1UHUA

Solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
b'GSSGSSGTPLSLTLDHWSEIRSRAHNLSVEIKKGPWRTFCASEWPTFDVGWPPEGTFDLTVIFEVKAIVFQDGPGSHPDQQPYITVWQDLVQNSPPWIKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords product of RIKEN cDNA 3110009E22
publication title Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1uhuA00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
4M2YA 1ZRNA 2YB1A 5KFFA 1Z19A 4LJXA 3V6HA 5J2EA 1RQLA 3KKAC 2YMMA 3BS5A 5AK3A 4C4SA 5EE3A 3ZDEA 4BDPA 2P66A 3KTQA 5IIJA 2KFNA 4FS1A 4M0AA 9ICTA 4DSLA 3B0XA 3C21A 8ICUA 2YMPA 2FMPA 3WKCA 3RR7A 1V9PA 2AQ4A 2MUTB 1XSPA 3M7DA 4Y2QA 2GH1A 3NVWA 8ICZA 3PSFA 4KITB 4FBUA 2EZXA 2DBYA 2YMLA 1JROA 2ZIXA 1ZQXA 2AXTU 1X9MA 1CI4A 9ICEA 4RPXA 2W55A 3NVVA 4RQ8A 1ZQTA 4DFJA 5J0UA 2L5YA 3NVZA 2HOIA 2JEFA 4KLTA 4EBCA 4TQSA 2VJ5A 1KQQA 1NJZA 5J8YA 4DF4A 4BX9C 4YP3A 2BPGA 5ALDA 4DL7A 2NO4A 1S0NA 2G06A 5HNKA 2BQRA 5KT5A 7ICEA 5DG8A 2KIVA 5KFBA 3ZD8A 4I2AA 1ZD3A 2QLTA 1V38A 2EAOA 3F2CA 3S6JA 4AP9A 4WJ3B 4KLSA 2F77X 2GOLA 1BNPA 3BQ2A 1S10A 5ALIA 1RXWA 4P2HA 4FZLA 4XRHA 3PW7A 1XS9D 9ICBA 3PMLA 3KBBA 1X9XA 4YVZA 2EANA 4R64A 4M47A 1D9FA 4R8UA 1IIPA 1TV9A 2FJ6A 9ICFA 7ICOA 3UQ0A 4CCHA 1S5LU 2KMDA 4Y2RA 5AK4A 3ZI4A 1SZHA 5AK6A 3CYMA 3PO4A 1NOMA 2Y9TA 1DOQA 3IDWA 1QCKA 1SXEA 2BGWA 4IQTA 4QZBA 1HEKA 4DQSA 3E2EA 3C5GA 7ICKA 3TFSA 3G6XA 2HHTA 4OJLA 2BQ3A 1UA1A 3KHHA 3QU4A 2W8KA 2PFQA 1KDHA 4NV0A 4F4ZA 1YT3A 4QZCA 2KG5A 4G9BA 1RXVA 1BPBA 4M6WB 2KTQA 2E8PA 5KFXA 4LVSA 2KFZA 1L7OA 4NLZA 1T4GA 1V85A 5ALRA 2KZMA 2V4RA 1SKWA 3SZ2A 3WK6A 2I1QA 1ZD2P 5IILA 4BWMA 5HP4A 4IRKA 4BUGA 5J2KA 3PZPA 5J0WA 3HT3A 2C2EA 4UAWA 5AKEA 4J9RA 1T3NA 8ICAA 2Q4TA 3BQ0A 5AM0A 3RRHA 4DL3A 3KKAA 3WKBA 1SB3C 4F91B 2ZIUB 2A1JB 4ECYA 2MUTA 3L5KA 1DGJA 5L1JA 4BXOB 4DOCA 4RNMA 5KG6A 4C7YA 5J0RA 4I2GA 5ALHA 3IN5A 3R9KA 4RPYA 2I5HA 2PMZC 2BKEA 5AM4A 3IM1A 5CJ7A 1Q8KA 2JXJA 3LWLA 4Y2SA 3IHQB 1UT5A 3TFRA 4YFKA 3AU6A 1SWVA 1Q46A 4GLXA 2JHDA 2F8KA 3T79A 2HHQA 1NK0A 2HOQA 9ICRA 2VA3A 4YG2A 2WAQF 3UM9A 4US8A 3D2NA 4JMUA 4NXZA 3PR4A 3C2KA 2KOBA 4JV0A 4YXMA 5KG0A 1NK5A 2ES6A 8ICEA 1WWUA 3QUTA 4C8MA 4DFDA 1K1SA 4O3MA 3KZIU 2W9BA 4Q8FA 3F53A 1J2NA 5AK5A 1UQVA 5AI6A 2KJ8A 3LYSA 4J9KA 3MR2A 3RB6A 4NJ8A 4Y2TA 4MEXA 4YN4A 3N7RC 4QWBA 3KZXA 2ZUDA 4GC6A 3NTUA 3RAXA 2HDOA 2KJ9A 2HBLA 3MFIA 5IIIA 5AI8A 1U47A 2G08A 1B0XA 5KFLA 3Q8SB 3EW9A 1S0OA 5ALVA 1N61A 1NKCA 1SKSA 4J03A 1UHUA 4FS2A 2C2RA 4I2IA 4ZOHC 2CXYA 3AUOA 1ZQPA 3GIMA 4NM1A 1DK2A 2ISPA 3M9MB 2HW3A 3FM9A 3RJKA 5DBCA 4IC9A 2NRTA 3GIJA 2XY7A 2K8BB 4DSEA 4AYBF 4OJ5A 4KLDA 1A76A 1ZQYA 8ICSA 2KHQA 5L1MA 2K60A 2JH7A 3IP4B 4M6WA 7ICSA 4CF4A 9ICLA 4QZGA 1LVHA 1TKDA 9ICXA 9ICUA 2NV3A 1PVPA 5T14A 3EZ5A 3SENA 3Q8QB 2LI6A 4DLEA 5HMLA 4QZ8A 2W9CB 4P4MA 2ASDA 4Y2PA 1O08A 1ZD5A 5ALSA 4PHAA 2ZIUA 3DEEA 2A1JA 4EEKA 5CB1A 5J2AA 4BXOA 2Y0SF 4UATA 3JPQA 2W7PA 4X5VA 3MFHA 4F2SA 2LYAA 1MQ2A 3ISDA 2F76X 4UAVA 4O3RA 1ZQCA 4C8NA 4RT3A 1QSLA 4PGYA 5EWFA 7ICUA 3ISCA 3ZDCA 2WAQC 1M6YA 1S0VA 2BCUA 3LWMA 2FLNA 4RQ5A 1RG6A 5KG1A 5KT3A 2BHNA 3J81j 5KFEA 2F1HA 3UXOA 5DLFA 4BGDA 1KTQA 2ZXHA 4ZH4A 3H0LB 1RPLA 3F2BA 3MBYA 3SI8A 1ZQSA 4TUSA 4BJQA 4O5EA 2OHFA 3EUB2 2E8MA 3C2LA 5KNIA 1U49A 3JPTA 1DXSA 3GU3A 9ICKA 2B6GA 5DDMA 1WUDA 4LZGA 3N7SC 3C5FA 4MF2A 2AH5A 2W9AA 5L1KA 1KFDA 2N1RA 5FP0A 2DWQA 4UBCA 3MABA 2HSZA 2PI5A 2XCAA 3NASA 2LKYA 4M9LA 4Q44A 1TK5A 2LHTA 4HYKA 2AJQA 1RM6C 9ICAA 4R65A 3N4MB 3RR8A 4DQRA 3QU7A 2DQNB 2ZTEA 3C1ZA 5DGAA 1UA0A 2B0CA 4C8KA 4AYBC 2MRLA 1FFUA 4KMUA 8ICMA 3KOOA 3M9OB 5DKWA 1A6SA 5KFOA 5EWGA 4QWCA 4TUPA 1ZXIA 1X40A 2BCSA 4B6JA 3OPXA 2WTFA 3WK9A 1SKRA 3H0MB 3HP6A 1VJ5A 4M9NA 2JEGA 3T5LA 3H4BA 1BPYA 1VLBA 2E1EA 5KFVA 4KLMA 2XIDA 2NYVA 5TISU 4DCCA 5D46A 2W9CA 3M1YA 4UB6U 1ZJMA 7ICRA 5ALEA 5KT6A 1NJXA 4EZ6A 3KHLA 5ALPA 5J2FA 3QU2A 1D8YA 2IOFA 2ZJ8A 4NLCA 3TADC 4UAZA 3ED5A 3RBEA 4P0PB 4R63A 3NGDA 1XWLA 1U4BA 2BCVA 4UQGA 1H38A 1S97A 5DLGA 1RYUA 1K5OA 5DB6A 5KFGA 3PO5A 3D6JA 9ICIA 4J9MA 5DGBA 4F5RA 2OM6A 1L7NA 4PHPA 3FYHA 1JN3A 5JTIA 4GFJA 2XY6A 3KHRA 1QQ6A 2YY6A 5C5JA 2PKEA 5KFDA 1L3VA 3QX7A 2RRDA 3Q8LA 2W9MA 3OTQA 2Y9UA 1JMSA 3KFUF 1JRPA 1S0MA 2ZIWB 3K1RB 5CHGA 2ASLA 4QZHA 5HHIA 4RQ4A 3EYZA 4DOAA 2F44A 5AKGA 4KLOA 1Y88A 2WF9A 4TUQA 4GXJA 2J6TA 4O3PA 4KLLA 2LM4A 4ECWA 1MSWD 1WYGA 5HR7A 1QH9A 7ICGA 3V72A 3Q8KA 1SV0C 3RJIA 3M8SA 1SIJA 4JB3A 3GILA 4F50A 4J9QA 2G07A 2HBKA 3AN1A 1KKXA 1F44A 2KSOB 2KIWA 2HHSA 1TAUA 3PR5B 3CP8A 3WU2U 2HBMA 5EE0A 3PW2A 5L1LA 4B9TA 5EWEA 4I2HA 4CF3A 5J2IA 2W03A 1LB2B 3H4DA 5KFKA 2PXIA 2PFPA 2Y1JA 4UB2A 5ALJA 4ED1A 2Q0ZX 1N48A 1JUDA 5KAFU 3WKAA 1Z00B 1B22A 2KVCA 3E58A 4OO1J 5DQGA 1XU4A 2LYBA 2QKQA 4PZOA 4DSKA 1EXNA 1OW5A 8ICNA 1Z1VA 3SAHA 1HIWA 3L4PA 4NLNA 4XUSA 3AEVA 3GFKB 3UMGA 3ICXA 3PX6A 1ZQRA 1ZQAA 5KFWA 5ALUA 1N56A 2IA6A 2KKPA 2DUYA 3I1YA 2G5HB 4EX6A 4QWAA 3KHGA 3KD3A 1ZQUA 5KFNA 1TVAA 4F72A 1ZRMA 2ZTDA 2ZIVB 3RH4A 1BPEA 2K8AA 5J0QA 2ZJAA 3E0FA 3ETRA 1XC9A 4DSFA 5F3XB 4IR1A 2J6UA 5ALXA 4RNNA 4UAYA 1K1QA 4XA5A 4CRXA 4DO9A 9ICWA 5ALMA 3HW8A 1PK1B 3G6YA 1ZQNA 4P0PA 2BPCA 3TAPA 1DK3A 2W11A 3SV3A 3UMBA 3U26A 3TADA 4RU9A 3MDCA 2J6SA 4P0QB 4DFMA 2FI1A 1NKBA 1KBUA 2XI9A 4C80A 3H7IA 2YB4A 2FDRA 3RJFA 3QU5A 2R8JA 4DLGA 4F4KA 5AKXA 4P4PA 4EENA 7ICQA 2XGPA 5ALYA 2I6XA 3C1YA 2YTUA 1TK8A 1KRPA 1L7PA 5L9XA 3RTVA 4LZDA 3IV6A 2BDUA 2KEYA 2ZIWA 2C28A 2RQ5A 5ALKA 4NM2A 1DRGA 2BCRA 1WG8A 5B5EU 5AKJA 9ICJA 4QWEA 3PX4A 4CF5A 4ECZA 2ESEA 5IIMA 4ECSA 2R8GA 2K4EA 4QWDA 1QLNA 4EBDA 5HHHA 1BPDA 4UB1A 1S8OA 4RPZA 2RDIA 2FPLA 3GV8B 3QYPA 1L6NA 4IRDA 4Z6DA 4EELA 4U6PA 1Z4NA 3PNCA 2H3ZA 1SV0A 2KSOA 5JRTA 2JV3A 5AKYA 2H3VA 2JGAA 4YQWA 5KFHA 2NRWA 4ECTA 5AM3A 2YN4A 5J0SA 2H3QA 2F1JA 2XO7A 4UB4A 2ODGA 4FE3A 4QIWF 3RFAA 1PUZA 2DPJA 1Z00A 3WK4A 2LBOA 1UCVA 8ICQA 4UBBA 1KW4A 3GQCA 3L3FX 1ZQVA 1VDVA 4Y2UA 1T8EA 1J97A 4ELUA 1N2XA 4IS7A 5KL8B 1PZNA 2DKXA 4MEYA 4QZFA 2QB0B 2JMGA 4Y2XA 1NJYA 3AM9A 2E3TA 4RQ1A 2H3IA 1OUQA 3EPIA 5G5GA 9ICCA 4J9PA 1T7PA 2EQYA 1ZD4A 4TQRA 8ICIA 3SV4A 2W43A 4K4HA 3NS1A 4B9VA 1BVSA 2KD1A 2MU2A 2KJ5A 2HVHA 4DS5A 3BQ7A 4RUAA 1ZQFA 1BNOA 5KFTA 5KG5A 2DGZA 4RQ0A 3OGUA 1O03A 4F2RA 3PSIA 2XVTA 2E8NA 5K4LA 3HKZF 1PK1A 4OJOA 2KICA 4DEZA 4FZMA 4UW9A 4F92B 1ZETA 2O6KA 4P0QA 3MGHA 3O0FA 3WK7A 4Q43A 3H8MA 4PZNA 1SL1A 2KZZA 5KFSA 2R8IA 2C2DA 2PFOA 1N62A 1Z3EB 3PW5A 4C4TA 1N63A 4QZEA 3UQ2A 1CRXA 3OSNA 3PY8A 1X42A 4A8EA 4F93B 2IHNA 5DBBA 2YMQA 5CR0A 2EZYA 2KNJA 1JXLA 3F5EA 5DG9A 4J9SA 4NL9A 3B9JA 4O9MA 2FLPA 2JEIA 5AI4A 5AKKA 2AGOA 4F4YA 3B0YA 1U48A 2AU0A 4PGXA 5L1IA 1ZOLA 3GV7B 4E0DA 5KT2A 2XC9A 5AM2A 2IMWP 8ICWA 1TAQA 4JV2A 1KFTA 1MN8A 4YXJA 1XNSA 4O3QA 4PHEA 5AKLA 3PV8A 4YR3A 3RB0A 1Q3UA 3QZ7A 1PVQA 4ED2A 2D6FC 3QXGA 5AIBA 8ICXA 2KKVA 4UB3A 2GLEA 2WF5A 3T3FA 1FIQA 3RBDA 1SL0A 2LMRA 1IV8A 1S76D 4DWIA 4YCXA 3VC8A 4Z6CA 2FPMA 3LVWA 2RLTA 1MA7A 9ICVA 3QU9A 4F5QA 5KG3A 2JH1A 4GXIA 2W54A 3LK9A 5JU5A 2FMSA 5KFAA 3V7KA 5KFPA 4QZ9A 2OXOA 3CRXA 2QB0A 1NK7A 2FMQA 2IOFK 1ZQWA 5AI5A 3GV5B 3V7JA 3QE9Y 2EAPA 2BDPA 1ZQEA 1CEZA 1SGGA 5GTIU 8ICBA 4I2BA 2KHVA 3BDPA 1BGXT 3C23A 3RRGA 1MC8A 3DDHA 2E8OA 4RQ7A 2JRZA 2BCQA 1PVRA 2Y1IA 2CN1A 3RAQA 4ELTA 9ICSA 4I2EA 5KG2A 2ATLA 2WB1F 4Z6EA 9ICGA 1LKYB 1TK0A 4PL2A 1ZQOA 1RYRA 4JK1A 3NRWA 3TI0A 2XICA 3N28A 4GC7A 4JWMA 5ALFA 9ICMA 3PW0A 2KV2A 3M6KA 4K4IA 5KFZA 2ZUBA 5BPCA 5KFCA 3V6KA 4NY8A 2BPFA 1L3UA 3MGIA 3NRZA 3GIIA 2LYHA 1ZQMA 4RQ6A 2XY5A 4RNOA 4ED7A 2K4IA 5J0TA 5AM1A 1L3SA 3UPQA 2P6UA 3SEIA 3A0HU 1KL9A 1RZTA 3PMNA 3HILA 2H5XA 2CRXA 1PK3A 4IQVA 1WWVA 2AQ0A 8ICJA 4KLJA 1NJWA 2DFLA 4J9LA 1SWWA 4RQMA 1ECWA 2ZG6A 2PFNA 3QUCA 2WHEA 4JUZA 3RF9A 4B9NA 2Y0SC 1COKA 5BOMA 4KTQA 4ED0A 2JR5A 3T5JA 1ZQBA 5JUMA 4B9LA 1F0MA 2RDJA 8ICGA 7ICHA 2M0NA 2KN7A 2IBKA 3ONNA 9ICHA 3PX0A 8ICYA 3ZDBA 1QSSA 3SAFA 4O0IA 3RH5A 3M9NB 3BS7A 3ORYA 4TURA 3AMZA 3MR3A 2F2AB 5BOLA 2R8KA 1YZ7A 4NLBA 2E1FA 1XO0A 4ECXA 4DL4A 4DQPA 4I28A 4EYIB 3BZCA 4CE6A 3BJYA 4UB8U 5ALZA 3V7LA 3ZD9A 3N97B 2PI4A 1QSYA 4P4OA 5DG7A 3A0BU 5KFYA 2UVUA 5G5HA 8ICRA 3MDAA 4NWIA 1XSLA 1X6JA 2HMXA 3JPRA 4F5NA 4C7ZA 2P35A 3UMCA 2FLLA 2HVIA 4DL6A 1URJA 3RB3A 4G3IA 4DQQA 2P6RA 4M9GA 4F5OA 5DBAA 4EYHB 2B21A 4FFDA 3BZKA 4RQ3A 4YR2A 4O5KA 3OJSA 1S77D 2W04A 5EE1A 4PJ0U 2WB1C 3V6JA 1JIHA 7ICIA 3D2SA 4OJPA 1X66A 4QJFB 5J2CA 4IL6U 8ICCA 2H3FA 4NLGA 2RP5A 2V9WA 2VANA 1LKYA 4PGQA 5AI9A 2VA2A 8ICHA 2XGQA 1NK4A 3HWTA 5GTHU 3GIKA 2WF8A 1UPHA 2F1IA 4GXKA 4QNLA 1YZ6A 1KSPA 3AU2A 3SMVA 4C8OA 1L3TA 2UVWA 4F4XA 2PMZF 1IXRA 5DB8A 9ICQA 4ECVA 4ICAA 3RH6A 2FPKA 7ICJA 4ECQA 2QARB 2OH2A 2OWOA 2QB1A 3HX0A 1QTMA 3TQ1A 2VA8A 1NK6A 1IG6A 3N7PD 4DSJA 1X9WA 2LM1A 4YD1A 1NK8A 3ALRA 4IR9A 1D9DA 3C28A 5ALTA 4UAUA 4C0ZA 3SAGA 4RQNA 1FFVA 2K89A 3Q8MA 3H40A 1NZPA 4O5CA 2KZ3A 2W9BB 2XCPA 2MA1A 4RT2A 2YX8A 4K4GA 5F9LA 5KT4A 4DF8A 1L8LA 3VCBA 4CNQA 3JPOA 3RJJA 3H8SA 4B9MA 1TFRA 4CDGA 3CNHA 5IIOA 4F8RA 3QNMA 2MSNA 1ZQJA 4KLFA 2ALZA 4EX7A 4NL9C 2FE9A 1JX4A 3ZDAA 4I29A 5DQHA 4OJ6A 4DSIA 2K4HA 5CA7A 5DB9A 3Q8RB 5CEHA 4UASA 8ICOA 8ICPA 5CRXA 1AQ6A 3ZDDA 4PH5A 3PW4A 5KG7A 4ECRA 1ZYQA 5KFUA 2EH9A 1B43A 2K4PA 4Q45A 2UVVA 5AI0A 2ZUCA 3JPSA 4UARA 4ED8A 2UVRA 4MFAA 1WCNA 2VKQA 3M8RA 3ISBA 4GIBA 4M04A 4MF8A 4Y2VA 2BR0A 2EZZA 5KTQA 2AHOB 2HHVA 4PHDA 3H8WA 3H0RB 4QW8A 3UXNA 2EAMA 1Q3VA 3QZ8A 1LV5A 5J0OA 2A3VA 2ISOA 2JEJA 5J0YA 7ICNA 2VIXA 4EZ9A 1L5UA 3SR6A 4EBEA 1COOA 5DB7A 1ZQQA 4JV1A 1JALA 4IRCA 2C22A 3WKDA 4UB5A 1QQ7A 5J2DA 4ELVA 5ALOA 2W7OA 2G5IB 2QARA 4HAIA 3SD7A 8ICFA 1T94A 4MHVA 3JPNA 1X6IA 4KN7A 5C0YA 1X9SA 1RQNA 1HUOA 3AQFA 5KFIA 5KFJA 4IQWA 5AKZA 2D3DA 2HCFA 5J29A 9ICOA 4J9OA 3G6VA 4YMNA 2ZIVA 3M6ZA 3PSTA 2AGQA 3RB4A 2R18A 5AM5A 3WK5A 3H8JA 1S9FA 3PSPA 4KX5A 3I76A 3TKAA 2HHXA 1L7MA 2JZBB 3F5AA 4USAA 1SL2A 5KFQA 3DV9A 1QQ5A 4F71A 5D4BA 5J0XA 3T5HA 2ZTCA 4DFPA 2GO7A 2KK0A 1F5SA 2LPEA 5D49A 4PPXA 3TARA 3NVYA 4FO6A 2KP7A 5ALGA 7ICTA 1KN5A 5AKIA 5J2HA 4Z6FA 5A0LA 2OYYA 3AL0B 1WCLA 2V4QA 2RHFA 2WF7A 4DL5A 1X2IA 1NNLA 5DQIA 4Y2YA 1N5WA 2VJ4A 4F5PA 1OXJA 3EWAA 4MFFA 5HMMA 2F8LA 4YMMA 5J2GA 1ZJNA 2NRZA 4O3SA 3FDSA 2DL0A 1RDFA 1FEZA 1CUKA 1TAMA 1RYSA 3ETLA 8ICTA 4ED6A 5J0PA 4DQIA 2NO5A 3GZFA 7ICMA 4KLIA 1ZQGA 3OHAA 4O3OA 2KVSA 2MAXA 4DOBA 5EOZA 5J2JA 7ICLA 4DS4A 1NKEA 1ZQHA 3CW2C 5CP2A 5AKHA 7ICVA 5EE9A 4DFKA 1DGSA 3I28A 1ZQKA 3TAQA 2HBJA 4QZAA 1C20A 4QIWC 4ED3A 3F2DA 3BQ1A 4U7CA 3FAHA 1BPXA 3C29A 5KT7A 4PL1A 3EPGA 3HPOA 3HJEA 1U9LA 3PVXA 1T3QA 2WF6A 5HR6A 1MQ3A 1NI3A 3K1ZA 4I2CA 5KL1B 5ALLA 5KAIU 5H2FU 8ICKA 2IHMA 4MFCA 3QUQA 2K8CB 2W3RA 4J9NA 3BQTA 4I27A 3GDXA 4IQUA 4O3NA 3MR6A 3UXPA 1IM4A 2ASJA 3BS5B 2NRXA 3THVA 3Q8PB 4C4RA 5AICA 2DPIA 1SXDA 4ECUA 1KFSA 1HUZA 1JI7A 4BWJA 1KEJA 3RJHA 3MC1A 3WK8A 4I2DA 3HKZC 1JXEA 1ZQIA 1ZQDA 2IOHA 2JZBA 5ALWA 1J2MA 4QW9A 3MR5A 2R8HA 1NK9A 4OCZA 1FO4A 4F4WA 2G0AA 2E5SA 2I9GA 5KFMA 2ZIXB 3LDAA 4KLUA 1B4FA 8ICVA 4KX3A 9ICNA 5AIAA 2W8LA 3QEAZ 2W3SA 3JPPA 5AHXA 2OEHA 5J2BA 5J8YC 5ALQA 4F3OA 4NLKA 4JWNA 1A0PA 3OHBA 3AQEA 1P7DA 1HJPA 4RUCA 3FC4A 1TE2A 3T5KA 2OCEA 1BPZA 2EDUA 4FZNA 2HOFA 7ICPA 2KE7A 4M9JA 5IINA 1KLNA 4B9SA 4YR0A 2G09A 1GO3F 3K75D 5IIKA 1U45A 1N5XA 2ZXIA 4Q8EA 4US9A 3TANA 3RJGA 2HI0A 2A1AA 3IRUA 3TACB 1XSNA 1C7YA 1UT8A 4KMOB 1ED1A 4YD2A 1D8BA 4EEYA 3K4GA 4I2FA 1V97A 1ZQ1C 3HRDD 1N60A 4R66A 3QUBA 4QZDA 4R8UB 1L8OA 2DKZA 4DL2A 5KFRA 1ZQZA 2ZJ5A 1XO1A 1D8LA 4KLQA 1SV4A 3RJEA 2HHWA 3C2MA 2DF4B 4C8LA 3D2QA 1NZBA 3IG8A 2F3NA 3LVVA 4ACOA 4KLEA 2D8CA 2HHUA 4XQ8A 4KLGA 4B9UA 3SQIA 4KLHA 1Z4OA 5KG4A 5E79U 4OD0A 4KN4A 2BZFA 1AROP 4I2JA 2AGPA 5F9NA 8ICLA 7ICFA 3SYZA 2CPRA 2M9NA 4M9HA 2NRVA 1Z1BA 2BQUA 3OSPA 2GWSA 9ICPA 4QZIA 3WKEA 4RQ2A 2WFAA 3NUQA 5TZVA 4YMOA 1ZQLA 2YQEA 3QEBZ 5CWRA 2A19A 1A77A 1SZPA 3IG5A 4FBTA 4RZRA 4CGZA 5B66U 4Y2JA 5ALNA 3OJUA 3MGVA 2Z7JA 5DDYA
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 4M2Y A;  1ZRN A;  2YB1 A;  5KFF A;  1Z19 A;  4LJX A;  3V6H A;  5J2E A;  1RQL A;  3KKA C;  2YMM A;  3BS5 A;  5AK3 A;  4C4S A;  5EE3 A;  3ZDE A;  4BDP A;  2P66 A;  3KTQ A;  5IIJ A;  2KFN A;  4FS1 A;  4M0A A;  9ICT A;  4DSL A;  3B0X A;  3C21 A;  8ICU A;  2YMP A;  2FMP A;  3WKC A;  3RR7 A;  1V9P A;  2AQ4 A;  2MUT B;  1XSP A;  3M7D A;  4Y2Q A;  2GH1 A;  3NVW A;  8ICZ A;  3PSF A;  4KIT B;  4FBU A;  2EZX A;  2DBY A;  2YML A;  1JRO A;  2ZIX A;  1ZQX A;  2AXT U;  1X9M A;  1CI4 A;  9ICE A;  4RPX A;  2W55 A;  3NVV A;  4RQ8 A;  1ZQT A;  4DFJ A;  5J0U A;  2L5Y A;  3NVZ A;  2HOI A;  2JEF A;  4KLT A;  4EBC A;  4TQS A;  2VJ5 A;  1KQQ A;  1NJZ A;  5J8Y A;  4DF4 A;  4BX9 C;  4YP3 A;  2BPG A;  5ALD A;  4DL7 A;  2NO4 A;  1S0N A;  2G06 A;  5HNK A;  2BQR A;  5KT5 A;  7ICE A;  5DG8 A;  2KIV A;  5KFB A;  3ZD8 A;  4I2A A;  1ZD3 A;  2QLT A;  1V38 A;  2EAO A;  3F2C A;  3S6J A;  4AP9 A;  4WJ3 B;  4KLS A;  2F77 X;  2GOL A;  1BNP A;  3BQ2 A;  1S10 A;  5ALI A;  1RXW A;  4P2H A;  4FZL A;  4XRH A;  3PW7 A;  1XS9 D;  9ICB A;  3PML A;  3KBB A;  1X9X A;  4YVZ A;  2EAN A;  4R64 A;  4M47 A;  1D9F A;  4R8U A;  1IIP A;  1TV9 A;  2FJ6 A;  9ICF A;  7ICO A;  3UQ0 A;  4CCH A;  1S5L U;  2KMD A;  4Y2R A;  5AK4 A;  3ZI4 A;  1SZH A;  5AK6 A;  3CYM A;  3PO4 A;  1NOM A;  2Y9T A;  1DOQ A;  3IDW A;  1QCK A;  1SXE A;  2BGW A;  4IQT A;  4QZB A;  1HEK A;  4DQS A;  3E2E A;  3C5G A;  7ICK A;  3TFS A;  3G6X A;  2HHT A;  4OJL A;  2BQ3 A;  1UA1 A;  3KHH A;  3QU4 A;  2W8K A;  2PFQ A;  1KDH A;  4NV0 A;  4F4Z A;  1YT3 A;  4QZC A;  2KG5 A;  4G9B A;  1RXV A;  1BPB A;  4M6W B;  2KTQ A;  2E8P A;  5KFX A;  4LVS A;  2KFZ A;  1L7O A;  4NLZ A;  1T4G A;  1V85 A;  5ALR A;  2KZM A;  2V4R A;  1SKW A;  3SZ2 A;  3WK6 A;  2I1Q A;  1ZD2 P;  5IIL A;  4BWM A;  5HP4 A;  4IRK A;  4BUG A;  5J2K A;  3PZP A;  5J0W A;  3HT3 A;  2C2E A;  4UAW A;  5AKE A;  4J9R A;  1T3N A;  8ICA A;  2Q4T A;  3BQ0 A;  5AM0 A;  3RRH A;  4DL3 A;  3KKA A;  3WKB A;  1SB3 C;  4F91 B;  2ZIU B;  2A1J B;  4ECY A;  2MUT A;  3L5K A;  1DGJ A;  5L1J A;  4BXO B;  4DOC A;  4RNM A;  5KG6 A;  4C7Y A;  5J0R A;  4I2G A;  5ALH A;  3IN5 A;  3R9K A;  4RPY A;  2I5H A;  2PMZ C;  2BKE A;  5AM4 A;  3IM1 A;  5CJ7 A;  1Q8K A;  2JXJ A;  3LWL A;  4Y2S A;  3IHQ B;  1UT5 A;  3TFR A;  4YFK A;  3AU6 A;  1SWV A;  1Q46 A;  4GLX A;  2JHD A;  2F8K A;  3T79 A;  2HHQ A;  1NK0 A;  2HOQ A;  9ICR A;  2VA3 A;  4YG2 A;  2WAQ F;  3UM9 A;  4US8 A;  3D2N A;  4JMU A;  4NXZ A;  3PR4 A;  3C2K A;  2KOB A;  4JV0 A;  4YXM A;  5KG0 A;  1NK5 A;  2ES6 A;  8ICE A;  1WWU A;  3QUT A;  4C8M A;  4DFD A;  1K1S A;  4O3M A;  3KZI U;  2W9B A;  4Q8F A;  3F53 A;  1J2N A;  5AK5 A;  1UQV A;  5AI6 A;  2KJ8 A;  3LYS A;  4J9K A;  3MR2 A;  3RB6 A;  4NJ8 A;  4Y2T A;  4MEX A;  4YN4 A;  3N7R C;  4QWB A;  3KZX A;  2ZUD A;  4GC6 A;  3NTU A;  3RAX A;  2HDO A;  2KJ9 A;  2HBL A;  3MFI A;  5III A;  5AI8 A;  1U47 A;  2G08 A;  1B0X A;  5KFL A;  3Q8S B;  3EW9 A;  1S0O A;  5ALV A;  1N61 A;  1NKC A;  1SKS A;  4J03 A;  1UHU A;  4FS2 A;  2C2R A;  4I2I A;  4ZOH C;  2CXY A;  3AUO A;  1ZQP A;  3GIM A;  4NM1 A;  1DK2 A;  2ISP A;  3M9M B;  2HW3 A;  3FM9 A;  3RJK A;  5DBC A;  4IC9 A;  2NRT A;  3GIJ A;  2XY7 A;  2K8B B;  4DSE A;  4AYB F;  4OJ5 A;  4KLD A;  1A76 A;  1ZQY A;  8ICS A;  2KHQ A;  5L1M A;  2K60 A;  2JH7 A;  3IP4 B;  4M6W A;  7ICS A;  4CF4 A;  9ICL A;  4QZG A;  1LVH A;  1TKD A;  9ICX A;  9ICU A;  2NV3 A;  1PVP A;  5T14 A;  3EZ5 A;  3SEN A;  3Q8Q B;  2LI6 A;  4DLE A;  5HML A;  4QZ8 A;  2W9C B;  4P4M A;  2ASD A;  4Y2P A;  1O08 A;  1ZD5 A;  5ALS A;  4PHA A;  2ZIU A;  3DEE A;  2A1J A;  4EEK A;  5CB1 A;  5J2A A;  4BXO A;  2Y0S F;  4UAT A;  3JPQ A;  2W7P A;  4X5V A;  3MFH A;  4F2S A;  2LYA A;  1MQ2 A;  3ISD A;  2F76 X;  4UAV A;  4O3R A;  1ZQC A;  4C8N A;  4RT3 A;  1QSL A;  4PGY A;  5EWF A;  7ICU A;  3ISC A;  3ZDC A;  2WAQ C;  1M6Y A;  1S0V A;  2BCU A;  3LWM A;  2FLN A;  4RQ5 A;  1RG6 A;  5KG1 A;  5KT3 A;  2BHN A;  3J81 j;  5KFE A;  2F1H A;  3UXO A;  5DLF A;  4BGD A;  1KTQ A;  2ZXH A;  4ZH4 A;  3H0L B;  1RPL A;  3F2B A;  3MBY A;  3SI8 A;  1ZQS A;  4TUS A;  4BJQ A;  4O5E A;  2OHF A;  3EUB 2;  2E8M A;  3C2L A;  5KNI A;  1U49 A;  3JPT A;  1DXS A;  3GU3 A;  9ICK A;  2B6G A;  5DDM A;  1WUD A;  4LZG A;  3N7S C;  3C5F A;  4MF2 A;  2AH5 A;  2W9A A;  5L1K A;  1KFD A;  2N1R A;  5FP0 A;  2DWQ A;  4UBC A;  3MAB A;  2HSZ A;  2PI5 A;  2XCA A;  3NAS A;  2LKY A;  4M9L A;  4Q44 A;  1TK5 A;  2LHT A;  4HYK A;  2AJQ A;  1RM6 C;  9ICA A;  4R65 A;  3N4M B;  3RR8 A;  4DQR A;  3QU7 A;  2DQN B;  2ZTE A;  3C1Z A;  5DGA A;  1UA0 A;  2B0C A;  4C8K A;  4AYB C;  2MRL A;  1FFU A;  4KMU A;  8ICM A;  3KOO A;  3M9O B;  5DKW A;  1A6S A;  5KFO A;  5EWG A;  4QWC A;  4TUP A;  1ZXI A;  1X40 A;  2BCS A;  4B6J A;  3OPX A;  2WTF A;  3WK9 A;  1SKR A;  3H0M B;  3HP6 A;  1VJ5 A;  4M9N A;  2JEG A;  3T5L A;  3H4B A;  1BPY A;  1VLB A;  2E1E A;  5KFV A;  4KLM A;  2XID A;  2NYV A;  5TIS U;  4DCC A;  5D46 A;  2W9C A;  3M1Y A;  4UB6 U;  1ZJM A;  7ICR A;  5ALE A;  5KT6 A;  1NJX A;  4EZ6 A;  3KHL A;  5ALP A;  5J2F A;  3QU2 A;  1D8Y A;  2IOF A;  2ZJ8 A;  4NLC A;  3TAD C;  4UAZ A;  3ED5 A;  3RBE A;  4P0P B;  4R63 A;  3NGD A;  1XWL A;  1U4B A;  2BCV A;  4UQG A;  1H38 A;  1S97 A;  5DLG A;  1RYU A;  1K5O A;  5DB6 A;  5KFG A;  3PO5 A;  3D6J A;  9ICI A;  4J9M A;  5DGB A;  4F5R A;  2OM6 A;  1L7N A;  4PHP A;  3FYH A;  1JN3 A;  5JTI A;  4GFJ A;  2XY6 A;  3KHR A;  1QQ6 A;  2YY6 A;  5C5J A;  2PKE A;  5KFD A;  1L3V A;  3QX7 A;  2RRD A;  3Q8L A;  2W9M A;  3OTQ A;  2Y9U A;  1JMS A;  3KFU F;  1JRP A;  1S0M A;  2ZIW B;  3K1R B;  5CHG A;  2ASL A;  4QZH A;  5HHI A;  4RQ4 A;  3EYZ A;  4DOA A;  2F44 A;  5AKG A;  4KLO A;  1Y88 A;  2WF9 A;  4TUQ A;  4GXJ A;  2J6T A;  4O3P A;  4KLL A;  2LM4 A;  4ECW A;  1MSW D;  1WYG A;  5HR7 A;  1QH9 A;  7ICG A;  3V72 A;  3Q8K A;  1SV0 C;  3RJI A;  3M8S A;  1SIJ A;  4JB3 A;  3GIL A;  4F50 A;  4J9Q A;  2G07 A;  2HBK A;  3AN1 A;  1KKX A;  1F44 A;  2KSO B;  2KIW A;  2HHS A;  1TAU A;  3PR5 B;  3CP8 A;  3WU2 U;  2HBM A;  5EE0 A;  3PW2 A;  5L1L A;  4B9T A;  5EWE A;  4I2H A;  4CF3 A;  5J2I A;  2W03 A;  1LB2 B;  3H4D A;  5KFK A;  2PXI A;  2PFP A;  2Y1J A;  4UB2 A;  5ALJ A;  4ED1 A;  2Q0Z X;  1N48 A;  1JUD A;  5KAF U;  3WKA A;  1Z00 B;  1B22 A;  2KVC A;  3E58 A;  4OO1 J;  5DQG A;  1XU4 A;  2LYB A;  2QKQ A;  4PZO A;  4DSK A;  1EXN A;  1OW5 A;  8ICN A;  1Z1V A;  3SAH A;  1HIW A;  3L4P A;  4NLN A;  4XUS A;  3AEV A;  3GFK B;  3UMG A;  3ICX A;  3PX6 A;  1ZQR A;  1ZQA A;  5KFW A;  5ALU A;  1N56 A;  2IA6 A;  2KKP A;  2DUY A;  3I1Y A;  2G5H B;  4EX6 A;  4QWA A;  3KHG A;  3KD3 A;  1ZQU A;  5KFN A;  1TVA A;  4F72 A;  1ZRM A;  2ZTD A;  2ZIV B;  3RH4 A;  1BPE A;  2K8A A;  5J0Q A;  2ZJA A;  3E0F A;  3ETR A;  1XC9 A;  4DSF A;  5F3X B;  4IR1 A;  2J6U A;  5ALX A;  4RNN A;  4UAY A;  1K1Q A;  4XA5 A;  4CRX A;  4DO9 A;  9ICW A;  5ALM A;  3HW8 A;  1PK1 B;  3G6Y A;  1ZQN A;  4P0P A;  2BPC A;  3TAP A;  1DK3 A;  2W11 A;  3SV3 A;  3UMB A;  3U26 A;  3TAD A;  4RU9 A;  3MDC A;  2J6S A;  4P0Q B;  4DFM A;  2FI1 A;  1NKB A;  1KBU A;  2XI9 A;  4C80 A;  3H7I A;  2YB4 A;  2FDR A;  3RJF A;  3QU5 A;  2R8J A;  4DLG A;  4F4K A;  5AKX A;  4P4P A;  4EEN A;  7ICQ A;  2XGP A;  5ALY A;  2I6X A;  3C1Y A;  2YTU A;  1TK8 A;  1KRP A;  1L7P A;  5L9X A;  3RTV A;  4LZD A;  3IV6 A;  2BDU A;  2KEY A;  2ZIW A;  2C28 A;  2RQ5 A;  5ALK A;  4NM2 A;  1DRG A;  2BCR A;  1WG8 A;  5B5E U;  5AKJ A;  9ICJ A;  4QWE A;  3PX4 A;  4CF5 A;  4ECZ A;  2ESE A;  5IIM A;  4ECS A;  2R8G A;  2K4E A;  4QWD A;  1QLN A;  4EBD A;  5HHH A;  1BPD A;  4UB1 A;  1S8O A;  4RPZ A;  2RDI A;  2FPL A;  3GV8 B;  3QYP A;  1L6N A;  4IRD A;  4Z6D A;  4EEL A;  4U6P A;  1Z4N A;  3PNC A;  2H3Z A;  1SV0 A;  2KSO A;  5JRT A;  2JV3 A;  5AKY A;  2H3V A;  2JGA A;  4YQW A;  5KFH A;  2NRW A;  4ECT A;  5AM3 A;  2YN4 A;  5J0S A;  2H3Q A;  2F1J A;  2XO7 A;  4UB4 A;  2ODG A;  4FE3 A;  4QIW F;  3RFA A;  1PUZ A;  2DPJ A;  1Z00 A;  3WK4 A;  2LBO A;  1UCV A;  8ICQ A;  4UBB A;  1KW4 A;  3GQC A;  3L3F X;  1ZQV A;  1VDV A;  4Y2U A;  1T8E A;  1J97 A;  4ELU A;  1N2X A;  4IS7 A;  5KL8 B;  1PZN A;  2DKX A;  4MEY A;  4QZF A;  2QB0 B;  2JMG A;  4Y2X A;  1NJY A;  3AM9 A;  2E3T A;  4RQ1 A;  2H3I A;  1OUQ A;  3EPI A;  5G5G A;  9ICC A;  4J9P A;  1T7P A;  2EQY A;  1ZD4 A;  4TQR A;  8ICI A;  3SV4 A;  2W43 A;  4K4H A;  3NS1 A;  4B9V A;  1BVS A;  2KD1 A;  2MU2 A;  2KJ5 A;  2HVH A;  4DS5 A;  3BQ7 A;  4RUA A;  1ZQF A;  1BNO A;  5KFT A;  5KG5 A;  2DGZ A;  4RQ0 A;  3OGU A;  1O03 A;  4F2R A;  3PSI A;  2XVT A;  2E8N A;  5K4L A;  3HKZ F;  1PK1 A;  4OJO A;  2KIC A;  4DEZ A;  4FZM A;  4UW9 A;  4F92 B;  1ZET A;  2O6K A;  4P0Q A;  3MGH A;  3O0F A;  3WK7 A;  4Q43 A;  3H8M A;  4PZN A;  1SL1 A;  2KZZ A;  5KFS A;  2R8I A;  2C2D A;  2PFO A;  1N62 A;  1Z3E B;  3PW5 A;  4C4T A;  1N63 A;  4QZE A;  3UQ2 A;  1CRX A;  3OSN A;  3PY8 A;  1X42 A;  4A8E A;  4F93 B;  2IHN A;  5DBB A;  2YMQ A;  5CR0 A;  2EZY A;  2KNJ A;  1JXL A;  3F5E A;  5DG9 A;  4J9S A;  4NL9 A;  3B9J A;  4O9M A;  2FLP A;  2JEI A;  5AI4 A;  5AKK A;  2AGO A;  4F4Y A;  3B0Y A;  1U48 A;  2AU0 A;  4PGX A;  5L1I A;  1ZOL A;  3GV7 B;  4E0D A;  5KT2 A;  2XC9 A;  5AM2 A;  2IMW P;  8ICW A;  1TAQ A;  4JV2 A;  1KFT A;  1MN8 A;  4YXJ A;  1XNS A;  4O3Q A;  4PHE A;  5AKL A;  3PV8 A;  4YR3 A;  3RB0 A;  1Q3U A;  3QZ7 A;  1PVQ A;  4ED2 A;  2D6F C;  3QXG A;  5AIB A;  8ICX A;  2KKV A;  4UB3 A;  2GLE A;  2WF5 A;  3T3F A;  1FIQ A;  3RBD A;  1SL0 A;  2LMR A;  1IV8 A;  1S76 D;  4DWI A;  4YCX A;  3VC8 A;  4Z6C A;  2FPM A;  3LVW A;  2RLT A;  1MA7 A;  9ICV A;  3QU9 A;  4F5Q A;  5KG3 A;  2JH1 A;  4GXI A;  2W54 A;  3LK9 A;  5JU5 A;  2FMS A;  5KFA A;  3V7K A;  5KFP A;  4QZ9 A;  2OXO A;  3CRX A;  2QB0 A;  1NK7 A;  2FMQ A;  2IOF K;  1ZQW A;  5AI5 A;  3GV5 B;  3V7J A;  3QE9 Y;  2EAP A;  2BDP A;  1ZQE A;  1CEZ A;  1SGG A;  5GTI U;  8ICB A;  4I2B A;  2KHV A;  3BDP A;  1BGX T;  3C23 A;  3RRG A;  1MC8 A;  3DDH A;  2E8O A;  4RQ7 A;  2JRZ A;  2BCQ A;  1PVR A;  2Y1I A;  2CN1 A;  3RAQ A;  4ELT A;  9ICS A;  4I2E A;  5KG2 A;  2ATL A;  2WB1 F;  4Z6E A;  9ICG A;  1LKY B;  1TK0 A;  4PL2 A;  1ZQO A;  1RYR A;  4JK1 A;  3NRW A;  3TI0 A;  2XIC A;  3N28 A;  4GC7 A;  4JWM A;  5ALF A;  9ICM A;  3PW0 A;  2KV2 A;  3M6K A;  4K4I A;  5KFZ A;  2ZUB A;  5BPC A;  5KFC A;  3V6K A;  4NY8 A;  2BPF A;  1L3U A;  3MGI A;  3NRZ A;  3GII A;  2LYH A;  1ZQM A;  4RQ6 A;  2XY5 A;  4RNO A;  4ED7 A;  2K4I A;  5J0T A;  5AM1 A;  1L3S A;  3UPQ A;  2P6U A;  3SEI A;  3A0H U;  1KL9 A;  1RZT A;  3PMN A;  3HIL A;  2H5X A;  2CRX A;  1PK3 A;  4IQV A;  1WWV A;  2AQ0 A;  8ICJ A;  4KLJ A;  1NJW A;  2DFL A;  4J9L A;  1SWW A;  4RQM A;  1ECW A;  2ZG6 A;  2PFN A;  3QUC A;  2WHE A;  4JUZ A;  3RF9 A;  4B9N A;  2Y0S C;  1COK A;  5BOM A;  4KTQ A;  4ED0 A;  2JR5 A;  3T5J A;  1ZQB A;  5JUM A;  4B9L A;  1F0M A;  2RDJ A;  8ICG A;  7ICH A;  2M0N A;  2KN7 A;  2IBK A;  3ONN A;  9ICH A;  3PX0 A;  8ICY A;  3ZDB A;  1QSS A;  3SAF A;  4O0I A;  3RH5 A;  3M9N B;  3BS7 A;  3ORY A;  4TUR A;  3AMZ A;  3MR3 A;  2F2A B;  5BOL A;  2R8K A;  1YZ7 A;  4NLB A;  2E1F A;  1XO0 A;  4ECX A;  4DL4 A;  4DQP A;  4I28 A;  4EYI B;  3BZC A;  4CE6 A;  3BJY A;  4UB8 U;  5ALZ A;  3V7L A;  3ZD9 A;  3N97 B;  2PI4 A;  1QSY A;  4P4O A;  5DG7 A;  3A0B U;  5KFY A;  2UVU A;  5G5H A;  8ICR A;  3MDA A;  4NWI A;  1XSL A;  1X6J A;  2HMX A;  3JPR A;  4F5N A;  4C7Z A;  2P35 A;  3UMC A;  2FLL A;  2HVI A;  4DL6 A;  1URJ A;  3RB3 A;  4G3I A;  4DQQ A;  2P6R A;  4M9G A;  4F5O A;  5DBA A;  4EYH B;  2B21 A;  4FFD A;  3BZK A;  4RQ3 A;  4YR2 A;  4O5K A;  3OJS A;  1S77 D;  2W04 A;  5EE1 A;  4PJ0 U;  2WB1 C;  3V6J A;  1JIH A;  7ICI A;  3D2S A;  4OJP A;  1X66 A;  4QJF B;  5J2C A;  4IL6 U;  8ICC A;  2H3F A;  4NLG A;  2RP5 A;  2V9W A;  2VAN A;  1LKY A;  4PGQ A;  5AI9 A;  2VA2 A;  8ICH A;  2XGQ A;  1NK4 A;  3HWT A;  5GTH U;  3GIK A;  2WF8 A;  1UPH A;  2F1I A;  4GXK A;  4QNL A;  1YZ6 A;  1KSP A;  3AU2 A;  3SMV A;  4C8O A;  1L3T A;  2UVW A;  4F4X A;  2PMZ F;  1IXR A;  5DB8 A;  9ICQ A;  4ECV A;  4ICA A;  3RH6 A;  2FPK A;  7ICJ A;  4ECQ A;  2QAR B;  2OH2 A;  2OWO A;  2QB1 A;  3HX0 A;  1QTM A;  3TQ1 A;  2VA8 A;  1NK6 A;  1IG6 A;  3N7P D;  4DSJ A;  1X9W A;  2LM1 A;  4YD1 A;  1NK8 A;  3ALR A;  4IR9 A;  1D9D A;  3C28 A;  5ALT A;  4UAU A;  4C0Z A;  3SAG A;  4RQN A;  1FFV A;  2K89 A;  3Q8M A;  3H40 A;  1NZP A;  4O5C A;  2KZ3 A;  2W9B B;  2XCP A;  2MA1 A;  4RT2 A;  2YX8 A;  4K4G A;  5F9L A;  5KT4 A;  4DF8 A;  1L8L A;  3VCB A;  4CNQ A;  3JPO A;  3RJJ A;  3H8S A;  4B9M A;  1TFR A;  4CDG A;  3CNH A;  5IIO A;  4F8R A;  3QNM A;  2MSN A;  1ZQJ A;  4KLF A;  2ALZ A;  4EX7 A;  4NL9 C;  2FE9 A;  1JX4 A;  3ZDA A;  4I29 A;  5DQH A;  4OJ6 A;  4DSI A;  2K4H A;  5CA7 A;  5DB9 A;  3Q8R B;  5CEH A;  4UAS A;  8ICO A;  8ICP A;  5CRX A;  1AQ6 A;  3ZDD A;  4PH5 A;  3PW4 A;  5KG7 A;  4ECR A;  1ZYQ A;  5KFU A;  2EH9 A;  1B43 A;  2K4P A;  4Q45 A;  2UVV A;  5AI0 A;  2ZUC A;  3JPS A;  4UAR A;  4ED8 A;  2UVR A;  4MFA A;  1WCN A;  2VKQ A;  3M8R A;  3ISB A;  4GIB A;  4M04 A;  4MF8 A;  4Y2V A;  2BR0 A;  2EZZ A;  5KTQ A;  2AHO B;  2HHV A;  4PHD A;  3H8W A;  3H0R B;  4QW8 A;  3UXN A;  2EAM A;  1Q3V A;  3QZ8 A;  1LV5 A;  5J0O A;  2A3V A;  2ISO A;  2JEJ A;  5J0Y A;  7ICN A;  2VIX A;  4EZ9 A;  1L5U A;  3SR6 A;  4EBE A;  1COO A;  5DB7 A;  1ZQQ A;  4JV1 A;  1JAL A;  4IRC A;  2C22 A;  3WKD A;  4UB5 A;  1QQ7 A;  5J2D A;  4ELV A;  5ALO A;  2W7O A;  2G5I B;  2QAR A;  4HAI A;  3SD7 A;  8ICF A;  1T94 A;  4MHV A;  3JPN A;  1X6I A;  4KN7 A;  5C0Y A;  1X9S A;  1RQN A;  1HUO A;  3AQF A;  5KFI A;  5KFJ A;  4IQW A;  5AKZ A;  2D3D A;  2HCF A;  5J29 A;  9ICO A;  4J9O A;  3G6V A;  4YMN A;  2ZIV A;  3M6Z A;  3PST A;  2AGQ A;  3RB4 A;  2R18 A;  5AM5 A;  3WK5 A;  3H8J A;  1S9F A;  3PSP A;  4KX5 A;  3I76 A;  3TKA A;  2HHX A;  1L7M A;  2JZB B;  3F5A A;  4USA A;  1SL2 A;  5KFQ A;  3DV9 A;  1QQ5 A;  4F71 A;  5D4B A;  5J0X A;  3T5H A;  2ZTC A;  4DFP A;  2GO7 A;  2KK0 A;  1F5S A;  2LPE A;  5D49 A;  4PPX A;  3TAR A;  3NVY A;  4FO6 A;  2KP7 A;  5ALG A;  7ICT A;  1KN5 A;  5AKI A;  5J2H A;  4Z6F A;  5A0L A;  2OYY A;  3AL0 B;  1WCL A;  2V4Q A;  2RHF A;  2WF7 A;  4DL5 A;  1X2I A;  1NNL A;  5DQI A;  4Y2Y A;  1N5W A;  2VJ4 A;  4F5P A;  1OXJ A;  3EWA A;  4MFF A;  5HMM A;  2F8L A;  4YMM A;  5J2G A;  1ZJN A;  2NRZ A;  4O3S A;  3FDS A;  2DL0 A;  1RDF A;  1FEZ A;  1CUK A;  1TAM A;  1RYS A;  3ETL A;  8ICT A;  4ED6 A;  5J0P A;  4DQI A;  2NO5 A;  3GZF A;  7ICM A;  4KLI A;  1ZQG A;  3OHA A;  4O3O A;  2KVS A;  2MAX A;  4DOB A;  5EOZ A;  5J2J A;  7ICL A;  4DS4 A;  1NKE A;  1ZQH A;  3CW2 C;  5CP2 A;  5AKH A;  7ICV A;  5EE9 A;  4DFK A;  1DGS A;  3I28 A;  1ZQK A;  3TAQ A;  2HBJ A;  4QZA A;  1C20 A;  4QIW C;  4ED3 A;  3F2D A;  3BQ1 A;  4U7C A;  3FAH A;  1BPX A;  3C29 A;  5KT7 A;  4PL1 A;  3EPG A;  3HPO A;  3HJE A;  1U9L A;  3PVX A;  1T3Q A;  2WF6 A;  5HR6 A;  1MQ3 A;  1NI3 A;  3K1Z A;  4I2C A;  5KL1 B;  5ALL A;  5KAI U;  5H2F U;  8ICK A;  2IHM A;  4MFC A;  3QUQ A;  2K8C B;  2W3R A;  4J9N A;  3BQT A;  4I27 A;  3GDX A;  4IQU A;  4O3N A;  3MR6 A;  3UXP A;  1IM4 A;  2ASJ A;  3BS5 B;  2NRX A;  3THV A;  3Q8P B;  4C4R A;  5AIC A;  2DPI A;  1SXD A;  4ECU A;  1KFS A;  1HUZ A;  1JI7 A;  4BWJ A;  1KEJ A;  3RJH A;  3MC1 A;  3WK8 A;  4I2D A;  3HKZ C;  1JXE A;  1ZQI A;  1ZQD A;  2IOH A;  2JZB A;  5ALW A;  1J2M A;  4QW9 A;  3MR5 A;  2R8H A;  1NK9 A;  4OCZ A;  1FO4 A;  4F4W A;  2G0A A;  2E5S A;  2I9G A;  5KFM A;  2ZIX B;  3LDA A;  4KLU A;  1B4F A;  8ICV A;  4KX3 A;  9ICN A;  5AIA A;  2W8L A;  3QEA Z;  2W3S A;  3JPP A;  5AHX A;  2OEH A;  5J2B A;  5J8Y C;  5ALQ A;  4F3O A;  4NLK A;  4JWN A;  1A0P A;  3OHB A;  3AQE A;  1P7D A;  1HJP A;  4RUC A;  3FC4 A;  1TE2 A;  3T5K A;  2OCE A;  1BPZ A;  2EDU A;  4FZN A;  2HOF A;  7ICP A;  2KE7 A;  4M9J A;  5IIN A;  1KLN A;  4B9S A;  4YR0 A;  2G09 A;  1GO3 F;  3K75 D;  5IIK A;  1U45 A;  1N5X A;  2ZXI A;  4Q8E A;  4US9 A;  3TAN A;  3RJG A;  2HI0 A;  2A1A A;  3IRU A;  3TAC B;  1XSN A;  1C7Y A;  1UT8 A;  4KMO B;  1ED1 A;  4YD2 A;  1D8B A;  4EEY A;  3K4G A;  4I2F A;  1V97 A;  1ZQ1 C;  3HRD D;  1N60 A;  4R66 A;  3QUB A;  4QZD A;  4R8U B;  1L8O A;  2DKZ A;  4DL2 A;  5KFR A;  1ZQZ A;  2ZJ5 A;  1XO1 A;  1D8L A;  4KLQ A;  1SV4 A;  3RJE A;  2HHW A;  3C2M A;  2DF4 B;  4C8L A;  3D2Q A;  1NZB A;  3IG8 A;  2F3N A;  3LVV A;  4ACO A;  4KLE A;  2D8C A;  2HHU A;  4XQ8 A;  4KLG A;  4B9U A;  3SQI A;  4KLH A;  1Z4O A;  5KG4 A;  5E79 U;  4OD0 A;  4KN4 A;  2BZF A;  1ARO P;  4I2J A;  2AGP A;  5F9N A;  8ICL A;  7ICF A;  3SYZ A;  2CPR A;  2M9N A;  4M9H A;  2NRV A;  1Z1B A;  2BQU A;  3OSP A;  2GWS A;  9ICP A;  4QZI A;  3WKE A;  4RQ2 A;  2WFA A;  3NUQ A;  5TZV A;  4YMO A;  1ZQL A;  2YQE A;  3QEB Z;  5CWR A;  2A19 A;  1A77 A;  1SZP A;  3IG5 A;  4FBT A;  4RZR A;  4CGZ A;  5B66 U;  4Y2J A;  5ALN A;  3OJU A;  3MGV A;  2Z7J A;  5DDY A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...