1UHUA

Solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
GSSGSSGTPLSLTLDHWSEIRSRAHNLSVEIKKGPWRTFCASEWPTFDVGWPPEGTFDLTVIFEVKAIVFQDGPGSHPDQQPYITVWQDLVQNSPPWIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords product of RIKEN cDNA 3110009E22
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.180 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Gamma-retroviral matrix domain 1uhuA00
1UHUA 1MN8A
chains in the Genus database with same CATH superfamily
2UVUA 1NOMA 3RJIA 1ZQWA 1P7DA 2F1HA 4UATA 4C7ZA 4ECVA 3OHAA 4KLTA 2B6GA 5G5HA 3T5JA 3PW7A 1GO3F 1QSYA 4QZHA 4DLEA 1LKYB 2FI1A 4UQGA 3JPPA 2N1RA 2ESEA 2Q4TA 3C21A 4IC9A 4TUQA 4KTQA 9ICVA 2ZIUA 2DGZA 4FFDA 4ED7A 4F72A 3BDPA 3SAGA 5IIMA 2D6FC 8ICOA 2KSOA 3SR6A 1XS9D 2CN1A 3MABA 4M0AA 1HIWA 3V7LA 2K4HA 1UHUA 3GILA 4B6JA 4I2CA 5KG6A 4DL3A 5DQGA 3WKDA 1ZQIA 2JEGA 5L9XA 1L7PA 4MEYA 5AHXA 2K8BB 3KKAA 9ICKA 2K4EA 3H40A 4ECXA 1IV8A 4Y2RA 3NRWA 1BVSA 1HUZA 2I6XA 5KFCA 2KVCA 2XY7A 2H3VA 1PVQA 3ZD9A 5EE1A 3KBBA 2A1AA 2KSOB 7ICGA 2J6TA 3N97B 4Q44A 1BNPA 3OJSA 1KTQA 2EZZA 3Q8PB 3KHLA 1X9SA 2JH1A 8ICAA 4M9LA 2W8KA 2MAXA 5ALKA 4P0PA 4FBUA 2I1QA 3RJGA 8ICXA 2W9CB 4PGYA 5KFFA 4FS2A 8ICIA 5AM1A 5BPCA 1NK9A 4I2DA 1JXLA 4CF5A 2F8KA 4U7CA 4DFPA 2V4RA 4PZOA 1RYSA 3MDCA 3GQCA 3CP8A 4PH5A 8ICWA 5J2IA 1VLBA 1TVAA 3E58A 5F3XB 4M47A 5JTIA 2WAQF 4NXZA 2XIDA 2KD1A 3C2LA 8ICMA 2GLEA 1S0NA 1KL9A 7ICMA 4XA5A 5KT7A 4DL5A 1T3NA 5J2BA 2PMZF 4QW9A 3F53A 2KG5A 4IQTA 4M9HA 4RQ2A 2OCEA 1A6SA 2BDUA 5BOLA 4UB8U 2LKYA 4QJFB 8ICNA 4NL9A 5J2DA 1MQ2A 7ICKA 4CF4A 1F0MA 2HVIA 4RT2A 4UAVA 1A77A 4XUSA 1UA0A 2W43A 4ECQA 3KHGA 4F4WA 3QUCA 2HHUA 4KITB 4MFAA 1PK1B 4A8EA 3ED5A 3I76A 4RU9A 2Y1JA 4IQVA 1XSPA 3HX0A 4YXJA 4QZGA 3AL0B 4RPXA 9ICGA 4Z6EA 9ICOA 5DLFA 3ZI4A 5KNIA 1XSNA 3SMVA 2F76X 1SV0C 4IR1A 1KRPA 2PXIA 3KHHA 4JWNA 4EBDA 3A0BU 3PR5B 2VANA 3NUQA 2WF5A 5ALRA 4DO9A 4M9GA 2AQ0A 3H4DA 1KQQA 3C5FA 1U49A 3TADA 2HHSA 4CRXA 4UAZA 1JRPA 1Q46A 8ICKA 2DPIA 7ICSA 5KFJA 5A0LA 1KFDA 4F5NA 2Q0ZX 4PGQA 2BQ3A 3B0YA 4UARA 1X9WA 2IBKA 1SL0A 5KFQA 4I2IA 2FE9A 4TURA 2JZBA 2QB1A 3RR8A 5AKYA 1BGXT 2KNJA 1QH9A 1N62A 3WKBA 2FMPA 3KFUF 4FZMA 2MSNA 5AK5A 4RQ6A 3LK9A 1X6IA 4EX6A 3RJKA 1COOA 5AI4A 3UXPA 3MR5A 3Q8LA 5KFKA 1SWWA 4XRHA 3AQEA 5IIKA 2F2AB 1KN5A 7ICUA 1S10A 4DL2A 2P35A 1RPLA 5KFDA 1NK4A 4QWCA 3GV5B 2OEHA 4G9BA 4KLFA 2EH9A 4C8MA 5J0XA 3IRUA 2AXTU 4OJ6A 3PX6A 3BJYA 2UVVA 1RXWA 5EE0A 1PVPA 4EBEA 2QB0B 2FPKA 4MF2A 1ZQMA 3OJUA 3IN5A 4I2AA 3RTVA 1ZQAA 3HJEA 5EWGA 4LZDA 3H0MB 5KG7A 2MUTA 4J03A 2H3ZA 4DL6A 2EAOA 4YR3A 7ICHA 2G08A 2FLLA 5J0TA 7ICFA 3C2MA 2HOQA 2XCAA 1N5WA 5KFEA 3EW9A 2XICA 5HNKA 5ALSA 4IQWA 1D8LA 3KZXA 3U26A 4IR9A 4ED2A 5KFNA 2FLNA 5KFOA 3AQFA 1PK1A 2NRZA 2Y0SC 1Q8KA 2CXYA 2ISOA 5KFBA 5L1JA 3VC8A 2KICA 3M9NB 5J2FA 4MF8A 2RDJA 1Q3VA 2AU0A 4UAWA 4QZCA 2YMLA 4KLSA 3GIIA 2PFNA 4F2SA 4UBBA 4HAIA 1O08A 4PHAA 1L8OA 4RPZA 1NZPA 2F44A 2EQYA 1S77D 1SZPA 1SKWA 3RAQA 2ZG6A 3PSIA 2OHFA 2BKEA 2IOFK 3FC4A 1X66A 4RQ1A 5KFHA 3NVWA 2JRZA 2W11A 5KFZA 5J0YA 2KE7A 4FZLA 2RHFA 3GV7B 4F71A 3L5KA 4EZ6A 3PW2A 2L5YA 5DB7A 7ICNA 4Q8EA 2EDUA 4GXJA 1A0PA 1ZRNA 3KD3A 1S0MA 5HMMA 1ZJNA 5KFYA 4M04A 3NASA 1TE2A 1Z4OA 3QEAZ 2WB1C 5FP0A 1FO4A 4F4ZA 7ICTA 4GC6A 3PSTA 2ZUDA 3M6KA 5KFTA 4QW8A 4F4XA 2F1IA 4YVZA 1TAUA 5ALUA 5KFIA 3C5GA 9ICXA 2FLPA 2IHMA 5IIJA 5AKGA 1QQ5A 1ZQRA 5AM4A 4BJQA 4KMOB 8ICTA 2W7PA 5ALLA 3T5HA 2G09A 2LM4A 2A1JA 4DCCA 4KMUA 3L4PA 2G5HB 3F2BA 4OCZA 1XNSA 1HJPA 1Z4NA 9ICEA 1B4FA 4US9A 1KFSA 2KZZA 2PFQA 3WK8A 5KTQA 3UQ0A 5F9NA 3TI0A 1KSPA 1NJZA 5DG7A 7ICIA 4IQUA 1RM6C 4GLXA 3EPIA 4O3OA 3MR3A 3BS5B 1ZQSA 4F5QA 1RG6A 7ICJA 4O5EA 3CNHA 3NRZA 2VIXA 4FO6A 3LWMA 1XSLA 4AYBF 3QUTA 4DQRA 4F5OA 4M9NA 2W3SA 4QZAA 5AICA 4RQ8A 2NRVA 3V7JA 3LYSA 5EWEA 4F4KA 3SQIA 2BPCA 4AP9A 4ECSA 4C8NA 5J0WA 4QWDA 1ZQEA 5DQIA 2RP5A 4C7YA 3BS7A 1DGJA 4KLHA 2KHQA 4DSIA 4F8RA 3SAHA 2HMXA 2XO7A 1TV9A 1T94A 4LZGA 7ICEA 2W9MA 2ZJ8A 9ICFA 4M6WA 2W54A 4DSKA 5ALGA 4CE6A 4U6PA 1B0XA 3ZDCA 9ICJA 5EE3A 2W55A 2WTFA 4US8A 4UAUA 3V6KA 3AU6A 1OXJA 1JN3A 5IIIA 3M7DA 3ZDEA 4JWMA 3WKEA 2HCFA 1F44A 2D8CA 4Z6DA 3PNCA 4ECZA 4R66A 1UQVA 4I29A 2F8LA 1TAMA 3TFRA 3CW2C 3RBEA 3PY8A 1S0OA 4O3NA 3ONNA 4MFFA 3RJJA 3ZDAA 5J0SA 5J8YA 2WF8A 5KFPA 4C8LA 3TARA 9ICCA 3JPSA 2C22A 3QZ7A 1M6YA 3IG5A 1ECWA 2GO7A 5KAFU 1ZRMA 4NLZA 4BXOA 1U45A 4BGDA 4QZIA 2DPJA 3GFKB 1ZQOA 5KFXA 2ZJ5A 2LI6A 5AKIA 1TKDA 3IG8A 2KZ3A 3AMZA 2E8MA 1EXNA 1NK0A 9ICRA 3VCBA 4ECUA 1SXDA 2H3IA 4RQ3A 1URJA 2BQUA 2ZTEA 3GIJA 4DSLA 4JK1A 9ICPA 1MSWD 2DKZA 1WWUA 2AH5A 4NY8A 4RNOA 4IRCA 5HHHA 3PO4A 2B0CA 1L3VA 1S8OA 3Q8KA 1NKBA 4JUZA 2R8GA 3RJHA 2HBJA 1XO0A 3WK5A 5J2KA 3T79A 2K8CB 4YCXA 4QNLA 5DBAA 2NYVA 1NK7A 1IM4A 2JHDA 1L7MA 3M9OB 1ZD4A 5KFLA 4NJ8A 1ZQCA 2IA6A 3SD7A 3SV4A 3ICXA 8ICRA 1FFUA 2LYBA 9ICWA 4DSJA 2Y9TA 1KBUA 2RQ5A 1B22A 2VA8A 3RR7A 1HUOA 2KV2A 2W03A 3M8RA 4B9UA 4R63A 3I28A 3SYZA 3R9KA 4DQSA 1SL1A 1ZQFA 4OJOA 2P6RA 2UVRA 4XQ8A 9ICNA 1PVRA 5T14A 5KT3A 3GV8B 8ICJA 2JV3A 1YZ6A 2ZIWB 1WCLA 4KN7A 2R8HA 3K1ZA 3WK7A 1WWVA 1KEJA 4UB3A 3ETLA 5J0OA 3G6YA 3RFAA 1QSLA 2BDPA 3C23A 1ZQGA 4I2GA 4I2JA 2ZIXA 3UXNA 1ZJMA 9ICUA 5KFUA 2HSZA 3QNMA 2W8LA 3QEBZ 4DQIA 1FFVA 4EZ9A 8ICVA 1CI4A 3AUOA 3FDSA 3T5KA 1SL2A 4PPXA 4CCHA 2BR0A 3QXGA 5AKEA 3HKZF 5AI8A 4YMNA 3ORYA 2JXJA 3QU7A 2HOIA 4CNQA 5KFVA 5ALVA 4B9NA 2W9BA 2ZUBA 4NL9C 1DK2A 1JX4A 2JH7A 4DFJA 1SV4A 1ED1A 3H8MA 4E0DA 3N7RC 1ZD2P 3Q8RB 2PKEA 4ECRA 3H8JA 1J97A 2B21A 4GC7A 3ZD8A 1L7OA 4TQRA 1LVHA 4WJ3B 1SXEA 1BPZA 2HI0A 4K4HA 2ZUCA 3MBYA 4PJ0U 4O0IA 4ED0A 3DV9A 2ZXIA 5KFAA 1S97A 3PX4A 2FJ6A 1ZQ1C 2EAMA 3RB4A 2MRLA 5J2JA 4C8OA 5HP4A 1XWLA 4LVSA 3QUQA 3MDAA 5AKJA 4CGZA 1NJXA 5DBBA 3PR4A 2QKQA 2HHTA 3CRXA 5J2GA 2XCPA 2XY6A 4DOCA 2KP7A 3MR6A 1U9LA 3RJEA 2BHNA 3GZFA 2JEJA 2R8KA 3RRHA 8ICQA 1J2MA 3PW4A 1BPBA 4Z6FA 5ALOA 1ZQJA 2KEYA 4CDGA 3RRGA 4KLQA 3IV6A 4Y2QA 1C7YA 3RH5A 4B9LA 4F2RA 4RZRA 4CF3A 4ZOHC 5AKXA 3KKAC 4PL1A 2KFZA 4NV0A 1WCNA 2WF9A 5AI5A 3H0RB 4B9VA 2JMGA 3PMNA 4EYIB 3AEVA 4YN4A 2FMQA 5L1LA 4C4RA 2BCUA 4J9MA 4R64A 1KFTA 1NJYA 3MR2A 4KLMA 3RBDA 4DQPA 2HBKA 2W9AA 4O3PA 3EWAA 3OGUA 1NK6A 4Y2JA 5CHGA 4ECWA 3TKAA 2KMDA 2JEFA 2G07A 1ZQUA 1DGSA 5G5GA 1C20A 5CP2A 2R8JA 3DDHA 8ICPA 4Y2PA 3F5EA 1FIQA 1ZQHA 3KOOA 4P4PA 3THVA 5GTHU 4KLDA 2O6KA 2NO4A 1TFRA 4EBCA 3NVYA 4F93B 1UA1A 1KKXA 1DRGA 3D2SA 4ED8A 4JB3A 4RUCA 5K4LA 4NWIA 3TFSA 5KFSA 1SIJA 2BQRA 2KFNA 3QE9Y 2DBYA 1X9XA 5IIOA 2ISPA 4K4IA 5HHIA 2W9CA 2PMZC 4F4YA 4UB1A 1SV0A 2NRXA 4YG2A 4UB5A 5KG1A 3TAQA 3H8SA 2PI4A 3GIKA 1V9PA 4KLIA 4RNMA 5DB9A 1NKCA 2NRTA 2K4IA 2XY5A 1WUDA 2M9NA 4J9QA 1X42A 1VJ5A 4O5CA 3MFHA 1L8LA 2R8IA 3ETRA 1D9FA 2BGWA 2E5SA 2MUTB 5AK4A 1ZQTA 2KN7A 1N61A 1BNOA 3MGIA 4ECYA 5JU5A 2W7OA 2ASDA 2ASLA 4DFKA 4F50A 4Y2YA 1A76A 3MFIA 3PW0A 1N60A 3PZPA 2EANA 4YMOA 5ALXA 5J0RA 2YB1A 1FEZA 4PZNA 5AM5A 3JPQA 2YMQA 3PO5A 5B5EU 2K60A 5ALQA 1NK5A 3H4BA 3OTQA 5CR0A 4RQ5A 1ZETA 1JXEA 4O3RA 4NLCA 5CEHA 5L1IA 4ED6A 3E2EA 4C4TA 2HHXA 4RQNA 1RZTA 5CJ7A 8ICYA 1LV5A 2LPEA 3GU3A 3WKCA 4BDPA 1ZQKA 3G6VA 5KG2A 4KLUA 3QX7A 3WK6A 4OJ5A 5KT4A 5KFGA 2ZTDA 7ICQA 3J81j 4O5KA 5J29A 5TISU 2FPMA 2QARA 3E0FA 2C2DA 2JEIA 5DLGA 2LYHA 4QZBA 3HP6A 4F92B 3V72A 1ZQLA 1RQLA 5KT2A 2OYYA 2BCVA 2QB0A 3F2DA 3QU5A 3C1ZA 4IL6U 2UVWA 1ZD3A 3ISBA 2OXOA 3A0HU 8ICEA 5J2HA 2FDRA 2V9WA 3TANA 3NVZA 3SI8A 2YY6A 2LM1A 1IG6A 2LMRA 3BS5A 1KLNA 1KW4A 1ZQYA 2ASJA 1BPDA 3T5LA 4UASA 4QIWF 4C80A 2ATLA 4QIWC 4QWAA 5ALIA 1H38A 2NO5A 2XI9A 4EENA 2BPGA 1Z3EB 5ALHA 4PHDA 4B9SA 1T4GA 2ODGA 2PI5A 7ICVA 3SAFA 1QQ6A 4J9RA 3SEIA 4PL2A 4YXMA 2E8PA 4ED1A 3H8WA 3CYMA 1JMSA 2F1JA 1K1SA 3K4GA 3DEEA 3HWTA 5CWRA 2ZIVB 5KL1B 3ISDA 1L6NA 4F5PA 4KLJA 2HHWA 8ICLA 3LVWA 1YT3A 2Z7JA 5DG9A 3ZDBA 5ALZA 3AU2A 2IHNA 1T7PA 4UB4A 9ICIA 4ZH4A 3OSNA 1NZBA 4I27A 5C5JA 2KHVA 3IDWA 1MC8A 4KLEA 5HR7A 3N28A 3N7SC 4F5RA 1B43A 4O3QA 1PZNA 2YTUA 4OJLA 2Y0SF 1V97A 5AI6A 3D6JA 4Y2UA 4C4SA 4GXKA 3UMBA 4O3MA 2ZIUB 1K5OA 1RXVA 4Q8FA 4I2FA 8ICBA 3RH4A 1N48A 5B66U 3S6JA 2HVHA 4RQ4A 3EPGA 3TAPA 1TK5A 4TUSA 3Q8QB 1LKYA 3WU2U 5J0PA 2LBOA 1NI3A 4J9LA 2HDOA 4DL7A 2OH2A 4YR0A 4BXOB 2EZYA 4UAYA 3PMLA 3G6XA 1ZQDA 2KJ5A 4FE3A 1NKEA 1ZQVA 5KFRA 2J6SA 2WFAA 5ALPA 4O3SA 2YMMA 8ICSA 1COKA 2G0AA 3K1RB 3IHQB 4FBTA 5KL8B 4KX3A 3WK4A 3BQ1A 3PW5A 3QYPA 4YP3A 3BQ2A 1Y88A 2GOLA 4C8KA 5AM3A 4ED3A 4QZEA 5ALMA 5KG5A 4Y2XA 3JPOA 8ICCA 2GWSA 3QU4A 5AKLA 4J9PA 4YQWA 1S9FA 4KX5A 4HYKA 3IM1A 2RRDA 2HHQA 1MQ3A 2PFOA 2E1FA 4BUGA 3Q8SB 4P0PB 4RQ7A 4EEYA 4O9MA 5J2AA 2HOFA 5HR6A 9ICQA 4I2BA 9ICMA 3HT3A 8ICUA 4R8UA 4EYHB 9ICSA 1QSSA 1YZ7A 2J6UA 3B9JA 5J2CA 1L3SA 4QZ9A 2XGQA 5IINA 3MC1A 2DUYA 5L1MA 3SZ2A 1XC9A 4P4MA 1TK8A 3UPQA 2M0NA 1N5XA 4ICAA 2ZIWA 3UXOA 1BPXA 7ICLA 1BPYA 1CUKA 2KTQA 3ZDDA 2VA2A 4EX7A 2BCQA 2RDIA 1NNLA 1X2IA 5L1KA 3NVVA 1TK0A 3WK9A 3C28A 2C2RA 3M8SA 1RYRA 4B9TA 5J2EA 4G3IA 2H3QA 1L3TA 1Z00B 1ZQBA 3RB0A 5DGAA 4RUAA 1SGGA 3HKZC 4KLGA 2P66A 4M2YA 4JMUA 4F3OA 2I5HA 7ICOA 4QZ8A 3QU2A 3N7PD 3HRDD 3PX0A 5AKHA 4I2HA 4YMMA 2VJ4A 2K4PA 8ICHA 5KT5A 2JR5A 5HMLA 3BZCA 3TQ1A 1SKSA 2Y1IA 5AI0A 2Y9UA 3OHBA 4DQQA 5DB6A 4DF4A 9ICLA 2C28A 3AN1A 2QARB 2ES6A 2IOFA 4Q45A 2W9BB 3LWLA 2DFLA 5D49A 4IRKA 4LJXA 5EOZA 2VJ5A 4NLGA 2AGPA 1N63A 5KG0A 1ZQXA 2CPRA 1WYGA 4QZDA 1CEZA 5ALEA 4DSFA 5JUMA 5KAIU 4I28A 5AKZA 3TACB 2KIWA 2C2EA 3LDAA 3EYZA 3PV8A 4YFKA 5ALDA 3V7KA 4C0ZA 5CB1A 4TQSA 3OPXA 4J9NA 2VA3A 3M1YA 4NM2A 4DS4A 1OUQA 4UB2A 2BZFA 3RF9A 4DOAA 3N4MB 4RT3A 1JALA 1K1QA 3PVXA 4AYBC 3JPRA 2WB1F 4DL4A 2YQEA 4B9MA 2ALZA 4KLOA 1UT5A 1ZQPA 1L5UA 2KKPA 5ALJA 1HEKA 3V6HA 1U47A 2CRXA 2WF6A 3HPOA 4J9KA 2G5IB 3QU9A 4RQ0A 4UB6U 2KKVA 4ECTA 3SV3A 1X40A 1V38A 4DF8A 4M6WB 5EE9A 8ICFA 3UMCA 1U4BA 3H7IA 4Y2SA 3RB6A 4IRDA 2YMPA 1UT8A 2YB4A 4TUPA 3SENA 8ICZA 2EAPA 3FM9A 2DQNB 4BX9C 5ALFA 2I9GA 4DFMA 4K4GA 3O0FA 5J0QA 1IIPA 5DB8A 1MA7A 4UBCA 4YR2A 1ZXIA 2KZMA 5KFMA 2G06A 5BOMA 3NTUA 1SB3C 2JGAA 5J8YC 3EZ5A 4DLGA 5DKWA 1DK3A 3UQ2A 3D2QA 3GIMA 3C29A 2BCRA 1S76D 2ZXHA 9ICTA 1XU4A 1J2NA 5J0UA 1ZYQA 5AI9A 4OJPA 4JV2A 2PFPA 5E79U 2XGPA 3OSPA 4M9JA 8ICGA 4MHVA 1SZHA 1LB2B 1JROA 5ALYA 1JIHA 2DKXA 4DEZA 4Z6CA 5TZVA 1QQ7A 2AQ4A 2AGOA 2K8AA 3KTQA 2EZXA 2E1EA 5KG3A 3M9MB 2HW3A 3QUBA 3T3FA 4USAA 4IS7A 1T3QA 2KK0A 4YD1A 4RNNA 5JRTA 3FAHA 3C2KA 1UCVA 3B0XA 2HHVA 2MU2A 2ZJAA 3FYHA 2KIVA 4KN4A 5DDYA 2WAQC 3ISCA 1O03A 5AM2A 5CA7A 2DWQA 2E8OA 9ICBA 4F91B 1MN8A 1Z1BA 1Z00A 4P0QB 5DGBA 5AIBA 1BPEA 3BZKA 5IILA 3EUB2 3JPTA 3PSFA 2HBLA 2BCSA 5C0YA 4ACOA 3WKAA 4I2EA 4J9SA 2K89A 3K75D 2IOHA 7ICRA 5AIAA 2E8NA 3UMGA 4Q43A 2R18A 5ALWA 4ELVA 1DXSA 2WHEA 2YX8A 2AGQA 1Z1VA 1NK8A 2W04A 2A3VA 4NLKA 2HBMA 2OWOA 4R65A 1QCKA 1RDFA 4BWMA 4BWJA 2D3DA 4GFJA 4KLLA 3KHRA 2ZTCA 5DG8A 4QWBA 1IXRA 1NJWA 3L3FX 3MGVA 1QLNA 2AJQA 2H3FA 2ZIXB 1SKRA 3LVVA 1S5LU 3C1YA 3GDXA 1ZQZA 4PGXA 3F2CA 1D8BA 2NV3A 3RH6A 1U48A 4FS1A 2A1JB 4PHPA 2RLTA 2KOBA 1RYUA 3ALRA 4NLBA 1SWVA 2WF7A 4OO1J 4QWEA 5KG4A 4DFDA 1F5SA 4EEKA 2LHTA 4P4OA 4Y2VA 3JPNA 3BQTA 1D8YA 4Y2TA 2DL0A 1VDVA 4J9OA 4ELTA 9ICAA 3UM9A 4RPYA 4NM1A 1ZOLA 5DDMA 3HILA 5GTIU 3TADC 1JI7A 2IMWP 4P2HA 4MEXA 3F5AA 1DOQA 4PHEA 2BPFA 2E3TA 2QLTA 2V4QA 4OD0A 2H5XA 2XC9A 4R8UB 4MFCA 2MA1A 1N56A 1QTMA 5ALTA 4JV0A 3BQ7A 2GH1A 3I1YA 4X5VA 4FZNA 1L3UA 1RQNA 1PUZA 5H2FU 5KT6A 3NS1A 2DF4B 4DSEA 2XVTA 2FPLA 2FMSA 3BQ0A 3PSPA 2F3NA 5DBCA 4EELA 2A19A 3KZIU 3RB3A 3HW8A 4ELUA 5D4BA 1KDHA 4RQMA 2VKQA 3MGHA 1ZQNA 9ICHA 2YN4A 3H0LB 2ZIVA 1AQ6A 4GIBA 1OW5A 4DWIA 1AROP 5F9LA 3RAXA 1Q3UA 3IP4B 2AHOB 2NRWA 3QZ8A 1Z19A 4QZFA 2P6UA 1ZQQA 3AM9A 5CRXA 1UPHA 4DS5A 5D46A 2KJ9A 5AK6A 4YD2A 1D9DA 3Q8MA 1PK3A 3NGDA 7ICPA 2KJ8A 5ALNA 1N2XA 1WG8A 2KVSA 4GXIA 1CRXA 3RJFA 4NLNA 2JZBB 1V85A 1JUDA 2W3RA 3D2NA 5AK3A 5EWFA 4P0QA 4JV1A 3V6JA 1L7NA 2LYAA 1T8EA 3M6ZA 5KFWA 2OM6A 2F77X 4UW9A 1XO1A 5AKKA 1S0VA 1X6JA 4DOBA 1X9MA 1TAQA 5DQHA 5AM0A 1ZD5A
chains in the Genus database with same CATH topology
1UHUA 1MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHU A;  1MN8 A; 
#chains in the Genus database with same CATH topology
 2UVU A;  1NOM A;  3RJI A;  1ZQW A;  1P7D A;  2F1H A;  4UAT A;  4C7Z A;  4ECV A;  3OHA A;  4KLT A;  2B6G A;  5G5H A;  3T5J A;  3PW7 A;  1GO3 F;  1QSY A;  4QZH A;  4DLE A;  1LKY B;  2FI1 A;  4UQG A;  3JPP A;  2N1R A;  2ESE A;  2Q4T A;  3C21 A;  4IC9 A;  4TUQ A;  4KTQ A;  9ICV A;  2ZIU A;  2DGZ A;  4FFD A;  4ED7 A;  4F72 A;  3BDP A;  3SAG A;  5IIM A;  2D6F C;  8ICO A;  2KSO A;  3SR6 A;  1XS9 D;  2CN1 A;  3MAB A;  4M0A A;  1HIW A;  3V7L A;  2K4H A;  1UHU A;  3GIL A;  4B6J A;  4I2C A;  5KG6 A;  4DL3 A;  5DQG A;  3WKD A;  1ZQI A;  2JEG A;  5L9X A;  1L7P A;  4MEY A;  5AHX A;  2K8B B;  3KKA A;  9ICK A;  2K4E A;  3H40 A;  4ECX A;  1IV8 A;  4Y2R A;  3NRW A;  1BVS A;  1HUZ A;  2I6X A;  5KFC A;  2KVC A;  2XY7 A;  2H3V A;  1PVQ A;  3ZD9 A;  5EE1 A;  3KBB A;  2A1A A;  2KSO B;  7ICG A;  2J6T A;  3N97 B;  4Q44 A;  1BNP A;  3OJS A;  1KTQ A;  2EZZ A;  3Q8P B;  3KHL A;  1X9S A;  2JH1 A;  8ICA A;  4M9L A;  2W8K A;  2MAX A;  5ALK A;  4P0P A;  4FBU A;  2I1Q A;  3RJG A;  8ICX A;  2W9C B;  4PGY A;  5KFF A;  4FS2 A;  8ICI A;  5AM1 A;  5BPC A;  1NK9 A;  4I2D A;  1JXL A;  4CF5 A;  2F8K A;  4U7C A;  4DFP A;  2V4R A;  4PZO A;  1RYS A;  3MDC A;  3GQC A;  3CP8 A;  4PH5 A;  8ICW A;  5J2I A;  1VLB A;  1TVA A;  3E58 A;  5F3X B;  4M47 A;  5JTI A;  2WAQ F;  4NXZ A;  2XID A;  2KD1 A;  3C2L A;  8ICM A;  2GLE A;  1S0N A;  1KL9 A;  7ICM A;  4XA5 A;  5KT7 A;  4DL5 A;  1T3N A;  5J2B A;  2PMZ F;  4QW9 A;  3F53 A;  2KG5 A;  4IQT A;  4M9H A;  4RQ2 A;  2OCE A;  1A6S A;  2BDU A;  5BOL A;  4UB8 U;  2LKY A;  4QJF B;  8ICN A;  4NL9 A;  5J2D A;  1MQ2 A;  7ICK A;  4CF4 A;  1F0M A;  2HVI A;  4RT2 A;  4UAV A;  1A77 A;  4XUS A;  1UA0 A;  2W43 A;  4ECQ A;  3KHG A;  4F4W A;  3QUC A;  2HHU A;  4KIT B;  4MFA A;  1PK1 B;  4A8E A;  3ED5 A;  3I76 A;  4RU9 A;  2Y1J A;  4IQV A;  1XSP A;  3HX0 A;  4YXJ A;  4QZG A;  3AL0 B;  4RPX A;  9ICG A;  4Z6E A;  9ICO A;  5DLF A;  3ZI4 A;  5KNI A;  1XSN A;  3SMV A;  2F76 X;  1SV0 C;  4IR1 A;  1KRP A;  2PXI A;  3KHH A;  4JWN A;  4EBD A;  3A0B U;  3PR5 B;  2VAN A;  3NUQ A;  2WF5 A;  5ALR A;  4DO9 A;  4M9G A;  2AQ0 A;  3H4D A;  1KQQ A;  3C5F A;  1U49 A;  3TAD A;  2HHS A;  4CRX A;  4UAZ A;  1JRP A;  1Q46 A;  8ICK A;  2DPI A;  7ICS A;  5KFJ A;  5A0L A;  1KFD A;  4F5N A;  2Q0Z X;  4PGQ A;  2BQ3 A;  3B0Y A;  4UAR A;  1X9W A;  2IBK A;  1SL0 A;  5KFQ A;  4I2I A;  2FE9 A;  4TUR A;  2JZB A;  2QB1 A;  3RR8 A;  5AKY A;  1BGX T;  2KNJ A;  1QH9 A;  1N62 A;  3WKB A;  2FMP A;  3KFU F;  4FZM A;  2MSN A;  5AK5 A;  4RQ6 A;  3LK9 A;  1X6I A;  4EX6 A;  3RJK A;  1COO A;  5AI4 A;  3UXP A;  3MR5 A;  3Q8L A;  5KFK A;  1SWW A;  4XRH A;  3AQE A;  5IIK A;  2F2A B;  1KN5 A;  7ICU A;  1S10 A;  4DL2 A;  2P35 A;  1RPL A;  5KFD A;  1NK4 A;  4QWC A;  3GV5 B;  2OEH A;  4G9B A;  4KLF A;  2EH9 A;  4C8M A;  5J0X A;  3IRU A;  2AXT U;  4OJ6 A;  3PX6 A;  3BJY A;  2UVV A;  1RXW A;  5EE0 A;  1PVP A;  4EBE A;  2QB0 B;  2FPK A;  4MF2 A;  1ZQM A;  3OJU A;  3IN5 A;  4I2A A;  3RTV A;  1ZQA A;  3HJE A;  5EWG A;  4LZD A;  3H0M B;  5KG7 A;  2MUT A;  4J03 A;  2H3Z A;  4DL6 A;  2EAO A;  4YR3 A;  7ICH A;  2G08 A;  2FLL A;  5J0T A;  7ICF A;  3C2M A;  2HOQ A;  2XCA A;  1N5W A;  5KFE A;  3EW9 A;  2XIC A;  5HNK A;  5ALS A;  4IQW A;  1D8L A;  3KZX A;  3U26 A;  4IR9 A;  4ED2 A;  5KFN A;  2FLN A;  5KFO A;  3AQF A;  1PK1 A;  2NRZ A;  2Y0S C;  1Q8K A;  2CXY A;  2ISO A;  5KFB A;  5L1J A;  3VC8 A;  2KIC A;  3M9N B;  5J2F A;  4MF8 A;  2RDJ A;  1Q3V A;  2AU0 A;  4UAW A;  4QZC A;  2YML A;  4KLS A;  3GII A;  2PFN A;  4F2S A;  4UBB A;  4HAI A;  1O08 A;  4PHA A;  1L8O A;  4RPZ A;  1NZP A;  2F44 A;  2EQY A;  1S77 D;  1SZP A;  1SKW A;  3RAQ A;  2ZG6 A;  3PSI A;  2OHF A;  2BKE A;  2IOF K;  3FC4 A;  1X66 A;  4RQ1 A;  5KFH A;  3NVW A;  2JRZ A;  2W11 A;  5KFZ A;  5J0Y A;  2KE7 A;  4FZL A;  2RHF A;  3GV7 B;  4F71 A;  3L5K A;  4EZ6 A;  3PW2 A;  2L5Y A;  5DB7 A;  7ICN A;  4Q8E A;  2EDU A;  4GXJ A;  1A0P A;  1ZRN A;  3KD3 A;  1S0M A;  5HMM A;  1ZJN A;  5KFY A;  4M04 A;  3NAS A;  1TE2 A;  1Z4O A;  3QEA Z;  2WB1 C;  5FP0 A;  1FO4 A;  4F4Z A;  7ICT A;  4GC6 A;  3PST A;  2ZUD A;  3M6K A;  5KFT A;  4QW8 A;  4F4X A;  2F1I A;  4YVZ A;  1TAU A;  5ALU A;  5KFI A;  3C5G A;  9ICX A;  2FLP A;  2IHM A;  5IIJ A;  5AKG A;  1QQ5 A;  1ZQR A;  5AM4 A;  4BJQ A;  4KMO B;  8ICT A;  2W7P A;  5ALL A;  3T5H A;  2G09 A;  2LM4 A;  2A1J A;  4DCC A;  4KMU A;  3L4P A;  2G5H B;  3F2B A;  4OCZ A;  1XNS A;  1HJP A;  1Z4N A;  9ICE A;  1B4F A;  4US9 A;  1KFS A;  2KZZ A;  2PFQ A;  3WK8 A;  5KTQ A;  3UQ0 A;  5F9N A;  3TI0 A;  1KSP A;  1NJZ A;  5DG7 A;  7ICI A;  4IQU A;  1RM6 C;  4GLX A;  3EPI A;  4O3O A;  3MR3 A;  3BS5 B;  1ZQS A;  4F5Q A;  1RG6 A;  7ICJ A;  4O5E A;  3CNH A;  3NRZ A;  2VIX A;  4FO6 A;  3LWM A;  1XSL A;  4AYB F;  3QUT A;  4DQR A;  4F5O A;  4M9N A;  2W3S A;  4QZA A;  5AIC A;  4RQ8 A;  2NRV A;  3V7J A;  3LYS A;  5EWE A;  4F4K A;  3SQI A;  2BPC A;  4AP9 A;  4ECS A;  4C8N A;  5J0W A;  4QWD A;  1ZQE A;  5DQI A;  2RP5 A;  4C7Y A;  3BS7 A;  1DGJ A;  4KLH A;  2KHQ A;  4DSI A;  4F8R A;  3SAH A;  2HMX A;  2XO7 A;  1TV9 A;  1T94 A;  4LZG A;  7ICE A;  2W9M A;  2ZJ8 A;  9ICF A;  4M6W A;  2W54 A;  4DSK A;  5ALG A;  4CE6 A;  4U6P A;  1B0X A;  3ZDC A;  9ICJ A;  5EE3 A;  2W55 A;  2WTF A;  4US8 A;  4UAU A;  3V6K A;  3AU6 A;  1OXJ A;  1JN3 A;  5III A;  3M7D A;  3ZDE A;  4JWM A;  3WKE A;  2HCF A;  1F44 A;  2D8C A;  4Z6D A;  3PNC A;  4ECZ A;  4R66 A;  1UQV A;  4I29 A;  2F8L A;  1TAM A;  3TFR A;  3CW2 C;  3RBE A;  3PY8 A;  1S0O A;  4O3N A;  3ONN A;  4MFF A;  3RJJ A;  3ZDA A;  5J0S A;  5J8Y A;  2WF8 A;  5KFP A;  4C8L A;  3TAR A;  9ICC A;  3JPS A;  2C22 A;  3QZ7 A;  1M6Y A;  3IG5 A;  1ECW A;  2GO7 A;  5KAF U;  1ZRM A;  4NLZ A;  4BXO A;  1U45 A;  4BGD A;  4QZI A;  2DPJ A;  3GFK B;  1ZQO A;  5KFX A;  2ZJ5 A;  2LI6 A;  5AKI A;  1TKD A;  3IG8 A;  2KZ3 A;  3AMZ A;  2E8M A;  1EXN A;  1NK0 A;  9ICR A;  3VCB A;  4ECU A;  1SXD A;  2H3I A;  4RQ3 A;  1URJ A;  2BQU A;  2ZTE A;  3GIJ A;  4DSL A;  4JK1 A;  9ICP A;  1MSW D;  2DKZ A;  1WWU A;  2AH5 A;  4NY8 A;  4RNO A;  4IRC A;  5HHH A;  3PO4 A;  2B0C A;  1L3V A;  1S8O A;  3Q8K A;  1NKB A;  4JUZ A;  2R8G A;  3RJH A;  2HBJ A;  1XO0 A;  3WK5 A;  5J2K A;  3T79 A;  2K8C B;  4YCX A;  4QNL A;  5DBA A;  2NYV A;  1NK7 A;  1IM4 A;  2JHD A;  1L7M A;  3M9O B;  1ZD4 A;  5KFL A;  4NJ8 A;  1ZQC A;  2IA6 A;  3SD7 A;  3SV4 A;  3ICX A;  8ICR A;  1FFU A;  2LYB A;  9ICW A;  4DSJ A;  2Y9T A;  1KBU A;  2RQ5 A;  1B22 A;  2VA8 A;  3RR7 A;  1HUO A;  2KV2 A;  2W03 A;  3M8R A;  4B9U A;  4R63 A;  3I28 A;  3SYZ A;  3R9K A;  4DQS A;  1SL1 A;  1ZQF A;  4OJO A;  2P6R A;  2UVR A;  4XQ8 A;  9ICN A;  1PVR A;  5T14 A;  5KT3 A;  3GV8 B;  8ICJ A;  2JV3 A;  1YZ6 A;  2ZIW B;  1WCL A;  4KN7 A;  2R8H A;  3K1Z A;  3WK7 A;  1WWV A;  1KEJ A;  4UB3 A;  3ETL A;  5J0O A;  3G6Y A;  3RFA A;  1QSL A;  2BDP A;  3C23 A;  1ZQG A;  4I2G A;  4I2J A;  2ZIX A;  3UXN A;  1ZJM A;  9ICU A;  5KFU A;  2HSZ A;  3QNM A;  2W8L A;  3QEB Z;  4DQI A;  1FFV A;  4EZ9 A;  8ICV A;  1CI4 A;  3AUO A;  3FDS A;  3T5K A;  1SL2 A;  4PPX A;  4CCH A;  2BR0 A;  3QXG A;  5AKE A;  3HKZ F;  5AI8 A;  4YMN A;  3ORY A;  2JXJ A;  3QU7 A;  2HOI A;  4CNQ A;  5KFV A;  5ALV A;  4B9N A;  2W9B A;  2ZUB A;  4NL9 C;  1DK2 A;  1JX4 A;  2JH7 A;  4DFJ A;  1SV4 A;  1ED1 A;  3H8M A;  4E0D A;  3N7R C;  1ZD2 P;  3Q8R B;  2PKE A;  4ECR A;  3H8J A;  1J97 A;  2B21 A;  4GC7 A;  3ZD8 A;  1L7O A;  4TQR A;  1LVH A;  4WJ3 B;  1SXE A;  1BPZ A;  2HI0 A;  4K4H A;  2ZUC A;  3MBY A;  4PJ0 U;  4O0I A;  4ED0 A;  3DV9 A;  2ZXI A;  5KFA A;  1S97 A;  3PX4 A;  2FJ6 A;  1ZQ1 C;  2EAM A;  3RB4 A;  2MRL A;  5J2J A;  4C8O A;  5HP4 A;  1XWL A;  4LVS A;  3QUQ A;  3MDA A;  5AKJ A;  4CGZ A;  1NJX A;  5DBB A;  3PR4 A;  2QKQ A;  2HHT A;  3CRX A;  5J2G A;  2XCP A;  2XY6 A;  4DOC A;  2KP7 A;  3MR6 A;  1U9L A;  3RJE A;  2BHN A;  3GZF A;  2JEJ A;  2R8K A;  3RRH A;  8ICQ A;  1J2M A;  3PW4 A;  1BPB A;  4Z6F A;  5ALO A;  1ZQJ A;  2KEY A;  4CDG A;  3RRG A;  4KLQ A;  3IV6 A;  4Y2Q A;  1C7Y A;  3RH5 A;  4B9L A;  4F2R A;  4RZR A;  4CF3 A;  4ZOH C;  5AKX A;  3KKA C;  4PL1 A;  2KFZ A;  4NV0 A;  1WCN A;  2WF9 A;  5AI5 A;  3H0R B;  4B9V A;  2JMG A;  3PMN A;  4EYI B;  3AEV A;  4YN4 A;  2FMQ A;  5L1L A;  4C4R A;  2BCU A;  4J9M A;  4R64 A;  1KFT A;  1NJY A;  3MR2 A;  4KLM A;  3RBD A;  4DQP A;  2HBK A;  2W9A A;  4O3P A;  3EWA A;  3OGU A;  1NK6 A;  4Y2J A;  5CHG A;  4ECW A;  3TKA A;  2KMD A;  2JEF A;  2G07 A;  1ZQU A;  1DGS A;  5G5G A;  1C20 A;  5CP2 A;  2R8J A;  3DDH A;  8ICP A;  4Y2P A;  3F5E A;  1FIQ A;  1ZQH A;  3KOO A;  4P4P A;  3THV A;  5GTH U;  4KLD A;  2O6K A;  2NO4 A;  1TFR A;  4EBC A;  3NVY A;  4F93 B;  1UA1 A;  1KKX A;  1DRG A;  3D2S A;  4ED8 A;  4JB3 A;  4RUC A;  5K4L A;  4NWI A;  3TFS A;  5KFS A;  1SIJ A;  2BQR A;  2KFN A;  3QE9 Y;  2DBY A;  1X9X A;  5IIO A;  2ISP A;  4K4I A;  5HHI A;  2W9C A;  2PMZ C;  4F4Y A;  4UB1 A;  1SV0 A;  2NRX A;  4YG2 A;  4UB5 A;  5KG1 A;  3TAQ A;  3H8S A;  2PI4 A;  3GIK A;  1V9P A;  4KLI A;  4RNM A;  5DB9 A;  1NKC A;  2NRT A;  2K4I A;  2XY5 A;  1WUD A;  2M9N A;  4J9Q A;  1X42 A;  1VJ5 A;  4O5C A;  3MFH A;  1L8L A;  2R8I A;  3ETR A;  1D9F A;  2BGW A;  2E5S A;  2MUT B;  5AK4 A;  1ZQT A;  2KN7 A;  1N61 A;  1BNO A;  3MGI A;  4ECY A;  5JU5 A;  2W7O A;  2ASD A;  2ASL A;  4DFK A;  4F50 A;  4Y2Y A;  1A76 A;  3MFI A;  3PW0 A;  1N60 A;  3PZP A;  2EAN A;  4YMO A;  5ALX A;  5J0R A;  2YB1 A;  1FEZ A;  4PZN A;  5AM5 A;  3JPQ A;  2YMQ A;  3PO5 A;  5B5E U;  2K60 A;  5ALQ A;  1NK5 A;  3H4B A;  3OTQ A;  5CR0 A;  4RQ5 A;  1ZET A;  1JXE A;  4O3R A;  4NLC A;  5CEH A;  5L1I A;  4ED6 A;  3E2E A;  4C4T A;  2HHX A;  4RQN A;  1RZT A;  5CJ7 A;  8ICY A;  1LV5 A;  2LPE A;  3GU3 A;  3WKC A;  4BDP A;  1ZQK A;  3G6V A;  5KG2 A;  4KLU A;  3QX7 A;  3WK6 A;  4OJ5 A;  5KT4 A;  5KFG A;  2ZTD A;  7ICQ A;  3J81 j;  4O5K A;  5J29 A;  5TIS U;  2FPM A;  2QAR A;  3E0F A;  2C2D A;  2JEI A;  5DLG A;  2LYH A;  4QZB A;  3HP6 A;  4F92 B;  3V72 A;  1ZQL A;  1RQL A;  5KT2 A;  2OYY A;  2BCV A;  2QB0 A;  3F2D A;  3QU5 A;  3C1Z A;  4IL6 U;  2UVW A;  1ZD3 A;  3ISB A;  2OXO A;  3A0H U;  8ICE A;  5J2H A;  2FDR A;  2V9W A;  3TAN A;  3NVZ A;  3SI8 A;  2YY6 A;  2LM1 A;  1IG6 A;  2LMR A;  3BS5 A;  1KLN A;  1KW4 A;  1ZQY A;  2ASJ A;  1BPD A;  3T5L A;  4UAS A;  4QIW F;  4C80 A;  2ATL A;  4QIW C;  4QWA A;  5ALI A;  1H38 A;  2NO5 A;  2XI9 A;  4EEN A;  2BPG A;  1Z3E B;  5ALH A;  4PHD A;  4B9S A;  1T4G A;  2ODG A;  2PI5 A;  7ICV A;  3SAF A;  1QQ6 A;  4J9R A;  3SEI A;  4PL2 A;  4YXM A;  2E8P A;  4ED1 A;  3H8W A;  3CYM A;  1JMS A;  2F1J A;  1K1S A;  3K4G A;  3DEE A;  3HWT A;  5CWR A;  2ZIV B;  5KL1 B;  3ISD A;  1L6N A;  4F5P A;  4KLJ A;  2HHW A;  8ICL A;  3LVW A;  1YT3 A;  2Z7J A;  5DG9 A;  3ZDB A;  5ALZ A;  3AU2 A;  2IHN A;  1T7P A;  4UB4 A;  9ICI A;  4ZH4 A;  3OSN A;  1NZB A;  4I27 A;  5C5J A;  2KHV A;  3IDW A;  1MC8 A;  4KLE A;  5HR7 A;  3N28 A;  3N7S C;  4F5R A;  1B43 A;  4O3Q A;  1PZN A;  2YTU A;  4OJL A;  2Y0S F;  1V97 A;  5AI6 A;  3D6J A;  4Y2U A;  4C4S A;  4GXK A;  3UMB A;  4O3M A;  2ZIU B;  1K5O A;  1RXV A;  4Q8F A;  4I2F A;  8ICB A;  3RH4 A;  1N48 A;  5B66 U;  3S6J A;  2HVH A;  4RQ4 A;  3EPG A;  3TAP A;  1TK5 A;  4TUS A;  3Q8Q B;  1LKY A;  3WU2 U;  5J0P A;  2LBO A;  1NI3 A;  4J9L A;  2HDO A;  4DL7 A;  2OH2 A;  4YR0 A;  4BXO B;  2EZY A;  4UAY A;  3PML A;  3G6X A;  1ZQD A;  2KJ5 A;  4FE3 A;  1NKE A;  1ZQV A;  5KFR A;  2J6S A;  2WFA A;  5ALP A;  4O3S A;  2YMM A;  8ICS A;  1COK A;  2G0A A;  3K1R B;  3IHQ B;  4FBT A;  5KL8 B;  4KX3 A;  3WK4 A;  3BQ1 A;  3PW5 A;  3QYP A;  4YP3 A;  3BQ2 A;  1Y88 A;  2GOL A;  4C8K A;  5AM3 A;  4ED3 A;  4QZE A;  5ALM A;  5KG5 A;  4Y2X A;  3JPO A;  8ICC A;  2GWS A;  3QU4 A;  5AKL A;  4J9P A;  4YQW A;  1S9F A;  4KX5 A;  4HYK A;  3IM1 A;  2RRD A;  2HHQ A;  1MQ3 A;  2PFO A;  2E1F A;  4BUG A;  3Q8S B;  4P0P B;  4RQ7 A;  4EEY A;  4O9M A;  5J2A A;  2HOF A;  5HR6 A;  9ICQ A;  4I2B A;  9ICM A;  3HT3 A;  8ICU A;  4R8U A;  4EYH B;  9ICS A;  1QSS A;  1YZ7 A;  2J6U A;  3B9J A;  5J2C A;  1L3S A;  4QZ9 A;  2XGQ A;  5IIN A;  3MC1 A;  2DUY A;  5L1M A;  3SZ2 A;  1XC9 A;  4P4M A;  1TK8 A;  3UPQ A;  2M0N A;  1N5X A;  4ICA A;  2ZIW A;  3UXO A;  1BPX A;  7ICL A;  1BPY A;  1CUK A;  2KTQ A;  3ZDD A;  2VA2 A;  4EX7 A;  2BCQ A;  2RDI A;  1NNL A;  1X2I A;  5L1K A;  3NVV A;  1TK0 A;  3WK9 A;  3C28 A;  2C2R A;  3M8S A;  1RYR A;  4B9T A;  5J2E A;  4G3I A;  2H3Q A;  1L3T A;  1Z00 B;  1ZQB A;  3RB0 A;  5DGA A;  4RUA A;  1SGG A;  3HKZ C;  4KLG A;  2P66 A;  4M2Y A;  4JMU A;  4F3O A;  2I5H A;  7ICO A;  4QZ8 A;  3QU2 A;  3N7P D;  3HRD D;  3PX0 A;  5AKH A;  4I2H A;  4YMM A;  2VJ4 A;  2K4P A;  8ICH A;  5KT5 A;  2JR5 A;  5HML A;  3BZC A;  3TQ1 A;  1SKS A;  2Y1I A;  5AI0 A;  2Y9U A;  3OHB A;  4DQQ A;  5DB6 A;  4DF4 A;  9ICL A;  2C28 A;  3AN1 A;  2QAR B;  2ES6 A;  2IOF A;  4Q45 A;  2W9B B;  3LWL A;  2DFL A;  5D49 A;  4IRK A;  4LJX A;  5EOZ A;  2VJ5 A;  4NLG A;  2AGP A;  1N63 A;  5KG0 A;  1ZQX A;  2CPR A;  1WYG A;  4QZD A;  1CEZ A;  5ALE A;  4DSF A;  5JUM A;  5KAI U;  4I28 A;  5AKZ A;  3TAC B;  2KIW A;  2C2E A;  3LDA A;  3EYZ A;  3PV8 A;  4YFK A;  5ALD A;  3V7K A;  4C0Z A;  5CB1 A;  4TQS A;  3OPX A;  4J9N A;  2VA3 A;  3M1Y A;  4NM2 A;  4DS4 A;  1OUQ A;  4UB2 A;  2BZF A;  3RF9 A;  4DOA A;  3N4M B;  4RT3 A;  1JAL A;  1K1Q A;  3PVX A;  4AYB C;  3JPR A;  2WB1 F;  4DL4 A;  2YQE A;  4B9M A;  2ALZ A;  4KLO A;  1UT5 A;  1ZQP A;  1L5U A;  2KKP A;  5ALJ A;  1HEK A;  3V6H A;  1U47 A;  2CRX A;  2WF6 A;  3HPO A;  4J9K A;  2G5I B;  3QU9 A;  4RQ0 A;  4UB6 U;  2KKV A;  4ECT A;  3SV3 A;  1X40 A;  1V38 A;  4DF8 A;  4M6W B;  5EE9 A;  8ICF A;  3UMC A;  1U4B A;  3H7I A;  4Y2S A;  3RB6 A;  4IRD A;  2YMP A;  1UT8 A;  2YB4 A;  4TUP A;  3SEN A;  8ICZ A;  2EAP A;  3FM9 A;  2DQN B;  4BX9 C;  5ALF A;  2I9G A;  4DFM A;  4K4G A;  3O0F A;  5J0Q A;  1IIP A;  5DB8 A;  1MA7 A;  4UBC A;  4YR2 A;  1ZXI A;  2KZM A;  5KFM A;  2G06 A;  5BOM A;  3NTU A;  1SB3 C;  2JGA A;  5J8Y C;  3EZ5 A;  4DLG A;  5DKW A;  1DK3 A;  3UQ2 A;  3D2Q A;  3GIM A;  3C29 A;  2BCR A;  1S76 D;  2ZXH A;  9ICT A;  1XU4 A;  1J2N A;  5J0U A;  1ZYQ A;  5AI9 A;  4OJP A;  4JV2 A;  2PFP A;  5E79 U;  2XGP A;  3OSP A;  4M9J A;  8ICG A;  4MHV A;  1SZH A;  1LB2 B;  1JRO A;  5ALY A;  1JIH A;  2DKX A;  4DEZ A;  4Z6C A;  5TZV A;  1QQ7 A;  2AQ4 A;  2AGO A;  2K8A A;  3KTQ A;  2EZX A;  2E1E A;  5KG3 A;  3M9M B;  2HW3 A;  3QUB A;  3T3F A;  4USA A;  4IS7 A;  1T3Q A;  2KK0 A;  4YD1 A;  4RNN A;  5JRT A;  3FAH A;  3C2K A;  1UCV A;  3B0X A;  2HHV A;  2MU2 A;  2ZJA A;  3FYH A;  2KIV A;  4KN4 A;  5DDY A;  2WAQ C;  3ISC A;  1O03 A;  5AM2 A;  5CA7 A;  2DWQ A;  2E8O A;  9ICB A;  4F91 B;  1MN8 A;  1Z1B A;  1Z00 A;  4P0Q B;  5DGB A;  5AIB A;  1BPE A;  3BZK A;  5IIL A;  3EUB 2;  3JPT A;  3PSF A;  2HBL A;  2BCS A;  5C0Y A;  4ACO A;  3WKA A;  4I2E A;  4J9S A;  2K89 A;  3K75 D;  2IOH A;  7ICR A;  5AIA A;  2E8N A;  3UMG A;  4Q43 A;  2R18 A;  5ALW A;  4ELV A;  1DXS A;  2WHE A;  2YX8 A;  2AGQ A;  1Z1V A;  1NK8 A;  2W04 A;  2A3V A;  4NLK A;  2HBM A;  2OWO A;  4R65 A;  1QCK A;  1RDF A;  4BWM A;  4BWJ A;  2D3D A;  4GFJ A;  4KLL A;  3KHR A;  2ZTC A;  5DG8 A;  4QWB A;  1IXR A;  1NJW A;  3L3F X;  3MGV A;  1QLN A;  2AJQ A;  2H3F A;  2ZIX B;  1SKR A;  3LVV A;  1S5L U;  3C1Y A;  3GDX A;  1ZQZ A;  4PGX A;  3F2C A;  1D8B A;  2NV3 A;  3RH6 A;  1U48 A;  4FS1 A;  2A1J B;  4PHP A;  2RLT A;  2KOB A;  1RYU A;  3ALR A;  4NLB A;  1SWV A;  2WF7 A;  4OO1 J;  4QWE A;  5KG4 A;  4DFD A;  1F5S A;  4EEK A;  2LHT A;  4P4O A;  4Y2V A;  3JPN A;  3BQT A;  1D8Y A;  4Y2T A;  2DL0 A;  1VDV A;  4J9O A;  4ELT A;  9ICA A;  3UM9 A;  4RPY A;  4NM1 A;  1ZOL A;  5DDM A;  3HIL A;  5GTI U;  3TAD C;  1JI7 A;  2IMW P;  4P2H A;  4MEX A;  3F5A A;  1DOQ A;  4PHE A;  2BPF A;  2E3T A;  2QLT A;  2V4Q A;  4OD0 A;  2H5X A;  2XC9 A;  4R8U B;  4MFC A;  2MA1 A;  1N56 A;  1QTM A;  5ALT A;  4JV0 A;  3BQ7 A;  2GH1 A;  3I1Y A;  4X5V A;  4FZN A;  1L3U A;  1RQN A;  1PUZ A;  5H2F U;  5KT6 A;  3NS1 A;  2DF4 B;  4DSE A;  2XVT A;  2FPL A;  2FMS A;  3BQ0 A;  3PSP A;  2F3N A;  5DBC A;  4EEL A;  2A19 A;  3KZI U;  3RB3 A;  3HW8 A;  4ELU A;  5D4B A;  1KDH A;  4RQM A;  2VKQ A;  3MGH A;  1ZQN A;  9ICH A;  2YN4 A;  3H0L B;  2ZIV A;  1AQ6 A;  4GIB A;  1OW5 A;  4DWI A;  1ARO P;  5F9L A;  3RAX A;  1Q3U A;  3IP4 B;  2AHO B;  2NRW A;  3QZ8 A;  1Z19 A;  4QZF A;  2P6U A;  1ZQQ A;  3AM9 A;  5CRX A;  1UPH A;  4DS5 A;  5D46 A;  2KJ9 A;  5AK6 A;  4YD2 A;  1D9D A;  3Q8M A;  1PK3 A;  3NGD A;  7ICP A;  2KJ8 A;  5ALN A;  1N2X A;  1WG8 A;  2KVS A;  4GXI A;  1CRX A;  3RJF A;  4NLN A;  2JZB B;  1V85 A;  1JUD A;  2W3R A;  3D2N A;  5AK3 A;  5EWF A;  4P0Q A;  4JV1 A;  3V6J A;  1L7N A;  2LYA A;  1T8E A;  3M6Z A;  5KFW A;  2OM6 A;  2F77 X;  4UW9 A;  1XO1 A;  5AKK A;  1S0V A;  1X6J A;  4DOB A;  1X9M A;  1TAQ A;  5DQH A;  5AM0 A;  1ZD5 A; 
#chains in the Genus database with same CATH homology
 1UHU A;  1MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...