3AQFA

Crystal structure of the human crlr/ramp2 extracellular complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
GTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/membrane protein
molecule keywords Receptor activity-modifying protein 2
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqfA00
3AQEA 3N7RC 3AQFA 2XVTA 3N7PD 2YX8A 3N7SC
chains in the Genus database with same CATH superfamily
4C4TA 5DBBA 2KG5A 2KJ9A 4KLGA 2BZFA 2FPMA 4OJ5A 2MAXA 3EPGA 2Y1JA 2ES6A 3F2CA 5J0YA 2I1QA 3TAQA 1RPLA 5J2JA 3PSTA 4ELUA 5AK3A 4IQTA 4UB5A 4UAWA 4JWNA 4F8RA 4PHEA 1TKDA 3V7KA 5J2DA 4K4HA 5CEHA 8ICQA 3UPQA 3QX7A 2HHTA 4RQ1A 2F8LA 1Z3EB 2G5HB 3ETLA 9ICXA 2ZTDA 7ICUA 5DG8A 3SV4A 2L5YA 4C0ZA 2BGWA 1ZD5A 4C4RA 3BZKA 7ICLA 2KE7A 3CNHA 2DBYA 4YXJA 3PR5B 3UMGA 3EW9A 3N7PD 5G5HA 2NRVA 4O5KA 4UAVA 1RXVA 4A8EA 2YMQA 1XSPA 3NVWA 3H40A 5AM5A 3PW7A 3JPOA 3NASA 1MQ3A 3G6VA 3AQEA 4R65A 2K8CB 2GLEA 3MGHA 2G06A 2F3NA 3SZ2A 8ICYA 9ICGA 2JV3A 1ED1A 4QW8A 1J2MA 5KFBA 5KFFA 2RRDA 3A0HU 1DOQA 4BGDA 4KLDA 3QUQA 1PVPA 1QQ5A 4KX5A 5C5JA 4QZEA 2LMRA 1ZD2P 2HI0A 5AI5A 3UM9A 2CN1A 4PGQA 2HHQA 1XC9A 2AH5A 1N56A 2H3VA 2E3TA 3UQ0A 4BDPA 2RHFA 4QZAA 2A1JA 5J2EA 4X5VA 7ICTA 1IM4A 4JV1A 2YB4A 1T94A 4ECVA 4IR1A 4UAZA 2JEGA 4DSKA 3F2BA 5HR7A 5DDMA 1X9MA 2LHTA 8ICTA 3ONNA 2BHNA 3PVXA 3B9JA 1RDFA 4J9QA 5DDYA 2HVHA 2XI9A 4JMUA 2EDUA 4F71A 3V6KA 3JPSA 4M0AA 5AM3A 4ECTA 7ICEA 2ZUDA 2AHOB 9ICKA 3PNCA 2EZZA 4TUSA 5KAFU 3RBDA 5AM1A 3AMZA 2KIWA 3H0MB 5ALVA 5HHIA 3HX0A 1ZQDA 1K5OA 2R8HA 2D8CA 5KFNA 3C28A 4I2HA 4NLZA 5TZVA 4BWMA 2F76X 2YQEA 4YR0A 3E2EA 3B0YA 4FBUA 3ZDBA 3M7DA 2QB0B 3RH5A 3HKZC 8ICWA 1Z4OA 3ZD8A 2F1HA 3S6JA 4F5QA 4WJ3B 2PFQA 3AU6A 2BCUA 4NM2A 4QZ8A 3H0RB 3NVVA 3TARA 4I28A 4TUQA 4QWAA 2C2EA 3RJEA 1YZ7A 2ASJA 5KFGA 1BPDA 2VA2A 3C2LA 1XS9D 1YZ6A 1JI7A 1CI4A 2PI5A 2KOBA 4ED2A 4B9LA 3CRXA 2EAMA 2C22A 4FZMA 1HUOA 4UQGA 3WK9A 4O3RA 1SXDA 4XQ8A 4GC7A 4UB3A 2A1JB 2RDIA 3KHGA 1SL1A 5KG7A 5F9NA 2KNJA 3MC1A 1Z00B 1XSLA 1KN5A 4QJFB 3T3FA 2KZMA 2DF4B 4YMMA 2MU2A 3IP4B 2PMZC 3RH6A 3DEEA 5A0LA 4FS1A 2W9CA 2XGQA 2JHDA 4IC9A 8ICIA 3QYPA 1C7YA 5AKJA 4GIBA 4DLGA 1NNLA 4Z6FA 1EXNA 3PO5A 3F5EA 4UARA 1ZQQA 2EANA 5J29A 2PFPA 3FC4A 1MC8A 4RQ2A 4YVZA 4YQWA 1UA1A 4ACOA 2XY7A 2G08A 5E79U 2IOHA 5ALGA 2A3VA 5ALUA 5KFOA 1IIPA 2WB1F 3NRWA 2RP5A 4EELA 2KJ8A 3PSPA 4PGYA 4UBCA 1KBUA 3TFSA 2JH1A 5ALFA 1ZQBA 2KVCA 2WFAA 3FM9A 5JTIA 2HSZA 3NGDA 5J2FA 1DGSA 4ED0A 5KFSA 4B9VA 4DQPA 4NY8A 3BJYA 4BXOA 2H3FA 3SAHA 3KOOA 2WF8A 5AIBA 1WG8A 2B0CA 4ECQA 1ZQNA 2AJQA 1KSPA 2J6UA 9ICMA 1T7PA 3N28A 5CRXA 2Q4TA 5L9XA 4NWIA 5BPCA 4PZOA 3D2NA 3RRHA 2ODGA 2ZIUA 3H8MA 3HWTA 1KQQA 1D9FA 3WU2U 9ICHA 3PW0A 4FZNA 1P7DA 9ICIA 2EZYA 4Z6CA 4P0PA 4ED8A 4DQSA 3DDHA 3RB3A 5HMMA 3QEAZ 4DFDA 1ZQPA 4EX6A 2ASLA 1SL0A 4KN7A 1LV5A 2FMQA 3RAXA 3QUCA 2E8NA 3MR3A 3WKBA 2UVUA 3QUTA 3CYMA 1U48A 1KKXA 3EZ5A 5CHGA 4YP3A 2YY6A 2XIDA 4B9SA 3GIMA 1ZQOA 3MGVA 3RH4A 2LKYA 2GWSA 4YXMA 4IQVA 2FPKA 2HCFA 3VCBA 4GC6A 4KLUA 2IOFK 2Q0ZX 4P2HA 4QW9A 2NRTA 2AGQA 3SMVA 2E8PA 1PUZA 1UT5A 1ZJMA 3E58A 3WKAA 3V6HA 4RQ0A 1RM6C 2KN7A 4CRXA 3PX4A 2BCSA 3L3FX 4QWEA 5ALJA 3T5JA 1QTMA 2W9BB 9ICEA 3KHRA 1ZXIA 1JROA 5G5GA 1RQLA 4IQWA 4R63A 1SB3C 2LBOA 4ED7A 4OJPA 3LDAA 5EE9A 3NVYA 3R9KA 2YB1A 3Q8RB 4ECRA 5T14A 2FPLA 4DCCA 4O3MA 4J9KA 1Q46A 4JK1A 3SYZA 1OUQA 4EYHB 1NJWA 3N97B 3H8SA 4NLGA 2BPCA 3PMNA 1NZBA 1NK8A 2KFZA 2BDPA 3WK4A 1BPXA 5ALQA 9ICQA 2W7OA 4LZDA 5AKXA 3GDXA 3F53A 2W54A 4RNNA 3EPIA 1CUKA 1ZQTA 1Z19A 1A77A 2JMGA 5KFUA 4PZNA 1LKYB 2YX8A 3C23A 2DL0A 1N63A 4YG2A 9ICSA 3IG5A 4MFAA 4KLLA 5KFMA 2XY6A 4P4OA 1GO3F 3LVWA 3L4PA 2HBKA 4HYKA 2W43A 3JPTA 1KRPA 5CJ7A 5DQHA 2KKVA 2JEFA 5EWEA 4R66A 2J6SA 2F8KA 4USAA 1D8BA 2OXOA 3Q8KA 3LWMA 2R18A 1K1QA 1L3TA 4B9TA 1S5LU 1QCKA 1NKCA 3LWLA 4RPXA 1TVAA 5ALPA 3M9OB 2ESEA 5DG9A 4PPXA 1Z4NA 4UW9A 1UCVA 3C5FA 5IIJA 1N61A 2VJ4A 2GH1A 5AK6A 2K4HA 3PV8A 4PL1A 2NO5A 4NV0A 4DFMA 3GIKA 4DL2A 1CRXA 5AI6A 2IBKA 5EWFA 4BX9C 2AU0A 2YN4A 3NRZA 2KV2A 8ICHA 8ICZA 5KFYA 5AI8A 3AN1A 2ALZA 2W04A 5KFCA 3PY8A 1LKYA 3F5AA 1TAQA 4Z6EA 1M6YA 2BCVA 3H4DA 5AM2A 5L1MA 2ZXIA 4ZOHC 1T4GA 4DLEA 5AIAA 4QZCA 1F5SA 2OEHA 1IXRA 5KG6A 2KTQA 2QB1A 4ECSA 1VDVA 2NYVA 3E0FA 3ZD9A 2BPFA 4C8NA 5KFXA 3WK7A 3BZCA 3D2QA 3BS7A 1ZQMA 1UA0A 1SGGA 1V97A 2MSNA 4QIWF 3GU3A 2DPJA 2HBJA 4NL9A 2JGAA 8ICCA 4RQMA 5KL1B 3WKEA 2JR5A 9ICUA 5ALSA 4CF3A 5K4LA 3QEBZ 5IIIA 2VA3A 2ASDA 1NK6A 4BUGA 4QZHA 3T79A 2W03A 4TURA 2HW3A 4UBBA 3PMLA 3ZDDA 3RAQA 2JXJA 4RNOA 1QH9A 1U49A 3EWAA 1BPBA 3MR5A 4J9PA 3C1ZA 1D8LA 8ICMA 4KMUA 3BS5A 1NJZA 2VKQA 1MN8A 4PGXA 2DUYA 2KHVA 2IHNA 2JEIA 1X2IA 3D2SA 5C0YA 1Y88A 2KSOA 1JX4A 1BPYA 2JH7A 2EQYA 2VA8A 5GTIU 2YMLA 2B21A 4MF8A 3M8SA 2LI6A 5CA7A 4R8UA 4JV0A 4UASA 3OTQA 5DKWA 2H3IA 1XNSA 1NOMA 3MDCA 9ICRA 5IINA 4M9JA 4F4ZA 4ELVA 1X42A 2G07A 5KT6A 2KSOB 3SR6A 3UQ2A 4CDGA 5IIKA 2WAQF 4XRHA 4CF5A 4Y2XA 1V38A 1X9XA 2BQRA 2XCPA 5KG2A 1KL9A 3NUQA 1L3VA 2C2DA 4UB4A 5HR6A 2KICA 3IG8A 1ZD3A 1XO0A 4YFKA 3U26A 3HW8A 3QZ7A 5DGAA 1X66A 4GXJA 2VIXA 3PSIA 3Q8SB 1S0OA 1SKRA 1PK1A 9ICVA 2LYHA 4DS5A 2WF7A 2YMPA 3THVA 2KZ3A 2ZTEA 4IR9A 4RQ8A 1ZOLA 3C21A 2EAPA 1ZQ1C 1BNPA 3RB0A 2FMSA 5AM0A 1B0XA 3BQ7A 4P0PB 2EAOA 1F0MA 5D49A 3PW4A 4NLKA 2V4QA 7ICOA 4ECWA 4AYBC 4F4KA 4Q44A 1QQ6A 5BOLA 3C1YA 1NJYA 4LZGA 3PSFA 4YD2A 4C8LA 1XWLA 2XY5A 2XC9A 4CE6A 4M04A 3OGUA 1VLBA 3H0LB 1ZRNA 5JU5A 3AEVA 2MA1A 4IS7A 2ZXHA 4FFDA 4KLFA 3ISDA 1AROP 7ICRA 4GLXA 4YCXA 2PFOA 8ICOA 3K1ZA 2DWQA 2HOQA 1QSSA 4B6JA 3RRGA 2E1FA 1ZQCA 4F5PA 2Y0SC 3SV3A 5AKKA 2BKEA 3MGIA 3MABA 4LVSA 4RUAA 2J6TA 7ICVA 3GIJA 2BCRA 2B6GA 7ICIA 3IRUA 4DQIA 2D3DA 5ALOA 2HHXA 4KLTA 3RJKA 2QARA 4I2BA 1FIQA 4F2RA 2FJ6A 2ZIVA 5AKLA 5KFWA 4OJLA 3KZIU 1TK0A 2K89A 3EUB2 3N7SC 3IV6A 4B9UA 4DFPA 2FLPA 2RQ5A 4CCHA 5KG0A 1SV0A 5ALEA 4U6PA 3TFRA 2ZIXB 3RJJA 2NV3A 9ICBA 1SZPA 3M9NB 7ICMA 3HJEA 4J03A 3F2DA 2CRXA 2K4EA 4RQ5A 3KHLA 3HRDD 5JRTA 5AI9A 1QSLA 5KT4A 8ICAA 1YT3A 2DPIA 5F9LA 3OJUA 3UXNA 1KFSA 2OYYA 9ICTA 3ALRA 5L1JA 4O3NA 3RFAA 3KZXA 5AKGA 1RQNA 5CWRA 1TV9A 1DRGA 3G6YA 5KTQA 5KFPA 2I9GA 1TAMA 2K8AA 4BXOB 2FLLA 1COKA 4RQ7A 3SD7A 4PH5A 2A1AA 2OM6A 5J0RA 3I1YA 5AHXA 3WKCA 3ZDCA 4NXZA 9ICCA 5J8YC 2BPGA 4EEYA 4ECZA 4DSLA 2OH2A 1WCNA 2HVIA 4F5NA 1Z1VA 2NRXA 3CW2C 4UAYA 4P0QB 3ZDEA 4O3QA 1LVHA 3V7JA 4C80A 4F50A 3RR8A 1B22A 4P4MA 3GZFA 4QZDA 1RG6A 4EBEA 2ZJAA 5DB7A 4I2EA 4NLNA 3RJHA 1PK1B 3Q8MA 3JPQA 4KLJA 3JPNA 2GOLA 2Z7JA 1NK4A 3GQCA 1UPHA 4US8A 4C8MA 1JALA 2XCAA 1DGJA 5ALYA 1DK3A 3KKAA 4F72A 2NO4A 1JRPA 8ICNA 2DFLA 2PI4A 4F92B 1KTQA 3TKAA 5HNKA 5J0OA 3BQTA 2E1EA 5DLGA 4J9LA 3Q8PB 2Y1IA 7ICGA 2ZIUB 1WUDA 1BVSA 1SWVA 4QWBA 2H3QA 4YR2A 3FDSA 4M47A 4AP9A 1BNOA 4RUCA 5EOZA 5EE0A 4US9A 5HHHA 1ZETA 2W7PA 4I2AA 8ICVA 2NRZA 2AGOA 2KJ5A 3GILA 4DSEA 4R64A 2ZG6A 4BJQA 1K1SA 2W3RA 5DLFA 1QQ7A 3PZPA 2AQ4A 2ISPA 2CPRA 4RQ4A 1L5UA 2KK0A 4PHAA 4M9LA 1L7NA 4F2SA 1ZQJA 3D6JA 4GFJA 2M9NA 2C2RA 4QIWC 5KG1A 3BS5B 3M8RA 4O5EA 8ICJA 2Y9UA 5D46A 1OW5A 2AGPA 1U47A 4F4WA 4EEKA 2P35A 2UVWA 2OCEA 1T3NA 4LJXA 9ICOA 1ZQIA 4QZBA 4QZ9A 1CEZA 3SQIA 2VANA 4J9OA 1Q8KA 1SKWA 4ICAA 4HAIA 5KFZA 4EENA 5H2FU 3VC8A 3N7RC 2AXTU 2HHUA 2BCQA 3RB6A 2ZTCA 1BPEA 3AL0B 1HEKA 3ED5A 4MF2A 2KD1A 4MHVA 4NJ8A 5DGBA 3GV8B 5KFIA 5CR0A 4JB3A 2JRZA 2R8IA 3TI0A 4ELTA 2ISOA 2HOFA 3UMCA 4I2IA 8ICBA 2Y0SF 1ZQRA 2A19A 5KT2A 2IHMA 1IV8A 3GFKB 1S76D 1JXLA 1J2NA 5J0QA 4EX7A 2PXIA 4FO6A 3FAHA 5KFDA 3QZ8A 4GXKA 4I2CA 3QU7A 4F93B 4C8KA 2ATLA 1SZHA 4ECXA 3RF9A 5IIOA 4Y2JA 3QU5A 1ZJNA 5J0XA 4JWMA 2C28A 5KFQA 4DO9A 4J9SA 3T5HA 4RT2A 1OXJA 3C5GA 2JZBB 2FDRA 4M9GA 5AKEA 5EWGA 5FP0A 4K4GA 1XO1A 2ZUCA 4DL6A 3SI8A 4DFJA 3H8JA 4RZRA 1L7MA 3WK8A 2BR0A 2FMPA 2YMMA 3RJGA 3NTUA 7ICKA 4NM1A 5KG5A 4P0QA 5J0UA 3GV7B 5DB8A 1RYUA 2QKQA 2M0NA 2G5IB 2ZIWA 3MBYA 3QE9Y 4Q45A 2HHVA 1LB2B 4YR3A 4B9MA 2G0AA 1X6IA 1H38A 4DOAA 4RNMA 2WF5A 5HP4A 3CP8A 5J2IA 5J8YA 3MFHA 5AICA 4DF8A 4IL6U 2D6FC 5J2HA 5EE1A 5KFJA 1SWWA 2K4PA 1SV4A 4F4YA 4P4PA 3RB4A 1KW4A 2I6XA 4YMOA 3KHHA 4TQSA 5ALNA 5ALWA 1PZNA 1U9LA 4AYBF 5ALRA 4DSFA 4C7YA 3V7LA 3PW5A 4RPYA 1S77D 3BQ0A 7ICSA 3C2MA 2ZIXA 1RYSA 1D8YA 4K4IA 2IOFA 1JMSA 4JUZA 1BGXT 3V72A 4DSIA 4F4XA 5B5EU 1RXWA 2E5SA 4RT3A 1QSYA 1KLNA 3ETRA 2W8KA 1Q3VA 1ZQHA 5AI0A 5L1LA 2E8OA 5KT3A 2G09A 9ICNA 1SXEA 4YMNA 2HBMA 2LYAA 3IHQB 4OJ6A 3MFIA 1Z1BA 2W9BA 5DBCA 3UXOA 1TE2A 4FZLA 4O3SA 2RDJA 1AQ6A 1ZD4A 5B66U 4RQNA 2DQNB 8ICUA 4ED6A 2F1IA 4DEZA 3ORYA 2XICA 5KAIU 3ZDAA 4Y2YA 3H7IA 1HJPA 1N5XA 4DFKA 2W9MA 1NK0A 3NVZA 4QZFA 2LYBA 1FO4A 4CGZA 4IRCA 2VJ5A 1L3UA 3A0BU 3T5LA 3L5KA 2MUTB 4E0DA 1MA7A 1FFVA 3OPXA 5AKIA 1ZQXA 3K75D 3AUOA 4OO1J 2LM4A 4NL9C 4KN4A 3SENA 4KLSA 1FFUA 3UXPA 4UAUA 2UVRA 3UMBA 5J2CA 3ISCA 2JEJA 3OSPA 4ECUA 2KIVA 1ZQKA 2NRWA 4Q8FA 4M9HA 5DG7A 3HP6A 4CNQA 4DQRA 1RYRA 3C29A 2QLTA 5CB1A 2XO7A 3DV9A 4DS4A 1L8OA 1MQ2A 3OHBA 1SIJA 5J2KA 4KX3A 4UB2A 5J2GA 3B0XA 8ICRA 5AKYA 5KG3A 3MDAA 3KTQA 4UB6U 4YD1A 5DQIA 2CXYA 4QZGA 4DL3A 1N48A 1XU4A 2W55A 3HT3A 4B9NA 3OHAA 1UQVA 1N5WA 3PR4A 2ZIWB 3M1YA 4J9NA 5L1IA 3T5KA 2WHEA 9ICAA 1SL2A 4Y2SA 4MEXA 1S9FA 5KFRA 2KMDA 3OSNA 2ZJ8A 1TAUA 2P6UA 4DL7A 4MEYA 2P6RA 4C8OA 5CP2A 3TANA 1L3SA 2UVVA 4PHDA 2QARB 5ALLA 2KZZA 5ALHA 5ALXA 3PW2A 2H5XA 5J0PA 2KKPA 1N60A 1MSWD 3JPRA 2HHWA 4Y2VA 4R8UB 5KFTA 4J9MA 4KLHA 1RZTA 4QZIA 2N1RA 3H8WA 2XGPA 4EZ6A 1URJA 4KLIA 2YTUA 4RU9A 5IILA 5ALZA 3PX0A 1HIWA 3KFUF 2FLNA 1VJ5A 4Y2RA 3BQ1A 4M9NA 4DSJA 1ZQFA 1JUDA 3RJFA 4I29A 4IRDA 9ICPA 2F1JA 4EBCA 2P66A 2DKXA 3IDWA 1ZQUA 4DOCA 4QWCA 5AKZA 1HUZA 1B4FA 5HMLA 1S0VA 2F44A 3I28A 1FEZA 4I2DA 4FS2A 4PHPA 2IA6A 4I2JA 3TAPA 3QU4A 4M6WB 3IM1A 5L1KA 4KITB 2K60A 3TQ1A 7ICNA 4IQUA 2KP7A 1NK7A 5KT5A 2F2AB 9ICWA 8ICPA 5KFEA 3RBEA 4XA5A 4PJ0U 1S10A 7ICQA 8ICEA 8ICSA 2R8JA 5KFKA 8ICGA 1N62A 2DKZA 1A6SA 3KD3A 4FBTA 1Z00A 4TQRA 4DQQA 4UB1A 4PL2A 2XVTA 4DOBA 4I2GA 1WCLA 1U4BA 2BQ3A 1V9PA 2K4IA 2PFNA 4MFCA 5KT7A 2HHSA 1V85A 5KFAA 1TK8A 2JZBA 5AI4A 4YN4A 7ICPA 3SAGA 1J97A 3MR2A 4Y2QA 2OHFA 1L7PA 1O08A 4KLMA 4O5CA 9ICLA 2FI1A 3QU2A 2QB0A 4RQ6A 5ALTA 2R8GA 5J0TA 1ZQAA 3TACB 8ICKA 2LPEA 9ICFA 2RLTA 1KFDA 4FE3A 2HBLA 1L7OA 5KL8B 1PK3A 3QNMA 7ICHA 2ZUBA 3LK9A 1X9WA 2HOIA 1ZQLA 3GIIA 2WF6A 1S0NA 1BPZA 1ZQYA 3H4BA 3EYZA 2EZXA 3LYSA 1DK2A 4ZH4A 5BOMA 2O6KA 1A76A 3QXGA 3M6KA 1NK5A 1XSNA 4RPZA 1N2XA 2WB1C 1F44A 4OCZA 1ZQSA 4F3OA 3ISBA 4J9RA 2ZIVB 4ED3A 4Q43A 4F91B 5AKHA 5ALMA 5EE3A 1S97A 3WK6A 4M6WA 2GO7A 4OD0A 1TK5A 1NI3A 5J2BA 8ICXA 5DB6A 1NKEA 1IG6A 2FE9A 2PKEA 5KNIA 4Q8EA 1UHUA 7ICFA 3M9MB 3HPOA 5JUMA 2WAQC 4OJOA 5DQGA 4DF4A 2W3SA 4KLOA 1UT8A 1JN3A 3OJSA 1C20A 4CF4A 1NKBA 4DL5A 1NZPA 2IMWP 1WWUA 4Z6DA 4KTQA 1ZQZA 3N4MB 3ZI4A 1PVQA 3Q8LA 4G9BA 1ZQEA 4QNLA 4O3OA 1COOA 5D4BA 8ICFA 2E8MA 2F77X 5F3XB 2K8BB 3HILA 5DBAA 4JV2A 4O3PA 2ZJ5A 1S0MA 3K4GA 3G6XA 3GV5B 4G3IA 4I2FA 3AQFA 3TADA 3RJIA 3AU2A 4C4SA 4ED1A 2PMZF 2W8LA 1ZYQA 3RTVA 2HMXA 1SKSA 3BDPA 5DB9A 3I76A 4KMOB 2OWOA 1L6NA 4NLCA 4XUSA 4IRKA 1QLNA 1TFRA 1T8EA 2WF9A 1NJXA 1X6JA 4KLEA 4BWJA 2W9AA 3SAFA 3BQ2A 1X40A 3IN5A 5AK5A 2R8KA 4Y2UA 3WKDA 4U7CA 1JXEA 2MUTA 5KG4A 3PX6A 5J0WA 3Q8QB 2Y9TA 2KEYA 4GXIA 5J0SA 2BDUA 3O0FA 5AM4A 3ICXA 3SEIA 3LVVA 3RR7A 2DGZA 2BQUA 2HDOA 3K1RB 4UATA 4DWIA 3J81j 1ZQGA 2KHQA 2W11A 5KFHA 1T3QA 4DL4A 3QUBA 3KBBA 1WYGA 2KVSA 4EYIB 1U45A 1S8OA 1ZRMA 5AK4A 3V6JA 3AM9A 1JIHA 1D9DA 5J2AA 3NS1A 1B43A 4QWDA 4Y2PA 4Y2TA 3WK5A 1KEJA 5TISU 2V9WA 1NK9A 2LM1A 4KLQA 3FYHA 8ICLA 3M6ZA 4UB8U 2I5HA 4EZ9A 5ALDA 1WWVA 4C7ZA 2KFNA 3HKZF 4O0IA 2EH9A 2W9CB 2WTFA 3QU9A 3JPPA 7ICJA 5KFLA 1A0PA 4RQ3A 4TUPA 5IIMA 4F5RA 1KDHA 4EBDA 5GTHU 1O03A 4NLBA 2AQ0A 4M2YA 3KKAC 1ECWA 5ALIA 4F5OA 1L8LA 3TADC 1PVRA 2V4RA 9ICJA 2H3ZA 5KFVA 1KFTA 3MR6A 4ECYA 1Q3UA 5ALKA 4MFFA 4O9MA 3C2KA 3PO4A 1ZQVA 1SV0C 2MRLA 1DXSA 1ZQWA 1X9SA 4I27A
chains in the Genus database with same CATH topology
2HOQA 2ZIUA 2BDUA 3O0FA 2CN1A 2KOBA 1Z1BA 2E1FA 3ICXA 2KJ9A 3LVVA 2Y0SC 3E0FA 1Z19A 2JMGA 4FZLA 3CRXA 3NUQA 4OJ5A 2DGZA 4FZMA 1P7DA 4FZNA 3F53A 2OH2A 2H3VA 4P0PA 5HR6A 2RHFA 3D2QA 4P0QA 2DQNB 2KICA 3F2CA 2YX8A 2WAQC 1A6SA 2YB4A 1T94A 4OJOA 4P0QB 3IG8A 4QIWF 3GU3A 2KHQA 2HBJA 3IG5A 2KNJA 3F2BA 1XO0A 3SQIA 5HR7A 2JGAA 2M0NA 4QJFB 3GZFA 2XICA 2G5IB 1GO3F 2DF4B 2LHTA 2XVTA 3LVWA 3PSTA 2ZIWA 3CYMA 3ONNA 4PL2A 5KL1B 2HBKA 2PMZC 3IP4B 4ICAA 3VC8A 3N7RC 2K4IA 3AL0B 2XIDA 2G0AA 2ZIVA 3DEEA 5A0LA 2JHDA 2GOLA 1HEKA 2LYBA 2VIXA 2Z7JA 4IC9A 3MGVA 2KKVA 2KD1A 2VJ5A 1UPHA 3PSIA 4OJLA 3SAGA 2LKYA 2XI9A 3CP8A 4JMUA 1D8BA 2KKPA 4BUGA 4CGZA 2K89A 3N7SC 2OXOA 3T79A 1MA7A 3OPXA 3VCBA 2W03A 2HOFA 1PVQA 2R18A 3F5EA 2D6FC 4QNLA 4U6PA 4OO1J 2ZIXB 2F8LA 3SMVA 2Y0SF 2N1RA 2G5HB 1ZQ1C 3M6ZA 2E1EA 2NV3A 4ACOA 2F77X 1URJA 2K8BB 2G08A 2ZIUB 1WUDA 2H3QA 2KIWA 3H0MB 4C0ZA 3F2DA 2A3VA 3HKZF 2CRXA 4CRXA 4P0PB 2K4EA 3L3FX 1IIPA 2VKQA 2WB1F 3NRWA 2RP5A 1HIWA 3C28A 2KHVA 2KJ8A 3KFUF 3AQFA 3PSPA 1KBUA 2F76X 2VJ4A 2GH1A 3C29A 2K4HA 4AYBF 4AYBC 1SZHA 1YT3A 3D2SA 4FE3A 4PL1A 1A0PA 2PMZF 5C0YA 2HBLA 2JH7A 2LBOA 4NV0A 3N7PD 5KL8B 2HMXA 3RF9A 2OYYA 2JH1A 4OJPA 3ALRA 3M7DA 4KMOB 2W7PA 1CRXA 2HOIA 2KVCA 3PSFA 4NLCA 2ZIXA 4NLBA 1L6NA 4BX9C 2YB1A 4A8EA 2KJ5A 3HKZC 2KV2A 4WJ3B 3RFAA 5T14A 1ECWA 3KZXA 2W04A 3LYSA 3AQEA 4KX3A 2K8CB 1PVRA 2H3IA 2ZG6A 4BJQA 1XNSA 1DRGA 4O3MA 1TAMA 2K8AA 3F5AA 2H3ZA 3SAFA 3H0RB 2G06A 2H3FA 3H0LB 1OUQA 3SAHA 3IN5A 3M6KA 3PZPA 2CPRA 2MA1A 2E5SA 1ED1A 4U7CA 2ZXHA 2G07A 1NZBA 1Q3UA 2RRDA 1Q3VA 2OM6A 2ZXIA 1PVPA 2WB1C 1F44A 4GFJA 4KX5A 5CRXA 2Q4TA 4CDGA 4QIWC 2ZIVB 3K1ZA 2F2AB 4NWIA 2G09A 2MRLA 2KEYA 2W7OA 2WAQF 3D2NA 2HBMA 2LYAA 2ZIWB 4OJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQE A;  3N7R C;  3AQF A;  2XVT A;  3N7P D;  2YX8 A;  3N7S C; 
#chains in the Genus database with same CATH topology
 4C4T A;  5DBB A;  2KG5 A;  2KJ9 A;  4KLG A;  2BZF A;  2FPM A;  4OJ5 A;  2MAX A;  3EPG A;  2Y1J A;  2ES6 A;  3F2C A;  5J0Y A;  2I1Q A;  3TAQ A;  1RPL A;  5J2J A;  3PST A;  4ELU A;  5AK3 A;  4IQT A;  4UB5 A;  4UAW A;  4JWN A;  4F8R A;  4PHE A;  1TKD A;  3V7K A;  5J2D A;  4K4H A;  5CEH A;  8ICQ A;  3UPQ A;  3QX7 A;  2HHT A;  4RQ1 A;  2F8L A;  1Z3E B;  2G5H B;  3ETL A;  9ICX A;  2ZTD A;  7ICU A;  5DG8 A;  3SV4 A;  2L5Y A;  4C0Z A;  2BGW A;  1ZD5 A;  4C4R A;  3BZK A;  7ICL A;  2KE7 A;  3CNH A;  2DBY A;  4YXJ A;  3PR5 B;  3UMG A;  3EW9 A;  3N7P D;  5G5H A;  2NRV A;  4O5K A;  4UAV A;  1RXV A;  4A8E A;  2YMQ A;  1XSP A;  3NVW A;  3H40 A;  5AM5 A;  3PW7 A;  3JPO A;  3NAS A;  1MQ3 A;  3G6V A;  3AQE A;  4R65 A;  2K8C B;  2GLE A;  3MGH A;  2G06 A;  2F3N A;  3SZ2 A;  8ICY A;  9ICG A;  2JV3 A;  1ED1 A;  4QW8 A;  1J2M A;  5KFB A;  5KFF A;  2RRD A;  3A0H U;  1DOQ A;  4BGD A;  4KLD A;  3QUQ A;  1PVP A;  1QQ5 A;  4KX5 A;  5C5J A;  4QZE A;  2LMR A;  1ZD2 P;  2HI0 A;  5AI5 A;  3UM9 A;  2CN1 A;  4PGQ A;  2HHQ A;  1XC9 A;  2AH5 A;  1N56 A;  2H3V A;  2E3T A;  3UQ0 A;  4BDP A;  2RHF A;  4QZA A;  2A1J A;  5J2E A;  4X5V A;  7ICT A;  1IM4 A;  4JV1 A;  2YB4 A;  1T94 A;  4ECV A;  4IR1 A;  4UAZ A;  2JEG A;  4DSK A;  3F2B A;  5HR7 A;  5DDM A;  1X9M A;  2LHT A;  8ICT A;  3ONN A;  2BHN A;  3PVX A;  3B9J A;  1RDF A;  4J9Q A;  5DDY A;  2HVH A;  2XI9 A;  4JMU A;  2EDU A;  4F71 A;  3V6K A;  3JPS A;  4M0A A;  5AM3 A;  4ECT A;  7ICE A;  2ZUD A;  2AHO B;  9ICK A;  3PNC A;  2EZZ A;  4TUS A;  5KAF U;  3RBD A;  5AM1 A;  3AMZ A;  2KIW A;  3H0M B;  5ALV A;  5HHI A;  3HX0 A;  1ZQD A;  1K5O A;  2R8H A;  2D8C A;  5KFN A;  3C28 A;  4I2H A;  4NLZ A;  5TZV A;  4BWM A;  2F76 X;  2YQE A;  4YR0 A;  3E2E A;  3B0Y A;  4FBU A;  3ZDB A;  3M7D A;  2QB0 B;  3RH5 A;  3HKZ C;  8ICW A;  1Z4O A;  3ZD8 A;  2F1H A;  3S6J A;  4F5Q A;  4WJ3 B;  2PFQ A;  3AU6 A;  2BCU A;  4NM2 A;  4QZ8 A;  3H0R B;  3NVV A;  3TAR A;  4I28 A;  4TUQ A;  4QWA A;  2C2E A;  3RJE A;  1YZ7 A;  2ASJ A;  5KFG A;  1BPD A;  2VA2 A;  3C2L A;  1XS9 D;  1YZ6 A;  1JI7 A;  1CI4 A;  2PI5 A;  2KOB A;  4ED2 A;  4B9L A;  3CRX A;  2EAM A;  2C22 A;  4FZM A;  1HUO A;  4UQG A;  3WK9 A;  4O3R A;  1SXD A;  4XQ8 A;  4GC7 A;  4UB3 A;  2A1J B;  2RDI A;  3KHG A;  1SL1 A;  5KG7 A;  5F9N A;  2KNJ A;  3MC1 A;  1Z00 B;  1XSL A;  1KN5 A;  4QJF B;  3T3F A;  2KZM A;  2DF4 B;  4YMM A;  2MU2 A;  3IP4 B;  2PMZ C;  3RH6 A;  3DEE A;  5A0L A;  4FS1 A;  2W9C A;  2XGQ A;  2JHD A;  4IC9 A;  8ICI A;  3QYP A;  1C7Y A;  5AKJ A;  4GIB A;  4DLG A;  1NNL A;  4Z6F A;  1EXN A;  3PO5 A;  3F5E A;  4UAR A;  1ZQQ A;  2EAN A;  5J29 A;  2PFP A;  3FC4 A;  1MC8 A;  4RQ2 A;  4YVZ A;  4YQW A;  1UA1 A;  4ACO A;  2XY7 A;  2G08 A;  5E79 U;  2IOH A;  5ALG A;  2A3V A;  5ALU A;  5KFO A;  1IIP A;  2WB1 F;  3NRW A;  2RP5 A;  4EEL A;  2KJ8 A;  3PSP A;  4PGY A;  4UBC A;  1KBU A;  3TFS A;  2JH1 A;  5ALF A;  1ZQB A;  2KVC A;  2WFA A;  3FM9 A;  5JTI A;  2HSZ A;  3NGD A;  5J2F A;  1DGS A;  4ED0 A;  5KFS A;  4B9V A;  4DQP A;  4NY8 A;  3BJY A;  4BXO A;  2H3F A;  3SAH A;  3KOO A;  2WF8 A;  5AIB A;  1WG8 A;  2B0C A;  4ECQ A;  1ZQN A;  2AJQ A;  1KSP A;  2J6U A;  9ICM A;  1T7P A;  3N28 A;  5CRX A;  2Q4T A;  5L9X A;  4NWI A;  5BPC A;  4PZO A;  3D2N A;  3RRH A;  2ODG A;  2ZIU A;  3H8M A;  3HWT A;  1KQQ A;  1D9F A;  3WU2 U;  9ICH A;  3PW0 A;  4FZN A;  1P7D A;  9ICI A;  2EZY A;  4Z6C A;  4P0P A;  4ED8 A;  4DQS A;  3DDH A;  3RB3 A;  5HMM A;  3QEA Z;  4DFD A;  1ZQP A;  4EX6 A;  2ASL A;  1SL0 A;  4KN7 A;  1LV5 A;  2FMQ A;  3RAX A;  3QUC A;  2E8N A;  3MR3 A;  3WKB A;  2UVU A;  3QUT A;  3CYM A;  1U48 A;  1KKX A;  3EZ5 A;  5CHG A;  4YP3 A;  2YY6 A;  2XID A;  4B9S A;  3GIM A;  1ZQO A;  3MGV A;  3RH4 A;  2LKY A;  2GWS A;  4YXM A;  4IQV A;  2FPK A;  2HCF A;  3VCB A;  4GC6 A;  4KLU A;  2IOF K;  2Q0Z X;  4P2H A;  4QW9 A;  2NRT A;  2AGQ A;  3SMV A;  2E8P A;  1PUZ A;  1UT5 A;  1ZJM A;  3E58 A;  3WKA A;  3V6H A;  4RQ0 A;  1RM6 C;  2KN7 A;  4CRX A;  3PX4 A;  2BCS A;  3L3F X;  4QWE A;  5ALJ A;  3T5J A;  1QTM A;  2W9B B;  9ICE A;  3KHR A;  1ZXI A;  1JRO A;  5G5G A;  1RQL A;  4IQW A;  4R63 A;  1SB3 C;  2LBO A;  4ED7 A;  4OJP A;  3LDA A;  5EE9 A;  3NVY A;  3R9K A;  2YB1 A;  3Q8R B;  4ECR A;  5T14 A;  2FPL A;  4DCC A;  4O3M A;  4J9K A;  1Q46 A;  4JK1 A;  3SYZ A;  1OUQ A;  4EYH B;  1NJW A;  3N97 B;  3H8S A;  4NLG A;  2BPC A;  3PMN A;  1NZB A;  1NK8 A;  2KFZ A;  2BDP A;  3WK4 A;  1BPX A;  5ALQ A;  9ICQ A;  2W7O A;  4LZD A;  5AKX A;  3GDX A;  3F53 A;  2W54 A;  4RNN A;  3EPI A;  1CUK A;  1ZQT A;  1Z19 A;  1A77 A;  2JMG A;  5KFU A;  4PZN A;  1LKY B;  2YX8 A;  3C23 A;  2DL0 A;  1N63 A;  4YG2 A;  9ICS A;  3IG5 A;  4MFA A;  4KLL A;  5KFM A;  2XY6 A;  4P4O A;  1GO3 F;  3LVW A;  3L4P A;  2HBK A;  4HYK A;  2W43 A;  3JPT A;  1KRP A;  5CJ7 A;  5DQH A;  2KKV A;  2JEF A;  5EWE A;  4R66 A;  2J6S A;  2F8K A;  4USA A;  1D8B A;  2OXO A;  3Q8K A;  3LWM A;  2R18 A;  1K1Q A;  1L3T A;  4B9T A;  1S5L U;  1QCK A;  1NKC A;  3LWL A;  4RPX A;  1TVA A;  5ALP A;  3M9O B;  2ESE A;  5DG9 A;  4PPX A;  1Z4N A;  4UW9 A;  1UCV A;  3C5F A;  5IIJ A;  1N61 A;  2VJ4 A;  2GH1 A;  5AK6 A;  2K4H A;  3PV8 A;  4PL1 A;  2NO5 A;  4NV0 A;  4DFM A;  3GIK A;  4DL2 A;  1CRX A;  5AI6 A;  2IBK A;  5EWF A;  4BX9 C;  2AU0 A;  2YN4 A;  3NRZ A;  2KV2 A;  8ICH A;  8ICZ A;  5KFY A;  5AI8 A;  3AN1 A;  2ALZ A;  2W04 A;  5KFC A;  3PY8 A;  1LKY A;  3F5A A;  1TAQ A;  4Z6E A;  1M6Y A;  2BCV A;  3H4D A;  5AM2 A;  5L1M A;  2ZXI A;  4ZOH C;  1T4G A;  4DLE A;  5AIA A;  4QZC A;  1F5S A;  2OEH A;  1IXR A;  5KG6 A;  2KTQ A;  2QB1 A;  4ECS A;  1VDV A;  2NYV A;  3E0F A;  3ZD9 A;  2BPF A;  4C8N A;  5KFX A;  3WK7 A;  3BZC A;  3D2Q A;  3BS7 A;  1ZQM A;  1UA0 A;  1SGG A;  1V97 A;  2MSN A;  4QIW F;  3GU3 A;  2DPJ A;  2HBJ A;  4NL9 A;  2JGA A;  8ICC A;  4RQM A;  5KL1 B;  3WKE A;  2JR5 A;  9ICU A;  5ALS A;  4CF3 A;  5K4L A;  3QEB Z;  5III A;  2VA3 A;  2ASD A;  1NK6 A;  4BUG A;  4QZH A;  3T79 A;  2W03 A;  4TUR A;  2HW3 A;  4UBB A;  3PML A;  3ZDD A;  3RAQ A;  2JXJ A;  4RNO A;  1QH9 A;  1U49 A;  3EWA A;  1BPB A;  3MR5 A;  4J9P A;  3C1Z A;  1D8L A;  8ICM A;  4KMU A;  3BS5 A;  1NJZ A;  2VKQ A;  1MN8 A;  4PGX A;  2DUY A;  2KHV A;  2IHN A;  2JEI A;  1X2I A;  3D2S A;  5C0Y A;  1Y88 A;  2KSO A;  1JX4 A;  1BPY A;  2JH7 A;  2EQY A;  2VA8 A;  5GTI U;  2YML A;  2B21 A;  4MF8 A;  3M8S A;  2LI6 A;  5CA7 A;  4R8U A;  4JV0 A;  4UAS A;  3OTQ A;  5DKW A;  2H3I A;  1XNS A;  1NOM A;  3MDC A;  9ICR A;  5IIN A;  4M9J A;  4F4Z A;  4ELV A;  1X42 A;  2G07 A;  5KT6 A;  2KSO B;  3SR6 A;  3UQ2 A;  4CDG A;  5IIK A;  2WAQ F;  4XRH A;  4CF5 A;  4Y2X A;  1V38 A;  1X9X A;  2BQR A;  2XCP A;  5KG2 A;  1KL9 A;  3NUQ A;  1L3V A;  2C2D A;  4UB4 A;  5HR6 A;  2KIC A;  3IG8 A;  1ZD3 A;  1XO0 A;  4YFK A;  3U26 A;  3HW8 A;  3QZ7 A;  5DGA A;  1X66 A;  4GXJ A;  2VIX A;  3PSI A;  3Q8S B;  1S0O A;  1SKR A;  1PK1 A;  9ICV A;  2LYH A;  4DS5 A;  2WF7 A;  2YMP A;  3THV A;  2KZ3 A;  2ZTE A;  4IR9 A;  4RQ8 A;  1ZOL A;  3C21 A;  2EAP A;  1ZQ1 C;  1BNP A;  3RB0 A;  2FMS A;  5AM0 A;  1B0X A;  3BQ7 A;  4P0P B;  2EAO A;  1F0M A;  5D49 A;  3PW4 A;  4NLK A;  2V4Q A;  7ICO A;  4ECW A;  4AYB C;  4F4K A;  4Q44 A;  1QQ6 A;  5BOL A;  3C1Y A;  1NJY A;  4LZG A;  3PSF A;  4YD2 A;  4C8L A;  1XWL A;  2XY5 A;  2XC9 A;  4CE6 A;  4M04 A;  3OGU A;  1VLB A;  3H0L B;  1ZRN A;  5JU5 A;  3AEV A;  2MA1 A;  4IS7 A;  2ZXH A;  4FFD A;  4KLF A;  3ISD A;  1ARO P;  7ICR A;  4GLX A;  4YCX A;  2PFO A;  8ICO A;  3K1Z A;  2DWQ A;  2HOQ A;  1QSS A;  4B6J A;  3RRG A;  2E1F A;  1ZQC A;  4F5P A;  2Y0S C;  3SV3 A;  5AKK A;  2BKE A;  3MGI A;  3MAB A;  4LVS A;  4RUA A;  2J6T A;  7ICV A;  3GIJ A;  2BCR A;  2B6G A;  7ICI A;  3IRU A;  4DQI A;  2D3D A;  5ALO A;  2HHX A;  4KLT A;  3RJK A;  2QAR A;  4I2B A;  1FIQ A;  4F2R A;  2FJ6 A;  2ZIV A;  5AKL A;  5KFW A;  4OJL A;  3KZI U;  1TK0 A;  2K89 A;  3EUB 2;  3N7S C;  3IV6 A;  4B9U A;  4DFP A;  2FLP A;  2RQ5 A;  4CCH A;  5KG0 A;  1SV0 A;  5ALE A;  4U6P A;  3TFR A;  2ZIX B;  3RJJ A;  2NV3 A;  9ICB A;  1SZP A;  3M9N B;  7ICM A;  3HJE A;  4J03 A;  3F2D A;  2CRX A;  2K4E A;  4RQ5 A;  3KHL A;  3HRD D;  5JRT A;  5AI9 A;  1QSL A;  5KT4 A;  8ICA A;  1YT3 A;  2DPI A;  5F9L A;  3OJU A;  3UXN A;  1KFS A;  2OYY A;  9ICT A;  3ALR A;  5L1J A;  4O3N A;  3RFA A;  3KZX A;  5AKG A;  1RQN A;  5CWR A;  1TV9 A;  1DRG A;  3G6Y A;  5KTQ A;  5KFP A;  2I9G A;  1TAM A;  2K8A A;  4BXO B;  2FLL A;  1COK A;  4RQ7 A;  3SD7 A;  4PH5 A;  2A1A A;  2OM6 A;  5J0R A;  3I1Y A;  5AHX A;  3WKC A;  3ZDC A;  4NXZ A;  9ICC A;  5J8Y C;  2BPG A;  4EEY A;  4ECZ A;  4DSL A;  2OH2 A;  1WCN A;  2HVI A;  4F5N A;  1Z1V A;  2NRX A;  3CW2 C;  4UAY A;  4P0Q B;  3ZDE A;  4O3Q A;  1LVH A;  3V7J A;  4C80 A;  4F50 A;  3RR8 A;  1B22 A;  4P4M A;  3GZF A;  4QZD A;  1RG6 A;  4EBE A;  2ZJA A;  5DB7 A;  4I2E A;  4NLN A;  3RJH A;  1PK1 B;  3Q8M A;  3JPQ A;  4KLJ A;  3JPN A;  2GOL A;  2Z7J A;  1NK4 A;  3GQC A;  1UPH A;  4US8 A;  4C8M A;  1JAL A;  2XCA A;  1DGJ A;  5ALY A;  1DK3 A;  3KKA A;  4F72 A;  2NO4 A;  1JRP A;  8ICN A;  2DFL A;  2PI4 A;  4F92 B;  1KTQ A;  3TKA A;  5HNK A;  5J0O A;  3BQT A;  2E1E A;  5DLG A;  4J9L A;  3Q8P B;  2Y1I A;  7ICG A;  2ZIU B;  1WUD A;  1BVS A;  1SWV A;  4QWB A;  2H3Q A;  4YR2 A;  3FDS A;  4M47 A;  4AP9 A;  1BNO A;  4RUC A;  5EOZ A;  5EE0 A;  4US9 A;  5HHH A;  1ZET A;  2W7P A;  4I2A A;  8ICV A;  2NRZ A;  2AGO A;  2KJ5 A;  3GIL A;  4DSE A;  4R64 A;  2ZG6 A;  4BJQ A;  1K1S A;  2W3R A;  5DLF A;  1QQ7 A;  3PZP A;  2AQ4 A;  2ISP A;  2CPR A;  4RQ4 A;  1L5U A;  2KK0 A;  4PHA A;  4M9L A;  1L7N A;  4F2S A;  1ZQJ A;  3D6J A;  4GFJ A;  2M9N A;  2C2R A;  4QIW C;  5KG1 A;  3BS5 B;  3M8R A;  4O5E A;  8ICJ A;  2Y9U A;  5D46 A;  1OW5 A;  2AGP A;  1U47 A;  4F4W A;  4EEK A;  2P35 A;  2UVW A;  2OCE A;  1T3N A;  4LJX A;  9ICO A;  1ZQI A;  4QZB A;  4QZ9 A;  1CEZ A;  3SQI A;  2VAN A;  4J9O A;  1Q8K A;  1SKW A;  4ICA A;  4HAI A;  5KFZ A;  4EEN A;  5H2F U;  3VC8 A;  3N7R C;  2AXT U;  2HHU A;  2BCQ A;  3RB6 A;  2ZTC A;  1BPE A;  3AL0 B;  1HEK A;  3ED5 A;  4MF2 A;  2KD1 A;  4MHV A;  4NJ8 A;  5DGB A;  3GV8 B;  5KFI A;  5CR0 A;  4JB3 A;  2JRZ A;  2R8I A;  3TI0 A;  4ELT A;  2ISO A;  2HOF A;  3UMC A;  4I2I A;  8ICB A;  2Y0S F;  1ZQR A;  2A19 A;  5KT2 A;  2IHM A;  1IV8 A;  3GFK B;  1S76 D;  1JXL A;  1J2N A;  5J0Q A;  4EX7 A;  2PXI A;  4FO6 A;  3FAH A;  5KFD A;  3QZ8 A;  4GXK A;  4I2C A;  3QU7 A;  4F93 B;  4C8K A;  2ATL A;  1SZH A;  4ECX A;  3RF9 A;  5IIO A;  4Y2J A;  3QU5 A;  1ZJN A;  5J0X A;  4JWM A;  2C28 A;  5KFQ A;  4DO9 A;  4J9S A;  3T5H A;  4RT2 A;  1OXJ A;  3C5G A;  2JZB B;  2FDR A;  4M9G A;  5AKE A;  5EWG A;  5FP0 A;  4K4G A;  1XO1 A;  2ZUC A;  4DL6 A;  3SI8 A;  4DFJ A;  3H8J A;  4RZR A;  1L7M A;  3WK8 A;  2BR0 A;  2FMP A;  2YMM A;  3RJG A;  3NTU A;  7ICK A;  4NM1 A;  5KG5 A;  4P0Q A;  5J0U A;  3GV7 B;  5DB8 A;  1RYU A;  2QKQ A;  2M0N A;  2G5I B;  2ZIW A;  3MBY A;  3QE9 Y;  4Q45 A;  2HHV A;  1LB2 B;  4YR3 A;  4B9M A;  2G0A A;  1X6I A;  1H38 A;  4DOA A;  4RNM A;  2WF5 A;  5HP4 A;  3CP8 A;  5J2I A;  5J8Y A;  3MFH A;  5AIC A;  4DF8 A;  4IL6 U;  2D6F C;  5J2H A;  5EE1 A;  5KFJ A;  1SWW A;  2K4P A;  1SV4 A;  4F4Y A;  4P4P A;  3RB4 A;  1KW4 A;  2I6X A;  4YMO A;  3KHH A;  4TQS A;  5ALN A;  5ALW A;  1PZN A;  1U9L A;  4AYB F;  5ALR A;  4DSF A;  4C7Y A;  3V7L A;  3PW5 A;  4RPY A;  1S77 D;  3BQ0 A;  7ICS A;  3C2M A;  2ZIX A;  1RYS A;  1D8Y A;  4K4I A;  2IOF A;  1JMS A;  4JUZ A;  1BGX T;  3V72 A;  4DSI A;  4F4X A;  5B5E U;  1RXW A;  2E5S A;  4RT3 A;  1QSY A;  1KLN A;  3ETR A;  2W8K A;  1Q3V A;  1ZQH A;  5AI0 A;  5L1L A;  2E8O A;  5KT3 A;  2G09 A;  9ICN A;  1SXE A;  4YMN A;  2HBM A;  2LYA A;  3IHQ B;  4OJ6 A;  3MFI A;  1Z1B A;  2W9B A;  5DBC A;  3UXO A;  1TE2 A;  4FZL A;  4O3S A;  2RDJ A;  1AQ6 A;  1ZD4 A;  5B66 U;  4RQN A;  2DQN B;  8ICU A;  4ED6 A;  2F1I A;  4DEZ A;  3ORY A;  2XIC A;  5KAI U;  3ZDA A;  4Y2Y A;  3H7I A;  1HJP A;  1N5X A;  4DFK A;  2W9M A;  1NK0 A;  3NVZ A;  4QZF A;  2LYB A;  1FO4 A;  4CGZ A;  4IRC A;  2VJ5 A;  1L3U A;  3A0B U;  3T5L A;  3L5K A;  2MUT B;  4E0D A;  1MA7 A;  1FFV A;  3OPX A;  5AKI A;  1ZQX A;  3K75 D;  3AUO A;  4OO1 J;  2LM4 A;  4NL9 C;  4KN4 A;  3SEN A;  4KLS A;  1FFU A;  3UXP A;  4UAU A;  2UVR A;  3UMB A;  5J2C A;  3ISC A;  2JEJ A;  3OSP A;  4ECU A;  2KIV A;  1ZQK A;  2NRW A;  4Q8F A;  4M9H A;  5DG7 A;  3HP6 A;  4CNQ A;  4DQR A;  1RYR A;  3C29 A;  2QLT A;  5CB1 A;  2XO7 A;  3DV9 A;  4DS4 A;  1L8O A;  1MQ2 A;  3OHB A;  1SIJ A;  5J2K A;  4KX3 A;  4UB2 A;  5J2G A;  3B0X A;  8ICR A;  5AKY A;  5KG3 A;  3MDA A;  3KTQ A;  4UB6 U;  4YD1 A;  5DQI A;  2CXY A;  4QZG A;  4DL3 A;  1N48 A;  1XU4 A;  2W55 A;  3HT3 A;  4B9N A;  3OHA A;  1UQV A;  1N5W A;  3PR4 A;  2ZIW B;  3M1Y A;  4J9N A;  5L1I A;  3T5K A;  2WHE A;  9ICA A;  1SL2 A;  4Y2S A;  4MEX A;  1S9F A;  5KFR A;  2KMD A;  3OSN A;  2ZJ8 A;  1TAU A;  2P6U A;  4DL7 A;  4MEY A;  2P6R A;  4C8O A;  5CP2 A;  3TAN A;  1L3S A;  2UVV A;  4PHD A;  2QAR B;  5ALL A;  2KZZ A;  5ALH A;  5ALX A;  3PW2 A;  2H5X A;  5J0P A;  2KKP A;  1N60 A;  1MSW D;  3JPR A;  2HHW A;  4Y2V A;  4R8U B;  5KFT A;  4J9M A;  4KLH A;  1RZT A;  4QZI A;  2N1R A;  3H8W A;  2XGP A;  4EZ6 A;  1URJ A;  4KLI A;  2YTU A;  4RU9 A;  5IIL A;  5ALZ A;  3PX0 A;  1HIW A;  3KFU F;  2FLN A;  1VJ5 A;  4Y2R A;  3BQ1 A;  4M9N A;  4DSJ A;  1ZQF A;  1JUD A;  3RJF A;  4I29 A;  4IRD A;  9ICP A;  2F1J A;  4EBC A;  2P66 A;  2DKX A;  3IDW A;  1ZQU A;  4DOC A;  4QWC A;  5AKZ A;  1HUZ A;  1B4F A;  5HML A;  1S0V A;  2F44 A;  3I28 A;  1FEZ A;  4I2D A;  4FS2 A;  4PHP A;  2IA6 A;  4I2J A;  3TAP A;  3QU4 A;  4M6W B;  3IM1 A;  5L1K A;  4KIT B;  2K60 A;  3TQ1 A;  7ICN A;  4IQU A;  2KP7 A;  1NK7 A;  5KT5 A;  2F2A B;  9ICW A;  8ICP A;  5KFE A;  3RBE A;  4XA5 A;  4PJ0 U;  1S10 A;  7ICQ A;  8ICE A;  8ICS A;  2R8J A;  5KFK A;  8ICG A;  1N62 A;  2DKZ A;  1A6S A;  3KD3 A;  4FBT A;  1Z00 A;  4TQR A;  4DQQ A;  4UB1 A;  4PL2 A;  2XVT A;  4DOB A;  4I2G A;  1WCL A;  1U4B A;  2BQ3 A;  1V9P A;  2K4I A;  2PFN A;  4MFC A;  5KT7 A;  2HHS A;  1V85 A;  5KFA A;  1TK8 A;  2JZB A;  5AI4 A;  4YN4 A;  7ICP A;  3SAG A;  1J97 A;  3MR2 A;  4Y2Q A;  2OHF A;  1L7P A;  1O08 A;  4KLM A;  4O5C A;  9ICL A;  2FI1 A;  3QU2 A;  2QB0 A;  4RQ6 A;  5ALT A;  2R8G A;  5J0T A;  1ZQA A;  3TAC B;  8ICK A;  2LPE A;  9ICF A;  2RLT A;  1KFD A;  4FE3 A;  2HBL A;  1L7O A;  5KL8 B;  1PK3 A;  3QNM A;  7ICH A;  2ZUB A;  3LK9 A;  1X9W A;  2HOI A;  1ZQL A;  3GII A;  2WF6 A;  1S0N A;  1BPZ A;  1ZQY A;  3H4B A;  3EYZ A;  2EZX A;  3LYS A;  1DK2 A;  4ZH4 A;  5BOM A;  2O6K A;  1A76 A;  3QXG A;  3M6K A;  1NK5 A;  1XSN A;  4RPZ A;  1N2X A;  2WB1 C;  1F44 A;  4OCZ A;  1ZQS A;  4F3O A;  3ISB A;  4J9R A;  2ZIV B;  4ED3 A;  4Q43 A;  4F91 B;  5AKH A;  5ALM A;  5EE3 A;  1S97 A;  3WK6 A;  4M6W A;  2GO7 A;  4OD0 A;  1TK5 A;  1NI3 A;  5J2B A;  8ICX A;  5DB6 A;  1NKE A;  1IG6 A;  2FE9 A;  2PKE A;  5KNI A;  4Q8E A;  1UHU A;  7ICF A;  3M9M B;  3HPO A;  5JUM A;  2WAQ C;  4OJO A;  5DQG A;  4DF4 A;  2W3S A;  4KLO A;  1UT8 A;  1JN3 A;  3OJS A;  1C20 A;  4CF4 A;  1NKB A;  4DL5 A;  1NZP A;  2IMW P;  1WWU A;  4Z6D A;  4KTQ A;  1ZQZ A;  3N4M B;  3ZI4 A;  1PVQ A;  3Q8L A;  4G9B A;  1ZQE A;  4QNL A;  4O3O A;  1COO A;  5D4B A;  8ICF A;  2E8M A;  2F77 X;  5F3X B;  2K8B B;  3HIL A;  5DBA A;  4JV2 A;  4O3P A;  2ZJ5 A;  1S0M A;  3K4G A;  3G6X A;  3GV5 B;  4G3I A;  4I2F A;  3AQF A;  3TAD A;  3RJI A;  3AU2 A;  4C4S A;  4ED1 A;  2PMZ F;  2W8L A;  1ZYQ A;  3RTV A;  2HMX A;  1SKS A;  3BDP A;  5DB9 A;  3I76 A;  4KMO B;  2OWO A;  1L6N A;  4NLC A;  4XUS A;  4IRK A;  1QLN A;  1TFR A;  1T8E A;  2WF9 A;  1NJX A;  1X6J A;  4KLE A;  4BWJ A;  2W9A A;  3SAF A;  3BQ2 A;  1X40 A;  3IN5 A;  5AK5 A;  2R8K A;  4Y2U A;  3WKD A;  4U7C A;  1JXE A;  2MUT A;  5KG4 A;  3PX6 A;  5J0W A;  3Q8Q B;  2Y9T A;  2KEY A;  4GXI A;  5J0S A;  2BDU A;  3O0F A;  5AM4 A;  3ICX A;  3SEI A;  3LVV A;  3RR7 A;  2DGZ A;  2BQU A;  2HDO A;  3K1R B;  4UAT A;  4DWI A;  3J81 j;  1ZQG A;  2KHQ A;  2W11 A;  5KFH A;  1T3Q A;  4DL4 A;  3QUB A;  3KBB A;  1WYG A;  2KVS A;  4EYI B;  1U45 A;  1S8O A;  1ZRM A;  5AK4 A;  3V6J A;  3AM9 A;  1JIH A;  1D9D A;  5J2A A;  3NS1 A;  1B43 A;  4QWD A;  4Y2P A;  4Y2T A;  3WK5 A;  1KEJ A;  5TIS U;  2V9W A;  1NK9 A;  2LM1 A;  4KLQ A;  3FYH A;  8ICL A;  3M6Z A;  4UB8 U;  2I5H A;  4EZ9 A;  5ALD A;  1WWV A;  4C7Z A;  2KFN A;  3HKZ F;  4O0I A;  2EH9 A;  2W9C B;  2WTF A;  3QU9 A;  3JPP A;  7ICJ A;  5KFL A;  1A0P A;  4RQ3 A;  4TUP A;  5IIM A;  4F5R A;  1KDH A;  4EBD A;  5GTH U;  1O03 A;  4NLB A;  2AQ0 A;  4M2Y A;  3KKA C;  1ECW A;  5ALI A;  4F5O A;  1L8L A;  3TAD C;  1PVR A;  2V4R A;  9ICJ A;  2H3Z A;  5KFV A;  1KFT A;  3MR6 A;  4ECY A;  1Q3U A;  5ALK A;  4MFF A;  4O9M A;  3C2K A;  3PO4 A;  1ZQV A;  1SV0 C;  2MRL A;  1DXS A;  1ZQW A;  1X9S A;  4I27 A; 
#chains in the Genus database with same CATH homology
 2HOQ A;  2ZIU A;  2BDU A;  3O0F A;  2CN1 A;  2KOB A;  1Z1B A;  2E1F A;  3ICX A;  2KJ9 A;  3LVV A;  2Y0S C;  3E0F A;  1Z19 A;  2JMG A;  4FZL A;  3CRX A;  3NUQ A;  4OJ5 A;  2DGZ A;  4FZM A;  1P7D A;  4FZN A;  3F53 A;  2OH2 A;  2H3V A;  4P0P A;  5HR6 A;  2RHF A;  3D2Q A;  4P0Q A;  2DQN B;  2KIC A;  3F2C A;  2YX8 A;  2WAQ C;  1A6S A;  2YB4 A;  1T94 A;  4OJO A;  4P0Q B;  3IG8 A;  4QIW F;  3GU3 A;  2KHQ A;  2HBJ A;  3IG5 A;  2KNJ A;  3F2B A;  1XO0 A;  3SQI A;  5HR7 A;  2JGA A;  2M0N A;  4QJF B;  3GZF A;  2XIC A;  2G5I B;  1GO3 F;  2DF4 B;  2LHT A;  2XVT A;  3LVW A;  3PST A;  2ZIW A;  3CYM A;  3ONN A;  4PL2 A;  5KL1 B;  2HBK A;  2PMZ C;  3IP4 B;  4ICA A;  3VC8 A;  3N7R C;  2K4I A;  3AL0 B;  2XID A;  2G0A A;  2ZIV A;  3DEE A;  5A0L A;  2JHD A;  2GOL A;  1HEK A;  2LYB A;  2VIX A;  2Z7J A;  4IC9 A;  3MGV A;  2KKV A;  2KD1 A;  2VJ5 A;  1UPH A;  3PSI A;  4OJL A;  3SAG A;  2LKY A;  2XI9 A;  3CP8 A;  4JMU A;  1D8B A;  2KKP A;  4BUG A;  4CGZ A;  2K89 A;  3N7S C;  2OXO A;  3T79 A;  1MA7 A;  3OPX A;  3VCB A;  2W03 A;  2HOF A;  1PVQ A;  2R18 A;  3F5E A;  2D6F C;  4QNL A;  4U6P A;  4OO1 J;  2ZIX B;  2F8L A;  3SMV A;  2Y0S F;  2N1R A;  2G5H B;  1ZQ1 C;  3M6Z A;  2E1E A;  2NV3 A;  4ACO A;  2F77 X;  1URJ A;  2K8B B;  2G08 A;  2ZIU B;  1WUD A;  2H3Q A;  2KIW A;  3H0M B;  4C0Z A;  3F2D A;  2A3V A;  3HKZ F;  2CRX A;  4CRX A;  4P0P B;  2K4E A;  3L3F X;  1IIP A;  2VKQ A;  2WB1 F;  3NRW A;  2RP5 A;  1HIW A;  3C28 A;  2KHV A;  2KJ8 A;  3KFU F;  3AQF A;  3PSP A;  1KBU A;  2F76 X;  2VJ4 A;  2GH1 A;  3C29 A;  2K4H A;  4AYB F;  4AYB C;  1SZH A;  1YT3 A;  3D2S A;  4FE3 A;  4PL1 A;  1A0P A;  2PMZ F;  5C0Y A;  2HBL A;  2JH7 A;  2LBO A;  4NV0 A;  3N7P D;  5KL8 B;  2HMX A;  3RF9 A;  2OYY A;  2JH1 A;  4OJP A;  3ALR A;  3M7D A;  4KMO B;  2W7P A;  1CRX A;  2HOI A;  2KVC A;  3PSF A;  4NLC A;  2ZIX A;  4NLB A;  1L6N A;  4BX9 C;  2YB1 A;  4A8E A;  2KJ5 A;  3HKZ C;  2KV2 A;  4WJ3 B;  3RFA A;  5T14 A;  1ECW A;  3KZX A;  2W04 A;  3LYS A;  3AQE A;  4KX3 A;  2K8C B;  1PVR A;  2H3I A;  2ZG6 A;  4BJQ A;  1XNS A;  1DRG A;  4O3M A;  1TAM A;  2K8A A;  3F5A A;  2H3Z A;  3SAF A;  3H0R B;  2G06 A;  2H3F A;  3H0L B;  1OUQ A;  3SAH A;  3IN5 A;  3M6K A;  3PZP A;  2CPR A;  2MA1 A;  2E5S A;  1ED1 A;  4U7C A;  2ZXH A;  2G07 A;  1NZB A;  1Q3U A;  2RRD A;  1Q3V A;  2OM6 A;  2ZXI A;  1PVP A;  2WB1 C;  1F44 A;  4GFJ A;  4KX5 A;  5CRX A;  2Q4T A;  4CDG A;  4QIW C;  2ZIV B;  3K1Z A;  2F2A B;  4NWI A;  2G09 A;  2MRL A;  2KEY A;  2W7O A;  2WAQ F;  3D2N A;  2HBM A;  2LYA A;  2ZIW B;  4OJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...