2JR5A

Solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MYTAEQKARIKWACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNLSKVRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of UPF0350 protein VC_2471.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
molecule keywords UPF0350 protein VC_2471
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2jr5A00
1X6IA 2JR5A 1X6JA 1PUZA 2LM4A
chains in the Genus database with same CATH superfamily
1SWVA 3SI8A 2FMSA 4A8EA 5J2HA 2NRTA 2KKVA 1L3UA 2ALZA 4KLUA 2PMZC 2DBYA 5ALFA 2A1AA 2AQ0A 4DS5A 1SWWA 4RT2A 3KHHA 2Y9UA 4O3SA 4DOAA 1MQ3A 2ATLA 4JB3A 5AI9A 4CF5A 2R8GA 3RAXA 1L3SA 1KRPA 4ED0A 4O9MA 4EBDA 2FI1A 4UBBA 2EAMA 5IIOA 4CRXA 2YB1A 4RQ3A 1ZQNA 2MUTA 3KFUF 1NKEA 3NVVA 1J97A 3Q8MA 2I6XA 4Q43A 2MSNA 1NKCA 2N1RA 1X9MA 7ICVA 1N61A 3BZCA 1IV8A 4UB8U 2J6TA 1CRXA 1XU4A 1WYGA 4I2JA 4JUZA 4DOBA 3DV9A 3K4GA 2OHFA 2KSOB 4ELTA 9ICBA 3H7IA 1BPYA 1LKYB 3V6JA 4MHVA 4C4TA 5AI5A 4IL6U 2K4HA 5DBCA 1S0MA 2FLNA 5EOZA 2JHDA 1SV4A 2PFNA 4Q8FA 3PX0A 5ALVA 1LB2B 7ICEA 5J2EA 1N48A 2W9AA 7ICTA 4US9A 4ECUA 2KE7A 1A6SA 5KG5A 2IOHA 4J9MA 2AHOB 2KJ9A 2YB4A 3V6KA 1MQ2A 4I2HA 1JXEA 1MA7A 2NYVA 1S0OA 3QX7A 4BXOA 1ZQTA 2KK0A 3RTVA 5KFSA 2YMLA 2FMPA 4O3MA 3RH4A 1X66A 4JV0A 3PSTA 5L9XA 2D8CA 3N28A 4AYBF 1WWUA 4RPXA 3F2DA 2QARA 4F2RA 4UAVA 5JUMA 3LK9A 5J2KA 2YQEA 3JPSA 1QH9A 4RZRA 1SZPA 1DK3A 5AK4A 2ASJA 2JMGA 1RG6A 3AQFA 2XC9A 8ICCA 3IG5A 5JU5A 2RHFA 3TI0A 9ICIA 9ICKA 7ICSA 1Y88A 4YD1A 1ED1A 1X6IA 4O3PA 4KTQA 4ED8A 4DL4A 3SMVA 4J9RA 3GZFA 2K4IA 4EENA 3BQTA 5KFRA 5G5HA 1TVAA 1ZQHA 4YMMA 4TQSA 2DKXA 2RLTA 2ZIWB 8ICVA 4I27A 7ICJA 8ICQA 1XO0A 4CF3A 1TFRA 4F4YA 1ZQYA 5DG9A 1N60A 4Y2RA 3THVA 4XQ8A 3RBEA 1V97A 5EE3A 4RNMA 5KFKA 4C8MA 1ZQAA 4F4KA 1N62A 5KG3A 1KKXA 1SGGA 3NUQA 3WKDA 5HP4A 4YQWA 5KT3A 4DFPA 3SV4A 4DL5A 1ZYQA 3V72A 3AL0B 1PK1B 3SYZA 4QWCA 1X9SA 5C5JA 2KZZA 5AKEA 4KLLA 2Z7JA 3EZ5A 2KHVA 2RDJA 3QYPA 2KHQA 2JGAA 4RQMA 2K8CB 4FZNA 4KLSA 1PK1A 2W55A 3MGIA 1ZQFA 4QNLA 2HOQA 4DCCA 4PJ0U 3UXOA 3TACB 2W9BA 8ICZA 2ASLA 2QLTA 5A0LA 5DLFA 2K8BB 8ICHA 5FP0A 1JIHA 3HJEA 2KN7A 2XCAA 4YMOA 8ICAA 4M9GA 4U7CA 4PGXA 1VDVA 4M9NA 1NK6A 4KX3A 1UT8A 1T7PA 3BDPA 4F5OA 8ICJA 1NOMA 1TK0A 7ICPA 3TANA 1YZ6A 3ISBA 4YVZA 2HHSA 1TAUA 5J0OA 3RFAA 3C21A 1ZQXA 2JEGA 4IRCA 4M6WA 1GO3F 1X2IA 9ICLA 3KBBA 4DSJA 2LM1A 5F3XB 5CEHA 1RQNA 3I28A 1ECWA 5DG8A 1OXJA 7ICQA 1DGJA 4P0QB 4QZAA 2J6SA 2Y1JA 3GIJA 5AKLA 2UVUA 5J2FA 4UB4A 4DSLA 3OGUA 2G06A 2DKZA 1JRPA 4C8NA 1N5WA 2HHQA 3EUB2 1OUQA 1WCNA 1RYUA 3G6YA 3H40A 4XRHA 3L5KA 3UXNA 1XS9D 1ZXIA 4O3OA 3MDCA 5ALLA 2EAOA 4M47A 4EBEA 1A77A 1J2NA 3RB4A 2BPGA 1L7OA 2JEJA 5B5EU 3UMCA 4GFJA 4F2SA 5KFEA 3ZD9A 4YR2A 1L8OA 5KFTA 2C28A 2NRVA 5KL8B 5KFVA 2VIXA 3PR4A 3T5JA 1YZ7A 3UQ2A 4C4SA 5J0YA 4TUSA 3RJJA 1SL1A 4QZDA 2D6FC 3IM1A 1ZQOA 4QZIA 5HNKA 5AM0A 2FE9A 2KVSA 1B22A 2BQRA 2E1FA 2ESEA 1WCLA 2VA3A 3RJKA 4NXZA 5J0TA 1RYRA 1OW5A 2HI0A 4QWAA 2A19A 4YN4A 3OJSA 1L7NA 5AIBA 8ICGA 4RQ1A 5GTHU 7ICIA 2P6UA 4AP9A 2M0NA 1SXDA 2OM6A 2ZXIA 4QIWC 3SAGA 5ALSA 2KVCA 3RR7A 1SL0A 5DB6A 3LYSA 4UB1A 1LVHA 4BWMA 4NLCA 3RRGA 4RQNA 2HHTA 3Q8KA 5KAIU 4J9OA 3GQCA 4JV1A 3ZDEA 3WU2U 4DFJA 3OPXA 9ICMA 1ZD5A 1MSWD 4CF4A 4J9SA 2HBJA 5CRXA 2A3VA 4QZCA 4MEYA 3RJFA 5E79U 3LWLA 1Q8KA 4ECYA 2JEIA 2DPIA 1HJPA 4I28A 5HMMA 5CR0A 2ZIUB 5EWEA 4CDGA 1TKDA 9ICHA 2XVTA 1NJXA 4GC6A 1TE2A 2LPEA 3V7JA 2GWSA 4JWMA 1RM6C 1N63A 4GLXA 3RB6A 4R64A 5CA7A 4IQVA 4F93B 5KT2A 2IMWP 3J81j 2WB1F 5KG0A 4GXIA 1SIJA 2K4PA 1Z00B 3DEEA 2R8HA 3D2NA 4CGZA 2OWOA 4OCZA 1COOA 4DQQA 1T3NA 7ICNA 2ZIXB 4Q45A 5BOLA 8ICTA 2ISPA 4PHPA 2WF9A 4UW9A 3M1YA 2EANA 2EZYA 2E3TA 1U49A 4NY8A 1HIWA 2R8JA 4K4GA 4OO1J 5DGBA 2DWQA 2IOFK 4GXJA 4KLIA 3H0MB 3PSFA 4O5CA 5AI8A 1XSLA 5DQGA 5K4LA 2HVHA 2B6GA 5KFJA 3IRUA 1DRGA 9ICOA 4EYIB 2NRWA 5DDMA 2W8LA 1FO4A 5D4BA 4BGDA 2IHMA 2F1IA 2AU0A 4R66A 4EELA 7ICOA 1D9DA 4KLEA 4G3IA 4FZMA 3D2SA 5DB7A 3NRZA 1PVRA 4RQ2A 1SZHA 2ZIWA 2IA6A 1TAQA 1XO1A 3OTQA 2P6RA 1KL9A 2V4QA 3GIMA 3NGDA 4LJXA 3GIKA 1B0XA 1ZQVA 3RJIA 5AI6A 3E0FA 4YFKA 2G09A 1JUDA 4PZNA 5J2CA 4Y2YA 2RRDA 3SENA 3C2KA 2BPCA 1T94A 2CRXA 5KFDA 1U4BA 2GLEA 2BR0A 8ICNA 2W54A 1WUDA 3F2CA 1U48A 3L4PA 4ED3A 2RDIA 4DFMA 2KICA 3H8SA 4NLKA 4QZBA 4GC7A 2RP5A 2KEYA 1QTMA 1KFTA 4CCHA 4OJ6A 5F9NA 4ZH4A 4DSFA 1ZQWA 1KEJA 5ALZA 2WB1C 4FZLA 4Y2TA 3KZXA 1A76A 4B6JA 2C22A 1ZJMA 4O5EA 4PHDA 4M0AA 4ED1A 4IRDA 2BHNA 4AYBC 1IG6A 1KTQA 4Q44A 1HUOA 4NLZA 5DB9A 2KV2A 4XA5A 4F92B 4KN4A 4C4RA 5EE0A 4NWIA 1JMSA 5KG4A 1S76D 1B4FA 4RQ4A 5J0XA 4IS7A 4ECTA 2V9WA 3ICXA 1BPBA 2HOFA 8ICFA 4NM1A 1BNOA 5AKJA 1DGSA 2PFQA 5HHHA 4ECQA 2VANA 3NVWA 5ALWA 3FM9A 4C0ZA 3PW4A 4DWIA 4Z6CA 2AGPA 4UB5A 1KW4A 5AKHA 3ISCA 4DL6A 2HW3A 2FLPA 9ICGA 2WFAA 2HHXA 4FS1A 2WF6A 1Q3VA 2CPRA 3PW7A 2W7OA 4Y2UA 3F2BA 4Z6EA 1SV0A 2LYBA 4EYHB 1U47A 2BCUA 1SXEA 1NKBA 5KFYA 3TAPA 2HHVA 1L7PA 4YD2A 1ZQPA 1IIPA 4TUPA 4U6PA 1KDHA 2MUTB 3WK7A 3KKAC 3RH6A 4O3RA 3JPQA 1QQ6A 2HOIA 2K4EA 1QSLA 1TAMA 3DDHA 4P0PB 4TQRA 2ZIXA 4P4PA 4F5RA 1S0VA 3ORYA 3GV5B 4J9KA 2W7PA 4FO6A 3AUOA 4FBTA 1JX4A 1KFDA 4FFDA 5AI4A 5B66U 1O03A 8ICMA 4UBCA 2RQ5A 1Z1BA 1X9WA 4Y2JA 3AU6A 3L3FX 4EZ6A 5KFZA 9ICXA 5KFLA 5DG7A 2QKQA 4Q8EA 3UM9A 4QWBA 3C2LA 2YMPA 1X42A 4ICAA 4F5PA 4ECSA 5IIIA 2BQUA 2K89A 1NK7A 3NVYA 7ICGA 2W8KA 1V9PA 2KZ3A 1F44A 2H3VA 3QUCA 5J0SA 3T5KA 3PV8A 8ICSA 1L8LA 5CB1A 1TV9A 1FFVA 3PY8A 5KFQA 4KMOB 4P2HA 3BZKA 4MFFA 2QB0B 2DL0A 3R9KA 1ZD3A 2ZIVA 5CHGA 3HW8A 3CW2C 2ZJ5A 3F53A 1ZQRA 1XWLA 3ZI4A 2PFOA 8ICWA 2YN4A 2F1HA 2BCQA 3FDSA 1U45A 1BVSA 3VC8A 3HP6A 4KX5A 4IR9A 3BQ1A 3KD3A 1DK2A 9ICEA 1DOQA 2EDUA 5J0PA 3N4MB 7ICMA 2G5HB 4R63A 2XIDA 3QNMA 2D3DA 2H3ZA 5ALPA 4EX7A 5JTIA 3PR5B 5EWGA 1PK3A 3M6KA 5KAFU 3MABA 2KZMA 3PW0A 2BCSA 3RR8A 2NRZA 2DF4B 8ICXA 5KFPA 4EBCA 2BDUA 4USAA 4F4XA 2UVWA 4HAIA 2DGZA 4I2DA 2B0CA 1COKA 2NO4A 4ECRA 1ZQQA 4HYKA 5D46A 4KLOA 5L1MA 2IHNA 1KLNA 2JXJA 3O0FA 2XI9A 4KLDA 1FFUA 9ICWA 1L6NA 1PUZA 2MAXA 4YG2A 4K4IA 4FBUA 5L1JA 1PZNA 5AK3A 3PW2A 4YP3A 3MGHA 1BPZA 1S97A 2KG5A 4RQ5A 1KN5A 3HX0A 9ICUA 1BGXT 2W3RA 3TADA 3EWAA 2IBKA 4O3QA 4CNQA 3QEAZ 2HSZA 2KFNA 2OXOA 3PX4A 3H8MA 2DQNB 9ICSA 2ZTDA 1C7YA 1BNPA 3M9OB 3QE9Y 1A0PA 3QEBZ 3ED5A 1HEKA 4DOCA 3WK5A 4DF4A 4MF2A 4C7YA 9ICAA 3I1YA 1UHUA 4OD0A 5G5GA 4ZOHC 3PO5A 5TZVA 4KN7A 2EQYA 4B9LA 2F3NA 3NVZA 4I2IA 3NTUA 2W03A 3LVWA 3AN1A 1K1QA 1ZQLA 3QU5A 3UMGA 4DQIA 2W9BB 1Z3EB 1S10A 4B9MA 4DL7A 7ICHA 4ECWA 1QQ7A 4DL2A 4DLGA 9ICFA 1N56A 5EE1A 5J2AA 3C23A 5KG2A 1QCKA 1LV5A 3Q8LA 1NNLA 2XY6A 1RXVA 2F77X 5KG1A 2H3FA 2W11A 5J8YA 4MFCA 4ED6A 3OSPA 4UQGA 2L5YA 4C8KA 1ZOLA 4GIBA 3IHQB 2W43A 3RBDA 4KLQA 3H0LB 4DQPA 4ACOA 4G9BA 1BPXA 4ED7A 4M9JA 9ICTA 2A1JB 5KG7A 1SKWA 4PH5A 2HHWA 4JV2A 2W04A 4Z6FA 8ICKA 5KL1B 1IXRA 3N97B 2W9MA 4MEXA 4E0DA 2CN1A 3RH5A 3ALRA 5KFUA 8ICIA 1MC8A 4J9PA 1L3TA 3TAQA 3N7PD 5J0WA 1Z00A 3GFKB 1T3QA 5DGAA 3BQ0A 4F71A 4DF8A 4C8LA 1ZQZA 3MFIA 4PZOA 5AKKA 4IQTA 2JEFA 1N2XA 1S0NA 2HBMA 2XICA 5KT7A 4F5NA 1T4GA 1ZRMA 3SAFA 2FPMA 3M8SA 2HCFA 5C0YA 3WKBA 3QZ7A 1DXSA 3CP8A 3BQ2A 1RZTA 4YCXA 2H3IA 5ALQA 3S6JA 1KFSA 5KFCA 3QU9A 5AM5A 3RJHA 2PXIA 4UB3A 4Y2XA 1SKRA 1S77D 2EZZA 5ALNA 2ASDA 5DKWA 5AICA 3QUTA 1QSSA 4NJ8A 3ONNA 2QARB 1T8EA 3KTQA 3ZDAA 2HBLA 2FDRA 2KNJA 5DB8A 3T5HA 2F76X 4EEYA 3C2MA 1ZD4A 4ECZA 3QUQA 2XCPA 4RUCA 2ZUBA 5J2JA 1X9XA 4PGQA 2DUYA 4KLTA 4BXOB 1Z1VA 2EAPA 3WK4A 3PNCA 1QSYA 1CI4A 3K1RB 9ICVA 2MU2A 4RPYA 2G07A 5AHXA 5KFNA 1HUZA 3WK6A 3WK8A 5KT5A 8ICPA 3TQ1A 2R8IA 3H4DA 2ZTCA 3SAHA 4UB2A 2VKQA 4I2AA 3CNHA 8ICYA 2JZBA 8ICRA 2V4RA 4UAYA 2F1JA 4PL1A 1P7DA 1NK0A 2JR5A 5JRTA 4F4WA 3WKAA 2WHEA 1NZBA 4IC9A 2UVRA 3H4BA 1ZQDA 5ALHA 2KIWA 5KTQA 4NL9C 3KHLA 4DSIA 2YTUA 5AKYA 2VJ5A 3GDXA 2YMMA 1Z19A 1Q3UA 3IG8A 1Q46A 4BJQA 3PO4A 5KFAA 1ZQKA 2Q0ZX 1N5XA 4JWNA 4NLBA 9ICNA 1BPEA 1CUKA 5EWFA 2H3QA 1UA1A 4KLGA 5J2GA 3ZD8A 2LI6A 3RJEA 3ETRA 3PSPA 4QJFB 5ALRA 9ICQA 5HR6A 4Z6DA 5AKZA 4UAZA 4DQSA 3RB0A 3GIIA 1V38A 2E8OA 4XUSA 3KOOA 2WF8A 2QB0A 3BS7A 3M9MB 3HWTA 5KFOA 1F5SA 4CE6A 1NK5A 4O3NA 3V7LA 2BKEA 2AXTU 5J0UA 3QU4A 5BOMA 3Q8SB 4DS4A 3FYHA 3AEVA 5ALGA 4OJ5A 5H2FU 5KFIA 2FPKA 1SKSA 5AM2A 3SD7A 2GO7A 3E2EA 3QU7A 2O6KA 5D49A 5KFHA 5AKXA 2KFZA 3OSNA 3KHGA 2ZIUA 3SR6A 1L7MA 1VJ5A 5AIAA 4I2FA 3HKZF 3B9JA 5CWRA 2XY7A 2PKEA 1ZQGA 4F5QA 4I2GA 3HT3A 2LKYA 3GILA 1TK8A 3BJYA 4ELUA 2JH7A 4US8A 5ALDA 2KMDA 3T3FA 5KFMA 2PFPA 2H5XA 4ECVA 2ZJAA 5KFWA 1BPDA 4QZFA 3KHRA 4BX9C 3PX6A 3ZDCA 3OHAA 3GV7B 4P0PA 4LZDA 3SEIA 3MR5A 2KJ5A 3HPOA 4BWJA 5L1IA 1NJWA 4IQWA 3ISDA 4JK1A 4OJLA 2XO7A 2AGOA 1PVPA 1KBUA 4PHAA 3IV6A 3FC4A 1AROP 4QWEA 1ZETA 1TK5A 1JI7A 1WG8A 3EPIA 3PZPA 4B9NA 4RUAA 4QW8A 2GH1A 4MF8A 1O08A 4B9UA 2LYAA 5AK5A 3HKZC 2LYHA 4RU9A 3UQ0A 1RXWA 1URJA 3A0BU 3IN5A 2I5HA 2BPFA 3BS5A 2HMXA 1IM4A 1ZQUA 3GV8B 5ALYA 3D6JA 9ICCA 2HVIA 4ED2A 3RJGA 2HBKA 3C28A 2Y9TA 3K1ZA 5DBAA 2OCEA 5J0QA 4TUQA 3KKAA 1RYSA 1EXNA 3TKAA 3IP4B 5KFXA 1ZJNA 5KNIA 4I2CA 3F5EA 2XGQA 2FMQA 4RQ0A 1QQ5A 1XNSA 1ZQCA 2K8AA 1J2MA 5AKGA 1H38A 4DQRA 4R8UB 3NRWA 2DFLA 3U26A 4PGYA 5J29A 1XSNA 4J9QA 3Q8RB 4NM2A 3MFHA 3A0HU 5F9LA 5KFGA 2KIVA 1ZQMA 2R18A 4UB6U 2VJ4A 4KLJA 3RRHA 5BPCA 5ALIA 1V85A 2YY6A 2ZUDA 1K1SA 4F91B 1L3VA 3NASA 3MR2A 3AM9A 1QLNA 2KP7A 4X5VA 3AU2A 3M6ZA 5ALTA 4J9LA 2WAQF 4R8UA 7ICRA 4M6WB 4NLNA 4O0IA 2C2RA 2VA8A 4J9NA 4YMNA 3KZIU 1ZD2P 4ECXA 1U9LA 4KLFA 1JALA 4YXMA 3SQIA 5KG6A 1JN3A 5T14A 3MR6A 3HILA 3TARA 1LKYA 1SV0C 1RDFA 3CYMA 4B9SA 3MGVA 4M9LA 4DO9A 5EE9A 4DFDA 5CP2A 3EYZA 5L1LA 2G5IB 2CXYA 4QIWF 3D2QA 7ICUA 2JRZA 3ZDDA 4B9TA 1ZQBA 2PMZF 4PHEA 2FPLA 3AMZA 2LMRA 4KLMA 8ICUA 4P4OA 4C7ZA 3WKCA 3WKEA 4IR1A 4OJOA 4KLHA 5IILA 4KMUA 4WJ3B 1RPLA 2W9CA 4F72A 3N7SC 2NV3A 1D8BA 3UMBA 2ISOA 2AQ4A 2WAQC 3M9NB 2VA2A 4IRKA 3K75D 3C5FA 1YT3A 3F5AA 4P4MA 5KT4A 3C5GA 2Y1IA 2F8LA 5TISU 4TURA 1ZQ1C 4QZEA 4QWDA 2NO5A 3PW5A 3PMLA 4DLEA 4I2BA 3LVVA 2KKPA 3LWMA 1NJYA 3N7RC 2OH2A 3HRDD 3MC1A 2E5SA 4PL2A 1NK9A 4Y2VA 2ZIVB 2BQ3A 1Z4OA 1NK4A 3JPPA 2M9NA 4ELVA 1M6YA 4RQ8A 4F8RA 2XGPA 4DSKA 1D8LA 4YR0A 3C1ZA 1F0MA 2FJ6A 1KQQA 5IIJA 2I1QA 1NI3A 5HMLA 2PI4A 5ALMA 1WWVA 4DSEA 2IOFA 3C29A 3QUBA 5ALUA 2I9GA 1ZRNA 4NLGA 1L5UA 3UPQA 3BQ7A 2PI5A 1UCVA 2UVVA 3WK9A 3JPRA 2MA1A 2P66A 3JPTA 5KFFA 3Q8PB 3T5LA 3H8WA 2A1JA 4EZ9A 5J2IA 1ZQIA 3UXPA 1MN8A 4O5KA 2ES6A 3AQEA 5J2BA 3V7KA 3V6HA 2DPJA 2J6UA 1CEZA 2AH5A 4C8OA 3QU2A 2WF7A 5L1KA 4C80A 1JXLA 2W9CB 1X6JA 2ZXHA 2QB1A 3C1YA 4QZGA 4UATA 5ALEA 4F3OA 2OEHA 2F8KA 2LHTA 1NK8A 4MFAA 4DL3A 5HHIA 4F50A 5J0RA 2KSOA 3EPGA 5DQHA 2JZBB 2BCVA 5CJ7A 1RQLA 4QZ9A 9ICRA 5AI0A 4QZHA 1D9FA 2YMQA 3IDWA 3PMNA 5AM4A 5ALJA 3G6VA 2NRXA 3M8RA 4LZGA 4B9VA 3PSIA 5IIMA 4RNNA 2BCRA 1UA0A 2AJQA 4LVSA 3RAQA 1UQVA 2C2EA 3MBYA 5HR7A 4FS2A 2OYYA 1AQ6A 4BUGA 9ICJA 2HDOA 1SB3C 1K5OA 4EX6A 3B0YA 1S5LU 1JROA 1Z4NA 4RT3A 3FAHA 1SL2A 2WF5A 4Y2PA 1UT5A 4P0QA 2Y0SC 5AM3A 3MR3A 5KT6A 2ZJ8A 2JV3A 5DBBA 2AGQA 3EW9A 2WTFA 2KJ8A 4R65A 4QW9A 7ICLA 1D8YA 3PVXA 2LBOA 1XC9A 3ZDBA 3TADC 5J8YC 3MDAA 2W3SA 5ALXA 2E8PA 4RNOA 4Y2QA 4FE3A 2JH1A 1VLBA 4RPZA 3OJUA 3RB3A 2BGWA 5AKIA 2F44A 4KITB 1UPHA 2ZTEA 2FLLA 2B21A 5AM1A 4BDPA 3G6XA 4GXKA 1ZQSA 2Y0SF 3VCBA 4IQUA 4YR3A 3T79A 1ZQEA 4DEZA 3BS5B 2BZFA 3H8JA 2ZUCA 3QZ8A 3M7DA 1PVQA 4PPXA 2LM4A 8ICLA 5ALKA 2G0AA 2E8NA 2EZXA 3SZ2A 4M04A 1X40A 8ICOA 2EH9A 3RF9A 1B43A 5DDYA 1NJZA 2R8KA 3I76A 5J2DA 8ICEA 1S9FA 3Q8QB 4UARA 9ICPA 1NZPA 2YX8A 2KOBA 5AK6A 4UAWA 4RQ6A 5IINA 2G08A 7ICFA 3CRXA 1ZQJA 3B0XA 5IIKA 4J03A 1C20A 5DLGA 3E58A 4YXJA 2XY5A 2MRLA 3ETLA 2C2DA 4Y2SA 4DFKA 3H0RB 2HHUA 4K4HA 5GTIU 4JMUA 2F2AB 4NL9A 5DQIA 7ICKA 3QXGA 3TFSA 1FIQA 4UAUA 2E8MA 3LDAA 5KFBA 1XSPA 4M9HA 1S8OA 4QZ8A 2E1EA 4NV0A 4F4ZA 4I2EA 2KTQA 2ZG6A 4OJPA 8ICBA 2BDPA 4M2YA 2ODGA 4I29A 3GU3A 3NS1A 4UASA 3TFRA 1KSPA 4RQ7A 5ALOA 3JPNA 3OHBA 3SV3A 2GOLA 3JPOA 2KD1A 4EEKA 2P35A 2Q4TA 2K60A 1FEZA
chains in the Genus database with same CATH topology
1X6IA 2JR5A 1X6JA 1PUZA 2LM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6I A;  2JR5 A;  1X6J A;  1PUZ A;  2LM4 A; 
#chains in the Genus database with same CATH topology
 1SWV A;  3SI8 A;  2FMS A;  4A8E A;  5J2H A;  2NRT A;  2KKV A;  1L3U A;  2ALZ A;  4KLU A;  2PMZ C;  2DBY A;  5ALF A;  2A1A A;  2AQ0 A;  4DS5 A;  1SWW A;  4RT2 A;  3KHH A;  2Y9U A;  4O3S A;  4DOA A;  1MQ3 A;  2ATL A;  4JB3 A;  5AI9 A;  4CF5 A;  2R8G A;  3RAX A;  1L3S A;  1KRP A;  4ED0 A;  4O9M A;  4EBD A;  2FI1 A;  4UBB A;  2EAM A;  5IIO A;  4CRX A;  2YB1 A;  4RQ3 A;  1ZQN A;  2MUT A;  3KFU F;  1NKE A;  3NVV A;  1J97 A;  3Q8M A;  2I6X A;  4Q43 A;  2MSN A;  1NKC A;  2N1R A;  1X9M A;  7ICV A;  1N61 A;  3BZC A;  1IV8 A;  4UB8 U;  2J6T A;  1CRX A;  1XU4 A;  1WYG A;  4I2J A;  4JUZ A;  4DOB A;  3DV9 A;  3K4G A;  2OHF A;  2KSO B;  4ELT A;  9ICB A;  3H7I A;  1BPY A;  1LKY B;  3V6J A;  4MHV A;  4C4T A;  5AI5 A;  4IL6 U;  2K4H A;  5DBC A;  1S0M A;  2FLN A;  5EOZ A;  2JHD A;  1SV4 A;  2PFN A;  4Q8F A;  3PX0 A;  5ALV A;  1LB2 B;  7ICE A;  5J2E A;  1N48 A;  2W9A A;  7ICT A;  4US9 A;  4ECU A;  2KE7 A;  1A6S A;  5KG5 A;  2IOH A;  4J9M A;  2AHO B;  2KJ9 A;  2YB4 A;  3V6K A;  1MQ2 A;  4I2H A;  1JXE A;  1MA7 A;  2NYV A;  1S0O A;  3QX7 A;  4BXO A;  1ZQT A;  2KK0 A;  3RTV A;  5KFS A;  2YML A;  2FMP A;  4O3M A;  3RH4 A;  1X66 A;  4JV0 A;  3PST A;  5L9X A;  2D8C A;  3N28 A;  4AYB F;  1WWU A;  4RPX A;  3F2D A;  2QAR A;  4F2R A;  4UAV A;  5JUM A;  3LK9 A;  5J2K A;  2YQE A;  3JPS A;  1QH9 A;  4RZR A;  1SZP A;  1DK3 A;  5AK4 A;  2ASJ A;  2JMG A;  1RG6 A;  3AQF A;  2XC9 A;  8ICC A;  3IG5 A;  5JU5 A;  2RHF A;  3TI0 A;  9ICI A;  9ICK A;  7ICS A;  1Y88 A;  4YD1 A;  1ED1 A;  1X6I A;  4O3P A;  4KTQ A;  4ED8 A;  4DL4 A;  3SMV A;  4J9R A;  3GZF A;  2K4I A;  4EEN A;  3BQT A;  5KFR A;  5G5H A;  1TVA A;  1ZQH A;  4YMM A;  4TQS A;  2DKX A;  2RLT A;  2ZIW B;  8ICV A;  4I27 A;  7ICJ A;  8ICQ A;  1XO0 A;  4CF3 A;  1TFR A;  4F4Y A;  1ZQY A;  5DG9 A;  1N60 A;  4Y2R A;  3THV A;  4XQ8 A;  3RBE A;  1V97 A;  5EE3 A;  4RNM A;  5KFK A;  4C8M A;  1ZQA A;  4F4K A;  1N62 A;  5KG3 A;  1KKX A;  1SGG A;  3NUQ A;  3WKD A;  5HP4 A;  4YQW A;  5KT3 A;  4DFP A;  3SV4 A;  4DL5 A;  1ZYQ A;  3V72 A;  3AL0 B;  1PK1 B;  3SYZ A;  4QWC A;  1X9S A;  5C5J A;  2KZZ A;  5AKE A;  4KLL A;  2Z7J A;  3EZ5 A;  2KHV A;  2RDJ A;  3QYP A;  2KHQ A;  2JGA A;  4RQM A;  2K8C B;  4FZN A;  4KLS A;  1PK1 A;  2W55 A;  3MGI A;  1ZQF A;  4QNL A;  2HOQ A;  4DCC A;  4PJ0 U;  3UXO A;  3TAC B;  2W9B A;  8ICZ A;  2ASL A;  2QLT A;  5A0L A;  5DLF A;  2K8B B;  8ICH A;  5FP0 A;  1JIH A;  3HJE A;  2KN7 A;  2XCA A;  4YMO A;  8ICA A;  4M9G A;  4U7C A;  4PGX A;  1VDV A;  4M9N A;  1NK6 A;  4KX3 A;  1UT8 A;  1T7P A;  3BDP A;  4F5O A;  8ICJ A;  1NOM A;  1TK0 A;  7ICP A;  3TAN A;  1YZ6 A;  3ISB A;  4YVZ A;  2HHS A;  1TAU A;  5J0O A;  3RFA A;  3C21 A;  1ZQX A;  2JEG A;  4IRC A;  4M6W A;  1GO3 F;  1X2I A;  9ICL A;  3KBB A;  4DSJ A;  2LM1 A;  5F3X B;  5CEH A;  1RQN A;  3I28 A;  1ECW A;  5DG8 A;  1OXJ A;  7ICQ A;  1DGJ A;  4P0Q B;  4QZA A;  2J6S A;  2Y1J A;  3GIJ A;  5AKL A;  2UVU A;  5J2F A;  4UB4 A;  4DSL A;  3OGU A;  2G06 A;  2DKZ A;  1JRP A;  4C8N A;  1N5W A;  2HHQ A;  3EUB 2;  1OUQ A;  1WCN A;  1RYU A;  3G6Y A;  3H40 A;  4XRH A;  3L5K A;  3UXN A;  1XS9 D;  1ZXI A;  4O3O A;  3MDC A;  5ALL A;  2EAO A;  4M47 A;  4EBE A;  1A77 A;  1J2N A;  3RB4 A;  2BPG A;  1L7O A;  2JEJ A;  5B5E U;  3UMC A;  4GFJ A;  4F2S A;  5KFE A;  3ZD9 A;  4YR2 A;  1L8O A;  5KFT A;  2C28 A;  2NRV A;  5KL8 B;  5KFV A;  2VIX A;  3PR4 A;  3T5J A;  1YZ7 A;  3UQ2 A;  4C4S A;  5J0Y A;  4TUS A;  3RJJ A;  1SL1 A;  4QZD A;  2D6F C;  3IM1 A;  1ZQO A;  4QZI A;  5HNK A;  5AM0 A;  2FE9 A;  2KVS A;  1B22 A;  2BQR A;  2E1F A;  2ESE A;  1WCL A;  2VA3 A;  3RJK A;  4NXZ A;  5J0T A;  1RYR A;  1OW5 A;  2HI0 A;  4QWA A;  2A19 A;  4YN4 A;  3OJS A;  1L7N A;  5AIB A;  8ICG A;  4RQ1 A;  5GTH U;  7ICI A;  2P6U A;  4AP9 A;  2M0N A;  1SXD A;  2OM6 A;  2ZXI A;  4QIW C;  3SAG A;  5ALS A;  2KVC A;  3RR7 A;  1SL0 A;  5DB6 A;  3LYS A;  4UB1 A;  1LVH A;  4BWM A;  4NLC A;  3RRG A;  4RQN A;  2HHT A;  3Q8K A;  5KAI U;  4J9O A;  3GQC A;  4JV1 A;  3ZDE A;  3WU2 U;  4DFJ A;  3OPX A;  9ICM A;  1ZD5 A;  1MSW D;  4CF4 A;  4J9S A;  2HBJ A;  5CRX A;  2A3V A;  4QZC A;  4MEY A;  3RJF A;  5E79 U;  3LWL A;  1Q8K A;  4ECY A;  2JEI A;  2DPI A;  1HJP A;  4I28 A;  5HMM A;  5CR0 A;  2ZIU B;  5EWE A;  4CDG A;  1TKD A;  9ICH A;  2XVT A;  1NJX A;  4GC6 A;  1TE2 A;  2LPE A;  3V7J A;  2GWS A;  4JWM A;  1RM6 C;  1N63 A;  4GLX A;  3RB6 A;  4R64 A;  5CA7 A;  4IQV A;  4F93 B;  5KT2 A;  2IMW P;  3J81 j;  2WB1 F;  5KG0 A;  4GXI A;  1SIJ A;  2K4P A;  1Z00 B;  3DEE A;  2R8H A;  3D2N A;  4CGZ A;  2OWO A;  4OCZ A;  1COO A;  4DQQ A;  1T3N A;  7ICN A;  2ZIX B;  4Q45 A;  5BOL A;  8ICT A;  2ISP A;  4PHP A;  2WF9 A;  4UW9 A;  3M1Y A;  2EAN A;  2EZY A;  2E3T A;  1U49 A;  4NY8 A;  1HIW A;  2R8J A;  4K4G A;  4OO1 J;  5DGB A;  2DWQ A;  2IOF K;  4GXJ A;  4KLI A;  3H0M B;  3PSF A;  4O5C A;  5AI8 A;  1XSL A;  5DQG A;  5K4L A;  2HVH A;  2B6G A;  5KFJ A;  3IRU A;  1DRG A;  9ICO A;  4EYI B;  2NRW A;  5DDM A;  2W8L A;  1FO4 A;  5D4B A;  4BGD A;  2IHM A;  2F1I A;  2AU0 A;  4R66 A;  4EEL A;  7ICO A;  1D9D A;  4KLE A;  4G3I A;  4FZM A;  3D2S A;  5DB7 A;  3NRZ A;  1PVR A;  4RQ2 A;  1SZH A;  2ZIW A;  2IA6 A;  1TAQ A;  1XO1 A;  3OTQ A;  2P6R A;  1KL9 A;  2V4Q A;  3GIM A;  3NGD A;  4LJX A;  3GIK A;  1B0X A;  1ZQV A;  3RJI A;  5AI6 A;  3E0F A;  4YFK A;  2G09 A;  1JUD A;  4PZN A;  5J2C A;  4Y2Y A;  2RRD A;  3SEN A;  3C2K A;  2BPC A;  1T94 A;  2CRX A;  5KFD A;  1U4B A;  2GLE A;  2BR0 A;  8ICN A;  2W54 A;  1WUD A;  3F2C A;  1U48 A;  3L4P A;  4ED3 A;  2RDI A;  4DFM A;  2KIC A;  3H8S A;  4NLK A;  4QZB A;  4GC7 A;  2RP5 A;  2KEY A;  1QTM A;  1KFT A;  4CCH A;  4OJ6 A;  5F9N A;  4ZH4 A;  4DSF A;  1ZQW A;  1KEJ A;  5ALZ A;  2WB1 C;  4FZL A;  4Y2T A;  3KZX A;  1A76 A;  4B6J A;  2C22 A;  1ZJM A;  4O5E A;  4PHD A;  4M0A A;  4ED1 A;  4IRD A;  2BHN A;  4AYB C;  1IG6 A;  1KTQ A;  4Q44 A;  1HUO A;  4NLZ A;  5DB9 A;  2KV2 A;  4XA5 A;  4F92 B;  4KN4 A;  4C4R A;  5EE0 A;  4NWI A;  1JMS A;  5KG4 A;  1S76 D;  1B4F A;  4RQ4 A;  5J0X A;  4IS7 A;  4ECT A;  2V9W A;  3ICX A;  1BPB A;  2HOF A;  8ICF A;  4NM1 A;  1BNO A;  5AKJ A;  1DGS A;  2PFQ A;  5HHH A;  4ECQ A;  2VAN A;  3NVW A;  5ALW A;  3FM9 A;  4C0Z A;  3PW4 A;  4DWI A;  4Z6C A;  2AGP A;  4UB5 A;  1KW4 A;  5AKH A;  3ISC A;  4DL6 A;  2HW3 A;  2FLP A;  9ICG A;  2WFA A;  2HHX A;  4FS1 A;  2WF6 A;  1Q3V A;  2CPR A;  3PW7 A;  2W7O A;  4Y2U A;  3F2B A;  4Z6E A;  1SV0 A;  2LYB A;  4EYH B;  1U47 A;  2BCU A;  1SXE A;  1NKB A;  5KFY A;  3TAP A;  2HHV A;  1L7P A;  4YD2 A;  1ZQP A;  1IIP A;  4TUP A;  4U6P A;  1KDH A;  2MUT B;  3WK7 A;  3KKA C;  3RH6 A;  4O3R A;  3JPQ A;  1QQ6 A;  2HOI A;  2K4E A;  1QSL A;  1TAM A;  3DDH A;  4P0P B;  4TQR A;  2ZIX A;  4P4P A;  4F5R A;  1S0V A;  3ORY A;  3GV5 B;  4J9K A;  2W7P A;  4FO6 A;  3AUO A;  4FBT A;  1JX4 A;  1KFD A;  4FFD A;  5AI4 A;  5B66 U;  1O03 A;  8ICM A;  4UBC A;  2RQ5 A;  1Z1B A;  1X9W A;  4Y2J A;  3AU6 A;  3L3F X;  4EZ6 A;  5KFZ A;  9ICX A;  5KFL A;  5DG7 A;  2QKQ A;  4Q8E A;  3UM9 A;  4QWB A;  3C2L A;  2YMP A;  1X42 A;  4ICA A;  4F5P A;  4ECS A;  5III A;  2BQU A;  2K89 A;  1NK7 A;  3NVY A;  7ICG A;  2W8K A;  1V9P A;  2KZ3 A;  1F44 A;  2H3V A;  3QUC A;  5J0S A;  3T5K A;  3PV8 A;  8ICS A;  1L8L A;  5CB1 A;  1TV9 A;  1FFV A;  3PY8 A;  5KFQ A;  4KMO B;  4P2H A;  3BZK A;  4MFF A;  2QB0 B;  2DL0 A;  3R9K A;  1ZD3 A;  2ZIV A;  5CHG A;  3HW8 A;  3CW2 C;  2ZJ5 A;  3F53 A;  1ZQR A;  1XWL A;  3ZI4 A;  2PFO A;  8ICW A;  2YN4 A;  2F1H A;  2BCQ A;  3FDS A;  1U45 A;  1BVS A;  3VC8 A;  3HP6 A;  4KX5 A;  4IR9 A;  3BQ1 A;  3KD3 A;  1DK2 A;  9ICE A;  1DOQ A;  2EDU A;  5J0P A;  3N4M B;  7ICM A;  2G5H B;  4R63 A;  2XID A;  3QNM A;  2D3D A;  2H3Z A;  5ALP A;  4EX7 A;  5JTI A;  3PR5 B;  5EWG A;  1PK3 A;  3M6K A;  5KAF U;  3MAB A;  2KZM A;  3PW0 A;  2BCS A;  3RR8 A;  2NRZ A;  2DF4 B;  8ICX A;  5KFP A;  4EBC A;  2BDU A;  4USA A;  4F4X A;  2UVW A;  4HAI A;  2DGZ A;  4I2D A;  2B0C A;  1COK A;  2NO4 A;  4ECR A;  1ZQQ A;  4HYK A;  5D46 A;  4KLO A;  5L1M A;  2IHN A;  1KLN A;  2JXJ A;  3O0F A;  2XI9 A;  4KLD A;  1FFU A;  9ICW A;  1L6N A;  1PUZ A;  2MAX A;  4YG2 A;  4K4I A;  4FBU A;  5L1J A;  1PZN A;  5AK3 A;  3PW2 A;  4YP3 A;  3MGH A;  1BPZ A;  1S97 A;  2KG5 A;  4RQ5 A;  1KN5 A;  3HX0 A;  9ICU A;  1BGX T;  2W3R A;  3TAD A;  3EWA A;  2IBK A;  4O3Q A;  4CNQ A;  3QEA Z;  2HSZ A;  2KFN A;  2OXO A;  3PX4 A;  3H8M A;  2DQN B;  9ICS A;  2ZTD A;  1C7Y A;  1BNP A;  3M9O B;  3QE9 Y;  1A0P A;  3QEB Z;  3ED5 A;  1HEK A;  4DOC A;  3WK5 A;  4DF4 A;  4MF2 A;  4C7Y A;  9ICA A;  3I1Y A;  1UHU A;  4OD0 A;  5G5G A;  4ZOH C;  3PO5 A;  5TZV A;  4KN7 A;  2EQY A;  4B9L A;  2F3N A;  3NVZ A;  4I2I A;  3NTU A;  2W03 A;  3LVW A;  3AN1 A;  1K1Q A;  1ZQL A;  3QU5 A;  3UMG A;  4DQI A;  2W9B B;  1Z3E B;  1S10 A;  4B9M A;  4DL7 A;  7ICH A;  4ECW A;  1QQ7 A;  4DL2 A;  4DLG A;  9ICF A;  1N56 A;  5EE1 A;  5J2A A;  3C23 A;  5KG2 A;  1QCK A;  1LV5 A;  3Q8L A;  1NNL A;  2XY6 A;  1RXV A;  2F77 X;  5KG1 A;  2H3F A;  2W11 A;  5J8Y A;  4MFC A;  4ED6 A;  3OSP A;  4UQG A;  2L5Y A;  4C8K A;  1ZOL A;  4GIB A;  3IHQ B;  2W43 A;  3RBD A;  4KLQ A;  3H0L B;  4DQP A;  4ACO A;  4G9B A;  1BPX A;  4ED7 A;  4M9J A;  9ICT A;  2A1J B;  5KG7 A;  1SKW A;  4PH5 A;  2HHW A;  4JV2 A;  2W04 A;  4Z6F A;  8ICK A;  5KL1 B;  1IXR A;  3N97 B;  2W9M A;  4MEX A;  4E0D A;  2CN1 A;  3RH5 A;  3ALR A;  5KFU A;  8ICI A;  1MC8 A;  4J9P A;  1L3T A;  3TAQ A;  3N7P D;  5J0W A;  1Z00 A;  3GFK B;  1T3Q A;  5DGA A;  3BQ0 A;  4F71 A;  4DF8 A;  4C8L A;  1ZQZ A;  3MFI A;  4PZO A;  5AKK A;  4IQT A;  2JEF A;  1N2X A;  1S0N A;  2HBM A;  2XIC A;  5KT7 A;  4F5N A;  1T4G A;  1ZRM A;  3SAF A;  2FPM A;  3M8S A;  2HCF A;  5C0Y A;  3WKB A;  3QZ7 A;  1DXS A;  3CP8 A;  3BQ2 A;  1RZT A;  4YCX A;  2H3I A;  5ALQ A;  3S6J A;  1KFS A;  5KFC A;  3QU9 A;  5AM5 A;  3RJH A;  2PXI A;  4UB3 A;  4Y2X A;  1SKR A;  1S77 D;  2EZZ A;  5ALN A;  2ASD A;  5DKW A;  5AIC A;  3QUT A;  1QSS A;  4NJ8 A;  3ONN A;  2QAR B;  1T8E A;  3KTQ A;  3ZDA A;  2HBL A;  2FDR A;  2KNJ A;  5DB8 A;  3T5H A;  2F76 X;  4EEY A;  3C2M A;  1ZD4 A;  4ECZ A;  3QUQ A;  2XCP A;  4RUC A;  2ZUB A;  5J2J A;  1X9X A;  4PGQ A;  2DUY A;  4KLT A;  4BXO B;  1Z1V A;  2EAP A;  3WK4 A;  3PNC A;  1QSY A;  1CI4 A;  3K1R B;  9ICV A;  2MU2 A;  4RPY A;  2G07 A;  5AHX A;  5KFN A;  1HUZ A;  3WK6 A;  3WK8 A;  5KT5 A;  8ICP A;  3TQ1 A;  2R8I A;  3H4D A;  2ZTC A;  3SAH A;  4UB2 A;  2VKQ A;  4I2A A;  3CNH A;  8ICY A;  2JZB A;  8ICR A;  2V4R A;  4UAY A;  2F1J A;  4PL1 A;  1P7D A;  1NK0 A;  2JR5 A;  5JRT A;  4F4W A;  3WKA A;  2WHE A;  1NZB A;  4IC9 A;  2UVR A;  3H4B A;  1ZQD A;  5ALH A;  2KIW A;  5KTQ A;  4NL9 C;  3KHL A;  4DSI A;  2YTU A;  5AKY A;  2VJ5 A;  3GDX A;  2YMM A;  1Z19 A;  1Q3U A;  3IG8 A;  1Q46 A;  4BJQ A;  3PO4 A;  5KFA A;  1ZQK A;  2Q0Z X;  1N5X A;  4JWN A;  4NLB A;  9ICN A;  1BPE A;  1CUK A;  5EWF A;  2H3Q A;  1UA1 A;  4KLG A;  5J2G A;  3ZD8 A;  2LI6 A;  3RJE A;  3ETR A;  3PSP A;  4QJF B;  5ALR A;  9ICQ A;  5HR6 A;  4Z6D A;  5AKZ A;  4UAZ A;  4DQS A;  3RB0 A;  3GII A;  1V38 A;  2E8O A;  4XUS A;  3KOO A;  2WF8 A;  2QB0 A;  3BS7 A;  3M9M B;  3HWT A;  5KFO A;  1F5S A;  4CE6 A;  1NK5 A;  4O3N A;  3V7L A;  2BKE A;  2AXT U;  5J0U A;  3QU4 A;  5BOM A;  3Q8S B;  4DS4 A;  3FYH A;  3AEV A;  5ALG A;  4OJ5 A;  5H2F U;  5KFI A;  2FPK A;  1SKS A;  5AM2 A;  3SD7 A;  2GO7 A;  3E2E A;  3QU7 A;  2O6K A;  5D49 A;  5KFH A;  5AKX A;  2KFZ A;  3OSN A;  3KHG A;  2ZIU A;  3SR6 A;  1L7M A;  1VJ5 A;  5AIA A;  4I2F A;  3HKZ F;  3B9J A;  5CWR A;  2XY7 A;  2PKE A;  1ZQG A;  4F5Q A;  4I2G A;  3HT3 A;  2LKY A;  3GIL A;  1TK8 A;  3BJY A;  4ELU A;  2JH7 A;  4US8 A;  5ALD A;  2KMD A;  3T3F A;  5KFM A;  2PFP A;  2H5X A;  4ECV A;  2ZJA A;  5KFW A;  1BPD A;  4QZF A;  3KHR A;  4BX9 C;  3PX6 A;  3ZDC A;  3OHA A;  3GV7 B;  4P0P A;  4LZD A;  3SEI A;  3MR5 A;  2KJ5 A;  3HPO A;  4BWJ A;  5L1I A;  1NJW A;  4IQW A;  3ISD A;  4JK1 A;  4OJL A;  2XO7 A;  2AGO A;  1PVP A;  1KBU A;  4PHA A;  3IV6 A;  3FC4 A;  1ARO P;  4QWE A;  1ZET A;  1TK5 A;  1JI7 A;  1WG8 A;  3EPI A;  3PZP A;  4B9N A;  4RUA A;  4QW8 A;  2GH1 A;  4MF8 A;  1O08 A;  4B9U A;  2LYA A;  5AK5 A;  3HKZ C;  2LYH A;  4RU9 A;  3UQ0 A;  1RXW A;  1URJ A;  3A0B U;  3IN5 A;  2I5H A;  2BPF A;  3BS5 A;  2HMX A;  1IM4 A;  1ZQU A;  3GV8 B;  5ALY A;  3D6J A;  9ICC A;  2HVI A;  4ED2 A;  3RJG A;  2HBK A;  3C28 A;  2Y9T A;  3K1Z A;  5DBA A;  2OCE A;  5J0Q A;  4TUQ A;  3KKA A;  1RYS A;  1EXN A;  3TKA A;  3IP4 B;  5KFX A;  1ZJN A;  5KNI A;  4I2C A;  3F5E A;  2XGQ A;  2FMQ A;  4RQ0 A;  1QQ5 A;  1XNS A;  1ZQC A;  2K8A A;  1J2M A;  5AKG A;  1H38 A;  4DQR A;  4R8U B;  3NRW A;  2DFL A;  3U26 A;  4PGY A;  5J29 A;  1XSN A;  4J9Q A;  3Q8R B;  4NM2 A;  3MFH A;  3A0H U;  5F9L A;  5KFG A;  2KIV A;  1ZQM A;  2R18 A;  4UB6 U;  2VJ4 A;  4KLJ A;  3RRH A;  5BPC A;  5ALI A;  1V85 A;  2YY6 A;  2ZUD A;  1K1S A;  4F91 B;  1L3V A;  3NAS A;  3MR2 A;  3AM9 A;  1QLN A;  2KP7 A;  4X5V A;  3AU2 A;  3M6Z A;  5ALT A;  4J9L A;  2WAQ F;  4R8U A;  7ICR A;  4M6W B;  4NLN A;  4O0I A;  2C2R A;  2VA8 A;  4J9N A;  4YMN A;  3KZI U;  1ZD2 P;  4ECX A;  1U9L A;  4KLF A;  1JAL A;  4YXM A;  3SQI A;  5KG6 A;  1JN3 A;  5T14 A;  3MR6 A;  3HIL A;  3TAR A;  1LKY A;  1SV0 C;  1RDF A;  3CYM A;  4B9S A;  3MGV A;  4M9L A;  4DO9 A;  5EE9 A;  4DFD A;  5CP2 A;  3EYZ A;  5L1L A;  2G5I B;  2CXY A;  4QIW F;  3D2Q A;  7ICU A;  2JRZ A;  3ZDD A;  4B9T A;  1ZQB A;  2PMZ F;  4PHE A;  2FPL A;  3AMZ A;  2LMR A;  4KLM A;  8ICU A;  4P4O A;  4C7Z A;  3WKC A;  3WKE A;  4IR1 A;  4OJO A;  4KLH A;  5IIL A;  4KMU A;  4WJ3 B;  1RPL A;  2W9C A;  4F72 A;  3N7S C;  2NV3 A;  1D8B A;  3UMB A;  2ISO A;  2AQ4 A;  2WAQ C;  3M9N B;  2VA2 A;  4IRK A;  3K75 D;  3C5F A;  1YT3 A;  3F5A A;  4P4M A;  5KT4 A;  3C5G A;  2Y1I A;  2F8L A;  5TIS U;  4TUR A;  1ZQ1 C;  4QZE A;  4QWD A;  2NO5 A;  3PW5 A;  3PML A;  4DLE A;  4I2B A;  3LVV A;  2KKP A;  3LWM A;  1NJY A;  3N7R C;  2OH2 A;  3HRD D;  3MC1 A;  2E5S A;  4PL2 A;  1NK9 A;  4Y2V A;  2ZIV B;  2BQ3 A;  1Z4O A;  1NK4 A;  3JPP A;  2M9N A;  4ELV A;  1M6Y A;  4RQ8 A;  4F8R A;  2XGP A;  4DSK A;  1D8L A;  4YR0 A;  3C1Z A;  1F0M A;  2FJ6 A;  1KQQ A;  5IIJ A;  2I1Q A;  1NI3 A;  5HML A;  2PI4 A;  5ALM A;  1WWV A;  4DSE A;  2IOF A;  3C29 A;  3QUB A;  5ALU A;  2I9G A;  1ZRN A;  4NLG A;  1L5U A;  3UPQ A;  3BQ7 A;  2PI5 A;  1UCV A;  2UVV A;  3WK9 A;  3JPR A;  2MA1 A;  2P66 A;  3JPT A;  5KFF A;  3Q8P B;  3T5L A;  3H8W A;  2A1J A;  4EZ9 A;  5J2I A;  1ZQI A;  3UXP A;  1MN8 A;  4O5K A;  2ES6 A;  3AQE A;  5J2B A;  3V7K A;  3V6H A;  2DPJ A;  2J6U A;  1CEZ A;  2AH5 A;  4C8O A;  3QU2 A;  2WF7 A;  5L1K A;  4C80 A;  1JXL A;  2W9C B;  1X6J A;  2ZXH A;  2QB1 A;  3C1Y A;  4QZG A;  4UAT A;  5ALE A;  4F3O A;  2OEH A;  2F8K A;  2LHT A;  1NK8 A;  4MFA A;  4DL3 A;  5HHI A;  4F50 A;  5J0R A;  2KSO A;  3EPG A;  5DQH A;  2JZB B;  2BCV A;  5CJ7 A;  1RQL A;  4QZ9 A;  9ICR A;  5AI0 A;  4QZH A;  1D9F A;  2YMQ A;  3IDW A;  3PMN A;  5AM4 A;  5ALJ A;  3G6V A;  2NRX A;  3M8R A;  4LZG A;  4B9V A;  3PSI A;  5IIM A;  4RNN A;  2BCR A;  1UA0 A;  2AJQ A;  4LVS A;  3RAQ A;  1UQV A;  2C2E A;  3MBY A;  5HR7 A;  4FS2 A;  2OYY A;  1AQ6 A;  4BUG A;  9ICJ A;  2HDO A;  1SB3 C;  1K5O A;  4EX6 A;  3B0Y A;  1S5L U;  1JRO A;  1Z4N A;  4RT3 A;  3FAH A;  1SL2 A;  2WF5 A;  4Y2P A;  1UT5 A;  4P0Q A;  2Y0S C;  5AM3 A;  3MR3 A;  5KT6 A;  2ZJ8 A;  2JV3 A;  5DBB A;  2AGQ A;  3EW9 A;  2WTF A;  2KJ8 A;  4R65 A;  4QW9 A;  7ICL A;  1D8Y A;  3PVX A;  2LBO A;  1XC9 A;  3ZDB A;  3TAD C;  5J8Y C;  3MDA A;  2W3S A;  5ALX A;  2E8P A;  4RNO A;  4Y2Q A;  4FE3 A;  2JH1 A;  1VLB A;  4RPZ A;  3OJU A;  3RB3 A;  2BGW A;  5AKI A;  2F44 A;  4KIT B;  1UPH A;  2ZTE A;  2FLL A;  2B21 A;  5AM1 A;  4BDP A;  3G6X A;  4GXK A;  1ZQS A;  2Y0S F;  3VCB A;  4IQU A;  4YR3 A;  3T79 A;  1ZQE A;  4DEZ A;  3BS5 B;  2BZF A;  3H8J A;  2ZUC A;  3QZ8 A;  3M7D A;  1PVQ A;  4PPX A;  2LM4 A;  8ICL A;  5ALK A;  2G0A A;  2E8N A;  2EZX A;  3SZ2 A;  4M04 A;  1X40 A;  8ICO A;  2EH9 A;  3RF9 A;  1B43 A;  5DDY A;  1NJZ A;  2R8K A;  3I76 A;  5J2D A;  8ICE A;  1S9F A;  3Q8Q B;  4UAR A;  9ICP A;  1NZP A;  2YX8 A;  2KOB A;  5AK6 A;  4UAW A;  4RQ6 A;  5IIN A;  2G08 A;  7ICF A;  3CRX A;  1ZQJ A;  3B0X A;  5IIK A;  4J03 A;  1C20 A;  5DLG A;  3E58 A;  4YXJ A;  2XY5 A;  2MRL A;  3ETL A;  2C2D A;  4Y2S A;  4DFK A;  3H0R B;  2HHU A;  4K4H A;  5GTI U;  4JMU A;  2F2A B;  4NL9 A;  5DQI A;  7ICK A;  3QXG A;  3TFS A;  1FIQ A;  4UAU A;  2E8M A;  3LDA A;  5KFB A;  1XSP A;  4M9H A;  1S8O A;  4QZ8 A;  2E1E A;  4NV0 A;  4F4Z A;  4I2E A;  2KTQ A;  2ZG6 A;  4OJP A;  8ICB A;  2BDP A;  4M2Y A;  2ODG A;  4I29 A;  3GU3 A;  3NS1 A;  4UAS A;  3TFR A;  1KSP A;  4RQ7 A;  5ALO A;  3JPN A;  3OHB A;  3SV3 A;  2GOL A;  3JPO A;  2KD1 A;  4EEK A;  2P35 A;  2Q4T A;  2K60 A;  1FEZ A; 
#chains in the Genus database with same CATH homology
 1X6I A;  2JR5 A;  1X6J A;  1PUZ A;  2LM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...