3K1RB

Structure of harmonin npdz1 in complex with the sam-pbm of sans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
ETSPLETFLASLHMEDFAALLRQEKIDLEALMLCSDLDLRSISVPLGPREKILGAVRRRRQAMERPPALEDTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the harmonin/sans complex reveals an unexpected interaction mode of the two Usher syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Harmonin
total genus 23
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3k1rB00
2KIVA 2F3NA 5JRTA 3BS5A 1SXEA 1SXDA 1JI7A 2QARA 1F0MA 2F44A 2JV3A 2D8CA 1PK3A 5J8YA 2GLEA 1X40A 2Y9TA 4IS7A 2QKQA 2DKXA 2ES6A 1OW5A 1WWVA 2E8PA 1SV0C 1SV0A 3K1RB 3BQ7A 1V85A 4RQNA 2QB1A 3SEIA 1LKYA 4NL9C 2KMDA 2DKZA 1X66A 2Y9UA 1SGGA 3KKAC 5F3XB 2YTUA 4PZOA 1KW4A 1B4FA 2D3DA 5J8YC 1PK1B 4NL9A 1WWUA 2QB0A 1OXJA 2LMRA 2F8KA 2E8NA 1LKYB 2E8OA 1PK1A 3TACB 3H8MA 3BS7A 2B6GA 1B0XA 2KSOB 2E8MA 2LPEA 2EAPA 5JU5A 1SV4A 2EANA 2EAMA 3IDWA 5JTIA 2KE7A 2QARB 3HILA 2FE9A 2KG5A 1V38A 1RG6A 1UQVA 2QB0B 4MHVA 3KKAA 3BS5B 2ESEA 2L5YA 2EAOA 1UCVA 2K60A 2KSOA 1Z1VA 1X9XA 1COKA 4NJ8A 2K4PA 4RQMA 3TADC 3TADA 5KNIA 4PZNA 3SENA 1DXSA 2DL0A 5L1MA
chains in the Genus database with same CATH superfamily
3UMCA 2V4RA 1ZQJA 4KMOB 3BS5A 5AK6A 3CP8A 9ICRA 3WKAA 1MN8A 4RZRA 5DB7A 4FS2A 4DLGA 1N56A 4DF4A 2D8CA 3L5KA 1DK2A 5DG7A 4GXKA 9ICCA 2FJ6A 4J9QA 4DL6A 5B66U 2XCPA 3PSIA 1V85A 3LYSA 5J0YA 4UAUA 1Z1BA 3V7JA 4RQ8A 3ORYA 2K8CB 3GDXA 5ALRA 3KKAC 5F3XB 4I28A 1X6IA 2K8BB 4R8UA 4Y2VA 4RQ1A 1A6SA 1JUDA 9ICJA 2ZUCA 3QU2A 4F8RA 5EE9A 1L7NA 5KG2A 3UXPA 4RPZA 1PVRA 2LI6A 4DQQA 8ICOA 2KSOB 3BQ2A 3H4DA 1BNPA 2LPEA 5IIJA 2MRLA 2FI1A 1TK8A 3IDWA 5IIOA 5JUMA 4J9RA 4Y2RA 4QWDA 1NJXA 1ZQXA 3EYZA 7ICVA 2F2AB 3K4GA 1T8EA 5KFIA 1RYRA 5BOLA 3JPTA 2FE9A 2RQ5A 2ZTDA 3SAFA 2UVRA 4CGZA 2BCRA 5KFPA 1XC9A 5KFQA 2O6KA 1X9MA 1QCKA 4IRCA 7ICFA 3H8SA 3RR7A 3GZFA 5CWRA 3UMGA 1NZPA 3KZXA 2MUTA 4Z6DA 3PW5A 8ICEA 4UB3A 4YMOA 4I2DA 2BCSA 4G3IA 4ED2A 4FZLA 5L1KA 4YCXA 3HRDD 2JEGA 3FDSA 2Q0ZX 4Q44A 1TAMA 2OHFA 3MGHA 9ICKA 3MR3A 3I28A 2D6FC 5KG3A 2OM6A 1L8LA 5J0XA 3RFAA 7ICEA 1L7OA 5AI9A 2IOFA 3RH4A 7ICIA 2IOHA 2W3SA 4KLEA 5J0OA 4KLLA 2XI9A 1D8YA 4EEYA 1XSLA 3E2EA 4ECYA 1WYGA 2PFNA 2HW3A 1KW4A 4DQIA 1UT5A 2KZ3A 4C7ZA 1ZQYA 2VIXA 1ZQCA 2MSNA 1WWUA 3PW2A 5ALQA 4PHDA 1Q8KA 1S0OA 3IG5A 9ICXA 4F92B 3H8JA 1ZQIA 2ZIUB 2EAMA 2FLLA 5HNKA 4QJFB 5KFTA 4FZNA 4B9NA 4O3PA 3V6HA 2KG5A 5DQHA 4XRHA 4ED3A 1V38A 2JH1A 4R63A 5AKLA 3WU2U 1U49A 1T4GA 4UB1A 4J9KA 3UQ0A 5HHHA 1TK5A 1X6JA 3C2LA 2ZIVB 4EX7A 1L3UA 2KSOA 4QNLA 2E1FA 2C22A 1X2IA 5AM2A 4Y2PA 2H5XA 4EEKA 3TFSA 4PZNA 3UPQA 5AKHA 2A19A 2EQYA 1L6NA 4MFCA 5J0PA 4PHAA 3RB6A 4YR0A 3OJUA 4MEXA 4FZMA 1U9LA 3Q8QB 8ICLA 5KG1A 3ED5A 4YP3A 2RDJA 4CF5A 3RB0A 4I27A 5DG8A 1SV0C 4CCHA 3H0MB 1UHUA 2MU2A 1FFUA 1LB2B 2ZTEA 3NUQA 4YD1A 4BX9C 2KEYA 8ICCA 3MDCA 2UVWA 3S6JA 5G5GA 4B9VA 3M6ZA 4F5QA 3RB4A 2Y9UA 1ZQMA 2B0CA 1L7PA 1ZQEA 1T7PA 4OJLA 5HMMA 3C1ZA 1KSPA 1A77A 1S5LU 4NXZA 3JPNA 4FE3A 5ALPA 1BPBA 1ZJNA 4EENA 2KK0A 1TKDA 2HHTA 1Z4NA 4ZH4A 4QW8A 4KLJA 4O3SA 3C29A 4RQ3A 4RT3A 3A0HU 4UB5A 4O3MA 3ZDDA 4M9GA 1ZQWA 2ISOA 3SQIA 2ZIXB 5IIMA 5JTIA 1S8OA 2J6UA 2PMZC 5KFHA 4P0PB 1IG6A 5ALGA 2KICA 4OO1J 3PSPA 4O5KA 3GIIA 4Q8EA 4DL2A 4QWAA 5DB6A 3MR5A 2XY6A 1Z19A 2FLPA 4OJOA 2KIWA 3MABA 1X9XA 4QZDA 1QLNA 3RH5A 2FMPA 1JXLA 2JMGA 3THVA 2KIVA 5DBAA 3FYHA 4IRKA 5KT2A 3B0YA 3QZ7A 2MAXA 5AM3A 1BVSA 2PI4A 4OJPA 3LDAA 4KX3A 4JV1A 1ZD3A 2NYVA 4O3OA 5EE0A 2DKXA 5IIKA 2G5HB 2ZIVA 3NVYA 1F44A 5AKXA 4CF4A 4ELVA 2KJ5A 2F1HA 4DSLA 1UA0A 4YD2A 4F2RA 3AU6A 4NWIA 9ICPA 8ICIA 4XQ8A 4NM2A 2KMDA 4QIWC 2W8LA 5IILA 3LWMA 4C4SA 4KLQA 2H3VA 4TURA 1QSSA 4MF2A 4F5NA 9ICOA 4AP9A 2KHVA 2GOLA 4F4KA 4IC9A 2FPLA 3BJYA 1LKYB 4GFJA 5HP4A 1ZQLA 3HX0A 8ICXA 2EZYA 2WF8A 3OTQA 2KVSA 5EWEA 3QU9A 7ICUA 3UM9A 4FS1A 2F8LA 4DOBA 3IG8A 4F93B 4NY8A 4DF8A 2Y1IA 2CPRA 4QZCA 4QZIA 4XA5A 5DKWA 2OH2A 4DFPA 4YFKA 1Z3EB 2A1JA 1Z4OA 1FFVA 3WK6A 3C5GA 1EXNA 1KQQA 2HHSA 4NJ8A 5L1JA 2VA8A 5KNIA 3QU7A 9ICVA 2KVCA 2ZJAA 4KLHA 4DSJA 4F4ZA 1T3QA 1TVAA 2KV2A 1AQ6A 1DGSA 4QWBA 4F4XA 4DEZA 3F5EA 4M9NA 3GV5B 5J2HA 2P6RA 3F5AA 3ZD8A 4PGQA 1N61A 1B43A 1YT3A 3T5HA 4EBDA 2ZUBA 1SL0A 4JMUA 4RQ6A 4B9LA 5DB8A 2G06A 3QZ8A 3CYMA 4R64A 4CF3A 1XSNA 2G07A 4F91B 2XCAA 3RJEA 2W9CA 2ISPA 2W9MA 1WG8A 3E0FA 2FMSA 1WUDA 4GC7A 1ZQBA 1S0VA 1KKXA 5J2JA 3TAQA 5KFDA 4OJ6A 1YZ6A 3V7KA 5B5EU 2E8NA 3DEEA 5KFFA 1ZQGA 2WAQF 8ICTA 3QNMA 3FM9A 2H3FA 2R8HA 2IHNA 8ICWA 3D2SA 2PFPA 3PX6A 2I5HA 3VC8A 5ALTA 1CEZA 1KN5A 1KBUA 3SV3A 3F2CA 5EWGA 2FMQA 5ALXA 2LM4A 5AKEA 3QX7A 2H3QA 2V4QA 1V97A 2ZIWB 1D9DA 3DDHA 1PVPA 4JV2A 2BPFA 2WB1F 1Z1VA 1UPHA 4MF8A 2HHQA 2I1QA 5J0TA 7ICMA 4DOCA 4DLEA 3QU4A 4RU9A 3KHLA 5J0QA 1PK3A 4ED1A 1S10A 5JRTA 1C20A 3NS1A 4NM1A 4ACOA 4Q8FA 4RQ7A 3MR6A 1JXEA 4DQSA 1RZTA 2OEHA 2UVUA 5E79U 2XO7A 4B9UA 1DK3A 3WK4A 5TISU 2ES6A 4KLMA 9ICIA 1U45A 4DL7A 4GXIA 2HDOA 3GV7B 1SV0A 1KRPA 4RT2A 4BXOB 4DL5A 4Q45A 2W11A 1JROA 2FDRA 4DOAA 3TI0A 1NJWA 3TFRA 2GWSA 4NLCA 3T79A 2HVIA 3BQ0A 2KD1A 4Y2JA 5J0UA 3Q8LA 5KFWA 2WFAA 4KLDA 2WTFA 4DFDA 4UATA 3WK7A 2R18A 4RNOA 1IM4A 2C2DA 5AIBA 5HR7A 7ICKA 4RPYA 5KFAA 2K8AA 5KT5A 2XICA 4P0PA 4UAYA 3BZKA 1D8LA 4KLUA 5J2KA 1XS9D 4UB2A 1NK6A 4PHPA 1ZQRA 3LVWA 5T14A 3Q8KA 3PW0A 4Y2TA 1X9SA 4UAVA 2PFOA 5KT7A 2LKYA 5D46A 2CXYA 2ASDA 3ZDAA 1KFSA 4XUSA 2RDIA 3QU5A 1SWVA 1KTQA 2RHFA 3WKDA 5ALKA 4Z6FA 1N60A 2HBMA 3ZDEA 2ESEA 3SD7A 5KG6A 1ZQAA 1P7DA 1XSPA 4EZ9A 2ZXHA 4KLFA 4DSEA 1K1QA 3RBEA 3KHGA 3KD3A 4ECVA 3M8RA 2NV3A 3G6XA 4MFFA 3RJFA 3WK8A 2EZXA 5J0WA 1U4BA 1SXEA 4C8NA 1JI7A 2F44A 4YMNA 3MBYA 1ZQ1C 2Y9TA 2LM1A 4IS7A 2HOFA 2ZJ8A 1ZJMA 5EOZA 2YMMA 4F3OA 4QZFA 1RYUA 5ALOA 2Y0SC 2BCQA 1S9FA 4RQ4A 3LWLA 3SR6A 4O3NA 1SZHA 2H3IA 4UB4A 2ZTCA 1RQLA 2ODGA 4QZEA 3EPIA 2M9NA 5J29A 2KZMA 5ALHA 2K89A 3H8WA 3M1YA 1TFRA 3V7LA 1NK7A 4KITB 1JMSA 4I2JA 2VJ5A 5TZVA 4Y2UA 1ZQNA 2HHUA 2W04A 5KG0A 1PK1A 4EX6A 5C0YA 5AKJA 4RNNA 1QTMA 4MFAA 1IIPA 3KHHA 3PMNA 2ZUDA 4IRDA 2RP5A 3ETLA 9ICFA 3HILA 1N5WA 2HHVA 5KFGA 2QB0B 5ALFA 3CRXA 3HT3A 3EW9A 5CHGA 1BPYA 1K1SA 2W3RA 4DL4A 3ZDCA 2K60A 4KX5A 1FEZA 3ZD9A 4UAWA 3RRGA 5ALIA 1U48A 5CB1A 1ZQZA 3SAGA 3PNCA 4O9MA 1XNSA 2ALZA 4M0AA 4IQVA 4I2CA 2BKEA 1ZETA 3OSPA 1ZQHA 3AMZA 2VJ4A 3R9KA 3BQTA 2EDUA 4IR1A 4R65A 8ICHA 4M6WB 4NLBA 1TAUA 4UQGA 3EZ5A 4J03A 4PL1A 3PO5A 2OCEA 4ED8A 1ZD5A 3AUOA 7ICNA 3C23A 1SZPA 2DPJA 2QB1A 5EE1A 2VANA 3CNHA 2WF6A 1S0MA 7ICGA 2VKQA 4OCZA 3ZI4A 4LZDA 2I6XA 2MUTB 3KTQA 4Y2XA 1X42A 2ASLA 4PGXA 2VA2A 1ZRMA 1B4FA 3IRUA 4JUZA 2KFZA 4QZBA 3GIKA 3RJJA 3MGVA 3EPGA 4C0ZA 4P4MA 5F9LA 2KJ8A 3SI8A 2EZZA 9ICEA 5DG9A 2YMPA 4O3QA 1U47A 4R66A 4J9LA 4DQRA 5KG5A 3OJSA 2F76X 2BR0A 5AKZA 4U6PA 3QEBZ 3JPOA 2JR5A 3NRZA 2BPCA 2KE7A 4F72A 3T3FA 4B9MA 4RUCA 1ZQFA 5J2GA 3F2BA 5KFYA 5A0LA 3PMLA 8ICYA 3MFIA 2G08A 4RQ5A 9ICWA 3PV8A 3M9NB 4QZAA 1KFDA 4YMMA 3C2MA 2C2RA 2K4HA 4JWMA 1F0MA 2XGPA 4U7CA 3BQ1A 3L4PA 8ICKA 4J9MA 3KFUF 4ICAA 1N5XA 5D49A 2KP7A 5CR0A 2AJQA 4RQNA 2DF4B 3PR4A 4WJ3B 2BQUA 3DV9A 9ICAA 4DSKA 1RXWA 5J0RA 1NK4A 4F2SA 3OHAA 1ECWA 4QW9A 3ISBA 2NO5A 1SGGA 4JK1A 4LZGA 1IV8A 3WKCA 1PZNA 1N48A 3PX4A 1ZYQA 1ZQKA 3SYZA 2DFLA 4Z6EA 4I29A 3UQ2A 2VA3A 3BS7A 3UMBA 2IMWP 1NK8A 4KLTA 1FO4A 1LVHA 4IQTA 1S77D 3CW2C 5KFXA 4F4WA 4ECWA 3Q8RB 3NGDA 4C8OA 4OJ5A 1VJ5A 8ICZA 2JRZA 5ALDA 1SKSA 1BPZA 5L9XA 4C80A 4I2BA 2RRDA 3V6KA 3M8SA 3KKAA 4DL3A 1ZQSA 3MGIA 4GLXA 1UCVA 2E1EA 2FLNA 4MEYA 5J2FA 2W9AA 3MFHA 3MC1A 4RPXA 4PPXA 1ZQQA 1NZBA 4P4OA 5KFCA 2E3TA 4BWJA 3ICXA 3HPOA 2LHTA 3E58A 2PKEA 2AQ4A 1HJPA 2KTQA 4M9JA 1N62A 5KFBA 3Q8SB 3GQCA 4CE6A 3WK9A 1TAQA 2XGQA 3NRWA 3MR2A 8ICBA 2W54A 1MSWD 2FPMA 3RF9A 4G9BA 3SEIA 4QZ9A 1NKEA 2BHNA 4EELA 1BPEA 4B9SA 1QH9A 4LVSA 3B9JA 4OD0A 4QIWF 4UB6U 4EBEA 3PSFA 1KDHA 4A8EA 5KFEA 2OXOA 7ICSA 5DDYA 1X9WA 1L3TA 2IBKA 5KTQA 4NL9A 1BPDA 3AU2A 2DQNB 4I2EA 2FPKA 2DWQA 3N28A 4NV0A 4P2HA 1J97A 5ALYA 5AK3A 2B6GA 7ICLA 2QLTA 3M7DA 5JU5A 4C8KA 1Q3VA 4FFDA 3SZ2A 2MA1A 4ED0A 4YR3A 1HUOA 2ATLA 2IOFK 1UQVA 3BDPA 4P4PA 9ICLA 5DB9A 1ZD4A 4I2AA 5EWFA 3PZPA 4O3RA 1NNLA 3KOOA 4Y2QA 2WB1C 1KEJA 3QUCA 4K4GA 4K4IA 2HBKA 3J81j 4USAA 4RQMA 3SMVA 9ICHA 1TK0A 5CEHA 2Z7JA 2KNJA 4DQPA 4DCCA 4DSIA 1JRPA 2F77X 3RBDA 1Z00B 2WF5A 5ALSA 4F5OA 1SXDA 3AQFA 2QARA 2ZJ5A 2AGPA 3K1ZA 3PVXA 1T94A 3Q8PB 2QKQA 2W7PA 4F4YA 5DDMA 1BGXT 1IXRA 3K75D 3N97B 3OPXA 3NVWA 5AIAA 5ALVA 1MC8A 5DQIA 3L3FX 1LV5A 4GXJA 4CDGA 2WF7A 5KFZA 4ECZA 3HJEA 3V6JA 5KT3A 3TKAA 3HWTA 4BUGA 2G5IB 1B22A 3C21A 2XY5A 1NJZA 1KFTA 1L7MA 3OHBA 2HOQA 1ZQDA 5AK4A 5L1IA 4IR9A 1O03A 4KMUA 1KL9A 4P0QA 3KBBA 1N2XA 2HMXA 1L3SA 2BCVA 5AI4A 4RQ0A 2JH7A 3NASA 2HBLA 4NLKA 4IQUA 2EANA 1FIQA 5HMLA 5KFKA 1HEKA 4C7YA 1CRXA 2AXTU 1S0NA 5CP2A 2C2EA 1JN3A 2XIDA 3T5JA 2NRTA 4DSFA 5KFVA 1UT8A 5BOMA 1WCLA 3QXGA 3HW8A 3H40A 2J6TA 3BS5B 5L1LA 3JPPA 2IHMA 4DFJA 2EAOA 4GIBA 5KFMA 4CNQA 2YB4A 2W7OA 3PX0A 2NRVA 5CA7A 5AM4A 3TADC 2R8JA 2JXJA 1V9PA 5D4BA 5KT4A 3AQEA 5AI5A 3ETRA 4ELTA 1PUZA 4YXMA 2P66A 1X40A 5KAFU 2BGWA 4YN4A 2WHEA 3LVVA 5AI8A 3H4BA 4UBBA 4J9NA 2DUYA 4QWCA 4B9TA 5AM0A 1TE2A 3QUBA 2R8KA 5ALZA 3ISCA 1BPXA 1DRGA 1LKYA 4QZ8A 2JEJA 1NI3A 4F50A 1Q3UA 1XWLA 4Z6CA 4NL9C 3WKEA 4YR2A 2I9GA 1WCNA 4ECQA 4B6JA 2G09A 5AK5A 2D3DA 5J8YC 1AROP 1PK1B 5KFLA 3U26A 3SV4A 5IINA 2AGOA 1RXVA 2PI5A 7ICTA 2W03A 1OXJA 4RQ2A 5ALLA 2F8KA 3C1YA 1VLBA 3TACB 2KZZA 4F5PA 2E8MA 2KFNA 3PR5B 1N63A 2P35A 3GU3A 3OSNA 4EBCA 1COOA 3TANA 2A3VA 5ALWA 3C5FA 3B0XA 2OYYA 3MDAA 1RG6A 2ZG6A 4MHVA 2Y1JA 1L8OA 1Z00A 1ZQTA 1RYSA 2L5YA 3AM9A 3AEVA 4PJ0U 5KFOA 4HAIA 1TV9A 4QZHA 5AKYA 1QSLA 4UB8U 8ICVA 3IV6A 2HVHA 3EUB2 3QE9Y 2K4PA 1ZQOA 1NJYA 4IQWA 8ICSA 3SENA 3F2DA 4M6WA 4LJXA 1C7YA 1ZXIA 2F3NA 2PMZF 3M9OB 3M9MB 1Y88A 4O0IA 2R8IA 8ICPA 5J8YA 4O5EA 4ECTA 3RAXA 8ICRA 5IIIA 8ICUA 3KHRA 1WWVA 1L5UA 2HHXA 5AKKA 2JHDA 3RTVA 7ICRA 3O0FA 2AHOB 2W43A 2Y0SF 4Y2SA 2W9BB 5J0SA 4M9LA 3HKZC 4J9SA 4ED7A 2H3ZA 4PGYA 4M04A 4P0QB 2F1IA 2EH9A 3RJGA 1S97A 3EWAA 4CRXA 3GILA 2LBOA 4KLIA 1RDFA 1K5OA 1NK9A 2B21A 4I2GA 2M0NA 3IP4B 2ZIXA 2YMQA 5KFUA 2E8OA 4TUPA 3HP6A 5KL1B 3N4MB 5CJ7A 3NTUA 2F1JA 1SL1A 3QUTA 1VDVA 5ALMA 5BPCA 2EAPA 3TARA 1SV4A 4BWMA 2GO7A 5DLFA 2W9CB 4EYIB 4ELUA 2HCFA 4TQSA 4JWNA 3I1YA 3RAQA 9ICSA 2R8GA 4DS4A 3G6YA 1RPLA 4KLSA 3LK9A 5KL8B 4QWEA 2E5SA 2AQ0A 2KN7A 1J2MA 4KTQA 2ASJA 4I2FA 5KG7A 1H38A 9ICMA 4IL6U 5ALUA 3D2NA 3GV8B 2BPGA 4KN7A 2V9WA 3N7PD 4YVZA 1KLNA 2CRXA 2YQEA 4F71A 5KFNA 3KZIU 4ECRA 3HKZF 4O5CA 3VCBA 3Q8MA 1GO3F 4DO9A 2GLEA 2AGQA 2G0AA 2W55A 4ECSA 5KG4A 1SIJA 1XU4A 4I2IA 3K1RB 4UARA 3RB3A 1QQ5A 1NK0A 1F5SA 2YMLA 4ECUA 5J2DA 4AYBF 4E0DA 5AI0A 2AU0A 2WF9A 5DGBA 3RR8A 5CRXA 2K4IA 3NVZA 4QZGA 2ZXIA 3V72A 4PZOA 3H7IA 5G5HA 1SKRA 4US9A 2HI0A 3T5KA 1ED1A 1J2NA 2JGAA 1DOQA 5KFRA 4PH5A 5AHXA 1XO0A 2HOIA 2QB0A 2UVVA 1DGJA 4BXOA 5KAIU 3ZDBA 2W9BA 4FO6A 3JPQA 3ONNA 1O08A 1SKWA 5ALEA 1B0XA 4BJQA 3N7SC 4C8LA 8ICGA 5K4LA 3RJIA 4YXJA 1XO1A 5AKIA 1OUQA 5J2IA 2BCUA 5HHIA 3BZCA 4EZ6A 5GTHU 8ICQA 4JV0A 5DQGA 1JALA 5EE3A 5HR6A 5J2CA 2PFQA 3IN5A 3C28A 2BDUA 2XY7A 2YN4A 4DFKA 4J9OA 3N7RC 3PW7A 2WAQC 2CN1A 2XVTA 2JZBB 3QEAZ 2NRZA 5KT6A 3SAHA 1UA1A 3H0LB 1NKCA 5FP0A 5KFJA 1BNOA 5DBCA 1NK5A 1S76D 1MA7A 1JX4A 4UW9A 3TADA 1T3NA 1NOMA 3IM1A 8ICMA 5L1MA 2IA6A 2NRXA 5KFSA 1MQ2A 2JEIA 5AI6A 2KHQA 1HIWA 4PL2A 3WKBA 1OW5A 2E8PA 2W8KA 3BQ7A 5C5JA 4KN4A 1PVQA 4YQWA 1ZQUA 4UASA 2YB1A 4YG2A 5AICA 3FAHA 7ICPA 1Q46A 4M2YA 2XC9A 5AKGA 8ICFA 2YTUA 4NLGA 1ZQPA 1QQ6A 9ICNA 3I76A 4RUAA 2Q4TA 2A1AA 1QQ7A 3TAPA 1YZ7A 1D9FA 2LMRA 3JPSA 2KKPA 2P6UA 4EYHB 3C2KA 3PO4A 4PHEA 4R8UB 1A0PA 1SL2A 5AM5A 1ZRNA 5DGAA 2LYBA 4JB3A 2ZIWA 5J2EA 4F5RA 2A1JB 2BZFA 4UBCA 3PY8A 2YX8A 2BDPA 2YY6A 1ZQVA 4TQRA 8ICNA 2QARB 3GIJA 4US8A 1D8BA 2HSZA 2NO4A 2BQ3A 3RH6A 2RLTA 7ICHA 2GH1A 5H2FU 3D2QA 3JPRA 2PXIA 7ICJA 1MQ3A 1JIHA 4ED6A 2NRWA 3RJHA 3D6JA 2AH5A 1DXSA 5J2BA 3IHQB 3TQ1A 3A0BU 1L3VA 1CUKA 4C4RA 2LYHA 4AYBC 5J2AA 4M9HA 3QYPA 3AN1A 4I2HA 2JV3A 4K4HA 2J6SA 4M47A 3GIMA 4J9PA 9ICBA 4ECXA 4TUSA 4DFMA 4C8MA 2JZBA 3GFKB 3G6VA 4X5VA 4BGDA 9ICTA 1M6YA 4Q43A 1HUZA 3OGUA 2LYAA 3M6KA 3ALRA 2DPIA 2DKZA 2KOBA 5GTIU 1CI4A 2C28A 2KKVA 3F53A 1X66A 3WK5A 4DS5A 5DBBA 3RJKA 1RQNA 4NLNA 2DBYA 1SB3C 5DLGA 4BDPA 4RNMA 5F9NA 2K4EA 5ALJA 1URJA 3UXOA 3ISDA 3AL0B 9ICQA 3PSTA 8ICAA 4FBUA 7ICOA 8ICJA 4GC6A 4NLZA 5AM1A 3H8MA 4KLGA 2HHWA 1QSYA 3UXNA 4C4TA 4TUQA 2DGZA 4ZOHC 9ICGA 1ZOLA 9ICUA 2KJ9A 1A76A 2HBJA 3RRHA 1NKBA 4DWIA 4KLOA 7ICQA 4HYKA 2OWOA 4FBTA 4UAZA 4Y2YA 2ZIUA 1ZD2P 2BQRA 3FC4A 5ALNA 2JEFA 1COKA 3NVVA 3QUQA 3T5LA 1RM6C 1SWWA 2N1RA 3H0RB 2DL0A 3PW4A
chains in the Genus database with same CATH topology
2KIVA 2F3NA 5JRTA 3BS5A 1SXEA 1SXDA 1JI7A 2QARA 1F0MA 2F44A 2JV3A 2D8CA 1PK3A 5J8YA 2GLEA 1X40A 2Y9TA 4IS7A 2QKQA 2DKXA 2ES6A 1OW5A 1WWVA 2E8PA 1SV0C 1SV0A 3K1RB 3BQ7A 1V85A 4RQNA 2QB1A 3SEIA 1LKYA 4NL9C 2KMDA 2DKZA 1X66A 2Y9UA 1SGGA 3KKAC 5F3XB 2YTUA 4PZOA 1KW4A 1B4FA 2D3DA 5J8YC 1PK1B 4NL9A 1WWUA 2QB0A 1OXJA 2LMRA 2F8KA 2E8NA 1LKYB 2E8OA 1PK1A 3TACB 3H8MA 3BS7A 2B6GA 1B0XA 2KSOB 2E8MA 2LPEA 2EAPA 5JU5A 1SV4A 2EANA 2EAMA 3IDWA 5JTIA 2KE7A 2QARB 3HILA 2FE9A 2KG5A 1V38A 1RG6A 1UQVA 2QB0B 4MHVA 3KKAA 3BS5B 2ESEA 2L5YA 2EAOA 1UCVA 2K60A 2KSOA 1Z1VA 1X9XA 1COKA 4NJ8A 2K4PA 4RQMA 3TADC 3TADA 5KNIA 4PZNA 3SENA 1DXSA 2DL0A 5L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIV A;  2F3N A;  5JRT A;  3BS5 A;  1SXE A;  1SXD A;  1JI7 A;  2QAR A;  1F0M A;  2F44 A;  2JV3 A;  2D8C A;  1PK3 A;  5J8Y A;  2GLE A;  1X40 A;  2Y9T A;  4IS7 A;  2QKQ A;  2DKX A;  2ES6 A;  1OW5 A;  1WWV A;  2E8P A;  1SV0 C;  1SV0 A;  3K1R B;  3BQ7 A;  1V85 A;  4RQN A;  2QB1 A;  3SEI A;  1LKY A;  4NL9 C;  2KMD A;  2DKZ A;  1X66 A;  2Y9U A;  1SGG A;  3KKA C;  5F3X B;  2YTU A;  4PZO A;  1KW4 A;  1B4F A;  2D3D A;  5J8Y C;  1PK1 B;  4NL9 A;  1WWU A;  2QB0 A;  1OXJ A;  2LMR A;  2F8K A;  2E8N A;  1LKY B;  2E8O A;  1PK1 A;  3TAC B;  3H8M A;  3BS7 A;  2B6G A;  1B0X A;  2KSO B;  2E8M A;  2LPE A;  2EAP A;  5JU5 A;  1SV4 A;  2EAN A;  2EAM A;  3IDW A;  5JTI A;  2KE7 A;  2QAR B;  3HIL A;  2FE9 A;  2KG5 A;  1V38 A;  1RG6 A;  1UQV A;  2QB0 B;  4MHV A;  3KKA A;  3BS5 B;  2ESE A;  2L5Y A;  2EAO A;  1UCV A;  2K60 A;  2KSO A;  1Z1V A;  1X9X A;  1COK A;  4NJ8 A;  2K4P A;  4RQM A;  3TAD C;  3TAD A;  5KNI A;  4PZN A;  3SEN A;  1DXS A;  2DL0 A;  5L1M A; 
#chains in the Genus database with same CATH topology
 3UMC A;  2V4R A;  1ZQJ A;  4KMO B;  3BS5 A;  5AK6 A;  3CP8 A;  9ICR A;  3WKA A;  1MN8 A;  4RZR A;  5DB7 A;  4FS2 A;  4DLG A;  1N56 A;  4DF4 A;  2D8C A;  3L5K A;  1DK2 A;  5DG7 A;  4GXK A;  9ICC A;  2FJ6 A;  4J9Q A;  4DL6 A;  5B66 U;  2XCP A;  3PSI A;  1V85 A;  3LYS A;  5J0Y A;  4UAU A;  1Z1B A;  3V7J A;  4RQ8 A;  3ORY A;  2K8C B;  3GDX A;  5ALR A;  3KKA C;  5F3X B;  4I28 A;  1X6I A;  2K8B B;  4R8U A;  4Y2V A;  4RQ1 A;  1A6S A;  1JUD A;  9ICJ A;  2ZUC A;  3QU2 A;  4F8R A;  5EE9 A;  1L7N A;  5KG2 A;  3UXP A;  4RPZ A;  1PVR A;  2LI6 A;  4DQQ A;  8ICO A;  2KSO B;  3BQ2 A;  3H4D A;  1BNP A;  2LPE A;  5IIJ A;  2MRL A;  2FI1 A;  1TK8 A;  3IDW A;  5IIO A;  5JUM A;  4J9R A;  4Y2R A;  4QWD A;  1NJX A;  1ZQX A;  3EYZ A;  7ICV A;  2F2A B;  3K4G A;  1T8E A;  5KFI A;  1RYR A;  5BOL A;  3JPT A;  2FE9 A;  2RQ5 A;  2ZTD A;  3SAF A;  2UVR A;  4CGZ A;  2BCR A;  5KFP A;  1XC9 A;  5KFQ A;  2O6K A;  1X9M A;  1QCK A;  4IRC A;  7ICF A;  3H8S A;  3RR7 A;  3GZF A;  5CWR A;  3UMG A;  1NZP A;  3KZX A;  2MUT A;  4Z6D A;  3PW5 A;  8ICE A;  4UB3 A;  4YMO A;  4I2D A;  2BCS A;  4G3I A;  4ED2 A;  4FZL A;  5L1K A;  4YCX A;  3HRD D;  2JEG A;  3FDS A;  2Q0Z X;  4Q44 A;  1TAM A;  2OHF A;  3MGH A;  9ICK A;  3MR3 A;  3I28 A;  2D6F C;  5KG3 A;  2OM6 A;  1L8L A;  5J0X A;  3RFA A;  7ICE A;  1L7O A;  5AI9 A;  2IOF A;  3RH4 A;  7ICI A;  2IOH A;  2W3S A;  4KLE A;  5J0O A;  4KLL A;  2XI9 A;  1D8Y A;  4EEY A;  1XSL A;  3E2E A;  4ECY A;  1WYG A;  2PFN A;  2HW3 A;  1KW4 A;  4DQI A;  1UT5 A;  2KZ3 A;  4C7Z A;  1ZQY A;  2VIX A;  1ZQC A;  2MSN A;  1WWU A;  3PW2 A;  5ALQ A;  4PHD A;  1Q8K A;  1S0O A;  3IG5 A;  9ICX A;  4F92 B;  3H8J A;  1ZQI A;  2ZIU B;  2EAM A;  2FLL A;  5HNK A;  4QJF B;  5KFT A;  4FZN A;  4B9N A;  4O3P A;  3V6H A;  2KG5 A;  5DQH A;  4XRH A;  4ED3 A;  1V38 A;  2JH1 A;  4R63 A;  5AKL A;  3WU2 U;  1U49 A;  1T4G A;  4UB1 A;  4J9K A;  3UQ0 A;  5HHH A;  1TK5 A;  1X6J A;  3C2L A;  2ZIV B;  4EX7 A;  1L3U A;  2KSO A;  4QNL A;  2E1F A;  2C22 A;  1X2I A;  5AM2 A;  4Y2P A;  2H5X A;  4EEK A;  3TFS A;  4PZN A;  3UPQ A;  5AKH A;  2A19 A;  2EQY A;  1L6N A;  4MFC A;  5J0P A;  4PHA A;  3RB6 A;  4YR0 A;  3OJU A;  4MEX A;  4FZM A;  1U9L A;  3Q8Q B;  8ICL A;  5KG1 A;  3ED5 A;  4YP3 A;  2RDJ A;  4CF5 A;  3RB0 A;  4I27 A;  5DG8 A;  1SV0 C;  4CCH A;  3H0M B;  1UHU A;  2MU2 A;  1FFU A;  1LB2 B;  2ZTE A;  3NUQ A;  4YD1 A;  4BX9 C;  2KEY A;  8ICC A;  3MDC A;  2UVW A;  3S6J A;  5G5G A;  4B9V A;  3M6Z A;  4F5Q A;  3RB4 A;  2Y9U A;  1ZQM A;  2B0C A;  1L7P A;  1ZQE A;  1T7P A;  4OJL A;  5HMM A;  3C1Z A;  1KSP A;  1A77 A;  1S5L U;  4NXZ A;  3JPN A;  4FE3 A;  5ALP A;  1BPB A;  1ZJN A;  4EEN A;  2KK0 A;  1TKD A;  2HHT A;  1Z4N A;  4ZH4 A;  4QW8 A;  4KLJ A;  4O3S A;  3C29 A;  4RQ3 A;  4RT3 A;  3A0H U;  4UB5 A;  4O3M A;  3ZDD A;  4M9G A;  1ZQW A;  2ISO A;  3SQI A;  2ZIX B;  5IIM A;  5JTI A;  1S8O A;  2J6U A;  2PMZ C;  5KFH A;  4P0P B;  1IG6 A;  5ALG A;  2KIC A;  4OO1 J;  3PSP A;  4O5K A;  3GII A;  4Q8E A;  4DL2 A;  4QWA A;  5DB6 A;  3MR5 A;  2XY6 A;  1Z19 A;  2FLP A;  4OJO A;  2KIW A;  3MAB A;  1X9X A;  4QZD A;  1QLN A;  3RH5 A;  2FMP A;  1JXL A;  2JMG A;  3THV A;  2KIV A;  5DBA A;  3FYH A;  4IRK A;  5KT2 A;  3B0Y A;  3QZ7 A;  2MAX A;  5AM3 A;  1BVS A;  2PI4 A;  4OJP A;  3LDA A;  4KX3 A;  4JV1 A;  1ZD3 A;  2NYV A;  4O3O A;  5EE0 A;  2DKX A;  5IIK A;  2G5H B;  2ZIV A;  3NVY A;  1F44 A;  5AKX A;  4CF4 A;  4ELV A;  2KJ5 A;  2F1H A;  4DSL A;  1UA0 A;  4YD2 A;  4F2R A;  3AU6 A;  4NWI A;  9ICP A;  8ICI A;  4XQ8 A;  4NM2 A;  2KMD A;  4QIW C;  2W8L A;  5IIL A;  3LWM A;  4C4S A;  4KLQ A;  2H3V A;  4TUR A;  1QSS A;  4MF2 A;  4F5N A;  9ICO A;  4AP9 A;  2KHV A;  2GOL A;  4F4K A;  4IC9 A;  2FPL A;  3BJY A;  1LKY B;  4GFJ A;  5HP4 A;  1ZQL A;  3HX0 A;  8ICX A;  2EZY A;  2WF8 A;  3OTQ A;  2KVS A;  5EWE A;  3QU9 A;  7ICU A;  3UM9 A;  4FS1 A;  2F8L A;  4DOB A;  3IG8 A;  4F93 B;  4NY8 A;  4DF8 A;  2Y1I A;  2CPR A;  4QZC A;  4QZI A;  4XA5 A;  5DKW A;  2OH2 A;  4DFP A;  4YFK A;  1Z3E B;  2A1J A;  1Z4O A;  1FFV A;  3WK6 A;  3C5G A;  1EXN A;  1KQQ A;  2HHS A;  4NJ8 A;  5L1J A;  2VA8 A;  5KNI A;  3QU7 A;  9ICV A;  2KVC A;  2ZJA A;  4KLH A;  4DSJ A;  4F4Z A;  1T3Q A;  1TVA A;  2KV2 A;  1AQ6 A;  1DGS A;  4QWB A;  4F4X A;  4DEZ A;  3F5E A;  4M9N A;  3GV5 B;  5J2H A;  2P6R A;  3F5A A;  3ZD8 A;  4PGQ A;  1N61 A;  1B43 A;  1YT3 A;  3T5H A;  4EBD A;  2ZUB A;  1SL0 A;  4JMU A;  4RQ6 A;  4B9L A;  5DB8 A;  2G06 A;  3QZ8 A;  3CYM A;  4R64 A;  4CF3 A;  1XSN A;  2G07 A;  4F91 B;  2XCA A;  3RJE A;  2W9C A;  2ISP A;  2W9M A;  1WG8 A;  3E0F A;  2FMS A;  1WUD A;  4GC7 A;  1ZQB A;  1S0V A;  1KKX A;  5J2J A;  3TAQ A;  5KFD A;  4OJ6 A;  1YZ6 A;  3V7K A;  5B5E U;  2E8N A;  3DEE A;  5KFF A;  1ZQG A;  2WAQ F;  8ICT A;  3QNM A;  3FM9 A;  2H3F A;  2R8H A;  2IHN A;  8ICW A;  3D2S A;  2PFP A;  3PX6 A;  2I5H A;  3VC8 A;  5ALT A;  1CEZ A;  1KN5 A;  1KBU A;  3SV3 A;  3F2C A;  5EWG A;  2FMQ A;  5ALX A;  2LM4 A;  5AKE A;  3QX7 A;  2H3Q A;  2V4Q A;  1V97 A;  2ZIW B;  1D9D A;  3DDH A;  1PVP A;  4JV2 A;  2BPF A;  2WB1 F;  1Z1V A;  1UPH A;  4MF8 A;  2HHQ A;  2I1Q A;  5J0T A;  7ICM A;  4DOC A;  4DLE A;  3QU4 A;  4RU9 A;  3KHL A;  5J0Q A;  1PK3 A;  4ED1 A;  1S10 A;  5JRT A;  1C20 A;  3NS1 A;  4NM1 A;  4ACO A;  4Q8F A;  4RQ7 A;  3MR6 A;  1JXE A;  4DQS A;  1RZT A;  2OEH A;  2UVU A;  5E79 U;  2XO7 A;  4B9U A;  1DK3 A;  3WK4 A;  5TIS U;  2ES6 A;  4KLM A;  9ICI A;  1U45 A;  4DL7 A;  4GXI A;  2HDO A;  3GV7 B;  1SV0 A;  1KRP A;  4RT2 A;  4BXO B;  4DL5 A;  4Q45 A;  2W11 A;  1JRO A;  2FDR A;  4DOA A;  3TI0 A;  1NJW A;  3TFR A;  2GWS A;  4NLC A;  3T79 A;  2HVI A;  3BQ0 A;  2KD1 A;  4Y2J A;  5J0U A;  3Q8L A;  5KFW A;  2WFA A;  4KLD A;  2WTF A;  4DFD A;  4UAT A;  3WK7 A;  2R18 A;  4RNO A;  1IM4 A;  2C2D A;  5AIB A;  5HR7 A;  7ICK A;  4RPY A;  5KFA A;  2K8A A;  5KT5 A;  2XIC A;  4P0P A;  4UAY A;  3BZK A;  1D8L A;  4KLU A;  5J2K A;  1XS9 D;  4UB2 A;  1NK6 A;  4PHP A;  1ZQR A;  3LVW A;  5T14 A;  3Q8K A;  3PW0 A;  4Y2T A;  1X9S A;  4UAV A;  2PFO A;  5KT7 A;  2LKY A;  5D46 A;  2CXY A;  2ASD A;  3ZDA A;  1KFS A;  4XUS A;  2RDI A;  3QU5 A;  1SWV A;  1KTQ A;  2RHF A;  3WKD A;  5ALK A;  4Z6F A;  1N60 A;  2HBM A;  3ZDE A;  2ESE A;  3SD7 A;  5KG6 A;  1ZQA A;  1P7D A;  1XSP A;  4EZ9 A;  2ZXH A;  4KLF A;  4DSE A;  1K1Q A;  3RBE A;  3KHG A;  3KD3 A;  4ECV A;  3M8R A;  2NV3 A;  3G6X A;  4MFF A;  3RJF A;  3WK8 A;  2EZX A;  5J0W A;  1U4B A;  1SXE A;  4C8N A;  1JI7 A;  2F44 A;  4YMN A;  3MBY A;  1ZQ1 C;  2Y9T A;  2LM1 A;  4IS7 A;  2HOF A;  2ZJ8 A;  1ZJM A;  5EOZ A;  2YMM A;  4F3O A;  4QZF A;  1RYU A;  5ALO A;  2Y0S C;  2BCQ A;  1S9F A;  4RQ4 A;  3LWL A;  3SR6 A;  4O3N A;  1SZH A;  2H3I A;  4UB4 A;  2ZTC A;  1RQL A;  2ODG A;  4QZE A;  3EPI A;  2M9N A;  5J29 A;  2KZM A;  5ALH A;  2K89 A;  3H8W A;  3M1Y A;  1TFR A;  3V7L A;  1NK7 A;  4KIT B;  1JMS A;  4I2J A;  2VJ5 A;  5TZV A;  4Y2U A;  1ZQN A;  2HHU A;  2W04 A;  5KG0 A;  1PK1 A;  4EX6 A;  5C0Y A;  5AKJ A;  4RNN A;  1QTM A;  4MFA A;  1IIP A;  3KHH A;  3PMN A;  2ZUD A;  4IRD A;  2RP5 A;  3ETL A;  9ICF A;  3HIL A;  1N5W A;  2HHV A;  5KFG A;  2QB0 B;  5ALF A;  3CRX A;  3HT3 A;  3EW9 A;  5CHG A;  1BPY A;  1K1S A;  2W3R A;  4DL4 A;  3ZDC A;  2K60 A;  4KX5 A;  1FEZ A;  3ZD9 A;  4UAW A;  3RRG A;  5ALI A;  1U48 A;  5CB1 A;  1ZQZ A;  3SAG A;  3PNC A;  4O9M A;  1XNS A;  2ALZ A;  4M0A A;  4IQV A;  4I2C A;  2BKE A;  1ZET A;  3OSP A;  1ZQH A;  3AMZ A;  2VJ4 A;  3R9K A;  3BQT A;  2EDU A;  4IR1 A;  4R65 A;  8ICH A;  4M6W B;  4NLB A;  1TAU A;  4UQG A;  3EZ5 A;  4J03 A;  4PL1 A;  3PO5 A;  2OCE A;  4ED8 A;  1ZD5 A;  3AUO A;  7ICN A;  3C23 A;  1SZP A;  2DPJ A;  2QB1 A;  5EE1 A;  2VAN A;  3CNH A;  2WF6 A;  1S0M A;  7ICG A;  2VKQ A;  4OCZ A;  3ZI4 A;  4LZD A;  2I6X A;  2MUT B;  3KTQ A;  4Y2X A;  1X42 A;  2ASL A;  4PGX A;  2VA2 A;  1ZRM A;  1B4F A;  3IRU A;  4JUZ A;  2KFZ A;  4QZB A;  3GIK A;  3RJJ A;  3MGV A;  3EPG A;  4C0Z A;  4P4M A;  5F9L A;  2KJ8 A;  3SI8 A;  2EZZ A;  9ICE A;  5DG9 A;  2YMP A;  4O3Q A;  1U47 A;  4R66 A;  4J9L A;  4DQR A;  5KG5 A;  3OJS A;  2F76 X;  2BR0 A;  5AKZ A;  4U6P A;  3QEB Z;  3JPO A;  2JR5 A;  3NRZ A;  2BPC A;  2KE7 A;  4F72 A;  3T3F A;  4B9M A;  4RUC A;  1ZQF A;  5J2G A;  3F2B A;  5KFY A;  5A0L A;  3PML A;  8ICY A;  3MFI A;  2G08 A;  4RQ5 A;  9ICW A;  3PV8 A;  3M9N B;  4QZA A;  1KFD A;  4YMM A;  3C2M A;  2C2R A;  2K4H A;  4JWM A;  1F0M A;  2XGP A;  4U7C A;  3BQ1 A;  3L4P A;  8ICK A;  4J9M A;  3KFU F;  4ICA A;  1N5X A;  5D49 A;  2KP7 A;  5CR0 A;  2AJQ A;  4RQN A;  2DF4 B;  3PR4 A;  4WJ3 B;  2BQU A;  3DV9 A;  9ICA A;  4DSK A;  1RXW A;  5J0R A;  1NK4 A;  4F2S A;  3OHA A;  1ECW A;  4QW9 A;  3ISB A;  2NO5 A;  1SGG A;  4JK1 A;  4LZG A;  1IV8 A;  3WKC A;  1PZN A;  1N48 A;  3PX4 A;  1ZYQ A;  1ZQK A;  3SYZ A;  2DFL A;  4Z6E A;  4I29 A;  3UQ2 A;  2VA3 A;  3BS7 A;  3UMB A;  2IMW P;  1NK8 A;  4KLT A;  1FO4 A;  1LVH A;  4IQT A;  1S77 D;  3CW2 C;  5KFX A;  4F4W A;  4ECW A;  3Q8R B;  3NGD A;  4C8O A;  4OJ5 A;  1VJ5 A;  8ICZ A;  2JRZ A;  5ALD A;  1SKS A;  1BPZ A;  5L9X A;  4C80 A;  4I2B A;  2RRD A;  3V6K A;  3M8S A;  3KKA A;  4DL3 A;  1ZQS A;  3MGI A;  4GLX A;  1UCV A;  2E1E A;  2FLN A;  4MEY A;  5J2F A;  2W9A A;  3MFH A;  3MC1 A;  4RPX A;  4PPX A;  1ZQQ A;  1NZB A;  4P4O A;  5KFC A;  2E3T A;  4BWJ A;  3ICX A;  3HPO A;  2LHT A;  3E58 A;  2PKE A;  2AQ4 A;  1HJP A;  2KTQ A;  4M9J A;  1N62 A;  5KFB A;  3Q8S B;  3GQC A;  4CE6 A;  3WK9 A;  1TAQ A;  2XGQ A;  3NRW A;  3MR2 A;  8ICB A;  2W54 A;  1MSW D;  2FPM A;  3RF9 A;  4G9B A;  3SEI A;  4QZ9 A;  1NKE A;  2BHN A;  4EEL A;  1BPE A;  4B9S A;  1QH9 A;  4LVS A;  3B9J A;  4OD0 A;  4QIW F;  4UB6 U;  4EBE A;  3PSF A;  1KDH A;  4A8E A;  5KFE A;  2OXO A;  7ICS A;  5DDY A;  1X9W A;  1L3T A;  2IBK A;  5KTQ A;  4NL9 A;  1BPD A;  3AU2 A;  2DQN B;  4I2E A;  2FPK A;  2DWQ A;  3N28 A;  4NV0 A;  4P2H A;  1J97 A;  5ALY A;  5AK3 A;  2B6G A;  7ICL A;  2QLT A;  3M7D A;  5JU5 A;  4C8K A;  1Q3V A;  4FFD A;  3SZ2 A;  2MA1 A;  4ED0 A;  4YR3 A;  1HUO A;  2ATL A;  2IOF K;  1UQV A;  3BDP A;  4P4P A;  9ICL A;  5DB9 A;  1ZD4 A;  4I2A A;  5EWF A;  3PZP A;  4O3R A;  1NNL A;  3KOO A;  4Y2Q A;  2WB1 C;  1KEJ A;  3QUC A;  4K4G A;  4K4I A;  2HBK A;  3J81 j;  4USA A;  4RQM A;  3SMV A;  9ICH A;  1TK0 A;  5CEH A;  2Z7J A;  2KNJ A;  4DQP A;  4DCC A;  4DSI A;  1JRP A;  2F77 X;  3RBD A;  1Z00 B;  2WF5 A;  5ALS A;  4F5O A;  1SXD A;  3AQF A;  2QAR A;  2ZJ5 A;  2AGP A;  3K1Z A;  3PVX A;  1T94 A;  3Q8P B;  2QKQ A;  2W7P A;  4F4Y A;  5DDM A;  1BGX T;  1IXR A;  3K75 D;  3N97 B;  3OPX A;  3NVW A;  5AIA A;  5ALV A;  1MC8 A;  5DQI A;  3L3F X;  1LV5 A;  4GXJ A;  4CDG A;  2WF7 A;  5KFZ A;  4ECZ A;  3HJE A;  3V6J A;  5KT3 A;  3TKA A;  3HWT A;  4BUG A;  2G5I B;  1B22 A;  3C21 A;  2XY5 A;  1NJZ A;  1KFT A;  1L7M A;  3OHB A;  2HOQ A;  1ZQD A;  5AK4 A;  5L1I A;  4IR9 A;  1O03 A;  4KMU A;  1KL9 A;  4P0Q A;  3KBB A;  1N2X A;  2HMX A;  1L3S A;  2BCV A;  5AI4 A;  4RQ0 A;  2JH7 A;  3NAS A;  2HBL A;  4NLK A;  4IQU A;  2EAN A;  1FIQ A;  5HML A;  5KFK A;  1HEK A;  4C7Y A;  1CRX A;  2AXT U;  1S0N A;  5CP2 A;  2C2E A;  1JN3 A;  2XID A;  3T5J A;  2NRT A;  4DSF A;  5KFV A;  1UT8 A;  5BOM A;  1WCL A;  3QXG A;  3HW8 A;  3H40 A;  2J6T A;  3BS5 B;  5L1L A;  3JPP A;  2IHM A;  4DFJ A;  2EAO A;  4GIB A;  5KFM A;  4CNQ A;  2YB4 A;  2W7O A;  3PX0 A;  2NRV A;  5CA7 A;  5AM4 A;  3TAD C;  2R8J A;  2JXJ A;  1V9P A;  5D4B A;  5KT4 A;  3AQE A;  5AI5 A;  3ETR A;  4ELT A;  1PUZ A;  4YXM A;  2P66 A;  1X40 A;  5KAF U;  2BGW A;  4YN4 A;  2WHE A;  3LVV A;  5AI8 A;  3H4B A;  4UBB A;  4J9N A;  2DUY A;  4QWC A;  4B9T A;  5AM0 A;  1TE2 A;  3QUB A;  2R8K A;  5ALZ A;  3ISC A;  1BPX A;  1DRG A;  1LKY A;  4QZ8 A;  2JEJ A;  1NI3 A;  4F50 A;  1Q3U A;  1XWL A;  4Z6C A;  4NL9 C;  3WKE A;  4YR2 A;  2I9G A;  1WCN A;  4ECQ A;  4B6J A;  2G09 A;  5AK5 A;  2D3D A;  5J8Y C;  1ARO P;  1PK1 B;  5KFL A;  3U26 A;  3SV4 A;  5IIN A;  2AGO A;  1RXV A;  2PI5 A;  7ICT A;  2W03 A;  1OXJ A;  4RQ2 A;  5ALL A;  2F8K A;  3C1Y A;  1VLB A;  3TAC B;  2KZZ A;  4F5P A;  2E8M A;  2KFN A;  3PR5 B;  1N63 A;  2P35 A;  3GU3 A;  3OSN A;  4EBC A;  1COO A;  3TAN A;  2A3V A;  5ALW A;  3C5F A;  3B0X A;  2OYY A;  3MDA A;  1RG6 A;  2ZG6 A;  4MHV A;  2Y1J A;  1L8O A;  1Z00 A;  1ZQT A;  1RYS A;  2L5Y A;  3AM9 A;  3AEV A;  4PJ0 U;  5KFO A;  4HAI A;  1TV9 A;  4QZH A;  5AKY A;  1QSL A;  4UB8 U;  8ICV A;  3IV6 A;  2HVH A;  3EUB 2;  3QE9 Y;  2K4P A;  1ZQO A;  1NJY A;  4IQW A;  8ICS A;  3SEN A;  3F2D A;  4M6W A;  4LJX A;  1C7Y A;  1ZXI A;  2F3N A;  2PMZ F;  3M9O B;  3M9M B;  1Y88 A;  4O0I A;  2R8I A;  8ICP A;  5J8Y A;  4O5E A;  4ECT A;  3RAX A;  8ICR A;  5III A;  8ICU A;  3KHR A;  1WWV A;  1L5U A;  2HHX A;  5AKK A;  2JHD A;  3RTV A;  7ICR A;  3O0F A;  2AHO B;  2W43 A;  2Y0S F;  4Y2S A;  2W9B B;  5J0S A;  4M9L A;  3HKZ C;  4J9S A;  4ED7 A;  2H3Z A;  4PGY A;  4M04 A;  4P0Q B;  2F1I A;  2EH9 A;  3RJG A;  1S97 A;  3EWA A;  4CRX A;  3GIL A;  2LBO A;  4KLI A;  1RDF A;  1K5O A;  1NK9 A;  2B21 A;  4I2G A;  2M0N A;  3IP4 B;  2ZIX A;  2YMQ A;  5KFU A;  2E8O A;  4TUP A;  3HP6 A;  5KL1 B;  3N4M B;  5CJ7 A;  3NTU A;  2F1J A;  1SL1 A;  3QUT A;  1VDV A;  5ALM A;  5BPC A;  2EAP A;  3TAR A;  1SV4 A;  4BWM A;  2GO7 A;  5DLF A;  2W9C B;  4EYI B;  4ELU A;  2HCF A;  4TQS A;  4JWN A;  3I1Y A;  3RAQ A;  9ICS A;  2R8G A;  4DS4 A;  3G6Y A;  1RPL A;  4KLS A;  3LK9 A;  5KL8 B;  4QWE A;  2E5S A;  2AQ0 A;  2KN7 A;  1J2M A;  4KTQ A;  2ASJ A;  4I2F A;  5KG7 A;  1H38 A;  9ICM A;  4IL6 U;  5ALU A;  3D2N A;  3GV8 B;  2BPG A;  4KN7 A;  2V9W A;  3N7P D;  4YVZ A;  1KLN A;  2CRX A;  2YQE A;  4F71 A;  5KFN A;  3KZI U;  4ECR A;  3HKZ F;  4O5C A;  3VCB A;  3Q8M A;  1GO3 F;  4DO9 A;  2GLE A;  2AGQ A;  2G0A A;  2W55 A;  4ECS A;  5KG4 A;  1SIJ A;  1XU4 A;  4I2I A;  3K1R B;  4UAR A;  3RB3 A;  1QQ5 A;  1NK0 A;  1F5S A;  2YML A;  4ECU A;  5J2D A;  4AYB F;  4E0D A;  5AI0 A;  2AU0 A;  2WF9 A;  5DGB A;  3RR8 A;  5CRX A;  2K4I A;  3NVZ A;  4QZG A;  2ZXI A;  3V72 A;  4PZO A;  3H7I A;  5G5H A;  1SKR A;  4US9 A;  2HI0 A;  3T5K A;  1ED1 A;  1J2N A;  2JGA A;  1DOQ A;  5KFR A;  4PH5 A;  5AHX A;  1XO0 A;  2HOI A;  2QB0 A;  2UVV A;  1DGJ A;  4BXO A;  5KAI U;  3ZDB A;  2W9B A;  4FO6 A;  3JPQ A;  3ONN A;  1O08 A;  1SKW A;  5ALE A;  1B0X A;  4BJQ A;  3N7S C;  4C8L A;  8ICG A;  5K4L A;  3RJI A;  4YXJ A;  1XO1 A;  5AKI A;  1OUQ A;  5J2I A;  2BCU A;  5HHI A;  3BZC A;  4EZ6 A;  5GTH U;  8ICQ A;  4JV0 A;  5DQG A;  1JAL A;  5EE3 A;  5HR6 A;  5J2C A;  2PFQ A;  3IN5 A;  3C28 A;  2BDU A;  2XY7 A;  2YN4 A;  4DFK A;  4J9O A;  3N7R C;  3PW7 A;  2WAQ C;  2CN1 A;  2XVT A;  2JZB B;  3QEA Z;  2NRZ A;  5KT6 A;  3SAH A;  1UA1 A;  3H0L B;  1NKC A;  5FP0 A;  5KFJ A;  1BNO A;  5DBC A;  1NK5 A;  1S76 D;  1MA7 A;  1JX4 A;  4UW9 A;  3TAD A;  1T3N A;  1NOM A;  3IM1 A;  8ICM A;  5L1M A;  2IA6 A;  2NRX A;  5KFS A;  1MQ2 A;  2JEI A;  5AI6 A;  2KHQ A;  1HIW A;  4PL2 A;  3WKB A;  1OW5 A;  2E8P A;  2W8K A;  3BQ7 A;  5C5J A;  4KN4 A;  1PVQ A;  4YQW A;  1ZQU A;  4UAS A;  2YB1 A;  4YG2 A;  5AIC A;  3FAH A;  7ICP A;  1Q46 A;  4M2Y A;  2XC9 A;  5AKG A;  8ICF A;  2YTU A;  4NLG A;  1ZQP A;  1QQ6 A;  9ICN A;  3I76 A;  4RUA A;  2Q4T A;  2A1A A;  1QQ7 A;  3TAP A;  1YZ7 A;  1D9F A;  2LMR A;  3JPS A;  2KKP A;  2P6U A;  4EYH B;  3C2K A;  3PO4 A;  4PHE A;  4R8U B;  1A0P A;  1SL2 A;  5AM5 A;  1ZRN A;  5DGA A;  2LYB A;  4JB3 A;  2ZIW A;  5J2E A;  4F5R A;  2A1J B;  2BZF A;  4UBC A;  3PY8 A;  2YX8 A;  2BDP A;  2YY6 A;  1ZQV A;  4TQR A;  8ICN A;  2QAR B;  3GIJ A;  4US8 A;  1D8B A;  2HSZ A;  2NO4 A;  2BQ3 A;  3RH6 A;  2RLT A;  7ICH A;  2GH1 A;  5H2F U;  3D2Q A;  3JPR A;  2PXI A;  7ICJ A;  1MQ3 A;  1JIH A;  4ED6 A;  2NRW A;  3RJH A;  3D6J A;  2AH5 A;  1DXS A;  5J2B A;  3IHQ B;  3TQ1 A;  3A0B U;  1L3V A;  1CUK A;  4C4R A;  2LYH A;  4AYB C;  5J2A A;  4M9H A;  3QYP A;  3AN1 A;  4I2H A;  2JV3 A;  4K4H A;  2J6S A;  4M47 A;  3GIM A;  4J9P A;  9ICB A;  4ECX A;  4TUS A;  4DFM A;  4C8M A;  2JZB A;  3GFK B;  3G6V A;  4X5V A;  4BGD A;  9ICT A;  1M6Y A;  4Q43 A;  1HUZ A;  3OGU A;  2LYA A;  3M6K A;  3ALR A;  2DPI A;  2DKZ A;  2KOB A;  5GTI U;  1CI4 A;  2C28 A;  2KKV A;  3F53 A;  1X66 A;  3WK5 A;  4DS5 A;  5DBB A;  3RJK A;  1RQN A;  4NLN A;  2DBY A;  1SB3 C;  5DLG A;  4BDP A;  4RNM A;  5F9N A;  2K4E A;  5ALJ A;  1URJ A;  3UXO A;  3ISD A;  3AL0 B;  9ICQ A;  3PST A;  8ICA A;  4FBU A;  7ICO A;  8ICJ A;  4GC6 A;  4NLZ A;  5AM1 A;  3H8M A;  4KLG A;  2HHW A;  1QSY A;  3UXN A;  4C4T A;  4TUQ A;  2DGZ A;  4ZOH C;  9ICG A;  1ZOL A;  9ICU A;  2KJ9 A;  1A76 A;  2HBJ A;  3RRH A;  1NKB A;  4DWI A;  4KLO A;  7ICQ A;  4HYK A;  2OWO A;  4FBT A;  4UAZ A;  4Y2Y A;  2ZIU A;  1ZD2 P;  2BQR A;  3FC4 A;  5ALN A;  2JEF A;  1COK A;  3NVV A;  3QUQ A;  3T5L A;  1RM6 C;  1SWW A;  2N1R A;  3H0R B;  2DL0 A;  3PW4 A; 
#chains in the Genus database with same CATH homology
 2KIV A;  2F3N A;  5JRT A;  3BS5 A;  1SXE A;  1SXD A;  1JI7 A;  2QAR A;  1F0M A;  2F44 A;  2JV3 A;  2D8C A;  1PK3 A;  5J8Y A;  2GLE A;  1X40 A;  2Y9T A;  4IS7 A;  2QKQ A;  2DKX A;  2ES6 A;  1OW5 A;  1WWV A;  2E8P A;  1SV0 C;  1SV0 A;  3K1R B;  3BQ7 A;  1V85 A;  4RQN A;  2QB1 A;  3SEI A;  1LKY A;  4NL9 C;  2KMD A;  2DKZ A;  1X66 A;  2Y9U A;  1SGG A;  3KKA C;  5F3X B;  2YTU A;  4PZO A;  1KW4 A;  1B4F A;  2D3D A;  5J8Y C;  1PK1 B;  4NL9 A;  1WWU A;  2QB0 A;  1OXJ A;  2LMR A;  2F8K A;  2E8N A;  1LKY B;  2E8O A;  1PK1 A;  3TAC B;  3H8M A;  3BS7 A;  2B6G A;  1B0X A;  2KSO B;  2E8M A;  2LPE A;  2EAP A;  5JU5 A;  1SV4 A;  2EAN A;  2EAM A;  3IDW A;  5JTI A;  2KE7 A;  2QAR B;  3HIL A;  2FE9 A;  2KG5 A;  1V38 A;  1RG6 A;  1UQV A;  2QB0 B;  4MHV A;  3KKA A;  3BS5 B;  2ESE A;  2L5Y A;  2EAO A;  1UCV A;  2K60 A;  2KSO A;  1Z1V A;  1X9X A;  1COK A;  4NJ8 A;  2K4P A;  4RQM A;  3TAD C;  3TAD A;  5KNI A;  4PZN A;  3SEN A;  1DXS A;  2DL0 A;  5L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...