3KKAC

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-A RECEPTOR 1
publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 59
sequence length 59
chains with identical sequence D, E
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaC00
4IS7A 1KW4A 1PK1A 3TADC 2E8MA 1X9XA 1F0MA 2KG5A 5J8YC 2KE7A 2LPEA 5F3XB 3SENA 2KIVA 2KSOB 3BS5A 2QB0A 4NL9A 1PK3A 1SV0C 2DKXA 2KMDA 1LKYA 2D3DA 2QARB 1SGGA 2DKZA 2QKQA 2EAOA 3K1RB 1DXSA 4MHVA 1B4FA 5JU5A 2ES6A 2GLEA 1JI7A 4NL9C 2YTUA 2KSOA 2K4PA 5JTIA 2B6GA 5L1MA 1Z1VA 2LMRA 2Y9TA 3TACB 2JV3A 3SEIA 3BQ7A 2E8NA 2EAPA 1SV4A 1X40A 1PK1B 2L5YA 1X66A 2E8OA 3IDWA 2ESEA 2QARA 1UCVA 1WWUA 2F44A 5KNIA 4PZOA 3KKAA 2FE9A 4RQNA 3HILA 5J8YA 4RQMA 1UQVA 2Y9UA 1RG6A 4NJ8A 1WWVA 2K60A 2QB1A 1SV0A 1SXEA 1B0XA 2EAMA 2F3NA 1V85A 3BS7A 2E8PA 1OXJA 2F8KA 1OW5A 5JRTA 3KKAC 2EANA 3TADA 3H8MA 1SXDA 3BS5B 2QB0B 2D8CA 1COKA 1V38A 1LKYB 2DL0A 4PZNA
chains in the Genus database with same CATH superfamily
4QZIA 3LWMA 5KFDA 3EPGA 2UVVA 2NRTA 5ALZA 3IRUA 3IP4B 4MEXA 4QZHA 4GXJA 1X9SA 1JXEA 3V6HA 1S5LU 1U49A 4EZ9A 5CHGA 1WG8A 1SWWA 3KZXA 2VA8A 4DQSA 2QB0A 3QEAZ 1DK2A 7ICHA 4I2IA 3TI0A 5CR0A 1CEZA 5GTIU 1KLNA 4I2GA 3ZD9A 1X6JA 2FI1A 4Y2YA 4DQQA 4YXJA 2Y0SF 1S0NA 1B4FA 1JMSA 5AK3A 3IM1A 3PMNA 2DWQA 4FZMA 5KFFA 5EE9A 4F5NA 4A8EA 4ECVA 2MRLA 1MA7A 1PK1B 9ICIA 2ESEA 4C4TA 2F44A 4DF8A 5KG4A 2CPRA 4NY8A 2HHQA 4FS1A 2KFNA 4UB6U 5FP0A 8ICLA 2H3VA 2LYAA 2AQ0A 3SD7A 3EZ5A 4KLUA 4ED1A 4P4OA 4GC6A 3WK4A 2F1HA 1SV0A 2HBJA 3KHLA 1L7PA 5KFOA 4I27A 4KLEA 2W55A 7ICJA 4QWAA 2HSZA 5CEHA 2VA2A 5KFKA 2ZUBA 1JX4A 1ZQJA 1LVHA 3GIIA 4F5QA 2NO4A 2FLNA 5J2CA 3N7PD 5HNKA 5L1LA 1ZQUA 3EWAA 4B6JA 1ZQCA 5C5JA 1Z3EB 1KW4A 4P0QB 3B0XA 4LZDA 1L5UA 1QSLA 5AKGA 4KTQA 4DSLA 2I1QA 2HOIA 1S0MA 3NRWA 4RUAA 3M6ZA 1RXVA 4J9LA 3KZIU 3RRGA 4QNLA 4NWIA 3DEEA 2A1JB 4LZGA 4O3MA 5G5HA 4QZ8A 1N61A 3S6JA 5J0QA 2DPJA 4F2RA 4KLOA 1ZQYA 5DG8A 2EAOA 5KG6A 5JU5A 4KLHA 4FZNA 4DL5A 2H3FA 3H8SA 4O5KA 3GIKA 4P2HA 5F9LA 1VJ5A 3N7SC 2XGPA 8ICNA 3KHHA 3ZDDA 9ICNA 4QIWF 5AM1A 2QARA 4TUSA 4EENA 1NZBA 1ZD5A 4IQWA 3ORYA 1IV8A 4ECQA 3KKAA 2YQEA 2W43A 4Q8EA 4JWMA 3HILA 2YY6A 4C8OA 2HHSA 4AYBF 3PV8A 4ECWA 5KL1B 4EBCA 2EAMA 2A19A 2BPCA 2W8LA 2KKPA 4BX9C 2HHWA 2MSNA 4RQ0A 3HX0A 5HMLA 2WB1F 3AM9A 2ZIVB 4RQ8A 3AQEA 3EUB2 3RH5A 4IQVA 3WU2U 3V7LA 2BCRA 3FM9A 7ICKA 4ED3A 3KHGA 8ICZA 1ZXIA 2IMWP 3UM9A 2WF6A 4IS7A 5J2IA 2M9NA 3BQTA 2LYHA 3TADC 1HUZA 4DL6A 3WK9A 3SV4A 2PFNA 4NM1A 5HHIA 2Z7JA 5DBAA 2I9GA 4EYIB 2D6FC 4NL9A 4KLMA 4RPZA 2DKXA 3OPXA 2R8JA 3QXGA 1Z1BA 2IHNA 8ICIA 5KL8B 4NLZA 4BDPA 2KJ5A 5ALKA 1UA0A 9ICGA 2ZIUA 2W54A 4IRCA 4RQ3A 3RRHA 1FIQA 4DFKA 4E0DA 2RDJA 2JGAA 2ZIWA 3NVVA 4DO9A 3V72A 2G5HB 2HHUA 4ZOHC 1RZTA 4DSKA 1N2XA 4DCCA 2DGZA 5KG1A 2R18A 4M6WB 3L4PA 5ALGA 4DSEA 3UQ0A 4C4SA 3SAHA 4UAYA 8ICPA 5L1IA 4Y2RA 1QSSA 3DV9A 2OXOA 3QU9A 5J2JA 4DOAA 4PHAA 2FLLA 4Q44A 5DBCA 2DF4B 1F44A 1BPEA 4Z6DA 2KNJA 5HMMA 4DFDA 1L7NA 3KD3A 2DBYA 1X2IA 4ED2A 5AI8A 2OYYA 3T79A 2C2EA 2UVWA 1MSWD 2LM1A 3SR6A 2C2RA 4RUCA 2ZJAA 2QB0B 1XO1A 2G09A 1JALA 2F2AB 2C2DA 2ZTDA 5T14A 2W11A 2F76X 3M8SA 1IG6A 3AQFA 5KFCA 5KFAA 5ALRA 3LVWA 1PK1A 1CUKA 4DF4A 1T4GA 2YB4A 4ED6A 1XSLA 3RB4A 2V4QA 3V7KA 1J2MA 2ZG6A 4QWCA 1TK0A 1D9FA 5D49A 4KLJA 1X6IA 2AXTU 1DGSA 5AI0A 2K4IA 3KOOA 7ICVA 1N5WA 4J9NA 7ICNA 4J9SA 5ALHA 4LVSA 3NASA 5CA7A 5BOMA 4CNQA 4J9KA 2W9CA 4B9SA 4QW9A 4XRHA 1ED1A 3GQCA 1X66A 2E8OA 3GFKB 1ZQBA 5J0WA 3HPOA 3F5AA 3NVWA 4UARA 2IOFA 2Y9UA 5KFSA 4RQ4A 2Q0ZX 4US9A 3Q8RB 2FPLA 3RH4A 3M7DA 5KT5A 2F3NA 3NTUA 1RQLA 1KSPA 7ICTA 3N7RC 4YMOA 5GTHU 1MQ2A 1COOA 2R8GA 4YG2A 3ZDCA 2F8LA 1L3SA 1S97A 4UAVA 2LYBA 5ALFA 4DSFA 2J6SA 3ALRA 5AHXA 2W8KA 4ECYA 4P0PA 3ZDAA 2P35A 3JPQA 4PZNA 5AKZA 2IA6A 4FBTA 2JEJA 1UHUA 3C21A 4DOCA 8ICOA 3TAPA 2XO7A 1NI3A 4UATA 8ICCA 4UBCA 2KE7A 5B5EU 1UPHA 2W04A 1JN3A 4UB8U 8ICHA 3TANA 4G9BA 1Q3VA 4DS4A 2G07A 5AICA 5KG7A 1ZD3A 3SV3A 1ZQAA 4R66A 3PO4A 2CN1A 2QARB 4OD0A 1NJZA 2PFQA 1NKCA 2ISOA 3TAQA 1CRXA 3UQ2A 3WK5A 5ALEA 2AU0A 3U26A 1L7MA 3OHAA 2O6KA 1ZQVA 5IIOA 7ICOA 3QZ7A 8ICYA 5J2FA 2KSOA 4NLCA 5EE0A 3RJJA 1TE2A 3R9KA 4O5CA 3RBEA 2E8NA 4GC7A 1RM6C 1K1SA 2A1AA 2BZFA 2BPFA 5J0RA 3F2BA 1WWUA 4YCXA 5ALVA 3HWTA 1BGXT 1U4BA 3HP6A 1QQ6A 1TV9A 4RQNA 4I2AA 4JWNA 4EELA 5KT7A 3KHRA 2HCFA 1XSNA 3IHQB 3THVA 4UAZA 3SQIA 2QB1A 2JEFA 4IRKA 1B0XA 4OJ6A 4QWDA 1TVAA 1DGJA 4GXIA 1BNPA 3WK7A 1OUQA 4B9TA 4C7ZA 9ICOA 2W9MA 1MC8A 5J2BA 4XA5A 5AM4A 2BKEA 2KOBA 2HDOA 3UMBA 2A3VA 1ZQIA 8ICTA 2BDUA 4UB5A 4ED7A 5KAFU 1MN8A 3BJYA 2K4HA 3PX4A 1TAQA 1O08A 2ZIUB 1EXNA 5A0LA 4ED0A 4F5PA 3PO5A 4KLTA 4JB3A 4FZLA 9ICVA 4K4HA 3QU2A 1Z4OA 2ZIWB 4M9NA 2IOFK 1PVRA 4ECXA 3KFUF 2QKQA 3UXNA 1X9MA 3MR5A 2RQ5A 5KFWA 2OEHA 4TQSA 4O0IA 2UVUA 3QX7A 3LDAA 3RR8A 4C8MA 4DSIA 5JTIA 2ALZA 5CRXA 4XQ8A 2KV2A 2ZIXA 4GIBA 2RRDA 1SV4A 3V7JA 3AEVA 3D2SA 5KFIA 4GLXA 4BUGA 2JEIA 1URJA 4ACOA 4M9LA 4DS5A 2WHEA 4OO1J 3B9JA 1S77D 2BGWA 3JPRA 3ICXA 4DWIA 3HRDD 4UB2A 2XY5A 1NJWA 3BS7A 5ALNA 1OW5A 2FJ6A 5KFXA 3JPSA 3RJIA 4RU9A 2AGOA 3PSPA 4YD1A 1QTMA 3H8MA 2KFZA 4RQ2A 3ED5A 4FE3A 8ICJA 1ZQQA 2KHVA 4UASA 1COKA 2ZUCA 2IBKA 8ICRA 4Y2QA 2RHFA 2BQUA 4DFJA 4I29A 5J0YA 5KFZA 2FLPA 1ZD4A 4CE6A 4KLSA 5KG5A 1NNLA 4F91B 1SB3C 4EBEA 2E3TA 3QNMA 1WYGA 2ASLA 4EEYA 5AKHA 3MDCA 3PW5A 4JMUA 4I2JA 2K89A 3Q8LA 4BXOA 3I28A 3PNCA 5ALPA 1XO0A 2W9CB 3C1YA 5ALDA 2ZUDA 5KT2A 2DKZA 3PSFA 9ICQA 5KFEA 2H5XA 9ICWA 2JZBA 8ICSA 2CXYA 5K4LA 9ICMA 3A0BU 1UT8A 4PL2A 4R8UA 3PSTA 5IIKA 3N97B 3TACB 4QZCA 3ETRA 4CF3A 4O3NA 5J0XA 3N4MB 3PR5B 4PHDA 2LI6A 1NK7A 4PZOA 2DQNB 2B21A 3I1YA 4DL3A 4P0PB 1C20A 3WKBA 3RAXA 3CYMA 2IHMA 4DL4A 4YMMA 1D8BA 2KHQA 4B9UA 9ICHA 2KZZA 4M9JA 1ZQWA 5ALXA 4R64A 1Y88A 4C8NA 7ICGA 4US8A 2KIWA 2EZZA 4Y2VA 5AKKA 2VA3A 1TFRA 8ICUA 3PY8A 1IM4A 2EZXA 5KFMA 9ICXA 4G3IA 4RZRA 4NLKA 5J0SA 1M6YA 3PR4A 4C80A 1WCNA 7ICLA 5DDMA 3Q8MA 4JV2A 4CDGA 4RT2A 2EZYA 3ZI4A 2H3IA 4HAIA 4YR3A 1A6SA 1YZ7A 2KK0A 3NRZA 4KMOB 3RR7A 5J2AA 4CF4A 4CCHA 2KSOB 1KFDA 8ICQA 8ICFA 3H0RB 3PMLA 3E2EA 2BDPA 4YFKA 1TAMA 2ASJA 1A76A 2HHTA 2WF7A 2HOFA 5AKEA 4F4YA 3RJEA 4USAA 2BCVA 2B0CA 3OSPA 1J2NA 4ECSA 2HI0A 5KFRA 1SKRA 3HW8A 2Y9TA 1KFTA 3SMVA 1NK6A 4F4ZA 5F9NA 1O03A 4BWJA 3OJSA 5AIAA 4IRDA 4F4WA 3C2LA 2P6UA 5KAIU 3H8WA 5J2EA 5KG0A 5ALWA 3PZPA 1N48A 4KX3A 4RPYA 3RB3A 3C5GA 4O3PA 1V85A 4R63A 3D2QA 4FBUA 4DQPA 4ZH4A 4R65A 3IG5A 5JRTA 4F2SA 5EOZA 4NLBA 4MF8A 3ZDEA 4KMUA 1GO3F 1IXRA 3OHBA 2WF9A 9ICBA 4OCZA 4TURA 2XICA 1QLNA 1V38A 3C29A 4KITB 1RQNA 4MFCA 4DFPA 5KT6A 4TUPA 4PGQA 5KFLA 3QUCA 2NRXA 3JPTA 4JK1A 5CJ7A 1KFSA 2NRVA 4QZEA 3WKCA 2PXIA 4RPXA 3CW2C 2ZJ5A 3WKDA 3BQ1A 2BQ3A 1ZQTA 4UAWA 1L3VA 2JMGA 2JEGA 3B0YA 3RB0A 4J9OA 4M0AA 9ICFA 2WF8A 2PMZC 3CRXA 2ZIXB 1XSPA 5DDYA 4ECUA 1VLBA 5ALTA 1AROP 3LK9A 2WF5A 3WK6A 3ZDBA 3SI8A 5DLGA 3FAHA 2OM6A 3Q8KA 3MDAA 2FMQA 3K1RB 1JUDA 5AKYA 1ZQZA 1S0OA 5AI6A 2BQRA 3C2MA 1KDHA 3H40A 4JV0A 9ICUA 2B6GA 3QUBA 5AKLA 2R8HA 3TFRA 5ALQA 1X40A 3RF9A 4DL7A 5AI5A 4KX5A 4B9MA 5AK5A 2G06A 4I28A 5EWGA 2VIXA 1L3TA 2KICA 3H8JA 4KLQA 3WK8A 4MFFA 4F93B 3N28A 2WAQC 2K60A 2KP7A 3MGIA 8ICEA 3FDSA 5HHHA 2XVTA 5HR6A 1L7OA 2KVCA 2E8PA 1P7DA 4F71A 1QH9A 2F8KA 1F5SA 2JXJA 4LJXA 3C23A 3TADA 5AM5A 4KLGA 1N56A 1SXDA 5KTQA 2OH2A 1NK8A 1NOMA 4BXOB 4C8LA 4IR9A 1YT3A 2HOQA 3ISCA 2P6RA 7ICUA 1ZJMA 1RYUA 3H7IA 2JH7A 9ICRA 4M04A 2EH9A 2JR5A 2JZBB 1SL2A 2LPEA 3PW7A 2GWSA 5KFHA 2ATLA 2W3RA 4K4IA 4R8UB 1FFVA 3H0LB 1ZRNA 1TK8A 3DDHA 3M9MB 2PKEA 3TQ1A 3SAGA 4ELTA 2JRZA 4NLGA 2JV3A 3OGUA 4B9VA 2MAXA 4PGYA 5AM2A 3Q8PB 5L1JA 1PZNA 2G5IB 2HBMA 5ALSA 2ZXIA 1ZQDA 5HP4A 3IDWA 2FMPA 2IOHA 4NV0A 4C7YA 4PGXA 2NV3A 5ALJA 5AIBA 5B66U 4CF5A 1UA1A 3UMCA 4OJ5A 5DQIA 4JV1A 4NJ8A 1HJPA 2LKYA 3NGDA 1Q46A 3FYHA 4F5OA 2KJ8A 2FPKA 3AMZA 1QQ5A 2KVSA 1KQQA 1DOQA 4MEYA 5IINA 1NZPA 5AI9A 5KFJA 3UMGA 3QZ8A 1ZQXA 3JPOA 3M9OB 4I2BA 4RNOA 5AM0A 5DB9A 3RB6A 1XC9A 2D8CA 3BZCA 3I76A 2XCAA 3OJUA 3T5JA 3OSNA 8ICAA 2W9AA 4PHPA 1RPLA 1UT5A 4X5VA 1NKEA 1A77A 4YMNA 2K8AA 1F0MA 3ISBA 1T3NA 5L9XA 3FC4A 2KN7A 3BDPA 1YZ6A 2PMZF 3H4DA 4RQ6A 4DFMA 4U7CA 4NM2A 3UXPA 4CGZA 1NKBA 3E0FA 1ZQLA 4QZ9A 3GV8B 2XY7A 4UB4A 3RTVA 1JXLA 1C7YA 2WFAA 4QZAA 2F1JA 2AGQA 1L3UA 1JI7A 2ZTEA 3BQ2A 5J2KA 3C1ZA 4Y2PA 3UPQA 1NJXA 4QZFA 4YQWA 4YVZA 3PW2A 2YB1A 4I2EA 1Q3UA 4DSJA 2KTQA 1X9WA 3T3FA 4PPXA 1S76D 4Z6FA 5AKXA 2DPIA 3VCBA 1ZRMA 2E1FA 5KFTA 4TUQA 5DBBA 4PH5A 5IIJA 1ZQ1C 1H38A 3NVYA 7ICQA 2ISPA 1XS9D 4ED8A 1TK5A 1RG6A 3GV7B 2RLTA 2WAQF 4DLEA 2PI4A 2DFLA 1U45A 2HHVA 4F4XA 5EWEA 1ZQPA 4QZDA 3QU5A 5TISU 3KKAC 2CRXA 3UXOA 2W7OA 5KFPA 2Y1JA 1ZD2P 3F53A 4UQGA 5DQHA 2K8BB 2YN4A 4NXZA 2K8CB 2LBOA 2W9BA 1T3QA 4O5EA 5DKWA 1N5XA 1XNSA 4RT3A 1NJYA 3MR3A 1ZQFA 2J6TA 4QWEA 5JUMA 1RYRA 4I2DA 1ZOLA 1PVQA 3KBBA 4CRXA 2M0NA 1AQ6A 1D8LA 1J97A 2KG5A 3GV5B 3LYSA 4Q8FA 3SAFA 5KG3A 1FFUA 3BS5A 4UB1A 4B9NA 2XGQA 2HBLA 2E5SA 1LKYA 3MC1A 2Y1IA 4M9GA 9ICCA 3NS1A 2D3DA 2KZMA 4F50A 1SGGA 5DQGA 3LVVA 3GZFA 2PFOA 2JH1A 2YMPA 3Q8QB 4F72A 3AL0B 4WJ3B 3QEBZ 1ZJNA 4NL9C 1U9LA 4IQUA 7ICRA 2I5HA 1Z00A 5DLFA 2ZJ8A 1ZYQA 3T5HA 4QWBA 2KD1A 1LV5A 2OHFA 1FO4A 1ZQSA 2J6UA 3OTQA 2UVRA 3H4BA 4I2HA 4F4KA 3V6JA 1BPYA 4F5RA 2FE9A 1V97A 4J9RA 4I2CA 4HYKA 2PFPA 5E79U 4ELVA 5DB7A 3KTQA 1WWVA 2LHTA 3SZ2A 2GO7A 1JROA 3G6XA 5ALUA 4DLGA 3M8RA 3GDXA 5ALYA 2VKQA 4UB3A 5KG2A 2EANA 2VJ5A 5KFQA 3CNHA 4YN4A 2BPGA 3PVXA 2K4EA 2MUTA 5IIMA 4YD2A 1NK4A 4EEKA 1MQ3A 3PW0A 4EX6A 1KTQA 5C0YA 2E8MA 1XWLA 1ZQRA 2AJQA 1V9PA 4YP3A 1QQ7A 1ZQEA 5CP2A 5J2DA 4O3RA 2KIVA 2FPMA 1JIHA 4J9PA 2HMXA 1BVSA 2HVHA 1B43A 5AI4A 1NK0A 3NUQA 7ICEA 5J2GA 2R8KA 2HHXA 1KBUA 4QZGA 4DEZA 1TAUA 3QU7A 8ICMA 2KZ3A 2C22A 8ICBA 3ONNA 2NRWA 3QUQA 1S9FA 5CB1A 3HT3A 3QYPA 1ZQHA 3MGHA 5HR7A 4TQRA 2VANA 4F3OA 1CI4A 2XI9A 4PHEA 4KLLA 1ZQNA 3RJKA 2VJ4A 1N62A 4KN7A 4MFAA 4Z6EA 4BGDA 4M9HA 3HKZC 4UAUA 3C2KA 4C0ZA 1PVPA 2F1IA 4P4PA 2JHDA 2I6XA 4EZ6A 1RDFA 2BR0A 2HBKA 3PX0A 1Z4NA 1N63A 2WTFA 2RDIA 4F8RA 1RXWA 3ZD8A 2HVIA 5KT3A 4J9MA 4NLNA 5DG9A 4OJOA 3RFAA 1U47A 1WUDA 9ICSA 8ICVA 3G6VA 3H0MB 1L8LA 5EE3A 1WCLA 4BJQA 2AH5A 4I2FA 1T94A 5DB8A 2C28A 2GH1A 1ZQOA 4UBBA 1ZQGA 3TFSA 1T8EA 5D46A 3SYZA 3MFIA 5J8YC 3L3FX 4RQ5A 3QUTA 1SKSA 2BCSA 4Q43A 1BPZA 4Y2JA 2HW3A 1ZETA 1PK3A 4EBDA 4ELUA 2EDUA 8ICKA 1QCKA 3NVZA 4PL1A 3IG8A 1KRPA 2KKVA 3J81j 9ICJA 1VDVA 2YMMA 1RYSA 1K5OA 3VC8A 3MGVA 4C8KA 1HUOA 4EYHB 8ICGA 3WKAA 4IR1A 2YMLA 4FS2A 4EX7A 2ZTCA 1KEJA 3BQ7A 3RJHA 4RQ7A 4RNNA 2L5YA 5ALMA 4JUZA 3F2CA 3EPIA 5KFGA 4P4MA 5J29A 2BCQA 1SZPA 4QZBA 3E58A 3RAQA 3IV6A 1LB2B 2YMQA 2ZXHA 3WKEA 2W9BB 5AK6A 3GU3A 4QW8A 9ICAA 3MFHA 1S0VA 2XC9A 1K1QA 1XU4A 3K75D 4FFDA 1SL0A 3MBYA 3Q8SB 9ICTA 5ALIA 1HEKA 5DB6A 1FEZA 4GFJA 4AP9A 1B22A 2NYVA 3F5EA 5G5GA 1NK9A 3BS5B 2P66A 1BNOA 1N60A 5KT4A 4M2YA 1LKYB 4M47A 4OJPA 5J0PA 2DL0A 4YR0A 3RH6A 2BCUA 3K1ZA 5ALLA 3GIJA 5IILA 1BPXA 1A0PA 1L8OA 5BPCA 2NRZA 9ICKA 4YXMA 1S10A 2FMSA 4KN4A 5F3XB 1Z00B 2N1RA 4Y2XA 9ICEA 5KFYA 4Y2TA 2KEYA 1BPBA 1DK3A 4RQ1A 3M6KA 4ICAA 2G08A 3RJGA 4RNMA 4P0QA 3ISDA 3AU6A 2QLTA 2H3QA 4OJLA 2RP5A 4QJFB 1DXSA 4MHVA 1KL9A 4FO6A 3AUOA 2ES6A 2GLEA 2F77X 1SIJA 2Y0SC 2K4PA 2AGPA 5J0UA 2XCPA 2A1JA 3ETLA 1Z1VA 2LMRA 2ASDA 1T7PA 5L1KA 3HJEA 3SEIA 4BWMA 5J0TA 4ECRA 3V6KA 4O9MA 3HKZF 3QU4A 3AU2A 2EQYA 4O3OA 5KNIA 5AK4A 2V4RA 5J8YA 4RQMA 3CP8A 1UQVA 9ICLA 2NO5A 1SZHA 3M1YA 4IL6U 1Q8KA 1SKWA 2BHNA 2MUTB 1BPDA 4IC9A 1SL1A 4K4GA 1KN5A 4DL2A 2XIDA 3EW9A 2OCEA 2MU2A 4MF2A 2AQ4A 1KKXA 4UW9A 3PW4A 2KJ9A 3BQ0A 5KFVA 3TKAA 3RBDA 1JRPA 5IIIA 7ICMA 4O3QA 2GOLA 4YR2A 2LM4A 3O0FA 5ALOA 5AKJA 4PJ0U 4F92B 3IN5A 4Z6CA 7ICSA 5AM3A 5CWRA 3C28A 3MR6A 2AHOB 4KLDA 5TZVA 8ICXA 1X9XA 3C5FA 2ZIVA 1SWVA 2FDRA 2ODGA 3A0HU 4J03A 2PI5A 1ZQKA 5D4BA 2V9WA 2W3SA 3SENA 3K4GA 5DGBA 3GILA 1SV0C 3D6JA 4Y2UA 3T5KA 2KMDA 4DQRA 2R8IA 4ECZA 1QSYA 1TKDA 4DOBA 3LWLA 1U48A 1HIWA 3TARA 2YX8A 5J0OA 1PUZA 5AKIA 5J2HA 4ECTA 3L5KA 1ECWA 3BZKA 9ICPA 4KLFA 4Q45A 2E1EA 1D8YA 3G6YA 5KFNA 2YTUA 3JPNA 5L1MA 2MA1A 3M9NB 1DRGA 1S8OA 3F2DA 3PX6A 3MABA 3QE9Y 5EE1A 4IQTA 4XUSA 4U6PA 2EAPA 5BOLA 4KLIA 3PSIA 1UCVA 4QIWC 3JPPA 1X42A 4J9QA 3T5LA 3GIMA 4GXKA 4Y2SA 1ZQMA 1D9DA 2DUYA 4AYBC 1SXEA 3MR2A 4O3SA 5KFBA 2Q4TA 5EWFA 3AN1A 3D2NA 2G0AA 8ICWA 1OXJA 5KFUA 2H3ZA 4C4RA 4M6WA 7ICPA 2OWOA 7ICIA 2WB1C 1NK5A 2XY6A 7ICFA 2W03A 4DQIA 5DGAA 3EYZA 3RJFA 2W7PA 1IIPA 4B9LA 5DG7A 5H2FU 1L6NA 1Z19A
chains in the Genus database with same CATH topology
4IS7A 1KW4A 1PK1A 3TADC 2E8MA 1X9XA 1F0MA 2KG5A 5J8YC 2KE7A 2LPEA 5F3XB 3SENA 2KIVA 2KSOB 3BS5A 2QB0A 4NL9A 1PK3A 1SV0C 2DKXA 2KMDA 1LKYA 2D3DA 2QARB 1SGGA 2DKZA 2QKQA 2EAOA 3K1RB 1DXSA 4MHVA 1B4FA 5JU5A 2ES6A 2GLEA 1JI7A 4NL9C 2YTUA 2KSOA 2K4PA 5JTIA 2B6GA 5L1MA 1Z1VA 2LMRA 2Y9TA 3TACB 2JV3A 3SEIA 3BQ7A 2E8NA 2EAPA 1SV4A 1X40A 1PK1B 2L5YA 1X66A 2E8OA 3IDWA 2ESEA 2QARA 1UCVA 1WWUA 2F44A 5KNIA 4PZOA 3KKAA 2FE9A 4RQNA 3HILA 5J8YA 4RQMA 1UQVA 2Y9UA 1RG6A 4NJ8A 1WWVA 2K60A 2QB1A 1SV0A 1SXEA 1B0XA 2EAMA 2F3NA 1V85A 3BS7A 2E8PA 1OXJA 2F8KA 1OW5A 5JRTA 3KKAC 2EANA 3TADA 3H8MA 1SXDA 3BS5B 2QB0B 2D8CA 1COKA 1V38A 1LKYB 2DL0A 4PZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IS7 A;  1KW4 A;  1PK1 A;  3TAD C;  2E8M A;  1X9X A;  1F0M A;  2KG5 A;  5J8Y C;  2KE7 A;  2LPE A;  5F3X B;  3SEN A;  2KIV A;  2KSO B;  3BS5 A;  2QB0 A;  4NL9 A;  1PK3 A;  1SV0 C;  2DKX A;  2KMD A;  1LKY A;  2D3D A;  2QAR B;  1SGG A;  2DKZ A;  2QKQ A;  2EAO A;  3K1R B;  1DXS A;  4MHV A;  1B4F A;  5JU5 A;  2ES6 A;  2GLE A;  1JI7 A;  4NL9 C;  2YTU A;  2KSO A;  2K4P A;  5JTI A;  2B6G A;  5L1M A;  1Z1V A;  2LMR A;  2Y9T A;  3TAC B;  2JV3 A;  3SEI A;  3BQ7 A;  2E8N A;  2EAP A;  1SV4 A;  1X40 A;  1PK1 B;  2L5Y A;  1X66 A;  2E8O A;  3IDW A;  2ESE A;  2QAR A;  1UCV A;  1WWU A;  2F44 A;  5KNI A;  4PZO A;  3KKA A;  2FE9 A;  4RQN A;  3HIL A;  5J8Y A;  4RQM A;  1UQV A;  2Y9U A;  1RG6 A;  4NJ8 A;  1WWV A;  2K60 A;  2QB1 A;  1SV0 A;  1SXE A;  1B0X A;  2EAM A;  2F3N A;  1V85 A;  3BS7 A;  2E8P A;  1OXJ A;  2F8K A;  1OW5 A;  5JRT A;  3KKA C;  2EAN A;  3TAD A;  3H8M A;  1SXD A;  3BS5 B;  2QB0 B;  2D8C A;  1COK A;  1V38 A;  1LKY B;  2DL0 A;  4PZN A; 
#chains in the Genus database with same CATH topology
 4QZI A;  3LWM A;  5KFD A;  3EPG A;  2UVV A;  2NRT A;  5ALZ A;  3IRU A;  3IP4 B;  4MEX A;  4QZH A;  4GXJ A;  1X9S A;  1JXE A;  3V6H A;  1S5L U;  1U49 A;  4EZ9 A;  5CHG A;  1WG8 A;  1SWW A;  3KZX A;  2VA8 A;  4DQS A;  2QB0 A;  3QEA Z;  1DK2 A;  7ICH A;  4I2I A;  3TI0 A;  5CR0 A;  1CEZ A;  5GTI U;  1KLN A;  4I2G A;  3ZD9 A;  1X6J A;  2FI1 A;  4Y2Y A;  4DQQ A;  4YXJ A;  2Y0S F;  1S0N A;  1B4F A;  1JMS A;  5AK3 A;  3IM1 A;  3PMN A;  2DWQ A;  4FZM A;  5KFF A;  5EE9 A;  4F5N A;  4A8E A;  4ECV A;  2MRL A;  1MA7 A;  1PK1 B;  9ICI A;  2ESE A;  4C4T A;  2F44 A;  4DF8 A;  5KG4 A;  2CPR A;  4NY8 A;  2HHQ A;  4FS1 A;  2KFN A;  4UB6 U;  5FP0 A;  8ICL A;  2H3V A;  2LYA A;  2AQ0 A;  3SD7 A;  3EZ5 A;  4KLU A;  4ED1 A;  4P4O A;  4GC6 A;  3WK4 A;  2F1H A;  1SV0 A;  2HBJ A;  3KHL A;  1L7P A;  5KFO A;  4I27 A;  4KLE A;  2W55 A;  7ICJ A;  4QWA A;  2HSZ A;  5CEH A;  2VA2 A;  5KFK A;  2ZUB A;  1JX4 A;  1ZQJ A;  1LVH A;  3GII A;  4F5Q A;  2NO4 A;  2FLN A;  5J2C A;  3N7P D;  5HNK A;  5L1L A;  1ZQU A;  3EWA A;  4B6J A;  1ZQC A;  5C5J A;  1Z3E B;  1KW4 A;  4P0Q B;  3B0X A;  4LZD A;  1L5U A;  1QSL A;  5AKG A;  4KTQ A;  4DSL A;  2I1Q A;  2HOI A;  1S0M A;  3NRW A;  4RUA A;  3M6Z A;  1RXV A;  4J9L A;  3KZI U;  3RRG A;  4QNL A;  4NWI A;  3DEE A;  2A1J B;  4LZG A;  4O3M A;  5G5H A;  4QZ8 A;  1N61 A;  3S6J A;  5J0Q A;  2DPJ A;  4F2R A;  4KLO A;  1ZQY A;  5DG8 A;  2EAO A;  5KG6 A;  5JU5 A;  4KLH A;  4FZN A;  4DL5 A;  2H3F A;  3H8S A;  4O5K A;  3GIK A;  4P2H A;  5F9L A;  1VJ5 A;  3N7S C;  2XGP A;  8ICN A;  3KHH A;  3ZDD A;  9ICN A;  4QIW F;  5AM1 A;  2QAR A;  4TUS A;  4EEN A;  1NZB A;  1ZD5 A;  4IQW A;  3ORY A;  1IV8 A;  4ECQ A;  3KKA A;  2YQE A;  2W43 A;  4Q8E A;  4JWM A;  3HIL A;  2YY6 A;  4C8O A;  2HHS A;  4AYB F;  3PV8 A;  4ECW A;  5KL1 B;  4EBC A;  2EAM A;  2A19 A;  2BPC A;  2W8L A;  2KKP A;  4BX9 C;  2HHW A;  2MSN A;  4RQ0 A;  3HX0 A;  5HML A;  2WB1 F;  3AM9 A;  2ZIV B;  4RQ8 A;  3AQE A;  3EUB 2;  3RH5 A;  4IQV A;  3WU2 U;  3V7L A;  2BCR A;  3FM9 A;  7ICK A;  4ED3 A;  3KHG A;  8ICZ A;  1ZXI A;  2IMW P;  3UM9 A;  2WF6 A;  4IS7 A;  5J2I A;  2M9N A;  3BQT A;  2LYH A;  3TAD C;  1HUZ A;  4DL6 A;  3WK9 A;  3SV4 A;  2PFN A;  4NM1 A;  5HHI A;  2Z7J A;  5DBA A;  2I9G A;  4EYI B;  2D6F C;  4NL9 A;  4KLM A;  4RPZ A;  2DKX A;  3OPX A;  2R8J A;  3QXG A;  1Z1B A;  2IHN A;  8ICI A;  5KL8 B;  4NLZ A;  4BDP A;  2KJ5 A;  5ALK A;  1UA0 A;  9ICG A;  2ZIU A;  2W54 A;  4IRC A;  4RQ3 A;  3RRH A;  1FIQ A;  4DFK A;  4E0D A;  2RDJ A;  2JGA A;  2ZIW A;  3NVV A;  4DO9 A;  3V72 A;  2G5H B;  2HHU A;  4ZOH C;  1RZT A;  4DSK A;  1N2X A;  4DCC A;  2DGZ A;  5KG1 A;  2R18 A;  4M6W B;  3L4P A;  5ALG A;  4DSE A;  3UQ0 A;  4C4S A;  3SAH A;  4UAY A;  8ICP A;  5L1I A;  4Y2R A;  1QSS A;  3DV9 A;  2OXO A;  3QU9 A;  5J2J A;  4DOA A;  4PHA A;  2FLL A;  4Q44 A;  5DBC A;  2DF4 B;  1F44 A;  1BPE A;  4Z6D A;  2KNJ A;  5HMM A;  4DFD A;  1L7N A;  3KD3 A;  2DBY A;  1X2I A;  4ED2 A;  5AI8 A;  2OYY A;  3T79 A;  2C2E A;  2UVW A;  1MSW D;  2LM1 A;  3SR6 A;  2C2R A;  4RUC A;  2ZJA A;  2QB0 B;  1XO1 A;  2G09 A;  1JAL A;  2F2A B;  2C2D A;  2ZTD A;  5T14 A;  2W11 A;  2F76 X;  3M8S A;  1IG6 A;  3AQF A;  5KFC A;  5KFA A;  5ALR A;  3LVW A;  1PK1 A;  1CUK A;  4DF4 A;  1T4G A;  2YB4 A;  4ED6 A;  1XSL A;  3RB4 A;  2V4Q A;  3V7K A;  1J2M A;  2ZG6 A;  4QWC A;  1TK0 A;  1D9F A;  5D49 A;  4KLJ A;  1X6I A;  2AXT U;  1DGS A;  5AI0 A;  2K4I A;  3KOO A;  7ICV A;  1N5W A;  4J9N A;  7ICN A;  4J9S A;  5ALH A;  4LVS A;  3NAS A;  5CA7 A;  5BOM A;  4CNQ A;  4J9K A;  2W9C A;  4B9S A;  4QW9 A;  4XRH A;  1ED1 A;  3GQC A;  1X66 A;  2E8O A;  3GFK B;  1ZQB A;  5J0W A;  3HPO A;  3F5A A;  3NVW A;  4UAR A;  2IOF A;  2Y9U A;  5KFS A;  4RQ4 A;  2Q0Z X;  4US9 A;  3Q8R B;  2FPL A;  3RH4 A;  3M7D A;  5KT5 A;  2F3N A;  3NTU A;  1RQL A;  1KSP A;  7ICT A;  3N7R C;  4YMO A;  5GTH U;  1MQ2 A;  1COO A;  2R8G A;  4YG2 A;  3ZDC A;  2F8L A;  1L3S A;  1S97 A;  4UAV A;  2LYB A;  5ALF A;  4DSF A;  2J6S A;  3ALR A;  5AHX A;  2W8K A;  4ECY A;  4P0P A;  3ZDA A;  2P35 A;  3JPQ A;  4PZN A;  5AKZ A;  2IA6 A;  4FBT A;  2JEJ A;  1UHU A;  3C21 A;  4DOC A;  8ICO A;  3TAP A;  2XO7 A;  1NI3 A;  4UAT A;  8ICC A;  4UBC A;  2KE7 A;  5B5E U;  1UPH A;  2W04 A;  1JN3 A;  4UB8 U;  8ICH A;  3TAN A;  4G9B A;  1Q3V A;  4DS4 A;  2G07 A;  5AIC A;  5KG7 A;  1ZD3 A;  3SV3 A;  1ZQA A;  4R66 A;  3PO4 A;  2CN1 A;  2QAR B;  4OD0 A;  1NJZ A;  2PFQ A;  1NKC A;  2ISO A;  3TAQ A;  1CRX A;  3UQ2 A;  3WK5 A;  5ALE A;  2AU0 A;  3U26 A;  1L7M A;  3OHA A;  2O6K A;  1ZQV A;  5IIO A;  7ICO A;  3QZ7 A;  8ICY A;  5J2F A;  2KSO A;  4NLC A;  5EE0 A;  3RJJ A;  1TE2 A;  3R9K A;  4O5C A;  3RBE A;  2E8N A;  4GC7 A;  1RM6 C;  1K1S A;  2A1A A;  2BZF A;  2BPF A;  5J0R A;  3F2B A;  1WWU A;  4YCX A;  5ALV A;  3HWT A;  1BGX T;  1U4B A;  3HP6 A;  1QQ6 A;  1TV9 A;  4RQN A;  4I2A A;  4JWN A;  4EEL A;  5KT7 A;  3KHR A;  2HCF A;  1XSN A;  3IHQ B;  3THV A;  4UAZ A;  3SQI A;  2QB1 A;  2JEF A;  4IRK A;  1B0X A;  4OJ6 A;  4QWD A;  1TVA A;  1DGJ A;  4GXI A;  1BNP A;  3WK7 A;  1OUQ A;  4B9T A;  4C7Z A;  9ICO A;  2W9M A;  1MC8 A;  5J2B A;  4XA5 A;  5AM4 A;  2BKE A;  2KOB A;  2HDO A;  3UMB A;  2A3V A;  1ZQI A;  8ICT A;  2BDU A;  4UB5 A;  4ED7 A;  5KAF U;  1MN8 A;  3BJY A;  2K4H A;  3PX4 A;  1TAQ A;  1O08 A;  2ZIU B;  1EXN A;  5A0L A;  4ED0 A;  4F5P A;  3PO5 A;  4KLT A;  4JB3 A;  4FZL A;  9ICV A;  4K4H A;  3QU2 A;  1Z4O A;  2ZIW B;  4M9N A;  2IOF K;  1PVR A;  4ECX A;  3KFU F;  2QKQ A;  3UXN A;  1X9M A;  3MR5 A;  2RQ5 A;  5KFW A;  2OEH A;  4TQS A;  4O0I A;  2UVU A;  3QX7 A;  3LDA A;  3RR8 A;  4C8M A;  4DSI A;  5JTI A;  2ALZ A;  5CRX A;  4XQ8 A;  2KV2 A;  2ZIX A;  4GIB A;  2RRD A;  1SV4 A;  3V7J A;  3AEV A;  3D2S A;  5KFI A;  4GLX A;  4BUG A;  2JEI A;  1URJ A;  4ACO A;  4M9L A;  4DS5 A;  2WHE A;  4OO1 J;  3B9J A;  1S77 D;  2BGW A;  3JPR A;  3ICX A;  4DWI A;  3HRD D;  4UB2 A;  2XY5 A;  1NJW A;  3BS7 A;  5ALN A;  1OW5 A;  2FJ6 A;  5KFX A;  3JPS A;  3RJI A;  4RU9 A;  2AGO A;  3PSP A;  4YD1 A;  1QTM A;  3H8M A;  2KFZ A;  4RQ2 A;  3ED5 A;  4FE3 A;  8ICJ A;  1ZQQ A;  2KHV A;  4UAS A;  1COK A;  2ZUC A;  2IBK A;  8ICR A;  4Y2Q A;  2RHF A;  2BQU A;  4DFJ A;  4I29 A;  5J0Y A;  5KFZ A;  2FLP A;  1ZD4 A;  4CE6 A;  4KLS A;  5KG5 A;  1NNL A;  4F91 B;  1SB3 C;  4EBE A;  2E3T A;  3QNM A;  1WYG A;  2ASL A;  4EEY A;  5AKH A;  3MDC A;  3PW5 A;  4JMU A;  4I2J A;  2K89 A;  3Q8L A;  4BXO A;  3I28 A;  3PNC A;  5ALP A;  1XO0 A;  2W9C B;  3C1Y A;  5ALD A;  2ZUD A;  5KT2 A;  2DKZ A;  3PSF A;  9ICQ A;  5KFE A;  2H5X A;  9ICW A;  2JZB A;  8ICS A;  2CXY A;  5K4L A;  9ICM A;  3A0B U;  1UT8 A;  4PL2 A;  4R8U A;  3PST A;  5IIK A;  3N97 B;  3TAC B;  4QZC A;  3ETR A;  4CF3 A;  4O3N A;  5J0X A;  3N4M B;  3PR5 B;  4PHD A;  2LI6 A;  1NK7 A;  4PZO A;  2DQN B;  2B21 A;  3I1Y A;  4DL3 A;  4P0P B;  1C20 A;  3WKB A;  3RAX A;  3CYM A;  2IHM A;  4DL4 A;  4YMM A;  1D8B A;  2KHQ A;  4B9U A;  9ICH A;  2KZZ A;  4M9J A;  1ZQW A;  5ALX A;  4R64 A;  1Y88 A;  4C8N A;  7ICG A;  4US8 A;  2KIW A;  2EZZ A;  4Y2V A;  5AKK A;  2VA3 A;  1TFR A;  8ICU A;  3PY8 A;  1IM4 A;  2EZX A;  5KFM A;  9ICX A;  4G3I A;  4RZR A;  4NLK A;  5J0S A;  1M6Y A;  3PR4 A;  4C80 A;  1WCN A;  7ICL A;  5DDM A;  3Q8M A;  4JV2 A;  4CDG A;  4RT2 A;  2EZY A;  3ZI4 A;  2H3I A;  4HAI A;  4YR3 A;  1A6S A;  1YZ7 A;  2KK0 A;  3NRZ A;  4KMO B;  3RR7 A;  5J2A A;  4CF4 A;  4CCH A;  2KSO B;  1KFD A;  8ICQ A;  8ICF A;  3H0R B;  3PML A;  3E2E A;  2BDP A;  4YFK A;  1TAM A;  2ASJ A;  1A76 A;  2HHT A;  2WF7 A;  2HOF A;  5AKE A;  4F4Y A;  3RJE A;  4USA A;  2BCV A;  2B0C A;  3OSP A;  1J2N A;  4ECS A;  2HI0 A;  5KFR A;  1SKR A;  3HW8 A;  2Y9T A;  1KFT A;  3SMV A;  1NK6 A;  4F4Z A;  5F9N A;  1O03 A;  4BWJ A;  3OJS A;  5AIA A;  4IRD A;  4F4W A;  3C2L A;  2P6U A;  5KAI U;  3H8W A;  5J2E A;  5KG0 A;  5ALW A;  3PZP A;  1N48 A;  4KX3 A;  4RPY A;  3RB3 A;  3C5G A;  4O3P A;  1V85 A;  4R63 A;  3D2Q A;  4FBU A;  4DQP A;  4ZH4 A;  4R65 A;  3IG5 A;  5JRT A;  4F2S A;  5EOZ A;  4NLB A;  4MF8 A;  3ZDE A;  4KMU A;  1GO3 F;  1IXR A;  3OHB A;  2WF9 A;  9ICB A;  4OCZ A;  4TUR A;  2XIC A;  1QLN A;  1V38 A;  3C29 A;  4KIT B;  1RQN A;  4MFC A;  4DFP A;  5KT6 A;  4TUP A;  4PGQ A;  5KFL A;  3QUC A;  2NRX A;  3JPT A;  4JK1 A;  5CJ7 A;  1KFS A;  2NRV A;  4QZE A;  3WKC A;  2PXI A;  4RPX A;  3CW2 C;  2ZJ5 A;  3WKD A;  3BQ1 A;  2BQ3 A;  1ZQT A;  4UAW A;  1L3V A;  2JMG A;  2JEG A;  3B0Y A;  3RB0 A;  4J9O A;  4M0A A;  9ICF A;  2WF8 A;  2PMZ C;  3CRX A;  2ZIX B;  1XSP A;  5DDY A;  4ECU A;  1VLB A;  5ALT A;  1ARO P;  3LK9 A;  2WF5 A;  3WK6 A;  3ZDB A;  3SI8 A;  5DLG A;  3FAH A;  2OM6 A;  3Q8K A;  3MDA A;  2FMQ A;  3K1R B;  1JUD A;  5AKY A;  1ZQZ A;  1S0O A;  5AI6 A;  2BQR A;  3C2M A;  1KDH A;  3H40 A;  4JV0 A;  9ICU A;  2B6G A;  3QUB A;  5AKL A;  2R8H A;  3TFR A;  5ALQ A;  1X40 A;  3RF9 A;  4DL7 A;  5AI5 A;  4KX5 A;  4B9M A;  5AK5 A;  2G06 A;  4I28 A;  5EWG A;  2VIX A;  1L3T A;  2KIC A;  3H8J A;  4KLQ A;  3WK8 A;  4MFF A;  4F93 B;  3N28 A;  2WAQ C;  2K60 A;  2KP7 A;  3MGI A;  8ICE A;  3FDS A;  5HHH A;  2XVT A;  5HR6 A;  1L7O A;  2KVC A;  2E8P A;  1P7D A;  4F71 A;  1QH9 A;  2F8K A;  1F5S A;  2JXJ A;  4LJX A;  3C23 A;  3TAD A;  5AM5 A;  4KLG A;  1N56 A;  1SXD A;  5KTQ A;  2OH2 A;  1NK8 A;  1NOM A;  4BXO B;  4C8L A;  4IR9 A;  1YT3 A;  2HOQ A;  3ISC A;  2P6R A;  7ICU A;  1ZJM A;  1RYU A;  3H7I A;  2JH7 A;  9ICR A;  4M04 A;  2EH9 A;  2JR5 A;  2JZB B;  1SL2 A;  2LPE A;  3PW7 A;  2GWS A;  5KFH A;  2ATL A;  2W3R A;  4K4I A;  4R8U B;  1FFV A;  3H0L B;  1ZRN A;  1TK8 A;  3DDH A;  3M9M B;  2PKE A;  3TQ1 A;  3SAG A;  4ELT A;  2JRZ A;  4NLG A;  2JV3 A;  3OGU A;  4B9V A;  2MAX A;  4PGY A;  5AM2 A;  3Q8P B;  5L1J A;  1PZN A;  2G5I B;  2HBM A;  5ALS A;  2ZXI A;  1ZQD A;  5HP4 A;  3IDW A;  2FMP A;  2IOH A;  4NV0 A;  4C7Y A;  4PGX A;  2NV3 A;  5ALJ A;  5AIB A;  5B66 U;  4CF5 A;  1UA1 A;  3UMC A;  4OJ5 A;  5DQI A;  4JV1 A;  4NJ8 A;  1HJP A;  2LKY A;  3NGD A;  1Q46 A;  3FYH A;  4F5O A;  2KJ8 A;  2FPK A;  3AMZ A;  1QQ5 A;  2KVS A;  1KQQ A;  1DOQ A;  4MEY A;  5IIN A;  1NZP A;  5AI9 A;  5KFJ A;  3UMG A;  3QZ8 A;  1ZQX A;  3JPO A;  3M9O B;  4I2B A;  4RNO A;  5AM0 A;  5DB9 A;  3RB6 A;  1XC9 A;  2D8C A;  3BZC A;  3I76 A;  2XCA A;  3OJU A;  3T5J A;  3OSN A;  8ICA A;  2W9A A;  4PHP A;  1RPL A;  1UT5 A;  4X5V A;  1NKE A;  1A77 A;  4YMN A;  2K8A A;  1F0M A;  3ISB A;  1T3N A;  5L9X A;  3FC4 A;  2KN7 A;  3BDP A;  1YZ6 A;  2PMZ F;  3H4D A;  4RQ6 A;  4DFM A;  4U7C A;  4NM2 A;  3UXP A;  4CGZ A;  1NKB A;  3E0F A;  1ZQL A;  4QZ9 A;  3GV8 B;  2XY7 A;  4UB4 A;  3RTV A;  1JXL A;  1C7Y A;  2WFA A;  4QZA A;  2F1J A;  2AGQ A;  1L3U A;  1JI7 A;  2ZTE A;  3BQ2 A;  5J2K A;  3C1Z A;  4Y2P A;  3UPQ A;  1NJX A;  4QZF A;  4YQW A;  4YVZ A;  3PW2 A;  2YB1 A;  4I2E A;  1Q3U A;  4DSJ A;  2KTQ A;  1X9W A;  3T3F A;  4PPX A;  1S76 D;  4Z6F A;  5AKX A;  2DPI A;  3VCB A;  1ZRM A;  2E1F A;  5KFT A;  4TUQ A;  5DBB A;  4PH5 A;  5IIJ A;  1ZQ1 C;  1H38 A;  3NVY A;  7ICQ A;  2ISP A;  1XS9 D;  4ED8 A;  1TK5 A;  1RG6 A;  3GV7 B;  2RLT A;  2WAQ F;  4DLE A;  2PI4 A;  2DFL A;  1U45 A;  2HHV A;  4F4X A;  5EWE A;  1ZQP A;  4QZD A;  3QU5 A;  5TIS U;  3KKA C;  2CRX A;  3UXO A;  2W7O A;  5KFP A;  2Y1J A;  1ZD2 P;  3F53 A;  4UQG A;  5DQH A;  2K8B B;  2YN4 A;  4NXZ A;  2K8C B;  2LBO A;  2W9B A;  1T3Q A;  4O5E A;  5DKW A;  1N5X A;  1XNS A;  4RT3 A;  1NJY A;  3MR3 A;  1ZQF A;  2J6T A;  4QWE A;  5JUM A;  1RYR A;  4I2D A;  1ZOL A;  1PVQ A;  3KBB A;  4CRX A;  2M0N A;  1AQ6 A;  1D8L A;  1J97 A;  2KG5 A;  3GV5 B;  3LYS A;  4Q8F A;  3SAF A;  5KG3 A;  1FFU A;  3BS5 A;  4UB1 A;  4B9N A;  2XGQ A;  2HBL A;  2E5S A;  1LKY A;  3MC1 A;  2Y1I A;  4M9G A;  9ICC A;  3NS1 A;  2D3D A;  2KZM A;  4F50 A;  1SGG A;  5DQG A;  3LVV A;  3GZF A;  2PFO A;  2JH1 A;  2YMP A;  3Q8Q B;  4F72 A;  3AL0 B;  4WJ3 B;  3QEB Z;  1ZJN A;  4NL9 C;  1U9L A;  4IQU A;  7ICR A;  2I5H A;  1Z00 A;  5DLF A;  2ZJ8 A;  1ZYQ A;  3T5H A;  4QWB A;  2KD1 A;  1LV5 A;  2OHF A;  1FO4 A;  1ZQS A;  2J6U A;  3OTQ A;  2UVR A;  3H4B A;  4I2H A;  4F4K A;  3V6J A;  1BPY A;  4F5R A;  2FE9 A;  1V97 A;  4J9R A;  4I2C A;  4HYK A;  2PFP A;  5E79 U;  4ELV A;  5DB7 A;  3KTQ A;  1WWV A;  2LHT A;  3SZ2 A;  2GO7 A;  1JRO A;  3G6X A;  5ALU A;  4DLG A;  3M8R A;  3GDX A;  5ALY A;  2VKQ A;  4UB3 A;  5KG2 A;  2EAN A;  2VJ5 A;  5KFQ A;  3CNH A;  4YN4 A;  2BPG A;  3PVX A;  2K4E A;  2MUT A;  5IIM A;  4YD2 A;  1NK4 A;  4EEK A;  1MQ3 A;  3PW0 A;  4EX6 A;  1KTQ A;  5C0Y A;  2E8M A;  1XWL A;  1ZQR A;  2AJQ A;  1V9P A;  4YP3 A;  1QQ7 A;  1ZQE A;  5CP2 A;  5J2D A;  4O3R A;  2KIV A;  2FPM A;  1JIH A;  4J9P A;  2HMX A;  1BVS A;  2HVH A;  1B43 A;  5AI4 A;  1NK0 A;  3NUQ A;  7ICE A;  5J2G A;  2R8K A;  2HHX A;  1KBU A;  4QZG A;  4DEZ A;  1TAU A;  3QU7 A;  8ICM A;  2KZ3 A;  2C22 A;  8ICB A;  3ONN A;  2NRW A;  3QUQ A;  1S9F A;  5CB1 A;  3HT3 A;  3QYP A;  1ZQH A;  3MGH A;  5HR7 A;  4TQR A;  2VAN A;  4F3O A;  1CI4 A;  2XI9 A;  4PHE A;  4KLL A;  1ZQN A;  3RJK A;  2VJ4 A;  1N62 A;  4KN7 A;  4MFA A;  4Z6E A;  4BGD A;  4M9H A;  3HKZ C;  4UAU A;  3C2K A;  4C0Z A;  1PVP A;  2F1I A;  4P4P A;  2JHD A;  2I6X A;  4EZ6 A;  1RDF A;  2BR0 A;  2HBK A;  3PX0 A;  1Z4N A;  1N63 A;  2WTF A;  2RDI A;  4F8R A;  1RXW A;  3ZD8 A;  2HVI A;  5KT3 A;  4J9M A;  4NLN A;  5DG9 A;  4OJO A;  3RFA A;  1U47 A;  1WUD A;  9ICS A;  8ICV A;  3G6V A;  3H0M B;  1L8L A;  5EE3 A;  1WCL A;  4BJQ A;  2AH5 A;  4I2F A;  1T94 A;  5DB8 A;  2C28 A;  2GH1 A;  1ZQO A;  4UBB A;  1ZQG A;  3TFS A;  1T8E A;  5D46 A;  3SYZ A;  3MFI A;  5J8Y C;  3L3F X;  4RQ5 A;  3QUT A;  1SKS A;  2BCS A;  4Q43 A;  1BPZ A;  4Y2J A;  2HW3 A;  1ZET A;  1PK3 A;  4EBD A;  4ELU A;  2EDU A;  8ICK A;  1QCK A;  3NVZ A;  4PL1 A;  3IG8 A;  1KRP A;  2KKV A;  3J81 j;  9ICJ A;  1VDV A;  2YMM A;  1RYS A;  1K5O A;  3VC8 A;  3MGV A;  4C8K A;  1HUO A;  4EYH B;  8ICG A;  3WKA A;  4IR1 A;  2YML A;  4FS2 A;  4EX7 A;  2ZTC A;  1KEJ A;  3BQ7 A;  3RJH A;  4RQ7 A;  4RNN A;  2L5Y A;  5ALM A;  4JUZ A;  3F2C A;  3EPI A;  5KFG A;  4P4M A;  5J29 A;  2BCQ A;  1SZP A;  4QZB A;  3E58 A;  3RAQ A;  3IV6 A;  1LB2 B;  2YMQ A;  2ZXH A;  3WKE A;  2W9B B;  5AK6 A;  3GU3 A;  4QW8 A;  9ICA A;  3MFH A;  1S0V A;  2XC9 A;  1K1Q A;  1XU4 A;  3K75 D;  4FFD A;  1SL0 A;  3MBY A;  3Q8S B;  9ICT A;  5ALI A;  1HEK A;  5DB6 A;  1FEZ A;  4GFJ A;  4AP9 A;  1B22 A;  2NYV A;  3F5E A;  5G5G A;  1NK9 A;  3BS5 B;  2P66 A;  1BNO A;  1N60 A;  5KT4 A;  4M2Y A;  1LKY B;  4M47 A;  4OJP A;  5J0P A;  2DL0 A;  4YR0 A;  3RH6 A;  2BCU A;  3K1Z A;  5ALL A;  3GIJ A;  5IIL A;  1BPX A;  1A0P A;  1L8O A;  5BPC A;  2NRZ A;  9ICK A;  4YXM A;  1S10 A;  2FMS A;  4KN4 A;  5F3X B;  1Z00 B;  2N1R A;  4Y2X A;  9ICE A;  5KFY A;  4Y2T A;  2KEY A;  1BPB A;  1DK3 A;  4RQ1 A;  3M6K A;  4ICA A;  2G08 A;  3RJG A;  4RNM A;  4P0Q A;  3ISD A;  3AU6 A;  2QLT A;  2H3Q A;  4OJL A;  2RP5 A;  4QJF B;  1DXS A;  4MHV A;  1KL9 A;  4FO6 A;  3AUO A;  2ES6 A;  2GLE A;  2F77 X;  1SIJ A;  2Y0S C;  2K4P A;  2AGP A;  5J0U A;  2XCP A;  2A1J A;  3ETL A;  1Z1V A;  2LMR A;  2ASD A;  1T7P A;  5L1K A;  3HJE A;  3SEI A;  4BWM A;  5J0T A;  4ECR A;  3V6K A;  4O9M A;  3HKZ F;  3QU4 A;  3AU2 A;  2EQY A;  4O3O A;  5KNI A;  5AK4 A;  2V4R A;  5J8Y A;  4RQM A;  3CP8 A;  1UQV A;  9ICL A;  2NO5 A;  1SZH A;  3M1Y A;  4IL6 U;  1Q8K A;  1SKW A;  2BHN A;  2MUT B;  1BPD A;  4IC9 A;  1SL1 A;  4K4G A;  1KN5 A;  4DL2 A;  2XID A;  3EW9 A;  2OCE A;  2MU2 A;  4MF2 A;  2AQ4 A;  1KKX A;  4UW9 A;  3PW4 A;  2KJ9 A;  3BQ0 A;  5KFV A;  3TKA A;  3RBD A;  1JRP A;  5III A;  7ICM A;  4O3Q A;  2GOL A;  4YR2 A;  2LM4 A;  3O0F A;  5ALO A;  5AKJ A;  4PJ0 U;  4F92 B;  3IN5 A;  4Z6C A;  7ICS A;  5AM3 A;  5CWR A;  3C28 A;  3MR6 A;  2AHO B;  4KLD A;  5TZV A;  8ICX A;  1X9X A;  3C5F A;  2ZIV A;  1SWV A;  2FDR A;  2ODG A;  3A0H U;  4J03 A;  2PI5 A;  1ZQK A;  5D4B A;  2V9W A;  2W3S A;  3SEN A;  3K4G A;  5DGB A;  3GIL A;  1SV0 C;  3D6J A;  4Y2U A;  3T5K A;  2KMD A;  4DQR A;  2R8I A;  4ECZ A;  1QSY A;  1TKD A;  4DOB A;  3LWL A;  1U48 A;  1HIW A;  3TAR A;  2YX8 A;  5J0O A;  1PUZ A;  5AKI A;  5J2H A;  4ECT A;  3L5K A;  1ECW A;  3BZK A;  9ICP A;  4KLF A;  4Q45 A;  2E1E A;  1D8Y A;  3G6Y A;  5KFN A;  2YTU A;  3JPN A;  5L1M A;  2MA1 A;  3M9N B;  1DRG A;  1S8O A;  3F2D A;  3PX6 A;  3MAB A;  3QE9 Y;  5EE1 A;  4IQT A;  4XUS A;  4U6P A;  2EAP A;  5BOL A;  4KLI A;  3PSI A;  1UCV A;  4QIW C;  3JPP A;  1X42 A;  4J9Q A;  3T5L A;  3GIM A;  4GXK A;  4Y2S A;  1ZQM A;  1D9D A;  2DUY A;  4AYB C;  1SXE A;  3MR2 A;  4O3S A;  5KFB A;  2Q4T A;  5EWF A;  3AN1 A;  3D2N A;  2G0A A;  8ICW A;  1OXJ A;  5KFU A;  2H3Z A;  4C4R A;  4M6W A;  7ICP A;  2OWO A;  7ICI A;  2WB1 C;  1NK5 A;  2XY6 A;  7ICF A;  2W03 A;  4DQI A;  5DGA A;  3EYZ A;  3RJF A;  2W7P A;  1IIP A;  4B9L A;  5DG7 A;  5H2F U;  1L6N A;  1Z19 A; 
#chains in the Genus database with same CATH homology
 4IS7 A;  1KW4 A;  1PK1 A;  3TAD C;  2E8M A;  1X9X A;  1F0M A;  2KG5 A;  5J8Y C;  2KE7 A;  2LPE A;  5F3X B;  3SEN A;  2KIV A;  2KSO B;  3BS5 A;  2QB0 A;  4NL9 A;  1PK3 A;  1SV0 C;  2DKX A;  2KMD A;  1LKY A;  2D3D A;  2QAR B;  1SGG A;  2DKZ A;  2QKQ A;  2EAO A;  3K1R B;  1DXS A;  4MHV A;  1B4F A;  5JU5 A;  2ES6 A;  2GLE A;  1JI7 A;  4NL9 C;  2YTU A;  2KSO A;  2K4P A;  5JTI A;  2B6G A;  5L1M A;  1Z1V A;  2LMR A;  2Y9T A;  3TAC B;  2JV3 A;  3SEI A;  3BQ7 A;  2E8N A;  2EAP A;  1SV4 A;  1X40 A;  1PK1 B;  2L5Y A;  1X66 A;  2E8O A;  3IDW A;  2ESE A;  2QAR A;  1UCV A;  1WWU A;  2F44 A;  5KNI A;  4PZO A;  3KKA A;  2FE9 A;  4RQN A;  3HIL A;  5J8Y A;  4RQM A;  1UQV A;  2Y9U A;  1RG6 A;  4NJ8 A;  1WWV A;  2K60 A;  2QB1 A;  1SV0 A;  1SXE A;  1B0X A;  2EAM A;  2F3N A;  1V85 A;  3BS7 A;  2E8P A;  1OXJ A;  2F8K A;  1OW5 A;  5JRT A;  3KKA C;  2EAN A;  3TAD A;  3H8M A;  1SXD A;  3BS5 B;  2QB0 B;  2D8C A;  1COK A;  1V38 A;  1LKY B;  2DL0 A;  4PZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...