3KKAC

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 1
total genus 19
structure length 59
sequence length 59
chains with identical sequence D, E
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaC00
2E8PA 1B0XA 1V85A 2KIVA 1WWVA 5KNIA 1SV4A 2D8CA 3BS5A 3TACB 1PK1A 2K60A 2QARB 1B4FA 3IDWA 1SXEA 2EAPA 2E8OA 2Y9UA 5JRTA 5JTIA 1PK3A 2EAOA 2QB0A 3KKAA 2F44A 2FE9A 2LMRA 1OXJA 3BS5B 2D3DA 3HILA 1OW5A 1V38A 2KSOA 2QB1A 1PK1B 2KMDA 3SEIA 1KW4A 2ESEA 4PZNA 1LKYB 1SV0A 1JI7A 1X9XA 2E8NA 5J8YA 2EANA 3H8MA 1F0MA 1SGGA 2GLEA 3BS7A 2KG5A 1X40A 2YTUA 1COKA 4NJ8A 4RQMA 2Y9TA 2F3NA 3K1RB 1DXSA 2EAMA 2DKXA 3SENA 2E8MA 1WWUA 5J8YC 5L1MA 1SXDA 1UCVA 2DL0A 5F3XB 1Z1VA 4MHVA 1X66A 2DKZA 1SV0C 2KSOB 2KE7A 2QKQA 2LPEA 1UQVA 2QARA 4NL9A 4NL9C 1LKYA 1RG6A 4RQNA 2ES6A 2QB0B 2JV3A 4IS7A 2L5YA 4PZOA 3TADC 3TADA 2B6GA 2K4PA 5JU5A 3BQ7A 2F8KA 3KKAC
chains in the Genus database with same CATH superfamily
3UXNA 5DKWA 2G07A 3V72A 2M9NA 3K75D 5H2FU 4WJ3B 3N28A 4YQWA 5KG3A 2XGQA 5KFUA 9ICCA 2AXTU 4OJLA 3UPQA 3RR7A 1KQQA 4DQSA 2K8CB 2AJQA 1D8LA 5DQGA 3IN5A 5DB9A 1PK3A 4F5RA 3QUCA 4YCXA 1L3VA 2LMRA 1JROA 1TV9A 3Q8LA 3SEIA 4KLIA 2IBKA 3TFSA 2OM6A 9ICGA 5KT7A 4RQ7A 1SWWA 4FE3A 2F8LA 3TKAA 2Z7JA 2W3SA 3H8MA 1MSWD 4FO6A 3ZDEA 2FI1A 5J0YA 3V7KA 8ICCA 3TI0A 5ALUA 1KN5A 2YMMA 4F4YA 4MFCA 4R8UB 2WB1F 3SV4A 3N7PD 3GIIA 4F71A 2RP5A 1XSLA 3WU2U 4QWDA 3MBYA 2PI4A 1ZQAA 4UAUA 1B43A 2DKXA 4RU9A 3QU2A 3JPSA 2LYHA 2ZIXA 5AKLA 5J2IA 3WK7A 1URJA 2C28A 2DKZA 2KSOB 5ALWA 3PSPA 5IIIA 5DG9A 2HOFA 3H7IA 3J81j 4QW8A 4QJFB 1JMSA 2AGQA 5J2JA 5CR0A 5KFJA 2K8BB 4GC6A 3C5FA 2YN4A 4PHDA 3TADC 3MR3A 4NLCA 1QSLA 1MC8A 3PMLA 1TAQA 1NK9A 9ICMA 3H4BA 5DLFA 4EBDA 1NJWA 4Z6DA 3F2BA 3LDAA 5KFFA 4DCCA 2QARB 1ZJNA 4UAWA 5AKZA 1B4FA 1Q3UA 9ICNA 5G5HA 2AU0A 1BNPA 3DV9A 5ALLA 1J97A 1WYGA 1TE2A 4RNOA 5AICA 1OXJA 4BXOB 5KT4A 3RBDA 1ZQPA 4FFDA 2BDUA 1VLBA 9ICBA 2ZIWB 4DEZA 4EENA 2NO5A 5J0WA 2J6UA 2N1RA 5ALTA 5AIBA 2FMQA 2C22A 2HI0A 2EZYA 3JPOA 5J0TA 2HHSA 2EQYA 1IV8A 2XC9A 3PO5A 3AU6A 1N61A 4BWJA 8ICXA 3GFKB 1UPHA 5ALIA 2EZXA 2ZUDA 4Y2XA 2J6SA 3SQIA 2EZZA 1NJYA 5L1MA 7ICIA 1ZQQA 3AQFA 3ZI4A 2HHQA 3HP6A 1KRPA 2G5IB 4RNNA 2KOBA 4PJ0U 3KHHA 3BQ1A 2W8KA 4UW9A 3H0MB 3RJFA 5J2CA 2LYBA 2JEGA 4UB6U 4RQ0A 5EWFA 1BPZA 1XSPA 3BZCA 3EPIA 3T5LA 5IILA 5ALKA 3V6JA 5CB1A 5ALNA 2YQEA 4EELA 2KV2A 1DRGA 4USAA 3PW5A 4M6WB 5K4LA 3C29A 3BQ2A 1RZTA 2FLLA 2KJ5A 4UB8U 2Y1IA 1YZ7A 2WAQF 3F2CA 2PFNA 7ICGA 2PMZC 2DF4B 3IM1A 4BDPA 3AQEA 4NWIA 1T8EA 1KEJA 2HHXA 4C7YA 4Q45A 3RAQA 4P0PA 4UB3A 5KFDA 4DF8A 1XO0A 3K1ZA 1BPBA 4O5KA 2H5XA 2KMDA 4OJPA 2YX8A 3RTVA 3QYPA 4KN7A 3ISCA 2XCAA 1SZPA 4J9LA 4DF4A 5KFIA 1SL0A 2WF8A 1JN3A 4PGQA 2F1JA 4DSFA 1IIPA 3WKDA 1PUZA 2BPFA 2NRTA 2HBJA 3C5GA 9ICVA 2R8KA 3KTQA 4OCZA 1CI4A 1O08A 5J0UA 4GXKA 1RXWA 4KLLA 5KFBA 3RRHA 3MR5A 3OJSA 1JXLA 2IOFA 4M9HA 1GO3F 3KOOA 7ICQA 4PH5A 3PO4A 3Q8QB 4F93B 2PI5A 1S5LU 2G06A 4NLBA 1ZD5A 1A0PA 4B6JA 1NK5A 1N5XA 5IIJA 5CA7A 5J0QA 5J0PA 3OSPA 2L5YA 5AKJA 4QW9A 2AGPA 3NASA 7ICUA 2Q4TA 3HT3A 5IINA 4JV0A 4DFMA 3KD3A 2YY6A 7ICVA 5KL8B 1X6IA 9ICRA 4FZLA 1Z00A 5J0OA 3WKAA 2O6KA 3SMVA 8ICMA 5TZVA 2W04A 2KP7A 3T79A 4JK1A 4BXOA 4UARA 5KT3A 2BQ3A 2H3ZA 1RQNA 3WKEA 9ICPA 1N63A 1MQ3A 4Q44A 4R66A 2E3TA 4DO9A 1S0NA 5ALRA 2OCEA 4DSKA 4LZGA 1U47A 4RT2A 4J9SA 5ALJA 4C8MA 5J2HA 3SV3A 5CEHA 3AL0B 1F0MA 1PVRA 2PFQA 3H40A 2G0AA 1NK6A 4EX7A 5ALVA 4O0IA 3SI8A 1X6JA 1V97A 3L4PA 2ZUCA 4I27A 5C0YA 4Y2SA 1DGSA 1ZQJA 7ICHA 2BCRA 3RH6A 4NM2A 4XUSA 5TISU 4UAYA 3F5EA 3ZDCA 4KITB 2W9BB 1SKWA 2UVUA 4J9PA 8ICZA 1HUOA 5AIAA 2VKQA 3D6JA 1ZQDA 3IV6A 4RQ5A 3WK6A 2YB1A 4MFFA 2A3VA 4IRDA 5HNKA 4J03A 4G3IA 2E8PA 4OJ5A 2C2RA 1V85A 1L3SA 1ZQTA 4J9KA 5DG7A 9ICQA 5KFWA 1WWVA 4TQSA 4P0QA 4LJXA 9ICSA 5EE0A 3Q8SB 1PK1A 5KG7A 1DK3A 3Q8KA 1N56A 3IDWA 4DS4A 4RNMA 1ZD2P 2KZMA 2HOIA 3GV7B 2DGZA 2JEJA 4QZCA 5DGBA 4F5OA 1XO1A 3K4GA 1U9LA 2WF7A 5L1IA 8ICTA 2ESEA 2V4RA 4DLEA 7ICEA 4KLGA 3RB4A 4IQTA 4KLOA 3RB3A 1M6YA 3U26A 2HDOA 1L7OA 4P4PA 2WFAA 4R64A 1B22A 4I2EA 1D9FA 2IOFK 1BNOA 2ATLA 4ELTA 4I2BA 4RQ3A 2KG5A 2AQ4A 2EH9A 4QZGA 4I2AA 2KKPA 4PL1A 4M9LA 2NRZA 2BGWA 2KICA 3AMZA 1Y88A 3ISBA 3PSFA 8ICHA 1UA0A 1HIWA 1IG6A 1X66A 4IQUA 1NI3A 2GOLA 3CNHA 2MAXA 2JZBA 2KE7A 2WB1C 2ZIVB 5BOMA 1L7MA 3A0HU 3QX7A 5KAFU 2G08A 5ALDA 4ELUA 3ZD9A 1P7DA 5C5JA 3HX0A 3V6KA 1HJPA 5HHIA 1RG6A 4PGYA 2NYVA 3ZDAA 5L1LA 2R8JA 4QZ9A 5KFPA 4QWAA 2ASJA 1JALA 2G5HB 8ICNA 1L3TA 4GXJA 8ICIA 9ICWA 3NVVA 5ALOA 3GV5B 5CJ7A 1MN8A 2KD1A 3E58A 4EEYA 4ECQA 4Y2YA 1DGJA 3TAQA 2K60A 4KX3A 3M6KA 4F4ZA 4CCHA 5KFEA 5DB7A 1N62A 3RJIA 4DOCA 4K4HA 4QZBA 2Y9UA 5DB8A 4K4IA 3KKAA 5AHXA 4C8KA 1LV5A 3QU5A 2HHUA 2DFLA 1XC9A 3BQ0A 2KVCA 1ZQGA 2HHTA 1D8BA 5EE9A 4NLNA 4CF3A 4FBUA 4ECUA 4C4TA 1ZQYA 3PX0A 3BDPA 2BCSA 1K1SA 2W3RA 4C80A 2I6XA 3HKZC 9ICLA 2W9MA 3O0FA 5D49A 2YMPA 3B0YA 4J9QA 2JEFA 1QSYA 5KTQA 1T7PA 3VC8A 3WK5A 1T3QA 2IHNA 5G5GA 1QSSA 3UMBA 5A0LA 2F2AB 2XIDA 2E8MA 3V6HA 2Q0ZX 5KT2A 1TAUA 3KFUF 4FZMA 1S97A 5J2AA 2KNJA 3ICXA 5AKHA 2ALZA 8ICYA 3NS1A 1TK5A 4FS1A 1ZXIA 3RB0A 3RBEA 5AK3A 2JH7A 2ASDA 4NY8A 5CP2A 2BKEA 5EE1A 4YFKA 2WAQC 4F3OA 5KFXA 1J2NA 3HJEA 7ICJA 1O03A 3PV8A 3T3FA 3SYZA 1EXNA 4JV2A 7ICNA 1F5SA 3EYZA 1NK0A 4LVSA 4Y2VA 4Y2TA 5KG5A 1ZQLA 7ICTA 1OUQA 2D8CA 2I9GA 3EUB2 4UB1A 2MUTB 5KFTA 1SXEA 4DSIA 1ZRNA 2P35A 2JGAA 5ALEA 4HAIA 4EX6A 1BPYA 1L7PA 2VJ4A 4DL6A 4DFDA 3GDXA 3RRGA 2ZIVA 4YR0A 4JV1A 3HW8A 4EBCA 2V4QA 2A19A 1QQ5A 1PK1B 3N4MB 3FYHA 4QWEA 4PZNA 1SV0A 1QLNA 3A0BU 4UQGA 4F8RA 1NK8A 4EEKA 1Q8KA 5AI9A 5AKIA 4KLMA 4QWBA 1U4BA 2K4IA 3NTUA 8ICQA 3R9KA 2ISPA 5J2EA 3TFRA 5AKEA 1HEKA 3LK9A 4UASA 4IRKA 5BOLA 4KLJA 8ICLA 2HMXA 2R8IA 1VDVA 2FPKA 5DBCA 1UHUA 4RQ2A 4IRCA 5F9LA 1NK4A 1UCVA 1AROP 1ZQCA 2W11A 1S9FA 3M8SA 4QZAA 5J2FA 2BQRA 4NM1A 5DLGA 3MFIA 1A77A 1K5OA 5CWRA 3WK4A 2K4EA 1WCLA 3H8JA 4XQ8A 4F2SA 4KLQA 4I2HA 5KFNA 4YD1A 4C8LA 4RUCA 1CUKA 4O3RA 3UXOA 5AKGA 4DL2A 3M7DA 2AGOA 5AM2A 4AYBF 3JPQA 1BGXT 4TUPA 3C28A 3MC1A 9ICIA 1XU4A 5KFGA 8ICWA 2ZJ8A 7ICKA 1JIHA 3PW4A 2W7PA 3RAXA 3PVXA 3E2EA 2NV3A 3QU9A 1D8YA 2FPMA 3OJUA 1FFVA 4OJ6A 4JWNA 5AKXA 4YD2A 2WF9A 1Z1BA 1X9WA 5J0SA 2E5SA 1WCNA 2FJ6A 1FIQA 3T5JA 4J9MA 1V38A 4UB2A 2IHMA 4DQIA 1ZD4A 1S0OA 4BX9C 4YR3A 2ZIUA 5AK6A 1BPEA 3ZD8A 2BZFA 5CHGA 1X9XA 4F72A 3PNCA 2E8NA 3PX6A 1S10A 9ICXA 4BGDA 4F5QA 3B9JA 4FZNA 5HHHA 5KFKA 2PFOA 2KHQA 2G09A 1KBUA 1RM6C 3PW2A 1ZQSA 5DBAA 1NNLA 3PR5B 1X9SA 3WK8A 4ECZA 2XVTA 1MQ2A 1Z4NA 5AKKA 5KFAA 5F3XB 3M9NB 2BHNA 3CW2C 1U45A 2H3QA 5AI0A 3C1ZA 2K8AA 5KFZA 2QKQA 2QARA 2A1AA 2P66A 3JPPA 2ZTCA 2IA6A 7ICRA 5AKYA 4B9VA 8ICBA 4KLUA 4O3OA 3TADA 1X2IA 2B6GA 5B5EU 5DQHA 2DWQA 3NUQA 3T5KA 2PXIA 2KK0A 2ZIWA 5ALFA 2W9CB 1ED1A 2Y0SF 4EYIB 9ICOA 3TACB 2BR0A 3JPNA 2BCUA 1RDFA 1SL2A 5AI6A 2RDIA 5EE3A 2I5HA 2KN7A 8ICGA 5JTIA 4DFJA 1ZQVA 2QLTA 1SKSA 4PPXA 4YXMA 1PVPA 5JUMA 3UMGA 3E0FA 8ICVA 2ZTDA 5ALSA 3EWAA 1JI7A 2KEYA 4O3QA 2W54A 5KFOA 2W7OA 5J8YA 2XI9A 2XY5A 2GH1A 4UATA 4PHAA 3MABA 3F2DA 1COKA 5KFHA 3OPXA 1NJZA 4DQPA 2Y9TA 4YMMA 1C7YA 4CNQA 5HP4A 3KZXA 5KFQA 3AU2A 3PSTA 2EAMA 5HR6A 1BPXA 8ICEA 3MGVA 3RR8A 1NJXA 4M04A 4I2JA 4MHVA 2HBKA 4I29A 9ICJA 3UQ0A 5DB6A 5DDMA 2R8HA 2RQ5A 4NL9A 4ECWA 1SWVA 8ICKA 5CRXA 5IIOA 3HWTA 2HW3A 1S0VA 4RQNA 4DOAA 4XRHA 4IR1A 9ICTA 4KMOB 4F50A 4DSJA 4U6PA 4J9NA 5JU5A 2KZ3A 3Q8RB 4EZ9A 4ED1A 1BPDA 1NKCA 4GXIA 1L7NA 4P2HA 4C8NA 4FS2A 3SZ2A 2OYYA 5IIMA 4Z6FA 4Z6CA 5KAIU 4EBEA 2FPLA 4DL3A 1ZQKA 4YP3A 2F44A 1JUDA 2FE9A 2MA1A 4KLDA 4BUGA 3MDCA 5J0XA 1NZBA 2BCQA 5AI4A 3S6JA 4IC9A 2NRWA 2BQUA 1RQLA 3QEAZ 1H38A 2VA3A 3RJGA 4M47A 3LVWA 5FP0A 2HVHA 2IMWP 2GLEA 2WF6A 3RJKA 4B9UA 3QNMA 1D9DA 2FMPA 4P4OA 2DQNB 4CF5A 2ASLA 4DSLA 4I2IA 5AK4A 5HR7A 4J9OA 5ALGA 1PVQA 1IM4A 1AQ6A 2ZUBA 5L9XA 5GTIU 4DQRA 2GO7A 2ZXIA 1WWUA 5AM0A 4AYBC 4ECSA 1WG8A 2KFZA 3NVZA 5KFVA 3KHLA 4PHPA 3CYMA 5DGAA 1SV0C 4NLKA 4M2YA 2AQ0A 2KTQA 1T4GA 1KFDA 1LVHA 5EOZA 9ICEA 5HMMA 3PX4A 4DS5A 3QZ7A 2C2EA 5ALHA 5ALPA 4ECRA 3AM9A 7ICOA 5E79U 2I1QA 4ECYA 3UM9A 2ES6A 2LM1A 2HBMA 2JR5A 3SR6A 1DOQA 2JH1A 7ICMA 3DDHA 2HVIA 1LB2B 4QZDA 1COOA 1B0XA 5KT6A 2UVWA 8ICFA 1NZPA 3FM9A 5KFYA 5KNIA 1SV4A 3BS5A 4YMNA 1UT8A 1TVAA 4KLTA 4TURA 3RF9A 5JRTA 2E1FA 1UA1A 2EAOA 4B9MA 4KN4A 9ICKA 1BVSA 3BZKA 4I2CA 8ICJA 3M8RA 3M1YA 1NKBA 1ZETA 1Q46A 4YG2A 4TQRA 1L5UA 4DL4A 4YN4A 3PZPA 3ORYA 4JWMA 3SAGA 2HCFA 2YMQA 2PMZF 3FC4A 1TK0A 3MDAA 1ZD3A 1ZRMA 4C4RA 1L3UA 2LBOA 3BS7A 1L8OA 4UAZA 1FEZA 4CRXA 2P6RA 4I28A 2HOQA 4F91B 3MFHA 5L1KA 2ISOA 5J2DA 2WTFA 3I28A 3G6VA 4UAVA 2K4HA 3WKCA 4MF8A 1X42A 1HUZA 3DEEA 4NXZA 2DL0A 1ZQMA 7ICPA 4EYHB 4KLHA 3IP4B 4RQ6A 5KG0A 3IG5A 4NV0A 4F5NA 2ZIUB 3L3FX 3OGUA 4U7CA 4NL9C 3C2MA 1ZQFA 2LM4A 4QZ8A 1N2XA 1ZQRA 4PL2A 2RHFA 3WK9A 2A1JB 3C23A 4E0DA 1ZYQA 3V7JA 2K4PA 4ED0A 3N7RC 1DK2A 4JB3A 5J29A 3NRZA 2KIVA 4RZRA 5KFRA 4ECVA 2F1HA 5AM3A 2JHDA 2VIXA 3MR2A 3C1YA 2JXJA 1RXVA 4B9SA 4YXJA 3T5HA 1TAMA 3AEVA 5KT5A 4M0AA 2QB0A 3AN1A 4F2RA 5KG2A 8ICUA 4QZIA 2UVVA 2FLNA 5J2GA 1S0MA 2MSNA 2BCVA 2OH2A 4K4GA 3Q8MA 5AK5A 4BWMA 2HBLA 3ETRA 5D46A 2QB1A 3ALRA 1QTMA 3C2LA 4UB4A 5DBBA 1KTQA 5AI5A 1NOMA 3VCBA 1ZQBA 4C8OA 5T14A 4YMOA 4P0PB 5HMLA 2W55A 4RPZA 4F92B 2EANA 3KHRA 4GLXA 3FDSA 4HYKA 5DQIA 1J2MA 4F5PA 2D6FC 4P0QB 5AM4A 2YTUA 2HHWA 5KG6A 4O5EA 2WHEA 2YMLA 7ICFA 3PSIA 1A6SA 9ICFA 3M9MB 2ODGA 4KLFA 5F9NA 1IXRA 1ZQWA 3SENA 4RQ8A 1JXEA 3GILA 3EZ5A 3QUQA 5ALQA 3CRXA 2P6UA 2W03A 3I76A 3UMCA 4CDGA 4IQWA 1X9MA 1CEZA 1JRPA 1LKYA 2XY7A 3OSNA 2ZXHA 4M9NA 4PZOA 5J0RA 5DDYA 1ZQUA 1PZNA 2JEIA 2CXYA 3HPOA 3KKAC 2LHTA 4MFAA 2R8GA 4NLZA 1NK7A 2MRLA 1ZQZA 3RJEA 1MA7A 3CP8A 2AH5A 4O3MA 3G6YA 2A1JA 2B21A 5DG8A 2F77X 3H4DA 5KG1A 3PY8A 4RQ4A 4Y2QA 2IOHA 1Z00B 4DWIA 2F76X 2D3DA 3HILA 4P4MA 1XSNA 1OW5A 1L8LA 1RYSA 1ZQNA 2KJ9A 2DPJA 4EZ6A 3IRUA 4C7ZA 5EWEA 4CF4A 5KG4A 1NKEA 1KL9A 4QNLA 1SGGA 3KHGA 4AP9A 2EDUA 8ICRA 2Y0SC 1U49A 1S8OA 2BPGA 4NJ8A 2JMGA 4B9TA 2Y1JA 4TUSA 4B9LA 3N97B 4OD0A 4UBCA 2J6TA 3PW7A 1ZQEA 5ALZA 2XICA 4FBTA 4G9BA 3F5AA 8ICAA 1ZQHA 9ICHA 5KFLA 4I2FA 3QUTA 5AM1A 2MUTA 3SAHA 1ZQOA 5KFMA 4M9GA 1SIJA 2JRZA 4IQVA 3LWLA 4IS7A 4JMUA 1CRXA 2VANA 3LYSA 2BDPA 2V9WA 2LYAA 5EWGA 4LZDA 4ED7A 1V9PA 2VA8A 3IHQB 1TK8A 2PKEA 4Z6EA 5L1JA 4ELVA 4R8UA 4ACOA 4ICAA 1XWLA 1Z19A 1Q3VA 3RJJA 3MR6A 4US8A 2RRDA 1C20A 2BPCA 2H3FA 3JPTA 3NRWA 4GIBA 3TAPA 2KSOA 1ECWA 4RPYA 4QIWF 2KJ8A 3IG8A 3ISDA 2ZIXB 2KVSA 1K1QA 3L5KA 3NVWA 5ALYA 4YVZA 1RYRA 4Y2JA 4DQQA 1N5WA 1RPLA 4KLSA 1T3NA 3NGDA 3OTQA 5IIKA 1S77D 3QE9Y 2AHOB 4O3PA 4KLEA 9ICUA 4RQMA 1TFRA 3RJHA 7ICSA 2HSZA 3Q8PB 4ED3A 3TARA 3K1RB 4ZOHC 3HRDD 3ZDDA 4O3SA 8ICOA 5J8YC 3TQ1A 2FMSA 2KIWA 4XA5A 2ZJAA 5J2BA 3M9OB 2NRXA 2NRVA 2FDRA 4J9RA 1U48A 4YR2A 3JPRA 3ONNA 2OEHA 2C2DA 2B0CA 4US9A 2LPEA 4UBBA 4DSEA 1XNSA 2M0NA 2OWOA 3THVA 4CGZA 1ZQ1C 1N48A 2QB0B 1S76D 2JV3A 4QZEA 4RT3A 4ED2A 4BJQA 3BQ7A 4X5VA 4PGXA 4I2GA 3EW9A 3D2QA 2ZG6A 4MEYA 3BQTA 2H3VA 2KKVA 4Q43A 4KMUA 3KBBA 3D2NA 4UB5A 3GQCA 2YB4A 1VJ5A 3PW0A 2W9CA 4NLGA 2EAPA 3D2SA 4ECTA 2E8OA 3GU3A 1JX4A 3OHBA 1FO4A 2MU2A 2KHVA 2DBYA 4O3NA 4DFPA 2E1EA 4ED6A 3RH4A 4KTQA 2OXOA 4OJOA 3MGHA 7ICLA 2GWSA 5AM5A 5GTHU 1KW4A 1N60A 3QZ8A 4A8EA 1LKYB 3WKBA 4GC7A 1KDHA 4IR9A 2CRXA 2KFNA 2W9BA 3QXGA 3C21A 2ZTEA 1KLNA 8ICPA 3N7SC 2R18A 3PR4A 4MF2A 2LI6A 4MEXA 1QH9A 1T94A 1X40A 4OO1J 3RFAA 2RDJA 2CPRA 4M6WA 4C0ZA 4ECXA 4IL6U 4JUZA 2F3NA 5J2KA 1ZJMA 5D4BA 1SB3C 1YT3A 3G6XA 2HHVA 2FLPA 1ZQXA 4O5CA 1SXDA 5B66U 3QU7A 4R65A 2H3IA 4ED8A 2PFPA 1QQ6A 3FAHA 3V7LA 1Z3EB 3ETLA 2XO7A 2DPIA 2XGPA 3LVVA 3SD7A 5ALXA 4DLGA 9ICAA 1WUDA 2WF5A 3B0XA 2K89A 2OHFA 4QWCA 2UVRA 4DL7A 2DUYA 5KL1B 3ED5A 4RUAA 3ZDBA 3QEBZ 2NO4A 2XY6A 4RQ1A 3HKZF 3C2KA 1XS9D 4ZH4A 4DL5A 3GIKA 4F4XA 3H0LB 3RH5A 2W8LA 1YZ6A 3UQ2A 4RPXA 3KZIU 4QIWC 3BS5B 4C4SA 2ZJ5A 3TANA 2JZBB 4R63A 3GIJA 2LKYA 4CE6A 3H8SA 4DFKA 3M6ZA 5ALMA 1SKRA 3RB6A 3SAFA 3BJYA 5AI8A 3UXPA 5KFCA 3GIMA 4QZHA 1TKDA 3GZFA 4GFJA 4I2DA 4Y2PA 4Y2RA 4PHEA 3QUBA 1FFUA 4O9MA 3H0RB 4F4KA 4Y2UA 3F53A 1A76A 8ICSA 1L6NA 4Q8FA 3LWMA 3QU4A 2CN1A 1QQ7A 1ZOLA 1KSPA 2XCPA 2RLTA 1DXSA 1ZQIA 1KKXA 3OHAA 4DOBA 1Z4OA 4B9NA 1Z1VA 4M9JA 1KFSA 3EPGA 2W43A 5KFSA 4Q8EA 5BPCA 3GV8B 4KX5A 1SZHA 3PMNA 1UQVA 3NVYA 2KZZA 3MGIA 3I1YA 4F4WA 1F44A 2W9AA 4TUQA 2VJ5A 1RYUA 1UT5A 1SL1A 1KFTA 2VA2A 3H8WA 1QCKA 2F1IA 4QZFA 3AUOA 2F8KA
chains in the Genus database with same CATH topology
2E8PA 1B0XA 1V85A 2KIVA 1WWVA 5KNIA 1SV4A 2D8CA 3BS5A 3TACB 1PK1A 2K60A 2QARB 1B4FA 3IDWA 1SXEA 2EAPA 2E8OA 2Y9UA 5JRTA 5JTIA 1PK3A 2EAOA 2QB0A 3KKAA 2F44A 2FE9A 2LMRA 1OXJA 3BS5B 2D3DA 3HILA 1OW5A 1V38A 2KSOA 2QB1A 1PK1B 2KMDA 3SEIA 1KW4A 2ESEA 4PZNA 1LKYB 1SV0A 1JI7A 1X9XA 2E8NA 5J8YA 2EANA 3H8MA 1F0MA 1SGGA 2GLEA 3BS7A 2KG5A 1X40A 2YTUA 1COKA 4NJ8A 4RQMA 2Y9TA 2F3NA 3K1RB 1DXSA 2EAMA 2DKXA 3SENA 2E8MA 1WWUA 5J8YC 5L1MA 1SXDA 1UCVA 2DL0A 5F3XB 1Z1VA 4MHVA 1X66A 2DKZA 1SV0C 2KSOB 2KE7A 2QKQA 2LPEA 1UQVA 2QARA 4NL9A 4NL9C 1LKYA 1RG6A 4RQNA 2ES6A 2QB0B 2JV3A 4IS7A 2L5YA 4PZOA 3TADC 3TADA 2B6GA 2K4PA 5JU5A 3BQ7A 2F8KA 3KKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8P A;  1B0X A;  1V85 A;  2KIV A;  1WWV A;  5KNI A;  1SV4 A;  2D8C A;  3BS5 A;  3TAC B;  1PK1 A;  2K60 A;  2QAR B;  1B4F A;  3IDW A;  1SXE A;  2EAP A;  2E8O A;  2Y9U A;  5JRT A;  5JTI A;  1PK3 A;  2EAO A;  2QB0 A;  3KKA A;  2F44 A;  2FE9 A;  2LMR A;  1OXJ A;  3BS5 B;  2D3D A;  3HIL A;  1OW5 A;  1V38 A;  2KSO A;  2QB1 A;  1PK1 B;  2KMD A;  3SEI A;  1KW4 A;  2ESE A;  4PZN A;  1LKY B;  1SV0 A;  1JI7 A;  1X9X A;  2E8N A;  5J8Y A;  2EAN A;  3H8M A;  1F0M A;  1SGG A;  2GLE A;  3BS7 A;  2KG5 A;  1X40 A;  2YTU A;  1COK A;  4NJ8 A;  4RQM A;  2Y9T A;  2F3N A;  3K1R B;  1DXS A;  2EAM A;  2DKX A;  3SEN A;  2E8M A;  1WWU A;  5J8Y C;  5L1M A;  1SXD A;  1UCV A;  2DL0 A;  5F3X B;  1Z1V A;  4MHV A;  1X66 A;  2DKZ A;  1SV0 C;  2KSO B;  2KE7 A;  2QKQ A;  2LPE A;  1UQV A;  2QAR A;  4NL9 A;  4NL9 C;  1LKY A;  1RG6 A;  4RQN A;  2ES6 A;  2QB0 B;  2JV3 A;  4IS7 A;  2L5Y A;  4PZO A;  3TAD C;  3TAD A;  2B6G A;  2K4P A;  5JU5 A;  3BQ7 A;  2F8K A;  3KKA C; 
#chains in the Genus database with same CATH topology
 3UXN A;  5DKW A;  2G07 A;  3V72 A;  2M9N A;  3K75 D;  5H2F U;  4WJ3 B;  3N28 A;  4YQW A;  5KG3 A;  2XGQ A;  5KFU A;  9ICC A;  2AXT U;  4OJL A;  3UPQ A;  3RR7 A;  1KQQ A;  4DQS A;  2K8C B;  2AJQ A;  1D8L A;  5DQG A;  3IN5 A;  5DB9 A;  1PK3 A;  4F5R A;  3QUC A;  4YCX A;  1L3V A;  2LMR A;  1JRO A;  1TV9 A;  3Q8L A;  3SEI A;  4KLI A;  2IBK A;  3TFS A;  2OM6 A;  9ICG A;  5KT7 A;  4RQ7 A;  1SWW A;  4FE3 A;  2F8L A;  3TKA A;  2Z7J A;  2W3S A;  3H8M A;  1MSW D;  4FO6 A;  3ZDE A;  2FI1 A;  5J0Y A;  3V7K A;  8ICC A;  3TI0 A;  5ALU A;  1KN5 A;  2YMM A;  4F4Y A;  4MFC A;  4R8U B;  2WB1 F;  3SV4 A;  3N7P D;  3GII A;  4F71 A;  2RP5 A;  1XSL A;  3WU2 U;  4QWD A;  3MBY A;  2PI4 A;  1ZQA A;  4UAU A;  1B43 A;  2DKX A;  4RU9 A;  3QU2 A;  3JPS A;  2LYH A;  2ZIX A;  5AKL A;  5J2I A;  3WK7 A;  1URJ A;  2C28 A;  2DKZ A;  2KSO B;  5ALW A;  3PSP A;  5III A;  5DG9 A;  2HOF A;  3H7I A;  3J81 j;  4QW8 A;  4QJF B;  1JMS A;  2AGQ A;  5J2J A;  5CR0 A;  5KFJ A;  2K8B B;  4GC6 A;  3C5F A;  2YN4 A;  4PHD A;  3TAD C;  3MR3 A;  4NLC A;  1QSL A;  1MC8 A;  3PML A;  1TAQ A;  1NK9 A;  9ICM A;  3H4B A;  5DLF A;  4EBD A;  1NJW A;  4Z6D A;  3F2B A;  3LDA A;  5KFF A;  4DCC A;  2QAR B;  1ZJN A;  4UAW A;  5AKZ A;  1B4F A;  1Q3U A;  9ICN A;  5G5H A;  2AU0 A;  1BNP A;  3DV9 A;  5ALL A;  1J97 A;  1WYG A;  1TE2 A;  4RNO A;  5AIC A;  1OXJ A;  4BXO B;  5KT4 A;  3RBD A;  1ZQP A;  4FFD A;  2BDU A;  1VLB A;  9ICB A;  2ZIW B;  4DEZ A;  4EEN A;  2NO5 A;  5J0W A;  2J6U A;  2N1R A;  5ALT A;  5AIB A;  2FMQ A;  2C22 A;  2HI0 A;  2EZY A;  3JPO A;  5J0T A;  2HHS A;  2EQY A;  1IV8 A;  2XC9 A;  3PO5 A;  3AU6 A;  1N61 A;  4BWJ A;  8ICX A;  3GFK B;  1UPH A;  5ALI A;  2EZX A;  2ZUD A;  4Y2X A;  2J6S A;  3SQI A;  2EZZ A;  1NJY A;  5L1M A;  7ICI A;  1ZQQ A;  3AQF A;  3ZI4 A;  2HHQ A;  3HP6 A;  1KRP A;  2G5I B;  4RNN A;  2KOB A;  4PJ0 U;  3KHH A;  3BQ1 A;  2W8K A;  4UW9 A;  3H0M B;  3RJF A;  5J2C A;  2LYB A;  2JEG A;  4UB6 U;  4RQ0 A;  5EWF A;  1BPZ A;  1XSP A;  3BZC A;  3EPI A;  3T5L A;  5IIL A;  5ALK A;  3V6J A;  5CB1 A;  5ALN A;  2YQE A;  4EEL A;  2KV2 A;  1DRG A;  4USA A;  3PW5 A;  4M6W B;  5K4L A;  3C29 A;  3BQ2 A;  1RZT A;  2FLL A;  2KJ5 A;  4UB8 U;  2Y1I A;  1YZ7 A;  2WAQ F;  3F2C A;  2PFN A;  7ICG A;  2PMZ C;  2DF4 B;  3IM1 A;  4BDP A;  3AQE A;  4NWI A;  1T8E A;  1KEJ A;  2HHX A;  4C7Y A;  4Q45 A;  3RAQ A;  4P0P A;  4UB3 A;  5KFD A;  4DF8 A;  1XO0 A;  3K1Z A;  1BPB A;  4O5K A;  2H5X A;  2KMD A;  4OJP A;  2YX8 A;  3RTV A;  3QYP A;  4KN7 A;  3ISC A;  2XCA A;  1SZP A;  4J9L A;  4DF4 A;  5KFI A;  1SL0 A;  2WF8 A;  1JN3 A;  4PGQ A;  2F1J A;  4DSF A;  1IIP A;  3WKD A;  1PUZ A;  2BPF A;  2NRT A;  2HBJ A;  3C5G A;  9ICV A;  2R8K A;  3KTQ A;  4OCZ A;  1CI4 A;  1O08 A;  5J0U A;  4GXK A;  1RXW A;  4KLL A;  5KFB A;  3RRH A;  3MR5 A;  3OJS A;  1JXL A;  2IOF A;  4M9H A;  1GO3 F;  3KOO A;  7ICQ A;  4PH5 A;  3PO4 A;  3Q8Q B;  4F93 B;  2PI5 A;  1S5L U;  2G06 A;  4NLB A;  1ZD5 A;  1A0P A;  4B6J A;  1NK5 A;  1N5X A;  5IIJ A;  5CA7 A;  5J0Q A;  5J0P A;  3OSP A;  2L5Y A;  5AKJ A;  4QW9 A;  2AGP A;  3NAS A;  7ICU A;  2Q4T A;  3HT3 A;  5IIN A;  4JV0 A;  4DFM A;  3KD3 A;  2YY6 A;  7ICV A;  5KL8 B;  1X6I A;  9ICR A;  4FZL A;  1Z00 A;  5J0O A;  3WKA A;  2O6K A;  3SMV A;  8ICM A;  5TZV A;  2W04 A;  2KP7 A;  3T79 A;  4JK1 A;  4BXO A;  4UAR A;  5KT3 A;  2BQ3 A;  2H3Z A;  1RQN A;  3WKE A;  9ICP A;  1N63 A;  1MQ3 A;  4Q44 A;  4R66 A;  2E3T A;  4DO9 A;  1S0N A;  5ALR A;  2OCE A;  4DSK A;  4LZG A;  1U47 A;  4RT2 A;  4J9S A;  5ALJ A;  4C8M A;  5J2H A;  3SV3 A;  5CEH A;  3AL0 B;  1F0M A;  1PVR A;  2PFQ A;  3H40 A;  2G0A A;  1NK6 A;  4EX7 A;  5ALV A;  4O0I A;  3SI8 A;  1X6J A;  1V97 A;  3L4P A;  2ZUC A;  4I27 A;  5C0Y A;  4Y2S A;  1DGS A;  1ZQJ A;  7ICH A;  2BCR A;  3RH6 A;  4NM2 A;  4XUS A;  5TIS U;  4UAY A;  3F5E A;  3ZDC A;  4KIT B;  2W9B B;  1SKW A;  2UVU A;  4J9P A;  8ICZ A;  1HUO A;  5AIA A;  2VKQ A;  3D6J A;  1ZQD A;  3IV6 A;  4RQ5 A;  3WK6 A;  2YB1 A;  4MFF A;  2A3V A;  4IRD A;  5HNK A;  4J03 A;  4G3I A;  2E8P A;  4OJ5 A;  2C2R A;  1V85 A;  1L3S A;  1ZQT A;  4J9K A;  5DG7 A;  9ICQ A;  5KFW A;  1WWV A;  4TQS A;  4P0Q A;  4LJX A;  9ICS A;  5EE0 A;  3Q8S B;  1PK1 A;  5KG7 A;  1DK3 A;  3Q8K A;  1N56 A;  3IDW A;  4DS4 A;  4RNM A;  1ZD2 P;  2KZM A;  2HOI A;  3GV7 B;  2DGZ A;  2JEJ A;  4QZC A;  5DGB A;  4F5O A;  1XO1 A;  3K4G A;  1U9L A;  2WF7 A;  5L1I A;  8ICT A;  2ESE A;  2V4R A;  4DLE A;  7ICE A;  4KLG A;  3RB4 A;  4IQT A;  4KLO A;  3RB3 A;  1M6Y A;  3U26 A;  2HDO A;  1L7O A;  4P4P A;  2WFA A;  4R64 A;  1B22 A;  4I2E A;  1D9F A;  2IOF K;  1BNO A;  2ATL A;  4ELT A;  4I2B A;  4RQ3 A;  2KG5 A;  2AQ4 A;  2EH9 A;  4QZG A;  4I2A A;  2KKP A;  4PL1 A;  4M9L A;  2NRZ A;  2BGW A;  2KIC A;  3AMZ A;  1Y88 A;  3ISB A;  3PSF A;  8ICH A;  1UA0 A;  1HIW A;  1IG6 A;  1X66 A;  4IQU A;  1NI3 A;  2GOL A;  3CNH A;  2MAX A;  2JZB A;  2KE7 A;  2WB1 C;  2ZIV B;  5BOM A;  1L7M A;  3A0H U;  3QX7 A;  5KAF U;  2G08 A;  5ALD A;  4ELU A;  3ZD9 A;  1P7D A;  5C5J A;  3HX0 A;  3V6K A;  1HJP A;  5HHI A;  1RG6 A;  4PGY A;  2NYV A;  3ZDA A;  5L1L A;  2R8J A;  4QZ9 A;  5KFP A;  4QWA A;  2ASJ A;  1JAL A;  2G5H B;  8ICN A;  1L3T A;  4GXJ A;  8ICI A;  9ICW A;  3NVV A;  5ALO A;  3GV5 B;  5CJ7 A;  1MN8 A;  2KD1 A;  3E58 A;  4EEY A;  4ECQ A;  4Y2Y A;  1DGJ A;  3TAQ A;  2K60 A;  4KX3 A;  3M6K A;  4F4Z A;  4CCH A;  5KFE A;  5DB7 A;  1N62 A;  3RJI A;  4DOC A;  4K4H A;  4QZB A;  2Y9U A;  5DB8 A;  4K4I A;  3KKA A;  5AHX A;  4C8K A;  1LV5 A;  3QU5 A;  2HHU A;  2DFL A;  1XC9 A;  3BQ0 A;  2KVC A;  1ZQG A;  2HHT A;  1D8B A;  5EE9 A;  4NLN A;  4CF3 A;  4FBU A;  4ECU A;  4C4T A;  1ZQY A;  3PX0 A;  3BDP A;  2BCS A;  1K1S A;  2W3R A;  4C80 A;  2I6X A;  3HKZ C;  9ICL A;  2W9M A;  3O0F A;  5D49 A;  2YMP A;  3B0Y A;  4J9Q A;  2JEF A;  1QSY A;  5KTQ A;  1T7P A;  3VC8 A;  3WK5 A;  1T3Q A;  2IHN A;  5G5G A;  1QSS A;  3UMB A;  5A0L A;  2F2A B;  2XID A;  2E8M A;  3V6H A;  2Q0Z X;  5KT2 A;  1TAU A;  3KFU F;  4FZM A;  1S97 A;  5J2A A;  2KNJ A;  3ICX A;  5AKH A;  2ALZ A;  8ICY A;  3NS1 A;  1TK5 A;  4FS1 A;  1ZXI A;  3RB0 A;  3RBE A;  5AK3 A;  2JH7 A;  2ASD A;  4NY8 A;  5CP2 A;  2BKE A;  5EE1 A;  4YFK A;  2WAQ C;  4F3O A;  5KFX A;  1J2N A;  3HJE A;  7ICJ A;  1O03 A;  3PV8 A;  3T3F A;  3SYZ A;  1EXN A;  4JV2 A;  7ICN A;  1F5S A;  3EYZ A;  1NK0 A;  4LVS A;  4Y2V A;  4Y2T A;  5KG5 A;  1ZQL A;  7ICT A;  1OUQ A;  2D8C A;  2I9G A;  3EUB 2;  4UB1 A;  2MUT B;  5KFT A;  1SXE A;  4DSI A;  1ZRN A;  2P35 A;  2JGA A;  5ALE A;  4HAI A;  4EX6 A;  1BPY A;  1L7P A;  2VJ4 A;  4DL6 A;  4DFD A;  3GDX A;  3RRG A;  2ZIV A;  4YR0 A;  4JV1 A;  3HW8 A;  4EBC A;  2V4Q A;  2A19 A;  1QQ5 A;  1PK1 B;  3N4M B;  3FYH A;  4QWE A;  4PZN A;  1SV0 A;  1QLN A;  3A0B U;  4UQG A;  4F8R A;  1NK8 A;  4EEK A;  1Q8K A;  5AI9 A;  5AKI A;  4KLM A;  4QWB A;  1U4B A;  2K4I A;  3NTU A;  8ICQ A;  3R9K A;  2ISP A;  5J2E A;  3TFR A;  5AKE A;  1HEK A;  3LK9 A;  4UAS A;  4IRK A;  5BOL A;  4KLJ A;  8ICL A;  2HMX A;  2R8I A;  1VDV A;  2FPK A;  5DBC A;  1UHU A;  4RQ2 A;  4IRC A;  5F9L A;  1NK4 A;  1UCV A;  1ARO P;  1ZQC A;  2W11 A;  1S9F A;  3M8S A;  4QZA A;  5J2F A;  2BQR A;  4NM1 A;  5DLG A;  3MFI A;  1A77 A;  1K5O A;  5CWR A;  3WK4 A;  2K4E A;  1WCL A;  3H8J A;  4XQ8 A;  4F2S A;  4KLQ A;  4I2H A;  5KFN A;  4YD1 A;  4C8L A;  4RUC A;  1CUK A;  4O3R A;  3UXO A;  5AKG A;  4DL2 A;  3M7D A;  2AGO A;  5AM2 A;  4AYB F;  3JPQ A;  1BGX T;  4TUP A;  3C28 A;  3MC1 A;  9ICI A;  1XU4 A;  5KFG A;  8ICW A;  2ZJ8 A;  7ICK A;  1JIH A;  3PW4 A;  2W7P A;  3RAX A;  3PVX A;  3E2E A;  2NV3 A;  3QU9 A;  1D8Y A;  2FPM A;  3OJU A;  1FFV A;  4OJ6 A;  4JWN A;  5AKX A;  4YD2 A;  2WF9 A;  1Z1B A;  1X9W A;  5J0S A;  2E5S A;  1WCN A;  2FJ6 A;  1FIQ A;  3T5J A;  4J9M A;  1V38 A;  4UB2 A;  2IHM A;  4DQI A;  1ZD4 A;  1S0O A;  4BX9 C;  4YR3 A;  2ZIU A;  5AK6 A;  1BPE A;  3ZD8 A;  2BZF A;  5CHG A;  1X9X A;  4F72 A;  3PNC A;  2E8N A;  3PX6 A;  1S10 A;  9ICX A;  4BGD A;  4F5Q A;  3B9J A;  4FZN A;  5HHH A;  5KFK A;  2PFO A;  2KHQ A;  2G09 A;  1KBU A;  1RM6 C;  3PW2 A;  1ZQS A;  5DBA A;  1NNL A;  3PR5 B;  1X9S A;  3WK8 A;  4ECZ A;  2XVT A;  1MQ2 A;  1Z4N A;  5AKK A;  5KFA A;  5F3X B;  3M9N B;  2BHN A;  3CW2 C;  1U45 A;  2H3Q A;  5AI0 A;  3C1Z A;  2K8A A;  5KFZ A;  2QKQ A;  2QAR A;  2A1A A;  2P66 A;  3JPP A;  2ZTC A;  2IA6 A;  7ICR A;  5AKY A;  4B9V A;  8ICB A;  4KLU A;  4O3O A;  3TAD A;  1X2I A;  2B6G A;  5B5E U;  5DQH A;  2DWQ A;  3NUQ A;  3T5K A;  2PXI A;  2KK0 A;  2ZIW A;  5ALF A;  2W9C B;  1ED1 A;  2Y0S F;  4EYI B;  9ICO A;  3TAC B;  2BR0 A;  3JPN A;  2BCU A;  1RDF A;  1SL2 A;  5AI6 A;  2RDI A;  5EE3 A;  2I5H A;  2KN7 A;  8ICG A;  5JTI A;  4DFJ A;  1ZQV A;  2QLT A;  1SKS A;  4PPX A;  4YXM A;  1PVP A;  5JUM A;  3UMG A;  3E0F A;  8ICV A;  2ZTD A;  5ALS A;  3EWA A;  1JI7 A;  2KEY A;  4O3Q A;  2W54 A;  5KFO A;  2W7O A;  5J8Y A;  2XI9 A;  2XY5 A;  2GH1 A;  4UAT A;  4PHA A;  3MAB A;  3F2D A;  1COK A;  5KFH A;  3OPX A;  1NJZ A;  4DQP A;  2Y9T A;  4YMM A;  1C7Y A;  4CNQ A;  5HP4 A;  3KZX A;  5KFQ A;  3AU2 A;  3PST A;  2EAM A;  5HR6 A;  1BPX A;  8ICE A;  3MGV A;  3RR8 A;  1NJX A;  4M04 A;  4I2J A;  4MHV A;  2HBK A;  4I29 A;  9ICJ A;  3UQ0 A;  5DB6 A;  5DDM A;  2R8H A;  2RQ5 A;  4NL9 A;  4ECW A;  1SWV A;  8ICK A;  5CRX A;  5IIO A;  3HWT A;  2HW3 A;  1S0V A;  4RQN A;  4DOA A;  4XRH A;  4IR1 A;  9ICT A;  4KMO B;  4F50 A;  4DSJ A;  4U6P A;  4J9N A;  5JU5 A;  2KZ3 A;  3Q8R B;  4EZ9 A;  4ED1 A;  1BPD A;  1NKC A;  4GXI A;  1L7N A;  4P2H A;  4C8N A;  4FS2 A;  3SZ2 A;  2OYY A;  5IIM A;  4Z6F A;  4Z6C A;  5KAI U;  4EBE A;  2FPL A;  4DL3 A;  1ZQK A;  4YP3 A;  2F44 A;  1JUD A;  2FE9 A;  2MA1 A;  4KLD A;  4BUG A;  3MDC A;  5J0X A;  1NZB A;  2BCQ A;  5AI4 A;  3S6J A;  4IC9 A;  2NRW A;  2BQU A;  1RQL A;  3QEA Z;  1H38 A;  2VA3 A;  3RJG A;  4M47 A;  3LVW A;  5FP0 A;  2HVH A;  2IMW P;  2GLE A;  2WF6 A;  3RJK A;  4B9U A;  3QNM A;  1D9D A;  2FMP A;  4P4O A;  2DQN B;  4CF5 A;  2ASL A;  4DSL A;  4I2I A;  5AK4 A;  5HR7 A;  4J9O A;  5ALG A;  1PVQ A;  1IM4 A;  1AQ6 A;  2ZUB A;  5L9X A;  5GTI U;  4DQR A;  2GO7 A;  2ZXI A;  1WWU A;  5AM0 A;  4AYB C;  4ECS A;  1WG8 A;  2KFZ A;  3NVZ A;  5KFV A;  3KHL A;  4PHP A;  3CYM A;  5DGA A;  1SV0 C;  4NLK A;  4M2Y A;  2AQ0 A;  2KTQ A;  1T4G A;  1KFD A;  1LVH A;  5EOZ A;  9ICE A;  5HMM A;  3PX4 A;  4DS5 A;  3QZ7 A;  2C2E A;  5ALH A;  5ALP A;  4ECR A;  3AM9 A;  7ICO A;  5E79 U;  2I1Q A;  4ECY A;  3UM9 A;  2ES6 A;  2LM1 A;  2HBM A;  2JR5 A;  3SR6 A;  1DOQ A;  2JH1 A;  7ICM A;  3DDH A;  2HVI A;  1LB2 B;  4QZD A;  1COO A;  1B0X A;  5KT6 A;  2UVW A;  8ICF A;  1NZP A;  3FM9 A;  5KFY A;  5KNI A;  1SV4 A;  3BS5 A;  4YMN A;  1UT8 A;  1TVA A;  4KLT A;  4TUR A;  3RF9 A;  5JRT A;  2E1F A;  1UA1 A;  2EAO A;  4B9M A;  4KN4 A;  9ICK A;  1BVS A;  3BZK A;  4I2C A;  8ICJ A;  3M8R A;  3M1Y A;  1NKB A;  1ZET A;  1Q46 A;  4YG2 A;  4TQR A;  1L5U A;  4DL4 A;  4YN4 A;  3PZP A;  3ORY A;  4JWM A;  3SAG A;  2HCF A;  2YMQ A;  2PMZ F;  3FC4 A;  1TK0 A;  3MDA A;  1ZD3 A;  1ZRM A;  4C4R A;  1L3U A;  2LBO A;  3BS7 A;  1L8O A;  4UAZ A;  1FEZ A;  4CRX A;  2P6R A;  4I28 A;  2HOQ A;  4F91 B;  3MFH A;  5L1K A;  2ISO A;  5J2D A;  2WTF A;  3I28 A;  3G6V A;  4UAV A;  2K4H A;  3WKC A;  4MF8 A;  1X42 A;  1HUZ A;  3DEE A;  4NXZ A;  2DL0 A;  1ZQM A;  7ICP A;  4EYH B;  4KLH A;  3IP4 B;  4RQ6 A;  5KG0 A;  3IG5 A;  4NV0 A;  4F5N A;  2ZIU B;  3L3F X;  3OGU A;  4U7C A;  4NL9 C;  3C2M A;  1ZQF A;  2LM4 A;  4QZ8 A;  1N2X A;  1ZQR A;  4PL2 A;  2RHF A;  3WK9 A;  2A1J B;  3C23 A;  4E0D A;  1ZYQ A;  3V7J A;  2K4P A;  4ED0 A;  3N7R C;  1DK2 A;  4JB3 A;  5J29 A;  3NRZ A;  2KIV A;  4RZR A;  5KFR A;  4ECV A;  2F1H A;  5AM3 A;  2JHD A;  2VIX A;  3MR2 A;  3C1Y A;  2JXJ A;  1RXV A;  4B9S A;  4YXJ A;  3T5H A;  1TAM A;  3AEV A;  5KT5 A;  4M0A A;  2QB0 A;  3AN1 A;  4F2R A;  5KG2 A;  8ICU A;  4QZI A;  2UVV A;  2FLN A;  5J2G A;  1S0M A;  2MSN A;  2BCV A;  2OH2 A;  4K4G A;  3Q8M A;  5AK5 A;  4BWM A;  2HBL A;  3ETR A;  5D46 A;  2QB1 A;  3ALR A;  1QTM A;  3C2L A;  4UB4 A;  5DBB A;  1KTQ A;  5AI5 A;  1NOM A;  3VCB A;  1ZQB A;  4C8O A;  5T14 A;  4YMO A;  4P0P B;  5HML A;  2W55 A;  4RPZ A;  4F92 B;  2EAN A;  3KHR A;  4GLX A;  3FDS A;  4HYK A;  5DQI A;  1J2M A;  4F5P A;  2D6F C;  4P0Q B;  5AM4 A;  2YTU A;  2HHW A;  5KG6 A;  4O5E A;  2WHE A;  2YML A;  7ICF A;  3PSI A;  1A6S A;  9ICF A;  3M9M B;  2ODG A;  4KLF A;  5F9N A;  1IXR A;  1ZQW A;  3SEN A;  4RQ8 A;  1JXE A;  3GIL A;  3EZ5 A;  3QUQ A;  5ALQ A;  3CRX A;  2P6U A;  2W03 A;  3I76 A;  3UMC A;  4CDG A;  4IQW A;  1X9M A;  1CEZ A;  1JRP A;  1LKY A;  2XY7 A;  3OSN A;  2ZXH A;  4M9N A;  4PZO A;  5J0R A;  5DDY A;  1ZQU A;  1PZN A;  2JEI A;  2CXY A;  3HPO A;  3KKA C;  2LHT A;  4MFA A;  2R8G A;  4NLZ A;  1NK7 A;  2MRL A;  1ZQZ A;  3RJE A;  1MA7 A;  3CP8 A;  2AH5 A;  4O3M A;  3G6Y A;  2A1J A;  2B21 A;  5DG8 A;  2F77 X;  3H4D A;  5KG1 A;  3PY8 A;  4RQ4 A;  4Y2Q A;  2IOH A;  1Z00 B;  4DWI A;  2F76 X;  2D3D A;  3HIL A;  4P4M A;  1XSN A;  1OW5 A;  1L8L A;  1RYS A;  1ZQN A;  2KJ9 A;  2DPJ A;  4EZ6 A;  3IRU A;  4C7Z A;  5EWE A;  4CF4 A;  5KG4 A;  1NKE A;  1KL9 A;  4QNL A;  1SGG A;  3KHG A;  4AP9 A;  2EDU A;  8ICR A;  2Y0S C;  1U49 A;  1S8O A;  2BPG A;  4NJ8 A;  2JMG A;  4B9T A;  2Y1J A;  4TUS A;  4B9L A;  3N97 B;  4OD0 A;  4UBC A;  2J6T A;  3PW7 A;  1ZQE A;  5ALZ A;  2XIC A;  4FBT A;  4G9B A;  3F5A A;  8ICA A;  1ZQH A;  9ICH A;  5KFL A;  4I2F A;  3QUT A;  5AM1 A;  2MUT A;  3SAH A;  1ZQO A;  5KFM A;  4M9G A;  1SIJ A;  2JRZ A;  4IQV A;  3LWL A;  4IS7 A;  4JMU A;  1CRX A;  2VAN A;  3LYS A;  2BDP A;  2V9W A;  2LYA A;  5EWG A;  4LZD A;  4ED7 A;  1V9P A;  2VA8 A;  3IHQ B;  1TK8 A;  2PKE A;  4Z6E A;  5L1J A;  4ELV A;  4R8U A;  4ACO A;  4ICA A;  1XWL A;  1Z19 A;  1Q3V A;  3RJJ A;  3MR6 A;  4US8 A;  2RRD A;  1C20 A;  2BPC A;  2H3F A;  3JPT A;  3NRW A;  4GIB A;  3TAP A;  2KSO A;  1ECW A;  4RPY A;  4QIW F;  2KJ8 A;  3IG8 A;  3ISD A;  2ZIX B;  2KVS A;  1K1Q A;  3L5K A;  3NVW A;  5ALY A;  4YVZ A;  1RYR A;  4Y2J A;  4DQQ A;  1N5W A;  1RPL A;  4KLS A;  1T3N A;  3NGD A;  3OTQ A;  5IIK A;  1S77 D;  3QE9 Y;  2AHO B;  4O3P A;  4KLE A;  9ICU A;  4RQM A;  1TFR A;  3RJH A;  7ICS A;  2HSZ A;  3Q8P B;  4ED3 A;  3TAR A;  3K1R B;  4ZOH C;  3HRD D;  3ZDD A;  4O3S A;  8ICO A;  5J8Y C;  3TQ1 A;  2FMS A;  2KIW A;  4XA5 A;  2ZJA A;  5J2B A;  3M9O B;  2NRX A;  2NRV A;  2FDR A;  4J9R A;  1U48 A;  4YR2 A;  3JPR A;  3ONN A;  2OEH A;  2C2D A;  2B0C A;  4US9 A;  2LPE A;  4UBB A;  4DSE A;  1XNS A;  2M0N A;  2OWO A;  3THV A;  4CGZ A;  1ZQ1 C;  1N48 A;  2QB0 B;  1S76 D;  2JV3 A;  4QZE A;  4RT3 A;  4ED2 A;  4BJQ A;  3BQ7 A;  4X5V A;  4PGX A;  4I2G A;  3EW9 A;  3D2Q A;  2ZG6 A;  4MEY A;  3BQT A;  2H3V A;  2KKV A;  4Q43 A;  4KMU A;  3KBB A;  3D2N A;  4UB5 A;  3GQC A;  2YB4 A;  1VJ5 A;  3PW0 A;  2W9C A;  4NLG A;  2EAP A;  3D2S A;  4ECT A;  2E8O A;  3GU3 A;  1JX4 A;  3OHB A;  1FO4 A;  2MU2 A;  2KHV A;  2DBY A;  4O3N A;  4DFP A;  2E1E A;  4ED6 A;  3RH4 A;  4KTQ A;  2OXO A;  4OJO A;  3MGH A;  7ICL A;  2GWS A;  5AM5 A;  5GTH U;  1KW4 A;  1N60 A;  3QZ8 A;  4A8E A;  1LKY B;  3WKB A;  4GC7 A;  1KDH A;  4IR9 A;  2CRX A;  2KFN A;  2W9B A;  3QXG A;  3C21 A;  2ZTE A;  1KLN A;  8ICP A;  3N7S C;  2R18 A;  3PR4 A;  4MF2 A;  2LI6 A;  4MEX A;  1QH9 A;  1T94 A;  1X40 A;  4OO1 J;  3RFA A;  2RDJ A;  2CPR A;  4M6W A;  4C0Z A;  4ECX A;  4IL6 U;  4JUZ A;  2F3N A;  5J2K A;  1ZJM A;  5D4B A;  1SB3 C;  1YT3 A;  3G6X A;  2HHV A;  2FLP A;  1ZQX A;  4O5C A;  1SXD A;  5B66 U;  3QU7 A;  4R65 A;  2H3I A;  4ED8 A;  2PFP A;  1QQ6 A;  3FAH A;  3V7L A;  1Z3E B;  3ETL A;  2XO7 A;  2DPI A;  2XGP A;  3LVV A;  3SD7 A;  5ALX A;  4DLG A;  9ICA A;  1WUD A;  2WF5 A;  3B0X A;  2K89 A;  2OHF A;  4QWC A;  2UVR A;  4DL7 A;  2DUY A;  5KL1 B;  3ED5 A;  4RUA A;  3ZDB A;  3QEB Z;  2NO4 A;  2XY6 A;  4RQ1 A;  3HKZ F;  3C2K A;  1XS9 D;  4ZH4 A;  4DL5 A;  3GIK A;  4F4X A;  3H0L B;  3RH5 A;  2W8L A;  1YZ6 A;  3UQ2 A;  4RPX A;  3KZI U;  4QIW C;  3BS5 B;  4C4S A;  2ZJ5 A;  3TAN A;  2JZB B;  4R63 A;  3GIJ A;  2LKY A;  4CE6 A;  3H8S A;  4DFK A;  3M6Z A;  5ALM A;  1SKR A;  3RB6 A;  3SAF A;  3BJY A;  5AI8 A;  3UXP A;  5KFC A;  3GIM A;  4QZH A;  1TKD A;  3GZF A;  4GFJ A;  4I2D A;  4Y2P A;  4Y2R A;  4PHE A;  3QUB A;  1FFU A;  4O9M A;  3H0R B;  4F4K A;  4Y2U A;  3F53 A;  1A76 A;  8ICS A;  1L6N A;  4Q8F A;  3LWM A;  3QU4 A;  2CN1 A;  1QQ7 A;  1ZOL A;  1KSP A;  2XCP A;  2RLT A;  1DXS A;  1ZQI A;  1KKX A;  3OHA A;  4DOB A;  1Z4O A;  4B9N A;  1Z1V A;  4M9J A;  1KFS A;  3EPG A;  2W43 A;  5KFS A;  4Q8E A;  5BPC A;  3GV8 B;  4KX5 A;  1SZH A;  3PMN A;  1UQV A;  3NVY A;  2KZZ A;  3MGI A;  3I1Y A;  4F4W A;  1F44 A;  2W9A A;  4TUQ A;  2VJ5 A;  1RYU A;  1UT5 A;  1SL1 A;  1KFT A;  2VA2 A;  3H8W A;  1QCK A;  2F1I A;  4QZF A;  3AUO A;  2F8K A; 
#chains in the Genus database with same CATH homology
 2E8P A;  1B0X A;  1V85 A;  2KIV A;  1WWV A;  5KNI A;  1SV4 A;  2D8C A;  3BS5 A;  3TAC B;  1PK1 A;  2K60 A;  2QAR B;  1B4F A;  3IDW A;  1SXE A;  2EAP A;  2E8O A;  2Y9U A;  5JRT A;  5JTI A;  1PK3 A;  2EAO A;  2QB0 A;  3KKA A;  2F44 A;  2FE9 A;  2LMR A;  1OXJ A;  3BS5 B;  2D3D A;  3HIL A;  1OW5 A;  1V38 A;  2KSO A;  2QB1 A;  1PK1 B;  2KMD A;  3SEI A;  1KW4 A;  2ESE A;  4PZN A;  1LKY B;  1SV0 A;  1JI7 A;  1X9X A;  2E8N A;  5J8Y A;  2EAN A;  3H8M A;  1F0M A;  1SGG A;  2GLE A;  3BS7 A;  2KG5 A;  1X40 A;  2YTU A;  1COK A;  4NJ8 A;  4RQM A;  2Y9T A;  2F3N A;  3K1R B;  1DXS A;  2EAM A;  2DKX A;  3SEN A;  2E8M A;  1WWU A;  5J8Y C;  5L1M A;  1SXD A;  1UCV A;  2DL0 A;  5F3X B;  1Z1V A;  4MHV A;  1X66 A;  2DKZ A;  1SV0 C;  2KSO B;  2KE7 A;  2QKQ A;  2LPE A;  1UQV A;  2QAR A;  4NL9 A;  4NL9 C;  1LKY A;  1RG6 A;  4RQN A;  2ES6 A;  2QB0 B;  2JV3 A;  4IS7 A;  2L5Y A;  4PZO A;  3TAD C;  3TAD A;  2B6G A;  2K4P A;  5JU5 A;  3BQ7 A;  2F8K A;  3KKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...