4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
4FYPA 1QH9A 4FFDA 3ZW7A 3U7EB 3L8FA 4YCMA 3B9RA 4J03A 4QQFA 3QXGA 3WKDA 4L57A 1YV9A 1SWVA 2HF7A 4UATA 4Y2TA 1RRCA 5AVWA 1Z4OA 2HSZA 5T41A 4C4RA 4J2TA 2YMPA 3AR7A 2GHQA 2WF7A 4YCLA 3N07A 3U7FB 4YIKA 4RESA 2YJ5A 3WKCA 2HHLA 3S6JA 3QNMA 5AVYA 3SKXA 2IYEA 2NO4A 2YBDA 5AKZA 3HLTA 4UMDA 5IT4A 3CZ4A 2IOFA 4GIBA 4OFZA 3OTQA 3L8GA 4KNVA 1L7NA 3KBBA 2ZOSA 3QU9A 2IOHA 5AI9A 1RDFA 1TJ4A 2CFTA 1Q91A 5AI5A 3QU2A 1T5TA 2ZG6A 4YIHA 5AVVA 5AKYA 3NALA 3KD3A 5AIAA 1Z4MA 1WR8A 5AW3A 3UMGA 1XP5A 2MU1A 3DV9A 1RLMA 3CNHA 1EK2A 2JAUA 3RFUA 5AM0A 2R8EA 5AM2A 4KNWA 3PCTA 3AR3A 5ALOA 2MSNA 2EATA 3M9LA 3NAMA 3ZVLA 3NANA 3EWIA 4UMFA 5AW9A 4BEVA 1WVIA 4ZEXA 2O9JA 4UU0A 3IB6A 2Q4TA 4HGRA 3FZQA 4HGNA 4OD0A 5AM4A 3BA6A 1XPJA 3N1UA 3SHQA 4KYTA 1ZD5A 3OCWA 1L8LA 1F5SA 2R8XA 2IOFK 5ALTA 3PGLA 4BX3A 3AR8A 4DCCA 2D2VA 3OCUA 3AR5A 1U7PA 1S2OA 2B0CA 4C4TA 5AKXA 3IJ5A 5AK5A 3BWVA 2OM6A 1RKQA 3W5BA 1YS9A 1U02A 4BBJA 3L1VA 4Y2PA 2C8KA 2PR7A 5AI0A 4F72A 2JAWA 1S8OA 3NRJA 5ALXA 2AGVA 1RQLA 3DAOA 3FPBA 2Q5EA 3WK5A 5AKJA 3EF0A 2YJ4A 2O2XA 4ZEWA 4OCZA 4C4SA 2FUEA 4Y2VA 3QU7A 2YMQA 1K1EA 2QLTA 1L8OA 5ALFA 4EENA 4Y2QA 1WZCA 3R09A 2HI0A 1Q92A 4HAIA 2I6XA 3A1DA 2CFRA 1YMQA 3L0BA 2YFYA 4ZEVA 3W5AA 5AKKA 5ALMA 4BKMA 5AW2A 1NF2A 4Y2UA 3IRUA 2PQ0A 1CQZA 1RKVA 2NO5A 3B8EA 4E88A 4H1WA 1SU4A 5ALKA 2BY4A 4IFTA 4QJBA 3FVVA 5ALHA 1RC8A 4G63A 3ZTWA 5AW0A 1CR6A 4XE5A 1RMYA 1Z4LA 3KOOA 3UM9A 3I1YA 3L1UA 2FDRA 2AMYA 2P9JA 4CNQA 5AK6A 3FM9A 2RARA 5ALNA 3EPRA 3ONNA 1U2TA 4EX6A 1NNLA 4JB3A 2Q4RA 2FPSA 3ZUPA 4GXTA 3KC2A 2PKEA 2B30A 2P69A 5AI6A 4UM7A 2FI1A 4BX0A 2OYCA 5ALVA 3B9BA 3NASA 5AW4A 3OCZA 1X42A 5AM1A 3MC1A 1RLTA 2W4MA 5ALLA 2FPUA 4PNHA 3ZU6A 5AHXA 5ALGA 4KN8A 3MPOA 5AM3A 1Z4NA 1ZRNA 1Z4JA 2GHTA 2EAUA 4OHFA 4BNDA 5AKLA 4EELA 1JUDA 5ALEA 2ODAA 5A3QA 2I34A 3WK6A 1Z88A 2JAOA 5FP0A 2OBBA 3QLEA 4FE3A 3KZXA 4HGOA 2C4NA 2I7DA 2OA0A 1Z4IA 3OCVA 4XPZA 3WKAA 2NYVA 2G08A 2GFHA 5AVZA 3MMZA 1L7PA 2B8JA 1Z5UA 2BDUA 4IG4A 4JDPA 2WFAA 3WKEA 2ZBFA 1Z4KA 3SMVA 2YN4A 5A3RA 1ZD2P 2WF6A 3W5DA 3L0YA 2YMMA 2FPXA 3L0CA 4BYGA 4MWOA 1ZJJA 2G09A 3U13A 3N5KA 4UU1A 4AP9A 5AVRA 3QUTA 3KDPA 4BEWA 5AK4A 5AKEA 3UMBA 2WF9A 2C8LA 1RMQA 3U19A 2ZBGA 5AI8A 4YCNA 3MN1A 1T5SA 2B1RA 1TJ5A 1QQ5A 1LTQA 5IS2A 3SF0A 3QGMA 3K1ZA 3QUBA 1PW5A 4I9GA 1AQ6A 2IA5A 3M1YA 5ALQA 2GO7A 3SKYA 2FPWA 2YMLA 1T9ZA 4HYTA 3ET4A 5AKHA 5ALRA 2B1QA 3FPSA 3NIWA 2P27A 4CF5A 4L6AA 3QU5A 5ALDA 5AESA 4RETA 1FEZA 2RAVA 5AW1A 5AKGA 3SLRA 4Y2XA 4L6CA 4G9BA 4Y2YA 2C9MA 2AUTA 3WK4A 1TA0A 1Z4PX 4AS2A 3PDWA 1L7OA 1ZOLA 3N28A 2EARA 2R8YA 2ZBEA 3F9RA 1RLOA 2RBKA 2G80A 3E81A 2I55A 2HDOA 1ZS9A 2ZXEA 3ZTYA 3E8MA 2ZBDA 2HCFA 1Z4QA 4CF3A 4B6JA 1VJRA 1N8NA 4DFDA 2G07A 1LVHA 3OCYA 2I33A 3A1CA 4UMEA 5AKIA 5AI4A 5IT0A 3OCXA 4NV0A 4UMVA 3E58A 3WGVA 1WPGA 3FGOA 1VFPA 3NUQA 3ZVNA 2YJ6A 3WK9A 3ESRA 1RQNA 1Z5GA 4HGQA 1XVIA 1SWWA 1O03A 5AW7A 1RPZA 3ZVMA 2HO4A 3L7YA 4Y2JA 2JARA 3AR9A 1EK1A 5AVTA 4DWOA 3L5KA 3R9KA 2HF2A 2YJ3A 1J8DA 4I9FA 3AR4A 4MUMA 2WF5A 4UM5A 4CF4A 5AW6A 2W43A 3L8EA 4YH1A 2JGAA 4F71A 2WM8A 4AS3A 2HEGA 1YNSA 3A1EA 3QYPA 5AICA 3R4CA 4NAVA 5AVQA 3W5CA 4DW8A 3QU4A 2W11A 3WKBA 3U26A 1U2SA 3ZX4A 1J97A 3QUCA 4KX3A 3AR2A 1TE2A 4UAVA 1YJ5A 5AW8A 5ALJA 1RMTA 2FUCA 3E84A 5ALIA 4Y2RA 3ESQA 3J7TA 3ZI4A 4UAUA 2P11A 1L6RA 3EF1A 5AW5A 3VAYA 2AH5A 5AVUA 3I76A 4XOUA 2X4DA 3PGVA 4Y3UA 4XQ0A 1QYIA 1QQ6A 2VKQA 2WF8A 3QUQA 3ZX5A 2G06A 4BNDB 1MH9A 5ALPA 2B8EA 2CFSA 4NWIA 4Y2SA 4UW9A 3A3YA 3UMCA 2RB5A 3DDHA 1U7OA 1Y8AA 3L8HA 1KYTA 3D6JA 3WK7A 3GYGA 3ET5A 5AK3A 1TJ3A 3WK8A 3P96A 4YGYA 3ED5A 5ALSA 2I54A 4NABA 1N9KA 2HX1A 1YDFA 2FEAA 5AM5A 3ZWKA 2HOQA 4UASA 4BX2A 3OPXA 3AR6A 2C88A 4UARA 4EX7A 2GMWA 3ZWDA 1L7MA 1O08A 5ALWA 1VJ5A 5ALYA 2WHEA 3WGUA 4CE6A 3RF6A 4NFLA 5AVXA 4EEKA 2YY6A 1RKUA 1QQ7A 1ZD4A 4EZEA 3U7HB 3I28A 2FPRA 3DNPA 1NRWA 4KX5A 2DQSA 3TLMA 1ZRMA 5JJBA 3U7GA 5AIBA 5AVSA 3N8GA 2MU2A 2G0AA 5A3SA 3SD7A 2G1AA 2B82A 2R8ZA 2QYHA 5E0OA 3QX7A 1ZD3A 5ALZA 3I6BA 2CN1A 2BDEA 4O8CA 4HGPA 3HYCA 5ALUA 1IWOA
chains in the Genus database with same CATH superfamily
1GTL1 4I29A 2GZ2A 3PVXA 4J03A 1Z7GA 4X93A 4TS9A 4ZALA 5E2IA 4BVFA 1KR5A 4P34A 3ITDA 2H1LA 1UBGA 2HJ9A 1WOMA 3RVOA 2HHHB 5JRZA 2XLCA 5HKOA 1YONA 2I22A 1BDJA 3GAMA 5DBGA 3PHBE 2X76A 1AD2A 1DBWA 4R31A 4J9VA 5BWMA 3DMGA 4UFPA 3T5JA 3GV0A 2ORVA 1U2PA 1T4GA 2I91A 3AIMA 4TUSA 4OBXA 4L2IB 1VPEA 3E5NA 3F3KA 4EKNB 2KG5A 3GRRA 3M9XA 4GYKA 2DHDA 4KWCA 3CPHA 1XDWA 3HPOA 4YR7A 1Z13A 1RAGA 1OVMA 4BNVA 4YO8A 1EFAA 5E6RB 5AKJA 5M7EA 2Q5JA 1H3FA 3OOHA 2V9CA 3Q8MA 4BWJA 1NN3A 3L8ZA 3GMDA 4DDMA 1VSBA 4ED3A 3ND6A 4TKLA 3H0CA 5KOHA 4JODA 1T10A 4K7JA 2X0FA 1E4VA 3K9CA 4FO6A 1ECLA 4RADA 5ECGC 2AXTU 1XQWA 4ZOQI 3DBHA 1PT5A 5LIRA 1IEQA 4HADA 4NYJR 5LQKA 3H4TA 3FM9A 4PC1A 4DFJA 2QZZA 1CUYA 4LGMA 4M1KA 4ZO4A 1RYRA 3R3UA 4G1BA 3PC4A 4IHJF 4PM4A 4NENA 3A2LA 1XMVA 3NEAA 2OE2A 1PK7A 2HIHA 2ZXFA 4DNOA 5L95A 5EWJA 4CKYA 1EXVA 2ZI5A 2VUSA 1WW8A 3H99A 4DM7A 5JW6A 1SIOA 4UULA 1LA2A 1QTRA 5DXAA 2OFFA 4WJLA 1PL6A 2PMDA 2WHPB 1ZJNA 2NM0A 3RVMA 4PS1A 4XIIA 1QFXA 4C20A 5TY0A 2W2OA 5DXJA 3A8TA 3CE9A 4S12A 5CCBA 1CB7A 3V32A 3RRZA 1RQXA 1ZJJA 2BDTA 5JVDF 1Z6YA 5KHOC 3CZQA 1LTHR 2XUFA 1VB3A 3IG5A 2IYLD 4AZ3A 3W3AH 1N63A 3D9QX 4URUR 4QX6A 2BGNA 5CB1A 4GVPA 2PT5A 3GAZA 2YZNA 5LZ4A 3ONEA 3T9EA 5EJ5A 4RVOA 3KCNA 3M1YA 2NZ8A 3H5OA 5K4HA 1QM5A 2FPWA 3VR4H 4KLQA 2M6LA 2C03A 2P35A 1JU3A 4L6AA 3RR8A 3TBHA 2JEZA 4I50A 1OBCA 1NNEA 5JU6A 4FLFA 4EHLA 1XCJA 4C7MA 3JQFC 4HYQA 4O3QA 4JOBA 4RS3A 3WLRA 1AK1A 4B6JA 1E4EA 4EI2A 4NV1A 1QO0D 3TI7A 1FRQA 1XXHA 4PAWA 1KSHA 4PLYA 4BFSA 5IT5A 3VKVA 3FVWA 3BQ2A 1UBEA 3FI9A 1L5RA 4HUQA 3CS3A 2PKWA 5B3JC 1B6TA 4H7IA 3QUAA 3M7IA 5AW6A 2LM1A 2X9GA 2XY6A 2WTFA 4PZ9A 4EBCA 4P98A 2VJ5A 1Y1TA 1Y9JA 2IHBA 5KYUA 2OY0A 1RABA 3PO5A 5HJ5A 1OPRA 1WJGA 4QLBA 4BNYA 5T6BA 1HO3A 4EJSB 2WLSA 1WQ1R 3I76A 1E5XA 4NESA 2HHJA 4PQYA 2FFHA 2BT4A 2QGFA 2H57A 2AJDA 2V6IA 4TS3A 4HL6A 3HO8A 2TECE 4OJOA 3IP3A 1BQ4A 1D8TA 3B70A 3BQ1A 5C8DA 4D6XA 4JI8B 5IX8A 3SPXA 1OREA 4XJVA 3BTUA 2RJ3A 4TTIA 4P54A 3TEJA 4E94A 4FBGA 4FNGA 3ZKWA 2BFPA 3ENKA 4UDXX 4B3XA 1S5LU 1MIHA 4YVFA 2V4ZA 3G7NA 4PBTA 3NFRA 4KQ1A 2OGZA 1VLHA 4X7RA 1YVRA 3HKZC 4DG5A 5T8KA 3FSGA 1ARZA 4G4JA 2R1VB 5DLEA 3GFSA 2OHJA 3GLFE 3KSDO 3L46A 4M53A 3O3MB 1FK8A 1CS4C 2V7PA 3T15A 5KFGA 3Q7PA 1ZK2A 4OQFA 1IIPA 3C6XA 1LKZA 5DYGA 4F2GA 3A1VA 3VYTB 1PUZA 1ORVA 3PE6A 4HG2A 3E1KA 4LZZA 3VR0A 1N0HA 4KPFC 3V80A 2L5YA 1LBTA 1OFIA 3GZNB 2DQKA 4GZ5A 3RHTA 3HKCB 4RSGA 1I6WA 3KD2A 5FWAA 3H7IA 4NOLA 4RF4A 4BO6A 5CPFA 5JH7F 3NHLA 3EVGA 4H17A 3OOYA 4I4TF 4NM1A 2WD7B 1DC5A 2R66A 4F5DA 2HZBA 4D8YA 5LYJB 3R9WA 1IPHA 2WJIA 3QBTA 3B2NA 2WSYB 2OORA 1BD3A 2P0YA 1KFEB 1Y88A 5CBPB 4HBZA 1S0MA 1XZPA 1ODJA 2AI1A 2IYNA 4LIPD 3UXMA 1ZK1A 4JUFA 2QLTA 4PXAA 1QWSA 1ZH4A 4HOYA 4PCAA 4DUYB 3L0BA 3NC4A 3QVXA 3EVFA 5L4LA 1TOAA 1Y8CA 4CLOB 2WHXA 2VDMB 3K6SB 1W48A 3KE8A 4RA6B 3LO8A 1FTQA 1ACMA 3DP9A 2VK8A 1QRDA 1MAAA 3PYMA 2OCIA 4KN6A 2Z1NA 3BYZA 4WZAB 3WXMA 1CEEA 4RQ0A 4EYKA 1RI2A 4PX9A 1FTYA 2PX6A 4RPYA 4H0FA 4YRTA 1T9KA 1WMAA 2JF0A 3V4PB 3ZY4A 4BJ5A 2V6FA 3MTIA 1VCOA 3DLBA 4KQFA 1V3TA 2OBBA 5EKSA 1TCCA 8ICTA 1SU7A 5F1OA 3DF7A 5CDSA 2CV2A 3C16C 1PWXA 3KWLA 1NYQA 4GM0A 2YXBA 4L8FA 2ZBFA 4LDAA 5E3IA 1M5UA 3W5DA 4IX9A 1JLHA 1KFKB 2WQ6A 1CY0A 5JD3A 3V8MA 4FYIA 4C04A 1B16A 1J8QA 1PJ2A 5C34B 4K87A 1SRRA 3O84A 3EASA 1KXZA 4I9UA 3VTKA 3FTFA 3F9CA 4U7WA 1ZXLA 1E9CA 2V5UA 2V7EA 4CLXA 2CL5A 1IV8A 1NXQA 3GP5A 5KOJA 4DV1B 2KOBA 1RXVA 2AZDA 4G1UC 1P73A 3B2EA 4KLIA 3SCZA 3WMGA 2Q8QA 2RI0A 3KQWA 4OGKA 2O52A 3C5FA 3KXLA 4JI1B 3A6KA 1NRJB 1PSWA 1VOTA 3BGDA 3MIIA 3EX7C 3VGPA 5K0BA 4QVIA 3ACBA 4H6XA 3NBZC 2Y1LA 1YTUA 2V7UA 4G37A 3LF2A 4FX2A 5KFDA 3UWPA 4PYOA 4QAJA 2PANA 3DTYA 3L0DA 2IXBA 4U6NA 4DQXA 3G9ZA 3V7FA 1MN6A 1LS1A 4L4SA 4O5EA 1V7PC 2YJ3A 4TV8B 3SQNA 3O8OA 5LSAA 3H4BA 1YNSA 3H5RA 5BUQA 3A25A 3AHFA 3CNBA 9ICTA 5G2OA 4X6UA 5JCJD 2FG7C 3FYCA 5HEKA 2XODA 2OZEA 2BKAA 5JAPA 1A9SA 1WUYA 2AH5A 1E1CB 1DAHA 3A6GA 5BSMA 4F3YA 2XA2A 5ALPA 2CFSA 3V6KA 4ZJPA 4DY6A 1Y8AA 2MSCB 3L84A 1JVNA 4IIJF 1L4MA 5ARBA 5BSTA 4HNVA 5D3KA 2DPIA 5A4AA 3MT9A 4GZ3A 2D2FA 4XWAA 5SYNA 3QJGA 5IDQA 1E1RA 3CLRC 5ALYA 2FR8C 2M9NA 3RK4A 2YYYA 4D8UA 5CJ7A 3UGTA 2YY6A 5DGTA 3KQPA 3SICE 5AD1A 1GPH1 5TQJA 2PT6A 2ZSUA 2ERCA 4DMLA 4E2XA 2K4IA 3PT5A 1DSSG 3QG5A 3B9RA 4R1LA 3BL8A 2QGNA 2Q6LA 1D2AA 1JFFB 4P0TA 4HLUA 5FBZA 3VBCA 3PKIA 4CUZA 3N53A 1SH7A 3F4KA 4WDRA 1YVDA 4QWEA 3HN7A 4PSCA 3L4SO 4U6PA 2J0UB 2ZRJA 1BWRA 4JB8A 1C3EA 4DJAA 3G9QA 4CM9D 3DFFA 1TJPB 3NXKA 3QV1A 3P26A 2XYVA 4YCBA 3QF4B 4EG1A 3FIJA 3WLFA 4O5OA 1XHFA 5DI3B 1HE5A 4KXFB 4KAJA 5J4KA 1XN4A 1Y0BA 4HAYA 2JRZA 3LUHA 3GGDA 3GIKA 1AMNA 3C3MA 4CIWA 4M88A 4A0SA 2BP7B 4MRSA 3UJ3X 4LXHA 1QP4A 1GYPA 4N5DA 1F4LA 4RIFA 3UPTA 2JJYA 2XRFA 1ZUIA 2MYTA 1HV8A 3OPYA 1NXTA 1TTQB 3JPYA 1T1JA 3DE1X 2PQ0A 1U5AA 3KVNA 1E9FA 4F1JA 1VG9B 5MHTA 1LVUA 2X1MA 3EXHA 1ZU5A 1GZ5A 1ZONA 4EX6A 1SKUA 3MTQA 3BRSA 3KOMA 1EX1A 3ZBPA 4US9A 3I5XA 3IDQA 1SQ6A 1RZTA 1MSWD 1PU2A 3MOSA 3D81A 4LYHA 2CD9A 1NTOA 3JRXA 3HP1A 3TKLA 4GC7A 4FJ2A 4BJ6A 5K09A 4MVJF 3G6YA 3SC4A 3GIJA 2XVMA 2OUIA 3OF5A 1AB5A 3JPSA 1H66A 2K8CB 3EIEA 1GCOA 1H4TA 3V7NA 2XXJA 3FLMA 4TT3A 1MOSA 5KYNA 3OEED 2E82A 2O5VA 4BNKA 5P8WA 4LJRA 4BGEA 2IP2A 2ZYHA 2HMTA 2V65A 1BHJA 2WIBA 2BR0A 1XNHA 3FTPA 5GIPE 4UC0A 1X8JA 3K1AA 2ZTLA 4UHBA 1FBTA 4PSVA 1M8PA 3TSAA 3UY4A 2ZXEA 3LUPA 3GFFA 4M60A 3GBSA 4KGVA 3ZWWA 2E5SA 1LBEA 1O58A 3FH0A 4UNNA 2FN8A 1LK0A 1E69A 3HB9A 3ZEAA 3JWEA 3H9GA 3B1ZA 3SZMA 1SU6A 2OHIA 5EJFA 2QR5A 3U44B 1ZA2A 1PQWA 5CT6A 1X1EA 3H7AA 3M5DA 4L5CA 5K3DA 7REQA 1CJTC 4UUPA 2AKAB 1BXGA 4Y9RA 4BFWA 1XZKA 4CMEC 4MS4B 4JYBA 3KYDA 3PJDA 2IIQA 5A2GA 4DFKA 2K4PA 2YYZA 3Q7EA 1H9AA 1JAIA 3IGFA 1KVSA 3NNSA 4MW0A 1Y6JA 1G18A 4G8DA 4L74A 4XOUA 4K8RB 3CLUD 5SZIA 2WI8A 1ZY2A 1DXQA 3ZCPA 3R7FA 1MP0A 1ZQCA 5GV7A 2PUTA 2ANCA 2XQJA 2HBJA 3RTCA 1GZUA 3ZEIA 2QQGA 1C9DB 3DQQA 4FLMA 3P96A 4DANA 3G1UA 4FUTA 4ZCPA 4MEJA 4TMZA 4RGQA 3ROFA 2BFWA 1XTVA 5HIMA 3JCZA 3N2YA 1ABFA 2EZUA 3QP9A 3THVA 1KMIY 1W5BA 4CU2A 2EHDA 3HKEB 2PGDA 5D3MA 3UJDA 1GFSA 2FPGA 5FI0B 1LNSA 4CETA 4LFCB 2RHTA 3OJUA 4I1IA 4RHUA 4RM2A 5EJ7A 2J7PD 2D1TA 2XYRA 4A92A 3C3XA 1M9NA 2W3RA 3LG2A 3IBSA 3RFFA 3QXGA 3RK0A 4FYVA 4MW7A 4AYWA 1AVTA 3R5XA 4QEZA 1JE0A 1WHTA 4B9AA 2AD1A 2EFHB 4YIKA 2AVNA 4JBXA 1P2SA 3KHLA 2FWAA 5F3XB 4I8IA 3UCFA 4BUCA 1U2GA 5C5DA 2Y0DA 1L5LA 4Q9LA 1P4GA 2P2SA 2QVZX 2QSJA 3IH5A 5ELLA 2K8AA 2WJAA 4HHEA 1V48A 2ZT7A 1ISPA 4YJ3A 1DRWA 5CDFE 2P7IA 3WS7A 4H4CA 1D1SA 4ZC1A 1ZQSA 5CYPA 4DL9A 3WFJA 1VKOA 5AR1A 4EUEA 3MSXA 4BFXA 3HG7A 2FHPA 2WD9A 1AXGA 4ZEXA 4QBGB 2XMZA 2SKDA 2A3NA 4DMGA 1Z62A 1O96A 4YRBA 5C0YA 1RPNA 4LK3A 3HCBA 3PGLA 2TMKA 1MV8A 3C0KA 3DE6X 5HXAA 1NOIA 8ICIA 4BWFB 4MB6A 6AT1A 2XCUA 5HZMA 3CVUA 2PJDA 1C7IA 1JJBA 1WLSA 3A26A 1RQPA 2O2CA 4Y2VA 1K08A 1HT0A 3R09A 2ZDGA 3CNNA 5IH3A 2CVOA 3KQYA 1TYZA 3AVQA 3G6VA 2HDHA 3BD8A 1VYUA 1DXHA 3ZGYA 1MT0A 5CB4B 2OMKA 2K5UA 2R85A 3LBHA 4G81A 4QUJA 1VI2A 5K2MA 1CEQA 1W1UA 2WUGA 1M0SA 4K05A 3RFXA 2Q4RA 3SGLA 2EW8A 5KZMB 1CZOA 2FEMA 3OLYA 3UT5A 2VR1A 2JH1A 3L0PA 3L8DA 1Z82A 3IMEA 4FT4A 1OV6A 3I04A 5CNIA 5TVGA 3O8BA 2IP4A 1YQWA 4GXRA 2J32A 3PGA1 2ZANA 5GGXA 3KZOA 3LD9A 1DAPA 1M66A 4A27A 4FE3A 3KHHA 4OOFA 4PV7A 2NTJA 1R8YA 3UAWA 5CCDA 1P2UA 1CD5A 2HW8A 3NTVA 1II8B 1D2MA 5SZJA 4RYLA 3PSAA 1JTFA 3G0CA 2P0AA 3BWXA 2PCLA 1ZHOA 4MV6A 3HCRA 1LKYB 3LGAA 3DGEC 3F9IA 4WCFB 3ZY2A 1YZLA 5K0ZA 4JOSA 2PVSA 4IQ4A 2OP1A 1QHEA 2PJUA 1H0HA 5AKGA 2A5YB 2KK0A 3AUOA 1V39A 1KDPA 1G66A 1HE8B 1CKEA 5LOVF 2HXGA 2FFJA 3OCCA 1ZQTA 4QAQA 2P9YA 1G5PA 3MCVA 1NFRA 4RH0A 2EX1A 4DQDA 2PA0A 1PJZA 4YAWA 2WFLB 5BOLA 5DN9A 4KGDA 4EUHA 4L9SA 3HY4A 4QGSA 3LU1A 3HN6A 1X7ZA 3GBPA 2RHHA 2ECPA 4KXYA 1R8SA 3EBPA 3KQTA 4I9FA 3JWJA 4CIVA 3D4LA 2OB1A 2RK6A 3M1LA 1JDPA 4L75A 1C0KA 1NUUA 1YL5A 3WBJA 3TGLA 4AY2A 2BKVA 4MP6A 2YQEA 2XE4A 3EF1A 1TAHA 4H7EA 4RK4A 5EQDA 1QIIA 3COVA 3GLFA 3GCDA 4IPTA 3ZX5A 5KKNB 4EYGA 2JFGA 4JZKA 3PHGA 4S1VA 4NE2A 1L5UA 5CVDA 3O1JC 2DY1A 3VNRA 4I2GA 3P7MA 2BBSA 1N1GA 4CL8A 1OBHA 2M32A 2XMGA 3WOVA 1XZQA 1QH8B 1QRUA 4YI3A 4RZUA 4LOLA 4PHCA 4GMKA 2I4RA 3JQAD 3TB4A 4FD2A 3GLIB 3Q7QA 2XKJE 2GN1A 4NP6A 1MG0A 4DJ5X 1UC5B 4MUNA 5KINB 4JYPA 3UYKA 2XYGA 1NK4A 2H1FA 3JQFA 4M7RA 2ONZA 5E0OA 3JRNA 2R62A 3TECE 4QNRA 2W2QA 1NUSA 4GVLA 3U7EB 4MW4A 3QX3A 5DYYA 4IHJA 2JFVA 4YR3A 2EIHA 5FLKA 4J2TA 4NAHA 1PS8A 4LXTA 3AJ8A 4GEKA 1P74A 1TKCA 3D31A 2XOKA 4HY3A 1ONBA 2HHLA 2JD0A 1W75A 2WT8A 3U48A 4ON9A 4EW2A 5JWHA 5B3JA 4QWCA 4O08A 5BSUA 3HJAA 1E7QA 2FEWB 2NV6A 3HJRA 3T4EA 5IAKA 3BMNB 3E4DA 4OHOA 2EANA 1MFPA 1ZQ1C 2VTEA 3DTNA 3LPCA 5F7JA 3UT0A 2Y99A 5DE3A 5ALOA 2NVWA 5JS2A 2YIVX 4RDHA 1Z2EA 3W9UA 3EB9A 1YB2A 3O4GA 4TQGA 1HEKA 3AVVA 4KO1S 1T91A 3O2QB 2BC9A 1TYCA 2DFNA 1R9MA 2WIFA 2X77A 1WKBA 1Z6XA 3SR0A 3EG9B 2B0CA 1ZIXA 3M6IA 2A1TR 1A27A 1KS9A 3GJ4A 4QNMA 4WIAA 1E9BA 2R8BA 5LIPA 4O3SA 5IIOA 4R2LA 4IJUA 4WXYB 3NKLA 1ZOOA 1J2NA 1XZLA 5E6UB 2ZWOA 2QXTA 3IM1A 4M6WB 1ZJYA 4M9GA 4P8RA 3RKRA 3RYHB 1KN5A 3BULA 4AF7A 1JHZA 3AG6A 3DGFC 1D2EA 2G17A 1LC3A 4XSGA 4DBLC 1NVXQ 3HBMA 2JH3A 1GNVA 4CM6A 4QSMA 3P2EA 4WWHA 2F4NA 3WWYA 5TE9A 1UKBA 1DJPA 1E5TA 1EUCA 1UBOS 1EX9A 2RHRA 1EJ0A 3SZLA 3LK9A 1KMHB 1U3DA 1D2HA 2WJGA 5A1TA 3Q6MA 4LF9B 4DHWA 1D6JA 4H7JA 4JI4B 4CFSA 4LTNA 2WF6A 2HRCA 5IVPA 2WOOA 2G09A 3QUSA 4W8GA 3X1KA 4FDVA 4UPDA 4FFPA 5HJ2A 1ONNA 1H2WA 5FRDA 4G5SA 3MN1A 3C4JA 1SHKA 4KJXA 4DWJA 2DPLA 3WR5A 4HTAA 2V7QD 3RB0A 3ICEA 5J5AA 3QKRB 3DPIA 2REOA 6YASA 4ETMA 1B0PA 2AJ8A 1GARA 1Q46A 1RACA 5F2EA 5FOWA 5DDYA 3I62A 4EABA 4I1OA 1HQYE 3DAYA 2G7MC 2GK6A 1R9JA 1UWLA 4QYIB 2ADMA 1LX7A 1RP7A 5I9NA 2R8PA 2DZDA 5FLXA 2BEWB 2GB4A 4DFDA 3PHIA 4Q6WA 5I47A 3JASB 3RKSA 3TVYA 2Y4OA 1HT2E 1QGUB 1VL1A 5EMNA 3EK2A 2FSPA 5A62A 3BMQA 2R11A 1PSZA 4YN4A 1TLFA 5E1MA 5TRTA 3UXPA 2OD2A 1FP7A 2H4JA 1I2ZA 2H18A 2Z09A 1MH1A 4IIDA 4YVZA 2B20A 3PNVA 2ZETA 3E84A 4W6QA 4GSKA 2IELA 8ATCA 2OOSA 1E6CA 1IN8A 3LY9A 3TPFA 1NPDA 3CF2A 4OGLA 5AVUA 1L3IA 1ZQRA 5FFNA 5DM1A 3TUJC 2PRKA 1SVWA 2QMUA 3BD9A 1MCZA 3DFKA 1N1EA 4MQFA 4DBLE 2VTVA 3TSOA 3U0BA 2CNWD 4XA8A 1XT6A 1SN7A 3T0IA 4WASA 3TVTA 4MWZA 1QS0A 3LT0A 3WB1A 3UHJA 3W4KA 4RX1A 1A2QA 1ZQJA 2PBFA 2CLCX 4R81A 4LI0A 3LKBA 4QBIA 4IKOA 4XQGA 2WUDA 3ZDYB 5CH5A 2FPRA 3OIVA 4PLGA 5DIFA 1KI8A 3NDJA 2GVNA 5KNIA 3WIUA 3HRKA 2RIPA 2G0AA 4V1CB 3WLPA 1XD2A 3VH3A 2PLAA 4RQBA 1FNDA 4GP7A 1FFSA 4CTNA 2EHJA 4DCGA 4TWRA 2E1FA 4FR2A 3I6ZA 1OF1A 2QR2A 3OY7A 2PS1A 4QUAA 3KYCA 3ZIAA 1P1IA 1VP3A 4R83A 1I33A 2Q3LA 2GASA 2PNJA 4FS1A 1KPHA 4YJGB 3W6ZA 4IW3B 2Q1UA 1G291 5EUCA 4WMLA 2NO4A 4ZQEA 3CN9A 2AWOA 2XIQA 1DT5A 2IOFA 2J0QA 1VPTA 4FR0A 2HDNB 2I62A 1UA0A 5KFHA 3KPWA 3RUHA 5EXDA 5I4CA 5C37A 1COZA 4UUBA 1XQVA 4IXDA 3AEKB 2IOYA 3FRIA 2H9YA 5JFGA 2R8GA 1OC2A 1VE7A 5YASA 1DDIA 2V6MA 1JI7A 3FTCA 3UTDA 2FW8A 4XSVA 2QRHA 2RAUA 4TVSA 1HNXB 3AL0C 4CV2A 4PZCA 5HMMA 2CZQA 3V1KA 3TN7A 3RS0A 3T3PB 3NRJA 2BTQB 5TLSA 4OCZA 4MNTA 3Q6IA 4F91B 2FR8A 4F92B 3PI7A 3L2OB 3E9YA 4BLTA 2QG6A 1A5ZA 2GM5A 2Y8EA 1VJ0A 3VYUB 4KH1A 4E4YA 5E95A 1SIUA 1TUEA 4MA4A 2J67A 1EUDA 2O2EA 2C3OA 2BFBA 2GZHA 3MBYA 2OGUA 1U2TA 4TUYB 2J9XB 3MYYA 4JB3A 3WSTA 2ZDHA 3T4UA 5B7NA 3ICVA 1Z8FA 3KHTA 3OP1A 4JX8A 1FJHA 5LD2B 3R5TA 3IOCA 3UFXB 2AQIA 4JBGA 2VHVA 5BV8A 5C35A 4ENUA 1RKXA 2VEOA 4R84A 3SMQA 1HUZA 2F1KA 1IPFA 1M2OA 3VHQA 5ABPA 4XLTA 3AKEA 1U5BA 3PIRA 1ECCA 5DCUA 2HPVA 1BH6A 1BFDA 2BCVA 2OA0A 4TPKA 4E0BA 1OAAA 1SB3C 3VCBA 5HQ3B 1IZZA 2P4EA 4WNCA 4L72A 1QHGA 1F6DA 4CHGA 4C03A 4IIJA 1ZH8A 1VSUA 1T25A 3H1AA 3N9IA 3VOTA 1FUYB 3WLSA 3B6JA 3VO8A 2AOTA 3CSUA 1K4KA 2Y77A 1Z74A 1I30A 4FKBA 4IG9A 5KT5A 1QUEA 1CS0B 1ZN9A 4CFZA 2BE7A 1ZJMA 4C0KA 5H3CA 3RC9A 3FWNA 2GILA 2YXLA 5AW1A 4Y2XA 3N86A 1PJ3A 4PC6A 3VZSA 3KV1A 3LOQA 2K8BB 2H3QA 1SPXA 3IDOA 1HYGA 4ENWA 1NBHA 4MPRA 2QUIA 4I5FA 1SEVA 3WRWA 1I5EA 4X1YB 3M6ZA 2PSSA 4Z4EA 2Q3DA 3LUGA 4HNRA 3ZWMA 4GGMX 1V5GA 3EW7A 1EUYA 4EJFA 4LHWA 3MFYA 2QXYA 1EINA 5DCWA 4OFWA 2NSDA 4C1NA 3TTVA 4G36A 5G4KA 4KG7A 1ZQWA 2MSWA 3Q10A 1KA9H 5JRDS 4IDQA 2DPMA 3FWZA 4ELVA 4AFNA 1FE8A 4HX2A 1FDUA 1PJQA 1B4DA 3N2KB 2DFKB 3ZYCA 4CM7A 4PG6A 1FQOA 1I0LA 4ALLA 3Q3JB 1IJFA 1UOOA 2CXRA 2RHFA 2B35A 3Q40A 3T7AA 2Q5CA 3C8ZA 3LBIA 3HSSA 3TRFA 2ATVA 1XFDA 4JELA 3TD2A 1P0QA 4UHJA 1G5TA 3NIBA 1OTHA 2HMXA 2PS0A 3DBRB 1NY5A 4B34A 5IBPA 3QVTA 5EIHA 2C88A 1U7ZA 4B3SB 1BMFA 3MUNA 1X15A 1SVIA 3MWDA 4NULA 3INRA 4BQOA 4DQSA 4MEXA 2AB0A 2Y2VA 4E14A 4UTVA 1W59A 3CUKA 3C6MA 2ZUSA 1XQYA 3EOZA 2M98A 1XLUA 3ANNA 2CE2X 3GFQA 2E8OA 2ZJ3A 3KSZO 4JC0A 2RGYA 2KKPA 1K7CA 4KAFA 5KI6A 7MDHA 1V5FA 1H1LA 3ZHCA 1IXSB 1LLUA 2ES4A 1F9AA 2FR1A 3H1EA 1WNTA 2XDWA 2QN2A 3U3DA 3FIUA 3AKYA 2ASLA 4CMEA 5GWXA 3QXHA 2JFNA 1PYGA 1DRGA 4NX2A 2IZ0A 3RIGA 1NQTA 4QU8A 5KG4A 2AFIB 2IYYA 4HYYA 4FBUA 1NI4B 4HH0A 3DPSA 2VYCA 3NBYC 2VUUA 4CG2A 4H3HB 3E5HA 5IKPA 3PYLA 4QDXA 1RCFA 4HXFB 2X23A 4LE1A 3KFUF 5ENVA 2Y93A 3GJ7A 1D2CA 1GGFA 1LQ2A 4NKRA 1N5MA 3EQZA 2C57A 4G9GA 4UU7A 1MXFA 3RB8A 2Z30A 4JQZA 1ZN8A 1E62A 1D0IA 5EFZA 2AMJA 1TYDE 1YJXA 2PO5A 4E46A 1N57A 3GH3A 5IBRA 4HMQA 3RYIA 4FOLA 2SECE 2NU9B 3TUIC 2BFCA 1SKBA 3AOEC 1EFPB 4URXR 1J5XA 3HO1A 9GPBA 1EWVA 4QM6A 4Z4CA 1NQAO 2Z9BA 3QEOA 4GX0A 3K5IA 4J9SA 2R87A 5ISMA 2IXTA 3KKOA 1T8SA 4N76A 1EXNA 2QMZA 3J81j 2CLOB 2NNWB 2XSZD 3R0XA 4P4MA 3N7AA 4FHDA 1DEXA 3P9IA 4ZU3A 1AIPA 2JLVA 1Y9EA 3QXXA 1O97D 2GTIA 4IOMA 3ZGZA 4NC9A 1YASA 1NF9A 2F44A 4EGJA 3OFSA 1H4SA 3H9UA 1PE0A 3KALA 2VT6A 3D2LA 4BATA 3MTBA 2NRXA 5K6TA 2Z6QA 2HXSA 2GK3A 1QBKC 5DN6D 2WWGA 3KLOA 3U56A 2XCSB 4GI5A 3F6PA 4CM4B 1KARA 2M6SA 4KN5A 1JYSA 3F98A 2VPTA 2QRGA 3IEUA 4ATNA 4B17A 1V1JA 4DUZB 4J4BA 3OZCA 3TSWA 3U7IA 1X1QA 1W0KD 1LBSA 1ORWA 2O3JA 4UCFA 2LYAA 1P17A 3ZG6A 4K88A 5I9BA 5JG7A 4PH5A 4YX9A 3RWBA 4TV9B 1N6HA 4RZQA 3A9SA 1P1BA 4GE0A 3C21A 2W3SA 1I3MA 2EWMA 2I1QA 4KSCA 5FV4A 4O4LB 1OLOA 3B1VA 2Q6IA 2SBTA 1E7MA 1LDMA 4GRAA 4N9WA 4UBKA 4H1HA 5DMHA 2BGTA 2ZWMA 4O1HA 1YR6A 1C30A 4A5SA 1J9ZA 1U3WA 3QX8A 1OFUA 1JSZA 1B2RA 5DXFA 3Q5DA 2C4VA 4V0KA 5J2TA 1K86A 1NQ5A 5KCMA 2ZR8A 3A31A 1D2RA 3JD0A 2KKVA 1J2YA 3NHUA 4WOPA 1A76A 4C5CA 4OQZA 1E58A 1EVEA 4GFDA 3LFHA 3RJ9A 1T6ZA 3PHHA 1GAJA 3S2ZA 5E8JA 2X22A 3M7DA 1D07A 1V6AA 1O1YA 2QTZA 3AJEA 1Y4SA 3QA9A 4WBXC 1VP9A 3NHBA 2V4RA 1G1MA 3TLAA 1Q3KA 4J9NA 1U8EA 3H5NA 3PQ4A 1UAYA 2NU6B 3BL5A 5AJZA 2VOEA 1GPDG 4HT3B 2H8GA 2P41A 3JWPA 4U7DA 4I28A 2JBHA 4RPXA 1IBKB 1L5GB 3RRBA 4OJ6A 1PTJC 3O0FA 1F2UA 4ONEA 2A6PA 1U94A 3WGGA 3DAFA 3QVMA 4J2OA 5BVHB 2GEBA 4R6XA 4A3SA 1NI5A 1QPBA 4FQ5A 3S40A 5JNWA 3PDIA 4WACA 1Z5VA 3S2GA 4YP5A 1B8UA 5FWYA 3KR1A 5JD6A 4G5OA 1X1CA 2X19A 3MF4A 4B76A 2FSIA 3IQXA 3UXHA 4P38A 3FMGA 4OFZA 5WRFA 2GN8A 3SQLA 4XWKA 2D54A 3MRXA 1TJ4A 4IRCA 3O26A 3JYLA 3MMXA 5KL8B 1PQYA 1Q17A 1XP5A 1F60A 4X0EA 2B94A 1ETHA 3NVZA 1N7JA 5K9ZA 3V2UA 1FUUA 1SKWA 4B6OA 3UJCA 2FLWA 1SZPA 1ZUNB 1ZWLA 2JIZA 3JQDA 1JT9A 1H3EA 1NK5A 3V3TA 2PMEA 3ESCA 1VB5A 3RU7A 2FX3A 3FKSA 1M72A 5K8IA 2I29A 4KHPB 1LPPA 1K5HA 2ZSFA 1NJ2A 4S05A 1WWKA 2EDAA 1IHYA 1P9OA 3AVPA 4P3XA 5KU7A 3T3GA 1UDXA 2H65A 2F8MA 4GU5A 3F67A 5ICMA 1P5ZB 1GTVA 3W8FA 1QHYA 4OXRA 1U3VA 5KFIA 3CNOA 7AT1A 3NM6B 1Z39A 1L7QA 1FYXA 5HUQA 2YWJA 3LCJA 4ZI7B 3CTPA 4M0EA 2H4YA 1G38A 1UAGA 3HGMA 3K8ZA 2XT9A 1ZHHA 2R48A 3W6NA 4NZZA 3AEZA 2QSYA 3TFOA 2R8KA 4JLOA 1FNMA 4WKBA 2ZULA 4U7FA 5K3FA 4BMOB 2PYIA 4DSUA 2MMCA 4LXQA 3WRYC 4NV3A 3U6BA 1BCRA 4QFCA 4OKNA 4HV4A 2B4RO 1L3SA 1QUFA 5J2DA 1Q1EA 5ERGB 1AG9A 1ZQ1A 3CZCA 3KKPA 3HU3A 1G17A 5SYAA 2RLTA 1KVTA 1Q1GA 3T61A 1F12A 3W2GA 2OBLA 5E7IA 1UM9A 1DO8A 2MCFA 3GQBA 3QUTA 1RI4A 4TRRA 1L1FA 1DIAA 3GEBA 2DOKA 1AH2A 2VXCA 4RMGA 2IWRA 2JH8A 3FDSA 3V4RA 1YAHA 3ND8A 3LWBA 1ZINA 5E0KB 4MPPA 2ZXHA 2YWHA 4BZQA 3PWKA 2MINB 4RETA 1J99A 2I4NA 1GPNA 4RK5A 4EJMA 1ZVJA 3QE9Y 3BS7A 4ZHQF 2VIIA 2E8PA 2EBUA 3FPKA 4CVNA 4C0QC 3QXCA 2A33A 4IM7A 1P2TA 5TMBA 4U9HS 4Q9NA 4AIIA 1QFJA 5IT0A 4I0WB 3R0QA 2A1JB 2I99A 2NT3A 2BUBA 3FGOA 5BN5A 5J2UB 2AEJA 4WK6A 5DK6A 1MENA 4IS2A 3TEFA 3DOFA 3FROA 3N75A 2FEXA 1IEXA 1NF8A 5BPHA 5EMLA 2DERA 5DBCA 3BCRA 4J1TC 4OLHA 4HP8A 3QU4A 1V9CA 1PYDA 4LV8B 4J43A 5AUPB 4YAFA 4TMKA 5AXCA 3WDLA 3ZW9A 4DSEA 1FP1D 2BAGA 2BR3A 4A8JB 3RC1A 4KFUA 1J4AA 2WY2D 2DTXA 1NUAA 9ICSA 1DTWB 2Q9UA 4CKBA 2J1LA 4WGFA 2CYCA 3D3WA 5CLIA 5ERYA 2ID7A 2C4UA 4MR9A 4KDRA 4UEQA 5B36A 2X3UA 3O93A 3UPDA 2HM7A 4UEOA 2K4MA 3MFHA 2PHZA 4RY9A 3S99A 4W4TA 4YGYA 4DCPA 5HZHA 1U7TA 1PL7A 3T5BA 1Z6GA 3AR6A 3GLGB 5DLGA 3MGHA 3N2LA 5ESDA 4I1VA 3UUGA 3F3YA 4YXJA 1JT2A 1Z0FA 4G07A 1Y33E 1NOJA 2ZJBA 4DQQA 3HBNA 5DYIA 4AMVA 1TVAA 4KVAA 3LXRA 4F04A 2H4FA 3HJGA 3IRVA 3E9RA 3LCRA 1CRZA 3STHA 2V6BA 4PZEA 4H6VA 4F2PA 2FPLA 2QPOA 4CCWA 1EDZA 2OGWA 3EEBA 2NRVA 4JX9A 1XCPA 2BMFA 2P8JA 4PAQA 3RR2A 1U9CA 1NUQA 3EFOB 1OW3B 3GRCA 2R25B 3HKBB 5CHGA 3T06B 3M81A 4PHEA 4UJ5A 3B7GA 3TOZA 2YOGA 1S2DA 1E3IA 1M83A 2X5OA 3MTAA 3PQDA 2YBEA 3LP8A 4LKRA 1K9SA 3QBEA 4ID9A 3HZHA 4FHGA 1NUTA 4JP2A 5J0QA 3VR6A 5G1NA 4UE3S 5KDLA 4DQPA 4B5KA 5AIAA 4AYBF 3T6KA 4F8RA 1XCMA 1OW5A 2N46A 3D2SA 1VLVA 4DA9A 3NAMA 3PTAA 5HFAA 4LBYA 1ZWKA 4BYMA 3ZWXA 1HLDA 3RQSA 2NOAA 1ZN7A 3WJ2A 1MA3A 1FP4B 2UU9B 3D3NA 1U0TA 3IIMA 1A7JA 3FPEA 3GIDA 4L5BA 1YJ8A 4QVKA 3VAAA 2JI8A 1UKEA 3CR3C 5I9IA 2DH6A 1D7AA 3N87A 4FK8A 7ICMA 3WRVA 3H6KA 1G7SA 4R8UB 4FU0A 1E2MA 1KI1A 3E2PA 3UG7A 2NYUA 4DLZA 4UBCA 4C0WA 1X7YB 2XMDA 3H87A 4XH9B 3RNOA 4IILA 1AE1A 3M1IA 1TAUA 4MV3A 2OPHA 4ZZ2A 3JYQA 3LWZA 3SDBA 4ZT3A 3W9BA 3NGDA 1XCOA 1FFCA 3E7DA 4F5OA 1BPXA 3MB5A 4AW9A 4Q3AA 1BKDR 2P9QA 4IL5A 3E2IA 4TTRA 1JQJC 5KFXA 1SXJB 1QG2A 1ODKA 1MIOB 1NL3A 3NJ8A 2Y1EA 3QBVA 4KN8A 2H54A 1ZRNA 1RZUA 4TLBA 5AKLA 4DIDA 5B58T 3HCEA 4NNPA 1ZJ4A 1RNLA 1TKRA 4RKYA 4BWVA 4FSXA 3CBQA 4QATA 3SQMA 1VKZA 2ZRAA 2ESRA 2OBFA 4GPTA 1J39A 2W70A 4IQTA 3L0YA 2BYTA 3HX0A 3CKMA 4YASA 3STTA 3KDPA 3NEPX 4OA5A 5HBGA 5B1SA 2HGSA 1GD1O 1JQBA 3T7KA 4Q5IA 1TKDA 1A72A 2DF8A 2W00A 2RKOA 3MJFA 4QKQA 4D4GA 3R7WA 5B66U 3ET4A 4R9RA 4NAUA 2EYQA 5DHAA 1CYDA 5KG6A 2XADA 4FNOA 4QG7A 4DCOA 3UWMA 4CEJA 4IMPA 2H4ZA 2Q99A 5ARCA 3WYGA 1ESEA 1U8TA 3A11A 4KVZA 1X1DA 3HCNA 1FS4A 4AJPA 5FNZA 1N32B 3KVRA 1JTEA 3GELA 2SICE 3G6WA 1DC6A 3FJOA 1UOEA 3E3AA 2AEFA 3KSRA 2REXB 1KRPA 4R69A 4DSNA 5KYYA 4LAFA 2KTQA 2DU8A 5LZ8A 1PR6A 3CRW1 1JIUA 2Y27A 2WINI 3GXBA 1F20A 3IUPA 2HWXA 1SKRA 1L5VA 3IJRA 3KKZA 1I3KA 2PO7A 4EO7A 2ODPA 3L77A 1MR3F 3BZBA 2KI5A 2AF4C 4HSEA 1DOAA 3X1DA 3P0FA 3R5KA 4EW3A 2VOJA 1W44A 4O4IA 2VQSA 1MZPA 3QNUA 4AZVA 4F9EA 4M99A 4V3CA 5FHRA 1G8MA 4DVGA 1MA7A 1PV4A 3DV0A 3LWNA 1Z37A 3H8VA 1ODCA 4X24A 3FNRA 4RD6A 2Q62A 3PO4A 4I2NA 1BMDA 1H42A 4D7AA 3RI3A 3TPCA 4PGHA 1NPTO 5DHRA 4IYRA 3I6IA 4WT7A 2VDNB 4NFLA 4YMGA 4RHXA 1MLDA 1PGOA 9ICVA 2A86A 2WTAA 4TLDA 3PFKA 3ISDA 2ORYA 3D6MA 3Q7IA 1CC1S 1W2WB 5LLSA 2AFHE 4DRYA 4YRGA 5BR1A 3DULA 4G97A 2UUAB 1QAOA 5DGDA 2ZJ7A 2HSEA 5DT9A 3WRXC 2ADOA 1ORHA 4XQCA 4XD7D 1EH5A 5F7XA 3IVGA 3GN1A 2Q4OA 3JZMA 4LCEA 1P0CA 3MHPA 2V5VA 4YALA 3CZ4A 1XTBA 1ZAYA 4RCVA 3M4YA 1EFTA 2ZOSA 4DKJA 3E5RA 4MICA 5JBNA 3BDPA 4R4JA 3T4PA 1E3SA 2CSUA 3KR9A 4BMDA 2Z8YA 4XYBA 9LDTA 2WJWA 1ZMBA 3PXXA 2HAEA 1CULC 1LV7A 3CISA 2H5XA 2CD7A 3THYB 4XCXA 3D4OA 5T67A 4G4GA 5I7UA 2AR9A 4Z6KA 2GCIA 3BILA 2LBPA 4MVJI 2C82A 4LDZA 1LF0A 3O3CA 3AI2A 2C77A 1KBOA 1KYQA 3N05A 4L22A 4OGFA 4RXUA 2C84A 4I46A 1L1RA 1T2UA 2Y0CA 2P77A 1CNEA 4CMIB 1O0BA 2AX3A 3MB8A 3VPDA 1KVQA 3KZVA 2VH1A 5FX2A 4HUTA 2IH5A 1NU6A 4B45A 3FA2A 4B87A 5I5GA 3L7BA 3COPA 5CIQA 4BLUA 2IKSA 2CNNA 2VP0A 4B40A 3K0FB 2DT5A 4BZZA 4XX0A 3DEIA 2EQYA 5CEFA 2BKEA 1WDTA 2QD5A 3SZ2A 5IBCA 3ZE1B 2C5BA 2P69A 1CQIB 3CVYA 2X7HA 5JSHA 4KYUA 4ALIA 2OILA 3K6RA 5B1YA 4WBNA 4NBLA 4MEBA 4RGBA 1PK3A 4P22A 1U9YA 4RFVA 4HTFB 1UDRA 4L02A 2C00A 1Z4IA 1E79D 3AF1A 2ACVA 4RBNA 4KUEA 5KNDD 5AK0A 3LHIA 1W9MA 4J0GA 2HMUA 1NVVQ 1KR2A 4QBFA 3W5HA 1CE8A 5TVKA 4MWTA 2HY7A 3TJZA 3USCS 3MT7A 9ICXA 4LMRA 3PXDA 4LY3A 5DCYA 1U0HC 2C31A 3SKVA 2QRJA 2D5IA 2G67A 5G41A 1IXRC 1KQNA 1RLIA 5TQ2A 4LVCA 4Q1CA 3IVMA 1NSFA 3O8LA 3MBOA 3MJHA 3RRMA 1BXRA 3WLAA 1DKMA 1G3IA 1KDOA 4L0CA 2GKSA 2JEFA 1LSSA 2O19A 1B22A 2CL6X 3AOEA 4ER6A 2IRWA 2M1XA 4HNQA 4D9JA 2J6BA 5C46F 5J2CA 2AJQA 1PHPA 4QODA 2YJGA 1B42A 5HRUA 4JGIA 2YHIB 2X1LA 1JPVA 4MAMA 4QHTA 4R64A 4H2DA 2ORIA 4AULA 1KJ9A 1V9LA 4ELTA 3GMSA 1GNLA 4CF4A 2A5DA 3TACB 2QQFA 2C07A 1GXSA 1MF7A 2BPFA 1ZQHA 4WL0A 2XD4A 3L93A 4IMJB 4UAVA 4XQEA 4GL2A 3CMMA 3UQ0A 1OT5A 1SEPA 4E31A 1SCKA 2XJ9A 1ZXBA 2GLEA 2PYZA 2VKQA 2JGNA 2IHUA 2FSGA 2E4ZA 4NEQA 3RT7A 1RWMA 5HBRA 1R3UA 1BE8A 2EF0A 4NWIA 1G8AA 2CYBA 4A8HA 3VPAA 3Q4GA 1XTSA 5CLQA 5FKJA 5T4HA 3WNCA 2GSDA 4FFLA 4LE2A 2JZBA 3BIJA 4IKEA 4C0AC 2OOKA 2HYIC 4LV5B 4JR0A 1S4QA 4EF6A 5JS6A 4UB4A 3IV6A 1YE8A 2BEJA 2XGOA 2F43B 3U1BA 4J1NA 3NWJA 2O8VA 5GGYA 4MVJE 2H85A 3IFSA 4DOAA 2ZM5A 3KVOA 3KAQA 4W8HA 3E4CA 4G2NA 2HFKA 4LHXA 1HUQA 4U9UA 4YCSA 4IOLA 4YDSA 5AOVA 4UATA 1Z4OA 3GLRA 2VSYA 3LQ4A 4KXQA 1PUJA 3KWJA 4UOEA 2E4UA 3WC4A 1E1YA 5IN4A 4YAIA 3WAJA 1NJ6A 1V6SA 1LW6E 3H16A 3GK3A 4IJ5A 5TJ9A 1PGPA 3LCVB 4BNFA 2E5FA 2F67A 3DLCA 3SSAA 5HW0A 4RPZA 2PZKA 1XA0A 3EZ9A 3T5KA 4O2LA 1TW3A 1ATIA 2UUOA 2UYOA 1FC0A 3ZHBA 1GFWA 1EUQA 2GH1A 3L7LA 4LJYA 1B14A 1K63A 1LWOA 3I92A 4P3OA 4IR1A 3NR2A 3A6EA 3IT3A 4HRVA 3T9BA 3C6YA 3QVVA 2VP9A 2PSFA 3LLMA 4MB2A 4B3JA 1CX9B 4CM5A 4EP1A 2IYOA 4QT4A 4ECRA 1QE0A 1C3XA 3OFJA 3NOOA 2EGHA 5ALFA 2I8AA 3I6MA 3T7CA 3SYNA 2IW3A 2YFYA 4IXTA 2AYXA 1PTJA 5LM3A 1L7VC 4M9JA 2VDWA 3QV2A 1Y4DE 4WD3A 3FFBA 3T3OA 2ZYRA 2WE8A 1EK0A 5LU8A 3TW8B 4MVCA 3X1MA 5EZSA 4BRWA 1T13A 2V58A 4LOAA 5I5EA 3V9AA 3DE3X 2KBEA 1Z2CA 4N3AA 2W6OA 3EH2A 3ANYB 2EZZA 2OYCA 4EQ6B 4JV0A 2JLYA 5JYCA 3IQHX 3AESA 3LDUA 4JB0A 3PX6A 4J94A 3EEFA 4H7DA 3AEUB 2X2PA 3GR6A 2HOIA 3PF8A 3GCXA 2JJ1D 2P75A 5FUQA 1DT3A 5HGJA 3JWHA 2I7DA 2IXGA 4MW2A 1BFKA 3V42A 1WV0A 4BFLA 1SM4A 1IN1A 2IA6A 3B9QA 3KOWA 5GONF 1MQ8B 1PJSA 3HI6A 3WLHA 4PZLA 5EIAA 4F21A 1TECE 5KNBD 1CVLA 1OXVA 1GWNA 3OZTA 5FWXB 3MINB 4HLDA 4RQNA 4R16A 2VS1A 5LXTB 3M1AA 5HZGA 1RADA 1YIAA 2AQ8A 2FPPB 1QIDA 2EZTA 5IU6A 4Y6OA 2QU8A 5EEHA 4D4HA 5CB6A 1WMFA 4GECA 3UF0A 5KBYA 1KQ3A 3G0DA 5E9QA 2VJQA 3FFAA 5JYBA 2ZBDA 3CO0S 1U4NA 4J0FA 4OQQA 3OG9A 1V4NA 4N0QA 1U99A 4YUWA 1EE2A 3LA6A 3PK0A 3UA4A 2ZVJA 4JLUA 1X7WA 4D8XA 4MLCA 2A1AA 2ESEA 1ONPA 3FVTA 5EQFA 2VC2B 3U39A 3V1YA 3P9RA 4F2DA 5TXGA 3WRYA 3INGA 2JVIA 2PLRA 4B4UA 4QTUB 4TWIA 4WLOA 4QOSA 1J97A 4NVRA 3ZJ4A 4QZHA 1Z00A 1PEDA 3L49A 2OUKA 2Z5GA 4UZEA 1GEGA 2DE0X 4D79A 4NDAA 1UXJA 2PX0A 1KI9A 1ITZA 4ZYUA 4UPEA 2IU6A 5JVDA 1SCUA 1STOA 2FMPA 3DVSX 4Q43A 3IIJA 5BOMA 3BIFA 3PX0A 1ZJZA 2BCUA 4KE7A 3R77A 1OAKA 1K5OA 5ELXA 3HP7A 1KSFX 2ATCA 3GAAA 2UZ1A 1NDQA 3ZLTA 3U7QB 4JQCA 3V8BA 1ABEA 2MT9A 5HWSA 3RUAA 4R2MA 5TF0A 5F9NA 4OUDB 4I27A 1N3YA 5CCEA 1Z1BA 1UQTA 2B4YA 2O3QA 2F8TA 1SHUX 2Q0QA 1U3FA 3TW4A 3TJMA 4JYMA 3TXXA 2X2FA 4R2KA 2F2AB 3ZE2B 4WZZA 1OASA 2VH2A 1T2DA 4C4YA 2GZAA 4UPVA 4KMOB 1O57A 1W29A 1NP3A 2VNSA 4BKUA 5KNCD 3NVKI 2YDXA 1X9XA 2CXOA 3B2QA 3QBDA 4DAEA 4UVEA 3CUYA 4D9GA 1YOVA 5IIJA 3FI0A 4YR0A 4H27A 4J1TA 3V34A 5GVRA 4M22A 4JI2B 1EAYA 2D2EA 3CYMA 1PJCA 2H16A 3HVHA 2XUJA 3DEZA 3JX9A 5KJFA 2NU8A 3ISJA 4BQEA 8ICSA 1V1MA 4O4HB 3FZQA 1UMBA 4OD0A 2DC1A 2RP5A 3MCTA 3OICA 3BE5A 2Y1WA 4RULA 3K4GA 2EGUA 4NOKA 3T5LA 5KKCA 5AK5A 3M4NA 1TC2A 1QLWA 1D9ZA 5CB8A 3UGKA 3X3HA 3BRCA 4L73A 3VC1A 2CBGA 3QYAA 2C3YA 1SUEA 4RQ4A 1UKVY 2YZ7A 4AS1A 4D46A 2WEKA 2OQIA 1X7XB 3G82C 1G3QA 3E8SA 3F5DA 4ZHQA 2ONKA 8ICKA 5EJAA 2JEJA 3HCCA 3CVXA 1ZIDA 3OLCX 1A3CA 3PLAE 2Y9UA 4CEHB 1QLHA 3ZTTA 3RJKA 5SYMA 4DCMA 4GO1A 2ID4A 3OX4A 3GPIA 3G2HA 3KC2A 4Z3DA 4FDMA 4XQ9A 1Z18A 4TVOA 1YULA 1EGAA 3HKDA 3LZDA 4XZ3A 5PGMA 4OLAA 3DO5A 1EVJA 4G0VA 2VJBA 3DTVB 4NK5A 3F97A 4CKCB 5JJLA 1VGRA 1NU8A 2DT8A 3AEVA 1L5HA 4YP3A 2FNAA 4HFNA 3UO8B 3HZZA 3OCVA 2NYVA 4F3OA 7ICOA 2OV2A 3NYWA 1BX3A 1OXMA 2JV3A 3LPNA 4KLJA 3VBEA 2BM9A 4CUKA 5JH7A 3WVNA 2PMBA 1K6JA 5EVJA 4ZAYA 4I4TA 4OAQA 5EJ8A 1QE5A 1CBUA 5KPDA 4ED1A 2YW2A 4QFBA 2F1HA 4Z2YA 5A2QA 3FYHA 3G5LA 4NBRA 3NKFA 4IUYA 2HBKA 3NIWA 1N5WA 4Z9FA 3LHKA 2CCGA 3TE6A 2BF7A 4Q48A 4U2CA 1SA0A 3N28A 5CFPA 3OWXA 1FLDA 5FD8A 2TMGA 2XTJA 1NKBA 3PPYA 1Y81A 3PE3A 5BMOA 4P4NA 5FBQB 4PSKA 3I4LA 1SL1A 3HABA 2B7LA 2IYVA 3D54D 5I9SA 4I4LA 4RVSA 2XOEA 3Q9UA 5E4FA 1IONA 3GEMA 5TSDA 4BLSA 4IDPA 2ZW9A 3FHJA 4MUMA 4DLBA 1TQHA 4D3ZA 3K20A 2B4QA 1LVGA 4ECQA 3DKIA 2ODGA 1TI7A 1YVEI 2AFHA 5BNIA 1KXJA 2OESA 3HILA 2G6TA 1MABA 3CNEA 5LMUB 1OFGA 1Y9DA 3P8ZA 4Y2SA 2OHGA 1AS2A 3UMCA 1G41A 1G5QA 4CT5A 3DO8A 1QYXA 4DR6B 5B4UA 2AMVA 4LXGA 4YUVA 3ICOA 4HDQB 1LBQA 1R27A 4G5RA 2VBCA 2QBYA 4RO0A 3OE1A 5E4JA 3QEJA 3DCYA 4Q02A 4X1KA 1CIVA 3HJCA 4ZI2A 1TA9A 1W0JD 2VP5A 1XYYA 1YIOA 4DO9A 1VC2A 1WHSA 2TMDA 3CXUA 5AJXA 4OK6A 1JBQA 3ZNPA 2E5LB 1N5KA 2XB8A 1W1IA 1SBTA 3S70A 3INNA 4X64B 3ASYA 1DGSA 2ZRBA 2HLNA 2UUBB 3PXUA 1COOA 3V4SA 1Q20A 4FHEA 1IBLB 3RAEC 1YCDA 4YMLA 4MMZB 3R24A 2UYQA 2YC2C 3IPRA 1K5DA 4K9OA 3NHRA 5AVYA 5J2FA 3STVA 4JCCA 2RSLA 2ZP1A 3M3HA 3HU5A 4IIXA 3WAKA 5AO9A 2CFTA 1G7RA 2WG2A 2QRMA 3QVJA 1FFEA 2J87A 3UMGA 3Q85A 1P1KA 3PEWA 5LZ9A 2H5IA 2XF2A 5J5VA 3HW8A 2P9HA 4II7A 2ZE8A 2P3SA 2ODQA 3HWX1 5IXSA 2NRZA 4QWAA 1WZEA 3C3PA 4HGZA 1Z56C 2ZRMA 2XXBA 3DHEA 2OZLA 1ILWA 4IO1A 1QAQA 1U2ZA 3D7NA 4FOSA 1WZNA 1KZHA 4AMYA 3IA2A 5B1DA 3JAKB 3CPEA 1T9BA 1N5RA 1G6OA 5DHPA 1ZNZA 4WK0B 2G5HB 3PXCX 3B8EA 3TIIA 3FCYA 4BN0A 4MYHA 4M76B 3SAGA 3B9JA 1M6VA 2B21A 4AN1A 4DEVA 2A7XA 4OFXA 2ASDA 5BY2A 3PL1A 3WRXA 5CIWA 8ICVA 1KEJA 3OJSA 5LQMA 4DDHA 1Z19A 4US2R 1TV9A 1TVCA 1F6WA 1EFDN 2YINC 2IZ7A 4QE3A 1PD1A 4BMNA 2NRTA 3F8WA 2UUPA 4G8JA 1JLLA 2OXFA 1KI6A 1NW4A 2FQYA 3O4FA 4EPXA 4BJ1A 3D8UA 3PWZA 3T7TA 4BMPB 4ZCTA 5HDQA 1AX9A 1ZVVA 1PT7A 1EVKA 4WJKB 4BB0A 4CIDA 2QP3A 5JNVA 1P6UA 5FPSA 1Z33A 2P62A 1OYOA 2EZ8A 1W2HA 4QZBA 4HWOA 5DT2A 5HDBB 4Y7DA 5IFLA 3MUEA 3GRZA 3T5HA 3T3DA 4NZYA 5I8PA 5EA2A 1C4KA 4KQEA 2FWJA 1JQ3A 2HPAA 4YQWA 5ALQA 4IUBS 4F2SA 1X74A 5T4FA 4Z1MA 8ICPA 1VHLA 4DR4B 2F1RA 4EKYA 1L5WA 5KTKA 3EXEA 1ZX1A 4RIIA 1E96A 4BBPA 3WJ7A 1QGED 3AQIA 4RVHA 4Z7NB 4P53A 4PPGA 5EKUA 1PZNA 1ZRSA 5BYJA 4OHYA 2AYZA 2J3EA 4OGWA 2QKYA 3IV9A 2PZAA 3I5UA 1U8AA 2DKXA 1HJPA 3Q8KA 1ZL2A 3KTOA 4JVMA 4AJ4A 3F78A 3CP8A 1ODSA 2HNAA 5CYFA 2ZTCA 5K20A 1JDVA 4AECA 1XCLA 2FRDC 2CZGA 4XOIA 3ELUA 5KQPA 2FR0A 3BL6A 2X0DA 1UJ2A 2JEOA 2XUAA 3ZGVA 3W2FA 1W36B 3D1VA 2QNBA 5B7PA 5CD9A 2QAGC 3EZXA 1GZ7A 4MVJA 4JUCA 3QFSA 3WISA 2UYHA 5KFZA 5CT8A 1JN3A 4GPIB 3EJ6A 3I8XA 3WMEA 3TXYA 1BPBA 1EE9A 4TN5A 3AVYA 5FPPA 1V47A 3OWHA 2LYHA 1N8TA 3GCWA 3RREA 3G59A 2A9QA 4ZTZB 2C4HA 1FIQA 4F5NA 3FZNA 1Q6ZA 2CDRA 3THRA 4I9HA 2HX1A 3AF6A 1KKLA 4M36A 1OB5A 4C6RA 1IXRA 1O6BA 2CB0A 3OHPA 3T38A 2O8BA 1YJAA 3RJJA 4QWBA 4B3TB 1Z2AA 3L3FX 3HJNA 1DI0A 2IEDA 3EGDB 3C2LA 3UGQA 2P8SA 4HSGA 4P2BA 4TROA 2GXSA 1V5WA 2ZB4A 5IJZA 5AYVA 5E7MA 1M2VB 5BVGB 5IAJA 1H1TA 2CFOA 3QX7A 4M46A 3B89A 4TYYA 2WTUA 4IJVA 2FGKA 2AOVA 2BEUA 2BHSA 5EOZA 1KZYC 1P3Y1 1I7QB 4PGFA 4CW7A 4NZOA 1K75A 3G5TA 2Y1GA 3MFQA 4QM7A 4EHHA 4DCSA 4Q4HB 2WJJA 1O6GA 1YHYA 4KR2A 1T1SA 1WXEA 4FOPA 4QUGA 2UVWA 4D44A 1PVOA 5DOVA 1ZM9A 4L28A 1MPTA 3ISCA 4O4JF 1US8B 1J2RA 3KD3A 2HYDA 3VU3A 4KLAA 1XDBA 2BHTA 3PRJA 1FRZA 1X80A 2Q1SA 3EXFB 3N2GB 2R8EA 5B1HA 3PFBA 3IALA 1RJEA 1Y7TA 3FYSA 3FPFA 4DF4A 2D2VA 2BI7A 4Q9AA 2XOXA 1O77A 1U7PA 1EE1A 3BWVA 4BWYA 1GUZA 3M6XA 1LQUA 4GLJA 2OGTA 5JADA 3SQDA 4YV1A 1Y5MA 1T1EA 4BQQA 4GSYA 4HN2A 4W5QA 2RHDA 1MOQA 3BHIA 5KFCA 4C22A 3QU7A 2Q0SA 1XTKA 4RQ2A 4F4UA 1BPEA 3U7RA 1NN1A 3VDRA 2C7QA 1Q0TA 2GBPA 3JQGA 3QJYA 1LS6A 1BE6A 4DLNA 4L7QA 3BWEA 5DWQA 2HWWA 2GEKA 3A6LA 3EGEA 1ML3A 5H70A 4UAYA 1YUMA 4RZ3A 1CUHA 2N1MA 4FFBA 5H4GA 3PNBA 4BVLA 2G1JA 2GKGA 1JTVA 4YMSA 3GT0A 3JYHA 3RYCA 1ESCA 4PYQA 5CUQA 3EIOA 4E5SA 1LD3A 4JVSB 1W52X 4M8SA 2CEKA 2Z4SA 3REQA 1L7BA 5C4GB 4C7OB 3DHVA 1JUDA 3R5FA 4LHSA 3E0FA 3L1JA 1XZHA 1A8QA 4PAMA 1LRLA 3C6KA 1R0RE 2JW5A 1NFQA 3QHPA 1GLNA 3HRDD 1NSYA 5EJGA 2BDUA 5LWQA 3PR1A 1SK9A 4E6EA 1Z4KA 4F60A 1HSOA 1RBMA 4R2JA 4B8WA 1OVGA 4GGOA 4ARVA 5K2OA 1YZNA 3THWA 3FKJA 3GFOA 2OXCA 4CMBA 3LK7A 3A3KA 5T57A 2CV1A 3F49S 2A0XA 4JC8A 2DPHA 3O38A 4RTMA 1FPMA 4TTVA 1S8NA 1AURA 2BL4A 3GXOA 3AH8A 3TLBA 5IUJC 1SVNA 2XEDA 2ASVA 4MUYA 5P21A 3PV0A 1I14A 2AT1A 3RH4A 4MWEA 1SOUA 1V95A 2J46A 4FJ1A 2F00A 5ADUS 4XPIA 4DY4A 1ZLXA 2A9OA 2IIBA 3RRGA 3OZSA 3E8MA 2CXNA 1EP1B 2QL6A 3M70A 2XEXA 4C6TA 4GBMA 1XE3A 4ZIRA 5KCZA 2FP3A 3HUEA 2WTMA 4TZ6A 3WYNA 4X95A 3ADDA 5J2GA 2XQGA 3Q1KA 4MEAA 3CLSD 3Q8SB 4MKGA 2Q45A 2C7BA 3II6X 2H51A 1DAIA 4HDOB 2WM8A 4RQ8A 2NVUA 2JFXA 3G8DA 1XVAA 5F2NA 4JP5A 3LSTA 1GL3A 1B8NA 4GBJA 2OYYA 4G85A 3B1JA 3ZU2A 3L4KA 4CDNA 2II6A 2P30A 1K89A 2HD4A 1XF1A 1X6IA 2BGUA 1R0WA 4BNDB 2XB6A 2ZT8A 5FR2A 1FU8A 5HE8A 2B8EA 2QD3A 1P1HA 1ZOSA 2PBZA 2J3MA 1IBMB 4DV0B 3KWMA 9ICAA 4CXMA 4Y98A 4TKZA 2AEEA 4IIFA 4FYKA 4TS1A 5A7FA 4D98A 4YAKA 4KIFA 4BQPA 5LOVA 2MRLA 1SUAA 3D3QA 4TN1A 4ML3A 4IR9A 3GV5B 3TQQA 3JQ6A 5TPWB 3I34X 3ANTA 4CZ2A 5A3JA 3AI7A 3I6BA 2O2JA 2XUKA 4EI8A 3F2CA 4IL6U 5ALUA 1XYGA 4PO3X 3MJSA 1BCSB 2NZVG 1ADFA 3CX7A 4LZGA 1THZA 3MD0A 2E1EA 1N6IA 1KEKA 3V1TC 2IDKA 2XCTB 2OLKA 2UV8A 2GESA 3GPLA 1ZQOA 2GPWA 5HCIA 1XAJA 5TQ0A 1CQXA 5IT4A 2A9VA 2PX3A 3UC9A 2Z6AA 4JNKA 2CLFB 3LL7A 2YZMA 1YS2X 2ZIUA 4HXYA 4L8GA 1S9HA 1DOZA 2MUTB 4IRDA 2MYNA 5KFRA 1R15A 3FDIA 2HMYB 3H2SA 2HKIA 4JLKA 3CY6A 4UUMA 1PV1A 3WZ2A 4X94A 4YS6A 2BFMA 3ZI7A 2V03A 2H0AA 2G3YA 1TC1A 2PRYA 1H4QA 5EZYB 5M5BA 2NUBA 1IY1A 3EAQA 2VP4A 3BZUA 2F9LA 2F1OA 1A9TA 3WLJA 3WA6A 4CCHA 2D0DA 1K0UA 2QPAA 5HR6A 4J0DA 4RFSA 1OI7A 1EFLA 3IT1A 1SY7A 1UZLA 2BEVB 2NV3A 1YB6A 3T1HB 1X0XA 3EUEA 2CK3D 1XQXA 5D85A 2F76X 2PXIA 5SV2A 4QJBA 3B6ZA 1BW9B 5C2JB 1FNSA 3VTZA 2FFAA 4JBYA 2BBWA 5DBOA 3K9WA 3ZQ4A 2HU8A 5BN4A 1XRLA 2C58A 4IDFA 4HAVA 4FEYA 1YQUA 4GZ6A 4C7JA 3L7JA 2XKAA 3C3WA 3RS5A 4IHQA 3NP7A 1PTKA 4FXPA 1FFWA 2I4LA 4ECYA 4UHEA 1IK4A 1W85B 4CDGA 5DNAA 4EVRA 4ZANA 5AVZA 2V97A 2WWYA 3N5KA 3G0BA 3RRYA 3FFTA 3T7DA 2JASA 3RVKA 4UDYX 3DP7A 3C3KA 2HMWA 3ZI0A 4DQ0A 2PZEA 2ZGVA 4IY1A 2Y1CA 2C3PA 1QV9A 1XWIA 5C8ZA 3WX0A 1AV6A 4GI2A 3RT9A 4TSFA 1P5FA 3VO9A 3GEIA 3NHFA 3R4VA 1M1XB 2I2CA 3ESXA 4M54A 4YFKA 2HL6A 3BD7A 2BJWA 3ERCA 4NMHA 5D6OA 1N0IA 2B1GA 2R8YA 3T5GA 2GBLC 2KW5A 4JLDA 2ZUWA 2W2LA 1R00A 2WJ3A 5CG2A 2I33A 5LC1A 4OQNA 1PLJA 1O95C 2Y66A 5A0VA 5JC1A 3Q8WA 5EE3A 4C0HA 1SKYE 1P1CA 3PC3A 3KKEA 3WGKA 1J5PA 1FX1A 1XZGA 4LGYA 1A77A 2HK9A 3TKAA 1SVSA 1Z63A 2G71A 2XDAA 5L45A 1D1QA 4AP6A 3KDAA 1N5LA 4RV4A 4S1OA 1WB6A 4ZQCB 2VA9A 4P83A 4D0NA 2DG2A 2CVFA 4CUJA 3B8HA 1NXVA 1F0MA 1TZ2A 4L9RA 2FSUA 2A7QA 5IJXA 4PRZA 3Q2KA 5LR6A 4I2DA 1OBOA 5ADVA 3JQRA 4M7PA 4F4IA 3I0ZA 1UUFA 4N8EA 1XJQA 2YZGA 1L5FA 4P3NA 4KYIB 1BA2A 2B9EA 3BCSA 3SNHA 1YDFA 4J9QA 3M2TA 4WNAB 4QGFA 1GUDA 5ALWA 4FTWA 3ETNA 1T1IA 2Q5OA 2VBFA 4BZXA 1MUUA 4JP1A 2JGFA 1V2HE 5L8VA 1P39A 1WP9A 3OZEA 5JS8A 1WDLA 2H52A 5DVZA 4P7KA 2QZSA 4M37A 1K4YA 1IM2A 4LF7B 2OT3B 1H3NA 3KT3A 3DM9B 3HSKA 3H3FA 4JWNA 2JCGA 3P9XA 4B79A 5C32A 3TLJA 3FY4A 1PV2A 3GVHA 5FF9A 4RT3A 1PDVA 2WABA 3NWOA 4CQLA 3NVVA 1GV1A 1KZ7B 3OT1B 3P1JA 2XNCA 1M76A 1P5JA 2G9VA 1II0A 2WLTA 4FZMA 1JDNA 1XG5A 3IBYA 3FYDA 3LP6A 1F14A 4ITUA 3LW8A 2ZI9A 4AYBC 2IK8A 1YQTA 2DFTA 2KE7A 3PW7A 1RCUA 3PCTA 3QE3A 3R5SA 2QLMA 4JKYA 2NP6A 1NASA 2DRIA 2GZ3A 1SCQA 1SK8A 4QJ4A 1G5IA 3P0JA 3A6DA 4ECEA 4CV3A 4ALKA 3BA6A 1I01A 2FUG1 4PWYA 2JGDB 2CXQA 3FUVA 3MLAA 2BTEA 3IXLA 4NJMB 4BZPA 2O06A 4W9RA 3O91A 1UBMS 3G5MA 3TRHA 1SC3A 3PKZA 4IEIA 5GOZA 5DGIA 4Q24A 2W2MA 4L9AA 1XTPA 5F9MA 5K8CA 2Y9PB 4K3VA 3N0XA 2AV6A 3W5VA 4B33A 4DF8A 4MZDA 4X6YA 3I2HA 1SCNE 3PX4A 1FQWA 3C1AA 4Q1BA 1R1DA 1M1NA 3C7CB 5EEGA 5F9LA 2YOHA 2O8EA 1Q12A 3UAGA 3T95A 4MUKA 4XTRA 3ZUPA 5REQA 3KKLA 2G25A 4W1QA 4NOMA 2I9GA 2QN1A 3JATB 1KBUA 4E32A 4FBTA 1WS6A 2QT0A 5H80A 3SZGA 5IANA 1CUKA 3MGGA 1YA8A 4Z7OB 5TC4A 5C8YB 4FLEA 2FEKA 2J31A 3V6HA 2GRAA 2SKCA 1B0AA 2A14A 3ZDCA 5AJHA 1ZG3A 4O3NA 1PX0A 2X8JB 1WKCA 3RB4A 2JZOA 1R6DA 1WE2A 2VAMA 1RRKA 4BEWA 2FPMA 5IF9A 2EJCA 3EFEA 3C5CA 3PIDA 2ZIWB 2PL1A 2HR1A 1QVAA 4DCUA 4PFSA 4ZOLF 3GILA 4BKRA 4MQ5A 2KQUA 2ZSKA 1Q0QA 3SHOA 1U0FA 2C9BA 5HA5A 3AT1A 3A9CA 2NYRA 4B9NA 4H1VA 1XD9A 4HFJA 4YRFA 5I51A 1ZQDA 2IE8A 2NMVA 2AQHA 4DWIA 1F3LA 4AJKA 2NRWA 1I9GA 4YUZA 2NWQA 5IC5A 3IO3A 1IN4A 2HQSA 1FUKA 3RS3A 1R16A 1XKQA 1XVIA 2DGDA 5CFRA 1PL0A 5NULA 4YMMA 3NU1A 3ECCA 3OLZA 3KEOA 3E9EA 1BNOA 4U1RA 3BD6A 2OCYC 3LUCA 1TF7A 1MEEA 1XELA 3CZPA 4DLGA 4OB7A 3N3BC 3KFVA 1A50B 3ICXA 3HY3A 1YJ5A 1E1LA 4NF2A 3SAJA 4C80A 4HJRA 3BFKA 2VRBA 3F6RA 1T2CA 2HLPA 3BQ9A 3GRUA 2IHTA 2W4QA 1ISGA 1GT6A 2AOUA 1VG8A 2H6EA 4R3UC 1JYFA 4ODIA 1J8FA 1TZBA 1F2DA 4EHBA 3PITA 5FBKA 5K0CA 1YZ6A 4NLCA 1GPYA 2X3FA 2A9RA 2PS9A 3MCWA 1VMEA 1QIEA 2WAMA 4J7XA 1Y4ZA 2HLDA 4ITVA 1HMYA 1KYIA 2WB2A 1MG5A 1ZKMA 3ZV5A 1QJCA 3VVLA 1URPA 1LPBB 1LUAA 3JTEA 3JPNA 3X2SA 1H2RS 1JG1A 1OX4B 3KJEA 1JS1X 4FBLA 4LXXA 1KWGA 3WY9A 1M2HA 2O07A 1Z6QA 2NXCA 3LK6A 4PSAA 3ZU4A 4ZVMA 3MDAA 2YXEA 5JQGF 2EFEB 2FRDA 1ULUA 2GZRA 2A9PA 1Q15A 5EQTA 1PFGA 2HHUA 5DX0A 1EFVA 2KHZA 2EFCB 3TZHA 3OFKA 4EZBA 3FDXA 2IF2A 9ICUA 4Q4AB 3DKKA 5BRNA 3S8YA 2QAGA 1Z4MA 4ITRC 4KPUB 3QEMA 1H23A 3SBOA 2XCRB 2BCRA 5JNTA 4BS9A 3UJNA 4B9SA 1FL9A 3K5HA 1DQRA 1DHRA 4UU0A 2O1EA 1MB0A 2XKKA 3HPQA 5U9CA 3QOXA 5EJ4A 3VU0A 2F48A 4R68A 4TKUA 1S89A 4L51A 4B35A 2Z4RA 4C4PA 1JR2A 1M8FA 4D02A 1CU1A 1N2XA 2FSVC 1YAJA 4PQEA 1Q83A 3HC7A 3MRSA 3HR7A 2WWTA 5JZVA 3UBTA 1RQLA 3JQQA 1R3DA 2LW7A 1KOJA 1K1EA 5C3UA 2GN6A 1IHDA 4H7HA 4HMPA 2E4VA 4NU8X 3DBOB 4G0YA 3ANSA 1N5DA 2WVAA 1DO2A 3NAQA 1DJMA 1S1CA 1P80A 5L7TA 3S55A 5COQA 4NCNA 1P4AA 4Q3EA 3NOXA 2EJUA 3PKJA 3HYLA 3V8RA 4B43A 2JFZA 3ESDA 4MIEA 3U9LA 4UEKA 3NX4A 3DE2X 4P84A 4EM6A 3BWCA 4ZKEA 4X84A 5LP6B 4MVJH 2Y2UA 2IH4A 3OFVA 3A4YA 4K9MA 1G7TA 1ZLYA 1T3TA 5F5LA 4H59A 2P4HX 1EG7A 4I6JA 1X1AA 1Z4JA 2XUPA 1FFXB 2AGOA 2CJYA 4QZDA 1Z88A 2Z9DA 4EGAA 5F21A 5GPBA 2WP8J 2YR0A 3HGQA 3W2EA 1PBNA 4JI7B 1PLKA 4P0PA 3OIDA 1QO9A 1D9XA 2H08A 1XMQB 1M73E 2GFIA 2XW6A 5SICE 2RDJA 4BP1A 3EZ7A 2I6TA 1Q0LA 5JTIA 1ZH0A 1AUXA 2K6GA 1F8XA 3HM2A 3T3EA 4KOAA 4IF6A 3AB3A 4DL4A 4LISA 4XDZA 3JSAA 2R6CA 5SY9A 3EYAA 3LX8A 3TLGB 1UOQA 3E7WA 2O23A 1S3IA 5EHQA 2ECQA 3UICA 2CLMB 4MWCA 3CUTA 5EERA 3KQVA 1RZRD 2BH2A 4U2EA 4B2YA 1NG9A 2PY6A 4F4XA 2VF8A 3ZXYA 2H9IA 3GFRA 4JUIA 3DBVO 4MKZA 4HLQB 3TRJA 4Q8FA 2DF4B 1LJUA 1XD8A 4FB5A 4KLNA 1KEPA 4L76A 2QTNA 1EK1A 4B2LA 1OD6A 4JD5A 5KWEA 2GRJA 4KQ9A 2HF2A 5EMMA 2AXEA 3QELB 1F8UA 4RGVA 4AS3A 5JXJA 2HV8A 2H63A 1QHSA 3HVUA 1FJ2A 4OAPA 1TF2A 2X41A 3JXEA 2RONA 2JLSA 2CGEA 4UTNA 3N8HA 1USUA 3ZVRA 3DEKA 3MEQA 3STUA 4ZARA 3FYUC 9ICOA 3O21A 2F4VB 3BKWA 1H5UA 8ICHA 2Q28A 3RHSA 4Q3NA 3OTWA 2X86A 8LDHA 1QF7A 1DADA 4HDKB 4S3MA 1RXEA 3N59A 3ME5A 2ST1A 2OAEA 5LN1A 3I28A 3FFWA 3V8QA 5TMPA 1P5HA 3G2KA 5AUNB 1OLXA 4IFIA 3IQWA 3IE1A 2VUIB 3AF5A 1XRNA 1VG0B 3TEMA 2OO5C 1T5DX 4X1OA 5IULC 4MQEA 3WL7A 3QEKA 4OQ4A 1DNPA 3A9VA 4CMAA 1ZMRA 3HJEA 4QZFA 1HI9A 4WN9B 3OI7A 3HB1A 2YN0A 3D8SA 1QFZA 3B48A 2Q3CA 2DHEA 2TMYA 3MG9A 3D8TA 1H65A 3SEZA 3QU9A 4NPCA 1X0VA 1J0DA 5J0SA 3GJ0A 4S2EA 1CG6A 1E2GA 3AY3A 1P7VA 3WDMA 2FQ1A 4BB9A 5ILOA 1EDDA 3DKRA 3AWDA 1MDFA 1Z0JA 3ROZA 1DBIA 3AVXA 4KYTA 1EKXA 2AG5A 2X8LA 5EIWA 1P81A 3PL5A 4EWLA 1NATA 2AR0A 1JVBA 4UAWA 3L04A 5CVEA 2C5AA 4G01B 2PR7A 2RRDA 1GU1A 2R3SA 1ZR2A 1U5CA 5DG9A 1VZ3A 2P9TA 2B8WA 2KNJA 3ZK8A 4BASA 1SMKA 4YG2A 1IMJA 3K8QA 1NXPA 2V0GA 3TQCA 1YZQA 2FZ5A 1CRXA 3X44A 4R3NA 5ALHA 5HKBA 3IT0A 1U0RA 5DISB 3RB3A 3G2QA 1ADBA 5DEIA 2VUTA 5IBQA 3TOXA 2NX2A 2V9WA 2Q9AA 3RFVA 2ZJ8A 3KZNA 2GTPA 1Y6QA 1RM5A 4HK4A 4MWSA 1F51E 3OPNA 4P5DA 3THXB 2D7DA 1QC5A 3TLKA 4IGFA 2D74A 3STWA 4XYEA 3WLEA 2PUDA 3QIVA 2GOYA 1L7AA 3T9AA 3ELDA 3I9V6 2GXAA 4MUHA 3ITEA 1AZTA 2HB6A 3BPSA 4DNQA 4G89A 1EVYA 3M6KA 9ICIA 1OZHA 4ZC8A 2OZKA 1MNQA 5CX1A 4TMXA 3RE1A 1CUVA 3KG2A 2VRCA 4WE3A 3HMKA 3U13A 4GPZA 4PQFA 4FW8A 3BZKA 4QHYA 4IZIA 2D3TA 5IZCC 4TYNA 3K9QO 1SUWA 1QQ5A 2Q0HA 3VZPA 3NIGB 2H1IA 1PJAA 2DEUA 4AIRA 5BN3B 1EFKA 3MT8A 3LVVA 4Q37A 5JHHB 4OXIA 1XWLA 4C76A 1K7FB 5JCZA 2KIVA 3GFGA 4JXXA 3B52X 1E6EA 3PICA 4NCAA