3K1RB

Structure of harmonin npdz1 in complex with the sam-pbm of sans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
ETSPLETFLASLHMEDFAALLRQEKIDLEALMLCSDLDLRSISVPLGPREKILGAVRRRRQAMERPPALEDTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Harmonin
publication title The structure of the harmonin/sans complex reveals an unexpected interaction mode of the two Usher syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3k1rB00
3TADC 2Y9TA 2JV3A 1OXJA 1PK1A 1JI7A 2QKQA 1SXEA 2ES6A 3BS5B 2E8MA 2B6GA 5L1MA 2KIVA 2EAOA 2D8CA 4NJ8A 2EAMA 1UCVA 1LKYB 1B4FA 2KMDA 4PZOA 1WWUA 1WWVA 2K4PA 1SV0A 4PZNA 1X9XA 5JRTA 1Z1VA 1SV4A 1KW4A 1COKA 2QB0A 1X40A 2KSOB 2QARB 1DXSA 2F3NA 2L5YA 2LPEA 1SGGA 1SV0C 5KNIA 1PK3A 4IS7A 2Y9UA 3BQ7A 4MHVA 2D3DA 2ESEA 1B0XA 2DL0A 2KG5A 3SENA 2E8NA 1PK1B 3K1RB 3H8MA 5F3XB 3BS5A 1OW5A 3KKAA 2KE7A 2E8PA 2EANA 2DKZA 1LKYA 5JTIA 3HILA 2EAPA 2GLEA 4NL9A 2F8KA 2DKXA 5J8YA 1V38A 3SEIA 4RQNA 3KKAC 1RG6A 1UQVA 2E8OA 2FE9A 2YTUA 2QB0B 3TADA 1SXDA 2KSOA 4RQMA 2QARA 3BS7A 4NL9C 3TACB 2F44A 1V85A 2K60A 5J8YC 1X66A 2QB1A 3IDWA 5JU5A 1F0MA 2LMRA
chains in the Genus database with same CATH superfamily
3QUQA 3QE9Y 1S76D 1F5SA 4FZMA 4MFAA 4TURA 4QW8A 5DBBA 3LVWA 2C22A 4ICAA 8ICCA 4IRKA 5EE1A 2KJ5A 4U7CA 1WWUA 3IG8A 5KFIA 3C2MA 1KFDA 9ICJA 4UAYA 3ZDEA 1SZPA 3ALRA 3BQTA 1IIPA 5AM4A 8ICMA 2ZIUB 4J9RA 1X40A 1TAQA 2KSOB 1ZQGA 2Y1IA 1RYSA 5TISU 1HUOA 1QTMA 5IILA 4LVSA 4O3SA 2HHQA 2KHVA 2ZUBA 3PZPA 3RRGA 1B0XA 2VA8A 2JRZA 1TFRA 4NLBA 2CN1A 2DWQA 4RQ1A 1TKDA 4RZRA 2P6RA 4BWMA 5EE3A 4PGQA 4DF4A 3ISDA 3SD7A 4C80A 3RH4A 3RAXA 3T5LA 2NRVA 4X5VA 2EDUA 2FPMA 3HPOA 2JH1A 2KN7A 4RT3A 2KHQA 4OJLA 3NGDA 5ALYA 2DGZA 1QQ6A 2ZIWB 3NTUA 1DGSA 4NL9C 4OJ5A 4YMMA 3G6XA 2W9MA 5F9LA 4Q43A 2BCQA 4ECRA 3EWAA 1BGXT 2DBYA 3KBBA 4YD1A 4OD0A 2KV2A 1N5XA 4YVZA 4YMNA 2XC9A 3PW2A 3SI8A 1Z3EB 2I9GA 7ICRA 1XSNA 4Z6CA 3GFKB 1D8YA 5HMMA 4P0QA 5KFOA 2B6GA 5CP2A 2GH1A 4F4ZA 3PMNA 3PSIA 4YR2A 1T4GA 3EPGA 1D8BA 1JROA 3H0MB 1L7PA 3RH6A 4GC6A 1ZD2P 5J2GA 1KRPA 4ECXA 3LWLA 1JALA 1IG6A 1BPDA 3MABA 4YP3A 1NZPA 4R66A 5KG4A 8ICYA 1FO4A 2J6UA 3DV9A 4I2BA 2F3NA 9ICFA 5ALEA 4KLLA 2LKYA 5KL1B 4IS7A 3UPQA 1BNOA 2ZTEA 1SL0A 2BCVA 5DG8A 5AM5A 1UPHA 4Q44A 2YY6A 1VDVA 2K4EA 1FEZA 3OHBA 4F5NA 5ALDA 5J0SA 1IV8A 3C5FA 3CNHA 1KBUA 3QNMA 3PV8A 5J0OA 2BKEA 1IXRA 4QZHA 1NNLA 1T94A 2E8PA 1Q46A 2EANA 1U47A 1CRXA 5EWFA 4B9MA 4F2SA 1XU4A 4DSJA 3QU5A 3HILA 2FDRA 2A1JB 2W9BB 2F8KA 5KFWA 8ICPA 5KFZA 4GXIA 2A19A 3PNCA 3SEIA 4QWBA 3E58A 3M9OB 5DQGA 2EZYA 3JPTA 1S97A 3N7PD 4RQ5A 1RXWA 5KFQA 1WG8A 1ZETA 3BS7A 4OCZA 4BXOA 2Q0ZX 4YXMA 3WK7A 4PH5A 2WF5A 2ZIXB 4I2EA 3ETLA 2C2EA 4RQ3A 1NKEA 4F2RA 2XY6A 3ZD8A 1S0MA 1ZQ1C 4QNLA 3RBDA 3WU2U 4I29A 3RB4A 2RRDA 2BQ3A 3MDAA 5J2CA 4UBBA 1KDHA 4KN4A 2W9CA 3T5HA 3OSPA 3QUBA 2WB1F 3RTVA 2JEFA 5J2DA 3Q8MA 3RAQA 4IR9A 4DSFA 5DLGA 2XCAA 5HP4A 2R8GA 5B5EU 3S6JA 4O3OA 5GTHU 5ALHA 3MR3A 3FAHA 1WYGA 3E2EA 2KTQA 3SAGA 2VA2A 5KNIA 3SQIA 2B21A 4CGZA 4IC9A 1ED1A 4ZH4A 2HOIA 5KFYA 3WK8A 2G08A 4RQ4A 3I28A 1UA1A 4UATA 1ZQEA 1ZD3A 4J9SA 1A6SA 1DK3A 3TKAA 4EELA 2KE7A 2KEYA 3M7DA 9ICLA 2YN4A 1TV9A 1KEJA 1COOA 1YZ6A 1LKYA 2IMWP 1L3VA 2FLNA 4Z6FA 1HUZA 2M9NA 4QZAA 3B0XA 5AKLA 3F2BA 4CCHA 5AIBA 4FBTA 7ICMA 1DGJA 2RDIA 4KLMA 1J2MA 5CR0A 4DCCA 2Y0SF 5KFLA 2KD1A 2FMSA 8ICHA 3TADA 5AK6A 4DEZA 2JR5A 5GTIU 4IQWA 2RP5A 2ISOA 3V7KA 5AI8A 1X2IA 2I1QA 2RLTA 2EZXA 3JPRA 5KFUA 5CB1A 4J9PA 3LDAA 4M6WA 9ICXA 4RQ2A 2AGOA 4FBUA 2QLTA 4US9A 1PK1A 4OO1J 4CF4A 2WB1C 4EBEA 2KICA 3H0LB 3WKAA 4NLKA 3QU4A 1X9XA 2F76X 2MSNA 2Y1JA 8ICXA 4JMUA 1S0VA 3KZIU 5KFEA 2P35A 4UBCA 2QB0A 5KFXA 4QWCA 3M9MB 1FFUA 2L5YA 2MUTA 1X42A 1L3UA 4O3QA 1URJA 2ZJAA 3AEVA 4R8UA 4BX9C 5J2KA 3PW5A 1Z4NA 3QX7A 2ZXHA 3OHAA 3FYHA 1Z00A 1ZQJA 2JZBB 1MC8A 2ZIVB 3F2CA 5DKWA 4CE6A 2JGAA 2KKPA 8ICEA 4KLSA 4R64A 2H3QA 1L8LA 4BJQA 2LYHA 2NRZA 2ISPA 3QUCA 4FS1A 2H3FA 2XICA 1PUZA 2PXIA 4P4PA 1NJWA 1DOQA 1JXEA 4A8EA 8ICAA 5AI9A 1UHUA 2W7OA 3GDXA 3TFSA 1QSYA 2C2DA 2Y0SC 2UVWA 1RG6A 5KFVA 1Z4OA 2W43A 9ICSA 1KN5A 4M9LA 1MSWD 3AN1A 3IP4B 1XNSA 2UVUA 4F5QA 4YQWA 1UT5A 2AGPA 1PZNA 2NRXA 4IQUA 5IIKA 3PX6A 5AM2A 1F0MA 3ED5A 3QZ8A 2C28A 4QZBA 2FJ6A 3NVYA 2OM6A 1NJXA 4P0PA 3TADC 2AH5A 1N48A 1OXJA 4YG2A 1RXVA 5AK4A 3BS5B 5CA7A 4DSEA 3RF9A 2WF7A 5AHXA 9ICNA 1A0PA 3WKDA 2EAMA 2YMPA 2PI4A 4ED2A 4J9QA 1NOMA 4JV0A 3GV7B 5AM3A 2XY7A 4PZNA 4QWEA 4JV2A 4KX5A 2BCUA 5AIAA 5KFFA 5EE9A 5ALZA 4UB8U 3IM1A 5DG9A 4J9KA 5DBAA 1QSSA 1A76A 1S10A 4KLIA 4RT2A 5ALJA 1PK3A 4ED8A 1SB3C 4FFDA 5J2AA 4I2CA 3H8SA 4PJ0U 1BPZA 2HSZA 2D6FC 3SENA 3K75D 4DLGA 5DB8A 4QZGA 2F1IA 5DGAA 4DOAA 1MA7A 4IRDA 1ECWA 4IQTA 4M9JA 3Q8PB 2HCFA 5E79U 2R18A 4Y2TA 1Q8KA 3GV8B 2K4IA 2V4RA 3RB6A 1ZQCA 2IOFA 3HX0A 2KVSA 8ICRA 5AKZA 3RJFA 4Y2XA 4C4SA 2DPIA 7ICUA 4O9MA 5KFHA 4TUPA 5HNKA 5J2BA 5AKHA 3JPNA 1JXLA 5J0QA 2FLLA 3RJKA 4YD2A 1PVPA 4C8OA 2YQEA 2H3VA 3D2SA 3ISCA 5DB9A 1J2NA 5JU5A 4F4KA 4FZLA 1ZQSA 2F2AB 1Z1BA 1ZQQA 3V6KA 3PX0A 2VIXA 3JPPA 4ED6A 4KLDA 3MGIA 4F4XA 2KKVA 9ICRA 2YMLA 5L1IA 5CJ7A 4GXKA 3ZDCA 3GZFA 2KJ8A 3BZKA 3QU7A 5TZVA 5J0PA 4QZDA 4KN7A 3BQ2A 1SIJA 3HWTA 4ECUA 3FC4A 1GO3F 3MGVA 2O6KA 1Q3UA 4UB1A 3C1YA 2ASDA 1ZQMA 3KHRA 3TI0A 2W9AA 4UW9A 5IINA 3PMLA 4YMOA 2IOHA 1TVAA 4F92B 5G5HA 1SV4A 5BPCA 3T79A 4C7ZA 4B6JA 1Y88A 4FE3A 4KLQA 2AGQA 2WF8A 1L5UA 1N5WA 3Q8QB 4ECYA 3SAHA 2R8JA 3I76A 4P0QB 4QZ9A 3H7IA 5EE0A 3T5KA 1NZBA 2GO7A 1KFSA 1T3QA 9ICCA 3AMZA 1SKRA 4XQ8A 2J6SA 4ZOHC 5J0XA 2F77X 2ZJ8A 1V9PA 3PW0A 3J81j 5L1JA 2RHFA 2ZXIA 4G3IA 4KMUA 4M9GA 8ICUA 2PKEA 5KFBA 1SXDA 4NLGA 2R8KA 1X66A 3OJUA 3QYPA 3OTQA 4DL2A 5D49A 2W7PA 2ASLA 1IM4A 1S9FA 3HRDD 1KL9A 5ALRA 1NK4A 1C7YA 1JI7A 2BCSA 3WKBA 5KT2A 3CRXA 3TQ1A 2KNJA 3LVVA 1YZ7A 3UMGA 2YMQA 1LV5A 5A0LA 4PHDA 1B4FA 4IL6U 5B66U 3L4PA 4CRXA 4ED7A 3C23A 3NRZA 3RH5A 2K4PA 1SV0A 2ASJA 1ZRMA 4Y2SA 4NV0A 7ICJA 1FIQA 1K1SA 2XY5A 1Z1VA 4FZNA 1KW4A 1ZQBA 3LWMA 2HOFA 3V6JA 1KSPA 4BXOB 2PFOA 2NO4A 2HBJA 2J6TA 4P2HA 1KKXA 4F3OA 5DB6A 3AUOA 1S0NA 3F5EA 1TK0A 4G9BA 3MBYA 2HHVA 1VJ5A 1O08A 2DUYA 4J9OA 3NASA 4RPZA 4ELVA 3EPIA 4UASA 1N2XA 2YB4A 1KLNA 4QZ8A 5ALKA 2NO5A 2HVIA 1BPEA 4MF2A 1SL2A 3SV4A 8ICQA 2NV3A 4KTQA 3OSNA 4JWMA 3G6YA 1T8EA 4KLOA 3K4GA 1K5OA 4I2IA 3WK9A 3WK4A 2V4QA 2WAQF 2OH2A 2W11A 2F44A 2XVTA 2ODGA 1ZQAA 3A0BU 3Q8KA 4DSIA 3KFUF 3C21A 3EZ5A 4IQVA 2G5IB 1ZOLA 8ICOA 4ECZA 2WF9A 4MFCA 2AQ0A 3UXOA 2ZIWA 3UXPA 4KLUA 4Y2UA 1LKYB 2HBKA 4J9LA 1XS9D 3D2QA 1NKBA 2XI9A 3RJJA 2I5HA 4PL2A 2JEGA 1U9LA 5HHHA 4DQPA 2G0AA 1N62A 3THVA 3FM9A 1B22A 7ICHA 2RQ5A 1BPBA 3OJSA 1RPLA 1N61A 2N1RA 4LZGA 7ICQA 5J0YA 4RPYA 4TQRA 2HHWA 1COKA 4EBCA 3SMVA 3PR5B 1RYRA 3QEBZ 1SGGA 2F1HA 3AM9A 1X9WA 2ZG6A 1SV0C 5J0TA 4C8KA 3EYZA 3HP6A 2XCPA 2DPJA 5ALGA 2K4HA 4Z6EA 1BVSA 2WF6A 4M6WB 1M6YA 2M0NA 4QJFB 4QZCA 2ALZA 1NJZA 4MEXA 1F44A 5KTQA 1PK1B 5T14A 1OW5A 3NRWA 4UQGA 2GOLA 3SAFA 5J29A 5CRXA 4UAZA 1CI4A 3H4DA 1L3TA 9ICMA 4Q8EA 2K8AA 4C0ZA 3IN5A 3PVXA 5ALMA 2HDOA 3MC1A 5AKEA 1TAMA 2QB0B 2QARA 2WAQC 4KMOB 4M2YA 4EEKA 1U48A 5KFNA 2HBLA 3UM9A 4R8UB 4NXZA 1J97A 2HOQA 5AK3A 4GFJA 4I27A 1C20A 3IV6A 3PR4A 3H4BA 2FMPA 5DQHA 1JMSA 4BUGA 4QWDA 4Y2VA 2WTFA 2HW3A 3HKZF 7ICFA 4QZEA 2E8MA 2HHSA 5L1MA 2Q4TA 2W3RA 9ICEA 4CNQA 2KOBA 4DSKA 3F5AA 4NLCA 4MEYA 4DQRA 4UARA 4LZDA 3HT3A 5KFKA 5KT5A 5KFMA 1ZQUA 2BGWA 4AP9A 5ALSA 2DF4B 4ED3A 1HEKA 4I28A 1SZHA 4NLNA 5DDMA 1Q3VA 4JWNA 1TE2A 4UAVA 2D3DA 2ESEA 2JH7A 8ICJA 2KG5A 1SKWA 4P0PB 5IIOA 2E8NA 3GIIA 5HMLA 1UA0A 3I1YA 5KFGA 3SR6A 3JPQA 2KZMA 2LYBA 5BOLA 5J2HA 3RB0A 5IIIA 4AYBF 4F91B 3C2KA 4F71A 2NYVA 4QZFA 1ZJMA 3GV5B 2ZTCA 1JN3A 4NWIA 2YB1A 3SYZA 4DQSA 4EEYA 4F8RA 2FE9A 3V7LA 5KT6A 4E0DA 3D6JA 3PO5A 4HAIA 1BNPA 7ICOA 1V85A 2BPFA 3H8JA 1XSLA 3JPSA 4ED0A 2QB1A 7ICSA 3C2LA 3MR5A 1L3SA 3DEEA 1UT8A 4JUZA 8ICKA 2Y9TA 3NVVA 2KFNA 4JV1A 4J9MA 2JEJA 3HKZC 3V72A 5AKXA 1ZQKA 4M04A 4O5KA 3RFAA 5CHGA 2KIVA 2YMMA 4CF3A 2BZFA 4DFKA 1L7NA 2FMQA 2AU0A 2FPLA 4UAUA 4B9TA 1QH9A 1TAUA 1QCKA 2W04A 4ELTA 4NLZA 3ZD9A 2G07A 3MDCA 4J03A 3TFRA 1AROP 3VCBA 2WFAA 3QZ7A 1ZQIA 2ATLA 9ICBA 3PSPA 4ACOA 2LM1A 5AI0A 8ICWA 1ZQLA 3PY8A 4BGDA 2JMGA 1ZXIA 5AKJA 1ZQHA 4RUAA 2OHFA 4DS5A 3C1ZA 4AYBC 4ECWA 9ICVA 4C4RA 4C7YA 2G06A 1HJPA 1RYUA 4F5OA 1QQ5A 4JB3A 9ICQA 1YT3A 2KP7A 1UQVA 2E8OA 2F8LA 2BHNA 1ZD4A 3M8SA 2XGPA 3WK6A 2OCEA 2PI5A 4PHEA 2IHMA 1JX4A 3H0RB 4Z6DA 1XWLA 1X9SA 4UB5A 5IIJA 2C2RA 5AI6A 1FFVA 1NK6A 1JRPA 4Y2RA 4NJ8A 3IRUA 4PZOA 2HBMA 1MQ3A 2P66A 1SL1A 2OXOA 5KFRA 4ECSA 9ICAA 5J2JA 4KLFA 5ALUA 4O3PA 3A0HU 5JRTA 5AI4A 3QU9A 2MAXA 4GXJA 1JUDA 9ICOA 2LPEA 2FLPA 4M9NA 4MFFA 7ICIA 4U6PA 4DOCA 1WCLA 1L7MA 4LJXA 1WUDA 3ZDDA 5KT3A 1U45A 1NK8A 5KFPA 4B9LA 4Q45A 9ICHA 1X6IA 5BOMA 3Q8SB 1PVQA 1NKCA 1PVRA 3BDPA 3R9KA 2CPRA 2DKZA 3UMBA 1ZJNA 8ICFA 2OYYA 4KLTA 3DDHA 2EAPA 3B0YA 2VJ5A 4EX7A 2E1EA 2JXJA 1JIHA 5KG6A 4HYKA 7ICPA 2EH9A 2K8BB 1ZQYA 1ZRNA 3MFIA 5AKIA 5DLFA 3WKEA 3L3FX 1A77A 1XC9A 2A3VA 4M0AA 5DQIA 4P4MA 4O5EA 4F50A 1NK0A 5L1LA 2R8HA 4TUSA 4UB2A 2MA1A 4DL4A 2BCRA 5AM1A 5AKGA 2HVHA 1ZD5A 2B0CA 4RNMA 1EXNA 3G6VA 3UMCA 1Z19A 3ETRA 4CF5A 5CWRA 4IR1A 4DL5A 4R63A 1NK9A 2G09A 4DO9A 2XGQA 4PHAA 4ELUA 2HHTA 4GC7A 3MR6A 2V9WA 3AQFA 5C0YA 4XRHA 2KMDA 3M1YA 5F9NA 2PFQA 5KG1A 4GLXA 5DG7A 4EZ9A 4BDPA 1SWVA 3ICXA 5KFCA 5C5JA 3BJYA 4PPXA 2K89A 2ZUDA 3KD3A 5ALLA 3MGHA 2CXYA 4F72A 4DSLA 2KJ9A 2A1AA 4R65A 1ZQOA 8ICVA 3RJEA 7ICKA 4USAA 1X9MA 2PFPA 3BQ7A 2E5SA 1XO0A 3OGUA 2ZTDA 4ECVA 5ALPA 3RJGA 3PW4A 2IOFK 3KHLA 3H8MA 4RQ0A 4KX3A 3UXNA 7ICGA 4JK1A 5AI5A 2EZZA 5KG2A 2HMXA 4ED1A 1N60A 4I2HA 4Y2QA 5JTIA 1L8OA 2GLEA 4QWAA 4QIWF 5J0WA 2KVCA 3RB3A 4RQNA 2BQRA 3UQ2A 3QXGA 4YXJA 3U26A 1ZQZA 2KIWA 4Q8FA 2ZIUA 2G5HB 2KSOA 2VKQA 3WK5A 4J9NA 3CW2C 2W9CB 3F2DA 1TK8A 2OWOA 7ICLA 5K4LA 8ICLA 2LM4A 4O3NA 5ALIA 2NRWA 3O0FA 3KOOA 4PL1A 1RM6C 5KT7A 3TANA 2IBKA 1NJYA 2QKQA 1SXEA 4I2AA 3PSTA 3KHGA 4EX6A 1T3NA 2YX8A 4UB6U 3V6HA 1U4BA 1D9DA 4Y2JA 5H2FU 9ICGA 2JHDA 3F53A 1D8LA 2OEHA 3N28A 4DF8A 3ZDAA 1ZQTA 4TUQA 4C8LA 4XUSA 4DFPA 1P7DA 5JUMA 2NRTA 3WKCA 3D2NA 4FO6A 2QARB 2MRLA 3AQEA 9ICWA 3TARA 2BR0A 1ZQWA 4WJ3B 2Y9UA 5ALNA 3M8RA 4Y2YA 1L7OA 1S8OA 5ALWA 1XSPA 5HHIA 5EWGA 1S0OA 3LYSA 1LB2B 1T7PA 1KQQA 3N7SC 2KK0A 4GIBA 1ZYQA 1HIWA 2KFZA 3E0FA 3KTQA 1L6NA 4US8A 3L5KA 4DL7A 4QIWC 1S77D 1V38A 2AXTU 1RDFA 3M6KA 2VA3A 3QEAZ 1S5LU 2HHXA 4YCXA 3RJIA 9ICTA 2Z7JA 5KFTA 2RDJA 4KITB 2K60A 2AJQA 3CP8A 3BQ1A 1WCNA 1RZTA 2P6UA 2DFLA 3AU6A 4K4GA 4OJPA 3JPOA 1VLBA 1DK2A 2LI6A 2H3ZA 4DL6A 3T5JA 5KFSA 4BWJA 3MFHA 1BPYA 3RJHA 5KG7A 3V7JA 1NK7A 3VC8A 3GIMA 4DLEA 2W8LA 4F5PA 4DS4A 3GILA 2MUTB 4EZ6A 2BQUA 1OUQA 1UCVA 5ALOA 1RQNA 5KT4A 2A1JA 2HHUA 2W9BA 5HR7A 2BPGA 1U49A 1Z00B 1MN8A 1ZQVA 3PX4A 4EYHB 2E3TA 1DXSA 3TAPA 2K8CB 1X6JA 5L1KA 4C4TA 1ZQPA 4O0IA 2BPCA 5J2EA 4TQSA 5KG0A 4MHVA 3PO4A 3RR8A 4B9NA 2EQYA 2ZIXA 2W3SA 2DQNB 3PSFA 4RUCA 4Y2PA 4RQ6A 4C8NA 4I2JA 5KG5A 3GIKA 9ICIA 4C8MA 2R8IA 4RQ8A 4XA5A 3ZI4A 1DRGA 2XO7A 4F4YA 4DOBA 3EUB2 3QU2A 2VJ4A 4K4HA 2UVVA 3KHHA 3Q8LA 3NUQA 5J8YA 2FPKA 2LYAA 3SV3A 1N56A 3T3FA 1KFTA 4RU9A 1O03A 4YR3A 2WHEA 4O3RA 3GQCA 3PW7A 2BDPA 4EYIB 2BDUA 3M6ZA 5KAFU 3CYMA 5EWEA 4ECTA 3NVWA 2JEIA 5J0UA 3ZDBA 4ECQA 1N63A 2AHOB 1QSLA 2LHTA 2PFNA 2LBOA 2LMRA 3BQ0A 2JV3A 4OJ6A 4PGXA 2MU2A 4YFKA 2ES6A 2GWSA 2EAOA 2D8CA 1QLNA 1LVHA 3GIJA 3C28A 1WWVA 5FP0A 1XO1A 3HJEA 5L9XA 3HW8A 3C5GA 8ICTA 4KLJA 4M47A 4IRCA 3GU3A 2XIDA 3BZCA 5KG3A 2PMZF 3FDSA 3B9JA 5KFAA 1ZQDA 4QW9A 3AU2A 4DFJA 4I2FA 7ICEA 3K1ZA 3H40A 2W55A 4DFDA 8ICSA 5CEHA 4MF8A 4FS2A 3RBEA 4NY8A 4DQIA 5F3XB 3KKAA 5DDYA 5HR6A 3TAQA 7ICNA 4YR0A 4RNNA 4B9UA 4P4OA 4CDGA 4OJOA 3ISBA 1SKSA 2W8KA 5KFDA 5AKYA 4NM2A 3SZ2A 5ALXA 5KAIU 2HI0A 3H8WA 5EOZA 5AKKA 5DB7A 1QQ7A 4M9HA 4DQQA 5AK5A 3MR2A 4RQMA 5ALFA 2KZ3A 1H38A 1BPXA 3TACB 5J8YC 2F1JA 5DBCA 4PGYA 4B9VA 5G5GA 4KLGA 8ICNA 3IDWA 3OPXA 5J2IA 4UAWA 5ALTA 3AL0B 5DGBA 2CRXA 2JZBA 1B43A 2ZIVA 1ZQNA 3C29A 3NS1A 4YN4A 4QZIA 1MQ2A 3IHQB 4NM1A 4EENA 8ICGA 2IHNA 3RRHA 3M9NB 5AICA 4O5CA 4RQ7A 1ZQXA 1AQ6A 5ALVA 1KTQA 4O3MA 3NVZA 2AQ4A 4DWIA 5D4BA 4RPXA 4DFMA 3N4MB 1RQLA 4PHPA 4F93B 3IG5A 9ICPA 1ZQRA 4DL3A 1NI3A 2H5XA 3UQ0A 2PMZC 3EW9A 4UB4A 5J2FA 2UVRA 2I6XA 5KFJA 3KZXA 8ICBA 1NK5A 4UB3A 3LK9A 4I2DA 3Q8RB 2DL0A 5IIMA 1TK5A 2ZJ5A 1V97A 3K1RB 4F4WA 3N97B 2VANA 3BS5A 3RR7A 2FI1A 4B9SA 2W03A 2H3IA 2W54A 4RNOA 2E1FA 4NL9A 3N7RC 5ALQA 1CEZA 1SWWA 2DKXA 4K4IA 4KLHA 2KZZA 9ICKA 8ICZA 7ICVA 5J0RA 8ICIA 1CUKA 1D9FA 3KKAC 3ONNA 5KL8B 2YTUA 4EBDA 3QUTA 1ZQFA 7ICTA 4F5RA 1K1QA 4I2GA 9ICUA 2ZUCA 5AM0A 3ORYA 4KLEA 5D46A 2IA6A
chains in the Genus database with same CATH topology
3TADC 2Y9TA 2JV3A 1OXJA 1PK1A 1JI7A 2QKQA 1SXEA 2ES6A 3BS5B 2E8MA 2B6GA 5L1MA 2KIVA 2EAOA 2D8CA 4NJ8A 2EAMA 1UCVA 1LKYB 1B4FA 2KMDA 4PZOA 1WWUA 1WWVA 2K4PA 1SV0A 4PZNA 1X9XA 5JRTA 1Z1VA 1SV4A 1KW4A 1COKA 2QB0A 1X40A 2KSOB 2QARB 1DXSA 2F3NA 2L5YA 2LPEA 1SGGA 1SV0C 5KNIA 1PK3A 4IS7A 2Y9UA 3BQ7A 4MHVA 2D3DA 2ESEA 1B0XA 2DL0A 2KG5A 3SENA 2E8NA 1PK1B 3K1RB 3H8MA 5F3XB 3BS5A 1OW5A 3KKAA 2KE7A 2E8PA 2EANA 2DKZA 1LKYA 5JTIA 3HILA 2EAPA 2GLEA 4NL9A 2F8KA 2DKXA 5J8YA 1V38A 3SEIA 4RQNA 3KKAC 1RG6A 1UQVA 2E8OA 2FE9A 2YTUA 2QB0B 3TADA 1SXDA 2KSOA 4RQMA 2QARA 3BS7A 4NL9C 3TACB 2F44A 1V85A 2K60A 5J8YC 1X66A 2QB1A 3IDWA 5JU5A 1F0MA 2LMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD C;  2Y9T A;  2JV3 A;  1OXJ A;  1PK1 A;  1JI7 A;  2QKQ A;  1SXE A;  2ES6 A;  3BS5 B;  2E8M A;  2B6G A;  5L1M A;  2KIV A;  2EAO A;  2D8C A;  4NJ8 A;  2EAM A;  1UCV A;  1LKY B;  1B4F A;  2KMD A;  4PZO A;  1WWU A;  1WWV A;  2K4P A;  1SV0 A;  4PZN A;  1X9X A;  5JRT A;  1Z1V A;  1SV4 A;  1KW4 A;  1COK A;  2QB0 A;  1X40 A;  2KSO B;  2QAR B;  1DXS A;  2F3N A;  2L5Y A;  2LPE A;  1SGG A;  1SV0 C;  5KNI A;  1PK3 A;  4IS7 A;  2Y9U A;  3BQ7 A;  4MHV A;  2D3D A;  2ESE A;  1B0X A;  2DL0 A;  2KG5 A;  3SEN A;  2E8N A;  1PK1 B;  3K1R B;  3H8M A;  5F3X B;  3BS5 A;  1OW5 A;  3KKA A;  2KE7 A;  2E8P A;  2EAN A;  2DKZ A;  1LKY A;  5JTI A;  3HIL A;  2EAP A;  2GLE A;  4NL9 A;  2F8K A;  2DKX A;  5J8Y A;  1V38 A;  3SEI A;  4RQN A;  3KKA C;  1RG6 A;  1UQV A;  2E8O A;  2FE9 A;  2YTU A;  2QB0 B;  3TAD A;  1SXD A;  2KSO A;  4RQM A;  2QAR A;  3BS7 A;  4NL9 C;  3TAC B;  2F44 A;  1V85 A;  2K60 A;  5J8Y C;  1X66 A;  2QB1 A;  3IDW A;  5JU5 A;  1F0M A;  2LMR A; 
#chains in the Genus database with same CATH topology
 3QUQ A;  3QE9 Y;  1S76 D;  1F5S A;  4FZM A;  4MFA A;  4TUR A;  4QW8 A;  5DBB A;  3LVW A;  2C22 A;  4ICA A;  8ICC A;  4IRK A;  5EE1 A;  2KJ5 A;  4U7C A;  1WWU A;  3IG8 A;  5KFI A;  3C2M A;  1KFD A;  9ICJ A;  4UAY A;  3ZDE A;  1SZP A;  3ALR A;  3BQT A;  1IIP A;  5AM4 A;  8ICM A;  2ZIU B;  4J9R A;  1X40 A;  1TAQ A;  2KSO B;  1ZQG A;  2Y1I A;  1RYS A;  5TIS U;  1HUO A;  1QTM A;  5IIL A;  4LVS A;  4O3S A;  2HHQ A;  2KHV A;  2ZUB A;  3PZP A;  3RRG A;  1B0X A;  2VA8 A;  2JRZ A;  1TFR A;  4NLB A;  2CN1 A;  2DWQ A;  4RQ1 A;  1TKD A;  4RZR A;  2P6R A;  4BWM A;  5EE3 A;  4PGQ A;  4DF4 A;  3ISD A;  3SD7 A;  4C80 A;  3RH4 A;  3RAX A;  3T5L A;  2NRV A;  4X5V A;  2EDU A;  2FPM A;  3HPO A;  2JH1 A;  2KN7 A;  4RT3 A;  2KHQ A;  4OJL A;  3NGD A;  5ALY A;  2DGZ A;  1QQ6 A;  2ZIW B;  3NTU A;  1DGS A;  4NL9 C;  4OJ5 A;  4YMM A;  3G6X A;  2W9M A;  5F9L A;  4Q43 A;  2BCQ A;  4ECR A;  3EWA A;  1BGX T;  2DBY A;  3KBB A;  4YD1 A;  4OD0 A;  2KV2 A;  1N5X A;  4YVZ A;  4YMN A;  2XC9 A;  3PW2 A;  3SI8 A;  1Z3E B;  2I9G A;  7ICR A;  1XSN A;  4Z6C A;  3GFK B;  1D8Y A;  5HMM A;  4P0Q A;  5KFO A;  2B6G A;  5CP2 A;  2GH1 A;  4F4Z A;  3PMN A;  3PSI A;  4YR2 A;  1T4G A;  3EPG A;  1D8B A;  1JRO A;  3H0M B;  1L7P A;  3RH6 A;  4GC6 A;  1ZD2 P;  5J2G A;  1KRP A;  4ECX A;  3LWL A;  1JAL A;  1IG6 A;  1BPD A;  3MAB A;  4YP3 A;  1NZP A;  4R66 A;  5KG4 A;  8ICY A;  1FO4 A;  2J6U A;  3DV9 A;  4I2B A;  2F3N A;  9ICF A;  5ALE A;  4KLL A;  2LKY A;  5KL1 B;  4IS7 A;  3UPQ A;  1BNO A;  2ZTE A;  1SL0 A;  2BCV A;  5DG8 A;  5AM5 A;  1UPH A;  4Q44 A;  2YY6 A;  1VDV A;  2K4E A;  1FEZ A;  3OHB A;  4F5N A;  5ALD A;  5J0S A;  1IV8 A;  3C5F A;  3CNH A;  1KBU A;  3QNM A;  3PV8 A;  5J0O A;  2BKE A;  1IXR A;  4QZH A;  1NNL A;  1T94 A;  2E8P A;  1Q46 A;  2EAN A;  1U47 A;  1CRX A;  5EWF A;  4B9M A;  4F2S A;  1XU4 A;  4DSJ A;  3QU5 A;  3HIL A;  2FDR A;  2A1J B;  2W9B B;  2F8K A;  5KFW A;  8ICP A;  5KFZ A;  4GXI A;  2A19 A;  3PNC A;  3SEI A;  4QWB A;  3E58 A;  3M9O B;  5DQG A;  2EZY A;  3JPT A;  1S97 A;  3N7P D;  4RQ5 A;  1RXW A;  5KFQ A;  1WG8 A;  1ZET A;  3BS7 A;  4OCZ A;  4BXO A;  2Q0Z X;  4YXM A;  3WK7 A;  4PH5 A;  2WF5 A;  2ZIX B;  4I2E A;  3ETL A;  2C2E A;  4RQ3 A;  1NKE A;  4F2R A;  2XY6 A;  3ZD8 A;  1S0M A;  1ZQ1 C;  4QNL A;  3RBD A;  3WU2 U;  4I29 A;  3RB4 A;  2RRD A;  2BQ3 A;  3MDA A;  5J2C A;  4UBB A;  1KDH A;  4KN4 A;  2W9C A;  3T5H A;  3OSP A;  3QUB A;  2WB1 F;  3RTV A;  2JEF A;  5J2D A;  3Q8M A;  3RAQ A;  4IR9 A;  4DSF A;  5DLG A;  2XCA A;  5HP4 A;  2R8G A;  5B5E U;  3S6J A;  4O3O A;  5GTH U;  5ALH A;  3MR3 A;  3FAH A;  1WYG A;  3E2E A;  2KTQ A;  3SAG A;  2VA2 A;  5KNI A;  3SQI A;  2B21 A;  4CGZ A;  4IC9 A;  1ED1 A;  4ZH4 A;  2HOI A;  5KFY A;  3WK8 A;  2G08 A;  4RQ4 A;  3I28 A;  1UA1 A;  4UAT A;  1ZQE A;  1ZD3 A;  4J9S A;  1A6S A;  1DK3 A;  3TKA A;  4EEL A;  2KE7 A;  2KEY A;  3M7D A;  9ICL A;  2YN4 A;  1TV9 A;  1KEJ A;  1COO A;  1YZ6 A;  1LKY A;  2IMW P;  1L3V A;  2FLN A;  4Z6F A;  1HUZ A;  2M9N A;  4QZA A;  3B0X A;  5AKL A;  3F2B A;  4CCH A;  5AIB A;  4FBT A;  7ICM A;  1DGJ A;  2RDI A;  4KLM A;  1J2M A;  5CR0 A;  4DCC A;  2Y0S F;  5KFL A;  2KD1 A;  2FMS A;  8ICH A;  3TAD A;  5AK6 A;  4DEZ A;  2JR5 A;  5GTI U;  4IQW A;  2RP5 A;  2ISO A;  3V7K A;  5AI8 A;  1X2I A;  2I1Q A;  2RLT A;  2EZX A;  3JPR A;  5KFU A;  5CB1 A;  4J9P A;  3LDA A;  4M6W A;  9ICX A;  4RQ2 A;  2AGO A;  4FBU A;  2QLT A;  4US9 A;  1PK1 A;  4OO1 J;  4CF4 A;  2WB1 C;  4EBE A;  2KIC A;  3H0L B;  3WKA A;  4NLK A;  3QU4 A;  1X9X A;  2F76 X;  2MSN A;  2Y1J A;  8ICX A;  4JMU A;  1S0V A;  3KZI U;  5KFE A;  2P35 A;  4UBC A;  2QB0 A;  5KFX A;  4QWC A;  3M9M B;  1FFU A;  2L5Y A;  2MUT A;  1X42 A;  1L3U A;  4O3Q A;  1URJ A;  2ZJA A;  3AEV A;  4R8U A;  4BX9 C;  5J2K A;  3PW5 A;  1Z4N A;  3QX7 A;  2ZXH A;  3OHA A;  3FYH A;  1Z00 A;  1ZQJ A;  2JZB B;  1MC8 A;  2ZIV B;  3F2C A;  5DKW A;  4CE6 A;  2JGA A;  2KKP A;  8ICE A;  4KLS A;  4R64 A;  2H3Q A;  1L8L A;  4BJQ A;  2LYH A;  2NRZ A;  2ISP A;  3QUC A;  4FS1 A;  2H3F A;  2XIC A;  1PUZ A;  2PXI A;  4P4P A;  1NJW A;  1DOQ A;  1JXE A;  4A8E A;  8ICA A;  5AI9 A;  1UHU A;  2W7O A;  3GDX A;  3TFS A;  1QSY A;  2C2D A;  2Y0S C;  2UVW A;  1RG6 A;  5KFV A;  1Z4O A;  2W43 A;  9ICS A;  1KN5 A;  4M9L A;  1MSW D;  3AN1 A;  3IP4 B;  1XNS A;  2UVU A;  4F5Q A;  4YQW A;  1UT5 A;  2AGP A;  1PZN A;  2NRX A;  4IQU A;  5IIK A;  3PX6 A;  5AM2 A;  1F0M A;  3ED5 A;  3QZ8 A;  2C28 A;  4QZB A;  2FJ6 A;  3NVY A;  2OM6 A;  1NJX A;  4P0P A;  3TAD C;  2AH5 A;  1N48 A;  1OXJ A;  4YG2 A;  1RXV A;  5AK4 A;  3BS5 B;  5CA7 A;  4DSE A;  3RF9 A;  2WF7 A;  5AHX A;  9ICN A;  1A0P A;  3WKD A;  2EAM A;  2YMP A;  2PI4 A;  4ED2 A;  4J9Q A;  1NOM A;  4JV0 A;  3GV7 B;  5AM3 A;  2XY7 A;  4PZN A;  4QWE A;  4JV2 A;  4KX5 A;  2BCU A;  5AIA A;  5KFF A;  5EE9 A;  5ALZ A;  4UB8 U;  3IM1 A;  5DG9 A;  4J9K A;  5DBA A;  1QSS A;  1A76 A;  1S10 A;  4KLI A;  4RT2 A;  5ALJ A;  1PK3 A;  4ED8 A;  1SB3 C;  4FFD A;  5J2A A;  4I2C A;  3H8S A;  4PJ0 U;  1BPZ A;  2HSZ A;  2D6F C;  3SEN A;  3K75 D;  4DLG A;  5DB8 A;  4QZG A;  2F1I A;  5DGA A;  4DOA A;  1MA7 A;  4IRD A;  1ECW A;  4IQT A;  4M9J A;  3Q8P B;  2HCF A;  5E79 U;  2R18 A;  4Y2T A;  1Q8K A;  3GV8 B;  2K4I A;  2V4R A;  3RB6 A;  1ZQC A;  2IOF A;  3HX0 A;  2KVS A;  8ICR A;  5AKZ A;  3RJF A;  4Y2X A;  4C4S A;  2DPI A;  7ICU A;  4O9M A;  5KFH A;  4TUP A;  5HNK A;  5J2B A;  5AKH A;  3JPN A;  1JXL A;  5J0Q A;  2FLL A;  3RJK A;  4YD2 A;  1PVP A;  4C8O A;  2YQE A;  2H3V A;  3D2S A;  3ISC A;  5DB9 A;  1J2N A;  5JU5 A;  4F4K A;  4FZL A;  1ZQS A;  2F2A B;  1Z1B A;  1ZQQ A;  3V6K A;  3PX0 A;  2VIX A;  3JPP A;  4ED6 A;  4KLD A;  3MGI A;  4F4X A;  2KKV A;  9ICR A;  2YML A;  5L1I A;  5CJ7 A;  4GXK A;  3ZDC A;  3GZF A;  2KJ8 A;  3BZK A;  3QU7 A;  5TZV A;  5J0P A;  4QZD A;  4KN7 A;  3BQ2 A;  1SIJ A;  3HWT A;  4ECU A;  3FC4 A;  1GO3 F;  3MGV A;  2O6K A;  1Q3U A;  4UB1 A;  3C1Y A;  2ASD A;  1ZQM A;  3KHR A;  3TI0 A;  2W9A A;  4UW9 A;  5IIN A;  3PML A;  4YMO A;  2IOH A;  1TVA A;  4F92 B;  5G5H A;  1SV4 A;  5BPC A;  3T79 A;  4C7Z A;  4B6J A;  1Y88 A;  4FE3 A;  4KLQ A;  2AGQ A;  2WF8 A;  1L5U A;  1N5W A;  3Q8Q B;  4ECY A;  3SAH A;  2R8J A;  3I76 A;  4P0Q B;  4QZ9 A;  3H7I A;  5EE0 A;  3T5K A;  1NZB A;  2GO7 A;  1KFS A;  1T3Q A;  9ICC A;  3AMZ A;  1SKR A;  4XQ8 A;  2J6S A;  4ZOH C;  5J0X A;  2F77 X;  2ZJ8 A;  1V9P A;  3PW0 A;  3J81 j;  5L1J A;  2RHF A;  2ZXI A;  4G3I A;  4KMU A;  4M9G A;  8ICU A;  2PKE A;  5KFB A;  1SXD A;  4NLG A;  2R8K A;  1X66 A;  3OJU A;  3QYP A;  3OTQ A;  4DL2 A;  5D49 A;  2W7P A;  2ASL A;  1IM4 A;  1S9F A;  3HRD D;  1KL9 A;  5ALR A;  1NK4 A;  1C7Y A;  1JI7 A;  2BCS A;  3WKB A;  5KT2 A;  3CRX A;  3TQ1 A;  2KNJ A;  3LVV A;  1YZ7 A;  3UMG A;  2YMQ A;  1LV5 A;  5A0L A;  4PHD A;  1B4F A;  4IL6 U;  5B66 U;  3L4P A;  4CRX A;  4ED7 A;  3C23 A;  3NRZ A;  3RH5 A;  2K4P A;  1SV0 A;  2ASJ A;  1ZRM A;  4Y2S A;  4NV0 A;  7ICJ A;  1FIQ A;  1K1S A;  2XY5 A;  1Z1V A;  4FZN A;  1KW4 A;  1ZQB A;  3LWM A;  2HOF A;  3V6J A;  1KSP A;  4BXO B;  2PFO A;  2NO4 A;  2HBJ A;  2J6T A;  4P2H A;  1KKX A;  4F3O A;  5DB6 A;  3AUO A;  1S0N A;  3F5E A;  1TK0 A;  4G9B A;  3MBY A;  2HHV A;  1VJ5 A;  1O08 A;  2DUY A;  4J9O A;  3NAS A;  4RPZ A;  4ELV A;  3EPI A;  4UAS A;  1N2X A;  2YB4 A;  1KLN A;  4QZ8 A;  5ALK A;  2NO5 A;  2HVI A;  1BPE A;  4MF2 A;  1SL2 A;  3SV4 A;  8ICQ A;  2NV3 A;  4KTQ A;  3OSN A;  4JWM A;  3G6Y A;  1T8E A;  4KLO A;  3K4G A;  1K5O A;  4I2I A;  3WK9 A;  3WK4 A;  2V4Q A;  2WAQ F;  2OH2 A;  2W11 A;  2F44 A;  2XVT A;  2ODG A;  1ZQA A;  3A0B U;  3Q8K A;  4DSI A;  3KFU F;  3C21 A;  3EZ5 A;  4IQV A;  2G5I B;  1ZOL A;  8ICO A;  4ECZ A;  2WF9 A;  4MFC A;  2AQ0 A;  3UXO A;  2ZIW A;  3UXP A;  4KLU A;  4Y2U A;  1LKY B;  2HBK A;  4J9L A;  1XS9 D;  3D2Q A;  1NKB A;  2XI9 A;  3RJJ A;  2I5H A;  4PL2 A;  2JEG A;  1U9L A;  5HHH A;  4DQP A;  2G0A A;  1N62 A;  3THV A;  3FM9 A;  1B22 A;  7ICH A;  2RQ5 A;  1BPB A;  3OJS A;  1RPL A;  1N61 A;  2N1R A;  4LZG A;  7ICQ A;  5J0Y A;  4RPY A;  4TQR A;  2HHW A;  1COK A;  4EBC A;  3SMV A;  3PR5 B;  1RYR A;  3QEB Z;  1SGG A;  2F1H A;  3AM9 A;  1X9W A;  2ZG6 A;  1SV0 C;  5J0T A;  4C8K A;  3EYZ A;  3HP6 A;  2XCP A;  2DPJ A;  5ALG A;  2K4H A;  4Z6E A;  1BVS A;  2WF6 A;  4M6W B;  1M6Y A;  2M0N A;  4QJF B;  4QZC A;  2ALZ A;  1NJZ A;  4MEX A;  1F44 A;  5KTQ A;  1PK1 B;  5T14 A;  1OW5 A;  3NRW A;  4UQG A;  2GOL A;  3SAF A;  5J29 A;  5CRX A;  4UAZ A;  1CI4 A;  3H4D A;  1L3T A;  9ICM A;  4Q8E A;  2K8A A;  4C0Z A;  3IN5 A;  3PVX A;  5ALM A;  2HDO A;  3MC1 A;  5AKE A;  1TAM A;  2QB0 B;  2QAR A;  2WAQ C;  4KMO B;  4M2Y A;  4EEK A;  1U48 A;  5KFN A;  2HBL A;  3UM9 A;  4R8U B;  4NXZ A;  1J97 A;  2HOQ A;  5AK3 A;  4GFJ A;  4I27 A;  1C20 A;  3IV6 A;  3PR4 A;  3H4B A;  2FMP A;  5DQH A;  1JMS A;  4BUG A;  4QWD A;  4Y2V A;  2WTF A;  2HW3 A;  3HKZ F;  7ICF A;  4QZE A;  2E8M A;  2HHS A;  5L1M A;  2Q4T A;  2W3R A;  9ICE A;  4CNQ A;  2KOB A;  4DSK A;  3F5A A;  4NLC A;  4MEY A;  4DQR A;  4UAR A;  4LZD A;  3HT3 A;  5KFK A;  5KT5 A;  5KFM A;  1ZQU A;  2BGW A;  4AP9 A;  5ALS A;  2DF4 B;  4ED3 A;  1HEK A;  4I28 A;  1SZH A;  4NLN A;  5DDM A;  1Q3V A;  4JWN A;  1TE2 A;  4UAV A;  2D3D A;  2ESE A;  2JH7 A;  8ICJ A;  2KG5 A;  1SKW A;  4P0P B;  5IIO A;  2E8N A;  3GII A;  5HML A;  1UA0 A;  3I1Y A;  5KFG A;  3SR6 A;  3JPQ A;  2KZM A;  2LYB A;  5BOL A;  5J2H A;  3RB0 A;  5III A;  4AYB F;  4F91 B;  3C2K A;  4F71 A;  2NYV A;  4QZF A;  1ZJM A;  3GV5 B;  2ZTC A;  1JN3 A;  4NWI A;  2YB1 A;  3SYZ A;  4DQS A;  4EEY A;  4F8R A;  2FE9 A;  3V7L A;  5KT6 A;  4E0D A;  3D6J A;  3PO5 A;  4HAI A;  1BNP A;  7ICO A;  1V85 A;  2BPF A;  3H8J A;  1XSL A;  3JPS A;  4ED0 A;  2QB1 A;  7ICS A;  3C2L A;  3MR5 A;  1L3S A;  3DEE A;  1UT8 A;  4JUZ A;  8ICK A;  2Y9T A;  3NVV A;  2KFN A;  4JV1 A;  4J9M A;  2JEJ A;  3HKZ C;  3V72 A;  5AKX A;  1ZQK A;  4M04 A;  4O5K A;  3RFA A;  5CHG A;  2KIV A;  2YMM A;  4CF3 A;  2BZF A;  4DFK A;  1L7N A;  2FMQ A;  2AU0 A;  2FPL A;  4UAU A;  4B9T A;  1QH9 A;  1TAU A;  1QCK A;  2W04 A;  4ELT A;  4NLZ A;  3ZD9 A;  2G07 A;  3MDC A;  4J03 A;  3TFR A;  1ARO P;  3VCB A;  2WFA A;  3QZ7 A;  1ZQI A;  2ATL A;  9ICB A;  3PSP A;  4ACO A;  2LM1 A;  5AI0 A;  8ICW A;  1ZQL A;  3PY8 A;  4BGD A;  2JMG A;  1ZXI A;  5AKJ A;  1ZQH A;  4RUA A;  2OHF A;  4DS5 A;  3C1Z A;  4AYB C;  4ECW A;  9ICV A;  4C4R A;  4C7Y A;  2G06 A;  1HJP A;  1RYU A;  4F5O A;  1QQ5 A;  4JB3 A;  9ICQ A;  1YT3 A;  2KP7 A;  1UQV A;  2E8O A;  2F8L A;  2BHN A;  1ZD4 A;  3M8S A;  2XGP A;  3WK6 A;  2OCE A;  2PI5 A;  4PHE A;  2IHM A;  1JX4 A;  3H0R B;  4Z6D A;  1XWL A;  1X9S A;  4UB5 A;  5IIJ A;  2C2R A;  5AI6 A;  1FFV A;  1NK6 A;  1JRP A;  4Y2R A;  4NJ8 A;  3IRU A;  4PZO A;  2HBM A;  1MQ3 A;  2P66 A;  1SL1 A;  2OXO A;  5KFR A;  4ECS A;  9ICA A;  5J2J A;  4KLF A;  5ALU A;  4O3P A;  3A0H U;  5JRT A;  5AI4 A;  3QU9 A;  2MAX A;  4GXJ A;  1JUD A;  9ICO A;  2LPE A;  2FLP A;  4M9N A;  4MFF A;  7ICI A;  4U6P A;  4DOC A;  1WCL A;  1L7M A;  4LJX A;  1WUD A;  3ZDD A;  5KT3 A;  1U45 A;  1NK8 A;  5KFP A;  4B9L A;  4Q45 A;  9ICH A;  1X6I A;  5BOM A;  3Q8S B;  1PVQ A;  1NKC A;  1PVR A;  3BDP A;  3R9K A;  2CPR A;  2DKZ A;  3UMB A;  1ZJN A;  8ICF A;  2OYY A;  4KLT A;  3DDH A;  2EAP A;  3B0Y A;  2VJ5 A;  4EX7 A;  2E1E A;  2JXJ A;  1JIH A;  5KG6 A;  4HYK A;  7ICP A;  2EH9 A;  2K8B B;  1ZQY A;  1ZRN A;  3MFI A;  5AKI A;  5DLF A;  3WKE A;  3L3F X;  1A77 A;  1XC9 A;  2A3V A;  4M0A A;  5DQI A;  4P4M A;  4O5E A;  4F50 A;  1NK0 A;  5L1L A;  2R8H A;  4TUS A;  4UB2 A;  2MA1 A;  4DL4 A;  2BCR A;  5AM1 A;  5AKG A;  2HVH A;  1ZD5 A;  2B0C A;  4RNM A;  1EXN A;  3G6V A;  3UMC A;  1Z19 A;  3ETR A;  4CF5 A;  5CWR A;  4IR1 A;  4DL5 A;  4R63 A;  1NK9 A;  2G09 A;  4DO9 A;  2XGQ A;  4PHA A;  4ELU A;  2HHT A;  4GC7 A;  3MR6 A;  2V9W A;  3AQF A;  5C0Y A;  4XRH A;  2KMD A;  3M1Y A;  5F9N A;  2PFQ A;  5KG1 A;  4GLX A;  5DG7 A;  4EZ9 A;  4BDP A;  1SWV A;  3ICX A;  5KFC A;  5C5J A;  3BJY A;  4PPX A;  2K89 A;  2ZUD A;  3KD3 A;  5ALL A;  3MGH A;  2CXY A;  4F72 A;  4DSL A;  2KJ9 A;  2A1A A;  4R65 A;  1ZQO A;  8ICV A;  3RJE A;  7ICK A;  4USA A;  1X9M A;  2PFP A;  3BQ7 A;  2E5S A;  1XO0 A;  3OGU A;  2ZTD A;  4ECV A;  5ALP A;  3RJG A;  3PW4 A;  2IOF K;  3KHL A;  3H8M A;  4RQ0 A;  4KX3 A;  3UXN A;  7ICG A;  4JK1 A;  5AI5 A;  2EZZ A;  5KG2 A;  2HMX A;  4ED1 A;  1N60 A;  4I2H A;  4Y2Q A;  5JTI A;  1L8O A;  2GLE A;  4QWA A;  4QIW F;  5J0W A;  2KVC A;  3RB3 A;  4RQN A;  2BQR A;  3UQ2 A;  3QXG A;  4YXJ A;  3U26 A;  1ZQZ A;  2KIW A;  4Q8F A;  2ZIU A;  2G5H B;  2KSO A;  2VKQ A;  3WK5 A;  4J9N A;  3CW2 C;  2W9C B;  3F2D A;  1TK8 A;  2OWO A;  7ICL A;  5K4L A;  8ICL A;  2LM4 A;  4O3N A;  5ALI A;  2NRW A;  3O0F A;  3KOO A;  4PL1 A;  1RM6 C;  5KT7 A;  3TAN A;  2IBK A;  1NJY A;  2QKQ A;  1SXE A;  4I2A A;  3PST A;  3KHG A;  4EX6 A;  1T3N A;  2YX8 A;  4UB6 U;  3V6H A;  1U4B A;  1D9D A;  4Y2J A;  5H2F U;  9ICG A;  2JHD A;  3F53 A;  1D8L A;  2OEH A;  3N28 A;  4DF8 A;  3ZDA A;  1ZQT A;  4TUQ A;  4C8L A;  4XUS A;  4DFP A;  1P7D A;  5JUM A;  2NRT A;  3WKC A;  3D2N A;  4FO6 A;  2QAR B;  2MRL A;  3AQE A;  9ICW A;  3TAR A;  2BR0 A;  1ZQW A;  4WJ3 B;  2Y9U A;  5ALN A;  3M8R A;  4Y2Y A;  1L7O A;  1S8O A;  5ALW A;  1XSP A;  5HHI A;  5EWG A;  1S0O A;  3LYS A;  1LB2 B;  1T7P A;  1KQQ A;  3N7S C;  2KK0 A;  4GIB A;  1ZYQ A;  1HIW A;  2KFZ A;  3E0F A;  3KTQ A;  1L6N A;  4US8 A;  3L5K A;  4DL7 A;  4QIW C;  1S77 D;  1V38 A;  2AXT U;  1RDF A;  3M6K A;  2VA3 A;  3QEA Z;  1S5L U;  2HHX A;  4YCX A;  3RJI A;  9ICT A;  2Z7J A;  5KFT A;  2RDJ A;  4KIT B;  2K60 A;  2AJQ A;  3CP8 A;  3BQ1 A;  1WCN A;  1RZT A;  2P6U A;  2DFL A;  3AU6 A;  4K4G A;  4OJP A;  3JPO A;  1VLB A;  1DK2 A;  2LI6 A;  2H3Z A;  4DL6 A;  3T5J A;  5KFS A;  4BWJ A;  3MFH A;  1BPY A;  3RJH A;  5KG7 A;  3V7J A;  1NK7 A;  3VC8 A;  3GIM A;  4DLE A;  2W8L A;  4F5P A;  4DS4 A;  3GIL A;  2MUT B;  4EZ6 A;  2BQU A;  1OUQ A;  1UCV A;  5ALO A;  1RQN A;  5KT4 A;  2A1J A;  2HHU A;  2W9B A;  5HR7 A;  2BPG A;  1U49 A;  1Z00 B;  1MN8 A;  1ZQV A;  3PX4 A;  4EYH B;  2E3T A;  1DXS A;  3TAP A;  2K8C B;  1X6J A;  5L1K A;  4C4T A;  1ZQP A;  4O0I A;  2BPC A;  5J2E A;  4TQS A;  5KG0 A;  4MHV A;  3PO4 A;  3RR8 A;  4B9N A;  2EQY A;  2ZIX A;  2W3S A;  2DQN B;  3PSF A;  4RUC A;  4Y2P A;  4RQ6 A;  4C8N A;  4I2J A;  5KG5 A;  3GIK A;  9ICI A;  4C8M A;  2R8I A;  4RQ8 A;  4XA5 A;  3ZI4 A;  1DRG A;  2XO7 A;  4F4Y A;  4DOB A;  3EUB 2;  3QU2 A;  2VJ4 A;  4K4H A;  2UVV A;  3KHH A;  3Q8L A;  3NUQ A;  5J8Y A;  2FPK A;  2LYA A;  3SV3 A;  1N56 A;  3T3F A;  1KFT A;  4RU9 A;  1O03 A;  4YR3 A;  2WHE A;  4O3R A;  3GQC A;  3PW7 A;  2BDP A;  4EYI B;  2BDU A;  3M6Z A;  5KAF U;  3CYM A;  5EWE A;  4ECT A;  3NVW A;  2JEI A;  5J0U A;  3ZDB A;  4ECQ A;  1N63 A;  2AHO B;  1QSL A;  2LHT A;  2PFN A;  2LBO A;  2LMR A;  3BQ0 A;  2JV3 A;  4OJ6 A;  4PGX A;  2MU2 A;  4YFK A;  2ES6 A;  2GWS A;  2EAO A;  2D8C A;  1QLN A;  1LVH A;  3GIJ A;  3C28 A;  1WWV A;  5FP0 A;  1XO1 A;  3HJE A;  5L9X A;  3HW8 A;  3C5G A;  8ICT A;  4KLJ A;  4M47 A;  4IRC A;  3GU3 A;  2XID A;  3BZC A;  5KG3 A;  2PMZ F;  3FDS A;  3B9J A;  5KFA A;  1ZQD A;  4QW9 A;  3AU2 A;  4DFJ A;  4I2F A;  7ICE A;  3K1Z A;  3H40 A;  2W55 A;  4DFD A;  8ICS A;  5CEH A;  4MF8 A;  4FS2 A;  3RBE A;  4NY8 A;  4DQI A;  5F3X B;  3KKA A;  5DDY A;  5HR6 A;  3TAQ A;  7ICN A;  4YR0 A;  4RNN A;  4B9U A;  4P4O A;  4CDG A;  4OJO A;  3ISB A;  1SKS A;  2W8K A;  5KFD A;  5AKY A;  4NM2 A;  3SZ2 A;  5ALX A;  5KAI U;  2HI0 A;  3H8W A;  5EOZ A;  5AKK A;  5DB7 A;  1QQ7 A;  4M9H A;  4DQQ A;  5AK5 A;  3MR2 A;  4RQM A;  5ALF A;  2KZ3 A;  1H38 A;  1BPX A;  3TAC B;  5J8Y C;  2F1J A;  5DBC A;  4PGY A;  4B9V A;  5G5G A;  4KLG A;  8ICN A;  3IDW A;  3OPX A;  5J2I A;  4UAW A;  5ALT A;  3AL0 B;  5DGB A;  2CRX A;  2JZB A;  1B43 A;  2ZIV A;  1ZQN A;  3C29 A;  3NS1 A;  4YN4 A;  4QZI A;  1MQ2 A;  3IHQ B;  4NM1 A;  4EEN A;  8ICG A;  2IHN A;  3RRH A;  3M9N B;  5AIC A;  4O5C A;  4RQ7 A;  1ZQX A;  1AQ6 A;  5ALV A;  1KTQ A;  4O3M A;  3NVZ A;  2AQ4 A;  4DWI A;  5D4B A;  4RPX A;  4DFM A;  3N4M B;  1RQL A;  4PHP A;  4F93 B;  3IG5 A;  9ICP A;  1ZQR A;  4DL3 A;  1NI3 A;  2H5X A;  3UQ0 A;  2PMZ C;  3EW9 A;  4UB4 A;  5J2F A;  2UVR A;  2I6X A;  5KFJ A;  3KZX A;  8ICB A;  1NK5 A;  4UB3 A;  3LK9 A;  4I2D A;  3Q8R B;  2DL0 A;  5IIM A;  1TK5 A;  2ZJ5 A;  1V97 A;  3K1R B;  4F4W A;  3N97 B;  2VAN A;  3BS5 A;  3RR7 A;  2FI1 A;  4B9S A;  2W03 A;  2H3I A;  2W54 A;  4RNO A;  2E1F A;  4NL9 A;  3N7R C;  5ALQ A;  1CEZ A;  1SWW A;  2DKX A;  4K4I A;  4KLH A;  2KZZ A;  9ICK A;  8ICZ A;  7ICV A;  5J0R A;  8ICI A;  1CUK A;  1D9F A;  3KKA C;  3ONN A;  5KL8 B;  2YTU A;  4EBD A;  3QUT A;  1ZQF A;  7ICT A;  4F5R A;  1K1Q A;  4I2G A;  9ICU A;  2ZUC A;  5AM0 A;  3ORY A;  4KLE A;  5D46 A;  2IA6 A; 
#chains in the Genus database with same CATH homology
 3TAD C;  2Y9T A;  2JV3 A;  1OXJ A;  1PK1 A;  1JI7 A;  2QKQ A;  1SXE A;  2ES6 A;  3BS5 B;  2E8M A;  2B6G A;  5L1M A;  2KIV A;  2EAO A;  2D8C A;  4NJ8 A;  2EAM A;  1UCV A;  1LKY B;  1B4F A;  2KMD A;  4PZO A;  1WWU A;  1WWV A;  2K4P A;  1SV0 A;  4PZN A;  1X9X A;  5JRT A;  1Z1V A;  1SV4 A;  1KW4 A;  1COK A;  2QB0 A;  1X40 A;  2KSO B;  2QAR B;  1DXS A;  2F3N A;  2L5Y A;  2LPE A;  1SGG A;  1SV0 C;  5KNI A;  1PK3 A;  4IS7 A;  2Y9U A;  3BQ7 A;  4MHV A;  2D3D A;  2ESE A;  1B0X A;  2DL0 A;  2KG5 A;  3SEN A;  2E8N A;  1PK1 B;  3K1R B;  3H8M A;  5F3X B;  3BS5 A;  1OW5 A;  3KKA A;  2KE7 A;  2E8P A;  2EAN A;  2DKZ A;  1LKY A;  5JTI A;  3HIL A;  2EAP A;  2GLE A;  4NL9 A;  2F8K A;  2DKX A;  5J8Y A;  1V38 A;  3SEI A;  4RQN A;  3KKA C;  1RG6 A;  1UQV A;  2E8O A;  2FE9 A;  2YTU A;  2QB0 B;  3TAD A;  1SXD A;  2KSO A;  4RQM A;  2QAR A;  3BS7 A;  4NL9 C;  3TAC B;  2F44 A;  1V85 A;  2K60 A;  5J8Y C;  1X66 A;  2QB1 A;  3IDW A;  5JU5 A;  1F0M A;  2LMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...