3TAQA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3taqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3taqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3taqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3taqA01
2F8SA 4DEZA 1TGOA 1BHLA 3TWHA 1K1SA 2V9WA 4CEOA 3T3FA 2IC3A 4IRDA 5EOZA 3LDAA 4ECTA 3NGIA 4CJEA 4DTXA 3OYCA 1LWFA 5JS1A 4B3OA 5J0TA 8ICSA 1C0TA 4LSLA 2YNGA 3KJVA 3K5NA 1S0NA 1U9LA 4PGXA 3GILA 3SUNA 4M45A 2FPLA 1WCLA 4EYIB 5EWFA 1PZNA 4QZAA 4M2YA 1XSNA 3AA2A 4W5TA 3DOLA 2KN7A 1IM4A 3GIMA 2XY7A 3V6KA 3CFPA 4FM0A 2O4GA 7ICGA 1BI4A 4HUEA 2DTUA 4YFKA 3S3MA 7ICQA 1UT5A 4GVMA 4Y1DA 3ZSXA 4FJNA 3RJHA 4FLVA 3ZSYA 3OSNA 1T05A 4I2BA 3KHRA 5KG0A 4JS4A 3L2RA 2W9BB 2Z1HA 1RXWA 1BPEA 2W9MA 3QEPA 2OZSA 1FXXA 4Z4CA 2VANA 1XSLA 3IG1A 1Q9YA 4B08A 4ID5A 1I39A 2NRXA 5HHHA 2BE2A 4OKJA 2F1JA 4YXJA 2KTQA 3RH6A 3QEAZ 5KFQA 4N41A 1N5YA 3OYBA 1N48A 8ICWA 8ICRA 5JS2A 4J9PA 4B9SA 4J2EA 2ATLA 1TV9A 3RMCA 3NCIA 3PW4A 3V72A 5C5JA 4IRCA 3DRSA 1XHZA 4FJ7A 2W9AA 1HUZA 5I3UA 4ED7A 3RTVA 5J2DA 3AVHA 1ZJMA 1TFRA 1TL1A 4ECWA 3LPUA 4N47A 4UB3A 3QEXA 5HP1A 3ZSZA 2PYLA 4Y1CA 2V4RA 3DRPA 4RUAA 3PMNA 4AH9A 1UA0A 4J2DA 2BGWA 4DOAA 4KLSA 4RQ0A 3DRRA 2X74A 3AVIA 3OGUA 4DQRA 3WNEA 1ZQJA 2EX3A 3B0XA 4CIEA 4QAGA 1CXUA 3HP6A 2BCQA 3TAEA 4CJ5A 4G3IA 2R8GA 4F3OA 3KHLA 5KG5A 1RBTA 3PR4A 1BQMA 4YMNA 4HVJA 4B9UA 3PX6A 4CEQA 1AROP 4DSEA 2NUBA 5IIMA 3ULDA 4I2PA 2R8JA 3HW8A 2PI4A 2PXIA 2PY5A 3PX4A 3KKRA 2KFNA 3Q8PB 3MFIA 1KFSA 1XSPA 4DQPA 1RT7A 3BQ1A 2E6LA 4CCHA 4I27A 4QWDA 3MBYA 4OKEA 4DSKA 1LW2A 1EX4A 4ECYA 1C7YA 2J6UA 4CF2A 3JYTA 4QZBA 1RXVA 8ICLA 2W8LA 1RTHA 9ICAA 5HMMA 4M47A 5CYQA 4CHYA 1NKBA 3BGRA 1ZQSA 3BQ2A 1J5OA 4DO9A 3OYIA 3JPRA 4Z6CA 4KB0A 4E7IA 1LB2B 1Z25A 4FXDA 4HYKA 3ZSQA 3NF9A 1COOA 3TARA 3AA5X 3H4DA 2PFOA 3HVRA 4GLXA 4ED0A 1RZTA 2AGQA 1ZBLA 1NOMA 2A1RA 3RB0A 3KTQA 4RQ4A 3T19A 4BGDA 4PHAA 1B92A 3QERA 1S0MA 4QZFA 4ED8A 1J9AA 4H4OA 4F50A 3Q8KA 3GIIA 1X2IA 2P5OA 4QZ8A 4CGJA 4AHUA 4FS2A 4M3TA 3HO1A 4BE2A 4ECQA 3JPOA 4ZH4A 3DYAA 5IIKA 3LP2A 2F1IA 2BHNA 1O1WA 4KHNA 4EZ9A 3WNHA 5SZTA 2A1JB 4DFJA 1LWEA 3DI6A 3HT3A 5DB9A 4EBDA 3VQEA 3UXNA 3SJJA 3GQCA 3VQDA 4CEBA 3RAQA 4TUQA 5CZ1A 4CJFA 1C0MA 4M3YA 4JV1A 9ICMA 5EU7A 5L9XA 5KFYA 4PHDA 4BWJA 5DLFA 4CEDA 3ISNC 5KG2A 3QINA 4M3RA 3L2WA 1HRHA 5FRMA 1TKDA 1L3UA 2BANA 2VWJA 3QIPA 4J9LA 1NK5A 4RQ1A 5KRTA 3K4GA 5KRSA 2EHGA 3AO4A 4FJ5A 4QWAA 3NF7A 4CJTA 4ECUA 3V6JA 2D0BA 4KTWA 4CJPA 4E7HA 4ZHRA 4M3WA 3RJEA 4Z4IA 5FROA 5T7BA 1X9MA 4K4IA 3PUFA 1L3VA 4M9LA 1VSKA 1S9FA 3V9XA 5KGWA 3PVXA 8ICKA 2JZBB 3SQ1A 3MECA 2AQ0A 4NM1A 1K6YA 3KLEA 4K8ZA 3SPZA 2F8TA 9ICSA 1RYSA 1NJWA 2XY5A 4XIUA 1DTTA 4O5EA 2J6SA 2G8FA 1JLGA 4NCAA 2RPIA 3KHHA 2IHNA 3ZSWA 1X1PA 1ZQMA 4KHUA 2W9CA 1IO2A 1V9PA 4O3OA 2GWSA 4CIFA 4I2AA 3SI6A 3AU6A 3TQ1A 2VG6A 5HNKA 1BCOA 1TVRA 4YD2A 3OSPA 3NE6A 4KMUA 2VA3A 9ICCA 1RBVA 3OYHA 4NXZA 2QXFA 3P5JA 2DFEA 3L2VA 3FFIA 4UBCA 4NYNA 3V9SA 4O9MA 3MFHA 4M9HA 4BXOB 4DU4A 3ISCA 3VQ8A 1C1BA 1KFDA 9ICTA 4LD0A 4QCLA 4KLGA 4FK0A 4CEFA 5KFNA 3IM1A 5J2IA 1ZBFA 1J54A 8ICOA 4QWBA 3SQ0A 1B9FA 3PV8A 1ZQDA 2IA6A 9ICPA 5KFJA 4KHSA 5DMRA 2XRIA 1SUQA 1ZQBA 3G6YA 4GXJA 4BACA 3NFAA 4F4YA 3SQ2A 4F8RA 3LAKA 3KHGA 4O5BA 4RNNA 1NK8A 4DQIA 1JN3A 2RF2A 3T5LA 1JXEA 3HSTB 1WNSA 9ICUA 3OYEA 1A77A 2G8WA 4CGFA 3C1YA 4B9LA 5KFEA 4DL6A 2PI5A 3ALYA 4QZEA 4ECVA 2YNFA 4NCBA 4F3TA 1DOQA 5CHGA 3RJIA 1D8YA 4M3XA 1BI4B 4M6WA 4NYFA 3RBDA 5SWMA 4EBEA 3VQ9A 4DL2A 4MFFA 4E3SA 4DSJA 1BPZA 1IH7A 4B8CA 2XY6A 4RQ5A 9ICRA 1UT8A 1EP4A 1HJRA 4CFCA 1WCNA 4NLKA 2Q0ZX 4MFAA 4IFYA 1BPDA 4DF4A 4UAWA 4OGEA 3V6DA 2NRTA 8ICVA 4NLZA 4YNQA 3HK2A 1D9DA 1U49A 1S5JA 3AUOA 4ELTA 4IDKA 8ICYA 5J1EA 4ECZA 4FJ8A 3AA3A 1S6PA 3C95A 1ZQYA 4RT3A 3C94A 1ASUA 5J2BA 1ZQOA 3L8BA 3U3GA 5HRPA 1HJPA 4CFDA 2I5JA 3LPTA 3KLIA 1WAJA 3EYZA 5KFTA 4ECRA 5DDMA 1L3SA 4O5CA 5HBMA 4EP5A 2GBZA 4W5NA 5J0OA 4CHQA 7ICJA 4HCCA 3C6UA 3K5LA 3OHAA 4DWIA 3K58A 4XA5A 1BCMA 4I2CA 3HM9A 3SNNA 1YT3A 2D0AA 2VWKA 5CZ2A 4O3QA 3CM5A 1NOYA 3M8PA 2BPFA 4RPXA 2GUIA 4FZZA 1KVBA 5IIOA 3HPHA 3MR2A 1KFTA 1HNVA 1CEZA 1ZQQA 2OPQA 2WTFA 2XC9A 4I9QA 3AVKA 5HROA 3H8WA 3SV3A 2A1SA 3E01A 3RB4A 3PW0A 8ICTA 3M9NB 4KLOA 8ICQA 1NKEA 1BPYA 1F21A 1KLMA 1BISA 3O4NA 2DPJA 7ICSA 4R8UA 2KQ2A 3NH2A 5KFFA 3PR5B 2HHVA 3WNGA 3AVCA 4QOZB 4YD1A 4YR2A 4CJSA 1EXQA 4ED6A 5KFGA 4QZHA 5J2KA 4FJ9A 3RRHA 2QK9A 3L2QA 2JGUA 2YKNA 2P1JA 3ZT2A 4FS1A 4KO0A 1FKPA 4OJRA 1SKWA 3OYJA 1TL3A 3ASMA 2HB5A 5DG7A 1MU2A 2BQRA 3MXMA 1QSLA 4LZGA 3L3VA 2RN2A 4Q8EA 4PY5A 1N56A 2YNHA 1XHXA 2B21A 2W42A 4K4GA 4RW7A 3OS0A 3QEVA 4CJWA 4E7KA 1XU4A 4BE0A 2BCUA 5KG1A 1HNIA 3ZD9A 3OY9A 2R8KA 4C8LA 4RU9A 3MAQA 5C25A 3SCXA 4CEAA 1RDDA 4J9QA 1U04A 1VSHA 4GC6A 4Z6FA 2UVUA 5KTQA 4DTRA 1IKWA 3C5GA 7ICNA 5J2HA 3KK2A 4O3PA 5J2JA 1KVAA 3OS2A 2NRWA 3GIJA 3KLHA 4F93B 3WNFA 3UIQA 2ITGA 3S9HA 3VQBA 8ICBA 1WSHA 3KK1A 2QKBA 4DTOA 1HYSA 1ZQLA 4W5RA 3PY8A 3SUQA 1D8LA 5HLFA 4F92B 1DGSA 3K75D 1B9DA 9ICJA 4OPJA 1NOZA 2O4IA 4IRKA 3JPSA 4KLTA 4MFCA 2Z1GA 4O0JA 2PYJA 2IOCA 4FZXC 4M41A 3AO5A 3DLHA 2FLNA 4DTNA 3G0ZA 4JV2A 5F9NA 1SL1A 1C6VA 3O3FA 4DFKA 8ICXA 4N76A 4M3UA 3TAPA 4ED2A 2XY8A 3KIOA 4YVZA 4CK1A 1RILA 3CM6A 3G10A 3O3HA 1HUOA 5J2EA 4J9MA 2UVVA 3HJFA 4RW4A 4MEYA 1JLBA 1VRUA 2W8KA 1TKXA 4KN7A 2G8KA 3T1AA 9ICHA 2RKIA 2ISOA 9ICKA 3NH0A 4DTMA 2OWOA 3AA4A 1IXRA 3CQ8A 3HL8A 5BPCA 9ICEA 2LYHA 3DM2A 4I2IA 2DY4A 4I28A 5IILA 1DTQA 4FZYA 4KRFA 3AU2A 3H08A 1VSEA 1RT3A 4JK1A 1HYVA 2C2EA 5KT7A 3H40A 1TK5A 4CK2A 3V7JA 4FK4A 2X78A 1LAWA 1T03A 8ICMA 9ICLA 4QZDA 4RZRA 4ECXA 4DL3A 2WONA 3L2UA 1FK9A 3AVFA 4CE9A 2C2DA 2FC0A 4Q5VA 5C24A 3V81A 3ETLA 4UAZA 1ZBUA 3MDCA 1RT2A 3PO5A 4WE1A 4P2HA 4FLTA 2GV9A 4J9NA 1HPZA 1QQCA 2KZZA 3RBEA 3Q8MA 3SUPA 1HQUA 1SV5A 2XHBA 4RW8A 4CGGA 1VSIA 2FBTA 1JXLA 3K5MA 4QW8A 2W9CB 1UWBA 3JPPA 5DB7A 5CYMA 1T8EA 4QZIA 2YHBA 4B9VA 4RQ2A 4R64A 3CYMA 2VG7A 1C1AA 3K5OA 3UXOA 4I2QA 3RMAA 4O3NA 4KLIA 5DDYA 3TFSA 4NCGA 4UB5A 2HVHA 4OKKA 4J9RA 5DG8A 4CJRA 2ZJ8A 4DQQA 1WLJA 1WAFA 3V9WA 5J2MA 2VA2A 2ZUDA 1RDAA 2BR0A 2DPIA 3IHQB 4AHRA 3GV8B 4YMOA 1ZQPA 3AVMA 5TZVA 2LSNA 8ICZA 4F91B 5BOLA 3K57A 4KFBA 4DFPA 7ICFA 4CERA 3N97B 4ID1A 1BPXA 4MQ3A 3NAEA 3Q8RB 3OYNA 3TAMA 5J2NA 3OYAA 2FLPA 2C28A 3I8DA 3LZIA 5HRNA 7ICHA 3QEIA 4CHPA 5L1JA 1QS4A 5KFMA 4DQSA 3C2KA 3ZT4A 4M0AA 2P6RA 2IDOA 1ZQWA 4I9LA 4RNOA 1NJZA 4F2RA 2Y1JA 4R65A 3PO4A 1J53A 4YR3A 4E1MA 3LDSA 1I3AA 4K4HA 4Q45A 3C6TA 3OYGA 3NF8A 1TAUA 3BDPA 5J0UA 4NLGA 5HMLA 4F4WA 1RT5A 1S76D 4YG2A 4JRPA 2E6MA 1RT4A 3VQCA 1ZQRA 7ICTA 3TI0A 2P51A 2Z1IA 4PWDA 2BCSA 4CF8A 3VQAA 3PW5A 4M6WB 3RRGA 5KFCA 2BPGA 3V9UA 4O3RA 1U48A 1RDCA 5J2CA 3B6PA 3H8SA 5DQHA 3V7LA 1KDHA 2IS3A 2YNIA 4Z4HA 1KEJA 3KLFA 1D5AA 1S1TA 3ISDA 2FPKA 3ZCMA 3EZ5A 4PQUA 2HNDA 2BQ3A 1VSLA 1IG9A 3ZT1A 5J0SA 4FLXA 3AVJA 3IRXA 3MDAA 4DS4A 1MSWD 4KLQA 7ICUA 4FO6A 3UQ2A 3HPGA 4CESA 1L5UA 2ISPA 1VRTA 2BKEA 4DSLA 4LVSA 4E7LA 4YXMA 4FJJA 4IQWA 2BCRA 3OJUA 4DF8A 5HP4A 1BVSA 4ELUA 4CJLA 3NDKA 3V1RA 1S9EA 4I2FA 2HHTA 1ZQNA 1CUKA 1QLNA 2M9NA 4JWMA 1BPBA 3NGZA 4IKFA 4ELVA 4CEZA 4FJMA 1BGXT 1MQ2A 2DFHA 4JLHA 4Z4EA 4W5QA 2DFLA 4Q0BA 3RJGA 3HP9A 4M04A 4KLHA 9ICOA 4KAZA 1S0VA 3NHGA 4KV8A 1BQNA 5J29A 4J9OA 4CJ4A 4MEXA 3AO2A 2J6TA 2ZUCA 1H38A 4QWCA 4CIGA 4NM2A 4R8UB 3T5HA 1JKHA 3OYDA 1QTMA 1WSIA 3DOKA 1D9FA 1EETA 4PH5A 3Q8LA 3VQ7A 3H8JA 5KFDA 1T7PA 4CJUA 4DL7A 5DBAA 3D45A 3SZ2A 4K8XA 1IKYA 4M42A 1UA1A 2DFFA 3AVLA 1NK4A 1RNHA 3O3GA 4F5RA 4QWEA 4RT2A 1S97A 3HPOA 2ALZA 3OYKA 4AHCA 4CEEA 2B4JA 5KFHA 2R8HA 4R63A 4Z6DA 3OS1A 3A2FA 3C5FA 4TQRA 3SQ4A 2BDPA 2YKMA 7ICVA 5DGAA 8ICNA 1S9GA 2IGIA 4OGCA 1NJYA 1ZQEA 4KLLA 1W9HA 1S1WA 2AGPA 4FBTA 1X9WA 3MEGA 3QEBZ 4CHZA 2ASLA 2B6AA 5E41A 3PNCA 4KREA 2VG5A 2ZUBA 5KFKA 1ZETA 2YV0X 2H5XA 4AILC 1A76A 1VK0A 4DTJA 1S77D 2C22A 3MEDA 3OYLA 3V6HA 3LWMA 4CECA 3OYFA 5DG9A 4OVLA 3O4QA 3QO9A 9ICNA 2NRVA 7ICPA 2AU0A 3GIKA 1XO1A 1RT6A 3M8RA 3RB3A 9ICFA 2ATQA 3ZSOA 3TABA 4YN4A 3AVGA 4KI6A 4DOCA 1ITGA 2X6NA 1MQ3A 4CJVA 1JXBA 1TK0A 5HRSA 2ZJAA 4F4KA 1JLAA 9ICGA 1B43A 1S0OA 5CB1A 5IIIA 4LSNA 1GOBA 2G8IA 1EXNA 3HXMA 1ZQUA 4CHNA 2MUTA 3OHBA 4DL4A 4C8OA 3L3UA 3MABA 4M9NA 3F9KA 2QKKA 4O4GA 1NK6A 1JLCA 1RTJA 3SYZA 1TVAA 1VSDA 4HCBA 4E0DA 3UPQA 3IS9A 3ITHA 4IQTA 2HHUA 3ZD8A 5J2GA 3KLGA 3DMJA 3OJSA 4I2JA 3ZDCA 5DQIA 4IQUA 1U45A 4I29A 4JUZA 1XS9D 5KG6A 4RNMA 4DSFA 1RT1A 1ZQKA 3QEWA 4Q44A 4OLBA 4IG3A 4KPYA 4LZDA 3MGHA 1JLQA 3LP0A 3M9MB 3BJYA 4N56A 4PUOA 4F2SA 4P4OA 4DS5A 3UXPA 3CFRA 4NLNA 3QNOA 4FVMA 2VA8A 1KTQA 4KTQA 4BE1A 3PW2A 1HQEA 4CF1A 3NBPA 3HVTA 4EYHB 4F5OA 5JUMA 5KFAA 4KLUA 4JRQA 5KFVA 3QZ8A 3NGYA 5J2AA 3C2LA 4F4ZA 2V4QA 4TQSA 1TAQA 1XI1A 5F9LA 4IG0A 2I1QA 4UB4A 4DTUA 2AJQA 3P1GA 3N4MB 4AHTA 4KLFA 5IIJA 1ZQCA 4CGIA 4CK3A 1JL2A 2JEFA 3LALA 3PMLA 1S1UA 4O3SA 1NKCA 5DLGA 4ECSA 4I7FA 1KSPA 4CFAA 4I2GA 3C1ZA 3AVBA 1L3TA 2HHXA 8ICHA 1ZQHA 3H7IA 4I2HA 3U6FA 3LZJA 1HMVA 3V4IA 3QLHA 2XGQA 2BGGA 3M9OB 4KLJA 4B9MA 4E7JA 3UQ0A 4EP4A 2PFNA 2Q3SA 2G8HA 5KFBA 2RDJA 4HHTA 5FRNA 3DLKA 1ZQAA 3GV5B 1WSEA 1RBUA 8ICIA 4L8RB 3EWAA 4QZGA 4KTZA 5KG3A 3SPYA 5KT2A 4HTUA 4KLEA 1TKTA 4FJKA 1SL0A 1VSMA 5KGXA 1KVCA 5DK5A 5KFOA 5J0WA 1CXQA 2AQ4A 4O44A 2C2RA 5CJ7A 3JSMA 4KKOA 3VN5A 1ASWA 4E19A 4BDYA 4P4PA 3QIOA 3Q8SB 2E4LA 4FJLA 2HNZA 3BQTA 5D49A 3EW9A 2HHWA 1VSJA 1RTIA 4M3ZA 1C0UA 2YHAA 3U3YA 2HMIA 4FLZA 4YCXA 1Z26A 4UBBA 3HX0A 4F5PA 2PFQA 5DKWA 9ICVA 4RG8A 3MXIA 5D3GA 1RBSA 3EY1A 7ICRA 4FJHA 3JPQA 4FM2A 4RPZA 3LP1A 4DFMA 4IFVA 4CF9A 5KFLA 3KD5E 1S1XA 3S3OA 4CHOA 4DSIA 3DLEA 4PPXA 4CFBA 4DU1A 4FW1A 1S1VA 4LY7A 9ICQA 3AVAA 1T3NA 4CGHA 3E2EA 4PGQA 2ETJA 3P83D 2JEGA 4TUPA 1S10A 3ZDAA 4RUCA 1IKVA 4KN4A 5DBBA 1Z00A 3GDXA 4F5NA 1ZQXA 2FMPA 5KFRA 3H4BA 2KZMA 1QE1A 3SI8A 3RWUA 2WOMA 1W0HA 4BDPA 3GFKB 4FJIA 2FBXA 1UAXA 3TAGA 3MEEA 4LH5A 4YP3A 3PX0A 2ZTCA 1A5WA 3LAMA 4DU3A 4KHYA 1SL2A 5KFZA 4RPYA 2P5GA 1QSSA 2ZTEA 3RB6A 4ED3A 1Z3EB 2ZTDA 4TURA 3I0RA 3Q8QB 4H4MA 4W5OA 5J2PA 4QZCA 4CF0A 3TFRA 1NJXA 1JL1A 4TUSA 2JLEA 4PHPA 1TK8A 4M9JA 4GW6A 4J9KA 2G8UA 4Q8FA 4BWMA 1UOCA 1HYZA 5HHIA 1JMSA 5CY4A 2R8IA 5J0XA 2ZD1A 1KCFA 4DTPA 4M9GA 9ICWA 4FJGA 3VQ5A 3EPIA 3LWLA 3AVNA 4X5VA 4OLAA 5KFWA 3G6XA 1X9SA 1B22A 4KHWA 2XCPA 2KW4A 4FK2A 4UB1A 3NF6A 4DL5A 4FLYA 5CA7A 4DOBA 4AHVA 5CR0A 1VSFA 5FDLA 1LAVA 1KRPA 3AO1A 3ZDBA 4KB1A 4YFUA 1YVUA 2W9BA 4ZTFA 1Y97A 4PHEA 1XC9A 4UB2A 3QETA 2KZ3A 4C8KA 2R7YA 1ZQFA 5DBCA 3C2MA 2D5RA 3I0SA 1SZPA 3HYFA 4O5KA 5KT6A 1ZYQA 2P66A 3K2PA 3QZ7A 2KFZA 1GOAA 3IAYA 3VQ6A 1ASVA 4FYDA 2BCVA 5BOMA 4GC7A 1ZQTA 5KG4A 5EWEA 1CZ9A 3T5JA 4CJ3A 3T5KA 8ICAA 3V9ZA 2G8VA 5J0RA 1MC8A 2ASDA 3EPGA 2HHSA 3M8QA 3ZSRA 3MR6A 3ZT0A 4DG1A 3LP3A 3KD1E 3NTUA 3C21A 5IINA 5KFPA 3V1QA 3RJJA 2MAXA 5KI6A 1REVA 3C23A 4MFBA 4J9SA 2FMQA 2UVRA 1ZBIA 3VQQA 4OPKA 3GV7B 4J2AA 3HWTA 4N5SA 7ICOA 1NK0A 5KFXA 2F1HA 4RW6A 1NK7A 4I2EA 1ZQZA 2OPPA 5DGBA 3VQPA 4FLWA 1WN7A 5DB6A 4JV0A 2D0CA 9ICIA 1CZBA 1Y88A 5J0QA 1ZQIA 4MF2A 4Z6EA 2FBYA 5D46A 3V7KA 2IAJA 4RQ8A 3RJKA 3RMDA 5KT5A 4KHQA 3MGIA 1RBRA 1GOCA 3OVNA 2I9GA 3V1OA 5J0PA 4CJQA 3LANA 1JLFA 2MUTB 4Z4FA 1BL3A 3DLGA 1IKXA 2PFPA 2PZSA 4Z4GA 4LH4A 3PW7A 5I42A 3VA0A 1ZQVA 4UAYA 3M8SA 4IBNA 2OPRA 4DTSA 5DQGA 4FBUA 4J2BA 4FJXA 3B6OA 1SKSA 8ICCA 2ASJA 5CWRA 1NK9A 5HRRA 4ZTJA 4RQ7A 4RQ3A 3MXJA 4KLDA 1QHTA 9ICBA 1BIUA 2ZE2A 5J2QA 4KI4A 5L1KA 1DLOA 3K59A 1TKZA 1RDBA 3NGDA 5K14A 5C42A 7ICEA 3NH1A 4BDZA 4P4MA 2Y1IA 3DLRA 1RCHA 2IMWP 4ICLA 4FCYA 3S3NA 4E1NA 1RYRA 3TR8A 4B9TA 2NRZA 4YR0A 5KFIA 4R5PA 4CGDA 4EEYA 1K1QA 2OA8A 2XO7A 3AO3A 2FPMA 1TV6A 4FM1A 1XWLA 2OZMA 4YMMA 2JEIA 2HVIA 4C8NA 3F73A 1KLNA 4F4XA 1WSGA 4HUFA 3ORYA 3CFOA 4EBCA 3SV4A 4RW9A 1WSJA 2HW3A 4B8AB 2HHQA 4IR9A 4O55A 4FW2A 4QZ9A 1U4BA 1U47A 2HNYA 3FDSA 5CP2A 3TAQA 1R0AA 5KG7A 2AGOA 3RAXA 1G15A 4F5QA 1Q8IA 1RTDA 3OYMA 5L1LA 2P6UA 1LWCA 4Z0UA 3ZSVA 3SUOA 2ZJ5A 4DLEA 5L1IA 1C1CA 7ICIA 2A1JA 4Q43A 7ICLA 3MR5A 3KK3A 4C8MA 3RJFA 4AHSA 2FMSA 3ZT3A 2IBKA 2X6SA 2RDIA 3ISBA 4R66A 4TSXA 1QSYA 4YQWA 9ICXA 2Z1JA 2OPSA 3RMBA 4XUSA 4JS5A 1A5VA 7ICMA 4GXKA 3JPNA 4JWNA 1ZBHA 3D0PA 4NY8A 4PGYA 4MF8A 4O0IA 3RR7A 3BQ0A 4HUGA 2FLLA 8ICJA 3RH4A 3RR8A 4KITB 2BPCA 2BQUA 5KFUA 4KLMA 2XGPA 4ED1A 3ZDDA 5DB8A 1JX4A 1BIZA 1N6QA 3FYHA 3QE9Y 4XRHA 3G6VA 3MR3A 2JZBA 3JPTA 4I2DA 2JEJA 1S6QA 8ICUA 3KKSA 4EZ6A 1T4GA 2FBVA 4FLUA 2XCAA 8ICEA 2F96A 5J2FA 2OYQA 1JIHA 8ICPA 3AV9A 1YTUA 1LW0A 2IHMA 4IR1A 1YTAA 4PA1A 1JLEA 3VA3A 4UQGA 3DLBA 5KFSA 1ZQGA 3LK9A 5EWGA 1Z00B 8ICFA 1Q9XA 1CLQA 1WSFA 4G1QA 5D4BA 1FKOA 4GMJB 3QNNA 1EKEA 1A5XA 2ZQBA 3B0YA 5KT3A 1SKRA 3QESA 3CG7A 4DLGA 7ICKA 5KT4A 4E89A 4GXIA 3TANA 8ICGA 3VQ4A 4IQVA 4B9NA 4BXOA 4CJKA 3ZDEA 3THVA 4QW9A 3RH5A 3TAFA 5J0YA 4RQ6A 1LV5A 1RPLA 2B5JA 4H8KA 4DMNA 2UVWA 4XQ8A 1ZJNA
chains in the Genus database with same CATH superfamily
2F8SA 4J5OA 2DO0A 5BR8F 4PR6A 3SDEB 2MEWA 2DEJA 4LREA 3Q7BA 3FZMA 1E6YB 2IC3A 3IG8A 3TSQA 2F4VK 1LWFA 3N6MA 3WKDA 2V51B 3QWPA 4B3OA 2K4PA 2G4BA 3F9MA 3BPDA 3K5NA 3QSIA 1VLBA 2ZD1B 2YQ1A 4PGXA 4A59A 2R7VA 3D2FB 2FPLA 1X4FA 5A8KB 2MKHA 3NGKA 4MIAA 1YX2A 3AFGA 5ALYA 2OHFA 4LF1A 4W5TA 1W2BR 4CM2A 2OO4A 1IM4A 1O8BA 3GIMA 3BS5A 2XY7A 4YN3B 3DXBA 3RUBL 3VAHA 5E79U 1Q81T 2DYAA 1XMBA 4DV1K 3RJHA 2XYHB 1N34F 1Q81O 5ETOA 1ZA1B 1ZAXA 4UASA 1VQKS 5CRXA 4MT1A 2W9BB 3PRBA 3H1VX 2W9MA 2C3OA 3W62A 3QEPA 4Z4CA 3GLJA 1EHWA 3WX4A 1Q9YA 4B08A 3KWIA 4X2BA 2WSFC 1HHTP 1IBMK 2BE2A 4UAUA 2NZCA 1FEHA 1ZQ1C 1HW8A 3NASA 2QC3A 4C11B 5JRTA 1N48A 3OYBA 1OH8A 3W3SA 8ICRA 5JS2A 1EJ7L 4CLPA 2PA3A 4J2EA 3RMCA 3V72A 2JVOA 2E8NA 2BKNA 2W3SA 4IRCA 3K0JA 3AODA 4FJ7A 2W9AA 2JWNA 4ED7A 5C12A 5GTIU 4HR2A 3MM9B 3PSPA 4UB3A 1FX4A 5AI5A 3QICA 4FXVA 2E8OA 4LBIA 2K8BB 3PMNA 2IJRA 2LU2A 4G9ZA 1MN9A 2BGWA 1JALA 2DXFA 1FRLA 2LLZA 4B1ZA 1NGGA 2OPPB 3MM7A 1UEUA 3VAFA 4EHTA 2FGCA 1HBNA 5G0RB 3HP6A 3FSIA 4G3IA 3Q2SC 1QQNA 4Y28C 4WFBL 1JRPA 5ALWA 4C8YA 3LL3A 2KDOA 1VBZA 5IOLA 3HKZF 2F4VF 2Y3YA 1FHTA 3TTCA 4YMNA 4ZDNA 3ULHA 3QPIA 3KVGA 3HVWA 4KHPF 3UNYA 4JP8A 3K0SA 3ZI4A 1S79A 3VWSA 4NLBA 4DR7J 1RUSA 4OJ5A 1X60A 1F5BA 4WWSA 2R2SA 3OW2M 3PX4A 4DX8H 4I1TA 3MFIA 1KFSA 3BQ1A 4CCHA 2YKQA 3E8OA 5J1PA 1BG3A 5A0YB 2P6TA 1EX4A 2UUBF 2CUYA 1NH8A 1PJ7A 3VAMA 1TKZB 3WHIA 3OR2B 2UVWA 1V3RA 5D15A 3N0VA 1HBOB 2W2QP 3JYTA 5AM2A 4ILGB 2XULA 4QZBA 3U26A 3MPDA 4RNFA 4JHDA 2IRUA 4AXJA 3R8EA 4H5TA 1OW5A 5HMMA 4H0XB 5CYQA 1I51B 3GFZA 1NKBA 3M1VA 1HWJA 5AQRA 1PBAA 2HURA 2QFIA 2D0PA 1Z19A 1Y3JA 3AA8A 3OYIA 5M1FA 1MWKA 3DXSX 4Z6CA 1FDNA 1HD0A 1IBMF 3MPWA 2ROPA 5GADP 3ICXA 3TWZA 2A1AA 2V67A 1COOA 3AOCA 3MMAA 1ZBLA 2A1RA 3L3FX 4RQ4A 3BREA 4TU9A 4WZQA 1J9AA 5IT9U 2V69A 3Q8KA 5AK5A 1X2IA 4QZ8A 2NPFA 3KUHA 4OHVA 3DXKA 4FWRA 3MDFA 4JKGB 1EARA 1HBUA 3OL6A 4KHNA 2B9WA 2J5AA 1XMQJ 1NM1A 3D7SB 4ISGA 2A1JB 2QYCA 1WF2A 4CEBA 3RAQA 4TUQA 5CZ1A 3A13A 4CJFA 1IIPA 3IM9A 3L6QA 1AT1B 4PHDA 2Y1RI 3H0MB 3ADAC 4G1PA 2QT7A 3ISNC 3C0BA 2G1HA 4M3RA 1HRHA 5FRMA 1TKDA 1L3UA 2R7OA 5KRSA 1JNZB 1TYQB 4WK1A 4QWAA 3QFHA 2W04A 1CQNA 3CDUA 1YQHA 4KTWA 3RJEA 1R89A 5FROA 2FJWA 4K4IA 3PUFA 1L3VA 3DWLA 1VQOS 1N2XA 4IH5A 1VJ5A 2XZWA 3AXKA 5LJ3Y 3VZIA 4FPRA 5DDRC 4K8ZA 2YHWA 5IV4A 2NXJA 1XNSA 2J6SA 4WYWA 4ZPDA 2YKAA 1VHXA 3A5MC 1B7YB 4CLSA 1NSKL 1CG2A 1JLEB 1V9PA 4X4QA 1N60A 2CQCA 4I2AA 2DNZA 1DZ5A 1K47A 4A8SA 4YB1P 2HVZA 3QMQA 5ALHA 1V5IB 1MA9B 5M1PA 5HNKA 5B8HA 3F5AA 2G9OA 1TVRA 4JI1J 3DJCA 2K7JA 3OSPA 2PT0A 4C1NK 3OYHA 2DFEA 2PD1A 3W8GA 3J7YI 3KK7A 2KFYA 3V9SA 4OJOA 2WHEA 3HZEA 4M9HA 1WI6A 5LSOA 4OHYA 1RAEB 5IS2A 1KFDA 4LD0A 4WFNL 4RWXA 1NZPA 1J2VA 2B5JB 5KFNA 2E1CA 2GW8A 3ATVA 2R7UA 8ICOA 2HZCA 4H5NA 2LA6A 4JN4A 4PCQA 1WEXA 3W5XA 3MM6A 4PL1A 3EGNA 3O3LA 1MG7A 2GIFA 3G6YA 1FRJA 1T95A 2V9KA 4ENOA 3QUTA 1KXPA 4LSLB 4NA1A 3NFAA 2YNGB 2E5IA 2HMPA 2DGTA 2K8CB 4A57A 4DR2J 4RNNA 2QLWA 1JN3A 2UUTA 1RCXB 4CO4A 4UUXA 1X4BA 1YGYA 1BE4A 4ZITA 5KFEA 2JHEA 1RWUA 3VAIA 1HR0F 4QZEA 3H46O 5AQZA 4F3TA 3QSYB 1H73A 1YJWN 3GWCA 3F2KA 4FZNA 1CS4B 1C2PA 5FPEA 2B0GA 1I6JA 2HAFA 4M5MA 3C16A 3VQ9A 2KH9A 4JI7F 4BRAA 4B8CA 3PRVA 4B3RJ 1HJRA 2MA1A 2O8FA 2Q0ZX 1KD1O 1BPDA 5L46A 3BKUA 3IG1B 4IDKA 4JI5K 8ICYA 2GFFA 4ID5B 1Q82T 3K1ZA 4QNLA 3F41A 4P73A 4ZN3A 2FJAB 3ILJA 3GG1A 5J2BA 1S48A 2RILA 5EN1A 2ZM6K 1KAYA 5KFTA 2G2YA 3RFAA 1CPZA 2GBZA 1KNZA 4JMUA 4JB3A 5J0OA 4CHQA 1AUDA 4HCCA 3OHAA 1TAMA 4DWIA 2DTJA 4KX5A 2PBDA 3MF5A 3HM9A 5AZJB 2E1ZA 2VWKA 5CZ2A 3M8PA 5C2DA 3AJDA 1JJ4A 4WCEQ 5HP1B 3MR7A 1HNVA 3TPQA 1ZQQA 4DR4J 2WTFA 1R27B 4DUYK 3H8WA 1IM6A 4W90B 2J8SA 3RB4A 5B7WA 3M9NB 1CQMA 2V34A 8ICQA 1M5HA 4MHVA 3F53A 4IC9A 7ICSA 2YX1A 2ZH2A 2QEXN 1APSA 4YD1A 1KS2A 3MN9A 4ZK7M 1BQMB 1EXQA 1YJUA 4WQ5C 4ED6A 5KFGA 4QZHA 2QI2A 4PEOA 2QTWA 5CH7B 3IAS9 1RLCL 1Y5NB 2QK9A 4I2PB 2MZQA 5AKHA 3ZT2A 4FS1A 4O0NA 3UW1A 4DHYA 3OL8A 1VK8A 3ASMA 5DG7A 4A8FA 4MYUA 2BQRA 1QSLA 3TADA 2YN4A 4C4TA 2Z2YB 2ZH3A 4JI6K 3L3VA 2DD8S 2RN2A 4Q8EA 3R6GB 4YOVA 2YNHA 2B21A 3OPXA 2LYVA 3OS0A 1ZZFA 5D4OA 1XU4A 1IR0A 4ETXA 2HGNA 2C42A 2BCUA 4DPXA 3CO0P 3MWPA 2H3VA 2VGNA 2VQFK 5C25A 3G8TA 1RDDA 4J9QA 2WVBA 1U04A 2GC8A 3O9QA 2EZZA 4UB8U 1L7PA 5IWAF 1D1UA 4OPHA 2WB1D 5EVZA 1GQEA 3PCOB 4O3PA 1SIWB 1VQSA 2L08A 1TMMA 3FBCA 4CO2A 3BPSP 4F93B 3IC1A 2E88A 3S9HA 3NLCA 1S4FA 4MO5A 1COKA 2B9XA 1D8LA 2DO4A 2HFUA 1KONA 3N6NA 4F92B 4YUDA 3FBFA 4OJGA 1GFWB 4PL2A 2IVYA 2QE5A 1SI9A 2Z1GA 1EIYB 3JTOA 3B82A 2GJ2A 3ZFVA 5ALOA 4ZCKA 2O8DA 3AO5A 2FLNA 4U96A 1LNQA 3UD3P 3D2WA 4B1VA 3I9V9 2FVCA 2VFTA 1SL1A 3MMCB 3I32A 4M3UA 4IDHA 1CJUB 4ED2A 3PIOQ 4YVZA 4CK1A 3C14A 4K2XA 3JXOA 1NSAA 4U8VA 4JI0K 4MEYA 2JLFA 1JLBA 2LXIA 2VWBA 3D2EB 2LEPA 3K1RB 3HRDD 1VJWA 3M05A 3T1AA 3QGIA 9ICHA 4IOCL 2CJXB 3M2RA 2DNHA 3AA4A 3HL8A 2FJXA 3FAHA 4JI2F 1N32K 4A8XA 4URQU 1RU1A 4DMZA 2CXYA 1T02A 4IJAA 2BANB 4I28A 5IILA 2HF4A 3CCJS 1UEKA 4EI2A 1RT3A 2C2EA 3NNCA 1ATNA 3H40A 2HFOA 5HL7Q 3QDKA 2V2KA 3V7JA 3EDRB 1RAAB 2I0XA 1KHWA 4Q2MA 4QZDA 1NMNA 4BRLA 1Q0NA 1UQVA 5AQVA 3CJSA 1GK8A 4FYYB 2MKIA 2HRUA 3AVFA 5TKYA 3SQIA 2FC0A 1OIAA 4BRNA 3UKRA 3ETLA 3MDCA 3L4BC 4PPZA 1MWYA 1RWKB 3BF4A 4FLTA 2J0WA 3R1LA 5ALKA 5HQLA 2XHBA 6FDRA 2E8AA 3QNMA 2W9CB 1Y9OA 1UWBA 4B3TF 3VCDA 4QS8A 5AQQA 4QYZJ 2DQNB 2H3GX 1T8EA 1NJIO 4QZIA 1ZD5A 2L9WA 1FJGJ 2YHBA 3LM9A 3AT1B 2C2OB 3K5OA 2RLTA 5G4DA 2EG2A 3VAJA 4TN2A 3D68A 1XMOJ 4OKKA 4J9RA 2X1GA 5DG8A 2BW2A 3LA0A 5AQWA 2ZJ8A 5T41A 1WLJA 1WAFA 3V9WA 1G6BA 3TZWA 2MZTA 3LH2S 4AT1B 2D1KA 1ZQPA 3AVMA 1NGJA 5TZVA 2Q2RA 3A8KA 2Y8WA 2FTRA 2PKEA 1LK7A 3K57A 2RD5C 4TU8A 1HHSA 2O01C 4DPTA 2FVPA 1Z4NA 1BPXA 3NAEA 4J37A 3OHRA 2DNNA 3HHLD 3LZIA 2VICA 3Q2TC 4NX9A 5L1JA 4ZPAA 3OR1A 1NBEB 3ZT4A 2P6RA 4JKDA 3NG8A 3RSEA 4A2AA 4NLCA 5D6GA 2RF2B 2Y1JA 3PO4A 4JI0F 1I3AA 3RVCA 2VBWA 4K4HA 4K42A 4X66J 4Q45A 3C6TA 3WZ0A 3RW7A 4NLGA 4F4WA 4YG2A 4IO9L 2DHGA 2ZBIA 7ICTA 2Z1IA 4CF8A 1UZDA 3H6EA 3D6JA 1S3XA 5KFCA 3F5EA 2BPGA 4DUZF 2HQ3A 3B6PA 3V7LA 4USMA 1Q8BA 4K0KJ 3NVKA 2YNIA 4Z4HA 1TL4A 3EJMA 2GX8A 3T6JA 3V6DB 4KRWA 3ISDA 1WC4A 2P9SA 4PQUA 4K4WA 2OANA 1OYDA 2J7WA 2MZJA 1VSLA 3BN4A 2BH1A 4LF9J 4CGZA 1OH7A 2CPXA 4FLXA 1S6PB 3IRXA 3P3DA 4X65K 4KLQA 1NDLA 7ICUA 3UQ2A 3HPGA 4ZCLA 1L5UA 4BCAA 2ISPA 1VRTA 4NLUA 5AKYA 4E7LA 5G0RA 2GELA 4YXMA 2I5JB 3KLIB 2GJFA 3H45C 5HAOA 3VHQA 2E1EA 1BVSA 4H0VB 3C6UB 3A3OB 3WDOA 2HHTA 2CQDA 2YI1A 1KTVA 5F8LA 1QLNA 4DR1J 4JWMA 4DV4J 2G0CA 3KWMA 1WI8A 2H65B 1C0GA 3NGZA 4ELVA 4CEZA 1WTFA 4OHZA 3HFKA 5AQGA 2KT2A 2OPQB 3FJ2A 2FZGB 2MKYA 2R42A 2DFHA 3O80A 4M04A 4A8KA 3TADC 3WXIA 1VLYA 1H6KX 3PSTA 5J29A 4CF5A 3MAAA 4TYAA 5GAGI 2HFVA 1H38A 4M7XA 3FE1A 2UXDJ 2BOPA 5D0EA 4YHHF 2MHNA 4BR7A 1EQYA 3BSCA 2DKZA 1NZBA 4CYUB 5KOXA 2H48B 3H8JA 5KFDA 2LFVA 5B0AA 2HBRB 5AM5A 5DBAA 5HR7A 2DNQA 1R6YA 3UPFA 1FKPB 1TUUA 4C80A 4Y2PA 3AHPA 4DV5J 2J9EA 3FBBA 4DR3K 3DOMB 2Y9HA 3O3GA 4F5RA 1S97A 1MMNA 2IDEA 1OMSA 1OUQA 4RBUA 2CADA 5LSRA 3W9JA 4KH5A 1NI3A 2CZVC 2BTFA 4CEEA 2R8HA 5CEHA 3TEHB 3R27A 4EX7A 1F3FA 2W4PA 3OS1A 4TQRA 5ETPA 1Q86T 2KKZA 2BZFA 3IR5B 5ALGA 7ICVA 5DGAA 8ICNA 1CJVA 1FI4A 4FPAA 2GVZA 4CHZA 3H3OB 2ASLA 4TLQA 1ZM9A 4B3SJ 1GLFO 2NQPA 1N33J 1IKWB 2P9PB 3KLVA 1RA6A 1VK0A 1XEZA 4TVAB 2OIHA 3G8QA 3SJHA 5CCMA 4X65F 2NUHA 4CECA 4P72A 2CPIA 4KMOB 3OYFA 5DG9A 3J7AN 3EEQA 3T9NA 2N82B 2HSZA 7ICPA 3FZ2A 3OUYA 1MMDA 3KK1B 3VALA 1HYSB 2DPNA 1G1XA 3RB3A 1RGIA 3A0HU 1HKGA 4KI6A 3TABA 3BP8A 4DOCA 4CJVA 4OYMA 3OVAA 3EZWA 2ZJAA 4F4KA 4DCJB 1B43A 2ZJQL 4FN5A 1FXDA 1DXSA 4GKKJ 1S7IA 1GOBA 2G8IA 2QA4N 2IRXA 3ULEB 5HQ8A 4M95A 3H8YA 3CJBA 2MUTA 3OHBA 3CF5Q 4ZVFA 3GE1A 3MABA 2IIRA 3NVMA 3BH6B 4M9NA 2B0CA 4O4GA 1NK6A 1DARA 3VPZA 3CPWM 3D1QA 1HNXK 1VRUB 3ZEUB 1NDCA 3UPQA 3ITHA 4IQTA 5F8HA 5KQDA 1E6VA 3ZD8A 1Q4RA 2BJ1A 5HMWA 4R79A 2AWZA 4UOFA 3DM2B 4IOAL 3QYYA 1TQLA 3QEWA 4Q44A 2F7TA 2J0SD 1RAHB 3HOSA 2J0XA 1PO6A 4IG3A 3F44A 2ZH1A 2VQEJ 1FXLA 3LP0A 3MGVA 4PUOA 1U0HA 4F2SA 2C3PA 3R9PA 2QN6B 4DR3F 1KQQA 3ET6A 1JI7A 4PABA 4FVMA 2P35A 4KC5A 1MROA 4KTQA 3J7YU 2VDIA 2BE7D 3KJQB 3RZAA 4F5OA 3D2SA 2CJAA 5KFVA 3SEOA 2HAIA 2H3QA 2VPXB 4UOGA 1SV5B 4IG0A 1HI1A 7AT1B 1N36K 1ZAWA 3K5PA 3L95X 2AJQA 1U26A 4IEEA 1KVJA 4BGAA 2MY7A 3W2VB 4YB7A 4M5DB 3TJAA 2W6LA 4ZVSB 3ZTQA 3M30A 5B09A 5ETQA 2O8CA 2KXNB 3LALA 8ATCB 2EFNA 3FRYA 3CTRA 5E0OA 2FDNA 3I5AA 1TUWA 1VQON 2W25A 4LR8A 4I7FA 3FQKA 1DJ0A 1P27B 4MDAA 1L3TA 1X9JA 2JDJA 8ICHA 1YVFA 2DITA 2HEKA 3V4IA 4F71A 1RWOB 2ZNZA 2JWLA 4NE9C 4IZ9A 3M9OB 4KLJA 2PFNA 3OPKA 3LVWA 4HHTA 5FRNA 1V85A 1C4CA 4C7QA 1HUXA 1PK1B 2KVIA 1ZQAA 4L8RB 3FSYA 1I94K 1ECWA 1T0TV 2AEFA 5KG3A 4AYBD 2QB0A 5J2NB 1VC0A 4QZVB 3SPYA 2MGZB 4HTUA 4KLEA 1TKTA 1VSMA 2NYHA 1KVCA 2GHVC 5J0WA 4J91A 5CJ7A 3JSMA 1HWIA 4DV3J 1ASWA 2HBYB 1FJCA 4OV6A 3QIOA 2E4LA 2KU7A 3BEXA 2MLXA 5D49A 2HHWA 2AXTU 5CHIA 3MURP 5ALVA 3M2VA 1HNXF 3MMVA 4KPCA 4BRKA 5HATA 2MZSA 4B17A 4DU8A 3ZLJA 3AAPA 1HA1A 5LY3A 3CETA 3EY1A 3OD2A 5M1OA 3AQFA 5AKLA 2OLWA 3THYA 5JTIA 4OZ2A 3SD7A 1S1XA 2RQMA 1X0FA 3S3OA 3AOBA 4DSIA 2WFAA 1N8RT 4CFBA 4FW1A 3AVAA 4CGHA 1X3NA 3E2EA 1PUZA 3P83D 2EANA 4TUPA 1S10A 5D4NA 4HLBA 1F5CA 3DKDA 4XK8C 4JAXA 3EL2A 1YDLA 4HEA9 3CNHA 3BN7A 3R5AA 2HNDB 4FWMA 3OTBA 5KFRA 1IVZA 1QE1A 3SI8A 2DIVA 5GADI 4WQ4A 1W0HA 2KJ9A 4UQTA 2M3DA 1AUSL 3C7NA 4JI3F 4HKQA 3MEEA 2LM4A 1VJQA 4YP3A 3I56S 2NNWA 1N36F 2ZTCA 3FK4A 3F5TA 2FVQA 3DDNA 4KHYA 2K60A 4RPYA 2ZTEA 2OJ3A 4DV2J 3ZZRA 1S9EB 2HZAA 5ALNA 3TZYA 4KHMA 3L5KA 5T14A 2ZIVB 1Z3EB 4TURA 2NYIA 3IXQA 4J9UE 4H54A 3WC2A 2B4UA 4W5OA 1K5OA 3VV2B 2F65A 2E1YA 4QZCA 4CF0A 3TFRA 2ZH4A 4TUSA 2A6OA 2GWKA 4Q0BB 2JLEA 2JFDA 4M9JA 4J9KA 1L6NA 1GO3F 2G8UA 2LDIA 1BQNB 5HHIA 2Y8YA 3P49B 1HYZA 1JMSA 2QWOA 4DTPA 4X64J 4IOBA 2PAVA 3GG0A 4FJGA 2OTLS 3TTFA 1JKHB 5LMNK 1T9UA 5KFWA 2UUCJ 1EETB 4I6WA 2MLZA 3G4SS 2E44A 4ICAA 3NF6A 3CNQP 3US5A 2EXUA 2HWTA 5LM7E 4LFCJ 2YQ0A 1OH6A 3GZ7A 4ISFA 4KY3A 3HZGA 2FVSA 4KB1A 4YFUA 2KP7A 2G1DA 1KR4A 3KNGA 4AM7A 1X4AA 1Y97A 5GAHI 1K8AT 2KZ3A 2CIMA 2R7YA 3ENAA 4Y2UA 3SENA 5DBCA 4MJKA 4FZLA 5HMZA 3VC8A 3NGTA 1VQLS 2YKMB 1S9GB 1JJHA 2P66A 4WFAQ 2KFZA 5I3PA 4FYDA 1ASVA 2E1PA 2QWRA 2DNGA 1ZQTA 2UXCF 5KG4A 5GAEP 5EWEA 5BYSA 4ZPBA 1LVHA 1H7XA 1EKRA 2VC0A 3BGUA 2B6AB 1HBMA 2VPYB 4CJ3A 3MCOA 3TACB 3EXYA 3W1YC 2A42A 3V9ZA 1MC8A 2HHSA 3M8QA 4YOEA 2CQPA 3LP3A 2YWFA 2DGOA 2E2OA 3MEDB 4X4TA 3S6EA 5KI6A 5DM6L 3HSZA 3J80U 4OO1J 3FRZA 3VQQA 2V5HG 2DNLA 5GIOA 1X3MA 2CRXA 1HWUA 1NK0A 3R5BA 2XYGB 1NK7A 1ZQZA 5DGBA 3IDWA 5DB6A 9ICIA 1JLAB 1L7OA 5J0QA 4GKJF 5EHHA 3Q8VA 3CCRS 1QAJA 2W01A 3UFCX 4LSNB 2IAJA 4GFJA 4M5GA 2P9KA 4H0PA 4ILLA 1GOCA 3Q7CA 5K8MA 4CJQA 3LANA 1JLFA 3QRRA 1IKXA 2O8EB 2QGFB 2PFPA 2PZSA 1PGZA 4LH4A 4OX9J 5I42A 3KZIU 5JMVA 4PL8A 3NGUA 5E7OB 4MH8A 4LRAA 2MSTA 3MEKA 4J2BA 1OSDA 3T1YK 1SKSA 8ICCA 2ASJA 1NM2A 2RB7A 3DMJB 4ZTJA 4RQ7A 5LMNF 3I4PA 2LQJA 1WG5A 4CTAB 2A41A 1BNOA 2HWIA 2WW8A 4ZMMA 2XSFA 3QJLA 4FNHA 4KI4A 1KQFB 2LHTA 1H3DA 5C42A 3J7ZT 2O8BB 2LKZA 3ENBA 4CJ7A 2LKYA 4E1NA 4KAIA 1RYRA 1U1MA 4BREA 3TR8A 1HQEB 3GFXA 4NMLA 4CGDA 3AGKA 4BLGA 5A8WB 2JMGA 2CFXA 2OA8A 2JOQA 3ONNA 1SPBP 4FM1A 1SQKA 1DHMA 2OZMA 2R2RA 2MQPA 3BF1A 2WC9A 2HVIA 5A8RA 1PKUA 1M5OC 3GJRB 2J9DE 3RW6A 4HUFA 2NYVA 2OD4A 1LFWA 3GSDA 2PMHA 2GMHA 4RW9A 4B8AB 2E9RX 1YK9A 4CLUA 4Z2XA 3GSIA 4WKRA 5EX5A 1JUDA 3HHDA 2HNYA 3TAQA 4LF4F 1FDDA 1T9WA 3ED5A 5AICA 1SJFA 1O13A 1RI7A 2Q0RA 2OHDA 8AT1B 5CCLA 4WFBQ 3FKBA 5JMNA 3QLHB 4WFZA 1NGDA 1RQNA 4AL5A 4Q43A 2YXLA 2H9ZA 4RR5A 1YRTA 2RHKA 4C8MA 3DLKB 4R66A 2AZ1A 2ZDOA 1GNKA 4YQWA 1LQ9A 2Z1JA 2KIWA 1IN0A 2FSJA 3EWGA 1SXEA 3HDSA 4O44B 3GR0A 2EDUA 4FZVA 4PGYA 2OFHX 3RAMA 2HNZB 3VAKA 2FLLA 8ICJA 3RH4A 1YI2S 3RR8A 4HT7A 1RTIB 2NREA 5CYJA 1Q7YT 4X4NA 4BY9C 1C0UB 1VIOA 2HMIB 4PQAA 1BIZA 3VR1A 3T1YF 3K2YA 5EE9A 1BWEA 1QM9A 1V6HA 3SMZA 2KNJA 1F6TA 4K43A 4P71A 4WXWA 1T4GA 2RDDA 4IFVB 4OJ3A 3BH7B 4BG9A 4RWTA 2P6SA 1NGHA 4IL6U 1RADB 4DV0J 8ICPA 4MAKA 2F2AB 3KKFA 2IHMA 3W2WA 1YTAA 1S1VB 2JX2A 2XNQA 1WOPA 4PYDA 5E2QA 4UQGA 5LT5A 5AE3A 1ZQGA 3LK9A 1IKVB 3L7UA 1WTBA 1QQ6A 1XNQJ 1E4GT 5EWGA 1Z00B 1CLQA 1RHUB 3BZKA 1FKOA 4GMJB 1W7AA 1EKEA 4PZNA 1A5XA 2ZQBA 4JKEA 3B0YA 4GV3A 3VF0B 2XIDA 2W24A 2CQ1A 2DGZA 3QUQA 4LVNP 4B9NA 3G9CA 4ZLLA 4CJKA 4NI2B 5JJBA 4BS2A 3TAFA 5LMUK 4RQ6A 3SR6A 4CW7B 1TGOA 2WMMA 5AI8A 5EE0A 3CCQS 3VEXA 1K0TA 1TL5A 4CEOA 1CLFA 2AH5A 3ENVA 3GIRA 3I0RB 3LTOA 4K7QA 3LDAA 4H4MB 4CJEA 2CPHA 2E9TA 4DTXA 4ED5A 2MYFA 5J2PB 4X62J 5JS1A 3HD1A 3GB0A 1C0TA 2H3IA 4GV6A 4OX6A 4USWA 3KJVA 5GMKa 4RLEA 2WVEA 5KQ8A 1U9LA 4RPFA 1JXVA 4M45A 1OPZA 1WCLA 1RWMB 1WELA 1PZNA 5E3QA 2XMMA 2FZCB 2JRSA 3TA0A 2OXOA 5ALJA 1MA7A 2OGUA 1QJHA 4DV6J 3O0FA 4CT9A 4FM0A 2O4GA 4DUTA 7ICGA 4CO0A 1BI4A 4NASA 5FDLB 4YFKA 7ICQA 4OHXA 2NUUG 3MOJB 3CW2C 2ZZNA 4FLVA 4WIIA 1T05A 2DHAA 1Q7LB 2V63A 1VMBA 4P2FA 4I6MA 4NZ7A 2VANA 3CDAA 1VQ5N 3A8YA 1YBTA 2VJ4A 1U2RA 1VDHA 3F56A 2VFVA 3UKUA 2CQ4A 4Q7AA 1Y11A 1N5YA 1V38A 8ICWA 3W9IA 3A0IX 3TJ8A 3FR0A 3QFPA 1HLWA 1QVFM 2GMJA 3DRSA 4Y0FA 2A6AA 2Q36A 1B70B 1J5EJ 4DG1B 3VGUA 1TZ0A 4GVBA 3B4DA 3AVHA 1ZJMA 1TFRA 4RX6A 4ECWA 3ONQA 3LPUA 4N47A 4O5FA 1REVB 3ZSZA 3JTNA 2EEYA 4MFBB 2V4RA 4Y1CA 3QT6A 1K9MO 1IQZA 1KP6A 2LQ9A 2RNEA 4AH9A 5TISU 1UA0A 4J2DA 1W7WA 4KLSA 4RQ0A 3DRRA 2B4VA 4ZP6A 3AVIA 1AQ6A 4RU2A 4JK8A 2GIQA 4L3QA 5AXKA 3B0XA 2E7WA 1X7VA 3V4MA 4XH5A 2BCQA 4WJBA 4CJ5A 1DQ9A 2BJ7A 4MKVA 3KHLA 3HCXA 5RUBA 3U27A 1RBTA 1WWHA 2LCWA 3SBTA 3PIPL 2KK0A 2VBXA 2CNKB 3FNNA 4NLVA 1ZAVA 3ILIA 4CIOA 4DSEA 4PJ0U 1H98A 3KMSA 2NUBA 3QBXA 2D69A 4DCOB 1K8KB 2GWJA 2R8JA 3J81U 1QVGR 5C10A 2OPRB 2QMXA 4L3KA 2WAQF 3JS9A 5AM3A 2MKJA 4LFBJ 3KKRA 3E1YA 3Q8PB 4YDUA 3QJPA 1N62A 4LF7K 4CDIA 3SAHA 1JNRB 5AKJA 1WC1A 5C15A 4R0EA 4OKEA 1JROA 1VHFA 3KFWX 2ZE2B 5J2QB 3T79A 1N0VC 3EO3A 1DLOB 3CDBA 3NS1A 5K14B 1RHJB 3CQXA 2KXFA 3CIPA 3MD3A 1PILA 3SBGA 1HNWJ 1VQNN 3E3XA 4PZOA 4CWBA 4ICLB 1RTHA 4BC4A 4ZVRB 4M47A 3UDVA 3GU0A 4DR7F 1OYEA 4R5PB 2U1AA 4P0PB 3BQ2A 1D09B 1J5OA 1FESA 2CJYB 3M6ZA 2YHXA 3G71N 2GVDB 2IOFA 2IRYA 3NL0A 3DGPA 1LB2B 4HYKA 3ZSQA 1EWQA 4MLEA 3H20A 4LMZA 3HVRA 4UY85 4WYLA 4GLXA 2NR0A 2QMUB 1RZTA 2L9NA 3NS5A 1NOMA 4WJ3B 2ODGA 3RB0A 1HNZK 3T19A 3D6RA 3Q23A 5GIPA 3UVJA 3M6XA 5GINA 3QERA 1S0MA 4JV5K 1IR1A 5HMYA 3CJ7A 4ED8A 4H4OA 2CG4A 1KC8T 1R0AB 2PMZF 3FQLA 3C6HA 4WU3A 4F3QA 3H5SA 1T6CA 2EZXA 4AHUA 2V4JB 4KBIA 1RTDB 4FF1A 3M6VA 4BE2A 4ZH4A 4KQZA 2DUYA 5IIKA 4IS7A 3LP2A 4BR4A 3DFEA 2EBEA 3ISND 4LFAJ 2NZ4A 5SZTA 3AD9C 4BVOA 1C1CB 3GCWP 3VGTA 5IQQA 4HHUA 3D4JA 1LWEA 2ADCA 4RTFD 3VQEA 5D0GA 3VQDA 4UUWA 5IV3A 2B4PA 1C0MA 4JV1A 4DV7K 5BN9A 5L9XA 3BKTA 2OPSB 2ACMA 4PKIA 3L2WA 5KRTA 4J9LA 2QLTA 4IKAA 2DKOB 3RF9A 5BR9A 2FC8A 4RWWA 4FXWA 3I33A 2M70A 2D0BA 4E7HA 4Z4IA 5GADU 2ATCB 3A1YG 2ZFHA 4M9LA 4DR2K 1VSKA 1XMQF 4PXDA 1ZOTA 1U24A 5KGWA 2P9UB 4BGBA 4WFXA 5IFMA 3MMBB 3SCJE 3MECA 4NM1A 1NGIA 3KLEA 2VKRA 2A40A 2F8TA 9ICSA 1GXTA 1RYSA 1FDBA 2G8FA 1N63A 1JLGA 1LW0B 3OLBA 4NCAA 3A5OC 2QARA 3BF3A 2IHNA 3AD7C 3BO4A 4O3OA 3LDPA 4Y2TA 4QQBA 3U1MA 3MUVP 3AU6A 2ZBPA 5EXWA 4DR6K 2WSEC 1PAUB 2GV1A 2VG6A 5A6WA 5AQKA 5HJYA 1BCOA 5DDOC 2ZEJA 1BA1A 3I31A 4Y2XA 3GL1A 4KMUA 2VA3A 2OUGA 4F0HA 1VQ6S 1RBVA 3SQOP 3L2VA 5B0GA 4UBCA 3A12A 1U1QA 3MFHA 1WDDA 3CMQA 3ISCA 2AHOB 3IR7B 1UCVA 3VQ8A 3NWRA 1C1BA 3PIOL 4KLGA 1OS5A 4A5AA 3IM1A 4ZOHC 2AT1B 1ZBFA 3ZTPA 2ABYA 4QWBA 3IMXA 2GHPA 2ZJRL 3PV8A 2IC3B 2IA6A 4Y2CA 9ICPA 2P8IA 3M6UA 2FC9A 1ATRA 1LWFB 3VEZA 5LJ5Y 3T41A 1SUQA 1ZQBA 1T9VA 4B3OB 1P8ZA 4K5RA 4CZCA 4IOCQ 4C0BA 4BACA 4F4YA 2KB2A 3SCIE 3FZKA 3LAKA 3KHGA 3VGMA 1M5KC 1NK8A 2B4OA 4HI1A 2IM3A 2VV5A 5HL7L 3HSTB 3I56N 9ICUA 3HSGA 1RZMA 4B9LA 2XZDB 4DL6A 2VHGA 2O67A 2PI5A 5FPDA 1B3TA 3ALYA 4ECVA 4NCBA 4DV7F 2B9YA 4JBCA 1B0VA 2F4FA 3PYEA 3WKBA 3BS5B 1YJNN 2J0QD 3PYDA 2W4DA 4L75A 2FJEB 3RJIA 1M6YA 4M6WA 4IO1A 4KJIA 3VEYA 5SWMA 2KRBA 4DL2A 4MFFA 1IBLK 3BSAA 2XY6A 9ICRA 2WSCC 4TYBA 1EP4A 5BJRA 1QQOA 4CZJA 3V5RA 5C2FA 5L38A 2YH0A 4ZPTR 4MFAA 2AKWB 3M7VA 4IFYA 2QMWA 4UAWA 4OGEA 2NRTA 5HR6A 2IBOA 4DR2F 3SMVA 4YNQA 1IBKJ 3ZZTA 1D9DA 2K1RA 4P10A 1U49A 3AN1A 3UWTA 4AQYJ 4FJ8A 5G5GA 5J1EA 5KAIU 3AA3A 4USAA 1FJEB 2IVOA 2BE2B 5E3CA 4AP9A 4CDGA 2CRLA 3L8BA 5D0HA 3G4SN 1Q8KA 1HJPA 5DJBA 1Y10A 4NA2A 1ZRNA 4IYQA 5AQTA 5BYQA 2WF9A 3LPTA 1WAJA 1EWRA 4ECRA 5DDMA 5HBMA 2AJ2A 1X5PA 2FD2A 4ATNA 2POKA 3JAMY 4DR6F 3WK4A 4NWBA 4CLYA 2HMXA 1Y64A 3QGHA 4XA5A 1Q53A 2V50A 5F8JA 4I2CA 4ZPVR 4QJFB 4B3RF 2LMRA 3GP9A 4CZHA 4FZZA 2QG9B 1WOQA 3MR2A 1CEZA 3UB5A 5ETLA 1X4CA 4PYAA 4BC7A 2R2UA 3SV3A 1VQLN 2MPUA 2A1SA 3MM7B 3BR8A 1UAWA 1N5TA 4KLOA 1HBNB 1NKEA 1KVIA 1KLMA 1BISA 1Q5VA 2VFUA 4R8UA 3Q8UA 1SJ4P 4M8LA 5KFFA 3AVCA 2VFRA 4CJSA 4X4RA 5BPMA 3DN9A 2AYGA 3P6YC 1S57A 2DB1A 3KBBA 2JHDA 5E3RA 1OQ3A 3T7ZA 3WUHA 4PG8A 2YKNA 3N28A 4IO9Q 1WC5A 4JI8J 2JGUA 4OJRA 2YWHA 2HB5A 1MU2A 4MK9A 4Q2LA 1RABB 1ZM3A 4JOUA 2ZBQA 1N4LA 3DC2A 3AMZA 2D3OR 4PY5A 2W42A 1FCAA 3QEVA 4E7KA 4FZMA 2D41A 2Q3PA 3DLJA 4BE0A 3B8HA 3OTOJ 3LGHA 2CH6A 3FBEA 2KV2A 3ZD9A 2GGPA 4RJVA 1S72N 3CDWA 2XS2A 4RU9A 3JYTB 3S01A 3B9JA 1NHVA 4JHDB 4CEAA 4KGKA 1B64A 4LF8K 3VEVA 2YHYA 3LPEA 5CYQB 4LRFA 4GC6A 3M1VB 4V19S 3MDQA 2F7VA 1Q3VA 5E33A 1HKBA 4US8A 4B6JA 4GV9A 1XC3A 1X6JA 4C3MA 4YY3K 5J2JA 2AMCB 3OS2A 2NRWA 4K41A 2MQQA 2J4RA 2UUAK 3WNFA 2ITGA 1Q5YA 3VQBA 3CPWR 4NV0A 4LF5J 5H9FK 1XBWA 2DNYA 4RUBA 4DTOA 3MMAB 2WVFA 4W5RA 3N01A 3SUQA 3P38A 3K75D 3IBCB 1B9DA 1HI8A 2C2NA 2GO7A 4C98A 2PYJA 3F2DA 5CHCB 2IOCA 3VQSA 4Y3CA 2DR5A 2B51A 5HMXA 4M41A 3THPA 4DTNA 3G0ZA 5L1MA 1N61A 3DXKB 2F4VJ 2Q31A 5AXNA 1S12A 1X5OA 3O3FA 4DFKA 3BYRA 3M6GA 3F0NA 1REGX 2WBMA 3NMRA 1HBUB 3TAPA 2EQYA 1S4EA 4CO5A 3NRZA 3B8AX 3CM6A 3O3HA 1ZD3A 3U02A 3IN5A 3HJFA 2ZWOA 3AY0A 2PFUA 4A8YA 4ER8A 1F3VA 2YJEA 4KN7A 2E5SA 3CCVN 1XNRK 1X0PA 4V19J 4OX7A 3HKZC 1IXRA 1B0PA 5BPCA 4DOZA 2LYHA 4M94A 2JL9A 3BS7A 3K7RA 4CF3A 3CJTA 3CMAN 5KT7A 3QBWA 2ZHOA 5FPNA 1RU2A 3MOZA 4NXNK 4FK4A 3QU5A 2X78A 4DV1J 2CQ0A 1TTHB 4ECXA 4DL3A 3OVSA 1WEZA 3D6FB 3D6TB 3HSDA 4WIQA 2BE9B 1OY6A 3F2CA 3SMPA 1D4XA 2AP1A 3V81A 3S7RA 1RT2A 3M1FA 4MKYA 4WE1A 5GAEI 2MXYA 4J9NA 3DV9A 3ZXWA 3J8AA 3Q8MA 1HQUA 1NPKA 2FBTA 2ZBRA 3PSIA 3TVYA 4WYBA 3QYPA 3WK7A 2E20A 4Y6IA 2VIHA 1NZAA 1P9QC 2VZ9A 4RQ2A 1YI2N 2VG7A 1TVRB 1OY8A 3QNWB 3PTWA 4F36A 2XG8A 4NLQA 3UXOA 4YY3F 1C1AA 4KLIA 2HQFA 2C3UA 1X66A 3IM8A 4RL1A 2ZJQQ 1WC0A 1B4SA 3MM5A 4DQQA 5KL8B 5J2MA 2VA2A 1HX1A 5ADXH 1U1NA 1RG6A 2VYPA 3ID8A 2FHJD 4EGLA 8ICZA 2CQ2A 3W0LA 2EWSA 1GAOA 3NUQA 5BOLA 4MIWA 4KFBA 1Z2ZA 2QWLA 4CLWA 4CERA 4GO5X 3N97B 3MM6B 5AQLA 3OYNA 3TAMA 2FLPA 3PM9A 3H7HB 1FJGF 5HRNA 3LGMA 3QEIA 3U9ZA 3AEVA 1BA0A 4DQSA 5E84A 5AZIA 4FDFA 4RNOA 4CNZA 2EC2A 4F67A 1GX6A 3JSYA 4IOAQ 3EKSA 3CCUS 4R65A 2V94A 1CVJA 1XMOF 2HWHA 4A5BA 1ESVA 4YOUA 5EY4A 2DISA 3LOUA 3OYGA 1FDAA 2F3NA 3NF8A 2QTDA 2GLEA 3NVVA 4JRPA 1RT4A 3CCQN 3R8YA 4CH7A 2AJ1A 2J8AA 2G2OA 4PWDA 3VQAA 1VQ7N 5IM0A 1YJ9N 4KBOA 2QEXS 3RRGA 5F8NA 2J7UA 2QW9A 1HI0P 3V9UA 3C16B 3WKCA 1UL3A 4MMOA 5J2CA 3H8SA 4RO0A 5DQHA 2XM3A 1DRZA 4PWWA 4NXNF 1VHIA 2HHHK 3VF4A 2JVRA 5A2QY 2O8FB 4CZFA 3M8WA 1U0SA 5A76A 1D5AA 3JXUA 5AKKA 2VKQA 2DGSA 2HFNA 5EE1A 2PA8D 3ZCMA 3EZ5A 3ZT1A 4IDKB 1HQ2A 2OH2A 3AVJA 4DS4A 4V1Ak 1WHXA 4OYIA 5ALZA 4FO6A 4WTOB 1TL7A 4HWIA 4DSLA 4LVSA 1LXJA 3FEYB 3UMCA 1U2VA 1SV4A 4IQWA 5C2CA 3I8BA 2Z58B 4CJLA 4U6PA 2QLBB 3V1RA 3R9KA 3UCGA 4CZLA 1SC1B 3K8VA 3A5LC 1XQIA 4MO4A 3M8PB 2XI9A 2BUNA 4F02A 3MX5A 2RHSB 2EC0A 1HNVB 3FLCO 3TVZA 4LF9F 4CNYA 3HP9A 1NDPA 5CR4A 4KLHA 4KAZA 5DRKA 1S0VA 2B8QA 4KV8A 1FRXA 4O8KA 4J9OA 3AH6A 1NWKA 1YLXA 2MJNA 2X3DA 4RKUC 4IFEA 1MLAA 2J6TA 2ZUCA 2DRBA 5AE2A 4CIGA 3T5HA 3FEXB 1ZTWA 3ILOA 1WSIA 3DOKA 3D5MA 4PH5A 4FF4A 3IGNA 4MK8A 1ITPA 3THXA 2BXJA 4DR5K 2DR7A 2X51A 4HVZA 4DR1F 4DV4F 2OSQA 4FOIA 5M2PA 3D45A 3O9SA 2P9NA 2RMLA 4N8OA 4A48A 1X4GA 3BB5A 1IKYA 1R6VA 4HT5A 1TE2A 5JU5A 3CXCM 1NK4A 4QWEA 4LQ3A 3AD8C 2ALZA 3NY0A 4OPAA 2AYEA 3MTKA 2YNHB 3RYLA 4BRIA 4R63A 2VD3A 4BRMA 3A2FA 1SB6A 4X4PA 1DQAA 3P8BB 3RRKA 4JK9A 5DZ6A 2UXDF 5BR8K 3THTA 2Y1LB 3C65A 2DBYA 4OGCA 3OFFA 4GVEA 4FNIA 2VH7A 1FNXH 3MEGA 2GIRA 4PWUA 5E41A 2YMMA 4KSEB 2YWKA 3PNCA 3GBTA 4KREA 2VG5A 2ZUBA 5KFKA 1WOOA 2WF8A 3UD4P 4DV5F 2YV0X 4AF1A 2B7BB 1S77D 3EXCX 2C22A 2Q97A 5I3QA 5F3XB 2Y0BB 1KWMA 2AJ0A 2FQQB 2KT5A 4OVLA 4PRFA 9ICNA 2WZ1A 5GVQA 2AU0A 4D3GA 4FYXB 3GIKA 4C6AA 5AI0A 1RAIB 1RT6A 1G99A 1BMQB 9ICFA 2GX9A 3HHLA 1X8DA 3VERA 1ITGA 1R3NA 2X6NA 3A8EA 5HRSA 4MKAA 1FT8A 9ICGA 2Y0SF 1SIJA 4QIWF 2KJ8A 5CB1A 2O8DB 3CCMS 4B3SF 1N34K 1N33F 3KJNB 1EXNA 3HXMA 2DR8A 5AQYA 2Y9UA 4UW2A 4DL4A 3PYGA 5BRDA 3C14B 4OI0A 3L09A 2K3IA 1JLCA 3SYZA 5A0LA 4EUVA 1JLBB 3L7OA 1NG9A 2OCEA 4E0DA 2JNJA 2DT9A 2VDHA 1IV0A 1FTRA 3M2RB 3OJSA 4JUZA 5AIAA 2ZOFA 1EO1A 1YVNA 2FF6A 3SSSA 4WU2A 3VAGA 2FYXA 1IJJA 2WF6A 1VQ9S 3LF0A 1ZBTA 1RT3B 4OLBA 4LRDA 3I4HX 3CJQA 2XYPB 2LYAA 1B0XA 3S41A 5ADZA 4C23A 3MGHA 3QGGA 1JLQA 2XMTA 3M9MB 4WFAL 4N56A 1GTHA 3AQOA 4P4OA 3UI3A 4USUA 4BR5A 2VA8A 5F0WA 1CBKA 4CF1A 5GMEA 3JB9k 1JCFA 3UKRB 4LJXA 5JUMA 4JI5J 4A4JA 4JRQA 3NGYA 4NWIA 5J2AA 1XI1A 2XMUA 2I1QA 3EZOA 2P9LA 4FWPA 5L39A 1VIXA 5FD1A 1UWBB 1TFYA 4K5SA 2WB4A 3UMGA 3CJ2A 2ZM6J 1CJKA 5DM6Q 3N4MB 4AHTA 4KHPK 4C0ZA 2HI0A 1ZQCA 2CPYA 5U47A 3VGLA 2JEFA 1TMJA 3HHEA 1S1UA 1NKCA 5DLGA 2H5JB 4LSZB 3QIDA 1KSPA 4CFAA 4LJMA 2D0OA 5CQGA 4WBFA 2GHWA 3I5BA 1MN7A 3H7IA 4I2HA 5ETMA 4IOXA 4DUYJ 2BGGA 1LOTB 3DLLQ 4B9MA 4E7JA 4YS2A 4EP4A 2Q3SA 5KFBA 3MPYA 3M8YA 2UUBK 4LF2A 1OY9A 1WSEA 3J7AP 3EWAA 1JK9B 4HHJA 3O8WA 4C0OC 4DU7A 9RUBA 5KGXA 4ZS6A 5DK5A 3VQTA 2Q6BA 5KFOA 3OR1B 1EKSA 1VQ6N 1DURA 3RSEB 2GH1A 4C0HA 4BDYA 3KKAA 4FJLA 3KWGA 3BQTA 5ALEA 3BS9A 3FMBA 2F9WA 2ZH7A 2ZJPQ 3C6TB 4M3ZA 2WCXA 2MHEA 4FLZA 2CQIA 4JI6J 2XBPA 5DKWA 5D3GA 4QIEA 2EAOA 3I5CA 2EAMA 3E9PA 3M2UA 3W5ZA 1NB7A 4DU1A 2BJ3A 2VQFJ 2YNIB 2ETJA 2HLUA 1IUJA 4RUCA 3PACA 4URGA 3P96A 5DBBA 4DV3F 2P9SB 3GDXA 5AM4A 3C15A 4PQUB 1HD1A 4P7TA 1GEHA 4HACA 4I4BA 3HJVA 4L6V3 1YG0A 2O5DA 3IRXB 4DQ8A 1GX5A 3RBXA 1RM6C 4BDPA 3GFKB 4U95A 4FFDA 3ALRA 3DU5A 1VRTB 2ZIXA 3LDOA 4TLRA 1VQPS 3BDEA 1WDTA 2XO6A 2FI1A 1SL2A 4DBQA 4IJNA 3CJ3A 2P5GA 1QSSA 3RB6A 3ZX0A 1P9YA 2HK3A 4KGMA 2WFBA 2M9KA 2D9OA 3W8PA 4P52A 2OTJN 3Q8QB 2D3ZA 1ZRMA 4ES1A 2D3UA 1NJXA 1WWUA 1JL1A 2MJUA 3G96A 5IZHA 4PHPA 4GMKA 3A5NC 1SZHA 1TK8A 1D9AA 3HULA 1KCFA 3FFIB 5AKEA 3H5XA 3MAAB 1U1KA 9ICWA 2N3LA 2P9EA 4JI0J 1RK8A 4F7VA 3LDNA 3EPIA 4K8RA 3D2NA 3UE5A 3AVNA 4X5VA 4AFFA 2UXBK 4FE3A 3WK5A 4DV2F 3G6XA 4Y2MA 2KW4A 4FK2A 3DNCA 3O9TA 4DL5A 1N32J 4XTTA 3JQMA 1HHQA 4EU0A 1GMWD 5CR0A 4OYXA 2FY1A 1VSFA 2QA4S 2XTJP 3R3TA 3TVKA 2Q0UA 1QVFR 1KRPA 3ZDBA 5D8HB 3W7BA 2F9JA 2K4IA 1NBWA 5AR0A 1JQGA 3K17A 3OBWA 4KGXB 3SFGA 1J27A 4UB2A 5BN8A 3BGFA 3CGIA 2EFQA 4C7YA 2CPDA 1ZQFA 2D1CA 1RJJA 2F63A 1IQTA 1RFQA 1KN5A 4OIXA 3WXKA 5ETSA 2D5RA 4U9RA 4I0WA 3I0SA 1SZPA 3HYFA 4O5KA 2UUCF 2BVZA 2GEMA 1CJVB 3VQ6A 2BCVA 3Q22A 2GVZB 2MRLA 3FFKB 1VLOA 5K9FA 4DI6A 3GPAA 4LFCF 4S0MA 3T5KA 2Y9TA 1WNEA 4J7CA 2G8VA 5GMDA 1WOSA 1V5VA 3G6ES 1FF2A 1TELA 2BKOA 3O8MA 4FKXA 5K4LA 1BDGA 3KD1E 1G3OA 2IJNA 5B5EU 2HBJA 2AX0A 5IINA 4C7ZA 2WBRA 5KFPA 5JLFA 3HZ6A 2DR6A 2IYGA 1LKYA 3C23A 1NDKA 4J9SA 4XH1A 2FMQA 3OUYB 1ZBIA 1HR0K 3GV7B 3HWTA 5AJ3J 4ZPCA 4N5SA 1XTZA 1ED1A 5KFXA 1Z1ZA 3OFEA 2EAPA 3U4LA 4RW6A 4I2EA 4JV0A 2D0CA 3ICLA 1CZBA 2K8GA 3D0HE 4MF2A 4YORA 5F8MA 2FBYA 1EQMA 4JI7K 4QIFA 5AQXA 2V8DA 3P39A 5KT5A 2OI2A 1RGVA 3MGIA 3BZCA 1RBRA 2JV3A 3HHKA 2HYIB 2O6KA 4B1YB 1UTAA 2MUTB 4Z4FA 3E58A 3DLGA 3FZHA 4Z4GA 2GQ2A 4JD2A 3L3CA 4O4GB 3ISZA 2KKVA 4UAYA 4IBNA 5AQFA 3ITHB 1DAXA 1U1PA 1E6VB 3KZBA 5GAEU 1NK9A 3PJ9A 2OMOA 3I55S 3MXJA 1YIJN 2UXBF 3VMFB 1ZM2A 2D74B 1BIUA 3ZZYA 4CI0B 2NXUA 2F5GA 4CLTA 3WXLA 4CT8A 1OXJA 4IG3B 4ZKAA 2BZ2A 1RDBA 2UUWA 7ICEA 3NH1A 4BDZA 2MQLA 3LP0B 4Y2AA 2BYCA 4PUOB 1U0HB 2P9IA 2JFKA 4RCHA 2IPOB 3ET6B 1CRXA 2LYBA 4FCYA 1MROB 2DH8A 4I68A 4OX9F 5KFIA 2F76X 5D4PA 2BV3A 1URRA 4EEYA 2F1FA 4NL9A 4EMDA 2Q1NA 2DJWA 2NCKL 5CZVA 4X65J 3AJ2A 3AO3A 2FPMA 1TV6A 2P9GA 2KL8A 2MZ1A 4IG0B 4YMMA 1VDVA 2CQHA 2CPEA 2JEIA 5I9EB 3T69A 4C8NA 4F4XA 1WSGA 4IEIA 4OI1A 3CFOA 2CNNB 4EFAC 1BO5O 3JQJA 3M30B 5FIIA 2HHQA 4GY2B 2O8CB 4FW2A 4OI6A 4AUKA 1FD8A 4BR2A 4PHTX 4QZ9A 1U4BA 4LT6A 2NV3A 4BHQA 2K06A 2AGOA 1XNQK 1G15A 4OJ1A 4I7FB 4F5QA 3CCZA 3KKAC 5L1LA 2RHQB 4EIAA 3IFEA 2DNOA 1LWCA 1NNLA 3ZSVA 1N5SA 2MMYA 5HOOA 3PIPQ 3V4IB 5L1IA 3QT5A 3P4IA 7ICIA 4OZ5A 2IYIA 2DY1A 4MIBA 1BUPA 3KK3A 3S1TA 2LMIA 1NGEA 3RJFA 5E5NA 2IBKA 2RDIA 3ISBA 3UM9A 3CULA 2YMLA 4ISEA 2QB0B 2KYZA 4U67Q 1KD1T 2NPIA 5DO2A 3NXZA 1MMLA 2OKQA 1TKTB 3RMBA 2L41A 4JS5A 1ZXOA 3Q83A 1A5VA 1FFUA 2BRLA 3JSMB 5F0UA 5CABA 5IWAK 4L74A 2DY9A 4M63A 1WC6A 2YPYA 1VAZA 1DT9A 2AF6A 2X1BA 1P1LA 3M2VB 5AQHA 4KITB 2BPCA 2BQUA 4DR3J 4WPAA 3EGZA 3ZDDA 5HJXA 3QE9Y 3G6VA 4XRHA 2JZBA 1XR6A 1JCEA 3ZTOA 2B7CB 1S6QA 4M5KA 3THYB 2YTCA 2M2BA 3CJ0A 2XCAA 3IUCA 1S1XB 3C2PA 1JIHA 1EB0A 3JSBA 1Z05A 2Z7JA 3MN5A 1YTUA 1RWWB 4F4AA 4B1WB 1YBUA 4BBYA 1UVMA 4L76A 4PA1A 3VA3A 3TTDA 2ES6A 2GCFA 1J97A 3DLBA 2OD6A 3CC7S 2GUPA 4MKBA 3KG0A 2RQ4A 2A2CA 3CCUN 8ICFA 1FRMA 1VBYA 4G1QA 1QE1B 3CERA 3QNNA 1C4AA 1SKUB 4ANDA 5KL1B 1QTNB 2DGVA 3EX7B 1A6SA 5KT3A 4F3MA 3C7NB 1NU0A 7ICKA 2M52A 5KT4A 4C2MA 4E89A 2ZIUA 1U1OA 2F8LA 3TANA 8ICGA 3MEEB 4ZLJA 4FOEA 4BXOA 3RH5A 1LV5A 1F9HA 4JI2K 1M5SA 1A7GE 4DV0F 4XQ8A 2GQCA 1NAQA 5K20B 5ITHA 4NXMJ 1K1SA 5I4MA 1GTEA 3T3FA 2CGJA 5AM0A 5EOZA 3HSJA 3NGIA 1BLUA 1XNQF 3OYCA 2WBNA 4EO6A 4P0QA 1SGGA 2H51B 5J0TA 2AP6A 2HBQB 3THWA 1AYEA 4QR0A 4I6YA 5CE3A 4XPCA 1S0NA 4NCGB 4EYIB 4Y2YA 3VEOA 2W7OA 4QZAA 3UN5A 2XWYA 3AA2A 4OD0A 3H5UA 3DOLA 4B3TK 2PSZA 2E7VA 3V6KA 3CFPA 2N7CA 4IUFA 1S6OA 2EW9A 4QS7A 1YTYA 1RWXB 1QVGM 4HUEA 2DTUA 1UT5A 4GVMA 2Z56B 2ZF5O 4Y1DA 4I2BA 3KHRA 5KG0A 3ZC4A 2CG8A 3D0IE 1LXNA 1BPEA 4AXIA 4QBUA 3PHTA 3K9JA 4BRQA 1XSLA 3UN2A 1SJ3P 1M90O 5H9EK 2XVTA 2HK2A 2W4CA 2NRXA 5ALUA 5HHHA 2M5YA 2LI6A 1M5PC 4OKJA 2CPFA 1I3OB 1WSRA 2EPIA 4UY8O 4N41A 4DV6F 4TU7A 1N36J 3G82A 5MLCQ 4J9PA 3PEJA 5AKZA 4B1UB 1LFPA 4OZ3A 1HBMB 3NCIA 5C5JA 4WP8A 2WB1F 3PZPA 1NRKA 3OV7A 1XHZA 3M8QB 5I3UA 1DK3A 2NXEA 5J2DA 3DDHA 1TL1A 3M32A 5AXMA 1FO1A 2ZJRQ 1N5XA 3DRPA 4USJC 1UEVA 2CZ4A 1HWKA 1VQ8S 2CGLA 2E9ZA 1FWKA 2X74A 4DQRA 1IR2A 4IQXA 3WNEA 4CLLA 4CO1A 4K4XA 3QBCA 4CIEA 3KZXA 1CXUA 3TAEA 4C97A 4DUZK 1X4HA 2R8GA 3GU3A 1Y5LB 2IAJB 2DKXA 1QAYA 5KG5A 5AHXA 2P9KB 1F5SA 2WUSA 4C1NI 1I94J 4HVJA 2UU9J 1JLFB 1ZBSA 1AROP 4B1XB 2MQNA 2HOQA 1IKXB 2YTUA 1VGYA 4OYZA 1QQMA 2DXEA 5I42B 2PI4A 4P7VA 4TY8A 2PY5A 5H1SV 2AIRB 2KFNA 2VKZG 5IQ6A 4DCPB 3PKYA 3ZZZA 1O6XA 4DQPA 1RT7A 1NJIT 4QWDA 3ZETA 3MBYA 2M8HA 5AQIA 4DSKA 1M1KO 1B0TA 2CYYA 1LW2A 3CCMN 4OL8A 3WEEA 5C42B 2ZWPA 2KIVA 2J6UA 5B0BA 3M4XA 1RXVA 8ICLA 4NL5A 1SIZA 3HD2A 9ICAA 5AQUA 4CHYA 3OXGA 3R7NB 2KE7A 4O3MA 1TR0A 3BGRA 1ZQSA 1WBBA 4LFBF 2DCUB 2ZVSA 3JPRA 4FPIA 4DPOA 3CMES 1Z25A 2KMDA 4FXDA 2EKNA 3TARA 3AA5X 4YHHK 2Z57B 5A8RB 1VQ9N 2PFOA 3NNHA 2Z0GA 4ED0A 3ENQA 4OZLA 5CXTA 2GJIA 1F9FA 3NVYA 3KTQA 4RW9B 1UWAA 1PCAA 4PHAA 1B92A 1H72C 4H5RA 1WORA 4QZFA 3IA0A 2HNYB 4F50A 1S49A 3GIIA 2P5OA 1RDRA 4ZOSA 4Y2IA 2FGOA 2ZH9A 4OX8A 4H0OA 2WK4A 4FS2A 3HO1A 2A5XA 1IWAA 2DK2A 2ZVIA 2F1IA 2IA0A 1O1WA 2XSJA 4OMFG 3I9ZA 1AW0A 3DI6A 4QOTA 4EBDA 2I6XA 1AZSB 2XHWA 2QWNA 5HN0A 4BC9A 9ICMA 1Q79A 4FF3A 3CCTA 1BHNA 2V2QA 5LMNJ 5DLFA 4PPDA 5KG2A 3QINA 4OJHA 4OZNA 1ZC6A 3QIPA 1NK5A 3BBBA 3QQCD 3K4GA 2EHGA 3SBMA 4ECUA 3V6JA 4M3WA 4ZHRA 1WC3A 4F0MA 1AXQA 3HILA 2VONA 2OM6A 5ALPA 1UP1A 1RKJA 4LFAF 1S9FA 2RVJA 1NB2A 3PVXA 3MM8A 4X4SA 2AW0A 3SQ1A 2AQ0A