3H8MA

Sam domain of human ephrin type-a receptor 7 (epha7)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
b'TPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 7
publication title SAM Domain of Human Ephrin Type-A Receptor 7 (Epha7)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 23
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3h8mA00
2ESEA 2DKXA 2QARB 3TADC 1WWUA 5L1MA 2ES6A 2QKQA 1COKA 3BS7A 2KG5A 2YTUA 3IDWA 2KSOA 1LKYB 2DL0A 1F0MA 1UCVA 2EAOA 2LMRA 1B0XA 1X9XA 1OW5A 2FE9A 3KKAC 1DXSA 2Y9UA 1V38A 2D8CA 1RG6A 1UQVA 5J8YC 2DKZA 4PZOA 1SXDA 1JI7A 1SXEA 3HILA 2E8OA 5J8YA 4RQNA 2QB0B 4RQMA 1PK3A 2QB1A 2B6GA 2D3DA 2Y9TA 1KW4A 2KSOB 1PK1B 4IS7A 2KMDA 5JTIA 2QARA 2F8KA 1B4FA 1V85A 3BQ7A 2EAMA 2K60A 1LKYA 4NJ8A 4NL9A 3H8MA 2E8NA 4PZNA 1X66A 2GLEA 2KE7A 2E8PA 2EAPA 3BS5A 2EANA 4MHVA 3TACB 2KIVA 3K1RB 1WWVA 2JV3A 2K4PA 5F3XB 1OXJA 2QB0A 3SENA 4NL9C 3TADA 2E8MA 1Z1VA 5JU5A 1PK1A 2F44A 3SEIA 2F3NA 5KNIA 1SV0C 1SGGA 2LPEA 5JRTA 2L5YA 1X40A 3BS5B 1SV4A 3KKAA 1SV0A
chains in the Genus database with same CATH superfamily
1ED1A 5ALIA 4O3OA 2HHSA 4BWJA 5AM2A 3H0MB 1RXVA 2HOIA 5CA7A 7ICMA 7ICQA 2WAQF 5AKKA 3BQ0A 1N5WA 2P6UA 3PR5B 1WG8A 4UAVA 4RPYA 4JB3A 2DFLA 4UASA 4QZIA 5EE1A 3ZI4A 3T3FA 4RQ2A 2W11A 2DKZA 3UXNA 2AU0A 5HHIA 5CRXA 1ZD4A 2WAQC 4NV0A 5AI9A 3RH4A 8ICVA 4O3MA 4YMOA 2C22A 1UHUA 1NJXA 2KZ3A 4RQNA 3IG5A 2XI9A 2ASDA 1Z00A 2Y1JA 3FC4A 4A8EA 3GIMA 3RB3A 3MR6A 5L1IA 2DBYA 2HBKA 4ECVA 2C2RA 4KLFA 3PX4A 1DOQA 2W8LA 3QUTA 8ICRA 1S0MA 2BKEA 3RRGA 5ALDA 5KFSA 5TZVA 2Y0SF 2A1AA 1ZQPA 4Q8EA 1SIJA 1V85A 2W43A 4I2EA 5KFAA 4QZAA 4TQSA 5IINA 1KL9A 9ICTA 4B9TA 2OCEA 4YMMA 2Y0SC 2GLEA 4O0IA 1L3VA 4M9HA 3UMGA 4J9OA 1COOA 3OJSA 1OXJA 1ZD5A 3QYPA 3F2CA 4F5RA 2ZXHA 1ZQQA 4NM1A 5DBAA 5ALQA 1QTMA 2F3NA 3TI0A 5BPCA 1SV0C 3NVYA 1Q8KA 2Z7JA 4DL5A 2H3ZA 3H4DA 3QUBA 8ICFA 4DSEA 3ONNA 3BQ2A 2G07A 2EZYA 2GO7A 4UB4A 2ODGA 1TAUA 4UB5A 3IDWA 2FI1A 2LBOA 4M2YA 2ZTDA 3TFSA 1RZTA 3T5JA 5CJ7A 4R64A 4YR2A 3RJIA 5KFVA 3VCBA 3SAGA 4F4ZA 4KN7A 4NY8A 1OUQA 3PNCA 8ICMA 7ICVA 3PY8A 3C2LA 5KG4A 4CCHA 2KD1A 4YQWA 1QQ7A 4DCCA 2VA8A 3C2MA 5HMMA 1A77A 2IMWP 3L3FX 4I2AA 1IXRA 4P0QA 4QWCA 4HAIA 2RQ5A 4UB6U 2NO4A 2V4RA 1K5OA 1KSPA 4KLMA 2BQ3A 3UMBA 4G3IA 4GLXA 4ED7A 1BVSA 2BZFA 4J9NA 4OJOA 4F71A 4R8UB 4JV1A 1WUDA 3L4PA 2CRXA 5KFYA 5DB9A 4KLLA 2CPRA 3KHHA 5J0PA 3N97B 2KFNA 1T3NA 1JIHA 9ICQA 1U4BA 4Y2PA 1SKWA 3ZDDA 1L8OA 2XICA 4MF2A 4UAYA 2J6UA 2BR0A 4IQUA 4UAWA 4M9JA 4XRHA 4Z6FA 4OJ6A 3LDAA 3TADC 5KFJA 1X42A 3UMCA 4O3RA 9ICPA 2FLPA 4MFCA 4C7ZA 3H0LB 1TAMA 1ZQVA 1WCNA 2YTUA 2H3VA 3AQEA 3H4BA 4EELA 8ICCA 5KFDA 5BOLA 2I1QA 4F4XA 4RNMA 4ELTA 4YFKA 2UVRA 2E3TA 4DL4A 2JZBB 4UB8U 1N61A 4TQRA 1XSNA 3JPRA 3GIJA 7ICJA 2KMDA 2NV3A 2XVTA 1VJ5A 1WYGA 9ICGA 2YMLA 5KT2A 1U9LA 2XIDA 2KK0A 1TV9A 7ICFA 3HX0A 4I2IA 3RB0A 5ALVA 4K4HA 2VANA 4R66A 2AH5A 4K4GA 2NRVA 3PVXA 5KFQA 3A0HU 3HKZF 2IBKA 3C28A 4J9PA 2ZIVA 5DQHA 4GXJA 4OJLA 5AKJA 1D9FA 2G5HB 4IC9A 4AYBF 5ALOA 3HKZC 2RLTA 4Y2SA 2K89A 4UAUA 3K1ZA 1L5UA 1SWVA 5ALYA 4RNNA 4RQ0A 4RT2A 1NK5A 3IG8A 3CRXA 5J0OA 3N28A 5JU5A 1X9WA 2F44A 3RAQA 4ECYA 3DV9A 1SKSA 4KLTA 4F50A 1N63A 3G6YA 3RH6A 1SV0A 1XS9D 1T4GA 2LM1A 5KFOA 5AHXA 3BS7A 5ALWA 3F2DA 4F92B 4CRXA 2KJ5A 1JMSA 3GIIA 2ZIXA 2IOFA 3D2SA 4EEKA 3SAHA 4QZGA 2DF4B 4YD1A 4PH5A 3BQ1A 1NJYA 2XCPA 2FMSA 1J2NA 1CRXA 2ASJA 5J0YA 2JEGA 5E79U 3FYHA 4P4PA 2Q0ZX 5KG2A 3OSPA 4MEYA 3ZDCA 1UT8A 4ECWA 4J9LA 4BGDA 4MF8A 2BQUA 4IRDA 4UATA 2JGAA 4I27A 3A0BU 3PO4A 2BGWA 9ICCA 4RNOA 5ALXA 4QZCA 3H7IA 4BXOB 5J0XA 3CYMA 5CHGA 1X9MA 4UB3A 4DFMA 3LWLA 3ZD8A 4KLJA 1PVQA 4I2BA 1S0NA 4FBTA 5DG8A 5EE0A 3TAQA 5KT3A 4DSFA 2KKPA 3H8SA 1DK3A 4F5NA 1V97A 4JWNA 3V6KA 3B0YA 5ALSA 1MQ2A 1Z4OA 1ZRNA 2K4HA 4JV0A 4TUSA 3HRDD 4YP3A 2DQNB 2YMQA 2R8IA 2VKQA 5KT5A 2FLLA 4ECZA 3GQCA 4RQ6A 9ICEA 4F5QA 7ICTA 5AM3A 2MAXA 3EPIA 1ZQDA 1B22A 1SGGA 4NM2A 4JK1A 4Y2RA 3F5AA 1SZHA 3BS5B 3N7SC 1BGXT 3M6ZA 5KAFU 3G6VA 4NLKA 1JROA 1TK5A 1LV5A 5AIAA 1S5LU 1TVAA 3KBBA 1ZQFA 1F0MA 2YMPA 2WB1C 5AI6A 3V7JA 5ALKA 4F4WA 1K1QA 9ICUA 8ICUA 4PZOA 1HIWA 1QCKA 2BHNA 3H0RB 5AKXA 3QZ8A 1SL2A 3PMLA 4Q44A 2OWOA 1NNLA 4PHEA 3QEAZ 3BDPA 1T3QA 1ZQGA 2A1JA 3QE9Y 3OHBA 9ICJA 4CF5A 3PSIA 2I6XA 2UVVA 1U49A 2K8AA 5T14A 1SKRA 3QUQA 4J9KA 5J2JA 4KLUA 4USAA 5JUMA 4RPXA 4PHPA 1BPEA 3WKDA 2NRZA 5AIBA 2F8LA 2W9BA 3THVA 8ICAA 4O3QA 1Z00B 3PR4A 3ETRA 7ICSA 1TE2A 4O5KA 4KN4A 1KLNA 2BPGA 8ICTA 3GV8B 4OCZA 3SYZA 4F2RA 2KHQA 3MFHA 2ZIWB 3B9JA 2PFOA 2XGPA 1GO3F 2KICA 1NKCA 1DGSA 3C23A 3WU2U 4DFDA 4UBBA 4IL6U 2A19A 5J2KA 1ZQXA 2M9NA 2W03A 4EZ9A 3UQ2A 2H3QA 3I1YA 2UVUA 2F1JA 3FAHA 2AHOB 5FP0A 3BJYA 5J2EA 2VIXA 4QIWF 4ZH4A 4Y2QA 2BCUA 4DLGA 3KKAA 1P7DA 2KFZA 3E0FA 4C8OA 3AM9A 1ZRMA 1N2XA 4DF8A 4QIWC 1S76D 1XO0A 3JPPA 2PMZF 2DL0A 3ISCA 1UCVA 1B0XA 1ZJMA 3M8RA 5DB6A 4UW9A 3N7RC 4U7CA 1JALA 3ED5A 5AI0A 4PL1A 1JN3A 3TQ1A 2J6SA 1ZJNA 4QJFB 1RXWA 9ICLA 1NZPA 8ICPA 1XC9A 4KLHA 2D3DA 4B9UA 2FDRA 4F91B 1JXLA 2W3SA 1ECWA 2DWQA 4EX6A 3HWTA 4DSLA 5DLGA 5EOZA 3NTUA 1NK7A 3UM9A 3RR7A 3BQTA 5ALNA 3RB4A 5KFIA 4ED6A 4YG2A 3V7KA 2W3RA 4MEXA 1DGJA 2V9WA 4PHDA 1SZPA 4NLBA 4EZ6A 2GOLA 7ICHA 3M8SA 5KFHA 2BQRA 5BOMA 2KE7A 4IR9A 3ZDAA 2KVCA 5CB1A 3EYZA 1SL1A 3K1RB 1NI3A 3KFUF 1D8LA 1J97A 4P0QB 4Y2TA 4I2DA 4O3SA 3OSNA 2B0CA 1MN8A 2E8MA 4ELUA 5KFRA 5KFMA 1PK1A 2RHFA 3SEIA 2WF8A 1URJA 4DWIA 1BNOA 2P6RA 2EZXA 5D46A 3H8JA 5J2IA 1QSLA 4KITB 3Q8QB 2C2EA 2QARB 3WKBA 4LVSA 5AKIA 3PZPA 3Q8SB 4FFDA 5AKEA 1X6JA 2HCFA 1N5XA 2AGQA 3IN5A 3SR6A 9ICKA 2YX8A 1Z19A 4U6PA 4Q8FA 3WKEA 2KN7A 4XUSA 1Z1BA 4Y2UA 1ZXIA 1ZETA 5HP4A 4PPXA 2ZJ5A 4US9A 1UQVA 1FIQA 2P66A 4B9SA 1JI7A 3FM9A 2HHWA 3SI8A 1CUKA 2JRZA 2NRTA 5AM0A 2RDIA 2QB1A 5KG1A 2UVWA 3D6JA 5ALMA 5CEHA 2ZUBA 5DB7A 2XY6A 3QXGA 4NLGA 1O03A 5IIKA 4KLSA 2G0AA 1ZQHA 2HDOA 2W04A 2YB4A 4BX9C 1TK0A 5DB8A 1PUZA 2KVSA 2VA2A 2ZG6A 2F8KA 4QWBA 3IP4B 4ECUA 4PGYA 3PW0A 2XC9A 4CF3A 1S10A 1S0OA 1D8BA 5J2DA 1HUZA 5AI4A 4FBUA 4J9RA 2OEHA 1C20A 3KHLA 2DGZA 3GIKA 4GXIA 4YXJA 9ICBA 4M6WB 3TAPA 3UPQA 2DPJA 5DLFA 2HBJA 2J6TA 3SENA 5EWFA 3TANA 1S9FA 1N62A 2F1HA 4OJPA 3M9NB 7ICPA 4YCXA 1M6YA 3IRUA 1RYRA 1IM4A 1H38A 2E1FA 5DQIA 2LHTA 3C21A 4RZRA 9ICAA 2LYBA 4DFJA 4I2JA 4I28A 2PXIA 1C7YA 1ZQJA 4XA5A 4RUAA 1L3TA 7ICGA 3MR5A 1U45A 2R18A 2HHTA 2FMPA 4P4MA 1MQ3A 4FZNA 5AKYA 1TK8A 2R8KA 3MDCA 9ICWA 1XO1A 1QQ5A 4M9LA 3EPGA 5AI8A 5AKGA 3UQ0A 1X9XA 5KFPA 3M6KA 2AQ0A 2XGQA 4DFPA 4BDPA 2IHNA 3RR8A 2BPCA 5J8YC 5IIJA 4NXZA 3Q8LA 1PK3A 2MSNA 2I9GA 5DBCA 2KTQA 7ICNA 4DOCA 2AQ4A 4RQ5A 5C0YA 3MR2A 4PHAA 3MGHA 2Y1IA 4FO6A 2WF6A 4B9NA 2PI4A 1N48A 2IOFK 2ZIXB 4UARA 1LVHA 4PL2A 4E0DA 2W55A 9ICXA 1O08A 4DF4A 4TURA 1KQQA 1Q3UA 4ED8A 2R8GA 3CNHA 5KAIU 3NUQA 2KZMA 4F4KA 4YXMA 1HJPA 2MUTB 2IHMA 4J03A 3C1ZA 1XSPA 1TFRA 8ICOA 1WWVA 1NK0A 3WK9A 3OTQA 4IRCA 4I2HA 2HHUA 1KFTA 1KEJA 4GIBA 2ALZA 2EDUA 1Z4NA 2JH1A 3T79A 3KOOA 1ZQSA 2ZTEA 4I2GA 2EQYA 1S77D 5C5JA 1RM6C 4UAZA 1T7PA 3NS1A 2V4QA 4F4YA 3IHQB 3F2BA 3KHGA 4ELVA 1UT5A 3AU6A 2MRLA 9ICFA 3RBEA 4RPZA 2ATLA 3QNMA 3G6XA 2YB1A 3ZDBA 4IQTA 1LKYB 2KOBA 4AYBC 2B21A 4C7YA 5ALZA 3KKAC 4R8UA 2CXYA 5EE3A 5L1LA 3E2EA 2ZIUB 2G08A 5DGBA 2W9CB 3PW7A 1ZQ1C 1IG6A 2KP7A 5KFWA 5F9LA 4C4SA 4RUCA 4M47A 3QUCA 2B6GA 3ZD9A 1IV8A 5DG9A 4F5PA 3TKAA 4C8LA 5DGAA 5KFBA 8ICGA 5AK4A 4DEZA 5KFFA 3PX0A 3MFIA 4B9VA 2YY6A 1BPBA 5AKLA 4NLNA 4KLGA 1L6NA 4TUQA 4EX7A 5IIOA 2XCAA 3RJKA 2FLNA 3M7DA 3S6JA 4NJ8A 1HEKA 4NL9A 3H8MA 4C0ZA 5DKWA 3NVVA 5K4LA 4QZ9A 3M9MB 4PGQA 1QQ6A 3AL0B 4DQQA 2WTFA 2ISOA 2OXOA 5TISU 1XU4A 2C2DA 2EAPA 1WCLA 3RH5A 4DSIA 4F72A 2KHVA 4QNLA 2E5SA 2N1RA 3N4MB 4Y2YA 4KMOB 1A76A 3JPSA 1YT3A 2JZBA 8ICBA 5ALJA 1F5SA 4DOAA 3MBYA 3RJFA 4M9NA 4EBEA 3QU2A 5IIIA 1CEZA 1V9PA 3E58A 2FMQA 1X9SA 3PO5A 3H8WA 4ICAA 2JEJA 2M0NA 2ESEA 4QZEA 1ZQEA 2HI0A 2ZTCA 4QZFA 4BUGA 3C29A 2JR5A 2HOFA 2KG5A 4O3PA 5J2AA 5DDMA 4KLQA 1L7NA 1QH9A 1D8YA 1DXSA 4RU9A 1L3SA 4JUZA 2WF7A 4DQIA 1A6SA 2AGOA 3RRHA 7ICLA 5J8YA 2QB0B 4RQMA 4HYKA 5HR6A 5HHHA 2JH7A 4IRKA 4YR3A 3F5EA 3SV3A 1NK9A 2ZUCA 1RYUA 4QW9A 3JPQA 2D6FC 4M0AA 4O3NA 2KZZA 2G06A 4DQPA 5ALEA 1L7PA 2F2AB 3QEBZ 3PSFA 2K60A 1L7MA 4M9GA 2KNJA 1JUDA 9ICRA 5CWRA 1KN5A 2ZXIA 3O0FA 5KG7A 1FEZA 2NO5A 5B66U 5B5EU 2Q4TA 3TACB 1N56A 4LZDA 1Q46A 4P0PA 5F3XB 3RBDA 2A3VA 4PGXA 5KFEA 3J81j 1NK8A 4C4TA 5EWEA 5AK5A 3JPOA 3R9KA 2IOHA 4CGZA 4BXOA 1NKEA 3V72A 4GC6A 1A0PA 3ETLA 1ZQRA 4KTQA 7ICUA 2HHVA 2HHXA 4KLOA 3WK8A 3BZCA 8ICEA 2YN4A 5KFZA 4WJ3B 3RAXA 3HJEA 1D9DA 4DOBA 2XY5A 4IQWA 1IIPA 3CP8A 1RPLA 2KJ9A 2NYVA 2D8CA 2ZJ8A 5KL1B 1VLBA 3HILA 3ORYA 5KFCA 4O5EA 4CE6A 1ZD3A 1KRPA 2PFQA 4IR1A 3EUB2 8ICKA 4RQ8A 2FJ6A 7ICOA 1SB3C 3AUOA 2HSZA 2K4IA 1ZQOA 5J2BA 2FPLA 2LKYA 3OJUA 2PMZC 1PVRA 3RJEA 4EBCA 4FZLA 4ACOA 5J2FA 1ZQYA 3NRZA 2HMXA 1TAQA 4K4IA 1KFSA 2KEYA 3KZIU 2E8NA 9ICOA 3WKCA 1RQLA 1X66A 3MABA 1L7OA 1XNSA 1ZD2P 2RRDA 2W54A 1ZQIA 4Q45A 2MA1A 4Y2JA 2W7OA 5IIMA 3AMZA 4ECSA 4F5OA 5GTHU 2CN1A 5D49A 2JV3A 1NZBA 4R65A 5AM1A 1K1SA 5EE9A 2O6KA 1Z1VA 4J9SA 1ZQWA 4DFKA 4QZHA 3D2NA 3HT3A 3NGDA 2FPMA 1ZQKA 3C5GA 2E1EA 1KKXA 4KMUA 3BZKA 2EZZA 5L1KA 2PFNA 4EBDA 1UPHA 3CW2C 7ICRA 4UQGA 1ZQLA 2C28A 4RQ4A 3SMVA 3ICXA 4B6JA 5KT6A 2KSOA 5ALLA 2EAOA 1ZYQA 4OJ5A 2FE9A 3ISBA 5AKZA 5KFXA 4EEYA 2NRXA 2ZIWA 3DDHA 2RP5A 4IQVA 2OYYA 9ICMA 1JX4A 1V38A 5D4BA 3V6HA 2JEFA 2HOQA 2KJ8A 3N7PD 1SXDA 3EW9A 3QU7A 3TARA 4C80A 2WFAA 3H40A 8ICNA 1HUOA 3K4GA 4RT3A 2Y9TA 3U26A 3ALRA 3VC8A 1ZQUA 1S0VA 3F53A 4QW8A 3SQIA 4LJXA 3HW8A 4DLEA 5KL8B 5DBBA 1N60A 1L8LA 1QLNA 3AN1A 5HNKA 2BDPA 2K8CB 2JEIA 3Q8RB 5H2FU 4QWAA 2ASLA 3QU9A 1F44A 2ZUDA 4UB2A 4F3OA 1ZQMA 2HVHA 4OD0A 5KG3A 4KLIA 5J0UA 4RQ3A 3M9OB 3T5KA 3GV7B 2KIVA 4JV2A 1LB2B 5J0QA 7ICIA 3C1YA 2H3FA 1JRPA 4NL9C 5ALPA 1MC8A 4YR0A 1L3UA 8ICSA 3T5LA 3GILA 3MGIA 3WK7A 2YQEA 3MR3A 5KFTA 5EWGA 4MFAA 2FPKA 4PJ0U 4NLCA 2R8HA 3T5HA 3M1YA 5KT7A 3WKAA 1KBUA 1ZOLA 1RDFA 2BCRA 2WHEA 3GV5B 9ICHA 1UA1A 4QZBA 5KT4A 4YMNA 3AEVA 5J2HA 1OW5A 4XQ8A 5DG7A 2ZIVB 1RYSA 3QU5A 2VA3A 4Q43A 2Y9UA 4ECRA 4ED3A 1BPXA 4DS4A 1SXEA 1NOMA 2H5XA 3NVWA 3RTVA 4KX3A 4ECXA 1XWLA 4F8RA 1DRGA 4NLZA 2HBLA 2XO7A 1ZQTA 4O9MA 1KW4A 2BDUA 3HPOA 9ICIA 4M04A 1NJWA 2I5HA 4CDGA 4DL3A 5J2CA 1T94A 1X2IA 1RQNA 3KD3A 5AI5A 4O5CA 2QARA 5J0TA 3RJGA 2W8KA 3SAFA 5J2GA 1BNPA 4GXKA 4I2FA 1TKDA 3OPXA 3Q8KA 4C8MA 3BQ7A 2P35A 5CP2A 2BCSA 3NRWA 2HBMA 1Y88A 4FS2A 5AK6A 4PZNA 2VJ4A 1BPDA 3UXOA 5HMLA 4TUPA 2E8PA 4FS1A 2EANA 4F2SA 3IM1A 4JWMA 2KIWA 8ICXA 2GWSA 3C5FA 4R63A 2G09A 5AICA 3MGVA 5ALTA 3IV6A 3NVZA 3AQFA 2JHDA 3PSPA 3RFAA 1YZ6A 1X40A 5ALHA 3KTQA 2F1IA 2JMGA 4UB1A 4QWDA 5ALUA 4P4OA 4B9LA 1COKA 4Y2XA 5G5HA 1EXNA 5J0RA 1ZQNA 2W9AA 3LVWA 1XSLA 4M6WA 3QX7A 3PW2A 4I2CA 3MC1A 1AROP 4CNQA 5KFLA 2E8OA 4EENA 3Q8MA 2OHFA 3WK6A 7ICEA 1X6IA 8ICWA 2F76X 4IS7A 4EYHB 5G5GA 9ICNA 2DPIA 3PX6A 3GZFA 3TFRA 5J0SA 8ICZA 3RJJA 1DK2A 3HP6A 1PZNA 3PV8A 3SV4A 2PI5A 1KDHA 5AK3A 1PVPA 4NWIA 4FE3A 1MSWD 1SWWA 3KZXA 4MHVA 2RDJA 2ISPA 2WF9A 3I76A 1J2MA 1NK6A 2OM6A 3MDAA 4US8A 2LYAA 1NK4A 8ICLA 2ZJAA 4EYIB 5DQGA 2A1JB 4RQ1A 5ALGA 4CF4A 5KG0A 4X5VA 1VDVA 4DL2A 1S97A 5L9XA 2IA6A 4ECTA 3RJHA 8ICHA 2XY7A 3AU2A 2DKXA 3D2QA 3V7LA 3GU3A 4P0PB 2ES6A 3K75D 2KKVA 5CR0A 1KFDA 2HHQA 2MUTA 1AQ6A 5J0WA 2W9BB 4YVZA 2G5IB 2W7PA 2LI6A 5GTIU 2GH1A 1BPYA 2BCQA 8ICJA 5DDYA 1QSYA 4Z6DA 1RG6A 1QSSA 1UA0A 3FDSA 3DEEA 2PFPA 4J9MA 4ED1A 4Z6EA 2HVIA 4QZ8A 5KG6A 4GFJA 1BPZA 4KX5A 1ZQZA 3QU4A 3PW5A 1T8EA 4OO1J 2AJQA 9ICSA 1MA7A 2WF5A 3V6JA 4KLDA 4GC7A 1B43A 2LM4A 5AM5A 5L1JA 1B4FA 4RQ7A 1ZQBA 1LKYA 4F93B 2KV2A 4DSJA 4I29A 3RF9A 4MFFA 4KLEA 3GFKB 2JXJA 2ZIUA 2AGPA 4YN4A 3C2KA 3WK5A 1KTQA 2W9CA 1Z3EB 4ZOHC 1SL0A 3ZDEA 2WB1F 4B9MA 2K4PA 4BJQA 3LWMA 2BCVA 2K4EA 5AM4A 4FZMA 3WK4A 5KG5A 3UXPA 5KTQA 3TADA 1FO4A 2R8JA 2DUYA 2W9MA 2QLTA 1ZQAA 3KHRA 4C4RA 2F77X 3GDXA 3PSTA 5F9NA 2L5YA 1S8OA 1SV4A 4Y2VA 3SD7A 1WWUA 5L1MA 3LVVA 3JPTA 2QKQA 4DQRA 1JXEA 4LZGA 1CI4A 5A0LA 4DL6A 4C8NA 3B0XA 1U47A 2LMRA 3ISDA 3LYSA 5ALRA 2BPFA 4BWMA 4QZDA 4AP9A 2YMMA 3LK9A 8ICQA 4DSKA 4DQSA 3EZ5A 1FFUA 3JPNA 8ICIA 5IILA 2KSOB 2NRWA 5KFUA 1PK1B 2PKEA 4QWEA 5HR7A 9ICVA 1YZ7A 2AXTU 2H3IA 5JTIA 4JMUA 4ECQA 4P2HA 3PMNA 1U48A 3Q8PB 2MU2A 4ED2A 3RB6A 2EAMA 2OH2A 4UBCA 5J29A 7ICKA 2K8BB 5ALFA 4J9QA 4ED0A 2EH9A 3L5KA 4Z6CA 3I28A 3SZ2A 2VJ5A 3NASA 1NKBA 3BS5A 4C8KA 4YD2A 3PW4A 4DL7A 2HW3A 5KFNA 1FFVA 2QB0A 3OGUA 2LYHA 4DS5A 3EWAA 4DO9A 1NJZA 8ICYA 5KFGA 5AKHA 3OHAA 5KNIA 5KFKA 2LPEA 3QZ7A 1ZQCA 5JRTA 1Q3VA 4G9BA
chains in the Genus database with same CATH topology
2ESEA 2DKXA 2QARB 3TADC 1WWUA 5L1MA 2ES6A 2QKQA 1COKA 3BS7A 2KG5A 2YTUA 3IDWA 2KSOA 1LKYB 2DL0A 1F0MA 1UCVA 2EAOA 2LMRA 1B0XA 1X9XA 1OW5A 2FE9A 3KKAC 1DXSA 2Y9UA 1V38A 2D8CA 1RG6A 1UQVA 5J8YC 2DKZA 4PZOA 1SXDA 1JI7A 1SXEA 3HILA 2E8OA 5J8YA 4RQNA 2QB0B 4RQMA 1PK3A 2QB1A 2B6GA 2D3DA 2Y9TA 1KW4A 2KSOB 1PK1B 4IS7A 2KMDA 5JTIA 2QARA 2F8KA 1B4FA 1V85A 3BQ7A 2EAMA 2K60A 1LKYA 4NJ8A 4NL9A 3H8MA 2E8NA 4PZNA 1X66A 2GLEA 2KE7A 2E8PA 2EAPA 3BS5A 2EANA 4MHVA 3TACB 2KIVA 3K1RB 1WWVA 2JV3A 2K4PA 5F3XB 1OXJA 2QB0A 3SENA 4NL9C 3TADA 2E8MA 1Z1VA 5JU5A 1PK1A 2F44A 3SEIA 2F3NA 5KNIA 1SV0C 1SGGA 2LPEA 5JRTA 2L5YA 1X40A 3BS5B 1SV4A 3KKAA 1SV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  2DKX A;  2QAR B;  3TAD C;  1WWU A;  5L1M A;  2ES6 A;  2QKQ A;  1COK A;  3BS7 A;  2KG5 A;  2YTU A;  3IDW A;  2KSO A;  1LKY B;  2DL0 A;  1F0M A;  1UCV A;  2EAO A;  2LMR A;  1B0X A;  1X9X A;  1OW5 A;  2FE9 A;  3KKA C;  1DXS A;  2Y9U A;  1V38 A;  2D8C A;  1RG6 A;  1UQV A;  5J8Y C;  2DKZ A;  4PZO A;  1SXD A;  1JI7 A;  1SXE A;  3HIL A;  2E8O A;  5J8Y A;  4RQN A;  2QB0 B;  4RQM A;  1PK3 A;  2QB1 A;  2B6G A;  2D3D A;  2Y9T A;  1KW4 A;  2KSO B;  1PK1 B;  4IS7 A;  2KMD A;  5JTI A;  2QAR A;  2F8K A;  1B4F A;  1V85 A;  3BQ7 A;  2EAM A;  2K60 A;  1LKY A;  4NJ8 A;  4NL9 A;  3H8M A;  2E8N A;  4PZN A;  1X66 A;  2GLE A;  2KE7 A;  2E8P A;  2EAP A;  3BS5 A;  2EAN A;  4MHV A;  3TAC B;  2KIV A;  3K1R B;  1WWV A;  2JV3 A;  2K4P A;  5F3X B;  1OXJ A;  2QB0 A;  3SEN A;  4NL9 C;  3TAD A;  2E8M A;  1Z1V A;  5JU5 A;  1PK1 A;  2F44 A;  3SEI A;  2F3N A;  5KNI A;  1SV0 C;  1SGG A;  2LPE A;  5JRT A;  2L5Y A;  1X40 A;  3BS5 B;  1SV4 A;  3KKA A;  1SV0 A; 
#chains in the Genus database with same CATH topology
 1ED1 A;  5ALI A;  4O3O A;  2HHS A;  4BWJ A;  5AM2 A;  3H0M B;  1RXV A;  2HOI A;  5CA7 A;  7ICM A;  7ICQ A;  2WAQ F;  5AKK A;  3BQ0 A;  1N5W A;  2P6U A;  3PR5 B;  1WG8 A;  4UAV A;  4RPY A;  4JB3 A;  2DFL A;  4UAS A;  4QZI A;  5EE1 A;  3ZI4 A;  3T3F A;  4RQ2 A;  2W11 A;  2DKZ A;  3UXN A;  2AU0 A;  5HHI A;  5CRX A;  1ZD4 A;  2WAQ C;  4NV0 A;  5AI9 A;  3RH4 A;  8ICV A;  4O3M A;  4YMO A;  2C22 A;  1UHU A;  1NJX A;  2KZ3 A;  4RQN A;  3IG5 A;  2XI9 A;  2ASD A;  1Z00 A;  2Y1J A;  3FC4 A;  4A8E A;  3GIM A;  3RB3 A;  3MR6 A;  5L1I A;  2DBY A;  2HBK A;  4ECV A;  2C2R A;  4KLF A;  3PX4 A;  1DOQ A;  2W8L A;  3QUT A;  8ICR A;  1S0M A;  2BKE A;  3RRG A;  5ALD A;  5KFS A;  5TZV A;  2Y0S F;  2A1A A;  1ZQP A;  4Q8E A;  1SIJ A;  1V85 A;  2W43 A;  4I2E A;  5KFA A;  4QZA A;  4TQS A;  5IIN A;  1KL9 A;  9ICT A;  4B9T A;  2OCE A;  4YMM A;  2Y0S C;  2GLE A;  4O0I A;  1L3V A;  4M9H A;  3UMG A;  4J9O A;  1COO A;  3OJS A;  1OXJ A;  1ZD5 A;  3QYP A;  3F2C A;  4F5R A;  2ZXH A;  1ZQQ A;  4NM1 A;  5DBA A;  5ALQ A;  1QTM A;  2F3N A;  3TI0 A;  5BPC A;  1SV0 C;  3NVY A;  1Q8K A;  2Z7J A;  4DL5 A;  2H3Z A;  3H4D A;  3QUB A;  8ICF A;  4DSE A;  3ONN A;  3BQ2 A;  2G07 A;  2EZY A;  2GO7 A;  4UB4 A;  2ODG A;  1TAU A;  4UB5 A;  3IDW A;  2FI1 A;  2LBO A;  4M2Y A;  2ZTD A;  3TFS A;  1RZT A;  3T5J A;  5CJ7 A;  4R64 A;  4YR2 A;  3RJI A;  5KFV A;  3VCB A;  3SAG A;  4F4Z A;  4KN7 A;  4NY8 A;  1OUQ A;  3PNC A;  8ICM A;  7ICV A;  3PY8 A;  3C2L A;  5KG4 A;  4CCH A;  2KD1 A;  4YQW A;  1QQ7 A;  4DCC A;  2VA8 A;  3C2M A;  5HMM A;  1A77 A;  2IMW P;  3L3F X;  4I2A A;  1IXR A;  4P0Q A;  4QWC A;  4HAI A;  2RQ5 A;  4UB6 U;  2NO4 A;  2V4R A;  1K5O A;  1KSP A;  4KLM A;  2BQ3 A;  3UMB A;  4G3I A;  4GLX A;  4ED7 A;  1BVS A;  2BZF A;  4J9N A;  4OJO A;  4F71 A;  4R8U B;  4JV1 A;  1WUD A;  3L4P A;  2CRX A;  5KFY A;  5DB9 A;  4KLL A;  2CPR A;  3KHH A;  5J0P A;  3N97 B;  2KFN A;  1T3N A;  1JIH A;  9ICQ A;  1U4B A;  4Y2P A;  1SKW A;  3ZDD A;  1L8O A;  2XIC A;  4MF2 A;  4UAY A;  2J6U A;  2BR0 A;  4IQU A;  4UAW A;  4M9J A;  4XRH A;  4Z6F A;  4OJ6 A;  3LDA A;  3TAD C;  5KFJ A;  1X42 A;  3UMC A;  4O3R A;  9ICP A;  2FLP A;  4MFC A;  4C7Z A;  3H0L B;  1TAM A;  1ZQV A;  1WCN A;  2YTU A;  2H3V A;  3AQE A;  3H4B A;  4EEL A;  8ICC A;  5KFD A;  5BOL A;  2I1Q A;  4F4X A;  4RNM A;  4ELT A;  4YFK A;  2UVR A;  2E3T A;  4DL4 A;  2JZB B;  4UB8 U;  1N61 A;  4TQR A;  1XSN A;  3JPR A;  3GIJ A;  7ICJ A;  2KMD A;  2NV3 A;  2XVT A;  1VJ5 A;  1WYG A;  9ICG A;  2YML A;  5KT2 A;  1U9L A;  2XID A;  2KK0 A;  1TV9 A;  7ICF A;  3HX0 A;  4I2I A;  3RB0 A;  5ALV A;  4K4H A;  2VAN A;  4R66 A;  2AH5 A;  4K4G A;  2NRV A;  3PVX A;  5KFQ A;  3A0H U;  3HKZ F;  2IBK A;  3C28 A;  4J9P A;  2ZIV A;  5DQH A;  4GXJ A;  4OJL A;  5AKJ A;  1D9F A;  2G5H B;  4IC9 A;  4AYB F;  5ALO A;  3HKZ C;  2RLT A;  4Y2S A;  2K89 A;  4UAU A;  3K1Z A;  1L5U A;  1SWV A;  5ALY A;  4RNN A;  4RQ0 A;  4RT2 A;  1NK5 A;  3IG8 A;  3CRX A;  5J0O A;  3N28 A;  5JU5 A;  1X9W A;  2F44 A;  3RAQ A;  4ECY A;  3DV9 A;  1SKS A;  4KLT A;  4F50 A;  1N63 A;  3G6Y A;  3RH6 A;  1SV0 A;  1XS9 D;  1T4G A;  2LM1 A;  5KFO A;  5AHX A;  3BS7 A;  5ALW A;  3F2D A;  4F92 B;  4CRX A;  2KJ5 A;  1JMS A;  3GII A;  2ZIX A;  2IOF A;  3D2S A;  4EEK A;  3SAH A;  4QZG A;  2DF4 B;  4YD1 A;  4PH5 A;  3BQ1 A;  1NJY A;  2XCP A;  2FMS A;  1J2N A;  1CRX A;  2ASJ A;  5J0Y A;  2JEG A;  5E79 U;  3FYH A;  4P4P A;  2Q0Z X;  5KG2 A;  3OSP A;  4MEY A;  3ZDC A;  1UT8 A;  4ECW A;  4J9L A;  4BGD A;  4MF8 A;  2BQU A;  4IRD A;  4UAT A;  2JGA A;  4I27 A;  3A0B U;  3PO4 A;  2BGW A;  9ICC A;  4RNO A;  5ALX A;  4QZC A;  3H7I A;  4BXO B;  5J0X A;  3CYM A;  5CHG A;  1X9M A;  4UB3 A;  4DFM A;  3LWL A;  3ZD8 A;  4KLJ A;  1PVQ A;  4I2B A;  1S0N A;  4FBT A;  5DG8 A;  5EE0 A;  3TAQ A;  5KT3 A;  4DSF A;  2KKP A;  3H8S A;  1DK3 A;  4F5N A;  1V97 A;  4JWN A;  3V6K A;  3B0Y A;  5ALS A;  1MQ2 A;  1Z4O A;  1ZRN A;  2K4H A;  4JV0 A;  4TUS A;  3HRD D;  4YP3 A;  2DQN B;  2YMQ A;  2R8I A;  2VKQ A;  5KT5 A;  2FLL A;  4ECZ A;  3GQC A;  4RQ6 A;  9ICE A;  4F5Q A;  7ICT A;  5AM3 A;  2MAX A;  3EPI A;  1ZQD A;  1B22 A;  1SGG A;  4NM2 A;  4JK1 A;  4Y2R A;  3F5A A;  1SZH A;  3BS5 B;  3N7S C;  1BGX T;  3M6Z A;  5KAF U;  3G6V A;  4NLK A;  1JRO A;  1TK5 A;  1LV5 A;  5AIA A;  1S5L U;  1TVA A;  3KBB A;  1ZQF A;  1F0M A;  2YMP A;  2WB1 C;  5AI6 A;  3V7J A;  5ALK A;  4F4W A;  1K1Q A;  9ICU A;  8ICU A;  4PZO A;  1HIW A;  1QCK A;  2BHN A;  3H0R B;  5AKX A;  3QZ8 A;  1SL2 A;  3PML A;  4Q44 A;  2OWO A;  1NNL A;  4PHE A;  3QEA Z;  3BDP A;  1T3Q A;  1ZQG A;  2A1J A;  3QE9 Y;  3OHB A;  9ICJ A;  4CF5 A;  3PSI A;  2I6X A;  2UVV A;  1U49 A;  2K8A A;  5T14 A;  1SKR A;  3QUQ A;  4J9K A;  5J2J A;  4KLU A;  4USA A;  5JUM A;  4RPX A;  4PHP A;  1BPE A;  3WKD A;  2NRZ A;  5AIB A;  2F8L A;  2W9B A;  3THV A;  8ICA A;  4O3Q A;  1Z00 B;  3PR4 A;  3ETR A;  7ICS A;  1TE2 A;  4O5K A;  4KN4 A;  1KLN A;  2BPG A;  8ICT A;  3GV8 B;  4OCZ A;  3SYZ A;  4F2R A;  2KHQ A;  3MFH A;  2ZIW B;  3B9J A;  2PFO A;  2XGP A;  1GO3 F;  2KIC A;  1NKC A;  1DGS A;  3C23 A;  3WU2 U;  4DFD A;  4UBB A;  4IL6 U;  2A19 A;  5J2K A;  1ZQX A;  2M9N A;  2W03 A;  4EZ9 A;  3UQ2 A;  2H3Q A;  3I1Y A;  2UVU A;  2F1J A;  3FAH A;  2AHO B;  5FP0 A;  3BJY A;  5J2E A;  2VIX A;  4QIW F;  4ZH4 A;  4Y2Q A;  2BCU A;  4DLG A;  3KKA A;  1P7D A;  2KFZ A;  3E0F A;  4C8O A;  3AM9 A;  1ZRM A;  1N2X A;  4DF8 A;  4QIW C;  1S76 D;  1XO0 A;  3JPP A;  2PMZ F;  2DL0 A;  3ISC A;  1UCV A;  1B0X A;  1ZJM A;  3M8R A;  5DB6 A;  4UW9 A;  3N7R C;  4U7C A;  1JAL A;  3ED5 A;  5AI0 A;  4PL1 A;  1JN3 A;  3TQ1 A;  2J6S A;  1ZJN A;  4QJF B;  1RXW A;  9ICL A;  1NZP A;  8ICP A;  1XC9 A;  4KLH A;  2D3D A;  4B9U A;  2FDR A;  4F91 B;  1JXL A;  2W3S A;  1ECW A;  2DWQ A;  4EX6 A;  3HWT A;  4DSL A;  5DLG A;  5EOZ A;  3NTU A;  1NK7 A;  3UM9 A;  3RR7 A;  3BQT A;  5ALN A;  3RB4 A;  5KFI A;  4ED6 A;  4YG2 A;  3V7K A;  2W3R A;  4MEX A;  1DGJ A;  2V9W A;  4PHD A;  1SZP A;  4NLB A;  4EZ6 A;  2GOL A;  7ICH A;  3M8S A;  5KFH A;  2BQR A;  5BOM A;  2KE7 A;  4IR9 A;  3ZDA A;  2KVC A;  5CB1 A;  3EYZ A;  1SL1 A;  3K1R B;  1NI3 A;  3KFU F;  1D8L A;  1J97 A;  4P0Q B;  4Y2T A;  4I2D A;  4O3S A;  3OSN A;  2B0C A;  1MN8 A;  2E8M A;  4ELU A;  5KFR A;  5KFM A;  1PK1 A;  2RHF A;  3SEI A;  2WF8 A;  1URJ A;  4DWI A;  1BNO A;  2P6R A;  2EZX A;  5D46 A;  3H8J A;  5J2I A;  1QSL A;  4KIT B;  3Q8Q B;  2C2E A;  2QAR B;  3WKB A;  4LVS A;  5AKI A;  3PZP A;  3Q8S B;  4FFD A;  5AKE A;  1X6J A;  2HCF A;  1N5X A;  2AGQ A;  3IN5 A;  3SR6 A;  9ICK A;  2YX8 A;  1Z19 A;  4U6P A;  4Q8F A;  3WKE A;  2KN7 A;  4XUS A;  1Z1B A;  4Y2U A;  1ZXI A;  1ZET A;  5HP4 A;  4PPX A;  2ZJ5 A;  4US9 A;  1UQV A;  1FIQ A;  2P66 A;  4B9S A;  1JI7 A;  3FM9 A;  2HHW A;  3SI8 A;  1CUK A;  2JRZ A;  2NRT A;  5AM0 A;  2RDI A;  2QB1 A;  5KG1 A;  2UVW A;  3D6J A;  5ALM A;  5CEH A;  2ZUB A;  5DB7 A;  2XY6 A;  3QXG A;  4NLG A;  1O03 A;  5IIK A;  4KLS A;  2G0A A;  1ZQH A;  2HDO A;  2W04 A;  2YB4 A;  4BX9 C;  1TK0 A;  5DB8 A;  1PUZ A;  2KVS A;  2VA2 A;  2ZG6 A;  2F8K A;  4QWB A;  3IP4 B;  4ECU A;  4PGY A;  3PW0 A;  2XC9 A;  4CF3 A;  1S10 A;  1S0O A;  1D8B A;  5J2D A;  1HUZ A;  5AI4 A;  4FBU A;  4J9R A;  2OEH A;  1C20 A;  3KHL A;  2DGZ A;  3GIK A;  4GXI A;  4YXJ A;  9ICB A;  4M6W B;  3TAP A;  3UPQ A;  2DPJ A;  5DLF A;  2HBJ A;  2J6T A;  3SEN A;  5EWF A;  3TAN A;  1S9F A;  1N62 A;  2F1H A;  4OJP A;  3M9N B;  7ICP A;  4YCX A;  1M6Y A;  3IRU A;  1RYR A;  1IM4 A;  1H38 A;  2E1F A;  5DQI A;  2LHT A;  3C21 A;  4RZR A;  9ICA A;  2LYB A;  4DFJ A;  4I2J A;  4I28 A;  2PXI A;  1C7Y A;  1ZQJ A;  4XA5 A;  4RUA A;  1L3T A;  7ICG A;  3MR5 A;  1U45 A;  2R18 A;  2HHT A;  2FMP A;  4P4M A;  1MQ3 A;  4FZN A;  5AKY A;  1TK8 A;  2R8K A;  3MDC A;  9ICW A;  1XO1 A;  1QQ5 A;  4M9L A;  3EPG A;  5AI8 A;  5AKG A;  3UQ0 A;  1X9X A;  5KFP A;  3M6K A;  2AQ0 A;  2XGQ A;  4DFP A;  4BDP A;  2IHN A;  3RR8 A;  2BPC A;  5J8Y C;  5IIJ A;  4NXZ A;  3Q8L A;  1PK3 A;  2MSN A;  2I9G A;  5DBC A;  2KTQ A;  7ICN A;  4DOC A;  2AQ4 A;  4RQ5 A;  5C0Y A;  3MR2 A;  4PHA A;  3MGH A;  2Y1I A;  4FO6 A;  2WF6 A;  4B9N A;  2PI4 A;  1N48 A;  2IOF K;  2ZIX B;  4UAR A;  1LVH A;  4PL2 A;  4E0D A;  2W55 A;  9ICX A;  1O08 A;  4DF4 A;  4TUR A;  1KQQ A;  1Q3U A;  4ED8 A;  2R8G A;  3CNH A;  5KAI U;  3NUQ A;  2KZM A;  4F4K A;  4YXM A;  1HJP A;  2MUT B;  2IHM A;  4J03 A;  3C1Z A;  1XSP A;  1TFR A;  8ICO A;  1WWV A;  1NK0 A;  3WK9 A;  3OTQ A;  4IRC A;  4I2H A;  2HHU A;  1KFT A;  1KEJ A;  4GIB A;  2ALZ A;  2EDU A;  1Z4N A;  2JH1 A;  3T79 A;  3KOO A;  1ZQS A;  2ZTE A;  4I2G A;  2EQY A;  1S77 D;  5C5J A;  1RM6 C;  4UAZ A;  1T7P A;  3NS1 A;  2V4Q A;  4F4Y A;  3IHQ B;  3F2B A;  3KHG A;  4ELV A;  1UT5 A;  3AU6 A;  2MRL A;  9ICF A;  3RBE A;  4RPZ A;  2ATL A;  3QNM A;  3G6X A;  2YB1 A;  3ZDB A;  4IQT A;  1LKY B;  2KOB A;  4AYB C;  2B21 A;  4C7Y A;  5ALZ A;  3KKA C;  4R8U A;  2CXY A;  5EE3 A;  5L1L A;  3E2E A;  2ZIU B;  2G08 A;  5DGB A;  2W9C B;  3PW7 A;  1ZQ1 C;  1IG6 A;  2KP7 A;  5KFW A;  5F9L A;  4C4S A;  4RUC A;  4M47 A;  3QUC A;  2B6G A;  3ZD9 A;  1IV8 A;  5DG9 A;  4F5P A;  3TKA A;  4C8L A;  5DGA A;  5KFB A;  8ICG A;  5AK4 A;  4DEZ A;  5KFF A;  3PX0 A;  3MFI A;  4B9V A;  2YY6 A;  1BPB A;  5AKL A;  4NLN A;  4KLG A;  1L6N A;  4TUQ A;  4EX7 A;  5IIO A;  2XCA A;  3RJK A;  2FLN A;  3M7D A;  3S6J A;  4NJ8 A;  1HEK A;  4NL9 A;  3H8M A;  4C0Z A;  5DKW A;  3NVV A;  5K4L A;  4QZ9 A;  3M9M B;  4PGQ A;  1QQ6 A;  3AL0 B;  4DQQ A;  2WTF A;  2ISO A;  2OXO A;  5TIS U;  1XU4 A;  2C2D A;  2EAP A;  1WCL A;  3RH5 A;  4DSI A;  4F72 A;  2KHV A;  4QNL A;  2E5S A;  2N1R A;  3N4M B;  4Y2Y A;  4KMO B;  1A76 A;  3JPS A;  1YT3 A;  2JZB A;  8ICB A;  5ALJ A;  1F5S A;  4DOA A;  3MBY A;  3RJF A;  4M9N A;  4EBE A;  3QU2 A;  5III A;  1CEZ A;  1V9P A;  3E58 A;  2FMQ A;  1X9S A;  3PO5 A;  3H8W A;  4ICA A;  2JEJ A;  2M0N A;  2ESE A;  4QZE A;  1ZQE A;  2HI0 A;  2ZTC A;  4QZF A;  4BUG A;  3C29 A;  2JR5 A;  2HOF A;  2KG5 A;  4O3P A;  5J2A A;  5DDM A;  4KLQ A;  1L7N A;  1QH9 A;  1D8Y A;  1DXS A;  4RU9 A;  1L3S A;  4JUZ A;  2WF7 A;  4DQI A;  1A6S A;  2AGO A;  3RRH A;  7ICL A;  5J8Y A;  2QB0 B;  4RQM A;  4HYK A;  5HR6 A;  5HHH A;  2JH7 A;  4IRK A;  4YR3 A;  3F5E A;  3SV3 A;  1NK9 A;  2ZUC A;  1RYU A;  4QW9 A;  3JPQ A;  2D6F C;  4M0A A;  4O3N A;  2KZZ A;  2G06 A;  4DQP A;  5ALE A;  1L7P A;  2F2A B;  3QEB Z;  3PSF A;  2K60 A;  1L7M A;  4M9G A;  2KNJ A;  1JUD A;  9ICR A;  5CWR A;  1KN5 A;  2ZXI A;  3O0F A;  5KG7 A;  1FEZ A;  2NO5 A;  5B66 U;  5B5E U;  2Q4T A;  3TAC B;  1N56 A;  4LZD A;  1Q46 A;  4P0P A;  5F3X B;  3RBD A;  2A3V A;  4PGX A;  5KFE A;  3J81 j;  1NK8 A;  4C4T A;  5EWE A;  5AK5 A;  3JPO A;  3R9K A;  2IOH A;  4CGZ A;  4BXO A;  1NKE A;  3V72 A;  4GC6 A;  1A0P A;  3ETL A;  1ZQR A;  4KTQ A;  7ICU A;  2HHV A;  2HHX A;  4KLO A;  3WK8 A;  3BZC A;  8ICE A;  2YN4 A;  5KFZ A;  4WJ3 B;  3RAX A;  3HJE A;  1D9D A;  4DOB A;  2XY5 A;  4IQW A;  1IIP A;  3CP8 A;  1RPL A;  2KJ9 A;  2NYV A;  2D8C A;  2ZJ8 A;  5KL1 B;  1VLB A;  3HIL A;  3ORY A;  5KFC A;  4O5E A;  4CE6 A;  1ZD3 A;  1KRP A;  2PFQ A;  4IR1 A;  3EUB 2;  8ICK A;  4RQ8 A;  2FJ6 A;  7ICO A;  1SB3 C;  3AUO A;  2HSZ A;  2K4I A;  1ZQO A;  5J2B A;  2FPL A;  2LKY A;  3OJU A;  2PMZ C;  1PVR A;  3RJE A;  4EBC A;  4FZL A;  4ACO A;  5J2F A;  1ZQY A;  3NRZ A;  2HMX A;  1TAQ A;  4K4I A;  1KFS A;  2KEY A;  3KZI U;  2E8N A;  9ICO A;  3WKC A;  1RQL A;  1X66 A;  3MAB A;  1L7O A;  1XNS A;  1ZD2 P;  2RRD A;  2W54 A;  1ZQI A;  4Q45 A;  2MA1 A;  4Y2J A;  2W7O A;  5IIM A;  3AMZ A;  4ECS A;  4F5O A;  5GTH U;  2CN1 A;  5D49 A;  2JV3 A;  1NZB A;  4R65 A;  5AM1 A;  1K1S A;  5EE9 A;  2O6K A;  1Z1V A;  4J9S A;  1ZQW A;  4DFK A;  4QZH A;  3D2N A;  3HT3 A;  3NGD A;  2FPM A;  1ZQK A;  3C5G A;  2E1E A;  1KKX A;  4KMU A;  3BZK A;  2EZZ A;  5L1K A;  2PFN A;  4EBD A;  1UPH A;  3CW2 C;  7ICR A;  4UQG A;  1ZQL A;  2C28 A;  4RQ4 A;  3SMV A;  3ICX A;  4B6J A;  5KT6 A;  2KSO A;  5ALL A;  2EAO A;  1ZYQ A;  4OJ5 A;  2FE9 A;  3ISB A;  5AKZ A;  5KFX A;  4EEY A;  2NRX A;  2ZIW A;  3DDH A;  2RP5 A;  4IQV A;  2OYY A;  9ICM A;  1JX4 A;  1V38 A;  5D4B A;  3V6H A;  2JEF A;  2HOQ A;  2KJ8 A;  3N7P D;  1SXD A;  3EW9 A;  3QU7 A;  3TAR A;  4C80 A;  2WFA A;  3H40 A;  8ICN A;  1HUO A;  3K4G A;  4RT3 A;  2Y9T A;  3U26 A;  3ALR A;  3VC8 A;  1ZQU A;  1S0V A;  3F53 A;  4QW8 A;  3SQI A;  4LJX A;  3HW8 A;  4DLE A;  5KL8 B;  5DBB A;  1N60 A;  1L8L A;  1QLN A;  3AN1 A;  5HNK A;  2BDP A;  2K8C B;  2JEI A;  3Q8R B;  5H2F U;  4QWA A;  2ASL A;  3QU9 A;  1F44 A;  2ZUD A;  4UB2 A;  4F3O A;  1ZQM A;  2HVH A;  4OD0 A;  5KG3 A;  4KLI A;  5J0U A;  4RQ3 A;  3M9O B;  3T5K A;  3GV7 B;  2KIV A;  4JV2 A;  1LB2 B;  5J0Q A;  7ICI A;  3C1Y A;  2H3F A;  1JRP A;  4NL9 C;  5ALP A;  1MC8 A;  4YR0 A;  1L3U A;  8ICS A;  3T5L A;  3GIL A;  3MGI A;  3WK7 A;  2YQE A;  3MR3 A;  5KFT A;  5EWG A;  4MFA A;  2FPK A;  4PJ0 U;  4NLC A;  2R8H A;  3T5H A;  3M1Y A;  5KT7 A;  3WKA A;  1KBU A;  1ZOL A;  1RDF A;  2BCR A;  2WHE A;  3GV5 B;  9ICH A;  1UA1 A;  4QZB A;  5KT4 A;  4YMN A;  3AEV A;  5J2H A;  1OW5 A;  4XQ8 A;  5DG7 A;  2ZIV B;  1RYS A;  3QU5 A;  2VA3 A;  4Q43 A;  2Y9U A;  4ECR A;  4ED3 A;  1BPX A;  4DS4 A;  1SXE A;  1NOM A;  2H5X A;  3NVW A;  3RTV A;  4KX3 A;  4ECX A;  1XWL A;  4F8R A;  1DRG A;  4NLZ A;  2HBL A;  2XO7 A;  1ZQT A;  4O9M A;  1KW4 A;  2BDU A;  3HPO A;  9ICI A;  4M04 A;  1NJW A;  2I5H A;  4CDG A;  4DL3 A;  5J2C A;  1T94 A;  1X2I A;  1RQN A;  3KD3 A;  5AI5 A;  4O5C A;  2QAR A;  5J0T A;  3RJG A;  2W8K A;  3SAF A;  5J2G A;  1BNP A;  4GXK A;  4I2F A;  1TKD A;  3OPX A;  3Q8K A;  4C8M A;  3BQ7 A;  2P35 A;  5CP2 A;  2BCS A;  3NRW A;  2HBM A;  1Y88 A;  4FS2 A;  5AK6 A;  4PZN A;  2VJ4 A;  1BPD A;  3UXO A;  5HML A;  4TUP A;  2E8P A;  4FS1 A;  2EAN A;  4F2S A;  3IM1 A;  4JWM A;  2KIW A;  8ICX A;  2GWS A;  3C5F A;  4R63 A;  2G09 A;  5AIC A;  3MGV A;  5ALT A;  3IV6 A;  3NVZ A;  3AQF A;  2JHD A;  3PSP A;  3RFA A;  1YZ6 A;  1X40 A;  5ALH A;  3KTQ A;  2F1I A;  2JMG A;  4UB1 A;  4QWD A;  5ALU A;  4P4O A;  4B9L A;  1COK A;  4Y2X A;  5G5H A;  1EXN A;  5J0R A;  1ZQN A;  2W9A A;  3LVW A;  1XSL A;  4M6W A;  3QX7 A;  3PW2 A;  4I2C A;  3MC1 A;  1ARO P;  4CNQ A;  5KFL A;  2E8O A;  4EEN A;  3Q8M A;  2OHF A;  3WK6 A;  7ICE A;  1X6I A;  8ICW A;  2F76 X;  4IS7 A;  4EYH B;  5G5G A;  9ICN A;  2DPI A;  3PX6 A;  3GZF A;  3TFR A;  5J0S A;  8ICZ A;  3RJJ A;  1DK2 A;  3HP6 A;  1PZN A;  3PV8 A;  3SV4 A;  2PI5 A;  1KDH A;  5AK3 A;  1PVP A;  4NWI A;  4FE3 A;  1MSW D;  1SWW A;  3KZX A;  4MHV A;  2RDJ A;  2ISP A;  2WF9 A;  3I76 A;  1J2M A;  1NK6 A;  2OM6 A;  3MDA A;  4US8 A;  2LYA A;  1NK4 A;  8ICL A;  2ZJA A;  4EYI B;  5DQG A;  2A1J B;  4RQ1 A;  5ALG A;  4CF4 A;  5KG0 A;  4X5V A;  1VDV A;  4DL2 A;  1S97 A;  5L9X A;  2IA6 A;  4ECT A;  3RJH A;  8ICH A;  2XY7 A;  3AU2 A;  2DKX A;  3D2Q A;  3V7L A;  3GU3 A;  4P0P B;  2ES6 A;  3K75 D;  2KKV A;  5CR0 A;  1KFD A;  2HHQ A;  2MUT A;  1AQ6 A;  5J0W A;  2W9B B;  4YVZ A;  2G5I B;  2W7P A;  2LI6 A;  5GTI U;  2GH1 A;  1BPY A;  2BCQ A;  8ICJ A;  5DDY A;  1QSY A;  4Z6D A;  1RG6 A;  1QSS A;  1UA0 A;  3FDS A;  3DEE A;  2PFP A;  4J9M A;  4ED1 A;  4Z6E A;  2HVI A;  4QZ8 A;  5KG6 A;  4GFJ A;  1BPZ A;  4KX5 A;  1ZQZ A;  3QU4 A;  3PW5 A;  1T8E A;  4OO1 J;  2AJQ A;  9ICS A;  1MA7 A;  2WF5 A;  3V6J A;  4KLD A;  4GC7 A;  1B43 A;  2LM4 A;  5AM5 A;  5L1J A;  1B4F A;  4RQ7 A;  1ZQB A;  1LKY A;  4F93 B;  2KV2 A;  4DSJ A;  4I29 A;  3RF9 A;  4MFF A;  4KLE A;  3GFK B;  2JXJ A;  2ZIU A;  2AGP A;  4YN4 A;  3C2K A;  3WK5 A;  1KTQ A;  2W9C A;  1Z3E B;  4ZOH C;  1SL0 A;  3ZDE A;  2WB1 F;  4B9M A;  2K4P A;  4BJQ A;  3LWM A;  2BCV A;  2K4E A;  5AM4 A;  4FZM A;  3WK4 A;  5KG5 A;  3UXP A;  5KTQ A;  3TAD A;  1FO4 A;  2R8J A;  2DUY A;  2W9M A;  2QLT A;  1ZQA A;  3KHR A;  4C4R A;  2F77 X;  3GDX A;  3PST A;  5F9N A;  2L5Y A;  1S8O A;  1SV4 A;  4Y2V A;  3SD7 A;  1WWU A;  5L1M A;  3LVV A;  3JPT A;  2QKQ A;  4DQR A;  1JXE A;  4LZG A;  1CI4 A;  5A0L A;  4DL6 A;  4C8N A;  3B0X A;  1U47 A;  2LMR A;  3ISD A;  3LYS A;  5ALR A;  2BPF A;  4BWM A;  4QZD A;  4AP9 A;  2YMM A;  3LK9 A;  8ICQ A;  4DSK A;  4DQS A;  3EZ5 A;  1FFU A;  3JPN A;  8ICI A;  5IIL A;  2KSO B;  2NRW A;  5KFU A;  1PK1 B;  2PKE A;  4QWE A;  5HR7 A;  9ICV A;  1YZ7 A;  2AXT U;  2H3I A;  5JTI A;  4JMU A;  4ECQ A;  4P2H A;  3PMN A;  1U48 A;  3Q8P B;  2MU2 A;  4ED2 A;  3RB6 A;  2EAM A;  2OH2 A;  4UBC A;  5J29 A;  7ICK A;  2K8B B;  5ALF A;  4J9Q A;  4ED0 A;  2EH9 A;  3L5K A;  4Z6C A;  3I28 A;  3SZ2 A;  2VJ5 A;  3NAS A;  1NKB A;  3BS5 A;  4C8K A;  4YD2 A;  3PW4 A;  4DL7 A;  2HW3 A;  5KFN A;  1FFV A;  2QB0 A;  3OGU A;  2LYH A;  4DS5 A;  3EWA A;  4DO9 A;  1NJZ A;  8ICY A;  5KFG A;  5AKH A;  3OHA A;  5KNI A;  5KFK A;  2LPE A;  3QZ7 A;  1ZQC A;  5JRT A;  1Q3V A;  4G9B A; 
#chains in the Genus database with same CATH homology
 2ESE A;  2DKX A;  2QAR B;  3TAD C;  1WWU A;  5L1M A;  2ES6 A;  2QKQ A;  1COK A;  3BS7 A;  2KG5 A;  2YTU A;  3IDW A;  2KSO A;  1LKY B;  2DL0 A;  1F0M A;  1UCV A;  2EAO A;  2LMR A;  1B0X A;  1X9X A;  1OW5 A;  2FE9 A;  3KKA C;  1DXS A;  2Y9U A;  1V38 A;  2D8C A;  1RG6 A;  1UQV A;  5J8Y C;  2DKZ A;  4PZO A;  1SXD A;  1JI7 A;  1SXE A;  3HIL A;  2E8O A;  5J8Y A;  4RQN A;  2QB0 B;  4RQM A;  1PK3 A;  2QB1 A;  2B6G A;  2D3D A;  2Y9T A;  1KW4 A;  2KSO B;  1PK1 B;  4IS7 A;  2KMD A;  5JTI A;  2QAR A;  2F8K A;  1B4F A;  1V85 A;  3BQ7 A;  2EAM A;  2K60 A;  1LKY A;  4NJ8 A;  4NL9 A;  3H8M A;  2E8N A;  4PZN A;  1X66 A;  2GLE A;  2KE7 A;  2E8P A;  2EAP A;  3BS5 A;  2EAN A;  4MHV A;  3TAC B;  2KIV A;  3K1R B;  1WWV A;  2JV3 A;  2K4P A;  5F3X B;  1OXJ A;  2QB0 A;  3SEN A;  4NL9 C;  3TAD A;  2E8M A;  1Z1V A;  5JU5 A;  1PK1 A;  2F44 A;  3SEI A;  2F3N A;  5KNI A;  1SV0 C;  1SGG A;  2LPE A;  5JRT A;  2L5Y A;  1X40 A;  3BS5 B;  1SV4 A;  3KKA A;  1SV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...