3K1RB

Structure of harmonin npdz1 in complex with the sam-pbm of sans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
ETSPLETFLASLHMEDFAALLRQEKIDLEALMLCSDLDLRSISVPLGPREKILGAVRRRRQAMERPPALEDTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Harmonin
publication title The structure of the harmonin/sans complex reveals an unexpected interaction mode of the two Usher syndrome proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 23
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3k1rB00
2D8CA 2K60A 2ES6A 3SEIA 1SGGA 2GLEA 1PK1A 2QARB 1RG6A 2QB1A 2F8KA 2KG5A 1OXJA 1COKA 1DXSA 5KNIA 2KSOA 2D3DA 1X40A 2E8OA 5JU5A 4MHVA 5J8YC 2EANA 2E8MA 2F44A 1OW5A 2KMDA 1SXDA 2DKZA 3TADC 1SV0C 3H8MA 1LKYB 4RQNA 2YTUA 2QARA 4PZOA 3K1RB 2QB0B 4PZNA 2LPEA 1KW4A 1V38A 3BQ7A 1WWVA 2E8NA 2F3NA 2E8PA 1SV4A 1B0XA 2L5YA 2K4PA 4NL9A 1WWUA 1LKYA 2KE7A 3IDWA 1V85A 2EAOA 2QB0A 4NJ8A 2LMRA 3TACB 4RQMA 2EAMA 3BS7A 1JI7A 2Y9UA 1Z1VA 3BS5B 3KKAA 5L1MA 1UQVA 3SENA 3KKAC 5JRTA 1X66A 2QKQA 4NL9C 1PK1B 3HILA 5J8YA 1X9XA 4IS7A 2DL0A 2Y9TA 1F0MA 1SXEA 2KIVA 1UCVA 2DKXA 5F3XB 3TADA 2KSOB 1SV0A 2EAPA 2FE9A 5JTIA 3BS5A 2ESEA 1PK3A 2JV3A 1B4FA 2B6GA
chains in the Genus database with same CATH superfamily
4Z6EA 4O5EA 1X2IA 5KFOA 2RP5A 1JROA 2LYBA 4QJFB 2J6TA 5AIAA 4B9TA 2I9GA 8ICCA 3D6JA 1ZQKA 2KG5A 3GFKB 2JGAA 8ICQA 5KFHA 1NI3A 4PJ0U 5AKJA 5F9NA 2HBMA 5J8YC 2PMZF 1EXNA 4DF8A 7ICNA 4JWNA 4Y2JA 1OW5A 1SZHA 8ICEA 5HMMA 1AQ6A 7ICKA 2FMPA 4F4ZA 4ED2A 3MC1A 3NVYA 3BQ7A 3BDPA 2ASDA 1NOMA 2LM4A 2K8CB 2W3RA 5FP0A 5CJ7A 2K8BB 4Y2SA 2XCAA 5EOZA 4C4SA 1L3UA 2RHFA 3SQIA 2KZ3A 4UBCA 4DO9A 4C80A 3HP6A 4IRKA 2FPMA 4R63A 5AK5A 4YCXA 4QZEA 1QQ5A 1QQ6A 5J2FA 2MUTA 4I2FA 1ZQWA 1BPEA 4QZHA 4PL1A 4ED1A 4NL9C 4UATA 2ZIXB 1LVHA 5AI8A 1ZQBA 4NXZA 1X9XA 1L8LA 2JEGA 5EWFA 5F3XB 2EAPA 3C29A 5KFUA 1TK8A 1QSSA 3PO4A 3TANA 4QZ8A 4F2RA 3BQ2A 3ZDAA 2G06A 3VC8A 1YT3A 1NK8A 4LZDA 4RPYA 1KRPA 5ALHA 1RYRA 1COKA 4M6WA 5AK3A 4BWMA 3EPGA 4ECUA 4Q8EA 4J9QA 3PW5A 1FFUA 1N63A 3MBYA 3HX0A 4RPXA 2F44A 2WF9A 2XVTA 2WAQF 3V7KA 1JUDA 1L8OA 2R8HA 4NWIA 4GFJA 1V38A 5KFIA 3G6XA 4B9NA 1QLNA 1XO1A 4YXMA 3UPQA 3Q8MA 2ZIVB 1JIHA 4DFDA 2BQUA 2BR0A 2KFZA 1ZQTA 4KLSA 4KX5A 1RXVA 4TUPA 3KHLA 8ICZA 3OSPA 5CR0A 2YN4A 2W9MA 3RJIA 5DLGA 1NK6A 4X5VA 4TQSA 4P4OA 1Z4OA 2W9AA 1JXEA 4QIWC 4M2YA 5J0SA 3BJYA 1JXLA 2NYVA 4FO6A 1FFVA 1PVPA 2AHOB 1N62A 2ZIUB 4IQVA 1IM4A 2IHMA 4OJLA 5AI5A 3RJGA 3IHQB 4XA5A 4F2SA 1A77A 5JTIA 3AMZA 2W9BA 2PFOA 3MFIA 2XY5A 1IG6A 5CEHA 4ZH4A 4GC7A 4EELA 5DLFA 2NRXA 1Z00A 3PSFA 1PK1A 4O9MA 2NRWA 4OJOA 1WUDA 4M04A 2HW3A 1X9MA 1MN8A 3UQ2A 4EBDA 4I27A 3GQCA 3KD3A 3HKZC 4UBBA 3EWAA 3Q8PB 3AU6A 5J0XA 5KFPA 1NNLA 3T3FA 3QUBA 2HVHA 5KG0A 5KFYA 1BPBA 4BJQA 3ZDCA 2HHTA 3MR3A 3AEVA 3D2QA 2VANA 2RQ5A 4MFFA 4XRHA 4BX9C 1NK9A 1WWVA 4HAIA 4XQ8A 3NUQA 5EE9A 1N5XA 1U9LA 5ALNA 5J0TA 3RFAA 2W8KA 7ICVA 4C8KA 8ICMA 4Y2RA 1T94A 4JV0A 1A0PA 3BQ0A 2ZTEA 5DB6A 3OHAA 3L5KA 4PL2A 4YD1A 4QZFA 1L5UA 3OPXA 4M9JA 3ICXA 4C4RA 5KL8B 3V72A 1AROP 5KG2A 5D49A 4O3MA 1S0NA 3HPOA 1H38A 3QU9A 4P0QA 3MGVA 2YQEA 2FLNA 3CP8A 1FO4A 1JRPA 2DPJA 4RQ4A 2V4RA 4B9VA 1SL1A 2HHUA 2EZYA 3TADA 1KFSA 5KAIU 1ZJNA 5GTHU 2EQYA 4ELUA 5DDMA 4F8RA 2YMMA 2A1JA 2W9CB 7ICQA 1V97A 2E3TA 5AM5A 3UMCA 4UAZA 1N5WA 4JB3A 2F8KA 2BCSA 1XC9A 2HOIA 1ZQSA 2C22A 1N60A 2D3DA 1X40A 2FDRA 4MEYA 8ICIA 2H3FA 3WU2U 1RXWA 2BQRA 3PX0A 1NKCA 4G9BA 5AM3A 5KFWA 1NZPA 3H4BA 2VA3A 3IN5A 1BPZA 5L1IA 3RH5A 1Z19A 2PI4A 1Y88A 2K4EA 2HHXA 3AN1A 3K75D 1TAQA 1ZQNA 2K4PA 1WWUA 5IIKA 1PVRA 3H8SA 2XGQA 4RQ2A 2XCPA 3JPTA 9ICCA 4LZGA 4P4MA 4GXJA 4P2HA 4PHPA 4QWBA 3RH6A 1BNPA 4E0DA 5DG7A 2RLTA 3H0RB 1ZQGA 3SENA 4NLKA 5AM2A 4RQ7A 4EX7A 4F4XA 5DGAA 5HR7A 1ZQAA 1RM6C 1X9SA 2BCQA 3M1YA 2JXJA 7ICMA 1BNOA 5G5HA 4EEYA 2GWSA 4DSKA 1NZBA 3T5JA 3RAQA 4ED6A 1PK3A 3H4DA 4ELVA 4TUSA 4CF3A 4O0IA 4KMOB 4QW8A 1ZJMA 1WYGA 2DF4B 4I2JA 4KTQA 8ICAA 1MC8A 4EZ9A 1RYUA 2KHQA 4RQ3A 3B0YA 3WKCA 5BOLA 1WCNA 2HOQA 1WG8A 4US9A 4Z6DA 2A1AA 2IMWP 4I2CA 5KFAA 5AKYA 2WHEA 3KHHA 1MQ2A 2K4IA 2NRZA 4Y2PA 4QIWF 3JPOA 3KZXA 2GH1A 2YB1A 1BGXT 5DGBA 3UMBA 2M9NA 5DQHA 4O5KA 1UT8A 2FLPA 4DQPA 2JH1A 1NJWA 2JH7A 5J2AA 1KL9A 4K4HA 3WK6A 4O3PA 1PUZA 2AQ4A 9ICSA 4TUQA 4RZRA 5ALDA 4RUAA 1IIPA 2NRTA 4RT2A 3RB6A 5ALKA 1O03A 4NJ8A 1KKXA 3EYZA 4QZIA 4IR1A 3H7IA 4EYHB 3QU7A 1DGSA 2HI0A 1XSPA 3EUB2 4B9SA 4CGZA 4F91B 5J0PA 3HKZF 3I28A 3JPSA 7ICUA 2G08A 3T5LA 2KKPA 5J0YA 5DB7A 3O0FA 2DL0A 1S10A 3PMLA 3GIJA 1O08A 5ALXA 2GOLA 2KSOB 2ESEA 2JV3A 3D2SA 9ICLA 2I1QA 4RPZA 4R66A 1TAUA 2KZMA 2KK0A 5HHHA 2W8LA 2F1HA 3CYMA 1J2NA 4WJ3B 2AXTU 1SKWA 1S97A 4C4TA 4B9UA 1J2MA 3M7DA 3OJUA 4KN7A 1SIJA 4PHEA 1ZETA 4EZ6A 4G3IA 5L1JA 3KHRA 2BDUA 4FE3A 2DKZA 4R8UB 4DSLA 4MF2A 2XY7A 5ALRA 1SL2A 2G0AA 2H3VA 1Q3UA 1ZQZA 9ICXA 4PZNA 1L7OA 3C5GA 4IQUA 5ALEA 2E8PA 5ALQA 1SZPA 2RDJA 3LWMA 1ZQDA 2CPRA 3F2BA 3KOOA 3F5EA 4MF8A 5KFGA 4U6PA 1ZQLA 3F2CA 1D8BA 1ZQYA 4BXOB 2KVSA 5KT7A 4KLUA 4BDPA 3C2LA 4P0PB 4FZMA 5ALJA 4PGXA 2F2AB 5KT3A 2MU2A 1ECWA 1K5OA 2W03A 4NM1A 3RRHA 5K4LA 2ZTCA 4IRCA 3TARA 5ALZA 5AKKA 4NY8A 2J6SA 4ECRA 1RQNA 4F5RA 4J9SA 3U26A 2JEIA 2E1FA 2JR5A 3PW0A 4M9LA 2XGPA 4DQIA 5KFRA 4F72A 1UCVA 1ZD4A 1HEKA 8ICKA 5AM1A 4M9GA 3I76A 1DOQA 1UHUA 7ICIA 4I2HA 3ZDDA 9ICMA 1S76D 4R65A 3HRDD 2EZXA 8ICSA 1B43A 2ZIXA 5DB9A 9ICJA 3C23A 1L7MA 3RB4A 3OSNA 2WB1C 1OXJA 4RQ0A 3RJKA 3PX4A 4FFDA 3NVVA 4RNMA 4UB1A 4UB2A 2C2DA 2FMSA 2IOFK 4O3RA 2IA6A 2YTUA 3AQFA 2YMLA 1QH9A 1F5SA 3N7PD 3NASA 2HHVA 3AU2A 4Q44A 4UAVA 5B5EU 2YB4A 5KFVA 7ICOA 2KHVA 5AI0A 2OEHA 2HDOA 4PHDA 1S0VA 1L7NA 5H2FU 3F2DA 2FPLA 3OTQA 2BQ3A 3M6KA 4K4IA 2BCRA 4O3SA 4QWDA 8ICVA 1X6JA 9ICNA 1TAMA 1Q8KA 3E2EA 2ZIVA 4FBTA 4QZGA 9ICVA 7ICHA 4Q43A 5AI9A 4OO1J 9ICEA 2AGPA 3SMVA 1KBUA 5IIOA 3Q8KA 1P7DA 4UARA 1F0MA 1SXEA 4DCCA 3PSIA 2DKXA 1N56A 4US8A 4RQ8A 1M6YA 4J9MA 7ICJA 1YZ6A 5J2BA 1N48A 2K60A 4RU9A 2V9WA 5J0UA 3J81j 1XSNA 5KG3A 2PKEA 2ZIUA 2W7OA 3GIMA 4I2GA 2LBOA 4ECTA 3V6HA 2VIXA 3QXGA 1T7PA 3Q8LA 8ICNA 1ZOLA 4AYBC 2RDIA 4AP9A 3BQ1A 5D46A 5ALYA 2BZFA 3TADC 4DQQA 2ZUDA 3N28A 3RRGA 2KFNA 2QB0B 2JMGA 1L7PA 1KTQA 1NKEA 2K8AA 2BCUA 2BGWA 1VJ5A 1SV4A 3GIKA 4KLEA 3GV7B 2F1IA 3GV8B 5AIBA 1RPLA 5KFMA 4UB8U 1Q3VA 3DEEA 3AM9A 1L3VA 2NO5A 2KE7A 2YY6A 3K4GA 4JV2A 1ZQUA 2V4QA 2FPKA 1TK0A 5ALGA 4GXIA 3ALRA 4RQMA 2R8IA 2BDPA 4Q8FA 3JPQA 3Q8QB 3LK9A 5ALUA 2R8KA 3TAQA 3ED5A 3NVWA 3OGUA 2KIWA 1QCKA 4TQRA 4YMOA 5KFZA 5C5JA 8ICWA 2HBLA 3ETLA 1KDHA 2YX8A 2KVCA 2ZXIA 3NS1A 5EE0A 4DOCA 4J9KA 1MA7A 5CRXA 1NKBA 3NRZA 1SKSA 1TFRA 4Y2TA 3RJFA 8ICHA 5J0QA 2MA1A 3GV5B 2W55A 2Y9TA 5J2GA 3QEBZ 2ASJA 1DK3A 1JX4A 2ZJ5A 2ISPA 2KTQA 3VCBA 2W04A 1ZQOA 1U4BA 1IXRA 4O3QA 5KFXA 2D8CA 2G5IB 4FZLA 3SR6A 9ICBA 3SYZA 3SAGA 9ICUA 5L1KA 4F5OA 4Z6CA 4NM2A 5J0WA 1ZRMA 2JRZA 4YMNA 5ALMA 4TURA 3RR8A 3RJHA 5JU5A 3QU4A 2R8GA 2AQ0A 4F71A 1D9FA 3FC4A 2E8MA 5A0LA 2ATLA 1DRGA 1UPHA 2W9CA 4RQNA 5J2DA 1ZQQA 2VA8A 3KZIU 2M0NA 1SL0A 2ZJAA 4C8LA 3FAHA 1VDVA 3IG5A 2W43A 3QE9Y 1CUKA 9ICRA 2FLLA 3M8RA 2FI1A 5KTQA 3THVA 4KX3A 3KHGA 1NJYA 5KFLA 1K1QA 4RQ6A 3MR6A 2KJ5A 1V85A 4J9LA 2LMRA 1ZQHA 3S6JA 1XSLA 4O3NA 3RF9A 3NRWA 5DB8A 2WB1F 1JMSA 1URJA 4FZNA 2OH2A 1X9WA 3BS5B 2K4HA 7ICSA 4GXKA 2IBKA 4DL5A 1BPDA 3F53A 3QZ7A 5J0OA 3Q8SB 3ETRA 3D2NA 4ED7A 5JRTA 1LB2B 1X66A 2GO7A 1T8EA 2AU0A 1DK2A 1ZXIA 2KOBA 1ZD2P 2Q0ZX 3WKDA 2AGOA 4USAA 3A0HU 3PY8A 3PSPA 2EDUA 4QZBA 4YP3A 2JZBB 5EE1A 4KLIA 3UM9A 2Z7JA 2ES6A 3PZPA 3SEIA 3UXNA 2W11A 3QZ8A 2CN1A 3IV6A 2HBKA 2AJQA 1S8OA 3HWTA 2OWOA 1XO0A 3QUCA 2LI6A 9ICTA 5KFNA 4ACOA 4PGYA 3H0LB 3SV4A 3E58A 3BZKA 3ZD9A 1Z4NA 2P6UA 3PVXA 3PX6A 3KTQA 3AUOA 2OM6A 5ALIA 1SXDA 1TK5A 4CNQA 2XI9A 2MRLA 2I6XA 2UVRA 5D4BA 4PZOA 4MFAA 7ICEA 3BQTA 5DBAA 4KLHA 5KG5A 2DFLA 3QU2A 2UVVA 3ZD8A 2BHNA 2W3SA 3GZFA 5CP2A 4DLEA 4QZDA 5AI4A 5AM0A 5AKLA 4UAYA 4DWIA 3QX7A 3SZ2A 2ZXHA 4HYKA 5HMLA 4XUSA 4F50A 4C8OA 4EBEA 2WF8A 3JPRA 1DGJA 4OD0A 3FM9A 2JEJA 2N1RA 1COOA 4PGQA 3ISBA 4Y2UA 5KFQA 1ZQEA 3IM1A 3V6KA 1Q46A 4C0ZA 5KFFA 3EPIA 4UAUA 4AYBF 4F4YA 3H8JA 3SAFA 1UA1A 2A19A 1NK0A 5B66U 1ZYQA 1U47A 3TFSA 2HHWA 1QSYA 4LVSA 3KKAC 3N7SC 4B6JA 7ICLA 3ZDEA 4ELTA 2XICA 4KN4A 2BPGA 1RQLA 3H40A 1RZTA 2NV3A 4Y2YA 1Z3EB 3CW2C 3ONNA 1SV0A 1Z1BA 9ICGA 1HUZA 1PZNA 4ECYA 5KFKA 1ZQXA 3NVZA 2IOFA 3HW8A 2F1JA 4F4WA 3TKAA 4IC9A 5ALOA 3GIIA 3RB3A 2GLEA 4CRXA 9ICAA 2QARB 4IL6U 2WF5A 1RG6A 4ECZA 1SWVA 1ZD3A 5KG7A 1A6SA 1F44A 2IOHA 2KSOA 1T4GA 1CI4A 4EBCA 1HUOA 1OUQA 2EANA 3ISDA 1KEJA 4MFCA 5AKGA 4DEZA 2KMDA 5L9XA 2W54A 3H8MA 2HCFA 1XU4A 1LKYB 1ZQVA 4KITB 2PXIA 7ICTA 2ASLA 4UB4A 2F77X 4ECVA 2NRVA 2B0CA 4K4GA 5J0RA 2F3NA 5HHIA 2ZIWB 3G6VA 1TV9A 1GO3F 5EWGA 3IRUA 1ZQPA 3UXOA 4R8UA 2HSZA 1X42A 5IIMA 5KFCA 4Y2VA 2VKQA 4PHAA 4NLGA 4DF4A 3FYHA 3BS7A 2JEFA 8ICTA 4DL6A 1FEZA 4RQ1A 3WK4A 3G6YA 1KFDA 2KP7A 5IILA 3KKAA 3M9NB 5KG1A 4RNOA 5J2KA 8ICRA 1L6NA 2KJ9A 5F9LA 4UB3A 4BXOA 2YMQA 2ODGA 2XC9A 2E5SA 3UXPA 5BPCA 4P0PA 5TISU 4M9HA 5ALFA 1SB3C 2WTFA 5IINA 4Z6FA 1S5LU 5KFTA 3R9KA 2KNJA 3JPNA 8ICFA 2FE9A 3M8SA 2Y1IA 4OJ6A 4IR9A 1S0MA 2BCVA 3WK7A 2IHNA 3UMGA 4IRDA 5KG4A 1T3NA 2FMQA 3CNHA 1HJPA 5KT6A 2DBYA 2QB1A 3SAHA 8ICUA 1ZQMA 3MR5A 4ED3A 1DXSA 4KLLA 3F5AA 4ICAA 4UB6U 8ICLA 4OJ5A 2PFNA 5AK4A 2Y0SC 3JPPA 5CHGA 4ECXA 2P66A 5G5GA 4CF4A 4NV0A 5AM4A 1B0XA 4KLMA 9ICFA 3GU3A 2MUTB 4M47A 4FBUA 5DG8A 8ICYA 1KFTA 4YR2A 4M0AA 3IDWA 5DG9A 3TI0A 5IIIA 3C5FA 4OCZA 2G5HB 3WKEA 2DGZA 3N97B 2O6KA 1TKDA 4I2AA 4YFKA 1KQQA 4KLFA 2A3VA 3V7JA 1UQVA 4ED8A 3ISCA 2KZZA 3NTUA 4J9RA 1TVAA 5J2JA 2KICA 5C0YA 2CXYA 9ICPA 3PO5A 5J8YA 5JUMA 2HHSA 1S9FA 5ALWA 2KIVA 4C8NA 2KKVA 4M6WB 2NO4A 4I2IA 3I1YA 5KL1B 4F4KA 1D8YA 8ICOA 4J03A 3K1ZA 2CRXA 5ALTA 1NJZA 3PR5B 3GILA 9ICHA 4BWJA 1KLNA 4CCHA 2LKYA 3HJEA 2LYHA 4I28A 3UQ0A 4DQSA 4GIBA 5DQIA 2OCEA 4KLGA 5J2CA 1HIWA 2E8OA 4MHVA 4GC6A 1KSPA 4DOAA 1ZQJA 3M6ZA 1VLBA 4C8MA 3V7LA 4DFPA 2W7PA 3AL0B 2MSNA 3MFHA 1U45A 3TQ1A 1KW4A 4YXJA 2R8JA 5KFEA 5AICA 4DL4A 5TZVA 4QWEA 5AKZA 2HBJA 3ZI4A 4NL9A 4B9LA 5T14A 4A8EA 5AKXA 5KT4A 1JN3A 5HP4A 2QB0A 5J29A 3TACB 3PNCA 4O5CA 4U7CA 5KAFU 1BPXA 2AGQA 7ICRA 2D6FC 3H0MB 3PR4A 3PW4A 9ICKA 3FDSA 3C1ZA 1CRXA 2H3ZA 2W9BB 1J97A 3TAPA 3DDHA 2LM1A 1B22A 2ALZA 1Z00B 3ZDBA 1PK1B 2OHFA 3RJEA 3B0XA 3WK9A 2HVIA 4KLTA 1JALA 1LV5A 2BPFA 4IS7A 3IG8A 2VJ5A 3QYPA 4RNNA 2P35A 4YG2A 3C28A 4DS4A 4PH5A 5EWEA 5HNKA 1B4FA 8ICXA 2G07A 1V9PA 2VJ4A 3LVWA 1QSLA 4I2DA 4QZCA 5DBBA 2DPIA 2DQNB 1C20A 1BVSA 5HR6A 4DS5A 1XNSA 4MEXA 2ZG6A 2XY6A 2ZTDA 2OYYA 4JWMA 4YD2A 3M9MB 3M9OB 8ICGA 2VA2A 4QZAA 3MGIA 3ORYA 5DBCA 3N7RC 5AHXA 5GTIU 3K1RB 3QU5A 2I5HA 4M9NA 3WKBA 3RH4A 4F3OA 4NLNA 3T79A 3PSTA 4DSEA 4DSFA 3QNMA 8ICPA 2LYAA 8ICJA 4NLZA 4DSJA 5DKWA 2YMPA 3KBBA 1L3TA 7ICPA 1U48A 2EAOA 2ZJ8A 3OHBA 4NLCA 2JHDA 5AKHA 4CF5A 1NK7A 4P0QB 3KFUF 1JI7A 4I2EA 4YR0A 2WF6A 9ICWA 4YR3A 2PMZC 1UA0A 3C2MA 4BGDA 3QUQA 4KLOA 2WF7A 4YMMA 3PW2A 4DL7A 2K89A 5J2HA 2KN7A 1N2XA 2BKEA 4QNLA 4QZ9A 2LHTA 2A1JB 1NK5A 2Y0SF 5KFBA 2R18A 4RQ5A 4JUZA 5J2IA 4CE6A 3MR2A 4DL2A 2BPCA 1RYSA 4F92B 3CRXA 5KFSA 4R64A 3NGDA 1ZQIA 5CWRA 4FS1A 1SWWA 1S77D 3BS5A 3LWLA 1NJXA 4F5PA 4UASA 4Y2QA 2DWQA 1MQ3A 5AK6A 3C21A 3EZ5A 1FIQA 1SGGA 3WKAA 4DFMA 3C1YA 1ZQ1C 3AQEA 2OXOA 3OJSA 1MSWD 5KNIA 2PFPA 1X6IA 4DQRA 3E0FA 4KLDA 3C2KA 3SI8A 1BPYA 4EX6A 2JZBA 1ZQRA 5ALPA 1SV0C 2RRDA 4IQTA 5EE3A 2C2EA 3Q8RB 2DUYA 4F93B 2LPEA 1L3SA 2ZUBA 3LDAA 4UQGA 3PV8A 2E8NA 4UB5A 3LYSA 9ICIA 2MAXA 3WK5A 3DV9A 4OJPA 3A0BU 1CEZA 4RT3A 3N4MB 1ZRNA 5AKIA 1N61A 3QUTA 4QWCA 2J6UA 3V6JA 1SKRA 3MDCA 3PW7A 3RTVA 2C28A 2XIDA 5IIJA 4I2BA 4C7YA 4DOBA 4JMUA 5CB1A 1A76A 1IV8A 4BUGA 4ECSA 4CDGA 5L1MA 5J2EA 4I29A 3SV3A 2WAQC 2AH5A 1QTMA 4J9NA 1XWLA 4UAWA 1YZ7A 1NK4A 7ICFA 2Q4TA 4YQWA 4KLJA 3T5HA 5ALSA 1ZQCA 2HMXA 5L1LA 2KD1A 4KLQA 1T3QA 3B9JA 4QW9A 2UVUA 4Y2XA 5E79U 1PVQA 2WFAA 3H8WA 4C7ZA 8ICBA 2HHQA 3L3FX 9ICOA 4O3OA 3MDAA 3RJJA 3L4PA 3BZCA 5CA7A 2PI5A 3RBDA 1D8LA 4B9MA 3HT3A 3SD7A 4JV1A 4KMUA 2H5XA 1ZD5A 4ECWA 4YN4A 1S0OA 4P4PA 3WK8A 2H3QA 2ISOA 1XS9D 2B21A 1K1SA 1TE2A 5KT5A 3RBEA 2QARA 4F5QA 2HOFA 5KFJA 4FS2A 3RB0A 2PFQA 4EYIB 3RR7A 4IQWA 2KV2A 4RUCA 4J9OA 2L5YA 2ZUCA 4JK1A 5KFDA 5DQGA 2EH9A 5KT2A 3PMNA 1ZQFA 9ICQA 3MABA 4UW9A 4Q45A 1LKYA 5ALLA 2Y1JA 2KJ8A 4DFKA 2FJ6A 3EW9A 2EAMA 4ZOHC 1QQ7A 3T5KA 1WCLA 2Y9UA 2KEYA 1Z1VA 4LJXA 3RAXA 2G09A 2ZIWA 5AKEA 2XO7A 4DFJA 4DL3A 4NLBA 4DSIA 3GDXA 1C7YA 4GLXA 4PPXA 4YVZA 4EENA 2C2RA 2QLTA 2EZZA 1UT5A 5BOMA 7ICGA 5AI6A 2QKQA 2F8LA 5ALVA 1U49A 4DLGA 1RDFA 3HILA 3MGHA 4J9PA 3LVVA 2E1EA 1KN5A 4EEKA 5KG6A 2F76X 2P6RA 4ECQA 5DDYA 2H3IA 4QWAA 1D9DA 4ED0A 1ED1A 3TFRA 3IP4B 2B6GA 4F5NA 2UVWA 3QEAZ
chains in the Genus database with same CATH topology
2D8CA 2K60A 2ES6A 3SEIA 1SGGA 2GLEA 1PK1A 2QARB 1RG6A 2QB1A 2F8KA 2KG5A 1OXJA 1COKA 1DXSA 5KNIA 2KSOA 2D3DA 1X40A 2E8OA 5JU5A 4MHVA 5J8YC 2EANA 2E8MA 2F44A 1OW5A 2KMDA 1SXDA 2DKZA 3TADC 1SV0C 3H8MA 1LKYB 4RQNA 2YTUA 2QARA 4PZOA 3K1RB 2QB0B 4PZNA 2LPEA 1KW4A 1V38A 3BQ7A 1WWVA 2E8NA 2F3NA 2E8PA 1SV4A 1B0XA 2L5YA 2K4PA 4NL9A 1WWUA 1LKYA 2KE7A 3IDWA 1V85A 2EAOA 2QB0A 4NJ8A 2LMRA 3TACB 4RQMA 2EAMA 3BS7A 1JI7A 2Y9UA 1Z1VA 3BS5B 3KKAA 5L1MA 1UQVA 3SENA 3KKAC 5JRTA 1X66A 2QKQA 4NL9C 1PK1B 3HILA 5J8YA 1X9XA 4IS7A 2DL0A 2Y9TA 1F0MA 1SXEA 2KIVA 1UCVA 2DKXA 5F3XB 3TADA 2KSOB 1SV0A 2EAPA 2FE9A 5JTIA 3BS5A 2ESEA 1PK3A 2JV3A 1B4FA 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8C A;  2K60 A;  2ES6 A;  3SEI A;  1SGG A;  2GLE A;  1PK1 A;  2QAR B;  1RG6 A;  2QB1 A;  2F8K A;  2KG5 A;  1OXJ A;  1COK A;  1DXS A;  5KNI A;  2KSO A;  2D3D A;  1X40 A;  2E8O A;  5JU5 A;  4MHV A;  5J8Y C;  2EAN A;  2E8M A;  2F44 A;  1OW5 A;  2KMD A;  1SXD A;  2DKZ A;  3TAD C;  1SV0 C;  3H8M A;  1LKY B;  4RQN A;  2YTU A;  2QAR A;  4PZO A;  3K1R B;  2QB0 B;  4PZN A;  2LPE A;  1KW4 A;  1V38 A;  3BQ7 A;  1WWV A;  2E8N A;  2F3N A;  2E8P A;  1SV4 A;  1B0X A;  2L5Y A;  2K4P A;  4NL9 A;  1WWU A;  1LKY A;  2KE7 A;  3IDW A;  1V85 A;  2EAO A;  2QB0 A;  4NJ8 A;  2LMR A;  3TAC B;  4RQM A;  2EAM A;  3BS7 A;  1JI7 A;  2Y9U A;  1Z1V A;  3BS5 B;  3KKA A;  5L1M A;  1UQV A;  3SEN A;  3KKA C;  5JRT A;  1X66 A;  2QKQ A;  4NL9 C;  1PK1 B;  3HIL A;  5J8Y A;  1X9X A;  4IS7 A;  2DL0 A;  2Y9T A;  1F0M A;  1SXE A;  2KIV A;  1UCV A;  2DKX A;  5F3X B;  3TAD A;  2KSO B;  1SV0 A;  2EAP A;  2FE9 A;  5JTI A;  3BS5 A;  2ESE A;  1PK3 A;  2JV3 A;  1B4F A;  2B6G A; 
#chains in the Genus database with same CATH topology
 4Z6E A;  4O5E A;  1X2I A;  5KFO A;  2RP5 A;  1JRO A;  2LYB A;  4QJF B;  2J6T A;  5AIA A;  4B9T A;  2I9G A;  8ICC A;  3D6J A;  1ZQK A;  2KG5 A;  3GFK B;  2JGA A;  8ICQ A;  5KFH A;  1NI3 A;  4PJ0 U;  5AKJ A;  5F9N A;  2HBM A;  5J8Y C;  2PMZ F;  1EXN A;  4DF8 A;  7ICN A;  4JWN A;  4Y2J A;  1OW5 A;  1SZH A;  8ICE A;  5HMM A;  1AQ6 A;  7ICK A;  2FMP A;  4F4Z A;  4ED2 A;  3MC1 A;  3NVY A;  3BQ7 A;  3BDP A;  2ASD A;  1NOM A;  2LM4 A;  2K8C B;  2W3R A;  5FP0 A;  5CJ7 A;  2K8B B;  4Y2S A;  2XCA A;  5EOZ A;  4C4S A;  1L3U A;  2RHF A;  3SQI A;  2KZ3 A;  4UBC A;  4DO9 A;  4C80 A;  3HP6 A;  4IRK A;  2FPM A;  4R63 A;  5AK5 A;  4YCX A;  4QZE A;  1QQ5 A;  1QQ6 A;  5J2F A;  2MUT A;  4I2F A;  1ZQW A;  1BPE A;  4QZH A;  4PL1 A;  4ED1 A;  4NL9 C;  4UAT A;  2ZIX B;  1LVH A;  5AI8 A;  1ZQB A;  4NXZ A;  1X9X A;  1L8L A;  2JEG A;  5EWF A;  5F3X B;  2EAP A;  3C29 A;  5KFU A;  1TK8 A;  1QSS A;  3PO4 A;  3TAN A;  4QZ8 A;  4F2R A;  3BQ2 A;  3ZDA A;  2G06 A;  3VC8 A;  1YT3 A;  1NK8 A;  4LZD A;  4RPY A;  1KRP A;  5ALH A;  1RYR A;  1COK A;  4M6W A;  5AK3 A;  4BWM A;  3EPG A;  4ECU A;  4Q8E A;  4J9Q A;  3PW5 A;  1FFU A;  1N63 A;  3MBY A;  3HX0 A;  4RPX A;  2F44 A;  2WF9 A;  2XVT A;  2WAQ F;  3V7K A;  1JUD A;  1L8O A;  2R8H A;  4NWI A;  4GFJ A;  1V38 A;  5KFI A;  3G6X A;  4B9N A;  1QLN A;  1XO1 A;  4YXM A;  3UPQ A;  3Q8M A;  2ZIV B;  1JIH A;  4DFD A;  2BQU A;  2BR0 A;  2KFZ A;  1ZQT A;  4KLS A;  4KX5 A;  1RXV A;  4TUP A;  3KHL A;  8ICZ A;  3OSP A;  5CR0 A;  2YN4 A;  2W9M A;  3RJI A;  5DLG A;  1NK6 A;  4X5V A;  4TQS A;  4P4O A;  1Z4O A;  2W9A A;  1JXE A;  4QIW C;  4M2Y A;  5J0S A;  3BJY A;  1JXL A;  2NYV A;  4FO6 A;  1FFV A;  1PVP A;  2AHO B;  1N62 A;  2ZIU B;  4IQV A;  1IM4 A;  2IHM A;  4OJL A;  5AI5 A;  3RJG A;  3IHQ B;  4XA5 A;  4F2S A;  1A77 A;  5JTI A;  3AMZ A;  2W9B A;  2PFO A;  3MFI A;  2XY5 A;  1IG6 A;  5CEH A;  4ZH4 A;  4GC7 A;  4EEL A;  5DLF A;  2NRX A;  1Z00 A;  3PSF A;  1PK1 A;  4O9M A;  2NRW A;  4OJO A;  1WUD A;  4M04 A;  2HW3 A;  1X9M A;  1MN8 A;  3UQ2 A;  4EBD A;  4I27 A;  3GQC A;  3KD3 A;  3HKZ C;  4UBB A;  3EWA A;  3Q8P B;  3AU6 A;  5J0X A;  5KFP A;  1NNL A;  3T3F A;  3QUB A;  2HVH A;  5KG0 A;  5KFY A;  1BPB A;  4BJQ A;  3ZDC A;  2HHT A;  3MR3 A;  3AEV A;  3D2Q A;  2VAN A;  2RQ5 A;  4MFF A;  4XRH A;  4BX9 C;  1NK9 A;  1WWV A;  4HAI A;  4XQ8 A;  3NUQ A;  5EE9 A;  1N5X A;  1U9L A;  5ALN A;  5J0T A;  3RFA A;  2W8K A;  7ICV A;  4C8K A;  8ICM A;  4Y2R A;  1T94 A;  4JV0 A;  1A0P A;  3BQ0 A;  2ZTE A;  5DB6 A;  3OHA A;  3L5K A;  4PL2 A;  4YD1 A;  4QZF A;  1L5U A;  3OPX A;  4M9J A;  3ICX A;  4C4R A;  5KL8 B;  3V72 A;  1ARO P;  5KG2 A;  5D49 A;  4O3M A;  1S0N A;  3HPO A;  1H38 A;  3QU9 A;  4P0Q A;  3MGV A;  2YQE A;  2FLN A;  3CP8 A;  1FO4 A;  1JRP A;  2DPJ A;  4RQ4 A;  2V4R A;  4B9V A;  1SL1 A;  2HHU A;  2EZY A;  3TAD A;  1KFS A;  5KAI U;  1ZJN A;  5GTH U;  2EQY A;  4ELU A;  5DDM A;  4F8R A;  2YMM A;  2A1J A;  2W9C B;  7ICQ A;  1V97 A;  2E3T A;  5AM5 A;  3UMC A;  4UAZ A;  1N5W A;  4JB3 A;  2F8K A;  2BCS A;  1XC9 A;  2HOI A;  1ZQS A;  2C22 A;  1N60 A;  2D3D A;  1X40 A;  2FDR A;  4MEY A;  8ICI A;  2H3F A;  3WU2 U;  1RXW A;  2BQR A;  3PX0 A;  1NKC A;  4G9B A;  5AM3 A;  5KFW A;  1NZP A;  3H4B A;  2VA3 A;  3IN5 A;  1BPZ A;  5L1I A;  3RH5 A;  1Z19 A;  2PI4 A;  1Y88 A;  2K4E A;  2HHX A;  3AN1 A;  3K75 D;  1TAQ A;  1ZQN A;  2K4P A;  1WWU A;  5IIK A;  1PVR A;  3H8S A;  2XGQ A;  4RQ2 A;  2XCP A;  3JPT A;  9ICC A;  4LZG A;  4P4M A;  4GXJ A;  4P2H A;  4PHP A;  4QWB A;  3RH6 A;  1BNP A;  4E0D A;  5DG7 A;  2RLT A;  3H0R B;  1ZQG A;  3SEN A;  4NLK A;  5AM2 A;  4RQ7 A;  4EX7 A;  4F4X A;  5DGA A;  5HR7 A;  1ZQA A;  1RM6 C;  1X9S A;  2BCQ A;  3M1Y A;  2JXJ A;  7ICM A;  1BNO A;  5G5H A;  4EEY A;  2GWS A;  4DSK A;  1NZB A;  3T5J A;  3RAQ A;  4ED6 A;  1PK3 A;  3H4D A;  4ELV A;  4TUS A;  4CF3 A;  4O0I A;  4KMO B;  4QW8 A;  1ZJM A;  1WYG A;  2DF4 B;  4I2J A;  4KTQ A;  8ICA A;  1MC8 A;  4EZ9 A;  1RYU A;  2KHQ A;  4RQ3 A;  3B0Y A;  3WKC A;  5BOL A;  1WCN A;  2HOQ A;  1WG8 A;  4US9 A;  4Z6D A;  2A1A A;  2IMW P;  4I2C A;  5KFA A;  5AKY A;  2WHE A;  3KHH A;  1MQ2 A;  2K4I A;  2NRZ A;  4Y2P A;  4QIW F;  3JPO A;  3KZX A;  2GH1 A;  2YB1 A;  1BGX T;  5DGB A;  3UMB A;  2M9N A;  5DQH A;  4O5K A;  1UT8 A;  2FLP A;  4DQP A;  2JH1 A;  1NJW A;  2JH7 A;  5J2A A;  1KL9 A;  4K4H A;  3WK6 A;  4O3P A;  1PUZ A;  2AQ4 A;  9ICS A;  4TUQ A;  4RZR A;  5ALD A;  4RUA A;  1IIP A;  2NRT A;  4RT2 A;  3RB6 A;  5ALK A;  1O03 A;  4NJ8 A;  1KKX A;  3EYZ A;  4QZI A;  4IR1 A;  3H7I A;  4EYH B;  3QU7 A;  1DGS A;  2HI0 A;  1XSP A;  3EUB 2;  4B9S A;  4CGZ A;  4F91 B;  5J0P A;  3HKZ F;  3I28 A;  3JPS A;  7ICU A;  2G08 A;  3T5L A;  2KKP A;  5J0Y A;  5DB7 A;  3O0F A;  2DL0 A;  1S10 A;  3PML A;  3GIJ A;  1O08 A;  5ALX A;  2GOL A;  2KSO B;  2ESE A;  2JV3 A;  3D2S A;  9ICL A;  2I1Q A;  4RPZ A;  4R66 A;  1TAU A;  2KZM A;  2KK0 A;  5HHH A;  2W8L A;  2F1H A;  3CYM A;  1J2N A;  4WJ3 B;  2AXT U;  1SKW A;  1S97 A;  4C4T A;  4B9U A;  1J2M A;  3M7D A;  3OJU A;  4KN7 A;  1SIJ A;  4PHE A;  1ZET A;  4EZ6 A;  4G3I A;  5L1J A;  3KHR A;  2BDU A;  4FE3 A;  2DKZ A;  4R8U B;  4DSL A;  4MF2 A;  2XY7 A;  5ALR A;  1SL2 A;  2G0A A;  2H3V A;  1Q3U A;  1ZQZ A;  9ICX A;  4PZN A;  1L7O A;  3C5G A;  4IQU A;  5ALE A;  2E8P A;  5ALQ A;  1SZP A;  2RDJ A;  3LWM A;  1ZQD A;  2CPR A;  3F2B A;  3KOO A;  3F5E A;  4MF8 A;  5KFG A;  4U6P A;  1ZQL A;  3F2C A;  1D8B A;  1ZQY A;  4BXO B;  2KVS A;  5KT7 A;  4KLU A;  4BDP A;  3C2L A;  4P0P B;  4FZM A;  5ALJ A;  4PGX A;  2F2A B;  5KT3 A;  2MU2 A;  1ECW A;  1K5O A;  2W03 A;  4NM1 A;  3RRH A;  5K4L A;  2ZTC A;  4IRC A;  3TAR A;  5ALZ A;  5AKK A;  4NY8 A;  2J6S A;  4ECR A;  1RQN A;  4F5R A;  4J9S A;  3U26 A;  2JEI A;  2E1F A;  2JR5 A;  3PW0 A;  4M9L A;  2XGP A;  4DQI A;  5KFR A;  4F72 A;  1UCV A;  1ZD4 A;  1HEK A;  8ICK A;  5AM1 A;  4M9G A;  3I76 A;  1DOQ A;  1UHU A;  7ICI A;  4I2H A;  3ZDD A;  9ICM A;  1S76 D;  4R65 A;  3HRD D;  2EZX A;  8ICS A;  1B43 A;  2ZIX A;  5DB9 A;  9ICJ A;  3C23 A;  1L7M A;  3RB4 A;  3OSN A;  2WB1 C;  1OXJ A;  4RQ0 A;  3RJK A;  3PX4 A;  4FFD A;  3NVV A;  4RNM A;  4UB1 A;  4UB2 A;  2C2D A;  2FMS A;  2IOF K;  4O3R A;  2IA6 A;  2YTU A;  3AQF A;  2YML A;  1QH9 A;  1F5S A;  3N7P D;  3NAS A;  2HHV A;  3AU2 A;  4Q44 A;  4UAV A;  5B5E U;  2YB4 A;  5KFV A;  7ICO A;  2KHV A;  5AI0 A;  2OEH A;  2HDO A;  4PHD A;  1S0V A;  1L7N A;  5H2F U;  3F2D A;  2FPL A;  3OTQ A;  2BQ3 A;  3M6K A;  4K4I A;  2BCR A;  4O3S A;  4QWD A;  8ICV A;  1X6J A;  9ICN A;  1TAM A;  1Q8K A;  3E2E A;  2ZIV A;  4FBT A;  4QZG A;  9ICV A;  7ICH A;  4Q43 A;  5AI9 A;  4OO1 J;  9ICE A;  2AGP A;  3SMV A;  1KBU A;  5IIO A;  3Q8K A;  1P7D A;  4UAR A;  1F0M A;  1SXE A;  4DCC A;  3PSI A;  2DKX A;  1N56 A;  4US8 A;  4RQ8 A;  1M6Y A;  4J9M A;  7ICJ A;  1YZ6 A;  5J2B A;  1N48 A;  2K60 A;  4RU9 A;  2V9W A;  5J0U A;  3J81 j;  1XSN A;  5KG3 A;  2PKE A;  2ZIU A;  2W7O A;  3GIM A;  4I2G A;  2LBO A;  4ECT A;  3V6H A;  2VIX A;  3QXG A;  1T7P A;  3Q8L A;  8ICN A;  1ZOL A;  4AYB C;  2RDI A;  4AP9 A;  3BQ1 A;  5D46 A;  5ALY A;  2BZF A;  3TAD C;  4DQQ A;  2ZUD A;  3N28 A;  3RRG A;  2KFN A;  2QB0 B;  2JMG A;  1L7P A;  1KTQ A;  1NKE A;  2K8A A;  2BCU A;  2BGW A;  1VJ5 A;  1SV4 A;  3GIK A;  4KLE A;  3GV7 B;  2F1I A;  3GV8 B;  5AIB A;  1RPL A;  5KFM A;  4UB8 U;  1Q3V A;  3DEE A;  3AM9 A;  1L3V A;  2NO5 A;  2KE7 A;  2YY6 A;  3K4G A;  4JV2 A;  1ZQU A;  2V4Q A;  2FPK A;  1TK0 A;  5ALG A;  4GXI A;  3ALR A;  4RQM A;  2R8I A;  2BDP A;  4Q8F A;  3JPQ A;  3Q8Q B;  3LK9 A;  5ALU A;  2R8K A;  3TAQ A;  3ED5 A;  3NVW A;  3OGU A;  2KIW A;  1QCK A;  4TQR A;  4YMO A;  5KFZ A;  5C5J A;  8ICW A;  2HBL A;  3ETL A;  1KDH A;  2YX8 A;  2KVC A;  2ZXI A;  3NS1 A;  5EE0 A;  4DOC A;  4J9K A;  1MA7 A;  5CRX A;  1NKB A;  3NRZ A;  1SKS A;  1TFR A;  4Y2T A;  3RJF A;  8ICH A;  5J0Q A;  2MA1 A;  3GV5 B;  2W55 A;  2Y9T A;  5J2G A;  3QEB Z;  2ASJ A;  1DK3 A;  1JX4 A;  2ZJ5 A;  2ISP A;  2KTQ A;  3VCB A;  2W04 A;  1ZQO A;  1U4B A;  1IXR A;  4O3Q A;  5KFX A;  2D8C A;  2G5I B;  4FZL A;  3SR6 A;  9ICB A;  3SYZ A;  3SAG A;  9ICU A;  5L1K A;  4F5O A;  4Z6C A;  4NM2 A;  5J0W A;  1ZRM A;  2JRZ A;  4YMN A;  5ALM A;  4TUR A;  3RR8 A;  3RJH A;  5JU5 A;  3QU4 A;  2R8G A;  2AQ0 A;  4F71 A;  1D9F A;  3FC4 A;  2E8M A;  5A0L A;  2ATL A;  1DRG A;  1UPH A;  2W9C A;  4RQN A;  5J2D A;  1ZQQ A;  2VA8 A;  3KZI U;  2M0N A;  1SL0 A;  2ZJA A;  4C8L A;  3FAH A;  1VDV A;  3IG5 A;  2W43 A;  3QE9 Y;  1CUK A;  9ICR A;  2FLL A;  3M8R A;  2FI1 A;  5KTQ A;  3THV A;  4KX3 A;  3KHG A;  1NJY A;  5KFL A;  1K1Q A;  4RQ6 A;  3MR6 A;  2KJ5 A;  1V85 A;  4J9L A;  2LMR A;  1ZQH A;  3S6J A;  1XSL A;  4O3N A;  3RF9 A;  3NRW A;  5DB8 A;  2WB1 F;  1JMS A;  1URJ A;  4FZN A;  2OH2 A;  1X9W A;  3BS5 B;  2K4H A;  7ICS A;  4GXK A;  2IBK A;  4DL5 A;  1BPD A;  3F53 A;  3QZ7 A;  5J0O A;  3Q8S B;  3ETR A;  3D2N A;  4ED7 A;  5JRT A;  1LB2 B;  1X66 A;  2GO7 A;  1T8E A;  2AU0 A;  1DK2 A;  1ZXI A;  2KOB A;  1ZD2 P;  2Q0Z X;  3WKD A;  2AGO A;  4USA A;  3A0H U;  3PY8 A;  3PSP A;  2EDU A;  4QZB A;  4YP3 A;  2JZB B;  5EE1 A;  4KLI A;  3UM9 A;  2Z7J A;  2ES6 A;  3PZP A;  3SEI A;  3UXN A;  2W11 A;  3QZ8 A;  2CN1 A;  3IV6 A;  2HBK A;  2AJQ A;  1S8O A;  3HWT A;  2OWO A;  1XO0 A;  3QUC A;  2LI6 A;  9ICT A;  5KFN A;  4ACO A;  4PGY A;  3H0L B;  3SV4 A;  3E58 A;  3BZK A;  3ZD9 A;  1Z4N A;  2P6U A;  3PVX A;  3PX6 A;  3KTQ A;  3AUO A;  2OM6 A;  5ALI A;  1SXD A;  1TK5 A;  4CNQ A;  2XI9 A;  2MRL A;  2I6X A;  2UVR A;  5D4B A;  4PZO A;  4MFA A;  7ICE A;  3BQT A;  5DBA A;  4KLH A;  5KG5 A;  2DFL A;  3QU2 A;  2UVV A;  3ZD8 A;  2BHN A;  2W3S A;  3GZF A;  5CP2 A;  4DLE A;  4QZD A;  5AI4 A;  5AM0 A;  5AKL A;  4UAY A;  4DWI A;  3QX7 A;  3SZ2 A;  2ZXH A;  4HYK A;  5HML A;  4XUS A;  4F50 A;  4C8O A;  4EBE A;  2WF8 A;  3JPR A;  1DGJ A;  4OD0 A;  3FM9 A;  2JEJ A;  2N1R A;  1COO A;  4PGQ A;  3ISB A;  4Y2U A;  5KFQ A;  1ZQE A;  3IM1 A;  3V6K A;  1Q46 A;  4C0Z A;  5KFF A;  3EPI A;  4UAU A;  4AYB F;  4F4Y A;  3H8J A;  3SAF A;  1UA1 A;  2A19 A;  1NK0 A;  5B66 U;  1ZYQ A;  1U47 A;  3TFS A;  2HHW A;  1QSY A;  4LVS A;  3KKA C;  3N7S C;  4B6J A;  7ICL A;  3ZDE A;  4ELT A;  2XIC A;  4KN4 A;  2BPG A;  1RQL A;  3H40 A;  1RZT A;  2NV3 A;  4Y2Y A;  1Z3E B;  3CW2 C;  3ONN A;  1SV0 A;  1Z1B A;  9ICG A;  1HUZ A;  1PZN A;  4ECY A;  5KFK A;  1ZQX A;  3NVZ A;  2IOF A;  3HW8 A;  2F1J A;  4F4W A;  3TKA A;  4IC9 A;  5ALO A;  3GII A;  3RB3 A;  2GLE A;  4CRX A;  9ICA A;  2QAR B;  4IL6 U;  2WF5 A;  1RG6 A;  4ECZ A;  1SWV A;  1ZD3 A;  5KG7 A;  1A6S A;  1F44 A;  2IOH A;  2KSO A;  1T4G A;  1CI4 A;  4EBC A;  1HUO A;  1OUQ A;  2EAN A;  3ISD A;  1KEJ A;  4MFC A;  5AKG A;  4DEZ A;  2KMD A;  5L9X A;  2W54 A;  3H8M A;  2HCF A;  1XU4 A;  1LKY B;  1ZQV A;  4KIT B;  2PXI A;  7ICT A;  2ASL A;  4UB4 A;  2F77 X;  4ECV A;  2NRV A;  2B0C A;  4K4G A;  5J0R A;  2F3N A;  5HHI A;  2ZIW B;  3G6V A;  1TV9 A;  1GO3 F;  5EWG A;  3IRU A;  1ZQP A;  3UXO A;  4R8U A;  2HSZ A;  1X42 A;  5IIM A;  5KFC A;  4Y2V A;  2VKQ A;  4PHA A;  4NLG A;  4DF4 A;  3FYH A;  3BS7 A;  2JEF A;  8ICT A;  4DL6 A;  1FEZ A;  4RQ1 A;  3WK4 A;  3G6Y A;  1KFD A;  2KP7 A;  5IIL A;  3KKA A;  3M9N B;  5KG1 A;  4RNO A;  5J2K A;  8ICR A;  1L6N A;  2KJ9 A;  5F9L A;  4UB3 A;  4BXO A;  2YMQ A;  2ODG A;  2XC9 A;  2E5S A;  3UXP A;  5BPC A;  4P0P A;  5TIS U;  4M9H A;  5ALF A;  1SB3 C;  2WTF A;  5IIN A;  4Z6F A;  1S5L U;  5KFT A;  3R9K A;  2KNJ A;  3JPN A;  8ICF A;  2FE9 A;  3M8S A;  2Y1I A;  4OJ6 A;  4IR9 A;  1S0M A;  2BCV A;  3WK7 A;  2IHN A;  3UMG A;  4IRD A;  5KG4 A;  1T3N A;  2FMQ A;  3CNH A;  1HJP A;  5KT6 A;  2DBY A;  2QB1 A;  3SAH A;  8ICU A;  1ZQM A;  3MR5 A;  4ED3 A;  1DXS A;  4KLL A;  3F5A A;  4ICA A;  4UB6 U;  8ICL A;  4OJ5 A;  2PFN A;  5AK4 A;  2Y0S C;  3JPP A;  5CHG A;  4ECX A;  2P66 A;  5G5G A;  4CF4 A;  4NV0 A;  5AM4 A;  1B0X A;  4KLM A;  9ICF A;  3GU3 A;  2MUT B;  4M47 A;  4FBU A;  5DG8 A;  8ICY A;  1KFT A;  4YR2 A;  4M0A A;  3IDW A;  5DG9 A;  3TI0 A;  5III A;  3C5F A;  4OCZ A;  2G5H B;  3WKE A;  2DGZ A;  3N97 B;  2O6K A;  1TKD A;  4I2A A;  4YFK A;  1KQQ A;  4KLF A;  2A3V A;  3V7J A;  1UQV A;  4ED8 A;  3ISC A;  2KZZ A;  3NTU A;  4J9R A;  1TVA A;  5J2J A;  2KIC A;  5C0Y A;  2CXY A;  9ICP A;  3PO5 A;  5J8Y A;  5JUM A;  2HHS A;  1S9F A;  5ALW A;  2KIV A;  4C8N A;  2KKV A;  4M6W B;  2NO4 A;  4I2I A;  3I1Y A;  5KL1 B;  4F4K A;  1D8Y A;  8ICO A;  4J03 A;  3K1Z A;  2CRX A;  5ALT A;  1NJZ A;  3PR5 B;  3GIL A;  9ICH A;  4BWJ A;  1KLN A;  4CCH A;  2LKY A;  3HJE A;  2LYH A;  4I28 A;  3UQ0 A;  4DQS A;  4GIB A;  5DQI A;  2OCE A;  4KLG A;  5J2C A;  1HIW A;  2E8O A;  4MHV A;  4GC6 A;  1KSP A;  4DOA A;  1ZQJ A;  3M6Z A;  1VLB A;  4C8M A;  3V7L A;  4DFP A;  2W7P A;  3AL0 B;  2MSN A;  3MFH A;  1U45 A;  3TQ1 A;  1KW4 A;  4YXJ A;  2R8J A;  5KFE A;  5AIC A;  4DL4 A;  5TZV A;  4QWE A;  5AKZ A;  2HBJ A;  3ZI4 A;  4NL9 A;  4B9L A;  5T14 A;  4A8E A;  5AKX A;  5KT4 A;  1JN3 A;  5HP4 A;  2QB0 A;  5J29 A;  3TAC B;  3PNC A;  4O5C A;  4U7C A;  5KAF U;  1BPX A;  2AGQ A;  7ICR A;  2D6F C;  3H0M B;  3PR4 A;  3PW4 A;  9ICK A;  3FDS A;  3C1Z A;  1CRX A;  2H3Z A;  2W9B B;  1J97 A;  3TAP A;  3DDH A;  2LM1 A;  1B22 A;  2ALZ A;  1Z00 B;  3ZDB A;  1PK1 B;  2OHF A;  3RJE A;  3B0X A;  3WK9 A;  2HVI A;  4KLT A;  1JAL A;  1LV5 A;  2BPF A;  4IS7 A;  3IG8 A;  2VJ5 A;  3QYP A;  4RNN A;  2P35 A;  4YG2 A;  3C28 A;  4DS4 A;  4PH5 A;  5EWE A;  5HNK A;  1B4F A;  8ICX A;  2G07 A;  1V9P A;  2VJ4 A;  3LVW A;  1QSL A;  4I2D A;  4QZC A;  5DBB A;  2DPI A;  2DQN B;  1C20 A;  1BVS A;  5HR6 A;  4DS5 A;  1XNS A;  4MEX A;  2ZG6 A;  2XY6 A;  2ZTD A;  2OYY A;  4JWM A;  4YD2 A;  3M9M B;  3M9O B;  8ICG A;  2VA2 A;  4QZA A;  3MGI A;  3ORY A;  5DBC A;  3N7R C;  5AHX A;  5GTI U;  3K1R B;  3QU5 A;  2I5H A;  4M9N A;  3WKB A;  3RH4 A;  4F3O A;  4NLN A;  3T79 A;  3PST A;  4DSE A;  4DSF A;  3QNM A;  8ICP A;  2LYA A;  8ICJ A;  4NLZ A;  4DSJ A;  5DKW A;  2YMP A;  3KBB A;  1L3T A;  7ICP A;  1U48 A;  2EAO A;  2ZJ8 A;  3OHB A;  4NLC A;  2JHD A;  5AKH A;  4CF5 A;  1NK7 A;  4P0Q B;  3KFU F;  1JI7 A;  4I2E A;  4YR0 A;  2WF6 A;  9ICW A;  4YR3 A;  2PMZ C;  1UA0 A;  3C2M A;  4BGD A;  3QUQ A;  4KLO A;  2WF7 A;  4YMM A;  3PW2 A;  4DL7 A;  2K89 A;  5J2H A;  2KN7 A;  1N2X A;  2BKE A;  4QNL A;  4QZ9 A;  2LHT A;  2A1J B;  1NK5 A;  2Y0S F;  5KFB A;  2R18 A;  4RQ5 A;  4JUZ A;  5J2I A;  4CE6 A;  3MR2 A;  4DL2 A;  2BPC A;  1RYS A;  4F92 B;  3CRX A;  5KFS A;  4R64 A;  3NGD A;  1ZQI A;  5CWR A;  4FS1 A;  1SWW A;  1S77 D;  3BS5 A;  3LWL A;  1NJX A;  4F5P A;  4UAS A;  4Y2Q A;  2DWQ A;  1MQ3 A;  5AK6 A;  3C21 A;  3EZ5 A;  1FIQ A;  1SGG A;  3WKA A;  4DFM A;  3C1Y A;  1ZQ1 C;  3AQE A;  2OXO A;  3OJS A;  1MSW D;  5KNI A;  2PFP A;  1X6I A;  4DQR A;  3E0F A;  4KLD A;  3C2K A;  3SI8 A;  1BPY A;  4EX6 A;  2JZB A;  1ZQR A;  5ALP A;  1SV0 C;  2RRD A;  4IQT A;  5EE3 A;  2C2E A;  3Q8R B;  2DUY A;  4F93 B;  2LPE A;  1L3S A;  2ZUB A;  3LDA A;  4UQG A;  3PV8 A;  2E8N A;  4UB5 A;  3LYS A;  9ICI A;  2MAX A;  3WK5 A;  3DV9 A;  4OJP A;  3A0B U;  1CEZ A;  4RT3 A;  3N4M B;  1ZRN A;  5AKI A;  1N61 A;  3QUT A;  4QWC A;  2J6U A;  3V6J A;  1SKR A;  3MDC A;  3PW7 A;  3RTV A;  2C28 A;  2XID A;  5IIJ A;  4I2B A;  4C7Y A;  4DOB A;  4JMU A;  5CB1 A;  1A76 A;  1IV8 A;  4BUG A;  4ECS A;  4CDG A;  5L1M A;  5J2E A;  4I29 A;  3SV3 A;  2WAQ C;  2AH5 A;  1QTM A;  4J9N A;  1XWL A;  4UAW A;  1YZ7 A;  1NK4 A;  7ICF A;  2Q4T A;  4YQW A;  4KLJ A;  3T5H A;  5ALS A;  1ZQC A;  2HMX A;  5L1L A;  2KD1 A;  4KLQ A;  1T3Q A;  3B9J A;  4QW9 A;  2UVU A;  4Y2X A;  5E79 U;  1PVQ A;  2WFA A;  3H8W A;  4C7Z A;  8ICB A;  2HHQ A;  3L3F X;  9ICO A;  4O3O A;  3MDA A;  3RJJ A;  3L4P A;  3BZC A;  5CA7 A;  2PI5 A;  3RBD A;  1D8L A;  4B9M A;  3HT3 A;  3SD7 A;  4JV1 A;  4KMU A;  2H5X A;  1ZD5 A;  4ECW A;  4YN4 A;  1S0O A;  4P4P A;  3WK8 A;  2H3Q A;  2ISO A;  1XS9 D;  2B21 A;  1K1S A;  1TE2 A;  5KT5 A;  3RBE A;  2QAR A;  4F5Q A;  2HOF A;  5KFJ A;  4FS2 A;  3RB0 A;  2PFQ A;  4EYI B;  3RR7 A;  4IQW A;  2KV2 A;  4RUC A;  4J9O A;  2L5Y A;  2ZUC A;  4JK1 A;  5KFD A;  5DQG A;  2EH9 A;  5KT2 A;  3PMN A;  1ZQF A;  9ICQ A;  3MAB A;  4UW9 A;  4Q45 A;  1LKY A;  5ALL A;  2Y1J A;  2KJ8 A;  4DFK A;  2FJ6 A;  3EW9 A;  2EAM A;  4ZOH C;  1QQ7 A;  3T5K A;  1WCL A;  2Y9U A;  2KEY A;  1Z1V A;  4LJX A;  3RAX A;  2G09 A;  2ZIW A;  5AKE A;  2XO7 A;  4DFJ A;  4DL3 A;  4NLB A;  4DSI A;  3GDX A;  1C7Y A;  4GLX A;  4PPX A;  4YVZ A;  4EEN A;  2C2R A;  2QLT A;  2EZZ A;  1UT5 A;  5BOM A;  7ICG A;  5AI6 A;  2QKQ A;  2F8L A;  5ALV A;  1U49 A;  4DLG A;  1RDF A;  3HIL A;  3MGH A;  4J9P A;  3LVV A;  2E1E A;  1KN5 A;  4EEK A;  5KG6 A;  2F76 X;  2P6R A;  4ECQ A;  5DDY A;  2H3I A;  4QWA A;  1D9D A;  4ED0 A;  1ED1 A;  3TFR A;  3IP4 B;  2B6G A;  4F5N A;  2UVW A;  3QEA Z; 
#chains in the Genus database with same CATH homology
 2D8C A;  2K60 A;  2ES6 A;  3SEI A;  1SGG A;  2GLE A;  1PK1 A;  2QAR B;  1RG6 A;  2QB1 A;  2F8K A;  2KG5 A;  1OXJ A;  1COK A;  1DXS A;  5KNI A;  2KSO A;  2D3D A;  1X40 A;  2E8O A;  5JU5 A;  4MHV A;  5J8Y C;  2EAN A;  2E8M A;  2F44 A;  1OW5 A;  2KMD A;  1SXD A;  2DKZ A;  3TAD C;  1SV0 C;  3H8M A;  1LKY B;  4RQN A;  2YTU A;  2QAR A;  4PZO A;  3K1R B;  2QB0 B;  4PZN A;  2LPE A;  1KW4 A;  1V38 A;  3BQ7 A;  1WWV A;  2E8N A;  2F3N A;  2E8P A;  1SV4 A;  1B0X A;  2L5Y A;  2K4P A;  4NL9 A;  1WWU A;  1LKY A;  2KE7 A;  3IDW A;  1V85 A;  2EAO A;  2QB0 A;  4NJ8 A;  2LMR A;  3TAC B;  4RQM A;  2EAM A;  3BS7 A;  1JI7 A;  2Y9U A;  1Z1V A;  3BS5 B;  3KKA A;  5L1M A;  1UQV A;  3SEN A;  3KKA C;  5JRT A;  1X66 A;  2QKQ A;  4NL9 C;  1PK1 B;  3HIL A;  5J8Y A;  1X9X A;  4IS7 A;  2DL0 A;  2Y9T A;  1F0M A;  1SXE A;  2KIV A;  1UCV A;  2DKX A;  5F3X B;  3TAD A;  2KSO B;  1SV0 A;  2EAP A;  2FE9 A;  5JTI A;  3BS5 A;  2ESE A;  1PK3 A;  2JV3 A;  1B4F A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...