA 1A5WA 2XM3A 2HBRB 1UEKA 2R9LA 2GWJA 3OTOJ 4NLPA 1SZPA 2YNFA 1KKHA 3SLCA 3Q8YA 3SPYA 3KLIA 1JJHA 3CIMA 4E3SA 1YTUA 2GELA 4OZ1A 1RWKB 5I3PA 2G0AA 1RU2A 2KU7A 3PNCA 1X4EA 2DEIA 4KN4A 4BRFA 3U3GA 4DL5A 4M3WA 4IQXA 8ICFA 2GMHA 4K43A 2UU9J 4X4QA 4EGLA 4BLGA 2GOLA 5EVZA 2QL5B 3GG4A 4YDUC 5DM6L 3WDOA 3ZDEA 3LH2S 5D77A 4LQ3A 4H4MB 2EBEA 2ZWPA 2HF4A 4ZOSA 1QQCA 2KN7A 2QL9B 1W2BM 3FJ2A 1WD6A 5AKEA 4MDAA 3WK9A 2RNEA 2WSEC 2EI5A 2AEJA 1WHWA 2B7BB 5D4LA 3VEYA 3CC4N 2RP5A 2L5YA 4C6AA 3OXGA 3R6LB 1RXVA 3VQBA 5AQRA 4K4HA 3CF5Q 4J9QA 3AJDA 3VQ8A 1JL2A 3NE6A 1S49A 2G13A 3GB0A 2XI9A 1Y0HA 3AM9A 3Q83A 3QUTA 4DQIA 3EXCX 5AQYA 1TMJA 1U9LA 3AQFA 1HBMB 1HNXF 2DR9A 5M1QA 1Y64A 3U7JA 3KTQA 3V9ZA 3PSTA 2KFYA 2DR5A 4M9GA 2WZ1A 2F8LA 4DSLA 1L3VA 3AA9A 4YDDB 4P10A 5TISU 4YR0A 2RD5C 2P5OA 3Q8MA 4ED0A 5L1KA 3TKAA 3OYCA 3OY9A 4B17A 4CFCA 4URQU 3AO1A 3TA2A 2UXCJ 3GR1A 4KHNA 5DZ7A 4JYAF 2N7YA 4DCJB 3DU5A 4BROA 2QW9A 3CFOA 4YY3J 2XY5A 2HLUA 1AYEA 3OL8A 3HP6A 3OL7A 4X62F 2FHMA 4Q0BB 4KTZA 4RW6B 1WBBA 9ICSA 2LA6A 1ZM3A 2A6MA 2KYZA 3MOZA 1DHMA 4TUQA 1VRUA 4YMOA 2BANA 2PE8A 1RTIB 3OUYA 3M8PA 3DM2A 2PIIA 4A2BA 2FMQA 3O9UA 2OEJA 1FNOA 1S9EB 3ZLJA 4JI7F 2KRBA 2WFBA 3MC1A 5H9FK 5HHIA 1OIAA 2IVOA 3O5TB 1SXLA 2KJWA 4LH5A 1T9UA 3D6RA 1WSEA 3ZZOA 2WHOA 3C6UB 2WF9A 3UIQA 3BKUA 3KWGA 3QEBZ 5CYQB 5CYJA 1Z2LA 3I8BA 2DNGA 1FDNA 5DZ6A 3N7RC 3NCIA 3UMCA 3K7RA 5AFUH 1L7OA 2W9BB 4YFUA 1U48A 5AKXA 2ABYA 1Q46A 1AW0A 3MFIA 1MQ2A 4GO7X 1KP6A 3C2LA 2HNZB 2UU9F 4CT9A 2HNZA 3CJ5A 3BPDA 2RQMA 3H5UA 3KZXA 4CF2A 3BY5A 3ZX0A 3NFAA 3TP2A 3O2IA 5GIOA 2DTUA 1VQMS 2O8DA 3ZNJ1 2PN6A 4PWDA 1L7NA 4XH5A 3N4QA 4PABA 2HMXA 7ICVA 4OKEA 3RGIA 5KQDA 2VICA 4ED4A 4DR2J 5EOYA 1S1WB 2ZGYA 4A8QA 4CGDA 4B3OA 4WYLA 2H3FA 5L46A 1Q79A 2PFNA 3OYLA 3AJ2A 3NUQA 2LQBA 5EY4A 5C24A 3VGMA 2CPFA 2OAUA 3DLGB 3SDEB 3CC4S 4ILHA 2F4FA 2MQMA 4CI0B 4B9VA 4ED7A 3CVKA 4JI5F 4WFBQ 1IBKJ 1UOCA 4YN4A 2HHPA 2XC9A 3EKUA 5HN0A 3L4PA 4N77A 4TYBA 4NXNJ 1S6OA 1X3MA 3QSYB 5FDLA 1JLBA 3DC2A 2MKHA 1TYQA 1BHLA 2V63A 3JSMB 2RRAA 5DDMA 1RI7A 3DI6A 3AVFA 3QFUA 2LP4A 3JPQA 3G82B 1X3NA 1RDCA 4IOCQ 1R8HA 3P4IA 4DQRA 4QZIA 2OPRA 1RCOB 1HNZK 3M9NB 2ZBRA 2HQIA 1QTMA 3M32A 3BDEA 2WCXA 1R8CA 5CB1A 3Q89A 1TAQA 3FRYA 4BRAA 5AQPA 2F4VK 3T1YJ 3M2UA 4BJQA 1TGOA 3TW0A 4OJ5A 1A6SA 2Y0SC 4WJBA 4NA1A 1IBLK 2VBXA 3A1YG 2YX8A 5C7PA 3F2KA 4YFKA 4KPYA 3D3BJ 4RNHA 1RT1B 2QB0A 3BBFA 2E5HA 1ZTWA 2VJUA 1K1SA 3RJFA 4LY7A 5CP2A 4Y2RA 1BO5O 3RRGA 1YLXA 2P9IB 1QTNB 3F2DA 4FFDA 4XPEA 1Y3KA 4MKVA 5AJ3F 1S22A 2CH5A 4AHVA 1AFJA 1E4GT 3JPNA 4CHNA 4CQ1A 2AXTU 3BSAA 3D2FA 4DR7F 1Y5NB 2DKXA 1GLBG 1XSLA 4DS4A 2C3YA 2KT3A 3EN9A 3HL8A 3M2UB 5L9XA 1AT1B 1WNSA 1S6UA 1HKBA 1EX4A 1F9FA 2P1JA 1HNWF 1ROFA 3QEVA 2PFOA 3THYA 3NGRA 4DV1J 4QWCA 2FGCA 1J5OB 2HOIA 4A62A 4IKAA 3KOOA 2DFHA 1LNQA 3FC9A 1TVRB 1SPBP 4U7UK 3D0PA 3UCUP 2BJDA 4QZCA 2GW8A 2ZOGA 3NCPA 3JPOA 3OW2R 3LM9A 4I67A 2VC1A 4JI0J 1IKVA 4UAWA 2KSOB 2WF6A 5ALFA 3PMNA 1FFGB 2QA2A 3LPYA 2FPMA 4XH1A 2NSCA 3QDKA 2V7YA 4CF1A 1GTHA 4Z0UA 3CJTA 5MAOA 4QR0A 4I0WA 4PWWA 1SGGA 2DK2A 2QJ3A 3V7LA 2DBBA 2HHVA 2AHOB 1TL1A 3AAWB 5D4BA 1O03A 2NQPA 2PT0A 2ZOFA 3M32B 4KV8A 1KQKA 2UXBJ 4FWRA 2QX0A 4I56A 1UEUA 1EQ0A 4ANCA 4K5SA 4DV3K 3QUCA 2V4RA 2LYAA 1BY9A 2DGQA 3L2UA 4RQ3A 3CDUA 3RMBA 2LM4A 1S1XA 3JB9k 1JJ2M 4CJFA 2LCWA 1DQ8A 4DLEA 2LDIA 4WU2A 4FYDA 2ZXHA 1CXUA 4YN3B 4LF6J 2ATQA 4Y2SA 4LR9A 3PX4A 5BYQA 5KFQA 3I32A 3Q8QB 1APSA 4KB0A 1BPBA 3QRRA 1CJUB 4TUSA 1IIPA 1SV0C 1I6JA 4CI6A 3PYEA 2O67A 2ZH5A 3C14B 2AWZA 1O1WA 4OD0A 2EANA 4RQ7A 2MGZA 2R2TA 1FRKA 4NL9A 3U1MA 4X62K 3RBDA 1WOQA 2P9NB 4QJVA 2GA7A 1XMQJ 2P9UA 2KMDA 5EXWA 1YG0A 1B99A 2OPQA 3LALA 5DM6Q 3X3UA 4OV6A 3KLHB 4K2XA 4E7JA 2KYXA 2OYQA 2GIRA 1GT8A 1LXJA 1X5TA 3C2PA 3KMQA 1M6YA 4ZTFA 5L1MA 3ITHB 2J0WA 5KFVA 2DXFA 5KFWA 1T6CA 3VQEA 2IA6A 2RIJA 1J5EF 2HFUA 2RDDA 3O4WA 1BIUA 5A8KA 1PC5A 8ICXA 4PAAA 2KK0A 2HMPA 3OSNA 1S6QA 2GFFA 5KT7A 1RQLA 2ZD1A 5AQKA 2ZD1B 1NPKA 3A0HU 3M3ZA 3VAIA 1Q9XA 3T5KA 1SL0A 3N0VA 1ED1A 4DFKA 3GFHA 2CIMA 4BRDA 4R63A 4P2MA 5L38A 1AB8A 2KE7A 1VQKS 3HHKA 2WTFA 4DV5F 4F0KA 4I2QB 1JLQB 1U8WA 1OUQA 1H6KX 3UB5A 5KFMA 2LQ8A 1XUPO 3THPA 4DV3F 4FK0A 1T4GA 4QW8A 1KN6A 1H73A 4DQPA 9ICVA 4OYIA 3T79A 2IIRA 5KFCA 3S3NA 2RKIB 3FFIB 2C42A 2M2BA 1U6BA 1TKZB 2BKPA 4QOZB 1VSJA 3MXHP 4QIGA 3RH6A 3W3SA 3NS1A 1E3MA 2DNMA 3AA5X 2KM8C 2QWPA 2ASJA 4US9A 1EETB 4P7VA 1JX4A 5D0EA 2BRKA 3KG4A 4H0YB 1CXQA 2RE2A 1BISA 1VQOS 3DLBA 4FW2A 2MQPA 1UW9A 1RGVA 2FB0A 4WCEL 3M6ZA 3Q8KA 2YKPA 4UATA 1SH0A 4OIXA 2LSNA 3QO9B 1RCXB 5HVFA 4LF7J 3A5NC 4GKJF 3D68A 5C24B 4DV1K 1N5VA 3IFRA 3BF1A 1N8RO 1TV6B 2BM1A 3DRPA 3SJHA 3F9MA 2NRWA 3B4MA 4AE5A 2D0OA 5B0BA 3LZJA 5CH7B 2DNPA 1N32K 5B0EA 4ID5B 3N97B 4P0PA 8ICZA 4U8VA 3ZETB 2NUUG 1KC8O 1RBOB 5I42A 4B9NA 2JX2A 3EXYA 3V4IA 1HUOA 2BVZA 2O01C 2EFOA 3KD1E 3Q0AA 3M2VA 1NGCA 2YTUA 1LOUA 2ZF5O 2WBMA 9ICPA 1OVYA 1A5XA 4WKYA 4FK2A 2F1FA 3DCAA 3CCQN 4MT1A 3AV9A 1SB6A 1RBUA 2W04A 5A2QU 3F53A 3I28A 3Q8UA 1VQLS 3CCJN 4CNZA 2C2OB 2WHEA 1OYEA 5KG5A 3HBTA 3H20A 3AO2A 2W2MP 4J9PA 4LBHA 4HEA9 1CJTA 4TU9A 4FVCA 3NWGA 2VOPA 4JI4K 2K06A 2XS2A 1QAIA 2GHWA 1HMVA 4JN4A 4A8XA 3Q8LA 2WOMB 3MCSA 1DZ5A 4AL5A 2VANA 5IV4A 2VFRA 2WOMA 2ZITA 1ITGA 3V4MA 4IOAQ 4ECSA 1KAZA 5AM4A 3SV4A 3B0XA 4CJ3A 4OKKA 1UEVA 1V5VA 2ASDA 1TVAA 3H0PA 3DM2B 1TL7A 2WONA 3DLJA 1N54B 2W55A 1NB7A 1Z05A 4KGXB 3H3OB 2CXYA 1MMDA 1G99A 3PTWA 3VQPA 4BQZA 1NGGA 5E0OA 1T03A 1NLKL 3IG1B 3NKYA 4UB5A 2NCKL 3WHIA 4JKFA 4JP8A 2Z4PA 3OTCA 4O3QA 1VK3A 4ZOHC 4WIIA 2BCRA 4XK8C 4IJNA 2PXIA 4X62J 4PKHA 4W98A 2V2ZA 1RHQB 1XMOJ 2C3OA 4C0OC 1XMQK 3K5LA 4USAA 1IJJA 2FLPA 5DG8A 5LSRA 5F3XB 1X6JA 3GP9A 3W9JA 5AK6A 3P5TL 4R0EA 4DL6A 2RH3A 2RT3A 1W25A 2CWKA 1PSDA 4UY8T 4DSFA 1F0XA 1HKGA 2IHNA 1S1VB 8ICEA 2JSXA 1GLAG 5BRDA 1GXUA 1N34J 4ZVGA 2HQFA 1XQIA 2YY3A 4DG1A 5KFIA 5HATA 1HX1A 5EE1A 4ITSA 3K59A 5LSLA 3HHLA 2M9KA 3P4UB 2QI2A 2XZTB 2VF3A 2FMSA 1NZPA 3EX7B 3H59A 1T3QA 3OV7A 3FAHA 2A1JB 1PK3A 4AL6A 1P9QC 4N7TA 1SQFA 3SUQA 4CECA 2YN4A 2QLTA 2VG6B 1HHSA 1JROA 5J2PB 3D2EA 3QMLA 1ZQZA 5C15A 3BPSP 5J2HA 2PC6A 4J8FA 1UW4A 2N4DA 3B82A 4RW4B 2NRHA 1KTVA 4Q44A 5FJ4A 1ICEB 1URRA 3L95X 4L73A 2FBTA 3EEQA 4PRFA 1SJQA 3IBPA 4Q8FA 1W7AA 1RAJA 4O8UA 4KH1B 1W9HA 3ULEB 2KLAA 2OTJS 1TKTA 2ZJPL 3B54A 4HHTA 2E5SA 3U02A 3LAKA 2B6AB 1SV4A 4QIFA 1Q78A 3BZKA 5AQUA 3JQKA 4OLAA 3BGLA 2OMLA 1T3VA 3I31A 4RW7A 1B92A 2APOA 3MFHA 2KZMA 1GXTA 3MEGA 1FRMA 1LK7A 3R7SB 2BE7D 4DV0K 4WFNL 1KCFA 1WUDA 1TL3B 2C22A 3BS5B 5J2FA 2ZG6A 2CPDA 3S7RA 2KKVA 2EDUA 2HRUA 1P9YA 4CJ7A 4UB8U 4F4XA 3HVTB 3W62A 3P6YC 1WN7A 8ICNA 2XGQA 4QZ8A 3TARA 3KHYA 4NLSA 2FMPA 2CWXA 2AJ1A 3OS1A 4OHXA 3UDEA 1NGJA 2JZ5A 4DV5K 2XWXA 4GKKJ 1QQ6A 3J8AA 1KLMB 3HPHA 4DFJA 3ZFVA 4BRGA 1BD6A 2Q1LA 3RYLA 1JJCB 1X9XA 5CXTA 4ZITA 2EPIA 2J8SA 4P0PB 2AGPA 4QBUA 2NNWA 2HWTA 4DR6K 5DQGA 1PBAA 5A8WA 3FZBA 3ISDA 2ZHAA 2RF2B 5JUMA 1N88A 1HYSA 2ASYA 5IILA 4JUZA 2VG6A 2OD6A 9RUBA 2D1KA 5DDOC 1K73T 4DCPB 3ZTQA 2H48B 4N56A 2B0CA 4J37A 4QR2A 5J1EA 2WF8A 4QWAA 3CDBA 4WP9A 3OVBA 5AQZA 2ZTEA 3VHQA 3ULHA 4DDFA 3GCWP 1DRZA 8ICCA 2V0NA 1RYRA 3NNAA 5D49A 1L7PA 3RRKA 3MM7A 1KEKA 2ODGA 4ZPTR 2NXJA 4OGCA 4NA2A 1F5CA 4OI1A 2CRLA 4MFBA 3M4XA 5D8HB 5EE9A 1U6ZA 4DN9A 3LF0A 3KKFA 4KHPJ 4CJUA 3D6JA 2I9GA 2A2CA 2CYYA 2OELA 2K2PA 4R5PA 4JI7K 4F2RA 2R7UA 1U09A 3N79A 3H42A 5M1FA 4KB7A 3JXUA 3GU0A 1ZQGA 1HI8A 5AJ3J 3DDNA 1SJFA 3N4WA 2HCFA 1RBVA 2B9YA 2K4IA 1WORA 1J6ZA 4LR8A 4JI6F 5IWAF 5C2DA 1CJVA 4B9UA 1T05B 4V19S 1WWHA 3AJ1A 3O08A 3ET6B 2GX8A 1LEOA 3NF6A 3MM9A 5GAEI 3T19A 3A8YA 4NV0A 2CZ4A 3RAMA 3TFRA 3DWLA 4M5KA 5LXYA 4CZKA 5BPMA 4A8WA 3IG1A 3TNVA 2JGUA 1CC7A 3IRUA 3T1YF 4QWDA 4CHZA 3GSIA 2W3RA 1SH3A 2Y9TA 1AUDA 2CQHA 2BZ2A 2FHOB 4A8OA 2R4FA 2KTQA 4PZNA 4O5KA 4IG3B 3D67A 3TA0A 5HOOA 1ZQSA 1JJ2R 2HEKA 3IMQJ 5D3GB 1BPDA 1IBLF 4WXOA 4X4SA 1WSHA 1KSPA 2W2OP 5M2UA 4YB6A 3ONQA 2OSRA 4K4WA 3D2FB 1X4CA 4O4GB 3MUMP 2G1HA 1NHKL 3H90A 4CFDA 3OYEA 4N5SA 1OPIA 3F56A 4GKKF 1FFVA 2HIYA 3TRGA 4KPCA 5ALQA 3EYZA 4FJ8A 4GVBB 1UVNA 1K1QA 3R27A 1C1BA 4DL4A 3TFSA 4DV2K 2Z2ZA 2V8VA 1SV5A 1Y10A 2GLEA 3PEHA 5L39A 2X6SA 5J2NA 3X1LB 2PFFB 3L5KA 1RAGB 3HFKA 4KQZA 4PPZA 2BE2B 4IJAA 3JPSA 2ZEJA 2JMGA 3AVKA 1ZPVA 4IFYB 2FLLA 4QIWC 1MWMA 2E2QA 4CGHA 2B3TB 4C48A 2D74B 2P6RA 3VGVA 3TUZC 4BG9A 2DGZA 4HL9A 1VJ5A 3ZEUB 1OH7A 2M8HA 4C8ZA 1T6DA 3IS9B 3L9ZA 9ICQA 4DV6J 4Z4FA 1RHJB 3N9UC 4IXCA 3AQOA 1RUSA 3PX0A 5JLFA 3I0SA 2VD3A 2F8MA 2XO6A 5AQLA 2QEXS 3GONA 3UCZP 4DX8H 2IRYA 3D7SB 1I39A 2GAGC 2F9TA 2KSOA 1NGHA 4RUAA 4BRMA 1VSHA 3VEZA 3O9RA 4DUZJ 1JI7A 1WUUA 4NLTA 1D9FA 4DTXA 4RBTA 2KIWA 4BRPA 4RPXA 3CULA 5M1KA 2UXDK 2VYPA 1IQZA 4CO2A 3VQAA 4EFHA 2EWHA 4CF8A 3BV8A 3SSRA 4DR4F 4IOBA 4KH6A 5K8OA 1KLMA 4HDHA 2LHTA 3QERA 1YBAA 1CZ9A 3K1RB 3SQ2A 2MB0B 1KRPA 1KQQA 3NWRA 4QIWD 4I4BA 2RS8A 4ER8A 4X4OA 1HIWA 2EZYA 6FDRA 4NX9A 2UUCK 1WAJA 5A0YA 2GIFA 4DR6F 3NRWA 2DFEA 2LECA 3EW9A 3QBCA 4YG2A 5CCLA 3IUCA 2P66A 1AUSL 1DQ9A 1JJ4A 2UUTA 1X9SA 4IH6A 1DQAA 4YMMA 1HEKA 2VH7A 4DPYA 1D9DA 2UVVA 1Y11A 5ALJA 2CPIA 2QLWA 1NCLA 4DU7A 2CGKA 2POKA 1B70B 4IQTA 1RHKB 3CJKB 3K5MA 2DPIA 1VRTB 3IM9A 5AJ3K 2QKBA 1Q53A 1HPZA 1LWXA 2WONB 1LW2B 3FKBA 3VERA 2COLA 1ZQIA 2VG7A 2KP7A 4DV4J 5K8NA 3WT0A 4F5NA 1RE1B 3A3PB 1PILA 1IV8A 3PW0A 3C3LA 3BEXA 4LJXA 4FE3A 4DUZF 4BC7A 4QZBA 2ZIWB 3I82A 3AHPA 3CCLS 1EQMA 3UXOA 2BW7A 2CQIA 3W9IA 1T11A 2I5HA 4QIEA 3H46O 4E2FB 3ZT2A 3KOAA 5CZXA 4ES1A 4O5CA 2WF5A 4FWSA 4LF4F 2BJ1A 2QWQA 4DU8A 1P7DA 2EW9A 2ZIVA 4KE5A 2W8LA 4OYXA 4CEAA 1R8AA 2J5AA 4C97A 3IWNC 1OMSA 2RHFA 3MCAB 4ZIWA 1XNQF 3C14A 1P8ZA 4DSJA 4GXKA 5F0WA 4CIGA 4WFNQ 4LFBK 4P73A 2WB1C 1CLFA 2HFNA 5EGYA 2ZUBA 1UP1A 2FVRA 3AODA 3EY1A 1D3WA 5AI5A 4F04B 2KO1A 5D15A 4DV7K 4EP5A 2JH7A 9ICMA 3W5XA 1YITN 2W6LA 1WF2A 2LKZA 3A8IA 4B1XB 3AEVA 2QYGA 2YQ0A 2PI4A 4XQ8A 1ZBFA 1U6FA 1I1GA 4CJPA 4DTSA 2HS3A 2P9KB 3H4DA 2J6TA 3AD9C 3QEPA 5IQQA 2GC8A 3O5BA 3VEVA 4Q8EA 3MWBA 4WQ4C 3EE9A 4NWIA 4IQWA 3AO3A 2KDOA 2QA4G 3L4BC 5ALZA 3J7YI 2HFVA 1VSDA 3IP0A 1QAYA 1ZBTA 2JH3A 3THWB 2IIHA 4KREA 5DDYA 5ALRA 1SQGA 3WKBA 3BYPA 2UV8A 3WKAA 2RILA 2OEMA 2E4LA 4LZDA 4LRAA 4JAXA 1UFKA 3AUOA 4UAZA 2AMCB 3RMAA 1O08A 5LMUJ 3PYFA 2FF3B 5HJXA 2GQQA 2H5XA 5D6GA 2KIVA 1X4HA 3A3NB 3KJNB 1I94J 3O1WA 2HQCA 2DJWA 3LQVA 2W9CB 2B43A 4FBUA 1IM4A 5A8KB 3FZFA 4CBWA 1ZBSA 2X1GA 1VLBA 3ALRA 5LJ5Y 2R8IA 4I27A 1XR7A 2ZQBA 2VUGA 3KK7A 3OD2A 1ATNA 3BZQA 5KG3A 3NLCA 2DRBA 7ICJA 3L3CA 4TU7A 3MDCA 4A47A 3NF9A 2FLNA 2H1YA 2E2NA 5J2GA 3HHLC 3DXMB 2AJ4A 3PJ9A 4HR2A 2EXUA 3SENA 5C2FA 2CN1A 1XN9A 3KNAA 3QNWB 3PIOQ 1H1VA 5G4DA 3OHBA 3DRSA 1K0VA 4IO9Q 1CBKA 3FCHA 2OEKA 2QMXA 4A5BA 4K50A 4PL7A 4HWIA 2CJYB 2VIHA 2Y9HA 2JVRA 3VQDA 4RBUA 2X6NA 2FD2A 4CD3A 3OYIA 3OS2A 1UHUA 1MMLA 2FC8A 4PUOB 3H2UB 3H25A 4YNQA 4FM2A 2PKEA 3T41A 3BQ0A 4EX6A 3MAHA 2MZJA 4HUEA 5KPRA 2QWLA 2F7TA 3GIJA 2R8KA 2IAJA 4C3KA 4DCCA 4DV7F 4MK8A 4X2BA 4DS5A 1S5JA 4CIFA 1CJKB 2WAQD 4BRNA 5BXIA 4B8AB 3L3UA 4BVOA 7ICEA 4Q2LA 4B02A 3SNNA 7ICSA 3DAWA 1KVKA 4DR4J 4CM0A 5IM0A 1U8SA 3JAMO 1YJNS 1T44A 2A2DA 3C28A 1RDFA 1YIJN 1NKBA 2L9WA 4TLRA 1YXQA 4LSLB 3AA8A 4NYOA 3IBWA 4WFAL 3KDOA 3M1YA 2OXOA 2X3GA 4MKYA 2E1PA 2OD4A 3S9HA 2OH2A 4AT1B 4BRIA 4TURA 2F40A 1UVMA 3M7DA 5IOLA 1LWFB 2QM1A 4QZ9A 4K25A 5HI7A 1JXEA 4OYAA 4A2AA 4CM2A 2A1JA 2OPPA 5AQOA 1RBRA 3M8YA 1DLOA 1NZBA 2YHAA 1QLNA 1QVFM 4MDBA 3CCVN 4JI4J 2J7WA 1H72C 1Q8KA 2FVCA 3B9JA 2HWIA 2B4JA 2GNKA 1BLUA 5AXLA 4K4SA 3VQ5A 4WK1A 5KFDA 5EWEA 4M5GA 1Z4OA 3DLHA 4AXJA 4PEOA 4Y2JA 1KQFB 1BL3A 2FZKB 1VQ8S 2WF7A 1U2CA 2JWKA 4I68A 1GEHA 3FZ2A 3MM8A 1JLCB 4DR1K 4CFAA 5CYMB 1RYUA 1Z00B 2A19A 2YX1A 4GY2B 4DR2K 2I6XA 4ECVA 2QGFB 5AZIB 4P6QA 3KDNA 3L6QA 1WLJA 4OVLA 3J7Z5 1N36J 4DTMA 1U2VA 2QLJB 3BYRA 4C3LA 2KVIA 1U1RA 5B0GA 1XMOK 5TKYA 3ZYYX 3OYAA 3LVVA 4DMZA 3OPXA 3BZCA 2AD9A 4CLTA 3EVOA 1AFIA 3BKFA 4JI0F 1T7PA 2V34A 2BGWA 4JI2F 4CO4A 1TV9A 3HVTA 2DY9A 4CJSA 4P4OA 4M5DA 1VRTA 4OHVA 4RW6A 4YXMA 4UB3A 1IWGA 1HPZB 2B5JA 1OXJA 1LKZA 4J03A 3M6WA 3EO3A 2ZJRQ 1BMQB 4D3HA 4ELVA 4ZLLA 5LT5A 4OJHA 4DV0J 1ZYQA 1VC5A 2KT2A 2KG0A 3O8WA 2O8BB 1MW7A 1WF0A 4CZMA 2F8KA 3BS9A 2QL7B 3G6XA 1HUXA 1ECWA 4DR7J 3ICXA 3DRRA 4FJKA 3BSOA 2FHKA 4O0NA 2E1FA 5T7LB 4OJRA 4AYBC 2YMLA 2OTLN 4DBQA 2YNHB 3CDEA 3MUVP 4Y1CA 3GJSB 3F5AA 3PKMA 3MCOA 1S48A 3F5TA 2F65A 4P2FA 4PZVA 2MQNA 4OJ1A 4JV1A 3DGPA 5ITHA 3UNGC 2GBZA 4BHQA 3O1LA 3GIIA 5EDWA 1NAQA 1S0MA 3J7A1 1GTEA 5LY3A 4OZ5A 1GLEG 1HQUB 4ZVOB 4KMOB 5F8IA 8ICRA 4DV0F 2NO5A 3CC7N 1BQMB 1VRQC 2JEFA 3AGKA 4IRDA 1XMBA 4H4MA 5CHGA 4FOIA 2E8AA 2ZM6J 1PYTA 2HPUA 4RQ8A 2LEAA 1NEEA 3ZX3A 1XIQA 4CGFA 1QZ5A 4B3RF 1KBRA 3CCUN 3C16B 3RTVA 1FT8A 1R3NA 3C21A 4ZVQB 1VQ4N 4FYVB 4CFBA 3EZ5A 1FJGF 1CVJA 3CP8A 1EZZB 1ZBLA 2H3ZA 4J9LA 1WKKA 2W4PA 4Z94A 5JS1A 1ASWA 3G10A 1COOA 1VK0A 3ZDAA 5HLFA 3TAEA 2R18A 4DR2F 4Z4CA 2F7VA 5M2RA 2PMZD 3GG1A 4FPRA 4ZVHA 2MZQA 2XEXA 5DRKA 5E3CA 5ALVA 1ZQFA 2E2PA 1N36F 2UUBF 2V2KA 1RT4A 5KPTA 5AQMA 1BU6O 1NDCA 5JU5A 3OGUA 2ZDOA 3AVAA 2A1RA 1T95A 4C8LA 1HJPA 4XAKA 4I2FA 2W43A 2EHGA 1NK0A 4Z2XA 1ZQRA 2B6AA 4I1TA 4M7XA 4NI2B 2A1BA 3CJ4A 2XVTA 4LFAJ 4UB2A 5ETVA 4JI8F 2Z1JA 1BQXA 2P9SA 3SQ4A 4OZ2A 2Y1JA 2BDUA 2VKQA 3H6EA 2D9OA 2ATCB 2HFSA 4KLOA 3KG1A 1SIJA 1OJ4A 1RTJA 4X4TA 1N60A 2EFPA 4DX7A 1S59A 2HHHK 1BQNB 4LBPA 2KXHA 3GYGA 1YZ6A 1SJ3P 7ICTA 1S9FA 1HA1A 1VJWA 3GFYA 2AKWB 2KQ2A 1F2HA 2BPGA 1BQMA 3C5FA 1KKXA 1UCVA 1RTDA 4YD2A 3FM9A 2V4QA 3AAQA 2CH6A 2YNIB 1XERA 3E1YA 4S0MA 4AH9A 2HHUA 4NM2A 1NH7A 3SV3A 2WB1F 4M5IA 4F71A 1VCTA 2MJUA 5BPCA 4JKEA 1O8BA 3QIDA 5IIIA 2QMUB 4BVPA 2W40A 3FZKA 1GLCG 5HRSA 3SCIE 2FZCB 5KNIA 4FJGA 4HACB 3P39A 2CJAA 2V4JB 4G3IA 4NXMF 3QXGA 2P9PB 4RBVA 1XO0A 4F5OA 2PA8D 1RWUA 4YY3F 1RT3A 2V5HG 3P31A 3VF6A 2E1CA 2IHR1 3MTKA 3PCOB 2VODA 5HR7A 4O3RA 3QJLA 3KLEA 3QUQA 2ZJ5A 2JEJA 3IR5B 4TVAB 4PKGA 8ICBA 1TELA 1XJWB 2XS7A 3KJVA 2HK3A 3WNGA 2A6AA 4JD2B 1WYGA 1ZQWA 5AQWA 3PZPA 3LDSA 3R7BB 5CZ1A 1FX2A 1SZ2A 1FJGJ 9ICKA 3US5A 5JVGL 3C95A 4Q2MA 3HWTA 4DU1A 3UKUB 4I7FB 1HWIA 2JXJA 3V5RA 1XO1A 2H5EA 4IG0B 2WVEA 5AIAA 1IJFB 3D3CJ 4IEEA 3OYJA 5KOWA 4GLXA 3AXMA 1HWLA 1IG8A 2CNLB 3LOUA 4P9SA 4ZDNA 1C0MA 2ZFHA 3ZCMA 5C12A 4B9SA 3LPTA 3EE3A 2DFFA 3DV9A 1TUYA 2F1HA 3MN7A 1AXQA 2A42A 2L9NA 1SKWA 4FKXA 3HSCA 1BCOA 2CJBA 4OJLA 4DV6F 5LL6d 1K8KB 1X42A 4JI1F 2MGZB 1GX5A 3CCUS 2DGVA 4Z4IA 5ALLA 2XMTA 8ICYA 2LXFA 4FDFA 5CR0A 1OSCA 1NGFA 3ZT3A 1NHVA 1PYSB 3IV6A 2HBQB 3J7AN 1YI2N 1KQGB 2HI0A 3OJUA 3CCSS 3QAEA 3W63A 1VS3A 4JWNA 1O0PA 2W9BA 5AQHA 2D4WA 3WNHA 5J2IA 2HGNA 1U0HB 2A40A 1HNXK 2V8GA 2M5YA 4I6WA 3TAGA 2FHJD 3BB5A 4ZJOA 1B4SA 3ZNUA 3WNEA 4IQMA 4RCHA 3B78A 4CP5A 1N32F 2VBYA 4C4RA 4L3QA 3AA3A 3VESA 2NRXA 3SIPB 3VMFB 5A76A 4LF5K 4O44B 3UDLA 4J9MA 1Z1ZA 1FTRA 3W64A 1ZH5A 3JAMY 1KAXA 4CF4A 2OFGX 5LSOA 3QIOA 4EYIB 4Q0BA 3NEKA 2HWHA 2HVHA 3OVSA 2P35A 2WAQC 2RB7A 2KHCA 4OGEA 5FRMA 4HI2A 4C4SA 3SBGA 4BY9C 2RRDA 2E66A 4ALZA 4YR3A 4WFBL 1MSWD 1YJVA 1S0VA 2F8HA 1XBWA 3MGIA 2J0SD 4CF3A 2EFQA 2HGLA 4K4TA 2F8TA 1LV5A 4K4UA 4NLNA 2EK1A 3BUZB 1YHQS 4M5NA 3D4JA 2IVPA 1S12A 2UZAA 3I0RB 3UXNA 3NASA 2Q2RA 4GW6A 4ES2A 5DQHA 3MGHA 1IKXB 4H4OA 3G6YA 2HURA 4OI3A 5ALDA 2BCUA 3CCMN 5G0RB 4KHRA 4W5RA 2VG7B 2Z2MA 1D5AA 4JS5A 2FLOA 3LDOA 3MEDB 4UAUA 1WHXA 2H54B 2QSFA 5FLXO 3G8SA 2FSKA 3QE9Y 1NJYA 1N34K 3KK1A 4DKWA 2L3MA 4LF2A 2E5IA 4ZCKA 3OR2A 1T03B 3W66A 3NOCA 2XTJP 1WOPA 3M30B 1C0TB 3CUNA 2CZVC 3UPQA 1ZD2P 2JWLA 4PHPA 3G8QA 2DTJA 2KFNA 1RADB 3DXSX 1NLVA 2VG5A 1K6YA 5DK5A 3O4NA 1FJGK 4CO1A 4O3NA 3H8MA 1Q5VA 2WBNA 5LM7E 3M8PB 3CCZA 4KLUA 1S9EA 5F8LA 3MEEA 3AT1B 1VQ6N 1W2IA 2WBRA 1BC6A 4NRTA 4CLYA 5I3UA 5BOLA 3QGHA 2FJBB 4CZGA 3W2WA 2AGQA 3T1HF 1Q86O 2ZZTA 4JK8A 4PGQA 1FEZA 3BR8A 3D5MA 1FO1A 5HR6A 4A5AA 1WG4A 2F5GA 2R8JA 8ICVA 3CCRS 3HKZD 3SXLA 2D0CA 8ICPA 4CZFA 4B1VA 3L2RA 4CO5A 3TTCA 1MQ3A 2VA2A 2DH8A 1BHNA 5AI4A 1HNZJ 2ZBIA 2OTJN 2RUGA 2MJNA 4O44A 3MMAA 5BRHA 2W03A 4FK4A 1UCNA 1IG9A 3MMAB 1WCNA 1YQHA 4QWBA 1SC3B 5K14B 2BPFA 2DNRA 4WF9L 5DQIA 1LAWA 4R5PB 1I94K 4A8MP 3NCRA 4AHCA 1PJ7A 5KT6A 1BNPA 1YJNN 4OJGA 4X4RA 4W90B 1FNMA 2D7SA 2RJZA 2OP5A 1UWAA 3MTJA 4GKKK 1HNXJ 4ILMA 1G3OA 3KMSA 1LK5A 3D7EO 2MHEA 5FLXY 4CBXA 2YHXA 2D3ZA 4CJ5A 2G8IA 1G6BA 3VAJA 3NMAA 3LAMA 1IKWA 1WAFA 1XNRJ 3R8EA 3TZXA 3MURP 2KOBA 1N63A 2EX3A 4HTUA 4LZGA 4N8OA 2YTCA 2OGUA 2N3LA 2A41A 5JICA 2BJ7A 7ICNA 1U7LA 2DHXA 4Z4HA 3LP1A 1FNXH 2RQCA 2AYGA 1R59O 3TTFA 3FEYB 3ISZA 1A77A 4DR1F 2CKWA 2A18A 3N01A 1HNWJ 3NTUA 4OJ6A 1WC6A 4NCGB 2RE1A 4QOTA 2DD8S 1KVBA 3ZX2A 4PG6A 5HBMA 4O0JA 4GMKA 5ALOA 4B9MA 1UJ5A 5AI0A 3LGHA 1N34F 4FKYA 2NUBA 3ZTPA 3F9KA 1MU2B 2ZWOA 4KHWA