2JR5A

Solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
b'MYTAEQKARIKWACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAHNLSKVRLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0350 protein VC_2471
publication title Solution structure of UPF0350 protein VC_2471.
rcsb
source organism Vibrio cholerae
molecule tags Structural genomics, unknown function
total genus 26
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2jr5A00
1PUZA 1X6IA 2LM4A 2JR5A 1X6JA
chains in the Genus database with same CATH superfamily
2HHXA 2C22A 1WUDA 4TURA 2F1IA 8ICSA 3ZDAA 7ICPA 1NI3A 4F4ZA 2RP5A 4KX3A 4B9TA 1X42A 1N5WA 1SXDA 3BQTA 2E8MA 2YMQA 2OHFA 2EAPA 1SB3C 2BZFA 2JXJA 4J9OA 2XI9A 5ALOA 2PI4A 2ES6A 3SR6A 3CP8A 2W8KA 2NRWA 4RQ3A 4Z6EA 1V97A 4ECVA 3O0FA 2ZIUB 3OJSA 9ICLA 8ICMA 4HAIA 2W9BA 2KNJA 3A0BU 4LJXA 7ICGA 4KLTA 4NLGA 3JPQA 3EPGA 4B9SA 1KBUA 2P35A 1S97A 2AHOB 1WWVA 2ZTEA 3KTQA 2YB1A 1COKA 3KKAA 5DG9A 2K4HA 2FPKA 2Q0ZX 2R8JA 3Q8MA 4IR9A 1Z1BA 3BS5A 1PVRA 5KG6A 4IRKA 3ZDBA 2KHVA 3RR8A 2YB4A 5ALUA 2G09A 4I2AA 2PI5A 2BCVA 2E8PA 9ICNA 3UXPA 5J2CA 4CRXA 3KD3A 4MEXA 4M04A 1S0NA 4C4SA 5EWGA 5J0XA 4J9NA 4XQ8A 3AN1A 4YD2A 5ALKA 4Y2YA 1IG6A 3TAQA 1N2XA 1ZRNA 2FPLA 7ICOA 4DL5A 2H3FA 1TK5A 3V7JA 4RT3A 3UMBA 1Z19A 2AGPA 4X5VA 3HPOA 3ISCA 2AGQA 3D2NA 2XVTA 2NO5A 2FLPA 1K1SA 2AQ0A 3SQIA 5J0TA 2ZUDA 2LM4A 7ICUA 2UVRA 3UPQA 2LM1A 4XRHA 1TAQA 8ICLA 9ICMA 1JUDA 3B0YA 5L1LA 9ICJA 1DRGA 2K8BB 9ICAA 8ICJA 5CA7A 3WKBA 2G07A 1SL1A 1DGJA 4Q44A 5J2HA 2W7PA 1KDHA 1ZQPA 4KN4A 3T5JA 4RUAA 3VCBA 1F44A 3K1RB 1ZQIA 4A8EA 2Y1JA 1MQ3A 1B43A 1XC9A 8ICUA 3T5KA 3SI8A 4Y2SA 9ICPA 1N62A 2BQRA 3PO5A 1MA7A 1XSLA 3I76A 2EANA 3UMGA 2KZZA 1UT5A 4F4WA 2C2EA 1L7OA 5EE1A 2K4PA 4UB4A 1ZQ1C 2WAQF 1KW4A 4O3MA 9ICIA 5CB1A 4ED7A 2F8LA 4DSLA 1S76D 8ICFA 2NYVA 4P4OA 5KFTA 1A0PA 4NJ8A 5AKKA 4FO6A 3ETLA 2ZIWB 3WK9A 3GIKA 4PGXA 2DKXA 1NKEA 4I29A 1TK0A 9ICQA 3GIJA 3EWAA 4UARA 3WKEA 3PO4A 3NUQA 5AICA 1NJYA 5KFWA 2D8CA 3NVWA 5D46A 1SKRA 3KBBA 4UAWA 2VA8A 2Y1IA 4Z6CA 1WCNA 4JB3A 4YFKA 4ED1A 2M9NA 3OPXA 3PSPA 4UB8U 2I1QA 2MUTB 4O5KA 5J0QA 4C8NA 4Y2VA 2ZXHA 2FI1A 4PH5A 3HRDD 2K89A 1OXJA 2QKQA 3TANA 3DDHA 3GZFA 4KX5A 3OSNA 2W9CB 1X66A 5DGAA 1D9FA 5KFGA 5ALTA 3RFAA 5AIAA 1ZRMA 4RQ4A 4Q8FA 1A6SA 4QWBA 4ED6A 5ALLA 5FP0A 1HIWA 1Z4NA 4F3OA 3IRUA 5KFSA 1NZPA 2HSZA 2KG5A 3QEAZ 1HJPA 1ZQOA 2R8GA 4QZGA 3MR2A 3RB6A 3GIMA 4F92B 5KFRA 2BDUA 3RH4A 2FJ6A 3MR3A 4RQMA 1SL0A 4NL9A 4PJ0U 2XCPA 1O03A 1X6IA 2KSOB 3AQEA 4QZCA 1ZQEA 2F77X 4I2JA 3PR5B 4DQPA 2ZJ5A 4O5CA 2ZIVB 3HJEA 1L7NA 2V4RA 1WYGA 2WB1F 3BQ2A 5J2IA 1U4BA 4PL2A 1L7MA 4I2CA 1TKDA 3AL0B 4IQWA 2ZTDA 4OJ5A 2HW3A 2G06A 5KFHA 3PSFA 4DFJA 4NL9C 2L5YA 2AJQA 5F9NA 5DG8A 4YVZA 4UB2A 5J8YA 1OUQA 3T79A 2W7OA 7ICMA 1P7DA 2E1EA 5AKIA 3RAQA 2RDIA 2KJ9A 3QZ7A 3GV5B 1BPEA 1PVQA 3KZIU 1BPBA 1L7PA 2HHSA 1NK5A 5HP4A 3H0LB 1PK1A 1S5LU 3C2LA 1BPXA 2BDPA 5KT7A 3LK9A 4F2SA 8ICCA 4ZH4A 3K4GA 5J8YC 2MAXA 2ODGA 4AYBC 3GIIA 4GLXA 4Y2QA 2QARB 1RDFA 1ZXIA 3HT3A 4F93B 3ZDCA 1XSPA 5F9LA 4J9RA 4M9NA 3TI0A 3UQ0A 4DF8A 1S0OA 3WKDA 3C1ZA 4PHAA 5DQIA 1X9XA 2WF9A 2DPIA 4RQ7A 3RH6A 5KFZA 2ISPA 4JK1A 3NVVA 2KICA 4F71A 2ATLA 4ECSA 3EYZA 5L9XA 3BZCA 4PGQA 5HMLA 2HOQA 5AM4A 1LB2B 2XGPA 2ZIWA 1J97A 3IM1A 5ALRA 9ICGA 4QNLA 5IIIA 4PHPA 2HOIA 2ZUCA 1NZBA 5DB7A 4KLLA 3H8JA 2BQUA 8ICOA 1KQQA 2A3VA 2QB0B 5AKHA 4AYBF 5ALJA 3RRGA 4M2YA 1XS9D 1BNOA 1S0MA 4IQTA 4RPZA 5BOMA 1X9MA 5KG7A 1N5XA 1ZQTA 2KHQA 2BCUA 1YZ7A 4NXZA 8ICHA 2VA3A 3H0RB 3M6ZA 1NKCA 3PW5A 3RH5A 4UAZA 4O0IA 3V72A 2ALZA 1NJWA 1Z00B 1JMSA 3RF9A 3PZPA 3BS7A 2KTQA 3OTQA 4ELTA 2W9CA 2BPFA 5J0WA 4UQGA 3UMCA 8ICWA 4UATA 4KTQA 2EDUA 4USAA 5AM2A 4C4RA 2KN7A 1ZETA 4DF4A 2G0AA 2PFOA 3S6JA 3F5EA 3WK6A 2KIWA 3QU5A 5J0OA 3PNCA 4I2HA 2LYAA 1U9LA 4YR0A 5IIMA 5AKLA 4F4KA 4QIWC 1Z3EB 2KSOA 4IR1A 4YMMA 3C5FA 4UB5A 1S9FA 2F8KA 4Q45A 2RRDA 4F4YA 1VLBA 4FBTA 4DOAA 4DFPA 1RQLA 1SIJA 3FC4A 4PHDA 2ZUBA 2NRTA 5AM3A 4QWDA 5J0PA 3RAXA 4YMNA 3TKAA 5KFVA 2W03A 1L3SA 4CCHA 2A1JB 2HBLA 5KTQA 5EE0A 9ICEA 1LKYB 2LHTA 4FZNA 3WK5A 1COOA 3IP4B 2YN4A 5KFUA 3SAFA 3KFUF 4EX6A 3GV8B 1T7PA 2KFNA 3AMZA 4ELUA 4EYIB 2DUYA 5C0YA 5KFDA 1M6YA 3RJKA 4R66A 3MBYA 5ALGA 9ICXA 3ZI4A 4TUPA 3QNMA 5EWFA 5H2FU 1NK7A 2B0CA 2H3ZA 4JMUA 1QTMA 4DLGA 5DLFA 3RJJA 4NLNA 1QSYA 4GC7A 1KL9A 3MGVA 4DL7A 3IG5A 4BUGA 5J2EA 2HCFA 4XA5A 3T5HA 4KLOA 2NO4A 8ICYA 1TFRA 5J2JA 3SAHA 2PFQA 3QUCA 8ICEA 7ICNA 4JV2A 3WKCA 2FPMA 2QARA 3SENA 3TQ1A 2G5HB 7ICJA 2XICA 4MEYA 1QCKA 3AU2A 2NRVA 5ALEA 3KHRA 1FFUA 4ICAA 5A0LA 3T5LA 2R8KA 2PMZF 4F50A 3H0MB 3NVYA 2O6KA 1WCLA 4DOBA 1ZQVA 1HUOA 4NLBA 4KITB 1ZQRA 1T94A 4DS4A 3PW4A 1X2IA 2UVVA 4UBCA 3MC1A 5AKZA 1UHUA 2W3RA 4ED3A 4QJFB 1ZYQA 1Y88A 3ISBA 3QU2A 4CF5A 1SV0C 4BJQA 4KLIA 3G6XA 5KFCA 2AQ4A 5D49A 3C29A 5KFPA 8ICKA 1QQ7A 3FM9A 2WF6A 2XC9A 8ICXA 4KLSA 4Z6DA 3ISDA 2KOBA 5AK4A 3MR5A 2W11A 3H8SA 4EELA 1A77A 5ALMA 5TZVA 4NM1A 2KVSA 3SEIA 3UQ2A 2WAQC 2YMMA 7ICKA 5C5JA 4ECWA 1F0MA 3JPRA 4OD0A 5CEHA 4P4PA 3PV8A 2JZBB 1GO3F 1Z00A 3LYSA 3NS1A 4QZ9A 3SYZA 9ICBA 2EH9A 1A76A 1T3NA 3RBEA 4YCXA 5L1MA 1FFVA 4US9A 5ALIA 2WF7A 2VA2A 5DLGA 3U26A 4XUSA 5AI4A 4EBCA 5KFQA 3QE9Y 1RZTA 3EUB2 1QLNA 1UCVA 2W9MA 4F5NA 1RQNA 5AI0A 5HR6A 3C21A 3Q8SB 2JR5A 4R65A 1JIHA 5GTHU 3WKAA 2R8HA 3T3FA 4M9LA 3ZDEA 4B9UA 4F5PA 3SAGA 2G5IB 4KN7A 3WK4A 1ZQNA 3F5AA 2RHFA 4CF4A 4B9NA 3FAHA 1X40A 2IOFA 2BCSA 3GFKB 9ICWA 3THVA 4E0DA 4NLKA 5HR7A 2C2RA 3D2SA 8ICZA 1L5UA 3AM9A 4DFKA 2EAMA 2YTUA 3BZKA 4CGZA 1KFDA 3PSIA 4J9KA 4DL2A 3ONNA 2A1AA 4YD1A 1J2NA 1Z1VA 5J2GA 5JUMA 4KLDA 8ICNA 4DQRA 1VJ5A 2FDRA 3F53A 4ECRA 8ICPA 1PZNA 1QQ5A 1ZQWA 3JPPA 4C8OA 1ZD3A 2PXIA 1Q8KA 3C28A 4NY8A 4RQ2A 3RJIA 1TV9A 4JWNA 5J0RA 4Y2PA 4DQSA 1NK4A 4JV0A 2HMXA 4KLFA 4PZNA 2WB1C 3F2DA 1TK8A 4J03A 5ALFA 4RNMA 5ALNA 2HBJA 1YT3A 4BXOB 1S8OA 5J2AA 3Q8LA 2E3TA 5EE9A 8ICRA 1CEZA 1Q46A 4DWIA 1T3QA 3ICXA 4F5OA 2XY5A 4FFDA 3N28A 1IIPA 1FO4A 2I6XA 5HMMA 1TAUA 2ZIUA 1CI4A 1B0XA 3ED5A 5ALZA 5CWRA 4O9MA 4P0QB 2BGWA 2GLEA 1ZD4A 4M47A 3PR4A 4MHVA 2WFAA 5DBBA 1B4FA 4NM2A 9ICHA 2AGOA 3B0XA 2W8LA 4UB6U 5AI8A 2A19A 4KLUA 1L6NA 4DL6A 1XO1A 3M7DA 5KG0A 5AKGA 5KFIA 3V6JA 3QEBZ 4EYHB 1ECWA 4R8UB 4RPXA 2JEFA 2OEHA 4I2IA 4DSEA 4LVSA 5AKEA 3GDXA 1TAMA 3IG8A 4NWIA 2ASLA 1L3TA 2VJ5A 1S77D 2YY6A 3IDWA 5ALWA 1NNLA 2UVUA 4ECZA 1XU4A 2GOLA 3HX0A 4JV1A 4B6JA 1BGXT 4DOCA 1HUZA 5IIJA 1FEZA 3RR7A 3J81j 1SXEA 1CUKA 2JZBA 3EPIA 2BQ3A 2FMQA 4C4TA 2ZG6A 5KT2A 4UAYA 3NTUA 2LPEA 3TAPA 2HOFA 5GTIU 4QWEA 4LZDA 5K4LA 2EZYA 3PX0A 3Q8QB 1HEKA 1K5OA 7ICLA 4J9MA 1JXEA 5J2KA 1XSNA 2Y0SC 1QSLA 4KLEA 2HHTA 4RQ6A 4J9LA 1YZ6A 3KOOA 5AKJA 1MQ2A 1LVHA 3K75D 1PK3A 4GXIA 1UA0A 1Z4OA 3OGUA 1DXSA 7ICQA 4IQUA 2YQEA 4YXJA 2KZ3A 4C7YA 5JTIA 3M9OB 2KJ5A 2GH1A 1V9PA 2F76X 1D8BA 2JMGA 4DFDA 1J2MA 4QWAA 3EW9A 5AKYA 1DK3A 3RB3A 2XY6A 5DBAA 2EZZA 2W43A 5B5EU 5J0YA 4YG2A 2W9BB 1ZQCA 5AKXA 4DSFA 3CYMA 1ZQHA 4ED8A 3HP6A 2K8CB 4Y2RA 5DDMA 4ECUA 2LYHA 1UPHA 2PKEA 1ZOLA 1N61A 5DB9A 4DEZA 3IHQB 2Y0SF 4FS1A 1QQ6A 3BS5B 1U49A 2W3SA 1RYUA 1EXNA 4QZIA 4QW8A 3RTVA 2B21A 4QZFA 2IMWP 1BPDA 2DQNB 2MUTA 2D6FC 2HVHA 1NJXA 4ELVA 2FLLA 3HKZF 4F8RA 3QU7A 2KD1A 4FZMA 5B66U 5HHHA 1IXRA 3M8SA 4O3OA 2BKEA 2HHUA 2CXYA 5D4BA 1DK2A 4DLEA 3PSTA 5G5HA 9ICSA 3C1YA 4BDPA 3RJGA 4YMOA 2N1RA 5ALQA 1KSPA 5BOLA 4M9JA 4CNQA 3E0FA 4RPYA 4PGYA 5KT3A 3PW0A 1V38A 3HWTA 2Z7JA 3MGIA 5EOZA 4ACOA 2ISOA 4QZDA 2WHEA 5KFYA 3H4DA 1O08A 1QSSA 2I5HA 4JWMA 3E58A 3MGHA 3I28A 1L8LA 2C2DA 5KG2A 3SZ2A 1RM6C 5AI9A 5EWEA 3IN5A 1SKWA 5KG1A 5AIBA 3AUOA 3H4BA 3GQCA 3CNHA 2CN1A 9ICTA 4UAVA 1SL2A 3M9MB 1KFTA 2OWOA 3N7RC 9ICVA 4C8MA 1ZQXA 4F4XA 2ASDA 1XNSA 3LWMA 2IBKA 1AROP 3QZ8A 1U48A 2ZIVA 1ZQKA 3TFSA 4RUCA 1CRXA 2PFPA 1ZQUA 3TARA 2JHDA 3C23A 1JROA 3HW8A 5L1KA 2WF5A 2KIVA 2IHNA 1BNPA 4ECQA 1H38A 2LI6A 3H8MA 1WWUA 4UAUA 2E1FA 2MRLA 4US8A 2J6SA 2PMZC 4MFCA 4DFMA 2FMPA 4RNOA 2HHQA 1N48A 3OHBA 2ASJA 4M0AA 1N56A 2DGZA 5IINA 2IHMA 1ZQGA 4ECYA 3F2BA 2HI0A 2BCRA 2VANA 4K4HA 2OM6A 5E79U 4J9PA 5J2FA 4IC9A 2ZXIA 2FMSA 1TVAA 5AK3A 1X9WA 2JEGA 4OJLA 2F44A 2M0NA 3G6VA 3JPSA 2JV3A 4B9MA 1RXWA 2E8NA 2FE9A 1L8OA 1PVPA 4Y2UA 2W54A 4P0PB 1K1QA 2ZIXB 5J2BA 1SV0A 4YP3A 1D9DA 1JXLA 5KFNA 4HYKA 1BPYA 4EEYA 4MF2A 3I1YA 5DQHA 1JALA 2Y9TA 5JU5A 1NOMA 4RZRA 4QWCA 2P66A 3H8WA 2ZJ8A 4TQRA 5G5GA 2EQYA 4O3RA 5KFLA 4M9GA 1KLNA 5KG3A 5KG5A 3QYPA 5KT6A 5KT4A 3CRXA 5KFOA 2RLTA 2EZXA 3TACB 4I2FA 2V9WA 2KFZA 4RQ8A 1JRPA 4EBDA 2HVIA 2H3IA 3QUQA 2OYYA 3RB4A 2J6TA 7ICSA 4O3SA 2QB0A 3WK8A 5AK6A 2JRZA 4YR3A 4RQNA 1ZQQA 5CJ7A 1KRPA 4J9QA 1F5SA 2XCAA 4BX9C 3ZD8A 4PPXA 1D8YA 3PMNA 3OSPA 4DSJA 4QZEA 3NVZA 8ICGA 1U47A 3ORYA 2R18A 7ICRA 4EENA 5EE3A 1N63A 4KLGA 3RRHA 2K60A 4WJ3B 4I2DA 1U45A 1NK0A 4TUSA 4ZOHC 1SZHA 3FDSA 3N4MB 1L3VA 2IA6A 3KKAC 4CF3A 5KAIU 2BCQA 3QXGA 2GO7A 4C80A 1SWWA 4RT2A 4RU9A 4KMUA 2W04A 4M6WB 2OH2A 4Y2JA 1NK6A 1RPLA 1XWLA 2Y9UA 4OJOA 4TQSA 8ICVA 4CE6A 3MFIA 1C20A 5AHXA 2G08A 4M9HA 3JPOA 1UT8A 4GXJA 1PK1B 2OXOA 3QUTA 2WF8A 3DV9A 1C7YA 2C28A 2KK0A 2RDJA 1VDVA 5IIKA 4MFAA 9ICRA 4EEKA 4RNNA 4Q43A 5KNIA 5J0SA 4U7CA 2I9GA 1ZQLA 2KEYA 3UM9A 5KFMA 4GIBA 7ICTA 3N7SC 2NRXA 3UXNA 3C5GA 4I2BA 4K4GA 2J6UA 2JH7A 2MA1A 4FBUA 4FS2A 5ALXA 4LZGA 1ZQAA 3CW2C 1ZQMA 1SGGA 1MC8A 2DKZA 2JH1A 5CHGA 2A1JA 5AK5A 2ZTCA 4U6PA 3BQ1A 2RQ5A 1DOQA 1LKYA 2VJ4A 4ED0A 5J29A 2VIXA 1ZD2P 5ALVA 8ICIA 1FIQA 2BPCA 4MF8A 4DQQA 3LVWA 3ETRA 1LV5A 2HBKA 3AEVA 5KL8B 1IV8A 2KKVA 3M6KA 1ZQDA 5KT5A 1S10A 1L3UA 4DSKA 3E2EA 3BJYA 8ICAA 1ZQFA 2CRXA 2W9AA 2P6RA 3V6HA 2B6GA 2JGAA 4Y2XA 2K4IA 4RQ1A 2P6UA 1ZJNA 2OCEA 2LKYA 2KP7A 3SV3A 3LVVA 2BR0A 2QB1A 3L5KA 2LMRA 1SWVA 3PX4A 4IS7A 2E5SA 1ED1A 4EZ6A 3H40A 3SMVA 2UVWA 5J2DA 4OJ6A 3WK7A 2Q4TA 4QZBA 1QH9A 3RJEA 3ALRA 3PW7A 4P0PA 2ESEA 2ZIXA 3B9JA 2W55A 1RYRA 1ZQYA 2KJ8A 4I27A 3BQ0A 1KTQA 4C7ZA 3MFHA 5KFEA 4P2HA 1ZQZA 2R8IA 3QU4A 7ICEA 4FZLA 2MU2A 4I2EA 3M1YA 2DPJA 2K4EA 3UXOA 1XO0A 4DS5A 5CP2A 1B22A 3PY8A 2F1HA 4GXKA 3TFRA 1RYSA 1ZD5A 4QW9A 3KHLA 4J9SA 3N97B 2VKQA 2BHNA 4ED2A 3GV7B 2EAOA 9ICCA 2FLNA 3V7KA 4O3NA 1TE2A 5DB8A 3NRWA 4QZAA 3OJUA 3GU3A 2KVCA 5HHIA 9ICUA 2D3DA 5ALHA 4I2GA 3AU6A 4B9LA 2KMDA 4UASA 4O3PA 1RXVA 5L1JA 8ICQA 1WG8A 5ALYA 1MN8A 4YR2A 1OW5A 2LBOA 2YX8A 3AQFA 4RQ0A 3PW2A 3G6YA 3RBDA 3JPNA 3LWLA 2PFNA 4YN4A 4F5QA 3BQ7A 4IRDA 5CRXA 2HBMA 5DG7A 3K1ZA 5CR0A 3V6KA 2LYBA 2H3QA 3MDCA 1UQVA 4C0ZA 5BPCA 1V85A 4KLMA 1SKSA 1X6JA 3N7PD 4M6WA 4F5RA 5KFKA 9ICFA 1URJA 4UB3A 3MR6A 3OHAA 4DQIA 5ALDA 3NASA 4ECTA 3MABA 3D2QA 3KZXA 3DEEA 4YQWA 5DB6A 4BGDA 4C8LA 3QUBA 4EX7A 9ICOA 2ZJAA 2BPGA 2DF4B 4CDGA 1UA1A 4Y2TA 3PMLA 2H5XA 1S0VA 4QZHA 5AM1A 1T8EA 1T4GA 3KHHA 4I28A 4BWJA 3A0HU 5F3XB 2KKPA 3HKZC 1JX4A 1PUZA 1JI7A 3F2CA 5AM0A 4PL1A 4G9BA 2HHWA 4K4IA 4F2RA 3Q8RB 4KLHA 3PX6A 1D8LA 1NKBA 1NK8A 4NV0A 3TADA 3L4PA 5IILA 4G3IA 3ZDDA 7ICVA 5KG4A 4EZ9A 4O3QA 2GWSA 2JEIA 4DL3A 2NV3A 4R63A 2YMLA 1JN3A 4R64A 3R9KA 2XY7A 5HNKA 1Q3VA 8ICTA 2K8AA 5L1IA 4OO1J 5KFFA 4B9VA 2F3NA 3ZD9A 4MFFA 3QU9A 5KFJA 5DKWA 4RQ5A 4NLZA 2XGQA 1KEJA 2HDOA 3JPTA 3WU2U 7ICFA 3C2KA 4EBEA 2CPRA 1NJZA 8ICBA 3KHGA 3TADC 3M8RA 2DWQA 2JEJA 4OCZA 2XIDA 2DL0A 5DQGA 2KE7A 4PZOA 4NLCA 5KL1B 1N60A 3QX7A 4UW9A 4DO9A 2XO7A 5DGBA 4QZ8A 4PHEA 1KKXA 4IRCA 4TUQA 5ALSA 1BVSA 4O5EA 4OJPA 3H7IA 5AM5A 4IQVA 5KFAA 3LDAA 3SV4A 4BXOA 3NGDA 3SD7A 5JRTA 2WTFA 4IL6U 4C8KA 2NRZA 2IOHA 3D6JA 2F1JA 5AI6A 4Z6FA 4P0QA 4BWMA 1AQ6A 2AU0A 4DL4A 4YXMA 2KV2A 2MSNA 4KMOB 1RG6A 7ICHA 5TISU 1SV4A 5AI5A 1MSWD 3MDAA 5ALPA 1X9SA 5DDYA 3EZ5A 3NRZA 2AXTU 4ECXA 4R8UA 3V7LA 1ZQBA 4KLQA 1Q3UA 1KN5A 2IOFK 2YMPA 7ICIA 3Q8KA 2V4QA 2DBYA 1DGSA 5IIOA 5KFBA 4UBBA 1ZQSA 1BPZA 4GC6A 3RB0A 3GILA 4DCCA 4JUZA 2DFLA 3RJFA 5KAFU 4F91B 4AP9A 2KZMA 1ZJMA 4Q8EA 2QLTA 5T14A 5KFXA 2F2AB 1KFSA 4FE3A 3C2MA 1NK9A 4KLJA 3RJHA 1ZQJA 2H3VA 3Q8PB 4GFJA 3M9NB 2AH5A 3FYHA 3HILA 4QIWF 2E8OA 4F72A 1SZPA 3IV6A 3L3FX 9ICKA 2HHVA 3PVXA 4UB1A 4DSIA 3VC8A 3BDPA 1IM4A 5DBCA 4P4MA 5J0UA
chains in the Genus database with same CATH topology
1PUZA 1X6IA 2LM4A 2JR5A 1X6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUZ A;  1X6I A;  2LM4 A;  2JR5 A;  1X6J A; 
#chains in the Genus database with same CATH topology
 2HHX A;  2C22 A;  1WUD A;  4TUR A;  2F1I A;  8ICS A;  3ZDA A;  7ICP A;  1NI3 A;  4F4Z A;  2RP5 A;  4KX3 A;  4B9T A;  1X42 A;  1N5W A;  1SXD A;  3BQT A;  2E8M A;  2YMQ A;  2OHF A;  2EAP A;  1SB3 C;  2BZF A;  2JXJ A;  4J9O A;  2XI9 A;  5ALO A;  2PI4 A;  2ES6 A;  3SR6 A;  3CP8 A;  2W8K A;  2NRW A;  4RQ3 A;  4Z6E A;  1V97 A;  4ECV A;  3O0F A;  2ZIU B;  3OJS A;  9ICL A;  8ICM A;  4HAI A;  2W9B A;  2KNJ A;  3A0B U;  4LJX A;  7ICG A;  4KLT A;  4NLG A;  3JPQ A;  3EPG A;  4B9S A;  1KBU A;  2P35 A;  1S97 A;  2AHO B;  1WWV A;  2ZTE A;  3KTQ A;  2YB1 A;  1COK A;  3KKA A;  5DG9 A;  2K4H A;  2FPK A;  2Q0Z X;  2R8J A;  3Q8M A;  4IR9 A;  1Z1B A;  3BS5 A;  1PVR A;  5KG6 A;  4IRK A;  3ZDB A;  2KHV A;  3RR8 A;  2YB4 A;  5ALU A;  2G09 A;  4I2A A;  2PI5 A;  2BCV A;  2E8P A;  9ICN A;  3UXP A;  5J2C A;  4CRX A;  3KD3 A;  4MEX A;  4M04 A;  1S0N A;  4C4S A;  5EWG A;  5J0X A;  4J9N A;  4XQ8 A;  3AN1 A;  4YD2 A;  5ALK A;  4Y2Y A;  1IG6 A;  3TAQ A;  1N2X A;  1ZRN A;  2FPL A;  7ICO A;  4DL5 A;  2H3F A;  1TK5 A;  3V7J A;  4RT3 A;  3UMB A;  1Z19 A;  2AGP A;  4X5V A;  3HPO A;  3ISC A;  2AGQ A;  3D2N A;  2XVT A;  2NO5 A;  2FLP A;  1K1S A;  2AQ0 A;  3SQI A;  5J0T A;  2ZUD A;  2LM4 A;  7ICU A;  2UVR A;  3UPQ A;  2LM1 A;  4XRH A;  1TAQ A;  8ICL A;  9ICM A;  1JUD A;  3B0Y A;  5L1L A;  9ICJ A;  1DRG A;  2K8B B;  9ICA A;  8ICJ A;  5CA7 A;  3WKB A;  2G07 A;  1SL1 A;  1DGJ A;  4Q44 A;  5J2H A;  2W7P A;  1KDH A;  1ZQP A;  4KN4 A;  3T5J A;  4RUA A;  3VCB A;  1F44 A;  3K1R B;  1ZQI A;  4A8E A;  2Y1J A;  1MQ3 A;  1B43 A;  1XC9 A;  8ICU A;  3T5K A;  3SI8 A;  4Y2S A;  9ICP A;  1N62 A;  2BQR A;  3PO5 A;  1MA7 A;  1XSL A;  3I76 A;  2EAN A;  3UMG A;  2KZZ A;  1UT5 A;  4F4W A;  2C2E A;  1L7O A;  5EE1 A;  2K4P A;  4UB4 A;  1ZQ1 C;  2WAQ F;  1KW4 A;  4O3M A;  9ICI A;  5CB1 A;  4ED7 A;  2F8L A;  4DSL A;  1S76 D;  8ICF A;  2NYV A;  4P4O A;  5KFT A;  1A0P A;  4NJ8 A;  5AKK A;  4FO6 A;  3ETL A;  2ZIW B;  3WK9 A;  3GIK A;  4PGX A;  2DKX A;  1NKE A;  4I29 A;  1TK0 A;  9ICQ A;  3GIJ A;  3EWA A;  4UAR A;  3WKE A;  3PO4 A;  3NUQ A;  5AIC A;  1NJY A;  5KFW A;  2D8C A;  3NVW A;  5D46 A;  1SKR A;  3KBB A;  4UAW A;  2VA8 A;  2Y1I A;  4Z6C A;  1WCN A;  4JB3 A;  4YFK A;  4ED1 A;  2M9N A;  3OPX A;  3PSP A;  4UB8 U;  2I1Q A;  2MUT B;  4O5K A;  5J0Q A;  4C8N A;  4Y2V A;  2ZXH A;  2FI1 A;  4PH5 A;  3HRD D;  2K89 A;  1OXJ A;  2QKQ A;  3TAN A;  3DDH A;  3GZF A;  4KX5 A;  3OSN A;  2W9C B;  1X66 A;  5DGA A;  1D9F A;  5KFG A;  5ALT A;  3RFA A;  5AIA A;  1ZRM A;  4RQ4 A;  4Q8F A;  1A6S A;  4QWB A;  4ED6 A;  5ALL A;  5FP0 A;  1HIW A;  1Z4N A;  4F3O A;  3IRU A;  5KFS A;  1NZP A;  2HSZ A;  2KG5 A;  3QEA Z;  1HJP A;  1ZQO A;  2R8G A;  4QZG A;  3MR2 A;  3RB6 A;  3GIM A;  4F92 B;  5KFR A;  2BDU A;  3RH4 A;  2FJ6 A;  3MR3 A;  4RQM A;  1SL0 A;  4NL9 A;  4PJ0 U;  2XCP A;  1O03 A;  1X6I A;  2KSO B;  3AQE A;  4QZC A;  1ZQE A;  2F77 X;  4I2J A;  3PR5 B;  4DQP A;  2ZJ5 A;  4O5C A;  2ZIV B;  3HJE A;  1L7N A;  2V4R A;  1WYG A;  2WB1 F;  3BQ2 A;  5J2I A;  1U4B A;  4PL2 A;  1L7M A;  4I2C A;  1TKD A;  3AL0 B;  4IQW A;  2ZTD A;  4OJ5 A;  2HW3 A;  2G06 A;  5KFH A;  3PSF A;  4DFJ A;  4NL9 C;  2L5Y A;  2AJQ A;  5F9N A;  5DG8 A;  4YVZ A;  4UB2 A;  5J8Y A;  1OUQ A;  3T79 A;  2W7O A;  7ICM A;  1P7D A;  2E1E A;  5AKI A;  3RAQ A;  2RDI A;  2KJ9 A;  3QZ7 A;  3GV5 B;  1BPE A;  1PVQ A;  3KZI U;  1BPB A;  1L7P A;  2HHS A;  1NK5 A;  5HP4 A;  3H0L B;  1PK1 A;  1S5L U;  3C2L A;  1BPX A;  2BDP A;  5KT7 A;  3LK9 A;  4F2S A;  8ICC A;  4ZH4 A;  3K4G A;  5J8Y C;  2MAX A;  2ODG A;  4AYB C;  3GII A;  4GLX A;  4Y2Q A;  2QAR B;  1RDF A;  1ZXI A;  3HT3 A;  4F93 B;  3ZDC A;  1XSP A;  5F9L A;  4J9R A;  4M9N A;  3TI0 A;  3UQ0 A;  4DF8 A;  1S0O A;  3WKD A;  3C1Z A;  4PHA A;  5DQI A;  1X9X A;  2WF9 A;  2DPI A;  4RQ7 A;  3RH6 A;  5KFZ A;  2ISP A;  4JK1 A;  3NVV A;  2KIC A;  4F71 A;  2ATL A;  4ECS A;  3EYZ A;  5L9X A;  3BZC A;  4PGQ A;  5HML A;  2HOQ A;  5AM4 A;  1LB2 B;  2XGP A;  2ZIW A;  1J97 A;  3IM1 A;  5ALR A;  9ICG A;  4QNL A;  5III A;  4PHP A;  2HOI A;  2ZUC A;  1NZB A;  5DB7 A;  4KLL A;  3H8J A;  2BQU A;  8ICO A;  1KQQ A;  2A3V A;  2QB0 B;  5AKH A;  4AYB F;  5ALJ A;  3RRG A;  4M2Y A;  1XS9 D;  1BNO A;  1S0M A;  4IQT A;  4RPZ A;  5BOM A;  1X9M A;  5KG7 A;  1N5X A;  1ZQT A;  2KHQ A;  2BCU A;  1YZ7 A;  4NXZ A;  8ICH A;  2VA3 A;  3H0R B;  3M6Z A;  1NKC A;  3PW5 A;  3RH5 A;  4UAZ A;  4O0I A;  3V72 A;  2ALZ A;  1NJW A;  1Z00 B;  1JMS A;  3RF9 A;  3PZP A;  3BS7 A;  2KTQ A;  3OTQ A;  4ELT A;  2W9C A;  2BPF A;  5J0W A;  4UQG A;  3UMC A;  8ICW A;  4UAT A;  4KTQ A;  2EDU A;  4USA A;  5AM2 A;  4C4R A;  2KN7 A;  1ZET A;  4DF4 A;  2G0A A;  2PFO A;  3S6J A;  3F5E A;  3WK6 A;  2KIW A;  3QU5 A;  5J0O A;  3PNC A;  4I2H A;  2LYA A;  1U9L A;  4YR0 A;  5IIM A;  5AKL A;  4F4K A;  4QIW C;  1Z3E B;  2KSO A;  4IR1 A;  4YMM A;  3C5F A;  4UB5 A;  1S9F A;  2F8K A;  4Q45 A;  2RRD A;  4F4Y A;  1VLB A;  4FBT A;  4DOA A;  4DFP A;  1RQL A;  1SIJ A;  3FC4 A;  4PHD A;  2ZUB A;  2NRT A;  5AM3 A;  4QWD A;  5J0P A;  3RAX A;  4YMN A;  3TKA A;  5KFV A;  2W03 A;  1L3S A;  4CCH A;  2A1J B;  2HBL A;  5KTQ A;  5EE0 A;  9ICE A;  1LKY B;  2LHT A;  4FZN A;  3WK5 A;  1COO A;  3IP4 B;  2YN4 A;  5KFU A;  3SAF A;  3KFU F;  4EX6 A;  3GV8 B;  1T7P A;  2KFN A;  3AMZ A;  4ELU A;  4EYI B;  2DUY A;  5C0Y A;  5KFD A;  1M6Y A;  3RJK A;  4R66 A;  3MBY A;  5ALG A;  9ICX A;  3ZI4 A;  4TUP A;  3QNM A;  5EWF A;  5H2F U;  1NK7 A;  2B0C A;  2H3Z A;  4JMU A;  1QTM A;  4DLG A;  5DLF A;  3RJJ A;  4NLN A;  1QSY A;  4GC7 A;  1KL9 A;  3MGV A;  4DL7 A;  3IG5 A;  4BUG A;  5J2E A;  2HCF A;  4XA5 A;  3T5H A;  4KLO A;  2NO4 A;  8ICY A;  1TFR A;  5J2J A;  3SAH A;  2PFQ A;  3QUC A;  8ICE A;  7ICN A;  4JV2 A;  3WKC A;  2FPM A;  2QAR A;  3SEN A;  3TQ1 A;  2G5H B;  7ICJ A;  2XIC A;  4MEY A;  1QCK A;  3AU2 A;  2NRV A;  5ALE A;  3KHR A;  1FFU A;  4ICA A;  5A0L A;  3T5L A;  2R8K A;  2PMZ F;  4F50 A;  3H0M B;  3NVY A;  2O6K A;  1WCL A;  4DOB A;  1ZQV A;  1HUO A;  4NLB A;  4KIT B;  1ZQR A;  1T94 A;  4DS4 A;  3PW4 A;  1X2I A;  2UVV A;  4UBC A;  3MC1 A;  5AKZ A;  1UHU A;  2W3R A;  4ED3 A;  4QJF B;  1ZYQ A;  1Y88 A;  3ISB A;  3QU2 A;  4CF5 A;  1SV0 C;  4BJQ A;  4KLI A;  3G6X A;  5KFC A;  2AQ4 A;  5D49 A;  3C29 A;  5KFP A;  8ICK A;  1QQ7 A;  3FM9 A;  2WF6 A;  2XC9 A;  8ICX A;  4KLS A;  4Z6D A;  3ISD A;  2KOB A;  5AK4 A;  3MR5 A;  2W11 A;  3H8S A;  4EEL A;  1A77 A;  5ALM A;  5TZV A;  4NM1 A;  2KVS A;  3SEI A;  3UQ2 A;  2WAQ C;  2YMM A;  7ICK A;  5C5J A;  4ECW A;  1F0M A;  3JPR A;  4OD0 A;  5CEH A;  4P4P A;  3PV8 A;  2JZB B;  1GO3 F;  1Z00 A;  3LYS A;  3NS1 A;  4QZ9 A;  3SYZ A;  9ICB A;  2EH9 A;  1A76 A;  1T3N A;  3RBE A;  4YCX A;  5L1M A;  1FFV A;  4US9 A;  5ALI A;  2WF7 A;  2VA2 A;  5DLG A;  3U26 A;  4XUS A;  5AI4 A;  4EBC A;  5KFQ A;  3QE9 Y;  1RZT A;  3EUB 2;  1QLN A;  1UCV A;  2W9M A;  4F5N A;  1RQN A;  5AI0 A;  5HR6 A;  3C21 A;  3Q8S B;  2JR5 A;  4R65 A;  1JIH A;  5GTH U;  3WKA A;  2R8H A;  3T3F A;  4M9L A;  3ZDE A;  4B9U A;  4F5P A;  3SAG A;  2G5I B;  4KN7 A;  3WK4 A;  1ZQN A;  3F5A A;  2RHF A;  4CF4 A;  4B9N A;  3FAH A;  1X40 A;  2IOF A;  2BCS A;  3GFK B;  9ICW A;  3THV A;  4E0D A;  4NLK A;  5HR7 A;  2C2R A;  3D2S A;  8ICZ A;  1L5U A;  3AM9 A;  4DFK A;  2EAM A;  2YTU A;  3BZK A;  4CGZ A;  1KFD A;  3PSI A;  4J9K A;  4DL2 A;  3ONN A;  2A1A A;  4YD1 A;  1J2N A;  1Z1V A;  5J2G A;  5JUM A;  4KLD A;  8ICN A;  4DQR A;  1VJ5 A;  2FDR A;  3F53 A;  4ECR A;  8ICP A;  1PZN A;  1QQ5 A;  1ZQW A;  3JPP A;  4C8O A;  1ZD3 A;  2PXI A;  1Q8K A;  3C28 A;  4NY8 A;  4RQ2 A;  3RJI A;  1TV9 A;  4JWN A;  5J0R A;  4Y2P A;  4DQS A;  1NK4 A;  4JV0 A;  2HMX A;  4KLF A;  4PZN A;  2WB1 C;  3F2D A;  1TK8 A;  4J03 A;  5ALF A;  4RNM A;  5ALN A;  2HBJ A;  1YT3 A;  4BXO B;  1S8O A;  5J2A A;  3Q8L A;  2E3T A;  5EE9 A;  8ICR A;  1CEZ A;  1Q46 A;  4DWI A;  1T3Q A;  3ICX A;  4F5O A;  2XY5 A;  4FFD A;  3N28 A;  1IIP A;  1FO4 A;  2I6X A;  5HMM A;  1TAU A;  2ZIU A;  1CI4 A;  1B0X A;  3ED5 A;  5ALZ A;  5CWR A;  4O9M A;  4P0Q B;  2BGW A;  2GLE A;  1ZD4 A;  4M47 A;  3PR4 A;  4MHV A;  2WFA A;  5DBB A;  1B4F A;  4NM2 A;  9ICH A;  2AGO A;  3B0X A;  2W8L A;  4UB6 U;  5AI8 A;  2A19 A;  4KLU A;  1L6N A;  4DL6 A;  1XO1 A;  3M7D A;  5KG0 A;  5AKG A;  5KFI A;  3V6J A;  3QEB Z;  4EYH B;  1ECW A;  4R8U B;  4RPX A;  2JEF A;  2OEH A;  4I2I A;  4DSE A;  4LVS A;  5AKE A;  3GDX A;  1TAM A;  3IG8 A;  4NWI A;  2ASL A;  1L3T A;  2VJ5 A;  1S77 D;  2YY6 A;  3IDW A;  5ALW A;  1NNL A;  2UVU A;  4ECZ A;  1XU4 A;  2GOL A;  3HX0 A;  4JV1 A;  4B6J A;  1BGX T;  4DOC A;  1HUZ A;  5IIJ A;  1FEZ A;  3RR7 A;  3J81 j;  1SXE A;  1CUK A;  2JZB A;  3EPI A;  2BQ3 A;  2FMQ A;  4C4T A;  2ZG6 A;  5KT2 A;  4UAY A;  3NTU A;  2LPE A;  3TAP A;  2HOF A;  5GTI U;  4QWE A;  4LZD A;  5K4L A;  2EZY A;  3PX0 A;  3Q8Q B;  1HEK A;  1K5O A;  7ICL A;  4J9M A;  1JXE A;  5J2K A;  1XSN A;  2Y0S C;  1QSL A;  4KLE A;  2HHT A;  4RQ6 A;  4J9L A;  1YZ6 A;  3KOO A;  5AKJ A;  1MQ2 A;  1LVH A;  3K75 D;  1PK3 A;  4GXI A;  1UA0 A;  1Z4O A;  3OGU A;  1DXS A;  7ICQ A;  4IQU A;  2YQE A;  4YXJ A;  2KZ3 A;  4C7Y A;  5JTI A;  3M9O B;  2KJ5 A;  2GH1 A;  1V9P A;  2F76 X;  1D8B A;  2JMG A;  4DFD A;  1J2M A;  4QWA A;  3EW9 A;  5AKY A;  1DK3 A;  3RB3 A;  2XY6 A;  5DBA A;  2EZZ A;  2W43 A;  5B5E U;  5J0Y A;  4YG2 A;  2W9B B;  1ZQC A;  5AKX A;  4DSF A;  3CYM A;  1ZQH A;  4ED8 A;  3HP6 A;  2K8C B;  4Y2R A;  5DDM A;  4ECU A;  2LYH A;  1UPH A;  2PKE A;  1ZOL A;  1N61 A;  5DB9 A;  4DEZ A;  3IHQ B;  2Y0S F;  4FS1 A;  1QQ6 A;  3BS5 B;  1U49 A;  2W3S A;  1RYU A;  1EXN A;  4QZI A;  4QW8 A;  3RTV A;  2B21 A;  4QZF A;  2IMW P;  1BPD A;  2DQN B;  2MUT A;  2D6F C;  2HVH A;  1NJX A;  4ELV A;  2FLL A;  3HKZ F;  4F8R A;  3QU7 A;  2KD1 A;  4FZM A;  5B66 U;  5HHH A;  1IXR A;  3M8S A;  4O3O A;  2BKE A;  2HHU A;  2CXY A;  5D4B A;  1DK2 A;  4DLE A;  3PST A;  5G5H A;  9ICS A;  3C1Y A;  4BDP A;  3RJG A;  4YMO A;  2N1R A;  5ALQ A;  1KSP A;  5BOL A;  4M9J A;  4CNQ A;  3E0F A;  4RPY A;  4PGY A;  5KT3 A;  3PW0 A;  1V38 A;  3HWT A;  2Z7J A;  3MGI A;  5EOZ A;  4ACO A;  2ISO A;  4QZD A;  2WHE A;  5KFY A;  3H4D A;  1O08 A;  1QSS A;  2I5H A;  4JWM A;  3E58 A;  3MGH A;  3I28 A;  1L8L A;  2C2D A;  5KG2 A;  3SZ2 A;  1RM6 C;  5AI9 A;  5EWE A;  3IN5 A;  1SKW A;  5KG1 A;  5AIB A;  3AUO A;  3H4B A;  3GQC A;  3CNH A;  2CN1 A;  9ICT A;  4UAV A;  1SL2 A;  3M9M B;  1KFT A;  2OWO A;  3N7R C;  9ICV A;  4C8M A;  1ZQX A;  4F4X A;  2ASD A;  1XNS A;  3LWM A;  2IBK A;  1ARO P;  3QZ8 A;  1U48 A;  2ZIV A;  1ZQK A;  3TFS A;  4RUC A;  1CRX A;  2PFP A;  1ZQU A;  3TAR A;  2JHD A;  3C23 A;  1JRO A;  3HW8 A;  5L1K A;  2WF5 A;  2KIV A;  2IHN A;  1BNP A;  4ECQ A;  1H38 A;  2LI6 A;  3H8M A;  1WWU A;  4UAU A;  2E1F A;  2MRL A;  4US8 A;  2J6S A;  2PMZ C;  4MFC A;  4DFM A;  2FMP A;  4RNO A;  2HHQ A;  1N48 A;  3OHB A;  2ASJ A;  4M0A A;  1N56 A;  2DGZ A;  5IIN A;  2IHM A;  1ZQG A;  4ECY A;  3F2B A;  2HI0 A;  2BCR A;  2VAN A;  4K4H A;  2OM6 A;  5E79 U;  4J9P A;  5J2F A;  4IC9 A;  2ZXI A;  2FMS A;  1TVA A;  5AK3 A;  1X9W A;  2JEG A;  4OJL A;  2F44 A;  2M0N A;  3G6V A;  3JPS A;  2JV3 A;  4B9M A;  1RXW A;  2E8N A;  2FE9 A;  1L8O A;  1PVP A;  4Y2U A;  2W54 A;  4P0P B;  1K1Q A;  2ZIX B;  5J2B A;  1SV0 A;  4YP3 A;  1D9D A;  1JXL A;  5KFN A;  4HYK A;  1BPY A;  4EEY A;  4MF2 A;  3I1Y A;  5DQH A;  1JAL A;  2Y9T A;  5JU5 A;  1NOM A;  4RZR A;  4QWC A;  2P66 A;  3H8W A;  2ZJ8 A;  4TQR A;  5G5G A;  2EQY A;  4O3R A;  5KFL A;  4M9G A;  1KLN A;  5KG3 A;  5KG5 A;  3QYP A;  5KT6 A;  5KT4 A;  3CRX A;  5KFO A;  2RLT A;  2EZX A;  3TAC B;  4I2F A;  2V9W A;  2KFZ A;  4RQ8 A;  1JRP A;  4EBD A;  2HVI A;  2H3I A;  3QUQ A;  2OYY A;  3RB4 A;  2J6T A;  7ICS A;  4O3S A;  2QB0 A;  3WK8 A;  5AK6 A;  2JRZ A;  4YR3 A;  4RQN A;  1ZQQ A;  5CJ7 A;  1KRP A;  4J9Q A;  1F5S A;  2XCA A;  4BX9 C;  3ZD8 A;  4PPX A;  1D8Y A;  3PMN A;  3OSP A;  4DSJ A;  4QZE A;  3NVZ A;  8ICG A;  1U47 A;  3ORY A;  2R18 A;  7ICR A;  4EEN A;  5EE3 A;  1N63 A;  4KLG A;  3RRH A;  2K60 A;  4WJ3 B;  4I2D A;  1U45 A;  1NK0 A;  4TUS A;  4ZOH C;  1SZH A;  3FDS A;  3N4M B;  1L3V A;  2IA6 A;  3KKA C;  4CF3 A;  5KAI U;  2BCQ A;  3QXG A;  2GO7 A;  4C80 A;  1SWW A;  4RT2 A;  4RU9 A;  4KMU A;  2W04 A;  4M6W B;  2OH2 A;  4Y2J A;  1NK6 A;  1RPL A;  1XWL A;  2Y9U A;  4OJO A;  4TQS A;  8ICV A;  4CE6 A;  3MFI A;  1C20 A;  5AHX A;  2G08 A;  4M9H A;  3JPO A;  1UT8 A;  4GXJ A;  1PK1 B;  2OXO A;  3QUT A;  2WF8 A;  3DV9 A;  1C7Y A;  2C28 A;  2KK0 A;  2RDJ A;  1VDV A;  5IIK A;  4MFA A;  9ICR A;  4EEK A;  4RNN A;  4Q43 A;  5KNI A;  5J0S A;  4U7C A;  2I9G A;  1ZQL A;  2KEY A;  3UM9 A;  5KFM A;  4GIB A;  7ICT A;  3N7S C;  2NRX A;  3UXN A;  3C5G A;  4I2B A;  4K4G A;  2J6U A;  2JH7 A;  2MA1 A;  4FBU A;  4FS2 A;  5ALX A;  4LZG A;  1ZQA A;  3CW2 C;  1ZQM A;  1SGG A;  1MC8 A;  2DKZ A;  2JH1 A;  5CHG A;  2A1J A;  5AK5 A;  2ZTC A;  4U6P A;  3BQ1 A;  2RQ5 A;  1DOQ A;  1LKY A;  2VJ4 A;  4ED0 A;  5J29 A;  2VIX A;  1ZD2 P;  5ALV A;  8ICI A;  1FIQ A;  2BPC A;  4MF8 A;  4DQQ A;  3LVW A;  3ETR A;  1LV5 A;  2HBK A;  3AEV A;  5KL8 B;  1IV8 A;  2KKV A;  3M6K A;  1ZQD A;  5KT5 A;  1S10 A;  1L3U A;  4DSK A;  3E2E A;  3BJY A;  8ICA A;  1ZQF A;  2CRX A;  2W9A A;  2P6R A;  3V6H A;  2B6G A;  2JGA A;  4Y2X A;  2K4I A;  4RQ1 A;  2P6U A;  1ZJN A;  2OCE A;  2LKY A;  2KP7 A;  3SV3 A;  3LVV A;  2BR0 A;  2QB1 A;  3L5K A;  2LMR A;  1SWV A;  3PX4 A;  4IS7 A;  2E5S A;  1ED1 A;  4EZ6 A;  3H40 A;  3SMV A;  2UVW A;  5J2D A;  4OJ6 A;  3WK7 A;  2Q4T A;  4QZB A;  1QH9 A;  3RJE A;  3ALR A;  3PW7 A;  4P0P A;  2ESE A;  2ZIX A;  3B9J A;  2W55 A;  1RYR A;  1ZQY A;  2KJ8 A;  4I27 A;  3BQ0 A;  1KTQ A;  4C7Z A;  3MFH A;  5KFE A;  4P2H A;  1ZQZ A;  2R8I A;  3QU4 A;  7ICE A;  4FZL A;  2MU2 A;  4I2E A;  3M1Y A;  2DPJ A;  2K4E A;  3UXO A;  1XO0 A;  4DS5 A;  5CP2 A;  1B22 A;  3PY8 A;  2F1H A;  4GXK A;  3TFR A;  1RYS A;  1ZD5 A;  4QW9 A;  3KHL A;  4J9S A;  3N97 B;  2VKQ A;  2BHN A;  4ED2 A;  3GV7 B;  2EAO A;  9ICC A;  2FLN A;  3V7K A;  4O3N A;  1TE2 A;  5DB8 A;  3NRW A;  4QZA A;  3OJU A;  3GU3 A;  2KVC A;  5HHI A;  9ICU A;  2D3D A;  5ALH A;  4I2G A;  3AU6 A;  4B9L A;  2KMD A;  4UAS A;  4O3P A;  1RXV A;  5L1J A;  8ICQ A;  1WG8 A;  5ALY A;  1MN8 A;  4YR2 A;  1OW5 A;  2LBO A;  2YX8 A;  3AQF A;  4RQ0 A;  3PW2 A;  3G6Y A;  3RBD A;  3JPN A;  3LWL A;  2PFN A;  4YN4 A;  4F5Q A;  3BQ7 A;  4IRD A;  5CRX A;  2HBM A;  5DG7 A;  3K1Z A;  5CR0 A;  3V6K A;  2LYB A;  2H3Q A;  3MDC A;  1UQV A;  4C0Z A;  5BPC A;  1V85 A;  4KLM A;  1SKS A;  1X6J A;  3N7P D;  4M6W A;  4F5R A;  5KFK A;  9ICF A;  1URJ A;  4UB3 A;  3MR6 A;  3OHA A;  4DQI A;  5ALD A;  3NAS A;  4ECT A;  3MAB A;  3D2Q A;  3KZX A;  3DEE A;  4YQW A;  5DB6 A;  4BGD A;  4C8L A;  3QUB A;  4EX7 A;  9ICO A;  2ZJA A;  2BPG A;  2DF4 B;  4CDG A;  1UA1 A;  4Y2T A;  3PML A;  2H5X A;  1S0V A;  4QZH A;  5AM1 A;  1T8E A;  1T4G A;  3KHH A;  4I28 A;  4BWJ A;  3A0H U;  5F3X B;  2KKP A;  3HKZ C;  1JX4 A;  1PUZ A;  1JI7 A;  3F2C A;  5AM0 A;  4PL1 A;  4G9B A;  2HHW A;  4K4I A;  4F2R A;  3Q8R B;  4KLH A;  3PX6 A;  1D8L A;  1NKB A;  1NK8 A;  4NV0 A;  3TAD A;  3L4P A;  5IIL A;  4G3I A;  3ZDD A;  7ICV A;  5KG4 A;  4EZ9 A;  4O3Q A;  2GWS A;  2JEI A;  4DL3 A;  2NV3 A;  4R63 A;  2YML A;  1JN3 A;  4R64 A;  3R9K A;  2XY7 A;  5HNK A;  1Q3V A;  8ICT A;  2K8A A;  5L1I A;  4OO1 J;  5KFF A;  4B9V A;  2F3N A;  3ZD9 A;  4MFF A;  3QU9 A;  5KFJ A;  5DKW A;  4RQ5 A;  4NLZ A;  2XGQ A;  1KEJ A;  2HDO A;  3JPT A;  3WU2 U;  7ICF A;  3C2K A;  4EBE A;  2CPR A;  1NJZ A;  8ICB A;  3KHG A;  3TAD C;  3M8R A;  2DWQ A;  2JEJ A;  4OCZ A;  2XID A;  2DL0 A;  5DQG A;  2KE7 A;  4PZO A;  4NLC A;  5KL1 B;  1N60 A;  3QX7 A;  4UW9 A;  4DO9 A;  2XO7 A;  5DGB A;  4QZ8 A;  4PHE A;  1KKX A;  4IRC A;  4TUQ A;  5ALS A;  1BVS A;  4O5E A;  4OJP A;  3H7I A;  5AM5 A;  4IQV A;  5KFA A;  3LDA A;  3SV4 A;  4BXO A;  3NGD A;  3SD7 A;  5JRT A;  2WTF A;  4IL6 U;  4C8K A;  2NRZ A;  2IOH A;  3D6J A;  2F1J A;  5AI6 A;  4Z6F A;  4P0Q A;  4BWM A;  1AQ6 A;  2AU0 A;  4DL4 A;  4YXM A;  2KV2 A;  2MSN A;  4KMO B;  1RG6 A;  7ICH A;  5TIS U;  1SV4 A;  5AI5 A;  1MSW D;  3MDA A;  5ALP A;  1X9S A;  5DDY A;  3EZ5 A;  3NRZ A;  2AXT U;  4ECX A;  4R8U A;  3V7L A;  1ZQB A;  4KLQ A;  1Q3U A;  1KN5 A;  2IOF K;  2YMP A;  7ICI A;  3Q8K A;  2V4Q A;  2DBY A;  1DGS A;  5IIO A;  5KFB A;  4UBB A;  1ZQS A;  1BPZ A;  4GC6 A;  3RB0 A;  3GIL A;  4DCC A;  4JUZ A;  2DFL A;  3RJF A;  5KAF U;  4F91 B;  4AP9 A;  2KZM A;  1ZJM A;  4Q8E A;  2QLT A;  5T14 A;  5KFX A;  2F2A B;  1KFS A;  4FE3 A;  3C2M A;  1NK9 A;  4KLJ A;  3RJH A;  1ZQJ A;  2H3V A;  3Q8P B;  4GFJ A;  3M9N B;  2AH5 A;  3FYH A;  3HIL A;  4QIW F;  2E8O A;  4F72 A;  1SZP A;  3IV6 A;  3L3F X;  9ICK A;  2HHV A;  3PVX A;  4UB1 A;  4DSI A;  3VC8 A;  3BDP A;  1IM4 A;  5DBC A;  4P4M A;  5J0U A; 
#chains in the Genus database with same CATH homology
 1PUZ A;  1X6I A;  2LM4 A;  2JR5 A;  1X6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...