4NJ8A

Crystal structure of the human anks3 sam domain l52a mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
RAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITAFGPKRKMTSAIARWHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 21
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nj8A01
2KG5A 1LKYB 5F3XB 1OW5A 2QB0B 2KE7A 1KW4A 2EANA 3BS5A 1SGGA 1X9XA 2F44A 3KKAC 5J8YA 1PK1B 2ESEA 2F3NA 1B0XA 1PK3A 4NL9C 1SV4A 2LMRA 5JU5A 2DL0A 3TADA 1V38A 3BQ7A 3H8MA 2ES6A 3SENA 2KIVA 2QB0A 2EAOA 1OXJA 5JRTA 2KSOB 1WWUA 2D3DA 2EAMA 4PZOA 2QARB 2EAPA 4PZNA 1SV0A 4IS7A 5J8YC 3BS7A 1V85A 3BS5B 2L5YA 1X66A 2Y9TA 2QKQA 4RQNA 1UQVA 2QB1A 4MHVA 3HILA 3KKAA 1SXDA 3TADC 1LKYA 5KNIA 2DKZA 2FE9A 1X40A 2LPEA 1UCVA 1RG6A 2K60A 2DKXA 3IDWA 4NJ8A 2K4PA 2KMDA 1F0MA 2QARA 1PK1A 2E8MA 2B6GA 1SV0C 2E8NA 1DXSA 2GLEA 3SEIA 4RQMA 5L1MA 2F8KA 2E8PA 1Z1VA 1COKA 2YTUA 1WWVA 2D8CA 3K1RB 4NL9A 3TACB 2KSOA 2E8OA 1SXEA 2JV3A 1JI7A 2Y9UA 5JTIA 1B4FA
chains in the Genus database with same CATH superfamily
2CRXA 4IR1A 3IG8A 1X6JA 1OUQA 5L9XA 4MEXA 5ALGA 1QSSA 3NRWA 3HKZF 5J2HA 1U4BA 1SGGA 3L4PA 3Q8PB 1ZQCA 4NV0A 4F5QA 4G3IA 5AM5A 3WKCA 3U26A 4C7YA 3SYZA 2VKQA 4XQ8A 2YN4A 2DFLA 4I2JA 4DSLA 4F4XA 8ICLA 2EZYA 5EE1A 2HCFA 4M2YA 4FFDA 5EWFA 4KLHA 2P66A 2W7OA 3QXGA 1QQ5A 2GH1A 5DB8A 5KFLA 5J2KA 4KLJA 4UATA 2QARB 2J6SA 3Q8RB 1Q3VA 4K4GA 3I28A 5AM3A 1U45A 5DDMA 3BDPA 4RPYA 4QWBA 4F4ZA 2H3ZA 3L3FX 5AICA 2PFOA 2LHTA 4M9LA 4KITB 4DFKA 4ED8A 4O5CA 3AU2A 3V7LA 1Y88A 3HX0A 5KG6A 4J9QA 4OO1J 2C2RA 2RQ5A 2JH1A 4F72A 2XCPA 1XNSA 3T5HA 3PW7A 5AKHA 3SEIA 4KLTA 3ISCA 4BXOB 4RU9A 1ZQHA 4US8A 5HHIA 2W9CA 4DQIA 2BCUA 1T94A 2HBJA 5KFBA 5F9LA 4QZFA 3AUOA 1NK4A 2JV3A 3GU3A 1L3VA 2Y9UA 4YG2A 1L6NA 4ED1A 1HUZA 1KSPA 5F3XB 2EANA 1SKWA 2XCAA 4YMMA 4M0AA 1C7YA 3MR2A 5KFKA 3NVYA 4RQ6A 5G5GA 1X9XA 5KTQA 4P4MA 4GXKA 2F1IA 1QTMA 4KMUA 4QZCA 5J2FA 3N7PD 1URJA 4E0DA 2KFZA 9ICCA 4JWNA 2AGPA 5ALHA 3SI8A 4UBBA 4DSEA 1P7DA 1NKBA 2RLTA 3I1YA 4GFJA 1QH9A 4Y2TA 5EWGA 3V72A 3WK4A 4PZOA 5HR7A 4Y2VA 4RQ1A 2KICA 4CGZA 1JUDA 2YB4A 4Y2QA 5J0TA 2VA3A 3C1ZA 5J0OA 3QUCA 3N7SC 1O03A 4RQ2A 1KEJA 5KFAA 3A0BU 4RQNA 3B0YA 1ZQKA 2MUTB 4YMNA 2P6RA 1SXDA 4ZOHC 3CP8A 3J81j 4F8RA 3RJJA 4DSJA 3BZCA 4B9TA 4RNOA 3RRGA 3RB0A 4AP9A 4UB8U 1RQLA 1TAMA 3AMZA 1SKRA 4RQ4A 3LVWA 3H8WA 1HJPA 2JEIA 2E8MA 1SV0C 2PFQA 3MABA 5AM1A 4RZRA 3PX4A 2ZIWB 8ICBA 1RM6C 3PR4A 2PFNA 4TURA 2W54A 1ZD3A 2H3QA 3LWLA 3QYPA 1S76D 4NL9A 1BPXA 3RTVA 4NY8A 4P0QB 3OTQA 7ICQA 2JH7A 3OSNA 2AHOB 1UA1A 1LKYB 1JIHA 4ELUA 1X42A 1KBUA 4BX9C 2XC9A 3CNHA 3C29A 3JPRA 3BS5A 1KKXA 3MR6A 5IIJA 2OCEA 3RJFA 5HR6A 5ALLA 8ICTA 3EPIA 2JMGA 3GIIA 4JMUA 2JXJA 3K75D 5J8YA 5J2DA 5IIKA 1D9DA 4DL4A 5CRXA 4QW9A 5KFQA 8ICMA 4KLGA 5KT2A 5B66U 4PHEA 2BPFA 3H4BA 2A1JB 4J9NA 2W55A 5JRTA 3RJKA 1WG8A 8ICEA 3WK9A 5BPCA 3RR7A 4NLBA 2QLTA 1ZQZA 2LM4A 3JPQA 3BQTA 1NJWA 4ECWA 1ZD2P 3VC8A 3IG5A 5IILA 7ICEA 1TV9A 3QNMA 5DLGA 9ICUA 5AK4A 7ICHA 2UVVA 2EDUA 3Q8MA 2FMPA 4KLFA 1J2NA 1RQNA 4B6JA 4DL6A 5J2CA 3GIKA 4M04A 4GXJA 4ED2A 4IRKA 5IIMA 3UXPA 1X9SA 8ICGA 3TARA 3GIJA 1L8LA 5J2JA 4IQTA 4EYIB 2GO7A 2Q4TA 2IBKA 2K4EA 3NTUA 5ALWA 4F5RA 4KLLA 1L3TA 4TUPA 5BOLA 3NVZA 3KOOA 1PVQA 1WWVA 3GQCA 4ACOA 1ZQAA 2W8LA 3PMNA 1JI7A 3ZDDA 3BZKA 3E58A 2V4RA 3LYSA 4F4KA 3H40A 3ZDCA 4GXIA 4YR3A 1YZ7A 4YXMA 2JGAA 1ZOLA 1SZHA 5G5HA 1MA7A 2KTQA 2ZTCA 1B0XA 4XA5A 4KX3A 2KKVA 4PL1A 1N48A 3M1YA 3AL0B 4UAYA 3EWAA 3SAHA 2M0NA 5DB7A 3B0XA 2XO7A 4R65A 1XO0A 4DEZA 2GOLA 4ECVA 2NRTA 9ICQA 5KG5A 3EPGA 4DQSA 4EBDA 1ZQFA 5L1KA 4CF4A 4MHVA 2W9CB 5KNIA 1JXLA 1SL2A 3C5GA 2K60A 1MSWD 4WJ3B 3PSFA 4Z6CA 1QSLA 3WK8A 3QEBZ 4NJ8A 3M9OB 4YD2A 3PNCA 3UMCA 3H4DA 5A0LA 7ICSA 3PX6A 4MFCA 1L3UA 2XI9A 4RUCA 3IV6A 2PFPA 2GLEA 3MGHA 3K1ZA 3F2DA 2E8PA 5AI5A 4NLKA 5TZVA 3AN1A 1COKA 2ZJ8A 4PH5A 1FEZA 1ZQLA 9ICNA 2G08A 2ODGA 4IQVA 2JEFA 3Q8QB 3TANA 1XU4A 4O3PA 4AYBF 1RXVA 2HVIA 5GTHU 3UPQA 3M6KA 3TI0A 2H3IA 1B22A 2ASJA 2MUTA 4Z6FA 3PW5A 2OEHA 1ZD4A 5ALOA 1IXRA 2JEGA 5ALQA 3N4MB 2EZZA 5KFEA 2KP7A 3M9NB 2R8JA 2KZMA 1D8BA 4QZAA 4FBTA 3RH4A 3ZDEA 1H38A 2ZJ5A 2LYAA 3HPOA 5AKYA 1AROP 3N7RC 3QU4A 2BZFA 4F91B 1CI4A 1SV0A 1JN3A 5KG2A 4RQ5A 2YY6A 4P0QA 2QKQA 1N61A 2ZIUB 3KHHA 1SKSA 2QB1A 5ALKA 4CE6A 2BDPA 2RDIA 3ETRA 3KKAA 1LKYA 4YVZA 5KL1B 2DKZA 3T5KA 1ZQUA 3JPPA 4DWIA 4UQGA 4EEKA 8ICOA 3H8JA 3EW9A 2HHWA 4FS2A 1S0OA 9ICMA 4R8UB 3NGDA 4O0IA 1NKEA 5DBBA 4C4TA 2Z7JA 3PR5B 4F4WA 2WHEA 3UXNA 4C0ZA 2WTFA 1RDFA 3OJSA 4PGXA 2O6KA 1U49A 2A1JA 4ECUA 3SQIA 4IRCA 1ZQEA 1NKCA 1S0MA 5AKIA 4YD1A 3WKEA 2BDUA 1L7NA 2DQNB 2K89A 2RHFA 1KW4A 4DS5A 4DFJA 3ISBA 3CRXA 2ISOA 3TQ1A 4NXZA 7ICFA 2LBOA 5DG8A 5HNKA 1A77A 2F8LA 4DL5A 3FM9A 2BGWA 3C1YA 2F77X 3EYZA 3PVXA 1RZTA 4ECTA 2RRDA 3IM1A 1QQ6A 2FLPA 4P4PA 2ZG6A 4UB2A 2AGOA 4C8KA 4BGDA 3C2LA 4M6WA 2I1QA 4LJXA 1CEZA 2XVTA 2VANA 1S10A 4Y2RA 2HMXA 4U6PA 4RQ8A 3RAQA 3MGIA 5DB6A 2EZXA 1IM4A 4ELTA 4OD0A 5KFMA 2FMQA 2OH2A 4YXJA 1J97A 3G6YA 9ICFA 4ELVA 1IG6A 2FE9A 2R18A 1NK9A 4JUZA 2LPEA 2KIWA 3HJEA 5IIIA 4O9MA 3PZPA 4O3RA 4Z6EA 4DQQA 5HMLA 2ASLA 1Z00A 2K4HA 3V7KA 3H0RB 5JUMA 4J9SA 4DFDA 3WU2U 1MN8A 4UB5A 2UVWA 4RQMA 4UAVA 4UB6U 5ALZA 4I2DA 2YMMA 2H3VA 1ZQVA 3SV4A 4QWAA 4QZBA 5KT4A 1RYSA 2HBLA 1BNPA 2N1RA 4JV0A 2HW3A 9ICKA 2IA6A 2BPGA 2KJ8A 2OYYA 4PPXA 1OW5A 4CCHA 4QZ9A 3MC1A 4PJ0U 2UVUA 2HOIA 3KD3A 1N5WA 5DG7A 2V9WA 4ICAA 1UT5A 3QZ7A 1T8EA 2HHVA 2ISPA 2VA2A 2HBMA 1Z4NA 1MC8A 4F2SA 2MAXA 9ICBA 2DL0A 3O0FA 4M9JA 2A19A 3OHBA 1FFVA 3LWMA 3QU5A 3ZD9A 2NRXA 2MA1A 4ECQA 2ZJAA 4KLEA 2W7PA 2R8GA 4JK1A 1S97A 3UQ0A 3D2QA 3BQ0A 4I29A 1S9FA 2XIDA 4PHAA 5KG4A 1XS9D 4B9UA 2KFNA 1V85A 4FBUA 4P0PA 1ZQXA 4K4HA 4F93B 4O3NA 4I27A 9ICEA 4ED7A 1LV5A 2OHFA 4DCCA 1JROA 1WYGA 5F9NA 4QWDA 4UARA 2ZUBA 1UCVA 4ECZA 1Z4OA 3IDWA 4QZDA 2WF7A 5AI4A 2K8BB 3ZDBA 3QU9A 1QQ7A 4US9A 4LZGA 3KZIU 3C23A 5KFNA 9ICTA 1A76A 1QLNA 1V9PA 3IP4B 4UAUA 3KBBA 1KL9A 2CPRA 2BCRA 3K1RB 5H2FU 4BWJA 4F50A 1IIPA 3T3FA 1LVHA 4O5KA 2KG5A 3N97B 2I5HA 5KG7A 9ICOA 5BOMA 1ZQRA 4DLEA 4JV1A 3RAXA 3PW4A 2ZIUA 4EEYA 1COOA 7ICKA 3KKAC 3HP6A 1BPEA 2JRZA 1D9FA 3BQ1A 3KHGA 2F3NA 4J9OA 1SZPA 3AU6A 3V6KA 5J2EA 5AI0A 4DSFA 4YN4A 4UAWA 2KNJA 3H8SA 4R8UA 1Q8KA 4Y2SA 2F76X 1UPHA 2I6XA 2WF8A 2HBKA 4XUSA 3F2CA 7ICIA 1XWLA 4KN7A 4P4OA 2Q0ZX 2G09A 2GWSA 3C2MA 3RB3A 1PVRA 2K8CB 1ZD5A 2KKPA 5ALTA 1ZXIA 4YR2A 4BJQA 5L1IA 3PMLA 2K4IA 4RT3A 3QE9Y 4Q8EA 1VJ5A 5D46A 3V7JA 2JR5A 2K4PA 3QUQA 3WKBA 4DQRA 1F0MA 5AI9A 2DUYA 3HW8A 3QU7A 4BDPA 3T5JA 5KAIU 4DLGA 1Q3UA 3QU2A 4TQSA 3KHLA 9ICAA 3I76A 3F5AA 4I2AA 4IQUA 5ALYA 3GFKB 4F71A 4O3SA 4NM1A 3SD7A 5AIBA 2C2DA 5KT3A 4TQRA 4MFAA 1TAUA 5DLFA 1SWWA 1B4FA 2B21A 2E1FA 3PSTA 5AM0A 5DGAA 4Y2PA 4M6WB 4FZMA 1TAQA 5KFGA 2BQRA 4YFKA 1RXWA 3H0MB 4CRXA 1ZYQA 3FAHA 5D49A 3GDXA 4QZHA 3MR5A 1NJXA 5EE9A 1TK8A 2VJ4A 5ALJA 5J0QA 2FPMA 8ICYA 4DSKA 2BQUA 8ICXA 3RRHA 1ZRNA 2J6UA 2C22A 4DL7A 2VIXA 5J2BA 7ICMA 2NRWA 3C5FA 4TUQA 4DO9A 5KG1A 2HHSA 1MQ3A 1NK5A 2KSOB 2MSNA 3OPXA 5E79U 3DDHA 2EAMA 5KFZA 1Z00B 4CDGA 9ICPA 4R64A 2EAPA 5DQHA 4O3MA 2IOFK 5KAFU 5EE3A 2Y9TA 2DWQA 3K4GA 1ZQQA 4ED0A 4QIWC 3Q8KA 2HSZA 5DB9A 4QIWF 5KFWA 4UW9A 4YCXA 8ICSA 3OGUA 4OJ6A 2DPIA 3Q8LA 3WK5A 2W8KA 5DG9A 4OJOA 1SB3C 1XO1A 3M9MB 5DQIA 1SIJA 2FJ6A 2E8NA 4UBCA 1ZQSA 5HMMA 4Q43A 5GTIU 1JALA 3SZ2A 4UB1A 2LYBA 4DF8A 7ICUA 7ICNA 8ICKA 8ICNA 1BVSA 4NLCA 4RQ0A 4QJFB 4I2FA 4LZDA 5AK3A 3V6JA 1QCKA 2DPJA 4EYHB 5AK6A 2XY6A 1N5XA 1KLNA 3T79A 3TFSA 3JPTA 2NO4A 1S0NA 5KG0A 4R63A 4DOAA 3ISDA 4CF5A 1TVAA 1F5SA 3OHAA 1SL1A 1BPZA 1PK1B 2ESEA 4P0PB 5CEHA 3GV7B 3D2SA 4M47A 4F4YA 3PO4A 3UQ2A 2CN1A 3BQ7A 3FDSA 4DF4A 2DF4B 3AQFA 4Z6DA 3IHQB 1DOQA 5ALEA 2E3TA 1RYRA 5ALMA 5ALUA 4KMOB 8ICPA 4F2RA 4C80A 3HWTA 3FC4A 8ICWA 4PZNA 1K5OA 4OJLA 4RQ7A 3BS7A 5TISU 4F3OA 3UMGA 5J2GA 5J2IA 5L1JA 5CWRA 5AKEA 2NYVA 3TKAA 1NOMA 1SWVA 4BWMA 2HOFA 1RG6A 1HEKA 2PI5A 2PMZC 2P6UA 3UM9A 1ZQJA 4F5NA 3B9JA 2BPCA 5J0SA 3KTQA 2PMZF 5KFUA 3M8SA 2KN7A 1NJYA 1X6IA 1NZPA 2HHTA 1Z1VA 2NRZA 3C2KA 3RJGA 2KVCA 2FPKA 1YT3A 1UA0A 2HVHA 2YTUA 1ZQYA 4IL6U 4RPZA 3ZI4A 1VDVA 2W9MA 4J9PA 3G6VA 1GO3F 1FO4A 4C7ZA 9ICHA 2C28A 5J0WA 2KE7A 4RQ3A 3PSIA 1C20A 2BCVA 1T7PA 2BQ3A 5IINA 2KJ9A 4JB3A 3VCBA 1ZQGA 4QZ8A 5J0PA 2W9AA 2G5HB 1PK3A 3N28A 4GIBA 1YZ6A 2YMLA 5DDYA 2E1EA 7ICJA 5HP4A 3H7IA 4C4RA 3C28A 4YP3A 1WCLA 4LVSA 4QZEA 1TKDA 2W3RA 3V6HA 4C8LA 1WWUA 4MF2A 1VLBA 1N2XA 2BHNA 7ICPA 3IRUA 3KZXA 5ALXA 9ICWA 5DQGA 8ICZA 2WF6A 5ALRA 1UHUA 1XSPA 3UXOA 3NRZA 5CP2A 4QW8A 2ATLA 1U47A 4CF3A 5KFCA 2LYHA 3RBEA 3ONNA 8ICUA 4QWEA 1K1SA 3F53A 4KLOA 4M9NA 4Y2YA 4M9GA 3BQ2A 2NO5A 1XSNA 3SAFA 1S0VA 1A6SA 2FI1A 5CB1A 3HKZC 3A0HU 5CA7A 2NRVA 1S77D 8ICRA 4PGYA 3PSPA 2B0CA 4F92B 1BGXT 1L8OA 1NK0A 3GV5B 1DGJA 2KSOA 4QZIA 1JMSA 4I2HA 2V4QA 4ECYA 5JTIA 2IMWP 3PO5A 1NK6A 3D6JA 2KV2A 4UB3A 1PVPA 3QX7A 1ZQWA 8ICFA 3TAPA 4KLIA 2AJQA 5DBCA 3MDAA 4ECSA 2FPLA 5AKXA 1ZJNA 3GZFA 4IR9A 4I2BA 2ZXIA 2HHXA 7ICTA 1BPDA 2DBYA 2KHVA 4MF8A 1N62A 4I2IA 2XY5A 1V38A 2HDOA 1CUKA 2ZIVB 2A3VA 3H8MA 8ICJA 4OJPA 1L7MA 5DKWA 2IHMA 8ICCA 4Y2JA 1T3NA 4Q45A 4P2HA 4B9NA 2D3DA 1ZQTA 2JHDA 5KFYA 2FLNA 2FMSA 4A8EA 3E2EA 3PV8A 4K4IA 4IS7A 1T4GA 4EBEA 4KLSA 4EELA 5J2AA 4U7CA 2IHNA 1LB2B 5ALNA 1MQ2A 7ICLA 3TADC 3MGVA 4B9SA 4KTQA 4GLXA 7ICOA 1TE2A 5AI8A 3RB4A 5CR0A 4YMOA 3RJEA 1L7PA 4PHDA 2Y1JA 5C0YA 1WUDA 1S8OA 3EUB2 1PK1A 5EWEA 2Y1IA 1ZQDA 4UB4A 2KK0A 2YX8A 2ZXHA 2C2EA 1XSLA 4RNNA 1ED1A 3DV9A 2W04A 3SMVA 2D8CA 2Y0SC 3PX0A 1U9LA 2ZUDA 3PY8A 1RYUA 3TACB 2RDJA 4DL2A 3NVWA 2Y0SF 4B9MA 1NI3A 1F44A 3QUTA 4OCZA 2KJ5A 2KOBA 1V97A 4F5OA 2HOQA 3H0LB 1NZBA 5KFOA 4IQWA 8ICQA 1X9MA 4BUGA 2ASDA 3QUBA 2W9BB 4ECXA 4GC6A 1HUOA 5KFPA 3KHRA 2DGZA 4J9KA 4ED3A 2PXIA 2I9GA 4YR0A 1PUZA 4RPXA 3MFIA 3WKDA 3ETLA 5AHXA 2R8KA 2AGQA 4TUSA 4C4SA 1Z1BA 2ES6A 2AU0A 2QB0A 4I2CA 9ICRA 5AIAA 1BPBA 1ZQMA 2YMQA 3GILA 1ZQNA 2LM1A 2WB1C 1D8YA 1EXNA 3QZ8A 3JPSA 5KFFA 4DFPA 2PI4A 5KFRA 2BCQA 2KD1A 3RF9A 3G6XA 3SV3A 2HHUA 2MRLA 4OJ5A 2WB1F 2OM6A 2VJ5A 2BCSA 1KTQA 2G0AA 3DEEA 4O5EA 1FFUA 1DGSA 4Y2UA 1N63A 3TFRA 3T5LA 1SL0A 4Q44A 1S5LU 2JZBA 8ICHA 2EQYA 7ICGA 4J03A 2D6FC 2R8IA 5KG3A 3RJIA 3PW0A 3OJUA 2YB1A 2KVSA 1RPLA 1JRPA 8ICIA 1UT8A 4DSIA 4DOCA 4EBCA 3FYHA 1XC9A 1L5UA 5EOZA 2EH9A 2AQ4A 4KLUA 2CXYA 1SXEA 2RP5A 3CYMA 3THVA 2OXOA 3ICXA 2J6TA 2YQEA 1N60A 1DK3A 4FZLA 4G9BA 1T3QA 9ICIA 4EZ9A 2ZIXA 3GV8B 5EE0A 2F44A 4NLNA 4GC7A 2XICA 2JEJA 1IV8A 2P35A 3LVVA 1K1QA 5KFIA 4DOBA 1ZETA 1SV4A 5ALFA 1HIWA 1AQ6A 3L5KA 3GIMA 5HHHA 2WF9A 4DS4A 3RBDA 1N56A 5KL8B 3SENA 3RJHA 5T14A 1B43A 5J0XA 3Q8SB 3PW2A 3NVVA 1D8LA 1ZQBA 2H3FA 2WFAA 1NK7A 3NASA 5C5JA 4B9LA 3NS1A 4M9HA 2ZTDA 2XGPA 2ALZA 2L5YA 3MFHA 3JPOA 3LDAA 5IIOA 1X66A 2G07A 3SAGA 4DQPA 3WKAA 2VA8A 5J0UA 3HILA 4Y2XA 4YQWA 4KLDA 1O08A 4J9MA 2W03A 2KEYA 2W43A 3R9KA 2DKXA 5AKGA 4JWMA 3HRDD 1PZNA 2H5XA 5KFTA 2QARA 4NWIA 3CW2C 2FDRA 2B6GA 5ALDA 2KZ3A 1DXSA 5AI6A 2LKYA 9ICGA 4HYKA 1KDHA 2F1HA 2M9NA 2ZIVA 5J0RA 4KN4A 2KZZA 1KFSA 1JX4A 5AKJA 1ZQOA 2E5SA 4O3QA 4KLMA 5KT7A 3ED5A 1L3SA 4RUAA 5KFSA 4ZH4A 9ICVA 5KFVA 2OWOA 4PHPA 1QSYA 5K4LA 1FIQA 3HT3A 2LI6A 3WK7A 4CNQA 2UVRA 4RT2A 5KFXA 3BJYA 3SR6A 1KFDA 1DK2A 4BXOA 2AQ0A 3ZD8A 2XGQA 4NLGA 1NNLA 4I2EA 3ZDAA 1TFRA 3D2NA 2IOFA 3RR8A 2YMPA 4QNLA 3TADA 3AM9A 2ZTEA 2K8AA 5ALPA 1L7OA 4FO6A 5ALVA 1Z3EB 2NV3A 4UASA 4QWCA 2BR0A 5J0YA 3F2BA 3JPNA 8ICVA 3TAQA 2A1AA 3ORYA 4HAIA 5L1LA 1UQVA 2PKEA 5ALIA 5AKKA 2W3SA 8ICAA 5AKZA 7ICVA 5AM4A 1ECWA 4NLZA 4USAA 4AYBC 4I28A 4I2GA 4DL3A 4FS1A 4X5VA 4J9RA 5AK5A 2W9BA 1BNOA 5CHGA 1ZQ1C 1ZRMA 9ICJA 5KFHA 3MR3A 3EZ5A 4EZ6A 3E0FA 1KFTA 2XY7A 3IN5A 1NK8A 4DFMA 4B9VA 4ED6A 3RB6A 4ECRA 4FE3A 5KFDA 2E8OA 1X2IA 4R66A 9ICLA 4RNMA 4IC9A 2WF5A 2QB0B 1KQQA 1KRPA 4NM2A 4F5PA 4O3OA 4EX6A 2ZIWA 1J2MA 4C8OA 5D4BA 5KT5A 5CJ7A 4Q8FA 2MU2A 3F5EA 3KFUF 4NL9C 2G5IB 2LMRA 4XRHA 4QZGA 5JU5A 9ICXA 9ICSA 3M6ZA 3M8RA 2JZBB 1TK0A 1CRXA 2KIVA 5FP0A 2EAOA 1ZJMA 1OXJA 5AKLA 5AM2A 3AQEA 5B5EU 5J29A 4IRDA 3RH6A 5DBAA 1Q46A 4C8NA 4MFFA 4KX5A 3NUQA 4PGQA 3M7DA 5J8YC 5KFJA 1ZQPA 1A0PA 2F1JA 3BS5B 1JXEA 2R8HA 3OSPA 3QEAZ 3AEVA 4JV2A 4FZNA 3LK9A 2AH5A 3C21A 3RFAA 1BPYA 7ICRA 2HHQA 1TK5A 2G06A 1X40A 3WK6A 4EENA 4C8MA 2W11A 4PL2A 3UMBA 5KT6A 2IOHA 1ZQIA 2KMDA 4J9LA 1M6YA 2ZUCA 1Z19A 2BKEA 2ZIXB 4MEYA 5ALSA 3S6JA 5L1MA 2F8KA 2WAQC 4KLQA 2HI0A 2FLLA 4EX7A 3MBYA 1KN5A 3RH5A 1X9WA 5DGBA 3MDCA 2KHQA 1NJZA 2F2AB 2AXTU 2WAQF 1WCNA 3ALRA 4UAZA 1DRGA 1U48A
chains in the Genus database with same CATH topology
2KG5A 1LKYB 5F3XB 1OW5A 2QB0B 2KE7A 1KW4A 2EANA 3BS5A 1SGGA 1X9XA 2F44A 3KKAC 5J8YA 1PK1B 2ESEA 2F3NA 1B0XA 1PK3A 4NL9C 1SV4A 2LMRA 5JU5A 2DL0A 3TADA 1V38A 3BQ7A 3H8MA 2ES6A 3SENA 2KIVA 2QB0A 2EAOA 1OXJA 5JRTA 2KSOB 1WWUA 2D3DA 2EAMA 4PZOA 2QARB 2EAPA 4PZNA 1SV0A 4IS7A 5J8YC 3BS7A 1V85A 3BS5B 2L5YA 1X66A 2Y9TA 2QKQA 4RQNA 1UQVA 2QB1A 4MHVA 3HILA 3KKAA 1SXDA 3TADC 1LKYA 5KNIA 2DKZA 2FE9A 1X40A 2LPEA 1UCVA 1RG6A 2K60A 2DKXA 3IDWA 4NJ8A 2K4PA 2KMDA 1F0MA 2QARA 1PK1A 2E8MA 2B6GA 1SV0C 2E8NA 1DXSA 2GLEA 3SEIA 4RQMA 5L1MA 2F8KA 2E8PA 1Z1VA 1COKA 2YTUA 1WWVA 2D8CA 3K1RB 4NL9A 3TACB 2KSOA 2E8OA 1SXEA 2JV3A 1JI7A 2Y9UA 5JTIA 1B4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG5 A;  1LKY B;  5F3X B;  1OW5 A;  2QB0 B;  2KE7 A;  1KW4 A;  2EAN A;  3BS5 A;  1SGG A;  1X9X A;  2F44 A;  3KKA C;  5J8Y A;  1PK1 B;  2ESE A;  2F3N A;  1B0X A;  1PK3 A;  4NL9 C;  1SV4 A;  2LMR A;  5JU5 A;  2DL0 A;  3TAD A;  1V38 A;  3BQ7 A;  3H8M A;  2ES6 A;  3SEN A;  2KIV A;  2QB0 A;  2EAO A;  1OXJ A;  5JRT A;  2KSO B;  1WWU A;  2D3D A;  2EAM A;  4PZO A;  2QAR B;  2EAP A;  4PZN A;  1SV0 A;  4IS7 A;  5J8Y C;  3BS7 A;  1V85 A;  3BS5 B;  2L5Y A;  1X66 A;  2Y9T A;  2QKQ A;  4RQN A;  1UQV A;  2QB1 A;  4MHV A;  3HIL A;  3KKA A;  1SXD A;  3TAD C;  1LKY A;  5KNI A;  2DKZ A;  2FE9 A;  1X40 A;  2LPE A;  1UCV A;  1RG6 A;  2K60 A;  2DKX A;  3IDW A;  4NJ8 A;  2K4P A;  2KMD A;  1F0M A;  2QAR A;  1PK1 A;  2E8M A;  2B6G A;  1SV0 C;  2E8N A;  1DXS A;  2GLE A;  3SEI A;  4RQM A;  5L1M A;  2F8K A;  2E8P A;  1Z1V A;  1COK A;  2YTU A;  1WWV A;  2D8C A;  3K1R B;  4NL9 A;  3TAC B;  2KSO A;  2E8O A;  1SXE A;  2JV3 A;  1JI7 A;  2Y9U A;  5JTI A;  1B4F A; 
#chains in the Genus database with same CATH topology
 2CRX A;  4IR1 A;  3IG8 A;  1X6J A;  1OUQ A;  5L9X A;  4MEX A;  5ALG A;  1QSS A;  3NRW A;  3HKZ F;  5J2H A;  1U4B A;  1SGG A;  3L4P A;  3Q8P B;  1ZQC A;  4NV0 A;  4F5Q A;  4G3I A;  5AM5 A;  3WKC A;  3U26 A;  4C7Y A;  3SYZ A;  2VKQ A;  4XQ8 A;  2YN4 A;  2DFL A;  4I2J A;  4DSL A;  4F4X A;  8ICL A;  2EZY A;  5EE1 A;  2HCF A;  4M2Y A;  4FFD A;  5EWF A;  4KLH A;  2P66 A;  2W7O A;  3QXG A;  1QQ5 A;  2GH1 A;  5DB8 A;  5KFL A;  5J2K A;  4KLJ A;  4UAT A;  2QAR B;  2J6S A;  3Q8R B;  1Q3V A;  4K4G A;  3I28 A;  5AM3 A;  1U45 A;  5DDM A;  3BDP A;  4RPY A;  4QWB A;  4F4Z A;  2H3Z A;  3L3F X;  5AIC A;  2PFO A;  2LHT A;  4M9L A;  4KIT B;  4DFK A;  4ED8 A;  4O5C A;  3AU2 A;  3V7L A;  1Y88 A;  3HX0 A;  5KG6 A;  4J9Q A;  4OO1 J;  2C2R A;  2RQ5 A;  2JH1 A;  4F72 A;  2XCP A;  1XNS A;  3T5H A;  3PW7 A;  5AKH A;  3SEI A;  4KLT A;  3ISC A;  4BXO B;  4RU9 A;  1ZQH A;  4US8 A;  5HHI A;  2W9C A;  4DQI A;  2BCU A;  1T94 A;  2HBJ A;  5KFB A;  5F9L A;  4QZF A;  3AUO A;  1NK4 A;  2JV3 A;  3GU3 A;  1L3V A;  2Y9U A;  4YG2 A;  1L6N A;  4ED1 A;  1HUZ A;  1KSP A;  5F3X B;  2EAN A;  1SKW A;  2XCA A;  4YMM A;  4M0A A;  1C7Y A;  3MR2 A;  5KFK A;  3NVY A;  4RQ6 A;  5G5G A;  1X9X A;  5KTQ A;  4P4M A;  4GXK A;  2F1I A;  1QTM A;  4KMU A;  4QZC A;  5J2F A;  3N7P D;  1URJ A;  4E0D A;  2KFZ A;  9ICC A;  4JWN A;  2AGP A;  5ALH A;  3SI8 A;  4UBB A;  4DSE A;  1P7D A;  1NKB A;  2RLT A;  3I1Y A;  4GFJ A;  1QH9 A;  4Y2T A;  5EWG A;  3V72 A;  3WK4 A;  4PZO A;  5HR7 A;  4Y2V A;  4RQ1 A;  2KIC A;  4CGZ A;  1JUD A;  2YB4 A;  4Y2Q A;  5J0T A;  2VA3 A;  3C1Z A;  5J0O A;  3QUC A;  3N7S C;  1O03 A;  4RQ2 A;  1KEJ A;  5KFA A;  3A0B U;  4RQN A;  3B0Y A;  1ZQK A;  2MUT B;  4YMN A;  2P6R A;  1SXD A;  4ZOH C;  3CP8 A;  3J81 j;  4F8R A;  3RJJ A;  4DSJ A;  3BZC A;  4B9T A;  4RNO A;  3RRG A;  3RB0 A;  4AP9 A;  4UB8 U;  1RQL A;  1TAM A;  3AMZ A;  1SKR A;  4RQ4 A;  3LVW A;  3H8W A;  1HJP A;  2JEI A;  2E8M A;  1SV0 C;  2PFQ A;  3MAB A;  5AM1 A;  4RZR A;  3PX4 A;  2ZIW B;  8ICB A;  1RM6 C;  3PR4 A;  2PFN A;  4TUR A;  2W54 A;  1ZD3 A;  2H3Q A;  3LWL A;  3QYP A;  1S76 D;  4NL9 A;  1BPX A;  3RTV A;  4NY8 A;  4P0Q B;  3OTQ A;  7ICQ A;  2JH7 A;  3OSN A;  2AHO B;  1UA1 A;  1LKY B;  1JIH A;  4ELU A;  1X42 A;  1KBU A;  4BX9 C;  2XC9 A;  3CNH A;  3C29 A;  3JPR A;  3BS5 A;  1KKX A;  3MR6 A;  5IIJ A;  2OCE A;  3RJF A;  5HR6 A;  5ALL A;  8ICT A;  3EPI A;  2JMG A;  3GII A;  4JMU A;  2JXJ A;  3K75 D;  5J8Y A;  5J2D A;  5IIK A;  1D9D A;  4DL4 A;  5CRX A;  4QW9 A;  5KFQ A;  8ICM A;  4KLG A;  5KT2 A;  5B66 U;  4PHE A;  2BPF A;  3H4B A;  2A1J B;  4J9N A;  2W55 A;  5JRT A;  3RJK A;  1WG8 A;  8ICE A;  3WK9 A;  5BPC A;  3RR7 A;  4NLB A;  2QLT A;  1ZQZ A;  2LM4 A;  3JPQ A;  3BQT A;  1NJW A;  4ECW A;  1ZD2 P;  3VC8 A;  3IG5 A;  5IIL A;  7ICE A;  1TV9 A;  3QNM A;  5DLG A;  9ICU A;  5AK4 A;  7ICH A;  2UVV A;  2EDU A;  3Q8M A;  2FMP A;  4KLF A;  1J2N A;  1RQN A;  4B6J A;  4DL6 A;  5J2C A;  3GIK A;  4M04 A;  4GXJ A;  4ED2 A;  4IRK A;  5IIM A;  3UXP A;  1X9S A;  8ICG A;  3TAR A;  3GIJ A;  1L8L A;  5J2J A;  4IQT A;  4EYI B;  2GO7 A;  2Q4T A;  2IBK A;  2K4E A;  3NTU A;  5ALW A;  4F5R A;  4KLL A;  1L3T A;  4TUP A;  5BOL A;  3NVZ A;  3KOO A;  1PVQ A;  1WWV A;  3GQC A;  4ACO A;  1ZQA A;  2W8L A;  3PMN A;  1JI7 A;  3ZDD A;  3BZK A;  3E58 A;  2V4R A;  3LYS A;  4F4K A;  3H40 A;  3ZDC A;  4GXI A;  4YR3 A;  1YZ7 A;  4YXM A;  2JGA A;  1ZOL A;  1SZH A;  5G5H A;  1MA7 A;  2KTQ A;  2ZTC A;  1B0X A;  4XA5 A;  4KX3 A;  2KKV A;  4PL1 A;  1N48 A;  3M1Y A;  3AL0 B;  4UAY A;  3EWA A;  3SAH A;  2M0N A;  5DB7 A;  3B0X A;  2XO7 A;  4R65 A;  1XO0 A;  4DEZ A;  2GOL A;  4ECV A;  2NRT A;  9ICQ A;  5KG5 A;  3EPG A;  4DQS A;  4EBD A;  1ZQF A;  5L1K A;  4CF4 A;  4MHV A;  2W9C B;  5KNI A;  1JXL A;  1SL2 A;  3C5G A;  2K60 A;  1MSW D;  4WJ3 B;  3PSF A;  4Z6C A;  1QSL A;  3WK8 A;  3QEB Z;  4NJ8 A;  3M9O B;  4YD2 A;  3PNC A;  3UMC A;  3H4D A;  5A0L A;  7ICS A;  3PX6 A;  4MFC A;  1L3U A;  2XI9 A;  4RUC A;  3IV6 A;  2PFP A;  2GLE A;  3MGH A;  3K1Z A;  3F2D A;  2E8P A;  5AI5 A;  4NLK A;  5TZV A;  3AN1 A;  1COK A;  2ZJ8 A;  4PH5 A;  1FEZ A;  1ZQL A;  9ICN A;  2G08 A;  2ODG A;  4IQV A;  2JEF A;  3Q8Q B;  3TAN A;  1XU4 A;  4O3P A;  4AYB F;  1RXV A;  2HVI A;  5GTH U;  3UPQ A;  3M6K A;  3TI0 A;  2H3I A;  1B22 A;  2ASJ A;  2MUT A;  4Z6F A;  3PW5 A;  2OEH A;  1ZD4 A;  5ALO A;  1IXR A;  2JEG A;  5ALQ A;  3N4M B;  2EZZ A;  5KFE A;  2KP7 A;  3M9N B;  2R8J A;  2KZM A;  1D8B A;  4QZA A;  4FBT A;  3RH4 A;  3ZDE A;  1H38 A;  2ZJ5 A;  2LYA A;  3HPO A;  5AKY A;  1ARO P;  3N7R C;  3QU4 A;  2BZF A;  4F91 B;  1CI4 A;  1SV0 A;  1JN3 A;  5KG2 A;  4RQ5 A;  2YY6 A;  4P0Q A;  2QKQ A;  1N61 A;  2ZIU B;  3KHH A;  1SKS A;  2QB1 A;  5ALK A;  4CE6 A;  2BDP A;  2RDI A;  3ETR A;  3KKA A;  1LKY A;  4YVZ A;  5KL1 B;  2DKZ A;  3T5K A;  1ZQU A;  3JPP A;  4DWI A;  4UQG A;  4EEK A;  8ICO A;  3H8J A;  3EW9 A;  2HHW A;  4FS2 A;  1S0O A;  9ICM A;  4R8U B;  3NGD A;  4O0I A;  1NKE A;  5DBB A;  4C4T A;  2Z7J A;  3PR5 B;  4F4W A;  2WHE A;  3UXN A;  4C0Z A;  2WTF A;  1RDF A;  3OJS A;  4PGX A;  2O6K A;  1U49 A;  2A1J A;  4ECU A;  3SQI A;  4IRC A;  1ZQE A;  1NKC A;  1S0M A;  5AKI A;  4YD1 A;  3WKE A;  2BDU A;  1L7N A;  2DQN B;  2K89 A;  2RHF A;  1KW4 A;  4DS5 A;  4DFJ A;  3ISB A;  3CRX A;  2ISO A;  3TQ1 A;  4NXZ A;  7ICF A;  2LBO A;  5DG8 A;  5HNK A;  1A77 A;  2F8L A;  4DL5 A;  3FM9 A;  2BGW A;  3C1Y A;  2F77 X;  3EYZ A;  3PVX A;  1RZT A;  4ECT A;  2RRD A;  3IM1 A;  1QQ6 A;  2FLP A;  4P4P A;  2ZG6 A;  4UB2 A;  2AGO A;  4C8K A;  4BGD A;  3C2L A;  4M6W A;  2I1Q A;  4LJX A;  1CEZ A;  2XVT A;  2VAN A;  1S10 A;  4Y2R A;  2HMX A;  4U6P A;  4RQ8 A;  3RAQ A;  3MGI A;  5DB6 A;  2EZX A;  1IM4 A;  4ELT A;  4OD0 A;  5KFM A;  2FMQ A;  2OH2 A;  4YXJ A;  1J97 A;  3G6Y A;  9ICF A;  4ELV A;  1IG6 A;  2FE9 A;  2R18 A;  1NK9 A;  4JUZ A;  2LPE A;  2KIW A;  3HJE A;  5III A;  4O9M A;  3PZP A;  4O3R A;  4Z6E A;  4DQQ A;  5HML A;  2ASL A;  1Z00 A;  2K4H A;  3V7K A;  3H0R B;  5JUM A;  4J9S A;  4DFD A;  3WU2 U;  1MN8 A;  4UB5 A;  2UVW A;  4RQM A;  4UAV A;  4UB6 U;  5ALZ A;  4I2D A;  2YMM A;  2H3V A;  1ZQV A;  3SV4 A;  4QWA A;  4QZB A;  5KT4 A;  1RYS A;  2HBL A;  1BNP A;  2N1R A;  4JV0 A;  2HW3 A;  9ICK A;  2IA6 A;  2BPG A;  2KJ8 A;  2OYY A;  4PPX A;  1OW5 A;  4CCH A;  4QZ9 A;  3MC1 A;  4PJ0 U;  2UVU A;  2HOI A;  3KD3 A;  1N5W A;  5DG7 A;  2V9W A;  4ICA A;  1UT5 A;  3QZ7 A;  1T8E A;  2HHV A;  2ISP A;  2VA2 A;  2HBM A;  1Z4N A;  1MC8 A;  4F2S A;  2MAX A;  9ICB A;  2DL0 A;  3O0F A;  4M9J A;  2A19 A;  3OHB A;  1FFV A;  3LWM A;  3QU5 A;  3ZD9 A;  2NRX A;  2MA1 A;  4ECQ A;  2ZJA A;  4KLE A;  2W7P A;  2R8G A;  4JK1 A;  1S97 A;  3UQ0 A;  3D2Q A;  3BQ0 A;  4I29 A;  1S9F A;  2XID A;  4PHA A;  5KG4 A;  1XS9 D;  4B9U A;  2KFN A;  1V85 A;  4FBU A;  4P0P A;  1ZQX A;  4K4H A;  4F93 B;  4O3N A;  4I27 A;  9ICE A;  4ED7 A;  1LV5 A;  2OHF A;  4DCC A;  1JRO A;  1WYG A;  5F9N A;  4QWD A;  4UAR A;  2ZUB A;  1UCV A;  4ECZ A;  1Z4O A;  3IDW A;  4QZD A;  2WF7 A;  5AI4 A;  2K8B B;  3ZDB A;  3QU9 A;  1QQ7 A;  4US9 A;  4LZG A;  3KZI U;  3C23 A;  5KFN A;  9ICT A;  1A76 A;  1QLN A;  1V9P A;  3IP4 B;  4UAU A;  3KBB A;  1KL9 A;  2CPR A;  2BCR A;  3K1R B;  5H2F U;  4BWJ A;  4F50 A;  1IIP A;  3T3F A;  1LVH A;  4O5K A;  2KG5 A;  3N97 B;  2I5H A;  5KG7 A;  9ICO A;  5BOM A;  1ZQR A;  4DLE A;  4JV1 A;  3RAX A;  3PW4 A;  2ZIU A;  4EEY A;  1COO A;  7ICK A;  3KKA C;  3HP6 A;  1BPE A;  2JRZ A;  1D9F A;  3BQ1 A;  3KHG A;  2F3N A;  4J9O A;  1SZP A;  3AU6 A;  3V6K A;  5J2E A;  5AI0 A;  4DSF A;  4YN4 A;  4UAW A;  2KNJ A;  3H8S A;  4R8U A;  1Q8K A;  4Y2S A;  2F76 X;  1UPH A;  2I6X A;  2WF8 A;  2HBK A;  4XUS A;  3F2C A;  7ICI A;  1XWL A;  4KN7 A;  4P4O A;  2Q0Z X;  2G09 A;  2GWS A;  3C2M A;  3RB3 A;  1PVR A;  2K8C B;  1ZD5 A;  2KKP A;  5ALT A;  1ZXI A;  4YR2 A;  4BJQ A;  5L1I A;  3PML A;  2K4I A;  4RT3 A;  3QE9 Y;  4Q8E A;  1VJ5 A;  5D46 A;  3V7J A;  2JR5 A;  2K4P A;  3QUQ A;  3WKB A;  4DQR A;  1F0M A;  5AI9 A;  2DUY A;  3HW8 A;  3QU7 A;  4BDP A;  3T5J A;  5KAI U;  4DLG A;  1Q3U A;  3QU2 A;  4TQS A;  3KHL A;  9ICA A;  3I76 A;  3F5A A;  4I2A A;  4IQU A;  5ALY A;  3GFK B;  4F71 A;  4O3S A;  4NM1 A;  3SD7 A;  5AIB A;  2C2D A;  5KT3 A;  4TQR A;  4MFA A;  1TAU A;  5DLF A;  1SWW A;  1B4F A;  2B21 A;  2E1F A;  3PST A;  5AM0 A;  5DGA A;  4Y2P A;  4M6W B;  4FZM A;  1TAQ A;  5KFG A;  2BQR A;  4YFK A;  1RXW A;  3H0M B;  4CRX A;  1ZYQ A;  3FAH A;  5D49 A;  3GDX A;  4QZH A;  3MR5 A;  1NJX A;  5EE9 A;  1TK8 A;  2VJ4 A;  5ALJ A;  5J0Q A;  2FPM A;  8ICY A;  4DSK A;  2BQU A;  8ICX A;  3RRH A;  1ZRN A;  2J6U A;  2C22 A;  4DL7 A;  2VIX A;  5J2B A;  7ICM A;  2NRW A;  3C5F A;  4TUQ A;  4DO9 A;  5KG1 A;  2HHS A;  1MQ3 A;  1NK5 A;  2KSO B;  2MSN A;  3OPX A;  5E79 U;  3DDH A;  2EAM A;  5KFZ A;  1Z00 B;  4CDG A;  9ICP A;  4R64 A;  2EAP A;  5DQH A;  4O3M A;  2IOF K;  5KAF U;  5EE3 A;  2Y9T A;  2DWQ A;  3K4G A;  1ZQQ A;  4ED0 A;  4QIW C;  3Q8K A;  2HSZ A;  5DB9 A;  4QIW F;  5KFW A;  4UW9 A;  4YCX A;  8ICS A;  3OGU A;  4OJ6 A;  2DPI A;  3Q8L A;  3WK5 A;  2W8K A;  5DG9 A;  4OJO A;  1SB3 C;  1XO1 A;  3M9M B;  5DQI A;  1SIJ A;  2FJ6 A;  2E8N A;  4UBC A;  1ZQS A;  5HMM A;  4Q43 A;  5GTI U;  1JAL A;  3SZ2 A;  4UB1 A;  2LYB A;  4DF8 A;  7ICU A;  7ICN A;  8ICK A;  8ICN A;  1BVS A;  4NLC A;  4RQ0 A;  4QJF B;  4I2F A;  4LZD A;  5AK3 A;  3V6J A;  1QCK A;  2DPJ A;  4EYH B;  5AK6 A;  2XY6 A;  1N5X A;  1KLN A;  3T79 A;  3TFS A;  3JPT A;  2NO4 A;  1S0N A;  5KG0 A;  4R63 A;  4DOA A;  3ISD A;  4CF5 A;  1TVA A;  1F5S A;  3OHA A;  1SL1 A;  1BPZ A;  1PK1 B;  2ESE A;  4P0P B;  5CEH A;  3GV7 B;  3D2S A;  4M47 A;  4F4Y A;  3PO4 A;  3UQ2 A;  2CN1 A;  3BQ7 A;  3FDS A;  4DF4 A;  2DF4 B;  3AQF A;  4Z6D A;  3IHQ B;  1DOQ A;  5ALE A;  2E3T A;  1RYR A;  5ALM A;  5ALU A;  4KMO B;  8ICP A;  4F2R A;  4C80 A;  3HWT A;  3FC4 A;  8ICW A;  4PZN A;  1K5O A;  4OJL A;  4RQ7 A;  3BS7 A;  5TIS U;  4F3O A;  3UMG A;  5J2G A;  5J2I A;  5L1J A;  5CWR A;  5AKE A;  2NYV A;  3TKA A;  1NOM A;  1SWV A;  4BWM A;  2HOF A;  1RG6 A;  1HEK A;  2PI5 A;  2PMZ C;  2P6U A;  3UM9 A;  1ZQJ A;  4F5N A;  3B9J A;  2BPC A;  5J0S A;  3KTQ A;  2PMZ F;  5KFU A;  3M8S A;  2KN7 A;  1NJY A;  1X6I A;  1NZP A;  2HHT A;  1Z1V A;  2NRZ A;  3C2K A;  3RJG A;  2KVC A;  2FPK A;  1YT3 A;  1UA0 A;  2HVH A;  2YTU A;  1ZQY A;  4IL6 U;  4RPZ A;  3ZI4 A;  1VDV A;  2W9M A;  4J9P A;  3G6V A;  1GO3 F;  1FO4 A;  4C7Z A;  9ICH A;  2C28 A;  5J0W A;  2KE7 A;  4RQ3 A;  3PSI A;  1C20 A;  2BCV A;  1T7P A;  2BQ3 A;  5IIN A;  2KJ9 A;  4JB3 A;  3VCB A;  1ZQG A;  4QZ8 A;  5J0P A;  2W9A A;  2G5H B;  1PK3 A;  3N28 A;  4GIB A;  1YZ6 A;  2YML A;  5DDY A;  2E1E A;  7ICJ A;  5HP4 A;  3H7I A;  4C4R A;  3C28 A;  4YP3 A;  1WCL A;  4LVS A;  4QZE A;  1TKD A;  2W3R A;  3V6H A;  4C8L A;  1WWU A;  4MF2 A;  1VLB A;  1N2X A;  2BHN A;  7ICP A;  3IRU A;  3KZX A;  5ALX A;  9ICW A;  5DQG A;  8ICZ A;  2WF6 A;  5ALR A;  1UHU A;  1XSP A;  3UXO A;  3NRZ A;  5CP2 A;  4QW8 A;  2ATL A;  1U47 A;  4CF3 A;  5KFC A;  2LYH A;  3RBE A;  3ONN A;  8ICU A;  4QWE A;  1K1S A;  3F53 A;  4KLO A;  4M9N A;  4Y2Y A;  4M9G A;  3BQ2 A;  2NO5 A;  1XSN A;  3SAF A;  1S0V A;  1A6S A;  2FI1 A;  5CB1 A;  3HKZ C;  3A0H U;  5CA7 A;  2NRV A;  1S77 D;  8ICR A;  4PGY A;  3PSP A;  2B0C A;  4F92 B;  1BGX T;  1L8O A;  1NK0 A;  3GV5 B;  1DGJ A;  2KSO A;  4QZI A;  1JMS A;  4I2H A;  2V4Q A;  4ECY A;  5JTI A;  2IMW P;  3PO5 A;  1NK6 A;  3D6J A;  2KV2 A;  4UB3 A;  1PVP A;  3QX7 A;  1ZQW A;  8ICF A;  3TAP A;  4KLI A;  2AJQ A;  5DBC A;  3MDA A;  4ECS A;  2FPL A;  5AKX A;  1ZJN A;  3GZF A;  4IR9 A;  4I2B A;  2ZXI A;  2HHX A;  7ICT A;  1BPD A;  2DBY A;  2KHV A;  4MF8 A;  1N62 A;  4I2I A;  2XY5 A;  1V38 A;  2HDO A;  1CUK A;  2ZIV B;  2A3V A;  3H8M A;  8ICJ A;  4OJP A;  1L7M A;  5DKW A;  2IHM A;  8ICC A;  4Y2J A;  1T3N A;  4Q45 A;  4P2H A;  4B9N A;  2D3D A;  1ZQT A;  2JHD A;  5KFY A;  2FLN A;  2FMS A;  4A8E A;  3E2E A;  3PV8 A;  4K4I A;  4IS7 A;  1T4G A;  4EBE A;  4KLS A;  4EEL A;  5J2A A;  4U7C A;  2IHN A;  1LB2 B;  5ALN A;  1MQ2 A;  7ICL A;  3TAD C;  3MGV A;  4B9S A;  4KTQ A;  4GLX A;  7ICO A;  1TE2 A;  5AI8 A;  3RB4 A;  5CR0 A;  4YMO A;  3RJE A;  1L7P A;  4PHD A;  2Y1J A;  5C0Y A;  1WUD A;  1S8O A;  3EUB 2;  1PK1 A;  5EWE A;  2Y1I A;  1ZQD A;  4UB4 A;  2KK0 A;  2YX8 A;  2ZXH A;  2C2E A;  1XSL A;  4RNN A;  1ED1 A;  3DV9 A;  2W04 A;  3SMV A;  2D8C A;  2Y0S C;  3PX0 A;  1U9L A;  2ZUD A;  3PY8 A;  1RYU A;  3TAC B;  2RDJ A;  4DL2 A;  3NVW A;  2Y0S F;  4B9M A;  1NI3 A;  1F44 A;  3QUT A;  4OCZ A;  2KJ5 A;  2KOB A;  1V97 A;  4F5O A;  2HOQ A;  3H0L B;  1NZB A;  5KFO A;  4IQW A;  8ICQ A;  1X9M A;  4BUG A;  2ASD A;  3QUB A;  2W9B B;  4ECX A;  4GC6 A;  1HUO A;  5KFP A;  3KHR A;  2DGZ A;  4J9K A;  4ED3 A;  2PXI A;  2I9G A;  4YR0 A;  1PUZ A;  4RPX A;  3MFI A;  3WKD A;  3ETL A;  5AHX A;  2R8K A;  2AGQ A;  4TUS A;  4C4S A;  1Z1B A;  2ES6 A;  2AU0 A;  2QB0 A;  4I2C A;  9ICR A;  5AIA A;  1BPB A;  1ZQM A;  2YMQ A;  3GIL A;  1ZQN A;  2LM1 A;  2WB1 C;  1D8Y A;  1EXN A;  3QZ8 A;  3JPS A;  5KFF A;  4DFP A;  2PI4 A;  5KFR A;  2BCQ A;  2KD1 A;  3RF9 A;  3G6X A;  3SV3 A;  2HHU A;  2MRL A;  4OJ5 A;  2WB1 F;  2OM6 A;  2VJ5 A;  2BCS A;  1KTQ A;  2G0A A;  3DEE A;  4O5E A;  1FFU A;  1DGS A;  4Y2U A;  1N63 A;  3TFR A;  3T5L A;  1SL0 A;  4Q44 A;  1S5L U;  2JZB A;  8ICH A;  2EQY A;  7ICG A;  4J03 A;  2D6F C;  2R8I A;  5KG3 A;  3RJI A;  3PW0 A;  3OJU A;  2YB1 A;  2KVS A;  1RPL A;  1JRP A;  8ICI A;  1UT8 A;  4DSI A;  4DOC A;  4EBC A;  3FYH A;  1XC9 A;  1L5U A;  5EOZ A;  2EH9 A;  2AQ4 A;  4KLU A;  2CXY A;  1SXE A;  2RP5 A;  3CYM A;  3THV A;  2OXO A;  3ICX A;  2J6T A;  2YQE A;  1N60 A;  1DK3 A;  4FZL A;  4G9B A;  1T3Q A;  9ICI A;  4EZ9 A;  2ZIX A;  3GV8 B;  5EE0 A;  2F44 A;  4NLN A;  4GC7 A;  2XIC A;  2JEJ A;  1IV8 A;  2P35 A;  3LVV A;  1K1Q A;  5KFI A;  4DOB A;  1ZET A;  1SV4 A;  5ALF A;  1HIW A;  1AQ6 A;  3L5K A;  3GIM A;  5HHH A;  2WF9 A;  4DS4 A;  3RBD A;  1N56 A;  5KL8 B;  3SEN A;  3RJH A;  5T14 A;  1B43 A;  5J0X A;  3Q8S B;  3PW2 A;  3NVV A;  1D8L A;  1ZQB A;  2H3F A;  2WFA A;  1NK7 A;  3NAS A;  5C5J A;  4B9L A;  3NS1 A;  4M9H A;  2ZTD A;  2XGP A;  2ALZ A;  2L5Y A;  3MFH A;  3JPO A;  3LDA A;  5IIO A;  1X66 A;  2G07 A;  3SAG A;  4DQP A;  3WKA A;  2VA8 A;  5J0U A;  3HIL A;  4Y2X A;  4YQW A;  4KLD A;  1O08 A;  4J9M A;  2W03 A;  2KEY A;  2W43 A;  3R9K A;  2DKX A;  5AKG A;  4JWM A;  3HRD D;  1PZN A;  2H5X A;  5KFT A;  2QAR A;  4NWI A;  3CW2 C;  2FDR A;  2B6G A;  5ALD A;  2KZ3 A;  1DXS A;  5AI6 A;  2LKY A;  9ICG A;  4HYK A;  1KDH A;  2F1H A;  2M9N A;  2ZIV A;  5J0R A;  4KN4 A;  2KZZ A;  1KFS A;  1JX4 A;  5AKJ A;  1ZQO A;  2E5S A;  4O3Q A;  4KLM A;  5KT7 A;  3ED5 A;  1L3S A;  4RUA A;  5KFS A;  4ZH4 A;  9ICV A;  5KFV A;  2OWO A;  4PHP A;  1QSY A;  5K4L A;  1FIQ A;  3HT3 A;  2LI6 A;  3WK7 A;  4CNQ A;  2UVR A;  4RT2 A;  5KFX A;  3BJY A;  3SR6 A;  1KFD A;  1DK2 A;  4BXO A;  2AQ0 A;  3ZD8 A;  2XGQ A;  4NLG A;  1NNL A;  4I2E A;  3ZDA A;  1TFR A;  3D2N A;  2IOF A;  3RR8 A;  2YMP A;  4QNL A;  3TAD A;  3AM9 A;  2ZTE A;  2K8A A;  5ALP A;  1L7O A;  4FO6 A;  5ALV A;  1Z3E B;  2NV3 A;  4UAS A;  4QWC A;  2BR0 A;  5J0Y A;  3F2B A;  3JPN A;  8ICV A;  3TAQ A;  2A1A A;  3ORY A;  4HAI A;  5L1L A;  1UQV A;  2PKE A;  5ALI A;  5AKK A;  2W3S A;  8ICA A;  5AKZ A;  7ICV A;  5AM4 A;  1ECW A;  4NLZ A;  4USA A;  4AYB C;  4I28 A;  4I2G A;  4DL3 A;  4FS1 A;  4X5V A;  4J9R A;  5AK5 A;  2W9B A;  1BNO A;  5CHG A;  1ZQ1 C;  1ZRM A;  9ICJ A;  5KFH A;  3MR3 A;  3EZ5 A;  4EZ6 A;  3E0F A;  1KFT A;  2XY7 A;  3IN5 A;  1NK8 A;  4DFM A;  4B9V A;  4ED6 A;  3RB6 A;  4ECR A;  4FE3 A;  5KFD A;  2E8O A;  1X2I A;  4R66 A;  9ICL A;  4RNM A;  4IC9 A;  2WF5 A;  2QB0 B;  1KQQ A;  1KRP A;  4NM2 A;  4F5P A;  4O3O A;  4EX6 A;  2ZIW A;  1J2M A;  4C8O A;  5D4B A;  5KT5 A;  5CJ7 A;  4Q8F A;  2MU2 A;  3F5E A;  3KFU F;  4NL9 C;  2G5I B;  2LMR A;  4XRH A;  4QZG A;  5JU5 A;  9ICX A;  9ICS A;  3M6Z A;  3M8R A;  2JZB B;  1TK0 A;  1CRX A;  2KIV A;  5FP0 A;  2EAO A;  1ZJM A;  1OXJ A;  5AKL A;  5AM2 A;  3AQE A;  5B5E U;  5J29 A;  4IRD A;  3RH6 A;  5DBA A;  1Q46 A;  4C8N A;  4MFF A;  4KX5 A;  3NUQ A;  4PGQ A;  3M7D A;  5J8Y C;  5KFJ A;  1ZQP A;  1A0P A;  2F1J A;  3BS5 B;  1JXE A;  2R8H A;  3OSP A;  3QEA Z;  3AEV A;  4JV2 A;  4FZN A;  3LK9 A;  2AH5 A;  3C21 A;  3RFA A;  1BPY A;  7ICR A;  2HHQ A;  1TK5 A;  2G06 A;  1X40 A;  3WK6 A;  4EEN A;  4C8M A;  2W11 A;  4PL2 A;  3UMB A;  5KT6 A;  2IOH A;  1ZQI A;  2KMD A;  4J9L A;  1M6Y A;  2ZUC A;  1Z19 A;  2BKE A;  2ZIX B;  4MEY A;  5ALS A;  3S6J A;  5L1M A;  2F8K A;  2WAQ C;  4KLQ A;  2HI0 A;  2FLL A;  4EX7 A;  3MBY A;  1KN5 A;  3RH5 A;  1X9W A;  5DGB A;  3MDC A;  2KHQ A;  1NJZ A;  2F2A B;  2AXT U;  2WAQ F;  1WCN A;  3ALR A;  4UAZ A;  1DRG A;  1U48 A; 
#chains in the Genus database with same CATH homology
 2KG5 A;  1LKY B;  5F3X B;  1OW5 A;  2QB0 B;  2KE7 A;  1KW4 A;  2EAN A;  3BS5 A;  1SGG A;  1X9X A;  2F44 A;  3KKA C;  5J8Y A;  1PK1 B;  2ESE A;  2F3N A;  1B0X A;  1PK3 A;  4NL9 C;  1SV4 A;  2LMR A;  5JU5 A;  2DL0 A;  3TAD A;  1V38 A;  3BQ7 A;  3H8M A;  2ES6 A;  3SEN A;  2KIV A;  2QB0 A;  2EAO A;  1OXJ A;  5JRT A;  2KSO B;  1WWU A;  2D3D A;  2EAM A;  4PZO A;  2QAR B;  2EAP A;  4PZN A;  1SV0 A;  4IS7 A;  5J8Y C;  3BS7 A;  1V85 A;  3BS5 B;  2L5Y A;  1X66 A;  2Y9T A;  2QKQ A;  4RQN A;  1UQV A;  2QB1 A;  4MHV A;  3HIL A;  3KKA A;  1SXD A;  3TAD C;  1LKY A;  5KNI A;  2DKZ A;  2FE9 A;  1X40 A;  2LPE A;  1UCV A;  1RG6 A;  2K60 A;  2DKX A;  3IDW A;  4NJ8 A;  2K4P A;  2KMD A;  1F0M A;  2QAR A;  1PK1 A;  2E8M A;  2B6G A;  1SV0 C;  2E8N A;  1DXS A;  2GLE A;  3SEI A;  4RQM A;  5L1M A;  2F8K A;  2E8P A;  1Z1V A;  1COK A;  2YTU A;  1WWV A;  2D8C A;  3K1R B;  4NL9 A;  3TAC B;  2KSO A;  2E8O A;  1SXE A;  2JV3 A;  1JI7 A;  2Y9U A;  5JTI A;  1B4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...