4NJ8A

Crystal structure of the human anks3 sam domain l52a mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
RAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITAFGPKRKMTSAIARWHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 21
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nj8A01
1WWUA 2F8KA 4RQMA 3TACB 5L1MA 1SV0C 3IDWA 2JV3A 2KIVA 3TADC 3HILA 2E8OA 1SXDA 1X9XA 1F0MA 1SGGA 1B0XA 4NL9C 5J8YC 1LKYA 1V85A 2KSOB 1LKYB 3BS7A 4NJ8A 2ES6A 5JU5A 2EANA 2K60A 1UCVA 5F3XB 3SEIA 2E8PA 1SV4A 2F44A 2YTUA 2ESEA 1PK3A 1SXEA 1WWVA 2KSOA 2L5YA 2EAOA 2LMRA 2FE9A 2D8CA 1B4FA 2DL0A 3TADA 2EAPA 2LPEA 1X40A 2KMDA 2QKQA 4NL9A 2KE7A 3KKAA 3K1RB 3BS5A 5J8YA 2KG5A 1COKA 3BS5B 2E8NA 2DKXA 2QARA 4PZNA 2QARB 4PZOA 1RG6A 4MHVA 2K4PA 1DXSA 2GLEA 1UQVA 2D3DA 1V38A 2QB1A 4RQNA 2EAMA 1SV0A 5JRTA 2B6GA 2E8MA 2DKZA 5KNIA 2F3NA 1OXJA 1PK1A 1X66A 3H8MA 5JTIA 1OW5A 1KW4A 1PK1B 2Y9UA 3KKAC 3SENA 1Z1VA 2QB0A 1JI7A 2QB0B 2Y9TA 4IS7A 3BQ7A
chains in the Genus database with same CATH superfamily
3QX7A 3LVWA 5KFHA 2IA6A 2JZBB 2BPGA 5L1KA 1LVHA 4AYBC 2H3ZA 2KOBA 1V85A 4I29A 4Y2VA 4Z6CA 5AKHA 3C29A 5J0XA 3RJGA 1UCVA 5ALHA 3VC8A 3MR6A 4ICAA 3L4PA 1QSSA 3MR2A 5ALGA 2AU0A 2GOLA 2F1JA 1HEKA 1NJYA 3TARA 2LBOA 4PL2A 1N56A 5KFPA 4J9PA 4CNQA 2HVHA 3TADA 4FS2A 4MF2A 4YXJA 1SZHA 1CUKA 2WTFA 5IIMA 2KVSA 3HKZC 4DQIA 3Q8PB 9ICAA 4PGXA 3PNCA 4YR0A 1N63A 2DKXA 1Z4NA 2QARB 3RRHA 2JEGA 4F5OA 2NRVA 2GLEA 2YMMA 1Y88A 3F5AA 7ICFA 1V38A 3IM1A 4RQNA 4C4TA 2ZUDA 3KHLA 3HW8A 1T4GA 4UAVA 5BPCA 2RDJA 2B6GA 5ALFA 4UB3A 1OUQA 4UAUA 2XICA 4QWBA 5CWRA 4YMNA 1BNPA 4QWDA 3JPSA 3SAFA 4QZCA 3CRXA 3ETLA 1Z1VA 1FFUA 4C8LA 4DLGA 2W3RA 5J2KA 5KFWA 7ICSA 5J2FA 2LYAA 4US9A 5ALZA 4G9BA 3AL0B 5DG8A 1J97A 4J9KA 4ZOHC 1X9WA 5IILA 4C8NA 1XO0A 2Y1IA 8ICQA 5AKKA 4P2HA 8ICSA 2XY5A 3ZD8A 3JPRA 2NO5A 3MFIA 1N5WA 2FMPA 1N2XA 4R63A 2J6UA 5EWEA 3RH4A 5AI9A 1FO4A 2FPMA 2G0AA 4F2RA 2ZJ5A 1Q46A 3RR7A 4R66A 2F1IA 2IMWP 3G6YA 4Y2RA 4R64A 3MFHA 1S9FA 3TFRA 4F4ZA 2KSOA 3SQIA 2WAQF 3GFKB 2P6UA 3JPQA 4ECZA 5KFOA 2LPEA 2MAXA 2AJQA 8ICIA 2W54A 4FS1A 5T14A 2KJ8A 3BS5A 3SV4A 1L8LA 3AQEA 4UB2A 5A0LA 1L3VA 5KG0A 3Q8SB 4MHVA 4Y2SA 2K4PA 5E79U 3Q8LA 4O5EA 7ICLA 5HP4A 2PKEA 3GQCA 5KFDA 5J0PA 4DF4A 2VJ5A 5DGAA 5ALWA 1SV0A 8ICAA 2ZIVA 1ZQ1C 2H5XA 4UBCA 1O08A 4OJPA 3TQ1A 3G6VA 1D8LA 1SKWA 4BWMA 5HNKA 2ALZA 4EENA 3KD3A 2RLTA 1IM4A 4RQ4A 4ED0A 4PHEA 5DDMA 1U4BA 2KIWA 3ISBA 2G09A 1JXEA 4UAZA 4XA5A 2NO4A 2WHEA 3GIIA 1ZYQA 7ICMA 3GU3A 3TADC 2E8OA 4RQ1A 2WF9A 1Q3UA 5ALUA 3LWMA 3RB3A 1T94A 4UQGA 1ZQPA 4UAYA 1RM6C 4IRDA 4JUZA 3K1ZA 9ICLA 3B9JA 1JXLA 3E58A 3RJEA 2NRWA 1XU4A 3H8JA 3ORYA 2W8LA 3V7LA 3OJSA 3NVZA 4DOAA 4DWIA 2K4IA 4J9MA 1VJ5A 3AQFA 2XCAA 4DFPA 1WCNA 2H3FA 4C0ZA 2EAOA 4KLTA 4RNOA 2LM4A 4RQ6A 2YMPA 3PW4A 1TE2A 4F4YA 2Q4TA 4PHDA 3ED5A 2JGAA 3N7PD 3F2CA 3PX6A 3BZCA 5KFFA 3CYMA 3VCBA 2KJ5A 4Y2YA 2OWOA 1N5XA 2PI5A 2E8NA 3FAHA 2LI6A 4TQRA 1TK0A 2PFNA 4KITB 2AXTU 2G06A 2VIXA 5DB8A 2BDUA 1UHUA 2KNJA 1ZQLA 4MEXA 3PW7A 2QB1A 1KBUA 2RRDA 1SIJA 5JRTA 1NK0A 4DL4A 1QH9A 3AU6A 3PY8A 4ECWA 4C8MA 5AI5A 2BGWA 4IQWA 1OXJA 2KEYA 4DL2A 3KKAC 2BCQA 4NLBA 3I28A 1KSPA 1ZQCA 2A19A 5J0YA 3C5GA 4Y2TA 2FI1A 4DSLA 3LDAA 4RUAA 3TKAA 3NGDA 1ZQUA 1WYGA 2HHWA 2F8KA 1Q8KA 8ICNA 1XO1A 9ICVA 1BPYA 4I27A 2DPJA 2HMXA 1BGXT 3N7RC 2XO7A 3RB0A 2W11A 5AICA 4Z6EA 4ECQA 2ES6A 5ALXA 2JH1A 2OYYA 3C28A 2KKPA 5KFCA 4EZ6A 2F1HA 4KLHA 2XI9A 1SV4A 3N7SC 4BJQA 5AM5A 2YTUA 3ZI4A 4M9HA 4DO9A 3H8WA 4DQQA 2DWQA 4AYBF 1L7NA 5DQIA 3KHRA 5CJ7A 2HHTA 7ICKA 9ICBA 4J9LA 3I76A 2HW3A 2EQYA 5J2EA 2KE7A 1L7PA 4U6PA 4QZDA 1ZQJA 4YN4A 1J2NA 3F2DA 4YG2A 3S6JA 3SI8A 4J03A 3HP6A 2ZUCA 2HBKA 5DLFA 2JRZA 3THVA 1S0OA 5IIOA 2PI4A 2R8JA 2A1JA 3C2LA 4DL6A 1U47A 1TV9A 3M9OB 2KD1A 5KFMA 8ICWA 4GLXA 3FYHA 9ICXA 1SL1A 3HKZF 3PX0A 4I2DA 2EDUA 5GTIU 2LM1A 4PJ0U 4CRXA 1SKSA 4FFDA 3PV8A 1SL2A 1Z00A 1TAMA 8ICCA 2Y9TA 1MQ2A 1TKDA 1S8OA 3MDAA 1MA7A 2ASJA 2KHVA 1BPXA 2FJ6A 1HUZA 4EBEA 4YD2A 2R8KA 4Q44A 3T5JA 4US8A 3EPIA 4IRCA 2XCPA 3BQ1A 4PGYA 2KHQA 4XRHA 1X9MA 4NLKA 1S5LU 1NK4A 4WJ3B 3IP4B 9ICRA 4UATA 5KFRA 2W9AA 1ZQVA 2H3IA 8ICJA 1QLNA 2ZIWA 4F5QA 3H0RB 4O3QA 1TFRA 2BR0A 4IQVA 3EW9A 7ICVA 4P4PA 2F8LA 4PHAA 2DF4B 1SZPA 3HRDD 1DOQA 2UVRA 4ELTA 2ODGA 3H8SA 1ZQNA 4IL6U 1X40A 3SZ2A 2YMLA 2C2RA 4CF5A 4UB4A 1H38A 3BS5B 5KT3A 2ZTDA 5KT4A 3C23A 2W55A 2JH7A 4EEKA 3V7JA 5CHGA 3V7KA 1AROP 3PO4A 1T7PA 1DK2A 4QZHA 2ASLA 1KL9A 2ZIVB 2LYBA 3Q8RB 4O3SA 2KN7A 5DG7A 4EX6A 5DB6A 5KFUA 1QQ6A 4AP9A 1L3SA 2J6TA 1ZJMA 4UBBA 4KX5A 8ICXA 3WK5A 3PSIA 4JV0A 2QB0A 4MF8A 3JPNA 5TZVA 3PZPA 4HAIA 3PSPA 4M04A 3DDHA 2HBMA 2W7OA 4KLMA 3H4DA 1IV8A 2KIVA 3GV7B 5KT6A 4MFFA 4KLDA 1B0XA 4O3PA 4ECUA 3MC1A 1N61A 4DF8A 9ICGA 4C7ZA 5J0OA 9ICWA 3WU2U 2N1RA 4NM2A 3ZDDA 3BZKA 1HIWA 8ICBA 8ICMA 1ZQTA 2BDPA 1KEJA 2ZXIA 4P4OA 5ALSA 5F3XB 1N62A 1SL0A 7ICUA 4PGQA 4O3OA 2QLTA 5KG6A 4K4GA 4F50A 4B9VA 4FZNA 1WWVA 3H40A 2HVIA 1X42A 5D49A 5KG2A 2E1FA 2JEIA 5DLGA 1CRXA 2HOQA 4RU9A 2XY6A 2MUTA 2XGPA 3KZIU 3MGHA 1KFDA 2AH5A 5IIKA 2WF7A 1D9DA 1T3QA 3K1RB 4GC6A 1XS9D 5ALNA 4DL5A 3BDPA 4C8OA 5J0UA 1HUOA 3T5KA 4FBUA 3UQ0A 1NK5A 1UQVA 2D3DA 4M9GA 4QZEA 2G08A 4DSFA 4F71A 3F2BA 3CP8A 2OM6A 1ZQGA 4IR1A 2BQRA 4RQ3A 1ZQYA 4ECRA 3HPOA 3WKEA 4NY8A 5CEHA 1QCKA 2BKEA 3OHBA 4NLGA 1K5OA 1K1SA 2Y1JA 4QIWC 3BQ7A 3PMLA 1ZQFA 5AK6A 4RQMA 2E5SA 8ICZA 1SGGA 3C2KA 4F4WA 4MFAA 2BCVA 2C2DA 2OEHA 5KFKA 4YVZA 4MEYA 5KG3A 4ECVA 2ZUBA 5AI8A 1QQ7A 2AQ0A 4I2EA 3M8RA 5JUMA 3ZDEA 4Z6DA 5D4BA 9ICCA 3EUB2 4YXMA 1FIQA 8ICTA 4PL1A 1SXEA 5J2DA 4F5NA 5HHHA 1D8YA 1L7MA 2K89A 2FE9A 3WK7A 2FMQA 3OGUA 1ZD4A 4YD1A 5KG1A 3M7DA 3QU7A 1RPLA 2RHFA 3GDXA 4RNNA 1VDVA 4ELUA 3QXGA 4NL9A 4EZ9A 5KFYA 3NRWA 4OD0A 1ZQSA 3KKAA 1DGSA 5EWGA 5HMMA 3WKCA 4GIBA 5DG9A 1A0PA 1ZJNA 5AIAA 2CRXA 4M2YA 1DXSA 5KTQA 1ZQIA 4LJXA 1J2MA 2IHMA 3AU2A 3PR5B 2FLPA 4C8KA 2A1JB 3QUCA 1ED1A 3RR8A 3D2SA 2K4HA 1TK8A 3MDCA 2ZTCA 4DOBA 1JI7A 4M9LA 1ZQQA 2IHNA 5ALRA 5KFGA 1Z00B 3BQTA 2JEFA 1WWUA 1KQQA 3IN5A 3Q8QB 1T8EA 3KOOA 4OO1J 5ALTA 2F76X 1Z3EB 4R8UA 2ZG6A 2PFPA 1Z4OA 3HJEA 3FM9A 1QSYA 2OH2A 2P66A 2IBKA 3B0YA 3F5EA 4BDPA 1ZRMA 4KLFA 9ICMA 3ICXA 3RTVA 1ZQDA 4XUSA 5J2GA 7ICEA 1ZXIA 3RRGA 4OJ6A 5DDYA 5G5HA 2G5HB 4BGDA 4EELA 2GH1A 3EYZA 1S77D 4R65A 3UXPA 9ICOA 2KJ9A 4JV2A 2ZIWB 3RB4A 5ALDA 3H0MB 4I2JA 5EE1A 4I2IA 2KZZA 4DSEA 1L8OA 4NV0A 1UPHA 5IIIA 4DQSA 2JMGA 2PMZC 3M6ZA 4KLLA 5AKXA 2KG5A 3NS1A 3UXOA 5D46A 5TISU 1YZ6A 1RXWA 3QU2A 1COOA 2B21A 2W43A 2CN1A 5ALYA 4Z6FA 3UM9A 2GWSA 3SR6A 5ALPA 1UA0A 2EH9A 3ALRA 4F8RA 1RYRA 3Q8MA 1JX4A 5J29A 4M6WA 3KHHA 4KMOB 1KKXA 5B66U 1RDFA 2WF5A 5KFBA 1V97A 4ECXA 4C7YA 5AKZA 2RP5A 5DBCA 3QEAZ 2VKQA 4DOCA 2QB0B 5AI4A 3C1YA 4DQRA 1SWWA 1S76D 3ZDCA 4ED1A 3C5FA 4JMUA 4QNLA 4DLEA 2W3SA 2ZIXA 3HILA 5KFAA 1M6YA 1XSNA 1MC8A 3EZ5A 1EXNA 3AMZA 4Y2JA 2HDOA 4NL9C 3UXNA 4EBDA 4X5VA 1P7DA 4RPYA 3GV5B 5H2FU 4P0QA 4Q8EA 3MGVA 4DL7A 3ZDBA 4JWMA 2BPCA 1JUDA 5J0QA 2K8AA 3DV9A 4B9UA 3TFSA 3GIMA 3UPQA 5KFJA 3BJYA 2F44A 4ED2A 3E2EA 3WK4A 4A8EA 1RZTA 5C0YA 4RUCA 3ISCA 3IRUA 2G5IB 9ICFA 5DGBA 4U7CA 2WF8A 4DFJA 3I1YA 2MRLA 3GZFA 5AK3A 2MUTB 3NVWA 5AI0A 1AQ6A 4NXZA 4EEYA 3IHQB 1L7OA 4M0AA 5L1LA 4PZNA 4PZOA 1XSPA 4IR9A 2K4EA 2KKVA 3M6KA 4LZDA 1NK8A 4LVSA 9ICIA 5KT7A 1RQNA 1WG8A 5DBBA 3OSPA 4QZ8A 1NKEA 4RT3A 1SB3C 2VA2A 4J9QA 4KN7A 1MSWD 1PK1A 2EZZA 2MSNA 5L9XA 1OW5A 2DFLA 2W9MA 3PO5A 5AM3A 1XNSA 4ECYA 9ICHA 2HOFA 1U9LA 2ZJ8A 2BQ3A 2FLNA 3SMVA 5IINA 5AM1A 3TACB 5L1MA 8ICLA 1L3UA 1NJXA 3RJHA 3D2QA 2HI0A 1QQ5A 5J0WA 5L1JA 2NYVA 2XVTA 2NRXA 1C20A 5KT2A 1C7YA 5EWFA 4NJ8A 2AGOA 4JV1A 4QZIA 1N60A 4F4KA 4ED6A 1RXVA 4FZLA 3QU5A 3PR4A 5KFQA 3QYPA 2C2EA 2MU2A 4QIWF 3RAXA 4YQWA 4KTQA 7ICPA 3FC4A 2HSZA 9ICSA 3KBBA 2YY6A 3U26A 7ICQA 3H7IA 7ICHA 2XY7A 3N28A 3WK6A 2VA3A 5CRXA 2IOHA 1IIPA 8ICVA 5HMLA 1ECWA 3ETRA 5J0TA 4RQ0A 1S10A 2QKQA 5AKLA 5J8YA 1NNLA 4DEZA 2DQNB 4O3MA 5KFTA 3ONNA 4UW9A 4KLGA 3LYSA 4GXKA 2ASDA 1U48A 2V4RA 4YMOA 2EAMA 2M9NA 1ZQKA 3OJUA 5KG7A 3J81j 3AUOA 2KFNA 3RH5A 3LWLA 4OJ5A 3HWTA 2XGQA 3RBDA 1KW4A 2R8HA 2IOFA 2YX8A 3T79A 1JALA 1KDHA 5ALLA 4HYKA 5ALOA 1NK7A 3M8SA 4OJOA 3RB6A 2BZFA 3PSFA 2K8BB 3EPGA 4YR2A 3HT3A 1NI3A 4RQ5A 1SXDA 1X9XA 5AI6A 5C5JA 3PW0A 5AKIA 4R8UB 3GIJA 4F91B 4B9SA 1A76A 1TAUA 5AM4A 3KZXA 4O5KA 2BHNA 1V9PA 4K4HA 5KFSA 4EYIB 3CW2C 4JK1A 3WK9A 4EBCA 9ICTA 4ZH4A 3QNMA 4YCXA 5ALEA 4PPXA 3AEVA 3OTQA 4I2CA 5KFXA 3FDSA 4DQPA 2Z7JA 1WUDA 1HJPA 3TAPA 3KHGA 1UT5A 2LMRA 2C22A 4NLCA 4KLQA 3KTQA 1MN8A 3GIKA 2DL0A 4ECSA 4JWNA 3AN1A 3L3FX 2HHXA 5IIJA 4ED3A 3GV8B 2FPKA 1ZQRA 4TUQA 4CGZA 3PW2A 3ISDA 3D6JA 4USAA 3N97B 5ALKA 4B9NA 4BX9C 2V4QA 5AK5A 1X9SA 3O0FA 2W9BA 3V6JA 3RF9A 1LB2B 2W9CA 1UA1A 3H0LB 3RH6A 2KZMA 5F9NA 4UB5A 7ICGA 1FEZA 5KL8B 4F92B 3M1YA 2BCSA 1NZBA 2CXYA 2PMZF 4M6WB 1NJZA 3M9MB 2LKYA 3LK9A 2ZTEA 1ZRNA 4ED7A 3PMNA 2PFQA 1CI4A 3RBEA 4C4RA 3PX4A 2YQEA 2ISPA 3RJFA 3A0BU 2BPFA 2FMSA 1NKBA 2BCUA 5ALIA 2ZIXB 3WKAA 1ZQOA 4MFCA 2R18A 9ICJA 2FPLA 1S0VA 2KK0A 5J8YC 1LKYA 1PVQA 1NK6A 3PW5A 1S97A 3UMCA 4P0QB 1BPBA 4YFKA 1BPZA 2KZ3A 4I2FA 3IG8A 1QTMA 2Y0SC 1NK9A 4CF4A 2E8PA 5KFZA 8ICUA 2XC9A 4Q45A 4Q8FA 2RDIA 1PK3A 1ZQBA 4UB1A 4I28A 3M9NB 2D8CA 2UVUA 3TAQA 4QWAA 3V72A 4TUPA 3R9KA 4CDGA 1U49A 1X6JA 3UMBA 2ATLA 1RYSA 4F72A 5DQHA 4I2AA 4P0PA 5KFLA 1BPDA 4M47A 1COKA 1XSLA 4DS4A 4JB3A 3UQ2A 2OXOA 3C2MA 3SAHA 1NZPA 2EZYA 5L1IA 2R8IA 4Y2QA 4UASA 4TURA 4B9MA 2IOFK 3H4BA 4ACOA 1KTQA 3EWAA 7ICJA 2YMQA 2ZIUA 2I9GA 5J0SA 1X66A 3H8MA 5AHXA 1PK1B 2JR5A 9ICEA 2FDRA 1IG6A 2YN4A 2NV3A 4QZBA 2VA8A 1CEZA 3K75D 2I6XA 5HR7A 3V6KA 4I2BA 3IDWA 3QZ8A 3QUQA 1ZD5A 1ZD3A 2UVVA 4FO6A 4KLUA 3C21A 2AGPA 1BNOA 2RQ5A 4BXOB 4B6JA 8ICGA 2NRTA 1DGJA 1RYUA 5AIBA 1T3NA 3BS7A 4I2HA 4GXJA 2E3TA 4E0DA 2W03A 1Z19A 4J9NA 4B9LA 4EX7A 5CP2A 3WKBA 1L6NA 1O03A 2ESEA 4I2GA 3NASA 3JPTA 1A6SA 2E1EA 3QU9A 3BQ2A 2HHQA 2OHFA 5EE0A 4QZ9A 5KAFU 1A77A 2JHDA 5J2JA 1Q3VA 4ECTA 4NWIA 3ZD9A 1ZQZA 4GFJA 3GILA 2KMDA 4KX3A 2WB1C 3MBYA 1XWLA 1L3TA 3LVVA 1PVRA 2H3QA 3F53A 4QWCA 5J2HA 1MQ3A 4NM1A 5AM2A 2DPIA 1ZD2P 4QJFB 3JPOA 8ICEA 4XQ8A 2F77X 4KMUA 5DKWA 2DKZA 5EOZA 5GTHU 4DFMA 1BPEA 1NKCA 2KVCA 4KLEA 5KT5A 3SENA 4KLJA 3A0HU 2H3VA 5CB1A 3PSTA 1URJA 3T5LA 5ALQA 1PUZA 4O9MA 2HBLA 4RPXA 2JZBA 4EYHB 1D9FA 4J9OA 3N4MB 3MR5A 3OSNA 4KLSA 3PVXA 4RPZA 1PZNA 4F5PA 1KFTA 3RFAA 4QWEA 3Q8KA 4QW8A 4YP3A 4F2SA 3QU4A 4DSJA 4J9SA 2I5HA 2Q0ZX 1NOMA 5ALJA 8ICHA 2EANA 2WF6A 3ZDAA 1YZ7A 3WK8A 2K60A 3SV3A 3QE9Y 5DB9A 4RT2A 3QUTA 2HHVA 1DRGA 3NVYA 4NLZA 2EZXA 2L5YA 2PXIA 7ICRA 1B43A 4O3NA 3T3FA 1SKRA 1B4FA 4QZFA 4Q43A 5AKYA 4GC7A 8ICFA 1S0NA 5J0RA 2PFOA 3DEEA 4DCCA 4RZRA 5HR6A 3G6XA 5F9LA 2JEJA 2QARA 5AKEA 2W9BB 4BWJA 5DB7A 2HHUA 1L5UA 2W04A 7ICNA 1Z1BA 5KFVA 2I1QA 5EE3A 5AK4A 2M0NA 4Y2UA 5KAIU 2W9CB 2DGZA 1ZQAA 2DUYA 4UB8U 1TK5A 5G5GA 4FZMA 3JPPA 3BQ0A 3OHAA 5K4LA 1ZQMA 1XC9A 3NTUA 4C4SA 4BUGA 7ICTA 1BVSA 3RJKA 4RQ8A 5EE9A 4G3IA 1ZOLA 4IC9A 1JN3A 1JRPA 2VANA 2KTQA 5AKJA 3AM9A 2P6RA 1IXRA 7ICIA 2CPRA 4DS5A 3L5KA 9ICQA 1SV0C 4PHPA 3E0FA 3SAGA 2W7PA 2AGQA 2HHSA 2G07A 4F3OA 4ED8A 1KN5A 4P4MA 2GO7A 2F2AB 2WAQC 4QZAA 5AKGA 2D6FC 5BOLA 5J2CA 1LKYB 4KN4A 1GO3F 2HBJA 4LZGA 2BQUA 3HX0A 2O6KA 3TI0A 4PH5A 4C80A 1YT3A 4YR3A 1KFSA 4DFDA 2ZXHA 1B22A 2KICA 4UARA 3NRZA 2ISOA 1SWVA 4RQ7A 2P35A 2KP7A 4RQ2A 2BCRA 1K1QA 4BXOA 5ALMA 1S0MA 2V9WA 4KLIA 3B0XA 1KLNA 3MABA 2A1AA 5KFIA 4UB6U 4IQTA 4FE3A 1ZQWA 4P0PB 3RAQA 4YMMA 2DBYA 2YB1A 4TQSA 2Y0SF 4Y2PA 5KG5A 5J2IA 5KFEA 4O3RA 4M9JA 3SD7A 2XIDA 3NVVA 1ZQHA 2R8GA 5CR0A 3T5HA 2UVWA 3TANA 2E8MA 5B5EU 5DBAA 5KFNA 2F3NA 1KRPA 2OCEA 2ZJAA 4IRKA 2JXJA 2ZIUB 1F44A 1LV5A 4F93B 2KV2A 4OCZA 5J2BA 4RNMA 5KL1B 1UT8A 2K8CB 2B0CA 4IS7A 9ICPA 2HOIA 1N48A 1F5SA 3SYZA 5BOMA 2JV3A 8ICKA 1F0MA 1ZQXA 4UAWA 2LHTA 1TVAA 3KFUF 3MGIA 8ICPA 7ICOA 4IQUA 1DK3A 2KSOB 2W8KA 3D2NA 1D8BA 1PVPA 3NUQA 1X6IA 5JU5A 5FP0A 3IV6A 2MA1A 5J2AA 4DFKA 8ICYA 3SEIA 1VLBA 4KLOA 2YB4A 4CF3A 2WFAA 3OPXA 3RJJA 9ICKA 2AHOB 4CCHA 4QZGA 2HCFA 3QEBZ 1RQLA 3K4GA 4DSIA 4K4IA 4TUSA 8ICRA 1FFVA 2AQ4A 2J6SA 2EAPA 5KG4A 4FBTA 4DL3A 1ZQEA 5ALVA 4QW9A 2VJ4A 2C28A 9ICNA 3CNHA 1WCLA 2A3VA 5HHIA 3QUBA 1JIHA 1RG6A 4O0IA 2KFZA 4O5CA 1U45A 3WKDA 4J9RA 4CE6A 4F5RA 1JMSA 3C1ZA 3IG5A 2NRZA 4M9NA 1JROA 4OJLA 5KNIA 1QSLA 5DQGA 4B9TA 4Y2XA 3QZ7A 3V6HA 1NJWA 2LYHA 5AM0A 8ICOA 3UMGA 5JTIA 2Y9UA 3MR3A 4GXIA 1ZETA 2WB1F 4DSKA 4ELVA 1X2IA 3RJIA 1TAQA 2FLLA 4NLNA 5CA7A 4F4XA 9ICUA
chains in the Genus database with same CATH topology
1WWUA 2F8KA 4RQMA 3TACB 5L1MA 1SV0C 3IDWA 2JV3A 2KIVA 3TADC 3HILA 2E8OA 1SXDA 1X9XA 1F0MA 1SGGA 1B0XA 4NL9C 5J8YC 1LKYA 1V85A 2KSOB 1LKYB 3BS7A 4NJ8A 2ES6A 5JU5A 2EANA 2K60A 1UCVA 5F3XB 3SEIA 2E8PA 1SV4A 2F44A 2YTUA 2ESEA 1PK3A 1SXEA 1WWVA 2KSOA 2L5YA 2EAOA 2LMRA 2FE9A 2D8CA 1B4FA 2DL0A 3TADA 2EAPA 2LPEA 1X40A 2KMDA 2QKQA 4NL9A 2KE7A 3KKAA 3K1RB 3BS5A 5J8YA 2KG5A 1COKA 3BS5B 2E8NA 2DKXA 2QARA 4PZNA 2QARB 4PZOA 1RG6A 4MHVA 2K4PA 1DXSA 2GLEA 1UQVA 2D3DA 1V38A 2QB1A 4RQNA 2EAMA 1SV0A 5JRTA 2B6GA 2E8MA 2DKZA 5KNIA 2F3NA 1OXJA 1PK1A 1X66A 3H8MA 5JTIA 1OW5A 1KW4A 1PK1B 2Y9UA 3KKAC 3SENA 1Z1VA 2QB0A 1JI7A 2QB0B 2Y9TA 4IS7A 3BQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWU A;  2F8K A;  4RQM A;  3TAC B;  5L1M A;  1SV0 C;  3IDW A;  2JV3 A;  2KIV A;  3TAD C;  3HIL A;  2E8O A;  1SXD A;  1X9X A;  1F0M A;  1SGG A;  1B0X A;  4NL9 C;  5J8Y C;  1LKY A;  1V85 A;  2KSO B;  1LKY B;  3BS7 A;  4NJ8 A;  2ES6 A;  5JU5 A;  2EAN A;  2K60 A;  1UCV A;  5F3X B;  3SEI A;  2E8P A;  1SV4 A;  2F44 A;  2YTU A;  2ESE A;  1PK3 A;  1SXE A;  1WWV A;  2KSO A;  2L5Y A;  2EAO A;  2LMR A;  2FE9 A;  2D8C A;  1B4F A;  2DL0 A;  3TAD A;  2EAP A;  2LPE A;  1X40 A;  2KMD A;  2QKQ A;  4NL9 A;  2KE7 A;  3KKA A;  3K1R B;  3BS5 A;  5J8Y A;  2KG5 A;  1COK A;  3BS5 B;  2E8N A;  2DKX A;  2QAR A;  4PZN A;  2QAR B;  4PZO A;  1RG6 A;  4MHV A;  2K4P A;  1DXS A;  2GLE A;  1UQV A;  2D3D A;  1V38 A;  2QB1 A;  4RQN A;  2EAM A;  1SV0 A;  5JRT A;  2B6G A;  2E8M A;  2DKZ A;  5KNI A;  2F3N A;  1OXJ A;  1PK1 A;  1X66 A;  3H8M A;  5JTI A;  1OW5 A;  1KW4 A;  1PK1 B;  2Y9U A;  3KKA C;  3SEN A;  1Z1V A;  2QB0 A;  1JI7 A;  2QB0 B;  2Y9T A;  4IS7 A;  3BQ7 A; 
#chains in the Genus database with same CATH topology
 3QX7 A;  3LVW A;  5KFH A;  2IA6 A;  2JZB B;  2BPG A;  5L1K A;  1LVH A;  4AYB C;  2H3Z A;  2KOB A;  1V85 A;  4I29 A;  4Y2V A;  4Z6C A;  5AKH A;  3C29 A;  5J0X A;  3RJG A;  1UCV A;  5ALH A;  3VC8 A;  3MR6 A;  4ICA A;  3L4P A;  1QSS A;  3MR2 A;  5ALG A;  2AU0 A;  2GOL A;  2F1J A;  1HEK A;  1NJY A;  3TAR A;  2LBO A;  4PL2 A;  1N56 A;  5KFP A;  4J9P A;  4CNQ A;  2HVH A;  3TAD A;  4FS2 A;  4MF2 A;  4YXJ A;  1SZH A;  1CUK A;  2WTF A;  5IIM A;  2KVS A;  3HKZ C;  4DQI A;  3Q8P B;  9ICA A;  4PGX A;  3PNC A;  4YR0 A;  1N63 A;  2DKX A;  1Z4N A;  2QAR B;  3RRH A;  2JEG A;  4F5O A;  2NRV A;  2GLE A;  2YMM A;  1Y88 A;  3F5A A;  7ICF A;  1V38 A;  3IM1 A;  4RQN A;  4C4T A;  2ZUD A;  3KHL A;  3HW8 A;  1T4G A;  4UAV A;  5BPC A;  2RDJ A;  2B6G A;  5ALF A;  4UB3 A;  1OUQ A;  4UAU A;  2XIC A;  4QWB A;  5CWR A;  4YMN A;  1BNP A;  4QWD A;  3JPS A;  3SAF A;  4QZC A;  3CRX A;  3ETL A;  1Z1V A;  1FFU A;  4C8L A;  4DLG A;  2W3R A;  5J2K A;  5KFW A;  7ICS A;  5J2F A;  2LYA A;  4US9 A;  5ALZ A;  4G9B A;  3AL0 B;  5DG8 A;  1J97 A;  4J9K A;  4ZOH C;  1X9W A;  5IIL A;  4C8N A;  1XO0 A;  2Y1I A;  8ICQ A;  5AKK A;  4P2H A;  8ICS A;  2XY5 A;  3ZD8 A;  3JPR A;  2NO5 A;  3MFI A;  1N5W A;  2FMP A;  1N2X A;  4R63 A;  2J6U A;  5EWE A;  3RH4 A;  5AI9 A;  1FO4 A;  2FPM A;  2G0A A;  4F2R A;  2ZJ5 A;  1Q46 A;  3RR7 A;  4R66 A;  2F1I A;  2IMW P;  3G6Y A;  4Y2R A;  4R64 A;  3MFH A;  1S9F A;  3TFR A;  4F4Z A;  2KSO A;  3SQI A;  2WAQ F;  3GFK B;  2P6U A;  3JPQ A;  4ECZ A;  5KFO A;  2LPE A;  2MAX A;  2AJQ A;  8ICI A;  2W54 A;  4FS1 A;  5T14 A;  2KJ8 A;  3BS5 A;  3SV4 A;  1L8L A;  3AQE A;  4UB2 A;  5A0L A;  1L3V A;  5KG0 A;  3Q8S B;  4MHV A;  4Y2S A;  2K4P A;  5E79 U;  3Q8L A;  4O5E A;  7ICL A;  5HP4 A;  2PKE A;  3GQC A;  5KFD A;  5J0P A;  4DF4 A;  2VJ5 A;  5DGA A;  5ALW A;  1SV0 A;  8ICA A;  2ZIV A;  1ZQ1 C;  2H5X A;  4UBC A;  1O08 A;  4OJP A;  3TQ1 A;  3G6V A;  1D8L A;  1SKW A;  4BWM A;  5HNK A;  2ALZ A;  4EEN A;  3KD3 A;  2RLT A;  1IM4 A;  4RQ4 A;  4ED0 A;  4PHE A;  5DDM A;  1U4B A;  2KIW A;  3ISB A;  2G09 A;  1JXE A;  4UAZ A;  4XA5 A;  2NO4 A;  2WHE A;  3GII A;  1ZYQ A;  7ICM A;  3GU3 A;  3TAD C;  2E8O A;  4RQ1 A;  2WF9 A;  1Q3U A;  5ALU A;  3LWM A;  3RB3 A;  1T94 A;  4UQG A;  1ZQP A;  4UAY A;  1RM6 C;  4IRD A;  4JUZ A;  3K1Z A;  9ICL A;  3B9J A;  1JXL A;  3E58 A;  3RJE A;  2NRW A;  1XU4 A;  3H8J A;  3ORY A;  2W8L A;  3V7L A;  3OJS A;  3NVZ A;  4DOA A;  4DWI A;  2K4I A;  4J9M A;  1VJ5 A;  3AQF A;  2XCA A;  4DFP A;  1WCN A;  2H3F A;  4C0Z A;  2EAO A;  4KLT A;  4RNO A;  2LM4 A;  4RQ6 A;  2YMP A;  3PW4 A;  1TE2 A;  4F4Y A;  2Q4T A;  4PHD A;  3ED5 A;  2JGA A;  3N7P D;  3F2C A;  3PX6 A;  3BZC A;  5KFF A;  3CYM A;  3VCB A;  2KJ5 A;  4Y2Y A;  2OWO A;  1N5X A;  2PI5 A;  2E8N A;  3FAH A;  2LI6 A;  4TQR A;  1TK0 A;  2PFN A;  4KIT B;  2AXT U;  2G06 A;  2VIX A;  5DB8 A;  2BDU A;  1UHU A;  2KNJ A;  1ZQL A;  4MEX A;  3PW7 A;  2QB1 A;  1KBU A;  2RRD A;  1SIJ A;  5JRT A;  1NK0 A;  4DL4 A;  1QH9 A;  3AU6 A;  3PY8 A;  4ECW A;  4C8M A;  5AI5 A;  2BGW A;  4IQW A;  1OXJ A;  2KEY A;  4DL2 A;  3KKA C;  2BCQ A;  4NLB A;  3I28 A;  1KSP A;  1ZQC A;  2A19 A;  5J0Y A;  3C5G A;  4Y2T A;  2FI1 A;  4DSL A;  3LDA A;  4RUA A;  3TKA A;  3NGD A;  1ZQU A;  1WYG A;  2HHW A;  2F8K A;  1Q8K A;  8ICN A;  1XO1 A;  9ICV A;  1BPY A;  4I27 A;  2DPJ A;  2HMX A;  1BGX T;  3N7R C;  2XO7 A;  3RB0 A;  2W11 A;  5AIC A;  4Z6E A;  4ECQ A;  2ES6 A;  5ALX A;  2JH1 A;  2OYY A;  3C28 A;  2KKP A;  5KFC A;  4EZ6 A;  2F1H A;  4KLH A;  2XI9 A;  1SV4 A;  3N7S C;  4BJQ A;  5AM5 A;  2YTU A;  3ZI4 A;  4M9H A;  4DO9 A;  3H8W A;  4DQQ A;  2DWQ A;  4AYB F;  1L7N A;  5DQI A;  3KHR A;  5CJ7 A;  2HHT A;  7ICK A;  9ICB A;  4J9L A;  3I76 A;  2HW3 A;  2EQY A;  5J2E A;  2KE7 A;  1L7P A;  4U6P A;  4QZD A;  1ZQJ A;  4YN4 A;  1J2N A;  3F2D A;  4YG2 A;  3S6J A;  3SI8 A;  4J03 A;  3HP6 A;  2ZUC A;  2HBK A;  5DLF A;  2JRZ A;  3THV A;  1S0O A;  5IIO A;  2PI4 A;  2R8J A;  2A1J A;  3C2L A;  4DL6 A;  1U47 A;  1TV9 A;  3M9O B;  2KD1 A;  5KFM A;  8ICW A;  4GLX A;  3FYH A;  9ICX A;  1SL1 A;  3HKZ F;  3PX0 A;  4I2D A;  2EDU A;  5GTI U;  2LM1 A;  4PJ0 U;  4CRX A;  1SKS A;  4FFD A;  3PV8 A;  1SL2 A;  1Z00 A;  1TAM A;  8ICC A;  2Y9T A;  1MQ2 A;  1TKD A;  1S8O A;  3MDA A;  1MA7 A;  2ASJ A;  2KHV A;  1BPX A;  2FJ6 A;  1HUZ A;  4EBE A;  4YD2 A;  2R8K A;  4Q44 A;  3T5J A;  4US8 A;  3EPI A;  4IRC A;  2XCP A;  3BQ1 A;  4PGY A;  2KHQ A;  4XRH A;  1X9M A;  4NLK A;  1S5L U;  1NK4 A;  4WJ3 B;  3IP4 B;  9ICR A;  4UAT A;  5KFR A;  2W9A A;  1ZQV A;  2H3I A;  8ICJ A;  1QLN A;  2ZIW A;  4F5Q A;  3H0R B;  4O3Q A;  1TFR A;  2BR0 A;  4IQV A;  3EW9 A;  7ICV A;  4P4P A;  2F8L A;  4PHA A;  2DF4 B;  1SZP A;  3HRD D;  1DOQ A;  2UVR A;  4ELT A;  2ODG A;  3H8S A;  1ZQN A;  4IL6 U;  1X40 A;  3SZ2 A;  2YML A;  2C2R A;  4CF5 A;  4UB4 A;  1H38 A;  3BS5 B;  5KT3 A;  2ZTD A;  5KT4 A;  3C23 A;  2W55 A;  2JH7 A;  4EEK A;  3V7J A;  5CHG A;  3V7K A;  1ARO P;  3PO4 A;  1T7P A;  1DK2 A;  4QZH A;  2ASL A;  1KL9 A;  2ZIV B;  2LYB A;  3Q8R B;  4O3S A;  2KN7 A;  5DG7 A;  4EX6 A;  5DB6 A;  5KFU A;  1QQ6 A;  4AP9 A;  1L3S A;  2J6T A;  1ZJM A;  4UBB A;  4KX5 A;  8ICX A;  3WK5 A;  3PSI A;  4JV0 A;  2QB0 A;  4MF8 A;  3JPN A;  5TZV A;  3PZP A;  4HAI A;  3PSP A;  4M04 A;  3DDH A;  2HBM A;  2W7O A;  4KLM A;  3H4D A;  1IV8 A;  2KIV A;  3GV7 B;  5KT6 A;  4MFF A;  4KLD A;  1B0X A;  4O3P A;  4ECU A;  3MC1 A;  1N61 A;  4DF8 A;  9ICG A;  4C7Z A;  5J0O A;  9ICW A;  3WU2 U;  2N1R A;  4NM2 A;  3ZDD A;  3BZK A;  1HIW A;  8ICB A;  8ICM A;  1ZQT A;  2BDP A;  1KEJ A;  2ZXI A;  4P4O A;  5ALS A;  5F3X B;  1N62 A;  1SL0 A;  7ICU A;  4PGQ A;  4O3O A;  2QLT A;  5KG6 A;  4K4G A;  4F50 A;  4B9V A;  4FZN A;  1WWV A;  3H40 A;  2HVI A;  1X42 A;  5D49 A;  5KG2 A;  2E1F A;  2JEI A;  5DLG A;  1CRX A;  2HOQ A;  4RU9 A;  2XY6 A;  2MUT A;  2XGP A;  3KZI U;  3MGH A;  1KFD A;  2AH5 A;  5IIK A;  2WF7 A;  1D9D A;  1T3Q A;  3K1R B;  4GC6 A;  1XS9 D;  5ALN A;  4DL5 A;  3BDP A;  4C8O A;  5J0U A;  1HUO A;  3T5K A;  4FBU A;  3UQ0 A;  1NK5 A;  1UQV A;  2D3D A;  4M9G A;  4QZE A;  2G08 A;  4DSF A;  4F71 A;  3F2B A;  3CP8 A;  2OM6 A;  1ZQG A;  4IR1 A;  2BQR A;  4RQ3 A;  1ZQY A;  4ECR A;  3HPO A;  3WKE A;  4NY8 A;  5CEH A;  1QCK A;  2BKE A;  3OHB A;  4NLG A;  1K5O A;  1K1S A;  2Y1J A;  4QIW C;  3BQ7 A;  3PML A;  1ZQF A;  5AK6 A;  4RQM A;  2E5S A;  8ICZ A;  1SGG A;  3C2K A;  4F4W A;  4MFA A;  2BCV A;  2C2D A;  2OEH A;  5KFK A;  4YVZ A;  4MEY A;  5KG3 A;  4ECV A;  2ZUB A;  5AI8 A;  1QQ7 A;  2AQ0 A;  4I2E A;  3M8R A;  5JUM A;  3ZDE A;  4Z6D A;  5D4B A;  9ICC A;  3EUB 2;  4YXM A;  1FIQ A;  8ICT A;  4PL1 A;  1SXE A;  5J2D A;  4F5N A;  5HHH A;  1D8Y A;  1L7M A;  2K89 A;  2FE9 A;  3WK7 A;  2FMQ A;  3OGU A;  1ZD4 A;  4YD1 A;  5KG1 A;  3M7D A;  3QU7 A;  1RPL A;  2RHF A;  3GDX A;  4RNN A;  1VDV A;  4ELU A;  3QXG A;  4NL9 A;  4EZ9 A;  5KFY A;  3NRW A;  4OD0 A;  1ZQS A;  3KKA A;  1DGS A;  5EWG A;  5HMM A;  3WKC A;  4GIB A;  5DG9 A;  1A0P A;  1ZJN A;  5AIA A;  2CRX A;  4M2Y A;  1DXS A;  5KTQ A;  1ZQI A;  4LJX A;  1J2M A;  2IHM A;  3AU2 A;  3PR5 B;  2FLP A;  4C8K A;  2A1J B;  3QUC A;  1ED1 A;  3RR8 A;  3D2S A;  2K4H A;  1TK8 A;  3MDC A;  2ZTC A;  4DOB A;  1JI7 A;  4M9L A;  1ZQQ A;  2IHN A;  5ALR A;  5KFG A;  1Z00 B;  3BQT A;  2JEF A;  1WWU A;  1KQQ A;  3IN5 A;  3Q8Q B;  1T8E A;  3KOO A;  4OO1 J;  5ALT A;  2F76 X;  1Z3E B;  4R8U A;  2ZG6 A;  2PFP A;  1Z4O A;  3HJE A;  3FM9 A;  1QSY A;  2OH2 A;  2P66 A;  2IBK A;  3B0Y A;  3F5E A;  4BDP A;  1ZRM A;  4KLF A;  9ICM A;  3ICX A;  3RTV A;  1ZQD A;  4XUS A;  5J2G A;  7ICE A;  1ZXI A;  3RRG A;  4OJ6 A;  5DDY A;  5G5H A;  2G5H B;  4BGD A;  4EEL A;  2GH1 A;  3EYZ A;  1S77 D;  4R65 A;  3UXP A;  9ICO A;  2KJ9 A;  4JV2 A;  2ZIW B;  3RB4 A;  5ALD A;  3H0M B;  4I2J A;  5EE1 A;  4I2I A;  2KZZ A;  4DSE A;  1L8O A;  4NV0 A;  1UPH A;  5III A;  4DQS A;  2JMG A;  2PMZ C;  3M6Z A;  4KLL A;  5AKX A;  2KG5 A;  3NS1 A;  3UXO A;  5D46 A;  5TIS U;  1YZ6 A;  1RXW A;  3QU2 A;  1COO A;  2B21 A;  2W43 A;  2CN1 A;  5ALY A;  4Z6F A;  3UM9 A;  2GWS A;  3SR6 A;  5ALP A;  1UA0 A;  2EH9 A;  3ALR A;  4F8R A;  1RYR A;  3Q8M A;  1JX4 A;  5J29 A;  4M6W A;  3KHH A;  4KMO B;  1KKX A;  5B66 U;  1RDF A;  2WF5 A;  5KFB A;  1V97 A;  4ECX A;  4C7Y A;  5AKZ A;  2RP5 A;  5DBC A;  3QEA Z;  2VKQ A;  4DOC A;  2QB0 B;  5AI4 A;  3C1Y A;  4DQR A;  1SWW A;  1S76 D;  3ZDC A;  4ED1 A;  3C5F A;  4JMU A;  4QNL A;  4DLE A;  2W3S A;  2ZIX A;  3HIL A;  5KFA A;  1M6Y A;  1XSN A;  1MC8 A;  3EZ5 A;  1EXN A;  3AMZ A;  4Y2J A;  2HDO A;  4NL9 C;  3UXN A;  4EBD A;  4X5V A;  1P7D A;  4RPY A;  3GV5 B;  5H2F U;  4P0Q A;  4Q8E A;  3MGV A;  4DL7 A;  3ZDB A;  4JWM A;  2BPC A;  1JUD A;  5J0Q A;  2K8A A;  3DV9 A;  4B9U A;  3TFS A;  3GIM A;  3UPQ A;  5KFJ A;  3BJY A;  2F44 A;  4ED2 A;  3E2E A;  3WK4 A;  4A8E A;  1RZT A;  5C0Y A;  4RUC A;  3ISC A;  3IRU A;  2G5I B;  9ICF A;  5DGB A;  4U7C A;  2WF8 A;  4DFJ A;  3I1Y A;  2MRL A;  3GZF A;  5AK3 A;  2MUT B;  3NVW A;  5AI0 A;  1AQ6 A;  4NXZ A;  4EEY A;  3IHQ B;  1L7O A;  4M0A A;  5L1L A;  4PZN A;  4PZO A;  1XSP A;  4IR9 A;  2K4E A;  2KKV A;  3M6K A;  4LZD A;  1NK8 A;  4LVS A;  9ICI A;  5KT7 A;  1RQN A;  1WG8 A;  5DBB A;  3OSP A;  4QZ8 A;  1NKE A;  4RT3 A;  1SB3 C;  2VA2 A;  4J9Q A;  4KN7 A;  1MSW D;  1PK1 A;  2EZZ A;  2MSN A;  5L9X A;  1OW5 A;  2DFL A;  2W9M A;  3PO5 A;  5AM3 A;  1XNS A;  4ECY A;  9ICH A;  2HOF A;  1U9L A;  2ZJ8 A;  2BQ3 A;  2FLN A;  3SMV A;  5IIN A;  5AM1 A;  3TAC B;  5L1M A;  8ICL A;  1L3U A;  1NJX A;  3RJH A;  3D2Q A;  2HI0 A;  1QQ5 A;  5J0W A;  5L1J A;  2NYV A;  2XVT A;  2NRX A;  1C20 A;  5KT2 A;  1C7Y A;  5EWF A;  4NJ8 A;  2AGO A;  4JV1 A;  4QZI A;  1N60 A;  4F4K A;  4ED6 A;  1RXV A;  4FZL A;  3QU5 A;  3PR4 A;  5KFQ A;  3QYP A;  2C2E A;  2MU2 A;  4QIW F;  3RAX A;  4YQW A;  4KTQ A;  7ICP A;  3FC4 A;  2HSZ A;  9ICS A;  3KBB A;  2YY6 A;  3U26 A;  7ICQ A;  3H7I A;  7ICH A;  2XY7 A;  3N28 A;  3WK6 A;  2VA3 A;  5CRX A;  2IOH A;  1IIP A;  8ICV A;  5HML A;  1ECW A;  3ETR A;  5J0T A;  4RQ0 A;  1S10 A;  2QKQ A;  5AKL A;  5J8Y A;  1NNL A;  4DEZ A;  2DQN B;  4O3M A;  5KFT A;  3ONN A;  4UW9 A;  4KLG A;  3LYS A;  4GXK A;  2ASD A;  1U48 A;  2V4R A;  4YMO A;  2EAM A;  2M9N A;  1ZQK A;  3OJU A;  5KG7 A;  3J81 j;  3AUO A;  2KFN A;  3RH5 A;  3LWL A;  4OJ5 A;  3HWT A;  2XGQ A;  3RBD A;  1KW4 A;  2R8H A;  2IOF A;  2YX8 A;  3T79 A;  1JAL A;  1KDH A;  5ALL A;  4HYK A;  5ALO A;  1NK7 A;  3M8S A;  4OJO A;  3RB6 A;  2BZF A;  3PSF A;  2K8B B;  3EPG A;  4YR2 A;  3HT3 A;  1NI3 A;  4RQ5 A;  1SXD A;  1X9X A;  5AI6 A;  5C5J A;  3PW0 A;  5AKI A;  4R8U B;  3GIJ A;  4F91 B;  4B9S A;  1A76 A;  1TAU A;  5AM4 A;  3KZX A;  4O5K A;  2BHN A;  1V9P A;  4K4H A;  5KFS A;  4EYI B;  3CW2 C;  4JK1 A;  3WK9 A;  4EBC A;  9ICT A;  4ZH4 A;  3QNM A;  4YCX A;  5ALE A;  4PPX A;  3AEV A;  3OTQ A;  4I2C A;  5KFX A;  3FDS A;  4DQP A;  2Z7J A;  1WUD A;  1HJP A;  3TAP A;  3KHG A;  1UT5 A;  2LMR A;  2C22 A;  4NLC A;  4KLQ A;  3KTQ A;  1MN8 A;  3GIK A;  2DL0 A;  4ECS A;  4JWN A;  3AN1 A;  3L3F X;  2HHX A;  5IIJ A;  4ED3 A;  3GV8 B;  2FPK A;  1ZQR A;  4TUQ A;  4CGZ A;  3PW2 A;  3ISD A;  3D6J A;  4USA A;  3N97 B;  5ALK A;  4B9N A;  4BX9 C;  2V4Q A;  5AK5 A;  1X9S A;  3O0F A;  2W9B A;  3V6J A;  3RF9 A;  1LB2 B;  2W9C A;  1UA1 A;  3H0L B;  3RH6 A;  2KZM A;  5F9N A;  4UB5 A;  7ICG A;  1FEZ A;  5KL8 B;  4F92 B;  3M1Y A;  2BCS A;  1NZB A;  2CXY A;  2PMZ F;  4M6W B;  1NJZ A;  3M9M B;  2LKY A;  3LK9 A;  2ZTE A;  1ZRN A;  4ED7 A;  3PMN A;  2PFQ A;  1CI4 A;  3RBE A;  4C4R A;  3PX4 A;  2YQE A;  2ISP A;  3RJF A;  3A0B U;  2BPF A;  2FMS A;  1NKB A;  2BCU A;  5ALI A;  2ZIX B;  3WKA A;  1ZQO A;  4MFC A;  2R18 A;  9ICJ A;  2FPL A;  1S0V A;  2KK0 A;  5J8Y C;  1LKY A;  1PVQ A;  1NK6 A;  3PW5 A;  1S97 A;  3UMC A;  4P0Q B;  1BPB A;  4YFK A;  1BPZ A;  2KZ3 A;  4I2F A;  3IG8 A;  1QTM A;  2Y0S C;  1NK9 A;  4CF4 A;  2E8P A;  5KFZ A;  8ICU A;  2XC9 A;  4Q45 A;  4Q8F A;  2RDI A;  1PK3 A;  1ZQB A;  4UB1 A;  4I28 A;  3M9N B;  2D8C A;  2UVU A;  3TAQ A;  4QWA A;  3V72 A;  4TUP A;  3R9K A;  4CDG A;  1U49 A;  1X6J A;  3UMB A;  2ATL A;  1RYS A;  4F72 A;  5DQH A;  4I2A A;  4P0P A;  5KFL A;  1BPD A;  4M47 A;  1COK A;  1XSL A;  4DS4 A;  4JB3 A;  3UQ2 A;  2OXO A;  3C2M A;  3SAH A;  1NZP A;  2EZY A;  5L1I A;  2R8I A;  4Y2Q A;  4UAS A;  4TUR A;  4B9M A;  2IOF K;  3H4B A;  4ACO A;  1KTQ A;  3EWA A;  7ICJ A;  2YMQ A;  2ZIU A;  2I9G A;  5J0S A;  1X66 A;  3H8M A;  5AHX A;  1PK1 B;  2JR5 A;  9ICE A;  2FDR A;  1IG6 A;  2YN4 A;  2NV3 A;  4QZB A;  2VA8 A;  1CEZ A;  3K75 D;  2I6X A;  5HR7 A;  3V6K A;  4I2B A;  3IDW A;  3QZ8 A;  3QUQ A;  1ZD5 A;  1ZD3 A;  2UVV A;  4FO6 A;  4KLU A;  3C21 A;  2AGP A;  1BNO A;  2RQ5 A;  4BXO B;  4B6J A;  8ICG A;  2NRT A;  1DGJ A;  1RYU A;  5AIB A;  1T3N A;  3BS7 A;  4I2H A;  4GXJ A;  2E3T A;  4E0D A;  2W03 A;  1Z19 A;  4J9N A;  4B9L A;  4EX7 A;  5CP2 A;  3WKB A;  1L6N A;  1O03 A;  2ESE A;  4I2G A;  3NAS A;  3JPT A;  1A6S A;  2E1E A;  3QU9 A;  3BQ2 A;  2HHQ A;  2OHF A;  5EE0 A;  4QZ9 A;  5KAF U;  1A77 A;  2JHD A;  5J2J A;  1Q3V A;  4ECT A;  4NWI A;  3ZD9 A;  1ZQZ A;  4GFJ A;  3GIL A;  2KMD A;  4KX3 A;  2WB1 C;  3MBY A;  1XWL A;  1L3T A;  3LVV A;  1PVR A;  2H3Q A;  3F53 A;  4QWC A;  5J2H A;  1MQ3 A;  4NM1 A;  5AM2 A;  2DPI A;  1ZD2 P;  4QJF B;  3JPO A;  8ICE A;  4XQ8 A;  2F77 X;  4KMU A;  5DKW A;  2DKZ A;  5EOZ A;  5GTH U;  4DFM A;  1BPE A;  1NKC A;  2KVC A;  4KLE A;  5KT5 A;  3SEN A;  4KLJ A;  3A0H U;  2H3V A;  5CB1 A;  3PST A;  1URJ A;  3T5L A;  5ALQ A;  1PUZ A;  4O9M A;  2HBL A;  4RPX A;  2JZB A;  4EYH B;  1D9F A;  4J9O A;  3N4M B;  3MR5 A;  3OSN A;  4KLS A;  3PVX A;  4RPZ A;  1PZN A;  4F5P A;  1KFT A;  3RFA A;  4QWE A;  3Q8K A;  4QW8 A;  4YP3 A;  4F2S A;  3QU4 A;  4DSJ A;  4J9S A;  2I5H A;  2Q0Z X;  1NOM A;  5ALJ A;  8ICH A;  2EAN A;  2WF6 A;  3ZDA A;  1YZ7 A;  3WK8 A;  2K60 A;  3SV3 A;  3QE9 Y;  5DB9 A;  4RT2 A;  3QUT A;  2HHV A;  1DRG A;  3NVY A;  4NLZ A;  2EZX A;  2L5Y A;  2PXI A;  7ICR A;  1B43 A;  4O3N A;  3T3F A;  1SKR A;  1B4F A;  4QZF A;  4Q43 A;  5AKY A;  4GC7 A;  8ICF A;  1S0N A;  5J0R A;  2PFO A;  3DEE A;  4DCC A;  4RZR A;  5HR6 A;  3G6X A;  5F9L A;  2JEJ A;  2QAR A;  5AKE A;  2W9B B;  4BWJ A;  5DB7 A;  2HHU A;  1L5U A;  2W04 A;  7ICN A;  1Z1B A;  5KFV A;  2I1Q A;  5EE3 A;  5AK4 A;  2M0N A;  4Y2U A;  5KAI U;  2W9C B;  2DGZ A;  1ZQA A;  2DUY A;  4UB8 U;  1TK5 A;  5G5G A;  4FZM A;  3JPP A;  3BQ0 A;  3OHA A;  5K4L A;  1ZQM A;  1XC9 A;  3NTU A;  4C4S A;  4BUG A;  7ICT A;  1BVS A;  3RJK A;  4RQ8 A;  5EE9 A;  4G3I A;  1ZOL A;  4IC9 A;  1JN3 A;  1JRP A;  2VAN A;  2KTQ A;  5AKJ A;  3AM9 A;  2P6R A;  1IXR A;  7ICI A;  2CPR A;  4DS5 A;  3L5K A;  9ICQ A;  1SV0 C;  4PHP A;  3E0F A;  3SAG A;  2W7P A;  2AGQ A;  2HHS A;  2G07 A;  4F3O A;  4ED8 A;  1KN5 A;  4P4M A;  2GO7 A;  2F2A B;  2WAQ C;  4QZA A;  5AKG A;  2D6F C;  5BOL A;  5J2C A;  1LKY B;  4KN4 A;  1GO3 F;  2HBJ A;  4LZG A;  2BQU A;  3HX0 A;  2O6K A;  3TI0 A;  4PH5 A;  4C80 A;  1YT3 A;  4YR3 A;  1KFS A;  4DFD A;  2ZXH A;  1B22 A;  2KIC A;  4UAR A;  3NRZ A;  2ISO A;  1SWV A;  4RQ7 A;  2P35 A;  2KP7 A;  4RQ2 A;  2BCR A;  1K1Q A;  4BXO A;  5ALM A;  1S0M A;  2V9W A;  4KLI A;  3B0X A;  1KLN A;  3MAB A;  2A1A A;  5KFI A;  4UB6 U;  4IQT A;  4FE3 A;  1ZQW A;  4P0P B;  3RAQ A;  4YMM A;  2DBY A;  2YB1 A;  4TQS A;  2Y0S F;  4Y2P A;  5KG5 A;  5J2I A;  5KFE A;  4O3R A;  4M9J A;  3SD7 A;  2XID A;  3NVV A;  1ZQH A;  2R8G A;  5CR0 A;  3T5H A;  2UVW A;  3TAN A;  2E8M A;  5B5E U;  5DBA A;  5KFN A;  2F3N A;  1KRP A;  2OCE A;  2ZJA A;  4IRK A;  2JXJ A;  2ZIU B;  1F44 A;  1LV5 A;  4F93 B;  2KV2 A;  4OCZ A;  5J2B A;  4RNM A;  5KL1 B;  1UT8 A;  2K8C B;  2B0C A;  4IS7 A;  9ICP A;  2HOI A;  1N48 A;  1F5S A;  3SYZ A;  5BOM A;  2JV3 A;  8ICK A;  1F0M A;  1ZQX A;  4UAW A;  2LHT A;  1TVA A;  3KFU F;  3MGI A;  8ICP A;  7ICO A;  4IQU A;  1DK3 A;  2KSO B;  2W8K A;  3D2N A;  1D8B A;  1PVP A;  3NUQ A;  1X6I A;  5JU5 A;  5FP0 A;  3IV6 A;  2MA1 A;  5J2A A;  4DFK A;  8ICY A;  3SEI A;  1VLB A;  4KLO A;  2YB4 A;  4CF3 A;  2WFA A;  3OPX A;  3RJJ A;  9ICK A;  2AHO B;  4CCH A;  4QZG A;  2HCF A;  3QEB Z;  1RQL A;  3K4G A;  4DSI A;  4K4I A;  4TUS A;  8ICR A;  1FFV A;  2AQ4 A;  2J6S A;  2EAP A;  5KG4 A;  4FBT A;  4DL3 A;  1ZQE A;  5ALV A;  4QW9 A;  2VJ4 A;  2C28 A;  9ICN A;  3CNH A;  1WCL A;  2A3V A;  5HHI A;  3QUB A;  1JIH A;  1RG6 A;  4O0I A;  2KFZ A;  4O5C A;  1U45 A;  3WKD A;  4J9R A;  4CE6 A;  4F5R A;  1JMS A;  3C1Z A;  3IG5 A;  2NRZ A;  4M9N A;  1JRO A;  4OJL A;  5KNI A;  1QSL A;  5DQG A;  4B9T A;  4Y2X A;  3QZ7 A;  3V6H A;  1NJW A;  2LYH A;  5AM0 A;  8ICO A;  3UMG A;  5JTI A;  2Y9U A;  3MR3 A;  4GXI A;  1ZET A;  2WB1 F;  4DSK A;  4ELV A;  1X2I A;  3RJI A;  1TAQ A;  2FLL A;  4NLN A;  5CA7 A;  4F4X A;  9ICU A; 
#chains in the Genus database with same CATH homology
 1WWU A;  2F8K A;  4RQM A;  3TAC B;  5L1M A;  1SV0 C;  3IDW A;  2JV3 A;  2KIV A;  3TAD C;  3HIL A;  2E8O A;  1SXD A;  1X9X A;  1F0M A;  1SGG A;  1B0X A;  4NL9 C;  5J8Y C;  1LKY A;  1V85 A;  2KSO B;  1LKY B;  3BS7 A;  4NJ8 A;  2ES6 A;  5JU5 A;  2EAN A;  2K60 A;  1UCV A;  5F3X B;  3SEI A;  2E8P A;  1SV4 A;  2F44 A;  2YTU A;  2ESE A;  1PK3 A;  1SXE A;  1WWV A;  2KSO A;  2L5Y A;  2EAO A;  2LMR A;  2FE9 A;  2D8C A;  1B4F A;  2DL0 A;  3TAD A;  2EAP A;  2LPE A;  1X40 A;  2KMD A;  2QKQ A;  4NL9 A;  2KE7 A;  3KKA A;  3K1R B;  3BS5 A;  5J8Y A;  2KG5 A;  1COK A;  3BS5 B;  2E8N A;  2DKX A;  2QAR A;  4PZN A;  2QAR B;  4PZO A;  1RG6 A;  4MHV A;  2K4P A;  1DXS A;  2GLE A;  1UQV A;  2D3D A;  1V38 A;  2QB1 A;  4RQN A;  2EAM A;  1SV0 A;  5JRT A;  2B6G A;  2E8M A;  2DKZ A;  5KNI A;  2F3N A;  1OXJ A;  1PK1 A;  1X66 A;  3H8M A;  5JTI A;  1OW5 A;  1KW4 A;  1PK1 B;  2Y9U A;  3KKA C;  3SEN A;  1Z1V A;  2QB0 A;  1JI7 A;  2QB0 B;  2Y9T A;  4IS7 A;  3BQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...