3TAQA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3taqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3taqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3taqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3taqA01
2JZBA 3OYEA 3KLIA 4DSKA 3O3HA 4CCHA 4CEAA 4ED7A 2IHNA 4KKOA 3OJSA 3T1AA 4CJLA 4CJQA 4F93B 5HHIA 4ID1A 4MF8A 3DOLA 3H8WA 1U48A 3V6HA 3QLHA 3QEVA 1ZQMA 3WNHA 2PYJA 4FM1A 2R7YA 3H08A 4QZGA 3OS0A 4C8MA 4Z4EA 5KG2A 3RWUA 4BWJA 4M2YA 1TGOA 3L2VA 7ICKA 2ZQBA 2JGUA 3B6OA 1NK5A 4FS1A 3V9SA 1D9DA 4H4MA 1Q9YA 1ZQVA 5EOZA 4FJ5A 4NLZA 4PQUA 8ICVA 3O4NA 1NK6A 2ZE2A 1NJWA 4O3SA 2XCAA 3IS9A 3K2PA 1WCLA 4FM2A 3TANA 3LDAA 3RBDA 1QSYA 2BPGA 1S0NA 1GOAA 3AU2A 1NK7A 4Z6EA 4QZIA 2PXIA 1JXBA 4QWDA 3BDPA 2VA2A 3ZSXA 1D8YA 2ZUBA 2P51A 2P6RA 5KFFA 1AROP 4AH9A 4Z4CA 1HQEA 7ICFA 5J2DA 3SYZA 2LYHA 2V4QA 4HTUA 4FJNA 4PGXA 3Q8PB 2IS3A 4DO9A 5DKWA 1IKYA 1U45A 3O3FA 3LALA 3V7JA 3MR6A 1CEZA 2OPQA 3ZSVA 2H5XA 4M3ZA 4ZHRA 3AVLA 3IRXA 3QEWA 2XO7A 1ASUA 5CZ2A 1S0OA 1T05A 4EEYA 1X9MA 4NYNA 5E41A 1RCHA 1QSSA 4N5SA 1S1UA 8ICRA 4KLJA 4EP5A 3V81A 4M9NA 3KLFA 3DM2A 3TAQA 1SL1A 2DFEA 4IBNA 4QZCA 3NGDA 4W5NA 4FK0A 4N41A 3MFIA 2BCRA 3D45A 4CFBA 4RQ7A 4B8AB 3V7LA 4O5KA 2ZTEA 2LSNA 1D8LA 4KLHA 1FXXA 3ZDEA 4FLVA 4CHQA 2QK9A 4CF9A 1SL2A 2R8KA 4AHUA 4IQVA 2OZMA 1S1XA 1SKWA 4HYKA 4W5QA 4DL6A 4IR9A 3QEBZ 1HYZA 3ZSZA 2B5JA 1C6VA 3ZD8A 4I2CA 3OYDA 4IRKA 5J0WA 4CHPA 4BWMA 1IM4A 4P4MA 4TUQA 3QNOA 3HPGA 1UT5A 4CJFA 4J2BA 5HRRA 3TQ1A 4KHSA 3JPPA 1K6YA 1BIZA 1IKVA 4KN4A 2Z1GA 3C1ZA 5EWEA 4M3UA 2PYLA 1DLOA 1TVRA 4EZ9A 3T19A 2R8IA 4K8XA 1W0HA 3IM1A 9ICAA 1ITGA 4CEBA 4DQQA 2Z1IA 2F96A 4CJ4A 2G8WA 3B0XA 4M04A 1D9FA 4IG0A 2FPLA 4DS5A 1DOQA 1UWBA 1CXQA 4I9LA 3C5GA 1JL1A 4CF1A 1XSNA 2FBTA 4DFPA 3GIMA 4KTQA 3SI8A 3SPZA 5KTQA 8ICLA 3LPUA 4F91B 3DLEA 4Q8EA 4H8KA 4CEFA 1X1PA 3Q8SB 4UAWA 1HMVA 4KTWA 4E7LA 3LAMA 4EZ6A 1I3AA 3WNFA 1ZQBA 4KITB 1NK9A 1ASWA 3LP1A 9ICQA 3G6XA 1VSHA 5C25A 1BISA 4LSLA 4OGCA 3HXMA 4Z4GA 4J9QA 4F92B 1B9DA 4Y1DA 4DU4A 1L3VA 4YFUA 1ZBFA 9ICKA 4F8RA 1VSDA 1RT2A 4QOZB 3E2EA 8ICHA 1XWLA 3SV3A 2W9CA 3SQ1A 5IILA 4YN4A 4DU1A 4UBBA 4F4XA 4CHOA 4QZAA 2DPIA 2UVUA 4E89A 4PY5A 3RH6A 4XRHA 1VSIA 8ICUA 8ICCA 3HVRA 1U49A 9ICOA 2FLLA 5J0QA 4ECVA 2OA8A 1ZQYA 5J0OA 1JLEA 3VQ8A 3AO4A 4QZ8A 5CZ1A 5J2AA 2BE2A 3TAFA 3AO2A 2FBVA 2F1JA 2A1JA 5KFWA 4C8LA 4O55A 1HNVA 1XSLA 4E0DA 4PGQA 1IO2A 3DLGA 5DB6A 2QKKA 4I2HA 3T5KA 5CYQA 4O5EA 3MFHA 1S76D 4F2RA 4AILC 4PHAA 1ZQSA 1ZQXA 3I0SA 5HRPA 3SQ4A 5D46A 3DLKA 5KFEA 1U04A 3RMDA 3H4BA 1ZQDA 2FPKA 2NRXA 2FLNA 3OYFA 4BXOA 2XY5A 5KFBA 1ZQPA 1TKTA 4CJPA 1T4GA 4O9MA 3GIIA 3TAGA 4JLHA 3I8DA 3RMBA 2BCVA 2AQ4A 3QEPA 4EYHB 3UPQA 7ICGA 3M9MB 1GOBA 4I2JA 4KO0A 3V7KA 3ISNC 4B08A 3C2LA 2W8LA 2ATLA 7ICVA 7ICMA 4GW6A 3NBPA 3OYLA 3SUOA 2KZMA 4M3TA 3AO3A 4M42A 3TABA 3ZSWA 4LVSA 4DL2A 3K59A 4KLOA 4RU9A 4ECXA 4MFCA 4FJ7A 8ICNA 2NRVA 3JPRA 4FLUA 4DQSA 4KAZA 3FFIA 2VG5A 3G6VA 3N97B 4J2DA 2ISPA 3KLHA 9ICHA 4RG8A 1SV5A 4DMNA 4O5BA 4QZBA 1NOMA 2MUTA 4YXJA 2JZBB 2IAJA 3LP2A 3RR7A 4R63A 3RJJA 5JUMA 4NLKA 4CHYA 4CJRA 1BCOA 3GDXA 4O4GA 5DG8A 1RXVA 2JEIA 2VG6A 2R8HA 2B4JA 3V9XA 3AU6A 2WONA 5IIIA 3LANA 1A5XA 3DMJA 4R66A 4F5NA 9ICUA 1QSLA 2J6UA 1G15A 1T03A 4EBCA 2Q0ZX 3OVNA 3V6DA 3OS1A 2AGQA 4IFYA 1LAWA 5J0UA 4DL3A 1YVUA 8ICQA 2GUIA 3SCXA 5KG5A 5KFZA 1TKDA 4PUOA 1ZJNA 4M6WB 3V1RA 4UQGA 3GQCA 3RB4A 1JLCA 4FCYA 3ZT3A 4ECYA 1S0MA 4RNNA 3HX0A 2B21A 4BDPA 3SPYA 5BOMA 2ZD1A 1L3SA 4DTNA 4KLLA 1TKXA 2YNFA 1R0AA 3C2KA 3KHRA 8ICKA 4NLNA 1TV6A 1KVAA 4TQSA 4Z4HA 4CF2A 3NTUA 4BACA 4YP3A 1SL0A 1RDAA 1TL3A 4YD2A 3PW0A 2HW3A 1HJPA 1NK8A 2YHAA 4RNMA 5T7BA 5DQHA 3RH4A 4B9VA 3RMAA 4KHWA 3C94A 4TSXA 4M0AA 8ICTA 3HJFA 1KSPA 2F1IA 3HT3A 3AVCA 3ITHA 3PW2A 5KG0A 3LZIA 3DLHA 4B9SA 3VQ7A 4KLMA 1C0UA 3RRGA 3NCIA 1XSPA 5J0XA 1BHLA 3KD1E 3NGYA 2HB5A 4E3SA 1WCNA 3OYIA 3K5OA 2BKEA 2XY7A 1XC9A 1S1VA 2FBYA 3N4MB 5KFVA 4NCBA 3KHLA 4JV2A 4DQPA 3EPIA 3HO1A 3OSNA 8ICXA 2C2DA 4YR2A 3AVKA 1TL1A 5J0RA 5KG6A 1UT8A 1VSLA 5DDMA 2I9GA 1ZQQA 3NFAA 1BL3A 3K57A 4KHNA 2C28A 1SKSA 1RBVA 3JPQA 4JV1A 2DTUA 3ASMA 4JUZA 5KT4A 1J54A 3UXNA 2W42A 4KHQA 4QZHA 3TWHA 4ECSA 2X6SA 3MDCA 2G8KA 9ICEA 8ICJA 3ZDCA 1VK0A 4KRFA 4BE2A 3JPSA 2W9BA 5DLGA 3V6JA 1C1CA 4CGIA 1RPLA 3EW9A 5L1JA 4E7JA 3Q8KA 1UA0A 1WNSA 2HVIA 1H38A 3S9HA 4CF0A 4K4HA 2HNDA 5J0YA 5KFGA 3K75D 9ICBA 2I5JA 4EYIB 1C7YA 4FJJA 1C0TA 4NCGA 3ZSOA 2C2EA 1ZQCA 4RW4A 1IKWA 3TARA 3MR5A 1MU2A 3AVIA 3RJHA 1CUKA 4E1NA 3OYBA 3PV8A 1EKEA 3SUQA 3FYHA 3K58A 1S9FA 3AVAA 9ICXA 3TAPA 2ZJ8A 1S1TA 3BQ2A 9ICFA 3HM9A 2AQ0A 4DSIA 4F4ZA 2VWJA 4CGFA 3V4IA 4FJIA 4Z6DA 3OYHA 4CIEA 4YD1A 3LWLA 1RZTA 4XIUA 2HHSA 3VQQA 3C23A 3AA5X 4NM2A 4LD0A 4OLBA 4FS2A 3JPNA 4GC7A 4O3RA 5KFKA 4BDYA 2D0AA 4W5RA 3B6PA 2EX3A 3I0RA 5FRMA 2BCUA 1HUZA 4KLGA 3KJVA 3NGZA 4CJTA 1WAFA 1JN3A 3IAYA 4B3OA 1T8EA 4QWAA 2NRTA 3EPGA 2HHXA 4G1QA 4RW9A 2F8SA 2IBKA 4OKEA 4CEOA 4KI4A 3AA2A 1WLJA 1L3TA 3AVJA 4IQUA 1KEJA 4UB1A 2ZTDA 5J2JA 2YNGA 4QZEA 5D49A 3S3OA 3PMNA 4TQRA 1KRPA 3IG1A 4OPKA 5D3GA 1LB2B 4QZFA 3PX0A 3QE9Y 2KZZA 2BPFA 2IHMA 5KT7A 3LAKA 4DL7A 4J2EA 4IFVA 5EU7A 3QETA 4Q45A 4F5OA 3EZ5A 2ASDA 3AO1A 3ZCMA 4HHTA 1XI1A 5KFTA 1QE1A 3PR4A 1KLMA 3TAEA 4P2HA 4UB4A 4K4IA 3M8QA 2P1JA 3V6KA 1RBTA 1ZQOA 4M6WA 4XUSA 2NRZA 4O3PA 1ZBLA 5KFAA 4KB1A 1TVAA 1A5VA 4FBTA 4M41A 4ED6A 3HWTA 5HRSA 9ICJA 3PY8A 5KI6A 1JMSA 2P66A 4DLEA 4QWBA 1KFTA 1NJZA 9ICWA 2PFQA 4PA1A 3CQ8A 5J2IA 1EXNA 3EYZA 4M3YA 3THVA 4ED1A 4O0JA 4FLWA 5KG1A 4DQRA 3C95A 2KN7A 4Z0UA 3DLBA 4RQ0A 4IQWA 4CJ5A 4JS5A 2BPCA 1TK5A 4DFKA 3QESA 3M8RA 4DQIA 4O3OA 1LWEA 5CJ7A 4CFCA 3SJJA 1CLQA 4RNOA 2D0BA 4FXDA 5J0TA 1C1BA 3VQAA 3AVNA 4CERA 2P5OA 2ASLA 1ZQJA 4PH5A 4RQ3A 4R65A 4F4KA 2BHNA 4DOCA 3H8JA 3MABA 4DTXA 4CEEA 5F9LA 4I2AA 4I2IA 3NH1A 2DY4A 4E19A 3VQCA 3LZJA 3RJGA 1B92A 1JLFA 4MFBA 4RQ2A 2VWKA 5KFIA 3C5FA 4KLFA 2XGPA 4JRQA 3NF9A 3NF8A 3UIQA 4ED8A 3DRSA 1ZQNA 3BGRA 1XHZA 2PI5A 4Z4FA 3VN5A 3VQ4A 1ZQFA 4K8ZA 5DDYA 3E01A 3T5LA 2XY6A 4QWCA 2AJQA 1BPZA 2BQRA 2G8HA 4DLGA 2FMPA 3ZDAA 3TFSA 8ICGA 3OYAA 3C2MA 4XA5A 4KLTA 1PZNA 2JEFA 4DTOA 1RT1A 2C22A 4IR1A 3V72A 1KVBA 4ED0A 4QZ9A 3LDSA 4GC6A 5KGXA 1MC8A 3GIKA 2BR0A 1ZYQA 2J6TA 2GV9A 3OHBA 4E1MA 3ALYA 5KT5A 4UBCA 4B9UA 2O4IA 4KLQA 4R5PA 4J9LA 1C1AA 4CFAA 1RBUA 4P4PA 1BQMA 3G0ZA 4DTJA 2DFHA 3K4GA 3RAQA 1W9HA 5KFRA 5DG7A 3MAQA 5FRNA 3O4QA 4OKKA 4PHDA 4NY8A 1BGXT 3ZT1A 4R8UA 1K1SA 2FLPA 4F4WA 9ICNA 2HHVA 1FKPA 4HCBA 3UXOA 1ZJMA 2KFNA 1RXWA 4JV0A 4HUFA 3L2WA 4F5RA 3DRRA 4Q5VA 1VRTA 2ASJA 4ID5A 4LSNA 2ITGA 3RMCA 3TR8A 3PR5B 3JSMA 4FJXA 1VRUA 3VA3A 5FDLA 4EBEA 3LWMA 4FLZA 4CIGA 5KFUA 2RPIA 4AHCA 5F9NA 1HNIA 3C6TA 1IXRA 3C6UA 7ICTA 4DG1A 4MFAA 4AHTA 4F4YA 3AA4A 5HLFA 3HK2A 4YG2A 4ECWA 3ZDDA 3AA3A 5DQGA 5J1EA 2YV0X 1RNHA 4DTRA 4TUSA 3HYFA 2P6UA 8ICAA 2OWOA 1RYSA 5JS2A 1DGSA 4Z6FA 3KHHA 1RT6A 4J9NA 3SV4A 7ICRA 4LH4A 1JKHA 3Q8RB 4ECUA 1Z25A 1ZQHA 3ZSYA 3BQTA 2AGPA 3RJIA 4FK2A 3FDSA 3PX6A 4MF2A 4M47A 3MEDA 5KFCA 1ZQLA 1YT3A 2B6AA 4KFBA 4YMNA 4UB2A 9ICTA 4J9MA 4YCXA 3PW5A 5KFSA 1N5YA 4FO6A 1KTQA 1ZQEA 4CK1A 1YTUA 1JLGA 3ZT2A 4UB5A 4DU3A 9ICMA 3Q8LA 5DK5A 1Z00B 1XHXA 2D0CA 3RJEA 5DB8A 9ICGA 4JWMA 2RKIA 2UVWA 7ICJA 3CYMA 3H7IA 3GV7B 2F8TA 2F1HA 4PPXA 4Y1CA 3RR8A 1RYRA 2KFZA 4Q0BA 1RDDA 3DYAA 2C2RA 2BDPA 3MECA 2FMSA 2IA6A 5DLFA 4DF8A 4CIFA 4GVMA 3PW7A 2ETJA 1ZBIA 2D5RA 1ZQZA 1S0VA 4ELVA 4I9QA 3PO5A 4FM0A 5HP4A 3QZ8A 2HMIA 2HHWA 4M9LA 2VA8A 3MR2A 1Q9XA 4DF4A 4DOBA 4TUPA 1S97A 4C8KA 3QIOA 2IC3A 1TKZA 2G8UA 4QZDA 1F21A 4F3OA 3KD5E 2W9AA 3M9OB 3TFRA 5KFJA 3T5HA 1HJRA 4GMJB 8ICOA 4O44A 2M9NA 2OPSA 5C24A 1N56A 1S1WA 3MGHA 5KG3A 4BGDA 3KKRA 1J5OA 3OS2A 2JLEA 2XCPA 4DTUA 3K5MA 4CJ3A 3GFKB 4JRPA 3AVBA 1NJYA 5L1KA 4I7FA 1IG9A 4FJLA 5DG9A 2A1SA 5HMLA 5IINA 4P4OA 2JEJA 1CZBA 3H4DA 5DBBA 2X6NA 4J9SA 1QLNA 4DWIA 2FBXA 1LW2A 4FW1A 5J2HA 3BQ0A 4M9GA 4W5OA 9ICCA 4J9PA 4KHYA 7ICQA 5HROA 2ZTCA 5HMMA 1RTIA 4RQ8A 4I27A 1JLAA 3C1YA 3KK1A 3AUOA 3JPOA 3PUFA 3OYNA 3WNGA 4IQTA 3S3MA 2G8IA 5I3UA 2R8JA 3LP3A 1FK9A 3NH0A 4ZH4A 3F9KA 2W9MA 5KFXA 5JS1A 1JLBA 3L8BA 8ICEA 1HUOA 3HP9A 1KDHA 2NUBA 4NCAA 1A76A 1BPEA 1UA1A 2PFOA 7ICEA 5KRSA 4OPJA 4MQ3A 4LY7A 1BPXA 4RUCA 1ZETA 3L2RA 4CHNA 2J6SA 7ICIA 4YR0A 1B9FA 2E6LA 8ICWA 3EWAA 1NOZA 2I1QA 1L5UA 4HVJA 3B0YA 3G6YA 1ZQGA 4MFFA 4LH5A 1O1WA 3DLRA 4I2FA 2X78A 3KK2A 1JX4A 5KRTA 1RILA 2MUTB 1MSWD 3P83D 1U4BA 3DOKA 1S5JA 1ZQKA 1RBRA 5J2EA 2IOCA 4KB0A 3GILA 3OYCA 4GLXA 5J2MA 2A1RA 5EWGA 3EY1A 5J2BA 1TAQA 5HP1A 5DMRA 2UVRA 4FBUA 5SZTA 2ZJ5A 5IIMA 7ICOA 4KPYA 4IG3A 4ELTA 5HNKA 4RPYA 1BCMA 5KFQA 1D5AA 3QO9A 3M9NB 3RB3A 2RDJA 2ZUDA 3QEAZ 2FPMA 4CGHA 3MEEA 1NK4A 4M3XA 3LK9A 3C21A 1Y97A 4F5PA 4DSLA 3ISDA 3PO4A 3ZSQA 1Y88A 3JPTA 2BANA 4J2AA 2W9BB 5KT3A 2WOMA 4KREA 1XO1A 5CYMA 4QCLA 1HPZA 2KTQA 4KMUA 9ICVA 1S10A 3CFOA 4HCCA 5HRNA 4DFMA 3LP0A 5KG4A 2FMQA 1RT3A 4Q8FA 1HRHA 2ZUCA 5TZVA 3MXMA 1NKBA 2QXFA 2W9CB 4JK1A 2KW4A 8ICPA 4FJGA 3HPHA 4RPXA 1KVCA 2E4LA 2HHTA 4YNQA 5DQIA 4Q44A 4ECZA 1ZQTA 4I28A 3NDKA 3KLEA 1T3NA 2HNYA 2Z1HA 5KFOA 1KLNA 4CFDA 4RT3A 8ICSA 4IDKA 4AHSA 3MEGA 4TURA 5HBMA 4ECQA 1A77A 5KT2A 2A1JB 2JEGA 1S9EA 5L1LA 1MQ3A 1Z00A 4ELUA 4OKJA 4DSJA 1Q8IA 1WSIA 2GBZA 9ICIA 5KFMA 4RQ1A 4XQ8A 5C5JA 1UAXA 5CB1A 1COOA 1NOYA 1WSHA 4FLTA 3PX4A 4CJUA 4M9HA 1HYVA 1XU4A 1RTHA 2VANA 3QINA 3G10A 5KGWA 4KLSA 2ATQA 4C8OA 7ICSA 5KFHA 3F73A 4DTMA 1ZQRA 4CJKA 1TFRA 1BQNA 1QTMA 3BQ1A 2DPJA 1SUQA 3PMLA 4N56A 4FLYA 1RDCA 2XGQA 3ORYA 4Q43A 4G3IA 5L1IA 1RDBA 3MXJA 3RBEA 2Z1JA 3V9UA 8ICBA 1BIUA 4B9MA 2G8VA 1MQ2A 1B22A 4FVMA 4YQWA 1WSFA 4F5QA 4I29A 4GXIA 3OYJA 4IRCA 4N47A 2BCSA 4DSEA 3NH2A 3Q8MA 3AVFA 1ZQWA 4NM1A 5KFYA 1RT4A 3CM5A 1S77D 1QS4A 3V1QA 4NYFA 5J2NA 1RTDA 1J9AA 1VSMA 3P1GA 3L2UA 4J9RA 1ASVA 3OYGA 3PW4A 4KV8A 4Z4IA 3Q8QB 4B9NA 4DSFA 2V9WA 3S3NA 5DBCA 1U9LA 4YVZA 1BPYA 4FLXA 3GIJA 3QNNA 4RQ6A 4PHEA 4DFJA 4KLDA 3UXPA 4E7KA 1WSGA 1VSKA 3PNCA 4RW6A 1NKCA 1C0MA 4RW8A 3IHQB 4RW7A 4UB3A 4CGJA 1WAJA 4CEZA 4KTZA 2ZJAA 4CJVA 3ULDA 4YMOA 4KHUA 4I2EA 3M8SA 2HHQA 5J29A 1JLQA 3NAEA 3MXIA 4N76A 4E7IA 4F2SA 4O3NA 3VQ6A 5BPCA 2OZSA 2HHUA 4O0IA 5BOLA 4FJKA 1KFSA 1HYSA 5KT6A 4M45A 3OY9A 4RT2A 1QQCA 4ED2A 3O3GA 4AHVA 1CZ9A 2OPRA 4QWEA 3OYMA 2YKNA 1L3UA 5FROA 5CY4A 1FKOA 3KIOA 2VA3A 3ZSRA 4LZGA 1V9PA 1GOCA 2ALZA 1T7PA 1DTQA 3ZD9A 2X74A 4UAZA 4DL5A 8ICMA 3WNEA 3VQEA 2Q3SA 3KK3A 4O5CA 3L2QA 3QEIA 3RB0A 4FJMA 4C8NA 1IH7A 1HQUA 2GWSA 4OGEA 2XHBA 2DFFA 3SUPA 4CGGA 5D4BA 1ZBHA 2UVVA 5CWRA 3QIPA 1K1QA 8ICYA 1QHTA 3NE6A 4M3RA 1Z3EB 8ICZA 5CA7A 2YKMA 9ICLA 1ZQUA 2Y1JA 4CHZA 3SZ2A 4X5VA 3VA0A 4CJWA 1JXEA 5KFLA 2NRWA 2P5GA 1WSEA 1WN7A 5DBAA 4HUGA 4B9LA 2AGOA 1RT5A 3VQ9A 4KLEA 3HVTA 3RJKA 1EP4A 4LZDA 2BCQA 4DOAA 3LPTA 1LAVA 1DTTA 4ZTJA 5EWFA 3VQBA 4CE9A 7ICNA 3T5JA 4OVLA 3KTQA 1LV5A 1N48A 9ICPA 2RF2A 3NHGA 2VG7A 4UAYA 1X9SA 2MAXA 5J2QA 3OSPA 1TK8A 2HNZA 2XC9A 4EP4A 4BE0A 3A2FA 7ICHA 2PFNA 3SNNA 4CECA 1BI4B 2O4GA 1BPBA 3HL8A 3MGIA 1SZPA 3U6FA 3KHGA 2FC0A 4ECTA 3HP6A 1EXQA 4NXZA 5IIJA 4KI6A 3ZT4A 1EETA 3U3YA 3UQ2A 7ICLA 2E6MA 3ETLA 5DB9A 1B43A 3HW8A 2WTFA 1NK0A 4IKFA 5J2FA 3V9WA 2V4RA 2YNIA 1SKRA 1TK0A 2KQ2A 1ZQIA 3MDAA 2AU0A 3HSTB 1Z26A 3L3UA 4FYDA 4YR3A 5DGAA 1ZQAA 1RTJA 3KKSA 1KFDA 4B9TA 3OHAA 9ICSA 2BQ3A 3RRHA 3NF6A 1U47A 4DS4A 4R8UB 4QAGA 4CEQA 3GV8B 4FZYA 3VQDA 4GXJA 1N6QA 1XS9D 5CR0A 1LWFA 4CF8A 5CP2A 4YFKA 4J9OA 3V9ZA 1BVSA 4FJHA 2R8GA 4KLUA 3AVMA 1WSJA 4PHPA 3ISCA 2IMWP 2YHBA 4ZTFA 3DI6A 4BE1A 3VQPA 4ECRA 2KZ3A 1LWCA 2DFLA 5J2GA 2BGWA 4OLAA 5J0PA 1S9GA 4KLIA 1EX4A 4I2BA 1ZBUA 4RPZA 3SQ2A 2XY8A 3AVHA 4DTPA 4CJEA 5KFPA 4B8CA 1JXLA 2W8KA 3QEXA 1RBSA 5K14A 4HUEA 3UQ0A 1RT7A 3AVGA 4RQ4A 2RDIA 3VQ5A 3RB6A 3M8PA 4RZRA 3HPOA 1IKXA 3AV9A 4EBDA 5J0SA 4FJ9A 4AHRA 4OJRA 8ICFA 4QW9A 5IIKA 3H8SA 2HVHA 3OJUA 4QW8A 2IGIA 4DTSA 1CXUA 3H40A 2PFPA 2PI4A 2BQUA 5KFDA 3AO5A 5DB7A 1LW0A 2PY5A 1S6QA 3DRPA 7ICUA 5CHGA 3GV5B 3TAMA 4DL4A 4H4OA 4WE1A 1J53A 1YTAA 3NGIA 4YXMA 4F3TA 4MEXA 4BDZA 4FZZA 3MBYA 4FW2A 1TV9A 9ICRA 1BPDA 3D0PA 4ED3A 5DGBA 5KFNA 4CK2A 3QZ7A 1A5WA 1JL2A 2Y1IA 2XRIA 3OGUA 3RJFA 4CGDA 2RN2A 5C42A 3SQ0A 5L9XA 4K4GA 4ICLA 2OYQA 3CFRA 1VSFA 3SUNA 3CFPA 4RUAA 3CG7A 4M3WA 4BXOB 3NF7A 4M9JA 1S6PA 3L3VA 3CM6A 4E7HA 5I42A 4FK4A 5IIOA 4RQ5A 3OYKA 3RAXA 5KG7A 3JYTA 4GXKA 4MEYA 2OPPA 1I39A 4JS4A 1TAUA 3RH5A 1X9WA 3BJYA 3SI6A 4JWNA 1BI4A 4DEZA 4L8RB 2QKBA 1NJXA 4R64A 4CK3A 1X2IA 2PZSA 8ICIA 4I2PA 4I2DA 4O3QA 2IDOA 4PGYA 4CJSA 4IRDA 4KN7A 4YMMA 3PVXA 2YNHA 4W5TA 4FZXC 3ISBA 1KCFA 5J2PA 2G8FA 5J2CA 3ZDBA 1VSJA 3P5JA 3KLGA 3MR3A 1VSEA 1UOCA 1REVA 5SWMA 4FJ8A 4PWDA 3RTVA 3ZT0A 4I2QA 5HHHA 1JIHA 3T3FA 2ISOA 7ICPA 2EHGA 3QERA 3U3GA 5J2KA 3V1OA 4Z6CA 3K5NA 4F50A 4I2GA 3K5LA 3TI0A 1NKEA 4CESA 4J9KA 4CEDA 4NLGA 2BGGA
chains in the Genus database with same CATH superfamily
4EFAC 3I9ZA 2BXJA 5H1SV 4ED7A 2IHNA 5AQTA 2FHKA 3OJSA 1N88A 2BRLA 3T1AA 2XNRA 4CJLA 4F93B 2FZCB 5K4LA 2HOIA 4DHVA 1IBKF 1VBKA 3O9SA 5HHIA 1EO1A 1FXDA 4DPYA 3L0QA 4ACOA 1HNWK 1ZQMA 3C29A 2EVZA 1FD8A 3F56A 3WNHA 2EZZA 2JRSA 3C66A 1TMJA 4QZGA 2XO6A 4Y2RA 2NPIA 4C8MA 2F2AB 4LUBA 3RYLA 4M2YA 4ZPWR 4BRHA 2AYGA 2PFFB 3L2VA 2LLZA 3QFWA 5EE3A 1VQ4S 2JGUA 3RAMA 4FS1A 3V9SA 1Q9YA 3LVVA 5EOZA 4FL9A 2HAIA 1NK6A 3IKMA 1WC3A 2XCAA 1L7NA 4OZ3A 4M1KA 1WCLA 1I6JA 1X60A 2DIUA 4RL1A 2KD1A 1GOAA 3I1YA 3VC8A 5GAHI 4DR4K 3CJ4A 1NK7A 5JMNA 3GFHA 2XWXA 3BDPA 1S59A 5DZ6A 5M1QA 2ES6A 2ZUBA 2P51A 2I6WA 3H20A 4BRPA 4HT7A 5TKYA 1JROA 3D3BJ 2BX6A 5ETNA 3DDIA 1S4EA 1R8BA 4P0QB 3EXYA 2ZJPL 2LYHA 2HFUA 2YX4A 2V4QA 4FF3A 2MKSA 3TX8A 5A0YB 3ZETB 3DOLB 4DO9A 1JB0C 3HI0A 3NP5A 3M6KA 1XNRK 1XNQK 1U45A 3LOUA 5EN1A 3W3DA 1OY6A 3VESA 1OYEA 2B8PA 2I8EA 3MR6A 1D09B 1L6NA 4FF4A 1KLMB 4Y2AA 3TZYA 3MD3A 3PKMA 4CE6A 3UKUA 3AVLA 2WHOA 4CM2A 5KQ8A 1S0OA 1T05A 1TAMA 3H8MA 4JYAK 4NYNA 2NO4A 1RCHA 5BJRA 3E51A 1QVFR 4NLWA 4KLJA 3TAQA 1SL1A 2DFEA 3NOCA 3NGDA 4O8KA 3CI5A 2OH2A 4FK0A 3CNQP 3MFIA 4NXMJ 3VEXA 2JC1A 2BKPA 1FXXA 4CHQA 2C3OA 1DGKN 2HOEA 7FD1A 2WCXA 3I8BA 3AB4B 1HD0A 3KZXA 1KVKA 3QUBA 4FZNA 5F8MA 2ZEJA 3W2WB 5LSRA 1HYZA 2Y0SD 2HCFA 3CJRA 1C6VA 1LKYB 3FRYA 4I2CA 1S7IA 5GTIU 2YQ0A 4BWMA 2D3O1 1UT5A 4CJFA 4YB1P 1RTHB 2W24A 2DCLA 3JPPA 1BIZA 4FF1A 2Z1GA 2H54B 5EWEA 2KG5A 4ZHRB 3T9NA 1OH6A 5THWA 1DLOA 3UCUP 4EZ9A 4KAIA 4K8XA 4P74A 2XTJP 2FSKA 1LNQA 4FSVA 4CO2A 1TL7B 4DQQA 4DN0A 1PC5A 4LJXA 2G8WA 3X3UA 1EJ7L 3HZGA 2A3VA 4WYWA 1N34F 4DS5A 3T1YF 1CVJA 4ILGB 1DOQA 4URGA 3TAMB 4WE1B 4YOEA 4EELA 3ENHA 3GIMA 3SI8A 3SPZA 3M1VB 2RLTA 3L09A 3SFUA 1T3OA 4DHYA 4PXCA 4K41A 4WFZA 4CEFA 2GTDA 2F4VK 3TP2A 3MX5A 2KV2A 3U1MA 3CD7A 2CQPA 1KAXA 3WNFA 1ZQBA 2JGAA 5ALDA 4MHVA 3MMCA 1E6VB 3I0RB 5LMNJ 3OVSA 4E1JA 3N5FA 2HMPA 2RRBA 1PK1B 2AJ4A 3WX4A 1LXNA 1B9DA 4Y1DA 3R5CA 1RLCL 2OO4A 4OIXA 3SQGA 2XSFA 2W25A 1RT2A 5ITHA 4QOZB 4NYPA 4UZCA 3E2EA 3L5KA 3H59A 5AQVA 1OO0B 2W9CA 3NRWA 5IILA 2DPIA 1Q95G 3TZXA 4PG5A 8ICUA 5JLFA 3HVRA 1HHSA 2QYCA 2FLLA 2FHJD 1VQMS 5HO4A 3EE9A 3JXUA 5J0OA 3VQ8A 2LU2A 3AO4A 4QZ8A 1WEXA 2PC6A 2K4IA 1XBWA 2IVYA 2HFOA 5AQNA 2F1JA 2X7IA 2A1JA 5EX3A 1ELOA 3CRXA 2MZRA 2RHSB 1HNVA 3RSEB 4EO8A 2B6AB 3W7BA 4PGQA 3DLGA 3HI9A 3O9RA 4QS9A 2H3EB 2OHFA 1U8SA 1G6BA 2LBOA 4O5EA 3MFHA 2DXEA 3S6EA 5I4MA 3R8EA 1IBMF 1C0UB 2YKOA 3THXB 2MY7A 3U1LA 3M05A 1I1GA 3QGPA 3RMDA 1ZQDA 2FLNA 2E7WA 1MW7A 4OYZA 2O8FA 2GWKA 5KFBA 4O8UA 1K44A 3FQKA 3G8TA 1JJHA 1ZQPA 2AD9A 3SSRA 1XIQA 4YOTA 2QSWA 2LM4A 5IXUA 4ZS6A 5KOXA 1PYOB 2AQ4A 2AF6A 3UVJB 1B0XA 3CNHA 5IC6B 4AUKA 3CJ8A 2ATLA 7ICVA 7ICMA 2B4OA 3OYLA 3CPWM 2KZMA 2ZH8A 2LKZA 2ZIVA 1S1TB 3ZSWA 2UXCK 1VJQA 3WKEA 3CHWA 1PC4A 3PHEA 3M6WA 2MU2A 3D67A 3M5RA 1GMWD 3FFIA 2VYPA 1APSA 3G6VA 3FSIA 2W4DA 4USUA 4A8OA 1SV5A 3W2VB 1ZTWA 2QO3A 1VS3A 2FJAB 4E2FB 3CW2C 1U8WA 1NOMA 4NX9A 1WNEA 3N7SC 2MUTA 5GAGU 2JZBB 2L9DA 4UTGA 1GAOA 3N7PD 5HSPA 2V68A 2EW9A 3GYXB 1BLUA 3BGFA 3M6UA 1XMOK 2VG6A 3AU6A 2DR7A 3EL2A 5ALXA 3FJ2A 2CKWA 5HBMB 4YDDB 4WTOB 3AA9A 2DH9A 4F5NA 4LF5F 1QSLA 2J6UA 5AFUH 1G15A 1E3MA 2E7VA 4EBCA 4KSEB 2RE2A 2K3KA 1XR5A 2JXJA 2GUPA 1PILA 5J0UA 3HTVA 1PYSB 2GUIA 1CI4A 2KH9A 3HZEA 2KMDA 3SLCA 2FSJA 3GQCA 1JLCA 4M5DB 3PFEA 4RNNA 2KJWA 2WF8A 2O66A 3SPYA 3MN5A 2XZWA 3MAAA 3T69A 5ETOA 2RIJA 2V4JA 2RAQA 3BF3A 3DLLL 4DV5K 5D0EA 4GKJF 2KHVA 1CSJA 3EGZA 8ICKA 2Z2ZA 1T6CA 4CF5A 1ZZNA 1KVAA 2AKWB 2E8MA 4CF2A 2ZXIA 4EEKA 2M4MA 3CMQA 3PW0A 4ZLJA 4CLSA 2XYGB 4PG6A 5T7BA 1IBLJ 5F3XB 1V3ZA 3R9KA 4TSXA 2E1AA 3G82B 4V1Ak 2P2CB 3HJFA 5CRXA 5D6GA 3ITHA 1SAZA 3PW2A 2PDAA 3HOSA 4RBUA 3LZIA 4B9SA 4C3MA 4KLMA 1DTTB 1YBUA 3KWMA 3BSOA 4FDFA 2KIVA 2IRYA 5H2FU 1VRQC 2A0FB 2A18A 4M5HA 1Q86T 3KD1E 4OJPA 1D8ZA 3N6LA 4LIRA 1VQ8N 2QWMA 4CYUA 2BKEA 3I56S 3FBBA 4GMKA 3BO3A 1GK8A 1FRIA 1FFVA 3FSXA 2XICA 4NCBA 3KHLA 1V3SA 2FY8A 1AZSA 3CXCM 5IQQA 2J7WA 1X0FA 4DV0J 3HO1A 4CZHA 3CCTA 4YR2A 2CPHA 5J0RA 5KG6A 1VSLA 5C15A 2DITA 2I9GA 1T9UA 3WBZA 3PIOQ 3NFAA 1OMSA 5ADXA 4KHNA 3NS1A 2C28A 4L75A 1SKSA 2U1AA 3BEGB 1RBVA 1UL3A 1XTZA 4JV1A 3KG0A 5C12A 1Y3JA 2W42A 4BRAA 3TWHA 4IO9L 3ED5A 2HWHA 4GVBA 3D2FA 5KNIA 2W04A 1C1CA 5L1JA 1UA0A 1PK1A 4UF4A 2HWIA 1H38A 1RCOB 3HM8A 2KL8A 3M7VA 5J0YA 3WDOA 2ZD1B 3KMSA 4QIVA 2I5JA 1C7YA 3W1YC 3R6MA 2KJ5A 3H98A 5CXTA 4FE3A 2J9DE 4LFAF 1RSCA 4DV4J 1X4DA 2I5HA 3HHLA 5ALLA 2V2KA 4BLGA 5D3GB 4XDCA 1RKJA 1JLEB 1CUKA 1S4FA 6AT1B 1S9EB 3FYHA 1S9FA 2BOPA 3MDFA 1HJOA 2ZJ8A 4DV2K 3A13A 3IP0A 3BQ2A 3HM9A 3PLAA 3V4IA 4CGFA 1VHIA 4JI0K 4MLHA 3QBCA 3NS5A 3AA5X 4DR6J 4NM2A 1PAEX 4B6JA 4FS2A 3JPNA 4GC7A 1ZC6A 3CEDA 3ZC4A 1DZ5A 4Q0BB 3B6PA 2W54A 3SQIA 3D2SA 4JKFA 4QJFB 2EX3A 4KLGA 2HVEA 2A40A 3C0BA 2EFGA 2L3MA 3LO3A 1U2FA 1UEVA 1VHXA 1X8DA 4A8KA 1S22A 2F8SA 3DU6A 2F8HA 1R27B 1BG3A 3BGOP 5KAFU 2F44A 3IR6B 4CEOA 4WJBA 1YXQA 4RNHA 1JKHB 4PZOA 1WLJA 4ZPBA 1KEJA 1GXUA 1OH5A 3S3OA 4B3SK 4IKAA 1FF2A 1RU1A 4KE5A 1HNXK 4QZFA 1LWEB 5EE0A 3QE9Y 2G13A 4ATNA 1BOTO 3TZZA 4K50A 3CJAA 3VEYA 2HG4A 2CH6A 3LAKA 4DL7A 4IFVA 1RBOB 4Q45A 3QT6A 2ASDA 3AO1A 2H3QA 3ZCMA 1EARA 1MWZA 4U7BA 1XI1A 5KFTA 1QE1A 1KEKA 2QB1A 4ZVHA 2VWBA 3HHLD 5HLFB 1VIOA 2ZHBA 2P1JA 1KC8T 3MUVP 1VBZA 1WUDA 5DDOC 4Z94A 1HNZK 3MPDA 2NRZA 1GH8A 2JH7A 1TVAA 1N6QB 1UKUA 4C2MA 1S49A 2XYPB 3DXKA 3GB0A 3I33A 5BXIA 5AQKA 1M90T 4ED6A 1FWPA 4G6VB 5HRSA 3PY8A 5KI6A 1O03A 3D2EA 3B9JA 1PVPA 4A8MP 1NZ8A 1NJZA 2O8EB 4PA1A 2MLYA 2G2ZA 4BY9C 3EYZA 2QMUB 5L9NA 4M3YA 2OEHA 2ZH6A 2P9EA 1PJ7A 2W3RA 1WDDA 3RU0A 2KN7A 4KO0B 5FJ4A 4Z0UA 3DLBA 1NNLA 1UVNA 3TTCA 3AAWB 2PMZC 3CCVS 4P72A 1PJ6A 3LDLA 2ZIUA 3IGNA 5E5NA 4ILMA 1LWEA 1YZ6A 3VQSA 3HSJA 4QJVA 2HBRB 3AH6A 1UJ6A 3IN5A 1CLQA 4AYBF 1HPMA 1U2VB 2AP6A 2ZVSA 5HR7A 5ADXH 1HPZB 2HRUA 2W2NP 5AKJA 4LF4F 5J0TA 1X31C 4OQJA 3VQAA 5GMDA 3AVNA 1NH8A 1VISA 5K9FA 2NRRA 4R5PB 2BHNA 3IV6A 2OUGA 3ZX3A 2JWKA 3L7OA 3VGTA 3HHDA 1FCAA 4CEEA 3J7YU 4NXNF 4DCHA 1P7DA 2XWYA 3VQCA 3LZJA 2CZ9A 4FYXB 2DGTA 3LP2B 1FVQA 2VWKA 4ITSA 4ZP9A 3C5FA 3GZ7A 2XGPA 4JI6K 3D6TB 3UIQA 4KHPJ 3VCDA 2PI5A 2XQCA 3MUMP 3VN5A 2O5DA 3RGIA 4IS7A 3NLCA 2VFTA 2JFDA 1YJUA 3H5YA 1BPZA 5J2NB 1FEEA 2BQRA 5GADI 8ICGA 3JAMU 3OYAA 4FWNA 3I31A 4UATA 1JUDA 2KJ9A 4IR1A 3LDSA 1KVBA 4QZ9A 2HF4A 4DV6F 5KGXA 3CJCA 1MC8A 2YNIB 4A8XA 2WSEC 4AXJA 5L39A 1YKWA 5ALEA 4R5PA 3C14B 2JFKA 4J9LA 3FZFA 4P4PA 5ETKA 3K4GA 3NNAA 2ZZNA 2N7YA 3KVGA 5DG7A 3CQYA 1BC6A 3MWTA 3O4QA 1YDLA 1BGXT 4R8UA 2O8EA 3SEOA 1RBAA 4TNOA 5AKEA 4KH6A 5F8LA 4DR7K 1L7MA 3UXOA 1RXWA 3TOQA 5AM3A 4HUFA 3ENAA 4F5RA 3OTDA 3L2WA 2UUAK 4LF6K 1VQKN 4EI2A 1FK9B 3O8WA 3FUYA 1B7YB 2EAPA 2IMOA 4F9OA 3VA3A 5FDLA 2GQ2A 5AZJA 4EBEA 1VGYA 2RPIA 2YY6A 3AODA 2W3SA 3MXHP 2VH7A 2F9TA 4WK1A 4YB6A 4X64J 5AI4A 1RHKB 2P9IB 4AHTA 3VF4A 3UDCA 4DV6J 4U9RA 1BDGA 3AA4A 1URRA 2RRNA 1HWLA 2BANB 2UXBJ 1BMQB 4PQAA 4YG2A 1YHQN 2F4FA 4P6QA 2EFVA 3O1LA 2LYVA 1ZXOA 2CDQA 5HMXA 5DQGA 1IBCB 1O51A 3TEHB 2KRRA 4RW8B 4RW7B 2P6UA 1RYSA 5KOWA 2FHMA 5JS2A 2WTUA 1DGSA 3POTB 3ATVA 3VGMA 3OTCA 4AM6A 3EO3A 3UQSA 1R6YA 2AXTU 4S0MA 1JKHA 2GEMA 1U1KA 1RDRA 2E1RA 3ZSYA 3BQTA 4ETXA 3FDSA 3W60A 4M47A 1J5EK 1X5TA 1V5IB 1ZQLA 5CA5A 1Q7LB 4KFBA 1NGGA 4UB2A 4NXNJ 9ICTA 4J9MA 3PW5A 3U27A 4NLUA 4ZIVA 1KTQA 3BM7A 1MN8A 1JLGA 3THWB 4H4KC 4DU3A 3Q8LA 3QSIA 3TO8A 1Z00B 2R7XA 5CD4A 2ZIWA 1IJFB 1DQ9A 1GLDG 1MA7A 4DR1K 5DB8A 3FZLA 5JVHQ 4JWMA 2RKIA 2UVWA 3ZLJA 3MM7A 2MJUA 3KZIU 2KFZA 1NGIA 1RDDA 3DYAA 3OTBA 4RLEA 3TA1A 2FMSA 3ELHA 4TXSA 1WB9A 4YB7A 3QNMA 4OFZA 1VOMA 5DLFA 4FXWA 4BVOA 4DF8A 2L48A 4YHHJ 2DNHA 3K8VA 5AK4A 2IAJB 1AT1B 3HJEA 1T44A 1URNA 3KKAC 2D5RA 3TRGA 4I9QA 4DCOB 1R0CB 3OTOK 3KXDA 3QZ8A 2HMIA 3HHEA 2JHDA 4WXOA 3R2DJ 2IYGA 1S97A 1RGIA 3LGMA 1WOPA 1DKGD 3D2QA 2HBJA 2KOBA 1CJUB 2X1AA 4X65J 3KD5E 5EGYA 4U95A 5KFJA 5AQZA 2CDRB 3P31A 2JOQA 1HJRA 3GPAA 4TU9A 3C16A 2P9GA 3QGHA 2YHXA 4O44A 1S1WA 4BGDA 2CQDA 4H4MB 2HS0A 3ZZOA 4JRPA 1S6PB 2KDOA 1QDUB 2N7CA 3C7NA 2YKPA 4AP9A 4NI2B 2C2KB 2W4PA 3QT7A 5L1KA 4LF9K 4ICLB 4FJLA 5IINA 2IJRA 2R7RA 2JEJA 3H4DA 1FX2A 2X6NA 4J9SA 1QLNA 3MMAB 2QLBB 1LW2A 2DPNA 4FW1A 4ILHA 3KK2B 4M9GA 4W5OA 2V69A 5KQDA 1WEZA 5HANA 1IR0A 3A1YG 1RTIA 4I27A 1XO0A 3C1YA 1CC7A 1BWVA 3JPOA 3PUFA 1JLGB 2ZWOA 3OYNA 4X66F 2H48B 3NH0A 4ZH4A 5KFXA 4A2AA 1HUOA 2DNNA 1V85A 1KDHA 4IDKB 3TYTA 2C2NA 5B0CA 1U1PA 1A76A 4IFYB 4DPWA 3PIOL 3M30B 3NWGA 5LL6d 4LY7A 2B0GA 4N8NA 3P5BP 3G6ES 7ICIA 4YR0A 5BR8J 2E1MC 5SUHA 3HULA 1L5UA 5E3RA 1VQOS 3B0YA 3ET6B 1ZQGA 4XEIA 2QW9A 2ZJRL 4IOCQ 1BQMB 2HGNA 1F60B 1R0BG 4NJ8A 4LR9A 2YWFA 2CNNB 2YNFB 4I2FA 3FBEA 3M3ZA 2OEKA 2MUTB 1VQ5N 5E79U 1TL7A 2OD6A 3P83D 1RISA 4CLLA 1LW2B 1TKTB 3FZBA 1UPHA 3JB9k 3PJ9A 4P0PB 1HBNB 2RT3A 2UUCK 3ENWA 1RHUB 1DQAA 1NHUA 4IG3A 3MCPA 3CMAS 5KFQA 4JP8A 4IEEA 1M1HA 2RDJA 5FDLB 1U2CA 4NLYA 4CGHA 4EHTA 5ALGA 5B0FA 4ZA1A 1NK4A 4JI1J 2V94A 3LK9A 5DS7A 5AI8A 1Y97A 3M8PB 3ISDA 2OXOA 2KKVA 3TACB 2GA7A 1F3FA 3CTRA 4QIEA 4WK3A 2K89A 3NL0A 3IRXB 5EVZA 2WOMA 3NAIA 4KREA 4QCLA 5T7LB 1CLFA 3H0PA 1F5AA 2GMJA 2G07A 2G2YA 3US5A 1ZS6A 2ZUCA 5TZVA 3MXMA 5AQOA 4CT8A 5RUBA 2W9CB 1PVRA 2KW4A 4FJGA 4N7TA 5B0GA 4WZMA 1IN0A 4ECZA 2VKZG 3QWUA 3KLEA 1T3NA 3CP8A 5E84A 2Z1HA 5AKZA 4X4VA 4CFDA 4RQMA 4IDKA 3KJNB 3PRBA 1F44A 1G1XA 2BJ3A 4X84A 3VF0B 2A1JB 3D9BA 5BRDA 4OKJA 5AZJB 4DSJA 1Q8IA 2F7VA 4DUYF 1VK3A 2DXDA 3RSEA 5ALMA 3T41A 2PT0A 5AZIB 2G2OA 1NSKL 3LP1B 3Q89A 1NU0A 2DR8A 4PXBA 4C4TA 1XU4A 1RTHA 4GRSA 2N4CA 4C8OA 7ICSA 3D54A 3F73A 1QM9A 3C65A 2HOFA 2DR9A 2ZIXA 3BQ1A 2W2QP 5CE3A 1XEZA 4N56A 4BR9A 4FLYA 4ZLPA 2RE1A 4AXIA 2XGQA 3ORYA 5AI5A 2GGPB 3F0NA 4OJ1A 1RAIB 3WT0A 3RBEA 2MQPA 3DHXA 4B9MA 4TKTA 1YJ9N 3WKCA 3QBWA 3MEKA 4IRCA 2RU9A 4N47A 3C6AA 3JAMY 3RVCA 1IIPA 3IR7B 5BR8K 1EIYB 1YAGA 1UPMB 3CDEA 2OFHX 1ZQWA 3AN1A 4PG8A 4RO0A 2XMVA 2OLWA 1XQSC 5BR9A 1N61A 5J8YC 1LKYA 1EX8A 1J9AA 3BREA 2W2PP 2HQIA 4B9NA 2QA4S 1RHMB 3S3NA 2B9YA 2YBVA 1GXLA 4YVZA 1HBUA 4NL9A 1E6VA 3QNNA 2AMCB 3TSUA 4RQ6A 5F8HA 5BPNA 2QL7B 5C2CA 2ZH4A 2LQ5A 2P5VA 4WYLA 3FAHA 3P3DA 1C0MA 1Z05A 3LPEA 1FX4A 2C3MA 1MU2B 1WAJA 5AIBA 3M6VA 1MWMA 2ZJAA 4X66J 5HR6A 2VQFJ 4DX8H 3FK4A 2E3TA 1VQ8S 5C10A 1KNZA 2HHQA 1QTNB 3MXIA 2ESEA 3GL1A 4LSNB 2UYTA 2HHUA 2DNOA 2K8AA 4MIBA 1Q3VA 1KFSA 1HYSA 5KT6A 1T02A 2KO1A 1EETB 3OY9A 1YRTA 4ED2A 1UZDA 1CZ9A 4E8UA 4AHVA 3TSQA 3PSFA 4NEZA 5IOLA 3U9DA 3C3LA 2NUHA 4MMOA 2VV5A 3NXZA 1JALA 4DV3K 4X4OA 2AYEA 4LZGA 3I5AA 1GOCA 3OTOJ 3F5TA 3MX2A 4BR5A 3KDOA 3WNEA 1FNMA 3BSCA 2Q3SA 3RFAA 3RB0A 3H1VX 4F72A 4C4WA 5GAEI 1FWLA 4FYWB 1RT6B 4X65F 4P2XA 1U09A 3C19A 5IM0B 2DFFA 2CJAA 5M2RA 2PMHA 1JLQB 1CC8A 3QIPA 3NE6A 5A8RB 1TYQA 2K7KA 9RUBA 1YJNS 4CHZA 2P8IA 1UFKA 2DB1A 4ZP6A 2WSFC 2NRWA 1WN7A 1NGEA 4C7QA 5CQGA 4BS2A 4JI8K 5C24B 1GNKA 3UD3P 4KLEA 2G06A 1X7VA 3BS9A 3J7ZT 2YMLA 2FHJA 4M7XA 4L3NA 2BCQA 3LPTA 2IVMA 5E3CA 1LAVA 4ZTJA 3F2DA 5EWFA 1U0HB 3VQBA 4PUOB 2B51A 5HOOA 4CZFA 2XMTA 2F1FA 4UT4A 9ICPA 5GAEP 2MAXA 2WBRA 5J2QA 2MQQA 2XC9A 4EP4A 4HAIA 4Y2PA 1B3TA 4BE0A 1FJGF 1REGX 4U7UD 1TL5A 7ICHA 3PIPL 4HHJA 3NNHA 4CW7B 2HNYB 3MGIA 3KHGA 2FC0A 1YJTA 4X64K 4WFNQ 2YQ1A 4KI6A 3QU9A 3ZT4A 1H6KX 4X4UA 3GDQA 1EETA 1B4FA 3U3YA 2VPYB 2E6MA 5DB9A 1B43A 3HW8A 1NK0A 4NLDA 4IKFA 1Z2LA 2V4RA 1SKRA 3TUJC 3MDAA 1Z26A 1H7XA 4YR3A 1ZQAA 3KKSA 2QARA 1KFDA 4B9TA 4PABA 4DR7J 3OHAA 4FXVA 2MKKA 3WKDA 2BQ3A 4WKRA 5F1XA 4ANEA 2UU9K 4DS4A 2H65B 1VQKS 3NG8A 2BUPA 4DXLA 1NRKA 2I6XA 1U0HA 4P2MA 4DR2K 5KAKA 1LWFA 2VQEK 5IM0A 1WG8A 5CP2A 2F9DA 2OEJA 3K2YA 2ZJPQ 4O4GB 4ETZA 3LGNA 2W40A 5A8WB 4PHPA 2IA0A 3TQEA 2IMWP 2XMUA 1YX2A 2XMWA 3B6BA 5J2GA 3LF0A 3WXJA 3UI3A 4OLAA 4C98A 2OTLS 2BDUA 4I2BA 3KD3A 5AM1A 3IA0A 1GFWB 4JKGB 1WWHA 4GKKJ 2FJBB 2QTDA 4MKBA 4DUZF 4ZPDA 3UQ0A 4BC4A 4DKWA 2ZGZA 1C4CA 2K3IA 3BH6B 4RQ4A 2HZVA 1D4XA 4JI1F 4R0JA 1PKUA 4FJ9A 3R1HA 1X4AA 3ZXWA 4JD2B 3SEIA 3H8SA 3GCWP 3HSCA 2P9PA 2NXCA 5DM7Q 2H3GX 1FTRA 4FWKA 3O3LA 4DZDA 2PFPA 3MPWA 4ZCMA 2E5LK 3KFWX 3CCES 3BPDA 4PKDB 2PY5A 3DRPA 3N6MA 2JX2A 2KKHA 4USJC 4OI6A 4LF8F 1S99A 1H2VZ 3NGIA 2VUGA 2E20A 4P10A 4AL7A 3G87A 3PNIA 4BC5A 2PMWA 9ICRA 1VC0A 4NLTA 2J8SA 3FRZA 1QCKA 3M32B 5DGBA 4NEYA 2XYHB 4M5KA 1A5WA 1AXQA 4CGDA 2RN2A 2OTLN 1U6BA 4LF4J 1V4TA 1I3OB 5FLXO 4RUAA 1ILYA 2V34A 1JCFA 3GR1A 3CULA 4BXOB 2OMOA 4M9JA 3L3VA 4FK4A 1Q0NA 1UZHA 1SQKA 3JYTA 2CFXA 1S5ZA 2VG7B 4MEYA 2FZGB 4JS4A 3K5PA 2VJUA 2WF5A 2OP5A 4JWNA 1CULA 4CH1A 1BI4A 3DHWC 3PYDA 1NJXA 4BRCA 1EKRA 2Q66A 3H25A 2PZSA 1CG2A 2IDOA 3BZCA 1Z6RA 2C42A 1HD1A 4J5OA 2C3UA 4FZXC 1HFEL 3IRWP 2QI2A 5J2CA 1RDWX 5AM0A 3P5JA 4IH5A 2VQFK 1P6TA 1KOOA 3RW6A 3V6DB 2KXNB 4FJ8A 1XR6A 3B82A 2Q36A 3RTVA 4I2QA 2EAMA 4LQ3A 7ICPA 1IKXB 2EHGA 5CHCB 1ZM9A 4Z6CA 3KK7A 4QNLA 4JKAA 2J8AA 3RJMB 5J1EB 4ZVTB 4AFFA 3K5LA 4A4JA 3JQJA 1KWMA 2B3TB 3R6LB 3BO2A 4BR4A 3O3HA 1Y4ZB 4CCHA 4Y2IA 3I9V9 2QA4G 4KKOA 2H51B 2I5JB 4NLRA 1AB8A 4QR0A 3TTDA 5LJ3Y 2ITMA 4MF8A 3V6HA 2XBPA 3P45B 4ED4A 5IV3A 2YWHA 1W26A 4I68A 4BC3A 1VK8A 2BV3A 3UR0A 3H08A 3OS0A 1WHVA 4OYOA 1D3WA 4Z4EA 5KG2A 3D7EO 4GO7X 3AM9A 4BWJA 2O8CB 2F8MA 7ICKA 4YDXA 1VI7A 3B6OA 1NK5A 1HI0P 4H4MA 2GO8A 3CCLN 3UNGC 4NLZA 4PQUA 2QWLA 2JNJA 2ZE2A 2JMGA 4HTIA 3AQFA 3L4BC 2R2SA 3K2PA 2RRAA 4JI4K 3TANA 2VD3A 5CZXA 1W2BR 4UOFA 3UD4P 4MDAA 2BPGA 2BJEA 2CNOB 5AK3A 2WBNA 4CD3A 3AU2A 1SC3B 1BXNA 3MM6A 1S57A 4QZIA 2PXIA 1N32F 4K2JA 4QWDA 1D8YA 2VF3A 4IO8A 1WORA 2P6RA 4GKKK 4G9ZA 1KC8O 1AROP 4AH9A 4Z4CA 1XMQJ 1HQEA 5J2DA 3M2RB 4ILJA 4CRJA 4TN2A 4M63C 4MK8A 4FJNA 2WVCA 2AEFA 4YORA 2D0OA 2DEJA 1C2PA 5DKWA 1NH7A 3LALA 5D4OA 3V7JA 1VQYA 2JL9A 5KPTA 3T7ZA 1IUJA 4PQUB 2OPQA 4IJNA 5JMVA 2RS8A 1KDNA 1ASUA 5CZ2A 3DV9A 4EEYA 5E41A 4ILLA 3VQTA 1QSSA 3NGUA 1S1UA 1ZM2A 4M9NA 3DM2A 4LT6A 2H4YB 2IIRA 2BA9A 4IBNA 2LQBA 4QZCA 2ZKUA 3OL9A 2P9PB 4FWMA 2BCRA 3D45A 4CFBA 1D9AA 5A8WA 4GFJA 4K43A 4O5KA 2ZTEA 2D4WA 8ATCB 4FLVA 4CF9A 1RFQA 1SL2A 5FPEA 1OSDA 3KKAA 4C0ZA 1SKWA 4USTA 4HYKA 4W5QA 2WB1F 2Y1LB 1HMVB 5BYRA 3ULEB 2YX8A 3ZSZA 2B5JA 3A8YA 3M30A 4PJ0U 3OYDA 4P2SA 5GAHU 2DQNB 2CQGA 3AQPA 4OHWA 1RT4B 4CHPA 1IM4A 4P4MA 4TUQA 1Q82T 4BQLA 4CI6A 1SBRA 1C0GA 4WQ5C 3R5BA 1SJ3P 3TQ1A 2CQ2A 1K6YA 2OKQA 1NZBA 3CC4N 2Y0SC 3C1ZA 4NLPA 2LVWA 1YJRA 3NCQA 4M3UA 4KBOA 2W01A 1TVRA 2EFPA 3S41A 3S6JA 3ETOA 3F5AA 3U1NA 4JI8J 3F41A 1Q82O 3IM1A 9ICAA 3EDRB 1SIWB 1ITGA 5CYJA 1VC5A 3TKAA 3MN6A 2F96A 2QXLA 3NGTA 1HBNA 5HVGA 3F2KA 3B0XA 4M04A 3CB4A 4IG0A 2MLZA 2CPXA 1UWBA 3C5GA 1JL1A 4CF1A 3CCEN 1W97L 4C0HA 2K2PA 3A0HU 2R42A 4DFPA 1YJ7A 5C2DA 5L38A 3R9PA 1KVIA 3DMJB 2WFBA 1YHQS 5ETRA 8ICLA 4F91B 2X3GA 1FO4A 3PDNA 3ZTPA 3MPUB 3GE1A 4UAWA 3JQMA 2ZVIA 3MGJA 4JYAF 1I3AA 3LP1A 2QM1A 3G6XA 3SR6A 3N6NA 3OXGA 3C14A 3LYSA 5AXLA 1BISA 4LSLA 3GE9A 3CD0A 2O1PA 3SK3A 2ZH5A 3C7NB 3H45C 3IG5A 4DU4A 1DRZA 4ISFA 4F8RA 1VSDA 4PEOA 5GMKa 4LF9J 3DXBA 8ICHA 5TKWA 1HBMA 4GO5X 4YN4A 4UBBA 1GTHA 2UVUA 4PY5A 2F63A 3BN4A 3A0IX 2MSNA 8ICCA 2A3ZA 2HDOA 2Y9TA 4YHHF 3LGHA 9ICOA 2YWEA 3POTA 4OZ5A 5J0QA 2OA8A 3GJTB 1ZQYA 4OYWA 1FFUA 1FWKA 5J2AA 2MKIA 2DH7A 2BE2A 2GO9A 3TAFA 1P90A 3CJTA 4QIWC 1WEYA 3SFGA 2RS2A 1Z1BA 1EHWA 2QKQA 4E0DA 3HDSA 1KD1O 2ZUGA 3SCKE 4I2HA 2BZFA 3THWA 4DV1F 2HHHF 5CYQA 4MKVA 4JI2K 4F2RA 3G71S 1ZQSA 4FNHA 1N5XA 3IR5B 2FVPA 5BRFA 4NZ6A 3SQ4A 5D46A 1WC4A 2QWQA 1IR1A 3DLKA 2KHQA 2E5IA 3IC1A 4OX9F 3R7SB 1M5OC 4NWBA 1E6YB 2E5HA 3E0FA 1YVNA 2O6KA 4Y28C 5GVQA 3BSAA 2XY5A 4U7CA 2QMXA 4L3QA 3DXKB 2EK1A 1A9NB 2E29A 4XK8C 2GQQA 1V5VA 4QPXA 2DNGA 2KG1A 3AXKA 2GOLA 4PXDA 4DR6K 4WP9A 2HURA 1T4GA 4O9MA 3HILA 4JLHA 1UVMA 2BCVA 1X9XA 1GOBA 4I2JA 3GSIA 5G5GA 1F1BB 4KJIA 2MZSA 1VQON 4B3RF 3I82A 4OZ0A 2BJ1A 1SJRA 1U7LA 1J5EJ 4GW6A 3SUOA 4DUYJ 1KN6A 4LVSA 4DL2A 3K59A 2WUSA 3HKZC 2CXEA 4CZGA 4KLOA 2EANA 4ECXA 4MFCA 5ALVA 3A12A 3TJAA 3JPRA 2EDUA 1Q8BA 2FXUA 4FLUA 1LOUA 4DQSA 2AJ1A 3EGVA 4CNYA 2VG5A 5JVGL 1H3DA 2M9KA 4J2DA 3N97B 1QAYA 4QIWF 4RG8A 2V8VA 4IO1A 3OL8A 1AFJA 4DMNA 3ILIA 4QZBA 4FO0A 1D0EA 1N5TA 1HW8A 4NLSA 3SMZA 2QV6A 2MDAA 3R3LA 4JKDA 2DHSA 2IAJA 4HH0A 3LP2A 1VQMN 3RR7A 3RJJA 4NLKA 3NNCA 5AKYA 3GDXA 3EMTA 4ANCA 4NMLA 2H3IA 3P8BB 3QYYA 2R8HA 5IIIA 3CO9A 3LANA 1CJUA 2XULA 4J90A 1X0PA 3OPXA 4KHMA 5TISU 3MMBA 2M70A 3H5SA 1N36F 2Q0ZX 2FDNA 1N60A 3OS1A 3MM8A 4IFYA 2RUGA 4RX6A 4DL3A 1T05B 2Q79A 1FKAF 1YVUA 1WTFA 2RQKA 1N5WA 1J2MA 2W2MP 4CH0S 3BS5B 2F5GA 5KG5A 2MZJA 2R4FA 4PUOA 4C1NK 4M6WB 4C6AA 2Z8QA 4UQGA 3ZT3A 1XMQF 1S0MA 2EC0A 3SBGA 2XLJA 3WX8A 1M1KT 3HX0A 2B21A 5J1NA 4BDPA 4M63A 1RAOA 3L4PA 1YJVA 4KLLA 5GAEU 1TKXA 1N32J 2YNFA 4HDGA 4AYBD 1YRXA 4FPRA 4OCZA 2AYMA 3GZFA 3NAHA 2XMMA 1AUDA 1TV6A 4CLKA 2I9SA 3DU5A 4Y3CA 5A8RA 4C0BA 2FJVA 2YNGB 1TYQB 4JNEA 3NTUA 3B8HA 4BACA 1AA1B 1RDAA 1TL3A 1S6QB 1G4CA 4C1NI 1IBLK 4KHPK 2UXCF 3DGPB 4RR5A 5DQHA 3WHIA 3RMAA 5D4NA 4LRAA 3C6HA 4BRNA 2QEXS 4QU6A 2QA2A 5D78A 4M0AA 2BM0A 4HTLA 1NM1A 1RAJA 3CJBA 1KS2A 3NVMA 1X42A 2W03A 3D0IE 3M6XA 3D6HB 3VZHA 2MGZA 3DDNA 4BROA 2DK2A 5AT1B 2HIYA 2FZKB 1J27A 2HB5A 2YB4A 1FDAA 1TE2A 1WCNA 3K5OA 4U6PA 3GONA 3R5AA 2BABA 3QWPA 1S1VA 3NRBA 3HHKA 3MM5B 5B0DA 3VWSA 4QYZJ 3VEVA 5KFVA 2E8OA 4GV3A 1HKGA 4OV1A 3IWLA 1NDKA 3F44A 5C7PA 1HEKA 3EPIA 3OVBA 1UT8A 3FZKA 5LMUF 1T6DA 1TV6B 4CLZA 4H4KA 2ZZTA 1NSQA 2DTUA 1RJJA 1CQNA 3UXNA 4OZNA 3IUCA 5LSLA 5J2PB 4F71A 8ICJA 3J81U 3ZDCA 3W62A 4DR3F 1D1UA 2HOQA 2W9BA 1MN7A 2LXUA 2ROPA 3Q7BA 1IQTA 5IT4A 2XS2A 4OJHA 4BG8A 2RJZA 1NGJA 1WNSA 2HVIA 3S9HA 1KP6A 4DR5J 2HNDA 4OJ6A 1HHTP 5KFGA 4DV5F 4K2XA 4EYIB 3CE8A 4WF9Q 3AY9A 1C0TA 2D7SA 3BPSP 4NCGA 3ZSOA 2C2EA 4UW2A 2QWOA 4RW4A 1IKWA 2DRAA 3TARA 1MU2A 2MZ1A 3IFEA 3J7Z5 2A5XA 4ZCKA 4NO7A 1HR0F 3KKFA 5IT9O 3RJHA 4E1NA 2UUBF 2PKEA 5D8HB 1JI7A 9ICXA 2QT7A 1N2XA 4WFYA 5BPLA 4BR2A 2XMKA 2ZIVB 1S1TA 5AQXA 9ICFA 2AQ0A 2LM1A 3DRYA 1UVLA 1FFGB 3CXCR 1L3KA 4Y2QA 1HHQA 4IXCA 4FJIA 4Z6DA 3UFCX 1TFYA 1Q53A 3ILOA 3GU3A 2KVIA 3LWLA 4KH0B 4XIUA 2HHSA 1RKIA 2LYAA 2YPYA 4LD0A 4OLBA 2E8PA 3QMQA 2ZWHA 4BDYA 1NJIO 1VJWA 3CIZA 2HSZA 2PD1A 5FRMA 2BCUA 4A46A 2BUNA 1F9FA 3NGZA 5ALFA 1JN3A 4B3OA 4YOUA 2NQPA 1UHUA 2R7QA 2JZ5A 4JMUA 1T9WA 3EPGA 2LDYA 4RW9A 1FE0A 3QFHA 4FWPA 2LA6A 4CTAA 2X1GA 1L3TA 4P73A 2UXBF 4UB1A 3NWRA 5J2JA 2J76E 4OI0A 3NKYA 3AAPA 4DV2J 2EK6A 3FMWA 3F2CA 4NA3A 4M5GA 5D3GA 1B0VA 1U1NA 4X62F 2KHOA 2HS4A 2BPFA 3KLGB 1YLXA 3LW5C 2Y8WA 1KW4A 5EU7A 1XJWB 4F5OA 1J5OB 3C6UB 4HHTA 5GIPA 2FI1A 2YX1A 4M5NA 3PR4A 4DB3A 4UB4A 3K7RA 2DGWA 3V6KA 3VAFA 1RBTA 3OBYA 4K4SA 1SV5B 4L73A 1DXSA 3O9UA 4LFAK 2H1YA 3VAIA 4KB1A 1A5VA 2PO4A 1WC5A 2KHDA 3HT0A 4M41A 2CIMA 3HWTA 1HX1A 2P66A 5K20B 1FTCA 2A1BA 4KGZB 1MROB 1FE4A 3TPQA 2IM3A 4MN4C 3WK6A 2PFQA 2V5HG 1UPPA 4Y2KA 4RJVA 2DUYA 2EQYA 5KG1A 3QO9B 4ZCIA 4DQRA 4AT1B 2HQGA 3MMJA 2YHWA 2E1CA 4IQWA 3BBCA 4CJ5A 3GSDA 3BV8A 4JS5A 1TK5A 1UETA 2HS3A 3SAHA 2EKYA 2RB7A 3TWZA 3QESA 3J7AP 3OLBA 4JI3F 5CJ7A 4TVAB 5LM7E 4CFCA 4EWTA 5AQHA 5IFMA 1IBKK 4NMXA 1Q81O 2AT1B 1K9MO 2J4RA 2D0BA 2D3OR 2C2ZB 2P5OA 2ASLA 1BQNB 4R65A 4F4KA 1RTZA 3MM9A 1NZAA 5M1OA 4ZOHC 4ZPVR 1NLKL 1O08A 5CD4H 3MAAB 4DTXA 4A8QA 3VEOA 3NH1A 1Q81T 3J81Y 1K9MT 2L9WA 2LMRA 5HROB 2XSJA 4WWSA 1WKJA 4LMZA 3NF8A 4UY8O 1TKZB 3DRSA 2D6FC 2E5JA 2EI5A 3CPWR 2FTRA 2B6GA 1XHZA 1HR0J 4CM0A 2FF3B 2XG8A 3VQ4A 3WK8A 1ZQFA 4K8ZA 3E01A 5AXNA 5DDRC 2XY6A 2AJQA 5T14A 1P1TA 3SJHA 2G8HA 4DLGA 2VB6A 1DT9A 2X1FA 2K7JA 3C28A 4BCAA 4DV5J 1RWMB 3V72A 2BR0A 4E1MA 4UBCA 2HMXA 1UFLA 1RBUA 4DTJA 4LF7K 2EZYA 2VU5A 4QS7A 2JVOA 3MAQA 1HARA 4OKKA 4DUTA 1ZPWX 4EFHA 4NY8A 1GMVA 1GQEA 5MAOA 3ZNUA 2A10A 1OXJA 2V8DA 2HHVA 1FI4A 4B1ZA 4JV0A 3S01A 3DRRA 4Q5VA 3JTPA 2O8BB 4ID5A 2ITGA 3G8QA 4B3MF 2FVRA 1XNQJ 1XNRJ 3G71N 3PR5B 3JSMA 4C7YA 3LWMA 2KM8C 1RE1B 4V19S 5KFUA 2MRLA 2RUSA 3M2VB 1IXRA 4DG1A 4IZ9A 2NPFA 5HLFA 5AE3A 4TU7A 3HK2A 3HD2A 2P9SA 4ECWA 3ZDDA 4IJAA 3AA3A 5I9EB 1KXPA 3BZQA 3VETA 2MZQA 1DTQB 5ALYA 2P9UB 5J1EA 4H0OA 2H5IB 4TUSA 2Z2YB 1FNXH 5HVFA 2OWOA 2MJNA 2A1AA 5LXYA 2FF6A 4Z6FA 1WG1A 2ASPA 4X2BA 4XPCA 3NVYA 4CBWA 3MTKA 5HMYA 1S12A 1X4BA 4LH4A 2EFNA 4LQ9A 2E5GA 3RJIA 3FC4A 5E0OA 2IM1A 3MEDA 1ATNA 4FWSA 3WC2A 1BE4A 1MWKA 1A0PA 4YMNA 3KWIA 1N8RO 3WQUA 4CK1A 1ZQEA 2PMZD 3SDEA 4PYAA 1X4FA 2BRKA 2HFVA 1ZD3A 4TLQA 2E2QA 3CYMA 3WXMB 1FJCA 2MY8A 3H7IA 2QWPA 2F1HA 4Y1CA 3UDVA 1RYRA 4Q0BA 2V6AA 4OMFG 2XNQA 1N8RT 1YSJA 2BDPA 3G2XA 3E3XA 2P9IA 2BEFA 2P9NA 2IA6A 3JSRA 3BR9A 1WWVA 4GVMA 4MH8A 1Q79A 1HBMB 3KLIB 1ZBIA 2R7TA 1ZQZA 5G4DA 2FJWA 3PO5A 1JMTA 4LF2A 3TJ8A 2F4VF 2KJ8A 2F8EX 4M9LA 2ZM6J 2VA8A 1KONA 2CG8A 1Q9XA 3DOKB 3WEEA 3DRRB 4I6YA 4DOBA 1YG0A 4C8KA 3QIOA 4RQNA 1DK2A 1SVDA 5AM2A 1RZMA 2WVBA 3DRPB 4MIAA 1HKAA 2G8UA 1R31A 1F21A 3DEEA 5JXSA 4F3OA 5H9EK 2FVCA 1Y5LB 3DAWA 3TFRA 4FWQA 3MEDB 1RQLA 5I3UB 1B64A 5L8RC 1ATRA 4DV4K 1RHQB 4FPIA 2QC3A 4A8YA 2EBGA 3PXGa 3MGHA 1JCGA 1J5OA 3KKRA 3OS2A 1Q46A 1VQ7S 4JI7K 3TW0A 1T03B 4HLBA 3EGWB 1U2VA 1HA1A 2Z57B 3CT9A 3AVBA 3C8YA 1Q78A 1NJYA 2MKCA 4LRDA 4B1XB 4NLBA 2A1SA 5HMLA 2KU7A 4P4OA 2ZFHA 3ZZZA 3VOVA 3TEGA 1E6YA 3CCMN 3TA2A 3EX7B 1ZRMA 3BQ0A 2V7YA 2ZHAA 2OGUA 1ITPA 4AQYJ 2Q6CA 4J9PA 2J0QD 5AK5A 2WC9A 7ICQA 3D2EB 4UW9A 4KHYA 2ZTCA 3EXCX 3LDNA 1G99A 5GINA 4M95A 1RWXB 3M1YA 4CF3A 3AUOA 3HMJG 2G8IA 5F0UA 5I3UA 3VGLA 2R8JA 1FK9A 3F9KA 3MC1A 1SC1B 3TU5A 1JLBA 2MQNA 1PO6A 1Y0HA 3CJ9A 1FJEB 1HKCA 4A8SA 2AWZA 1UA1A 2PFOA 4V19X 2EG1A 3AOCA 2NCKL 2A2DA 4WQ4C 4RUCA 3L2RA 3W9JA 3GJSB 2KJVA 2E6LA 2KIWA 8ICWA 3OFGA 2I1QA 2FHOB 2BKOA 4HVJA 1H2TZ 4OX6A 4USWA 4MFFA 2MKJA 1ICEB 2MYFA 1S1UB 3UPFA 3JTOA 5HATA 3VTHA 3V81B 4J9VA 3KK2A 2X78A 5M2PA 3KMQA 4L6V3 1JX4A 2AP1A 3E58A 5KRTA 1RILA 2CPDA 3ENQA 4NXMF 2AZ3A 3DOKA 2GIRA 1ZQKA 3THPA 2IOCA 3PSIA 4LFBJ 2E8AA 4BR7A 3VCBA 4USAA 2DRDA 3KOOA 2OELA 5EWGA 3EY1A 5HP1A 5DMRA 1UEKA 1FVSA 4FBUA 3SXLA 1SWWA 5SZTA 4OZ1A 4M94A 1BA0A 1JLBB 4KPYA 5HNKA 1D5AA 2I7NA 4B17A 2B5JB 3EKSA 4LIWA 3SBTA 3ICLA 4NLVA 4H5RA 3CCVN 3MEEA 4DOZA 2ZBIA 4LF9F 4K4UA 3VENA 4DSLA 5CHIA 3EJMA 3ZSQA 2DNPA 3CJKA 2BANA 3TADA 2I0XA 4G1IA 4KX5A 1A7GE 1HBOA 3WK5A 3O9TA 4PKGA 4PWUA 1XO1A 5CYMA 4KGXB 4KMUA 4WFAL 4JYAJ 4HCCA 1K5OA 3WK4A 1QJHA 3LP0A 4JI5J 1RA7A 2YMMA 1RT3A 1HRHA 1IJEB 1NKBA 2QXFA 4P0PA 8ICPA 3VAHA 1RXOB 2E4LA 1TL4A 2CQHA 2E1ZA 2DKOB 1GX5A 1H7WA 2DHXA 4YY3K 3ZZYA 1U24A 2OHDA 3GP9A 3MEGA 1N5YB 2IYIA 5KT2A 3BGRB 5L1LA 1MQ3A 1Z00A 4ELUA 2CNKB 4ZMMA 3PYFA 4F36A 1WSIA 1U6FA 3HHLC 4Y00A 4OYPA 5C5JA 1IJJA 5CB1A 1COOA 1NOYA 1RTDB 2KK0A 2QB0A 1HWUA 2PBDA 2HBQB 2HFNA 3EN9A 2C2MB 2ZJQQ 1X66A 1TUWA 3QINA 2VANA 1SC4B 3BEXA 2ATQA 2P9UA 4DTMA 3UNYA 2HSTA 2FC9A 1QTMA 2HF3A 2OPPB 2HBKA 2JSXA 2KYXA 3KHYA 2KT2A 2YTUA 1RDBA 2QL5B 2NXNA 3FM9A 1UAWA 2Z1JA 2R18A 5EE1A 2G8VA 4FVMA 4YQWA 1WSFA 4F5QA 5M1FA 1PYTA 4I29A 4GXIA 3OW2R 4HR2A 3I55S 3OYJA 3Q7CA 4DSEA 3NH2A 5CABA 3O6QA 2E9ZA 3UR3C 3FEYB 2LDIA 5KFYA 1RT4A 5ETSA 3W2WA 3C16B 1QS4A 4EGLA 3ZFVA 5JICA 5J2NA 5G5HA 1X4GA 3QGGA 1RTDA 3G4SS 3L2UA 4J9RA 1FXRA 3PW4A 4Z4IA 3RBZA 2P9KB 2V9WA 1UW4A 2AX1A 2VPXB 2K60A 5D4LA 4CLYA 5LOQA 2YJFA 3PTWA 2CH5A 4A8FA 5JTIA 2E66A 4WTYA 2R2RA 2CGLA 5AKKA 2DGZA 4E7KA 1K73T 1VSKA 2DY1A 1NKCA 3T1HK 3BGUA 4RW7A 1LEOA 4CGJA 4CEZA 2YKQA 4HL9A 4L74A 3O8MA 1QUVA 3QUCA 2A42A 3CCQN 3BUZB 5AQGA 3NAEA 1CQMA 4F2SA 1UTAA 4O3NA 1MA9B 3OW2M 4IH6A 2R7SA 2I2YA 5BPCA 3TADC 3ID8A 1O5JA 4LFCK 4U8YA 5H9EJ 4ZVFA 2KG0A 4QWEA 3A5NC 1Y10A 1VQSA 3KNGA 2ZIXB 2HNDB 3KIOA 2VA3A 1N0VC 2ASYA 3ZSRA 1CPZA 5LMNK 3SMSA 1N54B 2PE8A 2ALZA 1T7PA 4I67A 2YXLA 5AKIA 3QJLA 3QICA 1WSVA 2ZGYA 1SJ1A 4DL5A 8ICMA 2A6MA 3VF2A 5JRTA 1KHVA 4O5CA 3QEIA 5BYQA 2MZTA 5ALSA 1PBAA 2UXDJ 3ZI4A 4EK2A 4K4XA 5HL7Q 4B3TK 4C8NA 2GFFA 2AW0A 1VCTA 4OGEA 4JI0F 2J0XA 2Q0UA 2UVVA 1OPZA 3UN5A 3WQPA 5BPMA 3CJ0A 1FRXA 1RYUA 1H98A 1YITN 1SXEA 1UJ5A 2YKMA 3PKYA 3AEVA 3QMLA 2Y1JA 3MN7A 3FCVA 3KUGA 1LWCB 2HBMA 1COKA 1C20A 4KRWA 1JRPA 2LQ8A 3BB5A 2F8KA 4K5SA 4B9LA 2AGOA 3UN2A 1RT5A 3ISZA 3ITHB 3HVTA 1GXTA 2KVSA 1KN5A 1EP4A 2DO0A 4LZDA 4DOAA 2DGVA 4LBHA 3CMAN 4NLXA 1RTJB 1UWAA 7ICNA 5A8KA 2O67A 1RWKB 3T5JA 3GFYA 4OVLA 3KTQA 3FFIB 1LV5A 3O2IA 4UAYA 1X9SA 2V2QA 2DRBA 5JJBA 3W2VA 5AICA 1VQ9N 3SNNA 2DR5A 1FESA 5AE2A 4IL6U 2YY3A 1BPBA 2VJ5A 2YX6A 5FD1A 1SZPA 1BHNA 2IBOA 3KLEB 3KLVA 4FYYB 4ECTA 4ZVRB 1RACB 4LVOP 2ADBA 2WSCC 2YKMB 3M1VA 5IIJA 1TL3B 2KRBA 4WF9L 4XDDA 3EVOA 1SV0C 4BJQA 5ETTA 3ETLA 1VDHA 1QHAA 3MTJA 2WTFA 3UW1A 4NLOA 3HSGA 4Z7YA 1TK0A 1WKLA 5ALTA 1VQNN 2E1YA 1C4AA 3J80U 3GTYX 2RQMA 2GC8A 3HFVA 1NGFA 1RTJA 1WC6A 3E66A 3MUTP 3FZHA 1DK3A 1IQZA 3UKRA 2VJ4A 9ICSA 3HVTB 1PVQA 1F2HA 2Y9HA 2UUTA 3MM9B 1NEEA 1WDTA 2B4UA 1RT3B 4FZYA 3I32A 3R5DA 5CR0A 2HLTA 4CF8A 5E3PA 1WOQA 3V9ZA 1PAUB 3CC2S 3TUPA 5AQFA 3MCSA 1U1QA 3D6FB 5B7WA 3ISCA 1K8AO 2N4DA 2YHBA 1Y9OA 2K8BB 4ZP7A 1DFDA 2KZ3A 1LWCA 1NM2A 3DC2A 2BGWA 2NSCA 1FJ7A 4JI8F 2XY8A 5KPZA 1JXLA 2W8KA 1RBSA 3DGPA 3GFZA 1S6OA 4HUEA 1TMMA 5F2RA 2LMIA 1S3XA 3W9IA 3B8AX 4A2BA 1YBAA 1AUSL 5A8KB 1EAYC 3RB6A 4RZRA 4JI6F 5J0SA 3K17A 3OFEA 3BF4A 3D1QA 4OJRA 4P75A 4DN9A 1P27B 2AIRB 3NY0A 2JR5A 2NZ4A 4QW8A 2WF7A 2PI4A 2IIHA 4PL7A 1KHWA 5IWAF 2OI2A 2KLAA 7ICUA 4P0QA 1L7PA 3H7HB 3GV5B 3ETRA 4DL4A 1R8AA 5IQ6A 5IT9U 2MPUA 3BQ7A 1EKSA 3QJJA 4ISEA 4YXMA 3QQCD 2KNJA 1QVGR 4BDZA 2LP4A 1Q5VA 2MQLA 1N0UA 3R1LA 3D0PA 1RDUA 1YGYA 2OMLA 2IOFK 4B3TJ 5KFNA 4CK2A 2ZJQL 1Y5IB 2Y1IA 2VC1A 5A2QU 4P2FA 2BW7A 4AQYK 2UU9F 1GLLO 1IR2A 3CFRA 3DXSX 1VSFA 3AT1B 3SUNA 2GMLA 4M3WA 3NF7A 4E7HA 3CM6A 1EQMA 5IIOA 3OYKA 3SENA 2CJKA 1I94F 3ENVA 4YUDA 2M8HA 4GXKA 2Y0BB 4LFAJ 1EWRA 1I39A 3RH5A 1X9WA 5AJ3F 2LCWA 3O08A 1ZM4A 3I76A 2LI6A 4DEZA 1H73A 4CGZA 4CK3A 1X2IA 4CRXA 2XZTB 1BNOA 2W7OA 4I2DA 1WKKA 4ZVGA 2G0CA 4CJSA 3CJ5A 1Y64A 4A8WA 4PKIA 4KN7A 2V0NA 2F3NA 3JS6A 4DUZK 5J2PA 1URJA 3V2UC 3ZDBA 5B8HA 3KLGA 1F9EB 4NLCA 5HJYA 2V9KA 3IBFB 5DM7L 2R7VA 1EWQA 2DTJA 5F0WA 1JIHA 5G0RB 3T3FA 2ISOA 3RUBL 3V1OA 2JH3A 4FKXA 3K5NA 2O01C 4QPTA 4F50A 4BRQA 4RKUC 3TI0A 1F3VA 3GJQB 4J9KA 2HRTA 3IRUA 1FEHA 4NA2A 2JZBA 3KLIA 4DSKA 2E88A 3UN3A 4WZQA 2RQCA 4CEAA 1Q1KA 5J2QB 2F9JA 4QYRA 1JLAB 4M7YA 2H3VA 4LF8K 1GLBG 4ID1A 4KGMA 4ED5A 4CD1A 2DY9A 4KH4A 3H8WA 1U48A 3QEVA 5LY3A 3PCOB 4OHXA 4IFEA 3FC9A 4Y2CA 1SJFA 2EFOA 4R79A 1RAGB 2PYJA 4FM1A 2R7YA 2I38A 1O8BA 3RWUA 4JV5F 3NOGA 2ZQBA 4CO0A 2G5HB 5E26A 5B5EU 1OSCA 4FN5A 4OJ5A 1VQPS 3HFKA 3OTOF 1ZQVA 1ZZFA 2HSEB 4QIGA 3O4NA 5IV4A 1U1LA 1U6ZA 2YKNB 3J81j 3TX0A 4J8FA 2G5IB 1VQPN 4DCPB 3RBDA 3V4MA 4BG9A 2EEYA 3EGNA 5M2UA 1S0NA 4EU0A 3CDAA 3O5BA 1W2IA 2KVCA 5EOYA 4MK7A 4ID8A 1JXBA 5EY4A 2PFUA 4BGBA 3ZSXA 4DR5K 4PL1A 5KFFA 2K4EA 1SCJB 4B3SF 4MFBB 2I7PA 1R3NA 4I56A 4K4ZA 4YOWA 2XMAA 2IC3B 2OCEA 2WAQF 3FVYA 4LBIA 2VQFF 2VFRA 2QLWA 3SBMA 4UARA 3O3FA 4YY3J 3HX9A 2WB1C 2V51B 1RWNB 5B0BA 3JSMB 3KOAA 3AY0A 2KXHA 3CF5L 4M3ZA 2F7TA 2JLGA 1X9MA 3OT9A 3CD6S 2IY5B 1QE1B 4N5SA 8ICRA 3SSSA 3V81A 3KLFA 2WW4A 4LF7J 2ASMA 3P5TL 2WRMA 2NZTA 3H8YA 5A2QO 4DL0C 2HRYA 4Y34A 6FD1A 2GIFA 4RQ7A 2LSNA 2SXLA 2E9TA 1D8LA 2NLWA 1RG6A 3ZDEA 5F8IA 3PEHA 1N5QA 4EX6A 1ZAXA 4E98A 2KSOA 2NO5A 3HKWA 1NGAA 4NZ0A 5DRKA 2OZMA 2M0NA 3R5GA 3GFXA 3D3CJ 5E3AA 4F67A 3LQVA 2CWXA 4IRKA 2DWQA 4NPOA 1AW0A 5J0WA 3RG6A 4EO6A 1QY7A 3Q0AA 3HVWA 3N9UC 2YKAA 3VF6A 1Q7YO 4H03B 3QATA 4J2BA 5HRRA 4OYIA 4KN4A 1BY9A 2N3LA 1NHKL 1O0PA 2QG9B 3OTEA 2PYLA 1N32K 2P9NB 3CCUS 2UXDF 3T19A 2R8IA 4GKKF 4IO9Q 1SGGA 4WIIA 1W0HA 4IOCL 2RQ5A 3B54A 5I3PA 1M1GA 3S7RA 2GVZB 3ILJA 3AD9C 2GX9A 5K8OA 2DO4A 4I9LA 1CXQA 1S79A 4EHUA 4GV6A 2DYAA 4LRFA 4KTQA 1WF1A 5KTQA 3DWLA 4BRLA 3DLEA 3CIPA 3WK7A 4Q8EA 4H8KA 3EVWA 2PAVA 3QSYB 2YCHA 4KY3A 2B8QA 2HQCA 1HMVA 4KTWA 4E7LA 4EZ6A 1NK9A 9ICQA 3G82A 2PEHA 3MD1A 4MDBA 3U7JA 3IG8A 3VAGA 3PZPA 4Z4GA 2E2NA 4J9QA 3W0LA 3O1BA 3JTNA 4DG1B 1PCAA 1ZBFA