4NJ8A

Crystal structure of the human anks3 sam domain l52a mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
b'RAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITAFGPKRKMTSAIARWHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
molecule tags Structural protein
source organism Homo sapiens
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
total genus 21
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nj8A01
2ES6A 3SEIA 2D3DA 1SGGA 4MHVA 1X9XA 2E8PA 2E8NA 3TADA 2Y9TA 3TACB 3K1RB 2B6GA 2DL0A 2GLEA 2KSOB 2KSOA 2D8CA 2KE7A 1SV0C 2EAPA 2DKXA 4RQNA 1OW5A 1UCVA 1OXJA 2DKZA 5KNIA 1RG6A 1X66A 1X40A 2KMDA 2EANA 5L1MA 2L5YA 5JU5A 2QB0B 2F3NA 2JV3A 3BQ7A 1WWVA 3H8MA 1SV4A 2KG5A 2E8MA 3IDWA 2E8OA 4NJ8A 3BS5A 1LKYA 3KKAA 1WWUA 2FE9A 2LMRA 5J8YC 2QB0A 3HILA 5J8YA 5JTIA 5JRTA 3TADC 2EAMA 1B4FA 1UQVA 3SENA 1PK1B 3BS5B 4PZNA 1KW4A 2LPEA 5F3XB 2EAOA 4RQMA 3BS7A 1F0MA 2Y9UA 2YTUA 1V38A 2KIVA 1PK3A 1COKA 2QB1A 1LKYB 2ESEA 2QKQA 1PK1A 2K60A 2K4PA 1SV0A 1Z1VA 1DXSA 2F8KA 1B0XA 1JI7A 2QARB 4NL9C 3KKAC 1SXEA 4PZOA 2F44A 4NL9A 4IS7A 1V85A 2QARA 1SXDA
chains in the Genus database with same CATH superfamily
4IQWA 1BPBA 3SEIA 3TQ1A 1TK0A 4QWCA 3KD3A 4AYBC 5ALMA 4ZOHC 4OJPA 2HOFA 3ISCA 2DWQA 3UPQA 3GDXA 1P7DA 1Z4NA 1KFSA 4PL2A 4FZLA 5ALGA 3M6KA 4DFJA 5J2FA 4QZEA 3ZDAA 2V4RA 1X9SA 4YFKA 5KFTA 4M9GA 2RRDA 2WF7A 4ECSA 4UBCA 1ZQIA 1SL0A 5DQHA 5CHGA 4NLKA 7ICHA 1UA1A 3QU9A 2YMQA 4KLLA 3NVYA 1U4BA 2XI9A 4ECTA 5KT2A 2KKPA 3SV3A 1CEZA 4XA5A 9ICNA 1ZQCA 1ZQZA 2KK0A 4GLXA 2F2AB 3NTUA 4IQUA 4PZNA 2FLPA 3QU4A 5ALJA 5J0WA 9ICGA 3WK6A 5AI6A 3BS7A 4KX5A 2FMSA 3THVA 2HSZA 1Z3EB 4NM2A 4DL7A 5DG7A 1X9WA 4RPZA 3M8RA 5BPCA 3BZCA 2Q0ZX 2MUTA 3PMLA 3MDCA 2WFAA 1QQ7A 4RQ7A 5J0PA 2VKQA 4PZOA 2Y0SC 3M6ZA 4DL6A 2D6FC 4RT3A 4P4MA 4EELA 4ELVA 4KN7A 1SXDA 3C1YA 5AKZA 2I1QA 7ICEA 4RQ5A 4C8NA 1N62A 3M9NB 5KFXA 4WJ3B 3TADA 2EH9A 1N61A 4C7ZA 1ZRMA 1NOMA 5AM4A 4UARA 3T5LA 3VC8A 4M9HA 2VIXA 5BOLA 1BNOA 2W43A 7ICTA 1YZ7A 5ALDA 1TE2A 2JH7A 4Y2PA 4BWJA 1BPZA 4OCZA 2W9CB 5KG4A 2ZIVA 3H0RB 3B0YA 2KZZA 1ZRNA 4Q43A 2MUTB 3GZFA 3SD7A 1SV4A 4UB6U 4PHPA 3ZDDA 5ALKA 3M9OB 3M7DA 2NRZA 1NJXA 2ALZA 1K1QA 2OCEA 1L3SA 1XNSA 2KHVA 4ECWA 5J8YC 1KKXA 5CWRA 3OJSA 1X2IA 5D49A 3ICXA 3FYHA 4QZCA 4PL1A 3E2EA 1D8BA 4GXIA 4QZ8A 1K5OA 2PFOA 5KFKA 3GIIA 1T8EA 4RQ3A 2FI1A 1PK1B 5KFUA 1KW4A 5F3XB 9ICHA 3GQCA 5KFAA 2VJ4A 2R8GA 5BOMA 3OPXA 1F0MA 5B5EU 3JPQA 4EYIB 1JMSA 4O3SA 4USAA 5ALIA 4UB8U 1QH9A 4FBUA 1QTMA 1X6JA 5C0YA 1TK5A 1DGJA 2EQYA 4M9JA 1IXRA 2W7OA 2I6XA 3T5HA 5KFWA 3DEEA 2QARA 1L7PA 5CB1A 4DSFA 4C8LA 2WB1C 5KFNA 3V7JA 7ICPA 4YD1A 2VA8A 2Y0SF 3R9KA 2NO4A 4RNNA 2PI4A 2KSOB 3RJFA 3RBDA 1D8YA 4UATA 4OD0A 4ECZA 5AI4A 4RNOA 4QW8A 1SV0C 4ED6A 5AM5A 2OEHA 1HEKA 3IHQB 2H3QA 1XO1A 4ED2A 2YQEA 3C29A 3OGUA 1SKSA 1NK4A 3ZD9A 2FJ6A 2IOFA 2UVWA 2KIWA 3F53A 2F1HA 4EX6A 1Q3VA 1L7OA 2E8MA 2BQUA 9ICSA 7ICIA 5KFDA 3KKAA 1BPXA 3H0LB 3U26A 2E1FA 3MABA 1L3UA 1ZD4A 4HAIA 5EE9A 2W7PA 4TUPA 2KICA 9ICUA 2HHVA 5AM1A 5DKWA 1RXWA 3RB0A 5ALNA 1J2NA 4JB3A 1U49A 2KKVA 4EBEA 1NK0A 3H7IA 4MFFA 2YB4A 2XGPA 3BQ2A 2LPEA 2DGZA 3D2SA 3HJEA 5KFLA 3T5JA 4KTQA 4B9NA 3ORYA 1XSNA 4I2CA 1ZJMA 4KX3A 2AXTU 2R8IA 4Z6EA 3SAFA 5AI0A 2HVHA 3AMZA 1Q46A 2UVRA 4Q8FA 4YR0A 3G6YA 2WF6A 2BPCA 2CN1A 2I9GA 5J2IA 4E0DA 4BWMA 2NV3A 2RLTA 4KMOB 4US8A 2XVTA 2FLNA 3RH6A 4XUSA 8ICUA 3C28A 5DDMA 2AHOB 2RP5A 3E58A 2P6RA 4UB1A 1JIHA 2K4EA 4F5NA 1B22A 5DDYA 5CP2A 4QWBA 5AICA 1OXJA 2EDUA 2DKZA 2KV2A 3NUQA 3ZDEA 9ICEA 1X66A 4QZAA 3PW5A 4KLIA 1TFRA 2YB1A 3JPNA 5J2KA 2W9MA 9ICMA 4J9SA 3PX0A 5AKEA 1T3QA 4B9VA 1BPYA 3IDWA 1JXEA 1Z00A 5AK6A 3TKAA 4F8RA 2W9BA 3EPGA 4MEYA 1L3VA 3MR3A 4ECVA 3K1ZA 5JRTA 2RQ5A 2B0CA 2NRVA 1PVPA 1QSSA 2J6SA 2CRXA 4QWDA 3C5GA 5L1KA 4NM1A 3MBYA 4EZ9A 3EW9A 2MSNA 3QEBZ 4RPYA 1NKCA 2JZBB 1VDVA 3IV6A 1PK1A 2LI6A 2JRZA 1Z19A 2LKYA 2BCQA 4LJXA 1JI7A 1XU4A 2QARB 3C5FA 4EEYA 2BDUA 1FEZA 3SI8A 2ZTEA 3J81j 2W3SA 2B21A 2ES6A 4QZFA 3RB6A 4FBTA 1XWLA 1RQNA 3WK5A 3D2QA 9ICWA 5KT6A 3RR8A 9ICCA 4RQ1A 2DBYA 1NK7A 3F5AA 4ECYA 9ICRA 3DDHA 1HIWA 3EPIA 4RNMA 4F3OA 3WKBA 1FIQA 3Q8KA 5KAIU 2IA6A 2PMZF 2O6KA 5FP0A 5G5GA 4RU9A 3H8MA 1ZQPA 5AI8A 4KITB 5ALQA 1ZQDA 3ISDA 4J9NA 5J8YA 1T7PA 8ICOA 2DQNB 3SAGA 8ICVA 3PX4A 2JR5A 1LV5A 4A8EA 1NJYA 4C0ZA 9ICOA 4EBCA 3WK7A 4RQ2A 8ICTA 2F76X 5IIKA 4RQMA 2J6TA 1NKBA 3MFIA 1U47A 5IIIA 5ALTA 4B9TA 2OHFA 2K4IA 2H5XA 4B9UA 1U48A 3V6HA 2YMLA 4F92B 1H38A 1SXEA 4FE3A 2F44A 4I2FA 2YX8A 3MR6A 1Z1BA 2W9CA 5L1IA 1ZQLA 2LHTA 3SMVA 2ZXHA 3CNHA 4KLMA 3T79A 3RJIA 3D2NA 2W04A 3T5KA 3H0MB 2A1AA 2DKXA 4DSLA 4NLBA 4O3NA 3N7SC 1T3NA 5J2CA 8ICAA 3V6JA 3Q8MA 1GO3F 4QNLA 2MA1A 2WB1F 3C2LA 3PMNA 1URJA 2MAXA 5IINA 4B9SA 3WK8A 3LWMA 4DO9A 4DLGA 1NZBA 2VJ5A 4P0PB 2F3NA 1COOA 1ZD3A 4CF3A 1KDHA 4OJOA 4M9LA 4KN4A 2BCVA 2FLLA 5G5HA 1N60A 2E8OA 1SIJA 4C4TA 4ECQA 3RFAA 2G5HB 3IN5A 3CW2C 3HP6A 4YCXA 3A0HU 2ZTDA 3AEVA 4I2IA 4US9A 5DBBA 4QZHA 3ISBA 4F50A 2W9AA 4RUAA 2DF4B 3BZKA 1B4FA 2PFNA 3NRWA 4KLEA 2NO5A 8ICLA 4YMNA 2W54A 1N5XA 2HHUA 2W55A 3IG5A 4OJ6A 4F5QA 2C2RA 3GILA 2YTUA 4O3PA 3WK9A 5EWEA 3Q8PB 1AQ6A 4I2BA 4PPXA 2LYHA 5KT7A 4IQTA 5CRXA 3KKAC 2IHMA 2JEGA 1J97A 4O3OA 3UQ2A 3GV8B 3ETRA 3K4GA 2E5SA 2KVSA 2BHNA 2W9BB 2AU0A 3WK4A 1XS9D 9ICBA 3AQFA 1SGGA 1X9XA 2ODGA 2P66A 2IBKA 3PW0A 1ZXIA 2KSOA 4IRKA 1TK8A 2BZFA 2LM4A 4I28A 3GFKB 5J2HA 4MEXA 9ICLA 4C8KA 1S0VA 1S8OA 2HHQA 5C5JA 2JEJA 4NY8A 5KFHA 3F2BA 2MRLA 5DGAA 7ICQA 5KFBA 5ALXA 2IOHA 5KT3A 3RF9A 3FM9A 1PZNA 4I2GA 8ICFA 4YG2A 2ZJ8A 2C2DA 3PZPA 2C28A 8ICGA 4F4WA 3NVZA 3RRHA 4Y2JA 2XICA 4NLCA 3V7LA 5DGBA 1SKWA 5DB8A 5KG1A 4P4PA 8ICKA 5DG8A 2WF5A 2NRWA 2QB0A 5KTQA 2ZIVB 2W8LA 8ICEA 2BCUA 2BPGA 2AGQA 2JGAA 5ALLA 2A3VA 1FFVA 1YZ6A 4DFDA 4JV2A 2FPMA 1SKRA 1ZOLA 3RBEA 4PGXA 3WKEA 4KLJA 5KFPA 1RYRA 5HHIA 2BQRA 1ZQFA 4EENA 3KOOA 5KFIA 3SYZA 8ICIA 1D9DA 5J29A 4RQ8A 5DBCA 2F8KA 1L8LA 4P0QA 4CE6A 4QZGA 4DCCA 4BUGA 4QZIA 3RJKA 1NK6A 4CGZA 3KZIU 5DLFA 4PGYA 1FFUA 3K75D 1V9PA 1UT8A 2V9WA 2ZUCA 3V7KA 2E8NA 3PSFA 2F77X 2YMMA 3CP8A 2F8LA 2HOIA 2Y1IA 4DOCA 5AKYA 4Y2XA 4QW9A 4C4RA 1KFTA 1ZQWA 3I1YA 1RZTA 4DFKA 3LWLA 2Z7JA 4DL5A 3KBBA 2CXYA 3RJJA 3HW8A 5JU5A 3GV7B 5AI5A 2KD1A 4LZGA 3TARA 3HX0A 3OSNA 3UXPA 4FO6A 4DLEA 3TANA 4JWNA 3WKDA 9ICPA 4ECRA 4GXKA 2QLTA 2ZG6A 4TURA 1ZQMA 2KFZA 2NRXA 2AH5A 1UPHA 1MC8A 4ED8A 4F91B 3ALRA 4YP3A 3V6KA 1Z4OA 3VCBA 4Z6CA 5J2AA 1UT5A 2WAQC 4QZ9A 3UMCA 4F2RA 4QIWC 3ONNA 7ICNA 7ICOA 4DWIA 2BCRA 5AKLA 3PW2A 2ZXIA 1DK2A 4PHEA 1JX4A 4JV0A 2KIVA 1PK3A 3O0FA 5EE1A 5J0XA 4DSKA 1X9MA 3PSPA 5DB9A 4DOBA 3PY8A 2ZTCA 3NGDA 2FMQA 4Y2VA 4JK1A 1KTQA 2IHNA 2R8HA 9ICKA 5HP4A 2YMPA 1KL9A 1KQQA 1D9FA 4B9MA 3RH5A 2ATLA 3QUTA 1L6NA 2E3TA 3WKAA 5AKGA 3BQTA 4JV1A 1JROA 5ALOA 4X5VA 1SZPA 3PW4A 4KLFA 1MA7A 4KLOA 1D8LA 2OXOA 4EBDA 5AKXA 3JPSA 5E79U 2VA3A 1S97A 4RQNA 5DB6A 1OW5A 2ZIUB 1KBUA 3AQEA 4F5RA 5DQIA 4KLGA 2KZ3A 5ALWA 3QUCA 2KMDA 4RUCA 2L5YA 1X42A 2XIDA 4QJFB 1L7MA 3OHBA 1ZJNA 1ZQTA 1DGSA 2LYBA 3RR7A 1S77D 3KFUF 3MR2A 1WWVA 2FDRA 1QLNA 4F93B 2ZJ5A 2HW3A 2JZBA 5A0LA 2G0AA 1N63A 2BPFA 1A0PA 2A1JA 3NVWA 1WCNA 5EWFA 3M8SA 3HWTA 3MFHA 2KJ5A 2KNJA 4BGDA 2HOQA 2JMGA 4F4YA 1UQVA 2W3RA 3HRDD 4UB4A 1JALA 2ASDA 3IP4B 4FFDA 4I2JA 4O0IA 3MR5A 3C23A 3H8JA 2AQ0A 1SV0A 1J2MA 3C21A 3G6VA 3F2CA 4M6WB 3GIJA 4I2EA 5J0RA 5KFVA 4NV0A 2AJQA 1BPDA 4NL9C 4C7YA 5DB7A 4NXZA 5AHXA 1ECWA 3HPOA 4GC7A 1ZQHA 2OH2A 3PSIA 2BGWA 1X6IA 4DS5A 2DPIA 4EZ6A 1ZQGA 4O9MA 2UVUA 1AROP 1O08A 4B9LA 2ZIWB 5ALUA 4GXJA 2AQ4A 3K1RB 5J0YA 5J2EA 4RT2A 4Y2TA 2R8JA 2NYVA 4BXOB 2LBOA 5D4BA 5KFSA 3H4DA 4J9LA 3M1YA 2VA2A 8ICCA 1CUKA 4CDGA 3NS1A 4K4GA 4Y2YA 1UCVA 4YMMA 3ZI4A 5KFQA 1S5LU 3RJEA 2ASJA 1PVQA 9ICQA 5KFZA 3PR4A 3OJUA 3FC4A 2BQ3A 4MF8A 1MQ3A 4P0QB 2OYYA 5TISU 2PFQA 4ELTA 3C2MA 4NJ8A 4UAUA 3EZ5A 1Q8KA 1S9FA 5J2DA 5KG2A 2KJ8A 1ZQSA 5CA7A 3QU5A 2WF8A 3PO5A 2EAMA 5AIBA 5J2GA 1NK5A 4GFJA 1HJPA 1SL1A 1KLNA 1A6SA 5HHHA 5KL8B 4DQPA 1TVAA 3BDPA 1DOQA 2A1JB 1T94A 2K4HA 4Q44A 2Y9UA 4LVSA 4R8UB 2HHWA 4PH5A 3TAPA 4K4IA 1RYSA 2K4PA 2LM1A 3MGIA 5KFEA 4P2HA 4OJLA 1JUDA 2PXIA 4UAVA 3WU2U 1NK9A 4BXOA 3ETLA 4MHVA 2Y1JA 4ED1A 2Y9TA 2KP7A 4DL3A 3BJYA 2DL0A 2GLEA 4XQ8A 2GO7A 1BVSA 3EUB2 4QIWF 2PKEA 1RPLA 1ZQ1C 2EAPA 4TUQA 1QSLA 5KFYA 4ZH4A 4O3QA 4MF2A 4G3IA 5J0UA 4IR1A 9ICTA 5ALSA 2BCSA 5F9NA 2EZZA 1N2XA 1L8OA 4G9BA 2K8AA 1WYGA 2BR0A 4UBBA 2JV3A 2F1IA 3QYPA 5AKKA 4RPXA 3QZ8A 4RQ4A 3E0FA 4F4ZA 4I29A 4DS4A 3IG8A 4YQWA 9ICJA 4C80A 4BDPA 1ED1A 1A76A 3SR6A 3QUQA 3HKZF 5K4LA 4PGQA 1JN3A 1HUZA 4P0PA 2FMPA 4KLSA 2AGPA 5DQGA 5IILA 9ICIA 9ICAA 2E1EA 2JEIA 4KMUA 5CR0A 1VLBA 2PFPA 5KAFU 3ED5A 2P35A 3KHGA 2CPRA 2R18A 2G09A 2ISPA 4CF4A 1QCKA 4Q8EA 2N1RA 4MFCA 2AGOA 2ISOA 2EAOA 4FZMA 3H40A 1V38A 4FS2A 1CI4A 2KFNA 4J9QA 5KFOA 8ICZA 1Z00B 2K60A 4UAWA 2ASLA 1K1SA 3RJHA 4UW9A 1B0XA 7ICRA 3MGHA 5EWGA 5AKHA 3Q8LA 2W03A 1NZPA 3H4BA 4DF4A 4PHAA 1DRGA 2PMZC 2HHXA 3AU6A 3EYZA 4KLDA 2EZXA 1L3TA 5D46A 2E8PA 4YN4A 3PNCA 5ALFA 3F2DA 1N48A 1IV8A 7ICUA 4I2AA 1C20A 1UA0A 2HHSA 1ZETA 2F1JA 1LB2B 3AUOA 2RDJA 2KEYA 2VANA 4UQGA 4F72A 3D6JA 2ZIWA 2ZJAA 2H3FA 2HMXA 1MQ2A 1ZQOA 4CRXA 2G06A 4CCHA 3T3FA 3JPPA 2H3ZA 3PX6A 2LYAA 4RZRA 5AM0A 3SAHA 1S10A 2KTQA 5L1MA 2NRTA 2K89A 8ICMA 3HT3A 4DQSA 4IC9A 3TFRA 3KHLA 3QU7A 5AKJA 4B6JA 4J03A 2WF9A 1ZQAA 1LKYA 2XCPA 3QE9Y 4F5PA 4YXJA 2LMRA 4M2YA 2K8CB 5DG9A 1S0OA 2RDIA 3QZ7A 5AM3A 3BQ1A 2JH1A 5AK4A 7ICFA 2DUYA 1XO0A 5J0SA 1TAQA 3L4PA 7ICMA 1FO4A 2KHQA 5ALVA 5KFFA 1IM4A 5EE3A 3A0BU 3H8WA 2JXJA 5ALZA 5T14A 3QX7A 5ALHA 4F4XA 1COKA 5ALPA 4IL6U 1UHUA 3TI0A 2C22A 1Z1VA 8ICNA 1CRXA 5EOZA 2M9NA 4FS1A 1XSPA 1T4GA 5KT4A 5KG3A 1LVHA 2EZYA 4EYHB 4NL9A 4C8OA 7ICVA 2HI0A 1V85A 3PW7A 3NRZA 5HMMA 4LZDA 3NVVA 3M9MB 3SZ2A 5KL1B 3GIKA 5AK3A 2IMWP 3RRGA 1ZQRA 5F9LA 5IIJA 3I76A 4DL2A 2KN7A 3B0XA 1Q3UA 5KG7A 4TQSA 4J9RA 2HBMA 2KE7A 3AU2A 3CYMA 2GOLA 4I2DA 1TV9A 2G08A 3IM1A 4ICAA 2WTFA 3ZDBA 3N7RC 3FAHA 4UB3A 2H3VA 1KSPA 1SB3C 2WHEA 3GIMA 2GH1A 7ICSA 5KFGA 5IIMA 1EXNA 2UVVA 1WUDA 3BQ0A 9ICFA 1O03A 1U45A 2G5IB 1ZQXA 1TAUA 4MFAA 5KFRA 4IQVA 2FPKA 4C8MA 1NKEA 4DSJA 1ZQBA 1WWUA 3NASA 4QWAA 2FE9A 3B9JA 3RH4A 5J2BA 3LYSA 1NJWA 1QSYA 4IRDA 2HHTA 3HKZC 3UMBA 5KG0A 3PR5B 5AIAA 1ZD5A 4U7CA 2K8BB 1JXLA 1N5WA 4Z6DA 3LDAA 3SENA 1ZQNA 5L9XA 7ICGA 2OM6A 3OHAA 1QQ5A 4NLNA 3KHHA 1TKDA 4QWEA 5KG5A 4F5OA 1WG8A 4EX7A 4OO1J 4Y2SA 3UMGA 4IRCA 1S0NA 2ZIUA 4HYKA 3QUBA 4R64A 1KEJA 1MSWD 3ZDCA 4ECUA 4BJQA 1S76D 4J9PA 5J0OA 2W11A 1BNPA 2D3DA 4YXMA 1PVRA 3PSTA 3DV9A 1N56A 1OUQA 5ALEA 5IIOA 3QEAZ 1JRPA 1S0MA 4R66A 3KHRA 2XY5A 3N4MB 1B43A 4BX9C 4P4OA 1SL2A 5CEHA 1DK3A 2BKEA 3GU3A 2ZIXA 1M6YA 3SV4A 5DLGA 4JMUA 1ZQQA 3F5EA 1X40A 4O3RA 8ICWA 1ZQEA 1XSLA 5AM2A 4DFMA 2QB0B 5L1LA 5KFCA 4KLUA 2HCFA 3UM9A 1BPEA 4FZNA 5AKIA 3AM9A 4M9NA 3S6JA 2HBJA 1A77A 5AK5A 4F2SA 4J9KA 3I28A 3HILA 1RM6C 4Z6FA 4DSIA 1L7NA 3UXOA 4Y2RA 1NK8A 2HDOA 4DEZA 5GTIU 4RQ0A 3TADC 4Q45A 1ZQVA 4AP9A 3QNMA 4UAZA 8ICJA 2M0NA 5DBAA 4ECXA 1Y88A 3FDSA 3RB4A 5GTHU 4EEKA 4KLHA 5AI9A 5J0TA 4IR9A 4J9OA 2WAQF 3H8SA 4YMOA 4ELUA 3N97B 2ZUDA 8ICBA 2ESEA 1KRPA 1IIPA 2YY6A 3PVXA 3OTQA 1DXSA 5KG6A 5TZVA 4NLZA 2ZIXB 2HBLA 5CJ7A 3AL0B 2PI5A 4DF8A 3C2KA 2H3IA 3L5KA 3PV8A 5L1JA 4C4SA 4O5EA 1ZQJA 3TACB 2XC9A 3OSPA 2HVIA 1SWVA 2B6GA 4DQQA 4UB5A 2G07A 3LK9A 4M47A 3CRXA 5ALYA 3GV5B 1ZD2P 4U6PA 3MC1A 1NNLA 4DL4A 3V72A 9ICXA 8ICHA 5J0QA 4DQRA 1RG6A 5HR7A 5HR6A 3C1ZA 2EANA 2XCAA 1WCLA 3RTVA 1PUZA 3UQ0A 4KLQA 2JEFA 3JPOA 3RJGA 4QZBA 3QU2A 4YR3A 4Y2UA 1L5UA 4ED3A 3UXNA 5KFJA 2DFLA 1RDFA 4OJ5A 4R8UA 1NI3A 9ICVA 3N28A 3TAQA 7ICJA 3JPTA 4I2HA 4O5KA 4XRHA 3RAXA 1NJZA 8ICYA 5B66U 4JWMA 1ZQYA 2XGQA 2A19A 1ZQUA 3KZXA 3Q8RB 3RAQA 1KN5A 1TAMA 4YVZA 4TQRA 1HUOA 4DOAA 3KTQA 2XY6A 1RQLA 2KZMA 1SWWA 1LKYB 4F71A 1YT3A 5H2FU 4YD2A 2W8KA 2XY7A 2QKQA 2MU2A 4O3MA 4ED0A 2ZUBA 1MN8A 2JHDA 3MGVA 3IRUA 2HBKA 4J9MA 4UB2A 4IS7A 2BDPA 3RB3A 4UASA 4AYBF 1XC9A 8ICSA 4M6WA 1RYUA 4ACOA 2KOBA 4TUSA 3SQIA 1U9LA 2RHFA 5ALRA 2P6UA 4NLGA 3N7PD 4CNQA 5EE0A 3TFSA 1SZHA 2D8CA 2YN4A 3MDAA 1IG6A 8ICRA 8ICQA 4K4HA 3PO4A 4I27A 1F44A 4R63A 4ED7A 4F4KA 3QXGA 1VJ5A 1C7YA 4DQIA 3G6XA 5KNIA 1KFDA 2IOFK 3Q8QB 2KJ9A 4PHDA 8ICPA 3L3FX 3LVVA 3BQ7A 4DSEA 4O5CA 2I5HA 1ZYQA 7ICKA 2KG5A 2J6UA 1F5SA 7ICLA 3BS5A 3WKCA 2DPJA 8ICXA 4YR2A 2C2EA 2GWSA 1ZQKA 4DFPA 5JTIA 5J2JA 2R8KA 4M04A 4GIBA 2OWOA 5KT5A 5KFMA 5HNKA 4UAYA 4PJ0U 5HMLA 4QZDA 1BGXT 3JPRA 3BS5B 4CF5A 1QQ6A 3AN1A 3EWAA 4RQ6A 4Y2QA 2QB1A 4KLTA 2KVCA 4GC6A 2XO7A 3Q8SB 1V97A 3ZD8A 4R65A 2Q4TA 3LVWA 5JUMA 1RXVA 4JUZA 2V4QA 2FPLA 4NWIA 4M0AA
chains in the Genus database with same CATH topology
2ES6A 3SEIA 2D3DA 1SGGA 4MHVA 1X9XA 2E8PA 2E8NA 3TADA 2Y9TA 3TACB 3K1RB 2B6GA 2DL0A 2GLEA 2KSOB 2KSOA 2D8CA 2KE7A 1SV0C 2EAPA 2DKXA 4RQNA 1OW5A 1UCVA 1OXJA 2DKZA 5KNIA 1RG6A 1X66A 1X40A 2KMDA 2EANA 5L1MA 2L5YA 5JU5A 2QB0B 2F3NA 2JV3A 3BQ7A 1WWVA 3H8MA 1SV4A 2KG5A 2E8MA 3IDWA 2E8OA 4NJ8A 3BS5A 1LKYA 3KKAA 1WWUA 2FE9A 2LMRA 5J8YC 2QB0A 3HILA 5J8YA 5JTIA 5JRTA 3TADC 2EAMA 1B4FA 1UQVA 3SENA 1PK1B 3BS5B 4PZNA 1KW4A 2LPEA 5F3XB 2EAOA 4RQMA 3BS7A 1F0MA 2Y9UA 2YTUA 1V38A 2KIVA 1PK3A 1COKA 2QB1A 1LKYB 2ESEA 2QKQA 1PK1A 2K60A 2K4PA 1SV0A 1Z1VA 1DXSA 2F8KA 1B0XA 1JI7A 2QARB 4NL9C 3KKAC 1SXEA 4PZOA 2F44A 4NL9A 4IS7A 1V85A 2QARA 1SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ES6 A;  3SEI A;  2D3D A;  1SGG A;  4MHV A;  1X9X A;  2E8P A;  2E8N A;  3TAD A;  2Y9T A;  3TAC B;  3K1R B;  2B6G A;  2DL0 A;  2GLE A;  2KSO B;  2KSO A;  2D8C A;  2KE7 A;  1SV0 C;  2EAP A;  2DKX A;  4RQN A;  1OW5 A;  1UCV A;  1OXJ A;  2DKZ A;  5KNI A;  1RG6 A;  1X66 A;  1X40 A;  2KMD A;  2EAN A;  5L1M A;  2L5Y A;  5JU5 A;  2QB0 B;  2F3N A;  2JV3 A;  3BQ7 A;  1WWV A;  3H8M A;  1SV4 A;  2KG5 A;  2E8M A;  3IDW A;  2E8O A;  4NJ8 A;  3BS5 A;  1LKY A;  3KKA A;  1WWU A;  2FE9 A;  2LMR A;  5J8Y C;  2QB0 A;  3HIL A;  5J8Y A;  5JTI A;  5JRT A;  3TAD C;  2EAM A;  1B4F A;  1UQV A;  3SEN A;  1PK1 B;  3BS5 B;  4PZN A;  1KW4 A;  2LPE A;  5F3X B;  2EAO A;  4RQM A;  3BS7 A;  1F0M A;  2Y9U A;  2YTU A;  1V38 A;  2KIV A;  1PK3 A;  1COK A;  2QB1 A;  1LKY B;  2ESE A;  2QKQ A;  1PK1 A;  2K60 A;  2K4P A;  1SV0 A;  1Z1V A;  1DXS A;  2F8K A;  1B0X A;  1JI7 A;  2QAR B;  4NL9 C;  3KKA C;  1SXE A;  4PZO A;  2F44 A;  4NL9 A;  4IS7 A;  1V85 A;  2QAR A;  1SXD A; 
#chains in the Genus database with same CATH topology
 4IQW A;  1BPB A;  3SEI A;  3TQ1 A;  1TK0 A;  4QWC A;  3KD3 A;  4AYB C;  5ALM A;  4ZOH C;  4OJP A;  2HOF A;  3ISC A;  2DWQ A;  3UPQ A;  3GDX A;  1P7D A;  1Z4N A;  1KFS A;  4PL2 A;  4FZL A;  5ALG A;  3M6K A;  4DFJ A;  5J2F A;  4QZE A;  3ZDA A;  2V4R A;  1X9S A;  4YFK A;  5KFT A;  4M9G A;  2RRD A;  2WF7 A;  4ECS A;  4UBC A;  1ZQI A;  1SL0 A;  5DQH A;  5CHG A;  4NLK A;  7ICH A;  1UA1 A;  3QU9 A;  2YMQ A;  4KLL A;  3NVY A;  1U4B A;  2XI9 A;  4ECT A;  5KT2 A;  2KKP A;  3SV3 A;  1CEZ A;  4XA5 A;  9ICN A;  1ZQC A;  1ZQZ A;  2KK0 A;  4GLX A;  2F2A B;  3NTU A;  4IQU A;  4PZN A;  2FLP A;  3QU4 A;  5ALJ A;  5J0W A;  9ICG A;  3WK6 A;  5AI6 A;  3BS7 A;  4KX5 A;  2FMS A;  3THV A;  2HSZ A;  1Z3E B;  4NM2 A;  4DL7 A;  5DG7 A;  1X9W A;  4RPZ A;  3M8R A;  5BPC A;  3BZC A;  2Q0Z X;  2MUT A;  3PML A;  3MDC A;  2WFA A;  1QQ7 A;  4RQ7 A;  5J0P A;  2VKQ A;  4PZO A;  2Y0S C;  3M6Z A;  4DL6 A;  2D6F C;  4RT3 A;  4P4M A;  4EEL A;  4ELV A;  4KN7 A;  1SXD A;  3C1Y A;  5AKZ A;  2I1Q A;  7ICE A;  4RQ5 A;  4C8N A;  1N62 A;  3M9N B;  5KFX A;  4WJ3 B;  3TAD A;  2EH9 A;  1N61 A;  4C7Z A;  1ZRM A;  1NOM A;  5AM4 A;  4UAR A;  3T5L A;  3VC8 A;  4M9H A;  2VIX A;  5BOL A;  1BNO A;  2W43 A;  7ICT A;  1YZ7 A;  5ALD A;  1TE2 A;  2JH7 A;  4Y2P A;  4BWJ A;  1BPZ A;  4OCZ A;  2W9C B;  5KG4 A;  2ZIV A;  3H0R B;  3B0Y A;  2KZZ A;  1ZRN A;  4Q43 A;  2MUT B;  3GZF A;  3SD7 A;  1SV4 A;  4UB6 U;  4PHP A;  3ZDD A;  5ALK A;  3M9O B;  3M7D A;  2NRZ A;  1NJX A;  2ALZ A;  1K1Q A;  2OCE A;  1L3S A;  1XNS A;  2KHV A;  4ECW A;  5J8Y C;  1KKX A;  5CWR A;  3OJS A;  1X2I A;  5D49 A;  3ICX A;  3FYH A;  4QZC A;  4PL1 A;  3E2E A;  1D8B A;  4GXI A;  4QZ8 A;  1K5O A;  2PFO A;  5KFK A;  3GII A;  1T8E A;  4RQ3 A;  2FI1 A;  1PK1 B;  5KFU A;  1KW4 A;  5F3X B;  9ICH A;  3GQC A;  5KFA A;  2VJ4 A;  2R8G A;  5BOM A;  3OPX A;  1F0M A;  5B5E U;  3JPQ A;  4EYI B;  1JMS A;  4O3S A;  4USA A;  5ALI A;  4UB8 U;  1QH9 A;  4FBU A;  1QTM A;  1X6J A;  5C0Y A;  1TK5 A;  1DGJ A;  2EQY A;  4M9J A;  1IXR A;  2W7O A;  2I6X A;  3T5H A;  5KFW A;  3DEE A;  2QAR A;  1L7P A;  5CB1 A;  4DSF A;  4C8L A;  2WB1 C;  5KFN A;  3V7J A;  7ICP A;  4YD1 A;  2VA8 A;  2Y0S F;  3R9K A;  2NO4 A;  4RNN A;  2PI4 A;  2KSO B;  3RJF A;  3RBD A;  1D8Y A;  4UAT A;  4OD0 A;  4ECZ A;  5AI4 A;  4RNO A;  4QW8 A;  1SV0 C;  4ED6 A;  5AM5 A;  2OEH A;  1HEK A;  3IHQ B;  2H3Q A;  1XO1 A;  4ED2 A;  2YQE A;  3C29 A;  3OGU A;  1SKS A;  1NK4 A;  3ZD9 A;  2FJ6 A;  2IOF A;  2UVW A;  2KIW A;  3F53 A;  2F1H A;  4EX6 A;  1Q3V A;  1L7O A;  2E8M A;  2BQU A;  9ICS A;  7ICI A;  5KFD A;  3KKA A;  1BPX A;  3H0L B;  3U26 A;  2E1F A;  3MAB A;  1L3U A;  1ZD4 A;  4HAI A;  5EE9 A;  2W7P A;  4TUP A;  2KIC A;  9ICU A;  2HHV A;  5AM1 A;  5DKW A;  1RXW A;  3RB0 A;  5ALN A;  1J2N A;  4JB3 A;  1U49 A;  2KKV A;  4EBE A;  1NK0 A;  3H7I A;  4MFF A;  2YB4 A;  2XGP A;  3BQ2 A;  2LPE A;  2DGZ A;  3D2S A;  3HJE A;  5KFL A;  3T5J A;  4KTQ A;  4B9N A;  3ORY A;  1XSN A;  4I2C A;  1ZJM A;  4KX3 A;  2AXT U;  2R8I A;  4Z6E A;  3SAF A;  5AI0 A;  2HVH A;  3AMZ A;  1Q46 A;  2UVR A;  4Q8F A;  4YR0 A;  3G6Y A;  2WF6 A;  2BPC A;  2CN1 A;  2I9G A;  5J2I A;  4E0D A;  4BWM A;  2NV3 A;  2RLT A;  4KMO B;  4US8 A;  2XVT A;  2FLN A;  3RH6 A;  4XUS A;  8ICU A;  3C28 A;  5DDM A;  2AHO B;  2RP5 A;  3E58 A;  2P6R A;  4UB1 A;  1JIH A;  2K4E A;  4F5N A;  1B22 A;  5DDY A;  5CP2 A;  4QWB A;  5AIC A;  1OXJ A;  2EDU A;  2DKZ A;  2KV2 A;  3NUQ A;  3ZDE A;  9ICE A;  1X66 A;  4QZA A;  3PW5 A;  4KLI A;  1TFR A;  2YB1 A;  3JPN A;  5J2K A;  2W9M A;  9ICM A;  4J9S A;  3PX0 A;  5AKE A;  1T3Q A;  4B9V A;  1BPY A;  3IDW A;  1JXE A;  1Z00 A;  5AK6 A;  3TKA A;  4F8R A;  2W9B A;  3EPG A;  4MEY A;  1L3V A;  3MR3 A;  4ECV A;  3K1Z A;  5JRT A;  2RQ5 A;  2B0C A;  2NRV A;  1PVP A;  1QSS A;  2J6S A;  2CRX A;  4QWD A;  3C5G A;  5L1K A;  4NM1 A;  3MBY A;  4EZ9 A;  3EW9 A;  2MSN A;  3QEB Z;  4RPY A;  1NKC A;  2JZB B;  1VDV A;  3IV6 A;  1PK1 A;  2LI6 A;  2JRZ A;  1Z19 A;  2LKY A;  2BCQ A;  4LJX A;  1JI7 A;  1XU4 A;  2QAR B;  3C5F A;  4EEY A;  2BDU A;  1FEZ A;  3SI8 A;  2ZTE A;  3J81 j;  2W3S A;  2B21 A;  2ES6 A;  4QZF A;  3RB6 A;  4FBT A;  1XWL A;  1RQN A;  3WK5 A;  3D2Q A;  9ICW A;  5KT6 A;  3RR8 A;  9ICC A;  4RQ1 A;  2DBY A;  1NK7 A;  3F5A A;  4ECY A;  9ICR A;  3DDH A;  1HIW A;  3EPI A;  4RNM A;  4F3O A;  3WKB A;  1FIQ A;  3Q8K A;  5KAI U;  2IA6 A;  2PMZ F;  2O6K A;  5FP0 A;  5G5G A;  4RU9 A;  3H8M A;  1ZQP A;  5AI8 A;  4KIT B;  5ALQ A;  1ZQD A;  3ISD A;  4J9N A;  5J8Y A;  1T7P A;  8ICO A;  2DQN B;  3SAG A;  8ICV A;  3PX4 A;  2JR5 A;  1LV5 A;  4A8E A;  1NJY A;  4C0Z A;  9ICO A;  4EBC A;  3WK7 A;  4RQ2 A;  8ICT A;  2F76 X;  5IIK A;  4RQM A;  2J6T A;  1NKB A;  3MFI A;  1U47 A;  5III A;  5ALT A;  4B9T A;  2OHF A;  2K4I A;  2H5X A;  4B9U A;  1U48 A;  3V6H A;  2YML A;  4F92 B;  1H38 A;  1SXE A;  4FE3 A;  2F44 A;  4I2F A;  2YX8 A;  3MR6 A;  1Z1B A;  2W9C A;  5L1I A;  1ZQL A;  2LHT A;  3SMV A;  2ZXH A;  3CNH A;  4KLM A;  3T79 A;  3RJI A;  3D2N A;  2W04 A;  3T5K A;  3H0M B;  2A1A A;  2DKX A;  4DSL A;  4NLB A;  4O3N A;  3N7S C;  1T3N A;  5J2C A;  8ICA A;  3V6J A;  3Q8M A;  1GO3 F;  4QNL A;  2MA1 A;  2WB1 F;  3C2L A;  3PMN A;  1URJ A;  2MAX A;  5IIN A;  4B9S A;  3WK8 A;  3LWM A;  4DO9 A;  4DLG A;  1NZB A;  2VJ5 A;  4P0P B;  2F3N A;  1COO A;  1ZD3 A;  4CF3 A;  1KDH A;  4OJO A;  4M9L A;  4KN4 A;  2BCV A;  2FLL A;  5G5H A;  1N60 A;  2E8O A;  1SIJ A;  4C4T A;  4ECQ A;  3RFA A;  2G5H B;  3IN5 A;  3CW2 C;  3HP6 A;  4YCX A;  3A0H U;  2ZTD A;  3AEV A;  4I2I A;  4US9 A;  5DBB A;  4QZH A;  3ISB A;  4F50 A;  2W9A A;  4RUA A;  2DF4 B;  3BZK A;  1B4F A;  2PFN A;  3NRW A;  4KLE A;  2NO5 A;  8ICL A;  4YMN A;  2W54 A;  1N5X A;  2HHU A;  2W55 A;  3IG5 A;  4OJ6 A;  4F5Q A;  2C2R A;  3GIL A;  2YTU A;  4O3P A;  3WK9 A;  5EWE A;  3Q8P B;  1AQ6 A;  4I2B A;  4PPX A;  2LYH A;  5KT7 A;  4IQT A;  5CRX A;  3KKA C;  2IHM A;  2JEG A;  1J97 A;  4O3O A;  3UQ2 A;  3GV8 B;  3ETR A;  3K4G A;  2E5S A;  2KVS A;  2BHN A;  2W9B B;  2AU0 A;  3WK4 A;  1XS9 D;  9ICB A;  3AQF A;  1SGG A;  1X9X A;  2ODG A;  2P66 A;  2IBK A;  3PW0 A;  1ZXI A;  2KSO A;  4IRK A;  1TK8 A;  2BZF A;  2LM4 A;  4I28 A;  3GFK B;  5J2H A;  4MEX A;  9ICL A;  4C8K A;  1S0V A;  1S8O A;  2HHQ A;  5C5J A;  2JEJ A;  4NY8 A;  5KFH A;  3F2B A;  2MRL A;  5DGA A;  7ICQ A;  5KFB A;  5ALX A;  2IOH A;  5KT3 A;  3RF9 A;  3FM9 A;  1PZN A;  4I2G A;  8ICF A;  4YG2 A;  2ZJ8 A;  2C2D A;  3PZP A;  2C28 A;  8ICG A;  4F4W A;  3NVZ A;  3RRH A;  4Y2J A;  2XIC A;  4NLC A;  3V7L A;  5DGB A;  1SKW A;  5DB8 A;  5KG1 A;  4P4P A;  8ICK A;  5DG8 A;  2WF5 A;  2NRW A;  2QB0 A;  5KTQ A;  2ZIV B;  2W8L A;  8ICE A;  2BCU A;  2BPG A;  2AGQ A;  2JGA A;  5ALL A;  2A3V A;  1FFV A;  1YZ6 A;  4DFD A;  4JV2 A;  2FPM A;  1SKR A;  1ZOL A;  3RBE A;  4PGX A;  3WKE A;  4KLJ A;  5KFP A;  1RYR A;  5HHI A;  2BQR A;  1ZQF A;  4EEN A;  3KOO A;  5KFI A;  3SYZ A;  8ICI A;  1D9D A;  5J29 A;  4RQ8 A;  5DBC A;  2F8K A;  1L8L A;  4P0Q A;  4CE6 A;  4QZG A;  4DCC A;  4BUG A;  4QZI A;  3RJK A;  1NK6 A;  4CGZ A;  3KZI U;  5DLF A;  4PGY A;  1FFU A;  3K75 D;  1V9P A;  1UT8 A;  2V9W A;  2ZUC A;  3V7K A;  2E8N A;  3PSF A;  2F77 X;  2YMM A;  3CP8 A;  2F8L A;  2HOI A;  2Y1I A;  4DOC A;  5AKY A;  4Y2X A;  4QW9 A;  4C4R A;  1KFT A;  1ZQW A;  3I1Y A;  1RZT A;  4DFK A;  3LWL A;  2Z7J A;  4DL5 A;  3KBB A;  2CXY A;  3RJJ A;  3HW8 A;  5JU5 A;  3GV7 B;  5AI5 A;  2KD1 A;  4LZG A;  3TAR A;  3HX0 A;  3OSN A;  3UXP A;  4FO6 A;  4DLE A;  3TAN A;  4JWN A;  3WKD A;  9ICP A;  4ECR A;  4GXK A;  2QLT A;  2ZG6 A;  4TUR A;  1ZQM A;  2KFZ A;  2NRX A;  2AH5 A;  1UPH A;  1MC8 A;  4ED8 A;  4F91 B;  3ALR A;  4YP3 A;  3V6K A;  1Z4O A;  3VCB A;  4Z6C A;  5J2A A;  1UT5 A;  2WAQ C;  4QZ9 A;  3UMC A;  4F2R A;  4QIW C;  3ONN A;  7ICN A;  7ICO A;  4DWI A;  2BCR A;  5AKL A;  3PW2 A;  2ZXI A;  1DK2 A;  4PHE A;  1JX4 A;  4JV0 A;  2KIV A;  1PK3 A;  3O0F A;  5EE1 A;  5J0X A;  4DSK A;  1X9M A;  3PSP A;  5DB9 A;  4DOB A;  3PY8 A;  2ZTC A;  3NGD A;  2FMQ A;  4Y2V A;  4JK1 A;  1KTQ A;  2IHN A;  2R8H A;  9ICK A;  5HP4 A;  2YMP A;  1KL9 A;  1KQQ A;  1D9F A;  4B9M A;  3RH5 A;  2ATL A;  3QUT A;  1L6N A;  2E3T A;  3WKA A;  5AKG A;  3BQT A;  4JV1 A;  1JRO A;  5ALO A;  4X5V A;  1SZP A;  3PW4 A;  4KLF A;  1MA7 A;  4KLO A;  1D8L A;  2OXO A;  4EBD A;  5AKX A;  3JPS A;  5E79 U;  2VA3 A;  1S97 A;  4RQN A;  5DB6 A;  1OW5 A;  2ZIU B;  1KBU A;  3AQE A;  4F5R A;  5DQI A;  4KLG A;  2KZ3 A;  5ALW A;  3QUC A;  2KMD A;  4RUC A;  2L5Y A;  1X42 A;  2XID A;  4QJF B;  1L7M A;  3OHB A;  1ZJN A;  1ZQT A;  1DGS A;  2LYB A;  3RR7 A;  1S77 D;  3KFU F;  3MR2 A;  1WWV A;  2FDR A;  1QLN A;  4F93 B;  2ZJ5 A;  2HW3 A;  2JZB A;  5A0L A;  2G0A A;  1N63 A;  2BPF A;  1A0P A;  2A1J A;  3NVW A;  1WCN A;  5EWF A;  3M8S A;  3HWT A;  3MFH A;  2KJ5 A;  2KNJ A;  4BGD A;  2HOQ A;  2JMG A;  4F4Y A;  1UQV A;  2W3R A;  3HRD D;  4UB4 A;  1JAL A;  2ASD A;  3IP4 B;  4FFD A;  4I2J A;  4O0I A;  3MR5 A;  3C23 A;  3H8J A;  2AQ0 A;  1SV0 A;  1J2M A;  3C21 A;  3G6V A;  3F2C A;  4M6W B;  3GIJ A;  4I2E A;  5J0R A;  5KFV A;  4NV0 A;  2AJQ A;  1BPD A;  4NL9 C;  4C7Y A;  5DB7 A;  4NXZ A;  5AHX A;  1ECW A;  3HPO A;  4GC7 A;  1ZQH A;  2OH2 A;  3PSI A;  2BGW A;  1X6I A;  4DS5 A;  2DPI A;  4EZ6 A;  1ZQG A;  4O9M A;  2UVU A;  1ARO P;  1O08 A;  4B9L A;  2ZIW B;  5ALU A;  4GXJ A;  2AQ4 A;  3K1R B;  5J0Y A;  5J2E A;  4RT2 A;  4Y2T A;  2R8J A;  2NYV A;  4BXO B;  2LBO A;  5D4B A;  5KFS A;  3H4D A;  4J9L A;  3M1Y A;  2VA2 A;  8ICC A;  1CUK A;  4CDG A;  3NS1 A;  4K4G A;  4Y2Y A;  1UCV A;  4YMM A;  3ZI4 A;  5KFQ A;  1S5L U;  3RJE A;  2ASJ A;  1PVQ A;  9ICQ A;  5KFZ A;  3PR4 A;  3OJU A;  3FC4 A;  2BQ3 A;  4MF8 A;  1MQ3 A;  4P0Q B;  2OYY A;  5TIS U;  2PFQ A;  4ELT A;  3C2M A;  4NJ8 A;  4UAU A;  3EZ5 A;  1Q8K A;  1S9F A;  5J2D A;  5KG2 A;  2KJ8 A;  1ZQS A;  5CA7 A;  3QU5 A;  2WF8 A;  3PO5 A;  2EAM A;  5AIB A;  5J2G A;  1NK5 A;  4GFJ A;  1HJP A;  1SL1 A;  1KLN A;  1A6S A;  5HHH A;  5KL8 B;  4DQP A;  1TVA A;  3BDP A;  1DOQ A;  2A1J B;  1T94 A;  2K4H A;  4Q44 A;  2Y9U A;  4LVS A;  4R8U B;  2HHW A;  4PH5 A;  3TAP A;  4K4I A;  1RYS A;  2K4P A;  2LM1 A;  3MGI A;  5KFE A;  4P2H A;  4OJL A;  1JUD A;  2PXI A;  4UAV A;  3WU2 U;  1NK9 A;  4BXO A;  3ETL A;  4MHV A;  2Y1J A;  4ED1 A;  2Y9T A;  2KP7 A;  4DL3 A;  3BJY A;  2DL0 A;  2GLE A;  4XQ8 A;  2GO7 A;  1BVS A;  3EUB 2;  4QIW F;  2PKE A;  1RPL A;  1ZQ1 C;  2EAP A;  4TUQ A;  1QSL A;  5KFY A;  4ZH4 A;  4O3Q A;  4MF2 A;  4G3I A;  5J0U A;  4IR1 A;  9ICT A;  5ALS A;  2BCS A;  5F9N A;  2EZZ A;  1N2X A;  1L8O A;  4G9B A;  2K8A A;  1WYG A;  2BR0 A;  4UBB A;  2JV3 A;  2F1I A;  3QYP A;  5AKK A;  4RPX A;  3QZ8 A;  4RQ4 A;  3E0F A;  4F4Z A;  4I29 A;  4DS4 A;  3IG8 A;  4YQW A;  9ICJ A;  4C80 A;  4BDP A;  1ED1 A;  1A76 A;  3SR6 A;  3QUQ A;  3HKZ F;  5K4L A;  4PGQ A;  1JN3 A;  1HUZ A;  4P0P A;  2FMP A;  4KLS A;  2AGP A;  5DQG A;  5IIL A;  9ICI A;  9ICA A;  2E1E A;  2JEI A;  4KMU A;  5CR0 A;  1VLB A;  2PFP A;  5KAF U;  3ED5 A;  2P35 A;  3KHG A;  2CPR A;  2R18 A;  2G09 A;  2ISP A;  4CF4 A;  1QCK A;  4Q8E A;  2N1R A;  4MFC A;  2AGO A;  2ISO A;  2EAO A;  4FZM A;  3H40 A;  1V38 A;  4FS2 A;  1CI4 A;  2KFN A;  4J9Q A;  5KFO A;  8ICZ A;  1Z00 B;  2K60 A;  4UAW A;  2ASL A;  1K1S A;  3RJH A;  4UW9 A;  1B0X A;  7ICR A;  3MGH A;  5EWG A;  5AKH A;  3Q8L A;  2W03 A;  1NZP A;  3H4B A;  4DF4 A;  4PHA A;  1DRG A;  2PMZ C;  2HHX A;  3AU6 A;  3EYZ A;  4KLD A;  2EZX A;  1L3T A;  5D46 A;  2E8P A;  4YN4 A;  3PNC A;  5ALF A;  3F2D A;  1N48 A;  1IV8 A;  7ICU A;  4I2A A;  1C20 A;  1UA0 A;  2HHS A;  1ZET A;  2F1J A;  1LB2 B;  3AUO A;  2RDJ A;  2KEY A;  2VAN A;  4UQG A;  4F72 A;  3D6J A;  2ZIW A;  2ZJA A;  2H3F A;  2HMX A;  1MQ2 A;  1ZQO A;  4CRX A;  2G06 A;  4CCH A;  3T3F A;  3JPP A;  2H3Z A;  3PX6 A;  2LYA A;  4RZR A;  5AM0 A;  3SAH A;  1S10 A;  2KTQ A;  5L1M A;  2NRT A;  2K89 A;  8ICM A;  3HT3 A;  4DQS A;  4IC9 A;  3TFR A;  3KHL A;  3QU7 A;  5AKJ A;  4B6J A;  4J03 A;  2WF9 A;  1ZQA A;  1LKY A;  2XCP A;  3QE9 Y;  4F5P A;  4YXJ A;  2LMR A;  4M2Y A;  2K8C B;  5DG9 A;  1S0O A;  2RDI A;  3QZ7 A;  5AM3 A;  3BQ1 A;  2JH1 A;  5AK4 A;  7ICF A;  2DUY A;  1XO0 A;  5J0S A;  1TAQ A;  3L4P A;  7ICM A;  1FO4 A;  2KHQ A;  5ALV A;  5KFF A;  1IM4 A;  5EE3 A;  3A0B U;  3H8W A;  2JXJ A;  5ALZ A;  5T14 A;  3QX7 A;  5ALH A;  4F4X A;  1COK A;  5ALP A;  4IL6 U;  1UHU A;  3TI0 A;  2C22 A;  1Z1V A;  8ICN A;  1CRX A;  5EOZ A;  2M9N A;  4FS1 A;  1XSP A;  1T4G A;  5KT4 A;  5KG3 A;  1LVH A;  2EZY A;  4EYH B;  4NL9 A;  4C8O A;  7ICV A;  2HI0 A;  1V85 A;  3PW7 A;  3NRZ A;  5HMM A;  4LZD A;  3NVV A;  3M9M B;  3SZ2 A;  5KL1 B;  3GIK A;  5AK3 A;  2IMW P;  3RRG A;  1ZQR A;  5F9L A;  5IIJ A;  3I76 A;  4DL2 A;  2KN7 A;  3B0X A;  1Q3U A;  5KG7 A;  4TQS A;  4J9R A;  2HBM A;  2KE7 A;  3AU2 A;  3CYM A;  2GOL A;  4I2D A;  1TV9 A;  2G08 A;  3IM1 A;  4ICA A;  2WTF A;  3ZDB A;  3N7R C;  3FAH A;  4UB3 A;  2H3V A;  1KSP A;  1SB3 C;  2WHE A;  3GIM A;  2GH1 A;  7ICS A;  5KFG A;  5IIM A;  1EXN A;  2UVV A;  1WUD A;  3BQ0 A;  9ICF A;  1O03 A;  1U45 A;  2G5I B;  1ZQX A;  1TAU A;  4MFA A;  5KFR A;  4IQV A;  2FPK A;  4C8M A;  1NKE A;  4DSJ A;  1ZQB A;  1WWU A;  3NAS A;  4QWA A;  2FE9 A;  3B9J A;  3RH4 A;  5J2B A;  3LYS A;  1NJW A;  1QSY A;  4IRD A;  2HHT A;  3HKZ C;  3UMB A;  5KG0 A;  3PR5 B;  5AIA A;  1ZD5 A;  4U7C A;  2K8B B;  1JXL A;  1N5W A;  4Z6D A;  3LDA A;  3SEN A;  1ZQN A;  5L9X A;  7ICG A;  2OM6 A;  3OHA A;  1QQ5 A;  4NLN A;  3KHH A;  1TKD A;  4QWE A;  5KG5 A;  4F5O A;  1WG8 A;  4EX7 A;  4OO1 J;  4Y2S A;  3UMG A;  4IRC A;  1S0N A;  2ZIU A;  4HYK A;  3QUB A;  4R64 A;  1KEJ A;  1MSW D;  3ZDC A;  4ECU A;  4BJQ A;  1S76 D;  4J9P A;  5J0O A;  2W11 A;  1BNP A;  2D3D A;  4YXM A;  1PVR A;  3PST A;  3DV9 A;  1N56 A;  1OUQ A;  5ALE A;  5IIO A;  3QEA Z;  1JRP A;  1S0M A;  4R66 A;  3KHR A;  2XY5 A;  3N4M B;  1B43 A;  4BX9 C;  4P4O A;  1SL2 A;  5CEH A;  1DK3 A;  2BKE A;  3GU3 A;  2ZIX A;  1M6Y A;  3SV4 A;  5DLG A;  4JMU A;  1ZQQ A;  3F5E A;  1X40 A;  4O3R A;  8ICW A;  1ZQE A;  1XSL A;  5AM2 A;  4DFM A;  2QB0 B;  5L1L A;  5KFC A;  4KLU A;  2HCF A;  3UM9 A;  1BPE A;  4FZN A;  5AKI A;  3AM9 A;  4M9N A;  3S6J A;  2HBJ A;  1A77 A;  5AK5 A;  4F2S A;  4J9K A;  3I28 A;  3HIL A;  1RM6 C;  4Z6F A;  4DSI A;  1L7N A;  3UXO A;  4Y2R A;  1NK8 A;  2HDO A;  4DEZ A;  5GTI U;  4RQ0 A;  3TAD C;  4Q45 A;  1ZQV A;  4AP9 A;  3QNM A;  4UAZ A;  8ICJ A;  2M0N A;  5DBA A;  4ECX A;  1Y88 A;  3FDS A;  3RB4 A;  5GTH U;  4EEK A;  4KLH A;  5AI9 A;  5J0T A;  4IR9 A;  4J9O A;  2WAQ F;  3H8S A;  4YMO A;  4ELU A;  3N97 B;  2ZUD A;  8ICB A;  2ESE A;  1KRP A;  1IIP A;  2YY6 A;  3PVX A;  3OTQ A;  1DXS A;  5KG6 A;  5TZV A;  4NLZ A;  2ZIX B;  2HBL A;  5CJ7 A;  3AL0 B;  2PI5 A;  4DF8 A;  3C2K A;  2H3I A;  3L5K A;  3PV8 A;  5L1J A;  4C4S A;  4O5E A;  1ZQJ A;  3TAC B;  2XC9 A;  3OSP A;  2HVI A;  1SWV A;  2B6G A;  4DQQ A;  4UB5 A;  2G07 A;  3LK9 A;  4M47 A;  3CRX A;  5ALY A;  3GV5 B;  1ZD2 P;  4U6P A;  3MC1 A;  1NNL A;  4DL4 A;  3V72 A;  9ICX A;  8ICH A;  5J0Q A;  4DQR A;  1RG6 A;  5HR7 A;  5HR6 A;  3C1Z A;  2EAN A;  2XCA A;  1WCL A;  3RTV A;  1PUZ A;  3UQ0 A;  4KLQ A;  2JEF A;  3JPO A;  3RJG A;  4QZB A;  3QU2 A;  4YR3 A;  4Y2U A;  1L5U A;  4ED3 A;  3UXN A;  5KFJ A;  2DFL A;  1RDF A;  4OJ5 A;  4R8U A;  1NI3 A;  9ICV A;  3N28 A;  3TAQ A;  7ICJ A;  3JPT A;  4I2H A;  4O5K A;  4XRH A;  3RAX A;  1NJZ A;  8ICY A;  5B66 U;  4JWM A;  1ZQY A;  2XGQ A;  2A19 A;  1ZQU A;  3KZX A;  3Q8R B;  3RAQ A;  1KN5 A;  1TAM A;  4YVZ A;  4TQR A;  1HUO A;  4DOA A;  3KTQ A;  2XY6 A;  1RQL A;  2KZM A;  1SWW A;  1LKY B;  4F71 A;  1YT3 A;  5H2F U;  4YD2 A;  2W8K A;  2XY7 A;  2QKQ A;  2MU2 A;  4O3M A;  4ED0 A;  2ZUB A;  1MN8 A;  2JHD A;  3MGV A;  3IRU A;  2HBK A;  4J9M A;  4UB2 A;  4IS7 A;  2BDP A;  3RB3 A;  4UAS A;  4AYB F;  1XC9 A;  8ICS A;  4M6W A;  1RYU A;  4ACO A;  2KOB A;  4TUS A;  3SQI A;  1U9L A;  2RHF A;  5ALR A;  2P6U A;  4NLG A;  3N7P D;  4CNQ A;  5EE0 A;  3TFS A;  1SZH A;  2D8C A;  2YN4 A;  3MDA A;  1IG6 A;  8ICR A;  8ICQ A;  4K4H A;  3PO4 A;  4I27 A;  1F44 A;  4R63 A;  4ED7 A;  4F4K A;  3QXG A;  1VJ5 A;  1C7Y A;  4DQI A;  3G6X A;  5KNI A;  1KFD A;  2IOF K;  3Q8Q B;  2KJ9 A;  4PHD A;  8ICP A;  3L3F X;  3LVV A;  3BQ7 A;  4DSE A;  4O5C A;  2I5H A;  1ZYQ A;  7ICK A;  2KG5 A;  2J6U A;  1F5S A;  7ICL A;  3BS5 A;  3WKC A;  2DPJ A;  8ICX A;  4YR2 A;  2C2E A;  2GWS A;  1ZQK A;  4DFP A;  5JTI A;  5J2J A;  2R8K A;  4M04 A;  4GIB A;  2OWO A;  5KT5 A;  5KFM A;  5HNK A;  4UAY A;  4PJ0 U;  5HML A;  4QZD A;  1BGX T;  3JPR A;  3BS5 B;  4CF5 A;  1QQ6 A;  3AN1 A;  3EWA A;  4RQ6 A;  4Y2Q A;  2QB1 A;  4KLT A;  2KVC A;  4GC6 A;  2XO7 A;  3Q8S B;  1V97 A;  3ZD8 A;  4R65 A;  2Q4T A;  3LVW A;  5JUM A;  1RXV A;  4JUZ A;  2V4Q A;  2FPL A;  4NWI A;  4M0A A; 
#chains in the Genus database with same CATH homology
 2ES6 A;  3SEI A;  2D3D A;  1SGG A;  4MHV A;  1X9X A;  2E8P A;  2E8N A;  3TAD A;  2Y9T A;  3TAC B;  3K1R B;  2B6G A;  2DL0 A;  2GLE A;  2KSO B;  2KSO A;  2D8C A;  2KE7 A;  1SV0 C;  2EAP A;  2DKX A;  4RQN A;  1OW5 A;  1UCV A;  1OXJ A;  2DKZ A;  5KNI A;  1RG6 A;  1X66 A;  1X40 A;  2KMD A;  2EAN A;  5L1M A;  2L5Y A;  5JU5 A;  2QB0 B;  2F3N A;  2JV3 A;  3BQ7 A;  1WWV A;  3H8M A;  1SV4 A;  2KG5 A;  2E8M A;  3IDW A;  2E8O A;  4NJ8 A;  3BS5 A;  1LKY A;  3KKA A;  1WWU A;  2FE9 A;  2LMR A;  5J8Y C;  2QB0 A;  3HIL A;  5J8Y A;  5JTI A;  5JRT A;  3TAD C;  2EAM A;  1B4F A;  1UQV A;  3SEN A;  1PK1 B;  3BS5 B;  4PZN A;  1KW4 A;  2LPE A;  5F3X B;  2EAO A;  4RQM A;  3BS7 A;  1F0M A;  2Y9U A;  2YTU A;  1V38 A;  2KIV A;  1PK3 A;  1COK A;  2QB1 A;  1LKY B;  2ESE A;  2QKQ A;  1PK1 A;  2K60 A;  2K4P A;  1SV0 A;  1Z1V A;  1DXS A;  2F8K A;  1B0X A;  1JI7 A;  2QAR B;  4NL9 C;  3KKA C;  1SXE A;  4PZO A;  2F44 A;  4NL9 A;  4IS7 A;  1V85 A;  2QAR A;  1SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...