3KKAC

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
b'TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-A RECEPTOR 1
publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 59
sequence length 59
chains with identical sequence D, E
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaC00
1UCVA 2KIVA 3TADC 2FE9A 2KE7A 2QKQA 3SEIA 4PZNA 1KW4A 5J8YC 5JRTA 2GLEA 2KSOA 1V85A 2LPEA 4MHVA 2YTUA 2E8NA 1X9XA 1LKYA 2E8MA 2KG5A 5L1MA 1SXDA 2DL0A 2Y9TA 1SV0A 3BQ7A 1X66A 1X40A 1SV4A 4RQNA 3BS7A 2D8CA 1PK1B 1UQVA 2DKZA 1SXEA 5F3XB 2QB1A 2ESEA 4NJ8A 2QB0B 5KNIA 3SENA 3KKAC 2D3DA 3BS5B 4NL9A 1DXSA 2QARB 2ES6A 3TADA 1COKA 1B0XA 1JI7A 1Z1VA 2EAPA 5J8YA 1SGGA 5JTIA 2EAMA 1PK1A 2B6GA 2E8OA 2QB0A 3K1RB 2Y9UA 2KMDA 1OW5A 2F44A 2K4PA 2E8PA 3BS5A 4RQMA 2L5YA 2QARA 1F0MA 1B4FA 1PK3A 3HILA 1WWVA 1OXJA 2EAOA 1SV0C 3IDWA 3TACB 1V38A 2JV3A 2KSOB 3KKAA 4IS7A 2F3NA 2K60A 1RG6A 4PZOA 1WWUA 2DKXA 3H8MA 5JU5A 2F8KA 1LKYB 2LMRA 4NL9C 2EANA
chains in the Genus database with same CATH superfamily
1UCVA 4ECWA 1IG6A 4ECUA 5KFJA 3EZ5A 3J81j 5ALHA 2PFOA 2I6XA 4PZNA 1DK2A 4UATA 5JRTA 1V85A 4UW9A 4OJPA 4FZLA 2WAQC 3SV4A 1L3VA 2XGPA 3Q8LA 3TARA 2YTUA 4ECQA 2BDPA 2ZJ5A 2RDJA 2V4RA 2E8MA 4Z6EA 4USAA 3WKBA 3ISDA 2KZ3A 2KICA 1X66A 3K4GA 4F8RA 3AL0B 4R8UA 4RQNA 3GIJA 4ED2A 4ZOHC 5DQHA 3H40A 3TANA 3IV6A 3C5FA 5IIOA 3B9JA 3HRDD 3RTVA 3F53A 3Q8QB 4MF2A 1RQLA 5CRXA 1RM6C 2BCRA 2ZTCA 4I2HA 3GQCA 1SWVA 1KEJA 4JUZA 2LHTA 1ZQQA 2EAMA 3RJJA 1ZQVA 3G6XA 3NASA 4QWEA 4DFKA 2PMZC 4KX5A 2AGOA 3SMVA 1LV5A 5J0YA 4MEXA 1ZXIA 2PKEA 3HP6A 3V72A 4Y2QA 3TFRA 2K4HA 1KL9A 1SV0C 1RXVA 3PW5A 5IIIA 4XUSA 4M2YA 5KFZA 5AKXA 2JGAA 2F3NA 4YP3A 3JPPA 5ALYA 4M6WA 5K4LA 1X6JA 1YZ6A 5BOMA 1X6IA 1XSPA 4RQ8A 2E1FA 3H0MB 2H5XA 2KVSA 1MQ3A 5C0YA 2HVIA 2EQYA 4BGDA 2HCFA 3ZDAA 4YD2A 4JV2A 4ICAA 4U7CA 3IP4B 4YFKA 1U48A 2PFPA 4NY8A 1UT5A 4UQGA 7ICVA 4KLFA 4GXKA 5BPCA 4YMMA 4K4IA 2Y9TA 2JMGA 3M7DA 3PO4A 3L3FX 4I2DA 5DDYA 3PW2A 3H8WA 3AQEA 3F2CA 2DKZA 3TAQA 4NM2A 5F3XB 2QB1A 3AM9A 1NKBA 4UAZA 3TAPA 4O5CA 4DSEA 7ICLA 5J0WA 3ETRA 3KHHA 4IQTA 2W9BB 5E79U 4KLQA 5KFIA 4KLHA 2FMQA 4TUPA 3QUQA 2GO7A 2IOFK 1Z4NA 3MGIA 2KEYA 1A6SA 1T7PA 2AHOB 2LYBA 4QZGA 4M9HA 2QB0A 2HVHA 8ICTA 1S76D 4Q43A 1V97A 3BZCA 4I2JA 4ZH4A 2F44A 4RQMA 7ICNA 3QU2A 3S6JA 4FFDA 3OSNA 3BQ2A 1ZQIA 9ICJA 2LI6A 5KT2A 3SAHA 2KP7A 5DLGA 4NLNA 5AI4A 4DL3A 1L3UA 4RQ0A 4DO9A 1BPEA 3BZKA 2DWQA 2EANA 5J2GA 1KKXA 2AQ0A 4QZBA 1T8EA 1UT8A 4J9QA 4DWIA 2N1RA 1Q8KA 2FMSA 3PW7A 2J6SA 2BCSA 1QSYA 4JK1A 2EDUA 5CR0A 4F4XA 1MQ2A 5ALGA 2F8LA 3OPXA 5HR7A 5ALNA 5F9NA 8ICWA 5DB9A 4O5KA 1JXLA 1SV0A 1ZQHA 2W3SA 4EEYA 4CF5A 3M9MB 4ECYA 5EWGA 1ZOLA 4A8EA 4QZIA 1L3TA 1SXEA 1VLBA 5ALQA 4AP9A 4M47A 2PFQA 5ALLA 1L7OA 3LWMA 5G5HA 4DOAA 3MDCA 3QU7A 1T94A 3PSIA 2JXJA 3VC8A 3MR2A 5KFPA 1T3NA 2NV3A 3KTQA 1ECWA 2UVUA 5KG5A 2W04A 4C0ZA 4LZDA 2NYVA 3QZ8A 1PK1A 5AIBA 5AM3A 7ICMA 2E8OA 1XO0A 4O3SA 3V6KA 3C1YA 2JEFA 2Y9UA 1IIPA 5L1KA 1OW5A 2W43A 2L5YA 4EZ9A 3T5LA 3CP8A 3HILA 3N7PD 9ICBA 4Y2YA 2KZMA 5KL1B 4NLGA 2JH1A 4UASA 4RNOA 4YMNA 3Q8SB 2DFLA 1KSPA 5AKLA 2M9NA 3OJSA 5T14A 4FZMA 5GTHU 4QWAA 1WCLA 4Y2XA 4YVZA 1QTMA 4EZ6A 8ICQA 2HDOA 1N2XA 2MU2A 2FLLA 4NL9C 4DSKA 4F92B 3JPRA 5J2IA 3CNHA 4BXOA 4NM1A 1ZQZA 2ODGA 2ZG6A 4BXOB 9ICKA 2QKQA 5J0UA 4QJFB 3KBBA 4Q44A 2GLEA 7ICRA 4RPYA 5KG0A 2B21A 5ALIA 3HJEA 4KMUA 4EELA 2ZIXA 5J2AA 2G07A 2ZIXB 5AIAA 4B9NA 2KZZA 3CW2C 4CE6A 1LKYA 2ZIUA 2ZTDA 2ZIUB 4I2GA 3HT3A 2C2DA 2HSZA 3N97B 9ICRA 2EZZA 2HHXA 1UQVA 2KHQA 8ICLA 4ECRA 3RAXA 1S0VA 2DUYA 1S0MA 4B9UA 3D2QA 4MFAA 5AKYA 4PL2A 4DSFA 5J29A 5AKKA 5AK6A 1HIWA 3ETLA 3ZDEA 2RLTA 5B66U 3SZ2A 2DPIA 1XSLA 3ALRA 2DQNB 4B6JA 3QXGA 4C8LA 1U4BA 4B9VA 3LWLA 3BQ0A 1NK8A 1K1SA 3TKAA 3H4DA 3HX0A 4DLGA 4I2BA 9ICNA 2C22A 5DGAA 2BPCA 4DOCA 3BQTA 1K1QA 1HUZA 9ICVA 5L9XA 4PJ0U 4OCZA 1VDVA 2DBYA 1UA1A 1JXEA 4UBBA 4FS1A 3H0LB 4GXIA 5DDMA 3ZDDA 1AROP 1WWUA 2KK0A 2OM6A 2BQRA 3WKCA 3NVVA 2FLNA 4C7ZA 7ICFA 5KL8B 1NK0A 3M6KA 2ZUCA 5HHIA 2XY6A 4MF8A 1KRPA 3OJUA 3RH4A 2WHEA 3C5GA 1Z00A 2FLPA 5CA7A 1MC8A 7ICGA 4KLMA 4DSIA 7ICHA 2BPGA 2JEJA 2HHUA 4JWNA 1TFRA 1YT3A 2KIWA 7ICOA 3T5JA 1DK3A 2BDUA 1S10A 4QWBA 2XCAA 4QIWF 3UXOA 2AQ4A 1SL1A 5TZVA 1TAUA 1ZYQA 4F4KA 3EWAA 4UAVA 5KG1A 1WYGA 2XIDA 3PMLA 2HBJA 2NRXA 2GH1A 4UB6U 4KLJA 5DBAA 7ICSA 4RQ6A 4DL6A 1FEZA 4NL9A 2OH2A 2QARB 3M1YA 5ALJA 3C1ZA 3AMZA 4DF8A 1COKA 2Z7JA 2VA2A 5KG2A 1XU4A 3MFIA 3WK8A 3KD3A 4J9SA 1SGGA 1F5SA 1PZNA 5ALDA 3RH6A 1DGJA 3NVWA 3DEEA 1NK4A 5AKEA 3UQ0A 4DF4A 2ZXIA 3H8JA 5J2DA 3L5KA 3NS1A 1ZQFA 3TFSA 3QEBZ 8ICYA 4RNMA 1RYRA 2PFNA 3UMBA 3SAFA 4QZDA 5ALVA 3MR6A 5J2BA 5IIJA 4DQIA 1Z19A 5KFHA 2HBMA 4J9NA 3KFUF 4QW9A 5IINA 4YXMA 5J2CA 2ASDA 1BNOA 1A0PA 1RDFA 1L8OA 1T3QA 1TAQA 2K60A 3QUBA 1U47A 1ZQSA 4RQ7A 3RJGA 1XO1A 3E2EA 4J9RA 3JPQA 4ACOA 2W9CA 2HW3A 3TADC 3EPGA 5KFLA 4M9LA 5KT5A 4YG2A 3E58A 3PR5B 2ZJ8A 4YN4A 3ZD9A 4B9TA 1KW4A 4JB3A 4ECVA 4J9KA 2IHMA 3B0YA 3RH5A 1HUOA 4KITB 1JALA 1TK0A 4Y2JA 1SKRA 3PVXA 5AKHA 2BCUA 3BQ1A 1Q3VA 3MGVA 5HNKA 5KG7A 1SZHA 3RF9A 1JROA 2K8CB 1NZPA 1J97A 1S5LU 1SV4A 9ICXA 1TAMA 5KFRA 5KTQA 5KT4A 2D8CA 1KDHA 4I2EA 4IRDA 3C23A 5KG3A 3LVWA 1PUZA 1N63A 2D3DA 3NVYA 3FAHA 2G0AA 3BS5B 1N61A 5TISU 3Q8MA 1CRXA 3NGDA 4Y2RA 1ZQXA 4DFMA 1X9SA 1JN3A 3F5AA 2YX8A 3ED5A 3QNMA 4DCCA 2YB1A 1Z4OA 9ICSA 1SL0A 3N28A 1ZD2P 3PSTA 2OHFA 9ICAA 4Y2PA 2NRWA 4GC7A 3IG8A 3LYSA 4IRKA 8ICOA 1JRPA 3HW8A 9ICQA 1SWWA 1IXRA 1SB3C 4Z6CA 2W7PA 4UB3A 2DPJA 2PI4A 3SQIA 2JRZA 4TQRA 5DBBA 4NLBA 4IS7A 2LYAA 4IR1A 9ICIA 1CI4A 3HPOA 2FDRA 2FPMA 4F5PA 1A76A 1L5UA 2ZJAA 7ICQA 1QSSA 2KIVA 8ICRA 4Y2TA 4P0QB 2W3RA 3G6YA 8ICPA 1X9WA 5ALFA 1O03A 2ZIWB 1M6YA 3CRXA 4EBDA 3DDHA 3QU5A 2ZUDA 4P4OA 4UB4A 2H3QA 2AXTU 4GFJA 2HOFA 1U9LA 3ZDBA 1UHUA 1X2IA 4DL5A 3M8SA 4O3PA 3GDXA 3RB4A 2G5IB 1D8BA 3SI8A 3Q8KA 3WK7A 1QSLA 2CN1A 4UBCA 3KKAC 5KAIU 4O3NA 4EBEA 2ES6A 3TADA 3M9OB 4Q45A 2LKYA 1B0XA 1NJWA 4NWIA 3RFAA 5AKJA 1NI3A 1C20A 4J9OA 4RUAA 2MSNA 1L7PA 4QW8A 4GC6A 1CUKA 4RQ5A 3AEVA 5J2KA 2BCQA 2B6GA 2W54A 8ICJA 3RJKA 4K4GA 5ALMA 2K4PA 1T4GA 4F93B 2BR0A 9ICLA 4PHPA 1BPXA 7ICTA 5CWRA 2W9BA 5KT7A 3LVVA 1TKDA 3PZPA 4TQSA 4BDPA 7ICIA 4RPZA 3RB6A 4EX6A 3KOOA 4R63A 1NJYA 4KLSA 4DL4A 5DKWA 3PNCA 3ZI4A 3IG5A 2F8KA 2J6UA 1FFVA 4RQ4A 2LMRA 4ELTA 5DLFA 4CCHA 5AI6A 2R8IA 4J9LA 2E5SA 1L8LA 3IN5A 4RU9A 3HKZF 2WB1F 3G6VA 2BQ3A 4G3IA 4BWMA 2JHDA 8ICUA 4PPXA 2WB1C 4YQWA 5IIKA 2KHVA 3WK5A 2IA6A 2YQEA 1Y88A 1ZETA 2OXOA 4KLEA 3RJFA 1ZQKA 3PMNA 2K89A 1U45A 2ISPA 4FBUA 3FC4A 4KLIA 5L1LA 3PO5A 3THVA 4BJQA 2C2RA 4QZ9A 2VANA 2EZXA 3R9KA 3TI0A 4JV0A 1DGSA 3OSPA 1NNLA 2A3VA 1ZD5A 1JMSA 1D9FA 4UAWA 4DSJA 4HYKA 4ECZA 3T3FA 2F1IA 2HHWA 1B22A 2BPFA 4ECSA 5KT6A 2AU0A 4LZGA 1RPLA 3GV7B 4IQWA 4US8A 5DQGA 1UA0A 4DQQA 2GOLA 3F2BA 4O3OA 5KFSA 5J0TA 1KLNA 2K8BB 5AI8A 3KKAA 4EEKA 1RG6A 3PW4A 2V4QA 5EWFA 3AQFA 3AU6A 4FO6A 4IL6U 3NUQA 3WKDA 4K4HA 1Q46A 2EZYA 4CF4A 4GXJA 4UAUA 1UPHA 4IRCA 5AM5A 5ALTA 1D8YA 1RYUA 4CDGA 2XCPA 2LPEA 2VA3A 2OEHA 4F2SA 4C4SA 5DBCA 5KFGA 5KFFA 2AGPA 2WTFA 3PX6A 3D2NA 3N7RC 3V6HA 1C7YA 4PGXA 5EOZA 4KN7A 2MRLA 4DL2A 1X40A 1FO4A 4JV1A 4IC9A 4MFCA 5EE9A 2G5HB 3AU2A 3MABA 8ICVA 2OWOA 2ESEA 9ICEA 3WKEA 4KTQA 1QH9A 5BOLA 3M6ZA 2I9GA 2IBKA 8ICZA 4OJLA 2NRVA 3RBEA 5ALZA 4JMUA 5ALOA 7ICEA 1Z1VA 2EAPA 4F72A 3KZXA 1ZQPA 2G08A 3LDAA 5CB1A 3T5HA 2XI9A 4M9NA 1N56A 5DG9A 4J9MA 5EE3A 1ZQTA 3V7KA 3ORYA 4BWJA 4UB8U 9ICOA 4RQ2A 1L6NA 2QLTA 4RQ3A 3K1ZA 1CEZA 2YN4A 3EYZA 3FM9A 2RDIA 3FYHA 3M9NB 4Y2UA 3IHQB 1V38A 2E3TA 5DB7A 2GWSA 2DGZA 4G9BA 2HHVA 4CF3A 2ZTEA 1XC9A 1XNSA 1ZRMA 2PXIA 2XICA 1OUQA 5ALUA 3B0XA 4O5EA 5HHHA 4O3MA 5AI9A 4XQ8A 2CPRA 3T5KA 5AK3A 4DQPA 3GU3A 5AM0A 3C29A 4DOBA 4I28A 4ECTA 9ICPA 5DGBA 1NK6A 2WF8A 1QQ6A 1JUDA 1X42A 3NVZA 3OGUA 3BS7A 3IM1A 3AN1A 5AM4A 2R8JA 9ICCA 2JZBA 2JZBB 4ECXA 1QQ5A 3UXNA 2JEGA 7ICJA 3KHRA 1DXSA 5KFTA 1N5WA 3RJHA 1JI7A 5ALRA 4U6PA 4GLXA 2ISOA 2MA1A 1ZQWA 2KJ5A 5JTIA 5HMMA 4QIWC 4ED1A 2IHNA 8ICSA 1FFUA 4KMOB 3WK9A 2AJQA 2HHQA 3M8RA 2ZIVB 2HOIA 4YR0A 2QARA 3GIKA 1ZQRA 3WU2U 3N7SC 4P0PB 1DOQA 2VKQA 2JEIA 4PGQA 4XRHA 4Z6FA 2KSOB 3ZD8A 4Q8FA 2JH7A 2OCEA 4C8MA 1Q3UA 5G5GA 2UVRA 1SZPA 3GV5B 4TURA 3ICXA 8ICFA 2WF5A 5J0SA 1KBUA 1ZJMA 3V7LA 9ICFA 1QQ7A 4F5OA 1PVRA 1TE2A 4FE3A 4QNLA 5KFMA 1N48A 2F77X 5J0XA 4F50A 1ZQAA 3BJYA 1MA7A 4MHVA 4KLUA 1MSWD 1URJA 5ALEA 5IILA 2YB4A 2Y0SF 3A0BU 5CEHA 3I1YA 1TK5A 5D46A 8ICHA 2Y0SC 2KG5A 5HR6A 1N5XA 2HHTA 3BQ7A 2W8LA 4RT3A 4DS4A 5DG7A 1HJPA 4YR2A 4FS2A 2BZFA 1B43A 3ISCA 1RXWA 9ICWA 2HOQA 2FMPA 3F5EA 3V6JA 5ALWA 2H3ZA 2P6RA 1ZQNA 3SENA 5JUMA 1KTQA 5DB6A 1N62A 2RQ5A 9ICUA 3EW9A 4I2IA 3QX7A 2W11A 5L1IA 5AICA 3ISBA 2MUTA 3UM9A 2MUTB 4Q8EA 3NRZA 3GFKB 4LJXA 4P4MA 2KMDA 4P2HA 2A19A 3BS5A 3UMCA 1B4FA 4UB5A 5KG6A 5KFAA 1PK3A 4DSLA 4DFDA 2G06A 4XA5A 3RR7A 4QWDA 4RNNA 2KV2A 4PGYA 3Q8RB 4NXZA 1SKSA 2WAQF 2JV3A 3I76A 4BX9C 2KKVA 3C28A 3GZFA 4MFFA 1K5OA 2AGQA 3HWTA 4CGZA 3H8MA 1NKCA 4CNQA 1L7NA 1JIHA 2VJ5A 1J2NA 4OJOA 8ICEA 1KFSA 4DQRA 4UB1A 2UVVA 3F2DA 3MBYA 4R8UB 2FE9A 3BDPA 2KKPA 3QU4A 3SEIA 3MR3A 2HHSA 3RB0A 5KFNA 4ED7A 3RRHA 4C4RA 4C4TA 5J2JA 2KTQA 1ZRNA 2WF6A 5KFEA 1SKWA 2DL0A 3FDSA 4P0QA 5L1JA 3EPIA 2ZIWA 1ZD3A 2C28A 2PMZF 5AM2A 1Z3EB 2DF4B 4F2RA 3MDAA 2LM4A 5KNIA 3UXPA 2ZXHA 3VCBA 3QE9Y 3PX0A 2NRTA 4O3RA 4DEZA 4DQSA 4C8OA 2XC9A 5DB8A 4F5RA 2KOBA 2H3FA 1BPYA 2KJ8A 2VIXA 4UAYA 1NZBA 4KLTA 4PHAA 9ICGA 5AI0A 2ASLA 4M6WB 5KFQA 2FJ6A 4X5VA 4QWCA 3QUTA 3A0HU 1F0MA 3C21A 2CRXA 4Z6DA 4I2FA 1DRGA 3L4PA 4I2AA 1ZJNA 1PVQA 4OJ5A 2HI0A 3QU9A 2OYYA 2YMLA 4QZ8A 2EH9A 5CJ7A 1NJZA 1VJ5A 3QUCA 3O0FA 1ED1A 5KFDA 4C80A 2IOHA 2VA8A 1AQ6A 2YMPA 1QLNA 1JX4A 4NV0A 1Z1BA 4J03A 1U49A 1ZD4A 1IV8A 2J6TA 3QYPA 1J2MA 5KFCA 5GTIU 3PX4A 4RZRA 3Q8PB 4YMOA 4DL7A 3H8SA 4F71A 4P4PA 1S77D 5FP0A 9ICMA 2MAXA 3OTQA 5KFOA 3RJEA 2K4IA 4R65A 5AKIA 1RQNA 1L7MA 1ZQGA 1FIQA 3C2KA 5A0LA 3TQ1A 2P66A 1LB2B 4HAIA 2LBOA 1ZQEA 3UMGA 1BVSA 4EX7A 4UARA 2KJ9A 2QB0B 3HKZC 1NK5A 4BUGA 4PHEA 1SIJA 4ED0A 1KFTA 2PI5A 3RJIA 3RB3A 1S0NA 5J2EA 4TUQA 3C2MA 4DS5A 3JPOA 2UVWA 5KFXA 4KLOA 2C2EA 4YCXA 8ICAA 2K4EA 5H2FU 2YY6A 1ZQUA 2KFZA 5F9LA 1ZQBA 3EUB2 2G09A 4F5NA 4DLEA 1XSNA 8ICNA 5B5EU 2HMXA 2Y1JA 2RP5A 2LM1A 3IDWA 4ELUA 2R18A 8ICCA 2W7OA 4PL1A 4DFJA 3ZDCA 1RZTA 3H0RB 4O0IA 2W03A 3MC1A 5KFWA 5JU5A 2XY5A 2KFNA 2BCVA 4FBTA 2E1EA 2I5HA 1ZQJA 2KVCA 4OD0A 5J8YC 1ZQMA 3E0FA 5AKGA 5KFUA 4QZHA 5AM1A 4C8KA 4E0DA 4ED8A 4EBCA 1COOA 2WF9A 4ELVA 3MFHA 4R64A 4QZCA 3CYMA 1S8OA 5HMLA 4QZAA 5J0QA 2ALZA 3GIIA 4IQVA 3T79A 2H3IA 8ICIA 1BPDA 3DV9A 3RR8A 7ICUA 2R8KA 1PK1B 4KX3A 4UB2A 4YD1A 2I1QA 5J0OA 4LVSA 4F4WA 3V7JA 3MR5A 2KD1A 4ED3A 2XO7A 2H3VA 1D9DA 2ASJA 1S9FA 1EXNA 2VJ4A 3AUOA 3SR6A 2KNJA 4RPXA 4F91B 2IMWP 4B9LA 9ICTA 2NRZA 1S0OA 3GILA 3RRGA 4CRXA 3PY8A 1KFDA 2A1AA 4O9MA 5C5JA 2F1JA 8ICXA 3KHGA 4AYBF 4O3QA 5AI5A 1D8LA 1N60A 3KZIU 4QZFA 4AYBC 2YMQA 4EYHB 8ICKA 3H4BA 4C7YA 1SL2A 1TVAA 5AK4A 1BGXT 2DKXA 2D6FC 1S97A 3RAQA 3JPNA 1RYSA 5DQIA 4RUCA 4OJ6A 1LKYB 5J2FA 2LYHA 1HEKA 4F4YA 2KE7A 3SV3A 2WF7A 4IQUA 2K8AA 2FPLA 1NKEA 2ATLA 1WUDA 3KHLA 4ED6A 5KAFU 1X9XA 5J0PA 5DG8A 2BQUA 1TV9A 3ONNA 5L1MA 1NK7A 1SXDA 2R8HA 2RHFA 3SD7A 2XVTA 3UQ2A 1NOMA 2WFAA 3PSPA 1TK8A 1XS9D 1L3SA 3OHAA 2Q0ZX 2Y1IA 4B9SA 2NO4A 4YR3A 4OO1J 3IRUA 3PSFA 2F2AB 4C8NA 1WCNA 1XWLA 1O08A 5IIMA 1LVHA 5J8YA 3SYZA 2IOFA 1WG8A 4GIBA 2BHNA 2A1JA 3WK4A 3LK9A 4I27A 2A1JB 4M9JA 4PHDA 3D2SA 5KFBA 1GO3F 3K1RB 2RRDA 2BGWA 5CP2A 2W9AA 2XGQA 5J0RA 3QEAZ 5AKZA 5KT3A 8ICGA 1KN5A 2HBKA 2XY7A 3PR4A 2V9WA 4R66A 1P7DA 4MEYA 2B0CA 1V9PA 3PW0A 1ZQOA 3WK6A 1H38A 4M9GA 3TACB 2P6UA 4YXJA 1Z00B 3JPTA 4B9MA 2FPKA 3WKAA 4PZOA 3D6JA 1ZQLA 4EYIB 1KQQA 1IM4A 2ZIVA 2YMMA 4F4ZA 4EENA 1NK9A 4NLZA 2ZUBA 5CHGA 1BNPA 4KN4A 3SAGA 4P0PA 4DFPA 4PH5A 1ZQDA 5KG4A 2CXYA 2KSOA 1QCKA 2E8NA 4RT2A 4TUSA 5EE1A 4J9PA 7ICKA 2BKEA 1ZQ1C 2FI1A 7ICPA 4M0AA 5D4BA 3N4MB 4I29A 3QZ7A 4NLCA 2W55A 4WJ3B 2W8KA 2AH5A 4NJ8A 4IR9A 4M04A 1YZ7A 4JWMA 2R8GA 4Y2VA 5ALSA 5J2HA 3C2LA 4F5QA 2F76X 1ZQCA 1A77A 3K75D 5EE0A 2W9MA 5KFVA 1ZQYA 5KFKA 2M0NA 4KLGA 3H7IA 3NRWA 3RBDA 4NLKA 5ALPA 3UPQA 4US9A 5HP4A 5ALKA 3OHBA 5EWEA 8ICMA 3NTUA 2F1HA 3MGHA 2HBLA 1NJXA 2E8PA 3GIMA 3PV8A 5AK5A 4QZEA 4Y2SA 4RQ1A 2O6KA 2W9CB 1X9MA 1F44A 1WWVA 4I2CA 1OXJA 5KFYA 3JPSA 4KLLA 2EAOA 1BPZA 4FZNA 3I28A 5ALXA 4F3OA 2NO5A 2P35A 5D49A 2JR5A 2Q4TA 4KLDA 2KN7A 3GV8B 3U26A 1PVPA 9ICHA 8ICBA 5AHXA 1BPBA 1MN8A
chains in the Genus database with same CATH topology
1UCVA 2KIVA 3TADC 2FE9A 2KE7A 2QKQA 3SEIA 4PZNA 1KW4A 5J8YC 5JRTA 2GLEA 2KSOA 1V85A 2LPEA 4MHVA 2YTUA 2E8NA 1X9XA 1LKYA 2E8MA 2KG5A 5L1MA 1SXDA 2DL0A 2Y9TA 1SV0A 3BQ7A 1X66A 1X40A 1SV4A 4RQNA 3BS7A 2D8CA 1PK1B 1UQVA 2DKZA 1SXEA 5F3XB 2QB1A 2ESEA 4NJ8A 2QB0B 5KNIA 3SENA 3KKAC 2D3DA 3BS5B 4NL9A 1DXSA 2QARB 2ES6A 3TADA 1COKA 1B0XA 1JI7A 1Z1VA 2EAPA 5J8YA 1SGGA 5JTIA 2EAMA 1PK1A 2B6GA 2E8OA 2QB0A 3K1RB 2Y9UA 2KMDA 1OW5A 2F44A 2K4PA 2E8PA 3BS5A 4RQMA 2L5YA 2QARA 1F0MA 1B4FA 1PK3A 3HILA 1WWVA 1OXJA 2EAOA 1SV0C 3IDWA 3TACB 1V38A 2JV3A 2KSOB 3KKAA 4IS7A 2F3NA 2K60A 1RG6A 4PZOA 1WWUA 2DKXA 3H8MA 5JU5A 2F8KA 1LKYB 2LMRA 4NL9C 2EANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCV A;  2KIV A;  3TAD C;  2FE9 A;  2KE7 A;  2QKQ A;  3SEI A;  4PZN A;  1KW4 A;  5J8Y C;  5JRT A;  2GLE A;  2KSO A;  1V85 A;  2LPE A;  4MHV A;  2YTU A;  2E8N A;  1X9X A;  1LKY A;  2E8M A;  2KG5 A;  5L1M A;  1SXD A;  2DL0 A;  2Y9T A;  1SV0 A;  3BQ7 A;  1X66 A;  1X40 A;  1SV4 A;  4RQN A;  3BS7 A;  2D8C A;  1PK1 B;  1UQV A;  2DKZ A;  1SXE A;  5F3X B;  2QB1 A;  2ESE A;  4NJ8 A;  2QB0 B;  5KNI A;  3SEN A;  3KKA C;  2D3D A;  3BS5 B;  4NL9 A;  1DXS A;  2QAR B;  2ES6 A;  3TAD A;  1COK A;  1B0X A;  1JI7 A;  1Z1V A;  2EAP A;  5J8Y A;  1SGG A;  5JTI A;  2EAM A;  1PK1 A;  2B6G A;  2E8O A;  2QB0 A;  3K1R B;  2Y9U A;  2KMD A;  1OW5 A;  2F44 A;  2K4P A;  2E8P A;  3BS5 A;  4RQM A;  2L5Y A;  2QAR A;  1F0M A;  1B4F A;  1PK3 A;  3HIL A;  1WWV A;  1OXJ A;  2EAO A;  1SV0 C;  3IDW A;  3TAC B;  1V38 A;  2JV3 A;  2KSO B;  3KKA A;  4IS7 A;  2F3N A;  2K60 A;  1RG6 A;  4PZO A;  1WWU A;  2DKX A;  3H8M A;  5JU5 A;  2F8K A;  1LKY B;  2LMR A;  4NL9 C;  2EAN A; 
#chains in the Genus database with same CATH topology
 1UCV A;  4ECW A;  1IG6 A;  4ECU A;  5KFJ A;  3EZ5 A;  3J81 j;  5ALH A;  2PFO A;  2I6X A;  4PZN A;  1DK2 A;  4UAT A;  5JRT A;  1V85 A;  4UW9 A;  4OJP A;  4FZL A;  2WAQ C;  3SV4 A;  1L3V A;  2XGP A;  3Q8L A;  3TAR A;  2YTU A;  4ECQ A;  2BDP A;  2ZJ5 A;  2RDJ A;  2V4R A;  2E8M A;  4Z6E A;  4USA A;  3WKB A;  3ISD A;  2KZ3 A;  2KIC A;  1X66 A;  3K4G A;  4F8R A;  3AL0 B;  4R8U A;  4RQN A;  3GIJ A;  4ED2 A;  4ZOH C;  5DQH A;  3H40 A;  3TAN A;  3IV6 A;  3C5F A;  5IIO A;  3B9J A;  3HRD D;  3RTV A;  3F53 A;  3Q8Q B;  4MF2 A;  1RQL A;  5CRX A;  1RM6 C;  2BCR A;  2ZTC A;  4I2H A;  3GQC A;  1SWV A;  1KEJ A;  4JUZ A;  2LHT A;  1ZQQ A;  2EAM A;  3RJJ A;  1ZQV A;  3G6X A;  3NAS A;  4QWE A;  4DFK A;  2PMZ C;  4KX5 A;  2AGO A;  3SMV A;  1LV5 A;  5J0Y A;  4MEX A;  1ZXI A;  2PKE A;  3HP6 A;  3V72 A;  4Y2Q A;  3TFR A;  2K4H A;  1KL9 A;  1SV0 C;  1RXV A;  3PW5 A;  5III A;  4XUS A;  4M2Y A;  5KFZ A;  5AKX A;  2JGA A;  2F3N A;  4YP3 A;  3JPP A;  5ALY A;  4M6W A;  5K4L A;  1X6J A;  1YZ6 A;  5BOM A;  1X6I A;  1XSP A;  4RQ8 A;  2E1F A;  3H0M B;  2H5X A;  2KVS A;  1MQ3 A;  5C0Y A;  2HVI A;  2EQY A;  4BGD A;  2HCF A;  3ZDA A;  4YD2 A;  4JV2 A;  4ICA A;  4U7C A;  3IP4 B;  4YFK A;  1U48 A;  2PFP A;  4NY8 A;  1UT5 A;  4UQG A;  7ICV A;  4KLF A;  4GXK A;  5BPC A;  4YMM A;  4K4I A;  2Y9T A;  2JMG A;  3M7D A;  3PO4 A;  3L3F X;  4I2D A;  5DDY A;  3PW2 A;  3H8W A;  3AQE A;  3F2C A;  2DKZ A;  3TAQ A;  4NM2 A;  5F3X B;  2QB1 A;  3AM9 A;  1NKB A;  4UAZ A;  3TAP A;  4O5C A;  4DSE A;  7ICL A;  5J0W A;  3ETR A;  3KHH A;  4IQT A;  2W9B B;  5E79 U;  4KLQ A;  5KFI A;  4KLH A;  2FMQ A;  4TUP A;  3QUQ A;  2GO7 A;  2IOF K;  1Z4N A;  3MGI A;  2KEY A;  1A6S A;  1T7P A;  2AHO B;  2LYB A;  4QZG A;  4M9H A;  2QB0 A;  2HVH A;  8ICT A;  1S76 D;  4Q43 A;  1V97 A;  3BZC A;  4I2J A;  4ZH4 A;  2F44 A;  4RQM A;  7ICN A;  3QU2 A;  3S6J A;  4FFD A;  3OSN A;  3BQ2 A;  1ZQI A;  9ICJ A;  2LI6 A;  5KT2 A;  3SAH A;  2KP7 A;  5DLG A;  4NLN A;  5AI4 A;  4DL3 A;  1L3U A;  4RQ0 A;  4DO9 A;  1BPE A;  3BZK A;  2DWQ A;  2EAN A;  5J2G A;  1KKX A;  2AQ0 A;  4QZB A;  1T8E A;  1UT8 A;  4J9Q A;  4DWI A;  2N1R A;  1Q8K A;  2FMS A;  3PW7 A;  2J6S A;  2BCS A;  1QSY A;  4JK1 A;  2EDU A;  5CR0 A;  4F4X A;  1MQ2 A;  5ALG A;  2F8L A;  3OPX A;  5HR7 A;  5ALN A;  5F9N A;  8ICW A;  5DB9 A;  4O5K A;  1JXL A;  1SV0 A;  1ZQH A;  2W3S A;  4EEY A;  4CF5 A;  3M9M B;  4ECY A;  5EWG A;  1ZOL A;  4A8E A;  4QZI A;  1L3T A;  1SXE A;  1VLB A;  5ALQ A;  4AP9 A;  4M47 A;  2PFQ A;  5ALL A;  1L7O A;  3LWM A;  5G5H A;  4DOA A;  3MDC A;  3QU7 A;  1T94 A;  3PSI A;  2JXJ A;  3VC8 A;  3MR2 A;  5KFP A;  1T3N A;  2NV3 A;  3KTQ A;  1ECW A;  2UVU A;  5KG5 A;  2W04 A;  4C0Z A;  4LZD A;  2NYV A;  3QZ8 A;  1PK1 A;  5AIB A;  5AM3 A;  7ICM A;  2E8O A;  1XO0 A;  4O3S A;  3V6K A;  3C1Y A;  2JEF A;  2Y9U A;  1IIP A;  5L1K A;  1OW5 A;  2W43 A;  2L5Y A;  4EZ9 A;  3T5L A;  3CP8 A;  3HIL A;  3N7P D;  9ICB A;  4Y2Y A;  2KZM A;  5KL1 B;  4NLG A;  2JH1 A;  4UAS A;  4RNO A;  4YMN A;  3Q8S B;  2DFL A;  1KSP A;  5AKL A;  2M9N A;  3OJS A;  5T14 A;  4FZM A;  5GTH U;  4QWA A;  1WCL A;  4Y2X A;  4YVZ A;  1QTM A;  4EZ6 A;  8ICQ A;  2HDO A;  1N2X A;  2MU2 A;  2FLL A;  4NL9 C;  4DSK A;  4F92 B;  3JPR A;  5J2I A;  3CNH A;  4BXO A;  4NM1 A;  1ZQZ A;  2ODG A;  2ZG6 A;  4BXO B;  9ICK A;  2QKQ A;  5J0U A;  4QJF B;  3KBB A;  4Q44 A;  2GLE A;  7ICR A;  4RPY A;  5KG0 A;  2B21 A;  5ALI A;  3HJE A;  4KMU A;  4EEL A;  2ZIX A;  5J2A A;  2G07 A;  2ZIX B;  5AIA A;  4B9N A;  2KZZ A;  3CW2 C;  4CE6 A;  1LKY A;  2ZIU A;  2ZTD A;  2ZIU B;  4I2G A;  3HT3 A;  2C2D A;  2HSZ A;  3N97 B;  9ICR A;  2EZZ A;  2HHX A;  1UQV A;  2KHQ A;  8ICL A;  4ECR A;  3RAX A;  1S0V A;  2DUY A;  1S0M A;  4B9U A;  3D2Q A;  4MFA A;  5AKY A;  4PL2 A;  4DSF A;  5J29 A;  5AKK A;  5AK6 A;  1HIW A;  3ETL A;  3ZDE A;  2RLT A;  5B66 U;  3SZ2 A;  2DPI A;  1XSL A;  3ALR A;  2DQN B;  4B6J A;  3QXG A;  4C8L A;  1U4B A;  4B9V A;  3LWL A;  3BQ0 A;  1NK8 A;  1K1S A;  3TKA A;  3H4D A;  3HX0 A;  4DLG A;  4I2B A;  9ICN A;  2C22 A;  5DGA A;  2BPC A;  4DOC A;  3BQT A;  1K1Q A;  1HUZ A;  9ICV A;  5L9X A;  4PJ0 U;  4OCZ A;  1VDV A;  2DBY A;  1UA1 A;  1JXE A;  4UBB A;  4FS1 A;  3H0L B;  4GXI A;  5DDM A;  3ZDD A;  1ARO P;  1WWU A;  2KK0 A;  2OM6 A;  2BQR A;  3WKC A;  3NVV A;  2FLN A;  4C7Z A;  7ICF A;  5KL8 B;  1NK0 A;  3M6K A;  2ZUC A;  5HHI A;  2XY6 A;  4MF8 A;  1KRP A;  3OJU A;  3RH4 A;  2WHE A;  3C5G A;  1Z00 A;  2FLP A;  5CA7 A;  1MC8 A;  7ICG A;  4KLM A;  4DSI A;  7ICH A;  2BPG A;  2JEJ A;  2HHU A;  4JWN A;  1TFR A;  1YT3 A;  2KIW A;  7ICO A;  3T5J A;  1DK3 A;  2BDU A;  1S10 A;  4QWB A;  2XCA A;  4QIW F;  3UXO A;  2AQ4 A;  1SL1 A;  5TZV A;  1TAU A;  1ZYQ A;  4F4K A;  3EWA A;  4UAV A;  5KG1 A;  1WYG A;  2XID A;  3PML A;  2HBJ A;  2NRX A;  2GH1 A;  4UB6 U;  4KLJ A;  5DBA A;  7ICS A;  4RQ6 A;  4DL6 A;  1FEZ A;  4NL9 A;  2OH2 A;  2QAR B;  3M1Y A;  5ALJ A;  3C1Z A;  3AMZ A;  4DF8 A;  1COK A;  2Z7J A;  2VA2 A;  5KG2 A;  1XU4 A;  3MFI A;  3WK8 A;  3KD3 A;  4J9S A;  1SGG A;  1F5S A;  1PZN A;  5ALD A;  3RH6 A;  1DGJ A;  3NVW A;  3DEE A;  1NK4 A;  5AKE A;  3UQ0 A;  4DF4 A;  2ZXI A;  3H8J A;  5J2D A;  3L5K A;  3NS1 A;  1ZQF A;  3TFS A;  3QEB Z;  8ICY A;  4RNM A;  1RYR A;  2PFN A;  3UMB A;  3SAF A;  4QZD A;  5ALV A;  3MR6 A;  5J2B A;  5IIJ A;  4DQI A;  1Z19 A;  5KFH A;  2HBM A;  4J9N A;  3KFU F;  4QW9 A;  5IIN A;  4YXM A;  5J2C A;  2ASD A;  1BNO A;  1A0P A;  1RDF A;  1L8O A;  1T3Q A;  1TAQ A;  2K60 A;  3QUB A;  1U47 A;  1ZQS A;  4RQ7 A;  3RJG A;  1XO1 A;  3E2E A;  4J9R A;  3JPQ A;  4ACO A;  2W9C A;  2HW3 A;  3TAD C;  3EPG A;  5KFL A;  4M9L A;  5KT5 A;  4YG2 A;  3E58 A;  3PR5 B;  2ZJ8 A;  4YN4 A;  3ZD9 A;  4B9T A;  1KW4 A;  4JB3 A;  4ECV A;  4J9K A;  2IHM A;  3B0Y A;  3RH5 A;  1HUO A;  4KIT B;  1JAL A;  1TK0 A;  4Y2J A;  1SKR A;  3PVX A;  5AKH A;  2BCU A;  3BQ1 A;  1Q3V A;  3MGV A;  5HNK A;  5KG7 A;  1SZH A;  3RF9 A;  1JRO A;  2K8C B;  1NZP A;  1J97 A;  1S5L U;  1SV4 A;  9ICX A;  1TAM A;  5KFR A;  5KTQ A;  5KT4 A;  2D8C A;  1KDH A;  4I2E A;  4IRD A;  3C23 A;  5KG3 A;  3LVW A;  1PUZ A;  1N63 A;  2D3D A;  3NVY A;  3FAH A;  2G0A A;  3BS5 B;  1N61 A;  5TIS U;  3Q8M A;  1CRX A;  3NGD A;  4Y2R A;  1ZQX A;  4DFM A;  1X9S A;  1JN3 A;  3F5A A;  2YX8 A;  3ED5 A;  3QNM A;  4DCC A;  2YB1 A;  1Z4O A;  9ICS A;  1SL0 A;  3N28 A;  1ZD2 P;  3PST A;  2OHF A;  9ICA A;  4Y2P A;  2NRW A;  4GC7 A;  3IG8 A;  3LYS A;  4IRK A;  8ICO A;  1JRP A;  3HW8 A;  9ICQ A;  1SWW A;  1IXR A;  1SB3 C;  4Z6C A;  2W7P A;  4UB3 A;  2DPJ A;  2PI4 A;  3SQI A;  2JRZ A;  4TQR A;  5DBB A;  4NLB A;  4IS7 A;  2LYA A;  4IR1 A;  9ICI A;  1CI4 A;  3HPO A;  2FDR A;  2FPM A;  4F5P A;  1A76 A;  1L5U A;  2ZJA A;  7ICQ A;  1QSS A;  2KIV A;  8ICR A;  4Y2T A;  4P0Q B;  2W3R A;  3G6Y A;  8ICP A;  1X9W A;  5ALF A;  1O03 A;  2ZIW B;  1M6Y A;  3CRX A;  4EBD A;  3DDH A;  3QU5 A;  2ZUD A;  4P4O A;  4UB4 A;  2H3Q A;  2AXT U;  4GFJ A;  2HOF A;  1U9L A;  3ZDB A;  1UHU A;  1X2I A;  4DL5 A;  3M8S A;  4O3P A;  3GDX A;  3RB4 A;  2G5I B;  1D8B A;  3SI8 A;  3Q8K A;  3WK7 A;  1QSL A;  2CN1 A;  4UBC A;  3KKA C;  5KAI U;  4O3N A;  4EBE A;  2ES6 A;  3TAD A;  3M9O B;  4Q45 A;  2LKY A;  1B0X A;  1NJW A;  4NWI A;  3RFA A;  5AKJ A;  1NI3 A;  1C20 A;  4J9O A;  4RUA A;  2MSN A;  1L7P A;  4QW8 A;  4GC6 A;  1CUK A;  4RQ5 A;  3AEV A;  5J2K A;  2BCQ A;  2B6G A;  2W54 A;  8ICJ A;  3RJK A;  4K4G A;  5ALM A;  2K4P A;  1T4G A;  4F93 B;  2BR0 A;  9ICL A;  4PHP A;  1BPX A;  7ICT A;  5CWR A;  2W9B A;  5KT7 A;  3LVV A;  1TKD A;  3PZP A;  4TQS A;  4BDP A;  7ICI A;  4RPZ A;  3RB6 A;  4EX6 A;  3KOO A;  4R63 A;  1NJY A;  4KLS A;  4DL4 A;  5DKW A;  3PNC A;  3ZI4 A;  3IG5 A;  2F8K A;  2J6U A;  1FFV A;  4RQ4 A;  2LMR A;  4ELT A;  5DLF A;  4CCH A;  5AI6 A;  2R8I A;  4J9L A;  2E5S A;  1L8L A;  3IN5 A;  4RU9 A;  3HKZ F;  2WB1 F;  3G6V A;  2BQ3 A;  4G3I A;  4BWM A;  2JHD A;  8ICU A;  4PPX A;  2WB1 C;  4YQW A;  5IIK A;  2KHV A;  3WK5 A;  2IA6 A;  2YQE A;  1Y88 A;  1ZET A;  2OXO A;  4KLE A;  3RJF A;  1ZQK A;  3PMN A;  2K89 A;  1U45 A;  2ISP A;  4FBU A;  3FC4 A;  4KLI A;  5L1L A;  3PO5 A;  3THV A;  4BJQ A;  2C2R A;  4QZ9 A;  2VAN A;  2EZX A;  3R9K A;  3TI0 A;  4JV0 A;  1DGS A;  3OSP A;  1NNL A;  2A3V A;  1ZD5 A;  1JMS A;  1D9F A;  4UAW A;  4DSJ A;  4HYK A;  4ECZ A;  3T3F A;  2F1I A;  2HHW A;  1B22 A;  2BPF A;  4ECS A;  5KT6 A;  2AU0 A;  4LZG A;  1RPL A;  3GV7 B;  4IQW A;  4US8 A;  5DQG A;  1UA0 A;  4DQQ A;  2GOL A;  3F2B A;  4O3O A;  5KFS A;  5J0T A;  1KLN A;  2K8B B;  5AI8 A;  3KKA A;  4EEK A;  1RG6 A;  3PW4 A;  2V4Q A;  5EWF A;  3AQF A;  3AU6 A;  4FO6 A;  4IL6 U;  3NUQ A;  3WKD A;  4K4H A;  1Q46 A;  2EZY A;  4CF4 A;  4GXJ A;  4UAU A;  1UPH A;  4IRC A;  5AM5 A;  5ALT A;  1D8Y A;  1RYU A;  4CDG A;  2XCP A;  2LPE A;  2VA3 A;  2OEH A;  4F2S A;  4C4S A;  5DBC A;  5KFG A;  5KFF A;  2AGP A;  2WTF A;  3PX6 A;  3D2N A;  3N7R C;  3V6H A;  1C7Y A;  4PGX A;  5EOZ A;  4KN7 A;  2MRL A;  4DL2 A;  1X40 A;  1FO4 A;  4JV1 A;  4IC9 A;  4MFC A;  5EE9 A;  2G5H B;  3AU2 A;  3MAB A;  8ICV A;  2OWO A;  2ESE A;  9ICE A;  3WKE A;  4KTQ A;  1QH9 A;  5BOL A;  3M6Z A;  2I9G A;  2IBK A;  8ICZ A;  4OJL A;  2NRV A;  3RBE A;  5ALZ A;  4JMU A;  5ALO A;  7ICE A;  1Z1V A;  2EAP A;  4F72 A;  3KZX A;  1ZQP A;  2G08 A;  3LDA A;  5CB1 A;  3T5H A;  2XI9 A;  4M9N A;  1N56 A;  5DG9 A;  4J9M A;  5EE3 A;  1ZQT A;  3V7K A;  3ORY A;  4BWJ A;  4UB8 U;  9ICO A;  4RQ2 A;  1L6N A;  2QLT A;  4RQ3 A;  3K1Z A;  1CEZ A;  2YN4 A;  3EYZ A;  3FM9 A;  2RDI A;  3FYH A;  3M9N B;  4Y2U A;  3IHQ B;  1V38 A;  2E3T A;  5DB7 A;  2GWS A;  2DGZ A;  4G9B A;  2HHV A;  4CF3 A;  2ZTE A;  1XC9 A;  1XNS A;  1ZRM A;  2PXI A;  2XIC A;  1OUQ A;  5ALU A;  3B0X A;  4O5E A;  5HHH A;  4O3M A;  5AI9 A;  4XQ8 A;  2CPR A;  3T5K A;  5AK3 A;  4DQP A;  3GU3 A;  5AM0 A;  3C29 A;  4DOB A;  4I28 A;  4ECT A;  9ICP A;  5DGB A;  1NK6 A;  2WF8 A;  1QQ6 A;  1JUD A;  1X42 A;  3NVZ A;  3OGU A;  3BS7 A;  3IM1 A;  3AN1 A;  5AM4 A;  2R8J A;  9ICC A;  2JZB A;  2JZB B;  4ECX A;  1QQ5 A;  3UXN A;  2JEG A;  7ICJ A;  3KHR A;  1DXS A;  5KFT A;  1N5W A;  3RJH A;  1JI7 A;  5ALR A;  4U6P A;  4GLX A;  2ISO A;  2MA1 A;  1ZQW A;  2KJ5 A;  5JTI A;  5HMM A;  4QIW C;  4ED1 A;  2IHN A;  8ICS A;  1FFU A;  4KMO B;  3WK9 A;  2AJQ A;  2HHQ A;  3M8R A;  2ZIV B;  2HOI A;  4YR0 A;  2QAR A;  3GIK A;  1ZQR A;  3WU2 U;  3N7S C;  4P0P B;  1DOQ A;  2VKQ A;  2JEI A;  4PGQ A;  4XRH A;  4Z6F A;  2KSO B;  3ZD8 A;  4Q8F A;  2JH7 A;  2OCE A;  4C8M A;  1Q3U A;  5G5G A;  2UVR A;  1SZP A;  3GV5 B;  4TUR A;  3ICX A;  8ICF A;  2WF5 A;  5J0S A;  1KBU A;  1ZJM A;  3V7L A;  9ICF A;  1QQ7 A;  4F5O A;  1PVR A;  1TE2 A;  4FE3 A;  4QNL A;  5KFM A;  1N48 A;  2F77 X;  5J0X A;  4F50 A;  1ZQA A;  3BJY A;  1MA7 A;  4MHV A;  4KLU A;  1MSW D;  1URJ A;  5ALE A;  5IIL A;  2YB4 A;  2Y0S F;  3A0B U;  5CEH A;  3I1Y A;  1TK5 A;  5D46 A;  8ICH A;  2Y0S C;  2KG5 A;  5HR6 A;  1N5X A;  2HHT A;  3BQ7 A;  2W8L A;  4RT3 A;  4DS4 A;  5DG7 A;  1HJP A;  4YR2 A;  4FS2 A;  2BZF A;  1B43 A;  3ISC A;  1RXW A;  9ICW A;  2HOQ A;  2FMP A;  3F5E A;  3V6J A;  5ALW A;  2H3Z A;  2P6R A;  1ZQN A;  3SEN A;  5JUM A;  1KTQ A;  5DB6 A;  1N62 A;  2RQ5 A;  9ICU A;  3EW9 A;  4I2I A;  3QX7 A;  2W11 A;  5L1I A;  5AIC A;  3ISB A;  2MUT A;  3UM9 A;  2MUT B;  4Q8E A;  3NRZ A;  3GFK B;  4LJX A;  4P4M A;  2KMD A;  4P2H A;  2A19 A;  3BS5 A;  3UMC A;  1B4F A;  4UB5 A;  5KG6 A;  5KFA A;  1PK3 A;  4DSL A;  4DFD A;  2G06 A;  4XA5 A;  3RR7 A;  4QWD A;  4RNN A;  2KV2 A;  4PGY A;  3Q8R B;  4NXZ A;  1SKS A;  2WAQ F;  2JV3 A;  3I76 A;  4BX9 C;  2KKV A;  3C28 A;  3GZF A;  4MFF A;  1K5O A;  2AGQ A;  3HWT A;  4CGZ A;  3H8M A;  1NKC A;  4CNQ A;  1L7N A;  1JIH A;  2VJ5 A;  1J2N A;  4OJO A;  8ICE A;  1KFS A;  4DQR A;  4UB1 A;  2UVV A;  3F2D A;  3MBY A;  4R8U B;  2FE9 A;  3BDP A;  2KKP A;  3QU4 A;  3SEI A;  3MR3 A;  2HHS A;  3RB0 A;  5KFN A;  4ED7 A;  3RRH A;  4C4R A;  4C4T A;  5J2J A;  2KTQ A;  1ZRN A;  2WF6 A;  5KFE A;  1SKW A;  2DL0 A;  3FDS A;  4P0Q A;  5L1J A;  3EPI A;  2ZIW A;  1ZD3 A;  2C28 A;  2PMZ F;  5AM2 A;  1Z3E B;  2DF4 B;  4F2R A;  3MDA A;  2LM4 A;  5KNI A;  3UXP A;  2ZXH A;  3VCB A;  3QE9 Y;  3PX0 A;  2NRT A;  4O3R A;  4DEZ A;  4DQS A;  4C8O A;  2XC9 A;  5DB8 A;  4F5R A;  2KOB A;  2H3F A;  1BPY A;  2KJ8 A;  2VIX A;  4UAY A;  1NZB A;  4KLT A;  4PHA A;  9ICG A;  5AI0 A;  2ASL A;  4M6W B;  5KFQ A;  2FJ6 A;  4X5V A;  4QWC A;  3QUT A;  3A0H U;  1F0M A;  3C21 A;  2CRX A;  4Z6D A;  4I2F A;  1DRG A;  3L4P A;  4I2A A;  1ZJN A;  1PVQ A;  4OJ5 A;  2HI0 A;  3QU9 A;  2OYY A;  2YML A;  4QZ8 A;  2EH9 A;  5CJ7 A;  1NJZ A;  1VJ5 A;  3QUC A;  3O0F A;  1ED1 A;  5KFD A;  4C80 A;  2IOH A;  2VA8 A;  1AQ6 A;  2YMP A;  1QLN A;  1JX4 A;  4NV0 A;  1Z1B A;  4J03 A;  1U49 A;  1ZD4 A;  1IV8 A;  2J6T A;  3QYP A;  1J2M A;  5KFC A;  5GTI U;  3PX4 A;  4RZR A;  3Q8P B;  4YMO A;  4DL7 A;  3H8S A;  4F71 A;  4P4P A;  1S77 D;  5FP0 A;  9ICM A;  2MAX A;  3OTQ A;  5KFO A;  3RJE A;  2K4I A;  4R65 A;  5AKI A;  1RQN A;  1L7M A;  1ZQG A;  1FIQ A;  3C2K A;  5A0L A;  3TQ1 A;  2P66 A;  1LB2 B;  4HAI A;  2LBO A;  1ZQE A;  3UMG A;  1BVS A;  4EX7 A;  4UAR A;  2KJ9 A;  2QB0 B;  3HKZ C;  1NK5 A;  4BUG A;  4PHE A;  1SIJ A;  4ED0 A;  1KFT A;  2PI5 A;  3RJI A;  3RB3 A;  1S0N A;  5J2E A;  4TUQ A;  3C2M A;  4DS5 A;  3JPO A;  2UVW A;  5KFX A;  4KLO A;  2C2E A;  4YCX A;  8ICA A;  2K4E A;  5H2F U;  2YY6 A;  1ZQU A;  2KFZ A;  5F9L A;  1ZQB A;  3EUB 2;  2G09 A;  4F5N A;  4DLE A;  1XSN A;  8ICN A;  5B5E U;  2HMX A;  2Y1J A;  2RP5 A;  2LM1 A;  3IDW A;  4ELU A;  2R18 A;  8ICC A;  2W7O A;  4PL1 A;  4DFJ A;  3ZDC A;  1RZT A;  3H0R B;  4O0I A;  2W03 A;  3MC1 A;  5KFW A;  5JU5 A;  2XY5 A;  2KFN A;  2BCV A;  4FBT A;  2E1E A;  2I5H A;  1ZQJ A;  2KVC A;  4OD0 A;  5J8Y C;  1ZQM A;  3E0F A;  5AKG A;  5KFU A;  4QZH A;  5AM1 A;  4C8K A;  4E0D A;  4ED8 A;  4EBC A;  1COO A;  2WF9 A;  4ELV A;  3MFH A;  4R64 A;  4QZC A;  3CYM A;  1S8O A;  5HML A;  4QZA A;  5J0Q A;  2ALZ A;  3GII A;  4IQV A;  3T79 A;  2H3I A;  8ICI A;  1BPD A;  3DV9 A;  3RR8 A;  7ICU A;  2R8K A;  1PK1 B;  4KX3 A;  4UB2 A;  4YD1 A;  2I1Q A;  5J0O A;  4LVS A;  4F4W A;  3V7J A;  3MR5 A;  2KD1 A;  4ED3 A;  2XO7 A;  2H3V A;  1D9D A;  2ASJ A;  1S9F A;  1EXN A;  2VJ4 A;  3AUO A;  3SR6 A;  2KNJ A;  4RPX A;  4F91 B;  2IMW P;  4B9L A;  9ICT A;  2NRZ A;  1S0O A;  3GIL A;  3RRG A;  4CRX A;  3PY8 A;  1KFD A;  2A1A A;  4O9M A;  5C5J A;  2F1J A;  8ICX A;  3KHG A;  4AYB F;  4O3Q A;  5AI5 A;  1D8L A;  1N60 A;  3KZI U;  4QZF A;  4AYB C;  2YMQ A;  4EYH B;  8ICK A;  3H4B A;  4C7Y A;  1SL2 A;  1TVA A;  5AK4 A;  1BGX T;  2DKX A;  2D6F C;  1S97 A;  3RAQ A;  3JPN A;  1RYS A;  5DQI A;  4RUC A;  4OJ6 A;  1LKY B;  5J2F A;  2LYH A;  1HEK A;  4F4Y A;  2KE7 A;  3SV3 A;  2WF7 A;  4IQU A;  2K8A A;  2FPL A;  1NKE A;  2ATL A;  1WUD A;  3KHL A;  4ED6 A;  5KAF U;  1X9X A;  5J0P A;  5DG8 A;  2BQU A;  1TV9 A;  3ONN A;  5L1M A;  1NK7 A;  1SXD A;  2R8H A;  2RHF A;  3SD7 A;  2XVT A;  3UQ2 A;  1NOM A;  2WFA A;  3PSP A;  1TK8 A;  1XS9 D;  1L3S A;  3OHA A;  2Q0Z X;  2Y1I A;  4B9S A;  2NO4 A;  4YR3 A;  4OO1 J;  3IRU A;  3PSF A;  2F2A B;  4C8N A;  1WCN A;  1XWL A;  1O08 A;  5IIM A;  1LVH A;  5J8Y A;  3SYZ A;  2IOF A;  1WG8 A;  4GIB A;  2BHN A;  2A1J A;  3WK4 A;  3LK9 A;  4I27 A;  2A1J B;  4M9J A;  4PHD A;  3D2S A;  5KFB A;  1GO3 F;  3K1R B;  2RRD A;  2BGW A;  5CP2 A;  2W9A A;  2XGQ A;  5J0R A;  3QEA Z;  5AKZ A;  5KT3 A;  8ICG A;  1KN5 A;  2HBK A;  2XY7 A;  3PR4 A;  2V9W A;  4R66 A;  1P7D A;  4MEY A;  2B0C A;  1V9P A;  3PW0 A;  1ZQO A;  3WK6 A;  1H38 A;  4M9G A;  3TAC B;  2P6U A;  4YXJ A;  1Z00 B;  3JPT A;  4B9M A;  2FPK A;  3WKA A;  4PZO A;  3D6J A;  1ZQL A;  4EYI B;  1KQQ A;  1IM4 A;  2ZIV A;  2YMM A;  4F4Z A;  4EEN A;  1NK9 A;  4NLZ A;  2ZUB A;  5CHG A;  1BNP A;  4KN4 A;  3SAG A;  4P0P A;  4DFP A;  4PH5 A;  1ZQD A;  5KG4 A;  2CXY A;  2KSO A;  1QCK A;  2E8N A;  4RT2 A;  4TUS A;  5EE1 A;  4J9P A;  7ICK A;  2BKE A;  1ZQ1 C;  2FI1 A;  7ICP A;  4M0A A;  5D4B A;  3N4M B;  4I29 A;  3QZ7 A;  4NLC A;  2W55 A;  4WJ3 B;  2W8K A;  2AH5 A;  4NJ8 A;  4IR9 A;  4M04 A;  1YZ7 A;  4JWM A;  2R8G A;  4Y2V A;  5ALS A;  5J2H A;  3C2L A;  4F5Q A;  2F76 X;  1ZQC A;  1A77 A;  3K75 D;  5EE0 A;  2W9M A;  5KFV A;  1ZQY A;  5KFK A;  2M0N A;  4KLG A;  3H7I A;  3NRW A;  3RBD A;  4NLK A;  5ALP A;  3UPQ A;  4US9 A;  5HP4 A;  5ALK A;  3OHB A;  5EWE A;  8ICM A;  3NTU A;  2F1H A;  3MGH A;  2HBL A;  1NJX A;  2E8P A;  3GIM A;  3PV8 A;  5AK5 A;  4QZE A;  4Y2S A;  4RQ1 A;  2O6K A;  2W9C B;  1X9M A;  1F44 A;  1WWV A;  4I2C A;  1OXJ A;  5KFY A;  3JPS A;  4KLL A;  2EAO A;  1BPZ A;  4FZN A;  3I28 A;  5ALX A;  4F3O A;  2NO5 A;  2P35 A;  5D49 A;  2JR5 A;  2Q4T A;  4KLD A;  2KN7 A;  3GV8 B;  3U26 A;  1PVP A;  9ICH A;  8ICB A;  5AHX A;  1BPB A;  1MN8 A; 
#chains in the Genus database with same CATH homology
 1UCV A;  2KIV A;  3TAD C;  2FE9 A;  2KE7 A;  2QKQ A;  3SEI A;  4PZN A;  1KW4 A;  5J8Y C;  5JRT A;  2GLE A;  2KSO A;  1V85 A;  2LPE A;  4MHV A;  2YTU A;  2E8N A;  1X9X A;  1LKY A;  2E8M A;  2KG5 A;  5L1M A;  1SXD A;  2DL0 A;  2Y9T A;  1SV0 A;  3BQ7 A;  1X66 A;  1X40 A;  1SV4 A;  4RQN A;  3BS7 A;  2D8C A;  1PK1 B;  1UQV A;  2DKZ A;  1SXE A;  5F3X B;  2QB1 A;  2ESE A;  4NJ8 A;  2QB0 B;  5KNI A;  3SEN A;  3KKA C;  2D3D A;  3BS5 B;  4NL9 A;  1DXS A;  2QAR B;  2ES6 A;  3TAD A;  1COK A;  1B0X A;  1JI7 A;  1Z1V A;  2EAP A;  5J8Y A;  1SGG A;  5JTI A;  2EAM A;  1PK1 A;  2B6G A;  2E8O A;  2QB0 A;  3K1R B;  2Y9U A;  2KMD A;  1OW5 A;  2F44 A;  2K4P A;  2E8P A;  3BS5 A;  4RQM A;  2L5Y A;  2QAR A;  1F0M A;  1B4F A;  1PK3 A;  3HIL A;  1WWV A;  1OXJ A;  2EAO A;  1SV0 C;  3IDW A;  3TAC B;  1V38 A;  2JV3 A;  2KSO B;  3KKA A;  4IS7 A;  2F3N A;  2K60 A;  1RG6 A;  4PZO A;  1WWU A;  2DKX A;  3H8M A;  5JU5 A;  2F8K A;  1LKY B;  2LMR A;  4NL9 C;  2EAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...