3AQFA

Crystal structure of the human crlr/ramp2 extracellular complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
b'GTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor activity-modifying protein 2
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/membrane protein
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqfA00
3AQEA 3N7RC 3N7PD 2YX8A 3AQFA 2XVTA 3N7SC
chains in the Genus database with same CATH superfamily
5KFLA 3I76A 1HIWA 2M0NA 3JPRA 1L6NA 1UA1A 1TK5A 4K4GA 3SAHA 3KOOA 4EENA 3C2MA 1Q3VA 1S0VA 2GWSA 5KFFA 1S0NA 2DPIA 2FPMA 3E0FA 3QUTA 5AM1A 1SV0A 4Q43A 3AM9A 4BUGA 4FZLA 4B9MA 3GQCA 3AN1A 2W3RA 1OXJA 3HKZC 2YQEA 3TADA 2AGQA 5G5GA 3T5HA 3N7SC 2K8CB 5D46A 2BDUA 4P0QB 2BQUA 1T8EA 1ZQOA 2LM4A 3PNCA 2OXOA 3WKAA 3GV8B 4DOBA 8ICYA 2IHNA 4JV1A 3V7KA 2Q4TA 2ZIVA 4PZOA 2WHEA 2V4QA 4DF4A 3QU9A 1J2NA 1Z4NA 1K1SA 2XI9A 3V72A 3SR6A 3RH5A 2EH9A 2KTQA 2K8AA 4XRHA 4F3OA 3QUQA 3QUBA 4QWEA 1PVRA 3PY8A 4Q44A 5J0WA 4C8NA 5CJ7A 3GIKA 3VCBA 2WAQF 1ZOLA 4F91B 4F4WA 3PX0A 2UVVA 1HEKA 2DKZA 1SV4A 4R66A 5DB6A 1MSWD 2ESEA 4UAWA 1MQ3A 1N48A 1A6SA 5ALMA 3U26A 4UAZA 1N60A 4C0ZA 4PL2A 5F3XB 2HOQA 2F8KA 4C7YA 4DEZA 2G5IB 3IDWA 5B5EU 1RYRA 3QZ7A 1NK9A 2R8HA 4DL7A 2W9CB 4C8OA 2IOFA 2CRXA 5KFKA 2BZFA 2W3SA 1RM6C 1KL9A 4M9NA 3C28A 2XY7A 5J0QA 2W9MA 5J2IA 2HHVA 5KFWA 5CB1A 5BOMA 3RH6A 4BGDA 3RTVA 8ICXA 5KG3A 1U47A 1X6IA 2AHOB 2J6UA 8ICTA 5EE0A 1N62A 4TURA 4I2FA 5JUMA 5ALHA 3M8SA 5AKGA 3WKDA 9ICEA 1FO4A 1BNOA 1ZJNA 1QSLA 4GC6A 1SGGA 1MC8A 3CP8A 2HBMA 3H40A 2WF7A 2A3VA 3C5FA 4CDGA 5ALIA 2Y9TA 1S9FA 5KG1A 1TFRA 2RDJA 4MEXA 3KHLA 5ALOA 3THVA 3WK4A 8ICJA 2UVWA 2OCEA 4YR3A 2K4IA 5AK3A 9ICOA 3NS1A 4YQWA 4OJOA 5AKXA 4Z6EA 2LKYA 1MQ2A 3WK7A 2ASDA 2CXYA 3TFSA 3C1ZA 4PJ0U 5ALJA 4FBUA 7ICEA 4RNOA 4BDPA 4RPXA 2AU0A 3QU2A 4CCHA 2G5HB 2VJ4A 1LVHA 1U9LA 2IBKA 1H38A 1FIQA 3CW2C 2JEGA 1B22A 8ICAA 1ZD4A 4Y2UA 4NXZA 2AQ4A 1UA0A 4NLCA 5KL1B 4ED3A 1S0MA 4Y2YA 5J2JA 4GIBA 2FDRA 4DQPA 2E1FA 1PZNA 4O3MA 1BPXA 1BVSA 1WCNA 2W8KA 2FMPA 3L3FX 2XO7A 5ALUA 3M7DA 3BQ0A 4PZNA 3T5LA 9ICRA 9ICGA 3OJSA 3N28A 5L9XA 2ZIUA 1KW4A 5KFGA 5C0YA 4KLMA 1ZRNA 2K60A 9ICAA 1F44A 3UMBA 3SQIA 3GV7B 1C20A 4PHAA 8ICSA 2LBOA 1L7OA 9ICWA 1ECWA 2XGPA 1TV9A 2JXJA 1A77A 4ZH4A 3K1RB 4B6JA 3WK6A 5ALDA 4UW9A 1JX4A 1K5OA 1TAUA 1NKCA 4TUPA 2YMLA 2E1EA 3N7RC 5KFRA 4GXJA 3SV3A 3TQ1A 4QZBA 1XWLA 3K4GA 3B0XA 5CEHA 2JEIA 3RB4A 1ZD3A 2WTFA 3AQFA 9ICCA 2N1RA 2C28A 1SV0C 4EBCA 1D8BA 3HJEA 3SAGA 1JN3A 2VIXA 5DB9A 3G6VA 3RF9A 4F4YA 5J8YC 3IRUA 3M9OB 2KJ8A 4Q8EA 4F4XA 2WB1C 5HR7A 3CNHA 3C5GA 4RPYA 2E8OA 3TACB 4P0PA 3NVWA 3RJGA 3F2CA 2VANA 5ALEA 4DL6A 2EQYA 3NASA 4NLKA 2A19A 1F0MA 2Y0SF 1YZ6A 4UAYA 2ZIWB 3SZ2A 4DQRA 1S5LU 2QB0A 5AK5A 1UPHA 3GDXA 1N5WA 3DEEA 5JTIA 2E3TA 3ZD9A 3RRHA 1HUOA 5J0XA 1DK2A 5DGAA 1WWVA 4WJ3B 2JHDA 1SL1A 4Y2QA 4ED2A 4ACOA 2C22A 5DBBA 1CEZA 1UCVA 3HT3A 4R65A 4JV0A 2RRDA 3PSIA 5ALXA 1N2XA 1ZD5A 4UB4A 4PL1A 2W7PA 2JZBB 5CRXA 2ISOA 2K4PA 1ZQHA 4KLLA 2WF9A 2PI4A 2KD1A 2QARA 1L3TA 2ODGA 5KAIU 7ICQA 1NK4A 1ZJMA 4QNLA 2KEYA 3KTQA 2H5XA 2UVRA 4F72A 4F5PA 3N7PD 4P0QA 8ICMA 3C1YA 2XCPA 4MF2A 4IRKA 5AKKA 3MFHA 3MBYA 4DQSA 3PX4A 4HAIA 2D6FC 3TKAA 3AU6A 5KFEA 4ECWA 1NNLA 4F4ZA 2KFZA 5E79U 4KLJA 1Q46A 4ED1A 4EX6A 2KV2A 3PW4A 3ISBA 5ALTA 1ZQVA 1L3SA 2BCRA 1KQQA 2W11A 2K8BB 4RNNA 2XCAA 4O5KA 3C29A 1V97A 1Z1BA 1ZQ1C 1WYGA 1PK1B 4CE6A 3WK5A 1U4BA 3MGHA 4NV0A 2RHFA 4NLNA 3QEBZ 5EE9A 4DCCA 5T14A 2IA6A 2JV3A 5J2AA 1ZQBA 4ED6A 4YMNA 5DG9A 4EZ9A 2JR5A 2W9CA 3UPQA 1SKWA 3GU3A 2VA2A 9ICMA 5ALPA 2NRWA 4C80A 1WWUA 5KT6A 2ZJ8A 4XQ8A 2GO7A 4OD0A 4RZRA 2KE7A 3H4BA 3DDHA 1RZTA 3EWAA 5AKHA 1X9XA 4F93B 1CI4A 3ETLA 4RQ0A 3KFUF 8ICLA 4BWMA 1XSLA 2CN1A 4I2GA 1AROP 2WB1F 5DB7A 2E8NA 4IQUA 3PX6A 1BPDA 1VLBA 1QCKA 2JMGA 7ICUA 4RQ2A 1BPBA 5KFZA 2EZZA 3K1ZA 2G07A 1X9MA 3RBDA 4UASA 2MU2A 1SZPA 5D4BA 5AKLA 4M9HA 9ICFA 3MC1A 5AM3A 1PUZA 3ZDEA 3AEVA 1NI3A 3H0LB 2HVHA 4IQWA 1FFVA 4J9NA 2KHQA 4M6WB 5KFSA 2NYVA 4YMMA 1SKRA 4XA5A 9ICPA 5DQGA 2OM6A 1XU4A 4PHDA 4F8RA 5KFTA 1QQ5A 5J0OA 1NK6A 4M9GA 5CA7A 4ECXA 5AM4A 1NK8A 4DFDA 5HHHA 5IINA 2NRZA 3C21A 1CUKA 1KDHA 4UBBA 1FEZA 4IL6U 4MHVA 5KFHA 1PK3A 5ALGA 2R8GA 4DO9A 1N63A 3HX0A 4ELTA 4J9QA 2BPCA 5F9LA 4I2AA 3OSPA 5F9NA 5KFDA 1N5XA 1CRXA 3L5KA 4UB2A 7ICOA 3QU7A 1NZPA 2HOIA 2KIWA 4J9SA 5J8YA 4FFDA 2BHNA 2MAXA 2D3DA 1T3QA 4DSJA 2KZMA 9ICVA 8ICWA 4FO6A 5GTHU 4DLGA 2BQRA 4ECTA 2MA1A 4U6PA 1QLNA 4NM2A 1XS9D 1U48A 3G6YA 5A0LA 4Y2SA 1KBUA 2AQ0A 4P4OA 4EYHB 4RT2A 2W7OA 1ZQDA 4C7ZA 5J0PA 2BPGA 2EAPA 3EW9A 2AXTU 1KLNA 1BNPA 4ECYA 4OJ5A 4KLDA 1WUDA 1LKYB 3SD7A 4EEKA 1Z00B 4RT3A 4QZGA 1PVQA 1C7YA 3PO5A 5KG4A 5KFUA 5AI5A 5AKZA 2HBLA 2BCVA 1SXDA 4KX5A 4J9LA 4ECRA 2FLLA 3PSFA 9ICTA 3IN5A 1JXEA 4KLFA 3Q8PB 3SI8A 3JPOA 4YFKA 4X5VA 2ZIXB 3A0BU 4BXOB 5HMLA 5DDYA 4ECQA 4Y2XA 5J0TA 4F5OA 5KFAA 2ZIWA 3TARA 3LWLA 2FJ6A 3IG5A 2HHTA 5TZVA 1S76D 3ISDA 2O6KA 3GZFA 2JEJA 4O3OA 4DSLA 2BCSA 3V7JA 4DSFA 1JMSA 4JB3A 1ZQMA 2A1AA 4R63A 2Y0SC 3UXNA 4GFJA 1UT8A 2AGPA 1ZQXA 1ZQYA 8ICQA 2YX8A 5IIOA 1NKEA 5KG6A 2JZBA 4GXIA 4MFFA 2W43A 4NLBA 8ICKA 3GV5B 1Z4OA 1COKA 4Y2JA 1QSYA 4OJLA 4Z6FA 2WF6A 3D2SA 4DFPA 2F44A 1VJ5A 5AI4A 1RQNA 2FMSA 2EDUA 2KVSA 3NUQA 1QH9A 2F2AB 2R8IA 2JGAA 2BPFA 2BCQA 5KG7A 3T3FA 2B0CA 3N97B 2HOFA 2WF5A 4O3RA 4YR0A 2HHWA 3IP4B 1YZ7A 5HNKA 1ZRMA 5J0RA 2OWOA 4KITB 4KMUA 5ALKA 1KKXA 2XVTA 7ICKA 3RAQA 1J97A 2DKXA 1OUQA 5EWFA 3H0MB 1S77D 5KFPA 3BQ2A 1SKSA 1UHUA 4PPXA 1L5UA 4YR2A 3JPPA 2KNJA 4TQRA 1Y88A 4JWMA 2A1JA 2JRZA 3ZD8A 2ZUCA 1ZQIA 4C8MA 4KLTA 4M04A 2DFLA 1P7DA 3IHQB 3OTQA 1QQ6A 2BCUA 3O0FA 5ALQA 1DGJA 3ZDBA 1AQ6A 5CHGA 1JRPA 3BS7A 5KT2A 3WU2U 1SWWA 3ISCA 4ED0A 5KFJA 2BQ3A 1B0XA 4QZFA 2LHTA 2I1QA 1ZQZA 4UB5A 2YB4A 1ZQFA 2ZUBA 7ICNA 2K4HA 2KSOA 3LVWA 4ECZA 4ZOHC 4M2YA 3C23A 1B4FA 1ZQCA 4EBDA 4B9UA 1DXSA 4GXKA 1X66A 2KKPA 2EANA 2XICA 7ICJA 4F71A 5DKWA 4MFCA 1JUDA 4U7CA 2FLPA 3RJKA 5L1KA 5AM5A 4PHEA 4QZDA 2BR0A 4JMUA 5BPCA 2PXIA 2IHMA 2VA8A 4DSIA 1IXRA 4NM1A 2DL0A 4JUZA 4YVZA 1KFTA 4HYKA 5J2EA 3RR8A 2Y1IA 4NY8A 1MN8A 1L7PA 1KSPA 2F8LA 3QNMA 4R8UB 5ALYA 4RQ1A 3AMZA 4Y2TA 4UB8U 1OW5A 2HW3A 5J2DA 1NJXA 4IRCA 5AI0A 4NWIA 1Z19A 4C4RA 3TANA 2GOLA 3WKBA 1IM4A 9ICLA 2HCFA 2I6XA 4YCXA 3T5KA 4EBEA 2XIDA 5JRTA 3MDCA 2L5YA 2YTUA 4KMOB 4RQ5A 3UXOA 2BDPA 5EWGA 2V4RA 2UVUA 3M6ZA 3SMVA 4MEYA 2J6TA 3Q8MA 4IC9A 2KMDA 3BQ1A 1ZXIA 4I2IA 1RDFA 2C2RA 1IV8A 3PSPA 5DBAA 2XC9A 2LMRA 2W03A 3RJIA 4KLOA 7ICGA 2FI1A 5AK6A 1X40A 8ICNA 3BS5A 1M6YA 1RYUA 3F53A 4P2HA 4KLGA 1KEJA 1HUZA 4OO1J 2PKEA 3MGVA 4UAVA 5J0YA 3JPNA 1U49A 3A0HU 2VA3A 1KN5A 2Z7JA 4OJPA 3LYSA 4MF8A 3C2KA 4O3PA 4DFKA 1LV5A 4KN4A 3AU2A 5KT7A 3BZCA 5J2BA 4QIWF 2NO4A 4JWNA 2LI6A 4MFAA 2HBKA 3UMGA 5KFOA 3PW7A 4KLSA 1KFSA 3SAFA 2W04A 5DG7A 3SEIA 4B9TA 5AIBA 8ICIA 4K4HA 5HR6A 2H3VA 3LVVA 1QSSA 5J0SA 1JI7A 5BOLA 3KBBA 3PO4A 9ICBA 5KFMA 2ASJA 2KJ9A 4DSEA 3MR2A 3UQ2A 1URJA 5DQHA 5DG8A 2ATLA 4PGQA 4BX9C 4PHPA 2P6RA 2MRLA 4UB1A 4B9LA 4GLXA 2FPKA 2M9NA 4DWIA 4ECVA 4P4MA 5KAFU 3H4DA 8ICCA 4QWDA 3G6XA 1S0OA 3OPXA 4KTQA 3V6HA 1RQLA 1X9SA 3B9JA 3PVXA 5HHIA 4DF8A 2HSZA 2C2EA 4J9MA 2E5SA 4BXOA 2XGQA 2GH1A 4O0IA 4UAUA 1NK7A 2XY5A 3JPQA 4G9BA 3HW8A 1L3VA 2YMQA 5GTIU 2ZG6A 9ICXA 1Q3UA 1MA7A 2ZIUB 5ALNA 4ELUA 4J9PA 4CGZA 2ZUDA 4US8A 1XO0A 4YD1A 4I27A 3LDAA 3RJHA 5L1LA 1L3UA 2YMPA 8ICEA 1PVPA 2IOFK 3H8WA 2NRVA 4RQNA 2G06A 2CPRA 4J9RA 1N56A 7ICSA 4UQGA 2YN4A 4ED7A 2I9GA 5AKJA 3M9MB 1DOQA 1IIPA 3FAHA 2KKVA 3MR3A 3ZDAA 2KN7A 3NRZA 9ICSA 3FDSA 4PGYA 5CP2A 4O3NA 4AP9A 1O03A 1BPYA 3E2EA 3HPOA 7ICRA 1NK5A 1XO1A 5TISU 2LYBA 5KFXA 4XUSA 4C8KA 2VJ5A 1ZQKA 4AYBF 3KHGA 4GC7A 3MR6A 1BPEA 3PZPA 2Q0ZX 7ICMA 2JH7A 8ICGA 2KK0A 4FZMA 3T79A 4CF5A 5DGBA 3PMLA 1D9DA 2GLEA 4P0PB 1Z1VA 4OCZA 5AKEA 5AKYA 4NJ8A 2VKQA 2IMWP 1TKDA 4F92B 2QB0B 4EX7A 3RBEA 4B9SA 4KLHA 1NJWA 3J81j 2IOHA 5AK4A 3UXPA 5EE3A 2E8MA 4DSKA 3BQ7A 4ECSA 2V9WA 1COOA 4M47A 1SXEA 2NRXA 1TVAA 1NJZA 2RP5A 3ORYA 5ALSA 1GO3F 2H3QA 4O3SA 2DGZA 2HMXA 3Q8QB 7ICPA 2OEHA 1VDVA 3H8SA 2W9BB 4C4TA 3PR5B 4KLEA 2KICA 2YY6A 4M0AA 2QARB 4EYIB 4Z6DA 2BKEA 5J2CA 2KFNA 1SZHA 1SIJA 3KD3A 3OSNA 1X2IA 3CRXA 5AKIA 2HDOA 2FLNA 5AI8A 1S8OA 1TAQA 2EAOA 2J6SA 3FM9A 5AI6A 3FYHA 5J0UA 4IR1A 3SV4A 1T7PA 3EPIA 5KFNA 9ICNA 2HHSA 2DBYA 4FZNA 5JU5A 1XNSA 3RH4A 4FE3A 1V38A 4K4IA 4QWCA 1O08A 4PGXA 4F5QA 1JROA 3QUCA 1D8LA 3KKAA 2NRTA 4NL9A 9ICUA 4R8UA 2R8JA 1ZQSA 5AM2A 5J2GA 2HI0A 3F5AA 4O5CA 4BJQA 3D2NA 2I5HA 3NVVA 4Y2PA 2W55A 4KLQA 1UT5A 3F2BA 1X42A 3NVYA 4DL2A 2ZXIA 3ZI4A 4J9OA 9ICIA 8ICPA 5ALVA 3GFKB 3E58A 3QEAZ 5FP0A 4P4PA 2YMMA 4KLUA 2EZYA 3H7IA 4DFJA 4DS4A 3JPTA 5KFBA 3PW0A 4I2HA 3M6KA 3RJFA 4QJFB 3UMCA 1SL2A 3RR7A 1K1QA 2H3IA 4YXMA 1TE2A 4M9LA 1J2MA 4QZHA 2K4EA 3R9KA 1RPLA 2QB1A 2AGOA 1Q8KA 5KFIA 4LVSA 2MUTB 3ICXA 4NLGA 2BGWA 2P66A 5KFCA 3Q8LA 3I1YA 4UARA 4YD2A 3ONNA 2ZJ5A 3SYZA 4IQTA 5KTQA 3BDPA 3N4MB 1ZQLA 4QW9A 4DLEA 4I2DA 2RDIA 2QLTA 7ICFA 2ISPA 4CF4A 2ZTDA 1L8OA 3NGDA 3RJEA 3IG8A 1KRPA 1WG8A 4JK1A 2OHFA 4Y2RA 5DLFA 1BGXT 5CWRA 2KJ5A 2WFAA 3H8MA 3BQTA 5KT4A 3M9NB 4FS2A 2Y1JA 5G5HA 3QZ8A 3RB0A 4F5RA 4DS5A 3PMNA 3IV6A 5DDMA 1D8YA 4QIWC 4RUCA 1L7NA 4KN7A 4QZIA 4RQ3A 3LWMA 1SWVA 2EZXA 4QWAA 1T94A 3RB3A 3RFAA 3GIMA 3H0RB 4KLIA 2RQ5A 2FMQA 4F2SA 1RYSA 3NTUA 4Z6CA 3AQEA 5IIKA 3MABA 2P35A 2R18A 3PSTA 2W8LA 5ALZA 4UBCA 1NZBA 1ED1A 1PK1A 2HHUA 1TK8A 3WK8A 5IILA 5KNIA 5J2FA 3HKZF 4DQQA 3RRGA 2NV3A 5DBCA 4RPZA 4RNMA 2HBJA 4US9A 1FFUA 3BJYA 8ICVA 3QU5A 4UB3A 2DUYA 3UQ0A 1EXNA 3QU4A 1S10A 5EOZA 4DFMA 2B21A 1QQ7A 3B0YA 4C4SA 5DLGA 3EPGA 3PW5A 2PFQA 4F4KA 2PFPA 5AIAA 4CNQA 4Q45A 1TK0A 1U45A 4O5EA 1TAMA 4A8EA 3HILA 1JXLA 1ZQEA 3HRDD 4QWBA 1V85A 2DF4B 2H3ZA 4RQ6A 5KFYA 4USAA 2W54A 1NKBA 1LB2B 5KG0A 3OHAA 1YT3A 3M8RA 4LZGA 2ZIVB 3RAXA 2F76X 3L4PA 3Q8KA 1XSPA 5L1IA 1HJPA 2F77X 1JIHA 3I28A 3NVZA 3WKEA 4I2JA 5KG2A 3H8JA 1XC9A 2LPEA 7ICIA 4IR9A 1ZYQA 2FE9A 2ALZA 4I2CA 3TAPA 4TUQA 3M1YA 1SB3C 3OGUA 4OJ6A 5J2KA 4ED8A 7ICHA 4RQ8A 3GILA 4QZAA 4Q8FA 3ED5A 4J9KA 4QZEA 5IIMA 3EZ5A 3TADC 5KG5A 4RU9A 4M6WA 2KVCA 8ICZA 2ZTCA 8ICHA 2G08A 1ZQNA 3ZDCA 7ICTA 5KFQA 1F5SA 5J2HA 1ZQGA 1IG6A 1RG6A 3WKCA 5L1JA 1S97A 4AYBC 2G0AA 3T5JA 3FC4A 1T4GA 1ZD2P 5KL8B 2XY6A 2F1HA 3BZKA 4PH5A 3TI0A 3MGIA 2HHXA 5AHXA 1ZQJA 1JALA 1A0PA 3KKAC 4NL9C 2DWQA 3MR5A 3CYMA 4RQ7A 2NO5A 2W9AA 4IS7A 8ICFA 5KT5A 3D2QA 4R64A 2PMZC 2F1JA 2F1IA 2G09A 5HMMA 1ZQUA 3F2DA 3KZIU 5CR0A 3TAQA 7ICVA 4C8LA 1Z3EB 2C2DA 2F3NA 3PR4A 4B9NA 1ZQWA 1QTMA 2KOBA 5H2FU 2Y9UA 4NLZA 4M9JA 3K75D 1DGSA 3RB6A 2QKQA 2W9BA 4EEYA 3D6JA 8ICBA 2D8CA 3PW2A 4QW8A 1SL0A 4UATA 3GIIA 2JEFA 5K4LA 3QE9Y 8ICRA 2K89A 5J29A 3KZXA 1DRGA 1ZQTA 1ZQAA 4DL3A 4I2BA 3JPSA 1RXWA 9ICQA 9ICJA 1L8LA 1T3NA 5IIIA 3QXGA 5EE1A 2ASLA 3Q8SB 9ICHA 4DOAA 4F2RA 3Q8RB 3TFRA 3AL0B 5IIJA 1X9WA 3V6JA 1ZETA 2DQNB 5EWEA 4RUAA 1XSNA 5KFVA 1LKYA 2H3FA 1Z00A 4BWJA 4O3QA 4F50A 1RXVA 4F5NA 1ZQQA 3IM1A 3ZDDA 2ES6A 1BPZA 3PV8A 3KHHA 9ICKA 5ALLA 1UQVA 4ICAA 4TQSA 1NOMA 3OJUA 2A1JB 4JV2A 3MFIA 3F5EA 2LM1A 2ZIXA 8ICUA 5DQIA 2KP7A 3DV9A 4FS1A 3UM9A 2OH2A 1NK0A 3ETRA 2ZXHA 3LK9A 4YG2A 4RQ4A 5AICA 1X6JA 4ELVA 2WAQC 4EZ6A 4DQIA 4DL5A 4CF3A 3MDAA 3S6JA 2PI5A 5HP4A 5L1MA 3HP6A 4FBTA 2KSOB 4ECUA 4DL4A 1KTQA 4LJXA 4QZ9A 4YN4A 2HVIA 1V9PA 2ZTEA 3NRWA 4O9MA 2OYYA 5D49A 5B66U 1DK3A 2MSNA 4EELA 3SENA 3EUB2 4I29A 2MUTA 4LZDA 3VC8A 3C2LA 4CRXA 5ALRA 7ICLA 2PFNA 2DPJA 3V6KA 4E0DA 3KHRA 4J03A 1N61A 2KHVA 4I2EA 4QZ8A 5C5JA 2JH1A 4QZCA 5ALWA 2HHQA 3HWTA 1A76A 2KZ3A 4YXJA 1WCLA 2B6GA 2PFOA 2KG5A 4DOCA 4RQMA 2YB1A 3ALRA 2PMZF 4Y2VA 3V7LA 4KX3A 4G3IA 2EAMA 2ZJAA 2LYAA 4IRDA 5AI9A 4YMOA 2AH5A 4YP3A 4IQVA 3EYZA 2FPLA 5DB8A 2R8KA 3RJJA 4UB6U 3OHBA 1B43A 5KT3A 1ZQRA 3GIJA 5ALFA 3WK9A 8ICOA 3QX7A 3AUOA 2LYHA 2E8PA 2AJQA 2WF8A 5AM0A 3QYPA 2P6UA 4I28A 1NJYA 4TUSA 1KFDA 1D9FA 2KIVA 2RLTA 4B9VA 2KZZA 3BS5B 1ZQPA 1L7MA
chains in the Genus database with same CATH topology
4O3MA 1TAMA 4A8EA 1HIWA 2KOBA 1PVQA 2M0NA 3CRXA 1L6NA 2F8LA 1UPHA 3L3FX 2OM6A 2XVTA 1ZQ1C 3SAHA 2CRXA 3DEEA 3M7DA 1Z1BA 2DF4B 2KJ9A 2H3ZA 1Q3VA 2HBLA 2LYBA 4KX5A 3PSFA 1OUQA 1YT3A 3C28A 3NRWA 2ZIVB 2OYYA 3E0FA 3H0MB 3IN5A 2VJ5A 1URJA 4NWIA 4WJ3B 1Z19A 4NV0A 2F76X 2JHDA 2RHFA 2ZIUA 4AYBF 4BX9C 4BUGA 2GOLA 4FZLA 3IG8A 4ACOA 5C0YA 2F77X 2MRLA 2ZIXB 5T14A 3VC8A 4FZNA 4CRXA 2K89A 3PZPA 1XNSA 3HKZC 4FE3A 1F44A 3KZXA 2KNJA 2JH7A 2RRDA 2KJ5A 3PSIA 3SQIA 2XIDA 1DRGA 4FZMA 3T79A 4KMOB 4PL1A 2ZIWA 2LBOA 3N7SC 2K8CB 2W7PA 4P0QB 2BDUA 3OPXA 3M6ZA 4P0PB 3GU3A 3SMVA 1ECWA 5CRXA 2OXOA 3IG5A 1P7DA 4QIWC 3F5AA 4IC9A 4BJQA 3CP8A 3O0FA 2KHVA 2HBMA 3GZFA 4OJ6A 2VKQA 2Q4TA 2ZIVA 1T94A 3D2NA 2A3VA 2KD1A 3RFAA 1CRXA 3AL0B 2JH1A 3H0RB 4CDGA 3PSPA 2E1EA 3N7RC 2DQNB 3F2BA 3KFUF 2Y0SC 2E5SA 2HOIA 2W03A 4GFJA 2GH1A 2KIWA 2KVCA 4QNLA 2XI9A 2LHTA 2H3FA 2G08A 2KEYA 3F53A 3AQEA 2CN1A 2ZG6A 2ZXIA 2K8AA 2YB1A 3ALRA 1Q3UA 2K4IA 1MA7A 3N7PD 4OO1J 2YX8A 2R18A 2ZIUB 3AQFA 2WB1F 2YB4A 3PSTA 4P0QA 3MGVA 1NZBA 2N1RA 4CGZA 1ED1A 4OJOA 2PMZF 2K4HA 2LKYA 4NLBA 1PVRA 3LVWA 1D8BA 4ICAA 4KX3A 4AYBC 2JMGA 2MA1A 1XO0A 2G0AA 2LYAA 2RP5A 3SAGA 2VIXA 5KL8B 3VCBA 4U6PA 3HKZF 2WAQF 3RF9A 3F5EA 2Z7JA 3K1ZA 2H3QA 1GO3F 2NV3A 2KKPA 2DGZA 2HMXA 2XICA 3M6KA 2ZIXA 2G07A 4OJPA 3LYSA 1PVPA 2D6FC 1A0PA 5A0LA 2G5HB 2HBJA 4OJLA 4QJFB 2H3IA 1KBUA 2VJ4A 1HEKA 3D2SA 2G06A 2CPRA 2K4EA 3CYMA 2KJ8A 4U7CA 4QIWF 2OH2A 2WB1C 5HR7A 2W7OA 2KICA 1A6SA 2ZXHA 4JMUA 3D2QA 3NUQA 2F2AB 2KV2A 2PMZC 4P0PA 2HBKA 3H0LB 2G09A 1IIPA 2JGAA 4NLCA 3ICXA 4PL2A 4C0ZA 1SZHA 5KL1B 2W04A 2HOQA 3SAFA 3F2CA 3F2DA 2KKVA 2KHQA 2HOFA 2K8BB 2G5IB 3ONNA 2WAQC 3IP4B 4OJ5A 3C29A 2H3VA 3LVVA 2E1FA 5HR6A 1WUDA 2Y0SF 2ZIWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQE A;  3N7R C;  3N7P D;  2YX8 A;  3AQF A;  2XVT A;  3N7S C; 
#chains in the Genus database with same CATH topology
 5KFL A;  3I76 A;  1HIW A;  2M0N A;  3JPR A;  1L6N A;  1UA1 A;  1TK5 A;  4K4G A;  3SAH A;  3KOO A;  4EEN A;  3C2M A;  1Q3V A;  1S0V A;  2GWS A;  5KFF A;  1S0N A;  2DPI A;  2FPM A;  3E0F A;  3QUT A;  5AM1 A;  1SV0 A;  4Q43 A;  3AM9 A;  4BUG A;  4FZL A;  4B9M A;  3GQC A;  3AN1 A;  2W3R A;  1OXJ A;  3HKZ C;  2YQE A;  3TAD A;  2AGQ A;  5G5G A;  3T5H A;  3N7S C;  2K8C B;  5D46 A;  2BDU A;  4P0Q B;  2BQU A;  1T8E A;  1ZQO A;  2LM4 A;  3PNC A;  2OXO A;  3WKA A;  3GV8 B;  4DOB A;  8ICY A;  2IHN A;  4JV1 A;  3V7K A;  2Q4T A;  2ZIV A;  4PZO A;  2WHE A;  2V4Q A;  4DF4 A;  3QU9 A;  1J2N A;  1Z4N A;  1K1S A;  2XI9 A;  3V72 A;  3SR6 A;  3RH5 A;  2EH9 A;  2KTQ A;  2K8A A;  4XRH A;  4F3O A;  3QUQ A;  3QUB A;  4QWE A;  1PVR A;  3PY8 A;  4Q44 A;  5J0W A;  4C8N A;  5CJ7 A;  3GIK A;  3VCB A;  2WAQ F;  1ZOL A;  4F91 B;  4F4W A;  3PX0 A;  2UVV A;  1HEK A;  2DKZ A;  1SV4 A;  4R66 A;  5DB6 A;  1MSW D;  2ESE A;  4UAW A;  1MQ3 A;  1N48 A;  1A6S A;  5ALM A;  3U26 A;  4UAZ A;  1N60 A;  4C0Z A;  4PL2 A;  5F3X B;  2HOQ A;  2F8K A;  4C7Y A;  4DEZ A;  2G5I B;  3IDW A;  5B5E U;  1RYR A;  3QZ7 A;  1NK9 A;  2R8H A;  4DL7 A;  2W9C B;  4C8O A;  2IOF A;  2CRX A;  5KFK A;  2BZF A;  2W3S A;  1RM6 C;  1KL9 A;  4M9N A;  3C28 A;  2XY7 A;  5J0Q A;  2W9M A;  5J2I A;  2HHV A;  5KFW A;  5CB1 A;  5BOM A;  3RH6 A;  4BGD A;  3RTV A;  8ICX A;  5KG3 A;  1U47 A;  1X6I A;  2AHO B;  2J6U A;  8ICT A;  5EE0 A;  1N62 A;  4TUR A;  4I2F A;  5JUM A;  5ALH A;  3M8S A;  5AKG A;  3WKD A;  9ICE A;  1FO4 A;  1BNO A;  1ZJN A;  1QSL A;  4GC6 A;  1SGG A;  1MC8 A;  3CP8 A;  2HBM A;  3H40 A;  2WF7 A;  2A3V A;  3C5F A;  4CDG A;  5ALI A;  2Y9T A;  1S9F A;  5KG1 A;  1TFR A;  2RDJ A;  4MEX A;  3KHL A;  5ALO A;  3THV A;  3WK4 A;  8ICJ A;  2UVW A;  2OCE A;  4YR3 A;  2K4I A;  5AK3 A;  9ICO A;  3NS1 A;  4YQW A;  4OJO A;  5AKX A;  4Z6E A;  2LKY A;  1MQ2 A;  3WK7 A;  2ASD A;  2CXY A;  3TFS A;  3C1Z A;  4PJ0 U;  5ALJ A;  4FBU A;  7ICE A;  4RNO A;  4BDP A;  4RPX A;  2AU0 A;  3QU2 A;  4CCH A;  2G5H B;  2VJ4 A;  1LVH A;  1U9L A;  2IBK A;  1H38 A;  1FIQ A;  3CW2 C;  2JEG A;  1B22 A;  8ICA A;  1ZD4 A;  4Y2U A;  4NXZ A;  2AQ4 A;  1UA0 A;  4NLC A;  5KL1 B;  4ED3 A;  1S0M A;  4Y2Y A;  5J2J A;  4GIB A;  2FDR A;  4DQP A;  2E1F A;  1PZN A;  4O3M A;  1BPX A;  1BVS A;  1WCN A;  2W8K A;  2FMP A;  3L3F X;  2XO7 A;  5ALU A;  3M7D A;  3BQ0 A;  4PZN A;  3T5L A;  9ICR A;  9ICG A;  3OJS A;  3N28 A;  5L9X A;  2ZIU A;  1KW4 A;  5KFG A;  5C0Y A;  4KLM A;  1ZRN A;  2K60 A;  9ICA A;  1F44 A;  3UMB A;  3SQI A;  3GV7 B;  1C20 A;  4PHA A;  8ICS A;  2LBO A;  1L7O A;  9ICW A;  1ECW A;  2XGP A;  1TV9 A;  2JXJ A;  1A77 A;  4ZH4 A;  3K1R B;  4B6J A;  3WK6 A;  5ALD A;  4UW9 A;  1JX4 A;  1K5O A;  1TAU A;  1NKC A;  4TUP A;  2YML A;  2E1E A;  3N7R C;  5KFR A;  4GXJ A;  3SV3 A;  3TQ1 A;  4QZB A;  1XWL A;  3K4G A;  3B0X A;  5CEH A;  2JEI A;  3RB4 A;  1ZD3 A;  2WTF A;  3AQF A;  9ICC A;  2N1R A;  2C28 A;  1SV0 C;  4EBC A;  1D8B A;  3HJE A;  3SAG A;  1JN3 A;  2VIX A;  5DB9 A;  3G6V A;  3RF9 A;  4F4Y A;  5J8Y C;  3IRU A;  3M9O B;  2KJ8 A;  4Q8E A;  4F4X A;  2WB1 C;  5HR7 A;  3CNH A;  3C5G A;  4RPY A;  2E8O A;  3TAC B;  4P0P A;  3NVW A;  3RJG A;  3F2C A;  2VAN A;  5ALE A;  4DL6 A;  2EQY A;  3NAS A;  4NLK A;  2A19 A;  1F0M A;  2Y0S F;  1YZ6 A;  4UAY A;  2ZIW B;  3SZ2 A;  4DQR A;  1S5L U;  2QB0 A;  5AK5 A;  1UPH A;  3GDX A;  1N5W A;  3DEE A;  5JTI A;  2E3T A;  3ZD9 A;  3RRH A;  1HUO A;  5J0X A;  1DK2 A;  5DGA A;  1WWV A;  4WJ3 B;  2JHD A;  1SL1 A;  4Y2Q A;  4ED2 A;  4ACO A;  2C22 A;  5DBB A;  1CEZ A;  1UCV A;  3HT3 A;  4R65 A;  4JV0 A;  2RRD A;  3PSI A;  5ALX A;  1N2X A;  1ZD5 A;  4UB4 A;  4PL1 A;  2W7P A;  2JZB B;  5CRX A;  2ISO A;  2K4P A;  1ZQH A;  4KLL A;  2WF9 A;  2PI4 A;  2KD1 A;  2QAR A;  1L3T A;  2ODG A;  5KAI U;  7ICQ A;  1NK4 A;  1ZJM A;  4QNL A;  2KEY A;  3KTQ A;  2H5X A;  2UVR A;  4F72 A;  4F5P A;  3N7P D;  4P0Q A;  8ICM A;  3C1Y A;  2XCP A;  4MF2 A;  4IRK A;  5AKK A;  3MFH A;  3MBY A;  4DQS A;  3PX4 A;  4HAI A;  2D6F C;  3TKA A;  3AU6 A;  5KFE A;  4ECW A;  1NNL A;  4F4Z A;  2KFZ A;  5E79 U;  4KLJ A;  1Q46 A;  4ED1 A;  4EX6 A;  2KV2 A;  3PW4 A;  3ISB A;  5ALT A;  1ZQV A;  1L3S A;  2BCR A;  1KQQ A;  2W11 A;  2K8B B;  4RNN A;  2XCA A;  4O5K A;  3C29 A;  1V97 A;  1Z1B A;  1ZQ1 C;  1WYG A;  1PK1 B;  4CE6 A;  3WK5 A;  1U4B A;  3MGH A;  4NV0 A;  2RHF A;  4NLN A;  3QEB Z;  5EE9 A;  4DCC A;  5T14 A;  2IA6 A;  2JV3 A;  5J2A A;  1ZQB A;  4ED6 A;  4YMN A;  5DG9 A;  4EZ9 A;  2JR5 A;  2W9C A;  3UPQ A;  1SKW A;  3GU3 A;  2VA2 A;  9ICM A;  5ALP A;  2NRW A;  4C80 A;  1WWU A;  5KT6 A;  2ZJ8 A;  4XQ8 A;  2GO7 A;  4OD0 A;  4RZR A;  2KE7 A;  3H4B A;  3DDH A;  1RZT A;  3EWA A;  5AKH A;  1X9X A;  4F93 B;  1CI4 A;  3ETL A;  4RQ0 A;  3KFU F;  8ICL A;  4BWM A;  1XSL A;  2CN1 A;  4I2G A;  1ARO P;  2WB1 F;  5DB7 A;  2E8N A;  4IQU A;  3PX6 A;  1BPD A;  1VLB A;  1QCK A;  2JMG A;  7ICU A;  4RQ2 A;  1BPB A;  5KFZ A;  2EZZ A;  3K1Z A;  2G07 A;  1X9M A;  3RBD A;  4UAS A;  2MU2 A;  1SZP A;  5D4B A;  5AKL A;  4M9H A;  9ICF A;  3MC1 A;  5AM3 A;  1PUZ A;  3ZDE A;  3AEV A;  1NI3 A;  3H0L B;  2HVH A;  4IQW A;  1FFV A;  4J9N A;  2KHQ A;  4M6W B;  5KFS A;  2NYV A;  4YMM A;  1SKR A;  4XA5 A;  9ICP A;  5DQG A;  2OM6 A;  1XU4 A;  4PHD A;  4F8R A;  5KFT A;  1QQ5 A;  5J0O A;  1NK6 A;  4M9G A;  5CA7 A;  4ECX A;  5AM4 A;  1NK8 A;  4DFD A;  5HHH A;  5IIN A;  2NRZ A;  3C21 A;  1CUK A;  1KDH A;  4UBB A;  1FEZ A;  4IL6 U;  4MHV A;  5KFH A;  1PK3 A;  5ALG A;  2R8G A;  4DO9 A;  1N63 A;  3HX0 A;  4ELT A;  4J9Q A;  2BPC A;  5F9L A;  4I2A A;  3OSP A;  5F9N A;  5KFD A;  1N5X A;  1CRX A;  3L5K A;  4UB2 A;  7ICO A;  3QU7 A;  1NZP A;  2HOI A;  2KIW A;  4J9S A;  5J8Y A;  4FFD A;  2BHN A;  2MAX A;  2D3D A;  1T3Q A;  4DSJ A;  2KZM A;  9ICV A;  8ICW A;  4FO6 A;  5GTH U;  4DLG A;  2BQR A;  4ECT A;  2MA1 A;  4U6P A;  1QLN A;  4NM2 A;  1XS9 D;  1U48 A;  3G6Y A;  5A0L A;  4Y2S A;  1KBU A;  2AQ0 A;  4P4O A;  4EYH B;  4RT2 A;  2W7O A;  1ZQD A;  4C7Z A;  5J0P A;  2BPG A;  2EAP A;  3EW9 A;  2AXT U;  1KLN A;  1BNP A;  4ECY A;  4OJ5 A;  4KLD A;  1WUD A;  1LKY B;  3SD7 A;  4EEK A;  1Z00 B;  4RT3 A;  4QZG A;  1PVQ A;  1C7Y A;  3PO5 A;  5KG4 A;  5KFU A;  5AI5 A;  5AKZ A;  2HBL A;  2BCV A;  1SXD A;  4KX5 A;  4J9L A;  4ECR A;  2FLL A;  3PSF A;  9ICT A;  3IN5 A;  1JXE A;  4KLF A;  3Q8P B;  3SI8 A;  3JPO A;  4YFK A;  4X5V A;  2ZIX B;  3A0B U;  4BXO B;  5HML A;  5DDY A;  4ECQ A;  4Y2X A;  5J0T A;  4F5O A;  5KFA A;  2ZIW A;  3TAR A;  3LWL A;  2FJ6 A;  3IG5 A;  2HHT A;  5TZV A;  1S76 D;  3ISD A;  2O6K A;  3GZF A;  2JEJ A;  4O3O A;  4DSL A;  2BCS A;  3V7J A;  4DSF A;  1JMS A;  4JB3 A;  1ZQM A;  2A1A A;  4R63 A;  2Y0S C;  3UXN A;  4GFJ A;  1UT8 A;  2AGP A;  1ZQX A;  1ZQY A;  8ICQ A;  2YX8 A;  5IIO A;  1NKE A;  5KG6 A;  2JZB A;  4GXI A;  4MFF A;  2W43 A;  4NLB A;  8ICK A;  3GV5 B;  1Z4O A;  1COK A;  4Y2J A;  1QSY A;  4OJL A;  4Z6F A;  2WF6 A;  3D2S A;  4DFP A;  2F44 A;  1VJ5 A;  5AI4 A;  1RQN A;  2FMS A;  2EDU A;  2KVS A;  3NUQ A;  1QH9 A;  2F2A B;  2R8I A;  2JGA A;  2BPF A;  2BCQ A;  5KG7 A;  3T3F A;  2B0C A;  3N97 B;  2HOF A;  2WF5 A;  4O3R A;  4YR0 A;  2HHW A;  3IP4 B;  1YZ7 A;  5HNK A;  1ZRM A;  5J0R A;  2OWO A;  4KIT B;  4KMU A;  5ALK A;  1KKX A;  2XVT A;  7ICK A;  3RAQ A;  1J97 A;  2DKX A;  1OUQ A;  5EWF A;  3H0M B;  1S77 D;  5KFP A;  3BQ2 A;  1SKS A;  1UHU A;  4PPX A;  1L5U A;  4YR2 A;  3JPP A;  2KNJ A;  4TQR A;  1Y88 A;  4JWM A;  2A1J A;  2JRZ A;  3ZD8 A;  2ZUC A;  1ZQI A;  4C8M A;  4KLT A;  4M04 A;  2DFL A;  1P7D A;  3IHQ B;  3OTQ A;  1QQ6 A;  2BCU A;  3O0F A;  5ALQ A;  1DGJ A;  3ZDB A;  1AQ6 A;  5CHG A;  1JRP A;  3BS7 A;  5KT2 A;  3WU2 U;  1SWW A;  3ISC A;  4ED0 A;  5KFJ A;  2BQ3 A;  1B0X A;  4QZF A;  2LHT A;  2I1Q A;  1ZQZ A;  4UB5 A;  2YB4 A;  1ZQF A;  2ZUB A;  7ICN A;  2K4H A;  2KSO A;  3LVW A;  4ECZ A;  4ZOH C;  4M2Y A;  3C23 A;  1B4F A;  1ZQC A;  4EBD A;  4B9U A;  1DXS A;  4GXK A;  1X66 A;  2KKP A;  2EAN A;  2XIC A;  7ICJ A;  4F71 A;  5DKW A;  4MFC A;  1JUD A;  4U7C A;  2FLP A;  3RJK A;  5L1K A;  5AM5 A;  4PHE A;  4QZD A;  2BR0 A;  4JMU A;  5BPC A;  2PXI A;  2IHM A;  2VA8 A;  4DSI A;  1IXR A;  4NM1 A;  2DL0 A;  4JUZ A;  4YVZ A;  1KFT A;  4HYK A;  5J2E A;  3RR8 A;  2Y1I A;  4NY8 A;  1MN8 A;  1L7P A;  1KSP A;  2F8L A;  3QNM A;  4R8U B;  5ALY A;  4RQ1 A;  3AMZ A;  4Y2T A;  4UB8 U;  1OW5 A;  2HW3 A;  5J2D A;  1NJX A;  4IRC A;  5AI0 A;  4NWI A;  1Z19 A;  4C4R A;  3TAN A;  2GOL A;  3WKB A;  1IM4 A;  9ICL A;  2HCF A;  2I6X A;  4YCX A;  3T5K A;  4EBE A;  2XID A;  5JRT A;  3MDC A;  2L5Y A;  2YTU A;  4KMO B;  4RQ5 A;  3UXO A;  2BDP A;  5EWG A;  2V4R A;  2UVU A;  3M6Z A;  3SMV A;  4MEY A;  2J6T A;  3Q8M A;  4IC9 A;  2KMD A;  3BQ1 A;  1ZXI A;  4I2I A;  1RDF A;  2C2R A;  1IV8 A;  3PSP A;  5DBA A;  2XC9 A;  2LMR A;  2W03 A;  3RJI A;  4KLO A;  7ICG A;  2FI1 A;  5AK6 A;  1X40 A;  8ICN A;  3BS5 A;  1M6Y A;  1RYU A;  3F53 A;  4P2H A;  4KLG A;  1KEJ A;  1HUZ A;  4OO1 J;  2PKE A;  3MGV A;  4UAV A;  5J0Y A;  3JPN A;  1U49 A;  3A0H U;  2VA3 A;  1KN5 A;  2Z7J A;  4OJP A;  3LYS A;  4MF8 A;  3C2K A;  4O3P A;  4DFK A;  1LV5 A;  4KN4 A;  3AU2 A;  5KT7 A;  3BZC A;  5J2B A;  4QIW F;  2NO4 A;  4JWN A;  2LI6 A;  4MFA A;  2HBK A;  3UMG A;  5KFO A;  3PW7 A;  4KLS A;  1KFS A;  3SAF A;  2W04 A;  5DG7 A;  3SEI A;  4B9T A;  5AIB A;  8ICI A;  4K4H A;  5HR6 A;  2H3V A;  3LVV A;  1QSS A;  5J0S A;  1JI7 A;  5BOL A;  3KBB A;  3PO4 A;  9ICB A;  5KFM A;  2ASJ A;  2KJ9 A;  4DSE A;  3MR2 A;  3UQ2 A;  1URJ A;  5DQH A;  5DG8 A;  2ATL A;  4PGQ A;  4BX9 C;  4PHP A;  2P6R A;  2MRL A;  4UB1 A;  4B9L A;  4GLX A;  2FPK A;  2M9N A;  4DWI A;  4ECV A;  4P4M A;  5KAF U;  3H4D A;  8ICC A;  4QWD A;  3G6X A;  1S0O A;  3OPX A;  4KTQ A;  3V6H A;  1RQL A;  1X9S A;  3B9J A;  3PVX A;  5HHI A;  4DF8 A;  2HSZ A;  2C2E A;  4J9M A;  2E5S A;  4BXO A;  2XGQ A;  2GH1 A;  4O0I A;  4UAU A;  1NK7 A;  2XY5 A;  3JPQ A;  4G9B A;  3HW8 A;  1L3V A;  2YMQ A;  5GTI U;  2ZG6 A;  9ICX A;  1Q3U A;  1MA7 A;  2ZIU B;  5ALN A;  4ELU A;  4J9P A;  4CGZ A;  2ZUD A;  4US8 A;  1XO0 A;  4YD1 A;  4I27 A;  3LDA A;  3RJH A;  5L1L A;  1L3U A;  2YMP A;  8ICE A;  1PVP A;  2IOF K;  3H8W A;  2NRV A;  4RQN A;  2G06 A;  2CPR A;  4J9R A;  1N56 A;  7ICS A;  4UQG A;  2YN4 A;  4ED7 A;  2I9G A;  5AKJ A;  3M9M B;  1DOQ A;  1IIP A;  3FAH A;  2KKV A;  3MR3 A;  3ZDA A;  2KN7 A;  3NRZ A;  9ICS A;  3FDS A;  4PGY A;  5CP2 A;  4O3N A;  4AP9 A;  1O03 A;  1BPY A;  3E2E A;  3HPO A;  7ICR A;  1NK5 A;  1XO1 A;  5TIS U;  2LYB A;  5KFX A;  4XUS A;  4C8K A;  2VJ5 A;  1ZQK A;  4AYB F;  3KHG A;  4GC7 A;  3MR6 A;  1BPE A;  3PZP A;  2Q0Z X;  7ICM A;  2JH7 A;  8ICG A;  2KK0 A;  4FZM A;  3T79 A;  4CF5 A;  5DGB A;  3PML A;  1D9D A;  2GLE A;  4P0P B;  1Z1V A;  4OCZ A;  5AKE A;  5AKY A;  4NJ8 A;  2VKQ A;  2IMW P;  1TKD A;  4F92 B;  2QB0 B;  4EX7 A;  3RBE A;  4B9S A;  4KLH A;  1NJW A;  3J81 j;  2IOH A;  5AK4 A;  3UXP A;  5EE3 A;  2E8M A;  4DSK A;  3BQ7 A;  4ECS A;  2V9W A;  1COO A;  4M47 A;  1SXE A;  2NRX A;  1TVA A;  1NJZ A;  2RP5 A;  3ORY A;  5ALS A;  1GO3 F;  2H3Q A;  4O3S A;  2DGZ A;  2HMX A;  3Q8Q B;  7ICP A;  2OEH A;  1VDV A;  3H8S A;  2W9B B;  4C4T A;  3PR5 B;  4KLE A;  2KIC A;  2YY6 A;  4M0A A;  2QAR B;  4EYI B;  4Z6D A;  2BKE A;  5J2C A;  2KFN A;  1SZH A;  1SIJ A;  3KD3 A;  3OSN A;  1X2I A;  3CRX A;  5AKI A;  2HDO A;  2FLN A;  5AI8 A;  1S8O A;  1TAQ A;  2EAO A;  2J6S A;  3FM9 A;  5AI6 A;  3FYH A;  5J0U A;  4IR1 A;  3SV4 A;  1T7P A;  3EPI A;  5KFN A;  9ICN A;  2HHS A;  2DBY A;  4FZN A;  5JU5 A;  1XNS A;  3RH4 A;  4FE3 A;  1V38 A;  4K4I A;  4QWC A;  1O08 A;  4PGX A;  4F5Q A;  1JRO A;  3QUC A;  1D8L A;  3KKA A;  2NRT A;  4NL9 A;  9ICU A;  4R8U A;  2R8J A;  1ZQS A;  5AM2 A;  5J2G A;  2HI0 A;  3F5A A;  4O5C A;  4BJQ A;  3D2N A;  2I5H A;  3NVV A;  4Y2P A;  2W55 A;  4KLQ A;  1UT5 A;  3F2B A;  1X42 A;  3NVY A;  4DL2 A;  2ZXI A;  3ZI4 A;  4J9O A;  9ICI A;  8ICP A;  5ALV A;  3GFK B;  3E58 A;  3QEA Z;  5FP0 A;  4P4P A;  2YMM A;  4KLU A;  2EZY A;  3H7I A;  4DFJ A;  4DS4 A;  3JPT A;  5KFB A;  3PW0 A;  4I2H A;  3M6K A;  3RJF A;  4QJF B;  3UMC A;  1SL2 A;  3RR7 A;  1K1Q A;  2H3I A;  4YXM A;  1TE2 A;  4M9L A;  1J2M A;  4QZH A;  2K4E A;  3R9K A;  1RPL A;  2QB1 A;  2AGO A;  1Q8K A;  5KFI A;  4LVS A;  2MUT B;  3ICX A;  4NLG A;  2BGW A;  2P66 A;  5KFC A;  3Q8L A;  3I1Y A;  4UAR A;  4YD2 A;  3ONN A;  2ZJ5 A;  3SYZ A;  4IQT A;  5KTQ A;  3BDP A;  3N4M B;  1ZQL A;  4QW9 A;  4DLE A;  4I2D A;  2RDI A;  2QLT A;  7ICF A;  2ISP A;  4CF4 A;  2ZTD A;  1L8O A;  3NGD A;  3RJE A;  3IG8 A;  1KRP A;  1WG8 A;  4JK1 A;  2OHF A;  4Y2R A;  5DLF A;  1BGX T;  5CWR A;  2KJ5 A;  2WFA A;  3H8M A;  3BQT A;  5KT4 A;  3M9N B;  4FS2 A;  2Y1J A;  5G5H A;  3QZ8 A;  3RB0 A;  4F5R A;  4DS5 A;  3PMN A;  3IV6 A;  5DDM A;  1D8Y A;  4QIW C;  4RUC A;  1L7N A;  4KN7 A;  4QZI A;  4RQ3 A;  3LWM A;  1SWV A;  2EZX A;  4QWA A;  1T94 A;  3RB3 A;  3RFA A;  3GIM A;  3H0R B;  4KLI A;  2RQ5 A;  2FMQ A;  4F2S A;  1RYS A;  3NTU A;  4Z6C A;  3AQE A;  5IIK A;  3MAB A;  2P35 A;  2R18 A;  3PST A;  2W8L A;  5ALZ A;  4UBC A;  1NZB A;  1ED1 A;  1PK1 A;  2HHU A;  1TK8 A;  3WK8 A;  5IIL A;  5KNI A;  5J2F A;  3HKZ F;  4DQQ A;  3RRG A;  2NV3 A;  5DBC A;  4RPZ A;  4RNM A;  2HBJ A;  4US9 A;  1FFU A;  3BJY A;  8ICV A;  3QU5 A;  4UB3 A;  2DUY A;  3UQ0 A;  1EXN A;  3QU4 A;  1S10 A;  5EOZ A;  4DFM A;  2B21 A;  1QQ7 A;  3B0Y A;  4C4S A;  5DLG A;  3EPG A;  3PW5 A;  2PFQ A;  4F4K A;  2PFP A;  5AIA A;  4CNQ A;  4Q45 A;  1TK0 A;  1U45 A;  4O5E A;  1TAM A;  4A8E A;  3HIL A;  1JXL A;  1ZQE A;  3HRD D;  4QWB A;  1V85 A;  2DF4 B;  2H3Z A;  4RQ6 A;  5KFY A;  4USA A;  2W54 A;  1NKB A;  1LB2 B;  5KG0 A;  3OHA A;  1YT3 A;  3M8R A;  4LZG A;  2ZIV B;  3RAX A;  2F76 X;  3L4P A;  3Q8K A;  1XSP A;  5L1I A;  1HJP A;  2F77 X;  1JIH A;  3I28 A;  3NVZ A;  3WKE A;  4I2J A;  5KG2 A;  3H8J A;  1XC9 A;  2LPE A;  7ICI A;  4IR9 A;  1ZYQ A;  2FE9 A;  2ALZ A;  4I2C A;  3TAP A;  4TUQ A;  3M1Y A;  1SB3 C;  3OGU A;  4OJ6 A;  5J2K A;  4ED8 A;  7ICH A;  4RQ8 A;  3GIL A;  4QZA A;  4Q8F A;  3ED5 A;  4J9K A;  4QZE A;  5IIM A;  3EZ5 A;  3TAD C;  5KG5 A;  4RU9 A;  4M6W A;  2KVC A;  8ICZ A;  2ZTC A;  8ICH A;  2G08 A;  1ZQN A;  3ZDC A;  7ICT A;  5KFQ A;  1F5S A;  5J2H A;  1ZQG A;  1IG6 A;  1RG6 A;  3WKC A;  5L1J A;  1S97 A;  4AYB C;  2G0A A;  3T5J A;  3FC4 A;  1T4G A;  1ZD2 P;  5KL8 B;  2XY6 A;  2F1H A;  3BZK A;  4PH5 A;  3TI0 A;  3MGI A;  2HHX A;  5AHX A;  1ZQJ A;  1JAL A;  1A0P A;  3KKA C;  4NL9 C;  2DWQ A;  3MR5 A;  3CYM A;  4RQ7 A;  2NO5 A;  2W9A A;  4IS7 A;  8ICF A;  5KT5 A;  3D2Q A;  4R64 A;  2PMZ C;  2F1J A;  2F1I A;  2G09 A;  5HMM A;  1ZQU A;  3F2D A;  3KZI U;  5CR0 A;  3TAQ A;  7ICV A;  4C8L A;  1Z3E B;  2C2D A;  2F3N A;  3PR4 A;  4B9N A;  1ZQW A;  1QTM A;  2KOB A;  5H2F U;  2Y9U A;  4NLZ A;  4M9J A;  3K75 D;  1DGS A;  3RB6 A;  2QKQ A;  2W9B A;  4EEY A;  3D6J A;  8ICB A;  2D8C A;  3PW2 A;  4QW8 A;  1SL0 A;  4UAT A;  3GII A;  2JEF A;  5K4L A;  3QE9 Y;  8ICR A;  2K89 A;  5J29 A;  3KZX A;  1DRG A;  1ZQT A;  1ZQA A;  4DL3 A;  4I2B A;  3JPS A;  1RXW A;  9ICQ A;  9ICJ A;  1L8L A;  1T3N A;  5III A;  3QXG A;  5EE1 A;  2ASL A;  3Q8S B;  9ICH A;  4DOA A;  4F2R A;  3Q8R B;  3TFR A;  3AL0 B;  5IIJ A;  1X9W A;  3V6J A;  1ZET A;  2DQN B;  5EWE A;  4RUA A;  1XSN A;  5KFV A;  1LKY A;  2H3F A;  1Z00 A;  4BWJ A;  4O3Q A;  4F50 A;  1RXV A;  4F5N A;  1ZQQ A;  3IM1 A;  3ZDD A;  2ES6 A;  1BPZ A;  3PV8 A;  3KHH A;  9ICK A;  5ALL A;  1UQV A;  4ICA A;  4TQS A;  1NOM A;  3OJU A;  2A1J B;  4JV2 A;  3MFI A;  3F5E A;  2LM1 A;  2ZIX A;  8ICU A;  5DQI A;  2KP7 A;  3DV9 A;  4FS1 A;  3UM9 A;  2OH2 A;  1NK0 A;  3ETR A;  2ZXH A;  3LK9 A;  4YG2 A;  4RQ4 A;  5AIC A;  1X6J A;  4ELV A;  2WAQ C;  4EZ6 A;  4DQI A;  4DL5 A;  4CF3 A;  3MDA A;  3S6J A;  2PI5 A;  5HP4 A;  5L1M A;  3HP6 A;  4FBT A;  2KSO B;  4ECU A;  4DL4 A;  1KTQ A;  4LJX A;  4QZ9 A;  4YN4 A;  2HVI A;  1V9P A;  2ZTE A;  3NRW A;  4O9M A;  2OYY A;  5D49 A;  5B66 U;  1DK3 A;  2MSN A;  4EEL A;  3SEN A;  3EUB 2;  4I29 A;  2MUT A;  4LZD A;  3VC8 A;  3C2L A;  4CRX A;  5ALR A;  7ICL A;  2PFN A;  2DPJ A;  3V6K A;  4E0D A;  3KHR A;  4J03 A;  1N61 A;  2KHV A;  4I2E A;  4QZ8 A;  5C5J A;  2JH1 A;  4QZC A;  5ALW A;  2HHQ A;  3HWT A;  1A76 A;  2KZ3 A;  4YXJ A;  1WCL A;  2B6G A;  2PFO A;  2KG5 A;  4DOC A;  4RQM A;  2YB1 A;  3ALR A;  2PMZ F;  4Y2V A;  3V7L A;  4KX3 A;  4G3I A;  2EAM A;  2ZJA A;  2LYA A;  4IRD A;  5AI9 A;  4YMO A;  2AH5 A;  4YP3 A;  4IQV A;  3EYZ A;  2FPL A;  5DB8 A;  2R8K A;  3RJJ A;  4UB6 U;  3OHB A;  1B43 A;  5KT3 A;  1ZQR A;  3GIJ A;  5ALF A;  3WK9 A;  8ICO A;  3QX7 A;  3AUO A;  2LYH A;  2E8P A;  2AJQ A;  2WF8 A;  5AM0 A;  3QYP A;  2P6U A;  4I28 A;  1NJY A;  4TUS A;  1KFD A;  1D9F A;  2KIV A;  2RLT A;  4B9V A;  2KZZ A;  3BS5 B;  1ZQP A;  1L7M A; 
#chains in the Genus database with same CATH homology
 4O3M A;  1TAM A;  4A8E A;  1HIW A;  2KOB A;  1PVQ A;  2M0N A;  3CRX A;  1L6N A;  2F8L A;  1UPH A;  3L3F X;  2OM6 A;  2XVT A;  1ZQ1 C;  3SAH A;  2CRX A;  3DEE A;  3M7D A;  1Z1B A;  2DF4 B;  2KJ9 A;  2H3Z A;  1Q3V A;  2HBL A;  2LYB A;  4KX5 A;  3PSF A;  1OUQ A;  1YT3 A;  3C28 A;  3NRW A;  2ZIV B;  2OYY A;  3E0F A;  3H0M B;  3IN5 A;  2VJ5 A;  1URJ A;  4NWI A;  4WJ3 B;  1Z19 A;  4NV0 A;  2F76 X;  2JHD A;  2RHF A;  2ZIU A;  4AYB F;  4BX9 C;  4BUG A;  2GOL A;  4FZL A;  3IG8 A;  4ACO A;  5C0Y A;  2F77 X;  2MRL A;  2ZIX B;  5T14 A;  3VC8 A;  4FZN A;  4CRX A;  2K89 A;  3PZP A;  1XNS A;  3HKZ C;  4FE3 A;  1F44 A;  3KZX A;  2KNJ A;  2JH7 A;  2RRD A;  2KJ5 A;  3PSI A;  3SQI A;  2XID A;  1DRG A;  4FZM A;  3T79 A;  4KMO B;  4PL1 A;  2ZIW A;  2LBO A;  3N7S C;  2K8C B;  2W7P A;  4P0Q B;  2BDU A;  3OPX A;  3M6Z A;  4P0P B;  3GU3 A;  3SMV A;  1ECW A;  5CRX A;  2OXO A;  3IG5 A;  1P7D A;  4QIW C;  3F5A A;  4IC9 A;  4BJQ A;  3CP8 A;  3O0F A;  2KHV A;  2HBM A;  3GZF A;  4OJ6 A;  2VKQ A;  2Q4T A;  2ZIV A;  1T94 A;  3D2N A;  2A3V A;  2KD1 A;  3RFA A;  1CRX A;  3AL0 B;  2JH1 A;  3H0R B;  4CDG A;  3PSP A;  2E1E A;  3N7R C;  2DQN B;  3F2B A;  3KFU F;  2Y0S C;  2E5S A;  2HOI A;  2W03 A;  4GFJ A;  2GH1 A;  2KIW A;  2KVC A;  4QNL A;  2XI9 A;  2LHT A;  2H3F A;  2G08 A;  2KEY A;  3F53 A;  3AQE A;  2CN1 A;  2ZG6 A;  2ZXI A;  2K8A A;  2YB1 A;  3ALR A;  1Q3U A;  2K4I A;  1MA7 A;  3N7P D;  4OO1 J;  2YX8 A;  2R18 A;  2ZIU B;  3AQF A;  2WB1 F;  2YB4 A;  3PST A;  4P0Q A;  3MGV A;  1NZB A;  2N1R A;  4CGZ A;  1ED1 A;  4OJO A;  2PMZ F;  2K4H A;  2LKY A;  4NLB A;  1PVR A;  3LVW A;  1D8B A;  4ICA A;  4KX3 A;  4AYB C;  2JMG A;  2MA1 A;  1XO0 A;  2G0A A;  2LYA A;  2RP5 A;  3SAG A;  2VIX A;  5KL8 B;  3VCB A;  4U6P A;  3HKZ F;  2WAQ F;  3RF9 A;  3F5E A;  2Z7J A;  3K1Z A;  2H3Q A;  1GO3 F;  2NV3 A;  2KKP A;  2DGZ A;  2HMX A;  2XIC A;  3M6K A;  2ZIX A;  2G07 A;  4OJP A;  3LYS A;  1PVP A;  2D6F C;  1A0P A;  5A0L A;  2G5H B;  2HBJ A;  4OJL A;  4QJF B;  2H3I A;  1KBU A;  2VJ4 A;  1HEK A;  3D2S A;  2G06 A;  2CPR A;  2K4E A;  3CYM A;  2KJ8 A;  4U7C A;  4QIW F;  2OH2 A;  2WB1 C;  5HR7 A;  2W7O A;  2KIC A;  1A6S A;  2ZXH A;  4JMU A;  3D2Q A;  3NUQ A;  2F2A B;  2KV2 A;  2PMZ C;  4P0P A;  2HBK A;  3H0L B;  2G09 A;  1IIP A;  2JGA A;  4NLC A;  3ICX A;  4PL2 A;  4C0Z A;  1SZH A;  5KL1 B;  2W04 A;  2HOQ A;  3SAF A;  3F2C A;  3F2D A;  2KKV A;  2KHQ A;  2HOF A;  2K8B B;  2G5I B;  3ONN A;  2WAQ C;  3IP4 B;  4OJ5 A;  3C29 A;  2H3V A;  3LVV A;  2E1F A;  5HR6 A;  1WUD A;  2Y0S F;  2ZIW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...