4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
b'FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
3U7EB 2IOFA 3ZU6A 5ALJA 2YJ5A 1RLMA 4YGYA 5ALQA 1RKUA 2FUCA 4QJBA 3AR2A 1RC8A 1J97A 2Q4TA 4NAVA 2YY6A 1L8LA 3QUBA 1Z5UA 1IWOA 2EAUA 5ALSA 3L0BA 1Z4QA 4CE6A 4JDPA 3RFUA 2W43A 2WF7A 4HAIA 3U26A 4QQFA 2BDUA 4I9GA 1YV9A 4BX3A 3AR6A 2HO4A 3WKCA 4Y2RA 3IB6A 4HGRA 4NV0A 4JB3A 5AW5A 3KZXA 4RETA 3WK4A 5AESA 2CFSA 3NANA 4H1WA 2O9JA 2R8EA 1NF2A 1FEZA 4XE5A 4B6JA 3DAOA 4OCZA 3W5CA 1RMYA 2NO4A 4NFLA 4Y2TA 4UU0A 3FM9A 2FDRA 5AW0A 3EPRA 2YN4A 3OPXA 5AKXA 2Q5EA 2FPSA 1WR8A 2D2VA 4ZEWA 2AMYA 2FPRA 3MN1A 1EK1A 3FVVA 3UMCA 1TJ5A 3B9BA 3PCTA 3DNPA 4UMVA 5AKGA 1RRCA 1Z4LA 4BKMA 1XP5A 2YFYA 1QH9A 3N8GA 5AM1A 3ZX4A 4CF4A 4DWOA 2YMPA 4NWIA 3KBBA 1WPGA 1L7OA 1Z4JA 3AR5A 1L7PA 2JAUA 3K1ZA 5FP0A 5E0OA 3SLRA 3ESRA 4EX7A 3AR9A 1LTQA 3ZTWA 3WKBA 5ALEA 3KDPA 2JGAA 4O8CA 5AKIA 5AW9A 1L7MA 3OCVA 1EK2A 4EENA 3OTQA 2EARA 2G08A 2G09A 2ZBDA 1CR6A 1MH9A 3IRUA 3EF0A 3CZ4A 5AVYA 4C4TA 5ALTA 5AVTA 2MU2A 5AIAA 3A1DA 4MWOA 4FYPA 4UARA 3EF1A 1ZOLA 1O03A 3D6JA 2ZG6A 3FGOA 3NUQA 4KYTA 3QX7A 3BWVA 1YNSA 4UASA 5A3QA 2WFAA 5ALIA 4L6AA 3PGVA 4F72A 2C8KA 2RAVA 2YMMA 4CF3A 1YDFA 2JAWA 4BNDB 5AI4A 2ODAA 4ZEVA 2HSZA 2GHQA 2RBKA 3SMVA 2ZBGA 3ZVNA 5AKJA 4IG4A 2P27A 3I6BA 5AHXA 5AVUA 3PDWA 1Y8AA 3P96A 3BA6A 4UMFA 5AW2A 1SWVA 5AM2A 3WKDA 3AR4A 3ESQA 5AVWA 2OYCA 1NNLA 2GMWA 1RLTA 2MSNA 3FPBA 4YCMA 4C4SA 3L8EA 4L57A 4AP9A 4RESA 3WK7A 4KX3A 3U7GA 5AK6A 2PQ0A 2G06A 2OBBA 4UAVA 2R8XA 3AR8A 4BEWA 4HGQA 1O08A 1Z4IA 2HCFA 3S6JA 2ZBFA 5AK3A 5IT0A 3MPOA 3NALA 5AK5A 5AM3A 2B8EA 2PR7A 3J7TA 3L5KA 5AVXA 5ALKA 3MMZA 4PNHA 4FE3A 5ALGA 3ZTYA 2ZBEA 2C4NA 3IJ5A 3WK6A 1L8OA 2YJ3A 3OCZA 3SD7A 5AI9A 2X4DA 3AR7A 2WF8A 1Z4OA 1WVIA 1XPJA 5AM5A 5ALVA 2G80A 2HF7A 3HYCA 3OCUA 1RDFA 2C8LA 1YS9A 3W5BA 1J8DA 4Y3UA 1T9ZA 1Z4KA 4L6CA 1Z88A 3E84A 4EZEA 4Y2SA 2PKEA 4ZEXA 4UMDA 5IT4A 3ET4A 3F9RA 4NABA 2WF5A 2BDEA 1ZD4A 2HDOA 1VFPA 1RKQA 1ZJJA 1QQ7A 2GO7A 3L1UA 1L7NA 4AS2A 2HOQA 4UMEA 4G63A 3CNHA 2I7DA 5AVRA 3W5DA 2W4MA 5AKLA 2YJ6A 2RARA 3SKYA 3L8HA 3ZWDA 5AW1A 5AW6A 1RQNA 2IOFK 3ET5A 4BYGA 3W5AA 2B30A 5AVQA 2B1QA 1YJ5A 2FEAA 3L0CA 3GYGA 3B8EA 5AW8A 5ALDA 3N1UA 3KOOA 4C4RA 3L8FA 3NIWA 2CFTA 2GHTA 2AGVA 3U7FB 4BNDA 1L6RA 2P9JA 2WF9A 2B82A 1Q91A 3DV9A 5AICA 5AVSA 1VJ5A 3WK9A 3WGVA 1U2SA 4OHFA 5ALXA 2G1AA 1TJ4A 4Y2JA 4G9BA 4GIBA 2BY4A 5ALWA 3N5KA 4I9FA 3QU5A 5JJBA 5AI6A 1TJ3A 2ZOSA 2WHEA 1YMQA 2IOHA 3FZQA 2IYEA 3ZI4A 2O2XA 1RMQA 3FPSA 3QYPA 3NASA 2OA0A 4AS3A 3SHQA 3L0YA 4UATA 2YJ4A 5ALOA 1X42A 4YIHA 4HYTA 5AI5A 4YCNA 3N07A 2C88A 1RKVA 1ZD5A 4BX2A 1ZD2P 2I33A 4YIKA 2YMLA 4F71A 1RPZA 1ZD3A 2DQSA 2JARA 4IFTA 4CNQA 1Z4NA 2W11A 1XVIA 2CFRA 5AM4A 1SU4A 4UM7A 1U7PA 3A1CA 3E81A 3WKAA 3ZX5A 4OFZA 3SF0A 1T5TA 1Z5GA 2VKQA 1RQLA 5AKHA 2HHLA 2C9MA 2NYVA 4KX5A 4KNVA 2QYHA 3HLTA 2G0AA 5ALZA 3R4CA 1Q92A 5AKEA 3EWIA 4GXTA 3AR3A 5A3RA 3PGLA 4XPZA 1QYIA 5AK4A 5AIBA 1N9KA 3QLEA 5AW7A 2WF6A 3ZVMA 4UW9A 1F5SA 3UM9A 5AI0A 2R8YA 5ALHA 1WZCA 1CQZA 4BEVA 3U19A 2P11A 5AM0A 3KC2A 1VJRA 3QUCA 2Q4RA 3TLMA 2IA5A 4J03A 4Y2QA 4J2TA 3U13A 2FPUA 1KYTA 3NRJA 3I28A 4DFDA 1U7OA 1U2TA 1K1EA 4BX0A 5ALMA 2EATA 3OCXA 1ZRNA 3I76A 2I55A 3I1YA 4Y2VA 3VAYA 2GFHA 4OD0A 3DDHA 2HF2A 2HEGA 3WK5A 3R09A 3L7YA 2JAOA 2HX1A 5A3SA 1T5SA 3E8MA 2R8ZA 5AKZA 2B1RA 2NO5A 3OCYA 1Z4MA 3QU2A 5ALYA 4XOUA 5ALUA 3QU4A 2RB5A 5AKKA 5ALLA 3N28A 2HI0A 3ZVLA 1JUDA 4EELA 3QGMA 4Y2XA 4UU1A 5T41A 3RF6A 3L8GA 2CN1A 2I54A 3M9LA 3U7HB 2I34A 1Z4PX 3WKEA 2B8JA 4YH1A 4KNWA 1QQ6A 5AVZA 4YCLA 3ONNA 2FI1A 5ALPA 1NRWA 2ZXEA 4XQ0A 2AH5A 3A3YA 3NAMA 2OM6A 5ALRA 2FUEA 3SKXA 4EEKA 4KN8A 4UM5A 3MC1A 2I6XA 3QXGA 1N8NA 3UMBA 3OCWA 4MUMA 2QLTA 2WM8A 5AW4A 1RMTA 4Y2YA 2AUTA 5AI8A 1PW5A 3E58A 1ZRMA 1U02A 3R9KA 3ZUPA 3QNMA 4HGOA 5AW3A 3ZW7A 4HGNA 3M1YA 2P69A 4HGPA 4DW8A 3KD3A 5ALFA 1TE2A 4UAUA 1TA0A 4CF5A 2MU1A 5IS2A 3ED5A 2B0CA 3ZWKA 1QQ5A 1LVHA 3QU9A 4Y2UA 3QUQA 2FPWA 4BBJA 3QU7A 1S8OA 2YMQA 1AQ6A 1RLOA 3WGUA 5AVVA 3UMGA 4DCCA 4E88A 1ZS9A 2YBDA 3B9RA 2G07A 4Y2PA 2FPXA 4EX6A 3A1EA 1SWWA 5AKYA 3WK8A 4FFDA 5ALNA 3L1VA 3QUTA 1S2OA
chains in the Genus database with same CATH superfamily
2YJ5A 2FA9A 3AR2A 2CLIB 3BRWA 2E9SA 1PR2A 3DUWA 5J8YA 3DHNA 4DCUA 2IJGX 1L5QA 5AH0A 5MN4A 5KJFA 4Z6EA 2BZGA 4A0GA 4NCAA 3IMEA 1E5DA 1LZKA 4WN3A 5GQSA 3CLHA 1XEXB 1K7SN 4LNHA 3F90A 1AQYA 4RXTA 1GTZA 1QGAA 4M83A 2BFBB 3N53A 3WHKA 2V8BA 3CNQS 1L3UA 2O05A 1SY7A 2ZYSA 1PI3A 1I36A 2IELA 2Q1WA 4GOKA 3H7AA 2FN7A 3PNMA 4FWTA 3ZJTA 4H16A 2D2IA 1E1NA 3HO6A 4IDGA 3VTZA 2ZVDA 3B5IA 1E77A 1X9WA 2AKYA 1DXQA 4NEHB 2V6MA 4LDZA 1Q15A 3GLTA 4I3HA 1INLA 4QVKA 2DLCX 5FPYA 2HU2A 4H7KA 4INJA 2XZLA 1ZQAA 2CDRA 3CFYA 3Q9LA 4BBZA 2P9EA 4IDNA 3SHWA 2XIDA 2DPIA 4EHHA 1KMNA 1NKVA 1V16B 2JCGA 1CB0A 4YYEA 1ODKA 2Q6VA 4KOEC 3PNQA 2M6RA 2HFKA 3L7MA 1FSZA 2DWPA 1G0OA 4QBTA 2Y68A 1N8SA 1VKOA 1MT3A 2NVBA 2XV1A 4TUYF 1O89A 2W2LD 2NO9A 4GC5A 1T35A 4KLZA 2QQFA 1ZA2A 3RGWS 3LVWA 4EG6A 3IXMA 1FMJA 3CZ9A 2FPPA 4RV4A 4KLCA 3LRXA 3AEKB 1CQPA 3AK4A 4R3WA 3L4KA 3LCRA 3RB8A 1ZIPA 2IC5A 2FDCA 2VF4X 1OXSC 2CHGA 1D6JA 3R9XB 2Z98A 4ND8B 4JQYA 1SEVA 5KUTA 3VHQA 3E2MA 4OXYA 1T4DA 3P2KA 4RUKA 1BC5A 4FM9A 3FWPA 2LI6A 3M9OB 3LA6A 3B8HA 3QWFA 3W2TA 5JRZA 1SO8A 2NXEA 1SBZA 4URFA 3D4NA 2WM3A 4JJ7A 3I9KA 2DPJA 2WPDD 2HHSA 4IKEA 1XWIA 3ESYA 2AZXA 3E3NA 4TV8B 1MV8A 3GNSA 2IV3A 1SKAA 4G1BA 1V9CA 2I33A 2Q2VA 3RT1A 3EIQA 4LF9B 2B37A 5HW0A 4ECUA 2AG1A 5AM4A 3D2LA 3PMNA 3ELUA 1SPBS 1NHGA 1OXXK 3G8AA 1YULA 2ZDQA 3GDWA 2YXBA 3PQ8A 1CUEA 1TTPB 1E0KA 3GGGA 4EW6A 4G0ZA 4QUBA 5AKEA 3EWIA 5LYJB 1D9DA 5ELMA 2QXUA 1H1DA 3ZZMA 1DWUA 4FIDA 3UNXA 2H4ZA 4NENB 3DSRA 4P4GA 1PWZA 1THZA 4NATA 1J42A 3HCEA 3AESA 3ZW9A 5DXAA 3O7MA 2W4IA 4GOXA 4FWBA 1B2RA 1EVJA 3BG5A 4HDMB 1U28A 3S29A 2B8WA 2PKXA 3ZDYB 5JZVA 3AV3A 2BPFA 4K9SA 4ZWNA 3HCCA 3EVBA 4IOJA 2H4YA 1T43A 1HEUA 1GO2A 4YR0A 4EAQA 2CLFB 4DRZA 1Y5IA 3G5AA 1ECBA 5LQDA 4EELA 4OQYA 1E1MA 3OOHA 2GYYA 1J9GA 2QN9A 4TMZA 4JC0A 3HJCA 4KN8A 5CG1A 2I6XA 1BDMA 3VZDA 4I2FA 4TMFA 2FG7C 1SOUA 2XMZA 4IQVA 3ND8A 2CMGA 3ICCA 1SCBA 5A4IS 2HLDD 4QPCA 5IMSA 4OA5A 3ZWPA 4RTRA 2MU1A 3ZDBA 2A9PA 1WKBA 1IPEA 2FW9A 1C0LA 4LJXA 5GJVC 1CT9A 3T52A 4R1MA 1TV9A 4IZ6A 2MAXA 4BIMA 1JQ5A 3GBVA 1MFPA 3OQBA 5JI2E 1BGXT 4IQFA 4KR7A 1RC8A 4FX5A 1OLSA 3GFVA 5DM70 1SIJA 1O96B 2I3GA 5IM5A 1C20A 1KU6A 4RWZA 1RZTA 4FYXA 4LUCA 2G5IB 2Q4BA 3VBEA 3WKCA 5BV8A 4JUZA 4QRIA 3VH4A 2CFSA 1TOAA 2P2SA 2QHXA 4NQRA 1X66A 5EEHA 3NEJA 4IQGA 2FDRA 3KTFA 2FZLA 1BVSA 5K0FA 2NP6A 3NHSA 1NJ8A 4MR9B 3LUHA 9LDTA 3S8MA 1XJ0A 2Y2UA 3A04A 3C3AA 5I4KA 3ZHTA 5A6SB 4TROA 1P62B 1IUOA 3LRTA 3BZBA 2O2EA 3AVVA 2GLUA 2VA9A 4XR4A 5EN4A 1T2DA 2AN1A 1VDZA 5L1MA 2NZYA 1I0ZA 3PNYA 1KZ9A 5K3FA 4XJTA 2H65A 3CZ4A 1P7DA 1XWWA 3AEQA 2BEVB 4NYMQ 1WLYA 4YRDA 3ROTA 2QDXA 3IPXA 1D0IA 2P75A 1I6KA 1T0PA 2YMMA 3VPSA 2I65A 3OKPA 3X3HA 2BR5A 1CVIA 1O9BA 1WYGA 3HLKA 5H0IA 3VZPA 3WNDA 2LPEA 3NHBA 4MK4A 2O20A 3PNCA 5HIAA 1WZ2A 3UWPA 2H3FA 1Z0UA 3EGDA 1TO2E 2RGGA 2VP2A 5D3QA 3TPZA 3FTFA 3VJKA 1HKUA 4G41A 1MABB 3NEAA 2H7YA 2NTEA 4O4HA 3GAMA 2B83A 3G13A 1NW8A 3LLVA 1BWPA 3V4OA 1NASA 3IEMA 3PLNA 2EHDA 2OV1A 4YAGA 2Q1SA 1VB5A 2XCAA 5LM3A 1AG9A 4FHEA 1LK0A 5KFIA 5HTOA 3HXPA 2R6DA 1QKKA 1UJBA 1YQ9A 1QGUA 3B85A 2JVJA 2RFLA 4UQOA 2PQ2A 4WCFC 1YTUA 5KG1A 3H5RA 2P8JA 4MMZB 5JS8A 5E8RA 3A26A 2B4RO 3B0XA 3GJ4A 1ODLA 3PW5A 2O8BB 4BWVA 3DFIA 5J2TF 4DBZA 3I6MA 2IYNA 5F5LA 3HVRA 3MWDA 3N4MB 4XPIB 5FA5A 1E7YA 4OI1A 4IOLA 3EOAI 2FZEA 3ASVA 2Z1NA 3TH5A 1BKYA 4RQ3A 3GARA 1LRJA 1LI4A 3SAGA 3AM4A 1L8XA 4YAUA 4B6GA 1MKYA 5LNK1 1G2QA 4MEYA 1SKMA 4PS1A 3FTPA 2JA2A 3IHTA 4AP6A 3QKWA 4TTIA 4JAVC 4DKJA 5ALZA 1DRGA 3P97A 3Q1LA 1FZTA 3DGEC 2N42A 1P77A 3LUPA 3M89A 4G9EA 2OFOA 4RMJA 3OWHA 2C99A 4L3VA 1QUEA 1HGXA 4RLQA 5DG8A 3T9CA 1G1MA 1TQHA 1GRVA 3LCJA 4PYRA 1ECCA 4XR9A 1W46A 4TMVA 4QBGB 2PUAA 1Y6FA 3WQBA 2JZBB 3C39A 3GIJA 2VJDA 1WXEA 2YH2A 4FDLA 1UDBA 1EFAA 2FF7A 1M1XB 4ABTA 3PW4A 3KZ1E 2R8BA 5JBQA 4IAOA 2WNSA 3ZGOA 4BFZA 4KL8S 3W4KA 3SSAA 4FIZA 3WP1B 5BNWA 2XB6A 2ZDGA 2I1VB 2AH5A 4S2UA 1Y6RA 1OILA 2QVGA 3ZI7A 2ID8A 2ZXHA 3OCWA 2FQXA 3DDNA 4CETA 3NHYA 5DTQA 2F3RA 2KN7A 3K9HA 3OZVA 4C4OA 1JKXA 5JCJD 2I3DA 4Y2UA 2IHVA 1U4SA 1PUXA 2VT2A 4N3CA 3BHNA 2F4VB 1PVRA 1YZKA 1I4TD 3A1EA 3WK8A 4C0SA 3PWKA 4YWHA 3ZQKA 3IE2A 2J1LA 2W70A 4CRWB 1N4AA 2JGRA 3SQNA 1J00A 3RWOA 2VHTA 1JLLA 1UPCA 4LYJA 2XRZA 5J0YA 3C3EA 2BRUC 4IMRA 5FWDA 1SPXA 5CB4A 3WFJA 1NPTO 1JNXX 1GR0A 2XJ9A 4MDYA 4O2AA 2HNBA 3KJHA 1QSYA 1DDIA 3NX4A 4URXR 1M2VA 3VKHA 3G85A 2GCGA 5CCBA 4WKCA 3QZUA 3EXAA 3K8YA 4AKIA 2OGWA 4Y67A 4JYAB 2BKXA 1R00A 2BMAA 3ICOA 1MQSA 3EGVA 3DPUA 2GLEA 4ALJA 2Q2QA 3DLAA 4IHQA 1R0YA 4AO6A 2ZYUX 3PUVA 2JHFA 3ZDCA 1OBHA 1XA0A 1EQ2A 3EZ5A 2X0JA 2G36A 4DQLA 3EGWA 4Y2GA 4HATA 4F2GA 2RGXA 3SYKA 2IUTA 4TQGA 1AMOA 4EUFA 2C84A 4XVCA 5C1PA 4BP1A 1Q16A 3V4SA 5HVNA 1TJYA 4UBBA 2MSNA 3VV2A 3B1FA 1PQYA 2WWWA 3BXGA 5IIMA 2X1MA 3AHDA 4K87A 2QD3A 1XDSA 1GIAA 5A4FS 1ONNA 2HMWA 2WUFA 1VBMA 2M1ZA 3V1TC 3QLJA 7ICKA 3Q9UA 4YMHA 3UV7A 1YZGA 5CEJA 2IYUA 4V0QA 2GM3A 3I30X 5FV7A 5B37A 3G8BA 1EM8B 3OZGA 1DCMA 2WTXA 1JWAB 2IK8A 3DT6A 1T34A 1U0BB 4II3A 4UB8U 4PRLA 1IM5A 3QMWA 1B0UA 4KVGA 2QR5A 3UK6A 4LJ4A 3WMFA 1Z06A 2ALZA 4RVOA 1O94C 1RI1A 4I50A 5DBFA 4DV6B 3D0OA 1G3RA 4DM4A 4FYIA 1K0UA 5KI6A 4BJ6A 4EF4A 4XIJA 1VQ1A 1ZKDA 2H0AA 2OO3A 3DZIA 2J46A 4ENTA 2XNDA 4FDAA 1BHQ1 1SCKA 3SXUA 5A2GA 3DEFA 3SMQA 3AKDA 4K9KA 3ZY3A 3SV3A 2G76A 1F2UB 3TQCA 5KJ1A 3IOMA 4XVHA 3QHPA 1R8XA 1LPOA 2NSJA 1OV6A 1SU4A 5BQOA 2QN7A 1A7AA 4JOSA 4NMXB 1NX6A 1MP0A 1MJ5A 2II6A 1CQIB 4AZ3B 4PHCA 1RW4A 3G5TA 4J9QA 3G1UA 1XV5A 1MQ8B 3WSTA 5EP2A 4MF2A 3EFOB 4BO0A 3TL2A 5KS2A 2ODPA 3HVUA 2LKCA 3Q3JB 4Z5XA 4NF2A 1DFGA 4YREA 1E6MA 2P4QA 3FNEA 5KEIA 4HN9A 4BVEA 2B4YA 3N0WA 3I1YA 1I4WA 1G19A 2YYAA 4N5IX 3L82B 3V6LA 3MT0A 1N1EA 1Y1SA 1HTWA 4BNJA 2G3YA 8ICLA 4F11A 3Q8LA 7ICQA 5EKUA 3BGIA 1X9XA 1NR7A 5BV7A 2Q7DA 1ABFA 1NMZA 3LX4A 2CN1A 3WKEA 4E5NA 4IIBA 5D46A 2XUFA 2CV0A 3J7AC 4GFJA 5ANRB 2PT9A 3Q3VA 4KQ2A 4L1KA 1AXGA 4CM8A 4Z4FA 2H92A 3RUEA 1L4GA 3BTVA 3NDIA 5HJ5A 4RKWA 5B3JA 3WMGA 4OK3A 4TKVB 1KJWA 4RCZA 4GLBA 5DULA 2A1AA 1ZQXA 4JLDA 4H1WA 4MYHA 4E4RA 4I2GA 1ODFA 4KQ1A 3V33A 4BVJA 2VF5X 4DLXA 4BNLA 4CZ2A 3DBVO 1JHUA 3IA7A 5KFEA 5K8VA 4O02B 1B8VA 2RK6A 4WBNF 5EE5B 3M0EA 4FZ5A 2CXYA 3T79A 1NZFA 4B3HA 2P9QA 3KUDA 1U8XX 3DJYA 2BBWA 3AKYA 1H0RA 5JRTA 1X7GA 4E46A 1V38A 3QVGA 1B8PA 2EZ4A 2C5EA 1AF4A 1WO8A 1H38A 3RWBA 3IEUA 4PYOA 3C2MA 1KVTA 4WOKA 5FUQA 1VM6A 2AJBA 3H6HA 7ICPA 2J6HA 2XMDA 3MT9A 2JASA 1UZMA 3BQNB 3CEMA 2GCOA 9GPBA 3AJAA 2GQ0A 3H16A 4RV5A 1FDOA 1G5HA 5FWYB 1USUA 3VR3A 4M7RA 3KKLA 3GVHA 4CQLB 2JGDB 3NHKA 4BRSA 1IONA 5ENDA 3DLBA 1ZSYA 2GWSA 1V35A 3DLCA 1K3TA 2R1VA 2OCAA 4F4UA 4PXAA 3O4IA 1YR3A 2PMWB 3RQIA 5IKXA 1M2OB 1LZLA 1X87A 3B1YA 4RDXA 5KQPA 2VZEA 2EZYA 1GKUB 9ICUA 2X7XA 1GHTA 2AOTB 4O2BA 3C3CA 3JPSA 1QYXA 1RYFA 3L0IB 2NV0A 3SBDA 2X8JA 1MA7A 1NTOA 3TJZA 4R66A 1XJCA 3ND5A 1EB9A 2NZWA 2F3QA 3GP5A 3R7LA 1N6NA 3GHHA 1SIWA 4AY2A 3MINA 3ILVA 4Z8XA 4RD2A 3KZOA 3RYHB 3KCQA 4ENWA 4TV9F 2IOFK 4CXMA 5L4NA 2VTDA 1EA7A 2CDBA 3CZMA 1NIJA 3ETGA 3OCCA 2H3IA 2J3QA 3ZWCA 4DS4A 3NIWA 3QLVA 4BNHA 4E14A 1XFAA 1D8LA 2BCUA 5FWXB 13PKA 5EHNA 1SXPA 1B93A 1QIHA 2PX6A 4D8WA 1BVHA 3C85A 3V34A 3X1MA 4LGVA 2BVNA 4MWCA 4YCNA 2F8SA 1FXWF 3NYQA 5EC8A 3GFRA 3CZRA 2J45A 4TWBA 2OV6A 1NP6A 2HUPA 4H0NA 4XEHA 2PMBA 3GCZA 2K8CB 4BGIA 3GEBA 3IUJA 3BCRA 1F0YA 4BMCA 1CULC 2XVYA 2D1SA 3SF8A 4A0SA 1QZZA 4II2A 1NXWA 1E7RA 2DHRA 3IYLW 1K06A 1L7EA 1WZCA 4CIVA 4GX2A 2JFFA 2ZUSA 4X6YA 1W36B 3LGXA 5KQSA 4DZRA 2JFPA 4QG3A 3LP8A 5EUMA 4LG1A 2FPLA 1H93A 4GZ3A 1US8A 2WU4A 1Y4DE 2COUA 4DVGA 1Q7CA 4W99A 5LQAA 4FR5A 2I71A 4DREA 3TVYA 5B2EA 3O4HA 3EXG2 1Y3FE 3PL1A 4ECYA 1Q17A 2X4IA 4R71A 4JOQA 3CNEA 3TZBA 2ZIWB 3M34A 3SSNA 2R1TB 3SEIA 1C9KA 3G7NA 2ZJ7A 2WY2D 1J1UA 3STYA 3DAYA 3IPLA 4ACOA 4V0LA 2PFKA 6ABPA 1G0NA 2GARA 4ZZ3A 5DT2A 2WA1A 3IQZA 3VX4A 3DCYA 2FEOA 1HTTA 4KRFA 1DL5A 3KTQA 3PHJA 3QLUC 3VPDA 1OB2A 2L19A 1KKXA 3ED5A 4V0SA 1DWPA 2AZTA 2B6GA 3EYZA 1GAWA 3L6BA 3KZIU 2C57A 4HXEB 1ORHA 5K3AA 3DZKA 5AQEA 1E2BA 3CV3A 5DX0A 2P4HX 5IJ0A 4B6RA 2VOEA 2JHCA 4C0QC 3FZEA 3JASA 1P75A 3ZYCA 3RB3A 1FEZA 3M8KA 2NO4A 1P81A 2FRVA 3OO0A 2ZANA 2ZJ4A 2W83A 3O7WA 3V7UA 2ZTLA 2R1ZA 3P4XA 3H5WA 5IU6A 1W93A 2GTHA 4D3DA 2R84A 4X90A 3BQ2A 3PPXA 1S3GA 3RTEA 3BIFA 1JHVA 1M6EX 4KFTA 1VMKA 1QP0A 5K9ZA 4GUAA 5I51A 4LTMA 1SA0B 3UQ2A 4J43A 1QLWA 3JATA 3H0LB 3ENVA 1K4YA 4B2YA 3O73A 2YYYA 3ZVNA 3BYZA 1NOJA 1YASA 1SXJD 2A94A 3AFGA 3KQHA 2M32A 1UL1X 1ZQJA 1JVNA 2ZSDA 3HCPA 2NU6B 3OHBA 5KNBH 3I0ZA 4ZYUA 3DO5A 4F1JA 3HUFA 2YRXA 4INPA 3UB4A 4AWXA 3I4FA 2BI4A 5JVDF 3BULA 3IR7A 3QFHA 1DQPA 1L7BA 4JSYA 1G3UA 3AL3A 5KYWB 2IZ6A 4OYRA 4KKXB 4IQ0A 1NVWQ 4DMUB 3VNBA 4UB5A 5KTSA 4EZIA 2J3IA 2O8CA 3UAXA 5KYXB 1Q7EA 3A58B 1NVUQ 1JWLA 3DAFA 1G8MA 3K6SA 4YP3A 2F8KA 4ZTBA 3QK7A 1CTQA 3OAAD 4PLZA 1J49A 5L3SA 4IIHA 1NMYA 4TSRA 1NUTA 2IXEA 1NURA 1TTHA 3NDRA 4CTJA 3RW9A 4CUZA 1Z12A 2FEAA 3WBBA 2FQYA 1N75A 3DZFA 2M9NA 2WV9A 1QMPA 1N36B 3JZIA 4QPPA 3DDSA 1PTJA 1CDDA 4YP5A 4Y2JA 3AEVA 1REQA 1E3WA 2IUSA 1UBJS 1RXCA 2QE7D 1XZFA 4GBMA 2QUBA 2QP9X 3SOZA 1EDDA 2Q1TA 4DNXA 3M7DA 3O0DA 2C7RA 2BE9A 1Q11A 5G4KA 1JHRA 4QNNA 3C3KA 5D6OA 3W2EA 4KE8A 1K8QA 2B3DA 1XSLA 4DTCA 4P54A 2A1TS 3CPSA 2QZSA 3IMCA 3DHVA 2SCUB 3F67A 2C9MA 4Q15A 4QM6A 4RIFA 5ICCA 5FWAA 2KICA 1YE5A 2PUTA 4RD4A 3RS8A 2KD1A 3CUEF 5TJHA 2VDVE 3OVMA 3KOUA 4M9JA 3PQFA 2QL7A 3JYLA 1K9SA 1E7MA 3I6YA 2DBYA 4RPXA 1J8YF 3D8NA 3QUCA 1M67A 5ER9A 3RJMA 1EJ0A 3IH5A 4DLKA 3PG5A 3NTOA 1KYTA 5CJPA 2XZOA 1U3VA 3Q8SB 1H6AA 2GXAA 2ASVA 1PK1A 1QQTA 5HS6A 1GUBA 2I55A 4Y2VA 1ZMTA 2NXJA 4OFBA 4JUBA 1O95D 4X1IA 1L5NA 3MDAA 2H54A 4EMSA 1N3IA 2V7VA 4MPTA 1WSBA 1FDUA 2RHWA 2PZBA 3H86A 3V8QA 2FR1A 5JE8A 3FCXA 4WXHA 2ZKLA 3TQOA 3F6PA 4UBOA 4P0QA 4DC0A 1VJTA 2Q5QA 3D7KA 3QA9A 3QXXA 2ISCA 3FI0A 3QI2A 3UCXA 4PSAA 1HH4A 2B7BA 1BN7A 1D2MA 4KXNA 3AUJB 1W5FA 2Q4DA 4JLNA 4PS0A 2EZUA 1E32A 5FYQA 4F9FA 3DL7A 3KT6A 5IC4A 1YOVB 5E6RB 3NTUA 1S8AA 4I55B 2M9MA 5SYAA 2NXCA 5KG3A 1IXRC 4TTJA 4Y9TA 4CQJA 2JJYA 4BNZA 1RLJA 1YZTA 2PBZA 2X8AA 4OXRA 2FPWA 1UKYA 1G8HA 2QT0A 5LZ4A 3U5ZB 3E7PA 2IHZA 4AFNA 5D4BA 4OUDA 3W5UA 1R0WA 2J0UA 2DG2A 4KMOB 4BNIA 1YIDA 4LRTB 2CXQA 1W2WB 3K0BA 4ZYZA 3FMVA 2H1CA 4R9RA 2VPZA 3NKVA 4B7UA 3RJJA 3NONA 2VRCA 3NPAA 1YVDA 2ZULA 3F5DA 1W34A 4KGZA 1JFFA 4O2RA 2P6UA 3RFVA 1ZQTA 1E2DA 3T3NA 4WIAA 5K6AA 3G49A 4EG5A 4K86A 1CG6A 2IYWA 5EGSA 4MUNA 1D1QA 3MAAC 4FBGA 2H1VA 3BCSA 1CJKC 4CDNA 1LBHA 2NUAB 1JEQA 2V6IA 2JCYA 3R7SA 4EW1A 4FVTA 4HAYA 4DMFA 4QARA 4BASA 1RG6A 2Q46A 2ZJ3A 3N2LA 2PD6A 3HE3A 5KG0A 5ALIA 5JDCC 4N41A 2Q9BA 5LA6F 2QGNA 2ODAA 2AZDA 3G0GA 3PFCA 1BW9B 2GO1A 3SR0A 1IZYA 5KTQA 1LBEA 4L8WB 3L5OA 3I5YA 1UOOA 3K4QA 4X62B 2NSLA 1LC3A 4D41A 1Z5OA 4EPYA 2EG5A 3RAXA 3U4CA 5U1PA 4RZUA 4AJHA 3G8YA 4WGGA 3CONA 2H7CA 2C95A 1V9PA 1KFEB 3VAAA 1KY3A 4KFCA 2UVUA 1W76A 4MA4A 5FBZA 2G80A 4O3PA 3RT7A 3JAWB 3D3NA 3LHSA 4PQFA 4U7CA 2O57A 3P9RA 1KZYC 3RS0A 1JTFA 4J9RA 5EJMA 2RHHA 3COVA 3PX0A 4AY4A 2PMFA 2Z5GA 4OGFA 4RIGA 3R9IA 1MT0A 2GZDA 2VJ5A 4JJFA 3P2YA 4N0PA 2SICE 5JOQA 4EY7A 4WH0A 1RE0A 3R3WA 4PYMA 5KL8B 2RGUA 5DNAA 4TYNA 3EDRA 1UODA 5E2AA 3A1VA 3EXIB 4M6WB 3UQZA 5BV2P 3T5TA 5A4AA 3KALA 3U7FB 1ZGHA 3NT4A 1SHKA 3SYNA 2JCXA 3OGUA 3MYYA 4LNUA 5EWEA 2XZTA 2QORA 3OH8A 4A1FA 1FSGA 4BVFA 2CV2A 5GZ3A 2OG2A 4JVMA 5MF6A 4MQEA 4Q7QA 1HM5A 4FGZA 3COWA 2JFWA 3T7SA 3GJXC 3PX4A 2HDHA 3P9QA 5BVHA 2BW0A 4IPTA 1SHZA 3QBEA 1E6KA 1SNYA 2VK4A 3T5CA 4M7WA 1DQRA 1UMDB 3K16A 4RELA 4IF4A 2VCYA 5CB1A 3VSCA 1LC0A 4P4LA 3RPEA 3K1TA 3WFIA 4BIIA 5EG5A 3LO8A 4J3NA 5DN9A 1R27A 3ZVMA 1VFNA 3ZCUA 4MPDA 4B8ZA 7ICMA 3ZZTA 2WB1F 1DJMA 4QZVA 4BEVA 3IR5A 3GELA 1DUIA 5KPDA 1DXHA 2Z9CA 3KVOA 2IWRA 2QU8A 4IG9A 3EBLA 3GLIE 3QVVA 3IHLA 4LWPA 4C29A 3N2KA 3V8PA 3D7RA 4OJOA 1V5IA 4JQOA 4CBVA 3TAHA 1IEXA 2X5JO 3KFUF 3N7TA 4E1VA 2EQ5A 3TQIA 5LYJF 3HB1A 4UEJA 3ROKA 2J9FA 3E8MA 4O4IA 2QMQA 4UM9D 2KW5A 3AP3A 2HHJA 2V6JA 5BUZA 1JJ7A 1NWHA 1SVUA 3T61A 2K2WA 4ZT7A 4FGKA 4FHFA 3Q7SA 5P21A 2R18A 1X9MA 3MSXA 3RF9A 5GAJA 4DA0A 1FS6A 2E6UX 5J40A 4F5OA 4E5UA 2O1EA 4CCYB 5I9SA 5E1MA 4ZOBA 4M1SA 2ZSKA 4HPWA 2ERCA 4BECA 2UZ1A 3JWJA 4R40A 1FJ2A 4US1R 2G07A 2C5SA 1A9QA 3X2FA 1KBQA 2PCJA 1WQ3A 3I5AA 4XZ3A 4GKJB 4LVSA 3AL2A 3T38A 5E38A 3WRWA 4CIWA 4HAIA 3UPQA 3MGVA 3MBKA 4F4XA 3AR6A 3I8SA 4YX9A 2PLFA 2SNIE 2CF6A 2XTJA 1SIBE 1UBSB 1AV7A 3I32A 2ZSFA 5LP6B 4J0EA 4EMTA 3G59A 3C5VA 3VU1A 4H60A 1DT3A 4MVXA 1FFDA 5IILA 3P0FA 2PI4A 3LX5A 4ROTA 5AJZA 3MOGA 4BYMA 5KSWB 1YB1A 4JQZA 1FFXA 2E0IA 3PVCA 3CVUA 4RD6A 4JWKA 1L8QA 1OFUX 3GCWA 1CY6A 5DGIA 2G4CA 3HCNA 4LCBA 3K0HA 4KLEA 5FLKA 2EQYA 4BXOA 4KO3S 1SGWA 1VPEA 1K97A 5DTRA 4H7PA 1U5AA 2WYUA 3LJKA 1ZHHA 2FMIA 4FYPA 3F6SA 1TA9A 4QDJA 1TQ2A 2IUFA 4OMDA 4QOFA 1NW7A 3VVMA 3H2JA 3D81A 2XCPA 2RGEA 1PK3A 2L5YA 4IILA 3SR6A 1P1CA 3O82A 3NVDA 3KEMA 5EJFA 2IXTA 1LLDA 5CVUA 3S2GA 1A9RA 3G2QA 2WAQC 4DS3A 1ZH2A 2VHZA 2M6LA 2G6BA 2HCFA 4KWHA 3H1BA 2R1UA 2HQSA 4Q37A 2EP7A 3V8EA 2C04A 1ZQWA 4Z6CA 1F5NA 1RM5A 3JSXA 3KVNA 2FZWA 2V45A 1ZY2A 1LF0A 4M0MA 2JEIA 5JIBA 3RBXA 2XRFA 5A0TA 2J5RA 4AUMA 4QBIA 3RIXA 3AJRA 5FDFA 1C0IA 3DZGA 1LX7A 1ZMOA 4CV2A 5J0SA 4TYYA 1ZJJA 3B13B 3BB4A 2V9ZA 1JEOA 3M83A 2W8BB 3RS2A 4JP5A 1ULZA 6NULA 4HT3B 1DEXA 5D3MA 1P73A 1CDZA 2O3RA 4GAEA 2C5AA 1UBMS 4UU8A 3AIKA 2PH3A 4OKIA 4YUZA 4OHFA 1UC8A 4LGMA 1QHNA 3HWWA 3C1UA 1CYDA 1NK9A 2PO5A 3ZNNA 1PR0A 4F97A 3LTNC 5BNZA 3GLQA 2YUTA 1ZISA 5CITA 1GLGA 2DETA 1PGJA 3VC1A 1QTNA 2D5IA 4TWJA 1DQNA 3HNRA 1K4KA 1NX9A 4NV1A 2H4FA 1E94E 3VGPA 5CFZA 2VDRB 3Q9NA 4MSUA 4PZ0A 1Q1EA 4PLFA 3WZMA 5FUVA 3A1CA 5J2IA 1M6WA 4LCJA 3H87A 1O1YA 1GZHB 5G0VA 1EZZA 3LF1A 4BQNA 3ZWQA 2LBOA 3FUCA 1N60A 2I6GA 4WN9A 3SHOA 2QRUA 4DDVA 4D7AA 4A8JA 2XECA 4HQKA 3AUAA 3N05A 2HJVA 1EFPB 4DLNA 1ZZGA 3MS7A 3L4JA 1SXIA 3TZKA 1VLQA 1K1EA 5KQRA 3SCZA 4AP5A 3DUFA 4Z53A 2QG4A 2XYQA 3P9CA 4NRDA 2HXSA 5JNUA 1QC5B 4HBZA 2OB1A 2Y0CA 4QUKA 3CLKA 5LA6B 2BP7A 3GJRA 4MQUA 2YKGA 2YY5A 4F5DA 2FRDA 1VXRA 1R6DA 2HI0A 1UKEA 4RTQA 3CRXA 2VK8A 3SEFA 3D3WB 2JL1A 4AW9A 3MGBA 3I61A 1UMBB 5HKOA 4IHKA 4QYMA 2XXBA 3UWSA 4CW7A 2GJ9A 3VPAA 3QMVA 1E1LA 1NK0A 1YS4A 1MENA 2PMDA 4RZHA 5DP2A 3ZJVA 4ZO9A 2A5FA 3T12A 4JT8A 3WLSA 3QENA 2VC2B 3QA3E 5TJ9A 3K5PA 5KIAA 3CCBA 1YS1X 1JHDA 3HP4A 1Z5UA 5AJHA 1AB5A 2PWBA 5LN1A 3VUFA 3K9FC 4ZQEA 5KYUA 1T15A 4C08A 3OZIA 2R8GA 2R11A 1QQAA 1V97A 1HDCA 4J8PA 1QRTA 1CS0A 3ZJ5A 3EZ2A 3EPRA 9ICQA 4KFUA 4CV1A 5LZ7A 1I1QB 4B9VA 5LD2B 2FSFA 3AMZA 1K1SA 3G2LA 3FUXA 3W7AA 3LYHA 2HBLA 2VPXA 4C06A 2JCSA 2GVZC 2OLEA 4F92B 4DPLA 3QE9Y 3WGKA 2AZ4A 4Q39A 1KZ7B 4O8CA 2PUDA 5UKDA 3CW2A 1IVYA 5FI1B 1J8FA 1AQLA 4Q7KA 4R2JA 2ZTVA 4X8MA 3ZHXA 1NBOA 3RCBA 1IPHA 1H1LA 1F8GA 3ZBTA 5HKLA 4R6WA 4CMIB 3KXIA 3IX7A 3QQPA 3E9RA 4B9UA 2NV3A 3PZPA 4LZLA 4L02A 3B7WA 2YB4A 1LLFA 1I2DA 1N2HA 1E58A 1XMQB 4HDRB 2Z4TA 1NQTA 2YFQA 5I7WA 5ITVA 3TLCA 4ARVA 5ARBA 4XQ9A 1DIOB 4HLUC 4C80A 3QBJA 4NOKA 1WBBA 4LQLA 2P40A 3PKIA 3LC0A 2AD5A 3U4IA 4OU4A 4JS0A 3GBPA 4Z3KA 4XLTA 5DYTA 1W4RA 1HJPA 1U0SY 1MF7A 1KDVA 3QTTA 2GM5A 2ZJZA 4BMYA 4UMEA 3V4ZA 3DOOA 1WEKA 2LGJA 4DOCA 3D43A 1YQTA 3L0CA 1Y1QA 2CFTA 4RF4A 1FUYB 2XVXA 1T8WA 5G0TA 2B82A 3EMVA 3UB3A 5JMWA 3WIDA 3LL7A 4N0EA 2V1XA 1U80A 3B1WA 3Q7TA 2O59A 5LIPA 4V0OA 1ZIXA 1QO0A 4FFNA 4XIYA 3DXZA 3GY0A 3L0YA 1KP3A 2AG6A 3UHPA 5EZ6B 3RB6A 2WYVA 4M60A 1YAJA 1QONA 1ZQQA 4RIEA 4K1XA 5HFAA 1JSLA 1X80A 1IOZA 3WXMA 1FU4A 2NVUB 1USVA 2GRJA 3GGOA 4NE2A 1CZNA 1VL5A 1L6IA 3RIYA 2AYYA 2JLRA 4MEJA 2BKAA 2FPGA 1ZN9A 3NGDA 3AU6A 1VHQA 1FTGA 4D57A 5F77A 3IBYA 4RTSA 4EO7A 1QK5A 1HLDA 1XROA 4HNAA 1KC1A 4IS3A 4EHBA 3QY9A 4HUJA 5K8TA 1PR9A 1Z36A 1XQ1A 4YRKA 4X41A 2V7GA 4BZZA 5J2BA 4RNMA 3FOBA 3FCSB 2Y1IA 4U2KA 2QENA 1U8CB 1K5OA 2AI3A 4U8HA 4RVNA 3KLBA 5ADVA 3WOVA 4F21A 1COKA 1HE3A 1ECWA 3O1JC 1K0FA 1HFJA 2R8ZA 4PZUA 1FQWA 2W9BB 3M6AA 5TLSA 1OKKD 3PQ5A 1S1CA 4B3DA 4KW7A 5KJ6A 3EQ6A 2WJ6A 1SL0A 3JQCA 3N6RA 4ZCMA 1UPBA 4M1WA 1E7WA 3RBZA 4KR2A 1YZHA 3C4VA 4LBYA 1N0VC 1WCIA 1CQJA 1JHXA 1GWNA 3S8YA 5J2GA 2VJYA 5JU6A 4RA6A 4YRLA 1XMSA 2AWOA 2ANBA 2QTTA 4NCKA 4NMMA 4HYYA 1RD4A 2EWMA 3LC1O 4D6PA 2UDPA 2OHGA 1QGED 2F43A 3HVJA 4KFSA 4JEMA 2JLVA 4DIBA 3W05A 2I4IA 1ZRSA 5HR6A 1TM4E 3GFPA 2N47A 621PA 1EFVB 3L1VA 1E9FA 1KY4A 2DTDA 4B8WA 1V2GA 4EY6A 5E7JA 4TUSA 3RC8A 1UC9A 3UAWA 1G7TA 2CZGA 2D54A 4HX2A 5ILOA 4L08A 3HO1A 4MYDA 4V1CB 2PWYA 3LKDA 3D6AA 3SG0A 3P2JA 3HKDA 2RDIA 2YVKA 1OFUA 1OA1A 1UDWA 5JNSA 5AVJA 3SS7X 1B4FA 4WEQA 2H11A 1ZETA 1N5KA 2YVAA 4PZPA 3IQGX 2J0VA 3QITA 4HTFA 1K86A 2OFWA 1P8JA 5KTYA 4BGUA 2FFRA 3GMIA 2QRKA 4DA4A 2UYYA 2CNOA 4BX9C 1WDWB 5KFGA 4RVSA 2J3MA 3UIEA 3IILA 3ZIAA 2K4MA 5BWBA 1M6VB 3DF7A 3UGQA 4PE5B 4HUTA 2BCSA 1TZKA 4EEXA 5K4AA 1W30A 5T3YA 3INRA 2JBAB 5IKMA 3HWTA 3DE2X 1WP9A 2PL3A 5CA1B 4GI5A 3DZBA 1NMXA 2GPWA 3FYUC 4FI3F 2I1LA 3KQOA 4PBRA 1HDEA 1WVMA 1HMPA 3N8DA 3HRKA 2QTHA 3OJFA 3V00A 2MSWA 1HURA 3ZBPA 3TDKA 4ARAA 1PUIA 3ESBA 3QEMA 4ND2A 1L4BA 1Z33A 3FOAA 4FEYA 4RQ2A 3GILA 4QUIA 2DSTA 2AQ8A 4TYWA 4EB8A 5KVVA 2LR0A 3TAQA 1GTVA 1F2DA 3QV1A 5IK2A 2PLRA 1R66A 4I2HA 1SKYE 4BFUA 3U4AA 3PHBE 4K4GA 1OKKA 4LFAB 1C9NA 2EF0A 4QZDA 1L5SA 3ANXA 1TVKB 4FFMA 2KFZA 2YZNA 2FSUA 2YDYA 5FO0A 4L28A 3LE8A 3GIWA 4UXHA 3M4ZA 3A4TA 2QSUA 4GI1A 3WMXA 4O5OA 2ZREA 3TSAA 5JY1A 4QDTA 4DCSA 5EJ4A 3FRJA 1DUSA 2J48A 3PC8A 2BFOA 5J5CA 3LK7A 3NHUA 2LBPA 3WGOA 3HO8A 1E1CB 4BV8A 5BT9A 3F7TA 1SBIA 3R0JA 3A9UA 2C9BA 5U4QA 1KMHA 4N49A 2ZI6A 1YVUA 5K99A 3L8ZA 3UGKA 5FUMA 4V0MA 4EFMA 4US0R 4Q7EA 2XNDD 4DCNA 3MB5A 1G3IA 1KI7A 4B44A 1WSDA 3VC2A 2A1TR 2Y67A 4E7PA 2VLBA 2MOKA 1XTKA 2QTVA 1HY3A 2B7LA 1U3GA 2XWPA 4ESHA 3GLFE 1S5LU 1M9NA 3UT5A 2HWXA 3ASZA 3JZAA 4A7PA 4H7FA 1J09A 4MYCA 5DLQC 4UQGA 2JEFA 1JKIA 2LCQA 3SR3A 2QMOA 3DQPA 3GGCA 4YMMA 4ECTA 1VA4A 1Y1PA 2Z30A 5K8CA 2AXQA 4CEHB 1ISHA 4FLMA 3K70D 4TWAA 3MSCA 4CLXA 2YCLA 4DOAA 1RJDA 5G53C 3DBOB 4B1FA 1TA4A 5HX7A 4HWGA 4KRGA 1ZUD1 1T9HA 1KWGA 1VP3A 3FCAA 2XITA 3JPWA 3L2OB 1JAIA 5DSZA 4IV5A 3DMTA 1RPAA 5KYYA 4C3OB 2H1WA 2TS1A 4KLAA 4I3GA 4G09A 1E7SA 4MO9A 3OJLA 3WLFA 1WCLA 4BFVA 1W59A 3G5MA 5TQ0A 4MUFA 4JC8A 2VTEA 4Y2YA 4ILEA 3KHKA 4FYHA 4CMEC 4RLSA 3TW0A 4UAUA 2R6FA 4EPTA 2Y1KA 3IG8A 1QHYA 5BSFA 4EJSA 4TLCA 5I4IA 5CPFA 3H8JA 3OI7A 3KJGA 4FYJA 2A0KA 2CK3A 5CB6A 4EVSA 4INOA 4ECVA 3AB3A 4JYPA 1YKFA 5IRCD 3MZ0A 3QUSA 4Q05A 2HBJA 2FKNA 2A84A 4UFNA 3GLGB 2BISA 2VHWA 4IMJB 2YWRA 3G3EA 2QTCA 4A6EA 1XC9A 3WK4A 1UOPA 1OLXA 2CXSA 2I2CA 3QVOA 4WCDA 2HWUA 4AF8A 1SKSA 3LI2A 4PZEA 1JDVA 1Q1BA 2HMAA 1I2CA 4O5EA 3OA0A 3TXAA 1RRCA 3IBSA 1W19A 5JH7B 2PMEA 1QH9A 1LBQA 5AM1A 1NK7A 4CU2A 3IQEA 1HUQA 1NOKA 2VXYA 4TM7A 3THXA 5EI5A 1KDYA 3KYDA 3B3GA 4E07A 3D2SA 4RHTA 1YR7A 2O8NA 3PGVA 4K9PA 2ODNA 5E6SB 5FUXA 4R63A 3T5MA 1Q22A 3NYRA 3BQ0A 4ACAA 4XI9A 4XCVA 3RYFB 3KEOA 4K6CA 3NBZC 3T1VA 2JFGA 5CLFA 2PBFA 3RS4A 2ZRGA 2L69A 2A9VA 2HM7A 1Z56C 2IE0A 1T4BA 2X2EA 1CUYA 1E2QA 4MRPA 3VR3D 4P3PA 3ZCRA 2ATCA 1KGSA 3HDHA 1Z26A 2PLAA 1CRLA 2YX1A 1AKQA 4C8MA 2OWDA 1P2VA 1PWXA 2LZ0A 5E4TA 2NP7A 1N48A 3GLRA 4MR8B 3WBFA 4XUDA 1GQQA 2P9BA 1QDUA 1WUIS 5JV5A 4WY5A 2V7XA 2YJ3A 2QQ5A 2NU9B 5AM5A 3CIOA 2YOHA 4C7KA 3TW6A 3E0FA 1BJTA 2O0HA 2AJTA 2NU7A 4RLFA 2P62A 3FJ1A 4I8IA 2JIOA 4KQ9A 4DSTA 1PVVA 4HUQB 2CSXA 2ZS8A 4X1KB 1ZH4A 4L15A 2QX9A 3AF0A 3T7KA 1L3BA 2BFEA 1T2EA 3S3TA 4C07A 3R74A 3JQGA 1UK9A 3ADBA 2BONA 3QFCA 4UPDA 5K4LA 2XX3A 4LDRA 3BS5B 2OESA 2VHCA 5CUQA 1OWNA 4YRNA 1OI2A 1WKCA 2RGWA 4OBEA 2F9LA 1L4YA 5C4MA 4YIKA 5KFSA 1EQUA 2Y1DA 3EGXA 4LMAA 3C6YA 4Z4IA 4MS3B 4CG1A 1ED1A 3D3QA 3MJEA 1OZHA 9ATCA 1NLYA 4KP7A 2WR8A 1MU0A 5IG2A 4HEJA 5PNTA 3HVIA 3PR5B 5EMKA 3D5QA 5C37A 1CR4A 2PKQO 5IWCA 3EPKA 1KXZA 1BOFA 1RZRA 3IOCA 2YV5A 1XR3A 2PXIA 3KB8A 5BMVA 4PSVA 5ECGC 4B6EA 1GXSA 4YRTA 3GGSA 1MIOB 3OIDA 3SJ7A 1R74A 2HA4A 4JD5A 5GM1A 1LVGA 9ICNA 3MHTA 3VKGA 2QGZA 4GM1A 1E5TA 1J22A 4OD0A 3GV5B 4X3PA 3A6KA 2Y8EA 2NU8B 2ZBPA 2YJZA 4RY2A 2WT9A 1LS6A 3EJ6A 3I53A 4H1UA 1PWHA 3K4HA 4ND3A 4GGPA 1JJBA 5CFMA 1UAAA 1KAEA 2J6TA 4ZN6A 4ZV7A 3MUOA 3R3SA 4MP3A 3IRVA 4YN4A 1NRIA 4B7XA 3IESA 4BP3A 4W9RA 1JGTA 1NXPA 3SEAA 1OX6A 1Z6XA 3C2LA 1A04A 3GLIA 5DB6A 4D26A 1YU6A 2I7VA 4CN9A 3G5LA 5TGZA 5KWEA 4OGWA 2XDQA 1CUUA 1ONSA 4DA7A 1W0KA 4YV1A 3TN7A 4WZAE 4JI5B 3LXMA 3NVZA 3I9FA 1L7RA 3Q4GA 3O2JA 1XELA 2W8LA 2OECA 3BE8A 4GX5A 1P4RA 2P9HA 4J0JA 1PNRA 1NSYA 4L85A 2RH4A 3FR8A 2WD9A 2OXIA 3INYA 3RRJA 3KLNA 1M6HA 5F1PA 4UFOA 4I55F 5JR3A 3F8TA 4X65B 1A2BA 4HEA6 1ZOIA 1IUNA 2E82A 1RQRA 4DUYB 5HIMA 4K2HA 4IYRA 3H9JA 1FW8A 1JDUA 3D1LA 1T8SA 3JY6A 1E9BA 1MXHA 1UBOS 1DJPA 3SAHA 4U9UA 3NCTA 5A9SB 2C7QA 2PS0A 1XF9A 4BTEA 2MSKA 4CT4B 4XDYA 5C35A 4MWEA 1SQ5A 2CXHA 1TFUA 3O74A 2Q9AA 2HNAA 1X7WA 1U7ZA 3THWB 2C4MA 1F9AA 4NJ8A 4RIIA 4D6YA 2C5BA 2JATA 2OCGA 4EYSA 3NIGB 5D3ZA 2ZIXB 5EIAA 3DM5A 5J59A 4C5CA 4EYKA 3I6BA 1QVVA 4PHFA 3ISJA 1N61A 2VJQA 5J0TA 3EZ6A 2WG0A 2C7VA 4GMGA 5HJEA 2OV3A 3C5HA 2VPTA 3K2BA 4XW2A 1PYDA 1CY7A 4ENQA 4N76A 4J9KA 3D7MA 2EDUA 4M8IA 1YCDA 5EWJA 1DKPA 3DTYA 3W6NA 4YRAA 4I29A 4TL9A 4KOAA 3SVZA 2PFPA 1T91A 3OECA 1JQEA 4O8ZA 2OY0A 1HE5A 3UGJA 1P0FA 4JUIA 4KVAA 4BQSA 4NDNE 1YFJA 1JEAA 4NLKA 3FMGA 2EFEB 3AM1A 2WD8A 1FMLA 4E5DA 2E49A 1WW2A 4F5YA 3G0OA 4U00A 5EMMA 3KOMA 3RVJA 5HTKA 1JDNA 4I1PA 7ICLA 3SKYA 2FXVA 2QARB 2ILTA 3B82A 2AQKA 1S1MA 3GDOA 3AUYA 4E2XA 3CCCA 2CNDA 3WWCA 4ENUA 4WV3A 4MFFA 3G7SA 2AIRA 4GMDA 4UBMA 3NBKA 4MB6A 3CLVA 3KUCA 1M7GA 1GYQA 2VDMB 5FNVA 4N4AA 3SV4A 4E3ZA 3W2GA 4MQFB 3GV8B 3FF1A 1JB9A 4J9OA 1IM8A 4DN6A 5JC1A 2CHFA 3H75A 3KPWA 1D2AA 2XQVA 1DX9A 3S7TA 3BS4A 3Q40A 4DCPA 2HRCA 1U7PA 3RUAA 1EDEA 1T4MA 2W00A 3VPXA 1MRSA 2JD1A 4HAZA 3DMPA 2DL0A 4FHZA 1NN5A 3A37A 1JJAA 3IP4B 2IHUA 5BRNA 2R5FA 2FF5A 2I6TA 1OASA 1AO3A 1FXUA 3P0RA 1MRNA 4A1OA 4DC1A 2HGZA 3P19A 4CMAA 2JG3A 3TTSA 2Q49A 2QRNA 4ZO6A 5FKJA 5HJ2A 4R69A 2G7MC 2VJBA 1OE0A 2GFHA 1PJ3A 1SVKA 3M70A 5KFYA 1F0NA 4KLQA 1FTNA 3L7YA 3PQ4A 3AETB 3QYAA 1Y9DA 3RK0A 3IEVA 3UJPA 7AT1A 4BWYA 2EYUA 2HCJB 3CPJB 5FA6A 4OO3A 2ZE8A 5G02A 2GEDA 2A5JA 4YBZA 3EBPA 2LYBA 1G59A 3D2CA 4D74A 4MHTA 2H57A 5A0FA 2OVFA 1KDTA 3B12A 3H2IA 2D74A 3DFZA 1A7JA 3S27A 1UMCA 2H52A 5LQUA 5KWVA 3VU0A 3HJTA 5JHGB 1U02A 3I37X 4LYYA 2PNJA 2J9YB 3VNSA 4AO8A 2QVBA 3EZ9A 4KDFA 3FG9A 4RGYA 3ORQA 2DT8A 1CBUA 4KQXA 3M6MD 3N97B 3J81j 4AO7A 1VDVA 4R8RA 2B78A 2CVHA 3L7NA 1WQ1R 2YS7A 5C0YA 4BDPA 4CE6A 2P9TA 4ZHQB 1C9JA 4YRFA 4CEJB 2BDUA 1AKRA 1JIKA 1FFCA 1VC2A 1NF9A 1YMUA 1EXWA 1G38A 4TQUS 2PXXA 2PVSA 2KBFA 1U2PA 4W5TA 1A9SA 2KEYA 2KLHA 4GVXA 5IF9A 2OD2A 2Y71A 3KQQA 2BOVA 3MQ4A 3OPXA 2PT6A 1P0PA 1J2EA 1EX6A 1LRLA 5THKA 3Q3GE 3S2YA 1JDBB 3NWPA 3R6LA 4ZKDA 1OYWA 4DLWA 5EAIA 2VRCD 3KHTA 3MFYA 4A8EA 2GD2A 4GR5A 3RYTC 1NE2A 1UJ5A 2F67A 4DLSA 1PLLA 2WKPA 2GHRA 4PO3X 2EYQA 3PXAA 3W9BA 5LP6F 4LQDA 5CDYA 4E5MA 3PC2A 4OM8A 3ZE1B 4QBHA 3S2SA 1ZGZA 2HPAA 1VP9A 3OPQA 3JPTA 1ZQNA 4ALMA 5FBRB 1JLMA 5DCUA 5KL1B 1E89A 3O3NB 2P30A 2ZK7A 3C1YA 2AKAB 3LDFA 4US9A 5LCXA 5EXDA 4I9NA 2ZR8A 4MV4A 3HHEA 2A3NA 9ICAA 1ORDA 3RC1A 2G0NA 3E53A 4Q8EA 5EINA 5A2QA 1B73A 5FUBA 5AVXA 1H23A 3OCZA 5DZSA 5C7YA 2FX2A 4AMVA 1EXVA 4Q3EA 3ANSA 1HYEA 1MHPA 4S0XA 3HDGA 2OGUA 3RU2A 1OZGA 2HT6A 1L5HB 3AF3A 1WZIA 4TXHA 1F8UA 1MN8A 5AMXA 1Z62A 5KAFU 3Q8QB 4FOSA 5TXGA 3QEKA 5AVRA 3G9TA 3TL6A 3O8OB 5NULA 3L7JA 5L6LB 2AGQA 1AM4D 3FMIA 1Y89A 1G9XA 3W77A 3R5SA 4KUHA 1TIBA 3ZXXA 5CEHA 1P9OA 2P90A 3QJYA 4WI1A 5T6MA 3A14A 4JASB 5I9MA 3H05A 3EPIA 4DWIA 1V8BA 1KI3A 1LUAA 5AHOA 3WB2A 1YMQA 1G5TA 3A6HA 3OA2A 4IIYA 3V1YA 5J63A 2AR0A 2R7KA 1ZONA 3ED1A 2OAQ1 1P5HA 1R6XA 7REQA 4TS1A 1P74A 1ESEA 4L3OA 3ZV3A 3OX4A 1FE8A 3R3VA 4Y98A 4G5XA 4MQ6A 3X0DA 3PBKA 4BLPA 3LUAA 1Z5GA 5EUBA 1WW8A 3N8HA 1WB9A 3ZD6A 1R4NB 4YDQA 1ZM2A 2OAEA 3IUEA 3VO9A 9ICGA 2A7XA 1C9DB 1PFQA 2DEUA 1XCBA 1E1DA 3UOGA 4RZRA 4UTPA 1KY5A 2NZXA 5KT6A 2OBFA 4AX4A 1PFUA 1KPIA 2FLWA 3FCYA 4GXJA 2A19A 1AX9A 2VUUA 2QEQA 3KLPX 2PBLA 3OP4A 2ZE7A 3PSFA 4IF6A 1NJYA 4EEZA 4DYVA 1ZEJA 1CZRA 4FEEA 2EC5A 3MWJA 5C32A 1NG9A 1XDZA 3PNOA 4U7GA 1FMCA 3DEJA 3E9CA 3MDCA 5DP1A 4D42A 2KOBA 2ZI9A 2CY0A 3FYDA 2LYHA 3A70A 2VLIA 4H1TA 4CN8A 1QPZA 5H9VA 4L9SA 1XVAA 4UBJA 4WACA 5BYJA 4B3SB 2WU1A 2Y0SC 2XLBA 3T7EA 3DOCA 2FOXA 1PR5A 1XRNA 1M2HA 1C4XA 2P68A 4HNSA 5IZCC 2A3RA 4H6XA 1RMTA 1ZRMA 5CP2A 4FB5A 1ATZA 1D2RA 4KHZA 4M21A 3OQIB 3RJTA 1ZGAA 4IHJA 2R7AA 3GF4A 1TYZA 3BCUA 3HCDA 3T7TA 1T94A 3TSCA 3SBXA 1SV0A 2G17A 4TTPA 1G4AE 2X8BA 1S97A 1SCUB 1FJGB 2VATA 2X86A 4JDPA 1CY0A 1F38A 2G1JA 2PYDA 2X9QA 2JPDA 4A4DA 4LC0A 1U0OC 5EUQB 3U80A 3GXOA 1FL9A 2PZAA 4BUGA 3RSHA 1JBQA 1PUJA 4OI4A 1BNCA 3P5SA 1G8FA 2EX0A 3ZLUA 3U0BA 3PCTA 1TT5B 2Y93A 6ADHA 1SG6A 1J7KA 3Q3CA 3ORHA 4QWAA 3AGPA 1XCLA 5CCDA 1KQFA 3SGLA 1C7FA 5BNIA 5A3VA 1GQ2A 2QM7A 3KHLA 4NX2A 1FY2A 4UAWA 2WAYA 3LY7A 1EK2A 5AJYA 3NXKA 4N7BA 1XTIA 3F46A 4RPGA 2FZVA 1N9ZA 1WD5A 2ESRA 1TKBA 3W06A 3PX2A 4F2DA 4ED9A 1H5NA 2PUGA 1FXSA 1J2JA 3WIOA 2D1YA 3CLRD 2Q6OA 4U5QA 3V5NA 5JXGA 5C80A 4K8OA 4HNQA 2YV3A 3DFKA 4XD2A 2HHUA 2OCPA 1JROA 3GQCA 4ROSA 1T8YA 1A3CA 2FWPA 3WK7A 3BK7A 5I3ZA 2HMUA 3C3BA 4XWGA 1N5XA 1CFZA 2IT1A 3A11A 5J0RA 1S0OA 3IAM1 1O6GA 1KZ6A 2I99A 4G3IA 1TZCA 4WXYB 2V03A 4JODA 1MOPA 1WQ4A 5KNDH 4PZDA 3NLLA 1LQUA 3S55A 2YFKA 1N57A 5I7RA 4ND1A 3JVIA 5C5EA 5KMGB 3PVSA 4HEQA 2E3JA 4A0FA 1WSAA 3RS3A 2HOQA 1DIRA 3NM6B 4CKYA 3F9CA 1NQAO 1RQNA 1JZQA 3ZC3A 4B9SA 4Z4EA 3U7RA 3KUUA 4G1EB 3H3JA 5CP8A 4MCIA 2GF9A 4BMSA 1PZNA 4LY6A 5DSTA 3ELYA 2ZWAA 3ZD8A 4K9DA 1BDHA 2O2ZA 1M54A 2VHEA 4UAJA 4MW6A 1DQYA 4WJLA 2IYTA 1W581 1DG9A 4V2UA 2VKTA 3FNIA 1R0RE 1OR8A 1H0HA 1P60A 2YL2A 4TZ0A 4MROA 4ZQFA 2HJGA 2XNKA 3NC1C 3E7DA 4ETNA 2WZCA 2XI4A 2C88A 1ZD5A 1Q7TA 5FEUA 1UJ4A 5EERA 2ZYRA 3DULA 3M49A 3P9ZA 2BLNA 3SQMA 5IAKA 3CJTA 1E5LA 4YMTA 1OZFA 3FRIA 1QTIA 5LLDA 1E99A 3KAKA 1EX1A 3LAWA 5M5BA 4B83A 4YMUA 1ZI6A 1KJJA 1Z39A 1U4BA 2G25A 5KFRA 1GJRA 5IFLA 3V97A 4JKOA 2V9WA 4ZDIA 4PGAA 5L4SA 4MV0A 2HRRA 3T6KA 4OB7A 4I46A 1Y48E 3NJ8A 3JARB 1SVOA 2IMWP 1ML3A 3VDRA 3KYBA 1X1TA 4B3BA 2B25A 4WTOA 4MJ7A 4QATA 3WLLA 1T9BA 1PEDA 4XDZA 2OBLA 5DBBA 4UEKA 4H7HA 3O4VA 1GNRA 3TRJA 3GLFA 3BXEA 1POXA 2D3TA 2QX4A 4QO8A 1QFMA 3RARA 2RB5A 3RTAA 3VPHA 4R65A 4S1NA 2V98A 1ZQCA 2LWIA 4Y2XA 3L7DA 5JCXA 3ILHA 3L8GA 1NKCA 5A9TA 2ILVA 2JEGA 5ECWA 1NW4A 4U7WA 1YQXA 5A04A 2YHIA 3VYRB 2PXCA 2IX3A 3AW9A 4E2WA 2QLTA 1PN3A 2ZM5A 3LVQE 2ZZMA 1DXSA 3TIXB 1C7YA 2O1XA 4ZZ2A 1M5RA 4F2WA 2QK4A 1I32A 5LQKA 5IIIA 3EH2A 4LJSA 3KLOA 3R0IA 5LOVB 3BBPA 2CLLB 3NUGA 5ALJA 2H1LA 3VISA 5HILA 4HDKB 3B9QA 2JFVA 4Z9YA 4D4IA 1MQ9A 2NADA 1YONA 5F3RA 4KE6A 2BCQA 1WL8A 1IZZA 2IRWA 1N56A 1BCRB 1FLDA 3MM4A 2YWJA 3CKKA 3O8QA 1KRPA 2IPOA 2EX4A 1D8TA 3GMTA 2D62A 2OO5C 1A77A 3COSA 3V6MA 2FGKA 1ENYA 4EHNA 4YDHB 2C5FA 3CNLA 1L6NA 4XGIA 5A1JA 2P4EA 4YJ2B 1WM1A 1WCNA 3EBOA 4RABA 1RPJA 1UK6A 4ZQCB 1KYIA 1RZVA 1Q77A 3I3SR 2I5PO 2PKCA 3RT9A 3JRNA 5IJ9A 4P7JA 2DH5A 3MCTA 2KHQA 3QXSA 1NMEA 4PCLA 1G6OA 2BMDA 2P27A 4I9HA 2HPVA 1P1JA 9ICRA 3I58A 4DR5B 3S1AB 3PDIA 3CG4A 3S8EA 3L8EA 4EQZA 3TNJA 1I1OA 5I7HA 3JQEA 3KAJA 2NTNA 4J9PA 1YD7A 3RJKA 4X85A 3J81A 3I5UA 3IFSA 4ML3A 3I9V1 4AT1A 3W2FA 1E66A 2YWFA 4LZPA 4REQA 1XNGA 2V5AA 3IJ5A 1MX5A 3IEIA 2A92A 1N8TA 1VLVA 3T4XA 5CA1F 4LXQA 4QHTA 1GARA 3I6ZA 2QVXX 3MFIA 2HW8A 1I7PA 4LX0A 4ZEXA 5L7TA 3LK6A 2CW5A 1JF8A 4A36A 1UP6A 2O7QA 1T2AA 3SHVA 1Y42X 5EIBD 5M7EA 1BE6A 2NXNA 2IS2A 3ITKA 4GQAA 2XICA 4C5AA 3K75D 2YQ5A 2FVYA 3GYGA 3HXQA 2ZWIA 3GJTA 3VHLB 2ZZKA 4N8DA 3EXFB 3BILA 1C5KA 4BHTA 5DTEA 5AVSA 3WGVA 1PDVA 3WGYA 4KTTE 4I9FA 1B41A 1CF4A 2W2VA 5REQB 1PR4A 3GC6A 2KBEA 3G2KA 3ROPA 3FUUA 3LQ4A 1GU1A 3FSGA 4LF5B 4IGEA 5ELXA 3A3NA 4A15A 3SE7A 1L4LA 2QD1A 4YWJA 2V9CA 3QXHA 3DOFA 1JU3A 2BFWA 1OZ0A 3ZR4B 3REQA 5HK8A 2OQIA 4DFPA 3L8MA 2VNIA 4R84A 3RADC 1QO0D 4OX9Y 4PLTA 4RF5A 3QLTA 4IIEA 1W44A 2GEFA 1BEZA 1CUHA 3ESCA 2UVQA 1IBMB 5BR8B 1RI2A 3K1JA 4BMOB 4ZI5A 1V1RB 2J5BA 3O8DA 4LGYA 1RYMA 1S4QA 2NOAA 5CK5A 3IXQA 4RYDA 3NVMB 4JLPA 2Q7OE 4R2HA 5KG7A 2OV2A 3R09A 2IVZA 1NXVA 4G5GA 4R1LA 3ZCVA 1Y5NA 1RXWA 4MDFA 3K9LA 1A4XA 5HHHA 5K8LA 2F8TA 2WQZA 3PD1A 1Z6ZA 2GM9A 1ITZA 3MCUA 4RY8A 4P35A 1AHPA 1UOQA 1YXMA 1X92A 4UBLA 9ABPA 1KI2A 1TYCA 1YHNA 3QRWA 4YCLA 2BHSA 4CT5A 3GN2A 2GD0A 4EEKA 3WQHA 2DGZA 4WY2A 5FFMA 4KR9A 2LHTA 1AZTA 4PF1A 1BROA 2EKZA 3MJ4A 1JT9A 4DQDA 3WRYC 4UCXA 4I2EA 1DHTA 5EIEA 4F6RB 1WZEA 4YAIA 1PZXA 3B36A 2F48A 3C48A 2YS6A 4EX6A 4OQPA 5HR5A 1BMFA 4X8OA 4IDAA 5JW6A 3GEGA 1R5OA 4CMGA 1OD6A 4GHWA 3WG9A 3V8MA 2V65A 4GF5A 3MAJA 1P0MA 4MKZA 2QAGA 3WGTA 3VH3A 3HDTA 1Y8RA 1E60A 3NR2A 4MRAA 4JROA 4WZAA 1CNEA 4YRZA 3LX8A 4QTUB 4FS3A 2QUAA 1Y98A 5DI9A 5DGXA 2UUPA 3DHEA 4IH4A 3EOBI 4S1VA 5J2FA 3D6HA 3R3JA 4COOA 3L0OA 1FS5A 2IS4A 4DFJA 3T0GA 2DUMA 2HLNA 3HHPA 3TAXA 2ZWPA 2QVYX 2QIOA 1BAPA 1E5XA 2UYQA 5FP0A 2ZUDA 3JWIA 1X9SA 5C46F 2HO5A 2V3CC 1CRZA 3O8NA 4C4TA 3EDQA 3H8WA 2Z2KA 4FS2A 4R54A 4MRMB 4ZO7A 4US8A 3TFOA 4LHWA 1I14A 3F98A 2JAWA 1H66A 4PX5A 2AFIB 4MUBA 5JH7F 2B20A 3HCRA 1SH7A 5AVUA 4OXKA 2P8SA 1L3SA 1GYPA 1SWVA 1X1DA 2X22A 1E1KA 1EESA 1Y7TA 2IZ7A 3ZIAD 3DKKA 3PEWA 5JD3A 4IH1A 3RBVA 1A2OA 1EK5A 4ETMA 4G4SP 4DR7B 1B14A 3AHEA 1UXHA 2GWHA 4XSGA 1XZEA 2ZRJA 3MT7A 4B85A 4YCXA 3LHFA 3OE1A 3OX1A 5KNLA 4U7HA 5A5GA 4OL9A 4IL5A 4ZO4A 5ALVA 2B6NA 3L93A 2H1SA 5BSMA 3OCUA 1U9IA 3SQXA 1J90A 3M9NB 2DUWA 1T4CB 1C8BA 4P3KA 4UMDA 1E3LA 5IBPA 5C8ZA 2VJMA 3L1UA 3LLSA 4M9LA 4NU6A 3CLSC 2O48X 4G97A 1GPMA 4PG4A 4U9IS 1OX4B 4DA9A 4I28A 4Y9RA 3ZTTA 1X2IA 5A4JA 2ODGA 4Y9UA 1WETA 4KTVE 5IK2D 4JSRA 4AMUA 2AMVA 3W8NA 4GBGA 1IFXA 1THGA 4ND7A 2JKZA 3H3FA 4TLLB 5CFQA 5FHQA 1B0ZA 1K7XB 2ZYWX 3MT8A 3CNOA 5ALOA 4LQCA 3R5HA 3UCFA 2ZPUA 5KTTA 5KPJA 2JARA 1WLSA 3A06A 4F46A 3KOYA 4OQEA 1UP4A 2GX6A 1QF6A 3FDSA 5CDUA 3Q2OA 4WW0A 2V5UA 2XUGA 4KIUA 5P8WA 3IOBA 2J41A 3FWZA 3MLEA 3MD0A 4G1MB 4XASA 1B2LA 1SB3C 1QH1A 3W5HA 4TTVA 1KDPA 1W36C 2Z3ZA 4B5LA 4OHBA 3CF2A 1RBZA 1R88A 2EU8A 3V8BA 5EXXA 4N6NA 3ZY6A 2XTNA 1GN8A 2FU5C 4U5XA 2AOVA 4C0BA 4N1AA 4KPUA 4E2YA 3OETA 3PTZA 4DQ0A 4DLPA 2QMZA 4H1VA 4LDQA 3VAYA 1G3QA 1DZ3A 3FWKA 4GZLA 3KT8A 1AH2A 2GEJA 2PI5A 4GMKA 1N32B 2PTHA 1JAZA 2NQTA 1SC9A 2BMFA 3AXSA 1ZVVA 2IYZA 1HF3A 4EFNA 1FRZA 4NCIA 1G2OA 1RVV1 1AKMA 2AMFA 1OXVA 2FG5A 3R75A 2HREA 3JSAA 1QFXA 5IVKA 2YB1A 5CFPA 4GI2A 4A6DA 3TJMA 3MUEA 3BX1A 1HKHA 3JQDA 1J06A 1JG6A 4HG2A 5LMNB 2AUTA 1JIVA 1XAGA 1XPUA 1QFSA 4WXMA 1B4DA 2YW2A 1UMKA 4GZ5A 3GGJA 3HL0A 4QHSA 1QWSA 1SULA 2ZAYA 1SKBA 1FRVA 3G2JA 4RVGA 1A27A 4W1QA 2PSJA 1SD1A 2B92A 1RWBA 4BGDA 5BN3A 3VJRA 1SOAA 5FA8A 1PAUA 3RASA 1ZQIA 4WL0A 1VYUA 4NBTA 3RFUA 2WF7A 1PD0A 1BXRA 3CB2A 3RVBA 1X8LA 1WTCA 1FQOA 1I2BA 4OJ5A 1U81A 1O0CA 4KDRA 2R00C 3URMA 3WU2U 2NT4A 5H16A 2CK3D 5F23A 2XVAA 1KSFX 3LPMA 1IHPA 3MN1A 5KFWA 1V1MB 4DM3A 3IAHA 3DWFA 3HXMA 1U8UA 1IJEA 2E4XA 4UMVA 2X0FA 2ZCJA 3BPSA 2AG0A 2OR3A 3VNAA 1IJKA 2Z5VA 4KLFA 3NUZA 1ECLA 3WLPA 3BXXA 2RMKA 3A0BU 4L2IA 3JPRA 2VP6A 3UMSA 3G7UA 3P52A 2G08A 3COPA 4QECA 2XEXA 2NO7A 4JC5A 1X3LA 3WHIA 4JR2A 2MWMA 4A10A 4QOIA 5GGYA 1WBDA 4AF7A 3OWOA 4P4SA 2IZ1A 1N1MA 1AS2A 5JBIA 3AB8A 4MV9A 3A4VA 2P6OA 3RJFA 1BVYF 4G5YA 3HG7A 5GWXA 2P4SA 1QRAA 4EY8A 1W0CA 2CLKB 4IS2A 3OPVA 3GLHE 5FJIA 5HYVA 3RSCA 1E6UA 3UXMA 3V8VA 4LOIA 1KFKB 5BSKA 4NLNA 1T2FA 3UA4A 3R8XA 1HFEL 2GUGA 4UBIA 4KQEA 4ALNA 5KFZA 2W2KB 3AG6A 5GTHU 4K7JA 2AE2A 3RC9A 2QYTA 1Z6TA 3LWZA 1L8OA 1UKCA 4D0RA 4KLGA 2QN6A 1F2TA 1PWEA 4P2GA 1KJ9A 1T2CA 1MO3A 1SV4A 3TNLA 1BPZA 4FXPA 1I1HA 1APBA 4FFBB 1AKEA 4GUDA 3ZGZA 1FNCA 2FSVA 4C3ZA 4GOJA 4OXNA 3H0MB 2B5WA 4R05A 1TEHA 5KVQA 1JVSA 3VOTA 2DZDA 3SBEA 3G2HA 1WY5A 1X86B 3PC7A 3AONB 5AW8A 4F2HA 5ADHA 4X1YB 1HE8B 3JD3A 5AJUA 5CYPA 3OQVA 2UZ3A 5LXTA 3DXXA 1NUAA 4CM9A 1NSFA 1RXIA 2ZIVA 3S0JA 4QZAA 1P3DA 3AU8A 2DUNA 5HEKA 3PJFA 2NTJA 4KREA 1RBQA 4LCEA 5BW6B 3C1ZA 4ED3A 3QYPA 3OY2A 3OIYA 4AULA 1V71A 4NYJR 4BP8A 3BHMA 1VKHA 3VV3A 3TZEA 2P6RA 3BDVA 1Y1LA 1GGNA 2W2MA 4HDOB 3T7IA 3C70A 3FETA 1XXLA 1Z5WA 2PFGA 4EHDA 4MR7A 2RHBA 3OPYI 2SKCA 4LXYA 4NYJQ 2NUTA 3WQQA 2QLMA 2QWXA 2H5XA 1RXEA 2ZWOA 4ZT2A 1OVMA 5K0NA 3SU8A 3N76A 1YA8A 3A4NA 3SZMA 3QVWA 3U31A 5FOXA 4CM3A 2ZT8A 1KFTA 1G5PA 4AWBA 1VJRA 1DIGA 4WZBB 3TSZA 1JH8A 2NZJA 1N77A 4B31A 2ORIA 1NM5C 2DR3A 4W8OA 1OV4A 2I22A 4J9MA 4PLVA 3VKVA 3TFSA 4H7DA 1R1DA 3OCXA 4I8DA 2ZIZA 5EJ9A 1H9BA 3PDHA 2E4ZA 3RIMA 3BSSA 3WK5A 2FAXA 1RZRD 1YIAA 5EA2A 4P84A 3WGGA 3HSSA 2HPHA 1WY7A 4F06A 4ZYTA 1MGPA 1XTQA 5AKZA 3QU2A 5H70A 4ECXA 3PC6A 2NQ2C 3OC6A 1KC3A 2FCRA 4PFJA 4DV1B 3MR2A 2J9RA 8ICQA 4EDFA 3I72A 3M9LA 3R6TA 7ABPA 4AICA 3K09A 1NNUA 1GTSA 4FDUA 2X4LA 3M82A 2BM8A 1B15A 1FDWA 4IGAA 5BWLA 2G6TA 3R9KA 3ZUPA 4KPYA 4O5KA 5I7FA 2G5GX 4R81A 4LHXA 4AJ1A 3GH1A 1I4EB 3KS9A 4W8HA 3LZDA 1XCOA 2YOGA 5GJBA 4KI0A 3O47A 3FGZA 4HAOA 4F5ZA 2AOUB 3RS5A 3LQQA 1T0IA 3X44A 1W0KD 1MCZA 3VZCA 3H5IA 1RM0A 1EINA 1AROP 3IDZA 4LVNA 1II0A 5DBOA 3UMVA 2B2XA 2W5UA 4LIPD 1IPFA 5FAXA 4OH1A 2HA7A 3EPGA 4G4JA 5B1SA 4J0HA 2RHOA 5KX5B 5AW0A 1F9EA 1UBGA 4KXFB 1GP2A 4HSEA 4RQNA 4MGKR 2FY8A 1ORVA 1R64A 4EA6A 1ESZA 4ZHQF 1WJGA 4CF4A 2P0AA 4GR4A 4I9UA 3ILSA 4P2HA 2GXUA 5KG5A 8ICEA 2JI9A 2FCAA 5HWSA 1U9CA 4EHKA 4ED1A 4QEZA 5ALTA 5KFHA 1PX0A 2WFLA 2W71A 2XXJA 4YCJA 1K8RA 4M53A 1LQTA 3ITDA 4G01B 3FDXA 1I1NA 2D7DA 4AYBC 1BEEA 3VU9B 2JFQA 1MB9A 2IKQA 3UV6A 2GJ8A 3CUYA 1XWFA 4HLQB 2QR3A 1HZZA 3AQ4A 2VDKB 5A0LA 3PEUA 2D5AA 2C7PA 1NT2A 3GDHA 3K4GA 5AK6A 2ST1A 1BIFA 1ICEA 3MMXA 5E4FA 3EA0A 2O7SA 2WICA 2FWIA 5IJZA 1YMVA 4QYIB 2EKDA 1RI3A 1E6EA 1AA6A 2IVFA 4FT2A 5I48A 4KPEC 1HQKA 5TNXA 3AR7A 2UVPA 2C9DA 2PJRA 3THSA 2KTQA 2QAIA 1JHAA 4C1NA 2ZI5A 5C4GB 1T9ZA 4PGQA 4ED8A 1XCPA 4JI2B 3ZVRA 2C5LA 3VHXA 2F8MA 4DDKA 5DM0A 5JS1A 5J2UF 1T29A 5TB5A 3BCHA 4LF4B 1S9FA 3ND9A 2RD2A 5KT2A 5JRJA 3QHQA 2RHGB 1GU0A 5G40A 3WHPA 3MVEA 2Z56A 4OHPA 1B26A 3OQHA 3FIUA 5BWOA 5B1HA 1RYSA 1KDRA 5TE9A 3OOEA 4PM4A 1JEYB 4YRRA 3WGJA 5AFSA 1QP7A 1U49A 4B43A 3P9PA 1MHTA 1SVWA 1JW9B 1CUIA 3PPYA 3D0RA 4ZQBA 4J0GA 4FOTA 5BYBA 9MHTA 4AKHA 2GZ2A 3QKSB 4Q1CA 3D4PA 2HIGA 1WAMA 2RONA 4GT1A 2H3EA 3ELWA 4JL8A 4AJJA 1LX6A 2RK4A 1IZ8A 3CF4A 4R83A 4RKYA 4OAOA 2XD4A 2VKQA 2C3OA 1NQVA 4J2HA 1NOMA 2I2XB 2QUKA 4JITA 4KNVA 1CWUA 2JRZA 2FNAA 4CU5A 2QTNA 4UHEA 1AMUA 2NO1A 2BSAA 2Q5IA 3NDPA 4JK3A 1I8TA 1BEUB 4XQ8A 1YB7A 3HU3A 4B3RB 3OEWA 4KKVA 4DMMA 4CKWB 4JV1A 2GPSA 4I19A 3FGNA 3HI4A 2ZQYA 2R5WA 4JYZA 3Q10A 4WNCA 4E32A 2J9ZB 3NATA 4GVPA 5CH8A 1T5LA 1CUAA 1Q50A 4MDHA 2NPFA 1UK8A 3VZBA 2VF7A 4X20A 3H1GA 2D8MA 4QGGA 4CIDA 1IY1A 2H17A 3C3MA 3U62A 5TARA 3VQTA 4OATA 1SL2A 2ZB4A 4QUAA 1XYVA 4OXQA 2C8JA 3LUBA 5E9QA 4JI0B 5K8UA 1VECA 4YH1A 2JLSA 3AFHA 2RC5A 2CT8A 4PC2A 4CFYA 1UK7A 5DNWA 4QX6A 5BT8A 3K6KA 1NW3A 2V8OA 1MX1A 3PFIA 2D3DA 3WP0A 2DKXA 3QE0A 3ASUA 1ZI9A 5HQTA 3UICA 2WM9B 4ZXFA 1UPHA 2B3TA 4U2EA 4UTXA 2CHUA 4GSLA 4XWTA 4X97A 2D5CA 4E6EA 2Q5CA 1V5GA 4YRPA 2WIGA 3GU3A 1Q3KA 5J4HA 3PUXA 2EAMA 4PIPA 3I52A 1Z4QA 4R2IA 1XDDA 1RAGA 1H8EA 5GONF 4FMCB 2F8LA 3TKAA 5DHPA 3W9YA 3BD7A 4B81A 4DGSA 4BLQA 2GOLA 3PSIA 1A1VA 1Y1RA 4W1SA 1EK1A 3IV9A 3TR6A 2EDCA 4CM1A 3OIVA 1HG0A 1JA1A 1DAEA 2H07A 5DF1A 1JPVA 4G0NA 1XTRA 1OAOC 4DCGA 5JPDA 1RRGA 1J39A 1AUPA 4EHLA 3BMOB 4JV0A 4NLBA 1NC1A 1XLUA 3ISCA 2BGJA 3KO8A 3ZWVA 4F8EA 4RZQA 4Q8FA 4RL6A 1S2IA 4WFKA 4KAXA 5A5FA 1YVEI 1UBNA 4X71A 1GG8A 4AK9A 2P2YA 3AFIA 1DHRA 4PIMA 1NI4B 4DARA 1A88A 2KSOA 2HYDA 2D1RA 2WQ6A 2OXEA 2AB0A 1G8GA 4DQQA 1NYLA 5KOJA 5DXFA 3HCBA 1EWQA 4KLTA 1PW7A 3QX8A 5DHSA 1XQYA 4ZRMA 4OHOA 3BE4A 3LU1A 4QOGA 1MFZA 3B1KA 2EVWX 1PV4A 4EI2A 4KYIB 2XF8A 4Q7JB 3ZI0A 1U0HC 3ZDZB 2IUEA 5CEEA 1CE8A 4MEAA 4DMLA 4UDOA 3IQFA 4QXQA 4ESVA 1QG2A 2HZ7A 3M9MB 5FULA 2IHBA 5L1JA 3G8CA 5CM2Z 3PK0A 3QVMA 4BN0A 4FX2A 1CS4C 1U9ZA 3I42A 1II9A 3L1JA 1XKQA 4WVFA 5T8KC 3ZLBA 4EJFA 3GMDA 4G9BA 1H2ZA 2YHSA 3ZI4A 3O4RA 4BNFA 3BA1A 5HZMA 4JEHA 2QRLA 2VJCA 1CRQA 2F1RA 2FK8A 3WLOA 4XLLA 4BEJA 2O0KA 3CMCO 1HC7A 3EVNA 5IAAA 1G66A 2ORED 2C2GA 3OD1A 3WISA 4ZVTA 4Y1RB 5TEWA 4MRSA 1B6SA 4KIGA 4LZGA 1UZAA 1MZPA 3AQEA 2ZRLA 4ZOAA 1GVHA 3CUWA 3NC4A 1RBMA 1UFOA 2ZRIA 4AC9A 1HDRA 2MHCA 3UM9A 1VJDA 3BHIA 2OEHA 1GTJ1 4ENVA 4CMBA 5ES4B 2DWQA 2B1GA 4CIBA 5EXEA 4PHGA 1U1IA 2CWWA 5A4MS 3EYWA 3WGHA <