1UHUA

Solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
GSSGSSGTPLSLTLDHWSEIRSRAHNLSVEIKKGPWRTFCASEWPTFDVGWPPEGTFDLTVIFEVKAIVFQDGPGSHPDQQPYITVWQDLVQNSPPWIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords product of RIKEN cDNA 3110009E22
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1uhuA00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
2PFPA 2WF5A 4TQSA 2F8LA 2VJ5A 3M8RA 4BWMA 2DPJA 5DGAA 4Q44A 4ECVA 2M9NA 3NRWA 2JMGA 3UQ0A 4Z6EA 4ECRA 2MUTB 1QSYA 2BDPA 1VLBA 5CB1A 7ICIA 3UQ2A 2DUYA 2BZFA 1BPXA 3GIMA 1NJYA 2IMWP 3QU2A 2XO7A 2F76X 1XO0A 4PGQA 4UB5A 2K89A 4FZMA 3OHAA 2W8LA 4KLQA 3SZ2A 1S97A 5ALUA 2F77X 4ZH4A 5EWEA 3E2EA 8ICMA 1S77D 4BWJA 4US9A 1WUDA 3KTQA 4OJ6A 4CRXA 2MAXA 3SMVA 3C23A 4RPXA 7ICLA 2ZUCA 5C5JA 2JH7A 1XSNA 2OM6A 3I76A 1KLNA 1XC9A 1QQ5A 2K8CB 4F2SA 4J9OA 1DOQA 1Z1VA 4MHVA 1ZD2P 1MQ3A 1YT3A 4CF3A 1SKRA 4GC7A 4IR1A 3SQIA 2LMRA 2ESEA 4U7CA 4F2RA 2A1JB 3K1RB 2P66A 1XNSA 1CUKA 5ALNA 3KKAA 1N48A 5KFZA 1KFDA 1X6JA 2W03A 4LJXA 3F2DA 2F1HA 2W55A 5K4LA 4QZFA 5KFFA 4EZ9A 2W9BA 2XICA 3NS1A 4PZNA 1U4BA 4YR0A 4DSKA 3E0FA 2W8KA 3I1YA 3THVA 1Q46A 7ICUA 2AQ4A 1L8OA 5EOZA 8ICRA 5DG9A 1PZNA 2DPIA 2QB0B 5AIBA 9ICUA 2XI9A 1KFSA 4F50A 4UARA 3K4GA 4RT3A 1H38A 3TFSA 2H3VA 3LK9A 5AM2A 1SWWA 3M6ZA 3N28A 3CYMA 1U45A 3DDHA 1IV8A 3HRDD 3EZ5A 1RG6A 3H8JA 2P6UA 3EUB2 4P0PB 5AK5A 2PFOA 5KFVA 1VDVA 2KSOB 3GV8B 2RP5A 1BPEA 2HCFA 3EW9A 9ICOA 1RPLA 3DEEA 1T7PA 4K4IA 1S0VA 5T14A 2JEJA 2P35A 2C22A 1ZQFA 4RNOA 4Z6DA 3Q8LA 4EBEA 1Z00A 3MR6A 4RQMA 2VANA 4QZAA 2LPEA 3HP6A 3IHQB 5KFDA 4FZNA 3RR7A 4FO6A 5L1MA 1N2XA 5J8YA 2HVIA 1PVPA 2KV2A 1WCLA 2KKVA 4F91B 4IR9A 1L7MA 2HBKA 2W43A 1Z00B 4B9NA 3S6JA 1UQVA 4QWCA 4GIBA 2JZBB 1UA0A 1MQ2A 3NVVA 2QARB 4DL5A 2KFZA 4J9LA 5CJ7A 3PO4A 3CNHA 2RDJA 1ZQDA 4J9MA 1BPZA 2IOFK 3PMLA 4NY8A 2KICA 5C0YA 3TAPA 4YVZA 2W7PA 4QWAA 3HPOA 2ASDA 2AU0A 5KT4A 1L7OA 5ALMA 1JUDA 1L5UA 2OCEA 3HJEA 1COKA 2H3FA 5IIOA 5AIAA 1L3UA 1SXDA 3TARA 7ICEA 3C2MA 1QLNA 3PV8A 4KLUA 5D4BA 4NLZA 4KN4A 1JXLA 2XC9A 2K8BB 1PK1B 3WU2U 4QZBA 2W54A 3MABA 5KG0A 4I2JA 9ICTA 2MRLA 2IA6A 1NZBA 1FO4A 3C2LA 4YD1A 2NRTA 2K60A 5KNIA 4DOBA 4Y2YA 4GXIA 3WK5A 4RNMA 4R64A 2KFNA 2KJ9A 1TV9A 2XY5A 3K75D 1RQLA 3HKZC 4M9NA 4IRDA 4DLGA 3KBBA 2H3ZA 2PKEA 3BS5A 5KG3A 1HUZA 4PL2A 1SV0C 3LVVA 4Q8EA 2HHSA 2F8KA 1ZXIA 4HAIA 4KTQA 1SZHA 5IIKA 4DL4A 5KT7A 3B0YA 4NJ8A 5DBCA 1A77A 1ZQSA 7ICNA 1ZJMA 4B6JA 3SV3A 5ALHA 2XIDA 2ZJ8A 4F5PA 1YZ6A 1HEKA 4PHEA 1X6IA 5EE1A 2RQ5A 4C8MA 3GU3A 1MN8A 3Q8SB 3RJGA 2VA2A 1L3SA 3ONNA 5ALZA 2L5YA 2ZXIA 2HHXA 5AI0A 1ZQMA 4ZOHC 5KG5A 2R8GA 3M9MB 2KSOA 3RBDA 3V6KA 4CGZA 5DDYA 4IC9A 3PX0A 2UVVA 2AH5A 2HHWA 2BPGA 1OXJA 3MC1A 3CW2C 1RZTA 3NRZA 2DBYA 1ZQWA 4R66A 1PVQA 8ICAA 2Y0SF 5EE9A 4J9KA 4O9MA 2XCPA 3AU6A 2FDRA 3J81j 2CXYA 3EPIA 2R18A 2W9AA 4DFJA 3GDXA 1A0PA 5D49A 5KFUA 5J0YA 2MUTA 4ED2A 1F0MA 2FE9A 4ECTA 1WG8A 3U26A 2E1EA 1NNLA 2LYHA 2F1IA 1XSPA 4EELA 3B9JA 2LYBA 9ICSA 4KLFA 5AM0A 2HBMA 3IP4B 4O3PA 4F71A 1ECWA 3ZI4A 1ZQNA 4Y2RA 4PHAA 5KT3A 8ICLA 3AM9A 5CHGA 5J0WA 3PY8A 3BDPA 2YQEA 1JRPA 4F5OA 1X42A 5A0LA 4DQSA 8ICJA 3QNMA 1NKBA 5J0XA 1T3QA 3F2BA 4GXJA 3ZDDA 4EX7A 1O08A 1T3NA 2P6RA 2C28A 3I28A 2DGZA 4GFJA 3JPTA 3ISBA 5AKKA 4I2IA 5ALEA 3MDAA 5DQGA 2XY6A 2GWSA 5HMMA 1L8LA 4P0PA 4DF4A 4P0QB 3IRUA 3PNCA 2R8JA 2WHEA 7ICQA 1KW4A 2VKQA 4P2HA 7ICSA 2VJ4A 5J0TA 2EZZA 3UPQA 1TVAA 4HYKA 3N97B 5AKIA 5AM5A 4J9NA 2ISPA 2KZZA 4J9RA 1K1QA 5JRTA 1U9LA 4R63A 1NK5A 2I1QA 2Z7JA 3TKAA 1WWVA 2HHTA 3RTVA 5IILA 2E3TA 3V6HA 2FI1A 4MF2A 1ZRNA 4KLDA 1EXNA 3GIIA 9ICHA 2BDUA 2EH9A 3HILA 4IQUA 1L7PA 1LVHA 4KLJA 1KSPA 4F4XA 1B22A 4I2BA 4RQ1A 3HX0A 4EENA 3H0RB 3PZPA 9ICWA 2J6UA 2NRXA 1TK0A 5KFYA 4PHDA 4JB3A 4UB8U 5ALKA 2G5IB 5IINA 1NZPA 3QUQA 3PR5B 2EAPA 4YN4A 2A19A 2ISOA 1Q8KA 4BUGA 7ICRA 2HBLA 1D8YA 1UT8A 3H8MA 3SAHA 2BCQA 1QSSA 3RR8A 5L1JA 5ALXA 4IL6U 2LKYA 1FEZA 2D3DA 4EEKA 4DF8A 2G0AA 1XSLA 2V9WA 4UAUA 4I2HA 3V7KA 3CRXA 2GLEA 3RJFA 3WK8A 4RPZA 4M9GA 7ICHA 5AKEA 1KL9A 1JI7A 3H7IA 9ICXA 1UA1A 5IIJA 2B6GA 2KG5A 4ACOA 5ALGA 2C2EA 2KJ8A 2A3VA 3JPOA 4RQ7A 3ZDCA 1V97A 2I9GA 1ZQZA 1NOMA 4G9BA 2IHNA 4YP3A 3UMBA 4XRHA 5KFSA 3OSNA 4EYIB 9ICKA 1ZQGA 2C2DA 4KLHA 2HSZA 3NUQA 4Y2TA 3EYZA 4IQVA 5J8YC 2HW3A 4DL7A 1NK6A 4Q45A 4PH5A 5BPCA 3M6KA 4Y2UA 9ICFA 2KD1A 2BQ3A 8ICVA 3Q8PB 2AXTU 4UW9A 3KHLA 2KOBA 3PSPA 1KRPA 4RQ6A 2ZG6A 3MFIA 8ICKA 2KKPA 4RUCA 1L3VA 4NLKA 1URJA 5J2GA 2BHNA 8ICZA 3SAGA 4F72A 4RQNA 5KFIA 5KFRA 3F5AA 4IRKA 2E8NA 4ECWA 1VJ5A 4Q43A 4P4OA 4KLEA 4Y2QA 5DG7A 4FFDA 2OYYA 4BDPA 4TUPA 1ZQTA 5AKYA 3ORYA 4B9MA 4YMOA 4OD0A 3ICXA 3WKCA 2OXOA 4ED8A 2Y9UA 3N7PD 3OTQA 8ICBA 5GTHU 3Q8KA 2K4HA 3PW5A 4YXMA 9ICIA 4TQRA 2BQUA 1ZQXA 5DQIA 3BS5B 3DV9A 1ZETA 1UPHA 8ICOA 4C8OA 4JUZA 4Y2JA 1N63A 3H8WA 4O3NA 3G6XA 4IS7A 3B0XA 1DXSA 5AM1A 3E58A 3FYHA 4QZHA 2F44A 4UAWA 4YD2A 4NLGA 3H40A 2A1AA 4EZ6A 3H8SA 5DGBA 5CP2A 3QYPA 2PMZC 1ZRMA 1NI3A 3OPXA 5KG1A 4AYBC 4KMOB 3UMGA 2W9CB 2R8IA 8ICUA 4GLXA 8ICFA 4XUSA 4QIWC 2ZUDA 3HW8A 3T3FA 2MU2A 1TE2A 2RDIA 2PFNA 2G07A 1N62A 2HBJA 5AKJA 4RT2A 3RJJA 3M9NB 1SB3C 1TAMA 4FS2A 3C29A 4DSIA 3AL0B 5AKHA 1S9FA 1KKXA 3JPRA 1ZQHA 1IG6A 2KZ3A 3RH4A 4QZ9A 9ICCA 2W9CA 2BCUA 4ELUA 2FPMA 3QU7A 4TUSA 2K8AA 5F3XB 4KLIA 5KG6A 3IG8A 1Q3UA 4YR2A 9ICNA 1ZYQA 1HJPA 3C2KA 5J29A 1C20A 2ODGA 3LVWA 4DEZA 3PSIA 3BZCA 4XA5A 4OCZA 4ECXA 4KLTA 3MDCA 3LYSA 1L7NA 2AHOB 2WAQC 3QX7A 5KL8B 3AQFA 2JEGA 4DQPA 5DB6A 1D8BA 3F53A 3GV5B 2KNJA 3QEAZ 2FLLA 1WYGA 9ICVA 3NASA 4CF5A 1JMSA 3QE9Y 4J03A 3RRGA 3MBYA 1V38A 5HHHA 3UXOA 2BCSA 2BPCA 3UM9A 3G6YA 1FIQA 5IIMA 1CI4A 4NV0A 2ZTEA 1ZQOA 5DLFA 5KFPA 3MR2A 5ALLA 3KFUF 4U6PA 3IN5A 2EZYA 2WB1F 1S10A 4A8EA 3QU9A 5EWFA 2JGAA 8ICIA 5AKGA 7ICTA 3PW4A 3RAQA 5B66U 2YMLA 5KFBA 2ATLA 2NYVA 1DK3A 1TKDA 2KHVA 2WF6A 3RF9A 8ICTA 4QWDA 1RDFA 1TFRA 2JR5A 3TQ1A 5ALOA 3L3FX 3NTUA 3FC4A 5G5HA 3BQ0A 4OJOA 2NO4A 3V7LA 7ICJA 2WF8A 2ZUBA 4B9TA 4O5KA 3AEVA 2JXJA 4NLBA 1ZQQA 4UB6U 1BVSA 4C8LA 1X9XA 1ZQIA 4BXOA 4DQRA 3C21A 1RYSA 3PW0A 2F3NA 4F92B 4O3RA 2KTQA 2KMDA 3KHHA 4K4GA 1AROP 1UHUA 5ALYA 1BNOA 3QXGA 2ZTDA 5DQHA 5GTIU 3KHRA 4DS4A 3C28A 2M0NA 3ZDEA 4WJ3B 4YFKA 3ZD8A 4DFDA 8ICNA 1PUZA 1UCVA 3BZKA 8ICEA 4I2CA 3KD3A 5ALTA 2E5SA 7ICGA 2RRDA 1BGXT 2CN1A 2W3SA 5ALRA 1Q3VA 3QUTA 4CE6A 3PW7A 1J2MA 3BS7A 1X9SA 3SV4A 2ASLA 1DRGA 4IQTA 2B0CA 1SIJA 5KFHA 2FMSA 2IOHA 1TK5A 5KAIU 2F1JA 3EWAA 2OH2A 4OO1J 2JEFA 4DQQA 3RB4A 3PX6A 4R65A 4ED0A 2AJQA 3MGIA 3T5HA 4EEYA 4KLOA 4CF4A 5J2KA 2KE7A 1OUQA 1K1SA 4P0QA 4M9HA 4KLMA 4DOAA 4I2DA 2BCRA 4DFPA 5IIIA 1TK8A 5D46A 4JV2A 2HMXA 4YCXA 1KEJA 1KBUA 1F5SA 4Y2SA 2ZIUA 2EAOA 1YZ7A 1SWVA 1BPDA 2A1JA 4O3MA 5KFEA 3WKEA 5ALDA 3WK7A 2VA3A 2GH1A 5J0SA 3RJIA 2DKXA 3VCBA 3V6JA 4UB1A 1UT5A 4MFAA 3WK9A 2WAQF 2H5XA 2CPRA 4BJQA 3IDWA 1Z3EB 2ZIVA 2ZIUB 2O6KA 3QU4A 4EBCA 4GXKA 3PX4A 2EQYA 4JK1A 2UVUA 5DBAA 3ETRA 3N7RC 2YX8A 3PSTA 4US8A 2W11A 4EBDA 5AI4A 5DKWA 4UBBA 1MA7A 1Z4NA 2MSNA 3NVZA 2W7OA 9ICEA 4P4PA 4I2FA 4JV1A 4YR3A 5ALFA 2ZIVB 1Y88A 3PR4A 4F3OA 8ICCA 3GFKB 1ZQBA 1U47A 3KKAC 1NKCA 2LM1A 2LM4A 2ZTCA 5KFNA 3MR5A 4RNNA 3F5EA 5KT6A 2K4EA 1JX4A 4DSJA 4KLLA 4O0IA 1SZPA 4NLCA 4NXZA 4EX6A 1FFUA 4KITB 4QWBA 3RAXA 3C5GA 3QUCA 1XU4A 4XQ8A 2E8MA 5HHIA 5JTIA 4F5RA 5B5EU 5ALIA 4M04A 4OJLA 2DWQA 1RYUA 2EAMA 4YG2A 3ZDAA 2DL0A 5EE3A 2E1FA 5AK4A 1O03A 5KG7A 1SL1A 1RM6C 2FMPA 3OSPA 1P7DA 2KVSA 1BPYA 2GOLA 5EE0A 3Q8RB 1OW5A 3VC8A 3OJSA 2I6XA 2JZBA 5L9XA 5DB7A 4PZOA 4F4KA 1V85A 3TACB 2FJ6A 3SD7A 4O5EA 5J2IA 2FPLA 5AK6A 4O3SA 3T5JA 2KP7A 1Z1BA 3V7JA 4ED6A 1L3TA 3OHBA 5JUMA 1HIWA 5J0UA 4P4MA 4RQ0A 5AI8A 1MC8A 1SV0A 4GC6A 1NK0A 2FLPA 2YN4A 4ICAA 4C80A 1PK1A 5HR6A 1NJXA 1ZQ1C 1ZQJA 4C8NA 5AI9A 3A0HU 3C1YA 5AI5A 1ZQPA 2H3QA 4ECSA 2QB1A 8ICXA 2IHMA 2JRZA 3BQ2A 4QZIA 1ZQLA 1SXEA 1ZJNA 4F93B 1SKWA 3NGDA 4DL3A 2EDUA 2NRVA 5ALSA 1ZOLA 4UAVA 1DGSA 5KFKA 1LV5A 3L5KA 4KN7A 2AQ0A 2KEYA 3TADC 3ED5A 1V9PA 2XY7A 4F5QA 3BQ7A 3SYZA 1QTMA 4MFFA 1X40A 3QU5A 4DQIA 3SAFA 1B0XA 3RJHA 5L1LA 5HNKA 4M47A 2ZJAA 4QWEA 5KT5A 3T5LA 2AGPA 2I5HA 4DLEA 5KL1B 2KN7A 3ISCA 2FLNA 4FZLA 4J9SA 4B9LA 4B9SA 5L1IA 1X2IA 3GQCA 5EWGA 4AYBF 4FS1A 3SI8A 5HMLA 3HWTA 5KFOA 3C5FA 2MA1A 5KAFU 4C7YA 4DCCA 5TISU 1J97A 4BXOB 3HT3A 4QZGA 4LZGA 4QW9A 2KZMA 4YQWA 4PPXA 4O5CA 1DK2A 1ZQRA 3G6VA 3KZIU 2AGQA 3RB6A 3D2SA 2WF9A 7ICVA 4MEYA 5ALVA 4QZ8A 4TURA 4DL2A 9ICLA 2YMQA 2FMQA 7ICFA 1KQQA 3MR3A 2D6FC 2J6SA 2NV3A 2KIWA 2V4RA 2JH1A 5BOMA 1S0OA 3RJKA 5JU5A 7ICOA 2V4QA 4C4TA 3QZ7A 5AKXA 3QUBA 5ALWA 4NL9A 2BPFA 1ZD4A 4QZEA 4ECZA 4QJFB 4O3QA 4B9UA 2YY6A 1NK4A 4DS5A 4FBUA 3RB0A 1ZQAA 1ZD5A 1SGGA 5DG8A 5KFCA 5J0OA 2HI0A 3RH5A 3TI0A 3JPQA 3AUOA 2Y9TA 1PK3A 2PXIA 2LBOA 1N5WA 3TFRA 3JPSA 4UB4A 5AM4A 4UAYA 2BKEA 4USAA 1T94A 2F2AB 4TUQA 1BNPA 5J2JA 4RQ4A 5KT2A 3NVWA 4ED3A 5J2AA 4PGXA 2DQNB 1QCKA 1TAQA 4I29A 3WK6A 2YTUA 1D8LA 4KLGA 4I2AA 2ES6A 1M6YA 1X66A 2ALZA 1PVRA 3JPPA 2HOFA 4M9LA 4M2YA 5KFQA 1D9FA 1S8OA 4NM1A 4B9VA 7ICKA 2EZXA 2UVWA 5AKZA 4RUAA 5J2EA 3OJUA 2LI6A 3RFAA 8ICPA 1IXRA 5F9LA 3ZD9A 4I28A 4M6WA 2HOIA 3TANA 2NRWA 4Z6CA 1NJZA 2ASJA 1J2NA 2AGOA 4F5NA 3O0FA 4NM2A 2W9MA 3BQTA 1ZQVA 2YMMA 4UB3A 1T4GA 4UQGA 2K4PA 2D8CA 2GO7A 4KMUA 3WKAA 2WB1C 8ICYA 5AI6A 5ALJA 2C2RA 4MFCA 2OEHA 3RB3A 2YB1A 4X5VA 1AQ6A 3H4BA 1S0NA 5F9NA 3Q8MA 1NK8A 1S76D 4M9JA 2QB0A 3LDAA 2WF7A 4QW8A 3D2NA 4CCHA 3M1YA 3MGHA 2QLTA 1RYRA 5CEHA 1Z4OA 3PVXA 2PI5A 3IG5A 4O3OA 9ICBA 4RZRA 9ICGA 4JWMA 2K4IA 2ZXHA 4PGYA 3AN1A 1DGJA 2E8OA 3UXPA 3T5KA 3JPNA 5E79U 3L4PA 2XGQA 3TADA 2Y1IA 1NKEA 3H0LB 3SR6A 1QSLA 4JMUA 2KHQA 4LZDA 3FDSA 5KFGA 4UATA 3GIKA 3QZ8A 5J0RA 2PFQA 1N5XA 2NRZA 5J2CA 3IV6A 4J9QA 1QQ7A 8ICGA 5KG2A 1S0MA 2HDOA 5KFMA 2YMPA 4PHPA 2G08A 5J2DA 5BOLA 4MF8A 2R8HA 4RU9A 2BR0A 4DOCA 4MEXA 5KFXA 4QZCA 3BQ1A 4DSFA 4ELTA 3UXNA 4F8RA 1U48A 3ISDA 1F44A 4Q8FA 5H2FU 3GZFA 3TAQA 3Q8QB 2WTFA 3IM1A 3KHGA 2YB4A 1GO3F 2JV3A 3K1ZA 2LYAA 4OJPA 4RQ5A 2G5HB 4ECUA 5ALPA 2Q4TA 5DLGA 3N7SC 1ZD3A 4ED7A 4UB2A 1D9DA 4LVSA 4QNLA 3MGVA 1L6NA 3H0MB 1COOA 4KX5A 2VA8A 1JROA 3BJYA 4UAZA 1ZQKA 2RLTA 4PJ0U 2KJ5A 9ICMA 4Z6FA 5DBBA 3D2QA 5J2BA 4C7ZA 4J9PA 4C4RA 2Q0ZX 2KK0A 4FBTA 2BQRA 4Y2VA 1XO1A 8ICWA 3A0BU 1KTQA 9ICQA 4C4SA 2ZIWA 1KFTA 3SENA 3WKDA 4F4YA 2UVRA 1ZQEA 3FM9A 2RHFA 4CNQA 1A6SA 1RXVA 4DFKA 3RH6A 5DB8A 1NK9A 2Y0SC 8ICHA 5J0QA 5KFAA 9ICPA 4FE3A 3CP8A 4JV0A 1FFVA 4R8UA 7ICPA 1U49A 5G5GA 2W9BB 3LWMA 1RQNA 2XCAA 4OJ5A 4F4ZA 1JXEA 5CWRA 3PW2A 8ICSA 1NK7A 4UBCA 8ICQA 2VIXA 3ETLA 2IBKA 5AKLA 2ZJ5A 2HHUA 5HP4A 3PO5A 9ICAA 2WFAA 1C7YA 3WK4A 3GILA 3V72A 4NWIA 3AMZA 4R8UB 1KDHA 2DF4B 1XS9D 4G3IA 3WKBA 5AHXA 4QZDA 1SKSA 5HR7A 3UMCA 2JEIA 2XVTA 4UASA 2J6TA 5CA7A 3NVYA 3RJEA 4RQ3A 2LHTA 3C1ZA 3QEBZ 5KFTA 1CEZA 5AK3A 2BGWA 1HUOA 2PI4A 4DL6A 3PSFA 3R9KA 4JWNA 4RPYA 4EYHB 4IRCA 2G06A 1TAUA 2QKQA 3T79A 4BGDA 2DFLA 1JIHA 3PMNA 1LKYB 4DSLA 1N60A 4ECYA 2Y1JA 1N56A 1WWUA 2IOFA 3HKZF 2W04A 4YMNA 1MSWD 1QQ6A 3KZXA 5KFWA 4DFMA 3EPGA 4Y2PA 4I2EA 5KFLA 4CDGA 3GIJA 2OHFA 4F4WA 1T8EA 4DWIA 2DKZA 2G09A 2N1RA 3GV7B 4E0DA 1LKYA 9ICRA 2XGPA 4QIWF 1NJWA 1IM4A 1SV4A 9ICJA 4M0AA 1K5OA 5AICA 2OWOA 3M9OB 1A76A 5AM3A 2CRXA 5KTQA 5J2FA 2FPKA 5CRXA 2PMZF 1S5LU 4M6WB 4IQWA 5DB9A 7ICMA 3M7DA 4DSEA 2KIVA 1LB2B 2B21A 2QARA 4NL9C 2HOQA 2JHDA 1BPBA 3KOOA 3N4MB 1X9MA 4RQ8A 2R8KA 5TZVA 2HHQA 3SEIA 1B4FA 4ED1A 3RBEA 4K4HA 5ALQA 4YXJA 5L1KA 4ECQA 5FP0A 1IIPA 5J2HA 1XWLA 4I27A 1CRXA 5CR0A 1B43A 3LWLA 1QH9A 2EANA 3AU2A 4PL1A 4KLSA 2BCVA 1SL0A 3ZDBA 2KVCA 3ALRA 3D6JA 4I2GA 5KG4A 3FAHA 1SL2A 4C8KA 2ZIXA 2NO5A 4KX3A 1ZQCA 3OGUA 1JN3A 4AP9A 2HVHA 4RQ2A 4BX9C 1WCNA 1ZQUA 3M8SA 2ZIWB 4ELVA 5DDMA 3RRHA 1RXWA 4NLNA 2H3IA 1ED1A 4YMMA 3MFHA 5KFJA 4DO9A 5J0PA 2E8PA 1Z19A 1ZQYA 4C0ZA 3F2CA 3AQEA 3H4DA 2HHVA 1X9WA 2ZIXB 1N61A 1KN5A 1JALA 2W3RA 4Y2XA
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 2PFP A;  2WF5 A;  4TQS A;  2F8L A;  2VJ5 A;  3M8R A;  4BWM A;  2DPJ A;  5DGA A;  4Q44 A;  4ECV A;  2M9N A;  3NRW A;  2JMG A;  3UQ0 A;  4Z6E A;  4ECR A;  2MUT B;  1QSY A;  2BDP A;  1VLB A;  5CB1 A;  7ICI A;  3UQ2 A;  2DUY A;  2BZF A;  1BPX A;  3GIM A;  1NJY A;  2IMW P;  3QU2 A;  2XO7 A;  2F76 X;  1XO0 A;  4PGQ A;  4UB5 A;  2K89 A;  4FZM A;  3OHA A;  2W8L A;  4KLQ A;  3SZ2 A;  1S97 A;  5ALU A;  2F77 X;  4ZH4 A;  5EWE A;  3E2E A;  8ICM A;  1S77 D;  4BWJ A;  4US9 A;  1WUD A;  3KTQ A;  4OJ6 A;  4CRX A;  2MAX A;  3SMV A;  3C23 A;  4RPX A;  7ICL A;  2ZUC A;  5C5J A;  2JH7 A;  1XSN A;  2OM6 A;  3I76 A;  1KLN A;  1XC9 A;  1QQ5 A;  2K8C B;  4F2S A;  4J9O A;  1DOQ A;  1Z1V A;  4MHV A;  1ZD2 P;  1MQ3 A;  1YT3 A;  4CF3 A;  1SKR A;  4GC7 A;  4IR1 A;  3SQI A;  2LMR A;  2ESE A;  4U7C A;  4F2R A;  2A1J B;  3K1R B;  2P66 A;  1XNS A;  1CUK A;  5ALN A;  3KKA A;  1N48 A;  5KFZ A;  1KFD A;  1X6J A;  2W03 A;  4LJX A;  3F2D A;  2F1H A;  2W55 A;  5K4L A;  4QZF A;  5KFF A;  4EZ9 A;  2W9B A;  2XIC A;  3NS1 A;  4PZN A;  1U4B A;  4YR0 A;  4DSK A;  3E0F A;  2W8K A;  3I1Y A;  3THV A;  1Q46 A;  7ICU A;  2AQ4 A;  1L8O A;  5EOZ A;  8ICR A;  5DG9 A;  1PZN A;  2DPI A;  2QB0 B;  5AIB A;  9ICU A;  2XI9 A;  1KFS A;  4F50 A;  4UAR A;  3K4G A;  4RT3 A;  1H38 A;  3TFS A;  2H3V A;  3LK9 A;  5AM2 A;  1SWW A;  3M6Z A;  3N28 A;  3CYM A;  1U45 A;  3DDH A;  1IV8 A;  3HRD D;  3EZ5 A;  1RG6 A;  3H8J A;  2P6U A;  3EUB 2;  4P0P B;  5AK5 A;  2PFO A;  5KFV A;  1VDV A;  2KSO B;  3GV8 B;  2RP5 A;  1BPE A;  2HCF A;  3EW9 A;  9ICO A;  1RPL A;  3DEE A;  1T7P A;  4K4I A;  1S0V A;  5T14 A;  2JEJ A;  2P35 A;  2C22 A;  1ZQF A;  4RNO A;  4Z6D A;  3Q8L A;  4EBE A;  1Z00 A;  3MR6 A;  4RQM A;  2VAN A;  4QZA A;  2LPE A;  3HP6 A;  3IHQ B;  5KFD A;  4FZN A;  3RR7 A;  4FO6 A;  5L1M A;  1N2X A;  5J8Y A;  2HVI A;  1PVP A;  2KV2 A;  1WCL A;  2KKV A;  4F91 B;  4IR9 A;  1L7M A;  2HBK A;  2W43 A;  1Z00 B;  4B9N A;  3S6J A;  1UQV A;  4QWC A;  4GIB A;  2JZB B;  1UA0 A;  1MQ2 A;  3NVV A;  2QAR B;  4DL5 A;  2KFZ A;  4J9L A;  5CJ7 A;  3PO4 A;  3CNH A;  2RDJ A;  1ZQD A;  4J9M A;  1BPZ A;  2IOF K;  3PML A;  4NY8 A;  2KIC A;  5C0Y A;  3TAP A;  4YVZ A;  2W7P A;  4QWA A;  3HPO A;  2ASD A;  2AU0 A;  5KT4 A;  1L7O A;  5ALM A;  1JUD A;  1L5U A;  2OCE A;  3HJE A;  1COK A;  2H3F A;  5IIO A;  5AIA A;  1L3U A;  1SXD A;  3TAR A;  7ICE A;  3C2M A;  1QLN A;  3PV8 A;  4KLU A;  5D4B A;  4NLZ A;  4KN4 A;  1JXL A;  2XC9 A;  2K8B B;  1PK1 B;  3WU2 U;  4QZB A;  2W54 A;  3MAB A;  5KG0 A;  4I2J A;  9ICT A;  2MRL A;  2IA6 A;  1NZB A;  1FO4 A;  3C2L A;  4YD1 A;  2NRT A;  2K60 A;  5KNI A;  4DOB A;  4Y2Y A;  4GXI A;  3WK5 A;  4RNM A;  4R64 A;  2KFN A;  2KJ9 A;  1TV9 A;  2XY5 A;  3K75 D;  1RQL A;  3HKZ C;  4M9N A;  4IRD A;  4DLG A;  3KBB A;  2H3Z A;  2PKE A;  3BS5 A;  5KG3 A;  1HUZ A;  4PL2 A;  1SV0 C;  3LVV A;  4Q8E A;  2HHS A;  2F8K A;  1ZXI A;  4HAI A;  4KTQ A;  1SZH A;  5IIK A;  4DL4 A;  5KT7 A;  3B0Y A;  4NJ8 A;  5DBC A;  1A77 A;  1ZQS A;  7ICN A;  1ZJM A;  4B6J A;  3SV3 A;  5ALH A;  2XID A;  2ZJ8 A;  4F5P A;  1YZ6 A;  1HEK A;  4PHE A;  1X6I A;  5EE1 A;  2RQ5 A;  4C8M A;  3GU3 A;  1MN8 A;  3Q8S B;  3RJG A;  2VA2 A;  1L3S A;  3ONN A;  5ALZ A;  2L5Y A;  2ZXI A;  2HHX A;  5AI0 A;  1ZQM A;  4ZOH C;  5KG5 A;  2R8G A;  3M9M B;  2KSO A;  3RBD A;  3V6K A;  4CGZ A;  5DDY A;  4IC9 A;  3PX0 A;  2UVV A;  2AH5 A;  2HHW A;  2BPG A;  1OXJ A;  3MC1 A;  3CW2 C;  1RZT A;  3NRZ A;  2DBY A;  1ZQW A;  4R66 A;  1PVQ A;  8ICA A;  2Y0S F;  5EE9 A;  4J9K A;  4O9M A;  2XCP A;  3AU6 A;  2FDR A;  3J81 j;  2CXY A;  3EPI A;  2R18 A;  2W9A A;  4DFJ A;  3GDX A;  1A0P A;  5D49 A;  5KFU A;  5J0Y A;  2MUT A;  4ED2 A;  1F0M A;  2FE9 A;  4ECT A;  1WG8 A;  3U26 A;  2E1E A;  1NNL A;  2LYH A;  2F1I A;  1XSP A;  4EEL A;  3B9J A;  2LYB A;  9ICS A;  4KLF A;  5AM0 A;  2HBM A;  3IP4 B;  4O3P A;  4F71 A;  1ECW A;  3ZI4 A;  1ZQN A;  4Y2R A;  4PHA A;  5KT3 A;  8ICL A;  3AM9 A;  5CHG A;  5J0W A;  3PY8 A;  3BDP A;  2YQE A;  1JRP A;  4F5O A;  1X42 A;  5A0L A;  4DQS A;  8ICJ A;  3QNM A;  1NKB A;  5J0X A;  1T3Q A;  3F2B A;  4GXJ A;  3ZDD A;  4EX7 A;  1O08 A;  1T3N A;  2P6R A;  2C28 A;  3I28 A;  2DGZ A;  4GFJ A;  3JPT A;  3ISB A;  5AKK A;  4I2I A;  5ALE A;  3MDA A;  5DQG A;  2XY6 A;  2GWS A;  5HMM A;  1L8L A;  4P0P A;  4DF4 A;  4P0Q B;  3IRU A;  3PNC A;  2R8J A;  2WHE A;  7ICQ A;  1KW4 A;  2VKQ A;  4P2H A;  7ICS A;  2VJ4 A;  5J0T A;  2EZZ A;  3UPQ A;  1TVA A;  4HYK A;  3N97 B;  5AKI A;  5AM5 A;  4J9N A;  2ISP A;  2KZZ A;  4J9R A;  1K1Q A;  5JRT A;  1U9L A;  4R63 A;  1NK5 A;  2I1Q A;  2Z7J A;  3TKA A;  1WWV A;  2HHT A;  3RTV A;  5IIL A;  2E3T A;  3V6H A;  2FI1 A;  4MF2 A;  1ZRN A;  4KLD A;  1EXN A;  3GII A;  9ICH A;  2BDU A;  2EH9 A;  3HIL A;  4IQU A;  1L7P A;  1LVH A;  4KLJ A;  1KSP A;  4F4X A;  1B22 A;  4I2B A;  4RQ1 A;  3HX0 A;  4EEN A;  3H0R B;  3PZP A;  9ICW A;  2J6U A;  2NRX A;  1TK0 A;  5KFY A;  4PHD A;  4JB3 A;  4UB8 U;  5ALK A;  2G5I B;  5IIN A;  1NZP A;  3QUQ A;  3PR5 B;  2EAP A;  4YN4 A;  2A19 A;  2ISO A;  1Q8K A;  4BUG A;  7ICR A;  2HBL A;  1D8Y A;  1UT8 A;  3H8M A;  3SAH A;  2BCQ A;  1QSS A;  3RR8 A;  5L1J A;  5ALX A;  4IL6 U;  2LKY A;  1FEZ A;  2D3D A;  4EEK A;  4DF8 A;  2G0A A;  1XSL A;  2V9W A;  4UAU A;  4I2H A;  3V7K A;  3CRX A;  2GLE A;  3RJF A;  3WK8 A;  4RPZ A;  4M9G A;  7ICH A;  5AKE A;  1KL9 A;  1JI7 A;  3H7I A;  9ICX A;  1UA1 A;  5IIJ A;  2B6G A;  2KG5 A;  4ACO A;  5ALG A;  2C2E A;  2KJ8 A;  2A3V A;  3JPO A;  4RQ7 A;  3ZDC A;  1V97 A;  2I9G A;  1ZQZ A;  1NOM A;  4G9B A;  2IHN A;  4YP3 A;  3UMB A;  4XRH A;  5KFS A;  3OSN A;  4EYI B;  9ICK A;  1ZQG A;  2C2D A;  4KLH A;  2HSZ A;  3NUQ A;  4Y2T A;  3EYZ A;  4IQV A;  5J8Y C;  2HW3 A;  4DL7 A;  1NK6 A;  4Q45 A;  4PH5 A;  5BPC A;  3M6K A;  4Y2U A;  9ICF A;  2KD1 A;  2BQ3 A;  8ICV A;  3Q8P B;  2AXT U;  4UW9 A;  3KHL A;  2KOB A;  3PSP A;  1KRP A;  4RQ6 A;  2ZG6 A;  3MFI A;  8ICK A;  2KKP A;  4RUC A;  1L3V A;  4NLK A;  1URJ A;  5J2G A;  2BHN A;  8ICZ A;  3SAG A;  4F72 A;  4RQN A;  5KFI A;  5KFR A;  3F5A A;  4IRK A;  2E8N A;  4ECW A;  1VJ5 A;  4Q43 A;  4P4O A;  4KLE A;  4Y2Q A;  5DG7 A;  4FFD A;  2OYY A;  4BDP A;  4TUP A;  1ZQT A;  5AKY A;  3ORY A;  4B9M A;  4YMO A;  4OD0 A;  3ICX A;  3WKC A;  2OXO A;  4ED8 A;  2Y9U A;  3N7P D;  3OTQ A;  8ICB A;  5GTH U;  3Q8K A;  2K4H A;  3PW5 A;  4YXM A;  9ICI A;  4TQR A;  2BQU A;  1ZQX A;  5DQI A;  3BS5 B;  3DV9 A;  1ZET A;  1UPH A;  8ICO A;  4C8O A;  4JUZ A;  4Y2J A;  1N63 A;  3H8W A;  4O3N A;  3G6X A;  4IS7 A;  3B0X A;  1DXS A;  5AM1 A;  3E58 A;  3FYH A;  4QZH A;  2F44 A;  4UAW A;  4YD2 A;  4NLG A;  3H40 A;  2A1A A;  4EZ6 A;  3H8S A;  5DGB A;  5CP2 A;  3QYP A;  2PMZ C;  1ZRM A;  1NI3 A;  3OPX A;  5KG1 A;  4AYB C;  4KMO B;  3UMG A;  2W9C B;  2R8I A;  8ICU A;  4GLX A;  8ICF A;  4XUS A;  4QIW C;  2ZUD A;  3HW8 A;  3T3F A;  2MU2 A;  1TE2 A;  2RDI A;  2PFN A;  2G07 A;  1N62 A;  2HBJ A;  5AKJ A;  4RT2 A;  3RJJ A;  3M9N B;  1SB3 C;  1TAM A;  4FS2 A;  3C29 A;  4DSI A;  3AL0 B;  5AKH A;  1S9F A;  1KKX A;  3JPR A;  1ZQH A;  1IG6 A;  2KZ3 A;  3RH4 A;  4QZ9 A;  9ICC A;  2W9C A;  2BCU A;  4ELU A;  2FPM A;  3QU7 A;  4TUS A;  2K8A A;  5F3X B;  4KLI A;  5KG6 A;  3IG8 A;  1Q3U A;  4YR2 A;  9ICN A;  1ZYQ A;  1HJP A;  3C2K A;  5J29 A;  1C20 A;  2ODG A;  3LVW A;  4DEZ A;  3PSI A;  3BZC A;  4XA5 A;  4OCZ A;  4ECX A;  4KLT A;  3MDC A;  3LYS A;  1L7N A;  2AHO B;  2WAQ C;  3QX7 A;  5KL8 B;  3AQF A;  2JEG A;  4DQP A;  5DB6 A;  1D8B A;  3F53 A;  3GV5 B;  2KNJ A;  3QEA Z;  2FLL A;  1WYG A;  9ICV A;  3NAS A;  4CF5 A;  1JMS A;  3QE9 Y;  4J03 A;  3RRG A;  3MBY A;  1V38 A;  5HHH A;  3UXO A;  2BCS A;  2BPC A;  3UM9 A;  3G6Y A;  1FIQ A;  5IIM A;  1CI4 A;  4NV0 A;  2ZTE A;  1ZQO A;  5DLF A;  5KFP A;  3MR2 A;  5ALL A;  3KFU F;  4U6P A;  3IN5 A;  2EZY A;  2WB1 F;  1S10 A;  4A8E A;  3QU9 A;  5EWF A;  2JGA A;  8ICI A;  5AKG A;  7ICT A;  3PW4 A;  3RAQ A;  5B66 U;  2YML A;  5KFB A;  2ATL A;  2NYV A;  1DK3 A;  1TKD A;  2KHV A;  2WF6 A;  3RF9 A;  8ICT A;  4QWD A;  1RDF A;  1TFR A;  2JR5 A;  3TQ1 A;  5ALO A;  3L3F X;  3NTU A;  3FC4 A;  5G5H A;  3BQ0 A;  4OJO A;  2NO4 A;  3V7L A;  7ICJ A;  2WF8 A;  2ZUB A;  4B9T A;  4O5K A;  3AEV A;  2JXJ A;  4NLB A;  1ZQQ A;  4UB6 U;  1BVS A;  4C8L A;  1X9X A;  1ZQI A;  4BXO A;  4DQR A;  3C21 A;  1RYS A;  3PW0 A;  2F3N A;  4F92 B;  4O3R A;  2KTQ A;  2KMD A;  3KHH A;  4K4G A;  1ARO P;  1UHU A;  5ALY A;  1BNO A;  3QXG A;  2ZTD A;  5DQH A;  5GTI U;  3KHR A;  4DS4 A;  3C28 A;  2M0N A;  3ZDE A;  4WJ3 B;  4YFK A;  3ZD8 A;  4DFD A;  8ICN A;  1PUZ A;  1UCV A;  3BZK A;  8ICE A;  4I2C A;  3KD3 A;  5ALT A;  2E5S A;  7ICG A;  2RRD A;  1BGX T;  2CN1 A;  2W3S A;  5ALR A;  1Q3V A;  3QUT A;  4CE6 A;  3PW7 A;  1J2M A;  3BS7 A;  1X9S A;  3SV4 A;  2ASL A;  1DRG A;  4IQT A;  2B0C A;  1SIJ A;  5KFH A;  2FMS A;  2IOH A;  1TK5 A;  5KAI U;  2F1J A;  3EWA A;  2OH2 A;  4OO1 J;  2JEF A;  4DQQ A;  3RB4 A;  3PX6 A;  4R65 A;  4ED0 A;  2AJQ A;  3MGI A;  3T5H A;  4EEY A;  4KLO A;  4CF4 A;  5J2K A;  2KE7 A;  1OUQ A;  1K1S A;  4P0Q A;  4M9H A;  4KLM A;  4DOA A;  4I2D A;  2BCR A;  4DFP A;  5III A;  1TK8 A;  5D46 A;  4JV2 A;  2HMX A;  4YCX A;  1KEJ A;  1KBU A;  1F5S A;  4Y2S A;  2ZIU A;  2EAO A;  1YZ7 A;  1SWV A;  1BPD A;  2A1J A;  4O3M A;  5KFE A;  3WKE A;  5ALD A;  3WK7 A;  2VA3 A;  2GH1 A;  5J0S A;  3RJI A;  2DKX A;  3VCB A;  3V6J A;  4UB1 A;  1UT5 A;  4MFA A;  3WK9 A;  2WAQ F;  2H5X A;  2CPR A;  4BJQ A;  3IDW A;  1Z3E B;  2ZIV A;  2ZIU B;  2O6K A;  3QU4 A;  4EBC A;  4GXK A;  3PX4 A;  2EQY A;  4JK1 A;  2UVU A;  5DBA A;  3ETR A;  3N7R C;  2YX8 A;  3PST A;  4US8 A;  2W11 A;  4EBD A;  5AI4 A;  5DKW A;  4UBB A;  1MA7 A;  1Z4N A;  2MSN A;  3NVZ A;  2W7O A;  9ICE A;  4P4P A;  4I2F A;  4JV1 A;  4YR3 A;  5ALF A;  2ZIV B;  1Y88 A;  3PR4 A;  4F3O A;  8ICC A;  3GFK B;  1ZQB A;  1U47 A;  3KKA C;  1NKC A;  2LM1 A;  2LM4 A;  2ZTC A;  5KFN A;  3MR5 A;  4RNN A;  3F5E A;  5KT6 A;  2K4E A;  1JX4 A;  4DSJ A;  4KLL A;  4O0I A;  1SZP A;  4NLC A;  4NXZ A;  4EX6 A;  1FFU A;  4KIT B;  4QWB A;  3RAX A;  3C5G A;  3QUC A;  1XU4 A;  4XQ8 A;  2E8M A;  5HHI A;  5JTI A;  4F5R A;  5B5E U;  5ALI A;  4M04 A;  4OJL A;  2DWQ A;  1RYU A;  2EAM A;  4YG2 A;  3ZDA A;  2DL0 A;  5EE3 A;  2E1F A;  5AK4 A;  1O03 A;  5KG7 A;  1SL1 A;  1RM6 C;  2FMP A;  3OSP A;  1P7D A;  2KVS A;  1BPY A;  2GOL A;  5EE0 A;  3Q8R B;  1OW5 A;  3VC8 A;  3OJS A;  2I6X A;  2JZB A;  5L9X A;  5DB7 A;  4PZO A;  4F4K A;  1V85 A;  3TAC B;  2FJ6 A;  3SD7 A;  4O5E A;  5J2I A;  2FPL A;  5AK6 A;  4O3S A;  3T5J A;  2KP7 A;  1Z1B A;  3V7J A;  4ED6 A;  1L3T A;  3OHB A;  5JUM A;  1HIW A;  5J0U A;  4P4M A;  4RQ0 A;  5AI8 A;  1MC8 A;  1SV0 A;  4GC6 A;  1NK0 A;  2FLP A;  2YN4 A;  4ICA A;  4C80 A;  1PK1 A;  5HR6 A;  1NJX A;  1ZQ1 C;  1ZQJ A;  4C8N A;  5AI9 A;  3A0H U;  3C1Y A;  5AI5 A;  1ZQP A;  2H3Q A;  4ECS A;  2QB1 A;  8ICX A;  2IHM A;  2JRZ A;  3BQ2 A;  4QZI A;  1ZQL A;  1SXE A;  1ZJN A;  4F93 B;  1SKW A;  3NGD A;  4DL3 A;  2EDU A;  2NRV A;  5ALS A;  1ZOL A;  4UAV A;  1DGS A;  5KFK A;  1LV5 A;  3L5K A;  4KN7 A;  2AQ0 A;  2KEY A;  3TAD C;  3ED5 A;  1V9P A;  2XY7 A;  4F5Q A;  3BQ7 A;  3SYZ A;  1QTM A;  4MFF A;  1X40 A;  3QU5 A;  4DQI A;  3SAF A;  1B0X A;  3RJH A;  5L1L A;  5HNK A;  4M47 A;  2ZJA A;  4QWE A;  5KT5 A;  3T5L A;  2AGP A;  2I5H A;  4DLE A;  5KL1 B;  2KN7 A;  3ISC A;  2FLN A;  4FZL A;  4J9S A;  4B9L A;  4B9S A;  5L1I A;  1X2I A;  3GQC A;  5EWG A;  4AYB F;  4FS1 A;  3SI8 A;  5HML A;  3HWT A;  5KFO A;  3C5F A;  2MA1 A;  5KAF U;  4C7Y A;  4DCC A;  5TIS U;  1J97 A;  4BXO B;  3HT3 A;  4QZG A;  4LZG A;  4QW9 A;  2KZM A;  4YQW A;  4PPX A;  4O5C A;  1DK2 A;  1ZQR A;  3G6V A;  3KZI U;  2AGQ A;  3RB6 A;  3D2S A;  2WF9 A;  7ICV A;  4MEY A;  5ALV A;  4QZ8 A;  4TUR A;  4DL2 A;  9ICL A;  2YMQ A;  2FMQ A;  7ICF A;  1KQQ A;  3MR3 A;  2D6F C;  2J6S A;  2NV3 A;  2KIW A;  2V4R A;  2JH1 A;  5BOM A;  1S0O A;  3RJK A;  5JU5 A;  7ICO A;  2V4Q A;  4C4T A;  3QZ7 A;  5AKX A;  3QUB A;  5ALW A;  4NL9 A;  2BPF A;  1ZD4 A;  4QZE A;  4ECZ A;  4QJF B;  4O3Q A;  4B9U A;  2YY6 A;  1NK4 A;  4DS5 A;  4FBU A;  3RB0 A;  1ZQA A;  1ZD5 A;  1SGG A;  5DG8 A;  5KFC A;  5J0O A;  2HI0 A;  3RH5 A;  3TI0 A;  3JPQ A;  3AUO A;  2Y9T A;  1PK3 A;  2PXI A;  2LBO A;  1N5W A;  3TFR A;  3JPS A;  4UB4 A;  5AM4 A;  4UAY A;  2BKE A;  4USA A;  1T94 A;  2F2A B;  4TUQ A;  1BNP A;  5J2J A;  4RQ4 A;  5KT2 A;  3NVW A;  4ED3 A;  5J2A A;  4PGX A;  2DQN B;  1QCK A;  1TAQ A;  4I29 A;  3WK6 A;  2YTU A;  1D8L A;  4KLG A;  4I2A A;  2ES6 A;  1M6Y A;  1X66 A;  2ALZ A;  1PVR A;  3JPP A;  2HOF A;  4M9L A;  4M2Y A;  5KFQ A;  1D9F A;  1S8O A;  4NM1 A;  4B9V A;  7ICK A;  2EZX A;  2UVW A;  5AKZ A;  4RUA A;  5J2E A;  3OJU A;  2LI6 A;  3RFA A;  8ICP A;  1IXR A;  5F9L A;  3ZD9 A;  4I28 A;  4M6W A;  2HOI A;  3TAN A;  2NRW A;  4Z6C A;  1NJZ A;  2ASJ A;  1J2N A;  2AGO A;  4F5N A;  3O0F A;  4NM2 A;  2W9M A;  3BQT A;  1ZQV A;  2YMM A;  4UB3 A;  1T4G A;  4UQG A;  2K4P A;  2D8C A;  2GO7 A;  4KMU A;  3WKA A;  2WB1 C;  8ICY A;  5AI6 A;  5ALJ A;  2C2R A;  4MFC A;  2OEH A;  3RB3 A;  2YB1 A;  4X5V A;  1AQ6 A;  3H4B A;  1S0N A;  5F9N A;  3Q8M A;  1NK8 A;  1S76 D;  4M9J A;  2QB0 A;  3LDA A;  2WF7 A;  4QW8 A;  3D2N A;  4CCH A;  3M1Y A;  3MGH A;  2QLT A;  1RYR A;  5CEH A;  1Z4O A;  3PVX A;  2PI5 A;  3IG5 A;  4O3O A;  9ICB A;  4RZR A;  9ICG A;  4JWM A;  2K4I A;  2ZXH A;  4PGY A;  3AN1 A;  1DGJ A;  2E8O A;  3UXP A;  3T5K A;  3JPN A;  5E79 U;  3L4P A;  2XGQ A;  3TAD A;  2Y1I A;  1NKE A;  3H0L B;  3SR6 A;  1QSL A;  4JMU A;  2KHQ A;  4LZD A;  3FDS A;  5KFG A;  4UAT A;  3GIK A;  3QZ8 A;  5J0R A;  2PFQ A;  1N5X A;  2NRZ A;  5J2C A;  3IV6 A;  4J9Q A;  1QQ7 A;  8ICG A;  5KG2 A;  1S0M A;  2HDO A;  5KFM A;  2YMP A;  4PHP A;  2G08 A;  5J2D A;  5BOL A;  4MF8 A;  2R8H A;  4RU9 A;  2BR0 A;  4DOC A;  4MEX A;  5KFX A;  4QZC A;  3BQ1 A;  4DSF A;  4ELT A;  3UXN A;  4F8R A;  1U48 A;  3ISD A;  1F44 A;  4Q8F A;  5H2F U;  3GZF A;  3TAQ A;  3Q8Q B;  2WTF A;  3IM1 A;  3KHG A;  2YB4 A;  1GO3 F;  2JV3 A;  3K1Z A;  2LYA A;  4OJP A;  4RQ5 A;  2G5H B;  4ECU A;  5ALP A;  2Q4T A;  5DLG A;  3N7S C;  1ZD3 A;  4ED7 A;  4UB2 A;  1D9D A;  4LVS A;  4QNL A;  3MGV A;  1L6N A;  3H0M B;  1COO A;  4KX5 A;  2VA8 A;  1JRO A;  3BJY A;  4UAZ A;  1ZQK A;  2RLT A;  4PJ0 U;  2KJ5 A;  9ICM A;  4Z6F A;  5DBB A;  3D2Q A;  5J2B A;  4C7Z A;  4J9P A;  4C4R A;  2Q0Z X;  2KK0 A;  4FBT A;  2BQR A;  4Y2V A;  1XO1 A;  8ICW A;  3A0B U;  1KTQ A;  9ICQ A;  4C4S A;  2ZIW A;  1KFT A;  3SEN A;  3WKD A;  4F4Y A;  2UVR A;  1ZQE A;  3FM9 A;  2RHF A;  4CNQ A;  1A6S A;  1RXV A;  4DFK A;  3RH6 A;  5DB8 A;  1NK9 A;  2Y0S C;  8ICH A;  5J0Q A;  5KFA A;  9ICP A;  4FE3 A;  3CP8 A;  4JV0 A;  1FFV A;  4R8U A;  7ICP A;  1U49 A;  5G5G A;  2W9B B;  3LWM A;  1RQN A;  2XCA A;  4OJ5 A;  4F4Z A;  1JXE A;  5CWR A;  3PW2 A;  8ICS A;  1NK7 A;  4UBC A;  8ICQ A;  2VIX A;  3ETL A;  2IBK A;  5AKL A;  2ZJ5 A;  2HHU A;  5HP4 A;  3PO5 A;  9ICA A;  2WFA A;  1C7Y A;  3WK4 A;  3GIL A;  3V72 A;  4NWI A;  3AMZ A;  4R8U B;  1KDH A;  2DF4 B;  1XS9 D;  4G3I A;  3WKB A;  5AHX A;  4QZD A;  1SKS A;  5HR7 A;  3UMC A;  2JEI A;  2XVT A;  4UAS A;  2J6T A;  5CA7 A;  3NVY A;  3RJE A;  4RQ3 A;  2LHT A;  3C1Z A;  3QEB Z;  5KFT A;  1CEZ A;  5AK3 A;  2BGW A;  1HUO A;  2PI4 A;  4DL6 A;  3PSF A;  3R9K A;  4JWN A;  4RPY A;  4EYH B;  4IRC A;  2G06 A;  1TAU A;  2QKQ A;  3T79 A;  4BGD A;  2DFL A;  1JIH A;  3PMN A;  1LKY B;  4DSL A;  1N60 A;  4ECY A;  2Y1J A;  1N56 A;  1WWU A;  2IOF A;  3HKZ F;  2W04 A;  4YMN A;  1MSW D;  1QQ6 A;  3KZX A;  5KFW A;  4DFM A;  3EPG A;  4Y2P A;  4I2E A;  5KFL A;  4CDG A;  3GIJ A;  2OHF A;  4F4W A;  1T8E A;  4DWI A;  2DKZ A;  2G09 A;  2N1R A;  3GV7 B;  4E0D A;  1LKY A;  9ICR A;  2XGP A;  4QIW F;  1NJW A;  1IM4 A;  1SV4 A;  9ICJ A;  4M0A A;  1K5O A;  5AIC A;  2OWO A;  3M9O B;  1A76 A;  5AM3 A;  2CRX A;  5KTQ A;  5J2F A;  2FPK A;  5CRX A;  2PMZ F;  1S5L U;  4M6W B;  4IQW A;  5DB9 A;  7ICM A;  3M7D A;  4DSE A;  2KIV A;  1LB2 B;  2B21 A;  2QAR A;  4NL9 C;  2HOQ A;  2JHD A;  1BPB A;  3KOO A;  3N4M B;  1X9M A;  4RQ8 A;  2R8K A;  5TZV A;  2HHQ A;  3SEI A;  1B4F A;  4ED1 A;  3RBE A;  4K4H A;  5ALQ A;  4YXJ A;  5L1K A;  4ECQ A;  5FP0 A;  1IIP A;  5J2H A;  1XWL A;  4I27 A;  1CRX A;  5CR0 A;  1B43 A;  3LWL A;  1QH9 A;  2EAN A;  3AU2 A;  4PL1 A;  4KLS A;  2BCV A;  1SL0 A;  3ZDB A;  2KVC A;  3ALR A;  3D6J A;  4I2G A;  5KG4 A;  3FAH A;  1SL2 A;  4C8K A;  2ZIX A;  2NO5 A;  4KX3 A;  1ZQC A;  3OGU A;  1JN3 A;  4AP9 A;  2HVH A;  4RQ2 A;  4BX9 C;  1WCN A;  1ZQU A;  3M8S A;  2ZIW B;  4ELV A;  5DDM A;  3RRH A;  1RXW A;  4NLN A;  2H3I A;  1ED1 A;  4YMM A;  3MFH A;  5KFJ A;  4DO9 A;  5J0P A;  2E8P A;  1Z19 A;  1ZQY A;  4C0Z A;  3F2C A;  3AQE A;  3H4D A;  2HHV A;  1X9W A;  2ZIX B;  1N61 A;  1KN5 A;  1JAL A;  2W3R A;  4Y2X A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...