3H8MA

Sam domain of human ephrin type-a receptor 7 (epha7)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
71
structure length
71
Chain Sequence
TPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 7
publication title SAM Domain of Human Ephrin Type-A Receptor 7 (Epha7)
rcsb
source organism Homo sapiens
total genus 23
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3h8mA00
1JI7A 3HILA 2KSOA 4IS7A 2E8NA 3KKAA 3SEIA 1SGGA 1KW4A 1LKYA 5JTIA 2K60A 4RQMA 5L1MA 1DXSA 2F3NA 1X66A 1OXJA 2Y9UA 3SENA 2QARA 1PK3A 2YTUA 5J8YC 2B6GA 2ESEA 2EANA 1WWUA 4NJ8A 1PK1B 2EAOA 2DL0A 1WWVA 2D8CA 2QB0B 5JRTA 3BS5A 2QKQA 5KNIA 5J8YA 3BS7A 2KIVA 1SV0C 2JV3A 3TADC 2D3DA 2GLEA 2F44A 2F8KA 1V85A 2KMDA 4MHVA 2E8PA 2KSOB 2L5YA 2E8MA 4NL9C 1X40A 1Z1VA 2KE7A 1RG6A 2EAPA 3TACB 1UQVA 2LMRA 1B4FA 2QB0A 2FE9A 1V38A 1F0MA 2ES6A 1SXEA 2LPEA 3K1RB 4PZOA 1OW5A 2DKZA 3H8MA 1B0XA 1COKA 3TADA 1SXDA 5JU5A 4NL9A 2KG5A 2QB1A 4RQNA 5F3XB 1PK1A 3KKAC 3IDWA 1X9XA 2E8OA 3BQ7A 1SV4A 1LKYB 2Y9TA 3BS5B 2DKXA 2K4PA 4PZNA 2EAMA 2QARB 1SV0A 1UCVA
chains in the Genus database with same CATH superfamily
4ELVA 2XGQA 4KMOB 4P4PA 4IRCA 5HNKA 4CNQA 5H2FU 2ZTCA 4F4YA 1CUKA 3QU9A 2CRXA 1XS9D 4C7YA 1X9SA 3F2DA 1V97A 2A1AA 2NRVA 2Y9UA 2ZIUB 9ICXA 4XA5A 2KD1A 5KFYA 2PI5A 2K8CB 5BOMA 4OO1J 1ZQJA 3HT3A 2W7PA 2YQEA 3VCBA 1C20A 3RAQA 4FBUA 1S76D 5J2EA 3CP8A 5J8YA 2WAQC 7ICQA 2D3DA 2H3FA 2KP7A 1QCKA 4ECXA 4OJ5A 4DOAA 4O5CA 4M6WB 2R8KA 3L4PA 3SAFA 3C2MA 2YMLA 4RPYA 3Q8RB 4U6PA 2C2RA 1Z4OA 3RBDA 2HHVA 4MEXA 2QB0A 1V38A 4BXOA 4JUZA 4FS1A 5IIIA 3MGHA 3B9JA 5L9XA 5J29A 3MFHA 1IV8A 4NLGA 2JZBB 4JWNA 3JPQA 2ZIUA 2HOQA 3C23A 3TQ1A 1PVQA 5ALEA 1FFVA 4C8LA 3KHHA 4DF8A 1KFDA 9ICJA 5DB8A 5FP0A 1XNSA 4I27A 1CEZA 2EH9A 3Q8QB 2E8OA 3ZD8A 4DOCA 1NKEA 5DQHA 2XIDA 2FLNA 3RF9A 1L8OA 4FZNA 5KT3A 4J9QA 4J9MA 3RB3A 3MR6A 2FPLA 2BKEA 1L7NA 4US8A 4M6WA 4UQGA 4B9VA 5F9LA 3N97B 1TK8A 3BDPA 3QUQA 2EDUA 3ZDEA 4DSKA 1SGGA 8ICPA 8ICOA 2JZBA 1T94A 3MR2A 4QZHA 4QJFB 3PSFA 4DQRA 8ICZA 4P0QA 8ICUA 1S10A 5ALGA 1TE2A 3KHRA 2F8LA 3AU2A 3H8SA 5KG0A 4GXJA 1NJWA 3ORYA 4IRDA 1NZPA 5DG9A 2KNJA 4GIBA 2XCAA 2P66A 1UT8A 2A1JB 3H8WA 2PXIA 4IL6U 1TK5A 4O3SA 4Q43A 2F44A 1RXWA 4DEZA 3HW8A 1N60A 1Z1VA 2I1QA 5JUMA 1RM6C 3RFAA 2EAPA 3GFKB 7ICVA 3M7DA 4USAA 4GC7A 2FE9A 3THVA 5AKLA 4XRHA 2H3QA 2NO4A 3RJEA 8ICMA 1SKSA 5J2GA 3KZXA 2DKZA 3JPTA 2MAXA 4NLNA 3IN5A 3M6ZA 3H0LB 1BPXA 2JRZA 3A0HU 2ZUCA 3PW0A 8ICLA 3IDWA 2ZXIA 4FZMA 5AK5A 5J2DA 4J9OA 5D49A 1LB2B 3PR4A 4IR1A 2A1JA 2DKXA 4KLJA 1BVSA 2BPCA 1Z00A 2FJ6A 2P6RA 5KFNA 2ASDA 3T5LA 4P4OA 1T8EA 3KZIU 4R65A 2HCFA 3WK8A 5ALSA 2AGOA 2Y0SC 4UB8U 4QW9A 3B0YA 1JX4A 4C8KA 2G09A 4EELA 4TUQA 3ZD9A 5D46A 2PFQA 3SENA 1T4GA 2HHWA 1SB3C 1Q3UA 2ATLA 2YY6A 4DSFA 1Z4NA 4CF4A 3MDAA 1NK5A 8ICNA 1RYSA 3OSPA 4YXMA 2ZJAA 2D8CA 5DDYA 4Y2PA 4RZRA 5DG7A 1QQ7A 5HR7A 1UA0A 2BCUA 5C0YA 5DBCA 3BS7A 5ALQA 1WCLA 2PKEA 1M6YA 2W9CA 1HUOA 2F8KA 4OJ6A 2YMMA 1YT3A 5ALTA 4M9JA 4UARA 4TUPA 1NNLA 4QWDA 4KITB 4F4KA 4P0PA 4MFCA 5IINA 3ISBA 1XC9A 4YR0A 1SIJA 2H3IA 1ZQSA 4F5QA 2M0NA 3F2BA 3QEAZ 1QQ5A 5IIKA 2W9MA 3KKAC 5AM1A 3GDXA 2VKQA 1SKRA 5K4LA 2IHNA 3MGIA 2KK0A 3T3FA 4Y2UA 2KZ3A 4XQ8A 4LZGA 4DFKA 3RAXA 2W55A 1JRPA 3GZFA 1SV0A 1ZQBA 1RQNA 4GLXA 4Y2TA 2LYHA 4OJLA 3UXPA 4DSIA 3C5FA 1DGSA 2J6UA 4MFFA 3M9MB 3ETLA 1TK0A 1P7DA 3TARA 5KT7A 2XCPA 1X2IA 3GIKA 3GIJA 1Q3VA 2YTUA 3WKDA 4KX3A 2ESEA 4RUAA 1HIWA 5CRXA 2VIXA 4BDPA 2EZZA 5AIAA 2ZUBA 4GXIA 2DFLA 1JN3A 2ASLA 5EE3A 3QU5A 9ICIA 1SV0C 1JXLA 1RPLA 4J9LA 4J9KA 2OEHA 3TACB 3RH5A 4ZH4A 5ALZA 4F2RA 2LM1A 3BQ2A 3C2LA 2BCSA 2Z7JA 5J0WA 4ECRA 4YFKA 5KFXA 2I9GA 3DV9A 1C7YA 4F2SA 3MABA 1KBUA 3UQ0A 4C4RA 3QU2A 4YMOA 7ICHA 2GOLA 4NM1A 5HHIA 3NVWA 3D2NA 3NS1A 2A3VA 1ZQRA 2KICA 2HBJA 1O03A 1L6NA 2KOBA 4Q8FA 4AYBC 1KLNA 5AKZA 4U7CA 7ICUA 4P2HA 3CNHA 2G08A 3FM9A 1NK6A 1D8BA 3GU3A 3SMVA 4CDGA 5KFEA 3RRHA 9ICSA 4RQMA 4O3NA 4B9NA 4RUCA 1NKBA 4C80A 2QARA 2B0CA 4C8NA 4PGXA 2C22A 3RR8A 3CW2C 4RQ4A 3LYSA 4UAVA 4NLCA 3C28A 1ZQPA 5KAFU 2WF6A 1XSPA 1ZQVA 4K4IA 2AU0A 2HBMA 4KLOA 3PW2A 3MC1A 5DKWA 4I29A 3JPPA 4Q8EA 7ICTA 3ZDAA 4UB2A 3V6JA 4Y2YA 4KLFA 2ISOA 4LZDA 1J97A 3G6YA 3TADC 2HVIA 8ICCA 2BCRA 4O9MA 2FLPA 1KEJA 4M9NA 4DL3A 4EBCA 3H0RB 8ICEA 3AMZA 3EYZA 4UAUA 2R8GA 1DOQA 1S5LU 2XICA 2ZUDA 5J0XA 3BZCA 5ALFA 4UAWA 1F0MA 3UXNA 3AQEA 4J03A 2JH7A 2P35A 4YN4A 5J0QA 4YR2A 3GIIA 3HKZF 2C2EA 1L7MA 5CHGA 4UB1A 2ZIWB 4RQNA 9ICTA 1N5XA 4I2JA 5F3XB 3D6JA 3N7RC 4QWCA 1X9XA 1NK0A 3CRXA 3OHAA 1ZQHA 1ZD4A 8ICVA 4ED3A 3BZKA 2Q4TA 1ZQGA 1FFUA 3ALRA 3CYMA 2GO7A 4Y2QA 3JPRA 2H3VA 4I2DA 4Y2VA 1ZQEA 2E8NA 1L3SA 2E1FA 4EYIB 1L3UA 9ICAA 1ZQWA 4K4GA 3D2QA 5J0SA 3H4BA 2HHXA 4ECQA 3RB4A 4F5PA 3LVVA 3LWLA 5DLFA 5IIMA 4BUGA 1DXSA 2YB4A 3Q8MA 3H7IA 4F50A 3OJUA 3ZDCA 5KFKA 2FDRA 4A8EA 2IA6A 1KDHA 4OCZA 2ZTDA 1MC8A 4FE3A 2ZIWA 4BJQA 5KFWA 4DSEA 1B43A 4ELTA 2HHSA 4NM2A 1ZJNA 4UBBA 2QB0B 1ZD3A 3IHQB 4DFMA 3SYZA 3SR6A 1DK2A 4BXOB 4QWAA 4QW8A 5KT5A 8ICWA 2MU2A 2ZJ5A 2VA2A 5KG6A 2Y1JA 2FMQA 5ALXA 3M1YA 1V85A 2VA8A 4F91B 2G5HB 2VJ4A 5EE0A 5ALUA 1BNPA 1PVPA 2E1EA 1XU4A 2LMRA 1UHUA 3T79A 1J2NA 4C0ZA 2ES6A 3QUBA 2XI9A 4TQSA 3PW4A 2HBKA 3GV5B 5KFQA 3B0XA 3T5JA 5KFGA 1QQ6A 3H8MA 4Z6DA 1L3VA 1B0XA 4I2AA 2K4HA 4JB3A 2MUTA 4YVZA 3WK9A 5B5EU 2KFNA 4US9A 3LK9A 2AGPA 1TVAA 5KFDA 2W3RA 4O0IA 2Y9TA 2D6FC 2IOFK 2KKVA 1UT5A 2RP5A 4EX7A 4P0QB 5KFPA 2HOIA 4CRXA 3ZDBA 1N61A 3F53A 4IS7A 3RH6A 4F8RA 4JV1A 4YCXA 4F5OA 2IBKA 2ZIVB 3SI8A 5IIOA 1SWVA 1K1SA 1KW4A 1AQ6A 5AKXA 2K60A 1ZQIA 2H3ZA 4EZ9A 2F3NA 5KFJA 1YZ7A 5KTQA 1XSNA 2DUYA 1TAUA 1PK3A 5J8YC 2DPJA 3FAHA 5G5GA 2OYYA 4LJXA 4C7ZA 3IV6A 4KLEA 1IG6A 2WB1C 5JRTA 3HRDD 5KT4A 4C8OA 3PY8A 4MFAA 1ZQFA 4QZAA 5KL1B 2PFOA 2LHTA 3RJKA 2JV3A 2KJ8A 3RJJA 1L5UA 4I28A 3MBYA 5L1LA 2DF4B 4NLBA 2ZIVA 1WYGA 3RR7A 1UQVA 2XY5A 2F2AB 8ICTA 5AICA 5KG5A 3AM9A 5J2HA 3LDAA 4B9LA 1Z00B 3M6KA 4RQ5A 4NV0A 3E2EA 4Y2RA 2ODGA 5JU5A 4NL9A 2A19A 3MFIA 2HHQA 2KJ5A 7ICNA 4DQPA 3TANA 1OUQA 5EWGA 4DLGA 1TFRA 3QEBZ 3H40A 4M0AA 5AK3A 2E3TA 4O3PA 2JGAA 4KLDA 5DGBA 2K89A 1TV9A 3WK4A 3R9KA 4ED1A 4MF2A 3NVVA 3PSTA 4NLZA 2MA1A 3QU7A 3KBBA 2W7OA 5ALNA 1U4BA 5ALRA 1YZ6A 4ICAA 1U9LA 4F4XA 3RBEA 1ZXIA 1L8LA 5DQIA 3V7LA 5AK4A 4KLLA 2KHVA 2PMZC 2XGPA 1LKYA 4DF4A 5CP2A 4C4SA 1QTMA 3EPGA 5ALHA 2IHMA 5ALLA 1DGJA 3T5KA 4YR3A 5ALKA 4KLHA 2LKYA 4QZDA 4X5VA 2PFNA 4UB6U 5AI5A 4EEYA 2Q0ZX 5J0YA 2B6GA 9ICPA 1PZNA 5KT2A 2W9CB 3SAHA 8ICBA 9ICQA 2W9AA 2W54A 2DL0A 4P0PB 3HPOA 1NK7A 4ED7A 4F92B 2W8KA 4TURA 5KFCA 3RJFA 4KLGA 4PGQA 3OHBA 5ALIA 2RHFA 2FPMA 2ISPA 8ICSA 2R8IA 1QSSA 3PO4A 3JPOA 4MHVA 4HYKA 9ICRA 3QUCA 9ICLA 3WKAA 4F3OA 5BOLA 2KE7A 3QYPA 4ED6A 3G6XA 5J2IA 5DQGA 5KFHA 5KFAA 5ALWA 4KTQA 4FZLA 5KFRA 1UPHA 2KVCA 2LPEA 3K1RB 5ALVA 7ICEA 1OW5A 3GIMA 3OGUA 1SZPA 4J9NA 5EE9A 4EBDA 4OD0A 3WKBA 4UBCA 2WAQF 1ZJMA 4RNOA 8ICXA 2WF9A 1T3NA 4YQWA 4JV0A 3E0FA 5DB9A 4MF8A 5AI4A 4TQRA 2FMSA 4Z6CA 4KLSA 2V9WA 2J6SA 1T3QA 4QZGA 4DQSA 4UAYA 1D8YA 3BJYA 1HJPA 4GFJA 2J6TA 3ONNA 1ZQTA 1JALA 2RDIA 2W9BA 1BPEA 3OTQA 4KMUA 1Z1BA 1KRPA 3M9NB 2K8BB 3UMGA 1V9PA 9ICNA 2EANA 4RPZA 5KT6A 5J0OA 4CGZA 4M04A 4DS4A 4MEYA 5ALJA 1A77A 4NWIA 4O3RA 8ICAA 2YB1A 2DWQA 5J0UA 4RQ3A 4M9GA 2GLEA 1DK3A 1X6IA 2ZXHA 3WKCA 5AM3A 4DFDA 7ICPA 1LVHA 5B66U 7ICIA 1KKXA 1NJYA 3NRZA 4R64A 3U26A 2K4EA 4QIWC 1MQ3A 2JEIA 1KFTA 1ZQCA 1F44A 3MR3A 4I2EA 2LI6A 1D9DA 1JMSA 4ZOHC 4TUSA 1NJZA 3WK5A 3C29A 5J2JA 1XO1A 4NLKA 3GV7B 4UB3A 1BNOA 2GH1A 3PX6A 2Y1IA 1N56A 8ICYA 3N28A 4I2CA 3A0BU 2XY7A 4Y2SA 1U47A 4FBTA 3OSNA 5KFUA 1ZD5A 4M2YA 4Q44A 4HAIA 5EE1A 2QARB 3K1ZA 2RLTA 5AKIA 2C28A 9ICBA 5DBBA 2EZYA 1IXRA 2WFAA 1NOMA 3F2CA 4EX6A 1NK8A 5AI8A 5KG4A 4RQ2A 4FO6A 4PL1A 3UXOA 3KHGA 1PUZA 2BPGA 3SEIA 5KFSA 4J9PA 2YMQA 4ED2A 4KN7A 3V6KA 5AI6A 1N48A 4DS5A 2XO7A 2PFPA 2K8AA 2AJQA 4ED8A 4I2FA 5KFIA 8ICIA 1QSYA 1S97A 4KN4A 2UVRA 4I2IA 4ECZA 3TKAA 4KLMA 3M8RA 1X9MA 3RH4A 2DPIA 1JUDA 4Y2XA 1S9FA 1WWVA 9ICGA 5AI0A 2O6KA 4DOBA 2Y0SF 2DGZA 5HMLA 2WF7A 3ED5A 3C1ZA 4B9SA 4PHEA 3FDSA 4UAZA 5AK6A 4KLTA 3KTQA 5J0PA 3NUQA 2M9NA 2MRLA 5CR0A 4F5RA 5AM0A 5E79U 4DL5A 3QZ8A 4RNMA 1RZTA 1T7PA 4KX5A 1ZOLA 4PZOA 1RYUA 3I28A 1RYRA 1RDFA 3UM9A 2FI1A 2BDUA 2WF8A 4QZIA 3T5HA 3H0MB 3OJSA 1U48A 3AN1A 2W43A 3FYHA 1SKWA 2OH2A 4CF5A 1Q46A 4IRKA 7ICFA 4LVSA 1MN8A 2DQNB 5KG7A 2FMPA 4C8MA 2KHQA 2JH1A 3VC8A 2WTFA 4RNNA 7ICSA 2CXYA 5J2CA 5BPCA 5AKEA 1KQQA 1ZQDA 3BQ0A 2LYBA 2OM6A 2OXOA 3QNMA 1DRGA 4PHDA 3HWTA 2AQ0A 5KFTA 5HP4A 2I6XA 5L1IA 4DQQA 1ZQOA 2DBYA 4RQ1A 3AEVA 1TKDA 4UATA 4YD1A 2IOFA 4QZCA 4KLQA 3GILA 2NRXA 5ALOA 1NJXA 5DGAA 2W3SA 1HEKA 1ZQUA 5KG3A 4NJ8A 3SV3A 4DQIA 2BHNA 4RPXA 1Z3EB 3MDCA 1ZQ1C 2BCQA 1S8OA 4OJPA 4DFJA 2JR5A 4PH5A 4UASA 1ZQAA 4E0DA 5DDMA 3K4GA 2W8LA 3PNCA 2ZIXB 4PHAA 2L5YA 1S0MA 3NVZA 5J2AA 4BWJA 2MUTB 4G3IA 4GXKA 1XWLA 4ECTA 4QZBA 5DB7A 1TAMA 4JK1A 1BPDA 2W04A 4I2BA 4AP9A 3PSPA 5AKHA 3NRWA 2KJ9A 5CWRA 2UVUA 5GTHU 4R63A 1EXNA 1ZQKA 5AKKA 5KFVA 2BR0A 2ZJ8A 8ICQA 2FLLA 4F5NA 1SV4A 5L1KA 3QU4A 4O3QA 3AU6A 4ECWA 3AL0B 1ZYQA 2UVVA 2ZIXA 3HILA 4M9LA 4QNLA 4CE6A 3PW7A 3N7PD 2BDPA 2G5IB 3HP6A 1VLBA 4EBEA 2JMGA 2BZFA 2EZXA 2QLTA 5AKGA 1QLNA 4ED0A 2RQ5A 5CA7A 8ICJA 9ICFA 5KL8B 1NK4A 5DBAA 5CEHA 4O3OA 2KTQA 3NGDA 1KN5A 3IM1A 3M8SA 3SV4A 2JXJA 2HBLA 4PL2A 3KHLA 4K4HA 5AHXA 4AYBF 1BPBA 1SL2A 9ICUA 2ASJA 4UW9A 1VJ5A 1VDVA 5AM5A 4YD2A 3HX0A 4ELUA 2BQRA 3MR5A 1N5WA 1KTQA 1RXVA 4G9BA 1QH9A 3N7SC 3WK6A 2QKQA 3D2SA 4JMUA 1ZRNA 2HMXA 2HSZA 8ICFA 2AHOB 2CPRA 1XO0A 1WG8A 1N62A 2NRZA 4JV2A 1X40A 1K1QA 3LVWA 3PV8A 4F71A 1N63A 7ICGA 2BCVA 3IRUA 4CF3A 3V6HA 2MSNA 4QZEA 1X6JA 1SZHA 1ZQXA 3EPIA 5CB1A 4J9RA 3G6VA 3N4MB 2NO5A 5IIJA 2AH5A 4UB4A 2FPKA 3EUB2 3RB6A 2XVTA 1J2MA 4Q45A 2E5SA 1S77D 5ALMA 5IILA 3V72A 5ALPA 1F5SA 2GWSA 5KFMA 3MGVA 2F76X 3SZ2A 1LKYB 4YP3A 5DB6A 3BS5B 3H8JA 7ICLA 4RT2A 2EAMA 2R18A 1S0OA 4DL6A 3JPSA 2XC9A 3QZ7A 3UMCA 2H5XA 1WCNA 2F77X 3TFSA 2LYAA 2AGQA 3SQIA 4B9UA 4EEKA 5L1MA 1BPZA 1QSLA 3I1YA 2R8HA 1OXJA 3HJEA 4YMNA 4JWMA 3Q8LA 4ECVA 2HHTA 3ICXA 1ZQNA 1ZRMA 3C2KA 4M9HA 1PK1B 4NY8A 2JEGA 3H4DA 1X9WA 2EAOA 5KG1A 4DL4A 2VANA 2NRTA 2CN1A 3BS5A 1U49A 2NYVA 3GV8B 2KZMA 4QZ8A 4O5KA 5ALDA 3L5KA 3DDHA 5G5HA 2HVHA 4PGYA 7ICJA 4NL9C 3ISDA 2RRDA 5DG8A 4EZ6A 5DLGA 3KD3A 1L7PA 4QZ9A 4B9TA 2KVSA 3EW9A 4IQUA 2WF5A 1S0VA 4DFPA 3QE9Y 3PSIA 2W03A 4Y2JA 2EQYA 3NTUA 4Z6EA 1SXDA 1MA7A 2KG5A 2QB1A 3RJHA 4YMMA 1AROP 1PK1A 4P4MA 4PHPA 5AM4A 2UVWA 1ECWA 2P6UA 5KFFA 3ISCA 2KIWA 2BGWA 2W9BB 2K4PA 3SD7A 3F5AA 2OWOA 4DO9A 1UCVA 3WK7A 1ZQQA 4QWEA 5J2BA 3KKAA 1A76A 2HOFA 4RU9A 3PR5B 5T14A 2G0AA 4YG2A 5KFOA 3RJGA 1MQ2A 3K75D 4ECSA 3EWAA 5ALYA 4BGDA 9ICEA 5AKYA 2KZZA 2IMWP 3KFUF 1S0NA 5HHHA 9ICVA 3EZ5A 5F9NA 2G06A 1Z19A 1H38A 1UA1A 1X42A 9ICHA 3KOOA 3HKZC 4IQVA 1PVRA 3DEEA 4DL7A 1ZQZA 4BX9C 1U45A 2YMPA 1IM4A 1HUZA 1RQLA 2KSOB 2E8MA 2F1JA 5AIBA 3NVYA 1Y88A 1KSPA 1FO4A 1D8LA 3QUTA 3JPNA 2F1HA 1SXEA 5HR6A 1A6SA 5KFBA 9ICWA 9ICMA 4ECUA 2HHUA 2WB1F 5TZVA 8ICGA 1NI3A 3M9OB 2K4IA 3RRGA 3C1YA 8ICRA 3UQ2A 4CCHA 5D4BA 3I76A 1NZBA 5EWFA 2VA3A 2B21A 3AUOA 5KFLA 7ICRA 2JHDA 1D9FA 3IP4B 1L7OA 3BQTA 2NV3A 2KKPA 4FS2A 3L3FX 4KLUA 4PJ0U 1B22A 4DCCA 1ZQLA 9ICKA 4R8UB 3OPXA 1NK9A 3C21A 4RQ0A 2JEFA 2KSOA 2JEJA 4C4TA 3E58A 2XY6A 3PZPA 1URJA 1ZQMA 5JTIA 3TAPA 4IQWA 1K5OA 2R8JA 5L1JA 4DSJA 4KLIA 4QWBA 5J2FA 3PW5A 3WU2U 4NXZA 5KFZA 3BQ1A 2V4RA 1KFSA 1BGXT 3TAQA 4ECYA 1LV5A 2HW3A 3ZDDA 4BWMA 3Q8KA 4DWIA 5J0RA 5TISU 1KL9A 3UPQA 1IIPA 5HMMA 4I2GA 2PMZF 1FIQA 2ZG6A 4F93B 5CJ7A 4FFDA 9ICCA 2V4QA 2KFZA 5KNIA 3GQCA 9ICOA 1O08A 1ZETA 4R8UA 4DLEA 2KIVA 2I5HA 1TAQA 4IQTA 3QXGA 5EWEA 2E8PA 1COOA 5KG2A 4Z6FA 4R66A 4J9SA 3LWMA 4DSLA 1RG6A 4XUSA 4OJOA 2LM4A 1B4FA 5KAIU 4PPXA 7ICKA 2NRWA 1JROA 3IG8A 4IR9A 3RTVA 1JIHA 5A0LA 4F4WA 5J0TA 1ZD2P 3PMNA 1COKA 3TADA 2KV2A 1BPYA 2WHEA 4WJ3B 2N1RA 4DL2A 3C5GA 2KEYA 4O5EA 1SL1A 1Q8KA 3PVXA 3IG5A 5GTIU 1FEZA 3Q8PB 3V7JA 2W11A 3J81j 1L3TA 1CRXA 2HDOA 2KN7A 7ICOA 1JI7A 2HI0A 5AI9A 3FC4A 2ZTEA 4M47A 3TFRA 2BPFA 3WKEA 1XSLA 4QZFA 1CI4A 2G07A 4EENA 1X66A 8ICHA 2AQ4A 2BQUA 4RQ7A 5AM2A 4IC9A 1NKCA 2YX8A 5J2KA 4RQ8A 3S6JA 1WUDA 1WWUA 5EOZA 2OHFA 3UMBA 4YXJA 1SWWA 1MSWD 3PMLA 2OCEA 3PX4A 4RQ6A 4F4ZA 2LBOA 1SL0A 3O0FA 4I2HA 3PX0A 8ICKA 3QX7A 3F5EA 2KMDA 4F72A 3Q8SB 4B9MA 1ZQYA 2PI4A 1ED1A 2ALZA 2F1IA 3AQFA 4UB5A 7ICMA 1JXEA 2VJ5A 1GO3F 4ACOA 3TI0A 4O3MA 5C5JA 3SAGA 3V7KA 4GC6A 2AXTU 2RDJA 2C2DA 1A0PA 3NASA 3BQ7A 3RJIA 4EYHB 3RB0A 1N2XA 2IOHA 5AKJA 2YN4A 3ZI4A 4B6JA 2BQ3A 3PO5A 4QIWF 3ETRA 4PZNA 4RT3A
chains in the Genus database with same CATH topology
1JI7A 3HILA 2KSOA 4IS7A 2E8NA 3KKAA 3SEIA 1SGGA 1KW4A 1LKYA 5JTIA 2K60A 4RQMA 5L1MA 1DXSA 2F3NA 1X66A 1OXJA 2Y9UA 3SENA 2QARA 1PK3A 2YTUA 5J8YC 2B6GA 2ESEA 2EANA 1WWUA 4NJ8A 1PK1B 2EAOA 2DL0A 1WWVA 2D8CA 2QB0B 5JRTA 3BS5A 2QKQA 5KNIA 5J8YA 3BS7A 2KIVA 1SV0C 2JV3A 3TADC 2D3DA 2GLEA 2F44A 2F8KA 1V85A 2KMDA 4MHVA 2E8PA 2KSOB 2L5YA 2E8MA 4NL9C 1X40A 1Z1VA 2KE7A 1RG6A 2EAPA 3TACB 1UQVA 2LMRA 1B4FA 2QB0A 2FE9A 1V38A 1F0MA 2ES6A 1SXEA 2LPEA 3K1RB 4PZOA 1OW5A 2DKZA 3H8MA 1B0XA 1COKA 3TADA 1SXDA 5JU5A 4NL9A 2KG5A 2QB1A 4RQNA 5F3XB 1PK1A 3KKAC 3IDWA 1X9XA 2E8OA 3BQ7A 1SV4A 1LKYB 2Y9TA 3BS5B 2DKXA 2K4PA 4PZNA 2EAMA 2QARB 1SV0A 1UCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI7 A;  3HIL A;  2KSO A;  4IS7 A;  2E8N A;  3KKA A;  3SEI A;  1SGG A;  1KW4 A;  1LKY A;  5JTI A;  2K60 A;  4RQM A;  5L1M A;  1DXS A;  2F3N A;  1X66 A;  1OXJ A;  2Y9U A;  3SEN A;  2QAR A;  1PK3 A;  2YTU A;  5J8Y C;  2B6G A;  2ESE A;  2EAN A;  1WWU A;  4NJ8 A;  1PK1 B;  2EAO A;  2DL0 A;  1WWV A;  2D8C A;  2QB0 B;  5JRT A;  3BS5 A;  2QKQ A;  5KNI A;  5J8Y A;  3BS7 A;  2KIV A;  1SV0 C;  2JV3 A;  3TAD C;  2D3D A;  2GLE A;  2F44 A;  2F8K A;  1V85 A;  2KMD A;  4MHV A;  2E8P A;  2KSO B;  2L5Y A;  2E8M A;  4NL9 C;  1X40 A;  1Z1V A;  2KE7 A;  1RG6 A;  2EAP A;  3TAC B;  1UQV A;  2LMR A;  1B4F A;  2QB0 A;  2FE9 A;  1V38 A;  1F0M A;  2ES6 A;  1SXE A;  2LPE A;  3K1R B;  4PZO A;  1OW5 A;  2DKZ A;  3H8M A;  1B0X A;  1COK A;  3TAD A;  1SXD A;  5JU5 A;  4NL9 A;  2KG5 A;  2QB1 A;  4RQN A;  5F3X B;  1PK1 A;  3KKA C;  3IDW A;  1X9X A;  2E8O A;  3BQ7 A;  1SV4 A;  1LKY B;  2Y9T A;  3BS5 B;  2DKX A;  2K4P A;  4PZN A;  2EAM A;  2QAR B;  1SV0 A;  1UCV A; 
#chains in the Genus database with same CATH topology
 4ELV A;  2XGQ A;  4KMO B;  4P4P A;  4IRC A;  5HNK A;  4CNQ A;  5H2F U;  2ZTC A;  4F4Y A;  1CUK A;  3QU9 A;  2CRX A;  1XS9 D;  4C7Y A;  1X9S A;  3F2D A;  1V97 A;  2A1A A;  2NRV A;  2Y9U A;  2ZIU B;  9ICX A;  4XA5 A;  2KD1 A;  5KFY A;  2PI5 A;  2K8C B;  5BOM A;  4OO1 J;  1ZQJ A;  3HT3 A;  2W7P A;  2YQE A;  3VCB A;  1C20 A;  3RAQ A;  4FBU A;  1S76 D;  5J2E A;  3CP8 A;  5J8Y A;  2WAQ C;  7ICQ A;  2D3D A;  2H3F A;  2KP7 A;  1QCK A;  4ECX A;  4OJ5 A;  4DOA A;  4O5C A;  4M6W B;  2R8K A;  3L4P A;  3SAF A;  3C2M A;  2YML A;  4RPY A;  3Q8R B;  4U6P A;  2C2R A;  1Z4O A;  3RBD A;  2HHV A;  4MEX A;  2QB0 A;  1V38 A;  4BXO A;  4JUZ A;  4FS1 A;  5III A;  3MGH A;  3B9J A;  5L9X A;  5J29 A;  3MFH A;  1IV8 A;  4NLG A;  2JZB B;  4JWN A;  3JPQ A;  2ZIU A;  2HOQ A;  3C23 A;  3TQ1 A;  1PVQ A;  5ALE A;  1FFV A;  4C8L A;  3KHH A;  4DF8 A;  1KFD A;  9ICJ A;  5DB8 A;  5FP0 A;  1XNS A;  4I27 A;  1CEZ A;  2EH9 A;  3Q8Q B;  2E8O A;  3ZD8 A;  4DOC A;  1NKE A;  5DQH A;  2XID A;  2FLN A;  3RF9 A;  1L8O A;  4FZN A;  5KT3 A;  4J9Q A;  4J9M A;  3RB3 A;  3MR6 A;  2FPL A;  2BKE A;  1L7N A;  4US8 A;  4M6W A;  4UQG A;  4B9V A;  5F9L A;  3N97 B;  1TK8 A;  3BDP A;  3QUQ A;  2EDU A;  3ZDE A;  4DSK A;  1SGG A;  8ICP A;  8ICO A;  2JZB A;  1T94 A;  3MR2 A;  4QZH A;  4QJF B;  3PSF A;  4DQR A;  8ICZ A;  4P0Q A;  8ICU A;  1S10 A;  5ALG A;  1TE2 A;  3KHR A;  2F8L A;  3AU2 A;  3H8S A;  5KG0 A;  4GXJ A;  1NJW A;  3ORY A;  4IRD A;  1NZP A;  5DG9 A;  2KNJ A;  4GIB A;  2XCA A;  2P66 A;  1UT8 A;  2A1J B;  3H8W A;  2PXI A;  4IL6 U;  1TK5 A;  4O3S A;  4Q43 A;  2F44 A;  1RXW A;  4DEZ A;  3HW8 A;  1N60 A;  1Z1V A;  2I1Q A;  5JUM A;  1RM6 C;  3RFA A;  2EAP A;  3GFK B;  7ICV A;  3M7D A;  4USA A;  4GC7 A;  2FE9 A;  3THV A;  5AKL A;  4XRH A;  2H3Q A;  2NO4 A;  3RJE A;  8ICM A;  1SKS A;  5J2G A;  3KZX A;  2DKZ A;  3JPT A;  2MAX A;  4NLN A;  3IN5 A;  3M6Z A;  3H0L B;  1BPX A;  2JRZ A;  3A0H U;  2ZUC A;  3PW0 A;  8ICL A;  3IDW A;  2ZXI A;  4FZM A;  5AK5 A;  5J2D A;  4J9O A;  5D49 A;  1LB2 B;  3PR4 A;  4IR1 A;  2A1J A;  2DKX A;  4KLJ A;  1BVS A;  2BPC A;  1Z00 A;  2FJ6 A;  2P6R A;  5KFN A;  2ASD A;  3T5L A;  4P4O A;  1T8E A;  3KZI U;  4R65 A;  2HCF A;  3WK8 A;  5ALS A;  2AGO A;  2Y0S C;  4UB8 U;  4QW9 A;  3B0Y A;  1JX4 A;  4C8K A;  2G09 A;  4EEL A;  4TUQ A;  3ZD9 A;  5D46 A;  2PFQ A;  3SEN A;  1T4G A;  2HHW A;  1SB3 C;  1Q3U A;  2ATL A;  2YY6 A;  4DSF A;  1Z4N A;  4CF4 A;  3MDA A;  1NK5 A;  8ICN A;  1RYS A;  3OSP A;  4YXM A;  2ZJA A;  2D8C A;  5DDY A;  4Y2P A;  4RZR A;  5DG7 A;  1QQ7 A;  5HR7 A;  1UA0 A;  2BCU A;  5C0Y A;  5DBC A;  3BS7 A;  5ALQ A;  1WCL A;  2PKE A;  1M6Y A;  2W9C A;  1HUO A;  2F8K A;  4OJ6 A;  2YMM A;  1YT3 A;  5ALT A;  4M9J A;  4UAR A;  4TUP A;  1NNL A;  4QWD A;  4KIT B;  4F4K A;  4P0P A;  4MFC A;  5IIN A;  3ISB A;  1XC9 A;  4YR0 A;  1SIJ A;  2H3I A;  1ZQS A;  4F5Q A;  2M0N A;  3F2B A;  3QEA Z;  1QQ5 A;  5IIK A;  2W9M A;  3KKA C;  5AM1 A;  3GDX A;  2VKQ A;  1SKR A;  5K4L A;  2IHN A;  3MGI A;  2KK0 A;  3T3F A;  4Y2U A;  2KZ3 A;  4XQ8 A;  4LZG A;  4DFK A;  3RAX A;  2W55 A;  1JRP A;  3GZF A;  1SV0 A;  1ZQB A;  1RQN A;  4GLX A;  4Y2T A;  2LYH A;  4OJL A;  3UXP A;  4DSI A;  3C5F A;  1DGS A;  2J6U A;  4MFF A;  3M9M B;  3ETL A;  1TK0 A;  1P7D A;  3TAR A;  5KT7 A;  2XCP A;  1X2I A;  3GIK A;  3GIJ A;  1Q3V A;  2YTU A;  3WKD A;  4KX3 A;  2ESE A;  4RUA A;  1HIW A;  5CRX A;  2VIX A;  4BDP A;  2EZZ A;  5AIA A;  2ZUB A;  4GXI A;  2DFL A;  1JN3 A;  2ASL A;  5EE3 A;  3QU5 A;  9ICI A;  1SV0 C;  1JXL A;  1RPL A;  4J9L A;  4J9K A;  2OEH A;  3TAC B;  3RH5 A;  4ZH4 A;  5ALZ A;  4F2R A;  2LM1 A;  3BQ2 A;  3C2L A;  2BCS A;  2Z7J A;  5J0W A;  4ECR A;  4YFK A;  5KFX A;  2I9G A;  3DV9 A;  1C7Y A;  4F2S A;  3MAB A;  1KBU A;  3UQ0 A;  4C4R A;  3QU2 A;  4YMO A;  7ICH A;  2GOL A;  4NM1 A;  5HHI A;  3NVW A;  3D2N A;  3NS1 A;  2A3V A;  1ZQR A;  2KIC A;  2HBJ A;  1O03 A;  1L6N A;  2KOB A;  4Q8F A;  4AYB C;  1KLN A;  5AKZ A;  4U7C A;  7ICU A;  4P2H A;  3CNH A;  2G08 A;  3FM9 A;  1NK6 A;  1D8B A;  3GU3 A;  3SMV A;  4CDG A;  5KFE A;  3RRH A;  9ICS A;  4RQM A;  4O3N A;  4B9N A;  4RUC A;  1NKB A;  4C80 A;  2QAR A;  2B0C A;  4C8N A;  4PGX A;  2C22 A;  3RR8 A;  3CW2 C;  4RQ4 A;  3LYS A;  4UAV A;  4NLC A;  3C28 A;  1ZQP A;  5KAF U;  2WF6 A;  1XSP A;  1ZQV A;  4K4I A;  2AU0 A;  2HBM A;  4KLO A;  3PW2 A;  3MC1 A;  5DKW A;  4I29 A;  3JPP A;  4Q8E A;  7ICT A;  3ZDA A;  4UB2 A;  3V6J A;  4Y2Y A;  4KLF A;  2ISO A;  4LZD A;  1J97 A;  3G6Y A;  3TAD C;  2HVI A;  8ICC A;  2BCR A;  4O9M A;  2FLP A;  1KEJ A;  4M9N A;  4DL3 A;  4EBC A;  3H0R B;  8ICE A;  3AMZ A;  3EYZ A;  4UAU A;  2R8G A;  1DOQ A;  1S5L U;  2XIC A;  2ZUD A;  5J0X A;  3BZC A;  5ALF A;  4UAW A;  1F0M A;  3UXN A;  3AQE A;  4J03 A;  2JH7 A;  2P35 A;  4YN4 A;  5J0Q A;  4YR2 A;  3GII A;  3HKZ F;  2C2E A;  1L7M A;  5CHG A;  4UB1 A;  2ZIW B;  4RQN A;  9ICT A;  1N5X A;  4I2J A;  5F3X B;  3D6J A;  3N7R C;  4QWC A;  1X9X A;  1NK0 A;  3CRX A;  3OHA A;  1ZQH A;  1ZD4 A;  8ICV A;  4ED3 A;  3BZK A;  2Q4T A;  1ZQG A;  1FFU A;  3ALR A;  3CYM A;  2GO7 A;  4Y2Q A;  3JPR A;  2H3V A;  4I2D A;  4Y2V A;  1ZQE A;  2E8N A;  1L3S A;  2E1F A;  4EYI B;  1L3U A;  9ICA A;  1ZQW A;  4K4G A;  3D2Q A;  5J0S A;  3H4B A;  2HHX A;  4ECQ A;  3RB4 A;  4F5P A;  3LVV A;  3LWL A;  5DLF A;  5IIM A;  4BUG A;  1DXS A;  2YB4 A;  3Q8M A;  3H7I A;  4F50 A;  3OJU A;  3ZDC A;  5KFK A;  2FDR A;  4A8E A;  2IA6 A;  1KDH A;  4OCZ A;  2ZTD A;  1MC8 A;  4FE3 A;  2ZIW A;  4BJQ A;  5KFW A;  4DSE A;  1B43 A;  4ELT A;  2HHS A;  4NM2 A;  1ZJN A;  4UBB A;  2QB0 B;  1ZD3 A;  3IHQ B;  4DFM A;  3SYZ A;  3SR6 A;  1DK2 A;  4BXO B;  4QWA A;  4QW8 A;  5KT5 A;  8ICW A;  2MU2 A;  2ZJ5 A;  2VA2 A;  5KG6 A;  2Y1J A;  2FMQ A;  5ALX A;  3M1Y A;  1V85 A;  2VA8 A;  4F91 B;  2G5H B;  2VJ4 A;  5EE0 A;  5ALU A;  1BNP A;  1PVP A;  2E1E A;  1XU4 A;  2LMR A;  1UHU A;  3T79 A;  1J2N A;  4C0Z A;  2ES6 A;  3QUB A;  2XI9 A;  4TQS A;  3PW4 A;  2HBK A;  3GV5 B;  5KFQ A;  3B0X A;  3T5J A;  5KFG A;  1QQ6 A;  3H8M A;  4Z6D A;  1L3V A;  1B0X A;  4I2A A;  2K4H A;  4JB3 A;  2MUT A;  4YVZ A;  3WK9 A;  5B5E U;  2KFN A;  4US9 A;  3LK9 A;  2AGP A;  1TVA A;  5KFD A;  2W3R A;  4O0I A;  2Y9T A;  2D6F C;  2IOF K;  2KKV A;  1UT5 A;  2RP5 A;  4EX7 A;  4P0Q B;  5KFP A;  2HOI A;  4CRX A;  3ZDB A;  1N61 A;  3F53 A;  4IS7 A;  3RH6 A;  4F8R A;  4JV1 A;  4YCX A;  4F5O A;  2IBK A;  2ZIV B;  3SI8 A;  5IIO A;  1SWV A;  1K1S A;  1KW4 A;  1AQ6 A;  5AKX A;  2K60 A;  1ZQI A;  2H3Z A;  4EZ9 A;  2F3N A;  5KFJ A;  1YZ7 A;  5KTQ A;  1XSN A;  2DUY A;  1TAU A;  1PK3 A;  5J8Y C;  2DPJ A;  3FAH A;  5G5G A;  2OYY A;  4LJX A;  4C7Z A;  3IV6 A;  4KLE A;  1IG6 A;  2WB1 C;  5JRT A;  3HRD D;  5KT4 A;  4C8O A;  3PY8 A;  4MFA A;  1ZQF A;  4QZA A;  5KL1 B;  2PFO A;  2LHT A;  3RJK A;  2JV3 A;  2KJ8 A;  3RJJ A;  1L5U A;  4I28 A;  3MBY A;  5L1L A;  2DF4 B;  4NLB A;  2ZIV A;  1WYG A;  3RR7 A;  1UQV A;  2XY5 A;  2F2A B;  8ICT A;  5AIC A;  5KG5 A;  3AM9 A;  5J2H A;  3LDA A;  4B9L A;  1Z00 B;  3M6K A;  4RQ5 A;  4NV0 A;  3E2E A;  4Y2R A;  2ODG A;  5JU5 A;  4NL9 A;  2A19 A;  3MFI A;  2HHQ A;  2KJ5 A;  7ICN A;  4DQP A;  3TAN A;  1OUQ A;  5EWG A;  4DLG A;  1TFR A;  3QEB Z;  3H40 A;  4M0A A;  5AK3 A;  2E3T A;  4O3P A;  2JGA A;  4KLD A;  5DGB A;  2K89 A;  1TV9 A;  3WK4 A;  3R9K A;  4ED1 A;  4MF2 A;  3NVV A;  3PST A;  4NLZ A;  2MA1 A;  3QU7 A;  3KBB A;  2W7O A;  5ALN A;  1U4B A;  5ALR A;  1YZ6 A;  4ICA A;  1U9L A;  4F4X A;  3RBE A;  1ZXI A;  1L8L A;  5DQI A;  3V7L A;  5AK4 A;  4KLL A;  2KHV A;  2PMZ C;  2XGP A;  1LKY A;  4DF4 A;  5CP2 A;  4C4S A;  1QTM A;  3EPG A;  5ALH A;  2IHM A;  5ALL A;  1DGJ A;  3T5K A;  4YR3 A;  5ALK A;  4KLH A;  2LKY A;  4QZD A;  4X5V A;  2PFN A;  4UB6 U;  5AI5 A;  4EEY A;  2Q0Z X;  5J0Y A;  2B6G A;  9ICP A;  1PZN A;  5KT2 A;  2W9C B;  3SAH A;  8ICB A;  9ICQ A;  2W9A A;  2W54 A;  2DL0 A;  4P0P B;  3HPO A;  1NK7 A;  4ED7 A;  4F92 B;  2W8K A;  4TUR A;  5KFC A;  3RJF A;  4KLG A;  4PGQ A;  3OHB A;  5ALI A;  2RHF A;  2FPM A;  2ISP A;  8ICS A;  2R8I A;  1QSS A;  3PO4 A;  3JPO A;  4MHV A;  4HYK A;  9ICR A;  3QUC A;  9ICL A;  3WKA A;  4F3O A;  5BOL A;  2KE7 A;  3QYP A;  4ED6 A;  3G6X A;  5J2I A;  5DQG A;  5KFH A;  5KFA A;  5ALW A;  4KTQ A;  4FZL A;  5KFR A;  1UPH A;  2KVC A;  2LPE A;  3K1R B;  5ALV A;  7ICE A;  1OW5 A;  3GIM A;  3OGU A;  1SZP A;  4J9N A;  5EE9 A;  4EBD A;  4OD0 A;  3WKB A;  4UBC A;  2WAQ F;  1ZJM A;  4RNO A;  8ICX A;  2WF9 A;  1T3N A;  4YQW A;  4JV0 A;  3E0F A;  5DB9 A;  4MF8 A;  5AI4 A;  4TQR A;  2FMS A;  4Z6C A;  4KLS A;  2V9W A;  2J6S A;  1T3Q A;  4QZG A;  4DQS A;  4UAY A;  1D8Y A;  3BJY A;  1HJP A;  4GFJ A;  2J6T A;  3ONN A;  1ZQT A;  1JAL A;  2RDI A;  2W9B A;  1BPE A;  3OTQ A;  4KMU A;  1Z1B A;  1KRP A;  3M9N B;  2K8B B;  3UMG A;  1V9P A;  9ICN A;  2EAN A;  4RPZ A;  5KT6 A;  5J0O A;  4CGZ A;  4M04 A;  4DS4 A;  4MEY A;  5ALJ A;  1A77 A;  4NWI A;  4O3R A;  8ICA A;  2YB1 A;  2DWQ A;  5J0U A;  4RQ3 A;  4M9G A;  2GLE A;  1DK3 A;  1X6I A;  2ZXH A;  3WKC A;  5AM3 A;  4DFD A;  7ICP A;  1LVH A;  5B66 U;  7ICI A;  1KKX A;  1NJY A;  3NRZ A;  4R64 A;  3U26 A;  2K4E A;  4QIW C;  1MQ3 A;  2JEI A;  1KFT A;  1ZQC A;  1F44 A;  3MR3 A;  4I2E A;  2LI6 A;  1D9D A;  1JMS A;  4ZOH C;  4TUS A;  1NJZ A;  3WK5 A;  3C29 A;  5J2J A;  1XO1 A;  4NLK A;  3GV7 B;  4UB3 A;  1BNO A;  2GH1 A;  3PX6 A;  2Y1I A;  1N56 A;  8ICY A;  3N28 A;  4I2C A;  3A0B U;  2XY7 A;  4Y2S A;  1U47 A;  4FBT A;  3OSN A;  5KFU A;  1ZD5 A;  4M2Y A;  4Q44 A;  4HAI A;  5EE1 A;  2QAR B;  3K1Z A;  2RLT A;  5AKI A;  2C28 A;  9ICB A;  5DBB A;  2EZY A;  1IXR A;  2WFA A;  1NOM A;  3F2C A;  4EX6 A;  1NK8 A;  5AI8 A;  5KG4 A;  4RQ2 A;  4FO6 A;  4PL1 A;  3UXO A;  3KHG A;  1PUZ A;  2BPG A;  3SEI A;  5KFS A;  4J9P A;  2YMQ A;  4ED2 A;  4KN7 A;  3V6K A;  5AI6 A;  1N48 A;  4DS5 A;  2XO7 A;  2PFP A;  2K8A A;  2AJQ A;  4ED8 A;  4I2F A;  5KFI A;  8ICI A;  1QSY A;  1S97 A;  4KN4 A;  2UVR A;  4I2I A;  4ECZ A;  3TKA A;  4KLM A;  3M8R A;  1X9M A;  3RH4 A;  2DPI A;  1JUD A;  4Y2X A;  1S9F A;  1WWV A;  9ICG A;  5AI0 A;  2O6K A;  4DOB A;  2Y0S F;  2DGZ A;  5HML A;  2WF7 A;  3ED5 A;  3C1Z A;  4B9S A;  4PHE A;  3FDS A;  4UAZ A;  5AK6 A;  4KLT A;  3KTQ A;  5J0P A;  3NUQ A;  2M9N A;  2MRL A;  5CR0 A;  4F5R A;  5AM0 A;  5E79 U;  4DL5 A;  3QZ8 A;  4RNM A;  1RZT A;  1T7P A;  4KX5 A;  1ZOL A;  4PZO A;  1RYU A;  3I28 A;  1RYR A;  1RDF A;  3UM9 A;  2FI1 A;  2BDU A;  2WF8 A;  4QZI A;  3T5H A;  3H0M B;  3OJS A;  1U48 A;  3AN1 A;  2W43 A;  3FYH A;  1SKW A;  2OH2 A;  4CF5 A;  1Q46 A;  4IRK A;  7ICF A;  4LVS A;  1MN8 A;  2DQN B;  5KG7 A;  2FMP A;  4C8M A;  2KHQ A;  2JH1 A;  3VC8 A;  2WTF A;  4RNN A;  7ICS A;  2CXY A;  5J2C A;  5BPC A;  5AKE A;  1KQQ A;  1ZQD A;  3BQ0 A;  2LYB A;  2OM6 A;  2OXO A;  3QNM A;  1DRG A;  4PHD A;  3HWT A;  2AQ0 A;  5KFT A;  5HP4 A;  2I6X A;  5L1I A;  4DQQ A;  1ZQO A;  2DBY A;  4RQ1 A;  3AEV A;  1TKD A;  4UAT A;  4YD1 A;  2IOF A;  4QZC A;  4KLQ A;  3GIL A;  2NRX A;  5ALO A;  1NJX A;  5DGA A;  2W3S A;  1HEK A;  1ZQU A;  5KG3 A;  4NJ8 A;  3SV3 A;  4DQI A;  2BHN A;  4RPX A;  1Z3E B;  3MDC A;  1ZQ1 C;  2BCQ A;  1S8O A;  4OJP A;  4DFJ A;  2JR5 A;  4PH5 A;  4UAS A;  1ZQA A;  4E0D A;  5DDM A;  3K4G A;  2W8L A;  3PNC A;  2ZIX B;  4PHA A;  2L5Y A;  1S0M A;  3NVZ A;  5J2A A;  4BWJ A;  2MUT B;  4G3I A;  4GXK A;  1XWL A;  4ECT A;  4QZB A;  5DB7 A;  1TAM A;  4JK1 A;  1BPD A;  2W04 A;  4I2B A;  4AP9 A;  3PSP A;  5AKH A;  3NRW A;  2KJ9 A;  5CWR A;  2UVU A;  5GTH U;  4R63 A;  1EXN A;  1ZQK A;  5AKK A;  5KFV A;  2BR0 A;  2ZJ8 A;  8ICQ A;  2FLL A;  4F5N A;  1SV4 A;  5L1K A;  3QU4 A;  4O3Q A;  3AU6 A;  4ECW A;  3AL0 B;  1ZYQ A;  2UVV A;  2ZIX A;  3HIL A;  4M9L A;  4QNL A;  4CE6 A;  3PW7 A;  3N7P D;  2BDP A;  2G5I B;  3HP6 A;  1VLB A;  4EBE A;  2JMG A;  2BZF A;  2EZX A;  2QLT A;  5AKG A;  1QLN A;  4ED0 A;  2RQ5 A;  5CA7 A;  8ICJ A;  9ICF A;  5KL8 B;  1NK4 A;  5DBA A;  5CEH A;  4O3O A;  2KTQ A;  3NGD A;  1KN5 A;  3IM1 A;  3M8S A;  3SV4 A;  2JXJ A;  2HBL A;  4PL2 A;  3KHL A;  4K4H A;  5AHX A;  4AYB F;  1BPB A;  1SL2 A;  9ICU A;  2ASJ A;  4UW9 A;  1VJ5 A;  1VDV A;  5AM5 A;  4YD2 A;  3HX0 A;  4ELU A;  2BQR A;  3MR5 A;  1N5W A;  1KTQ A;  1RXV A;  4G9B A;  1QH9 A;  3N7S C;  3WK6 A;  2QKQ A;  3D2S A;  4JMU A;  1ZRN A;  2HMX A;  2HSZ A;  8ICF A;  2AHO B;  2CPR A;  1XO0 A;  1WG8 A;  1N62 A;  2NRZ A;  4JV2 A;  1X40 A;  1K1Q A;  3LVW A;  3PV8 A;  4F71 A;  1N63 A;  7ICG A;  2BCV A;  3IRU A;  4CF3 A;  3V6H A;  2MSN A;  4QZE A;  1X6J A;  1SZH A;  1ZQX A;  3EPI A;  5CB1 A;  4J9R A;  3G6V A;  3N4M B;  2NO5 A;  5IIJ A;  2AH5 A;  4UB4 A;  2FPK A;  3EUB 2;  3RB6 A;  2XVT A;  1J2M A;  4Q45 A;  2E5S A;  1S77 D;  5ALM A;  5IIL A;  3V72 A;  5ALP A;  1F5S A;  2GWS A;  5KFM A;  3MGV A;  2F76 X;  3SZ2 A;  1LKY B;  4YP3 A;  5DB6 A;  3BS5 B;  3H8J A;  7ICL A;  4RT2 A;  2EAM A;  2R18 A;  1S0O A;  4DL6 A;  3JPS A;  2XC9 A;  3QZ7 A;  3UMC A;  2H5X A;  1WCN A;  2F77 X;  3TFS A;  2LYA A;  2AGQ A;  3SQI A;  4B9U A;  4EEK A;  5L1M A;  1BPZ A;  1QSL A;  3I1Y A;  2R8H A;  1OXJ A;  3HJE A;  4YMN A;  4JWM A;  3Q8L A;  4ECV A;  2HHT A;  3ICX A;  1ZQN A;  1ZRM A;  3C2K A;  4M9H A;  1PK1 B;  4NY8 A;  2JEG A;  3H4D A;  1X9W A;  2EAO A;  5KG1 A;  4DL4 A;  2VAN A;  2NRT A;  2CN1 A;  3BS5 A;  1U49 A;  2NYV A;  3GV8 B;  2KZM A;  4QZ8 A;  4O5K A;  5ALD A;  3L5K A;  3DDH A;  5G5H A;  2HVH A;  4PGY A;  7ICJ A;  4NL9 C;  3ISD A;  2RRD A;  5DG8 A;  4EZ6 A;  5DLG A;  3KD3 A;  1L7P A;  4QZ9 A;  4B9T A;  2KVS A;  3EW9 A;  4IQU A;  2WF5 A;  1S0V A;  4DFP A;  3QE9 Y;  3PSI A;  2W03 A;  4Y2J A;  2EQY A;  3NTU A;  4Z6E A;  1SXD A;  1MA7 A;  2KG5 A;  2QB1 A;  3RJH A;  4YMM A;  1ARO P;  1PK1 A;  4P4M A;  4PHP A;  5AM4 A;  2UVW A;  1ECW A;  2P6U A;  5KFF A;  3ISC A;  2KIW A;  2BGW A;  2W9B B;  2K4P A;  3SD7 A;  3F5A A;  2OWO A;  4DO9 A;  1UCV A;  3WK7 A;  1ZQQ A;  4QWE A;  5J2B A;  3KKA A;  1A76 A;  2HOF A;  4RU9 A;  3PR5 B;  5T14 A;  2G0A A;  4YG2 A;  5KFO A;  3RJG A;  1MQ2 A;  3K75 D;  4ECS A;  3EWA A;  5ALY A;  4BGD A;  9ICE A;  5AKY A;  2KZZ A;  2IMW P;  3KFU F;  1S0N A;  5HHH A;  9ICV A;  3EZ5 A;  5F9N A;  2G06 A;  1Z19 A;  1H38 A;  1UA1 A;  1X42 A;  9ICH A;  3KOO A;  3HKZ C;  4IQV A;  1PVR A;  3DEE A;  4DL7 A;  1ZQZ A;  4BX9 C;  1U45 A;  2YMP A;  1IM4 A;  1HUZ A;  1RQL A;  2KSO B;  2E8M A;  2F1J A;  5AIB A;  3NVY A;  1Y88 A;  1KSP A;  1FO4 A;  1D8L A;  3QUT A;  3JPN A;  2F1H A;  1SXE A;  5HR6 A;  1A6S A;  5KFB A;  9ICW A;  9ICM A;  4ECU A;  2HHU A;  2WB1 F;  5TZV A;  8ICG A;  1NI3 A;  3M9O B;  2K4I A;  3RRG A;  3C1Y A;  8ICR A;  3UQ2 A;  4CCH A;  5D4B A;  3I76 A;  1NZB A;  5EWF A;  2VA3 A;  2B21 A;  3AUO A;  5KFL A;  7ICR A;  2JHD A;  1D9F A;  3IP4 B;  1L7O A;  3BQT A;  2NV3 A;  2KKP A;  4FS2 A;  3L3F X;  4KLU A;  4PJ0 U;  1B22 A;  4DCC A;  1ZQL A;  9ICK A;  4R8U B;  3OPX A;  1NK9 A;  3C21 A;  4RQ0 A;  2JEF A;  2KSO A;  2JEJ A;  4C4T A;  3E58 A;  2XY6 A;  3PZP A;  1URJ A;  1ZQM A;  5JTI A;  3TAP A;  4IQW A;  1K5O A;  2R8J A;  5L1J A;  4DSJ A;  4KLI A;  4QWB A;  5J2F A;  3PW5 A;  3WU2 U;  4NXZ A;  5KFZ A;  3BQ1 A;  2V4R A;  1KFS A;  1BGX T;  3TAQ A;  4ECY A;  1LV5 A;  2HW3 A;  3ZDD A;  4BWM A;  3Q8K A;  4DWI A;  5J0R A;  5TIS U;  1KL9 A;  3UPQ A;  1IIP A;  5HMM A;  4I2G A;  2PMZ F;  1FIQ A;  2ZG6 A;  4F93 B;  5CJ7 A;  4FFD A;  9ICC A;  2V4Q A;  2KFZ A;  5KNI A;  3GQC A;  9ICO A;  1O08 A;  1ZET A;  4R8U A;  4DLE A;  2KIV A;  2I5H A;  1TAQ A;  4IQT A;  3QXG A;  5EWE A;  2E8P A;  1COO A;  5KG2 A;  4Z6F A;  4R66 A;  4J9S A;  3LWM A;  4DSL A;  1RG6 A;  4XUS A;  4OJO A;  2LM4 A;  1B4F A;  5KAI U;  4PPX A;  7ICK A;  2NRW A;  1JRO A;  3IG8 A;  4IR9 A;  3RTV A;  1JIH A;  5A0L A;  4F4W A;  5J0T A;  1ZD2 P;  3PMN A;  1COK A;  3TAD A;  2KV2 A;  1BPY A;  2WHE A;  4WJ3 B;  2N1R A;  4DL2 A;  3C5G A;  2KEY A;  4O5E A;  1SL1 A;  1Q8K A;  3PVX A;  3IG5 A;  5GTI U;  1FEZ A;  3Q8P B;  3V7J A;  2W11 A;  3J81 j;  1L3T A;  1CRX A;  2HDO A;  2KN7 A;  7ICO A;  1JI7 A;  2HI0 A;  5AI9 A;  3FC4 A;  2ZTE A;  4M47 A;  3TFR A;  2BPF A;  3WKE A;  1XSL A;  4QZF A;  1CI4 A;  2G07 A;  4EEN A;  1X66 A;  8ICH A;  2AQ4 A;  2BQU A;  4RQ7 A;  5AM2 A;  4IC9 A;  1NKC A;  2YX8 A;  5J2K A;  4RQ8 A;  3S6J A;  1WUD A;  1WWU A;  5EOZ A;  2OHF A;  3UMB A;  4YXJ A;  1SWW A;  1MSW D;  3PML A;  2OCE A;  3PX4 A;  4RQ6 A;  4F4Z A;  2LBO A;  1SL0 A;  3O0F A;  4I2H A;  3PX0 A;  8ICK A;  3QX7 A;  3F5E A;  2KMD A;  4F72 A;  3Q8S B;  4B9M A;  1ZQY A;  2PI4 A;  1ED1 A;  2ALZ A;  2F1I A;  3AQF A;  4UB5 A;  7ICM A;  1JXE A;  2VJ5 A;  1GO3 F;  4ACO A;  3TI0 A;  4O3M A;  5C5J A;  3SAG A;  3V7K A;  4GC6 A;  2AXT U;  2RDJ A;  2C2D A;  1A0P A;  3NAS A;  3BQ7 A;  3RJI A;  4EYH B;  3RB0 A;  1N2X A;  2IOH A;  5AKJ A;  2YN4 A;  3ZI4 A;  4B6J A;  2BQ3 A;  3PO5 A;  4QIW F;  3ETR A;  4PZN A;  4RT3 A; 
#chains in the Genus database with same CATH homology
 1JI7 A;  3HIL A;  2KSO A;  4IS7 A;  2E8N A;  3KKA A;  3SEI A;  1SGG A;  1KW4 A;  1LKY A;  5JTI A;  2K60 A;  4RQM A;  5L1M A;  1DXS A;  2F3N A;  1X66 A;  1OXJ A;  2Y9U A;  3SEN A;  2QAR A;  1PK3 A;  2YTU A;  5J8Y C;  2B6G A;  2ESE A;  2EAN A;  1WWU A;  4NJ8 A;  1PK1 B;  2EAO A;  2DL0 A;  1WWV A;  2D8C A;  2QB0 B;  5JRT A;  3BS5 A;  2QKQ A;  5KNI A;  5J8Y A;  3BS7 A;  2KIV A;  1SV0 C;  2JV3 A;  3TAD C;  2D3D A;  2GLE A;  2F44 A;  2F8K A;  1V85 A;  2KMD A;  4MHV A;  2E8P A;  2KSO B;  2L5Y A;  2E8M A;  4NL9 C;  1X40 A;  1Z1V A;  2KE7 A;  1RG6 A;  2EAP A;  3TAC B;  1UQV A;  2LMR A;  1B4F A;  2QB0 A;  2FE9 A;  1V38 A;  1F0M A;  2ES6 A;  1SXE A;  2LPE A;  3K1R B;  4PZO A;  1OW5 A;  2DKZ A;  3H8M A;  1B0X A;  1COK A;  3TAD A;  1SXD A;  5JU5 A;  4NL9 A;  2KG5 A;  2QB1 A;  4RQN A;  5F3X B;  1PK1 A;  3KKA C;  3IDW A;  1X9X A;  2E8O A;  3BQ7 A;  1SV4 A;  1LKY B;  2Y9T A;  3BS5 B;  2DKX A;  2K4P A;  4PZN A;  2EAM A;  2QAR B;  1SV0 A;  1UCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...