1UHUA

Solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
GSSGSSGTPLSLTLDHWSEIRSRAHNLSVEIKKGPWRTFCASEWPTFDVGWPPEGTFDLTVIFEVKAIVFQDGPGSHPDQQPYITVWQDLVQNSPPWIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords product of RIKEN cDNA 3110009E22
publication title Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
rcsb
source organism Mus musculus
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1uhuA00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
2M9NA 4FFDA 1HJPA 5J0TA 2B6GA 5F9LA 3RBDA 2ESEA 2BQUA 8ICLA 2QARB 4F5PA 4J9RA 3M6KA 1S8OA 5DQIA 3AUOA 1XU4A 5KG4A 2ZJ5A 3PSPA 4GC6A 4JMUA 5AI5A 2NV3A 4UATA 2KEYA 3WKDA 3KZIU 1ZQMA 3C2MA 3RB6A 5KG0A 4HYKA 1B22A 5L1KA 3FC4A 5AKGA 5KFDA 4C4SA 5IIOA 1S97A 2BCQA 2XCPA 4RQ3A 4PHDA 4IQTA 2BCUA 2NYVA 3R9KA 1L7PA 3KTQA 4YD2A 4F5QA 4JWMA 5J2DA 4C8KA 3IM1A 1COOA 3RJGA 1PUZA 1FFVA 9ICMA 4ECRA 5KFCA 2LPEA 3ICXA 1RG6A 1RYRA 3FM9A 4R8UA 4DFMA 1SKWA 2WF8A 2KJ8A 2RDIA 4QZHA 3N28A 4I28A 3BDPA 4CRXA 7ICOA 1KFDA 3HX0A 2IOHA 2NO5A 1ZJMA 4F2SA 2JMGA 4DL4A 2WB1F 3JPQA 1N56A 2D3DA 4FS1A 5AM5A 3QEAZ 3PSTA 1NJWA 1D9FA 2JH7A 4DOAA 2OM6A 2PFOA 5DG9A 4ECXA 5HHHA 4IQUA 4ECUA 5AKLA 4I2IA 1Z4OA 1ZQ1C 2LHTA 2YN4A 4PHAA 3TFRA 4BGDA 5JTIA 2MRLA 4QW9A 2P6UA 8ICXA 1ZQPA 3RRGA 3F2DA 1ZETA 1N60A 3QX7A 4UB4A 4P0QB 1ZQEA 5EE3A 4O3QA 1JXEA 4RQNA 2VANA 5J2BA 2GLEA 4F5NA 2IMWP 1ZQFA 3RH5A 3C28A 4MFFA 5KL8B 4DFPA 3L4PA 4K4GA 5HMMA 3LYSA 4PGXA 9ICQA 1TE2A 2DL0A 4M9GA 3UMCA 1S0NA 3N7SC 5J2CA 5D49A 5HMLA 1PK1A 4UAVA 2NRWA 1L3VA 4C8OA 4IR1A 4F71A 4UB8U 2I5HA 2PMZF 5AKJA 3IDWA 2ZUDA 1N61A 3H7IA 3L3FX 5KT3A 2P35A 3ALRA 9ICFA 3NS1A 5ALOA 2KKVA 4F5OA 4UB5A 1NJZA 5J2IA 5J0UA 2PFNA 5ALSA 1WWUA 5KFYA 4RNMA 4YVZA 2RLTA 1ZQJA 5AIBA 4YMNA 2B21A 3C5FA 1XC9A 2EZXA 4YR3A 4F4YA 1S77D 3T5LA 2F44A 2W3SA 4NWIA 1ZQHA 2HVIA 2KN7A 4FZLA 4M47A 4FBTA 2HHVA 2ZIXA 4KX3A 2NRVA 2HW3A 3ZDAA 5D46A 3FYHA 3K1RB 3ZD9A 4CCHA 2LI6A 2VA8A 1FIQA 2MA1A 5CRXA 2HCFA 2JZBA 3PW5A 2AH5A 1QQ5A 3AN1A 4NLZA 2KK0A 4QJFB 4DQIA 2W9BA 4BWMA 5ALKA 2YMQA 4YN4A 7ICFA 3F2BA 1C20A 2HHXA 3FAHA 5DB8A 4F2RA 4Y2UA 1Z3EB 1JRPA 1T94A 3O0FA 2JEGA 2WFAA 5ALZA 3IHQB 2FMQA 4FBUA 1A76A 4PPXA 4KLFA 4KN4A 9ICHA 3LK9A 2JRZA 2ZXHA 1IV8A 3GFKB 2E8NA 4F8RA 2CXYA 5B66U 2HHWA 3PMNA 8ICUA 2H3VA 9ICAA 4EYHB 5KTQA 2GWSA 4IRDA 3QEBZ 1TK0A 5AICA 4F4WA 2ZTCA 4QZGA 1N5XA 3NTUA 2VIXA 4F4XA 4KLHA 1QLNA 2KFNA 4EEKA 4C8NA 1QH9A 2XC9A 1A77A 4TUSA 1ZQSA 2RP5A 3MABA 2ALZA 2XCAA 3RJJA 3SV4A 4MEYA 1V38A 4B9SA 3BQ2A 4KLGA 2ODGA 4C8MA 4XQ8A 3RAQA 4EBEA 5KFRA 1PK1B 3EYZA 4G9BA 4C7YA 2HHSA 3BZKA 1WYGA 1UQVA 3OPXA 1J97A 3C1ZA 4B6JA 2N1RA 4O3MA 2VA2A 2EAOA 2G09A 1S5LU 3SAGA 4ECZA 2IA6A 3PZPA 1L8LA 4KLIA 3H8JA 4YR0A 5IIIA 4DLEA 5KG1A 2BPCA 3ETLA 3SAFA 2H5XA 2BQRA 4NL9A 4RQ2A 7ICEA 4I2CA 1X2IA 4IRCA 5E79U 4ECQA 2NRTA 2BKEA 3HJEA 5L1JA 3KHRA 5HR6A 4DWIA 5J0RA 3M9MB 2Q0ZX 4YD1A 3PW2A 2FJ6A 5KFKA 4DO9A 2JGAA 4Q43A 3Q8LA 4Y2VA 2OWOA 2MSNA 4Y2SA 4UASA 2QARA 2I1QA 4TUQA 4Y2YA 2HSZA 4NLNA 5ALIA 1SZPA 2K4IA 4O5EA 4CNQA 5JUMA 4FZMA 1ZQNA 1WUDA 5KT5A 4DL2A 2D8CA 4JK1A 2HHUA 2E5SA 1NI3A 2BPFA 4UARA 5A0LA 2YY6A 1NK0A 2F3NA 4QWEA 1XO0A 2EDUA 4DQSA 3C29A 1L7NA 4NXZA 4I2BA 3QUTA 1ZQKA 1D8LA 2W7OA 1TK5A 1PVQA 5J29A 5BPCA 4EENA 2XICA 5IIMA 2UVWA 4KLQA 5KT2A 4Q8FA 4DOBA 2A1AA 1KL9A 4JV2A 4TQRA 2D6FC 4EX7A 2PKEA 9ICBA 4DSKA 2QB0A 3PX6A 4C4TA 2ZG6A 1SL2A 2EQYA 3HPOA 2LYAA 3RH4A 5ALWA 4QZDA 5KFSA 1B0XA 4QZ8A 4QZEA 1KLNA 1N63A 4OJOA 4ELVA 1BGXT 2W8LA 5DGAA 5DB6A 4JV1A 5AM0A 1OXJA 3SI8A 4EZ6A 2CPRA 1NJYA 4MFCA 3V7KA 3CNHA 2UVRA 3KHHA 3QUQA 2FDRA 3MR3A 4TUPA 4NLBA 2RRDA 1X40A 2Y0SC 7ICRA 1ZQOA 2BPGA 4MF2A 4M2YA 1QCKA 4Z6DA 1RXWA 1QSSA 7ICMA 4CE6A 3WK5A 5AKEA 2F8LA 2WF5A 2BGWA 4P0QA 4Q45A 8ICGA 1KW4A 3H8SA 4QWAA 4ECYA 4JV0A 3C1YA 2BHNA 2DFLA 1P7DA 1T7PA 1RM6C 5DLFA 2HVHA 4QZ9A 5KFIA 3PO5A 4NL9C 3Q8PB 1S0MA 5EWGA 2DUYA 2NRZA 7ICUA 5KG2A 3UQ2A 4DL3A 1ZQDA 4YMOA 2XY6A 1TAQA 1ZQIA 2KIWA 1UA0A 4XRHA 5KFPA 4UBCA 2RQ5A 5ALGA 1NZPA 3HRDD 5AKIA 5DB9A 1UHUA 4EYIB 4ECTA 2G06A 5KFUA 1FFUA 2ISPA 4OJPA 3ZDBA 3E58A 4P4OA 5ALLA 1GO3F 1JMSA 1K1SA 3WK6A 3F2CA 5KFWA 2J6SA 2KMDA 3M8RA 9ICEA 3NVYA 4FE3A 2BCSA 3D6JA 1JROA 5EOZA 2F1HA 2G08A 8ICJA 3RF9A 3QUCA 5CJ7A 3MR2A 3N7RC 1IXRA 5EE0A 2BCVA 1VDVA 2W3RA 1S0OA 4KLJA 4I2GA 1SL1A 1XO1A 1BPBA 8ICRA 1X42A 5KFZA 2AQ4A 4DFKA 4QWBA 1CI4A 5AM4A 4KMOB 2L5YA 4P4MA 2G5HB 1XNSA 1YZ6A 2F1JA 2DKXA 4ACOA 3TI0A 4LJXA 4DF4A 2FLPA 2C2EA 4RNNA 2JV3A 3ZD8A 3UMGA 4B9MA 2QB0B 2VJ4A 2UVUA 4BJQA 4RUCA 3PR5B 4Y2QA 3RAXA 9ICOA 1YZ7A 2MU2A 1MA7A 1PK3A 1Z00B 3QNMA 1LKYA 2KKPA 3BZCA 3TADA 4C80A 3RJHA 1NZBA 7ICNA 4OJLA 2HOFA 4EELA 3FDSA 1ZQYA 3OHAA 1BPEA 4KLLA 1UCVA 4US9A 2JHDA 1XSPA 3EPIA 3HP6A 3NGDA 1X9SA 3IN5A 3MR5A 7ICVA 1A0PA 3H4BA 4QZIA 4DFDA 3NVVA 2XGQA 4AYBF 4DQRA 1U4BA 3D2NA 2DPJA 2KHQA 8ICEA 4ED1A 2F1IA 1JALA 3QYPA 5ALRA 4B9UA 4ED7A 1T3QA 3TACB 5KAIU 2YTUA 7ICLA 4OCZA 4IR9A 8ICZA 3KHGA 2W9CA 1AQ6A 3H0MB 1ZD3A 5ALMA 5KL1B 3RH6A 1B4FA 1X6JA 3ETRA 4ED0A 4RPXA 8ICYA 3PSFA 2VA3A 3GZFA 5AHXA 3AQEA 3NRWA 3RFAA 4YCXA 2Y1IA 4YG2A 1ZD2P 2KZZA 5ALUA 2W55A 4WJ3B 4RU9A 5AKHA 9ICSA 4DOCA 1RZTA 5DG8A 1LVHA 4RQ0A 4ED8A 1KSPA 2FPKA 4G3IA 2OHFA 2Z7JA 2OH2A 1V85A 1PVRA 1HUZA 3TKAA 2Y0SF 4M9NA 1Z19A 1HIWA 2R8IA 5DBAA 2OXOA 3KKAA 4QWCA 3SD7A 1L3TA 3PVXA 4U7CA 3B9JA 2FMSA 2YMMA 2E1EA 4NJ8A 4DS4A 9ICXA 2UVVA 3T79A 4KLUA 2R8JA 3MBYA 2XO7A 4CF5A 4UAZA 4Y2TA 1WCLA 3MDCA 1SWVA 8ICKA 5GTHU 2Y1JA 4M6WA 3UMBA 1NKEA 2KVSA 2G5IB 1WG8A 3SEIA 5CEHA 2BZFA 5J2FA 1DRGA 2JR5A 3S6JA 4B9NA 2F76X 3HWTA 1UPHA 4I2AA 1ZQBA 2EAPA 1DGSA 4F5RA 2KE7A 5T14A 3B0XA 1JXLA 3EZ5A 3U26A 4PZNA 1SGGA 1NKBA 1KEJA 1QQ6A 3NRZA 1Q3UA 8ICWA 3TADC 3PX0A 4Y2PA 4ED2A 1RPLA 5TZVA 1L6NA 4E0DA 1MN8A 4KX5A 3V7LA 2R8HA 1NK7A 1SXEA 2KG5A 4NV0A 4EBDA 3BQ1A 4Q8EA 5CP2A 1LKYB 3AL0B 5AK6A 5G5GA 1CRXA 3UM9A 3OHBA 4UB2A 3K75D 5EE9A 4OJ5A 3KZXA 2YX8A 9ICPA 3UPQA 4KLTA 5GTIU 5B5EU 3TAQA 1BNPA 4MHVA 1X9MA 2XY7A 5KFMA 4I2HA 3WK4A 2KZ3A 4XA5A 5IILA 9ICVA 4KLMA 4DLGA 5L1MA 4OO1J 4LZDA 2KD1A 2WHEA 1NK4A 2LBOA 1X9WA 3BQ7A 4Y2JA 5AI0A 4PHPA 3HILA 1NKCA 8ICCA 4GC7A 1QQ7A 4F72A 1YT3A 4ECSA 4C0ZA 2YMLA 2W9CB 1JN3A 1M6YA 4PZOA 4O3PA 1TKDA 4F50A 2AGQA 5BOMA 2GH1A 3RR7A 3WKEA 4QZCA 1JI7A 4IL6U 2F2AB 2F77X 4Y2XA 2K8AA 2ZIVA 5DQGA 4C4RA 2W9MA 4RT2A 2KFZA 1NK8A 4QZAA 3A0HU 1L7MA 3C5GA 4Z6CA 1BVSA 3RRHA 2FLLA 4AP9A 4I2EA 4YXJA 4J9LA 2XVTA 5ALEA 5DBBA 4NLGA 1ZOLA 2W54A 2ATLA 2M0NA 2K60A 2PI5A 4NM1A 2H3ZA 3RTVA 3QUBA 5J0XA 4IRKA 5ALHA 3M7DA 1PZNA 3EPGA 1SV0A 3OGUA 3GIMA 5KFXA 3IG5A 4K4HA 1TK8A 4P0PB 3HKZC 3KFUF 1NK9A 3K4GA 4ZH4A 4X5VA 9ICNA 5J0QA 2HOQA 4GIBA 5DKWA 2LM4A 3GIIA 4DSFA 3GV5B 2HMXA 7ICIA 5KFOA 4GXKA 3PNCA 1KFTA 1BPZA 5KT7A 2HHTA 4DL6A 4I2FA 1DOQA 2C2RA 4F4ZA 2A19A 3IRUA 3PMLA 1IM4A 3JPOA 7ICJA 1Q8KA 2BDPA 4JUZA 4M6WB 2P66A 5ALXA 4JB3A 3KOOA 3RJFA 5AKXA 8ICPA 4Q44A 4R65A 1U9LA 4UAUA 1JIHA 4LVSA 5KAFU 1Z1BA 1X6IA 1K1QA 1ZQGA 4AYBC 3C2LA 1VJ5A 1PVPA 2AXTU 3NASA 4FS2A 5ALQA 2KHVA 3TANA 3PW7A 2PFPA 2P6RA 2ZXIA 4NLKA 4MFAA 2AHOB 3RJIA 4MEXA 2H3QA 1S0VA 2A3VA 4PGQA 5KFGA 5F9NA 3G6VA 3WKAA 3E0FA 1XS9D 2QLTA 4IC9A 4BXOA 3VCBA 4O3SA 4RZRA 4QIWC 4UAWA 2LYBA 3GIKA 2DQNB 4Z6FA 2AGOA 3TFSA 2R8KA 3AU6A 2FMPA 1Z00A 2W04A 5KT4A 1KFSA 3BQTA 1ZQUA 3T5JA 2V9WA 1O03A 1KRPA 3V7JA 3MC1A 2JH1A 2KICA 1WWVA 4DQPA 2EH9A 3LVWA 1ZQWA 1NNLA 3AQFA 2FLNA 1CUKA 5KT6A 2C2DA 2E8OA 3MDAA 2J6UA 1ED1A 1IIPA 4RQ4A 2HHQA 5J2GA 4PL2A 4I29A 1WCNA 4BWJA 2FPMA 5J8YA 3ZDEA 1TFRA 1T3NA 5AM1A 3OTQA 1RYUA 5TISU 8ICHA 1N48A 4UB6U 1X66A 3BS7A 3T5KA 4J9SA 1ZRNA 4EZ9A 3JPNA 1XSLA 3RBEA 4XUSA 4R63A 1OUQA 4J9KA 2ZIVB 2E8PA 3N7PD 3TQ1A 3H40A 3PO4A 1ZJNA 3JPSA 5AKZA 5CHGA 3UQ0A 3WK7A 1D9DA 1SV0C 3PW4A 4P4PA 4DSJA 4DSIA 4CGZA 3BJYA 5BOLA 3GQCA 4FO6A 3B0YA 3DV9A 3RB3A 3ISCA 2ASLA 2EANA 2ES6A 2DWQA 2ZUCA 2C22A 4TQSA 1S9FA 8ICSA 4B9VA 4KLOA 1NK5A 3OJSA 2OYYA 4PHEA 2KZMA 1UT5A 3H0RB 2WF9A 1MC8A 5DQHA 3EW9A 2HBKA 1TV9A 1NOMA 3H8MA 3M9OB 1U45A 1X9XA 5AK4A 4KMUA 5J2JA 2W03A 3EUB2 4U6PA 7ICPA 1UA1A 3GV7B 3QU5A 5KFAA 3QXGA 4YXMA 5KFFA 4F93B 3ORYA 7ICKA 3T5HA 3D2QA 5ALFA 4DEZA 3A0BU 3L5KA 4RQMA 2BCRA 3M6ZA 5EWEA 3NUQA 1BPYA 1J2MA 3I1YA 4J9NA 3K1ZA 4J03A 3EWAA 1O08A 1V9PA 4RQ1A 2O6KA 2YB1A 4Y2RA 5AK3A 2RHFA 2ZJAA 5ALTA 5HR7A 3TAPA 2GOLA 2W9AA 2K89A 4O5KA 5J2HA 4RQ5A 5IINA 3HKZF 3C2KA 1CEZA 3UXPA 2V4RA 5KFNA 1D8YA 5H2FU 4BXOB 2KNJA 5AI4A 4DF8A 2VJ5A 2K4HA 3BS5A 5F3XB 2YB4A 2BDUA 3ZDCA 3UXOA 3H4DA 3SMVA 1DXSA 5AI8A 2WF6A 4TURA 8ICTA 2OEHA 5J0SA 8ICVA 4C7ZA 9ICUA 1D8BA 2MUTA 1ZD5A 2WF7A 4PGYA 2KOBA 4GLXA 3PX4A 4ICAA 2YQEA 1H38A 5J2KA 5KG6A 3DDHA 1ZD4A 3G6XA 1L3UA 5J8YC 1MQ2A 4DL5A 4O5CA 4HAIA 1L7OA 1BNOA 2DF4B 8ICAA 2Y9UA 3E2EA 5DG7A 5AK5A 5HNKA 1DGJA 1Q46A 4UB3A 1ZYQA 3MFHA 3BQ0A 3F5AA 3M8SA 4QNLA 4NY8A 2KJ9A 5IIKA 3HT3A 2C28A 3RR8A 4YR2A 1SKRA 5KG5A 1LB2B 2KIVA 4QWDA 2HBLA 5EWFA 2KVCA 5J0WA 3PSIA 3LWMA 4O3NA 4NLCA 3UXNA 1KBUA 2IBKA 3AU2A 1JUDA 2J6TA 3IP4B 3TARA 5J0YA 2WTFA 5DLGA 3M9NB 3QE9Y 3KHLA 4ELUA 4QIWF 2ZTDA 2IOFA 4GFJA 4RT3A 3N97B 3PW0A 3QZ8A 2V4QA 2EZZA 3WKBA 3WK8A 4A8EA 3RJEA 2KTQA 4M9JA 5HHIA 4UW9A 4IQWA 3WKCA 3LDAA 4RQ8A 3WU2U 9ICWA 3N4MB 8ICFA 5DB7A 3Q8QB 5JU5A 5ALNA 4YFKA 4RNOA 8ICQA 1C7YA 2A1JB 4MF8A 2HDOA 1ZQRA 2YMPA 3QZ7A 5KNIA 3V72A 1KQQA 2I9GA 2DGZA 2KV2A 4O0IA 2XI9A 3SV3A 2LKYA 3T3FA 4P0PA 2AQ0A 2MAXA 3QU4A 2AGPA 2ZJ8A 1TVAA 7ICTA 4OJ6A 1F5SA 3AEVA 3I76A 1T4GA 2QB1A 1SL0A 2NRXA 4O3OA 4DSEA 2ZIWB 4EBCA 3F53A 5ALJA 1RQNA 2E1FA 5L9XA 2EZYA 3ED5A 1ZQXA 4UB1A 1MQ3A 3MR6A 3JPPA 3QU2A 2WAQC 4PL1A 3WK9A 4QZFA 4J9OA 8ICMA 4FZNA 2HI0A 2HBMA 4YMMA 2LYHA 1ZRMA 2W8KA 2JXJA 5KFBA 5KFLA 3ISBA 1F0MA 1ECWA 2H3FA 1J2NA 3KBBA 3ZI4A 3SZ2A 5DDYA 1RYSA 1QTMA 1RQLA 3BS5B 4O9MA 3GILA 4IQVA 2AU0A 2G0AA 4PH5A 5ALYA 1QSYA 2E8MA 5EE1A 1L5UA 2K8BB 2MUTB 5CB1A 5J0OA 4KTQA 3V6KA 1XSNA 7ICGA 3LVVA 2ZTEA 1L8OA 3ONNA 4R8UB 3CP8A 4NM2A 3V6JA 5JRTA 8ICBA 5G5HA 3AM9A 5KFHA 5KG7A 5DDMA 5C0YA 2PXIA 4CF4A 5DBCA 2Q4TA 2H3IA 5KFVA 5KG3A 3CW2C 5L1LA 4ZOHC 3GIJA 5J2AA 1BPDA 9ICCA 9ICTA 1COKA 2CRXA 2Y9TA 4O3RA 5J2EA 1S76D 3SQIA 1S10A 3SAHA 1Y88A 2F8KA 3SENA 5ALPA 1RDFA 4ED6A 4CF3A 5KFJA 5CWRA 1ZQQA 2EAMA 2ISOA 4KLEA 4B9LA 1T8EA 1Q3VA 3J81j 1SZHA 4KLSA 2W7PA 4IS7A 4RUAA 4RPYA 4USAA 2ZIUA 4ED3A 5HP4A 4F4KA 4J9PA 2XIDA 4RQ6A 3KKAC 4K4IA 1KKXA 1L3SA 1KDHA 5L1IA 3C21A 4I2JA 5AKKA 4ECWA 2ASJA 1U47A 3QU9A 2ZUBA 8ICOA 4DQQA 2BR0A 3MGVA 5KFEA 4GXIA 2JEFA 9ICLA 1NJXA 4ELTA 2KSOA 3H0LB 3ZDDA 2LMRA 5CA7A 4J9MA 3Q8MA 1HEKA 4I27A 5ALDA 2VKQA 1URJA 4BX9C 4M04A 2PFQA 2K8CB 4YQWA 1QSLA 2G07A 3PV8A 5K4LA 4R64A 4F91B 4KITB 1RXVA 7ICSA 3I28A 1UT8A 3RB4A 4R66A 4DCCA 4DS5A 3CYMA 5AM3A 3DEEA 2R8GA 1F44A 4P2HA 4DSLA 3V6HA 1U49A 9ICIA 2WB1C 3IV6A 4EX6A 2CN1A 3Q8KA 2XGPA 4M9LA 2ZIXB 3GDXA 1DK3A 2GO7A 2PI4A 4KLDA 1SV4A 4PJ0U 3JPTA 3HW8A 9ICRA 2JEJA 1XWLA 4QZBA 1SXDA 3MGHA 4GXJA 2K4EA 3D2SA 4KN7A 2XY5A 7ICHA 2JZBB 8ICNA 4I2DA 1ZQVA 9ICGA 1FEZA 2W9BB 3NVWA 3ISDA 1B43A 1VLBA 2KP7A 1KTQA 9ICJA 4B9TA 1U48A 1V97A 2LM1A 3MGIA 1ZQLA 4F92B 1SB3C 3F5EA 4RPZA 2W43A 2WAQF 4ECVA 1IG6A 1DK2A 3RB0A 5CR0A 1ZQTA 3Q8RB 3KD3A 2OCEA 2DPIA 2IHMA 5D4BA 3G6YA 4C8LA 4F3OA 1SIJA 3CRXA 3QU7A 4DFJA 1MSWD 2BQ3A 3OSPA 1SKSA 1KN5A 1TAMA 2IHNA 2QKQA 4JWNA 3SYZA 2KJ5A 4RQ7A 5AKYA 9ICKA 3Q8SB 2FPLA 1N5WA 2DBYA 1ZQAA 2HBJA 4M0AA 4UQGA 3GU3A 7ICQA 1ZXIA 1JX4A 2PMZC 4US8A 1N62A 5C5JA 4BDPA 2HOIA 4J9QA 4OD0A 1TAUA 4UAYA 4YP3A 8ICIA 2R18A 1A6SA 4CDGA 1AROP 2FE9A 2I6XA 5AM2A 2K4PA 3IG8A 5FP0A 3OSNA 2DKZA 1K5OA 3THVA 1N2XA 2FI1A 5ALVA 1OW5A 2NO4A 3RJKA 2ZIUB 4EEYA 5KFQA 4M9HA 2B0CA 3AMZA 3H8WA 1FO4A 3GV8B 1BPXA 5AI9A 4UBBA 5J0PA 5DGBA 3OJUA 3C23A 3JPRA 1HUOA 3PR4A 1ZQZA 1Z4NA 1LV5A 1SWWA 2KSOB 2IOFK 3MFIA 4DL7A 4LZGA 5KFTA 3LWLA 2W11A 2A1JA 4BUGA 5AI6A 5IIJA 2AJQA 4QW8A 5AIAA 1EXNA 2JEIA 3NVZA 3M1YA 2ASDA 3SR6A 2ZIWA 2RDJA 3PY8A 2E3TA 3VC8A 1Z1VA 1NK6A 4Z6EA 1ZQCA
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 2M9N A;  4FFD A;  1HJP A;  5J0T A;  2B6G A;  5F9L A;  3RBD A;  2ESE A;  2BQU A;  8ICL A;  2QAR B;  4F5P A;  4J9R A;  3M6K A;  1S8O A;  5DQI A;  3AUO A;  1XU4 A;  5KG4 A;  2ZJ5 A;  3PSP A;  4GC6 A;  4JMU A;  5AI5 A;  2NV3 A;  4UAT A;  2KEY A;  3WKD A;  3KZI U;  1ZQM A;  3C2M A;  3RB6 A;  5KG0 A;  4HYK A;  1B22 A;  5L1K A;  3FC4 A;  5AKG A;  5KFD A;  4C4S A;  5IIO A;  1S97 A;  2BCQ A;  2XCP A;  4RQ3 A;  4PHD A;  4IQT A;  2BCU A;  2NYV A;  3R9K A;  1L7P A;  3KTQ A;  4YD2 A;  4F5Q A;  4JWM A;  5J2D A;  4C8K A;  3IM1 A;  1COO A;  3RJG A;  1PUZ A;  1FFV A;  9ICM A;  4ECR A;  5KFC A;  2LPE A;  3ICX A;  1RG6 A;  1RYR A;  3FM9 A;  4R8U A;  4DFM A;  1SKW A;  2WF8 A;  2KJ8 A;  2RDI A;  4QZH A;  3N28 A;  4I28 A;  3BDP A;  4CRX A;  7ICO A;  1KFD A;  3HX0 A;  2IOH A;  2NO5 A;  1ZJM A;  4F2S A;  2JMG A;  4DL4 A;  2WB1 F;  3JPQ A;  1N56 A;  2D3D A;  4FS1 A;  5AM5 A;  3QEA Z;  3PST A;  1NJW A;  1D9F A;  2JH7 A;  4DOA A;  2OM6 A;  2PFO A;  5DG9 A;  4ECX A;  5HHH A;  4IQU A;  4ECU A;  5AKL A;  4I2I A;  1Z4O A;  1ZQ1 C;  2LHT A;  2YN4 A;  4PHA A;  3TFR A;  4BGD A;  5JTI A;  2MRL A;  4QW9 A;  2P6U A;  8ICX A;  1ZQP A;  3RRG A;  3F2D A;  1ZET A;  1N60 A;  3QX7 A;  4UB4 A;  4P0Q B;  1ZQE A;  5EE3 A;  4O3Q A;  1JXE A;  4RQN A;  2VAN A;  5J2B A;  2GLE A;  4F5N A;  2IMW P;  1ZQF A;  3RH5 A;  3C28 A;  4MFF A;  5KL8 B;  4DFP A;  3L4P A;  4K4G A;  5HMM A;  3LYS A;  4PGX A;  9ICQ A;  1TE2 A;  2DL0 A;  4M9G A;  3UMC A;  1S0N A;  3N7S C;  5J2C A;  5D49 A;  5HML A;  1PK1 A;  4UAV A;  2NRW A;  1L3V A;  4C8O A;  4IR1 A;  4F71 A;  4UB8 U;  2I5H A;  2PMZ F;  5AKJ A;  3IDW A;  2ZUD A;  1N61 A;  3H7I A;  3L3F X;  5KT3 A;  2P35 A;  3ALR A;  9ICF A;  3NS1 A;  5ALO A;  2KKV A;  4F5O A;  4UB5 A;  1NJZ A;  5J2I A;  5J0U A;  2PFN A;  5ALS A;  1WWU A;  5KFY A;  4RNM A;  4YVZ A;  2RLT A;  1ZQJ A;  5AIB A;  4YMN A;  2B21 A;  3C5F A;  1XC9 A;  2EZX A;  4YR3 A;  4F4Y A;  1S77 D;  3T5L A;  2F44 A;  2W3S A;  4NWI A;  1ZQH A;  2HVI A;  2KN7 A;  4FZL A;  4M47 A;  4FBT A;  2HHV A;  2ZIX A;  4KX3 A;  2NRV A;  2HW3 A;  3ZDA A;  5D46 A;  3FYH A;  3K1R B;  3ZD9 A;  4CCH A;  2LI6 A;  2VA8 A;  1FIQ A;  2MA1 A;  5CRX A;  2HCF A;  2JZB A;  3PW5 A;  2AH5 A;  1QQ5 A;  3AN1 A;  4NLZ A;  2KK0 A;  4QJF B;  4DQI A;  2W9B A;  4BWM A;  5ALK A;  2YMQ A;  4YN4 A;  7ICF A;  3F2B A;  1C20 A;  2HHX A;  3FAH A;  5DB8 A;  4F2R A;  4Y2U A;  1Z3E B;  1JRP A;  1T94 A;  3O0F A;  2JEG A;  2WFA A;  5ALZ A;  3IHQ B;  2FMQ A;  4FBU A;  1A76 A;  4PPX A;  4KLF A;  4KN4 A;  9ICH A;  3LK9 A;  2JRZ A;  2ZXH A;  1IV8 A;  3GFK B;  2E8N A;  4F8R A;  2CXY A;  5B66 U;  2HHW A;  3PMN A;  8ICU A;  2H3V A;  9ICA A;  4EYH B;  5KTQ A;  2GWS A;  4IRD A;  3QEB Z;  1TK0 A;  5AIC A;  4F4W A;  2ZTC A;  4QZG A;  1N5X A;  3NTU A;  2VIX A;  4F4X A;  4KLH A;  1QLN A;  2KFN A;  4EEK A;  4C8N A;  1QH9 A;  2XC9 A;  1A77 A;  4TUS A;  1ZQS A;  2RP5 A;  3MAB A;  2ALZ A;  2XCA A;  3RJJ A;  3SV4 A;  4MEY A;  1V38 A;  4B9S A;  3BQ2 A;  4KLG A;  2ODG A;  4C8M A;  4XQ8 A;  3RAQ A;  4EBE A;  5KFR A;  1PK1 B;  3EYZ A;  4G9B A;  4C7Y A;  2HHS A;  3BZK A;  1WYG A;  1UQV A;  3OPX A;  1J97 A;  3C1Z A;  4B6J A;  2N1R A;  4O3M A;  2VA2 A;  2EAO A;  2G09 A;  1S5L U;  3SAG A;  4ECZ A;  2IA6 A;  3PZP A;  1L8L A;  4KLI A;  3H8J A;  4YR0 A;  5III A;  4DLE A;  5KG1 A;  2BPC A;  3ETL A;  3SAF A;  2H5X A;  2BQR A;  4NL9 A;  4RQ2 A;  7ICE A;  4I2C A;  1X2I A;  4IRC A;  5E79 U;  4ECQ A;  2NRT A;  2BKE A;  3HJE A;  5L1J A;  3KHR A;  5HR6 A;  4DWI A;  5J0R A;  3M9M B;  2Q0Z X;  4YD1 A;  3PW2 A;  2FJ6 A;  5KFK A;  4DO9 A;  2JGA A;  4Q43 A;  3Q8L A;  4Y2V A;  2OWO A;  2MSN A;  4Y2S A;  4UAS A;  2QAR A;  2I1Q A;  4TUQ A;  4Y2Y A;  2HSZ A;  4NLN A;  5ALI A;  1SZP A;  2K4I A;  4O5E A;  4CNQ A;  5JUM A;  4FZM A;  1ZQN A;  1WUD A;  5KT5 A;  4DL2 A;  2D8C A;  4JK1 A;  2HHU A;  2E5S A;  1NI3 A;  2BPF A;  4UAR A;  5A0L A;  2YY6 A;  1NK0 A;  2F3N A;  4QWE A;  1XO0 A;  2EDU A;  4DQS A;  3C29 A;  1L7N A;  4NXZ A;  4I2B A;  3QUT A;  1ZQK A;  1D8L A;  2W7O A;  1TK5 A;  1PVQ A;  5J29 A;  5BPC A;  4EEN A;  2XIC A;  5IIM A;  2UVW A;  4KLQ A;  5KT2 A;  4Q8F A;  4DOB A;  2A1A A;  1KL9 A;  4JV2 A;  4TQR A;  2D6F C;  4EX7 A;  2PKE A;  9ICB A;  4DSK A;  2QB0 A;  3PX6 A;  4C4T A;  2ZG6 A;  1SL2 A;  2EQY A;  3HPO A;  2LYA A;  3RH4 A;  5ALW A;  4QZD A;  5KFS A;  1B0X A;  4QZ8 A;  4QZE A;  1KLN A;  1N63 A;  4OJO A;  4ELV A;  1BGX T;  2W8L A;  5DGA A;  5DB6 A;  4JV1 A;  5AM0 A;  1OXJ A;  3SI8 A;  4EZ6 A;  2CPR A;  1NJY A;  4MFC A;  3V7K A;  3CNH A;  2UVR A;  3KHH A;  3QUQ A;  2FDR A;  3MR3 A;  4TUP A;  4NLB A;  2RRD A;  1X40 A;  2Y0S C;  7ICR A;  1ZQO A;  2BPG A;  4MF2 A;  4M2Y A;  1QCK A;  4Z6D A;  1RXW A;  1QSS A;  7ICM A;  4CE6 A;  3WK5 A;  5AKE A;  2F8L A;  2WF5 A;  2BGW A;  4P0Q A;  4Q45 A;  8ICG A;  1KW4 A;  3H8S A;  4QWA A;  4ECY A;  4JV0 A;  3C1Y A;  2BHN A;  2DFL A;  1P7D A;  1T7P A;  1RM6 C;  5DLF A;  2HVH A;  4QZ9 A;  5KFI A;  3PO5 A;  4NL9 C;  3Q8P B;  1S0M A;  5EWG A;  2DUY A;  2NRZ A;  7ICU A;  5KG2 A;  3UQ2 A;  4DL3 A;  1ZQD A;  4YMO A;  2XY6 A;  1TAQ A;  1ZQI A;  2KIW A;  1UA0 A;  4XRH A;  5KFP A;  4UBC A;  2RQ5 A;  5ALG A;  1NZP A;  3HRD D;  5AKI A;  5DB9 A;  1UHU A;  4EYI B;  4ECT A;  2G06 A;  5KFU A;  1FFU A;  2ISP A;  4OJP A;  3ZDB A;  3E58 A;  4P4O A;  5ALL A;  1GO3 F;  1JMS A;  1K1S A;  3WK6 A;  3F2C A;  5KFW A;  2J6S A;  2KMD A;  3M8R A;  9ICE A;  3NVY A;  4FE3 A;  2BCS A;  3D6J A;  1JRO A;  5EOZ A;  2F1H A;  2G08 A;  8ICJ A;  3RF9 A;  3QUC A;  5CJ7 A;  3MR2 A;  3N7R C;  1IXR A;  5EE0 A;  2BCV A;  1VDV A;  2W3R A;  1S0O A;  4KLJ A;  4I2G A;  1SL1 A;  1XO1 A;  1BPB A;  8ICR A;  1X42 A;  5KFZ A;  2AQ4 A;  4DFK A;  4QWB A;  1CI4 A;  5AM4 A;  4KMO B;  2L5Y A;  4P4M A;  2G5H B;  1XNS A;  1YZ6 A;  2F1J A;  2DKX A;  4ACO A;  3TI0 A;  4LJX A;  4DF4 A;  2FLP A;  2C2E A;  4RNN A;  2JV3 A;  3ZD8 A;  3UMG A;  4B9M A;  2QB0 B;  2VJ4 A;  2UVU A;  4BJQ A;  4RUC A;  3PR5 B;  4Y2Q A;  3RAX A;  9ICO A;  1YZ7 A;  2MU2 A;  1MA7 A;  1PK3 A;  1Z00 B;  3QNM A;  1LKY A;  2KKP A;  3BZC A;  3TAD A;  4C80 A;  3RJH A;  1NZB A;  7ICN A;  4OJL A;  2HOF A;  4EEL A;  3FDS A;  1ZQY A;  3OHA A;  1BPE A;  4KLL A;  1UCV A;  4US9 A;  2JHD A;  1XSP A;  3EPI A;  3HP6 A;  3NGD A;  1X9S A;  3IN5 A;  3MR5 A;  7ICV A;  1A0P A;  3H4B A;  4QZI A;  4DFD A;  3NVV A;  2XGQ A;  4AYB F;  4DQR A;  1U4B A;  3D2N A;  2DPJ A;  2KHQ A;  8ICE A;  4ED1 A;  2F1I A;  1JAL A;  3QYP A;  5ALR A;  4B9U A;  4ED7 A;  1T3Q A;  3TAC B;  5KAI U;  2YTU A;  7ICL A;  4OCZ A;  4IR9 A;  8ICZ A;  3KHG A;  2W9C A;  1AQ6 A;  3H0M B;  1ZD3 A;  5ALM A;  5KL1 B;  3RH6 A;  1B4F A;  1X6J A;  3ETR A;  4ED0 A;  4RPX A;  8ICY A;  3PSF A;  2VA3 A;  3GZF A;  5AHX A;  3AQE A;  3NRW A;  3RFA A;  4YCX A;  2Y1I A;  4YG2 A;  1ZD2 P;  2KZZ A;  5ALU A;  2W55 A;  4WJ3 B;  4RU9 A;  5AKH A;  9ICS A;  4DOC A;  1RZT A;  5DG8 A;  1LVH A;  4RQ0 A;  4ED8 A;  1KSP A;  2FPK A;  4G3I A;  2OHF A;  2Z7J A;  2OH2 A;  1V85 A;  1PVR A;  1HUZ A;  3TKA A;  2Y0S F;  4M9N A;  1Z19 A;  1HIW A;  2R8I A;  5DBA A;  2OXO A;  3KKA A;  4QWC A;  3SD7 A;  1L3T A;  3PVX A;  4U7C A;  3B9J A;  2FMS A;  2YMM A;  2E1E A;  4NJ8 A;  4DS4 A;  9ICX A;  2UVV A;  3T79 A;  4KLU A;  2R8J A;  3MBY A;  2XO7 A;  4CF5 A;  4UAZ A;  4Y2T A;  1WCL A;  3MDC A;  1SWV A;  8ICK A;  5GTH U;  2Y1J A;  4M6W A;  3UMB A;  1NKE A;  2KVS A;  2G5I B;  1WG8 A;  3SEI A;  5CEH A;  2BZF A;  5J2F A;  1DRG A;  2JR5 A;  3S6J A;  4B9N A;  2F76 X;  3HWT A;  1UPH A;  4I2A A;  1ZQB A;  2EAP A;  1DGS A;  4F5R A;  2KE7 A;  5T14 A;  3B0X A;  1JXL A;  3EZ5 A;  3U26 A;  4PZN A;  1SGG A;  1NKB A;  1KEJ A;  1QQ6 A;  3NRZ A;  1Q3U A;  8ICW A;  3TAD C;  3PX0 A;  4Y2P A;  4ED2 A;  1RPL A;  5TZV A;  1L6N A;  4E0D A;  1MN8 A;  4KX5 A;  3V7L A;  2R8H A;  1NK7 A;  1SXE A;  2KG5 A;  4NV0 A;  4EBD A;  3BQ1 A;  4Q8E A;  5CP2 A;  1LKY B;  3AL0 B;  5AK6 A;  5G5G A;  1CRX A;  3UM9 A;  3OHB A;  4UB2 A;  3K75 D;  5EE9 A;  4OJ5 A;  3KZX A;  2YX8 A;  9ICP A;  3UPQ A;  4KLT A;  5GTI U;  5B5E U;  3TAQ A;  1BNP A;  4MHV A;  1X9M A;  2XY7 A;  5KFM A;  4I2H A;  3WK4 A;  2KZ3 A;  4XA5 A;  5IIL A;  9ICV A;  4KLM A;  4DLG A;  5L1M A;  4OO1 J;  4LZD A;  2KD1 A;  2WHE A;  1NK4 A;  2LBO A;  1X9W A;  3BQ7 A;  4Y2J A;  5AI0 A;  4PHP A;  3HIL A;  1NKC A;  8ICC A;  4GC7 A;  1QQ7 A;  4F72 A;  1YT3 A;  4ECS A;  4C0Z A;  2YML A;  2W9C B;  1JN3 A;  1M6Y A;  4PZO A;  4O3P A;  1TKD A;  4F50 A;  2AGQ A;  5BOM A;  2GH1 A;  3RR7 A;  3WKE A;  4QZC A;  1JI7 A;  4IL6 U;  2F2A B;  2F77 X;  4Y2X A;  2K8A A;  2ZIV A;  5DQG A;  4C4R A;  2W9M A;  4RT2 A;  2KFZ A;  1NK8 A;  4QZA A;  3A0H U;  1L7M A;  3C5G A;  4Z6C A;  1BVS A;  3RRH A;  2FLL A;  4AP9 A;  4I2E A;  4YXJ A;  4J9L A;  2XVT A;  5ALE A;  5DBB A;  4NLG A;  1ZOL A;  2W54 A;  2ATL A;  2M0N A;  2K60 A;  2PI5 A;  4NM1 A;  2H3Z A;  3RTV A;  3QUB A;  5J0X A;  4IRK A;  5ALH A;  3M7D A;  1PZN A;  3EPG A;  1SV0 A;  3OGU A;  3GIM A;  5KFX A;  3IG5 A;  4K4H A;  1TK8 A;  4P0P B;  3HKZ C;  3KFU F;  1NK9 A;  3K4G A;  4ZH4 A;  4X5V A;  9ICN A;  5J0Q A;  2HOQ A;  4GIB A;  5DKW A;  2LM4 A;  3GII A;  4DSF A;  3GV5 B;  2HMX A;  7ICI A;  5KFO A;  4GXK A;  3PNC A;  1KFT A;  1BPZ A;  5KT7 A;  2HHT A;  4DL6 A;  4I2F A;  1DOQ A;  2C2R A;  4F4Z A;  2A19 A;  3IRU A;  3PML A;  1IM4 A;  3JPO A;  7ICJ A;  1Q8K A;  2BDP A;  4JUZ A;  4M6W B;  2P66 A;  5ALX A;  4JB3 A;  3KOO A;  3RJF A;  5AKX A;  8ICP A;  4Q44 A;  4R65 A;  1U9L A;  4UAU A;  1JIH A;  4LVS A;  5KAF U;  1Z1B A;  1X6I A;  1K1Q A;  1ZQG A;  4AYB C;  3C2L A;  1VJ5 A;  1PVP A;  2AXT U;  3NAS A;  4FS2 A;  5ALQ A;  2KHV A;  3TAN A;  3PW7 A;  2PFP A;  2P6R A;  2ZXI A;  4NLK A;  4MFA A;  2AHO B;  3RJI A;  4MEX A;  2H3Q A;  1S0V A;  2A3V A;  4PGQ A;  5KFG A;  5F9N A;  3G6V A;  3WKA A;  3E0F A;  1XS9 D;  2QLT A;  4IC9 A;  4BXO A;  3VCB A;  4O3S A;  4RZR A;  4QIW C;  4UAW A;  2LYB A;  3GIK A;  2DQN B;  4Z6F A;  2AGO A;  3TFS A;  2R8K A;  3AU6 A;  2FMP A;  1Z00 A;  2W04 A;  5KT4 A;  1KFS A;  3BQT A;  1ZQU A;  3T5J A;  2V9W A;  1O03 A;  1KRP A;  3V7J A;  3MC1 A;  2JH1 A;  2KIC A;  1WWV A;  4DQP A;  2EH9 A;  3LVW A;  1ZQW A;  1NNL A;  3AQF A;  2FLN A;  1CUK A;  5KT6 A;  2C2D A;  2E8O A;  3MDA A;  2J6U A;  1ED1 A;  1IIP A;  4RQ4 A;  2HHQ A;  5J2G A;  4PL2 A;  4I29 A;  1WCN A;  4BWJ A;  2FPM A;  5J8Y A;  3ZDE A;  1TFR A;  1T3N A;  5AM1 A;  3OTQ A;  1RYU A;  5TIS U;  8ICH A;  1N48 A;  4UB6 U;  1X66 A;  3BS7 A;  3T5K A;  4J9S A;  1ZRN A;  4EZ9 A;  3JPN A;  1XSL A;  3RBE A;  4XUS A;  4R63 A;  1OUQ A;  4J9K A;  2ZIV B;  2E8P A;  3N7P D;  3TQ1 A;  3H40 A;  3PO4 A;  1ZJN A;  3JPS A;  5AKZ A;  5CHG A;  3UQ0 A;  3WK7 A;  1D9D A;  1SV0 C;  3PW4 A;  4P4P A;  4DSJ A;  4DSI A;  4CGZ A;  3BJY A;  5BOL A;  3GQC A;  4FO6 A;  3B0Y A;  3DV9 A;  3RB3 A;  3ISC A;  2ASL A;  2EAN A;  2ES6 A;  2DWQ A;  2ZUC A;  2C22 A;  4TQS A;  1S9F A;  8ICS A;  4B9V A;  4KLO A;  1NK5 A;  3OJS A;  2OYY A;  4PHE A;  2KZM A;  1UT5 A;  3H0R B;  2WF9 A;  1MC8 A;  5DQH A;  3EW9 A;  2HBK A;  1TV9 A;  1NOM A;  3H8M A;  3M9O B;  1U45 A;  1X9X A;  5AK4 A;  4KMU A;  5J2J A;  2W03 A;  3EUB 2;  4U6P A;  7ICP A;  1UA1 A;  3GV7 B;  3QU5 A;  5KFA A;  3QXG A;  4YXM A;  5KFF A;  4F93 B;  3ORY A;  7ICK A;  3T5H A;  3D2Q A;  5ALF A;  4DEZ A;  3A0B U;  3L5K A;  4RQM A;  2BCR A;  3M6Z A;  5EWE A;  3NUQ A;  1BPY A;  1J2M A;  3I1Y A;  4J9N A;  3K1Z A;  4J03 A;  3EWA A;  1O08 A;  1V9P A;  4RQ1 A;  2O6K A;  2YB1 A;  4Y2R A;  5AK3 A;  2RHF A;  2ZJA A;  5ALT A;  5HR7 A;  3TAP A;  2GOL A;  2W9A A;  2K89 A;  4O5K A;  5J2H A;  4RQ5 A;  5IIN A;  3HKZ F;  3C2K A;  1CEZ A;  3UXP A;  2V4R A;  5KFN A;  1D8Y A;  5H2F U;  4BXO B;  2KNJ A;  5AI4 A;  4DF8 A;  2VJ5 A;  2K4H A;  3BS5 A;  5F3X B;  2YB4 A;  2BDU A;  3ZDC A;  3UXO A;  3H4D A;  3SMV A;  1DXS A;  5AI8 A;  2WF6 A;  4TUR A;  8ICT A;  2OEH A;  5J0S A;  8ICV A;  4C7Z A;  9ICU A;  1D8B A;  2MUT A;  1ZD5 A;  2WF7 A;  4PGY A;  2KOB A;  4GLX A;  3PX4 A;  4ICA A;  2YQE A;  1H38 A;  5J2K A;  5KG6 A;  3DDH A;  1ZD4 A;  3G6X A;  1L3U A;  5J8Y C;  1MQ2 A;  4DL5 A;  4O5C A;  4HAI A;  1L7O A;  1BNO A;  2DF4 B;  8ICA A;  2Y9U A;  3E2E A;  5DG7 A;  5AK5 A;  5HNK A;  1DGJ A;  1Q46 A;  4UB3 A;  1ZYQ A;  3MFH A;  3BQ0 A;  3F5A A;  3M8S A;  4QNL A;  4NY8 A;  2KJ9 A;  5IIK A;  3HT3 A;  2C28 A;  3RR8 A;  4YR2 A;  1SKR A;  5KG5 A;  1LB2 B;  2KIV A;  4QWD A;  2HBL A;  5EWF A;  2KVC A;  5J0W A;  3PSI A;  3LWM A;  4O3N A;  4NLC A;  3UXN A;  1KBU A;  2IBK A;  3AU2 A;  1JUD A;  2J6T A;  3IP4 B;  3TAR A;  5J0Y A;  2WTF A;  5DLG A;  3M9N B;  3QE9 Y;  3KHL A;  4ELU A;  4QIW F;  2ZTD A;  2IOF A;  4GFJ A;  4RT3 A;  3N97 B;  3PW0 A;  3QZ8 A;  2V4Q A;  2EZZ A;  3WKB A;  3WK8 A;  4A8E A;  3RJE A;  2KTQ A;  4M9J A;  5HHI A;  4UW9 A;  4IQW A;  3WKC A;  3LDA A;  4RQ8 A;  3WU2 U;  9ICW A;  3N4M B;  8ICF A;  5DB7 A;  3Q8Q B;  5JU5 A;  5ALN A;  4YFK A;  4RNO A;  8ICQ A;  1C7Y A;  2A1J B;  4MF8 A;  2HDO A;  1ZQR A;  2YMP A;  3QZ7 A;  5KNI A;  3V72 A;  1KQQ A;  2I9G A;  2DGZ A;  2KV2 A;  4O0I A;  2XI9 A;  3SV3 A;  2LKY A;  3T3F A;  4P0P A;  2AQ0 A;  2MAX A;  3QU4 A;  2AGP A;  2ZJ8 A;  1TVA A;  7ICT A;  4OJ6 A;  1F5S A;  3AEV A;  3I76 A;  1T4G A;  2QB1 A;  1SL0 A;  2NRX A;  4O3O A;  4DSE A;  2ZIW B;  4EBC A;  3F53 A;  5ALJ A;  1RQN A;  2E1F A;  5L9X A;  2EZY A;  3ED5 A;  1ZQX A;  4UB1 A;  1MQ3 A;  3MR6 A;  3JPP A;  3QU2 A;  2WAQ C;  4PL1 A;  3WK9 A;  4QZF A;  4J9O A;  8ICM A;  4FZN A;  2HI0 A;  2HBM A;  4YMM A;  2LYH A;  1ZRM A;  2W8K A;  2JXJ A;  5KFB A;  5KFL A;  3ISB A;  1F0M A;  1ECW A;  2H3F A;  1J2N A;  3KBB A;  3ZI4 A;  3SZ2 A;  5DDY A;  1RYS A;  1QTM A;  1RQL A;  3BS5 B;  4O9M A;  3GIL A;  4IQV A;  2AU0 A;  2G0A A;  4PH5 A;  5ALY A;  1QSY A;  2E8M A;  5EE1 A;  1L5U A;  2K8B B;  2MUT B;  5CB1 A;  5J0O A;  4KTQ A;  3V6K A;  1XSN A;  7ICG A;  3LVV A;  2ZTE A;  1L8O A;  3ONN A;  4R8U B;  3CP8 A;  4NM2 A;  3V6J A;  5JRT A;  8ICB A;  5G5H A;  3AM9 A;  5KFH A;  5KG7 A;  5DDM A;  5C0Y A;  2PXI A;  4CF4 A;  5DBC A;  2Q4T A;  2H3I A;  5KFV A;  5KG3 A;  3CW2 C;  5L1L A;  4ZOH C;  3GIJ A;  5J2A A;  1BPD A;  9ICC A;  9ICT A;  1COK A;  2CRX A;  2Y9T A;  4O3R A;  5J2E A;  1S76 D;  3SQI A;  1S10 A;  3SAH A;  1Y88 A;  2F8K A;  3SEN A;  5ALP A;  1RDF A;  4ED6 A;  4CF3 A;  5KFJ A;  5CWR A;  1ZQQ A;  2EAM A;  2ISO A;  4KLE A;  4B9L A;  1T8E A;  1Q3V A;  3J81 j;  1SZH A;  4KLS A;  2W7P A;  4IS7 A;  4RUA A;  4RPY A;  4USA A;  2ZIU A;  4ED3 A;  5HP4 A;  4F4K A;  4J9P A;  2XID A;  4RQ6 A;  3KKA C;  4K4I A;  1KKX A;  1L3S A;  1KDH A;  5L1I A;  3C21 A;  4I2J A;  5AKK A;  4ECW A;  2ASJ A;  1U47 A;  3QU9 A;  2ZUB A;  8ICO A;  4DQQ A;  2BR0 A;  3MGV A;  5KFE A;  4GXI A;  2JEF A;  9ICL A;  1NJX A;  4ELT A;  2KSO A;  3H0L B;  3ZDD A;  2LMR A;  5CA7 A;  4J9M A;  3Q8M A;  1HEK A;  4I27 A;  5ALD A;  2VKQ A;  1URJ A;  4BX9 C;  4M04 A;  2PFQ A;  2K8C B;  4YQW A;  1QSL A;  2G07 A;  3PV8 A;  5K4L A;  4R64 A;  4F91 B;  4KIT B;  1RXV A;  7ICS A;  3I28 A;  1UT8 A;  3RB4 A;  4R66 A;  4DCC A;  4DS5 A;  3CYM A;  5AM3 A;  3DEE A;  2R8G A;  1F44 A;  4P2H A;  4DSL A;  3V6H A;  1U49 A;  9ICI A;  2WB1 C;  3IV6 A;  4EX6 A;  2CN1 A;  3Q8K A;  2XGP A;  4M9L A;  2ZIX B;  3GDX A;  1DK3 A;  2GO7 A;  2PI4 A;  4KLD A;  1SV4 A;  4PJ0 U;  3JPT A;  3HW8 A;  9ICR A;  2JEJ A;  1XWL A;  4QZB A;  1SXD A;  3MGH A;  4GXJ A;  2K4E A;  3D2S A;  4KN7 A;  2XY5 A;  7ICH A;  2JZB B;  8ICN A;  4I2D A;  1ZQV A;  9ICG A;  1FEZ A;  2W9B B;  3NVW A;  3ISD A;  1B43 A;  1VLB A;  2KP7 A;  1KTQ A;  9ICJ A;  4B9T A;  1U48 A;  1V97 A;  2LM1 A;  3MGI A;  1ZQL A;  4F92 B;  1SB3 C;  3F5E A;  4RPZ A;  2W43 A;  2WAQ F;  4ECV A;  1IG6 A;  1DK2 A;  3RB0 A;  5CR0 A;  1ZQT A;  3Q8R B;  3KD3 A;  2OCE A;  2DPI A;  2IHM A;  5D4B A;  3G6Y A;  4C8L A;  4F3O A;  1SIJ A;  3CRX A;  3QU7 A;  4DFJ A;  1MSW D;  2BQ3 A;  3OSP A;  1SKS A;  1KN5 A;  1TAM A;  2IHN A;  2QKQ A;  4JWN A;  3SYZ A;  2KJ5 A;  4RQ7 A;  5AKY A;  9ICK A;  3Q8S B;  2FPL A;  1N5W A;  2DBY A;  1ZQA A;  2HBJ A;  4M0A A;  4UQG A;  3GU3 A;  7ICQ A;  1ZXI A;  1JX4 A;  2PMZ C;  4US8 A;  1N62 A;  5C5J A;  4BDP A;  2HOI A;  4J9Q A;  4OD0 A;  1TAU A;  4UAY A;  4YP3 A;  8ICI A;  2R18 A;  1A6S A;  4CDG A;  1ARO P;  2FE9 A;  2I6X A;  5AM2 A;  2K4P A;  3IG8 A;  5FP0 A;  3OSN A;  2DKZ A;  1K5O A;  3THV A;  1N2X A;  2FI1 A;  5ALV A;  1OW5 A;  2NO4 A;  3RJK A;  2ZIU B;  4EEY A;  5KFQ A;  4M9H A;  2B0C A;  3AMZ A;  3H8W A;  1FO4 A;  3GV8 B;  1BPX A;  5AI9 A;  4UBB A;  5J0P A;  5DGB A;  3OJU A;  3C23 A;  3JPR A;  1HUO A;  3PR4 A;  1ZQZ A;  1Z4N A;  1LV5 A;  1SWW A;  2KSO B;  2IOF K;  3MFI A;  4DL7 A;  4LZG A;  5KFT A;  3LWL A;  2W11 A;  2A1J A;  4BUG A;  5AI6 A;  5IIJ A;  2AJQ A;  4QW8 A;  5AIA A;  1EXN A;  2JEI A;  3NVZ A;  3M1Y A;  2ASD A;  3SR6 A;  2ZIW A;  2RDJ A;  3PY8 A;  2E3T A;  3VC8 A;  1Z1V A;  1NK6 A;  4Z6E A;  1ZQC A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...