3TAQA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3taqA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3taqA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3taqA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3taqA01
2Y1JA 4FW1A 1RDDA 3U3GA 4CJ4A 4IQWA 4MFAA 4K8ZA 4CGGA 2H5XA 3UXPA 4EBEA 4MFBA 1X9SA 1UWBA 3NCIA 3CG7A 1B9FA 4LY7A 3AVHA 3SUOA 9ICJA 4KHUA 3QO9A 3VQAA 8ICUA 2PZSA 2IHMA 4O3QA 1VSLA 4Z4GA 1KTQA 1C0MA 2J6SA 4JS5A 3RH5A 1TAQA 1XSPA 4I2PA 4P4PA 4J9QA 4JUZA 4RQ3A 4OVLA 1WSJA 4QWBA 3MEDA 3LPTA 4OKKA 1SV5A 2BCVA 5J2CA 4B8CA 4P2HA 2VWKA 3TR8A 4XA5A 4DS4A 4F91B 3ZT3A 4FLUA 2PYJA 3EW9A 4MEXA 3DLRA 2D5RA 3RMAA 3QEVA 3G6VA 1BPBA 5KG4A 2NUBA 5IIMA 1NK6A 1K1QA 3RB6A 2Q3SA 3SPYA 2OZMA 3JPPA 5KGWA 3AO5A 4HUGA 2FBXA 2HB5A 2RN2A 1NJXA 1SZPA 4KLUA 1T8EA 4UB3A 3AO2A 4ZHRA 3P1GA 4MEYA 2C28A 9ICAA 4CK3A 5DDYA 3SUQA 1T03A 3BJYA 4RNNA 4IKFA 4LVSA 3V9SA 3K5MA 3MDAA 1FXXA 1L3UA 7ICGA 2P51A 1RILA 3VQDA 5KFKA 4IQVA 4DQPA 2C22A 1RYSA 2DFFA 2HNYA 4CJVA 1MSWD 4RW8A 1MQ2A 4N41A 3EY1A 1JLAA 4Z6EA 2OWOA 4RQ0A 5L1LA 4E0DA 4NYFA 2OPSA 3DLHA 3ZD8A 2FMPA 4NLZA 4ID5A 4CEQA 2LSNA 5HHIA 2KW4A 4FJKA 4GVMA 4CJKA 5EOZA 1QS4A 1VSHA 7ICMA 4WE1A 4TSXA 4F92B 4DL6A 2B5JA 2X6NA 2YNIA 3NH0A 1JXLA 9ICTA 3RH4A 4KI4A 1ASUA 5CY4A 1JLBA 4I2CA 1I3AA 4P4MA 3Q8PB 2OPPA 3EZ5A 3AVCA 3TAPA 2GUIA 3S3OA 4RW7A 4CK1A 4FJ9A 3AV9A 2W8LA 3OSNA 1C7YA 4YFUA 5IIKA 3BQTA 3H8JA 1WLJA 1QHTA 4FLZA 2ASDA 2G8IA 2HNZA 3LP0A 4I2IA 4RNMA 3M8PA 3TFSA 5J2PA 1B43A 4F3OA 2R8HA 3KKSA 4OGCA 4CEFA 4CJSA 5CYMA 5FRMA 5J0PA 2LYHA 4CJLA 4OJRA 3E2EA 5I42A 3C6UA 1S77D 1PZNA 3MR2A 4DOCA 1UT5A 2AGOA 4BACA 4E7LA 4UB1A 3OYHA 3TWHA 3SI6A 3ZD9A 3NDKA 4DL4A 4RNOA 1S1VA 1KFDA 3PO5A 3OJUA 2HHVA 1B22A 4ECUA 5HLFA 1IKXA 4ECTA 4KLEA 3ZDBA 1BIZA 1B9DA 4J9LA 1UT8A 3C2MA 3H40A 2IA6A 1TFRA 1SL2A 2YKMA 4N76A 1TAUA 3KHHA 3MXMA 3KLGA 3PW2A 1RTIA 5IIJA 2UVUA 3T1AA 4HYKA 4ELVA 4FJXA 3LZJA 1WAFA 1HJRA 2VG7A 4ECRA 3ZDAA 5FRNA 4EYHB 4JS4A 3ISNC 4X5VA 1D9DA 3TARA 1XWLA 1U45A 3SV3A 4DF4A 1BQNA 1HNIA 3IHQB 3OS1A 1SKSA 3DLKA 1ZETA 2F8TA 4Q45A 5TZVA 3VQ8A 2AU0A 4ED2A 1LW2A 3WNFA 2E6LA 2FBYA 3OY9A 4R66A 1NK5A 1A5XA 3QEIA 4IRCA 2XCPA 5DGBA 1TGOA 4JRPA 1W0HA 1S9EA 4JV1A 9ICOA 3C95A 4KLIA 4FBTA 1NKBA 4AHRA 1GOBA 3MFHA 4Z4HA 5HP4A 1Q9YA 4LSNA 5D46A 2EHGA 7ICRA 3L2WA 4RQ4A 2Z1GA 1HQUA 1MQ3A 1IH7A 5DLFA 3AA4A 1U04A 3HPHA 4F4YA 4KHNA 4KLLA 2FLLA 1S0MA 3ZSYA 4G1QA 4FLVA 2GBZA 2F1HA 1UOCA 4QZBA 4W5RA 3DOKA 4PHPA 2BGWA 1BQMA 1VSDA 3AVBA 4Q5VA 3M9OB 1ZJMA 2YV0X 4E7IA 3DMJA 2C2RA 4DQIA 2RDJA 5J2KA 3M9MB 1RBVA 4M9HA 4F93B 1EX4A 3SV4A 1RXWA 2ALZA 5KFMA 1YVUA 3KLHA 3NH2A 3QNOA 4DLEA 3IM1A 4MF8A 8ICGA 3OGUA 4RW9A 5KT5A 3NGZA 3L8BA 1RZTA 3LWMA 1XSNA 3ZSQA 4B9NA 4YR2A 1TL1A 5EWEA 5KT2A 4CF8A 1RNHA 3L2QA 4DL5A 1D8YA 2JEJA 3ZSXA 1LB2B 1QLNA 1UAXA 2P1JA 4KTWA 4IFVA 4DMNA 1J53A 5KFSA 2WTFA 3V7LA 4M41A 4GXJA 2FPLA 3C23A 2I9GA 4QZHA 2FC0A 4O3OA 2PFOA 3HO1A 3V81A 4M3YA 1X9MA 4KI6A 4CF9A 3LK9A 4EEYA 2I1QA 4JWNA 2PFQA 4DU3A 3GIJA 1CUKA 4EBDA 4DSEA 3QEXA 2OZSA 2IS3A 3AO1A 4C8KA 2X6SA 1Q9XA 4FLXA 4BGDA 4YG2A 1XO1A 4OPJA 5BPCA 2IBKA 3AA3A 2BHNA 1KDHA 4I28A 4M9JA 4OLBA 3JYTA 1DTTA 3RBEA 2VG5A 4LSLA 4C8MA 4CGHA 3LP3A 2VANA 3SCXA 4J2EA 1HQEA 3NE6A 3PX6A 4TUPA 2R7YA 4DO9A 2KZMA 4OLAA 5KRSA 3VQ7A 1WAJA 3GIMA 5D4BA 1NK8A 5KFQA 4BXOB 4EZ9A 3HYFA 4QCLA 3VQCA 1ZQTA 3T5HA 5CZ1A 2P5OA 4DF8A 2D0AA 3TAFA 1T05A 4XUSA 7ICHA 2ZD1A 5KT6A 4KLMA 5KFTA 2XY8A 4Q8FA 2MUTA 4CFBA 4QAGA 4HUFA 2YNHA 2ZUBA 4DU1A 3DYAA 3ZDCA 2BGGA 3O4QA 3TQ1A 4NLGA 4KKOA 3KTQA 1JLQA 3L3VA 4IFYA 4KRFA 3TAEA 3OYNA 1BVSA 3TAGA 5D49A 4Z6DA 1YTUA 1ZQBA 3QERA 2ATLA 4BDZA 1WNSA 4FJHA 3O3GA 4NM2A 1T7PA 4F5PA 1RBTA 1HYSA 1C1BA 3VQEA 3SQ2A 5DDMA 2MAXA 3B0XA 4F5QA 4N47A 7ICSA 2XY7A 1DOQA 3RH6A 1VSIA 3QESA 4PHAA 1JLCA 9ICHA 5KFFA 4I29A 3GFKB 4NLKA 1RT3A 4CGIA 4JRQA 4M3XA 5J2FA 2BANA 3Q8QB 4IR1A 3KD5E 1KVAA 4CHZA 1AROP 4Q8EA 2BQ3A 2ZUCA 4QZCA 1T4GA 3K57A 4RT2A 3KHGA 4M3ZA 1K1SA 4DSLA 4LH4A 4CGDA 1BPEA 5KFJA 1RT7A 8ICNA 4O4GA 2VG6A 1SKRA 4CIEA 2Y1IA 4KREA 1HUZA 3WNEA 3CYMA 4UBBA 4I2AA 4ED0A 4I2EA 1YT3A 1X1PA 1HNVA 4BXOA 8ICVA 4Q0BA 4DTJA 3Q8LA 1KLMA 3B6OA 4DSKA 1HYVA 1RYRA 1JL1A 2R8JA 4CEAA 2ATQA 2RF2A 4DTMA 4CGJA 3MBYA 4CJEA 1Z00A 3K2PA 4FJIA 3DRRA 2G8WA 1RT6A 3MXIA 4F3TA 1S9GA 5KG1A 4QZ8A 1S9FA 3AU6A 1S76D 2XCAA 3SPZA 1ZQMA 3S3MA 3T3FA 2QK9A 1HPZA 4IG3A 3IRXA 3V9ZA 5CJ7A 3UIQA 5D3GA 3OHBA 3I0RA 5EWFA 2HHUA 3U3YA 3JPRA 3UXNA 3MR6A 1TVAA 3L2UA 4C8LA 4O5CA 2QXFA 3SQ1A 1NJYA 5J2IA 4CEDA 1RBUA 2YHBA 3V6KA 1ZQKA 4BDYA 4CESA 4QZDA 3O4NA 1LWFA 3MEGA 2XGPA 4XRHA 1ZQRA 4PHEA 4R5PA 5J2DA 4OGEA 1SUQA 3DI6A 4CE9A 4I9QA 3OS0A 3ISBA 2YNFA 3PR4A 4CECA 5CYQA 1ZQDA 8ICOA 4UAWA 4M9LA 4NCGA 5J1EA 1HYZA 1RXVA 3ISCA 2V4RA 7ICOA 5KFAA 4RQ2A 3VA0A 1W9HA 3ZT0A 3OHAA 2F8SA 2Z1HA 3LALA 5DGAA 4AHUA 3BDPA 2F1JA 4CF2A 1KCFA 4YR3A 4FVMA 1BI4B 1VRUA 3AVLA 1NOZA 4CEOA 3V6HA 4O55A 1WCNA 3RAXA 4UQGA 1Z25A 4ECVA 3PMLA 4E3SA 4PA1A 4DL7A 4DTPA 5KFZA 5C5JA 4FS2A 4O5BA 3TAQA 3PO4A 2YHAA 3ZSWA 4DL3A 3GQCA 1CLQA 3IS9A 4PY5A 4KLDA 2KZ3A 3NBPA 4CK2A 4NCAA 4NCBA 3V4IA 1IXRA 3ZDEA 3AVAA 1ZQJA 3HW8A 4ECXA 4DFJA 4QW8A 3NF9A 3ZCMA 1FKOA 1N48A 7ICUA 1TL3A 4B9TA 1HUOA 1IKWA 1LW0A 2NRTA 4K4GA 1NK9A 3MAQA 1NK0A 2KTQA 1IKYA 3IAYA 4F4KA 4W5OA 2PFNA 1J5OA 2M9NA 4M6WB 4O3SA 4IG0A 4O0JA 3HP9A 5J0QA 5J29A 4YNQA 5KFEA 4TQRA 1JLEA 3AVKA 4RT3A 2BCSA 4E1NA 4DQSA 5L1IA 1S0OA 2FBVA 1WSHA 3H8WA 5DMRA 3V72A 1N6QA 8ICRA 4KFBA 4B9MA 1SKWA 4ELUA 3PUFA 4RQ7A 3HL8A 3HX0A 5F9LA 4KTQA 2GWSA 2P5GA 3QIOA 1I39A 5I3UA 1BHLA 4F5RA 5KG3A 4FJ5A 3SUPA 5KRTA 2RKIA 3P83D 2O4IA 2BPCA 1VSFA 5CR0A 4IR9A 3U6FA 2BCQA 1BPDA 3QEPA 4KITB 4GC7A 1NKEA 3ZT2A 4AHSA 1N56A 3I0SA 4MF2A 3T5KA 4QWEA 3DLBA 2OYQA 3HSTB 2BQUA 1NK4A 5KFCA 4LH5A 4YMOA 1WSFA 5DB6A 4DG1A 2A1RA 4FZZA 3MR3A 4JLHA 4O3PA 4I2JA 2HVIA 3RRGA 1TKXA 5HROA 1WCLA 3NGYA 4O5KA 4RG8A 2XY6A 1ZBUA 4JV0A 3NH1A 2E4LA 5HRRA 3KHLA 4UAZA 2DPIA 3UPQA 1IO2A 3SQ4A 4XQ8A 2FLPA 3VQQA 4FBUA 7ICKA 2IOCA 1MU2A 3GV5B 5KT3A 4DS5A 5E41A 3C5FA 1GOAA 3LP2A 1KEJA 2B6AA 2ETJA 1LV5A 3OYLA 9ICBA 4YP3A 4LD0A 4KN7A 8ICTA 3OS2A 4EYIB 5HBMA 4I2GA 5EWGA 3CFOA 3KJVA 5KG0A 3F9KA 3N97B 1XC9A 3C5GA 4K4IA 3PX4A 4O5EA 4ECQA 1XI1A 5DBBA 8ICIA 1QQCA 4K4HA 8ICPA 4M3WA 4GC6A 3QEAZ 3F73A 3CQ8A 4RU9A 4FJ8A 3C2KA 1D9FA 1NK7A 3BQ1A 1RTJA 1VSJA 5J0UA 1L3TA 4HHTA 5DG7A 4AILC 1TK8A 3TI0A 4J2DA 3CFPA 3ISDA 3SZ2A 4GXKA 3RB4A 4KLHA 4E7KA 1FK9A 4Z6FA 4DSFA 4DLGA 4HUEA 4YXJA 3SYZA 1HJPA 2PFPA 4OKJA 4BE1A 3RTVA 1XU4A 3TABA 3AVIA 9ICQA 1RTDA 1B92A 5KFLA 3KHRA 4DL2A 5KFBA 1C0UA 1U4BA 4J2BA 3K5NA 4C8OA 2V4QA 4E1MA 3HPGA 2BDPA 4DTNA 1KSPA 5DBAA 3G6YA 2DFLA 5J2HA 3QEBZ 5J2MA 2ASJA 2HHTA 4DQQA 8ICMA 3ORYA 5J0XA 4IDKA 2P66A 1ZQIA 5J2BA 4RW4A 1RTHA 3K5LA 4O0IA 1DTQA 1RT5A 5HHHA 2KZZA 4EP4A 2HHWA 3LZIA 5CA7A 3H08A 1COOA 3NGDA 4DOAA 1U49A 1ZQOA 3AVNA 8ICEA 9ICEA 4CJWA 4DQRA 2XGQA 3DLGA 3NF6A 2C2DA 3OVNA 4E19A 3G6XA 1TKTA 3T5LA 4H4MA 2UVVA 3KK3A 3OSPA 4GW6A 9ICRA 4J9KA 3GIIA 2HNDA 5KI6A 4DFKA 3EPIA 4KAZA 1U9LA 4BDPA 5KFYA 4F4ZA 4QZ9A 4QZFA 5J2NA 5DG9A 3OYIA 4PWDA 1DLOA 3OYCA 4CEZA 1XS9D 4PGQA 5C25A 4PGXA 1R0AA 1SL0A 4TQSA 1K6YA 9ICMA 5CWRA 4Q43A 4RPZA 3RR8A 2PYLA 1G15A 1IKVA 3M8QA 3M8RA 4K8XA 2JEFA 5J0YA 2XRIA 8ICBA 3RMBA 4ZH4A 4YR0A 4FM2A 3V9WA 3IG1A 1VSMA 2BR0A 8ICCA 3P5JA 2RDIA 2BCRA 4TUSA 4J9RA 4PQUA 4IRDA 4RZRA 9ICKA 5C42A 2D0CA 8ICZA 8ICAA 5DG8A 3AO4A 3GV7B 3PR5B 3UQ0A 4UBCA 3PW0A 3V1QA 3K59A 3HVRA 3G0ZA 4MQ3A 1TKDA 2KQ2A 3ZSRA 2JEGA 3HT3A 2ZJ5A 1KLNA 3QINA 2VWJA 4CIFA 3PW5A 4E7HA 1CZBA 5EU7A 2J6TA 4UB5A 3HK2A 1TK0A 2HVHA 4FCYA 3S3NA 2W9CB 1JL2A 5DLGA 2ZTCA 4NLNA 1A5VA 1ZQYA 3M8SA 2OA8A 3BGRA 1NKCA 4YFKA 4YN4A 4B08A 4ICLA 4R63A 4M9NA 4H8KA 2NRXA 4QZGA 3VA3A 3PY8A 1EXNA 3NF7A 1ZQVA 1DGSA 4B3OA 1WSIA 1MC8A 4IQTA 4NYNA 4JK1A 3EYZA 4RPYA 2R8IA 1UA1A 4CEEA 4EBCA 9ICLA 5KFPA 4GLXA 3B0YA 3H8SA 5KG6A 1QSLA 8ICSA 5C24A 1QTMA 3HWTA 1ZQUA 2IGIA 4FJGA 1CXUA 5HRSA 2HHSA 2ISPA 1L5UA 5KG7A 4M3UA 5HMLA 5KG5A 4H4OA 5F9NA 3MXJA 3WNHA 5J0OA 4KLSA 1JMSA 4R64A 5DB7A 4RUAA 5JUMA 4FJMA 4KHQA 3PV8A 2G8VA 2ZJ8A 5J0WA 3H4BA 4NM1A 3SNNA 5KFHA 2YKNA 4ECWA 3K58A 4QWAA 9ICIA 3GV8B 2ISOA 3ASMA 4B8AB 1LAWA 1LAVA 4EP5A 5J0RA 1ASVA 5KFDA 1NJZA 1C6VA 4CJQA 5DQIA 3DLEA 3L2RA 1KFSA 4RQ8A 3K5OA 4KB0A 1S0NA 5KT7A 2R8KA 1WSEA 3UXOA 4M9GA 1VRTA 3C2LA 1BPXA 3JPOA 4W5QA 4KHSA 4I2HA 3RR7A 2DFEA 4M47A 4B9SA 4ECZA 4FS1A 1D8LA 5KFNA 4IBNA 1N5YA 3G10A 2O4GA 3N4MB 4R8UB 4KPYA 5IINA 3JSMA 4O3NA 1RBRA 1Y88A 3LDSA 4CERA 5KFWA 3HP6A 5CZ2A 4FZYA 5KGXA 2R8GA 4M42A 3RWUA 4O44A 4J9PA 5KTQA 1WN7A 3LAMA 2G8FA 1NOYA 4FJJA 3ZT4A 2PY5A 2ZJAA 2OPQA 4QWCA 5DK5A 3ALYA 1RT1A 2F1IA 1NJWA 4FYDA 4CJUA 2W42A 5J2AA 3AUOA 2ZTDA 1JLGA 3OYAA 1QE1A 3AVGA 3V9XA 3DRSA 2PI5A 3KK2A 2BQRA 3ITHA 4YD2A 1GOCA 3PW4A 1L3SA 4PUOA 1S10A 4J9OA 4DTXA 5HRNA 1ZBLA 1J9AA 3TFRA 2ITGA 7ICIA 4DFPA 4DSJA 1ZQLA 5KG2A 1WSGA 4E7JA 3C21A 4R65A 2P6RA 5DQGA 2IHNA 4KHWA 4YCXA 7ICVA 4FLTA 1KRPA 1RDCA 4ECYA 2ZUDA 3LWLA 4I7FA 9ICFA 5FDLA 4HTUA 5K14A 2VA2A 1A77A 1JKHA 4M45A 2KN7A 2BCUA 4QW9A 2G8HA 4NXZA 4QWDA 3VQBA 4KLOA 1ZQWA 4FZXC 1LWEA 3VQ9A 3KKRA 3KK1A 3L2VA 3TAMA 3ZSVA 4FK2A 3EWAA 2AGPA 2Z1JA 3L3UA 3C6TA 3ZDDA 1ZQZA 5J0TA 1UA0A 1FKPA 1Z26A 2JLEA 3RMCA 4MFFA 2GV9A 1JXEA 8ICHA 3AA5X 8ICJA 3MABA 3VQ6A 2KFNA 5J2EA 4AHVA 1VSEA 1TVRA 5L1JA 5HP1A 2IAJA 4R8UA 1U48A 1EETA 1S1UA 1REVA 5FROA 3H4DA 4KLQA 2KFZA 2FLNA 3QZ8A 4FK4A 7ICQA 2ASLA 2BPFA 4B9LA 3OYEA 9ICVA 4ED3A 4CJ5A 2X74A 2IC3A 2VA8A 3GDXA 3THVA 4DU4A 1ASWA 2XO7A 2NRVA 3V1OA 4DFMA 3LP1A 4M3TA 5HMMA 3T19A 3VQ5A 4ID1A 4ELTA 1HMVA 4F5OA 3B6PA 1VSKA 1CXQA 1ZQCA 4OKEA 3I8DA 1Q8IA 3SI8A 1XHXA 8ICQA 4P4OA 4I9LA 3C1YA 3QETA 3JPNA 9ICWA 3NAEA 3EPGA 1S5JA 3FYHA 4PGYA 4IRKA 3SQ0A 4RQ1A 3HPOA 8ICFA 3RB0A 4Z0UA 5J2QA 4YXMA 3HXMA 3S9HA 4UB4A 3RJHA 3SUNA 3RJIA 4J9MA 4CJ3A 4KMUA 3BQ0A 2NRWA 4CHPA 4KLJA 4FLYA 3D0PA 3V7JA 7ICLA 1BI4A 7ICNA 4J9SA 2XY5A 1S6PA 2FPMA 3KLIA 2FPKA 1ZQEA 1F21A 3PX0A 1BCOA 4FW2A 4YQWA 5KFVA 3RBDA 2FMSA 1CEZA 2JZBB 3TANA 5JS1A 5KFIA 3UQ2A 2D0BA 2HMIA 4AHTA 5BOMA 4CFAA 4FJNA 5KFOA 4KV8A 2A1JB 4I2DA 3NGIA 5HRPA 3AO3A 1RCHA 1ZQQA 5CP2A 3Q8RB 3K4GA 4M0AA 3OYFA 3RJKA 4KLFA 3QZ7A 4ED7A 2XHBA 1NOMA 4QZEA 3KIOA 3KLFA 3Q8KA 2YNGA 3MR5A 4M6WA 2HW3A 3QNNA 4F4WA 3DRPA 4QZAA 4XIUA 4Z4EA 3PNCA 4I2QA 1ITGA 3RJEA 2UVRA 4OPKA 4CHQA 2HHXA 4C8NA 2QKBA 4AH9A 3KD1E 5IILA 2W8KA 3O3FA 1ZBIA 3OYJA 4KLGA 4N5SA 5HNKA 5IIIA 1BCMA 8ICYA 1RT2A 2VA3A 5DB9A 1ZYQA 3ULDA 5CHGA 1ZQAA 4DTRA 9ICGA 3AVFA 2FBTA 2Q0ZX 3V6DA 4CJRA 1LWCA 4NY8A 2NRZA 1X2IA 3V9UA 7ICTA 3LAKA 3GIKA 4FXDA 1A5WA 4HVJA 3HJFA 4N56A 2RPIA 5J2GA 3RRHA 3O3HA 3C1ZA 4UB2A 2ZE2A 3H7IA 3M9NB 4Y1DA 1A76A 9ICNA 5SZTA 4RW6A 1BIUA 3NHGA 1YTAA 2BKEA 3MGHA 2W9AA 1TKZA 2BE2A 4KB1A 1BISA 4I27A 2DFHA 3MFIA 4LZDA 4FM0A 4Z6CA 5L1KA 3QE9Y 4TUQA 5DBCA 5DB8A 2I5JA 4GMJB 3OYGA 1ZQHA 2JZBA 3C94A 2AQ4A 5L9XA 4Z4IA 3ZSZA 2WONA 3AA2A 5KFUA 8ICWA 5DKWA 2A1JA 3V6JA 3MECA 4CJTA 1S0VA 3SJJA 1TK5A 5BOLA 1EKEA 4CGFA 2HHQA 1U47A 4QOZB 1C1AA 4CHYA 4FJLA 4YD1A 4QZIA 2MUTB 2BPGA 1ZQGA 4Q44A 4B9VA 3D45A 4ED1A 4W5TA 4B9UA 3QLHA 4M04A 3DOLA 1ZQFA 1T3NA 1S1WA 4M3RA 3RB3A 1QSSA 9ICSA 4ZTJA 4BE0A 4FK0A 3A2FA 4DWIA 4DOBA 4W5NA 2W9BB 2AGQA 2B21A 4BWMA 4CIGA 1H38A 4KLTA 4KHYA 3K75D 5KFXA 4MFCA 2W9MA 2V9WA 4FM1A 4GXIA 2AQ0A 9ICXA 4RUCA 4CFCA 5J2JA 4M2YA 4CJFA 1L3VA 7ICJA 3QEWA 4DTUA 4JV2A 3FFIA 2IDOA 3MEEA 4FO6A 5DQHA 4F2RA 3QIPA 3RJGA 2JGUA 3V1RA 3CM5A 4I2BA 4Z4CA 2XC9A 4RPXA 4KO0A 4IQUA 1IG9A 1CZ9A 3OYBA 1SL1A 2AJQA 3E01A 4F8RA 2UVWA 4F50A 8ICXA 1TV9A 3MDCA 3Q8MA 4F2SA 3LANA 4YVZA 4DTOA 9ICUA 1RPLA 5SWMA 2C2EA 3HM9A 9ICPA 3LPUA 3PW7A 1RT4A 4DEZA 3NFAA 3NTUA 4DTSA 4AHCA 1C0TA 4CCHA 1BL3A 1ZQPA 1S1XA 2ZQBA 3PVXA 3ZSOA 3OYDA 3FDSA 4PPXA 2OPRA 3JPQA 4L8RB 3CM6A 3MGIA 4Y1CA 5IIOA 4F4XA 3GILA 1J54A 3RAQA 2PXIA 4DSIA 3RMDA 7ICPA 3ZT1A 4YMMA 4TURA 1EP4A 2EX3A 1Z00B 1C1CA 2PI4A 1VK0A 5KFRA 4ED6A 4LZGA 4UAYA 1BPZA 5J0SA 4ZTFA 1ZQSA 3VQPA 1S97A 4CJPA 2A1SA 1Z3EB 4O3RA 4O9MA 1RDBA 3DM2A 2ZTEA 4KN4A 3JPSA 4CFDA 4RQ6A 1X9WA 3RJJA 2W9BA 9ICCA 3BQ2A 1JN3A 3KLEA 4PHDA 1O1WA 4J2AA 4Z4FA 2FMQA 1KFTA 1KVCA 2E6MA 1S1TA 4RQ5A 4I2FA 2DPJA 1D5AA 1RDAA 8ICLA 4JWMA 4EZ6A 1RBSA 3OJSA 4KTZA 2WOMA 4CEBA 5T7BA 4ECSA 5JS2A 1JX4A 3CFRA 1TV6A 1XSLA 7ICFA 1JXBA 4PH5A 4CF0A 1ZBHA 2X78A 3VN5A 4G3IA 2J6UA 1IM4A 2DY4A 4ED8A 1ZJNA 1Y97A 4BE2A 2G8UA 3T5JA 1KVBA 3JPTA 4FLWA 3PMNA 3AU2A 1EXQA 4YMNA 4BWJA 3RJFA 1XHZA 3OYKA 4CHNA 1ZQXA 3HVTA 3AVJA 8ICKA 4E89A 1ZQNA 1BGXT 2P6UA 3LDAA 4F5NA 4FJ7A 5KT4A 2QKKA 4HCCA 1V9PA 3AVMA 1ZBFA 2W9CA 1S6QA 2F96A 3NF8A 2IMWP 1JIHA 1QSYA 2B4JA 2DTUA 3ETLA 4CHOA 7ICEA 3Q8SB 4CF1A 3OYMA 5CB1A 2G8KA 3VQ4A 1BPYA 2JEIA 4J9NA 5KFGA 3V7KA 1HRHA 4HCBA 2Z1IA 3WNGA 1JLFA
chains in the Genus database with same CATH superfamily
4NLCA 2Y1JA 1YHQN 1KQSM 1TE2A 2WFBA 5MAOA 5B0GA 2AZ3A 3OTBA 4K8ZA 1U6FA 5F8GA 1ITPA 4EBEA 5AKZA 3CG7A 1S72N 3MMBA 1B9FA 3MEKA 3RF9A 4DZDA 3FR0A 3TO8A 1N0UA 2LFVA 4O3QA 1C0MA 1QDUB 2EC0A 2JL9A 4Y2KA 4Y2PA 4KFBB 1RWPB 4WXOA 1MWZA 2Z30B 2ZH8A 3N6MA 4XA5A 5BJRA 4ZN1A 3BYRA 3E9LA 5E2QA 4L73A 3FRYA 4LT6A 4FLUA 2IVYA 4PL8A 1QQ6A 2D5RA 4PQAA 1BPBA 3R5BA 2ZXHA 3QFWA 1K1QA 3I0SB 2Q3SA 1JCEA 3G4SS 1PCAA 4EELA 1SJ4P 2RN2A 1PC4A 3B4DA 3BO2A 3NRWA 1ZC6A 3UMBA 1FNMA 2P35A 1K8AT 1HIWA 4F72A 3KJNB 4M5KA 3FAHA 4CRXA 4OYOA 2Q2RA 4LVSA 2GO8A 3DCAA 3N6LA 3V9SA 3K5MA 2CQBA 1ZOTA 3T69A 7ICGA 1TKXB 5KFKA 2FHMA 1JNRB 1RYSA 2DFFA 1RAAB 3D0IE 1VBXA 1D4XA 1HHSA 2KJWA 2CH5A 4DV6J 2Y9UA 3UR0A 2VG7B 2OPSA 1HW9A 4N7TA 3EZWA 2FMPA 3JS9A 4US9A 1FO4A 2CXYA 1MU2B 4CJKA 1UMJA 3R9KA 3RSEB 5AK6A 1DQ9A 4DV5F 4KX5A 9ICTA 1M1GA 2KVIA 1CC7A 1S7HA 4KI4A 2RE2A 2QKQA 3KNAA 4KAIA 4EIAA 2NXUA 1GX5A 3MOJB 3EZ5A 1LFPA 1PGZA 3FLCO 2KK0A 5AJ3J 1J5EJ 3ZTSA 1C7YA 1XNRJ 5IIKA 1VQ5S 5ETPA 2LM4A 3FUYA 1QHTA 2QL9B 4JI7F 4WFZA 3FVYA 3LP0A 3WX4A 4USIA 2QWLA 2H3QA 5J2PA 1B43A 3ETOA 1HQUB 1W7AA 1E6VA 1VLOA 1YJRA 1CULB 2J9EA 3H59A 3BO3A 1EWQA 4DV4J 5KPZA 5I42A 3AB2B 1FRHA 3D66A 4OHVA 1URJA 4DV1J 4A8EA 4AM6A 1Q0NA 4BACA 1FK9B 3L5KA 1B0PA 1XR7A 1ZH5A 3W7BA 5IT9Y 3NDKA 5BREA 3R27A 4LF7J 2UV8A 1M5VC 1I6JA 2DNQA 5IWAF 3VAKA 2WF8A 3G6ES 3SSSA 5HLFA 1HEKA 3CVKA 3LGMA 3HJEA 3I87A 3AAPA 3EGVA 1VDVA 1BIZA 1OPIA 4USMA 1JRPA 2G0CA 1IR1A 3KLHB 2AJ4A 2MJUA 4J9LA 2FYXA 3Q8UA 3H40A 1HKGA 2IA6A 5AZJA 2K7JA 2Z2ZA 5A76A 2JLGA 1TAUA 1XC3A 1RTIA 5IIJA 1TUGB 2E8NA 3ZZ0A 2B6GA 2R4FA 4HYKA 5B66U 5B5EU 3EXCX 4DI6A 5GMKa 1GTHA 2WVCA 4OX7A 5A8WB 4IO9Q 4L74A 2KL8A 4RU2A 1HFEL 3ISNC 4YDUC 1D9DA 1EARA 2E7VA 2RILA 2BKPA 3TARA 4JI0J 1JQGA 1FA0A 4NA1A 3S8SA 2KIVA 1KTVA 2XMTA 1RYUA 2BOAA 4NEZA 4Q45A 2LEBA 5TZVA 3MMVA 4ED2A 3C65A 3PSPA 3KK3B 3PJWA 4GVBA 1QAYA 3WNFA 2VONA 2E6LA 4NLOA 2YTCA 4WPAA 2XBPA 3NVYA 1WHVA 2RSQA 1NK5A 5G0RA 5IT9U 1F6TA 2H5EA 3PYGA 4A8QA 1S9EA 1Y00A 2LEAA 2AT1B 1NSAA 4NLPA 9ICOA 4LBHA 4YB7A 4C4WA 4FWKA 1GOBA 1GMVA 4P0QA 3MFHA 5HP4A 1R0AB 2UU9J 1Q9YA 4LF5F 4LSNA 3L2WA 2FDRA 4RQ4A 3AH6A 1MQ3A 1IH7A 3BY5A 1U04A 1VOMA 4E1JA 4KHNA 4KLLA 3C8YA 3MI7X 1Q82T 1S0MA 3ZSYA 5CCMA 5ALFA 2IYGA 4QZBA 4W5RA 3OD2A 1AYEA 2EQYA 3DOKA 1KQKA 3GYGA 1BQMA 3AVBA 4Q5VA 4PZNA 2YV0X 3ADAC 2JOQA 1CJVA 1T6DA 3OTDA 3D9BA 2C2KB 2GELA 3N7RC 1U1KA 2C2MB 1EX4A 5AQQA 2JWLA 3KZIU 4KB7A 3NH2A 4DBQA 1T9TA 3NGRA 2FJEB 1KVJA 4KPCA 1XK8A 2CWXA 4NLTA 1RZTA 1Y3KA 3VETA 5AQGA 1QUPA 4KMOB 3I5BA 1MN7A 4FN5A 5EWEA 3FZ2A 3QT6A 5KT2A 5AICA 4J90A 4CF8A 3L2QA 1RE1B 2P6TA 1D8YA 2ZWOA 3MPDA 3EVOA 1UAXA 3EZOA 4IYQA 2WC9A 1SQGA 4IFVA 4K5RA 3ENQA 1RDUA 1YZ6A 4EHUA 3I5CA 4RKUC 4M41A 1P8ZA 3CULA 4BRKA 3IWNC 2FPLA 2I9GA 2BE9B 2FC0A 3KDOA 4B3OB 2KHQA 3JQKA 5ADZA 3TZYA 2PFOA 4KI6A 1X5SA 3DU5A 4P2MA 4EEYA 4ISEA 3D1OA 3AMZA 2CQDA 2P6SA 2WB1C 2PFQA 5AE2A 1HBOA 3GIJA 2DGWA 5LMUF 3M6KA 2QMXA 3QEXA 1FRLA 1RXOB 1VQLS 4FXWA 2QTWA 3AO1A 4KYZA 4C8KA 1RT3B 2RQMA 3IG8A 4X4TA 3CCVS 3HVWA 2P9NB 2FVCA 2IBKA 2UUBK 4J8FA 4I28A 1TZ0A 4UTGA 2XSJA 3R3TA 2HRUA 3JYTA 4ZP6A 1DTTA 3RBEA 2Q66A 3L6QA 2MDAA 2VANA 3SCXA 1HQEA 2QXLA 4DO9A 4M8LA 4IFEA 3CQXA 3S7RA 2KFYA 3HT0A 2Q97A 3R3LA 5KRSA 1WAJA 5CZVA 3B9JA 4LF4F 4ETZA 4C6AA 4EZ9A 4QCLA 2QWOA 3D28A 4ZVOB 2IBOA 5ALRA 2XMUA 5AXNA 3A5MC 2P5OA 4PKIA 2R7RA 1VBYA 2D0AA 5F0UA 1T05A 4HEA9 1MA9B 1FE4A 3TEHB 4Q8FA 3GG4A 1RBLA 2WBRA 1K47A 1QM9A 2ZUBA 1NBEB 3BZQA 3TQEA 4LF6J 5F8NA 2J76E 2H3ZA 3NCPA 3QUBA 1HPZB 4DX6A 4KRFA 1WG5A 4IOCL 5AQHA 3OYNA 2ZC3A 1BVSA 1J27A 3ENHA 3TAGA 3BF3A 4ES1A 4DOZA 3I0RB 2J5AA 4N8OA 4JV5K 1ZQBA 3QERA 1S48A 1T7PA 1VFJA 5ETRA 2XICA 4F9OA 3H0PA 2QARA 3TTDA 3SQ2A 1KR4A 3WZ0A 5TKYA 2X1BA 1QE1B 4OYMA 1LWFB 3C3LA 5TISU 3ITHB 2LMIA 4ZPAA 2XY7A 3RH6A 3QMQA 3PIPL 1WNEA 3LGNA 3BP8A 4JK8A 4I29A 1RTZA 3OPXA 3RW7A 1U1MA 5CQGA 1JJ4A 4JRQA 4M3XA 5J2FA 2BANA 2OEHA 1KVAA 4CHZA 4Q8EA 2BEFA 5FDLB 5K14B 4GMKA 2B9YA 4M3ZA 1R6VA 3A8JA 3O0FA 1N33K 2IVMA 1BPEA 4JHDA 1RT7A 5AKXA 1VLYA 5BPMA 4O4GA 2L5YA 1KOOA 4KJIA 3ID6A 3DXSX 4QR0A 3TPQA 4I2EA 1YT3A 2WVEA 4Q0BA 2FSKA 5BN8A 5AK3A 4DTJA 3LM9A 1SXDA 2YWEA 4LQ3A 1V4TA 3W8PA 2HF3A 2IJFA 2G2ZA 3MX2A 2H3GX 1HYVA 3JQMA 5AZIB 3A8YA 4CEAA 3MBYA 3KJQB 2R42A 3W9JA 4AXJA 3H90A 4PZOA 3D1HA 5GADP 1RHUB 3TZWA 2G8WA 1RT6A 4DV2J 2CPRA 4QZ8A 2VPZB 3GFHA 1S76D 1TL3B 2HSTA 1ZQMA 3S3MA 2WF6A 1KWMA 2O3DA 3V9ZA 3UIQA 2X1FA 2M3DA 2DXFA 4ANEA 2JJ4D 2F63A 2HHUA 2ALYB 1KD1O 2GO7A 3U3YA 1R27B 1TVAA 4K25A 3UI3A 3L2UA 4O5CA 5C12A 4IZ9A 4BRLA 5J2IA 5CRXA 3FK4A 1ZQKA 4BDYA 4OZ1A 2Q0UA 1UW4A 5AQJA 5J2DA 1ECWA 4Y2UA 2ZEJA 2UXBK 1D09B 4N8NA 3ISBA 3HKZC 5AT1B 5HSPA 4H0YB 3PR4A 4J37A 3MUVP 5E3AA 1N4LA 5AXMA 1Q8KA 4UW2A 1RXVA 1GNKA 3EXYA 1BE4A 4RQ2A 3VA0A 1W9HA 4YOYA 3LGHA 3D68A 2Z1HA 3UN3A 4CF2A 4AYBC 1GLDG 4TKTA 1KCFA 1VQ8N 2BKOA 1YJNN 1VRUA 5AQZA 4FZNA 5LL6Z 3UR3C 1NOZA 2ITMA 1RWMB 3S6EA 4X4SA 3RUBL 1WCNA 3RAXA 1Z25A 4ECVA 4E3SA 4DL7A 4PKHA 4DG1B 5C5JA 1RU1A 2GMLA 3A4TA 3MMAB 1HLUA 4O5BA 2HBJA 3D54A 3WKBA 4ZVTB 3ZZRA 2KZ3A 4CK2A 1IXRA 1X3NA 4JK7A 2AYMA 1ZQJA 4F71A 4V1Ak 1BUXA 3T6JA 2W7OA 3ZCMA 1QAJA 1RUSA 1HNXF 1HUOA 4NWBA 2K8CB 2NRTA 3KOOA 3MAQA 1VISA 3IAYA 1IBLJ 4A5BA 1DGKN 4JI2K 2PFNA 1S12A 2FHJA 2V8GA 3VEVA 3IXQA 4M6WB 4O3SA 1RGVA 1SXLA 5F8MA 2FB0A 1N34K 2HBYB 3VGSA 4CTAA 5J0QA 5J29A 4YNQA 2UXDK 4TQRA 2DL0A 4US8A 4DCPB 4DR1K 2A1BA 4DQSA 2KSOB 3BDEA 1S0OA 1NNLA 4DQ8A 3V72A 1N6QA 1B64A 4KFBA 4K41A 4C98A 4IQXA 1LWCB 2UUBJ 2J8AA 2GWSA 1BA0A 2NYIA 5I3UA 2E1PA 4I1TA 5HMXA 4KX3A 3P83D 2O4IA 1UFKA 4URSA 2MZ1A 3CJ2A 3KD3A 1NGCA 4GC7A 2VFVA 1H73A 1XO0A 4AHSA 2DBBA 3I0SA 2P9CA 3MX5A 2VFUA 3N5BA 4Q2MA 3RW6A 2W1BA 1FX4A 2P9UB 1C0FA 4G9ZA 2BQUA 2E1MC 1NK4A 4LH5A 1C0UB 1UPMB 3PXGa 2ADCA 1WSFA 2H54B 5DB6A 2ZH7A 5AM5A 3E0FA 4OI6A 3QMLA 1TKXA 5HROA 4OPAA 4O5KA 3CJ4A 3CCUN 3O6QA 5HRRA 2YY6A 4AXIA 2AHOB 4YDXA 5ETSA 3R6GB 4CF5A 5AI5A 1FFUA 2GQQA 4RBVA 5IC6B 1RT5B 2HFSA 1OY8A 4FBUA 4USKA 3RYLA 3TA2A 4OZNA 2EAOA 1MU2A 2IMOA 1V4SA 3C5FA 5HQ8A 1NCLA 2NPFA 4BX9C 1YWXA 3RSEA 1Z6RA 3DLGB 2VF3A 4LD0A 4KN7A 3CCMS 5L39A 3CFOA 4WKRA 3QUTA 3N97B 2R7SA 1XC9A 2HNDB 3PX4A 2GIFA 4LBIA 5AXLA 4ECQA 1NHKL 5B0DA 3KHYA 5C0YA 2VDIA 4PWDB 1WORA 5LXRA 4DCHA 1RHJB 3B6BA 1H2VZ 4OHYA 5ALGA 4GC6A 2CNKB 3F73A 3AODA 2ZWHA 1NK7A 3ZO7A 1RTJA 4ZOHC 2E8AA 3TSPA 2RRDA 1RB0A 3B82A 2AF6A 2WVFA 3M8QB 1N33J 1CULA 5AI0A 1TK8A 2BUPA 3MAHA 3MEEB 3WX8A 1GXTA 2KI2A 3ZYYX 4E98A 3UMCA 3GJTB 4JK9A 3SZ2A 4GXKA 3OL9A 4UZBA 4E7KA 1FK9A 5GADI 3UNYA 2IVPA 4U6PA 4YXJA 2YXLA 4DV0K 3VEZA 1HPMA 4OKJA 1SCJB 1Z4NA 2UP1A 1SH2A 5CH7B 3BPDA 1RTDA 1B92A 4QIFA 3K5NA 2FVQA 1R8CA 2HHHK 3SDEA 2EANA 2BDPA 3W60A 4IH5A 4H5VA 2QYGA 1H3DA 1JJCB 5DBAA 2OFGX 3QEBZ 3U9ZA 2UYTA 2F3JA 4QBUA 3TVZA 4DQQA 2QLXA 3J7YP 2B9WA 3ORYA 1LVHA 5A8WA 4UUXA 1RA6A 4O0IA 3KKAC 1C1CB 4DUZF 4USJC 1X4CA 2PT0A 4ICLB 3H08A 2HBMA 3ENAA 3FZMA 1U02A 4CJWA 3LA0A 4DQRA 2XGQA 1P9YA 4EAHD 1NJIT 1TKTA 3T5LA 3KK3A 5F3ZA 3OSPA 2WW8A 1QVFM 4NRUA 1Y7PA 3EPIA 3CCQN 3QU5A 4F4ZA 2XB2D 4QZ9A 2MQOA 5J2NA 4NYPA 5FPMA 5BXIA 4QPTA 3OYCA 3VGUA 3SR6A 1XQIA 1RAIB 4OHZA 2M88A 3EGZA 1R0AA 4BG9A 4TQSA 9ICMA 4CDGA 1G15A 1NEEA 3MGJA 4B6JA 4K8XA 2HQ3A 4ILHA 3QAEA 3U02A 8RUCA 3EJMA 2B4VA 4CQ1A 4NRTA 3I9V9 2W54A 3E66A 3VTIA 3BZKA 5KNIA 1W2IA 1JUDA 8ICCA 2AP6A 3MWPA 4OV6A 4J9RA 2NXJA 4H5NA 1NB7A 4M95A 3FKBA 3B54A 1RAFB 2AEMA 8ICAA 5DG8A 1LKYA 1LNQA 2U1AA 3T1YK 4BR0A 4UBCA 4F7VA 3TR5A 1YJVA 3M32A 4M94A 4LRCA 1FRJA 4IL6U 1NGIA 2JEGA 3D1QA 3F2KA 3HT3A 3BN7A 4CIFA 5GAHU 2DXDA 4LQ9A 4NXMK 2RHQB 1CZBA 4ZVPB 1N5YB 2O01C 1RSCA 1RI7A 1TK0A 4FCYA 3S3NA 3CCEN 3GZ7A 1VQPN 3CW2C 4L6V3 3GU3A 1BG3A 4YN4A 4B08A 4M9NA 2NRXA 4BRGA 3VA3A 4RBTA 3PY8A 3FFKB 1EXNA 2YX7A 1ZQVA 4JNEA 3PLAA 4B3OA 4FYXB 5AK4A 2E1RA 1MC8A 4IQTA 1SAZA 4QJVA 3VGKA 2A0FB 4JK1A 3EYZA 2HGLA 3ULHA 2NZ4A 2HI0A 4EBCA 3DRSB 5I4MA 3MTJA 5KG6A 3V2UC 4R0EA 2B8QA 1QTMA 1NU0A 2HQIA 3L7OA 4QR2A 4LFAK 4JI8K 2LQ9A 3GCXP 1LEOA 4M3UA 3G9CA 5AQOA 1U8SA 4I2PB 2GX9A 2P9NA 2HURA 4PWUA 4R64A 5JUMA 3MEDB 4FJMA 4KHQA 3PV8A 2ZJ8A 5KL1B 5J0WA 4NM1A 3KFUF 5KFHA 5E3RA 3I9ZA 3PACA 2AD9A 1K8KA 3GV8B 2ZH5A 5J0RA 1GQEA 2BV3A 3F53A 1NJZA 2HBKA 4DKWA 5RUBA 2QC3A 1KFSA 4OJHA 4MAKA 2VKRA 3E1YA 2LM1A 2KEYA 5F8JA 3SAGA 4Y2RA 2L9WA 4M9GA 1FKPB 3N4WA 2KYXA 1TMMA 4FWLA 5DDQC 2W2NP 3FBCA 2WSCC 3I76A 2VQEK 3JSMA 2CJYB 3HJVA 3CJBA 4M42A 4X4PA 5KTQA 3UDLA 3LAMA 2IC3B 4C97A 1VGYA 1NOYA 2C1EB 4FJJA 3ZT4A 5AFUA 2QLBB 2OPQA 4QWCA 3I82A 5DK5A 3D2FB 2PAVA 3ALYA 1RT1A 2L48A 1F2GA 2AJFE 1BDGA 4FYDA 4CJUA 3O9RA 2B5JB 3AGRA 1HMVB 1JLGA 2A2DA 2G0IA 1QE1A 1DT9A 2PI5A 3KK2A 2BQRA 1JLBB 4CO0A 3ITHA 3PW4A 1S10A 1CJTB 4DTXA 5HRNA 1ZBLA 2G06A 1J9AA 4CD3A 2ITGA 4DMZA 1M5SA 1PK1B 4DSJA 2BJ1A 1WSGA 4R65A 2YX4A 3HRGA 3L3FX 5AQWA 4I7FA 4DV0J 5FDLA 5HQLA 3KJFB 5K14A 1A77A 4ZCLA 3BF4A 3J7YI 1OSCA 2EPIA 2YHWA 1U09A 2G8HA 1WSVA 3C6UB 2HHHJ 2B7BB 4X64F 1ZQWA 3ILOA 3D6JA 2HBRB 1YJWN 2BBEA 2E3TA 3CSKA 4PEOA 2F2AB 2XI9A 2IIHA 1SH3A 3DRYA 3TAMA 1B0VA 3CE8A 4ZVSB 5AKGA 3HOTA 1EQYA 1DXSA 4B1VA 5AZIA 2JLEA 3OTOK 3MABA 1Z05A 2KFNA 3UDCA 2F44A 2IJRA 3SCIE 1HWLA 1KOHA 2DITA 5B0AA 1R89A 2VQFK 2VICA 3H4DA 2FLNA 2A3JA 1V6HA 1E4GT 2OLWA 1WKKA 7ICQA 2ASLA 4XDDA 4M5MA 3MURP 4XH5A 5AQXA 3M8YA 5GAGP 4DV5K 3WXLA 3PRDA 2K60A 1Z19A 5D4NA 2QMWA 1WC3A 2MJNA 2XO7A 4KSEB 1TL7B 3LP1A 4M3TA 2CPXA 3NOCA 4WQ5A 3QB0A 4L75A 1HNIB 3ONNA 3MUMP 2O6KA 3C19A 3DLKB 2HHPA 3B6PA 4JI5J 1VSKA 4E8UA 3KZXA 3TADC 4HVZA 5LSRA 5ADXA 3H5XA 8ICQA 4P4OA 4JI7K 4CM0A 1TU0B 9ICWA 3NAEA 3TKAA 4GKJF 3R2CJ 2YB1A 1IJEB 4PGYA 1LQ9A 1N8RO 3FEYB 6FD1A 4CNQA 4RQ1A 1R0CB 5FIIA 2AH5A 5J2QA 4YXMA 2DGOA 4YOEA 2FSJA 5AIAA 1PSDA 3SUNA 1MW7A 3CD0A 2NRWA 2RDDA 2K8BB 3HSDA 4PAAA 7ICLA 3SXLA 1HNZJ 4K4SA 4HR2A 4P74A 3EE9A 3QU4A 1S6PA 2FPKA 2CQCA 4OZLA 2BXJA 1YI2N 1CEZA 2I5JB 1XMQJ 1UJ5A 1RGIA 4FWPA 4X4UA 3DXMA 4AHTA 4CFAA 4AQYF 5JMVA 5KFOA 3I55N 2FVSA 3NGIA 3TTCA 5HRPA 3AO3A 2YN4A 3G8SA 1DAXA 5H9FK 4QIWD 3JSYA 2B0CA 3Q8RB 2QN6B 1X9XA 1FJCA 2G09A 1VQNN 1X4DA 1JJ2M 3RJKA 1N5XA 1WHYA 3W1YC 3CC4S 1K9MT 3R5CA 4JKDA 1FDDA 5HR6A 4QZEA 3VMFB 1OS5A 4UATA 4FDFA 3Q8KA 2YNGA 2XS2A 1CZAN 4M6WA 1T44A 1ZQ1C 4ISFA 3MXHP 4XIUA 1DEJA 3SEIA 5H9EK 3PNCA 4DR7F 2P9KB 3EN9A 1S59A 1XERA 3QSIA 4CHQA 5EY4A 4DR6J 2KSOA 1H7WA 1RCOB 2CAJA 3Q22A 3O3FA 4A59A 4KLGA 4N5SA 5HNKA 2BZFA 1ZYQA 5CHGA 5L46A 4LF8K 4DTRA 3R1HA 4GY2B 1LWCA 5EN1A 4M63A 4NY8A 4DUYF 4LF5K 2NRZA 3WKEA 2E2OA 7ICTA 3GIKA 5HMYA 4HVJA 2RPIA 2KXFA 5J2GA 3RRHA 4JKHA 3O3HA 4WF9Q 4CF3A 1Q78A 5ALWA 4IEEA 2CPHA 3RBZA 2OXOA 1O13A 3MM6B 3EDRB 1JCFA 1ELOA 1BIUA 3AHPA 3E01B 1X5OA 1EJ7L 1MG7A 2VODA 4WP8A 5AXKA 2DIVA 2RP5A 1B7YB 1FRMA 1VQKS 2BYCA 4WFXA 4YY3J 2JZBA 2VIXA 3O80A 2AQ4A 4Z4IA 2LU1A 1PVRA 3VF4A 3SFGA 2OPRB 2A1JA 3V6JA 4DPXA 3MECA 1O5JA 1TK5A 3NCQA 3PYDA 2Q43A 3TA0A 2R7WA 2MGZA 1W2BR 1ZXIA 4QZIA 2BPGA 1E4FT 5DM6L 1ZQGA 3UVJA 3SCKE 3AQOA 2M52A 3DNCA 3BKTA 4DR5J 3T1HK 4BRCA 2KH9A 4ILMA 4JKFA 4X65K 2V2KA 3RB3A 3NGUA 1J97A 2Z57B 4UB6U 4ANCA 5FJ4A 4LSZB 4DWIA 3FSYA 3CCJS 5GTIU 1SI9A 1KP6A 1ZA2B 1PO6A 4Y00A 1MLAA 2ZDOA 3KLEB 1MWMA 3H0RB 2M5YA 2HVDA 5LMUK 4U7UK 2N82B 4DV6F 1S1TB 1GXUA 1VBKA 4L76A 2GHPA 1NMNA 6AT1B 2PA8D 2D3DA 5AQLA 2HLUA 2R7OA 2IDOA 3NS5A 3MEEA 3F2CA 4F2RA 3PYFA 3V1RA 2QTDA 2AX0A 2I5HA 1NZAA 1SL1A 4FOEA 2WHEA 5AJ3F 1J5EF 3QFPA 3MUTP 1IJFB 2RQ5A 3CJ0A 1TV9A 4CBXA 1VQMN 2VD3A 5L38A 2BVZA 1XNRF 3L4IA 2Q79A 2UUCJ 3K89A 3PSFA 3MM8A 3THTA 3NFAA 3OTOJ 5T14A 1R8PA 5GAGI 2ZWPA 4AHCA 3CF5L 2E1CA 5GMEA 1XQSC 3MN5A 4V19X 2HBLA 4C1NI 3FDSA 4PPXA 2VQFJ 4RL1A 4DV4F 5M2PA 3MGIA 2HIQA 3J7A1 5IIOA 4F4XA 1J54A 3MM7B 1GH8A 1HIYA 3DRXA 4DV1F 2PXIA 2MZQA 3GJRB 3ZT1A 1U2CA 4PYAA 1NO8A 4LJMA 1Z00B 1C1CA 5C2GA 5J0SA 2VWBA 5DO2A 4LF7F 3HF5A 1T6CA 3EE3A 1S97A 4DFDA 2A1SA 2CIMA 2H3FA 4UW9A 3DM2A 1RHRB 2KU7A 2GA7A 2XSFA 2V8PA 4KN4A 3JPSA 4RWTA 2DVIA 4IG3B 3IRXB 1N54B 1HNWK 3BQ2A 4AL7A 1UWBB 1WBDA 2W55A 1W7WA 4DPTA 5IV3A 4LVOP 5D78A 3D3CJ 1O1WA 3QO9B 1L8OA 4Z4FA 2FMQA 1WSRA 1F3FA 1BUPA 1PVQA 2DGXA 1RM6C 4YOUA 1GT8A 3C16B 4FPRA 2DHAA 2NQPA 2DPJA 1BNOA 5HR7A 3IWXA 4R5PB 3MM5B 3OJSA 1FRIA 4JI0F 2RH3A 3NOGA 3K1RB 4HLBA 3K5PA 4ECSA 3IC1A 3KOAA 1FVQA 4CLKA 1OW5A 1WC6A 1JX4A 2KKPA 3CFRA 5CYQB 3NVVA 4PH5A 4FYYB 4NCGB 4P10A 3J80U 2VFRA 1FWPA 1HWJA 3GIRA 1L8LA 1Y97A 4BE2A 3G8TA 2FHKA 2HOQA 4ZK7M 2RE1A 2EW9A 4TU7A 2KG1A 2G8UA 2JSXA 1HWUA 3T5JA 1KVBA 3JPTA 4MK8A 3PMNA 4YMNA 2Y1RI 3OYKA 3HDSA 4JB8B 2H1YA 1ZQXA 2CN1A 2UU9F 2FY8A 1Q46A 1FE0A 3WXMB 2Q1LA 1ZQNA 1BGXT 2P6UA 4KE5A 2WBNA 2DGZA 4FJ7A 1CS4A 3MPYA 2QO3A 3J81Y 3IS9B 1OVYA 1ZBFA 3QBWA 4Y2JA 4RW8B 4Y2AA 1T3QA 2HFVA 2QLJB 2QX0A 5BR8K 3D2EB 2YWKA 2DTUA 4CHOA 3VCBA 7ICEA 4CF1A 5CB1A 4J9NA 1REGX 3V7KA 3QWPA 3MCPA 2WBMA 4ID5B 4HCBA 2K8GA 3WNGA 2LXIA 5ALNA 3WK7A 5DS7A 4X4QA 3U3GA 5HMZA 3R97A 4LF8J 4EO6A 3QFHA 4IG0B 2H5XA 3AARA 1B4FA 3KKFA 1X9SA 2Y9TA 4ZCMA 4PKGA 1HBMA 2GAHC 4LY7A 1TYQA 9ICJA 3O8WA 3US5A 3P4IA 2F9DA 2L9DA 4J5OA 4RW7B 1VSLA 1KTQA 1Q53A 5AQVA 4LF2A 4BROA 1TAQA 1R8BA 4I2PA 4P4PA 4J9QA 3IAM9 4JI4J 1QZ5A 3BV8A 4RQ3A 2HNZB 4I67A 1XN9A 1GLJO 2KJVA 3MEDA 2MEWA 3I31A 3M2RA 1C20A 4BC7A 3FCWA 2A3ZA 4H0TB 4OKKA 7FD1A 2J7WA 4B8CA 4URGA 2KHDA 5IT0A 2VWKA 3TR8A 4DS4A 2JNJA 2ABYA 3ZT3A 4MEXA 1WOPA 2N4DA 4DV3K 3G6VA 1C4CA 2OTJS 4OD0A 1QQNA 1NDKA 3IM8A 3VQTA 3PKMA 4DHYA 1NK6A 3SPYA 2OZMA 3HFZB 4WCEQ 3NVKA 4HUGA 5ALQA 1FXRA 4CRJA 2FBXA 2HB5A 1T8EA 1BHNA 4UB3A 4B3TJ 3AO2A 2FSNA 4WJ3B 1JMTA 4H03B 5J8YA 2C28A 5ALEA 5DDYA 4CK3A 3BJYA 5DRKA 1WOQA 4IKFA 1DARA 2PKEA 4BC2A 1L3UA 2P51A 3JAMY 3T1HJ 1X9JA 2C22A 2WZ1A 2W41A 5IT9O 2YX1A 1GO3F 1Q5YA 2CG4A 3WKCA 4X65J 1DQ8A 3MPUB 3MN7A 1K8AO 1JLAA 3ULEB 1U26A 1FVSA 4NLDA 4E0DA 4NYFA 3DLHA 3QT7A 1BC6A 3ZD8A 3D2FA 3CCLS 4KGXB 5HJXA 3BUZB 4LRDA 5ALZA 4CEQA 4GVMA 4K4TA 1BQNB 2O8FB 1L7NA 7ICMA 4TSXA 4NLUA 2B5JA 1AUSL 4DX8H 3GP9A 3CETA 4NLXA 1ASUA 3DDIA 2W24A 5CY4A 5FLXU 1JLBA 4I2CA 1F0MA 1LW2B 4BGBA 4HHHA 2W01A 4LF6F 3THXB 2KVQE 5J1PA 2GUIA 4GRSA 4FJ9A 1PK1A 2B0GA 4YFUA 2KV2A 2ASDA 1Z2ZA 3ENVA 3AA9A 1T02A 2RUSA 2GIRA 3TFSA 3BSOA 1RQ0A 2R8HA 4OGCA 1H2TZ 2F8LA 2OD6A 5CYMA 5FRMA 5J0PA 3R7NB 2LYHA 4CJLA 3JAMU 4EENA 2D74B 5EE9A 3C6UA 2W7AA 2QWMA 2JRZA 1N0VC 4NL9C 4UB1A 2XI2A 1SJFA 3TWHA 3E58A 3SI6A 3HHLA 1NZ8A 3ZD9A 1FJGK 1KW4A 5A8KA 2Y8WA 3R5JB 2J9CA 3DMJB 4WP3A 3W8GA 1KFDA 1OWXA 4X2BA 3OJUA 1B22A 4BR7A 1X0FA 4K4XA 1IKXA 1RAEB 5KQ8A 2NUUG 2J0XA 3UKRB 2CADA 3F5EA 1RHQB 4YHHK 1UT8A 3C2MA 2DRDA 2AEJA 2FVRA 2EZZA 2LQ8A 2OD4A 3KLGA 3PW2A 2DJWA 1RKJA 2BRLA 2M0NA 2F7TA 3OL6A 3QICA 2JH1A 2E1EA 2HVZA 1HUXA 1QUVA 3S1TA 3LZJA 1WAFA 4JYAK 7AT1B 1DTQB 1HNWJ 2GVZB 4ECRA 4PL7A 2O8BA 5FRNA 1F0XA 4JS4A 5ETNA 2G0AA 2KKVA 1TL7A 3QGHA 2E8PA 2IOFK 2LKYA 2Z4PA 1HNIA 1CJKA 2ZH1A 1JJHA 1Y10A 2EAMA 2BDUA 1T0TV 1SKSA 3DLKA 1NPPA 2CKWA 2P8IA 4AT1B 3LDQA 4CNZA 4QIEA 3V81B 4ZCIA 5CD4A 3NP5A 3M7DA 2A6MA 3CC7S 3FZLA 2FBYA 5D0GA 4BRPA 1GMWA 2K89A 3OY9A 4CBUA 2B4OA 4BC5A 2XCPA 1HD1A 4JRPA 3AY9A 2FUG9 4JV1A 2A40A 1CI4A 2MY8A 3GDQA 3POTA 4Z4HA 3T41A 3ID8A 8ATCB 7ICRA 4BJQA 4I6YA 3EUNA 3AA4A 5DLFA 2GMJA 1FFGB 1YBAA 3QYPA 4NWIA 2FLLA 3MCNA 4G1QA 4FLVA 3IG1B 1GLEG 1UOCA 3H5SA 4EX6A 5F41A 5GADU 2WB1F 3BBBA 3TZXA 3SQIA 3CDEA 1ZJMA 3A8IA 4E7IA 4ZVGA 2K2PA 1X8DA 4W98A 3M9MB 1Q82O 3BS9A 4F3MA 1RAJA 1RBVA 4DUTA 1R43A 1X66A 2DNGA 5KL8B 4F93B 3E9OA 3VF0B 1NGFA 5BR8J 1NGGA 4WYBA 1Q16B 2KM8C 4S0MA 3PRVA 1HWKA 4CYUB 3HILA 1X31C 4DUZK 8ICGA 1ZOLA 2EZYA 3THPA 4RW9A 3LWMA 3NS6A 4OYBA 2BTFA 4HL9A 3M2UB 4Y34A 1SS6A 2JFDA 4KKOB 4RPFA 1JLQB 5A6WA 2JEJA 3UFCX 3ZSXA 1YRUA 4H54A 3UW1A 1EX8A 4TU8A 1SQKA 4ZLNA 2BH1A 2UUWA 4NLWA 4MIAA 2P9KA 2A1AA 4L3KA 3M05A 3WXIA 2KRRA 3IBFB 2DNHA 2WW4A 3UKUB 4QZHA 3ZZYA 4O3OA 5H1SQ 5KOXA 2NSCA 3HO1A 3RRKA 4CF9A 3LK9A 2FJVA 2M70A 5E3QA 2I1QA 3IFRA 1IBLF 4JEPA 4HI1A 1IR0A 1CUKA 4NE9C 2BACA 3A8KA 3FCVA 2HGMA 2OZSA 4DV3J 4HTLA 4FLXA 1XO1A 4OCZA 3GMGA 2QJ3A 4XK8C 2P9SB 1VS3A 2D3UA 3OFHA 3ZTQA 2BHNA 3AA3A 1Q95G 2DNMA 1GFWB 4M9JA 1NSQA 3FRZA 3LDNA 1VQ5N 2HAFA 3MDQA 1S6OA 2DR8A 4LSLA 4B3MK 3LP3A 4J2EA 2PC6A 2BJDA 2VG6B 2R7YA 4WQ4C 3BF1A 3O9TA 2BJ7A 2UUBF 1NWKA 3CB4A 2ZITA 3GIMA 1NK8A 3W63A 3O8MA 2E88A 4BXOB 2BW7A 2XO6A 4F26A 5B7WA 3T5HA 5K5MA 4LIWA 1IBMJ 4B1YB 1NSPA 1H2UX 3PM9A 3TAFA 2OAUA 1ZBTA 2D41A 1WC1A 7ICHA 3Q7BA 2RF2B 2ZD1A 4BRIA 5C10A 2XY8A 3HZGA 4CFBA 4QIWC 3H6EA 2EH9A 5CHCB 4DU1A 4MO5A 3K9JA 3ZDCA 2BGGA 3G6EN 3WU2U 3I6PA 5HANA 2LYAA 1IWAA 3I96A 3EKUA 3CCZA 3TAEA 3KDNA 5DZ7A 3L7UA 1FHTA 3EKSA 5IV4A 3R8EA 1SIZA 2LXUA 4Z6DA 3O4WA 5AQRA 2HS3A 3ILLA 3BS5B 1Y3JA 2CQ0A 2Z8QA 1YKWA 4NM2A 4F5PA 3OTEA 2DNZA 2A5XA 4P6QA 2KHVA 2GQ2A 2MAXA 2DPNA 1VYAA 3HFKA 3MEGB 3N9UC 2F4FA 3LQVA 4RTFD 1DK2A 1ACMB 4CLLA 3LDPA 7ICSA 2DCLA 4K59A 1SUQB 5D4PA 1UWAA 3DI6B 3ISZA 4PHAA 5KFFA 1HWIA 2J9DA 3IP4B 4ER8A 3L9ZA 4MJKA 4A8OA 3BSAA 1NRKA 2O8CB 2KMDA 4IR1A 3KD5E 1Q1KA 1TL5A 4OQJA 2Q0RA 1FJGJ 1BU6O 1CJUA 1VHXA 4JKGA 3V4MA 1SJ3P 2CJXB 5KAKA 3K57A 1G4CA 2C2OB 3W3DA 3AAQA 3IO1A 2MKIA 3NVWA 1A0OB 4NI2B 2ZH2A 2IA0A 3WNEA 3L4PA 3CYMA 1WTFA 2ZZTA 4UBBA 4FWQA 4I2AA 2QLTA 4NLQA 3J8AA 1WC5A 2D1CA 4YHHJ 8ICVA 1N33F 4I6MB 1WI6A 3Q8LA 2DXEA 2GHVC 1QD1A 3MM7A 2CH6A 5ALUA 2MKHA 3B6OA 1JL1A 3HZ6A 4MIWA 2ATQA 2MSTA 1Z00A 3AL0B 2L9NA 1FD2A 2QEXS 3NAHA 3PCOB 4M5NA 3W2WA 4JYAJ 3CT9A 3DRRA 2VBWA 3FEZA 5KG1A 2HBZB 4I6WA 1S1UB 3AU6A 3P5BP 1IKWB 1LW0B 2NV3A 4PCQA 4PJ0U 1RJJA 3SPZA 1IKYB 3T3FA 4CVNE 4IG3A 3IRXA 5CJ7A 1KHVA 5M1PA 4WFAL 1DRZA 1QVGR 2X51A 4UQTA 4C8LA 2QXFA 5KOWA 1G6BA 2YHBA 3V6KA 2E9TA 3RU0A 4CESA 4QZDA 4ZIVA 4XRHA 1ZQRA 1X4EA 3S6JA 5AIBA 4R5PA 3MM5A 3WC2A 2HWTA 5M1KA 4NXNK 4K7QA 1SVDA 1IV8A 4CE9A 4I9QA 2E9RX 3F5AA 2OSRA 3NRBA 3SENA 5CYQA 1ZQDA 3GTYX 4NCGA 5J1EA 1HI0P 2V4RA 4NZ0A 3TEGA 2R18A 1LFWA 1OQ3A 1FI4A 3ZT0A 2DR5A 3HTVA 3TJ9A 5DGAA 3VHQA 3C15B 3W2VB 4A8SA 1IG6A 1HL6A 1BI4B 1NZBA 2YH0A 3AVLA 3UPFA 3K8WA 2FPHX 3WIUA 4CEOA 3VAIA 2VU5A 4W90B 3KLIB 3CCVN 4OI1A 3C14A 2AIRB 4DTPA 4PA1A 2RHFA 5KFZA 1ATSA 1FEEA 2G5IB 2YKPA 2ZG6A 4GFJA 3TAQA 4DL3A 3GQCA 1CLQA 3IS9A 3QX7A 4KLDA 2FIUA 3NBPA 4ZLPA 3KYLA 4NCAA 3QFUA 3JXOA 4NCBA 3V4IA 3ZDEA 2LCWA 1NGHA 4XO0A 3D2EA 4EHTA 4DFJA 2QLFB 3NF9A 1IWGA 2ASYA 1N48A 7ICUA 1UCNA 3MN6A 5SUHA 4B9TA 4K4GA 1NK9A 2KJ9A 3O9UA 2HSEB 4DHVA 1NK0A 2VC1A 2N3LA 1UCVA 1Y0HA 3KUEA 4C7QA 2NZTA 7FDRA 1J5OA 4AM7A 2M9NA 4WWSA 1NPKA 2QG9B 4IG0A 2XMJA 4A2BA 2YMMA 3HP9A 5CR4A 5KFEA 3OBIA 1JLEA 3AVKA 1RADB 2AYGA 3P8BB 4RT3A 2BCSA 4E1NA 4GKJK 1B99A 2IDLA 5L1IA 4ZPCA 2OTLN 3ZTRA 2YQ1A 3CJ9A 2ZBIA 1SKWA 2I7NA 1JB0C 2C3MA 1V3ZA 3HL8A 4CNYA 3I33A 2V67A 1S79A 3T9NA 1BHLA 4R79A 5KRTA 4HTJA 4AL6A 5DDOC 2MPUA 2BPCA 5CR0A 4B3MJ 4IR9A 3U6FA 2BCQA 3THWB 3LL3A 2WMMA 3FQLA 2GTDA 3QEPA 4HAIA 2ZE2B 2EXUA 2F76X 3ZT2A 3AEVA 1N56A 3R7SB 3R2DJ 3HLUA 4FF2A 3NL0A 1E6YA 5CXTA 3T5KA 3SAFA 4QWEA 2QL7B 1MN8A 3H8YA 2OYQA 3HSTB 4HACA 5AFUH 1UZDA 5AM1A 3QRRA 1RAHB 4TY8B 5J1NA 2CNNB 2A1RA 3VGMA 4ZPBA 2GJFA 2FVPA 2HVIA 4K0KK 3C29A 4WZMA 3NGYA 2G1DA 3E51A 2MZJA 2QYCA 1UJ4A 2C2NA 3IBPA 1B7FA 3KHLA 4UAZA 1L7MA 1UL3A 3UPQA 3ULEA 3SQ4A 4NLSA 1RG6A 1Q7YT 4XQ8A 3AOCA 3PRBA 1NMEB 1TUVA 1AQ6A 3PTWA 3HD2A 4DR7K 5KT3A 4DS5A 1CC8A 5B0FA 3DDNA 2PMZD 5A8RA 1YITS 4YP3A 3OS2A 2YWHA 1ZM2A 4EYIB 5HBMA 5EWGA 3MC1A 2PGCA 3HHKA 2FJDB 4LRBA 2B9XA 3C5GA 4DUYK 4O5EA 4B3RK 1BQXA 2KYZA 5GINA 4YUDA 3GYXB 4K4HA 8ICPA 3CI5A 2QM1A 4QZVB 2CJKA 2DGSA 1D9FA 2BM1A 3BQ1A 2FJBB 1N5QA 4KHPK 1L3TA 1IKVB 5CABA 3OR1B 4AILC 4C80A 4WCEL 3TI0A 4GVLA 4F25A 3PHTA 1CVJA 3CFPA 2K7KA 2CPFA 3RB4A 4KO0B 3VEWA 2IM0A 4HUEA 4PQUB 3SYZA 1H7XA 4KH5A 2PFPA 1Z1VA 4BE1A 5C42B 3RTVA 2HEKA 2ZJPQ 2WSEC 1WF1A 3MOZA 3JTNA 4ILRA 4DL2A 5KFBA 4XTTA 1U4BA 4J2BA 1FD8A 2XMKA 3UKRA 4DV0F 2CRLA 4MT1A 1C0TB 1P7DA 1T9UA 4ICAA 4FO0A 5ADXH 5J2HA 2ASJA 2HHTA 4IEIA 3D4JA 5J0XA 2HHHF 2P66A 5J2BA 3CMAS 1NUEA 4AD6A 1DTQA 2ROGA 3KUHA 3CMEN 3BGRB 5LMNJ 2HHWA 3LZIA 5CA7A 3GOIA 2EVZA 1COOA 2Y3YA 3P31A 4F67A 3AVNA 8ICEA 3I4PA 1AXQA 3O3LA 1LKZA 2P9LA 3DAWA 4H4MA 2UVVA 4DL0C 1XMBA 3N5FA 4WYWA 4DV6K 1IG8A 4GW6A 3C7NB 2LLZA 3GIIA 3L09A 5EXWA 3UQSA 2OFHX 3KG0A 4NXNJ 4KAZA 1U9LA 4BDPA 2W4PA 4BRFA 2H3EB 1FERA 1ZRMA 4QZFA 1SIWB 2IDEA 1XUPO 1NJIO 3ENBA 1PAUB 1GLCG 1YJNS 2F9WA 4A4JA 4PGQA 3K1ZA 3DHWC 3ENOA 2N4CA 5C25A 1SL0A 3THYA 3KBBA 4H4OB 2O8EA 2PYLA 5EX5A 4JI5F 2XRIA 1XNRK 3RMBA 2GO9A 2NXEA 3V9WA 8AT1B 3IG1A 1VSMA 3U1MA 5HMWA 1TUYA 5EVZA 4CZFA 4RZRA 9ICKA 4OJPA 1NLKL 4H5TA 2KKHA 1I94K 1ZM4A 8ICZA 3AO4A 3GV7B 3PR5B 3UQ0A 4B1WB 3PW0A 4DV4K 3V1QA 2Y0SF 2EFOA 3CJSA 3G0ZA 4ITSA 2KQ2A 3ZSRA 2BJ3A 3HVTB 3GFXA 2ZJ5A 2MHEA 3QINA 3QSYB 1IBKJ 5KQDA 3HZEA 3HD1A 4CYUA 1M1HA 3PW5A 1N5SA 3MM9B 4E7HA 4GIBA 1Y5LB 1HNZF 2J6TA 3FZHA 5BYRA 3HK2A 2CVEA 5AE1A 5JRTA 3M2UA 2ZTCA 1BWVA 1ZQYA 3O44A 2HS4A 5B0BA 1GLAG 4LIRA 1XMQF 1A9NB 4MYUA 4OX8A 4O44B 1NKCA 3IA0A 4H8KA 1FT8A 1X40A 3DV9A 2E1YA 4U67L 1VHIA 2ERRA 4RPYA 3EE8A 4UUWA 2V52B 3B8HA 4JN4A 4JD2B 5KFPA 4CH0S 4JAXA 2DKXA 3B0YA 1JK9B 1UETA 4WJBA 4Y0FA 4LFCK 4URQU 2VL1A 1QSLA 2GJ2A 2FZKB 3FZFA 3HWTA 4JI0K 1Z1BA 3SFUA 2DBYA 2VASA 4AFFA 4MKYA 2IGIA 5HRSA 3CCMN 2HHSA 4WTOB 4Z94A 1L5UA 2EKYA 2R2SA 2YKAA 5KG5A 2ZXIA 4C0BA 2P9SA 3MXJA 3H2VE 4KLSA 1JMSA 4DR6F 5DB7A 3WEEA 3DN9A 3D2SA 2KHCA 3SNNA 3FQKA 2YKNA 2C2ZB 3H5YA 3CCUS 2ISOA 2OCEA 3ASMA 3G82B 2CUYA 1LAVA 4EP5A 2EI5A 1QJHA 5A0LA 1ASVA 2H51B 4K0KJ 1C6VA 5AM0A 4M5DA 2RIJA 1PJ7A 2NO4A 1WSEA 2YCHA 2AZ1A 4C0OC 2XZWA 1BPXA 3JPOA 4KHSA 4I2HA 3H2LA 4YMEA 1T03B 1FRXA 4B9SA 3WHIA 4ECZA 5AQPA 1D8LA 5KFNA 1TVRB 5HP1B 3G10A 3N4MB 4R8UB 2I8EA 1FKAF 3VWSA 3MK6A 4KPYA 4GKKK 4I56A 1G3OA 1RBRA 1U2VA 4FYVB 3LDSA 1FWKA 4YY3F 4FZYA 2R8GA 1UEUA 4J9PA 3HFVA 4RNHA 4JI1J 3AT1B 2ZJAA 2D0PA 2HG4A 3CNQP 4B3RJ 1NJWA 1S57A 4M5GA 3AUOA 2W42A 4WE1B 1T9WA 4H0VB 4EX7A 1PUZA 4UAUA 1D0EA 3OYAA 2NXNA 4WFNQ 1L3SA 4KHPJ 4DR5F 4J9OA 1Y64A 4ED4A 4U8YA 1WOSA 3GZFA 3AAWB 3KWIA 4DFPA 5IM0B 4DR2K 2JR5A 5D0RA 1ZQLA 1XR5A 3WQTA 5KG2A 3CGIA 1Q86T 2IYIA 2IHNA 4KHWA 4YCXA 3NGKA 1KRPA 4ECYA 2ZUDA 3CIMA 3M8PB 4LR9A 1G2EA 5JU5A 2FF6A 2KN7A 3NAIA 5JVHQ 3PZPA 1N62A 4JBCA 3CJ7A 1S22A 4KHMA 4QW9A 3LPYA 2VOOA 3BYPA 2XWXA 5M2RA 2DKZA 4I6MA 3VQ9A 3KKRA 2RRNA 2KG5A 3ZSVA 1HR0K 1S1VB 1YUWA 2KM8B 1RHKB 3EGNA 4OYPA 3L3UA 4BG8A 1UA0A 2ZOMA 3AA5X 2OP5A 1CG2A 2NNWA 4HWIA 3VQ6A 4OL8A 3MDFA 2IAJA 4ZKAA 1S1UA 3GBTA 2ZNZA 1RBOB 2UUCF 5FROA 3CJ5A 2KFZA 3QXGA 2WAQD 3QZ8A 4FK4A 3OTOF 3I28A 1FTRA 1WB9A 2BPFA 3KLFB 9ICVA 2AYEA 1W26A 4CJ5A 2X74A 2ZM6K 4BVPA 4U7CA 4CLSA 2VQFF 2K3IA 1EB0A 2BX6A 4Y0WA 2E5LK 3V1OA 4P71A 4LF6K 4KGMA 3ZZZA 3T19A 2JH7A 3QBCA 4ELTA 1PJ6A 4F5OA 1ZAWA 4QOTA 2O5DA 3OV7A 1VQ4N 2ZIXB 1RT2B 1HBNA 2EBEA 4Y6IA 4H0OA 2HFOA 4A5AA 2GS8A 4UOFA 4X4VA 2NR0A 3F5TA 3FYHA 3G87A 4IRKA 3SQ0A 1J2VA 3RB0A 3HXMA 5AKIA 4P73A 2YB4A 2RQ4A 4CJ3A 4KMUA 3BQ0A 2NRHA 3T79A 3O9SA 1VQYA 2I38A 1I94J 4FLYA 3D0PA 1BI4A 1TKZB 1TTHB 2PD1A 1KEKA 4WZQA 3H20A 4KHRA 2FZGB 3KLIA 1F21A 2KHOA 1TFWA 1NDPA 5D15A 1AZSA 4EMDA 1BCOA 4FW2A 4YQWA 3TANA 1HI8A 3J7AP 2D0BA 1FDBA 1OIAA 2I0XA 3OVBA 3RJMB 2ZHBA 3ETRA 4PKDB 4FJNA 4KV8A 3UN2A 5DETA 2QSFA 4I2DA 2HQGA 4FWMA 4HHJA 1YVNA 2OEJA 3VERA 3GPAA 2A41A 2F1FA 5CP2A 3OLBA 3TUIC 1PAEX 3K4GA 2FE9A 3RVCA 2DHXA 3ZX3A 2VJ5A 2IY5B 2VJUA 1NOMA 3KIOA 5T7LA 4ISGA 2D7SA 2FJWA 1TL1B 3MR5A 5K4LA 4BRMA 2HW3A 1AW0A 3QNNA 2CG8A 3ZXWA 1GX6A 1Q81T 4DV2K 1XIQA 3SLCA 2DKOB 4I2QA 4LFCJ 1K9MO 3RJEA 2UVRA 2I9SA 5EUHA 2FF3B 1KBRA 2WF7A 2WHOA 4IH6A 5ALVA 1ZBIA 5IIIA 3GB0A 1K73T 4GO5X 2Q0ZX 3H0LB 3V6DA 4K42A 2Z0GA 3ILIA 2FJXA 1X2IA 2A2CA 2KRBA 1YX2A 5H1SV 3LAKA 3BGOP 1ZPWX 3HJFA 3FFIB 4N56A 1YF5L 2K3KA 2OJ3A 4PXBA 4LF8F 2ZJQQ 2DCUB 2DH8A 5DM7Q 5LJWA 4UB2A 2ZE2A 1A76A 1R31A 5SZTA 1S4FA 1K0VA 3QT8A 2WUSA 4ATNA 1YTAA 2PSZA 2W9AA 3NXZA 3FJ2A 4KB1A 2DFHA 3MFIA 2GC8A 4FM0A 4Z6CA 4C11B 4EFHA 2VG5B 4JI4F 5DBCA 5DB8A 2GMHA 1OMSA 3HI9A 2YX6A 1FEHA 4C3LA 3CCSN 3AA2A 2NYVA 5D0HA 1NHUA 4HHUA 4A8WA 5HQMA 3TX8A 3OFFA 2OELA 3UCZP 2G2OA 2XS7A 1T9YA 2W03A 4GKKJ 2AP1A 5BOLA 2XQCA 2P9PB 1O6XA 1EKEA 4B1UB 4DPOA 1KKXA 4CGFA 3KXDA 4K2JA 1U47A 1YJ9S 1MWKA 1C1AA 4CHYA 4FJLA 3TW0A 2PEBA 1U0HA 4Q44A 1SQEA 2EK6A 3NWGA 2G5HB 3LOUA 2YNHB 4UY8T 1KONA 3DYAB 4B3TF 3SQGB 3WDOA 3TUZC 1ZQFA 1KAXA 4KH0B 1DKGD 2YVSA 2VHGA 4F04B 4DJBA 3J80O 2P9IB 3CHWA 4X62J 1Y11A 4PXDA 2AGQA 2CFXA 2BJ8A 3T1HF 2PBDA 4DCJB 2H9ZA 4CIGA 4X65F 4KLTA 3CDWA 5AHXA 4DR2J 2O8DA 1IBLK 4ZJLA 5KFXA 1N32K 3IG5A 2LI6A 3ZI4A 2LPEA 4FM1A 4CLZA 9ICXA 4CFCA 4MO4A 2UZAA 2FC9A 4F36A 1L3VA 1HX1A 3OR1A 3QEWA 1UEKA 4Z7YA 4OJ6A 5EOYA 3QIPA 1W2BM 2D6FC 3SQOP 1L3KA 2GLEA 1MROB 1TV6B 1H98A 3CM5A 3H45C 3W62A 4RPXA 4KO0A 3K8VA 3GG1A 2AJQA 2DF4B 2K4PA 2LEPA 3Q8MA 1QQMA 2I6XA 4F2SA 3LANA 3CC2N 2ZIVA 1HR0J 5SWMA 1SWVA 3LPUA 3PW7A 1CQMA 2GQCA 5E3CA 2GVDB 1RDRA 3NTUA 3O9QA 2HOFA 1C0TA 2FI1A 3PVXA 1HNVB 2GUPA 1N36J 1WEYA 1RWKB 5CD4H 3T7ZA 2BZ2A 5A6PA 3T9ZA 3RMDA 4PG5A 4DV7J 4YMMA 3CO0P 2ZM6J 1QH9A 2X7IA 1Q3UA 5KFRA 3UWTA 3KWMA 4LZGA 1HARA 1BPZA 3OR2B 4K4UA 2K1RA 2E5LJ 5IOLA 1Z3EB 2ZKUA 4O3RA 3FCHA 3W9HA 2E2NA 2ZTEA 5HL7Q 3J81O 4OHWA 2W11A 2YI1A 4CFDA 2PMZC 4ILGB 5HOOA 3LTOA 5D3GB 3J7Z5 2W9BA 3CC4N 3OVAA 3HBTA 3A1YG 1JN3A 4QYRA 1SIJA 1KFTA 2Q36A 1RBAA 2JLFA 2Z58B 2E6MA 5T41A 1HNWF 5EE1A 2IHR1 1RDAA 4UZCA 2VPWB 2JC0A 4U95A 1RBSA 4CEBA 5T7BA 1NH8A 2YNFB 4KT0C 1B3TA 4B3SK 1JXBA 1HKCA 3I55S 4JMUA 4IOXA 2DY4A 4OZ0A 2LYBA 5CCLA 4K4YA 3NNAA 4TNOA 1YXQA 1D8BA 2VB6A 1EXQA 3RJFA 2MLYA 4EUVA 1XHZA 4G9BA 4DN0A 3HVTA 4CP5A 4C3KA 1NZPA 8ICKA 5FLXO 2Z56B 3MM9A 3LDAA 4F5NA 2ZHOA 2M0GB 3RFAA 2XLIA 3EDQB 2LQBA 5KT4A 4K5SA 4BQZA 2CJAA 1VQKN 1S6QA 2V63A 4BQLA 1EKSA 1F9FA 1VDHA 2GFFA 3HSGA 1FFSB 3QAUA 2D9OA 2E5HA 1QSYA 3D2NA 1OVQA 1SKUB 2W4DA 3OYMA 5AKEA 2NXCA 2OPSB 3VQ4A 2JEIA 2KN4A 2B4PA 1KKHA 4MKVA 5HJYA 2Z1IA 3LVWA 4OZ3A 5BR8F 3JAMO 3R9PA 4FW1A 1MNEA 3GR0A 2CYYA 2QIFA 4IQWA 4JD2A 3WK5A 5A2QY 3ICXA 3UXPA 4MFBA 2CZVC 1TUUA 1FW6A 3GONA 3M6ZA 1DFDA 1G99A 2LA6A 4JS5A 3RH5A 1VAZA 1YBTA 3CCJN 4OI2A 4PG7A 5MLCV 2HQCA 1A7GE 4PRFA 1ZM3A 3DGPA 3BSNA 4OVLA 2O66A 4QWBA 3LPTA 2RQKA 5J2PB 1M1KT 1SV5A 3AJ1A 2MKKA 4P2HA 1E6VB 2RKIB 1SC1B 4R0JA 4F91B 3DKDA 4I68A 5I42B 2YX8A 2PYJA 3EW9A 1RABB 4FNIA 3DLRA 1NPRA 2R2UA 3RMAA 1NM1A 3QEVA 2MZRA 3OXLA 2ZF5O 2E2PA 5IIMA 3R1XA 3UD5A 3HHLD 5KGWA 3AO5A 1NJXA 1SZPA 4KLUA 4OX9J 4DV3F 4CO5A 5HLFB 4MEYA 2AKWB 1T03A 4CZCA 3EWGA 2QLWA 2ZIUB 3MDAA 1TL4A 2IJNA 3S41A 1HQ2A 5A2QU 3AN1A 2B43A 4A8KA 4IQVA 4DQPA 3EX7B 4LF9K 1S99A 4CJVA 1MSWD 4CI0B 3LPEA 2XMWA 4QIVA 4CE6A 1VRQC 5FPDA 2LKZA 5U47A 4ZVQB 4N41A 3EY1A 2Z2MA 3Q2TC 2W3RA 2OWOA 4TLQA 2PIIA 1IV0A 5E5NA 5GAHP 2M4MA 4J7CA 1IBMF 2LSNA 2KW4A 1NNEA 1T9XA 1VSHA 4WE1A 1N32J 4F92B 2B6AB 3NH0A 3N7PD 3U26A 1I3AA 3UD3P 4BC4A 3Q8PB 3KJVB 3Q86A 1FEZA 1WG8A 1MMDA 3X1LB 1WACA 3AVCA 3S3OA 3QGPA 2JC1A 4FPBA 3QIDA 2DWQA 3OSNA 1GMWD 1P6TA 2V51B 3BQTA 2BW2A 1Z4UA 2XM3A 2J8SA 4LRFA 1IUJA 2DNPA 3L0QA 3VEYA 4P0QB 3M8PA 4BRAA 3W5YA 4CEFA 4CJSA 4PPZA 2XVTA 3GSDA 3E2EA 3A12A 4KR0B 4JOUA 1PZNA 4G65A 4DOCA 1UT5A 4IJNA 2AXTU 3D67A 4NJ8A 2DRBA 2K4EA 3BZCA 3DOKB 4LFBK 4U8VA 1BQMB 3TOQA 3KMQA 2AW0A 3N28A 2V34A 1S1VA 3CPWR 2R2RA 1M90T 3PO5A 2HHVA 2XNRA 3P38A 4C4TA 4KLEA 2BM0A 3WUHA 3ZDBA 2QA2A 3L4BC 1FJGF 1B9DA 3LH2S 2IOFA 2B4UA 3VAJA 2AX1A 1OQ6A 1AFIA 1TFRA 2V94A 1R8AA 1SL2A 3BN4A 1E3MA 1U1LA 3MXMA 1F9EB 1ZAVA 2UVUA 1VIXA 3HHDA 4J9UE 2VDHA 4ELVA 4IDKB 3MZIA 4FJXA 4YHHF 4M5LA 2FDNA 2VG7A 3ZDAA 1F2HA 2DEJA 4X5VA 4WFNL 4IFVB 5HAOA 3B78A 3H1QA 1XWLA 3SV3A 4DF4A 3IHQB 5K8OA 1IXKA 2F8TA 4WYLA 4IOCQ 4OPHA 5C2FA 4ZITA 2P2CB 1N5VA 4JYAF 2AU0A 1VQ9N 5F0WA 2FQQB 4WQ5C 4JKEA 2QB1A 2YMPA 1F5CA 2AJ0A 1VQ6S