2EZZA

Solution structure of human barrier-to-autointegration factor baf nmr, ensemble of 20 simulated annealing structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezzA00
2BZFA 2EZXA 2ODGA 2EZYA 1QCKA 2EZZA 1CI4A
chains in the Genus database with same CATH superfamily
2PKEA 4QIWC 4EYHB 4J9SA 5KG2A 3SEIA 1NK0A 2JEIA 4RQNA 4BWJA 4PGXA 1ZQFA 2VA3A 3V72A 9ICUA 8ICHA 5AKIA 4BDPA 3QX7A 2W43A 2FMPA 2FDRA 5ALUA 3N7RC 4RPYA 2KVSA 1FEZA 1Z00B 1TK0A 4DEZA 4YD1A 4XQ8A 4CGZA 4F5NA 5J2KA 4ACOA 1L8OA 2GOLA 3G6YA 1NKBA 3HP6A 4YP3A 2FLNA 4Q45A 4Q43A 4K4GA 2FMSA 1JIHA 1T7PA 3O0FA 3TADA 4GFJA 5HR6A 1QQ6A 4J9QA 1OUQA 1L3UA 4LZGA 2ZTEA 4DL4A 3QEBZ 3BQ2A 2WF9A 1SKRA 4F5QA 5DQGA 2ZIXB 7ICHA 2GO7A 4IRCA 4IS7A 2R8GA 1F0MA 1KN5A 2WAQC 5T14A 3RB6A 1Q3UA 4P2HA 3GU3A 2MUTA 1NJWA 3C28A 1BPDA 1TVAA 5J29A 4KTQA 2ISOA 3GDXA 3OHBA 2AJQA 3HX0A 2V4RA 3QU4A 4F4YA 2KHVA 2KMDA 1X6JA 5KFIA 1ZQQA 3S6JA 2XGPA 2KK0A 3D2SA 5KG0A 2XCAA 2G0AA 1ZXIA 4RQ6A 2Q0ZX 2ES6A 2BDUA 3WK5A 2K60A 3BQ0A 3GFKB 2ALZA 2YMPA 2XY6A 1CEZA 4C8MA 2WFAA 3Q8KA 5EWFA 3HT3A 5KT3A 2ZIWA 1URJA 3JPOA 3TACB 5BOMA 2ZXHA 9ICNA 4F8RA 1SZHA 1PK1A 3EYZA 1ZQIA 1S5LU 1ZQJA 1Q3VA 2HVIA 2IA6A 2V4QA 4KLGA 2RDJA 1KKXA 2M9NA 2MSNA 2WB1F 3UXPA 4PGYA 4FZMA 4C8OA 3TFSA 3MR6A 4KLHA 7ICIA 2HI0A 3NVYA 4QW8A 3SV3A 5ALRA 4DSJA 2K89A 1UA1A 4J03A 3CW2C 5KFWA 3Q8QB 2FPLA 4Y2RA 4GXIA 3HW8A 2KJ5A 2YMMA 4TUSA 1NK9A 4UQGA 5KG6A 3PX4A 9ICKA 4HYKA 1D8LA 4NV0A 2F1IA 4OD0A 3N7SC 1JUDA 4M0AA 4PHEA 2JZBA 3H4BA 3QNMA 5DG7A 3AU2A 4RQ0A 2KN7A 3AEVA 4NL9A 1T8EA 2RLTA 3D2NA 1J2MA 3ZI4A 2RRDA 2E5SA 8ICLA 5KFZA 2KP7A 4XRHA 1QCKA 2QARA 4ED8A 4IL6U 4NM2A 4YMMA 5DDMA 4CF3A 3WK4A 1IXRA 3F5AA 1SL0A 4IC9A 1S0OA 2ZIVB 2AQ4A 4NY8A 3NVWA 1L6NA 2LI6A 2NV3A 9ICWA 3FC4A 5DGAA 3SV4A 2I5HA 3SAHA 1OW5A 2KV2A 1SB3C 1SXDA 2DWQA 3RB0A 4B9MA 4O3MA 4RT3A 4QJFB 1FFVA 2BCUA 7ICMA 1OXJA 2KSOA 4GIBA 1NK5A 4UB6U 5J2BA 3LWMA 4KX3A 1NJYA 1ZRNA 1KSPA 1MQ2A 5F3XB 1DOQA 2ZUDA 2Y0SF 2ZJAA 4DL6A 3T5JA 3PMNA 4WJ3B 3ETLA 3RFAA 3WK7A 3T5HA 3MDCA 2W9CB 5A0LA 5BPCA 2W55A 2PFPA 2EANA 4M47A 5KFOA 4O3SA 2JEFA 1JMSA 4Y2QA 2LHTA 2C2RA 3ZDCA 2XVTA 1PZNA 2A3VA 3C2KA 3RAQA 5AKYA 5KG7A 1RXWA 1MC8A 4UARA 2BHNA 4I2BA 4FBTA 5E79U 1S0MA 3M6ZA 4FZLA 1B22A 1QQ7A 3FDSA 3GILA 9ICIA 5KL8B 4ECUA 4O3NA 1SV0A 4U7CA 1T94A 2EZYA 2IOFK 1TAUA 3OSNA 4OJ5A 4O3OA 2MUTB 4NL9C 1ZRMA 5J0RA 4NLGA 4I2FA 4MFCA 4EZ9A 1DGJA 1U48A 3ALRA 5EE0A 5J2FA 3RH5A 1LB2B 4GC7A 2ZTDA 2VKQA 3GIKA 3BS7A 7ICEA 4Y2JA 1UT8A 5B66U 3IG8A 5J0PA 1QQ5A 1XSNA 4UB5A 4RQ3A 1C7YA 3N28A 1Z4NA 5ALGA 2OCEA 2UVRA 4Q8FA 1B4FA 2AQ0A 3NRWA 5JTIA 3H0MB 1ZQNA 4EBDA 3CYMA 1JRPA 2AXTU 5EE1A 2WTFA 5DG9A 3M6KA 2DBYA 3F53A 5DB7A 5KT4A 4M9GA 4CF4A 2C28A 3RF9A 3SI8A 4DFMA 2JEJA 1N63A 3SQIA 2UVVA 3K4GA 3C23A 5KFQA 2KIWA 8ICCA 1RQNA 2KEYA 4E0DA 2XIDA 5L1MA 1ZQXA 1ZQRA 3WK9A 4FO6A 1SL1A 3ISCA 1WWVA 2Y0SC 1EXNA 2MU2A 4CRXA 5AKXA 5KT2A 1Z1VA 4M04A 9ICQA 2YQEA 5J0QA 4QWAA 4I2GA 2KE7A 2J6TA 1NZPA 1X40A 3IP4B 2WF8A 5AM2A 3DV9A 2BQRA 4GXJA 4I2JA 2G08A 2W11A 2ODGA 1SKSA 3L5KA 4DQSA 5HMLA 2FLLA 2PI5A 3I28A 2DKZA 1ZQ1C 3E2EA 3JPPA 1BNPA 4RU9A 4Y2TA 2PFOA 5KFCA 3SD7A 4RQ2A 1SV0C 1S10A 4DL2A 4ELVA 3QU9A 5IIOA 3H8JA 1QSSA 2C2EA 1QH9A 4ECVA 4C8KA 2A1AA 1WCLA 9ICRA 3SYZA 2R8IA 5H2FU 5J0XA 5ALJA 1IIPA 3E0FA 2EAOA 5CJ7A 4M9HA 1BPBA 2EAPA 2KSOB 1N48A 1ZQPA 1N5WA 3PNCA 1MSWD 4ECZA 4DF8A 4M9NA 4Q44A 4EBCA 4GC6A 4ED1A 4R8UB 3SR6A 2B6GA 2C2DA 4BX9C 5HMMA 2GWSA 1H38A 3R9KA 4I28A 4F92B 4R66A 4QZFA 5DLFA 4QZGA 4MF8A 1ZQAA 3NTUA 4CE6A 3D6JA 3TAPA 5F9NA 3HKZF 2YY6A 4ECXA 3GV5B 5AKZA 4B9SA 4NXZA 4P0PA 3GQCA 3KHLA 3AU6A 3JPNA 2ZG6A 2KJ8A 4TUPA 4K4IA 2K4IA 3Q8RB 1P7DA 5EE9A 4DFKA 2ZIVA 5IIIA 2H3ZA 4FZNA 4RUAA 1ZQCA 2MAXA 5D46A 7ICVA 2KICA 4B9LA 3HILA 1JXLA 2P35A 4ECSA 4I27A 1V97A 4DSIA 4M6WB 2HW3A 5AI5A 4B6JA 3OJSA 2K8AA 3C5GA 3WKAA 4J9OA 5KG5A 1TV9A 1NK4A 4NLKA 2I1QA 2KVCA 2JMGA 3OTQA 1ZQVA 2KNJA 2G5HB 2OYYA 4DLEA 5KFDA 4ICAA 3ZDBA 3ZD9A 2JV3A 2P6RA 4KLFA 3UMGA 5AKLA 4US8A 2R8HA 1RYRA 4O5EA 1JXEA 3TKAA 2ISPA 3L4PA 2DQNB 5KFLA 3T79A 2ZTCA 3IV6A 8ICMA 1BVSA 2W9CA 3OHAA 3F2BA 8ICSA 1MN8A 1A77A 2O6KA 2DL0A 4QZAA 3KTQA 1M6YA 4DF4A 1A6SA 2DPJA 2BZFA 3SZ2A 3QU7A 5DKWA 3TI0A 4PZNA 4DQIA 1HUOA 4JV1A 4J9KA 2KJ9A 5AKHA 4DQQA 5ALMA 3BDPA 4Y2VA 4DLGA 9ICJA 4FE3A 4F4XA 3QYPA 1XSLA 1B0XA 1LV5A 4XA5A 2CXYA 5KFFA 4P0QA 3PMLA 2FPMA 3RTVA 3K1RB 4ECWA 1X9SA 4KLDA 3CNHA 4TQRA 9ICCA 4F5OA 4RQ8A 1TK5A 5EWEA 4O9MA 4F91B 3OGUA 2K4EA 3AUOA 2YX8A 3M9MB 4AP9A 1BGXT 2H3IA 4B9NA 1QSLA 4DQPA 2AGPA 1RXVA 2DUYA 1ZQEA 4I2HA 2HHXA 4OJOA 2HBMA 4Y2SA 2W9BB 2HDOA 5DQIA 5L1KA 3N4MB 4QZ9A 4AYBC 2HHVA 2H3VA 5KG1A 2F76X 2KKVA 3ZD8A 1ZD4A 1PUZA 9ICFA 5EOZA 3M1YA 3C5FA 2K8CB 5JU5A 9ICHA 5KFNA 2K4HA 1FIQA 2BPGA 5J2GA 4DS4A 4UAUA 4YR2A 2Y1IA 2KZZA 1ZQOA 1X6IA 9ICLA 2E8OA 3FM9A 3HPOA 3KOOA 1XSPA 1TAMA 2E8MA 3AQEA 2LYHA 2ZIUB 4OO1J 5KFBA 1L7OA 2W9AA 4DL3A 3H4DA 3LVVA 2QB1A 2B21A 4CCHA 1UA0A 1ZJNA 9ICVA 3RJHA 4LJXA 4UB1A 2FJ6A 2AH5A 1T4GA 3WK8A 1QLNA 3NGDA 2EQYA 4DS5A 3QUBA 2I9GA 4F5PA 3V6HA 1HIWA 4XUSA 2XCPA 1L3VA 1GO3F 2H3FA 3IM1A 4UW9A 5G5HA 3KHRA 3RBEA 2JGAA 1FO4A 7ICRA 5ALEA 4ZH4A 4UAYA 9ICGA 3G6XA 1A0PA 4A8EA 1Z4OA 4EENA 2CN1A 4P0PB 3RH4A 3CRXA 4B9UA 2BCQA 2PMZF 3T5LA 1VJ5A 4Z6DA 3PO4A 3Q8SB 3TQ1A 3C29A 4IR1A 1PK3A 1NJXA 2PFNA 5AICA 3KD3A 3SAGA 3M8RA 5J0YA 5F9LA 2B0CA 4UAWA 1RYSA 2N1RA 3B0YA 1PVRA 3QU5A 4C4SA 5GTIU 2OHFA 4FS2A 2F44A 4QWDA 2F1JA 3RR7A 4ECRA 3PV8A 4IRKA 5ALPA 5CHGA 4QZBA 1NK8A 4R8UA 3UXOA 1ZQSA 7ICTA 5DB8A 2MRLA 4O5CA 2W9MA 3GIMA 4EBEA 1HUZA 4DFPA 1BPYA 5IIMA 3MGHA 3PX6A 3KZXA 1JX4A 1ZQDA 4KLQA 3H0RB 4YFKA 1SGGA 1KQQA 4PH5A 4MEXA 2HBKA 2AGOA 3I76A 1ZD2P 5ALZA 2WHEA 3K75D 1CUKA 2YTUA 3F2CA 1N61A 3D2QA 4QNLA 5DBBA 3RB4A 1RYUA 2KKPA 5CP2A 4C4RA 4I2CA 2L5YA 4RT2A 3TFRA 4X5VA 3CP8A 4ECYA 3IG5A 4OJPA 5KFEA 1VLBA 3C2LA 1KDHA 3HJEA 1KLNA 2GH1A 4QZDA 2KFNA 2WB1C 5ALHA 4MFFA 2DF4B 8ICUA 1NI3A 3DEEA 4M6WA 2XGQA 4P0QB 5J2AA 1BPXA 2WF7A 1NZBA 4PHDA 3QEAZ 1CI4A 3MR2A 5KAFU 4KLSA 5TISU 1KFTA 5AIBA 5AKEA 4PL1A 1N60A 3BS5A 1UT5A 4MF2A 1WCNA 3JPTA 7ICJA 2E8NA 2FPKA 4P4MA 2HVHA 2JRZA 1N2XA 2NO5A 2ATLA 3EWAA 7ICGA 4UB3A 5CR0A 1TK8A 5AK3A 4NWIA 1U9LA 4RNMA 2HHTA 4BGDA 2QKQA 5AKJA 1L3TA 4QZHA 5EWGA 2NRWA 2Q4TA 4CDGA 1ZQBA 2GLEA 4UB4A 5DBCA 5L1IA 2BCVA 2JXJA 2XC9A 5C0YA 1V9PA 2BCRA 2A1JB 3KFUF 1QTMA 5J2EA 2NYVA 2CRXA 1BNOA 5AHXA 2ZJ5A 1LVHA 4TQSA 4PHAA 2ASDA 5KFRA 4I2DA 1MA7A 4KLMA 4I2IA 3ICXA 4OJ6A 3ISDA 5KT6A 3OPXA 3WKBA 2NRZA 5ALIA 3EPGA 3H8SA 7ICQA 1X42A 5AI6A 4C4TA 3SENA 2IOFA 4C7ZA 1ZQHA 2F8KA 1D9FA 3V7JA 2HOIA 3F5EA 3OSPA 2F1HA 2H3QA 5KFGA 2IMWP 4F2SA 8ICWA 1D9DA 1U45A 4PJ0U 1XNSA 1ZQLA 4YXMA 3TANA 1MQ3A 1JROA 1HJPA 4RQ7A 3MDAA 8ICJA 3PW5A 1A76A 4O3QA 5AKKA 4RPXA 2W9BA 2R8KA 3VC8A 1ZYQA 4YG2A 5AK5A 3T5KA 5L1LA 4QIWF 2M0NA 3KHHA 3RJIA 4PGQA 4F50A 3PZPA 5ALXA 1SIJA 3RJJA 4F72A 1KTQA 1YZ7A 4QZ8A 5CWRA 3AMZA 4PZOA 2RP5A 5J0TA 3M9NB 2OXOA 2R8JA 2RDIA 4B9VA 5ALLA 4YQWA 1N5XA 1ZQYA 4MHVA 2R18A 5AK4A 2W8LA 1ZETA 1WWUA 5KFXA 4CNQA 4KITB 3OJUA 5J2IA 2HSZA 3QZ8A 2W3RA 3QZ7A 2VA8A 2ZIUA 2HOFA 7ICLA 3MR5A 3ZDDA 2DFLA 4RQ5A 5KFJA 5D49A 2LKYA 1NK6A 1Q8KA 2XICA 4CF5A 8ICYA 1N62A 7ICSA 9ICSA 4NJ8A 2VA2A 4RQ1A 4J9NA 4F2RA 2W3SA 2EH9A 3H8WA 3ISBA 1YZ6A 4YXJA 1J2NA 1LKYA 3C1YA 3LDAA 4ED7A 2WAQF 3L3FX 2YMQA 2LPEA 3N7PD 5KFVA 3ORYA 2W8KA 1XO0A 1NKCA 4BJQA 4PL2A 2IHNA 3H8MA 3Q8MA 3DDHA 4F4WA 2BDPA 1DXSA 1T3QA 5ALSA 2CPRA 3FAHA 1SXEA 2AU0A 1XU4A 4OCZA 3H7IA 3C1ZA 4DL7A 3PW2A 3BQTA 2HBLA 4O3RA 4KMUA 7ICKA 4Z6CA 4DSEA 4JWNA 1ECWA 1UQVA 2DGZA 1KFSA 2I6XA 2C22A 4Y2PA 2YB4A 3UQ0A 1O08A 3JPRA 4BXOA 5KL1B 4QZCA 4LVSA 5AI8A 3PR5B 5KFKA 2UVWA 7ICFA 2LYBA 4QWBA 4KX5A 1L5UA 8ICXA 5KFSA 3BS5B 4YR0A 2G07A 3RJEA 4IQWA 4IQVA 1NKEA 4I2EA 4Y2UA 2P6UA 3UM9A 4J9MA 1PVPA 2UVUA 1JN3A 4RQMA 5J0UA 1Z19A 7ICNA 3C21A 4ECQA 5DLGA 5AM5A 5KG3A 3FYHA 4Q8EA 4YMOA 9ICPA 5J0OA 2HHUA 1ZQKA 4DL5A 4M9LA 3HRDD 5KTQA 1TAQA 1X9WA 4NLCA 4C7YA 3RH6A 3ED5A 4I2AA 5GTHU 3NASA 3U26A 4YR3A 8ICQA 3J81j 2D8CA 2G06A 4KN7A 4ED6A 5IIJA 2AGQA 4C80A 5KFTA 1V85A 4BWMA 3RJKA 3V6JA 3Q8LA 1WG8A 4YN4A 4JWMA 1RPLA 3NRZA 1Z3EB 4RPZA 4ECTA 4K4HA 1XC9A 5ALTA 1UPHA 8ICBA 2LMRA 3BJYA 4R64A 4P4PA 4FS1A 4KLIA 2F2AB 3WKEA 2W7PA 4JV2A 3ETRA 4QW9A 8ICZA 2K8BB 4US9A 3B9JA 4O0IA 3Q8PB 4F3OA 5AI9A 4MFAA 3C2MA 4M2YA 1IV8A 1KEJA 5J8YA 2K4PA 4ED2A 7ICOA 5ALFA 2PI4A 3QE9Y 3VCBA 1JI7A 4KN4A 1KL9A 5KG4A 3TAQA 2BQ3A 3UMCA 4DCCA 1S0NA 5JUMA 1T3NA 4UBCA 5DB6A 1JALA 3QUQA 1DGSA 3MABA 5J0WA 2QB0B 3HKZC 3QU2A 1Z1BA 3GIIA 4PPXA 2A19A 5KFPA 1ZD3A 5AI0A 2BKEA 4KLJA 8ICFA 3BZCA 5KFAA 2Z7JA 3RB3A 3NUQA 1COOA 2ZUBA 2XY7A 2XI9A 4RUCA 2F3NA 2A1JA 2BQUA 4UB2A 5AM4A 1TKDA 4UAVA 1SZPA 3V7LA 1B43A 3QUCA 4EYIB 1ZOLA 3M8SA 4DWIA 2JHDA 2D6FC 2VJ4A 8ICKA 2J6SA 8ICRA 3PW7A 2H5XA 5D4BA 2OH2A 1NNLA 4U6PA 1X9XA 2BGWA 1C20A 8ICVA 5KFYA 4J9LA 4DSLA 2KFZA 4ZOHC 1S97A 4KLLA 8ICNA 3PVXA 1O03A 3PSFA 2ASJA 4RNOA 1ZJMA 1X9MA 5J0SA 4UB8U 4O3PA 1LKYB 1SWVA 4EEYA 2IHMA 3GIJA 5AM3A 3N97B 2JH1A 3BQ7A 3IN5A 5HNKA 3E58A 3RBDA 8ICOA 9ICOA 4KLUA 4JB3A 3PSTA 2V9WA 4F4ZA 5HR7A 3AQFA 2RQ5A 3UQ2A 5EE3A 1RQLA 3TADC 2OEHA 4DQRA 2ZUCA 4DFDA 1X2IA 2IBKA 2W03A 2WF6A 1Q46A 3SAFA 3PW4A 3KZIU 4YVZA 2WF5A 4P4OA 2HBJA 4F5RA 5J8YC 4QZIA 3F2DA 2HOQA 5DQHA 3I1YA 3RR8A 3A0BU 1BPZA 4YD2A 2HCFA 4BXOB 2QLTA 3V7KA 3H40A 2W7OA 5DB9A 1DK2A 1L7MA 3MGIA 1Y88A 3KBBA 1RZTA 1WUDA 7ICPA 4IRDA 4G9BA 4NLBA 3RRHA 4RQ4A 2ASLA 3T3FA 1DRGA 1IM4A 4QWEA 5KFHA 2EDUA 4NLZA 3SMVA 5AI4A 2LM1A 5HP4A 3AM9A 1V38A 1L8LA 3PSIA 1SWWA 4JMUA 4C8LA 4I29A 5C5JA 3KHGA 3WK6A 5HHHA 4EELA 4TURA 1X66A 4KLOA 4C0ZA 4MEYA 2LBOA 2OWOA 1RDFA 2F77X 5G5GA 3RRGA 1L7PA 4R63A 8ICEA 3GV8B 1ZQGA 3QUTA 3GV7B 2AHOB 8ICIA 5AIAA 1ZD5A 2BPCA 2FI1A 2DPIA 3IRUA 1F44A 2EZXA 3UXNA 1U47A 5CB1A 2Y9UA 5IINA 4YCXA 2E1EA 5ALOA 5B5EU 4Z6EA 3JPSA 9ICBA 1K1QA 1XWLA 5AK6A 2BR0A 9ICMA 4FBUA 4JK1A 2DKXA 2XY5A 8ICPA 4Y2XA 2W54A 5AM0A 2VIXA 4EZ6A 2VANA 2KHQA 1NOMA 4EX7A 5DG8A 1S9FA 1KBUA 2G5IB 1S0VA 1K5OA 2YMLA 4NLNA 3UMBA 1S77D 3M7DA 2PMZC 5ALWA 1WYGA 5DDYA 3PX0A 3NVZA 4TUQA 3NVVA 3JPQA 2BPFA 3PO5A 8ICAA 3THVA 1SKWA 1U49A 1Z00A 3WU2U 4GLXA 2W04A 5DGBA 3QXGA 3LWLA 2JEGA 1S8OA 3MFIA 1UCVA 3B0XA 2ZIWB 4DOBA 4IR9A 5KFUA 5AKGA 4O5KA 3WKDA 4RZRA 2G09A 1KFDA 4DSKA 3A0HU 9ICAA 4NM1A 1AROP 4IQTA 3IHQB 2NRXA 1ZQUA 3EW9A 2EAMA 1PK1B 3PY8A 1L3SA 1COKA 5ALYA 1D8YA 5L9XA 4B9TA 3PSPA 1F5SA 1N56A 2KD1A 2HHSA 3LVWA 4DSFA 5L1JA 1QSYA 1NK7A 2KZMA 1D8BA 2ZIXA 1NJZA 5KT5A 2RHFA 2JR5A 4F71A 4USAA 2KOBA 3GZFA 3RJGA 4LZDA 2XO7A 4HAIA 3WKCA 3BQ1A 4YMNA 1TFRA 2QB0A 2FE9A 5DBAA 5ALDA 2EZZA 3MGVA 4PHPA 8ICGA 9ICXA 4KLEA 3H0LB 3KKAA 5J2DA 5J2JA 5ALQA 2P66A 3K1ZA 3PW0A 4IQUA 2JZBB 2OM6A 1HEKA 2NRVA 1L7NA 5KAIU 2ESEA 2KG5A 4DOCA 3RAXA 5HHIA 2Y9TA 5KFMA 1TE2A 4QWCA 1S76D 2FLPA 3BZKA 4FFDA 4BUGA 5AM1A 4J9PA 1IG6A 1XO1A 4OJLA 1ED1A 1ZQZA 3ZDEA 4UATA 4JV0A 1SV4A 9ICTA 5FP0A 4Z6FA 2QARB 4M9JA 3UPQA 3MBYA 4ED3A 4F4KA 2KTQA 3IDWA 4UASA 1PVQA 3MFHA 4G3IA 3MR3A 1KRPA 2E1FA 4F93B 2D3DA 2ZJ8A 3MC1A 2PFQA 3RJFA 1ZQMA 3HWTA 9ICEA 2F8LA 1ZQTA 4QZEA 5IILA 3NS1A 1VDVA 3LK9A 2Y1JA 2YN4A 2KIVA 2KZ3A 3LYSA 4EX6A 2NO4A 2HMXA 1RM6C 4JUZA 4GXKA 2JH7A 4UAZA 3M9OB 1FFUA 4RNNA 5CA7A 4ED0A 5J2HA 1U4BA 1DK3A 3EPIA 1BPEA 4DFJA 4DO9A 3V6KA 2E8PA 3AN1A 3EUB2 5KT7A 5K4LA 1YT3A 2IOHA 1XS9D 2J6UA 5ALVA 4AYBF 4ELTA 5CEHA 8ICTA 5TZVA 2PXIA 4C8NA 2LM4A 5CRXA 2BCSA 4J9RA 1RG6A 5ALKA 4ELUA 2ZXIA 1AQ6A 3PR4A 1CRXA 2HHQA 2VJ5A 1UHUA 4EEKA 3AL0B 2HHWA 4Y2YA 5JRTA 2LYAA 3TARA 3G6VA 3EZ5A 5ALNA 5J2CA 1KW4A 5IIKA 1SL2A 2NRTA 1K1SA 2MA1A 5KNIA 7ICUA 2YB1A 4R65A 4DOAA 3KKAC 2E3TA 1ZQWA 3ZDAA 5BOLA 4KMOB 1J97A 3ONNA 2FMQA 4UBBA 4KLTA
chains in the Genus database with same CATH topology
2BZFA 2EZXA 2ODGA 2EZYA 1QCKA 2EZZA 1CI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZF A;  2EZX A;  2ODG A;  2EZY A;  1QCK A;  2EZZ A;  1CI4 A; 
#chains in the Genus database with same CATH topology
 2PKE A;  4QIW C;  4EYH B;  4J9S A;  5KG2 A;  3SEI A;  1NK0 A;  2JEI A;  4RQN A;  4BWJ A;  4PGX A;  1ZQF A;  2VA3 A;  3V72 A;  9ICU A;  8ICH A;  5AKI A;  4BDP A;  3QX7 A;  2W43 A;  2FMP A;  2FDR A;  5ALU A;  3N7R C;  4RPY A;  2KVS A;  1FEZ A;  1Z00 B;  1TK0 A;  4DEZ A;  4YD1 A;  4XQ8 A;  4CGZ A;  4F5N A;  5J2K A;  4ACO A;  1L8O A;  2GOL A;  3G6Y A;  1NKB A;  3HP6 A;  4YP3 A;  2FLN A;  4Q45 A;  4Q43 A;  4K4G A;  2FMS A;  1JIH A;  1T7P A;  3O0F A;  3TAD A;  4GFJ A;  5HR6 A;  1QQ6 A;  4J9Q A;  1OUQ A;  1L3U A;  4LZG A;  2ZTE A;  4DL4 A;  3QEB Z;  3BQ2 A;  2WF9 A;  1SKR A;  4F5Q A;  5DQG A;  2ZIX B;  7ICH A;  2GO7 A;  4IRC A;  4IS7 A;  2R8G A;  1F0M A;  1KN5 A;  2WAQ C;  5T14 A;  3RB6 A;  1Q3U A;  4P2H A;  3GU3 A;  2MUT A;  1NJW A;  3C28 A;  1BPD A;  1TVA A;  5J29 A;  4KTQ A;  2ISO A;  3GDX A;  3OHB A;  2AJQ A;  3HX0 A;  2V4R A;  3QU4 A;  4F4Y A;  2KHV A;  2KMD A;  1X6J A;  5KFI A;  1ZQQ A;  3S6J A;  2XGP A;  2KK0 A;  3D2S A;  5KG0 A;  2XCA A;  2G0A A;  1ZXI A;  4RQ6 A;  2Q0Z X;  2ES6 A;  2BDU A;  3WK5 A;  2K60 A;  3BQ0 A;  3GFK B;  2ALZ A;  2YMP A;  2XY6 A;  1CEZ A;  4C8M A;  2WFA A;  3Q8K A;  5EWF A;  3HT3 A;  5KT3 A;  2ZIW A;  1URJ A;  3JPO A;  3TAC B;  5BOM A;  2ZXH A;  9ICN A;  4F8R A;  1SZH A;  1PK1 A;  3EYZ A;  1ZQI A;  1S5L U;  1ZQJ A;  1Q3V A;  2HVI A;  2IA6 A;  2V4Q A;  4KLG A;  2RDJ A;  1KKX A;  2M9N A;  2MSN A;  2WB1 F;  3UXP A;  4PGY A;  4FZM A;  4C8O A;  3TFS A;  3MR6 A;  4KLH A;  7ICI A;  2HI0 A;  3NVY A;  4QW8 A;  3SV3 A;  5ALR A;  4DSJ A;  2K89 A;  1UA1 A;  4J03 A;  3CW2 C;  5KFW A;  3Q8Q B;  2FPL A;  4Y2R A;  4GXI A;  3HW8 A;  2KJ5 A;  2YMM A;  4TUS A;  1NK9 A;  4UQG A;  5KG6 A;  3PX4 A;  9ICK A;  4HYK A;  1D8L A;  4NV0 A;  2F1I A;  4OD0 A;  3N7S C;  1JUD A;  4M0A A;  4PHE A;  2JZB A;  3H4B A;  3QNM A;  5DG7 A;  3AU2 A;  4RQ0 A;  2KN7 A;  3AEV A;  4NL9 A;  1T8E A;  2RLT A;  3D2N A;  1J2M A;  3ZI4 A;  2RRD A;  2E5S A;  8ICL A;  5KFZ A;  2KP7 A;  4XRH A;  1QCK A;  2QAR A;  4ED8 A;  4IL6 U;  4NM2 A;  4YMM A;  5DDM A;  4CF3 A;  3WK4 A;  1IXR A;  3F5A A;  1SL0 A;  4IC9 A;  1S0O A;  2ZIV B;  2AQ4 A;  4NY8 A;  3NVW A;  1L6N A;  2LI6 A;  2NV3 A;  9ICW A;  3FC4 A;  5DGA A;  3SV4 A;  2I5H A;  3SAH A;  1OW5 A;  2KV2 A;  1SB3 C;  1SXD A;  2DWQ A;  3RB0 A;  4B9M A;  4O3M A;  4RT3 A;  4QJF B;  1FFV A;  2BCU A;  7ICM A;  1OXJ A;  2KSO A;  4GIB A;  1NK5 A;  4UB6 U;  5J2B A;  3LWM A;  4KX3 A;  1NJY A;  1ZRN A;  1KSP A;  1MQ2 A;  5F3X B;  1DOQ A;  2ZUD A;  2Y0S F;  2ZJA A;  4DL6 A;  3T5J A;  3PMN A;  4WJ3 B;  3ETL A;  3RFA A;  3WK7 A;  3T5H A;  3MDC A;  2W9C B;  5A0L A;  5BPC A;  2W55 A;  2PFP A;  2EAN A;  4M47 A;  5KFO A;  4O3S A;  2JEF A;  1JMS A;  4Y2Q A;  2LHT A;  2C2R A;  3ZDC A;  2XVT A;  1PZN A;  2A3V A;  3C2K A;  3RAQ A;  5AKY A;  5KG7 A;  1RXW A;  1MC8 A;  4UAR A;  2BHN A;  4I2B A;  4FBT A;  5E79 U;  1S0M A;  3M6Z A;  4FZL A;  1B22 A;  1QQ7 A;  3FDS A;  3GIL A;  9ICI A;  5KL8 B;  4ECU A;  4O3N A;  1SV0 A;  4U7C A;  1T94 A;  2EZY A;  2IOF K;  1TAU A;  3OSN A;  4OJ5 A;  4O3O A;  2MUT B;  4NL9 C;  1ZRM A;  5J0R A;  4NLG A;  4I2F A;  4MFC A;  4EZ9 A;  1DGJ A;  1U48 A;  3ALR A;  5EE0 A;  5J2F A;  3RH5 A;  1LB2 B;  4GC7 A;  2ZTD A;  2VKQ A;  3GIK A;  3BS7 A;  7ICE A;  4Y2J A;  1UT8 A;  5B66 U;  3IG8 A;  5J0P A;  1QQ5 A;  1XSN A;  4UB5 A;  4RQ3 A;  1C7Y A;  3N28 A;  1Z4N A;  5ALG A;  2OCE A;  2UVR A;  4Q8F A;  1B4F A;  2AQ0 A;  3NRW A;  5JTI A;  3H0M B;  1ZQN A;  4EBD A;  3CYM A;  1JRP A;  2AXT U;  5EE1 A;  2WTF A;  5DG9 A;  3M6K A;  2DBY A;  3F53 A;  5DB7 A;  5KT4 A;  4M9G A;  4CF4 A;  2C28 A;  3RF9 A;  3SI8 A;  4DFM A;  2JEJ A;  1N63 A;  3SQI A;  2UVV A;  3K4G A;  3C23 A;  5KFQ A;  2KIW A;  8ICC A;  1RQN A;  2KEY A;  4E0D A;  2XID A;  5L1M A;  1ZQX A;  1ZQR A;  3WK9 A;  4FO6 A;  1SL1 A;  3ISC A;  1WWV A;  2Y0S C;  1EXN A;  2MU2 A;  4CRX A;  5AKX A;  5KT2 A;  1Z1V A;  4M04 A;  9ICQ A;  2YQE A;  5J0Q A;  4QWA A;  4I2G A;  2KE7 A;  2J6T A;  1NZP A;  1X40 A;  3IP4 B;  2WF8 A;  5AM2 A;  3DV9 A;  2BQR A;  4GXJ A;  4I2J A;  2G08 A;  2W11 A;  2ODG A;  1SKS A;  3L5K A;  4DQS A;  5HML A;  2FLL A;  2PI5 A;  3I28 A;  2DKZ A;  1ZQ1 C;  3E2E A;  3JPP A;  1BNP A;  4RU9 A;  4Y2T A;  2PFO A;  5KFC A;  3SD7 A;  4RQ2 A;  1SV0 C;  1S10 A;  4DL2 A;  4ELV A;  3QU9 A;  5IIO A;  3H8J A;  1QSS A;  2C2E A;  1QH9 A;  4ECV A;  4C8K A;  2A1A A;  1WCL A;  9ICR A;  3SYZ A;  2R8I A;  5H2F U;  5J0X A;  5ALJ A;  1IIP A;  3E0F A;  2EAO A;  5CJ7 A;  4M9H A;  1BPB A;  2EAP A;  2KSO B;  1N48 A;  1ZQP A;  1N5W A;  3PNC A;  1MSW D;  4ECZ A;  4DF8 A;  4M9N A;  4Q44 A;  4EBC A;  4GC6 A;  4ED1 A;  4R8U B;  3SR6 A;  2B6G A;  2C2D A;  4BX9 C;  5HMM A;  2GWS A;  1H38 A;  3R9K A;  4I28 A;  4F92 B;  4R66 A;  4QZF A;  5DLF A;  4QZG A;  4MF8 A;  1ZQA A;  3NTU A;  4CE6 A;  3D6J A;  3TAP A;  5F9N A;  3HKZ F;  2YY6 A;  4ECX A;  3GV5 B;  5AKZ A;  4B9S A;  4NXZ A;  4P0P A;  3GQC A;  3KHL A;  3AU6 A;  3JPN A;  2ZG6 A;  2KJ8 A;  4TUP A;  4K4I A;  2K4I A;  3Q8R B;  1P7D A;  5EE9 A;  4DFK A;  2ZIV A;  5III A;  2H3Z A;  4FZN A;  4RUA A;  1ZQC A;  2MAX A;  5D46 A;  7ICV A;  2KIC A;  4B9L A;  3HIL A;  1JXL A;  2P35 A;  4ECS A;  4I27 A;  1V97 A;  4DSI A;  4M6W B;  2HW3 A;  5AI5 A;  4B6J A;  3OJS A;  2K8A A;  3C5G A;  3WKA A;  4J9O A;  5KG5 A;  1TV9 A;  1NK4 A;  4NLK A;  2I1Q A;  2KVC A;  2JMG A;  3OTQ A;  1ZQV A;  2KNJ A;  2G5H B;  2OYY A;  4DLE A;  5KFD A;  4ICA A;  3ZDB A;  3ZD9 A;  2JV3 A;  2P6R A;  4KLF A;  3UMG A;  5AKL A;  4US8 A;  2R8H A;  1RYR A;  4O5E A;  1JXE A;  3TKA A;  2ISP A;  3L4P A;  2DQN B;  5KFL A;  3T79 A;  2ZTC A;  3IV6 A;  8ICM A;  1BVS A;  2W9C A;  3OHA A;  3F2B A;  8ICS A;  1MN8 A;  1A77 A;  2O6K A;  2DL0 A;  4QZA A;  3KTQ A;  1M6Y A;  4DF4 A;  1A6S A;  2DPJ A;  2BZF A;  3SZ2 A;  3QU7 A;  5DKW A;  3TI0 A;  4PZN A;  4DQI A;  1HUO A;  4JV1 A;  4J9K A;  2KJ9 A;  5AKH A;  4DQQ A;  5ALM A;  3BDP A;  4Y2V A;  4DLG A;  9ICJ A;  4FE3 A;  4F4X A;  3QYP A;  1XSL A;  1B0X A;  1LV5 A;  4XA5 A;  2CXY A;  5KFF A;  4P0Q A;  3PML A;  2FPM A;  3RTV A;  3K1R B;  4ECW A;  1X9S A;  4KLD A;  3CNH A;  4TQR A;  9ICC A;  4F5O A;  4RQ8 A;  1TK5 A;  5EWE A;  4O9M A;  4F91 B;  3OGU A;  2K4E A;  3AUO A;  2YX8 A;  3M9M B;  4AP9 A;  1BGX T;  2H3I A;  4B9N A;  1QSL A;  4DQP A;  2AGP A;  1RXV A;  2DUY A;  1ZQE A;  4I2H A;  2HHX A;  4OJO A;  2HBM A;  4Y2S A;  2W9B B;  2HDO A;  5DQI A;  5L1K A;  3N4M B;  4QZ9 A;  4AYB C;  2HHV A;  2H3V A;  5KG1 A;  2F76 X;  2KKV A;  3ZD8 A;  1ZD4 A;  1PUZ A;  9ICF A;  5EOZ A;  3M1Y A;  3C5F A;  2K8C B;  5JU5 A;  9ICH A;  5KFN A;  2K4H A;  1FIQ A;  2BPG A;  5J2G A;  4DS4 A;  4UAU A;  4YR2 A;  2Y1I A;  2KZZ A;  1ZQO A;  1X6I A;  9ICL A;  2E8O A;  3FM9 A;  3HPO A;  3KOO A;  1XSP A;  1TAM A;  2E8M A;  3AQE A;  2LYH A;  2ZIU B;  4OO1 J;  5KFB A;  1L7O A;  2W9A A;  4DL3 A;  3H4D A;  3LVV A;  2QB1 A;  2B21 A;  4CCH A;  1UA0 A;  1ZJN A;  9ICV A;  3RJH A;  4LJX A;  4UB1 A;  2FJ6 A;  2AH5 A;  1T4G A;  3WK8 A;  1QLN A;  3NGD A;  2EQY A;  4DS5 A;  3QUB A;  2I9G A;  4F5P A;  3V6H A;  1HIW A;  4XUS A;  2XCP A;  1L3V A;  1GO3 F;  2H3F A;  3IM1 A;  4UW9 A;  5G5H A;  3KHR A;  3RBE A;  2JGA A;  1FO4 A;  7ICR A;  5ALE A;  4ZH4 A;  4UAY A;  9ICG A;  3G6X A;  1A0P A;  4A8E A;  1Z4O A;  4EEN A;  2CN1 A;  4P0P B;  3RH4 A;  3CRX A;  4B9U A;  2BCQ A;  2PMZ F;  3T5L A;  1VJ5 A;  4Z6D A;  3PO4 A;  3Q8S B;  3TQ1 A;  3C29 A;  4IR1 A;  1PK3 A;  1NJX A;  2PFN A;  5AIC A;  3KD3 A;  3SAG A;  3M8R A;  5J0Y A;  5F9L A;  2B0C A;  4UAW A;  1RYS A;  2N1R A;  3B0Y A;  1PVR A;  3QU5 A;  4C4S A;  5GTI U;  2OHF A;  4FS2 A;  2F44 A;  4QWD A;  2F1J A;  3RR7 A;  4ECR A;  3PV8 A;  4IRK A;  5ALP A;  5CHG A;  4QZB A;  1NK8 A;  4R8U A;  3UXO A;  1ZQS A;  7ICT A;  5DB8 A;  2MRL A;  4O5C A;  2W9M A;  3GIM A;  4EBE A;  1HUZ A;  4DFP A;  1BPY A;  5IIM A;  3MGH A;  3PX6 A;  3KZX A;  1JX4 A;  1ZQD A;  4KLQ A;  3H0R B;  4YFK A;  1SGG A;  1KQQ A;  4PH5 A;  4MEX A;  2HBK A;  2AGO A;  3I76 A;  1ZD2 P;  5ALZ A;  2WHE A;  3K75 D;  1CUK A;  2YTU A;  3F2C A;  1N61 A;  3D2Q A;  4QNL A;  5DBB A;  3RB4 A;  1RYU A;  2KKP A;  5CP2 A;  4C4R A;  4I2C A;  2L5Y A;  4RT2 A;  3TFR A;  4X5V A;  3CP8 A;  4ECY A;  3IG5 A;  4OJP A;  5KFE A;  1VLB A;  3C2L A;  1KDH A;  3HJE A;  1KLN A;  2GH1 A;  4QZD A;  2KFN A;  2WB1 C;  5ALH A;  4MFF A;  2DF4 B;  8ICU A;  1NI3 A;  3DEE A;  4M6W A;  2XGQ A;  4P0Q B;  5J2A A;  1BPX A;  2WF7 A;  1NZB A;  4PHD A;  3QEA Z;  1CI4 A;  3MR2 A;  5KAF U;  4KLS A;  5TIS U;  1KFT A;  5AIB A;  5AKE A;  4PL1 A;  1N60 A;  3BS5 A;  1UT5 A;  4MF2 A;  1WCN A;  3JPT A;  7ICJ A;  2E8N A;  2FPK A;  4P4M A;  2HVH A;  2JRZ A;  1N2X A;  2NO5 A;  2ATL A;  3EWA A;  7ICG A;  4UB3 A;  5CR0 A;  1TK8 A;  5AK3 A;  4NWI A;  1U9L A;  4RNM A;  2HHT A;  4BGD A;  2QKQ A;  5AKJ A;  1L3T A;  4QZH A;  5EWG A;  2NRW A;  2Q4T A;  4CDG A;  1ZQB A;  2GLE A;  4UB4 A;  5DBC A;  5L1I A;  2BCV A;  2JXJ A;  2XC9 A;  5C0Y A;  1V9P A;  2BCR A;  2A1J B;  3KFU F;  1QTM A;  5J2E A;  2NYV A;  2CRX A;  1BNO A;  5AHX A;  2ZJ5 A;  1LVH A;  4TQS A;  4PHA A;  2ASD A;  5KFR A;  4I2D A;  1MA7 A;  4KLM A;  4I2I A;  3ICX A;  4OJ6 A;  3ISD A;  5KT6 A;  3OPX A;  3WKB A;  2NRZ A;  5ALI A;  3EPG A;  3H8S A;  7ICQ A;  1X42 A;  5AI6 A;  4C4T A;  3SEN A;  2IOF A;  4C7Z A;  1ZQH A;  2F8K A;  1D9F A;  3V7J A;  2HOI A;  3F5E A;  3OSP A;  2F1H A;  2H3Q A;  5KFG A;  2IMW P;  4F2S A;  8ICW A;  1D9D A;  1U45 A;  4PJ0 U;  1XNS A;  1ZQL A;  4YXM A;  3TAN A;  1MQ3 A;  1JRO A;  1HJP A;  4RQ7 A;  3MDA A;  8ICJ A;  3PW5 A;  1A76 A;  4O3Q A;  5AKK A;  4RPX A;  2W9B A;  2R8K A;  3VC8 A;  1ZYQ A;  4YG2 A;  5AK5 A;  3T5K A;  5L1L A;  4QIW F;  2M0N A;  3KHH A;  3RJI A;  4PGQ A;  4F50 A;  3PZP A;  5ALX A;  1SIJ A;  3RJJ A;  4F72 A;  1KTQ A;  1YZ7 A;  4QZ8 A;  5CWR A;  3AMZ A;  4PZO A;  2RP5 A;  5J0T A;  3M9N B;  2OXO A;  2R8J A;  2RDI A;  4B9V A;  5ALL A;  4YQW A;  1N5X A;  1ZQY A;  4MHV A;  2R18 A;  5AK4 A;  2W8L A;  1ZET A;  1WWU A;  5KFX A;  4CNQ A;  4KIT B;  3OJU A;  5J2I A;  2HSZ A;  3QZ8 A;  2W3R A;  3QZ7 A;  2VA8 A;  2ZIU A;  2HOF A;  7ICL A;  3MR5 A;  3ZDD A;  2DFL A;  4RQ5 A;  5KFJ A;  5D49 A;  2LKY A;  1NK6 A;  1Q8K A;  2XIC A;  4CF5 A;  8ICY A;  1N62 A;  7ICS A;  9ICS A;  4NJ8 A;  2VA2 A;  4RQ1 A;  4J9N A;  4F2R A;  2W3S A;  2EH9 A;  3H8W A;  3ISB A;  1YZ6 A;  4YXJ A;  1J2N A;  1LKY A;  3C1Y A;  3LDA A;  4ED7 A;  2WAQ F;  3L3F X;  2YMQ A;  2LPE A;  3N7P D;  5KFV A;  3ORY A;  2W8K A;  1XO0 A;  1NKC A;  4BJQ A;  4PL2 A;  2IHN A;  3H8M A;  3Q8M A;  3DDH A;  4F4W A;  2BDP A;  1DXS A;  1T3Q A;  5ALS A;  2CPR A;  3FAH A;  1SXE A;  2AU0 A;  1XU4 A;  4OCZ A;  3H7I A;  3C1Z A;  4DL7 A;  3PW2 A;  3BQT A;  2HBL A;  4O3R A;  4KMU A;  7ICK A;  4Z6C A;  4DSE A;  4JWN A;  1ECW A;  1UQV A;  2DGZ A;  1KFS A;  2I6X A;  2C22 A;  4Y2P A;  2YB4 A;  3UQ0 A;  1O08 A;  3JPR A;  4BXO A;  5KL1 B;  4QZC A;  4LVS A;  5AI8 A;  3PR5 B;  5KFK A;  2UVW A;  7ICF A;  2LYB A;  4QWB A;  4KX5 A;  1L5U A;  8ICX A;  5KFS A;  3BS5 B;  4YR0 A;  2G07 A;  3RJE A;  4IQW A;  4IQV A;  1NKE A;  4I2E A;  4Y2U A;  2P6U A;  3UM9 A;  4J9M A;  1PVP A;  2UVU A;  1JN3 A;  4RQM A;  5J0U A;  1Z19 A;  7ICN A;  3C21 A;  4ECQ A;  5DLG A;  5AM5 A;  5KG3 A;  3FYH A;  4Q8E A;  4YMO A;  9ICP A;  5J0O A;  2HHU A;  1ZQK A;  4DL5 A;  4M9L A;  3HRD D;  5KTQ A;  1TAQ A;  1X9W A;  4NLC A;  4C7Y A;  3RH6 A;  3ED5 A;  4I2A A;  5GTH U;  3NAS A;  3U26 A;  4YR3 A;  8ICQ A;  3J81 j;  2D8C A;  2G06 A;  4KN7 A;  4ED6 A;  5IIJ A;  2AGQ A;  4C80 A;  5KFT A;  1V85 A;  4BWM A;  3RJK A;  3V6J A;  3Q8L A;  1WG8 A;  4YN4 A;  4JWM A;  1RPL A;  3NRZ A;  1Z3E B;  4RPZ A;  4ECT A;  4K4H A;  1XC9 A;  5ALT A;  1UPH A;  8ICB A;  2LMR A;  3BJY A;  4R64 A;  4P4P A;  4FS1 A;  4KLI A;  2F2A B;  3WKE A;  2W7P A;  4JV2 A;  3ETR A;  4QW9 A;  8ICZ A;  2K8B B;  4US9 A;  3B9J A;  4O0I A;  3Q8P B;  4F3O A;  5AI9 A;  4MFA A;  3C2M A;  4M2Y A;  1IV8 A;  1KEJ A;  5J8Y A;  2K4P A;  4ED2 A;  7ICO A;  5ALF A;  2PI4 A;  3QE9 Y;  3VCB A;  1JI7 A;  4KN4 A;  1KL9 A;  5KG4 A;  3TAQ A;  2BQ3 A;  3UMC A;  4DCC A;  1S0N A;  5JUM A;  1T3N A;  4UBC A;  5DB6 A;  1JAL A;  3QUQ A;  1DGS A;  3MAB A;  5J0W A;  2QB0 B;  3HKZ C;  3QU2 A;  1Z1B A;  3GII A;  4PPX A;  2A19 A;  5KFP A;  1ZD3 A;  5AI0 A;  2BKE A;  4KLJ A;  8ICF A;  3BZC A;  5KFA A;  2Z7J A;  3RB3 A;  3NUQ A;  1COO A;  2ZUB A;  2XY7 A;  2XI9 A;  4RUC A;  2F3N A;  2A1J A;  2BQU A;  4UB2 A;  5AM4 A;  1TKD A;  4UAV A;  1SZP A;  3V7L A;  1B43 A;  3QUC A;  4EYI B;  1ZOL A;  3M8S A;  4DWI A;  2JHD A;  2D6F C;  2VJ4 A;  8ICK A;  2J6S A;  8ICR A;  3PW7 A;  2H5X A;  5D4B A;  2OH2 A;  1NNL A;  4U6P A;  1X9X A;  2BGW A;  1C20 A;  8ICV A;  5KFY A;  4J9L A;  4DSL A;  2KFZ A;  4ZOH C;  1S97 A;  4KLL A;  8ICN A;  3PVX A;  1O03 A;  3PSF A;  2ASJ A;  4RNO A;  1ZJM A;  1X9M A;  5J0S A;  4UB8 U;  4O3P A;  1LKY B;  1SWV A;  4EEY A;  2IHM A;  3GIJ A;  5AM3 A;  3N97 B;  2JH1 A;  3BQ7 A;  3IN5 A;  5HNK A;  3E58 A;  3RBD A;  8ICO A;  9ICO A;  4KLU A;  4JB3 A;  3PST A;  2V9W A;  4F4Z A;  5HR7 A;  3AQF A;  2RQ5 A;  3UQ2 A;  5EE3 A;  1RQL A;  3TAD C;  2OEH A;  4DQR A;  2ZUC A;  4DFD A;  1X2I A;  2IBK A;  2W03 A;  2WF6 A;  1Q46 A;  3SAF A;  3PW4 A;  3KZI U;  4YVZ A;  2WF5 A;  4P4O A;  2HBJ A;  4F5R A;  5J8Y C;  4QZI A;  3F2D A;  2HOQ A;  5DQH A;  3I1Y A;  3RR8 A;  3A0B U;  1BPZ A;  4YD2 A;  2HCF A;  4BXO B;  2QLT A;  3V7K A;  3H40 A;  2W7O A;  5DB9 A;  1DK2 A;  1L7M A;  3MGI A;  1Y88 A;  3KBB A;  1RZT A;  1WUD A;  7ICP A;  4IRD A;  4G9B A;  4NLB A;  3RRH A;  4RQ4 A;  2ASL A;  3T3F A;  1DRG A;  1IM4 A;  4QWE A;  5KFH A;  2EDU A;  4NLZ A;  3SMV A;  5AI4 A;  2LM1 A;  5HP4 A;  3AM9 A;  1V38 A;  1L8L A;  3PSI A;  1SWW A;  4JMU A;  4C8L A;  4I29 A;  5C5J A;  3KHG A;  3WK6 A;  5HHH A;  4EEL A;  4TUR A;  1X66 A;  4KLO A;  4C0Z A;  4MEY A;  2LBO A;  2OWO A;  1RDF A;  2F77 X;  5G5G A;  3RRG A;  1L7P A;  4R63 A;  8ICE A;  3GV8 B;  1ZQG A;  3QUT A;  3GV7 B;  2AHO B;  8ICI A;  5AIA A;  1ZD5 A;  2BPC A;  2FI1 A;  2DPI A;  3IRU A;  1F44 A;  2EZX A;  3UXN A;  1U47 A;  5CB1 A;  2Y9U A;  5IIN A;  4YCX A;  2E1E A;  5ALO A;  5B5E U;  4Z6E A;  3JPS A;  9ICB A;  1K1Q A;  1XWL A;  5AK6 A;  2BR0 A;  9ICM A;  4FBU A;  4JK1 A;  2DKX A;  2XY5 A;  8ICP A;  4Y2X A;  2W54 A;  5AM0 A;  2VIX A;  4EZ6 A;  2VAN A;  2KHQ A;  1NOM A;  4EX7 A;  5DG8 A;  1S9F A;  1KBU A;  2G5I B;  1S0V A;  1K5O A;  2YML A;  4NLN A;  3UMB A;  1S77 D;  3M7D A;  2PMZ C;  5ALW A;  1WYG A;  5DDY A;  3PX0 A;  3NVZ A;  4TUQ A;  3NVV A;  3JPQ A;  2BPF A;  3PO5 A;  8ICA A;  3THV A;  1SKW A;  1U49 A;  1Z00 A;  3WU2 U;  4GLX A;  2W04 A;  5DGB A;  3QXG A;  3LWL A;  2JEG A;  1S8O A;  3MFI A;  1UCV A;  3B0X A;  2ZIW B;  4DOB A;  4IR9 A;  5KFU A;  5AKG A;  4O5K A;  3WKD A;  4RZR A;  2G09 A;  1KFD A;  4DSK A;  3A0H U;  9ICA A;  4NM1 A;  1ARO P;  4IQT A;  3IHQ B;  2NRX A;  1ZQU A;  3EW9 A;  2EAM A;  1PK1 B;  3PY8 A;  1L3S A;  1COK A;  5ALY A;  1D8Y A;  5L9X A;  4B9T A;  3PSP A;  1F5S A;  1N56 A;  2KD1 A;  2HHS A;  3LVW A;  4DSF A;  5L1J A;  1QSY A;  1NK7 A;  2KZM A;  1D8B A;  2ZIX A;  1NJZ A;  5KT5 A;  2RHF A;  2JR5 A;  4F71 A;  4USA A;  2KOB A;  3GZF A;  3RJG A;  4LZD A;  2XO7 A;  4HAI A;  3WKC A;  3BQ1 A;  4YMN A;  1TFR A;  2QB0 A;  2FE9 A;  5DBA A;  5ALD A;  2EZZ A;  3MGV A;  4PHP A;  8ICG A;  9ICX A;  4KLE A;  3H0L B;  3KKA A;  5J2D A;  5J2J A;  5ALQ A;  2P66 A;  3K1Z A;  3PW0 A;  4IQU A;  2JZB B;  2OM6 A;  1HEK A;  2NRV A;  1L7N A;  5KAI U;  2ESE A;  2KG5 A;  4DOC A;  3RAX A;  5HHI A;  2Y9T A;  5KFM A;  1TE2 A;  4QWC A;  1S76 D;  2FLP A;  3BZK A;  4FFD A;  4BUG A;  5AM1 A;  4J9P A;  1IG6 A;  1XO1 A;  4OJL A;  1ED1 A;  1ZQZ A;  3ZDE A;  4UAT A;  4JV0 A;  1SV4 A;  9ICT A;  5FP0 A;  4Z6F A;  2QAR B;  4M9J A;  3UPQ A;  3MBY A;  4ED3 A;  4F4K A;  2KTQ A;  3IDW A;  4UAS A;  1PVQ A;  3MFH A;  4G3I A;  3MR3 A;  1KRP A;  2E1F A;  4F93 B;  2D3D A;  2ZJ8 A;  3MC1 A;  2PFQ A;  3RJF A;  1ZQM A;  3HWT A;  9ICE A;  2F8L A;  1ZQT A;  4QZE A;  5IIL A;  3NS1 A;  1VDV A;  3LK9 A;  2Y1J A;  2YN4 A;  2KIV A;  2KZ3 A;  3LYS A;  4EX6 A;  2NO4 A;  2HMX A;  1RM6 C;  4JUZ A;  4GXK A;  2JH7 A;  4UAZ A;  3M9O B;  1FFU A;  4RNN A;  5CA7 A;  4ED0 A;  5J2H A;  1U4B A;  1DK3 A;  3EPI A;  1BPE A;  4DFJ A;  4DO9 A;  3V6K A;  2E8P A;  3AN1 A;  3EUB 2;  5KT7 A;  5K4L A;  1YT3 A;  2IOH A;  1XS9 D;  2J6U A;  5ALV A;  4AYB F;  4ELT A;  5CEH A;  8ICT A;  5TZV A;  2PXI A;  4C8N A;  2LM4 A;  5CRX A;  2BCS A;  4J9R A;  1RG6 A;  5ALK A;  4ELU A;  2ZXI A;  1AQ6 A;  3PR4 A;  1CRX A;  2HHQ A;  2VJ5 A;  1UHU A;  4EEK A;  3AL0 B;  2HHW A;  4Y2Y A;  5JRT A;  2LYA A;  3TAR A;  3G6V A;  3EZ5 A;  5ALN A;  5J2C A;  1KW4 A;  5IIK A;  1SL2 A;  2NRT A;  1K1S A;  2MA1 A;  5KNI A;  7ICU A;  2YB1 A;  4R65 A;  4DOA A;  3KKA C;  2E3T A;  1ZQW A;  3ZDA A;  5BOL A;  4KMO B;  1J97 A;  3ONN A;  2FMQ A;  4UBB A;  4KLT A; 
#chains in the Genus database with same CATH homology
 2BZF A;  2EZX A;  2ODG A;  2EZY A;  1QCK A;  2EZZ A;  1CI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...