3K1RB

Structure of harmonin npdz1 in complex with the sam-pbm of sans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
ETSPLETFLASLHMEDFAALLRQEKIDLEALMLCSDLDLRSISVPLGPREKILGAVRRRRQAMERPPALEDTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Harmonin
publication title The structure of the harmonin/sans complex reveals an unexpected interaction mode of the two Usher syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 23
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3k1rB00
1SXEA 3IDWA 4NJ8A 2K60A 3HILA 2E8PA 2LPEA 5J8YA 4MHVA 1KW4A 4IS7A 5J8YC 4NL9A 2K4PA 1V85A 4RQMA 4NL9C 3BS5A 1PK1A 1SV4A 5JTIA 3TADA 3SENA 2L5YA 3TADC 3H8MA 1Z1VA 2D3DA 2KSOB 2D8CA 3BS7A 2EAOA 2DKXA 2KE7A 1X40A 3K1RB 2EANA 2F44A 1JI7A 2Y9TA 2LMRA 2EAPA 1COKA 1UCVA 2E8OA 1SV0C 2QARA 1SGGA 3SEIA 4RQNA 1X9XA 2EAMA 3BS5B 1PK1B 2E8NA 2QB0B 2Y9UA 5JRTA 2B6GA 4PZOA 1RG6A 2F3NA 1WWUA 3BQ7A 2KG5A 1V38A 5KNIA 1B4FA 2KIVA 5F3XB 1SV0A 2E8MA 1LKYA 1B0XA 4PZNA 1SXDA 1X66A 2KMDA 3TACB 5JU5A 2F8KA 2QARB 1F0MA 2ES6A 1WWVA 2GLEA 2YTUA 2QB1A 1OXJA 2JV3A 1PK3A 1OW5A 1UQVA 1DXSA 2DKZA 2KSOA 2QB0A 2QKQA 3KKAA 5L1MA 2FE9A 2ESEA 3KKAC 1LKYB 2DL0A
chains in the Genus database with same CATH superfamily
2MUTB 1ZYQA 4YG2A 4YN4A 2LPEA 2W9CA 9ICLA 2R8HA 3IG8A 2RDIA 2P6UA 5J2BA 3TAQA 5DKWA 1KFDA 4ECWA 3ZDBA 1SV4A 5IIKA 3HJEA 4YXMA 3WK8A 1ZOLA 2RLTA 1DK2A 3QU2A 2B0CA 3M9OB 1WCNA 5TISU 5HMLA 2ZIUA 3BJYA 3VC8A 2ZIWA 4DF4A 4C4TA 3RB4A 2F44A 5DGBA 2BR0A 3D2SA 5DBAA 1QSLA 4IQVA 2BPCA 2JH1A 3WK4A 2W3SA 9ICTA 5L1LA 4UW9A 3OHAA 4O3PA 1ZQZA 3IN5A 5AIAA 3O0FA 1JXEA 2HHUA 4YD2A 5J0YA 1ZQFA 2D6FC 1WWUA 3NRWA 1QQ7A 2BCVA 4J9RA 7ICNA 4KLFA 4TUQA 2KN7A 4P0QB 5H2FU 1L3UA 1VJ5A 5JU5A 3WU2U 5KL1B 2OCEA 4NV0A 3N7RC 2KD1A 2VANA 7ICPA 5AKZA 5AI5A 5J2HA 4ED0A 5AI6A 4DQRA 1NKBA 1NK8A 4C7ZA 3PO5A 2W9MA 3H40A 3JPQA 5ALRA 2GO7A 4UARA 3G6YA 3PSPA 2C2RA 1LKYB 2KVSA 2FLNA 1K1QA 7ICMA 3L5KA 2BDPA 4Q8FA 1ZQEA 3RH6A 3RR7A 2AGOA 2MU2A 5DGAA 4QZBA 2HBMA 4IS7A 2BGWA 2JR5A 3RFAA 4KLTA 3ICXA 2K8BB 4K4GA 5ALVA 3TADC 1QQ6A 3QXGA 1N63A 3KTQA 5EWGA 3LDAA 1CUKA 4JUZA 4I2GA 1S0MA 2HOIA 1Q46A 3NGDA 3RRHA 5CR0A 3TAPA 2Y9TA 2G5HB 3V7KA 1UCVA 2E8OA 5A0LA 3ZDAA 2YX8A 1RM6C 4BXOB 5T14A 2KKVA 2E8NA 5DLGA 1B22A 5JRTA 3C23A 1UHUA 1S9FA 2M9NA 2DUYA 4ED1A 3TANA 3D2NA 1ZRMA 1BPZA 4GXKA 3PY8A 4HAIA 2YY6A 2KIVA 3OJUA 2GWSA 4C4SA 1QSSA 3BDPA 1T94A 1N56A 2I5HA 2F8KA 3OHBA 4M04A 3RTVA 4KLQA 5J0XA 1U48A 3RB3A 4OO1J 1X9MA 2PKEA 1BPDA 3HX0A 3RJFA 2EZZA 3C1ZA 1QH9A 5ALWA 3WKEA 2OH2A 4I27A 2QB0A 2QKQA 1O03A 4DOAA 1BPEA 5KFMA 1JN3A 1RYSA 7ICUA 2AH5A 4TQSA 3B0YA 3OPXA 4X5VA 5ALDA 3IRUA 4G9BA 3NUQA 1MQ2A 2PI4A 3QZ7A 4JWMA 4ECVA 3JPSA 2A19A 5ALFA 8ICNA 1Z1BA 2LHTA 4TURA 2IOHA 2AJQA 1HUOA 3GIJA 2ZUBA 1T3NA 4XUSA 5L1IA 3RJHA 4EYIB 1TE2A 4Z6DA 4F4ZA 2O6KA 2ZJ5A 4CCHA 4J9MA 2RDJA 4I2IA 4I2BA 2JZBB 3K1RB 3QUTA 1XSLA 3K1ZA 1LB2B 1BPXA 2UVWA 3AU2A 5G5HA 3GIMA 7ICRA 1S97A 2E3TA 4CE6A 4YR2A 1SGGA 1PVPA 4MEXA 4F71A 1S76D 2KOBA 3U26A 4R64A 1KL9A 2DPJA 1ZD3A 3EWAA 3SYZA 1PZNA 3QUBA 2HVHA 3SR6A 4US8A 2ZJAA 4M9JA 7ICGA 1V38A 4I28A 4M2YA 9ICHA 1LKYA 3JPPA 3C2KA 2P35A 4YCXA 2WF5A 1WG8A 3Q8LA 2W9AA 2FI1A 3PSTA 2KKPA 5E79U 2WB1F 3QU4A 3OSNA 2ZUDA 1ZQUA 2LYBA 1MQ3A 1ZRNA 2YN4A 4ECQA 1Y88A 5AK6A 1ZQTA 3NASA 5J29A 1HUZA 4DOCA 1ZXIA 7ICJA 1N5XA 4KMUA 3RAXA 2FMPA 2V4QA 4QZGA 1SB3C 4GFJA 1EXNA 3RJEA 1DGSA 4UB5A 3PW5A 2KFNA 9ICSA 5TZVA 3ZDDA 3SQIA 3FC4A 4QWCA 3ETLA 4ZH4A 4C0ZA 3ED5A 4BXOA 3RBDA 2HHVA 4PGQA 1ZQJA 9ICUA 1Z3EB 3H8MA 5KFXA 3GV5B 1SZPA 1NZPA 1UT5A 2KVCA 3E0FA 2EAOA 4QZAA 3KHLA 4DEZA 5J0UA 4ECYA 1JUDA 2FPKA 3HRDD 4KMOB 4R66A 3AEVA 3HW8A 2A1JB 3EZ5A 4P4PA 4CDGA 5DQGA 2WTFA 1NK6A 5ALNA 3C2MA 1JALA 4B9TA 1S10A 2MA1A 5AI9A 2F77X 1JIHA 1A76A 3C21A 2W8KA 4KLEA 1L8LA 8ICFA 2K89A 3BQ7A 4FE3A 2BDUA 5HNKA 5BOLA 2Y1JA 9ICKA 1SKWA 1UA1A 3CW2C 1HJPA 3PW4A 3TACB 1BPYA 1ZD4A 3H7IA 1N61A 2ES6A 2FDRA 1RXVA 1WWVA 2P6RA 1XSPA 3GQCA 2V4RA 4GLXA 2JXJA 5HHIA 4QZ9A 2W43A 4BUGA 3QNMA 1KBUA 4JV2A 7ICKA 1B43A 5AM4A 1BPBA 3NVWA 1ZQWA 2JZBA 3WKAA 1XNSA 1CRXA 2ASJA 5AIBA 5DQIA 1HIWA 5KL8B 4O0IA 3V72A 3PMLA 5J8YA 4QZEA 1IIPA 1L8OA 3SI8A 1SKRA 1L5UA 5ALLA 4FZLA 5JUMA 1TV9A 2R8IA 1U4BA 4ED3A 4PGYA 1YZ7A 2H3QA 4DLEA 1ZQXA 3IHQB 8ICPA 4J9NA 1Z1VA 2KJ8A 4YQWA 4LZGA 2D8CA 1ZJMA 1AROP 3BS7A 1UT8A 3KOOA 3LWLA 2DKXA 3DEEA 5DDYA 2KZ3A 1U45A 1KQQA 1ZQMA 3PX4A 2ZTDA 4IR1A 3N7SC 5J2AA 1D8BA 5EOZA 4EBDA 3UXNA 1PK1B 1NK0A 3CYMA 5KT5A 1ZQGA 3LK9A 9ICMA 2NRTA 2Y9UA 3PNCA 2B6GA 4F91B 4EBCA 2FLPA 4IQWA 2HMXA 1ZQRA 2E8MA 5HR7A 2PFQA 1MSWD 1XS9D 4G3IA 3TFRA 5DB9A 7ICOA 3RF9A 9ICXA 2XCPA 3UQ0A 4DQIA 4DO9A 3SAGA 2AQ4A 4F5OA 2BHNA 1OXJA 4UASA 3PO4A 4F5PA 1Z19A 5AHXA 1UQVA 5AKIA 1QQ5A 4Z6CA 3PX6A 3H4BA 2KK0A 4BGDA 3MDAA 3D2QA 3QU9A 4RPXA 1ZJNA 2HDOA 9ICAA 2A1JA 2BKEA 2LM4A 4RQ5A 4F8RA 4KLUA 1C7YA 1ZD5A 3GILA 1NJXA 4QIWF 4UB8U 5KFSA 1VLBA 4J03A 3PR4A 4NL9A 2KJ5A 2BCUA 4Z6EA 2AQ0A 5DBCA 3EW9A 2PI5A 3WKCA 5KFQA 4RQ0A 1N48A 4F4XA 4R65A 2ALZA 4GXJA 2K4IA 3JPNA 4RQ1A 3HWTA 8ICZA 1X40A 4RZRA 7ICSA 4P2HA 4OCZA 4J9OA 2KFZA 3MGVA 5AKXA 2KTQA 5J0QA 5HR6A 4QZ8A 2NYVA 5KT3A 2W9BB 4QZDA 5C0YA 2QB0B 4O3NA 9ICRA 5ALTA 5ALKA 3T79A 3QEAZ 1DGJA 4UAZA 3EYZA 1D8LA 1SWWA 3SD7A 3TI0A 5D4BA 5EE3A 8ICXA 2IOFK 1ZQLA 4O9MA 3MDCA 2OXOA 4DOBA 4HYKA 3UMBA 4EYHB 2GLEA 3ONNA 5KT7A 1D9DA 3QZ8A 2OM6A 4Y2YA 5ALSA 4J9QA 3JPRA 3RR8A 9ICCA 5DG7A 1TVAA 1DXSA 1CI4A 1T4GA 1L7MA 3F53A 3MABA 4QZCA 5F9LA 4XQ8A 5J2CA 3RB6A 1IV8A 2H3IA 2NRVA 3HP6A 5FP0A 4ECRA 3IM1A 1KFSA 3N7PD 2C2EA 3EPIA 2DL0A 1SXEA 2PFOA 4NLZA 2NRWA 4F72A 5J2JA 4C8NA 5KG5A 3FM9A 4JK1A 1PK1A 4DSKA 1RXWA 3PSFA 2FJ6A 5L1KA 1ZQDA 4JV1A 2JGAA 4NLBA 5KFIA 1V97A 9ICIA 1S0NA 2WAQC 2G09A 4IRDA 1TKDA 4F92B 4QWBA 4O3RA 2PFNA 3C29A 2NO5A 1Q3VA 4UAUA 1ZQNA 3IG5A 3Q8QB 9ICJA 1U9LA 1HEKA 3ISCA 1TK0A 3ZD9A 2DQNB 4RQNA 2WHEA 4M6WA 1TAQA 2BPFA 3M9MB 3H0MB 4EZ6A 5KFRA 4DQQA 5CEHA 4M9GA 2ASDA 9ICQA 2BPGA 4O5EA 4A8EA 5KTQA 4KLDA 2HHXA 4F4YA 2ASLA 2YMMA 3QUQA 3UM9A 4ED2A 4JWNA 4I2HA 3H4DA 4ED6A 4Y2SA 8ICVA 4PZNA 3L3FX 1L7PA 4BX9C 1NI3A 3ETRA 5KFKA 4C8LA 4QW9A 4OD0A 1JMSA 3RAQA 1OUQA 4BWMA 4J9SA 4UB6U 3GIIA 5ALEA 5KFWA 5CB1A 8ICMA 4Q45A 4RQ6A 9ICWA 5HMMA 1S8OA 4JV0A 1QTMA 3PW2A 2K8AA 1M6YA 2Z7JA 2F2AB 5DQHA 3V6JA 2QLTA 3ORYA 1ZQPA 5ALUA 3M6KA 5BOMA 2BQRA 2AHOB 5EE1A 3OSPA 1RYUA 2F1HA 5AKLA 1KKXA 5DB6A 4O3SA 4BWJA 5ALYA 2KHQA 2W9BA 5KFLA 4KLLA 1ZQIA 3NVZA 4NM1A 5KG0A 4OJPA 5AM3A 4EEKA 2H3VA 2W7PA 2AXTU 2XIDA 3PVXA 4RU9A 4FFDA 1JI7A 2DGZA 4PH5A 1XO0A 3TFSA 2KZZA 2YQEA 5L9XA 7ICFA 4CNQA 4OJ5A 2R18A 5L1JA 1T7PA 4FS1A 3L4PA 2EDUA 2NV3A 4C4RA 3QU7A 4UBBA 4QNLA 5J2EA 1QCKA 2RQ5A 4I2CA 3BZKA 5J2GA 2IHMA 2W55A 4I2AA 5AK5A 3HPOA 4UB2A 1RZTA 2W11A 3MR5A 1N60A 2I6XA 5K4LA 1TK5A 4YVZA 2KV2A 4U7CA 3I76A 4K4HA 2R8KA 1UPHA 5EWEA 1ZQCA 2FMSA 1ZQVA 2HOQA 8ICJA 4ECZA 4RNMA 2XGQA 2BQUA 4I2EA 3QUCA 4PHPA 3KKAA 4QJFB 4F4KA 1BGXT 3EUB2 2H3ZA 4QW8A 4P4MA 4F5QA 4OJLA 2K4HA 2I9GA 2BCSA 4MEYA 2MSNA 2RRDA 3K75D 2BQ3A 4ECSA 4IL6U 1FFUA 5J0RA 4DSIA 3FYHA 4CRXA 1ZETA 2XICA 3GU3A 5J0PA 4AYBC 1X9SA 2RHFA 1TK8A 1BNOA 2PMZF 3H0RB 1XC9A 2JRZA 1KFTA 4DCCA 4O5KA 3MFIA 3UXOA 4KX5A 3T5LA 4Q8EA 2W7OA 1Q3UA 4FZMA 1SL0A 2H3FA 2G0AA 3HKZC 5AK4A 5KAFU 2WF6A 4OJOA 4DSLA 4NLKA 5KFBA 2LMRA 3KZXA 2HVIA 1XO1A 4AP9A 2IA6A 2KZMA 4I29A 5B66U 5ALMA 3AUOA 1KEJA 5J2IA 1NJWA 2NRXA 4NLGA 3IP4B 4IQTA 1NZBA 2KEYA 9ICEA 2VA3A 3RJKA 4JMUA 3RH4A 1NK5A 3RJGA 3M9NB 2HOFA 4RQ7A 2ZXHA 4ZOHC 1X66A 4DL2A 2HSZA 5AKYA 4QZFA 2ZTCA 3B9JA 1NOMA 4FZNA 2R8JA 4QZHA 1ZQ1C 2YMPA 3F2CA 3BQ1A 1PK3A 2CN1A 2I1QA 1TAUA 4I2JA 1ZQBA 2ATLA 4KLSA 5AK3A 3I1YA 2G07A 1RYRA 2CRXA 2CPRA 8ICLA 8ICBA 2XCAA 2HHWA 1X2IA 5G5GA 2WFAA 5IIMA 1WUDA 5ALZA 1VDVA 4C8MA 1ZQAA 1NJYA 4ACOA 2K4PA 2EZXA 2C22A 3QE9Y 1T8EA 2XY7A 4USAA 3TADA 5IIOA 2L5YA 1MC8A 2D3DA 4F5RA 4RNOA 3N28A 2JEIA 4Q43A 4F3OA 3QEBZ 3SV4A 3RRGA 3PZPA 5AKKA 4QWEA 5KFFA 1X9WA 5AI4A 4O3QA 3AQFA 5ALOA 4RQ3A 8ICOA 5KFEA 3MGHA 4KTQA 4KLMA 1XU4A 4QWDA 3Q8MA 4F50A 3TARA 2HHQA 9ICFA 5DLFA 2F1JA 5KG3A 1A6SA 1SZHA 2ZG6A 1RG6A 2WF7A 1FO4A 3D6JA 3PX0A 3NRZA 3SZ2A 3BQ0A 2KHVA 4TUPA 5ALIA 2BZFA 4EBEA 4CF5A 4Y2UA 8ICRA 3ZD8A 4KITB 1O08A 4PL2A 8ICYA 4Y2XA 2F1IA 4M9HA 1K1SA 3UXPA 2QB1A 4KN7A 3WKDA 5CJ7A 1LV5A 2JEJA 5J0WA 3KHRA 4PPXA 1S77D 7ICIA 2GH1A 3ZI4A 1L7NA 2W54A 2LI6A 4NLNA 4B9MA 3HT3A 4Z6FA 1ZQYA 1CEZA 2JH7A 1KTQA 1U49A 4M6WB 2AGPA 4KLHA 2E1FA 3AU6A 3S6JA 3OJSA 3UPQA 4B9SA 5IIIA 5F9NA 2EQYA 5B5EU 2LYHA 1MN8A 3Q8RB 1RQNA 4XRHA 3MBYA 4YR0A 2Y0SC 5C5JA 3FDSA 2HHSA 1QLNA 3SENA 4UAWA 4B9VA 1RQLA 1N5WA 5GTHU 3RH5A 5CP2A 2XY6A 1FEZA 4YMOA 4DSEA 1AQ6A 4MFAA 2HW3A 3GV7B 4DFDA 2W8LA 5J0SA 4I2DA 5AI0A 4UB4A 3KFUF 3OGUA 5HHHA 4LZDA 3ALRA 1PVQA 4DS5A 1J2MA 3T3FA 4DL5A 4RPZA 4RPYA 2EAMA 3BS5B 4IQUA 2IBKA 5ALPA 4DL3A 2M0NA 2IHNA 1JROA 4DL4A 8ICGA 2KG5A 2W3RA 3UQ2A 4CGZA 9ICGA 2WAQF 4GIBA 1SV0A 1DOQA 2YMLA 5ALXA 4M47A 2KP7A 3C28A 5KFDA 4ECUA 2YB4A 3RB0A 4LVSA 1GO3F 1SL2A 2HBKA 3RJIA 2A1AA 2KICA 4ED8A 9ICPA 2Y1IA 2WF8A 3QU5A 2IMWP 4DL7A 3V6KA 4EELA 3WK5A 2XGPA 3E2EA 5CRXA 5EE9A 1K5OA 1KLNA 4CF4A 2XC9A 3PMNA 4B9UA 4DSJA 2CXYA 2BCRA 1ED1A 1Z00B 5DBBA 1URJA 4NJ8A 2E8PA 4DLGA 1N2XA 5AM0A 5KFNA 4FO6A 4DS4A 1DRGA 1V9PA 2UVVA 5AM1A 4PHDA 1TAMA 1JRPA 4F93B 2HHTA 2DPIA 5KG6A 3QX7A 5AKJA 2K4EA 3Q8PB 2DWQA 4BDPA 4PHAA 3H8SA 1XSNA 2EH9A 1X6IA 1PUZA 3AL0B 4NWIA 1NK7A 2UVUA 2Q0ZX 7ICTA 2LYAA 3E58A 3TQ1A 5KFYA 4QIWC 4OJ6A 4RQ8A 5ALJA 3F5AA 2HBJA 5CHGA 5J0TA 2Q4TA 2KJ9A 3CNHA 3RJJA 4E0DA 4NY8A 4DFMA 1NNLA 4JB3A 1T3QA 3WKBA 9ICBA 5BPCA 1X6JA 5ALGA 2E5SA 5J2DA 4YMMA 2KMDA 4ED7A 1A77A 3MR6A 2QARB 4C80A 2PFPA 5AICA 3A0HU 4EENA 4QZIA 4Y2TA 2EZYA 1XWLA 5J0OA 2ZIXB 1L6NA 2AU0A 4K4IA 2BCQA 4PGXA 3C1YA 4R8UA 3GDXA 5IIJA 9ICOA 4DFKA 1P7DA 3WK9A 8ICIA 1IG6A 5DB8A 2LM1A 2J6UA 3CRXA 9ICVA 4YXJA 3NS1A 8ICKA 1ZD2P 3SAHA 2W04A 8ICSA 3B0XA 2JHDA 5KFGA 4F4WA 1D8YA 5J8YC 3MR3A 4YR3A 3F2BA 3I28A 3AN1A 4PHEA 4RQMA 3BS5A 3T5JA 3H8WA 4IRCA 5EWFA 4GC7A 1C20A 1N62A 2A3VA 3H8JA 4ECTA 2AGQA 1SWVA 5J2FA 3SMVA 2KSOB 4M0AA 4Y2JA 3LVWA 3CP8A 5KFZA 1RDFA 8ICHA 2ZXIA 4KLGA 3BQ2A 4TUSA 2YMQA 4NLCA 2FPLA 2XO7A 1S0OA 2MUTA 1ECWA 4AYBF 2FLLA 4NXZA 7ICEA 5CWRA 4EX6A 5KFHA 3SAFA 3KBBA 4F5NA 4EEYA 2JEGA 5DG8A 3MR2A 4WJ3B 3M6ZA 2C28A 4MF8A 1RPLA 4B9LA 1X42A 3HKZF 1Z00A 4PL1A 2G08A 2B21A 1ZQHA 1BNPA 1ZQSA 1L3SA 3K4GA 5ALQA 3F5EA 4UATA 2HBLA 5KFTA 1KSPA 4KLOA 3C2LA 4RNNA 5ALHA 3MFHA 1JXLA 2LKYA 1TFRA 3JPTA 5D46A 2XVTA 2UVRA 1BVSA 4ELTA 4M9LA 5HP4A 3V7LA 5J2KA 5DG9A 8ICTA 2FE9A 4F2RA 3FAHA 4F2SA 3IDWA 2K60A 4DSFA 5CA7A 1H38A 4P0QA 4C8KA 3WK6A 1V85A 3AQEA 4DL6A 1ZQKA 4NL9C 5DDMA 4DFJA 2FPMA 3QYPA 3KD3A 3F2DA 3V7JA 3KHGA 3GZFA 5JTIA 3GFKB 3EPGA 8ICAA 5KFCA 1LVHA 1WCLA 2FMQA 4DQSA 5KFUA 1ZQOA 7ICLA 4LJXA 1KN5A 5DB7A 3VCBA 4R63A 2ZUCA 3T5KA 2EAPA 1COKA 3PSIA 1SV0C 2QARA 2W03A 3SEIA 4B6JA 2P66A 4IR9A 2VKQA 2ZIXA 4Q44A 1Z4NA 8ICUA 4C8OA 1YT3A 4KN4A 4P4OA 2MAXA 4C7YA 5D49A 3ISDA 1S5LU 1Z4OA 2GOLA 3LWMA 2F3NA 3SV3A 8ICWA 3PR5B 4O5CA 2C2DA 1B4FA 4DFPA 4YFKA 3ZDEA 4RUCA 4KX3A 5AKHA 2DFLA 3C5FA 3PW0A 3A0BU 3R9KA 5KFOA 2ZIVB 3J81j 1J97A 4I2FA 4P0PB 4RUAA 1OW5A 3NVYA 5IILA 2KSOA 1KRPA 4Y2VA 2XY5A 2R8GA 4QWAA 1QSYA 4J9KA 3N97B 2G5IB 2ESEA 4UB1A 3M1YA 4Y2PA 5KT4A 3Q8SB 4O3OA 3N4MB 4YMNA 5KFJA 3HILA 5AKGA 4YD1A 4KLJA 2HCFA 5KG2A 2KNJA 2J6SA 1FFVA 2DF4B 7ICHA 5KT6A 4RQ4A 1L3TA 1Q8KA 3AM9A 4UBCA 2ZJ8A 4J9PA 3C5GA 2F8LA 3V6HA 1IXRA 4DWIA 5AI8A 5KFPA 1NK9A 2ZTEA 2EANA 3H0LB 3BZCA 2W9CB 4UAVA 1D9FA 4RT3A 4B9NA 2WB1C 4YP3A 3RBEA 1X9XA 2Y0SF 1L7OA 5KAIU 2VA8A 2NRZA 4Y2RA 2IOFA 3MGIA 1A0PA 4UB3A 1COOA 4PZOA 2VA2A 3KZIU 5AM2A 2PMZC 1SKSA 3UMCA 2ZIUB 2OYYA 1F5SA 4IC9A 2ZIWB 5KFAA 1SL1A 1B0XA 4TQRA 1IM4A 4KLIA 3LYSA 1F0MA 3IV6A 3PW7A 8ICEA 7ICVA 2YTUA 3NVVA 2ODGA 5KG1A 3NTUA 2OHFA 3G6VA 3M8SA 1MA7A 3G6XA 1UA0A 4UAYA 2E1EA 1NJZA 1FIQA 2VJ4A 4UQGA 3THVA 4PJ0U 2H5XA 3M8RA 3GIKA 2NO4A 4IRKA 5AKEA 4U6PA 1NKCA 2N1RA 2LBOA 4MFCA 4MHVA 1KW4A 8ICCA 3KHHA 1KDHA 3T5HA 4FBUA 3DDHA 4GC6A 7ICQA 3DV9A 1L3VA 4M9NA 2JEFA 2RP5A 3Q8KA 2ISOA 3BQTA 1JX4A 2K8CB 2YB1A 1J2NA 1DK3A 2JMGA 2KE7A 2VJ5A 4J9LA 4RQ2A 1SIJA 9ICNA 2WF9A 2HI0A 2V9WA 4FBTA 1F44A 3PV8A 3WK7A 3JPOA 1ZQQA 2DBYA 3M7DA 3ISBA 4R8UB 2ZIVA 2MRLA 4MF2A 2XI9A 4P0PA 4EX7A 4US9A 4EZ9A 5KG4A 3TKAA 1YZ6A 2OEHA 2F76X 1PVRA 5EE0A 3GV8B 3UMGA 5KNIA 4XA5A 4O3MA 5F3XB 4GXIA 5KFVA 4ELVA 3ZDCA 1SXDA 5AM5A 2OWOA 4CF3A 1NK4A 1WYGA 4NM2A 3MC1A 4DQPA 2KIWA 2JV3A 2VIXA 8ICQA 3LVVA 1NKEA 3OTQA 5KT2A 2PXIA 4ELUA 4ICAA 4ECXA 1S0VA 3AMZA 4Y2QA 2DKZA 5IINA 4MFFA 4FS2A 5GTIU 2G06A 5L1MA 1U47A 3KKAC 2J6TA 4RT2A 5KG7A 2ISPA 4BJQA 4DF8A
chains in the Genus database with same CATH topology
1SXEA 3IDWA 4NJ8A 2K60A 3HILA 2E8PA 2LPEA 5J8YA 4MHVA 1KW4A 4IS7A 5J8YC 4NL9A 2K4PA 1V85A 4RQMA 4NL9C 3BS5A 1PK1A 1SV4A 5JTIA 3TADA 3SENA 2L5YA 3TADC 3H8MA 1Z1VA 2D3DA 2KSOB 2D8CA 3BS7A 2EAOA 2DKXA 2KE7A 1X40A 3K1RB 2EANA 2F44A 1JI7A 2Y9TA 2LMRA 2EAPA 1COKA 1UCVA 2E8OA 1SV0C 2QARA 1SGGA 3SEIA 4RQNA 1X9XA 2EAMA 3BS5B 1PK1B 2E8NA 2QB0B 2Y9UA 5JRTA 2B6GA 4PZOA 1RG6A 2F3NA 1WWUA 3BQ7A 2KG5A 1V38A 5KNIA 1B4FA 2KIVA 5F3XB 1SV0A 2E8MA 1LKYA 1B0XA 4PZNA 1SXDA 1X66A 2KMDA 3TACB 5JU5A 2F8KA 2QARB 1F0MA 2ES6A 1WWVA 2GLEA 2YTUA 2QB1A 1OXJA 2JV3A 1PK3A 1OW5A 1UQVA 1DXSA 2DKZA 2KSOA 2QB0A 2QKQA 3KKAA 5L1MA 2FE9A 2ESEA 3KKAC 1LKYB 2DL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXE A;  3IDW A;  4NJ8 A;  2K60 A;  3HIL A;  2E8P A;  2LPE A;  5J8Y A;  4MHV A;  1KW4 A;  4IS7 A;  5J8Y C;  4NL9 A;  2K4P A;  1V85 A;  4RQM A;  4NL9 C;  3BS5 A;  1PK1 A;  1SV4 A;  5JTI A;  3TAD A;  3SEN A;  2L5Y A;  3TAD C;  3H8M A;  1Z1V A;  2D3D A;  2KSO B;  2D8C A;  3BS7 A;  2EAO A;  2DKX A;  2KE7 A;  1X40 A;  3K1R B;  2EAN A;  2F44 A;  1JI7 A;  2Y9T A;  2LMR A;  2EAP A;  1COK A;  1UCV A;  2E8O A;  1SV0 C;  2QAR A;  1SGG A;  3SEI A;  4RQN A;  1X9X A;  2EAM A;  3BS5 B;  1PK1 B;  2E8N A;  2QB0 B;  2Y9U A;  5JRT A;  2B6G A;  4PZO A;  1RG6 A;  2F3N A;  1WWU A;  3BQ7 A;  2KG5 A;  1V38 A;  5KNI A;  1B4F A;  2KIV A;  5F3X B;  1SV0 A;  2E8M A;  1LKY A;  1B0X A;  4PZN A;  1SXD A;  1X66 A;  2KMD A;  3TAC B;  5JU5 A;  2F8K A;  2QAR B;  1F0M A;  2ES6 A;  1WWV A;  2GLE A;  2YTU A;  2QB1 A;  1OXJ A;  2JV3 A;  1PK3 A;  1OW5 A;  1UQV A;  1DXS A;  2DKZ A;  2KSO A;  2QB0 A;  2QKQ A;  3KKA A;  5L1M A;  2FE9 A;  2ESE A;  3KKA C;  1LKY B;  2DL0 A; 
#chains in the Genus database with same CATH topology
 2MUT B;  1ZYQ A;  4YG2 A;  4YN4 A;  2LPE A;  2W9C A;  9ICL A;  2R8H A;  3IG8 A;  2RDI A;  2P6U A;  5J2B A;  3TAQ A;  5DKW A;  1KFD A;  4ECW A;  3ZDB A;  1SV4 A;  5IIK A;  3HJE A;  4YXM A;  3WK8 A;  1ZOL A;  2RLT A;  1DK2 A;  3QU2 A;  2B0C A;  3M9O B;  1WCN A;  5TIS U;  5HML A;  2ZIU A;  3BJY A;  3VC8 A;  2ZIW A;  4DF4 A;  4C4T A;  3RB4 A;  2F44 A;  5DGB A;  2BR0 A;  3D2S A;  5DBA A;  1QSL A;  4IQV A;  2BPC A;  2JH1 A;  3WK4 A;  2W3S A;  9ICT A;  5L1L A;  4UW9 A;  3OHA A;  4O3P A;  1ZQZ A;  3IN5 A;  5AIA A;  3O0F A;  1JXE A;  2HHU A;  4YD2 A;  5J0Y A;  1ZQF A;  2D6F C;  1WWU A;  3NRW A;  1QQ7 A;  2BCV A;  4J9R A;  7ICN A;  4KLF A;  4TUQ A;  2KN7 A;  4P0Q B;  5H2F U;  1L3U A;  1VJ5 A;  5JU5 A;  3WU2 U;  5KL1 B;  2OCE A;  4NV0 A;  3N7R C;  2KD1 A;  2VAN A;  7ICP A;  5AKZ A;  5AI5 A;  5J2H A;  4ED0 A;  5AI6 A;  4DQR A;  1NKB A;  1NK8 A;  4C7Z A;  3PO5 A;  2W9M A;  3H40 A;  3JPQ A;  5ALR A;  2GO7 A;  4UAR A;  3G6Y A;  3PSP A;  2C2R A;  1LKY B;  2KVS A;  2FLN A;  1K1Q A;  7ICM A;  3L5K A;  2BDP A;  4Q8F A;  1ZQE A;  3RH6 A;  3RR7 A;  2AGO A;  2MU2 A;  5DGA A;  4QZB A;  2HBM A;  4IS7 A;  2BGW A;  2JR5 A;  3RFA A;  4KLT A;  3ICX A;  2K8B B;  4K4G A;  5ALV A;  3TAD C;  1QQ6 A;  3QXG A;  1N63 A;  3KTQ A;  5EWG A;  3LDA A;  1CUK A;  4JUZ A;  4I2G A;  1S0M A;  2HOI A;  1Q46 A;  3NGD A;  3RRH A;  5CR0 A;  3TAP A;  2Y9T A;  2G5H B;  3V7K A;  1UCV A;  2E8O A;  5A0L A;  3ZDA A;  2YX8 A;  1RM6 C;  4BXO B;  5T14 A;  2KKV A;  2E8N A;  5DLG A;  1B22 A;  5JRT A;  3C23 A;  1UHU A;  1S9F A;  2M9N A;  2DUY A;  4ED1 A;  3TAN A;  3D2N A;  1ZRM A;  1BPZ A;  4GXK A;  3PY8 A;  4HAI A;  2YY6 A;  2KIV A;  3OJU A;  2GWS A;  4C4S A;  1QSS A;  3BDP A;  1T94 A;  1N56 A;  2I5H A;  2F8K A;  3OHB A;  4M04 A;  3RTV A;  4KLQ A;  5J0X A;  1U48 A;  3RB3 A;  4OO1 J;  1X9M A;  2PKE A;  1BPD A;  3HX0 A;  3RJF A;  2EZZ A;  3C1Z A;  1QH9 A;  5ALW A;  3WKE A;  2OH2 A;  4I27 A;  2QB0 A;  2QKQ A;  1O03 A;  4DOA A;  1BPE A;  5KFM A;  1JN3 A;  1RYS A;  7ICU A;  2AH5 A;  4TQS A;  3B0Y A;  3OPX A;  4X5V A;  5ALD A;  3IRU A;  4G9B A;  3NUQ A;  1MQ2 A;  2PI4 A;  3QZ7 A;  4JWM A;  4ECV A;  3JPS A;  2A19 A;  5ALF A;  8ICN A;  1Z1B A;  2LHT A;  4TUR A;  2IOH A;  2AJQ A;  1HUO A;  3GIJ A;  2ZUB A;  1T3N A;  4XUS A;  5L1I A;  3RJH A;  4EYI B;  1TE2 A;  4Z6D A;  4F4Z A;  2O6K A;  2ZJ5 A;  4CCH A;  4J9M A;  2RDJ A;  4I2I A;  4I2B A;  2JZB B;  3K1R B;  3QUT A;  1XSL A;  3K1Z A;  1LB2 B;  1BPX A;  2UVW A;  3AU2 A;  5G5H A;  3GIM A;  7ICR A;  1S97 A;  2E3T A;  4CE6 A;  4YR2 A;  1SGG A;  1PVP A;  4MEX A;  4F71 A;  1S76 D;  2KOB A;  3U26 A;  4R64 A;  1KL9 A;  2DPJ A;  1ZD3 A;  3EWA A;  3SYZ A;  1PZN A;  3QUB A;  2HVH A;  3SR6 A;  4US8 A;  2ZJA A;  4M9J A;  7ICG A;  1V38 A;  4I28 A;  4M2Y A;  9ICH A;  1LKY A;  3JPP A;  3C2K A;  2P35 A;  4YCX A;  2WF5 A;  1WG8 A;  3Q8L A;  2W9A A;  2FI1 A;  3PST A;  2KKP A;  5E79 U;  2WB1 F;  3QU4 A;  3OSN A;  2ZUD A;  1ZQU A;  2LYB A;  1MQ3 A;  1ZRN A;  2YN4 A;  4ECQ A;  1Y88 A;  5AK6 A;  1ZQT A;  3NAS A;  5J29 A;  1HUZ A;  4DOC A;  1ZXI A;  7ICJ A;  1N5X A;  4KMU A;  3RAX A;  2FMP A;  2V4Q A;  4QZG A;  1SB3 C;  4GFJ A;  1EXN A;  3RJE A;  1DGS A;  4UB5 A;  3PW5 A;  2KFN A;  9ICS A;  5TZV A;  3ZDD A;  3SQI A;  3FC4 A;  4QWC A;  3ETL A;  4ZH4 A;  4C0Z A;  3ED5 A;  4BXO A;  3RBD A;  2HHV A;  4PGQ A;  1ZQJ A;  9ICU A;  1Z3E B;  3H8M A;  5KFX A;  3GV5 B;  1SZP A;  1NZP A;  1UT5 A;  2KVC A;  3E0F A;  2EAO A;  4QZA A;  3KHL A;  4DEZ A;  5J0U A;  4ECY A;  1JUD A;  2FPK A;  3HRD D;  4KMO B;  4R66 A;  3AEV A;  3HW8 A;  2A1J B;  3EZ5 A;  4P4P A;  4CDG A;  5DQG A;  2WTF A;  1NK6 A;  5ALN A;  3C2M A;  1JAL A;  4B9T A;  1S10 A;  2MA1 A;  5AI9 A;  2F77 X;  1JIH A;  1A76 A;  3C21 A;  2W8K A;  4KLE A;  1L8L A;  8ICF A;  2K89 A;  3BQ7 A;  4FE3 A;  2BDU A;  5HNK A;  5BOL A;  2Y1J A;  9ICK A;  1SKW A;  1UA1 A;  3CW2 C;  1HJP A;  3PW4 A;  3TAC B;  1BPY A;  1ZD4 A;  3H7I A;  1N61 A;  2ES6 A;  2FDR A;  1RXV A;  1WWV A;  2P6R A;  1XSP A;  3GQC A;  2V4R A;  4GLX A;  2JXJ A;  5HHI A;  4QZ9 A;  2W43 A;  4BUG A;  3QNM A;  1KBU A;  4JV2 A;  7ICK A;  1B43 A;  5AM4 A;  1BPB A;  3NVW A;  1ZQW A;  2JZB A;  3WKA A;  1XNS A;  1CRX A;  2ASJ A;  5AIB A;  5DQI A;  1HIW A;  5KL8 B;  4O0I A;  3V72 A;  3PML A;  5J8Y A;  4QZE A;  1IIP A;  1L8O A;  3SI8 A;  1SKR A;  1L5U A;  5ALL A;  4FZL A;  5JUM A;  1TV9 A;  2R8I A;  1U4B A;  4ED3 A;  4PGY A;  1YZ7 A;  2H3Q A;  4DLE A;  1ZQX A;  3IHQ B;  8ICP A;  4J9N A;  1Z1V A;  2KJ8 A;  4YQW A;  4LZG A;  2D8C A;  1ZJM A;  1ARO P;  3BS7 A;  1UT8 A;  3KOO A;  3LWL A;  2DKX A;  3DEE A;  5DDY A;  2KZ3 A;  1U45 A;  1KQQ A;  1ZQM A;  3PX4 A;  2ZTD A;  4IR1 A;  3N7S C;  5J2A A;  1D8B A;  5EOZ A;  4EBD A;  3UXN A;  1PK1 B;  1NK0 A;  3CYM A;  5KT5 A;  1ZQG A;  3LK9 A;  9ICM A;  2NRT A;  2Y9U A;  3PNC A;  2B6G A;  4F91 B;  4EBC A;  2FLP A;  4IQW A;  2HMX A;  1ZQR A;  2E8M A;  5HR7 A;  2PFQ A;  1MSW D;  1XS9 D;  4G3I A;  3TFR A;  5DB9 A;  7ICO A;  3RF9 A;  9ICX A;  2XCP A;  3UQ0 A;  4DQI A;  4DO9 A;  3SAG A;  2AQ4 A;  4F5O A;  2BHN A;  1OXJ A;  4UAS A;  3PO4 A;  4F5P A;  1Z19 A;  5AHX A;  1UQV A;  5AKI A;  1QQ5 A;  4Z6C A;  3PX6 A;  3H4B A;  2KK0 A;  4BGD A;  3MDA A;  3D2Q A;  3QU9 A;  4RPX A;  1ZJN A;  2HDO A;  9ICA A;  2A1J A;  2BKE A;  2LM4 A;  4RQ5 A;  4F8R A;  4KLU A;  1C7Y A;  1ZD5 A;  3GIL A;  1NJX A;  4QIW F;  4UB8 U;  5KFS A;  1VLB A;  4J03 A;  3PR4 A;  4NL9 A;  2KJ5 A;  2BCU A;  4Z6E A;  2AQ0 A;  5DBC A;  3EW9 A;  2PI5 A;  3WKC A;  5KFQ A;  4RQ0 A;  1N48 A;  4F4X A;  4R65 A;  2ALZ A;  4GXJ A;  2K4I A;  3JPN A;  4RQ1 A;  3HWT A;  8ICZ A;  1X40 A;  4RZR A;  7ICS A;  4P2H A;  4OCZ A;  4J9O A;  2KFZ A;  3MGV A;  5AKX A;  2KTQ A;  5J0Q A;  5HR6 A;  4QZ8 A;  2NYV A;  5KT3 A;  2W9B B;  4QZD A;  5C0Y A;  2QB0 B;  4O3N A;  9ICR A;  5ALT A;  5ALK A;  3T79 A;  3QEA Z;  1DGJ A;  4UAZ A;  3EYZ A;  1D8L A;  1SWW A;  3SD7 A;  3TI0 A;  5D4B A;  5EE3 A;  8ICX A;  2IOF K;  1ZQL A;  4O9M A;  3MDC A;  2OXO A;  4DOB A;  4HYK A;  3UMB A;  4EYH B;  2GLE A;  3ONN A;  5KT7 A;  1D9D A;  3QZ8 A;  2OM6 A;  4Y2Y A;  5ALS A;  4J9Q A;  3JPR A;  3RR8 A;  9ICC A;  5DG7 A;  1TVA A;  1DXS A;  1CI4 A;  1T4G A;  1L7M A;  3F53 A;  3MAB A;  4QZC A;  5F9L A;  4XQ8 A;  5J2C A;  3RB6 A;  1IV8 A;  2H3I A;  2NRV A;  3HP6 A;  5FP0 A;  4ECR A;  3IM1 A;  1KFS A;  3N7P D;  2C2E A;  3EPI A;  2DL0 A;  1SXE A;  2PFO A;  4NLZ A;  2NRW A;  4F72 A;  5J2J A;  4C8N A;  5KG5 A;  3FM9 A;  4JK1 A;  1PK1 A;  4DSK A;  1RXW A;  3PSF A;  2FJ6 A;  5L1K A;  1ZQD A;  4JV1 A;  2JGA A;  4NLB A;  5KFI A;  1V97 A;  9ICI A;  1S0N A;  2WAQ C;  2G09 A;  4IRD A;  1TKD A;  4F92 B;  4QWB A;  4O3R A;  2PFN A;  3C29 A;  2NO5 A;  1Q3V A;  4UAU A;  1ZQN A;  3IG5 A;  3Q8Q B;  9ICJ A;  1U9L A;  1HEK A;  3ISC A;  1TK0 A;  3ZD9 A;  2DQN B;  4RQN A;  2WHE A;  4M6W A;  1TAQ A;  2BPF A;  3M9M B;  3H0M B;  4EZ6 A;  5KFR A;  4DQQ A;  5CEH A;  4M9G A;  2ASD A;  9ICQ A;  2BPG A;  4O5E A;  4A8E A;  5KTQ A;  4KLD A;  2HHX A;  4F4Y A;  2ASL A;  2YMM A;  3QUQ A;  3UM9 A;  4ED2 A;  4JWN A;  4I2H A;  3H4D A;  4ED6 A;  4Y2S A;  8ICV A;  4PZN A;  3L3F X;  1L7P A;  4BX9 C;  1NI3 A;  3ETR A;  5KFK A;  4C8L A;  4QW9 A;  4OD0 A;  1JMS A;  3RAQ A;  1OUQ A;  4BWM A;  4J9S A;  4UB6 U;  3GII A;  5ALE A;  5KFW A;  5CB1 A;  8ICM A;  4Q45 A;  4RQ6 A;  9ICW A;  5HMM A;  1S8O A;  4JV0 A;  1QTM A;  3PW2 A;  2K8A A;  1M6Y A;  2Z7J A;  2F2A B;  5DQH A;  3V6J A;  2QLT A;  3ORY A;  1ZQP A;  5ALU A;  3M6K A;  5BOM A;  2BQR A;  2AHO B;  5EE1 A;  3OSP A;  1RYU A;  2F1H A;  5AKL A;  1KKX A;  5DB6 A;  4O3S A;  4BWJ A;  5ALY A;  2KHQ A;  2W9B A;  5KFL A;  4KLL A;  1ZQI A;  3NVZ A;  4NM1 A;  5KG0 A;  4OJP A;  5AM3 A;  4EEK A;  2H3V A;  2W7P A;  2AXT U;  2XID A;  3PVX A;  4RU9 A;  4FFD A;  1JI7 A;  2DGZ A;  4PH5 A;  1XO0 A;  3TFS A;  2KZZ A;  2YQE A;  5L9X A;  7ICF A;  4CNQ A;  4OJ5 A;  2R18 A;  5L1J A;  1T7P A;  4FS1 A;  3L4P A;  2EDU A;  2NV3 A;  4C4R A;  3QU7 A;  4UBB A;  4QNL A;  5J2E A;  1QCK A;  2RQ5 A;  4I2C A;  3BZK A;  5J2G A;  2IHM A;  2W55 A;  4I2A A;  5AK5 A;  3HPO A;  4UB2 A;  1RZT A;  2W11 A;  3MR5 A;  1N60 A;  2I6X A;  5K4L A;  1TK5 A;  4YVZ A;  2KV2 A;  4U7C A;  3I76 A;  4K4H A;  2R8K A;  1UPH A;  5EWE A;  1ZQC A;  2FMS A;  1ZQV A;  2HOQ A;  8ICJ A;  4ECZ A;  4RNM A;  2XGQ A;  2BQU A;  4I2E A;  3QUC A;  4PHP A;  3KKA A;  4QJF B;  4F4K A;  1BGX T;  3EUB 2;  2H3Z A;  4QW8 A;  4P4M A;  4F5Q A;  4OJL A;  2K4H A;  2I9G A;  2BCS A;  4MEY A;  2MSN A;  2RRD A;  3K75 D;  2BQ3 A;  4ECS A;  4IL6 U;  1FFU A;  5J0R A;  4DSI A;  3FYH A;  4CRX A;  1ZET A;  2XIC A;  3GU3 A;  5J0P A;  4AYB C;  1X9S A;  2RHF A;  1TK8 A;  1BNO A;  2PMZ F;  3H0R B;  1XC9 A;  2JRZ A;  1KFT A;  4DCC A;  4O5K A;  3MFI A;  3UXO A;  4KX5 A;  3T5L A;  4Q8E A;  2W7O A;  1Q3U A;  4FZM A;  1SL0 A;  2H3F A;  2G0A A;  3HKZ C;  5AK4 A;  5KAF U;  2WF6 A;  4OJO A;  4DSL A;  4NLK A;  5KFB A;  2LMR A;  3KZX A;  2HVI A;  1XO1 A;  4AP9 A;  2IA6 A;  2KZM A;  4I29 A;  5B66 U;  5ALM A;  3AUO A;  1KEJ A;  5J2I A;  1NJW A;  2NRX A;  4NLG A;  3IP4 B;  4IQT A;  1NZB A;  2KEY A;  9ICE A;  2VA3 A;  3RJK A;  4JMU A;  3RH4 A;  1NK5 A;  3RJG A;  3M9N B;  2HOF A;  4RQ7 A;  2ZXH A;  4ZOH C;  1X66 A;  4DL2 A;  2HSZ A;  5AKY A;  4QZF A;  2ZTC A;  3B9J A;  1NOM A;  4FZN A;  2R8J A;  4QZH A;  1ZQ1 C;  2YMP A;  3F2C A;  3BQ1 A;  1PK3 A;  2CN1 A;  2I1Q A;  1TAU A;  4I2J A;  1ZQB A;  2ATL A;  4KLS A;  5AK3 A;  3I1Y A;  2G07 A;  1RYR A;  2CRX A;  2CPR A;  8ICL A;  8ICB A;  2XCA A;  2HHW A;  1X2I A;  5G5G A;  2WFA A;  5IIM A;  1WUD A;  5ALZ A;  1VDV A;  4C8M A;  1ZQA A;  1NJY A;  4ACO A;  2K4P A;  2EZX A;  2C22 A;  3QE9 Y;  1T8E A;  2XY7 A;  4USA A;  3TAD A;  5IIO A;  2L5Y A;  1MC8 A;  2D3D A;  4F5R A;  4RNO A;  3N28 A;  2JEI A;  4Q43 A;  4F3O A;  3QEB Z;  3SV4 A;  3RRG A;  3PZP A;  5AKK A;  4QWE A;  5KFF A;  1X9W A;  5AI4 A;  4O3Q A;  3AQF A;  5ALO A;  4RQ3 A;  8ICO A;  5KFE A;  3MGH A;  4KTQ A;  4KLM A;  1XU4 A;  4QWD A;  3Q8M A;  4F50 A;  3TAR A;  2HHQ A;  9ICF A;  5DLF A;  2F1J A;  5KG3 A;  1A6S A;  1SZH A;  2ZG6 A;  1RG6 A;  2WF7 A;  1FO4 A;  3D6J A;  3PX0 A;  3NRZ A;  3SZ2 A;  3BQ0 A;  2KHV A;  4TUP A;  5ALI A;  2BZF A;  4EBE A;  4CF5 A;  4Y2U A;  8ICR A;  3ZD8 A;  4KIT B;  1O08 A;  4PL2 A;  8ICY A;  4Y2X A;  2F1I A;  4M9H A;  1K1S A;  3UXP A;  2QB1 A;  4KN7 A;  3WKD A;  5CJ7 A;  1LV5 A;  2JEJ A;  5J0W A;  3KHR A;  4PPX A;  1S77 D;  7ICI A;  2GH1 A;  3ZI4 A;  1L7N A;  2W54 A;  2LI6 A;  4NLN A;  4B9M A;  3HT3 A;  4Z6F A;  1ZQY A;  1CEZ A;  2JH7 A;  1KTQ A;  1U49 A;  4M6W B;  2AGP A;  4KLH A;  2E1F A;  3AU6 A;  3S6J A;  3OJS A;  3UPQ A;  4B9S A;  5III A;  5F9N A;  2EQY A;  5B5E U;  2LYH A;  1MN8 A;  3Q8R B;  1RQN A;  4XRH A;  3MBY A;  4YR0 A;  2Y0S C;  5C5J A;  3FDS A;  2HHS A;  1QLN A;  3SEN A;  4UAW A;  4B9V A;  1RQL A;  1N5W A;  5GTH U;  3RH5 A;  5CP2 A;  2XY6 A;  1FEZ A;  4YMO A;  4DSE A;  1AQ6 A;  4MFA A;  2HW3 A;  3GV7 B;  4DFD A;  2W8L A;  5J0S A;  4I2D A;  5AI0 A;  4UB4 A;  3KFU F;  3OGU A;  5HHH A;  4LZD A;  3ALR A;  1PVQ A;  4DS5 A;  1J2M A;  3T3F A;  4DL5 A;  4RPZ A;  4RPY A;  2EAM A;  3BS5 B;  4IQU A;  2IBK A;  5ALP A;  4DL3 A;  2M0N A;  2IHN A;  1JRO A;  4DL4 A;  8ICG A;  2KG5 A;  2W3R A;  3UQ2 A;  4CGZ A;  9ICG A;  2WAQ F;  4GIB A;  1SV0 A;  1DOQ A;  2YML A;  5ALX A;  4M47 A;  2KP7 A;  3C28 A;  5KFD A;  4ECU A;  2YB4 A;  3RB0 A;  4LVS A;  1GO3 F;  1SL2 A;  2HBK A;  3RJI A;  2A1A A;  2KIC A;  4ED8 A;  9ICP A;  2Y1I A;  2WF8 A;  3QU5 A;  2IMW P;  4DL7 A;  3V6K A;  4EEL A;  3WK5 A;  2XGP A;  3E2E A;  5CRX A;  5EE9 A;  1K5O A;  1KLN A;  4CF4 A;  2XC9 A;  3PMN A;  4B9U A;  4DSJ A;  2CXY A;  2BCR A;  1ED1 A;  1Z00 B;  5DBB A;  1URJ A;  4NJ8 A;  2E8P A;  4DLG A;  1N2X A;  5AM0 A;  5KFN A;  4FO6 A;  4DS4 A;  1DRG A;  1V9P A;  2UVV A;  5AM1 A;  4PHD A;  1TAM A;  1JRP A;  4F93 B;  2HHT A;  2DPI A;  5KG6 A;  3QX7 A;  5AKJ A;  2K4E A;  3Q8P B;  2DWQ A;  4BDP A;  4PHA A;  3H8S A;  1XSN A;  2EH9 A;  1X6I A;  1PUZ A;  3AL0 B;  4NWI A;  1NK7 A;  2UVU A;  2Q0Z X;  7ICT A;  2LYA A;  3E58 A;  3TQ1 A;  5KFY A;  4QIW C;  4OJ6 A;  4RQ8 A;  5ALJ A;  3F5A A;  2HBJ A;  5CHG A;  5J0T A;  2Q4T A;  2KJ9 A;  3CNH A;  3RJJ A;  4E0D A;  4NY8 A;  4DFM A;  1NNL A;  4JB3 A;  1T3Q A;  3WKB A;  9ICB A;  5BPC A;  1X6J A;  5ALG A;  2E5S A;  5J2D A;  4YMM A;  2KMD A;  4ED7 A;  1A77 A;  3MR6 A;  2QAR B;  4C80 A;  2PFP A;  5AIC A;  3A0H U;  4EEN A;  4QZI A;  4Y2T A;  2EZY A;  1XWL A;  5J0O A;  2ZIX B;  1L6N A;  2AU0 A;  4K4I A;  2BCQ A;  4PGX A;  3C1Y A;  4R8U A;  3GDX A;  5IIJ A;  9ICO A;  4DFK A;  1P7D A;  3WK9 A;  8ICI A;  1IG6 A;  5DB8 A;  2LM1 A;  2J6U A;  3CRX A;  9ICV A;  4YXJ A;  3NS1 A;  8ICK A;  1ZD2 P;  3SAH A;  2W04 A;  8ICS A;  3B0X A;  2JHD A;  5KFG A;  4F4W A;  1D8Y A;  5J8Y C;  3MR3 A;  4YR3 A;  3F2B A;  3I28 A;  3AN1 A;  4PHE A;  4RQM A;  3BS5 A;  3T5J A;  3H8W A;  4IRC A;  5EWF A;  4GC7 A;  1C20 A;  1N62 A;  2A3V A;  3H8J A;  4ECT A;  2AGQ A;  1SWV A;  5J2F A;  3SMV A;  2KSO B;  4M0A A;  4Y2J A;  3LVW A;  3CP8 A;  5KFZ A;  1RDF A;  8ICH A;  2ZXI A;  4KLG A;  3BQ2 A;  4TUS A;  2YMQ A;  4NLC A;  2FPL A;  2XO7 A;  1S0O A;  2MUT A;  1ECW A;  4AYB F;  2FLL A;  4NXZ A;  7ICE A;  5CWR A;  4EX6 A;  5KFH A;  3SAF A;  3KBB A;  4F5N A;  4EEY A;  2JEG A;  5DG8 A;  3MR2 A;  4WJ3 B;  3M6Z A;  2C28 A;  4MF8 A;  1RPL A;  4B9L A;  1X42 A;  3HKZ F;  1Z00 A;  4PL1 A;  2G08 A;  2B21 A;  1ZQH A;  1BNP A;  1ZQS A;  1L3S A;  3K4G A;  5ALQ A;  3F5E A;  4UAT A;  2HBL A;  5KFT A;  1KSP A;  4KLO A;  3C2L A;  4RNN A;  5ALH A;  3MFH A;  1JXL A;  2LKY A;  1TFR A;  3JPT A;  5D46 A;  2XVT A;  2UVR A;  1BVS A;  4ELT A;  4M9L A;  5HP4 A;  3V7L A;  5J2K A;  5DG9 A;  8ICT A;  2FE9 A;  4F2R A;  3FAH A;  4F2S A;  3IDW A;  2K60 A;  4DSF A;  5CA7 A;  1H38 A;  4P0Q A;  4C8K A;  3WK6 A;  1V85 A;  3AQE A;  4DL6 A;  1ZQK A;  4NL9 C;  5DDM A;  4DFJ A;  2FPM A;  3QYP A;  3KD3 A;  3F2D A;  3V7J A;  3KHG A;  3GZF A;  5JTI A;  3GFK B;  3EPG A;  8ICA A;  5KFC A;  1LVH A;  1WCL A;  2FMQ A;  4DQS A;  5KFU A;  1ZQO A;  7ICL A;  4LJX A;  1KN5 A;  5DB7 A;  3VCB A;  4R63 A;  2ZUC A;  3T5K A;  2EAP A;  1COK A;  3PSI A;  1SV0 C;  2QAR A;  2W03 A;  3SEI A;  4B6J A;  2P66 A;  4IR9 A;  2VKQ A;  2ZIX A;  4Q44 A;  1Z4N A;  8ICU A;  4C8O A;  1YT3 A;  4KN4 A;  4P4O A;  2MAX A;  4C7Y A;  5D49 A;  3ISD A;  1S5L U;  1Z4O A;  2GOL A;  3LWM A;  2F3N A;  3SV3 A;  8ICW A;  3PR5 B;  4O5C A;  2C2D A;  1B4F A;  4DFP A;  4YFK A;  3ZDE A;  4RUC A;  4KX3 A;  5AKH A;  2DFL A;  3C5F A;  3PW0 A;  3A0B U;  3R9K A;  5KFO A;  2ZIV B;  3J81 j;  1J97 A;  4I2F A;  4P0P B;  4RUA A;  1OW5 A;  3NVY A;  5IIL A;  2KSO A;  1KRP A;  4Y2V A;  2XY5 A;  2R8G A;  4QWA A;  1QSY A;  4J9K A;  3N97 B;  2G5I B;  2ESE A;  4UB1 A;  3M1Y A;  4Y2P A;  5KT4 A;  3Q8S B;  4O3O A;  3N4M B;  4YMN A;  5KFJ A;  3HIL A;  5AKG A;  4YD1 A;  4KLJ A;  2HCF A;  5KG2 A;  2KNJ A;  2J6S A;  1FFV A;  2DF4 B;  7ICH A;  5KT6 A;  4RQ4 A;  1L3T A;  1Q8K A;  3AM9 A;  4UBC A;  2ZJ8 A;  4J9P A;  3C5G A;  2F8L A;  3V6H A;  1IXR A;  4DWI A;  5AI8 A;  5KFP A;  1NK9 A;  2ZTE A;  2EAN A;  3H0L B;  3BZC A;  2W9C B;  4UAV A;  1D9F A;  4RT3 A;  4B9N A;  2WB1 C;  4YP3 A;  3RBE A;  1X9X A;  2Y0S F;  1L7O A;  5KAI U;  2VA8 A;  2NRZ A;  4Y2R A;  2IOF A;  3MGI A;  1A0P A;  4UB3 A;  1COO A;  4PZO A;  2VA2 A;  3KZI U;  5AM2 A;  2PMZ C;  1SKS A;  3UMC A;  2ZIU B;  2OYY A;  1F5S A;  4IC9 A;  2ZIW B;  5KFA A;  1SL1 A;  1B0X A;  4TQR A;  1IM4 A;  4KLI A;  3LYS A;  1F0M A;  3IV6 A;  3PW7 A;  8ICE A;  7ICV A;  2YTU A;  3NVV A;  2ODG A;  5KG1 A;  3NTU A;  2OHF A;  3G6V A;  3M8S A;  1MA7 A;  3G6X A;  1UA0 A;  4UAY A;  2E1E A;  1NJZ A;  1FIQ A;  2VJ4 A;  4UQG A;  3THV A;  4PJ0 U;  2H5X A;  3M8R A;  3GIK A;  2NO4 A;  4IRK A;  5AKE A;  4U6P A;  1NKC A;  2N1R A;  2LBO A;  4MFC A;  4MHV A;  1KW4 A;  8ICC A;  3KHH A;  1KDH A;  3T5H A;  4FBU A;  3DDH A;  4GC6 A;  7ICQ A;  3DV9 A;  1L3V A;  4M9N A;  2JEF A;  2RP5 A;  3Q8K A;  2ISO A;  3BQT A;  1JX4 A;  2K8C B;  2YB1 A;  1J2N A;  1DK3 A;  2JMG A;  2KE7 A;  2VJ5 A;  4J9L A;  4RQ2 A;  1SIJ A;  9ICN A;  2WF9 A;  2HI0 A;  2V9W A;  4FBT A;  1F44 A;  3PV8 A;  3WK7 A;  3JPO A;  1ZQQ A;  2DBY A;  3M7D A;  3ISB A;  4R8U B;  2ZIV A;  2MRL A;  4MF2 A;  2XI9 A;  4P0P A;  4EX7 A;  4US9 A;  4EZ9 A;  5KG4 A;  3TKA A;  1YZ6 A;  2OEH A;  2F76 X;  1PVR A;  5EE0 A;  3GV8 B;  3UMG A;  5KNI A;  4XA5 A;  4O3M A;  5F3X B;  4GXI A;  5KFV A;  4ELV A;  3ZDC A;  1SXD A;  5AM5 A;  2OWO A;  4CF3 A;  1NK4 A;  1WYG A;  4NM2 A;  3MC1 A;  4DQP A;  2KIW A;  2JV3 A;  2VIX A;  8ICQ A;  3LVV A;  1NKE A;  3OTQ A;  5KT2 A;  2PXI A;  4ELU A;  4ICA A;  4ECX A;  1S0V A;  3AMZ A;  4Y2Q A;  2DKZ A;  5IIN A;  4MFF A;  4FS2 A;  5GTI U;  2G06 A;  5L1M A;  1U47 A;  3KKA C;  2J6T A;  4RT2 A;  5KG7 A;  2ISP A;  4BJQ A;  4DF8 A; 
#chains in the Genus database with same CATH homology
 1SXE A;  3IDW A;  4NJ8 A;  2K60 A;  3HIL A;  2E8P A;  2LPE A;  5J8Y A;  4MHV A;  1KW4 A;  4IS7 A;  5J8Y C;  4NL9 A;  2K4P A;  1V85 A;  4RQM A;  4NL9 C;  3BS5 A;  1PK1 A;  1SV4 A;  5JTI A;  3TAD A;  3SEN A;  2L5Y A;  3TAD C;  3H8M A;  1Z1V A;  2D3D A;  2KSO B;  2D8C A;  3BS7 A;  2EAO A;  2DKX A;  2KE7 A;  1X40 A;  3K1R B;  2EAN A;  2F44 A;  1JI7 A;  2Y9T A;  2LMR A;  2EAP A;  1COK A;  1UCV A;  2E8O A;  1SV0 C;  2QAR A;  1SGG A;  3SEI A;  4RQN A;  1X9X A;  2EAM A;  3BS5 B;  1PK1 B;  2E8N A;  2QB0 B;  2Y9U A;  5JRT A;  2B6G A;  4PZO A;  1RG6 A;  2F3N A;  1WWU A;  3BQ7 A;  2KG5 A;  1V38 A;  5KNI A;  1B4F A;  2KIV A;  5F3X B;  1SV0 A;  2E8M A;  1LKY A;  1B0X A;  4PZN A;  1SXD A;  1X66 A;  2KMD A;  3TAC B;  5JU5 A;  2F8K A;  2QAR B;  1F0M A;  2ES6 A;  1WWV A;  2GLE A;  2YTU A;  2QB1 A;  1OXJ A;  2JV3 A;  1PK3 A;  1OW5 A;  1UQV A;  1DXS A;  2DKZ A;  2KSO A;  2QB0 A;  2QKQ A;  3KKA A;  5L1M A;  2FE9 A;  2ESE A;  3KKA C;  1LKY B;  2DL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...