2EZZA

Solution structure of human barrier-to-autointegration factor baf nmr, ensemble of 20 simulated annealing structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezzA00
2EZXA 2EZYA 1CI4A 1QCKA 2ODGA 2EZZA 2BZFA
chains in the Genus database with same CATH superfamily
3C1YA 1NZBA 3CRXA 2BCRA 4J9SA 4BGDA 1LVHA 5AKKA 4KTQA 4LVSA 3CYMA 4I28A 2E3TA 3ZDDA 1QH9A 1RG6A 1SXDA 3PZPA 1OUQA 2W9BA 4PH5A 1PZNA 1GO3F 4NWIA 4R64A 3KHHA 3PSPA 2G5IB 1FFUA 3FDSA 4EEYA 5ALRA 1URJA 2JEGA 3OPXA 4RPZA 1L3TA 5IIKA 4ED7A 2HOFA 2W7OA 1D9DA 2HDOA 1Z00A 3EPIA 3IN5A 2IOFA 2J6UA 3QU4A 1V9PA 2ODGA 2ZJ8A 4NLZA 5CWRA 4F2SA 3IG8A 3ISDA 2UVUA 4TUQA 8ICWA 2F44A 5L1MA 1X2IA 1MQ2A 4U7CA 3QEBZ 4UATA 8ICYA 3JPOA 4ECWA 5G5GA 1ZD2P 4C8LA 5J2FA 1SZHA 3SR6A 1TAUA 1RYUA 3BZKA 3AMZA 4JK1A 3C5FA 4FZNA 5FP0A 1SV0C 1RDFA 1ZXIA 3MFHA 1L3UA 4ED3A 4DQPA 2NO5A 5C5JA 3D2SA 4UAUA 2KHVA 1NK8A 2DPJA 2WF5A 1N60A 3G6VA 5KAIU 8ICLA 1XSPA 5AI6A 2MSNA 1Q8KA 2W7PA 1X6IA 3L5KA 1TVAA 4M9JA 4RPXA 8ICGA 1BVSA 3QUQA 1SKSA 1ZQCA 5DG8A 4BXOA 1L8LA 2O6KA 4QWAA 1IXRA 5AKEA 3C2KA 4US8A 4DFPA 3PW7A 3JPRA 4GC6A 2ZIXA 2DFLA 1ZQQA 2G5HB 1NOMA 2JH1A 3N28A 4QZDA 4DL4A 3RJEA 3KZIU 4YR3A 2E8NA 1XS9D 1QSLA 2DKZA 5T14A 1V97A 5AK4A 3BQ0A 4C4SA 1Q3VA 1ZQVA 5L1KA 2ASLA 3MC1A 4F5RA 8ICQA 5KNIA 1WUDA 2ES6A 8ICMA 3KKAA 5DDYA 3RH5A 2WAQF 2DBYA 1ZQHA 2KK0A 3RH4A 4Y2PA 9ICKA 5KFOA 5J0WA 4RUAA 3THVA 3C2LA 2ZXHA 2PXIA 2IHNA 2HHVA 4I29A 4LJXA 1D8BA 2D8CA 2H3FA 4RUCA 2JRZA 4Q44A 5L1IA 4YQWA 2HSZA 5C0YA 4XUSA 2EZXA 2W9BB 4EEKA 2HHUA 2N1RA 3PW2A 5BOMA 4P4OA 4XRHA 3TAQA 1WYGA 1KTQA 2YQEA 1CI4A 2VA3A 3LDAA 4CGZA 1WG8A 1X9SA 4KLMA 4DL7A 4UQGA 2FMQA 3ZDBA 1MA7A 2G09A 3V7KA 4TQSA 3UXPA 5B5EU 2E1FA 3F5AA 4Y2XA 4YR0A 3V7JA 1U4BA 1JMSA 3RRHA 1ZQDA 1NNLA 4P4PA 1Q46A 2AXTU 2QB0A 2GO7A 2OYYA 3ZD8A 1X66A 4O3OA 1ZQMA 3HPOA 4F5QA 1BPBA 3NS1A 3V6KA 4NLKA 4OO1J 4G3IA 3PSFA 5KFEA 4RT2A 1RQLA 1OXJA 1JRPA 2CPRA 2FLPA 2BCVA 3KHGA 2W43A 1DXSA 3SQIA 3WK8A 3SV3A 4GXKA 5J2AA 2ZIVA 2OCEA 4LZGA 4KN4A 1DK3A 3IV6A 9ICEA 2EAPA 2WHEA 3Q8MA 2R8IA 2ZG6A 3TANA 1NK4A 1HUOA 4JMUA 1S9FA 3RJIA 2BQUA 4OJOA 4F93B 4ECXA 5BPCA 4DFKA 2YB1A 4RPYA 3ISCA 3HT3A 4C7YA 1NKEA 5ALQA 4F5PA 2ZIXB 5DKWA 2OM6A 5KFDA 4FBTA 2C2RA 5ALJA 3UMGA 4KMOB 2OWOA 2G0AA 4R8UB 5ALDA 1ZQWA 1O08A 5DGAA 4RQMA 2KSOA 2JEIA 2I9GA 2DWQA 2FJ6A 5F3XB 5DB9A 2Z7JA 2K4PA 3EYZA 5KT6A 4KLSA 2KTQA 2H3IA 3C28A 1PVPA 2FDRA 2LM4A 4NLCA 2EDUA 2E5SA 3VCBA 1RM6C 8ICPA 4OCZA 2NV3A 1FIQA 4JV1A 9ICWA 4IQUA 5J0TA 5J0QA 8ICOA 5J8YA 1A76A 4DSKA 3S6JA 1S8OA 1JXLA 1YZ7A 4KX3A 3MR3A 2HOIA 5EE9A 4P4MA 2AGQA 5J0SA 2XGQA 2KZ3A 3B0XA 3MGIA 3OSPA 1XO0A 4PHPA 7ICVA 4C4RA 1JX4A 5J2KA 1N63A 2KG5A 4DL6A 1CRXA 4US9A 1HUZA 2HVIA 5AKXA 4QIWF 8ICZA 4O3SA 1UT5A 3RB0A 5J2JA 5KG1A 5KT4A 3HWTA 1SV0A 3GU3A 4DEZA 2M9NA 5KFHA 2WTFA 5KFJA 3RAQA 1V38A 1RPLA 2DF4B 4MFAA 1N5XA 5ALEA 3GV5B 2AGOA 3J81j 4DQRA 2HHSA 2OEHA 1NJXA 4Z6EA 3TFRA 2AHOB 3IM1A 4J9QA 2HBKA 1U49A 4YN4A 4Y2TA 1PK1B 5J0OA 4ECYA 2B6GA 2DUYA 1NZPA 3BQ7A 5KG4A 5F9NA 5KG5A 2J6TA 3WKBA 1SV4A 4Y2SA 4FS2A 5AIAA 2W9MA 3T5HA 3AU6A 1ZQTA 9ICPA 2JZBA 3PMLA 1QQ6A 1C7YA 4IL6U 4B9MA 3LWMA 2HBMA 1KKXA 5ALYA 4ED1A 1B22A 4PZNA 2ATLA 2LMRA 4Z6CA 1SXEA 7ICMA 2KFNA 4JV0A 2BCUA 8ICNA 4QZBA 1ZQYA 1XSLA 2JGAA 2ZUDA 3PX0A 3T5LA 2HOQA 2OHFA 2YTUA 8ICJA 4QZFA 5CR0A 1FEZA 8ICVA 4PL1A 4DSFA 4X5VA 2AJQA 5AI4A 2CN1A 3LVVA 4JWMA 1ZQKA 1WWUA 2KSOB 4IQWA 3A0BU 7ICUA 1BNOA 2F76X 3RAXA 1UT8A 2W11A 5AKLA 3AUOA 4BX9C 1XU4A 3OTQA 4EBEA 4CF4A 4IQTA 3RJJA 4QWEA 3PW4A 4B9SA 1Q3UA 1DOQA 3F53A 3NUQA 3N7SC 5DG7A 2K8BB 1H38A 1PVQA 5AM4A 9ICTA 5KFYA 2R8HA 1RYRA 4P0PA 1HIWA 3ETLA 1L7NA 2W9CA 2XI9A 3AQEA 4UARA 3SAHA 2IA6A 3C21A 2FI1A 2FLLA 5EOZA 5CRXA 3ZI4A 7ICRA 1S5LU 9ICBA 1JXEA 4IR9A 4CNQA 4UB5A 4OJLA 5CA7A 3BS5A 2W3SA 4ECQA 1MN8A 4M9GA 5AK6A 9ICVA 1B0XA 2XCAA 2IMWP 1SIJA 3EWAA 4I2CA 3QXGA 3TARA 4CDGA 2HHQA 2QKQA 4PL2A 5J2GA 4M2YA 3HKZC 5JTIA 4Q8EA 8ICFA 4M6WA 5KFSA 3M8SA 2VKQA 2ZIUA 3Q8PB 2MAXA 4DQSA 3K4GA 1IM4A 1NK9A 4RU9A 1DGJA 1L6NA 5D49A 4MFFA 5AKJA 1BPDA 1HEKA 4FO6A 1O03A 1ZOLA 2W3RA 2XY7A 2K89A 5ALWA 4JUZA 1Z3EB 1NK0A 2BPGA 5ALOA 1KFSA 3H0LB 3NVZA 3ZDCA 5ALIA 3UXOA 2FE9A 1M6YA 2Q4TA 5KG3A 5HMLA 4RNOA 3KOOA 4KX5A 1A0PA 2KD1A 4ELVA 3QUTA 1L5UA 2XC9A 3SI8A 5K4LA 2W9AA 1U48A 5KFVA 4DOAA 1QQ5A 2FLNA 9ICIA 2P6RA 5KT2A 5A0LA 3UM9A 5J0RA 3TQ1A 4F4WA 2A1JA 2H3VA 4Y2VA 1ZQIA 4G9BA 3G6XA 4Y2JA 1ZQUA 4AYBC 4RNMA 4O5EA 2LYHA 1COOA 2V4QA 2BCSA 2JEFA 4YXMA 1SGGA 4F72A 1RXVA 2AQ0A 1L7MA 1NJWA 2K4EA 1JIHA 3DEEA 1YT3A 1XC9A 4YP3A 4K4IA 3H8JA 4O9MA 1UQVA 2KMDA 1ZJNA 5EWEA 4EBCA 2ZTDA 4O3QA 4C8OA 3MABA 2YMMA 3HW8A 4J03A 3TFSA 4PZOA 4J9NA 2ASDA 4P0PB 5JU5A 4TQRA 1XWLA 4PJ0U 1DRGA 2W9CB 3K1ZA 2MA1A 2XGPA 3PX6A 1SL2A 2JMGA 4F8RA 1T3QA 4FZLA 3PO4A 1CEZA 4QWCA 1KBUA 3RF9A 4PGQA 2I6XA 1JALA 1MQ3A 3QU5A 4IRCA 3KD3A 3IG5A 3DDHA 3QZ7A 4P0QB 2L5YA 1SL0A 4OD0A 3GQCA 4RQ6A 2LHTA 4KLUA 4YXJA 3FM9A 2A3VA 5ALFA 7ICSA 1N5WA 4EELA 1LKYA 1TKDA 1RQNA 3MGHA 4DF8A 9ICNA 9ICQA 5KFRA 3MGVA 1KN5A 4QZ9A 4CF3A 5J0YA 2F8KA 1D8LA 3HJEA 3WK6A 1S0OA 5CP2A 8ICHA 3C1ZA 2UVRA 1S0VA 2PKEA 2XY6A 2RDIA 1KFDA 5ALTA 3QUCA 4M6WB 4R63A 3WK5A 3RTVA 5ALKA 2KKPA 3EPGA 4YFKA 2R8GA 2BDPA 5GTHU 5AI0A 2PFPA 2YX8A 4YCXA 1B4FA 4CCHA 2WF6A 3K1RB 2KN7A 3PR4A 1X42A 3GZFA 4Z6DA 2ISPA 4XQ8A 2VJ5A 5ALGA 3PR5B 7ICKA 4QZHA 3T5JA 4O3RA 3RRGA 2KEYA 1ZYQA 9ICRA 1S76D 1UA0A 4O3NA 1NJZA 1Z00B 3B0YA 4RT3A 2H5XA 3KHLA 4EX7A 4M04A 2KE7A 1ZQJA 4I2GA 2AU0A 2KHQA 2ZJ5A 3RB3A 2EZZA 2KZZA 3ZD9A 1COKA 7ICIA 2A1JB 3NRWA 2IHMA 5CHGA 5AIBA 9ICXA 5IIOA 3WKEA 2UVVA 3PW5A 3M9OB 1QQ7A 1SL1A 4QJFB 4KLEA 3BDPA 2P35A 3H8MA 5DB6A 4C8KA 2BPCA 3HILA 1TAQA 3IHQB 3WK4A 2VJ4A 1ZETA 3RJKA 3TADC 3ED5A 1VJ5A 3SEIA 4J9RA 5ALHA 5KFUA 3OJSA 3H8WA 4OJ6A 2W03A 2LBOA 4BXOB 5DBBA 4ZH4A 2LPEA 4B9TA 3RB6A 5AM0A 2HBLA 2WFAA 3JPPA 1NKCA 4QZGA 2NYVA 2XO7A 4GXJA 4ECTA 5IIMA 1XSNA 5JRTA 1IIPA 1ZJMA 1LV5A 3E0FA 1QSYA 1TV9A 4JB3A 2JR5A 5KFLA 3SENA 4YMNA 2MU2A 1S77D 4RQ1A 4PGYA 4B9UA 5AM5A 4ECVA 7ICFA 1XNSA 4YVZA 2YMQA 4RQ0A 3T3FA 3GFKB 5DGBA 9ICOA 2F1JA 2KVSA 4DWIA 3IP4B 5ALNA 4DQQA 5KG7A 3M8RA 4UAZA 1UA1A 2BGWA 8ICUA 2GH1A 3A0HU 4EBDA 2E8PA 5CEHA 5AKHA 4FZMA 4ECSA 4IQVA 3UXNA 4B9NA 3MBYA 4LZDA 2I1QA 2H3ZA 2KOBA 2WAQC 1QCKA 4DL2A 3M9MB 2HHXA 2HBJA 1KDHA 2JEJA 1NJYA 4Y2RA 4ZOHC 1ECWA 5KFGA 4NM2A 5J2HA 3V6JA 7ICHA 4DL5A 4KLQA 4FFDA 5KG2A 4C0ZA 3SD7A 2PFNA 5AKZA 2HMXA 3MDCA 4M0AA 5GTIU 1V85A 1K1SA 5HP4A 3WK9A 4DO9A 2RQ5A 2GOLA 8ICAA 2MUTA 4Y2QA 4O0IA 4B6JA 4R65A 2YB4A 2BPFA 1ZQXA 4KLTA 5F9LA 2ZIWA 9ICFA 2QB0B 4I2DA 2AH5A 4YMMA 4K4HA 3PY8A 2J6SA 2F2AB 3PV8A 5B66U 3TKAA 3TAPA 2K4HA 5KFBA 4EX6A 2GLEA 4KLGA 1BPYA 5KT5A 5AI8A 3D2NA 3UPQA 4F4XA 1L3SA 1SKRA 3QEAZ 3OHAA 3RFAA 4C4TA 3KKAC 4QWBA 1B43A 1ZQNA 2Y9TA 5J0XA 1ZD3A 2K60A 4DL3A 2ASJA 1F5SA 2ZIVB 1DK2A 2FMPA 3QU7A 1S0MA 1RYSA 4BUGA 3D2QA 1TK8A 1LB2B 4I2BA 4O3MA 7ICTA 4F5OA 1TK0A 4UAYA 2DPIA 2W04A 1SWVA 1EXNA 3SMVA 2RLTA 5ALPA 1IG6A 2G08A 4NLNA 5KFXA 3C29A 1DGSA 2Y0SF 5KFMA 1ED1A 3N7PD 3GV8B 3Q8LA 2PMZF 1MSWD 4DLGA 1X9WA 2XICA 3QU9A 2WB1F 3HP6A 1JROA 3UMCA 4I27A 2QARA 4DSLA 9ICMA 2PI5A 3QE9Y 3C5GA 3B9JA 2GWSA 4GIBA 7ICQA 5AI5A 1PVRA 3KFUF 5KG0A 5DB8A 2DKXA 1Z19A 1SKWA 5EE3A 3IDWA 3LWLA 3N97B 4E0DA 1UCVA 3M7DA 2G07A 5KFNA 4R66A 3PSTA 3GIMA 4UBBA 1IV8A 4J9MA 5IIIA 3NVWA 1RZTA 1ZRNA 4F91B 5AI9A 4NM1A 3BZCA 2KJ5A 2RHFA 3AM9A 3PMNA 4UW9A 5ALXA 4J9PA 1BGXT 5AKIA 3NVYA 5AKYA 2NO4A 5DBAA 4ECUA 4ICAA 4EYHB 9ICHA 5ALZA 2K4IA 5KFAA 2AGPA 5AK3A 1P7DA 2FPKA 4DFDA 4KLLA 4MFCA 9ICAA 5CJ7A 2NRWA 4CF5A 4ED8A 2EANA 2C2EA 4IRKA 5AM3A 4I2JA 2KKVA 4GXIA 2D6FC 3OGUA 4MF8A 5KTQA 3RJGA 5DLFA 1TK5A 3ONNA 3MDAA 4QW8A 2K8AA 4HAIA 5IIJA 1U45A 2R8JA 1WCNA 4F4ZA 3DV9A 4ED0A 4JV2A 3QZ8A 2ZIWB 1X9MA 3TADA 4QZIA 1SZPA 2KFZA 2Y9UA 2W54A 1TFRA 4QIWC 4MF2A 9ICLA 2VIXA 5DLGA 4Y2UA 4QZAA 4UAVA 2C28A 1BPZA 2E1EA 4I2AA 4KLIA 1L8OA 1KL9A 4DSIA 4MHVA 2NRTA 1BPEA 2MRLA 2BQ3A 4F4KA 3OJUA 3H8SA 4DLEA 2XY5A 3K75D 2JZBB 5HNKA 2BCQA 3SV4A 2NRXA 5J2CA 1Y88A 2LM1A 4BDPA 5E79U 4YMOA 5DQGA 1TE2A 3KHRA 3FC4A 2QLTA 5J8YC 2G06A 1KSPA 1AROP 2BHNA 5EE0A 4TUSA 1QLNA 1VDVA 1L3VA 4Q45A 4DS4A 4CRXA 3ZDAA 1XO1A 1S10A 4ELUA 2HI0A 1VLBA 7ICGA 5ALUA 2ZTEA 1KFTA 9ICSA 4RQNA 3Q8SB 3M1YA 5H2FU 3MR2A 2QARB 3H40A 5KFFA 9ICGA 2FPLA 3BQTA 4IS7A 3OHBA 4OJ5A 3D6JA 2Y0SC 3HRDD 3SZ2A 1U9LA 5D46A 4DSJA 2ZXIA 2Y1IA 2PMZC 3BQ1A 2F1IA 4J9OA 4O5CA 3ICXA 2UVWA 2WB1C 4KITB 4GLXA 4IRDA 3N4MB 5DB7A 2JH7A 1Z1VA 2EAOA 3V7LA 3FYHA 3GV7B 1NK7A 5KL1B 4KN7A 3Q8KA 4NXZA 4DFJA 4F71A 5KL8B 5AM2A 4HYKA 3I76A 3KTQA 1ZD5A 3JPQA 2M0NA 3WKAA 2KIVA 4YR2A 5KT3A 5J2BA 5AKGA 1QSSA 3KBBA 2OH2A 1ZQ1C 3BS5B 4UB8U 2ZJAA 4R8UA 4O5KA 3V72A 1L7OA 4UB4A 2KICA 2KNJA 3Q8QB 4TURA 3R9KA 3BQ2A 2HW3A 1NK5A 3CP8A 2EQYA 2YN4A 4DOBA 3LK9A 1PK3A 4Y2YA 3PX4A 4RZRA 5HR7A 1PUZA 1ZQAA 1F0MA 2ZIUB 1ZQPA 2KJ8A 3MR5A 8ICEA 3EZ5A 1Z4OA 2YMLA 3PVXA 4PHEA 2W55A 5AICA 3MR6A 1X40A 2PFQA 1JUDA 3ALRA 8ICRA 2IBKA 2E8OA 5KFCA 3BJYA 7ICEA 3UQ2A 3RBDA 3QYPA 5L9XA 4BWJA 4BJQA 2NRVA 1UPHA 1WWVA 3FAHA 3L3FX 4FS1A 3F2DA 1YZ6A 2B21A 2XIDA 4I2IA 2A1AA 4PPXA 5HHHA 4RQ5A 5DG9A 3Q8RB 5KFIA 3M6KA 3G6YA 4EENA 2RRDA 4TUPA 3M9NB 2F77X 5J0UA 4NLGA 8ICIA 3N7RC 1T8EA 2IOFK 3JPNA 5IILA 3H0MB 4RQ2A 2V9WA 4MEYA 1N62A 3GIJA 1ZQFA 3C23A 3RH6A 3H0RB 3NGDA 4NL9C 2H3QA 2DQNB 2Y1JA 4WJ3B 4K4GA 2P6UA 1SWWA 3H4DA 5L1JA 3H7IA 5J0PA 2VANA 4EYIB 5G5HA 1T4GA 2BQRA 4KLFA 4C7ZA 4KLJA 2PFOA 4F92B 5J2IA 4I2HA 3SYZA 7ICJA 2AQ4A 1BPXA 3F2CA 4FBUA 1ZQOA 2ZUBA 5KFKA 4ELTA 2F1HA 2KZMA 4XA5A 3AEVA 4EZ9A 5DDMA 4UB1A 4DQIA 5AK5A 4IR1A 4YD1A 1PK1A 3O0FA 4J9LA 4EZ6A 2RP5A 2FPMA 3C2MA 1SB3C 3IRUA 3SAFA 9ICUA 4DSEA 2JXJA 4USAA 4DF4A 3VC8A 3RBEA 5J2DA 1X9XA 4QWDA 4F5NA 4O3PA 1T94A 3PO5A 9ICCA 3LYSA 2PI4A 4C8NA 4A8EA 1BNPA 2WF8A 5IINA 2DGZA 4F4YA 1QTMA 1KRPA 4C80A 2EH9A 4Z6FA 3F2BA 1N2XA 2D3DA 3T5KA 2XVTA 5HR6A 3JPTA 2V4RA 2RDJA 3EW9A 1NI3A 3QX7A 1CUKA 2NRZA 3AN1A 2ZTCA 3GIKA 5DQHA 3U26A 1LKYB 4ACOA 8ICSA 1RXWA 1ZQRA 2KVCA 3F5EA 4OJPA 1T7PA 8ICBA 9ICJA 3ZDEA 4CE6A 2WF7A 2P66A 1T3NA 2LKYA 8ICCA 3NVVA 1WCLA 5HMMA 4UB2A 2BR0A 3AQFA 3MFIA 5DQIA 2IOHA 1KW4A 1S0NA 4ECRA 4PGXA 5KFWA 3SAGA 2VA8A 5EE1A 3I1YA 1F44A 1JN3A 1K1QA 2KP7A 5L1LA 2VA2A 7ICPA 8ICXA 3EUB2 3ISBA 1N56A 7ICLA 2BKEA 4M9HA 5EWFA 2EZYA 5ALMA 2F8LA 2WF9A 3JPSA 1J2MA 4JWNA 2JHDA 1MC8A 3HKZF 3GDXA 5CB1A 4QZ8A 1J97A 4M47A 4RQ4A 4Q43A 3M6ZA 5BOLA 4J9KA 8ICTA 4PHDA 4ED2A 2ESEA 4U6PA 5AHXA 4QZEA 2F3NA 5J2EA 5D4BA 2XCPA 4DCCA 3T79A 2E8MA 4PHAA 2KIWA 8ICKA 1D8YA 2C2DA 1ZQEA 5ALLA 3RR7A 4GC7A 4YD2A 3WKCA 1TAMA 4DOCA 3KZXA 4KMUA 5AM1A 3CW2C 2QB1A 1Z4NA 4IC9A 2R18A 4DS5A 3V6HA 3UMBA 1FO4A 3WU2U 4FE3A 4M9NA 3H4BA 3HX0A 2OXOA 4I2EA 4F3OA 2CXYA 3NASA 2ALZA 1ZQZA 1HJPA 1ZQSA 4RQ7A 3I28A 1A77A 2BDUA 1U47A 2EAMA 1S97A 3BS7A 1X6JA 7ICNA 5EWGA 5KAFU 3UQ0A 2HCFA 2C22A 5J29A 1J2NA 4NV0A 4AYBF 4M9LA 5KFTA 1D9FA 4UB3A 3AL0B 3RB4A 1Z1BA 7ICOA 3QUBA 4F2RA 2HVHA 3RJFA 4MEXA 4QW9A 3TI0A 1KLNA 1ZD4A 4YG2A 2A19A 5KFZA 4KLOA 2LYAA 4NJ8A 2JV3A 3TACB 2FMSA 5DBCA 4RQ3A 2LYBA 2BZFA 3ETRA 4NLBA 5TZVA 3PW0A 4UASA 4C8MA 3GILA 4I2FA 2KJ9A 3CNHA 1OW5A 4DFMA 2Q0ZX 1N48A 4QNLA 4UBCA 2W8KA 4QZCA 2B0CA 3E58A 5KT7A 3WK7A 3ORYA 5HHIA 4P2HA 3LVWA 1KEJA 4ED6A 5KFPA 1JI7A 3E2EA 1N61A 1ZRMA 5KFQA 2DL0A 1FFVA 4KLDA 4UAWA 3PSIA 4AP9A 3AU2A 4B9VA 1KQQA 5KG6A 1ZQLA 3QU2A 3OSNA 2KV2A 2I5HA 1UHUA 2K8CB 4F50A 2YY6A 3GIIA 4KLHA 4UB6U 4Q8FA 1AQ6A 2ISOA 1C20A 4RNNA 3L4PA 4B9LA 1NKBA 3RJHA 3WKDA 4NL9A 1L7PA 2LI6A 2HHTA 5TISU 3RR8A 1ZQGA 3NRZA 2R8KA 4P0QA 1A6SA 3QNMA 5ALSA 3PNCA 2W8LA 2MUTB 2HHWA 4BWMA 4NY8A 2CRXA 4ECZA 3NTUA 1K5OA 1NK6A 4GFJA 2YMPA 4RQ8A 5ALVA 5JUMA 2ZUCA 1ZQBA
chains in the Genus database with same CATH topology
2EZXA 2EZYA 1CI4A 1QCKA 2ODGA 2EZZA 2BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZX A;  2EZY A;  1CI4 A;  1QCK A;  2ODG A;  2EZZ A;  2BZF A; 
#chains in the Genus database with same CATH topology
 3C1Y A;  1NZB A;  3CRX A;  2BCR A;  4J9S A;  4BGD A;  1LVH A;  5AKK A;  4KTQ A;  4LVS A;  3CYM A;  4I28 A;  2E3T A;  3ZDD A;  1QH9 A;  1RG6 A;  1SXD A;  3PZP A;  1OUQ A;  2W9B A;  4PH5 A;  1PZN A;  1GO3 F;  4NWI A;  4R64 A;  3KHH A;  3PSP A;  2G5I B;  1FFU A;  3FDS A;  4EEY A;  5ALR A;  1URJ A;  2JEG A;  3OPX A;  4RPZ A;  1L3T A;  5IIK A;  4ED7 A;  2HOF A;  2W7O A;  1D9D A;  2HDO A;  1Z00 A;  3EPI A;  3IN5 A;  2IOF A;  2J6U A;  3QU4 A;  1V9P A;  2ODG A;  2ZJ8 A;  4NLZ A;  5CWR A;  4F2S A;  3IG8 A;  3ISD A;  2UVU A;  4TUQ A;  8ICW A;  2F44 A;  5L1M A;  1X2I A;  1MQ2 A;  4U7C A;  3QEB Z;  4UAT A;  8ICY A;  3JPO A;  4ECW A;  5G5G A;  1ZD2 P;  4C8L A;  5J2F A;  1SZH A;  3SR6 A;  1TAU A;  1RYU A;  3BZK A;  3AMZ A;  4JK1 A;  3C5F A;  4FZN A;  5FP0 A;  1SV0 C;  1RDF A;  1ZXI A;  3MFH A;  1L3U A;  4ED3 A;  4DQP A;  2NO5 A;  5C5J A;  3D2S A;  4UAU A;  2KHV A;  1NK8 A;  2DPJ A;  2WF5 A;  1N60 A;  3G6V A;  5KAI U;  8ICL A;  1XSP A;  5AI6 A;  2MSN A;  1Q8K A;  2W7P A;  1X6I A;  3L5K A;  1TVA A;  4M9J A;  4RPX A;  8ICG A;  1BVS A;  3QUQ A;  1SKS A;  1ZQC A;  5DG8 A;  4BXO A;  1L8L A;  2O6K A;  4QWA A;  1IXR A;  5AKE A;  3C2K A;  4US8 A;  4DFP A;  3PW7 A;  3JPR A;  4GC6 A;  2ZIX A;  2DFL A;  1ZQQ A;  2G5H B;  1NOM A;  2JH1 A;  3N28 A;  4QZD A;  4DL4 A;  3RJE A;  3KZI U;  4YR3 A;  2E8N A;  1XS9 D;  1QSL A;  2DKZ A;  5T14 A;  1V97 A;  5AK4 A;  3BQ0 A;  4C4S A;  1Q3V A;  1ZQV A;  5L1K A;  2ASL A;  3MC1 A;  4F5R A;  8ICQ A;  5KNI A;  1WUD A;  2ES6 A;  8ICM A;  3KKA A;  5DDY A;  3RH5 A;  2WAQ F;  2DBY A;  1ZQH A;  2KK0 A;  3RH4 A;  4Y2P A;  9ICK A;  5KFO A;  5J0W A;  4RUA A;  3THV A;  3C2L A;  2ZXH A;  2PXI A;  2IHN A;  2HHV A;  4I29 A;  4LJX A;  1D8B A;  2D8C A;  2H3F A;  4RUC A;  2JRZ A;  4Q44 A;  5L1I A;  4YQW A;  2HSZ A;  5C0Y A;  4XUS A;  2EZX A;  2W9B B;  4EEK A;  2HHU A;  2N1R A;  3PW2 A;  5BOM A;  4P4O A;  4XRH A;  3TAQ A;  1WYG A;  1KTQ A;  2YQE A;  1CI4 A;  2VA3 A;  3LDA A;  4CGZ A;  1WG8 A;  1X9S A;  4KLM A;  4DL7 A;  4UQG A;  2FMQ A;  3ZDB A;  1MA7 A;  2G09 A;  3V7K A;  4TQS A;  3UXP A;  5B5E U;  2E1F A;  3F5A A;  4Y2X A;  4YR0 A;  3V7J A;  1U4B A;  1JMS A;  3RRH A;  1ZQD A;  1NNL A;  4P4P A;  1Q46 A;  2AXT U;  2QB0 A;  2GO7 A;  2OYY A;  3ZD8 A;  1X66 A;  4O3O A;  1ZQM A;  3HPO A;  4F5Q A;  1BPB A;  3NS1 A;  3V6K A;  4NLK A;  4OO1 J;  4G3I A;  3PSF A;  5KFE A;  4RT2 A;  1RQL A;  1OXJ A;  1JRP A;  2CPR A;  2FLP A;  2BCV A;  3KHG A;  2W43 A;  1DXS A;  3SQI A;  3WK8 A;  3SV3 A;  4GXK A;  5J2A A;  2ZIV A;  2OCE A;  4LZG A;  4KN4 A;  1DK3 A;  3IV6 A;  9ICE A;  2EAP A;  2WHE A;  3Q8M A;  2R8I A;  2ZG6 A;  3TAN A;  1NK4 A;  1HUO A;  4JMU A;  1S9F A;  3RJI A;  2BQU A;  4OJO A;  4F93 B;  4ECX A;  5BPC A;  4DFK A;  2YB1 A;  4RPY A;  3ISC A;  3HT3 A;  4C7Y A;  1NKE A;  5ALQ A;  4F5P A;  2ZIX B;  5DKW A;  2OM6 A;  5KFD A;  4FBT A;  2C2R A;  5ALJ A;  3UMG A;  4KMO B;  2OWO A;  2G0A A;  4R8U B;  5ALD A;  1ZQW A;  1O08 A;  5DGA A;  4RQM A;  2KSO A;  2JEI A;  2I9G A;  2DWQ A;  2FJ6 A;  5F3X B;  5DB9 A;  2Z7J A;  2K4P A;  3EYZ A;  5KT6 A;  4KLS A;  2KTQ A;  2H3I A;  3C28 A;  1PVP A;  2FDR A;  2LM4 A;  4NLC A;  2EDU A;  2E5S A;  3VCB A;  1RM6 C;  8ICP A;  4OCZ A;  2NV3 A;  1FIQ A;  4JV1 A;  9ICW A;  4IQU A;  5J0T A;  5J0Q A;  8ICO A;  5J8Y A;  1A76 A;  4DSK A;  3S6J A;  1S8O A;  1JXL A;  1YZ7 A;  4KX3 A;  3MR3 A;  2HOI A;  5EE9 A;  4P4M A;  2AGQ A;  5J0S A;  2XGQ A;  2KZ3 A;  3B0X A;  3MGI A;  3OSP A;  1XO0 A;  4PHP A;  7ICV A;  4C4R A;  1JX4 A;  5J2K A;  1N63 A;  2KG5 A;  4DL6 A;  1CRX A;  4US9 A;  1HUZ A;  2HVI A;  5AKX A;  4QIW F;  8ICZ A;  4O3S A;  1UT5 A;  3RB0 A;  5J2J A;  5KG1 A;  5KT4 A;  3HWT A;  1SV0 A;  3GU3 A;  4DEZ A;  2M9N A;  5KFH A;  2WTF A;  5KFJ A;  3RAQ A;  1V38 A;  1RPL A;  2DF4 B;  4MFA A;  1N5X A;  5ALE A;  3GV5 B;  2AGO A;  3J81 j;  4DQR A;  2HHS A;  2OEH A;  1NJX A;  4Z6E A;  3TFR A;  2AHO B;  3IM1 A;  4J9Q A;  2HBK A;  1U49 A;  4YN4 A;  4Y2T A;  1PK1 B;  5J0O A;  4ECY A;  2B6G A;  2DUY A;  1NZP A;  3BQ7 A;  5KG4 A;  5F9N A;  5KG5 A;  2J6T A;  3WKB A;  1SV4 A;  4Y2S A;  4FS2 A;  5AIA A;  2W9M A;  3T5H A;  3AU6 A;  1ZQT A;  9ICP A;  2JZB A;  3PML A;  1QQ6 A;  1C7Y A;  4IL6 U;  4B9M A;  3LWM A;  2HBM A;  1KKX A;  5ALY A;  4ED1 A;  1B22 A;  4PZN A;  2ATL A;  2LMR A;  4Z6C A;  1SXE A;  7ICM A;  2KFN A;  4JV0 A;  2BCU A;  8ICN A;  4QZB A;  1ZQY A;  1XSL A;  2JGA A;  2ZUD A;  3PX0 A;  3T5L A;  2HOQ A;  2OHF A;  2YTU A;  8ICJ A;  4QZF A;  5CR0 A;  1FEZ A;  8ICV A;  4PL1 A;  4DSF A;  4X5V A;  2AJQ A;  5AI4 A;  2CN1 A;  3LVV A;  4JWM A;  1ZQK A;  1WWU A;  2KSO B;  4IQW A;  3A0B U;  7ICU A;  1BNO A;  2F76 X;  3RAX A;  1UT8 A;  2W11 A;  5AKL A;  3AUO A;  4BX9 C;  1XU4 A;  3OTQ A;  4EBE A;  4CF4 A;  4IQT A;  3RJJ A;  4QWE A;  3PW4 A;  4B9S A;  1Q3U A;  1DOQ A;  3F53 A;  3NUQ A;  3N7S C;  5DG7 A;  2K8B B;  1H38 A;  1PVQ A;  5AM4 A;  9ICT A;  5KFY A;  2R8H A;  1RYR A;  4P0P A;  1HIW A;  3ETL A;  1L7N A;  2W9C A;  2XI9 A;  3AQE A;  4UAR A;  3SAH A;  2IA6 A;  3C21 A;  2FI1 A;  2FLL A;  5EOZ A;  5CRX A;  3ZI4 A;  7ICR A;  1S5L U;  9ICB A;  1JXE A;  4IR9 A;  4CNQ A;  4UB5 A;  4OJL A;  5CA7 A;  3BS5 A;  2W3S A;  4ECQ A;  1MN8 A;  4M9G A;  5AK6 A;  9ICV A;  1B0X A;  2XCA A;  2IMW P;  1SIJ A;  3EWA A;  4I2C A;  3QXG A;  3TAR A;  4CDG A;  2HHQ A;  2QKQ A;  4PL2 A;  5J2G A;  4M2Y A;  3HKZ C;  5JTI A;  4Q8E A;  8ICF A;  4M6W A;  5KFS A;  3M8S A;  2VKQ A;  2ZIU A;  3Q8P B;  2MAX A;  4DQS A;  3K4G A;  1IM4 A;  1NK9 A;  4RU9 A;  1DGJ A;  1L6N A;  5D49 A;  4MFF A;  5AKJ A;  1BPD A;  1HEK A;  4FO6 A;  1O03 A;  1ZOL A;  2W3R A;  2XY7 A;  2K89 A;  5ALW A;  4JUZ A;  1Z3E B;  1NK0 A;  2BPG A;  5ALO A;  1KFS A;  3H0L B;  3NVZ A;  3ZDC A;  5ALI A;  3UXO A;  2FE9 A;  1M6Y A;  2Q4T A;  5KG3 A;  5HML A;  4RNO A;  3KOO A;  4KX5 A;  1A0P A;  2KD1 A;  4ELV A;  3QUT A;  1L5U A;  2XC9 A;  3SI8 A;  5K4L A;  2W9A A;  1U48 A;  5KFV A;  4DOA A;  1QQ5 A;  2FLN A;  9ICI A;  2P6R A;  5KT2 A;  5A0L A;  3UM9 A;  5J0R A;  3TQ1 A;  4F4W A;  2A1J A;  2H3V A;  4Y2V A;  1ZQI A;  4G9B A;  3G6X A;  4Y2J A;  1ZQU A;  4AYB C;  4RNM A;  4O5E A;  2LYH A;  1COO A;  2V4Q A;  2BCS A;  2JEF A;  4YXM A;  1SGG A;  4F72 A;  1RXV A;  2AQ0 A;  1L7M A;  1NJW A;  2K4E A;  1JIH A;  3DEE A;  1YT3 A;  1XC9 A;  4YP3 A;  4K4I A;  3H8J A;  4O9M A;  1UQV A;  2KMD A;  1ZJN A;  5EWE A;  4EBC A;  2ZTD A;  4O3Q A;  4C8O A;  3MAB A;  2YMM A;  3HW8 A;  4J03 A;  3TFS A;  4PZO A;  4J9N A;  2ASD A;  4P0P B;  5JU5 A;  4TQR A;  1XWL A;  4PJ0 U;  1DRG A;  2W9C B;  3K1Z A;  2MA1 A;  2XGP A;  3PX6 A;  1SL2 A;  2JMG A;  4F8R A;  1T3Q A;  4FZL A;  3PO4 A;  1CEZ A;  4QWC A;  1KBU A;  3RF9 A;  4PGQ A;  2I6X A;  1JAL A;  1MQ3 A;  3QU5 A;  4IRC A;  3KD3 A;  3IG5 A;  3DDH A;  3QZ7 A;  4P0Q B;  2L5Y A;  1SL0 A;  4OD0 A;  3GQC A;  4RQ6 A;  2LHT A;  4KLU A;  4YXJ A;  3FM9 A;  2A3V A;  5ALF A;  7ICS A;  1N5W A;  4EEL A;  1LKY A;  1TKD A;  1RQN A;  3MGH A;  4DF8 A;  9ICN A;  9ICQ A;  5KFR A;  3MGV A;  1KN5 A;  4QZ9 A;  4CF3 A;  5J0Y A;  2F8K A;  1D8L A;  3HJE A;  3WK6 A;  1S0O A;  5CP2 A;  8ICH A;  3C1Z A;  2UVR A;  1S0V A;  2PKE A;  2XY6 A;  2RDI A;  1KFD A;  5ALT A;  3QUC A;  4M6W B;  4R63 A;  3WK5 A;  3RTV A;  5ALK A;  2KKP A;  3EPG A;  4YFK A;  2R8G A;  2BDP A;  5GTH U;  5AI0 A;  2PFP A;  2YX8 A;  4YCX A;  1B4F A;  4CCH A;  2WF6 A;  3K1R B;  2KN7 A;  3PR4 A;  1X42 A;  3GZF A;  4Z6D A;  2ISP A;  4XQ8 A;  2VJ5 A;  5ALG A;  3PR5 B;  7ICK A;  4QZH A;  3T5J A;  4O3R A;  3RRG A;  2KEY A;  1ZYQ A;  9ICR A;  1S76 D;  1UA0 A;  4O3N A;  1NJZ A;  1Z00 B;  3B0Y A;  4RT3 A;  2H5X A;  3KHL A;  4EX7 A;  4M04 A;  2KE7 A;  1ZQJ A;  4I2G A;  2AU0 A;  2KHQ A;  2ZJ5 A;  3RB3 A;  2EZZ A;  2KZZ A;  3ZD9 A;  1COK A;  7ICI A;  2A1J B;  3NRW A;  2IHM A;  5CHG A;  5AIB A;  9ICX A;  5IIO A;  3WKE A;  2UVV A;  3PW5 A;  3M9O B;  1QQ7 A;  1SL1 A;  4QJF B;  4KLE A;  3BDP A;  2P35 A;  3H8M A;  5DB6 A;  4C8K A;  2BPC A;  3HIL A;  1TAQ A;  3IHQ B;  3WK4 A;  2VJ4 A;  1ZET A;  3RJK A;  3TAD C;  3ED5 A;  1VJ5 A;  3SEI A;  4J9R A;  5ALH A;  5KFU A;  3OJS A;  3H8W A;  4OJ6 A;  2W03 A;  2LBO A;  4BXO B;  5DBB A;  4ZH4 A;  2LPE A;  4B9T A;  3RB6 A;  5AM0 A;  2HBL A;  2WFA A;  3JPP A;  1NKC A;  4QZG A;  2NYV A;  2XO7 A;  4GXJ A;  4ECT A;  5IIM A;  1XSN A;  5JRT A;  1IIP A;  1ZJM A;  1LV5 A;  3E0F A;  1QSY A;  1TV9 A;  4JB3 A;  2JR5 A;  5KFL A;  3SEN A;  4YMN A;  2MU2 A;  1S77 D;  4RQ1 A;  4PGY A;  4B9U A;  5AM5 A;  4ECV A;  7ICF A;  1XNS A;  4YVZ A;  2YMQ A;  4RQ0 A;  3T3F A;  3GFK B;  5DGB A;  9ICO A;  2F1J A;  2KVS A;  4DWI A;  3IP4 B;  5ALN A;  4DQQ A;  5KG7 A;  3M8R A;  4UAZ A;  1UA1 A;  2BGW A;  8ICU A;  2GH1 A;  3A0H U;  4EBD A;  2E8P A;  5CEH A;  5AKH A;  4FZM A;  4ECS A;  4IQV A;  3UXN A;  4B9N A;  3MBY A;  4LZD A;  2I1Q A;  2H3Z A;  2KOB A;  2WAQ C;  1QCK A;  4DL2 A;  3M9M B;  2HHX A;  2HBJ A;  1KDH A;  2JEJ A;  1NJY A;  4Y2R A;  4ZOH C;  1ECW A;  5KFG A;  4NM2 A;  5J2H A;  3V6J A;  7ICH A;  4DL5 A;  4KLQ A;  4FFD A;  5KG2 A;  4C0Z A;  3SD7 A;  2PFN A;  5AKZ A;  2HMX A;  3MDC A;  4M0A A;  5GTI U;  1V85 A;  1K1S A;  5HP4 A;  3WK9 A;  4DO9 A;  2RQ5 A;  2GOL A;  8ICA A;  2MUT A;  4Y2Q A;  4O0I A;  4B6J A;  4R65 A;  2YB4 A;  2BPF A;  1ZQX A;  4KLT A;  5F9L A;  2ZIW A;  9ICF A;  2QB0 B;  4I2D A;  2AH5 A;  4YMM A;  4K4H A;  3PY8 A;  2J6S A;  2F2A B;  3PV8 A;  5B66 U;  3TKA A;  3TAP A;  2K4H A;  5KFB A;  4EX6 A;  2GLE A;  4KLG A;  1BPY A;  5KT5 A;  5AI8 A;  3D2N A;  3UPQ A;  4F4X A;  1L3S A;  1SKR A;  3QEA Z;  3OHA A;  3RFA A;  4C4T A;  3KKA C;  4QWB A;  1B43 A;  1ZQN A;  2Y9T A;  5J0X A;  1ZD3 A;  2K60 A;  4DL3 A;  2ASJ A;  1F5S A;  2ZIV B;  1DK2 A;  2FMP A;  3QU7 A;  1S0M A;  1RYS A;  4BUG A;  3D2Q A;  1TK8 A;  1LB2 B;  4I2B A;  4O3M A;  7ICT A;  4F5O A;  1TK0 A;  4UAY A;  2DPI A;  2W04 A;  1SWV A;  1EXN A;  3SMV A;  2RLT A;  5ALP A;  1IG6 A;  2G08 A;  4NLN A;  5KFX A;  3C29 A;  1DGS A;  2Y0S F;  5KFM A;  1ED1 A;  3N7P D;  3GV8 B;  3Q8L A;  2PMZ F;  1MSW D;  4DLG A;  1X9W A;  2XIC A;  3QU9 A;  2WB1 F;  3HP6 A;  1JRO A;  3UMC A;  4I27 A;  2QAR A;  4DSL A;  9ICM A;  2PI5 A;  3QE9 Y;  3C5G A;  3B9J A;  2GWS A;  4GIB A;  7ICQ A;  5AI5 A;  1PVR A;  3KFU F;  5KG0 A;  5DB8 A;  2DKX A;  1Z19 A;  1SKW A;  5EE3 A;  3IDW A;  3LWL A;  3N97 B;  4E0D A;  1UCV A;  3M7D A;  2G07 A;  5KFN A;  4R66 A;  3PST A;  3GIM A;  4UBB A;  1IV8 A;  4J9M A;  5III A;  3NVW A;  1RZT A;  1ZRN A;  4F91 B;  5AI9 A;  4NM1 A;  3BZC A;  2KJ5 A;  2RHF A;  3AM9 A;  3PMN A;  4UW9 A;  5ALX A;  4J9P A;  1BGX T;  5AKI A;  3NVY A;  5AKY A;  2NO4 A;  5DBA A;  4ECU A;  4ICA A;  4EYH B;  9ICH A;  5ALZ A;  2K4I A;  5KFA A;  2AGP A;  5AK3 A;  1P7D A;  2FPK A;  4DFD A;  4KLL A;  4MFC A;  9ICA A;  5CJ7 A;  2NRW A;  4CF5 A;  4ED8 A;  2EAN A;  2C2E A;  4IRK A;  5AM3 A;  4I2J A;  2KKV A;  4GXI A;  2D6F C;  3OGU A;  4MF8 A;  5KTQ A;  3RJG A;  5DLF A;  1TK5 A;  3ONN A;  3MDA A;  4QW8 A;  2K8A A;  4HAI A;  5IIJ A;  1U45 A;  2R8J A;  1WCN A;  4F4Z A;  3DV9 A;  4ED0 A;  4JV2 A;  3QZ8 A;  2ZIW B;  1X9M A;  3TAD A;  4QZI A;  1SZP A;  2KFZ A;  2Y9U A;  2W54 A;  1TFR A;  4QIW C;  4MF2 A;  9ICL A;  2VIX A;  5DLG A;  4Y2U A;  4QZA A;  4UAV A;  2C28 A;  1BPZ A;  2E1E A;  4I2A A;  4KLI A;  1L8O A;  1KL9 A;  4DSI A;  4MHV A;  2NRT A;  1BPE A;  2MRL A;  2BQ3 A;  4F4K A;  3OJU A;  3H8S A;  4DLE A;  2XY5 A;  3K75 D;  2JZB B;  5HNK A;  2BCQ A;  3SV4 A;  2NRX A;  5J2C A;  1Y88 A;  2LM1 A;  4BDP A;  5E79 U;  4YMO A;  5DQG A;  1TE2 A;  3KHR A;  3FC4 A;  2QLT A;  5J8Y C;  2G06 A;  1KSP A;  1ARO P;  2BHN A;  5EE0 A;  4TUS A;  1QLN A;  1VDV A;  1L3V A;  4Q45 A;  4DS4 A;  4CRX A;  3ZDA A;  1XO1 A;  1S10 A;  4ELU A;  2HI0 A;  1VLB A;  7ICG A;  5ALU A;  2ZTE A;  1KFT A;  9ICS A;  4RQN A;  3Q8S B;  3M1Y A;  5H2F U;  3MR2 A;  2QAR B;  3H40 A;  5KFF A;  9ICG A;  2FPL A;  3BQT A;  4IS7 A;  3OHB A;  4OJ5 A;  3D6J A;  2Y0S C;  3HRD D;  3SZ2 A;  1U9L A;  5D46 A;  4DSJ A;  2ZXI A;  2Y1I A;  2PMZ C;  3BQ1 A;  2F1I A;  4J9O A;  4O5C A;  3ICX A;  2UVW A;  2WB1 C;  4KIT B;  4GLX A;  4IRD A;  3N4M B;  5DB7 A;  2JH7 A;  1Z1V A;  2EAO A;  3V7L A;  3FYH A;  3GV7 B;  1NK7 A;  5KL1 B;  4KN7 A;  3Q8K A;  4NXZ A;  4DFJ A;  4F71 A;  5KL8 B;  5AM2 A;  4HYK A;  3I76 A;  3KTQ A;  1ZD5 A;  3JPQ A;  2M0N A;  3WKA A;  2KIV A;  4YR2 A;  5KT3 A;  5J2B A;  5AKG A;  1QSS A;  3KBB A;  2OH2 A;  1ZQ1 C;  3BS5 B;  4UB8 U;  2ZJA A;  4R8U A;  4O5K A;  3V72 A;  1L7O A;  4UB4 A;  2KIC A;  2KNJ A;  3Q8Q B;  4TUR A;  3R9K A;  3BQ2 A;  2HW3 A;  1NK5 A;  3CP8 A;  2EQY A;  2YN4 A;  4DOB A;  3LK9 A;  1PK3 A;  4Y2Y A;  3PX4 A;  4RZR A;  5HR7 A;  1PUZ A;  1ZQA A;  1F0M A;  2ZIU B;  1ZQP A;  2KJ8 A;  3MR5 A;  8ICE A;  3EZ5 A;  1Z4O A;  2YML A;  3PVX A;  4PHE A;  2W55 A;  5AIC A;  3MR6 A;  1X40 A;  2PFQ A;  1JUD A;  3ALR A;  8ICR A;  2IBK A;  2E8O A;  5KFC A;  3BJY A;  7ICE A;  3UQ2 A;  3RBD A;  3QYP A;  5L9X A;  4BWJ A;  4BJQ A;  2NRV A;  1UPH A;  1WWV A;  3FAH A;  3L3F X;  4FS1 A;  3F2D A;  1YZ6 A;  2B21 A;  2XID A;  4I2I A;  2A1A A;  4PPX A;  5HHH A;  4RQ5 A;  5DG9 A;  3Q8R B;  5KFI A;  3M6K A;  3G6Y A;  4EEN A;  2RRD A;  4TUP A;  3M9N B;  2F77 X;  5J0U A;  4NLG A;  8ICI A;  3N7R C;  1T8E A;  2IOF K;  3JPN A;  5IIL A;  3H0M B;  4RQ2 A;  2V9W A;  4MEY A;  1N62 A;  3GIJ A;  1ZQF A;  3C23 A;  3RH6 A;  3H0R B;  3NGD A;  4NL9 C;  2H3Q A;  2DQN B;  2Y1J A;  4WJ3 B;  4K4G A;  2P6U A;  1SWW A;  3H4D A;  5L1J A;  3H7I A;  5J0P A;  2VAN A;  4EYI B;  5G5H A;  1T4G A;  2BQR A;  4KLF A;  4C7Z A;  4KLJ A;  2PFO A;  4F92 B;  5J2I A;  4I2H A;  3SYZ A;  7ICJ A;  2AQ4 A;  1BPX A;  3F2C A;  4FBU A;  1ZQO A;  2ZUB A;  5KFK A;  4ELT A;  2F1H A;  2KZM A;  4XA5 A;  3AEV A;  4EZ9 A;  5DDM A;  4UB1 A;  4DQI A;  5AK5 A;  4IR1 A;  4YD1 A;  1PK1 A;  3O0F A;  4J9L A;  4EZ6 A;  2RP5 A;  2FPM A;  3C2M A;  1SB3 C;  3IRU A;  3SAF A;  9ICU A;  4DSE A;  2JXJ A;  4USA A;  4DF4 A;  3VC8 A;  3RBE A;  5J2D A;  1X9X A;  4QWD A;  4F5N A;  4O3P A;  1T94 A;  3PO5 A;  9ICC A;  3LYS A;  2PI4 A;  4C8N A;  4A8E A;  1BNP A;  2WF8 A;  5IIN A;  2DGZ A;  4F4Y A;  1QTM A;  1KRP A;  4C80 A;  2EH9 A;  4Z6F A;  3F2B A;  1N2X A;  2D3D A;  3T5K A;  2XVT A;  5HR6 A;  3JPT A;  2V4R A;  2RDJ A;  3EW9 A;  1NI3 A;  3QX7 A;  1CUK A;  2NRZ A;  3AN1 A;  2ZTC A;  3GIK A;  5DQH A;  3U26 A;  1LKY B;  4ACO A;  8ICS A;  1RXW A;  1ZQR A;  2KVC A;  3F5E A;  4OJP A;  1T7P A;  8ICB A;  9ICJ A;  3ZDE A;  4CE6 A;  2WF7 A;  2P66 A;  1T3N A;  2LKY A;  8ICC A;  3NVV A;  1WCL A;  5HMM A;  4UB2 A;  2BR0 A;  3AQF A;  3MFI A;  5DQI A;  2IOH A;  1KW4 A;  1S0N A;  4ECR A;  4PGX A;  5KFW A;  3SAG A;  2VA8 A;  5EE1 A;  3I1Y A;  1F44 A;  1JN3 A;  1K1Q A;  2KP7 A;  5L1L A;  2VA2 A;  7ICP A;  8ICX A;  3EUB 2;  3ISB A;  1N56 A;  7ICL A;  2BKE A;  4M9H A;  5EWF A;  2EZY A;  5ALM A;  2F8L A;  2WF9 A;  3JPS A;  1J2M A;  4JWN A;  2JHD A;  1MC8 A;  3HKZ F;  3GDX A;  5CB1 A;  4QZ8 A;  1J97 A;  4M47 A;  4RQ4 A;  4Q43 A;  3M6Z A;  5BOL A;  4J9K A;  8ICT A;  4PHD A;  4ED2 A;  2ESE A;  4U6P A;  5AHX A;  4QZE A;  2F3N A;  5J2E A;  5D4B A;  2XCP A;  4DCC A;  3T79 A;  2E8M A;  4PHA A;  2KIW A;  8ICK A;  1D8Y A;  2C2D A;  1ZQE A;  5ALL A;  3RR7 A;  4GC7 A;  4YD2 A;  3WKC A;  1TAM A;  4DOC A;  3KZX A;  4KMU A;  5AM1 A;  3CW2 C;  2QB1 A;  1Z4N A;  4IC9 A;  2R18 A;  4DS5 A;  3V6H A;  3UMB A;  1FO4 A;  3WU2 U;  4FE3 A;  4M9N A;  3H4B A;  3HX0 A;  2OXO A;  4I2E A;  4F3O A;  2CXY A;  3NAS A;  2ALZ A;  1ZQZ A;  1HJP A;  1ZQS A;  4RQ7 A;  3I28 A;  1A77 A;  2BDU A;  1U47 A;  2EAM A;  1S97 A;  3BS7 A;  1X6J A;  7ICN A;  5EWG A;  5KAF U;  3UQ0 A;  2HCF A;  2C22 A;  5J29 A;  1J2N A;  4NV0 A;  4AYB F;  4M9L A;  5KFT A;  1D9F A;  4UB3 A;  3AL0 B;  3RB4 A;  1Z1B A;  7ICO A;  3QUB A;  4F2R A;  2HVH A;  3RJF A;  4MEX A;  4QW9 A;  3TI0 A;  1KLN A;  1ZD4 A;  4YG2 A;  2A19 A;  5KFZ A;  4KLO A;  2LYA A;  4NJ8 A;  2JV3 A;  3TAC B;  2FMS A;  5DBC A;  4RQ3 A;  2LYB A;  2BZF A;  3ETR A;  4NLB A;  5TZV A;  3PW0 A;  4UAS A;  4C8M A;  3GIL A;  4I2F A;  2KJ9 A;  3CNH A;  1OW5 A;  4DFM A;  2Q0Z X;  1N48 A;  4QNL A;  4UBC A;  2W8K A;  4QZC A;  2B0C A;  3E58 A;  5KT7 A;  3WK7 A;  3ORY A;  5HHI A;  4P2H A;  3LVW A;  1KEJ A;  4ED6 A;  5KFP A;  1JI7 A;  3E2E A;  1N61 A;  1ZRM A;  5KFQ A;  2DL0 A;  1FFV A;  4KLD A;  4UAW A;  3PSI A;  4AP9 A;  3AU2 A;  4B9V A;  1KQQ A;  5KG6 A;  1ZQL A;  3QU2 A;  3OSN A;  2KV2 A;  2I5H A;  1UHU A;  2K8C B;  4F50 A;  2YY6 A;  3GII A;  4KLH A;  4UB6 U;  4Q8F A;  1AQ6 A;  2ISO A;  1C20 A;  4RNN A;  3L4P A;  4B9L A;  1NKB A;  3RJH A;  3WKD A;  4NL9 A;  1L7P A;  2LI6 A;  2HHT A;  5TIS U;  3RR8 A;  1ZQG A;  3NRZ A;  2R8K A;  4P0Q A;  1A6S A;  3QNM A;  5ALS A;  3PNC A;  2W8L A;  2MUT B;  2HHW A;  4BWM A;  4NY8 A;  2CRX A;  4ECZ A;  3NTU A;  1K5O A;  1NK6 A;  4GFJ A;  2YMP A;  4RQ8 A;  5ALV A;  5JUM A;  2ZUC A;  1ZQB A; 
#chains in the Genus database with same CATH homology
 2EZX A;  2EZY A;  1CI4 A;  1QCK A;  2ODG A;  2EZZ A;  2BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...