3KKAC

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
59
structure length
59
Chain Sequence
TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 1
publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
total genus 19
structure length 59
sequence length 59
chains with identical sequence D, E
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaC00
2QKQA 1V38A 5F3XB 5JRTA 4NJ8A 2E8PA 2KG5A 1COKA 1X9XA 2LMRA 3K1RB 4NL9C 5J8YA 2D8CA 1SXEA 2F8KA 3BQ7A 2B6GA 3H8MA 3TACB 1SV4A 2QB1A 2QARA 1JI7A 2KSOA 2LPEA 1OXJA 3BS5A 3HILA 4PZOA 5KNIA 2K60A 2QB0A 2ES6A 2D3DA 1UQVA 1X66A 1DXSA 2FE9A 1UCVA 1SV0A 2EAOA 4PZNA 1WWUA 2E8OA 2Y9UA 4RQNA 4IS7A 5J8YC 3KKAA 1LKYA 1F0MA 1B0XA 1OW5A 2KIVA 5JU5A 1PK1A 2DKXA 2Y9TA 3TADA 2QARB 3BS7A 2KSOB 3BS5B 2E8NA 2F3NA 2DKZA 1B4FA 2L5YA 2QB0B 2E8MA 2EAPA 1KW4A 1SV0C 1SGGA 3SEIA 4RQMA 4MHVA 1X40A 1Z1VA 2F44A 2JV3A 4NL9A 2EANA 2K4PA 3KKAC 2EAMA 3SENA 5JTIA 2DL0A 2KMDA 1LKYB 1PK3A 3IDWA 1V85A 1RG6A 1SXDA 3TADC 5L1MA 1PK1B 2GLEA 2YTUA 1WWVA 2KE7A 2ESEA
chains in the Genus database with same CATH superfamily
4DQIA 4QJFB 3G6XA 3TANA 1CEZA 5ALFA 1X9WA 3RH6A 4ECVA 5AKIA 5AKHA 3K1RB 4JWMA 1ZQKA 5J8YA 5BOLA 4NLNA 4YR3A 1GO3F 4UB1A 4DFPA 5IILA 2HVIA 4UB4A 3CRXA 2QB1A 4C7YA 3TKAA 3N4MB 3C23A 4I2GA 2WF6A 4PZOA 4RPXA 5KG0A 2H3QA 1S10A 4PHDA 3THVA 2V4QA 4KMOB 1L7MA 4TQSA 4FE3A 4YN4A 2NO5A 2IBKA 3UPQA 3NTUA 4Z6FA 3IHQB 3T5JA 2Y0SC 1WUDA 2IOFA 2RP5A 5CEHA 4O3SA 3MGIA 4BXOB 4MEXA 3Q8QB 4KLHA 5CB1A 4P4MA 2K4HA 4NLZA 1NOMA 4QZDA 1L7NA 3L5KA 4HAIA 1ZQDA 1ZQGA 2VKQA 3UMCA 2PFNA 2IOHA 3V7JA 4EEKA 1UHUA 1JXEA 3RR7A 2PMZF 1XNSA 2MA1A 2BQRA 1IM4A 5DGBA 2W3SA 2KJ8A 4Q8FA 1HUZA 5AM4A 7ICGA 9ICBA 4CNQA 3AM9A 4ECYA 1TV9A 4KLQA 3KHHA 3D2NA 2FPMA 4Z6EA 5JTIA 3VC8A 4O3NA 3ICXA 1SWVA 2W55A 4M6WB 1Q3UA 4Y2XA 1SXDA 2Y1JA 3A0HU 2GLEA 2ASLA 2IA6A 2DFLA 4YR0A 5AIAA 3Q8LA 2ZIUA 4QWDA 1SIJA 4ICAA 5J0SA 3QUTA 3IG8A 1ZQAA 2PXIA 1XSLA 4KLJA 2D8CA 4DS4A 2B6GA 4IQTA 3ZDBA 4DFMA 4QZEA 1SV4A 4RQ2A 2BPGA 4RQ4A 5HR6A 2HHTA 4CCHA 5KFNA 2LPEA 2YMLA 3RJFA 1J2MA 5IIKA 1MSWD 1J2NA 2F8LA 2BKEA 1CRXA 3TFSA 2JR5A 1YT3A 4RQ7A 3N7RC 3SAGA 2ZUDA 4QWAA 4UW9A 3RJGA 4M9JA 1B22A 2W04A 4GFJA 4P0PB 1S8OA 3QZ8A 3WKBA 1A76A 4I2HA 2RLTA 2AU0A 1IV8A 4IL6U 8ICBA 2ZIXB 1ZQJA 5JU5A 1A0PA 1Q8KA 4O9MA 4ED6A 4ELUA 3T3FA 4JUZA 1NZBA 1SB3C 1DGJA 3G6YA 2E3TA 4US8A 3SV3A 1X40A 4DF8A 3EW9A 5AM3A 3RRHA 5EE1A 1S0NA 4MFAA 2XIDA 2J6TA 4BUGA 5AI6A 4KLTA 2EAMA 3C29A 3UXNA 4KN7A 8ICQA 1V85A 1RG6A 5AI4A 2GO7A 4JB3A 3PMNA 4RPYA 2AGOA 3GIIA 5L1KA 5KFJA 3SAFA 2QKQA 2MRLA 3H40A 4I2EA 1Z3EB 1N61A 4QW8A 1BNOA 1ZD4A 2LM4A 4Y2VA 3M9OB 1ZQOA 4ED1A 8ICHA 3JPSA 2QARA 5L1JA 2HDOA 5KFOA 2C2RA 1VJ5A 3HILA 4PGQA 4DOCA 2W9BA 1UT8A 9ICNA 5J0XA 3Q8SB 3M8SA 3AMZA 1UCVA 4USAA 3ISBA 4EBCA 3V6HA 2XI9A 2JZBA 3ED5A 4QZIA 2WFAA 2AGQA 5DG7A 4ED2A 9ICAA 4B9SA 8ICGA 3I76A 3M8RA 2NV3A 4QZGA 1LKYA 4AYBC 2HMXA 2Y0SF 2KJ5A 2ALZA 3PW4A 3RJHA 3M6ZA 2KVCA 1N56A 2BCUA 5ALSA 4DL3A 1DOQA 5F9LA 1BNPA 4EZ9A 2BCVA 2R8GA 4NM1A 1B4FA 5ALNA 1JROA 3RBEA 2BCRA 1JMSA 1MC8A 3PX6A 1N2XA 8ICWA 1ZQWA 1Z4NA 1XS9D 2WB1F 3BZKA 3WK5A 1IXRA 2I5HA 2JV3A 3NVVA 1XO0A 1T4GA 1SL0A 4YXJA 1TK8A 2D6FC 2EANA 1ZQHA 5KG7A 4IRCA 2KFZA 2F2AB 1BPDA 4RUCA 1MN8A 3N7PD 3K1ZA 3IM1A 2W43A 4ACOA 4FS2A 4I29A 2DQNB 3ISCA 3WKDA 1PK1B 4J9SA 1L5UA 4QNLA 3PVXA 1XSPA 5ALOA 5AK5A 8ICCA 2IOFK 9ICLA 4IC9A 3F2DA 7ICJA 4FZMA 5KG2A 4I2DA 5ALJA 1X9XA 9ICMA 2KD1A 5B5EU 1DRGA 2DPJA 3QXGA 3EPIA 3ISDA 5ALUA 2EQYA 2MSNA 4ZOHC 4B9LA 3LK9A 5KL8B 2F8KA 2F1HA 9ICCA 3IRUA 1L7OA 4UB8U 3C2MA 1L6NA 1U4BA 3TACB 5KAIU 1J97A 2FDRA 4XUSA 4IQVA 1OXJA 1T3NA 2FI1A 2HHSA 2DPIA 3D2SA 1KFSA 3G6VA 1SKWA 5J0RA 4KLOA 2WHEA 2BDPA 1ZETA 1EXNA 3HJEA 4DO9A 3M9MB 3LDAA 1ZQSA 4KLIA 5B66U 2PKEA 2OYYA 3KKAA 2C22A 5D46A 1TK5A 1NI3A 1X42A 5KFIA 4O3RA 4EBDA 4BDPA 2YMPA 3RH4A 2GWSA 9ICOA 4JMUA 1NKBA 5ALWA 2BCQA 4C4RA 2J6UA 1NK8A 2K89A 2HBKA 4Y2SA 4Q45A 3TAPA 4F5PA 5D4BA 1BPEA 4F72A 4DQPA 1NK5A 2HHXA 4TURA 2LI6A 5KFFA 5G5HA 3NS1A 4XRHA 2PMZC 3PW5A 2HOIA 4YG2A 5CRXA 1MA7A 1K1SA 4R8UA 3TADC 3D2QA 5J2CA 4M9NA 2DGZA 4TUPA 2LKYA 1KL9A 2HW3A 3I1YA 4EZ6A 1O08A 3AQEA 4GXJA 2KG5A 3ZD8A 3EUB2 3OSNA 5CR0A 1XO1A 2G5HB 3QEAZ 4NL9C 3PR4A 2WF8A 3BQ7A 4FZNA 4F4ZA 4DWIA 4P0QA 5KFBA 2HI0A 2V9WA 9ICXA 4F3OA 2G5IB 3BS5A 2A1JA 1KFTA 5AKXA 1ZQLA 3M7DA 2H3IA 3MFIA 3QYPA 4Z6DA 7ICOA 4C8MA 1D9DA 2ZIWA 1LV5A 3GDXA 4US9A 3MR6A 2MU2A 1PUZA 1QH9A 2BCSA 2UVVA 1ECWA 3RTVA 5KFPA 3UM9A 5ALYA 1ZOLA 4UQGA 4BJQA 2MAXA 5KL1B 4RNNA 4ED7A 4F2RA 2Y9TA 8ICMA 4AYBF 2W7PA 2VANA 2KSOB 1ZRNA 2E8NA 3ZDEA 4K4HA 2PI5A 2EAPA 8ICOA 4ECUA 3BQTA 1CI4A 3FC4A 3SYZA 8ICNA 4FBUA 3S6JA 4OJ5A 5KG5A 3GZFA 1L3TA 2Q4TA 5HR7A 4BGDA 5CJ7A 4M47A 1RYUA 5ALZA 1DGSA 4CDGA 1KKXA 2JRZA 1XSNA 5L1IA 3PMLA 4RT2A 2HSZA 3EYZA 3QUBA 3HKZC 1S0OA 4BXOA 3H0MB 3T5KA 4EBEA 3MFHA 2XY6A 1ZQRA 1NJWA 4EEYA 2ZJ5A 3JPQA 8ICUA 2VA2A 3PV8A 1V9PA 3D6JA 4LZDA 3L3FX 3NVZA 1C20A 3PY8A 4NV0A 5G5GA 1WG8A 2EH9A 2G08A 4I28A 4RQ6A 3B0XA 4KMUA 2R18A 1JN3A 2O6KA 7ICTA 1ZQZA 4M6WA 1N5XA 4QWBA 7ICNA 2KIVA 2K8AA 5ALPA 4F5RA 1UA1A 2DKXA 2QLTA 1U47A 2H3ZA 1NK6A 4HYKA 5KFCA 4UBCA 1ZQNA 3DEEA 3GV8B 2KJ9A 5AM1A 2QB0B 2XC9A 5KFXA 4DFDA 4WJ3B 1IIPA 3R9KA 5J0OA 3SEIA 4DL4A 1QSSA 4MHVA 9ICRA 5AKEA 3QU9A 3PNCA 2JGAA 1KRPA 2H3VA 5L1LA 1NJXA 2ISPA 3SQIA 1T3QA 5KG3A 4LZGA 2LM1A 2JEGA 4F8RA 2WB1C 2A3VA 3H0LB 1M6YA 4F4YA 1L3UA 9ICJA 2BR0A 4P0PA 1QCKA 3TARA 2UVRA 3E0FA 2FLLA 1ZRMA 3E2EA 4KLLA 3KHGA 3MGVA 2B21A 2ZIXA 1KLNA 2KK0A 5J29A 1RXVA 3T5HA 4LJXA 4DL6A 3H0RB 1RPLA 1D9FA 3K4GA 1TAQA 3ETLA 5KFYA 5ALTA 2KFNA 4R65A 3KZXA 5TZVA 4ECQA 2W7OA 3QE9Y 4R64A 3FYHA 5KG6A 4NXZA 4TUQA 1Z4OA 1NK0A 3TI0A 5EOZA 3EZ5A 2V4RA 4TUSA 5AI5A 4PHEA 3H7IA 4ED0A 4YD1A 1ZQCA 3FAHA 2H5XA 2FLNA 3NASA 4DQRA 4X5VA 1SKSA 2M9NA 3SMVA 3J81j 1NK4A 2XGPA 2N1RA 1SL1A 1JXLA 4FZLA 4F5OA 4B9UA 3ZD9A 2KTQA 3TFRA 1PVPA 1JRPA 3F2BA 4K4GA 1HUOA 1KDHA 4Q8EA 2K4IA 5DG8A 9ICGA 2M0NA 1LB2B 4P2HA 4B9MA 3WU2U 5EWFA 2KMDA 4IRKA 5CP2A 1K1QA 4BWJA 5CA7A 2WF5A 4C8KA 4FBTA 4YQWA 4RUAA 9ICQA 1FFVA 1WWVA 5JUMA 2KE7A 4Y2QA 4DLEA 3GIKA 3QX7A 4GXKA 2YB4A 4NLKA 3HRDD 2BHNA 1X2IA 3RJKA 2P66A 2RHFA 4MF8A 3SD7A 2VJ5A 2G0AA 2YMMA 5KAFU 3HKZF 1A6SA 2NRTA 1O03A 3OGUA 1NKEA 2YX8A 4YVZA 2BPFA 2KHVA 3JPPA 4DOAA 4TQRA 3UQ2A 5ALEA 4J03A 2D3DA 2ZXIA 4DSIA 1NNLA 2I6XA 2ZG6A 3NVYA 1ZQXA 3Q8RB 4C8NA 2PFPA 2ZTCA 3C5GA 5AM2A 1X6JA 5E79U 3PR5B 3HW8A 1NK7A 1ZQUA 4IS7A 2XY5A 1RZTA 5KT6A 3LVVA 3KOOA 5KG1A 3PO5A 1DK3A 5AIBA 1PK1A 4O5EA 5KFLA 1S0VA 2EZYA 8ICYA 3M1YA 3HPOA 4Y2RA 4OJPA 4CE6A 3V7LA 2NRZA 5J0YA 2F44A 1ZYQA 4DL5A 3NGDA 2PI4A 4B9NA 5AKKA 1WCLA 4P4OA 3QU2A 2AXTU 3OTQA 5J2IA 4DL2A 1TAUA 5DLGA 1N60A 1PK3A 1QQ5A 5ALKA 2R8HA 4DSLA 3PSFA 4KX5A 4YR2A 4DQSA 1PVQA 1QSLA 2F1IA 5KFUA 1T7PA 3NRZA 3F5EA 1BPZA 5J0QA 2ODGA 3UMBA 3EPGA 3AL0B 2BGWA 5KFEA 3ZDDA 3ZI4A 3WKCA 2OWOA 1JX4A 5AK4A 1JUDA 4I2BA 1S76D 2W9CB 4RQ5A 9ICSA 3C28A 2K8CB 2FPKA 2KVSA 8ICPA 5KNIA 1L8LA 2XICA 4CF4A 3B0YA 2K4EA 4CRXA 1WYGA 3C1YA 2W11A 3HWTA 4DQQA 4RNOA 1XWLA 1HEKA 4F5NA 4O5KA 4B9VA 4KLGA 4GXIA 2H3FA 5ALIA 1B0XA 5DBAA 9ICPA 2JZBB 5KFWA 4PGXA 3KFUF 3AEVA 4BWMA 2KZMA 4KITB 3PSIA 3TADA 1JIHA 3RRGA 2MUTB 4G3IA 2FLPA 4PGYA 9ICWA 2NRVA 1N62A 2VJ4A 2EDUA 3ZDAA 1SV0C 4RQMA 4F50A 4NLBA 2R8JA 1RDFA 3RR8A 3KD3A 4UB5A 4JV0A 8ICVA 4NL9A 1TFRA 3RFAA 1Z00B 5CHGA 2P6RA 2DWQA 1NK9A 8ICTA 1ZQFA 3IDWA 2E5SA 3EWAA 1AQ6A 3FM9A 4I2IA 4J9PA 4F71A 1NJYA 1S5LU 4DLGA 2A1AA 4UB6U 4CF5A 1V38A 2IHMA 3DV9A 4NJ8A 5ALVA 4FS1A 4O5CA 2ZJAA 1COKA 3BDPA 4DSKA 2VIXA 5IIJA 5AKZA 4JV1A 4PJ0U 5J2JA 4AP9A 4G9BA 2JXJA 1RM6C 3LWLA 7ICHA 1JI7A 1FO4A 2KSOA 3PSTA 1KTQA 1CUKA 4FO6A 2ZTEA 4F92B 2K60A 4KLFA 3GV7B 3AN1A 1UQVA 1X66A 3PX0A 4ED3A 8ICJA 4Y2JA 8ICEA 1DXSA 4BX9C 3F53A 3QU5A 3MR2A 1SWWA 5ALMA 2OHFA 3HT3A 1Z19A 1FIQA 4EX7A 1U9LA 2WF7A 4XQ8A 3RB6A 4C4TA 4GC6A 3OSPA 1LVHA 3UMGA 5EWEA 3OPXA 5ALHA 5EE3A 2KIWA 3CP8A 4Q43A 4OCZA 3N97B 3O0FA 4J9QA 2C28A 5DDMA 2KZZA 8ICRA 5HHHA 3B9JA 2HCFA 2Q0ZX 4EYHB 4UASA 3RH5A 3TQ1A 1MQ3A 2BQ3A 2I1QA 4YD2A 4C8OA 4QZ8A 1WCNA 4F4KA 5GTHU 4DSEA 1RQLA 2E1FA 5J2GA 3I28A 2G06A 4I2FA 5HMLA 3SAHA 1SKRA 4QZCA 3UXOA 2XY7A 5KFQA 1PZNA 2OEHA 2YTUA 2RDIA 3N7SC 4JK1A 4KLEA 1DK2A 1BPYA 9ICHA 5KFRA 1TE2A 2CPRA 1URJA 2FPLA 3C2KA 1AROP 4NLCA 5KFMA 5KT4A 1QQ7A 3VCBA 3GIMA 4U7CA 4JWNA 4UBBA 4I27A 4C4SA 5KTQA 4RZRA 3F2CA 2HHVA 2YMQA 1XC9A 8ICXA 5DQHA 2QB0A 2HBLA 5DKWA 3WK8A 1D8LA 4QZAA 1N63A 3MBYA 1S9FA 2YN4A 5ALXA 4DEZA 4P0QB 5F9NA 4UAWA 2OCEA 5AM5A 4RPZA 2WAQC 4B6JA 5BOMA 2XCPA 4ECRA 2BQUA 3HP6A 3QUQA 4YP3A 4GIBA 5AICA 2HBMA 3RBDA 4IQUA 7ICVA 1KSPA 1RQNA 5KFAA 4NLGA 4KLSA 4I2AA 5DB6A 5DB7A 1BVSA 3OHBA 2L5YA 7ICFA 2E8MA 2AQ4A 1ZQBA 1UPHA 1T94A 4O3PA 5J2FA 3CW2C 1Z1VA 4UAUA 1TK0A 2K4PA 2AGPA 3PW2A 5A0LA 4UB3A 2J6SA 5K4LA 4Y2TA 3BQ1A 5AKLA 4R63A 2W03A 3M6KA 3ORYA 2ZTDA 1ZQIA 4YMMA 7ICMA 2ZJ8A 4IR9A 1V97A 1TKDA 3IV6A 1ZQMA 2PFQA 9ICEA 2ZIVB 3WK9A 5L1MA 2HHQA 9ICVA 1BPXA 3PW7A 1L3SA 3V6JA 1ZQYA 4C8LA 5KFSA 2NYVA 1ZXIA 1ZD2P 5HNKA 4ECZA 3RB0A 7ICKA 5J2KA 4UAZA 4Y2YA 1F44A 4Y2PA 4EELA 4QZFA 5J2HA 3Q8PB 2ATLA 2HOQA 1A77A 4KLUA 1RYRA 3RB3A 4O0IA 5EWGA 1SZPA 5DQIA 2Y1IA 3V7KA 4PHPA 7ICRA 1H38A 3RB4A 5DG9A 4J9RA 3GU3A 3MR3A 5EE0A 4NM2A 2YQEA 2LYBA 1PVRA 3WK7A 2P35A 1KN5A 4UB2A 2VA3A 2Z7JA 4DSJA 3V6KA 1N5WA 4J9LA 1D8BA 4ELVA 2Y9UA 5J8YC 4M9GA 5DBBA 1ZQTA 2GOLA 4NY8A 4RT3A 1U48A 4IQWA 4ED8A 1L7PA 1ZQ1C 1OUQA 2UVWA 5IIMA 2CRXA 5J2BA 2W3RA 2I9GA 3V72A 2IHNA 3M9NB 3H8JA 4U6PA 3QEBZ 3CYMA 5ALGA 1YZ7A 4O3QA 4PL1A 3OJSA 4QIWC 2ZUBA 3GV5B 5DLFA 4KLDA 3UXPA 4B9TA 7ICQA 2RDJA 1UA0A 1TAMA 5KT3A 1Z1BA 3C5FA 5J2DA 4QWEA 1SL2A 4C80A 2BZFA 3PO4A 1B43A 4QWCA 3RJJA 4DFKA 5J0WA 4RQ3A 2R8IA 5DDYA 2YY6A 3QNMA 1NKCA 2DL0A 4GC7A 2FMQA 1FFUA 1ED1A 2DBYA 3LVWA 2K8BB 3KHLA 4YMOA 4QZ9A 3QUCA 2KZ3A 5F3XB 2KP7A 4PL2A 2HHWA 2HVHA 4OJLA 2JH1A 2KICA 1Q3VA 4QZBA 2RRDA 3KHRA 4ECSA 2ZXHA 4EYIB 4MEYA 4F2SA 3H8MA 5TISU 4Q44A 2OH2A 5AI9A 5AKGA 2OXOA 2JEFA 3AU2A 4P4PA 1XU4A 1ZJMA 1KEJA 4I2CA 4JV2A 2F76X 8ICAA 3GILA 2HBJA 1QQ6A 3WK6A 2FE9A 5AK3A 3C1ZA 4LVSA 3BJYA 4M0AA 3A0BU 2CXYA 2ZIUB 1COOA 3IN5A 2GH1A 1WWUA 1HIWA 4Z6CA 5DB8A 1F5SA 4RQ1A 3N28A 5IINA 1F0MA 2WAQF 1K5OA 1OW5A 3WK4A 4J9OA 4YXMA 1VLBA 2KNJA 3BS7A 3JPTA 2W8KA 2B0CA 2F3NA 2DKZA 4OO1J 2OM6A 1KW4A 3KTQA 5KFDA 1KFDA 7ICPA 5KFGA 2NRXA 1U49A 2W9CA 2BPCA 4EENA 2XCAA 3NUQA 1P7DA 4J9MA 4M04A 4FFDA 4ECXA 2W8LA 4J9KA 2R8KA 3NVWA 5C5JA 1JALA 2F77X 1KBUA 1MQ2A 4YFKA 5AM0A 4QW9A 2C2DA 8ICLA 3ZDCA 2E8PA 4YCXA 1FEZA 3FDSA 5J0PA 2F1JA 4KLMA 8ICIA 2KN7A 2W54A 3MR5A 4QZHA 4F4XA 2NRWA 3TAQA 2MUTA 4OJ6A 3CNHA 4DS5A 3OHAA 5FP0A 1YZ6A 2ES6A 3SR6A 5AKJA 2LBOA 4RQ0A 7ICLA 7ICSA 3MC1A 5KFTA 1SV0A 4MFCA 4PZNA 2VA8A 2E8OA 1Z00A 5EE9A 5DBCA 2UVUA 5KFZA 5J2EA 1L3VA 3H4BA 3K75D 3SZ2A 3PX4A 2DUYA 3SI8A 2DF4B 3T5LA 4EX6A 4Y2UA 3ONNA 2QARB 5IIOA 7ICUA 2AHOB 3JPOA 2G07A 2ASJA 4ELTA 2W9BB 2ASDA 3LYSA 1X9SA 2JMGA 3OJUA 2P6UA 3H8WA 2ZUCA 2WTFA 5AK6A 4QIWF 4M9LA 2XGQA 5DQGA 3GFKB 3RJIA 4KX3A 3SENA 4DF4A 2W9AA 1LKYB 4ECTA 4CF3A 2FMPA 5J0TA 1Q46A 5T14A 3C2LA 2ESEA 4O3OA 1BGXT 4M9HA 2LYHA 2IMWP 2ISOA 1C7YA 3Q8MA 4DSFA 5KFHA 3RAXA 1S0MA 3DDHA 4DL7A 3KBBA 3PSPA 5C0YA 4YMNA 3E58A 1T8EA 4UARA 5AKYA 2HOFA 3WKEA 4F93B 4ECWA 1TVAA 4IRDA 1QTMA 3QZ7A 5BPCA 2LYAA 1ZQVA 9ICUA 4PHAA 4RU9A 3IP4B 4E0DA 2AH5A 4OD0A 9ICKA 5L9XA 8ICKA 1RXWA 3T79A 5J2AA 1X9MA 2AJQA 9ICTA 1UT5A 1IG6A 5H2FU 2LHTA 3RF9A 5GTIU 1VDVA 5DGAA 2XO7A 4MFFA 3LWMA 3SV4A 2C2EA 1NJZA 2BDUA 1SZHA 5DB9A 1Y88A 2NO4A 3MDAA 4MF2A 5KFVA 3AUOA 1BPBA 2CN1A 3IG5A 3L4PA 5ALDA 1SGGA 4ZH4A 4R66A 2EZXA 2W9MA 4KN4A 5ALQA 8ICSA 9ICFA 3HX0A 4A8EA 1ZQPA 3KKAC 3Q8KA 3RAQA 3PZPA 3RJEA 2KEYA 2KV2A 2E1EA 1D8YA 3JPNA 4C7ZA 2KOBA 2RQ5A 3NRWA 7ICEA 1S77D 4PH5A 4PPXA 5AI8A 3BQ0A 5JRTA 4KTQA 4XA5A 2EZZA 4DCCA 3F5AA 2WF9A 3ALRA 1ZD5A 2LMRA 3C21A 3H8SA 3MDCA 5HHIA 1NZPA 5J0UA 1SXEA 4DOBA 4F4WA 1QLNA 5CWRA 4M2YA 3KZIU 2KHQA 1S97A 5IIIA 2AQ0A 2FJ6A 3BZCA 4I2JA 5HP4A 4R8UB 5KT7A 4K4IA 1QSYA 3AQFA 2YB1A 4F91B 4J9NA 4UAVA 4DFJA 2EAOA 1ZQEA 2JEIA 5D49A 2JEJA 4RNMA 5AI0A 1X6IA 5KT5A 4GLXA 4RQNA 2JHDA 1ZQQA 2A19A 4NWIA 3MABA 3AU6A 1N48A 2HHUA 3QU4A 4IR1A 3GIJA 2ZIVA 4OJOA 1KQQA 3ETRA 5KG4A 5AHXA 3MGHA 9ICIA 2PFOA 1HJPA 5HMMA 3GQCA 1ZJNA 5ALRA 2JH7A 3BS5B 8ICFA 2A1JB 4F5QA 2XVTA 5ALLA 3U26A 4RQ8A 4UAYA 1L8OA 2KKVA 5KFKA 2ZIWB 4C0ZA 2FMSA 4CGZA 3BQ2A 3PW0A 3H4DA 8ICZA 1RYSA 3JPRA 7ICIA 2G09A 5KT2A 2KKPA 3UQ0A 3QU7A 4O3MA 4UATA 1ZD3A 3WKAA 1U45A
chains in the Genus database with same CATH topology
2QKQA 1V38A 5F3XB 5JRTA 4NJ8A 2E8PA 2KG5A 1COKA 1X9XA 2LMRA 3K1RB 4NL9C 5J8YA 2D8CA 1SXEA 2F8KA 3BQ7A 2B6GA 3H8MA 3TACB 1SV4A 2QB1A 2QARA 1JI7A 2KSOA 2LPEA 1OXJA 3BS5A 3HILA 4PZOA 5KNIA 2K60A 2QB0A 2ES6A 2D3DA 1UQVA 1X66A 1DXSA 2FE9A 1UCVA 1SV0A 2EAOA 4PZNA 1WWUA 2E8OA 2Y9UA 4RQNA 4IS7A 5J8YC 3KKAA 1LKYA 1F0MA 1B0XA 1OW5A 2KIVA 5JU5A 1PK1A 2DKXA 2Y9TA 3TADA 2QARB 3BS7A 2KSOB 3BS5B 2E8NA 2F3NA 2DKZA 1B4FA 2L5YA 2QB0B 2E8MA 2EAPA 1KW4A 1SV0C 1SGGA 3SEIA 4RQMA 4MHVA 1X40A 1Z1VA 2F44A 2JV3A 4NL9A 2EANA 2K4PA 3KKAC 2EAMA 3SENA 5JTIA 2DL0A 2KMDA 1LKYB 1PK3A 3IDWA 1V85A 1RG6A 1SXDA 3TADC 5L1MA 1PK1B 2GLEA 2YTUA 1WWVA 2KE7A 2ESEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKQ A;  1V38 A;  5F3X B;  5JRT A;  4NJ8 A;  2E8P A;  2KG5 A;  1COK A;  1X9X A;  2LMR A;  3K1R B;  4NL9 C;  5J8Y A;  2D8C A;  1SXE A;  2F8K A;  3BQ7 A;  2B6G A;  3H8M A;  3TAC B;  1SV4 A;  2QB1 A;  2QAR A;  1JI7 A;  2KSO A;  2LPE A;  1OXJ A;  3BS5 A;  3HIL A;  4PZO A;  5KNI A;  2K60 A;  2QB0 A;  2ES6 A;  2D3D A;  1UQV A;  1X66 A;  1DXS A;  2FE9 A;  1UCV A;  1SV0 A;  2EAO A;  4PZN A;  1WWU A;  2E8O A;  2Y9U A;  4RQN A;  4IS7 A;  5J8Y C;  3KKA A;  1LKY A;  1F0M A;  1B0X A;  1OW5 A;  2KIV A;  5JU5 A;  1PK1 A;  2DKX A;  2Y9T A;  3TAD A;  2QAR B;  3BS7 A;  2KSO B;  3BS5 B;  2E8N A;  2F3N A;  2DKZ A;  1B4F A;  2L5Y A;  2QB0 B;  2E8M A;  2EAP A;  1KW4 A;  1SV0 C;  1SGG A;  3SEI A;  4RQM A;  4MHV A;  1X40 A;  1Z1V A;  2F44 A;  2JV3 A;  4NL9 A;  2EAN A;  2K4P A;  3KKA C;  2EAM A;  3SEN A;  5JTI A;  2DL0 A;  2KMD A;  1LKY B;  1PK3 A;  3IDW A;  1V85 A;  1RG6 A;  1SXD A;  3TAD C;  5L1M A;  1PK1 B;  2GLE A;  2YTU A;  1WWV A;  2KE7 A;  2ESE A; 
#chains in the Genus database with same CATH topology
 4DQI A;  4QJF B;  3G6X A;  3TAN A;  1CEZ A;  5ALF A;  1X9W A;  3RH6 A;  4ECV A;  5AKI A;  5AKH A;  3K1R B;  4JWM A;  1ZQK A;  5J8Y A;  5BOL A;  4NLN A;  4YR3 A;  1GO3 F;  4UB1 A;  4DFP A;  5IIL A;  2HVI A;  4UB4 A;  3CRX A;  2QB1 A;  4C7Y A;  3TKA A;  3N4M B;  3C23 A;  4I2G A;  2WF6 A;  4PZO A;  4RPX A;  5KG0 A;  2H3Q A;  1S10 A;  4PHD A;  3THV A;  2V4Q A;  4KMO B;  1L7M A;  4TQS A;  4FE3 A;  4YN4 A;  2NO5 A;  2IBK A;  3UPQ A;  3NTU A;  4Z6F A;  3IHQ B;  3T5J A;  2Y0S C;  1WUD A;  2IOF A;  2RP5 A;  5CEH A;  4O3S A;  3MGI A;  4BXO B;  4MEX A;  3Q8Q B;  4KLH A;  5CB1 A;  4P4M A;  2K4H A;  4NLZ A;  1NOM A;  4QZD A;  1L7N A;  3L5K A;  4HAI A;  1ZQD A;  1ZQG A;  2VKQ A;  3UMC A;  2PFN A;  2IOH A;  3V7J A;  4EEK A;  1UHU A;  1JXE A;  3RR7 A;  2PMZ F;  1XNS A;  2MA1 A;  2BQR A;  1IM4 A;  5DGB A;  2W3S A;  2KJ8 A;  4Q8F A;  1HUZ A;  5AM4 A;  7ICG A;  9ICB A;  4CNQ A;  3AM9 A;  4ECY A;  1TV9 A;  4KLQ A;  3KHH A;  3D2N A;  2FPM A;  4Z6E A;  5JTI A;  3VC8 A;  4O3N A;  3ICX A;  1SWV A;  2W55 A;  4M6W B;  1Q3U A;  4Y2X A;  1SXD A;  2Y1J A;  3A0H U;  2GLE A;  2ASL A;  2IA6 A;  2DFL A;  4YR0 A;  5AIA A;  3Q8L A;  2ZIU A;  4QWD A;  1SIJ A;  4ICA A;  5J0S A;  3QUT A;  3IG8 A;  1ZQA A;  2PXI A;  1XSL A;  4KLJ A;  2D8C A;  4DS4 A;  2B6G A;  4IQT A;  3ZDB A;  4DFM A;  4QZE A;  1SV4 A;  4RQ2 A;  2BPG A;  4RQ4 A;  5HR6 A;  2HHT A;  4CCH A;  5KFN A;  2LPE A;  2YML A;  3RJF A;  1J2M A;  5IIK A;  1MSW D;  1J2N A;  2F8L A;  2BKE A;  1CRX A;  3TFS A;  2JR5 A;  1YT3 A;  4RQ7 A;  3N7R C;  3SAG A;  2ZUD A;  4QWA A;  4UW9 A;  3RJG A;  4M9J A;  1B22 A;  2W04 A;  4GFJ A;  4P0P B;  1S8O A;  3QZ8 A;  3WKB A;  1A76 A;  4I2H A;  2RLT A;  2AU0 A;  1IV8 A;  4IL6 U;  8ICB A;  2ZIX B;  1ZQJ A;  5JU5 A;  1A0P A;  1Q8K A;  4O9M A;  4ED6 A;  4ELU A;  3T3F A;  4JUZ A;  1NZB A;  1SB3 C;  1DGJ A;  3G6Y A;  2E3T A;  4US8 A;  3SV3 A;  1X40 A;  4DF8 A;  3EW9 A;  5AM3 A;  3RRH A;  5EE1 A;  1S0N A;  4MFA A;  2XID A;  2J6T A;  4BUG A;  5AI6 A;  4KLT A;  2EAM A;  3C29 A;  3UXN A;  4KN7 A;  8ICQ A;  1V85 A;  1RG6 A;  5AI4 A;  2GO7 A;  4JB3 A;  3PMN A;  4RPY A;  2AGO A;  3GII A;  5L1K A;  5KFJ A;  3SAF A;  2QKQ A;  2MRL A;  3H40 A;  4I2E A;  1Z3E B;  1N61 A;  4QW8 A;  1BNO A;  1ZD4 A;  2LM4 A;  4Y2V A;  3M9O B;  1ZQO A;  4ED1 A;  8ICH A;  3JPS A;  2QAR A;  5L1J A;  2HDO A;  5KFO A;  2C2R A;  1VJ5 A;  3HIL A;  4PGQ A;  4DOC A;  2W9B A;  1UT8 A;  9ICN A;  5J0X A;  3Q8S B;  3M8S A;  3AMZ A;  1UCV A;  4USA A;  3ISB A;  4EBC A;  3V6H A;  2XI9 A;  2JZB A;  3ED5 A;  4QZI A;  2WFA A;  2AGQ A;  5DG7 A;  4ED2 A;  9ICA A;  4B9S A;  8ICG A;  3I76 A;  3M8R A;  2NV3 A;  4QZG A;  1LKY A;  4AYB C;  2HMX A;  2Y0S F;  2KJ5 A;  2ALZ A;  3PW4 A;  3RJH A;  3M6Z A;  2KVC A;  1N56 A;  2BCU A;  5ALS A;  4DL3 A;  1DOQ A;  5F9L A;  1BNP A;  4EZ9 A;  2BCV A;  2R8G A;  4NM1 A;  1B4F A;  5ALN A;  1JRO A;  3RBE A;  2BCR A;  1JMS A;  1MC8 A;  3PX6 A;  1N2X A;  8ICW A;  1ZQW A;  1Z4N A;  1XS9 D;  2WB1 F;  3BZK A;  3WK5 A;  1IXR A;  2I5H A;  2JV3 A;  3NVV A;  1XO0 A;  1T4G A;  1SL0 A;  4YXJ A;  1TK8 A;  2D6F C;  2EAN A;  1ZQH A;  5KG7 A;  4IRC A;  2KFZ A;  2F2A B;  1BPD A;  4RUC A;  1MN8 A;  3N7P D;  3K1Z A;  3IM1 A;  2W43 A;  4ACO A;  4FS2 A;  4I29 A;  2DQN B;  3ISC A;  3WKD A;  1PK1 B;  4J9S A;  1L5U A;  4QNL A;  3PVX A;  1XSP A;  5ALO A;  5AK5 A;  8ICC A;  2IOF K;  9ICL A;  4IC9 A;  3F2D A;  7ICJ A;  4FZM A;  5KG2 A;  4I2D A;  5ALJ A;  1X9X A;  9ICM A;  2KD1 A;  5B5E U;  1DRG A;  2DPJ A;  3QXG A;  3EPI A;  3ISD A;  5ALU A;  2EQY A;  2MSN A;  4ZOH C;  4B9L A;  3LK9 A;  5KL8 B;  2F8K A;  2F1H A;  9ICC A;  3IRU A;  1L7O A;  4UB8 U;  3C2M A;  1L6N A;  1U4B A;  3TAC B;  5KAI U;  1J97 A;  2FDR A;  4XUS A;  4IQV A;  1OXJ A;  1T3N A;  2FI1 A;  2HHS A;  2DPI A;  3D2S A;  1KFS A;  3G6V A;  1SKW A;  5J0R A;  4KLO A;  2WHE A;  2BDP A;  1ZET A;  1EXN A;  3HJE A;  4DO9 A;  3M9M B;  3LDA A;  1ZQS A;  4KLI A;  5B66 U;  2PKE A;  2OYY A;  3KKA A;  2C22 A;  5D46 A;  1TK5 A;  1NI3 A;  1X42 A;  5KFI A;  4O3R A;  4EBD A;  4BDP A;  2YMP A;  3RH4 A;  2GWS A;  9ICO A;  4JMU A;  1NKB A;  5ALW A;  2BCQ A;  4C4R A;  2J6U A;  1NK8 A;  2K89 A;  2HBK A;  4Y2S A;  4Q45 A;  3TAP A;  4F5P A;  5D4B A;  1BPE A;  4F72 A;  4DQP A;  1NK5 A;  2HHX A;  4TUR A;  2LI6 A;  5KFF A;  5G5H A;  3NS1 A;  4XRH A;  2PMZ C;  3PW5 A;  2HOI A;  4YG2 A;  5CRX A;  1MA7 A;  1K1S A;  4R8U A;  3TAD C;  3D2Q A;  5J2C A;  4M9N A;  2DGZ A;  4TUP A;  2LKY A;  1KL9 A;  2HW3 A;  3I1Y A;  4EZ6 A;  1O08 A;  3AQE A;  4GXJ A;  2KG5 A;  3ZD8 A;  3EUB 2;  3OSN A;  5CR0 A;  1XO1 A;  2G5H B;  3QEA Z;  4NL9 C;  3PR4 A;  2WF8 A;  3BQ7 A;  4FZN A;  4F4Z A;  4DWI A;  4P0Q A;  5KFB A;  2HI0 A;  2V9W A;  9ICX A;  4F3O A;  2G5I B;  3BS5 A;  2A1J A;  1KFT A;  5AKX A;  1ZQL A;  3M7D A;  2H3I A;  3MFI A;  3QYP A;  4Z6D A;  7ICO A;  4C8M A;  1D9D A;  2ZIW A;  1LV5 A;  3GDX A;  4US9 A;  3MR6 A;  2MU2 A;  1PUZ A;  1QH9 A;  2BCS A;  2UVV A;  1ECW A;  3RTV A;  5KFP A;  3UM9 A;  5ALY A;  1ZOL A;  4UQG A;  4BJQ A;  2MAX A;  5KL1 B;  4RNN A;  4ED7 A;  4F2R A;  2Y9T A;  8ICM A;  4AYB F;  2W7P A;  2VAN A;  2KSO B;  1ZRN A;  2E8N A;  3ZDE A;  4K4H A;  2PI5 A;  2EAP A;  8ICO A;  4ECU A;  3BQT A;  1CI4 A;  3FC4 A;  3SYZ A;  8ICN A;  4FBU A;  3S6J A;  4OJ5 A;  5KG5 A;  3GZF A;  1L3T A;  2Q4T A;  5HR7 A;  4BGD A;  5CJ7 A;  4M47 A;  1RYU A;  5ALZ A;  1DGS A;  4CDG A;  1KKX A;  2JRZ A;  1XSN A;  5L1I A;  3PML A;  4RT2 A;  2HSZ A;  3EYZ A;  3QUB A;  3HKZ C;  1S0O A;  4BXO A;  3H0M B;  3T5K A;  4EBE A;  3MFH A;  2XY6 A;  1ZQR A;  1NJW A;  4EEY A;  2ZJ5 A;  3JPQ A;  8ICU A;  2VA2 A;  3PV8 A;  1V9P A;  3D6J A;  4LZD A;  3L3F X;  3NVZ A;  1C20 A;  3PY8 A;  4NV0 A;  5G5G A;  1WG8 A;  2EH9 A;  2G08 A;  4I28 A;  4RQ6 A;  3B0X A;  4KMU A;  2R18 A;  1JN3 A;  2O6K A;  7ICT A;  1ZQZ A;  4M6W A;  1N5X A;  4QWB A;  7ICN A;  2KIV A;  2K8A A;  5ALP A;  4F5R A;  1UA1 A;  2DKX A;  2QLT A;  1U47 A;  2H3Z A;  1NK6 A;  4HYK A;  5KFC A;  4UBC A;  1ZQN A;  3DEE A;  3GV8 B;  2KJ9 A;  5AM1 A;  2QB0 B;  2XC9 A;  5KFX A;  4DFD A;  4WJ3 B;  1IIP A;  3R9K A;  5J0O A;  3SEI A;  4DL4 A;  1QSS A;  4MHV A;  9ICR A;  5AKE A;  3QU9 A;  3PNC A;  2JGA A;  1KRP A;  2H3V A;  5L1L A;  1NJX A;  2ISP A;  3SQI A;  1T3Q A;  5KG3 A;  4LZG A;  2LM1 A;  2JEG A;  4F8R A;  2WB1 C;  2A3V A;  3H0L B;  1M6Y A;  4F4Y A;  1L3U A;  9ICJ A;  2BR0 A;  4P0P A;  1QCK A;  3TAR A;  2UVR A;  3E0F A;  2FLL A;  1ZRM A;  3E2E A;  4KLL A;  3KHG A;  3MGV A;  2B21 A;  2ZIX A;  1KLN A;  2KK0 A;  5J29 A;  1RXV A;  3T5H A;  4LJX A;  4DL6 A;  3H0R B;  1RPL A;  1D9F A;  3K4G A;  1TAQ A;  3ETL A;  5KFY A;  5ALT A;  2KFN A;  4R65 A;  3KZX A;  5TZV A;  4ECQ A;  2W7O A;  3QE9 Y;  4R64 A;  3FYH A;  5KG6 A;  4NXZ A;  4TUQ A;  1Z4O A;  1NK0 A;  3TI0 A;  5EOZ A;  3EZ5 A;  2V4R A;  4TUS A;  5AI5 A;  4PHE A;  3H7I A;  4ED0 A;  4YD1 A;  1ZQC A;  3FAH A;  2H5X A;  2FLN A;  3NAS A;  4DQR A;  4X5V A;  1SKS A;  2M9N A;  3SMV A;  3J81 j;  1NK4 A;  2XGP A;  2N1R A;  1SL1 A;  1JXL A;  4FZL A;  4F5O A;  4B9U A;  3ZD9 A;  2KTQ A;  3TFR A;  1PVP A;  1JRP A;  3F2B A;  4K4G A;  1HUO A;  1KDH A;  4Q8E A;  2K4I A;  5DG8 A;  9ICG A;  2M0N A;  1LB2 B;  4P2H A;  4B9M A;  3WU2 U;  5EWF A;  2KMD A;  4IRK A;  5CP2 A;  1K1Q A;  4BWJ A;  5CA7 A;  2WF5 A;  4C8K A;  4FBT A;  4YQW A;  4RUA A;  9ICQ A;  1FFV A;  1WWV A;  5JUM A;  2KE7 A;  4Y2Q A;  4DLE A;  3GIK A;  3QX7 A;  4GXK A;  2YB4 A;  4NLK A;  3HRD D;  2BHN A;  1X2I A;  3RJK A;  2P66 A;  2RHF A;  4MF8 A;  3SD7 A;  2VJ5 A;  2G0A A;  2YMM A;  5KAF U;  3HKZ F;  1A6S A;  2NRT A;  1O03 A;  3OGU A;  1NKE A;  2YX8 A;  4YVZ A;  2BPF A;  2KHV A;  3JPP A;  4DOA A;  4TQR A;  3UQ2 A;  5ALE A;  4J03 A;  2D3D A;  2ZXI A;  4DSI A;  1NNL A;  2I6X A;  2ZG6 A;  3NVY A;  1ZQX A;  3Q8R B;  4C8N A;  2PFP A;  2ZTC A;  3C5G A;  5AM2 A;  1X6J A;  5E79 U;  3PR5 B;  3HW8 A;  1NK7 A;  1ZQU A;  4IS7 A;  2XY5 A;  1RZT A;  5KT6 A;  3LVV A;  3KOO A;  5KG1 A;  3PO5 A;  1DK3 A;  5AIB A;  1PK1 A;  4O5E A;  5KFL A;  1S0V A;  2EZY A;  8ICY A;  3M1Y A;  3HPO A;  4Y2R A;  4OJP A;  4CE6 A;  3V7L A;  2NRZ A;  5J0Y A;  2F44 A;  1ZYQ A;  4DL5 A;  3NGD A;  2PI4 A;  4B9N A;  5AKK A;  1WCL A;  4P4O A;  3QU2 A;  2AXT U;  3OTQ A;  5J2I A;  4DL2 A;  1TAU A;  5DLG A;  1N60 A;  1PK3 A;  1QQ5 A;  5ALK A;  2R8H A;  4DSL A;  3PSF A;  4KX5 A;  4YR2 A;  4DQS A;  1PVQ A;  1QSL A;  2F1I A;  5KFU A;  1T7P A;  3NRZ A;  3F5E A;  1BPZ A;  5J0Q A;  2ODG A;  3UMB A;  3EPG A;  3AL0 B;  2BGW A;  5KFE A;  3ZDD A;  3ZI4 A;  3WKC A;  2OWO A;  1JX4 A;  5AK4 A;  1JUD A;  4I2B A;  1S76 D;  2W9C B;  4RQ5 A;  9ICS A;  3C28 A;  2K8C B;  2FPK A;  2KVS A;  8ICP A;  5KNI A;  1L8L A;  2XIC A;  4CF4 A;  3B0Y A;  2K4E A;  4CRX A;  1WYG A;  3C1Y A;  2W11 A;  3HWT A;  4DQQ A;  4RNO A;  1XWL A;  1HEK A;  4F5N A;  4O5K A;  4B9V A;  4KLG A;  4GXI A;  2H3F A;  5ALI A;  1B0X A;  5DBA A;  9ICP A;  2JZB B;  5KFW A;  4PGX A;  3KFU F;  3AEV A;  4BWM A;  2KZM A;  4KIT B;  3PSI A;  3TAD A;  1JIH A;  3RRG A;  2MUT B;  4G3I A;  2FLP A;  4PGY A;  9ICW A;  2NRV A;  1N62 A;  2VJ4 A;  2EDU A;  3ZDA A;  1SV0 C;  4RQM A;  4F50 A;  4NLB A;  2R8J A;  1RDF A;  3RR8 A;  3KD3 A;  4UB5 A;  4JV0 A;  8ICV A;  4NL9 A;  1TFR A;  3RFA A;  1Z00 B;  5CHG A;  2P6R A;  2DWQ A;  1NK9 A;  8ICT A;  1ZQF A;  3IDW A;  2E5S A;  3EWA A;  1AQ6 A;  3FM9 A;  4I2I A;  4J9P A;  4F71 A;  1NJY A;  1S5L U;  4DLG A;  2A1A A;  4UB6 U;  4CF5 A;  1V38 A;  2IHM A;  3DV9 A;  4NJ8 A;  5ALV A;  4FS1 A;  4O5C A;  2ZJA A;  1COK A;  3BDP A;  4DSK A;  2VIX A;  5IIJ A;  5AKZ A;  4JV1 A;  4PJ0 U;  5J2J A;  4AP9 A;  4G9B A;  2JXJ A;  1RM6 C;  3LWL A;  7ICH A;  1JI7 A;  1FO4 A;  2KSO A;  3PST A;  1KTQ A;  1CUK A;  4FO6 A;  2ZTE A;  4F92 B;  2K60 A;  4KLF A;  3GV7 B;  3AN1 A;  1UQV A;  1X66 A;  3PX0 A;  4ED3 A;  8ICJ A;  4Y2J A;  8ICE A;  1DXS A;  4BX9 C;  3F53 A;  3QU5 A;  3MR2 A;  1SWW A;  5ALM A;  2OHF A;  3HT3 A;  1Z19 A;  1FIQ A;  4EX7 A;  1U9L A;  2WF7 A;  4XQ8 A;  3RB6 A;  4C4T A;  4GC6 A;  3OSP A;  1LVH A;  3UMG A;  5EWE A;  3OPX A;  5ALH A;  5EE3 A;  2KIW A;  3CP8 A;  4Q43 A;  4OCZ A;  3N97 B;  3O0F A;  4J9Q A;  2C28 A;  5DDM A;  2KZZ A;  8ICR A;  5HHH A;  3B9J A;  2HCF A;  2Q0Z X;  4EYH B;  4UAS A;  3RH5 A;  3TQ1 A;  1MQ3 A;  2BQ3 A;  2I1Q A;  4YD2 A;  4C8O A;  4QZ8 A;  1WCN A;  4F4K A;  5GTH U;  4DSE A;  1RQL A;  2E1F A;  5J2G A;  3I28 A;  2G06 A;  4I2F A;  5HML A;  3SAH A;  1SKR A;  4QZC A;  3UXO A;  2XY7 A;  5KFQ A;  1PZN A;  2OEH A;  2YTU A;  2RDI A;  3N7S C;  4JK1 A;  4KLE A;  1DK2 A;  1BPY A;  9ICH A;  5KFR A;  1TE2 A;  2CPR A;  1URJ A;  2FPL A;  3C2K A;  1ARO P;  4NLC A;  5KFM A;  5KT4 A;  1QQ7 A;  3VCB A;  3GIM A;  4U7C A;  4JWN A;  4UBB A;  4I27 A;  4C4S A;  5KTQ A;  4RZR A;  3F2C A;  2HHV A;  2YMQ A;  1XC9 A;  8ICX A;  5DQH A;  2QB0 A;  2HBL A;  5DKW A;  3WK8 A;  1D8L A;  4QZA A;  1N63 A;  3MBY A;  1S9F A;  2YN4 A;  5ALX A;  4DEZ A;  4P0Q B;  5F9N A;  4UAW A;  2OCE A;  5AM5 A;  4RPZ A;  2WAQ C;  4B6J A;  5BOM A;  2XCP A;  4ECR A;  2BQU A;  3HP6 A;  3QUQ A;  4YP3 A;  4GIB A;  5AIC A;  2HBM A;  3RBD A;  4IQU A;  7ICV A;  1KSP A;  1RQN A;  5KFA A;  4NLG A;  4KLS A;  4I2A A;  5DB6 A;  5DB7 A;  1BVS A;  3OHB A;  2L5Y A;  7ICF A;  2E8M A;  2AQ4 A;  1ZQB A;  1UPH A;  1T94 A;  4O3P A;  5J2F A;  3CW2 C;  1Z1V A;  4UAU A;  1TK0 A;  2K4P A;  2AGP A;  3PW2 A;  5A0L A;  4UB3 A;  2J6S A;  5K4L A;  4Y2T A;  3BQ1 A;  5AKL A;  4R63 A;  2W03 A;  3M6K A;  3ORY A;  2ZTD A;  1ZQI A;  4YMM A;  7ICM A;  2ZJ8 A;  4IR9 A;  1V97 A;  1TKD A;  3IV6 A;  1ZQM A;  2PFQ A;  9ICE A;  2ZIV B;  3WK9 A;  5L1M A;  2HHQ A;  9ICV A;  1BPX A;  3PW7 A;  1L3S A;  3V6J A;  1ZQY A;  4C8L A;  5KFS A;  2NYV A;  1ZXI A;  1ZD2 P;  5HNK A;  4ECZ A;  3RB0 A;  7ICK A;  5J2K A;  4UAZ A;  4Y2Y A;  1F44 A;  4Y2P A;  4EEL A;  4QZF A;  5J2H A;  3Q8P B;  2ATL A;  2HOQ A;  1A77 A;  4KLU A;  1RYR A;  3RB3 A;  4O0I A;  5EWG A;  1SZP A;  5DQI A;  2Y1I A;  3V7K A;  4PHP A;  7ICR A;  1H38 A;  3RB4 A;  5DG9 A;  4J9R A;  3GU3 A;  3MR3 A;  5EE0 A;  4NM2 A;  2YQE A;  2LYB A;  1PVR A;  3WK7 A;  2P35 A;  1KN5 A;  4UB2 A;  2VA3 A;  2Z7J A;  4DSJ A;  3V6K A;  1N5W A;  4J9L A;  1D8B A;  4ELV A;  2Y9U A;  5J8Y C;  4M9G A;  5DBB A;  1ZQT A;  2GOL A;  4NY8 A;  4RT3 A;  1U48 A;  4IQW A;  4ED8 A;  1L7P A;  1ZQ1 C;  1OUQ A;  2UVW A;  5IIM A;  2CRX A;  5J2B A;  2W3R A;  2I9G A;  3V72 A;  2IHN A;  3M9N B;  3H8J A;  4U6P A;  3QEB Z;  3CYM A;  5ALG A;  1YZ7 A;  4O3Q A;  4PL1 A;  3OJS A;  4QIW C;  2ZUB A;  3GV5 B;  5DLF A;  4KLD A;  3UXP A;  4B9T A;  7ICQ A;  2RDJ A;  1UA0 A;  1TAM A;  5KT3 A;  1Z1B A;  3C5F A;  5J2D A;  4QWE A;  1SL2 A;  4C80 A;  2BZF A;  3PO4 A;  1B43 A;  4QWC A;  3RJJ A;  4DFK A;  5J0W A;  4RQ3 A;  2R8I A;  5DDY A;  2YY6 A;  3QNM A;  1NKC A;  2DL0 A;  4GC7 A;  2FMQ A;  1FFU A;  1ED1 A;  2DBY A;  3LVW A;  2K8B B;  3KHL A;  4YMO A;  4QZ9 A;  3QUC A;  2KZ3 A;  5F3X B;  2KP7 A;  4PL2 A;  2HHW A;  2HVH A;  4OJL A;  2JH1 A;  2KIC A;  1Q3V A;  4QZB A;  2RRD A;  3KHR A;  4ECS A;  2ZXH A;  4EYI B;  4MEY A;  4F2S A;  3H8M A;  5TIS U;  4Q44 A;  2OH2 A;  5AI9 A;  5AKG A;  2OXO A;  2JEF A;  3AU2 A;  4P4P A;  1XU4 A;  1ZJM A;  1KEJ A;  4I2C A;  4JV2 A;  2F76 X;  8ICA A;  3GIL A;  2HBJ A;  1QQ6 A;  3WK6 A;  2FE9 A;  5AK3 A;  3C1Z A;  4LVS A;  3BJY A;  4M0A A;  3A0B U;  2CXY A;  2ZIU B;  1COO A;  3IN5 A;  2GH1 A;  1WWU A;  1HIW A;  4Z6C A;  5DB8 A;  1F5S A;  4RQ1 A;  3N28 A;  5IIN A;  1F0M A;  2WAQ F;  1K5O A;  1OW5 A;  3WK4 A;  4J9O A;  4YXM A;  1VLB A;  2KNJ A;  3BS7 A;  3JPT A;  2W8K A;  2B0C A;  2F3N A;  2DKZ A;  4OO1 J;  2OM6 A;  1KW4 A;  3KTQ A;  5KFD A;  1KFD A;  7ICP A;  5KFG A;  2NRX A;  1U49 A;  2W9C A;  2BPC A;  4EEN A;  2XCA A;  3NUQ A;  1P7D A;  4J9M A;  4M04 A;  4FFD A;  4ECX A;  2W8L A;  4J9K A;  2R8K A;  3NVW A;  5C5J A;  1JAL A;  2F77 X;  1KBU A;  1MQ2 A;  4YFK A;  5AM0 A;  4QW9 A;  2C2D A;  8ICL A;  3ZDC A;  2E8P A;  4YCX A;  1FEZ A;  3FDS A;  5J0P A;  2F1J A;  4KLM A;  8ICI A;  2KN7 A;  2W54 A;  3MR5 A;  4QZH A;  4F4X A;  2NRW A;  3TAQ A;  2MUT A;  4OJ6 A;  3CNH A;  4DS5 A;  3OHA A;  5FP0 A;  1YZ6 A;  2ES6 A;  3SR6 A;  5AKJ A;  2LBO A;  4RQ0 A;  7ICL A;  7ICS A;  3MC1 A;  5KFT A;  1SV0 A;  4MFC A;  4PZN A;  2VA8 A;  2E8O A;  1Z00 A;  5EE9 A;  5DBC A;  2UVU A;  5KFZ A;  5J2E A;  1L3V A;  3H4B A;  3K75 D;  3SZ2 A;  3PX4 A;  2DUY A;  3SI8 A;  2DF4 B;  3T5L A;  4EX6 A;  4Y2U A;  3ONN A;  2QAR B;  5IIO A;  7ICU A;  2AHO B;  3JPO A;  2G07 A;  2ASJ A;  4ELT A;  2W9B B;  2ASD A;  3LYS A;  1X9S A;  2JMG A;  3OJU A;  2P6U A;  3H8W A;  2ZUC A;  2WTF A;  5AK6 A;  4QIW F;  4M9L A;  2XGQ A;  5DQG A;  3GFK B;  3RJI A;  4KX3 A;  3SEN A;  4DF4 A;  2W9A A;  1LKY B;  4ECT A;  4CF3 A;  2FMP A;  5J0T A;  1Q46 A;  5T14 A;  3C2L A;  2ESE A;  4O3O A;  1BGX T;  4M9H A;  2LYH A;  2IMW P;  2ISO A;  1C7Y A;  3Q8M A;  4DSF A;  5KFH A;  3RAX A;  1S0M A;  3DDH A;  4DL7 A;  3KBB A;  3PSP A;  5C0Y A;  4YMN A;  3E58 A;  1T8E A;  4UAR A;  5AKY A;  2HOF A;  3WKE A;  4F93 B;  4ECW A;  1TVA A;  4IRD A;  1QTM A;  3QZ7 A;  5BPC A;  2LYA A;  1ZQV A;  9ICU A;  4PHA A;  4RU9 A;  3IP4 B;  4E0D A;  2AH5 A;  4OD0 A;  9ICK A;  5L9X A;  8ICK A;  1RXW A;  3T79 A;  5J2A A;  1X9M A;  2AJQ A;  9ICT A;  1UT5 A;  1IG6 A;  5H2F U;  2LHT A;  3RF9 A;  5GTI U;  1VDV A;  5DGA A;  2XO7 A;  4MFF A;  3LWM A;  3SV4 A;  2C2E A;  1NJZ A;  2BDU A;  1SZH A;  5DB9 A;  1Y88 A;  2NO4 A;  3MDA A;  4MF2 A;  5KFV A;  3AUO A;  1BPB A;  2CN1 A;  3IG5 A;  3L4P A;  5ALD A;  1SGG A;  4ZH4 A;  4R66 A;  2EZX A;  2W9M A;  4KN4 A;  5ALQ A;  8ICS A;  9ICF A;  3HX0 A;  4A8E A;  1ZQP A;  3KKA C;  3Q8K A;  3RAQ A;  3PZP A;  3RJE A;  2KEY A;  2KV2 A;  2E1E A;  1D8Y A;  3JPN A;  4C7Z A;  2KOB A;  2RQ5 A;  3NRW A;  7ICE A;  1S77 D;  4PH5 A;  4PPX A;  5AI8 A;  3BQ0 A;  5JRT A;  4KTQ A;  4XA5 A;  2EZZ A;  4DCC A;  3F5A A;  2WF9 A;  3ALR A;  1ZD5 A;  2LMR A;  3C21 A;  3H8S A;  3MDC A;  5HHI A;  1NZP A;  5J0U A;  1SXE A;  4DOB A;  4F4W A;  1QLN A;  5CWR A;  4M2Y A;  3KZI U;  2KHQ A;  1S97 A;  5III A;  2AQ0 A;  2FJ6 A;  3BZC A;  4I2J A;  5HP4 A;  4R8U B;  5KT7 A;  4K4I A;  1QSY A;  3AQF A;  2YB1 A;  4F91 B;  4J9N A;  4UAV A;  4DFJ A;  2EAO A;  1ZQE A;  2JEI A;  5D49 A;  2JEJ A;  4RNM A;  5AI0 A;  1X6I A;  5KT5 A;  4GLX A;  4RQN A;  2JHD A;  1ZQQ A;  2A19 A;  4NWI A;  3MAB A;  3AU6 A;  1N48 A;  2HHU A;  3QU4 A;  4IR1 A;  3GIJ A;  2ZIV A;  4OJO A;  1KQQ A;  3ETR A;  5KG4 A;  5AHX A;  3MGH A;  9ICI A;  2PFO A;  1HJP A;  5HMM A;  3GQC A;  1ZJN A;  5ALR A;  2JH7 A;  3BS5 B;  8ICF A;  2A1J B;  4F5Q A;  2XVT A;  5ALL A;  3U26 A;  4RQ8 A;  4UAY A;  1L8O A;  2KKV A;  5KFK A;  2ZIW B;  4C0Z A;  2FMS A;  4CGZ A;  3BQ2 A;  3PW0 A;  3H4D A;  8ICZ A;  1RYS A;  3JPR A;  7ICI A;  2G09 A;  5KT2 A;  2KKP A;  3UQ0 A;  3QU7 A;  4O3M A;  4UAT A;  1ZD3 A;  3WKA A;  1U45 A; 
#chains in the Genus database with same CATH homology
 2QKQ A;  1V38 A;  5F3X B;  5JRT A;  4NJ8 A;  2E8P A;  2KG5 A;  1COK A;  1X9X A;  2LMR A;  3K1R B;  4NL9 C;  5J8Y A;  2D8C A;  1SXE A;  2F8K A;  3BQ7 A;  2B6G A;  3H8M A;  3TAC B;  1SV4 A;  2QB1 A;  2QAR A;  1JI7 A;  2KSO A;  2LPE A;  1OXJ A;  3BS5 A;  3HIL A;  4PZO A;  5KNI A;  2K60 A;  2QB0 A;  2ES6 A;  2D3D A;  1UQV A;  1X66 A;  1DXS A;  2FE9 A;  1UCV A;  1SV0 A;  2EAO A;  4PZN A;  1WWU A;  2E8O A;  2Y9U A;  4RQN A;  4IS7 A;  5J8Y C;  3KKA A;  1LKY A;  1F0M A;  1B0X A;  1OW5 A;  2KIV A;  5JU5 A;  1PK1 A;  2DKX A;  2Y9T A;  3TAD A;  2QAR B;  3BS7 A;  2KSO B;  3BS5 B;  2E8N A;  2F3N A;  2DKZ A;  1B4F A;  2L5Y A;  2QB0 B;  2E8M A;  2EAP A;  1KW4 A;  1SV0 C;  1SGG A;  3SEI A;  4RQM A;  4MHV A;  1X40 A;  1Z1V A;  2F44 A;  2JV3 A;  4NL9 A;  2EAN A;  2K4P A;  3KKA C;  2EAM A;  3SEN A;  5JTI A;  2DL0 A;  2KMD A;  1LKY B;  1PK3 A;  3IDW A;  1V85 A;  1RG6 A;  1SXD A;  3TAD C;  5L1M A;  1PK1 B;  2GLE A;  2YTU A;  1WWV A;  2KE7 A;  2ESE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...