1UHUA

Solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
GSSGSSGTPLSLTLDHWSEIRSRAHNLSVEIKKGPWRTFCASEWPTFDVGWPPEGTFDLTVIFEVKAIVFQDGPGSHPDQQPYITVWQDLVQNSPPWIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords product of RIKEN cDNA 3110009E22
publication title Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1uhuA00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
1YZ7A 4QNLA 4M9HA 5ALLA 3GFKB 8ICQA 4QZIA 1T3NA 4NLGA 3EYZA 4Y2VA 2JV3A 4QWDA 1DRGA 4CNQA 4DLGA 1F0MA 1ZOLA 3SD7A 1UCVA 3QU5A 5A0LA 1V97A 1JUDA 2W55A 3IDWA 5AKJA 3IG5A 4RPZA 2JHDA 3PW7A 1PK1A 1TVAA 9ICKA 2JEIA 3HJEA 1A76A 3R9KA 2E8PA 4ECVA 4P4MA 5H2FU 1ZJNA 4P0PB 3V7JA 5E79U 4YR3A 4R8UA 5HR7A 1IG6A 2W03A 1KW4A 1LV5A 2BPGA 4C0ZA 2ZJ8A 4O3MA 3QYPA 2NYVA 3N97B 2LYAA 3FDSA 4C80A 1YT3A 1DK2A 2AGQA 4RPXA 4C8KA 4EBCA 5KFBA 1B0XA 2JR5A 5DQGA 1S10A 3L3FX 3AEVA 9ICFA 1WG8A 4NM1A 2DPJA 4LVSA 2ZIUA 3PNCA 5KG6A 4UAYA 1QH9A 8ICBA 4BXOB 2EZZA 4IQTA 2ZXIA 4F5OA 4J9OA 4PGYA 5D49A 5J29A 5CHGA 4B9UA 4I2FA 2LI6A 1SV4A 5DB8A 3AUOA 3TAQA 3QUBA 3OJUA 2OHFA 3IHQB 3EWAA 5AI5A 4DSJA 8ICSA 3WKDA 3MDAA 3K1ZA 4MF8A 4DEZA 4B6JA 3KTQA 2DF4B 5JU5A 3BS5B 2LMRA 4YFKA 5L1MA 2DKZA 1TAMA 3MC1A 3C2KA 3C5FA 2AQ4A 4KLUA 4Y2JA 2BPFA 1XNSA 3PY8A 1C7YA 1BVSA 4ED6A 1A0PA 3OSPA 3QUCA 5KFJA 2DBYA 2HHQA 4Y2RA 4Q45A 3LVWA 4Y2XA 3IM1A 4GXJA 3WK4A 2LM1A 2AH5A 5KFLA 2FE9A 2XCPA 1MSWD 2DFLA 4FZNA 3HILA 1ZQCA 5J2CA 2NRVA 1ZQ1C 1L3VA 1SZHA 3HKZC 3RRGA 1SV0A 3KHHA 4QIWC 5CA7A 3MGHA 3KHLA 2I5HA 5AICA 1PK3A 2BR0A 1ZQOA 5J0PA 4TUPA 2QB0A 2HW3A 1V38A 5CEHA 3IG8A 4NLNA 1WUDA 4YD1A 4RQ5A 5DBBA 9ICEA 1N63A 4CF5A 2F2AB 2ZUBA 5AIBA 1RXVA 2HVHA 2E5SA 4DOCA 1RYUA 2HHXA 5KG2A 1RXWA 4DL7A 3RB0A 4DFJA 4ECSA 1NKCA 5C5JA 4ICAA 5ALPA 2F1HA 3HKZF 4QIWF 3SV3A 1ZD3A 5HHHA 3ISCA 1S5LU 5HHIA 1JMSA 3AM9A 3WK6A 4Y2QA 2GWSA 4Z6FA 1XO0A 3HT3A 3VCBA 3UM9A 3I28A 3QE9Y 3RJGA 1L7MA 2OEHA 1X6JA 1XS9D 1SKRA 2JH1A 4RQMA 4BUGA 1A77A 5ALYA 1WWVA 4RNMA 5KFVA 5DGAA 1N5WA 5L1JA 4IQWA 1CRXA 4IS7A 4F72A 1NJXA 1N2XA 5KL1B 1S8OA 2FLLA 4KLEA 3PO4A 4UB6U 1TAUA 3UQ2A 4K4GA 1Z19A 1UT8A 1FFUA 3HPOA 3RJEA 2KG5A 5ALFA 2KSOB 4BDPA 2AQ0A 4ACOA 5AKKA 5AI9A 4O0IA 1P7DA 5J2GA 4DS5A 5AKHA 2N1RA 4NM2A 2R18A 1KBUA 3RAXA 1SXDA 2F3NA 8ICVA 4USAA 1KFSA 2A1JB 2QARB 5KG0A 2F77X 4NL9C 1ZRMA 8ICLA 2H3VA 3ICXA 3ZD8A 1S0NA 1CI4A 5DBAA 2PFOA 4I2EA 4YR2A 4Y2YA 3TACB 2OCEA 3N28A 1U45A 4KLIA 4ED1A 3BS7A 5KFEA 3MFHA 2KN7A 4C7YA 2W04A 2VA3A 1KEJA 4JUZA 1S0VA 4ECYA 1KN5A 3KD3A 5J8YA 4DL6A 2XY7A 2OM6A 4I2BA 2EQYA 2HDOA 1PUZA 2YMQA 2R8KA 3TADA 1OW5A 4F92B 4KN4A 3E0FA 5J2FA 2QLTA 3AMZA 2KOBA 3PW0A 4XRHA 3BQTA 2PMZF 3OTQA 2K4EA 4QWEA 2OH2A 1HJPA 3PV8A 1MQ2A 4KLLA 1Q46A 4DFKA 2JRZA 4FZLA 4ELVA 3WU2U 2RDJA 4K4HA 8ICFA 2HBLA 1N61A 3UMBA 5ALIA 1NKBA 1JRPA 2JZBB 1COOA 1ZD2P 1ZQBA 4K4IA 3TANA 2F8KA 2PFNA 3H7IA 5KFSA 3RBEA 3UPQA 5AM5A 5L1IA 5DB7A 2ZIVA 1L3UA 1QQ5A 4F5RA 5KFNA 4Q8EA 3C23A 2V9WA 3PO5A 2G09A 5J2AA 4EX7A 3MGIA 3RH4A 1N48A 5AKLA 3IN5A 5EE9A 4DFPA 3WK7A 3RAQA 4UBBA 4Y2PA 3I1YA 2O6KA 7ICHA 4B9TA 1ZQVA 3LWLA 1D8BA 4QWBA 1BPDA 4QZGA 5ALNA 2E3TA 3TAPA 1F44A 1V85A 2Q0ZX 1NKEA 4UW9A 3CNHA 4UQGA 5ALQA 1SKSA 5GTIU 2MAXA 4YXMA 4KLOA 2PXIA 4EBEA 3SYZA 2MSNA 4IQUA 4BJQA 1K5OA 5KG1A 4P0PA 4UASA 2BGWA 3GIKA 4QZHA 3Q8PB 3SAFA 5J0WA 5J2JA 3NVZA 5ALEA 2DGZA 2P66A 3UMGA 3M9OB 4MEXA 4M6WA 1J2NA 5DLGA 5ALSA 2HI0A 3NTUA 8ICNA 5EWFA 2KZ3A 4NLBA 2BKEA 1U48A 1ZXIA 2ATLA 3A0BU 4J9PA 5KG7A 8ICJA 5AKZA 2C2EA 3ZD9A 4DL2A 8ICCA 1UA1A 1IIPA 1LKYA 5DDMA 3RJJA 3ALRA 3V6KA 1RYRA 2WF9A 4B9NA 4O5KA 4IRCA 2ZG6A 1UA0A 2A3VA 4DL4A 4BXOA 4OJ5A 9ICXA 1AQ6A 3Q8SB 5AK5A 2DWQA 2Q4TA 3OHAA 2HHWA 3N7PD 1CEZA 3LDAA 4TUQA 4IR9A 2ZIWB 3LYSA 2E8OA 1ZRNA 4I2CA 4OCZA 4O3PA 2I1QA 1Q3VA 2RHFA 1ZQTA 4KLGA 1HIWA 5DBCA 2H3IA 3BS5A 3ETRA 2HOFA 1SL1A 3L5KA 3RH5A 3WKCA 2KK0A 4UB2A 1NK0A 4ELUA 4KX5A 3QUTA 4ECZA 4KLMA 4I2AA 4C4RA 3SQIA 1ZQFA 4F4YA 2H3QA 3C1YA 4BWMA 2ODGA 2PFPA 3GV7B 2KE7A 4OD0A 3D2QA 7ICFA 4O3OA 2EAOA 3PW5A 2GOLA 4B9LA 7ICTA 5KFIA 2KEYA 2K8AA 1ZQUA 4BGDA 3PX4A 1ZQDA 1TK5A 1T4GA 4JV0A 4QW8A 4RU9A 5ALHA 4QZBA 2IBKA 3M8RA 3G6YA 3RBDA 5J0OA 4O3NA 3HWTA 4Q44A 5KFKA 2KKVA 1RYSA 1ZQZA 2KFZA 5IIIA 2P35A 1OUQA 4BWJA 2IMWP 1M6YA 4DQSA 2HHVA 1UHUA 2G07A 2J6TA 2JEFA 2EAPA 1NK9A 1X2IA 4KLJA 3H8WA 3WKEA 1IXRA 2CPRA 3B0YA 4J9LA 3RH6A 3ISDA 1L7NA 1NNLA 5ALXA 1TK8A 4KMOB 2B6GA 9ICWA 3DV9A 2H3ZA 3GIIA 4P0QB 2FMPA 2PFQA 2RRDA 4FS1A 4O3QA 3PX6A 4BX9C 3V72A 4JV1A 3ZDBA 4CE6A 1NK5A 1X42A 2K89A 2YY6A 3H8JA 2W8KA 4PHAA 5KFHA 4PPXA 1C20A 2DPIA 4I2DA 5ALZA 1IM4A 3FYHA 4J9SA 4XUSA 3EW9A 5ALJA 3RJHA 7ICKA 2XO7A 4OO1J 2XVTA 8ICXA 3TFSA 2L5YA 4J9RA 9ICSA 1NJZA 1O08A 2KHVA 3Q8RB 1NI3A 2Y9TA 3JPQA 4O3SA 3M9NB 3Q8MA 1D8YA 4YCXA 1TKDA 4RZRA 4IR1A 4JWNA 3PSTA 3TI0A 2KSOA 4IC9A 2KIWA 1QSYA 2KJ9A 3KKAC 5IILA 5AK3A 2LM4A 8ICTA 2IA6A 3WKAA 7ICSA 3HW8A 2WF8A 5AI4A 1BPYA 2C28A 3H4BA 4IL6U 1UT5A 2HHTA 3QZ8A 1ZQHA 4F4WA 4MFCA 4NY8A 4J03A 4P4PA 2LPEA 4M2YA 4NXZA 3NS1A 3LWMA 3F2CA 2QARA 2E8NA 2K8CB 5AKXA 1T94A 3ZDAA 5J2IA 1N62A 5IIKA 4C4TA 3T3FA 3DEEA 2F8LA 4NWIA 4M04A 2G08A 2NO4A 4DF4A 1ZETA 3LVVA 2BCRA 2VJ5A 1IV8A 4Z6DA 2YQEA 3QU2A 3SAGA 4XA5A 4F5QA 1KFDA 5T14A 2XCAA 3DDHA 3N7SC 1VLBA 4O5EA 1ZQMA 5D4BA 4NV0A 2LHTA 5J0SA 1FIQA 5IIOA 1RQLA 1SZPA 1S0MA 4YQWA 1B4FA 2KMDA 3D2NA 5G5HA 2H3FA 1QCKA 3OGUA 1J2MA 1J97A 3C21A 2BDUA 1RDFA 3OJSA 1U4BA 1JX4A 4PH5A 2ISPA 4KX3A 1S76D 1ZQAA 4M9GA 2JZBA 1DK3A 2V4RA 3QEBZ 9ICPA 4GXIA 4QZDA 4OJOA 2RDIA 1F5SA 4ED7A 2GH1A 5DB9A 1Z4OA 5KFCA 1BNOA 4I29A 3QZ7A 2JEGA 4OJ6A 3PMLA 2KP7A 3EUB2 4Y2UA 4RQ3A 4IQVA 3PSFA 4Y2SA 1T3QA 3I76A 2HHSA 4F8RA 1BGXT 2W43A 5AI8A 2W9BA 5KFOA 1CUKA 1FEZA 2OWOA 2WB1C 1X6IA 2K4PA 2HMXA 4CF4A 5J0RA 4O3RA 3HX0A 4US9A 4R8UB 4ECTA 5ALMA 4ED2A 3MBYA 3RR7A 3C2MA 4U7CA 1FFVA 4PZOA 2F44A 2W9MA 4PHPA 3ZDCA 5AKEA 3MDCA 2QB1A 2VA8A 3ISBA 1V9PA 2XGPA 1XU4A 9ICLA 4FBTA 1SL2A 5J2BA 1Z00B 7ICIA 4MHVA 8ICZA 3K1RB 4FO6A 1QSSA 2WB1F 4I2JA 1QSLA 4YVZA 4FFDA 3H0MB 1ZQPA 4P2HA 2K60A 5EOZA 4NJ8A 7ICVA 5AI0A 3C29A 2FDRA 4JWMA 5KG3A 4QZ9A 3BZKA 4M47A 5HR6A 3KBBA 5AM4A 5ALTA 2LYBA 2LKYA 4M0AA 3NVWA 1TK0A 5ALGA 5ALVA 1MQ3A 4R65A 2PMZC 2OYYA 1SB3C 3G6VA 1Z3EB 2FI1A 4F2RA 2WF7A 4UAUA 1ZQRA 3NVYA 3PZPA 5EE1A 5DG8A 2FJ6A 1COKA 2KIVA 3FC4A 7ICMA 2KJ8A 2YB1A 2J6UA 4MF2A 2VIXA 2R8JA 9ICQA 1ZQJA 2W7OA 4JB3A 4M9LA 1SWWA 4DFMA 5CB1A 4J9MA 3NRZA 3EZ5A 1ZQYA 4TURA 5KG5A 3KHGA 3KHRA 2IOHA 1ZJMA 4C8LA 3T5HA 2K8BB 4F4XA 1KL9A 4TUSA 3AQEA 4F5PA 1K1QA 2IHNA 1QLNA 3BJYA 2KHQA 5BPCA 4RT3A 2WAQC 4O5CA 5KFQA 2B0CA 4PJ0U 3ZDDA 1HUOA 4C7ZA 3BQ0A 1DOQA 2WHEA 4J9KA 3K4GA 2IHMA 5TZVA 4F50A 5KAFU 4R64A 4UARA 3THVA 5IIMA 2HVIA 4RQ6A 2ZUDA 5KFYA 2HBJA 4F5NA 2W54A 3RB3A 2D8CA 1L7OA 2XIDA 1BPEA 2W9AA 3AQFA 3RB6A 3CYMA 2V4QA 2E1EA 2Y1JA 3L4PA 3J81j 4TQSA 2BCSA 1YZ6A 3CP8A 5B5EU 4CRXA 2KVCA 4DF8A 3C2LA 2PI5A 2WAQF 4E0DA 4F4ZA 1XO1A 7ICRA 1NK4A 5KFWA 5CR0A 1SV0C 1EXNA 4OJLA 1PZNA 5KAIU 5DKWA 2ASDA 4ECXA 5AM3A 2UVRA 2C22A 4YXJA 5EWGA 1OXJA 1JXLA 3AU2A 1ZQIA 2WF6A 1LVHA 4P0QA 4KLDA 1ZQXA 4QZEA 2KZMA 2ZTCA 5ALRA 1X9SA 2KNJA 2KD1A 4RNOA 5DG7A 2YMMA 2NRXA 3RRHA 5CRXA 3U26A 1L8OA 3QU9A 4RQ1A 4F91B 5HP4A 3SEIA 3WK9A 4DS4A 5AI6A 4IRKA 4MFAA 1S77D 1NJWA 1MN8A 3M1YA 4UAVA 2GLEA 3UXPA 5KT3A 4DSEA 1KTQA 2KKPA 5IIJA 2MA1A 5L1KA 3RJFA 3AU6A 2AHOB 2M0NA 5KFDA 3MR6A 2CN1A 2ZTDA 1X9MA 4YMNA 2AGPA 3MABA 9ICJA 1X66A 2KZZA 2I9GA 2R8HA 3QX7A 1RG6A 4ED0A 4PGXA 2MRLA 4NLKA 2UVVA 2XGQA 9ICTA 1SL0A 1BNPA 5KFPA 4F93B 2J6SA 5F9NA 2QKQA 3HRDD 1RQNA 3PVXA 5KNIA 1PVPA 2NO5A 4B9MA 4YN4A 4HAIA 2W7PA 3C5GA 1DGSA 3PR5B 3GDXA 4GLXA 5KTQA 7ICOA 5KFZA 2C2DA 3TQ1A 4QJFB 4QWCA 2EAMA 3BQ2A 2MU2A 3BQ7A 3K75D 1KQQA 5DG9A 3C28A 2VJ4A 5HNKA 2ZIXB 5G5GA 5DDYA 1H38A 3JPNA 3QU4A 2NRTA 9ICIA 1D9DA 4KLTA 3MR2A 2W9CB 4RQ4A 2CXYA 2ASLA 4AYBC 2DL0A 2I6XA 2IOFK 5AKIA 3RTVA 1L8LA 3H0LB 4G9BA 9ICUA 3M7DA 1XSPA 5AKGA 4PHDA 3AL0B 5IINA 8ICMA 5CP2A 4FE3A 1AROP 4PHEA 3RR8A 4IRDA 5J0TA 2Y0SF 4DOAA 2MUTB 1TFRA 2FLNA 5DQHA 4UB3A 2VA2A 9ICRA 2HBKA 4ECQA 5AK4A 4CGZA 3JPPA 4KN7A 5J8YC 2ZJAA 4U6PA 3OHBA 2P6RA 1JN3A 5J2DA 1ZYQA 5KFXA 4LZDA 2W3SA 3TADC 5J0UA 4TQRA 3MR3A 7ICNA 5KFUA 4DSFA 4US8A 1JALA 4EEYA 5AM1A 4AYBF 4OJPA 3QUQA 3KOOA 4ZH4A 3SZ2A 4DCCA 5D46A 1SIJA 5KT5A 3D2SA 1ECWA 4DQIA 4RT2A 5B66U 1UPHA 4UB4A 9ICCA 5DB6A 3ZI4A 1BPXA 1ZQQA 8ICHA 7ICEA 2LBOA 5KFMA 4UB8U 4DQRA 1U9LA 3H8SA 1Y88A 5F9LA 3MFIA 1HUZA 5F3XB 2NRZA 1NZPA 4I2GA 3MGVA 4KLQA 2VANA 4KTQA 4M9JA 5AHXA 4A8EA 4X5VA 1A6SA 7ICJA 4DFDA 4M6WB 1L7PA 2FPLA 2P6UA 3Q8QB 3UXOA 5AIAA 3PW2A 5J0XA 3RB4A 9ICNA 8ICKA 4PL2A 4NL9A 1JROA 8ICYA 2VKQA 2EH9A 1T8EA 3T5LA 3V7KA 2BQ3A 1Z00A 4FBUA 4KLSA 1LKYB 1L6NA 1N60A 2D3DA 5J2KA 3NRWA 5AM0A 4I27A 3T79A 4M9NA 3V7LA 2Z7JA 2ZTEA 2UVWA 2NRWA 4DQPA 2DKXA 2H5XA 4YMMA 1RPLA 2AGOA 3JPSA 1QQ7A 5JRTA 1MA7A 2A1JA 4DQQA 3GV5B 3F5AA 1U47A 3BZCA 1Z1VA 4GFJA 4RQ0A 4EENA 4KLHA 2HSZA 2E8MA 4DSKA 3UMCA 1XSNA 2G5HB 1SGGA 1KKXA 3PR4A 1KSPA 4JV2A 4DLEA 4CCHA 3BDPA 2WTFA 1NK6A 2FMQA 4F2SA 2PI4A 3NUQA 2YMPA 5ALWA 1WCLA 4GXKA 2ISOA 3B9JA 1XWLA 4CF3A 3M6KA 2AXTU 1U49A 4UAZA 4DWIA 3WK5A 2ZUCA 2KFNA 2KJ5A 5BOMA 8ICPA 7ICGA 3PW4A 3PMNA 1KFTA 3T5JA 1BPBA 1NZBA 2BCUA 1JIHA 4FZMA 2KV2A 4RUCA 1SKWA 4I2IA 5JTIA 4YG2A 2HCFA 4R66A 3IRUA 1VJ5A 5KT2A 2JMGA 3PSIA 4RQ8A 8ICGA 3H4DA 2ASJA 2AJQA 3S6JA 1ZQGA 5DLFA 3V6JA 4F4KA 5C0YA 1D9FA 2WF5A 4YR0A 3PSPA 3WK8A 4Y2TA 4KITB 1QTMA 3H8MA 5KT6A 1URJA 3PX0A 1ZD4A 3SMVA 4B9VA 3C1ZA 3EPGA 2F1IA 2ES6A 4RUAA 3GV8B 1PK1B 3GILA 3EPIA 5EWEA 4QW9A 3GQCA 1T7PA 2FMSA 5KFAA 5AK6A 2E1FA 2W11A 5HMLA 1MC8A 1UQVA 3GZFA 3GIMA 4GC7A 1JI7A 4J9NA 4ELTA 2W3RA 2GO7A 4Z6EA 1TV9A 1ZQLA 2BZFA 2WFAA 3GU3A 4C8MA 4FS2A 2KICA 2YX8A 4I2HA 7ICUA 2DUYA 2HBMA 5HMMA 1B43A 1LB2B 1NJYA 4F71A 1WCNA 3F2DA 3SAHA 3JPRA 1DXSA 9ICHA 4ECWA 4ED3A 1X9XA 2ZIUB 2RQ5A 4PZNA 4QZFA 3AN1A 1JXEA 3RF9A 4Q43A 3QU7A 4Z6CA 2LYHA 3H40A 2KVSA 1L3TA 2G06A 4DSIA 2RLTA 5J0QA 1ZQWA 7ICPA 2EZXA 8ICIA 2ZIWA 3CW2C 4DOBA 2Y9UA 2C2RA 2CRXA 4C8OA 9ICMA 2UVUA 5AM2A 5ALKA 4YMOA 7ICQA 3TARA 3ONNA 5K4LA 2JXJA 4C8NA 1XC9A 1PVRA 4R63A 3HP6A 4DSLA 1SWVA 3RJKA 4YP3A 2BQRA 2EDUA 1NK8A 1BPZA 1KRPA 1Q3UA 2YB4A 4NLZA 5CWRA 4WJ3B 2ZIXA 2JEJA 3JPTA 5L9XA 2JH7A 8ICRA 2IOFA 4UB1A 1HEKA 2ESEA 4UAWA 3D6JA 3VC8A 2HOIA 2W9CA 9ICBA 3LK9A 4AP9A 3JPOA 4RQNA 3QEAZ 2QB0B 2M9NA 4UBCA 4UATA 3FM9A 5ALOA 4QZAA 9ICAA 4I28A 3OSNA 9ICVA 3GIJA 1TAQA 2XI9A 2XY5A 2OXOA 3T5KA 3B0XA 2DQNB 5KT7A 4Q8FA 2MUTA 2B21A 1ZQSA 1ZQNA 4GIBA 3RFAA 4EZ6A 8ICWA 2HHUA 4HYKA 2K4IA 2D6FC 1B22A 1GO3F 4QZ8A 2ZXHA 4P4OA 4F3OA 1Z1BA 1VDVA 4G3IA 1ZD5A 2AU0A 3SV4A 1S9FA 3H0RB 5DQIA 8ICEA 4GC6A 2EANA 2R8IA 2K4HA 3ETLA 8ICUA 3A0HU 1XSLA 5L1LA 1KLNA 3ORYA 1Z4NA 2W9BB 4DO9A 5ALUA 8ICAA 4UB5A 1QQ6A 3KFUF 3NGDA 2ALZA 4CDGA 1D8LA 1PVQA 1N5XA 2EZYA 2BCQA 3ZDEA 3ED5A 1SXEA 5KT4A 5EE0A 2XY6A 3KKAA 3TKAA 2HOQA 2Y1IA 3NVVA 3WKBA 5FP0A 4KLFA 3SI8A 1RZTA 3E2EA 3G6XA 3N7RC 2XICA 9ICOA 2FPKA 1FO4A 4JMUA 9ICGA 2R8GA 1S97A 3TFRA 4ZOHC 4EBDA 5KL8B 1X9WA 2YTUA 5AKYA 5DGBA 4KMUA 5KFRA 5GTHU 4DL3A 1RM6C 1WYGA 4B9SA 4EYHB 3MR5A 2G0AA 5CJ7A 4QWAA 4ECUA 1NK7A 4XQ8A 3N4MB 4ECRA 4EX6A 2KTQA 3NASA 5EE3A 4EEKA 2F1JA 3M9MB 4C4SA 4PGQA 3UXNA 3KZXA 3QXGA 1L3SA 4PL1A 2JGAA 2BHNA 5TISU 3Q8KA 2Y0SC 4EYIB 1NOMA 1S0OA 2BPCA 4MFFA 4YD2A 2YN4A 1ED1A 5KFGA 4O9MA 2A1AA 8ICOA 1O03A 4EELA 2ZJ5A 3SENA 3KZIU 4JK1A 2BDPA 4RNNA 1ZQKA 5KFFA 1N56A 1ZQEA 3M6ZA 2PKEA 3BQ1A 2YMLA 2FPMA 3FAHA 4ED8A 3OPXA 1TE2A 5KG4A 4NLCA 3UQ0A 5ALDA 4MEYA 1KDHA 3F2BA 1Q8KA 1L5UA 4LJXA 3RJIA 5BOLA 2BQUA 3IV6A 3QNMA 2XC9A 5J0YA 3O0FA 1K1SA 2F76X 4EZ9A 2G5IB 3IP4B 5J2HA 3V6HA 2FLPA 3Q8LA 4LZGA 2RP5A 2NV3A 3M8SA 1WWUA 5J2EA 5KFTA 1X40A 4RQ2A 4J9QA 2W8LA 4QZCA 7ICLA 3CRXA 2ZIVB 4RQ7A 4RPYA 2A19A 2BCVA 1DGJA 3SR6A 3F5EA 3E58A 5JUMA 3F53A 4DL5A
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 1YZ7 A;  4QNL A;  4M9H A;  5ALL A;  3GFK B;  8ICQ A;  4QZI A;  1T3N A;  4NLG A;  3EYZ A;  4Y2V A;  2JV3 A;  4QWD A;  1DRG A;  4CNQ A;  4DLG A;  1F0M A;  1ZOL A;  3SD7 A;  1UCV A;  3QU5 A;  5A0L A;  1V97 A;  1JUD A;  2W55 A;  3IDW A;  5AKJ A;  3IG5 A;  4RPZ A;  2JHD A;  3PW7 A;  1PK1 A;  1TVA A;  9ICK A;  2JEI A;  3HJE A;  1A76 A;  3R9K A;  2E8P A;  4ECV A;  4P4M A;  5H2F U;  1ZJN A;  4P0P B;  3V7J A;  5E79 U;  4YR3 A;  4R8U A;  5HR7 A;  1IG6 A;  2W03 A;  1KW4 A;  1LV5 A;  2BPG A;  4C0Z A;  2ZJ8 A;  4O3M A;  3QYP A;  2NYV A;  3N97 B;  2LYA A;  3FDS A;  4C80 A;  1YT3 A;  1DK2 A;  2AGQ A;  4RPX A;  4C8K A;  4EBC A;  5KFB A;  1B0X A;  2JR5 A;  5DQG A;  1S10 A;  3L3F X;  3AEV A;  9ICF A;  1WG8 A;  4NM1 A;  2DPJ A;  4LVS A;  2ZIU A;  3PNC A;  5KG6 A;  4UAY A;  1QH9 A;  8ICB A;  4BXO B;  2EZZ A;  4IQT A;  2ZXI A;  4F5O A;  4J9O A;  4PGY A;  5D49 A;  5J29 A;  5CHG A;  4B9U A;  4I2F A;  2LI6 A;  1SV4 A;  5DB8 A;  3AUO A;  3TAQ A;  3QUB A;  3OJU A;  2OHF A;  3IHQ B;  3EWA A;  5AI5 A;  4DSJ A;  8ICS A;  3WKD A;  3MDA A;  3K1Z A;  4MF8 A;  4DEZ A;  4B6J A;  3KTQ A;  2DF4 B;  5JU5 A;  3BS5 B;  2LMR A;  4YFK A;  5L1M A;  2DKZ A;  1TAM A;  3MC1 A;  3C2K A;  3C5F A;  2AQ4 A;  4KLU A;  4Y2J A;  2BPF A;  1XNS A;  3PY8 A;  1C7Y A;  1BVS A;  4ED6 A;  1A0P A;  3OSP A;  3QUC A;  5KFJ A;  2DBY A;  2HHQ A;  4Y2R A;  4Q45 A;  3LVW A;  4Y2X A;  3IM1 A;  4GXJ A;  3WK4 A;  2LM1 A;  2AH5 A;  5KFL A;  2FE9 A;  2XCP A;  1MSW D;  2DFL A;  4FZN A;  3HIL A;  1ZQC A;  5J2C A;  2NRV A;  1ZQ1 C;  1L3V A;  1SZH A;  3HKZ C;  3RRG A;  1SV0 A;  3KHH A;  4QIW C;  5CA7 A;  3MGH A;  3KHL A;  2I5H A;  5AIC A;  1PK3 A;  2BR0 A;  1ZQO A;  5J0P A;  4TUP A;  2QB0 A;  2HW3 A;  1V38 A;  5CEH A;  3IG8 A;  4NLN A;  1WUD A;  4YD1 A;  4RQ5 A;  5DBB A;  9ICE A;  1N63 A;  4CF5 A;  2F2A B;  2ZUB A;  5AIB A;  1RXV A;  2HVH A;  2E5S A;  4DOC A;  1RYU A;  2HHX A;  5KG2 A;  1RXW A;  4DL7 A;  3RB0 A;  4DFJ A;  4ECS A;  1NKC A;  5C5J A;  4ICA A;  5ALP A;  2F1H A;  3HKZ F;  4QIW F;  3SV3 A;  1ZD3 A;  5HHH A;  3ISC A;  1S5L U;  5HHI A;  1JMS A;  3AM9 A;  3WK6 A;  4Y2Q A;  2GWS A;  4Z6F A;  1XO0 A;  3HT3 A;  3VCB A;  3UM9 A;  3I28 A;  3QE9 Y;  3RJG A;  1L7M A;  2OEH A;  1X6J A;  1XS9 D;  1SKR A;  2JH1 A;  4RQM A;  4BUG A;  1A77 A;  5ALY A;  1WWV A;  4RNM A;  5KFV A;  5DGA A;  1N5W A;  5L1J A;  4IQW A;  1CRX A;  4IS7 A;  4F72 A;  1NJX A;  1N2X A;  5KL1 B;  1S8O A;  2FLL A;  4KLE A;  3PO4 A;  4UB6 U;  1TAU A;  3UQ2 A;  4K4G A;  1Z19 A;  1UT8 A;  1FFU A;  3HPO A;  3RJE A;  2KG5 A;  5ALF A;  2KSO B;  4BDP A;  2AQ0 A;  4ACO A;  5AKK A;  5AI9 A;  4O0I A;  1P7D A;  5J2G A;  4DS5 A;  5AKH A;  2N1R A;  4NM2 A;  2R18 A;  1KBU A;  3RAX A;  1SXD A;  2F3N A;  8ICV A;  4USA A;  1KFS A;  2A1J B;  2QAR B;  5KG0 A;  2F77 X;  4NL9 C;  1ZRM A;  8ICL A;  2H3V A;  3ICX A;  3ZD8 A;  1S0N A;  1CI4 A;  5DBA A;  2PFO A;  4I2E A;  4YR2 A;  4Y2Y A;  3TAC B;  2OCE A;  3N28 A;  1U45 A;  4KLI A;  4ED1 A;  3BS7 A;  5KFE A;  3MFH A;  2KN7 A;  4C7Y A;  2W04 A;  2VA3 A;  1KEJ A;  4JUZ A;  1S0V A;  4ECY A;  1KN5 A;  3KD3 A;  5J8Y A;  4DL6 A;  2XY7 A;  2OM6 A;  4I2B A;  2EQY A;  2HDO A;  1PUZ A;  2YMQ A;  2R8K A;  3TAD A;  1OW5 A;  4F92 B;  4KN4 A;  3E0F A;  5J2F A;  2QLT A;  3AMZ A;  2KOB A;  3PW0 A;  4XRH A;  3BQT A;  2PMZ F;  3OTQ A;  2K4E A;  4QWE A;  2OH2 A;  1HJP A;  3PV8 A;  1MQ2 A;  4KLL A;  1Q46 A;  4DFK A;  2JRZ A;  4FZL A;  4ELV A;  3WU2 U;  2RDJ A;  4K4H A;  8ICF A;  2HBL A;  1N61 A;  3UMB A;  5ALI A;  1NKB A;  1JRP A;  2JZB B;  1COO A;  1ZD2 P;  1ZQB A;  4K4I A;  3TAN A;  2F8K A;  2PFN A;  3H7I A;  5KFS A;  3RBE A;  3UPQ A;  5AM5 A;  5L1I A;  5DB7 A;  2ZIV A;  1L3U A;  1QQ5 A;  4F5R A;  5KFN A;  4Q8E A;  3C23 A;  2V9W A;  3PO5 A;  2G09 A;  5J2A A;  4EX7 A;  3MGI A;  3RH4 A;  1N48 A;  5AKL A;  3IN5 A;  5EE9 A;  4DFP A;  3WK7 A;  3RAQ A;  4UBB A;  4Y2P A;  3I1Y A;  2O6K A;  7ICH A;  4B9T A;  1ZQV A;  3LWL A;  1D8B A;  4QWB A;  1BPD A;  4QZG A;  5ALN A;  2E3T A;  3TAP A;  1F44 A;  1V85 A;  2Q0Z X;  1NKE A;  4UW9 A;  3CNH A;  4UQG A;  5ALQ A;  1SKS A;  5GTI U;  2MAX A;  4YXM A;  4KLO A;  2PXI A;  4EBE A;  3SYZ A;  2MSN A;  4IQU A;  4BJQ A;  1K5O A;  5KG1 A;  4P0P A;  4UAS A;  2BGW A;  3GIK A;  4QZH A;  3Q8P B;  3SAF A;  5J0W A;  5J2J A;  3NVZ A;  5ALE A;  2DGZ A;  2P66 A;  3UMG A;  3M9O B;  4MEX A;  4M6W A;  1J2N A;  5DLG A;  5ALS A;  2HI0 A;  3NTU A;  8ICN A;  5EWF A;  2KZ3 A;  4NLB A;  2BKE A;  1U48 A;  1ZXI A;  2ATL A;  3A0B U;  4J9P A;  5KG7 A;  8ICJ A;  5AKZ A;  2C2E A;  3ZD9 A;  4DL2 A;  8ICC A;  1UA1 A;  1IIP A;  1LKY A;  5DDM A;  3RJJ A;  3ALR A;  3V6K A;  1RYR A;  2WF9 A;  4B9N A;  4O5K A;  4IRC A;  2ZG6 A;  1UA0 A;  2A3V A;  4DL4 A;  4BXO A;  4OJ5 A;  9ICX A;  1AQ6 A;  3Q8S B;  5AK5 A;  2DWQ A;  2Q4T A;  3OHA A;  2HHW A;  3N7P D;  1CEZ A;  3LDA A;  4TUQ A;  4IR9 A;  2ZIW B;  3LYS A;  2E8O A;  1ZRN A;  4I2C A;  4OCZ A;  4O3P A;  2I1Q A;  1Q3V A;  2RHF A;  1ZQT A;  4KLG A;  1HIW A;  5DBC A;  2H3I A;  3BS5 A;  3ETR A;  2HOF A;  1SL1 A;  3L5K A;  3RH5 A;  3WKC A;  2KK0 A;  4UB2 A;  1NK0 A;  4ELU A;  4KX5 A;  3QUT A;  4ECZ A;  4KLM A;  4I2A A;  4C4R A;  3SQI A;  1ZQF A;  4F4Y A;  2H3Q A;  3C1Y A;  4BWM A;  2ODG A;  2PFP A;  3GV7 B;  2KE7 A;  4OD0 A;  3D2Q A;  7ICF A;  4O3O A;  2EAO A;  3PW5 A;  2GOL A;  4B9L A;  7ICT A;  5KFI A;  2KEY A;  2K8A A;  1ZQU A;  4BGD A;  3PX4 A;  1ZQD A;  1TK5 A;  1T4G A;  4JV0 A;  4QW8 A;  4RU9 A;  5ALH A;  4QZB A;  2IBK A;  3M8R A;  3G6Y A;  3RBD A;  5J0O A;  4O3N A;  3HWT A;  4Q44 A;  5KFK A;  2KKV A;  1RYS A;  1ZQZ A;  2KFZ A;  5III A;  2P35 A;  1OUQ A;  4BWJ A;  2IMW P;  1M6Y A;  4DQS A;  2HHV A;  1UHU A;  2G07 A;  2J6T A;  2JEF A;  2EAP A;  1NK9 A;  1X2I A;  4KLJ A;  3H8W A;  3WKE A;  1IXR A;  2CPR A;  3B0Y A;  4J9L A;  3RH6 A;  3ISD A;  1L7N A;  1NNL A;  5ALX A;  1TK8 A;  4KMO B;  2B6G A;  9ICW A;  3DV9 A;  2H3Z A;  3GII A;  4P0Q B;  2FMP A;  2PFQ A;  2RRD A;  4FS1 A;  4O3Q A;  3PX6 A;  4BX9 C;  3V72 A;  4JV1 A;  3ZDB A;  4CE6 A;  1NK5 A;  1X42 A;  2K89 A;  2YY6 A;  3H8J A;  2W8K A;  4PHA A;  5KFH A;  4PPX A;  1C20 A;  2DPI A;  4I2D A;  5ALZ A;  1IM4 A;  3FYH A;  4J9S A;  4XUS A;  3EW9 A;  5ALJ A;  3RJH A;  7ICK A;  2XO7 A;  4OO1 J;  2XVT A;  8ICX A;  3TFS A;  2L5Y A;  4J9R A;  9ICS A;  1NJZ A;  1O08 A;  2KHV A;  3Q8R B;  1NI3 A;  2Y9T A;  3JPQ A;  4O3S A;  3M9N B;  3Q8M A;  1D8Y A;  4YCX A;  1TKD A;  4RZR A;  4IR1 A;  4JWN A;  3PST A;  3TI0 A;  2KSO A;  4IC9 A;  2KIW A;  1QSY A;  2KJ9 A;  3KKA C;  5IIL A;  5AK3 A;  2LM4 A;  8ICT A;  2IA6 A;  3WKA A;  7ICS A;  3HW8 A;  2WF8 A;  5AI4 A;  1BPY A;  2C28 A;  3H4B A;  4IL6 U;  1UT5 A;  2HHT A;  3QZ8 A;  1ZQH A;  4F4W A;  4MFC A;  4NY8 A;  4J03 A;  4P4P A;  2LPE A;  4M2Y A;  4NXZ A;  3NS1 A;  3LWM A;  3F2C A;  2QAR A;  2E8N A;  2K8C B;  5AKX A;  1T94 A;  3ZDA A;  5J2I A;  1N62 A;  5IIK A;  4C4T A;  3T3F A;  3DEE A;  2F8L A;  4NWI A;  4M04 A;  2G08 A;  2NO4 A;  4DF4 A;  1ZET A;  3LVV A;  2BCR A;  2VJ5 A;  1IV8 A;  4Z6D A;  2YQE A;  3QU2 A;  3SAG A;  4XA5 A;  4F5Q A;  1KFD A;  5T14 A;  2XCA A;  3DDH A;  3N7S C;  1VLB A;  4O5E A;  1ZQM A;  5D4B A;  4NV0 A;  2LHT A;  5J0S A;  1FIQ A;  5IIO A;  1RQL A;  1SZP A;  1S0M A;  4YQW A;  1B4F A;  2KMD A;  3D2N A;  5G5H A;  2H3F A;  1QCK A;  3OGU A;  1J2M A;  1J97 A;  3C21 A;  2BDU A;  1RDF A;  3OJS A;  1U4B A;  1JX4 A;  4PH5 A;  2ISP A;  4KX3 A;  1S76 D;  1ZQA A;  4M9G A;  2JZB A;  1DK3 A;  2V4R A;  3QEB Z;  9ICP A;  4GXI A;  4QZD A;  4OJO A;  2RDI A;  1F5S A;  4ED7 A;  2GH1 A;  5DB9 A;  1Z4O A;  5KFC A;  1BNO A;  4I29 A;  3QZ7 A;  2JEG A;  4OJ6 A;  3PML A;  2KP7 A;  3EUB 2;  4Y2U A;  4RQ3 A;  4IQV A;  3PSF A;  4Y2S A;  1T3Q A;  3I76 A;  2HHS A;  4F8R A;  1BGX T;  2W43 A;  5AI8 A;  2W9B A;  5KFO A;  1CUK A;  1FEZ A;  2OWO A;  2WB1 C;  1X6I A;  2K4P A;  2HMX A;  4CF4 A;  5J0R A;  4O3R A;  3HX0 A;  4US9 A;  4R8U B;  4ECT A;  5ALM A;  4ED2 A;  3MBY A;  3RR7 A;  3C2M A;  4U7C A;  1FFV A;  4PZO A;  2F44 A;  2W9M A;  4PHP A;  3ZDC A;  5AKE A;  3MDC A;  2QB1 A;  2VA8 A;  3ISB A;  1V9P A;  2XGP A;  1XU4 A;  9ICL A;  4FBT A;  1SL2 A;  5J2B A;  1Z00 B;  7ICI A;  4MHV A;  8ICZ A;  3K1R B;  4FO6 A;  1QSS A;  2WB1 F;  4I2J A;  1QSL A;  4YVZ A;  4FFD A;  3H0M B;  1ZQP A;  4P2H A;  2K60 A;  5EOZ A;  4NJ8 A;  7ICV A;  5AI0 A;  3C29 A;  2FDR A;  4JWM A;  5KG3 A;  4QZ9 A;  3BZK A;  4M47 A;  5HR6 A;  3KBB A;  5AM4 A;  5ALT A;  2LYB A;  2LKY A;  4M0A A;  3NVW A;  1TK0 A;  5ALG A;  5ALV A;  1MQ3 A;  4R65 A;  2PMZ C;  2OYY A;  1SB3 C;  3G6V A;  1Z3E B;  2FI1 A;  4F2R A;  2WF7 A;  4UAU A;  1ZQR A;  3NVY A;  3PZP A;  5EE1 A;  5DG8 A;  2FJ6 A;  1COK A;  2KIV A;  3FC4 A;  7ICM A;  2KJ8 A;  2YB1 A;  2J6U A;  4MF2 A;  2VIX A;  2R8J A;  9ICQ A;  1ZQJ A;  2W7O A;  4JB3 A;  4M9L A;  1SWW A;  4DFM A;  5CB1 A;  4J9M A;  3NRZ A;  3EZ5 A;  1ZQY A;  4TUR A;  5KG5 A;  3KHG A;  3KHR A;  2IOH A;  1ZJM A;  4C8L A;  3T5H A;  2K8B B;  4F4X A;  1KL9 A;  4TUS A;  3AQE A;  4F5P A;  1K1Q A;  2IHN A;  1QLN A;  3BJY A;  2KHQ A;  5BPC A;  4RT3 A;  2WAQ C;  4O5C A;  5KFQ A;  2B0C A;  4PJ0 U;  3ZDD A;  1HUO A;  4C7Z A;  3BQ0 A;  1DOQ A;  2WHE A;  4J9K A;  3K4G A;  2IHM A;  5TZV A;  4F50 A;  5KAF U;  4R64 A;  4UAR A;  3THV A;  5IIM A;  2HVI A;  4RQ6 A;  2ZUD A;  5KFY A;  2HBJ A;  4F5N A;  2W54 A;  3RB3 A;  2D8C A;  1L7O A;  2XID A;  1BPE A;  2W9A A;  3AQF A;  3RB6 A;  3CYM A;  2V4Q A;  2E1E A;  2Y1J A;  3L4P A;  3J81 j;  4TQS A;  2BCS A;  1YZ6 A;  3CP8 A;  5B5E U;  4CRX A;  2KVC A;  4DF8 A;  3C2L A;  2PI5 A;  2WAQ F;  4E0D A;  4F4Z A;  1XO1 A;  7ICR A;  1NK4 A;  5KFW A;  5CR0 A;  1SV0 C;  1EXN A;  4OJL A;  1PZN A;  5KAI U;  5DKW A;  2ASD A;  4ECX A;  5AM3 A;  2UVR A;  2C22 A;  4YXJ A;  5EWG A;  1OXJ A;  1JXL A;  3AU2 A;  1ZQI A;  2WF6 A;  1LVH A;  4P0Q A;  4KLD A;  1ZQX A;  4QZE A;  2KZM A;  2ZTC A;  5ALR A;  1X9S A;  2KNJ A;  2KD1 A;  4RNO A;  5DG7 A;  2YMM A;  2NRX A;  3RRH A;  5CRX A;  3U26 A;  1L8O A;  3QU9 A;  4RQ1 A;  4F91 B;  5HP4 A;  3SEI A;  3WK9 A;  4DS4 A;  5AI6 A;  4IRK A;  4MFA A;  1S77 D;  1NJW A;  1MN8 A;  3M1Y A;  4UAV A;  2GLE A;  3UXP A;  5KT3 A;  4DSE A;  1KTQ A;  2KKP A;  5IIJ A;  2MA1 A;  5L1K A;  3RJF A;  3AU6 A;  2AHO B;  2M0N A;  5KFD A;  3MR6 A;  2CN1 A;  2ZTD A;  1X9M A;  4YMN A;  2AGP A;  3MAB A;  9ICJ A;  1X66 A;  2KZZ A;  2I9G A;  2R8H A;  3QX7 A;  1RG6 A;  4ED0 A;  4PGX A;  2MRL A;  4NLK A;  2UVV A;  2XGQ A;  9ICT A;  1SL0 A;  1BNP A;  5KFP A;  4F93 B;  2J6S A;  5F9N A;  2QKQ A;  3HRD D;  1RQN A;  3PVX A;  5KNI A;  1PVP A;  2NO5 A;  4B9M A;  4YN4 A;  4HAI A;  2W7P A;  3C5G A;  1DGS A;  3PR5 B;  3GDX A;  4GLX A;  5KTQ A;  7ICO A;  5KFZ A;  2C2D A;  3TQ1 A;  4QJF B;  4QWC A;  2EAM A;  3BQ2 A;  2MU2 A;  3BQ7 A;  3K75 D;  1KQQ A;  5DG9 A;  3C28 A;  2VJ4 A;  5HNK A;  2ZIX B;  5G5G A;  5DDY A;  1H38 A;  3JPN A;  3QU4 A;  2NRT A;  9ICI A;  1D9D A;  4KLT A;  3MR2 A;  2W9C B;  4RQ4 A;  2CXY A;  2ASL A;  4AYB C;  2DL0 A;  2I6X A;  2IOF K;  5AKI A;  3RTV A;  1L8L A;  3H0L B;  4G9B A;  9ICU A;  3M7D A;  1XSP A;  5AKG A;  4PHD A;  3AL0 B;  5IIN A;  8ICM A;  5CP2 A;  4FE3 A;  1ARO P;  4PHE A;  3RR8 A;  4IRD A;  5J0T A;  2Y0S F;  4DOA A;  2MUT B;  1TFR A;  2FLN A;  5DQH A;  4UB3 A;  2VA2 A;  9ICR A;  2HBK A;  4ECQ A;  5AK4 A;  4CGZ A;  3JPP A;  4KN7 A;  5J8Y C;  2ZJA A;  4U6P A;  3OHB A;  2P6R A;  1JN3 A;  5J2D A;  1ZYQ A;  5KFX A;  4LZD A;  2W3S A;  3TAD C;  5J0U A;  4TQR A;  3MR3 A;  7ICN A;  5KFU A;  4DSF A;  4US8 A;  1JAL A;  4EEY A;  5AM1 A;  4AYB F;  4OJP A;  3QUQ A;  3KOO A;  4ZH4 A;  3SZ2 A;  4DCC A;  5D46 A;  1SIJ A;  5KT5 A;  3D2S A;  1ECW A;  4DQI A;  4RT2 A;  5B66 U;  1UPH A;  4UB4 A;  9ICC A;  5DB6 A;  3ZI4 A;  1BPX A;  1ZQQ A;  8ICH A;  7ICE A;  2LBO A;  5KFM A;  4UB8 U;  4DQR A;  1U9L A;  3H8S A;  1Y88 A;  5F9L A;  3MFI A;  1HUZ A;  5F3X B;  2NRZ A;  1NZP A;  4I2G A;  3MGV A;  4KLQ A;  2VAN A;  4KTQ A;  4M9J A;  5AHX A;  4A8E A;  4X5V A;  1A6S A;  7ICJ A;  4DFD A;  4M6W B;  1L7P A;  2FPL A;  2P6U A;  3Q8Q B;  3UXO A;  5AIA A;  3PW2 A;  5J0X A;  3RB4 A;  9ICN A;  8ICK A;  4PL2 A;  4NL9 A;  1JRO A;  8ICY A;  2VKQ A;  2EH9 A;  1T8E A;  3T5L A;  3V7K A;  2BQ3 A;  1Z00 A;  4FBU A;  4KLS A;  1LKY B;  1L6N A;  1N60 A;  2D3D A;  5J2K A;  3NRW A;  5AM0 A;  4I27 A;  3T79 A;  4M9N A;  3V7L A;  2Z7J A;  2ZTE A;  2UVW A;  2NRW A;  4DQP A;  2DKX A;  2H5X A;  4YMM A;  1RPL A;  2AGO A;  3JPS A;  1QQ7 A;  5JRT A;  1MA7 A;  2A1J A;  4DQQ A;  3GV5 B;  3F5A A;  1U47 A;  3BZC A;  1Z1V A;  4GFJ A;  4RQ0 A;  4EEN A;  4KLH A;  2HSZ A;  2E8M A;  4DSK A;  3UMC A;  1XSN A;  2G5H B;  1SGG A;  1KKX A;  3PR4 A;  1KSP A;  4JV2 A;  4DLE A;  4CCH A;  3BDP A;  2WTF A;  1NK6 A;  2FMQ A;  4F2S A;  2PI4 A;  3NUQ A;  2YMP A;  5ALW A;  1WCL A;  4GXK A;  2ISO A;  3B9J A;  1XWL A;  4CF3 A;  3M6K A;  2AXT U;  1U49 A;  4UAZ A;  4DWI A;  3WK5 A;  2ZUC A;  2KFN A;  2KJ5 A;  5BOM A;  8ICP A;  7ICG A;  3PW4 A;  3PMN A;  1KFT A;  3T5J A;  1BPB A;  1NZB A;  2BCU A;  1JIH A;  4FZM A;  2KV2 A;  4RUC A;  1SKW A;  4I2I A;  5JTI A;  4YG2 A;  2HCF A;  4R66 A;  3IRU A;  1VJ5 A;  5KT2 A;  2JMG A;  3PSI A;  4RQ8 A;  8ICG A;  3H4D A;  2ASJ A;  2AJQ A;  3S6J A;  1ZQG A;  5DLF A;  3V6J A;  4F4K A;  5C0Y A;  1D9F A;  2WF5 A;  4YR0 A;  3PSP A;  3WK8 A;  4Y2T A;  4KIT B;  1QTM A;  3H8M A;  5KT6 A;  1URJ A;  3PX0 A;  1ZD4 A;  3SMV A;  4B9V A;  3C1Z A;  3EPG A;  2F1I A;  2ES6 A;  4RUA A;  3GV8 B;  1PK1 B;  3GIL A;  3EPI A;  5EWE A;  4QW9 A;  3GQC A;  1T7P A;  2FMS A;  5KFA A;  5AK6 A;  2E1F A;  2W11 A;  5HML A;  1MC8 A;  1UQV A;  3GZF A;  3GIM A;  4GC7 A;  1JI7 A;  4J9N A;  4ELT A;  2W3R A;  2GO7 A;  4Z6E A;  1TV9 A;  1ZQL A;  2BZF A;  2WFA A;  3GU3 A;  4C8M A;  4FS2 A;  2KIC A;  2YX8 A;  4I2H A;  7ICU A;  2DUY A;  2HBM A;  5HMM A;  1B43 A;  1LB2 B;  1NJY A;  4F71 A;  1WCN A;  3F2D A;  3SAH A;  3JPR A;  1DXS A;  9ICH A;  4ECW A;  4ED3 A;  1X9X A;  2ZIU B;  2RQ5 A;  4PZN A;  4QZF A;  3AN1 A;  1JXE A;  3RF9 A;  4Q43 A;  3QU7 A;  4Z6C A;  2LYH A;  3H40 A;  2KVS A;  1L3T A;  2G06 A;  4DSI A;  2RLT A;  5J0Q A;  1ZQW A;  7ICP A;  2EZX A;  8ICI A;  2ZIW A;  3CW2 C;  4DOB A;  2Y9U A;  2C2R A;  2CRX A;  4C8O A;  9ICM A;  2UVU A;  5AM2 A;  5ALK A;  4YMO A;  7ICQ A;  3TAR A;  3ONN A;  5K4L A;  2JXJ A;  4C8N A;  1XC9 A;  1PVR A;  4R63 A;  3HP6 A;  4DSL A;  1SWV A;  3RJK A;  4YP3 A;  2BQR A;  2EDU A;  1NK8 A;  1BPZ A;  1KRP A;  1Q3U A;  2YB4 A;  4NLZ A;  5CWR A;  4WJ3 B;  2ZIX A;  2JEJ A;  3JPT A;  5L9X A;  2JH7 A;  8ICR A;  2IOF A;  4UB1 A;  1HEK A;  2ESE A;  4UAW A;  3D6J A;  3VC8 A;  2HOI A;  2W9C A;  9ICB A;  3LK9 A;  4AP9 A;  3JPO A;  4RQN A;  3QEA Z;  2QB0 B;  2M9N A;  4UBC A;  4UAT A;  3FM9 A;  5ALO A;  4QZA A;  9ICA A;  4I28 A;  3OSN A;  9ICV A;  3GIJ A;  1TAQ A;  2XI9 A;  2XY5 A;  2OXO A;  3T5K A;  3B0X A;  2DQN B;  5KT7 A;  4Q8F A;  2MUT A;  2B21 A;  1ZQS A;  1ZQN A;  4GIB A;  3RFA A;  4EZ6 A;  8ICW A;  2HHU A;  4HYK A;  2K4I A;  2D6F C;  1B22 A;  1GO3 F;  4QZ8 A;  2ZXH A;  4P4O A;  4F3O A;  1Z1B A;  1VDV A;  4G3I A;  1ZD5 A;  2AU0 A;  3SV4 A;  1S9F A;  3H0R B;  5DQI A;  8ICE A;  4GC6 A;  2EAN A;  2R8I A;  2K4H A;  3ETL A;  8ICU A;  3A0H U;  1XSL A;  5L1L A;  1KLN A;  3ORY A;  1Z4N A;  2W9B B;  4DO9 A;  5ALU A;  8ICA A;  4UB5 A;  1QQ6 A;  3KFU F;  3NGD A;  2ALZ A;  4CDG A;  1D8L A;  1PVQ A;  1N5X A;  2EZY A;  2BCQ A;  3ZDE A;  3ED5 A;  1SXE A;  5KT4 A;  5EE0 A;  2XY6 A;  3KKA A;  3TKA A;  2HOQ A;  2Y1I A;  3NVV A;  3WKB A;  5FP0 A;  4KLF A;  3SI8 A;  1RZT A;  3E2E A;  3G6X A;  3N7R C;  2XIC A;  9ICO A;  2FPK A;  1FO4 A;  4JMU A;  9ICG A;  2R8G A;  1S97 A;  3TFR A;  4ZOH C;  4EBD A;  5KL8 B;  1X9W A;  2YTU A;  5AKY A;  5DGB A;  4KMU A;  5KFR A;  5GTH U;  4DL3 A;  1RM6 C;  1WYG A;  4B9S A;  4EYH B;  3MR5 A;  2G0A A;  5CJ7 A;  4QWA A;  4ECU A;  1NK7 A;  4XQ8 A;  3N4M B;  4ECR A;  4EX6 A;  2KTQ A;  3NAS A;  5EE3 A;  4EEK A;  2F1J A;  3M9M B;  4C4S A;  4PGQ A;  3UXN A;  3KZX A;  3QXG A;  1L3S A;  4PL1 A;  2JGA A;  2BHN A;  5TIS U;  3Q8K A;  2Y0S C;  4EYI B;  1NOM A;  1S0O A;  2BPC A;  4MFF A;  4YD2 A;  2YN4 A;  1ED1 A;  5KFG A;  4O9M A;  2A1A A;  8ICO A;  1O03 A;  4EEL A;  2ZJ5 A;  3SEN A;  3KZI U;  4JK1 A;  2BDP A;  4RNN A;  1ZQK A;  5KFF A;  1N56 A;  1ZQE A;  3M6Z A;  2PKE A;  3BQ1 A;  2YML A;  2FPM A;  3FAH A;  4ED8 A;  3OPX A;  1TE2 A;  5KG4 A;  4NLC A;  3UQ0 A;  5ALD A;  4MEY A;  1KDH A;  3F2B A;  1Q8K A;  1L5U A;  4LJX A;  3RJI A;  5BOL A;  2BQU A;  3IV6 A;  3QNM A;  2XC9 A;  5J0Y A;  3O0F A;  1K1S A;  2F76 X;  4EZ9 A;  2G5I B;  3IP4 B;  5J2H A;  3V6H A;  2FLP A;  3Q8L A;  4LZG A;  2RP5 A;  2NV3 A;  3M8S A;  1WWU A;  5J2E A;  5KFT A;  1X40 A;  4RQ2 A;  4J9Q A;  2W8L A;  4QZC A;  7ICL A;  3CRX A;  2ZIV B;  4RQ7 A;  4RPY A;  2A19 A;  2BCV A;  1DGJ A;  3SR6 A;  3F5E A;  3E58 A;  5JUM A;  3F53 A;  4DL5 A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...