4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
3SMVA 4KYTA 5A3SA 4UMDA 5ALDA 2AGVA 2IOHA 4Y2TA 2NO5A 3BA6A 3E8MA 4I9GA 4HGOA 1L8OA 4CF5A 2I33A 1MH9A 4FE3A 1S2OA 3PGLA 2BDUA 5AKZA 4KX5A 1Z4OA 1U02A 1YS9A 2HDOA 3BWVA 2B8EA 4ZEVA 4CNQA 2GHQA 1ZOLA 3NALA 1Z4QA 4EEKA 4H1WA 2C88A 4XE5A 1Z4NA 2GFHA 3WK9A 4AP9A 1NNLA 5AI5A 1U2TA 5ALEA 3B8EA 3ZX5A 1TA0A 1ZD5A 5AM5A 2BY4A 2W43A 4FYPA 3IJ5A 5ALZA 1EK1A 3E81A 3J7TA 4G9BA 5AKGA 3UMGA 4XOUA 5IT0A 5ALQA 3NUQA 3I6BA 5ALJA 4Y2VA 3WKDA 5JJBA 4OD0A 3NIWA 4EZEA 3MMZA 3QUCA 2DQSA 5AVWA 4XPZA 5AVZA 3L8EA 4UATA 1TJ3A 3KDPA 2HF2A 5AW0A 2NYVA 3UM9A 5ALWA 2VKQA 3A3YA 4L6CA 5T41A 3WK6A 4NV0A 2WF8A 5ALOA 1QQ5A 1Z4KA 2HI0A 3E58A 2ZBFA 5ALGA 3U19A 3K1ZA 1U7OA 3KOOA 2ZXEA 5AHXA 4BX2A 3F9RA 3TLMA 1QYIA 3QNMA 5FP0A 1SWWA 4HAIA 1O08A 4G63A 2W4MA 5AK4A 2ZBGA 4BBJA 4BEWA 2OM6A 4C4TA 4YH1A 2I7DA 5AM3A 3WK4A 2PR7A 2G80A 3A1DA 5AKEA 2YJ6A 2RARA 4IFTA 3ONNA 3QU4A 1Z5GA 4F72A 1L7NA 1ZD4A 5ALPA 4HGPA 4GXTA 2Q4TA 1Z4IA 3U7FB 4XQ0A 3QXGA 3ED5A 1RKQA 3EWIA 1T5SA 1Y8AA 5ALUA 3WKEA 3P96A 2CFSA 4BX0A 3KC2A 2P27A 1QH9A 3WKAA 3SD7A 3N07A 3ZUPA 1RRCA 1NRWA 3QUBA 4KNVA 3WGUA 4E88A 2MSNA 2EATA 2G06A 1JUDA 5AKKA 2D2VA 3W5CA 3QU7A 4GIBA 2WF5A 5AVSA 2I34A 2R8YA 4Y2UA 1L7PA 2W11A 2IYEA 3M1YA 1WZCA 3D6JA 1VFPA 3B9BA 1FEZA 4Y2SA 3ZX4A 3AR2A 2G1AA 5AI6A 4UU1A 2FPRA 4YCMA 2YMLA 5AVVA 3ZVNA 2X4DA 3QYPA 2YN4A 4UM7A 2ZOSA 3OCYA 2AUTA 3CNHA 1RQNA 3MC1A 5AI8A 1RDFA 4OFZA 2OA0A 2FUCA 5A3RA 4YGYA 4IG4A 4B6JA 1F5SA 3L0CA 1TJ5A 3GYGA 2C8KA 2R8ZA 3FVVA 4L57A 1ZD3A 4KN8A 4YCLA 4O8CA 1Z4MA 1KYTA 3ZVMA 3W5DA 4PNHA 5ALLA 1RMTA 3PGVA 2ZBDA 5AW5A 3L8FA 2WF9A 3FM9A 4DW8A 2HHLA 5AW7A 2HEGA 3L1VA 5E0OA 1Q91A 3W5AA 1WVIA 3QU2A 1N8NA 2HCFA 3PCTA 2AMYA 3UMCA 1RKVA 1U2SA 1U7PA 2CFRA 2YJ3A 4UARA 4C4SA 3L1UA 4YIKA 2PQ0A 1XP5A 2O9JA 3SKXA 3L0BA 2ZG6A 5AK5A 3OCUA 4OHFA 3U7EB 5ALSA 2B8JA 2PKEA 2Q4RA 3HLTA 3OCXA 2FPWA 3AR4A 5IS2A 2B1QA 3EF1A 1T9ZA 1AQ6A 4L6AA 1SU4A 1YMQA 1RLMA 4QQFA 3RF6A 2GO7A 4AS2A 2YBDA 3IB6A 3MPOA 5ALXA 3WK7A 2I55A 4J03A 4QJBA 3ZWDA 4BNDA 2C8LA 4MUMA 3OCVA 3R9KA 3DNPA 1ZD2P 5ALIA 2HF7A 4OCZA 3UMBA 3NAMA 2G08A 1XVIA 3AR8A 3U26A 1L6RA 1Z4JA 2RAVA 2G0AA 1L7OA 1YJ5A 2EAUA 4HGNA 2I6XA 2YJ5A 4BEVA 1J97A 5AVTA 1NF2A 5AM4A 4UMVA 5ALTA 1RMYA 1Z4LA 4RETA 3ZTYA 4CF3A 2WM8A 3EPRA 5AICA 3AR7A 2WFAA 3NRJA 1QQ7A 5ALVA 3NASA 1Z88A 3ET5A 3AR5A 2YMMA 2QLTA 4BKMA 3MN1A 2IOFK 3ESRA 5AM1A 4DFDA 3U7HB 5AKJA 5AKXA 3NANA 1ZRMA 1RLOA 4Y2QA 2YY6A 5ALFA 3N5KA 4UM5A 3B9RA 4CF4A 5AVUA 5ALRA 1Z4PX 3CZ4A 3QUQA 5AKLA 5AI9A 4NWIA 4KNWA 2OYCA 2YMPA 2R8XA 5AW9A 4RESA 3WK8A 5AW8A 1WPGA 1S8OA 4EX6A 4C4RA 4JDPA 3RFUA 1LTQA 5AK6A 5ALHA 3R09A 2FUEA 2B30A 1L7MA 4BX3A 1Q92A 5AKHA 3ZTWA 3OPXA 4NABA 5AW3A 3L8GA 5AK3A 1J8DA 1RKUA 4AS3A 4KX3A 3QLEA 3WKBA 3I76A 2P11A 4Y2YA 3QX7A 3AR9A 1N9KA 5AW1A 3DDHA 2IA5A 3L7YA 2YMQA 2FPXA 5ALKA 3A1EA 3U7GA 4BNDB 5AI4A 3OCZA 2R8EA 3N8GA 4UMFA 3ET4A 2MU1A 2IOFA 3I1YA 4FFDA 4NAVA 2GMWA 3W5BA 5ALNA 3ZW7A 4BYGA 1CR6A 2YFYA 3ZVLA 1RLTA 5AM2A 3SHQA 3WGVA 2C4NA 3N28A 4I9FA 4EX7A 4EELA 3N1UA 4HGQA 3I28A 4J2TA 5AESA 1X42A 4Y2XA 2G07A 3AR6A 3DAOA 3KZXA 4EENA 2B1RA 3IRUA 1L8LA 5AVXA 2WF7A 2FDRA 2JAWA 1SWVA 3QUTA 2HOQA 2P9JA 3M9LA 1LVHA 1VJ5A 1T5TA 2JAUA 2BDEA 1XPJA 2FEAA 5AW6A 1YV9A 2HO4A 2EARA 3L8HA 1RMQA 5A3QA 5AKYA 3WKCA 2O2XA 3ZWKA 2RB5A 4Y2PA 2FPUA 2WF6A 2HSZA 3VAYA 4ZEWA 1VJRA 3E84A 3DV9A 3SF0A 2FPSA 3OTQA 3FGOA 2OBBA 3U13A 4HYTA 2NO4A 4UAVA 5AIBA 5AW4A 5ALMA 1WR8A 3FZQA 5AM0A 3SLRA 2AH5A 2FI1A 5AW2A 2JARA 1YNSA 3QU9A 4DCCA 5IT4A 2B0CA 1ZRNA 3L5KA 2YJ4A 2C9MA 3ESQA 1TJ4A 1RPZA 1O03A 1TE2A 5AVYA 4UMEA 2QYHA 2GHTA 3KD3A 4YIHA 3ZI4A 2B82A 3OCWA 3SKYA 5AKIA 2G09A 3HYCA 1PW5A 1RC8A 2ODAA 4UASA 3A1CA 5AVQA 4CE6A 2Q5EA 3AR3A 1ZJJA 1ZS9A 4UAUA 1EK2A 4MWOA 4UU0A 2WHEA 4HGRA 4ZEXA 2RBKA 2P69A 4NFLA 3FPSA 5AI0A 3R4CA 2HX1A 1Z5UA 4JB3A 4UW9A 5ALYA 3ZU6A 3QGMA 4Y2RA 4Y3UA 1YDFA 5AVRA 4F71A 3QU5A 2MU2A 1IWOA 3KBBA 2I54A 3WK5A 1QQ6A 2CFTA 2ZBEA 1RQLA 2JGAA 3EF0A 2CN1A 4DWOA 1K1EA 1CQZA 3PDWA 5AIAA 4YCNA 3FPBA 2JAOA 3S6JA 3L0YA 4Y2JA
chains in the Genus database with same CATH superfamily
3BB4A 4FE7A 1ZQTA 1D2CA 1S97A 3G8YA 2QKYA 2BZ1A 2DBYA 5JAUA 1NRIA 3ZQJA 1XDWA 4DWIA 2RAFA 1TM4E 4XIYA 2X23A 7REQA 1B6GA 3EEIA 4WNYA 4ZI7A 3L4PA 3LHIA 4JWMA 2PKRA 4RVSA 5LVAA 3CYFA 4PONA 3PHCA 4LRXA 2WW8A 4I1RA 2JHCA 2DQSA 5JH7A 1LV5A 1TMGE 3NBKA 3NDPA 4GDMA 2ODWA 4ICAA 3JYQA 3M0EA 1UDXA 4RDXA 1FJXA 3P9KA 5JD3A 4BLPA 3UT6A 2BDTA 4EUSA 4IMPA 1P9RA 3F9RA 1UPBA 1CUYA 5DHTA 1HTWA 3PR5B 1UC4B 4M9RA 1TGVA 3GP8A 2X7JA 4U63A 5IRCD 2A1UB 1W87A 3SZLA 3CUVA 1EE1A 6PFKA 3BDIA 3EASA 1MV8A 3F4BA 2ADFA 5F5NA 4B8ZA 1ZQKA 2XBMA 1DRKA 1GEGA 5BSWA 1PVQA 1OXXK 4RW0A 3DXFA 1PSWA 3ZUPA 1W9MA 5EOZA 5INTA 5AJHA 5J40A 3JZMA 1R1DA 1KZ9A 5IYZF 4G0QA 2VI5A 5MN5A 4LRQA 4BN0A 1H1LA 1QRSA 4LV5B 4P0TA 2H5LA 4JYPA 4PQRA 4NBSA 1RZRA 3VNBA 3ESYA 4GYKA 1PR9A 1VPEA 2O0KA 3K2EA 1M7BA 3QJ5A 2Q07A 4O2LA 1ECPA 3KQOA 4FCTA 4K0KB 1OY1A 5H80A 7ICGA 4HWPA 2P91A 1P1HA 4O8CA 2IZ1A 1U3DA 4MFCA 5IP5A 5F73A 3N2KB 4M0CA 4ZMBA 2ZXIA 1QE0A 1JHXA 1NRXA 1T9BA 2HK8A 2PPLA 4ZPJA 1OJLA 5IABA 2DE0X 2C9DA 1IHOA 4MJ3A 2OL4A 4KRYA 1G8PA 5LJLA 4ZYTA 4PG7A 4F5ZA 2WSYB 3CZMA 3HJEA 8ICSA 1JLLA 2KW5A 3DNPA 2HA2A 3OOEA 5CEFA 1B6RA 5HRAA 3PY8A 4J07A 1G64A 4CU2A 3UMBA 1LQUA 4AKGA 1WWKA 1FDRA 1M2HA 5T4FA 4QWWA 3MFQA 2MMCA 2OE2A 3ON5A 4B8WA 3GHYA 3PNKA 1PG0A 3WJAA 3LM8A 2DUNA 1PFGA 1WDWB 1GITA 4PBSA 1U90A 3ETGA 2WPNA 1QP7A 3GELA 3DW1X 2XYVA 2OMEA 3VSAA 5K6RA 4ZT4A 1A0OA 3UQ2A 3F6SA 4PS0A 4XARA 4I1YA 2RSLA 2HMWA 5CFRA 5DGTA 2OCYC 4DDTA 3TIFA 3BE8A 4DF4A 4R4JA 2HMUA 1A9QA 1ZQBA 3DV2A 1SG6A 1W0CA 1QIGA 3MPUA 4E3ZA 2O8CB 4LDQA 2DBVO 4X3CA 4WFIA 5EE3A 1TVMA 3O82A 4ALMA 2GBPA 2DAPA 1UBOS 1AUQA 1G3UA 3QUTA 4KQ6A 2P2YA 1J0EA 1SXJE 4UB4A 5K0GA 3I9V1 5CNJA 1IZYA 4RXUA 5HDBB 5F33A 5J2TB 1GG2A 1JLHA 4HYTA 3RIEA 3M82A 3OX4A 4IIBA 2DR2A 4MPDA 4B6SA 4GLBA 4U6PA 2H1RA 1Y5IA 1ADYA 1M54A 3Q7EA 1FX0B 3H1PA 5G41A 4F85A 4MR9B 2ZPUA 1ZA2A 3UG6A 5FFMA 2GWSA 2FWNA 1EK2A 1RWPA 4TV8B 3FPSA 4PYMA 2FVYA 4RKRA 4WZZA 3ZD8A 2GN8A 3WK5A 4NXMB 1RACA 1VI2A 2QN1A 5AUQA 4UBCA 2JGDA 4GFDA 1OTHA 3E9EA 1TUBA 3T3EA 1L8OA 1NK5A 4B6QA 4KOAA 1FP6A 2Y0PA 4MHVA 2Q8PA 5DB9A 2QVBA 2ASLA 2EBHX 4I19A 1NBHA 1T4CB 1RWKA 3HJHA 4Q15A 1GGMA 1SCBA 2JJ2A 1KFBB 3SZ2A 2AZ4A 3O4GA 2P1ZA 3HKEA 3WGNA 1EJ6A 2DLDA 1GG8A 3ZYZA 1VE9A 2BP7B 3SC6A 3Q9LA 5FWYB 3EIFA 2GN6A 4KN5A 3BXOA 2VP0A 2X2PA 1UBEA 3RHZA 2XQFA 3C1AA 1FQOA 2WUDA 1J2TA 4ZWNA 2BI8A 3DOFA 2B4AA 3IO5A 1G5IA 3A1WA 5D8DA 2YHIB 2AZXA 4F9FA 5E1DA 3I62A 1N36B 4KWTA 5DCLA 3FVQA 3F0TA 3N2IA 3ZDQA 1VYUA 3RREA 3KDAA 1KJZA 3O94A 3K4GA 4IXDA 4DLTA 3RIYA 3MWEB 2AX4A 5JZVA 2W9CB 3HWTA 4YO8A 1OASA 3R5TA 1P5RA 3WLMA 2DY1A 3RI3A 4QWEA 2JH9A 3R7WB 5EQTA 3ZD6A 3FVVA 1BPDA 3RS3A 2J8ZA 1E2FA 1D1PA 3PEYA 4MGIR 2BKLA 4PYQA 1H5UA 1BC5A 2CLFB 2ZGVA 4JUDX 3I37X 4S24A 2DWCA 4KRGA 2VT2A 4B43A 3VYUB 3GJTA 2VXYA 1JIHA 3QX3A 1DFIA 1NJ6A 2C1ZA 2IUUA 3L7MA 4CIVA 4PQEA 3AEXA 3EVGA 3ZHQA 1VLBA 4TQ9A 4JLUA 2H51A 3EVDA 2C2MA 3Q0EA 4M37A 1PZMA 3IAM6 2D0PB 4BMCA 3IAAA 5LKRA 3VR6H 5IWCA 1UJCA 1NI5A 2W2NA 3L8DA 5JALA 2QARA 4XYGA 1BQEA 4BNFA 1XX6A 4C7MA 2VBFA 4HAOA 2Q6LA 4C4ZA 4ZP1A 1N33B 3HO6A 1BZYA 1ADJA 2YWBA 3CZ9A 3L07A 2AEMA 4HHEA 5LZ5A 4CKEB 2H48A 2J9XB 3BXZA 4OJYA 3ZOZA 9ICRA 2W2KB 3INRA 1NC1A 3EVNA 3VTZA 1ETHA 5LLSA 2ZI5A 2O2CA 5AI9A 2W6JA 5JWRA 8ICLA 4A1OA 2D59A 3T1NA 4JP3A 1ZWLA 1U7ZA 3RAFC 2PUBA 1J8DA 2JGLA 1KE2A 1B00A 3O4IA 3X1JA 5H4GA 3K0KA 2UVQA 1CQJB 3MCTA 2BHRA 1P0CA 4IO1A 2J09A 3BG5A 5A0VA 1G66A 4B9LA 1FNDA 1SA0B 3ND7A 4ZJUA 3VRHA 1JH8A 1CHNA 2IELA 4TGLA 4D43A 3PA8A 4MS4A 1CEEA 2HAEA 1JSLA 3PS9A 2I8LA 1YQEA 3MIZA 4DLXA 5FO0A 3PIRA 4TL7A 1XJ0A 2DHCA 3R5JA 2XQKA 2ZSAA 3E9ZA 4OHUA 5EERA 1PLKA 5JO0A 2NO6A 4EUHA 3EUB2 1KVQA 1XMSA 2OV4A 3O4JA 1MV5A 2D13A 1X8LA 5KU7A 5KFMA 2KP7A 2R8GA 1LQ2A 3UB4A 2Q2VA 4XA5A 2AG8A 2Q50A 4IDBA 1ODTC 3GUUA 2DF4B 5CNMA 2YIMA 4W63A 4ENPA 1C7YA 1IDOA 4K05A 1VLMA 3WHIA 4UBIA 2ZTVA 4Y3UA 4NYJQ 2XZDA 3TLJA 2I1VB 3HUEA 2B94A 1YOBA 3CUYA 2PVSA 2ARKA 2AGVA 1MB3A 5JCJA 4E12A 3ASZA 3BMNB 1Z4OA 4MR8A 2GRUA 5IFLA 1CRXA 2J41A 4TZ6A 1PD1A 4V3BA 1WUHS 2EZZA 1Z47A 1PQ4A 3FOCA 2QVLA 4OHKA 1KYIA 3AFHA 4FINA 3VR3D 4CCAA 5F4BA 1T13A 4BKRA 2OXEA 2WI8A 4RGYA 4PVDA 3I61A 4WESB 3MWDB 2WJGA 5JDCA 4M9HA 4D25A 4ETIA 5BVGB 2BKXA 1G8AA 3HB9A 3IE0A 5AK4A 4FMCB 3IP1A 3LUHA 4PRLA 3IBFA 5CDFE 4CMIA 4HNRA 4HDSA 2JBAA 1GTJ1 5ICMA 2ZIXA 4WKBA 1FU8A 4TUSA 1AU9A 2CYBA 4C3ZA 1JHRA 3OZIA 5LL6P 1IUPA 1ZZGA 1IV8A 2OUKA 1U8ZA 3N07A 3ITNA 2A19A 5ERGB 3GZ4A 1ZQRA 3IHQB 3FPJA 3BQ7A 4IS2A 3T5BA 2XZLA 3QVUA 3L18A 3R0IA 2YOGA 4ED7A 4II2A 2KE7A 4DYHA 3HX0A 2PX6A 4YJ2B 3SSNA 1NBEA 1ISPA 2PX2A 5IFKA 4KO8A 3Q9NA 3EBLA 1YVEI 3TIVA 3ST7A 3N76A 1YVUA 2FGKA 5LMNB 3AQFA 3ZE9A 2NG1A 3P0JA 1EBFA 4RLQA 3T9EA 1C80A 1SZDA 4YO7A 5DYYA 1LK7A 3G7SA 3UMCA 1FJHA 2AMVA 4YIKA 3TJZA 1V7PC 1RI4A 3DE6X 3EJWA 2DRIA 3E9QA 1LCIA 5EMJA 4AKSA 1QHEA 1UWCA 3ASYA 4JLMA 1KY5A 1NRJB 1YDEA 3W5HA 3KSBC 3Q7SA 3QY9A 3I2YX 3ZY3A 1L5KA 2Y0SC 1BSVA 4A15A 3KEMA 1WNTA 1MZPA 5EIWA 2HF7A 2CNWD 1I51A 5J2UA 2XDAA 3FE2A 4XSGA 3V6MA 4HSEA 4L4YA 4OHOA 3JTMA 5LOVA 5CRIA 4ARBA 5D3MB 3C23A 5K6TA 1Z4LA 4FFWA 2WIJA 2A9KA 3B12A 1U8XX 3NRJA 3ZWOA 2R0QC 2AE1A 1OW3B 2YCBA 2HKIA 2C2WA 3TM5A 1RG6A 2K8BB 4TRJA 3PFHA 4PHDA 4ZCIA 4MZDA 4HX5A 1UZUA 4N0DA 4UXIA 2R8XA 1B26A 1XYVA 3OURA 2PBFA 2AN5A 5FA5A 3KEFA 3CGWA 4K4GA 2JEYA 2QRKA 2Y92A 4A6XA 3LQQA 4GBJA 5AI4A 1LPOA 1RQ2A 4CM6A 1BDBA 3I2HA 1R9JA 2XMZA 2ZWIA 1IHDA 1E2JA 1NK0A 3Q3EA 1F14A 5DNWA 5J2BA 3KR0A 1RPTA 3NHFA 1QYVA 1K98A 1QC5A 4FIDA 3CMCO 4S0ZA 1Y8QB 3VU8A 3PO4A 2H0RA 2KWIA 4FB4A 3PVCA 1CB0A 4BU0A 4HAYA 2ZSKA 4A8EA 2FPUA 3F3KA 4CHGA 1CEQA 2ODQA 3HWX1 1RRGA 1TQ8A 1K92A 4UAVA 4UHCA 3NHLA 1YZ6A 4LNUB 1N2HA 1PUXA 1K7SN 2FF7A 4BFWA 2QV7A 1DL5A 2YICA 4MFAA 4U02A 3KX2A 1NLUA 1FCJA 3N0VA 1Y7TA 2JDIA 2X5OA 3PD1A 1RKXA 2VFAA 3NDBB 2R66A 1A2KC 5EIAA 2MSWA 1QKKA 3VGPA 2RBKA 3AY7A 3AUAA 4B6OA 4MWEA 4IIDA 4S1OA 1NVKA 2RC6A 2ZBEA 1RYMA 4P8RA 4BQRA 4B83A 5P21A 1LB1B 1PX2A 5CDTA 3RC9A 2V0GA 1HQYE 4YK7A 4ND8A 4FC7A 1ECGA 3NYQA 5CNKA 3O83A 3H7AA 3IT0A 2QSUA 3L4BC 3QF4B 2BLLA 3ULKA 3BXEA 1TTHA 3NALA 3GLKA 3E3OA 2CNDA 5FOTA 1NG9A 1U7WA 5IG2A 3O2JA 1WCYA 4PLFA 5JI2E 1WMEA 4GP9A 5K0LA 4RY9A 4PSVA 1CUSA 4TM7A 4FYIA 1P6UA 3EB9A 3GLGE 1MXFA 4NM2A 1J7JA 3B1VA 2W7OA 2BFAA 5J2AA 2BBWA 3CW2C 2R96A 1M1NA 1G4AE 3TZBA 4ZVPA 2Q7XA 5G1PA 5KNLA 4M1ZA 5EWMB 3TSWA 3FFWA 5TDHA 3VSCA 1SV0C 3O84A 2V5UA 2P5TB 2I62A 3HABA 4NX2A 4MKGA 1MRSA 4KOEC 1PCXA 1ISSA 4DSAA 1KWKA 1H2FA 5CBPB 1G42A 2HXGA 3I0ZA 3TNYA 1CNEA 2LMRA 3I2FA 3ICEA 3OSPA 1FFAA 4HPWA 7ICOA 3PWTA 5B1IA 3N8NA 3OKAA 2P4UA 4IMIB 4PGQA 1O96B 2G36A 2YYYA 1ZVVA 1DKNA 4FYXA 4UFPA 3TX2A 5C18A 1NVGA 3ANTA 1EM6A 1Q44A 1XQ9A 1LKYB 4FBTA 5HP4A 4BYMA 3Q87B 4YMTA 2BR3A 5DM0A 2XGQA 3PEEA 1CDZA 4Q4JA 1MJFA 3LWMA 4Y6SA 1GJRA 1ZQDA 2BFWA 4LKRA 4N7BA 1YT3A 1ZMBA 3ISDA 3IB6A 3ILYA 1X1EA 4HH4A 5DT2A 3KUDA 4UNNA 3EQ8A 1ZD2P 3U26A 4YJFA 2ZATA 1JDBB 2J85A 5TLSA 5KQRA 3IBTA 5IBPA 4NFYA 1IRIA 1NMZA 3D7KA 4MS3B 4QOEA 1CUFA 4RL4A 2YDYA 4YXFA 4YMMA 3IKLA 2ZTLA 4XYBA 3W7VA 1ICIA 2D3TA 5DDYA 4EHNA 4KNWA 1SK9A 4QXOA 3WGOA 4WBSA 1V9SA 4OHWA 1XLTA 3WK8A 1YGYA 2MSEB 2RHFA 3C3WA 3DE5X 3PJGA 2PMEA 4PHCA 1VIMA 3DZ8A 4XGKA 1XALA 2H11A 3P2OA 3VVBA 4FQ7A 1FS5A 2WNSA 3RU2A 1W34A 3WICA 1N3BA 1GFIA 1NG1A 2JIZD 5G1NA 1EAYA 1SKBA 4PG4A 3FOEC 3ICWA 4DMLA 1NPTO 1Q20A 4WFKA 4Z9YA 3QKIA 5KQPA 2X9NA 1PWHA 1VLVA 2X8JB 1RVV1 2CXHA 1W0JD 3QKRA 3T15A 4WNAA 3SQWA 4R1MA 4FFRA 2WAQC 3FTDA 4FNAA 1U28A 4D8YA 3FGOA 1REQB 1ORVA 4PHGA 4ITUA 1JROA 1MTZA 3S55A 1M7HA 2CLEB 3GEDA 1JKJB 1F20A 2B6GA 5EHXA 1JW9B 1AOXA 5GIPE 2PU5A 2O3SA 2WFZA 3GDHA 3H16A 3J81k 2W9AA 3ZE6A 4IV0A 4DUZB 3TBKA 2W6OA 4D82A 3C97A 5FLKA 4R84A 2VDKB 5EGSA 4RADA 4Y2JA 2QN6A 5HE9A 1CUIA 1WHTB 3WGKA 1MA0A 5M3BA 5DBCA 2WT4A 3DZJA 4HGOA 1WJGA 3NV7A 4W5RA 2A1TR 3VI4B 3WVNA 5EJAA 1PBNA 1WCV1 1X0VA 2VJKA 2W5UA 1JSRA 5BOVA 3DT9A 1Z73A 1ZW1A 1UBJS 4TYQA 2O2GA 3WLJA 1JA0A 1GU7A 8AT1A 4IRUB 1RIIA 1QONA 1MAUA 3NNSA 1IXRA 1DI0A 1BCSA 3H9JA 4X1OA 4MUHA 2VWGA 2FP3A 3PSFA 5CWRA 1W36C 1TECE 2OESA 2W3RA 3UJ7A 5KS2A 2ECOA 3VJRA 4MICA 2GK7A 4G5OA 1UOQA 4UUQA 2AXTU 1WWUA 2AW5A 2FWBA 3KS9A 4O4LA 3IKTA 3P94A 3L84A 2VUIB 1NOIA 2EANA 4GO1A 4RMIA 1PR5A 4M7RA 4CDMA 2MJLA 3KFVA 5CJ7A 3QMPA 3U6BA 5TT0A 2JPDA 3RYHA 4RK4A 1H2HA 4LMRA 1P75A 1C30B 5DN9A 1AGRA 2Q2OA 1CE8A 3UJ9A 2HNKA 2V3VA 1B4DA 1MXHA 4NCIA 4WIAA 2B3TA 3BMCA 3O1LA 1YJXA 4QVKA 4PLVA 4EYSA 5AI6A 1DOZA 3KQYA 3HY3A 1SU7A 1G7RA 2YN4A 1QIKA 3RAJA 4J7XA 3ES9A 1NK6A 5HCNA 3W9UA 4ZIRB 5I51A 1VI5A 3M1AA 3UWDA 3IPAA 4IHKA 4YACA 1XYYA 3SXJA 1JBKA 2FN3A 4TWZA 5K09A 4BMYA 3C28A 1OD6A 1G6OA 1JI3A 4OF4A 4JEMA 4M7WA 2P5YA 4S3MA 4D4HA 4FMCF 3WAKA 4Q4HA 3GGSA 1J8FA 1J9EA 1P81A 1YZQA 1FS6A 4QELA 4MWCA 4KQ2A 5LP6A 4RD3A 4Z0TA 2R7MA 2A67A 4Q8FA 1U4NA 5AJYA 2XY6A 1YA4A 2CBGA 2YN0A 1N78A 2Y1OA 4CLOB 1QSLA 3OZXA 4YT2A 4UB2A 5ED4A 4MB6A 5B3JA 3VBCA 3EEFA 1KYXA 3DC2A 3K2QA 1ZINA 4LJAA 2A58A 5LDGA 1XVIA 3W0LB 4GVLA 4H1HA 1YBFA 2D5IA 4OMFG 3G6KA 4BEVA 1NXOA 3Q7PA 4TMZA 3GVXA 5IN5A 2J7PD 2QD4A 5F52A 4YJ2F 3M6WA 3FAKA 1JWBB 2UZ4A 3KZ1E 2Y05A 4KPEC 4OBBA 1C7IA 1O1YA 3TQRA 4X1IB 3DDZX 4R1PA 3DBVO 3BQMB 5BV7A 1M34A 3PMLA 1OXSC 2Y1GA 1DPGA 5EJGA 2A1JA 3JQ8B 4PLGA 721PA 5H3LA 1NXVA 2PXXA 4R2HA 4L8GA 1RBZA 1JIXA 2IXBA 2O0LA 2KFNA 1DFHA 4JX9A 4NF2A 1TA9A 1J1UA 1NKTA 1TX4B 3KQQA 3SLGA 2WWXA 3RS5A 2ISCA 4EYEA 1X14A 2C94A 2G07A 4RKQA 3L4SO 1XROA 4I8XA 5D3ZA 2P9JA 3IS3A 5KKCA 3D4OA 2RB4A 4BQSA 1HDZA 3HR4A 2A5JA 1TT7A 4PX2A 2Z5GA 2QA5A 4YRNA 3D6FA 1OH5A 2V7QD 4A2QA 3CVWA 2VF5X 2SKCA 4KO1S 1FRVA 3MAGA 1IHYA 4DV7B 1CEYA 4BL5A 3O9VA 2PXAA 2A86A 4FHDA 2WY2D 4RD2A 1G7SA 2QI9C 5F9MA 2FY8A 5AVYA 1Y4DE 1EZ1A 5B4TA 3I2KA 4DMFA 2AMLA 2EQBA 3DZGA 4MVYA 3V2IA 1R6TA 1GHTA 2KJ8A 3ZV3A 3F6RA 4NFLA 4OP1A 2FRDC 4YA6A 1RSZA 1OZFA 1QAQA 3OEWA 2HIAA 1WS6A 1FSPA 5LWHA 2JGAA 3EQZA 1VCOA 3JVIA 4IQ8A 3U1VA 1BVSA 8ICBA 1M6YA 4BBAA 2IL1A 2GBLC 3UN1A 3IODA 1RRFA 1SQ6A 3QVXA 2MTBA 1KNQA 1MH9A 2FSVA 2HPZA 1P4AA 5EY5B 4HRAA 1DGJA 1FYXA 5E2AA 3UGJA 4G0ZA 2BMFA 2FG6C 1YCGA 2QMYA 3ADBA 2Q9AA 2I2DA 3IJ5A 4FSHA 5ALQA 4ZVUA 1HLPA 5KZMB 2F3PA 3DZIA 3NIWA 3GEEA 3AUOA 4FLFA 4EZEA 3QA9A 1J0AA 1CZKA 4KLMA 2A1AA 4CT5A 1W8DA 2OHGA 3DL0A 1E96A 4KODA 2NTYC 4W7SA 4GEGA 1A9TA 1OXVA 2CDCA 4ZT2A 5FL3A 4KXUA 3JQDA 3OTOB 5KO2A 1ZQ9A 2JGMA 4J9NA 3C15C 1TTQB 2FMXA 5F1OA 1LDBA 4YXWA 3A1DA 1XNQB 3NGXA 5U9CA 3FUCA 3PCXA 4Q00A 3MSCA 1PZHA 4M1WA 3FF1A 1NR5A 2PTGA 4XQ0A 3IVMA 1GFWA 3MBOA 1RT9A 1U8UA 1OB2A 2JD2A 5MN6A 2HCBA 1Q6ZA 2UDPA 2CL6X 2O3QA 3TMYA 3P8ZA 4PZLA 5CD9A 4YAFA 1LXCA 4KYUA 3UJ3X 1WZCA 1YVDA 3NHBA 1TFUA 4L8LA 3B9BA 5HNKA 3EAFA 4A8JB 4L22A 2J6SA 3OF2A 1GFZA 3NTVA 3KB6A 5IIMA 4O0LA 5HVNA 1T5BA 2ACEA 4KTVE 2FB9A 4YP0A 5KHOC 3HM2A 3KL4A 1P0PA 2LIVA 3WJ1A 5JMTA 4YUYA 4UKDA 3LHSA 2C20A 1E1KA 1TYZA 2PSDA 2YHAA 3PJDA 5ALSA 4AZ3A 4GZMA 4GRAA 2ZBQA 2QD3A 2F17A 1JXAA 3PDIB 5F77A 4RY2A 4J03A 1A1VA 1IB6A 2KHVA 1QO0D 4WEQA 2VHQA 2B34A 1G21E 2PN1A 4UU7A 3DMNA 4TLMB 2WB4A 4ECSA 1FPMA 3T0GA 4XB2A 2WTBA 4W82A 2LCFA 2I7CA 1TCCA 4NC9A 1PKEA 4GMXA 2NMVA 3S1SA 3E7FA 1PK1B 4KCGA 3DZCA 5EXPA 3II6X 1S9DA 3T5DA 2LNDA 1ZQPA 3RBEA 5FTWA 4YS6A 4LXIA 5LUBA 4Q3DA 1FMLA 1WP4A 4UC0A 1UOEA 1QH8B 1A9RA 3ZWQA 1RWMA 3ZTWA 2I4OA 3LZCA 2WHYA 2UVWA 3A1FA 4FZJA 5DK6A 1E3JA 5DWDA 3ZNQA 5L1MA 5C9ZA 4DOAA 3CNQS 3AU6A 3FWYA 4CI9A 2ZITA 3H42B 4B5LA 3WGVA 1FNMA 3R3VA 2ZBRA 1P1BA 3UB2A 1M2VB 4KPFC 3G5AA 2IJGX 4EMSA 3TKLA 3WE7A 3PXCX 4OMUA 2HBQA 4WKPA 3IXLA 2PKQP 4MPRA 5HGXA 3OH8A 1VE7A 4AY4A 3OE1A 4P2BA 1E3DA 3VVCA 4E5NA 2ZIUA 4V3CA 4ARZB 1MW9X 4UQOA 1TM7E 2IHKA 3H0KA 1A88A 2AFIB 3WX0A 3KE9A 2RHRA 5CH3A 3QVWA 3IG8A 3VUEA 4EFLA 4ZVQA 1JL3A 5EP2A 1O03A 1Z26A 3AHFA 4RCZA 4UXHA 3ELBA 5BN4B 3VR4D 2CHGA 4WT7A 4HNVA 3BDPA 3E8XA 1NJWA 1ZJJA 3R74A 1FL9A 4N3BA 1ZJNA 3IP6A 3LQ1A 4L78A 3PPXA 4NG5A 1QQ6A 4XCXA 3P2KA 1NOMA 5U1PA 4H3VA 1A5ZA 5H82A 2X8WA 3RAEC 2PUEA 3ICXA 1MJ5A 4AS1A 2HC9A 4NHOA 2C4MA 2PKWA 2CEKA 2VTBA 1T2DA 2H7VA 3PLRA 3EXHB 1D2RA 2R8BA 1L5MA 2GM5A 3ZUGA 1LRKA 1T1IA 4JMLA 3ZVKA 1FE8A 1SOWA 4NL9A 2GFHA 5IZCC 5JAZA 1E2HA 1XKTA 2PZEA 4OL9A 1G2PA 4L0CA 4DABA 5IVPA 2FTKE 2HMXA 3KUXA 1T2FA 2E5LB 2M6RA 3S1AA 1IPEA 1NKSA 4ITRC 4ACBA 1MG5A 5ENDA 2ISQA 2XY4A 4P93A 1YZKA 3LOPA 1KBQA 1Y1RA 1TD9A 4PTZA 3NNDA 3EQ7A 2I1QA 1P9NA 5FWDA 2Q5FA 3OHAA 1NUHA 1AS2A 1MIOB 2EKLA 2VA9A 4X65B 1N8SA 2FZGA 4OK6A 1TA4A 3AEQA 5KFGA 4CU5A 1KMIY 4YPVA 2W7TA 1UJ5A 3E0QA 3IDQA 4X1YA 4JI4B 4TSFD 4B6RA 3E5HA 1PEYA 2FDCA 3HEAA 5A06A 5HUQA 1ZQYA 3EPJA 2CVOA 4MITA 3GRRA 2PCLA 5KYYA 1RRCA 3QX9A 1SD5A 3LXUX 1OXKB 3WRWA 4LRSB 2WAAA 1KAMA 2I6QA 2DBQA 2ZB4A 2Z6VA 1U0OC 1JILA 2LYHA 4UE6A 1POXA 2G70A 2WD9A 4BJ5A 4F7WA 1C8BA 2PQ6A 5AI8A 2JFHA 1AY0A 4IOJA 2AWOA 1TJ5A 3QVSA 1KMNA 1QRAA 5EP4A 2PS0A 1YZ7A 1Y7HA 2WSIA 3PCTA 3B60A 1D5CA 3C3PA 5KFKA 5BSVA 1B23P 1PVPA 4TTQA 5ENVA 4F12A 1IIRA 5KG2A 1EGAA 5TPWB 1S9HA 3IJRA 5K8LA 3UAGA 4BO8A 2OZKA 3O0TA 2H1SA 4QE3A 1X86B 3O8CA 4EIWA 1H38A 3RIGA 3P9QA 4ED8A 3OIUA 3KZMA 3GPDG 4HGNA 2TYSB 1E2IA 4F56A 4XYMA 2JGRA 1Z45A 5AT1A 1UXJA 2FPLA 4KGZA 1Y6JA 3AEUB 1Q5PA 5C1DA 2IYTA 4BZWA 5I3CA 4ZYWA 2E8OA 2AJBA 5MFPA 4RH1A 4FKZA 3L04A 3N6VA 1E1QA 3UYLA 3W4IA 3Q5EA 7ABPA 1KK0A 4NH4A 4DBZA 8ICXA 4WW0A 3R4VA 4UTVA 4EUNA 3RSHA 3JPOA 3I76A 4YNBA 4RUCA 4DQIA 1T36A 4ZOLA 5ALKA 1LPBB 2XRZA 2JJQA 3IURA 4YUZA 3UVEA 3SR4A 4PAWA 4JB0A 5LC1A 2EEPA 4LFCB 4QZFA 4Y1FA 4LJSA 1O8CA 2HJ9A 3WMEA 2E5FA 3OEED 4E94A 4TXLA 1PVRA 2D7DA 3KJGA 3PTZA 1BWPA 1SZHA 2P2NA 1QIFA 2AI3A 2PEZA 3P19A 4GS5A 4OREX 4F4FA 1PS0A 1XU9A 3WTCA 2QRJA 3E3AA 5LIPA 2Y1KA 3VYVA 1EFRA 3EPIA 2WIBA 4QAJA 4FMBB 1NUQA 2EFHB 1DOHA 2XWSA 1F3LA 1IULA 3RJ5A 1IQRA 4MSUA 4PXSA 3P9SA 2ZW9A 1Z3CA 3ZHVA 2PMWB 1W8IA 4XWOA 2WAOA 1ZXBA 4P53A 4UAUA 4O25A 2FMIA 5K4LA 3NBUA 3F1KA 1EE9A 621PA 1MQ3A 5CA0B 1Z68A 4PGMA 5D51S 3EF0A 5CJ2A 4X54A 1XJQA 1N9GA 1XG5A 3ZBTA 1TKDA 2CUTA 3EDOA 3DMRA 1PRYA 5BWBA 2ZETA 3UIEA 2IOHA 3CLHA 3RFXA 4U7CA 2DH6A 1BYUA 1QIMA 4DV1B 3BGOS 2C54A 3IEPA 4S0XA 1L4BA 2PUAA 2WTNA 4M7PA 1IB0A 2ZYAA 3D6AA 5B1SA 5L4NA 1A1SA 5IHXA 2NYRA 1I1OA 2AFHB 1ZCZA 2VHYA 2ZWMA 3D1LA 1Y80A 3C5GA 4B81A 3SSAA 1IK6A 4YRIA 3HSYA 1LZKA 1BN7A 3R6WA 2W83A 2YCLA 3IR7A 4PO9A 1AGXA 2HI0A 1RYNA 5L9XA 3O8NA 2J3JA 2C7QA 4QU9A 1OHHD 4XW2A 4J6FA 5KWSA 3ZZ0A 3VR5H 4FEGA 3D2CA 4BEWA 4NCAA 1Z0DA 2NSDA 2HPHA 2O7RA 4LCBA 3K6JA 5HRUA 3OPMA 3U0BA 3VDXA 1JNYA 5LLDA 5DF1A 4DLEA 1X15A 2FPIA 1R5OA 3HKDB 5BUQA 1DCTA 2V54A 2ZI4A 3V80A 1LLDA 1THMA 4XPIB 3ICCA 1D2EA 3FNGA 3LLUA 3G0BA 4YP6A 1E1CA 4J9PA 4S1WA 5EPOA 2X42A 2XUIA 1U0JA 2CNOA 3NONA 2GTIA 2VK1A 2R00A 3TW8A 3ICOA 2UVRA 1CRPA 4PZEA 3A2MA 3TRIA 2P7IA 3C6MA 3RVKA 1H69A 4HRXA 2BJWA 2YW2A 4WK6A 3WZ2A 1QX3A 2VT7A 2AIRA 1DELA 5JCZA 2NW6A 3R40A 3JX9A 3K32A 2GJ8A 3RWMB 3RYFA 3LX8A 5LZ2A 3HCFA 1IHPA 3PW2A 1Q0QA 2K7ZA 3QENA 4P4LA 4D4LA 2Q29A 4P3YA 3JPNA 4ZARA 4TMKA 5D5PA 1VLJA 3QX8A 4FFBA 1JKMA 1LBEA 2PZKA 4MIEA 1NULA 4GC7A 1Y4ZA 3DVLA 4QIWC 1NF2A 4YMOA 1RZRD 1WEHA 3NVVA 4RGVA 5EAIA 3A6JA 2H5IA 4NLNA 3ZJYA 3INYA 3T5HA 4K9PA 4M87A 5G0SA 4FB5A 2H7CA 1UKCA 1N77A 5JVDB 4FBGA 1PJBA 2FWIA 3FCOA 3SS9X 3JARB 4O3FA 1PTKA 3SFVA 2R6HA 2ZIVA 1RZUA 3UGTA 4EW2A 1F06A 4G9EA 3DAFA 2ZS7A 4URYR 1T35A 3E9RA 4AS3A 2HJWA 5BR8B 1DWPA 1BMDA 1G4UR 1SC4A 1G5TA 3RTVA 3R7LA 4RVHA 3ZLBA 1QZUA 5PNTA 1ZMXA 4LCJA 5AFSA 4ARSA 2OK8A 3O93A 5K0SA 3M9NB 2KS6A 4UBMA 3G5UA 3Q1LA 2VO1A 1QRTA 1VXRA 3VPBA 1SVLA 3LUBA 2GJKA 3M1IA 4CMKA 1I5RA 4EG6A 4F4CA 5IAOA 1XZCA 3CNLA 3ZWAA 3FMVA 4M1EA 3S2YA 2OMKA 4NM1A 3QEJA 1UPUA 2ZRFA 3N2GB 4ECYA 4BB0A 4RQNA 3QJYA 1QHYA 1LF0A 2ERCA 5K6AC 2AEEA 1JE0A 3UYKA 1XWFA 2FUKA 4GE3A 3GFRA 5L1KA 3AF4A 1H3NA 5KPJA 4PHFA 3QIVA 3M5CA 4LWOA 2MINA 1NK4A 4BVHA 2AQHA 4KZPA 2KQUA 5CK4A 1XCMA 3O73A 2QUIA 3HXMA 1MC4A 1I32A 3H2ZA 3AKDA 4JZYA 3K1YA 3M6FA 4EY5A 1HORA 3SYZA 3ZDRA 2JASA 4OFBA 1T2NA 4ADSG 1QBGA 4FXPA 1EHIA 3K0AA 4FOLA 1TCVA 4CDRA 4DR6B 1R6XA 5JNRA 5AQ1A 3U4AA 2V6MA 1E9FA 1I1HA 3C1TA 2EV9A 5FWAA 1N34B 4LV8B 4PVCA 1Z2PX 3L79A 3CH7A 4B4OA 2UZ3A 2P6RA 1SXEA 4RZ3A 1NF9A 2N3ZA 4DZZA 3CLTC 2D6FC 4K6OA 2MOKA 3PW0A 1I0IA 1X8KA 1SIWA 3ZX5A 4LVSA 1ZD5A 1H6DA 2ENWA 2NN3C 3ZXIA 4BN4A 4MVJE 1U31A 2HHAA 5KOJB 1W73A 1ZJYA 3MABA 3MT9A 5TX7A 3T5PA 3V4RA 3W8DA 2KMDA 1NQOA 1TL7C 3RG2A 2WF8A 5H3CA 3JQ9C 2K4IA 2WB1F 4E4RA 2ZRIA 1H9AA 3U19A 1XC9A 5I47A 4EJ6A 1TQHA 3CXRA 7GPBA 2XMQA 1HMYA 3ZEAA 2GD2A 1Y4UA 1OX6A 3K3PA 4NAHA 4ZN6A 4U8HA 2PTHA 1QTIA 1C8KA 1PJTA 1Z5NA 4KLEA 3DTTA 2GT1A 4A10A 3LRTA 1QTRA 3WDMA 1LUAA 5C4GB 2EJUA 2WSBA 1NRWA 4LDPA 3RR2A 2WJZB 2H8GA 2A9OA 4ZXFA 5J59A 1KVRA 3IUEA 3THWA 2QSYA 4WMLA 4B3CA 2JJ2D 2LZ0A 1KDTA 2DT5A 3HPRA 4O0MA 3HYRA 4KH1A 4ZVNA 4HWTA 2FLKA 3H97A 3QFRA 1IN7A 2BT4A 3PNYA 3GAFA 3H2KA 3WLAA 4TVKA 4LZDA 5CJPA 3ZHXA 4WSOA 3FFXA 4FZ5A 2GN2A 3GLTA 5DQHA 5DYWA 1JKIA 4ECRA 4Q9DA 3A25A 4DGQA 3SZGA 5ELXA 2EDCA 3KIPA 1G5HA 1JV2B 1VMDA 3PXUA 2A9JA 5EZYA 1EUQA 2I2FA 3BERA 4IILA 4JL5A 3T1HB 4N49A 3TM4A 1YR2A 3AP2A 3CWCA 4ANFA 3LHKA 1JSCA 2IWRA 1TCUA 2D0DA 2OORC 2XXBA 3M6UA 2YVUA 4R6XA 1AXGA 4BNDA 1II8A 1XPRA 1IOWA 1KOGA 2VRNA 1V8DA 2VJQA 4AN0A 2G08A 1I33A 1ZI8A 3RSFA 3GAAA 1V9CA 3RVSA 2K87A 3NGMA 5AVTA 1GGNA 2VJAA 3UJ6A 2B1JA 5ITZA 3ROMA 5CLFA 2PGDA 1QQ7A 2G3YA 1K0FA 1XQXA 9ICMA 1RP7A 4LF4B 3OETA 2AHOB 4YECA 3OPYI 4WN9B 1E1NA 4EGFA 4A2PA 5GZ3A 5IJXA 3IX7A 1FW6A 2OLEA 2EG9A 2BCEA 2OCIA 3KR2A 4DNQA 2GYYA 4KLLA 2WA1A 4K88A 3K53A 3EPGA 2DQ4A 1SXIA 1VLZA 4YJ3B 2WK1A 4LJYA 1HE5A 3WDLA 4NLCA 2O7SA 2GZ3A 2GXAA 1FVOA 3L05A 2QMEA 4DJDC 1GUYA 4QJ3A 1WM1A 1U2PA 2JK0A 5CT8A 1XI2A 3V7KA 2Z08A 4EM6A 2XY5A 3DF7A 3V2HA 3KWFA 5HGJA 2X0IA 2FDRA 1VHDA 3RUDA 5AW6A 2Z2KA 1AB6A 3L8HA 3E53A 2AQ4A 1AKTA 2JFUA 4C0KA 5EP1A 1C9YA 2G67A 2RHHA 3TOXA 2HLDA 1FK8A 5DLGA 1DG9A 1PE0A 3GIKA 2ZIWA 2I91A 1D0VA 2AH5A 1Z2NX 4LFAB 3ZCUA 3AFOA 4WKNA 4I36A 2W6JD 3RRBA 3TL3A 2QW1A 1XQVA 4L5AA 4R2MA 2QM0A 2VF4X 2Y4NA 4ARCA 3JCZA 3MUOA 2A5GA 4DLBA 2JA2A 4PYNA 4PZCA 1HDCA 4YT4A 4M60A 4OXXA 4CFZA 3K5HA 5I9NA 4AXXA 1U0BB 1D0SA 4A1FA 5E1BA 3ZWYA 2NIPA 2B37A 4EFKA 4I4CA 5KYKA 1T6NA 3RJZA 5ECWA 2G9UA 3L0PA 1TO6A 3OZDA 4GX5A 4S05A 3QG1A 4FHFA 5AKZA 1YBAA 1KI7A 2H4JA 1LI4A 2IUEA 1C0LA 2JRZA 2A14A 3BCHA 2AXPA 4MGHA 2G76A 2JCGA 1FUIA 3D8HA 5KOYA 1CP3A 5ILGA 3PHLA 3OZEA 4RIIA 1NHWA 1Y9DA 2BWJA 4EGAA 1NW5A 2I5PO 1K68A 1K5HA 3CTPA 3GFOA 3ICVA 1XRNA 3UC5A 1L5NA 3B1YA 1L5HB 3K8OE 4NATA 1OWNA 3NGDA 4IIYA 1F9AA 2XH8A 2RCYA 2IUYA 1C3XA 1PT5A 5CA0F 2G77B 1ID8A 3K8YA 3WFIA 4I0WB 4JP8A 2EXXA 1HOTA 2IODA 4KSCA 2GPWA 4WXYB 4I2GA 3T54A 5KG1A 1PV1A 2XNJA 2EWWA 3MBKA 5JCJD 3SD7A 4C6SA 3MZ0A 3G2MA 4C8KA 2OD2A 1KI2A 3FBGA 2F55A 3LUFA 3MXOA 3KEOA 1CJUC 2HJHA 5B57C 4WE3A 3K09A 2UZ0A 5CYGA 1VTKA 4F5DA 3VC2A 1VOTA 2GD1O 4IJVA 1XNRB 2CD9A 2D0IA 1XRPA 5TVKA 4FW9A 2VS1A 1CR2A 4RSMA 1GUFA 4DUGA 4GLOA 1SCUB 3G89A 1JIQA 4I14A 4XKJA 1CP2A 3EXFA 2WFLB 2VPIA 5FF9A 3V7WA 5JNUA 3FSGA 4AMUA 2IHMA 2OYRA 3DVRX 2HIMA 2WICA 1WMFA 2EFDB 4H6VA 4QRDA 2ZI7A 3IAM1 4O0IA 2ATCA 3H9EO 5IS2A 1WSBA 4CLRB 2PMBA 5A9SA 4GWLA 3MRTA 3MWJA 4GZ3A 1KZ1A 4NP6A 1RWNA 5BR4A 3BUSA 3PNPA 1EGVB 1PK7A 1G59A 4OAQA 1DRVA 1YE8A 1AQNA 3EY9A 1E2BA 1V3UA 1FYWA 3KYJB 2KD1A 4G24A 3RK1A 5J2GA 1N2SA 3RFCA 1U9CA 2A0FA 5FADA 2MR6A 1TZKA 1P9WA 1QIIA 5LZ8A 5FWXA 2HGSA 2GZMA 3EGXB 1IBSA 4GBGA 3U7HB 4Q66C 1V95A 1J5XA 4YVFA 2YY6A 3OJSA 3H3FA 3BFJA 1G63A 1CZHA 2BONA 4OJNA 4PZZA 3M6ZA 1YDGA 1E6MA 4IOMA 3HCEA 3AGPA 4N03A 4BX3A 2OQIA 4ID3A 1XHFA 3I4FA 1FIQA 3WI7A 4KSBA 2NVUA 5KFOA 1K9SA 2VDWB 4CEIB 2WHQA 1MENA 3X2FA 3T34A 1A77A 1AK1A 2CV1A 1F0KA 5DGHA 2Y77A 1ZSYA 3LC0A 1VSUA 2BE7A 3P7MA 2ACWA 3KKOA 3VTFA 3RFTA 1KDOA 3NJ8A 3EUWA 5FOQA 2F3QA 4RD1A 2HO4A 1Q3UA 2JB9A 3C16C 2BI4A 4EHHA 5IKPA 5BN1A 1NAIA 1MJGM 4KMOB 4G4JA 3ZWVA 5LYJA 2YIVX 2ZJ8A 3G0CA 1MN8A 3ZY6A 1CWUA 4F6LA 5DYNA 1FQKA 5JVDF 1XDZA 1C1DA 1P7CA 4CL0A 3DLIA 1Z62A 3EWAA 4OSOA 3RTEA 4TRRA 2I22A 4RUAA 3KHKA 1WXXA 1VPVA 3REOA 1QIEA 2B25A 1PDVA 4CE6A 2DJ5A 2OCAA 2AR0A 5LDHA 3B48A 2BFNA 4XUSA 5ALYA 3PA6A 2BFDA 4YHHB 3QU5A 3ZWCA 1EP9A 4N7MA 4PGGA 3W6ZA 1EK0A 1WCIB 2D1SA 3R5HA 5FPKA 4QXMA 3GRYA 1NJXA 3Q7QA 4MJ7A 2HBLA 1F44A 1MABB 1ZYQA 3HJBA 1L5QA 2CVFA 3DM5A 3IH5A 5KEIA 3VPHA 4HK4A 1ZUIA 2JLCA 2CMFA 4EKYA 1QK4A 1ZH6A 1SKSA 3OZCA 3DOHA 3RTBA 3PX4A 5FDFA 2O8BA 4L9WA 2XCPA 3NT4A 4B46A 5ALZA 5JARA 4F11A 3R8XA 4PS1A 3T8YA 3G5MA 1D07A 2KG5A 3KDPA 2JDID 1BXRA 5CVUA 5AJXA 5T3YA 1WD5A 4WD3A 3L43A 3HGTA 1ZJMA 3FC4A 1ORDA 5DIZA 2WNIA 1YB5A 4RKWA 4U7GA 1MAVA 3VH2A 1T94A 3A3OA 3L0SA 2JD0A 1K7EB 4DM7A 3WGZA 4G81A 1IG6A 2O2HA 4UE3S 3HFSA 3KO8A 1D4OA 3QW4B 4Q7LA 3MGCA 4YC7A 1OCEA 2E37A 4EBBA 3WAGA 4FGLA 3RYCA 2CFSA 2CJXA 2XA1A 3B1XA 3OCJA 1MRZA 1Y6GA 3GJZA 1E0JA 1OXTA 3QE0A 5LOVF 3ONWA 2ZQ5A 4PHPA 1L7VC 1E60A 4GMHA 3D7MA 1U8FO 4W5OA 1U4BA 1LPMA 2O3TA 3W5SA 4EY6A 4ETNA 1XTUA 2PR2A 1S0MA 4Y0NA 3G23A 4ROSA 1BAPA 5DI3A 1EGHA 1LBTA 4XLTA 2RIPA 2VUHB 4LPKA 5BOSB 4R8LA 5HM8A 5HK8A 2IS4A 1I30A 5FIUA 2AG1A 1XZJA 3OT1B 1R64A 2AJQA 2YJ3A 3ZY5A 4C7ZA 4NFHA 3HN2A 1GNSA 1Y1TA 1MW8X 2EF0A 1D7AA 2JLXA 4Y2GA 4H3KB 1CY0A 2DGZA 4OJ5A 4AY5A 1L8QA 4ZDWA 4YLYA 4AJEA 1YR6A 2YBEA 3FHLA 2GSWA 5HPYB 4KB5A 4PYIA 5BWLA 2EAUA 3EK2A 3V34A 4HDKA 2HF9A 2BFPA 5L6LB 1PBTA 1WSWA 1MMFB 1ISRA 3A1TA 5JD5A 4B3SB 5FOWA 1OLOA 3JZIA 3RV4A 2P77A 4M8NE 2J3LA 1XTBA 5AKJA 4V39A 4F3NA 5IIKA 3EQ9A 1X7WA 2QRHA 5I01A 2ZAMA 4KZKA 2WTFA 4Z8YA 3ZIUA 5M7EA 1MVOA 4LY3A 5EFOA 1BXGB 2W54A 1RHMA 1ECLA 1H1TA 3DW3X 1Z8HA 4RMGA 4YT5A 4POAA 3L0DA 1FQWA 3FOWA 3MGVA 1LVGA 3IMEA 1LRJA 1WZNA 2VDMB 1J56A 4MP8A 3PHIA 3VDNB 4CW7A 1M72A 3ZW7A 5CXXA 4B84A 1P0FA 2OLKA 2EKPA 5E3IA 1EIZA 2LM1A 1SIUA 4AF6A 1G5QA 4KXLA 3MSXA 4QSHA 2I9GA 4H0CA 1UMDA 1YK1A 4X95A 2ZR9A 2PRIA 1JQAA 3STWA 2WF7A 1G6HA 1IVSA 3IQWA 4I6EA 3AH8A 4PN3A 5L7WA 2VJPA 2XDQA 1ZH8A 4MYTA 1HDEA 2P6NA 9ICHA 4IFIA 1CJCA 2CMDA 2GPYA 1PG2A 4MWSA 2UXDB 3N7RC 4QOIA 5EJIA 1VJRA 1ZH4A 1W5SA 1NJSA 1L9XA 5GMOA 4HWOA 1GN8A 4W1QA 5FBLB 3BJZA 1OYWA 3I9OA 3TPFA 4KFRA 5FPYA 5FJIA 3FN4A 2YIDA 4RK6A 3UW1A 4AYXA 3BB3A 4YJ3F 3GBPA 1JPUA 2RIRA 3GRVA 1I94B 5CGZA 1EFKA 3CPHA 3X1DA 5E6SB 2W55A 2QAIA 2KJ5A 3TINA 4BXOB 4OQFA 3C4VA 1T2EA 1UA1A 1UEIA 2CN1A 5DX0A 2XVMA 4OQ4A 2IVFA 4L8VA 1R0KA 4JV5B 1OFHA 4KXQA 3OQHA 2LPEA 3DZKA 2BGGA 4ZRMA 4R8RA 8ICGA 1RM6C 1O97D 4UM9D 1XRLA 3AI7A 4BU1A 2C3PA 2GHQA 1UAGA 2ECQA 2PMKA 2Y67A 4H1WA 1RR6A 3GZTB 1NNLA 3C7AA 3GJRA 4QYMA 2HW8A 1GUDA 3MAAC 3ZH9B 1DXYA 3EISA 5CYPA 5TE9A 4UUPA 4GL4A 5FXMA 3WL7A 4LEIA 2H7XA 4EYGA 3W5JA 2WUVA 2J0UA 3D8BA 4FR2A 1PJQA 2NU8B 1QGED 4YALA 4AX4A 1SUSA 4U7FA 1JJIA 1J8QA 1MN6A 2RAUA 1GNTA 3DDOA 1FFEA 4OAOA 2RBEA 2XNDA 4D98A 4CJXA 5CDUA 1A50B 2OD9A 3NKVA 4NDNE 1Q1GA 3VZPA 3RUEA 4FIZA 4IFTA 3KHUA 4RPLA 2Q1UA 4TQGA 1CZRA 1UDBA 1ZKMA 5FUMA 4GBMA 2P4SA 1XTIA 1VSVA 2I4IA 1D7OA 4JR2A 1QTNA 5KTRA 3ZW9A 5I9IA 1CQIB 5CA1A 1L7PA 3EMBA 5DZSA 2PWPA 3WLLA 4XZ3A 1Y8RB 4F6RA 3N5CA 2C2OA 3JVDA 4CV2A 4I66A 1XDBA 5BV2P 5DB6A 4Q01A 4AY6A 3OY7A 1EP1B 3BCSA 4M8KA 1BE0A 2V9WA 4KLGA 2J3KA 2AR9A 2I2AA 1FMTA 1X7DA 1XZMA 4DW8A 3IHTA 3WV4A 3KYDA 4J9OA 2OGZA 1NVBA 4KE7A 2UUBB 4GL2A 3IQHX 3WZLA 3SV4A 4ZAGA 3ZLJA 2WJPA 1ZNQO 4QLOA 5F78A 3FPAA 3QEBZ 1YI8A 2JJ1A 1U0FA 3PZPA 3PEFA 1GYPA 3DTYA 5ES4B 1YZVA 2YVKA 1E8MA 1KYYA 1JKFA 2P9CA 2FH5B 3VC1A 3IILA 3CIOA 2AI1A 4JLKA 3SQDA 3ONVA 5LM3A 1U0HC 4HPXB 3DE0X 5EMMA 3EMVA 1ZQHA 3W3AA 1THZA 3RC3A 2Q3JA 3C8DA 1BDIA 1SBQA 4CDNA 4KRXA 1E1MA 1E79A 5ANRB 2PA3A 5AOCA 4A92A 2C3YA 1AK2A 4C0SA 4NJMA 2HM7A 1GL6A 5CVTA 4EWLA 2J32A 5TS2A 2HZ7A 4IV8A 2BFEA 3JSXA 1PVDA 4RS3A 5JRDS 5E7MA 3L49A 2WHPB 1ZW6A 1P2UA 3DPIA 1YI1A 2JLBA 1X3LA 4PFJA 3HI4A 4UBLA 2VDUE 1IN8A 2VHXA 4ICIA 8ICEA 1EFUA 1HRDA 3DONA 4CKBB 1CY2A 4LSGA 1XU7A 4BZQA 2PJZA 2CD7A 5SY6A 4PV7A 4NLZA 4TXMA 5HA5A 1GFSA 2IPXA 3OBBA 4R81A 3RK4A 3J7AC 3T7EA 3LYSA 4F2SA 1KFEB 5JROA 2V65A 1T10A 2A78A 2RBGA 5EXEA 3ZBPA 4GHWA 3I9MA 3IUYA 4TLEA 1ZNYA 4KFTA 1AB5A 3OOJA 2P2GA 3RRFA 1XJ5A 2X0NA 2H2HA 3U0VA 5EIHA 3L1KA 4ZI2A 4UDYX 4HH0A 3WL8A 2COEA 5C7IO 3UH1A 5ADUS 3THYB 1J5EB 1SY7A 3R7SA 5DP2A 3STVA 3I5XA 3RTDA 3RF7A 9ICNA 5F12A 1STOA 5CB4A 3UCXA 1LLQA 3IDFA 1GG9A 3FRJA 4RV9A 4K2HA 3EN0A 2HBMA 2Y6VA 4JT8A 3KTFA 1I9GA 2R18A 1QHGA 3ZCVA 1P9LA 3IOYA 5DP1A 1J6UA 3DZFA 2AFIE 3AILA 5KYWA 3V4LA 3WLOA 3AL3A 4JSYA 3GLHE 4DLVA 3E9DA 5HZKA 3TLBA 2YJTD 2E4ZA 2IIPA 1IIPA 1JI0A 3RRHA 1AXRA 1K2WA 3ZS8A 3A32A 4L6CA 5EEHA 2BEVB 3AB3A 4DQPA 3L4JA 2FSGA 3RGWS 4QHYA 2FLPA 4RTSA 5LQAA 1NN0A 3Q2KA 4J16A 5JNLA 2YZNA 1FS4A 2YFHA 4JT4A 3DVAA 3W5UA 4D4JA 1GYQA 1Y1LA 3WLKX 9ABPA 1CIJA 4NU5A 3NRZA 4BBJA 1U8YA 2I4LA 3QEKA 5CFOA 1KR5A 1ZSVA 3GD5A 3CZPA 3CHYA 4B40A 3B1JA 4L0QA 3U6KA 3WIOA 3JD4A 3UV7A 3W7AA 1CVIA 2WPDD 4UEJA 4EG5A 7REQB 3QUBA 1ZM2A 4ZI7B 1T4GA 1ZQCA 4E46A 2D2VA 4GIBA 1DAOA 4BC0A 1E0KA 2RGYA 4N5NA 4BASA 4I2FA 3KKKA 5JH7B 1WB4A 4R40A 3N8HA 2XCOA 2ISOA 4EEYA 3NFYA 1V16A 4L57A 2EFGA 4ARAA 3IVRA 3LQKA 1HT1E 5BN3B 3KKMA 1WAMA 4DG9A 1W47A 3E22A 4RVDA 1SB3C 1TAUA 3DXXA 5ICFA 3ORFA 1GPAA 2UYQA 3CPEA 2Q4BA 1ISFA 5KYXA 3HB1A 4CV0A 4LTNA 1YE5A 2DEUA 2HT6A 2WT8A 3WGIA 3AKZA 3UK2A 4TTVA 5F9NA 1ZJ4A 2HU5A 3AYXB 4ZCQA 1H1LB 2XSZA 4HLQB 2B4KA 3IP9A 4WVFA 2OO5C 1GZVA 4MIKA 1L4KA 4DR1B 3PL1A 1GGKA 3T94A 1L3IA 3YASA 5K03A 4HLUC 3BHNA 4EBDA 4KQFA 1FDWA 3LT5A 4EG3A 3MWYW 3S7TA 3VNAA 5GV7A 3RF9A 4JWNA 4M83A 5DTMA 3DUFA 3MN1A 3S8EA 2CCJA 4LC0A 4KGDA 4RE6A 2Z9CA 3VKHA 1D8AA 4XTRA 3T3FA 4ED2A 3ACCA 3N75A 4DLAA 5K3OA 2GDJA 2WWWA 1UBSB 5AW9A 1KY4A 2XJ4A 4V1CI 1B4FA 5JTIA 4YJHA 1SUDA 5F21A 2FMUA 2FR8C 3PFKA 1MOQA 1SUWA 2BBOA 1WVGA 3W4KA 5DLEA 1P2BA 1JLLB 1GXSA 3M4NA 1VCHA 1OAKA 5LQDA 3KLBA 2OR3A 3H3JA 4MKXA 4EELA 4BPBA 5AO9A 5KFTA 3CXUA 2R5FA 2ZYSA 3NUGA 4D9IA 3SXUA 3PUZA 4B4WA 1L7AA 2WZQA 3E3NA 2C59A 3H8VA 1DXHA 1AQIA 3PSIA 1ZQVA 1M33A 5A3QA 4MA0A 3S28A 2PI4A 2KSOA 3L93A 2GZ2A 3DC7A 4UB1A 2HXSA 4JUIA 1TIBA 1PVVA 4IYRA 2JIDA 1TUIA 4R1NA 1P8JA 4OKSA 4ND5A 3WLPA 3ISTA 2W42A 3MTQA 3CW2A 3D6MA 2JATA 1USIA 1ZSNA 2VIIA 1IEWA 3BRSA 3KHGA 3T3HA 3ONEA 3C5FA 1CFJA 4OLAA 1AE1A 1A5SB 2DECA 5J4LA 2GPSA 4YV2A 1SV0A 4PZUA 3ZY2A 4P80A 5MF6A 4DSIA 1HG1A 1CK4A 3KBBA 3G3EA 4DWOA 2OO7A 1AMUA 4G8CA 3RB3A 1S76D 1SIJA 4JITA 2I2CA 3HRKA 3KL2A 1K4KA 1YR8A 2YHSA 2E4AA 3JQ6A 3W9SA 3I73A 1ZQ1C 4DQSA 4IUCS 1M2EA 2V9ZA 2Q49A 3MT0A 3R6LA 2RHWA 3HNOA 9ICKA 3IJEB 4I5GA 1TA0A 1FMFA 4LJ6A 2GPAA 2R5WA 2OCDA 1T1GA 2ZBVA 4RZXA 1UP4A 2RHLA 4G01B 1L3CA 4XOUA 3KPVA 3L41A 5EJFA 1EH5A 4RWZA 5B7GA 2RMKA 4NV0A 1CBUA 4O3SA 4R3WA 1XZDA 2K2WA 7ICQA 3K1ZA 4HQKA 4B7XA 4B4KA 2N0SA 3IL2A 2CNLA 4HAVA 2ZJZA 1ZQWA 1RRPA 4C4TA 2JGDB 1BDMA 1UA0A 2RARA 1TUBB 4GOMD 4XUGB 1VE1A 4PHAA 4B1FA 2VPZA 3EZNA 1JDNA 5J9FA 1T8SA 1K66A 5IM5A 4DL4A 2X2OA 3DS8A 1DJMA 4JYBA 1KZ6A 2Q6KA 3HKEB 3VYRB 4WLVA 4BS9A 3I4CA 2ZJ4A 3QE3A 1Q1QA 2V8OA 3DR5A 5EQJB 1GZDA 4LHVA 1YRBA 1RXEA 3CX6A 4MRNA 2ZUVA 3AVQA 1QK5A 2VSYA 3CX4A 3GLVA 3WGJA 1E1DA 1ZL2A 4QUAA 1C0PA 2P41A 3WB9A 3DOUA 4Q0MA 1J1IA 2EJBA 1FFYA 3C3JA 2KICA 3ROKA 1A7JA 3ZG6A 2WJJA 2E5WA 4YQEA 3TQQA 5B6IA 1C8LA 3NBFA 4YJGB 4W9MC 2GXSA 1UKVY 3REQA 4PNZA 4JJ6A 2XMGA 1E9EA 1AQ6A 4QXRA 5HIIA 4LDNA 1W2HA 1YMQA 1LLFA 1U49A 3QTTA 1RAEA 4AZTA 3TF5A 3I1JA 2HDNB 4R54A 2FW7A 3NORA 6ADHA 4U6QA 3OOYA 3WP0A 2B99A 3I01A 4LGMA 4ER5A 5KFNA 3DT6A 1O4VA 3KQLA 1H0RA 1PJ4A 2DFDA 3G0IA 3I9FA 3LUGA 4OKIA 4NBRA 3JVVA 4BRUA 7MDHA 1R4NB 1KO8A 2QG6A 2CHUA 4IKOA 2YY7A 2COUA 1ULBA 2J6BA 1MX9A 1P4JA 4A2WA 1EXNA 1IZ7A 3BSSA 3D3WA 1A04A 3NXKA 3BRQA 4YMWA 4MV7A 1B6SA 3M49A 4H7PA 1YQUA 4JGGA 3A6PC 3H87A 1JA1A 4IYJA 2IA5A 2PA0A 1QSYA 2K89A 2IA6A 2N75A 5JOQA 1OTXA 3OFSA 2H1FA 3TAXA 4D02A 1P8AA 2IPNA 2DPIA 1DEOA 1HLFA 4N39A 3DP7A 2QARB 5JCOC 4LXXA 3S2UA 2EIXA 1D9FA 1MT0A 2HRBA 4RSHA 3RAQA 4W99A 4H2DA 5F9LA 1YBMA 4DXHA 1IN1A 4KUGA 1BD4A 4YAKA 9MHTA 3U44A 4QZHA 2IBMA 3BK7A 3PD7A 5HKBA 2BCVA 4J3JA 3FDJA 2MSKA 4AY2A 2C97A 3ZE1B 7ICVA 5E1OA 3QH4A 4NEHB 4I1UA 2ZE8A 3DLAA 1GRQA 3HI6A 4JHXA 5L1JA 1T8YA 4BB5A 4RA9A 4JNKA 4DDWA 4KIGA 3RDPA 4P84A 2ODTX 1FUKA 1YC2A 5GTDA 2A59A 3MD9A 4YV0A 2XKKA 1IBCA 3T7RA 3R0ZA 4AQYB 2UZ1A 2MU2A 4ZOBA 2I29A 4MS4B 1CJMA 1Q16A 1CT9A 4CG3A 2MRLA 5G4KA 2FWRA 4EJ0A 1ACLA 2JGIA 1G8SA 2KKVA 3CONA 5L4LA 1B74A 1PX0A 5G2OA 4UTRA 5EGNA 4IXMA 1AKVA 4FBUA 4LCEA 4DFJA 5KYNA 1EFRD 2ONKA 3ZV6A 3CUTA 3QVLA 2JH7A 4IDQA 3PPVA 4JSTA 5G5HA 4G65A 1ICEA 2F9LA 5AVOA 2FF5A 5DI9A 5KSPA 2QL7A 2NVBA 1D6NA 3EEQA 3WSTA 1U1FA 1KLNA 1GU0A 5A04A 4OIMA 4HAUA 1SQ5A 3VOTA 4J8PA 3L0ZA 1U2EA 1JIIA 4HGYA 3B7PA 4P5DA 3RR8A 3ESAA 1U9IC 2OBMA 4YRMA 1DCMA 4MR8B 1AQJA 4BX0A 1JIKA 1RYEA 2B3DA 4G97A 4N5MA 5FA8A 3RYTC 4PM4A 4HKTA 3TQSA 4YRPA 4HEHA 1R37A 4NEQA 3WLIA 5KJFA 2VEOA 3BQNB 3QFTA 3EG9A 1KJIA 2W0MA 2UYGA 4Y9DA 2BEKA 3CRQA 1F0YA 1F17A 1JN0A 2WP0A 4KN9S 1Y7PA 3M1LA 2PLAA 4AQ7A 1H2WA 2EAMA 3H5WA 3K9LA 2B4RO 1H0HA 4RD4A 2YUTA 1N8KA 1ZUWA 1GYRA 5FEUA 1RWBA 2Q3HA 5J0OA 4FKMA 3O8OA 1GGHA 5DU2A 1ZNXA 2YV3A 5JHHB 3ENVA 2OC9A 4CMIB 2JBAB 2ZIXB 1YOVA 1UC9A 3WBJA 2HA7A 3A1NA 1PAUA 4Y9SA 3RSSA 4G37A 3CVYA 1JQEA 1NMXA 1XZKA 4I6GA 2DY0A 1W93A 4ZO4A 2XT0A 2YZ7A 4NRDA 4ZI7F 3HB0A 5BRNA 5SICE 2X7XA 2IU4A 4LF6B 5GVSA 4PAGA 3OFJA 4G0WA 4AROA 4XQCA 5JH7F 4W5TA 2NV6A 2XUDA 1N2XA 5A3VA 3OM0A 1PT8A 1QDLB 2GK6A 1E7YA 2OBYA 2YYZA 1ST2A 1AKQA 2Q4DA 4P22A 4C5AA 1W5AA 3TQFA 5KTMA 2VKTA 1A9XB 1PDWA 4R8VA 2QRPA 1HURA 3WL5A 4U9IS 5EJ6A 1RBMA 2K4MA 4MQUA 3MNFA 1I2CA 1PVOA 3PMNA 3WYNA 1JFSA 2PD6A 3A9VA 2DBZA 1M73E 1ZK4A 3O9ZA 4JEHA 1W6UA 3DPSA 3RO7A 3ITKA 2HMTA 1N0VC 3S29A 2VTKA 4UHJA 3SYNA 3REGA 4JV0A 3AL0C 3LDHA 4CDGA 1VP3A 3UW3A 1FVHA 3NIFB 1ABBA 5C52B 4RDIA 5TY0A 2GBLA 1M2JA 3OIYA 5J2UB 2PRYA 4ALKA 4GR4A 5LOVB 4O3OA 4A23A 2HCTA 1XB2A 1TVAA 3UWMA 1Z0SA 1M2FA 1V8BA 1OU4A 3MMNA 4F45A 3RARA 2LR0A 4EFMA 1A95A 4YUXA 2IT1A 3N53A 2VSQA 3QVGA 4OI4A 1XYGA 5IUJC 4NEGA 4XJTA 3G8DA 3UMRA 2Q46A 2FGJA 3MMPA 4D3ZA 1W46A 1GZ5A 2QTBA 2Z3WA 2MYTA 3H04A 4AF8A 1BMFA 1T15A 1RKBA 2A0WA 4US1R 4YMIA 3OP1A 2X14A 1KH1A 2LIPA 2G09A 3I1FA 5A4JA 1Y1SA 3SEZA 2R3SA 1F6BA 1KQFA 2JZBA 3N74A 1HYHA 1JMSA 1TYDE 5AXCA 1KI9A 3OZAA 1QC5B 3KYCA 4E2FA 4QBKA 1EJBA 4RZUA 4HUTA 3C43A 4YCSA 5DEOA 3K5PA 4JKOA 4UAGA 5FTJA 1TNDA 4RHXA 1Y5RA 1RZTA 1QHSA 3KVRA 3JQCA 2G28A 4QRHA 5EQFA 4RYDA 4K3VA 1OT5A 3KSDO 1XZNA 4EYIB 3BS4A 4RBNA 1SC9A 5HBRA 5DBGA 4UVEA 2HV8A 3NVKI 4UU8A 3U81A 2VCEA 3LRXA 4YMVA 1T4MA 3H83A 4U6NA 1MG0A 2ID7A 1Z4KA 2WAYA 4A5OA 1N5OX 4MAFA 4JJIA 2ALJA 1MUUA 4AWXA 2ADMA 1XNHA 2W7PA 4LDRA 1LNQA 4A0RA 2JGNA 2G1UA 2W4MA 3ITDA 1NKBA 1P6XA 4V24A 2AXNA 3GR6A 4UHHA 1N0HA 4Q24A 3AINA 4ND8B 4OEHA 1KMCA 4D41A 3BJEA 1I3OA 4TZKA 3GA5A 3GA0A 4DOBA 3VX4A 4BFYA 1XE3A 2O6LA 4XWTA 1UBMS 2NXJA 4I8DA 2LKDA 3EEBA 1EVLA 2EW2A 4LZAA 5TF4A 2MSNA 4TM8A 2JCBA 1PFQA 3CGGA 4K6KA 1ENYA 4HADA 1NV8A 2XKAA 4OOEA 4IRDA 8OHMA 3BIFA 1L3BA 3NLLA 2YJZA 1U63A 5G4LA 3FDZA 2ZOSA 1TTTA 3GFBA 2LGJA 2YOHA 2E4UA 2VT6A 2FMPA 1M1NB 2Y6UA 2DU8A 4KBGA 3P9ZA 3ZHZA 1P62B 4NCNA 1RHQA 1WXEA 3PGVA 4GGPA 4NNPA 2HCFA 4NZNA 2RAPA 1ZUNA 4Y0AA 3UAWA 2Q3FA 3H2GA 2C83A 1FMCA 3ESDA 4C87A 5CRXA 2Y68A 4ER3A 5IKXA 2Z3VA 3U4HA 3SZRA 3MLBA 4Y6LA 4QT0A 3RBZA 4BNTA 4LOKA 4KJZA 1QOZA 4NBTA 3WK7A 3CRW1 3ZTTA 1KKMA 2BZFA 1G41A 3KOZA 3C8MA 4QM6A 3L4EA 1PFYA 2V7WA 2ZPTX 3GFKB 1AH2A 3IA2A 2PT6A 3IHLA 3IT3A 2ZRNA 2PFSA 4G5HA 4FFSA 5KJCA 1AHPA 2Q6OA 2F3TA 1JLRA 5MHTA 4N7JA 6Q21A 2WG0A 4PFQA 5IVHA 1T34A 4MLCA 3CB4A 4MX8A 4DDMA 1XNJA 2VAVA 5ALRA 5KFSA 5FULA 2A0YA 4Q4JB 4DUPA 1GAJA 5BW5A 1HTTA 4B2LA 2QTWB 2VSNA 3FUWA 4TXJA 4R0VA 3OPXA 1DWQA 4B4UA 1GPNA 5F9HA 1IEVA 2GGSA 4QDKA 1KOFA 1E6WA 2NO0A 1Z9BA 3K4HA 1KPHA 4Y98A 3GIMA 3W5BA 2O14A 1EU1A 4ID9A 1QF6A 3G9TA 4YJFB 4DTIA 1B0PA 3LBNA 3IRUA 4EHLA 1D2GA 3INNA 2ZR7A 3L8YA 2I9KA 4IJKA 1R5BA 1LK0A 1ZGHA 1DS6A 5IBCA 2R8KA 2BPCA 1KYVA 5A4IS 2NXNA 3THXA 3RVQA 3SQOA 4V0OA 2I7VA 2HPVA 4KPYA 2FPPA 4KXFB 4AJPA 1X7HA 3R3UA 1BQ4A 4X3OA 3QKTA 5KNCH 2GM9A 4TWIA 3OCWA 1P7DA 3ORYA 3IV9A 5LMCA 3K94A 3AO0B 2H1CA 4MWOA 3F97A 3ZDEA 1G16A 3JZDA 2FWAA 5JAHA 3DFUA 2WJIA 3TGPA 2X77A 3QGMA 5FI5A 3OMLA 2OV8A 3PRHA 5KT4A 4U6SA 5COAA 3RHFA 4UM9B 2QQ0A 2AC7A 2ORWA 1UXOA 3QKRB 3QXJA 4CUJA 2WKSA 4WNAB 2C7VA 1ZGJA 1MB2A 3EA0A 2X3YA 3WWCA 1K4YA 3B82A 1T3ZA 4Z0NA 4FQ8A 4Z4IA 3TDKA 4PIMA 1IJFA 1VHLA 5IX8A 3K70C 2HLDD 5A02A 1NXQA 3GCWA 4I2EA 4ECVA 5I48A 2CJWA 4L8FA 2FWJA 3M9OB 4YPFA 2VH2A 4BNNA 4DILA 1WF6A 3AVXA 4DM4A 2XICA 3OKCA 2I3DA 5CU7A 4OD0A 1YIOA 4OGWA 1XA0A 1NUAA 4M9LA 2GNPA 3NTLA 1CJSA 1T2VA 1R0CA 1HL7A 1KN5A 4ZZ1A 1YBHA 1GDHA 4LMAA 1ATZA 5KFJA 5JBQA 2P9EA 2WWVD 2Q99A 3L6DA 3JPWA 3FOAA 4Q3NA 2PY6A 4IJMA 1PNRA 3I2GA 2HD4A 4M22A 5JSKA 4X91A 4AJLA 1Z82A 2FX5A 4YP9A 1Y8AA 3TVTA 3ZKWB 3H2IA 3DLHA 1WB9A 5JZOA 3UFXA 2A30A 1VQ1A 3MCAA 2PANA 5B2ZA 5HJEA 2A88A 1BCSB 4KKXB 1UK8A 1KFKB 5EXXA 1V5WA 3FBTA 3KHTA 4D45A 1J90A 4YVZA 1KS2A 2OB1A 3B3GA 3P2YA 1CUDA 3KELA 2WZCA 2H1HA 3ETEA 3ZK9A 3QBVA 4M1TA 3M6AA 5JNSA 1S2GA 3LP5A 1OVMA 2AHRA 5F98A 3P26A 2I9PA 4IO0A 4O4LB 1DV2A 2WSMA 2AEFA 3NR2A 1PLJA 4RJIA 2ZTSA 3ZXXA 2P9ZA 4EI8A 4M89A 2GFQA 2AUNA 3COPA 1PQYA 1DKQA 1U2QA 2P0YA 1H66A 5FR1A 3RYHB 4NOMA 2JR5A 3BH7A 3KOXA 3DEIA 1ZBQA 4R1OA 1KQ3A 4L6AA 1CE8B 1SU4A 1HOXA 4Z6FA 4KHPB 1X1DA 3BMCB 4MLDA 3ZHUA 2AOXA 3LECA 2WWGA 3W9YA 4H7IA 5SYNA 4OB7A 2BBSA 4LBVA 2OTCA 3IV6A 1ODIA 1G6KA 1N62A 4R2IA 5ESDA 2IX3A 2XODA 5KFRA 4DUGD 1RI5A 5AM1A 4E70A 4TQAA 2F2TA 4LZGA 1C9NA 4HDAA 4Q4HB 1EUYA 1X1AA 5JS7A 3ABRB 1USVA 4QTTB 2OWOA 1U5BA 5FPQA 5LP6B 4LHXA 7ICTA 3OMWA 3UZUA 4XVRA 3DZBA 2ZJ0A 2VDVE 3FSGD 4QUGA 4B47A 1FXUA 1R27A 1T3NA 1YI0A 4QIHA 2DERA 3CEJA 2HJGA 1Z35A 4GZ6A 4YWHA 1U0SY 2MU1A 1H42A 2V7UA 5HX7A 2ZCVA 3ZVLA 1ZMOA 2PX0A 2X1VA 4XIGS 1U98A 2J46A 3RUAA 2VHCA 2GPBA 5JS8A 2ZQZA 5KCMA 1X9GA 1PIWA 5KJ1A 2IUSA 2KZMA 5SY9A 1WZUA 3PI6A 4EHAA 2P9YA 3G0OA 3C4QA 2R4TA 3V7NA 2WMYA 4LSMA 1M34B 2HRCA 5DASA 2GYVA 3WHLA 2DQNB 4QDXA 1Q1AA 1VIDA 2A1JB 1JDUA 2XRMA 3F6CA 3PUYA 4YAJA 3T9FA 1J2NA 1IAVA 4YYEA 2JLWA 3PGJA 1E2MA 1XK6A 2XI4A 3TTSA 1OLUA 2HO5A 2JI9A 3MS2A 2QW8A 5EC8A 2QNIA 5FEMA 3VX3A 2LKCA 3PF9A 3ROQA 1FRZA 2HX1A 4UW9A 4C7BA 1R9MA 5J2UF 3JQEA 4HG2A 4KXYA 3KHRA 5KG4A 1C9JA 4U7HA 1OFVA 3PX6A 1CRQA 4B34A 4MS1A 4HQNA 4RANA 3NX4A 4BQEA 2PMCA 3HCWA 4J9VA 2HJSA 1VA4A 2OECA 1SCNE 2DTXA 4MXDA 3UMVA 1NBME 4D56A 3T3OA 3L5OA 4NCKA 3ETRA 1VDMA 4XE5A 1Z4NA 4F8JA 3PT5A 4MUAA 2FWMX 1Z5OA 1CLUA 1GPMA 2R68A 1F4LA 1LTKA 3UAXA 3WBFA 4O3MA 2DWOA 5JXHA 3N9IA 2QT9A 1WCLA 2PD3A 4KXVA 2K6GA 4BJ1A 3DNMA 3DD5A 3VAAA 4WNIA 2NV2B 3SJAA 2EWMA 3A11A 3FPCA 2C00A 4H31A 2ZVDA 4ZOHC 2VRCA 4X8OA 3ZWBA 3WO1A 3WHKA 1RPJA 4RVOA 5BQXA 3AU8A 4HUQA 5DLFA 2ZCJA 4QVIA 1WNFA 2CXTA 3CV3A 4R16A 4GP7A 3RWOA 3D2AA 4UAWA 4DL6A 1JT9A 3E5RA 2P66A 3RJ9A 5D6OA 2Q8QA 2H63A 3KT3A 4PSAA 4OHCA 1AGPA 4OI0A 1ZHFA 3GZFA 4H0FA 4EPWA 3P0EA 2J59A 2Y1EA 1UMCB 3QZUA 4AX8A 3G85A 4NNOA 5JD6A 2IDJA 5T67A 3I34X 4YMSA 2SKDA 4TXNA 4O4JA 4FZNA 3VPGA 4E51A 4QDTA 4LJ9A 1VHWA 4DIEA 2X15A 3WMFA 5JMPA 2JEIA 2FE1A 1C81A 1JU3A 4B3GA 1HUZA 4MP6A 5LIRA 3I8XA 4IIFA 5IKEA 4X44A 2KJQA 3NGLA 3TWOA 2C31A 5C0YA 2AXQA 1NNI1 5AW5A 2RD2A 4N0EA 4W1RA 3W5AA 2BD0A 3Q7RA 3VO1A 5TEWA 1DB3A 4ZYZA 5EI5A 2WMOB 5KNDA 1W48A 3QWBA 4PLZA 2VWQA 2D1RA 3U7EB 3U4QA 4JN6B 3LK7A 1V11A 5DYIA 5FYQA 5HR5A 2BI7A 3WWEA 1S89A 3GZNB 4D4IA 1JXEA 4PYKA 2D2EA 1ULTA 1VCIA 4TZ0A 4BFCA 2IYOA 2IEIA 1DAKA 3THSA 4QDJA 5K8UA 3IIMA 3ZS9A 4FFLA 4RQUA 3BHMA 3BM5A 5J0UA 3H7IA 2H4YA 2QZPA 5K6AA 4DKJA 2XCIA 1IIBA 4CT4B 2XQGA 5EIBC 4UQPA 3AG6A 2F1IA 2IQIA 5LUAA 4D3FA 8ICPA 3JPQA 2IOFK 3HBAA 4KR7A 2DCUA 3FMGA 3W8FA 1RM3A 1CY1A 1WUKS 4YTEA 3ETCA 1MA7A 4XX1A 3OICA 4DSFA 4J91A 4GICA 4AZ3B 2ZVQX 4ZKEA 3V6JA 3E7XA 5FHRA 2XZTA 1PQWA 2VPTA 1FBNA 2IEDA 4WKCA 4Y2YA 3MJHA 1UWLA 4ZK6A 4RX1A 1MT3A 3LPDA 4BTVA 3PHBE 4F4DA 3RS2A 4KK3A 2GXUA 5TVGA 2GMWA 4RQ7A 4ZRNA 2NRTA 2C5BA 2C9YA 5BMOA 4LNHA 1MRNA 4HGQA 1NKVA 4IWYA 3X3HA 2ZWOA 3UJCA 3F5AA 9ICWA 2D74A 4RT2A 3QLVC 5D6NA 5K4HA 5IH7A 1KPIA 3X2SA 5IIJA 5J1SB 5HF5A 2D6FA 1J07A 2Z6AA 1XR3A 2O8DA 1S96A 4FCWA 3OLQA 5SYAA 4RTRA 1A8UA 2PYIA 4K8RB 3UOAB 3BILA 2B9EA 3BK2A 5M5BA 1KS9A 3I9JA 3UJDA 3N6XA 5HE8A 5A6VA 3CUKA 3LK9A 4RF5A 5AP9A 3BMQA 4DCCA 3LA6A 2B0CA 4QZIA 4AZ0A