4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
1J8DA 3L8EA 5AM1A 4UMDA 3SKYA 2HF2A 3A1DA 3TLMA 2EATA 1YS9A 4B6JA 2JAUA 3WKAA 2MSNA 3W5BA 2B8EA 2HSZA 2B82A 5ALLA 4Y2VA 2YN4A 1K1EA 4AS2A 5AKGA 1Z4MA 1JUDA 1TE2A 1LTQA 2WF7A 5JJBA 1TJ5A 4HYTA 1RKVA 3L8FA 3ZW7A 4KN8A 3OCUA 2ZBFA 2W11A 2OYCA 3N5KA 3OTQA 1QQ5A 2G07A 3E58A 4OCZA 2FEAA 3R9KA 3HLTA 2NYVA 2W4MA 3DAOA 2CFSA 4UAUA 3NALA 5IT0A 4KX5A 4YH1A 4BYGA 4NAVA 4HGQA 2B0CA 3U7FB 2EARA 4CF3A 3QU9A 4FYPA 2NO5A 5AKZA 1SWVA 1Z4NA 3U7GA 2HDOA 3WKBA 1Z5GA 1CQZA 3AR8A 3EPRA 3L8HA 1U7PA 2FPRA 4AP9A 5AESA 5A3RA 2YMLA 2HI0A 1RKQA 2DQSA 2G0AA 2YJ3A 3B9RA 1XVIA 1TA0A 1Q92A 4JB3A 4UATA 3L0CA 2W43A 3ET5A 2JARA 3QX7A 4UU0A 3ZX4A 3QLEA 2X4DA 4MWOA 5AK4A 5ALGA 1RLOA 1XPJA 2ZBEA 4IG4A 4ZEXA 5ALWA 2YMPA 3QUTA 3QYPA 4O8CA 5AW9A 3UMCA 5FP0A 2FDRA 4BEWA 2B1QA 1RQLA 3EF0A 3L1VA 3QU7A 3L8GA 2YY6A 3M9LA 3N28A 5AIAA 4I9FA 4YGYA 2MU2A 2PR7A 2R8YA 5AVSA 1TJ3A 3QXGA 4NWIA 1YJ5A 2G09A 4J03A 2WHEA 3K1ZA 3AR4A 3ZVMA 4Y2PA 3KDPA 5AW3A 1Z4QA 5AHXA 4Y2SA 2EAUA 2Q4RA 3A1CA 1NNLA 4BKMA 1KYTA 3ZVNA 4Y3UA 3W5DA 2AH5A 2YMMA 3B8EA 3OPXA 5AVQA 3AR9A 2BDUA 3SMVA 4EX7A 3NAMA 3OCXA 1YV9A 1CR6A 1N9KA 4UMVA 1RPZA 2PKEA 2P27A 2HHLA 5AKXA 3L1UA 1QYIA 4UM7A 3NANA 5AVXA 2IOFK 3WK8A 4XOUA 4J2TA 2WM8A 5ALRA 4BX0A 2I54A 2FPXA 4NFLA 3U26A 5AVVA 4EX6A 5ALYA 4F72A 3AR6A 3SLRA 2WF9A 5ALIA 2C9MA 3WKEA 3QUQA 4EZEA 2CN1A 4UARA 4DW8A 5ALKA 3L0BA 3PCTA 1RLMA 3FZQA 3DV9A 5IT4A 3AR7A 4I9GA 2P11A 2PQ0A 4BNDB 5AKHA 5AI0A 1L6RA 3FVVA 4UW9A 5AVWA 1Z88A 2HCFA 3QU5A 1ZOLA 4MUMA 4CE6A 4L6CA 4Y2QA 4EELA 2R8EA 3WKCA 5AW2A 3AR2A 3FM9A 3U13A 5AIBA 3AR3A 2YJ5A 2WF8A 4E88A 2FPSA 4RESA 2HEGA 2BDEA 1O08A 4OHFA 3FPBA 2NO4A 3A3YA 4KYTA 1YNSA 3SD7A 3J7TA 2C8KA 3OCVA 2G1AA 3ZWKA 2FPWA 2ZBGA 1X42A 4IFTA 2ZXEA 3I1YA 1QQ6A 1RKUA 3A1EA 5AVTA 5AVRA 3QNMA 2YJ4A 1U2TA 1T5TA 3DDHA 4UMFA 2I34A 5AW4A 1J97A 5AVYA 5AW0A 3SHQA 1S8OA 1ZRNA 3ET4A 2OBBA 2FUCA 3ZWDA 5AW5A 1T5SA 2HOQA 3I28A 2I6XA 4HGPA 2OA0A 5ALVA 2RB5A 3R09A 2WF5A 3KBBA 2B1RA 1SWWA 3L7YA 1YMQA 4OFZA 4PNHA 3KOOA 2JAWA 5T41A 5ALPA 4C4TA 1Z4LA 4NABA 3WK7A 1ZD3A 2GMWA 3SF0A 3MMZA 3MPOA 4Y2XA 1XP5A 1NF2A 4CF5A 3L0YA 5ALHA 4Y2YA 5AK3A 5ALSA 2CFRA 4QQFA 2ZBDA 1AQ6A 3M1YA 3OCWA 2HF7A 4DFDA 5AW6A 5ALJA 1LVHA 2RARA 5A3QA 3WKDA 1Z4IA 4OD0A 3ZTWA 2FPUA 3E8MA 3ED5A 2B8JA 5ALEA 1Z4KA 2D2VA 2OM6A 3IJ5A 4XQ0A 3E84A 4XE5A 1L7NA 2JGAA 3IRUA 1L7OA 4L6AA 3IB6A 3WK5A 2IA5A 4UM5A 2FI1A 3QU2A 4JDPA 3I76A 3PDWA 3QUCA 4Y2RA 4BX2A 4XPZA 1L7MA 2GFHA 2YBDA 1U2SA 2GHTA 1IWOA 1ZD5A 4YCLA 1QQ7A 5AK5A 3OCZA 4GXTA 1O03A 3ESQA 2HO4A 3QUBA 3P96A 5ALXA 5ALTA 5A3SA 2WF6A 1RC8A 1U7OA 4FFDA 4ZEWA 2GO7A 3ZU6A 3U19A 1RDFA 1U02A 2RBKA 3B9BA 4AS3A 4GIBA 3BA6A 5AM3A 3KC2A 4DWOA 1RQNA 3CNHA 5AICA 4ZEVA 4HGOA 4Y2UA 2VKQA 3NASA 3EWIA 3RFUA 1ZJJA 2P69A 4Y2JA 1YDFA 4CF4A 4RETA 1Q91A 1EK2A 4BX3A 1RLTA 3WK9A 1L8LA 1Z4JA 5AW7A 3WGVA 1VJ5A 3EF1A 5AKYA 3ZX5A 3U7EB 1TJ4A 5AM2A 1WR8A 4BNDA 3I6BA 2I33A 3NIWA 4C4RA 1ZD4A 3AR5A 5E0OA 5ALQA 4UAVA 1Z4PX 5AW1A 5AI5A 4C4SA 4CNQA 2Q5EA 5AKEA 5ALZA 1ZRMA 3GYGA 4Y2TA 2YJ6A 5AI4A 4YIKA 4H1WA 4G9BA 3UMBA 4UU1A 1N8NA 1RMQA 2R8ZA 5AKJA 1ZD2P 5ALOA 5AK6A 4FE3A 4YCNA 2G80A 4YCMA 5ALMA 1Z5UA 3KZXA 3BWVA 4BBJA 5AI6A 1VJRA 3PGLA 5AI9A 2C4NA 2I55A 2YMQA 2IOFA 2IYEA 3NUQA 2B30A 3UM9A 3D6JA 3ZTYA 3WK6A 5AKKA 1WZCA 3L5KA 3W5CA 3OCYA 4KNVA 3ZUPA 2C88A 2BY4A 1L8OA 3N8GA 2Q4TA 2O9JA 1EK1A 2C8LA 2P9JA 2ZG6A 4QJBA 3W5AA 3QGMA 3QU4A 4UMEA 1PW5A 3U7HB 2YFYA 1S2OA 2QLTA 4G63A 1QH9A 3RF6A 2G08A 5AVUA 5ALDA 1RRCA 5AKIA 5IS2A 4EEKA 4YIHA 2AUTA 3WK4A 3ESRA 1RMYA 3DNPA 3ONNA 3S6JA 4BEVA 4UASA 3R4CA 1NRWA 1WPGA 1L7PA 5AKLA 2AMYA 5AM5A 3VAYA 2ODAA 1SU4A 1T9ZA 2AGVA 3FPSA 1WVIA 1RMTA 2MU1A 2CFTA 5AM0A 4NV0A 1ZS9A 2O2XA 3ZVLA 1Y8AA 1Z4OA 1MH9A 2JAOA 4L57A 3WGUA 3UMGA 2G06A 4KX3A 4DCCA 5ALNA 4HGRA 4HAIA 3MC1A 5AVZA 5AM4A 3N07A 2ZOSA 4HGNA 3F9RA 3NRJA 3HYCA 5ALFA 3MN1A 3KD3A 1VFPA 2HX1A 2FUEA 3SKXA 2QYHA 2WFAA 4F71A 3FGOA 2GHQA 4EENA 4KNWA 2IOHA 3ZI4A 2R8XA 5AW8A 3N1UA 5ALUA 1FEZA 3E81A 5AI8A 1F5SA 3PGVA 3CZ4A 2RAVA 2I7DA
chains in the Genus database with same CATH superfamily
1BE8A 3QE0A 1HDEA 2X8AA 3O0FA 2CJPA 5SY6A 5LR6A 2WVJA 1PT9A 2EQAA 2HRQA 4O5EA 3U1TA 3Q2OA 3B1XA 1VG8A 1Y9EA 4TXHA 5CEEA 2FVYA 5JEDA 4NIMA 2GGSA 2W58A 5F3RA 4HAZA 5DNUA 1F7UA 3N7AA 2CCJA 2YZGA 4OH1A 3CB4A 4TWAA 2XE6A 5AH0A 4B33A 1JNXX 1ZQTA 3VVCA 1GEGA 4ES6A 1GL3A 2INGX 3LZDA 3FYUA 3BMQB 1JMYA 5L1MA 3TFWA 2F55A 2KB0A 3CLRD 4V02A 2GJ9A 3FNQA 1X9SA 1J90A 2MHCA 3JCZA 3BDIA 3QIVA 3C1TA 2ZCVA 4WOCA 3Q10A 4LJ9A 4Z7QB 2CHUA 2XXAB 1WV1A 4OJOA 3HJRA 3FDSA 2WHYA 5JS1A 3DFUA 4REMA 1SUIA 5WRFA 4G0YA 2PTHA 1AGYA 1LS1A 1U0NA 3D2LA 4L22A 2JI6A 4CMIB 4F2PA 5JJBA 3U4QA 3VUEA 1UWLA 5E79U 4N3NA 5FPQA 5FTLA 4IQTA 1J2EA 3RASA 3VM6A 4BP1A 3K72B 2GXSA 5KS2A 1N32B 3RANA 4FYJA 2D1FA 4HQOA 2AEEA 2ZSIA 2XADA 1UODA 3W77A 3JWPA 1ZJ4A 3P8ZA 2W9AA 3TQ1A 3MWYW 2PDAA 5CFLA 2W9XA 3H5RA 3ZQJA 2UV8A 5IAJA 2Y1KA 1LBQA 1MOPA 4KLFA 1JW9B 2ZXIA 3A3NA 2P2DA 5JSZA 2FR0A 3LDGA 2ZRJA 3S2UA 3RBEA 5DEIA 3LV8A 5HF9A 2B0CA 3U7FB 2YC2C 3MK31 2PMZF 4FJ0A 1MH1A 4MCHA 4NULA 3W9BA 4A6EA 4TYPA 5I7HA 4QZFA 5FUBA 5AKZA 5DCWA 1AS2A 9ICUA 2Y1LA 1E5QA 4A5SA 1WSAA 1WVGA 4DA8A 1QH1A 2IUEA 2NYRA 4KLQA 9ICBA 3UHPA 4BNTA 2ID9A 4DMGA 3KQNA 3L1KA 4B9SA 5T7BA 9ICXA 4ZVUA 4MKXA 1MX9A 4Z8YA 3OTWA 1CFJA 1RKQA 1B7GO 1EDDA 1OXKB 3HCFA 1V0JA 3JASA 3KT8A 1VKRA 4PXAA 1PQ4A 4C6HA 4II2A 1XTSA 4YRBA 1RRVA 2B6GA 4EJSC 2OL4A 2MAXA 3G13A 3MJTA 4PG5A 1PJ4A 5E6UB 2GZSA 1UBEA 3ET5A 1EHYA 4TTQA 9MHTA 1XQXA 1LPNA 3UWSA 1NVXQ 1AXRA 4BFTA 4JJ6A 2X4DA 5L3RA 2AR9A 2C00A 1GWNA 2ZWMA 4IEFB 2DWPA 4W5JA 3PQEA 3WRYC 2PMDA 1ZITA 2AMVA 3E9RA 3C3WA 1EKXA 1WCLA 3IUEA 2NTVA 4QGFA 5AJVB 4R8UB 4AKEA 2PMCA 4CMAA 5JSHA 2IH5A 2PKCA 2ZCUA 2QRNA 1BE0A 2BWJA 2ZVDA 3AI3A 1RQLA 1PVQA 3EY4A 3HPRA 1UKBA 4V38A 4NQZA 2FN4A 2QQGA 1J06A 4WV3A 5ICCA 1QGYA 5BSFA 1OY1A 1OYYA 3ELYA 4E21A 3AWIA 4YGYA 1Q15A 1RRPA 4RHXA 4B4VA 2PR7A 1AB6A 2V96A 2P6UA 1P4JA 2PPVA 1BIFA 2W6ZA 1C3EA 3HJTA 1YJ5A 3MTEA 1ZQMA 1Y42X 4H6VA 1IHOA 4BXOB 1QKIA 4AJKA 3SJUA 1RWNA 5A9SB 1U3DA 2XYVA 4KE8A 5HQJA 2XNDA 1N0VC 5AW3A 4JR2A 1OAAA 1TAUA 3EFOA 4P7GA 2D74A 1IWBB 1KI4A 2PX2A 4KFSA 1N3LA 4M9RA 4O0MA 4TRMA 4Z0TA 3RTGA 4EDHA 3GJ5A 2B4AA 3DDWA 1ES9A 3HUFA 5EZ5A 3DJYA 2K87A 4EKNB 2FG6C 1SBCA 3W5DA 2JLXA 4KLIA 2NRZA 2CHEA 3T35A 4R7TA 3E8SA 1BG6A 1Z16A 2RJOA 1Y3BE 1U4SA 1ZHHA 1MW8X 3PE4A 2C1ZA 3N87A 1G21A 4X0EA 1E6UA 1HYEA 1KDTA 4K6HA 1T4GA 5HZHA 3QYJA 1ZQYA 1HE2A 2M6RA 1OGYA 4PAOA 1N8SA 4DG9A 1DGQA 1YFZA 2WABA 1PZXA 2OCAA 2VJBA 3HBNA 2C59A 4R9SA 4XVRA 5GZ6A 1A96A 3AL0B 1YSCA 1E77A 4XOUA 5BMVB 2X14A 5ALRA 1V96A 3SR6A 4QFMA 4TN5A 1FTNA 3PJRA 1ZUIA 3VDQA 2ZYIA 5SZKB 1EWQA 3AW9A 4QYIB 2ZE5A 4TVOA 4WZBE 5JNUA 3Q3HA 3V2UA 1UBLS 3DC2A 3L46A 2CK3A 2HJHA 3P9RA 4FINA 3EG5A 2PQ6A 2HTEA 4JBIA 1NW4A 4JU8A 521PA 1J9EA 4EBEA 2FF5A 3L1IA 1HL7A 5J5CA 3JQFC 3FH0A 5IRCD 3ZWQA 1WBBA 2KKVA 5GZ3A 2EVWX 4K03A 3AETB 1U7UA 1SCDA 3EG9B 1PEYA 2PQ0A 3TI0A 4H0CA 4L5JA 2GS9A 1OT5A 5LBUA 4O5CA 1FXSA 2R48A 1BTOA 3HABA 3W5SA 3IAFA 5J2FA 3LUGA 1C2YA 5LXTB 1QIHA 2R4QA 2GPSA 5EWGA 5BWLA 3MWDA 3B70A 4MUMA 3IBFA 1TQ4A 2PS1A 1UP7A 3VR5A 2EL7A 1N7IA 1L5FA 3W2EA 4MA4A 3LO8A 5AW2A 2Y2UA 3JQBA 3L7BA 1QSYA 3FFBA 3GLGA 1OXMA 3JRWA 7ICPA 2WSIA 3O31A 4PFQA 4BB5A 3FSGD 1J5XA 4R3WA 4UUNA 4XVQA 1DQZA 4RJLA 2X0KA 1X2IA 4CMGA 3F3KA 1M66A 1IJEA 3EA4A 3GGOA 3NOQA 2VDMB 3DVQX 2ZSAA 5FBLB 3GG2A 5IJZA 3U2QA 2C8KA 1GYRA 1I2ZA 1M5RA 3AF1A 4LPKA 3NUZA 3Q6IA 4W5QA 2Q7DA 1UAYA 2WK1A 1Q3VA 1E2MA 2FLVA 1G16A 5AVKA 2P4HX 3RU7A 5KI6A 3M6AA 2B34A 2FZKA 1W5FA 3T3IA 1QQ6A 1HKHA 1LNSA 3D2BA 4QSHA 4RULA 1G3UA 3QNMA 2Q0QA 2WNSA 3KPWA 3QEBZ 4YCXA 1G8JA 4X20B 1FX1A 1GR0A 3VZRA 4D8UA 1UIMA 3JQAD 4KQ1A 2NVOA 1SUEA 1U8ZA 3D3EA 2R1TB 1A8QA 3H97A 4J9RA 1QBKC 1Q1NA 3KAKA 1CQIA 2CYBA 4EBCA 1XDDA 3BL6A 3MAAC 5EXDA 5H68A 2V54A 3LX4A 3W1WA 1ELOA 4B3TB 4ZKDA 1AURA 3ABOB 2FPPA 3AW8A 4HK4A 2WJWA 4P8RA 3VZSA 1M1YA 1O89A 4QPZA 1YL5A 1WV0A 3DZGA 1KDOA 1YZKA 4I2NA 2C1EA 1K8RA 4NU5A 3A4YA 1SC6A 2H63A 2Q1WA 2ID4A 1XA0A 2A5YB 3R09A 4PS0A 3RS4A 3N8NA 1CK4A 3KKLA 3T4PA 1KSFX 3JATB 1VE5A 4LWPA 4CMKA 1X39A 2D62A 5AUQA 4EAQA 1ZQBA 3OSZA 2HLPA 5EKTA 4DR4B 4FEGA 1COWA 4Q3DA 1KO5A 1WB5A 2P2NA 2GMWA 4F4IA 5LU8A 2ZSBA 4Q45A 1W9MA 2FW1A 1SBQA 2DCUA 3OPNA 4JVLA 5IVIA 1T2UA 3BCUA 4WVFA 2Y9TA 1XBTA 1UMBA 4UB3A 3BE8A 1FXWA 3HO1A 1LPSA 3BSYA 4L3OA 3MJ4A 3NHPA 3KWJA 4PPFA 4PVDA 5EHIA 1CDDA 5A4MS 4NOMA 1L7EA 2LV8A 5FUQA 1XO1A 2I9GA 1GQOA 2JLBA 3KP1A 1AC5A 5DB4A 2DBZA 1M10A 1AQ6A 1OWMA 3M1YA 2FHSA 2NXWA 2PZBA 3GFVA 4LNUA 4V0MA 4CT0A 4E03A 2MR6A 3V3KA 1AV6A 3A6EA 4E12A 1U0FA 2QTLA 1E3MA 2ORWA 1GTL1 1PFWA 4M9CA 2H1SA 4PYQA 3HPQA 1U0EA 3TZCA 4F8EA 1KY3A 1DC3A 2C2ZA 2FPIA 4LGYA 1SKSA 8ICHA 1KHTA 4DMMA 4QDTA 1GVHA 2FMUA 3RT7A 5CA1F 4KIJA 3TI9A 2ZAYA 4HF7A 4I1IA 4A82A 4QWWA 4J9PA 2AXTU 5FOSA 3ZW9A 2OO5C 3HB1A 4UB8U 4MVXA 3MGVA 2IIVA 4HH4A 1JIXA 2JEIA 3BEOA 1Z63A 2XUKA 4B2YA 1DZ3A 3PICA 1P0PA 2B78A 4Y7DA 3PW0A 5NULA 5K7SA 1XDZA 4F8YA 3FWZA 3WK5A 1UR5A 3CBQA 4ASUA 5AUNB 4RTMA 3F2CA 2R1VB 3FCAA 1AM4D 3G6KA 4Z1MA 1VKJA 3F74A 4GQAA 4ND5A 3NVVA 1VE6A 2ZIXB 3LHDA 4FIZA 1EESA 1S97A 1OTHA 8ICNA 2A58A 3BIFA 4XPZA 1EMDA 3NWJA 3T0FA 4F4KA 3LLSA 3WBJA 1G3QA 5HSGA 5JNTA 4EW2A 2AD1A 3GK3A 3U3JA 3GJ7A 5DNVA 4LAFA 5KNDD 3C1OA 3ESZA 1QQ7A 1DRUA 1YI1A 4P0QA 3LW8A 4LYJA 1X0VA 1P80A 1I7PA 4O4LA 1G8SA 5H02A 1OBVA 1WPXA 1DX6A 3AETA 5C8YF 3M2PA 2Z1DA 3OEED 5AOAA 4AG6A 4AC9A 4C0AC 4P4TA 3UGQA 1DQRA 4TXMA 1PVRA 1EWVA 4LJ5A 3GG9A 1NP6A 4RZRA 1RDFA 1UPAA 1PVDA 2GPNA 2UVPA 2PU7A 2DBYA 4LJKA 3TCXB 2F3PA 5LQRA 4ICIA 5B7QA 4E5KA 4Q3EA 2AOTB 4Z7NB 1OIVA 1WWVA 2W03A 1R0WA 2H2HA 1QANA 1BYUA 4QUIA 5AHWA 2EFYA 3TGWA 2CV2A 3PCRB 1KU0A 4ICAA 1E94E 3FETA 3RCBA 5LUAA 4GLOA 4WBNF 4M6WB 5F3XB 4MS4B 5FYQA 1N57A 4WJLA 1O8BA 1IXSB 2IF2A 4P92A 3Q5GA 4UOQA 4HS9A 4HUJA 4PYLA 1LQ2A 4MVJF 3X3HA 3ZWOA 3T5AA 4Z4FA 1U7XA 1Q91A 4OM8A 2DT8A 1T2FA 5FI1B 4R9UC 3LGSA 1ZW6A 1SVIA 1S9DA 4WMLA 3M89A 1S5PA 1TCUA 2QTGA 1YQTA 2BZGA 3KQTA 5JZBA 4B3SB 4LC9A 3B6KA 4BY9E 2A0YA 3N5CA 4C5AA 3F6EX 2Q1UA 2WB4A 3B2EA 3IQZA 1QFJA 4QUAA 5TE9A 1YZNA 4XIIA 5AWFC 1CJSA 2WJIA 4CCSA 3W4JA 3GILA 4KXLA 4AJ1A 1Q84A 5DN6A 2EDUA 1HDRA 1XMOB 4XTCS 2VPTA 2QN2A 3IPAA 1Q74A 1BMQA 4C4SA 1Z3CA 2Z58A 5AKEA 4MHTA 2Y1CA 8ICSA 3H2YA 3R7WB 3V8QA 4UB6U 1W5TA 3HZOA 4HDKA 2FWJA 3BERA 1ZX1A 8ICYA 4KLSA 3WNQA 4B71A 5EESA 4Q4AA 3RQSA 4DQUA 5JCJD 4LECA 1BSVA 1TZCA 1I3KA 1WDWB 3B7GA 5EI5A 2OHGA 3WYAA 5LFAA 2VPPA 3OC0A 5G1OA 3JARB 3AJ9A 2Q45A 1DAGA 1U8XX 1MOSA 3I42A 3LPMA 4FS3A 4JDUA 1FS5A 4MOWA 3UV3A 2C92A 4YX9A 4ZCTA 5KYWA 1U28C 4MZDA 1KNXA 2BJVA 4BBJA 1CUIA 5E4JA 1IVNA 2VCHA 1GN9A 2I55A 2YMQA 1UXGA 3U44B 1EXWA 3LUKA 4F5RA 4HY3A 4BLQA 4BWYA 3ZN2A 4DWJA 3RVDA 1HC7A 2V97A 3HWWA 5LVAA 4RU9A 4Z3KA 2WWHA 2HUPA 5FOTA 3KB6A 2IHMA 4MV1A 4TTSA 1IDN1 4N9WA 4U8GA 2WWWA 2WJAA 3ZDFA 5JU6A 1S3FA 4A0HA 5GIPE 3LT5A 4NLCA 1OASA 1P2DA 2G0NA 1DG3A 1WIWA 1XP8A 2IYAA 2QLNA 2KVCA 2MOKA 3GRUA 3GUVA 2XB8A 3R6WA 4MW6A 5EE5B 1M8JA 3IL2A 1ZQXA 4P3XA 3VV3A 4C7JA 3FCSB 2EBFX 1ENZA 4LDPA 1OILA 2JAHA 2M98A 2QSYA 3VMFA 7GPBA 1IIPA 1H94A 3LPAA 4QD3A 3UXMA 3HCAA 4C80A 1R0KA 2VKTA 4DARA 3ETLA 3ESRA 4IRKA 3ZW8A 1E1MA 2J9YB 5BSTA 3LL4A 5HA5A 4ILEA 4DANA 2EJWA 1R5NA 4FXOA 1ZETA 4C8MA 3AGQA 3JXEA 4UZEA 1E2PA 4N0MA 3KQSA 3AQ4A 4KN5A 1PKEA 1PNVA 4HB3A 4BV2A 5BUSA 1K8ZB 4LE0A 721PA 4KBYA 1LPPA 4TKZA 1G291 4L07A 1ILEA 4OHZA 2OBNA 4DFJA 5HUQA 1N33B 2MSDB 3AB8A 4JJGA 4HDMA 3K05A 2NP7A 2G71A 2GBFA 1DE0A 3AFIA 2BSAA 3C3MA 3D4LA 1A6SA 4RTLA 1W4RA 5EP4A 3BMQA 3OZUA 4IIJA 2YJZA 4IRMA 1XKTA 5HFNA 3AEXA 3FAKA 4LX8A 5B2ZA 4O3FA 4O5KA 1LB2B 1ZMOA 2QIPA 4L57A 5TDHA 3TADC 4YJGA 4KN6A 5FUMA 8ICIA 1RKXA 3ILYA 2C2BA 3HJNA 3G1UA 1JMKC 3IG8A 3G5AA 1P4RA 2X40A 2B9EA 3BUSA 4LC0A 3U62A 3V34A 5LOVF 2ZIAA 4L8VA 4PXYA 1KH1A 4BNLA 3NBMA 3JQ8A 4L0QA 3UOAB 1U9YA 8ICJA 5LA6A 1BN7A 3DBOB 3V9AA 3UMRA 3F8WA 3HDTA 3KQVA 1VFPA 3UAYA 4I28A 3AUAA 4L8LA 4BVLA 3O94A 3HBAA 2A8YA 5K3EA 1P62B 1YBHA 3BFJA 3IQXA 4KNWA 4QU5A 1E9EA 2GHQA 5EJMA 1Z75A 5F52A 3RBVA 2OEPA 1WUJS 4KCGA 4RTRA 1BFUA 4EA8A 5E1OA 4DM4A 5BVGB 2Q0XA 4PS1A 2JH1A 3RSFA 1WLSA 4BNYA 1JQDA 1CU1A 2RGWA 4AJEA 2UYGA 3IQDB 3MT0A 3KALA 1H4SA 1Q1GA 2AFHA 4BASA 3GVIA 4K1XA 2VO1A 4O3SA 2C4MA 3E5HA 4HSGA 2AZXA 2AR0A 4BTEA 2Q3CA 4MP6A 3JVIA 3SK0A 3V32A 5TMDA 4GOND 1LW6E 4Y67A 3W2TA 2QTBA 3TLMA 4ETMA 4MLPA 2EX0A 5T3YA 3A6LA 1DJOA 4U9IS 4BNXA 3QW2A 2BMAA 1VA5A 4XCQA 4OIFA 3HP4A 3W5BA 2O5VA 4NAUA 4ZOAA 1C29B 3GVXA 1NASA 4XJSA 3UPQA 3QVJA 3VSEA 4BKOA 2XCRB 3L4KA 4I1PA 3H1BA 1W2HA 2IVFA 4ZT4A 1TUBB 5FXMA 3PRJA 3LXRA 4AS2A 2CXRA 1NIPA 1CRXA 3S4YA 5AKGA 5KL1B 9ICRA 1AXEA 1N2ZA 1HZZA 3CMMA 1QOPB 2OY0A 4Y9TA 2KICA 4J1TC 5DLPA 1X1TA 4GEGA 2HN9A 4MVWA 4P0QB 3DR3A 3ZBUA 5KFYA 2GN6A 2K7ZA 4MFFA 4XWGA 1N2CE 1EFPB 3MJRA 4LXIA 4Z49A 3HDHA 4C0ZA 1SVOA 4QUDA 4YRDA 1E5VA 2PVSA 3IQGX 4IHKA 4R3UC 4YROA 1W85B 5K4LA 1ZW1A 1CS4C 4JYBA 3WB1A 4D0SA 1SB3C 3CNQS 3ZCVA 4L7VA 3T1VA 4YVFA 3GMSA 1Y6FA 1FDIA 4YPFA 3UAVA 3PF9A 5G4KB 3FX2A 1L7VC 5IT0A 4BBPA 1LKYB 4KNYA 5EWFA 3WWDA 3K30A 2CNDA 2QJOA 1NDHA 5FV7A 2SNIE 4X1KB 1J23A 1QP8A 1X14A 2B5VA 3BN3A 4G0WA 3N53A 1DV2A 2F48A 3MHTA 2VATA 3IV9A 1GA4A 3OKAA 2NO5A 3GIMA 2FQXA 3EEBA 4P4MA 1SWVA 4JC5A 4AJHA 3OEHD 4QXOA 1QIMA 4R2JA 4WLEA 3IC5A 1E58A 1BNCA 1W29A 1NW3A 1SXJD 1MA3A 5BWBA 3BFPA 3TQCA 3BQ7A 3V33A 4DSLA 1WW8A 5FOQA 1TIBA 1X3LA 3CKKA 3UKJA 3T1TA 4UATA 1HURA 2RGCA 1LVUA 3FDXA 1JGTA 1ZZEA 2ON6A 3NNNA 2VXBA 3PX2A 3SJCA 2BCRA 3V7NA 1CNMA 1RBQA 1VA4A 3X2FA 3KL4A 2COKA 5I9TA 1XZPA 2Q0ZX 2XTAA 3PGA1 1HT1E 5AW9A 1UJ5A 1R6TA 3OQMA 1I2CA 1GG8A 5KFGA 1DAPA 1RW4A 2QMQA 2YFQA 1NXOA 3C3DA 3KTAB 5IJXA 3RE1A 4ZJYA 2O8BA 5D1HA 3OPMA 3NV7A 3RU2A 3PF8A 4RIFA 4XGQA 3BCRA 4MARA 5A0LA 4E1BA 4CT4B 1KK3A 4BO9A 2FWPA 3LOPA 1QGUA 4UBJA 2BTOA 4OFBA 4IIVA 4YDQA 3QK7A 2NXNA 4NWIA 4JP3A 1ABFA 1W93A 3FSEA 4GL4A 5EXXA 4ZJZA 1ZGJA 2Q6TA 1SJ9A 2A9PA 1O97D 4EVSA 1GUZA 1K2WA 4HRYA 1QIGA 3H2SA 4WERA 4ED0A 1J1UA 4QO8A 1K2VN 2NZWA 4I1UA 5CJPA 2AHOB 4YUVA 2CT8A 4EGQA 2JCVA 3D43A 4R84A 1NXWA 1H93A 4OREX 1GZDA 1NJ2A 3CURA 4X6YA 1N1GA 2I4MA 2X41A 1CUDA 3CLUD 3R9IA 2UUCB 2CJXA 2XYGA 4YUZA 2Z83A 3CFYA 1PGJA 5CH5A 5A02A 1EFVA 3OOHA 3IBCA 5IBCA 5K0LA 1S7GA 3EIXA 2H1FA 3ZWPA 3WFZA 4CDNA 2IFTA 4F4WA 1OWNA 1GNVA 1MV8A 1CR6A 1OPRA 4URZR 3UJ7A 1X8JA 3WMGA 1L7XA 1PX2A 4LMRA 1VI5A 3AI7A 2CNLA 4A8EA 4G9EA 2CL5A 8ICKA 2W48A 4YMOA 1KQ3A 1QTRA 3BS4A 3H0EA 4R1MA 3QA3E 4MR9B 3GDXA 2PZEA 3NANA 3NVYA 2VDUE 1F8GA 2YNMA 3QVGB 4PZOA 1SPXA 1T0IA 5CEHA 1KYZA 2VJMA 4LOJA 2FPXA 5FFMA 4OLBA 2V7TA 2VK1A 1W36D 3NDIA 1NLYA 3T7IA 5AVVA 1XTBA 4JT4A 3BIXA 3PFHA 3I5YA 2C5GA 2FSVA 4DJDC 2VJAA 4L78A 3DWFA 4BCDA 4CMIA 1AGPA 2HQBA 1DKLA 3PHCA 4YCBA 3GB9A 1IPEA 5ALKA 5KFSA 2O05A 1UFKA 3FZQA 1JFVA 1CW2B 1Y1TA 1QO0A 1SUDA 1ZOSA 1NYTA 3DE0X 4DMCA 1KE1A 3VH1A 1N5RA 2ZU0C 4JWMA 2QBYA 2O54A 1PLJA 3H7IA 2BI7A 3SS8A 3VOTA 2B6HA 4P5PA 1L6RA 1X9GA 2WNIA 1KFCB 4H7EA 1H6AA 2FZVA 1CUXA 2DHRA 2OCYC 2WBLC 3CXRA 3F7MA 3L01A 4B0PA 2IE8A 4HKTA 1NPYA 2DLDA 3MQ2A 1R5BA 2V7WA 1JFRA 3DT6A 4IOKA 4RADA 4ZQIA 4BE7B 4WT7A 3OC6A 4TYMA 1IHYA 2WUEA 2PSHA 3W5JA 1ZSNA 1XCBA 5FPTA 3DXFA 1ZHOA 3D2AA 4D8TA 3LYSA 3TN7A 2YFKA 3MS4A 2H0AA 4BWMA 1M6NA 1KAMA 2NT4A 1HL3A 2XB9A 4GEKA 1YJBA 2YCBA 1A95A 1N56A 2GJ8A 2NO1A 2OHHA 3G89A 3HB0A 3TW4A 4DLYA 5H4GA 5M34A 4M7WA 2A5LA 1Y81A 4N65A 5GGXA 2R62A 1JL3A 5DMXA 1CF4A 2PZFA 3IAM1 1ADCA 4HYQA 1NXPA 3GFOA 3PR1A 1SHZA 4L73A 3R8CA 1UADA 4A0RA 2H3VA 1X6VA 1OHHD 3I1YA 5KG6A 4MAAA 5DX1A 4BECA 2JBAA 1XYGA 1CY7A 1QH0A 1T5TA 2JH8A 4JC4A 3T7JA 4ZMBA 3KXLA 2FEPA 3AEVA 4ZQCB 3UT6A 4BS9A 2J8ZA 3GIWA 2UZ1A 2B4RO 3I9V6 2B36A 3M81A 3LY5A 4WBSA 2E21A 2IIPA 5DDYA 1O4VA 3N7PD 5CIWA 1FTQA 2HQ1A 2I0FA 3IKMB 4RQBA 1SQ6A 3V2HA 3CS3A 2POQX 4U9UA 3KEGA 3OJSA 1T5SA 2CVPA 3AEUA 1A7JA 1I6LA 4I4TB 4JKOA 4LDQA 4ZK2A 5LXTA 1SBTA 2I6XA 3I05A 1YBFA 5KAPA 1QC5B 1DIOB 1P5RA 2R6JA 1RQPA 3HU1A 4ZOCA 4MP8A 3N70A 3O6VA 3KJZA 5CDTA 4GAEA 4MUGA 4OFZA 1AIPA 4RK5A 4KFCA 1FVFA 4I08A 3ZWYA 4P4SB 5EP3A 1W30A 5A0FA 4KVAA 3BDVA 1TUGA 2XR1A 3D6TB 3NIDB 1M7BA 1U80A 2KG5A 3OD1A 2DFLA 3EFOB 4BDPA 1B3BA 2AMLA 4IQ8A 5D01A 1ZNXA 1RYSA 1G6Q1 2RAPA 4S35A 2MIIA 1R0XA 6REQA 4O0IA 3R77A 5ALHA 1NJZA 4BVHA 1FSZA 5M7EA 4GVLA 4REQB 4ETIA 3L40A 2RHGB 3GCGA 3EXFA 1H4QA 2WSYB 3TINA 3IJRA 3SEZA 3IIIA 3F71A 3HBMA 4CODB 4P35A 4Z2AA 2IX3A 3ZNPA 1QHHA 4RV4A 3BQTA 5SY4A 1K8XB 1GSHA 2EZTA 2PX8A 1U9JA 2XX3A 3HEBA 2D5LA 1W8DA 5TGZA 4EARA 1H0HA 4YQYA 1CDOA 4B9VA 4IY1A 2EKLA 4QRDA 5DISB 4ZCQA 4V1CI 1Z6XA 4HAXA 2P2YA 1Z4KA 2O4CA 5KG7A 1L0BA 1D2AA 3LYAA 4P3YA 1FIQA 2EFDB 3S1LA 4DLBA 4I8XA 3GUCA 2DHQA 1QZTA 5AQ1A 621PA 1WOMA 1Y7PA 1H42A 1OOEA 2GJAA 2J4FA 3I5XA 4RIGA 3VC7A 2QD2A 2EFEB 2W42A 2FK8A 5ICGA 1EZ1A 2IH2A 2J5BA 3OT4A 3G2NA 4OP3A 3M0EA 1Z2OX 3KUXA 5TQVA 1UIRA 5BMVF 2GNPA 4PAWA 3NFRA 4M22A 3D54D 3O38A 3QOXA 4MZXA 4FFSA 4WCFC 1MQ2A 4RKRA 1N2IA 3JASB 2AG8A 1JH9A 4RZQA 3Q9UA 2QE6A 3NWBA 1YB7A 1E8NA 2YWHA 1YCHA 3KOMA 2H52A 4NRDA 1NOIA 1IZZA 3C45A 3SR3A 4DLWA 1X3SA 4ML3A 3TQIA 4AW9A 3ZHVA 1NHGA 2QI9F 3GN1A 2DKOA 2GFHA 5I5EA 2VQFB 1U2SA 2ODEA 3S68A 4P2HA 2XUFA 2PH3A 4KLAA 4E5MA 3IDFA 4UUBA 3UHAA 3OQPA 3WWEA 5JRDS 3SXUB 3QUBA 4DIKA 2RDIA 3FPFA 5HS6A 3EGWA 2HVIA 3ZLBA 5KJEA 3ZZ0A 4M8SA 1KI6A 1GQFA 4LWOA 1DBSA 3DLCA 3CW2A 4QT4A 3FWYA 4MUHA 4RGBA 5LZ7A 4FYKA 1K98A 8ICMA 3A04A 4BLTA 3GYBA 3NAGA 3IT2A 4DBVO 3EVZA 2Q3MA 1R0CA 1E0AA 4BE4A 5KU1A 4PHHA 1KOGA 2ACKA 4GPZA 2V5VA 2CJWB 3D4PA 3DVAA 1QHYA 3UAZA 4DBLC 1RYFA 4IICA 3TZHA 3NASA 3K8QA 3TX2A 3WX0A 5BPFA 1QXSA 1QYXA 1L5QA 4JP5A 4QBFA 4GPAA 2QIOA 1QIDA 4E08A 1ZJJA 4XB2A 4DQXA 2P69A 3SQOA 2VAMA 3OU2A 1DQNA 3WGGA 4CF4A 3JQGB 4ABTA 3OH8A 3I9OA 1IAVA 2F1JA 5LP6C 2OBXA 1XMXA 4ZAWA 1RLTA 4V0SA 4A5OA 2ZJ6A 2RGRA 5EN4A 5JXHA 3AN1A 2OGTA 3QVLA 1Z39A 1P19A 4OBBA 3NG1A 5HCIA 2EW8A 3BH0A 5LNK6 1AB5A 2EXXA 3U7JA 3ZC3A 3FVQA 3S1AB 3P2KA 4BLSA 2AXNA 5CG2A 3EGDA 1N9GA 3FJ1A 4UE3S 1BXGB 4DOCA 1I3CA 1U2DC 4CLDA 3S2EA 3MWGA 4IBOA 4LW8A 3TUZC 1E8MA 4C05A 4CMEA 5KTNA 4NLKA 4EIWA 4FYYA 4DL3A 5TARA 1D8YA 4ED8A 2XY5A 5CA7A 3N2GA 2DKFA 4E2ZA 2AW3A 1N2CA 1BXRB 2AFVA 2Q9BA 5TQJA 3C41J 4UAVA 2W6PA 3K5IA 1TKDA 2XUJA 1RHUA 4FN4A 2Q4BA 4C7ZA 1NK8A 1UXHA 1X70A 7AT1A 1RYDA 1VRVA 3R24A 1QORA 1ZXXA 1WSDA 1KRPA 5DGXA 5E6RA 3A1NA 5IANA 4QG7A 2Q9CA 4IUCS 1GN8A 4LRYA 4ARZA 4B6EA 2JEOA 4G9BA 1IJKA 3P94A 4M0FA 1IZ0A 1FNCA 2WAAA 4YHBA 1KPHA 4TYYA 3ZU5A 3R40A 3NH6A 1GARA 1P9WA 3QPDA 4GBMA 5LMNB 3B2QA 4KAJA 4QEDA 2II6A 2XODA 2P1DA 3VKWA 1WQ1R 1GCAA 1K7FB 1SNYA 4L50A 4QBHA 5J0YA 3T1QA 3UXEA 3GLIE 4M1KA 2QTAA 5AI6A 4IIEA 3E0FA 4QZIA 4H7FA 2WG1A 4EI8A 2PT9A 2XIQA 3NHUA 3P5SA 1UBUS 3P0FA 1FY2A 4R8MA 1X1DA 2VJPA 5CNMA 3LUPA 4A1OA 4LOIA 2XGPA 3MT7A 4ZGBA 2VXCA 3R7DA 1M54A 2DE0X 1WCIB 2PBRA 4HDKB 2KFZA 2HH9A 3CRXA 3Q8PB 1RCTE 1CDEA 1RJWA 2KI5A 4JJ4A 1M5UA 2JZCA 3O3OB 1KVRA 2ZZNA 5HKBA 3PC4A 2IXDA 1ZWLA 1F51E 4ZPJA 3ZD8A 5I7VA 1SD5A 2N75A 5BN5A 4B34A 1AKEA 3IJPA 5JJIA 3AF0A 4X6UA 3ZHQA 3VNQA 2JJQA 1KMNA 3MGCA 4K8OA 3CA8A 4KQ2A 3WLNA 2PRKA 3IQWA 2FMQA 1GGJA 5DM2A 3VYWA 1QBGA 4Q7MB 2W8KA 3INNA 1VCMA 4EEKA 4PHDA 2KZZA 1QYCA 5BSMA 1MUUA 2Z5LA 2XUGA 3DNPA 3RM3A 3ADBA 3GLGE 4MB2A 4YRJA 1MORA 3H42B 5I8PA 3EDMA 1I94B 4H7KA 2VBGA 2GWSA 3FYTA 2P4EA 1XV5A 4B7CA 4NZNA 5DKFA 2PRZA 2ZXHA 2JH9A 2GKGA 4D97A 3OZWA 4G4GA 4LX0A 4YRTA 1WKCA 2I8AA 4MCAA 1E2JA 1DDGA 2HSWA 3GUHA 4L15A 3RJZA 5B64A 3P9PA 3AC0A 2FLKA 3LUCA 1YZQA 1UC5B 5DCUA 2WD7B 5JHGB 1KTQA 1THGA 5LLDA 2HF8A 4QARA 1LWNA 1RPNA 1Z0KA 2CFTA 4XAQA 3NJRA 2FZ4A 2PBZA 3GH3A 1BROA 3O9MA 4ENPA 1EFRA 4OEHA 2OHXA 4G8BA 1RM6C 3COZA 4AZWA 4BRWA 1NZBA 1L4LA 4WFKA 2JC3A 2O50A 3SXUA 4QHSA 3WJAA 1F2TA 1DG1G 1YS1X 4ECXA 2BI8A 4RBNA 1NURA 2F62A 1H5NA 3CR3C 4UM8B 4WXHA 5F2OA 3W8NA 2DKXA 4EG4A 2YRFA 1HE5A 1OV4A 3LK9A 2ZRAA 3L93A 3GJYA 5C81A 4JEMA 1RBZA 2B1GA 2R6DA 4Q6WA 4XUDA 1XZHA 1N61A 1JKMA 1G1AA 1SHTX 1QQTA 1R27A 2D06A 3T1YB 1FFHA 3IDWA 4F5DA 2QAGB 3F78A 1Y37A 2ZOSA 5GMOA 1NLMA 5GONB 3RSGA 3A58B 4JT8A 5DHTA 1ZQNA 1R2QA 4HGNA 1OJLA 4RZ2A 1E5LA 4XKJA 3C2KA 1QO9A 4FX5A 3ZHUA 2AFHE 2WM9B 5COQA 5I9MA 1VMEA 5EIXA 2G72A 1M2VA 3KT3A 3RUPA 3IR7A 2ZUCA 1PD1A 1E6KA 1GVNB 2REOA 1Z56C 1EHIA 2OCGA 1CVLA 2Z2JA 1IN4A 3HA2A 4I1SA 3AMZA 4PPXA 4KWHA 1SVLA 4XIGS 5TQ2A 3VRHA 1J2NA 1SBZA 4ANFA 3LLUA 4UE2A 3C4QA 5DI3A 4W5NA 5CGQB 1M6HA 3N2GB 2YJTD 1PIWA 2IXTA 5KT2A 7ICLA 2XMRA 3A1UA 3B6EA 3BJEA 1QP7A 2JJ2D 1JJFA 3RB8A 2B4KA 1S1CA 3RYFB 1KZ7B 1UZUA 2ZXFA 4EZEA 2H2IA 3CLKA 4Q19A 3DO6A 2OORA 2GPJA 2VI5A 4DV4B 1N9GB 3U3MA 3PPXA 1TA4A 1NR5A 2Q4OA 1XRLA 3GAMA 1FW8A 1EM6A 1Q1BA 2JK1A 3HT3A 1JHOA 1EDOA 2OR3A 1Q0SA 2JGKA 3A1DA 3E82A 2EATA 3I12A 1ZQUA 4KWCA 2O2GA 4O2AB 4RF5A 3ROXA 4BO0A 2CDAA 2JAUA 4ROTA 1D2CA 3E9YA 1B0XA 3A6ZA 4MHVA 2TMYA 1E2NA 1RIIA 4IUDS 4RD0A 3P9SA 4KGZA 5AHKA 2GQ0A 3CHYA 4BVBA 1F20A 2BELA 3EDQA 4B3IA 5KFQA 4NBLA 4M99A 5CLHA 5A9RA 3ZZUA 4EB8A 2I78A 3T7DA 1XK7A 2QPAA 5MGBA 3M5PA 4LZDA 1XAJA 1XO0A 3DVAB 1KC3A 3N7TA 4QNLA 2K2QB 4HFMA 3CX6A 1COWD 5J0OA 1LCIA 2HPAA 3RBZA 3A32A 4KN8A 4AJNA 3PHIA 4FPXA 1GL9B 2PUBA 2W4QA 1ESEA 2OB1A 1R0RE 1X8LA 2MWMA 2NQ8A 1PQWA 3I2FA 3R5SA 4LOLA 4LYAA 4QTZA 4AZVA 3EBLA 5JCPA 4NVRA 4M04A 5EFOA 1QONA 1SUPA 1ZC4A 3M9OB 1SXJC 2WJ4A 1XJ0A 3BG5A 3STYA 2XO7A 5J58A 5JMWA 5KG0A 1GPBA 2P2CA 4HJRA 4M89A 4R0MA 1SUCA 5ARBA 3MTGA 3GFKB 4JJIA 5HIAA 3AM4A 1C8KA 4BFWA 5CFQA 1ATZA 1EHCA 4HMQA 5CK4A 1PKXA 1WAMA 2YTUA 3IHTA 2W7PA 3PC8C 2QVXX 1XALA 2KJ5A 5D3MA 3PP8A 1C3OA 4L72A 4ZA2A 4DHWA 3MWEA 1F0PA 4J1QA 4UXIA 2YQZA 4GWLA 3HEAA 1C2TA 1FDOA 1U7PA 4QYMA 3U49A 3L4JA 3W5IA 2NXJA 3DTNA 1SOVA 2P9QA 4W5HA 2RHRA 2AUNA 3S2IA 4WKCA 1PUJA 1B93A 3VZQA 1FRQA 4W6ZA 4JB3A 3LNTA 3DTTA 3WHIA 3C3EA 4XUGB 1PS9A 2QPLA 4DWIA 2YN0A 1RI5A 2MYPA 4ECUA 5H4HA 1MB4A 3T9AA 3VSAA 1V38A 2VP2A 3LXXA 4CV3A 4EMSA 5KOIA 2CLLB 2DP4E 1YS7A 5IYZF 4CEJA 5ALGA 1TX4B 4W1PA 1M2OB 2LVBA 3CYMA 1T1GA 2ZXUA 1CUYA 4CCYB 1XZGA 2BSXA 4DA9A 2HK9A 4ZI5A 1ZR2A 4FCWA 2JLWA 4FSHA 3S5JA 3CEMA 1NJYA 1R6DA 2YWJA 3WLQA 4GRDA 1BX3A 1A9SA 1BGWA 5B5EU 1JE1A 1IB6A 2ADMA 3L8GA 2YW9A 5DKWA 2Y99A 2O6KA 3RFVA 1KWKA 4KH0A 1NQOA 1Y80A 2PEZA 1JFTA 1NATA 2ETVA 5C5DA 1ZIOA 2VUSA 2YX1A 5DBOA 5B6PA 1LW7A 1O1YA 2CLFB 4CKEB 5TJ9A 3LUAA 3M1LA 1NW9B 3KDPA 1I51A 4ZIRA 1VIAA 4F85A 3F4BA 3QXCA 5IH7A 1KAOA 5DG9A 1H2ZA 1QWSA 2GK6A 2OHVA 2RGNC 2ZFUA 3EE6A 5B7PA 2C03A 1POXA 1C9MA 1J0CA 2CMKA 3RJTA 2G77B 3UJ6A 4ND4A 3UOGA 3Q8MA 1Z26A 2PCLA 2VDNB 1HMYA 1SOUA 3CTPA 3IOYA 4G2NA 4J29A 1RQRA 2GD6A 4NBVA 2B25A 2JG3A 4QIHA 4PGQA 2EGUA 4A8TA 2X23A 1H3EA 3BIJA 3KLNA 2OXEA 3GDHA 5KFRA 1PR2A 1ECGA 4DS5A 1JAHA 3D59A 3G68A 3LKVA 4OFWA 5JHHB 1H6DA 1S2DA 1I5RA 1R6BX 2DFNA 3CNLA 4LBYA 2V9PA 3BBPA 4NE7A 4XFJA 2VZ0A 5DB6A 3F6BX 1OMOA 4QELA 2HHLA 2YDXA 3L2OB 2DBQA 4AVYA 2MINA 2R8PA 3PLNA 4NP6A 1TOAA 5B1IA 1NFFA 4ZZ1A 2F2AB 5BV2P 2H2GA 3QKSA 1D2NA 4BNMA 3KKOA 8ABPA 4PWYA 4ED6A 1OTYA 2FMPA 1RZVA 3IURA 3RVJA 4LQDA 4QZVA 3GRCA 1DKPA 4PZLA 1TYAE 4HWPA 4HDRB 4MI1A 1XPOA 2IIQA 4O6VA 1R9GA 4TV9F 5FFFA 3UXPA 4OXNA 3WKEA 2PJUA 4IJUA 5JAOA 3OETA 4FDUA 1PV1A 1GQQA 2Y0EA 4E7OA 5KYXB 5DOZA 4OL0A 4A27A 3DR5A 4MIEA 5LKRA 3ILXA 1U1FA 5CK5A 5BRAA 1VL8A 1X74A 1YZUA 3QVWA 3TRKA 2P9HA 4US0R 4HXFB 4NYIR 1D9FA 2A30A 1WHTA 4PAGA 4RLQA 4YN3A 5H16A 1NJSA 2QAGA 2PQMA 1OU0A 3BHJA 3DEYX 1M8PA 1VBNA 3GLHA 3AEKA 1D9XA 5K3FB 1CD5A 2O3TA 3PSHA 3TB6A 1KJZA 2R4UA 2O3SA 4F21A 2EU8A 4HB4A 1NTRA 3BWBA 1ZOLA 1AZSC 1FSFA 1R74A 2ET6A 4D98A 5K05A 4J9SA 1HH4A 2Y93A 1URJA 3ALRA 4FE4A 2CEAA 2AOWA 1UAGA 4OQZA 4ENWA 5E8JA 4DNOA 4P32A 4QU9A 3ER8A 3AR3A 4LFBB 4KMUA 3B1VA 5HILA 3HVRA 1U2EA 3EQ2A 1ECWA 4QZAA 5GADl 5C8VA 2F8LA 1LK5A 2EH9A 2LIPA 1WSWA 1Q0LA 1VE7A 1Z06A 3ETDA 4QJ4A 5AXBA 5TPZA 2OD9A 5CDYA 3J81j 1VLJA 2PUWA 4L3WA 4LTNA 2QXTA 2Y0SF 4I2AA 1JYEA 5EWMB 3WL6A 2ZTVA 4FQ8A 3ZZTA 1AT1A 4KJXA 5CX1B 2ETXA 2ZVQX 5CCBA 1PR4A 3U7GA 3RAQA 4GZ6A 1JEYB 4YALA 2IPNA 1PNRA 2HB6A 2ZS9A 3E9EA 2XGQA 1XA4A 2ZI6A 1IATA 2WT9A 1Q22A 4JV2A 1O87A 3WQQA 3OE1A 3AHEA 4L9RA 1V3TA 3GJ8A 5THQA 4BRZA 3KTQA 5KMGA 1B26A 5DXJA 4A10A 1RI4A 2C7BA 1PSZA 3B9JA 1JF8A 4ECZA 4HAOA 5J23A 1FW6A 2IUUA 3ZGYA 4I2DA 4C2BA 1OZFA 3I34X 2QROA 2RHDA 2ZGVA 5DQIA 1OREA 1JS1X 4H7IA 2BZSA 4IV8A 2OZLB 4GM1A 5IDYA 4NJMA 5KSPA 5C51B 1N3BA 4IQ4A 4F4UA 1V5WA 1C9KA 2REXB 3JQDA 3KE8A 3DNMA 5JFTA 1E9DA 4ZVTA 1ATIA 3DT8A 1F38A 4JUAA 1RSZA 5DT2A 2FFRA 2AHOA 3SU8A 1DT3A 2VA2A 4EYSA 4EJ6A 2V0GA 3NGDA 4MS1B 4RCZA 3MIIA 4ZGWA 1JWBB 4V03A 4FDAA 1Y0BA 3KU1A 2GEKA 4ACAA 4DR3B 2HF9A 3EFEA 4FWIB 1V2HE 3ANMA 2ZT8A 4MEBA 3KKKA 1H22A 1XSEA 4UJ5A 5ESXA 2CFRA 4JBWA 1KTIA 4WGGA 1E5DA 2FSFA 2XNSA 3UBMA 9LDTA 2GBLC 2IYXA 4WEOA 5HK8A 1HG0A 1ORDA 4G41A 1KEJA 1NJXA 4C4AA 2QN3A 4F46A 5HVNA 1V7ZA 1HI9A 2OK8A 4XX0B 3V46A 1SKWA 1XMPA 3THYA 3ONFA 1UDRA 3I04A 1S02A 1GILA 2G9ZA 2YYAA 4GXJA 1ZBQA 2P6PA 3ED5A 1J25A 3GLIB 4KLLA 4S1PA 3ZJTA 3D2QA 5ICEA 3CZPA 1KW4A 1XRMA 2R5NA 1HRKA 1Z0AA 3T52A 2BM8A 1ODJA 3DYIA 3C87A 1E2LA 3NDBB 1V9CA 4AIRA 4DKXA 1GUDA 2EOAA 4R6XA 2JB9A 4IIUA 3RRHA 4P0PA 1KZGB 3D6MA 4HYKA 3NDRA 1DAIA 1EVQA 3OM9A 4OJ5A 2LW7A 5DYIA 1FYWA 3ZHYA 4F84A 2V1UA 2OBYA 4L6AA 4KSBA 1XRJA 2XMSA 4COKA 1QU3A 4TUSA 2DFPA 4ZRNA 1AU9A 2QZ9A 4K3UA 2YWGA 1PRYA 4AF7A 4CCYA 3I76A 2FV8A 1QCYA 1XSLA 2G8LA 3FOFC 1UBCA 4RQ5A 2FX2A 3GNQA 2WT8A 4TMXA 4JFRA 1DBPA 2HAEA 2RDJA 1PG0A 2ZREA 3RAPR 3RSQA 1L7MA 2VUUA 3P19A 9ICOA 2Q41A 3S2ZA 3PITA 4AUNA 4JVOA 4MP3A 4EQ6A 2ES4A 2GJKA 2BSQA 3DC7A 2OWDA 1FSSA 4Y9RA 1P4AA 3HJCA 3ESQA 4ENVA 1ZQEA 1J8QA 2DR3A 3P96A 5D51S 1OLUA 4WK4B 1VHDA 5I45A 2F17A 3VHXB 5ALTA 1HQDA 4Z7OB 1MB9A 4YJ2B 1NGSA 3PQ7A 4IFEA 4EKIA 3OX4A 4GMDA 1RT9A 1Z74A 1ZCBA 2XOXA 4KGXA 4ZEWA 3TR6A 3DMTA 4POOA 4KTQA 1TMGE 5J4HA 1W36B 4HBZA 7ICMA 2E6KA 3E22B 4EFKA 1F12A 1NC3A 4JQZA 5IJ0A 2AEJA 1E4VA 2HMTA 4FOLA 1FZTA 4K6OA 1FFDA 4G0QA 1Q1ZA 5ER9A 4DLZA 3T5KA 1RXUA 2P7IA 3KO8A 4US1R 2BCVA 5KYNA 1OYOA 1XCPA 2CUZA 2Z4RA 3AO0B 2GYWA 3GEIA 1ZM4A 4MYSA 4NZ9A 4EG0A 2BEVB 4HNTA 4EA6A 1NUQA 1PTKA 2D1YA 1T4CB 2J48A 4OMCA 4BMSA 1G8KA 2WTMA 4PH5A 2QMZA 5J63A 1KDZA 1B8UA 1KC1A 4F06A 2J30A 4QXPA 4YI5A 4FX2A 4YMVA 3TBFA 1FMFA 4R2LA 1JXEA 3JV7A 3LAWA 5JD4A 5DQHA 4HDAA 2O23A 2NV6A 1XZAA 2A1JA 3VKFA 3NHKA 1NZDA 3EYAA 1BRTA 2JL1A 3CUEF 3HA5A 4LRUA 3ULKA 1QMGA 3JW8A 4ZEOA 4QKQA 1JEYA 1L5OA 3NETA 2BMFA 3MTQA 3C6XA 3IQFA 5IM4A 2RGBA 3PE6A 3SEFA 4CLOA 4TLMB 5KUTA 4WNIA 2ZI3A 5J2KA 4XVCA 3HVUA 1SHJA 5D86A 4B4KA 4P98A 2WW8A 3AQIA 4ZXFA 1SL0A 1K9VF 1THTA 2C4VA 1D0SA 2JD2A 1G7CA 3KB8A 4G97A 3ZXUB 1YUMA 4Q1CA 4E51A 2XE7A 2Y1FA 8ICOA 3BYZA 3IERA 4HWTA 3TRIA 2O3UA 5AI5A 3EHEA 4UVDA 4ZOHC 3KE9A 4EGAA 3FPKA 4IUBS 2ZU6A 3U3XA 4IR9A 4ARSA 1V35A 2IY8A 3HWRA 4AP6A 4X92A 2QF7A 1VKZA 1DOHA 3C3JA 4E7PA 4F4JA 4XFKA 7MDHA 2MSWA 1G9TA 3D1LA 3HSYA 4G5OA 4U7DA 5CYGA 1POWA 1RMQA 3A2LA 3OFJA 1ZD2P 3OZ7A 2R8BA 4HQLA 3IPYA 4V0OA 4ZHQF 2QKQA 1XMSA 4JK1A 3AHCA 4AZ3A 1JSCA 1V1JA 3OO0A 4TV9B 3RVQA 1E6MA 4YCMA 3DE6X 3G9TA 3R5KA 4HRAA 1S3IA 2O7RA 2QDKA 4IHQA 2WJ6A 3PWKA 4G0ZA 4LKOA 4PYRA 1IZ8A 1M76A 4YV2A 2A9QA 1D9DA 1ZVQA 4AB1A 3NWOA 4E5VA 5G53C 2Z6QA 1UPBA 2PSSA 3GU3A 1NI3A 5ERGB 5TS2A 5KOHB 2VSOA 1WBDA 4WOJA 2YHIA 4YJ3F 1DZIA 3KKQA 3N58A 2FGJA 3IOCA 4J1NA 3EOAI 1X40A 1TIKA 1P9RA 5T4HA 1JDZA 3O4JA 1YQWA 3X2SA 1DSSG 4Y98A 5F1OA 3OLYA 1OXSC 4K0RA 4PZNA 1VKOA 2FUG1 2ZB3A 1P3DA 2QQEA 4N5NA 3WYDA 1KO7A 1PUIA 2WUDA 3GIJA 5C37A 1XD2A 2BLLA 1E8DA 3PC7A 3NBXX 3CT4A 1U94A 2ICAA 4GH5A 1KVSA 4RVFA 4UMEA 1I3MA 1QTIA 3F1LA 4EL0A 4RCVA 1WP9A 5CUQA 4QGBA 1K86A 4FB5A 4C08A 5JSZB 1ICEA 1GPYA 1EWYA 1TI7A 3Q7RA 4OHUA 1UFOA 4I4IA 1DAHA 3K9HA 4YMNA 1JDNA 2XMCA 3I72A 4D1YA 3RROA 1WS6A 3IUMA 5EZ6B 5JBNA 1ZUNA 1PLKA 1NONA 2GYUA 1P1IA 2AMYA 2WNHA 3MINA 4Q24A 3RJ9A 3MCVA 2E4WA 4LHYA 1IU9A 2ODAA 4BX9A 5KWJA 3KQLA 2P9GA 2UYYA 1JEDA 2L18A 1UDWA 1UQTA 3A6DA 3GHYA 4NCIA 5FTMA 4N8SA 1VBFA 1PFKA 1VMIA 4YR2A 1RYZA 1UPXA 1WXIA 3INTA 1K1QA 2XITA 3RNLA 1JU4A 1QCDA 1YDMA 2C9ZA 2IW1A 4P4SA 1V7PC 4IDGA 3Q8KA 1ANKA 2JAPA 5FL7D 3KCQA 3SEQA 3ZLJA 1P1HA 3B6IA 2E4UA 3A9SA 3F46A 4AULA 2AX3A 2W22A 2PSFA 4PX2A 5HK9A 1LLQA 2H06A 3ZE9A 2G06A 1V8FA 4F5NA 3A70A 3UKOA 1V5EA 3LF2A 5REQA 3DWIA 3UUWA 3ZXIA 4DVJA 3RUCA 2VHWA 2XUQA 3LQ1A 1HT3A 1QVZA 3DKRA 3PXEA 4WY2A 4X9XA 3ZDRA 4ARAA 3FKJA 1HSZA 1JIKA 3IMCA 1COOA 2Z30A 3N07A 2WLSA 4KFRA 1S0VA 3Q98A 8LDHA 3OQIA 4FGZA 1Y6JA 1BPDA 1M7HA 2GFQA 1SUBA 1NJ8A 1UF9A 3G0OA 4MV0A 4F9TA 1N6PA 1L4GA 4FYMA 2WIKA 3H9UA 4KUEA 3FB4A 2EBUA 2I5HA 1RYMA 3O90A 5IEBA 4GVPA 4PC3A 1G7RA 3AFGA 4HNAA 4YR3A 1S0OA 2MDTA 3KZOA 4H31A 2MYNA 1BE1A 1I5OA 2PL9A 2P79A 3L3BA 5FNVF 4RKFA 3FDJA 5ALUA 4LRSB 3E81A 4I4CA 3VR0A 1BVYF 4U5QA 5FULA 3CZ4A 1CEXA 1O54A 2QE7A 3RSZA 3EA5A 3T9EA 3M8RA 4LJSA 3P2MA 4LZWA 1OROA 3E2PA 5EKDA 1PU2A 4PY2A 2DEUA 3HJEA 1NBWB 4QSMA 4UM9B 2RHFA 2DPIA 3INYA 3DOOA 4U2DA 2QTNA 4UMDA 3H9QA 4P54A 3EPPA 4RKQA 5A4AA 1AY0A 3BL8A 3D2CA 1FDUA 5IM5A 2XWSA 3GJ6A 5JBQA 1GT91 4IJ6A 2O2CA 3EVTA 5A1JA 1DC8A 4KXVA 2WJ3A 3ASYA 4IS3A 3D31A 3CX7A 4EI9A 3SC4A 1XDSA 1B23P 2DBRA 3CNNA 2YN4A 2WAXA 2X42A 2IV3A 4F60A 3COPA 4QUEA 1R4MA 4BO2A 3IE1A 4MS4A 4MQBA 3A4TA 2P3LA 4RVDA 1GRNA 2G83A 3HKDA 3II6X 4IJVA 4KAFA 5T6BA 4OI1A 2XEDA 5K03A 1LJ8A 5IJ9A 2DSTA 4B9MA 3CCFA 3EXIA 3LK6A 5ULLA 4K3VA 4JODA 1CF9A 1DO0A 1PK8A 4ED2A 1G63A 4TZ6A 2A1TR 3LMKA 1FFSA 3L3FX 2HLDD 4TTRA 3T9DA 4DIBA 2PKQO 5TQ0A 3HKZF 3DM9B 3JQGA 3Q8LA 1J2JA 2D00A 2ZR7A 3C5VA 1KKLA 3VTZA 3QWIA 4IC9A 3QI7A 4EYEA 1HF3A 4GI3A 4TVKA 1BEUB 1RZRA 5IWCA 4WUTA 4GM4A 2JGFA 1C9NA 4OA8A 4BYGA 5EE0A 2WSLA 1C0IA 2I9PA 3EJ6A 2JEGA 3QMMA 1HX7A 4UDXX 1RAIA 3MMSA 2BEUA 4OGGA 4QGHA 3SSOA 1VCHA 1Q0RA 3KWFA 3FYDA 2VF7A 1QRTA 9ICNA 1GL6A 3NIGB 4G85A 4WKPA 1XLTC 5FV4A 5K01A 5K8CA 4QWMA 1B6TA 5KL8B 1MG0A 2XUOA 1DRGA 2KPOA 4C7OB 2QKYA 3BKXA 5EJ5A 3HCPA 1CQXA 3NHZA 2R1VA 3G2MA 1D4FA 1NW7A 4HRVA 4JHLA 5TQ0B 1K1SA 4LJXA 1E7SA 3R5XA 2QN8A 4IOJA 5DW0A 4D3ZA 3B8HA 5C0OE 4KLTA 5J0RA 1BQEA 3T7AA 2YW2A 8OHMA 2QARA 4ZQHA 3FTEA 2C2WA 2ZJBA 3QYFA 4K9SA 1TZJA 5IXSA 2X1VA 3T7KA 1XPJA 3PX3A 4YMHA 1CRPA 3CSSA 5BSUA 1JB1A 1VLBA 3F6YA 3FDZA 1CYDA 1ECBA 4HPWA 4MR9A 4OO3A 1Q3UA 1EBFA 3TLZA 1TGYA 1YTUA 1GO3F 1WW2A 3D6HA 3C21A 2ZBRA 3FMFA 3LCVB 4F4FA 5HR5A 1LBSA 1WZEA 5P21A 3SV3A 5M5BA 4B9UA 1N5XA 1KYIA 2YY6A 2GERA 3LP8A 3PEFA 1PI3A 1Z2AA 1NRJB 2QTVA 3LVRE 5CRIA 1JX4A 4JOCA 2ERCA 4TWRA 4CMCA 4Z4IA 2O1XA 2CW5A 1TDJA 1JDJA 1M2NA 2FOIA 2O2SA 2HWWA 3QELA 4NBUA 5D7NA 1KP3A 3K1ZA 4KVFA 3WTBA 1RACA 4RT2A 2UZAA 1ZGZA 1AF4A 1L5HB 1Y48E 2IDMA 2IE0A 3O03A 5EE1A 2G6BA 2H1VA 1H2RS 4Q9HA 5BSEA 4I5IA 2P2ZA 5CMLA 1NN5A 2IDZA 1RJGA 2HU2A 2R8IA 3HSSA 4IHJA 5FR1A 5B1HA 5BP7A 2E49A 4UB1A 2A57A 4A6XA 4EHJA 4EY3A 2FJ6A 1CTQA 1XF1A 4KN4A 3ZHRA 3EXFB 4RK0A 5CT9A 2PKXA 4ZV7A 4BJ6A 1WTCA 1DMSA 1VMKA 2EWMA 2GWHA 2HNAA 1KJWA 2ISOA 3H5IA 3GFGA 4TSFD 4IR1A 4MW4A 4Y2HA 2QN7A 3RVLA 5A9TA 4B7UA 4DBLE 2D3WA 1GAXA 2QRQA 1LDEA 1C3XA 1SKYE 3B7WA 4FBLA 3FUVA 4GR5A 2PN1A 4LNAA 5DH9A 4C01A 5HZMA 2PMKA 1JR2A 1OFHA 1KDHA 1T3SA 5AVXA 1I10A 4BMCA 2WM8A 1R8YA 4M9SA 2H9AA 3U3OA 3MGBA 3DMHA 5CPBA 2I7XA 1Q7CA 1NQVA 4JAVC 1S8NA 4F11A 5FL3A 1A97A 4IIYA 4MR8B 2FLNA 1DFIA 2VTVA 3V80A 4DR1B 3W3ZB 1C1DB 1R6AA 2Y8EA 3T5DA 3UGTA 4IAOA 3ZWXA 4HD8A 5BR7A 1T9AA 5CFZA 2NNLD 4QTXA 2H2WA 3MJSA 4P53A 1DARA 3CSUA 5IMBA 1W0JA 3C5EA 2HREA 3DT9A 3AR7A 1E3JA 3KUCA 3JQ8B 2GVZC 3OM1A 5DGDA 2VP5A 3RIXA 1G8AA 4A2WA 4BNDB 2CLSA 2G7ZA 3QXSA 4ZVQA 5H7XA 5P8WA 2VSXA 4R41A 1TAMA 4ZV4A 4I9UA 3TKAA 1UXIA 4KAXA 1XMIA 3EUWA 3CF4A 4NG5A 4O3PA 5EJ6A 2NOAA 4HBGA 4G4SO 1VE1A 3B6MA 1VJCA 4B6FA 2R8EA 3VO2A 2ZR9A 3K9BA 3OJOA 3F67A 4RM3A 4XWAA 3B85A 3GRRA 1ZLYA 2J09A 2AR7A 3FM9A 2HADA 4WJ3B 3B89A 4MEYA 2BE7A 1I0LA 3BWMA 2GCEA 3L7IA 2R2GA 1COZA 5LQJA 3K92A 4L9SA 2G5IB 2CK3D 2DZDA 4RLFA 4JENA 5KJ1A 2NTJA 3DF9A 2UVUA 1ZK1A 1OKKD 2W9CB 2NO4A 1MQSA 5KFLA 3BWDD 4M0DA 4KYTA 2HU5A 4YCAA 1M34E 1JT2A 2W2VA 1K6EA 2OZKA 2WG2A 4JLMA 5ESRA 5F51A 1DFGA 1NVVQ 3HVIA 1ZGGA 2EP5A 2JVJA 2LXNA 4GM0A 2BEUB 4IILA 4KR0A 5G02A 4R69A 3RUAA 3WIUA 3WL7A 1X42A 4UREA 5A4FS 3AVOA 4OHVA 1IN1A 2ZE6A 2BBWA 2KIVA 3MSXA 1AG9A 2YWEA 3TLAA 4F3RA 3HWX1 3P26A 4IRXA 1VXRA 3I4LA 4RK7A 3W8EA 3F2BA 4YXJA 4TKLA 4E70A 8MHTA 3K0SA 1NQXA 1RAGA 2Q99A 4U63A 1ZBDA 1E1KA 3CJTA 2TMDA 2R8OA 2B7CA 4JJ7A 5B12A 4DOMA 1CUSA 4ZI3A 2IEZA 4FLEA 5I4BA 4ZANA 1CX9B 5A6SB 1U4OA 5I4IA 3RIGA 5BN1A 3FPJA 3VJLA 3J81k 2OA0A 2RB5A 3U9LA 3C23A 2NAFA 2WMOB 2G9QA 1P18A 3E3MA 2QARB 1M6VB 4HVAA 1DHTA 5BYBA 3ZDCA 4PG7A 3UW1A 1KEKA 1AKYA 2GTPA 4IMIB 1TJPB 3AHFA 4RJTA 1TKAA 4WVLA 5T67A 1L5HA 4UTRA 2VYVA 3ZHSA 4OF4A 3LGXA 1LDGA 5EKXA 2FFAA 4HSEA 2QG6A 1EM8B 4ZYTA 5DM1A 4JASB 1YFJA 2KN7A 2V7UA 1PNOA 1SQ5A 3OQBA 2ZSUA 4G4JA 3K4QA 2H2AA 5IT5A 4I7EA 2R7KA 2W6MA 1J2MA 2DHDA 2YRXA 3AESB 3CKLA 1VLVA 1GAJA 3LVBA 2E5SA 1PK3A 4FFWA 4FT4A 4BUCA 4DCTA 4BC1A 5L3SA 2R8HA 2ZBDA 2OQVA 5ED0A 3ZS8A 1NYLA 4AZSA 3NVKI 4DFDA 2FP4A 1B0ZA 3HILA 3P9CA 4R54A 5F1YA 4IO0A 2RARA 4E22A 1BWPA 4NK4A 2YXNA 2RHHA 1QVWA 5IKPA 3LWBA 4YT8A 4YRAA 5DTRA 1GXSA 4OD0A 3UKDA 2FPUA 2NVBA 2AJBA 3E1GA 1EBUA 3NJ4A 1CY1A 1QRRA 2NSYA 2ZE7A 2B8JA 3COSA 5J2TB 4X90A 5BSGA 3B3JA 6PFKA 4PPYA 2VBIA 3D7MA 1X9XA 4MLCA 2V9CA 1O0CA 2GT1A 3T95A 2GBPA 2O1EA 4W63A 4XQ0A 1XEAA 3SGLA 1BEEA 4HGYA 5DI3B 3BMOB 1T24A 2HO5A 3EODA 1WU7A 1S4QA 3P9ZA 3BEDA 4HFNA 4N1AA 3RYCA 4GPTA 4DY4A 2CHQA 2HHXA 2O2ZA 3UAGA 2H18A 5G3YA 3LC7O 2HDHA 4MYHA 7ICEA 4QQNA 3E7DA 4WZBA 3H9GA 2Q5FA 5BV1A 1Q0HA 3LXMA 3DEIA 2ZJYA 3OKFA 1JR6A 1SK8A 5FOUA 1H2FA 2CVQA 3ZEAA 2ZBQA 2VRCA 3O8QB 4E5YA 2ORED 1H8ED 2J3HA 3ZE1B 3MCAA 3H6GA 1UC9A 3NXSA 4MI3A 1HM5A 1ZA1A 4J0DA 3TEMA 2XCSB 1J8MF 4ED9A 1PZFA 2KFNA 3FTPA 3JQPA 3KQWA 4CEHA 3UATA 5AYVA 1DC5A 3FPHA 4Y1EA 4O5AA 2I3ZA 5C5CA 2R97A 2Y3IA 5G4KA 2CSUA 1I7LA 2BUAA 3N6RA 1CWUA 1RRFA 1KE2A 4GLFA 4A91A 3EPJA 1JAXA 3GH1A 4GKAA 1VKHA 2QPOA 4XUSA 2QUBA 3L6EA 4DRXA 1WO8A 7ICRA 4BQNA 4JYPA 2XQKA 3RSCA 3ZDXB 4OJMX 4NEQA 3IKVA 1X9HA 1EFKA 5BQPA 4QIWC 5KQGA 5DV9A 2I99A 4EA9A 3PHBE 1U9IC 1XDWA 5HIMA 3RRMA 4GI7A 3A11A 5TPWA 2FCRA 2GTHA 4GX2A 3W4IA 1PS8A 5F5LA 4DEYA 3KC2A 3MGHA 2L69A 4LJYA 3NS1A 4CKCB 3VKVA 4JOBA 3P2YA 1PAUA 3AUKA 1AROP 3G5LA 3SE7A 2FR1A 5H2FU 3IIKA 1Y3HA 1GRVA 2WLTA 4RQMA 1U7TA 3AG6A 5JAIA 5KDOA 3EWIA 3RFUA 2YDYA 5GV7A 3OEYA 3JYLA 4KE6A 1MRZA 3IKLA 4C3UA 4L2IB 3AFNA 1DMRA 4MWBA 4TMVA 1SUSA 1GQSA 2NZVG 3M5DA 4LEIA 4IQWA 1MOQA 5ILGA 5C7IO 3BMNA 2F9FA 2R85A 3JY6A 2FEOA 3WYCA 1FA9A 3NHYA 4EG6A 3T7SA 4ZK6A 5ETJA 2QZJA 3Q0EA 1V8OA 1HT0A 3WGVA 4EFMA 2A3VA 3ZJYA 4QTYA 1JFLA 1WZNA 5J8YC 4M0LA 3VTAA 4MICA 3CSDA 3DE7X 1TJ4A 2GKSA 4L08A 3T54A 4CVNA 3ZS9A 2JDIA 4A0FA 2RE8A 3OU7A 5G3ZA 1NBME 4MVYA 1N6RA 3IV7A 4NHEA 1RYUA 4G3IA 3JYOA 3ND9A 4X1YB 1KQFA 1IMJA 2JJ1D 1AZTA 4OQQA 3ON5A 4AUEA 4C4RA 1JEJA 1X7WA 3VUFA 2WKQA 3GDOA 5IUJC 3FDZB 2IBSA 3S2FA 3FPEA 2P5SA 1M2FA 2KOBA 2IYNA 4PYOA 3TTWA 1JFFA 4CG2A 5ALZA 4EHKA 5D3QA 4B44A 4KR9A 2F3UA 2XSZD 2C07A 3QPUA 4LHZA 2A1IA 4H1WA 4QREA 1YDGA 4EATA 4YJ3B 2AZDA 2ZPTX 3MGAA 3Q5EA 3S1AA 4G0MA 1ZSVA 2KM1A 4LOAA 5IVHA 3CUUA 2GYVA 3IULA 1T5HX 1JZSA 1PT5A 1ZI8A 1Z68A 3DTVB 4KIWA 4ZOEA 5LZ4A 3U7IA 4DCPA 2BEWA 3I0NA 4E5PA 2NU7A 3TMAA 5DNAA 1QIFA 5JYEA 4P3OA 1ONPA 2Y6VA 1LK7A 4CF6A 4E0DA 5C8ZA 3RC2A 1F2VA 3UXNA 5KG5A 2ZTLA 3D5EA 3HFSA 4R8LA 5F21A 4F8JA 5J2AA 5EA2A 4BRSA 2ATLA 1RXSA 2I6GA 4YRCA 4UUAA 3WK6A 2V45A 2VRWA 3G2KA 5DNWA 1SVWA 3FHCB 4N54A 2AN3A 4ZOLB 2V74B 2AI3A 4PV7A 2I3DA 2BZ1A 4N3BA 2MR5A 2OFPA 5ERXA 1DINA 1LSUA 1FS4A 1L5YA 2EZUA 5AHOA 2C5SA 4DCUA 2VAVA 3L8YA 5LPNA 1NK5A 3SLKA 1S1MA 3LD9A 4TVSA 2O5RA 3TXXA 1D5WA 4XA8A 3ROPA 3C8MA 5HXAA 1UKEA 5JAZA 5FJIA 1K0UA 4UFPA 4EQZA 5AVUA 2QMYA 5ICMA 3DL4A 1ZK0A 3R41A 2JJYA 3F2VA 3H0LB 3RUEA 5HKKD 1CHNA 1HFKA 1N4AA 4EWLA 3OWHA 4Q0MA 1P4HA 4WY5A 2KBFA 3DZCA 3DXXA 3GA7A 2PI5A 1RM5A 2OC9A 1L5KA 3V2IA 3IHWA 1EX7A 4S05A 1L3BA 4PYKA 1I4WA 5BNIA 2JLVA 3K15A 1WYGA 4O3OA 3BQ9A 4LE2A 3AGPA 1HEYA 1T0PA 4YLEA 1K7CA 3VAYA 4RTQA 4TRRA 4HPXB 4QZGA 4HI0E 3T5MA 4G1CA 1X87A 4DL9A 2VHTA 4UQPA 1PL7A 2MU1A 2WM3A 1KERA 2LCFA 5CCEA 2JFQA 5GTHU 3F7TA 2OBMA 1WEHA 1BVSA 3RH4A 1DAFA 1Z19A 2GXUA 3I4CA 3L6UA 4C7VA 3W8DA 4RSMA 1K7EB 3NYWA 1W73A 4GYYA 4ZOLF 2D4HA 2F1KA 3HG7A 3PQ6A 4GR4A 4QOSA 2CVHA 2BFMA 1O58A 5LBIA 1TT5B 4Q01A 4WKGA 5SYAA 2VL7A 4G65A 3WA6A 3ZDEA 5H9VA 1AX9A 4DEZA 1ISFA 1FXUA 1MJ5A 1S2MA 3N75A 4QBKA 4EHAA 2IXEA 2PGOA 3CZ5A 4FFPA 4RYDA 5F3WB 1GCOA 3LPCA 1JA1A 1W4ZA 1M74A 3ZXXA 4E15A 2PE5A 5C4GB 1KAGA 3CUSA 1Y5MA 4H3VA 4YDSA 3W6OA 1XQVA 2JIMA 3ESBA 2QSZA 4JL5A 3RI3A 4B76A 3URKA 1F7VA 3EGEA 2WYIA 3BHMA 3TPFA 1QP0A 2NU9B 5KFFA 1E7QA 1U9IA 3O8OA 3PI6A 3I6MA 2NUPB 3RUFA 2QYHA 3PUYA 5IF9A 2WFAA 3OJWA 2R47A 4UNQA 1FE8A 3AMVA 1CEQA 1U2RA 1O8CA 2Q8NA 2YUIA 5HF8A 3TW6A 1GNTA 1L5MA 1T6XA 4HNSA 5HIJA 1ILWA 1DEKA 4YMGA 3B0YA 2IHJA 3KR1A 1K6MA 3RYTC 5EYPB 2JBHA 1L4BA 2H4FA 2EEZA 1BGVA 5J1TB 2J0QA 3IHQB 4N7RA 4HX5A 1XQ6A 1US8A 2QG9A 4WXPA 5GP1A 3GDGA 3OIUA 3OBIA 3VR2D 4ZI7A 1XAGA 1SHKA 4NZYA 2XDQA 2QS9A 4CM9A 1TW3A 4ZTBA 7ABPA 1FLVA 2MUTA 1KQOA 3GFRA 3BOSA 4DQKA 1GUBA 1URPA 4DUPA 3K6RA 4LQLA 1NK6A 1UBTS 1GPWB 3D4NA 1FYVA 5E1MA 1P73A 3LYUA 4QTTB 1ZQJA 3GJSA 4B3MB 3NZEA 1DIAA 3JWGA 1T29A 1NYRA 2H5EA 1KFTA 8ICRA 4WLVA 1PR3A 1Y6QA 3DAPA 5HFAA 3NATA 5A0TA 1PR5A 4OO1J 2PV7A 1XXHA 3IP1A 4L27A 1XTKA 4CL2A 3UVEA 1Z5ZA 3KG2A 1HDIA 4U5XA 3WBFA 5CM8B 2D5BA 3SX2A 6ABPA 3OQHA 4FZNA 4RPGA 5CLIA 1XQWA 5HKAA 1Y6GA 2G9VA 3C43A 3CLVA 4CTKA 4LBZA 3IJEB 3B5IA 1TE2A 3PT9A 2C3OA 4MVJP 3DDNA 4RQAA 4Y7CA 4OLFA 1TJ5A 5BWMA 2XTZA 1OV6A 2X7JA 4KXXA 4ZYUA 4H3SA 1N6NA 3TUJC 1CUKA 1I4EB 4P7BA 5B58T 4NZOA 221PA 3OPYA 3HN2A 4HGZA 2EKZA 3I32A 3IMKA 5JCJA 1N60A 3RNOA 1FS6A 1WF3A 3P2IA 5COBA 4QOEA 3E58A 4OCZA 3MD9A 2BGGA 1ZU4A 2NYVA 3K1RB 1PD0A 1AQYA 2WV9A 2VWGA 5L7WA 1ZLXA 1F4LA 4OM7A 3E1KA 2AFIB 4PXSA 5IZ4A 4AYXA 2PD6A 4PQGA 2XRMA 1JXQA 1FJ2A 3ZHZA 5MN6A 4G5QA 4AT1A 3VR6D 3QPVA 4O4JF 1AS3A 1G6HA 2QU8A 3QI2A 5IFKA 3QBJA 3VPGA 5EIEA 1LLDA 1J1ZA 2NN3C 2HDOA 2JXJA 2R6ZA 3PI7A 2V8BA 4XJTA 3EXHB 2J4CA 4JOSA 5C32A 3ROZA 2J3MA 4PLPA 1QLJA 1X8XA 2COEA 1KK2A 1R0LA 3F7NA 4HH0A 4NMWA 2CLHB 3KQQA 5AESA 4BIMA 2BUBA 4DSTA 3KYBA 2F6RA 3TPCA 3QX9A 4FS2A 1HV8A 4X41A 4FMCF 3UK2A 4X24A 3PW4A 3C3XA 4MDHA 3JQ7B 3ZKWB 2G70A 3MUFA 4RZHA 1L3VA 2YV4A 3B36A 3ZX4A 3AP2A 2F4VB 1G19A 1Y1QA 3CGWA 1W44A 4P34A 1L7RA 5EP1A 4M2LA 1YQDA 2WTXA 3R0VA 3QUTA 3QVGA 4U0JA 5FP0A 3OAAA 4ZYLA 2FDRA 5T8KC 3TQSA 4ZU3A 3SEIA 3ELWA 3NQ41 1EDZA 4ZZ3A 3KPVA 5JWRA 1QC5A 1CQJA 2JFYA 2VPIA 1V9SA 1Z0DA 3H6KA 4C7XA 1ADFA 1IPFA 5A62A 3ZDQA 1CQWA 2PYDA 4G4SP 3QXGA 3L41A 4GMHA 3SQWA 5FX2A 1TM4E 1P7DA 4IIGA 5B4TA 1XZQA 6GPBA 1N5LA 4DIOA 2MINB 3NHMA 3SCZA 3J81A 1B8VA 4ZC8A 5L3QB 2CXOA 4KIFA 4BKMA 4E1AA 1W7AA 5JS2A 2ECQA 3CLTD 4AY6A 2HJSA 3ETRA 3PUHA 1T0HB 1VLLA 2QYOA 4Q3AA 4RGVA 5KQPA 1RCFA 1A72A 3E3LA 1QVVA 2WAQC 3VSCA 3EZFA 3QM1A 2AH5A 2WWRA 3N7SC 5EVCA 3UCFA 5DM4A 1G6OA 4KOEC 2FFBA 2QD5A 2EHDA 2VXYA 2IGBA 1SKBA 1H1LB 3DPSA 3LTEA 3NAMA 1KOFA 4HLUA 5E7QA 1YFLA 5CR0A 1YV9A 1EFAA 2HSJA 2VJCA 2PH1A 2WUGA 3Q4GA 3P27A 3I53A 3M6KA 2E2WA 5FHQA 2IXBA 4XRGA 1RNLA 1RQ2A 1U6KA 4GZ3A 1PEKE 1FNNA 4GSYA 1LBIA 3TL3A 1JEOA 1TAQA 2KLHA 1T1IA 3HZHA 3OOSA 1YVEI 4EF5A 5DU2A 3TOXA 4OK5A 4LS3A 4MKGA 3O75A 1P1RA 4E32A 1OX6A 1DTEA 3TECE 4R2HA 4OHRA 1K06A 4JSYA 2LGJA 1Q57A 4F72A 4JP8A 3D6UA 5KC9A 3BZCA 1D2EA 5KYYB 2GH1A 2W5UA 1RWVA 4DIMA 1LSOA 2BHTA 2P62A 5AJZA 3HVJA 4UOEA 3HFJA 4TMKA 1EX9A 2FPPB 3PCTA 5D00A 3DZBA 1J7JA 1UK8A 2G8NA 5FUWA 5C46F 3DMDA 2FSIA 3STHA 3GAZA 1H1TA 1KI6B 4V0QA 1OYVA 2DH5A 3TM5A 1IK4A 1NJGA 1T8RA 2Q3EA 2MRLA 2PFNA 2P11A 3IAUA 5J0XA 3RW9A 3T5TA 3WHKA 2AVNA 4G24A 4MGHA 2ESEA 3D7KA 4MK4A 5LQDA 1LA2A 4O4IF 4AX4A 2AGQA 2FKNA 4DXDA 5KFUA 2V6FA 4UUMA 2Y9UA 4DJAA 2LWIA 3PR3A 4HADA 1E0DA 5LWQA 1D7OA 1T25A 1BDIA 5KVCA 4JI0B 1DOZA 3ZYCA 3QSGA 3G88A 4CHGA 4F4XA 4UPEA 2N0SA 4F1KA 2AB0A 1YRAA 4UOZA 4L8FA 2J87A 4EUKA 1C7RA 2QVBA 4PX9A 1EVLA 2Z3ZA 5BUCA 4O08A 4EW6A 4BP8A 5KMGB 3KFXA 2ZJ8A 3JYQA 4AJ2A 4M88A 4UB4A 1GRRA 1W5AA 1X7DA 3AM5A 3J7TA 3P9XA 1X66A 1Z37A 5A5FA 2IYQA 2W3RA 2M2IA 3GT4A 2LKCA 3INGA 4RVNA 5BN4A 5KG4A 3N3AC 3G6XA 3UO8B 2CJYA 2ZITA 1GHTA 2RIRA 1KIFA 1QZXA 1QTMA 1FP6A 5FTKA 3F98A 2XLCA 3PE3A