4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
3U7GA 2HEGA 4XOUA 5AVVA 2JGAA 5AI0A 5AVXA 3R09A 3PDWA 3QUTA 3BWVA 2I34A 3ZI4A 3ET5A 1RQLA 3E8MA 2B82A 3ZTYA 2FPXA 2X4DA 3E81A 2YJ5A 3NASA 3A1EA 4GXTA 5ALTA 4DFDA 4UMVA 5AI9A 4ZEWA 2R8XA 1RKQA 5ALFA 2HF7A 2YN4A 3KDPA 2NYVA 5AI8A 1U2TA 2OA0A 5ALGA 1F5SA 2B30A 4QQFA 4UMDA 5ALOA 4UAUA 4HAIA 1EK2A 2C8LA 4PNHA 1FEZA 2P11A 1RMYA 2NO4A 3PGLA 2HX1A 3A1CA 5ALEA 2ZOSA 5AKKA 4CF3A 2Q5EA 4YIHA 4KNVA 1RPZA 1Z4NA 4KYTA 1MH9A 3AR5A 5FP0A 2EARA 2FPWA 1U2SA 1Z4PX 2PQ0A 3L1UA 5A3QA 5AW7A 1Z88A 1PW5A 1QQ5A 2WF6A 3DDHA 4J03A 4BEWA 3L8HA 3R9KA 2ZBDA 2B1QA 2YMMA 5AIAA 1Z4LA 5AKIA 1L7MA 2G06A 4UMFA 5AKGA 1WZCA 1SWVA 2I55A 2MSNA 2IOHA 3AR9A 1RLTA 2BDUA 5AIBA 3EPRA 1J8DA 5AI5A 1NF2A 5IT4A 3CZ4A 2WM8A 4QJBA 1T5SA 3WK5A 4Y2SA 3BA6A 4Y2UA 3B9BA 4UASA 4UM5A 3MPOA 2C88A 1S8OA 2YMLA 5E0OA 2I7DA 2RARA 4XPZA 3B8EA 3L8EA 1X42A 4H1WA 3WKCA 3DAOA 2RAVA 3AR6A 3J7TA 3NIWA 3A1DA 3ESRA 4I9GA 2IOFK 3IRUA 3W5CA 3WK9A 4UU0A 1O08A 5ALZA 4UARA 1IWOA 5AKJA 3FZQA 3WGUA 2YMQA 4AS2A 1CR6A 2FPSA 4BNDB 1Z4IA 2GO7A 3QU4A 2P69A 3FPBA 5ALYA 3ZX5A 4DW8A 2WFAA 1L7NA 4OCZA 3AR8A 2R8ZA 1U7OA 4YCLA 1XPJA 2VKQA 5A3SA 1QYIA 2GMWA 5AM4A 4NV0A 3SD7A 5AKYA 2YBDA 3QU7A 3QUQA 2PKEA 2R8EA 3OCUA 5AKHA 2G0AA 2GFHA 3EF0A 5AW8A 5AM5A 2PR7A 3I76A 1U02A 2FDRA 3ZUPA 4UATA 1J97A 3ZWDA 4UM7A 4Y2YA 4E88A 1T5TA 5AK6A 1QQ7A 1Z4MA 5AW1A 4L57A 1YV9A 2YFYA 1RQNA 5AVQA 3ZVMA 2G80A 5AM1A 3ZW7A 2HOQA 4BYGA 1YMQA 2IA5A 4BKMA 5AM3A 3MN1A 3ZVNA 3U13A 1WR8A 3F9RA 3IB6A 3M1YA 1NRWA 4BX3A 2G08A 4EENA 1Z5UA 3U7EB 2HO4A 3L7YA 4RESA 3WK6A 1L8LA 3R4CA 2QLTA 4OFZA 3ET4A 3FM9A 2C8KA 4BEVA 5AW0A 3NALA 4HGNA 3OTQA 4HYTA 2HHLA 5ALWA 1K1EA 3AR3A 5AVTA 2YJ3A 3ZU6A 4C4RA 4KNWA 2GHQA 2O9JA 2MU2A 1Z4KA 3PCTA 2HDOA 5ALJA 3I28A 3VAYA 1Z5GA 3U7HB 2AUTA 4EELA 2Q4RA 3SLRA 1JUDA 3KZXA 1TE2A 5AI4A 1Z4JA 1YNSA 5AW5A 1Z4OA 3KOOA 2FPUA 3A3YA 3L0YA 1L7OA 2YJ6A 1ZRNA 4Y2JA 4BNDA 3B9RA 3TLMA 4Y2VA 3GYGA 4C4SA 2NO5A 3MC1A 3K1ZA 2YMPA 4FFDA 4C4TA 1L7PA 1ZRMA 2ZBEA 3WGVA 3UM9A 3N28A 2W4MA 1TJ4A 2WF7A 4UW9A 3DNPA 3QYPA 2AMYA 4YGYA 1EK1A 3QU9A 5ALNA 5ALMA 5AVRA 5AVUA 4JDPA 2IYEA 2JAOA 4KX3A 2FUEA 1SWWA 2HF2A 3SKXA 3N8GA 2G09A 2W43A 1NNLA 1ZS9A 3I6BA 3E58A 1VJ5A 2CN1A 5AW2A 4BX0A 3NUQA 5ALSA 3MMZA 3DV9A 4KX5A 4NFLA 1O03A 2B0CA 1RMTA 4YCNA 2OBBA 3NANA 4AP9A 4NAVA 3N1UA 4OD0A 2B8EA 3NAMA 2FUCA 1SU4A 4G63A 5AVZA 4FYPA 3SKYA 5IS2A 2FI1A 3U7FB 1Q92A 3FGOA 5AW9A 3EWIA 5AKZA 4DCCA 2C9MA 3U26A 4F72A 2WF8A 4HGQA 3SHQA 4UAVA 2I54A 1VFPA 2QYHA 3W5BA 2BDEA 4CF5A 4FE3A 2Q4TA 2P27A 1RLMA 2RBKA 1KYTA 3ZX4A 2ZG6A 2B8JA 3UMGA 3W5DA 4OHFA 1CQZA 3AR4A 3OCXA 2OM6A 4Y2RA 1U7PA 1N9KA 3ZVLA 5T41A 3SF0A 5ALVA 3QU5A 1Q91A 4J2TA 3L0CA 4HGOA 3QUBA 2DQSA 4DWOA 3N07A 4NABA 5ALIA 4ZEXA 3ZTWA 4Y2QA 2MU1A 3KBBA 3QLEA 3L5KA 4EX7A 3ED5A 4MUMA 3ONNA 5AESA 3OCWA 4L6AA 2I6XA 4YIKA 5AKEA 3AR2A 3RF6A 2W11A 1L8OA 2IOFA 4CF4A 4IG4A 1TA0A 3D6JA 5ALKA 3OCZA 4B6JA 1S2OA 4XQ0A 4Y2TA 4EEKA 4F71A 4AS3A 1Y8AA 4CNQA 1YJ5A 1ZD5A 4KN8A 4EZEA 5AVYA 1VJRA 3WK4A 3P96A 1RC8A 2AH5A 3L1VA 3W5AA 3OCYA 4L6CA 1QQ6A 2CFTA 1Z4QA 3U19A 3WKDA 3WKBA 2B1RA 5ALUA 2WF9A 5ALRA 1YDFA 2CFRA 2G1AA 1RKVA 3ZWKA 1RLOA 3OPXA 3QX7A 5ALQA 4Y2XA 2ZBFA 4HGPA 5A3RA 1LTQA 1TJ5A 2RB5A 2ZXEA 2HSZA 1WPGA 2C4NA 3FPSA 5AW6A 2CFSA 3M9LA 2ODAA 4BBJA 4EX6A 1AQ6A 1ZOLA 2JARA 4YH1A 1L6RA 4ZEVA 5AKXA 1XVIA 5AW4A 4O8CA 1TJ3A 4YCMA 2WF5A 4CE6A 1RDFA 4I9FA 1RMQA 1RRCA 2R8YA 3QU2A 5AW3A 3WKAA 2OYCA 3EF1A 5AKLA 2GHTA 3CNHA 5AK4A 3IJ5A 5AVSA 3L8GA 2O2XA 2YJ4A 5ALLA 4G9BA 4MWOA 4XE5A 3NRJA 2JAUA 5AHXA 5ALDA 2BY4A 3AR7A 3WK7A 5AICA 2AGVA 2JAWA 2P9JA 2FPRA 1LVHA 3QNMA 1XP5A 5AK5A 1ZJJA 2EAUA 5JJBA 4UMEA 3SMVA 2HCFA 1WVIA 2WHEA 1RKUA 5AVWA 4Y2PA 3L8FA 5ALPA 2D2VA 3ESQA 2HI0A 5ALXA 2ZBGA 4HGRA 3N5KA 5IT0A 5AI6A 2YY6A 3QUCA 1ZD3A 4GIBA 4Y3UA 3E84A 3L0BA 2G07A 3HLTA 5AM2A 3PGVA 4JB3A 5AK3A 3OCVA 3QGMA 3RFUA 5ALHA 1QH9A 2EATA 3QXGA 1ZD2P 3KD3A 1N8NA 3UMCA 3HYCA 3UMBA 3S6JA 1T9ZA 3FVVA 3WKEA 4IFTA 4UU1A 3WK8A 4BX2A 2FEAA 4RETA 3I1YA 1YS9A 3KC2A 1ZD4A 5AM0A 4NWIA 2I33A
chains in the Genus database with same CATH superfamily
5EQJB 3VQTA 1W5AA 2FMTA 4B6EA 5EJFA 1DDOA 3CX3A 2ICAA 5BPFA 3MRSA 4UVEA 1R0YA 2IY7A 2NU9A 2H7CA 4RA9A 1CPYA 1KDRA 2HKIA 5C5EA 3DE4X 1NJ5A 5AVKA 2ZOSA 5DBIA 1L4UA 1J42A 2V6BA 1MA0A 3CX4A 4WCFA 5L45A 3VJKA 4D80A 1OGYA 5KNBH 5ESWA 1Z88A 1AO3A 3L8HA 5C4MA 3QMPA 4GPEA 1Y5NA 1G7TA 3GZNB 2PANA 2X42A 1E5LA 1L4HA 1PJTA 3R7AA 5L1IA 4BBZA 3GFSA 4YRBA 1IMOA 1L9XA 3GD7A 1YASA 3FH0A 2H1RA 1T1RA 3OZ7A 4CW7A 3AHFA 1EP3B 2CLHB 3NRCA 4EJ2A 4KLTA 2IXAA 4DSFA 4DAEA 1UP4A 5KYTA 3BIFA 4RLSA 3QYJA 4A7PA 1QGUA 2E4YA 4R81A 4ZAWA 1M6NA 1RWQA 3DPSA 2AG0A 4L75A 2MYPA 3T9FA 5HFJA 1OZHA 1P0IA 1P2SA 1B1CA 4QWMA 2BEKA 4JI3B 5AM3A 3IR5A 1ZWLA 5IKOA 3IAM1 3QOFA 1M2VB 4MVXA 3OQ1A 4P82A 5CIYA 4X85A 4DQPA 2HHLA 2VT7A 2V7UA 3CPEA 4UC0A 3HLKA 4C08A 5IX8A 2X2OA 1I6WA 1AMUA 3A3KA 1O6ZA 4MJ7A 2PWZA 4O2LA 1XDZA 2ZKIA 3EOBI 2WAMA 4Y2GA 1YONA 4LVUA 3C6QA 2RC5A 2RGXA 1ODJA 2R8IA 3LWNA 4MNTA 5I9SA 3WU2U 1HTWA 1G291 2AMYA 2YXEA 1AKRA 5BN1A 2CSUA 1PFQA 3L1KA 1SWWA 1EWTA 1TMKA 1TT5A 2VHQA 4N18A 1DWQA 1X7WB 4RAQA 4ASUA 3HKZC 5ALSA 2AFHE 3G5UA 2G82A 1XHEA 3NAGA 3KXIA 5BN4A 2P90A 3DYBA 4B6RA 3OY2A 1UINA 2J6CA 2MT9A 3O83A 4C3OB 2RDJA 1WKCA 4EB6B 4D92A 4ZARA 2ATLA 1JTFA 3UWOA 4E46A 2CXRA 2YFQA 2E7ZA 3NOXA 5H3HA 4JDUA 1KVTA 5ALVA 4ZEOA 2XDQA 1EVIA 5B3AA 1LD3A 2GCOB 4EF6A 4MQEA 3ZWBA 5H2FU 5L6LB 4HDQB 2CB0A 5CK5A 4NC9A 3W4KA 4Y9UA 2Q29A 2OC4A 3GFKB 3EIQA 4BKQA 2IOFA 4YN3A 4BU1A 1CK4A 2ECKA 1IIPA 4V1CI 1NYTA 1M8GA 3WYEA 4HGYA 4MKFA 2OCAA 1RWBA 4JNCA 1AHPA 3KHKA 1QSYA 5FWNA 1OZGA 2QP4A 1ST3A 4JS0A 4FX5A 3A6ZA 3K1JA 3S2SA 1U2PA 4ED6A 2SECE 5JZ9A 4C7ZA 1GL6A 4MW7A 1ZVMA 1UC5B 1ONNA 1XMSA 1T7PA 1G5RA 3OFNA 4GMXA 2RP5A 3BN3A 4GEKA 4LNUA 4I4TB 2BGIA 2JLCA 2A3NA 2RHRA 1H1LA 1USIA 2JPDA 1MO5A 2JLUA 3S40A 2VCHA 3K0BA 1Q21A 3BFVA 1UBCA 5IXSA 2W2XA 1LDGA 9ICRA 1NXVA 3LZ6A 2AOWA 5PGMA 1DAIA 5AM2A 3SG0A 5DE3A 3LSTA 1SVOA 3BL6A 1JFLA 4ACOA 1K75A 1GZHB 4JI2B 2DR3A 3F96A 3KB1A 3T5BA 2WOOA 1EFUA 1YZTA 2MMCA 1IZ8A 3ZUGA 1ZK1A 2ZIVB 5K0ZA 3AILA 4EHKA 3FPKA 2WK1A 4I1UA 4EZ9A 1G20A 4MV0A 1HEUA 3U31A 1Y1SA 3LTNC 4UB3A 3IBTA 3M1IA 4QREA 2QTCA 1WCV1 3DVSX 4A73A 3PUWA 4CDNA 2OMEA 4EY4A 5E9JA 1XMPA 3C43A 1QWSA 3O8QA 2CGEA 3H05A 1RD4A 4XD7A 1JSLA 4NU6A 4HWPA 4U9HS 4NV1A 1EG7A 2CVFA 1J8DA 3V4PB 4FI3F 3TO5A 4GP7A 2L82A 4J6EA 3DMTC 2W2PA 4HJRA 1HOXA 3T52A 3WKCA 4PZEA 3WK9A 4IINA 2ILTA 3T1NA 2V7WA 4MFAA 4O4JB 5J0YA 3B9QA 2OGZA 3RTBA 1VLJA 4LW8A 5ESRA 3SEQA 5A4MS 4M1ZA 3QUQA 1R6UA 3F98A 3UMYA 3VZDA 1N56A 1KK0A 1I32A 3IAAA 1NYQA 5CTJA 3ISCA 1YQQA 3SENA 5FYDA 3UV3A 4J9KA 4QQRA 4FCWA 4AQ7A 4CM4A 4DMKA 1MG5A 2XKBA 2PZFA 2K4PA 1J20A 1QTMA 3OEHA 5TPZD 4QGGA 4NH0A 3ZHOA 2PSEA 4ZGWA 3NDJA 5IILA 4WK0B 5FOUA 3BMOB 2G40A 3Q7TA 2VNAA 1KJ8A 3SDBA 2HDOA 3BTSA 1UT5A 2FFBA 2AUTA 1IOVA 2XBMA 5JH7B 1WU7A 3TTVA 4WKCA 4LF5B 2EL7A 3BYZA 1OJ7A 1X7GA 5DGIA 2HIHA 1E99A 5F2NA 3MC1A 2LYBA 2XB2A 1LK5A 5J0WA 3I5XA 5E4JA 1R8JA 1CDEA 2A9OA 1BJRE 2G5IB 1KL7A 4DOMA 4XDGA 2DY0A 4OK5A 4AI6A 2R7KA 5JAHA 3HKEA 4Q3OA 1LDMA 1PGNA 5JI2E 3I62A 5LP6F 1N2IA 2CV0A 4GLJA 4HQ6A 3LPAA 2E6UX 2C2XA 1BFUA 2Q1XA 4CLEA 2K2WA 3AERB 4KE7A 5HKKA 5ELMA 3PXEA 2CHUA 1L3SA 1VFPA 1I5EA 2RHMA 3RSCA 3FG9A 2CYCA 3CP8A 4IQFA 1UDAA 2OB2A 2B8TA 3EDCA 3WOHA 4IVQA 4USAA 3ZGOA 2ZUSA 1HL3A 3P0IA 1S4MA 2ADFA 3VU9B 1B74A 3TM5A 2BBSA 4G5OA 2W2VA 3TZ6A 4OBBA 4Y98A 4CT4B 3BAZA 2IEDA 3AF1A 2CMFA 3H11B 2XCOA 3GQBB 3A9CA 2QROA 2A9RA 1L7DA 3U16A 1O0BA 4KQFA 4YWJA 3S70A 2WOJA 4ZYWA 3CR3C 2IYUA 4PAMA 1CF4A 3M7DA 2WA1A 4W9MC 3ZE8A 1Y63A 1N4DA 2EFHB 1J0DA 3NORA 4OOEA 4BO4A 1MXFA 2BUBA 1Z47A 4ZP1A 1H6DA 4BFLA 4QTXA 3QY0A 3MGGA 3NTVA 5KKNB 1Z16A 1TVAA 4ED3A 3TNFA 2D2IA 4KU4A 3BEOA 1AGRA 4M1OA 4A1OA 3I05A 5DM70 3VO2A 2J5RA 1UOPA 3IEVA 2ERXA 2VKTA 2RGAA 2WIBA 4QDOA 3EFHA 3WNBA 3WYDA 4O1MA 3WGLA 2BFBA 5LOVF 1N25A 4G84A 4OBEA 1RYDA 1Q0TA 1BFDA 4PQRA 3MOIA 3RSHA 1VG1A 1XKXA 2B2XA 4TRNA 1XALA 2FX2A 4MW1A 3K0KA 4HT3B 2VJOA 4PSCA 1RQLA 3AOGA 2PFPA 1Z5WA 2GN8A 1VA5A 2PFSA 2WM9B 3QVVA 4QGAA 5ICCA 3FPFA 3L41A 2CE2X 4ECAA 3LQQA 3E9EA 1BX0A 2QLLA 4RD0A 2HADA 7ICOA 3AETA 3KEMA 1OWLA 1R12A 5FBKA 3TM4A 1UBSB 2XITA 5LDHA 1MB2A 4KLRA 2WJ3A 1WO8A 5KFBA 4MQFA 4PFJA 2OLEA 3L0OA 2ZW9A 1G3IA 4QZEA 5FPHA 1VLVA 3LE8A 4NZMA 3BJYA 4EABA 4EQ6A 4PYRA 2Z58A 2FY8A 3RHZA 3WZLA 3VU0A 1UKZA 1S4QA 3EW9A 1UK8A 4RYDA 2VA2A 1S01A 1EVEA 3OAAA 3MM4A 3ZR4B 3DAFA 4R51A 3P2YA 3GR6A 1OX5A 4N9QA 2NUPA 1A7KA 3K4QA 2D1RA 3R6GA 2OCDA 3B52X 3LDAA 5DP2A 4RHXA 3OUZA 5H1YA 3W6OA 4NCJA 1VG0B 4LFAB 5JSUA 2QM8A 5D3MB 1VL0A 3MTAA 4WZAB 2ZANA 4PCAA 5K0BA 1E2EA 5ERYA 4JLVA 5IEJA 1L8LA 3GRCA 4BEVA 5B6IA 3QIVA 4AY4A 3A26A 2PUEA 3ZWQA 2JLXA 4YRLA 3DTVA 2X14A 1W5SA 4ZAZA 4BFXA 3NDPA 2VDOB 3ANMA 1KPIA 3F49S 2O8FA 2ZJZA 3A31A 5J2IA 1YF3A 5LQSA 1HXHA 2XPCA 1QDLB 2A35A 2Y2UA 2RKWA 2TYSB 4DCUA 3D3EA 1ZEMA 4AIRA 4AMGA 2C7PA 5EXDA 3WQHA 3E3OA 5J2KA 4TKUB 5F9NA 4BUGA 3SYZA 1LBHA 1SUDA 4A9AA 5BN3A 3EY4A 4L6IA 3EVAA 5EE3A 4GVPA 1TCAA 3M6LA 4L3VA 3ROKA 5B4VA 3NQ41 3LK9A 4RD1A 4YCNA 1X7HA 4RVNA 5JU6A 3PIIA 2FI1A 3A11A 3KKMA 4ZU6X 4K86A 4DXAA 1GEGA 5CPBA 2PCLA 4YEDA 3A0RB 5EIEA 4YXJA 1DV2A 1PK8A 1LV5A 2B5VA 1Z8FA 4KFTA 4E6EA 1FF9A 2DTDA 4QWAA 4BFSA 3AR4A 3HWX1 5IKEA 5KBYA 1DAOA 1YCGA 4ECWA 5FQOA 2DSNA 2LDBA 2P2NA 3EXHB 3HBFA 3DG9A 2ZI5A 3W77A 4EX7A 3R20A 3BZUA 1MO6A 2O4CA 1ORIA 3BIWA 2QX6A 4D41A 4AY3A 3VC3A 4DS5A 5JW6A 3BK1A 4YASA 4B5LA 3PUYA 2PMDA 1BCSA 1G6OA 2UYQA 1E7SA 1O4VA 2XDWA 2GBLA 2Q1SA 2PUTA 3B9JA 4M88A 5DT9A 1MO4A 3SS9X 3RHFA 2BTQA 3L6BA 1KYQA 4G25A 4Q1EA 3RVBA 3K0CC 4Q9NA 3A37A 2AC7A 5K4GA 4EY5A 1VIDA 4XARA 4ND5A 1ARZA 2WTNA 4ADSG 4CM9D 3QJ5A 3BCHA 3CCBA 1YS4A 3LLSA 2I3AA 3UXEA 3FOBA 1L4BA 1E79D 3AU8A 1R8XA 4P33A 4JKOA 4IF4A 2P9JA 4X91A 5GJBA 2NV3A 4EW1A 5KFFA 1W96A 4Y2PA 1A8UA 4JJIA 4PAWA 3MUEA 4BPBA 3VX3A 4AJOA 3NB0A 4FYJA 3ORYA 2AFIA 5CM9C 1SVIA 1V96A 4WLUA 1CP2A 1OXXK 1H0RA 3GG9A 2Q4OA 3NHYA 5F9MA 1SXJA 3IPRA 4ELUA 1ZQSA 1VLBA 4PHAA 3MMSA 1CEEA 3TW8A 1XSEA 4B34A 1QB8A 2XUOA 4R01A 1J0AA 2ET6A 3Q7EA 4AZ3B 1FX0A 5DCUA 1Z07A 3BDPA 9ICNA 4D9MA 2Q9AA 2IEZA 3N8HA 4IRKA 5IFKA 3TUJC 3E6AA 4DJDC 4G0OA 2P2SA 5EJ8A 3WYGA 2IQIA 4UMFA 4B4DA 1RI1A 4MSUA 4YMTA 4I4LA 4URHA 3BGVA 5BSVA 3U6KA 1DHTA 4U0JA 1CQJB 1Z39A 3KLOA 1GZ5A 9ICCA 1UPFA 3RK4A 2HQ1A 5ES3A 1TA4A 4ZAXA 3G0OA 2Y3IA 5JFTA 3WGUA 5IJAA 2BRUC 2VJLA 1A9YA 4K6HA 3W78A 3UUWA 3FPBA 3O1IC 5IASA 2R6CA 2V5AA 4BECA 1D8LA 2QRPA 1NRIA 4D8WA 2OAEA 8AT1A 4BMCA 9ICIA 5LB2A 1CB7A 2F3SA 2MYUA 4UE6A 4L7VA 4JB8A 4XXHA 1AMOA 1KZ1A 4RPZA 4KE6A 3PEUA 1JYEA 1IXSB 4B83A 3P1JA 3PUIA 4EYKA 5EERA 4UUOA 2G08A 3G2IA 3IBYA 3MS7A 4FQ7A 1GPBA 3O4RA 3JPSA 2QLTA 3ET4A 4OQQA 1T9GS 3TMAA 3INYA 3ZDDA 4DLKA 5G0SA 4HYQA 2JLWA 3ZJ4A 4FK8A 3BBPA 5JWRA 1W7AA 3GLGA 1UEXC 2FRDA 3ROGA 2Y1XA 5KQRA 4RUAA 3ER6A 3IAHA 1JA0A 2QZ9A 3EIUA 4JMPA 4OQPA 2FEXA 3R7BA 1DCKA 4YJ3A 1J8FA 1W75A 1XRMA 8ICLA 2QWXA 2AMLA 4JLNA 2ZM6B 2JD2A 3RYFA 3C16C 4WKNA 1M0WA 2QP9X 2GXSA 3CHYA 1PZNA 3F78A 4B75A 4PQGA 5F9HA 2BD0A 4I14A 2WYHA 2ZS8A 3VR4H 3IJPA 2AKYA 1DIBA 3RVNA 3V97A 2F3NA 5CVEA 2RLTA 3O6VA 3MUNA 5CJJA 2N42A 2AMVA 4HSEA 4Q4AB 1YS2X 4Y6SA 3Q6MA 2JI6A 1LRJA 1J6UA 3X2EA 5CDTA 4KN5A 2O3JA 2VNHA 5FFFA 1FC0A 1M6VA 1LTKA 4CCYA 1ZJZA 3N7RC 4QGSA 3IJEB 3VR2A 4C0ZA 1V4VA 4KO2S 5CDHA 4PSKA 1AHIA 1R0XA 4O02B 3FW1A 4MARA 4IMJB 4RKYA 4XQEA 1ACLA 4Y2QA 1ZQWA 5CFOA 1H3FA 4DN6A 5JATA 4B9UA 2UUBB 1HDYA 5K3BA 2W37A 1DOHA 3CKMA 4NSNA 4G65A 1ZGAA 3H0KA 5GVRA 1A5BB 4I1RA 1HOTA 4FB4A 3NU1A 4PZZA 3UHJA 4TMYA 3I8OA 4ETIA 4AURA 3OZXA 2QK4A 3CPSA 5DLQC 4HZUA 1THGA 3U0BA 3I9MA 3L8ZA 4DA9A 2F4NA 1RP1A 1RRFA 4YAEA 5IF9A 4Y2XA 4HGPA 3JAMA 1K6IA 3ZK8A 1E64A 1VB3A 2JL1A 2WMYA 4CL2A 5J2EA 3P0EA 5HQ3A 1AGYA 1OAAA 3UC5A 3ELBA 3LBAA 4RVDA 4BKPA 4W5TA 3X43A 2PJUA 2QE7A 1XQ9A 1E98A 5ALDA 1K5DA 1X1TA 1HNXB 4BWMA 3BILA 2I3ZA 1MQ3A 1D0SA 2AJDA 3O3OB 4R3UC 1M67A 3BDIA 3RIXA 2NPIA 5I9IA 1JF8A 2VP5A 4EMTA 4MRVA 1YU9A 1RKUA 3K9LA 1AQLA 2QN7A 4TMFA 4RJJA 3W2GA 2B5OA 3KDSE 4ZZIA 1KBOA 2VDNB 2JEZA 3QE2A 1E62A 1T2DA 2H2IA 2WUDA 2ZJ7A 4RQ7A 5LXTB 1U6IA 3ZCXA 1X40A 1SG6A 3H9GA 2O2JA 2PZGA 4XLLA 1D7AA 3EGDA 4C21A 1MHPA 4DHWA 3GJYA 3HB4X 1QAMA 4QICA 3GAZA 4BXOB 1PVVA 1NDUA 4OB7A 3B6JA 1BJKA 3OT5A 1DBRA 1YULA 4R40A 4KLDA 2A9JA 1NVDA 1D2EA 3KSMA 3P2IA 1T3HA 4YRGA 4F38A 5L3SB 2R8RA 2VHEA 3MELA 4NNOA 3W2TA 4R2XA 4EA6A 4NULA 3N8NA 2NO1A 5JAQA 3CG4A 4N1AA 3W9YA 4L73A 3BQ7A 1CVIA 2UU9B 3RYTC 1FP1D 3FDZB 2XXAB 3MGKA 1HYHA 4BDSA 2RH4A 3UT6A 1VC2A 1JG1A 1BMTA 4U7GA 4D4KA 5AKGA 4UNSA 3MGHA 1L3CA 2Q0XA 3V34A 1C20A 6Q21A 3LVQE 4H7IA 1K97A 2JFYA 4E94A 1U0RA 2NQ8A 2EZ8A 2RAFA 4B73A 4E08A 1Q7RA 3U3KA 3V8QA 5BSGA 2QLMA 2KYRA 3B6EA 3F3SA 4N0PA 3FDIA 4FFNA 4BB0A 1QFZA 2EFYA 2DJIA 3SD7A 3GRUA 1BPEA 4YDSA 1F1JA 1NVEA 3W6PA 4BE4A 9ICOA 1X2BA 4BGEA 4QU5A 3BS4A 2W9CA 3PC4A 3KV3O 2FZEA 4R68A 3PUHA 2ATVA 5L8VA 1BPBA 2BMJA 4LGCA 4KYUA 3U13A 3AEUB 4ZU1X 3RVSA 4MK4A 2GEUA 1G55A 3AM4A 1ZX1A 3FLAA 3VISA 3ZU6A 2BTEA 2P75A 5CNJA 4LBZA 4A6EA 2YHSA 4MINA 3HM2A 4KUHA 3Q8PB 4OX9B 3L6EA 1SKSA 3GDHA 1G1MA 3L7JA 5HUJA 1EXWA 2AHRA 3L0YA 3F1KA 1U81A 3RC1A 5K6AC 3EGVA 1KAGA 2JGEA 3T3MB 4PANA 1EB8A 3VTKA 4NOMA 3AOEC 4BAZA 5HHTA 3R9WA 4JJ7A 4BLOA 3DFFA 2QXTA 1FMFA 1OASA 5JNLA 3MDAA 2V59A 1NUQA 1E5VA 2X0JA 1ULTA 4DJFC 1Y37A 3UT5A 4FS3A 5EKSA 4NPHA 1C1YA 3KQTA 2QRVB 1JIHA 4RQNA 5DV9A 1ZKMA 1GGMA 3KSDO 4J16A 1KZ7B 2Z3ZA 3QHAA 1H69A 3ZWNA 1QMGA 4FYPA 3LOPA 2WPNA 3RAQA 3HSSA 3AJ9A 2QRNA 2NT3A 2IOQA 3O8OB 3SV3A 5BMVF 2HOIA 1QIDA 4TYPA 4CMGA 2ZRKA 3LT4A 1F60A 4KDCA 1VXRA 1G4UR 2BT4A 4JR1A 4EFNA 5A4FS 5K0NA 3LCCA 2C84A 2BMWA 4JLWA 4XDZA 2KZ3A 4LGVA 5F9LA 4D74A 4GXKA 2IXBA 5FUQA 1M74A 1O9BA 4CF4A 5CUQA 3ZS8A 4D6PA 3BH7A 2AKAB 5JV5A 1D4AA 1EFPA 2O8CB 1SJ9A 9ICGA 4IIVA 5L95A 4C3ZA 3QLTA 4BS9A 2IYQA 1GPMA 2IBTA 2EDUA 2QT9A 1AHHA 2Y9UA 3RS0A 2FDCA 1YB5A 4D0RA 3FPSA 2ZATA 4O2BF 2WF5A 1XX6A 4MDFA 4CL0A 3DONA 2VUSA 1Y5MA 1YS6A 3CNHA 3V2IA 3DE6X 2FQ1A 1IRXA 3VSEA 4LYGA 4B4UA 1UPXA 2PLFA 4H08A 1X1DA 1D4ZA 2PS3A 3B89A 1RRPA 1ICEA 1XQVA 1GD1O 3OF5A 3OHPA 2PKYX 1Z6PA 1U3FA 4GYWA 3RT1A 4UUNA 4J0QA 4XVCA 1IHOA 1X9MA 2VL7A 4B9LA 3KXKA 4YAFA 1N6OA 4Q1AA 2W6ID 5I9LA 9ATCA 3IG8A 1SHUX 1CB0A 3GV5B 4E14A 1KWGA 2Y6UA 4F3NA 1UBTS 2NVUA 1E5QA 2X4DA 2FX5A 3IUYA 3WLOA 4JV1A 2DKOA 3BS5A 3MWEA 5BSKA 1COZA 2G5CA 5ESXA 1XNGA 3O8CA 3TARA 5LQUA 4JQSA 3RNOA 4ED9A 2GLXA 1ND6A 1T15A 1F3OA 3GHYA 4HWSA 2IFTA 1V2HE 1U28C 1GARA 1QQTA 3AM9A 5FA5A 2IIBA 2QZJA 3PY8A 8ICWA 1T3QA 4RF4A 2NU9B 4XIIA 4RA9B 1WMFA 2AIRA 2WP8J 2EJTA 3DYVA 3WIUA 2I7DA 4ZYXA 3OP1A 3MBOA 2QG6A 1ULHA 1GR1A 3BWDD 3BE6A 1BDJA 5IIJA 2XA2A 9ICJA 4GL4A 3FRIA 4OXYA 1EBUA 3Q88A 2VKQA 2IHMA 3RVMA 3GJSA 1TW3A 4RSGA 4JC4A 3VBCA 5SICE 3WWCA 4UTRA 1WHTA 1Y8QB 5LZ2A 4M6WB 3ZVKA 1AKUA 2N1BA 4TWRA 3WV4A 3TXYA 4B80A 2IVZA 3KQVA 3T5MA 2KLBA 4EJ6A 3FZYA 2YIMA 1NHGA 4PGYA 2DR2A 4K4IA 1QGUB 1WDKA 3O4JA 4CFYA 2TMDA 1LX6A 3OPYB 1G8MA 4JSTA 2HQOA 1U2DA 4V1CA 2W8BB 1SKAA 5KJCA 3DS8A 2B9VA 2O2DA 5AXBA 3JQ8A 3GJRA 1TEVA 2REQA 4B4WA 4JUBA 5GIOE 1FUIA 1BNCA 3MWGA 1E89A 5ECGC 1RXVA 2Y9TA 5EL0A 1CW2B 3ASYA 1M5RA 5LLTA 4X00A 1WL8A 3OWOA 4BJ5A 2WSSD 3GPBA 2ZIAA 2RHHA 5FTMA 3WOVA 3RV3A 2V3CC 3GPCA 2ZP1A 2C5AA 1JG3A 2IGTA 1P39A 2BC9A 2WPDA 1PG5A 1KI9A 3LHDA 2QTNA 4C0HA 1J5EB 2C5BA 4DMHA 1N5MA 3CUYA 1WQ4A 2ZRAA 3EZYA 5IXYA 1YB7A 3PUKA 2C29D 4NJEA 3ZHSA 3O7MA 3HVJA 3K9GA 3WGKA 3MS4A 5L3RA 3DMPA 2PQ6A 3RDPA 4Y8VA 4JOCA 4QNNA 2RBKA 3P7MA 1TT5B 5BUSA 3WLRA 1QUEA 4ARCA 1POWA 3G2KA 4Q48A 4FEAA 5DHSA 5JADA 4M8LA 4OP1A 4I4IA 5BN4B 2KHZA 3F67A 3ZCTA 3BXHA 1SCUA 3QUAA 3CZQA 3B6MA 3PL1A 1JAXA 3L2OB 3LD9A 1ZQJA 1FSZA 2NO6A 4KXNA 2BEJA 2YQZA 1MSWD 4K46A 4LF9B 2KZMA 3CLRC 5AVYA 3FVTA 1VSUA 2J07A 3FJOA 3N05A 1ZC3A 3L84A 1YR8A 4BYMA 3AV0B 4QJ5A 1MENA 4NXMB 5C52B 4D6YA 4DXHA 2EJCA 2YYYA 4V0QA 5A0LA 3ESDA 3NVDA 3FA2A 4JSRA 4A2CA 1XVAA 1B73A 5DM60 3HWSA 1TNDA 5AW4A 1VJGA 2GYWA 5E1DA 3I92A 4OXKA 3STHA 5AKLA 1P1IA 4ALNA 4LSGA 4EYIB 3OX3A 3FMPB 1ZBDA 3H1FA 4EPXA 2FSPA 4PU0A 2ZR0A 1U3VA 4HQ0A 3U39A 3UGKA 4ECQA 3N53A 1E2JA 3FVWA 4E33A 3D0QA 4CMIB 4LSWA 1PZFA 1DAEA 3HBMA 3IIJA 1DVRA 2P6PA 1C7RA 1Z0SA 3PV8A 4G5XA 3PJEA 4LNUB 5JC1A 5KFJA 3FCEA 1PX0A 5E9WA 1U4NA 1N8NA 1H1LB 3F8TA 1UFQA 2G4LA 3NBYC 1GKIA 1VRCA 4NZNA 4HTFA 1QG6A 2E87A 4YROA 4XOUA 4YVZA 2KIWA 4HYKA 2COKA 3QXXA 3N8IA 1RYMA 4HDAA 4X94A 1ODSA 1LQ2A 3GRPA 9ICFA 4LA4A 4B3TB 4URXR 1SCKA 2FMQA 5I47A 2G28A 3HXOA 4WGFA 4IJKA 5JZMA 4QM6A 4LF7B 4CQMD 1KMHA 3GLFB 3GI1A 3FPAA 4NBKA 5JJ5A 4ZODA 1ISSA 1IZZA 3RO7A 1NPYA 3IUQA 1VIVA 2R3SA 2CHEA 4ZXFA 4YY3B 3H87A 5E9AA 4IICA 1XJQA 4M60A 3ZDXB 1TD9A 2IVFA 1ZINA 4KREA 1T5SA 4P58A 3KEOA 4UASA 4BMDA 3KYIB 2YV2A 4HC4A 2ZREA 2PMZC 1SKWA 3AR6A 4JJ4A 3P2MA 2V9WA 3UW1A 1IPEA 5DGAA 2ATCA 2AG6A 1YRLA 1SOWA 4E1BA 1A8IA 4OI1A 3M81A 5BSUA 1YRBA 4QLAA 4S1VA 5IVHA 2PHZA 5JARA 3N2NA 5BSTA 4LRXA 2XOKA 3FSRA 4L4RA 5CYOA 4PW0A 2KLHA 3L7KA 2JEFA 3MJCA 4UTPA 3CCFA 4J2OA 2WVAA 3RIHA 2IXGA 4UATA 2W4IA 1LPPA 3H0LB 4DDHA 1NULA 1RZUA 2F1JA 4XR4A 1XWFA 3CZRA 2CCKA 3N39C 3I9FA 2XNHA 4GRDA 3DMHA 4I9HA 3TSOA 1MQ9A 2BBTA 3CU5A 1JMYA 2KEYA 2ZKLA 4BVJA 1SCJA 3C4JA 4F5WA 3EEIA 3MWYW 3UW3A 1W9HA 5D5QA 4H3KB 1J56A 3U7HB 3K7EA 3NX4A 1P1BA 3ISVA 1T1SA 1NLMA 2ZJOA 5FUMA 2AZTA 1Y9EA 2RGBA 4LOAA 3FJYA 3ZNQA 1VCOA 4NLLA 3ZDAA 4FT4A 4GXRA 5DOVA 3RS5A 2OC9A 1L5OA 2LNDA 4M9NA 2EQAA 4UJ5A 2QGZA 2FUG6 4IHJB 3B70A 2R48A 4JJKA 2GRUA 1SVSA 3B1WA 1I9CA 5CFMA 2AGOA 1T0BA 3S0JA 1A50B 1I7QB 3K15A 1RBYA 4NJMA 1I5RA 3ZLJA 3RVDA 1ZHOA 3OU6A 2YX1A 2EAMA 1OUMA 2J9XB 1KK2A 3KK0A 3FHOA 1GSOA 2BR4A 4NZPA 4OV6B 4F7WA 2ZAGA 1T3NA 2QMQA 2OOKA 5EGSA 3HKEB 3TPCA 1VHQA 3SF0A 2SHKA 4RKEA 1CUXA 3HCEA 1N7IA 2VUTA 2FG7C 4RQ8A 3DWGA 4FZ3A 5ALIA 1AKMA 2HFKA 3ZY6A 3P9KA 2I3GA 3H4BA 5J2HA 1QP8A 4Y1GA 3HCPA 3SI8A 1YBVA 2CFIA 4JC5A 1UXGA 5CFRA 5U1PA 3AQFA 3DVAB 1SHTX 1WB9A 1YFJA 1DK2A 1YS1X 1FVFA 4I8IA 1FCJA 3WMGA 2VPZA 1F8GA 2AGPA 1JBQA 5F7ZA 4N8SA 1Q6ZA 5E2AA 4F85A 1D2HA 2JFNA 4O0LA 2A94A 1EJBA 4KAXA 4QVIA 1OYWA 4HL6A 1IWPB 1GV1A 3NDBB 3RYHA 3RS4A 1JR4A 5KYYB 3V6JA 4O8CA 2OCEA 3NGMA 4V0MA 2GYYA 4ZZ0A 4MPTA 1H2XA 2PZLA 1PK1B 4BLQA 4P32A 5JSHA 1OGIA 3HZHA 2LKDA 3QV2A 2YJZA 4HDNA 4OLFA 3HP4A 4EI2A 3SI7A 2AXTU 2Y99A 4KIFA 2P4QA 1P1FA 4Q21A 1IYZA 2NZVG 3QOWA 1GRRA 4R8LA 3TACB 1HC7A 4P80A 2RDMA 3IXMA 1VYHA 1Z2PX 4BV9A 2BCRA 4KK3A 3C7AA 3O4VA 4UFNA 1F9AA 2DHDA 4DDWA 3PJDA 3RUCA 2HWKA 3K1YA 4Y7CA 3VUEA 3V6HA 5C5JA 1NU8A 2BCSA 3PITA 3P2KA 2BFBB 2DPYA 1ZP6A 4QPPA 3X1YA 4BNMA 1K7EB 3AVPA 3PHCA 4F4HA 1FVOA 2ZIXB 4W5QA 5CG1A 4BO2A 2P8JA 3TLGA 5ALOA 4PBRA 2ZTDA 1Q11A 4IY1A 4C6RA 4YUYA 2F2AB 2VATA 5DKFA 3C7KA 3FGNA 4BEWA 2XVYA 1V95A 3BSSA 3PNQA 3PSAA 2I4TA 4EHNA 1TADA 2X6RA 3HHPA 1MPTA 3FHLA 1T34A 3VSDA 4PS1A 3EQ2A 2O0MA 1T9BA 3AETB 2RARA 4M1TA 4GNKA 3IKTA 4GWKA 3JV7A 8ICNA 1YT5A 4OXIA 4FYIA 4OFBA 2LCQA 2YR0A 4ITVA 1Y4DE 2UXDB 3LHSA 4LAFA 2QL6A 5IINA 1JJIA 4DSNA 4ZDWA 1GZ4A 2IHZA 2GLTA 4CTJA 2QTAA 1USKA 1QQ7A 5F5NA 3HI6A 2XIJA 1AJEA 1OUQA 4UBOA 1RKBA 4CG1A 4WNAB 4NS4A 3JATA 3G2OA 3SQOA 3A06A 3WRWA 3AK4A 3JRXA 2EWMA 3DBVO 1X2IA 2F3RA 4PG8A 2DWPA 4H1VA 3VYUB 1FW8A 1QP4A 3ZE1B 4HADA 2QY9A 1HE8B 5F35A 2IYTA 4M04A 1PS8A 1KQFA 1RYYA 4P1ZA 2RRDA 1P6UA 1BEZA 4I6JA 3OHMA 1UPTA 4JZYA 1Y9AA 3C5GA 4L76A 4UNRA 3RU2A 2M32A 4U3JB 2NU8B 4COKA 4DIMA 4JCCA 4D9NA 3T9BA 2EKDA 3LXRA 4V0NA 4Q1CA 2A57A 1NNLA 3V2HA 2O8FB 3FLBA 3JQDA 5AW2A 2EANA 2RAPA 1D5CA 2DFTA 5DZSA 2J4CA 3LUPA 1GU1A 2HUPA 2Z5GA 4JB0A 3NANA 2HLHA 4AF8A 5KFSA 3BHIA 3PQ2A 4Z8XA 4QWCA 2VRNA 5DYTA 4Q37A 1YK1A 2QX8A 3MRXA 1KU0A 3PXCX 1YOVA 1NXSA 3COSA 4BLUA 5JS6A 2JZNA 2X76A 3A9VA 1UFVA 2RGRA 2LPMA 3QE4A 3RFXA 4ZI2A 4AICA 2HHQA 1RS0A 4LGMA 3ENVA 2DEUA 7ADHA 2PX0A 3HA5A 1KEEA 3P45A 3DZHA 1ETHA 3WNVA 2JDIA 4N0MA 2YOFA 2VLIA 4B45A 3LW8A 2DY1A 4ODIA 4INZA 4ZQHA 1UWLA 2QRGA 2JV3A 2P9ZA 1TAUA 4B6QA 1HJPA 3STVA 4QASA 4H16A 1SH7A 3ZEIA 4GD3Q 2WUWE 3RKRA 4DCJA 4HH3C 4YT8A 5JMWA 5KU7A 4KWTA 2F4VB 4RTNA 3CLKA 5EP3A 5KFRA 3HY4A 2PIDA 4W4TA 2RB5A 4FOSA 5BQXA 2G77B 5JNSA 4B4VA 3HVIA 5TZVA 2Y1FA 1BCSB 4GZ5A 3EF1A 3E1GA 4R1MA 5J0PA 2XTJA 3H9BA 4TV8B 3NFRA 2OYRA 1U9IC 1NL3A 4E2WA 3AGQA 2PLAA 2C5EA 4F91B 3VA7A 9LDBA 1FBNA 1C0EA 5KTMA 3T5TA 1ENYA 2AX3A 4PQFA 1VL1A 1N61A 4L8FA 1FSGA 1D2RA 2YY5A 3GLIE 2XE7A 3DEIA 5C8DA 3HMKA 2C2KA 1IBCA 2OOSA 3WO0A 2FSVC 3IKVA 2ADMA 5HR5A 3UUFA 1PCXA 3HKBA 4EF5A 1NF3A 4PN7A 4L4ZA 3LUAA 1JBEA 1PT7A 1JMKC 1LXCA 3BWVA 4K81B 1N2CB 2JCGA 3UMFA 4C9BA 5EYPB 2KJ5A 4OHXA 2SCUB 5KU1A 2VJNA 3LHFA 1XRRA 3CLRD 1W0JA 1Z28A 4I55A 3ABZA 2WJWA 3G89A 4XQGA 3L4BC 3TQHA 4AY5A 4IIJA 2QRJA 4WZBA 1E59A 1BN6A 3KPVA 3TW8B 2PKQP 2RI6A 2XEXA 3RAGA 3UHPA 4M8NE 4LMRA 4KODA 5CJ7A 1LEHA 3R3VA 4MUJA 5J2TF 3FF4A 2QJFA 5NULA 1V7QA 2GFIA 2O8NA 4M76B 3D7LA 1H8HA 2FEPA 2GD0A 5KNDH 3HJRA 1SUWA 2HTFA 3ZDBA 3IOBA 1N6IA 3NKFA 3E70C 2RAVA 3RC3A 5LMZA 3IRUA 5J1TB 4S1OA 5A7GA 4OJOA 2H2DA 1OC2A 4J0JA 5GM1A 5FTKA 2I1VB 4MLDA 1ODLA 1GADO 1XDBA 2FZWA 1NATA 8ICAA 2VJKA 3BXFA 2C5SA 1VDVA 4X6YA 1NLZA 3TD9A 2NSJA 1PHRA 5KFOA 1OI4A 5ERXA 1T8UA 4CV2A 3GT3A 4B43A 4CR6A 1GQOA 3BPSA 3NEJA 3ASZA 3STUA 5H5JA 3AR3A 3PEYA 4PPFA 3BKXA 1R0CA 4RUCA 3FDJA 4ALJA 1RM0A 1XL0A 4V3BA 1J5XA 4HQNA 1AKTA 1XEAA 2ATEA 1LY1A 1ACJA 4P3YA 2ZULA 5JXJA 3OT1B 3GXOA 3JAWA 1W30A 421PA 1Z4OA 4DYVA 1KMNA 3TSAA 4BNDA 1WCNA 4C4SA 1BXRA 3OJUA 4CN9A 3RC9A 4UB1A 1OGJA 4IDOA 2UVUA 4R66A 4AJ2A 3B13B 2OKCA 3NO4A 3RLIA 2VS1A 2AN9A 3RWMB 2ZSHA 3I6BA 3E18A 1I80A 4MEXA 2EP8A 4ZCPA 2PS0A 1JSCA 5IUJC 3GJ8A 3H5WA 4RHYA 2IYLD 1DK3A 4LHYA 5EGNA 3RYFB 1DEKA 3WHLA 3LA8A 3MJVA 3SU8A 4MGYR 1VGQA 3W5BA 5JSKA 3V33A 4S35A 2IQ5A 4DZRA 4OKSA 2OXOA 1I0IA 1SKYB 7ICPA 3I01M 2QW8A 3KJQA 3R23A 2O54A 2XKAA 1NQ5A 3GEBA 2YN0A 2G5GX 2ZZKA 4LDAA 5CCDA 4RS3A 2DFKB 1MDFA 5A2QA 4KLUA 3KOZA 3TUZC 1G6KA 1M6VB 2ZTUA 4H2DA 3EUWA 4CCYB 1S8FA 2CYAA 5J4LA 2XE4A 4DL2A 1G7CA 4OMCA 3SX0A 2W6JD 5DYYA 4JWMA 5CDFA 1ZQHA 2YXDA 1CC1S 5KO2A 1IY2A 1NXXA 2O1EA 4EFDA 2UKDA 3HP7A 1UJBA 3P9NA 3L06A 4KWIA 3BEDA 2ENWA 1XE3A 4U7JA 5KFDA 1XQXA 3ZXSA 4UUMA 4C4PA 3Q72A 1MC5A 4HFJA 4Y1RA 1W93A 3ENZA 4TSKA 3SFVA 3PQ5A 5CT6A 1W52X 4I5GA 5DOZA 4K4GA 1V71A 2NADA 4W1SA 3A6FA 1Z5VA 5E1MA 4BNNA 4EB3A 5JD5A 5LZ5A 1AZTA 4CJXA 2XQJA 3KYBA 5EC8A 1VL8A 4U6PA 3S3TA 3TX2A 4QU9A 1JXMA 3FNEA 4UVDA 1ZQ1C 5JISA 2V7QA 3K2QA 1WMBA 1QV7A 4YUAA 1MUUA 2X40A 3J81k 1ESNA 3UMCA 1CUCA 3S6JA 4OQXA 5DLPA 1GFZA 4CUJA 3L9WA 1Z68A 4GWGA 3KE8A 5K3OA 4ZDIA 4RNNA 3JQCA 1RWNA 3DLCA 2UXCB 2H5XA 5E4TA 5EAIA 4JT4A 2F3PA 4RM3A 4HH1A 1GIAA 4YR2A 2HNKA 3MBIA 1LB2B 4QDUA 1XF1A 1WZIA 2UVPA 3D43A 2G6TA 4DV7B 4IJQA 2Q5EA 3PDUA 1I6LA 2GERA 2J33A 2I67A 5ELXA 3BMXA 2GK6A 2R84A 4IV0A 2CNWA 2OBLA 3N7TA 4KQHA 5E3JA 2FZLA 1DPGA 1KJIA 2GA9A 4AJLA 2FE4A 3OE5A 5HS6A 5FUBA 1ZM2A 1EB9A 4KKXB 1V16A 4AUNA 4AMVA 3FAZA 4YX9A 1SC9A 2G0NA 1XO1A 4BV2A 2OHFA 3BULA 3L7DA 3AB3A 1QFMA 1XZLA 4EG7A 1JFRA 2DC1A 7ICUA 3CRNA 1FDOA 1Y5LA 2ZCJA 1J0XO 3KETA 2QTMA 1ID8A 3KBOA 3COZA 1FTNA 4R5HA 4D44A 1XWLA 4FHDA 1NVKA 3H65A 4EJSC 3IAUA 4DSOA 4ML3A 3KRTA 3PRJA 2XRFA 4TLAA 5L4NA 1EAMA 2POCA 5F77A 4JXXA 4WXPA 3RM3A 5TQ2B 3IBFA 4FFSA 4MRSA 2H1WA 3VTFA 2GPNA 4FZ5A 1CRPA 5EIHA 5GONF 1JEJA 4WBNF 1VMIA 3TRFA 5HUQA 1KPGA 1N1DA 4XVQA 3I2GA 4BRSA 3LOQA 1NNEA 2FZKA 4BNUA 2N0SA 3GARA 2ODPA 4DWJA 3AV3A 4TQAA 4ZVKA 3VAYA 3EISA 3OURA 1AK2A 3DR5A 2QD5A 2PFQA 4B4OA 3AIMA 1YL6A 4D97A 3OZCA 4RTJA 3T94A 3TTSA 2G7MC 4NYIQ 1JQLB 5REQB 2I2XB 2PT9A 1FFCA 4E12A 5B1DA 4EDHA 4RV9A 1HFKA 3KM0A 3ABRB 4BTVA 2G5TA 3Q8XB 2FH5B 2C82A 3SQLA 2WKWA 2GZSA 3OF3A 5DN9A 1U9JA 4EPTA 4P6VF 2ZUTA 1KDTA 1W8DA 1VKRA 2F8MA 1W5TA 1ZZGA 1W36C 1LF5A 1SC6A 4RH1A 5TQVA 4BZZA 1SVUA 2Q41A 2ZSIA 1C7QA 2X7XA 4MVJM 3V7JA 2EFCB 2HCJB 3VPBA 2E5SA 1F0PA 3W5UA 1TRHA 1IJBA 5EWEA 2BHRA 4EYQA 3OECA 4K6FA 1DRVA 1XZHA 4DNQA 3VO8A 4RE5A 3QTLA 4AB1A 1C4OA 1ZNYA 4FS1A 2HQBA 4E4RA 4H0CA 3FTQA 4AMZA 2LHTA 1ATIA 1YZQA 1OYYA 3SAFA 1R4AA 2GTHA 4H6XA 1GAXA 4Q4LA 2ZT5A 2XGPA 4NFSA 2JJ2D 4QBIA 3F6SA 3PDCA 3U62A 5K8CA 1AO0A 2HRZA 4WI1A 3EGEA 1VKJA 4MYDA 1P2UA 1VE1A 3U9LA 5AJXA 4I1PA 3AHIA 1LBEA 2ES4A 3ZWPA 2FN3A 3OSUA 2A5YB 4LSZA 4BUCA 2FJUA 5JEDA 5CNIA 1T8YA 2W2LA 2QW0X 5C8VA 1BRTA 2R18A 3VR6H 1PZXA 1ZQXA 4QZCA 4QUGA 3KZ1E 3NR2A 2OZEA 2F9LA 2PR2A 2HBRA 3JWJA 4BN5A 1L3UA 2ONYA 5K99A 1Y7PA 2OLKA 1IHXA 2FHPA 4IF6A 2W2OA 2H29A 5JMTA 1FLVA 3STYA 1JEAA 4W5NA 3QXGA 3G6XA 3WP0A 2JJQA 4DADA 4ZTUB 4A3SA 3JWGA 5DDIP 4AUKA 1K6EA 4OBWA 2G8NA 3WIVA 1NLFA 2ZTLA 4HB3A 1MOZA 3DEJA 2XYGA 2BKVA 3KUDA 3QBEA 3ZGVA 5ALFA 1ZQRA 4BX9A 3BWBA 2I91A 1DDIA 3CBQA 4TYMA 1BWPA 1LTHR 1NW3A 1V5IA 5E79U 3LUHA 3R0VA 3BWEA 1ORWA 4NK5A 4M9JA 3I5YA 1URPA 2EW1A 1YQDA 1NURA 4YACA 4PGFA 1SKUA 4ZOAA 1W44A 1W29A 3THRA 4Z9YA 1RHQA 4R1QA 2BH9A 4EKIA 3M6AA 3BSYA 4NF2A 3T0GA 1AKVA 1JSXA 2VPIA 3WZMA 3GGGA 1M7GA 4OJQA 2Q9BA 4ZDKA 2WYVA 2YYAA 2RHJA 1EFVA 1J21A 1JHDA 2VYQA 1IN4A 5IM4A 1H1TA 3ENQA 7ICEA 2LBPA 1UJ2A 1J0CA 5SY4A 2QPTA 3OJSA 2WYUA 5TY0A 5HIMA 3A70A 5AKHA 4FS2A 1XNSA 4YJ2A 1IQUA 4DVJA 2ZYHA 2J0UA 4RIGA 5CP8A 1T5TA 2P67A 4MRMB 1NMXA 4FT2A 4GUDA 1DWUA 3U4IA 3PZBA 2VDQB 4EOGA 4OHWA 4HAZA 2MYTA 5JCZA 4H0FA 1LV7A 1O6CA 1DBVO 1YR1A 5T8KC 3HO1A 1PQ4A 3PVXA 3OSPA 2R2AA 5KYKA 4HDKB 3DZFA 4JB2A 2FUG1 3OOHA 2A4KA 3WLMA 1LKZA 4D9BA 5TS3A 4X1OA 1UBLS 1WHTB 1KI6A 1L5HA 4KQMA 4NIMA 3SYNA 1FMCA 3IBSA 1AVTA 5I9BA 5KWEA 3G3EA 4P7FA 4OREX 3OM1A 2F48A 4D25A 4GXIA 2UVWA 1I3CA 1J1UA 1QU2A 4OMFG 4I4TF 5HTKA 1VBFA 5IJ0A 2JZBB 1O96A 1OFGA 4YMNA 2FUEA 2WIJA 4TWZA 2XMCA 1J7KA 4IHQA 2W9AA 3DVLA 1BU8A 1RWOA 2V4RA 1O94A 2XNDD 3JQ8B 4B85A 2IYPA 2D5AA 2XE6A 4PHPA 1V3QE 1VJ0A 2PRYA 2JZOA 3NWBA 3TZBA 2IPOA 5CM8B 3WXMA 1LKYA 4UB2A 3I0ZA 3CKKA 4K87A 3KD2A 1CVLA 4G56A 5BWMA 2JFXA 5KVQA 4Z1MD 3TSCA 3WB1A 4LI3X 1J25A 1EDZA 3PX3A 3MCUA 4FCVA 2A5JA 5HWSA 1DIOB 1D8AA 2J7PA 5KNBA 1CJCA 5K2MA 4GPAA 2YC2C 5GPBA 4P83A 1TCUA 1BPZA 4K28A 1ZQPA 1VZ2A 1YA6A 1EFLA 1T26A 4R0MA 3DO8A 2JASA 2A0KA 1FO4A 1LFAA 5C31A 1U9CA 3I6IA 3ANSA 3H97A 5KWSA 1WY7A 1PUJA 1HR0B 3DYIA 3U19A 1Q3UA 4R1LA 4KJZA 4HNUA 1HLPA 4X65B 3AEKA 2UVQA 4FYYA 2CEAA 2HSZA 4TRJA 3BUSA 4GI2A 2PZKA 2R8GA 3OETA 1XCLA 3W7BA 2WQ6A 1LWOA 1ANKA 1C8LA 4N3BA 3U4HA 3ISDA 4O4JF 3OEEA 5ARDA 4B3HA 1J2YA 4DDUA 2OQVA 1UZAA 4IGFA 4C7BA 1OSNA 5CNMA 4DR2B 3F8WA 3KU1A 4YCAA 3VSCA 3SYRA 4QE3A 3RV4A 3TLBA 3DEYX 5K8JB 4ZT4A 5AVWA 1GAWA 3RTEA 2YTUA 1J4AA 3JPWA 3JD1A 3K6RA 4Q9JA 4I2HA 3CRQA 2WUEA 3WHIA 2BHLA 2DBZA 5DTIA 1NQAO 1ZXLA 3WSTA 4BDTA 3ZQ6A 4N5HX 2FA9A 1VLQA 1HMYA 1JHAA 4ZT2A 1UPUA 2FQYA 3TTXA 5KL8B 1P2BA 1XZBA 1ZN8A 2J3EA 4XRGA 2VHXA 4RV5A 4MRPA 5JH7F 3R7FA 3G6WA 1UFOA 5IMSA 2NYRA 4RWEA 1KEKA 2B30A 2LE0A 1GTVA 5H3CA 3MOGA 2RGYA 5KFXA 2VH2A 4C1NA 4B3RB 4QZGA 3SC3A 2QU7A 3DBIA 4GMFA 4ZZ2A 5M34A 4HTFB 4F60A 1A9TA 1FLNA 2H4FA 2C97A 3PPVA 3CEPB 3WL5A 4CPDA 4ZKDA 2P8SA 4JELA 3GU3A 3BD6A 3WK5A 3ST7A 4RDIA 1QFXA 1FL9A 3T7DA 2RMKA 4PFQA 1V9SA 4KACA 2C1ZA 1T4CA 3VVLA 3ZWMA 3M70A 1JP7A 1L7NA 3K9CA 3ZLUA 3HPQA 5JJIA 1FS5A 4Y67A 2BFPA 2MUTA 1BSVA 2YBDA 4EG3A 4OYLA 1Z7GA 3IP1A 1TX4B 2QUZA 4G23A 2WSMA 3T3IA 4LI0A 5EWLA 2W22A 3ROPA 4C0KA 1B23P 3BRQA 3RIGA 4LQ4A 1JDVA 1ULAA 3F7NA 4OATA 4D6XA 1W8IA 5B1YA 1YKGA 4IDNA 3FM9A 1YHYA 1Z2CA 3FOAA 4MWGA 4NYMR 2PUJA 4DSTA 4TXNA 5JVDA 3PTLA 2CB9A 1BTOA 1U2EA 1BS2A 5K1ZA 4JJFA 2VAXA 1E4EA 1B8VA 1PO7A 4YV7A 3JALA 1O0CA 4NCBA 2QAGC 3HDYA 3RPEA 2RQ5A 2HFJA 2J3DA 2ZYWX 1F7UA 9ICKA 3QYPA 3SE0A 4RQMA 4YQFA 4MVJF 1IQPA 2ZIFA 3OO1A 5ICSA 4Q8EA 1BDMA 1A96A 2A0WA 2AZDA 2CYBA 1QPZA 3E58A 4JVMA 4KSBA 2UZ1A 4R7GA 3G9ZA 3HXLA 3VPCA 4WJZA 5CA0B 4L16A 3K75D 1EK6A 1HDEA 4JBIA 4K2HA 1WD5A 2ZUDA 1HYEA 2O2GA 5DBEX 2ZVJA 3RYCA 1PAUA 4FGWA 2ODEA 4YCDA 3A25A 2HLPA 3D6NB 5DX8A 3GJZA 1PR4A 4N6NA 4MLZA 4FLEA 3H75A 5JQGB 1CQZA 1JG7A 1R15A 2WD9A 1MC1A 3GFRA 2O05A 1F8UA 1LW7A 3CKLA 3F6RA 1M34E 3G23A 2OSVA 3DDUA 4O4HA 1KY3A 4DLLA 4L51A 4E7OA 2JAHA 2Y1GA 3U6BA 1C7IA 4LJ7A 2ZT8A 4X7MA 3A58B 4PRYA 2L18A 3SZ2A 5T57A 3TOCA 2X5NA 3RC7A 1E2LA 3S4YA 3IR6A 4GR4A 1WXQA 1JZTA 4AS3A 5F2KA 4IQVA 5DXAA 4KXMA 4RKFA 4UB8U 1TO1E 5DBOA 2WMDA 5B3LA 5B7PA 2EZ4A 3EAFA 1DC3A 3HNOA 3DH0A 4C0SA 1HV8A 3ISJA 1W2WB 4IRCA 5A9RA 4IZHA 2FPOA 4FZJA 4ZEVA 4OHRA 1NRJB 3I04A 4DY4A 1DE0A 5BV1A 1W4ZA 4LBWA 4MAMA 1EXVA 4LE2A 3V42A 4NNJA 4JXZA 5T6BA 3PE6A 2RFLA 4Y6PA 3CM0A 5BVHA 4WCFB 1ZJJA 4XW2A 4P5DA 5EEGA 1P73A 1W36D 4CKEA 3KZVA 1M0TA 2R1TA 3GWGA 3V8VA 1PNTA 4DS3A 2ZFUA 2IELA 1NX6A 1XTJA 2KKPA 4DSUA 3LQRA 4DV2B 3ADKA 2VQ3A 1V9CA 4FM9A 1PTJA 4RLHA 3TQ1A 3NXKA 3C4QA 5TPWA 1AG9A 5EA2A 3M3HA 7ICMA 2TS1A 3SZMA 5AVXA 5KCZA 4CIXA 4RTSA 1OA1A 4IOLA 3ZTYA 5IC6A 4Q3NA 4BX8A 1KDPA 3SHVA 4ACBA 1RKQA 3RJHA 2L0XA 3I9LA 2C3YA 1T0HB 1VYTA 1NC3A 3TIGA 2HJ9A 3MXOA 3DBHA 1V7CA 3E05A 2QNBA 3MERA 5CT5A 4YIHA 4XVHA 5JRJA 5AR1A 4DFMA 1IDN1 1P5RA 4Q4HA 2PKXA 3O95A 2IKQA 2JIZA 3DBRA 1ZQEA 3V1MA 1FYDA 1ZQVA 1XEXA 1YFLA 1U8EA 4JJEA 4KQWA 4MFCA 1A5TA 4B71A 3B2EA 1ISPA 2HLDA 1L7QA 1MX9A 4UM8B 1CD5A 2JHFA 1T3ZA 3G8AA 2NXCA 4IJUA 3KJHA 2FNAA 2VF8A 1Z0UA 2Z98A 4M3NA 2BF7A 3BIXA 2Z6AA 3CYFA 1QZTA 5F2EA 2HJRA 4KV7A 1SIOA 1M1NA 1OVGA 1R6BX 2PKEA 1EM8A 1HE1C 3OZWA 1L4KA 4ZVMA 5C5DA 3F6EX 2C22A 5IHPA 4B40A 2WNSA 4PX3A 4WBXC 4KXQA 5KI6A 5I7OA 3MIZA 3RVLA 1ABEA 3IAXA 1TKCA 3C39A 4FFOA 1U0FA 1ZQMA 3COYA 1ZEJA 4L8LA 1Y7TA 4B3DA 1NU6A 1Y8RA 2C2DA 3G5MA 1JUDA 2P6OA 4LZJA 2FAXA 3LI2A 1J00A 4Q9DA 5B4TA 5JYDA 4BWFB 2PV0A 2XDQB 1A71A 1Z6GA 1M2FA 1T6ZA 1E1MA 3JATB 3QKWA 4MQEB 4YAUA 4UCQA 5F3WB 5CDGA 5EINA 2YVAA 2C96A 4K9LA 5KFZA 3PIDA 5DNUA 1CLUA 2FXIA 5FOVA 2VH5R 4RF2A 1VG9B 4MUXA 1W4RA 3ZPXA 2R751 1UJ5A 4WASA 2Z4RA 7ICSA 1FB5A 3HCOA 3ZE2B 3CLUC 3KPUA 3OLWA 3VNAA 3RB6A 2ABWA 3IEXA 5IH3A 2DE0X 3U4MA 3ABQB 1R27A 2HCTA 3JQAD 1QCDA 1PZHA 2ZWVA 1EGQA 1MX1A 1TW2A 3VHLB 3JQFC 1RI3A 3BICA 4BNVA 3T5CA 3WMWA 2XUQA 3EFBA 2RIRA 3K8YA 3RC2A 1EZ4A 1HGXA 4HGOA 3LPLA 4FX2A 3KBBA 1YCDA 5HIKA 1T8RA 4WH0A 2QPAA 1KVSA 2D62A 2DBVO 1RRGA 4LWPA 5ALKA 4B6JA 3OCZA 2PUCA 2VR1A 3L1JA 2INGX 3KQKA 1WDWB 5DLFA 4MP3A 3T7IA 1G63A 1XYGA 1VJRA 3AUJB 1U1CA 3EPGA 3JQPA 2MTBA 1X39A 4RJTA 1J9ZA 3HV2A 3JS5A 2Z8YA 4FR0A 4URUR 1Y3AA 5AOAA 5KJ1A 5AJWA 2W6CX 1RRVA 3AT1A 2RCYA 3O90A 2I9PA 3K70C 2EHDA 1U5AA 1EUZA 2XUAA 2QIOA 3UK1A 2FWPA 3PNMA 5F5LA 2JGDA 4K8OA 1UT6A 2XRYA 3OH8A 4Q3DA 4BQQA 3C8HA 1WBBA 1S1MA 5FL7D 1G20B 4GP9A 2YQEA 1X6IA 2QZSA 1ECFA 2QNRA 3ESXA 4KN7A 4NS1A 3HJUA 5K09A 4S1TA 4WOCA 6YASA 4YP9A 3O8QB 5BR1A 3G5LA 4HGRA 3PR4A 3KQNA 2XUIA 4WVFA 1X9GA 4LZNA 4ZH4A 4C76A 4YN4A 3SC6A 3KU4A 3PI7A 3QGMA 1QH9A 3P0JA 1JQJC 2JH7A 1DUIA 3D02A 4IMIB 3BF8A 2HEGA 3O94A 2VXOA 1QTNA 2RHDA 4BQIA 1A8PA 3U4QA 3WGHA 5KG1A 4QZDA 4ER3A 1GY8A 5HBGA 4CG0A 4S3MA 4GGMX 2YN4A 3PO5A 3PR5B 1SU7A 4D45A 4ZVUA 4EI9A 4PPXA 4RVHA 2P68A 3BTUA 3F3KA 1I3OA 4MJXA 1GHTA 1I4DD 4CM4B 1S3SA 2H7YA 2JK0A 1IUPA 2RGEA 2GPBA 1G6HA 1IHDA 1VCNA 4MPJA 1MAHA 4YGXB 3G8YA 2R1VA 3DQPA 1XVVA 3NIDB 1LRLA 1N75A 5FTNA 4YJKA 3BFKA 4EVRA 4IIJB 3GRKA 1GR0A 3O5AA 2LMRA 4P22A 1LA2A 1O08A 5FORA 2H18A 5A02A 2OAQ1 4BN0A 3H42B 1UXJA 3P2EA 3CY6A 1OH7A 2E4UA 4PC2A 4J9NA 3GO4A 3NT5A 3EZGA 1SKRA 1XVLA 3UQYS 5IWAB 3TADA 1MPXA 3OI7A 5TQ0A 5AW8A 3GRAA 3PC7A 2W5UA 4KMRA 3Q2KA 3ROZA 1Q3HA 1SUIA 2C5GA 4FDMA 4P7GA 1DNPA 1ZUNA 5J4YA 3AY0A 2DUNA 4BQOA 5DW3A 2QL9A 3A8TA 1CJKC 5AVQA 8MHTA 2R8KA 1CCWA 4B7ZA 1WR8A 3FMIA 3P26A 5ILGA 3X1XA 5J0SA 1Z2DA 1Z8DA 4Z9BA 1ZFNA 1NMQA 1G8AA 3I32A 1SVKA 3K3PA 3D31A 1C0LA 2C7VA 4Z86A 4NE7A 1Z13A 4M9LA 4DS4A 4W9NC 1G7RA 3PJRA 2I1QA 3NH6A 4F4KA 2V4MA 3SLKA 4YT5A 3C70A 2YWJA 4DG8A 4JGGA 3MF4A 1FA9A 4M89A 3RF9A 3MWFA 1QPGA 3GEDA 4JC0A 2H59A 2HMSA 4D43A 2ORWA 4MI9A 3TNDA 3EE6A 1JJBA 4REQA 2CVOA 5C35A 4Q03A 2ZM5A 2B2CA 1EQUA 2O5VA 2OV6A 3EAQA 2WHYA 4QOGA 2X9VA 1IRIA 4CV3A 5IT5A 3FPLA 3DAGA 5FTWA 1Y6JA 5LXTF 3PGJA 1NBME 2BBWA 3EMBA 3U26A 2O2ZA 1FTYA 3CMMA 4LFBB 1MB0A 2YXNA 2C2ZA 1ZZEA 1B6TA 2FW1A 1R6VA 1GQRA 2XODA 5FPYA 1VJDA 4J49A 4B76A 2HGZA 1I3NA 2ZWAA 4GHWA 2C0QA 4MAFA 3IIEA 2LPEA 3FTCA 3ED5A 3BE4A 2XVXA 1DRKA 2V7GA 4F6LA 4F8YA 1B1AA 2QN1A 2J3LA 4DQRA 3WFIA 3C8DA 2FP3A 3EGIA 5IIMA 3FTPA 4E11A 1L8XA 3I8SA 2WD8A 4YFVA 3PX4A 4XM2A 1KL9A 1E96A 2B8WA 4ZPXA 2BI4A 2JF0A 5TJ9A 4BLTA 3U4DA 1Q0LA 1LTQA 2ODAA 3H1GA 2I66A 1RMQA 2G6BA 1L5VA 5IK2D 3MZ0A 2O2XA 1DBQA 3M6ZA 3C3KA 4Z4QA 1XPRA 1YJXA 3GDXA 5IZ4A 2V8OA 4C6HA 1Y88A 4X8OA 4YV1A 3RUAA 2BE7A 1X6VA 1H94A 4IGKA 5HMLA 2V03A 3DBLA 1R88A 5I4KA 4M9ZA 4MQFB 2NP6A 2VPXA 3MD9A 3TXAA 3ZIUA 3X3HA 1EFKA 1IB6A 4XSGA 2DLDA 2A5FA 5AK3A 3ZD9A 1M2GA 3GMSA 2M9NA 4O4LA 1BHO1 4F9GA 3BG5A 4LJXA 5LUAA 3LXUX 4EQ6B 2C54A 2EV9A 3RJGA 3LX6A 5K0GA 2ASEA 1EWVA 1I14A 3MABA 5IEBA 2B82A 2Q8PA 3R7DA 4IXMA 4KO1S 3AVXA 1D4FA 1IEXA 2VAVA 2YS6A 2CK3D 5CRIA 5HDBB 1SPBS 3S27A 2QUHA 3V1TC 4TZ6A 1LNSA 5G0TA 3JZAA 2NUPB 3VR4A 3RSOA 1C7JA 1M1ZA 4R05A 4HEJA 9ICBA 5D49A 4FSDA 2EXXA 1NWHA 3HGQA 4ED0A 4M0UA 4M7RA 2ETVA 3CIFA 1T3SA 1CHNA 3B5EA 4OGWA 1FFSA 4JP2A 5GZ3A 1AGPA 2OHXA 4F86A 4JUDX 3CN7A 2ISCA 4KMMA 2B2NA 1AZSC 5K2OA 3PS9A 4OU5A 3DTVB 2KVSA 1S10A 2O59A 2YN2A 1PR3A 3KZKA 1JZSA 3M6IA 4TMZA 2R8HA 2F8TA 3B1XA 3EQ9A 3QVTA 1Z18A 3R6LA 4IILA 2H31A 4EMSA 1MD9A 3EJWA 3KAKA 2E8NA 2XMSA 4R9UC 2Q4EA 2BCUA 4CCWA 3TEFA 1JEDA 1KI7A 1O95A 1SA0A 1DBIA 2BOVA 2QVXX 1GN9A 1VDZA 2EZUA 5BN3B 3CUWA 3DC7A 3BJMA 3GQCA 3OE4A 4YT2A 1UQUA 2Q3BA 1KOJA 1JR6A 1WZNA 4HYEA 2QKQA 1PE0A 1XHFA 5EMHA 4BFCA 2FRXA 3OE1A 2Y0SC 2AF3C 5BUQA 4CMJA 4KL8S 1SR8A 3BE8A 2BMVA 4Q3EA 1KFEB 1QIJA 5IAKA 1F0NA 2OQIA 2J0SA 4ZU3A 2J8ZA 3MCTA 3C45A 1PJRA 2RC6A 1TE2A 3CS3A 3ZU3A 3TGWA 4C7XA 4KB5A 1U63A 3TLEA 3PKIA 1RJDA 5LYJA 2Z8ZA 4IKEA 3K53A 2I22A 3QU9A 3HN2A 4XFKA 4JDPA 3AP2A 4UQGA 2VA8A 1J49A 5ETJA 1YDWA 4W8OA 3VPSA 2AW3A 1KDZA 2W3SA 3BM5A 1HKHA 1SCIA 2Z3WA 5BQOA 4NI5A 2BPOA 2BTQB 3W5JA 3C2KA 3PMLA 4PY2A 3F3MA 3UJDA 5AK0A 5AKZA 1KMCA 3MS2A 4E21A 4Z6CA 3F6PA 4LTDA 4ECVA 3NBKA 2C2EA 1E6UA 5IZCC 4JT8A 4FN4A 2B8JA 2VT2A 3C5HA 3GH3A 4UNNA 1PSWA 3B9PA 1R8YA 4EI8A 1ZKDA 5HVNA 3F46A 4KRFA 3ND5A 3DB1A 3M82A 4S1PA 5FO1A 3M4XA 5TDHA 2J09A 2ID7A 3A9UA 5LZ4A 3OCWA 4UCWA 3D0OA 1QYCA 3M4NA 1PR0A 2QRMA 4RDHA 3ROMA 1CI4A 3L18A 2RI1A 3KVVA 3ER9A 2AFIB 1L0BA 2XO7A 3E0QA 3MA0A 4LOIA 2EIXA 3AIOA 2P3SA 1QTQA 5DSTA 3ANTA 3UAOA 3LS2A 4B9VA 3CZMA 1JT2A 3PNKA 3QF4A 4X54A 4U2DA 1SXJB 3AINA 3A0BU 4MQ4A 1WUTA 4BBJA 1I6KA 2XGQA 4F4JA 1FX0B 2XLBA 3L6OO 2WWXA 1XG5A 1WDLA 4M9HA 1TYAE 3G82C 1MEJA 3WL8A 3RE1A 2GJ4A 1FPQA 3THSA 2OT3B 3ETDA 3LIIA 4BKUA 3CLUD 4F4WA 5SY6A 1NMZA 2K4MA 5LZ9A 1IEQA 5TV2A 4DRYA 3MSCA 4E4TA 3IQDB 1ZVJA 2EBUA 3S2EA 4EA9A 2M2IA 3P0RA 2WABA 1VHJA 4LMPA 1RLIA 1H9AA 3PGVA 1WXXA 2FEMA 3OJOA 4IIEA 3F8SA 2X0DA 1HIWA 5B1IA 4PSDA 2ZJYA 4ARUA 5HM6A 3MXTA 3QLVA 3FFAA 3SHFA 4RY0A 5B2FA 2GPWA 2OEPA 1DEOA 1PR6A 3KQSA 2C7QA 5KFPA 2QN6A 5JXGA 1E66A 3NASA 2ANCA 1N0VC 2H5IA 2X9GA 3P9XA 3SCZA 4A4DA 4F4YA 4MKRA 3HNPA 3VNRA 5IAAA 1N0UA 2AOUA 4BEJA 1Q57A 4KYTA 2C9DA 2RB4A 2EFEB 2ZLBA 3PZPA 3L0ZA 2NQ2C 4NK4A 3NWJA 3K70D 2X8AA 3LECA 3HRHA 4DNXA 2ORVA 2YICA 4AY6A 1C81A 1GT6A 1T5HX 2WAOA 5HNKA 2GCNA 3ANYB 2AFVA 5IT4A 2ZAOA 3SFTA 1UPBA 4MEAA 1S2DA 3GLGB 4DHEA 4JK1A 3C6KA 2R66A 2DKXA 3LF1A 3V1NA 3PNSA 2GN6A 4X3PA 1JFTA 4YJ3B 2A9KA 3BK7A 4PQEA 2PPLA 5FPPA 3OOEA 4M7OA 1C8BA 4OA8A 3AB8A 1Z6ZA 2PSSA 4ZVRA 3LG2A 3PW7A 1K66A 3EUFA 3KS9A 2BFOA 4DAOA 1UXHA 2DFNA 1OKKA 4Y2YA 1RHRA 3H2JA 1RTKA 4EBFA 1EFVB 2E2WA 1HDXA 3B7WA 1KEUA 3QLUA 2FSHA 2X77A 1GTL1 4F9FA 3UMRA 1EESA 1B41A 2ISSD 5B36A 4GLBA 1YQTA 5C80A 3IAFA 4M9UA 3TLJA 2IZ6A 1U8ZA 1X80A 5KZMB 4CN8A 1DLJA 1SBHA 4M1KA 5K8LA 1SCDA 2AC2A 2CNNA 5I7WA 1QH1A 2C2BA 5KFEA 4C4ZA 1ZM4A 3IMKA 4UKDA 2QW1A 1WB6A 2PRJA 3CX6A 4PYIA 5TVGA 2PX2A 3QE3A 2H3ZA 4I3HA 3EPIA 3HJHA 4GBGA 3O3NB 3L6RA 5I45A 1NPDA 2PDAA 4PO9A 1L5HB 3EPPA 2QD2A 3IHQB 3TF5A 4TTVA 5JO9A 1PTKA 2XUZA 3WI7A 4FYMA 3N75A 2YWGA 1NYLA 4HZUB 1RMTA 2CXYA 3GBVA 3R74A 4JWKA 3BCSA 3FSGD 1KH1A 2C4UA 5IJ0B 4KQJA 4JLJA 1WDMA 4NU5A 3UWKA 2P1RA 5HQ3B 3GT4A 4W5RA 1E3JA 5J5AA 1B4FA 2BN4A 3CLSC 5EHQA 5GTDA 1NXTA 7ICIA 2JHGA 3RTAA 1VSTA 5LVAA 3QJYA 1YZ7A 4F04A 2F77X 1SXDA 1G4HA 1EXMA 2OUIA 4FOLA 4QBFA 4EVIA 4BLPA 5J5CA 3JVEA 1I7LA 5I9MA 2PMFA 4O3SA 1LPNA 3K0FA 3PFHA 3R5KA 4INOA 4QNRA 5AKEA 4UBBA 5AH0A 4PLFA 2H4HA 5A5EA 1HUQA 3QIAA 5ERGB 4MUYA 5CNKA 1PGOA 3L1VA 3W3AH 1ORRA 1QQ6A 4ZI5A 5TRTA 6REQA 1COWD 2A5DA 2EF1A 3CLHA 5DSZA 4ARZA 3EGDB 3TLAA 1EWKA 2H4XA 2IYAA 1IOZA 3RRNA 4RFSA 4PCVA 2KD1A 1TJ3A 3HRKA 3C3JA 1ED1A 1QQAA 2PUVA 1AIPA 1N0WA 1ZPDA 3FDSA 1ONOA 1V47A 5BQPA 3OCCA 1ZCBA 1UXIA 3SSNA 1JIQA 3WIDA 1IHYA 3RASA 1B0XA 4Q9KA 3AEKB 3UTCA 1JX6A 2WA2A 4J3FA 2CVZA 1B76A 4HS9A 5HG0A 3PW2A 3S29A 5KDLA 1M5UA 1ZQUA 1JQKA 2ATXA 4D56A 4KFCA 2GBCA 1S3GA 5CEEA 2OORA 3WK8A 1PR9A 2X41A 5FAXA 3MOSA 1QMPA 4CKBA 2EKZA 1Q1AA 5C51B 1KYIA 1JVSA 3L8MA 4J9UE 2IPXA 4N3CA 4XSHA 2TMGA 4K40A 3V5NA 3ZZUA 1ZJWA 4F2RA 5HJ2A 1AUPA 2QI9F 4RMGA 1CE8A 2E89A 4G97A 4FKMA 3AP3A 1N7HA 3K9QO 4IVPA 2W9CB 3BREA 4BQFA 1T13A 1Z4NA 3WISA 3QFSA 3OIFA 2IP4A 5I5GA 5BWLA 3GFBA 5JZBA 2R8BA 1HNNA 4IHJF 1GGNA 3BMCA 1KK1A 3BGDA 2QVYX 2QG9A 2EU8A 1J09A 1T8PA 2QUKA 2D13A 4Q66C 1YZ3A 4ARSA 2QX9A 1E8NA 2Q0QA 1ECWA 2VO1A 5D5PA 1ND5A 1H66A 3ESRA 1C9JA 3FZQA 3JQ7A 1Y8ZA 3Q8WA 1PW7A 3H17A 4OK6A 1C4KA 2D54A 1DIHA 2VK1A 1G2OA 5K6RA 1S8NA 4PAGA 4Q82A 5AKYA 1DG9A 1A2KC 2FEKA 3KFLA 3SIPA 5DHQA 2VHWA 4LJKA 1V3UA 1J07A 2HMXA 2O3UA 1VPVA 1TT7A 3Q0IA 2AT1A 3UT5B 2VNSA 7GPBA 3PEVA 2NNWB 1XZDA 2EQYA 3CVWA 3UB3A 5G1NA 1NTOA 2WUFA 3IVCA 1XAIA 1Y1RA 5D6OA 3JCZA 1U3WA 2OG2A 3CUTA 2PL3A 5JZVA 3OJLA 5K8TA 3LU1A 2WB4A 1NMYA 5C0OE 1X77A 5EWLB 2XZPA 3HN7A 2FP4A 4PPNA 1K4YA 3FUCA 3BMQA 1GKYA 4J9PA 2AR7A 5DK6A 3BA1A 3R1IA 2WW8A 3GVCA 1TIKA 821PA 4XCVA 4HX9A 2FW9A 3T5AA 4YMHA 1KC3A 4L2IA 4HNTA 2Q2NA 5CEJA 5J4VA 3IMFA 2VWQA 1CZRA 4TMTA 1OREA 5A0FA 1GUAA 2BGWA 2H4ZA 4YCXA 1EFPB 3PT5A 3P52A 2HAEA 4C06A 3OTOB 5BT9A 4U5XA 4WACA 3QFFA 3VVCA 3IUEA 3QVLA 1FFWA 2NRXA 5HM8A 4IWYA 3MBKA 4DIUA 5PNTA 5KYXA 2DLNA 1OILA 3DFUA 3NZEA 4B3XA 3E1KA 1JHQA 4PAOA 1CS0A 3PSTA 3FNQA 3WQSB 4YB8A 4NBNA 3MLEA 4Z2YA 1REQA 4OEHA 4FHEA 1C9DB 3OSZA 1TA0A 4HAVA 4IH1A 1XAGA 1NLYA 4CFSA 4BUJA 2KN7A 4MVJE 2IS4A 2VT3A 1UOQA 2V5UA 1JA1A 1QPBA 4A0GA 1JH9A 3FBGA 4O4HB 1ZITA 4YXFA 5LKAA 2VNJA 1IBMB 2C61A 1NTRA 2WU0A 4RTKA 2ZBFA 4L8YA 3PPYA 3UT0A 4ED1A 1TV9A 4NZZA 2NVUB 1SKYE 3NUZA 4H35A 4ZYUA 3RCBA 3BS5B 3MWEB 1SRQA 3IXQA 2R8YA 3ZCQA 1SELA 2Q50A 3W2HA 2EVWX 2JAQA 3W4JA 2JIBA 1LVHA 2BGTA 5C0YA 3PNBA 4UMEA 4KLMA 5JPDA 4YCBA 4LYYA 3UJ7A 3VNVA 2KNJA 1H2AS 2UUPA 5IJWA 4Y3UA 3WVNA 1N1MA 4FR5A 1OX6A 4WNIA 5D7BA 5FUYA 1RHMA 5FT9A 2WICA 1EEHA 3RUPA 1AQJA 1CUVA 2PAAA 4IFTA 2ERCA 5FAKA 3DCNA 4CKYA 4QTZA 3JASA 1Q1QA 4IX1A 1NR5A 2OMKA 3AI7A 2OCXA 3LYLA 3M49A 3EZ5A 5LMUB 1HFEL 1JG2A 2UUOA 3SVLA 2HHXA 1YWGO 2GZMA 1N5RA 4ETWA 4AJKA 4B9TA 1ZQLA 1NY5A 2V9CA 3Q9LA 3AESA 2P35A 2PQ0A 1ZNWA 1WKBA 2I78A 2OBFA 2OO5C 5L3VA 4UAWA 3LBHA 3CH7A 3TZLA 3NRWA 1E1YA 3LLUA 4E30A 1I0ZA 4WZAE 3KFXA 4PPQA 2OZPA 2C88A 4MIEA 4V1CB 3KYJB 4A6DA 4M46A 3G2QA 4G8JA 3DBRB 2YMQA 2REQB 3STXA 1CUYA 4QQKA 1Z4IA 1XEXB 4AJHA 2F2TA 3WGIA 3AI3A 3B3QA 3CH4B 3QU7A 3DCYA 4Q3KA 4Q7LA 1FP6A 1E5TA 4BVFA 2DBYA 1YA4A 1FSPA 2XT6A 5AW1A 3DOUA 4G0ZA 2XX3A 2YHUA 3WTCA 5CLQA 1DS6A 4IRDA 2OENG 3ECSA 1KIMA 1RPTA 1IUOA 1MX3A 4NPAA 4DL7A 1M1NB 3L7NA 4NJEB 1L5RA 3FYCA 4Y6OA 2FWRA 3IV9A 5LQMA 3VI3B 4WUVA 1XZNA 3TDKA 2C3PA 2NMVA 4R1SA 2GF9A 5DTJA 1IVYA 3H7AA 2Q07A 3DV0A 2PO7A 2Y76A 5GMOA 1MOQA 2DT8A 1NYRA 2E8OA 3B6IA 2WMOB 3V1UA 1SCUB 5CB4A 1PKXA 4TV8F 1JN0A 1WWVA 2GZ1A 2OD7A 4L02A 2HBLA 4HLDA 1E0KA 3LYHA 4KDFA 1MVLA 4KCGA 3UHOA 2O7NA 3BJEA 3IIIA 4RFVA 3UN1A 3VPFA 3N59A 2F7SA 3NDIA 2QYSA 4GOKA 1HURA 2H5JA 2XC9A 3DFZA 1ITZA 3SC2A 3VRHA 4MGHA 3JR7A 4EMUA 1X8XA 3B3AA 1TK3A 2P2YA 4ER6A 4RZ3A 3P9IA 1GDHA 3FKQA 3L8DA 3WLEA 2VHTA 1Q0RA 2FMFA 1MR3F 3OCXA 4MX8A 4GM4A 3PW5A 2YUTA 5EP1A 5F33A 2PKRA 4P4SA 1A72A 1H1DA 3DXFA 2VRBA 2YXLA 1ZSNA 3QLEA 2MRLA 5KC8A 1K8QA 5G1PA 1ZW1A 2QMYA 1E3LA 3WG9A 8ICKA 1YS7A 4MV7A 1S2OA 2DXIA 1ZK2A 4FD2A 1G16A 5J2BA 1ID1A 1QGED 4L6CA 1U7TA 2ENUA 1HUOA 3BD7A 3ZHBA 4I19A 2NRWA 3ILXA 2A0UA 3TNJA 1K5OA 3JPYA 4N8DA 3IDAA 3QX7A 4E09A 2ZTCA 2GN1A 1TF2A 2JFHA 3B1JA 1BMQA 1KDYA 4QL3A 3A36A