3AQFA

Crystal structure of the human crlr/ramp2 extracellular complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
GTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/membrane protein
molecule keywords Receptor activity-modifying protein 2
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqfA00
3N7PD 3AQFA 3AQEA 2XVTA 2YX8A 3N7SC 3N7RC
chains in the Genus database with same CATH superfamily
4F91B 1S77D 2KIVA 1RDFA 4Y2PA 7ICIA 9ICBA 4HAIA 3GIIA 2RQ5A 3NVVA 3F53A 4ELUA 3NASA 3NGDA 1N2XA 4DCCA 1T3NA 3A0BU 1NZBA 2K4HA 1L3UA 4IQVA 5J2BA 3E58A 3SEIA 2FMPA 5L9XA 2W04A 1K5OA 5DG9A 1VLBA 2KOBA 1S0VA 5ALPA 4IRDA 5KT6A 5J0YA 2DKXA 1ZD3A 5KFZA 1V97A 9ICQA 4ED0A 2MUTB 2ZJ8A 4DO9A 3FAHA 3HW8A 1L7NA 3AM9A 4O5EA 3C23A 1AROP 4RT3A 3AMZA 1SWVA 4DL5A 4NLKA 1X9WA 1V9PA 3Q8PB 1QSLA 2ESEA 5JTIA 2MA1A 2YMPA 1ZQ1C 4KLDA 2ALZA 1VJ5A 4QW9A 4J9SA 1XO1A 5DDYA 4DS5A 1N60A 4WJ3B 1ZQFA 3RR7A 3Q8RB 3D6JA 1SKSA 5F9LA 4PL1A 3ZDDA 5ALTA 5AICA 2FLNA 4UAVA 2AH5A 2F77X 2QB0A 3IRUA 1B43A 4RUCA 1ZQLA 3PNCA 8ICPA 5CR0A 1U45A 4GLXA 3NVZA 3OTQA 2HMXA 5ALGA 4P0QB 1QH9A 4EBDA 5E79U 3T5HA 4TUSA 3PR5B 4K4IA 4BWJA 4J9OA 4ECZA 5AM5A 3G6YA 3JPOA 2CRXA 8ICLA 5KFBA 3SZ2A 3QE9Y 1L8OA 5D46A 2KEYA 2Y9TA 2ZJAA 1S9FA 5CRXA 3SR6A 4NLZA 1U9LA 3BS5B 1QQ6A 1K1QA 2VA3A 3C21A 3B0XA 2IA6A 5HR6A 7ICNA 2W54A 5J0QA 1ZQKA 1RYRA 2RRDA 3L4PA 1U48A 5AI4A 2K4PA 3LDAA 3JPPA 5J0UA 4OO1J 1ZQEA 2LYBA 2WF6A 1WUDA 5KG4A 3ZDBA 5J2IA 1ZQOA 3SYZA 1P7DA 4PGXA 4IRKA 2ZUBA 4FBUA 2OHFA 4OJ5A 4I2AA 1TAMA 4XRHA 3OPXA 3LYSA 3BQ1A 4F5RA 2KG5A 1PUZA 3GU3A 2K4EA 1ZQVA 2D6FC 1UCVA 4M04A 1HUZA 4Z6DA 9ICLA 3KKAC 4KX5A 4U6PA 5AI8A 4C8NA 3H4DA 1EXNA 1Z4NA 1D9FA 4ED3A 5EE3A 1NJXA 3EUB2 1ZQJA 3PW5A 4M47A 4TUQA 3M9NB 2YN4A 1PVRA 1X2IA 1SKWA 9ICGA 5AK4A 1TKDA 4PGYA 1HJPA 4EEYA 1ZRNA 1DGSA 3C29A 3EW9A 4ED7A 1ZD2P 5CEHA 2L5YA 5KFRA 2BCVA 1ZQRA 1L7MA 2HCFA 1MSWD 1AQ6A 2KJ8A 4NM1A 4I2DA 2J6SA 3SMVA 4RQ1A 4MHVA 5ALUA 2W03A 2OCEA 2CN1A 4O3SA 2A1JB 3OJSA 9ICAA 1SWWA 2KFZA 4KLOA 2E8PA 3V6HA 1TE2A 2UVVA 4MEXA 9ICMA 1UT8A 1DK3A 3RAXA 7ICGA 4UW9A 4C8LA 5DQGA 4IQTA 4O5KA 2XY5A 4PHAA 4Y2XA 4PGQA 4DFJA 5KFOA 4XUSA 4UAYA 2BKEA 3RJIA 4Y2RA 3N97B 3GV8B 5KFLA 2LHTA 1Z3EB 1UHUA 1Z1VA 5DLGA 2P66A 2I1QA 1L8LA 3UM9A 4RQ4A 1CI4A 5HMLA 3K1ZA 1SXDA 1L7OA 2EDUA 1Q3VA 3AEVA 3R9KA 5J0OA 2F8KA 5L1LA 4R8UB 2ZUDA 4DLEA 4UB4A 3PO4A 1RQNA 3BZKA 3PW7A 2KJ5A 3AN1A 4NY8A 2VKQA 3AUOA 8ICHA 5EWEA 4C7YA 5J2EA 1T7PA 3BS7A 3D2SA 1ZOLA 3Q8SB 4LZDA 5GTHU 5DQIA 4QZDA 4DL6A 3RB6A 1ZQUA 5C5JA 3KHGA 1RM6C 2LBOA 1ZQPA 4RQ5A 5HP4A 4E0DA 1ZQBA 1Y88A 3GIMA 4P4PA 8ICCA 4KLJA 5KG0A 1TAQA 2XIDA 2P35A 7ICLA 3QX7A 1JUDA 3WU2U 3KFUF 3AL0B 3WK9A 5KAFU 4GFJA 4FBTA 2WB1C 5KFMA 3EWAA 2KE7A 3HRDD 4KLHA 4KLLA 3RJHA 3UXPA 2XCPA 3WKCA 3WK4A 3UMBA 5AM1A 5KFSA 2E5SA 4AYBC 2F76X 4RPXA 1SZPA 3K4GA 3Q8LA 2XGPA 1DRGA 4GC7A 4Z6EA 3T3FA 2ZIVB 4RQ8A 3DV9A 3QUCA 2I9GA 5KFDA 3QYPA 1RZTA 1QCKA 5KFFA 5J2AA 4QWAA 3H8JA 5KG6A 3PY8A 8ICZA 1KN5A 2G5HB 5DQHA 4CF3A 4DQRA 2KZMA 1RXWA 1HIWA 5F3XB 2YQEA 1Q8KA 2KHVA 5AKLA 3UXOA 3I28A 1ECWA 2K4IA 4C4TA 9ICJA 2UVRA 3WK6A 1B22A 2F1IA 2JZBA 3HPOA 5KT3A 1SGGA 1YZ7A 4BX9C 9ICCA 3MDCA 8ICQA 4RNOA 4Y2QA 3G6VA 1TK8A 1BNPA 3N7SC 4ED8A 2XICA 5L1MA 2W9BB 8ICTA 4MFAA 5CB1A 4ECTA 5KFHA 3PMNA 2UVWA 2AQ0A 3SAGA 3QXGA 4F93B 3IDWA 2AXTU 4Q8FA 1PK1A 1NJZA 4QZFA 1YT3A 3G6XA 3QU7A 5AKXA 4UARA 4O9MA 2FLLA 3HWTA 1N56A 3PO5A 2JMGA 1NKBA 1B0XA 1WWUA 2FPLA 1V38A 3GV7B 3C2MA 2KFNA 4F92B 3MFIA 4NLNA 2AHOB 2KHQA 4DOCA 2KIWA 1LV5A 5J2GA 4I2CA 4F72A 1JRPA 5J2FA 2C2EA 4YR0A 4F4YA 4QZ9A 3QEAZ 2W8LA 3RJFA 2YX8A 5J2CA 4YXJA 4QZGA 9ICWA 5ALNA 2W9MA 2NRWA 9ICXA 4USAA 4EYIB 2IOHA 4I2FA 3IP4B 5CWRA 5TISU 2BPGA 3C1ZA 1TK0A 2NRZA 2VIXA 4KN7A 3SAHA 2ASDA 3IM1A 4ECYA 3JPQA 3TI0A 4LJXA 3E2EA 5HMMA 4FZMA 5ALRA 2E8MA 5EOZA 3N28A 1S0OA 2BQUA 1ZQZA 4F4XA 5AKKA 4QZ8A 8ICVA 2YMQA 2DGZA 4YFKA 2ZTEA 1JIHA 1ZJMA 3O0FA 5G5GA 3QU9A 3RH6A 3JPNA 3RBDA 3AU6A 5AK3A 3ISBA 2VJ4A 3PW0A 5J8YA 3OHBA 2WTFA 2QLTA 4I29A 3KHRA 5AKGA 3TAQA 4PHPA 4XQ8A 2KKVA 1F0MA 1QQ7A 3MDAA 5AIAA 2ZG6A 4OJLA 2J6UA 5ALMA 3BDPA 1X66A 1TFRA 3JPRA 2AGPA 7ICEA 5AKIA 1IM4A 5ALJA 4I28A 3M8SA 3LK9A 1FFVA 4C4RA 8ICWA 3MABA 1X9XA 1J97A 2MRLA 4I2GA 4DF8A 3KD3A 4EBCA 4O3QA 5AI9A 2CXYA 1V85A 2IMWP 5AKHA 1UA0A 2HHVA 3M1YA 2PFPA 3PVXA 4ICAA 2F44A 2KSOB 3ISDA 4KTQA 1XC9A 4ECXA 5ALSA 5AKJA 1SV0A 5AI0A 1BGXT 4O3PA 4Y2TA 3KTQA 5A0LA 1SV0C 3THVA 2JEFA 4GXJA 5DDMA 1RYSA 2LM4A 5KT4A 1L3VA 1OXJA 4P4OA 2Q0ZX 1RQLA 2ZTCA 4JV1A 2RHFA 1A0PA 5ALIA 1F5SA 2C28A 4A8EA 1LVHA 2Z7JA 3GV5B 2LPEA 4B9VA 4P4MA 2MSNA 1PVPA 2F1JA 1SL1A 1UPHA 4FS1A 5ALEA 3H8WA 4ECQA 4CRXA 1O08A 4F5QA 1ZQNA 1TK5A 4CE6A 2PXIA 3ORYA 5EE9A 1ZQTA 1PZNA 1ZRMA 4DF4A 4DSLA 5IIKA 2A3VA 4DL2A 2F8LA 2W9AA 1PVQA 4C0ZA 4CNQA 9ICOA 3ZDEA 1SIJA 2FDRA 2XY6A 2K89A 4FZLA 4DL4A 2E8NA 2ZXIA 2HHUA 4OJPA 2WF5A 5KFWA 4QZHA 3Q8KA 4KMUA 4F3OA 5KG2A 3TARA 3HILA 1KDHA 2H3ZA 3MGIA 4RQ7A 2R8GA 5FP0A 2JRZA 3RR8A 3WKDA 2G5IB 4NM2A 3JPSA 5EWGA 4DOAA 4I2IA 3H0RB 3ZD9A 1TV9A 2WB1F 2K8BB 2R18A 4QWBA 3L3FX 2MUTA 3C1YA 2IBKA 4DLGA 5DB9A 2HDOA 5ALFA 4AYBF 1XU4A 4KN4A 2W43A 4M2YA 5KFGA 5B5EU 1MN8A 1BPXA 1FO4A 5HR7A 2LKYA 7ICHA 5IILA 3PW2A 1Q3UA 4RUAA 1X42A 4RPZA 5AKYA 5BOMA 1WCNA 9ICIA 2YMMA 1IV8A 4F50A 4C8KA 1ZQXA 2A1AA 2H3VA 3DEEA 4I2JA 3BQ2A 4YXMA 3RAQA 4NLBA 1L3SA 3KKAA 1VDVA 4FZNA 5F9NA 1X9MA 3ETLA 4FS2A 1X9SA 2RP5A 5EE1A 5KFEA 3KZXA 3PX4A 5ALOA 3V72A 1KSPA 2W7PA 1TVAA 2VA8A 3UMCA 4PH5A 4P0QA 4C4SA 8ICRA 3NTUA 3M7DA 4DQQA 4EENA 1A6SA 1QSYA 1NK0A 8ICEA 2HVIA 2KP7A 2XY7A 2LM1A 3V7JA 2E8OA 2KICA 2ZIXB 1BPDA 1N63A 4PL2A 1BPZA 4M9GA 5T14A 1O03A 3SAFA 2HHWA 2N1RA 4UB5A 3HJEA 3M9OB 2KV2A 3BS5A 2YMLA 2HVHA 2BR0A 3IG8A 4YMNA 5J29A 4NLGA 1ZQWA 1ZXIA 3SI8A 1NK9A 3VC8A 3IV6A 2GH1A 5AM0A 1XNSA 3UPQA 3T5LA 2E1FA 2Q4TA 3FDSA 2H3FA 1JX4A 1JXLA 1S97A 3MC1A 3LVWA 1CEZA 2AJQA 5AI6A 7ICQA 3RB3A 2WF7A 2RDIA 1ZD5A 2EQYA 4O3MA 1SV4A 5KFYA 2IOFA 2OM6A 3D2QA 2GLEA 1T3QA 5CJ7A 5KNIA 4P0PB 2EANA 3RTVA 8ICFA 3OJUA 4DSIA 4B9UA 4UAZA 3JPTA 3M6KA 1T94A 2W11A 2I6XA 4EBEA 3QUBA 3N7RC 2G06A 8ICAA 3RRGA 2Y1IA 3F5AA 9ICEA 1SB3C 3BQTA 5ALDA 1S10A 2BCRA 3RH5A 3ICXA 5CA7A 4G3IA 3QU2A 3DDHA 2PFQA 4J9RA 5BOLA 5ALLA 4F71A 3TADA 2JH1A 5HHHA 3I1YA 2WF8A 1KBUA 1NOMA 5L1JA 3TADC 3SV3A 1KQQA 4Q43A 2ZXHA 8ICUA 2GWSA 5HHIA 2A1JA 4KLUA 2WAQC 1ZQSA 2BCUA 3HX0A 4F4WA 4J9NA 2M0NA 5DBBA 1ZQCA 2B0CA 4BXOB 1U49A 4O3RA 4ECSA 2XC9A 4Q45A 5ALVA 2K60A 1C20A 5KFQA 4RQMA 4ECWA 1KW4A 3H7IA 1ZQMA 5L1IA 2ZIWB 1YZ6A 4EYHB 4EZ6A 4IQWA 5H2FU 1ZETA 9ICVA 2HOFA 3H40A 2ISPA 2OEHA 3UQ2A 3KOOA 2GOLA 5DLFA 8ICYA 3H8MA 5KT7A 4DFMA 4JMUA 2EZYA 4R8UA 3C28A 2VJ5A 3H4BA 4BUGA 3SQIA 3ZDAA 2HBKA 2JXJA 3T79A 3NVWA 1BNOA 2K8AA 1N5WA 2AU0A 5DBAA 1T4GA 4CF4A 2AGOA 1WCLA 4QW8A 3UMGA 5KT2A 1XO0A 4YR2A 8ICKA 5AKZA 1SXEA 1X6JA 1RXVA 4KLGA 2XI9A 3BQ7A 3GFKB 1JN3A 7ICVA 1XSLA 1K1SA 1MA7A 2B21A 2NRVA 4DS4A 3K1RB 1Z00B 1JROA 2JGAA 5KG7A 3F5EA 4P2HA 2W3RA 4IR1A 3MFHA 3QZ7A 3KHLA 2DF4B 2QARB 4KLFA 3BZCA 4B9MA 4MF8A 2EAMA 5KG3A 4JWMA 3QNMA 1BPBA 2E3TA 1LKYB 2DKZA 3WK8A 2JEJA 9ICPA 3KZIU 4DL3A 3H8SA 4Q44A 3FC4A 1D8LA 5DGBA 2ZIVA 1ED1A 1S76D 1IXRA 2HHSA 2FPKA 3WKBA 4MFFA 2G0AA 4NXZA 4OCZA 3CYMA 2FMSA 3IN5A 2MU2A 9ICNA 4QJFB 2ZIUB 3F2DA 1N61A 5DGAA 2KZZA 2V9WA 2BDPA 1KL9A 1IIPA 3N7PD 4NV0A 3C2LA 4DL7A 2G07A 5DKWA 4KX3A 4YVZA 1KTQA 2BHNA 4GIBA 5JUMA 1RG6A 3HKZC 3H0MB 4MFCA 5KFCA 4RQ0A 2W8KA 4NWIA 1SL0A 4F2SA 1ZQYA 3U26A 2W9BA 5KFNA 4KMOB 3A0HU 4K4GA 1L6NA 4R63A 1UQVA 4UATA 3KBBA 1MC8A 4M9HA 2W55A 4PHEA 3ALRA 8ICJA 2DBYA 2IHMA 9ICFA 1QSSA 4NL9A 3OHAA 5AK6A 1L5UA 4CF5A 4O5CA 4NL9C 1MQ2A 1KKXA 4NLCA 1NKEA 4ECRA 5D4BA 3PW4A 8ICNA 2LYAA 3QUTA 1D8YA 2DPIA 4J9MA 3FYHA 4RQNA 2R8KA 4IQUA 2GO7A 5ALWA 1NNLA 1BPEA 5AHXA 3QEBZ 2H3IA 5IIIA 1NK5A 1QLNA 2FMQA 2A19A 5K4LA 3ZI4A 5KFKA 1D8BA 2W9CB 4UQGA 4JV0A 4KLEA 7ICTA 7ICPA 1DK2A 4I2BA 4BGDA 5ALXA 4GXIA 1BPYA 1ZQGA 2W7OA 4CGZA 4MEYA 1H38A 7ICKA 2VA2A 4PZOA 5DG7A 3EPGA 3QU4A 4PHDA 5D49A 5KFIA 2Y1JA 2KNJA 3AU2A 4TQSA 4I2EA 2ZJ5A 1LB2B 1J2NA 3VCBA 4DOBA 1NK7A 1A76A 3J81j 3BJYA 2QB0B 5KAIU 3M8RA 5EE0A 3PV8A 3RH4A 3RRHA 1L3TA 2JH7A 3RBEA 4CDGA 4F5OA 2ASJA 4YD1A 3TQ1A 7ICSA 5EWFA 5KT5A 3QUQA 1ZQAA 1ZYQA 3EPIA 3CRXA 1JMSA 4UB2A 2NV3A 1NKCA 3QU5A 2J6TA 3MR3A 4DEZA 4YP3A 2HHQA 1N48A 5ALQA 5J0XA 1XS9D 1IG6A 4KLTA 3I76A 2BPFA 4DSKA 2ISOA 3PSFA 7ICUA 8ICOA 3E0FA 1WYGA 2OYYA 4RQ3A 1QTMA 4JB3A 4O3OA 9ICUA 4DQSA 2W9CA 4Y2YA 2ODGA 3GQCA 2Y0SC 5G5HA 2KVSA 5IINA 4QZAA 3NS1A 4DFDA 2F1HA 4C8OA 4OJ6A 3FM9A 4EX6A 5AIBA 2DQNB 2KSOA 2XVTA 3TACB 4ACOA 1UA1A 2K8CB 3ETRA 5J2JA 3TKAA 5KG5A 1ZQHA 2LYHA 3UQ0A 3AQFA 3T5JA 2KTQA 3C2KA 3CNHA 3CW2C 3MR5A 3RF9A 1KFTA 2WAQF 4ED1A 4FE3A 1OUQA 4OD0A 3PMLA 1S0MA 4RPYA 4J9PA 4EZ9A 5AKEA 4X5VA 2BGWA 5TZVA 2AQ4A 5DB6A 2PFOA 2P6UA 1S8OA 1SKRA 3IHQB 4Q8EA 4QIWC 4U7CA 3PSTA 1TAUA 3V7LA 3RFAA 5ALHA 1FIQA 4F4KA 1JXEA 1KFDA 9ICHA 1MQ3A 3L5KA 2Y9UA 4TURA 2BCSA 1XWLA 1GO3F 4C80A 4PPXA 5J0RA 1ZD4A 4R64A 4ZOHC 4DQPA 2I5HA 4UASA 4QZBA 4B6JA 4I27A 4JUZA 3WK7A 3OSNA 2NO4A 2PMZC 4RQ6A 4I2HA 3F2CA 3S6JA 3RJJA 3TANA 5DB7A 2F2AB 4IS7A 3BQ0A 4F5NA 4MF2A 4GXKA 2QKQA 5J0SA 2DWQA 3ONNA 2BPCA 2YB1A 1KFSA 3PX0A 3TFRA 3IG5A 2DPJA 3GZFA 5J0WA 5KFAA 1FEZA 4PZNA 4CCHA 2HOIA 3LWMA 2HW3A 5JU5A 4UB6U 1QQ5A 4LZGA 2LI6A 4YG2A 4UBCA 7ICFA 4ED6A 3N4MB 2D3DA 1NJWA 1SL2A 1JI7A 5B66U 1S0NA 1HUOA 1COKA 4M9LA 4UAWA 3WKEA 1L7PA 3PSIA 1ZJNA 1N5XA 3EYZA 3HP6A 4FO6A 1A77A 5ALYA 4EELA 4R65A 4B9SA 4Y2JA 4DSEA 4QWEA 3PX6A 2EZZA 5DBCA 4QWCA 4QNLA 1NI3A 3GIJA 5JRTA 9ICTA 2YY6A 2BDUA 2ES6A 2C22A 2JV3A 4M0AA 4O3NA 4YQWA 2DFLA 4ELTA 3MR2A 3ED5A 4QZCA 2OXOA 2LMRA 2BQ3A 5J2DA 4BDPA 1URJA 5AM4A 4YR3A 2HI0A 5ALZA 1WWVA 8ICMA 7ICJA 2PI5A 2R8JA 2IOFK 4TUPA 3OGUA 2O6KA 1FFUA 4J03A 2DUYA 2E1EA 2WF9A 4TQRA 2AGQA 5AM3A 4BWMA 2MAXA 4UBBA 2ZUCA 3PZPA 5IIOA 3HKZF 3CP8A 4J9QA 2V4QA 3PSPA 9ICKA 4JV2A 2B6GA 1Z19A 4F4ZA 1NZPA 1Z4OA 2KN7A 2ZIXA 3AQEA 5CHGA 1RPLA 2YTUA 2H5XA 2CPRA 1Z1BA 5KTQA 3MR6A 2NYVA 4QZIA 2EAOA 4J9LA 4Y2SA 3RB0A 1BVSA 3B0YA 3T5KA 3PR4A 4Y2VA 3HT3A 2KD1A 1CUKA 4Z6CA 3D2NA 2JZBB 3MGHA 7ICMA 4US8A 4DWIA 4DFPA 2OWOA 2HSZA 1U47A 1NJYA 1DGJA 4NJ8A 1OW5A 3KHHA 3EZ5A 2XCAA 4IR9A 4DSJA 5GTIU 1C7YA 1NK6A 1DOQA 3M6ZA 3GILA 4M6WB 3B9JA 4UB3A 4ED2A 1KEJA 5C0YA 3MBYA 4JK1A 9ICRA 4M9JA 5ALKA 3OSPA 4P0PA 2EZXA 1PK1B 3WK5A 2HBMA 2NRTA 1T8EA 5L1KA 3SD7A 3ZD8A 4KITB 4R66A 8ICXA 5AM2A 1UT5A 2WHEA 2F3NA 2JEIA 2VANA 2KJ9A 2HHXA 2KVCA 2JR5A 3Q8MA 5KFXA 4HYKA 4JWNA 5J2HA 3V7KA 3GDXA 5HNKA 2C2DA 5KL1B 5KFPA 1ZQQA 2KKPA 3LWLA 1JALA 2FPMA 4RT2A 4UB1A 2R8HA 3RJKA 2OH2A 1COOA 5KFVA 8ICSA 3H0LB 2YB4A 2FE9A 5AI5A 2P6RA 4ECVA 4RZRA 3TAPA 2HBJA 2WFAA 4O0IA 3C5FA 3NVYA 4RNNA 3K75D 1B4FA 5IIJA 4F2RA 2DL0A 1RYUA 4B9LA 3QZ8A 7ICRA 8ICIA 1N62A 3ISCA 4BXOA 1U4BA 4M6WA 8ICGA 2G09A 5CP2A 2XO7A 2Y0SF 1M6YA 5J0TA 4BJQA 3RJEA 4DQIA 4G9BA 2ZIWA 2G08A 4Z6FA 2KK0A 2V4RA 4KLSA 4XA5A 1XSPA 3UXNA 3V6KA 1XSNA 2HHTA 2ZTDA 1KRPA 4KLMA 1ZQIA 2KZ3A 4RNMA 2ASLA 2PKEA 4ECUA 3MGVA 4IC9A 1X40A 1DXSA 5KFTA 1NK4A 2JEGA 2IHNA 2BCQA 4PJ0U 5J2KA 3M9MB 4C7ZA 4US9A 3TFSA 4EX7A 4M9NA 4KLIA 4EEKA 4B9TA 4RQ2A 3SENA 5J0PA 3F2BA 4IRCA 1CRXA 3Q8QB 2NRXA 4DSFA 4F5PA 8ICBA 1J2MA 1SZHA 2M9NA 4ELVA 2NO5A 1ZQDA 4UAUA 4QIWF 4KLQA 2FI1A 2FJ6A 4YCXA 5AK5A 4QWDA 3LVVA 4B9NA 4J9KA 2JHDA 1Z00A 4FFDA 5IIMA 4OJOA 2PI4A 3GIKA 1WG8A 3C5GA 4Y2UA 2QARA 4YN4A 1NK8A 2XGQA 3RB4A 1LKYA 3WKAA 3RJGA 3SV4A 2PMZF 1PK3A 2D8CA 4RU9A 1Q46A 2W3SA 4K4HA 4UB8U 5J8YC 2HOQA 4QZEA 2RLTA 2HBLA 5KFJA 2BQRA 4YD2A 5KG1A 3NRWA 4DFKA 5KFUA 4YMOA 1S5LU 9ICSA 1HEKA 2KMDA 5KL8B 1D9DA 2FLPA 3NUQA 5DG8A 3V6JA 5DB8A 2C2RA 2ATLA 1F44A 3ZDCA 2ZIUA 4C8MA 2BZFA 2EAPA 4ZH4A 4YMMA 1KLNA 2PFNA 7ICOA 4GC6A 1X6IA 2EH9A 2H3QA 2QB1A 3NRZA 5BPCA 4AP9A 4LVSA 2UVUA 2R8IA 2RDJA 4IL6U 4F8RA
chains in the Genus database with same CATH topology
2KKVA 3RFAA 2NV3A 2ZG6A 4OJLA 2A3VA 2F8LA 2XIDA 4KMOB 1L6NA 1YT3A 2W7PA 3F53A 1PVQA 2KJ8A 4C0ZA 2CRXA 2E1EA 4P0QA 1GO3F 2KJ9A 3ALRA 3KFUF 2KEYA 3SMVA 1XO0A 2K89A 2KVCA 3M7DA 2JMGA 2JH1A 3PSFA 3AL0B 1A6SA 4FZLA 2W03A 4GFJA 2WB1C 1KBUA 2ZXIA 3F2BA 2XI9A 4OJPA 1NZBA 5CRXA 2K4HA 1CRXA 2MRLA 3PZPA 2CN1A 3HKZF 4NLCA 3E0FA 2KICA 2ZIXB 5HR6A 2OYYA 2KHQA 3CP8A 5KL1B 4PL2A 2PMZC 2KIWA 3F2CA 1SZHA 2ZXHA 2W04A 2KKPA 3PSPA 5T14A 1MA7A 4AYBC 2H3ZA 2LYAA 2E5SA 2F2AB 3SAFA 2RRDA 2F76X 2N1RA 1Z19A 2OH2A 2JGAA 2KOBA 2KV2A 4QIWF 2Y0SC 3F5EA 4ICAA 3ONNA 2ZIXA 2G5IB 3AQEA 2WAQC 2YB1A 3H0LB 1DRGA 2DF4B 2YX8A 4OO1J 3IG8A 3LVVA 2YB4A 3IG5A 2H3IA 3GZFA 4OJ6A 2LYBA 2JHDA 1WUDA 2ZIVB 2HOIA 2CPRA 1Z1BA 2HBJA 3VC8A 4OJOA 5A0LA 2GH1A 1D8BA 1XNSA 1P7DA 2DQNB 2M0NA 3IP4B 3H0RB 2XVTA 2WB1F 2E1FA 4ACOA 4OJ5A 2K8BB 2Q4TA 1TAMA 2R18A 2G5HB 2H3FA 2LHTA 2ZIVA 1ED1A 3L3FX 3OPXA 2W7OA 4CGZA 2KD1A 3LYSA 2K8CB 2VIXA 3SAHA 3LVWA 2PMZF 3PSIA 1HIWA 2ZIWB 2K4EA 3GU3A 2G0AA 2RHFA 3AQFA 1A0PA 3D2NA 4AYBF 2D6FC 2G09A 3K1ZA 4A8EA 4FZMA 2KNJA 2KHVA 2MA1A 3CYMA 2HOQA 2HOFA 1ECWA 2HBLA 2K4IA 3RF9A 2LKYA 2Y0SF 3IN5A 1ZQ1C 1Q3UA 1Q3VA 5HR7A 4O3MA 4KX5A 4BJQA 4U6PA 2WAQF 3VCBA 2OM6A 3D2QA 4QJFB 2Z7JA 2DGZA 2G08A 2ZIWA 4FE3A 3ICXA 1OUQA 3NRWA 2ZIUB 2GOLA 3F2DA 3M6ZA 4QNLA 4P0PB 2KJ5A 3O0FA 1IIPA 1HEKA 3N7PD 1PVPA 4WJ3B 4NV0A 3PSTA 4JMUA 4BX9C 1UPHA 2G07A 2VKQA 1PVRA 5KL8B 2BDUA 5C0YA 3NUQA 4KX3A 4PL1A 3M6KA 4CRXA 2VJ4A 1F44A 3D2SA 2H3VA 1T94A 2ZIUA 3DEEA 3HKZC 3C28A 3N7SC 2VJ5A 3H0MB 2JH7A 3N7RC 4P0PA 4BUGA 2F77X 2G06A 2XICA 2OXOA 4CDGA 4NLBA 3SQIA 2HBMA 4FZNA 2HBKA 2H3QA 3F5AA 3MGVA 1URJA 3T79A 4IC9A 3SAGA 2RP5A 3C29A 2HMXA 2LBOA 4P0QB 4QIWC 4NWIA 4U7CA 3KZXA 3CRXA 2K8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7P D;  3AQF A;  3AQE A;  2XVT A;  2YX8 A;  3N7S C;  3N7R C; 
#chains in the Genus database with same CATH topology
 4F91 B;  1S77 D;  2KIV A;  1RDF A;  4Y2P A;  7ICI A;  9ICB A;  4HAI A;  3GII A;  2RQ5 A;  3NVV A;  3F53 A;  4ELU A;  3NAS A;  3NGD A;  1N2X A;  4DCC A;  1T3N A;  3A0B U;  1NZB A;  2K4H A;  1L3U A;  4IQV A;  5J2B A;  3E58 A;  3SEI A;  2FMP A;  5L9X A;  2W04 A;  1K5O A;  5DG9 A;  1VLB A;  2KOB A;  1S0V A;  5ALP A;  4IRD A;  5KT6 A;  5J0Y A;  2DKX A;  1ZD3 A;  5KFZ A;  1V97 A;  9ICQ A;  4ED0 A;  2MUT B;  2ZJ8 A;  4DO9 A;  3FAH A;  3HW8 A;  1L7N A;  3AM9 A;  4O5E A;  3C23 A;  1ARO P;  4RT3 A;  3AMZ A;  1SWV A;  4DL5 A;  4NLK A;  1X9W A;  1V9P A;  3Q8P B;  1QSL A;  2ESE A;  5JTI A;  2MA1 A;  2YMP A;  1ZQ1 C;  4KLD A;  2ALZ A;  1VJ5 A;  4QW9 A;  4J9S A;  1XO1 A;  5DDY A;  4DS5 A;  1N60 A;  4WJ3 B;  1ZQF A;  3RR7 A;  3Q8R B;  3D6J A;  1SKS A;  5F9L A;  4PL1 A;  3ZDD A;  5ALT A;  5AIC A;  2FLN A;  4UAV A;  2AH5 A;  2F77 X;  2QB0 A;  3IRU A;  1B43 A;  4RUC A;  1ZQL A;  3PNC A;  8ICP A;  5CR0 A;  1U45 A;  4GLX A;  3NVZ A;  3OTQ A;  2HMX A;  5ALG A;  4P0Q B;  1QH9 A;  4EBD A;  5E79 U;  3T5H A;  4TUS A;  3PR5 B;  4K4I A;  4BWJ A;  4J9O A;  4ECZ A;  5AM5 A;  3G6Y A;  3JPO A;  2CRX A;  8ICL A;  5KFB A;  3SZ2 A;  3QE9 Y;  1L8O A;  5D46 A;  2KEY A;  2Y9T A;  2ZJA A;  1S9F A;  5CRX A;  3SR6 A;  4NLZ A;  1U9L A;  3BS5 B;  1QQ6 A;  1K1Q A;  2VA3 A;  3C21 A;  3B0X A;  2IA6 A;  5HR6 A;  7ICN A;  2W54 A;  5J0Q A;  1ZQK A;  1RYR A;  2RRD A;  3L4P A;  1U48 A;  5AI4 A;  2K4P A;  3LDA A;  3JPP A;  5J0U A;  4OO1 J;  1ZQE A;  2LYB A;  2WF6 A;  1WUD A;  5KG4 A;  3ZDB A;  5J2I A;  1ZQO A;  3SYZ A;  1P7D A;  4PGX A;  4IRK A;  2ZUB A;  4FBU A;  2OHF A;  4OJ5 A;  4I2A A;  1TAM A;  4XRH A;  3OPX A;  3LYS A;  3BQ1 A;  4F5R A;  2KG5 A;  1PUZ A;  3GU3 A;  2K4E A;  1ZQV A;  2D6F C;  1UCV A;  4M04 A;  1HUZ A;  4Z6D A;  9ICL A;  3KKA C;  4KX5 A;  4U6P A;  5AI8 A;  4C8N A;  3H4D A;  1EXN A;  1Z4N A;  1D9F A;  4ED3 A;  5EE3 A;  1NJX A;  3EUB 2;  1ZQJ A;  3PW5 A;  4M47 A;  4TUQ A;  3M9N B;  2YN4 A;  1PVR A;  1X2I A;  1SKW A;  9ICG A;  5AK4 A;  1TKD A;  4PGY A;  1HJP A;  4EEY A;  1ZRN A;  1DGS A;  3C29 A;  3EW9 A;  4ED7 A;  1ZD2 P;  5CEH A;  2L5Y A;  5KFR A;  2BCV A;  1ZQR A;  1L7M A;  2HCF A;  1MSW D;  1AQ6 A;  2KJ8 A;  4NM1 A;  4I2D A;  2J6S A;  3SMV A;  4RQ1 A;  4MHV A;  5ALU A;  2W03 A;  2OCE A;  2CN1 A;  4O3S A;  2A1J B;  3OJS A;  9ICA A;  1SWW A;  2KFZ A;  4KLO A;  2E8P A;  3V6H A;  1TE2 A;  2UVV A;  4MEX A;  9ICM A;  1UT8 A;  1DK3 A;  3RAX A;  7ICG A;  4UW9 A;  4C8L A;  5DQG A;  4IQT A;  4O5K A;  2XY5 A;  4PHA A;  4Y2X A;  4PGQ A;  4DFJ A;  5KFO A;  4XUS A;  4UAY A;  2BKE A;  3RJI A;  4Y2R A;  3N97 B;  3GV8 B;  5KFL A;  2LHT A;  1Z3E B;  1UHU A;  1Z1V A;  5DLG A;  2P66 A;  2I1Q A;  1L8L A;  3UM9 A;  4RQ4 A;  1CI4 A;  5HML A;  3K1Z A;  1SXD A;  1L7O A;  2EDU A;  1Q3V A;  3AEV A;  3R9K A;  5J0O A;  2F8K A;  5L1L A;  4R8U B;  2ZUD A;  4DLE A;  4UB4 A;  3PO4 A;  1RQN A;  3BZK A;  3PW7 A;  2KJ5 A;  3AN1 A;  4NY8 A;  2VKQ A;  3AUO A;  8ICH A;  5EWE A;  4C7Y A;  5J2E A;  1T7P A;  3BS7 A;  3D2S A;  1ZOL A;  3Q8S B;  4LZD A;  5GTH U;  5DQI A;  4QZD A;  4DL6 A;  3RB6 A;  1ZQU A;  5C5J A;  3KHG A;  1RM6 C;  2LBO A;  1ZQP A;  4RQ5 A;  5HP4 A;  4E0D A;  1ZQB A;  1Y88 A;  3GIM A;  4P4P A;  8ICC A;  4KLJ A;  5KG0 A;  1TAQ A;  2XID A;  2P35 A;  7ICL A;  3QX7 A;  1JUD A;  3WU2 U;  3KFU F;  3AL0 B;  3WK9 A;  5KAF U;  4GFJ A;  4FBT A;  2WB1 C;  5KFM A;  3EWA A;  2KE7 A;  3HRD D;  4KLH A;  4KLL A;  3RJH A;  3UXP A;  2XCP A;  3WKC A;  3WK4 A;  3UMB A;  5AM1 A;  5KFS A;  2E5S A;  4AYB C;  2F76 X;  4RPX A;  1SZP A;  3K4G A;  3Q8L A;  2XGP A;  1DRG A;  4GC7 A;  4Z6E A;  3T3F A;  2ZIV B;  4RQ8 A;  3DV9 A;  3QUC A;  2I9G A;  5KFD A;  3QYP A;  1RZT A;  1QCK A;  5KFF A;  5J2A A;  4QWA A;  3H8J A;  5KG6 A;  3PY8 A;  8ICZ A;  1KN5 A;  2G5H B;  5DQH A;  4CF3 A;  4DQR A;  2KZM A;  1RXW A;  1HIW A;  5F3X B;  2YQE A;  1Q8K A;  2KHV A;  5AKL A;  3UXO A;  3I28 A;  1ECW A;  2K4I A;  4C4T A;  9ICJ A;  2UVR A;  3WK6 A;  1B22 A;  2F1I A;  2JZB A;  3HPO A;  5KT3 A;  1SGG A;  1YZ7 A;  4BX9 C;  9ICC A;  3MDC A;  8ICQ A;  4RNO A;  4Y2Q A;  3G6V A;  1TK8 A;  1BNP A;  3N7S C;  4ED8 A;  2XIC A;  5L1M A;  2W9B B;  8ICT A;  4MFA A;  5CB1 A;  4ECT A;  5KFH A;  3PMN A;  2UVW A;  2AQ0 A;  3SAG A;  3QXG A;  4F93 B;  3IDW A;  2AXT U;  4Q8F A;  1PK1 A;  1NJZ A;  4QZF A;  1YT3 A;  3G6X A;  3QU7 A;  5AKX A;  4UAR A;  4O9M A;  2FLL A;  3HWT A;  1N56 A;  3PO5 A;  2JMG A;  1NKB A;  1B0X A;  1WWU A;  2FPL A;  1V38 A;  3GV7 B;  3C2M A;  2KFN A;  4F92 B;  3MFI A;  4NLN A;  2AHO B;  2KHQ A;  4DOC A;  2KIW A;  1LV5 A;  5J2G A;  4I2C A;  4F72 A;  1JRP A;  5J2F A;  2C2E A;  4YR0 A;  4F4Y A;  4QZ9 A;  3QEA Z;  2W8L A;  3RJF A;  2YX8 A;  5J2C A;  4YXJ A;  4QZG A;  9ICW A;  5ALN A;  2W9M A;  2NRW A;  9ICX A;  4USA A;  4EYI B;  2IOH A;  4I2F A;  3IP4 B;  5CWR A;  5TIS U;  2BPG A;  3C1Z A;  1TK0 A;  2NRZ A;  2VIX A;  4KN7 A;  3SAH A;  2ASD A;  3IM1 A;  4ECY A;  3JPQ A;  3TI0 A;  4LJX A;  3E2E A;  5HMM A;  4FZM A;  5ALR A;  2E8M A;  5EOZ A;  3N28 A;  1S0O A;  2BQU A;  1ZQZ A;  4F4X A;  5AKK A;  4QZ8 A;  8ICV A;  2YMQ A;  2DGZ A;  4YFK A;  2ZTE A;  1JIH A;  1ZJM A;  3O0F A;  5G5G A;  3QU9 A;  3RH6 A;  3JPN A;  3RBD A;  3AU6 A;  5AK3 A;  3ISB A;  2VJ4 A;  3PW0 A;  5J8Y A;  3OHB A;  2WTF A;  2QLT A;  4I29 A;  3KHR A;  5AKG A;  3TAQ A;  4PHP A;  4XQ8 A;  2KKV A;  1F0M A;  1QQ7 A;  3MDA A;  5AIA A;  2ZG6 A;  4OJL A;  2J6U A;  5ALM A;  3BDP A;  1X66 A;  1TFR A;  3JPR A;  2AGP A;  7ICE A;  5AKI A;  1IM4 A;  5ALJ A;  4I28 A;  3M8S A;  3LK9 A;  1FFV A;  4C4R A;  8ICW A;  3MAB A;  1X9X A;  1J97 A;  2MRL A;  4I2G A;  4DF8 A;  3KD3 A;  4EBC A;  4O3Q A;  5AI9 A;  2CXY A;  1V85 A;  2IMW P;  5AKH A;  1UA0 A;  2HHV A;  3M1Y A;  2PFP A;  3PVX A;  4ICA A;  2F44 A;  2KSO B;  3ISD A;  4KTQ A;  1XC9 A;  4ECX A;  5ALS A;  5AKJ A;  1SV0 A;  5AI0 A;  1BGX T;  4O3P A;  4Y2T A;  3KTQ A;  5A0L A;  1SV0 C;  3THV A;  2JEF A;  4GXJ A;  5DDM A;  1RYS A;  2LM4 A;  5KT4 A;  1L3V A;  1OXJ A;  4P4O A;  2Q0Z X;  1RQL A;  2ZTC A;  4JV1 A;  2RHF A;  1A0P A;  5ALI A;  1F5S A;  2C28 A;  4A8E A;  1LVH A;  2Z7J A;  3GV5 B;  2LPE A;  4B9V A;  4P4M A;  2MSN A;  1PVP A;  2F1J A;  1SL1 A;  1UPH A;  4FS1 A;  5ALE A;  3H8W A;  4ECQ A;  4CRX A;  1O08 A;  4F5Q A;  1ZQN A;  1TK5 A;  4CE6 A;  2PXI A;  3ORY A;  5EE9 A;  1ZQT A;  1PZN A;  1ZRM A;  4DF4 A;  4DSL A;  5IIK A;  2A3V A;  4DL2 A;  2F8L A;  2W9A A;  1PVQ A;  4C0Z A;  4CNQ A;  9ICO A;  3ZDE A;  1SIJ A;  2FDR A;  2XY6 A;  2K89 A;  4FZL A;  4DL4 A;  2E8N A;  2ZXI A;  2HHU A;  4OJP A;  2WF5 A;  5KFW A;  4QZH A;  3Q8K A;  4KMU A;  4F3O A;  5KG2 A;  3TAR A;  3HIL A;  1KDH A;  2H3Z A;  3MGI A;  4RQ7 A;  2R8G A;  5FP0 A;  2JRZ A;  3RR8 A;  3WKD A;  2G5I B;  4NM2 A;  3JPS A;  5EWG A;  4DOA A;  4I2I A;  3H0R B;  3ZD9 A;  1TV9 A;  2WB1 F;  2K8B B;  2R18 A;  4QWB A;  3L3F X;  2MUT A;  3C1Y A;  2IBK A;  4DLG A;  5DB9 A;  2HDO A;  5ALF A;  4AYB F;  1XU4 A;  4KN4 A;  2W43 A;  4M2Y A;  5KFG A;  5B5E U;  1MN8 A;  1BPX A;  1FO4 A;  5HR7 A;  2LKY A;  7ICH A;  5IIL A;  3PW2 A;  1Q3U A;  4RUA A;  1X42 A;  4RPZ A;  5AKY A;  5BOM A;  1WCN A;  9ICI A;  2YMM A;  1IV8 A;  4F50 A;  4C8K A;  1ZQX A;  2A1A A;  2H3V A;  3DEE A;  4I2J A;  3BQ2 A;  4YXM A;  3RAQ A;  4NLB A;  1L3S A;  3KKA A;  1VDV A;  4FZN A;  5F9N A;  1X9M A;  3ETL A;  4FS2 A;  1X9S A;  2RP5 A;  5EE1 A;  5KFE A;  3KZX A;  3PX4 A;  5ALO A;  3V72 A;  1KSP A;  2W7P A;  1TVA A;  2VA8 A;  3UMC A;  4PH5 A;  4P0Q A;  4C4S A;  8ICR A;  3NTU A;  3M7D A;  4DQQ A;  4EEN A;  1A6S A;  1QSY A;  1NK0 A;  8ICE A;  2HVI A;  2KP7 A;  2XY7 A;  2LM1 A;  3V7J A;  2E8O A;  2KIC A;  2ZIX B;  1BPD A;  1N63 A;  4PL2 A;  1BPZ A;  4M9G A;  5T14 A;  1O03 A;  3SAF A;  2HHW A;  2N1R A;  4UB5 A;  3HJE A;  3M9O B;  2KV2 A;  3BS5 A;  2YML A;  2HVH A;  2BR0 A;  3IG8 A;  4YMN A;  5J29 A;  4NLG A;  1ZQW A;  1ZXI A;  3SI8 A;  1NK9 A;  3VC8 A;  3IV6 A;  2GH1 A;  5AM0 A;  1XNS A;  3UPQ A;  3T5L A;  2E1F A;  2Q4T A;  3FDS A;  2H3F A;  1JX4 A;  1JXL A;  1S97 A;  3MC1 A;  3LVW A;  1CEZ A;  2AJQ A;  5AI6 A;  7ICQ A;  3RB3 A;  2WF7 A;  2RDI A;  1ZD5 A;  2EQY A;  4O3M A;  1SV4 A;  5KFY A;  2IOF A;  2OM6 A;  3D2Q A;  2GLE A;  1T3Q A;  5CJ7 A;  5KNI A;  4P0P B;  2EAN A;  3RTV A;  8ICF A;  3OJU A;  4DSI A;  4B9U A;  4UAZ A;  3JPT A;  3M6K A;  1T94 A;  2W11 A;  2I6X A;  4EBE A;  3QUB A;  3N7R C;  2G06 A;  8ICA A;  3RRG A;  2Y1I A;  3F5A A;  9ICE A;  1SB3 C;  3BQT A;  5ALD A;  1S10 A;  2BCR A;  3RH5 A;  3ICX A;  5CA7 A;  4G3I A;  3QU2 A;  3DDH A;  2PFQ A;  4J9R A;  5BOL A;  5ALL A;  4F71 A;  3TAD A;  2JH1 A;  5HHH A;  3I1Y A;  2WF8 A;  1KBU A;  1NOM A;  5L1J A;  3TAD C;  3SV3 A;  1KQQ A;  4Q43 A;  2ZXH A;  8ICU A;  2GWS A;  5HHI A;  2A1J A;  4KLU A;  2WAQ C;  1ZQS A;  2BCU A;  3HX0 A;  4F4W A;  4J9N A;  2M0N A;  5DBB A;  1ZQC A;  2B0C A;  4BXO B;  1U49 A;  4O3R A;  4ECS A;  2XC9 A;  4Q45 A;  5ALV A;  2K60 A;  1C20 A;  5KFQ A;  4RQM A;  4ECW A;  1KW4 A;  3H7I A;  1ZQM A;  5L1I A;  2ZIW B;  1YZ6 A;  4EYH B;  4EZ6 A;  4IQW A;  5H2F U;  1ZET A;  9ICV A;  2HOF A;  3H40 A;  2ISP A;  2OEH A;  3UQ2 A;  3KOO A;  2GOL A;  5DLF A;  8ICY A;  3H8M A;  5KT7 A;  4DFM A;  4JMU A;  2EZY A;  4R8U A;  3C28 A;  2VJ5 A;  3H4B A;  4BUG A;  3SQI A;  3ZDA A;  2HBK A;  2JXJ A;  3T79 A;  3NVW A;  1BNO A;  2K8A A;  1N5W A;  2AU0 A;  5DBA A;  1T4G A;  4CF4 A;  2AGO A;  1WCL A;  4QW8 A;  3UMG A;  5KT2 A;  1XO0 A;  4YR2 A;  8ICK A;  5AKZ A;  1SXE A;  1X6J A;  1RXV A;  4KLG A;  2XI9 A;  3BQ7 A;  3GFK B;  1JN3 A;  7ICV A;  1XSL A;  1K1S A;  1MA7 A;  2B21 A;  2NRV A;  4DS4 A;  3K1R B;  1Z00 B;  1JRO A;  2JGA A;  5KG7 A;  3F5E A;  4P2H A;  2W3R A;  4IR1 A;  3MFH A;  3QZ7 A;  3KHL A;  2DF4 B;  2QAR B;  4KLF A;  3BZC A;  4B9M A;  4MF8 A;  2EAM A;  5KG3 A;  4JWM A;  3QNM A;  1BPB A;  2E3T A;  1LKY B;  2DKZ A;  3WK8 A;  2JEJ A;  9ICP A;  3KZI U;  4DL3 A;  3H8S A;  4Q44 A;  3FC4 A;  1D8L A;  5DGB A;  2ZIV A;  1ED1 A;  1S76 D;  1IXR A;  2HHS A;  2FPK A;  3WKB A;  4MFF A;  2G0A A;  4NXZ A;  4OCZ A;  3CYM A;  2FMS A;  3IN5 A;  2MU2 A;  9ICN A;  4QJF B;  2ZIU B;  3F2D A;  1N61 A;  5DGA A;  2KZZ A;  2V9W A;  2BDP A;  1KL9 A;  1IIP A;  3N7P D;  4NV0 A;  3C2L A;  4DL7 A;  2G07 A;  5DKW A;  4KX3 A;  4YVZ A;  1KTQ A;  2BHN A;  4GIB A;  5JUM A;  1RG6 A;  3HKZ C;  3H0M B;  4MFC A;  5KFC A;  4RQ0 A;  2W8K A;  4NWI A;  1SL0 A;  4F2S A;  1ZQY A;  3U26 A;  2W9B A;  5KFN A;  4KMO B;  3A0H U;  4K4G A;  1L6N A;  4R63 A;  1UQV A;  4UAT A;  3KBB A;  1MC8 A;  4M9H A;  2W55 A;  4PHE A;  3ALR A;  8ICJ A;  2DBY A;  2IHM A;  9ICF A;  1QSS A;  4NL9 A;  3OHA A;  5AK6 A;  1L5U A;  4CF5 A;  4O5C A;  4NL9 C;  1MQ2 A;  1KKX A;  4NLC A;  1NKE A;  4ECR A;  5D4B A;  3PW4 A;  8ICN A;  2LYA A;  3QUT A;  1D8Y A;  2DPI A;  4J9M A;  3FYH A;  4RQN A;  2R8K A;  4IQU A;  2GO7 A;  5ALW A;  1NNL A;  1BPE A;  5AHX A;  3QEB Z;  2H3I A;  5III A;  1NK5 A;  1QLN A;  2FMQ A;  2A19 A;  5K4L A;  3ZI4 A;  5KFK A;  1D8B A;  2W9C B;  4UQG A;  4JV0 A;  4KLE A;  7ICT A;  7ICP A;  1DK2 A;  4I2B A;  4BGD A;  5ALX A;  4GXI A;  1BPY A;  1ZQG A;  2W7O A;  4CGZ A;  4MEY A;  1H38 A;  7ICK A;  2VA2 A;  4PZO A;  5DG7 A;  3EPG A;  3QU4 A;  4PHD A;  5D49 A;  5KFI A;  2Y1J A;  2KNJ A;  3AU2 A;  4TQS A;  4I2E A;  2ZJ5 A;  1LB2 B;  1J2N A;  3VCB A;  4DOB A;  1NK7 A;  1A76 A;  3J81 j;  3BJY A;  2QB0 B;  5KAI U;  3M8R A;  5EE0 A;  3PV8 A;  3RH4 A;  3RRH A;  1L3T A;  2JH7 A;  3RBE A;  4CDG A;  4F5O A;  2ASJ A;  4YD1 A;  3TQ1 A;  7ICS A;  5EWF A;  5KT5 A;  3QUQ A;  1ZQA A;  1ZYQ A;  3EPI A;  3CRX A;  1JMS A;  4UB2 A;  2NV3 A;  1NKC A;  3QU5 A;  2J6T A;  3MR3 A;  4DEZ A;  4YP3 A;  2HHQ A;  1N48 A;  5ALQ A;  5J0X A;  1XS9 D;  1IG6 A;  4KLT A;  3I76 A;  2BPF A;  4DSK A;  2ISO A;  3PSF A;  7ICU A;  8ICO A;  3E0F A;  1WYG A;  2OYY A;  4RQ3 A;  1QTM A;  4JB3 A;  4O3O A;  9ICU A;  4DQS A;  2W9C A;  4Y2Y A;  2ODG A;  3GQC A;  2Y0S C;  5G5H A;  2KVS A;  5IIN A;  4QZA A;  3NS1 A;  4DFD A;  2F1H A;  4C8O A;  4OJ6 A;  3FM9 A;  4EX6 A;  5AIB A;  2DQN B;  2KSO A;  2XVT A;  3TAC B;  4ACO A;  1UA1 A;  2K8C B;  3ETR A;  5J2J A;  3TKA A;  5KG5 A;  1ZQH A;  2LYH A;  3UQ0 A;  3AQF A;  3T5J A;  2KTQ A;  3C2K A;  3CNH A;  3CW2 C;  3MR5 A;  3RF9 A;  1KFT A;  2WAQ F;  4ED1 A;  4FE3 A;  1OUQ A;  4OD0 A;  3PML A;  1S0M A;  4RPY A;  4J9P A;  4EZ9 A;  5AKE A;  4X5V A;  2BGW A;  5TZV A;  2AQ4 A;  5DB6 A;  2PFO A;  2P6U A;  1S8O A;  1SKR A;  3IHQ B;  4Q8E A;  4QIW C;  4U7C A;  3PST A;  1TAU A;  3V7L A;  3RFA A;  5ALH A;  1FIQ A;  4F4K A;  1JXE A;  1KFD A;  9ICH A;  1MQ3 A;  3L5K A;  2Y9U A;  4TUR A;  2BCS A;  1XWL A;  1GO3 F;  4C80 A;  4PPX A;  5J0R A;  1ZD4 A;  4R64 A;  4ZOH C;  4DQP A;  2I5H A;  4UAS A;  4QZB A;  4B6J A;  4I27 A;  4JUZ A;  3WK7 A;  3OSN A;  2NO4 A;  2PMZ C;  4RQ6 A;  4I2H A;  3F2C A;  3S6J A;  3RJJ A;  3TAN A;  5DB7 A;  2F2A B;  4IS7 A;  3BQ0 A;  4F5N A;  4MF2 A;  4GXK A;  2QKQ A;  5J0S A;  2DWQ A;  3ONN A;  2BPC A;  2YB1 A;  1KFS A;  3PX0 A;  3TFR A;  3IG5 A;  2DPJ A;  3GZF A;  5J0W A;  5KFA A;  1FEZ A;  4PZN A;  4CCH A;  2HOI A;  3LWM A;  2HW3 A;  5JU5 A;  4UB6 U;  1QQ5 A;  4LZG A;  2LI6 A;  4YG2 A;  4UBC A;  7ICF A;  4ED6 A;  3N4M B;  2D3D A;  1NJW A;  1SL2 A;  1JI7 A;  5B66 U;  1S0N A;  1HUO A;  1COK A;  4M9L A;  4UAW A;  3WKE A;  1L7P A;  3PSI A;  1ZJN A;  1N5X A;  3EYZ A;  3HP6 A;  4FO6 A;  1A77 A;  5ALY A;  4EEL A;  4R65 A;  4B9S A;  4Y2J A;  4DSE A;  4QWE A;  3PX6 A;  2EZZ A;  5DBC A;  4QWC A;  4QNL A;  1NI3 A;  3GIJ A;  5JRT A;  9ICT A;  2YY6 A;  2BDU A;  2ES6 A;  2C22 A;  2JV3 A;  4M0A A;  4O3N A;  4YQW A;  2DFL A;  4ELT A;  3MR2 A;  3ED5 A;  4QZC A;  2OXO A;  2LMR A;  2BQ3 A;  5J2D A;  4BDP A;  1URJ A;  5AM4 A;  4YR3 A;  2HI0 A;  5ALZ A;  1WWV A;  8ICM A;  7ICJ A;  2PI5 A;  2R8J A;  2IOF K;  4TUP A;  3OGU A;  2O6K A;  1FFU A;  4J03 A;  2DUY A;  2E1E A;  2WF9 A;  4TQR A;  2AGQ A;  5AM3 A;  4BWM A;  2MAX A;  4UBB A;  2ZUC A;  3PZP A;  5IIO A;  3HKZ F;  3CP8 A;  4J9Q A;  2V4Q A;  3PSP A;  9ICK A;  4JV2 A;  2B6G A;  1Z19 A;  4F4Z A;  1NZP A;  1Z4O A;  2KN7 A;  2ZIX A;  3AQE A;  5CHG A;  1RPL A;  2YTU A;  2H5X A;  2CPR A;  1Z1B A;  5KTQ A;  3MR6 A;  2NYV A;  4QZI A;  2EAO A;  4J9L A;  4Y2S A;  3RB0 A;  1BVS A;  3B0Y A;  3T5K A;  3PR4 A;  4Y2V A;  3HT3 A;  2KD1 A;  1CUK A;  4Z6C A;  3D2N A;  2JZB B;  3MGH A;  7ICM A;  4US8 A;  4DWI A;  4DFP A;  2OWO A;  2HSZ A;  1U47 A;  1NJY A;  1DGJ A;  4NJ8 A;  1OW5 A;  3KHH A;  3EZ5 A;  2XCA A;  4IR9 A;  4DSJ A;  5GTI U;  1C7Y A;  1NK6 A;  1DOQ A;  3M6Z A;  3GIL A;  4M6W B;  3B9J A;  4UB3 A;  4ED2 A;  1KEJ A;  5C0Y A;  3MBY A;  4JK1 A;  9ICR A;  4M9J A;  5ALK A;  3OSP A;  4P0P A;  2EZX A;  1PK1 B;  3WK5 A;  2HBM A;  2NRT A;  1T8E A;  5L1K A;  3SD7 A;  3ZD8 A;  4KIT B;  4R66 A;  8ICX A;  5AM2 A;  1UT5 A;  2WHE A;  2F3N A;  2JEI A;  2VAN A;  2KJ9 A;  2HHX A;  2KVC A;  2JR5 A;  3Q8M A;  5KFX A;  4HYK A;  4JWN A;  5J2H A;  3V7K A;  3GDX A;  5HNK A;  2C2D A;  5KL1 B;  5KFP A;  1ZQQ A;  2KKP A;  3LWL A;  1JAL A;  2FPM A;  4RT2 A;  4UB1 A;  2R8H A;  3RJK A;  2OH2 A;  1COO A;  5KFV A;  8ICS A;  3H0L B;  2YB4 A;  2FE9 A;  5AI5 A;  2P6R A;  4ECV A;  4RZR A;  3TAP A;  2HBJ A;  2WFA A;  4O0I A;  3C5F A;  3NVY A;  4RNN A;  3K75 D;  1B4F A;  5IIJ A;  4F2R A;  2DL0 A;  1RYU A;  4B9L A;  3QZ8 A;  7ICR A;  8ICI A;  1N62 A;  3ISC A;  4BXO A;  1U4B A;  4M6W A;  8ICG A;  2G09 A;  5CP2 A;  2XO7 A;  2Y0S F;  1M6Y A;  5J0T A;  4BJQ A;  3RJE A;  4DQI A;  4G9B A;  2ZIW A;  2G08 A;  4Z6F A;  2KK0 A;  2V4R A;  4KLS A;  4XA5 A;  1XSP A;  3UXN A;  3V6K A;  1XSN A;  2HHT A;  2ZTD A;  1KRP A;  4KLM A;  1ZQI A;  2KZ3 A;  4RNM A;  2ASL A;  2PKE A;  4ECU A;  3MGV A;  4IC9 A;  1X40 A;  1DXS A;  5KFT A;  1NK4 A;  2JEG A;  2IHN A;  2BCQ A;  4PJ0 U;  5J2K A;  3M9M B;  4C7Z A;  4US9 A;  3TFS A;  4EX7 A;  4M9N A;  4KLI A;  4EEK A;  4B9T A;  4RQ2 A;  3SEN A;  5J0P A;  3F2B A;  4IRC A;  1CRX A;  3Q8Q B;  2NRX A;  4DSF A;  4F5P A;  8ICB A;  1J2M A;  1SZH A;  2M9N A;  4ELV A;  2NO5 A;  1ZQD A;  4UAU A;  4QIW F;  4KLQ A;  2FI1 A;  2FJ6 A;  4YCX A;  5AK5 A;  4QWD A;  3LVV A;  4B9N A;  4J9K A;  2JHD A;  1Z00 A;  4FFD A;  5IIM A;  4OJO A;  2PI4 A;  3GIK A;  1WG8 A;  3C5G A;  4Y2U A;  2QAR A;  4YN4 A;  1NK8 A;  2XGQ A;  3RB4 A;  1LKY A;  3WKA A;  3RJG A;  3SV4 A;  2PMZ F;  1PK3 A;  2D8C A;  4RU9 A;  1Q46 A;  2W3S A;  4K4H A;  4UB8 U;  5J8Y C;  2HOQ A;  4QZE A;  2RLT A;  2HBL A;  5KFJ A;  2BQR A;  4YD2 A;  5KG1 A;  3NRW A;  4DFK A;  5KFU A;  4YMO A;  1S5L U;  9ICS A;  1HEK A;  2KMD A;  5KL8 B;  1D9D A;  2FLP A;  3NUQ A;  5DG8 A;  3V6J A;  5DB8 A;  2C2R A;  2ATL A;  1F44 A;  3ZDC A;  2ZIU A;  4C8M A;  2BZF A;  2EAP A;  4ZH4 A;  4YMM A;  1KLN A;  2PFN A;  7ICO A;  4GC6 A;  1X6I A;  2EH9 A;  2H3Q A;  2QB1 A;  3NRZ A;  5BPC A;  4AP9 A;  4LVS A;  2UVU A;  2R8I A;  2RDJ A;  4IL6 U;  4F8R A; 
#chains in the Genus database with same CATH homology
 2KKV A;  3RFA A;  2NV3 A;  2ZG6 A;  4OJL A;  2A3V A;  2F8L A;  2XID A;  4KMO B;  1L6N A;  1YT3 A;  2W7P A;  3F53 A;  1PVQ A;  2KJ8 A;  4C0Z A;  2CRX A;  2E1E A;  4P0Q A;  1GO3 F;  2KJ9 A;  3ALR A;  3KFU F;  2KEY A;  3SMV A;  1XO0 A;  2K89 A;  2KVC A;  3M7D A;  2JMG A;  2JH1 A;  3PSF A;  3AL0 B;  1A6S A;  4FZL A;  2W03 A;  4GFJ A;  2WB1 C;  1KBU A;  2ZXI A;  3F2B A;  2XI9 A;  4OJP A;  1NZB A;  5CRX A;  2K4H A;  1CRX A;  2MRL A;  3PZP A;  2CN1 A;  3HKZ F;  4NLC A;  3E0F A;  2KIC A;  2ZIX B;  5HR6 A;  2OYY A;  2KHQ A;  3CP8 A;  5KL1 B;  4PL2 A;  2PMZ C;  2KIW A;  3F2C A;  1SZH A;  2ZXH A;  2W04 A;  2KKP A;  3PSP A;  5T14 A;  1MA7 A;  4AYB C;  2H3Z A;  2LYA A;  2E5S A;  2F2A B;  3SAF A;  2RRD A;  2F76 X;  2N1R A;  1Z19 A;  2OH2 A;  2JGA A;  2KOB A;  2KV2 A;  4QIW F;  2Y0S C;  3F5E A;  4ICA A;  3ONN A;  2ZIX A;  2G5I B;  3AQE A;  2WAQ C;  2YB1 A;  3H0L B;  1DRG A;  2DF4 B;  2YX8 A;  4OO1 J;  3IG8 A;  3LVV A;  2YB4 A;  3IG5 A;  2H3I A;  3GZF A;  4OJ6 A;  2LYB A;  2JHD A;  1WUD A;  2ZIV B;  2HOI A;  2CPR A;  1Z1B A;  2HBJ A;  3VC8 A;  4OJO A;  5A0L A;  2GH1 A;  1D8B A;  1XNS A;  1P7D A;  2DQN B;  2M0N A;  3IP4 B;  3H0R B;  2XVT A;  2WB1 F;  2E1F A;  4ACO A;  4OJ5 A;  2K8B B;  2Q4T A;  1TAM A;  2R18 A;  2G5H B;  2H3F A;  2LHT A;  2ZIV A;  1ED1 A;  3L3F X;  3OPX A;  2W7O A;  4CGZ A;  2KD1 A;  3LYS A;  2K8C B;  2VIX A;  3SAH A;  3LVW A;  2PMZ F;  3PSI A;  1HIW A;  2ZIW B;  2K4E A;  3GU3 A;  2G0A A;  2RHF A;  3AQF A;  1A0P A;  3D2N A;  4AYB F;  2D6F C;  2G09 A;  3K1Z A;  4A8E A;  4FZM A;  2KNJ A;  2KHV A;  2MA1 A;  3CYM A;  2HOQ A;  2HOF A;  1ECW A;  2HBL A;  2K4I A;  3RF9 A;  2LKY A;  2Y0S F;  3IN5 A;  1ZQ1 C;  1Q3U A;  1Q3V A;  5HR7 A;  4O3M A;  4KX5 A;  4BJQ A;  4U6P A;  2WAQ F;  3VCB A;  2OM6 A;  3D2Q A;  4QJF B;  2Z7J A;  2DGZ A;  2G08 A;  2ZIW A;  4FE3 A;  3ICX A;  1OUQ A;  3NRW A;  2ZIU B;  2GOL A;  3F2D A;  3M6Z A;  4QNL A;  4P0P B;  2KJ5 A;  3O0F A;  1IIP A;  1HEK A;  3N7P D;  1PVP A;  4WJ3 B;  4NV0 A;  3PST A;  4JMU A;  4BX9 C;  1UPH A;  2G07 A;  2VKQ A;  1PVR A;  5KL8 B;  2BDU A;  5C0Y A;  3NUQ A;  4KX3 A;  4PL1 A;  3M6K A;  4CRX A;  2VJ4 A;  1F44 A;  3D2S A;  2H3V A;  1T94 A;  2ZIU A;  3DEE A;  3HKZ C;  3C28 A;  3N7S C;  2VJ5 A;  3H0M B;  2JH7 A;  3N7R C;  4P0P A;  4BUG A;  2F77 X;  2G06 A;  2XIC A;  2OXO A;  4CDG A;  4NLB A;  3SQI A;  2HBM A;  4FZN A;  2HBK A;  2H3Q A;  3F5A A;  3MGV A;  1URJ A;  3T79 A;  4IC9 A;  3SAG A;  2RP5 A;  3C29 A;  2HMX A;  2LBO A;  4P0Q B;  4QIW C;  4NWI A;  4U7C A;  3KZX A;  3CRX A;  2K8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...