4NJ8A

Crystal structure of the human anks3 sam domain l52a mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
RAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITAFGPKRKMTSAIARWHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ankyrin repeat and SAM domain-containing protein 3
publication title Characterization of the SAM domain of the PKD-related protein ANKS6 and its interaction with ANKS3.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4nj8A01
2E8OA 2Y9TA 1JI7A 2B6GA 4NL9C 2Y9UA 4RQNA 2EAMA 3HILA 1PK1A 2L5YA 3BS5A 4IS7A 2ES6A 2F8KA 3KKAC 2KG5A 1WWVA 2QB0B 5F3XB 1COKA 2QKQA 3H8MA 3KKAA 5L1MA 1Z1VA 3BS7A 3BQ7A 5JTIA 3K1RB 1SV0A 2D3DA 2EAOA 2EAPA 1UCVA 2KSOB 2GLEA 1RG6A 4NJ8A 1SXEA 2QB1A 1SV0C 2K60A 1OXJA 5JRTA 2E8MA 1LKYB 2KMDA 2DL0A 5JU5A 2QARA 1B4FA 2JV3A 1PK1B 3BS5B 1SXDA 1WWUA 2DKXA 1SV4A 2LMRA 3SEIA 4PZNA 3TACB 1OW5A 2KIVA 2EANA 2D8CA 1KW4A 1SGGA 2YTUA 2QB0A 1X66A 1DXSA 2K4PA 1V85A 3IDWA 1LKYA 4MHVA 1B0XA 2F3NA 1V38A 2KE7A 1X9XA 5J8YA 1F0MA 4RQMA 5KNIA 2F44A 3TADC 2ESEA 3SENA 4NL9A 2E8PA 2E8NA 1UQVA 1PK3A 1X40A 2LPEA 2DKZA 3TADA 2KSOA 2FE9A 5J8YC 4PZOA 2QARB
chains in the Genus database with same CATH superfamily
3KHRA 1JI7A 1KEJA 3ZDEA 5KFYA 1SB3C 4O3QA 1SWVA 4KMOB 2Y9UA 7ICTA 2FLNA 2FPLA 2KJ5A 1J2NA 4IS7A 2H3ZA 1HEKA 2Y1JA 2PI5A 1QH9A 4KITB 4YG2A 3MDCA 2QKQA 5AI6A 2HSZA 2PFPA 2JEGA 8ICOA 4Z6DA 3BS7A 3G6VA 2IOFK 3WKDA 1S10A 5KT3A 3HWTA 4DFPA 3OHAA 3FYHA 3PW4A 5B5EU 5KT7A 4F5PA 5ALRA 4EYHB 3N4MB 1JX4A 4J03A 4CDGA 4ECQA 5KFHA 2H3QA 5J2GA 2PMZF 3GQCA 3RJFA 2DL0A 3RR8A 4RNOA 2K4HA 5IIOA 2HHSA 5BOLA 1PK1B 2I6XA 8ICSA 3QZ8A 2BZFA 3QUQA 1ZQNA 4PJ0U 4BGDA 1BNPA 1B22A 5L1LA 2ATLA 1QQ6A 4UQGA 1TV9A 5DG9A 3H8SA 5DG8A 4OJPA 4YD1A 4JV2A 4C8KA 3ORYA 3TFSA 4O3PA 9ICLA 4JV0A 5AI9A 4QZ9A 4YXMA 4BUGA 1D9DA 5KFDA 3NVVA 5KT5A 2VA2A 1Z3EB 4DF8A 3T3FA 2W8LA 3H4DA 4KLHA 4DF4A 4M9GA 5J0RA 3BJYA 5AK6A 4FZNA 5AKLA 8ICWA 4C0ZA 2LPEA 1XWLA 2KSOA 1ZQGA 3TI0A 4XQ8A 4M04A 5CEHA 2YQEA 2BCSA 4Y2VA 3RH4A 4BXOB 5HR7A 5KG5A 3QYPA 2PI4A 2RHFA 1L5UA 1RPLA 1K5OA 1ZQUA 1RYUA 5KG6A 3IP4B 4RPZA 2HMXA 3M8RA 4KTQA 1RYSA 3MC1A 5AM2A 4DS4A 3PZPA 4F91B 1BPZA 4Q44A 1UA0A 1QQ7A 3TANA 4ELVA 1NOMA 2OM6A 3V7LA 4F8RA 5IIJA 3M9NB 4ECZA 1S77D 3LYSA 8ICEA 1P7DA 3HRDD 2BGWA 8ICKA 5IINA 4M6WB 4I2DA 3UXNA 3MR6A 2P66A 4RQ4A 5IIIA 2DBYA 1IG6A 2WHEA 4DSLA 5ALQA 1OXJA 2WFAA 4PGXA 3H0RB 3N97B 2JV3A 1NJWA 2ASJA 4EZ6A 4PZNA 2FMSA 4US9A 5KFLA 1ZQKA 4IQUA 5BPCA 1BPYA 4UB6U 3IN5A 3ONNA 4JUZA 5KFPA 3PSTA 5GTHU 8ICZA 7ICHA 2HHVA 1WUDA 4ECXA 2ZIXA 4J9SA 2W9AA 4ICAA 1X9XA 5KNIA 3AN1A 4I2CA 4I27A 2UVVA 1MQ3A 1PUZA 3KHHA 2FI1A 1XSPA 1DK3A 5IIMA 2LI6A 5KFOA 4RQ0A 9ICEA 4F5OA 1C7YA 1ZQBA 1S97A 1RQNA 2C28A 4JK1A 2JEFA 4RT2A 4C7ZA 2F8KA 4GIBA 2CXYA 4Y2QA 7ICLA 4O3SA 3RFAA 4QW9A 1WWVA 2QB0B 2KVSA 4NXZA 3BZKA 3WKEA 4ELTA 4ECTA 4BX9C 3F5AA 5L1JA 4GXJA 5DQGA 5KFCA 2AH5A 4R64A 3BQ7A 5DBAA 4A8EA 2OHFA 3UQ0A 1V97A 3GV7B 2V4RA 1JXEA 3RTVA 2Q4TA 3J81j 3Q8RB 1KLNA 3AQEA 4X5VA 2W3RA 1ZQXA 3WK6A 1MC8A 4B9VA 2KFZA 3BS5B 4F72A 5J2IA 1Z00B 2JMGA 4QZEA 5CRXA 2A1AA 4ED0A 4EZ9A 1KRPA 4QZFA 4EEYA 5DDYA 1MSWD 1XO0A 1YT3A 2NRTA 9ICAA 3PSFA 1HUZA 1V85A 3QX7A 3GIMA 2ZIUA 2JRZA 2A19A 1F0MA 8ICMA 3QE9Y 5KG4A 2W9BB 2ZIWA 5ALFA 1XSNA 3IHQB 2KD1A 4P2HA 8ICIA 3TADA 2V9WA 4QWCA 4IR1A 4EENA 4ECUA 3T5LA 1ZETA 1ZQMA 4UB5A 3HPOA 4TQRA 4DQSA 4PPXA 1NJZA 3RBDA 3ALRA 4J9PA 1Y88A 1D8LA 1IM4A 3PO5A 5KFIA 5EOZA 4MFCA 4CGZA 1QSYA 2VA3A 2JEIA 3PMLA 2KOBA 5ALVA 1A77A 3PX6A 3SAFA 4B9LA 4CCHA 5TZVA 2ZUBA 1ZJNA 2YX8A 4M0AA 3PMNA 3TFRA 2EZXA 3CP8A 1ZRMA 2K4IA 1L3UA 1M6YA 2W11A 1KN5A 1O03A 2K4EA 1ZRNA 2XCPA 1T7PA 4QZBA 5KFMA 2C2DA 5KFBA 2KICA 1SXEA 2XCAA 4FBTA 4KLEA 3AEVA 1BVSA 3MABA 1X2IA 4O3NA 2YY6A 3SZ2A 2E1FA 3F2CA 3BQ0A 3GDXA 3AL0B 1DGJA 3MFIA 5EE9A 4HAIA 8ICYA 2AGOA 1LV5A 1QCKA 2HHWA 3JPRA 4ED8A 8ICBA 2ZIVA 8ICPA 3IDWA 2XC9A 3CRXA 2PMZC 7ICNA 1JMSA 3FDSA 1JALA 4KN4A 5L9XA 4J9OA 4F4WA 9ICIA 4US8A 3KBBA 3IRUA 5AK5A 2VJ4A 3SENA 5J2KA 1D8BA 1NI3A 3PVXA 5AICA 5ALHA 2AGQA 4Q45A 3FAHA 3BDPA 5J2HA 3WK5A 4PZOA 4DEZA 1RXVA 4NLBA 5J2DA 2YB1A 2E5SA 4UW9A 4P0PA 4U7CA 2R8HA 1S8OA 4EBDA 1JIHA 5AM3A 3HP6A 5DKWA 4RZRA 2ZTCA 3H7IA 3PR4A 2Z7JA 2MSNA 3A0BU 2W7PA 4RQ1A 4NLCA 3AMZA 3OSNA 5ALIA 3PO4A 4F4KA 2HVHA 5KT4A 3RR7A 3PW7A 2BDPA 1U4BA 1RYRA 3M6ZA 1SZHA 4YP3A 3K4GA 4DWIA 5HMMA 3QNMA 5CWRA 1U45A 2A1JA 4NM1A 4DL2A 4O5CA 2D6FC 2OWOA 1SWWA 2KKVA 3D2NA 1B43A 2KHQA 4NLZA 2IOFA 4U6PA 4DSIA 2OCEA 4FBUA 3AM9A 2F1HA 2HHUA 4ZH4A 4O0IA 2FDRA 3V6HA 2QB1A 1VDVA 4DSFA 4DL7A 3RH5A 3NRWA 4CF4A 5JU5A 2QARA 3ISCA 2G09A 2LHTA 9ICUA 5ALOA 4JB3A 3EYZA 2DKXA 1DK2A 1CUKA 2DWQA 1ZQEA 4C80A 4P0QB 8ICVA 4Y2RA 1OW5A 4DQIA 2W9CA 3RJGA 1SKSA 1S0OA 8ICXA 1N48A 3G6XA 2JH1A 4GXIA 1U48A 5J0XA 1A0PA 4ECYA 3LDAA 2WTFA 3KZIU 4FZMA 2PXIA 1ZQDA 2YN4A 1T4GA 2ESEA 4BWJA 5GTIU 3OGUA 5CP2A 1KL9A 5AM5A 4UASA 4DOBA 4O9MA 2VIXA 3Q8QB 2E8OA 3C2KA 3RAXA 3RB0A 1LVHA 2B6GA 3SI8A 3ETLA 1TKDA 3BQTA 1FO4A 4QIWF 1DGSA 4AYBF 3V72A 3MR3A 2OYYA 2LBOA 1Z19A 3H0LB 7ICSA 1U9LA 5F3XB 1WYGA 3C5FA 2VA8A 5DLGA 2AJQA 1CI4A 1TAQA 3GU3A 1F44A 1NK7A 4P4OA 2YMQA 4KLMA 5J0PA 3LWMA 3PX4A 5ALYA 1UT5A 4IQTA 4Z6EA 3EZ5A 3K1RB 5DB7A 2R8KA 2G06A 5IILA 2PFOA 3N7RC 1U47A 4DFDA 1YZ6A 5KT2A 2NV3A 4QZAA 5J2FA 4JWMA 4DSEA 1S0MA 1RG6A 2LYHA 4KLFA 1DRGA 5KFWA 4F2RA 2XGQA 4EBCA 4PHDA 2HHQA 7ICEA 1JN3A 3Q8SB 1ZQJA 1SXDA 5HR6A 1S0VA 2JH7A 3M1YA 1NJYA 2NRVA 2H3IA 5J2BA 3RAQA 7ICIA 1Z4NA 2MUTA 3MR5A 1X66A 4YR2A 3WKCA 2HBKA 2PFQA 2YMMA 3NVZA 4QW8A 2KEYA 4I2BA 2GO7A 4B9SA 1ZD5A 2OEHA 2LKYA 3SAHA 3ICXA 1KQQA 2I9GA 2AGPA 3Q8PB 2WB1F 4UAZA 4QWAA 4P0QA 7ICKA 4F71A 4RU9A 3GV5B 4DSJA 3QEAZ 4CF3A 5KFEA 3GV8B 4I2HA 2ZJ5A 1N56A 1MA7A 1X9SA 3NVYA 1H38A 2BCQA 5L1KA 2P6RA 1N63A 3QUCA 1T8EA 1ZQZA 5TISU 3I28A 5AK4A 4QZGA 2R8IA 2FMPA 4C8MA 2H3VA 9ICWA 3OTQA 4RQ5A 5ALJA 3Q8MA 3LVVA 2HI0A 1ZD2P 2B21A 3RRHA 3NUQA 2YB4A 5AKYA 4ZOHC 1SL1A 3SYZA 3PNCA 1UPHA 4UARA 1ZQQA 4KLOA 2OXOA 5AI8A 4NY8A 3E58A 1ZQOA 1NK6A 3T5JA 2NRWA 2W54A 4Y2UA 4CE6A 2R18A 3V6JA 3VCBA 1L3TA 3TAPA 3SEIA 4Z6CA 5AKHA 3TKAA 2BQ3A 8ICAA 5KAFU 2H5XA 4FS1A 2M9NA 9ICOA 5KFXA 5D46A 1JROA 1GO3F 3F2BA 4C8LA 3AU2A 1BNOA 3SV4A 2RDJA 1B0XA 2FPMA 5J8YA 3SQIA 3OHBA 2FPKA 8ICTA 3HKZF 5EWFA 4NL9A 2E8PA 7ICPA 1JXLA 1ZQSA 3KZXA 1Z1BA 5AKIA 2XO7A 5KFZA 4Y2YA 5J8YC 1KW4A 1FIQA 4DO9A 2XI9A 4R66A 4GXKA 3RB3A 3FC4A 8ICLA 4NL9C 2KK0A 2G08A 4YMOA 4OCZA 1Z4OA 1PK1A 4YD2A 1ZQLA 1TK0A 4XA5A 5EWEA 3AUOA 2J6TA 4J9QA 4DFJA 1WG8A 2B0CA 4NLGA 3C28A 2HOFA 4USAA 1Q3VA 4GC6A 3ZDBA 4P4MA 4DQQA 3IG8A 1ZD4A 2GOLA 2K8CB 2G5IB 4KX3A 9ICXA 5KFAA 2W9MA 1KDHA 4PL1A 4GC7A 4G3IA 2G5HB 5ALTA 4I28A 3UMGA 3MGIA 1D8YA 3M6KA 3H8WA 1JRPA 5ALXA 2G07A 4DQRA 1NKBA 4EEKA 5AKKA 4BXOA 5FP0A 1KFSA 3C1ZA 5DB9A 2D8CA 4ED1A 4NLNA 4UB3A 4DCCA 3MDAA 2W43A 2BPCA 3PR5B 8ICJA 1KFTA 4I2JA 3E0FA 4C7YA 4EELA 5AM1A 2I5HA 1S5LU 4LZDA 4GFJA 1FFUA 2CPRA 2HOIA 8ICHA 5AI5A 4F50A 3KD3A 2VKQA 2R8JA 3CNHA 4M6WA 1S76D 4F4ZA 4ELUA 5B66U 4UAYA 1Q8KA 5C0YA 2K8AA 4KLUA 4MF2A 4FFDA 4QWDA 2EZZA 3THVA 3HILA 3Q8LA 4XUSA 7ICFA 5KFJA 7ICGA 4B9TA 2E1EA 2W04A 2V4QA 4TUSA 4CNQA 1MN8A 4GLXA 3QEBZ 4F4XA 1T3QA 1HJPA 4J9RA 5F9LA 2KZMA 5AIBA 2BPGA 3UXPA 2NRZA 9ICCA 1L6NA 3QUTA 5G5HA 4QIWC 2DFLA 3K1ZA 4AYBC 2HHTA 4RQ3A 3KTQA 1BPDA 2P35A 3T5KA 2BDUA 4BWMA 1WCNA 4KLJA 3V7KA 3RJJA 2F1IA 5KFVA 1S0NA 1EXNA 3WKAA 4RT3A 2K8BB 3M8SA 4C8OA 5ALUA 1L7OA 3WKBA 2C22A 3GFKB 3RJEA 4R65A 3TAQA 1COOA 3I1YA 3RB4A 4KLGA 3IV6A 2QB0A 9ICQA 8ICNA 1QTMA 4KLIA 2F77X 4RQ8A 3RRGA 1L7NA 2C2EA 3Q8KA 4FS2A 2F3NA 4KX5A 2KE7A 3EUB2 2NRXA 9ICNA 3JPSA 4O3RA 2VJ5A 3NS1A 1UT8A 4DL6A 4DLGA 1UQVA 1PK3A 3NGDA 3N28A 5KFRA 4F3OA 3N7SC 2MRLA 4OJ6A 3GIIA 4PGQA 2IBKA 5CA7A 2LM1A 1RDFA 2EAMA 8ICQA 2W55A 3BS5A 5AKEA 1Z00A 2KP7A 3R9KA 4PGYA 1ZQCA 8ICCA 5IIKA 1XU4A 2BQUA 2EZYA 4Y2TA 2E3TA 9ICBA 1ZQHA 2WF7A 2KZZA 4YR0A 2XY6A 2EQYA 4QZCA 5L1MA 3JPQA 5ALEA 4UBBA 4R8UB 4RNMA 3UXOA 9ICMA 4Q43A 3VC8A 5J2CA 5KAIU 5ALMA 3V6KA 4QZHA 3OJUA 3D2SA 4MFAA 1ZQIA 2W9BA 1HIWA 4PHAA 5DBCA 4M9HA 2BPFA 1N61A 1URJA 3IM1A 3QXGA 1MQ2A 3BQ2A 9ICSA 5ALNA 2OH2A 5JRTA 1K1QA 1BPBA 2BR0A 5DB6A 2F76X 2R8GA 1ED1A 5DBBA 1RZTA 4QWEA 1CRXA 3T5HA 9ICGA 5EE0A 1FEZA 3PSPA 5J0SA 4RPYA 2ISPA 1PVRA 5ALGA 2HBLA 5J2JA 3L4PA 3ISBA 1SL0A 4NM2A 2FMQA 4K4IA 2K4PA 3NVWA 2ZTDA 5DQIA 2HOQA 5HMLA 2F44A 4LZGA 2M0NA 4LVSA 2A3VA 4QWBA 5KG1A 5J0TA 3PW5A 5ALZA 1KBUA 5J0WA 2YMPA 2HCFA 2RRDA 2XVTA 2ALZA 2ZUDA 3QZ7A 3KHGA 4JWNA 5G5GA 2KN7A 2ZJAA 4YQWA 9ICHA 4E0DA 4IL6U 4F93B 1QSSA 3JPPA 2Y0SF 4TUPA 3KKAC 3C1YA 1ZQ1C 3I76A 3HKZC 4OJLA 4F5NA 2DPJA 4C4RA 4WJ3B 1X6IA 4UB8U 1KSPA 4FO6A 4KLLA 3H8JA 4TQSA 2IHMA 5ALSA 1ZYQA 1XSLA 3B0YA 2J6UA 4I29A 2WAQF 3NASA 5AKJA 1PZNA 1K1SA 2D3DA 3A0HU 4UAVA 9ICTA 5DGBA 5F9NA 3WK4A 1N5WA 4YMMA 1SL2A 4DOCA 1NKEA 1ZQTA 2KSOB 7ICUA 5AM0A 4RUAA 5DQHA 3O0FA 4DL4A 1N62A 4ED3A 1PVPA 2PKEA 4B9MA 1DOQA 1LKYB 2I1QA 2KV2A 5J2AA 2IA6A 2BCRA 1ZJMA 3UPQA 3DV9A 5AKXA 1B4FA 2GH1A 4O5EA 4YCXA 7ICMA 1N5XA 4I2EA 1ZOLA 4R8UA 3UM9A 3KFUF 2ASLA 5BOMA 1NK9A 2JGAA 3SAGA 4HYKA 1ZXIA 4QJFB 1QSLA 5AHXA 1N60A 1AROP 4G9BA 4UAUA 5AKGA 7ICOA 1ZQAA 1BPXA 4MEXA 2K89A 1UHUA 4C4SA 2DPIA 3C2LA 3C21A 1KTQA 2XY7A 2KJ8A 3QU2A 1HUOA 3BQ1A 5KT6A 4M47A 4NLKA 3ISDA 4UB1A 3K75D 3GZFA 9ICPA 3ZD9A 4DOAA 3D2QA 3H4BA 4RQ7A 9ICRA 5KFKA 2GWSA 9ICVA 1XS9D 4OO1J 4M9JA 2DUYA 2PFNA 1RQLA 4IQWA 2ZTEA 2ZIXB 5ALWA 3DDHA 3MBYA 5HNKA 3AQFA 5AM4A 7ICRA 5AI0A 3F2DA 5AK3A 4ECRA 4UATA 1NK5A 4YVZA 3PX0A 2KIWA 4TURA 2EAOA 1UCVA 5KL1B 1FFVA 5KFQA 3RJKA 1LB2B 2WF9A 2HBMA 4O5KA 5D4BA 2JXJA 3OPXA 3PSIA 5EE3A 3L3FX 1L8LA 5HHIA 3SV3A 4Z6FA 4R63A 1N2XA 3RBEA 2XY5A 4RPXA 4K4GA 2KIVA 3WU2U 3GIKA 1O08A 3N7PD 8ICUA 1SIJA 3SD7A 1WCLA 3JPOA 1KKXA 4M2YA 2FJ6A 2ZG6A 3RB6A 1LKYA 4C4TA 5ALPA 1NK4A 3M9MB 1V38A 3GIJA 1NKCA 1ZQWA 3HW8A 2P6UA 3H40A 1J97A 1BGXT 4PHPA 3CW2C 2LYBA 2Y9TA 2HDOA 4DFMA 1ZQFA 5J29A 4DLEA 1CEZA 3ZDAA 4I2AA 5ALDA 3M7DA 4BJQA 2LM4A 5AI4A 3JPTA 1S9FA 1D9FA 2KFNA 2ZIUB 2KNJA 5EE1A 2C2RA 1XO1A 2WF5A 7ICVA 4BDPA 5E79U 5EWGA 2ZIWB 3G6YA 4ACOA 1TVAA 1TK5A 1X42A 1NZPA 1NNLA 4IRCA 4I2GA 2EAPA 2KJ9A 5C5JA 5J0UA 4IQVA 5A0LA 5J0QA 1XC9A 3EPIA 3ZDCA 1JUDA 4J9KA 4NV0A 3WK9A 3C29A 3F53A 2EANA 1AQ6A 1ZD3A 3MR2A 2YTUA 2CRXA 1DXSA 2HVIA 1X9WA 5DB8A 3ED5A 3RH6A 3ZI4A 4IRKA 4MHVA 1KFDA 4PH5A 2H3FA 2JZBB 1L7MA 4I2FA 1X40A 3U26A 2DKZA 4FZLA 2ZUCA 1OUQA 3MFHA 3JPNA 3PW0A 1T3NA 3C5GA 4RQNA 2LYAA 3QU7A 4EX7A 5CHGA 3MGHA 2KG5A 2JR5A 2ISOA 4DSKA 4JV1A 3UQ2A 2ZIVB 4UAWA 3HT3A 5L1IA 2FLPA 4DL5A 4Q8FA 3ZDDA 1ZQVA 4C8NA 4KN7A 8ICGA 2F1JA 1Z1VA 7ICJA 4Q8EA 1TE2A 3MGVA 8ICFA 2KZ3A 4KLSA 3SR6A 3LK9A 9ICFA 4DL3A 4CRXA 1X9MA 2Y0SC 4YR3A 2RQ5A 4PHEA 1RXWA 5J0YA 2W8KA 5HHHA 2DQNB 4P0PB 1L7PA 1TK8A 2KMDA 4LJXA 2Q0ZX 1QQ5A 3NTUA 2UVRA 4RQ6A 3ZD8A 2ZJ8A 1SV4A 4KLTA 3EWAA 3IG5A 4MF8A 4B6JA 2EH9A 5KG2A 4ECWA 2WAQC 4OJ5A 4O3MA 2NO5A 3SMVA 3RJIA 4F5QA 3S6JA 5KFGA 4F4YA 2ODGA 4KMUA 2A1JB 2NYVA 5DG7A 4PL2A 4QZIA 2W3SA 2RP5A 2F8LA 2UVUA 1A76A 4F92B 4QZ8A 3TADC 3TQ1A 2AQ0A 3ETRA 3NRZA 1BPEA 4CF5A 1YZ7A 1VLBA 4TUQA 1NZBA 2RLTA 4Y2XA 2FE9A 2UVWA 1SZPA 2QARB 4UB4A 4RQ2A 2MAXA 4DFKA 2DF4B 2AU0A 2HBJA 2W9CB 9ICJA 2KVCA 5KFSA 5KFUA 2Y1IA 4KLQA 4F2SA 2F2AB 1IV8A 2BHNA 1SKRA 4YMNA 2JZBA 1X6JA 1NK0A 1COKA 4J9MA 5K4LA 3M9OB 3H8MA 1U49A 1SKWA 2BCUA 5H2FU 3FM9A 3EPGA 2QLTA 1IIPA 3WK7A 5JTIA 2FLLA 4J9LA 1SV0A 2EDUA 5DDMA 4FE3A 4YFKA 2IOHA 2AXTU 5JUMA 2W03A 4IR9A 1C20A 3F5EA 8ICRA 9ICKA 3RF9A 1L3VA 2YMLA 3OSPA 3AU6A 2WB1C 4F5RA 2GLEA 3QUBA 4NJ8A 1RM6C 2AQ4A 1SV0C 4YXJA 2K60A 4B9UA 3QU5A 4B9NA 3UMBA 2BCVA 1WWUA 5KFNA 1NJXA 1V9PA 3B0XA 2XICA 4UB2A 1VJ5A 4KLDA 2WF6A 3V7JA 4AP9A 3PW2A 4Y2SA 1F5SA 1T94A 5KFTA 3CYMA 3KHLA 4ECVA 2BKEA 1ZQPA 2KKPA 4XRHA 2WF8A 1IXRA 4P4PA 4ECSA 2CN1A 2ZXHA 2VANA 2JEJA 1Q3UA 1QLNA 5AIAA 5D49A 1TAUA 3BZCA 2XGPA 3PV8A 3C2MA 5KG3A 2E8NA 5T14A 4K4HA 2O6KA 5CJ7A 3L5KA 1XNSA 1TAMA 5DLFA 4EX6A 2BQRA 2KHVA 1NK8A 4DS5A 4UBCA 5J0OA 7ICQA 1J2MA 2L5YA 2AHOB 4IC9A 4OD0A 4JMUA 2ES6A 2RDIA 2ZXIA 4Y2PA 3LVWA 2ASDA 4M9LA 2MUTB 3PY8A 4M9NA 4ED2A 1UA1A 1Q46A 2N1RA 4QNLA 4DQPA 3KKAA 3QU9A 4OJOA 5DGAA 3B9JA 3D6JA 5KG7A 5KG0A 4EYIB 4I2IA 3E2EA 3UMCA 2NO4A 4QZDA 5KTQA 3H0MB 2HHXA 1L8OA 3HJEA 2XIDA 1ZQYA 5HP4A 1A6SA 5CR0A 2DGZA 4O3OA 2E8MA 5J2EA 2IMWP 3KOOA 2J6SA 2MU2A 3TARA 4EBEA 2IHNA 5KFFA 5ALKA 2JHDA 5CB1A 4ED7A 2LMRA 3T79A 3TACB 4IRDA 1L3SA 3DEEA 3OJSA 4ED6A 2HW3A 4MFFA 3C23A 5ALLA 1ECWA 2G0AA 1SGGA 4Y2JA 5AKZA 3LWLA 4RUCA 2KTQA 4MEYA 5KL8B 1PVQA 3WK8A 4RQMA 4RNNA 3HX0A 3QU4A 1ZQRA 2W7OA 1TFRA 4J9NA 4YN4A 4NWIA 2MA1A 3RJHA 3GILA 3EW9A
chains in the Genus database with same CATH topology
2E8OA 2Y9TA 1JI7A 2B6GA 4NL9C 2Y9UA 4RQNA 2EAMA 3HILA 1PK1A 2L5YA 3BS5A 4IS7A 2ES6A 2F8KA 3KKAC 2KG5A 1WWVA 2QB0B 5F3XB 1COKA 2QKQA 3H8MA 3KKAA 5L1MA 1Z1VA 3BS7A 3BQ7A 5JTIA 3K1RB 1SV0A 2D3DA 2EAOA 2EAPA 1UCVA 2KSOB 2GLEA 1RG6A 4NJ8A 1SXEA 2QB1A 1SV0C 2K60A 1OXJA 5JRTA 2E8MA 1LKYB 2KMDA 2DL0A 5JU5A 2QARA 1B4FA 2JV3A 1PK1B 3BS5B 1SXDA 1WWUA 2DKXA 1SV4A 2LMRA 3SEIA 4PZNA 3TACB 1OW5A 2KIVA 2EANA 2D8CA 1KW4A 1SGGA 2YTUA 2QB0A 1X66A 1DXSA 2K4PA 1V85A 3IDWA 1LKYA 4MHVA 1B0XA 2F3NA 1V38A 2KE7A 1X9XA 5J8YA 1F0MA 4RQMA 5KNIA 2F44A 3TADC 2ESEA 3SENA 4NL9A 2E8PA 2E8NA 1UQVA 1PK3A 1X40A 2LPEA 2DKZA 3TADA 2KSOA 2FE9A 5J8YC 4PZOA 2QARB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8O A;  2Y9T A;  1JI7 A;  2B6G A;  4NL9 C;  2Y9U A;  4RQN A;  2EAM A;  3HIL A;  1PK1 A;  2L5Y A;  3BS5 A;  4IS7 A;  2ES6 A;  2F8K A;  3KKA C;  2KG5 A;  1WWV A;  2QB0 B;  5F3X B;  1COK A;  2QKQ A;  3H8M A;  3KKA A;  5L1M A;  1Z1V A;  3BS7 A;  3BQ7 A;  5JTI A;  3K1R B;  1SV0 A;  2D3D A;  2EAO A;  2EAP A;  1UCV A;  2KSO B;  2GLE A;  1RG6 A;  4NJ8 A;  1SXE A;  2QB1 A;  1SV0 C;  2K60 A;  1OXJ A;  5JRT A;  2E8M A;  1LKY B;  2KMD A;  2DL0 A;  5JU5 A;  2QAR A;  1B4F A;  2JV3 A;  1PK1 B;  3BS5 B;  1SXD A;  1WWU A;  2DKX A;  1SV4 A;  2LMR A;  3SEI A;  4PZN A;  3TAC B;  1OW5 A;  2KIV A;  2EAN A;  2D8C A;  1KW4 A;  1SGG A;  2YTU A;  2QB0 A;  1X66 A;  1DXS A;  2K4P A;  1V85 A;  3IDW A;  1LKY A;  4MHV A;  1B0X A;  2F3N A;  1V38 A;  2KE7 A;  1X9X A;  5J8Y A;  1F0M A;  4RQM A;  5KNI A;  2F44 A;  3TAD C;  2ESE A;  3SEN A;  4NL9 A;  2E8P A;  2E8N A;  1UQV A;  1PK3 A;  1X40 A;  2LPE A;  2DKZ A;  3TAD A;  2KSO A;  2FE9 A;  5J8Y C;  4PZO A;  2QAR B; 
#chains in the Genus database with same CATH topology
 3KHR A;  1JI7 A;  1KEJ A;  3ZDE A;  5KFY A;  1SB3 C;  4O3Q A;  1SWV A;  4KMO B;  2Y9U A;  7ICT A;  2FLN A;  2FPL A;  2KJ5 A;  1J2N A;  4IS7 A;  2H3Z A;  1HEK A;  2Y1J A;  2PI5 A;  1QH9 A;  4KIT B;  4YG2 A;  3MDC A;  2QKQ A;  5AI6 A;  2HSZ A;  2PFP A;  2JEG A;  8ICO A;  4Z6D A;  3BS7 A;  3G6V A;  2IOF K;  3WKD A;  1S10 A;  5KT3 A;  3HWT A;  4DFP A;  3OHA A;  3FYH A;  3PW4 A;  5B5E U;  5KT7 A;  4F5P A;  5ALR A;  4EYH B;  3N4M B;  1JX4 A;  4J03 A;  4CDG A;  4ECQ A;  5KFH A;  2H3Q A;  5J2G A;  2PMZ F;  3GQC A;  3RJF A;  2DL0 A;  3RR8 A;  4RNO A;  2K4H A;  5IIO A;  2HHS A;  5BOL A;  1PK1 B;  2I6X A;  8ICS A;  3QZ8 A;  2BZF A;  3QUQ A;  1ZQN A;  4PJ0 U;  4BGD A;  1BNP A;  1B22 A;  5L1L A;  2ATL A;  1QQ6 A;  4UQG A;  1TV9 A;  5DG9 A;  3H8S A;  5DG8 A;  4OJP A;  4YD1 A;  4JV2 A;  4C8K A;  3ORY A;  3TFS A;  4O3P A;  9ICL A;  4JV0 A;  5AI9 A;  4QZ9 A;  4YXM A;  4BUG A;  1D9D A;  5KFD A;  3NVV A;  5KT5 A;  2VA2 A;  1Z3E B;  4DF8 A;  3T3F A;  2W8L A;  3H4D A;  4KLH A;  4DF4 A;  4M9G A;  5J0R A;  3BJY A;  5AK6 A;  4FZN A;  5AKL A;  8ICW A;  4C0Z A;  2LPE A;  1XWL A;  2KSO A;  1ZQG A;  3TI0 A;  4XQ8 A;  4M04 A;  5CEH A;  2YQE A;  2BCS A;  4Y2V A;  3RH4 A;  4BXO B;  5HR7 A;  5KG5 A;  3QYP A;  2PI4 A;  2RHF A;  1L5U A;  1RPL A;  1K5O A;  1ZQU A;  1RYU A;  5KG6 A;  3IP4 B;  4RPZ A;  2HMX A;  3M8R A;  4KTQ A;  1RYS A;  3MC1 A;  5AM2 A;  4DS4 A;  3PZP A;  4F91 B;  1BPZ A;  4Q44 A;  1UA0 A;  1QQ7 A;  3TAN A;  4ELV A;  1NOM A;  2OM6 A;  3V7L A;  4F8R A;  5IIJ A;  3M9N B;  4ECZ A;  1S77 D;  3LYS A;  8ICE A;  1P7D A;  3HRD D;  2BGW A;  8ICK A;  5IIN A;  4M6W B;  4I2D A;  3UXN A;  3MR6 A;  2P66 A;  4RQ4 A;  5III A;  2DBY A;  1IG6 A;  2WHE A;  4DSL A;  5ALQ A;  1OXJ A;  2WFA A;  4PGX A;  3H0R B;  3N97 B;  2JV3 A;  1NJW A;  2ASJ A;  4EZ6 A;  4PZN A;  2FMS A;  4US9 A;  5KFL A;  1ZQK A;  4IQU A;  5BPC A;  1BPY A;  4UB6 U;  3IN5 A;  3ONN A;  4JUZ A;  5KFP A;  3PST A;  5GTH U;  8ICZ A;  7ICH A;  2HHV A;  1WUD A;  4ECX A;  2ZIX A;  4J9S A;  2W9A A;  4ICA A;  1X9X A;  5KNI A;  3AN1 A;  4I2C A;  4I27 A;  2UVV A;  1MQ3 A;  1PUZ A;  3KHH A;  2FI1 A;  1XSP A;  1DK3 A;  5IIM A;  2LI6 A;  5KFO A;  4RQ0 A;  9ICE A;  4F5O A;  1C7Y A;  1ZQB A;  1S97 A;  1RQN A;  2C28 A;  4JK1 A;  2JEF A;  4RT2 A;  4C7Z A;  2F8K A;  4GIB A;  2CXY A;  4Y2Q A;  7ICL A;  4O3S A;  3RFA A;  4QW9 A;  1WWV A;  2QB0 B;  2KVS A;  4NXZ A;  3BZK A;  3WKE A;  4ELT A;  4ECT A;  4BX9 C;  3F5A A;  5L1J A;  4GXJ A;  5DQG A;  5KFC A;  2AH5 A;  4R64 A;  3BQ7 A;  5DBA A;  4A8E A;  2OHF A;  3UQ0 A;  1V97 A;  3GV7 B;  2V4R A;  1JXE A;  3RTV A;  2Q4T A;  3J81 j;  3Q8R B;  1KLN A;  3AQE A;  4X5V A;  2W3R A;  1ZQX A;  3WK6 A;  1MC8 A;  4B9V A;  2KFZ A;  3BS5 B;  4F72 A;  5J2I A;  1Z00 B;  2JMG A;  4QZE A;  5CRX A;  2A1A A;  4ED0 A;  4EZ9 A;  1KRP A;  4QZF A;  4EEY A;  5DDY A;  1MSW D;  1XO0 A;  1YT3 A;  2NRT A;  9ICA A;  3PSF A;  1HUZ A;  1V85 A;  3QX7 A;  3GIM A;  2ZIU A;  2JRZ A;  2A19 A;  1F0M A;  8ICM A;  3QE9 Y;  5KG4 A;  2W9B B;  2ZIW A;  5ALF A;  1XSN A;  3IHQ B;  2KD1 A;  4P2H A;  8ICI A;  3TAD A;  2V9W A;  4QWC A;  4IR1 A;  4EEN A;  4ECU A;  3T5L A;  1ZET A;  1ZQM A;  4UB5 A;  3HPO A;  4TQR A;  4DQS A;  4PPX A;  1NJZ A;  3RBD A;  3ALR A;  4J9P A;  1Y88 A;  1D8L A;  1IM4 A;  3PO5 A;  5KFI A;  5EOZ A;  4MFC A;  4CGZ A;  1QSY A;  2VA3 A;  2JEI A;  3PML A;  2KOB A;  5ALV A;  1A77 A;  3PX6 A;  3SAF A;  4B9L A;  4CCH A;  5TZV A;  2ZUB A;  1ZJN A;  2YX8 A;  4M0A A;  3PMN A;  3TFR A;  2EZX A;  3CP8 A;  1ZRM A;  2K4I A;  1L3U A;  1M6Y A;  2W11 A;  1KN5 A;  1O03 A;  2K4E A;  1ZRN A;  2XCP A;  1T7P A;  4QZB A;  5KFM A;  2C2D A;  5KFB A;  2KIC A;  1SXE A;  2XCA A;  4FBT A;  4KLE A;  3AEV A;  1BVS A;  3MAB A;  1X2I A;  4O3N A;  2YY6 A;  3SZ2 A;  2E1F A;  3F2C A;  3BQ0 A;  3GDX A;  3AL0 B;  1DGJ A;  3MFI A;  5EE9 A;  4HAI A;  8ICY A;  2AGO A;  1LV5 A;  1QCK A;  2HHW A;  3JPR A;  4ED8 A;  8ICB A;  2ZIV A;  8ICP A;  3IDW A;  2XC9 A;  3CRX A;  2PMZ C;  7ICN A;  1JMS A;  3FDS A;  1JAL A;  4KN4 A;  5L9X A;  4J9O A;  4F4W A;  9ICI A;  4US8 A;  3KBB A;  3IRU A;  5AK5 A;  2VJ4 A;  3SEN A;  5J2K A;  1D8B A;  1NI3 A;  3PVX A;  5AIC A;  5ALH A;  2AGQ A;  4Q45 A;  3FAH A;  3BDP A;  5J2H A;  3WK5 A;  4PZO A;  4DEZ A;  1RXV A;  4NLB A;  5J2D A;  2YB1 A;  2E5S A;  4UW9 A;  4P0P A;  4U7C A;  2R8H A;  1S8O A;  4EBD A;  1JIH A;  5AM3 A;  3HP6 A;  5DKW A;  4RZR A;  2ZTC A;  3H7I A;  3PR4 A;  2Z7J A;  2MSN A;  3A0B U;  2W7P A;  4RQ1 A;  4NLC A;  3AMZ A;  3OSN A;  5ALI A;  3PO4 A;  4F4K A;  2HVH A;  5KT4 A;  3RR7 A;  3PW7 A;  2BDP A;  1U4B A;  1RYR A;  3M6Z A;  1SZH A;  4YP3 A;  3K4G A;  4DWI A;  5HMM A;  3QNM A;  5CWR A;  1U45 A;  2A1J A;  4NM1 A;  4DL2 A;  4O5C A;  2D6F C;  2OWO A;  1SWW A;  2KKV A;  3D2N A;  1B43 A;  2KHQ A;  4NLZ A;  2IOF A;  4U6P A;  4DSI A;  2OCE A;  4FBU A;  3AM9 A;  2F1H A;  2HHU A;  4ZH4 A;  4O0I A;  2FDR A;  3V6H A;  2QB1 A;  1VDV A;  4DSF A;  4DL7 A;  3RH5 A;  3NRW A;  4CF4 A;  5JU5 A;  2QAR A;  3ISC A;  2G09 A;  2LHT A;  9ICU A;  5ALO A;  4JB3 A;  3EYZ A;  2DKX A;  1DK2 A;  1CUK A;  2DWQ A;  1ZQE A;  4C80 A;  4P0Q B;  8ICV A;  4Y2R A;  1OW5 A;  4DQI A;  2W9C A;  3RJG A;  1SKS A;  1S0O A;  8ICX A;  1N48 A;  3G6X A;  2JH1 A;  4GXI A;  1U48 A;  5J0X A;  1A0P A;  4ECY A;  3LDA A;  2WTF A;  3KZI U;  4FZM A;  2PXI A;  1ZQD A;  2YN4 A;  1T4G A;  2ESE A;  4BWJ A;  5GTI U;  3OGU A;  5CP2 A;  1KL9 A;  5AM5 A;  4UAS A;  4DOB A;  4O9M A;  2VIX A;  3Q8Q B;  2E8O A;  3C2K A;  3RAX A;  3RB0 A;  1LVH A;  2B6G A;  3SI8 A;  3ETL A;  1TKD A;  3BQT A;  1FO4 A;  4QIW F;  1DGS A;  4AYB F;  3V72 A;  3MR3 A;  2OYY A;  2LBO A;  1Z19 A;  3H0L B;  7ICS A;  1U9L A;  5F3X B;  1WYG A;  3C5F A;  2VA8 A;  5DLG A;  2AJQ A;  1CI4 A;  1TAQ A;  3GU3 A;  1F44 A;  1NK7 A;  4P4O A;  2YMQ A;  4KLM A;  5J0P A;  3LWM A;  3PX4 A;  5ALY A;  1UT5 A;  4IQT A;  4Z6E A;  3EZ5 A;  3K1R B;  5DB7 A;  2R8K A;  2G06 A;  5IIL A;  2PFO A;  3N7R C;  1U47 A;  4DFD A;  1YZ6 A;  5KT2 A;  2NV3 A;  4QZA A;  5J2F A;  4JWM A;  4DSE A;  1S0M A;  1RG6 A;  2LYH A;  4KLF A;  1DRG A;  5KFW A;  4F2R A;  2XGQ A;  4EBC A;  4PHD A;  2HHQ A;  7ICE A;  1JN3 A;  3Q8S B;  1ZQJ A;  1SXD A;  5HR6 A;  1S0V A;  2JH7 A;  3M1Y A;  1NJY A;  2NRV A;  2H3I A;  5J2B A;  3RAQ A;  7ICI A;  1Z4N A;  2MUT A;  3MR5 A;  1X66 A;  4YR2 A;  3WKC A;  2HBK A;  2PFQ A;  2YMM A;  3NVZ A;  4QW8 A;  2KEY A;  4I2B A;  2GO7 A;  4B9S A;  1ZD5 A;  2OEH A;  2LKY A;  3SAH A;  3ICX A;  1KQQ A;  2I9G A;  2AGP A;  3Q8P B;  2WB1 F;  4UAZ A;  4QWA A;  4P0Q A;  7ICK A;  4F71 A;  4RU9 A;  3GV5 B;  4DSJ A;  3QEA Z;  4CF3 A;  5KFE A;  3GV8 B;  4I2H A;  2ZJ5 A;  1N56 A;  1MA7 A;  1X9S A;  3NVY A;  1H38 A;  2BCQ A;  5L1K A;  2P6R A;  1N63 A;  3QUC A;  1T8E A;  1ZQZ A;  5TIS U;  3I28 A;  5AK4 A;  4QZG A;  2R8I A;  2FMP A;  4C8M A;  2H3V A;  9ICW A;  3OTQ A;  4RQ5 A;  5ALJ A;  3Q8M A;  3LVV A;  2HI0 A;  1ZD2 P;  2B21 A;  3RRH A;  3NUQ A;  2YB4 A;  5AKY A;  4ZOH C;  1SL1 A;  3SYZ A;  3PNC A;  1UPH A;  4UAR A;  1ZQQ A;  4KLO A;  2OXO A;  5AI8 A;  4NY8 A;  3E58 A;  1ZQO A;  1NK6 A;  3T5J A;  2NRW A;  2W54 A;  4Y2U A;  4CE6 A;  2R18 A;  3V6J A;  3VCB A;  1L3T A;  3TAP A;  3SEI A;  4Z6C A;  5AKH A;  3TKA A;  2BQ3 A;  8ICA A;  5KAF U;  2H5X A;  4FS1 A;  2M9N A;  9ICO A;  5KFX A;  5D46 A;  1JRO A;  1GO3 F;  3F2B A;  4C8L A;  3AU2 A;  1BNO A;  3SV4 A;  2RDJ A;  1B0X A;  2FPM A;  5J8Y A;  3SQI A;  3OHB A;  2FPK A;  8ICT A;  3HKZ F;  5EWF A;  4NL9 A;  2E8P A;  7ICP A;  1JXL A;  1ZQS A;  3KZX A;  1Z1B A;  5AKI A;  2XO7 A;  5KFZ A;  4Y2Y A;  5J8Y C;  1KW4 A;  1FIQ A;  4DO9 A;  2XI9 A;  4R66 A;  4GXK A;  3RB3 A;  3FC4 A;  8ICL A;  4NL9 C;  2KK0 A;  2G08 A;  4YMO A;  4OCZ A;  1Z4O A;  1PK1 A;  4YD2 A;  1ZQL A;  1TK0 A;  4XA5 A;  5EWE A;  3AUO A;  2J6T A;  4J9Q A;  4DFJ A;  1WG8 A;  2B0C A;  4NLG A;  3C28 A;  2HOF A;  4USA A;  1Q3V A;  4GC6 A;  3ZDB A;  4P4M A;  4DQQ A;  3IG8 A;  1ZD4 A;  2GOL A;  2K8C B;  2G5I B;  4KX3 A;  9ICX A;  5KFA A;  2W9M A;  1KDH A;  4PL1 A;  4GC7 A;  4G3I A;  2G5H B;  5ALT A;  4I28 A;  3UMG A;  3MGI A;  1D8Y A;  3M6K A;  3H8W A;  1JRP A;  5ALX A;  2G07 A;  4DQR A;  1NKB A;  4EEK A;  5AKK A;  4BXO A;  5FP0 A;  1KFS A;  3C1Z A;  5DB9 A;  2D8C A;  4ED1 A;  4NLN A;  4UB3 A;  4DCC A;  3MDA A;  2W43 A;  2BPC A;  3PR5 B;  8ICJ A;  1KFT A;  4I2J A;  3E0F A;  4C7Y A;  4EEL A;  5AM1 A;  2I5H A;  1S5L U;  4LZD A;  4GFJ A;  1FFU A;  2CPR A;  2HOI A;  8ICH A;  5AI5 A;  4F50 A;  3KD3 A;  2VKQ A;  2R8J A;  3CNH A;  4M6W A;  1S76 D;  4F4Z A;  4ELU A;  5B66 U;  4UAY A;  1Q8K A;  5C0Y A;  2K8A A;  4KLU A;  4MF2 A;  4FFD A;  4QWD A;  2EZZ A;  3THV A;  3HIL A;  3Q8L A;  4XUS A;  7ICF A;  5KFJ A;  7ICG A;  4B9T A;  2E1E A;  2W04 A;  2V4Q A;  4TUS A;  4CNQ A;  1MN8 A;  4GLX A;  3QEB Z;  4F4X A;  1T3Q A;  1HJP A;  4J9R A;  5F9L A;  2KZM A;  5AIB A;  2BPG A;  3UXP A;  2NRZ A;  9ICC A;  1L6N A;  3QUT A;  5G5H A;  4QIW C;  2DFL A;  3K1Z A;  4AYB C;  2HHT A;  4RQ3 A;  3KTQ A;  1BPD A;  2P35 A;  3T5K A;  2BDU A;  4BWM A;  1WCN A;  4KLJ A;  3V7K A;  3RJJ A;  2F1I A;  5KFV A;  1S0N A;  1EXN A;  3WKA A;  4RT3 A;  2K8B B;  3M8S A;  4C8O A;  5ALU A;  1L7O A;  3WKB A;  2C22 A;  3GFK B;  3RJE A;  4R65 A;  3TAQ A;  1COO A;  3I1Y A;  3RB4 A;  4KLG A;  3IV6 A;  2QB0 A;  9ICQ A;  8ICN A;  1QTM A;  4KLI A;  2F77 X;  4RQ8 A;  3RRG A;  1L7N A;  2C2E A;  3Q8K A;  4FS2 A;  2F3N A;  4KX5 A;  2KE7 A;  3EUB 2;  2NRX A;  9ICN A;  3JPS A;  4O3R A;  2VJ5 A;  3NS1 A;  1UT8 A;  4DL6 A;  4DLG A;  1UQV A;  1PK3 A;  3NGD A;  3N28 A;  5KFR A;  4F3O A;  3N7S C;  2MRL A;  4OJ6 A;  3GII A;  4PGQ A;  2IBK A;  5CA7 A;  2LM1 A;  1RDF A;  2EAM A;  8ICQ A;  2W55 A;  3BS5 A;  5AKE A;  1Z00 A;  2KP7 A;  3R9K A;  4PGY A;  1ZQC A;  8ICC A;  5IIK A;  1XU4 A;  2BQU A;  2EZY A;  4Y2T A;  2E3T A;  9ICB A;  1ZQH A;  2WF7 A;  2KZZ A;  4YR0 A;  2XY6 A;  2EQY A;  4QZC A;  5L1M A;  3JPQ A;  5ALE A;  4UBB A;  4R8U B;  4RNM A;  3UXO A;  9ICM A;  4Q43 A;  3VC8 A;  5J2C A;  5KAI U;  5ALM A;  3V6K A;  4QZH A;  3OJU A;  3D2S A;  4MFA A;  1ZQI A;  2W9B A;  1HIW A;  4PHA A;  5DBC A;  4M9H A;  2BPF A;  1N61 A;  1URJ A;  3IM1 A;  3QXG A;  1MQ2 A;  3BQ2 A;  9ICS A;  5ALN A;  2OH2 A;  5JRT A;  1K1Q A;  1BPB A;  2BR0 A;  5DB6 A;  2F76 X;  2R8G A;  1ED1 A;  5DBB A;  1RZT A;  4QWE A;  1CRX A;  3T5H A;  9ICG A;  5EE0 A;  1FEZ A;  3PSP A;  5J0S A;  4RPY A;  2ISP A;  1PVR A;  5ALG A;  2HBL A;  5J2J A;  3L4P A;  3ISB A;  1SL0 A;  4NM2 A;  2FMQ A;  4K4I A;  2K4P A;  3NVW A;  2ZTD A;  5DQI A;  2HOQ A;  5HML A;  2F44 A;  4LZG A;  2M0N A;  4LVS A;  2A3V A;  4QWB A;  5KG1 A;  5J0T A;  3PW5 A;  5ALZ A;  1KBU A;  5J0W A;  2YMP A;  2HCF A;  2RRD A;  2XVT A;  2ALZ A;  2ZUD A;  3QZ7 A;  3KHG A;  4JWN A;  5G5G A;  2KN7 A;  2ZJA A;  4YQW A;  9ICH A;  4E0D A;  4IL6 U;  4F93 B;  1QSS A;  3JPP A;  2Y0S F;  4TUP A;  3KKA C;  3C1Y A;  1ZQ1 C;  3I76 A;  3HKZ C;  4OJL A;  4F5N A;  2DPJ A;  4C4R A;  4WJ3 B;  1X6I A;  4UB8 U;  1KSP A;  4FO6 A;  4KLL A;  3H8J A;  4TQS A;  2IHM A;  5ALS A;  1ZYQ A;  1XSL A;  3B0Y A;  2J6U A;  4I29 A;  2WAQ F;  3NAS A;  5AKJ A;  1PZN A;  1K1S A;  2D3D A;  3A0H U;  4UAV A;  9ICT A;  5DGB A;  5F9N A;  3WK4 A;  1N5W A;  4YMM A;  1SL2 A;  4DOC A;  1NKE A;  1ZQT A;  2KSO B;  7ICU A;  5AM0 A;  4RUA A;  5DQH A;  3O0F A;  4DL4 A;  1N62 A;  4ED3 A;  1PVP A;  2PKE A;  4B9M A;  1DOQ A;  1LKY B;  2I1Q A;  2KV2 A;  5J2A A;  2IA6 A;  2BCR A;  1ZJM A;  3UPQ A;  3DV9 A;  5AKX A;  1B4F A;  2GH1 A;  4O5E A;  4YCX A;  7ICM A;  1N5X A;  4I2E A;  1ZOL A;  4R8U A;  3UM9 A;  3KFU F;  2ASL A;  5BOM A;  1NK9 A;  2JGA A;  3SAG A;  4HYK A;  1ZXI A;  4QJF B;  1QSL A;  5AHX A;  1N60 A;  1ARO P;  4G9B A;  4UAU A;  5AKG A;  7ICO A;  1ZQA A;  1BPX A;  4MEX A;  2K89 A;  1UHU A;  4C4S A;  2DPI A;  3C2L A;  3C21 A;  1KTQ A;  2XY7 A;  2KJ8 A;  3QU2 A;  1HUO A;  3BQ1 A;  5KT6 A;  4M47 A;  4NLK A;  3ISD A;  4UB1 A;  3K75 D;  3GZF A;  9ICP A;  3ZD9 A;  4DOA A;  3D2Q A;  3H4B A;  4RQ7 A;  9ICR A;  5KFK A;  2GWS A;  9ICV A;  1XS9 D;  4OO1 J;  4M9J A;  2DUY A;  2PFN A;  1RQL A;  4IQW A;  2ZTE A;  2ZIX B;  5ALW A;  3DDH A;  3MBY A;  5HNK A;  3AQF A;  5AM4 A;  7ICR A;  5AI0 A;  3F2D A;  5AK3 A;  4ECR A;  4UAT A;  1NK5 A;  4YVZ A;  3PX0 A;  2KIW A;  4TUR A;  2EAO A;  1UCV A;  5KL1 B;  1FFV A;  5KFQ A;  3RJK A;  1LB2 B;  2WF9 A;  2HBM A;  4O5K A;  5D4B A;  2JXJ A;  3OPX A;  3PSI A;  5EE3 A;  3L3F X;  1L8L A;  5HHI A;  3SV3 A;  4Z6F A;  4R63 A;  1N2X A;  3RBE A;  2XY5 A;  4RPX A;  4K4G A;  2KIV A;  3WU2 U;  3GIK A;  1O08 A;  3N7P D;  8ICU A;  1SIJ A;  3SD7 A;  1WCL A;  3JPO A;  1KKX A;  4M2Y A;  2FJ6 A;  2ZG6 A;  3RB6 A;  1LKY A;  4C4T A;  5ALP A;  1NK4 A;  3M9M B;  1V38 A;  3GIJ A;  1NKC A;  1ZQW A;  3HW8 A;  2P6U A;  3H40 A;  1J97 A;  1BGX T;  4PHP A;  3CW2 C;  2LYB A;  2Y9T A;  2HDO A;  4DFM A;  1ZQF A;  5J29 A;  4DLE A;  1CEZ A;  3ZDA A;  4I2A A;  5ALD A;  3M7D A;  4BJQ A;  2LM4 A;  5AI4 A;  3JPT A;  1S9F A;  1D9F A;  2KFN A;  2ZIU B;  2KNJ A;  5EE1 A;  2C2R A;  1XO1 A;  2WF5 A;  7ICV A;  4BDP A;  5E79 U;  5EWG A;  2ZIW B;  3G6Y A;  4ACO A;  1TVA A;  1TK5 A;  1X42 A;  1NZP A;  1NNL A;  4IRC A;  4I2G A;  2EAP A;  2KJ9 A;  5C5J A;  5J0U A;  4IQV A;  5A0L A;  5J0Q A;  1XC9 A;  3EPI A;  3ZDC A;  1JUD A;  4J9K A;  4NV0 A;  3WK9 A;  3C29 A;  3F53 A;  2EAN A;  1AQ6 A;  1ZD3 A;  3MR2 A;  2YTU A;  2CRX A;  1DXS A;  2HVI A;  1X9W A;  5DB8 A;  3ED5 A;  3RH6 A;  3ZI4 A;  4IRK A;  4MHV A;  1KFD A;  4PH5 A;  2H3F A;  2JZB B;  1L7M A;  4I2F A;  1X40 A;  3U26 A;  2DKZ A;  4FZL A;  2ZUC A;  1OUQ A;  3MFH A;  3JPN A;  3PW0 A;  1T3N A;  3C5G A;  4RQN A;  2LYA A;  3QU7 A;  4EX7 A;  5CHG A;  3MGH A;  2KG5 A;  2JR5 A;  2ISO A;  4DSK A;  4JV1 A;  3UQ2 A;  2ZIV B;  4UAW A;  3HT3 A;  5L1I A;  2FLP A;  4DL5 A;  4Q8F A;  3ZDD A;  1ZQV A;  4C8N A;  4KN7 A;  8ICG A;  2F1J A;  1Z1V A;  7ICJ A;  4Q8E A;  1TE2 A;  3MGV A;  8ICF A;  2KZ3 A;  4KLS A;  3SR6 A;  3LK9 A;  9ICF A;  4DL3 A;  4CRX A;  1X9M A;  2Y0S C;  4YR3 A;  2RQ5 A;  4PHE A;  1RXW A;  5J0Y A;  2W8K A;  5HHH A;  2DQN B;  4P0P B;  1L7P A;  1TK8 A;  2KMD A;  4LJX A;  2Q0Z X;  1QQ5 A;  3NTU A;  2UVR A;  4RQ6 A;  3ZD8 A;  2ZJ8 A;  1SV4 A;  4KLT A;  3EWA A;  3IG5 A;  4MF8 A;  4B6J A;  2EH9 A;  5KG2 A;  4ECW A;  2WAQ C;  4OJ5 A;  4O3M A;  2NO5 A;  3SMV A;  3RJI A;  4F5Q A;  3S6J A;  5KFG A;  4F4Y A;  2ODG A;  4KMU A;  2A1J B;  2NYV A;  5DG7 A;  4PL2 A;  4QZI A;  2W3S A;  2RP5 A;  2F8L A;  2UVU A;  1A76 A;  4F92 B;  4QZ8 A;  3TAD C;  3TQ1 A;  2AQ0 A;  3ETR A;  3NRZ A;  1BPE A;  4CF5 A;  1YZ7 A;  1VLB A;  4TUQ A;  1NZB A;  2RLT A;  4Y2X A;  2FE9 A;  2UVW A;  1SZP A;  2QAR B;  4UB4 A;  4RQ2 A;  2MAX A;  4DFK A;  2DF4 B;  2AU0 A;  2HBJ A;  2W9C B;  9ICJ A;  2KVC A;  5KFS A;  5KFU A;  2Y1I A;  4KLQ A;  4F2S A;  2F2A B;  1IV8 A;  2BHN A;  1SKR A;  4YMN A;  2JZB A;  1X6J A;  1NK0 A;  1COK A;  4J9M A;  5K4L A;  3M9O B;  3H8M A;  1U49 A;  1SKW A;  2BCU A;  5H2F U;  3FM9 A;  3EPG A;  2QLT A;  1IIP A;  3WK7 A;  5JTI A;  2FLL A;  4J9L A;  1SV0 A;  2EDU A;  5DDM A;  4FE3 A;  4YFK A;  2IOH A;  2AXT U;  5JUM A;  2W03 A;  4IR9 A;  1C20 A;  3F5E A;  8ICR A;  9ICK A;  3RF9 A;  1L3V A;  2YML A;  3OSP A;  3AU6 A;  2WB1 C;  4F5R A;  2GLE A;  3QUB A;  4NJ8 A;  1RM6 C;  2AQ4 A;  1SV0 C;  4YXJ A;  2K60 A;  4B9U A;  3QU5 A;  4B9N A;  3UMB A;  2BCV A;  1WWU A;  5KFN A;  1NJX A;  1V9P A;  3B0X A;  2XIC A;  4UB2 A;  1VJ5 A;  4KLD A;  2WF6 A;  3V7J A;  4AP9 A;  3PW2 A;  4Y2S A;  1F5S A;  1T94 A;  5KFT A;  3CYM A;  3KHL A;  4ECV A;  2BKE A;  1ZQP A;  2KKP A;  4XRH A;  2WF8 A;  1IXR A;  4P4P A;  4ECS A;  2CN1 A;  2ZXH A;  2VAN A;  2JEJ A;  1Q3U A;  1QLN A;  5AIA A;  5D49 A;  1TAU A;  3BZC A;  2XGP A;  3PV8 A;  3C2M A;  5KG3 A;  2E8N A;  5T14 A;  4K4H A;  2O6K A;  5CJ7 A;  3L5K A;  1XNS A;  1TAM A;  5DLF A;  4EX6 A;  2BQR A;  2KHV A;  1NK8 A;  4DS5 A;  4UBC A;  5J0O A;  7ICQ A;  1J2M A;  2L5Y A;  2AHO B;  4IC9 A;  4OD0 A;  4JMU A;  2ES6 A;  2RDI A;  2ZXI A;  4Y2P A;  3LVW A;  2ASD A;  4M9L A;  2MUT B;  3PY8 A;  4M9N A;  4ED2 A;  1UA1 A;  1Q46 A;  2N1R A;  4QNL A;  4DQP A;  3KKA A;  3QU9 A;  4OJO A;  5DGA A;  3B9J A;  3D6J A;  5KG7 A;  5KG0 A;  4EYI B;  4I2I A;  3E2E A;  3UMC A;  2NO4 A;  4QZD A;  5KTQ A;  3H0M B;  2HHX A;  1L8O A;  3HJE A;  2XID A;  1ZQY A;  5HP4 A;  1A6S A;  5CR0 A;  2DGZ A;  4O3O A;  2E8M A;  5J2E A;  2IMW P;  3KOO A;  2J6S A;  2MU2 A;  3TAR A;  4EBE A;  2IHN A;  5KFF A;  5ALK A;  2JHD A;  5CB1 A;  4ED7 A;  2LMR A;  3T79 A;  3TAC B;  4IRD A;  1L3S A;  3DEE A;  3OJS A;  4ED6 A;  2HW3 A;  4MFF A;  3C23 A;  5ALL A;  1ECW A;  2G0A A;  1SGG A;  4Y2J A;  5AKZ A;  3LWL A;  4RUC A;  2KTQ A;  4MEY A;  5KL8 B;  1PVQ A;  3WK8 A;  4RQM A;  4RNN A;  3HX0 A;  3QU4 A;  1ZQR A;  2W7O A;  1TFR A;  4J9N A;  4YN4 A;  4NWI A;  2MA1 A;  3RJH A;  3GIL A;  3EW9 A; 
#chains in the Genus database with same CATH homology
 2E8O A;  2Y9T A;  1JI7 A;  2B6G A;  4NL9 C;  2Y9U A;  4RQN A;  2EAM A;  3HIL A;  1PK1 A;  2L5Y A;  3BS5 A;  4IS7 A;  2ES6 A;  2F8K A;  3KKA C;  2KG5 A;  1WWV A;  2QB0 B;  5F3X B;  1COK A;  2QKQ A;  3H8M A;  3KKA A;  5L1M A;  1Z1V A;  3BS7 A;  3BQ7 A;  5JTI A;  3K1R B;  1SV0 A;  2D3D A;  2EAO A;  2EAP A;  1UCV A;  2KSO B;  2GLE A;  1RG6 A;  4NJ8 A;  1SXE A;  2QB1 A;  1SV0 C;  2K60 A;  1OXJ A;  5JRT A;  2E8M A;  1LKY B;  2KMD A;  2DL0 A;  5JU5 A;  2QAR A;  1B4F A;  2JV3 A;  1PK1 B;  3BS5 B;  1SXD A;  1WWU A;  2DKX A;  1SV4 A;  2LMR A;  3SEI A;  4PZN A;  3TAC B;  1OW5 A;  2KIV A;  2EAN A;  2D8C A;  1KW4 A;  1SGG A;  2YTU A;  2QB0 A;  1X66 A;  1DXS A;  2K4P A;  1V85 A;  3IDW A;  1LKY A;  4MHV A;  1B0X A;  2F3N A;  1V38 A;  2KE7 A;  1X9X A;  5J8Y A;  1F0M A;  4RQM A;  5KNI A;  2F44 A;  3TAD C;  2ESE A;  3SEN A;  4NL9 A;  2E8P A;  2E8N A;  1UQV A;  1PK3 A;  1X40 A;  2LPE A;  2DKZ A;  3TAD A;  2KSO A;  2FE9 A;  5J8Y C;  4PZO A;  2QAR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...