3H8MA

Sam domain of human ephrin type-a receptor 7 (epha7)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
TPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SAM Domain of Human Ephrin Type-A Receptor 7 (Epha7)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 7
total genus 23
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3h8mA00
3K1RB 3HILA 1SXEA 2KE7A 1SV0A 1JI7A 2KSOB 1F0MA 3KKAA 4IS7A 1SV4A 2LMRA 2QB0B 2KG5A 2E8PA 3SEIA 1OW5A 3BS5A 1X9XA 2D8CA 3TADA 1UCVA 2DKXA 3TACB 1COKA 4RQNA 2ES6A 5JU5A 2EAMA 2QARA 3SENA 5J8YA 3KKAC 1PK1A 5J8YC 1LKYA 2D3DA 2LPEA 2JV3A 2FE9A 4MHVA 1KW4A 2F44A 1V85A 2EAOA 4NL9A 3BQ7A 3IDWA 5L1MA 3BS7A 2KMDA 1X40A 2EANA 2DKZA 4RQMA 2DL0A 2F3NA 2E8OA 1OXJA 2Y9UA 1RG6A 5JTIA 1SGGA 2E8MA 2GLEA 3H8MA 2EAPA 1SXDA 1PK1B 1WWUA 1B4FA 2QB1A 3BS5B 2YTUA 2KIVA 2QB0A 1B0XA 1X66A 2F8KA 1SV0C 2L5YA 1LKYB 3TADC 1PK3A 2K60A 2K4PA 4NL9C 1WWVA 1DXSA 2QKQA 2Y9TA 1V38A 2KSOA 4PZNA 5JRTA 2QARB 4PZOA 2ESEA 4NJ8A 2E8NA 1UQVA 2B6GA 5KNIA 5F3XB 1Z1VA
chains in the Genus database with same CATH superfamily
5KFZA 2MU2A 4Q45A 5KFGA 1NK0A 3ICXA 2E5SA 4FZNA 4JK1A 5L1KA 2UVVA 3H8JA 5KFKA 1NK9A 4KLEA 2FPKA 4Y2RA 4RUAA 5GTIU 3QU4A 9ICUA 2F1HA 1XO1A 3RB3A 2F8LA 3PMNA 2ISPA 2ZG6A 4IR9A 5AK5A 4KLOA 3N4MB 3SR6A 4PHAA 1RYUA 3RJGA 5F9NA 4RQ7A 2ZIWB 2XGQA 2CXYA 2FMSA 2A19A 3NRZA 3TARA 1ZQAA 4YN4A 4PH5A 3NUQA 4DL3A 4NM2A 2BCQA 3SQIA 5CWRA 1TAQA 3IDWA 3RB0A 1F5SA 3QXGA 3ZDEA 2J6SA 2DKZA 3KZIU 2JMGA 2RRDA 2Z7JA 5BOLA 1OXJA 2P6UA 2GO7A 3HRDD 3C2KA 1XSNA 2GLEA 4DQRA 2BR0A 2W9CA 5ALMA 3A0HU 4F4WA 4OCZA 1K1SA 3WK7A 2WF6A 2RDJA 2V9WA 5K4LA 4OJ6A 3KHHA 4DLEA 4I29A 3ORYA 1TAUA 2JEFA 3ZD8A 4KLHA 3QEAZ 4QIWF 4JMUA 4YXJA 3V72A 2K4PA 4DL7A 1L7MA 2YQEA 4O5CA 5KFMA 2E1EA 3RJIA 1MC8A 4P0PA 1ZJMA 5DBCA 4CE6A 3C1ZA 4ECUA 3T5KA 5J0OA 5KNIA 2PFPA 2EQYA 4J9NA 2HOQA 5J0TA 5IINA 1ZQEA 3WK4A 1TK8A 2LBOA 5KFUA 4DSEA 5AK6A 4MFCA 3SZ2A 2LMRA 5DLFA 4FS1A 2E8PA 1OW5A 4PJ0U 2BDPA 3MR6A 3SYZA 2D8CA 2GOLA 5HP4A 4DS5A 9ICIA 1NJZA 3C5GA 1U45A 9ICGA 2BHNA 4NLKA 5J8YC 3IRUA 5J0YA 2R8JA 3GFKB 4BXOB 2O6KA 3C23A 3PX6A 7ICNA 1L8OA 4QZ8A 1LB2B 3SMVA 3BQ1A 4R63A 3C5FA 4QWCA 2ZJ5A 3BQ7A 4US8A 3FDSA 2LYAA 3ONNA 2F1IA 1UT8A 4Z6FA 5DQIA 4I2GA 3SV3A 1NKEA 3PSIA 5G5HA 1ZD3A 1SGGA 4TUQA 3C21A 5KL8B 1ZQZA 3H8MA 2NRVA 1X9MA 1BGXT 2JH1A 5EE1A 2VANA 8ICWA 4Q8FA 4I27A 3TAPA 3HKZC 5KT6A 2YY6A 2KJ9A 4ECYA 4QZDA 5ALKA 4JB3A 4YMMA 2ALZA 8ICFA 5J0WA 1KFDA 3ZDAA 1UQVA 2B6GA 4QZFA 2V4RA 1ZQSA 1MQ3A 1VLBA 5AKZA 5ALDA 1Z1BA 1ZQHA 3T79A 1QH9A 9ICNA 1BNPA 1AROP 3HWTA 3MFHA 2QB0B 3GU3A 7ICLA 5GTHU 4RQ0A 9ICWA 1NK7A 2KV2A 5DB8A 2NYVA 2XCAA 3MGIA 2UVUA 3HPOA 1NI3A 3RBDA 1BNOA 4F5RA 5JUMA 4I2IA 4IC9A 4MEXA 8ICOA 4QZIA 5E79U 4C8NA 8ICMA 1ZQBA 4LZDA 1ZETA 5IIKA 2HHVA 1UA0A 1IV8A 4RQMA 2A1AA 3M6KA 3RH6A 5KG6A 3I1YA 1ZQDA 3K75D 3I28A 2FMQA 2R8KA 4F5QA 2ASJA 1SL2A 5KT5A 3RTVA 1ZQTA 4J9RA 4M9HA 3FAHA 4QWDA 2GWSA 3RJKA 1WWVA 5AKKA 2Y9TA 1IM4A 1S97A 8ICNA 5EE9A 5KFSA 2PFQA 1O03A 1NJXA 2RDIA 4KLJA 4F4ZA 4YMOA 5J2CA 5AM1A 5J0XA 3QYPA 1D8YA 3PSPA 3UXOA 4IQUA 4Z6DA 4YR2A 4DOAA 3V6HA 2KZMA 3QNMA 4U6PA 4YR3A 2ZIUA 2F76X 2K4IA 2KVCA 3V7KA 3MR3A 4XQ8A 1Y88A 5L1IA 2M9NA 2YN4A 4DFMA 1ZQYA 4DFDA 2KKVA 2E3TA 1ZQVA 3TADA 1N2XA 1Q3VA 1VJ5A 1HUZA 5CHGA 2HDOA 3KBBA 2K8AA 1YZ7A 2JZBA 5KFFA 2EAMA 4CCHA 3ISBA 2JGAA 4KLLA 5IILA 2VA2A 5KT2A 3PV8A 3L5KA 8ICJA 5G5GA 3IM1A 2ZXIA 3EYZA 3A0BU 3QX7A 1L3UA 2XCPA 3ISDA 3MDAA 2N1RA 3C2LA 1V85A 4ELUA 7ICFA 4FBTA 3OJSA 4KITB 3KOOA 3LDAA 5KAFU 1T8EA 4J9LA 4DEZA 1BPYA 1QQ7A 2F3NA 3FYHA 2W04A 1WCNA 4QWBA 1ZQJA 1PK1B 4YQWA 1WWUA 1TKDA 5AM2A 3LK9A 4K4IA 7ICMA 2K89A 8ICQA 4OJOA 1V97A 1JUDA 1SV0C 4F3OA 1ZOLA 5ALPA 4ECWA 5KFDA 2OM6A 3C1YA 4DL2A 2RQ5A 3H8SA 3SAHA 4GC7A 2F1JA 3K4GA 4C4TA 1L3TA 1L3SA 3OPXA 1HEKA 1ZYQA 4DWIA 2H5XA 3EUB2 1JMSA 5IIJA 4RZRA 2A1JB 3IV6A 4UB8U 4DOCA 1T7PA 2KHVA 3GIMA 1L7OA 9ICPA 2HCFA 3ZDBA 1DOQA 2MUTB 9ICRA 4K4GA 4B9SA 1COKA 1JROA 4R64A 5KT7A 4B9VA 3OSPA 4KTQA 2ASLA 3PW5A 2G07A 4KLFA 3F53A 1PK1A 1PVRA 2WF9A 4B6JA 4J9MA 1C7YA 4ELTA 1ZRNA 4UB1A 7ICVA 1ZQFA 2WB1C 4KLDA 3J81j 2KN7A 4I2AA 5DLGA 3Q8SB 3FM9A 9ICJA 5EE3A 4IRKA 1D8BA 3PMLA 4MFFA 1U48A 3IP4B 3AEVA 3K1ZA 2R8GA 8ICZA 1Z00B 2LKYA 4M0AA 3KHLA 5HMLA 2OYYA 4DL5A 4PGQA 7ICRA 5AI4A 4DLGA 3RFAA 4DF8A 4EENA 3RF9A 2YTUA 4C4RA 5AK3A 4Y2SA 4J9OA 1KQQA 5ALHA 2W9MA 1XU4A 1BVSA 2R8IA 4O9MA 5AIAA 5IIIA 1RYRA 7ICSA 7ICQA 4GXIA 2IOHA 2W3RA 3GQCA 2E1FA 1LVHA 2Q4TA 5HNKA 3RRHA 2YB4A 1KKXA 7ICPA 3SV4A 5KFIA 3TANA 3PY8A 4O5EA 7ICOA 5L1LA 2B21A 1BPEA 4RQ1A 1WUDA 3OGUA 5AI9A 3WKDA 3LWMA 2LI6A 3C28A 2Y0SC 2Q0ZX 3PW7A 5KT3A 3JPPA 4JUZA 5KFQA 1ZQCA 3NVWA 2DKXA 4IL6U 1N60A 2KVSA 5EE0A 4RT3A 3C29A 2DQNB 5KFOA 4JV1A 3AMZA 5JU5A 3BDPA 4CRXA 2MRLA 5CJ7A 4TURA 2AGPA 2LPEA 2JH7A 2C28A 4MF2A 3D2SA 4LZGA 1N48A 4F50A 1S0VA 1ECWA 2F44A 3CNHA 2K4EA 1L7NA 3B9JA 2NO5A 2HHQA 2V4QA 4ACOA 1A0PA 3MFIA 4AYBF 2DL0A 4KN4A 2E8OA 4MF8A 1NZPA 5ALJA 2DFLA 3CYMA 1S0MA 5DDMA 4C7ZA 5AKJA 3JPTA 9ICEA 3PX4A 1ZD2P 2W8LA 1B4FA 5EWFA 4DFPA 2QB1A 4FS2A 2WF5A 2HMXA 3S6JA 4ECSA 3OHAA 5J2HA 4EYHB 4ECQA 2LYHA 3ALRA 3H0MB 3TADC 3OHBA 2JHDA 2CRXA 4QNLA 2F77X 2XY5A 2H3VA 5AK4A 4JWNA 9ICOA 1X6JA 4LVSA 4JV0A 2JR5A 3C2MA 2ESEA 8ICKA 5DDYA 4FO6A 5J2IA 5KFPA 1FIQA 4KMUA 2EH9A 2PMZC 3AQFA 5KFRA 4M04A 2D6FC 2OXOA 3WKAA 1F0MA 3M8SA 2ODGA 2GH1A 9ICFA 1VDVA 4GFJA 4ECVA 3LVVA 4I2EA 2BCVA 1ZQQA 5KFLA 1UCVA 1ZQWA 2ZIXA 5KG7A 4P4MA 4I2FA 4EX7A 4K4HA 2VIXA 4QZCA 2HHWA 3AU2A 4I2HA 4ED8A 1N61A 3O0FA 1Q46A 4DSKA 1T3NA 4BJQA 2XO7A 5KFWA 2BKEA 3PVXA 1RDFA 2RLTA 4ED2A 5TISU 4ECRA 4M9LA 3WK8A 4NLZA 1X6IA 3BS7A 5KFXA 5AKLA 2IHNA 8ICRA 1X40A 1GO3F 5AKHA 4GIBA 1K1QA 2YMLA 4YD1A 1RG6A 4TUPA 2FPLA 2KTQA 5J2AA 4YVZA 4EBDA 4M9JA 1J2NA 1L7PA 2H3QA 2A3VA 2QB0A 1Q3UA 3TQ1A 4NM1A 1Z00A 4UAVA 4P0QB 3SI8A 1XSPA 4PHPA 3QEBZ 3KTQA 2FI1A 1DXSA 2ZUCA 1V38A 4FBUA 5C0YA 4Y2TA 4C7YA 2EDUA 3T5HA 1NZBA 5JRTA 3QZ7A 2MSNA 1KDHA 4PHEA 1BPZA 3F5EA 1SZPA 3UQ2A 4C0ZA 2BQRA 4I28A 4KLSA 3K1RB 3JPQA 1TK5A 4BX9C 3V7LA 5AI0A 4NXZA 4OO1J 4DQSA 4NLCA 3N28A 3PO5A 5CRXA 1X9XA 2H3IA 1ZQGA 1NJYA 2VJ4A 4BUGA 2ES6A 1KL9A 2AGOA 2OHFA 2KOBA 2FJ6A 5J2JA 4MFAA 2HOFA 4Q8EA 4GC6A 3QU9A 1WCLA 2W9CB 4UAWA 1QTMA 2I6XA 5ALUA 4C8MA 4PL1A 5J0RA 1RZTA 1NOMA 4F92B 4DOBA 1SL1A 2AGQA 1XS9D 2BDUA 3G6YA 3THVA 3IG8A 2H3ZA 1TVAA 5HMMA 1NJWA 1Q8KA 5J2GA 4F91B 5T14A 4UAUA 1K5OA 8ICEA 2E8MA 5AICA 2AU0A 8ICYA 4QW9A 3LYSA 2YX8A 4Y2UA 1U9LA 1SL0A 1NK6A 5KG3A 4O3MA 2RP5A 4J9PA 1TFRA 9ICLA 4USAA 2UVWA 5CR0A 2IMWP 2OH2A 5KFCA 5ALIA 1ZJNA 1RYSA 2XGPA 2KSOA 2ZIXB 3L4PA 4PZNA 4EZ6A 4IR1A 5KFHA 4G9BA 3NTUA 3KFUF 4YR0A 3CW2C 2ZUBA 4DSIA 2C2EA 1S5LU 3TFRA 1XNSA 2ZTCA 4R8UA 5KL1B 1ZD4A 1JI7A 2KSOB 4C8KA 2G08A 2NV3A 4J03A 3PR4A 4Q44A 3QUQA 3F2DA 3SEIA 2MAXA 7ICEA 2W43A 2C2RA 4KLIA 3V6JA 4DSFA 5AI5A 1KRPA 4P0PB 2W9BA 2IOFA 1ZXIA 2BZFA 3KKAC 3QUBA 2W9BB 1ZQNA 5BOMA 4KLTA 4HYKA 3U26A 3PW4A 3DV9A 1Z3EB 3RJHA 4KLMA 2IA6A 3L3FX 2BCSA 4UATA 1P7DA 5ALOA 1WG8A 1QSYA 8ICAA 1FFUA 3AL0B 3WKEA 3M8RA 4UAZA 5ALQA 5KFJA 2HHXA 2KICA 2XI9A 3EPIA 2XY6A 1O08A 1IG6A 1DGJA 2AXTU 3F2CA 2LM1A 2M0NA 4B9TA 3BJYA 1B0XA 5ALGA 1S8OA 4IQVA 1LKYB 4ED1A 4ZH4A 3NVYA 2Y1IA 5IIMA 2OCEA 1ZQMA 3NASA 5HHIA 9ICAA 2QKQA 4UASA 1JRPA 3Q8RB 3UXPA 1WYGA 1LV5A 5DG9A 4C4SA 4RQ6A 5AM0A 3M6ZA 4F4YA 3WKBA 1UHUA 2LYBA 3M9MB 1KSPA 3RAQA 4QIWC 2HHTA 2F2AB 5KTQA 4ED0A 3DDHA 3HT3A 2KJ5A 3HP6A 2KE7A 2KZ3A 2K8CB 5EWGA 4DS4A 4O3NA 1N5XA 2AQ4A 3D6JA 7ICUA 3BS5A 7ICJA 1KFSA 3UMBA 1DGSA 3CRXA 1N63A 3SENA 3F2BA 5KG1A 4DQQA 2D3DA 3UMCA 9ICXA 3MR2A 4MHVA 4Y2YA 3EW9A 3N7RC 5D49A 9ICQA 2B0CA 3PR5B 2HBKA 2KD1A 3H4BA 4Y2VA 1U4BA 3QU2A 3V6KA 4NL9A 1XC9A 4RPYA 4DF4A 2K8BB 5L1MA 3AQEA 4NLBA 4QZHA 2KMDA 2BPGA 1SWWA 3MGVA 4RNOA 3PSTA 3ISCA 2EZZA 8ICBA 4B9UA 3GZFA 3VCBA 5JTIA 4O3SA 3Q8MA 4C8LA 1FO4A 4NLNA 2I5HA 7ICHA 3WK9A 4CGZA 4OJLA 1KTQA 3CP8A 5KFYA 4DFKA 4RPZA 1KBUA 5KFVA 3AM9A 3GV7B 4UBBA 4BGDA 3QU7A 7ICIA 1KFTA 9ICVA 4O3QA 5CP2A 1JN3A 4ICAA 4ELVA 2YMQA 1J2MA 2XC9A 1HUOA 4R65A 1N56A 4NJ8A 3ETLA 3B0YA 5ALVA 4JWMA 4P2HA 1RXVA 4DCCA 2CN1A 3Q8KA 3KZXA 4I2BA 2KP7A 4NLGA 5CA7A 4C80A 5TZVA 1SKSA 1SXEA 4FZLA 2JRZA 2WF7A 5DG8A 4Y2QA 2W54A 4ED6A 2PFOA 2ZIVB 4UQGA 4UARA 3BZCA 1BPDA 1QLNA 3TACB 4QZBA 3RJFA 4I2DA 4Z6EA 1A6SA 5DB9A 1UT5A 5H2FU 4F5NA 5DB7A 3M1YA 5IIOA 8ICUA 5DBAA 3BQTA 3RRGA 4NV0A 3KHGA 4UB2A 4P4OA 1U47A 1S0NA 9ICKA 1A77A 4O0IA 3MBYA 4EELA 2H3FA 4HAIA 4J9QA 3H0RB 2EAOA 4YD2A 2AHOB 8ICGA 1JIHA 2G06A 3RH5A 1RQNA 2EANA 3MDCA 5DBBA 3R9KA 2K4HA 2KJ8A 3H0LB 2J6UA 3DEEA 1SXDA 2W7PA 5KFEA 2YMMA 4ECXA 4BWMA 4A8EA 3UMGA 4F2SA 2IBKA 4EZ9A 7ICGA 1IXRA 2P66A 4DSJA 2HI0A 2L5YA 3JPSA 2KEYA 3B0XA 3MGHA 3MC1A 1ZRMA 9ICHA 3WK6A 3N7SC 3WU2U 1CEZA 2AQ0A 4J9SA 3AN1A 3JPOA 2NO4A 4M6WB 1QSSA 4PHDA 1DK2A 4PZOA 4BXOA 4EYIB 5BPCA 5CB1A 3TI0A 2DPIA 1ZQRA 2ASDA 4LJXA 4Q43A 2ZIUB 2NRXA 4OJ5A 4G3IA 4RQ2A 8ICHA 2QLTA 4Y2PA 2OWOA 1JXLA 4Y2JA 1ZQLA 1X9WA 5ALLA 2G5IB 3ZDDA 2KG5A 2I9GA 3UPQA 2G5HB 2AH5A 5ALWA 4YFKA 4QWAA 3SD7A 2JEGA 4O3PA 3EPGA 2G09A 1F44A 3HKZF 5AM4A 2DGZA 3QUTA 4QZGA 3GDXA 3H7IA 1A76A 5HR7A 1HJPA 2FE9A 1S9FA 3M7DA 4M9NA 2BQ3A 2PXIA 1PUZA 5ALYA 8ICPA 4CF3A 4BDPA 2KZZA 1ED1A 1L8LA 3OSNA 8ICCA 4DQIA 4NWIA 4KX5A 3OJUA 3QE9Y 4F4XA 2Y9UA 3PW0A 4TQSA 1B22A 3GV5B 2PI5A 5AHXA 2HBMA 8ICLA 5J2EA 3E58A 7ICTA 5DGBA 3BS5B 2KFNA 4IQTA 2W7OA 1S76D 2IOFK 2ZUDA 4CF5A 1Z4NA 2CPRA 5DB6A 1RXWA 2MUTA 2HVIA 1D8LA 1ZQUA 2C2DA 1BPXA 1RQLA 1X42A 3OTQA 2MA1A 3BQ2A 4M47A 3GIKA 2W11A 4B9NA 5D4BA 4BWJA 2P35A 2BCUA 2JXJA 5KT4A 3PO4A 5AI6A 5B66U 4NY8A 5F3XB 1AQ6A 1PZNA 1RM6C 1MA7A 3HILA 5J0UA 4Z6CA 5J0PA 5B5EU 3GIIA 2LM4A 8ICIA 4WJ3B 2WAQC 4M2YA 5ALSA 5AI8A 4YG2A 2VA3A 2KKPA 5ALNA 2WFAA 3KD3A 5KFNA 4ED3A 2HHUA 5J0SA 5FP0A 4O3OA 4PPXA 4OD0A 3WKCA 5ALTA 2WAQF 3NVVA 4O3RA 2FLNA 5KAIU 2JV3A 2HSZA 4AP9A 1CUKA 2KNJA 4XRHA 4RNNA 3RJJA 5KG2A 1KW4A 5HHHA 2RHFA 4DFJA 5DG7A 8ICVA 1QCKA 4ED7A 4F93B 4U7CA 4RQ5A 2KIWA 3F5AA 5J29A 4ECTA 4UW9A 2HOIA 2G0AA 5KFTA 3RR7A 8ICTA 4OJPA 5EOZA 4C8OA 4F2RA 3MABA 1S10A 4FFDA 2EAPA 1QQ6A 2HW3A 2JEIA 5J2FA 2KIVA 4GLXA 1SKWA 4EEYA 2W03A 3AUOA 1YT3A 1PVPA 5KG0A 2KFZA 1B43A 4FZMA 1PK3A 2ZIWA 4NL9C 2WB1F 1JALA 3LVWA 1NK5A 4DQPA 4F4KA 4B9MA 4M9GA 3Q8LA 2WHEA 4EX6A 5AKGA 5A0LA 1XO0A 2R18A 2C22A 4QWEA 4DO9A 3IG5A 1S0OA 4UB3A 2PFNA 4I2JA 1EXNA 3TAQA 4KLQA 1KN5A 4QZ9A 1HIWA 1L6NA 1D9DA 1X2IA 3T5LA 2W9AA 3HX0A 1SV0A 2ZXHA 1H38A 1Z4OA 3VC8A 4R8UB 2IHMA 4XA5A 3UXNA 4YCXA 2DWQA 5KG5A 2FPMA 4P0QA 3T3FA 2BCRA 1M6YA 2WF8A 2I1QA 4RQNA 4ZOHC 5ALEA 2QARA 3HW8A 2JZBB 3G6VA 1LKYA 3SAFA 3Q8PB 2J6TA 3ED5A 3E0FA 1UA1A 4M6WA 3AU6A 3PW2A 4IRCA 2Y1JA 1DK3A 2DBYA 2HBJA 5AKIA 3IHQB 9ICTA 4YMNA 3QZ8A 2HHSA 3PSFA 4GXKA 3NS1A 5AM3A 8ICSA 9ICSA 4IRDA 4E0DA 5C5JA 2XY7A 4UB5A 5DGAA 1L5UA 1V9PA 3MR5A 3I76A 2BQUA 1QQ5A 2FLPA 5J2DA 4CNQA 3LWLA 1T4GA 1ZQKA 2ZJ8A 3H8WA 8ICXA 3HJEA 3E2EA 4KMOB 5KFBA 4RQ8A 3WK5A 4KN7A 4UB6U 3IN5A 1NK4A 3RJEA 1URJA 4P4PA 4RU9A 4F5PA 4IQWA 4O5KA 2JEJA 4CF4A 1U49A 2DF4B 4YP3A 1CRXA 5AM5A 4RQ3A 2ISOA 4Y2XA 3GIJA 4US9A 5L1JA 1ZQPA 3D2NA 1TAMA 9ICBA 1TK0A 3KKAA 1N62A 3JPRA 2FLLA 4IS7A 4ECZA 1UPHA 4UB4A 4QZAA 1MQ2A 2P6RA 3PZPA 4DSLA 4CDGA 7ICKA 2PMZF 4F8RA 1Z19A 3SAGA 2FDRA 1RPLA 3G6XA 1C20A 4PL2A 2VA8A 2LHTA 5AKYA 3H40A 2ZIVA 2YMPA 5AKXA 1TE2A 2NRWA 3ETRA 3BZKA 3ZI4A 3D2QA 3RB4A 3Q8QB 3ZDCA 4UAYA 1ZD5A 1DRGA 1D9FA 2ATLA 5F9LA 1N5WA 1MN8A 1XWLA 4RQ4A 3UQ0A 4KLGA 2YB1A 4JV2A 2PI4A 4RNMA 1SZHA 4EEKA 1ZQIA 2ZJAA 3EWAA 2DUYA 3ZD9A 1KLNA 5J0QA 1X66A 1NKCA 2OEHA 2BGWA 2F8KA 1PVQA 5DKWA 4PGYA 5AKEA 3EZ5A 2R8HA 1NKBA 1J97A 5L9XA 2AJQA 4R66A 2PKEA 2W3SA 1ZQOA 2E8NA 2HBLA 1S77D 4XUSA 1QSLA 2EZXA 5J2KA 4QW8A 4EBCA 2XICA 1COOA 5KG4A 5ALZA 1YZ6A 3UM9A 2KHQA 4QZEA 9ICCA 2FMPA 4F72A 3H4DA 3RB6A 5DQGA 4YXMA 4X5VA 5J2BA 1FFVA 2WTFA 1SV4A 5DQHA 4DL4A 4GXJA 3JPNA 3N97B 1SWVA 1FEZA 1ZQ1C 4QJFB 1KEJA 2XIDA 3RH4A 2Y0SF 3TKAA 3FC4A 2W8KA 2DPJA 1L3VA 3QUCA 5J8YA 2NRTA 4RUCA 1SB3C 2KK0A 4DL6A 3KHRA 3RAXA 3TFSA 5EWEA 4TQRA 4B9LA 4J9KA 4KX3A 4F5OA 3RR8A 3T5JA 1BPBA 4FE3A 2UVRA 3GV8B 1SKRA 3NVZA 3PNCA 1OUQA 4EBEA 4F71A 4RPXA 2ZTDA 1T94A 5D46A 1MSWD 1ZQXA 3V7JA 1X9SA 2XVTA 1JX4A 1IIPA 4AYBC 3N7PD 4PGXA 3PX0A 1NNLA 4RT2A 2HVHA 4KLUA 4UBCA 2EZYA 1SIJA 2W55A 3BQ0A 2BPFA 5KFAA 2VKQA 1TV9A 1T3QA 4MEYA 2K60A 3QU5A 3NGDA 2NRZA 5AIBA 3RBEA 5HR6A 1XSLA 1NK8A 3GILA 4I2CA 3M9OB 2BPCA 2QARB 2A1JA 3M9NB 5CEHA 9ICMA 1JXEA 4TUSA 3NRWA 2VJ5A 5ALXA 5ALFA 2ZTEA 1CI4A 5ALRA 1Z1VA
chains in the Genus database with same CATH topology
3K1RB 3HILA 1SXEA 2KE7A 1SV0A 1JI7A 2KSOB 1F0MA 3KKAA 4IS7A 1SV4A 2LMRA 2QB0B 2KG5A 2E8PA 3SEIA 1OW5A 3BS5A 1X9XA 2D8CA 3TADA 1UCVA 2DKXA 3TACB 1COKA 4RQNA 2ES6A 5JU5A 2EAMA 2QARA 3SENA 5J8YA 3KKAC 1PK1A 5J8YC 1LKYA 2D3DA 2LPEA 2JV3A 2FE9A 4MHVA 1KW4A 2F44A 1V85A 2EAOA 4NL9A 3BQ7A 3IDWA 5L1MA 3BS7A 2KMDA 1X40A 2EANA 2DKZA 4RQMA 2DL0A 2F3NA 2E8OA 1OXJA 2Y9UA 1RG6A 5JTIA 1SGGA 2E8MA 2GLEA 3H8MA 2EAPA 1SXDA 1PK1B 1WWUA 1B4FA 2QB1A 3BS5B 2YTUA 2KIVA 2QB0A 1B0XA 1X66A 2F8KA 1SV0C 2L5YA 1LKYB 3TADC 1PK3A 2K60A 2K4PA 4NL9C 1WWVA 1DXSA 2QKQA 2Y9TA 1V38A 2KSOA 4PZNA 5JRTA 2QARB 4PZOA 2ESEA 4NJ8A 2E8NA 1UQVA 2B6GA 5KNIA 5F3XB 1Z1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  3HIL A;  1SXE A;  2KE7 A;  1SV0 A;  1JI7 A;  2KSO B;  1F0M A;  3KKA A;  4IS7 A;  1SV4 A;  2LMR A;  2QB0 B;  2KG5 A;  2E8P A;  3SEI A;  1OW5 A;  3BS5 A;  1X9X A;  2D8C A;  3TAD A;  1UCV A;  2DKX A;  3TAC B;  1COK A;  4RQN A;  2ES6 A;  5JU5 A;  2EAM A;  2QAR A;  3SEN A;  5J8Y A;  3KKA C;  1PK1 A;  5J8Y C;  1LKY A;  2D3D A;  2LPE A;  2JV3 A;  2FE9 A;  4MHV A;  1KW4 A;  2F44 A;  1V85 A;  2EAO A;  4NL9 A;  3BQ7 A;  3IDW A;  5L1M A;  3BS7 A;  2KMD A;  1X40 A;  2EAN A;  2DKZ A;  4RQM A;  2DL0 A;  2F3N A;  2E8O A;  1OXJ A;  2Y9U A;  1RG6 A;  5JTI A;  1SGG A;  2E8M A;  2GLE A;  3H8M A;  2EAP A;  1SXD A;  1PK1 B;  1WWU A;  1B4F A;  2QB1 A;  3BS5 B;  2YTU A;  2KIV A;  2QB0 A;  1B0X A;  1X66 A;  2F8K A;  1SV0 C;  2L5Y A;  1LKY B;  3TAD C;  1PK3 A;  2K60 A;  2K4P A;  4NL9 C;  1WWV A;  1DXS A;  2QKQ A;  2Y9T A;  1V38 A;  2KSO A;  4PZN A;  5JRT A;  2QAR B;  4PZO A;  2ESE A;  4NJ8 A;  2E8N A;  1UQV A;  2B6G A;  5KNI A;  5F3X B;  1Z1V A; 
#chains in the Genus database with same CATH topology
 5KFZ A;  2MU2 A;  4Q45 A;  5KFG A;  1NK0 A;  3ICX A;  2E5S A;  4FZN A;  4JK1 A;  5L1K A;  2UVV A;  3H8J A;  5KFK A;  1NK9 A;  4KLE A;  2FPK A;  4Y2R A;  4RUA A;  5GTI U;  3QU4 A;  9ICU A;  2F1H A;  1XO1 A;  3RB3 A;  2F8L A;  3PMN A;  2ISP A;  2ZG6 A;  4IR9 A;  5AK5 A;  4KLO A;  3N4M B;  3SR6 A;  4PHA A;  1RYU A;  3RJG A;  5F9N A;  4RQ7 A;  2ZIW B;  2XGQ A;  2CXY A;  2FMS A;  2A19 A;  3NRZ A;  3TAR A;  1ZQA A;  4YN4 A;  4PH5 A;  3NUQ A;  4DL3 A;  4NM2 A;  2BCQ A;  3SQI A;  5CWR A;  1TAQ A;  3IDW A;  3RB0 A;  1F5S A;  3QXG A;  3ZDE A;  2J6S A;  2DKZ A;  3KZI U;  2JMG A;  2RRD A;  2Z7J A;  5BOL A;  1OXJ A;  2P6U A;  2GO7 A;  3HRD D;  3C2K A;  1XSN A;  2GLE A;  4DQR A;  2BR0 A;  2W9C A;  5ALM A;  3A0H U;  4F4W A;  4OCZ A;  1K1S A;  3WK7 A;  2WF6 A;  2RDJ A;  2V9W A;  5K4L A;  4OJ6 A;  3KHH A;  4DLE A;  4I29 A;  3ORY A;  1TAU A;  2JEF A;  3ZD8 A;  4KLH A;  3QEA Z;  4QIW F;  4JMU A;  4YXJ A;  3V72 A;  2K4P A;  4DL7 A;  1L7M A;  2YQE A;  4O5C A;  5KFM A;  2E1E A;  3RJI A;  1MC8 A;  4P0P A;  1ZJM A;  5DBC A;  4CE6 A;  3C1Z A;  4ECU A;  3T5K A;  5J0O A;  5KNI A;  2PFP A;  2EQY A;  4J9N A;  2HOQ A;  5J0T A;  5IIN A;  1ZQE A;  3WK4 A;  1TK8 A;  2LBO A;  5KFU A;  4DSE A;  5AK6 A;  4MFC A;  3SZ2 A;  2LMR A;  5DLF A;  4FS1 A;  2E8P A;  1OW5 A;  4PJ0 U;  2BDP A;  3MR6 A;  3SYZ A;  2D8C A;  2GOL A;  5HP4 A;  4DS5 A;  9ICI A;  1NJZ A;  3C5G A;  1U45 A;  9ICG A;  2BHN A;  4NLK A;  5J8Y C;  3IRU A;  5J0Y A;  2R8J A;  3GFK B;  4BXO B;  2O6K A;  3C23 A;  3PX6 A;  7ICN A;  1L8O A;  4QZ8 A;  1LB2 B;  3SMV A;  3BQ1 A;  4R63 A;  3C5F A;  4QWC A;  2ZJ5 A;  3BQ7 A;  4US8 A;  3FDS A;  2LYA A;  3ONN A;  2F1I A;  1UT8 A;  4Z6F A;  5DQI A;  4I2G A;  3SV3 A;  1NKE A;  3PSI A;  5G5H A;  1ZD3 A;  1SGG A;  4TUQ A;  3C21 A;  5KL8 B;  1ZQZ A;  3H8M A;  2NRV A;  1X9M A;  1BGX T;  2JH1 A;  5EE1 A;  2VAN A;  8ICW A;  4Q8F A;  4I27 A;  3TAP A;  3HKZ C;  5KT6 A;  2YY6 A;  2KJ9 A;  4ECY A;  4QZD A;  5ALK A;  4JB3 A;  4YMM A;  2ALZ A;  8ICF A;  5J0W A;  1KFD A;  3ZDA A;  1UQV A;  2B6G A;  4QZF A;  2V4R A;  1ZQS A;  1MQ3 A;  1VLB A;  5AKZ A;  5ALD A;  1Z1B A;  1ZQH A;  3T79 A;  1QH9 A;  9ICN A;  1BNP A;  1ARO P;  3HWT A;  3MFH A;  2QB0 B;  3GU3 A;  7ICL A;  5GTH U;  4RQ0 A;  9ICW A;  1NK7 A;  2KV2 A;  5DB8 A;  2NYV A;  2XCA A;  3MGI A;  2UVU A;  3HPO A;  1NI3 A;  3RBD A;  1BNO A;  4F5R A;  5JUM A;  4I2I A;  4IC9 A;  4MEX A;  8ICO A;  4QZI A;  5E79 U;  4C8N A;  8ICM A;  1ZQB A;  4LZD A;  1ZET A;  5IIK A;  2HHV A;  1UA0 A;  1IV8 A;  4RQM A;  2A1A A;  3M6K A;  3RH6 A;  5KG6 A;  3I1Y A;  1ZQD A;  3K75 D;  3I28 A;  2FMQ A;  2R8K A;  4F5Q A;  2ASJ A;  1SL2 A;  5KT5 A;  3RTV A;  1ZQT A;  4J9R A;  4M9H A;  3FAH A;  4QWD A;  2GWS A;  3RJK A;  1WWV A;  5AKK A;  2Y9T A;  1IM4 A;  1S97 A;  8ICN A;  5EE9 A;  5KFS A;  2PFQ A;  1O03 A;  1NJX A;  2RDI A;  4KLJ A;  4F4Z A;  4YMO A;  5J2C A;  5AM1 A;  5J0X A;  3QYP A;  1D8Y A;  3PSP A;  3UXO A;  4IQU A;  4Z6D A;  4YR2 A;  4DOA A;  3V6H A;  2KZM A;  3QNM A;  4U6P A;  4YR3 A;  2ZIU A;  2F76 X;  2K4I A;  2KVC A;  3V7K A;  3MR3 A;  4XQ8 A;  1Y88 A;  5L1I A;  2M9N A;  2YN4 A;  4DFM A;  1ZQY A;  4DFD A;  2KKV A;  2E3T A;  1ZQV A;  3TAD A;  1N2X A;  1Q3V A;  1VJ5 A;  1HUZ A;  5CHG A;  2HDO A;  3KBB A;  2K8A A;  1YZ7 A;  2JZB A;  5KFF A;  2EAM A;  4CCH A;  3ISB A;  2JGA A;  4KLL A;  5IIL A;  2VA2 A;  5KT2 A;  3PV8 A;  3L5K A;  8ICJ A;  5G5G A;  3IM1 A;  2ZXI A;  3EYZ A;  3A0B U;  3QX7 A;  1L3U A;  2XCP A;  3ISD A;  3MDA A;  2N1R A;  3C2L A;  1V85 A;  4ELU A;  7ICF A;  4FBT A;  3OJS A;  4KIT B;  3KOO A;  3LDA A;  5KAF U;  1T8E A;  4J9L A;  4DEZ A;  1BPY A;  1QQ7 A;  2F3N A;  3FYH A;  2W04 A;  1WCN A;  4QWB A;  1ZQJ A;  1PK1 B;  4YQW A;  1WWU A;  1TKD A;  5AM2 A;  3LK9 A;  4K4I A;  7ICM A;  2K89 A;  8ICQ A;  4OJO A;  1V97 A;  1JUD A;  1SV0 C;  4F3O A;  1ZOL A;  5ALP A;  4ECW A;  5KFD A;  2OM6 A;  3C1Y A;  4DL2 A;  2RQ5 A;  3H8S A;  3SAH A;  4GC7 A;  2F1J A;  3K4G A;  4C4T A;  1L3T A;  1L3S A;  3OPX A;  1HEK A;  1ZYQ A;  4DWI A;  2H5X A;  3EUB 2;  1JMS A;  5IIJ A;  4RZR A;  2A1J B;  3IV6 A;  4UB8 U;  4DOC A;  1T7P A;  2KHV A;  3GIM A;  1L7O A;  9ICP A;  2HCF A;  3ZDB A;  1DOQ A;  2MUT B;  9ICR A;  4K4G A;  4B9S A;  1COK A;  1JRO A;  4R64 A;  5KT7 A;  4B9V A;  3OSP A;  4KTQ A;  2ASL A;  3PW5 A;  2G07 A;  4KLF A;  3F53 A;  1PK1 A;  1PVR A;  2WF9 A;  4B6J A;  4J9M A;  1C7Y A;  4ELT A;  1ZRN A;  4UB1 A;  7ICV A;  1ZQF A;  2WB1 C;  4KLD A;  3J81 j;  2KN7 A;  4I2A A;  5DLG A;  3Q8S B;  3FM9 A;  9ICJ A;  5EE3 A;  4IRK A;  1D8B A;  3PML A;  4MFF A;  1U48 A;  3IP4 B;  3AEV A;  3K1Z A;  2R8G A;  8ICZ A;  1Z00 B;  2LKY A;  4M0A A;  3KHL A;  5HML A;  2OYY A;  4DL5 A;  4PGQ A;  7ICR A;  5AI4 A;  4DLG A;  3RFA A;  4DF8 A;  4EEN A;  3RF9 A;  2YTU A;  4C4R A;  5AK3 A;  4Y2S A;  4J9O A;  1KQQ A;  5ALH A;  2W9M A;  1XU4 A;  1BVS A;  2R8I A;  4O9M A;  5AIA A;  5III A;  1RYR A;  7ICS A;  7ICQ A;  4GXI A;  2IOH A;  2W3R A;  3GQC A;  2E1F A;  1LVH A;  2Q4T A;  5HNK A;  3RRH A;  2YB4 A;  1KKX A;  7ICP A;  3SV4 A;  5KFI A;  3TAN A;  3PY8 A;  4O5E A;  7ICO A;  5L1L A;  2B21 A;  1BPE A;  4RQ1 A;  1WUD A;  3OGU A;  5AI9 A;  3WKD A;  3LWM A;  2LI6 A;  3C28 A;  2Y0S C;  2Q0Z X;  3PW7 A;  5KT3 A;  3JPP A;  4JUZ A;  5KFQ A;  1ZQC A;  3NVW A;  2DKX A;  4IL6 U;  1N60 A;  2KVS A;  5EE0 A;  4RT3 A;  3C29 A;  2DQN B;  5KFO A;  4JV1 A;  3AMZ A;  5JU5 A;  3BDP A;  4CRX A;  2MRL A;  5CJ7 A;  4TUR A;  2AGP A;  2LPE A;  2JH7 A;  2C28 A;  4MF2 A;  3D2S A;  4LZG A;  1N48 A;  4F50 A;  1S0V A;  1ECW A;  2F44 A;  3CNH A;  2K4E A;  1L7N A;  3B9J A;  2NO5 A;  2HHQ A;  2V4Q A;  4ACO A;  1A0P A;  3MFI A;  4AYB F;  2DL0 A;  4KN4 A;  2E8O A;  4MF8 A;  1NZP A;  5ALJ A;  2DFL A;  3CYM A;  1S0M A;  5DDM A;  4C7Z A;  5AKJ A;  3JPT A;  9ICE A;  3PX4 A;  1ZD2 P;  2W8L A;  1B4F A;  5EWF A;  4DFP A;  2QB1 A;  4FS2 A;  2WF5 A;  2HMX A;  3S6J A;  4ECS A;  3OHA A;  5J2H A;  4EYH B;  4ECQ A;  2LYH A;  3ALR A;  3H0M B;  3TAD C;  3OHB A;  2JHD A;  2CRX A;  4QNL A;  2F77 X;  2XY5 A;  2H3V A;  5AK4 A;  4JWN A;  9ICO A;  1X6J A;  4LVS A;  4JV0 A;  2JR5 A;  3C2M A;  2ESE A;  8ICK A;  5DDY A;  4FO6 A;  5J2I A;  5KFP A;  1FIQ A;  4KMU A;  2EH9 A;  2PMZ C;  3AQF A;  5KFR A;  4M04 A;  2D6F C;  2OXO A;  3WKA A;  1F0M A;  3M8S A;  2ODG A;  2GH1 A;  9ICF A;  1VDV A;  4GFJ A;  4ECV A;  3LVV A;  4I2E A;  2BCV A;  1ZQQ A;  5KFL A;  1UCV A;  1ZQW A;  2ZIX A;  5KG7 A;  4P4M A;  4I2F A;  4EX7 A;  4K4H A;  2VIX A;  4QZC A;  2HHW A;  3AU2 A;  4I2H A;  4ED8 A;  1N61 A;  3O0F A;  1Q46 A;  4DSK A;  1T3N A;  4BJQ A;  2XO7 A;  5KFW A;  2BKE A;  3PVX A;  1RDF A;  2RLT A;  4ED2 A;  5TIS U;  4ECR A;  4M9L A;  3WK8 A;  4NLZ A;  1X6I A;  3BS7 A;  5KFX A;  5AKL A;  2IHN A;  8ICR A;  1X40 A;  1GO3 F;  5AKH A;  4GIB A;  1K1Q A;  2YML A;  4YD1 A;  1RG6 A;  4TUP A;  2FPL A;  2KTQ A;  5J2A A;  4YVZ A;  4EBD A;  4M9J A;  1J2N A;  1L7P A;  2H3Q A;  2A3V A;  2QB0 A;  1Q3U A;  3TQ1 A;  4NM1 A;  1Z00 A;  4UAV A;  4P0Q B;  3SI8 A;  1XSP A;  4PHP A;  3QEB Z;  3KTQ A;  2FI1 A;  1DXS A;  2ZUC A;  1V38 A;  4FBU A;  5C0Y A;  4Y2T A;  4C7Y A;  2EDU A;  3T5H A;  1NZB A;  5JRT A;  3QZ7 A;  2MSN A;  1KDH A;  4PHE A;  1BPZ A;  3F5E A;  1SZP A;  3UQ2 A;  4C0Z A;  2BQR A;  4I28 A;  4KLS A;  3K1R B;  3JPQ A;  1TK5 A;  4BX9 C;  3V7L A;  5AI0 A;  4NXZ A;  4OO1 J;  4DQS A;  4NLC A;  3N28 A;  3PO5 A;  5CRX A;  1X9X A;  2H3I A;  1ZQG A;  1NJY A;  2VJ4 A;  4BUG A;  2ES6 A;  1KL9 A;  2AGO A;  2OHF A;  2KOB A;  2FJ6 A;  5J2J A;  4MFA A;  2HOF A;  4Q8E A;  4GC6 A;  3QU9 A;  1WCL A;  2W9C B;  4UAW A;  1QTM A;  2I6X A;  5ALU A;  4C8M A;  4PL1 A;  5J0R A;  1RZT A;  1NOM A;  4F92 B;  4DOB A;  1SL1 A;  2AGQ A;  1XS9 D;  2BDU A;  3G6Y A;  3THV A;  3IG8 A;  2H3Z A;  1TVA A;  5HMM A;  1NJW A;  1Q8K A;  5J2G A;  4F91 B;  5T14 A;  4UAU A;  1K5O A;  8ICE A;  2E8M A;  5AIC A;  2AU0 A;  8ICY A;  4QW9 A;  3LYS A;  2YX8 A;  4Y2U A;  1U9L A;  1SL0 A;  1NK6 A;  5KG3 A;  4O3M A;  2RP5 A;  4J9P A;  1TFR A;  9ICL A;  4USA A;  2UVW A;  5CR0 A;  2IMW P;  2OH2 A;  5KFC A;  5ALI A;  1ZJN A;  1RYS A;  2XGP A;  2KSO A;  2ZIX B;  3L4P A;  4PZN A;  4EZ6 A;  4IR1 A;  5KFH A;  4G9B A;  3NTU A;  3KFU F;  4YR0 A;  3CW2 C;  2ZUB A;  4DSI A;  2C2E A;  1S5L U;  3TFR A;  1XNS A;  2ZTC A;  4R8U A;  5KL1 B;  1ZD4 A;  1JI7 A;  2KSO B;  4C8K A;  2G08 A;  2NV3 A;  4J03 A;  3PR4 A;  4Q44 A;  3QUQ A;  3F2D A;  3SEI A;  2MAX A;  7ICE A;  2W43 A;  2C2R A;  4KLI A;  3V6J A;  4DSF A;  5AI5 A;  1KRP A;  4P0P B;  2W9B A;  2IOF A;  1ZXI A;  2BZF A;  3KKA C;  3QUB A;  2W9B B;  1ZQN A;  5BOM A;  4KLT A;  4HYK A;  3U26 A;  3PW4 A;  3DV9 A;  1Z3E B;  3RJH A;  4KLM A;  2IA6 A;  3L3F X;  2BCS A;  4UAT A;  1P7D A;  5ALO A;  1WG8 A;  1QSY A;  8ICA A;  1FFU A;  3AL0 B;  3WKE A;  3M8R A;  4UAZ A;  5ALQ A;  5KFJ A;  2HHX A;  2KIC A;  2XI9 A;  3EPI A;  2XY6 A;  1O08 A;  1IG6 A;  1DGJ A;  2AXT U;  3F2C A;  2LM1 A;  2M0N A;  4B9T A;  3BJY A;  1B0X A;  5ALG A;  1S8O A;  4IQV A;  1LKY B;  4ED1 A;  4ZH4 A;  3NVY A;  2Y1I A;  5IIM A;  2OCE A;  1ZQM A;  3NAS A;  5HHI A;  9ICA A;  2QKQ A;  4UAS A;  1JRP A;  3Q8R B;  3UXP A;  1WYG A;  1LV5 A;  5DG9 A;  4C4S A;  4RQ6 A;  5AM0 A;  3M6Z A;  4F4Y A;  3WKB A;  1UHU A;  2LYB A;  3M9M B;  1KSP A;  3RAQ A;  4QIW C;  2HHT A;  2F2A B;  5KTQ A;  4ED0 A;  3DDH A;  3HT3 A;  2KJ5 A;  3HP6 A;  2KE7 A;  2KZ3 A;  2K8C B;  5EWG A;  4DS4 A;  4O3N A;  1N5X A;  2AQ4 A;  3D6J A;  7ICU A;  3BS5 A;  7ICJ A;  1KFS A;  3UMB A;  1DGS A;  3CRX A;  1N63 A;  3SEN A;  3F2B A;  5KG1 A;  4DQQ A;  2D3D A;  3UMC A;  9ICX A;  3MR2 A;  4MHV A;  4Y2Y A;  3EW9 A;  3N7R C;  5D49 A;  9ICQ A;  2B0C A;  3PR5 B;  2HBK A;  2KD1 A;  3H4B A;  4Y2V A;  1U4B A;  3QU2 A;  3V6K A;  4NL9 A;  1XC9 A;  4RPY A;  4DF4 A;  2K8B B;  5L1M A;  3AQE A;  4NLB A;  4QZH A;  2KMD A;  2BPG A;  1SWW A;  3MGV A;  4RNO A;  3PST A;  3ISC A;  2EZZ A;  8ICB A;  4B9U A;  3GZF A;  3VCB A;  5JTI A;  4O3S A;  3Q8M A;  4C8L A;  1FO4 A;  4NLN A;  2I5H A;  7ICH A;  3WK9 A;  4CGZ A;  4OJL A;  1KTQ A;  3CP8 A;  5KFY A;  4DFK A;  4RPZ A;  1KBU A;  5KFV A;  3AM9 A;  3GV7 B;  4UBB A;  4BGD A;  3QU7 A;  7ICI A;  1KFT A;  9ICV A;  4O3Q A;  5CP2 A;  1JN3 A;  4ICA A;  4ELV A;  2YMQ A;  1J2M A;  2XC9 A;  1HUO A;  4R65 A;  1N56 A;  4NJ8 A;  3ETL A;  3B0Y A;  5ALV A;  4JWM A;  4P2H A;  1RXV A;  4DCC A;  2CN1 A;  3Q8K A;  3KZX A;  4I2B A;  2KP7 A;  4NLG A;  5CA7 A;  4C80 A;  5TZV A;  1SKS A;  1SXE A;  4FZL A;  2JRZ A;  2WF7 A;  5DG8 A;  4Y2Q A;  2W54 A;  4ED6 A;  2PFO A;  2ZIV B;  4UQG A;  4UAR A;  3BZC A;  1BPD A;  1QLN A;  3TAC B;  4QZB A;  3RJF A;  4I2D A;  4Z6E A;  1A6S A;  5DB9 A;  1UT5 A;  5H2F U;  4F5N A;  5DB7 A;  3M1Y A;  5IIO A;  8ICU A;  5DBA A;  3BQT A;  3RRG A;  4NV0 A;  3KHG A;  4UB2 A;  4P4O A;  1U47 A;  1S0N A;  9ICK A;  1A77 A;  4O0I A;  3MBY A;  4EEL A;  2H3F A;  4HAI A;  4J9Q A;  3H0R B;  2EAO A;  4YD2 A;  2AHO B;  8ICG A;  1JIH A;  2G06 A;  3RH5 A;  1RQN A;  2EAN A;  3MDC A;  5DBB A;  3R9K A;  2K4H A;  2KJ8 A;  3H0L B;  2J6U A;  3DEE A;  1SXD A;  2W7P A;  5KFE A;  2YMM A;  4ECX A;  4BWM A;  4A8E A;  3UMG A;  4F2S A;  2IBK A;  4EZ9 A;  7ICG A;  1IXR A;  2P66 A;  4DSJ A;  2HI0 A;  2L5Y A;  3JPS A;  2KEY A;  3B0X A;  3MGH A;  3MC1 A;  1ZRM A;  9ICH A;  3WK6 A;  3N7S C;  3WU2 U;  1CEZ A;  2AQ0 A;  4J9S A;  3AN1 A;  3JPO A;  2NO4 A;  4M6W B;  1QSS A;  4PHD A;  1DK2 A;  4PZO A;  4BXO A;  4EYI B;  5BPC A;  5CB1 A;  3TI0 A;  2DPI A;  1ZQR A;  2ASD A;  4LJX A;  4Q43 A;  2ZIU B;  2NRX A;  4OJ5 A;  4G3I A;  4RQ2 A;  8ICH A;  2QLT A;  4Y2P A;  2OWO A;  1JXL A;  4Y2J A;  1ZQL A;  1X9W A;  5ALL A;  2G5I B;  3ZDD A;  2KG5 A;  2I9G A;  3UPQ A;  2G5H B;  2AH5 A;  5ALW A;  4YFK A;  4QWA A;  3SD7 A;  2JEG A;  4O3P A;  3EPG A;  2G09 A;  1F44 A;  3HKZ F;  5AM4 A;  2DGZ A;  3QUT A;  4QZG A;  3GDX A;  3H7I A;  1A76 A;  5HR7 A;  1HJP A;  2FE9 A;  1S9F A;  3M7D A;  4M9N A;  2BQ3 A;  2PXI A;  1PUZ A;  5ALY A;  8ICP A;  4CF3 A;  4BDP A;  2KZZ A;  1ED1 A;  1L8L A;  3OSN A;  8ICC A;  4DQI A;  4NWI A;  4KX5 A;  3OJU A;  3QE9 Y;  4F4X A;  2Y9U A;  3PW0 A;  4TQS A;  1B22 A;  3GV5 B;  2PI5 A;  5AHX A;  2HBM A;  8ICL A;  5J2E A;  3E58 A;  7ICT A;  5DGB A;  3BS5 B;  2KFN A;  4IQT A;  2W7O A;  1S76 D;  2IOF K;  2ZUD A;  4CF5 A;  1Z4N A;  2CPR A;  5DB6 A;  1RXW A;  2MUT A;  2HVI A;  1D8L A;  1ZQU A;  2C2D A;  1BPX A;  1RQL A;  1X42 A;  3OTQ A;  2MA1 A;  3BQ2 A;  4M47 A;  3GIK A;  2W11 A;  4B9N A;  5D4B A;  4BWJ A;  2P35 A;  2BCU A;  2JXJ A;  5KT4 A;  3PO4 A;  5AI6 A;  5B66 U;  4NY8 A;  5F3X B;  1AQ6 A;  1PZN A;  1RM6 C;  1MA7 A;  3HIL A;  5J0U A;  4Z6C A;  5J0P A;  5B5E U;  3GII A;  2LM4 A;  8ICI A;  4WJ3 B;  2WAQ C;  4M2Y A;  5ALS A;  5AI8 A;  4YG2 A;  2VA3 A;  2KKP A;  5ALN A;  2WFA A;  3KD3 A;  5KFN A;  4ED3 A;  2HHU A;  5J0S A;  5FP0 A;  4O3O A;  4PPX A;  4OD0 A;  3WKC A;  5ALT A;  2WAQ F;  3NVV A;  4O3R A;  2FLN A;  5KAI U;  2JV3 A;  2HSZ A;  4AP9 A;  1CUK A;  2KNJ A;  4XRH A;  4RNN A;  3RJJ A;  5KG2 A;  1KW4 A;  5HHH A;  2RHF A;  4DFJ A;  5DG7 A;  8ICV A;  1QCK A;  4ED7 A;  4F93 B;  4U7C A;  4RQ5 A;  2KIW A;  3F5A A;  5J29 A;  4ECT A;  4UW9 A;  2HOI A;  2G0A A;  5KFT A;  3RR7 A;  8ICT A;  4OJP A;  5EOZ A;  4C8O A;  4F2R A;  3MAB A;  1S10 A;  4FFD A;  2EAP A;  1QQ6 A;  2HW3 A;  2JEI A;  5J2F A;  2KIV A;  4GLX A;  1SKW A;  4EEY A;  2W03 A;  3AUO A;  1YT3 A;  1PVP A;  5KG0 A;  2KFZ A;  1B43 A;  4FZM A;  1PK3 A;  2ZIW A;  4NL9 C;  2WB1 F;  1JAL A;  3LVW A;  1NK5 A;  4DQP A;  4F4K A;  4B9M A;  4M9G A;  3Q8L A;  2WHE A;  4EX6 A;  5AKG A;  5A0L A;  1XO0 A;  2R18 A;  2C22 A;  4QWE A;  4DO9 A;  3IG5 A;  1S0O A;  4UB3 A;  2PFN A;  4I2J A;  1EXN A;  3TAQ A;  4KLQ A;  1KN5 A;  4QZ9 A;  1HIW A;  1L6N A;  1D9D A;  1X2I A;  3T5L A;  2W9A A;  3HX0 A;  1SV0 A;  2ZXH A;  1H38 A;  1Z4O A;  3VC8 A;  4R8U B;  2IHM A;  4XA5 A;  3UXN A;  4YCX A;  2DWQ A;  5KG5 A;  2FPM A;  4P0Q A;  3T3F A;  2BCR A;  1M6Y A;  2WF8 A;  2I1Q A;  4RQN A;  4ZOH C;  5ALE A;  2QAR A;  3HW8 A;  2JZB B;  3G6V A;  1LKY A;  3SAF A;  3Q8P B;  2J6T A;  3ED5 A;  3E0F A;  1UA1 A;  4M6W A;  3AU6 A;  3PW2 A;  4IRC A;  2Y1J A;  1DK3 A;  2DBY A;  2HBJ A;  5AKI A;  3IHQ B;  9ICT A;  4YMN A;  3QZ8 A;  2HHS A;  3PSF A;  4GXK A;  3NS1 A;  5AM3 A;  8ICS A;  9ICS A;  4IRD A;  4E0D A;  5C5J A;  2XY7 A;  4UB5 A;  5DGA A;  1L5U A;  1V9P A;  3MR5 A;  3I76 A;  2BQU A;  1QQ5 A;  2FLP A;  5J2D A;  4CNQ A;  3LWL A;  1T4G A;  1ZQK A;  2ZJ8 A;  3H8W A;  8ICX A;  3HJE A;  3E2E A;  4KMO B;  5KFB A;  4RQ8 A;  3WK5 A;  4KN7 A;  4UB6 U;  3IN5 A;  1NK4 A;  3RJE A;  1URJ A;  4P4P A;  4RU9 A;  4F5P A;  4IQW A;  4O5K A;  2JEJ A;  4CF4 A;  1U49 A;  2DF4 B;  4YP3 A;  1CRX A;  5AM5 A;  4RQ3 A;  2ISO A;  4Y2X A;  3GIJ A;  4US9 A;  5L1J A;  1ZQP A;  3D2N A;  1TAM A;  9ICB A;  1TK0 A;  3KKA A;  1N62 A;  3JPR A;  2FLL A;  4IS7 A;  4ECZ A;  1UPH A;  4UB4 A;  4QZA A;  1MQ2 A;  2P6R A;  3PZP A;  4DSL A;  4CDG A;  7ICK A;  2PMZ F;  4F8R A;  1Z19 A;  3SAG A;  2FDR A;  1RPL A;  3G6X A;  1C20 A;  4PL2 A;  2VA8 A;  2LHT A;  5AKY A;  3H40 A;  2ZIV A;  2YMP A;  5AKX A;  1TE2 A;  2NRW A;  3ETR A;  3BZK A;  3ZI4 A;  3D2Q A;  3RB4 A;  3Q8Q B;  3ZDC A;  4UAY A;  1ZD5 A;  1DRG A;  1D9F A;  2ATL A;  5F9L A;  1N5W A;  1MN8 A;  1XWL A;  4RQ4 A;  3UQ0 A;  4KLG A;  2YB1 A;  4JV2 A;  2PI4 A;  4RNM A;  1SZH A;  4EEK A;  1ZQI A;  2ZJA A;  3EWA A;  2DUY A;  3ZD9 A;  1KLN A;  5J0Q A;  1X66 A;  1NKC A;  2OEH A;  2BGW A;  2F8K A;  1PVQ A;  5DKW A;  4PGY A;  5AKE A;  3EZ5 A;  2R8H A;  1NKB A;  1J97 A;  5L9X A;  2AJQ A;  4R66 A;  2PKE A;  2W3S A;  1ZQO A;  2E8N A;  2HBL A;  1S77 D;  4XUS A;  1QSL A;  2EZX A;  5J2K A;  4QW8 A;  4EBC A;  2XIC A;  1COO A;  5KG4 A;  5ALZ A;  1YZ6 A;  3UM9 A;  2KHQ A;  4QZE A;  9ICC A;  2FMP A;  4F72 A;  3H4D A;  3RB6 A;  5DQG A;  4YXM A;  4X5V A;  5J2B A;  1FFV A;  2WTF A;  1SV4 A;  5DQH A;  4DL4 A;  4GXJ A;  3JPN A;  3N97 B;  1SWV A;  1FEZ A;  1ZQ1 C;  4QJF B;  1KEJ A;  2XID A;  3RH4 A;  2Y0S F;  3TKA A;  3FC4 A;  2W8K A;  2DPJ A;  1L3V A;  3QUC A;  5J8Y A;  2NRT A;  4RUC A;  1SB3 C;  2KK0 A;  4DL6 A;  3KHR A;  3RAX A;  3TFS A;  5EWE A;  4TQR A;  4B9L A;  4J9K A;  4KX3 A;  4F5O A;  3RR8 A;  3T5J A;  1BPB A;  4FE3 A;  2UVR A;  3GV8 B;  1SKR A;  3NVZ A;  3PNC A;  1OUQ A;  4EBE A;  4F71 A;  4RPX A;  2ZTD A;  1T94 A;  5D46 A;  1MSW D;  1ZQX A;  3V7J A;  1X9S A;  2XVT A;  1JX4 A;  1IIP A;  4AYB C;  3N7P D;  4PGX A;  3PX0 A;  1NNL A;  4RT2 A;  2HVH A;  4KLU A;  4UBC A;  2EZY A;  1SIJ A;  2W55 A;  3BQ0 A;  2BPF A;  5KFA A;  2VKQ A;  1TV9 A;  1T3Q A;  4MEY A;  2K60 A;  3QU5 A;  3NGD A;  2NRZ A;  5AIB A;  3RBE A;  5HR6 A;  1XSL A;  1NK8 A;  3GIL A;  4I2C A;  3M9O B;  2BPC A;  2QAR B;  2A1J A;  3M9N B;  5CEH A;  9ICM A;  1JXE A;  4TUS A;  3NRW A;  2VJ5 A;  5ALX A;  5ALF A;  2ZTE A;  1CI4 A;  5ALR A;  1Z1V A; 
#chains in the Genus database with same CATH homology
 3K1R B;  3HIL A;  1SXE A;  2KE7 A;  1SV0 A;  1JI7 A;  2KSO B;  1F0M A;  3KKA A;  4IS7 A;  1SV4 A;  2LMR A;  2QB0 B;  2KG5 A;  2E8P A;  3SEI A;  1OW5 A;  3BS5 A;  1X9X A;  2D8C A;  3TAD A;  1UCV A;  2DKX A;  3TAC B;  1COK A;  4RQN A;  2ES6 A;  5JU5 A;  2EAM A;  2QAR A;  3SEN A;  5J8Y A;  3KKA C;  1PK1 A;  5J8Y C;  1LKY A;  2D3D A;  2LPE A;  2JV3 A;  2FE9 A;  4MHV A;  1KW4 A;  2F44 A;  1V85 A;  2EAO A;  4NL9 A;  3BQ7 A;  3IDW A;  5L1M A;  3BS7 A;  2KMD A;  1X40 A;  2EAN A;  2DKZ A;  4RQM A;  2DL0 A;  2F3N A;  2E8O A;  1OXJ A;  2Y9U A;  1RG6 A;  5JTI A;  1SGG A;  2E8M A;  2GLE A;  3H8M A;  2EAP A;  1SXD A;  1PK1 B;  1WWU A;  1B4F A;  2QB1 A;  3BS5 B;  2YTU A;  2KIV A;  2QB0 A;  1B0X A;  1X66 A;  2F8K A;  1SV0 C;  2L5Y A;  1LKY B;  3TAD C;  1PK3 A;  2K60 A;  2K4P A;  4NL9 C;  1WWV A;  1DXS A;  2QKQ A;  2Y9T A;  1V38 A;  2KSO A;  4PZN A;  5JRT A;  2QAR B;  4PZO A;  2ESE A;  4NJ8 A;  2E8N A;  1UQV A;  2B6G A;  5KNI A;  5F3X B;  1Z1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...