3TAQA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3taqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3taqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3taqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3taqA01
3KLFA 4YMMA 4ELUA 2DPJA 4Y1CA 2XY5A 3GIKA 1UT5A 4KV8A 1TL1A 5IIJA 9ICNA 1C7YA 5KFYA 3HM9A 5BOMA 1KLMA 4CJUA 5KG4A 4IKFA 1TV9A 3GIMA 4CF1A 4Z4HA 4FK4A 1C1AA 4E0DA 1S97A 4FM0A 4FZXC 5KG1A 4FLXA 1HQUA 5J0WA 2MUTA 3MXMA 3AUOA 1TAQA 1LW0A 4DSIA 4DG1A 3JPTA 1WN7A 1LV5A 3AO4A 3UQ0A 2BCQA 4P2HA 3DMJA 3ZD9A 3RR7A 2ZUDA 3UPQA 3TAQA 2ITGA 3MR3A 1YVUA 2FPLA 4DL7A 4DFJA 7ICIA 1TKZA 5HRPA 2NRWA 3GV8B 5J2IA 3SNNA 3RJHA 3THVA 5J2KA 3QEWA 4AHSA 1SKSA 4QWBA 4C8NA 4FW1A 2P6UA 3VQ4A 8ICLA 4I2IA 4I28A 1D8LA 3JPOA 3V4IA 4Z6CA 3PW2A 1SV5A 4J2DA 3C2LA 2JEIA 3HX0A 2IOCA 5DLFA 4DS5A 4ECYA 2KFZA 4DSEA 4C8MA 1X9WA 1LAWA 4E7KA 4KHNA 3RBEA 3U3GA 4LZDA 3ZSXA 2DTUA 3B6PA 4I9LA 3SCXA 1ZQUA 3VQAA 9ICUA 5DB6A 3RMCA 4CJFA 2HW3A 1RTHA 5IIIA 2A1JB 1TVRA 4CGIA 4ID1A 1LWEA 1RDAA 2BQ3A 2E6MA 1HPZA 3AVLA 1RBVA 4R65A 1N56A 1NK0A 2IAJA 1R0AA 4ICLA 1TGOA 1U47A 1D8YA 4LSNA 5TZVA 4LY7A 4FZZA 1N6QA 4FS2A 8ICSA 1S1VA 4CHYA 4JS4A 1IKVA 3Q8QB 2BKEA 2EX3A 1UT8A 3DOKA 3TR8A 4ED3A 1QSLA 4DU1A 3O4QA 2QXFA 1C1BA 4K8ZA 4R66A 1O1WA 2PFOA 4K4GA 2HVHA 1BPBA 4HUFA 1TKXA 3V81A 4YNQA 1RT2A 3AVIA 2G8FA 4CJ3A 4BDZA 2GBZA 3QNOA 3OYNA 4FJ7A 4NLKA 3ZCMA 3GIIA 1U4BA 1X9MA 2E4LA 4QWEA 1TK8A 1D9DA 3L2RA 2IBKA 5D46A 9ICCA 1CXUA 2OPRA 4NLGA 3ETLA 4TQSA 4B8CA 4FJIA 2F8SA 1Y88A 2IDOA 1XWLA 1C0UA 4M2YA 2OPQA 4DTMA 5J0RA 7ICUA 3V1QA 4KHSA 2H5XA 4IFYA 2KQ2A 3RB0A 5EWGA 3I0SA 4O3SA 5KFSA 2Z1GA 5HMLA 4Q8EA 2HHWA 2W9CB 2I1QA 4UB2A 1ZQCA 2XGQA 3C5FA 1XO1A 1L3VA 4IG3A 2KZ3A 3PY8A 4J9KA 3RRHA 4RQ7A 5KFAA 5EOZA 3M8RA 5HBMA 1EX4A 4KLDA 2HHTA 8ICPA 1ZQPA 3ZT3A 3AO1A 4GLXA 5DG9A 3S9HA 1TL3A 1ZQJA 4BWJA 2UVWA 4PPXA 3K58A 3OY9A 3P1GA 5KTQA 3RR8A 1A77A 1JLAA 4GXIA 4RQ1A 2P51A 1DLOA 2IS3A 3DM2A 5I3UA 4J9MA 1TVAA 4E7JA 4AHVA 4BE2A 1X1PA 3SUPA 1B92A 3PNCA 3V9XA 2C28A 3KHLA 3JPRA 4RZRA 1NOMA 3MFIA 1RNHA 1WSJA 3UXOA 3PR5B 2G8HA 3PW0A 4CIGA 4DTSA 1RILA 3NF8A 1L3SA 5L1KA 4Z4FA 1HJPA 1UAXA 3MR2A 1C1CA 1HYZA 1ZETA 1RXVA 3NGYA 5KGXA 5J2JA 3HPHA 4N56A 2HHUA 2YNGA 1N48A 5KFRA 3MBYA 1W9HA 2VA8A 3V7KA 4KTZA 3BGRA 3V6HA 4I2JA 3RJKA 4MF2A 3L8BA 5DQGA 4OKEA 3O4NA 3ISCA 2AJQA 1ZBFA 2AQ0A 3B0XA 1UA1A 3M9MB 3KJVA 1SKRA 4ED6A 5J29A 1ZQHA 3HPGA 4KN4A 1QQCA 4H8KA 2IHNA 4O4GA 2XRIA 3L2VA 2VG5A 5J2EA 1ZQMA 1ZYQA 9ICTA 3MGHA 1JLQA 3BQ0A 4CJWA 3BQ2A 5HMMA 1VSMA 1RTIA 3PO4A 1HNVA 2KFNA 2FPMA 5J0SA 1Z26A 5KFGA 4FVMA 5J1EA 4F50A 2FBVA 4DTPA 4EP5A 2B4JA 4RQ0A 4CIFA 3ZSYA 5KGWA 2ISPA 4AHCA 3H40A 2P6RA 7ICMA 4CESA 1NKCA 2ZUCA 1JLFA 2PFPA 5KFDA 4RQ3A 2F1JA 1RT4A 2PI5A 5KG3A 4Z4CA 4OVLA 1IM4A 4CECA 4GVMA 4FW2A 3NDKA 4B3OA 3OHBA 1I3AA 3G0ZA 2W9BA 2JLEA 3OYKA 2XC9A 4YFUA 4ECWA 3K75D 1A76A 5HROA 1H38A 1D5AA 1T3NA 3AVCA 4NLNA 5FRNA 1NK7A 4QZ9A 5FDLA 5KFIA 2XO7A 3OYMA 4CJ4A 4KLMA 4RG8A 2V9WA 3TFSA 3OYDA 1J9AA 4BXOA 5J2HA 4EBDA 4E7LA 4ZTJA 5CWRA 4QZIA 7ICRA 5KT2A 1NJWA 2AGQA 4EYHB 3NGIA 5KFJA 1RT6A 2BE2A 4YR3A 4EBEA 5KFPA 3ZT0A 1LW2A 4EBCA 2EHGA 4YFKA 2PFNA 3K5OA 1RPLA 4DTJA 3PW7A 1T03A 8ICMA 1IG9A 2ISOA 1T8EA 1CXQA 1KCFA 4CEFA 3S3MA 3HT3A 3OYIA 3H8JA 4NXZA 3ASMA 4LZGA 4M3ZA 2W8KA 3LP0A 3QEVA 4Y1DA 4DS4A 3L2UA 1XHXA 4FBUA 2Q3SA 2YHAA 1NK4A 5JS1A 4PGQA 2B6AA 4H4MA 3JPSA 3RMBA 4QZBA 2J6TA 4E1NA 4DTUA 2WTFA 4HCCA 4CGDA 1A5VA 1X2IA 1G15A 4KLTA 4Z6DA 3DRSA 4J9NA 4O55A 2VWJA 4PHAA 1TKTA 5HRRA 3GILA 4QZEA 3MXIA 2Y1IA 2I5JA 2ETJA 2VA2A 4OLAA 5KFNA 3DLGA 4UB3A 4QZCA 3ZDCA 1U04A 1U49A 4CGHA 5J0QA 3PW4A 9ICAA 3OYAA 3WNFA 2X74A 3U3YA 4KITB 4ELVA 4MFBA 1SUQA 2OPPA 4NY8A 2YNHA 4M04A 4M3YA 4K4HA 8ICKA 4J2EA 1YTAA 4UB4A 2G8WA 5F9LA 4P4PA 3ZSWA 4GW6A 1ZBLA 4FJJA 4HUEA 3U6FA 3MABA 4CFBA 2G8KA 5HRNA 3OYJA 8ICHA 5I42A 1KSPA 4CJTA 1GOCA 4YP3A 4KHYA 4B08A 3VN5A 1ZQEA 4CF9A 5T7BA 1JX4A 4KLSA 2IHMA 2W8LA 5EWFA 1Y97A 2C22A 3AV9A 4FJKA 8ICZA 4UQGA 4CHNA 4ZH4A 3MFHA 3QERA 1S1UA 4KO0A 4DF8A 4BACA 3I0RA 7ICHA 4LH4A 1IH7A 4RNMA 4RNNA 2YV0X 1IKYA 4O5BA 3Q8MA 2BDPA 4ZHRA 1NOYA 4ECQA 4IQWA 4YD1A 1S76D 2XY8A 4FJ9A 3H8SA 4Z4EA 4F5PA 3OSPA 4CK2A 4I2HA 5SWMA 3BDPA 5J2AA 5DKWA 4IFVA 8ICGA 1UOCA 1BI4A 9ICFA 2HNDA 4CHQA 1T7PA 1JLGA 2ASJA 1RT1A 4I7FA 3AVBA 2QKKA 9ICGA 4F5RA 4YN4A 4C8LA 3ZDDA 2C2EA 3RB6A 1LWFA 2HMIA 2RF2A 3K5MA 5CP2A 5D4BA 4XIUA 4CF8A 4OGEA 3M9NB 1A5WA 5J0OA 4RUCA 2W42A 4RQ5A 2R8HA 1RXWA 5FROA 4DL3A 2P1JA 4CEQA 5CZ2A 3DLHA 3ZT2A 4NLZA 3JPPA 1EKEA 4C8KA 1WCNA 3D0PA 1FK9A 3K4GA 4FJMA 5CHGA 3LANA 2ASDA 2FC0A 3NFAA 4M6WA 4IQTA 4FZYA 1LAVA 4CJQA 3LK9A 1SKWA 1JLCA 3RJIA 1XS9D 4K4IA 5KFCA 1WAJA 2FLPA 4YMNA 5C42A 2BCVA 1JXLA 4P4OA 3QLHA 2PYLA 2BGGA 5KFZA 3KD5E 3C94A 3GIJA 3NH2A 4DMNA 3LPTA 2YKMA 5J2PA 4FS1A 3AA5X 4I2AA 4R5PA 2OWOA 5C24A 3AO5A 4AH9A 2DFHA 4NYFA 2KZZA 4RQ6A 4FLZA 1XI1A 3M9OB 4Q44A 2NUBA 8ICQA 2C2RA 1CZ9A 5J2NA 2Y1JA 4FO6A 3ZDEA 3EY1A 4YD2A 5HHHA 2MAXA 3HO1A 1JN3A 3RBDA 4IG0A 1NK6A 2ASLA 4KHUA 3TAPA 1N5YA 1KVBA 3TI0A 3G6VA 4W5NA 2BANA 3N97B 3B6OA 4BGDA 4KLQA 4FJNA 1T05A 1MC8A 4TUSA 3GV5B 5KFTA 4JLHA 4IQUA 1PZNA 3SPZA 4NCBA 3KHRA 4FBTA 4AHUA 5HLFA 2OZMA 2NRVA 4RT2A 4IRCA 5J2GA 3RH5A 1DTTA 4M9JA 3AVAA 4O0IA 3C5GA 2XGPA 4M45A 1ZQVA 1K6YA 4O9MA 2O4GA 3M8SA 3FFIA 1QLNA 3LZIA 2AGOA 1S9FA 1GOAA 2JEJA 3LP2A 3HVTA 3VQ9A 4M3WA 2DY4A 5J2FA 4MQ3A 1EXNA 3FDSA 3CFRA 4F4KA 4NCAA 1BHLA 4GMJB 2A1JA 1KVAA 4KLUA 2IGIA 4NM2A 3OJSA 4RW9A 4B9SA 1Z25A 3AO2A 4W5OA 1ZQWA 4I2CA 3AVMA 4NYNA 3PO5A 2HVIA 2DFEA 2RDJA 2AGPA 2FLNA 3WNGA 3SPYA 3HXMA 1FKPA 2V4RA 1ZQRA 4WE1A 2UVUA 2JZBB 4I2BA 9ICWA 4JV2A 1BPDA 2QKBA 1S1XA 8ICYA 3EWAA 4DOCA 3TAGA 1I39A 3PMLA 8ICBA 1BCMA 3V1OA 4O3RA 5DGBA 1QSYA 3DRRA 1XSLA 4B9LA 4TUQA 3MDAA 2P66A 4RPZA 4O3PA 9ICBA 4QZGA 1TFRA 2NRZA 4UAYA 4PHDA 4KLIA 3QZ8A 1UA0A 8ICAA 4CK1A 3VA0A 4E3SA 2HHVA 4J2BA 1A5XA 1S6PA 4ED2A 2UVVA 5DMRA 3Q8RB 4DTNA 1VSKA 1DGSA 9ICRA 1ZQFA 4W5RA 5KI6A 4DTXA 2FPKA 4TSXA 4OKKA 3ULDA 4QW9A 3GV7B 1BGXT 4Q5VA 2W9CA 1S0MA 7ICSA 3N4MB 4RW8A 2DFFA 4CGFA 5D3GA 3ALYA 1RTDA 2ZJAA 5CY4A 1ZQZA 1NOZA 4O3QA 4BWMA 4KB0A 1YT3A 1T4GA 5J0TA 1BL3A 3DLBA 4FJ5A 4KLGA 1XSNA 1MSWD 3HVRA 4DO9A 2RKIA 3OSNA 4QCLA 4N47A 2P5OA 3EZ5A 2PFQA 3Q8LA 4PH5A 3NBPA 3IRXA 4PA1A 3RWUA 3DOLA 4FJGA 2OZSA 3QINA 3KLHA 2R8KA 4F3TA 5KFHA 3AVNA 5C5JA 1MU2A 4UBCA 1RZTA 3VQ5A 1L3TA 5IIMA 4ECRA 5SZTA 1YTUA 4O5KA 3V9ZA 1SL0A 3DLKA 2BCRA 1JIHA 2R8IA 3CFPA 3PVXA 5EWEA 1WSGA 4O44A 5KT3A 5J2CA 4ECVA 4I2QA 4JK1A 4CJEA 4XUSA 5HP1A 2B21A 2F8TA 3VQ6A 4M9NA 4DEZA 9ICQA 1WSIA 3OYFA 4R8UB 4KLOA 2ATLA 1BPXA 3SQ4A 2M9NA 1CZBA 1RDCA 3G6XA 3T19A 1Z00B 4ECXA 4CJRA 4F5QA 3DRPA 5DQIA 2VA3A 1S77D 4I2PA 2D5RA 4AHRA 3Q8KA 1ZJNA 3V9UA 1BQNA 4CEAA 4OGCA 3MXJA 1NJZA 5DDMA 3ITHA 4J9OA 1CEZA 2YKNA 1RBTA 1ASUA 4PY5A 3QETA 4YMOA 1TV6A 4J2AA 4FCYA 4BDYA 1V9PA 3OS1A 2V4QA 3LDSA 4CHZA 2R7YA 2RPIA 4FJHA 2ZUBA 5JS2A 3K59A 3SJJA 1EP4A 3M8PA 3SV4A 3KHGA 4J9SA 2X6SA 1ZQOA 4CE9A 1S9GA 5IINA 5KG2A 1K1SA 3QEBZ 3QESA 4E7HA 2Z1IA 2W9AA 4DOBA 1RDDA 3ISNC 4QZ8A 4GXKA 3PX0A 3QNNA 4M9HA 1IKWA 4FK0A 1JL1A 3RJGA 7ICJA 2XHBA 3ORYA 3OGUA 2AQ4A 4E89A 1VSDA 2VANA 1L3UA 3O3FA 1IXRA 3ZT1A 5J0YA 3VQQA 4E1MA 4MFAA 1B9FA 5DB9A 3TAFA 1JMSA 4GXJA 4H4OA 4KLJA 2ZE2A 2NRTA 1Q8IA 5KFKA 3ZSQA 3V9WA 3LALA 1BPZA 4PGYA 3KKSA 4I2DA 3C95A 3QE9Y 1SL2A 1NJYA 1KLNA 4DOAA 4CGGA 4RPXA 3T5JA 4OPKA 2HHQA 3B0YA 1B43A 4KTWA 2XY6A 7ICFA 4CEEA 1HYSA 7ICLA 3OYLA 3ZT4A 8ICOA 4TQRA 1TKDA 3WNEA 2D0BA 7ICNA 5DB8A 9ICIA 3HK2A 1WSEA 5IIKA 3K2PA 5L1IA 4Z4IA 5J2MA 5HRSA 4JS5A 4N76A 2OPSA 3WNHA 1K1QA 1ZQBA 4B9MA 3VQEA 4FXDA 4CJSA 4PHPA 5J0XA 4F92B 1FKOA 4R63A 2KN7A 4MEYA 1JLEA 4KI4A 4MF8A 1ZQGA 4NCGA 3MAQA 1BPYA 1WSHA 4DQSA 4FLUA 2ZD1A 2VG7A 4AHTA 2PXIA 2LYHA 3K5NA 9ICPA 9ICVA 4YXJA 4KN7A 4O3OA 2C2DA 3RJJA 4ED0A 3NH0A 4ED8A 1TK0A 3C21A 5DBCA 1L5UA 5KT5A 4QAGA 5CA7A 1RTJA 3LAMA 4ED7A 3C6UA 4FYDA 4MEXA 1RYRA 4W5TA 5HHIA 3P5JA 4P4MA 1KDHA 4CF2A 2XCPA 2X6NA 3JPQA 5FRMA 4QOZB 2OA8A 3LDAA 3RJFA 4XA5A 1WNSA 2FLLA 4KHQA 2J6SA 4ECZA 1GOBA 3EPGA 3BJYA 3ISBA 4OPJA 5CB1A 3AU2A 3EW9A 4C8OA 3PUFA 1X9SA 1HYVA 3MGIA 4GC6A 9ICXA 2YHBA 3QEXA 3TARA 4EP4A 1ZQSA 4FM1A 4RQ2A 5J2BA 5D49A 3SQ0A 4MFCA 2MUTB 4DQPA 3HPOA 3ISDA 1U45A 5E41A 4KKOA 4EYIB 3TWHA 5DBBA 4CEZA 4ECTA 4I27A 1KFSA 1HJRA 8ICUA 1WAFA 3PV8A 3C2MA 3C2KA 3CM6A 3OVNA 4CCHA 5KT6A 3RMDA 3AA4A 1KFTA 4DU4A 3KKRA 3PW5A 4CF0A 1C0TA 4R64A 2XY7A 3OJUA 4KLEA 2RN2A 9ICJA 3T3FA 3MEGA 4BE0A 3KK2A 3O3HA 3Q8PB 4DL6A 4UBBA 4HVJA 1S10A 4OJRA 3RB3A 4PUOA 2YNFA 4Z6EA 3UXPA 3AO3A 2VWKA 4TUPA 9ICKA 3KD1E 4I9QA 1ZBIA 3RTVA 4M3TA 4QWCA 4B9NA 4F4YA 4GC7A 4IBNA 5KRSA 1ITGA 4YR2A 7ICEA 1BPEA 4FJ8A 4TURA 1AROP 2HNYA 3NAEA 1REVA 4HYKA 5KG7A 4W5QA 4YR0A 1S0NA 8ICWA 3T5HA 4UAZA 4JRPA 4JV1A 3JSMA 4E7IA 4CFDA 4RW4A 4YG2A 4KRFA 4CGJA 3AVFA 1RT5A 2ZTCA 1KEJA 4LD0A 4CIEA 2W9MA 1NK5A 1ZQTA 7ICKA 1DTQA 3HP9A 2A1SA 2HHSA 5J2QA 5KFEA 4FLVA 3RH4A 2KW4A 5KFXA 1WLJA 1XC9A 2BPGA 3NGDA 4N41A 4FLTA 3MR6A 3IG1A 3S3OA 1HMVA 4EZ6A 1RDBA 4N5SA 1NJXA 1UWBA 3NCIA 2BPCA 3HYFA 1S6QA 4RPYA 1XSPA 3EYZA 4HUGA 2ZJ5A 2J6UA 4KLLA 4DL4A 2ZJ8A 1J54A 3ZSVA 4QW8A 5KFVA 3DI6A 3V6JA 1S1WA 1S0OA 4DWIA 3SV3A 3H08A 4BE1A 3SZ2A 1S5JA 3OYGA 1JL2A 3NGZA 2FMSA 4IDKA 1KRPA 3OYBA 3V1RA 4F3OA 1IO2A 2ALZA 4DQQA 1NK8A 1NK9A 3VQ8A 2GWSA 1TK5A 4RUAA 3QEAZ 3KK1A 4LVSA 3ZD8A 4DFMA 4I2FA 2Z1JA 4M3XA 8ICTA 3VA3A 1NKBA 2BQRA 3PX6A 5F9NA 5DDYA 2D0CA 1VK0A 4RW7A 1BCOA 4CK3A 5CYMA 4JUZA 1COOA 3OS2A 2FMQA 3RAQA 3QO9A 4RNOA 3KHHA 4DSFA 4CFAA 4JWMA 3AA3A 1WCLA 4J9RA 5KG5A 5L1LA 4DL5A 3SUOA 1BISA 4XRHA 3TFRA 3NF6A 3FYHA 4I2EA 1BIUA 5IIOA 2F96A 1QE1A 4IR1A 3GFKB 3C1ZA 1BIZA 4KFBA 1ZQDA 4Q8FA 4M3RA 1SL1A 5CYQA 1HRHA 8ICFA 4AILC 3AVJA 4F4WA 4RW6A 4CJVA 4Q0BA 3VQDA 3F9KA 4F5NA 3PMNA 4QZHA 1VSEA 2GUIA 4CEOA 5CZ1A 8ICNA 1MQ3A 1J5OA 2X78A 5L1JA 3IM1A 4IRDA 3TAMA 1SZPA 3KIOA 3DYAA 1ZQKA 2ATQA 2BQUA 4DTOA 4FJXA 4B9VA 1IKXA 1HQEA 4FJLA 5DBAA 4EEYA 3SQ1A 4PHEA 2KTQA 1B9DA 1VSIA 4RQ4A 1JXEA 3V9SA 4F4XA 2WOMA 1ZBUA 3HW8A 3NH1A 4MFFA 3MEDA 3I8DA 2B5JA 3AVKA 4PGXA 3CM5A 3MEEA 3V7JA 3LP3A 4KI6A 1F21A 1ZQAA 4G3IA 1RBRA 4QZAA 8ICIA 2PZSA 4UB1A 3KK3A 5KFOA 4CJ5A 4QWAA 4FLYA 1C0MA 1NKEA 3IAYA 4O5EA 4QZDA 5CJ7A 4J9PA 3SI6A 8ICVA 4OLBA 2NRXA 2ZTDA 1ZJMA 2JEFA 4I2GA 4YQWA 5C25A 2HNZA 2JZBA 5KFQA 9ICLA 4DQRA 4M41A 5J2DA 3MDCA 5J0PA 4F2RA 3GDXA 3A2FA 3L3UA 3V6KA 4JV0A 7ICVA 8ICXA 3TAEA 1QSSA 3G10A 2OYQA 4L8RB 2XCAA 1KTQA 3H4BA 1Q9XA 5KG6A 3K5LA 3V6DA 3V72A 2DPIA 3OYCA 3UQ2A 3PX4A 4HCBA 1BQMA 5KFBA 1U48A 1RYSA 4JWNA 4JRQA 3E01A 4CJKA 3ZSZA 3MR5A 3NTUA 3VQCA 1KVCA 1WSFA 3M8QA 1ZQQA 3C23A 3HSTB 1HUZA 3T1AA 1ZQXA 1VRUA 3L3VA 2R8JA 2W9BB 1S9EA 2DFLA 3QZ7A 2O4IA 5KRTA 4Q43A 3KLIA 4G1QA 5DK5A 3V7LA 7ICGA 2UVRA 7ICPA 4DQIA 3F73A 4PWDA 4QZFA 3H8WA 2WONA 2F1IA 3ZDAA 3TQ1A 3AU6A 4DFKA 3C6TA 4EZ9A 3CYMA 3P83D 2AU0A 5HP4A 3SUNA 9ICMA 4ID5A 2VG6A 2HHXA 2ZQBA 4CJLA 2G8UA 4BXOB 4B9UA 4KB1A 1JLBA 3RB4A 2KZMA 4Z0UA 5DG7A 3OYHA 4F8RA 4RU9A 3JPNA 3QEPA 4M3UA 3KLGA 4FM2A 4I29A 9ICEA 4IRKA 1U9LA 5KT7A 3IHQB 3Q8SB 4UB5A 3GQCA 4KLHA 3PR4A 4LSLA 3KLEA 1VSHA 3SQ2A 3TABA 3E2EA 3NHGA 4F2SA 4X5VA 2YNIA 4BDPA 5L9XA 2FMPA 4OKJA 3DLRA 3NF7A 3OYEA 1EETA 4NM1A 5BOLA 4IQVA 4DSJA 3SI8A 2FBTA 3HL8A 3O3GA 3OHAA 1JXBA 4ZTFA 2Z1HA 1EXQA 1Q9YA 3C1YA 1VSLA 3CQ8A 3AVHA 4R8UA 2IMWP 3BQTA 3L2WA 3H4DA 4Q45A 5DB7A 4ECSA 4CHPA 5DQHA 4F5OA 1ZQNA 1Z00A 4ED1A 4CERA 3NE6A 7ICOA 3UIQA 5KFFA 1CUKA 4KLFA 1ZQLA 2FBYA 3RAXA 1RBUA 1RT7A 3T5KA 3LP1A 4F4ZA 1BVSA 3DLEA 4RQ8A 4DSLA 4J9LA 3LWMA 3KTQA 5IILA 4M47A 1S1TA 4O3NA 2G8VA 3QIPA 2D0AA 4M9GA 4RT3A 3T5LA 1D9FA 2PI4A 2BGWA 5EU7A 2GV9A 4DFPA 3JYTA 5KFWA 3LAKA 4CJPA 2Q0ZX 5CR0A 7ICTA 4B8AB 2PY5A 4O5CA 1JKHA 3G6YA 2E6LA 3AA2A 4FLWA 4LH5A 9ICSA 4J9QA 3ZDBA 4DL2A 3HP6A 3CFOA 4KAZA 4KMUA 1HUOA 1HNIA 2FBXA 1Z3EB 3K57A 2I9GA 2BPFA 1FXXA 3ZSOA 4YXMA 3D45A 4DF4A 3SYZA 4KREA 8ICJA 3RH6A 4YCXA 2ZTEA 5KFMA 3HWTA 3LWLA 4M42A 1QTMA 8ICCA 9ICOA 3QIOA 4FK2A 4KTQA 1B22A 1TAUA 4YVZA 5JUMA 5KFUA 2BR0A 1DOQA 3LZJA 4DU3A 5DG8A 1RBSA 4XQ8A 2BCUA 4Z6FA 5KFLA 3RJEA 1QHTA 2F1HA 2QK9A 1RT3A 3IS9A 4M9LA 1BI4B 3ZSRA 2JEGA 3CG7A 4O0JA 4HHTA 5KT4A 1ZQYA 4ELTA 3VQPA 3SUQA 1ASVA 1ASWA 4QWDA 1XU4A 3LPUA 2G8IA 3EPIA 2BHNA 5K14A 4B9TA 4F91B 4CEDA 3S3NA 3H7IA 9ICHA 3OS0A 8ICEA 5DGAA 3TANA 1W0HA 1ZBHA 3VQBA 1QS4A 5J0UA 4E19A 3NF9A 3UXNA 1XHZA 4KHWA 1RCHA 1CLQA 5DLGA 4K8XA 4Z4GA 3HJFA 1J53A 2P5GA 2A1RA 2R8GA 1VSFA 3MECA 5KG0A 2BCSA 3RMAA 1ZQIA 3VQ7A 4CFCA 2RDIA 2PYJA 2IC3A 7ICQA 4IR9A 4DTRA 2LSNA 5HNKA 3AVGA 4M6WB 4CEBA 2JGUA 1VSJA 1MQ2A 2IA6A 1C6VA 4HTUA 3RRGA 4DLEA 4F93B 1KFDA 4ECUA 5BPCA 4M0AA 4DSKA 1LB2B 2HB5A 4KPYA 4UAWA 8ICRA 4DLGA 4PQUA 1VRTA 3BQ1A 1S0VA 4CHOA 3L2QA 1LWCA 3QEIA
chains in the Genus database with same CATH superfamily
3M2VB 2L3MA 3GIKA 4WIQA 2YKMB 4KV8A 1TL1A 1X8DA 4PL1A 3HM9A 1XMOK 2V7ZA 2F7VA 3P3DA 2J7UA 2QIFA 3L09A 4UW9A 5CHIA 2GIRA 4IKFA 4BJQA 1TV9A 2OTLN 1RZMA 5C15A 5JMVA 1T9TA 2CJQA 1HQUA 2MLZA 3TA0A 5J0WA 3AUOA 1YRXA 2E9TA 1IBLK 3A5NC 1TQLA 2NCKL 4DG1A 4ZCMA 1WUAA 1FRXA 4FWOA 3CDUA 4BR9A 4P2HA 3DMJA 4BRKA 4A57A 2ES6A 1N33K 1XR5A 2XO6A 5CEHA 4DFJA 4DU8A 4FSVA 2NRWA 4K5SA 3GV8B 4ZVGA 3OFEA 1RHRB 3QEWA 4AHSA 4OYZA 3L4BC 4RCHA 4C8NA 2P6UA 3VQ4A 8ICLA 4I2IA 4I28A 4DR6F 4Z6CA 3UI3A 3PW2A 1IJJA 4DR1J 1GO3F 4J2DA 3C2LA 4GIBA 3Q2SC 3C2PA 4BG9A 2ASMA 4YY3K 2HFZA 3CIZA 3J7YU 3FUYA 3LQVA 3RBEA 2NREA 3ZTQA 3U3GA 1HIWA 2CQ3A 2MHEA 3CF5Q 3ZSXA 2DTUA 4NL5A 3B6PA 3SCXA 9ICUA 4O5FA 4CW7B 2W7OA 3FSXA 4KBOA 2A1JB 2J9DE 1TVRA 5TKWA 4ID1A 1P8GA 2BQ3A 2Q31A 4US8A 5KL1B 1N5QA 4C3KA 4R65A 1N56A 2IAJA 4ICLA 2AEJA 1NU0A 1U47A 2UV8A 3KDOA 2RRBA 3OT9A 1VC5A 4WKYA 2AYGA 1N6QA 3WKDA 2V52B 5E84A 1WI8A 4HWIA 3ZX2A 4DUYJ 4DV5J 3MZIA 4P7TA 2HEKA 3ZYYX 1U0HB 1IJFB 5CCMA 3DOKA 2H51B 2VGNA 1KOHA 1N54B 2LEPA 1N32J 4ED3A 2ZF5O 1S1XB 5J1PA 1BNOA 3T1YK 1Q1KA 3HJVA 1U02A 4K4GA 4ISEA 1TMMA 2RQKA 3V81A 1RT2A 4CJ3A 3QNOA 2KT2A 3OYNA 4FJ7A 4NLKA 3GIIA 1N2XA 1X9MA 2GAGC 4PWUA 3L2RA 2EW9A 1WACA 5LJ3Y 4UOHA 2OSRA 1KWMA 4X4QA 1CXUA 2OPRA 4USMA 3ETLA 4B8CA 5AXLA 1S6PB 5F8IA 1LOTB 2CXYA 2KJ5A 5AKIA 2OPQA 1K47A 3R9KA 1VQ7N 1HUXA 2H5XA 1D09B 5AKHA 2KQ2A 5AQZA 5EWGA 1WG8A 1WEXA 2Z1GA 1Q86O 4Q8EA 1H72C 3ZZRA 2YJEA 3WXLA 4RW8B 3W9HA 5AJ3F 2XULA 3C5FA 3I76A 3AY9A 2CIMA 3PRBA 4J9KA 4RQ7A 3M8RA 3QJLA 2CFXA 5HBMA 1GFWB 2HS4A 2VH7A 3ZT3A 1LKZA 3AO1A 4OZ5A 2FVQA 3ZETB 3G71S 4PL2A 4HACB 5EE3A 2KNJA 2UVWA 3FM9A 3ISZA 1F3FA 3R7BB 3NBPB 1SQEA 3OY9A 5CQGA 2HS3A 5KTQA 3QBCA 1RWUA 2KJ9A 1S22A 2W2QP 2W2OP 4GXIA 2P51A 4CRXA 3CD7A 3DM2A 2HHHJ 1VIOA 2ZH4A 1S4EA 4E7JA 2JXJA 4E8UA 2YMMA 4EI2A 3WX4A 1BQXA 2CH6A 4RZRA 4MO5A 1WSJA 3FFKB 3J7YI 2G8HA 4CIGA 2AYEA 3CCES 2O8CB 2ZM6F 3HHNB 4UT4A 5AI0A 4JI4F 4L76A 1FE4A 2HIYA 5GVQA 4O44B 4H5NA 3HPHA 4KGZB 5E0OA 2G2OA 1MMLA 4CNYA 4CH1A 3V6HA 1VBZA 3EX7B 4MF2A 2P9PA 3CI5A 1F2HA 3ISCA 5AXKA 1U1PA 4A46A 4F67A 2LXUA 5DDOC 2VQFK 4I2PB 3MURP 5F3TA 3MGVA 1BQNB 2CNKB 4KN4A 2IHNA 3L2VA 4NWIA 2V50A 2VG5A 1ZQMA 2AJ4A 5JJBA 1JLQA 3BQ0A 3BQ2A 3MWBA 2LYVA 1BDGA 5AIBA 1V3ZA 3N4WA 3AEVA 2YKNB 3D0IE 2GC8A 4FVMA 3VVUA 2FBVA 4WFBQ 4DTPA 1GAOA 2B4JA 4LC9B 1PVQA 1N4LA 4Z7YA 5E3RA 4LF4J 1Q5VA 2KHDA 3SQOP 1P1TA 7ICMA 4BBYA 2KDOA 2OIHA 4U7UD 4CESA 2KVSA 2PEHA 3MUVP 5KFDA 1FFWB 2AWZA 2XMVA 3A8JA 1RT4A 5KG3A 3BEXA 4OVLA 1OY8A 2ZJRL 4GVMA 3NS7B 5BR8J 3JB9k 3S7RA 2DTJA 1I3AA 1YJRA 5L46A 1BUPA 3ZXWA 1VHIA 3B4DA 4DV0J 4W92B 3FBEA 3I56S 1YZ7A 3LPYA 3M32A 4W4MA 4DV3K 2O8DA 3I55S 2JSXA 5AI9A 2DCLA 4NLNA 4DR1F 2GWKA 2WBRA 3IXQA 5KFIA 1WHXA 1HX1A 1Y5NB 2PGCA 2F3JA 4GFJA 1IBKJ 2AZ1A 5AZIB 3ULEA 4B3TK 1WNEA 2ZC4A 4MKAA 3SFGA 1VFJA 2CWKA 4QZIA 3K1RB 2FJBB 5KFJA 4OX8A 1XTZA 5ALQA 4EK2A 1S4FA 1LW2A 1X42A 2LVWA 3NS5A 3AGKA 4YFKA 5F2RA 3D2SA 2H5EA 5AQVA 1XO0A 1IM6A 2X7IA 2DHGA 1T03A 1SB3C 4NZ6A 5AKLA 5ITHA 3VEOA 5JU5A 4NXZA 4LZGA 2KMDA 4DUYF 4DV5F 2FC8A 2B3TB 2OD4A 5CHCB 1K9MO 2MDAA 4KH0B 3TA1A 1WHWA 3SSSA 5H9FJ 3QU4A 2X1FA 1N32F 4PR6A 2AF6A 3QT6A 3UKUB 3AJDA 2HGLA 1KVJA 3PSIA 1Y3KA 4QZBA 4E1NA 4DR5K 3M8ZA 4HCCA 1KKHA 1PCAA 3K7RA 5IQQA 4WFAL 1FKAF 4AF1A 4J9NA 2GMLA 3CJBA 3U4LA 2VWJA 3SEOA 4OJPA 5AXNA 4QZEA 4CT9A 2ETJA 4OLAA 5K20B 3K8VA 4PG7A 1U04A 1WKLA 5J0QA 2XB2D 1RTJB 2QT7A 3FBBA 2RMLA 3C6UB 3OVBA 2X74A 3OBWA 4NY8A 2VOPA 4RX6A 3CC2N 3LGNA 3H0RB 3UKRA 4K4HA 5A2QU 3DDKA 1ZPVA 3SBMA 2HBMA 1YTAA 3KZBA 2FXUA 2F8HA 3R7NB 4YDUA 4B1VA 2K8CB 1RGVA 5ETLA 3WXIA 1KN6A 1EZZB 1Q78A 4B3RJ 3LDPA 1PSDA 5C7PA 3MX2A 4H0YB 3E66A 1OH6A 2XHCA 1XMBA 2NUHA 4B08A 5AE1A 2XLJA 1M5PC 5E3CA 4ILLA 2YX7A 4NE9C 2W8LA 2FF6A 1B4FA 1RDRA 1Y97A 2RD5C 1Q79A 3DOMB 3MMJA 8ICZA 4UQGA 2QZ8A 3HJEA 4JNEA 1U1QA 3C16B 5AICA 1HR0F 1VQ6N 3J7ZT 3MEGB 2FZCB 2OKQA 5AXMA 2ZG6A 4QYRA 4BRDA 1W7AA 5I3QA 1X66A 4ECQA 1H98A 3Q7CA 4IQWA 1S76D 2XY8A 1KQQA 1VQPS 1S99A 1FXDA 4LRDA 4I2HA 2YNFB 3TPQA 4DV4J 1YJUA 2XS5A 1UTAA 1BI4A 1UOCA 2HNDA 4FZMA 1NLKL 4I7FA 2QKKA 3DHWC 3K0SA 4F5RA 2LEBA 2BJ9A 4G65A 5JXSA 5CP2A 2JR5A 4AXJA 3NS6A 2W42A 1RXWA 2A3ZA 5IT9Y 4DL3A 3CCJS 3DLHA 3R5BA 4KGKA 2J0SD 3ZT2A 2F65A 2QW9A 5J2QB 3JPPA 2ZIWB 4C8KA 2ZVIA 2NO4A 5AR0A 3M6GA 5JICA 3THWA 3D0PA 1JJHA 3K4GA 5CHGA 3VPZA 2ASDA 3MCSA 2FC0A 2F8EX 2MQNA 2OM6A 2KKVA 4RBTA 2Q2RA 1BO5O 1TL7A 2R3VA 2DF4B 3CW2C 4LF4F 1MN8A 1HHSA 3JAMY 1HWKA 2FHMA 4FZYA 5C0YA 4K4IA 2KE7A 2KU7A 3GCWP 1FT8A 1FFUA 2F1FA 4YMNA 2CQ2A 2WFAA 2IM2A 1JMTA 2N4CA 4AFFA 1B7FA 1H74A 5BR8F 3U1MA 5KFZA 5AKXA 4JB3A 2JDJA 3R5AA 2LMIA 4JB8B 1Q53A 2VQEJ 2ZBCA 2CQIA 3KK1B 1O13A 4DV0F 2Z8QA 3R5JB 5J2PA 1YBAA 5EVZA 5GINA 2J9EA 3J81j 3J80U 1DGJA 3D1HA 1IR2A 3OLBA 4Y0WA 2KZZA 4FLZA 2FUG9 1FJGK 4A8WA 3QO9B 1RUSA 2Q6BA 5J2NA 1FDDA 4OYIA 1IBKF 3FQKA 2QJ3A 1OQ3A 2RU9A 2MAXA 4NLTA 1YJ9S 3HO1A 3VR1A 4IG0A 5EHHA 5GMKa 1PKUA 2FSNA 4FOIA 1N5YA 4URQU 3FEYB 3TI0A 2FHOB 1YG0A 3N97B 3GOIA 1FRMA 4BGDA 3AARA 1A7GE 3TOQA 5CYQB 3CRXA 3MPYA 2F8KA 5KFTA 4IQUA 4NCBA 1RISA 4RW6B 4CLTA 2CA9A 4PWWA 2ZBRA 1T6CA 5EX0A 6FDRA 4RT2A 1DTTA 3AVAA 4B1WB 4O0IA 3C5GA 3HZGA 1J5OB 1NSPA 3IKMA 3PIOL 2HKEA 2O67A 3THXA 1OJ4A 3M8SA 3QATA 3DYAB 3LZIA 3KG4A 1GOAA 3LP2A 3CO9A 5EE9A 2DY4A 3C29A 3CFRA 4F4KA 1VYAA 3E3XA 5K4LA 3RJMB 3K9JA 1KVAA 1GLFO 3S1TA 2IGIA 4PKGA 4K59A 4W5OA 4ZVHA 1ZQWA 4CM0A 2RLTA 3AVMA 3PO5A 4YN3B 2YVSA 2EEYA 1RB0A 3TVYA 1MW7A 1DFDA 3Q2TC 3SQGA 4B17A 2AGPA 2HOIA 2WVBA 2W25A 1KQSR 1HNXK 1RWOB 2J0QD 2ZKUA 1YRTA 2LA4A 4Y00A 2UU9K 1BPDA 3OHRA 3QYPA 4X84A 5DJBA 4FWPA 2DWQA 2N7YA 2HQ3A 3UDCA 3MM5A 1CJKA 5A6WA 4DOCA 3CCQN 1I39A 4FFDA 4B3RF 5F3XB 1BCMA 4JK9A 1FFSB 2NYIA 3HT0A 5CYJA 4TUQA 3HVAA 3M6VA 5I3PA 4O3PA 4QZGA 1GXUA 2NRZA 4PHDA 1UA0A 4NLWA 3CJCA 2HSZA 3BKUA 4ZCKA 3VA0A 4CVNE 2A18A 3CJ2A 4OX9J 2VJUA 2HHVA 1A5XA 3MEKA 1FRKA 3KLIB 3FZHA 5ETKA 1QAIA 1P27B 1NZAA 4GO7X 1DGSA 1LVHA 9ICRA 1K73O 3TRGA 1ZQFA 5KI6A 3PHEA 3CJRA 3ULDA 4QW9A 2G0IA 3MD1A 4Q5VA 1RAIB 4EMDA 3VWSA 4ZVQB 2A19A 3QXGA 2DFFA 5ALGA 2XYHB 1K5OA 2MQOA 2H3FA 3OL9A 1RTDA 4JI2K 3NASA 2JWNA 4ID5B 4JKAA 1ROFA 4UB8U 2DNMA 4DV4F 2Y9TA 5LL6d 5AK5A 3HHDA 1NOZA 2QMWA 4BWMA 2UUBJ 2NS1B 2BZFA 4WFZA 4I6YA 3FRYA 1BL3A 4KLGA 1MSWD 2OTLS 1EWQA 4HHJA 2KG5A 3ZTRA 4BC9A 2RKIA 3OSNA 3Q8LA 2C42A 3RWUA 3AQOA 4BGAA 2Y0SF 3QINA 1XQIA 3KLHA 3T9ZA 2R8KA 1YJTA 4HTJA 1F3VA 3IMXA 1KDNA 3AVNA 1PIEA 1ILYA 5C5JA 1L6NA 7FDRA 5THWA 4QIFA 3VQ5A 1L3TA 1RACB 4ECRA 1BMQB 1KVKA 2BE9B 2WBMA 3NGKA 4QS7A 1SL0A 2BCRA 3IBPA 4HH1A 3W2VB 5GAHP 1SC3B 2P6TA 2D8CA 2GFFA 1B0VA 1NO8A 2AJ2A 1HBUA 3W9IA 5LMNJ 3PVXA 3R27A 1LXJA 1WSGA 1ZM2A 3JTOA 4I2QA 1UEKA 2W3SA 2ZIVB 4CJEA 3IAM9 2K3IA 5HP1A 1Q5YA 2PIIA 1UFKA 3Q89A 3VQ6A 9ICQA 3HF5A 1WSIA 4R8UB 1BPXA 3SQ4A 2G09A 5KPTA 1CZBA 2FTRA 3SDEA 2K60A 1RDCA 4DPXA 4FWKA 5JVHQ 4U8YA 1Z00B 4ECXA 3F0NA 4B3SJ 4CLWA 2D3DA 4IS7A 1FVQA 1X4DA 3V9UA 1HEKA 1SJRA 4EIAA 4CEAA 1Q81O 4F3QA 4LF1A 1RT7B 1NJZA 3R1LA 2RJZA 2E1RA 1RHKB 1RBTA 1CJUB 3PYFA 1B70B 3QIPB 3F44A 3BS5B 4FCYA 3DN9A 1NJIT 3FZMA 2VODA 1I3OB 4WYLA 1HI0P 3F5TA 3OS1A 3MM7A 3P31A 3LDSA 2R7YA 2RPIA 4USHA 4X4UA 3WK7A 5JS2A 2V7YA 4YS2A 2ODGA 1JNZB 3SV4A 2UXCJ 4QR1A 2Y3YA 3KHGA 2X6SA 1HNIB 2R2RA 2ZWPA 5AM1A 1VBKA 1VC6A 2BDUA 2EFQA 3CIPA 2EPIA 1VQ4S 4E7HA 4USJC 4EELA 3BYPA 2W9AA 5ALKA 5BYSA 4GXKA 2HVDA 2D7SA 3MWPA 2JNJA 4FK0A 2ZITA 3RJGA 4JKDA 3R6LB 5BPNA 4KRWA 3OGUA 2VC0A 1ZRMA 3HZEA 3BS9A 5AM2A 2XMUA 1NRKA 1PVPA 1VQ7S 2UXBJ 1IXRA 4MK8A 4E1MA 4KX5A 4DPWA 4KLJA 1RT3B 3D1QA 1WOQA 5KFKA 3V9WA 3LALA 2UUCK 1BPZA 4PGYA 2Q79A 3QE9Y 4YDXA 4OHYA 5JVGL 5AFUH 2DRDA 3PZPA 2KXHA 2O8BA 2P9IA 2F44A 5IWAF 3B0YA 3RFAA 5AK4A 3F56A 4KTWA 5IZHA 4US9A 2E5HA 4GVLA 4CEEA 1HYSA 3D2QA 8ICOA 4TQRA 1TKDA 3AY0A 3WNEA 4F04B 5DB8A 3HK2A 3SAGA 1SC1B 1WSEA 2FJXA 5IIKA 5GAEP 3K2PA 3M1FA 5L1IA 4Z4IA 5J2MA 3TW0A 3SMVA 5HRSA 4JS5A 2XS7A 2BJEA 1K1QA 3OXGA 1ZQBA 3MECB 4B9MA 3WHIA 1YVFA 3FJ2A 2IC3B 4PHPA 1UFLA 2NO5A 4HI1A 3K9KA 4F92B 3FNNA 4KI4A 3ZTPA 4MF8A 1ZQGA 4CZIA 5F0UA 4ZVTB 1FJCA 4GV9A 2M9KA 3MCAB 3Q24A 1BPYA 4DUZJ 3ZFVA 2ZD1A 4BQZA 1DK3A 1NDPA 4FPRA 4F0KA 5A2QO 2DCUB 4KN7A 1BWVA 4WFYA 5FP0A 1TK0A 3QPIA 3C21A 2ZOMA 4PQUB 2M0GB 3NWRA 4OX9F 1UW9A 2QLXA 3CERA 4ED7A 1GMUA 3NGTA 1RYRA 2U2FA 3G8QA 3GG0A 5CAAA 4IXCA 3KLFB 4X4NA 4USUA 3CWJA 4FVUA 4UF4A 2W4DA 3O8WA 3ZEUB 1RWPB 4KHQA 1F44A 4QR0A 1GOBA 3ISBA 3IRWP 2GZOA 5CB1A 3AU2A 3MCMA 4FWQA 4WJBA 2WSCC 3EW9A 3NVYA 3DXKB 1HBOB 3KZIU 4C8YA 3HRDD 4AUKA 3MGIA 2UZAA 2XZDB 9ICXA 2VUGA 4DN0A 4FM1A 4RQ2A 3WKEA 5KQDA 1HQ2A 1CULB 3QT7A 2UUBF 3Q8YA 4KKOA 4FZNA 5E41A 2AEMA 3MMCB 4KH4A 1LW0B 5H2FU 1HNWK 3TWHA 1JUDA 2H5IB 4ECTA 1KFSA 1HJRA 8ICUA 1WAFA 3EUNA 2DISA 4NX9A 3BUZB 3SMPA 3OVNA 4CCHA 2BZ2A 4ZOSA 4U95A 3R2DJ 4DU4A 1FERA 1AZSA 2HQGA 3DDNA 4CF0A 1C0TA 1YI2N 2X1BA 3X3UA 4NL9C 1JRPA 3M05A 3Q8PB 2C3MA 1SWWA 1UAWA 2E5LJ 3DU5A 3RB3A 1ATNA 4LFBK 5AQGA 5IXUA 3FMBA 2EI5A 4PUOA 3I4HX 2IM3A 3H20A 5LMNF 1CJVA 4Z6EA 4C1NK 3K0JA 2VWKA 3TACB 4DMZA 1ZBIA 3ETRA 4M3TA 4IBNA 3ENQA 1HNZK 1BPEA 2HNYA 4JOUA 4HYKA 3CNQP 3I5AA 4G1PA 4YR0A 3UM9A 2IA0A 2CJBA 2RU3A 4PYDA 2ROPA 4LRBA 3JSBA 4UAZA 4JRPA 3JSMA 4CFDA 4B3SF 1NGDA 4RUBA 3DXSX 4RWXA 1RT5A 2ZTCA 3GJTB 5M2PA 4CIEA 1Y5IB 1DTQA 3M2UA 2MTLA 1VLBA 4LIWA 2A1SA 2HHSA 1NGCA 3SLCA 3JAMO 2C2NA 3MM8B 2ZJRQ 2AX0A 2YMQA 1Y64A 1YWXA 1U1LA 1HMVA 4ZPTR 3N7PD 1KL9A 5ALZA 1C1BB 2LQ8A 2BPCA 3HYFA 1S6QA 3W60A 2AH5A 2ZJ5A 1VIXA 4JKBA 2NPIA 3MHYA 4DL4A 3OR1B 2KM8C 4QW8A 4ALZA 3P39A 2JH1A 5KFVA 3DI6A 4OZLA 3J81Y 2CJKA 3RSEA 2VBXA 3I9V9 4AXIA 1DAXA 4DWIA 3SV3A 2K06A 2UXCF 3J80O 4BE1A 2PEBA 1S6OA 3U9DA 5DZ6A 2LQ5A 2XSFA 4ZJQA 4D3HA 1RABB 3N6MA 1ZXOA 5ALYA 1OXJA 3UNYA 4DR3F 5A8KA 3UNGC 2LHTA 5LL6Z 2BQRA 5CR4A 4OHXA 2PBDA 1YQHA 3QJJA 1H0HB 1K8KA 2FMQA 5M1NA 2C1EB 3KHHA 3D6MB 4CFAA 1D4XA 1QQ5A 2Z57B 3CC2S 2ZGYA 1K0VA 2UXBF 4J9RA 5BRDA 4Y0FA 2Q66A 5L1LA 3IM8A 4ERDA 1XN9A 2ZDOA 1K0TA 2J8SA 3H1QA 1RBOB 4DI6A 3FYHA 4I2EA 1WOSA 3HHLB 3SENA 3GFKB 4LVOP 3DXMB 3I6PA 2EFNA 1TL3B 3D7EO 4KFBA 2RHKA 1ZQDA 4Q8FA 1RQ0A 4M3RA 1HRHA 1TUWA 8ICFA 1R8BA 2IJFA 2RHSB 1JLAB 4JN4A 4CJVA 1V85A 2I5HA 2AMCB 4ANDA 1NPPA 3DGVA 4FF4A 4H4KA 5B66U 3KG1A 3M8WA 3MM9B 4CEOA 5CZ1A 3AN1A 8ICNA 1TR0A 4M63C 3O3LA 4CNQA 3P45B 2X78A 3CJ8A 3TVZA 1FXLA 1DK2A 1R31A 1QHAA 2R2UA 1Q7LB 2ATQA 2DITA 2EK1A 4EEYA 4LJXA 3SQ1A 4WYWA 2KTQA 2OTJN 4LF6F 2UV8G 4DUZF 4IDHA 4ZPDA 4RNFA 2KFYA 3W3DA 1X5OA 1X4BA 3AVKA 3CM5A 3MEEA 4KI6A 1S57A 3U8XA 2PZSA 4CO4A 4CJ5A 1C0MA 1NKEA 3IAYA 1S6UA 1U2VA 4OLBA 3H0PA 4I2GA 2F7TA 2HAFA 4URGA 2PC6A 1RTIB 3UE2A 4I6MA 5FPMA 1PO6A 3G96A 4DQRA 3OXLA 4M41A 2ZZNA 4EFHA 5J0PA 3LVWA 5ALXA 4JV0A 3V6KA 1XR6A 4X62F 2GVZA 2VZ9A 2VKRA 1KTQA 1EQYA 1Q9XA 3DLLL 3K5LA 3VOVA 3OYCA 4C7ZA 1QUPA 3FZ2A 1BHNA 4JRQA 2VONA 3A3PB 3MR5A 3NTUA 3QQCD 4OZ3A 4GO5X 2FJAB 1Q82O 1HUZA 3FZBA 2HZAA 3T1AA 3OL7A 4LFCJ 4B3OB 2R8JA 1S9EA 3QZ7A 3ISND 2D0PA 4DV6J 4FWRA 7ICGA 1WORA 4HAIA 3BDEA 4FXVA 2UVRA 4HL9A 5HROB 3MOJB 4H0TB 4CBUA 1VC0A 4PWDA 2HK3A 2WONA 2F1IA 3GPAA 3ZDAA 3PSPA 2Y0BB 3M6ZA 3NKYA 2AU0A 5FDLB 2H3GX 3SUNA 3RAMA 3CB4A 2VG6A 4DBQA 4CJLA 3MMAA 2G8UA 4CF3A 1WC6A 1N0VC 3R9LA 4UOCA 1GK8A 4B9UA 4KB1A 2KZMA 4A2BA 1ZXIA 5DG7A 3D6TB 4DR4F 3OYHA 3R5CA 1S79A 3JPNA 4FP9A 2YHXA 4KX3A 4FM2A 4NLVA 4IRKA 1ATSA 2HLTA 1U9LA 3FRZA 4LSLA 2G1HA 3GQCA 2GA7A 2XQCA 3W5YA 2P5VA 1ICEB 3A1YG 4LRFA 3BO3A 3E2EA 4L3NA 4TY8A 5E3PA 4F2SA 4KR0B 1Q3VA 2YNIA 3GFHA 3OL8A 1P1LA 4BDPA 1KBUA 5L9XA 1M0SA 3A0HU 2DGUA 3E1YA 4X4OA 4EGLA 3HL8A 3O3GA 4K25A 3DRYA 5ETOA 1EXQA 3KKAC 4OFZA 1I94J 3NG8A 3ADAC 3PYEA 8RUCA 2WBNA 3O80A 1HPMA 3SCKE 4NV0A 3AB2B 4WCEQ 3DRSB 2IMWP 3O44A 3RBXA 1TKTB 1VQ9N 4Q45A 3ID8A 4ECSA 4JBCA 3DLGB 4ED1A 3KOOA 4K4WA 3ATVA 1RAFB 4DDFA 4CERA 4DCHA 2DGXA 7ICOA 1XMOJ 3VGKA 2BX6A 4DCCA 5AI4A 1SUQB 2AA4A 4JI1F 3T5KA 3LP1A 5AQHA 4DSLA 3T69A 4J9LA 2IYGA 4NRUA 1L7OA 1U1MA 3T5LA 2KV2A 1ZBTA 4GKJJ 1IBLJ 5KFWA 2XWYA 3LAKA 5CR0A 7ICTA 1JKHA 3AA2A 4KH5A 3FGUA 3HRGA 1U24A 2EKNA 1NAQA 3R3LA 4YUDA 3HILA 4KAZA 4KIAA 3CCQS 4KMUA 5G4DA 3ZTSA 4CYUB 3ZSOA 1FNOA 2V6AA 2WVCA 2W41A 8ICJA 4NWBA 4KO0B 1QD1A 3I0RB 4LF2A 3AB4B 2CJAA 2JVRA 4YY3J 9ICOA 5CE3A 3IWXA 3M30B 1TAUA 1YSJA 4PAAA 4DU3A 2EKYA 4LF9J 1G3OA 4IFVB 2F1HA 1NCLA 2QK9A 5LJWA 2HLUA 4M9LA 1L7MA 1UVNA 3ZSRA 2N1RA 4WJ3B 3JQMA 1ZTTA 3CG7A 3FGVA 4ELTA 1ZBSA 3SUQA 1ASWA 2FY8A 3LW5C 4QWDA 4FZLA 1XU4A 1XNQK 1ATRA 2Q0RA 3O8MA 3QFUA 4B9TA 3KMSA 4F91B 2IIHA 5D4OA 5DGAA 3TANA 3VQBA 5DO2A 2AP1A 5BXIA 1HKAA 1V4SA 3KD3A 1T9UA 2DXDA 2PN6A 4ZVOB 2D9OA 4C0OC 2E1YA 4RBVA 2Q1LA 1YBTA 3R9PA 2A1RA 3T1YJ 2E9RX 5KG0A 2BCSA 2K8GA 4CJ7A 3VC8A 2Y9HA 2PYJA 3VQ7A 2RDIA 4I56A 2O3DA 1ZD2P 1SWVA 2GGPB 3WQTA 4DTRA 2LSNA 3AVGA 3CMEN 2DO4A 4GNIA 3K1ZA 1C6VA 2F9TA 1NHKL 3QWUA 3QJPA 2V2ZA 2VDHA 4FE3A 4M0AA 2CNNB 2XMAA 4DSKA 3P96A 3CGIA 2FZKB 1J27A 2J5AA 4WU2A 4UAWA 8ICRA 3H25A 1U1OA 3D6FB 4CM2A 4Y2XA 5DRKA 3A8EA 1VRTA 4DQ8A 4LFCF 1KQFB 3L2QA 5B08A 2IOFK 4DHVA 1LWCA 2QWNA 3FLCO 4DV6F 4ELUA 1IG6A 1WUUA 2DPJA 2QA4G 4Y1CA 2LI6A 9ICNA 3W2WB 4H54A 4CLUA 1U2RA 5BOMA 4R5PB 1KLMA 1U8WA 2JV3A 1B0TA 4EEKA 4A48A 3W0LA 5KG4A 4CF1A 4JD2A 1AB8A 1F1BB 2ZKTA 3HHLD 4FLXA 1BE4A 3MXMA 3M6WA 2FY1A 4XH5A 4DSIA 4WFNQ 5FJ4A 2H3QA 1WN7A 1WBDA 2D41A 1LV5A 1Y10A 4GVBA 3D67A 5EXWA 1RDWX 3RR7A 5BN8A 3UPQA 1T05B 2F4VK 1OSCA 5D6GA 3AAWB 1TKZA 5J2IA 3KKFA 2XYGB 1SB6A 1SKSA 4FDFA 4QWBA 1IVZA 4N8OA 4FW1A 3OQ2A 3ET6B 2UUAK 3V4IA 4P74A 3PIPQ 4ANEA 1SV5A 4PXEA 4UTGA 2KFZA 4DSEA 1X9WA 3TUZC 4E7KA 3Q83A 2A5XA 2DEIA 2CRXA 1V38A 3L6QA 4RTFD 3US5A 3BS7A 3HVTB 4HHUA 1I94F 4I9LA 4PKDB 1ZQUA 1HKBA 1RTHA 2NQPA 3D66A 2A1BA 4CGIA 3O0FA 2O6KA 1LWEA 1YDLA 2E6MA 4RW9B 3MGJA 1TGOA 2E1FA 2VFSA 2IM0A 1XMOF 2H4YB 3A3OB 4FS2A 8ICSA 1IKVA 3Q8QB 1LKYB 1SKUB 2EFGA 2VASA 4QPTA 5AQXA 1NPRA 1FKPB 2M5YA 4WE1B 2EX3A 3KUGA 1NDCA 3E58A 1LFPA 1X4CA 5AKEA 1B0PA 2AW0A 2LQBA 4K8ZA 4R66A 4CRJA 1A6SA 3ENHA 4GKJF 3EZWA 1IBLF 4P0QB 5B0AA 4HUFA 1TKXA 1U2FA 3DRRB 4YNQA 4ETZA 1TFYA 2CQ1A 3X1LB 2ZZTA 2YJFA 2BA9A 4M5IA 3SCIE 2E4LA 4QWEA 4QYZK 3EVWA 2IBKA 2D3ZA 2FJWA 1Y7PA 2YX6A 9ICCA 2IFXA 3MEDB 4FPAA 4NYZA 3QIDA 2IDOA 4DV3J 1XWLA 1C0UA 1MN9A 4M2YA 2G08A 3V1QA 2BW7A 2I38A 4IFYA 3GBTA 2ITMA 3P8BB 2HBZB 4YY3F 2QB0A 5KL8B 2KHOA 4EWTA 2CYYA 3Q22A 3UW1A 4B3TJ 2Y0SC 2FVRA 2W9CB 3R5GA 3VCDA 2VF3A 2MZRA 5HVFA 4CZKA 4J8FA 2XGQA 4LF9F 3KYLA 5D3GB 4IG3A 4P10A 2KZ3A 1DHMA 3BV8A 1YTYA 3PY8A 3RRHA 1B99A 4IYQA 1MN7A 1D8ZA 3FEXB 3G82B 2CZVC 3GZ7A 1EX4A 1AUSL 3NCQA 1WSRA 8ICPA 5ETPA 4JHDA 1YKWA 5DG9A 5G0RA 5J8YC 2HQFA 5F8JA 3P4UB 4AP9A 3HFKA 4PPXA 3VEYA 3ICXA 4A8SA 3NOGA 3DOLB 2NXUA 2W4CA 2J9DA 4RQ1A 1QJHA 4ZP6A 1K8AO 5B8HA 1DLOA 1B92A 2CQHA 3PNCA 1JXVA 4M63A 3DLKB 2XMTA 1MWQA 4P52A 5AKZA 3PW0A 5GIPA 3QGIA 3CSKA 1YI2S 1UAXA 4DR5J 4IUFA 3CQYA 3M8YA 1C1CA 1HYZA 1ZETA 3PG9A 5DM6Q 1RXVA 5J2JA 1O8BA 2YNGA 1S59A 1N48A 5KFRA 3CULA 2VA8A 1UKUA 1OH5A 3BGRA 2DHXA 5DQGA 5HMZA 3EO3A 3HULA 1SXDA 3IFRA 1SV0A 2AJQA 4Y28C 4F9OA 5DM7L 3KJVA 2ZIUA 2ZNZA 4ED6A 5J29A 1ZQHA 4H8KA 1QQCA 4O4GA 2ATCB 2XRIA 2HPUA 4UW2A 4LF5F 4LFAF 2VPXB 2E7WA 1ZYQA 3AQEA 3C14B 4CJWA 5C2FA 1X0PA 3VEZA 2E44A 1VSMA 5ALPA 3CJ9A 4CBWA 2KFNA 4PZOA 1ZZFA 5J1EA 4F50A 3C28A 4RQ0A 5HI7A 2QB1A 2P9CA 4DOZA 1N34K 2A6OA 2IVFB 2XICA 3H40A 4ZPCA 1NKCA 1G99A 1Y5LB 1JLFA 3QGGA 2YKAA 4RQ3A 2IVPA 5IV4A 2F1JA 3QGHA 4WTYA 3M8PB 4C23A 1GX6A 2XMJA 4PXCA 4Z4CA 1IM4A 4FW2A 2KRRA 3NDKA 3OHBA 3QRPA 1S9GB 2E1AA 2QTDA 2JLEA 4DB3A 5AQMA 2XC9A 4ES1A 2KJVA 4KHPK 4ECWA 2H54B 4P0PB 2BMBA 1KQKA 1VLOA 3MPUB 1H38A 1IKWB 1RWKB 2GJFA 1GLBG 2DNGA 2H3ZA 4OYPA 3RUBL 4IO9L 5DDRC 1EIYB 3AVCA 1VQMN 4OV6A 1YRUA 2A2DA 4JI7K 5FRNA 4QZ9A 3N5FA 1CS4A 3Q8VA 4KJIA 1T9XA 1N5WA 3KOAA 2PMZD 2UP1A 3TFSA 2E66A 3OYDA 1J9AA 4E7LA 5CWRA 1RT6A 2Z2LA 4EBEA 1RDFA 4BVPA 4EBCA 2OP5A 5A8RB 2PFNA 1L8OA 3K5OA 4DTJA 2JOQA 1CXQA 4CEFA 3OTQA 1OSDA 3HT3A 4B1YB 2EWHA 3H8JA 4IOAL 3KNAA 3VGMA 4M3ZA 3LP0A 3MF5A 3QEVA 4Y1DA 4DS4A 1J6ZA 2K4EA 3L4IA 4I4BA 2DPNA 5AIAA 1XHXA 4NJ8A 4DU7A 2Q3SA 1IQTA 5JS1A 4MIBA 5JTIA 1JLEB 1RAEB 3AXKA 2B6AA 4H4MA 4QPXA 2G5IB 3H90A 2WSEC 2J6TA 4DTUA 2WTFA 3O1WA 2NZTA 3TTFA 5EDWA 3RGIA 4OO1J 2VG7B 4O55A 4PHAA 5HRRA 2IJNA 2N7CA 2Y1IA 4UB3A 3EMTA 3ZDCA 3S6EA 2F77X 1U49A 4TNOA 2OTJS 3V4MA 4K42A 4CLYA 2CPEA 4ZPAA 1VISA 2ERRA 3UN3A 3U3YA 4KITB 3GJSB 3K17A 1RLCL 3HKZC 5IM0A 1EAYC 2YNHA 1FJGJ 1X0FA 2M4MA 5MLCV 2QLWA 8ICKA 2HZVA 4J2EA 2KD1A 5LOQA 2W24A 5AI8A 1ZBLA 2K8AA 4C0BA 4FN5A 3MABA 4CFBA 2G8KA 1CI4A 3CD5A 8ICHA 5I42A 3FAHA 2CQ0A 5LSOA 5KAIU 4YP3A 3M1VA 1O0PA 1R6VA 3NL0A 2IHR1 5FPEA 3D2FA 4MT1A 2BUNA 5B0GA 1JX4A 3KZXA 2RH3A 2E2NA 4C7QA 3KDNA 2HFNA 4FJKA 2QC3A 5AQPA 3MFHA 3GYGA 1KD1T 1QZ5A 9RUBA 4DF8A 4BACA 1H7XA 3KK2B 2B9WA 3VAHA 1FX4A 1M5OC 3VZHA 1IKYA 4ZHRA 1NOYA 3T9NA 4DR6K 4F5PA 3FSYA 5SWMA 4BR7A 3FBCA 3WEEB 5J1NA 5J2AA 5DKWA 4DR5F 3CJKA 3OVAA 3DC2A 1QVFM 3KFWX 4CHQA 3ED5A 5BRFA 1JLGA 1RT1A 1TUGB 4DCPB 3EN9A 3W66A 4C8LA 2Y8WA 4GKKF 5H9EK 1KHWA 2DHSA 5AFUA 1RHJB 3H2UB 4C4TA 1OW5A 1OIAA 2KJWA 4OGEA 3M9NB 4RW4B 5J0OA 2MKSA 1HNXJ 3CETA 3DLLQ 1OYEA 4CEQA 2CPZA 5CZ2A 4BCAA 3TUIC 2V0NA 3D54A 1VBYA 1SJFA 1S3XA 3DXKA 1EKEA 1WCNA 4Z2XA 2WSFC 3PEJA 4FJMA 3FE1A 3LANA 2CPFA 1SC6A 4F02A 4ZIWA 1FFGB 1UWBB 4DPOA 1S8OA 4IQTA 4CO3A 4QIWC 4CJQA 3LK9A 1JLCA 1WOOA 2D1CA 5KFCA 4PJ0U 1NU4A 3THTA 1S1WB 1WC0A 4TU9A 2YCHA 1R8CA 1MG7A 5D78A 1J5EF 3GL1A 2KRBA 4B02A 2PYLA 2CRLA 3KD5E 3GIJA 3FEZA 4XDDA 3F53A 4DMNA 4UQTA 3ENOA 3LPTA 1VQ9S 4OI2A 1HI8A 4FS1A 3AA5X 2OWOA 1FA0A 5C24A 3G25A 4AH9A 4LR8A 1VMBA 4J9UE 5CYMB 4JI2J 4NYFA 1ESVA 1RJJA 3DWLA 2DH8A 3KUHA 3IO1A 3IMQJ 5AJ3K 5IT4A 2Y1JA 5A8WB 2EFVA 4YD2A 5HHHA 4ZCIA 3DFEA 4YMEA 3RBDA 2XVTA 2FVSA 2LYAA 4DV2J 1NK6A 2B9YA 3KUEA 3KJQB 1KVBA 1QE1B 4W5NA 4G6VB 2BANA 2NV3A 2ASYA 2YB4A 4FJNA 1MC8A 4TUSA 2W55A 4J37A 1BUXA 3M6XA 2QN6B 4JLHA 2BV3A 4BRQA 1PZNA 3TEGA 3VTHA 3SPZA 2CPRA 4NMXA 4Q0BB 5HLFA 2OZMA 2NRVA 2C3UA 3EL2A 4IRCA 3TNVA 2OEJA 3MAAA 1DRGA 5J2GA 4M9JA 2XMMA 4LR9A 3F9MA 2GNKA 2EC2A 4C3MA 2A1AA 1K6YA 4O9MA 4GV3A 1WWUA 1D8BA 3FFIA 1QLNA 2ALYB 3OR1A 1A0OB 2LEAA 4EAHD 2HIQA 1IKXB 1MLAA 1BA0A 4IEIA 2LM4A 3EVMA 1C4CA 3R8EA 4MQ3A 1EXNA 3FDSA 1Y11A 1C2PA 2QYGA 1BHLA 5CZVA 4GMJB 4NM2A 3JSRA 3U26A 2B5JB 3GU0A 2P9EA 4B9SA 1Z25A 5GMDA 2MZ1A 3QB0A 4BUGA 4I2CA 3P5TL 1YK9A 2O5DA 2DFEA 3KK3B 2FLNA 2WCXA 3D3BJ 1FJGF 4DUTA 3HXMA 2V4RA 5ADXH 2ZBIA 1QQ7A 2UVUA 4NXNJ 2RIJA 2JZBB 2K1RB 4I2BA 4JV2A 2YPYA 5B7WA 3CJQA 3KNGA 2QKBA 4CZJA 1KC8O 5LT5A 1KONA 3UQSA 3BR9A 4BRFA 1U1RA 3V1OA 3HOSA 3P4IA 5HQMA 3V6DB 1JB0C 1XSLA 1U8SA 2P66A 3AD9C 1HARA 3BBCA 2RQCA 3CEDA 1TFRA 3FZKA 1BQMB 4KLIA 3QZ8A 3CDWA 2D3O1 3CMES 5M1QA 3E01B 4CK1A 4N8NA 3AD7C 3ZZYA 2HURA 1Q7YT 2V9KA 1KR4A 4G9BA 1QUVA 3HZ6A 4J2BA 1CQNA 2UVVA 5DMRA 1BY9A 4G1QB 2JFKA 2D3OR 3LOUA 4W5RA 4DTXA 2QLBB 1M1KT 1NZPA 3GV7B 1BGXT 7ICSA 3L9ZA 3N4MB 3UCZP 3CCUN 4LF8F 3ALRA 3ALYA 1ED1A 2ZJAA 4TN2A 2BKNA 3TEHB 3SJHA 2O1PA 3Q0AA 2E3TA 2QV6A 1YT3A 1C20A 3MDQA 4CZGA 2YN4A 4DO9A 4Y65A 1VI7A 4QCLA 3KLGB 4N47A 2P5OA 2ZXHA 1F5SA 1F9FA 4JI5J 3IRXA 1FO4A 4PA1A 4J7CA 2DB1A 2OZSA 2AKWB 1HNXF 4UY8O 1WTBA 3CMQA 1MU2A 3EWGA 1SJ1A 3HDSA 4AYBD 1TYQB 5SZTA 1YTUA 4FOEA 5G5HA 3V9ZA 1ZRNA 4DV5K 3NCRA 3TX0A 2MKCA 4JKFA 1EETB 2HSTA 5M1FA 3CJ7A 3CFPA 3WT0A 5FD1A 4ZITA 4AM6A 3IDWA 1RGIA 1HHQA 1J2VA 1N32K 3A5MC 3H0MB 2AJ1A 2IRXA 4JK1A 3AMZA 4XUSA 4YEAA 3C15B 1R0CB 2ILZA 2W7AA 2F9WA 2DO0A 1PGZA 1XBWA 3R1HA 1WC4A 3PFOA 3ZNJ1 4KLOA 1W97L 2M9NA 2Z0GA 3NXZA 1WI6A 3TUJC 3NGUA 3G6XA 3T19A 4IOCL 5DQIA 2VA3A 2D5RA 4MTPA 1N62A 2BBEA 3DAWA 2IJRA 4XEIA 2EZXA 3PACA 2XNQA 2OANA 3MXJA 3CDAA 1T6DA 5DDMA 2PA8D 3ITHA 1L8LA 3WX8A 4J9OA 5AKKA 4ISGA 3QETA 1TV6A 1QQOA 1S1TB 4M1KA 4J2AA 2JX2A 3OTCA 4BRNA 2ZC3A 3TWZA 4CDGA 4ZVSB 1V9PA 1U1NA 2KT5A 2V4QA 1N36J 3JYTB 2X3DA 3NMRA 4X65F 1HNWJ 1HWJA 4FJHA 1SJQA 3SJJA 1EP4A 4DV2F 2HWTA 4QR2A 3S41A 2IRUA 2P6SA 4J9SA 3BN7A 5D4PA 4CE9A 2ZFHA 1NDLA 2WAQC 3QESA 1GLDG 4NEYA 4WIIA 3SSQA 3AT1B 3NUQA 1H2VZ 4QZ8A 3ZZUA 3VZIA 3PX0A 3QNNA 4LFBJ 1HR0K 4FYXB 3D6JA 4P72A 3EM1A 3ORYA 2VJ4A 3CO0P 2X3GA 1L3UA 1V5VA 3VF0B 5F1XA 1HNZJ 4MFAA 1NSKL 4GXJA 2ZOGA 4QIVA 3T6BA 2ZE2A 2KSOB 5D0RA 3ZSQA 2H3VA 1SL2A 1C4AA 2P9SB 3S8SA 5A0LA 2JLFA 4CGGA 2FJ6A 5ALEA 2DNLA 4JI3F 1PJ7A 4F7VA 3T5JA 2Q43A 2P9NB 1EB0A 1T9VA 2XY6A 7ICFA 4NXMK 5A0YB 7ICLA 2EWSA 1PJ5A 3GB0A 1R27B 2RT3A 1APSA 1SXLA 2R42A 1TL5A 1ZAXA 3OTBA 1WHYA 1Q8LA 2IVNA 4WZQA 3H59A 4F36A 4N76A 2OPSA 4I6AA 4NXNF 5CD4H 3VQEA 4FXDA 4LJMA 3D7SB 2EQYA 5J0XA 3CDBA 1FKOA 1RU1A 2R7VA 1RAOA 1DT9A 4LRCA 4MK9A 1YX2A 2A41A 4NLUA 3MWTA 4NCGA 3PDNA 3WXJA 1SXEA 2JL9A 1RA6A 3QT8A 4AHTA 2OSQA 3LDNA 3K5NA 3IGNA 9ICPA 4YXJA 3EGVA 1R8PA 2C2DA 4OI3A 4OYXA 4DJBA 2DH7A 4CZEA 2CKWA 5KT5A 1R89A 3VEWA 1SC4B 2H4WB 2GVDB 4MEXA 4NYOA 4W5TA 1KDHA 4CF2A 3N9UC 3JPQA 2CXEA 3KJFB 3M30A 5FRMA 4QOZB 4DV0K 4KV8B 1TL1B 4XA5A 3IG5A 3IBFB 4GY2B 1TELA 4BRIA 1JJCB 4V1Ak 1X4HA 4F0HA 1V4TA 3A8KA 4FF3A 1X9SA 1HW8A 2KHQA 2JGAA 3Q8UA 1IBKK 4JEPA 1V6HA 2LU2A 2OHDA 4FWNA 1HQUB 1XK8A 4H03B 4NMLA 5D49A 3SQ0A 1RAGB 3SAHA 4MFCA 5ETTA 2PA3A 2GLEA 2CJXB 2E5GA 2FHJD 1EHWA 4DG1B 3CP8A 2KI2A 1N63A 4I27A 3DMJB 4NZ7A 3CJTA 3UMCA 1WEYA 4JI5F 4NLOA 1UWAA 3ILOA 5KT6A 3RMDA 3BKFA 3GJQB 5KPZA 3AA4A 3AD8C 3PW5A 3W7BA 3OJUA 3T3FA 1Q86T 4BGBA 4GMKA 5T14A 5TISU 3EJMA 1OQ6A 3FBFA 3GLJA 4UBBA 1S10A 3H98A 2W01A 4OJRA 2GCFA 1S12A 2I1RA 2NXEA 2YWWA 1IBMJ 5DM7Q 3O5BA 5C12A 9ICKA 3UDLA 3ATUA 2QA4N 1SVDA 3RTVA 4ZP7A 1OH7A 3KWGA 4GC7A 5KRSA 3ENVA 3ETMA 4LQ3A 1VQMS 2DNNA 7ICEA 3RF9A 4JV5J 3NAEA 4PXBA 2WB1C 1REVA 1WJ9A 2DR9A 5E26A 3GSIA 5KG7A 4U67Q 4W5QA 1TVRB 2HVEA 4AQYF 2IVMA 2JLGA 2I6XA 2QSWA 2IAJB 4JV1A 4ICLB 2E2OA 4YG2A 4KRFA 4CGJA 5HL7Q 2W9MA 1N6QB 3E9PA 3UVJA 4UAUA 2VFUA 3HP9A 4BREA 5B0EA 5KFXA 1WLJA 1XC9A 3EGNA 3DOKB 3NGDA 2R2TA 3IG1A 4EZ6A 3TZYA 1RDBA 3QGPA 3MMVA 4N5SA 3NCIA 3CCMN 4RPYA 3ZX0A 2J6UA 1N36F 4B3RK 4C4WA 1J54A 4HTIA 3GFYA 2W54A 1RT2B 2QE5A 3V6JA 3AL0B 1S0OA 4WWSA 2CAJA 2QX0A 3WDOA 1S5JA 1B0XA 3TADA 2B6GA 3C19A 3NGZA 4IDKA 3IV6A 3ZTOA 3V1RA 2C2MB 2GO8A 2VHGA 5AZJA 2OPRB 3ONQA 1IO2A 2W40A 2MZSA 3VQ8A 4TY9A 1TK5A 3QEAZ 1U09A 5BYQA 3NOCA 1HKGA 2OPQB 3WKAA 2QMXA 8ICTA 2ZDPA 1NKBA 4ILGB 2GV1A 1A0PA 5DDYA 1J97A 2HQDA 4CK3A 3CCWA 2MSNA 4JUZA 3RAQA 1TFWA 4DSFA 2CDQA 4DZDA 4CO2A 2M0NA 5DZ7A 2Z2MA 5KG5A 4OV1A 1HNZF 3SUOA 4DN9A 2MQQA 4DV4K 5HBMB 2BE7D 4IH6A 4IOAQ 4DR2F 1KN5A 1BIUA 5IIOA 1UVMA 4IR1A 2A3JA 4PG6A 1T02A 4LREA 1VQ4N 2ZH2A 3W1YC 1NGAA 3H0LB 1GNKA 3W63A 5EUHA 1VQSA 3ENWA 2Z2ZA 2KT3A 4DV7J 3DM2B 3MTJA 2PFDA 3F9KA 4ZMMA 1VQNN 2FHKA 3SFUA 2MQ8A 2ZIXB 3HSCA 4X4SA 3CC4N 3OFHA 3D28A 2WTUA 5F41A 4P2FA 4HHHA 5K8NA 1X6JA 2B7CB 5L1JA 2HRTA 1SZPA 2YHWA 3S01A 4ENOA 2E1CA 4FJXA 3UCGA 1HQEA 4X64F 4FJLA 3MM6A 2FSJA 2J7WA 3WK8A 2LMRA 1Y3JA 2XHWA 4FNHA 1D0EA 4RQ4A 2AJ0A 2WOMA 5ALMA 1ZBUA 1YITN 3NH1A 1EX8A 3MEDA 4PGXA 4NA3A 1OO0B 3DCAA 3LP3A 1F21A 2O8EA 4JI6J 2P9KA 4IOXA 4UB1A 4PYAA 1MMDA 1KAXA 1K9MT 2VG5B 1P7DA 5CJ7A 1TU0B 3G6ES 5AE2A 2NRXA 1N5XA 1JLQB 4USTA 2JEFA 5HOOA 2R7OA 2B4OA 2VCPA 1FEEA 1EKRA 3A8YA 4JI0F 2HQIA 2BH1A 4ID8A 3EE9A 5J2DA 3GDXA 2E1ZA 1FW6A 2DIVA 1QSSA 4FPBA 2F8MA 3J7YP 2A10A 1LXNA 4FF1A 3QNWB 1YXQA 3L7PA 2OGUA 4PL8A 4A8FA 1R59O 2DRBA 4JWNA 1RYSA 2MSTA 3I5CA 2KOBA 1NG9A 3ZSZA 2C3YA 1RT4B 1KVCA 3WIUA 3M8QA 1ZQQA 1IQZA 1Y0HA 1ZQXA 5HMYA 3RW6A 1VRUA 3L3VA 3R6MA 3H1VX 2DFLA 2O4IA 4Q43A 1O08A 4JKGA 4FO0A 7ICPA 3OTEA 3J8AA 2ROEA 2O8FA 2BM1A 1AFIA 1E4GT 3JS6A 3M32B 3BB5A 2CGKA 4L74A 2XSJA 2O8DB 2XBPA 3TQ1A 2BEFA 4UY85 3CYMA 3C6TA 4EZ9A 2WF6A 1IBMF 3ULEB 2HHXA 1GXTA 1R3NA 2DR7A 4A61A 1V3RA 1JLBA 5B0CA 2W11A 4JV5F 1JROA 4F8RA 4OHVA 4LBPA 5IWAK 2B9XA 1LW2B 4RLEA 5KT7A 4UB5A 3IN5A 3KLEA 3CF5L 1H6KX 1VSHA 3ZO7A 1F0MA 3GG1A 1T03B 4X5VA 4AL5A 1MWZA 2W2PP 1X31C 4OKJA 3SCLE 3NAHA 3NF7A 3OYEA 3G9CA 1XMQJ 2P9UA 3CNHA 3LUYA 4IQVA 1R8AA 2J8AA 2HHPA 2FBTA 4CE6A 3MMBA 4MO4A 1JXBA 4ZTFA 1DRZA 1Q18A 1X5TA 5FIIA 2UXDJ 1Q9YA 5BR9A 5HSPA 2A42A 2CPIA 2KIWA 3CQ8A 1FRJA 4ZP9A 1D9AA 4H4OB 5LMUK 1FRHA 1KAZA 3N6NA 1SI9A 3BQTA 1MA9B 3L2WA 4UOFA 3K5PA 5FLXU 3TZZA 5JMNA 4F5OA 1JCEA 2FVCA 1ZOLA 4OX6A 2NRRA 2CWXA 4XPCA 4OX9K 4LBIA 4O0NA 4DXLA 2FBYA 3RAXA 4XK8C 3UKRB 4F4ZA 3DLEA 2P9LA 3LWMA 3GTYX 1N5VA 4ZVUB 2VPZB 3EICA 4OZ1A 4K4SA 4ZP8A 1D9FA 5F8GA 3HOTA 2A3VA 4DFPA 2VKQA 3OTOJ 4CJPA 3BKTA 2C3OA 5D77A 4B8AB 2PY5A 2M3DA 4GVEA 2I9SA 4R25A 4LH5A 9ICSA 4DV1K 1IJEB 4FZVA 2F4VJ 5A8RA 2BJ3A 2UUBK 4BVOA 2XIDA 5E7OB 1VQLS 4MK7A 4WU3A 1FXXA 3GE1A 4M5KA 4DV7F 2UUAJ 2Q6CA 2QG9B 4OYAA 4YCXA 2ZTEA 5A2QY 5M1PA 8ICCA 1WF2A 4FK2A 4KTQA 4P6QA 2NXNA 4QBUA 5KFUA 5HVHA 2V4JA 3QU9A 2D74B 4Z6FA 3DGPB 5LMNK 1S5LU 2KL8A 4IJNA 3LGMA 3VGUA 1BI4B 2JEGA 1NM1A 4O0JA 1TUYA 2HNDB 5KT4A 4I7FB 2MZJA 3CCUS 3VQPA 1ASVA 2HS0A 1TE2A 3LPUA 5BREA 3EPIA 4M5DA 5K14A 4NLDA 4HKQA 4KE5A 4EO8A 8ICEA 2V34A 1RHMB 1W0HA 1ZBHA 1QS4A 4B3SK 3RU0A 3NVWA 4JI6F 3EZOA 3QSIA 4E19A 3UXNA 2NXJA 1XHZA 3IG8A 1CLQA 1W2IA 2YI1A 2KVCA 1X5SA 4IQMA 2HHHF 3HJFA 1KVIA 2YB1A 2R8GA 3RMAA 1FWLA 1B7YB 3THWB 5B09A 7ICQA 1X4FA 4IR9A 4CEBA 1TL7B 4OI4A 1UMJA 1MQ2A 5IFMA 4HTUA 2W1BA 3RRGA 4C11B 1JALA 5ELZA 4F93B 1FNMA 3NLCA 5E3QA 3UE5A 2QXLA 1BOTO 2HMPA 1OKJA 2HB5A 4KPYA 2AYBA 3VEVA 1WSVA 4DLGA 1EQMA 2RQ5A 2J9CA 2EANA 1VK8A 4YMMA 3U1NA 3R2CJ 4DR3K 3SMZA 3NNAA 2DGVA 2ZWHA 4RJVA 1NZBA 3FC4A 5KFYA 4P2SA 5C2DA 1NHUA 1MA7A 6FD1A 4CJUA 5ALOA 4TU8A 3THPA 3IFEA 1NWKA 2M8HA 3Q7BA 3N0VA 3CJSA 2BM0A 4Z4HA 5B0FA 5J2NB 4WP3A 2BOAA 4FM0A 2UXBK 3U9ZA 1R43A 4AD6A 3HHEA 4TLRA 3QU7A 2MUTA 4IG0B 2GWJA 1RSCA 1TAQA 2QI2A 1HBNA 1M5SA 3JPTA 1N5YB 4C1NI 1HHTP 3AO4A 3UQ0A 3WZ0A 3THYA 1UJ4A 3TU5A 4Y2VA 3EGWB 2ITGA 3TAQA 3MR3A 1YVUA 3AOAA 2BYCA 4DL7A 1K73T 7ICIA 2FPHX 5HRPA 1FDNA 4MMOA 3RJHA 4KMOB 1H2TZ 2DNPA 2FZGB 3T79A 1GLAG 3J80Y 2F40A 1DTTB 2NSCA 3JPOA 1PC4A 1UCVA 4JP8A 5L1MA 2JEIA 3HX0A 1XMQF 4IOCQ 1F5CA 2DBYA 5DLFA 4DS5A 4RW7B 3ZZ0A 2F4FA 4J5OA 3THXB 1LAWA 3H6EA 3BPDA 4LZDA 3LP2B 4Y2IA 4M5NA 2UXDF 3FK4A 3DHXA 2KVIA 1UPMB 3LDLA 3FMWA 5DB6A 3RMCA 4CJFA 4LF6K 2MJNA 2JRZA 2HW3A 1R6YA 4DUZK 4DFDA 1E6YA 1BXNA 3ILJA 4CTAA 2RQ4A 2DNHA 1FDBA 2XI2A 4TYAA 1HPZA 2OD6A 3BY5A 1OPIA 4WF9Q 1R0AA 4LSNA 4Y2AA 5TZVA 2EBEA 1YJVA 3SQGB 1S1VA 4CHYA 1U6FA 3WBZA 5I4MA 3H42A 4H4KC 1E6VA 4ZDNA 4MKVA 5ETSA 3TR8A 1JJ4A 3FR0A 4P9SA 5GADU 1OWXA 4DU1A 3O6QA 1BLUA 3MM5B 1CJKB 3OTOF 4X62K 1O1WA 2K89A 2L9DA 3PJ9A 2DH9A 3HI0A 1MROB 3CVKA 2MGZA 4CD1A 2OFHX 2FHJA 2XMKA 5GAGU 3ZCMA 2CQCA 1U4BA 4F0MA 1TK8A 3W65A 2WK4A 1KKXA 2VU5A 4A5AA 1RWNB 2K2PA 2VGMA 5D46A 2DGSA 3ICLA 1Q81T 5AHXA 4NLGA 3VAKA 2F8SA 1Y88A 2NUUG 4LSZB 1KXPA 5J0RA 2VPWB 2N3OA 2I7PA 1HWLA 2YKOA 4JI7J 3RB0A 3I0SA 2K4HA 5AM4A 5KFSA 4KY3A 5HMLA 1Y00A 2HHWA 2Q4TA 1EWRA 4NRTA 4UB2A 4DX7A 1VQ8N 2HNZB 3F2CA 1P6TA 1RTDB 4K0KK 4MH8A 5EOZA 2CN1A 4QIGA 1FFVA 3MCOA 3VENA 3O9QA 4GLXA 1G4CA 4DZ6A 2IVYA 4JI8J 4KHMA 4DR4K 3TKAA 2RKIB 4ZA1A 1M90O 2I0XA 3U1LA 1QM9A 2LU1A 4IO8A 3P1GA 5JLHA 3RR8A 4YORA 4Q7AA 4MJKA 4ZVPB 3KLHB 4OZJA 1FRLA 2IS3A 5I3UA 4YOYA 4Y2MA 1TUUA 3CJ0A 1GTHA 2R7SA 3QT5A 4AHVA 4BE2A 1M5VC 5ALWA 2HRYA 2CZ4A 2C28A 3VMFB 1RNHA 3UXOA 3PR5B 2G2YA 4DTSA 1RILA 3NF8A 1L3SA 5L1KA 4Z4FA 1HBUB 1HJPA 1OH8A 4EHUA 1ZA2B 2WHOA 2QEXN 2VKZG 3D2WA 4I2QB 2CG8A 4A4JA 4NASA 4N56A 2HHUA 4OPHA 2YTCA 5CH7B 1W9HA 3V7KA 5ALIA 4MN4C 1QVFR 4KTZA 4HTLA 5ALRA 3UDEA 3EZUA 2WF7A 2ZUAA 1X60A 2M70A 4OKEA 3WU2U 3SDEB 2QA4S 3O4NA 1ZBFA 1D3WA 2DUYA 2ROGA 4MDAA 3WC2A 3O6WA 3M9MB 3HPGA 3JXUA 3ZLJA 2L9NA 3G4SN 5J2EA 3C7NA 4BRMA 9ICTA 4PCQA 3KWIA 1WDDA 4JI1K 5GADI 1RADB 2DIUA 4M94A 5CXTA 1SCJB 1HNVA 3WQUA 2FPMA 5ADXA