3TAQA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3taqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3taqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3taqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3taqA01
2A1RA 1C1BA 4JK1A 4LSLA 3HYFA 4UBCA 5J0OA 4DEZA 3AA2A 3GV5B 5CY4A 1HQEA 1S0OA 4CJQA 4QZBA 3SQ4A 4RUCA 4ECTA 1S6QA 4ELVA 9ICBA 7ICLA 3PX4A 3CM6A 4CK1A 4GW6A 4KHSA 1ZQCA 1NOZA 1Z3EB 4I2HA 2A1JA 4QZAA 4KLJA 3PY8A 4KKOA 2HHTA 5J2EA 4DFJA 3PR4A 4KLFA 3NDKA 1NK7A 4FK4A 4W5RA 4NLZA 1RT2A 4N41A 1CLQA 2J6SA 1ITGA 3ZT3A 2VG7A 5DG7A 9ICTA 4BGDA 2KZMA 3AU6A 3MR6A 4QW9A 1Q8IA 1DLOA 2KZ3A 4F5OA 4RNOA 1RYSA 3HM9A 1VRUA 3TAPA 3VA3A 7ICUA 2OPSA 4RQ1A 4BXOB 2FMSA 4L8RB 1WSGA 2G8FA 2F8SA 4DL3A 2IC3A 1FKPA 3SQ0A 3UQ2A 5CA7A 4EBEA 5J2AA 5C5JA 4CEBA 3P83D 1RT6A 4DU3A 1ZJNA 5DQGA 5CZ2A 3VQDA 1TAUA 3C23A 3O3GA 5KFQA 4YD2A 3TARA 3JPRA 1ZQQA 5J2NA 3HO1A 3UQ0A 5J0QA 2W8LA 4QZFA 4UB4A 5KT2A 1Z25A 3RH4A 3H8JA 5J2MA 2FBYA 2BQRA 5KFYA 4DTRA 4DTMA 3T5JA 1MC8A 4DS5A 5KFOA 1BPDA 5J2CA 4HTUA 1KVAA 1S5JA 8ICFA 2Z1GA 4N47A 5KT6A 4M3RA 3H08A 4IDKA 1ZBIA 1SKSA 1QSSA 1JXLA 3OJUA 2LYHA 3MGHA 3TI0A 3C5GA 5HMMA 4YP3A 4G1QA 4DMNA 5FRNA 5IIMA 5CYMA 5KG4A 7ICVA 1TL1A 4UAYA 1D9FA 3V9XA 1RNHA 2ZTEA 1Z00A 4XIUA 3RBDA 1UAXA 4N56A 4OPJA 5L1JA 4J9OA 4RW9A 3NBPA 3K59A 4I7FA 4DTNA 3M8RA 3CFOA 3MFIA 3AVHA 4W5OA 4CJKA 1ASWA 4O0IA 4CJFA 3KLIA 5DQHA 3ZT0A 4OKKA 4BXOA 3B6PA 5KFVA 3IG1A 4DQRA 4CESA 2AQ4A 1T7PA 5KFSA 4FO6A 4BDZA 2ITGA 4MQ3A 4QZ8A 4FBTA 4I27A 3SUNA 1TV9A 2VWJA 1ZJMA 4FJ8A 9ICAA 4R5PA 4HCBA 3NGYA 4IBNA 4FJIA 1IH7A 4QWBA 5D3GA 4W5TA 4FJJA 1SKWA 4ED6A 3CYMA 3PO5A 1Z26A 4CK2A 5HBMA 2G8KA 4F4KA 2FLPA 2BQ3A 4QCLA 4GXIA 4CJRA 4F3TA 4DQPA 4OKJA 5CP2A 5BOLA 3WNEA 9ICEA 3HVTA 4LVSA 3V6KA 1S9GA 3F9KA 1I39A 2NRZA 4B9MA 1X2IA 3K5MA 4CHPA 3QNOA 5KG7A 1WAJA 4PQUA 4Z4FA 2Z1IA 1NK9A 3RR8A 2ASLA 3UXNA 4GMJB 3PW7A 3QEAZ 4CHYA 4Y1CA 4XQ8A 3OHAA 4EYIB 3PNCA 4DWIA 1BI4B 1WSJA 4DFKA 2UVUA 9ICHA 2RDJA 2MUTA 2PFOA 4KLDA 3OS0A 4FM0A 4ICLA 9ICVA 4PWDA 2KFNA 1DOQA 4H8KA 9ICPA 2PZSA 4DU1A 1TL3A 2ISOA 4GLXA 8ICCA 4JS5A 3QIPA 1U4BA 4KLHA 1VSMA 4FW1A 4RQ7A 1ZQIA 4QZEA 4G3IA 3DM2A 3MXJA 2YKNA 4FXDA 1X9WA 1JLCA 1DGSA 3TFRA 4QZCA 1ASUA 5J2GA 5J0YA 3LAKA 4FJXA 4KB1A 3RMBA 3AVKA 2ISPA 1CUKA 1JX4A 4E1MA 3SJJA 3GV8B 4DSKA 5J1EA 4LZGA 3PO4A 3DRPA 4DLGA 1HYVA 3LAMA 4MFFA 1NKCA 1RBVA 4KFBA 4FLVA 4ECUA 4O3PA 1J53A 2ZD1A 1VSEA 3NGDA 4I28A 4GC6A 2BE2A 4LZDA 5KFLA 1LAWA 4GVMA 3H8WA 8ICEA 4JWMA 3D45A 3E01A 3AA5X 2IS3A 2YV0X 2RKIA 4FZYA 1JL1A 1RTIA 4IG0A 1JXEA 5DGBA 4PH5A 3ZDEA 1L3TA 4M04A 4RW7A 2ASDA 2ATQA 1S77D 3T3FA 4FJKA 2HVHA 4X5VA 3VQQA 3S3NA 1ZQEA 1RXVA 1WCNA 2JEGA 4CF2A 5IILA 1IKWA 3ISDA 4CJLA 3A2FA 1C6VA 3VQPA 5HRPA 4M9GA 4QZIA 3TR8A 7ICIA 1XC9A 1ZBUA 3OYKA 2PFQA 1RT1A 4BDYA 4FJ9A 1IKVA 8ICWA 4R8UA 2IAJA 1NOYA 4PHAA 1QSLA 2IBKA 4I29A 4JRPA 4O9MA 1ZQUA 5CHGA 3L3VA 3ZSRA 3ZD8A 1MQ3A 4CEQA 2D0CA 3KTQA 3MAQA 2KFZA 2VA2A 4QWEA 2YHBA 4PGXA 3EW9A 2DFHA 3C2LA 1KEJA 5J0RA 4KPYA 2XY6A 4DL5A 2C22A 3P1GA 8ICGA 5HHIA 3NFAA 2RF2A 3KLFA 5KFRA 2BANA 4FVMA 4RNMA 1WLJA 4IRDA 4EBCA 3MXMA 3Q8QB 5KFMA 5DBBA 9ICLA 4KHYA 5KT7A 2A1SA 1CXQA 4LSNA 4CF8A 3SNNA 4I9QA 5J2JA 4YR0A 5DKWA 4Q8FA 5IIKA 3GIMA 2AGQA 3TAQA 4N76A 4FK2A 9ICJA 3V7LA 4QOZB 1LAVA 4GXKA 4O5BA 3QINA 1ZQAA 1S1WA 4EP5A 2B6AA 2G8VA 3QNNA 4CJEA 1WSEA 4LD0A 1FXXA 3PX6A 3S3MA 2F96A 5CZ1A 4E89A 5KG1A 1JLEA 2C28A 5CJ7A 5HRRA 4I2QA 3AO5A 4ECVA 1JLQA 2ZQBA 3KLHA 4YD1A 2QKKA 3T5LA 5I42A 3O3HA 2NUBA 3H40A 2IHNA 2HHSA 4CJ3A 1XS9D 2AGPA 2BCRA 1VSIA 1MQ2A 3ZCMA 1NJYA 4KREA 5KRSA 1TKTA 4AH9A 4F4XA 4C8KA 5DB7A 4Z6CA 3L3UA 1B92A 2G8UA 3WNFA 1T3NA 2PXIA 1ZQKA 2E4LA 2HB5A 1TV6A 3SUOA 5BPCA 5J0WA 1L5UA 3BDPA 2HW3A 1N6QA 2OYQA 1LWCA 2KN7A 2X6SA 3C1YA 4MF2A 2FBVA 3MR5A 4UB1A 4DSLA 2JLEA 4QW8A 2FBTA 5KFKA 3Q8KA 1S1UA 2JGUA 1JLBA 1IKXA 4HHTA 9ICRA 3DI6A 4DOBA 2GUIA 3VQEA 1TVAA 3MECA 4XA5A 2A1JB 2RN2A 3V1QA 1D5AA 1QQCA 3VQ6A 9ICQA 5SWMA 4YG2A 4F4ZA 2B5JA 1NJZA 4AHSA 4ED2A 1NK6A 3GFKB 8ICZA 3TFSA 2BQUA 2PFPA 4E7IA 5DB8A 5J0TA 1F21A 4FBUA 4B3OA 2XC9A 3OYJA 5KFXA 3IAYA 7ICJA 1ZQWA 4O5KA 4NY8A 9ICUA 3QZ7A 3EZ5A 4KHNA 7ICFA 2FLNA 3ZSXA 5DB9A 4CHQA 3DMJA 2R8HA 4RT2A 3CFRA 2Y1IA 9ICMA 4NM1A 4IG3A 1W9HA 3ORYA 4M9NA 1IG9A 2BPCA 2O4IA 1QSYA 8ICKA 3IRXA 5CWRA 4CGFA 8ICSA 1ZBLA 3ZDCA 3KIOA 5KFCA 3MEGA 4I2IA 2AGOA 4JLHA 4HUEA 4J9MA 4NCBA 1YT3A 2QKBA 4J2EA 7ICTA 1ZQGA 1ZQVA 1C1CA 4RG8A 5J0PA 4RQ2A 1ASVA 1SZPA 4IRKA 1A77A 4DF8A 9ICKA 3NHGA 3HK2A 3UXOA 4CJ4A 4IRCA 3PW4A 5KFJA 3JPQA 3O4QA 8ICQA 1HNIA 3C6TA 4M3YA 4DL2A 5DG8A 4ED3A 2KQ2A 3RTVA 4OPKA 1T03A 4CGHA 3KHRA 3AA3A 1EX4A 4M45A 1ZQSA 4M3TA 1KVBA 5C42A 3PV8A 4E0DA 3K4GA 1H38A 9ICXA 4O5CA 4KB0A 3HT3A 2ZUDA 3AV9A 5CYQA 2P6RA 2GWSA 1Z00B 4K4GA 4IQUA 2BCQA 1I3AA 3SV3A 3VN5A 4I2JA 4FJ5A 4EEYA 4RZRA 4CJPA 4K8XA 4NCAA 1NK0A 4FLYA 3V1RA 4YCXA 4F4WA 1QS4A 1KTQA 4CEAA 3ULDA 3Q8PB 2DFFA 3WNGA 4DSFA 4OGEA 3DLBA 4YMNA 4FJGA 4DFPA 4RW4A 1LWFA 5L9XA 3LP1A 3JSMA 4YR2A 4B08A 4Z4EA 4DTPA 4P4MA 1T8EA 3AO3A 5HRSA 1XSLA 2DY4A 4KLSA 1PZNA 3QESA 1TFRA 4C8OA 3V9UA 3M8SA 3GIIA 4CHZA 3KKRA 1L3UA 3SI8A 3OYGA 4KLMA 4CHNA 1VSLA 1WNSA 1RTJA 5KFNA 4CJWA 3PMNA 2WOMA 4Z6EA 3PVXA 3LPUA 4FZZA 4FCYA 3UPQA 1BISA 1RTDA 3B6OA 4AHTA 1BPBA 3BGRA 2Z1JA 1JIHA 1TKDA 4F5QA 2P1JA 4B8AB 3C1ZA 9ICNA 3VQ4A 3TAGA 4PGQA 2PYLA 2X74A 3O4NA 4YMOA 1HYZA 5L1IA 4ED8A 1B9FA 2ASJA 2MUTB 2F1HA 4CEFA 2ZUBA 3S3OA 3Q8RB 4TUPA 3G6VA 2XY7A 4DSEA 1BPZA 1ZQDA 3OYEA 3HPGA 3LP3A 3QERA 1KLNA 1NJXA 2RPIA 2P5OA 3PUFA 4CGGA 4E19A 4CIFA 3TABA 2W9CB 3DOLA 3OYAA 4RUAA 4EYHB 3NE6A 4Z0UA 4NXZA 2NRXA 1HJPA 1BCMA 5J2KA 2XGQA 5HP4A 1RT5A 2YNGA 2E6LA 2W9MA 7ICQA 4F91B 3I8DA 4HYKA 4DTJA 1J54A 5KFIA 3KKSA 5EOZA 8ICTA 1KCFA 4B9UA 4FS2A 4ECZA 1WCLA 4JV1A 4O3NA 4BWJA 4EZ9A 4TQRA 8ICYA 3OYFA 3LWMA 4M3UA 4J2DA 2V9WA 1BIUA 1C0MA 3M8QA 3M8PA 3ZSQA 3GIKA 1VSDA 2HNZA 3KK3A 4OLBA 2AJQA 4Z6FA 4KTQA 2X78A 1L3VA 1VRTA 2HMIA 2BGGA 4DOCA 4ECYA 3MEEA 4FLUA 7ICEA 3QEWA 1X1PA 4IFYA 1XSNA 5J0UA 3BQTA 3C95A 4M3XA 5KFPA 3V1OA 1CXUA 2R8IA 1YTUA 3I0RA 2AU0A 2XY5A 5EWEA 2YNHA 4DTSA 1RBSA 5T7BA 4CF9A 4CJSA 4I2BA 2ZJAA 4R8UB 1XI1A 3HP6A 1S9FA 1HQUA 3OYBA 2PFNA 3ZDBA 5DGAA 3WNHA 4R63A 4CJTA 1X9MA 4FS1A 2DFLA 1RILA 3C2MA 4M9HA 1ZQJA 1FK9A 3M9NB 1ZQRA 9ICGA 4OLAA 3RAXA 2W9CA 3SPYA 3MXIA 2YHAA 4CEZA 5CB1A 3BQ1A 4CIEA 1XWLA 2KZZA 8ICOA 2G8IA 4O3QA 2KW4A 2ZJ5A 3ZSWA 4YVZA 2NRWA 4M3ZA 1S76D 3B0YA 4UBBA 4DU4A 4M9JA 3QE9Y 5TZVA 4CHOA 3RJEA 1GOBA 4J9QA 1UA0A 1ZBFA 4AHVA 1GOAA 4E3SA 4KLGA 7ICMA 3RWUA 2HHXA 3NGZA 3T19A 3F73A 1J9AA 2IGIA 3DLRA 1S10A 2VA8A 2PI4A 1J5OA 1IKYA 4C8MA 3VQBA 3NF6A 4I2AA 1ZYQA 4QWDA 1ZQNA 2X6NA 3C21A 4IR1A 4B9SA 4R65A 8ICLA 3LANA 3DOKA 3HX0A 5KFTA 3KHGA 4E7KA 4DOAA 3CM5A 3AVLA 4LH4A 4KITB 1UOCA 1Q9YA 3V6HA 1JKHA 2Z1HA 1YTAA 4JUZA 2XO7A 5HROA 2Q3SA 4FLWA 3GILA 7ICGA 4B9VA 3SUPA 4CJUA 3KLEA 4YMMA 3AVJA 4ED1A 5KT5A 4ZTJA 4PA1A 1SV5A 3K75D 5J0XA 3ISBA 4NYNA 3UXPA 2JEIA 4MFAA 3RJIA 4FJNA 4KHQA 3RB0A 4PHEA 4Q8EA 3AVFA 2HHWA 1RBTA 5SZTA 1D9DA 3EPGA 4RQ5A 7ICRA 3HVRA 5KG6A 5D49A 7ICHA 2ZUCA 3ZDAA 3RMDA 2DFEA 3RJFA 4UAWA 4TUQA 3ITHA 3ZSZA 4QZHA 3ZT2A 1SL1A 4DFMA 5KGXA 5KG2A 3GDXA 3HL8A 3ZSVA 4ECRA 1VSFA 4Z4HA 3N97B 4M0AA 4H4OA 4E7LA 4PUOA 1HRHA 3BJYA 4DLEA 5JUMA 3FYHA 3PX0A 2YKMA 3AVIA 4CERA 5F9NA 1QE1A 1RBUA 1U45A 2FLLA 4F2RA 4C8NA 1D8LA 1CEZA 2NRVA 4ED7A 4GXJA 2O4GA 4DL7A 5JS1A 2VG5A 4CFCA 1WSIA 5J0SA 1BCOA 1EP4A 2FBXA 3U6FA 1QHTA 3RH6A 2XCPA 1LB2B 1XHZA 7ICOA 4YXJA 2OWOA 1K1SA 2XHBA 3PR5B 4N5SA 3ZSOA 5J2QA 4FLXA 1NK8A 2AQ0A 1ZQHA 4F8RA 1RT4A 5I3UA 3RBEA 4PGYA 3NH1A 5L1KA 3CG7A 5D46A 5E41A 3ZT4A 5EWFA 3TWHA 2XRIA 1C7YA 3DLKA 4O3RA 3RB3A 2B21A 4ELTA 5DBAA 4FM2A 3RAQA 5KFHA 3BQ2A 3OYHA 4RNNA 2DPIA 2PYJA 2ZJ8A 5KFEA 5JS2A 4YNQA 1S0MA 5HRNA 1U49A 4FJMA 4CE9A 1KFDA 2HHVA 5KFUA 1ZQTA 3L8BA 3KLGA 1HMVA 1SUQA 4M42A 4Y1DA 3RH5A 5HLFA 5DDYA 4BE1A 1GOCA 2OA8A 2WONA 1VSJA 4B9TA 1K1QA 8ICIA 3VQ5A 1XO1A 3VQ8A 1ZETA 1BHLA 1A5VA 4DF4A 1EKEA 5DLFA 1IM4A 3OVNA 3HJFA 5KFGA 1MU2A 3EPIA 1UT5A 4MEYA 1Y88A 3AO2A 9ICCA 1C1AA 4CEDA 3PW2A 4MFCA 3DRSA 4M2YA 2HHUA 1SKRA 1S6PA 3C94A 4Z4IA 3OS2A 4DQSA 1BPYA 3V9SA 4KLTA 5J2DA 4Q0BA 4JV2A 4QAGA 2Q0ZX 2YNFA 1A5XA 3TQ1A 4IQVA 2UVRA 4RU9A 2D5RA 1Q9XA 3DLEA 2UVVA 1U9LA 1RDDA 4FJ7A 1L3SA 4F3OA 3K5NA 1N48A 3V81A 2HVIA 3ISNC 1ZQLA 1RDCA 3Q8MA 3E2EA 4P4PA 2W8KA 2F1JA 4PPXA 3L2WA 4TSXA 2J6UA 4F4YA 3OYLA 3C5FA 5DB6A 2JZBB 3T1AA 3SI6A 3MEDA 5KFWA 5KFAA 4F93B 8ICAA 2R8KA 4FM1A 1A76A 3JYTA 8ICHA 3NCIA 3MFHA 1KLMA 1HNVA 3EWAA 1B9DA 3ZD9A 1RBRA 2KTQA 3KHLA 3OSPA 2VANA 3LDSA 3G0ZA 8ICRA 1LW0A 4QWCA 3LP0A 1ZQYA 5KG3A 4P2HA 4BWMA 4FZXC 4CGJA 1NOMA 4DS4A 3TAMA 1EETA 1KVCA 4DG1A 1KRPA 3RB6A 3L2QA 4I2PA 4JV0A 3K5LA 1N5YA 4H4MA 3AO4A 3V9WA 4FLTA 4PHPA 4PY5A 3HP9A 3QEPA 4FJLA 2W9BA 2IA6A 1BPEA 4RQ6A 5DDMA 1HJRA 5IIOA 2FMPA 1T05A 2OZSA 2ETJA 4E1NA 2QXFA 3H7IA 1BQMA 4DTXA 2P5GA 1K6YA 4KRFA 2NRTA 2GV9A 4FW2A 4KHWA 4EP4A 1NKBA 4K4IA 4KI6A 4OVLA 2G8WA 2XY8A 2BPGA 3K5OA 1ZQOA 3VQCA 2VA3A 1ZQFA 3LZIA 4O3OA 2W9AA 2R8JA 2JZBA 4KHUA 3OJSA 3MR3A 3VA0A 3HPOA 2WTFA 1HUOA 3VQ7A 3ZT1A 4MF8A 2FMQA 4P4OA 2ATLA 1U04A 4RPYA 2I5JA 3AO1A 2BGWA 5F9LA 2G8HA 1X9SA 3ISCA 1SL2A 5J2IA 3PW5A 4UB2A 2ZTDA 5BOMA 4XRHA 3KK2A 3CQ8A 2GBZA 5EU7A 2MAXA 2HNDA 1W0HA 5HP1A 4YXMA 4RPXA 3HPHA 3AVGA 1S97A 4O0JA 3VQ9A 3UIQA 1U47A 9ICOA 3ASMA 1BIZA 3ETLA 3G10A 3KK1A 4UB3A 3M9MB 5IIIA 4RQ3A 7ICPA 4CF0A 2V4QA 2IMWP 5DQIA 1DTTA 2R7YA 3K57A 4O55A 1R0AA 4Z6DA 5KG5A 1QLNA 1WSHA 3EYZA 4F92B 4CGIA 3JPPA 3AUOA 1JL2A 3U3YA 4W5NA 4HCCA 4I2FA 3K2PA 2EHGA 1JMSA 3T5HA 3V4IA 5IINA 1RT3A 3MGIA 4QWAA 4UQGA 3LZJA 2I9GA 4YR3A 1RDBA 1RDAA 4I9LA 1BPXA 4LH5A 3NH0A 5KFBA 9ICIA 3MDAA 4W5QA 3SZ2A 4F2SA 4AHCA 1NKEA 3OGUA 4JRQA 3MBYA 3RJJA 3V9ZA 4CEOA 1CZ9A 7ICSA 4QZ9A 4J9KA 4DQQA 2LSNA 3FFIA 3H4DA 1KSPA 3LK9A 2EX3A 3L2RA 5C25A 4BE0A 1RXWA 1C0TA 4ELUA 2HHQA 2HNYA 4AILC 4Q43A 1NJWA 4CFDA 1S1XA 3NAEA 1B22A 7ICKA 3AA4A 3V6JA 3Q8LA 4K8ZA 4J9PA 2C2RA 5J2PA 8ICUA 2JEFA 4QZDA 3GQCA 4KN7A 4OGCA 5DG9A 2FC0A 3OYCA 9ICWA 3G6YA 5J29A 3ZDDA 3AVBA 1RYRA 4EZ6A 3TAFA 3PMLA 1Y97A 2BCSA 5J2BA 1S1VA 2W42A 4FJHA 1WN7A 4IR9A 4B9LA 4BACA 3V6DA 1BGXT 1REVA 3LDAA 3QETA 4KLLA 3N4MB 2B4JA 4I2GA 4PHDA 1JLGA 3LALA 4E7HA 3MABA 4UB5A 3B0XA 4Z4GA 4CFAA 4CJVA 1HPZA 2QK9A 1S0NA 3H4BA 5FRMA 4F5RA 3HSTB 9ICSA 2XGPA 3SYZA 5DMRA 3HWTA 8ICJA 5L1LA 3ALYA 4GC7A 1RT7A 3IS9A 4DQIA 3PW0A 3DLHA 5KFZA 3OYDA 2BHNA 5FDLA 3L2UA 4Q44A 1JXBA 1TVRA 2ZE2A 3SV4A 4J2AA 3GV7B 3QEIA 3OS1A 1WAFA 3JPNA 4RQ0A 2E6MA 2FPKA 4ZH4A 2OZMA 4O44A 3LPTA 2FPLA 3THVA 4OKEA 1ZQZA 1BL3A 4F50A 1TK8A 2OPPA 2FPMA 5KGWA 4RQ8A 3KD1E 1UT8A 1JLAA 4E7JA 4ZTFA 3IM1A 3ZSYA 2BPFA 3SQ1A 3AVAA 5C24A 4LY7A 4ZHRA 4NLKA 1COOA 8ICVA 1KFSA 4R66A 3OHBA 4J9LA 1UA1A 3HXMA 4DL4A 1HUZA 3OYMA 3C2KA 2UVWA 1YVUA 4ED0A 4J9SA 2J6TA 3V72A 4R64A 3BQ0A 4DTUA 3RJGA 2D0AA 2RDIA 3Q8SB 4RT3A 1WSFA 2F1IA 4KTWA 1SL0A 3RRHA 1U48A 1BI4A 2BKEA 4TQSA 1FKOA 3AVMA 3OYIA 1UWBA 3V7KA 4CJ5A 3SQ2A 3SPZA 3VQAA 2Y1JA 1QTMA 1TGOA 4CIGA 4K4HA 4KMUA 5DBCA 4CF1A 4TUSA 4HUFA 4NYFA 1TKXA 2VWKA 4ID5A 1A5WA 9ICFA 4KI4A 2YNIA 2I1QA 4CK3A 4DTOA 4I2EA 4KAZA 5HNKA 1NK5A 4ECWA 1RTHA 4KLUA 5K14A 4CGDA 3TAEA 3FDSA 3LP2A 3RJKA 4O4GA 1IXRA 1TK0A 8ICXA 2C2DA 4KV8A 4C8LA 4F5PA 5FROA 3LWLA 4ECSA 3DYAA 3K58A 3QIOA 1O1WA 3QLHA 7ICNA 3O3FA 4I2CA 3QEBZ 3OYNA 4QZGA 2IHMA 3C6UA 3G6XA 4I2DA 2OPQA 1KFTA 1S9EA 4KLEA 4O3SA 8ICMA 4M6WB 4KLIA 1RPLA 4NM2A 3RJHA 1LW2A 4YN4A 4CFBA 8ICBA 3EY1A 1JN3A 4B9NA 1V9PA 1TK5A 1D8YA 4IQWA 5DLGA 1T4GA 4MEXA 5J2HA 3OY9A 1XHXA 1BQNA 4KO0A 8ICPA 3QEVA 4O5EA 2ALZA 2DTUA 2BDPA 4AHRA 4XUSA 5KG0A 4IFVA 5KT4A 1CZBA 1VSHA 2BCVA 3NF8A 4AHUA 4ECQA 2V4RA 1DTQA 3KD5E 1ZQXA 2R8GA 4HUGA 4Q5VA 5EWGA 1N56A 2P51A 3P5JA 2ZTCA 5HHHA 4M9LA 3L2VA 3SCXA 1XSPA 3AVNA 5D4BA 4Z4CA 1LV5A 4M41A 3GIJA 2VG6A 4CECA 3CFPA 3KHHA 2F8TA 2BR0A 2OPRA 1MSWD 2IDOA 3M9OB 4NLNA 4ECXA 3DRRA 2P6UA 4CCHA 3NTUA 2DPJA 3D0PA 1BVSA 1TKZA 3KJVA 3RMCA 1ZBHA 5CR0A 1G15A 1RZTA 3AU2A 5KFDA 4YQWA 4J9NA 1EXQA 3SUQA 3QO9A 4CEEA 1IO2A 2JEJA 4MFBA 3QEXA 1VK0A 1ZQMA 5KT3A 3JPSA 2W9BB 3RRGA 1JLFA 3RB4A 4NCGA 3NF9A 4FK0A 4Q45A 4BDPA 2D0BA 4M6WA 5DK5A 4DL6A 3NH2A 4IQTA 4EBDA 3HW8A 5J2FA 4OJRA 3I0SA 3MR2A 1S1TA 4B8CA 4RQ4A 1TAQA 3S9HA 1ZQPA 3U3GA 5KI6A 2XCAA 1S0VA 3V7JA 2PY5A 8ICNA 3H8SA 4JS4A 2M9NA 1VSKA 4WE1A 1ZQBA 3RMAA 4IKFA 3TANA 3T5KA 4M3WA 1C0UA 3NF7A 1HYSA 1NK4A 4YFUA 4DO9A 3RR7A 1KDHA 4HVJA 4DSJA 1EXNA 4J2BA 4J9RA 4KTZA 1LWEA 3JPTA 3DLGA 4RW6A 4RW8A 1B43A 4KN4A 1RCHA 3QZ8A 2BCUA 4KLQA 4ID1A 3IHQB 5HMLA 5IIJA 4DSIA 4M47A 5KFFA 2P66A 4FYDA 2C2EA 1XU4A 4TURA 3JPOA 4KLOA 3AVCA 5KTQA 4NLGA 5KRTA 3OSNA 1AROP 4YFKA 4F5NA 2IOCA 2PI5A 2H5XA 4RPZA 4JWNA 3NGIA 4BE2A 4FLZA 4UAZA 3MDCA
chains in the Genus database with same CATH superfamily
1FF2A 1C1BA 3ETMA 1U2VB 1XNQJ 4LSLA 1F9EB 3HYFA 4UBCA 2R7UA 5J0OA 4DEZA 1ZZFA 3GV5B 2CAJA 1DFDA 5EGYA 5CY4A 1S0OA 2HNDB 1YITN 4L3NA 3SQ4A 4K4ZA 4LMZA 3FBCA 4ZJQA 3CM6A 2F1FA 3PYEA 3SBGA 4JP8A 2VPYB 5JTIA 1YZ7A 3SSQA 5F41A 5EDWA 5J2EA 4H5RA 4CZIA 1RSCA 3NDKA 3QBWA 3VEOA 3UFCX 1CSJA 2OEMA 2A2CA 1ITGA 3H6EA 4WP3A 1VC0A 2O1PA 4PXCA 4RW9B 1HIYA 3NBPB 3MR6A 3FGVA 2E1CA 2H5EA 5M1FA 1AW0A 5L38A 3ZTSA 4RNOA 2UXCJ 2Z2MA 1FDDA 5AK6A 3TAPA 5KOWA 3QPIA 2VQEF 2IC3A 1YAGA 1K8AO 2AZ3A 3UN3A 1PVQA 5AXNA 3B82A 4I6MA 4QYRA 1TAUA 2FHJD 4FZVA 3CF5Q 5AT1B 2M70A 1C4AA 4OI3A 3VPZA 3HO1A 5J2NA 4QZFA 4F04B 4OX6A 5KT2A 3CJKA 3QU5A 3FZFA 3RH4A 1VQSA 3QJJA 4DTMA 3KUEA 5EE0A 1YK9A 3T5JA 2A41A 1MC8A 3CRXA 3QNWB 1HR0K 2F4VK 1FE4A 1V4TA 5J2CA 3SDEB 2ZJRQ 2F9DA 1X60A 1UVMA 4IO9L 1KVAA 3N0VA 2K4IA 1N5XA 4N47A 3H08A 2BKOA 2ZJQL 4IDKA 2Y0SF 2V0NA 1D3WA 2HBRB 1QSSA 2P6TA 1JXLA 4JYAJ 2LYHA 3TI0A 2ROEA 1CJUA 4G1QA 4DMNA 1W2IA 1SQGA 4Y2RA 4HDGA 3CC2N 2CDRB 5ETNA 7ICVA 2KXNB 3PXGa 2D3DA 4ZLNA 1RNHA 2KM8C 1Z00A 1ZM9A 3RBDA 3IP4B 2G09A 3K59A 4DTNA 1UAWA 1F2HA 3AVHA 5D78A 2Q3PA 3MM5B 1ASWA 3FMBA 2K89A 5A6PA 4NZ6A 5KL8B 4CJFA 1S7IA 3DM2B 3KLIA 5ALEA 1U2CA 5DQHA 3CETA 4BXOA 1COKA 1CBKA 1ESVA 2KOBA 4CESA 2L48A 2KIVA 2GGPA 5E3CA 1T7PA 4BJQA 3UDVA 4FO6A 2HYIB 4BDZA 1HR0J 2F4VJ 1T6DA 2CQ4A 1RHRB 2CPDA 4K43A 4FBTA 4I27A 4FPRA 4BUGA 2WAQD 3Q0AA 1ZJMA 2GHWA 2VIHA 2B4OA 9ICAA 4O44B 4R5PA 2IRXA 4FJIA 4OZNA 1IH7A 1WHYA 4DCPB 1BWEA 4BRHA 2KYXA 4EENA 2VPWB 1X0FA 3PFOA 3JXOA 3T6JA 4ZVQB 2BQ3A 3D7SB 5C24B 2RKIB 1RTIB 4IG0B 4OKJA 1EARA 2FC8A 4I67A 3WNEA 2GO7A 2XWXA 1R8CA 3FEZA 3DLLQ 3R8EA 2KJVA 1X2IA 4CHPA 3WXMB 4DCOB 2VKRA 5DDPC 1BOTO 3PJXA 4PQUA 4Z4FA 4WCEL 5A8WA 4K0KK 4C11A 2YMMA 3UXNA 2VASA 4GMJB 2XMMA 2LDYA 2LQBA 2NS1B 5HR7A 2FDRA 1VQON 1BI4B 4Y00A 4AQYF 2UVUA 2QL9B 4KLDA 4OYBA 2MMYA 2IAJB 5AKKA 1TL3A 5EX0A 4AL7A 4JS5A 3QIPA 4KLHA 2AW0A 2IOHA 1ZXOA 4RQ7A 1ZH5A 1D09B 4QZEA 3MXJA 5EE1A 1UVNA 1X9WA 1DGSA 1WHXA 3PEHA 4QZCA 5J2GA 5J0YA 4JI5K 4KB1A 1TE2A 3DRPA 4DLGA 5AM3A 3L6QA 4PPZA 1NKCA 2F63A 4FLVA 4ECUA 2W2NP 2HRUA 3DXSX 1SV0A 2JMGA 5AZJB 3NS6A 1J53A 2V8DA 5HJXA 4K0KJ 4GC6A 1FWPA 2FE9A 2BE2A 2BYCA 2HOFA 5IFMA 3AA5X 1SJFA 3TQEA 5DZ7A 4FZYA 4JHDA 1JXEA 1RAAB 4PH5A 4M04A 2KB2A 5JVGQ 1IN0A 1NBEB 4DV0K 3IGNA 4BC2A 3VQQA 4CF2A 4MTPA 2FSJA 4O0NA 1JLQB 1IKWA 3W62A 5EOYA 2G4BA 2ZIWB 4CJLA 1WEZA 1C6VA 2NYVA 2ZBIA 4M9GA 3CCLN 3LO3A 5IM0A 1Z2ZA 2Z57B 3G4SS 4JI5J 2Q0UA 3BF3A 1XC9A 4OX7A 1ZBUA 1I6JA 2ZIVA 3EGNA 4R8UA 1CI4A 4PHAA 2M88A 3TSQA 2W55A 3M32A 4O9MA 3L3VA 5CHGA 3GG0A 3ZD8A 1MQ3A 2RD5C 2PMZD 3MAQA 1LOTB 2VA2A 4NWIA 4P0PB 4TY9A 4A8EA 4AYBF 3NG8A 2V34A 2Y8WA 3EXYA 2KHQA 1RACB 5HHIA 4BRPA 4FKYA 1OH5A 2RQKA 2PT0A 2D0OA 5LSRA 4DV0J 3FEYB 3UD4P 4J8FA 1NUEA 5KT7A 2YB1A 2V4JA 4USVA 4GFJA 4CF8A 2Y9HA 2WF5A 4LIRA 1F3VA 4Q8FA 4MFBB 4P9SA 1BQXA 3N6MA 4OHZA 4NCGB 2MQ8A 1ZQAA 2VODA 3HVAA 4DR4F 2B51A 5F0UA 2B6AA 1BO5O 2YB4A 2CRLA 1FXXA 1XERA 2CQPA 5CZ1A 3P49B 5CJ7A 2LEPA 4I2QA 5HRRA 5A2QO 3NS5A 4ECVA 3KLHA 2QGFB 4YD1A 2ZIUA 3SMSA 2DTJA 2FSNA 2HFVA 5I42A 2NUBA 3H40A 2IHNA 3EKSA 2HHSA 2YMLA 2HAFA 1MWMA 1EB0A 3S8SA 3ZCMA 1C0UB 1AZSB 5KRSA 1HYSB 1TKTA 4AH9A 3THPA 3CJQA 1VQNS 3OL8A 5DB7A 3OFHA 3KG4A 3DLGB 2CPHA 1AA1B 1Z4OA 4X62K 2H3FA 3AGRA 4DPWA 2F7TA 4JK9A 5IC6B 1WJ9A 3G86A 4AFFA 4ZKAA 2OYQA 4DR2K 2W2PP 4NMXA 3THTA 2FBVA 2Y1RI 4QW8A 1U0HA 2P8IA 4LSLB 4ZIVA 2J8AA 2VFUA 1JLBA 1IKXA 3A0IX 2QB0B 4HHTA 3DI6A 5BR8K 5KQ8A 3POTA 3MECA 4FWSA 3P39A 5AZIB 9ICQA 2MLZA 5BYRA 2MGZB 4KX3A 2AF6A 1FFUA 1NJZA 4AHSA 4ED2A 2Y0BB 1NK6A 4I69A 1X3NA 1TFYA 3SFGA 2HI0A 3TU5A 4B3OA 3SK3A 2QSFA 3IAYA 3I33A 4YB7A 4H54A 4J03A 4BRDA 1T44A 4LF1A 4O5KA 1MA7A 2CDQA 1X6JA 3UKUB 9ICUA 3W3DA 4X62J 1SWWA 2HSTA 1HI8A 4CHQA 2R8HA 3UMGA 4RT2A 3U7JA 3CFRA 2Y1IA 3EZWA 3ORYA 4DR2J 5DO2A 1RWVB 1IG9A 3L7UA 2O4IA 4L76A 4OJGA 1AFIA 4RUHA 2QMWA 4CH1A 4CGFA 1Q79A 4K5SA 2Q31A 4I6MB 5KFCA 4I2IA 3CIMA 3DHWC 4J9MA 5BR8J 1YT3A 4UZCA 3SEOA 2VFRA 1F0XA 1ZQGA 4CLUA 5AQSA 4RG8A 5J0PA 4RQ2A 5J2NB 4M63C 1KQKA 3CJKB 1SZPA 2AX1A 3LPEA 3DXKB 3QB0A 4DF8A 4IJNA 2XULA 3GFZA 2J9DE 2YH1A 1KN5A 4ZVHA 1KAZA 3JPQA 5G5HA 4GKJK 1HNIA 2OO4A 2DHSA 3K2YA 1R8AA 5B0DA 1KWMA 2MXYA 3LOUA 3AA3A 4M45A 4YDDB 5JRTA 5GIOA 1CJUB 1H38A 4G1QB 4EELA 2K3IA 1NB2A 4A48A 2BV3A 4KB0A 5CYJA 2FVSA 3EJMA 1GNKA 2XM3A 3ID8A 1CPZA 2GWSA 1Z00B 5CRXA 2CG4A 3U26A 4K4GA 2NLXA 1NXIA 1X9XA 3WKAA 2YPYA 4P7VA 2LU2A 3GE9A 1FW6A 3AD9C 2UU9K 4RZRA 3GCWP 3KLIB 3CULA 4NCAA 2M8HA 3V1RA 1Y4ZB 3QU4A 2MJNA 3MCPA 4OGEA 1Q81T 2NQPA 4IOCL 4C3KA 3FCVA 4DFPA 2IY5B 5BR9A 5L9XA 4RNHA 4YR2A 1RAEB 2CQDA 4F3MA 4B08A 4GKJJ 3W5XA 4DTPA 4P4MA 3E0FA 5A2QU 4TU9A 2WAQC 3CXCR 4R5PB 4OL8A 2BDUA 4P75A 4ZVFA 3IRWP 4KLSA 2FHKA 4A62A 1TFRA 4C8OA 3V9UA 2XLKA 3QESA 3M8SA 4CHZA 1L3UA 4YHHK 1VYAA 3M8QB 4WFZA 3M8PB 2Z8QA 3IFRA 1T9TA 2QMUB 3HILA 1RZMA 4IS7A 4O23A 4DHYA 2AMCB 3NVWA 2HRYA 3LPUA 1VRTB 5AQRA 3B6OA 5AK3A 1D4XA 1BPBA 4IOBA 4PQUB 4OI2A 2UU9J 2Z1JA 1TKDA 3MM6A 4F5QA 3D0IE 2O8DA 5AJ3J 2YKPA 3PIOQ 4CYUA 4A8YA 4DV7J 2MA1A 4USKA 4YMOA 1HYZA 4RTFD 5AFUA 2KHCA 1VQLS 4BC3A 1EWQA 2OJ3A 4ZCIA 5AQNA 1N33F 1WYGA 3G6VA 3MDQA 1WC5A 4ES1A 1UETA 3DGPB 1YRXA 1FJCA 1YRTA 4F71A 2R42A 2OM6A 4PCQA 2P5OA 3TZZA 4CIFA 2DBYA 1YJTA 4GMKA 1FK9B 2YPZA 4YHHJ 2NLWA 3IWNC 2A42A 4DV6K 2MJUA 2NXEA 1D9AA 3M4XA 4DU7A 3NE6A 2FUG9 4RUAA 4Z0UA 1O5JA 1PJ7A 2XMAA 4F36A 5AM5A 2R18A 4DV4K 2Z2LA 1L7MA 2W9MA 1SIZA 2GHVC 3JTNA 1TQLA 2NXNA 4HYKA 1KQSR 3NCQA 5KFIA 4B9UA 4FS2A 2WTUA 2HFZA 1JI7A 4B1ZA 4EZ9A 4TQRA 1JCFA 3OYFA 1B0VA 2JDJA 2CJXB 1UPMB 3GIKA 2KT5A 1TR0A 4IO1A 3W1YC 2HQ3A 4AF1A 3I6PA 4NLDA 4L3KA 3BGLA 2GWJA 4Q7AA 1QQOA 2BGGA 1HBNA 3T69A 4J91A 3AB2B 4FLUA 1R43A 1MG7A 5J0UA 3RG6A 3JAMO 5FPEA 3RF9A 1CXUA 4NLYA 4U7CA 1MWYA 4LBHA 3NXZA 5E7OB 5IM0B 4RUBA 1WC0A 3FJ2A 1YJ7A 3U1NA 2NZTA 2IIHA 3P45B 1FEEA 4R8UB 4DV4J 3M2RA 2LXIA 1NDLA 4U8VA 4C8YA 1HQUA 3HKZD 5H9EK 4M7XA 2YH0A 1FJ7A 2UUCF 1GX5A 2B56A 3OYBA 3HKWA 2D41A 3H42A 2QI2A 3FFKB 2DFLA 1A9NB 3QBCA 1JROA 5C7PA 1OJ4A 5E5NA 4ZVEA 1ZQJA 4NLBA 2MZ1A 2W9CA 2H3QA 4CLWA 2YHAA 2A3VA 5CB1A 1VQMS 1M1HA 3SSRA 3ITHB 1RWOB 3CCJN 1BWFO 4S0MA 3CE8A 4CI0B 4WK3A 3AGKA 4YVZA 2O01C 2NRWA 4M3ZA 2J9DA 4NLWA 4ANEA 4NV0A 1IJEB 2FY1A 3C15A 3ZI4A 3RJEA 2V4JB 4J9QA 1UA0A 4AHVA 4UZBA 3TEHB 1CZAN 2WSCC 3RWUA 3VZIA 2HHXA 4RWTA 3F73A 1SB6A 4CO1A 4CO5A 4DV1F 2ZH9A 4HR2A 2UUAF 5AI9A 2VA8A 2YX7A 5AQOA 2CFXA 3I56S 1FXLA 4A61A 1ZYQA 2VG5B 2X6NA 4R65A 8ICLA 1UFKA 2B6AB 2KG5A 3KMSA 2M7SA 2QLWA 2FZGB 4NRTA 5KFTA 2ITMA 1PILA 3CM5A 2NXCA 2ZUAA 4PHTX 1YJ9N 1UOCA 2ZIUB 1W97L 1Q9YA 2WSEC 1YTAA 1REGX 2IRYA 4OHYA 4JI7J 3Q8YA 4FLWA 1TAMA 1UEKA 3TUZC 2K2PA 4NA1A 4CJUA 4YMMA 2WVCA 5KT5A 1VQ6S 1KVIA 4ZTJA 1P1TA 3ISBA 4NYNA 4BR4A 1KTVA 1C2PA 3C6AA 3RJIA 1T6CA 4LRCA 3T1HF 1SH3A 1RBTA 3A5OC 2QLXA 4CLYA 1KBRA 5D49A 9ATCB 4H0XB 1F5BA 2DFEA 2IVOA 3WKDA 4TUQA 2V69A 4G1PA 2KKVA 4XEIA 3WK9A 5KG2A 3GDXA 4FZNA 4ECRA 2H4YB 5E3PA 1JLBB 3CD6S 1GLCG 3POTB 4M0AA 1SIWB 3MECB 2EKNA 4PUOA 1S4FA 4IJAA 4DR7J 3BJYA 2XSFA 3PX0A 3UCGA 5HATA 4U96A 1QE1A 1RBUA 3B8HA 4F2RA 1U1PA 2J0SD 2JOQA 2E8OA 3QIDA 4RBVA 5BN8A 2MZQA 1ZAXA 3DRSB 2O4GA 1FERA 1BCOA 1RHUB 3U6FA 2O8EB 1BUXA 1LB2B 1XHZA 7ICOA 3BZCA 3QYPA 4OO1J 1K1SA 2XHBA 1ED1A 5J2QA 3T7ZA 3D5MA 3GMGA 4NE9C 2IJNA 4FLXA 2Z7JA 4WYWA 1A7GE 1RT4A 4WFNQ 3DGVA 3SBMA 3D2FB 3L3FX 1VLBA 4PGYA 4CZFA 1XIQA 2IYGA 4A5AA 3CG7A 1VIXA 1XMQK 5EWFA 4TNOA 3WEEB 1C7YA 1GFWB 3EE3A 2RIJA 1YIJS 3JAMU 4ELTA 5DBAA 3ENBA 3SCKE 2I8EA 3MMAA 5GADU 1M5SA 4FJMA 4CE9A 1N54B 5F2RA 2HHVA 4URGA 3CC7S 3L8BA 3G6EN 4M42A 4Y1DA 3TADA 3I32A 3JSRA 3O0FA 1ZTTA 4BE1A 1F2GA 1VQNN 1WC4A 1K1QA 2EANA 2DNLA 4BRGA 3VQ5A 2WBMA 5JVHQ 1XO1A 1HNIB 2QC3A 3CJSA 2QJ3A 1DT9A 2WVEA 4CZMA 3HJFA 1NU4A 2CQ3A 3O5TB 5EX5A 1FDAA 1Q5YA 3MUVP 3WQTA 5K9FA 1LW0B 3TTDA 3PW2A 2Z0GA 2HFSA 1XMQJ 2CXYA 4C4RA 3DXMA 2MKJA 3C94A 4Z4IA 1EQMA 3PZPA 1N5YB 3WUHA 4DQSA 2IJRA 2WHOA 4X4NA 1K8KA 2CJYB 1WB9A 3O1WA 3X1LB 4M94A 3TQ1A 5K20B 2B9WA 4K4XA 4LFAK 3CT9A 3Q2SC 1EQYA 1W7AA 5EE3A 2G2OA 2K3KA 4UY85 4ZJLA 3EGWB 3C3LA 2Z2YB 4CT9A 1RDDA 2NUHA 1T9UA 5I9EB 4F3OA 3K5NA 2HVIA 5HVHA 3MCMA 1X4EA 1FRJA 2VL1A 1NCLA 4DR3J 3LVWA 2GCFA 1VQPN 3MCSA 1RISA 2O8FA 2F1JA 2ZGZA 1M5PC 3L2WA 4TSXA 2J6UA 1BU6O 5GMEA 4GRSA 3C5FA 3WQPA 2XLJA 3C2PA 3ZFVA 1TUVA 5CZVA 1Z05A 1MROA 3JSYA 2CIMA 4F93B 8ICAA 2A3JA 4BRIA 1Q0NA 2MYFA 5JXSA 3G82B 1N32K 2EC0A 3MFHA 2PDAA 2WF8A 1HNVA 2R9LA 3EWAA 1B9DA 2EWSA 1X66A 4B17A 3ZD9A 5KNIA 1X4GA 3IBCB 4YOWA 3MM6B 3AJ1A 1EKSA 4FO0A 3N7PD 2G0IA 3C14A 3KHLA 2VANA 4CYUB 1SC4B 1YRUA 2IIRA 4P0QA 3RJMB 2CPYA 3ULHA 3CO9A 4BWMA 2R7QA 4FZXC 2OEHA 4P2XA 1EETA 2YKOA 2WBNA 1Y3KA 3L2QA 2ZM6K 4I2PA 4JV0A 2IM3A 2HZCA 1PJ5A 1U25A 2LECA 3R7SB 4PY5A 3KXDA 1DTTB 2GW8A 4AM7A 2EFNA 2XHCA 4RQ6A 5DDMA 3UM9A 3THYB 3OR1A 2NO5A 1RP5A 5GMDA 2N7CA 2ZBPA 1K6YA 1VRQC 1GK8A 4FYVB 4FW2A 4BS2A 4KHWA 1JMTA 1N32J 2PFDA 4KI6A 4H5TA 2JR5A 2G8WA 2Q6CA 4C7ZA 3KFWX 3O2IA 3HJEA 4JI6K 3MK6A 1KL9A 2QA4S 4A4JA 4L6V3 2RHKA 3H45C 2Q4TA 4WFBQ 1E4GT 1U26A 2KVQE 1V85A 2JZBA 4ITSA 4CZCA 3MR3A 3VA0A 1MMDA 2FMQA 1DHMA 1Z4NA 3AO1A 2KO1A 4DR5J 2W04A 1X9SA 2HHPA 1WWVA 2ZM6J 4LF7K 2AWZA 3AHPA 3DDHA 1TZ0A 1FD2A 3D7EO 4NPOA 5BOMA 1NB7A 2G0AA 4G9BA 4US8A 5LJWA 3KK2A 2E1RA 5EU7A 2XI2A 4LF4K 4M5DA 1W0HA 5EXWA 2B3TB 1CULB 5EY4A 4EEKA 3M3ZA 2ZIXA 1G3OA 5FLXY 9ICOA 2HQIA 2LCWA 1QVFR 4R25A 1NLKL 2BXJA 1I94F 3M9MB 2WF7A 2QTDA 5LJVA 1DRZA 2UUBF 3K57A 4Z6DA 2XI3A 3AJDA 1T94A 1JLGB 3QXGA 3NVKA 3JPPA 5ALPA 3AUOA 2LKZA 1JL2A 4W5NA 3TYTA 3K2PA 1VQLN 3T5HA 2ZBRA 4AXIA 1RT3A 2O8CA 1XQIA 4QWAA 1M5HA 5C15A 3LZJA 4YR3A 1UJ5A 3KZIU 1NSQA 4LF7J 1RDAA 4HH0A 1BPXA 4LH5A 3NH0A 4ZVTB 3SBTA 2GVDA 3CXCM 1DGKN 4AE5A 3HI9A 1IJFB 3HHEA 4JRQA 3V9ZA 3T1YK 2GX9A 4NMLA 1HNWF 4LF4J 2C3YA 2EI5A 2FVQA 3H4DA 4NLVA 2F3JA 2GMHA 5G0RA 2AA4A 5C25A 1K47A 4BE0A 1FJGF 2R7WA 4BY9C 1UHUA 2HG4A 4Q43A 3OVAA 3E51A 3MAAA 2ZZTA 3W9HA 4UW2A 1JLAB 3H3NO 1V6HA 5LMUF 1VBZA 4UUXA 4QZDA 3GQCA 4KN7A 1Q53A 2FHOB 2EFVA 4FE3A 3H7HB 2W7AA 5J29A 3QQCD 2KIWA 2XSJA 3M6UA 1HHSA 3P4UB 2BCSA 5J2BA 2W42A 5CA5A 1HNXK 5ALYA 5LSOA 2HS3A 1DKGD 3V6DA 3PNIA 4CM2A 3OPKA 1VHXA 1REVA 1PYTA 4KLLA 1WOSA 1RHMB 3ILOA 2OELA 5A8KA 2B4JA 3GDQA 4P2FA 3PIPQ 4PR6A 3CW2C 1XEZA 1MDUB 2ZC4A 4FWRA 3GBTA 4Z4GA 3PSIA 3R3TA 3BEGB 1HPZA 3H4BA 3BYRA 3QX7A 5CXTA 2XGPA 3S7RA 5L1LA 3ALYA 2ZHOA 4FOIA 2F76X 1QM9A 2XZDB 3DLHA 1U2FA 4PUOB 1KQSM 1SQKA 4EO8A 4B3TK 2HVEA 4DPUA 2BHNA 5FDLA 2DIUA 1QE1B 3RU0A 3L2UA 2Y0SD 1TVRA 3BQ7A 4J2AA 3GV7B 1LFPA 3FSXA 1RKJA 3NS7B 1X3MA 2FPKA 3EMTA 3R2CJ 1VDVA 3THVA 4C0HA 4KV8B 1PC5A 1NGBA 1U1LA 1ZQZA 1BL3A 2MZTA 2HBYB 1Y5IB 2OPPA 4DV5K 2OTJN 2JRZA 4ZCMA 3KD1E 5L46A 4XO0A 4E7JA 3HFVA 4YOYA 5J2QB 1PYSB 3AVAA 2HBMA 1GMVA 4IEEA 3C6UB 5B5EU 4ZHRA 2QKQA 2EAPA 1YZ6A 8ICVA 1RT4B 2GS8A 3VAGA 5AQPA 5AQKA 4R66A 5AM4A 4XH4A 3ZTOA 3I56N 3OYMA 1B4SA 1B0PA 2GNKA 2CVEA 1X6IA 3AARA 3V5RA 2R2SA 4JI8K 3BQ0A 4GIBA 3W2WB 2RE2A 3VVTA 2JNJA 4KTWA 4B3TJ 1U48A 2UV8G 3MMAB 2BKEA 1MN9A 1IIPA 3LDPA 1G2EA 1EQ0A 4CTAB 3K0SA 4C80A 3SQ2A 1V38A 3FSIA 3FBEA 1AXQA 4QU7A 4KMUA 5DBCA 1WG5A 2P9GA 4HUFA 2KT3A 3ET6B 3ZNJ1 4DV5J 3EN9A 4NYFA 2HHHF 3KZBA 1A5WA 2RRBA 2H4WB 2XG8A 3P4IA 2MQLA 3KJQB 4DTOA 2P9KB 3TTFA 4KAZA 1BXNA 2CZ9A 5HO4A 1RTHA 3CDBA 4KLUA 1R27B 1DJ0A 2N7YA 1N5VA 3MWPA 4CE6A 1YG0A 3TAEA 3C66A 1NU0A 1UP1A 3VAJA 1IXRA 3W2VA 4CO4A 8ICXA 3ZLJA 3CUNA 3DXMB 1CJKA 2GUPA 3AN1A 3RBXA 1BG3A 2Q1LA 4UUWA 4JI8J 3DYAA 4ECSA 1OSDA 3K58A 5AQGA 2HOEA 2DH8A 3QIOA 2W11A 3EXCX 2DNKA 1RJJA 4I2CA 3AXKA 4QZGA 1RLDA 4FVUA 1O03A 1U8SA 3G2XA 3N4WA 3O8WA 4O3SA 4KLIA 1RPLA 1HNZF 4OZLA 2V2KA 4AUKA 4YN4A 2OD4A 2ZBCA 2XMVA 2X1AA 4YOXA 1S1TB 4Y6IA 5CH7B 3MPYA 5E3RA 4UY8T 2I7PA 4P72A 4MEXA 1RUSA 2XNRA 1XUPO 3CPWR 4DPXA 3P3DA 1XR5A 3IMQJ 3KWMA 4G65A 3QU2A 2BDPA 1JRPA 4XUSA 4AHRA 3K7RA 1SJQA 1CZBA 2FHJA 2E5LF 1LWEB 1MROB 3AH6A 5HQ8A 1ZD2P 4YN3B 3UE2A 3ZXWA 2EC2A 1NGHA 2CQ1A 1QQMA 3FAHA 3IBWA 1RGIA 2QWOA 3KD5E 2JSXA 3VC8A 2DH7A 3MEKA 4Q5VA 1YIJN 2P51A 4M9LA 3AVNA 3HZEA 5KOXA 3H0MB 4HT5A 3OTQA 2BABA 3O1LA 3GIJA 4LBPA 2VG6A 2RMLA 3KHHA 2QLTA 4BROA 4MHVA 2IDOA 3QNMA 2NZCA 4ECXA 2P6UA 3HULA 3NTUA 2PSZA 5ALSA 3D0PA 3THWB 3F5TA 3R9LA 3HFZB 1RQNA 4QIFA 3VAMA 1IBLK 2GVZA 5CR0A 3D6JA 3BS7A 2KL8A 1EXQA 1SKUB 5LMNF 3BGUA 3D1QA 4I2PB 1N88A 4LUBA 3TUIC 3SAHA 4FL9A 1IO2A 2JEJA 2GJIA 3SIPB 3QEXA 4TY8A 1VK0A 1BWVA 1ZQMA 4OCZA 3D67A 3LDNA 1JLFA 3RB4A 3R3LA 3FBBA 4IUFA 2RP5A 4CP5A 4M6WA 2YXLA 1NGJA 5DK5A 3NH2A 3UDCA 4DN9A 1Q7YO 1ZRNA 1B0XA 5F3XB 3PHEA 4DR4J 4X64K 2BACA 2ZBQA 1YBAA 3JQJA 3O80A 4JI4K 2PY5A 2IVPA 1KD1O 5E26A 2M9NA 4WE1A 2WCXA 3RMAA 4IKFA 1APSA 3GTYX 1YLXA 3GFHA 2RRAA 1B4FA 1NK4A 1KDHA 4IZ9A 1RCHA 5GAEI 4FYDA 2C2EA 3JPOA 1JCGA 5KTQA 4NLGA 1WELA 2JLFA 1NGDA 4QS8A 2JL9A 3JS6A 4F5NA 2IOCA 2BKPA 4JK1A 4URQU 4USHA 3KOAA 1HWUA 2XZTB 3KK2B 1ATNA 3SXLA 4CJ7A 3AA2A 1RHQB 2E1AA 1HQEA 4CJQA 3I87A 4RUCA 4ECTA 4ELVA 3HZGA 1IBMF 2XYHB 3PX4A 1YJUA 4OI6A 4HVZA 2ZIXB 4KLJA 3PY8A 4KKOA 4QJFB 1JNRB 4KLFA 4JI4J 2YQEA 3ILIA 3BF1A 1WSRA 1RT2A 1VLYA 1TL1B 1CLQA 4ILJA 1A0OB 2M52A 4GVBA 1QAXA 2KHOA 2CQCA 4Q2LA 9ICTA 4NXMK 2KZMA 3UR0A 2OMOA 1Q8IA 1RT3B 1DLOA 1XNRF 3CQXA 2KZ3A 4F5OA 5CD4H 5FD1A 3VA3A 1VK3A 2OPSA 4RQ1A 4FNHA 3FLCO 3QFUA 2QWMA 5HQLA 3R5CA 1X5OA 4DL3A 1MWZA 4BR7A 5C2CA 5AI0A 3SQ0A 3HSGA 1D0EA 5C0YA 1N52B 5C5JA 1IV8A 2VQFF 4CEBA 3P83D 1ZJNA 3AA8A 3CJBA 2DNNA 3ISND 4PG4A 4CO3A 2Y1LB 1N34K 5G0RB 3FR0A 1FRXA 4MKBA 5C25B 3C23A 3O3GA 5KFQA 3D2QA 3TARA 2KMDA 5AQUA 1N62A 3VTHA 5D15A 3IG8A 3JPRA 1S5ZA 3TP2A 4UB4A 1UJ4A 2ZH8A 3H8JA 5J2MA 4FYWB 5AKXA 5KFYA 4DTRA 5CR4A 3PJ9A 3N4QA 3BDEA 2QLBB 4K8RA 5KFOA 2F9JA 4ZPCA 4NLRA 5HI7A 4LJMA 1BPDA 3EICA 2UP1A 4NXMJ 1Q8BA 3HVTB 1S9GB 1VS3A 2EPIA 2CJ9A 4X4PA 5CCMA 3WT0A 1ZBIA 4MO4A 3OJUA 3CJ0A 4YP3A 1YKWA 2XBPA 4QPTA 3V6DB 2CVIA 5IIMA 2JH1A 1FA0A 4LFBK 1REVB 5L1MA 3V9XA 3KDOA 1NRKA 2AJ4A 2AJFE 4N56A 2ZWHA 4I56A 3EDQB 2ZUGA 5AQMA 4Y0FA 2DGTA 4I7FA 2PC6A 3CFOA 2IVYA 3PG9A 2ZKUA 4W5OA 4O0IA 4H4KC 3CJAA 4RQNA 4Q2MA 2HK2A 1R8BA 2IBOA 2P9UA 4FP9A 4FPIA 5KFVA 1PAEX 3IG1A 1IR1A 4DQRA 2RS2A 3MOZA 1NMDA 1WG1A 2Z56B 5KFSA 4UAVA 1GTEA 4V1Ak 2ITGA 3BO2A 4PZNA 4HHUA 3SUNA 1WHWA 2VWJA 3H90A 4FJ8A 1Y5NB 2WFAA 1T9VA 4ERDA 4Y2SA 5EVZA 3C16A 2PN6A 3HHKA 2OPPB 2CPFA 3CYMA 3F53A 4LFBJ 5HBMA 2G8KA 4F4KA 3N7SC 4PL2A 3D2EB 4GXIA 4X65K 4F3TA 2QLJB 2P35A 5CP2A 5BOLA 5HN0A 1BE4A 3KBBA 1FRKA 4LFCK 2RQ5A 2G06A 4K5RA 3ZZZA 5KG7A 3OFGA 4KHRA 3I8BA 4LF5K 5AIBA 1NK9A 3CCQN 2OI2A 4BR0A 5T14A 2V8GA 6FDRA 1QVFM 3QEAZ 4I6AA 1U8WA 4EYIB 3AAWB 3W3SA 3PNCA 4DWIA 3HD1A 1FO4A 4DFKA 5DRKA 2MUTA 2PFOA 3GYGA 3N5FA 1JJHA 3OS0A 9ICVA 4PWDA 1HKCA 2KFNA 1MMNA 2YBVA 2VBXA 9ICPA 2PZSA 3EVWA 2ISOA 2HZVA 3HHLC 1Q3VA 2PAVA 4YB1P 2JWNA 1HWLA 1WUDA 2B4PA 3US5A 5K8MA 3AQOA 2F8MA 2AIRB 1ZQIA 4DV2F 2DGQA 3FQLA 3QGHA 1JLCA 2JH3A 3FQKA 1ASUA 4EK2A 3LAKA 3NRBA 4X65J 4M5HA 2GA7A 2ISPA 4A8OA 4E1MA 3GV8B 4DSKA 5J1EA 3KLFB 2LPEA 5K5MA 2PD1A 2KG1A 2BANB 2HK3A 5F3ZA 1N0UA 1L3KA 4KFBA 2FD2A 6FD1A 2WB1F 1VK8A 4LFCJ 2WZ1A 1JK9B 3W2VB 2ZD1A 1XJWB 3SAFA 1J5EK 4LZDA 5KFLA 1G99A 4GVMA 3C7NA 4QS9A 3E01A 4CNQA 2ATCB 2IS3A 4NWBA 4JK8A 3VF2A 4H5VA 2J7UA 5DGBA 1PBAA 3ILLA 3O1BA 1LKZA 3UDLA 1S1WB 1EJ7L 4PG6A 3T3FA 2HVHA 2VGNA 1H1VA 2MSNA 4PAAA 2EDUA 2DWQA 4X5VA 1JLEB 2H51B 4KHPF 1OPIA 3J7AN 3ISDA 4CDIA 3AFGA 5HRPA 1ULRA 2E8MA 3TVZA 3BH6B 3OYKA 3LA0A 2PFQA 5AQTA 5LXYA 1X5PA 3OR2B 3CCZA 1IKVA 2UYTA 1NOYA 1QSLA 1ZQUA 5AE3A 2CZ4A 5DM7L 1XMOK 5ALRA 4QIGA 4I4BA 4WIQA 4CEQA 3KTQA 3MXHP 3N4PA 4JNEA 3ZETB 3FUYA 3EW9A 3I28A 1J5EJ 2GC8A 1F9HA 2ZWPA 5J0RA 1U1KA 1LWCB 4OD0A 3NNCA 3ATUA 3NFAA 4NXNF 5KFRA 1YJNS 2VDIA 1ZPWX 4MLEA 1S1UB 2OHDA 4IRDA 3T6BA 3QDKA 3A8EA 2QRRA 2UV8A 5DBBA 2QFIA 2GELA 4DB3A 2KJ8A 2A1SA 1NG9A 1CXQA 3AT1B 4F3QA 2F40A 2H5JB 5E33A 3EWGA 3D0HE 1UKUA 3GIMA 3M30A 4KH5A 2AGQA 5I3QA 3CCUS 4N76A 1WUAA 1JLFB 1URRA 2KXFA 3VQTA 2DRAA 1LAVA 4GXKA 4O5BA 3QINA 3NNHA 2ASYA 2UUAJ 1VQ4S 1WSEA 3WC0A 4DR6F 4AYBC 4U6PA 2F96A 4JEPA 4E89A 5KG1A 1WDTA 2ZQBA 2E1FA 3T5LA 4IG3B 3O3HA 5KAKA 2XMKA 3F2BA 4CJ3A 2MLXA 3SMPA 2X7IA 2AGPA 2ES6A 1VSIA 2W54A 1NJYA 4KREA 4F4XA 1YJRA 4C8KA 3MEGB 4Z6CA 4USJC 3LTOA 4EO6A 3GFYA 2HRTA 1B92A 1RWUA 2G8UA 3WNFA 2F8EX 1ZQKA 2MTLA 5BPCA 4CRXA 1O51A 3E66A 3LL3A 2X6SA 3C1YA 3TX8A 4ISFA 4UB1A 4I64A 1ATSA 2W6KA 2Q1NA 2WF9A 2FBTA 2LA6A 3EE9A 3JXUA 3DFEA 1WNEA 2P9PA 2JGUA 4MT1A 4DOBA 5KAFU 2O8BA 3VQEA 1TVAA 3I4HX 2K4HA 4FYXB 1YX2A 2RN2A 4FVCA 2WFBA 1QQCA 2OXOA 2ZDPA 5C42B 1OY9A 2PKEA 3ETOA 5BRHA 5LJ5Y 8ICZA 3RRKA 2JC1A 4JI2F 5J0TA 1RT2B 4FBUA 4ANCA 2XC9A 1FKAF 4LF6F 5C2DA 1SAZA 3I4PA 3CMAS 3FC9A 4GVBB 2FGOA 3KUGA 4QYZJ 1SZHA 3KOOA 1ZTWA 3IP0A 4NY8A 4OJPA 1GXTA 3LH2S 3QZ7A 2B4VA 3TEGA 2BJ7A 2QG9B 3NOGA 5DB9A 1DLOB 2CJKA 1UFWA 3DMJA 1NMEB 3W8PA 3E1YA 2OPSB 5E84A 2DNOA 2BJDA 2BVZA 2V52B 4NYZA 2B43A 3IRXA 3CPWM 5CWRA 3BO3A 5DM6Q 2JFDA 1WBBA 1ZBLA 3RAMA 3ZDCA 3OTBA 1N61A 4NCBA 4OJLA 3IC1A 7ICTA 2DR6A 1TYQB 1ZD5A 4B1YB 3UR3C 4K4VA 4IFEA 1ASVA 4PZOA 1S8OA 5J2MB 2PO4A 2CA9A 1FDNA 2IJFA 2M4MA 3NHGA 3HK2A 2YQ0A 3JB9k 2C2ZB 2YVSA 3WIVA 2E7WA 2IFXA 8ICQA 1VHFA 2QE5A 4MAKA 2FZKB 3C6TA 4M3YA 2W3RA 3IGVA 4JV5K 2N82B 5B0BA 2ZXIA 4PYDA 1WTFA 3A5LC 3WZ0A 4CGHA 1EX4A 4M3TA 2KP7A 3K4GA 3WKCA 2FJVA 5AK5A 1IXKA 3IFEA 3HF5A 4MYTA 3KJFB 5IWAF 4KH4A 2ZUDA 1YBUA 1RWMB 2P6RA 4HKQA 2WHEA 1NH7A 3PM9A 1CRXA 2CNKB 4IQUA 2CQIA 4LF9K 1NO8A 4QIWF 2G1DA 2JV3A 2EEYA 2AX0A 5IT4A 1BUPA 1RBAA 4EEYA 2QSWA 4PQAA 4DV3K 4FLYA 4CEAA 1URJA 1GLAG 3ZYYX 3WNGA 4BRLA 4IO9Q 1VOMA 4FJGA 4F0KA 4RW4A 1DGJA 2YNGB 3LP1A 4G9ZA 1IWGA 1P8ZA 1N5WA 3ENQA 1FNXH 2ZITA 2DRDA 4Z4EA 1T8EA 2ZJQQ 1VJWA 3WIUA 2QL5B 2VJ4A 2ODGA 3C16B 2K7JA 3AM9A 1PZNA 4WQ5C 3GIIA 4UAUA 3SI8A 3QWPA 4X4RA 4L72B 5HBMB 4KLMA 3IR6B 3A4TA 1VSLA 1WNSA 3KK3B 5E3QA 4ZMMA 5KFNA 3IR7B 3QJLA 4A8WA 4NYPA 2DR5A 2V7ZA 2WOMA 4WYLA 3V2UC 4Z6EA 3PVXA 4LF9J 5C10A 3UPQA 1BISA 4HLBA 3CC2S 4AHTA 3VEWA 5AQZA 1HBOA 3NMRA 2P1JA 1HJOA 2H48B 4IQMA 9ICNA 2E29A 3OL9A 2QMXA 3CCWA 2PYLA 5M2UA 3FC4A 2PA3A 2FXUA 5L1IA 2FY8A 3CD7A 1B9FA 1LNQA 2MUTB 2ZVIA 3QU9A 4CEFA 3S3OA 4PWDB 2XO6A 2QN6B 2J0WA 1BPZA 1IQZA 1X7VA 4YDUA 3IN5A 2NRRA 3GCXP 2DR7A 3QERA 3VEVA 3MWTA 5H1SV 1ZPVA 3Q89A 3PUFA 4LQ3A 2CQ0A 4E19A 1JLCB 1S5LU 2GMJA 1ZRMA 4EWTA 3CJTA 4NXZA 3BKFA 5ADXA 3HRGA 3BP8A 3O5BA 1UPHA 4KIAA 1J2NA 4EU0A 2KV2A 7ICQA 2WRMA 2IPOB 4TYBA 3SMVA 4O4RA 4CBXA 4WCEQ 1J54A 3M8YA 3KKSA 4DTJA 3D2NA 8ICTA 3G87A 1KCFA 4ECZA 2ZD1B 1QH9A 1IBKF 4AM6A 8ICYA 1NNDA 5B0FA 4M95A 1WBDA 4YY3F 2PIIA 1C0MA 1WI6A 3ZSQA 2HMXA 1VSDA 2QA4G 4A57A 4B02A 3R7NB 5F3TA 2A6OA 2X78A 1L3VA 1KKHA 2J0QD 3QFPA 1A0PA 3NGTA 4IFYA 1XSNA 3DU6A 2E2QA 3BQTA 4M3XA 1VQOS 1YTUA 1JKHB 2AU0A 4DPYA 4WF9L 1HKBA 2YNHA 3UW1A 2QWRA 3MWBA 2KG0A 1X4HA 4DR1K 2GAHC 2BJEA 4CD3A 2FGCA 2E44A 1M90O 4B3MK 3ONNA 4CJSA 2D3OR 4DUZF 2VOPA 2E5GA 3HP6A 4FF2A 1RU2A 5ETSA 3Q22A 1HKGA 5DGAA 3WNHA 5D4LA 2E5SA 1RILA 4QPXA 3C28A 4DZDA 2X1FA 2FSKA 4M9HA 1ZQRA 2UUBJ 3IKMA 3RAXA 4OLAA 3NS1A 2Z30B 1RAGB 1NPKA 8ICOA 4C0ZA 1HW9A 2ACYA 4O3QA 1LXNA 1SJ4P 4KY3A 1KVJA 3ZSWA 3CCRN 1NJIO 2EXUA 3VF4A 3QE9Y 4AP9A 2NSBA 5TZVA 4CHOA 1NSKL 4JOUA 1U7LA 1J6ZA 4CLSA 4E3SA 1LOUA 3QWUA 3BBFA 2WC9A 1QAJA 3CEDA 4USAA 4DR1J 3H8MA 3IG5A 4B3MJ 1X4CA 3ZZOA 1ZQNA 3DXBA 3DKDA 1F44A 4B9SA 3QRRA 5E0OA 2CJAA 2YMPA 1PBUA 1FJGJ 4DOAA 1N63A 4KITB 4F25A 4IWVA 3OTOF 3V6HA 4C1NI 4JUZA 2V63A 5HROA 2R2TA 2Q3SA 5LMUJ 2DXFA 3L5KA 5I3UB 3GILA 3UD5A 1QQ5A 3AVJA 4ED1A 3O3LA 2Z2ZA 3CSKA 4PA1A 1SV5A 5AQHA 3K75D 5J0XA 3BKTA 3UXPA 2O3DA 4MFAA 1E6VA 4MMOA 2JX2A 2DGUA 5LT5A 3AVFA 5SZTA 3EPGA 2J76E 4RQ5A 7ICRA 2IVMA 3HVRA 2R3VA 1YF5L 2F3NA 3CDEA 4ALZA 4K59A 3FRZA 3RJFA 4UAWA 2XLIA 3KLGB 3HD2A 1SUQB 4CLZA 3ZSZA 4C2MA 5HLFB 1U1OA 3B54A 5KGXA 1U1QA 4ZPVR 3HL8A 3IDHA 4BQZA 3EGZA 2EZYA 2RNEA 2P9PB 3E9PA 5IQQA 3A12A 3O9SA 4DX7A 3KYLA 4Z4HA 4UOHA 3I5CA 1GQEA 2O5DA 2RU3A 1OMSA 5JUMA 2YKMA 1TL7B 5F9NA 1F3FA 2X1GA 4Y28C 2FLLA 2PEHA 5ETVA 5IC4B 3O08A 3M6XA 3O6QA 4CLFA 4DL7A 3GWCA 3WXLA 2VD3A 1EP4A 1OQ6A 1UL3A 3B4MA 1QHTA 2MRLA 2XCPA 2DNZA 2CGJA 1VHIA 2DH9A 2U2FA 4N5SA 3MURP 3ZSOA 4Q0BB 2G08A 2HBKA 5GAGU 1U1MA 4LRDA 1NK8A 1RB0A 4X4TA 2QWQA 2AQ0A 5IT0A 3HCXA 2MPUA 4F8RA 3LGHA 3NH1A 2DEJA 3IRXB 2H3IA 2W43A 5E41A 3ZT4A 2ZDOA 3TWHA 3NWGA 2XRIA 3DLKA 1SS6A 1VQ4N 3QRQA 1X5SA 3M7VA 2C1EB 3OFFA 4HI2A 3V81B 1QZ5A 2M0GB 3MN6A 3GYXB 2YWWA 4FM2A 3RAQA 1GXLA 5KFHA 3M6VA 2ZJ8A 5KFEA 1ZA2B 4YNQA 3X3UA 1XNQF 3D66A 2GJFA 4ILGB 1Z4UA 1ZQTA 4WFNL 2K8CB 3QU7A 2ESEA 3UCUP 2PBDA 1HMVA 4C8ZA 3RH5A 2KJ9A 4P2MA 2MSSA 4QZVB 4F9OA 1VSJA 4B9TA 5ALNA 1R0CB 3QFWA 1SJRA 3C6TB 4DF4A 3M2VA 4A5BA 2HHHJ 2V8PA 5KFGA 4OYAA 2HQCA 5ALGA 1RFQA 4BG8A 2FVRA 1UT5A 1Y88A 2QO3A 4BR5A 4NEYA 3HT0A 9ICCA 1C1AA 1FFSB 1LKYA 4UARA 2OEJA 4MFCA 4PABA 3TA2A 4M2YA 3UO0A 1ZXIA 2HHUA 1S6PA 1O0PA 1F1BB 4JKAA 1DQ9A 2ZWOA 3OS2A 4IH5A 4TLRA 2D1CA 2UXCF 3V9SA 5JVHL 4DU8A 3C8YA 3M1FA 4QAGA 3TZXA 5ALOA 3QUCA 4IQVA 3BR9A 1U1NA 2UVRA 4HTJA 2ROPA 2QTWA 2RUSA 4NB4A 1Q9XA 4WQ4C 1H2TZ 2UVVA 1U9LA 1VGYA 1L3SA 3LP1B 1HNZJ 4E2FB 4OJ5A 3LDOA 2HZAA 1D1UA 1ZQLA 1Z2LA 1C0GA 1YUWA 4JI0K 4LF8K 4FWOA 3VHQA 1RDCA 2AHOB 4F72A 1SCJB 3ICXA 4OLPA 1NGIA 4BX9C 1NPRA 2E2NA 5IV3A 5AQVA 4WPAA 4CLTA 3FZMA 4LF2A 2EBEA 2DYAA 3GJQB 3EGVA 5B66U 1A76A 1WC3A 3JYTA 3M5RA 1RGVA 2E5LJ 4J9VA 3FM9A 2DD8S 4ZVPB 1L7NA 3P8BB 5HMYA 3D2SA 2OLWA 4A8QA 3R7BB 2J7KA 1HBOB 2W7OA 3NP5A 4MDAA 1RBLA 1BNOA 1K44A 1CLFA 3ZTPA 3LDSA 4Z7YA 1TMMA 5F8JA 3G0ZA 3DJCA 4MK9A 8AT1B 4K50A 4IOCQ 5J8YC 3M6ZA 3LP0A 5KG3A 3VESA 4CGJA 3TAMA 1L7OA 4DG1A 4K7QA 4JI0J 2MZJA 3K5LA 4LF8J 1E6YA 2UXBK 1KC8O 3KG1A 3V9WA 4PHPA 5LMNJ 3HP9A 1R0AB 3G9CA 2W9BA 3E3XA 1D8ZA 2YY3A 1U6BA 2IA6A 2OAUA 1HJRA 5IIOA 2MQOA 5ALZA 1T05A 2OZSA 1HR0F 2F4VF 4Z37A 4E1NA 2BZFA 4YEAA 1BQMA 4DTXA 4H4KA 3F56A 3K1ZA 4K25A 4KRFA 4LC9B 5CCLA 4EP4A 2L9DA 5T7LA 4JYAK 1NKBA 4K4IA 4OVLA 4K4TA 3A13A 2D0PA 4PG7A 2LYAA 3CB4A 4M5JA 3K5OA 4A8KA 2VA3A 3AD8C 3OQ2A 1ZQFA 3LZIA 4O3OA 2W9AA 1FRHA 4FF3A 3RW6A 1VQ8S 2E8AA 4X66K 3OJSA 3HPOA 2WTFA 1HUOA 3VQ7A 3ZT1A 5AQIA 2CNNB 5C2FA 4MF8A 4P4OA 2ATLA 5B7WA 2J0XA 1C0TB 3Q2TC 1NGGA 1NBWA 2GO9A 2G8HA 2OKQA 4UASA 2UXBJ 2D3UA 3PW5A 3L7OA 4YOUA 1FRLA 2H65B 3L4PA 4NJ8A 4UB2A 5J2PB 4XRHA 2OSRA 1FE0A 3KZXA 4ZPTR 3C0BA 2B4UA 1B3TA 1KN6A 3S41A 1NZ8A 5AHXA 4YXMA 3Q7BA 3PSPA 3AVGA 4Y2KA 1S97A 4X4VA 1VQ5N 1F9FA 2HPUA 2Q2RA 2DO0A 1VJQA 3G10A 4RQ3A 7ICPA 4ZN3A 2DCUB 4V19S 2IMWP 2HGMA 2FVPA 3I55S 4N7TA 3M8WA 5KG5A 4LR7A 1QLNA 4FWMA 1WSHA 3EYZA 4KHMA 4CGIA 1WWHA 4X66J 3HHLA 2WVDA 4TVAB 3OXGA 9RUBA 4HCCA 1G6BA 2BJ8A 3V4IA 5AE2A 4DQ8A 2EK1A 1RDBA 2CH6A 2ZH5A 4K0KF 4I9LA 4ACOA 3HJVA 3IS9B 3KFUF 9ICIA 2NR0A 1MMLA 1XNRJ 3MDAA 4LVOP 3TW0A 3L4IA 4F2SA 2I2YA 1NKEA 3R5JB 3OGUA 1HW8A 1ELOA 1CJVA 2PMZF 2I0XA 2LSNA 1LQ9A 4MYUA 3BSOA 4JKBA 1KW4A 2FJAB 4ZPBA 2EX3A 3A0BU 2Q97A 3K5PA 1RXWA 5AM1A 1AB8A 6AT1B 2FJ6A 3IAM9 4I68A 4HT7A 3IWXA 4CFDA 1S1XA 2OUGA 3AA4A 3Q8LA 2BM0A 8ICUA 2EVZA 4JI5F 3TVKA 2W4PA 5IQ6A 1KKXA 4FWNA 4JMUA 3R1HA 4OPAA 9ICWA 1NDPA 3HSDA 3ZDDA 2QZ8A 3HI0A 1RYRA 3TUJC 3PMLA 2HVZA 1SV5B 1ICEB 2DIVA 3VGKA 4HACA 3W5YA 4Y2MA 4B1VA 4IR9A 2GAGC 4BACA 3HDSA 2DNRA 2H5IB 2FDNA 4DJBA 5AXKA 2JWKA 2E9TA 2XS2A 2D8CA 3M6GA 4YB5A 4KB7A 4PHDA 4USMA 3CCJS 1FKOB 3GOIA 1X4DA 5D4OA 4E7HA 1N5TA 4ZPDA 4A46A 4CJVA 1QQ6A 3OUYB 2XMTA 2W3SA 4DV0F 2MY8A 3FCWA 4IEIA 4RBUA 3SYZA 5DMRA 2CJBA 3HWTA 1Y00A 1RT7A 4DQIA 1RDRA 3PW0A 1HHQA 2YNIB 2IDEA 4O3MA 2DUYA 2M0NA 3BSNA 1U24A 3OYDA 3JAMY 3H0LB 3KLVA 4Q44A 2ZE2A 3NVMA 2MKHA 2P9SA 3QEIA 3OS1A 3UMCA 3N5BA 1WAFA 3JPNA 4ZH4A 3LP2B 1M90T 5ALMA 2FPHX 1KOHA 2FPLA 2NXJA 3ZZTA 3SD7A 3SENA 1YJ9S 3MMCA 1EP4B 1TK8A 4IDHA 3ZEUB 2UXDK 2FPMA 3CJ7A 4RQ8A 4E8UA 1UT8A 3FKBA 3IM1A 4ZA1A 3ZSYA 4WK1A 1VQKN 2BE7D 1ZD4A 4LY7A 1RA6A 4B6JA 1WOOA 1KFSA 1S9EB 3TA1A 3B4DA 2CGLA 4J9LA 3HXMA 2B9XA 4DL4A 3NRWA 4EFHA 3GJSB 4X4SA 5HVFA 3DLKB 3V72A 5AE1A 2D4WA 3EL2A 2BKNA 4R64A 2RDIA 3Q8SB 1WSFA 3A8JA 3RRHA 3TSPA 3C19A 4JI3K 2I6WA 2A1AA 3F2KA 3KMQA 2P9IB 3SPZA 1HMVB 1TGOA 3MCOA 4CF1A 4ISEA 1SBRA 2GIQA 2UXDJ 1OYDA 3DC2A 3QAEA 4ID5A 9ICFA 2QYCA 5AK4A 4CBUA 3M2VB 1SV0C 4DV2J 2XS5A 2Q0RA 4I2EA 1GX6A 5HNKA 4Y2JA 1CS4B 4U67Q 2YHYA 4NLCA 1NK5A 1UCVA 4ECWA 4K42A 3ENOA 4LREA 4NA2A 4DUYK 1TKZB 3JQMA 1T9WA 2G07A 4FWKA 4IKAA 4O4GA 3CMQA 3TOQA 1KNZA 1LFWA 2C2DA 4X62F 4X4OA 3J81O 2YWGA 1N8RO 4RPFA 4ZVGA 2EZXA 3TPQA 2G1HA 3CCVN 3QLHA 1WEXA 1R0BG 4DR2F 2P9NB 3DOMB 3D1OA 3AB4B 4JI3J 3G6XA 4EUVA 3TWZA 3THXA 2WMMA 2OPQA 4G1IA 3UNGC 4NM2A 3KJNB 3MM8A 3T9NA 3QJPA 4ZVOB 1LW2A 4CFBA 3NL0A 4DOZA 5BR8F 8ICBA 4C98A 3EY1A 3ADAC 2BUNA 1JN3A 4B9NA 1JJ4A 1V9PA 1TK5A 3FSYA 4IQWA 1K0TA 4CD1A 1N0VC 2R7VA 5DLGA 4KHPJ 3BS5A 1SGGA 4GNIA 5I4MA 1Q78A 3CCMS 3G6ES 3OY9A 1BQNA 3BN7A 4KO0A 3HTVA 4GVLA 5KG0A 2E5HA 5KT4A 4DUYJ 4UQTA 1VSHA 4OQJA 3CIPA 4RW8B 3U1MA 4PRFA 2V4RA 3JYTB 1FX4A 5LM7E 3O9QA 2R8GA 1WSVA 2RSQA 1N56A 2RRDA 4CO2A 5HHHA 3OVSA 4WFAL 3L2VA 3BBBA 5E3AA 4H5WA 3BN4A 5ETLA 1C1BB 3VV2B 3EE8A 3M6KA 4M41A 2F8TA 4EI2A 5THWA 2OPRA 1VLOA 3R97A 2HOIA 3LM9A 3DRRA 3MN9A 2DPJA 3I5AA 4JK7A 4WZQA 4RU2A 4NXNJ 1ZBTA 3KJVA 4TU8A 2RDDA 1Q4RA 3NY0A 1RZTA 3AU2A 3D3CJ 4YQWA 3TAMB 3OHRA 1N5QA 1N2XA 1WKLA 3QO9A 1E6YB 3MMBA 3MUMP 2JHEA 2B7BB 5KT3A 4NLOA 4GKKK 2W9BB 3RRGA 2LM1A 2D3ZA 1SPBP 1VBYA 4YORA 4Y2QA 1T05B 2DHAA 2D0BA 3GYNA 3H3OB 4DL6A 5GADP 4IQTA 4GKJF 4B3SK 1BQMB 2VBWA 3HW8A 4WXOA 4OJRA 1VQPS 3C6HA 3L95X 5K4LA 1L8LA 2VIXA 3B78A 5H2FU 5T7LB 3GU3A 1K73T 4RQ4A 2Y8YA 3S9HA 1ZAWA 5ALKA 1ZQPA 5KI6A 2XCAA 4JS4A 4B3RK 2IC3B 5DDRC 1TUGB 3IV6A 4M3WA 3HX9A 4JI1K 4DSJA 1EXNA 4J2BA 4J9RA 3JPTA 2FIUA 1B43A 3H46O 1SQEA 4KN4A 3UKRA 4ID1A 2FJDB 3IHQB 3VAFA 4WQ5A 5IIJA 2ZZNA 3AVCA 1XU4A 1M1KO 2UU9F 1AROP 4E1JA 3BYPA 2QV6A 4JWNA 1RTZA 1NWKA 3MDCA 3SMZA 5B0CA 2A1RA 4GKKJ 3TO8A 2Q43A 1QQNA 3NWRA 3R6LB 2VH7A 2QEXN 3Q86A 4QZBA 1S6QA 3FGUA 9ICBA 4PWUA 7ICLA 4B3SJ 3OFEA 4CK1A 1ZQCA 3EKUA 1NOZA 1Z3EB 4I2HA 2A1JA 3EUB2 4IDKB 2HHTA 4DFJA 3PR4A 1NPPA 1NK7A 2LI6A 4W5RA 3QYYA 2ZH4A 3G71S 4B3RJ 4NLZA 4YHHF 4N41A 2A6AA 2J6SA 2HMPA 1Q18A 5IT9Y 4OJ3A 1SJ3P 8RUCA 4JI1J 2VOOA 1ZS6A 4BGDA 1DK3A 4CBWA 2HIQA 3MMVA 4QW9A 3GJTB 1F5AA 3J81U 3V4IB 1JJ2R 1IJJA 4P6QA 2N3OA 3ATVA 3HM9A 2GEMA 2G0CA 1IG8A 5AJ3K 1VRUA 2KLAA 7ICUA 3F2CA 2LQJA 1AUDA 2E88A 2VJVA 4BXOB 2FMSA 3MM9A 2G8FA 4DV7K 3AODA 2B8PA 3CDWA 2GGPB 3HKZF 2DNHA 3UQ2A 3BF4A 5CA7A 5J2AA 4KC5A 4OJ6A 2XMJA 2EG2A 5CZ2A 3VQDA 2W1BA 4OZJA 4YD2A 4LRAA 4DBQA 2N4CA 3UQ0A 3HHNB 2GFFA 3T41A 1WG4A 1S1XB 3M2UA 3GSDA 1KC8T 2VPZB 4DV6F 2Y9TA 4UT4A 1U2VA 1U09A 4DS5A 4UW9A 5HAOA 1OS5A 2YWEA 3FCHA 3LDQA 1L8OA 1ROFA 1VQ8N 5HMZA 4HTUA 2HQFA 4DV4F 1QUVA 1S5JA 8ICFA 2RQCA 4RR5A 4M3RA 5GADI 5TKYA 3GR0A 1QAYA 3PCOB 1SKSA 3C5GA 5HMMA 5HK4A 3VCDA 5A8WB 3P31A 5FRNA 4CIOA 4C11B 2B7CB 4ATNA 4BRAA 5KG4A 1S22A 4KX5A 3PYGA 4UAYA 1X4AA 4CZJA 4OYZA 2HURA 3ZZYA 1Q7LB 1RQLA 3I9ZA 1K8AT 5IWAJ 4CZKA 1HHTP 3LW5C 2RS8A 1TL3B 4RW9A 3NBPA 3RUBL 1MN7A 4PXDA 3QIPB 4CJKA 1BMQB 5KPTA 2K8AA 4QIVA 4HH1A 1RT7B 3ZT0A 3R1XA 1IBCB 4AXJA 4C4WA 3I55N 4X4UA 3H1QA 3DRPB 2ZE2B 3CHWA 1SC1B 3H5UA 5AQYA 2P9SB 2DVIA 3R9PA 2W6LA 3DWLA 4OYOA 1TV9A 1X31C 4HCBA 3NGYA 4IBNA 5FPNA 5F1XA 1XNSA 4QWBA 4W5TA 2VB6A 4FJJA 1SKWA 2BE2B 2WW8A 3CNQP 5F8LA 3H2LA 1Z26A 4CK2A 4P10A 1FFGB 2C2KB 4IH7A 4OJOA 4QIWD 2GQ2A 5JICA 3EM1A 4JHDB 4DQPA 1PSDA 1R6YA 2FI1A 5ALTA 9ICEA 3F9KA 4YMEA 2YX1A 2IOFK 3K5MA 3QNOA 2VJUA 2J5AA 1HIWA 1X4BA 4JKHA 2CN1A 4BC9A 1IKWB 3S1TA 2ASLA 1KAYA 3NVVA 3PW7A 2D74B 4CHYA 2DO4A 3OL7A 3OHAA 3VMFB 3UWTA 3VENA 9ICHA 3HFKA 2ZIVB 4DHVA 5JLFA 4FM0A 4CW7B 5LL6Z 2JRSA