4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
3W5AA 1L6RA 2FI1A 1Y8AA 2W11A 5AM1A 3DNPA 3QLEA 2AH5A 5ALDA 3OPXA 5ALKA 1YNSA 3ONNA 2B30A 3ZTYA 4Y2TA 4UMVA 4BYGA 1Z4IA 2EATA 2AUTA 2FDRA 1YS9A 4QQFA 3J7TA 4UMEA 5IS2A 1NNLA 3WKDA 3KBBA 2I34A 2JAOA 2JAWA 3AR5A 3IB6A 3AR3A 4YIHA 3BA6A 4OD0A 5IT0A 3WK9A 3DV9A 2P9JA 1Z88A 4BX0A 5AW1A 5AW2A 3N07A 5AI8A 2IOFK 2W4MA 1QQ6A 2I6XA 2DQSA 3WK5A 2B1QA 2YMQA 4G9BA 2YMPA 3TLMA 1L8LA 2B8EA 4HGOA 3SKYA 3WK6A 3N28A 2JARA 2FPUA 2YJ6A 1U7PA 5AVQA 2WHEA 5AVWA 3WK4A 4BBJA 2RARA 2MU2A 3L0CA 4L57A 2YN4A 5AK4A 1ZRMA 5ALIA 3DDHA 3I1YA 3U26A 3K1ZA 2P27A 3FM9A 1Q91A 2R8EA 4Y2RA 3PCTA 4YIKA 3QNMA 1MH9A 2BDUA 4NV0A 2IOHA 2G0AA 1F5SA 3ED5A 4HAIA 1ZD3A 4YCMA 3NUQA 2WF7A 5AKYA 2R8YA 4DCCA 5ALMA 5AM0A 1Z5GA 5ALYA 3SD7A 4O8CA 1RQNA 5FP0A 3EWIA 3L8GA 5AK5A 2OYCA 3F9RA 2HI0A 3I76A 2G1AA 4CF5A 3RF6A 4RETA 4XQ0A 5AKJA 3ZVLA 1J8DA 4BKMA 2RAVA 4H1WA 2WF8A 5AESA 5ALSA 4BEVA 4ZEVA 5ALQA 2QYHA 2R8ZA 1S2OA 4AS2A 5IT4A 4FYPA 3R09A 4L6CA 5AW5A 1U02A 2ZOSA 3DAOA 5ALWA 2YY6A 4UW9A 2C8KA 3IRUA 2BDEA 1J97A 4F72A 3PDWA 2RB5A 3L0BA 2EAUA 4CF4A 2FPWA 2G80A 4YCNA 4Y2XA 4NABA 1IWOA 5AKLA 3WGUA 2I7DA 5ALUA 2HO4A 2YJ3A 3ZVNA 3EF1A 2B1RA 3NASA 4NFLA 2O2XA 3U7FB 1VJ5A 3U7EB 1NF2A 5AVUA 1Z4KA 4AP9A 5AI6A 4ZEWA 1FEZA 4J2TA 2G09A 3L1UA 2C8LA 4EENA 4JDPA 3L8FA 3QUQA 1RLOA 3FGOA 4Y2PA 3GYGA 5T41A 2B0CA 2WM8A 5AW0A 1AQ6A 5ALFA 5AIAA 3QUBA 4J03A 1TA0A 2Q4RA 5AM2A 4XPZA 4C4RA 2RBKA 4BEWA 3W5BA 5AVYA 2P69A 5A3RA 3SLRA 5AW8A 1U2SA 5AW4A 3R9KA 1T5TA 5AVRA 3AR2A 3WK8A 3OCVA 3RFUA 3A3YA 1WR8A 1ZS9A 5AKIA 2EARA 4L6AA 2FPRA 1WZCA 2G06A 2ZBEA 4Y2VA 4UU0A 3ZWDA 3M9LA 2R8XA 3OCUA 5A3QA 4OCZA 3ZU6A 3CZ4A 3AR9A 1EK2A 2B82A 2G08A 3ET4A 3FPSA 1SWVA 4Y3UA 3L1VA 1TJ3A 5AKEA 1U2TA 5AVXA 2IOFA 3MC1A 5AKXA 2Q5EA 1ZRNA 4Y2YA 3KOOA 2GFHA 2PR7A 3QYPA 4ZEXA 4HGRA 5AVVA 2O9JA 4QJBA 3L8HA 1Z4NA 2X4DA 3L0YA 1Z4MA 3L5KA 5ALLA 2OBBA 4FE3A 2YBDA 4XOUA 4YH1A 1NRWA 3VAYA 2YFYA 2HX1A 2G07A 1PW5A 1RLMA 4DWOA 4UMFA 2GO7A 1QQ5A 4EX6A 1Z4OA 4MUMA 2BY4A 3U13A 1T9ZA 2WF9A 2WF5A 4BNDA 1RPZA 2HSZA 5AK3A 3WK7A 5ALXA 5AKHA 1TJ4A 4Y2UA 3WGVA 5AKZA 3ZUPA 1L7OA 2I33A 5ALOA 3WKAA 4BX3A 4HGPA 4KNWA 3W5DA 3U7GA 5AICA 4E88A 3PGLA 4OFZA 3SF0A 2NYVA 3IJ5A 4KYTA 3ZI4A 2VKQA 2FPSA 2FUEA 3B9RA 4BNDB 1XP5A 1ZJJA 2C9MA 3AR8A 3A1EA 4EZEA 3QXGA 4KX5A 3KZXA 4EX7A 4NWIA 4HYTA 1WPGA 3A1DA 1X42A 3FPBA 1CQZA 2ZBFA 1S8OA 3SMVA 2PQ0A 4IFTA 1ZD2P 3UM9A 2JAUA 1YDFA 2ZBDA 3MPOA 1SWWA 1N9KA 4HGNA 4DW8A 1RDFA 3ZX4A 1K1EA 2JGAA 2C88A 4KN8A 5A3SA 4YGYA 4EEKA 1RLTA 2GMWA 3OCZA 1Z4JA 5AKGA 3OCWA 4Y2QA 4CE6A 1Z4LA 3D6JA 1QH9A 2I54A 3I6BA 4CF3A 1Z5UA 4GIBA 2C4NA 5AIBA 3NAMA 3L7YA 4I9GA 4PNHA 1YV9A 5AM4A 1Z4QA 3ET5A 4UMDA 3FZQA 5ALEA 3CNHA 3KC2A 1RC8A 5AM5A 1U7OA 2CN1A 3NANA 3ZVMA 2OM6A 1RKVA 1T5SA 3AR6A 3QGMA 3QUTA 4KX3A 5AW6A 2I55A 4XE5A 3MMZA 3QX7A 4F71A 3OCYA 4UM7A 4UM5A 3U7HB 3SKXA 3QU9A 1L7PA 1QQ7A 1RMYA 3OCXA 1L7NA 3R4CA 1XPJA 2ODAA 2NO5A 2FPXA 3WKBA 3N8GA 3EF0A 3QUCA 5AI0A 2W43A 5ALTA 5AVTA 5AM3A 1LTQA 5ALPA 2OA0A 4CNQA 5AVSA 1YMQA 2AMYA 2B8JA 2HF7A 1N8NA 2HDOA 3ZW7A 1RKUA 1L7MA 4UU1A 4UATA 3E81A 3U19A 3P96A 1XVIA 5ALZA 5AW3A 1RMTA 4RESA 3ZX5A 3A1CA 2ZBGA 1QYIA 3KDPA 1SU4A 3M1YA 4Y2JA 4KNVA 1O08A 1VJRA 2IA5A 2YJ4A 4NAVA 3KD3A 5ALHA 3ESRA 3NALA 2HCFA 4C4SA 3UMBA 4UAUA 5ALRA 2GHQA 3PGVA 1YJ5A 3HLTA 3ZWKA 3E8MA 2HF2A 2YJ5A 4DFDA 4EELA 3NIWA 2D2VA 5AI9A 3OTQA 1Q92A 4GXTA 5AI5A 2NO4A 3QU7A 4Y2SA 3MN1A 2FEAA 2Q4TA 5E0OA 1WVIA 2MSNA 3NRJA 3S6JA 1Z4PX 2GHTA 1ZD5A 2PKEA 4MWOA 4BX2A 2HHLA 3B9BA 1CR6A 1EK1A 5AKKA 4AS3A 5ALNA 2WFAA 2CFSA 2ZXEA 4FFDA 3W5CA 3QU2A 3WKCA 3ZTWA 4OHFA 3I28A 4UAVA 1L8OA 4I9FA 3ESQA 2HOQA 2FUCA 5AI4A 3B8EA 3QU5A 3BWVA 2YMMA 1O03A 3L8EA 3SHQA 3WKEA 1JUDA 3HYCA 1TJ5A 3FVVA 3QU4A 3N5KA 3UMCA 2IYEA 4HGQA 2CFRA 3E58A 1RRCA 5ALVA 2MU1A 1LVHA 1RKQA 5AHXA 1VFPA 5AVZA 4UASA 4B6JA 4IG4A 1RMQA 1KYTA 4G63A 2YMLA 5ALJA 2P11A 4YCLA 4JB3A 5AW9A 5AW7A 1TE2A 3EPRA 2HEGA 3N1UA 2AGVA 2ZG6A 1ZOLA 5AK6A 3E84A 5ALGA 5JJBA 1RQLA 2QLTA 4UARA 3AR7A 2WF6A 3UMGA 4C4TA 3AR4A 2CFTA 1ZD4A
chains in the Genus database with same CATH superfamily
1L6RA 1ORIA 3FLEA 1SGGA 5AM1A 2BI4A 2PH5A 3DNPA 4XYBA 3V7FA 2PTHA 4RKWA 2Z4TA 2YN0A 3OFKA 5H82A 3PV0A 5C8DA 5CB4F 5IN4A 5ALDA 2GKGA 2QMEA 4RNDB 4CCYB 4F11A 1R0SA 2ILTA 2JJ1D 2GN2A 1NK5A 2WV7A 5FWYA 3R6LA 5F3DA 3EJ6A 13PKA 1WXHA 1ODSA 4S1PA 5DM0A 4KIFA 2Y1XA 4TS1A 2O57A 3R7LA 4DLPA 2FDRA 1U1DA 3BMNA 2VP4A 3F8SA 4FFVA 3ZCSA 2I62A 5I7SA 2HMXA 1VJGA 2QLJA 3I9LA 5JFTA 1QKJA 2VYCA 3SC3A 5E3HA 4DCGA 2JAWA 1EUDB 1DC8A 3CN7A 3K9WA 5BV8A 1MZPA 4K0KB 3VO2A 3DVQX 4YIHA 4PG5A 2F59A 1NIJA 4KQCA 3MSXA 2KHZA 2VDPB 3HRKA 4UFOA 2XB6A 4K3UA 1TZ2A 3ROPA 1F1JA 3UOWA 1H5NA 3N2KB 2R00C 2R11A 1ZMXA 4RV9A 2OSVA 1GGVA 1MC4A 3GEIA 3W6UA 3ZYZA 1WCXA 4ED7A 1XD2A 1Z25A 2NYUA 3OX3A 3KEQA 3DL4A 3S5UA 1XPUA 1V95A 1NQWA 5C31A 3WDLA 3FYSA 4ECTA 3URKA 4AUMA 4BQPA 4Y98A 3KELA 4C1BA 1LF0A 3WB1A 4DILA 4DWWA 3ORHA 4FU0A 4L1KA 4OI4A 4YCXA 4OQYA 2CVHA 2XVTA 2NTVA 2XQKA 3C1AA 3FVWA 3QVVA 4FW8A 3VV2A 2PUCA 2B4QA 3A26A 4TYPA 5KT4A 1KRHA 1TAUA 2G63A 3DC2A 3PF8A 3MMPA 4UHJA 2DFTA 1WMBA 3G0OA 1XMXA 2DUMA 2EZ9A 4BBJA 3KSDO 5TGZA 1MQ8B 5AVKA 4ZA2A 2BM0A 3AMZA 5C80A 5HOQA 5HKBA 1SKYB 4RA9A 3D3WA 1R0WA 2YN4A 1VKNA 3UNXA 3UC9A 1XRSB 4JVMA 3HO8A 2FSFA 3DWFA 3BBLA 4WOCA 4C87A 4Y2RA 4NU0A 1PQPA 2CJXA 4O59O 5LBUA 1HDOA 3GJXC 2V8OA 3H2ZA 4KVZA 2GNAA 4ALMA 1KJJA 3FNEA 5J5AA 3NVAA 2OCIA 5EMNA 4QZEA 3WIVA 1OX4B 4ZU3A 3IP4B 1GG2A 3ED5A 3AX6A 5KNLA 3T7KA 3QVUA 3G82C 1EEHA 2PX4A 3G1TA 4F4XA 1UWVA 1XLTA 4YTEA 2MDTA 1EESA 1A9RA 5SZJA 1AKMA 4WUTA 2HDNB 3U3ZA 1CHNA 1HZZC 1M5TA 1YJAA 3BGIA 3IP6A 4HDNA 4WNAA 3W2FA 4C0AC 1GYQA 1G2IA 2OOSA 2ZIFA 1S2LA 2BYTA 3EWIA 4IEIA 3IEVA 1T6YA 4XTCS 5JSKA 3TEMA 2DPLA 2XTMA 1JHPA 2I5HA 1JL3A 2E6UX 1Y89A 1MORA 4E94A 2A88A 1X3SA 3P4YA 3PPVA 4JA2A 4CMIA 1R4AA 5DTJA 3WWPA 3K0SA 1ZJZA 2NUPA 1Z5WA 1GT91 2K60A 2ATCA 1UKZA 3OHAA 4YYEA 4J1TA 1GGFA 4RCZA 2IUTA 1JAIA 3O3OB 4F06A 4U6QA 4BFLA 2V98A 1ZI8A 4EI9A 1HNZB 1U63A 5DRTA 5EUCA 1X94A 3LP8A 2YCBA 2G6BA 1HDXA 3ADOA 3N2EA 5KTRA 4HAOA 3MEQA 1BWQA 1FP6A 2R65A 3JS5A 5DLGA 2BFBB 4ZARA 3RR2A 2Z56A 4TTIA 1QH8A 4NAUA 4AG3A 2WWHA 3PEUA 2HR1A 4FYPA 1T13A 3EGOA 1QV7A 1QX3A 2BGNA 3Q1KA 1MIHA 3L9XA 1ZQCA 4PC3A 1KU6A 1BC5A 4DL7A 1I5RA 4TSKA 4F8EA 3BT7A 1WP9A 4TRMA 3IVCA 3UF0A 3HZHA 5B57C 3HKZF 1R6UA 2OD7A 1EP3B 1VMEA 2ZOSA 3D3KA 3E9DA 1L5OA 3O0TA 5AUNB 1NW9B 1OIVA 3DO6A 4QUAA 4ZZ0A 1E1DA 1GCOA 1RT9A 3ASZA 4UUNA 2YWHA 5FL3A 2WJAA 4NLKA 5CIWA 1LNSA 2F43B 3HB7A 1RAEA 4K86A 4R1OA 3QPUA 1PEYA 3AC0A 2FRDA 3L0PA 2J6SA 2QYTA 4ZRNA 5E9QA 1NF3A 2HFKA 2NU6A 5HFAA 3EPGA 5KFLA 5BYBA 1C1HA 4DTCA 5F3WB 4JFRA 1NM5C 2I7DA 2QN3A 1BXRB 4P0QB 1BGVA 2FFRA 3FHJA 4I2JA 1FSGA 2W8BA 2XXJA 2BUAA 3OBIA 1TO6A 3RPEA 1L5MA 3U7FB 2GN0A 1RZRD 1PWZA 5I7FA 2KP7A 4P4GA 3H40A 5IAJA 4PZYA 2HW8A 4I4IA 1XS9D 1A9YA 3WRVA 4BP8A 3U60B 5FWXB 1QOPB 1RYNA 1TQDA 2PLRA 2V7TA 3LUHA 4RVNA 4U8GA 4JLOA 4EYOA 3O74A 3T61A 1PJ4A 4V03A 3OIUA 2AK3A 4JA0A 2DPGA 4E0BA 2VR1A 2C28A 1P2TA 3B78A 2X1HA 4OQLA 4OH7A 2E7ZA 2IX9A 5FORA 1HE4A 1TPYA 1U2PA 3AGQA 5LB4A 4BAGA 4DPKA 5BN5A 5EQJB 3UJBA 2RGYA 2ETXA 1Q7CA 3UBTA 3NVKI 1JWBB 4GLOA 5JPDA 3P0FA 4U9UA 4QZDA 4CLOA 4IOJA 2WIAA 3N8NA 4RJKA 4J03A 5CXQA 2UXBB 3L2OB 3PWSA 4QGBA 4FFBB 4Q9JA 5ENZA 4D4JA 5EJ6A 3A4IA 4JP5A 1NG9A 1ZM7A 2ZJOA 3LGSA 4PGFA 4JI5B 4YDQA 2BSQA 3TJRA 4TUYF 5ERGB 2FSSA 1CUEA 1ABEA 3OE7D 3EEBA 2ONZA 4DNPA 2OFWA 4ZJUA 1Z2OX 1E2HA 2ZSDA 1P44A 1TZBA 3EASA 5AVRA 4L78A 2H59A 2LI6A 2Z2XA 5JPCA 4RMGA 4OO1J 1P7CA 1PTKA 4QDTA 2F2TA 2FPRA 5F21A 1AZSC 2UU9B 3STYA 2PL1A 4DJDC 5G41A 1KEKA 4FDLA 3EIWA 3K2QA 1GSHA 3LLCA 5JTIA 1OA0A 2GOYA 3P9XA 4TPKA 3ZWDA 3OCUA 4BB0A 4DG8A 4K40A 2CXOA 1Z0JA 3ZHQA 5A3QA 2BCEA 1PUJA 4YRSA 4OCZA 1RABA 2C5HA 2G1UA 4IGKA 3RVOA 1ISSA 1KH2A 5B5EU 1BRTA 1VLZA 3VYSB 1F4LA 3LHSA 3PE6A 3IHQB 3IL2A 4BEBA 4Z7QB 2RGNA 1ZIDA 4P2HA 4CU2A 5DP2A 2DRIA 4RL6A 1P5RA 4ZTUB 1FNCA 5KT6A 1QZZA 1ULTA 2JKYA 2X23A 1DTWA 2ZANA 4FW9A 4Z9AA 1RTTA 1Y9JA 2G17A 1J1IA 4JNKA 3AKCA 5CWRA 1QH0A 2RH8A 1AXRA 2ZGVA 1CWUA 1K7CA 2PKCA 5BSRA 4NL9C 4JKOA 3FR7A 4AYBC 5EIBC 4D9FA 2D2XA 2ORIA 3DZJA 3FNHA 2VA9A 1Q12A 1TUBB 1WD5A 1YQTA 1AOXA 2ADFA 2EFDB 2HA2A 5KFKA 1PNOA 2RAUA 2RH4A 2YC2C 3E1KA 3FX2A 3L82B 3IQIX 3PQ7A 3QZ8A 4Q3OA 2ZQYA 4Q4AA 2K4EA 1NN3A 1Z35A 4I4TB 2JPDA 4MVJP 2CL0X 4Y6LA 3UBMA 1H69A 5TMDA 1PWYE 1SM4A 3KVVA 4GYKA 3VTFA 3UB3A 1C1DB 1BAPA 2XUFA 2QYSA 3WISA 1T4CB 2QVBA 2R5FA 4XIIA 3IEMA 3DPIA 4OK3A 4G37A 2I6QA 3NUZA 3HDYA 3TTWA 3C3MA 1KA9H 5AQ1A 2J4DA 3B51X 1NVBA 4QVGA 4HGZA 3PR2B 2BN4A 2HM7A 4JVNA 3QHPA 4I1UA 3DKVA 2ZYIA 3PR1A 1W36C 4RCYA 1M74A 5JS2A 3IMFA 2CJWA 3VHRA 3RBXA 4DV2B 1OFUX 3EW9A 2VSXA 5G5GA 1TJ4A 2OCAA 3G2HA 1BX3A 3SF8A 2KZMA 4JMLA 4Y9DA 4P08A 4OGGA 5BNZA 1XRLA 4OA8A 5BSWA 4F1KA 4JI0B 1RWPA 1O6FA 2UZ4A 1NIPA 2C7QA 1PBTA 3L8DA 1PD1A 4KBFA 1II0A 5JZBA 3Q3HA 3S2IA 2P3OA 5FWDA 3STXA 4OPMA 4OFZA 3QMPA 2BFEB 3IJ5A 1Y9EA 2LD4A 5ADHA 3T3NA 3E4DA 3F4KA 2HNAA 3B5JA 5CLIA 4YDHB 3A8TA 5DYGA 4BNDB 3UATA 4YMNA 1HC7A 3P45A 4JI7B 1TGYA 4KPGA 3CEHA 3ILXA 3WLPA 1IHXA 3ZHRA 4FS8A 3M9OB 3T7DA 1UJBA 2PA3A 3UHJA 4YT4A 2OVFA 3RYFB 3TUIC 1E2FA 1U3VA 4BNHA 1SPBS 3V33A 5L45A 3VC7A 3FPBA 4X7BA 4PFQA 4COKA 3L40A 2Q1WA 3KAPA 3QH4A 2WILA 3L6DA 3D6UA 3WIEA 1HMPA 2AZDA 2JAUA 1ZH4A 2EAPA 3DDCA 4MV6A 1XNGA 4BASA 3CR8A 4G3IA 2C2GA 2F3NA 4UM8B 4DMFA 4J9QA 3VC3A 2FWIA 4I9UA 3K5WA 4J7UA 4NG5A 4MICA 2JHCA 3VH1A 5JXGA 5LOVF 4HTFB 1A2OA 1IK4A 2OO3A 3BGVA 5H0IA 2J30A 2NUBA 1FJGB 4PLCA 2O8BB 1K1SA 2GF0A 3JD1A 5D3ZA 1I5OA 4CLXA 4B1FA 2DTEA 4D96A 2R86A 3HUFA 4IS2A 4OEHA 1BQ4A 2C1XA 2I54A 2R60A 1CJMA 1CY7A 2J3DA 4QQRA 4HBZA 1Q8KA 3CEAA 2GERA 5AT1A 4CWAA 5BSHA 2JFQA 2LVBA 2CV1A 1W85B 1XLWA 1KEJA 5JAOA 2X5JO 2ZT5A 4U7HA 3UQYS 3OTHA 3M7IA 2CLHB 1E6KA 2QX7A 3FWNA 2PRKA 1YKFA 4IMPA 4NCXA 4RIFA 1S10A 3B3FA 3OH8A 5C8VA 3I61A 3COWA 1XVAA 4PF1A 1NPYA 4HDRB 2XGPA 2F8SA 1H23A 9ICFA 3HNPA 2M6SA 5B2FA 3KHLA 1KYZA 2GBLC 2YH2A 4HAXA 1U7HA 2PWYA 4CCSA 1Y8QB 5HDBB 4HI0E 3DXXA 3PZPA 4XE5A 1IG0A 2QIPA 4F71A 3NUGA 3OCYA 4Q1VA 2AQ4A 4ACOA 4RQ2A 1KFJB 3KKMA 4MUAA 1XRNA 2EJCA 4HS4A 5DT9A 4L9SA 4AURA 1K6MA 4B3RB 5BWCA 3PITA 4FGJA 3KHTA 5EINA 1NX9A 4M54A 3L41A 1TT7A 2A0YA 1SQ6A 4A0SA 3QKIA 4C7JA 1QO0A 3KFLA 3W06A 1X9XA 2NO1A 4DOCA 4MVJH 3MJHA 3K6KA 1WCIB 1A9QA 2ID8A 2A9RA 4A6EA 2P5TB 3IOMA 1ZPDA 3IQWA 4G1EB 3OLQA 2XC9A 3BK7A 3E35A 5BVGB 1QP0A 4YQWA 5KWSA 1S9HA 1Y6ZA 1Z37A 3EVTA 5JCJA 2H1FA 2WYHA 3DBVO 3L92A 2ASVA 1I14A 3C87A 2ENWA 2JMGA 2R4UA 3DFZA 3N53A 1B43A 1A76A 3QWBA 4H4CA 4UBNA 5CEHA 4E5UA 1G55A 2C0CA 4E7PA 3JPNA 2M9MA 2PBLA 3K32A 3VTZA 3VNSA 4ECZA 4FFRA 5J2EA 2XI9A 3RROA 4F3NA 2OT3B 2HMUA 2I4TA 3PQ3A 4R7TA 5TGTA 3R7FA 5IZ4A 2OCYC 1XVIA 1ZW1A 3OT1A 5EPUA 1ZGCA 2QU8A 4ZAVA 4HMPA 1UADA 2B25A 3ZX5A 5JH7B 3ASUA 1E79D 4U7JA 1ZQSA 1R12A 1V26A 2G82A 3KDPA 4A2WA 3FMOB 1O08A 3MGAA 4FGWA 4NAVA 3V8EA 4FZRA 4KJXA 5IASA 4LK3A 3V3KA 5JBQA 1WB9A 2ZR9A 1EXVA 1XAGA 3QVXA 3W4KA 1RHKA 3D8BA 3LOQA 3OECA 3QWHA 1Y4DE 1Z74A 2WJHA 3E18A 4IZHA 1T8PA 1K8YB 1NYRA 2NGRA 3BXZA 4KQEA 1Q5PA 4L3OA 4OJYA 4DCOA 1SHZA 5FAKA 2FW8A 4EHIA 1KL9A 4ZYUA 5L3QA 3OTOB 1WUYA 1ZCFA 4UQOA 5AHRA 2NVBA 1PJRA 1M2FA 2J6CA 5DYIA 1OLSB 4JOCA 4MTLA 1U9JA 1QKIA 3Q85A 5J2AA 3A32A 5FLYA 2Y9TA 3RS5A 1X2EA 4JLMA 1D09A 4TXNA 2VAXA 5G1OA 3TFWA 2IYZA 3CUVA 1T8EA 5KAFU 1OSNA 1KZ7B 1QRDA 2HJGA 3NRJA 3OHMA 3EZ7A 2X0DA 3CE9A 4EDHA 3ABOB 4XGKA 2ISSD 2GHTA 2WUEA 3EGIA 3I12A 5A4AA 5BQFA 2Q2WA 3IJPA 2I4MA 5B6IA 1XJ0A 2PQ2A 1DINA 2LUOA 1RZTA 2FXIA 1LLCA 1R0XA 5DF1A 3WAGA 2D7DA 4JWTA 1T2DA 2D5LA 4OTZA 4OXRA 5CVCA 3EMKA 4FEAA 4C4XA 3W5CA 4PXYA 3TQSA 4DMGA 1COKA 4MGKR 5AR1A 2D59A 2PE5A 2CXYA 2XHEA 3AL0C 4TTJA 2PMBA 1RLUA 3IBTA 3LKZA 4L4YA 1DBWA 3TLZA 4RIEA 3BHIA 3EVAA 1EB9A 3B8EA 2RHCA 2JZNA 2JANA 3AVQA 4JUDX 1K8ZB 1Q17A 3PEFA 1Z2EA 4EHNA 2JLUA 1UC4B 3ROXA 1JKXA 2OQ2A 3S81A 3CH7A 4RYLA 3M8KA 2P78A 2PI5A 3N97B 4CI9A 4F45A 4PLVA 4R69A 3FAHA 1G8SA 2CHGA 7ICGA 3E9CA 3FOZA 2QARB 5LQSA 1UJCA 2PX3A 5FBKA 1PJBA 3U49A 2R6DA 5F9FA 1QUFA 4ZQGA 1I6KA 3SZRA 1LVHA 1SV0A 4P4TA 1CDOA 1EFRD 1LX6A 2CNBA 3I8OA 1BA3A 1OLUB 1VFPA 1JI7A 3VNUA 1GXSB 1JIIA 3ITKA 1RMQA 3TH5A 2QEQA 5CD1A 4I1PA 3WSVA 2C04A 5AXCA 1W0JA 3PJEA 4B45A 3C4VA 1ISJA 5AW7A 2Q6LA 3GJ7A 1M6EX 2G1KA 4N7JA 2AGVA 5HK9A 1KHTA 4RTRA 1MGOA 5F3RA 1I4EB 2WU4A 1AKRA 5KT2A 1XSEA 1PJ2A 3FUTA 1SD1A 2B36A 1VXOA 2FWAA 3V4PB 1X0VA 1KE2A 3FHOA 1CZLA 1FB5A 1DHTA 1PT9A 3HKDA 5TC4A 3PR3A 1P31A 1W5FA 3PXUA 4QRIA 1GTMA 3CPEA 3IEPA 3KJXA 3VR4H 5TARA 3V7NA 3WGGA 3O3NB 2XY4A 5JSQA 3KJFA 2X6QA 4E5DA 4Q02A 5KWEA 4G1VA 1G7SA 3ETJA 4Q93A 1QOZA 5F4BA 5DOVA 1LDMA 3BK2A 5HQJA 3EPHA 1ESNA 2JF0A 1HLGA 2VPWA 3CVJA 4L9AA 1OZFA 2Z08A 4CFYA 3AHCA 4F9EA 1Z4IA 1KTIA 2IH5A 2ARKA 3LH5A 1N0UA 1G6Q1 1ZWLA 1OAKA 3VOTA 3IBFA 3V4SA 2V9WA 1JG6A 4GI7A 3NB0A 3TSAA 1TX4B 2NUAB 1WD7A 3EG5A 2VHQA 2B1JA 2V7EA 1ZOSA 3JQ8B 2J6IA 4MVJE 2FA9A 4BZWA 2Z3VA 1IXZA 2ZIVA 3B5IA 1E64A 3L8MA 4YAWA 5JCOA 3D8UA 3KB6A 2HMVA 1JIXA 2GSDA 3T9EA 3V8VA 1R9GA 1P2BA 4QWWA 5K09A 2ONCA 3VPBA 5BURA 2IDKA 3RRXA 1FU8A 3WZMA 4EG7A 2IEBA 4RA6B 4NOMA 1KTQA 4D56A 3KR1A 3IXMA 3P9NA 2RK6A 1E8NA 2AJLI 4E09A 1GPKA 4YN3A 4OUDB 2RGCA 4HH4A 3OSUA 4PL1A 3PP8A 2RIPA 1VCIA 2GKSA 2YIVX 4M1ZA 3K1AA 3TLKA 1M6WA 4GC7A 4D41A 3CPJB 2JIRA 1DAHA 3FUUA 3E3LA 1ZYUA 1U65A 2FK8A 1ITZA 2VOJA 4KZPA 1GG8A 3C2KA 1BOFA 1UXGA 5CX1A 2IP1A 1LS6A 2R79A 5IHPA 1XTSA 2FEKA 2R4TA 1M75A 4OQZA 1BHSA 4KE9A 4HUTA 2BM1A 3K6RA 5AUPB 3OPNA 5JD5A 1Q91A 4C22A 1ZITA 1VTKA 2BFBA 2DP4E 3KOWA 4M99A 3A1TA 3JQAB 3LT4A 2CE7A 3LWLA 2B3TA 4PCVA 2P6MA 4YMWA 4MWSA 4A8HA 4G1MB 1UMDA 3BJIC 4ARVA 4MKHA 3BD6A 4P84A 3ZPXA 3OPYA 3CF0A 3OZIA 5JNUA 4NQZA 2FZKA 5D8DA 3G2JA 3INRA 3D2AA 1OFGA 5THQA 1JE1A 1PKEA 2RJ3A 3CNBA 3F7OA 4OF4A 4M0AA 2WF7A 2N9UA 2KHVA 3MMNA 1IBMB 2QD3A 2R6GA 5ALMA 4NZZA 1NF9A 3TVTA 4B0OA 1NC3A 1JEOA 3C6KA 3T5GA 3P9KA 3S2UA 4MVJD 4C78A 1PQWA 4GXJA 1ODIA 2TRSB 4HC4A 5E2AA 3SN6A 5KFEA 3LGAA 1NZDA 3MYYA 2LW7A 3NIBA 1PL7A 3D64A 4JEHA 3S70A 2C0QA 5EYPA 4HMOA 1D2NA 2DBRA 2FMFA 2HGZA 3L7BA 5KAIU 1CQJA 2WZBA 4TN5A 1VIYA 2FB9A 2BTQB 4X7RA 2AD5A 3F9RA 3O1HB 4KDEA 4J3FA 1E3TA 1SPXA 2QRUA 3UXMA 3R6DA 4IF6A 4DLTA 1QGOA 3OT1B 4KWTA 1EMDA 2R6CA 1YBMA 2XQJA 4XOIA 1YGPA 1JHYA 1U2EA 2EW1A 2IZ6A 2KWIA 3JQRA 4GSKA 3VXKA 4ZZIA 1NI5A 2X2PA 3S68A 5BWBA 2PM8A 1I30A 1SVOA 2BGMA 2DE0X 4WKGA 1Q74A 3KOMA 1N2GA 4HYQA 1RWVA 3T35A 5CTJA 4B35A 4ZI2A 3IS3A 3EPIA 3JVVA 4QL3A 4CMKA 2NU6B 4EA7A 4FT4A 3IOBA 3ZZUA 1USIA 3HRHA 3RV4A 3L1JA 5EJ8A 2CK3A 1IBLB 3J80A 4LF7B 4QNRA 4QFCA 3DV0A 4BKUA 3EXG2 1ZQ1C 4G3XA 3DHVA 1ZMRA 2NQTA 2O3SA 2Q9UA 3R09A 4Q1EA 2Z4SA 2DJIA 3IOEA 2BBSA 4YCCA 1EUCB 2C95A 3G2IA 4GX1A 4N0PA 1N6HA 4TTQA 3DJFA 5WRFA 4CV3A 1A2KC 4DMMA 1OTYA 1DIGA 1SXEA 2YY6A 5HKKA 4FNOA 5GZ6A 3TQOA 2BDEA 5JG7A 1J33A 3IQXA 4F56A 4QGGA 3AI3A 2OZKA 1RYUA 5I9BA 2Y1KA 4S2UA 4PG8A 3FE2A 1TEXA 3HA7A 2P5SA 4LHEA 2IY7A 1MCZA 1DAIA 2Z30A 3DFUA 3IC5A 4MUBA 4P5EA 4V3CA 4DFJA 3TQIA 4FFSA 4C6SA 4LRWA 4Z9YA 2BC9A 3M81A 3PS9A 5DX0A 2X0JA 2D1TA 5LPNA 1PNQA 3C3PA 3M6FA 4YRJA 2K7ZA 1BMDA 4NFLA 1KH1A 3RS9A 1U3DA 1E66A 1DO8A 3EY9A 4QOEA 4JHXA 5EWJB 4D3FA 4KZKA 1YR8A 3IKJA 5K8IA 1CCWA 2HYIC 3M8SA 4ETWA 3F90A 4XQ9A 4GMHA 2DUUA 1OOEA 1PYOA 2RGEA 4MQ5A 3UT6A 2I5PO 1KYQA 3MWFA 3OLYA 4IIGA 1M8GA 4JC0A 4BP1A 4EO4A 2C8LA 2JH9A 5KHAA 1CR2A 3DF9A 4ZQEA 4Z0PA 2J9RA 4YRDA 3TK1A 3EX7C 3JQEA 3HA3A 4HDNB 4S24A 1VPTA 2KE7A 2RAFA 2H0AA 3USES 5J2TB 4A2QA 3GLIA 4I6JA 3S7ZA 2PGXA 5CM8B 1Z2PX 1ZG3A 2E1EA 3ITEA 2Y93A 4Q9IA 4DADA 4O4JA 5KG5A 1U94A 3M8RA 2JAXA 4G0OA 2EIXA 3OZGA 4RV4A 1CULC 2A57A 2DPMA 2YFKA 4JENA 3BAFA 3FTEA 1ZGHA 1VJTA 5T6BA 2P40A 4UHKA 1MABB 3I6ZA 4NG4A 1GKKA 1W88B 4KLIA 3GDFA 1L1FA 2F17A 2BE7A 3AWIA 2AX4A 4FLEA 7ICRA 8ICEA 5BMOA 4EGJA 5JZ9A 3VZBA 2WG1A 3D7NA 5D5QA 3KSAC 1KY2A 1J9ZA 3VNVA 3R7SA 1EK0A 3FFXA 1XG5A 1N5OX 4TUYA 1X92A 4U7WA 5JCOC 3A6JA 4UU0A 2IYAA 2H17A 2AWOA 3PEWA 4XJTA 3X44A 3D3JA 5CXXA 4X1IA 4D82A 3G8DA 1T26A 2GBFA 4O4LF 4U63A 5GP1A 1VG9B 2HAEA 5LZ8A 1MO6A 2RHJA 4G1UC 4EAAA 1JIQA 1I2DA 1P60A 4LZOA 2MYNA 4I7EA 3RAGA 2WJPA 3LZ6A 2C2OA 3NTRA 3VPFA 3FWYA 2A1IA 4PLFA 2JJQA 1U1CA 3A4VA 4BMPB 4DMUB 3KV3O 2VF8A 3DXFA 3MC1A 4QT4A 5I7WA 3IBGA 1AT1A 3A27A 2D6FA 1W85A 3JRNA 3S29A 1IMJA 1L4FA 2NXWA 2PR7A 3LYHA 3HO6A 3VM6A 1CR0A 4KOEC 2W9XA 3GI1A 2A33A 1M6VA 3GLRA 1YD7A 2A8YA 3HKEB 4MRMB 2WKQA 4UUPA 2OK7A 3SKVA 2OYYA 2QGFA 3QEJA 3HB5X 4KLFA 5EZ6B 3CBGA 4C3ZA 5JHGB 1ODTC 1ONOA 3E2EA 1IUNA 1UOOA 3MUEA 2GTIA 3SK0A 1JIVA 1EDDA 1YVRA 2QPOA 3V1MA 5K0ZA 2Z0MA 4GZ6A 3DKRA 1CX9B 4AXBA 1I94B 3K9HA 4MV8A 3RRJA 2E1RA 4XVCA 1DCTA 1CZRA 4NM2A 2PT5A 4RZUA 1X80A 2DCMA 5KOHB 4GZLA 1OKKD 3DYVA 1JAZA 4RQNA 1RJWA 3FUCA 2OCPA 5HZHA 5JC8A 5HA5A 5DEIA 4J0IA 1IQUA 2MR5A 2BKVA 2Z1NA 1P9RA 1QPZA 1GPLA 3OE7A 2YV4A 4BNJA 5KX5F 2W2QA 1ZGAA 4JSRA 4RS4A 4URHA 3TQRA 4M21A 4O4LB 2EKZA 2LCQA 3TLAA 4DQIA 2Z8ZA 4BNDA 1EZ4A 3ONWA 4QBTA 3U6KA 2WWTA 1JU3A 1ZUD1 3IXLA 3LWNA 4LVUA 4ESHA 2JD0A 2IWRA 2EXXA 1RWNA 3W5DA 2P5YA 3CSDA 3TAXA 5I7VA 3DEEA 3FXAA 2HU8A 5J23A 1JLLB 1UK7A 2QI9F 2FLLA 2JJMA 1FNMA 2JCYA 3GH1A 3IVRA 4K6HA 3WGNA 2GASA 5L7TA 1ELOA 1E7WA 2ZWIA 3G5TA 3Q7PA 4PQGA 4OAOA 2IMWP 1NK7A 1R0BA 1ZQJA 4DV7B 2P2YA 2UYYA 5CDSA 2JGRA 1JG7A 2WRZA 4EZEA 1NT2A 1YZLA 5GOZA 4GVXA 1KDPA 3IUJA 1Z2CA 3N7UA 2WD8A 1GZHB 3D4NA 3G1UA 3MBKA 3PXXA 4ZVMA 4JB2A 3VBEA 3ZNPA 5JNRA 1S8OA 3SVZA 4LJLA 4TYQA 4UPDA 4BNIA 3HACA 3OICA 5EIAA 2AHOB 4LV5B 3HJBA 3I1JA 4MWTA 5CVUA 3MCUA 2ZJ3A 3GARA 5A2QA 2GM4A 4MWDA 1PKXA 1OZAA 4E6EA 4JEIA 2C88A 1F8XA 4KN8A 5CFQA 3ZD8A 2F3TA 4IM7A 2HV8A 3MWLA 5JS7A 2MUTA 4C89A 2A5YB 3DUFB 4P2GA 5L3SB 4MQ4A 1GTRA 3K8ZA 4F84A 3PHGA 3ANTA 4FFPA 3V8NA 9ICSA 1TUBA 2VTDA 4EY7A 1OV4A 2F8KA 1RCUA 3B1YA 3G6WA 4JZYA 1JHDA 3L7MA 4YP0A 2QLMA 4XTRA 1N1DA 1ULZA 2A78A 1YR9A 5ICGA 1JKMA 5A04A 2Q41A 2JK0A 1MX1A 3AQFA 2G71A 2I3ZA 2WDPA 2INGX 4I9GA 3WL4A 3MJVA 2J09A 1P72A 2GX6A 3ETEA 3KJNA 4ZALA 3TD2A 4YJ2A 3ER9A 4B4OA 4H15A 3IAFA 1RC8A 3RO7A 2GOLA 3UC5A 2EKQA 2XH8A 4AY3A 2FMPA 2OM6A 1W1UA 4LXGA 2WEKA 3U7QA 1GVNB 4CRWB 1OVGA 4AULA 3O8NA 5M3BA 3ZWVA 2DPYA 1SNYA 1QIFA 4O08A 3RYTC 1RSZA 4XFKA 4B3BA 4BQNA 1H4QA 1PJQA 4YRZA 2EW2A 4W5JA 1FU4A 2Q4EA 3RVPA 6Q21A 3BREA 4PO8A 1NONA 2C22A 5DB8A 2UKDA 3W3ZB 3TIXB 4BRZA 3DCJA 5IAEA 4YUYA 3JARB 4UEJA 3BSYA 1KPGA 2H07A 3OO1A 2OXIA 3ADDA 2ZJAA 1AU9A 4YPVA 1WY7A 2A59A 4L0MA 4RELA 3SZOA 2XCOA 3B2EA 2R6ZA 3QUCA 4K4GA 1S3GA 2X8AA 4YRBA 5ALTA 3L4EA 4KN4A 1YRWA 3NP7A 2H9AA 4K46A 1NVUQ 1AUXA 1KXJA 1VHQA 2I3AA 3KCQA 4D8XA 3LC0A 4CQNA 2X19A 4IMIB 2WWYA 2EL7A 3ICXA 4OG2A 2OGZA 4EGAA 1P6QA 1UFRA 4INAA 3T6KA 2FPMA 1RKUA 4RY0A 3MTIA 4NARA 4MVJF 2L19A 1M3SA 2JBAB 3Q0TA 5JSUA 4MF2A 1V4VA 3UHOA 1NVXQ 2HWYA 5DH9A 4DAEA 1OFHA 4BO5A 3ICOA 2VBGA 2CVPA 5LU9A 3GVHA 3EJWA 2FV8A 3LBYA 1YR1A 4WKCA 4BWMA 5A3VA 1SBQA 3FWPA 4MS3A 1B2RA 4XD7A 3PGXA 4IR7A 1T7PA 2QRZA 3SYTA 5ALHA 5FBVB 4CL2A 5IK2D 3UGJA 4OLFA 3EYWA 4RIGA 1BD4A 4ZC1A 3A9VA 5TPZA 3W6PA 3MS4A 1E2KA 4AJHA 1JR6A 1DX4A 2WUDA 1CJTC 5BV1A 2QNIA 1O5TA 1RXYA 3IV9A 3L02A 4L5YA 4LC0A 4M53A 5DE3A 4Z6DA 4QLAA 2VHYA 3WAJA 4EELA 1LW6E 1OQAA 2J0EA 3IAXA 3LA8A 5LA6B 5EKSA 1OX6A 1VLVA 1ODCA 3LY8A 5AI5A 4ECAA 4RQ3A 4QRDA 2IBTA 2ZJZA 4AZ0B 5JTTA 3L0IB 2VO1A 5E0OA 3RJ9A 2PZGA 2JHDA 2DQNB 1EDOA 1MD9A 1PNTA 2H1VA 3I30X 4RQMA 1H1LA 5G4LA 3ZHBA 5LIPA 5LQKA 4DGSA 4FBLA 3OJCA 3EXHA 2JZCA 2P0YA 4QNMA 3NHPA 1MBZA 1W47A 4MGYR 4I2AA 3GC6A 3QEMA 4KV9A 3E9NA 4LCBA 1BXGA 4Y6QA 2W2TA 1UDAA 4ILEA 1GT6A 2BKEA 2EEPA 3C3WA 2JR5A 3CKLA 4GOJA 4W1PA 3CG4A 4JUIA 1FJXA 2XDQA 2FLKA 2G36A 3JZAA 3LRXA 3TLEA 5JNLA 2XKKA 1I6LA 7ICEA 3P26A 2L5YA 1G291 3EQ7A 5K3CA 3U81A 3VR1A 3ZTWA 2Z98A 2QQ0A 5K6TA 1G3IA 5DB4A 3T3DA 4JLUA 5KVCA 3V2IA 4G1BA 2ZCJA 1DXOA 3MJRA 4HX9A 3INYA 3T5DA 3KQSA 3T9AA 4LJ9A 3QENA 4BCBA 4FEYA 2CVFA 4AWXA 3BH7A 2AF3C 5TS3A 3C5VA 3IP8A 3EDYA 4LXUA 4RXTA 5JMOA 4OBXA 1G5FA 1I80A 1D0SA 2W6PA 3N5KA 4MUYA 3CVXA 4CMHA 4AXXA 4LHXA 3HCFA 2Z2JA 1N2BA 2WAQF 2YV1A 1TVAA 3E58A 4DSZA 3SLKA 3HK2A 2X0KA 3PF9A 2OO5A 3C23A 3AETB 2MYUA 3KZMA 1IG6A 5G40A 1AV6A 1CUGA 1T5LA 4X41A 4Q9AA 1CEZA 2HCTA 2YRFA 3IAUA 4A8JC 1AGNA 1EM8A 4WK6A 3YASA 2AFHA 4Y18A 4MW9A 3BGWA 3Q0EA 4KN9S 5HSGA 2PLWA 1RADA 4Q00A 3FSGA 1LGYA 1UQUA 4DCTA 3H4TA 5HIAA 1YJ8A 2FGJA 3GGDA 4B3FX 4IDHA 4CKCB 1CP3A 1QFXA 1VMIA 2Q2NA 5IXSA 2RGDA 4ARUA 1G7RA 2QUHA 4J0JA 3WLSA 1H9CA 2F43A 3AI2A 1DO0A 4I4TF 1WZNA 2IHZA 2UUPA 2XNJA 1WMAA 3AR7A 1RXVA 3BZUA 3LY9A 4M9JA 3TD9A 4N7BA 3I2GA 1E6EA 2AF4C 3JQGA 4P93A 4TWBA 5CUQA 4C8MA 3M1LA 5K8TA 5CAEA 5AUOB 3COPA 4IIUA 5JXHA 4DIEA 2GA8A 4YJ2B 4TLEA 2CXHA 5KVAA 2NU9A 3DGEC 1V7PC 1S8AA 2QTMA 5HK8A 5CXUA 3C0KA 3KUUA 1XCJA 5ALKA 4EDFA 1XJCA 4GVPA 2OWEA 3KKLA 3CE6A 3K75D 1RYZA 2K2WA 3HV0A 3K5IA 3PGMA 4XDYA 4X3CA 3FNFA 1P18A 2X9VA 8ICJA 2EG5A 4RENA 5A62A 2IXFA 1JQ3A 3ZCQA 1GGJA 1NXSA 4UCXA 4BRSA 2UZ0A 5JECA 4KXNA 4LE0A 2IX3A 2HIGA 1K7XB 1OXBB 3KP1A 2POQX 2W8ZA 3LF2A 4FHZA 4KRYA 1WJGA 2EFJA 3B1WA 2ZYWX 2BAGA 2ZROA 3BB1A 1RJDA 1PG2A 4IUBS 5E3IA 4BNYA 3UOAB 3ORYA 1W581 2FETA 3CX8A 1RPTA 5HE8A 3M5WA 2GAOA 1CUSA 3FLAA 2OWOA 1E0KA 1EP1B 2QTTA 5IT5A 4B9TA 1C30B 4EYKA 5ULLA 2I6XA 4HRYA 5CVJA 3T8YA 1F0KA 1U9CA 1YO6A 4GM0A 4DL3A 4DQRA 2OENG 4MYUA 4ESVA 2PWPA 2A0UA 1K3UB 4NDZA 3CH6A 2GQ0A 5IAKA 3CIOA 1V47A 4MR7A 2ALJA 3RTDA 3P9SA 4PPFA 3I5YA 3THXB 3ZDCA 1XXLA 1QRSA 2IHBA 1BMQA 1U7PA 2H3QA 1KGSA 2JRLA 2VQ6A 2WHEA 3UKJA 4OB6A 2ZT7A 1RPAA 2OMKA 1AY0A 2MHCA 3ICWA 5A1TA 2WLSA 4OJKA 1JZQA 1TM1E 3ME5A 2AGQA 3N0WA 1Z8NA 1UPUA 3NBUA 4RTPA 4B73A 4G0XA 3LLUA 4MJLA 1E2UA 3WWCA 6LDHA 1JWLA 4FS3A 2E5WA 2YWRA 4KWCA 1X1SA 5TMEA 3HWSA 4D5EA 3UY4A 1C3OA 1G5HA 2JCSA 1UZNA 3ESZA 4YB8A 3CVUA 1A04A 1ZQLA 1TA9A 1A72A 1UBJS 3MR3A 2QL5A 3A36A 1P8AA 3IURA 3R6GA 4YRFA 2NMVA 4H1VA 1D04A 3RS7A 2PY6A 1X6VA 3GIMA 4M9HA 2FSVA 4C8OA 3IVXA 2DWQA 3DE6X 4IIFA 1KP3A 4PYNA 4ERXA 1DRKA 4Y1GA 4PHEA 1G8PA 2IODA 3PFGA 3H1FA 5LQMA 4GXIA 1U4BA 5CDYA 1QBGA 1U5BA 4K9OA 2QZJA 3PZRA 1TM7E 3M3PA 5BR1A 4R65A 4G2TA 2VJQA 2H11A 3DWGA 4MMYB 1QFSA 1RQNA 4N0MA 4IX1A 2COUA 3STTA 5L1KA 1ZGGA 2O6LA 1EGAA 1M34E 4ZDWA 1E9VA 2MYPA 1XZLA 5JRTA 4ECYA 1EFTA 1RJ9A 1YS7A 2JFBA 2VHXA 1BEUB 3OSZA 4WN3A 2E0IA 4ZT7A 3CRVA 4UB6U 1V1RB 1V9SA 3FSGD 3GRCA 4NQRA 4RVUA 1ILWA 1Z3EB 1QNLA 4X3OA 4EF5A 2VT7A 2XKAA 4QZ8A 2CBXA 3KLMX 2EF1A 4RETA 5MHTA 2UAGA 4JR1A 2NXEA 2C77A 1CR1A 3HS3A 2HPHA 1J2UA 2O06A 3AILA 1EKXA 2QN1A 4K9DA 1QE5A 2TMGA 2YOHA 1NKSA 3M4NA 3UMMA 1L7VC 2FAXA 4IILA 4RPLA 2AW3A 1MTOA 3EYAA 1KVRA 3DAFA 2VJPA 2QR5A 4KLEA 3BH6A 4UBCA 4RLFA 3BJYA 4BEVA 2XYVA 4P4LA 4DCMA 1FVOA 3EWSA 4FN5A 4YONB 1NRXA 2VPPA 4XD7D 2VWGA 3CLTD 2GRUA 2AJQA 1EK6A 2Y0BA 2Q6TA 3QOXA 4N7MA 1VLHA 1F8YA 2H4ZA 2BR3A 2WNIA 4C2BA 4CMEC 4TL8A 4QJFB 2CLDX 4YLYA 4R7ZA 4CIWA 1X7XB 4RHTA 4REMA 2NSHA 1TLLA 4F2GA 1DHRA 3E1SA 3SS9X 3NWEA 2DPIA 5IC4A 4BOYA 3KKQA 1BN7A 5COBA 2F9MA 3FB1A 1C0EA 7ICKA 4MYTA 2HJHA 3NC4A 5E2BA 2OGSA 4BQRA 4BP3A 2NRTA 3FF1A 2N75A 1N7JA 1N2XA 3OO0A 1IN5A 3A6HA 3FW1A 3T7CA 1WXQA 1BEZA 3UJPA 4DDUA 1X7WA 2K2QB 5LYJB 3QBJA 4LF4B 2X9LA 1DBIA 2O2XA 4BAUA 4JKYA 2EX0A 2XEXA 1THTA 2IEZA 1DG3A 2P62A 2W4QA 1UBMS 2WU1A 1ZGBA 4O4JB 4P4MA 2BGGA 4II3A 1JFFA 3SZLA 3W9BA 1KSJA 3BICA 1WUTA 4JV0A 3HN2A 3LZDA 5BQ3A 5KJ1A 5EPEA 2J6UA 2VDOB 2GD6A 1V85A 5TPZD 5EWFA 2F9LA 5B3JC 4HK4A 2LCIA 3GGJA 5HZKA 1T6BY 3FGOA 2BPCA 2DXIA 3VX3A 4KMSA 1E98A 1VKZA 1MFZA 4F04A 4ZZ3A 4EWLA 4ER7A 4GBED 4D4IA 5DHFA 5EJ9A 2NV6A 3I92A 3ZJ5A 4C06A 1K9VF 3HQ4O 2PHZA 4IBOA 4DE5A 5HUQA 4IQUA 1QIDA 3A9WA 1OZ0A 5HHHA 3OQMA 1PGQA 1PYDA 1JG3A 1V11B 2PIAA 2VF2A 3ISTA 4YT2A 5IJ9A 5J2BA 5AVYA 3D5QA 5JIBA 3UWOA 1ND6A 4GLLA 5EVJA 4EYEA 4LFAB 2HUPA 4QYSA 2ZUBA 4BVLA 3QLVC 2ZBQA 2NO6A 3VV3A 6YASA 1MO2A 4BU1A 3FY4A 3NHWA 3MFQA 3F67A 4PAWA 2JFYA 4HH3C 3ADCA 4QICA 4B3CA 3LYSA 4NXZA 1IJBA 3OA0A 4IDDA 3GD7A 3LYAA 3M9LA 1E3IA 5CDGA 3WSTA 4KCGA 1EFPB 2DBYA 2YIDA 2V6GA 5F77A 4YMMA 3O0DA 1S8NA 2CT8A 4MUHA 5LQCA 1TCVA 2H8GA 1XN1A 3HWRA 1MO5A 4JGGA 1HNWB 1Z75A 1QGED 3V3TA 1B15A 1IRXA 2IE0A 4PZPA 4B3TB 2LP4Y 1FMFA 2QZ4A 4EYGA 2LPMA 3WGIA 2GK4A 2GFIA 3EVFA 3K53A 4U3JA 2GLTA 3T79A 3COSA 1H0HA 1N8KA 2DTDA 3GUYA 3TZCA 5KKNB 3NVMB 5ARBA 1LS1A 2FPGA 2EZYA 2JJ2A 3DMDA 1WX1A 2C1ZA 4BS9A 2W9MA 4BO0A 3EZ5A 2O9JA 4M7WA 2X4DA 4PFSA 2EP7A 4MB2A 5IDYA 9ATCA 3ZS9A 1PZFA 3E53A 4GGPA 3VSCA 4N6GA 2GUWA 5IYZB 1RWQA 2ZRDA 3K05A 3KL2A 5FBRB 3RH0A 3ZZTA 5D87A 2WVAA 4A8TA 3A4YA 3ORFA 2PJZA 4CMCA 4EHFA 4M0UA 1CE8A 5F33A 1Z8DA 4MFAA 3TNFA 1EVJA 3U31A 4Q05A 1GGNA 4HLDA 4L7VA 3W3AH 4E5NA 3RAEC 4MYHA 5LXTF 1KVQA 2FF5A 3GLSA 1NG1A 3TZQA 5BUCA 2ZIGA 5IM4F 1Z4OA 1MO4A 1XCMA 2EGUA 1F17A 1H0SA 4TGLA 1H3FA 2H31A 4B6OA 4CKXA 4GLXA 1ULUA 4E22A 2OILA 4D3DA 1V1MA 5B6PA 4PR0A 2VWQA 1SKRA 5C81A 3AEZA 2IIVA 3DTVB 3PDIB 3MM4A 1SIOA 1HYEA 2AUNA 1VYTA 2WP8J 2AQ8A 2FWBA 3DE5X 1U7ZA 4ED0A 4FOOA 1XCOA 3WK7A 1E4OA 1OBFO 1Y34E 2IP4A 1N5KA 2I7TA 2H57A 1OLXB 2G83A 4GM4A 4IDGA 1ECJA 4QBFA 4LYJA 5E9AA 5D3KA 4LOHA 4OKNA 3O4RA 1N7HA 1CG6A 1EJ2A 4EJ0A 1ECCA 4F2WA 5K05A 4PZOA 3D9QX 1LSJA 1IIRA 3H9QA 4RSGA 4Q4DA 3C1UA 3TANA 1FZQA 2OAP1 3ADBA 3B13B 2GRAA 3R5KA 3OM8A 5DKFA 5KVQA 1V5GA 2HLPA 3WP1B 4EKYA 1F8GA 2GXQA 4TXMA 3LUKA 3ROMA 4Q66C 2PKRA 2O6KA 3B9RA 3G8BA 4XGIA 4XWYA 1YAJA 1ZXXA 2YWFA 3L46A 5DBIA 4C0XA 5CFRA 2ISOA 6ABPA 3LX8A 4O4IB 3L4BA 3EBLA 2YQ4A 2JVIA 3AP1A 1LI7A 3ITDA 1JEAA 3MLEA 4P4UA 2X2FA 2ZDGA 4NWIA 5ED4A 4QVIA 2H6EA 3KFXA 2RHTA 4CODB 1XCBA 2JCXA 1S6YA 4O6VA 4JI8B 1KEWA 4Q6BA 4EECA 2EDCA 3KQUA 3GIWA 3O0FA 3ICPA 4C88A 1U0SY 2FMKA 1SWWA 1N9KA 3MF4A 4DW8A 3K0BA 5A9SB 2FZGA 1K6EA 3EGVA 1GILA 2G9RA 2OG2A 5FT9A 3GT3A 3VVMA 1AX9A 5DX8A 1DDOA 2QP3A 2ACKA 3R24A 5DU2A 4ZVTA 4UAWA 3D6HA 1LFAA 4K8RB 2YUTA 1M2VA 3WDMA 2CXNA 3TZBA 5BPHA 3NV9A 1KDVA 2WI8A 3V2UA 3ZQ4A 4TS9A 3EZXA 3RF7A 2O3QA 3EIQA 2Y9PB 1JA9A 5AHOA 3P97A 1O57A 1P8JA 4EJMA 3M5DA 4KIJA 1MV5A 5KREA 2Q3LA 4TVKA 5HQ3B 1A5ZA 1G6OA 1T3LA 3KNZA 3K2IA 4MHOA 4CKBB 2Z04A 3UK7A 3DB1A 1T10A 1YV9A 4P3XA 3RANA 1P19A 1V9PA 3BWCA 3D1LA 4KLRA 1J20A 1OC2A 2I1LA 3CNHA 2E82A 1GSAA 1NLMA 2FN9A 5H1YA 3AESA 1BPZA 3DE0X 2R18A 4FUQA 2QPLA 1R1DA 1BKDR 4NYJQ 4PW0A 4R0VA 3ZIAD 5FOVA 1A8PA 4HXEB 3QUTA 3AHJA 4E2FA 3LFHA 2WSMA 4DLNA 4Q4HA 5AW6A 2GZDA 3VC2A 1XXHE 1U0BB 5J0TA 2RGUA 4OLAA 4MA5A 4FEEA 4NK4A 2EANA 1CUBA 4UUBA 2O59A 1GDDA 3IUYA 1JF8A 3W1VA 2H63A 5BUQA 2MT9A 3WI7A 3CRQA 4IDEA 1PGPA 3D59A 4KFRA 3HU1A 1LBQA 5I9NA 1RG6A 2ENUA 4IIJA 2ZIWA 2HU2A 3CC8A 4IH1A 2HHTA 4KSYA 5DYYA 2XUAA 2C84A 3GJ4A 4RABA 4E33A 1VJ0A 9ICBA 1K4YA 4IAOA 1XEFA 1OE0A 4O5EA 2XB8A 4PZEA 1MJGM 1DCMA 1JWAB 5B37A 4DN6A 5BSKA 3G9ZA 1MC1A 1B16A 4JUZA 2QTCA 1A8UA 4CM5A 5KDDA 1L7QA 2EFEB 4LCJA 2IC5A 4ZODA 1YR6A 1X9WA 2RDIA 3UUWA 2NLOA 1GPH1 1CK4A 4GS5A 3RIXA 4QLBA 1WP4A 3IR6A 4M87A 4JASB 4QXPA 3FB4A 8ICSA 1GKUB 3GZFA 2WW8A 4JV5B 4EFLA 1ZY2A 5HQTA 3NVZA 2XSZA 4J0EA 5IH3A 2XCRB 2ISCA 1VJRA 3L4SO 2QTBA 1X1RA 1OH6A 4ELVA 5EJ4A 4KR6A 1VE3A 2V3VA 2O3RA 2HSGA 4OXXA 2DFDA 1QO7A 4OQQA 3PIRA 2GD2A 3WFIA 1JG4A 1R3UA 1HWYA 1XZKA 1NBHA 1K7YA 5IINA 1J2YA 2WQZA 9ICCA 2ZJ1A 4PZUA 2IF0A 2O8VA 1FXUA 2HF2A 1PR6A 3BRSA 1DAKA 3CH5A 3IO3A 3M34A 4NBWA 5YASA 4UNNA 2BEWB 4MHVA 2NO7A 3LP6A 4EUNA 3SXPA 2YYAA 3P9YA 2F3UA 2NO4A 1R8XA 2GWSA 4K6FA 1NC1A 2GB4A 2JGNA 4XDGA 3RIEA 4A16A 1KH3A 1GO2A 5L1LA 2JLWA 3MWKA 2CCGA 3RQSA 2QW1A 5C5CA 4Z4GA 3RVSA 2L42A 2QRHA 3I2IA 5BUZA 5KYNA 2ZTMA 5EGSA 1XWWA 3EQ2A 3IDSA 3IPYA 2CVQA 1LLDA 3FYDA 2HHLA 1VXRA 3ZW9A 1MXFA 3U3OA 4P4SA 1HDYA 1D8TA 4UC0A 1Q1GA 3K70C 2QX4A 4DV0B 4KQ9A 5LA6F 4B48A 4AQYB 4EG6A 3LLVA 4F9FA 1T35A 3WKCA 5HKKD 2H65A 4G9EA 3ZCRA 2GEKA 2HCBA 2XGOA 4EY3A 3Q9NA 2UYHA 1FVHA 3ON5A 3KXIA 4NH0A 1PSWA 1Q0UA 4EUEA 1FIUA 3FPAA 3MOSA 2Q1TA 4U7PB 1BDJA 4QTTB 5KKAA 3URMA 4LDQA 3C5FA 3QU5A 3SQIA 1DAGA 3AUTA 2A5DA 4W9NC 3V48A 1KK0A 1P0CA 4ZT4A 4B46A 3SHQA 8ICRA 4RO0A 3U44A 2WMDA 4Y6OA 1R4NB 5K3FA 1XROA 3ZWWA 4D9CA 4DIUA 1QU2A 4O25A 4PBRA 4QQKA 1P62B 2WG0A 3WHLA 1J9GA 1F2VA 3BIXA 3CW2A 2PGNA 2X76A 3DEIA 5KQSA 5L6LB 1WY5A 1WZEA 1I3MA 4JYPA 3ZCXA 3R76A 5DTQA 5TIIA 1KJIA 5ALVA 4NECA 2GDJA 3X1JA 2A9OA 2AZ4A 3SZ3A 4BRWA 2B5OA 1EDZA 3VR6D 4NDAA 4WH0A 5EFOA 3WNDA 3K70B 1RKQA 1X1TA 2C2RA 4S3MA 4RF4A 1HQDA 4UNSA 2BFCA 3BQ0A 1KYWA 5L51A 4MR8B 4OJ6A 1WPXA 1S5PA 4IIJF 1GTL1 3WO1A 1HK7A 2QMOA 5AH0A 1CRPA 4RUCA 2ZRGA 3GD5A 5J8YC 3TMKA 5EXPA 4BRUA 1W1IA 3HR4A 3M9XA 2R6R1 2IUFA 2BPOA 3VR4A 4XQEA 2NADA 1U2GA 3PR5B 2ZZKA 1J8VA 3AHEA 3OFJA 4HAZA 5G1PA 4QQ8A 4RJJA 5FO0A 3RAJA 3RUDA 2GJ4A 4EKNB 4QG7A 3AR4A 1U9ZA 1NBEA 1YXMA 3SOPA 2BCGY 2DFKB 2YVKA 1E1KA 1SXIA 4TUQA 2A3NA 2Q07A 3KJGA 3MD9A 1KYYA 4H3KB 2IT1A 4PX9A 2VP2A 1L7XA 5AVJA 4D3SA 2KN7A 1SRRA 4L5CA 3RC2A 3QWIA 3DOOA 4MQFB 10MHA 2JFUA 3GPCA 4YR7A 3EH1A 5DLYA 2WSBA 4KPEC 2GN8A 2VZ8A 5HCNA 5J40A 3JRWA 4H6WA 4HX5A 3IUEA 1R64A 4N7RA 4WVFA 1HV8A 2I34A 3RVKA 4DNXA 5IS2A 2HSWA 3DKIA 3ILSA 2NV3A 4QSMA 3WDKA 3PFIA 1V3VA 2QRLA 2R1UA 3B1ZA 1ZJNA 3K9FC 4NJOA 4TVOA 5HUJA 1U8UA 5I51A 2ACVA 1QAOA 1HO3A 5SYNA 1DWUA 1HUOA 1G8AA 4DSEA 3A25A 3DCNA 3O7MA 1FZTA 3UXEA 4JJ6A 5H8WA 4TQAA 3RVLA 3DSRA 2Q21A 1N2OA 5AW2A 2O52A 3G2MA 2IOFK 1XEXB 3P94A 4AKEA 4NM1A 2DHEA 2XBLA 3G2LA 5DASA 2JIZD 4DB4A 3A05A 2RJNA 3RHSA 2JLSA 4OYYA 2Y3IA 4KIWA 1GAJA 4BV9A 2Q0ZX 5JUWA 2QQEA 1T9CA 2Y8EA 3L4KA 5AWFC 3SKYA 3NGMA 2CHUA 1K7FB 5I6DA 4OAQA 5D5HA 3FUVA 3AZQA 1LVUA 2RKWA 2HW3A 4OK5A 4WKNA 4DJJA 4IZ6A 3F3KA 4MQEB 1D2MA 1O95C 1VECA 3PSAA 5C4GB 5U9CA 1QGDA 3H11A 3WK4A 4UFNA 3AEQA 3H5TA 3GY0A 1NN1A 3K0FB 4MIKA 5DULA 3NIFB 2CYCA 3WRXC 4D92A 1JFRA 4GPEA 1GHTA 1I0LA 1MGPA 1GGKA 1SHJA 2GAFA 2WIFA 4F91B 4QXQA 1HFKA 1TU3A 1SBIA 1V2GA 1X39A 2FX2A 1DZIA 2IW1A 2WDZA 3ICCA 3N87A 3N2GA 2ODEA 2XF2A 4O2AA 4OMFG 2W5UA 3ZVRA 4Q4CA 4DUYB 3DFIA 2XQFA 4LV6A 4MF8A 5JFGA 3GPDG 3GXOA 2IZZA 2OBFA 5ED0A 3ZIDA 3ICEA 1JDBC 1ECLA 4C0HA 3HXMA 3KHGA 1C5KA 2ERYA 2HXGA 3BGOS 4ZEOA 3T7IA 4G84A 4XPIA 1H38A 3Q3IA 4W5QA 3H6GA 4MCJA 3CA8A 4P83A 1J9EA 4P81A 3MSCA 1ZD3A 2PWZA 4IV5A 4YCMA 4KXWA 3S27A 1RBQA 5IU6A 2R8YA 5K8JB 5L3VA 2PGOA 5FLKA 5JO0A 3GIDA 3IPRA 4KC0A 5BMVA 2B99A 3L7OA 2QVZX 4II7A 1THMA 5KCZA 2Z09A 3ZU2A 5DHRA 5KQPA 3CP8A 2Y77A 3EDOA 4TLBA 2B6HA 1N4DA 2JFWA 5EESA 1R9JA 2QE6A 5CT9A 2NXJA 3HDJA 4GM1A 3GG2A 3CQ9A 1E6LA 4N5DA 4Q8FA 2VYVD 3WLEA 3FOFC 2KSOA 3KPYA 2UVRA 4PPNA 3IBYA 3O84A 4ZQHA 5BT8A 2W6OA 2XTJA 4DDTA 4ZCTA 1NHWA 1L5VA 2GLUA 2OV3A 3KWLA 4MWBA 3V42A 2IZ5A 4YVZA 4CCWA 3EEIA 1DJPA 1GN9A 1YZTA 3LDFA 3PL5A 2I1VB 4Q7MB 4LRUA 3D2QA 3ZGXA 4DQVA 1DB3A 3CG0A 2VUHB 1Q7BA 4QPZA 1IHPA 5HRUA 1NPTO 2RG7A 3KTQA 3HDHA 1DKUA 2X58A 3SC2A 3RVQA 1O77A 3U39A 3DFMA 1FYFA 1HYBA 4ZAXA 5KI6A 4ZEVA 3W9SA 4QPJC 1QTMA 2QYHA 4NNJA 4YHBA 3COJA 4IRUB 2ONKA 4NNOA 4O2LA 1YZ6A 4XB6B 3HI4A 3I45A 1N2EA 1SVNA 5DHUA 5BNTA 4R8VA 2AQKA 3SV3A 4Q45A 4O2RA 4LPKA 3N70A 1U02A 5F7ZA 4PLZA 1YIAA 1ZH6A 1AA9A 3HNRA 3R5XA 1XCPA 1PN3A 4TXHA 1WEKA 3DAOA 2WJYA 3ITNA 4X5OA 5TT1A 3A14A 3UV3A 3JPRA 2SECE 8ICVA 3DTVD 1SC4A 2C8KA 3F74A 5JS1A 3AUFA 2UUBB 3RS0A 4CMAA 4DXAA 3RFCA 4BC0A 3A2MA 4RLSA 3KUKA 2KQUA 3OQJA 1ZQPA 1T34A 3CLRD 3L6RA 4FHGA 3VA7A 2YXDA 4JWKA 3H0MB 4XGRA 1UAGA 1AROP 1G42A 1RYSA 2OAGA 3VO9A 1O6CA 3ZN2A 1ZCBA 2DR2A 2P8JA 5JCJD 2CNOA 2IBKA 4TS3A 5BOVA 2UYGA 5GV7A 2IF2A 1RD4A 3AFIA 1RQGA 3FPEA 1EHYA 5EZ5A 4XWAA 1FYDA 4G5FA 1BVRA 4IOLA 1Z6XA 1A96A 1MNQA 2NU8A 1PJSA 5AI6A 1YC2A 1YDGA 5A5VA 3KIPA 4G0VA 2JEFA 3M70A 3H4VA 2RGGA 2J41A 3JYOA 4MKRA 1Q7GA 5C53B 2AOXA 4NOKA 4C3OB 3ZHXA 2BI8A 5HP4A 1KZHA 3OJSA 3L93A 1XDUA 3GNLA 4ILKA 2H4WA 4CMJA 3CVWA 3O5AA 4JP2A 4U39A 2RRDA 1AXGA 1TJNA 4EENA 3MOGA 4J9UE 1IOWA 3TOCA 1E1RA 3ZHVA 4E1BA 5L4NA 4D9MA 3PJGA 1XTKA 2IYUA 3MTAA 2F4VB 1NZFA 4DF3A 3CZCA 5LWHA 1XTZA 2J9YB 4OBEA 3TAHA 3HEAA 3R41A 2V6IA 4RUKA 4B83A 4BQQA 1IUPA 2QE7A 2WTAA 1CVLA 3CUYA 1U7DA 1UEJA 3BDVA 3ZBTA 3L04A 5HIIA 2JC3A 2IS1A 1EAYA 5EY5B 2Q1UA 2PU5A 2WD7A 2DHRA 3UMVA 2GETA 1DXHA 2JVJA 4YUVA 1CLUA 2H4YA 3L7LA 3UJDA 2A6PA 3SLRA 5KNIA 2V6BA 4UPVA 1VYVA 3SYRA 1H9AA 1T8WA 2CLLB 2CXRA 1PU2A 3D4OA 5AQEA 3TLGA 1YVEI 2QOEA 3QKRA 4XDZA 4JJEA 5FIUA 5K3EA 1QG4A 2EARA 5ERYA 3WC4A 4OVKA 1MAHA 4I5DA 4KBGA 3V00A 1UCFA 5TX7A 1OWNA 2ZBEA 3T1VA 3NAZA 1ZUHA 4W1SA 5DTEA 2BJVA 5K0TA 4RNOA 2IUEA 4CG2A 5JXJA 1IL0A 2NTJA 1QO0D 3PA8A 4OQ4A 3NBYC 3GDXA 1W19A 4HWPA 4RNNA 1KJQA 1IG3A 1PI3A 2D1SA 3LO5A 2FR1A 3RH6A 2UDPA 3UQZA 3DT6A 2XA9A 1UBEA 3WMXA 4MTCA 4RJTA 3O8RA 1K06A 4I3HA 1YQXA 4J0FA 2I66A 3OE4A 5BQ5A 2G7ZA 2WYIA 1QIKA 5IKMA 5IUNC 2D54A 2I87A 2P90A 4KLGA 3PIIA 4GYWA 4CLEA 1QIMA 1L3TA 2QA5A 2IPXA 3NIDB 1T36B 4KVFA 4IO1A 3H5OA 1IEQA 1VC2A 4CKBA 4P4OA 1Q0QA 1QRRA 2Q0QA 2WE7A 1GUZA 3DR5A 5KFAA 3IDFA 4N01A 3WGYA 5AVVA 5A0LA 4I2NA 1IJEA 3BK1A 4V2UA 3ELDA 3WG9A 3L8HA 3WLLA 4BX9C 5FBLB 1RE1A 1U0OC 4LE1A 1DGQA 4I4CA 2BBOA 1TD1A 4ASUA 4QOFA 1E6WA 1GXSA 1ZQBA 1CNFA 4RPYA 4Y1RB 4ZT5A 5EIFA 1Q0LA 2YBDA 3FDFA 4LIPD 5J4VA 1FSPA 2C99A 1OMOA 1XZIA 3NONA 4BE4A 3H0RB 5DFAA 2G07A 3U1TA 2BH2A 2PD6A 2M1ZA 2F8TA 4FCCA 1T0UA 3KQYA 4NYIQ 1KZ4A 1KDHA 4CM8B 4EUKA 3GJZA 1U04A 2OUKA 2RFLA 3DAPA 5EL0A 4XUDA 2FPPB 1XFAA 2JD1A 4KXQA 3SYLA 2OXCA 4GZ3A 5SY6A 3IULA 2AIRA 1KMMA 1BPXA 3G8AA 4XZ3A 3W78A 4F4JA 4PN7A 1W4CA 4HB3A 1HM5A 1W5SA 2IUUA 2PFOA 1XEAA 1T9DA 4OLJA 4ALJA 4BKMA 5IFKA 5LWQA 1TAGA 5ALXA 2IRWA 2CW5A 3ND8A 3T3FA 3F6YA 3PTAA 3SDSA 1GL3A 1BMFD 1CZKA 1G8JA 1UWCA 4Q9NA 4WDRA 4B8ZA 3L5OA 3IALA 3QEOA 4KNWA 2XUZA 4X3PA 4RA9B 2X8BA 3H0CA 3C6YA 4KO2S 2DMRA 1ETUA 3ELWA 2C2KA 3TAUA 2OESA 3ZWOA 2ECQA 4DM4A 1A71A 1ED1A 3E0QA 2FZLA 4V0NA 2XT6A 2BFDA 1I9GA 3QE0A 4J94A 1E1CB 4GOXA 5IXYA 4R5HA 3JALA 3VVCA 1DWOA 2IIBA 1ISGA 4QGSA 1PE0A 5GIOE 1TK3A 3OIDA 3KLPX 1R6VA 1T4MA 5FBHA 3RK0A 4L74A 2O05A 3FRHA 3DJYA 4DSKA 2IIQA 3C85A 1IYZA 3DBRA 3FYCA 3NTXA 4HTAA 5A6SA 2C1EA 2FKNA 4B09A 5KT7A 1WU8A 1VG1A 2IEGA 1XD2B 2YDXA 3E23A 2ZBFA 3SMVA 4FJ1A 4HRVA 3WYAA 4Z6EA 3ZY6A 5IF9A 4CMIB 4EGQA 3N2KA 1T43A 1DEHA 1PZEA 1Y5MA 1XHEA 2FP3A 4FFWA 3WLQA 2H00A 2WJIA 2X14A 3P5BA 2ZBVA 5IIJA 3L06A 4NS1A 3R3HA 3TAQA 1CHDA 2R3SA 2WAAA 5JDIA 2K4IA 2GEUA 2VHZA 3IVGA 3TSYA 5I7UA 2KW5A 1GD1O 5KYXA 3H5AA 1RIIA 2X5KO 3R9XA 1ZUWA 4MS4B 5DG7A 1SUDA 1Y98A 5KSWB 1KDTA 1K5PA 2NAPA 4O2BB 1XNRB 3MBYA 1C41A 2O2GA 4MSUA 1SBHA 4EMBA 4YEDA 4DIMA 3ZLBA 4NP6A 4FOPA 3Q72A 1H2AS 2ZRAA 4L9RA 4X7PA 1TYBE 3CF6R 2FE1A 4HQNA 2VJKA 4RZHA 3SAJA 4C9BA 4LWOA 3GIIA 2EL9A 4F6RB 3HTXA 4R6WA 5AM5A 3SYMA 1X8LA 1X3LA 1PT6A 3LQYA 4JC5A 4TMXA 5F1PA 4IHAA 1SQGA 1GCGA 4Y1RA 2A2ZA 3JAMA 5BVGA 2O48X 2P3LA 2I55A 4ZV9A 1PVOA 1UUFA 1Z16A 3MFHA 3WV4A 1HDCA 5C5IA 4J9KA 3P2MA 1X14A 2AJ8A 4KLJA 5ELMA 2BZ0A 3M1AA 1OH5A 2HSDA 2DL0A 3PSHA 5D49A 4B87A 1XRJA 3DEAA 1DBVO 1FPQA 1QCDA 5ITSA 1DPFA 3OP1A 1R27A 3OGUA 3K6SA 3HO1A 2KB0A 3U7JA 3W4IA 3CEPB 4DCNA 4M1OA 3D8TA 2I4LA 2XE4A 1N0IA 4UCWA 2W9CA 2CMHA 2P9GA 3GT4A 2LDBA 4QODA 3VR4D 4AIIA 3JQAA 3V46A 2RJOA 5LBIA 5GADl 2PUHA 2FN7A 4UREA 2QNBA 5ALPA 2C4MA 3C6MA 3UXOA 1CSEE 5HMMA 5DBAA 1U98A 1DQZA 4HDRA 2KPOA 2P6NA 3HADA 4Q1FA 1ORTA 1PWXA 5GPBA 4BV3A 1E2MA 3MTBA 5I9IA 1AGYA 4OSOA 4PGXA 3PJRA 1PNRA 5TVGA 5DGXA 2XTZA 4LEIA 4BMNA 1PJCA 1PIWA 1FF9A 1C9DB 3E81A 4HHEA 4KRGA 3KL4A 1KOJA 3VDMA 2H7CA 3KWMA 3HL0A 4LGMA 2PFGA 1KY4A 5DLFA 1JYEA 4OYRA 5FYDA 3ZZNA 1B93A 4FIZA 4RGYA 3FETA 1TYEB 3HP4A 3G8YA 2GN6A 3H2IA 5H4HA 5HNKA 3TL3A 2XVYA 3WDSA 1BW9B 2WAMA 1V41E 1N6NA 4NK5A 4Q7EA 5LCXA 1O95D 3N8KA 1JKFA 3NALA 3RUHA 5E4TA 2HCFA 3EA4A 3PFFA 2CNDA 2XT0A 3U9TA 3ZOZA 5I7OA 1HE3A 2HREA 3LGXA 2FPIB 1FFXA 1OYVA 4IV0A 2HK7A 3RC1A 4JR0A 4A2PA 1I0ZA 3G7NA 4D9HA 1VSTA 4GZMA 2WSSD 1ZM9A 4C0WA 4HADA 3IDQA 9ABPA 1ZD8A 3KKEA 4H1TA 5EVCA 1X1AA 3PJFA 5HTKA 4RULA 4MFCA 4GPBA 1YZYA 1LV5A 4BZPA 5CEEA 1P4GA 1EB8A 2Z5FA 4RFSA 3V6KA 3DM5A 4M98A 2KEYA 4Y2SA 4A6PA 3MTEA 2XY7A 2OV4A 3OZRA 2OM2A 4C3VA 1TTQB 1B1AA 9ICHA 3DT8A 4II2A 4BMDA 2X0IA 4ERNA 1UC9A 1VSVA 3PX0A 5D4BA 3RVBA 5M04A 4YI3A 4UB8U 4D0NA 3QPCA 5D6OA 3WNQA 3CLSD 4EL5A 2W2KA 5CFOA 5BR7A 3GEDA 4ZJZA 4Q12A 1OI3A 3HKBA 3F5AA 4XLLA 2KE5A 1EK1A 1IBRA 1Y1PA 4NEGA 4M9QA 5L4SA 1AO0A 4KOAA 1C7IA 2WFAA 2CFSA 2IHJA 3E9RA 4ZP1A 2GAJA 4N65A 4FZVA 4R84A 1TZMA 2OUIA 4FB5A 2H2WA 1ZCJA 3NDJA 1FQJA 5DNAA 1UP4A 3TNLA 1V48A 2GZ3A 3WQBA 1L5HA 4UAVA 5CG2A 2GM9A 1HXHA 3MAAC 2XMDA 3DCYA 5CBPB 3EXFA 4EI8A 5JCPA 4YJHB 5IHXA 1O03A 2PK3A 3L8EA 1KPHA 4QAJA 4MULA 1JUDA 4CV0A 2ADMA 5JNTA 5KG6A 1TJ5A 2CLMB 2H0QA 4WNYA 7ICPA 2OFXA 1F9EA 5BW5A 1H2EA 5LP1A 4RLQA 3JPPA 3HILA 1FP7A 1OWLA 1W52X 3QW4B 4JUFA 2PGJA 2MU1A 3PC3A 2HRDA 2R0QC 1E99A 3WLKX 2ZWOA 3CKKA 1VG0B 2QRVB 3LPMA 1LV7A 4JIMA 2Y1EA 1Z2NX 5FOWA 2NPFA 2R48A 4D0GA 4YI5A 2O8CA 4FZMA 1YL5A 3EC2A 4XA8A 5DLPA 2EKDA 2YMLA 2MYTA 1TC1A 2P11A 1UBSB 4WCFB 3FROA 2HOFA 5CHYA 2WSSA 1OWOA 5H2FU 2C82A 4KK4A 5JANA 3HY4A 3FA2A 5FEUA 1QMGA 1YIDA 1J39A 3BB3A 4U7DA 4K6CA 3OZEA 2CWWA 4MV5A 3I23A 8ICHA 4NULA 4CM4A 4KFCA 2DFPA 1H9BA 2XQIA 3IUQA 3GJYA 4G36A 1B3RA 4Q4LA 1TF5A 2WF6A 3IAM1 3AUYA 2AR9A 3NYQA 1EBBA 3K0KA 4J90A 1OC4A 2JFFA 3R44A 4LYAA 3ZJ4A 4FHEA 1S4QA 3OQIB 2UVVA 2A14A 4XUGB 1KRWA 2R8GA 5CDFA 4EATA 2IGBA 3QA3E 1PGJA 2BGIA 1IXRA 5EP3A 5KFMA 2ATVA 2PZJA 2QENA 4H16A 2C07A 5EMMA 3RAQA 1WYGA 3G6VA 5L1JA 2NU8B 5CDFE 2OE2A 4ICIA 1Z06A 3KALA 1R3DA 1SH7A 2BBTA 3E3NA 1DUVG 1I2AA 1YC5A 1YRAA 2DR0A 1VCNA 2PT6A 3J7TA 1OV6A 5DYNA 4I19A 5DSZA 3NRWA 2Y4OA 1EXDA 1G66A 1FLAA 2PGIA 1BVHA 4LX8A 4R3WA 1IZ8A 2OCLA 5TF0A 2P2CA 1SKMA 2YWJA 3OQOA 3D7KA 1PUZA 3VQTA 2VNKA 3C4JA 4F5EA 4F8JA 1QF6A 3G0GA 3MGIA 1E1QD 5EOVA 3ZV6A 4PY2A 4MKZA 2H5EA 3AONB 4D8YA 3TXXA 4LZGA 3TDNA 1OTXA 2GZMA 4HDKB 1T15A 5AI8A 4H7PA 5SZHB 2WUGA 4CIDA 4EAQA 4PU0A 3EYZA 1ZU5A 4BFSA 3PSPA 4YMIA 1CUKA 2HIAA 2J5BA 2FHSA 1M34A 1ZOPA 4QAQA 1KI7A 4PYMA 3TLMA 5LD2C 3ABRB 5KNCH 3B9JA 2D13A 3VDRA 2MIIA 3FVQA 1JFTA 2FPUA 1CVRA 4PXSA 3K9CA 3KKPA 3TQTA 2DBZA 4XVUA 1AQIA 3IX7A 1XXHA 2I1WA 4HDSB 2GEFA 4KREA 1HE2A 2C4KA 4BQOA 1IC6A 1WO8A 2ZKLA 4Q7JB 2MU2A 1Y7TA 3TDMA 3WYNA 3EULA 4I9NA 3JVEA 1EFHA 4KLDA 1VKJA 1XMPA 2IE8A 2IZ7A 2W03A 4YP7A 1IZYA 1XTRA 2DC1A 4UHBA 4QO8A 2Z1MA 3I1YA 2KICA 3LVBA 4LXTA 4EPYA 4XM1A 1EAMA 3RRGA 2R84A 2W8BB 4I1RA 1KWKA 5F9HA 4KHPB 2AOUA 3G1WA 4JR2A 4CTOA 1AMNA 1M7HA 3RABA 1AS3A 1MH9A 2R6FA 1YZVA 3A6EA 1XZDA 2RI0A 3CNQS 5GTIU 4Z9BA 3PNSA 2XGSA 1KMHA 2RHFA 1OASA 2EC5A 4KUGA 5LA6A 2G1PA 1RTKA 1E4YA 2RGAA 3ZJUA 4Y6GB 2QXTA 4HH0A 4BN5A 1YR7A 4NRDA 2V7BA 2V9ZA 4KQFA 1PR4A 3D2LA 4FDUA 3GNTA 4M9NA 1Z28A 4I3FA 4YP3A 1JQBA 1YS1X 3CISA 4HSGA 4JC8A 4Y1EA 1FQWA 4L75A 1JQ5A 2JJ8A 2WHPB 2QN7A 3A58B 1P73A 3GH3A 3LXXA 2FLPA 1EHIA 2QQGA 3MAJA 4LMAA 3L8GA 5E38A 1UM9B 2O8DB 1ADGA 4J0QA 4MP3A 4Y30A 1JGTA 4YXJA 4QOHA 3CZQA 4HVAA 3VYUB 1N5IA 1IPEA 1RYHA 1Z82A 3AF1A 3I83A 4JXZA 4ECWA 2G1AA 4IIBA 4MWZA 4CF5A 1PL0A 1JR3D 1DQPA 1L1RA 2ZIXA 2Y1FA 3EGDB 3ENQA 4NV1A 4X94A 4AMUA 4QG3A 3GLIE 3A4LA 4HAYA 1T8UA 2EU8A 3GLGE 1BH6A 1SUPA 1USVA 3S2YA 2AD1A 4HT3B 4B4VA 1HURA 4WACA 4I08A 2IV2X 1X8XA 3OOEA 1DJMA 3X2FA 1CQXA 3D3EA 3MJEA 1FNNA 1H66A 3ZGVA 4HAVA 1SXJA 4GX2A 1PQYA 3A04A 2C2HA 3O93A 2ACEA 2W3SA 1GTZA 5KFFA 2FQXA 2J3EA 2V7QA 3C5HA 4RY2A 4L6CA 1RBZA 3RD5A 1JS1X 5MN6A 1IXYA 1D2RA 2FWJA 1CUCA 1GJRA 3I3OA 1EGQA 2OCDA 3NKLA 1NKVA 2YY7A 1Y1KE 3ROGA 4CM6A 2C00A 3SBDA 2VH2A 3IRUA 5F4ZA 4P7JA 2XPCA 5TQ0B 5KPJA 4MJ7A 4RKQA 1J24A 2EAUA 3Q9SA 3JQBC 1KR2A 2IV3A 1NAHA 5T7BA 3FNBA 2QTVB 1PO7A 2QLLA 4RHYA 3STHA 3EG9A 2X0FA 4EOGA 2YVAA 4MDHA 1HTTA 3IM1A 1CD5A 3MAGA 4B43A 3LVWA 3SI7A 1HQKA 1C3JA 3V8QA 1I01A 1W4RA 1SO8A 1SK8A 3K0HA 4GMGA 1NF2A 5EEHA 5HFNA 1F4VA 4MQFA 4AYXA 2QUIA 4AY6A 1Z7GA 1ZH0A 3EC1A 4MYCA 1KI9A 1BFUA 2GAAA 2CYAA 4TKLA 1G8MA 4EO9A 1D8BA 2G09A 2VXOA 1RRPA 3NEJA 3H87A 1NVTA 5F7XA 5J47A 3DO5A 3W5HA 2ZJ6A 4LK2A 4PX5A 4F3TA 1UAYA 1L7BA 4QX6A 1E6MA 2NZ2A 3QBDA 1SXGA 4DUZB 3GA5A 4PH5A 3W04A 1CY6A 1RLOA 4YP1A 2CBGA 3T3EA 3CONA 3V1LA 1JAXA 3RIGA 3QXCA 1V35A 1YL7A 1D9XA 4USAA 1P9LA 1T2FA 4DR2B 2VQEB 3RJHA 3L6BA 4I99A 3RVNA 5KL8B 4KGDA 1TA0A 4NL9A 4JVLA 4WIAA 5BSVA 5KKCA 1Y6FA 2PZMA 1TMYA 2V96A 3LTEA 4M9ZA 3SHWA 3GPLA 2DG2A 1K63A 4MP8A 4PIMA 2ZREA 3GR6A 3OZSA 3QI7A 4BDTA 1R7RA 4CL8A 1HL3A 1U2SA 1CEYA 1E7YA 4OIFA 2J0VA 1RXEA 3W90A 2R1ZA 3PW0A 3GCGA 3IKVA 2JGEA 5JBIA 3RJ5A 5IW8A 2BONA 5EKUA 2ET6A 1WMSA 1TM5E 2V1XA 3OEYA 1XT6A 4WBNF 5KJCA 4X6LA