2JR5A

Solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MYTAEQKARIKWACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNLSKVRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of UPF0350 protein VC_2471.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
molecule keywords UPF0350 protein VC_2471
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2jr5A00
1PUZA 1X6IA 2JR5A 1X6JA 2LM4A
chains in the Genus database with same CATH superfamily
2HHSA 2G09A 2HSZA 1NNLA 4P2HA 1IIPA 4MF2A 5EE1A 4QZBA 1IM4A 3NS1A 4C8KA 4IR1A 1ZQHA 5D4BA 1Z1BA 3N7RC 4QW8A 1U48A 4MFCA 2KFNA 4EEYA 1DGSA 2K8AA 4DLGA 3M6ZA 2EAPA 4I2HA 4KLUA 3HILA 5AM0A 4UB8U 2C28A 1ZQFA 3RR7A 3PVXA 2KVSA 4J9PA 3GIMA 8ICJA 5ALSA 3PV8A 7ICQA 1X2IA 4ECZA 3BQ7A 5TISU 1ZD5A 4ED1A 1N2XA 4Y2TA 3KHHA 4DQSA 1ZQYA 4XA5A 3IG8A 2RP5A 1S8OA 5KFTA 4B9MA 1RXVA 2QARA 1B0XA 4PH5A 4PGXA 4ED8A 2NYVA 4EENA 1U4BA 4MEYA 2IHNA 3SR6A 1NJWA 2Z7JA 2XIDA 5CP2A 3M9MB 4Y2UA 5ALZA 3M9OB 5KFJA 3UQ0A 4QZGA 5KFIA 5AI9A 2FLLA 4PJ0U 5KT7A 4RPXA 2GH1A 3ETRA 1NJXA 1V97A 2OHFA 4GLXA 2MRLA 3M9NB 3C2LA 4PGQA 4O5EA 3B0YA 4ED2A 4GXKA 3PSPA 4I2DA 1U49A 2FMSA 2I9GA 4GFJA 1S97A 5AKHA 5KFRA 1IV8A 4R65A 4YD1A 2LM1A 1S10A 8ICTA 1A77A 2Y1IA 4JWNA 4O3SA 2OEHA 3F5AA 2F1JA 5HHHA 7ICMA 1BPEA 4JK1A 3MGIA 7ICLA 2K4EA 4P0QB 3FYHA 1ZJMA 4R63A 3R9KA 4F50A 1LVHA 4KLFA 2ZJAA 2BQUA 1T4GA 2V9WA 4YCXA 5AKEA 3GIIA 3BQ2A 3SV3A 2WB1F 1KTQA 5C0YA 8ICWA 5DB6A 4QJFB 1ZXIA 5IIOA 1V9PA 2GO7A 5J2GA 4UBCA 1L3VA 2YX8A 9ICIA 4NLZA 3NVWA 2OM6A 3PW2A 3PO4A 3QE9Y 3MGHA 1NK7A 4UB4A 2HI0A 3QU2A 2ZJ5A 2KICA 2YN4A 3NRWA 4EYHB 5KFDA 2QB1A 2WF8A 3RB4A 1COKA 5KT4A 1P7DA 4ECRA 5J0OA 2EAOA 3ALRA 5AM4A 3C2KA 4B6JA 1RQLA 1URJA 4DQPA 4FBTA 3RB6A 2W11A 1L3SA 5DLFA 2FJ6A 3B0XA 1QQ6A 1KL9A 4KLSA 1Z1VA 1RYRA 3KFUF 2KSOB 4C8OA 1X42A 1L3UA 2EANA 1HUOA 5ALYA 4UB3A 2XY6A 3H4DA 4M9LA 5HMLA 3QZ7A 5AK4A 4PPXA 2CN1A 1Q8KA 1ZQJA 3I76A 3V7KA 2Y1JA 4B9UA 2KZMA 4TUPA 3Q8MA 4K4HA 4JV0A 3EZ5A 3RH6A 4XQ8A 1X9XA 1N48A 2H3QA 3TI0A 4KLGA 2XI9A 3KTQA 4P4OA 2BCQA 2W3RA 4KLLA 2ZIVB 4RQNA 2F76X 3RJGA 5DBAA 1SXEA 2XGPA 4IQVA 2WF6A 3OHAA 2EH9A 1NZBA 3WK6A 1DK3A 2LKYA 2JEGA 4O3MA 7ICNA 4TQRA 2K89A 3WKEA 3OTQA 3C28A 5IINA 5KT3A 3G6VA 1T8EA 2N1RA 2FPMA 1JUDA 2UVWA 3NASA 2G06A 1N5WA 4UW9A 2FPLA 7ICRA 9ICOA 1O03A 1Q3VA 2ZIUA 5K4LA 4C7YA 3NVVA 5KFNA 4JV1A 4DL6A 3OSNA 5L9XA 4QWDA 4PHDA 4PGYA 1ZD2P 2FDRA 2Y9UA 4DL2A 1C7YA 3AQFA 4I2CA 4DOAA 3IG5A 3E0FA 1L7MA 3UPQA 8ICRA 5KFKA 4E0DA 3NVZA 1TAQA 3OPXA 4UATA 4GC7A 1VDVA 4G3IA 2F1IA 1ZQEA 5KL8B 8ICHA 4QZ8A 1ZQUA 2M0NA 1FFUA 5DBBA 3EUB2 3WK8A 2DUYA 2HVIA 1HIWA 4KX3A 3PSTA 3H0LB 1S9FA 3RB0A 2I1QA 1ZD3A 2Y9TA 4RUAA 5DGBA 4ECYA 1GO3F 4NLNA 5EWGA 1JRPA 2KSOA 4OD0A 3SI8A 3BS5A 2W9CA 2NO4A 4P4MA 1XSPA 1Q46A 3Q8QB 2ZTEA 9ICCA 4KLDA 2HBJA 3WKBA 3I1YA 4AYBC 2LHTA 5ALQA 5HNKA 5IIIA 1A76A 2LPEA 4J9SA 3ZDDA 4R8UB 4F3OA 3ZDBA 4YR0A 1PVPA 4I2FA 4DO9A 1O08A 1B4FA 3OJSA 4MEXA 2RDJA 2DFLA 2JEFA 3H0RB 1AROP 4UARA 1KFSA 4QWCA 3Q8KA 1AQ6A 4Q8FA 3QUTA 1ED1A 5EE3A 3GIJA 3Q8PB 1IG6A 3O0FA 4C80A 2PI5A 2J6SA 2KOBA 1YZ7A 2KHQA 3RAQA 2LYBA 2JMGA 2DL0A 5KG6A 5H2FU 5AM1A 3SZ2A 4XRHA 3KZIU 4NLBA 1X6IA 5KFCA 4MFAA 2OH2A 4KTQA 1Z4NA 5KG0A 4JUZA 2C2RA 1WYGA 5AM3A 2UVUA 4FFDA 3CNHA 3SV4A 3SYZA 5GTHU 2XVTA 4IRCA 2Y0SF 1TK8A 3BQTA 5HHIA 4NL9C 5J2KA 3NRZA 4RQ5A 2OWOA 2W7PA 3OSPA 1KLNA 5KFLA 2F1HA 3BZKA 9ICFA 1DGJA 5KFYA 3BQ0A 3V7JA 2P6RA 1UT5A 4B9TA 5BPCA 4F5QA 7ICTA 7ICGA 4KMUA 4P4PA 5DDMA 2YMPA 5ALNA 2MUTA 1FIQA 3QZ8A 3H8MA 3QU4A 3ZI4A 4QW9A 2HVHA 5D46A 2ZTCA 1QQ7A 3QU5A 2D6FC 4EZ6A 5F9LA 3RFAA 1L8LA 4GC6A 3LDAA 5DBCA 5J0UA 5HMMA 1T94A 1CEZA 4ZH4A 4QWBA 3N7PD 3C23A 1BGXT 3RB3A 4IRKA 3AU2A 2JZBA 3MBYA 5ALXA 2H3VA 3FAHA 1QLNA 3RJFA 7ICPA 2H3ZA 5EE9A 5B66U 5C5JA 3C29A 3OHBA 8ICEA 3PZPA 1NOMA 1L8OA 5ALDA 1KDHA 4RQ6A 4PZOA 4QNLA 2JH7A 1NK6A 4RQ1A 4DOCA 3RBEA 4YP3A 2W04A 3LWMA 2B6GA 3GDXA 9ICTA 4FBUA 3GIKA 4DEZA 4DCCA 4IR9A 5ALTA 4QIWC 2A3VA 4RQ2A 3PX0A 2V4RA 3CP8A 1ZQTA 2HBMA 3F2CA 5L1JA 2B0CA 2ZIWB 4IL6U 5AKGA 3TACB 2PI4A 4Q45A 2MU2A 2VA8A 4PL1A 2BCRA 4M9JA 2O6KA 3GU3A 3JPRA 4B9LA 3SAFA 2FMQA 2XY5A 1ZETA 4DL4A 3PY8A 3UMBA 1BPXA 2HMXA 4NM1A 5G5GA 4AP9A 2AQ4A 2V4QA 1SL0A 1XSLA 4BUGA 4IS7A 4FS1A 3ZDCA 5ALWA 5J2EA 3BDPA 4EEKA 5J2DA 4EX6A 5AKYA 1QQ5A 1SB3C 2JH1A 2IBKA 1WG8A 3IP4B 4RQ8A 4RT2A 2ZUDA 4BX9C 5ALGA 4FZLA 4C8LA 1YT3A 4QIWF 3S6JA 3WKAA 4BXOA 4DL7A 4YG2A 4DQRA 5ALVA 1PZNA 2WF9A 2DGZA 3SAGA 5AICA 4RQ7A 1JX4A 4PZNA 5KFEA 2E3TA 4WJ3B 4DOBA 3LK9A 1SKSA 1KEJA 3GV5B 5AHXA 4ECVA 1S0MA 2KIVA 4EBCA 3G6YA 4M0AA 1SV0A 3WK5A 1LKYB 8ICFA 2A1JB 4NV0A 4KN4A 5CJ7A 4BGDA 3PW7A 5DQIA 2FLNA 4O3PA 1K5OA 4Z6FA 2PFOA 2J6TA 3M6KA 4MHVA 1ZOLA 5J0TA 3CYMA 2W54A 4DSFA 1WCNA 5EWEA 4KLJA 2PFNA 2ZIVA 1ZQ1C 5GTIU 3F5EA 3RRHA 3ICXA 1L7PA 5ALKA 4ICAA 4R64A 4UAWA 1D8YA 5AKJA 9ICSA 1TVAA 3RH5A 3PX4A 2YY6A 4FZMA 3ISDA 8ICLA 2W9MA 1ZQNA 1N56A 4UB2A 1LKYA 2LMRA 1ZQDA 9ICRA 2CXYA 3PMNA 2R8HA 3T5KA 4DQQA 3MC1A 3RBDA 4DS4A 1KBUA 2DKXA 3L4PA 5ALEA 3BS7A 9ICQA 1A6SA 1UQVA 3TFRA 2KZZA 3V6JA 4OJ6A 2LI6A 2F8KA 2JHDA 2W8LA 3NUQA 2OCEA 4UAYA 2J6UA 4IRDA 2EAMA 4Q43A 2W9BA 1XC9A 4CF5A 1X40A 5ALOA 4Y2YA 1FEZA 4QZDA 1F0MA 4US9A 3GILA 5ALFA 3T5LA 4OJLA 3K1ZA 3EWAA 2LBOA 4CCHA 3A0BU 3N4MB 2HCFA 2I6XA 4UAZA 1XS9D 3MDAA 5KFXA 1J2MA 3L5KA 4YR3A 1UCVA 3GFKB 2W7OA 2KKVA 4PHAA 1XU4A 4UB5A 1YZ6A 1Z00B 2P6UA 1ZQBA 4C4RA 2ZIUB 3PW4A 1WUDA 1Z4OA 3H8SA 2DKZA 3F2DA 4F4KA 3ZD9A 1N63A 5EE0A 3WKCA 3ORYA 2AXTU 2EQYA 3JPSA 4K4GA 5ALPA 5D49A 1N61A 2GLEA 4Z6EA 3AM9A 4F91B 4M2YA 3HRDD 2CPRA 2ZXIA 2BZFA 1Q3UA 4KITB 4KLHA 5ALHA 5J0SA 4RT3A 4A8EA 1CRXA 5KFFA 1RYUA 2WTFA 4R66A 2XICA 1ZQOA 2PKEA 4JWMA 2NRWA 2HHUA 3PW5A 2G5HB 4US8A 4CNQA 4F2SA 4DSKA 2WF7A 1K1QA 1S0OA 4O3NA 1ZQQA 4OJOA 3ISBA 4TURA 2BQRA 4ECTA 2IHMA 3CW2C 4UB1A 3BS5B 2FPKA 4YR2A 3G6XA 5CWRA 1X9SA 1S76D 4GXIA 1PK3A 5KFSA 2XCPA 4NJ8A 1NK0A 4M6WA 1N5XA 5L1LA 4ELUA 2Q0ZX 1SV4A 5KT5A 4UQGA 3HJEA 3T79A 7ICUA 2JRZA 2YMMA 3QUQA 1L7NA 5KL1B 3JPPA 3C21A 3AUOA 2KZ3A 4GIBA 2HOIA 4F5PA 3PMLA 1ZQIA 2HHWA 3IHQB 4FO6A 3DDHA 3EPIA 3HW8A 4MFFA 2MAXA 3MR3A 1RZTA 3DEEA 4CF3A 4P0PA 8ICKA 4RQ0A 2ASLA 3C1YA 2XO7A 2ESEA 2BCSA 4DLEA 1JI7A 2JEIA 4NLGA 4ECUA 9ICUA 2E1EA 3CRXA 4ECSA 5DG9A 4HYKA 4ELVA 4LJXA 4RU9A 5HR7A 4Y2PA 3M1YA 4F4YA 4K4IA 3NGDA 4KX5A 2H5XA 3RR8A 1S77D 2YTUA 3F53A 4NWIA 1NKCA 2A1JA 4KLEA 1CI4A 3OJUA 3THVA 1BPDA 1K1SA 3MDCA 1LV5A 1WWUA 3TARA 2ES6A 3WK7A 3MFIA 3H4BA 3PX6A 3JPNA 4DL3A 2G0AA 1NK4A 5DQHA 4ECWA 4U6PA 1SWWA 2DQNB 1JXLA 5J0RA 3QYPA 2NRTA 4Y2SA 5IILA 2OYYA 1ZD4A 4J9RA 8ICUA 3UMGA 4YD2A 1MN8A 1NK5A 2YB1A 5AIAA 4M04A 4UAUA 5J2HA 2XC9A 3GZFA 4DFMA 8ICMA 5CR0A 1TAUA 3MR2A 3FC4A 4EELA 4Y2RA 4DFDA 4PHEA 2KJ9A 3RJHA 3L3FX 2JGAA 4KLOA 1ZQVA 3MABA 5AIBA 5J29A 5A0LA 5TZVA 1ZQXA 4Q8EA 2EZZA 4J9MA 3AL0B 3B9JA 2YMQA 4QZCA 2OXOA 5J2FA 3QEAZ 4YXMA 2AU0A 3SD7A 4QWAA 1B22A 1NJYA 3KZXA 3RJKA 4UASA 5J0PA 4RNMA 3A0HU 1M6YA 3UM9A 3KOOA 1QH9A 3GV7B 2AGQA 2G07A 4C4TA 5CRXA 4J03A 5ALIA 2BQ3A 2FE9A 3KBBA 1L7OA 4QZAA 3GV8B 2R18A 2EDUA 2JEJA 2VKQA 4I2IA 2MUTB 1KFTA 2GWSA 1S5LU 3M8SA 1BNPA 3I28A 4BXOB 4F5NA 2KN7A 5ALJA 2HBLA 1SXDA 1U45A 2VA3A 2H3FA 1TE2A 1KQQA 2W9BB 2BDUA 3FM9A 1ZQPA 1RYSA 5AK6A 4O0IA 5DDYA 2G5IB 4J9OA 2K4IA 1ECWA 1D8BA 2F77X 4I28A 1IXRA 5J2IA 3TADA 1QTMA 1JMSA 2WAQF 4Z6CA 3T5JA 5KG1A 2MA1A 3EYZA 3HPOA 1NZPA 5EOZA 1RG6A 5KFVA 5DB8A 3Q8SB 2NRXA 5J0XA 3SENA 2ASDA 1KSPA 5J0QA 4J9LA 1ZQZA 4P0QA 3IN5A 3TQ1A 2YMLA 2VA2A 4CF4A 5J2JA 2EZXA 2RRDA 3D2QA 1UT8A 3RH4A 4JB3A 3ONNA 1L3TA 5IIMA 4EBEA 3H0MB 4Y2VA 5KAIU 3WK4A 3PR5B 2HHVA 1ZQSA 1JALA 1PVQA 1RQNA 2ALZA 1BPBA 1WCLA 3AMZA 2VJ4A 1XO0A 5DB7A 2KE7A 1SL1A 2FLPA 2HHXA 4FS2A 5HP4A 5KG7A 5KFGA 2ATLA 2R8KA 4KN7A 4PHPA 9ICXA 2BCUA 4NLKA 1MQ2A 9ICKA 1SV0C 2NRVA 4DSEA 2WF5A 1TK5A 5J2AA 2KV2A 3V7LA 3KKAC 4C8NA 1XSNA 2BPCA 1ZQGA 1ZQRA 2ZG6A 5DKWA 3DV9A 3UXNA 1C20A 3WU2U 1RXWA 2W3SA 4RQMA 2KD1A 4ELTA 5JTIA 3HWTA 2KVCA 3RJJA 4QZ9A 1Z3EB 4F93B 4B9NA 2ZXHA 2ISPA 9ICJA 3IRUA 4IQTA 1QSLA 4R8UA 4F2RA 5F9NA 5J8YA 3AU6A 1ZQAA 2WHEA 2JXJA 2W03A 2K8BB 2KEYA 4RNOA 1N60A 3VC8A 7ICJA 2JZBB 2D8CA 2NO5A 8ICNA 3F2BA 4YMNA 4Z6DA 4C4SA 3LVWA 1VLBA 3IDWA 4F4WA 3K4GA 4KLQA 1KRPA 4M9GA 2QB0A 3MR5A 1SKRA 3KHLA 1D8LA 4TUQA 1ZQCA 1Z19A 2RLTA 4EZ9A 4ED3A 3JPTA 9ICNA 1T3NA 8ICYA 3AN1A 9ICLA 4EBDA 2ODGA 4PL2A 4X5VA 2W9CB 3ZDAA 3KHGA 3QEBZ 2PFPA 1KKXA 3QX7A 4NXZA 3SQIA 2ZJ8A 3KHRA 3RJIA 3PO5A 2A19A 5L1IA 4RQ3A 1F5SA 1T7PA 4M6WB 2BR0A 2ZUCA 1PVRA 1S0NA 4Y2QA 4CGZA 2QB0B 4UAVA 2YQEA 5KG5A 1SZPA 2IA6A 1HUZA 5KFMA 1V85A 3LYSA 2ZIXB 1MQ3A 4YMMA 2KNJA 9ICPA 5AI5A 2R8GA 2DWQA 3Q8RB 2M9NA 3NTUA 4C8MA 8ICVA 4J9QA 8ICOA 5AI6A 1XWLA 5BOMA 3QUCA 3IM1A 3TFSA 1DXSA 2AQ0A 3ISCA 4BDPA 4B9VA 4DFJA 1NKBA 1MSWD 2R8JA 4QZIA 2BGWA 4J9KA 2BKEA 5E79U 2KMDA 3SEIA 4F4XA 1JIHA 3HT3A 3H40A 4YMOA 4O5CA 4DFPA 4NL9A 5JU5A 4O3RA 1J97A 5KFAA 2E1FA 1ZRNA 1TKDA 4IC9A 2PXIA 1QSYA 9ICHA 4M9NA 2ZUBA 5CEHA 3TAQA 5KNIA 2F8LA 2K8CB 1UA0A 5EWFA 3UXOA 1T3QA 3RTVA 4ED0A 4DSLA 1SKWA 5AM2A 4UBBA 5AK3A 5DQGA 4NM2A 3LWLA 2C22A 4YXJA 3C2MA 4IQWA 3QNMA 2UVVA 4O3QA 3K75D 2BDPA 3WK9A 7ICFA 4DS5A 4YFKA 4HAIA 4DL5A 2AH5A 4M9HA 5KG4A 3J81j 1PK1B 5J8YC 4Q44A 3OGUA 1L5UA 1DRGA 4RPYA 1ZQMA 4U7CA 2HOFA 2NRZA 4F92B 1BPZA 4DF4A 4KLIA 2FI1A 4I2JA 3HX0A 5KFBA 4DF8A 5AKIA 4RNNA 3U26A 1JN3A 3LVVA 5AI8A 2H3IA 1OXJA 1UPHA 2AGOA 9ICWA 5G5HA 3C5GA 3PNCA 3V6KA 5DLGA 2KJ8A 2VANA 4ACOA 1ZRMA 4F71A 4ED6A 1JROA 2YB4A 2G08A 5AKXA 5J0YA 1B43A 4XUSA 2IMWP 2K60A 2ISOA 2DPIA 2KTQA 1DK2A 3PR4A 2E5SA 1SIJA 3QU7A 1VJ5A 5KAFU 2VIXA 7ICOA 5J2CA 4IQUA 2HBKA 1Z00A 3D2NA 3AEVA 5B5EU 1QSSA 2HOQA 4NLCA 3TADC 2C2DA 5F3XB 4FZNA 1H38A 3HKZC 2KK0A 2ZIWA 1TK0A 2EZYA 1NJZA 5AI4A 5L1KA 2KP7A 1RM6C 1NI3A 3ETLA 3H8WA 2L5YA 2BHNA 1BPYA 4FE3A 4YQWA 5CHGA 4ED7A 3V6HA 5AKZA 2D3DA 4C7ZA 4NY8A 3Q8LA 2I5HA 2Q4TA 2HHTA 7ICHA 2HHQA 2PMZC 9ICVA 4TQSA 3JPOA 4ECQA 2QARB 4EYIB 2B21A 3ED5A 3C1ZA 2VJ5A 5J2BA 2RDIA 2XCAA 4CDGA 2W55A 4LZDA 4I27A 5AM5A 9ICEA 3T3FA 4OJPA 1HEKA 2KIWA 4OO1J 5J0WA 3QU9A 4B9SA 2DF4B 1PUZA 3EPGA 2KHVA 4RQ4A 4JMUA 3PSIA 3MR6A 3RJEA 8ICQA 3RF9A 5KT2A 2AGPA 5DGAA 3GQCA 3FDSA 3PSFA 8ICIA 2WFAA 1ZQKA 2XY7A 4DQIA 4GXJA 1X9MA 2KKPA 5JUMA 5KFHA 3N7SC 1S0VA 4BWJA 2BCVA 4Y2XA 4YN4A 5KTQA 4LVSA 1XO1A 8ICAA 1OW5A 1FO4A 1D9FA 8ICCA 3N97B 4O5KA 1BNOA 2IOHA 2KFZA 4UB6U 1X6JA 2E8NA 4RZRA 4QZHA 3D2SA 3K1RB 3HP6A 3H8JA 3ZDEA 3RRGA 4O9MA 2PMZF 2A1AA 3D6JA 9ICGA 2CRXA 1X9WA 2P35A 4F4ZA 3UQ2A 1U9LA 1F44A 2AHOB 3PW0A 2GOLA 5JRTA 4DSIA 4O3OA 2P66A 4J9NA 4CE6A 2RQ5A 9ICAA 1SZHA 4ZOHC 5KFQA 2QLTA 2DPJA 1KFDA 3BZCA 1MA7A 5DB9A 4P0PB 1ZYQA 1TAMA 4KMOB 5AKLA 5BOLA 7ICVA 3QXGA 1Y88A 2KJ5A 3E2EA 1SL2A 4I2EA 1MC8A 5KG2A 7ICIA 1NK9A 1UA1A 4OCZA 2AJQA 1KW4A 4I29A 1WWVA 4I2BA 1SGGA 2E8OA 1XNSA 5KFWA 5KG3A 4MF8A 4Y2JA 3UXPA 3UMCA 3ZD8A 3BJYA 8ICGA 1RPLA 2LM4A 1D9DA 9ICMA 3AQEA 2HDOA 4I2AA 2ASJA 2IOFK 4I2GA 1U47A 3NVYA 4F5RA 1EXNA 2IOFA 5KFPA 2KG5A 1TFRA 4BWMA 2NV3A 3IV6A 2PFQA 4LZGA 8ICZA 4YVZA 1KN5A 3MGVA 3SAHA 2E8MA 3TAPA 5ALRA 4JV2A 3SMVA 1L6NA 1J2NA 2WAQC 3V72A 1CUKA 8ICXA 3TANA 3M8RA 4G9BA 4DWIA 5T14A 5KFOA 4TUSA 2BPGA 5HR6A 2RHFA 4KLMA 2QKQA 4CRXA 3BQ1A 1ZJNA 2Y0SC 4AYBF 4USAA 4QZFA 5CB1A 1DOQA 4C0ZA 1SWVA 1COOA 4QZEA 3KKAA 2W43A 5FP0A 2XGQA 3KD3A 2W9AA 3QUBA 1NKEA 1ZQWA 3MFHA 5DG7A 5ALLA 2ZTDA 5AI0A 5KFZA 1PK1A 2DBYA 9ICBA 4RUCA 2MSNA 1JXEA 2WB1C 2K4PA 2FMPA 2R8IA 2JV3A 1NK8A 5IIJA 2F3NA 1N62A 4EX7A 1ZQLA 5IIKA 3RAXA 1V38A 5AK5A 5DG8A 3E58A 2F44A 3VCBA 2E8PA 3TKAA 2JR5A 4ECXA 2ZIXA 3JPQA 2C2EA 1BVSA 1HJPA 3H7IA 1FFVA 2HW3A 5ALMA 3WKDA 4M47A 4F5OA 3HKZF 3C5FA 8ICBA 1QCKA 2LYHA 5ALUA 4RPZA 7ICKA 5KFUA 3EW9A 2UVRA 4DFKA 2F2AB 1A0PA 2W8KA 5CA7A 4F8RA 7ICSA 4KLTA 1OUQA 4DSJA 4BJQA 2LYAA 1TV9A 4F72A 1X66A 1UHUA 2K4HA 2BPFA 3M7DA 8ICSA 5KT6A 5AKKA 4OJ5A 1LB2B 3N28A 8ICPA 4QWEA 5L1MA 7ICEA 1RDFA 3T5HA
chains in the Genus database with same CATH topology
1PUZA 1X6IA 2JR5A 1X6JA 2LM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUZ A;  1X6I A;  2JR5 A;  1X6J A;  2LM4 A; 
#chains in the Genus database with same CATH topology
 2HHS A;  2G09 A;  2HSZ A;  1NNL A;  4P2H A;  1IIP A;  4MF2 A;  5EE1 A;  4QZB A;  1IM4 A;  3NS1 A;  4C8K A;  4IR1 A;  1ZQH A;  5D4B A;  1Z1B A;  3N7R C;  4QW8 A;  1U48 A;  4MFC A;  2KFN A;  4EEY A;  1DGS A;  2K8A A;  4DLG A;  3M6Z A;  2EAP A;  4I2H A;  4KLU A;  3HIL A;  5AM0 A;  4UB8 U;  2C28 A;  1ZQF A;  3RR7 A;  3PVX A;  2KVS A;  4J9P A;  3GIM A;  8ICJ A;  5ALS A;  3PV8 A;  7ICQ A;  1X2I A;  4ECZ A;  3BQ7 A;  5TIS U;  1ZD5 A;  4ED1 A;  1N2X A;  4Y2T A;  3KHH A;  4DQS A;  1ZQY A;  4XA5 A;  3IG8 A;  2RP5 A;  1S8O A;  5KFT A;  4B9M A;  1RXV A;  2QAR A;  1B0X A;  4PH5 A;  4PGX A;  4ED8 A;  2NYV A;  4EEN A;  1U4B A;  4MEY A;  2IHN A;  3SR6 A;  1NJW A;  2Z7J A;  2XID A;  5CP2 A;  3M9M B;  4Y2U A;  5ALZ A;  3M9O B;  5KFJ A;  3UQ0 A;  4QZG A;  5KFI A;  5AI9 A;  2FLL A;  4PJ0 U;  5KT7 A;  4RPX A;  2GH1 A;  3ETR A;  1NJX A;  1V97 A;  2OHF A;  4GLX A;  2MRL A;  3M9N B;  3C2L A;  4PGQ A;  4O5E A;  3B0Y A;  4ED2 A;  4GXK A;  3PSP A;  4I2D A;  1U49 A;  2FMS A;  2I9G A;  4GFJ A;  1S97 A;  5AKH A;  5KFR A;  1IV8 A;  4R65 A;  4YD1 A;  2LM1 A;  1S10 A;  8ICT A;  1A77 A;  2Y1I A;  4JWN A;  4O3S A;  2OEH A;  3F5A A;  2F1J A;  5HHH A;  7ICM A;  1BPE A;  4JK1 A;  3MGI A;  7ICL A;  2K4E A;  4P0Q B;  3FYH A;  1ZJM A;  4R63 A;  3R9K A;  4F50 A;  1LVH A;  4KLF A;  2ZJA A;  2BQU A;  1T4G A;  2V9W A;  4YCX A;  5AKE A;  3GII A;  3BQ2 A;  3SV3 A;  2WB1 F;  1KTQ A;  5C0Y A;  8ICW A;  5DB6 A;  4QJF B;  1ZXI A;  5IIO A;  1V9P A;  2GO7 A;  5J2G A;  4UBC A;  1L3V A;  2YX8 A;  9ICI A;  4NLZ A;  3NVW A;  2OM6 A;  3PW2 A;  3PO4 A;  3QE9 Y;  3MGH A;  1NK7 A;  4UB4 A;  2HI0 A;  3QU2 A;  2ZJ5 A;  2KIC A;  2YN4 A;  3NRW A;  4EYH B;  5KFD A;  2QB1 A;  2WF8 A;  3RB4 A;  1COK A;  5KT4 A;  1P7D A;  4ECR A;  5J0O A;  2EAO A;  3ALR A;  5AM4 A;  3C2K A;  4B6J A;  1RQL A;  1URJ A;  4DQP A;  4FBT A;  3RB6 A;  2W11 A;  1L3S A;  5DLF A;  2FJ6 A;  3B0X A;  1QQ6 A;  1KL9 A;  4KLS A;  1Z1V A;  1RYR A;  3KFU F;  2KSO B;  4C8O A;  1X42 A;  1L3U A;  2EAN A;  1HUO A;  5ALY A;  4UB3 A;  2XY6 A;  3H4D A;  4M9L A;  5HML A;  3QZ7 A;  5AK4 A;  4PPX A;  2CN1 A;  1Q8K A;  1ZQJ A;  3I76 A;  3V7K A;  2Y1J A;  4B9U A;  2KZM A;  4TUP A;  3Q8M A;  4K4H A;  4JV0 A;  3EZ5 A;  3RH6 A;  4XQ8 A;  1X9X A;  1N48 A;  2H3Q A;  3TI0 A;  4KLG A;  2XI9 A;  3KTQ A;  4P4O A;  2BCQ A;  2W3R A;  4KLL A;  2ZIV B;  4RQN A;  2F76 X;  3RJG A;  5DBA A;  1SXE A;  2XGP A;  4IQV A;  2WF6 A;  3OHA A;  2EH9 A;  1NZB A;  3WK6 A;  1DK3 A;  2LKY A;  2JEG A;  4O3M A;  7ICN A;  4TQR A;  2K89 A;  3WKE A;  3OTQ A;  3C28 A;  5IIN A;  5KT3 A;  3G6V A;  1T8E A;  2N1R A;  2FPM A;  1JUD A;  2UVW A;  3NAS A;  2G06 A;  1N5W A;  4UW9 A;  2FPL A;  7ICR A;  9ICO A;  1O03 A;  1Q3V A;  2ZIU A;  5K4L A;  4C7Y A;  3NVV A;  5KFN A;  4JV1 A;  4DL6 A;  3OSN A;  5L9X A;  4QWD A;  4PHD A;  4PGY A;  1ZD2 P;  2FDR A;  2Y9U A;  4DL2 A;  1C7Y A;  3AQF A;  4I2C A;  4DOA A;  3IG5 A;  3E0F A;  1L7M A;  3UPQ A;  8ICR A;  5KFK A;  4E0D A;  3NVZ A;  1TAQ A;  3OPX A;  4UAT A;  4GC7 A;  1VDV A;  4G3I A;  2F1I A;  1ZQE A;  5KL8 B;  8ICH A;  4QZ8 A;  1ZQU A;  2M0N A;  1FFU A;  5DBB A;  3EUB 2;  3WK8 A;  2DUY A;  2HVI A;  1HIW A;  4KX3 A;  3PST A;  3H0L B;  1S9F A;  3RB0 A;  2I1Q A;  1ZD3 A;  2Y9T A;  4RUA A;  5DGB A;  4ECY A;  1GO3 F;  4NLN A;  5EWG A;  1JRP A;  2KSO A;  4OD0 A;  3SI8 A;  3BS5 A;  2W9C A;  2NO4 A;  4P4M A;  1XSP A;  1Q46 A;  3Q8Q B;  2ZTE A;  9ICC A;  4KLD A;  2HBJ A;  3WKB A;  3I1Y A;  4AYB C;  2LHT A;  5ALQ A;  5HNK A;  5III A;  1A76 A;  2LPE A;  4J9S A;  3ZDD A;  4R8U B;  4F3O A;  3ZDB A;  4YR0 A;  1PVP A;  4I2F A;  4DO9 A;  1O08 A;  1B4F A;  3OJS A;  4MEX A;  2RDJ A;  2DFL A;  2JEF A;  3H0R B;  1ARO P;  4UAR A;  1KFS A;  4QWC A;  3Q8K A;  1AQ6 A;  4Q8F A;  3QUT A;  1ED1 A;  5EE3 A;  3GIJ A;  3Q8P B;  1IG6 A;  3O0F A;  4C80 A;  2PI5 A;  2J6S A;  2KOB A;  1YZ7 A;  2KHQ A;  3RAQ A;  2LYB A;  2JMG A;  2DL0 A;  5KG6 A;  5H2F U;  5AM1 A;  3SZ2 A;  4XRH A;  3KZI U;  4NLB A;  1X6I A;  5KFC A;  4MFA A;  2OH2 A;  4KTQ A;  1Z4N A;  5KG0 A;  4JUZ A;  2C2R A;  1WYG A;  5AM3 A;  2UVU A;  4FFD A;  3CNH A;  3SV4 A;  3SYZ A;  5GTH U;  2XVT A;  4IRC A;  2Y0S F;  1TK8 A;  3BQT A;  5HHI A;  4NL9 C;  5J2K A;  3NRZ A;  4RQ5 A;  2OWO A;  2W7P A;  3OSP A;  1KLN A;  5KFL A;  2F1H A;  3BZK A;  9ICF A;  1DGJ A;  5KFY A;  3BQ0 A;  3V7J A;  2P6R A;  1UT5 A;  4B9T A;  5BPC A;  4F5Q A;  7ICT A;  7ICG A;  4KMU A;  4P4P A;  5DDM A;  2YMP A;  5ALN A;  2MUT A;  1FIQ A;  3QZ8 A;  3H8M A;  3QU4 A;  3ZI4 A;  4QW9 A;  2HVH A;  5D46 A;  2ZTC A;  1QQ7 A;  3QU5 A;  2D6F C;  4EZ6 A;  5F9L A;  3RFA A;  1L8L A;  4GC6 A;  3LDA A;  5DBC A;  5J0U A;  5HMM A;  1T94 A;  1CEZ A;  4ZH4 A;  4QWB A;  3N7P D;  3C23 A;  1BGX T;  3RB3 A;  4IRK A;  3AU2 A;  2JZB A;  3MBY A;  5ALX A;  2H3V A;  3FAH A;  1QLN A;  3RJF A;  7ICP A;  2H3Z A;  5EE9 A;  5B66 U;  5C5J A;  3C29 A;  3OHB A;  8ICE A;  3PZP A;  1NOM A;  1L8O A;  5ALD A;  1KDH A;  4RQ6 A;  4PZO A;  4QNL A;  2JH7 A;  1NK6 A;  4RQ1 A;  4DOC A;  3RBE A;  4YP3 A;  2W04 A;  3LWM A;  2B6G A;  3GDX A;  9ICT A;  4FBU A;  3GIK A;  4DEZ A;  4DCC A;  4IR9 A;  5ALT A;  4QIW C;  2A3V A;  4RQ2 A;  3PX0 A;  2V4R A;  3CP8 A;  1ZQT A;  2HBM A;  3F2C A;  5L1J A;  2B0C A;  2ZIW B;  4IL6 U;  5AKG A;  3TAC B;  2PI4 A;  4Q45 A;  2MU2 A;  2VA8 A;  4PL1 A;  2BCR A;  4M9J A;  2O6K A;  3GU3 A;  3JPR A;  4B9L A;  3SAF A;  2FMQ A;  2XY5 A;  1ZET A;  4DL4 A;  3PY8 A;  3UMB A;  1BPX A;  2HMX A;  4NM1 A;  5G5G A;  4AP9 A;  2AQ4 A;  2V4Q A;  1SL0 A;  1XSL A;  4BUG A;  4IS7 A;  4FS1 A;  3ZDC A;  5ALW A;  5J2E A;  3BDP A;  4EEK A;  5J2D A;  4EX6 A;  5AKY A;  1QQ5 A;  1SB3 C;  2JH1 A;  2IBK A;  1WG8 A;  3IP4 B;  4RQ8 A;  4RT2 A;  2ZUD A;  4BX9 C;  5ALG A;  4FZL A;  4C8L A;  1YT3 A;  4QIW F;  3S6J A;  3WKA A;  4BXO A;  4DL7 A;  4YG2 A;  4DQR A;  5ALV A;  1PZN A;  2WF9 A;  2DGZ A;  3SAG A;  5AIC A;  4RQ7 A;  1JX4 A;  4PZN A;  5KFE A;  2E3T A;  4WJ3 B;  4DOB A;  3LK9 A;  1SKS A;  1KEJ A;  3GV5 B;  5AHX A;  4ECV A;  1S0M A;  2KIV A;  4EBC A;  3G6Y A;  4M0A A;  1SV0 A;  3WK5 A;  1LKY B;  8ICF A;  2A1J B;  4NV0 A;  4KN4 A;  5CJ7 A;  4BGD A;  3PW7 A;  5DQI A;  2FLN A;  4O3P A;  1K5O A;  4Z6F A;  2PFO A;  2J6T A;  3M6K A;  4MHV A;  1ZOL A;  5J0T A;  3CYM A;  2W54 A;  4DSF A;  1WCN A;  5EWE A;  4KLJ A;  2PFN A;  2ZIV A;  1ZQ1 C;  5GTI U;  3F5E A;  3RRH A;  3ICX A;  1L7P A;  5ALK A;  4ICA A;  4R64 A;  4UAW A;  1D8Y A;  5AKJ A;  9ICS A;  1TVA A;  3RH5 A;  3PX4 A;  2YY6 A;  4FZM A;  3ISD A;  8ICL A;  2W9M A;  1ZQN A;  1N56 A;  4UB2 A;  1LKY A;  2LMR A;  1ZQD A;  9ICR A;  2CXY A;  3PMN A;  2R8H A;  3T5K A;  4DQQ A;  3MC1 A;  3RBD A;  4DS4 A;  1KBU A;  2DKX A;  3L4P A;  5ALE A;  3BS7 A;  9ICQ A;  1A6S A;  1UQV A;  3TFR A;  2KZZ A;  3V6J A;  4OJ6 A;  2LI6 A;  2F8K A;  2JHD A;  2W8L A;  3NUQ A;  2OCE A;  4UAY A;  2J6U A;  4IRD A;  2EAM A;  4Q43 A;  2W9B A;  1XC9 A;  4CF5 A;  1X40 A;  5ALO A;  4Y2Y A;  1FEZ A;  4QZD A;  1F0M A;  4US9 A;  3GIL A;  5ALF A;  3T5L A;  4OJL A;  3K1Z A;  3EWA A;  2LBO A;  4CCH A;  3A0B U;  3N4M B;  2HCF A;  2I6X A;  4UAZ A;  1XS9 D;  3MDA A;  5KFX A;  1J2M A;  3L5K A;  4YR3 A;  1UCV A;  3GFK B;  2W7O A;  2KKV A;  4PHA A;  1XU4 A;  4UB5 A;  1YZ6 A;  1Z00 B;  2P6U A;  1ZQB A;  4C4R A;  2ZIU B;  3PW4 A;  1WUD A;  1Z4O A;  3H8S A;  2DKZ A;  3F2D A;  4F4K A;  3ZD9 A;  1N63 A;  5EE0 A;  3WKC A;  3ORY A;  2AXT U;  2EQY A;  3JPS A;  4K4G A;  5ALP A;  5D49 A;  1N61 A;  2GLE A;  4Z6E A;  3AM9 A;  4F91 B;  4M2Y A;  3HRD D;  2CPR A;  2ZXI A;  2BZF A;  1Q3U A;  4KIT B;  4KLH A;  5ALH A;  5J0S A;  4RT3 A;  4A8E A;  1CRX A;  5KFF A;  1RYU A;  2WTF A;  4R66 A;  2XIC A;  1ZQO A;  2PKE A;  4JWM A;  2NRW A;  2HHU A;  3PW5 A;  2G5H B;  4US8 A;  4CNQ A;  4F2S A;  4DSK A;  2WF7 A;  1K1Q A;  1S0O A;  4O3N A;  1ZQQ A;  4OJO A;  3ISB A;  4TUR A;  2BQR A;  4ECT A;  2IHM A;  3CW2 C;  4UB1 A;  3BS5 B;  2FPK A;  4YR2 A;  3G6X A;  5CWR A;  1X9S A;  1S76 D;  4GXI A;  1PK3 A;  5KFS A;  2XCP A;  4NJ8 A;  1NK0 A;  4M6W A;  1N5X A;  5L1L A;  4ELU A;  2Q0Z X;  1SV4 A;  5KT5 A;  4UQG A;  3HJE A;  3T79 A;  7ICU A;  2JRZ A;  2YMM A;  3QUQ A;  1L7N A;  5KL1 B;  3JPP A;  3C21 A;  3AUO A;  2KZ3 A;  4GIB A;  2HOI A;  4F5P A;  3PML A;  1ZQI A;  2HHW A;  3IHQ B;  4FO6 A;  3DDH A;  3EPI A;  3HW8 A;  4MFF A;  2MAX A;  3MR3 A;  1RZT A;  3DEE A;  4CF3 A;  4P0P A;  8ICK A;  4RQ0 A;  2ASL A;  3C1Y A;  2XO7 A;  2ESE A;  2BCS A;  4DLE A;  1JI7 A;  2JEI A;  4NLG A;  4ECU A;  9ICU A;  2E1E A;  3CRX A;  4ECS A;  5DG9 A;  4HYK A;  4ELV A;  4LJX A;  4RU9 A;  5HR7 A;  4Y2P A;  3M1Y A;  4F4Y A;  4K4I A;  3NGD A;  4KX5 A;  2H5X A;  3RR8 A;  1S77 D;  2YTU A;  3F53 A;  4NWI A;  1NKC A;  2A1J A;  4KLE A;  1CI4 A;  3OJU A;  3THV A;  1BPD A;  1K1S A;  3MDC A;  1LV5 A;  1WWU A;  3TAR A;  2ES6 A;  3WK7 A;  3MFI A;  3H4B A;  3PX6 A;  3JPN A;  4DL3 A;  2G0A A;  1NK4 A;  5DQH A;  4ECW A;  4U6P A;  1SWW A;  2DQN B;  1JXL A;  5J0R A;  3QYP A;  2NRT A;  4Y2S A;  5IIL A;  2OYY A;  1ZD4 A;  4J9R A;  8ICU A;  3UMG A;  4YD2 A;  1MN8 A;  1NK5 A;  2YB1 A;  5AIA A;  4M04 A;  4UAU A;  5J2H A;  2XC9 A;  3GZF A;  4DFM A;  8ICM A;  5CR0 A;  1TAU A;  3MR2 A;  3FC4 A;  4EEL A;  4Y2R A;  4DFD A;  4PHE A;  2KJ9 A;  3RJH A;  3L3F X;  2JGA A;  4KLO A;  1ZQV A;  3MAB A;  5AIB A;  5J29 A;  5A0L A;  5TZV A;  1ZQX A;  4Q8E A;  2EZZ A;  4J9M A;  3AL0 B;  3B9J A;  2YMQ A;  4QZC A;  2OXO A;  5J2F A;  3QEA Z;  4YXM A;  2AU0 A;  3SD7 A;  4QWA A;  1B22 A;  1NJY A;  3KZX A;  3RJK A;  4UAS A;  5J0P A;  4RNM A;  3A0H U;  1M6Y A;  3UM9 A;  3KOO A;  1QH9 A;  3GV7 B;  2AGQ A;  2G07 A;  4C4T A;  5CRX A;  4J03 A;  5ALI A;  2BQ3 A;  2FE9 A;  3KBB A;  1L7O A;  4QZA A;  3GV8 B;  2R18 A;  2EDU A;  2JEJ A;  2VKQ A;  4I2I A;  2MUT B;  1KFT A;  2GWS A;  1S5L U;  3M8S A;  1BNP A;  3I28 A;  4BXO B;  4F5N A;  2KN7 A;  5ALJ A;  2HBL A;  1SXD A;  1U45 A;  2VA3 A;  2H3F A;  1TE2 A;  1KQQ A;  2W9B B;  2BDU A;  3FM9 A;  1ZQP A;  1RYS A;  5AK6 A;  4O0I A;  5DDY A;  2G5I B;  4J9O A;  2K4I A;  1ECW A;  1D8B A;  2F77 X;  4I28 A;  1IXR A;  5J2I A;  3TAD A;  1QTM A;  1JMS A;  2WAQ F;  4Z6C A;  3T5J A;  5KG1 A;  2MA1 A;  3EYZ A;  3HPO A;  1NZP A;  5EOZ A;  1RG6 A;  5KFV A;  5DB8 A;  3Q8S B;  2NRX A;  5J0X A;  3SEN A;  2ASD A;  1KSP A;  5J0Q A;  4J9L A;  1ZQZ A;  4P0Q A;  3IN5 A;  3TQ1 A;  2YML A;  2VA2 A;  4CF4 A;  5J2J A;  2EZX A;  2RRD A;  3D2Q A;  1UT8 A;  3RH4 A;  4JB3 A;  3ONN A;  1L3T A;  5IIM A;  4EBE A;  3H0M B;  4Y2V A;  5KAI U;  3WK4 A;  3PR5 B;  2HHV A;  1ZQS A;  1JAL A;  1PVQ A;  1RQN A;  2ALZ A;  1BPB A;  1WCL A;  3AMZ A;  2VJ4 A;  1XO0 A;  5DB7 A;  2KE7 A;  1SL1 A;  2FLP A;  2HHX A;  4FS2 A;  5HP4 A;  5KG7 A;  5KFG A;  2ATL A;  2R8K A;  4KN7 A;  4PHP A;  9ICX A;  2BCU A;  4NLK A;  1MQ2 A;  9ICK A;  1SV0 C;  2NRV A;  4DSE A;  2WF5 A;  1TK5 A;  5J2A A;  2KV2 A;  3V7L A;  3KKA C;  4C8N A;  1XSN A;  2BPC A;  1ZQG A;  1ZQR A;  2ZG6 A;  5DKW A;  3DV9 A;  3UXN A;  1C20 A;  3WU2 U;  1RXW A;  2W3S A;  4RQM A;  2KD1 A;  4ELT A;  5JTI A;  3HWT A;  2KVC A;  3RJJ A;  4QZ9 A;  1Z3E B;  4F93 B;  4B9N A;  2ZXH A;  2ISP A;  9ICJ A;  3IRU A;  4IQT A;  1QSL A;  4R8U A;  4F2R A;  5F9N A;  5J8Y A;  3AU6 A;  1ZQA A;  2WHE A;  2JXJ A;  2W03 A;  2K8B B;  2KEY A;  4RNO A;  1N60 A;  3VC8 A;  7ICJ A;  2JZB B;  2D8C A;  2NO5 A;  8ICN A;  3F2B A;  4YMN A;  4Z6D A;  4C4S A;  3LVW A;  1VLB A;  3IDW A;  4F4W A;  3K4G A;  4KLQ A;  1KRP A;  4M9G A;  2QB0 A;  3MR5 A;  1SKR A;  3KHL A;  1D8L A;  4TUQ A;  1ZQC A;  1Z19 A;  2RLT A;  4EZ9 A;  4ED3 A;  3JPT A;  9ICN A;  1T3N A;  8ICY A;  3AN1 A;  9ICL A;  4EBD A;  2ODG A;  4PL2 A;  4X5V A;  2W9C B;  3ZDA A;  3KHG A;  3QEB Z;  2PFP A;  1KKX A;  3QX7 A;  4NXZ A;  3SQI A;  2ZJ8 A;  3KHR A;  3RJI A;  3PO5 A;  2A19 A;  5L1I A;  4RQ3 A;  1F5S A;  1T7P A;  4M6W B;  2BR0 A;  2ZUC A;  1PVR A;  1S0N A;  4Y2Q A;  4CGZ A;  2QB0 B;  4UAV A;  2YQE A;  5KG5 A;  1SZP A;  2IA6 A;  1HUZ A;  5KFM A;  1V85 A;  3LYS A;  2ZIX B;  1MQ3 A;  4YMM A;  2KNJ A;  9ICP A;  5AI5 A;  2R8G A;  2DWQ A;  3Q8R B;  2M9N A;  3NTU A;  4C8M A;  8ICV A;  4J9Q A;  8ICO A;  5AI6 A;  1XWL A;  5BOM A;  3QUC A;  3IM1 A;  3TFS A;  1DXS A;  2AQ0 A;  3ISC A;  4BDP A;  4B9V A;  4DFJ A;  1NKB A;  1MSW D;  2R8J A;  4QZI A;  2BGW A;  4J9K A;  2BKE A;  5E79 U;  2KMD A;  3SEI A;  4F4X A;  1JIH A;  3HT3 A;  3H40 A;  4YMO A;  4O5C A;  4DFP A;  4NL9 A;  5JU5 A;  4O3R A;  1J97 A;  5KFA A;  2E1F A;  1ZRN A;  1TKD A;  4IC9 A;  2PXI A;  1QSY A;  9ICH A;  4M9N A;  2ZUB A;  5CEH A;  3TAQ A;  5KNI A;  2F8L A;  2K8C B;  1UA0 A;  5EWF A;  3UXO A;  1T3Q A;  3RTV A;  4ED0 A;  4DSL A;  1SKW A;  5AM2 A;  4UBB A;  5AK3 A;  5DQG A;  4NM2 A;  3LWL A;  2C22 A;  4YXJ A;  3C2M A;  4IQW A;  3QNM A;  2UVV A;  4O3Q A;  3K75 D;  2BDP A;  3WK9 A;  7ICF A;  4DS5 A;  4YFK A;  4HAI A;  4DL5 A;  2AH5 A;  4M9H A;  5KG4 A;  3J81 j;  1PK1 B;  5J8Y C;  4Q44 A;  3OGU A;  1L5U A;  1DRG A;  4RPY A;  1ZQM A;  4U7C A;  2HOF A;  2NRZ A;  4F92 B;  1BPZ A;  4DF4 A;  4KLI A;  2FI1 A;  4I2J A;  3HX0 A;  5KFB A;  4DF8 A;  5AKI A;  4RNN A;  3U26 A;  1JN3 A;  3LVV A;  5AI8 A;  2H3I A;  1OXJ A;  1UPH A;  2AGO A;  9ICW A;  5G5H A;  3C5G A;  3PNC A;  3V6K A;  5DLG A;  2KJ8 A;  2VAN A;  4ACO A;  1ZRM A;  4F71 A;  4ED6 A;  1JRO A;  2YB4 A;  2G08 A;  5AKX A;  5J0Y A;  1B43 A;  4XUS A;  2IMW P;  2K60 A;  2ISO A;  2DPI A;  2KTQ A;  1DK2 A;  3PR4 A;  2E5S A;  1SIJ A;  3QU7 A;  1VJ5 A;  5KAF U;  2VIX A;  7ICO A;  5J2C A;  4IQU A;  2HBK A;  1Z00 A;  3D2N A;  3AEV A;  5B5E U;  1QSS A;  2HOQ A;  4NLC A;  3TAD C;  2C2D A;  5F3X B;  4FZN A;  1H38 A;  3HKZ C;  2KK0 A;  2ZIW A;  1TK0 A;  2EZY A;  1NJZ A;  5AI4 A;  5L1K A;  2KP7 A;  1RM6 C;  1NI3 A;  3ETL A;  3H8W A;  2L5Y A;  2BHN A;  1BPY A;  4FE3 A;  4YQW A;  5CHG A;  4ED7 A;  3V6H A;  5AKZ A;  2D3D A;  4C7Z A;  4NY8 A;  3Q8L A;  2I5H A;  2Q4T A;  2HHT A;  7ICH A;  2HHQ A;  2PMZ C;  9ICV A;  4TQS A;  3JPO A;  4ECQ A;  2QAR B;  4EYI B;  2B21 A;  3ED5 A;  3C1Z A;  2VJ5 A;  5J2B A;  2RDI A;  2XCA A;  4CDG A;  2W55 A;  4LZD A;  4I27 A;  5AM5 A;  9ICE A;  3T3F A;  4OJP A;  1HEK A;  2KIW A;  4OO1 J;  5J0W A;  3QU9 A;  4B9S A;  2DF4 B;  1PUZ A;  3EPG A;  2KHV A;  4RQ4 A;  4JMU A;  3PSI A;  3MR6 A;  3RJE A;  8ICQ A;  3RF9 A;  5KT2 A;  2AGP A;  5DGA A;  3GQC A;  3FDS A;  3PSF A;  8ICI A;  2WFA A;  1ZQK A;  2XY7 A;  4DQI A;  4GXJ A;  1X9M A;  2KKP A;  5JUM A;  5KFH A;  3N7S C;  1S0V A;  4BWJ A;  2BCV A;  4Y2X A;  4YN4 A;  5KTQ A;  4LVS A;  1XO1 A;  8ICA A;  1OW5 A;  1FO4 A;  1D9F A;  8ICC A;  3N97 B;  4O5K A;  1BNO A;  2IOH A;  2KFZ A;  4UB6 U;  1X6J A;  2E8N A;  4RZR A;  4QZH A;  3D2S A;  3K1R B;  3HP6 A;  3H8J A;  3ZDE A;  3RRG A;  4O9M A;  2PMZ F;  2A1A A;  3D6J A;  9ICG A;  2CRX A;  1X9W A;  2P35 A;  4F4Z A;  3UQ2 A;  1U9L A;  1F44 A;  2AHO B;  3PW0 A;  2GOL A;  5JRT A;  4DSI A;  4O3O A;  2P66 A;  4J9N A;  4CE6 A;  2RQ5 A;  9ICA A;  1SZH A;  4ZOH C;  5KFQ A;  2QLT A;  2DPJ A;  1KFD A;  3BZC A;  1MA7 A;  5DB9 A;  4P0P B;  1ZYQ A;  1TAM A;  4KMO B;  5AKL A;  5BOL A;  7ICV A;  3QXG A;  1Y88 A;  2KJ5 A;  3E2E A;  1SL2 A;  4I2E A;  1MC8 A;  5KG2 A;  7ICI A;  1NK9 A;  1UA1 A;  4OCZ A;  2AJQ A;  1KW4 A;  4I29 A;  1WWV A;  4I2B A;  1SGG A;  2E8O A;  1XNS A;  5KFW A;  5KG3 A;  4MF8 A;  4Y2J A;  3UXP A;  3UMC A;  3ZD8 A;  3BJY A;  8ICG A;  1RPL A;  2LM4 A;  1D9D A;  9ICM A;  3AQE A;  2HDO A;  4I2A A;  2ASJ A;  2IOF K;  4I2G A;  1U47 A;  3NVY A;  4F5R A;  1EXN A;  2IOF A;  5KFP A;  2KG5 A;  1TFR A;  4BWM A;  2NV3 A;  3IV6 A;  2PFQ A;  4LZG A;  8ICZ A;  4YVZ A;  1KN5 A;  3MGV A;  3SAH A;  2E8M A;  3TAP A;  5ALR A;  4JV2 A;  3SMV A;  1L6N A;  1J2N A;  2WAQ C;  3V72 A;  1CUK A;  8ICX A;  3TAN A;  3M8R A;  4G9B A;  4DWI A;  5T14 A;  5KFO A;  4TUS A;  2BPG A;  5HR6 A;  2RHF A;  4KLM A;  2QKQ A;  4CRX A;  3BQ1 A;  1ZJN A;  2Y0S C;  4AYB F;  4USA A;  4QZF A;  5CB1 A;  1DOQ A;  4C0Z A;  1SWV A;  1COO A;  4QZE A;  3KKA A;  2W43 A;  5FP0 A;  2XGQ A;  3KD3 A;  2W9A A;  3QUB A;  1NKE A;  1ZQW A;  3MFH A;  5DG7 A;  5ALL A;  2ZTD A;  5AI0 A;  5KFZ A;  1PK1 A;  2DBY A;  9ICB A;  4RUC A;  2MSN A;  1JXE A;  2WB1 C;  2K4P A;  2FMP A;  2R8I A;  2JV3 A;  1NK8 A;  5IIJ A;  2F3N A;  1N62 A;  4EX7 A;  1ZQL A;  5IIK A;  3RAX A;  1V38 A;  5AK5 A;  5DG8 A;  3E58 A;  2F44 A;  3VCB A;  2E8P A;  3TKA A;  2JR5 A;  4ECX A;  2ZIX A;  3JPQ A;  2C2E A;  1BVS A;  1HJP A;  3H7I A;  1FFV A;  2HW3 A;  5ALM A;  3WKD A;  4M47 A;  4F5O A;  3HKZ F;  3C5F A;  8ICB A;  1QCK A;  2LYH A;  5ALU A;  4RPZ A;  7ICK A;  5KFU A;  3EW9 A;  2UVR A;  4DFK A;  2F2A B;  1A0P A;  2W8K A;  5CA7 A;  4F8R A;  7ICS A;  4KLT A;  1OUQ A;  4DSJ A;  4BJQ A;  2LYA A;  1TV9 A;  4F72 A;  1X66 A;  1UHU A;  2K4H A;  2BPF A;  3M7D A;  8ICS A;  5KT6 A;  5AKK A;  4OJ5 A;  1LB2 B;  3N28 A;  8ICP A;  4QWE A;  5L1M A;  7ICE A;  1RDF A;  3T5H A; 
#chains in the Genus database with same CATH homology
 1PUZ A;  1X6I A;  2JR5 A;  1X6J A;  2LM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...