4DFDA

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
205
Chain Sequence
FSKGIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFCTHQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 72
structure length 205
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4dfdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4dfdA01
5AKJA 3R9KA 3BA6A 5AKEA 4GIBA 4HGNA 3CNHA 1SWVA 5AKKA 2C4NA 1ZD5A 2YJ6A 5ALGA 2G1AA 1LVHA 1ZD2P 3QU9A 1Z88A 3ESQA 4NV0A 3VAYA 5AW4A 3N1UA 2EARA 3I76A 2IOFK 4Y2SA 2DQSA 2ODAA 3ZI4A 1U7PA 1YMQA 4UU0A 3SKXA 3WK9A 2YN4A 2NYVA 2ZBDA 3GYGA 1Z4OA 1VJRA 2B1QA 1ZD3A 3W5AA 1RMYA 1RQLA 3B9RA 4Y2TA 4HGQA 3M9LA 3L7YA 5AK6A 2R8YA 2AGVA 2VKQA 3PGVA 2EATA 2R8EA 4G9BA 5AKHA 5IT0A 4L6CA 5A3SA 5AK5A 2GHQA 5ALTA 4L57A 4Y2PA 5AM5A 5AKYA 1Z4LA 2WFAA 1L7PA 3ZWKA 2HSZA 4Y2YA 4I9GA 2WF9A 1T9ZA 3WGVA 3ZTWA 3DV9A 5AM4A 5AIBA 1RQNA 1L8OA 3OCWA 4NFLA 1X42A 1RLTA 2B8EA 3OCXA 2HX1A 5A3QA 5AI9A 3A1DA 3E84A 3WK7A 2C9MA 2WM8A 2HEGA 5AKGA 3EF0A 3FVVA 1RRCA 2RAVA 3SD7A 1TA0A 5AVYA 2BDUA 5ALUA 2MU2A 5ALRA 1N8NA 4KX5A 4E88A 1J97A 2ZOSA 4Y2UA 1CR6A 3IJ5A 1Z5GA 2AH5A 3QGMA 4RESA 5AI6A 2FPUA 1NNLA 4Y3UA 4UMDA 3WKBA 2W4MA 3WKAA 2G07A 3QU2A 1JUDA 2RB5A 1AQ6A 2ZXEA 1TE2A 1Z4PX 1TJ5A 1IWOA 4PNHA 4BEWA 3ZVNA 4G63A 5AK4A 1YJ5A 2EAUA 2R8XA 4XPZA 4UARA 5AW9A 1T5TA 2HI0A 4FYPA 4UMFA 2QLTA 4UMEA 2FPWA 3ZUPA 1L7MA 3UMBA 1Z4JA 3IB6A 1Z4QA 2HHLA 2YBDA 3HLTA 4NWIA 4C4TA 2YY6A 1RKUA 5AI4A 3OCUA 5ALMA 3AR3A 2W43A 5AVXA 5AW6A 4C4SA 2JAUA 3KZXA 1NF2A 2G09A 2FUCA 1YDFA 3J7TA 4O8CA 4YGYA 3U19A 2CN1A 5AKIA 1XP5A 3FGOA 4AP9A 2R8ZA 3M1YA 4F72A 4J03A 4CF5A 1Z4KA 3HYCA 3U7GA 2IYEA 3L8EA 4EENA 1RPZA 2FUEA 1WPGA 4JDPA 4BX0A 4Y2XA 3WGUA 2JAOA 1LTQA 1RLMA 4HGRA 5AHXA 2NO4A 3WK8A 4H1WA 5AM1A 1N9KA 2B0CA 3U7HB 3DAOA 2OM6A 4ZEVA 2ZG6A 2YFYA 2ZBGA 3BWVA 3N8GA 4EEKA 5IS2A 1ZRNA 5JJBA 4F71A 3D6JA 5A3RA 2D2VA 2WF7A 4BKMA 4IFTA 3QXGA 4YH1A 3B9BA 3MC1A 3NUQA 4AS3A 4QQFA 3WKEA 2YJ4A 4Y2QA 5ALIA 5ALOA 3ET5A 2JARA 2PR7A 1ZRMA 3E81A 3QLEA 2CFSA 4IG4A 3PGLA 3RF6A 1J8DA 2Q4RA 1ZOLA 5AVZA 5AW7A 4KYTA 4Y2JA 5AW1A 5AVQA 1VJ5A 3AR5A 3U7EB 2FDRA 3U26A 4NABA 1F5SA 2FI1A 1WVIA 3I6BA 3PDWA 3NANA 3NALA 4KX3A 3A3YA 3WK5A 3QYPA 1RMTA 4UATA 1S8OA 3L0YA 3ONNA 1KYTA 3NIWA 2WF8A 4B6JA 3OCYA 1WR8A 5FP0A 2Q5EA 3WK4A 4YCLA 1TJ3A 3DDHA 1T5SA 4KNVA 1QQ6A 3CZ4A 2QYHA 2GFHA 3OTQA 2I55A 2RARA 5AVRA 5AKZA 1ZD4A 4CF4A 5AK3A 4UASA 3UMCA 5ALNA 3P96A 3ZWDA 2MU1A 1L6RA 3KOOA 3B8EA 5ALSA 2ZBEA 2I6XA 1L8LA 3AR9A 2I34A 4XQ0A 5ALDA 2FEAA 2HF7A 3ZX4A 4BX2A 4OCZA 1Q91A 3R09A 1CQZA 2B82A 3SMVA 5AI5A 2G08A 3FPBA 1Q92A 2HDOA 4OD0A 2C8KA 3SLRA 3I1YA 1TJ4A 1Y8AA 2FPRA 3ZX5A 4MUMA 3OCZA 1RKQA 3FZQA 2B8JA 3W5DA 3K1ZA 4OHFA 3NRJA 4AS2A 5ALFA 2C88A 5ALQA 4NAVA 1Z5UA 3QU4A 3F9RA 2O9JA 4BNDB 1U2TA 4HYTA 3QUQA 3OCVA 1U02A 2HO4A 5AICA 4UAUA 3TLMA 5ALPA 3A1CA 3W5CA 2AMYA 5AM3A 3AR7A 4BBJA 1ZS9A 1WZCA 3ZTYA 4FFDA 5AKLA 5AW8A 3AR6A 2P27A 3ET4A 5AKXA 3UM9A 4CNQA 5AW5A 1YV9A 3PCTA 3L0CA 1SWWA 2CFTA 2P9JA 2I54A 3SF0A 2WF5A 3QUCA 4UU1A 5AVVA 4Y2RA 4C4RA 4EELA 2CFRA 3NASA 2ZBFA 2GO7A 4XOUA 1S2OA 5ALJA 2RBKA 5T41A 3QU5A 1L7OA 5ALHA 2IOFA 4Y2VA 3EPRA 3DNPA 2YMQA 4L6AA 5AI0A 5AM2A 3E8MA 1SU4A 4KNWA 4HGOA 2YJ5A 2B30A 4EX7A 3AR8A 3SHQA 2BDEA 3L1UA 1QQ7A 2WHEA 2AUTA 4BEVA 4HAIA 4ZEWA 3L1VA 5IT4A 2MSNA 3L8FA 4YIKA 3IRUA 4BX3A 2HOQA 5AVSA 5ALWA 2FPSA 1RKVA 5ALEA 5E0OA 2X4DA 2NO5A 1PW5A 2OBBA 3KD3A 2WF6A 1XPJA 3E58A 2IOHA 2JGAA 3AR4A 2B1RA 1YS9A 5ALLA 3ZVLA 1O03A 3L8HA 5AW3A 2GHTA 3QX7A 1U2SA 1QQ5A 1RMQA 2PKEA 3W5BA 2FPXA 1L7NA 3L0BA 3QUBA 3ZW7A 5AW2A 1FEZA 2JAWA 4I9FA 2YMMA 5ALYA 4CE6A 1MH9A 3EWIA 3I28A 4JB3A 1RC8A 3RFUA 3QU7A 3U13A 3OPXA 2OA0A 4EX6A 2I7DA 3N5KA 4XE5A 3WKDA 5ALXA 2G80A 4HGPA 5AM0A 4BNDA 2G06A 3QNMA 5AI8A 1EK2A 1RDFA 3MN1A 2C8LA 4DFDA 1EK1A 3WKCA 4UAVA 3EF1A 4OFZA 1RLOA 2BY4A 4QJBA 3FM9A 1QH9A 1QYIA 4RETA 2OYCA 3NAMA 3ZVMA 1Z4NA 3KC2A 3WK6A 4J2TA 4YIHA 4BYGA 3SKYA 3KDPA 1VFPA 2P11A 3AR2A 2IA5A 2PQ0A 3MPOA 4MWOA 2HF2A 3UMGA 4DCCA 4CF3A 4UMVA 4UM7A 3R4CA 4UM5A 1YNSA 4DWOA 2I33A 3ED5A 5AW0A 5AVWA 2W11A 4GXTA 2YMLA 1Z4MA 5AESA 4YCMA 1O08A 5AVTA 3L5KA 5ALZA 3KBBA 4FE3A 2YJ3A 2Q4TA 3N28A 5AIAA 2O2XA 2GMWA 4KN8A 1U7OA 3A1EA 1ZJJA 5ALVA 1K1EA 3L8GA 3S6JA 4ZEXA 4UW9A 3QUTA 3MMZA 3U7FB 4DW8A 2P69A 5AVUA 3ZU6A 2G0AA 3FPSA 2HCFA 5ALKA 4YCNA 2YMPA 1NRWA 1Z4IA 3ESRA 4EZEA 3N07A 1XVIA
chains in the Genus database with same CATH superfamily
3I2GA 3OJ0A 3OMXA 3EZ5A 4O4JA 1I7SB 4EY7A 1YRLA 2WE8A 4G0PA 4QOGA 3CNHA 5KL8B 5FTWA 1J9GA 5BW4A 3A4TA 3D8TA 4OL9A 5KQLA 1NONA 2VHUA 4AZ0B 1OWNA 3BL8A 4L76A 3L4PA 3OFKA 5DWVA 2FEPA 4UTOA 4RQ2A 2WUWE 3HVKA 5D7BA 3WBFA 2J3QA 1G59A 1VMIA 2GN6A 3SZUA 1XFAA 3ZI4A 2XX3A 1LPMA 2VSOA 1X7GA 4CDNA 3R5SA 2L2QA 4ZRMA 3U3RA 4F97A 4ZIRB 2H0QA 3A2KA 1VJRA 4F11A 3EDQA 2FR8A 4KCGA 4Y1RB 3T7KA 3FOCA 1O96B 4EO9A 2VJMA 1CQJA 4MRMA 4ZICA 4JBNA 2G67A 1YVRA 2PJUA 4M8NE 5T4EA 3ZPXA 3ZXIA 3OP4A 1Y7PA 3HYNA 5DYGA 3FYHA 1V5WA 1YZTA 1IIRA 2H2DA 2I2CA 2SCUA 4ZQFA 3ZWQA 1AC5A 1SCKA 1ZMOA 2I66A 5CA7A 2J4CA 1EJ0A 2R8YA 2W2KB 2VYCA 1Z6TA 3H2ZA 1WV0A 5I9BA 3KYCA 4E07A 2C2DA 3TX2A 1GQQA 1K6JA 1M5TA 1E5DA 3T34A 5A3SA 2JA2A 3W2EA 1CUBA 4B85A 4IRMA 4O08A 4P36A 1X1CA 4M9NA 1AHHA 4OH7A 4TLBA 2B92A 3WLNA 3A58B 2BHNA 1RHJA 3HDVA 4CKBA 4OX9Y 1X9WA 1T9ZA 1RRKA 5KHAA 5DLDA 1HYGA 3W5SA 3GLGA 1SHTX 3H5OA 3WE7A 2BMAA 2QYTA 3IOMA 5EP2A 1C9KA 1EDEA 2C0QA 1VE6A 2F4NA 3UXPA 3OVMA 2VDVE 4YV0A 1ZQZA 2VUUA 3OZXA 4PYQA 4UTPA 5JD6A 2PGXA 1HK7A 3BDIA 2ZIVA 3PC4A 3QTBA 1H9AA 1Z0KA 5D49A 7GPBA 2ZVJA 5FJJA 1P5ZB 4M0EA 1LSUA 4YAWA 4NM1A 2RAVA 1SVLA 1VE7A 3HDTA 4IWYA 4HNAA 3N58A 3E70C 4V38A 1M2OB 3PFWO 5ALRA 2HIAA 2OAQ1 4OHZA 3K9NA 1I3MA 2FSSA 4CLRA 4R51A 1MEOA 5CDUA 3HB9A 1NATA 5KFQA 1NLUA 4DL5A 2ADOA 2PGLA 4FYWA 4Q18A 4NMHA 1LB1B 3TGPA 1L4EA 3MR2A 2OM2A 2XITA 3LRPA 4FINA 3RAJA 2AXEA 2DY1A 4B2IA 1NNLA 3ORYA 1MB2A 3R2JA 1SA0B 2Q8QA 2F3UA 1TA9A 4YWHA 2R87A 4DAOA 3GMSA 4FS1A 4Y18A 5DM60 1SC4A 1Y1LA 2ZXEA 3QZ8A 2FSIA 4G0XA 1SR8A 4YI5A 3H9UA 4GXRA 5JAHA 1Z18A 1FDRA 4QBHA 5DLEA 3LQQA 2YDXA 4I4TB 3IKMB 1UH5A 1EP9A 1QH8B 5B1EA 4Q82A 3CISA 4OXKA 2AZDA 1BVSA 2FEKA 2P4QA 4HK4A 4MVYA 2PYZA 1ZYUA 2C3UA 1BO6A 4CMIB 1T5TA 1A5SB 1QIEA 2Q1WA 3DZBA 3TIXB 4JIGA 3QA9A 4RKFA 3H4IA 3VYRB 4O33A 2F9LA 1X9SA 3DOCA 1XTPA 3ILSA 1HFEL 5KYXB 3KKLA 1LEHA 3GP3A 2QK4A 3FAZA 4K9DA 3ZWWA 4E11A 2L5YA 4HDKA 4QAJA 4FDVA 4PGHA 2QNIA 1E2QA 1ESNA 1FFXA 1T0UA 2JHPA 2GASA 5G41A 3HBNA 3CPHA 2LV8A 2Y1GA 3JQ9A 1RCTE 4IUBS 1DIBA 4JVMA 2Z04A 1JDUA 1EH5A 3L7CA 4RBNA 5BWLA 4K4GA 5B64A 5M5BA 3U4CA 1Q7TA 4C08A 2ERYA 3DVAB 2QN2A 3T4UA 4QW9A 3THWB 2EHDA 3FYUC 1NHWA 1C7EA 4F4YA 3GFTA 3HXPA 5DLQC 3EX7C 2MRLA 1I7LA 1CY1A 3GWGA 1EVYA 3FPGA 3PE3A 1SZPA 2DKNA 5IEBA 5BT9A 2QZPA 4MKZA 1K7EB 4HTFB 4PXSA 4DYVA 3RRGA 2QSUA 2JEYA 4X71A 4CMCA 3TL3A 3GV8B 4GI2A 4D0SA 3H5NA 4U7WA 5ELLA 4K4IA 2QRHA 2YOFA 1CS4C 2IUFA 1P6XA 2IXFA 4RZHA 5HFAA 5LC1A 3R7LA 1TYZA 5JAQA 3WGUA 1MB3A 1U6IA 4J4TA 4C8OA 4I2AA 1J23A 1HNZB 1W1WA 2AG0A 4Z8YA 3GROA 3ZHOA 2BSXA 3A8TA 2I4OA 2B21A 1K0FA 1XRQA 4MVJA 4X93A 4X8OA 3U7HB 2ZIZA 4RNDB 9ICPA 5FTMA 3RVSA 2BFDB 4IOKA 1PFQA 2OM6A 2JGLA 4NS4A 4QTXA 5DSXA 3IAM1 2PUTA 3B3GA 2VXYA 3ZIAA 1N5WA 1ZQIA 4C0BA 3NVMB 2GM4A 4YCCA 3DH0A 4WRRA 3UHAA 1JAZA 2BT4A 1IJFA 3LQYA 4GPIB 4BLSA 4EA7A 2C0PA 1QLJA 1NW9B 3UC9A 2OZPA 4Z6EA 3QF4B 2JGNA 1EQUA 4OATA 1T8EA 3ROPA 2A14A 3EQZA 1JXEA 2DULA 4IFTA 2CNWD 4CG3A 4F96A 5DG9A 1GGVA 3CXRA 2V55B 3OKAA 4YH1A 3WX0A 2PHZA 2Z8ZA 1OZFA 1OLXA 3PL5A 2GERA 1UFKA 2XDYA 2ZQZA 3AKCA 4P4MA 3UK0A 4AS3A 1C7QA 2VPYA 1JLLA 1QGOA 2EBWA 3Q4GA 4LDJA 1KFSA 4CM7A 5EOZA 3P9SA 4HSEA 2P2LA 3L4JA 4I50B 1P1JA 2CFSA 5KFNA 1E60A 1HXHA 2FEMA 3GJ7A 3OD1A 3OQPA 2BGRA 1BNPA 3IALA 1NI3A 3LWZA 4U63A 4X6UA 4YP9A 3K35A 4ZVMA 3F73A 4CMEA 4CEIB 4TZTA 4CG1A 1Y82A 4EEYA 4D5EA 1HF3A 3PBKA 4Z99A 4DIMA 3ZDEA 3AILA 2HMWA 2XZPA 4IILA 4XW2A 4GVLA 1EFVB 3SS9X 4G07A 2CJXA 1BZYA 2H48A 1YK0A 3O3OB 3R0IA 3SPXA 5CRIA 1BEZA 5GZ6A 4D8WA 5AW4A 1TQDA 5KSZA 1SK8A 4HLUC 2VDRB 4QOFA 3KALA 1T6ZA 2D62A 3F6PA 3DBRA 3COPA 2VT2A 5DB9A 2C0CA 3UKOA 1C81A 1Q0RA 1WKBA 2CL6X 1PNTA 5IW8A 3UO8B 1E92A 2IHVA 4JYBA 3D5EA 4UB2A 1SB8A 2JXJA 1VG1A 5FPQA 1I30A 1BVYF 5HF6A 5EWGA 3VZRA 4A91A 3VNVA 2C2GA 2O4CA 1BX0A 1E5XA 4J9PA 5DDYA 2HMTA 1CZNA 2Q5OA 3F9CA 3SR0A 3DDHA 1T3NA 2ZLBA 5U1PA 1U3VA 1E8DA 4YUWA 1JEJA 4PC6A 3DO5A 2I55A 2R00A 4WKNA 2BFPA 3QFCA 3MJEA 1NRJB 1ZD4A 1U81A 1G8PA 3L7DA 4S3MA 4W8OA 4BWFB 1L3BA 3UMCA 4ZWNA 3MINB 2C29D 4QXOA 3WL3A 5M04A 2BTEA 2ISOA 2ZUSA 3DHVA 2QLJA 3L07A 3PXXA 2J0VA 1WMAA 2CV2A 3LL4A 3HZHA 3V1YA 1L4UA 1TUBB 2PM8A 3OZWA 1ZN7A 1X7XB 2HA7A 2RHJA 2I34A 3RDPA 5BW8A 5K45A 5TMPA 2IIBA 5CNKA 3E9DA 5CP2A 2JCBA 1R9JA 2ZTLA 5EIBC 4C4AA 1U1GA 4E5SA 2AFVA 1RXWA 4FFSA 4O5AA 9ICRA 1WDWB 5DMXA 5D8DA 1NBAA 4U2EA 4G85A 3RVJA 4EEXA 1LWOA 1RWNA 4G0QA 2V7QD 1YR8A 3KV1A 3IVGA 4UVIA 5B7QA 1QMPA 2FCRA 1XC9A 2Z2KA 4Y6QA 4QDTA 2P6UA 3GIKA 3K9CA 1Z73A 1EJBA 4QUGA 2A9VA 4OLFA 1ECWA 5EXPA 3TJRA 3MJDA 1X7ZA 2AN9A 2GM9A 4I46A 5JQWA 3VZSA 2A92A 2GJ8A 4BFSA 4NBSA 2ACVA 1ULHA 2JGIA 4M0AA 2QRPA 2AK3A 4JUCA 4ACBA 2DPIA 2J6SA 2HNKA 2RHBA 1QFSA 3F0TA 4IDDA 2BEUA 1SHUX 4KJXA 4FSHA 3DLTA 2H8KA 4HYTA 2XBUA 4MYDA 4IQ8A 4O02B 1DS6A 2Z1MA 4BMPB 4K88A 4DCGA 3DZIA 3FDIA 5MDHA 2B1IA 3FLAA 3CP8A 4JDUA 2VHQA 1SV0C 5F5LA 4C7ZA 1I5OA 1NJSA 3NFRA 1UOOA 2P30A 3GFRA 4F5OA 5HP4A 2O8NA 4YHBA 3GJTA 3WL7A 1KP9A 2VBIA 1NVKA 3U37A 5KNCA 4Y6OA 1SKRA 2W8BA 1T9HA 4YAGA 2NNLD 1JDBB 1MTZA 4LDNA 3RS0A 4PVCA 3UF0A 5J43A 4O4LF 3KETA 1GDTA 1U0FA 1YI8A 3GLQA 4IVRA 3LCCA 1SG6A 3OTHA 4UZFA 5KFHA 4DOCA 4I08A 5EESA 4IFBA 3OQNA 3KD2A 4URYR 1BGVA 4F4JA 5AVVA 2CFRA 2XV1A 4BB9A 1R4NA 1U0SY 3KTQA 3MTGA 4NU0A 3PTAA 2V1UA 2ECPA 4OM7A 1AGYA 2C2RA 1RZUA 2H9YA 1Z1BA 1NXOA 5DEOA 3RROA 3WNVA 4AXXA 3LFTA 2HBMA 1V9CA 1XQ9A 2D1QA 2OQIA 2Q6OA 1Z28A 2JZBA 4JLSA 2BF7A 2E9SA 4Y98A 1N5MA 1IM4A 1O97D 1ZQWA 2CB9A 1X9IA 4DLZA 3A1FA 4Q4HB 1NAHA 3ZLTA 4R9NA 5LZ8A 4DABA 8ICVA 1TM2A 2ZB3A 4U7TB 2BLLA 2GZ1A 5LKRA 1T2VA 3I1JA 4CKBB 2WG2A 4O6VA 1V39A 4R5MA 2OEPA 1VGQA 1DOZA 2GJ4A 3MABA 2V7VA 2XDQB 3NJ4A 3KEOA 1WW2A 4FT4A 1CY0A 3DCJA 4PYLA 1AUVA 1XCLA 2IY7A 1YASA 2HEIA 1ZXXA 4TLMB 1BX3A 4WKOA 4C7OB 4CMGA 4B31A 5KOJB 1DXSA 1NM5C 1CWUA 2XDWA 1XAGA 5JZVA 2OCLA 1B22A 1Z8FA 4LV5B 4TOIA 3EIQA 1DI0A 1MJFA 3OIYA 5ELMA 4MINA 2WKWA 2O2JA 2IZ0A 1N63A 1EM8A 1Z83A 2COKA 1W8DA 4CRWB 4Y9SA 2GB4A 3IIJA 4Q7JB 3KRTA 3RG8A 1GRCA 3GFQA 4L4RA 4QZEA 4DLEA 4NZNA 4KBYA 1Q17A 2L69A 3ENZA 1X6VA 1J6UA 1IZZA 1CF9A 1SUWA 1OLXB 2LNDA 2QDKA 2LDBA 1XDWA 2OBBA 3EVFA 1J2MA 3PT9A 2WF6A 1HFWA 1Q3HA 1WMEA 4JLPA 2IOHA 1GXSB 2VPQA 1F20A 3UOGA 5JJKA 2ZAOA 3LT1A 4FT2A 4OSOA 1L4YA 1VSQA 4ZOEA 2PFQA 3L1IA 4YMGA 4ED1A 2ZIUA 1DJNA 1QLWA 2GHTA 2GZ3A 3M6WA 4PCVA 5F33A 3V7YA 3RJFA 1CC1S 3FCSB 4RD2A 5A5EA 4HNTA 2BI8A 3PSIA 1ZJMA 3O90A 4C0KA 4PPNA 1ODFA 2GYYA 1PAUA 1DP4A 1L1QA 1A77A 3ZLVA 3UFXB 1DRKA 1KAQA 1W7AA 1O9GA 5A4DA 2KZZA 2F64A 2HDHA 4ZH4A 1GQRA 2CLSA 2Q5HA 4AY2A 1RZVA 1UBEA 2LPMA 4CE6A 1MC1A 3T5TA 4R69A 2JCXA 3NHUA 4MYRA 3TUZC 2BPCA 3IMEA 5DBOA 5CB4B 2ECFA 4HS9A 3RHZA 5L1IA 4R3NA 2C7GA 3V7NA 2NIPA 3OJUA 3ZZMA 5C51B 4ED2A 1HMYA 3NHBA 4XRGA 3SZ3A 2ZSBA 3FPAA 4N9QA 4FYJA 4O2AA 3BIOA 3K70C 2I7DA 2XIDA 5BORA 4PEVA 2Z0MA 4BMZA 4K2AA 4OXIA 1TW2A 5FO1A 4OHXA 4HI0E 2XVAA 2GM3A 4KI7A 3DZGA 4INOA 4EVQA 3EXHC 2WK1A 3GG2A 3T7JA 3W5UA 5GJBA 3GUVA 1AURA 3DVAA 2JFNA 2LD4A 4ZT3A 3HPQA 1E9CA 5JMPA 1B0PA 2FW0A 3NBUA 5K4AA 4TVOA 3ESDA 1EP2B 3HVRA 1SL0A 7ICJA 1OMOA 4YA6A 1VKNA 4PZPA 1KEUA 1AA6A 3THWA 1CIVA 1NP7A 2MUTA 1VDZA 2V59A 2AG8A 3O3MB 4RS3A 1CYDA 1TECE 2GEDA 5C46F 5IHXA 2I7XA 1Q1NA 1EUQA 2PMZF 1PJSA 3DONA 3QJGA 5HBGA 5JO0A 1VHTA 2NLOA 1D1SA 1ZZGA 2PH7A 2I6FA 4IGIA 4J6FA 4JGIA 4X6YA 4YK7A 3ZW8A 1C20A 13PKA 2GJAA 3SKYA 3ESZA 1VFPA 5EMMA 3G6WA 3WGOA 2HJWA 4BO3A 3GLIE 1E69A 2XT0A 1ZJYA 5CA0A 4LVUA 1TT5B 2QZSA 4PX2A 1LPAB 1RWKA 3WYNA 5DSZA 4KLLA 4TTSA 1GEEA 2HFJA 1AY0A 3BXOA 3S27A 3I6IA 4J1NA 4EHAA 4ETWA 1SKWA 2HBZA 3UH0A 1QZXA 4DZZA 3N2EA 3RTDA 4OXRA 2C1EA 5COBA 1UBKS 4DDHA 3H0MB 2GZDA 3OPNA 1I9GA 2QTZA 1G7RA 4C07A 1W5EA 3C6XA 2Z98A 1I94B 1Q0ZA 1ZL0A 1KMHB 3MOIA 3RRHA 5DLFA 5KFFA 4FYKA 2O2ZA 3F5MA 4HAVA 4YONB 2BE9A 3OGUA 3X1DA 1V1MB 3RK4A 1SBIA 4RQBA 2LW7A 1N2CB 1FA9A 3FDFA 1NBEA 1LBEA 3ETGA 3L8GA 3TSOA 2QJOA 5KINB 8MHTA 2WY2D 3FGPA 5DYWA 2Z3ZA 1ZXLA 3T79A 1YRAA 4RJLA 4IDEA 4EL5A 4OL0A 2J7PD 3WP1B 5JNVA 1LS6A 1ZG3A 3R1IA 5FBLB 2YHBA 5C80A 4PC1A 2JD1A 2OV1A 2C5SA 4KXNA 3U4QA 2A88A 2W3SA 3ADKA 3RWMB 1GAJA 4HFNA 5TV2A 2J31A 1NFQA 3QV2A 4FHGA 2B6GA 2PD3A 1OXMA 4MS1B 5REQB 1EIWA 5CFOA 5CJPA 1Z4IA 2H1WA 2IU0A 4QXRA 4XRHA 2R11A 5E1MA 2ADFA 3UQZA 5FDFA 1A9ZA 2BV3A 4DSAA 4RH0A 3TQCA 2ADMA 3AP1A 4HYEA 2WDPA 2LYBA 2Y1DA 3A11A 3D81A 2ATCA 3FG9A 1GYRA 1R12A 1IG3A 3PD0A 4KK3A 5E2AA 4QJ5A 1Y1KE 3UB4A 1DAPA 1P19A 3R6TA 3V7WA 5EY5B 2YJ6A 3GD5A 4COOA 2G1AA 1RYDA 3GI1A 3DR5A 4FZ5A 1Y1QA 4MS4B 4IZHA 4C7OA 1Z88A 3E3MA 4PYJA 3FNRA 1Y8ZA 1C8KA 3SYRA 2FEXA 2ARKA 3HB1A 2Q5CA 5H2FU 2OBXA 5IH7A 2V45A 4UXJA 4B6FA 4Z8XA 5EZQA 5HCUA 2IUTA 4AJJA 3ISCA 1FUKA 5EVJA 2FN4A 1N4DA 2OXIA 3JYHA 2K4PA 2C9BA 2E3TA 3KSMA 2AS0A 3FNIA 3HADA 4HWTA 3E22A 1KAHA 3IQGX 3A10A 2UYYA 1T15A 3OQHA 4JSYA 1LPPA 3PUVA 2QT0A 1RQLA 3RVNA 4YRNA 4TX1A 2C4MA 3ZU4A 4CN9A 2QBYB 1OT3A 2E8OA 5A7FA 2W58A 1UT8A 1XR3A 1LDMA 3C3PA 5JLAA 4AJHA 1UJMA 2PU7A 2FZCA 1T4GA 5A1JA 1IQUA 4KQJA 3QBJA 1GNTA 4CGZA 2GVNA 4TPKA 2OCAA 3VR6H 2PZAA 2FX2A 5REQA 1KIMA 1CB7A 1FS5A 4F7WA 5AKYA 1X87A 4KVFA 4JUIA 3VPXA 3ZWKA 4Z3OA 1XZLA 3ZY4A 1T3QA 2HHWA 1NF9A 1PT9A 3DE4X 3OHPA 4R68A 4YTEA 4OQFA 3WNZA 2O7RA 3RWBA 5JV5A 1G4UR 2KMLA 1KVUA 2OKGA 4NMMA 4TKUB 5EYPA 1DWOA 4XB1A 1CZKA 3ADDA 2P6PA 2CNOA 4BP1A 1POXA 4YCDA 1L8OA 1ORWA 3DOEA 4UAGA 2QXTA 1I0ZA 4GMDA 5BYJA 3G5TA 5HK9A 1YB1A 1JDSA 2V3WA 1GCGA 5C8YB 1XLWA 5CIQA 1G1MA 1D03A 3OZ7A 1US8A 1NUAA 4YCBA 3UXNA 1JSLA 4NY8A 3C85A 3CTPA 2CPRA 1RJEA 3SD7A 1KOFA 1XK6A 2HRZA 4WNCA 4OO1J 1NN5A 3FCXA 4KX5A 2MU2A 1GUYA 2O2EA 1E2GA 2REQB 4OYYA 1ZGAA 1ZOSA 2D2IA 5JISA 4MUIA 2DHEA 3QYFA 2C3MA 1DEAA 3GN2A 2NT3A 1ENPA 2HJRA 5IAKA 2Q62A 1AZLA 4GMHA 4AZVA 2XXAB 3QMWA 1XTTA 2JZOA 3NT2A 3IAXA 3DCNA 2WD9A 3UBTA 1EE2A 2A35A 1JX6A 4X1YB 4JC4A 3U3XA 1NG9A 3F4BA 5CFQA 3EASA 4QBKA 2KLHA 4RQ4A 4RPHA 3Q7RA 3TOCA 4P2BA 2G8LA 1JIJA 4R6WA 1PK7A 1CJTC 1I1OA 1PTJC 2EEPA 2QU7A 2CHGA 3VZDA 3P5SA 5C35A 5LSAA 1SIUA 1E1DA 1KMIY 3EGDB 3RVQA 3LGSA 1ZK0A 4KWTA 4PYMA 3PZPA 2PXCA 3G5LA 2ZYHA 1PNQA 4PAGA 1LTKA 3SC4A 1LUAA 5KOHB 1FSFA 4I4TF 4BO9A 1IN1A 1QH8A 4L16A 5AH0A 3WRWA 1QGDA 1V41E 3O7MA 5GWXA 4F2SA 4WE3A 4HCJA 3D4OA 4EAQA 4JB8A 3V42A 1U8YA 4GEKA 2F2AB 4NOKA 3UY4A 1VCIA 4IH1A 4BKRA 1P4JA 4ESHA 2YNMD 2OFWA 2WUEA 5CHYA 1XTBA 1JIIA 4BCCA 1BMTA 2AI2A 4DSJA 4BFZA 2IQ5A 4XVHA 2P4EA 4DA4A 2OV4A 2P3SA 4PAOA 5E6SA 3AW8A 1NF2A 2WAYA 3DBLA 2EVWX 4Z9BA 3TTVA 1UJBA 1GPBA 1RQ7A 4PQYA 3ZKWA 3PYMA 4ESVA 3ESYA 1J0XO 1DQSA 1B2LA 1GG2A 4HN2A 1K98A 5ENVA 4S1OA 4RLHA 4AJOA 3FGOA 3OLZA 4B3SB 1R4MB 3GT3A 1I33A 1CCWA 1TGYA 1XZKA 1IJBA 1QGYA 3QPCA 4NOLA 1D0SA 4TN1A 3TQ1A 3TD6A 3GHYA 2NO9A 3DFKA 4CMEC 1BMFA 2A0WA 4FPXA 5F2KA 2B5WA 3A37A 3G9XA 5A0TA 9ICQA 1E94E 2I6QA 3A0HU 4ZOLF 5HBRA 2IWRA 4NFSA 3VPCA 1KQQA 4M4SA 3H5VA 3JVVA 1S0VA 2QM3A 1U9CA 1NPTO 4DC0A 5CB0A 3VX4A 3NRZA 1KEEA 1AN0A 3LSTA 3ZBPA 5I47A 1DEOA 2PKQP 4YP6A 5IAGA 4DIFA 5TX7A 3R0XA 1E5TA 3BFJA 2LKDA 4KFTA 4OQ4A 2QTGA 3FLEA 2I3DA 3CYMA 3WIVA 5L1MA 3I39X 5WRFA 4UQGA 1MOSA 3SIRA 1CE8A 3DTVA 4YJ3B 3DC7A 2DTEA 1G2OA 2EX0A 2JI6A 3K2QA 4G63A 4F71A 3F6SA 3KT8A 4RMJA 2D2VA 1JHDA 1XDUA 5KT3A 3QH4A 5D01A 3B7GA 1KVRA 2BAGA 3Q88A 5BN1A 1Z6QA 3NU1A 4YJFB 3F5AA 3NOXA 1MD9A 2VXOA 2NP6A 3U81A 4B09A 4P7FA 3IJRA 3UENA 2IHZA 5J8YC 4NLZA 4Y2QA 1N2SA 2YJ4A 4TMVA 3H3JA 3GT4A 1NUTA 3ET5A 1JJIA 1YZHA 1CUVA 1I1QB 1V9SA 5A6VA 5F7XA 2OO5A 3SYZA 5KSWB 2Q9CA 2VC2B 2W2LD 2AOTB 3ENQA 1Q46A 4PPXA 2GBIA 3P9PA 3RF6A 3SI8A 1UBRS 3S1AA 5C5DA 4L8LA 3TM5A 4UNIA 3D5TA 1EBUA 1AE1A 1DXOA 4N82A 5GTDA 1ZQOA 5EMLA 3B1KA 2GEKA 3FNBA 4UUMA 1D8AA 2NYUA 4EYSA 2R8PA 2RH5A 4U7DA 2GTPA 1PUJA 1CDOA 4W63A 1XCBA 1P72A 1SVOA 3RUDA 1AKYA 2FMXA 3A3PA 2A2ZA 4K9KA 3QYPA 5BV1A 2NU9A 1WXEA 2I03A 3MRTA 4PS0A 3UTCA 3S4YA 1RQGA 5B53A 2XRFA 3R6DA 3PNOA 5L8VA 5IM4F 4JU8A 4LFAB 1ZJ6A 4BNWA 5LQMA 1T9AA 4EKIA 3OHSX 1O94D 3QLVC 2L18A 1V8BA 2O6LA 1GUZA 4XQCA 4YDHB 5HQ3B 4D57A 5DQHA 2ZE6A 2OD7A 4N0MA 3OTQA 2GEUA 3VVCA 4ATNA 4F6LA 2V9CA 3KIPA 5B1SA 1NKEA 3VI4B 3J80A 3RH6A 1GGMA 4CF4A 2BP7A 2HBJA 2D1RA 4MW6A 4DLPA 1EFUA 1WP9A 4J76A 2OENG 1ZSYA 4N18A 1OQAA 3ERCA 3OU6A 4NZYA 3KOOA 1R18A 1WPXA 2C78A 2VJPA 2PX3A 2QPOA 4XQ0A 4YJDA 4ZDIA 2WTFA 2HF7A 2O1XA 2R1ZA 3PGMA 4D3FA 5B1DA 3AF4A 2QM7A 1X1AA 2ID9A 3I58A 2FKNA 2OVBA 4XWGA 2IH2A 2B8TA 5EA2A 3U80A 1Q92A 2ROQA 4H0FA 4XEUA 4ZJZA 1FFAA 4Q7QA 4IDFA 1O57A 2GEVA 5M2QA 4LYFA 1C1YA 1L5WA 5F9MA 4F3YA 3NBXX 4W5OA 3KDSE 2O52A 3LKDA 2BGWA 2BOVA 3G1TA 3LCMA 1EINA 1N5DA 3AHCA 4NCNA 1C5KA 2ZCJA 3OF2A 2F55A 3FYUA 1X92A 4GOOD 4DCVA 4D9MA 1SXJA 1UKVY 3F5DA 4JIMA 1DEXA 3IC5A 3KQMA 4OU4A 2C88A 4OI2A 1LCIA 2ZTVA 2GESA 3OZAA 5DHFA 1SD2A 5K1ZA 4MGHA 2FFRA 1QE0A 2FUG6 2PKCA 3JQFC 3KELA 2B35A 3UEOA 5E1BA 2BH2A 5FOXA 4Q15A 1AQYA 3OM8A 4YFKA 3JQ8A 5IBPA 3ST7A 1V3QE 2WJAA 2O2HA 4MV9A 3U60B 1QS0B 1Z2DA 1DEHA 1USUA 2PKYX 4LY9A 4N3NA 3K1AB 1YOBA 3KUDA 4QFBA 3VU3A 4CDRA 5ABPA 3D3KA 4C5AA 2Z09A 3DYBA 3ANMA 1ZGGA 4XQ9A 3S5UA 3LFUA 3OOSA 5AO9A 4HWKA 2W9MA 3ISBA 2IBKA 1PK3A 1XZHA 3ZHZA 2NV3A 4CKYA 1NUUA 4HT3B 3NTVA 3TJZA 3BIFA 3CXUA 4ANFA 3N6VA 4MJLA 3THYA 4CIDA 3EVBA 4K40A 2HMSA 4S1VA 4LYJA 4S0ZA 1C9MA 2O1WA 3A1UA 2PMKA 4RPIA 2PL9A 3RVMA 1GARA 3GPIA 4G0MA 2X2EA 2WF5A 5CJ2A 3JQGA 3QV1A 2C9OA 2QGNA 3AFOA 3DTVB 4YJ3A 4NYJR 4D9HA 3NGMA 2R7MA 1EBBA 2WTXA 4G8JA 2Y0SF 1CEZA 1FNBA 1PJLA 1QKKA 3L7LA 3P9YA 1VE1A 1VI5A 4UBJA 5BSTA 4DL2A 2XB4A 5ALJA 2Y4NA 2QZ4A 4DXHA 1JMVA 1QM5A 1L7OA 2WG1A 3AV0B 3BH6A 3EPRA 4M98A 3EIEA 2YWFA 4UD2A 4AJKA 3M9WA 1E9RA 4G67A 5JYEA 5K8CA 5CYGA 3ORFA 1QP7A 4CR8A 3CRNA 2E87A 2GDZA 1DE0A 3LOQA 4LY3A 4DCPA 3RU2A 3RBAA 3C45A 2PYDA 2FRDC 4CNBA 3CRVA 2ZFUA 2XGQA 2Y2UA 5IIMA 1UQTA 3S2ZA 5L4LA 1E8MA 2Q3MA 4XGIA 1EIZA 2O5VA 1BHJA 1QR2A 1EM8B 4KIGA 3PQEA 5IKPA 2PL1A 4KRGA 4J1SA 3WB1A 2QJFA 3L4BC 3QW4B 4CM9D 3AUFA 5FQNA 4P35A 3PNSA 1NV8A 4HAIA 4GM4A 2PNFA 1XZQA 1NLFA 3FRHA 4G0VA 2BM1A 4H60A 2Q3EA 1BPEA 1II8B 3MRVA 4UC0A 2VJ5A 5DYNA 1M8JA 4ZALA 4CWAA 5BSGA 3EMDA 1BHQ1 1I3CA 2O57A 2RKWA 2LI6A 4BX3A 2HMVA 4R1SA 1EFTA 3KDAA 4CKXA 2ECQA 3CX4A 2UV8A 4LXGA 3EB9A 1ZITA 4RXUA 5J23A 1QKJA 2VPZA 3U7IA 2FH5B 1V6AA 3I32A 4MGEA 4JT2A 1Q6YA 3PO4A 4ZAXA 4Z7NB 2YX8A 2Q6TA 2AF3C 1KZ9A 1OTHA 2Q3DA 2VO1A 4RPCA 5KFXA 2CLKB 2G76A 2YWBA 1S2MA 3GV7B 1O87A 3C97A 4MV3A 2X42A 5TNXA 3TZCA 2G63A 2YC4C 1XROA 5KTYA 4J9LA 3MJRA 2JLSA 1CKEA 4M9JA 1HDCA 3O8LA 5FUXA 3PG5A 2VTBB 5F21A 3RC1A 1W47A 1G8HA 3BRWD 3WNBA 2O2SA 2X0JA 2XOXA 1BYIA 2JJYA 2IV3A 4BQQA 1LNZA 4INPA 2AFIE 3ISTA 1VFNA 4ECTA 3JW8A 1EX7A 4XIYA 2P78A 5F1OA 3TBKA 1LJUA 4K2HA 2WU1A 1RW4A 4FNAA 4MAFA 4B34A 3WA6A 3CW2C 1GTJ1 4K4HA 1XWFA 3OICA 2JFHA 3D6TB 4D9IA 4RELA 4RTLA 1A6SA 4BWVA 4UPDA 3R41A 1B2RA 3D2CA 3BHIA 4M9CA 4YN3A 5DGBA 1QK5A 3VBEA 4GWKA 2RAPA 3ZVRA 4ZU3A 2H9AA 5CA0F 5CB4A 3COZA 2QPAA 1MOPA 1DFGA 4HMQA 4LCJA 3RIYA 3T3OA 2JI9A 1GPWB 1ULZA 3LJKA 5I48A 3PC8C 5LQUA 2ZRQA 4EITA 1M6VA 4TKZA 3VAAA 4G0WA 4OX9B 5H16A 3FPFA 4LF6B 1UXJA 2OZLB 4RIGA 1OY1A 1FW8A 1VL0A 5GADl 4DR7B 4CV2A 2OO7A 3ICXA 1PDOA 4JXJA 4I2HA 5IPFA 2AOUB 1K6IA 2BY4A 5CG1A 2XXBA 3R6WA 3UCFA 3DB2A 1CYEA 2P77A 3FYTA 5AD1A 4ZHQA 4JENA 1CUGA 4FQ7A 1Z4NA 2ZWMA 4YIHA 2GLXA 2HLDD 2VUTA 4HNAB 1XNJA 4YP5A 4HC4A 2X6TA 3OZCA 1YQQA 3KKNA 4ZVTA 1JL3A 1BW9B 4RPXA 4UB6U 1BE8A 2Y0DA 1JFFA 3C3KA 3M9XA 4PIPA 4RDCA 1OW3B 1U1IA 2C2KA 4BRSA 5G4LA 3NQ41 1REQA 3Q7EA 4QELA 4YNBA 3AHGA 1E59A 3DHNA 5LLTA 3GLTA 5HE9A 4MIEA 4G5FA 2R1VA 3N2YA 1HNXB 1ECBA 1VJDA 2WD8A 5K3FA 3HUEA 5KKCA 1Y1SA 3B8HA 3BEDA 3BMOA 5DHRA 1WXXA 3TYXA 1TVAA 2AYXA 3T9BA 1Z6PA 4BBAA 3HW8A 3G9UA 2CDAA 2PAAA 4ZQBA 4GG1A 3W0LB 2FPGB 1YUBA 2ZT8A 1S10A 3DBHB 4MQLA 4PYNA 4WPGA 4GSLA 2OY0A 1Z5VA 2YC2C 4P4OA 3H87A 4NJEB 5J4HA 4KN8A 1XNHA 2WHPA 2PE5A 4YRCA 5JC8A 2RBGA 1HEUA 2CB0A 1XTJA 4NSNA 2VH2A 5CDFA 2H52A 2SCUB 2FQ1A 4GGMX 2G9NA 2W42A 5FBWB 3FYCA 3ONFA 3AB3A 3PNYA 2ZJ2A 3K9GA 4OKIA 3VPFA 1LH0A 3ZZ0A 2J3JA 3GNLA 4IGFA 1J0DA 1PR6A 3SSAA 5L51A 1J33A 1Z39A 3KTOA 5C0OE 2XC9A 4RHFA 5FWXA 1E2FA 1JE0A 2E1RA 1DRVA 4LC0A 2R7NA 3HJRA 1Z2AA 3VNRA 3HWTA 1CDEA 3T38A 4KO3S 4I1VA 3KQNA 1YL5A 3AM9A 1K3FA 2PX6A 1IEVA 2ZI6A 1VYVA 2J4DA 3C3CA 3MD0A 1YGPA 3CLUC 3KAQA 5K0LA 1XLVA 3R9KA 4OIMA 5C8VA 3IV6A 2QQ5A 2H5LA 4UVHA 5LM3A 1Y3BE 1SWVA 3H9CA 1V25A 2QAGC 1CV2A 4QARA 5EGNA 2KX7A 3GDXA 3ZY2A 4R2WA 4M0LA 1T2NA 5FWNA 5GONF 4Z86A 4U02A 2GSDA 1ZRSA 4NEHB 3VTAA 3ANNA 4OI0A 2C96A 1PP4A 1GFZA 4B3RB 4R7TA 3KZ1E 4K28A 3OTGA 2PQ6A 4LSGA 1G3UA 2IUYA 1WXQA 2HH9A 4MZXA 4ZDWA 2FOXA 2O1EA 5KG3A 4OHBA 3FFTA 3IUSA 2IPXA 1NBME 5EJ2A 8ATCA 3QZUA 2BFCB 1Q0PA 5KQRA 1TCCA 5AWFC 1U1CA 4J90A 1XYGA 2UAGA 3G89A 4B48A 2DQZA 2R60A 5T8KC 1KE1A 2NTYC 2WOJA 5B4VA 8ICYA 4YV7A 2GCOB 2CRXA 1HYBA 5AXAA 4BAUA 3L6EA 4BWJA 5IF9A 4RHCA 3OP1A 2BGLA 3PRKE 1UJ6A 2BCEA 2BFAA 2AR9A 3RB4A 1PQPA 2G40A 4CIYA 2EATA 4F2PA 2QN8A 4QHSA 4WDRA 4ER3A 3UZUA 1SKUA 4XX0A 2FW6A 1L8AA 1CUHA 1WHTB 1MOZA 3MQ2A 5BNWA 1QF6A 5CA0B 7ABPA 3M82A 1N8KA 4NLLA 1QX4A 3E5NA 4RSRA 4FZJA 1GNPA 4O2LA 4GI7A 3BORA 4CLRB 1UJCA 4CCWA 4DJTA 2VS1A 2P67A 4COKA 3DV9A 2JIMA 3JARB 3P45A 5SY9A 3MXTA 5L1KA 2X5XA 3M5WA 4YJGB 3TE7A 3PJRA 5IABA 1HT1E 2WYHA 3QY0A 4JI7B 1Y42X 2EWWA 3EUAA 3GA5A 4QZCA 5GVSA 2IS1A 2YFKA 5BSRA 3FTFA 2C61A 3RSQA 3O2SB 4QZBA 1M34B 2XTZA 2K4MA 5FTNA 3CBGA 2ZVDA 1QH0A 3PD1A 4MW4A 3PIDA 4X94A 5JDCC 2I22A 2WUVA 1U9IC 2W9CA 5AJVB 1GZ6A 3LI2A 3RQIA 5KTOA 3N4MB 1HLGA 2CK3D 2AXPA 2MR6A 4L4SA 4FZ3A 4LVOA 1LW6E 1T8WA 3KQWA 3MGKA 2V4RA 4D82A 4KIUA 1J2NA 1K7FB 1UANA 2OESA 3AUSA 5EZYA 3U3JA 4AZ3B 2NYAA 4CN8A 3KWMA 2GNOA 4L95C 5CVCA 3DMHA 1OWLA 5C8YF 4BKPA 3PVSA 1SL2A 3D2SA 2ONCA 4UBKA 4BGEA 4CLEA 1JBEA 3UJBA 2X8BA 3HKCB 4CQNA 3OM0A 3N0WA 1F0NA 4OHMA 5K3BA 1CR6A 1TXGA 1T36B 1SVUA 1TFRA 1XQWA 3GEGA 3PNVA 4LQDA 5BRNA 1IHOA 4RESA 1OIVA 2MSLA 3PJFA 3GGOA 3SJBA 3F8WA 5A03A 2ZPTX 1HTTA 3KQHA 2FXIA 4FW8A 5DW3A 1OE0A 2IK8A 2H54A 3COJA 4JKYA 1UA0A 1SEVA 5GQSA 3SMQA 4OY3A 3NDIA 4I2BA 1AGXA 1HKHA 3CUYA 1S7CA 2PSEA 4YJFA 1QXSA 3FUVA 1PG5A 4IZ6A 4B4UA 2GHRA 5ENDA 3A70A 2OPHA 1FMTA 4RWEA 1JR3E 1W5TA 1YDWA 2JZNA 9ICOA 3NS7A 4BP8A 1S89A 2WOOA 5FT9A 1J49A 1GO3F 1OFVA 4JJ4A 1G9SA 1IH8A 4NJEA 4LZLA 2ZS9A 3CW8X 5J2DA 4LS3A 4CCAA 1ZN9A 1II8A 2PSHA 3EDCA 1P0CA 3NPMA 4HDMA 4WEQA 2HHLA 5KC9A 5LZ9A 4LJ7A 1ZUD1 2G9RA 2YJTD 3OCJA 3D4IA 4GVXA 1D5WA 2ZB8A 4YP0A 3V5NA 1J07A 3MGBA 3TK1A 3Q8LA 2JH8A 1PEYA 2VYFA 2PL3A 4R16A 3SM9A 1PFGA 2BFNA 3AJEA 3HEBA 3L8DA 5AI4A 3Q3IA 1K68A 2JHCA 3UJ7A 5IKEA 3FGZA 1NXTA 2DB3A 4KVZA 4X6XA 3PEWA 4LTNA 4LJXA 3HX0A 3DDNA 5J29A 2VPPA 1L3VA 5A04A 4KMSA 1YDFA 3DMTA 4L5YA 1L9XA 4N8SA 5G0UA 4KDCA 1THTA 1TMGE 1V7CA 3B89A 3H99A 3C5WP 2ZR9A 3T8YA 4C0AC 2HHXA 1H8HA 1X1QA 3P8ZA 4GNKA 4HJXA 5ESRA 3TXYA 3DDUA 5B3JC 1WCNA 1YR3A 4TWBA 4RYDA 3U1VA 4YYEA 4DIBA 3L6OO 4KFCA 1BD3A 5GONB 3G8AA 3QBDA 1NYLA 1TOAA 1RPLA 3K0CC 5H3LA 3D3NA 3HYRA 1SRRA 2HCBA 3AX6A 2DT5A 1Y4DE 4AJLA 3SVTA 2PTHA 2FUEA 1LY1A 2DY0A 1FLDA 1TMYA 1MF7A 2CDNA 1JNXX 5KC8A 2AYYA 4Y2XA 3M8KA 1FUYB 8ICCA 4JASB 3F4LA 1RLMA 2R6R1 4IC9A 1SXPA 1I4DD 3HBJA 3UWSA 2GN1A 3OTWA 1JKMA 1YH3A 3ITEA 5EIEA 2GA8A 2KICA 1N9KA 2O0LA 2XTAA 5CJ7A 3B6MA 4MWBA 3BQMB 2XO7A 4G5YA 1VJCA 2ZXIA 3LYHA 5AK0A 2HMYB 1V3TA 2ZIFA 3B82A 3CJQA 4OHPA 2P0AA 2A1JB 1LV5A 1P3JA 2WHQA 1T3TA 3HUUA 3IP4B 3C3WA 3V7UA 1BQ3A 4OHCA 5TARA 4CTJA 4RHUA 3QWFA 1WL8A 4L50A 4D42A 3HU5A 1NK5A 4OTZA 2DFPA 4DLVA 5ELXA 1JDBC 1G0OA 4R9SA 1GILA 2BGMA 4PHTA 3K5IA 5C8DA 2BLNA 2ZT6A 3IEKA 5DQGA 2COUA 4AZ0A 5J4KA 4ER7A 6REQA 2UUPA 4OXNA 2WLTA 5CFZA 2ORWA 3CKKA 4ED6A 2QD4A 1A7JA 1RR6A 1A5BB 4LYDA 5LA6F 3ZNPA 2P91A 3ZBUA 1XG5A 4EJSA 2EL7A 4C8NA 3BDPA 2Z7JA 1W87A 2WU4A 3SJUA 3THOA 3P4UA 4DY4A 1P2DA 4GPAA 4QGFA 3OJXA 4RVGA 3TL6A 3SIXA 4B43A 2XQKA 3FCEA 1DAHA 2CHFA 1VHQA 1OW5A 1JA9A 3QVOA 3TEFA 4YD2A 2DUMA 3V7FA 4YFVA 2UZ3A 4J16A 1WU7A 2E49A 4MJ3A 5I4CA 3O03A 4J91A 3H0KA 2HOIA 3H2GA 2OEHA 1E58A 4ZV4A 1SB3C 3I6QA 1CZHA 1S0NA 3O8QA 4TXLA 4LZPA 2RGXA 1Z56C 3NP7A 1PWZA 3ANSA 2MSDB 4M7WA 1PV2A 2B9VA 5BNFA 3ZBQA 4DPKA 5JAIA 1C8BA 2PZBA 2QX7A 3QXCA 3SWWA 3LD9A 2G4VA 4YS6A 3GRFA 5D2CA 1RHKA 2CJWB 2CLLB 1DT5A 2W6PA 3MGAA 4PO3X 2HBQA 2CF6A 3Q3HA 2J33A 4NU8X 2ZR8A 1WSDA 2DCMA 3KHGA 3PTLA 1ZQRA 3ODPA 4MHTA 2VJQA 3MT7A 2JEFA 3I83A 1ZW1A 1QFXA 1RHMA 1QGED 3SYNA 1NVXQ 3PE6A 2GRAA 1M33A 3ZR4B 1LVGA 3K1TA 1ODTC 4LJ8A 5COAA 2QT1A 1VYTA 4RDXA 3VC1A 4ZQHA 3ZWDA 3TQQA 4RZUA 1X6IA 4O59O 2QXUA 4FC7A 4BB5A 1D9XA 3OKFA 4GICA 4RD3A 1KBOA 4S12A 5IK2A 4EP1A 1A9XA 1CRZA 2N1MA 2NGRA 2XQFA 2YVAA 2ZUCA 5JE8A 2WQ6A 2VHZA 4HH4A 4I5IA 2XUKA 3B1VA 3C3DA 3FUUA 5A0FA 1MVNA 3TSCA 1OR8A 2IX9A 2J3MA 3R09A 3TW0A 2AFRA 1B43A 1CW2B 1NT4A 1RS0A 2AD1A 3KOWA 3TANA 1X94A 1R5BA 3EXIB 1YVEI 3GEDA 3MZ0A 3RIMA 1WZNA 4V1CI 4OGWA 2XADA 4QZIA 2Z1DA 3GIIA 5LB4A 3UMMA 1BXRB 1FTNA 2C7VA 2ZRCA 3IKTA 2YQZA 3U4DA 3UAXA 5GZ3A 1TJ4A 4N41A 2XY4A 1O6FA 5DKFA 2ZUWA 3PI7A 1NAIA 2B8JA 2JLZA 4HGYA 2A7XA 1RWQA 1Z9BA 3NWEA 1XNQB 2IS2A 3HP7A 4B9LA 4M54A 3UMVA 1RAIA 3UTDA 3ZI0A 2QVXX 3JQAB 5IC5A 1L1FA 1H1DA 5ALFA 2F1OA 5FWXB 3BGVA 3WOVA 4ZCIA 3JASB 4BNDB 2WZQA 4DIUA 1QV7A 1VMDA 2POCA 4N54A 4IR1A 4V1CA 5IG2A 4MV7A 1W9MA 2ZJFA 5CT5A 1QJ4A 1J5XA 3STHA 2NOAA 1VE5A 3NVVA 1FNMA 4FFBB 1HL7A 3M1AA 2A6PA 3CLSC 4GE3A 4HUQA 1W5BA 3GMDA 1VIYA 1RG6A 4JLAA 4PLCA 3RYCB 1IOVA 3K9FC 4OJTA 5AM3A 1E5QA 1P0MA 1VPDA 2JA1A 2JIZA 3F97A 3K0EA 2VPXA 4GECA 2C5EA 4I99A 4II2A 2PXIA 1ZS9A 4B4OA 1SXJE 2WUDA 3I1FA 1IN6A 1ONOA 3RANA 3JZAA 4QU0A 2PUJA 4JK1A 2AEEA 4OSPA 3AR6A 3DNFA 5AW8A 3AVUA 1B3BA 1D8TA 1E3LA 4DDWA 4A0FA 3HGTA 3QENA 4B2YA 2R5NA 2PRKA 4LBZA 5HNKA 2GLUA 4YAFA 3OQ6A 3CUVA 2R62A 2OOKA 2G1KA 3VI3B 5HRCA 4LYHA 5C8XA 4FI3C 3FOWA 1PBTA 3PQFA 3KQQA 3QUCA 1QC5A 3CPSA 2XNCA 4WFKA 2X41A 4EELA 4WN3A 3U7QA 4U2FA 4EB6B 4YRKA 3ZW9A 2XI4A 1K1SA 4AMGA 3AVXA 4GYWA 3ZD8A 1N2OA 4LWZA 1B6RA 5J2TB 1EXWA 4QIWC 1JB1A 3MGVA 1N57A 1QV9A 4RK7A 2ZXUA 4GL2A 1NVGA 3N7TA 5ARDA 5FCDA 2NV0A 4B3JA 1WLYA 3N3AC 4ISCA 3BXZA 2FE1A 5B6JA 1I3KA 1P1FA 1Z0DA 1DCTA 2PTGA 2XT9A 4AJIA 2Q2WA 5HRUA 5AXDA 5CT8A 5I4IA 2C77A 1EAYA 2R8JA 3KOZA 1TW3A 3BZKA 2HJHA 1JSRA 3CT6A 3LRXA 4LKOA 3PX6A 4LFCB 4ZMRA 4YI3A 2QE7D 1G3IA 3A05A 1NOMA 5EQDA 4JNCA 3ZE8A 4D4GA 1GZ4A 1ADYA 4YDQA 3ZDXB 4LHVA 3LLSA 1T1SA 4KHZA 2Q6IA 3KVOA 1IHDA 2PPLA 4UPVA 1OFUX 4UCQA 1UP4A 4A8JB 3BQ2A 4R6XA 4KU4A 4BLPA 4BNTA 4NH0A 4YCSA 1W5SA 4IL5A 1J8VA 3OX3A 2Q9BA 4YRQA 1MA3A 4B81A 5I7OA 5JS1A 1E2MA 8OHMA 4IIVA 4MEBA 1DARA 3MJCA 3NDBB 1X9MA 2LCFA 1M34A 3L1VA 4PV7A 1N6LA 3U17A 2J3KA 1E6EA 4HL6A 1C3VA 1FDSA 4PWZA 3QEOA 3EBLA 2YBEA 1MUUA 3KP1A 4ZOCA 3SR3A 3ETLA 2J6TA 3AIMA 4OBEA 3LCVB 3REGA 3HJFA 3T5PA 2ODWA 4XYLA 4JYAB 5J5VA 3I5XA 5CWRA 3DUWA 1USWA 3TSWA 4D98A 4LYAA 2O2YA 1A9SA 1ETHA 1EFRD 3PE4A 4X1OA 4N0EA 1E2NA 1MVOA 5AW3A 1OZGA 1TM4E 1U0GA 4J49A 2ZWOA 1U80A 1D07A 3W9BA 5KJFA 2MDTA 1STOA 1F12A 3LLMA 4ZC1A 5LQJA 3PRHA 3UJAA 4BO7A 1N2JA 1OXJA 3JWJA 5KDOA 2K8BB 1DCMA 3ETDA 1PT5A 2JGKA 1QFYA 3QX8A 5ENZA 3VSEA 4BNZA 1E7WA 1ZDMA 5IDWA 2N3ZA 1C0LA 5ALYA 2IPOA 4XUGB 5T4HA 4H3SA 4IPTA 4RWZA 3ZGNA 4CM1A 3KPWA 3GFKB 4MX8A 4IO0A 2J5RA 4QUKA 1MO5A 3E7PA 1BU8A 4S35A 2X7HA 2G0NA 4PNPA 3IR7A 1ZJ5A 3R9IA 3PDHA 1SCNE 1RU3A 3UG7A 2OCPA 4RA6B 3WG9A 3AVPA 2PO5A 3PHGA 4M21A 4QVGA 3FMVA 4MUGA 4Y0AA 1CULC 5J0XA 3PQ8A 4B3MB 3NWBA 4Q7KA 4EUHA 4BB0A 3BTOA 1R16A 3LVVA 2RH4A 4PLPA 1VHJA 2G80A 3FIUA 2P8SA 2XKJE 5AM0A 2Q9AA 3G8CA 3HSKA 4MKHA 1NJ6A 5EHGA 1H38A 1XQXA 2CMFA 5AI8A 1ZHFA 2J5KA 3WYGA 2W2OA 1EHIA 1GUFA 1W49A 1LLCA 2FP3A 4KQ1A 3RLFA 4DLBA 1MH1A 5DSTA 1NXQA 4YMWA 5LA6A 1QFJA 3P19A 3WNDA 5HTOA 4FKBA 1CEQA 3N53A 5A3JA 2WUGA 2CFIA 4PG7A 5FD8A 4F4WA 4UBMA 1J8MF 3HHEA 4R8KA 2IU6A 2Q3HA 4N8DA 4GDMA 5FPYA 4C2AA 3R3JA 4TYMA 3VR5D 4JP5A 2Y1XA 4E2ZA 2QB1A 3HQ4O 3PW4A 2E5WA 4RHYA 3OIGA 2J9GA 4OJPA 5LBUA 5JTTA 2RQ5A 1QSSA 3GB9A 3LYSA 1QSLA 5EFZA 1NBWB 2IA5A 2X4IA 4F7DA 5LLSA 2EQ5A 2FLVA 1SQFA 4AJNA 5B6IA 2ZAGA 1P1CA 2VDMB 2VDNB 4DCCA 1T9KA 3IESA 3JQAA 3N74A 2ZGVA 3AU2A 3WIOA 2WU3A 4LHZA 3AY6A 1E3JA 4RMIA 2I80A 4QVKA 1OFIA 4XFDA 5ICFA 4OJ6A 3C98A 3QX3A 3ER8A 4A16A 3RSLA 3TQOA 3GH1A 1SCAA 4RTNA 1EK6A 2A3NA 1CJKC 1UBLS 2DT8A 2VDPB 2WVAA 3D9QX 2C8VA 1KQNA 1XYYA 1DQZA 3A32A 4LBYA 5FL7D 2LUOA 4FW9A 5I4BA 2CXUA 4Q9IA 2P6NA 3ZDFA 2QB5A 1J70A 3LU1A 4BHTA 5KOIA 2FW7A 3CEJA 1TM7E 5H02A 2WFLB 5F9LA 2F48A 2VT7A 4FGLA 5K3FB 5HR5A 5KNDA 1DQRA 1DC6A 1FDOA 3EGDA 2QD5A 2XWQA 4UUPA 1A4XA 3TRFA 1H66A 3ZLJA 5LOVB 3PP8A 4C0WA 1IPFA 2XVZA 5COQA 4QT4A 4W1SA 1K7SN 5PNTA 4ECVA 3L43A 1A97A 2QMZA 4IGEA 3MHTA 1ADBA 3C7TA 4LZWA 4P84A 4H7JA 4HXYA 5FFNA 4BRZA 1JQKA 1ZC4A 1VL2A 1SCIA 4M0FA 3U7FB 2P69A 3QZ7A 2JJ8A 2FVYA 1I6LA 1V38A 5M7EA 2BHRA 1KJ9A 2QRUA 2RHRA 5EJMA 2Q3BA 3DM9B 1LC0A 2R8IA 4LI0A 1EVQA 5SZIA 2X14A 2WJHA 4FGZA 3DAGA 4MVJP 4YUXA 2WMYA 4N7RA 2GEJA 1NRWA 1U8FO 1YKGA 2HSWA 4OI1A 1L5NA 5I4KA 4AU1A 8ICFA 1RXCA 1QVZA 5DG8A 1U2ZA 1P80A 3B1WA 4KL8S 4XGNA 4PPQA 2YKGA 1LK7A 5ALGA 2E89A 2XB8A 4J29A 4KAXA 2CXXA 4KSCA 3LM8A 3T1VA 2P5SA 4DZTA 1IBLB 3AEUB 3HKEB 1NKSA 2E0IA 2OP1A 4FOTA 4LW8A 1WVMA 4YALA 3TO5A 3VU9A 4RY0A 2RG1A 1L3UA 3V4ZA 2XCIA 2VZLA 1YBMA 1UDBA 3B78A 4TS1A 3V4SA 3BS5B 3MT8A 4GFDA 5L6LB 4MR8A 2X8AA 4KK4A 1KAMA 1VRWA 1YMQA 2WABA 2ZU0C 3EVAA 1NSFA 1NXSA 3C4VA 1RPNA 4Q9HA 4DQDA 5ADWA 4X65B 5CB1A 3COSA 4LBVA 4DA6A 1D2RA 5KG7A 2DKFA 3KKOA 4F4HA 4FX5A 4ASUD 4PL2A 4DMCA 2IFTA 2YB1A 4UUQA 5FLKA 3SZLA 1DRWA 3IERA 2K5UA 4EPTA 2I9PA 4KFSA 3LPDA 4MUAA 1RIIA 1R27A 4XVRA 4X61A 5F1PA 4BTLA 4FMBB 1N6KA 5EIWA 9ICHA 1ZBDA 4YBRA 1DC3A 4DPMA 3FWYA 1TJPB 3SV4A 2XNDD 2ATLA 2Y6UA 1YBVA 3IAS6 3IP7A 2UZ1B 3P2MA 4I1UA 1NUQA 4CTNA 2AWNA 4MW2A 4UB3A 4BMCA 5DBHX 2CVHA 4K05A 3B2QA 1NBOA 1M7HA 2GHQA 3DBIA 4X45A 3D8SA 2GX6A 4IXDA 3NXKA 3V2IA 1R6VA 4YMIA 1Z4LA 2JLQA 3C5GA 4X60A 3M0EA 1DAEA 1KBQA 4JT4A 2GZMA 3E48A 3HPRA 5A2QA 4QPPA 5DBIA 1R15A 5LZ5A 3ZQJA 2XPCA 1OB2A 4M1WA 4LJKA 4FB4A 5AM4A 5GGXA 1B0UA 5JCJD 4MOWA 3UOAB 3VNSA 5IJ9B 3GUHA 2AK2A 4P22A 3HJUA 3KXLA 3L6DA 7ICUA 1H2HA 1OH7A 8ABPA 1T0BA 5A4MS 1U0RA 1SUDA 3H1AA 1QYRA 2VP0A 3TL2A 4LV8B 1BWRA 2JD2A 4W1QA 4QNMA 2ZSJA 3F5QA 1JBKA 1W4CA 1CUYA 5JU6A 1T2FA 1FPMA 2XVMA 4W8HA 3LECA 5J0SA 1W36B 3NMUF 3ICQB 3WMFA 2ODEA 1S9DA 3CEHA 3GEBA 3CNBA 3QG5A 3PW2A 4LWPA 1YXMA 1PTJA 5E7JA 4BECA 4XX1A 3KHTA 3HKZF 3HUTA 3HYSA 3KPJA 4S1PA 1LKYA 2MHCA 3WADA 5BUSA 2YNMA 1XU7A 3ENWA 2D4AA 1I4LD 1R0LA 4A36A 4FJ1A 4B3HA 1FMJA 4D8TA 1FUUA 3EFEA 1IHYA 3KEGA 621PA 2FWIA 3I34X 4D02A 1GCAA 2FG7C 3PV8A 3U7JA 1E1KA 2QAGA 2X3YA 3OIVA 3NRBA 4IXMA 4OYLA 5F5NA 3WQHA 1WHSA 1Z5ZA 4MROA 5IANA 1FRNA 4N4AA 4TYWA 2YIMA 2AVDA 2CBZA 5IKOA 2H3ZA 1M1YB 1KYYA 2C5LA 1KKXA 1A7KA 1V9PA 2V74B 3UJ9A 2JLWA 2VPWA 1UMCB 3KSAC 4E2YA 2WAQC 1A50B 1RAGA 2ESRA 1KYVA 4PLFA 2DFKB 5ECYA 4EO7A 4FN4A 5A62A 4RGVA 4QWMA 5FX2A 4LHWA 3HJEA 2R8BA 3LVFO 1EQ2A 1V5FA 1WZEA 3E5MA 3UYKA 4ER5A 5CD9A 5HM8A 4B40A 2XLBA 2WWRA 3STVA 1U3GA 4AQ7A 1G5QA 2NU7B 1K06A 4R2JA 5ALMA 2P2GA 5LXTB 2JHFA 2QP9X 3ZXSA 4M88A 5JCOA 1AZTA 5TQJA 1XKTA 1MJGA 3D5QA 5ADHA 3CLRC 5K3SA 1E3IA 3LUPA 3R77A 4AY4A 1MC5A 4QXAA 3I4LA 3W8FA 4GKJB 1MAHA 3KQTA 5KWIA 4UAYA 1JEDA 1HMPA 1JG7A 3T3FA 4A0HA 2DHCA 4NZ9A 2CMGA 1Q11A 1Z06A 1Q84A 1K6MA 1CIJA 3MWJA 4EGAA 1Z0AA 5F3DA 4DLLA 1BVHA 5KG4A 2JIZD 3SN6A 4CKWA 1IFXA 2QI9F 4QOEA 3U9SA 5JEEA 3L1HA 3OLCX 3NCTA 5EQTA 5KNLA 4KSBA 1A98A 4YJGA 3WK8A 4L9AA 3RWOA 1EFCA 1XNSA 4L02A 3COVA 2K4IA 4FHFA 2R96A 3R7SA 8ICHA 1US8B 3DLHA 1T5BA 1NVBA 3TSZA 5I7SA 3GUYA 1YC2A 1SC6A 1VP3A 4R54A 3CX6A 1YRWA 4YAKA 1OF1A 1DCKA 2WKPA 1ID1A 3BGOS 3KPUA 3NAZA 4HP8A 4N65A 3CONA 2LPEA 1SVKA 2C5BA 3ZWXA 3VO1A 4DNPA 1HTBA 2WPNA 4FZLA 5HKLA 3RYTC 5CAEA 2WF7A 4PO8A 3FROA 2CD7A 3VU9B 4UCFA 1V3VA 2PXHA 3I12A 4OXXA 3LXUX 2C1XA 1Y3FE 1SUAA 4PCLA 4RAQA 1X7HA 1V7ZA 2DQKA 2BEUB 2NO0A 1WZ2A 2YV1A 3FNQA 4FGUA 2C92A 4KLFA 5TPZA 1ZW6A 3CO5A 1HRKA 2AHRA 4S2UA 3TECE 1JYEA 2A86A 3AF5A 3BBPA 3QLEA 4IG4A 1FFUA 3K6SB 2CXHA 3CS3A 4QWEA 2G5GX 3H6KA 3MLAA 1NZBA 1SHJA 3W7AA 2ZIUB 3BICA 4FTWA 2Q4RA 3R7FA 1T5LA 1IOZA 3JX9A 1RBMA 3FSGA 3O21A 5IVDA 4QJ3A 1F8GA 2AFIA 2D5CA 2R18A 5JO9A 1MA0A 1S8FA 2ON6A 4IDAA 4OJ5A 4OBWA 2JHGA 1F5SA 3GWZA 1GEGA 1WLSA 3CLKA 3IURA 4L51A 2EAOA 4P92A 2PMCA 5BSEA 5KFPA 3T7EA 3K9BA 3H4DA 1S3IA 4GXJA 1UK7A 1Z82A 3HI6A 4HN9A 2FWNA 5JCXA 1RMTA 3PUXA 2IXAA 1TUBA 3PPWA 4WBXC 3CUWA 4DE5A 4OJOA 2FU5C 2I6UA 3ESBA 4UZSA 1R8JA 5FO0A 5EWJB 3OU7A 4KVGA 2CGEA 2F17A 3GH3A 1QGZA 1C3OA 2ET6A 1QYVA 2ZSFA 5C31A 4LWOA 4FM9A 3QBTA 3CZ4A 1N8TA 4FZNA 4PGMA 3ZVKA 1NK7A 3ND6A 2GEBA 2OZVA 3DGFC 3KL4A 1Z75A 4QNNA 2VF4X 5ICSA 3CV3A 4CMHA 1BPDA 3ZDZB 2A1TR 3MRSA 4PSUA 2ZI3A 4WCFB 4V2IA 1SG0A 3DVRX 4J0KA 3AVWA 3OOWA 4GGPA 5AVJA 5I9MA 1KBZA 5C7LO 2GHIA 2WTAA 4Q16A 4OIFA 2P0YA 4II7A 2FEAA 4UCWA 1L7QA 1WYGA 1V45E 2ERXA 2XNJA 2LVBA 5AQ1A 3SMVA 2QVLA 1TM5E 3GYBA 4PG4A 1NFFA 3U2QA 1BVUA 4JFRA 2VQ3A 2C8KA 4DEYA 3AG6A 1NF8A 3NG1A 1JEOA 4P3NA 1KEEB 3C1YA 4MUKA 4C0HA 1RAAA 2ZE7A 1RCFA 2XGMA 4GRAA 4TQAA 4LMRA 4V2UA 4D99A 4D80A 4PSAA 5KFUA 3ZX5A 4RVUA 4C06A 2YNMC 4MQFA 2Q0XA 4RKEA 1YTUA 4LHEA 2PA3A 4QUHA 3OLWA 1RTKA 1XMOB 1MHTA 2PI5A 1LK0A 4Q21A 4RTPA 4Y67A 3SR4A 4KAJA 1LV8A 2GNAA 4GAEA 4Y0NA 4YT5A 3SK0A 1U2TA 5CXQA 3RJMA 4A0GA 3LCRA 4Q3AA 2G7MC 1NOKA 3FZEA 4G65A 4IJUA 2J59A 4QOIA 5AICA 4TTTS 4DCJA 1JMSA 1P81A 1BNCA 2C07A 2N9UA 2WKSA 3DAYA 2AT1A 1XSLA 3A1CA 3TLMA 5JAMA 5L7WA 4DV4B 3DBOB 4FJ2A 1KETA 1T2AA 3U48A 4FP9A 2J08A 5JADA 5DCWA 2FMTA 2VI5A 3MIZA 1ZUNA 4MR9B 5A4FS 3IBGA 3TLZA 2FQYA 5K8TA 4O2BA 4IRUB 3HKZC 4FHZA 4IICA 1OB5A 4P82A 4F84A 4U3JA 1PS0A 4RULA 2OPBA 4RAOA 1LPNA 4KQ6A 3TF5A 5FXMA 4RT2A 3AUTA 3GX1A 3HA3A 1KYIA 2BFMA 2F3PA 3IHWA 4J6EA 1YIAA 3AKDA 3TNFA 5EWEA 4HV4A 4PGYA 1CUZA 2VJCA 7ICMA 3FI9A 3HP1A 2GVDC 2HLNA 1PR9A 5LUBA 5HF8A 2WWVD 2ZBFA 4WADA 3R7AA 1JDTA 3SJAA 1EUDB 5D51S 2A9KA 2JJ1A 4NM2A 3AF0A 2K60A 5CVUA 1M8KA 2A5YB 1T2CA 1O95C 1WUTA 2CFOA 2JLCA 1PKEA 3F2IA 3N70A 4FFPA 4Z9AA 4DCNA 1S9FA 1W59A 1XTZA 4BY9E 1C9NA 1G98A 3DNPA 4IQFA 2PWPA 1G18A 1HZZA 3V8EA 3BAZA 2CZCA 4IDNA 4DS5A 1G16A 4INJA 2I91A 4U9UA 1FNCA 1NMQA 3NT4A 4L9SA 3RS3A 1WPRA 4M36A 3EXG2 1VG8A 1JG1A 2ZJAA 4HRAA 1T3LA 1BDBA 2PZJA 1W30A 1FTSA 3TUJC 4C29A 1P77A 2H18A 3FOBA 5FTLA 4EARA 2CHVA 2C3PA 3GAAA 3O92A 4MR8B 1JSCA 1YOVA 1XQ1A 4NOMA 1Q3TA 4UVEA 2NTJA 4XDHA 1WBBA 3KG2A 5F76A 3DLIA 2IXEA 5TISU 1JV2B 2CUTA 2GPBA 1KZ7B 4HDAA 4BDTA 4C8KA 1QQ7A 2GCPA 2I8CA 1SCJA 5DNDA 1VHLA 1T4CA 2HQBA 3G23A 1MPXA 4MYHA 2W4QA 2W6CX 3G2KA 1Y34E 5J2EA 2WSYB 1S01A 3DOHA 2ZTSA 3F7TA 4DQRA 4MVJD 1AUQA 3ZZTA 1S2DA 1M5UA 1XKLA 2A5JA 3MK31 3V6KA 1BMDA 1JN0A 4JELA 1PD0A 4XAQA 3U1TA 7ICKA 5JNUA 2MSNA 2W04A 3L8FA 1F4LA 3MJ4A 5L3ZA 5EJ6A 4BLWA 3L7BA 2K8CB 2FPSA 4LCEA 4W4TA 3RYIB 3GJYA 3ER6A 2EFGA 4JYZA 4IV8A 1CBUA 1RZRD 5A6SB 3RJGA 3SAGA 1MQSA 3AESB 3ZD9A 3CVYA 1QQAA 1G19A 1UBCA 4REMA 5AR1A 1K9VF 3ZGZA 5IRCD 2HXGA 1NNUA 2D2EA 1O03A 1W0KD 2I2WA 3HZZA 1J4AA 3VUEA 1FMFA 4XYMA 1DKOA 2Y77A 4M2YA 3OWHA 5HOQA 3NV7A 3E2MA 1L5RA 4CDGA 2Z9DA 1F0PA 4NCJA 2NXEA 2WRZA 2QS9A 3MWEB 2PFNA 2QLBA 3CPEA 2JAWA 1O89A 4DQSA 1ZD8A 4TMWA 4C04A 3BEOA 1FJGB 4DR5B 2G6BA 5H70A 3SG0A 1TK8A 3ZJ5A 1B8PA 8AT1A 2VR1A 4PHHA 4F04A 4B2LA 2ZRMA 1NYQA 1ZKMA 1PGNA 1ZBQA 2W6MA 4MEJA 3QFHA 1YL6A 2DC1A 2NXWA 3D6NB 2HW8A 2YV4A 1CJVC 4EW6A 2VJ4A 1IJKA 1TIPA 2PANA 2ID8A 2D5IA 1QFZA 2C94A 2I3BA 4ECQA 3BTUA 1K97A 3H3XA 3O74A 4LA4A 3RODA 821PA 4B8ZA 2H29A 5KYGA 5JI3E 1UM9B 4H08A 4JR2A 4XJVA 1NK9A 1MRNA 4JBLA 4CTKA 4KSYA 5A9SA 1S2GA 3K0AA 4RPJA 5TPZD 4HB0A 3NHPA 1CFJA 4JHXA 1GG9A 1E98A 4FONA 1MO6A 5KYWB 2ZZMA 1WTAA 1Z0SA 1GVHA 3T0IA 4ID9A 1ST3A 3DXZA 3EW7A 1Z8HA 3OOJA 2KJ5A 2QVBA 3THRA 3PSFA 3UMRA 5A2GA 4Z4QA 5HUQA 1O77A 1Q16A 2C8LA 2Q4EA 2BQ3A 4KKXB 4HBGA 4MIKA 3TI0A 3O83A 1K88A 1C1XA 4AN4A 3Q40A 1ND5A 1XN4A 1TDJA 2GCIA 3QVJA 3IUYA 1JJ7A 3N7PD 1RLOA 3NC1C 1GO2A 3KUXA 1HEKA 4LFBB 2WSSA 2WJPA 1SGWA 2J41A 3GG9A 3QFRA 1M8PA 1HYQA 1ZJWA 5HUJA 3HXMA 5EZYB 4AZ3A 4BYGA 5JAZA 2BCSA 4N5LA 1A7UA 3UC5A 2B4KA 1J56A 2JJ2D 4GE0A 4MWOA 1J42A 3GJ8A 3GLVA 1ZIPA 3ME5A 3C5VA 3DZHA 2UVUA 4QYMA 3SX2A 3WWEA 4BQNA 1JAYA 4DNOA 3NT5A 3R4CA 1LBTA 3BWYA 3AL0C 4B4WA 4RH3A 3A0BU 4XOIA 1P60A 1TIBA 4K9PA 4UHJA 4EHDA 2YZ7A 2ZTMA 3IE1A 1DJLA 2PSJA 2AEJA 3B1XA 5JSUA 5KNCD 4J1TC 1PJQA 1XZ8A 4LXHA 4KE6A 3C48A 3ZZUA 2BKUA 2Y4OA 4WY8A 5K05A 4DV2B 2W8LA 5LZ2A 2R7AA 1M3SA 1PS9A 3CKMA 4P3KA 4EGCB 1K92A 3B2EA 3ZNOA 2YJ3A 2ZT5A 2D3TA 4AUKA 4EJ2A 4PZUA 4IJMA 1UF9A 1ECGA 2PEYA 1UZUA 1FFSA 4N5NA 2R8HA 2GQ0A 2C58A 4G3IA 3IUJA 4BTEA 5CVDA 1ZD1A 2OV8A 1K1EA 3KQYA 2VCEA 1U98A 2H1HA 3PIRA 1J8QA 5F4ZA 1JJBA 1OBOA 2I6GA 3T94A 4RJIA 3EQ6A 3VC3A 3QUTA 2X8JB 4JC5A 3ZHQA 4YXFA 3IH5A 1J22A 1M76A 1RWBA 3CT4A 4ZI5A 1L4MA 2OTCA 4LDRA 5KNBA 3K70D 3S8YA 3DBVO 3OZFA 4EIWA 1OYYA 2K4EA 3BGWA 1UBFA 4HWPA 4A6PA 4PN7A 1T9CA 2J0QA 2XRYA 3TDNA 2HCFA 4EYEA 4Z6CA 2QB0B 3CMMA 3ESRA 1UPTA 4KYUA 4CT0A 5CYFA 3IQIX 4OJNA 4V0RA 3IA7A 4TUQA 1YCHA 5KYKA 4UQLA 4WNIA 1K5HA 3BA6A 4ITUA 1KHTA 1OPRA 4QX6A 3MG9A 1CRLA 4I3GA 5KWVA 1XZJA 2AX4A 2ZI4A 2IEDA 3WMEA 3VH1A 4IRKA 1N3IA 4PHAA 1U2GA 1LVHA 1OX5A 1P2VA 1X39A 4WIAA 1RHQA 4HDQB 2O06A 4Z7QB 1F1BA 1CRWG 1OA0A 2LGJA 3D6HA 3H2HA 1YUNA 4A23A 1R74A 2A84A 2EARA 3B9PA 4PINA 1WABA 2PUBA 5KFIA 1P44A 3WGJA 4RVOA 4ZJUA 4X00A 5F1YA 2ODAA 1WEKA 4XD7D 1QF7A 1EP3B 1JJVA 2BQUA 1MX9A 4FN5A 3WK9A 2HF9A 3D3QA 5E3JA 2QI9C 2B1QA 5LMNB 2W9BB 4BUJA 1NOJA 4I6GA 4P0QA 1E3TA 1JHPA 5ISMA 4O3QA 3EDYA 3BUSA 1HDYA 1CIPA 2CY0A 2FX5A 2OXCA 2ZSDA 1LLUA 3RE1A 3ZH9B 2QX9A 2O8VA 5J2TF 1M5RA 2VJDA 1NX6A 4MUNA 3AFGA 3K5WA 4ALJA 3NVZA 3WQBA 3ONDA 4LY6A 1QIDA 2GS9A 2DP4E 1IEXA 2MYTA 3NDRA 3K20A 4FKZA 1AG9A 3HN2A 3NNDA 4QECA 2X40A 1P2SA 2ZITA 4NNOA 2XMDA 1EBFA 4FYXA 4Q48A 5G3ZA 2WWGA 3A25A 4EPVA 3ECSA 1FXSA 3NETA 2IELA 3VVLA 5KVAA 1KGDA 2EZ9A 3ZZ1A 1Z6ZA 5DM4A 2HSZA 1JPJA 4HQNA 5K8UA 4ZYWA 2ZJ6A 1D8BA 3I04A 4PTYA 3R3YA 2EFDB 4KFUA 5JW6A 2QJRA 3DP9A 3ZC3A 3GLRA 4FKMA 4NG4A 5IU6A 2M32A 1KI6B 1Z00A 2Z95A 3GHHA 4E13A 1HOTA 3FYSA 1SD5A 1YKSA 3MR3A 1TEZA 1JEYB 4M3NA 3S68A 4XA5A 5D46A 1KO8A 2B8EA 4QOJA 3D4BA 3BXGA 1DINA 3B36A 1K27A 3NR2A 4KMUA 3NRCA 3OCXA 3PL1A 2OE2A 2NPFA 1OHHD 3GN1A 3CGWA 3WK7A 1K8XB 4HUQB 1KSPA 3HJNA 4MS3A 2A0FA 3NYRA 3FVVA 4KDRA 1D2NA 2X5JO 4DYDA 5EZYF 3ZI7A 1Z15A 2KOBA 5HPYB 1Y88A 1CQIB 1KL7A 3NZEA 5T4BA 1IONA 1J97A 1ZUIA 3E8SA 3INGA 3MT0A 4HAOA 4QU8A 3TARA 2ZOSA 3QF4A 2XYHA 4G89A 2RONA 4PZOA 1D2HA 3H8MA 3ACDA 2DG2A 4NYIR 4LYEA 4RVDA 1KI8A 4LYYA 5CCEA 4AJPA 1P7YA 2FFQA 4R1QA 4X3CA 4KBFA 3EQ8A 2GZHA 5CD1A 1YFJA 3CKLA 1RC1A 1HT0A 2WU8A 3Q7IA 2P9TA 1JIUA 4QWWA 3SC2A 1AK2A 3ZGYA 4L3VA 1GPH1 1RXIA 8LDHA 2JZCA 2HO5A 2NSDA 3BS4A 4BZWA 5KDDA 1V1JA 4JMPA 1UDWA 3QLVA 4YQZA 1V1RA 2F9MA 2EQBA 4IRXA 3SQIA 1FRFS 4WZ6A 5KTSA 3QVKA 3AVOA 5CFLA 1QGUA 1MXHA 1S7GA 4L8VA 1DGJA 5AK4A 1U0OC 4YCAA 5KNCH 1JJAA 5G0SA 4J4BA 3KKAA 2PZKA 2RHDA 3GV5B 2JRLA 3GJXC 4YRJA 4YV2A 3MUFA 4UMEA 4I29A 5A5VA 4AQYB 4MLCA 3UMBA 5IDQA 4EG3A 2Q50A 1WXIA 2Q5IA 1GWNA 4BDPA 1GQYA 3C3EA 3VYUB 3VV2A 2ZU6A 1M74A 4FEGA 1IQRA 3VZQA 4BJ1A 2P7HA 1TK2A 1N61A 2DFLA 3A4YA 4RA9B 4H6WA 3UIEA 1VBFA 2Y71A 3JVIA 3OURA 1GFWA 1M1UA 4BVFA 5IJZA 3P94A 2XYQA 5FR2A 4G5OA 1Z2CA 5BW6B 3SJ7A 2DPJA 2RHWA 4H16A 3UPTA 1G7TA 1DBSA 4OLBA 4TV8A 4U9HS 5EJ4A 1TIKA 3ROKA 2R79A 1I8TA 1OXSC 3W2FA 2FSFA 4XM1A 2I67A 5H81A 3P5BA 2KTQA 4ZREA 3GVPA 3RT1A 1TX4B 3L8YA 4DIKA 5AHOA 4JITA 4ZCTA 1XNRB 3VR1A 1YS4A 2NNWB 2OLEA 4R8MA 1MP0A 2WYIA 1U3UA 5HKKA 2Z30A 4CLDA 2NQ8A 2PWBA 3D8BA 8ICEA 3HYCA 4RY8A 4E5YA 4JN6B 2PD6A 2B8WA 3C4JA 4MVJI 3MOGA 1QSGA 4TVKA 4BO4A 4C4YA 1U9JA 2WWFA 3PPXA 1ZNZA 2Q3FA 3OZDA 2G3YA 2XF8A 5AOCA 2YJGA 2KWIA 4TRRA 1RPZA 1L4BA 1XAHA 2UUBB 1YVDA 4Q93A 3CZCA 5FLEX 2R4QA 4TKUA 2VHTA 4CQLB 3WISA 2WHXA 5B3JA 3SE0A 1NT2A 2FUKA 3E9EA 1GKUB 2V4MA 5AM1A 2VDJA 3LDFA 3RNLA 4D0GA 5D5HA 2HQSA 3OM9A 3KQKA 1R8SA 2V4UA 4MWCA 1TKCA 1N56A 2WD7A 1C2TA 4B6GA 4F3KA 4ZEVA 2VQEB 5CBKA 1OZ0A 2QSZA 1COOA 1SKYB 2B4TO 4AKSA 2OV2A 4BNYA 3G79A 4RS4A 3KHLA 5CH8A 5IIIA 2V3VA 3DAPA 1NQTA 4N7JA 4QBGB 3UJ8A 3WGYA 1PV4A 1SOWA 3OWOA 4ZP1A 1IAVA 3GIDA 1BNOA 2EC5A 3WDSA 4Z3KA 2AZMA 1EFHA 2QR3A 4Z4EA 2IQIA 3QE2A 3AY7A 3MTEA 2ACKA 1LJLA 3ID6C 4DM4A 1J1IA 2H4WA 3QRWA