3AQFA

Crystal structure of the human crlr/ramp2 extracellular complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
GTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor activity-modifying protein 2
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/membrane protein
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqfA00
3N7PD 3AQEA 2XVTA 3AQFA 2YX8A 3N7RC 3N7SC
chains in the Genus database with same CATH superfamily
3GFKB 5ALJA 1NKEA 2PMZC 3KZIU 1L3UA 3H40A 4F3OA 1ZD2P 5KFEA 3KD3A 2OHFA 4YR2A 1F5SA 3HKZF 2XIDA 9ICXA 4FFDA 4RPZA 2WAQC 1A76A 1ZJMA 1NKCA 4AYBF 4HAIA 1NOMA 8ICMA 3H8MA 2F1HA 5ALHA 1ZQXA 4Y2XA 3AM9A 4M9HA 5D4BA 3PZPA 3G6VA 1QH9A 3OPXA 5CP2A 4DOBA 2E8PA 4DEZA 3K75D 4PPXA 2EANA 3LVWA 4AP9A 4EELA 2KHVA 4OCZA 4IC9A 4MEYA 2HW3A 2JMGA 1TAUA 4RPXA 4EX7A 2XY6A 4EZ6A 3E0FA 4M47A 2ATLA 4FZMA 1PK1B 5EE0A 4Q8EA 2XI9A 4OJPA 3QU7A 3RF9A 3N4MB 1SL1A 3T5LA 4ECVA 1Z00B 1F0MA 2PFPA 1OXJA 1SV0A 5DG7A 2M9NA 2EH9A 2OEHA 4J9LA 5J0PA 3V72A 2KV2A 5DB9A 2KD1A 3BQTA 2E1EA 3PV8A 3MR3A 2BCRA 4NLKA 1QSYA 8ICUA 3BS5A 4Y2JA 5GTHU 2A19A 2W55A 5DBAA 1IIPA 5KFYA 2R8GA 2QKQA 2WB1F 3TKAA 3C1ZA 2C22A 2ZIXB 4WJ3B 3MDAA 1BPBA 3NGDA 2DQNB 2ZG6A 2FMQA 4J9MA 2AQ0A 3WK4A 3WU2U 5EE1A 5AIBA 5TZVA 4O0IA 3WKCA 4NWIA 4F2RA 1SL0A 2F3NA 2WAQF 7ICPA 4UAWA 3M9NB 3C2KA 3S6JA 4Y2SA 3UMBA 2HBKA 3ISCA 3LWMA 4KLEA 4RNNA 3MR5A 3SAFA 2C2RA 2DUYA 4Y2PA 5KAIU 2HHWA 3KHHA 5AK4A 2WF8A 4Q44A 2N1RA 5L9XA 2D6FC 5AKEA 3QYPA 2QB0B 5IINA 2PXIA 2JH1A 4ECSA 4GC6A 2FE9A 2EAPA 2W9AA 3CP8A 4IRKA 2FLPA 4JWNA 9ICCA 2QARA 3TACB 4K4IA 3B9JA 5IIMA 2K8BB 2NYVA 2ZIUB 1CEZA 8ICOA 4TUQA 7ICFA 4QWAA 3A0BU 3UM9A 5AK5A 5AKIA 1NK5A 1L5UA 4I2DA 4I2GA 3GV7B 1WWUA 1S8OA 5IILA 3BQ0A 1SKRA 1A6SA 4RZRA 2EDUA 4C4RA 5KT4A 1X9MA 2G09A 2MSNA 2MUTA 1N60A 2ASJA 3L3FX 1K1SA 3N28A 2LYHA 4F4XA 4ECTA 3IG5A 3C28A 5ALGA 4EBDA 5KFZA 1U47A 3RRHA 5DKWA 4KITB 4DFJA 2K8CB 4DQQA 8ICZA 2K4HA 3KKAC 2BCSA 3V6HA 4ECQA 2C2DA 3AMZA 2UVRA 2CN1A 4NLBA 5ALEA 3GZFA 2UVVA 2WF7A 4O9MA 3M7DA 1V85A 3N7RC 3N7SC 5J2EA 2HSZA 4F93B 1KQQA 3PR4A 5J2GA 2RHFA 1U48A 2AGQA 3ZD8A 1X9WA 3BQ1A 3A0HU 2LHTA 4UATA 3WKAA 4KX3A 5EWFA 9ICFA 2Q4TA 9ICQA 2OCEA 7ICMA 4XRHA 5J2AA 3CNHA 3MGHA 1XO0A 1KSPA 2FMPA 2NRTA 4QZDA 4YD2A 3PX0A 3PW0A 3CW2C 1RYUA 4BXOB 3Q8KA 3D6JA 1RM6C 2W7OA 2HVIA 5IIJA 1PK1A 4O3RA 1RYRA 1PZNA 4JV0A 4IRDA 1XSNA 4RU9A 3TFRA 2Y0SF 2LKYA 3VC8A 4J9QA 2YB4A 3D2QA 5AKJA 1Z00A 4YCXA 1SL2A 1F44A 1KKXA 3LVVA 3WK7A 4BUGA 8ICLA 2RLTA 4MFFA 4I2CA 4ECRA 3RB0A 2BGWA 3PSTA 3MR6A 8ICBA 3RR7A 3UXOA 3ZI4A 4NLCA 3D2NA 2ESEA 4KLSA 3KOOA 5DBCA 3MFHA 2VJ5A 5CEHA 2W11A 3WKDA 1QSLA 4DLGA 4ECYA 2J6TA 2EZZA 2B21A 1T7PA 1S0OA 4GFJA 8ICQA 3GV8B 2ISOA 2F8KA 1YZ6A 1DOQA 2E8NA 4EENA 1TAMA 4CDGA 3TANA 1S0NA 3Q8RB 1ZQCA 3BQ2A 5FP0A 1ZQNA 1IG6A 2KIVA 2NRWA 5DDMA 1ZQMA 2ZIVB 1L7MA 3MGVA 5KFTA 1N2XA 1ZQTA 5HR7A 1YT3A 2VJ4A 1Z3EB 4BWMA 4DQIA 2OH2A 3LWLA 3UMGA 1B4FA 2XC9A 5J8YA 4YFKA 3ETRA 4UW9A 2K60A 1MQ2A 1JRPA 5DG8A 4DL3A 5AM1A 1TK8A 2KE7A 4J9KA 2F2AB 2QB0A 2LYBA 3C5FA 1PVRA 5L1MA 1UT5A 2HI0A 1ZQRA 4NM2A 3LYSA 4QWEA 4QZ8A 2F1JA 1JI7A 1ZXIA 1U49A 2G08A 4P0QB 4C80A 3RH6A 1D9DA 5CB1A 5IIKA 1SXEA 2LI6A 4ED3A 2ZIUA 4GIBA 1TE2A 5KT5A 4DQSA 3GDXA 4Y2VA 2BPFA 4US9A 3I1YA 4DFKA 4PHPA 4PHDA 3SAGA 1NK4A 2ES6A 4DFMA 5ALDA 4NLNA 3SQIA 2B6GA 2EZYA 3HX0A 2ZTCA 4I2FA 3Q8MA 2HHVA 2R18A 5D46A 2YTUA 3HJEA 1WCLA 3C2LA 4I2BA 3UXNA 3UPQA 3NRWA 4QIWC 2BCQA 3PMNA 4ECXA 3AU6A 3O0FA 3PX4A 1RYSA 4Y2QA 5KFVA 2UVUA 3RBEA 1K5OA 4MF2A 4Y2TA 3ICXA 5CWRA 2RDJA 2OYYA 4B9TA 7ICQA 3IRUA 4QZEA 2KJ5A 2DGZA 3BDPA 3F53A 4IRCA 5F9NA 3C1YA 4RQ0A 3NASA 3AUOA 3SMVA 3PSIA 2KG5A 3MABA 5KFMA 2QLTA 1TKDA 1VLBA 4DS4A 1NJWA 2HHTA 4IQUA 3NTUA 4OJ6A 4G3IA 1UA1A 3BJYA 3HKZC 3T5HA 2GO7A 3Q8SB 5KFNA 1QQ7A 1RXVA 4QZBA 3PW5A 4FE3A 2AH5A 3G6YA 4YR3A 4DWIA 1RPLA 1S9FA 5AKHA 4YQWA 4KLDA 1CRXA 2R8JA 2P35A 1XO1A 5KFDA 5DBBA 1JROA 2HHUA 4F71A 1D8LA 4BXOA 3TAQA 3ZDAA 1UCVA 2KVCA 3NRZA 3IM1A 2DL0A 2DFLA 1JXLA 4UAUA 5AKYA 4DQPA 4ED0A 5KG3A 5L1IA 3MC1A 3KKAA 4M0AA 4CF4A 7ICEA 2H3ZA 5IIOA 3PW4A 3JPTA 2XVTA 4F72A 2ZJAA 1A0PA 9ICBA 4KMUA 2JV3A 5AM0A 3B0XA 4DOCA 5KG5A 4KLHA 2W43A 4Z6CA 1COKA 4GLXA 4QIWF 4YN4A 2IOHA 3RB3A 3THVA 4ICAA 3C2MA 1QSSA 5J0SA 2YQEA 1L8LA 1MC8A 4KLUA 4NM1A 4KLTA 1UA0A 2WTFA 4BWJA 4IQVA 4ELTA 8ICVA 3M8SA 4LJXA 1KFSA 1N56A 8ICNA 2IHMA 4CNQA 4Q45A 1S0MA 1S0VA 1AROP 2JEJA 2ZIVA 2HCFA 2K4IA 3FDSA 1ZYQA 2KJ9A 3PO5A 1ZQQA 1ZJNA 2R8KA 4UB8U 4RQMA 2LBOA 2BCVA 3PNCA 1A77A 3OHAA 3Q8QB 2W3SA 5HMLA 5BPCA 2EAOA 2DKXA 7ICJA 3QEBZ 1CUKA 1NNLA 4R65A 4I2JA 3OSPA 2BQ3A 3RR8A 4USAA 5KFUA 1KDHA 5KFWA 2ZIWB 1Z19A 2YY6A 3IDWA 4P0QA 1K1QA 5AI0A 5DGBA 3PW2A 1SGGA 2GWSA 1V38A 1B0XA 4KN7A 2A3VA 4EYHB 1ZQAA 5AM5A 4NLZA 4UB3A 3BQ7A 1TK5A 4CF3A 4O3MA 4X5VA 4HYKA 4PZNA 3MR2A 2FLLA 4OJ5A 2KK0A 3IN5A 3N97B 2B0CA 4QNLA 9ICLA 2P6UA 4DSFA 3ZDCA 1T3QA 4ED2A 5DLGA 4B9UA 3QX7A 1HJPA 4DQRA 4PL1A 5ALTA 4YD1A 7ICLA 1ZQOA 1XC9A 4B9SA 2V4RA 2C2EA 8ICFA 5CRXA 3SV3A 2Y1JA 4PHEA 5KG0A 4RNOA 1DGSA 2IOFA 2JEGA 2FPLA 3ZD9A 4F5RA 1TFRA 1NZBA 4KLFA 3OSNA 5KAFU 2XGQA 2XCPA 2ASDA 4QZGA 4RQ5A 4C8OA 4P4MA 4Z6FA 3WKBA 5KT7A 4YMNA 1SZHA 7ICOA 4FBTA 4I2EA 2VA2A 4I28A 3ED5A 3RAXA 4RQ2A 3OGUA 3FAHA 2YX8A 2HOIA 3JPOA 3LDAA 1IXRA 2R8IA 3NVYA 4U6PA 1ZD5A 3SEIA 3KTQA 1OW5A 4DSLA 2L5YA 4DSKA 1T4GA 5KT3A 4JWMA 4RUAA 3AL0B 3KBBA 5J0RA 4JB3A 5C0YA 3QZ8A 1PUZA 3CYMA 2G07A 2XGPA 1X6IA 4F8RA 4KX5A 2BQUA 2EZXA 4EEYA 3ISBA 4UB1A 8ICGA 1T3NA 1ZRMA 1ZQJA 2Y0SC 2AU0A 4DO9A 3ALRA 5KG2A 1XS9D 2PFOA 2H3IA 1HIWA 3RJHA 4F50A 3KHRA 1WG8A 2LPEA 5G5GA 1JALA 5KG1A 2XY5A 5CR0A 2JRZA 3PX6A 1FFVA 1KFTA 3ISDA 2AHOB 3QZ7A 4MEXA 1FIQA 1T8EA 1M6YA 2DBYA 5DG9A 2KP7A 5ALLA 1L3SA 4DOAA 3N7PD 2Q0ZX 9ICGA 4FS2A 5AK3A 1Q8KA 4KLMA 4J9SA 4YG2A 1N61A 4TURA 2RDIA 4KMOB 1BPDA 5ALOA 1S10A 3JPSA 5J2IA 5J2KA 2LYAA 3H4DA 4DFDA 5KFGA 1ZQUA 1ZRNA 2V4QA 5J0XA 2O6KA 1X42A 1BVSA 4QZ9A 5DGAA 2YMPA 5ALYA 3IG8A 2IBKA 3RJGA 1RDFA 2RQ5A 2PFNA 3UXPA 3H4BA 9ICSA 4RUCA 1RQNA 3QXGA 5AHXA 4OJLA 3TADC 3KFUF 5AK6A 1U45A 2PFQA 3AQFA 8ICTA 4LVSA 1QQ6A 3GIIA 1ZOLA 2KZMA 2YMLA 1U9LA 3ORYA 1AQ6A 4IS7A 1ZQGA 5CJ7A 3GIKA 4YMMA 2ZIWA 5DLFA 5J2HA 5BOLA 1YZ7A 5BOMA 3C5GA 2ZTEA 3H7IA 2W3RA 3WK8A 3KZXA 4MHVA 4BGDA 4RPYA 4ELVA 3DEEA 1LV5A 4ED8A 7ICUA 4PJ0U 2HVHA 1BPEA 2Y9TA 4K4HA 2G0AA 2BHNA 5L1JA 3T79A 4M6WB 3GIJA 2FPKA 1J97A 1J2NA 2VA8A 3C21A 5ALFA 4UAVA 2RRDA 2HHXA 3SD7A 5KFCA 3JPQA 1L3TA 4M9GA 5AM2A 3PMLA 2ZXIA 4GXJA 4B9VA 9ICKA 7ICVA 2IHNA 4XQ8A 4UAYA 2VA3A 2NV3A 1SXDA 3F2DA 5AI5A 5KFJA 1JX4A 3RJIA 5AM4A 4J9PA 3IV6A 1KLNA 5KFBA 4LZDA 5AM3A 3M1YA 1NK7A 1MA7A 2H3QA 4YMOA 4FZNA 3HPOA 4M9NA 1Q46A 2WHEA 2K4PA 5DDYA 5K4LA 2XCAA 3QE9Y 5J29A 2H3VA 1ZQYA 4IQWA 3SYZA 4DL6A 4PHAA 4U7CA 2E3TA 4YR0A 3Q8LA 9ICJA 5ALVA 2YMMA 1QCKA 3M8RA 5DQGA 1QLNA 4DSIA 3V7JA 5KFAA 4C4TA 1N5WA 3QUBA 1X40A 4JUZA 2E8MA 1D9FA 3CRXA 1T94A 5AI6A 1SZPA 1V9PA 2F77X 2JGAA 2WFAA 2KIWA 8ICKA 4RQNA 2NO4A 1UT8A 1NK9A 5AKXA 1LVHA 5ALIA 5EWGA 4P0PB 4QWCA 3V7LA 2UVWA 3JPRA 1DGJA 3QUQA 1PVQA 4QW9A 1OUQA 4XUSA 4RQ7A 5AKGA 8ICYA 3F2CA 5G5HA 1SKWA 5KNIA 5KFQA 2BPGA 3QU4A 3J81j 2PI5A 5J0UA 2LM1A 2KOBA 2BPCA 3T3FA 2JEFA 5KFPA 1NJZA 4QZHA 4PL2A 4DSJA 1D8BA 1WUDA 2DWQA 3OTQA 2V9WA 4J03A 2W9BB 2HBMA 1XSPA 1UPHA 5AI8A 4PGXA 2MRLA 3UQ2A 5L1LA 1MN8A 4K4GA 3FC4A 5KL8B 3JPPA 4QZAA 8ICRA 1BNOA 1JXEA 3RTVA 4F2SA 1KL9A 3H0MB 1COOA 2KNJA 1FFUA 2YN4A 2AXTU 3H8JA 2Y9UA 5ALWA 4C7ZA 4MF8A 3K4GA 4B9MA 2GLEA 3K1RB 3EZ5A 4O5EA 2F1IA 5F3XB 4B9NA 3BZCA 3RAQA 1ED1A 5KFOA 4CE6A 3KHGA 1FEZA 2HMXA 4NLGA 2XICA 9ICIA 1J2MA 2W8LA 7ICNA 2ASLA 1EXNA 4PGQA 4P2HA 4ZOHC 2ZUCA 4TUPA 9ICVA 2ALZA 3PW7A 4M6WA 4ED6A 1H38A 2KICA 1XNSA 3I28A 1DK3A 2WF6A 1ZQLA 3PSPA 5AKLA 4Y2UA 2QB1A 4GC7A 2JR5A 3H0LB 4C7YA 4O3PA 4M2YA 5DB8A 2MU2A 4UAZA 7ICHA 3WK9A 5DQHA 3DDHA 7ICSA 3TADA 4R63A 2RP5A 4I27A 4EYIB 2KEYA 2OWOA 3BZKA 3QU2A 8ICWA 3KHLA 4F5QA 2PI4A 4UB2A 1NKBA 8ICHA 1RG6A 1SWWA 3EWAA 4IR1A 2H3FA 1U4BA 1L7OA 3NVZA 3NUQA 4YVZA 4FBUA 3H8SA 4QW8A 1IM4A 5ALKA 1L3VA 1C20A 2NRZA 1RZTA 3M6ZA 3V6KA 4YP3A 3M9MB 2EQYA 1ZETA 4TUSA 4M04A 5GTIU 2H5XA 1GO3F 1ZQKA 2KFNA 4QWDA 2GOLA 2P6RA 1Q3VA 3MDCA 1KN5A 2KZZA 4Q43A 5KFRA 2I9GA 4B9LA 9ICHA 1XWLA 2KSOB 4UB5A 4TQSA 4DLEA 7ICRA 3RFAA 4NL9C 5C5JA 4RT3A 4EBEA 1ZQDA 3GV5B 3RH5A 2LMRA 2LM4A 1P7DA 5ALUA 3RJJA 1SV4A 1JIHA 8ICIA 1SB3C 5KFHA 3F5AA 4P0PA 3E2EA 5EWEA 2VANA 4C4SA 2MAXA 2YB1A 7ICTA 1SKSA 1DK2A 3T5JA 1SIJA 4PGYA 1ZQWA 4FO6A 4ECWA 2FLNA 1BGXT 3MGIA 2C28A 5DB7A 3MBYA 3PVXA 1NJXA 1ZQ1C 3OJSA 2W03A 2FPMA 1UQVA 5DB6A 5J0YA 4C8MA 3RB6A 3SR6A 3NVWA 3OJUA 4KLLA 3ZDDA 1Z1BA 2W9MA 1HEKA 5HP4A 2JEIA 2ZUDA 5J0TA 2W9BA 3H0RB 4ECUA 4F4KA 5J8YC 1ZQZA 8ICEA 4KLIA 3QU9A 9ICTA 2OM6A 4P4OA 4QZCA 1ZQBA 4OD0A 3GU3A 3H8WA 5HMMA 2BQRA 2A1AA 5B66U 2AJQA 3WK5A 1ZD4A 1NJYA 3RJEA 4EZ9A 3L5KA 4UB4A 5CHGA 4C8LA 3AEVA 5EOZA 4DL7A 1ZQIA 4ZH4A 1NK0A 5KFIA 3EPIA 4CGZA 4DL5A 3SI8A 5HNKA 1XSLA 3EYZA 2HHQA 2BDUA 4DCCA 2K8AA 4ED7A 9ICWA 2PMZF 5EE3A 2HBJA 1N48A 1PK3A 2W04A 4UBBA 4O3OA 4KLQA 4F5PA 3IHQB 1X66A 1FO4A 3QUTA 4LZGA 5J2JA 2JXJA 1QQ5A 2M0NA 3VCBA 4F4YA 3TI0A 5AI4A 4KLOA 3AQEA 1RXWA 2W9CB 3SZ2A 4Z6DA 2KKPA 3TQ1A 5AI9A 3RBDA 5J2BA 5ALZA 5F9LA 4NV0A 3PR5B 2DF4B 2ODGA 1Y88A 3G6XA 4P4PA 4I2HA 3PY8A 3QNMA 3PO4A 5KG6A 2E8OA 3GQCA 2KHQA 2F8LA 2DPJA 4O5CA 1X9XA 5KFLA 4CRXA 3ZDBA 2JZBB 2XY7A 2I1QA 2IMWP 3U26A 2ZXHA 1VDVA 2FJ6A 3HT3A 9ICOA 2FI1A 2PKEA 1JUDA 4J9NA 9ICNA 4UQGA 1S76D 1Q3UA 2P66A 5TISU 8ICJA 4M9JA 2D3DA 1O08A 2XO7A 3Q8PB 1V97A 5KFKA 2FDRA 3OHBA 5KFXA 1BPYA 3TARA 3LK9A 2G06A 1N63A 4XA5A 1TAQA 4F92B 1L8OA 4R64A 4DF4A 2HDOA 4ELUA 2J6SA 2ZTDA 4MFCA 4C8KA 5L1KA 4R8UA 4O3SA 1LKYB 2ZUBA 4Y2RA 2NRVA 3AU2A 3F5EA 5KT2A 4DF8A 4MFAA 3SV4A 1JN3A 3TAPA 1D8YA 2KSOA 3GILA 4F4ZA 2CRXA 2F44A 4DFPA 3MFIA 5J0WA 5KG7A 4RQ8A 4QWBA 2W7PA 3QUCA 1WWVA 4KLJA 2I5HA 4M9LA 2KJ8A 2DKZA 4F91B 4Q8FA 7ICKA 7ICGA 4O5KA 4CCHA 1HUZA 3BS7A 4RT2A 2G5HB 2BKEA 3WK6A 4QZIA 1NK8A 3RJKA 5HHIA 3RH4A 1ZQSA 9ICRA 1LB2B 4UBCA 1ZQPA 1B22A 4JK1A 2A1JB 4UB6U 3NVVA 3C23A 5KFSA 1SWVA 5JU5A 1TVAA 4I2IA 2AGPA 4Z6EA 4JV2A 4PH5A 4EBCA 4C0ZA 4F5NA 9ICUA 1WCNA 1VJ5A 1X9SA 1KW4A 1MQ3A 4J9RA 5ALNA 3C29A 4A8EA 2E5SA 5JUMA 4R66A 8ICXA 3SENA 1NZPA 5ALXA 4OJOA 2HOFA 4RQ4A 2K4EA 4NL9A 4CF5A 4IL6U 2ZJ5A 3NS1A 4DL4A 3DV9A 4RNMA 2KTQA 2AQ4A 2KKVA 9ICMA 3EPGA 2CPRA 1WYGA 5AKKA 4US8A 1Z4OA 5T14A 5KTQA 3QEAZ 2ZIXA 1N5XA 2NRXA 3RRGA 4RQ3A 4YXJA 5KT6A 3L4PA 2KMDA 4IQTA 5H2FU 2JHDA 8ICPA 3QU5A 4GXKA 4BDPA 5DQIA 5ALRA 5KL1B 3T5KA 1RQLA 2DPIA 1HUOA 2VKQA 4DS5A 3M6KA 4JMUA 2HBLA 1SV0C 4F5OA 4FS1A 4NY8A 5B5EU 5CA7A 1TK0A 4Y2YA 1ZQVA 4EX6A 4G9BA 2W9CA 4E0DA 1KBUA 4KN4A 9ICAA 3GIMA 3PSFA 1B43A 9ICPA 5AICA 8ICAA 5ALPA 1N62A 3RJFA 3ETLA 3E58A 4UARA 3TFSA 8ICSA 2Z7JA 3EW9A 5KG4A 4YXMA 1DRGA 3HWTA 3V7KA 1DXSA 1KFDA 2JZBA 5J0OA 3RB4A 2JH7A 1MSWD 4I2AA 1Z4NA 4IR9A 2KZ3A 2W54A 2IOFK 5KFFA 4ED1A 1NK6A 2VIXA 4J9OA 4EEKA 3WKEA 4KLGA 4BJQA 3UQ0A 1ZQFA 5J0QA 4C8NA 1L7PA 1O03A 5ALQA 2CXYA 1NI3A 3HW8A 1BNPA 1L7NA 2OXOA 8ICCA 4I29A 3BS5B 2I6XA 1XU4A 5J2DA 2BDPA 4GXIA 2BCUA 1JMSA 4FZLA 1X2IA 5J2FA 4RQ1A 9ICEA 2WF5A 1ECWA 4O3QA 4ECZA 1LKYA 2HOQA 4DSEA 2ZJ8A 2AGOA 5HR6A 4F4WA 5ALMA 1S97A 2KVSA 1URJA 2NO5A 1ZQHA 1ZD3A 1TV9A 4UASA 2G5IB 5J2CA 2W8KA 3K1ZA 2BZFA 5IIIA 3UMCA 4AYBC 2BR0A 1PVPA 4QJFB 4NJ8A 1CI4A 4KTQA 7ICIA 3ONNA 1L6NA 1X6JA 5AKZA 1Z1VA 3ZDEA 4QZFA 2A1JA 5AIAA 3JPNA 2QARB 5A0LA 2F76X 5D49A 3EUB2 1KRPA 3FYHA 2IA6A 2J6UA 2Y1IA 3IP4B 5EE9A 3I76A 3FM9A 3V6JA 2HHSA 2ISPA 2EAMA 4B6JA 5JTIA 2FMSA 3HRDD 1ZQEA 2K89A 1C7YA 2MUTB 1S77D 3D2SA 4BX9C 2GH1A 4ACOA 5ALSA 4RQ6A 3HILA 2KN7A 4OO1J 3HP6A 4PZOA 2WF9A 2WB1C 2MA1A 2R8HA 2KFZA 3AN1A 1KTQA 5JRTA 4DL2A 1QTMA 5HHHA 1IV8A 4NXZA 2E1FA 3SAHA 2D8CA 1UHUA 3R9KA 4JV1A 3B0YA 3F2BA 3M9OB 1KEJA 4TQRA 2YMQA 1BPZA 1BPXA 5E79U 4O3NA 1S5LU 4R8UB
chains in the Genus database with same CATH topology
3O0FA 1HIWA 4QIWF 2YB1A 2PMZC 2W7PA 2RRDA 1PVQA 1OUQA 4ICAA 2G5IB 4QIWC 2K8CB 2KJ8A 2K4HA 4NV0A 3K1ZA 2KICA 3ICXA 4GFJA 3F2CA 4NWIA 2DF4B 1XNSA 2OYYA 1KBUA 3HKZF 2XIDA 3PSFA 2ZXIA 3PSPA 4PL1A 2CN1A 2WAQC 2G5HB 4NLBA 4AYBC 3H0LB 2KJ5A 2WAQF 2DGZA 3GZFA 4AYBF 2KOBA 1TAMA 4CDGA 3F53A 3N7PD 1PVPA 2NV3A 2H3IA 3M7DA 3N7RC 4QJFB 1ZQ1C 3N7SC 3SMVA 4PL2A 2W03A 2HBKA 2Z7JA 3F2DA 2ZIVB 4KMOB 3MGVA 3PSIA 2KHQA 1WUDA 2F8LA 1D8BA 5CRXA 5HR7A 4CRXA 1YT3A 2RHFA 2RP5A 3PZPA 3ONNA 3OPXA 1DRGA 1L6NA 3SAFA 2VJ4A 2LHTA 2KEYA 2ZXHA 4OJ6A 2HBMA 2ZIVA 2LYAA 1NZBA 1Z1BA 4KX3A 2K4IA 1MA7A 1HEKA 2H3QA 2OH2A 3HKZC 1UPHA 2HOFA 2Q4TA 2JH7A 2N1RA 3LVWA 3H0RB 4C0ZA 2KJ9A 2D6FC 2MRLA 4FZNA 5A0LA 2F76X 2KHVA 2JH1A 2LBOA 2H3FA 4FE3A 4IC9A 5KL8B 1XO0A 3CP8A 2OM6A 3IG8A 2JMGA 2F2AB 3C29A 1Q3UA 4A8EA 2E5SA 2H3VA 1SZHA 2LYBA 3NUQA 1PVRA 3E0FA 1CRXA 3GU3A 4FZMA 2VIXA 2K8BB 3LYSA 4U7CA 3IP4B 2XI9A 4OJLA 3KFUF 2G08A 3H0MB 3AQFA 2YX8A 2ZIUB 2K4EA 2KNJA 4OJPA 4OJOA 2W7OA 2HOIA 4BJQA 4P0QB 3RF9A 3M6ZA 4U6PA 2G06A 2ZIWB 1Z19A 2ZIUA 4P0QA 2KKVA 2KVCA 4CGZA 2Y0SF 2CPRA 2LKYA 3VC8A 2OXOA 1GO3F 5T14A 2YB4A 3D2QA 3AL0B 2ZIXA 2K89A 2BDUA 3D2SA 2ZIWA 2GOLA 4BX9C 1F44A 2GH1A 2KV2A 2K8AA 3LVVA 4ACOA 3SAGA 2PMZF 2KD1A 4BUGA 5C0YA 1A6SA 2E1EA 3CRXA 1T94A 2HBJA 1Q3VA 2JHDA 4OO1J 2F77X 2W04A 2G09A 2H3ZA 1ED1A 3CYMA 3SQIA 2JGAA 3PSTA 2G07A 2A3VA 4FZLA 2KIWA 2XVTA 1IIPA 2WB1C 2MA1A 3KZXA 3L3FX 5KL1B 2WB1F 4KX5A 2HMXA 3F5EA 1A0PA 4NLCA 1ECWA 2XICA 2E1FA 2R18A 2VKQA 3D2NA 2M0NA 3SAHA 2HOQA 4P0PB 3F2BA 3DEEA 4O3MA 5HR6A 3IG5A 3RFAA 2ZIXB 3VCBA 4WJ3B 3M6KA 3C28A 4JMUA 4OJ5A 1P7DA 2Y0SC 2G0AA 3AQEA 2VJ5A 3T79A 2CRXA 3ALRA 3F5AA 1URJA 2DQNB 2HBLA 3NRWA 3IN5A 2ZG6A 4P0PA 4QNLA 2KKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7P D;  3AQE A;  2XVT A;  3AQF A;  2YX8 A;  3N7R C;  3N7S C; 
#chains in the Genus database with same CATH topology
 3GFK B;  5ALJ A;  1NKE A;  2PMZ C;  3KZI U;  1L3U A;  3H40 A;  4F3O A;  1ZD2 P;  5KFE A;  3KD3 A;  2OHF A;  4YR2 A;  1F5S A;  3HKZ F;  2XID A;  9ICX A;  4FFD A;  4RPZ A;  2WAQ C;  1A76 A;  1ZJM A;  1NKC A;  4AYB F;  4HAI A;  1NOM A;  8ICM A;  3H8M A;  2F1H A;  5ALH A;  1ZQX A;  4Y2X A;  3AM9 A;  4M9H A;  5D4B A;  3PZP A;  3G6V A;  1QH9 A;  3OPX A;  5CP2 A;  4DOB A;  2E8P A;  4DEZ A;  3K75 D;  4PPX A;  2EAN A;  3LVW A;  4AP9 A;  4EEL A;  2KHV A;  4OCZ A;  4IC9 A;  4MEY A;  2HW3 A;  2JMG A;  1TAU A;  4RPX A;  4EX7 A;  2XY6 A;  4EZ6 A;  3E0F A;  4M47 A;  2ATL A;  4FZM A;  1PK1 B;  5EE0 A;  4Q8E A;  2XI9 A;  4OJP A;  3QU7 A;  3RF9 A;  3N4M B;  1SL1 A;  3T5L A;  4ECV A;  1Z00 B;  1F0M A;  2PFP A;  1OXJ A;  1SV0 A;  5DG7 A;  2M9N A;  2EH9 A;  2OEH A;  4J9L A;  5J0P A;  3V72 A;  2KV2 A;  5DB9 A;  2KD1 A;  3BQT A;  2E1E A;  3PV8 A;  3MR3 A;  2BCR A;  4NLK A;  1QSY A;  8ICU A;  3BS5 A;  4Y2J A;  5GTH U;  2A19 A;  2W55 A;  5DBA A;  1IIP A;  5KFY A;  2R8G A;  2QKQ A;  2WB1 F;  3TKA A;  3C1Z A;  2C22 A;  2ZIX B;  4WJ3 B;  3MDA A;  1BPB A;  3NGD A;  2DQN B;  2ZG6 A;  2FMQ A;  4J9M A;  2AQ0 A;  3WK4 A;  3WU2 U;  5EE1 A;  5AIB A;  5TZV A;  4O0I A;  3WKC A;  4NWI A;  4F2R A;  1SL0 A;  2F3N A;  2WAQ F;  7ICP A;  4UAW A;  3M9N B;  3C2K A;  3S6J A;  4Y2S A;  3UMB A;  2HBK A;  3ISC A;  3LWM A;  4KLE A;  4RNN A;  3MR5 A;  3SAF A;  2C2R A;  2DUY A;  4Y2P A;  5KAI U;  2HHW A;  3KHH A;  5AK4 A;  2WF8 A;  4Q44 A;  2N1R A;  5L9X A;  2D6F C;  5AKE A;  3QYP A;  2QB0 B;  5IIN A;  2PXI A;  2JH1 A;  4ECS A;  4GC6 A;  2FE9 A;  2EAP A;  2W9A A;  3CP8 A;  4IRK A;  2FLP A;  4JWN A;  9ICC A;  2QAR A;  3TAC B;  4K4I A;  3B9J A;  5IIM A;  2K8B B;  2NYV A;  2ZIU B;  1CEZ A;  8ICO A;  4TUQ A;  7ICF A;  4QWA A;  3A0B U;  3UM9 A;  5AK5 A;  5AKI A;  1NK5 A;  1L5U A;  4I2D A;  4I2G A;  3GV7 B;  1WWU A;  1S8O A;  5IIL A;  3BQ0 A;  1SKR A;  1A6S A;  4RZR A;  2EDU A;  4C4R A;  5KT4 A;  1X9M A;  2G09 A;  2MSN A;  2MUT A;  1N60 A;  2ASJ A;  3L3F X;  1K1S A;  3N28 A;  2LYH A;  4F4X A;  4ECT A;  3IG5 A;  3C28 A;  5ALG A;  4EBD A;  5KFZ A;  1U47 A;  3RRH A;  5DKW A;  4KIT B;  4DFJ A;  2K8C B;  4DQQ A;  8ICZ A;  2K4H A;  3KKA C;  2BCS A;  3V6H A;  4ECQ A;  2C2D A;  3AMZ A;  2UVR A;  2CN1 A;  4NLB A;  5ALE A;  3GZF A;  2UVV A;  2WF7 A;  4O9M A;  3M7D A;  1V85 A;  3N7R C;  3N7S C;  5J2E A;  2HSZ A;  4F93 B;  1KQQ A;  3PR4 A;  5J2G A;  2RHF A;  1U48 A;  2AGQ A;  3ZD8 A;  1X9W A;  3BQ1 A;  3A0H U;  2LHT A;  4UAT A;  3WKA A;  4KX3 A;  5EWF A;  9ICF A;  2Q4T A;  9ICQ A;  2OCE A;  7ICM A;  4XRH A;  5J2A A;  3CNH A;  3MGH A;  1XO0 A;  1KSP A;  2FMP A;  2NRT A;  4QZD A;  4YD2 A;  3PX0 A;  3PW0 A;  3CW2 C;  1RYU A;  4BXO B;  3Q8K A;  3D6J A;  1RM6 C;  2W7O A;  2HVI A;  5IIJ A;  1PK1 A;  4O3R A;  1RYR A;  1PZN A;  4JV0 A;  4IRD A;  1XSN A;  4RU9 A;  3TFR A;  2Y0S F;  2LKY A;  3VC8 A;  4J9Q A;  2YB4 A;  3D2Q A;  5AKJ A;  1Z00 A;  4YCX A;  1SL2 A;  1F44 A;  1KKX A;  3LVV A;  3WK7 A;  4BUG A;  8ICL A;  2RLT A;  4MFF A;  4I2C A;  4ECR A;  3RB0 A;  2BGW A;  3PST A;  3MR6 A;  8ICB A;  3RR7 A;  3UXO A;  3ZI4 A;  4NLC A;  3D2N A;  2ESE A;  4KLS A;  3KOO A;  5DBC A;  3MFH A;  2VJ5 A;  5CEH A;  2W11 A;  3WKD A;  1QSL A;  4DLG A;  4ECY A;  2J6T A;  2EZZ A;  2B21 A;  1T7P A;  1S0O A;  4GFJ A;  8ICQ A;  3GV8 B;  2ISO A;  2F8K A;  1YZ6 A;  1DOQ A;  2E8N A;  4EEN A;  1TAM A;  4CDG A;  3TAN A;  1S0N A;  3Q8R B;  1ZQC A;  3BQ2 A;  5FP0 A;  1ZQN A;  1IG6 A;  2KIV A;  2NRW A;  5DDM A;  1ZQM A;  2ZIV B;  1L7M A;  3MGV A;  5KFT A;  1N2X A;  1ZQT A;  5HR7 A;  1YT3 A;  2VJ4 A;  1Z3E B;  4BWM A;  4DQI A;  2OH2 A;  3LWL A;  3UMG A;  1B4F A;  2XC9 A;  5J8Y A;  4YFK A;  3ETR A;  4UW9 A;  2K60 A;  1MQ2 A;  1JRP A;  5DG8 A;  4DL3 A;  5AM1 A;  1TK8 A;  2KE7 A;  4J9K A;  2F2A B;  2QB0 A;  2LYB A;  3C5F A;  1PVR A;  5L1M A;  1UT5 A;  2HI0 A;  1ZQR A;  4NM2 A;  3LYS A;  4QWE A;  4QZ8 A;  2F1J A;  1JI7 A;  1ZXI A;  1U49 A;  2G08 A;  4P0Q B;  4C80 A;  3RH6 A;  1D9D A;  5CB1 A;  5IIK A;  1SXE A;  2LI6 A;  4ED3 A;  2ZIU A;  4GIB A;  1TE2 A;  5KT5 A;  4DQS A;  3GDX A;  4Y2V A;  2BPF A;  4US9 A;  3I1Y A;  4DFK A;  4PHP A;  4PHD A;  3SAG A;  1NK4 A;  2ES6 A;  4DFM A;  5ALD A;  4NLN A;  3SQI A;  2B6G A;  2EZY A;  3HX0 A;  2ZTC A;  4I2F A;  3Q8M A;  2HHV A;  2R18 A;  5D46 A;  2YTU A;  3HJE A;  1WCL A;  3C2L A;  4I2B A;  3UXN A;  3UPQ A;  3NRW A;  4QIW C;  2BCQ A;  3PMN A;  4ECX A;  3AU6 A;  3O0F A;  3PX4 A;  1RYS A;  4Y2Q A;  5KFV A;  2UVU A;  3RBE A;  1K5O A;  4MF2 A;  4Y2T A;  3ICX A;  5CWR A;  2RDJ A;  2OYY A;  4B9T A;  7ICQ A;  3IRU A;  4QZE A;  2KJ5 A;  2DGZ A;  3BDP A;  3F53 A;  4IRC A;  5F9N A;  3C1Y A;  4RQ0 A;  3NAS A;  3AUO A;  3SMV A;  3PSI A;  2KG5 A;  3MAB A;  5KFM A;  2QLT A;  1TKD A;  1VLB A;  4DS4 A;  1NJW A;  2HHT A;  4IQU A;  3NTU A;  4OJ6 A;  4G3I A;  1UA1 A;  3BJY A;  3HKZ C;  3T5H A;  2GO7 A;  3Q8S B;  5KFN A;  1QQ7 A;  1RXV A;  4QZB A;  3PW5 A;  4FE3 A;  2AH5 A;  3G6Y A;  4YR3 A;  4DWI A;  1RPL A;  1S9F A;  5AKH A;  4YQW A;  4KLD A;  1CRX A;  2R8J A;  2P35 A;  1XO1 A;  5KFD A;  5DBB A;  1JRO A;  2HHU A;  4F71 A;  1D8L A;  4BXO A;  3TAQ A;  3ZDA A;  1UCV A;  2KVC A;  3NRZ A;  3IM1 A;  2DL0 A;  2DFL A;  1JXL A;  4UAU A;  5AKY A;  4DQP A;  4ED0 A;  5KG3 A;  5L1I A;  3MC1 A;  3KKA A;  4M0A A;  4CF4 A;  7ICE A;  2H3Z A;  5IIO A;  3PW4 A;  3JPT A;  2XVT A;  4F72 A;  2ZJA A;  1A0P A;  9ICB A;  4KMU A;  2JV3 A;  5AM0 A;  3B0X A;  4DOC A;  5KG5 A;  4KLH A;  2W43 A;  4Z6C A;  1COK A;  4GLX A;  4QIW F;  4YN4 A;  2IOH A;  3RB3 A;  3THV A;  4ICA A;  3C2M A;  1QSS A;  5J0S A;  2YQE A;  1L8L A;  1MC8 A;  4KLU A;  4NM1 A;  4KLT A;  1UA0 A;  2WTF A;  4BWJ A;  4IQV A;  4ELT A;  8ICV A;  3M8S A;  4LJX A;  1KFS A;  1N56 A;  8ICN A;  2IHM A;  4CNQ A;  4Q45 A;  1S0M A;  1S0V A;  1ARO P;  2JEJ A;  2ZIV A;  2HCF A;  2K4I A;  3FDS A;  1ZYQ A;  2KJ9 A;  3PO5 A;  1ZQQ A;  1ZJN A;  2R8K A;  4UB8 U;  4RQM A;  2LBO A;  2BCV A;  3PNC A;  1A77 A;  3OHA A;  3Q8Q B;  2W3S A;  5HML A;  5BPC A;  2EAO A;  2DKX A;  7ICJ A;  3QEB Z;  1CUK A;  1NNL A;  4R65 A;  4I2J A;  3OSP A;  2BQ3 A;  3RR8 A;  4USA A;  5KFU A;  1KDH A;  5KFW A;  2ZIW B;  1Z19 A;  2YY6 A;  3IDW A;  4P0Q A;  1K1Q A;  5AI0 A;  5DGB A;  3PW2 A;  1SGG A;  2GWS A;  1V38 A;  1B0X A;  4KN7 A;  2A3V A;  4EYH B;  1ZQA A;  5AM5 A;  4NLZ A;  4UB3 A;  3BQ7 A;  1TK5 A;  4CF3 A;  4O3M A;  4X5V A;  4HYK A;  4PZN A;  3MR2 A;  2FLL A;  4OJ5 A;  2KK0 A;  3IN5 A;  3N97 B;  2B0C A;  4QNL A;  9ICL A;  2P6U A;  4DSF A;  3ZDC A;  1T3Q A;  4ED2 A;  5DLG A;  4B9U A;  3QX7 A;  1HJP A;  4DQR A;  4PL1 A;  5ALT A;  4YD1 A;  7ICL A;  1ZQO A;  1XC9 A;  4B9S A;  2V4R A;  2C2E A;  8ICF A;  5CRX A;  3SV3 A;  2Y1J A;  4PHE A;  5KG0 A;  4RNO A;  1DGS A;  2IOF A;  2JEG A;  2FPL A;  3ZD9 A;  4F5R A;  1TFR A;  1NZB A;  4KLF A;  3OSN A;  5KAF U;  2XGQ A;  2XCP A;  2ASD A;  4QZG A;  4RQ5 A;  4C8O A;  4P4M A;  4Z6F A;  3WKB A;  5KT7 A;  4YMN A;  1SZH A;  7ICO A;  4FBT A;  4I2E A;  2VA2 A;  4I28 A;  3ED5 A;  3RAX A;  4RQ2 A;  3OGU A;  3FAH A;  2YX8 A;  2HOI A;  3JPO A;  3LDA A;  1IXR A;  2R8I A;  3NVY A;  4U6P A;  1ZD5 A;  3SEI A;  3KTQ A;  1OW5 A;  4DSL A;  2L5Y A;  4DSK A;  1T4G A;  5KT3 A;  4JWM A;  4RUA A;  3AL0 B;  3KBB A;  5J0R A;  4JB3 A;  5C0Y A;  3QZ8 A;  1PUZ A;  3CYM A;  2G07 A;  2XGP A;  1X6I A;  4F8R A;  4KX5 A;  2BQU A;  2EZX A;  4EEY A;  3ISB A;  4UB1 A;  8ICG A;  1T3N A;  1ZRM A;  1ZQJ A;  2Y0S C;  2AU0 A;  4DO9 A;  3ALR A;  5KG2 A;  1XS9 D;  2PFO A;  2H3I A;  1HIW A;  3RJH A;  4F50 A;  3KHR A;  1WG8 A;  2LPE A;  5G5G A;  1JAL A;  5KG1 A;  2XY5 A;  5CR0 A;  2JRZ A;  3PX6 A;  1FFV A;  1KFT A;  3ISD A;  2AHO B;  3QZ7 A;  4MEX A;  1FIQ A;  1T8E A;  1M6Y A;  2DBY A;  5DG9 A;  2KP7 A;  5ALL A;  1L3S A;  4DOA A;  3N7P D;  2Q0Z X;  9ICG A;  4FS2 A;  5AK3 A;  1Q8K A;  4KLM A;  4J9S A;  4YG2 A;  1N61 A;  4TUR A;  2RDI A;  4KMO B;  1BPD A;  5ALO A;  1S10 A;  3JPS A;  5J2I A;  5J2K A;  2LYA A;  3H4D A;  4DFD A;  5KFG A;  1ZQU A;  1ZRN A;  2V4Q A;  5J0X A;  2O6K A;  1X42 A;  1BVS A;  4QZ9 A;  5DGA A;  2YMP A;  5ALY A;  3IG8 A;  2IBK A;  3RJG A;  1RDF A;  2RQ5 A;  2PFN A;  3UXP A;  3H4B A;  9ICS A;  4RUC A;  1RQN A;  3QXG A;  5AHX A;  4OJL A;  3TAD C;  3KFU F;  5AK6 A;  1U45 A;  2PFQ A;  3AQF A;  8ICT A;  4LVS A;  1QQ6 A;  3GII A;  1ZOL A;  2KZM A;  2YML A;  1U9L A;  3ORY A;  1AQ6 A;  4IS7 A;  1ZQG A;  5CJ7 A;  3GIK A;  4YMM A;  2ZIW A;  5DLF A;  5J2H A;  5BOL A;  1YZ7 A;  5BOM A;  3C5G A;  2ZTE A;  3H7I A;  2W3R A;  3WK8 A;  3KZX A;  4MHV A;  4BGD A;  4RPY A;  4ELV A;  3DEE A;  1LV5 A;  4ED8 A;  7ICU A;  4PJ0 U;  2HVH A;  1BPE A;  2Y9T A;  4K4H A;  2G0A A;  2BHN A;  5L1J A;  3T79 A;  4M6W B;  3GIJ A;  2FPK A;  1J97 A;  1J2N A;  2VA8 A;  3C21 A;  5ALF A;  4UAV A;  2RRD A;  2HHX A;  3SD7 A;  5KFC A;  3JPQ A;  1L3T A;  4M9G A;  5AM2 A;  3PML A;  2ZXI A;  4GXJ A;  4B9V A;  9ICK A;  7ICV A;  2IHN A;  4XQ8 A;  4UAY A;  2VA3 A;  2NV3 A;  1SXD A;  3F2D A;  5AI5 A;  5KFJ A;  1JX4 A;  3RJI A;  5AM4 A;  4J9P A;  3IV6 A;  1KLN A;  5KFB A;  4LZD A;  5AM3 A;  3M1Y A;  1NK7 A;  1MA7 A;  2H3Q A;  4YMO A;  4FZN A;  3HPO A;  4M9N A;  1Q46 A;  2WHE A;  2K4P A;  5DDY A;  5K4L A;  2XCA A;  3QE9 Y;  5J29 A;  2H3V A;  1ZQY A;  4IQW A;  3SYZ A;  4DL6 A;  4PHA A;  4U7C A;  2E3T A;  4YR0 A;  3Q8L A;  9ICJ A;  5ALV A;  2YMM A;  1QCK A;  3M8R A;  5DQG A;  1QLN A;  4DSI A;  3V7J A;  5KFA A;  4C4T A;  1N5W A;  3QUB A;  1X40 A;  4JUZ A;  2E8M A;  1D9F A;  3CRX A;  1T94 A;  5AI6 A;  1SZP A;  1V9P A;  2F77 X;  2JGA A;  2WFA A;  2KIW A;  8ICK A;  4RQN A;  2NO4 A;  1UT8 A;  1NK9 A;  5AKX A;  1LVH A;  5ALI A;  5EWG A;  4P0P B;  4QWC A;  3V7L A;  2UVW A;  3JPR A;  1DGJ A;  3QUQ A;  1PVQ A;  4QW9 A;  1OUQ A;  4XUS A;  4RQ7 A;  5AKG A;  8ICY A;  3F2C A;  5G5H A;  1SKW A;  5KNI A;  5KFQ A;  2BPG A;  3QU4 A;  3J81 j;  2PI5 A;  5J0U A;  2LM1 A;  2KOB A;  2BPC A;  3T3F A;  2JEF A;  5KFP A;  1NJZ A;  4QZH A;  4PL2 A;  4DSJ A;  1D8B A;  1WUD A;  2DWQ A;  3OTQ A;  2V9W A;  4J03 A;  2W9B B;  2HBM A;  1XSP A;  1UPH A;  5AI8 A;  4PGX A;  2MRL A;  3UQ2 A;  5L1L A;  1MN8 A;  4K4G A;  3FC4 A;  5KL8 B;  3JPP A;  4QZA A;  8ICR A;  1BNO A;  1JXE A;  3RTV A;  4F2S A;  1KL9 A;  3H0M B;  1COO A;  2KNJ A;  1FFU A;  2YN4 A;  2AXT U;  3H8J A;  2Y9U A;  5ALW A;  4C7Z A;  4MF8 A;  3K4G A;  4B9M A;  2GLE A;  3K1R B;  3EZ5 A;  4O5E A;  2F1I A;  5F3X B;  4B9N A;  3BZC A;  3RAQ A;  1ED1 A;  5KFO A;  4CE6 A;  3KHG A;  1FEZ A;  2HMX A;  4NLG A;  2XIC A;  9ICI A;  1J2M A;  2W8L A;  7ICN A;  2ASL A;  1EXN A;  4PGQ A;  4P2H A;  4ZOH C;  2ZUC A;  4TUP A;  9ICV A;  2ALZ A;  3PW7 A;  4M6W A;  4ED6 A;  1H38 A;  2KIC A;  1XNS A;  3I28 A;  1DK3 A;  2WF6 A;  1ZQL A;  3PSP A;  5AKL A;  4Y2U A;  2QB1 A;  4GC7 A;  2JR5 A;  3H0L B;  4C7Y A;  4O3P A;  4M2Y A;  5DB8 A;  2MU2 A;  4UAZ A;  7ICH A;  3WK9 A;  5DQH A;  3DDH A;  7ICS A;  3TAD A;  4R63 A;  2RP5 A;  4I27 A;  4EYI B;  2KEY A;  2OWO A;  3BZK A;  3QU2 A;  8ICW A;  3KHL A;  4F5Q A;  2PI4 A;  4UB2 A;  1NKB A;  8ICH A;  1RG6 A;  1SWW A;  3EWA A;  4IR1 A;  2H3F A;  1U4B A;  1L7O A;  3NVZ A;  3NUQ A;  4YVZ A;  4FBU A;  3H8S A;  4QW8 A;  1IM4 A;  5ALK A;  1L3V A;  1C20 A;  2NRZ A;  1RZT A;  3M6Z A;  3V6K A;  4YP3 A;  3M9M B;  2EQY A;  1ZET A;  4TUS A;  4M04 A;  5GTI U;  2H5X A;  1GO3 F;  1ZQK A;  2KFN A;  4QWD A;  2GOL A;  2P6R A;  1Q3V A;  3MDC A;  1KN5 A;  2KZZ A;  4Q43 A;  5KFR A;  2I9G A;  4B9L A;  9ICH A;  1XWL A;  2KSO B;  4UB5 A;  4TQS A;  4DLE A;  7ICR A;  3RFA A;  4NL9 C;  5C5J A;  4RT3 A;  4EBE A;  1ZQD A;  3GV5 B;  3RH5 A;  2LMR A;  2LM4 A;  1P7D A;  5ALU A;  3RJJ A;  1SV4 A;  1JIH A;  8ICI A;  1SB3 C;  5KFH A;  3F5A A;  4P0P A;  3E2E A;  5EWE A;  2VAN A;  4C4S A;  2MAX A;  2YB1 A;  7ICT A;  1SKS A;  1DK2 A;  3T5J A;  1SIJ A;  4PGY A;  1ZQW A;  4FO6 A;  4ECW A;  2FLN A;  1BGX T;  3MGI A;  2C28 A;  5DB7 A;  3MBY A;  3PVX A;  1NJX A;  1ZQ1 C;  3OJS A;  2W03 A;  2FPM A;  1UQV A;  5DB6 A;  5J0Y A;  4C8M A;  3RB6 A;  3SR6 A;  3NVW A;  3OJU A;  4KLL A;  3ZDD A;  1Z1B A;  2W9M A;  1HEK A;  5HP4 A;  2JEI A;  2ZUD A;  5J0T A;  2W9B A;  3H0R B;  4ECU A;  4F4K A;  5J8Y C;  1ZQZ A;  8ICE A;  4KLI A;  3QU9 A;  9ICT A;  2OM6 A;  4P4O A;  4QZC A;  1ZQB A;  4OD0 A;  3GU3 A;  3H8W A;  5HMM A;  2BQR A;  2A1A A;  5B66 U;  2AJQ A;  3WK5 A;  1ZD4 A;  1NJY A;  3RJE A;  4EZ9 A;  3L5K A;  4UB4 A;  5CHG A;  4C8L A;  3AEV A;  5EOZ A;  4DL7 A;  1ZQI A;  4ZH4 A;  1NK0 A;  5KFI A;  3EPI A;  4CGZ A;  4DL5 A;  3SI8 A;  5HNK A;  1XSL A;  3EYZ A;  2HHQ A;  2BDU A;  4DCC A;  2K8A A;  4ED7 A;  9ICW A;  2PMZ F;  5EE3 A;  2HBJ A;  1N48 A;  1PK3 A;  2W04 A;  4UBB A;  4O3O A;  4KLQ A;  4F5P A;  3IHQ B;  1X66 A;  1FO4 A;  3QUT A;  4LZG A;  5J2J A;  2JXJ A;  1QQ5 A;  2M0N A;  3VCB A;  4F4Y A;  3TI0 A;  5AI4 A;  4KLO A;  3AQE A;  1RXW A;  2W9C B;  3SZ2 A;  4Z6D A;  2KKP A;  3TQ1 A;  5AI9 A;  3RBD A;  5J2B A;  5ALZ A;  5F9L A;  4NV0 A;  3PR5 B;  2DF4 B;  2ODG A;  1Y88 A;  3G6X A;  4P4P A;  4I2H A;  3PY8 A;  3QNM A;  3PO4 A;  5KG6 A;  2E8O A;  3GQC A;  2KHQ A;  2F8L A;  2DPJ A;  4O5C A;  1X9X A;  5KFL A;  4CRX A;  3ZDB A;  2JZB B;  2XY7 A;  2I1Q A;  2IMW P;  3U26 A;  2ZXH A;  1VDV A;  2FJ6 A;  3HT3 A;  9ICO A;  2FI1 A;  2PKE A;  1JUD A;  4J9N A;  9ICN A;  4UQG A;  1S76 D;  1Q3U A;  2P66 A;  5TIS U;  8ICJ A;  4M9J A;  2D3D A;  1O08 A;  2XO7 A;  3Q8P B;  1V97 A;  5KFK A;  2FDR A;  3OHB A;  5KFX A;  1BPY A;  3TAR A;  3LK9 A;  2G06 A;  1N63 A;  4XA5 A;  1TAQ A;  4F92 B;  1L8O A;  4R64 A;  4DF4 A;  2HDO A;  4ELU A;  2J6S A;  2ZTD A;  4MFC A;  4C8K A;  5L1K A;  4R8U A;  4O3S A;  1LKY B;  2ZUB A;  4Y2R A;  2NRV A;  3AU2 A;  3F5E A;  5KT2 A;  4DF8 A;  4MFA A;  3SV4 A;  1JN3 A;  3TAP A;  1D8Y A;  2KSO A;  3GIL A;  4F4Z A;  2CRX A;  2F44 A;  4DFP A;  3MFI A;  5J0W A;  5KG7 A;  4RQ8 A;  4QWB A;  2W7P A;  3QUC A;  1WWV A;  4KLJ A;  2I5H A;  4M9L A;  2KJ8 A;  2DKZ A;  4F91 B;  4Q8F A;  7ICK A;  7ICG A;  4O5K A;  4CCH A;  1HUZ A;  3BS7 A;  4RT2 A;  2G5H B;  2BKE A;  3WK6 A;  4QZI A;  1NK8 A;  3RJK A;  5HHI A;  3RH4 A;  1ZQS A;  9ICR A;  1LB2 B;  4UBC A;  1ZQP A;  1B22 A;  4JK1 A;  2A1J B;  4UB6 U;  3NVV A;  3C23 A;  5KFS A;  1SWV A;  5JU5 A;  1TVA A;  4I2I A;  2AGP A;  4Z6E A;  4JV2 A;  4PH5 A;  4EBC A;  4C0Z A;  4F5N A;  9ICU A;  1WCN A;  1VJ5 A;  1X9S A;  1KW4 A;  1MQ3 A;  4J9R A;  5ALN A;  3C29 A;  4A8E A;  2E5S A;  5JUM A;  4R66 A;  8ICX A;  3SEN A;  1NZP A;  5ALX A;  4OJO A;  2HOF A;  4RQ4 A;  2K4E A;  4NL9 A;  4CF5 A;  4IL6 U;  2ZJ5 A;  3NS1 A;  4DL4 A;  3DV9 A;  4RNM A;  2KTQ A;  2AQ4 A;  2KKV A;  9ICM A;  3EPG A;  2CPR A;  1WYG A;  5AKK A;  4US8 A;  1Z4O A;  5T14 A;  5KTQ A;  3QEA Z;  2ZIX A;  1N5X A;  2NRX A;  3RRG A;  4RQ3 A;  4YXJ A;  5KT6 A;  3L4P A;  2KMD A;  4IQT A;  5H2F U;  2JHD A;  8ICP A;  3QU5 A;  4GXK A;  4BDP A;  5DQI A;  5ALR A;  5KL1 B;  3T5K A;  1RQL A;  2DPI A;  1HUO A;  2VKQ A;  4DS5 A;  3M6K A;  4JMU A;  2HBL A;  1SV0 C;  4F5O A;  4FS1 A;  4NY8 A;  5B5E U;  5CA7 A;  1TK0 A;  4Y2Y A;  1ZQV A;  4EX6 A;  4G9B A;  2W9C A;  4E0D A;  1KBU A;  4KN4 A;  9ICA A;  3GIM A;  3PSF A;  1B43 A;  9ICP A;  5AIC A;  8ICA A;  5ALP A;  1N62 A;  3RJF A;  3ETL A;  3E58 A;  4UAR A;  3TFS A;  8ICS A;  2Z7J A;  3EW9 A;  5KG4 A;  4YXM A;  1DRG A;  3HWT A;  3V7K A;  1DXS A;  1KFD A;  2JZB A;  5J0O A;  3RB4 A;  2JH7 A;  1MSW D;  4I2A A;  1Z4N A;  4IR9 A;  2KZ3 A;  2W54 A;  2IOF K;  5KFF A;  4ED1 A;  1NK6 A;  2VIX A;  4J9O A;  4EEK A;  3WKE A;  4KLG A;  4BJQ A;  3UQ0 A;  1ZQF A;  5J0Q A;  4C8N A;  1L7P A;  1O03 A;  5ALQ A;  2CXY A;  1NI3 A;  3HW8 A;  1BNP A;  1L7N A;  2OXO A;  8ICC A;  4I29 A;  3BS5 B;  2I6X A;  1XU4 A;  5J2D A;  2BDP A;  4GXI A;  2BCU A;  1JMS A;  4FZL A;  1X2I A;  5J2F A;  4RQ1 A;  9ICE A;  2WF5 A;  1ECW A;  4O3Q A;  4ECZ A;  1LKY A;  2HOQ A;  4DSE A;  2ZJ8 A;  2AGO A;  5HR6 A;  4F4W A;  5ALM A;  1S97 A;  2KVS A;  1URJ A;  2NO5 A;  1ZQH A;  1ZD3 A;  1TV9 A;  4UAS A;  2G5I B;  5J2C A;  2W8K A;  3K1Z A;  2BZF A;  5III A;  3UMC A;  4AYB C;  2BR0 A;  1PVP A;  4QJF B;  4NJ8 A;  1CI4 A;  4KTQ A;  7ICI A;  3ONN A;  1L6N A;  1X6J A;  5AKZ A;  1Z1V A;  3ZDE A;  4QZF A;  2A1J A;  5AIA A;  3JPN A;  2QAR B;  5A0L A;  2F76 X;  5D49 A;  3EUB 2;  1KRP A;  3FYH A;  2IA6 A;  2J6U A;  2Y1I A;  3IP4 B;  5EE9 A;  3I76 A;  3FM9 A;  3V6J A;  2HHS A;  2ISP A;  2EAM A;  4B6J A;  5JTI A;  2FMS A;  3HRD D;  1ZQE A;  2K89 A;  1C7Y A;  2MUT B;  1S77 D;  3D2S A;  4BX9 C;  2GH1 A;  4ACO A;  5ALS A;  4RQ6 A;  3HIL A;  2KN7 A;  4OO1 J;  3HP6 A;  4PZO A;  2WF9 A;  2WB1 C;  2MA1 A;  2R8H A;  2KFZ A;  3AN1 A;  1KTQ A;  5JRT A;  4DL2 A;  1QTM A;  5HHH A;  1IV8 A;  4NXZ A;  2E1F A;  3SAH A;  2D8C A;  1UHU A;  3R9K A;  4JV1 A;  3B0Y A;  3F2B A;  3M9O B;  1KEJ A;  4TQR A;  2YMQ A;  1BPZ A;  1BPX A;  5E79 U;  4O3N A;  1S5L U;  4R8U B; 
#chains in the Genus database with same CATH homology
 3O0F A;  1HIW A;  4QIW F;  2YB1 A;  2PMZ C;  2W7P A;  2RRD A;  1PVQ A;  1OUQ A;  4ICA A;  2G5I B;  4QIW C;  2K8C B;  2KJ8 A;  2K4H A;  4NV0 A;  3K1Z A;  2KIC A;  3ICX A;  4GFJ A;  3F2C A;  4NWI A;  2DF4 B;  1XNS A;  2OYY A;  1KBU A;  3HKZ F;  2XID A;  3PSF A;  2ZXI A;  3PSP A;  4PL1 A;  2CN1 A;  2WAQ C;  2G5H B;  4NLB A;  4AYB C;  3H0L B;  2KJ5 A;  2WAQ F;  2DGZ A;  3GZF A;  4AYB F;  2KOB A;  1TAM A;  4CDG A;  3F53 A;  3N7P D;  1PVP A;  2NV3 A;  2H3I A;  3M7D A;  3N7R C;  4QJF B;  1ZQ1 C;  3N7S C;  3SMV A;  4PL2 A;  2W03 A;  2HBK A;  2Z7J A;  3F2D A;  2ZIV B;  4KMO B;  3MGV A;  3PSI A;  2KHQ A;  1WUD A;  2F8L A;  1D8B A;  5CRX A;  5HR7 A;  4CRX A;  1YT3 A;  2RHF A;  2RP5 A;  3PZP A;  3ONN A;  3OPX A;  1DRG A;  1L6N A;  3SAF A;  2VJ4 A;  2LHT A;  2KEY A;  2ZXH A;  4OJ6 A;  2HBM A;  2ZIV A;  2LYA A;  1NZB A;  1Z1B A;  4KX3 A;  2K4I A;  1MA7 A;  1HEK A;  2H3Q A;  2OH2 A;  3HKZ C;  1UPH A;  2HOF A;  2Q4T A;  2JH7 A;  2N1R A;  3LVW A;  3H0R B;  4C0Z A;  2KJ9 A;  2D6F C;  2MRL A;  4FZN A;  5A0L A;  2F76 X;  2KHV A;  2JH1 A;  2LBO A;  2H3F A;  4FE3 A;  4IC9 A;  5KL8 B;  1XO0 A;  3CP8 A;  2OM6 A;  3IG8 A;  2JMG A;  2F2A B;  3C29 A;  1Q3U A;  4A8E A;  2E5S A;  2H3V A;  1SZH A;  2LYB A;  3NUQ A;  1PVR A;  3E0F A;  1CRX A;  3GU3 A;  4FZM A;  2VIX A;  2K8B B;  3LYS A;  4U7C A;  3IP4 B;  2XI9 A;  4OJL A;  3KFU F;  2G08 A;  3H0M B;  3AQF A;  2YX8 A;  2ZIU B;  2K4E A;  2KNJ A;  4OJP A;  4OJO A;  2W7O A;  2HOI A;  4BJQ A;  4P0Q B;  3RF9 A;  3M6Z A;  4U6P A;  2G06 A;  2ZIW B;  1Z19 A;  2ZIU A;  4P0Q A;  2KKV A;  2KVC A;  4CGZ A;  2Y0S F;  2CPR A;  2LKY A;  3VC8 A;  2OXO A;  1GO3 F;  5T14 A;  2YB4 A;  3D2Q A;  3AL0 B;  2ZIX A;  2K89 A;  2BDU A;  3D2S A;  2ZIW A;  2GOL A;  4BX9 C;  1F44 A;  2GH1 A;  2KV2 A;  2K8A A;  3LVV A;  4ACO A;  3SAG A;  2PMZ F;  2KD1 A;  4BUG A;  5C0Y A;  1A6S A;  2E1E A;  3CRX A;  1T94 A;  2HBJ A;  1Q3V A;  2JHD A;  4OO1 J;  2F77 X;  2W04 A;  2G09 A;  2H3Z A;  1ED1 A;  3CYM A;  3SQI A;  2JGA A;  3PST A;  2G07 A;  2A3V A;  4FZL A;  2KIW A;  2XVT A;  1IIP A;  2WB1 C;  2MA1 A;  3KZX A;  3L3F X;  5KL1 B;  2WB1 F;  4KX5 A;  2HMX A;  3F5E A;  1A0P A;  4NLC A;  1ECW A;  2XIC A;  2E1F A;  2R18 A;  2VKQ A;  3D2N A;  2M0N A;  3SAH A;  2HOQ A;  4P0P B;  3F2B A;  3DEE A;  4O3M A;  5HR6 A;  3IG5 A;  3RFA A;  2ZIX B;  3VCB A;  4WJ3 B;  3M6K A;  3C28 A;  4JMU A;  4OJ5 A;  1P7D A;  2Y0S C;  2G0A A;  3AQE A;  2VJ5 A;  3T79 A;  2CRX A;  3ALR A;  3F5A A;  1URJ A;  2DQN B;  2HBL A;  3NRW A;  3IN5 A;  2ZG6 A;  4P0P A;  4QNL A;  2KKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...