2LYHA

Structure of faap24 residues 141-215
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Fanconi anemia-associated protein of 24 kDa
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2lyhA00
2BR0A 1SKWA 1JN3A 4KLTA 4KN4A 2H5XA 1NK5A 2FMSA 4UAWA 9ICKA 5J2DA 4UBCA 2C28A 4DSLA 1NOMA 4RQ6A 3M8RA 1CUKA 5HMLA 5KFBA 3OSNA 2BCSA 2C2DA 3EW9A 4QZIA 3C2KA 4J9RA 2HHVA 4DOCA 3Q8KA 4DEZA 5KT5A 4BGDA 9ICBA 4QWEA 4F92B 4J9OA 2AQ0A 2BCVA 3GIKA 9ICRA 1U45A 2F1IA 1X9MA 4DSFA 5DQHA 2P66A 2R8JA 4M6WB 5KT6A 8ICCA 3RAXA 1TFRA 5TZVA 1QSSA 2BCQA 1KDHA 3SZ2A 1XSNA 4J9PA 2IA6A 1HUOA 4YXJA 4DFMA 2BCUA 2ZUCA 1SZPA 1BPXA 8ICBA 5KFZA 4QZDA 4MFFA 5IIKA 2AGQA 4I2EA 5KFMA 3C1ZA 4F93B 3V7JA 5IILA 1X9WA 3PMNA 1C7YA 3NTUA 3PW5A 1ZQLA 4Q8EA 4XRHA 4F5OA 4ELTA 2ASDA 2HHXA 4GXIA 4RQ5A 1D9FA 2BQ3A 4Q8FA 5DG7A 5KFDA 4QWDA 1NK4A 1ZQKA 3MDAA 5KG6A 5EWGA 5KFQA 8ICFA 4ED6A 4RPXA 2ZTCA 3UPQA 1ZQYA 4ECZA 3TARA 2W8KA 3EZ5A 9ICLA 3T5LA 3N4MB 1NKEA 2IHNA 1UT5A 3H8SA 4RUCA 3Q8PB 4YFKA 4JV1A 1XU4A 2W9BA 3GIIA 1NK9A 5CHGA 1SKSA 5J0WA 3RRGA 7ICEA 4O3RA 5KG0A 1XSLA 3PX6A 3RB4A 1LV5A 4RPYA 1BVSA 1ZQVA 3V7LA 4RQ7A 3UQ0A 1L3UA 5KG2A 1ZQOA 3RJGA 2FLNA 4DQPA 4RT2A 5J2IA 2M9NA 3TQ1A 4KLDA 3OGUA 3HX0A 1RXVA 4RQ1A 4R8UB 7ICRA 1XS9D 3FYHA 5D4BA 2UVUA 1NJZA 4YMMA 3TFRA 3MR2A 2AJQA 4ECXA 4I2JA 1HJPA 3H8WA 5HP4A 5DQIA 1NKBA 3QEAZ 8ICRA 7ICIA 5CJ7A 4ELVA 4QW9A 3ORYA 4DOAA 4ED2A 1ZQQA 4GC6A 4B9MA 4Z6DA 3OHBA 2BPFA 3QZ7A 2FMQA 2DFLA 4YR3A 5KFCA 1XO1A 1TK0A 1NJXA 3OJSA 1CEZA 4F5QA 2F1HA 1X2IA 8ICAA 9ICIA 2MUTA 2AQ4A 3LDAA 4E0DA 4JUZA 1KFDA 2PI4A 5J2AA 5D46A 5J29A 1U47A 4EEYA 5DBAA 5KT3A 3Q8QB 2FLLA 1H38A 4IQTA 4J9LA 1JXLA 1B22A 3K4GA 3V6JA 1RZTA 2DPIA 1RPLA 1ZQIA 2V9WA 2ZTDA 5DG8A 4YMNA 4YMOA 4B9VA 9ICQA 3BQTA 4EYIB 1JIHA 4DL7A 3UXOA 4NLNA 1U9LA 4EZ6A 2BHNA 4IQVA 4Q44A 3MFHA 3M9NB 4QZCA 3H4BA 1S0OA 1ZQMA 4K4IA 9ICTA 4B9NA 4C8OA 4J9QA 4C8KA 3JPOA 5J0SA 3RBDA 2A1JA 1D8YA 2UVVA 4IRCA 4FBTA 2BDPA 4B9UA 2RDJA 2PXIA 4I2FA 3MABA 5J2JA 1ZQWA 4PGQA 5KFTA 4CCHA 3AU2A 4P4OA 4C8NA 4I27A 4M04A 4ECRA 4ELUA 8ICHA 1A77A 5KFPA 2ZJAA 5J0TA 1D9DA 3PW7A 5L9XA 4DFPA 5KFXA 3M9OB 3BQ2A 3EYZA 1NJYA 3ZDAA 4KLHA 4KITB 4RT3A 4DQQA 4ZH4A 3BQ0A 1SL0A 4I28A 2XY6A 4NY8A 1SL1A 4QZ8A 8ICWA 1Z3EB 8ICXA 4GXKA 2BCRA 8ICVA 5J0RA 9ICOA 3RB3A 2F1JA 4O3NA 4NM2A 9ICEA 4IQUA 8ICLA 4BXOA 1WCLA 1TV9A 2JEGA 4RPZA 2WTFA 4B9SA 4EZ9A 5KFUA 5J2CA 3RB6A 5J2EA 4RNMA 4YCXA 5DLGA 4Z6EA 1TAUA 3PV8A 2AU0A 4RU9A 2P6UA 1BPYA 3QE9Y 8ICJA 4O0IA 4YR2A 3V72A 5IIMA 4LVSA 4PH5A 4IRDA 4QWCA 4DSIA 4F2SA 1XC9A 5KFEA 3MGHA 4DL4A 5J2GA 5F9NA 1S10A 3GIJA 2J6UA 3RAQA 3EPIA 4KLJA 5DLFA 1TKDA 1ZQZA 4IR1A 4KN7A 3T3FA 4MF8A 4IRKA 3QZ8A 3TAPA 5EWFA 4RNOA 3V7KA 4TUPA 5J2HA 3ZDDA 4R65A 4M9JA 5KG7A 3KTQA 4M0AA 4RZRA 1AROP 3MR6A 3KHGA 1T7PA 4NXZA 1ZQGA 2W9CA 2C2EA 3RH5A 4UQGA 2XGQA 4PHDA 2XCPA 4FBUA 4KLSA 5IIIA 2W9CB 1K1QA 3C21A 4FO6A 7ICGA 4PHPA 5J0YA 2KFZA 5DB6A 4F50A 5L1IA 1U4BA 3MBYA 3MR3A 3RB0A 5J0UA 3C5GA 4EBEA 4UB5A 1L3SA 5KFHA 7ICFA 7ICKA 1QSLA 5IIJA 2UVRA 1ZQHA 5DKWA 4J9SA 2IHMA 4I2AA 1NK0A 2XO7A 4ECUA 5KFOA 4KLFA 4EBCA 4Z6CA 5J0OA 1KFTA 4Z6FA 4TURA 2PI5A 5KFIA 4M6WA 4UB3A 4RUAA 7ICQA 1UA1A 2FPLA 7ICVA 1ZQAA 1BPDA 1WCNA 7ICMA 9ICSA 3PR4A 3ISCA 3PO5A 4C8MA 4R8UA 5KFVA 5CA7A 4BWMA 1K1SA 2JEIA 3TAQA 4TUQA 1S0MA 4KLUA 4TQSA 4O5KA 4P2HA 4KMUA 4ECTA 3V6KA 4DO9A 4ED3A 1NJWA 4P4MA 2PFNA 4NLZA 4F4XA 1ZQFA 2UVWA 3PO4A 5CB1A 4M2YA 2KZ3A 3Q8SB 4UB1A 4O3QA 2BGWA 1S9FA 3LK9A 1ZJNA 2AGOA 5KT7A 1LB2B 1Y88A 3RH4A 4B9LA 3MFIA 3JPTA 4I2IA 4X5VA 2V4RA 2PFQA 4UBBA 5DDMA 4FS2A 3T5HA 4JV0A 3OSPA 2R8IA 3RJHA 4KLOA 4QZGA 5DBCA 7ICHA 3MGIA 5JUMA 5J2BA 1COOA 5HNKA 8ICKA 2R8KA 2BKEA 3RJJA 4KLLA 2R8GA 3ISBA 2MAXA 4K4GA 2C2RA 1L3VA 4IR9A 1UA0A 1ZQBA 1ZQNA 3TFSA 1KLNA 5KG1A 4Q43A 4ED0A 1MQ2A 7ICJA 7ICLA 5J0XA 2LYHA 4TUSA 1ZQDA 3ZD9A 9ICNA 3JPQA 3C1YA 4YN4A 1RYSA 4DS4A 4F3OA 4QZFA 3PR5B 1BGXT 3H40A 5EOZA 4FS1A 1N56A 2JEJA 3PY8A 4NLKA 5C5JA 2HW3A 4UAZA 3QEBZ 9ICCA 4XA5A 5J0PA 2ASJA 2JZBB 5EWEA 2JEFA 4TQRA 1EXNA 8ICNA 8ICTA 3JPSA 1SL2A 1ZQXA 3GQCA 4I2DA 1JMSA 1NK6A 8ICEA 1T4GA 7ICOA 2PFPA 3H8JA 5KFNA 4KLEA 7ICPA 1MQ3A 5CP2A 3G6YA 1QSYA 5DB9A 4XQ8A 3Q8MA 1KFSA 3UXPA 9ICXA 4YR0A 2B21A 4DL3A 2ATLA 3PW2A 9ICMA 2NRVA 4YG2A 3PNCA 2ZUDA 4DLEA 3RJFA 4YD1A 2XY5A 2I1QA 4O3PA 4BDPA 4I29A 2AGPA 4DFJA 4BXOB 2ASLA 1V9PA 2W9AA 4UAYA 4RQ4A 1JXEA 5L1LA 4J9KA 4ECVA 4MF2A 1JX4A 3PX0A 2FPKA 2V4QA 2NRWA 4QZEA 5L1KA 1S0NA 5KT4A 1Z00B 4XUSA 4BWJA 5DG9A 2ZJ8A 1T3NA 1ZQEA 3ZDBA 2KFNA 3B0YA 5BPCA 9ICWA 1Z00A 8ICGA 5BOLA 5DB7A 4RNNA 1KSPA 4DQRA 2W8LA 5IINA 2BQUA 2FLPA 2FMPA 3ZDCA 2NRTA 3JPPA 1QLNA 1S76D 5D49A 8ICMA 9ICJA 1HUZA 1BPBA 2BQRA 2HVIA 2XGPA 3GV5B 2J6TA 4QZBA 2HHQA 2P6RA 3GIMA 1X9SA 3GFKB 9ICFA 5KFRA 4P4PA 3HT3A 5J2FA 2VA3A 3THVA 4ED7A 5DGBA 2W9MA 3M9MB 4YVZA 4ECWA 3B0XA 3MR5A 3GILA 4MEYA 3KHRA 4EYHB 4B9TA 1DGSA 8ICYA 1ZQTA 2C22A 3HP6A 4DSEA 4MFAA 3PVXA 2HHSA 5DBBA 4GLXA 2Y1IA 4NM1A 2ISOA 3H7IA 4R66A 2BPCA 4QZAA 3ETLA 3RTVA 3AU6A 3OHAA 3K75D 5IIOA 3KHHA 2ISPA 4F4KA 3HW8A 4YXMA 1ZQUA 4DF4A 8ICZA 3G6VA 4F5NA 5L1JA 7ICUA 1ZYQA 1XSPA 2HVHA 5DB8A 1QTMA 4KLQA 2KZMA 4YD2A 4Q45A 4YP3A 5J2KA 3RH6A 2GWSA 2J6SA 3V6HA 3C2MA 1S77D 5KFSA 4LZGA 1NKCA 3SV3A 4RQ3A 3AUOA 1ZQJA 4PPXA 4DFKA 1L3TA 4ED8A 2IMWP 2VA8A 2XY7A 4O9MA 1B43A 3PW0A 5KG4A 3BDPA 3JPNA 3N97B 4JV2A 3SI8A 4UB2A 3C23A 4M9HA 5KG5A 2R8HA 4QWBA 4QZHA 4KLGA 8ICSA 4O3OA 4DQSA 5KFYA 2HHTA 1RYRA 1MSWD 7ICTA 3PX4A 4LZDA 1A76A 3ZDEA 4RQ0A 3SYZA 3TI0A 2Y1JA 4HYKA 9ICGA 4QW8A 2RDIA 8ICUA 1TAQA 1S97A 3RRHA 2XC9A 1TVAA 1KEJA 2ZUBA 2BPGA 4F4YA 3MDCA 4JK1A 3G6XA 3RJEA 5BOMA 4C8LA 5F9LA 3Q8LA 1ZETA 3EWAA 4RQ2A 3OJUA 4DQIA 4PGYA 3BJYA 2ALZA 4F4ZA 1ZQRA 4M9NA 9ICHA 1U48A 3RBEA 5KT2A 4IQWA 2W9BB 1SKRA 4ECYA 4F5RA 1IXRA 3T5KA 4MEXA 2IBKA 3RJKA 4F8RA 1D8LA 3Q8RB 4J9MA 3T5JA 8ICIA 5KG3A 1PZNA 4DL2A 5KFWA 9ICAA 5J0QA 9ICPA 4G3IA 3C2LA 4M47A 1MC8A 2ZTEA 9ICUA 3JPRA 4UB4A 2FPMA 4KTQA 5KFFA 2KN7A 3PMLA 4F5PA 3UXNA 9ICVA 5KFGA 5KTQA 4YQWA 2NRZA 4ECQA 2JZBA 5DQGA 1ZQSA 4KLMA 5DDYA 3E2EA 4RQ8A 3ZD8A 4QZ9A 4M9GA 1ZQCA 1S0VA 1IM4A 2VA2A 5HMMA 4R64A 4DF8A 2MUTB 5KFLA 4PHEA 3C5FA 4DLGA 3UQ2A 3IM1A 2VANA 2XCAA 1NK8A 1KRPA 4F2RA 1N48A 3PW4A 4JWMA 2PFOA 8ICOA 5CR0A 3FDSA 2KTQA 4NLGA 4ED1A 4DS5A 4EBDA 3TANA 3RR7A 4I2HA 1RXWA 8ICQA 4GC7A 5DGAA 4DSKA 2HHUA 1UT8A 3M8SA 3EPGA 4J9NA 3GV7B 3RJIA 4I2CA 2Q0ZX 4O5EA 4I2GA 4ECSA 1BPZA 1U49A 3HWTA 3LWLA 1NK7A 5KFKA 3IHQB 4I2BA 4KLIA 3GDXA 3ISDA 5CWRA 4F4WA 4DSJA 1ZJMA 2NRXA 3LWMA 2I9GA 4M9LA 1T8EA 4MFCA 1TK5A 2A1JB 4DL5A 7ICNA 1BPEA 3KHLA 3SV4A 4O5CA 3H4DA 3HPOA 2DPJA 4JWNA 2HHWA 4PHAA 4R63A 3RR8A 1XWLA 2KZZA 4F91B 4PGXA 5KFAA 1L5UA 3BQ1A 3GV8B 4K4HA 2ZJ5A 4DL6A 5KFJA 4DOBA 1TK8A 1DOQA 1ZQPA 2OWOA 8ICPA 1KTQA 5HHIA 4DWIA 4GXJA 5HHHA 3NGDA 4O3SA 7ICSA 4QWAA
chains in the Genus database with same CATH superfamily
1IV8A 2JV3A 3KOOA 2YX8A 4UBCA 1ZD5A 4U7CA 1NOMA 4RQ6A 1CUKA 5HMLA 5KFBA 4Y2TA 4J9RA 2HHVA 3NS1A 5KT5A 4F92B 4OJ5A 3QYPA 1DRGA 4DSFA 2WB1F 4M6WB 3RAXA 3QUBA 5AK3A 1QSSA 1KDHA 1XSNA 4J9PA 1HUOA 3T79A 2ZUCA 1BPXA 5AKGA 2HOFA 4I2EA 5KFMA 3V7JA 1ZQLA 3PMNA 4XRHA 4F5OA 5KAIU 3FM9A 2BQ3A 5KFDA 5EWGA 4ED6A 5ALVA 3TARA 2W8KA 4QIWF 3T5LA 3N4MB 1BNOA 1ZD2P 2DF4B 5AM2A 5AKIA 1NKEA 3Q8PB 1DK3A 2W9BA 3GIIA 2JGAA 7ICEA 2QARA 2KSOB 4RPYA 5ALRA 3TQ1A 5ALYA 1YT3A 1XS9D 5D4BA 1S8OA 4I2JA 5HP4A 2D3DA 3H8WA 1PVPA 2KKVA 2I6XA 1COKA 1ZQQA 1X9XA 4GC6A 2E3TA 5G5GA 1XO1A 2EAOA 1TK0A 9ICIA 1F44A 2F1HA 2MUTA 5J2AA 2DBYA 5J29A 3BS5B 2FLLA 3UM9A 4J9LA 1JXLA 2AXTU 4IL6U 1SXDA 3K4GA 1ZQIA 2MA1A 4A8EA 1IIPA 2GLEA 1UQVA 2BHNA 3M9NB 1QQ6A 3H4BA 3R9KA 4AYBC 1JUDA 5ALLA 2G5IB 5KFTA 3AU2A 5ALEA 4ECRA 2KKPA 4U6PA 2A3VA 3PSIA 4DFPA 5KFXA 4UASA 3BQ2A 2G5HB 3EYZA 2MU2A 4KITB 2W54A 1SL0A 2KJ5A 3PSPA 8ICWA 8ICXA 5ALXA 8ICVA 3RB3A 1AQ6A 1T3QA 5KNIA 5ALWA 2HOIA 2CRXA 2E8NA 2JEGA 5AI0A 5J2EA 4RU9A 2KP7A 4O0IA 2RP5A 4F2SA 4DSIA 5AKXA 5F9NA 2J6UA 4RNOA 5J2HA 4M9JA 4M0AA 1KN5A 3FAHA 4FBUA 5IIIA 2W9CB 1SWWA 2XI9A 3C21A 2KFZA 2M0NA 5AM4A 4C4RA 2Y9UA 7ICKA 4KMOB 1ZQHA 1Z4NA 2IHMA 2G09A 1GO3F 1KFTA 1L7MA 4FZNA 4J03A 3E58A 1BPDA 2QARB 9ICSA 3PR4A 3QU5A 2E8MA 3TAQA 5TISU 4ECTA 5AIAA 2PFNA 3QUCA 1J2NA 2AH5A 3IP4B 3Q8SB 4UB1A 1S9FA 3LK9A 1ZJNA 1LB2B 3JPTA 4KX5A 4FS2A 4JV0A 2R8IA 2YB4A 7ICHA 3NVZA 5J2BA 1ZD4A 5J8YC 3NASA 3ISBA 4K4GA 3S6JA 4EELA 1MQ2A 9ICNA 2DGZA 3ZD9A 4EX6A 4YN4A 4FS1A 1WWUA 4RQMA 4USAA 3QEBZ 4XA5A 2LYBA 5EWEA 3TADA 3D6JA 1ZOLA 3GQCA 2OH2A 1NK6A 3AN1A 5B66U 2PFPA 3H8JA 2HMXA 3G6YA 2KIVA 2ZG6A 3LVWA 1NZPA 2YMPA 2NRVA 4DLEA 3RJFA 4BDPA 4O3PA 2ASLA 1V9PA 4UAYA 4RQ4A 2FPKA 1S0NA 4OJOA 1YZ7A 5KT4A 1Z00B 4XUSA 4BWJA 3ZDBA 2ZJ8A 3B0YA 5BPCA 9ICWA 1HIWA 4RNNA 4NWIA 4DQRA 2BQUA 2FMPA 3ZDCA 1X6IA 1YZ6A 1BPBA 2P6RA 9ICFA 3HT3A 2VA3A 5J2FA 4PZOA 5DGBA 2WB1C 4MEYA 1ZQTA 1LKYB 2YMLA 2E8PA 2Y1IA 3HKZC 2Q4TA 2ODGA 4R66A 2BPCA 3RTVA 3HILA 3AU6A 5AM3A 3KHHA 4BUGA 5L1MA 1ZQUA 5ALMA 1VDVA 2G06A 8ICZA 2HVHA 4KLQA 2KZMA 2AHOB 4YD2A 5J2KA 5AKYA 3BQ7A 3V6HA 1S77D 1V97A 1ZQJA 2K89A 1L3TA 1Q8KA 2JR5A 4ACOA 2XY7A 1B43A 5KG4A 1HEKA 4EENA 3JPNA 4UB2A 5ALUA 2MSNA 3IN5A 1RYRA 7ICTA 3PX4A 1J2MA 3SYZA 4UW9A 3NVVA 9ICGA 4HYKA 1TAQA 1Z1VA 3PZPA 1SV0C 1KEJA 4F4YA 3MDCA 3HJEA 1FFUA 3FC4A 5F9LA 3OJUA 3SEIA 2E5SA 2ZIUB 4Y2PA 1O03A 1J97A 4J9MA 3LYSA 9ICAA 2F76X 2ZTEA 2FPMA 4KTQA 4CDGA 2QB0A 4KLMA 4NLCA 4RQ8A 1ZQCA 1S0VA 5ALOA 2HBKA 4DF8A 3C5FA 4NL9A 2VANA 2XCAA 2PFOA 5CR0A 5E79U 2YY6A 3TANA 3QX7A 4F72A 4DCCA 4DSKA 4J9NA 2QLTA 1BPZA 3LWLA 4IC9A 3IHQB 4I2BA 5CWRA 2ZXIA 4DSJA 1ZJMA 2RHFA 3E0FA 1TK5A 3I28A 2F44A 1T94A 2PKEA 4O5CA 1QH9A 5ALJA 4BJQA 4ZOHC 3RR8A 4F91B 5KFAA 1ZRNA 2K4IA 5AM0A 4DL6A 2ZIXB 2G07A 1KTQA 4O3SA 1ED1A 1Z19A 2BQRA 1SKWA 1JN3A 1JALA 3SQIA 2H5XA 1NK5A 4DSLA 2BCSA 4DOCA 4CF5A 1QCKA 1L6NA 3GIKA 1U45A 1X9MA 5DQHA 5KT6A 4Y2QA 5EE0A 1PK1B 3SZ2A 4DFMA 2BCUA 2WF9A 5ALNA 2XIDA 3DV9A 5KFZA 4QZDA 4MFFA 5IIKA 3WK4A 1TAUA 1A6SA 2HSZA 2LBOA 4RQ5A 3MDAA 2PMZC 2EAPA 3UPQA 3QXGA 1ZQYA 4ECZA 3EZ5A 9ICLA 3HKZF 2W55A 1N5XA 4AP9A 4JV1A 3QUQA 4O3RA 7ICOA 4RQ7A 3V7LA 1ZQVA 4CF4A 1Q46A 2FLNA 2EDUA 3KZXA 4RT2A 1LVHA 5EE9A 1RXVA 4RQ1A 4R8UB 7ICRA 4PL1A 2RQ5A 1L7PA 3TFRA 3MR2A 4ECXA 1NKBA 1HJPA 5DQIA 3QEAZ 4ELVA 3RF9A 4QW9A 4DOAA 1N5WA 4B9MA 4Z6DA 3OHBA 2FMQA 1NJXA 1X2IA 2AQ4A 3LDAA 4E0DA 1N2XA 1SIJA 2ES6A 4JUZA 2PI4A 4Y2XA 5D46A 2H3IA 2WAQC 3Q8QB 5ALSA 1H38A 1PK1A 4IQTA 2F8LA 4LJXA 3CNHA 1B22A 1IG6A 2XVTA 1RZTA 2ZTDA 4YMNA 4B6JA 4YMOA 1KBUA 4B9VA 2FI1A 2HCFA 4C7ZA 1U9LA 4EZ6A 4Q44A 2G08A 4C8OA 4C8KA 3O0FA 3RBDA 1D8YA 2UVVA 4OJ6A 4FBTA 2BDPA 4JMUA 2PXIA 4I2FA 4I27A 2QB1A 4CCHA 4C0ZA 5ALKA 2ZJAA 5J0TA 3PW7A 5L9XA 4P0PB 3N7RC 2H3VA 4OD0A 2DUYA 4QZ8A 5AKEA 4NM2A 9ICEA 5C0YA 4IQUA 4BX9C 2RLTA 1TV9A 5J2CA 4EEKA 3RB6A 2KEYA 5DLGA 4Z6EA 2K4EA 4Y2RA 5ALIA 4YR2A 3V72A 4LVSA 4IRDA 4QWCA 3L5KA 2VJ4A 5KFEA 3MGHA 4DL4A 5J2GA 3C29A 5DLFA 1ZQZA 4MF8A 3UMGA 2FDRA 3QZ8A 3V7KA 4TUPA 3ZDDA 4R65A 1X42A 4RZRA 3MR6A 4NXZA 1ZQGA 2C2EA 2XCPA 5L1IA 2D8CA 3RB0A 3C5GA 4EBEA 2YMQA 4UB5A 2RRDA 3F5EA 4HAIA 1QSLA 5IIJA 2WHEA 2K60A 4I2AA 4J9SA 3WKBA 1B4FA 5J0OA 2Y0SF 4M6WA 2K8AA 4RUAA 1UA1A 3L3FX 1RDFA 3IRUA 5KFVA 1P7DA 4TUQA 4KLUA 4TQSA 4KMUA 3GU3A 4DO9A 4ED3A 2WF8A 3J81j 4P4MA 1Q3UA 1K5OA 5CB1A 4M2YA 4O3QA 2ZIVB 2AGOA 2E1FA 3RH4A 4X5VA 3RJHA 4NL9C 4QZGA 5DBCA 3MGIA 3KBBA 8ICKA 4OJPA 3RJJA 3WK9A 1OUQA 4Q43A 7ICJA 7ICLA 4TUSA 3OPXA 3JPQA 1NZBA 4QZFA 3PR5B 3H40A 5EOZA 5C5JA 2HW3A 4UAZA 2ASJA 2JZBB 2JEFA 4TQRA 8ICTA 1SL2A 2K8CB 1T4GA 5AI8A 5DB9A 1XO0A 1KFSA 4CE6A 4DL3A 3PW2A 9ICMA 2W03A 5ALFA 4YG2A 2ZUDA 1Q3VA 2AGPA 3ED5A 4DFJA 4BXOB 5L1LA 4ECVA 1JXEA 2YQEA 5AI4A 3PX0A 2V4QA 1PUZA 2JXJA 5BOLA 2W8LA 2FLPA 1MA7A 2NRTA 3JPPA 1QLNA 1HUZA 3D2NA 4QZBA 3GIMA 2WF6A 5CRXA 5KFRA 4P4PA 2EQYA 2EZXA 3M9MB 4MFAA 4QZAA 3QNMA 4DF4A 4CNQA 2OXOA 4FE3A 1XSPA 2OCEA 5DB8A 2KK0A 3RH6A 2GWSA 2J6SA 3A0BU 4RQ3A 3IV6A 3AUOA 4PPXA 4DFKA 5AKKA 4ED8A 1LKYA 2VA8A 4O9MA 1DK2A 2KG5A 3N97B 5KG5A 2LYAA 4KLGA 4QZHA 8ICSA 4DQSA 2K4PA 2WF5A 1MSWD 3ZDEA 3TI0A 2Y1JA 8ICUA 2RDIA 4JB3A 3RRHA 2XC9A 1MN8A 2GOLA 4PGYA 4F4ZA 1ZQRA 9ICHA 2F2AB 3RBEA 3T5KA 4F5RA 3RJKA 4Y2UA 3T5JA 2CPRA 3C2LA 4M47A 1MC8A 3JPRA 4UB4A 2YTUA 4ECQA 2JZBA 2HBMA 4Y2SA 3ZD8A 2WF7A 2VA2A 5HMMA 1KQQA 3IM1A 3PW4A 3FDSA 2KTQA 1CRXA 4I2HA 3QU7A 5AM1A 4NV0A 3M8SA 3EPGA 2Q0ZX 1U49A 3HWTA 1NK7A 2LHTA 5KFKA 4KLIA 3ISDA 4F4WA 3LWMA 4M9LA 3HRDD 1X6JA 2NV3A 4MFCA 2A1JB 3M7DA 3HPOA 4JWNA 4R63A 1XWLA 3SMVA 3VC8A 1L7NA 1ZQPA 1DOQA 3AEVA 5ALPA 1NNLA 2WAQF 4KLTA 3I1YA 3AQEA 2FMSA 2LKYA 4UAWA 5J2DA 9ICKA 2C28A 5AM5A 3M8RA 2C2DA 3EW9A 4QZIA 4QWEA 4J9OA 9ICRA 2P66A 2R8JA 8ICCA 3AQFA 1TFRA 2ZIXA 1M6YA 5EE1A 1PK3A 3BZKA 2IA6A 3M6ZA 3TACB 3F53A 2AGQA 5IILA 1X9WA 2HHXA 3LVVA 4GXIA 1D9FA 4Q8FA 4QWDA 1NK4A 5KG6A 8ICFA 1RQNA 2ZTCA 4RPXA 1WUDA 2JH7A 2IOFK 2JH1A 2IHNA 1N61A 3H8SA 4YFKA 2YB1A 1NK9A 1SKSA 3RRGA 2W43A 1XSLA 3PX6A 3RB4A 8ICPA 5HR7A 5AI6A 4DQPA 2KIWA 5G5HA 1TE2A 2M9NA 1SV0A 2CN1A 3A0HU 3FYHA 4Y2VA 3CYMA 1NJZA 8ICRA 5CJ7A 1F5SA 3ORYA 5AHXA 4IS7A 4NJ8A 2XICA 3QZ7A 2DFLA 4YR3A 5KFCA 8ICAA 2E1EA 2W3SA 1U47A 4EEYA 5DBAA 3QU2A 2KOBA 2KV2A 3V6JA 1KW4A 2VIXA 2QKQA 9ICQA 3BQTA 4EYIB 1JIHA 4NLNA 4OO1J 4K4IA 3MFHA 1ZQMA 4QZCA 9ICTA 4B9NA 3DEEA 4J9QA 1RYUA 2A1JA 4B9UA 2RDJA 1ZQWA 4C8NA 8ICHA 1SXEA 1A77A 1D9DA 1NJYA 3WKEA 4RT3A 2KSOA 4C4TA 1OW5A 2XY6A 1ECWA 3EUB2 2YN4A 4NY8A 3K1RB 5J0RA 5AICA 2KMDA 9ICOA 4O3NA 3SR6A 8ICLA 1WCLA 4RPZA 4B9SA 5KFUA 2A19A 4RNMA 4YCXA 5ALGA 1BPYA 2P6UA 8ICJA 1N60A 2KE7A 5AK4A 1XC9A 2H3FA 3GIJA 1VLBA 3EPIA 1TKDA 3T3FA 3TAPA 4UARA 4Y2JA 1T7PA 2W9CA 4UQGA 2XGQA 1KL9A 1K1QA 4FO6A 7ICGA 5J0YA 4US9A 5DB6A 5J0UA 3IG8A 3AMZA 1L3SA 5J8YA 2UVRA 5DKWA 1NK0A 3BZCA 2OYYA 4ECUA 3CP8A 5ALHA 4EBCA 2HOQA 4Z6FA 4TURA 4UB3A 1XNSA 7ICQA 1JRPA 1WCNA 1URJA 7ICMA 3PO5A 4C8MA 4G9BA 5CA7A 3KZIU 1K1SA 2JEIA 3BS7A 1S0MA 5AKLA 3UMCA 3V6KA 1NJWA 3GZFA 4NLZA 1CI4A 1JROA 1ZQFA 3PO4A 5B5EU 2KZ3A 2BGWA 4AYBF 5KT7A 3N7SC 2D6FC 1Y88A 1ZD3A 3MFIA 4I2IA 5JU5A 3WU2U 4OJLA 2V4RA 4UBBA 5DDMA 3T5HA 3K1ZA 5HNKA 2R8KA 3WK8A 5ALTA 4FZLA 2R8GA 4KLLA 2MAXA 3KKAA 4IR9A 3QU4A 1UA0A 2VJ5A 5KG1A 3CW2C 1ZQDA 3C1YA 1RYSA 4DS4A 4F3OA 1BGXT 3PY8A 4NLKA 1X66A 5J0PA 3B9JA 2B6GA 8ICNA 1JMSA 4P0QB 1SGGA 4FZMA 1QSYA 4Y2YA 9ICXA 3Q8MA 3UXPA 4YR0A 2ATLA 4UAVA 3PSFA 3ZI4A 3PNCA 2DL0A 4I29A 2HI0A 2W9AA 3NRWA 5KL8B 3WKCA 2NRWA 4QZEA 5L1KA 1F0MA 5DG9A 2ZXHA 1T3NA 2KFNA 5AI5A 1Z00A 5AI9A 1KSPA 1SWVA 8ICMA 1S76D 5H2FU 2IOFA 2HVIA 2XGPA 3GV5B 3F2CA 1X9SA 3THVA 3TKAA 4ED7A 3NVWA 2W9MA 1RG6A 3MR5A 4B9TA 3KHRA 8ICYA 2KICA 2HDOA 4DSEA 1FEZA 2HHSA 5DBBA 4GLXA 4NM1A 2KD1A 4CRXA 3WK6A 3K75D 3M1YA 2E8OA 5IIOA 2VKQA 4YXMA 3WK5A 3D2QA 1OXJA 1ZYQA 3F5AA 1QTMA 3F2DA 3IDWA 5GTIU 5KFSA 2EAMA 4UAUA 3OTQA 3SAHA 2IMWP 3BDPA 2W7OA 3N7PD 8ICOA 3SI8A 2R8HA 4QWBA 1PVQA 3H0MB 2HHTA 2Z7JA 1A76A 3L4PA 1S97A 3SAFA 1TVAA 3D2SA 3G6XA 3Q8LA 4RQ2A 3DDHA 4MHVA 4M9NA 2ZIUA 5KT2A 1C20A 4IQWA 1IXRA 2IBKA 3Q8RB 1PZNA 3H0LB 1KKXA 3NUQA 9ICUA 5AKHA 5KFFA 2KN7A 3PMLA 4F5PA 3UXNA 9ICVA 1L8LA 5KTQA 1ZQSA 2LPEA 4QNLA 5DQGA 2QB0B 4QZ9A 1PVRA 4M9GA 3M6KA 5ALDA 4R64A 5KFLA 4PHEA 3ICXA 3RFAA 3UQ2A 5KAFU 4F2RA 1N48A 4JWMA 4NLGA 4EBDA 1RXWA 2O6KA 8ICQA 3ALRA 3VCBA 5DGAA 2HHUA 3GV7B 3N28A 4I2GA 3ONNA 2CXYA 2LM4A 3GDXA 3MGVA 2NRXA 3MC1A 1T8EA 1UCVA 3AM9A 3H4DA 5GTHU 2DPJA 2HHWA 4PHAA 1L5UA 1RM6C 3BQ1A 4K4HA 2ZJ5A 5AKZA 5KFJA 1VJ5A 2KVSA 5CEHA 5HR6A 7ICUA 2BR0A 2B0CA 1ZQ1C 4KN4A 2NYVA 2HBJA 2FE9A 3OSNA 3C2KA 2G0AA 3Q8KA 4DEZA 4BGDA 9ICBA 4FFDA 1V38A 2AQ0A 2BCVA 2F1IA 4GFJA 5TZVA 2BCQA 3TADC 4YXJA 1SZPA 8ICBA 1L7OA 3C1ZA 4F93B 1C7YA 4Q8EA 3NTUA 3PW5A 3IG5A 1UPHA 4ELTA 2ASDA 5DG7A 2JMGA 1ZQKA 2LMRA 5KFQA 1UT5A 4RQNA 4RUCA 1XU4A 5CHGA 1NI3A 5J0WA 1FIQA 5KG0A 1LV5A 1BVSA 1L3UA 2H3QA 4OCZA 3UQ0A 5KG2A 1ZQOA 3RJGA 4GIBA 2DKXA 5J2IA 4KLDA 3OGUA 3HX0A 2A1AA 5ALQA 2W04A 5K4LA 4EX7A 2DKZA 2W3RA 5ALZA 2UVUA 2OHFA 4YMMA 2AJQA 5T14A 7ICIA 4ED2A 2BPFA 1CEZA 3OJSA 4F5QA 1KFDA 1SB3C 5KT3A 1S5LU 2JHDA 1X40A 1WWVA 3UMBA 3SAGA 2DPIA 1RPLA 2V9WA 5DG8A 1RQLA 1N62A 1JI7A 4DL7A 2N1RA 3UXOA 4IQVA 1S0OA 5AK5A 3JPOA 2K8BB 5J0SA 4IRCA 3MABA 5J2JA 4PGQA 4M04A 4P4OA 4ICAA 4ELUA 5KFPA 3AL0B 1QQ5A 4C80A 3M9OB 3ZDAA 4KLHA 4DQQA 4ZH4A 3BQ0A 3QUTA 4I28A 2JRZA 2Y0SC 1SL1A 1Z3EB 1WYGA 4GXKA 2BCRA 5FP0A 3H8MA 2F1JA 4BXOA 4EZ9A 2WTFA 5EE3A 1DXSA 4UB6U 3PV8A 2AU0A 2EH9A 3QE9Y 5IIMA 4PH5A 4P0QA 1ZRMA 1D8BA 1S10A 2LI6A 4PJ0U 3RAQA 4KLJA 4IR1A 4KN7A 4IRKA 5EWFA 5KG7A 3KTQA 5AK6A 1AROP 3I76A 3KHGA 3RH5A 4PHDA 4KLSA 4PHPA 4F50A 1U4BA 3MBYA 3MR3A 2OEHA 1FO4A 5KFHA 1SZHA 7ICFA 4UB8U 2DWQA 2XO7A 5KFOA 1V85A 4KLFA 4Z6CA 2F8KA 2PI5A 5KFIA 4P0PA 3BS5A 2FPLA 7ICVA 1ZQAA 2EZZA 3ETRA 3ISCA 2KVCA 4R8UA 4BWMA 2NO4A 1WG8A 4O5KA 4P2HA 4F4XA 2UVWA 2MRLA 1L8OA 2ZIWA 2ZIVA 3WKAA 4B9LA 2BZFA 5F3XB 5JTIA 4C4SA 2PFQA 3OSPA 4KLOA 5JUMA 1COOA 2BKEA 2C2RA 1L3VA 1ZXIA 2IOHA 1ZQBA 1ZQNA 3TFSA 1KLNA 2LM1A 4ED0A 3CRXA 3KFUF 5J0XA 2LYHA 4US8A 3C28A 2EZYA 1N56A 2JEJA 9ICCA 1EXNA 2L5YA 3JPSA 1ZQXA 1B0XA 4I2DA 1QQ7A 2W11A 8ICEA 3SD7A 5KFNA 4KLEA 7ICPA 1MQ3A 5CP2A 2KHVA 4XQ8A 4WJ3B 2B21A 4YD1A 2XY5A 2I1QA 2GO7A 4MF2A 4J9KA 1JX4A 1ZQEA 8ICGA 5DB7A 2H3ZA 2Y9TA 5IINA 9ICJA 5D49A 3F2BA 4F71A 2J6TA 2HHQA 3GFKB 4O3MA 3H0RB 4ECWA 4YVZA 3B0XA 3GILA 4EYHB 1DGSA 3NVYA 2C22A 3HP6A 3PVXA 2WFAA 5JRTA 4QJFB 2ESEA 3H7IA 2ISOA 3ETLA 3OHAA 1Z4OA 2ISPA 4QIWC 4F4KA 3HW8A 4PZNA 3G6VA 4F5NA 5L1JA 5AKJA 3QU9A 2K4HA 4Q45A 4YP3A 1FFVA 3C2MA 4LZGA 1NKCA 3SV3A 1N63A 3PW0A 3NRZA 2EANA 1O08A 4JV2A 4M9HA 3C23A 2W7PA 4O3OA 5KFYA 4LZDA 4RQ0A 1BNPA 2PMZF 4QW8A 2ZUBA 2BPGA 4JK1A 4CF3A 2ZIWB 3RJEA 5BOMA 4C8LA 1ZETA 3EWAA 4DQIA 3BJYA 1UHUA 2ALZA 1U48A 3WK7A 2FJ6A 2W9BB 1SKRA 4ECYA 2P35A 4MEXA 2KJ8A 4F8RA 1D8LA 8ICIA 5KG3A 4DL2A 5KFWA 3WKDA 5J0QA 9ICPA 4G3IA 2F3NA 3U26A 1A0PA 2KNJA 2OM6A 3PSTA 5A0LA 2KJ9A 5KFGA 4YQWA 2NRZA 2GH1A 4KX3A 5DDYA 3E2EA 3KKAC 1IM4A 2NO5A 2MUTB 4DLGA 1TAMA 3KD3A 4NLBA 1KRPA 1NK8A 1DGJA 4ED1A 4DS5A 4C7YA 3RR7A 2R18A 4GC7A 1Z1BA 2F77X 1UT8A 3RJIA 4I2CA 4O5EA 4ECSA 2DQNB 5AIBA 2I9GA 2YMMA 4DL5A 4DFDA 2I5HA 1BPEA 7ICNA 1SV4A 4CGZA 3KHLA 3SV4A 2KZZA 3SENA 5KL1B 4PGXA 2BDUA 3GV8B 4PL2A 4UATA 2HBLA 2KHQA 4DOBA 1TK8A 2OWOA 5HHIA 4DWIA 4GXJA 5HHHA 3NGDA 7ICSA 4QWAA
chains in the Genus database with same CATH topology
2BR0A 1SKWA 1JN3A 4KLTA 4KN4A 2H5XA 1NK5A 2FMSA 4UAWA 9ICKA 5J2DA 4UBCA 2C28A 4DSLA 1NOMA 4RQ6A 3M8RA 1CUKA 5HMLA 5KFBA 3OSNA 2BCSA 2C2DA 3EW9A 4QZIA 3C2KA 4J9RA 2HHVA 4DOCA 3Q8KA 4DEZA 5KT5A 4BGDA 9ICBA 4QWEA 4F92B 4J9OA 2AQ0A 2BCVA 3GIKA 9ICRA 1U45A 2F1IA 1X9MA 4DSFA 5DQHA 2P66A 2R8JA 4M6WB 5KT6A 8ICCA 3RAXA 1TFRA 5TZVA 1QSSA 2BCQA 1KDHA 3SZ2A 1XSNA 4J9PA 2IA6A 1HUOA 4YXJA 4DFMA 2BCUA 2ZUCA 1SZPA 1BPXA 8ICBA 5KFZA 4QZDA 4MFFA 5IIKA 2AGQA 4I2EA 5KFMA 3C1ZA 4F93B 3V7JA 5IILA 1X9WA 3PMNA 1C7YA 3NTUA 3PW5A 1ZQLA 4Q8EA 4XRHA 4F5OA 4ELTA 2ASDA 2HHXA 4GXIA 4RQ5A 1D9FA 2BQ3A 4Q8FA 5DG7A 5KFDA 4QWDA 1NK4A 1ZQKA 3MDAA 5KG6A 5EWGA 5KFQA 8ICFA 4ED6A 4RPXA 2ZTCA 3UPQA 1ZQYA 4ECZA 3TARA 2W8KA 3EZ5A 9ICLA 3T5LA 3N4MB 1NKEA 2IHNA 1UT5A 3H8SA 4RUCA 3Q8PB 4YFKA 4JV1A 1XU4A 2W9BA 3GIIA 1NK9A 5CHGA 1SKSA 5J0WA 3RRGA 7ICEA 4O3RA 5KG0A 1XSLA 3PX6A 3RB4A 1LV5A 4RPYA 1BVSA 1ZQVA 3V7LA 4RQ7A 3UQ0A 1L3UA 5KG2A 1ZQOA 3RJGA 2FLNA 4DQPA 4RT2A 5J2IA 2M9NA 3TQ1A 4KLDA 3OGUA 3HX0A 1RXVA 4RQ1A 4R8UB 7ICRA 1XS9D 3FYHA 5D4BA 2UVUA 1NJZA 4YMMA 3TFRA 3MR2A 2AJQA 4ECXA 4I2JA 1HJPA 3H8WA 5HP4A 5DQIA 1NKBA 3QEAZ 8ICRA 7ICIA 5CJ7A 4ELVA 4QW9A 3ORYA 4DOAA 4ED2A 1ZQQA 4GC6A 4B9MA 4Z6DA 3OHBA 2BPFA 3QZ7A 2FMQA 2DFLA 4YR3A 5KFCA 1XO1A 1TK0A 1NJXA 3OJSA 1CEZA 4F5QA 2F1HA 1X2IA 8ICAA 9ICIA 2MUTA 2AQ4A 3LDAA 4E0DA 4JUZA 1KFDA 2PI4A 5J2AA 5D46A 5J29A 1U47A 4EEYA 5DBAA 5KT3A 3Q8QB 2FLLA 1H38A 4IQTA 4J9LA 1JXLA 1B22A 3K4GA 3V6JA 1RZTA 2DPIA 1RPLA 1ZQIA 2V9WA 2ZTDA 5DG8A 4YMNA 4YMOA 4B9VA 9ICQA 3BQTA 4EYIB 1JIHA 4DL7A 3UXOA 4NLNA 1U9LA 4EZ6A 2BHNA 4IQVA 4Q44A 3MFHA 3M9NB 4QZCA 3H4BA 1S0OA 1ZQMA 4K4IA 9ICTA 4B9NA 4C8OA 4J9QA 4C8KA 3JPOA 5J0SA 3RBDA 2A1JA 1D8YA 2UVVA 4IRCA 4FBTA 2BDPA 4B9UA 2RDJA 2PXIA 4I2FA 3MABA 5J2JA 1ZQWA 4PGQA 5KFTA 4CCHA 3AU2A 4P4OA 4C8NA 4I27A 4M04A 4ECRA 4ELUA 8ICHA 1A77A 5KFPA 2ZJAA 5J0TA 1D9DA 3PW7A 5L9XA 4DFPA 5KFXA 3M9OB 3BQ2A 3EYZA 1NJYA 3ZDAA 4KLHA 4KITB 4RT3A 4DQQA 4ZH4A 3BQ0A 1SL0A 4I28A 2XY6A 4NY8A 1SL1A 4QZ8A 8ICWA 1Z3EB 8ICXA 4GXKA 2BCRA 8ICVA 5J0RA 9ICOA 3RB3A 2F1JA 4O3NA 4NM2A 9ICEA 4IQUA 8ICLA 4BXOA 1WCLA 1TV9A 2JEGA 4RPZA 2WTFA 4B9SA 4EZ9A 5KFUA 5J2CA 3RB6A 5J2EA 4RNMA 4YCXA 5DLGA 4Z6EA 1TAUA 3PV8A 2AU0A 4RU9A 2P6UA 1BPYA 3QE9Y 8ICJA 4O0IA 4YR2A 3V72A 5IIMA 4LVSA 4PH5A 4IRDA 4QWCA 4DSIA 4F2SA 1XC9A 5KFEA 3MGHA 4DL4A 5J2GA 5F9NA 1S10A 3GIJA 2J6UA 3RAQA 3EPIA 4KLJA 5DLFA 1TKDA 1ZQZA 4IR1A 4KN7A 3T3FA 4MF8A 4IRKA 3QZ8A 3TAPA 5EWFA 4RNOA 3V7KA 4TUPA 5J2HA 3ZDDA 4R65A 4M9JA 5KG7A 3KTQA 4M0AA 4RZRA 1AROP 3MR6A 3KHGA 1T7PA 4NXZA 1ZQGA 2W9CA 2C2EA 3RH5A 4UQGA 2XGQA 4PHDA 2XCPA 4FBUA 4KLSA 5IIIA 2W9CB 1K1QA 3C21A 4FO6A 7ICGA 4PHPA 5J0YA 2KFZA 5DB6A 4F50A 5L1IA 1U4BA 3MBYA 3MR3A 3RB0A 5J0UA 3C5GA 4EBEA 4UB5A 1L3SA 5KFHA 7ICFA 7ICKA 1QSLA 5IIJA 2UVRA 1ZQHA 5DKWA 4J9SA 2IHMA 4I2AA 1NK0A 2XO7A 4ECUA 5KFOA 4KLFA 4EBCA 4Z6CA 5J0OA 1KFTA 4Z6FA 4TURA 2PI5A 5KFIA 4M6WA 4UB3A 4RUAA 7ICQA 1UA1A 2FPLA 7ICVA 1ZQAA 1BPDA 1WCNA 7ICMA 9ICSA 3PR4A 3ISCA 3PO5A 4C8MA 4R8UA 5KFVA 5CA7A 4BWMA 1K1SA 2JEIA 3TAQA 4TUQA 1S0MA 4KLUA 4TQSA 4O5KA 4P2HA 4KMUA 4ECTA 3V6KA 4DO9A 4ED3A 1NJWA 4P4MA 2PFNA 4NLZA 4F4XA 1ZQFA 2UVWA 3PO4A 5CB1A 4M2YA 2KZ3A 3Q8SB 4UB1A 4O3QA 2BGWA 1S9FA 3LK9A 1ZJNA 2AGOA 5KT7A 1LB2B 1Y88A 3RH4A 4B9LA 3MFIA 3JPTA 4I2IA 4X5VA 2V4RA 2PFQA 4UBBA 5DDMA 4FS2A 3T5HA 4JV0A 3OSPA 2R8IA 3RJHA 4KLOA 4QZGA 5DBCA 7ICHA 3MGIA 5JUMA 5J2BA 1COOA 5HNKA 8ICKA 2R8KA 2BKEA 3RJJA 4KLLA 2R8GA 3ISBA 2MAXA 4K4GA 2C2RA 1L3VA 4IR9A 1UA0A 1ZQBA 1ZQNA 3TFSA 1KLNA 5KG1A 4Q43A 4ED0A 1MQ2A 7ICJA 7ICLA 5J0XA 2LYHA 4TUSA 1ZQDA 3ZD9A 9ICNA 3JPQA 3C1YA 4YN4A 1RYSA 4DS4A 4F3OA 4QZFA 3PR5B 1BGXT 3H40A 5EOZA 4FS1A 1N56A 2JEJA 3PY8A 4NLKA 5C5JA 2HW3A 4UAZA 3QEBZ 9ICCA 4XA5A 5J0PA 2ASJA 2JZBB 5EWEA 2JEFA 4TQRA 1EXNA 8ICNA 8ICTA 3JPSA 1SL2A 1ZQXA 3GQCA 4I2DA 1JMSA 1NK6A 8ICEA 1T4GA 7ICOA 2PFPA 3H8JA 5KFNA 4KLEA 7ICPA 1MQ3A 5CP2A 3G6YA 1QSYA 5DB9A 4XQ8A 3Q8MA 1KFSA 3UXPA 9ICXA 4YR0A 2B21A 4DL3A 2ATLA 3PW2A 9ICMA 2NRVA 4YG2A 3PNCA 2ZUDA 4DLEA 3RJFA 4YD1A 2XY5A 2I1QA 4O3PA 4BDPA 4I29A 2AGPA 4DFJA 4BXOB 2ASLA 1V9PA 2W9AA 4UAYA 4RQ4A 1JXEA 5L1LA 4J9KA 4ECVA 4MF2A 1JX4A 3PX0A 2FPKA 2V4QA 2NRWA 4QZEA 5L1KA 1S0NA 5KT4A 1Z00B 4XUSA 4BWJA 5DG9A 2ZJ8A 1T3NA 1ZQEA 3ZDBA 2KFNA 3B0YA 5BPCA 9ICWA 1Z00A 8ICGA 5BOLA 5DB7A 4RNNA 1KSPA 4DQRA 2W8LA 5IINA 2BQUA 2FLPA 2FMPA 3ZDCA 2NRTA 3JPPA 1QLNA 1S76D 5D49A 8ICMA 9ICJA 1HUZA 1BPBA 2BQRA 2HVIA 2XGPA 3GV5B 2J6TA 4QZBA 2HHQA 2P6RA 3GIMA 1X9SA 3GFKB 9ICFA 5KFRA 4P4PA 3HT3A 5J2FA 2VA3A 3THVA 4ED7A 5DGBA 2W9MA 3M9MB 4YVZA 4ECWA 3B0XA 3MR5A 3GILA 4MEYA 3KHRA 4EYHB 4B9TA 1DGSA 8ICYA 1ZQTA 2C22A 3HP6A 4DSEA 4MFAA 3PVXA 2HHSA 5DBBA 4GLXA 2Y1IA 4NM1A 2ISOA 3H7IA 4R66A 2BPCA 4QZAA 3ETLA 3RTVA 3AU6A 3OHAA 3K75D 5IIOA 3KHHA 2ISPA 4F4KA 3HW8A 4YXMA 1ZQUA 4DF4A 8ICZA 3G6VA 4F5NA 5L1JA 7ICUA 1ZYQA 1XSPA 2HVHA 5DB8A 1QTMA 4KLQA 2KZMA 4YD2A 4Q45A 4YP3A 5J2KA 3RH6A 2GWSA 2J6SA 3V6HA 3C2MA 1S77D 5KFSA 4LZGA 1NKCA 3SV3A 4RQ3A 3AUOA 1ZQJA 4PPXA 4DFKA 1L3TA 4ED8A 2IMWP 2VA8A 2XY7A 4O9MA 1B43A 3PW0A 5KG4A 3BDPA 3JPNA 3N97B 4JV2A 3SI8A 4UB2A 3C23A 4M9HA 5KG5A 2R8HA 4QWBA 4QZHA 4KLGA 8ICSA 4O3OA 4DQSA 5KFYA 2HHTA 1RYRA 1MSWD 7ICTA 3PX4A 4LZDA 1A76A 3ZDEA 4RQ0A 3SYZA 3TI0A 2Y1JA 4HYKA 9ICGA 4QW8A 2RDIA 8ICUA 1TAQA 1S97A 3RRHA 2XC9A 1TVAA 1KEJA 2ZUBA 2BPGA 4F4YA 3MDCA 4JK1A 3G6XA 3RJEA 5BOMA 4C8LA 5F9LA 3Q8LA 1ZETA 3EWAA 4RQ2A 3OJUA 4DQIA 4PGYA 3BJYA 2ALZA 4F4ZA 1ZQRA 4M9NA 9ICHA 1U48A 3RBEA 5KT2A 4IQWA 2W9BB 1SKRA 4ECYA 4F5RA 1IXRA 3T5KA 4MEXA 2IBKA 3RJKA 4F8RA 1D8LA 3Q8RB 4J9MA 3T5JA 8ICIA 5KG3A 1PZNA 4DL2A 5KFWA 9ICAA 5J0QA 9ICPA 4G3IA 3C2LA 4M47A 1MC8A 2ZTEA 9ICUA 3JPRA 4UB4A 2FPMA 4KTQA 5KFFA 2KN7A 3PMLA 4F5PA 3UXNA 9ICVA 5KFGA 5KTQA 4YQWA 2NRZA 4ECQA 2JZBA 5DQGA 1ZQSA 4KLMA 5DDYA 3E2EA 4RQ8A 3ZD8A 4QZ9A 4M9GA 1ZQCA 1S0VA 1IM4A 2VA2A 5HMMA 4R64A 4DF8A 2MUTB 5KFLA 4PHEA 3C5FA 4DLGA 3UQ2A 3IM1A 2VANA 2XCAA 1NK8A 1KRPA 4F2RA 1N48A 3PW4A 4JWMA 2PFOA 8ICOA 5CR0A 3FDSA 2KTQA 4NLGA 4ED1A 4DS5A 4EBDA 3TANA 3RR7A 4I2HA 1RXWA 8ICQA 4GC7A 5DGAA 4DSKA 2HHUA 1UT8A 3M8SA 3EPGA 4J9NA 3GV7B 3RJIA 4I2CA 2Q0ZX 4O5EA 4I2GA 4ECSA 1BPZA 1U49A 3HWTA 3LWLA 1NK7A 5KFKA 3IHQB 4I2BA 4KLIA 3GDXA 3ISDA 5CWRA 4F4WA 4DSJA 1ZJMA 2NRXA 3LWMA 2I9GA 4M9LA 1T8EA 4MFCA 1TK5A 2A1JB 4DL5A 7ICNA 1BPEA 3KHLA 3SV4A 4O5CA 3H4DA 3HPOA 2DPJA 4JWNA 2HHWA 4PHAA 4R63A 3RR8A 1XWLA 2KZZA 4F91B 4PGXA 5KFAA 1L5UA 3BQ1A 3GV8B 4K4HA 2ZJ5A 4DL6A 5KFJA 4DOBA 1TK8A 1DOQA 1ZQPA 2OWOA 8ICPA 1KTQA 5HHIA 4DWIA 4GXJA 5HHHA 3NGDA 4O3SA 7ICSA 4QWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR0 A;  1SKW A;  1JN3 A;  4KLT A;  4KN4 A;  2H5X A;  1NK5 A;  2FMS A;  4UAW A;  9ICK A;  5J2D A;  4UBC A;  2C28 A;  4DSL A;  1NOM A;  4RQ6 A;  3M8R A;  1CUK A;  5HML A;  5KFB A;  3OSN A;  2BCS A;  2C2D A;  3EW9 A;  4QZI A;  3C2K A;  4J9R A;  2HHV A;  4DOC A;  3Q8K A;  4DEZ A;  5KT5 A;  4BGD A;  9ICB A;  4QWE A;  4F92 B;  4J9O A;  2AQ0 A;  2BCV A;  3GIK A;  9ICR A;  1U45 A;  2F1I A;  1X9M A;  4DSF A;  5DQH A;  2P66 A;  2R8J A;  4M6W B;  5KT6 A;  8ICC A;  3RAX A;  1TFR A;  5TZV A;  1QSS A;  2BCQ A;  1KDH A;  3SZ2 A;  1XSN A;  4J9P A;  2IA6 A;  1HUO A;  4YXJ A;  4DFM A;  2BCU A;  2ZUC A;  1SZP A;  1BPX A;  8ICB A;  5KFZ A;  4QZD A;  4MFF A;  5IIK A;  2AGQ A;  4I2E A;  5KFM A;  3C1Z A;  4F93 B;  3V7J A;  5IIL A;  1X9W A;  3PMN A;  1C7Y A;  3NTU A;  3PW5 A;  1ZQL A;  4Q8E A;  4XRH A;  4F5O A;  4ELT A;  2ASD A;  2HHX A;  4GXI A;  4RQ5 A;  1D9F A;  2BQ3 A;  4Q8F A;  5DG7 A;  5KFD A;  4QWD A;  1NK4 A;  1ZQK A;  3MDA A;  5KG6 A;  5EWG A;  5KFQ A;  8ICF A;  4ED6 A;  4RPX A;  2ZTC A;  3UPQ A;  1ZQY A;  4ECZ A;  3TAR A;  2W8K A;  3EZ5 A;  9ICL A;  3T5L A;  3N4M B;  1NKE A;  2IHN A;  1UT5 A;  3H8S A;  4RUC A;  3Q8P B;  4YFK A;  4JV1 A;  1XU4 A;  2W9B A;  3GII A;  1NK9 A;  5CHG A;  1SKS A;  5J0W A;  3RRG A;  7ICE A;  4O3R A;  5KG0 A;  1XSL A;  3PX6 A;  3RB4 A;  1LV5 A;  4RPY A;  1BVS A;  1ZQV A;  3V7L A;  4RQ7 A;  3UQ0 A;  1L3U A;  5KG2 A;  1ZQO A;  3RJG A;  2FLN A;  4DQP A;  4RT2 A;  5J2I A;  2M9N A;  3TQ1 A;  4KLD A;  3OGU A;  3HX0 A;  1RXV A;  4RQ1 A;  4R8U B;  7ICR A;  1XS9 D;  3FYH A;  5D4B A;  2UVU A;  1NJZ A;  4YMM A;  3TFR A;  3MR2 A;  2AJQ A;  4ECX A;  4I2J A;  1HJP A;  3H8W A;  5HP4 A;  5DQI A;  1NKB A;  3QEA Z;  8ICR A;  7ICI A;  5CJ7 A;  4ELV A;  4QW9 A;  3ORY A;  4DOA A;  4ED2 A;  1ZQQ A;  4GC6 A;  4B9M A;  4Z6D A;  3OHB A;  2BPF A;  3QZ7 A;  2FMQ A;  2DFL A;  4YR3 A;  5KFC A;  1XO1 A;  1TK0 A;  1NJX A;  3OJS A;  1CEZ A;  4F5Q A;  2F1H A;  1X2I A;  8ICA A;  9ICI A;  2MUT A;  2AQ4 A;  3LDA A;  4E0D A;  4JUZ A;  1KFD A;  2PI4 A;  5J2A A;  5D46 A;  5J29 A;  1U47 A;  4EEY A;  5DBA A;  5KT3 A;  3Q8Q B;  2FLL A;  1H38 A;  4IQT A;  4J9L A;  1JXL A;  1B22 A;  3K4G A;  3V6J A;  1RZT A;  2DPI A;  1RPL A;  1ZQI A;  2V9W A;  2ZTD A;  5DG8 A;  4YMN A;  4YMO A;  4B9V A;  9ICQ A;  3BQT A;  4EYI B;  1JIH A;  4DL7 A;  3UXO A;  4NLN A;  1U9L A;  4EZ6 A;  2BHN A;  4IQV A;  4Q44 A;  3MFH A;  3M9N B;  4QZC A;  3H4B A;  1S0O A;  1ZQM A;  4K4I A;  9ICT A;  4B9N A;  4C8O A;  4J9Q A;  4C8K A;  3JPO A;  5J0S A;  3RBD A;  2A1J A;  1D8Y A;  2UVV A;  4IRC A;  4FBT A;  2BDP A;  4B9U A;  2RDJ A;  2PXI A;  4I2F A;  3MAB A;  5J2J A;  1ZQW A;  4PGQ A;  5KFT A;  4CCH A;  3AU2 A;  4P4O A;  4C8N A;  4I27 A;  4M04 A;  4ECR A;  4ELU A;  8ICH A;  1A77 A;  5KFP A;  2ZJA A;  5J0T A;  1D9D A;  3PW7 A;  5L9X A;  4DFP A;  5KFX A;  3M9O B;  3BQ2 A;  3EYZ A;  1NJY A;  3ZDA A;  4KLH A;  4KIT B;  4RT3 A;  4DQQ A;  4ZH4 A;  3BQ0 A;  1SL0 A;  4I28 A;  2XY6 A;  4NY8 A;  1SL1 A;  4QZ8 A;  8ICW A;  1Z3E B;  8ICX A;  4GXK A;  2BCR A;  8ICV A;  5J0R A;  9ICO A;  3RB3 A;  2F1J A;  4O3N A;  4NM2 A;  9ICE A;  4IQU A;  8ICL A;  4BXO A;  1WCL A;  1TV9 A;  2JEG A;  4RPZ A;  2WTF A;  4B9S A;  4EZ9 A;  5KFU A;  5J2C A;  3RB6 A;  5J2E A;  4RNM A;  4YCX A;  5DLG A;  4Z6E A;  1TAU A;  3PV8 A;  2AU0 A;  4RU9 A;  2P6U A;  1BPY A;  3QE9 Y;  8ICJ A;  4O0I A;  4YR2 A;  3V72 A;  5IIM A;  4LVS A;  4PH5 A;  4IRD A;  4QWC A;  4DSI A;  4F2S A;  1XC9 A;  5KFE A;  3MGH A;  4DL4 A;  5J2G A;  5F9N A;  1S10 A;  3GIJ A;  2J6U A;  3RAQ A;  3EPI A;  4KLJ A;  5DLF A;  1TKD A;  1ZQZ A;  4IR1 A;  4KN7 A;  3T3F A;  4MF8 A;  4IRK A;  3QZ8 A;  3TAP A;  5EWF A;  4RNO A;  3V7K A;  4TUP A;  5J2H A;  3ZDD A;  4R65 A;  4M9J A;  5KG7 A;  3KTQ A;  4M0A A;  4RZR A;  1ARO P;  3MR6 A;  3KHG A;  1T7P A;  4NXZ A;  1ZQG A;  2W9C A;  2C2E A;  3RH5 A;  4UQG A;  2XGQ A;  4PHD A;  2XCP A;  4FBU A;  4KLS A;  5III A;  2W9C B;  1K1Q A;  3C21 A;  4FO6 A;  7ICG A;  4PHP A;  5J0Y A;  2KFZ A;  5DB6 A;  4F50 A;  5L1I A;  1U4B A;  3MBY A;  3MR3 A;  3RB0 A;  5J0U A;  3C5G A;  4EBE A;  4UB5 A;  1L3S A;  5KFH A;  7ICF A;  7ICK A;  1QSL A;  5IIJ A;  2UVR A;  1ZQH A;  5DKW A;  4J9S A;  2IHM A;  4I2A A;  1NK0 A;  2XO7 A;  4ECU A;  5KFO A;  4KLF A;  4EBC A;  4Z6C A;  5J0O A;  1KFT A;  4Z6F A;  4TUR A;  2PI5 A;  5KFI A;  4M6W A;  4UB3 A;  4RUA A;  7ICQ A;  1UA1 A;  2FPL A;  7ICV A;  1ZQA A;  1BPD A;  1WCN A;  7ICM A;  9ICS A;  3PR4 A;  3ISC A;  3PO5 A;  4C8M A;  4R8U A;  5KFV A;  5CA7 A;  4BWM A;  1K1S A;  2JEI A;  3TAQ A;  4TUQ A;  1S0M A;  4KLU A;  4TQS A;  4O5K A;  4P2H A;  4KMU A;  4ECT A;  3V6K A;  4DO9 A;  4ED3 A;  1NJW A;  4P4M A;  2PFN A;  4NLZ A;  4F4X A;  1ZQF A;  2UVW A;  3PO4 A;  5CB1 A;  4M2Y A;  2KZ3 A;  3Q8S B;  4UB1 A;  4O3Q A;  2BGW A;  1S9F A;  3LK9 A;  1ZJN A;  2AGO A;  5KT7 A;  1LB2 B;  1Y88 A;  3RH4 A;  4B9L A;  3MFI A;  3JPT A;  4I2I A;  4X5V A;  2V4R A;  2PFQ A;  4UBB A;  5DDM A;  4FS2 A;  3T5H A;  4JV0 A;  3OSP A;  2R8I A;  3RJH A;  4KLO A;  4QZG A;  5DBC A;  7ICH A;  3MGI A;  5JUM A;  5J2B A;  1COO A;  5HNK A;  8ICK A;  2R8K A;  2BKE A;  3RJJ A;  4KLL A;  2R8G A;  3ISB A;  2MAX A;  4K4G A;  2C2R A;  1L3V A;  4IR9 A;  1UA0 A;  1ZQB A;  1ZQN A;  3TFS A;  1KLN A;  5KG1 A;  4Q43 A;  4ED0 A;  1MQ2 A;  7ICJ A;  7ICL A;  5J0X A;  2LYH A;  4TUS A;  1ZQD A;  3ZD9 A;  9ICN A;  3JPQ A;  3C1Y A;  4YN4 A;  1RYS A;  4DS4 A;  4F3O A;  4QZF A;  3PR5 B;  1BGX T;  3H40 A;  5EOZ A;  4FS1 A;  1N56 A;  2JEJ A;  3PY8 A;  4NLK A;  5C5J A;  2HW3 A;  4UAZ A;  3QEB Z;  9ICC A;  4XA5 A;  5J0P A;  2ASJ A;  2JZB B;  5EWE A;  2JEF A;  4TQR A;  1EXN A;  8ICN A;  8ICT A;  3JPS A;  1SL2 A;  1ZQX A;  3GQC A;  4I2D A;  1JMS A;  1NK6 A;  8ICE A;  1T4G A;  7ICO A;  2PFP A;  3H8J A;  5KFN A;  4KLE A;  7ICP A;  1MQ3 A;  5CP2 A;  3G6Y A;  1QSY A;  5DB9 A;  4XQ8 A;  3Q8M A;  1KFS A;  3UXP A;  9ICX A;  4YR0 A;  2B21 A;  4DL3 A;  2ATL A;  3PW2 A;  9ICM A;  2NRV A;  4YG2 A;  3PNC A;  2ZUD A;  4DLE A;  3RJF A;  4YD1 A;  2XY5 A;  2I1Q A;  4O3P A;  4BDP A;  4I29 A;  2AGP A;  4DFJ A;  4BXO B;  2ASL A;  1V9P A;  2W9A A;  4UAY A;  4RQ4 A;  1JXE A;  5L1L A;  4J9K A;  4ECV A;  4MF2 A;  1JX4 A;  3PX0 A;  2FPK A;  2V4Q A;  2NRW A;  4QZE A;  5L1K A;  1S0N A;  5KT4 A;  1Z00 B;  4XUS A;  4BWJ A;  5DG9 A;  2ZJ8 A;  1T3N A;  1ZQE A;  3ZDB A;  2KFN A;  3B0Y A;  5BPC A;  9ICW A;  1Z00 A;  8ICG A;  5BOL A;  5DB7 A;  4RNN A;  1KSP A;  4DQR A;  2W8L A;  5IIN A;  2BQU A;  2FLP A;  2FMP A;  3ZDC A;  2NRT A;  3JPP A;  1QLN A;  1S76 D;  5D49 A;  8ICM A;  9ICJ A;  1HUZ A;  1BPB A;  2BQR A;  2HVI A;  2XGP A;  3GV5 B;  2J6T A;  4QZB A;  2HHQ A;  2P6R A;  3GIM A;  1X9S A;  3GFK B;  9ICF A;  5KFR A;  4P4P A;  3HT3 A;  5J2F A;  2VA3 A;  3THV A;  4ED7 A;  5DGB A;  2W9M A;  3M9M B;  4YVZ A;  4ECW A;  3B0X A;  3MR5 A;  3GIL A;  4MEY A;  3KHR A;  4EYH B;  4B9T A;  1DGS A;  8ICY A;  1ZQT A;  2C22 A;  3HP6 A;  4DSE A;  4MFA A;  3PVX A;  2HHS A;  5DBB A;  4GLX A;  2Y1I A;  4NM1 A;  2ISO A;  3H7I A;  4R66 A;  2BPC A;  4QZA A;  3ETL A;  3RTV A;  3AU6 A;  3OHA A;  3K75 D;  5IIO A;  3KHH A;  2ISP A;  4F4K A;  3HW8 A;  4YXM A;  1ZQU A;  4DF4 A;  8ICZ A;  3G6V A;  4F5N A;  5L1J A;  7ICU A;  1ZYQ A;  1XSP A;  2HVH A;  5DB8 A;  1QTM A;  4KLQ A;  2KZM A;  4YD2 A;  4Q45 A;  4YP3 A;  5J2K A;  3RH6 A;  2GWS A;  2J6S A;  3V6H A;  3C2M A;  1S77 D;  5KFS A;  4LZG A;  1NKC A;  3SV3 A;  4RQ3 A;  3AUO A;  1ZQJ A;  4PPX A;  4DFK A;  1L3T A;  4ED8 A;  2IMW P;  2VA8 A;  2XY7 A;  4O9M A;  1B43 A;  3PW0 A;  5KG4 A;  3BDP A;  3JPN A;  3N97 B;  4JV2 A;  3SI8 A;  4UB2 A;  3C23 A;  4M9H A;  5KG5 A;  2R8H A;  4QWB A;  4QZH A;  4KLG A;  8ICS A;  4O3O A;  4DQS A;  5KFY A;  2HHT A;  1RYR A;  1MSW D;  7ICT A;  3PX4 A;  4LZD A;  1A76 A;  3ZDE A;  4RQ0 A;  3SYZ A;  3TI0 A;  2Y1J A;  4HYK A;  9ICG A;  4QW8 A;  2RDI A;  8ICU A;  1TAQ A;  1S97 A;  3RRH A;  2XC9 A;  1TVA A;  1KEJ A;  2ZUB A;  2BPG A;  4F4Y A;  3MDC A;  4JK1 A;  3G6X A;  3RJE A;  5BOM A;  4C8L A;  5F9L A;  3Q8L A;  1ZET A;  3EWA A;  4RQ2 A;  3OJU A;  4DQI A;  4PGY A;  3BJY A;  2ALZ A;  4F4Z A;  1ZQR A;  4M9N A;  9ICH A;  1U48 A;  3RBE A;  5KT2 A;  4IQW A;  2W9B B;  1SKR A;  4ECY A;  4F5R A;  1IXR A;  3T5K A;  4MEX A;  2IBK A;  3RJK A;  4F8R A;  1D8L A;  3Q8R B;  4J9M A;  3T5J A;  8ICI A;  5KG3 A;  1PZN A;  4DL2 A;  5KFW A;  9ICA A;  5J0Q A;  9ICP A;  4G3I A;  3C2L A;  4M47 A;  1MC8 A;  2ZTE A;  9ICU A;  3JPR A;  4UB4 A;  2FPM A;  4KTQ A;  5KFF A;  2KN7 A;  3PML A;  4F5P A;  3UXN A;  9ICV A;  5KFG A;  5KTQ A;  4YQW A;  2NRZ A;  4ECQ A;  2JZB A;  5DQG A;  1ZQS A;  4KLM A;  5DDY A;  3E2E A;  4RQ8 A;  3ZD8 A;  4QZ9 A;  4M9G A;  1ZQC A;  1S0V A;  1IM4 A;  2VA2 A;  5HMM A;  4R64 A;  4DF8 A;  2MUT B;  5KFL A;  4PHE A;  3C5F A;  4DLG A;  3UQ2 A;  3IM1 A;  2VAN A;  2XCA A;  1NK8 A;  1KRP A;  4F2R A;  1N48 A;  3PW4 A;  4JWM A;  2PFO A;  8ICO A;  5CR0 A;  3FDS A;  2KTQ A;  4NLG A;  4ED1 A;  4DS5 A;  4EBD A;  3TAN A;  3RR7 A;  4I2H A;  1RXW A;  8ICQ A;  4GC7 A;  5DGA A;  4DSK A;  2HHU A;  1UT8 A;  3M8S A;  3EPG A;  4J9N A;  3GV7 B;  3RJI A;  4I2C A;  2Q0Z X;  4O5E A;  4I2G A;  4ECS A;  1BPZ A;  1U49 A;  3HWT A;  3LWL A;  1NK7 A;  5KFK A;  3IHQ B;  4I2B A;  4KLI A;  3GDX A;  3ISD A;  5CWR A;  4F4W A;  4DSJ A;  1ZJM A;  2NRX A;  3LWM A;  2I9G A;  4M9L A;  1T8E A;  4MFC A;  1TK5 A;  2A1J B;  4DL5 A;  7ICN A;  1BPE A;  3KHL A;  3SV4 A;  4O5C A;  3H4D A;  3HPO A;  2DPJ A;  4JWN A;  2HHW A;  4PHA A;  4R63 A;  3RR8 A;  1XWL A;  2KZZ A;  4F91 B;  4PGX A;  5KFA A;  1L5U A;  3BQ1 A;  3GV8 B;  4K4H A;  2ZJ5 A;  4DL6 A;  5KFJ A;  4DOB A;  1TK8 A;  1DOQ A;  1ZQP A;  2OWO A;  8ICP A;  1KTQ A;  5HHI A;  4DWI A;  4GXJ A;  5HHH A;  3NGD A;  4O3S A;  7ICS A;  4QWA A; 
#chains in the Genus database with same CATH topology
 1IV8 A;  2JV3 A;  3KOO A;  2YX8 A;  4UBC A;  1ZD5 A;  4U7C A;  1NOM A;  4RQ6 A;  1CUK A;  5HML A;  5KFB A;  4Y2T A;  4J9R A;  2HHV A;  3NS1 A;  5KT5 A;  4F92 B;  4OJ5 A;  3QYP A;  1DRG A;  4DSF A;  2WB1 F;  4M6W B;  3RAX A;  3QUB A;  5AK3 A;  1QSS A;  1KDH A;  1XSN A;  4J9P A;  1HUO A;  3T79 A;  2ZUC A;  1BPX A;  5AKG A;  2HOF A;  4I2E A;  5KFM A;  3V7J A;  1ZQL A;  3PMN A;  4XRH A;  4F5O A;  5KAI U;  3FM9 A;  2BQ3 A;  5KFD A;  5EWG A;  4ED6 A;  5ALV A;  3TAR A;  2W8K A;  4QIW F;  3T5L A;  3N4M B;  1BNO A;  1ZD2 P;  2DF4 B;  5AM2 A;  5AKI A;  1NKE A;  3Q8P B;  1DK3 A;  2W9B A;  3GII A;  2JGA A;  7ICE A;  2QAR A;  2KSO B;  4RPY A;  5ALR A;  3TQ1 A;  5ALY A;  1YT3 A;  1XS9 D;  5D4B A;  1S8O A;  4I2J A;  5HP4 A;  2D3D A;  3H8W A;  1PVP A;  2KKV A;  2I6X A;  1COK A;  1ZQQ A;  1X9X A;  4GC6 A;  2E3T A;  5G5G A;  1XO1 A;  2EAO A;  1TK0 A;  9ICI A;  1F44 A;  2F1H A;  2MUT A;  5J2A A;  2DBY A;  5J29 A;  3BS5 B;  2FLL A;  3UM9 A;  4J9L A;  1JXL A;  2AXT U;  4IL6 U;  1SXD A;  3K4G A;  1ZQI A;  2MA1 A;  4A8E A;  1IIP A;  2GLE A;  1UQV A;  2BHN A;  3M9N B;  1QQ6 A;  3H4B A;  3R9K A;  4AYB C;  1JUD A;  5ALL A;  2G5I B;  5KFT A;  3AU2 A;  5ALE A;  4ECR A;  2KKP A;  4U6P A;  2A3V A;  3PSI A;  4DFP A;  5KFX A;  4UAS A;  3BQ2 A;  2G5H B;  3EYZ A;  2MU2 A;  4KIT B;  2W54 A;  1SL0 A;  2KJ5 A;  3PSP A;  8ICW A;  8ICX A;  5ALX A;  8ICV A;  3RB3 A;  1AQ6 A;  1T3Q A;  5KNI A;  5ALW A;  2HOI A;  2CRX A;  2E8N A;  2JEG A;  5AI0 A;  5J2E A;  4RU9 A;  2KP7 A;  4O0I A;  2RP5 A;  4F2S A;  4DSI A;  5AKX A;  5F9N A;  2J6U A;  4RNO A;  5J2H A;  4M9J A;  4M0A A;  1KN5 A;  3FAH A;  4FBU A;  5III A;  2W9C B;  1SWW A;  2XI9 A;  3C21 A;  2KFZ A;  2M0N A;  5AM4 A;  4C4R A;  2Y9U A;  7ICK A;  4KMO B;  1ZQH A;  1Z4N A;  2IHM A;  2G09 A;  1GO3 F;  1KFT A;  1L7M A;  4FZN A;  4J03 A;  3E58 A;  1BPD A;  2QAR B;  9ICS A;  3PR4 A;  3QU5 A;  2E8M A;  3TAQ A;  5TIS U;  4ECT A;  5AIA A;  2PFN A;  3QUC A;  1J2N A;  2AH5 A;  3IP4 B;  3Q8S B;  4UB1 A;  1S9F A;  3LK9 A;  1ZJN A;  1LB2 B;  3JPT A;  4KX5 A;  4FS2 A;  4JV0 A;  2R8I A;  2YB4 A;  7ICH A;  3NVZ A;  5J2B A;  1ZD4 A;  5J8Y C;  3NAS A;  3ISB A;  4K4G A;  3S6J A;  4EEL A;  1MQ2 A;  9ICN A;  2DGZ A;  3ZD9 A;  4EX6 A;  4YN4 A;  4FS1 A;  1WWU A;  4RQM A;  4USA A;  3QEB Z;  4XA5 A;  2LYB A;  5EWE A;  3TAD A;  3D6J A;  1ZOL A;  3GQC A;  2OH2 A;  1NK6 A;  3AN1 A;  5B66 U;  2PFP A;  3H8J A;  2HMX A;  3G6Y A;  2KIV A;  2ZG6 A;  3LVW A;  1NZP A;  2YMP A;  2NRV A;  4DLE A;  3RJF A;  4BDP A;  4O3P A;  2ASL A;  1V9P A;  4UAY A;  4RQ4 A;  2FPK A;  1S0N A;  4OJO A;  1YZ7 A;  5KT4 A;  1Z00 B;  4XUS A;  4BWJ A;  3ZDB A;  2ZJ8 A;  3B0Y A;  5BPC A;  9ICW A;  1HIW A;  4RNN A;  4NWI A;  4DQR A;  2BQU A;  2FMP A;  3ZDC A;  1X6I A;  1YZ6 A;  1BPB A;  2P6R A;  9ICF A;  3HT3 A;  2VA3 A;  5J2F A;  4PZO A;  5DGB A;  2WB1 C;  4MEY A;  1ZQT A;  1LKY B;  2YML A;  2E8P A;  2Y1I A;  3HKZ C;  2Q4T A;  2ODG A;  4R66 A;  2BPC A;  3RTV A;  3HIL A;  3AU6 A;  5AM3 A;  3KHH A;  4BUG A;  5L1M A;  1ZQU A;  5ALM A;  1VDV A;  2G06 A;  8ICZ A;  2HVH A;  4KLQ A;  2KZM A;  2AHO B;  4YD2 A;  5J2K A;  5AKY A;  3BQ7 A;  3V6H A;  1S77 D;  1V97 A;  1ZQJ A;  2K89 A;  1L3T A;  1Q8K A;  2JR5 A;  4ACO A;  2XY7 A;  1B43 A;  5KG4 A;  1HEK A;  4EEN A;  3JPN A;  4UB2 A;  5ALU A;  2MSN A;  3IN5 A;  1RYR A;  7ICT A;  3PX4 A;  1J2M A;  3SYZ A;  4UW9 A;  3NVV A;  9ICG A;  4HYK A;  1TAQ A;  1Z1V A;  3PZP A;  1SV0 C;  1KEJ A;  4F4Y A;  3MDC A;  3HJE A;  1FFU A;  3FC4 A;  5F9L A;  3OJU A;  3SEI A;  2E5S A;  2ZIU B;  4Y2P A;  1O03 A;  1J97 A;  4J9M A;  3LYS A;  9ICA A;  2F76 X;  2ZTE A;  2FPM A;  4KTQ A;  4CDG A;  2QB0 A;  4KLM A;  4NLC A;  4RQ8 A;  1ZQC A;  1S0V A;  5ALO A;  2HBK A;  4DF8 A;  3C5F A;  4NL9 A;  2VAN A;  2XCA A;  2PFO A;  5CR0 A;  5E79 U;  2YY6 A;  3TAN A;  3QX7 A;  4F72 A;  4DCC A;  4DSK A;  4J9N A;  2QLT A;  1BPZ A;  3LWL A;  4IC9 A;  3IHQ B;  4I2B A;  5CWR A;  2ZXI A;  4DSJ A;  1ZJM A;  2RHF A;  3E0F A;  1TK5 A;  3I28 A;  2F44 A;  1T94 A;  2PKE A;  4O5C A;  1QH9 A;  5ALJ A;  4BJQ A;  4ZOH C;  3RR8 A;  4F91 B;  5KFA A;  1ZRN A;  2K4I A;  5AM0 A;  4DL6 A;  2ZIX B;  2G07 A;  1KTQ A;  4O3S A;  1ED1 A;  1Z19 A;  2BQR A;  1SKW A;  1JN3 A;  1JAL A;  3SQI A;  2H5X A;  1NK5 A;  4DSL A;  2BCS A;  4DOC A;  4CF5 A;  1QCK A;  1L6N A;  3GIK A;  1U45 A;  1X9M A;  5DQH A;  5KT6 A;  4Y2Q A;  5EE0 A;  1PK1 B;  3SZ2 A;  4DFM A;  2BCU A;  2WF9 A;  5ALN A;  2XID A;  3DV9 A;  5KFZ A;  4QZD A;  4MFF A;  5IIK A;  3WK4 A;  1TAU A;  1A6S A;  2HSZ A;  2LBO A;  4RQ5 A;  3MDA A;  2PMZ C;  2EAP A;  3UPQ A;  3QXG A;  1ZQY A;  4ECZ A;  3EZ5 A;  9ICL A;  3HKZ F;  2W55 A;  1N5X A;  4AP9 A;  4JV1 A;  3QUQ A;  4O3R A;  7ICO A;  4RQ7 A;  3V7L A;  1ZQV A;  4CF4 A;  1Q46 A;  2FLN A;  2EDU A;  3KZX A;  4RT2 A;  1LVH A;  5EE9 A;  1RXV A;  4RQ1 A;  4R8U B;  7ICR A;  4PL1 A;  2RQ5 A;  1L7P A;  3TFR A;  3MR2 A;  4ECX A;  1NKB A;  1HJP A;  5DQI A;  3QEA Z;  4ELV A;  3RF9 A;  4QW9 A;  4DOA A;  1N5W A;  4B9M A;  4Z6D A;  3OHB A;  2FMQ A;  1NJX A;  1X2I A;  2AQ4 A;  3LDA A;  4E0D A;  1N2X A;  1SIJ A;  2ES6 A;  4JUZ A;  2PI4 A;  4Y2X A;  5D46 A;  2H3I A;  2WAQ C;  3Q8Q B;  5ALS A;  1H38 A;  1PK1 A;  4IQT A;  2F8L A;  4LJX A;  3CNH A;  1B22 A;  1IG6 A;  2XVT A;  1RZT A;  2ZTD A;  4YMN A;  4B6J A;  4YMO A;  1KBU A;  4B9V A;  2FI1 A;  2HCF A;  4C7Z A;  1U9L A;  4EZ6 A;  4Q44 A;  2G08 A;  4C8O A;  4C8K A;  3O0F A;  3RBD A;  1D8Y A;  2UVV A;  4OJ6 A;  4FBT A;  2BDP A;  4JMU A;  2PXI A;  4I2F A;  4I27 A;  2QB1 A;  4CCH A;  4C0Z A;  5ALK A;  2ZJA A;  5J0T A;  3PW7 A;  5L9X A;  4P0P B;  3N7R C;  2H3V A;  4OD0 A;  2DUY A;  4QZ8 A;  5AKE A;  4NM2 A;  9ICE A;  5C0Y A;  4IQU A;  4BX9 C;  2RLT A;  1TV9 A;  5J2C A;  4EEK A;  3RB6 A;  2KEY A;  5DLG A;  4Z6E A;  2K4E A;  4Y2R A;  5ALI A;  4YR2 A;  3V72 A;  4LVS A;  4IRD A;  4QWC A;  3L5K A;  2VJ4 A;  5KFE A;  3MGH A;  4DL4 A;  5J2G A;  3C29 A;  5DLF A;  1ZQZ A;  4MF8 A;  3UMG A;  2FDR A;  3QZ8 A;  3V7K A;  4TUP A;  3ZDD A;  4R65 A;  1X42 A;  4RZR A;  3MR6 A;  4NXZ A;  1ZQG A;  2C2E A;  2XCP A;  5L1I A;  2D8C A;  3RB0 A;  3C5G A;  4EBE A;  2YMQ A;  4UB5 A;  2RRD A;  3F5E A;  4HAI A;  1QSL A;  5IIJ A;  2WHE A;  2K60 A;  4I2A A;  4J9S A;  3WKB A;  1B4F A;  5J0O A;  2Y0S F;  4M6W A;  2K8A A;  4RUA A;  1UA1 A;  3L3F X;  1RDF A;  3IRU A;  5KFV A;  1P7D A;  4TUQ A;  4KLU A;  4TQS A;  4KMU A;  3GU3 A;  4DO9 A;  4ED3 A;  2WF8 A;  3J81 j;  4P4M A;  1Q3U A;  1K5O A;  5CB1 A;  4M2Y A;  4O3Q A;  2ZIV B;  2AGO A;  2E1F A;  3RH4 A;  4X5V A;  3RJH A;  4NL9 C;  4QZG A;  5DBC A;  3MGI A;  3KBB A;  8ICK A;  4OJP A;  3RJJ A;  3WK9 A;  1OUQ A;  4Q43 A;  7ICJ A;  7ICL A;  4TUS A;  3OPX A;  3JPQ A;  1NZB A;  4QZF A;  3PR5 B;  3H40 A;  5EOZ A;  5C5J A;  2HW3 A;  4UAZ A;  2ASJ A;  2JZB B;  2JEF A;  4TQR A;  8ICT A;  1SL2 A;  2K8C B;  1T4G A;  5AI8 A;  5DB9 A;  1XO0 A;  1KFS A;  4CE6 A;  4DL3 A;  3PW2 A;  9ICM A;  2W03 A;  5ALF A;  4YG2 A;  2ZUD A;  1Q3V A;  2AGP A;  3ED5 A;  4DFJ A;  4BXO B;  5L1L A;  4ECV A;  1JXE A;  2YQE A;  5AI4 A;  3PX0 A;  2V4Q A;  1PUZ A;  2JXJ A;  5BOL A;  2W8L A;  2FLP A;  1MA7 A;  2NRT A;  3JPP A;  1QLN A;  1HUZ A;  3D2N A;  4QZB A;  3GIM A;  2WF6 A;  5CRX A;  5KFR A;  4P4P A;  2EQY A;  2EZX A;  3M9M B;  4MFA A;  4QZA A;  3QNM A;  4DF4 A;  4CNQ A;  2OXO A;  4FE3 A;  1XSP A;  2OCE A;  5DB8 A;  2KK0 A;  3RH6 A;  2GWS A;  2J6S A;  3A0B U;  4RQ3 A;  3IV6 A;  3AUO A;  4PPX A;  4DFK A;  5AKK A;  4ED8 A;  1LKY A;  2VA8 A;  4O9M A;  1DK2 A;  2KG5 A;  3N97 B;  5KG5 A;  2LYA A;  4KLG A;  4QZH A;  8ICS A;  4DQS A;  2K4P A;  2WF5 A;  1MSW D;  3ZDE A;  3TI0 A;  2Y1J A;  8ICU A;  2RDI A;  4JB3 A;  3RRH A;  2XC9 A;  1MN8 A;  2GOL A;  4PGY A;  4F4Z A;  1ZQR A;  9ICH A;  2F2A B;  3RBE A;  3T5K A;  4F5R A;  3RJK A;  4Y2U A;  3T5J A;  2CPR A;  3C2L A;  4M47 A;  1MC8 A;  3JPR A;  4UB4 A;  2YTU A;  4ECQ A;  2JZB A;  2HBM A;  4Y2S A;  3ZD8 A;  2WF7 A;  2VA2 A;  5HMM A;  1KQQ A;  3IM1 A;  3PW4 A;  3FDS A;  2KTQ A;  1CRX A;  4I2H A;  3QU7 A;  5AM1 A;  4NV0 A;  3M8S A;  3EPG A;  2Q0Z X;  1U49 A;  3HWT A;  1NK7 A;  2LHT A;  5KFK A;  4KLI A;  3ISD A;  4F4W A;  3LWM A;  4M9L A;  3HRD D;  1X6J A;  2NV3 A;  4MFC A;  2A1J B;  3M7D A;  3HPO A;  4JWN A;  4R63 A;  1XWL A;  3SMV A;  3VC8 A;  1L7N A;  1ZQP A;  1DOQ A;  3AEV A;  5ALP A;  1NNL A;  2WAQ F;  4KLT A;  3I1Y A;  3AQE A;  2FMS A;  2LKY A;  4UAW A;  5J2D A;  9ICK A;  2C28 A;  5AM5 A;  3M8R A;  2C2D A;  3EW9 A;  4QZI A;  4QWE A;  4J9O A;  9ICR A;  2P66 A;  2R8J A;  8ICC A;  3AQF A;  1TFR A;  2ZIX A;  1M6Y A;  5EE1 A;  1PK3 A;  3BZK A;  2IA6 A;  3M6Z A;  3TAC B;  3F53 A;  2AGQ A;  5IIL A;  1X9W A;  2HHX A;  3LVV A;  4GXI A;  1D9F A;  4Q8F A;  4QWD A;  1NK4 A;  5KG6 A;  8ICF A;  1RQN A;  2ZTC A;  4RPX A;  1WUD A;  2JH7 A;  2IOF K;  2JH1 A;  2IHN A;  1N61 A;  3H8S A;  4YFK A;  2YB1 A;  1NK9 A;  1SKS A;  3RRG A;  2W43 A;  1XSL A;  3PX6 A;  3RB4 A;  8ICP A;  5HR7 A;  5AI6 A;  4DQP A;  2KIW A;  5G5H A;  1TE2 A;  2M9N A;  1SV0 A;  2CN1 A;  3A0H U;  3FYH A;  4Y2V A;  3CYM A;  1NJZ A;  8ICR A;  5CJ7 A;  1F5S A;  3ORY A;  5AHX A;  4IS7 A;  4NJ8 A;  2XIC A;  3QZ7 A;  2DFL A;  4YR3 A;  5KFC A;  8ICA A;  2E1E A;  2W3S A;  1U47 A;  4EEY A;  5DBA A;  3QU2 A;  2KOB A;  2KV2 A;  3V6J A;  1KW4 A;  2VIX A;  2QKQ A;  9ICQ A;  3BQT A;  4EYI B;  1JIH A;  4NLN A;  4OO1 J;  4K4I A;  3MFH A;  1ZQM A;  4QZC A;  9ICT A;  4B9N A;  3DEE A;  4J9Q A;  1RYU A;  2A1J A;  4B9U A;  2RDJ A;  1ZQW A;  4C8N A;  8ICH A;  1SXE A;  1A77 A;  1D9D A;  1NJY A;  3WKE A;  4RT3 A;  2KSO A;  4C4T A;  1OW5 A;  2XY6 A;  1ECW A;  3EUB 2;  2YN4 A;  4NY8 A;  3K1R B;  5J0R A;  5AIC A;  2KMD A;  9ICO A;  4O3N A;  3SR6 A;  8ICL A;  1WCL A;  4RPZ A;  4B9S A;  5KFU A;  2A19 A;  4RNM A;  4YCX A;  5ALG A;  1BPY A;  2P6U A;  8ICJ A;  1N60 A;  2KE7 A;  5AK4 A;  1XC9 A;  2H3F A;  3GIJ A;  1VLB A;  3EPI A;  1TKD A;  3T3F A;  3TAP A;  4UAR A;  4Y2J A;  1T7P A;  2W9C A;  4UQG A;  2XGQ A;  1KL9 A;  1K1Q A;  4FO6 A;  7ICG A;  5J0Y A;  4US9 A;  5DB6 A;  5J0U A;  3IG8 A;  3AMZ A;  1L3S A;  5J8Y A;  2UVR A;  5DKW A;  1NK0 A;  3BZC A;  2OYY A;  4ECU A;  3CP8 A;  5ALH A;  4EBC A;  2HOQ A;  4Z6F A;  4TUR A;  4UB3 A;  1XNS A;  7ICQ A;  1JRP A;  1WCN A;  1URJ A;  7ICM A;  3PO5 A;  4C8M A;  4G9B A;  5CA7 A;  3KZI U;  1K1S A;  2JEI A;  3BS7 A;  1S0M A;  5AKL A;  3UMC A;  3V6K A;  1NJW A;  3GZF A;  4NLZ A;  1CI4 A;  1JRO A;  1ZQF A;  3PO4 A;  5B5E U;  2KZ3 A;  2BGW A;  4AYB F;  5KT7 A;  3N7S C;  2D6F C;  1Y88 A;  1ZD3 A;  3MFI A;  4I2I A;  5JU5 A;  3WU2 U;  4OJL A;  2V4R A;  4UBB A;  5DDM A;  3T5H A;  3K1Z A;  5HNK A;  2R8K A;  3WK8 A;  5ALT A;  4FZL A;  2R8G A;  4KLL A;  2MAX A;  3KKA A;  4IR9 A;  3QU4 A;  1UA0 A;  2VJ5 A;  5KG1 A;  3CW2 C;  1ZQD A;  3C1Y A;  1RYS A;  4DS4 A;  4F3O A;  1BGX T;  3PY8 A;  4NLK A;  1X66 A;  5J0P A;  3B9J A;  2B6G A;  8ICN A;  1JMS A;  4P0Q B;  1SGG A;  4FZM A;  1QSY A;  4Y2Y A;  9ICX A;  3Q8M A;  3UXP A;  4YR0 A;  2ATL A;  4UAV A;  3PSF A;  3ZI4 A;  3PNC A;  2DL0 A;  4I29 A;  2HI0 A;  2W9A A;  3NRW A;  5KL8 B;  3WKC A;  2NRW A;  4QZE A;  5L1K A;  1F0M A;  5DG9 A;  2ZXH A;  1T3N A;  2KFN A;  5AI5 A;  1Z00 A;  5AI9 A;  1KSP A;  1SWV A;  8ICM A;  1S76 D;  5H2F U;  2IOF A;  2HVI A;  2XGP A;  3GV5 B;  3F2C A;  1X9S A;  3THV A;  3TKA A;  4ED7 A;  3NVW A;  2W9M A;  1RG6 A;  3MR5 A;  4B9T A;  3KHR A;  8ICY A;  2KIC A;  2HDO A;  4DSE A;  1FEZ A;  2HHS A;  5DBB A;  4GLX A;  4NM1 A;  2KD1 A;  4CRX A;  3WK6 A;  3K75 D;  3M1Y A;  2E8O A;  5IIO A;  2VKQ A;  4YXM A;  3WK5 A;  3D2Q A;  1OXJ A;  1ZYQ A;  3F5A A;  1QTM A;  3F2D A;  3IDW A;  5GTI U;  5KFS A;  2EAM A;  4UAU A;  3OTQ A;  3SAH A;  2IMW P;  3BDP A;  2W7O A;  3N7P D;  8ICO A;  3SI8 A;  2R8H A;  4QWB A;  1PVQ A;  3H0M B;  2HHT A;  2Z7J A;  1A76 A;  3L4P A;  1S97 A;  3SAF A;  1TVA A;  3D2S A;  3G6X A;  3Q8L A;  4RQ2 A;  3DDH A;  4MHV A;  4M9N A;  2ZIU A;  5KT2 A;  1C20 A;  4IQW A;  1IXR A;  2IBK A;  3Q8R B;  1PZN A;  3H0L B;  1KKX A;  3NUQ A;  9ICU A;  5AKH A;  5KFF A;  2KN7 A;  3PML A;  4F5P A;  3UXN A;  9ICV A;  1L8L A;  5KTQ A;  1ZQS A;  2LPE A;  4QNL A;  5DQG A;  2QB0 B;  4QZ9 A;  1PVR A;  4M9G A;  3M6K A;  5ALD A;  4R64 A;  5KFL A;  4PHE A;  3ICX A;  3RFA A;  3UQ2 A;  5KAF U;  4F2R A;  1N48 A;  4JWM A;  4NLG A;  4EBD A;  1RXW A;  2O6K A;  8ICQ A;  3ALR A;  3VCB A;  5DGA A;  2HHU A;  3GV7 B;  3N28 A;  4I2G A;  3ONN A;  2CXY A;  2LM4 A;  3GDX A;  3MGV A;  2NRX A;  3MC1 A;  1T8E A;  1UCV A;  3AM9 A;  3H4D A;  5GTH U;  2DPJ A;  2HHW A;  4PHA A;  1L5U A;  1RM6 C;  3BQ1 A;  4K4H A;  2ZJ5 A;  5AKZ A;  5KFJ A;  1VJ5 A;  2KVS A;  5CEH A;  5HR6 A;  7ICU A;  2BR0 A;  2B0C A;  1ZQ1 C;  4KN4 A;  2NYV A;  2HBJ A;  2FE9 A;  3OSN A;  3C2K A;  2G0A A;  3Q8K A;  4DEZ A;  4BGD A;  9ICB A;  4FFD A;  1V38 A;  2AQ0 A;  2BCV A;  2F1I A;  4GFJ A;  5TZV A;  2BCQ A;  3TAD C;  4YXJ A;  1SZP A;  8ICB A;  1L7O A;  3C1Z A;  4F93 B;  1C7Y A;  4Q8E A;  3NTU A;  3PW5 A;  3IG5 A;  1UPH A;  4ELT A;  2ASD A;  5DG7 A;  2JMG A;  1ZQK A;  2LMR A;  5KFQ A;  1UT5 A;  4RQN A;  4RUC A;  1XU4 A;  5CHG A;  1NI3 A;  5J0W A;  1FIQ A;  5KG0 A;  1LV5 A;  1BVS A;  1L3U A;  2H3Q A;  4OCZ A;  3UQ0 A;  5KG2 A;  1ZQO A;  3RJG A;  4GIB A;  2DKX A;  5J2I A;  4KLD A;  3OGU A;  3HX0 A;  2A1A A;  5ALQ A;  2W04 A;  5K4L A;  4EX7 A;  2DKZ A;  2W3R A;  5ALZ A;  2UVU A;  2OHF A;  4YMM A;  2AJQ A;  5T14 A;  7ICI A;  4ED2 A;  2BPF A;  1CEZ A;  3OJS A;  4F5Q A;  1KFD A;  1SB3 C;  5KT3 A;  1S5L U;  2JHD A;  1X40 A;  1WWV A;  3UMB A;  3SAG A;  2DPI A;  1RPL A;  2V9W A;  5DG8 A;  1RQL A;  1N62 A;  1JI7 A;  4DL7 A;  2N1R A;  3UXO A;  4IQV A;  1S0O A;  5AK5 A;  3JPO A;  2K8B B;  5J0S A;  4IRC A;  3MAB A;  5J2J A;  4PGQ A;  4M04 A;  4P4O A;  4ICA A;  4ELU A;  5KFP A;  3AL0 B;  1QQ5 A;  4C80 A;  3M9O B;  3ZDA A;  4KLH A;  4DQQ A;  4ZH4 A;  3BQ0 A;  3QUT A;  4I28 A;  2JRZ A;  2Y0S C;  1SL1 A;  1Z3E B;  1WYG A;  4GXK A;  2BCR A;  5FP0 A;  3H8M A;  2F1J A;  4BXO A;  4EZ9 A;  2WTF A;  5EE3 A;  1DXS A;  4UB6 U;  3PV8 A;  2AU0 A;  2EH9 A;  3QE9 Y;  5IIM A;  4PH5 A;  4P0Q A;  1ZRM A;  1D8B A;  1S10 A;  2LI6 A;  4PJ0 U;  3RAQ A;  4KLJ A;  4IR1 A;  4KN7 A;  4IRK A;  5EWF A;  5KG7 A;  3KTQ A;  5AK6 A;  1ARO P;  3I76 A;  3KHG A;  3RH5 A;  4PHD A;  4KLS A;  4PHP A;  4F50 A;  1U4B A;  3MBY A;  3MR3 A;  2OEH A;  1FO4 A;  5KFH A;  1SZH A;  7ICF A;  4UB8 U;  2DWQ A;  2XO7 A;  5KFO A;  1V85 A;  4KLF A;  4Z6C A;  2F8K A;  2PI5 A;  5KFI A;  4P0P A;  3BS5 A;  2FPL A;  7ICV A;  1ZQA A;  2EZZ A;  3ETR A;  3ISC A;  2KVC A;  4R8U A;  4BWM A;  2NO4 A;  1WG8 A;  4O5K A;  4P2H A;  4F4X A;  2UVW A;  2MRL A;  1L8O A;  2ZIW A;  2ZIV A;  3WKA A;  4B9L A;  2BZF A;  5F3X B;  5JTI A;  4C4S A;  2PFQ A;  3OSP A;  4KLO A;  5JUM A;  1COO A;  2BKE A;  2C2R A;  1L3V A;  1ZXI A;  2IOH A;  1ZQB A;  1ZQN A;  3TFS A;  1KLN A;  2LM1 A;  4ED0 A;  3CRX A;  3KFU F;  5J0X A;  2LYH A;  4US8 A;  3C28 A;  2EZY A;  1N56 A;  2JEJ A;  9ICC A;  1EXN A;  2L5Y A;  3JPS A;  1ZQX A;  1B0X A;  4I2D A;  1QQ7 A;  2W11 A;  8ICE A;  3SD7 A;  5KFN A;  4KLE A;  7ICP A;  1MQ3 A;  5CP2 A;  2KHV A;  4XQ8 A;  4WJ3 B;  2B21 A;  4YD1 A;  2XY5 A;  2I1Q A;  2GO7 A;  4MF2 A;  4J9K A;  1JX4 A;  1ZQE A;  8ICG A;  5DB7 A;  2H3Z A;  2Y9T A;  5IIN A;  9ICJ A;  5D49 A;  3F2B A;  4F71 A;  2J6T A;  2HHQ A;  3GFK B;  4O3M A;  3H0R B;  4ECW A;  4YVZ A;  3B0X A;  3GIL A;  4EYH B;  1DGS A;  3NVY A;  2C22 A;  3HP6 A;  3PVX A;  2WFA A;  5JRT A;  4QJF B;  2ESE A;  3H7I A;  2ISO A;  3ETL A;  3OHA A;  1Z4O A;  2ISP A;  4QIW C;  4F4K A;  3HW8 A;  4PZN A;  3G6V A;  4F5N A;  5L1J A;  5AKJ A;  3QU9 A;  2K4H A;  4Q45 A;  4YP3 A;  1FFV A;  3C2M A;  4LZG A;  1NKC A;  3SV3 A;  1N63 A;  3PW0 A;  3NRZ A;  2EAN A;  1O08 A;  4JV2 A;  4M9H A;  3C23 A;  2W7P A;  4O3O A;  5KFY A;  4LZD A;  4RQ0 A;  1BNP A;  2PMZ F;  4QW8 A;  2ZUB A;  2BPG A;  4JK1 A;  4CF3 A;  2ZIW B;  3RJE A;  5BOM A;  4C8L A;  1ZET A;  3EWA A;  4DQI A;  3BJY A;  1UHU A;  2ALZ A;  1U48 A;  3WK7 A;  2FJ6 A;  2W9B B;  1SKR A;  4ECY A;  2P35 A;  4MEX A;  2KJ8 A;  4F8R A;  1D8L A;  8ICI A;  5KG3 A;  4DL2 A;  5KFW A;  3WKD A;  5J0Q A;  9ICP A;  4G3I A;  2F3N A;  3U26 A;  1A0P A;  2KNJ A;  2OM6 A;  3PST A;  5A0L A;  2KJ9 A;  5KFG A;  4YQW A;  2NRZ A;  2GH1 A;  4KX3 A;  5DDY A;  3E2E A;  3KKA C;  1IM4 A;  2NO5 A;  2MUT B;  4DLG A;  1TAM A;  3KD3 A;  4NLB A;  1KRP A;  1NK8 A;  1DGJ A;  4ED1 A;  4DS5 A;  4C7Y A;  3RR7 A;  2R18 A;  4GC7 A;  1Z1B A;  2F77 X;  1UT8 A;  3RJI A;  4I2C A;  4O5E A;  4ECS A;  2DQN B;  5AIB A;  2I9G A;  2YMM A;  4DL5 A;  4DFD A;  2I5H A;  1BPE A;  7ICN A;  1SV4 A;  4CGZ A;  3KHL A;  3SV4 A;  2KZZ A;  3SEN A;  5KL1 B;  4PGX A;  2BDU A;  3GV8 B;  4PL2 A;  4UAT A;  2HBL A;  2KHQ A;  4DOB A;  1TK8 A;  2OWO A;  5HHI A;  4DWI A;  4GXJ A;  5HHH A;  3NGD A;  7ICS A;  4QWA A; 
#chains in the Genus database with same CATH homology
 2BR0 A;  1SKW A;  1JN3 A;  4KLT A;  4KN4 A;  2H5X A;  1NK5 A;  2FMS A;  4UAW A;  9ICK A;  5J2D A;  4UBC A;  2C28 A;  4DSL A;  1NOM A;  4RQ6 A;  3M8R A;  1CUK A;  5HML A;  5KFB A;  3OSN A;  2BCS A;  2C2D A;  3EW9 A;  4QZI A;  3C2K A;  4J9R A;  2HHV A;  4DOC A;  3Q8K A;  4DEZ A;  5KT5 A;  4BGD A;  9ICB A;  4QWE A;  4F92 B;  4J9O A;  2AQ0 A;  2BCV A;  3GIK A;  9ICR A;  1U45 A;  2F1I A;  1X9M A;  4DSF A;  5DQH A;  2P66 A;  2R8J A;  4M6W B;  5KT6 A;  8ICC A;  3RAX A;  1TFR A;  5TZV A;  1QSS A;  2BCQ A;  1KDH A;  3SZ2 A;  1XSN A;  4J9P A;  2IA6 A;  1HUO A;  4YXJ A;  4DFM A;  2BCU A;  2ZUC A;  1SZP A;  1BPX A;  8ICB A;  5KFZ A;  4QZD A;  4MFF A;  5IIK A;  2AGQ A;  4I2E A;  5KFM A;  3C1Z A;  4F93 B;  3V7J A;  5IIL A;  1X9W A;  3PMN A;  1C7Y A;  3NTU A;  3PW5 A;  1ZQL A;  4Q8E A;  4XRH A;  4F5O A;  4ELT A;  2ASD A;  2HHX A;  4GXI A;  4RQ5 A;  1D9F A;  2BQ3 A;  4Q8F A;  5DG7 A;  5KFD A;  4QWD A;  1NK4 A;  1ZQK A;  3MDA A;  5KG6 A;  5EWG A;  5KFQ A;  8ICF A;  4ED6 A;  4RPX A;  2ZTC A;  3UPQ A;  1ZQY A;  4ECZ A;  3TAR A;  2W8K A;  3EZ5 A;  9ICL A;  3T5L A;  3N4M B;  1NKE A;  2IHN A;  1UT5 A;  3H8S A;  4RUC A;  3Q8P B;  4YFK A;  4JV1 A;  1XU4 A;  2W9B A;  3GII A;  1NK9 A;  5CHG A;  1SKS A;  5J0W A;  3RRG A;  7ICE A;  4O3R A;  5KG0 A;  1XSL A;  3PX6 A;  3RB4 A;  1LV5 A;  4RPY A;  1BVS A;  1ZQV A;  3V7L A;  4RQ7 A;  3UQ0 A;  1L3U A;  5KG2 A;  1ZQO A;  3RJG A;  2FLN A;  4DQP A;  4RT2 A;  5J2I A;  2M9N A;  3TQ1 A;  4KLD A;  3OGU A;  3HX0 A;  1RXV A;  4RQ1 A;  4R8U B;  7ICR A;  1XS9 D;  3FYH A;  5D4B A;  2UVU A;  1NJZ A;  4YMM A;  3TFR A;  3MR2 A;  2AJQ A;  4ECX A;  4I2J A;  1HJP A;  3H8W A;  5HP4 A;  5DQI A;  1NKB A;  3QEA Z;  8ICR A;  7ICI A;  5CJ7 A;  4ELV A;  4QW9 A;  3ORY A;  4DOA A;  4ED2 A;  1ZQQ A;  4GC6 A;  4B9M A;  4Z6D A;  3OHB A;  2BPF A;  3QZ7 A;  2FMQ A;  2DFL A;  4YR3 A;  5KFC A;  1XO1 A;  1TK0 A;  1NJX A;  3OJS A;  1CEZ A;  4F5Q A;  2F1H A;  1X2I A;  8ICA A;  9ICI A;  2MUT A;  2AQ4 A;  3LDA A;  4E0D A;  4JUZ A;  1KFD A;  2PI4 A;  5J2A A;  5D46 A;  5J29 A;  1U47 A;  4EEY A;  5DBA A;  5KT3 A;  3Q8Q B;  2FLL A;  1H38 A;  4IQT A;  4J9L A;  1JXL A;  1B22 A;  3K4G A;  3V6J A;  1RZT A;  2DPI A;  1RPL A;  1ZQI A;  2V9W A;  2ZTD A;  5DG8 A;  4YMN A;  4YMO A;  4B9V A;  9ICQ A;  3BQT A;  4EYI B;  1JIH A;  4DL7 A;  3UXO A;  4NLN A;  1U9L A;  4EZ6 A;  2BHN A;  4IQV A;  4Q44 A;  3MFH A;  3M9N B;  4QZC A;  3H4B A;  1S0O A;  1ZQM A;  4K4I A;  9ICT A;  4B9N A;  4C8O A;  4J9Q A;  4C8K A;  3JPO A;  5J0S A;  3RBD A;  2A1J A;  1D8Y A;  2UVV A;  4IRC A;  4FBT A;  2BDP A;  4B9U A;  2RDJ A;  2PXI A;  4I2F A;  3MAB A;  5J2J A;  1ZQW A;  4PGQ A;  5KFT A;  4CCH A;  3AU2 A;  4P4O A;  4C8N A;  4I27 A;  4M04 A;  4ECR A;  4ELU A;  8ICH A;  1A77 A;  5KFP A;  2ZJA A;  5J0T A;  1D9D A;  3PW7 A;  5L9X A;  4DFP A;  5KFX A;  3M9O B;  3BQ2 A;  3EYZ A;  1NJY A;  3ZDA A;  4KLH A;  4KIT B;  4RT3 A;  4DQQ A;  4ZH4 A;  3BQ0 A;  1SL0 A;  4I28 A;  2XY6 A;  4NY8 A;  1SL1 A;  4QZ8 A;  8ICW A;  1Z3E B;  8ICX A;  4GXK A;  2BCR A;  8ICV A;  5J0R A;  9ICO A;  3RB3 A;  2F1J A;  4O3N A;  4NM2 A;  9ICE A;  4IQU A;  8ICL A;  4BXO A;  1WCL A;  1TV9 A;  2JEG A;  4RPZ A;  2WTF A;  4B9S A;  4EZ9 A;  5KFU A;  5J2C A;  3RB6 A;  5J2E A;  4RNM A;  4YCX A;  5DLG A;  4Z6E A;  1TAU A;  3PV8 A;  2AU0 A;  4RU9 A;  2P6U A;  1BPY A;  3QE9 Y;  8ICJ A;  4O0I A;  4YR2 A;  3V72 A;  5IIM A;  4LVS A;  4PH5 A;  4IRD A;  4QWC A;  4DSI A;  4F2S A;  1XC9 A;  5KFE A;  3MGH A;  4DL4 A;  5J2G A;  5F9N A;  1S10 A;  3GIJ A;  2J6U A;  3RAQ A;  3EPI A;  4KLJ A;  5DLF A;  1TKD A;  1ZQZ A;  4IR1 A;  4KN7 A;  3T3F A;  4MF8 A;  4IRK A;  3QZ8 A;  3TAP A;  5EWF A;  4RNO A;  3V7K A;  4TUP A;  5J2H A;  3ZDD A;  4R65 A;  4M9J A;  5KG7 A;  3KTQ A;  4M0A A;  4RZR A;  1ARO P;  3MR6 A;  3KHG A;  1T7P A;  4NXZ A;  1ZQG A;  2W9C A;  2C2E A;  3RH5 A;  4UQG A;  2XGQ A;  4PHD A;  2XCP A;  4FBU A;  4KLS A;  5III A;  2W9C B;  1K1Q A;  3C21 A;  4FO6 A;  7ICG A;  4PHP A;  5J0Y A;  2KFZ A;  5DB6 A;  4F50 A;  5L1I A;  1U4B A;  3MBY A;  3MR3 A;  3RB0 A;  5J0U A;  3C5G A;  4EBE A;  4UB5 A;  1L3S A;  5KFH A;  7ICF A;  7ICK A;  1QSL A;  5IIJ A;  2UVR A;  1ZQH A;  5DKW A;  4J9S A;  2IHM A;  4I2A A;  1NK0 A;  2XO7 A;  4ECU A;  5KFO A;  4KLF A;  4EBC A;  4Z6C A;  5J0O A;  1KFT A;  4Z6F A;  4TUR A;  2PI5 A;  5KFI A;  4M6W A;  4UB3 A;  4RUA A;  7ICQ A;  1UA1 A;  2FPL A;  7ICV A;  1ZQA A;  1BPD A;  1WCN A;  7ICM A;  9ICS A;  3PR4 A;  3ISC A;  3PO5 A;  4C8M A;  4R8U A;  5KFV A;  5CA7 A;  4BWM A;  1K1S A;  2JEI A;  3TAQ A;  4TUQ A;  1S0M A;  4KLU A;  4TQS A;  4O5K A;  4P2H A;  4KMU A;  4ECT A;  3V6K A;  4DO9 A;  4ED3 A;  1NJW A;  4P4M A;  2PFN A;  4NLZ A;  4F4X A;  1ZQF A;  2UVW A;  3PO4 A;  5CB1 A;  4M2Y A;  2KZ3 A;  3Q8S B;  4UB1 A;  4O3Q A;  2BGW A;  1S9F A;  3LK9 A;  1ZJN A;  2AGO A;  5KT7 A;  1LB2 B;  1Y88 A;  3RH4 A;  4B9L A;  3MFI A;  3JPT A;  4I2I A;  4X5V A;  2V4R A;  2PFQ A;  4UBB A;  5DDM A;  4FS2 A;  3T5H A;  4JV0 A;  3OSP A;  2R8I A;  3RJH A;  4KLO A;  4QZG A;  5DBC A;  7ICH A;  3MGI A;  5JUM A;  5J2B A;  1COO A;  5HNK A;  8ICK A;  2R8K A;  2BKE A;  3RJJ A;  4KLL A;  2R8G A;  3ISB A;  2MAX A;  4K4G A;  2C2R A;  1L3V A;  4IR9 A;  1UA0 A;  1ZQB A;  1ZQN A;  3TFS A;  1KLN A;  5KG1 A;  4Q43 A;  4ED0 A;  1MQ2 A;  7ICJ A;  7ICL A;  5J0X A;  2LYH A;  4TUS A;  1ZQD A;  3ZD9 A;  9ICN A;  3JPQ A;  3C1Y A;  4YN4 A;  1RYS A;  4DS4 A;  4F3O A;  4QZF A;  3PR5 B;  1BGX T;  3H40 A;  5EOZ A;  4FS1 A;  1N56 A;  2JEJ A;  3PY8 A;  4NLK A;  5C5J A;  2HW3 A;  4UAZ A;  3QEB Z;  9ICC A;  4XA5 A;  5J0P A;  2ASJ A;  2JZB B;  5EWE A;  2JEF A;  4TQR A;  1EXN A;  8ICN A;  8ICT A;  3JPS A;  1SL2 A;  1ZQX A;  3GQC A;  4I2D A;  1JMS A;  1NK6 A;  8ICE A;  1T4G A;  7ICO A;  2PFP A;  3H8J A;  5KFN A;  4KLE A;  7ICP A;  1MQ3 A;  5CP2 A;  3G6Y A;  1QSY A;  5DB9 A;  4XQ8 A;  3Q8M A;  1KFS A;  3UXP A;  9ICX A;  4YR0 A;  2B21 A;  4DL3 A;  2ATL A;  3PW2 A;  9ICM A;  2NRV A;  4YG2 A;  3PNC A;  2ZUD A;  4DLE A;  3RJF A;  4YD1 A;  2XY5 A;  2I1Q A;  4O3P A;  4BDP A;  4I29 A;  2AGP A;  4DFJ A;  4BXO B;  2ASL A;  1V9P A;  2W9A A;  4UAY A;  4RQ4 A;  1JXE A;  5L1L A;  4J9K A;  4ECV A;  4MF2 A;  1JX4 A;  3PX0 A;  2FPK A;  2V4Q A;  2NRW A;  4QZE A;  5L1K A;  1S0N A;  5KT4 A;  1Z00 B;  4XUS A;  4BWJ A;  5DG9 A;  2ZJ8 A;  1T3N A;  1ZQE A;  3ZDB A;  2KFN A;  3B0Y A;  5BPC A;  9ICW A;  1Z00 A;  8ICG A;  5BOL A;  5DB7 A;  4RNN A;  1KSP A;  4DQR A;  2W8L A;  5IIN A;  2BQU A;  2FLP A;  2FMP A;  3ZDC A;  2NRT A;  3JPP A;  1QLN A;  1S76 D;  5D49 A;  8ICM A;  9ICJ A;  1HUZ A;  1BPB A;  2BQR A;  2HVI A;  2XGP A;  3GV5 B;  2J6T A;  4QZB A;  2HHQ A;  2P6R A;  3GIM A;  1X9S A;  3GFK B;  9ICF A;  5KFR A;  4P4P A;  3HT3 A;  5J2F A;  2VA3 A;  3THV A;  4ED7 A;  5DGB A;  2W9M A;  3M9M B;  4YVZ A;  4ECW A;  3B0X A;  3MR5 A;  3GIL A;  4MEY A;  3KHR A;  4EYH B;  4B9T A;  1DGS A;  8ICY A;  1ZQT A;  2C22 A;  3HP6 A;  4DSE A;  4MFA A;  3PVX A;  2HHS A;  5DBB A;  4GLX A;  2Y1I A;  4NM1 A;  2ISO A;  3H7I A;  4R66 A;  2BPC A;  4QZA A;  3ETL A;  3RTV A;  3AU6 A;  3OHA A;  3K75 D;  5IIO A;  3KHH A;  2ISP A;  4F4K A;  3HW8 A;  4YXM A;  1ZQU A;  4DF4 A;  8ICZ A;  3G6V A;  4F5N A;  5L1J A;  7ICU A;  1ZYQ A;  1XSP A;  2HVH A;  5DB8 A;  1QTM A;  4KLQ A;  2KZM A;  4YD2 A;  4Q45 A;  4YP3 A;  5J2K A;  3RH6 A;  2GWS A;  2J6S A;  3V6H A;  3C2M A;  1S77 D;  5KFS A;  4LZG A;  1NKC A;  3SV3 A;  4RQ3 A;  3AUO A;  1ZQJ A;  4PPX A;  4DFK A;  1L3T A;  4ED8 A;  2IMW P;  2VA8 A;  2XY7 A;  4O9M A;  1B43 A;  3PW0 A;  5KG4 A;  3BDP A;  3JPN A;  3N97 B;  4JV2 A;  3SI8 A;  4UB2 A;  3C23 A;  4M9H A;  5KG5 A;  2R8H A;  4QWB A;  4QZH A;  4KLG A;  8ICS A;  4O3O A;  4DQS A;  5KFY A;  2HHT A;  1RYR A;  1MSW D;  7ICT A;  3PX4 A;  4LZD A;  1A76 A;  3ZDE A;  4RQ0 A;  3SYZ A;  3TI0 A;  2Y1J A;  4HYK A;  9ICG A;  4QW8 A;  2RDI A;  8ICU A;  1TAQ A;  1S97 A;  3RRH A;  2XC9 A;  1TVA A;  1KEJ A;  2ZUB A;  2BPG A;  4F4Y A;  3MDC A;  4JK1 A;  3G6X A;  3RJE A;  5BOM A;  4C8L A;  5F9L A;  3Q8L A;  1ZET A;  3EWA A;  4RQ2 A;  3OJU A;  4DQI A;  4PGY A;  3BJY A;  2ALZ A;  4F4Z A;  1ZQR A;  4M9N A;  9ICH A;  1U48 A;  3RBE A;  5KT2 A;  4IQW A;  2W9B B;  1SKR A;  4ECY A;  4F5R A;  1IXR A;  3T5K A;  4MEX A;  2IBK A;  3RJK A;  4F8R A;  1D8L A;  3Q8R B;  4J9M A;  3T5J A;  8ICI A;  5KG3 A;  1PZN A;  4DL2 A;  5KFW A;  9ICA A;  5J0Q A;  9ICP A;  4G3I A;  3C2L A;  4M47 A;  1MC8 A;  2ZTE A;  9ICU A;  3JPR A;  4UB4 A;  2FPM A;  4KTQ A;  5KFF A;  2KN7 A;  3PML A;  4F5P A;  3UXN A;  9ICV A;  5KFG A;  5KTQ A;  4YQW A;  2NRZ A;  4ECQ A;  2JZB A;  5DQG A;  1ZQS A;  4KLM A;  5DDY A;  3E2E A;  4RQ8 A;  3ZD8 A;  4QZ9 A;  4M9G A;  1ZQC A;  1S0V A;  1IM4 A;  2VA2 A;  5HMM A;  4R64 A;  4DF8 A;  2MUT B;  5KFL A;  4PHE A;  3C5F A;  4DLG A;  3UQ2 A;  3IM1 A;  2VAN A;  2XCA A;  1NK8 A;  1KRP A;  4F2R A;  1N48 A;  3PW4 A;  4JWM A;  2PFO A;  8ICO A;  5CR0 A;  3FDS A;  2KTQ A;  4NLG A;  4ED1 A;  4DS5 A;  4EBD A;  3TAN A;  3RR7 A;  4I2H A;  1RXW A;  8ICQ A;  4GC7 A;  5DGA A;  4DSK A;  2HHU A;  1UT8 A;  3M8S A;  3EPG A;  4J9N A;  3GV7 B;  3RJI A;  4I2C A;  2Q0Z X;  4O5E A;  4I2G A;  4ECS A;  1BPZ A;  1U49 A;  3HWT A;  3LWL A;  1NK7 A;  5KFK A;  3IHQ B;  4I2B A;  4KLI A;  3GDX A;  3ISD A;  5CWR A;  4F4W A;  4DSJ A;  1ZJM A;  2NRX A;  3LWM A;  2I9G A;  4M9L A;  1T8E A;  4MFC A;  1TK5 A;  2A1J B;  4DL5 A;  7ICN A;  1BPE A;  3KHL A;  3SV4 A;  4O5C A;  3H4D A;  3HPO A;  2DPJ A;  4JWN A;  2HHW A;  4PHA A;  4R63 A;  3RR8 A;  1XWL A;  2KZZ A;  4F91 B;  4PGX A;  5KFA A;  1L5U A;  3BQ1 A;  3GV8 B;  4K4H A;  2ZJ5 A;  4DL6 A;  5KFJ A;  4DOB A;  1TK8 A;  1DOQ A;  1ZQP A;  2OWO A;  8ICP A;  1KTQ A;  5HHI A;  4DWI A;  4GXJ A;  5HHH A;  3NGD A;  4O3S A;  7ICS A;  4QWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...