2JR5A

Solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MYTAEQKARIKWACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNLSKVRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0350 protein VC_2471
publication title Solution structure of UPF0350 protein VC_2471.
rcsb
source organism Vibrio cholerae
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2jr5A00
1X6IA 2LM4A 2JR5A 1PUZA 1X6JA
chains in the Genus database with same CATH superfamily
2EZZA 3GV5B 5H2FU 4NLBA 4C7YA 1V9PA 8ICVA 5J2EA 5AKZA 4GXIA 4M9NA 1DK3A 3ZDDA 1ZQIA 2FLLA 3QNMA 2HCFA 3QZ8A 4EYIB 4F50A 4RPXA 5C0YA 4R8UA 5KFBA 1RYRA 4F4WA 5HR7A 3LDAA 1V85A 3ETRA 2EDUA 3ZDAA 3E58A 2FPLA 3DEEA 1L5UA 2HSZA 1SKWA 2PMZF 1ZQMA 2BPFA 5IINA 2KG5A 4B9TA 3A0BU 1SGGA 2HBLA 4MF8A 2MUTB 2ASLA 3NVZA 4PGXA 4FZLA 1GO3F 3RFAA 4JWMA 2KJ5A 2JH7A 3K4GA 5ALGA 5J2HA 3KZXA 2JEJA 1L3UA 9ICNA 2O6KA 4KLSA 2BQUA 1ZQLA 2D3DA 5DBBA 1S77D 3EWAA 1QSYA 2XY6A 2ZJ5A 3M8RA 2IOFK 1S76D 4F4KA 1X9XA 1XSNA 4QZAA 1LB2B 3NRWA 4UASA 4YD2A 4JV2A 4UB8U 1MQ3A 4FS1A 2KKPA 2J6SA 4RPYA 4ECTA 4BWMA 1KFDA 2KD1A 3A0HU 3TQ1A 4KLUA 2CN1A 7ICNA 4YD1A 2R8HA 4IQTA 2W9CA 2KHVA 4Y2XA 1ZQSA 2BHNA 1X42A 1TVAA 5DDMA 4DS4A 2CRXA 4RQ8A 4FS2A 3RJGA 2RLTA 1WG8A 1BPEA 5KT7A 3V7KA 2VA2A 5AK5A 1NK5A 4RQ2A 4I2FA 3RJJA 1A0PA 3MFHA 1ZQYA 2PI4A 3GFKB 3N28A 2LKYA 3PW7A 4U6PA 3WKEA 2K4PA 1NNLA 1Z00A 8ICZA 1B4FA 2J6TA 2BCQA 3CW2C 7ICMA 1TK8A 1A77A 4OCZA 4PHEA 3OGUA 3WK7A 4O5CA 5ALQA 2ISOA 4NLGA 3TACB 3BQTA 1RPLA 2K4IA 2F44A 3V72A 1SL1A 5KFHA 3BZKA 1UA1A 1ZQEA 5KL8B 2LI6A 3TANA 5KAFU 5AKXA 4M9GA 4QWEA 3NVYA 2FMPA 5ALDA 2UVWA 2HHTA 4LZGA 4MFFA 4Z6CA 2Z7JA 4PJ0U 4ECQA 1QQ5A 3N7PD 4F72A 4J9PA 1COKA 4OD0A 5AKHA 4IR1A 2BKEA 8ICLA 4USAA 3M9NB 1F44A 4YQWA 3BZCA 5KG1A 4Y2UA 2L5YA 1XU4A 2BCRA 2C2RA 1BPXA 5AM2A 1TAQA 4M6WA 1Z4OA 4KLGA 5J2KA 1L8OA 1B43A 4LVSA 5CWRA 2G5HB 4P0QA 3UQ2A 4RT2A 7ICRA 3H8WA 5AI0A 1X9MA 1QTMA 4ECSA 4YVZA 4EELA 3LVVA 3PW5A 5J0XA 2XY7A 8ICBA 5KFJA 2YX8A 7ICFA 4P0QB 1Y88A 1HEKA 3AU2A 3ETLA 3HW8A 5J2IA 3F2CA 2E8NA 3H4BA 5ALJA 4M9HA 3EW9A 2DQNB 3SI8A 5D4BA 4RQ0A 3QZ7A 4DL6A 4B9VA 1C7YA 4F5PA 3M7DA 3QUBA 5DKWA 1S0MA 4EEYA 2V4RA 3M9OB 3WK6A 3RBEA 4Y2JA 9ICWA 1WCLA 2Y9UA 4KLTA 2FDRA 4IC9A 3JPOA 1FIQA 1PK3A 2EQYA 5KT6A 2GH1A 4NL9A 4FZNA 4RQMA 4Y2QA 1JIHA 5KFIA 2I5HA 3ZDCA 1JMSA 4DF8A 1PVRA 4JK1A 3RB6A 4IQWA 3KOOA 5AK3A 4UBCA 1Q3VA 2ZIWB 3UMGA 3AUOA 2F1JA 3V7JA 1PUZA 2W04A 3FDSA 7ICUA 2FPMA 2A1JB 1SV0C 3Q8PB 3SAHA 4C7ZA 2YMPA 3PY8A 2NRZA 3L5KA 4EYHB 5L1LA 1A76A 2F77X 4PGYA 3OTQA 4J9NA 4KLQA 2KOBA 5TISU 2Q0ZX 2ODGA 2K4EA 2IOHA 2BPGA 4RNNA 5J0YA 4JMUA 4I28A 1SZPA 1KTQA 4DO9A 2KMDA 1S10A 3NRZA 2UVVA 5EE3A 2Q4TA 1KEJA 5IILA 3FM9A 4CF3A 4B9MA 5HHHA 4QZ8A 1S0NA 2HBKA 2XCPA 4ZH4A 4IQUA 1U48A 3PSFA 2AHOB 3PR5B 4JWNA 4CE6A 1Z4NA 7ICTA 3I76A 4K4GA 2AGOA 9ICQA 1KDHA 3F5AA 5DQGA 1ZD4A 9ICCA 4O5EA 1KLNA 3WKAA 1QLNA 2D6FC 2JRZA 2WAQF 2HMXA 5J8YC 3SEIA 3D2QA 4DFJA 2DUYA 2DBYA 2W9MA 1AROP 4K4IA 3BQ2A 2RQ5A 1N61A 2ZUCA 2AGPA 2C22A 4DFKA 3NGDA 4CDGA 2E8MA 4EZ9A 2W9AA 2NYVA 3MR2A 4RQ1A 4UAUA 4J03A 3Q8MA 1T8EA 3HKZF 2PFNA 4J9OA 2I1QA 4FBUA 2V4QA 4M04A 4F3OA 4NLZA 1SXDA 1MN8A 3UXPA 2EH9A 1O08A 4ECUA 7ICQA 2F8KA 3OPXA 4ED7A 4RQ6A 2C2EA 1CI4A 3PSPA 3K1RB 5EWGA 2JEFA 4BXOA 3SAGA 2F2AB 4EZ6A 1IV8A 2W43A 2WF5A 1BNOA 2I6XA 4US9A 3LWLA 2FMSA 5KFCA 3FAHA 5KFNA 5KG7A 3IG8A 3PV8A 2QARA 4BX9C 5J0UA 1TKDA 4QZDA 4YG2A 3AU6A 1UT8A 1ZJNA 3WKDA 3MFIA 4UARA 2ZIVB 3RF9A 3AL0B 4GC7A 3C23A 4F4ZA 2WB1C 1OXJA 9ICFA 5KFXA 2BQ3A 5ALPA 3BQ1A 4DQQA 4QIWF 4ELVA 5B66U 2ASJA 4EX6A 4M0AA 1ZQWA 3HRDD 4RU9A 4P2HA 1SB3C 2HOIA 2A19A 4JUZA 3H4DA 1BPZA 3QU5A 2BZFA 4PZNA 3TAPA 2B6GA 8ICCA 5AM5A 4ZOHC 1L7MA 1KFTA 4O3MA 1QSSA 3EUB2 4C8MA 4FFDA 1OW5A 1JALA 3Q8KA 2FPKA 5KT2A 3JPQA 2XC9A 3SD7A 3GQCA 3GU3A 2VIXA 2W8KA 1ZETA 1RZTA 1RQLA 3F53A 4RNOA 4PGQA 4C8NA 4I2IA 1NK9A 2QKQA 5IIIA 2KZ3A 1H38A 5AKJA 3G6VA 2CXYA 3V6KA 1J2MA 2W7PA 2W7OA 4NL9C 1SWWA 4TURA 2W03A 3LYSA 3RB3A 2W9BA 3JPRA 4KLHA 2JXJA 4A8EA 3HPOA 2KTQA 5E79U 2P66A 1NJZA 2M9NA 1DXSA 3M1YA 4Y2VA 2DFLA 4I2CA 4F92B 3AEVA 2YN4A 2UVUA 3MGVA 3C5GA 2KN7A 3LK9A 2E3TA 4YMOA 3SV3A 1X6IA 4RQ5A 1SIJA 1XO1A 3H7IA 4RUCA 4QWBA 5D49A 5DBCA 5ALIA 4DOBA 1ZQXA 1TAMA 4KLJA 2F8LA 3BS5A 1K5OA 1PVQA 1JN3A 2EZXA 4RQ4A 8ICTA 3WK9A 5AIAA 1S0OA 8ICUA 9ICUA 2YB1A 1D8YA 4F93B 9ICTA 1WUDA 3BS5B 2AJQA 2G07A 4J9LA 1B22A 4KX3A 2MUTA 3V6HA 3QUQA 3C29A 2VKQA 3GIJA 5ALRA 5J2CA 3M8SA 4ED2A 4IQVA 3TARA 2W3SA 5KL1B 2RRDA 8ICPA 5DGBA 1S0VA 4DLEA 2VANA 3IM1A 5DBAA 2NRXA 5ALKA 5AHXA 5J2JA 4Q8FA 5AI6A 5KFAA 4IRDA 2H5XA 4NWIA 8ICOA 1ZQHA 1LV5A 1CUKA 2HDOA 4ELTA 1N5WA 5TZVA 1LVHA 4O3NA 3GIIA 5KFQA 3E2EA 4C8KA 9ICVA 1SV0A 1WWUA 3QU7A 1U4BA 4KLLA 3KTQA 3MR5A 3H0LB 1PVPA 1K1QA 1B0XA 2JEGA 2IMWP 4XRHA 2QLTA 2KSOB 2KFZA 1CRXA 2MU2A 4LJXA 5ALSA 4UAZA 5KAIU 4I27A 1KL9A 4ECYA 2UVRA 4ICAA 1L6NA 3FC4A 2G06A 2JH1A 4CNQA 1V97A 3K1ZA 4J9RA 2BPCA 2HBMA 2HOQA 4K4HA 3DV9A 4DL5A 2AQ0A 3GV7B 1MA7A 2XO7A 4KTQA 5J2DA 5GTHU 1XSPA 3MR3A 3VC8A 1TE2A 3F5EA 2GOLA 3JPSA 2LMRA 3RR8A 4CCHA 3B9JA 1YZ6A 4QZHA 1CEZA 3ZD9A 2QB0A 2H3IA 3SQIA 5J0TA 4NJ8A 4ED3A 5J8YA 1ZOLA 4Y2TA 1LKYA 7ICLA 1HUOA 2DPJA 2YB4A 5KFZA 4RPZA 5CHGA 4CRXA 1L8LA 2QB0B 4ELUA 4J9KA 7ICGA 3TAQA 1KRPA 3WK4A 1LKYB 1SV4A 5HNKA 2HI0A 4AYBF 1N48A 3ONNA 3ZD8A 4KLOA 1QQ7A 4XQ8A 4C8OA 3T5KA 3AN1A 8ICKA 2ES6A 1P7DA 2G0AA 4DFPA 1ZQTA 4F5NA 1SKRA 2HBJA 1U47A 5DG8A 9ICXA 2E1FA 3IP4B 4TUSA 8ICNA 2G5IB 1TAUA 1QH9A 3BQ7A 4EBCA 9ICAA 4UB1A 4I2BA 1T3QA 2ZTDA 4YR0A 2FI1A 3LVWA 1ZQZA 1C20A 5AI8A 5CJ7A 1MC8A 4B9LA 2DGZA 4Y2PA 5L1JA 5ALHA 5AKEA 5KG2A 1ZQ1C 5J0OA 4Y2RA 1NK4A 5DGAA 3ZDEA 4MFAA 1KW4A 1NJWA 3C2KA 1ZQNA 5KFWA 4RNMA 3RJIA 1RM6C 1IM4A 4R66A 3ORYA 4DQSA 4KITB 3KBBA 5DQIA 4O3PA 1ZXIA 3NUQA 1S5LU 4JV0A 3TADC 5AKIA 2WHEA 1HJPA 4DF4A 2NRTA 4ECXA 1YT3A 4QJFB 1JXEA 1HUZA 4PL1A 2OYYA 3ISCA 5ALTA 2XI9A 1BPDA 8ICFA 3G6YA 1URJA 1S97A 2WAQC 3SR6A 1UT5A 1KQQA 3MBYA 3PO5A 3J81j 7ICEA 4DS5A 2R8GA 2NRVA 4RQNA 4UAWA 2OXOA 3PW2A 5KT5A 4IL6U 4DOAA 5AI5A 1MQ2A 2Y1JA 4YR3A 4E0DA 1K1SA 2ZXHA 4F2SA 2ZIWA 5KFKA 2HHXA 4DSKA 2RDJA 3HKZC 2FE9A 2A1JA 3N7SC 5KFGA 3T5HA 2LYAA 3PNCA 2PI5A 1BVSA 3PZPA 1IXRA 4WJ3B 1J2NA 1ZQJA 4NM2A 3E0FA 4KLMA 2E5SA 2LPEA 2H3VA 3ZDBA 2BDUA 2MRLA 1KSPA 5EOZA 1SWVA 4O0IA 2B0CA 5IIKA 3AM9A 1Z19A 5EE0A 4UAYA 5ALWA 1IIPA 1VJ5A 3WU2U 7ICOA 3HWTA 5AIBA 1RG6A 7ICIA 3C1ZA 4NLCA 5ALNA 5CR0A 2EAPA 4RQ3A 1D8LA 3HJEA 4F8RA 5GTIU 4PHAA 2ZIXB 2EANA 3C21A 1N2XA 4F71A 8ICRA 3MR6A 1NK6A 5BPCA 5B5EU 5AI9A 5ALZA 1U45A 3GZFA 1RXWA 1NK0A 4QIWC 3V6JA 3PO4A 2XCAA 3NVWA 4DL7A 3B0YA 2DF4B 1JI7A 2ISPA 2K89A 2WFAA 2KKVA 4G9BA 2R8JA 2JV3A 3RB0A 1DRGA 3RR7A 5AM1A 3PX0A 4TQRA 5G5GA 1TK0A 3PMNA 2LYHA 5DG7A 1ZD5A 8ICAA 1T94A 2ZIUA 4NV0A 2N1RA 1JRPA 1XNSA 4ED6A 3SV4A 2KEYA 2IBKA 4UW9A 4DSJA 2Y1IA 4DQRA 2XGPA 5J2GA 2RHFA 4PPXA 4Q8EA 4NLKA 4I2DA 2A1AA 2KJ8A 2K8BB 2K4HA 2ZIUB 4ECZA 5HR6A 4ED0A 3N97B 1ZJMA 9ICEA 4BDPA 1L7PA 3S6JA 9ICLA 3OJUA 5J0WA 4C0ZA 4PHPA 1X2IA 1F5SA 2BCUA 4IS7A 4B9SA 7ICSA 1KFSA 2ZIVA 4YFKA 2OH2A 4NM1A 3NASA 5KFTA 8ICHA 5J2BA 3KHHA 2ALZA 9ICOA 1L3TA 3RJKA 2H3ZA 5JRTA 4QNLA 2LM4A 4QWDA 8ICMA 4YMNA 4OJ6A 3U26A 4DLGA 1M6YA 1ZQRA 1X6JA 1VLBA 2FMQA 3MDAA 1YZ7A 4UQGA 3SZ2A 4O9MA 3OHAA 2NO4A 5A0LA 3TFRA 5EE9A 4KN4A 3EZ5A 4GC6A 2EAMA 1S8OA 2K8CB 3M6KA 5KG3A 4RZRA 3RAXA 4FZMA 3GDXA 2K8AA 4PL2A 3JPNA 4EBDA 4TUPA 5DB9A 9ICJA 2H3FA 2PFPA 4GIBA 4ECVA 2ASDA 4DSFA 2IA6A 5KT4A 4QWCA 3KHLA 3UMCA 5AKYA 4YXMA 5KG5A 4IRKA 3T5LA 1L7NA 1SL2A 1Z1BA 1OUQA 2VJ5A 1MSWD 4P0PA 5AKKA 1ZQFA 1NZBA 3PX6A 2MA1A 1RYUA 3THVA 1ZRNA 2FJ6A 2WF6A 2HOFA 3G6XA 4X5VA 1NOMA 4XUSA 2C28A 2ZTCA 4BWJA 4YMMA 3L4PA 5IIOA 2Y9TA 2PXIA 4P0PB 1VDVA 3RAQA 4JV1A 5J0SA 5G5HA 2HW3A 1N60A 2FLNA 5KFEA 2OHFA 4R65A 4F5QA 5KFVA 5CEHA 4QZFA 1L3VA 4EENA 2J6UA 4DSLA 5HMMA 1U9LA 1ZYQA 4ECWA 2R8IA 3C5FA 3OSPA 3EPIA 3QUCA 2KICA 1EXNA 3MABA 4ED8A 4LZDA 3WK8A 1BPBA 5AM3A 5AI4A 3ISDA 4YN4A 3NVVA 4QZIA 4KN7A 2WF9A 2YQEA 4C4TA 3RJFA 3RH5A 2KHQA 4UB5A 5KG0A 1D9FA 5ALFA 2JZBA 2WF7A 1KBUA 2P6RA 2C2DA 5KFFA 1ZQDA 2NO5A 1NKCA 1UCVA 2VA3A 3D2SA 3TADA 4CF4A 4CGZA 3D2NA 4MEXA 7ICJA 4O3QA 2VJ4A 2M0NA 2JZBB 3SENA 4YXJA 3GV8B 2YMMA 1XS9D 2BCVA 1FFUA 1ZQBA 4EX7A 4OJLA 2AXTU 4B9NA 5EE1A 4M9JA 1L3SA 2OCEA 1QQ6A 2XIDA 4Y2SA 2E8PA 3K75D 1NK7A 4DOCA 1BPYA 4R64A 3T5JA 3QU4A 1DOQA 3RB4A 3C1YA 1S9FA 3I28A 3QYPA 3I1YA 4DCCA 4M9LA 4RT3A 1NK8A 3QU9A 4QZEA 3TI0A 1U49A 4F5OA 2CPRA 5F9LA 3MGIA 4AYBC 3IG5A 3PW4A 2GLEA 4MFCA 1A6SA 1NJXA 3GIKA 2KSOA 2KIVA 2LM1A 1ZQGA 4R8UB 1QCKA 1N5XA 3BS7A 2W55A 2YTUA 2F1HA 3KKAC 3T3FA 5EWEA 5DLGA 8ICSA 3PW0A 4IRCA 2B21A 1ECWA 4I29A 2DKXA 2YY6A 1T4GA 4DQIA 5K4LA 5KFDA 4AP9A 1BGXT 4G3IA 1JUDA 5BOLA 2W11A 5ALMA 2PKEA 2Y0SF 2K60A 1FO4A 2WTFA 4Z6EA 2KIWA 1Q3UA 4QZBA 5J0RA 3PR4A 5EWFA 4KLEA 3KFUF 4DEZA 4OJPA 2F76X 5AK4A 3LWMA 3QE9Y 4F91B 1J97A 5J29A 3F2BA 3RRHA 2AGQA 2E8OA 4C80A 3NS1A 5D46A 2HVHA 2AU0A 3WK5A 3MC1A 8ICIA 1XSLA 4DL2A 4KLFA 3RH4A 2W9CB 2KZMA 2ESEA 2ZUBA 3EYZA 1RQNA 2DPIA 3ISBA 4QW9A 5HP4A 3ICXA 1PK1A 2LHTA 1ZQUA 4NY8A 4BUGA 1SZHA 4UB4A 4YR2A 3GILA 1X9WA 3EPGA 1ZQVA 4F5RA 4DL4A 9ICPA 2BQRA 2MSNA 3ALRA 2G08A 4Y2YA 2KVSA 5CA7A 5DB8A 3UM9A 2V9WA 4EBEA 4MEYA 3WKBA 3H40A 4Q43A 1PK1B 3R9KA 4KMOB 3ZI4A 3BDPA 3H0RB 4M2YA 1Z00B 5KG4A 2KJ9A 5AKGA 4ACOA 2RP5A 2P35A 4I2JA 5JTIA 5J2FA 4B9UA 5L1IA 1ZQKA 4J9SA 4B6JA 2KVCA 5KTQA 8ICWA 5JU5A 4HYKA 2AH5A 7ICVA 5KFOA 1Z3EB 5KFLA 1SXEA 1UPHA 2DL0A 2JGAA 2NV3A 5JUMA 1F0MA 2KE7A 3PMLA 1KN5A 4TUQA 3IHQB 2F3NA 3HX0A 3L3FX 2IHNA 4OO1J 2KZZA 2MAXA 3KHRA 4DL3A 5ALOA 3OJSA 1WCNA 3UXOA 1NJYA 8ICXA 1L7OA 5AK6A 3IV6A 2HHSA 3AQFA 2ZXIA 3HT3A 5L9XA 3SMVA 9ICIA 5KFYA 3QEAZ 2OWOA 5KNIA 2GO7A 3ED5A 2JEIA 4M6WB 4I2AA 4GXKA 4GXJA 3H0MB 1Q8KA 1AQ6A 1BNPA 3AMZA 2WF8A 2JHDA 3TFSA 4DQPA 1WWVA 3D6JA 2YMQA 2QB1A 4UB2A 5DDYA 4NLNA 4DFMA 2W54A 1ED1A 4XA5A 4RQ7A 2AQ4A 2HHQA 4CF5A 2DKZA 4GLXA 2XY5A 5ALXA 5KFRA 4P4OA 4F2RA 5HMLA 5DB7A 4DFDA 4NXZA 3MGHA 4QW8A 2P6UA 2ZG6A 2EAOA 1O03A 4QZCA 2R8KA 5DLFA 4J9QA 2HHVA 1RDFA 1TFRA 4P4PA 1PZNA 3UMBA 2XVTA 1N56A 2ZIXA 3CP8A 4KX5A 5CP2A 3NTUA 2JR5A 3N7RC 4I2HA 3M9MB 2YMLA 1FFVA 2XGQA 2HHUA 1DGJA 1X66A 8ICQA 2ZTEA 1ZQAA 1Z1VA 4O5KA 1NKBA 1ZQPA 1NZPA 1T7PA 3V7LA 5AM0A 4P4MA 4C4SA 1ZD2P 5CRXA 4I2EA 3Q8LA 4MF2A 4QWAA 4TQSA 4DWIA 3C2LA 7ICPA 3KD3A 4ED1A 5J0QA 2KK0A 7ICKA 4PHDA 2VA8A 3PVXA 4HAIA 9ICRA 3WKCA 3H8JA 3H8MA 3KZIU 5ALLA 4RUAA 4UB6U 3SAFA 2NRWA 4FO6A 4I2GA 3RTVA 5KFMA 9ICGA 3QU2A 1XC9A 1JX4A 2KV2A 5CB1A 3PX4A 1FEZA 2H3QA 2W3RA 3T79A 4EEKA 4UAVA 2BCSA 4ECRA 2HHWA 5KFPA 5AKLA 2RDIA 4DSEA 5FP0A 8ICJA 5DQHA 4OJOA 1XWLA 9ICMA 3OSNA 2D8CA 3KKAA 3OHBA 3PSTA 9ICHA 2BR0A 3BJYA 1RYSA 1T3NA 5KFSA 2ZJ8A 1NI3A 3AQEA 2KNJA 4YP3A 3FYHA 1X9SA 5J0PA 3CYMA 5IIJA 5DG9A 1RXVA 3MDCA 1WYGA 5BOMA 5DB6A 1ZQQA 3HILA 4UBBA 5ALUA 1V38A 3KHGA 1KKXA 4F4YA 2KP7A 5HHIA 3Q8SB 9ICBA 8ICGA 4PH5A 3IRUA 1UQVA 7ICHA 2GWSA 1N62A 1D9DA 8ICEA 5T14A 2G09A 3CNHA 4BXOB 3BQ0A 3RJHA 1ZRMA 3RJEA 4UB3A 2W8LA 4C8LA 1JROA 1NKEA 1TK5A 3IDWA 1N63A 2XICA 2QARB 4F4XA 4Q45A 2OM6A 1Q46A 1D8BA 1HIWA 2ZUDA 1IG6A 5J2AA 3Q8QB 2PFOA 4UATA 3O0FA 1UA0A 5AM4A 2HVIA 2F1IA 4BJQA 3VCBA 3RH6A 3QXGA 3N4MB 4QZ9A 2OEHA 5KG6A 4FBTA 2IOFA 1ZQOA 1TV9A 4C4RA 4O3OA 3C2MA 9ICKA 3QUTA 4GFJA 4Q44A 4O3SA 1COOA 4FE3A 2PMZC 2LBOA 4US8A 3GIMA 4IR9A 4BGDA 3UXNA 2ATLA 5L1KA 1DGSA 5KFUA 1ZQCA 5ALEA 2DWQA 5KT3A 5F9NA 1UHUA 5C5JA 4MHVA 4PZOA 3Q8RB 4R63A 2BDPA 4O3RA 5ALYA 2A3VA 2LYBA 4JB3A 4J9MA 3H8SA 1JXLA 5IIMA 1X40A 3IN5A 4YCXA 3HP6A 1XO0A 2PFQA 8ICYA 2E1EA 2EZYA 3TKAA 3DDHA 3B0XA 3SYZA 4KLIA 4KMUA 4U7CA 3M6ZA 4OJ5A 2ZJAA 3JPTA 5ALVA 2KFNA 3C28A 5L1MA 3QEBZ 3RRGA 3QX7A 1QSLA 2BGWA 2Y0SC 4Z6FA 4KLDA 3UQ0A 4Z6DA 1DK2A 2W9BB 2FLPA 3CRXA 1SL0A 2JMGA 2R18A 3RBDA 4DSIA 2WB1F 3UPQA 4M47A 3JPPA 3PSIA 4QZGA 5F3XB 1SKSA 9ICSA 2IHMA 1ZD3A 3F2DA 2I9GA 5AICA
chains in the Genus database with same CATH topology
1X6IA 2LM4A 2JR5A 1PUZA 1X6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6I A;  2LM4 A;  2JR5 A;  1PUZ A;  1X6J A; 
#chains in the Genus database with same CATH topology
 2EZZ A;  3GV5 B;  5H2F U;  4NLB A;  4C7Y A;  1V9P A;  8ICV A;  5J2E A;  5AKZ A;  4GXI A;  4M9N A;  1DK3 A;  3ZDD A;  1ZQI A;  2FLL A;  3QNM A;  2HCF A;  3QZ8 A;  4EYI B;  4F50 A;  4RPX A;  5C0Y A;  4R8U A;  5KFB A;  1RYR A;  4F4W A;  5HR7 A;  3LDA A;  1V85 A;  3ETR A;  2EDU A;  3ZDA A;  3E58 A;  2FPL A;  3DEE A;  1L5U A;  2HSZ A;  1SKW A;  2PMZ F;  1ZQM A;  2BPF A;  5IIN A;  2KG5 A;  4B9T A;  3A0B U;  1SGG A;  2HBL A;  4MF8 A;  2MUT B;  2ASL A;  3NVZ A;  4PGX A;  4FZL A;  1GO3 F;  3RFA A;  4JWM A;  2KJ5 A;  2JH7 A;  3K4G A;  5ALG A;  5J2H A;  3KZX A;  2JEJ A;  1L3U A;  9ICN A;  2O6K A;  4KLS A;  2BQU A;  1ZQL A;  2D3D A;  5DBB A;  1S77 D;  3EWA A;  1QSY A;  2XY6 A;  2ZJ5 A;  3M8R A;  2IOF K;  1S76 D;  4F4K A;  1X9X A;  1XSN A;  4QZA A;  1LB2 B;  3NRW A;  4UAS A;  4YD2 A;  4JV2 A;  4UB8 U;  1MQ3 A;  4FS1 A;  2KKP A;  2J6S A;  4RPY A;  4ECT A;  4BWM A;  1KFD A;  2KD1 A;  3A0H U;  3TQ1 A;  4KLU A;  2CN1 A;  7ICN A;  4YD1 A;  2R8H A;  4IQT A;  2W9C A;  2KHV A;  4Y2X A;  1ZQS A;  2BHN A;  1X42 A;  1TVA A;  5DDM A;  4DS4 A;  2CRX A;  4RQ8 A;  4FS2 A;  3RJG A;  2RLT A;  1WG8 A;  1BPE A;  5KT7 A;  3V7K A;  2VA2 A;  5AK5 A;  1NK5 A;  4RQ2 A;  4I2F A;  3RJJ A;  1A0P A;  3MFH A;  1ZQY A;  2PI4 A;  3GFK B;  3N28 A;  2LKY A;  3PW7 A;  4U6P A;  3WKE A;  2K4P A;  1NNL A;  1Z00 A;  8ICZ A;  1B4F A;  2J6T A;  2BCQ A;  3CW2 C;  7ICM A;  1TK8 A;  1A77 A;  4OCZ A;  4PHE A;  3OGU A;  3WK7 A;  4O5C A;  5ALQ A;  2ISO A;  4NLG A;  3TAC B;  3BQT A;  1RPL A;  2K4I A;  2F44 A;  3V72 A;  1SL1 A;  5KFH A;  3BZK A;  1UA1 A;  1ZQE A;  5KL8 B;  2LI6 A;  3TAN A;  5KAF U;  5AKX A;  4M9G A;  4QWE A;  3NVY A;  2FMP A;  5ALD A;  2UVW A;  2HHT A;  4LZG A;  4MFF A;  4Z6C A;  2Z7J A;  4PJ0 U;  4ECQ A;  1QQ5 A;  3N7P D;  4F72 A;  4J9P A;  1COK A;  4OD0 A;  5AKH A;  4IR1 A;  2BKE A;  8ICL A;  4USA A;  3M9N B;  1F44 A;  4YQW A;  3BZC A;  5KG1 A;  4Y2U A;  2L5Y A;  1XU4 A;  2BCR A;  2C2R A;  1BPX A;  5AM2 A;  1TAQ A;  4M6W A;  1Z4O A;  4KLG A;  5J2K A;  1L8O A;  1B43 A;  4LVS A;  5CWR A;  2G5H B;  4P0Q A;  3UQ2 A;  4RT2 A;  7ICR A;  3H8W A;  5AI0 A;  1X9M A;  1QTM A;  4ECS A;  4YVZ A;  4EEL A;  3LVV A;  3PW5 A;  5J0X A;  2XY7 A;  8ICB A;  5KFJ A;  2YX8 A;  7ICF A;  4P0Q B;  1Y88 A;  1HEK A;  3AU2 A;  3ETL A;  3HW8 A;  5J2I A;  3F2C A;  2E8N A;  3H4B A;  5ALJ A;  4M9H A;  3EW9 A;  2DQN B;  3SI8 A;  5D4B A;  4RQ0 A;  3QZ7 A;  4DL6 A;  4B9V A;  1C7Y A;  4F5P A;  3M7D A;  3QUB A;  5DKW A;  1S0M A;  4EEY A;  2V4R A;  3M9O B;  3WK6 A;  3RBE A;  4Y2J A;  9ICW A;  1WCL A;  2Y9U A;  4KLT A;  2FDR A;  4IC9 A;  3JPO A;  1FIQ A;  1PK3 A;  2EQY A;  5KT6 A;  2GH1 A;  4NL9 A;  4FZN A;  4RQM A;  4Y2Q A;  1JIH A;  5KFI A;  2I5H A;  3ZDC A;  1JMS A;  4DF8 A;  1PVR A;  4JK1 A;  3RB6 A;  4IQW A;  3KOO A;  5AK3 A;  4UBC A;  1Q3V A;  2ZIW B;  3UMG A;  3AUO A;  2F1J A;  3V7J A;  1PUZ A;  2W04 A;  3FDS A;  7ICU A;  2FPM A;  2A1J B;  1SV0 C;  3Q8P B;  3SAH A;  4C7Z A;  2YMP A;  3PY8 A;  2NRZ A;  3L5K A;  4EYH B;  5L1L A;  1A76 A;  2F77 X;  4PGY A;  3OTQ A;  4J9N A;  4KLQ A;  2KOB A;  5TIS U;  2Q0Z X;  2ODG A;  2K4E A;  2IOH A;  2BPG A;  4RNN A;  5J0Y A;  4JMU A;  4I28 A;  1SZP A;  1KTQ A;  4DO9 A;  2KMD A;  1S10 A;  3NRZ A;  2UVV A;  5EE3 A;  2Q4T A;  1KEJ A;  5IIL A;  3FM9 A;  4CF3 A;  4B9M A;  5HHH A;  4QZ8 A;  1S0N A;  2HBK A;  2XCP A;  4ZH4 A;  4IQU A;  1U48 A;  3PSF A;  2AHO B;  3PR5 B;  4JWN A;  4CE6 A;  1Z4N A;  7ICT A;  3I76 A;  4K4G A;  2AGO A;  9ICQ A;  1KDH A;  3F5A A;  5DQG A;  1ZD4 A;  9ICC A;  4O5E A;  1KLN A;  3WKA A;  1QLN A;  2D6F C;  2JRZ A;  2WAQ F;  2HMX A;  5J8Y C;  3SEI A;  3D2Q A;  4DFJ A;  2DUY A;  2DBY A;  2W9M A;  1ARO P;  4K4I A;  3BQ2 A;  2RQ5 A;  1N61 A;  2ZUC A;  2AGP A;  2C22 A;  4DFK A;  3NGD A;  4CDG A;  2E8M A;  4EZ9 A;  2W9A A;  2NYV A;  3MR2 A;  4RQ1 A;  4UAU A;  4J03 A;  3Q8M A;  1T8E A;  3HKZ F;  2PFN A;  4J9O A;  2I1Q A;  4FBU A;  2V4Q A;  4M04 A;  4F3O A;  4NLZ A;  1SXD A;  1MN8 A;  3UXP A;  2EH9 A;  1O08 A;  4ECU A;  7ICQ A;  2F8K A;  3OPX A;  4ED7 A;  4RQ6 A;  2C2E A;  1CI4 A;  3PSP A;  3K1R B;  5EWG A;  2JEF A;  4BXO A;  3SAG A;  2F2A B;  4EZ6 A;  1IV8 A;  2W43 A;  2WF5 A;  1BNO A;  2I6X A;  4US9 A;  3LWL A;  2FMS A;  5KFC A;  3FAH A;  5KFN A;  5KG7 A;  3IG8 A;  3PV8 A;  2QAR A;  4BX9 C;  5J0U A;  1TKD A;  4QZD A;  4YG2 A;  3AU6 A;  1UT8 A;  1ZJN A;  3WKD A;  3MFI A;  4UAR A;  2ZIV B;  3RF9 A;  3AL0 B;  4GC7 A;  3C23 A;  4F4Z A;  2WB1 C;  1OXJ A;  9ICF A;  5KFX A;  2BQ3 A;  5ALP A;  3BQ1 A;  4DQQ A;  4QIW F;  4ELV A;  5B66 U;  2ASJ A;  4EX6 A;  4M0A A;  1ZQW A;  3HRD D;  4RU9 A;  4P2H A;  1SB3 C;  2HOI A;  2A19 A;  4JUZ A;  3H4D A;  1BPZ A;  3QU5 A;  2BZF A;  4PZN A;  3TAP A;  2B6G A;  8ICC A;  5AM5 A;  4ZOH C;  1L7M A;  1KFT A;  4O3M A;  1QSS A;  3EUB 2;  4C8M A;  4FFD A;  1OW5 A;  1JAL A;  3Q8K A;  2FPK A;  5KT2 A;  3JPQ A;  2XC9 A;  3SD7 A;  3GQC A;  3GU3 A;  2VIX A;  2W8K A;  1ZET A;  1RZT A;  1RQL A;  3F53 A;  4RNO A;  4PGQ A;  4C8N A;  4I2I A;  1NK9 A;  2QKQ A;  5III A;  2KZ3 A;  1H38 A;  5AKJ A;  3G6V A;  2CXY A;  3V6K A;  1J2M A;  2W7P A;  2W7O A;  4NL9 C;  1SWW A;  4TUR A;  2W03 A;  3LYS A;  3RB3 A;  2W9B A;  3JPR A;  4KLH A;  2JXJ A;  4A8E A;  3HPO A;  2KTQ A;  5E79 U;  2P66 A;  1NJZ A;  2M9N A;  1DXS A;  3M1Y A;  4Y2V A;  2DFL A;  4I2C A;  4F92 B;  3AEV A;  2YN4 A;  2UVU A;  3MGV A;  3C5G A;  2KN7 A;  3LK9 A;  2E3T A;  4YMO A;  3SV3 A;  1X6I A;  4RQ5 A;  1SIJ A;  1XO1 A;  3H7I A;  4RUC A;  4QWB A;  5D49 A;  5DBC A;  5ALI A;  4DOB A;  1ZQX A;  1TAM A;  4KLJ A;  2F8L A;  3BS5 A;  1K5O A;  1PVQ A;  1JN3 A;  2EZX A;  4RQ4 A;  8ICT A;  3WK9 A;  5AIA A;  1S0O A;  8ICU A;  9ICU A;  2YB1 A;  1D8Y A;  4F93 B;  9ICT A;  1WUD A;  3BS5 B;  2AJQ A;  2G07 A;  4J9L A;  1B22 A;  4KX3 A;  2MUT A;  3V6H A;  3QUQ A;  3C29 A;  2VKQ A;  3GIJ A;  5ALR A;  5J2C A;  3M8S A;  4ED2 A;  4IQV A;  3TAR A;  2W3S A;  5KL1 B;  2RRD A;  8ICP A;  5DGB A;  1S0V A;  4DLE A;  2VAN A;  3IM1 A;  5DBA A;  2NRX A;  5ALK A;  5AHX A;  5J2J A;  4Q8F A;  5AI6 A;  5KFA A;  4IRD A;  2H5X A;  4NWI A;  8ICO A;  1ZQH A;  1LV5 A;  1CUK A;  2HDO A;  4ELT A;  1N5W A;  5TZV A;  1LVH A;  4O3N A;  3GII A;  5KFQ A;  3E2E A;  4C8K A;  9ICV A;  1SV0 A;  1WWU A;  3QU7 A;  1U4B A;  4KLL A;  3KTQ A;  3MR5 A;  3H0L B;  1PVP A;  1K1Q A;  1B0X A;  2JEG A;  2IMW P;  4XRH A;  2QLT A;  2KSO B;  2KFZ A;  1CRX A;  2MU2 A;  4LJX A;  5ALS A;  4UAZ A;  5KAI U;  4I27 A;  1KL9 A;  4ECY A;  2UVR A;  4ICA A;  1L6N A;  3FC4 A;  2G06 A;  2JH1 A;  4CNQ A;  1V97 A;  3K1Z A;  4J9R A;  2BPC A;  2HBM A;  2HOQ A;  4K4H A;  3DV9 A;  4DL5 A;  2AQ0 A;  3GV7 B;  1MA7 A;  2XO7 A;  4KTQ A;  5J2D A;  5GTH U;  1XSP A;  3MR3 A;  3VC8 A;  1TE2 A;  3F5E A;  2GOL A;  3JPS A;  2LMR A;  3RR8 A;  4CCH A;  3B9J A;  1YZ6 A;  4QZH A;  1CEZ A;  3ZD9 A;  2QB0 A;  2H3I A;  3SQI A;  5J0T A;  4NJ8 A;  4ED3 A;  5J8Y A;  1ZOL A;  4Y2T A;  1LKY A;  7ICL A;  1HUO A;  2DPJ A;  2YB4 A;  5KFZ A;  4RPZ A;  5CHG A;  4CRX A;  1L8L A;  2QB0 B;  4ELU A;  4J9K A;  7ICG A;  3TAQ A;  1KRP A;  3WK4 A;  1LKY B;  1SV4 A;  5HNK A;  2HI0 A;  4AYB F;  1N48 A;  3ONN A;  3ZD8 A;  4KLO A;  1QQ7 A;  4XQ8 A;  4C8O A;  3T5K A;  3AN1 A;  8ICK A;  2ES6 A;  1P7D A;  2G0A A;  4DFP A;  1ZQT A;  4F5N A;  1SKR A;  2HBJ A;  1U47 A;  5DG8 A;  9ICX A;  2E1F A;  3IP4 B;  4TUS A;  8ICN A;  2G5I B;  1TAU A;  1QH9 A;  3BQ7 A;  4EBC A;  9ICA A;  4UB1 A;  4I2B A;  1T3Q A;  2ZTD A;  4YR0 A;  2FI1 A;  3LVW A;  1ZQZ A;  1C20 A;  5AI8 A;  5CJ7 A;  1MC8 A;  4B9L A;  2DGZ A;  4Y2P A;  5L1J A;  5ALH A;  5AKE A;  5KG2 A;  1ZQ1 C;  5J0O A;  4Y2R A;  1NK4 A;  5DGA A;  3ZDE A;  4MFA A;  1KW4 A;  1NJW A;  3C2K A;  1ZQN A;  5KFW A;  4RNM A;  3RJI A;  1RM6 C;  1IM4 A;  4R66 A;  3ORY A;  4DQS A;  4KIT B;  3KBB A;  5DQI A;  4O3P A;  1ZXI A;  3NUQ A;  1S5L U;  4JV0 A;  3TAD C;  5AKI A;  2WHE A;  1HJP A;  4DF4 A;  2NRT A;  4ECX A;  1YT3 A;  4QJF B;  1JXE A;  1HUZ A;  4PL1 A;  2OYY A;  3ISC A;  5ALT A;  2XI9 A;  1BPD A;  8ICF A;  3G6Y A;  1URJ A;  1S97 A;  2WAQ C;  3SR6 A;  1UT5 A;  1KQQ A;  3MBY A;  3PO5 A;  3J81 j;  7ICE A;  4DS5 A;  2R8G A;  2NRV A;  4RQN A;  4UAW A;  2OXO A;  3PW2 A;  5KT5 A;  4IL6 U;  4DOA A;  5AI5 A;  1MQ2 A;  2Y1J A;  4YR3 A;  4E0D A;  1K1S A;  2ZXH A;  4F2S A;  2ZIW A;  5KFK A;  2HHX A;  4DSK A;  2RDJ A;  3HKZ C;  2FE9 A;  2A1J A;  3N7S C;  5KFG A;  3T5H A;  2LYA A;  3PNC A;  2PI5 A;  1BVS A;  3PZP A;  1IXR A;  4WJ3 B;  1J2N A;  1ZQJ A;  4NM2 A;  3E0F A;  4KLM A;  2E5S A;  2LPE A;  2H3V A;  3ZDB A;  2BDU A;  2MRL A;  1KSP A;  5EOZ A;  1SWV A;  4O0I A;  2B0C A;  5IIK A;  3AM9 A;  1Z19 A;  5EE0 A;  4UAY A;  5ALW A;  1IIP A;  1VJ5 A;  3WU2 U;  7ICO A;  3HWT A;  5AIB A;  1RG6 A;  7ICI A;  3C1Z A;  4NLC A;  5ALN A;  5CR0 A;  2EAP A;  4RQ3 A;  1D8L A;  3HJE A;  4F8R A;  5GTI U;  4PHA A;  2ZIX B;  2EAN A;  3C21 A;  1N2X A;  4F71 A;  8ICR A;  3MR6 A;  1NK6 A;  5BPC A;  5B5E U;  5AI9 A;  5ALZ A;  1U45 A;  3GZF A;  1RXW A;  1NK0 A;  4QIW C;  3V6J A;  3PO4 A;  2XCA A;  3NVW A;  4DL7 A;  3B0Y A;  2DF4 B;  1JI7 A;  2ISP A;  2K89 A;  2WFA A;  2KKV A;  4G9B A;  2R8J A;  2JV3 A;  3RB0 A;  1DRG A;  3RR7 A;  5AM1 A;  3PX0 A;  4TQR A;  5G5G A;  1TK0 A;  3PMN A;  2LYH A;  5DG7 A;  1ZD5 A;  8ICA A;  1T94 A;  2ZIU A;  4NV0 A;  2N1R A;  1JRP A;  1XNS A;  4ED6 A;  3SV4 A;  2KEY A;  2IBK A;  4UW9 A;  4DSJ A;  2Y1I A;  4DQR A;  2XGP A;  5J2G A;  2RHF A;  4PPX A;  4Q8E A;  4NLK A;  4I2D A;  2A1A A;  2KJ8 A;  2K8B B;  2K4H A;  2ZIU B;  4ECZ A;  5HR6 A;  4ED0 A;  3N97 B;  1ZJM A;  9ICE A;  4BDP A;  1L7P A;  3S6J A;  9ICL A;  3OJU A;  5J0W A;  4C0Z A;  4PHP A;  1X2I A;  1F5S A;  2BCU A;  4IS7 A;  4B9S A;  7ICS A;  1KFS A;  2ZIV A;  4YFK A;  2OH2 A;  4NM1 A;  3NAS A;  5KFT A;  8ICH A;  5J2B A;  3KHH A;  2ALZ A;  9ICO A;  1L3T A;  3RJK A;  2H3Z A;  5JRT A;  4QNL A;  2LM4 A;  4QWD A;  8ICM A;  4YMN A;  4OJ6 A;  3U26 A;  4DLG A;  1M6Y A;  1ZQR A;  1X6J A;  1VLB A;  2FMQ A;  3MDA A;  1YZ7 A;  4UQG A;  3SZ2 A;  4O9M A;  3OHA A;  2NO4 A;  5A0L A;  3TFR A;  5EE9 A;  4KN4 A;  3EZ5 A;  4GC6 A;  2EAM A;  1S8O A;  2K8C B;  3M6K A;  5KG3 A;  4RZR A;  3RAX A;  4FZM A;  3GDX A;  2K8A A;  4PL2 A;  3JPN A;  4EBD A;  4TUP A;  5DB9 A;  9ICJ A;  2H3F A;  2PFP A;  4GIB A;  4ECV A;  2ASD A;  4DSF A;  2IA6 A;  5KT4 A;  4QWC A;  3KHL A;  3UMC A;  5AKY A;  4YXM A;  5KG5 A;  4IRK A;  3T5L A;  1L7N A;  1SL2 A;  1Z1B A;  1OUQ A;  2VJ5 A;  1MSW D;  4P0P A;  5AKK A;  1ZQF A;  1NZB A;  3PX6 A;  2MA1 A;  1RYU A;  3THV A;  1ZRN A;  2FJ6 A;  2WF6 A;  2HOF A;  3G6X A;  4X5V A;  1NOM A;  4XUS A;  2C28 A;  2ZTC A;  4BWJ A;  4YMM A;  3L4P A;  5IIO A;  2Y9T A;  2PXI A;  4P0P B;  1VDV A;  3RAQ A;  4JV1 A;  5J0S A;  5G5H A;  2HW3 A;  1N60 A;  2FLN A;  5KFE A;  2OHF A;  4R65 A;  4F5Q A;  5KFV A;  5CEH A;  4QZF A;  1L3V A;  4EEN A;  2J6U A;  4DSL A;  5HMM A;  1U9L A;  1ZYQ A;  4ECW A;  2R8I A;  3C5F A;  3OSP A;  3EPI A;  3QUC A;  2KIC A;  1EXN A;  3MAB A;  4ED8 A;  4LZD A;  3WK8 A;  1BPB A;  5AM3 A;  5AI4 A;  3ISD A;  4YN4 A;  3NVV A;  4QZI A;  4KN7 A;  2WF9 A;  2YQE A;  4C4T A;  3RJF A;  3RH5 A;  2KHQ A;  4UB5 A;  5KG0 A;  1D9F A;  5ALF A;  2JZB A;  2WF7 A;  1KBU A;  2P6R A;  2C2D A;  5KFF A;  1ZQD A;  2NO5 A;  1NKC A;  1UCV A;  2VA3 A;  3D2S A;  3TAD A;  4CF4 A;  4CGZ A;  3D2N A;  4MEX A;  7ICJ A;  4O3Q A;  2VJ4 A;  2M0N A;  2JZB B;  3SEN A;  4YXJ A;  3GV8 B;  2YMM A;  1XS9 D;  2BCV A;  1FFU A;  1ZQB A;  4EX7 A;  4OJL A;  2AXT U;  4B9N A;  5EE1 A;  4M9J A;  1L3S A;  2OCE A;  1QQ6 A;  2XID A;  4Y2S A;  2E8P A;  3K75 D;  1NK7 A;  4DOC A;  1BPY A;  4R64 A;  3T5J A;  3QU4 A;  1DOQ A;  3RB4 A;  3C1Y A;  1S9F A;  3I28 A;  3QYP A;  3I1Y A;  4DCC A;  4M9L A;  4RT3 A;  1NK8 A;  3QU9 A;  4QZE A;  3TI0 A;  1U49 A;  4F5O A;  2CPR A;  5F9L A;  3MGI A;  4AYB C;  3IG5 A;  3PW4 A;  2GLE A;  4MFC A;  1A6S A;  1NJX A;  3GIK A;  2KSO A;  2KIV A;  2LM1 A;  1ZQG A;  4R8U B;  1QCK A;  1N5X A;  3BS7 A;  2W55 A;  2YTU A;  2F1H A;  3KKA C;  3T3F A;  5EWE A;  5DLG A;  8ICS A;  3PW0 A;  4IRC A;  2B21 A;  1ECW A;  4I29 A;  2DKX A;  2YY6 A;  1T4G A;  4DQI A;  5K4L A;  5KFD A;  4AP9 A;  1BGX T;  4G3I A;  1JUD A;  5BOL A;  2W11 A;  5ALM A;  2PKE A;  2Y0S F;  2K60 A;  1FO4 A;  2WTF A;  4Z6E A;  2KIW A;  1Q3U A;  4QZB A;  5J0R A;  3PR4 A;  5EWF A;  4KLE A;  3KFU F;  4DEZ A;  4OJP A;  2F76 X;  5AK4 A;  3LWM A;  3QE9 Y;  4F91 B;  1J97 A;  5J29 A;  3F2B A;  3RRH A;  2AGQ A;  2E8O A;  4C80 A;  3NS1 A;  5D46 A;  2HVH A;  2AU0 A;  3WK5 A;  3MC1 A;  8ICI A;  1XSL A;  4DL2 A;  4KLF A;  3RH4 A;  2W9C B;  2KZM A;  2ESE A;  2ZUB A;  3EYZ A;  1RQN A;  2DPI A;  3ISB A;  4QW9 A;  5HP4 A;  3ICX A;  1PK1 A;  2LHT A;  1ZQU A;  4NY8 A;  4BUG A;  1SZH A;  4UB4 A;  4YR2 A;  3GIL A;  1X9W A;  3EPG A;  1ZQV A;  4F5R A;  4DL4 A;  9ICP A;  2BQR A;  2MSN A;  3ALR A;  2G08 A;  4Y2Y A;  2KVS A;  5CA7 A;  5DB8 A;  3UM9 A;  2V9W A;  4EBE A;  4MEY A;  3WKB A;  3H40 A;  4Q43 A;  1PK1 B;  3R9K A;  4KMO B;  3ZI4 A;  3BDP A;  3H0R B;  4M2Y A;  1Z00 B;  5KG4 A;  2KJ9 A;  5AKG A;  4ACO A;  2RP5 A;  2P35 A;  4I2J A;  5JTI A;  5J2F A;  4B9U A;  5L1I A;  1ZQK A;  4J9S A;  4B6J A;  2KVC A;  5KTQ A;  8ICW A;  5JU5 A;  4HYK A;  2AH5 A;  7ICV A;  5KFO A;  1Z3E B;  5KFL A;  1SXE A;  1UPH A;  2DL0 A;  2JGA A;  2NV3 A;  5JUM A;  1F0M A;  2KE7 A;  3PML A;  1KN5 A;  4TUQ A;  3IHQ B;  2F3N A;  3HX0 A;  3L3F X;  2IHN A;  4OO1 J;  2KZZ A;  2MAX A;  3KHR A;  4DL3 A;  5ALO A;  3OJS A;  1WCN A;  3UXO A;  1NJY A;  8ICX A;  1L7O A;  5AK6 A;  3IV6 A;  2HHS A;  3AQF A;  2ZXI A;  3HT3 A;  5L9X A;  3SMV A;  9ICI A;  5KFY A;  3QEA Z;  2OWO A;  5KNI A;  2GO7 A;  3ED5 A;  2JEI A;  4M6W B;  4I2A A;  4GXK A;  4GXJ A;  3H0M B;  1Q8K A;  1AQ6 A;  1BNP A;  3AMZ A;  2WF8 A;  2JHD A;  3TFS A;  4DQP A;  1WWV A;  3D6J A;  2YMQ A;  2QB1 A;  4UB2 A;  5DDY A;  4NLN A;  4DFM A;  2W54 A;  1ED1 A;  4XA5 A;  4RQ7 A;  2AQ4 A;  2HHQ A;  4CF5 A;  2DKZ A;  4GLX A;  2XY5 A;  5ALX A;  5KFR A;  4P4O A;  4F2R A;  5HML A;  5DB7 A;  4DFD A;  4NXZ A;  3MGH A;  4QW8 A;  2P6U A;  2ZG6 A;  2EAO A;  1O03 A;  4QZC A;  2R8K A;  5DLF A;  4J9Q A;  2HHV A;  1RDF A;  1TFR A;  4P4P A;  1PZN A;  3UMB A;  2XVT A;  1N56 A;  2ZIX A;  3CP8 A;  4KX5 A;  5CP2 A;  3NTU A;  2JR5 A;  3N7R C;  4I2H A;  3M9M B;  2YML A;  1FFV A;  2XGQ A;  2HHU A;  1DGJ A;  1X66 A;  8ICQ A;  2ZTE A;  1ZQA A;  1Z1V A;  4O5K A;  1NKB A;  1ZQP A;  1NZP A;  1T7P A;  3V7L A;  5AM0 A;  4P4M A;  4C4S A;  1ZD2 P;  5CRX A;  4I2E A;  3Q8L A;  4MF2 A;  4QWA A;  4TQS A;  4DWI A;  3C2L A;  7ICP A;  3KD3 A;  4ED1 A;  5J0Q A;  2KK0 A;  7ICK A;  4PHD A;  2VA8 A;  3PVX A;  4HAI A;  9ICR A;  3WKC A;  3H8J A;  3H8M A;  3KZI U;  5ALL A;  4RUA A;  4UB6 U;  3SAF A;  2NRW A;  4FO6 A;  4I2G A;  3RTV A;  5KFM A;  9ICG A;  3QU2 A;  1XC9 A;  1JX4 A;  2KV2 A;  5CB1 A;  3PX4 A;  1FEZ A;  2H3Q A;  2W3R A;  3T79 A;  4EEK A;  4UAV A;  2BCS A;  4ECR A;  2HHW A;  5KFP A;  5AKL A;  2RDI A;  4DSE A;  5FP0 A;  8ICJ A;  5DQH A;  4OJO A;  1XWL A;  9ICM A;  3OSN A;  2D8C A;  3KKA A;  3OHB A;  3PST A;  9ICH A;  2BR0 A;  3BJY A;  1RYS A;  1T3N A;  5KFS A;  2ZJ8 A;  1NI3 A;  3AQE A;  2KNJ A;  4YP3 A;  3FYH A;  1X9S A;  5J0P A;  3CYM A;  5IIJ A;  5DG9 A;  1RXV A;  3MDC A;  1WYG A;  5BOM A;  5DB6 A;  1ZQQ A;  3HIL A;  4UBB A;  5ALU A;  1V38 A;  3KHG A;  1KKX A;  4F4Y A;  2KP7 A;  5HHI A;  3Q8S B;  9ICB A;  8ICG A;  4PH5 A;  3IRU A;  1UQV A;  7ICH A;  2GWS A;  1N62 A;  1D9D A;  8ICE A;  5T14 A;  2G09 A;  3CNH A;  4BXO B;  3BQ0 A;  3RJH A;  1ZRM A;  3RJE A;  4UB3 A;  2W8L A;  4C8L A;  1JRO A;  1NKE A;  1TK5 A;  3IDW A;  1N63 A;  2XIC A;  2QAR B;  4F4X A;  4Q45 A;  2OM6 A;  1Q46 A;  1D8B A;  1HIW A;  2ZUD A;  1IG6 A;  5J2A A;  3Q8Q B;  2PFO A;  4UAT A;  3O0F A;  1UA0 A;  5AM4 A;  2HVI A;  2F1I A;  4BJQ A;  3VCB A;  3RH6 A;  3QXG A;  3N4M B;  4QZ9 A;  2OEH A;  5KG6 A;  4FBT A;  2IOF A;  1ZQO A;  1TV9 A;  4C4R A;  4O3O A;  3C2M A;  9ICK A;  3QUT A;  4GFJ A;  4Q44 A;  4O3S A;  1COO A;  4FE3 A;  2PMZ C;  2LBO A;  4US8 A;  3GIM A;  4IR9 A;  4BGD A;  3UXN A;  2ATL A;  5L1K A;  1DGS A;  5KFU A;  1ZQC A;  5ALE A;  2DWQ A;  5KT3 A;  5F9N A;  1UHU A;  5C5J A;  4MHV A;  4PZO A;  3Q8R B;  4R63 A;  2BDP A;  4O3R A;  5ALY A;  2A3V A;  2LYB A;  4JB3 A;  4J9M A;  3H8S A;  1JXL A;  5IIM A;  1X40 A;  3IN5 A;  4YCX A;  3HP6 A;  1XO0 A;  2PFQ A;  8ICY A;  2E1E A;  2EZY A;  3TKA A;  3DDH A;  3B0X A;  3SYZ A;  4KLI A;  4KMU A;  4U7C A;  3M6Z A;  4OJ5 A;  2ZJA A;  3JPT A;  5ALV A;  2KFN A;  3C28 A;  5L1M A;  3QEB Z;  3RRG A;  3QX7 A;  1QSL A;  2BGW A;  2Y0S C;  4Z6F A;  4KLD A;  3UQ0 A;  4Z6D A;  1DK2 A;  2W9B B;  2FLP A;  3CRX A;  1SL0 A;  2JMG A;  2R18 A;  3RBD A;  4DSI A;  2WB1 F;  3UPQ A;  4M47 A;  3JPP A;  3PSI A;  4QZG A;  5F3X B;  1SKS A;  9ICS A;  2IHM A;  1ZD3 A;  3F2D A;  2I9G A;  5AIC A; 
#chains in the Genus database with same CATH homology
 1X6I A;  2LM4 A;  2JR5 A;  1PUZ A;  1X6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...