2JR5A

Solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MYTAEQKARIKWACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNLSKVRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0350 protein VC_2471
publication title Solution structure of UPF0350 protein VC_2471.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2jr5A00
2JR5A 2LM4A 1PUZA 1X6IA 1X6JA
chains in the Genus database with same CATH superfamily
4DWIA 5BOMA 2K89A 2E8PA 5G5HA 3ED5A 3V72A 5EE1A 4IQTA 4YMMA 4MFFA 1D8BA 2WF8A 2I1QA 1ZQMA 3QU9A 5AKLA 1N5XA 4CCHA 2XGQA 2BDPA 2JEGA 3M6ZA 3ETRA 2OEHA 3L4PA 3OSPA 3PO4A 5ALWA 4UBBA 3Q8SB 3RJFA 3PW0A 2ZIXB 5L1JA 1COKA 2C22A 3M8SA 5KFQA 3NVYA 4K4GA 4RPZA 3LWMA 1SKRA 3T5LA 4QZFA 4I2HA 5KFOA 3RAQA 1L5UA 3F2DA 5A0LA 3BS5B 5DGBA 8ICXA 1MC8A 5KFHA 5AKGA 1PZNA 2XI9A 4YG2A 4B9TA 3H8MA 2E1EA 4NLKA 5AK4A 3KZXA 3GZFA 2YN4A 5ALSA 4Q44A 3SYZA 2IBKA 4Y2JA 2D8CA 1PK1B 5J2KA 4YXJA 3I28A 2QARB 5ALNA 2NO4A 9ICXA 3NUQA 5J0SA 2HOFA 4J9QA 1ZQHA 3HW8A 5GTIU 5KFAA 3UQ0A 5ALHA 9ICJA 2IHNA 5KT6A 1Q3VA 4F4XA 4DFMA 5KT5A 2I5HA 4QZDA 1SL2A 3QEBZ 1J2NA 4US8A 2MA1A 3NGDA 3ONNA 3F53A 1CRXA 2PFNA 2B0CA 4MF2A 3RB3A 5AM0A 2CN1A 3UPQA 4ICAA 4DQSA 5IILA 2YY6A 2KN7A 4NV0A 2DWQA 1NNLA 4AYBC 5DB9A 4DCCA 3C5FA 2ASDA 2PFOA 2XO7A 2CPRA 3KBBA 3SR6A 3GV5B 1FFVA 4EZ9A 2KV2A 4Y2YA 4ECUA 4F8RA 4AP9A 3RR7A 1DRGA 2XICA 5KFZA 1WCNA 2JEIA 1OW5A 2NRVA 9ICEA 2MAXA 2M0NA 1RXVA 7ICHA 1J2MA 4ED8A 3ZDDA 3OGUA 2KSOA 3MFHA 4C4RA 1KEJA 5TISU 2YMPA 2ZUDA 4F5NA 7ICGA 3AMZA 3PY8A 1BPBA 1RPLA 1UQVA 4BXOB 5JTIA 3GIIA 4Z6DA 3T3FA 2UVVA 1JRPA 5AICA 2WAQF 4FBTA 1ZYQA 2FE9A 4M47A 5AKXA 4TQRA 4F91B 4ECSA 3WK6A 2F44A 5TZVA 4BDPA 1Z1BA 2HBLA 2JH1A 1V97A 4QZEA 2WAQC 1N5WA 3WK8A 3H40A 5ALMA 4ECRA 8ICEA 1VLBA 3IDWA 2DPJA 5KT7A 5L1KA 2G07A 3QE9Y 3N4MB 5J2DA 4ED0A 2JV3A 4B9UA 1N62A 4QZIA 1RYRA 3PW5A 1HUOA 4HAIA 4FZLA 3UM9A 3ZDBA 1DGJA 1NKEA 1QSSA 7ICSA 2JGAA 2C2DA 5AIAA 4FZNA 1A6SA 9ICRA 5ALYA 1ZJMA 2VANA 2KNJA 2ZIVA 1B22A 2HBMA 1K1QA 2KTQA 1B4FA 1V38A 4UB1A 4F5OA 5HMMA 4ELTA 4EX6A 1X6JA 5CWRA 1N56A 4CF3A 5AKKA 2WF5A 4KLEA 2C2RA 3TAPA 1ZQLA 3G6VA 5AI4A 4UB8U 2BPCA 5H2FU 4A8EA 1S0NA 4RUCA 1L6NA 2BCUA 4C7ZA 5J0XA 4RU9A 3AQEA 4NLCA 2V4QA 3ETLA 2DQNB 4ED7A 1BPDA 3RB0A 2KZMA 3RB4A 2M9NA 2Y9UA 4I27A 2KKVA 3RTVA 3SD7A 3IG8A 1WCLA 2NRZA 1GO3F 5ALKA 5EWEA 3WK5A 4O5EA 1SXDA 3T5JA 1BNOA 4PHDA 3FC4A 5T14A 1DK2A 4P4OA 1LKYA 4Q8FA 8ICTA 4J03A 3RJEA 3KHRA 1SXEA 8ICQA 5J2GA 1IIPA 2A1AA 4Z6FA 1V85A 2EH9A 7ICMA 1TAUA 2W3SA 4Y2UA 5E79U 1S5LU 3HILA 3PSFA 3RRHA 4DLEA 2PFPA 3LWLA 2VIXA 1DOQA 4UAUA 4OJOA 1Z4OA 4BGDA 4C7YA 4GFJA 4GC7A 4EBEA 1QSLA 3PR4A 1Z00A 8ICBA 2KZ3A 9ICTA 4R65A 1K1SA 2KOBA 3DEEA 5KL8B 3QUCA 3G6YA 3SZ2A 1BPEA 1QLNA 3PW4A 3L3FX 2FI1A 3B9JA 3QU5A 3JPPA 2W8LA 3IHQB 2ZIXA 1XS9D 4DS5A 5DG7A 4RQ4A 1LV5A 2YX8A 4JK1A 2Y0SF 3CP8A 4DEZA 1PVQA 3WK7A 5DGAA 4KLMA 1NZPA 5DG9A 3KOOA 2ZJ8A 1DXSA 2EAPA 4K4HA 5L1MA 4FBUA 4DFDA 2FPMA 1QQ7A 2ZTEA 2JRZA 2ZJ5A 1MA7A 8ICVA 4IC9A 1ZD3A 3A0HU 1L3UA 4B9MA 1Q3UA 2W7OA 4B9VA 8ICRA 3H8SA 4KLOA 1PK1A 5KFJA 2KVCA 1O03A 3O0FA 5AI9A 2ASJA 3N97B 2KICA 4F93B 1ZQSA 5AKIA 2AGQA 1ZQZA 5ALGA 2QKQA 2Q0ZX 1X40A 5ALJA 1PVRA 4OJPA 4BWJA 3V7LA 4MFCA 3Q8LA 5KTQA 4C8OA 2BCQA 4J9RA 7ICIA 1T7PA 3OPXA 3LK9A 4KLUA 2H3VA 3FYHA 4ZH4A 5EE0A 1RQNA 1S97A 1TVAA 4I2GA 2N1RA 3D2QA 4Y2QA 3OHAA 1ZQGA 5KG3A 5HHHA 2I9GA 2L5YA 3OTQA 4WJ3B 4KLTA 4QZ9A 5FP0A 4Q8EA 4GLXA 5KG6A 2GOLA 1QQ5A 3PSIA 4PZNA 4G3IA 4OJ6A 5DQGA 3F5AA 2KK0A 1P7DA 3SEIA 4I2AA 2HSZA 3THVA 9ICMA 2JXJA 3T5KA 4I2EA 2OM6A 3GIJA 1LVHA 2OYYA 4Y2PA 3NASA 4PGQA 2MSNA 2WB1F 4DSEA 1NOMA 3LVVA 1UT8A 3PV8A 1SV4A 2RQ5A 1KSPA 4BXOA 4QWBA 1WWUA 5D49A 1V9PA 2KD1A 2IOFA 3TFSA 3HKZC 4PGYA 2RRDA 2WB1C 2EAMA 4O5KA 2HHTA 2XCPA 1COOA 3KHGA 3KKAA 3RFAA 4JMUA 2W8KA 2VKQA 5AM1A 4UQGA 2F1IA 2JEJA 4DSIA 4ECYA 5ALVA 9ICBA 4KLJA 5J2EA 2W9BA 3GV8B 1UPHA 3M1YA 3E2EA 3K4GA 2ES6A 2AXTU 5KFBA 3IP4B 5DLFA 2HVIA 2E1FA 5ALPA 4YN4A 1Q8KA 4Z6EA 5BPCA 4IR1A 4RNNA 3MC1A 4CF4A 9ICIA 1SWWA 2K8BB 4CRXA 3IN5A 4IRDA 1WWVA 1PK3A 5HR6A 3TAQA 4I29A 8ICSA 1L3VA 3H0MB 4EELA 5J0UA 4QWEA 5EOZA 4DL7A 4QZAA 7ICRA 3PMLA 7ICJA 3PW7A 4ECXA 2VJ5A 5AI0A 5AK3A 5J0QA 3GDXA 7ICEA 2BR0A 1NJXA 4M6WA 1YZ7A 5GTHU 1SZPA 2EZYA 5DQHA 2FMSA 4F4KA 3H0LB 2NRWA 1S77D 4UAYA 1NJWA 4B9NA 4YR0A 2Z7JA 5ALIA 8ICHA 3FDSA 5L1IA 1KTQA 4I2IA 5KFMA 5G5GA 1NKCA 2HCFA 4RQNA 1MQ3A 1PUZA 3T79A 1Z00B 2FMPA 2ZTCA 2B6GA 5J2FA 2AQ0A 4UB2A 2KEYA 4I2DA 2BPFA 3T5HA 1BNPA 5EWGA 4RNOA 2FMQA 1UCVA 1MSWD 9ICAA 3JPNA 2W3RA 3C5GA 2R8GA 2FLPA 1TK5A 4IS7A 2KHQA 2WF6A 4US9A 4RNMA 3H8JA 1L3SA 9ICSA 4UB4A 3PX6A 3MR5A 2W11A 2HHQA 2KVSA 1XSLA 4M9GA 4GXKA 4FS1A 4DL6A 2ZIWA 3NVWA 3MBYA 3ZDEA 1D9DA 8ICZA 4XUSA 3GV7B 1D8YA 2F1HA 2V4RA 4DL4A 2HHVA 4KMUA 3C2KA 2MUTA 4M0AA 3BQ7A 9ICHA 4ECVA 3QUBA 5J2HA 2H5XA 5AM3A 2Q4TA 4XQ8A 3TARA 3QZ7A 4DOBA 5IIIA 5DB7A 5AKZA 5AI5A 1RYUA 3Q8QB 2RDJA 2VA8A 5ALDA 4C80A 8ICJA 4I28A 4P4PA 4AYBF 3OJSA 2WTFA 5CEHA 2GLEA 4CGZA 2BCRA 1IV8A 2LYBA 2VA2A 1SKSA 5KFCA 5DB6A 4YR3A 2NV3A 4CDGA 4R8UA 5JUMA 2BQ3A 2XIDA 1TFRA 2KIWA 3ISCA 5KFLA 2LBOA 3HP6A 3K1RB 4I2FA 5AKEA 4IRKA 4GXIA 3I76A 2W55A 4UBCA 5AK6A 4F4ZA 5J2IA 2CRXA 4RQ3A 5KFIA 3NRWA 1AQ6A 3PW2A 4IR9A 1BVSA 7ICUA 2NYVA 5CHGA 1KDHA 4EEYA 4O9MA 1ZRMA 1PVPA 1ZD4A 1NJYA 2PMZC 4NM2A 2UVWA 4DSJA 4F71A 1OXJA 4UB5A 1U49A 8ICNA 3QNMA 2HVHA 1SB3C 3PNCA 4HYKA 1MQ2A 2H3IA 5CJ7A 3V6KA 2Y1JA 3C21A 3B0YA 5KFRA 1IG6A 1ECWA 5AM2A 4QZBA 3N7PD 4DSFA 2W54A 4ELVA 4DOAA 2AGOA 5DDYA 5AKYA 3QYPA 4XRHA 1ZJNA 5ALTA 3RBEA 9ICLA 4XA5A 3D6JA 2W9BB 2YMQA 5ALEA 4PZOA 4C8MA 5KFUA 5HHIA 5BOLA 2OWOA 2IOFK 2DKZA 5KNIA 4Y2XA 4RQ8A 3QU7A 2ZUCA 3ZD9A 4KLHA 3BDPA 4RQ0A 2K60A 4MHVA 4FO6A 2J6TA 5KG2A 5DLGA 5IINA 1HEKA 3SAGA 4RQ5A 3Q8RB 4KLDA 1F44A 3L5KA 1KN5A 3KHHA 1Q46A 3IM1A 3PO5A 2WFAA 2P35A 1C7YA 1ZOLA 3CW2C 4J9PA 4EZ6A 2KIVA 4P0QA 2ZIUB 5B66U 4Y2TA 3V6HA 3DDHA 4PHAA 4KLFA 4GIBA 4DOCA 1ZQDA 1JI7A 4M6WB 4QJFB 9ICCA 3ALRA 1ZQEA 3QZ8A 4DLGA 3NTUA 1ZQXA 4FZMA 4Z6CA 3A0BU 4BJQA 4YR2A 5J0PA 3NRZA 4ECTA 1ZQIA 2F3NA 2VA3A 1XWLA 4QZGA 4I2CA 3RF9A 3ZDAA 4Y2RA 3TFRA 1YZ6A 4P2HA 1Z3EB 1NZBA 2MU2A 8ICFA 1SGGA 3F2BA 3S6JA 4R66A 5KAIU 2BCSA 2XY5A 3JPOA 2XC9A 3RBDA 5K4LA 2R8IA 9ICNA 1D9FA 1KLNA 4O3RA 3N7RC 3D2SA 1WG8A 9ICVA 3AUOA 1L7OA 4BWMA 2ZIWB 3JPQA 1X9XA 1JUDA 2PFQA 3OJUA 2EQYA 4J9OA 2HOQA 1BPZA 1SIJA 2YTUA 4RQMA 4YMNA 2MUTB 2KFNA 2W03A 1KL9A 1XO0A 2G5IB 1NK9A 5JU5A 3C2LA 3RAXA 5HNKA 1ZQYA 3E0FA 3H0RB 2Y1IA 4GC6A 2YB4A 2DF4B 4DSKA 3QX7A 4MFAA 1VJ5A 4G9BA 4EYIB 5AI8A 1N63A 1UHUA 4LZDA 2K8AA 2F77X 2ZUBA 2EDUA 3R9KA 1RDFA 1KFSA 4IQVA 3QU2A 8ICOA 4KMOB 1S0VA 2W9AA 5J0OA 5ALFA 2QB0A 3CYMA 3GILA 2ZG6A 4OCZA 5B5EU 3PX4A 1ZQNA 3MR2A 3ZI4A 1RG6A 4RQ2A 4YFKA 3C2MA 4R8UB 3F5EA 4PH5A 4PHEA 4JUZA 4C8KA 2RLTA 2IOHA 4NM1A 1FIQA 3E58A 3B0XA 1TAMA 1X66A 2A1JA 1NK0A 2K4HA 3ICXA 4EBCA 3QEAZ 2OHFA 1Z1VA 1CUKA 2BCVA 4F72A 1ZQWA 4DL5A 4RUAA 2ALZA 2AJQA 1HJPA 2K4EA 1ZXIA 2EANA 2G09A 4RT2A 3RH6A 2JHDA 3M8RA 3SMVA 1KKXA 1KBUA 5KFVA 4OO1J 3JPRA 4E0DA 5J2CA 2W9MA 2IHMA 3Q8KA 3GFKB 4KX3A 4ELUA 4UAVA 5KFDA 3GIMA 4EYHB 1BGXT 1QQ6A 2HI0A 4JWNA 3TACB 3MGVA 2Y9TA 2A3VA 2C28A 1ZQAA 2RHFA 5DDMA 1X9WA 1T94A 4DL2A 1ZQRA 3EWAA 2LM4A 5CP2A 4O0IA 2R8JA 4YVZA 2F2AB 5EE3A 3HKZF 1KFTA 4R64A 3UXNA 2OCEA 4FS2A 4NLBA 2P66A 7ICLA 4QZCA 1SL1A 5C0YA 2JR5A 5L9XA 4YCXA 3KFUF 3QU4A 8ICCA 3UXPA 2JMGA 5EWFA 5KT4A 1QH9A 4QW8A 3PZPA 2HW3A 3MABA 5J0RA 4TUSA 1ZQ1C 4Q45A 2B21A 1N48A 1M6YA 2XGPA 4P0QB 3RR8A 4KN4A 3HRDD 1U45A 1NKBA 4B9LA 4P0PA 1XNSA 1ZQBA 4FFDA 5J0WA 1TE2A 3UMCA 1RZTA 4F92B 1IM4A 3TI0A 1S76D 1KQQA 3JPSA 1ZQJA 4ED6A 3MDCA 3RJGA 1X9SA 1U48A 4F3OA 2DKXA 5IIJA 5KL1B 3H4DA 4YMOA 2ZXIA 3BQ1A 5KFPA 7ICFA 4RT3A 3V7KA 3EZ5A 3CRXA 4C8LA 4QNLA 2ASLA 2D3DA 3HX0A 2V9WA 3F2CA 4YD2A 2RDIA 2W04A 4NLNA 1EXNA 3RJHA 4NWIA 4DQIA 5DKWA 2G5HB 2W9CA 4PL2A 2BGWA 5KFKA 2P6UA 2ZIUA 3KZIU 5F3XB 2JH7A 2JEFA 2D6FC 4QIWF 1L7NA 2PI4A 1YT3A 3ZDCA 4YXMA 3WU2U 2BPGA 2FLNA 1JIHA 5AM4A 2NRTA 3PVXA 2ISOA 5IIOA 5KFFA 1KW4A 4DQQA 4F5RA 1OUQA 7ICTA 5KT2A 3WKAA 1TKDA 3KKAC 4QIWC 1URJA 4UAZA 5AM5A 2IMWP 5D4BA 8ICLA 3BZKA 5KG1A 3UXOA 3U26A 8ICAA 2OXOA 4RQ7A 4YQWA 2E8MA 4LVSA 8ICYA 5F9NA 2K4IA 4F2RA 2KZZA 2A19A 3EPGA 1F5SA 8ICUA 9ICUA 2O6KA 1SKWA 4M9NA 2R8KA 2HBJA 2KE7A 2QB0B 1JMSA 1UT5A 2J6SA 4DF4A 2MRLA 3SAFA 1ED1A 2F8KA 4RZRA 1L7MA 1NK8A 3SQIA 7ICKA 4U7CA 2XY7A 4M9HA 4TUQA 5IIKA 5J0YA 2K4PA 2BHNA 4QW9A 2RP5A 3NS1A 4DQRA 1BPYA 1JROA 3NVVA 3C28A 4ED3A 4UW9A 4O5CA 9ICWA 2A1JB 9ICPA 4O3QA 2EAOA 1QSYA 5KFSA 3C1YA 2KFZA 5AKHA 2VJ4A 3G6XA 3HPOA 2NO5A 4UARA 3HWTA 4PHPA 1T4GA 4DFKA 5AKJA 1L8LA 2W7PA 1J97A 2FLLA 3I1YA 3ISDA 2ZXHA 3UMBA 3LDAA 4C0ZA 3LVWA 4J9SA 4LJXA 2JZBB 2ZJAA 4JWMA 3EUB2 3BQ2A 4O3PA 4RPXA 4JV1A 5JRTA 3AEVA 5KG7A 2IA6A 3PSPA 4QWCA 2YQEA 3DV9A 3IG5A 1SV0A 2R18A 5C5JA 4RPYA 4RQ6A 4TURA 3RH4A 2PMZF 3N28A 1SWVA 3J81j 1ZQTA 4BUGA 1XO1A 1Y88A 3WKBA 9ICFA 5L1LA 5ALQA 3KTQA 9ICGA 3GIKA 1NK5A 2AH5A 4R63A 1TV9A 1BPXA 2NRXA 5ALOA 1T3QA 3C29A 1T3NA 2EZXA 2KG5A 4NJ8A 2BDUA 4MEXA 2J6UA 4B9SA 1ZQQA 3OHBA 3RJKA 1U4BA 1QTMA 4QZ8A 5DBCA 2ODGA 5F9LA 1X9MA 3FM9A 5DBAA 3MGIA 3CNHA 2GH1A 4JB3A 3MGHA 3FAHA 2AHOB 2FJ6A 4KLIA 2K8CB 3AU6A 5J8YA 3IV6A 3SV4A 3WK9A 4P0PB 2F76X 2W43A 1MN8A 2XCAA 1ZQOA 1SV0C 2FDRA 2P6RA 2KKPA 4OJ5A 1SL0A 3MR3A 2YMLA 2HBKA 3BQ0A 5EE9A 3M6KA 4KLSA 4CF5A 4JV2A 3WKDA 2R8HA 2ATLA 3AL0B 1Z4NA 3EW9A 3WKEA 5AK5A 2ISPA 2LYAA 1NK6A 2HHSA 4RQ1A 2KP7A 1UA1A 1CEZA 2GO7A 1VDVA 2LMRA 1B43A 2W9CB 1ZQPA 4DO9A 4EBDA 1KFDA 2FPLA 4NL9A 4NLZA 1K5OA 4J9LA 7ICOA 4C4TA 2BZFA 1UA0A 1N2XA 3LYSA 2PKEA 4MEYA 5IIMA 2BKEA 5KG0A 5CR0A 4O3MA 5CB1A 4PJ0U 5ALXA 2E8OA 4O3OA 2WF7A 1NJZA 2E8NA 1DK3A 1JXLA 3QXGA 4J9KA 4FE3A 4ECWA 5J8YC 4ECQA 2WHEA 2H3FA 3IRUA 4Y2VA 1F0MA 1N60A 3RB6A 1NK7A 1WUDA 2G08A 4JV0A 2UVUA 1N61A 2DGZA 4DFPA 4K4IA 1ZETA 4QWAA 1JXEA 1QCKA 4TUPA 1XSPA 3MDAA 3VCBA 3WK4A 2H3QA 2F1JA 4EENA 1ZQKA 3KHLA 3ZD8A 2KHVA 8ICMA 1XC9A 1Z19A 4UB3A 3V6JA 2G0AA 1FFUA 1TK8A 5D46A 4ECZA 5DBBA 1S0MA 5HMLA 1KRPA 1X2IA 1ZRNA 2LYHA 3N7SC 5J0TA 4KITB 1DGSA 3RH5A 2GWSA 4U6PA 3M7DA 2DBYA 5KAFU 2HHWA 2OH2A 1T8EA 4C4SA 4NL9C 4X5VA 2HOIA 5KFYA 2LM1A 4UATA 2XY6A 1JALA 1NI3A 4QZHA 4IL6U 4DQPA 1FO4A 5KFNA 4UAWA 4ZOHC 3H7IA 3ISBA 5DG8A 3NVZA 3PSTA 4F5PA 7ICPA 3Q8MA 2FPKA 5KFXA 3K75D 1XU4A 5ALZA 2I6XA 4DS4A 4EX7A 3AU2A 1WYGA 3GU3A 2YB1A 3AQFA 2H3ZA 3HT3A 3D2NA 3TQ1A 4OJLA 3BS7A 4C8NA 2HDOA 4KTQA 1FEZA 8ICPA 2KJ8A 2KJ5A 4DL3A 7ICVA 4P4MA 5J2JA 4QWDA 4CE6A 2XVTA 4LZGA 2KMDA 4PPXA 2AU0A 5J2AA 1CI4A 5HP4A 3C23A 5DQIA 2UVRA 1S9FA 5AI6A 3M9NB 3ORYA 3BS5A 3TKAA 4O3NA 1A76A 4ACOA 3PMNA 4ED2A 3C1ZA 4M2YA 2Y0SC 4M9JA 5ALRA 2AGPA 3MR6A 3PX0A 3SI8A 5KG4A 2ZTDA 5ALLA 2BQRA 1A77A 8ICWA 3OSNA 2QARA 1ZQUA 1TK0A 2HMXA 4USAA 2HHXA 4F4YA 4J9NA 4DSLA 2CXYA 2JZBA 1AROP 4NLGA 2QB1A 4YP3A 1S0OA 1L7PA 1SZHA 4TQSA 4BX9C 1RYSA 1U9LA 1HUZA 4KLGA 1C20A 3UMGA 2KSOB 4NY8A 1A0PA 4Y2SA 2E5SA 4UASA 2HHUA 2ESEA 2DL0A 1X42A 2PI5A 3SV3A 1JN3A 2QLTA 1XSNA 4M9LA 9ICOA 1LB2B 4YD1A 4KN7A 4IQWA 1X6IA 2WF9A 2LKYA 4J9MA 2BQUA 2DUYA 1RXWA 1L8OA 7ICNA 3H8WA 4OD0A 3TADA 4GXJA 5J2BA 3RJJA 1IXRA 2KJ9A 3M9OB 4M04A 1ZQFA 3UQ2A 1H38A 4F4WA 4ED1A 1ZQCA 4I2JA 4MF8A 1JX4A 9ICKA 5ALUA 3EYZA 4B6JA 5J29A 2YMMA 1S10A 2G06A 2PXIA 3V7JA 2LPEA 2EZZA 4I2BA 8ICKA 4F50A 3SAHA 9ICQA 1RM6C 2E3TA 1ZD5A 3TANA 4KX5A 4F5QA 3EPIA 8ICIA 1L3TA 2AQ4A 3QUQA 2ZIVB 2C2EA 2DPIA 2F8LA 4IQUA 1D8LA 5KFTA 5AIBA 1TAQA 3GQCA 4KLQA 5AHXA 5CRXA 4PL1A 3MFIA 5KFWA 4UB6U 1S8OA 3AM9A 4DF8A 4Q43A 5KFGA 1B0XA 4KLLA 2LI6A 3KD3A 2LHTA 3BJYA 3TADC 5KT3A 1O08A 4PGXA 1ZQVA 3VC8A 2DFLA 5CA7A 8ICGA 4IRCA 3K1ZA 3AN1A 3H4BA 3PR5B 4DFJA 3Q8PB 3RRGA 3WKCA 1RQLA 5DB8A 4EEKA 1HIWA 1U47A 1NK4A 3JPTA 3BQTA 4O3SA 3BZCA 4CNQA 3RJIA 7ICQA 1ZD2P 3M9MB 5KFEA 5HR7A 3HJEA 3SENA 1LKYB 3QUTA 5KG5A 4F2SA 4NXZA
chains in the Genus database with same CATH topology
2JR5A 2LM4A 1PUZA 1X6IA 1X6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR5 A;  2LM4 A;  1PUZ A;  1X6I A;  1X6J A; 
#chains in the Genus database with same CATH topology
 4DWI A;  5BOM A;  2K89 A;  2E8P A;  5G5H A;  3ED5 A;  3V72 A;  5EE1 A;  4IQT A;  4YMM A;  4MFF A;  1D8B A;  2WF8 A;  2I1Q A;  1ZQM A;  3QU9 A;  5AKL A;  1N5X A;  4CCH A;  2XGQ A;  2BDP A;  2JEG A;  3M6Z A;  3ETR A;  2OEH A;  3L4P A;  3OSP A;  3PO4 A;  5ALW A;  4UBB A;  3Q8S B;  3RJF A;  3PW0 A;  2ZIX B;  5L1J A;  1COK A;  2C22 A;  3M8S A;  5KFQ A;  3NVY A;  4K4G A;  4RPZ A;  3LWM A;  1SKR A;  3T5L A;  4QZF A;  4I2H A;  5KFO A;  3RAQ A;  1L5U A;  3F2D A;  5A0L A;  3BS5 B;  5DGB A;  8ICX A;  1MC8 A;  5KFH A;  5AKG A;  1PZN A;  2XI9 A;  4YG2 A;  4B9T A;  3H8M A;  2E1E A;  4NLK A;  5AK4 A;  3KZX A;  3GZF A;  2YN4 A;  5ALS A;  4Q44 A;  3SYZ A;  2IBK A;  4Y2J A;  2D8C A;  1PK1 B;  5J2K A;  4YXJ A;  3I28 A;  2QAR B;  5ALN A;  2NO4 A;  9ICX A;  3NUQ A;  5J0S A;  2HOF A;  4J9Q A;  1ZQH A;  3HW8 A;  5GTI U;  5KFA A;  3UQ0 A;  5ALH A;  9ICJ A;  2IHN A;  5KT6 A;  1Q3V A;  4F4X A;  4DFM A;  5KT5 A;  2I5H A;  4QZD A;  1SL2 A;  3QEB Z;  1J2N A;  4US8 A;  2MA1 A;  3NGD A;  3ONN A;  3F53 A;  1CRX A;  2PFN A;  2B0C A;  4MF2 A;  3RB3 A;  5AM0 A;  2CN1 A;  3UPQ A;  4ICA A;  4DQS A;  5IIL A;  2YY6 A;  2KN7 A;  4NV0 A;  2DWQ A;  1NNL A;  4AYB C;  5DB9 A;  4DCC A;  3C5F A;  2ASD A;  2PFO A;  2XO7 A;  2CPR A;  3KBB A;  3SR6 A;  3GV5 B;  1FFV A;  4EZ9 A;  2KV2 A;  4Y2Y A;  4ECU A;  4F8R A;  4AP9 A;  3RR7 A;  1DRG A;  2XIC A;  5KFZ A;  1WCN A;  2JEI A;  1OW5 A;  2NRV A;  9ICE A;  2MAX A;  2M0N A;  1RXV A;  7ICH A;  1J2M A;  4ED8 A;  3ZDD A;  3OGU A;  2KSO A;  3MFH A;  4C4R A;  1KEJ A;  5TIS U;  2YMP A;  2ZUD A;  4F5N A;  7ICG A;  3AMZ A;  3PY8 A;  1BPB A;  1RPL A;  1UQV A;  4BXO B;  5JTI A;  3GII A;  4Z6D A;  3T3F A;  2UVV A;  1JRP A;  5AIC A;  2WAQ F;  4FBT A;  1ZYQ A;  2FE9 A;  4M47 A;  5AKX A;  4TQR A;  4F91 B;  4ECS A;  3WK6 A;  2F44 A;  5TZV A;  4BDP A;  1Z1B A;  2HBL A;  2JH1 A;  1V97 A;  4QZE A;  2WAQ C;  1N5W A;  3WK8 A;  3H40 A;  5ALM A;  4ECR A;  8ICE A;  1VLB A;  3IDW A;  2DPJ A;  5KT7 A;  5L1K A;  2G07 A;  3QE9 Y;  3N4M B;  5J2D A;  4ED0 A;  2JV3 A;  4B9U A;  1N62 A;  4QZI A;  1RYR A;  3PW5 A;  1HUO A;  4HAI A;  4FZL A;  3UM9 A;  3ZDB A;  1DGJ A;  1NKE A;  1QSS A;  7ICS A;  2JGA A;  2C2D A;  5AIA A;  4FZN A;  1A6S A;  9ICR A;  5ALY A;  1ZJM A;  2VAN A;  2KNJ A;  2ZIV A;  1B22 A;  2HBM A;  1K1Q A;  2KTQ A;  1B4F A;  1V38 A;  4UB1 A;  4F5O A;  5HMM A;  4ELT A;  4EX6 A;  1X6J A;  5CWR A;  1N56 A;  4CF3 A;  5AKK A;  2WF5 A;  4KLE A;  2C2R A;  3TAP A;  1ZQL A;  3G6V A;  5AI4 A;  4UB8 U;  2BPC A;  5H2F U;  4A8E A;  1S0N A;  4RUC A;  1L6N A;  2BCU A;  4C7Z A;  5J0X A;  4RU9 A;  3AQE A;  4NLC A;  2V4Q A;  3ETL A;  2DQN B;  4ED7 A;  1BPD A;  3RB0 A;  2KZM A;  3RB4 A;  2M9N A;  2Y9U A;  4I27 A;  2KKV A;  3RTV A;  3SD7 A;  3IG8 A;  1WCL A;  2NRZ A;  1GO3 F;  5ALK A;  5EWE A;  3WK5 A;  4O5E A;  1SXD A;  3T5J A;  1BNO A;  4PHD A;  3FC4 A;  5T14 A;  1DK2 A;  4P4O A;  1LKY A;  4Q8F A;  8ICT A;  4J03 A;  3RJE A;  3KHR A;  1SXE A;  8ICQ A;  5J2G A;  1IIP A;  2A1A A;  4Z6F A;  1V85 A;  2EH9 A;  7ICM A;  1TAU A;  2W3S A;  4Y2U A;  5E79 U;  1S5L U;  3HIL A;  3PSF A;  3RRH A;  4DLE A;  2PFP A;  3LWL A;  2VIX A;  1DOQ A;  4UAU A;  4OJO A;  1Z4O A;  4BGD A;  4C7Y A;  4GFJ A;  4GC7 A;  4EBE A;  1QSL A;  3PR4 A;  1Z00 A;  8ICB A;  2KZ3 A;  9ICT A;  4R65 A;  1K1S A;  2KOB A;  3DEE A;  5KL8 B;  3QUC A;  3G6Y A;  3SZ2 A;  1BPE A;  1QLN A;  3PW4 A;  3L3F X;  2FI1 A;  3B9J A;  3QU5 A;  3JPP A;  2W8L A;  3IHQ B;  2ZIX A;  1XS9 D;  4DS5 A;  5DG7 A;  4RQ4 A;  1LV5 A;  2YX8 A;  4JK1 A;  2Y0S F;  3CP8 A;  4DEZ A;  1PVQ A;  3WK7 A;  5DGA A;  4KLM A;  1NZP A;  5DG9 A;  3KOO A;  2ZJ8 A;  1DXS A;  2EAP A;  4K4H A;  5L1M A;  4FBU A;  4DFD A;  2FPM A;  1QQ7 A;  2ZTE A;  2JRZ A;  2ZJ5 A;  1MA7 A;  8ICV A;  4IC9 A;  1ZD3 A;  3A0H U;  1L3U A;  4B9M A;  1Q3U A;  2W7O A;  4B9V A;  8ICR A;  3H8S A;  4KLO A;  1PK1 A;  5KFJ A;  2KVC A;  1O03 A;  3O0F A;  5AI9 A;  2ASJ A;  3N97 B;  2KIC A;  4F93 B;  1ZQS A;  5AKI A;  2AGQ A;  1ZQZ A;  5ALG A;  2QKQ A;  2Q0Z X;  1X40 A;  5ALJ A;  1PVR A;  4OJP A;  4BWJ A;  3V7L A;  4MFC A;  3Q8L A;  5KTQ A;  4C8O A;  2BCQ A;  4J9R A;  7ICI A;  1T7P A;  3OPX A;  3LK9 A;  4KLU A;  2H3V A;  3FYH A;  4ZH4 A;  5EE0 A;  1RQN A;  1S97 A;  1TVA A;  4I2G A;  2N1R A;  3D2Q A;  4Y2Q A;  3OHA A;  1ZQG A;  5KG3 A;  5HHH A;  2I9G A;  2L5Y A;  3OTQ A;  4WJ3 B;  4KLT A;  4QZ9 A;  5FP0 A;  4Q8E A;  4GLX A;  5KG6 A;  2GOL A;  1QQ5 A;  3PSI A;  4PZN A;  4G3I A;  4OJ6 A;  5DQG A;  3F5A A;  2KK0 A;  1P7D A;  3SEI A;  4I2A A;  2HSZ A;  3THV A;  9ICM A;  2JXJ A;  3T5K A;  4I2E A;  2OM6 A;  3GIJ A;  1LVH A;  2OYY A;  4Y2P A;  3NAS A;  4PGQ A;  2MSN A;  2WB1 F;  4DSE A;  1NOM A;  3LVV A;  1UT8 A;  3PV8 A;  1SV4 A;  2RQ5 A;  1KSP A;  4BXO A;  4QWB A;  1WWU A;  5D49 A;  1V9P A;  2KD1 A;  2IOF A;  3TFS A;  3HKZ C;  4PGY A;  2RRD A;  2WB1 C;  2EAM A;  4O5K A;  2HHT A;  2XCP A;  1COO A;  3KHG A;  3KKA A;  3RFA A;  4JMU A;  2W8K A;  2VKQ A;  5AM1 A;  4UQG A;  2F1I A;  2JEJ A;  4DSI A;  4ECY A;  5ALV A;  9ICB A;  4KLJ A;  5J2E A;  2W9B A;  3GV8 B;  1UPH A;  3M1Y A;  3E2E A;  3K4G A;  2ES6 A;  2AXT U;  5KFB A;  3IP4 B;  5DLF A;  2HVI A;  2E1F A;  5ALP A;  4YN4 A;  1Q8K A;  4Z6E A;  5BPC A;  4IR1 A;  4RNN A;  3MC1 A;  4CF4 A;  9ICI A;  1SWW A;  2K8B B;  4CRX A;  3IN5 A;  4IRD A;  1WWV A;  1PK3 A;  5HR6 A;  3TAQ A;  4I29 A;  8ICS A;  1L3V A;  3H0M B;  4EEL A;  5J0U A;  4QWE A;  5EOZ A;  4DL7 A;  4QZA A;  7ICR A;  3PML A;  7ICJ A;  3PW7 A;  4ECX A;  2VJ5 A;  5AI0 A;  5AK3 A;  5J0Q A;  3GDX A;  7ICE A;  2BR0 A;  1NJX A;  4M6W A;  1YZ7 A;  5GTH U;  1SZP A;  2EZY A;  5DQH A;  2FMS A;  4F4K A;  3H0L B;  2NRW A;  1S77 D;  4UAY A;  1NJW A;  4B9N A;  4YR0 A;  2Z7J A;  5ALI A;  8ICH A;  3FDS A;  5L1I A;  1KTQ A;  4I2I A;  5KFM A;  5G5G A;  1NKC A;  2HCF A;  4RQN A;  1MQ3 A;  1PUZ A;  3T79 A;  1Z00 B;  2FMP A;  2ZTC A;  2B6G A;  5J2F A;  2AQ0 A;  4UB2 A;  2KEY A;  4I2D A;  2BPF A;  3T5H A;  1BNP A;  5EWG A;  4RNO A;  2FMQ A;  1UCV A;  1MSW D;  9ICA A;  3JPN A;  2W3R A;  3C5G A;  2R8G A;  2FLP A;  1TK5 A;  4IS7 A;  2KHQ A;  2WF6 A;  4US9 A;  4RNM A;  3H8J A;  1L3S A;  9ICS A;  4UB4 A;  3PX6 A;  3MR5 A;  2W11 A;  2HHQ A;  2KVS A;  1XSL A;  4M9G A;  4GXK A;  4FS1 A;  4DL6 A;  2ZIW A;  3NVW A;  3MBY A;  3ZDE A;  1D9D A;  8ICZ A;  4XUS A;  3GV7 B;  1D8Y A;  2F1H A;  2V4R A;  4DL4 A;  2HHV A;  4KMU A;  3C2K A;  2MUT A;  4M0A A;  3BQ7 A;  9ICH A;  4ECV A;  3QUB A;  5J2H A;  2H5X A;  5AM3 A;  2Q4T A;  4XQ8 A;  3TAR A;  3QZ7 A;  4DOB A;  5III A;  5DB7 A;  5AKZ A;  5AI5 A;  1RYU A;  3Q8Q B;  2RDJ A;  2VA8 A;  5ALD A;  4C80 A;  8ICJ A;  4I28 A;  4P4P A;  4AYB F;  3OJS A;  2WTF A;  5CEH A;  2GLE A;  4CGZ A;  2BCR A;  1IV8 A;  2LYB A;  2VA2 A;  1SKS A;  5KFC A;  5DB6 A;  4YR3 A;  2NV3 A;  4CDG A;  4R8U A;  5JUM A;  2BQ3 A;  2XID A;  1TFR A;  2KIW A;  3ISC A;  5KFL A;  2LBO A;  3HP6 A;  3K1R B;  4I2F A;  5AKE A;  4IRK A;  4GXI A;  3I76 A;  2W55 A;  4UBC A;  5AK6 A;  4F4Z A;  5J2I A;  2CRX A;  4RQ3 A;  5KFI A;  3NRW A;  1AQ6 A;  3PW2 A;  4IR9 A;  1BVS A;  7ICU A;  2NYV A;  5CHG A;  1KDH A;  4EEY A;  4O9M A;  1ZRM A;  1PVP A;  1ZD4 A;  1NJY A;  2PMZ C;  4NM2 A;  2UVW A;  4DSJ A;  4F71 A;  1OXJ A;  4UB5 A;  1U49 A;  8ICN A;  3QNM A;  2HVH A;  1SB3 C;  3PNC A;  4HYK A;  1MQ2 A;  2H3I A;  5CJ7 A;  3V6K A;  2Y1J A;  3C21 A;  3B0Y A;  5KFR A;  1IG6 A;  1ECW A;  5AM2 A;  4QZB A;  3N7P D;  4DSF A;  2W54 A;  4ELV A;  4DOA A;  2AGO A;  5DDY A;  5AKY A;  3QYP A;  4XRH A;  1ZJN A;  5ALT A;  3RBE A;  9ICL A;  4XA5 A;  3D6J A;  2W9B B;  2YMQ A;  5ALE A;  4PZO A;  4C8M A;  5KFU A;  5HHI A;  5BOL A;  2OWO A;  2IOF K;  2DKZ A;  5KNI A;  4Y2X A;  4RQ8 A;  3QU7 A;  2ZUC A;  3ZD9 A;  4KLH A;  3BDP A;  4RQ0 A;  2K60 A;  4MHV A;  4FO6 A;  2J6T A;  5KG2 A;  5DLG A;  5IIN A;  1HEK A;  3SAG A;  4RQ5 A;  3Q8R B;  4KLD A;  1F44 A;  3L5K A;  1KN5 A;  3KHH A;  1Q46 A;  3IM1 A;  3PO5 A;  2WFA A;  2P35 A;  1C7Y A;  1ZOL A;  3CW2 C;  4J9P A;  4EZ6 A;  2KIV A;  4P0Q A;  2ZIU B;  5B66 U;  4Y2T A;  3V6H A;  3DDH A;  4PHA A;  4KLF A;  4GIB A;  4DOC A;  1ZQD A;  1JI7 A;  4M6W B;  4QJF B;  9ICC A;  3ALR A;  1ZQE A;  3QZ8 A;  4DLG A;  3NTU A;  1ZQX A;  4FZM A;  4Z6C A;  3A0B U;  4BJQ A;  4YR2 A;  5J0P A;  3NRZ A;  4ECT A;  1ZQI A;  2F3N A;  2VA3 A;  1XWL A;  4QZG A;  4I2C A;  3RF9 A;  3ZDA A;  4Y2R A;  3TFR A;  1YZ6 A;  4P2H A;  1Z3E B;  1NZB A;  2MU2 A;  8ICF A;  1SGG A;  3F2B A;  3S6J A;  4R66 A;  5KAI U;  2BCS A;  2XY5 A;  3JPO A;  2XC9 A;  3RBD A;  5K4L A;  2R8I A;  9ICN A;  1D9F A;  1KLN A;  4O3R A;  3N7R C;  3D2S A;  1WG8 A;  9ICV A;  3AUO A;  1L7O A;  4BWM A;  2ZIW B;  3JPQ A;  1X9X A;  1JUD A;  2PFQ A;  3OJU A;  2EQY A;  4J9O A;  2HOQ A;  1BPZ A;  1SIJ A;  2YTU A;  4RQM A;  4YMN A;  2MUT B;  2KFN A;  2W03 A;  1KL9 A;  1XO0 A;  2G5I B;  1NK9 A;  5JU5 A;  3C2L A;  3RAX A;  5HNK A;  1ZQY A;  3E0F A;  3H0R B;  2Y1I A;  4GC6 A;  2YB4 A;  2DF4 B;  4DSK A;  3QX7 A;  4MFA A;  1VJ5 A;  4G9B A;  4EYI B;  5AI8 A;  1N63 A;  1UHU A;  4LZD A;  2K8A A;  2F77 X;  2ZUB A;  2EDU A;  3R9K A;  1RDF A;  1KFS A;  4IQV A;  3QU2 A;  8ICO A;  4KMO B;  1S0V A;  2W9A A;  5J0O A;  5ALF A;  2QB0 A;  3CYM A;  3GIL A;  2ZG6 A;  4OCZ A;  5B5E U;  3PX4 A;  1ZQN A;  3MR2 A;  3ZI4 A;  1RG6 A;  4RQ2 A;  4YFK A;  3C2M A;  4R8U B;  3F5E A;  4PH5 A;  4PHE A;  4JUZ A;  4C8K A;  2RLT A;  2IOH A;  4NM1 A;  1FIQ A;  3E58 A;  3B0X A;  1TAM A;  1X66 A;  2A1J A;  1NK0 A;  2K4H A;  3ICX A;  4EBC A;  3QEA Z;  2OHF A;  1Z1V A;  1CUK A;  2BCV A;  4F72 A;  1ZQW A;  4DL5 A;  4RUA A;  2ALZ A;  2AJQ A;  1HJP A;  2K4E A;  1ZXI A;  2EAN A;  2G09 A;  4RT2 A;  3RH6 A;  2JHD A;  3M8R A;  3SMV A;  1KKX A;  1KBU A;  5KFV A;  4OO1 J;  3JPR A;  4E0D A;  5J2C A;  2W9M A;  2IHM A;  3Q8K A;  3GFK B;  4KX3 A;  4ELU A;  4UAV A;  5KFD A;  3GIM A;  4EYH B;  1BGX T;  1QQ6 A;  2HI0 A;  4JWN A;  3TAC B;  3MGV A;  2Y9T A;  2A3V A;  2C28 A;  1ZQA A;  2RHF A;  5DDM A;  1X9W A;  1T94 A;  4DL2 A;  1ZQR A;  3EWA A;  2LM4 A;  5CP2 A;  4O0I A;  2R8J A;  4YVZ A;  2F2A B;  5EE3 A;  3HKZ F;  1KFT A;  4R64 A;  3UXN A;  2OCE A;  4FS2 A;  4NLB A;  2P66 A;  7ICL A;  4QZC A;  1SL1 A;  5C0Y A;  2JR5 A;  5L9X A;  4YCX A;  3KFU F;  3QU4 A;  8ICC A;  3UXP A;  2JMG A;  5EWF A;  5KT4 A;  1QH9 A;  4QW8 A;  3PZP A;  2HW3 A;  3MAB A;  5J0R A;  4TUS A;  1ZQ1 C;  4Q45 A;  2B21 A;  1N48 A;  1M6Y A;  2XGP A;  4P0Q B;  3RR8 A;  4KN4 A;  3HRD D;  1U45 A;  1NKB A;  4B9L A;  4P0P A;  1XNS A;  1ZQB A;  4FFD A;  5J0W A;  1TE2 A;  3UMC A;  1RZT A;  4F92 B;  1IM4 A;  3TI0 A;  1S76 D;  1KQQ A;  3JPS A;  1ZQJ A;  4ED6 A;  3MDC A;  3RJG A;  1X9S A;  1U48 A;  4F3O A;  2DKX A;  5IIJ A;  5KL1 B;  3H4D A;  4YMO A;  2ZXI A;  3BQ1 A;  5KFP A;  7ICF A;  4RT3 A;  3V7K A;  3EZ5 A;  3CRX A;  4C8L A;  4QNL A;  2ASL A;  2D3D A;  3HX0 A;  2V9W A;  3F2C A;  4YD2 A;  2RDI A;  2W04 A;  4NLN A;  1EXN A;  3RJH A;  4NWI A;  4DQI A;  5DKW A;  2G5H B;  2W9C A;  4PL2 A;  2BGW A;  5KFK A;  2P6U A;  2ZIU A;  3KZI U;  5F3X B;  2JH7 A;  2JEF A;  2D6F C;  4QIW F;  1L7N A;  2PI4 A;  1YT3 A;  3ZDC A;  4YXM A;  3WU2 U;  2BPG A;  2FLN A;  1JIH A;  5AM4 A;  2NRT A;  3PVX A;  2ISO A;  5IIO A;  5KFF A;  1KW4 A;  4DQQ A;  4F5R A;  1OUQ A;  7ICT A;  5KT2 A;  3WKA A;  1TKD A;  3KKA C;  4QIW C;  1URJ A;  4UAZ A;  5AM5 A;  2IMW P;  5D4B A;  8ICL A;  3BZK A;  5KG1 A;  3UXO A;  3U26 A;  8ICA A;  2OXO A;  4RQ7 A;  4YQW A;  2E8M A;  4LVS A;  8ICY A;  5F9N A;  2K4I A;  4F2R A;  2KZZ A;  2A19 A;  3EPG A;  1F5S A;  8ICU A;  9ICU A;  2O6K A;  1SKW A;  4M9N A;  2R8K A;  2HBJ A;  2KE7 A;  2QB0 B;  1JMS A;  1UT5 A;  2J6S A;  4DF4 A;  2MRL A;  3SAF A;  1ED1 A;  2F8K A;  4RZR A;  1L7M A;  1NK8 A;  3SQI A;  7ICK A;  4U7C A;  2XY7 A;  4M9H A;  4TUQ A;  5IIK A;  5J0Y A;  2K4P A;  2BHN A;  4QW9 A;  2RP5 A;  3NS1 A;  4DQR A;  1BPY A;  1JRO A;  3NVV A;  3C28 A;  4ED3 A;  4UW9 A;  4O5C A;  9ICW A;  2A1J B;  9ICP A;  4O3Q A;  2EAO A;  1QSY A;  5KFS A;  3C1Y A;  2KFZ A;  5AKH A;  2VJ4 A;  3G6X A;  3HPO A;  2NO5 A;  4UAR A;  3HWT A;  4PHP A;  1T4G A;  4DFK A;  5AKJ A;  1L8L A;  2W7P A;  1J97 A;  2FLL A;  3I1Y A;  3ISD A;  2ZXH A;  3UMB A;  3LDA A;  4C0Z A;  3LVW A;  4J9S A;  4LJX A;  2JZB B;  2ZJA A;  4JWM A;  3EUB 2;  3BQ2 A;  4O3P A;  4RPX A;  4JV1 A;  5JRT A;  3AEV A;  5KG7 A;  2IA6 A;  3PSP A;  4QWC A;  2YQE A;  3DV9 A;  3IG5 A;  1SV0 A;  2R18 A;  5C5J A;  4RPY A;  4RQ6 A;  4TUR A;  3RH4 A;  2PMZ F;  3N28 A;  1SWV A;  3J81 j;  1ZQT A;  4BUG A;  1XO1 A;  1Y88 A;  3WKB A;  9ICF A;  5L1L A;  5ALQ A;  3KTQ A;  9ICG A;  3GIK A;  1NK5 A;  2AH5 A;  4R63 A;  1TV9 A;  1BPX A;  2NRX A;  5ALO A;  1T3Q A;  3C29 A;  1T3N A;  2EZX A;  2KG5 A;  4NJ8 A;  2BDU A;  4MEX A;  2J6U A;  4B9S A;  1ZQQ A;  3OHB A;  3RJK A;  1U4B A;  1QTM A;  4QZ8 A;  5DBC A;  2ODG A;  5F9L A;  1X9M A;  3FM9 A;  5DBA A;  3MGI A;  3CNH A;  2GH1 A;  4JB3 A;  3MGH A;  3FAH A;  2AHO B;  2FJ6 A;  4KLI A;  2K8C B;  3AU6 A;  5J8Y A;  3IV6 A;  3SV4 A;  3WK9 A;  4P0P B;  2F76 X;  2W43 A;  1MN8 A;  2XCA A;  1ZQO A;  1SV0 C;  2FDR A;  2P6R A;  2KKP A;  4OJ5 A;  1SL0 A;  3MR3 A;  2YML A;  2HBK A;  3BQ0 A;  5EE9 A;  3M6K A;  4KLS A;  4CF5 A;  4JV2 A;  3WKD A;  2R8H A;  2ATL A;  3AL0 B;  1Z4N A;  3EW9 A;  3WKE A;  5AK5 A;  2ISP A;  2LYA A;  1NK6 A;  2HHS A;  4RQ1 A;  2KP7 A;  1UA1 A;  1CEZ A;  2GO7 A;  1VDV A;  2LMR A;  1B43 A;  2W9C B;  1ZQP A;  4DO9 A;  4EBD A;  1KFD A;  2FPL A;  4NL9 A;  4NLZ A;  1K5O A;  4J9L A;  7ICO A;  4C4T A;  2BZF A;  1UA0 A;  1N2X A;  3LYS A;  2PKE A;  4MEY A;  5IIM A;  2BKE A;  5KG0 A;  5CR0 A;  4O3M A;  5CB1 A;  4PJ0 U;  5ALX A;  2E8O A;  4O3O A;  2WF7 A;  1NJZ A;  2E8N A;  1DK3 A;  1JXL A;  3QXG A;  4J9K A;  4FE3 A;  4ECW A;  5J8Y C;  4ECQ A;  2WHE A;  2H3F A;  3IRU A;  4Y2V A;  1F0M A;  1N60 A;  3RB6 A;  1NK7 A;  1WUD A;  2G08 A;  4JV0 A;  2UVU A;  1N61 A;  2DGZ A;  4DFP A;  4K4I A;  1ZET A;  4QWA A;  1JXE A;  1QCK A;  4TUP A;  1XSP A;  3MDA A;  3VCB A;  3WK4 A;  2H3Q A;  2F1J A;  4EEN A;  1ZQK A;  3KHL A;  3ZD8 A;  2KHV A;  8ICM A;  1XC9 A;  1Z19 A;  4UB3 A;  3V6J A;  2G0A A;  1FFU A;  1TK8 A;  5D46 A;  4ECZ A;  5DBB A;  1S0M A;  5HML A;  1KRP A;  1X2I A;  1ZRN A;  2LYH A;  3N7S C;  5J0T A;  4KIT B;  1DGS A;  3RH5 A;  2GWS A;  4U6P A;  3M7D A;  2DBY A;  5KAF U;  2HHW A;  2OH2 A;  1T8E A;  4C4S A;  4NL9 C;  4X5V A;  2HOI A;  5KFY A;  2LM1 A;  4UAT A;  2XY6 A;  1JAL A;  1NI3 A;  4QZH A;  4IL6 U;  4DQP A;  1FO4 A;  5KFN A;  4UAW A;  4ZOH C;  3H7I A;  3ISB A;  5DG8 A;  3NVZ A;  3PST A;  4F5P A;  7ICP A;  3Q8M A;  2FPK A;  5KFX A;  3K75 D;  1XU4 A;  5ALZ A;  2I6X A;  4DS4 A;  4EX7 A;  3AU2 A;  1WYG A;  3GU3 A;  2YB1 A;  3AQF A;  2H3Z A;  3HT3 A;  3D2N A;  3TQ1 A;  4OJL A;  3BS7 A;  4C8N A;  2HDO A;  4KTQ A;  1FEZ A;  8ICP A;  2KJ8 A;  2KJ5 A;  4DL3 A;  7ICV A;  4P4M A;  5J2J A;  4QWD A;  4CE6 A;  2XVT A;  4LZG A;  2KMD A;  4PPX A;  2AU0 A;  5J2A A;  1CI4 A;  5HP4 A;  3C23 A;  5DQI A;  2UVR A;  1S9F A;  5AI6 A;  3M9N B;  3ORY A;  3BS5 A;  3TKA A;  4O3N A;  1A76 A;  4ACO A;  3PMN A;  4ED2 A;  3C1Z A;  4M2Y A;  2Y0S C;  4M9J A;  5ALR A;  2AGP A;  3MR6 A;  3PX0 A;  3SI8 A;  5KG4 A;  2ZTD A;  5ALL A;  2BQR A;  1A77 A;  8ICW A;  3OSN A;  2QAR A;  1ZQU A;  1TK0 A;  2HMX A;  4USA A;  2HHX A;  4F4Y A;  4J9N A;  4DSL A;  2CXY A;  2JZB A;  1ARO P;  4NLG A;  2QB1 A;  4YP3 A;  1S0O A;  1L7P A;  1SZH A;  4TQS A;  4BX9 C;  1RYS A;  1U9L A;  1HUZ A;  4KLG A;  1C20 A;  3UMG A;  2KSO B;  4NY8 A;  1A0P A;  4Y2S A;  2E5S A;  4UAS A;  2HHU A;  2ESE A;  2DL0 A;  1X42 A;  2PI5 A;  3SV3 A;  1JN3 A;  2QLT A;  1XSN A;  4M9L A;  9ICO A;  1LB2 B;  4YD1 A;  4KN7 A;  4IQW A;  1X6I A;  2WF9 A;  2LKY A;  4J9M A;  2BQU A;  2DUY A;  1RXW A;  1L8O A;  7ICN A;  3H8W A;  4OD0 A;  3TAD A;  4GXJ A;  5J2B A;  3RJJ A;  1IXR A;  2KJ9 A;  3M9O B;  4M04 A;  1ZQF A;  3UQ2 A;  1H38 A;  4F4W A;  4ED1 A;  1ZQC A;  4I2J A;  4MF8 A;  1JX4 A;  9ICK A;  5ALU A;  3EYZ A;  4B6J A;  5J29 A;  2YMM A;  1S10 A;  2G06 A;  2PXI A;  3V7J A;  2LPE A;  2EZZ A;  4I2B A;  8ICK A;  4F50 A;  3SAH A;  9ICQ A;  1RM6 C;  2E3T A;  1ZD5 A;  3TAN A;  4KX5 A;  4F5Q A;  3EPI A;  8ICI A;  1L3T A;  2AQ4 A;  3QUQ A;  2ZIV B;  2C2E A;  2DPI A;  2F8L A;  4IQU A;  1D8L A;  5KFT A;  5AIB A;  1TAQ A;  3GQC A;  4KLQ A;  5AHX A;  5CRX A;  4PL1 A;  3MFI A;  5KFW A;  4UB6 U;  1S8O A;  3AM9 A;  4DF8 A;  4Q43 A;  5KFG A;  1B0X A;  4KLL A;  2LI6 A;  3KD3 A;  2LHT A;  3BJY A;  3TAD C;  5KT3 A;  1O08 A;  4PGX A;  1ZQV A;  3VC8 A;  2DFL A;  5CA7 A;  8ICG A;  4IRC A;  3K1Z A;  3AN1 A;  3H4B A;  3PR5 B;  4DFJ A;  3Q8P B;  3RRG A;  3WKC A;  1RQL A;  5DB8 A;  4EEK A;  1HIW A;  1U47 A;  1NK4 A;  3JPT A;  3BQT A;  4O3S A;  3BZC A;  4CNQ A;  3RJI A;  7ICQ A;  1ZD2 P;  3M9M B;  5KFE A;  5HR7 A;  3HJE A;  3SEN A;  1LKY B;  3QUT A;  5KG5 A;  4F2S A;  4NXZ A; 
#chains in the Genus database with same CATH homology
 2JR5 A;  2LM4 A;  1PUZ A;  1X6I A;  1X6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...