2LYHA

Structure of faap24 residues 141-215
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2lyhA00
3C2KA 3PR5B 2W9CA 2XY7A 5DDYA 4C8KA 2JEIA 5J2IA 3NGDA 4IR1A 4F4KA 3MR6A 1KFDA 4R66A 4ZH4A 5DB6A 2P6RA 2ZJAA 4ECYA 9ICGA 2ZTEA 5BPCA 4PHAA 3GDXA 3PV8A 2BQ3A 2ASLA 1RYRA 1LV5A 4CCHA 3PMNA 4EZ6A 2VANA 3Q8KA 2IMWP 1ZQUA 3MBYA 4I29A 1XSNA 4UBBA 4M9HA 3BDPA 3EPGA 4R64A 5KFAA 5L1KA 4UAWA 3TANA 5IIOA 4FO6A 8ICMA 1BGXT 1CEZA 3BQ1A 4JWNA 3GV7B 3QZ7A 7ICQA 5J0RA 3AUOA 3T5JA 1MQ3A 4F92B 1S0VA 3RJKA 3TAPA 4QZGA 5J0UA 1L5UA 4F50A 4YXMA 4O0IA 1JXLA 5J2FA 4QZCA 5KFNA 3G6YA 1NJXA 4BWMA 3V6JA 2Y1JA 1K1QA 4I27A 5DG8A 4GXJA 2UVVA 4ED8A 4KLUA 2J6TA 2HHQA 5HNKA 4UAYA 3M9NB 5L1JA 3HWTA 1BPXA 2XCPA 3C1YA 5J2HA 2BPGA 4PHDA 4NLNA 4DLGA 5DQIA 5KT4A 1A77A 1AROP 3V72A 4KLHA 3SZ2A 1HUOA 4DOCA 4Q45A 5CJ7A 2ASJA 3M9MB 5KG6A 7ICEA 4I2JA 3V6KA 2BPFA 3V7LA 3GFKB 2AGQA 3BJYA 5DQGA 4NLGA 4KLTA 7ICFA 9ICJA 2XY5A 3RTVA 2JEJA 3T5HA 9ICMA 3OHAA 9ICEA 1Z00A 3ZD8A 4QW9A 4J9LA 4YCXA 5EOZA 2BCRA 2IHMA 4ELTA 4Q8FA 4J9OA 1NK8A 7ICNA 1IXRA 5DB7A 4QZDA 3PMLA 4GXIA 4DFJA 4MF2A 8ICQA 2V9WA 3ZD9A 4YFKA 2XGPA 4G3IA 3PY8A 4RQ2A 5KFBA 4LZGA 3LDAA 1S10A 1TFRA 1NK5A 1ZQCA 4PGXA 4UB1A 2FLLA 1NK9A 5KFTA 3MGIA 4LZDA 3Q8QB 3MFIA 3M9OB 3Q8MA 2ALZA 1ZQKA 9ICTA 7ICUA 5KT6A 3JPQA 5J2BA 3PW5A 1TK5A 1D9FA 4Z6DA 3JPOA 3SI8A 2Y1IA 1KRPA 2ZUBA 5KFUA 7ICHA 4DF8A 4K4GA 4M6WA 2FPMA 4PPXA 8ICZA 1KLNA 3HW8A 4KN4A 4DEZA 3Q8SB 2XCAA 3ZDBA 4QZ9A 8ICOA 4B9MA 4XUSA 2W8KA 3C1ZA 4YXJA 4RUCA 4QZAA 4RT2A 3MGHA 4UB2A 4F5QA 4BDPA 2HHTA 4RQ8A 1ZQFA 5DLGA 3OSPA 3EYZA 1TK8A 9ICRA 2ATLA 3LWLA 1TVAA 1RPLA 8ICKA 1TK0A 1H38A 3RB4A 1ZQAA 4I2HA 4TURA 4DQSA 4DFKA 5F9LA 1QLNA 9ICLA 4KLMA 3OHBA 4EYIB 3H7IA 4EBDA 1NK7A 5IILA 2R8KA 4BXOA 5L9XA 4Z6CA 4PHPA 4RPXA 2W9AA 4DL6A 1ZQNA 4DOAA 2A1JB 4X5VA 2VA2A 4B9SA 4MFAA 4NXZA 1JXEA 2NRXA 4RZRA 4BGDA 5KFFA 3ISCA 4UB5A 1S77D 1L3UA 8ICHA 4O9MA 5KG2A 3ETLA 3TQ1A 1KSPA 4B9VA 4IQVA 4QZIA 4B9TA 3H8SA 1BPYA 2W9MA 5KFOA 9ICCA 2ZJ5A 1MC8A 3PW4A 2W9CB 2FLNA 4UB3A 3RR8A 1ZQWA 1Y88A 3ZDEA 5KFCA 2MUTA 4J9SA 4ECTA 1N56A 2OWOA 2RDIA 4YD2A 3MABA 1L3TA 2IHNA 8ICVA 5J2EA 4B9UA 1XU4A 4DSIA 4LVSA 4DSFA 5DLFA 3RJIA 4QWEA 3HX0A 2BQUA 2KFZA 5KFXA 3RRHA 2ZTCA 1T4GA 4O3OA 4C8NA 2JZBA 2HHUA 1TV9A 1XWLA 4QWBA 5DBAA 7ICVA 4B9LA 9ICBA 4YN4A 4RQ4A 1ZQDA 5CB1A 1X2IA 4DS4A 4DSLA 4I2GA 4ED7A 3TFRA 8ICIA 4F2RA 4F8RA 1U45A 2WTFA 5IIKA 2FPLA 3PO4A 4Z6EA 5IIJA 2BGWA 1ZQHA 3V7KA 1XO1A 1ZQSA 4KLQA 3BQ2A 1S76D 4EBEA 4ED0A 3ORYA 1S97A 2AQ0A 4YMNA 3JPPA 4GC6A 3E2EA 5CWRA 5D49A 5EWGA 4JWMA 8ICWA 2V4QA 2C2DA 8ICAA 5J2JA 2PI5A 3EWAA 5DBCA 3TAQA 1ZQOA 4UB4A 3UQ0A 3B0YA 8ICRA 1SL0A 3G6XA 4IRCA 2P6UA 8ICLA 5KFQA 2ZUCA 4IR9A 5KFKA 4KLDA 2R8HA 2J6SA 3GIMA 1QTMA 8ICCA 3RAQA 1L3SA 4GC7A 2ISOA 3RR7A 2W9BA 2R8GA 4K4IA 9ICWA 1IM4A 4O3QA 3IHQB 4RQ5A 1ZQBA 4M04A 9ICUA 3T3FA 2P66A 8ICNA 3FYHA 3M8RA 1BPDA 5HMLA 4UQGA 1NK6A 3EPIA 4DL3A 3THVA 5DB8A 3GQCA 1NKBA 9ICXA 3RB0A 4DFMA 5KG7A 3NTUA 4YR3A 3AU6A 4UBCA 5JUMA 1SKRA 3C2LA 3G6VA 3T5LA 1C7YA 4RNMA 4R65A 1B43A 2HVHA 3AU2A 4F4WA 4J9MA 1ZQPA 2FLPA 4JV2A 4Q43A 1NKEA 3SV3A 4EZ9A 5CHGA 4MF8A 2R8JA 2NRZA 3BQTA 2AGPA 4O5CA 3H8WA 1S0MA 1MSWD 1TAQA 4RNNA 5J0YA 1SL1A 8ICFA 1N48A 3JPRA 2ZJ8A 3PR4A 4DQRA 4C8LA 3C5GA 4HYKA 1S0OA 2H5XA 1UA1A 1K1SA 1TAUA 4NLKA 1JIHA 3MR5A 3OGUA 4TUPA 1L3VA 2NRTA 4M2YA 4YMOA 4F91B 2PXIA 4DLEA 4Z6FA 4F5OA 4DQIA 5KFZA 9ICVA 1D9DA 4O3RA 4KITB 1NOMA 4QZEA 5J2AA 3OJSA 2AGOA 4P2HA 3RBDA 2C2RA 2UVUA 1B22A 4NM1A 4K4HA 4JV1A 2F1HA 5KG3A 3C5FA 4R8UB 3ISBA 3Q8LA 2HVIA 5J2DA 4KN7A 1BPBA 4DQQA 5J29A 2HHWA 2B21A 1JMSA 1SKWA 4O3SA 2BR0A 2IBKA 4C8MA 5CR0A 2IA6A 2JEFA 4P4MA 7ICMA 1WCNA 5KFHA 4YQWA 3UPQA 4I2BA 4NM2A 4F5RA 3MDCA 3PO5A 5KFLA 4YVZA 3BQ0A 4YMMA 4Q44A 7ICIA 3TFSA 1SL2A 1BPZA 1ZQTA 4KLFA 3T5KA 5KG4A 5HHIA 3H4BA 1XSPA 1D8LA 1XS9D 1QSSA 4TQRA 1D8YA 2BCQA 5DQHA 4ECWA 4ED2A 7ICOA 3PNCA 1XSLA 4E0DA 5CP2A 4DL5A 2KZMA 1RZTA 7ICKA 4QW8A 1QSLA 4I28A 8ICXA 4DS5A 2F1JA 5C5JA 5J0SA 5BOLA 7ICTA 2BHNA 5KFJA 4RQ6A 4FS2A 3RAXA 1UA0A 2XGQA 2ZTDA 5F9NA 2XC9A 3UQ2A 5KFGA 3KTQA 3C21A 3UXOA 5J0QA 5J0XA 4ECUA 1LB2B 3MFHA 1ZQVA 4QZHA 4I2IA 4QWAA 4J9QA 1XC9A 5KFEA 1DGSA 5DB9A 4ECSA 3RRGA 3QE9Y 4TUSA 1UT5A 5EWEA 5D46A 3JPNA 1T7PA 2ASDA 5D4BA 2AJQA 3N4MB 5EWFA 2BKEA 5J0TA 2FMSA 3RB3A 3UXPA 3GIJA 1ZJMA 1X9WA 4DFPA 1ZQRA 2PFPA 9ICQA 4KLLA 2XO7A 2HHSA 3K4GA 8ICSA 1JN3A 5KFRA 4RT3A 4O5KA 3RBEA 4ECRA 4KLEA 4RUAA 3RJEA 4P4OA 1ZQEA 7ICRA 4RU9A 4O5EA 2VA8A 5KFSA 4GLXA 4ECZA 1U9LA 5KFWA 3MR2A 1JX4A 4ED3A 4F3OA 2PI4A 4F93B 2KZ3A 3KHLA 4I2AA 5HMMA 1ZYQA 3TARA 1PZNA 3HT3A 8ICPA 4M9LA 4EYHB 9ICSA 5KG1A 5KFVA 4ED6A 2V4RA 2W9BB 4F4YA 1COOA 3KHHA 5L1IA 1ZQXA 9ICKA 5J2GA 4ECVA 8ICUA 4M9NA 4NLZA 9ICOA 4IQWA 4DO9A 1X9SA 2JEGA 2DPJA 5KFMA 4DWIA 5J0PA 1V9PA 2RDJA 1U49A 4KLGA 5TZVA 3KHRA 4KMUA 3SV4A 4RQ0A 3GIIA 8ICEA 1S0NA 5J2KA 3M8SA 1KTQA 4YG2A 4RQ3A 1KEJA 1NJWA 1MQ2A 2PFNA 4ELUA 8ICGA 1ZETA 4DSKA 9ICIA 1HUZA 4RPZA 3ZDCA 3B0XA 4RQ7A 3EZ5A 1Z3EB 4P4PA 4YD1A 1RXWA 1ZQMA 4RNOA 1BVSA 1DOQA 3LWMA 3HPOA 4KLSA 1ZQJA 4GXKA 2I1QA 3UXNA 1Z00B 2NRVA 4FBUA 3QEBZ 4ECXA 4M0AA 4Q8EA 4JV0A 9ICNA 4QZFA 4ED1A 5KT5A 4RPYA 5J2CA 3SYZA 2PFQA 3HP6A 5KG5A 3KHGA 2AQ4A 3EW9A 4RQ1A 2FMPA 2ISPA 2UVRA 3IM1A 1WCLA 4PGYA 4F4XA 5HP4A 5IIMA 2W8LA 1NJZA 5BOMA 4QWCA 1HJPA 1KFSA 1U48A 4XRHA 5L1LA 4B9NA 2FMQA 4I2FA 1KFTA 4DL4A 3LK9A 3RH4A 4PHEA 4PH5A 4DF4A 4QZBA 4MEXA 4KTQA 3RH5A 9ICHA 4TQSA 4M47A 4XA5A 2I9GA 4I2EA 4KLIA 4QWDA 4EBCA 2BDPA 1U4BA 2FPKA 4M6WB 1CUKA 5KFDA 5KG0A 4R63A 5CA7A 1ZQLA 7ICSA 3RJFA 1U47A 4UAZA 4ELVA 4C8OA 3GV5B 2DPIA 5KT3A 2HHXA 4YR2A 3TI0A 3Q8RB 5KFYA 1BPEA 4M9JA 5DDMA 2HW3A 4IQTA 8ICTA 5KFPA 1QSYA 4KLOA 2KFNA 4YP3A 3JPSA 2MAXA 3V6HA 1A76A 1EXNA 2UVWA 7ICPA 4I2DA 4MFFA 7ICLA 4F5NA 3RJHA 4BXOB 4DL2A 5IINA 4MFCA 1NK4A 4DSEA 5DGBA 1ZQIA 3V7JA 1ZQGA 4I2CA 3PVXA 1NK0A 2LYHA 3QEAZ 7ICJA 4J9NA 5J0WA 1ZJNA 3OSNA 2XY6A 4KLJA 3C2MA 5DBBA 3H40A 4O3PA 2BCUA 1NJYA 2HHVA 2Q0ZX 3MDAA 2BPCA 2PFOA 8ICBA 2VA3A 1RXVA 3JPTA 2GWSA 2NRWA 5DGAA 1UT8A 4R8UA 3RJGA 2M9NA 5KT2A 2MUTB 3PW2A 4F2SA 1T8EA 5DG7A 4ECQA 5HHHA 3GV8B 3ISDA 2R8IA 1T3NA 1RYSA 1TKDA 4IRDA 1X9MA 9ICAA 4IQUA 4NY8A 9ICFA 3Q8PB 4J9KA 3PX0A 5DG9A 3RH6A 3H8JA 1NKCA 2JZBB 4F4ZA 4DL7A 2BCVA 1ZQZA 3H4DA 2AU0A 1ZQYA 4O3NA 4J9PA 4FS1A 4DOBA 3ZDDA 3MR3A 1SZPA 4J9RA 9ICPA 3PX4A 3PW0A 3RB6A 4MEYA 4PGQA 3PW7A 1ZQQA 3GIKA 1SKSA 3ZDAA 2KZZA 4FBTA 4QZ8A 3C23A 2ZUDA 2BQRA 2C2EA 4BWJA 2A1JA 7ICGA 5KT7A 4XQ8A 3GILA 1S9FA 2C28A 4M9GA 5KTQA 2BCSA 3N97B 5KFIA 4F5PA 4EEYA 3RJJA 3FDSA 4JUZA 3QZ8A 3OJUA 2DFLA 2KN7A 4DSJA 2F1IA 5DKWA 5J0OA 4DQPA 4YR0A 5IIIA 3K75D 4TUQA 1KDHA 4IRKA 3PX6A 8ICJA 2KTQA 2C22A 4JK1A 8ICYA 2J6UA
chains in the Genus database with same CATH superfamily
3PR5B 2JEIA 3MR6A 2ES6A 1KFDA 2YMLA 1X42A 2P6RA 2ZJAA 5ALQA 1Q3VA 5BPCA 1LV5A 2VANA 3MBYA 1XSNA 4M9HA 3BDPA 4R64A 4UAWA 2W03A 1SV4A 1BGXT 1CEZA 4EX6A 3GV7B 4USAA 3T5JA 3K1ZA 1JI7A 4OO1J 1L6NA 4YXMA 1JXLA 4RQNA 4QZCA 4I27A 5DG8A 4GXJA 2UVVA 5HNKA 4UAYA 5L1JA 1BPXA 1URJA 2BPGA 2KKPA 4DLGA 1A77A 2YTUA 3SZ2A 3ONNA 4QIWC 1HUOA 4DOCA 5CJ7A 2DKXA 4JMUA 4KLTA 3ETRA 3V7LA 2AGQA 5L1MA 2XY5A 3T5HA 9ICEA 1S5LU 2HDOA 4YCXA 2IHMA 3KFUF 1ZOLA 2F8KA 7ICNA 4DFJA 1FIQA 4YFKA 2XGPA 4QJFB 5KFBA 1S10A 1Z1VA 1TFRA 4PGXA 3T79A 3MFIA 1PVQA 3Q8MA 7ICUA 1QQ7A 3PSTA 5J2BA 1TK5A 3JPOA 4PPXA 2HBLA 3Q8SB 3WK5A 2XCAA 2HOIA 3ZDBA 4QZ9A 3QU4A 4RUCA 4YXJA 3KZXA 4RT2A 2ATLA 1PVRA 1TK0A 1DXSA 2EAMA 4TURA 4DFKA 9ICLA 5C0YA 3OHBA 2W54A 1NK7A 4EBDA 3OTQA 1PK1A 4O3MA 3QU5A 4DL6A 2W9AA 1ZQNA 4DOAA 3WKDA 4RZRA 5KFFA 3ISCA 1L3UA 3ETLA 3TADC 3TQ1A 1KSPA 4IQVA 2G06A 5KAFU 4B9TA 1BPYA 5ALGA 2ZJ5A 2YY6A 4UB3A 3RR8A 2QKQA 2JMGA 1ZQWA 3MABA 4LVSA 2KFZA 2ZTCA 2JZBA 2HHUA 1TV9A 4QWBA 3CYMA 1ZRMA 4RQ4A 1V97A 1QH9A 8ICIA 5AKLA 4F8RA 2FPLA 1K5OA 5ALUA 4KLQA 2F8LA 4EBEA 2K4HA 1S97A 4GC6A 5D49A 5EWGA 2V4QA 2C2DA 2PI5A 3EWAA 2E8OA 4IRCA 2P6UA 4C80A 2J6SA 4US8A 3RR7A 3QU2A 1IM4A 3AMZA 1NZPA 3IHQB 2KSOA 9ICUA 3NUQA 3QXGA 3IV6A 3FYHA 1BPDA 4UQGA 3THVA 3AU6A 4UBCA 3C2LA 1B43A 1ZQPA 2KIVA 5EE1A 4Q43A 3SV3A 2R8JA 4UB8U 2AXTU 3BQTA 2LKYA 5ALIA 1TAQA 1L7NA 5HR7A 1N48A 4CF4A 2JH1A 3JPRA 4C8LA 1RQNA 4NLBA 3C5GA 1UA1A 1K1SA 3N7SC 3MR5A 5G5GA 5HR6A 4O3RA 4KITB 2E1EA 2WB1F 2KKVA 4AYBC 3GZFA 3C5FA 4EEKA 4PJ0U 2HHWA 1Z4NA 2QB0B 2MRLA 1JMSA 3SAHA 7ICMA 4YQWA 4GFJA 4YVZA 3HJEA 1ZD2P 1ZQTA 2K8AA 3ED5A 3N28A 1XSPA 1D8LA 5ALLA 4ED2A 5AI4A 1XSLA 4DL5A 2KZMA 2WF9A 7ICKA 4I28A 8ICXA 4DS5A 5C5JA 3UQ2A 4NL9C 4KX5A 1ECWA 2QARA 3MFHA 4QWAA 4I2IA 3N7RC 5KFEA 4ECSA 1T7PA 2BKEA 3L4PA 3RB3A 4US9A 2PKEA 3GIJA 1X9WA 1OUQA 3K4GA 4C4RA 8ICSA 5AM2A 4Y2TA 5KFRA 4RT3A 4O5KA 4ECRA 2WF6A 2ZIXB 3D2QA 4RU9A 2VA8A 4ECZA 3MR2A 4ED3A 4F93B 2KZ3A 4I2AA 5HMMA 4WJ3B 3TARA 1PZNA 3TKAA 1ZQXA 5J2GA 4C7ZA 4KLGA 5TZVA 3F2DA 1Q46A 3KHRA 4KMUA 1YZ7A 8ICEA 4YG2A 1MQ2A 1KEJA 8ICGA 2G0AA 2G07A 2OXOA 1ZETA 4RPZA 3ZDCA 3B0XA 3EZ5A 2KHVA 2H3FA 1A0PA 1ZQJA 2ZIUB 3QEBZ 4GIBA 4QZFA 5KT5A 3SYZA 4CF5A 2EQYA 3DV9A 4UB6U 2KP7A 5BOMA 4XRHA 4B9NA 4PH5A 4MEXA 3H8MA 4B6JA 9ICHA 3SR6A 4M47A 4RQMA 1A6SA 4I2EA 4QWDA 2FPKA 4IL6U 4CDGA 2DPIA 2HHXA 5DDMA 1KW4A 5KFPA 1ZQ1C 4YP3A 2VJ4A 4NV0A 2KMDA 3I1YA 3PVXA 4J9NA 1OW5A 3OSNA 4KLJA 2JHDA 2QARB 3MDAA 2VKQA 3HILA 3JPTA 4R8UA 2MUTB 4F2SA 1T8EA 5DG7A 1TKDA 1X9MA 4IQUA 5DG9A 3RH6A 2FI1A 1ZQZA 2AU0A 3A0HU 1DK3A 3WK8A 3PW0A 4MEYA 4PGQA 1RM6C 3C23A 2H3QA 2ZUDA 2BQRA 2E8NA 5ALKA 4M9GA 2K4PA 5JTIA 2OH2A 2KIWA 2DFLA 3IDWA 3F2BA 5J0OA 3PX6A 4JK1A 4OJPA 5DDYA 5J2IA 4IR1A 5DB6A 3SMVA 9ICGA 3CRXA 3GDXA 1RYRA 2BQ3A 3QUCA 2G08A 3SD7A 2IMWP 1ZQUA 4KMOB 4FO6A 8ICMA 1WG8A 4JWNA 7ICQA 1S0VA 4F50A 2RLTA 1NJXA 3H0LB 4BWMA 2Y1JA 1K1QA 1SIJA 2E8PA 1PVPA 2HHQA 3EUB2 1VLBA 3HWTA 2WF8A 5J2HA 4NLNA 2LPEA 1N62A 2KOBA 2ASJA 2CRXA 5KG6A 2D3DA 4Y2PA 3GFKB 4NLGA 3BJYA 3NVWA 2L5YA 2KHQA 3K1RB 1Z00A 2BCRA 5EOZA 4Q8FA 1F0MA 1NK8A 2XI9A 1IXRA 3PMLA 3ZD9A 3BS7A 3KBBA 1QQ6A 2W7PA 4LZGA 1NK5A 4UB1A 1NK9A 3MGIA 4LZDA 3Q8QB 3FAHA 1ZQKA 3JPQA 1D9FA 4Z6DA 3SI8A 4C7YA 2ZUBA 5KFUA 2FPMA 4DEZA 3C1ZA 1TK8A 1BNOA 3H0RB 1ZQAA 4DQSA 1ZD3A 1QLNA 2CXYA 3BQ7A 3AM9A 2H3IA 4Z6CA 3O0FA 5AKXA 2KV2A 2NRXA 4BGDA 5ALRA 8ICHA 4QZIA 4C0ZA 4UAVA 5ALJA 5KFOA 4BUGA 2KVSA 3KKAA 2K89A 3PW4A 2FLNA 1N60A 3D2NA 2MU2A 2IHNA 4EELA 5J2EA 4DSFA 3RJIA 1J2NA 5AICA 5KFXA 4C8NA 2HMXA 2DGZA 5AM0A 2KVCA 3IG5A 3WK6A 4P0PA 9ICBA 5TISU 1ZQDA 3LVVA 4ED7A 3TFRA 1YT3A 4F2RA 1Q3UA 1U45A 2WTFA 4Z6EA 1ZQHA 3V7KA 1XO1A 2HBKA 3BQ2A 2ZIVA 1S76D 4ED0A 2AQ0A 4YMNA 3JPPA 5CWRA 4Y2VA 5AM4A 3TAQA 1ZQOA 1SL0A 2LYAA 3WK4A 2HBMA 4GC7A 4CE6A 4O3QA 1ZQBA 3IP4B 2P66A 2BZFA 5HMLA 3EPIA 1KKXA 5DB8A 4HAIA 2NO5A 5JUMA 4IS7A 1SKRA 5AIAA 4RNMA 4F4WA 4J9MA 2GLEA 2W7OA 1NKEA 4MF8A 2A19A 2NRZA 2AGPA 1S0MA 3QUBA 1N63A 2DF4B 2H3VA 3PR4A 2H5XA 1JIHA 2KNJA 2PXIA 3F5EA 4FZLA 4DQIA 5J2AA 1NOMA 3OJSA 1L8OA 2C2RA 1X6IA 5AK3A 3BZCA 4JV1A 3KZIU 4OCZA 3ISBA 1BPBA 5J29A 2B21A 2EDUA 4C8MA 3NVVA 4MHVA 2IOFA 4P4MA 1WCNA 5KFHA 4I2BA 1L7PA 3PO5A 3MDCA 5KFLA 1BPZA 2F3NA 3T5KA 5HHIA 1XS9D 1D8YA 4TQRA 2ZIWB 4BJQA 3PNCA 2LBOA 1RZTA 2LMRA 3MGVA 1J2MA 5BOLA 2BHNA 5KFJA 4RQ6A 1UA0A 3KTQA 2XGQA 3C21A 1MN8A 3UXOA 5J0QA 4ECUA 2WFAA 4J9QA 5DB9A 3JPNA 5EWFA 1ZQRA 4DFPA 1M6YA 1T94A 2W11A 1Q8KA 4J03A 2ZIVB 5ALNA 2MSNA 2D6FC 3H0MB 2WHEA 1TAMA 3F2CA 3KHLA 5ALMA 3D2SA 3HT3A 4M9LA 9ICSA 1LKYA 2KICA 2Y0SC 4OJ6A 9ICOA 4IQWA 3FM9A 1X9SA 2JEGA 1V9PA 1U49A 3VC8A 3SV4A 2JV3A 1HEKA 1C20A 4RQ3A 9ICIA 1Z3EB 4YD1A 2JGAA 1BVSA 3WK7A 2I1QA 5B5EU 2WF7A 4ED1A 4CRXA 1WUDA 2KE7A 2A1AA 4RQ1A 2ISPA 3IM1A 5HP4A 3PSFA 1U48A 1KFTA 2Y9UA 4DL4A 3RH4A 2G09A 4DF4A 4QZBA 3NVZA 4TQSA 1X40A 1X6JA 2I9GA 3QNMA 2BDUA 5KG0A 1ZQLA 2KK0A 1U47A 4ELVA 3QU9A 3GV5B 5KT3A 4M9JA 8ICTA 3CNHA 4NLCA 2HOQA 1KBUA 3V6HA 1A76A 2W43A 4I2DA 1PK1B 3WKAA 3RJHA 4DL2A 1ZQIA 3V7JA 4I2CA 3CW2C 1NK0A 4Y2RA 4PL1A 5EE3A 3C2MA 4O3PA 2BCUA 2HHVA 2BPCA 2PFOA 4UATA 1RXVA 1UT8A 3PW2A 4ECQA 3GV8B 1RYSA 5AKJA 9ICAA 3Q8PB 4FZMA 2RHFA 4LJXA 1QCKA 1NKCA 2JZBB 4F4ZA 4DL7A 3H4DA 3QX7A 4O3NA 4J9PA 4DOBA 3ZDDA 1SZPA 4J9RA 9ICPA 5F3XB 3RB6A 1ZQQA 2KZZA 3PW7A 1SKSA 1IIPA 3ZDAA 4QZ8A 3KKAC 4CGZA 4BWJA 2A1JA 2PMZC 5KT7A 3N97B 5KFIA 1B4FA 2KN7A 4DSJA 3N7PD 5DKWA 1LKYB 4DQPA 5IIIA 3K75D 2C22A 2F77X 8ICYA 2J6UA 1JALA 3C2KA 2K60A 3NGDA 2OYYA 3M1YA 4ZH4A 3E0FA 2KSOB 1FFVA 2ZTEA 4CCHA 3PV8A 2ASLA 4EZ6A 3Q8KA 3NS1A 4UBBA 3EPGA 5L1KA 5IIOA 5E79U 3BQ1A 5J0RA 3AUOA 4F92B 3TAPA 4QZGA 5J0UA 4OJOA 4O0IA 3NRWA 5J2FA 5KFNA 3G6YA 3V6JA 4ED8A 2F44A 1Z4OA 2XCPA 3IRUA 5DQIA 5KT4A 1AROP 3M6KA 4KLHA 2E8MA 5A0LA 3M9MB 2HI0A 7ICEA 5H2FU 3GU3A 7ICFA 9ICJA 7ICSA 4NWIA 2JEJA 3ZD8A 4J9LA 4J9OA 4QZDA 4GXIA 3HKZC 2V9WA 3ICXA 5KL1B 4RQ2A 1SB3C 1V85A 3LDAA 3B9JA 4QNLA 5JRTA 3C28A 5KFTA 3M9OB 2ALZA 5KT6A 3PW5A 5ALXA 1KN5A 5KAIU 2Y1IA 7ICHA 2JR5A 3RF9A 4M6WA 1X9XA 2LI6A 8ICZA 3HW8A 4KN4A 1JUDA 4B9MA 2W8KA 1OXJA 4UB2A 4F5QA 4BDPA 1ZD5A 4RQ8A 1ZQFA 5DLGA 3OSPA 2FDRA 9ICRA 3WK9A 1RPLA 1COKA 2QB1A 2I6XA 1H38A 3RB4A 1F44A 2LYBA 2WF5A 5F9LA 4EYIB 3H7IA 3SQIA 5AKKA 5IILA 2R8KA 4BXOA 4PHPA 4RPXA 2VA2A 4B9SA 2A1JB 4X5VA 4MFAA 2D8CA 2EH9A 4UB5A 2KJ5A 4B9VA 2EAOA 2LM4A 1S8OA 9ICCA 5KFCA 3ZDEA 4J9SA 4ECTA 2RDIA 4YD2A 4B9UA 2G5HB 4CNQA 5DLFA 3HX0A 2BQUA 1T4GA 1XWLA 5DBAA 1D8BA 7ICVA 4YN4A 3M7DA 1RG6A 1X2IA 5CB1A 4DSLA 1N5XA 3PO4A 5IIJA 1SXEA 3E2EA 8ICWA 4JWMA 3AEVA 5DBCA 2YQEA 4UB4A 3UQ0A 3PSIA 5AM1A 4IR9A 5KFKA 2LHTA 2R8HA 2YX8A 8ICCA 1NZBA 1L3SA 9ICWA 2W9BA 3WKCA 8ICNA 1NK6A 3M8RA 4AP9A 2I5HA 3GQCA 9ICXA 2Z7JA 3RB0A 1C7YA 3G6VA 1KL9A 3T5LA 4PZOA 5K4LA 3AU2A 4JV2A 2NYVA 1WYGA 5KNIA 4U7CA 1FO4A 2EAPA 3I28A 2FJ6A 5AI8A 1IV8A 4RNNA 3FC4A 5J0YA 5GTHU 1SL1A 8ICFA 2Y0SF 2EZYA 4OJLA 3NRZA 5ALFA 4M2YA 4YMOA 3RFAA 4DLEA 4Z6FA 4F5OA 2VJ5A 1YZ6A 4QZEA 3RBDA 2UVUA 1B22A 2F1HA 4R8UB 3Q8LA 2HVIA 2AHOB 1SKWA 4O3SA 2IBKA 4UW9A 4Y2UA 2KD1A 2XVTA 4NM2A 4F5RA 3TFSA 1SL2A 1QSSA 5DQHA 7ICOA 3BZKA 2RQ5A 2F1JA 5J0SA 4FS2A 5F9NA 5KFGA 1LB2B 1B0XA 5ALEA 3CP8A 2K8CB 4QZHA 1T3QA 1UT5A 5EWEA 5D46A 2ASDA 5D4BA 2AJQA 3N4MB 2FMSA 4Y2QA 4KLLA 2HHSA 1N61A 5GTIU 1V38A 3RBEA 4KLEA 3ALRA 3RJEA 4P4OA 7ICRA 3UM9A 4U6PA 2RP5A 2NO4A 4GLXA 5KFWA 4OD0A 4Y2XA 2Y9TA 5AKZA 2JH7A 3WKEA 1SV0A 5AI6A 1NI3A 1ZYQA 3HRDD 1DGJA 4EYHB 1TE2A 4ED6A 2W9BB 4F4YA 4M9NA 4NLZA 4DO9A 1JRPA 1S0NA 5J2KA 1NJWA 2PFNA 2ZXIA 4DSKA 4RQ7A 4P4PA 5ALVA 1XO0A 1RXWA 4UAUA 3LWMA 1VDVA 2PMZF 4GXKA 1Z00B 2NRVA 4JV0A 1SGGA 9ICNA 3HP6A 5KG5A 3AQFA 3KHGA 2FMPA 2W3RA 2UVRA 1WCLA 4PGYA 4F4XA 4NJ8A 2W8LA 5IIMA 1NJZA 4QWCA 5AM5A 1KFSA 3OPXA 4I2FA 5ALYA 2E3TA 2ODGA 4KLIA 1P7DA 2HBJA 1U4BA 5KFDA 4R63A 5B66U 3LYSA 4UASA 4YR2A 2YMMA 5KFYA 1BPEA 4IQTA 2GO7A 1X66A 2KFNA 2N1RA 3D6JA 3NVYA 4EENA 2UVWA 3SAGA 5J8YA 4PL2A 5DGBA 1ZQGA 2HCFA 2LYHA 3QEAZ 1KQQA 3F5AA 5J0WA 1ZJNA 2B0CA 5DBBA 3H40A 1NJYA 4PZNA 5JU5A 8ICBA 2VA3A 5ALTA 2RRDA 3RJGA 2M9NA 3KD3A 1J97A 2XIDA 2QB0A 2WAQC 5HHHA 3ISDA 2R8IA 1T3NA 4IRDA 9ICFA 3HKZF 4J9KA 3PX0A 3IN5A 3H8JA 3WKBA 2BCVA 1LVHA 2HOFA 1ZQYA 3I76A 5AKEA 4P0PB 3PX4A 5AKGA 7ICGA 3GILA 2C28A 5KTQA 5AI5A 4EEYA 4F5PA 3BS5A 2HSZA 4YR0A 2KTQA 2W9CA 2XY7A 4C8KA 4F4KA 4R66A 4ECYA 4PHAA 3PMNA 4I29A 4F72A 5KFAA 3TANA 2ZIXA 3QZ7A 2W55A 2W04A 1MQ3A 3RJKA 5AKIA 3UMCA 1L5UA 2DBYA 1SZHA 1Z19A 5AKHA 2OHFA 4KLUA 2J6TA 4P0QA 3M9NB 3F53A 5FP0A 3C1YA 4PHDA 1RYUA 3V72A 4Q45A 2FE9A 1N2XA 4I2JA 4Y2SA 3V6KA 2BPFA 4DFDA 3QUQA 5DQGA 2E5SA 3RTVA 9ICMA 3OHAA 2ZIUA 1IG6A 4QW9A 4ELTA 2K8BB 5DB7A 4MF2A 8ICQA 4G3IA 3PY8A 2DQNB 1ZQCA 2VIXA 1SWVA 2FLLA 4A8EA 4ACOA 1NNLA 1L7MA 9ICTA 1KRPA 2F76X 4DF8A 4K4GA 1KLNA 3QYPA 3UMGA 8ICOA 2GH1A 4XUSA 1DK2A 3LVWA 2Q4TA 4QZAA 3MGHA 2HHTA 3EYZA 4EX7A 3LWLA 1TVAA 3SENA 8ICKA 2LM1A 4I2HA 4ICAA 3R9KA 3KOOA 4UARA 4KLMA 2R18A 5L9XA 2QLTA 3TACB 4NXZA 1JXEA 1S77D 3BS5B 4O9MA 5KG2A 5EE9A 3H8SA 2W9MA 2E1FA 1MC8A 2W9CB 3ZI4A 2F2AB 1Y88A 2OWOA 2MUTA 2YB4A 4FZNA 3PZPA 1N56A 8ICVA 1L3TA 4CF3A 1XU4A 2YMPA 4DSIA 1F5SA 2OCEA 4QWEA 2AH5A 3AQEA 3S6JA 3RRHA 4O3OA 4B9LA 1CRXA 4DS4A 1SV0C 4I2GA 1WWVA 5IIKA 2BGWA 3C29A 1ZQSA 1UCVA 2MA1A 3ORYA 2G5IB 8ICAA 5J2JA 4P0QB 3U26A 3B0YA 5AM3A 8ICRA 3G6XA 1GO3F 4Y2JA 8ICLA 5KFQA 2ZUCA 4KLDA 3GIMA 1QTMA 1SXDA 3RAQA 2ISOA 4K4IA 2R8GA 2W3SA 5AK4A 2KJ8A 4RQ5A 4M04A 5ALZA 3T3FA 1HIWA 4DL3A 1NKBA 4DFMA 5KG7A 3NTUA 4YR3A 1VJ5A 4C4TA 2HVHA 4R65A 2FLPA 5ALSA 2OM6A 3M6ZA 4EZ9A 5CHGA 3VCBA 4F71A 2NV3A 4O5CA 3H8WA 4DCCA 1MSWD 1L8LA 2P35A 4BX9C 2GOLA 5AI0A 2ZJ8A 4DQRA 4HYKA 3L5KA 1S0OA 3J81j 2ZG6A 1TAUA 4NLKA 3OGUA 3IG8A 4TUPA 1L3VA 2NRTA 4F91B 2DL0A 1ED1A 2JRZA 5KFZA 9ICVA 1D9DA 2IOHA 5AHXA 2AGOA 4P2HA 2EZZA 1UPHA 4NM1A 3MC1A 4K4HA 5KG3A 5J2DA 4KN7A 4DQQA 2IOFK 5J8YC 5G5HA 2BR0A 2IA6A 5CR0A 2JEFA 3UPQA 1QQ5A 3BQ0A 4YMMA 4Q44A 7ICIA 2CPRA 4KLFA 2YB1A 5KG4A 5ALWA 1ZXIA 3H4BA 4QIWF 2BCQA 4ECWA 5CEHA 4E0DA 5CP2A 4QW8A 1QSLA 3SAFA 5AI9A 1UQVA 7ICTA 1UHUA 3RAXA 4G9BA 2ZTDA 2XC9A 1SWWA 5T14A 5J0XA 1O03A 4IC9A 3TADA 1DRGA 2JXJA 1ZQVA 1XC9A 1DGSA 4JB3A 3RRGA 3QE9Y 1FEZA 4TUSA 5J0TA 1PUZA 3UXPA 1ZJMA 5AKYA 2PFPA 9ICQA 2XO7A 2DWQA 3QU7A 1JN3A 1ZD4A 5ALOA 1WWUA 4RUAA 1BNPA 1ZQEA 4O5EA 5KFSA 1U9LA 1JX4A 4F3OA 2PI4A 3QUTA 5ALPA 4KX3A 8ICPA 5KG1A 5KFVA 1RDFA 2EANA 5ALDA 2V4RA 2WAQF 1COOA 3KHHA 5L1IA 2DKZA 9ICKA 2EZXA 4ECVA 8ICUA 3PSPA 1FFUA 2DPJA 5CRXA 5KFMA 4DWIA 5J0PA 2RDJA 4FFDA 2DUYA 4RQ0A 3GIIA 2H3ZA 3M8SA 1KTQA 3E58A 1Z1BA 4ELUA 2WB1C 1HUZA 1ZQMA 4RNOA 3DEEA 1DOQA 3HPOA 4KLSA 3UXNA 4ZOHC 5AK5A 4FBUA 4ECXA 4M0AA 4Q8EA 3UMBA 2XICA 4RPYA 5J2CA 2PFQA 2AQ4A 3EW9A 3WU2U 1HJPA 1ZRNA 2K4EA 5L1LA 2FMQA 3LK9A 4PHEA 4KTQA 3RH5A 1O08A 4XA5A 3DDHA 5KL8B 4EBCA 2BDPA 3AN1A 5EE0A 4M6WB 1CUKA 4FE3A 5CA7A 4Y2YA 5ALHA 3A0BU 3RJFA 2ZXHA 4UAZA 4C8OA 3SEIA 3TI0A 3Q8RB 3L3FX 2A3VA 2HW3A 1N5WA 1QSYA 4KLOA 3JPSA 2MAXA 1EXNA 1XNSA 2YN4A 7ICPA 2KJ9A 2ESEA 4MFFA 7ICLA 4F5NA 4BXOB 1JROA 5IINA 1MA7A 4MFCA 1NK4A 1RQLA 4DSEA 2KEYA 7ICJA 2XY6A 2K4IA 2CN1A 2Q0ZX 1CI4A 2GWSA 2NRWA 5DGAA 5AK6A 5KT2A 4OJ5A 3NASA 1L7OA 5AIBA 3AL0B 4NY8A 4NL9A 4FS1A 3MR3A 2OEHA 2O6KA 4C4SA 3GIKA 4FBTA 2ZIWA 2C2EA 2B6GA 4XQ8A 4AYBF 1S9FA 2BCSA 2M0NA 3RJJA 2KG5A 3FDSA 4JUZA 3QZ8A 3OJUA 2F1IA 2YMQA 4IRKA 4TUQA 1KDHA 1PK3A 1AQ6A 8ICJA
chains in the Genus database with same CATH topology
3C2KA 3PR5B 2W9CA 2XY7A 5DDYA 4C8KA 2JEIA 5J2IA 3NGDA 4IR1A 4F4KA 3MR6A 1KFDA 4R66A 4ZH4A 5DB6A 2P6RA 2ZJAA 4ECYA 9ICGA 2ZTEA 5BPCA 4PHAA 3GDXA 3PV8A 2BQ3A 2ASLA 1RYRA 1LV5A 4CCHA 3PMNA 4EZ6A 2VANA 3Q8KA 2IMWP 1ZQUA 3MBYA 4I29A 1XSNA 4UBBA 4M9HA 3BDPA 3EPGA 4R64A 5KFAA 5L1KA 4UAWA 3TANA 5IIOA 4FO6A 8ICMA 1BGXT 1CEZA 3BQ1A 4JWNA 3GV7B 3QZ7A 7ICQA 5J0RA 3AUOA 3T5JA 1MQ3A 4F92B 1S0VA 3RJKA 3TAPA 4QZGA 5J0UA 1L5UA 4F50A 4YXMA 4O0IA 1JXLA 5J2FA 4QZCA 5KFNA 3G6YA 1NJXA 4BWMA 3V6JA 2Y1JA 1K1QA 4I27A 5DG8A 4GXJA 2UVVA 4ED8A 4KLUA 2J6TA 2HHQA 5HNKA 4UAYA 3M9NB 5L1JA 3HWTA 1BPXA 2XCPA 3C1YA 5J2HA 2BPGA 4PHDA 4NLNA 4DLGA 5DQIA 5KT4A 1A77A 1AROP 3V72A 4KLHA 3SZ2A 1HUOA 4DOCA 4Q45A 5CJ7A 2ASJA 3M9MB 5KG6A 7ICEA 4I2JA 3V6KA 2BPFA 3V7LA 3GFKB 2AGQA 3BJYA 5DQGA 4NLGA 4KLTA 7ICFA 9ICJA 2XY5A 3RTVA 2JEJA 3T5HA 9ICMA 3OHAA 9ICEA 1Z00A 3ZD8A 4QW9A 4J9LA 4YCXA 5EOZA 2BCRA 2IHMA 4ELTA 4Q8FA 4J9OA 1NK8A 7ICNA 1IXRA 5DB7A 4QZDA 3PMLA 4GXIA 4DFJA 4MF2A 8ICQA 2V9WA 3ZD9A 4YFKA 2XGPA 4G3IA 3PY8A 4RQ2A 5KFBA 4LZGA 3LDAA 1S10A 1TFRA 1NK5A 1ZQCA 4PGXA 4UB1A 2FLLA 1NK9A 5KFTA 3MGIA 4LZDA 3Q8QB 3MFIA 3M9OB 3Q8MA 2ALZA 1ZQKA 9ICTA 7ICUA 5KT6A 3JPQA 5J2BA 3PW5A 1TK5A 1D9FA 4Z6DA 3JPOA 3SI8A 2Y1IA 1KRPA 2ZUBA 5KFUA 7ICHA 4DF8A 4K4GA 4M6WA 2FPMA 4PPXA 8ICZA 1KLNA 3HW8A 4KN4A 4DEZA 3Q8SB 2XCAA 3ZDBA 4QZ9A 8ICOA 4B9MA 4XUSA 2W8KA 3C1ZA 4YXJA 4RUCA 4QZAA 4RT2A 3MGHA 4UB2A 4F5QA 4BDPA 2HHTA 4RQ8A 1ZQFA 5DLGA 3OSPA 3EYZA 1TK8A 9ICRA 2ATLA 3LWLA 1TVAA 1RPLA 8ICKA 1TK0A 1H38A 3RB4A 1ZQAA 4I2HA 4TURA 4DQSA 4DFKA 5F9LA 1QLNA 9ICLA 4KLMA 3OHBA 4EYIB 3H7IA 4EBDA 1NK7A 5IILA 2R8KA 4BXOA 5L9XA 4Z6CA 4PHPA 4RPXA 2W9AA 4DL6A 1ZQNA 4DOAA 2A1JB 4X5VA 2VA2A 4B9SA 4MFAA 4NXZA 1JXEA 2NRXA 4RZRA 4BGDA 5KFFA 3ISCA 4UB5A 1S77D 1L3UA 8ICHA 4O9MA 5KG2A 3ETLA 3TQ1A 1KSPA 4B9VA 4IQVA 4QZIA 4B9TA 3H8SA 1BPYA 2W9MA 5KFOA 9ICCA 2ZJ5A 1MC8A 3PW4A 2W9CB 2FLNA 4UB3A 3RR8A 1ZQWA 1Y88A 3ZDEA 5KFCA 2MUTA 4J9SA 4ECTA 1N56A 2OWOA 2RDIA 4YD2A 3MABA 1L3TA 2IHNA 8ICVA 5J2EA 4B9UA 1XU4A 4DSIA 4LVSA 4DSFA 5DLFA 3RJIA 4QWEA 3HX0A 2BQUA 2KFZA 5KFXA 3RRHA 2ZTCA 1T4GA 4O3OA 4C8NA 2JZBA 2HHUA 1TV9A 1XWLA 4QWBA 5DBAA 7ICVA 4B9LA 9ICBA 4YN4A 4RQ4A 1ZQDA 5CB1A 1X2IA 4DS4A 4DSLA 4I2GA 4ED7A 3TFRA 8ICIA 4F2RA 4F8RA 1U45A 2WTFA 5IIKA 2FPLA 3PO4A 4Z6EA 5IIJA 2BGWA 1ZQHA 3V7KA 1XO1A 1ZQSA 4KLQA 3BQ2A 1S76D 4EBEA 4ED0A 3ORYA 1S97A 2AQ0A 4YMNA 3JPPA 4GC6A 3E2EA 5CWRA 5D49A 5EWGA 4JWMA 8ICWA 2V4QA 2C2DA 8ICAA 5J2JA 2PI5A 3EWAA 5DBCA 3TAQA 1ZQOA 4UB4A 3UQ0A 3B0YA 8ICRA 1SL0A 3G6XA 4IRCA 2P6UA 8ICLA 5KFQA 2ZUCA 4IR9A 5KFKA 4KLDA 2R8HA 2J6SA 3GIMA 1QTMA 8ICCA 3RAQA 1L3SA 4GC7A 2ISOA 3RR7A 2W9BA 2R8GA 4K4IA 9ICWA 1IM4A 4O3QA 3IHQB 4RQ5A 1ZQBA 4M04A 9ICUA 3T3FA 2P66A 8ICNA 3FYHA 3M8RA 1BPDA 5HMLA 4UQGA 1NK6A 3EPIA 4DL3A 3THVA 5DB8A 3GQCA 1NKBA 9ICXA 3RB0A 4DFMA 5KG7A 3NTUA 4YR3A 3AU6A 4UBCA 5JUMA 1SKRA 3C2LA 3G6VA 3T5LA 1C7YA 4RNMA 4R65A 1B43A 2HVHA 3AU2A 4F4WA 4J9MA 1ZQPA 2FLPA 4JV2A 4Q43A 1NKEA 3SV3A 4EZ9A 5CHGA 4MF8A 2R8JA 2NRZA 3BQTA 2AGPA 4O5CA 3H8WA 1S0MA 1MSWD 1TAQA 4RNNA 5J0YA 1SL1A 8ICFA 1N48A 3JPRA 2ZJ8A 3PR4A 4DQRA 4C8LA 3C5GA 4HYKA 1S0OA 2H5XA 1UA1A 1K1SA 1TAUA 4NLKA 1JIHA 3MR5A 3OGUA 4TUPA 1L3VA 2NRTA 4M2YA 4YMOA 4F91B 2PXIA 4DLEA 4Z6FA 4F5OA 4DQIA 5KFZA 9ICVA 1D9DA 4O3RA 4KITB 1NOMA 4QZEA 5J2AA 3OJSA 2AGOA 4P2HA 3RBDA 2C2RA 2UVUA 1B22A 4NM1A 4K4HA 4JV1A 2F1HA 5KG3A 3C5FA 4R8UB 3ISBA 3Q8LA 2HVIA 5J2DA 4KN7A 1BPBA 4DQQA 5J29A 2HHWA 2B21A 1JMSA 1SKWA 4O3SA 2BR0A 2IBKA 4C8MA 5CR0A 2IA6A 2JEFA 4P4MA 7ICMA 1WCNA 5KFHA 4YQWA 3UPQA 4I2BA 4NM2A 4F5RA 3MDCA 3PO5A 5KFLA 4YVZA 3BQ0A 4YMMA 4Q44A 7ICIA 3TFSA 1SL2A 1BPZA 1ZQTA 4KLFA 3T5KA 5KG4A 5HHIA 3H4BA 1XSPA 1D8LA 1XS9D 1QSSA 4TQRA 1D8YA 2BCQA 5DQHA 4ECWA 4ED2A 7ICOA 3PNCA 1XSLA 4E0DA 5CP2A 4DL5A 2KZMA 1RZTA 7ICKA 4QW8A 1QSLA 4I28A 8ICXA 4DS5A 2F1JA 5C5JA 5J0SA 5BOLA 7ICTA 2BHNA 5KFJA 4RQ6A 4FS2A 3RAXA 1UA0A 2XGQA 2ZTDA 5F9NA 2XC9A 3UQ2A 5KFGA 3KTQA 3C21A 3UXOA 5J0QA 5J0XA 4ECUA 1LB2B 3MFHA 1ZQVA 4QZHA 4I2IA 4QWAA 4J9QA 1XC9A 5KFEA 1DGSA 5DB9A 4ECSA 3RRGA 3QE9Y 4TUSA 1UT5A 5EWEA 5D46A 3JPNA 1T7PA 2ASDA 5D4BA 2AJQA 3N4MB 5EWFA 2BKEA 5J0TA 2FMSA 3RB3A 3UXPA 3GIJA 1ZJMA 1X9WA 4DFPA 1ZQRA 2PFPA 9ICQA 4KLLA 2XO7A 2HHSA 3K4GA 8ICSA 1JN3A 5KFRA 4RT3A 4O5KA 3RBEA 4ECRA 4KLEA 4RUAA 3RJEA 4P4OA 1ZQEA 7ICRA 4RU9A 4O5EA 2VA8A 5KFSA 4GLXA 4ECZA 1U9LA 5KFWA 3MR2A 1JX4A 4ED3A 4F3OA 2PI4A 4F93B 2KZ3A 3KHLA 4I2AA 5HMMA 1ZYQA 3TARA 1PZNA 3HT3A 8ICPA 4M9LA 4EYHB 9ICSA 5KG1A 5KFVA 4ED6A 2V4RA 2W9BB 4F4YA 1COOA 3KHHA 5L1IA 1ZQXA 9ICKA 5J2GA 4ECVA 8ICUA 4M9NA 4NLZA 9ICOA 4IQWA 4DO9A 1X9SA 2JEGA 2DPJA 5KFMA 4DWIA 5J0PA 1V9PA 2RDJA 1U49A 4KLGA 5TZVA 3KHRA 4KMUA 3SV4A 4RQ0A 3GIIA 8ICEA 1S0NA 5J2KA 3M8SA 1KTQA 4YG2A 4RQ3A 1KEJA 1NJWA 1MQ2A 2PFNA 4ELUA 8ICGA 1ZETA 4DSKA 9ICIA 1HUZA 4RPZA 3ZDCA 3B0XA 4RQ7A 3EZ5A 1Z3EB 4P4PA 4YD1A 1RXWA 1ZQMA 4RNOA 1BVSA 1DOQA 3LWMA 3HPOA 4KLSA 1ZQJA 4GXKA 2I1QA 3UXNA 1Z00B 2NRVA 4FBUA 3QEBZ 4ECXA 4M0AA 4Q8EA 4JV0A 9ICNA 4QZFA 4ED1A 5KT5A 4RPYA 5J2CA 3SYZA 2PFQA 3HP6A 5KG5A 3KHGA 2AQ4A 3EW9A 4RQ1A 2FMPA 2ISPA 2UVRA 3IM1A 1WCLA 4PGYA 4F4XA 5HP4A 5IIMA 2W8LA 1NJZA 5BOMA 4QWCA 1HJPA 1KFSA 1U48A 4XRHA 5L1LA 4B9NA 2FMQA 4I2FA 1KFTA 4DL4A 3LK9A 3RH4A 4PHEA 4PH5A 4DF4A 4QZBA 4MEXA 4KTQA 3RH5A 9ICHA 4TQSA 4M47A 4XA5A 2I9GA 4I2EA 4KLIA 4QWDA 4EBCA 2BDPA 1U4BA 2FPKA 4M6WB 1CUKA 5KFDA 5KG0A 4R63A 5CA7A 1ZQLA 7ICSA 3RJFA 1U47A 4UAZA 4ELVA 4C8OA 3GV5B 2DPIA 5KT3A 2HHXA 4YR2A 3TI0A 3Q8RB 5KFYA 1BPEA 4M9JA 5DDMA 2HW3A 4IQTA 8ICTA 5KFPA 1QSYA 4KLOA 2KFNA 4YP3A 3JPSA 2MAXA 3V6HA 1A76A 1EXNA 2UVWA 7ICPA 4I2DA 4MFFA 7ICLA 4F5NA 3RJHA 4BXOB 4DL2A 5IINA 4MFCA 1NK4A 4DSEA 5DGBA 1ZQIA 3V7JA 1ZQGA 4I2CA 3PVXA 1NK0A 2LYHA 3QEAZ 7ICJA 4J9NA 5J0WA 1ZJNA 3OSNA 2XY6A 4KLJA 3C2MA 5DBBA 3H40A 4O3PA 2BCUA 1NJYA 2HHVA 2Q0ZX 3MDAA 2BPCA 2PFOA 8ICBA 2VA3A 1RXVA 3JPTA 2GWSA 2NRWA 5DGAA 1UT8A 4R8UA 3RJGA 2M9NA 5KT2A 2MUTB 3PW2A 4F2SA 1T8EA 5DG7A 4ECQA 5HHHA 3GV8B 3ISDA 2R8IA 1T3NA 1RYSA 1TKDA 4IRDA 1X9MA 9ICAA 4IQUA 4NY8A 9ICFA 3Q8PB 4J9KA 3PX0A 5DG9A 3RH6A 3H8JA 1NKCA 2JZBB 4F4ZA 4DL7A 2BCVA 1ZQZA 3H4DA 2AU0A 1ZQYA 4O3NA 4J9PA 4FS1A 4DOBA 3ZDDA 3MR3A 1SZPA 4J9RA 9ICPA 3PX4A 3PW0A 3RB6A 4MEYA 4PGQA 3PW7A 1ZQQA 3GIKA 1SKSA 3ZDAA 2KZZA 4FBTA 4QZ8A 3C23A 2ZUDA 2BQRA 2C2EA 4BWJA 2A1JA 7ICGA 5KT7A 4XQ8A 3GILA 1S9FA 2C28A 4M9GA 5KTQA 2BCSA 3N97B 5KFIA 4F5PA 4EEYA 3RJJA 3FDSA 4JUZA 3QZ8A 3OJUA 2DFLA 2KN7A 4DSJA 2F1IA 5DKWA 5J0OA 4DQPA 4YR0A 5IIIA 3K75D 4TUQA 1KDHA 4IRKA 3PX6A 8ICJA 2KTQA 2C22A 4JK1A 8ICYA 2J6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2K A;  3PR5 B;  2W9C A;  2XY7 A;  5DDY A;  4C8K A;  2JEI A;  5J2I A;  3NGD A;  4IR1 A;  4F4K A;  3MR6 A;  1KFD A;  4R66 A;  4ZH4 A;  5DB6 A;  2P6R A;  2ZJA A;  4ECY A;  9ICG A;  2ZTE A;  5BPC A;  4PHA A;  3GDX A;  3PV8 A;  2BQ3 A;  2ASL A;  1RYR A;  1LV5 A;  4CCH A;  3PMN A;  4EZ6 A;  2VAN A;  3Q8K A;  2IMW P;  1ZQU A;  3MBY A;  4I29 A;  1XSN A;  4UBB A;  4M9H A;  3BDP A;  3EPG A;  4R64 A;  5KFA A;  5L1K A;  4UAW A;  3TAN A;  5IIO A;  4FO6 A;  8ICM A;  1BGX T;  1CEZ A;  3BQ1 A;  4JWN A;  3GV7 B;  3QZ7 A;  7ICQ A;  5J0R A;  3AUO A;  3T5J A;  1MQ3 A;  4F92 B;  1S0V A;  3RJK A;  3TAP A;  4QZG A;  5J0U A;  1L5U A;  4F50 A;  4YXM A;  4O0I A;  1JXL A;  5J2F A;  4QZC A;  5KFN A;  3G6Y A;  1NJX A;  4BWM A;  3V6J A;  2Y1J A;  1K1Q A;  4I27 A;  5DG8 A;  4GXJ A;  2UVV A;  4ED8 A;  4KLU A;  2J6T A;  2HHQ A;  5HNK A;  4UAY A;  3M9N B;  5L1J A;  3HWT A;  1BPX A;  2XCP A;  3C1Y A;  5J2H A;  2BPG A;  4PHD A;  4NLN A;  4DLG A;  5DQI A;  5KT4 A;  1A77 A;  1ARO P;  3V72 A;  4KLH A;  3SZ2 A;  1HUO A;  4DOC A;  4Q45 A;  5CJ7 A;  2ASJ A;  3M9M B;  5KG6 A;  7ICE A;  4I2J A;  3V6K A;  2BPF A;  3V7L A;  3GFK B;  2AGQ A;  3BJY A;  5DQG A;  4NLG A;  4KLT A;  7ICF A;  9ICJ A;  2XY5 A;  3RTV A;  2JEJ A;  3T5H A;  9ICM A;  3OHA A;  9ICE A;  1Z00 A;  3ZD8 A;  4QW9 A;  4J9L A;  4YCX A;  5EOZ A;  2BCR A;  2IHM A;  4ELT A;  4Q8F A;  4J9O A;  1NK8 A;  7ICN A;  1IXR A;  5DB7 A;  4QZD A;  3PML A;  4GXI A;  4DFJ A;  4MF2 A;  8ICQ A;  2V9W A;  3ZD9 A;  4YFK A;  2XGP A;  4G3I A;  3PY8 A;  4RQ2 A;  5KFB A;  4LZG A;  3LDA A;  1S10 A;  1TFR A;  1NK5 A;  1ZQC A;  4PGX A;  4UB1 A;  2FLL A;  1NK9 A;  5KFT A;  3MGI A;  4LZD A;  3Q8Q B;  3MFI A;  3M9O B;  3Q8M A;  2ALZ A;  1ZQK A;  9ICT A;  7ICU A;  5KT6 A;  3JPQ A;  5J2B A;  3PW5 A;  1TK5 A;  1D9F A;  4Z6D A;  3JPO A;  3SI8 A;  2Y1I A;  1KRP A;  2ZUB A;  5KFU A;  7ICH A;  4DF8 A;  4K4G A;  4M6W A;  2FPM A;  4PPX A;  8ICZ A;  1KLN A;  3HW8 A;  4KN4 A;  4DEZ A;  3Q8S B;  2XCA A;  3ZDB A;  4QZ9 A;  8ICO A;  4B9M A;  4XUS A;  2W8K A;  3C1Z A;  4YXJ A;  4RUC A;  4QZA A;  4RT2 A;  3MGH A;  4UB2 A;  4F5Q A;  4BDP A;  2HHT A;  4RQ8 A;  1ZQF A;  5DLG A;  3OSP A;  3EYZ A;  1TK8 A;  9ICR A;  2ATL A;  3LWL A;  1TVA A;  1RPL A;  8ICK A;  1TK0 A;  1H38 A;  3RB4 A;  1ZQA A;  4I2H A;  4TUR A;  4DQS A;  4DFK A;  5F9L A;  1QLN A;  9ICL A;  4KLM A;  3OHB A;  4EYI B;  3H7I A;  4EBD A;  1NK7 A;  5IIL A;  2R8K A;  4BXO A;  5L9X A;  4Z6C A;  4PHP A;  4RPX A;  2W9A A;  4DL6 A;  1ZQN A;  4DOA A;  2A1J B;  4X5V A;  2VA2 A;  4B9S A;  4MFA A;  4NXZ A;  1JXE A;  2NRX A;  4RZR A;  4BGD A;  5KFF A;  3ISC A;  4UB5 A;  1S77 D;  1L3U A;  8ICH A;  4O9M A;  5KG2 A;  3ETL A;  3TQ1 A;  1KSP A;  4B9V A;  4IQV A;  4QZI A;  4B9T A;  3H8S A;  1BPY A;  2W9M A;  5KFO A;  9ICC A;  2ZJ5 A;  1MC8 A;  3PW4 A;  2W9C B;  2FLN A;  4UB3 A;  3RR8 A;  1ZQW A;  1Y88 A;  3ZDE A;  5KFC A;  2MUT A;  4J9S A;  4ECT A;  1N56 A;  2OWO A;  2RDI A;  4YD2 A;  3MAB A;  1L3T A;  2IHN A;  8ICV A;  5J2E A;  4B9U A;  1XU4 A;  4DSI A;  4LVS A;  4DSF A;  5DLF A;  3RJI A;  4QWE A;  3HX0 A;  2BQU A;  2KFZ A;  5KFX A;  3RRH A;  2ZTC A;  1T4G A;  4O3O A;  4C8N A;  2JZB A;  2HHU A;  1TV9 A;  1XWL A;  4QWB A;  5DBA A;  7ICV A;  4B9L A;  9ICB A;  4YN4 A;  4RQ4 A;  1ZQD A;  5CB1 A;  1X2I A;  4DS4 A;  4DSL A;  4I2G A;  4ED7 A;  3TFR A;  8ICI A;  4F2R A;  4F8R A;  1U45 A;  2WTF A;  5IIK A;  2FPL A;  3PO4 A;  4Z6E A;  5IIJ A;  2BGW A;  1ZQH A;  3V7K A;  1XO1 A;  1ZQS A;  4KLQ A;  3BQ2 A;  1S76 D;  4EBE A;  4ED0 A;  3ORY A;  1S97 A;  2AQ0 A;  4YMN A;  3JPP A;  4GC6 A;  3E2E A;  5CWR A;  5D49 A;  5EWG A;  4JWM A;  8ICW A;  2V4Q A;  2C2D A;  8ICA A;  5J2J A;  2PI5 A;  3EWA A;  5DBC A;  3TAQ A;  1ZQO A;  4UB4 A;  3UQ0 A;  3B0Y A;  8ICR A;  1SL0 A;  3G6X A;  4IRC A;  2P6U A;  8ICL A;  5KFQ A;  2ZUC A;  4IR9 A;  5KFK A;  4KLD A;  2R8H A;  2J6S A;  3GIM A;  1QTM A;  8ICC A;  3RAQ A;  1L3S A;  4GC7 A;  2ISO A;  3RR7 A;  2W9B A;  2R8G A;  4K4I A;  9ICW A;  1IM4 A;  4O3Q A;  3IHQ B;  4RQ5 A;  1ZQB A;  4M04 A;  9ICU A;  3T3F A;  2P66 A;  8ICN A;  3FYH A;  3M8R A;  1BPD A;  5HML A;  4UQG A;  1NK6 A;  3EPI A;  4DL3 A;  3THV A;  5DB8 A;  3GQC A;  1NKB A;  9ICX A;  3RB0 A;  4DFM A;  5KG7 A;  3NTU A;  4YR3 A;  3AU6 A;  4UBC A;  5JUM A;  1SKR A;  3C2L A;  3G6V A;  3T5L A;  1C7Y A;  4RNM A;  4R65 A;  1B43 A;  2HVH A;  3AU2 A;  4F4W A;  4J9M A;  1ZQP A;  2FLP A;  4JV2 A;  4Q43 A;  1NKE A;  3SV3 A;  4EZ9 A;  5CHG A;  4MF8 A;  2R8J A;  2NRZ A;  3BQT A;  2AGP A;  4O5C A;  3H8W A;  1S0M A;  1MSW D;  1TAQ A;  4RNN A;  5J0Y A;  1SL1 A;  8ICF A;  1N48 A;  3JPR A;  2ZJ8 A;  3PR4 A;  4DQR A;  4C8L A;  3C5G A;  4HYK A;  1S0O A;  2H5X A;  1UA1 A;  1K1S A;  1TAU A;  4NLK A;  1JIH A;  3MR5 A;  3OGU A;  4TUP A;  1L3V A;  2NRT A;  4M2Y A;  4YMO A;  4F91 B;  2PXI A;  4DLE A;  4Z6F A;  4F5O A;  4DQI A;  5KFZ A;  9ICV A;  1D9D A;  4O3R A;  4KIT B;  1NOM A;  4QZE A;  5J2A A;  3OJS A;  2AGO A;  4P2H A;  3RBD A;  2C2R A;  2UVU A;  1B22 A;  4NM1 A;  4K4H A;  4JV1 A;  2F1H A;  5KG3 A;  3C5F A;  4R8U B;  3ISB A;  3Q8L A;  2HVI A;  5J2D A;  4KN7 A;  1BPB A;  4DQQ A;  5J29 A;  2HHW A;  2B21 A;  1JMS A;  1SKW A;  4O3S A;  2BR0 A;  2IBK A;  4C8M A;  5CR0 A;  2IA6 A;  2JEF A;  4P4M A;  7ICM A;  1WCN A;  5KFH A;  4YQW A;  3UPQ A;  4I2B A;  4NM2 A;  4F5R A;  3MDC A;  3PO5 A;  5KFL A;  4YVZ A;  3BQ0 A;  4YMM A;  4Q44 A;  7ICI A;  3TFS A;  1SL2 A;  1BPZ A;  1ZQT A;  4KLF A;  3T5K A;  5KG4 A;  5HHI A;  3H4B A;  1XSP A;  1D8L A;  1XS9 D;  1QSS A;  4TQR A;  1D8Y A;  2BCQ A;  5DQH A;  4ECW A;  4ED2 A;  7ICO A;  3PNC A;  1XSL A;  4E0D A;  5CP2 A;  4DL5 A;  2KZM A;  1RZT A;  7ICK A;  4QW8 A;  1QSL A;  4I28 A;  8ICX A;  4DS5 A;  2F1J A;  5C5J A;  5J0S A;  5BOL A;  7ICT A;  2BHN A;  5KFJ A;  4RQ6 A;  4FS2 A;  3RAX A;  1UA0 A;  2XGQ A;  2ZTD A;  5F9N A;  2XC9 A;  3UQ2 A;  5KFG A;  3KTQ A;  3C21 A;  3UXO A;  5J0Q A;  5J0X A;  4ECU A;  1LB2 B;  3MFH A;  1ZQV A;  4QZH A;  4I2I A;  4QWA A;  4J9Q A;  1XC9 A;  5KFE A;  1DGS A;  5DB9 A;  4ECS A;  3RRG A;  3QE9 Y;  4TUS A;  1UT5 A;  5EWE A;  5D46 A;  3JPN A;  1T7P A;  2ASD A;  5D4B A;  2AJQ A;  3N4M B;  5EWF A;  2BKE A;  5J0T A;  2FMS A;  3RB3 A;  3UXP A;  3GIJ A;  1ZJM A;  1X9W A;  4DFP A;  1ZQR A;  2PFP A;  9ICQ A;  4KLL A;  2XO7 A;  2HHS A;  3K4G A;  8ICS A;  1JN3 A;  5KFR A;  4RT3 A;  4O5K A;  3RBE A;  4ECR A;  4KLE A;  4RUA A;  3RJE A;  4P4O A;  1ZQE A;  7ICR A;  4RU9 A;  4O5E A;  2VA8 A;  5KFS A;  4GLX A;  4ECZ A;  1U9L A;  5KFW A;  3MR2 A;  1JX4 A;  4ED3 A;  4F3O A;  2PI4 A;  4F93 B;  2KZ3 A;  3KHL A;  4I2A A;  5HMM A;  1ZYQ A;  3TAR A;  1PZN A;  3HT3 A;  8ICP A;  4M9L A;  4EYH B;  9ICS A;  5KG1 A;  5KFV A;  4ED6 A;  2V4R A;  2W9B B;  4F4Y A;  1COO A;  3KHH A;  5L1I A;  1ZQX A;  9ICK A;  5J2G A;  4ECV A;  8ICU A;  4M9N A;  4NLZ A;  9ICO A;  4IQW A;  4DO9 A;  1X9S A;  2JEG A;  2DPJ A;  5KFM A;  4DWI A;  5J0P A;  1V9P A;  2RDJ A;  1U49 A;  4KLG A;  5TZV A;  3KHR A;  4KMU A;  3SV4 A;  4RQ0 A;  3GII A;  8ICE A;  1S0N A;  5J2K A;  3M8S A;  1KTQ A;  4YG2 A;  4RQ3 A;  1KEJ A;  1NJW A;  1MQ2 A;  2PFN A;  4ELU A;  8ICG A;  1ZET A;  4DSK A;  9ICI A;  1HUZ A;  4RPZ A;  3ZDC A;  3B0X A;  4RQ7 A;  3EZ5 A;  1Z3E B;  4P4P A;  4YD1 A;  1RXW A;  1ZQM A;  4RNO A;  1BVS A;  1DOQ A;  3LWM A;  3HPO A;  4KLS A;  1ZQJ A;  4GXK A;  2I1Q A;  3UXN A;  1Z00 B;  2NRV A;  4FBU A;  3QEB Z;  4ECX A;  4M0A A;  4Q8E A;  4JV0 A;  9ICN A;  4QZF A;  4ED1 A;  5KT5 A;  4RPY A;  5J2C A;  3SYZ A;  2PFQ A;  3HP6 A;  5KG5 A;  3KHG A;  2AQ4 A;  3EW9 A;  4RQ1 A;  2FMP A;  2ISP A;  2UVR A;  3IM1 A;  1WCL A;  4PGY A;  4F4X A;  5HP4 A;  5IIM A;  2W8L A;  1NJZ A;  5BOM A;  4QWC A;  1HJP A;  1KFS A;  1U48 A;  4XRH A;  5L1L A;  4B9N A;  2FMQ A;  4I2F A;  1KFT A;  4DL4 A;  3LK9 A;  3RH4 A;  4PHE A;  4PH5 A;  4DF4 A;  4QZB A;  4MEX A;  4KTQ A;  3RH5 A;  9ICH A;  4TQS A;  4M47 A;  4XA5 A;  2I9G A;  4I2E A;  4KLI A;  4QWD A;  4EBC A;  2BDP A;  1U4B A;  2FPK A;  4M6W B;  1CUK A;  5KFD A;  5KG0 A;  4R63 A;  5CA7 A;  1ZQL A;  7ICS A;  3RJF A;  1U47 A;  4UAZ A;  4ELV A;  4C8O A;  3GV5 B;  2DPI A;  5KT3 A;  2HHX A;  4YR2 A;  3TI0 A;  3Q8R B;  5KFY A;  1BPE A;  4M9J A;  5DDM A;  2HW3 A;  4IQT A;  8ICT A;  5KFP A;  1QSY A;  4KLO A;  2KFN A;  4YP3 A;  3JPS A;  2MAX A;  3V6H A;  1A76 A;  1EXN A;  2UVW A;  7ICP A;  4I2D A;  4MFF A;  7ICL A;  4F5N A;  3RJH A;  4BXO B;  4DL2 A;  5IIN A;  4MFC A;  1NK4 A;  4DSE A;  5DGB A;  1ZQI A;  3V7J A;  1ZQG A;  4I2C A;  3PVX A;  1NK0 A;  2LYH A;  3QEA Z;  7ICJ A;  4J9N A;  5J0W A;  1ZJN A;  3OSN A;  2XY6 A;  4KLJ A;  3C2M A;  5DBB A;  3H40 A;  4O3P A;  2BCU A;  1NJY A;  2HHV A;  2Q0Z X;  3MDA A;  2BPC A;  2PFO A;  8ICB A;  2VA3 A;  1RXV A;  3JPT A;  2GWS A;  2NRW A;  5DGA A;  1UT8 A;  4R8U A;  3RJG A;  2M9N A;  5KT2 A;  2MUT B;  3PW2 A;  4F2S A;  1T8E A;  5DG7 A;  4ECQ A;  5HHH A;  3GV8 B;  3ISD A;  2R8I A;  1T3N A;  1RYS A;  1TKD A;  4IRD A;  1X9M A;  9ICA A;  4IQU A;  4NY8 A;  9ICF A;  3Q8P B;  4J9K A;  3PX0 A;  5DG9 A;  3RH6 A;  3H8J A;  1NKC A;  2JZB B;  4F4Z A;  4DL7 A;  2BCV A;  1ZQZ A;  3H4D A;  2AU0 A;  1ZQY A;  4O3N A;  4J9P A;  4FS1 A;  4DOB A;  3ZDD A;  3MR3 A;  1SZP A;  4J9R A;  9ICP A;  3PX4 A;  3PW0 A;  3RB6 A;  4MEY A;  4PGQ A;  3PW7 A;  1ZQQ A;  3GIK A;  1SKS A;  3ZDA A;  2KZZ A;  4FBT A;  4QZ8 A;  3C23 A;  2ZUD A;  2BQR A;  2C2E A;  4BWJ A;  2A1J A;  7ICG A;  5KT7 A;  4XQ8 A;  3GIL A;  1S9F A;  2C28 A;  4M9G A;  5KTQ A;  2BCS A;  3N97 B;  5KFI A;  4F5P A;  4EEY A;  3RJJ A;  3FDS A;  4JUZ A;  3QZ8 A;  3OJU A;  2DFL A;  2KN7 A;  4DSJ A;  2F1I A;  5DKW A;  5J0O A;  4DQP A;  4YR0 A;  5III A;  3K75 D;  4TUQ A;  1KDH A;  4IRK A;  3PX6 A;  8ICJ A;  2KTQ A;  2C22 A;  4JK1 A;  8ICY A;  2J6U A; 
#chains in the Genus database with same CATH topology
 3PR5 B;  2JEI A;  3MR6 A;  2ES6 A;  1KFD A;  2YML A;  1X42 A;  2P6R A;  2ZJA A;  5ALQ A;  1Q3V A;  5BPC A;  1LV5 A;  2VAN A;  3MBY A;  1XSN A;  4M9H A;  3BDP A;  4R64 A;  4UAW A;  2W03 A;  1SV4 A;  1BGX T;  1CEZ A;  4EX6 A;  3GV7 B;  4USA A;  3T5J A;  3K1Z A;  1JI7 A;  4OO1 J;  1L6N A;  4YXM A;  1JXL A;  4RQN A;  4QZC A;  4I27 A;  5DG8 A;  4GXJ A;  2UVV A;  5HNK A;  4UAY A;  5L1J A;  1BPX A;  1URJ A;  2BPG A;  2KKP A;  4DLG A;  1A77 A;  2YTU A;  3SZ2 A;  3ONN A;  4QIW C;  1HUO A;  4DOC A;  5CJ7 A;  2DKX A;  4JMU A;  4KLT A;  3ETR A;  3V7L A;  2AGQ A;  5L1M A;  2XY5 A;  3T5H A;  9ICE A;  1S5L U;  2HDO A;  4YCX A;  2IHM A;  3KFU F;  1ZOL A;  2F8K A;  7ICN A;  4DFJ A;  1FIQ A;  4YFK A;  2XGP A;  4QJF B;  5KFB A;  1S10 A;  1Z1V A;  1TFR A;  4PGX A;  3T79 A;  3MFI A;  1PVQ A;  3Q8M A;  7ICU A;  1QQ7 A;  3PST A;  5J2B A;  1TK5 A;  3JPO A;  4PPX A;  2HBL A;  3Q8S B;  3WK5 A;  2XCA A;  2HOI A;  3ZDB A;  4QZ9 A;  3QU4 A;  4RUC A;  4YXJ A;  3KZX A;  4RT2 A;  2ATL A;  1PVR A;  1TK0 A;  1DXS A;  2EAM A;  4TUR A;  4DFK A;  9ICL A;  5C0Y A;  3OHB A;  2W54 A;  1NK7 A;  4EBD A;  3OTQ A;  1PK1 A;  4O3M A;  3QU5 A;  4DL6 A;  2W9A A;  1ZQN A;  4DOA A;  3WKD A;  4RZR A;  5KFF A;  3ISC A;  1L3U A;  3ETL A;  3TAD C;  3TQ1 A;  1KSP A;  4IQV A;  2G06 A;  5KAF U;  4B9T A;  1BPY A;  5ALG A;  2ZJ5 A;  2YY6 A;  4UB3 A;  3RR8 A;  2QKQ A;  2JMG A;  1ZQW A;  3MAB A;  4LVS A;  2KFZ A;  2ZTC A;  2JZB A;  2HHU A;  1TV9 A;  4QWB A;  3CYM A;  1ZRM A;  4RQ4 A;  1V97 A;  1QH9 A;  8ICI A;  5AKL A;  4F8R A;  2FPL A;  1K5O A;  5ALU A;  4KLQ A;  2F8L A;  4EBE A;  2K4H A;  1S97 A;  4GC6 A;  5D49 A;  5EWG A;  2V4Q A;  2C2D A;  2PI5 A;  3EWA A;  2E8O A;  4IRC A;  2P6U A;  4C80 A;  2J6S A;  4US8 A;  3RR7 A;  3QU2 A;  1IM4 A;  3AMZ A;  1NZP A;  3IHQ B;  2KSO A;  9ICU A;  3NUQ A;  3QXG A;  3IV6 A;  3FYH A;  1BPD A;  4UQG A;  3THV A;  3AU6 A;  4UBC A;  3C2L A;  1B43 A;  1ZQP A;  2KIV A;  5EE1 A;  4Q43 A;  3SV3 A;  2R8J A;  4UB8 U;  2AXT U;  3BQT A;  2LKY A;  5ALI A;  1TAQ A;  1L7N A;  5HR7 A;  1N48 A;  4CF4 A;  2JH1 A;  3JPR A;  4C8L A;  1RQN A;  4NLB A;  3C5G A;  1UA1 A;  1K1S A;  3N7S C;  3MR5 A;  5G5G A;  5HR6 A;  4O3R A;  4KIT B;  2E1E A;  2WB1 F;  2KKV A;  4AYB C;  3GZF A;  3C5F A;  4EEK A;  4PJ0 U;  2HHW A;  1Z4N A;  2QB0 B;  2MRL A;  1JMS A;  3SAH A;  7ICM A;  4YQW A;  4GFJ A;  4YVZ A;  3HJE A;  1ZD2 P;  1ZQT A;  2K8A A;  3ED5 A;  3N28 A;  1XSP A;  1D8L A;  5ALL A;  4ED2 A;  5AI4 A;  1XSL A;  4DL5 A;  2KZM A;  2WF9 A;  7ICK A;  4I28 A;  8ICX A;  4DS5 A;  5C5J A;  3UQ2 A;  4NL9 C;  4KX5 A;  1ECW A;  2QAR A;  3MFH A;  4QWA A;  4I2I A;  3N7R C;  5KFE A;  4ECS A;  1T7P A;  2BKE A;  3L4P A;  3RB3 A;  4US9 A;  2PKE A;  3GIJ A;  1X9W A;  1OUQ A;  3K4G A;  4C4R A;  8ICS A;  5AM2 A;  4Y2T A;  5KFR A;  4RT3 A;  4O5K A;  4ECR A;  2WF6 A;  2ZIX B;  3D2Q A;  4RU9 A;  2VA8 A;  4ECZ A;  3MR2 A;  4ED3 A;  4F93 B;  2KZ3 A;  4I2A A;  5HMM A;  4WJ3 B;  3TAR A;  1PZN A;  3TKA A;  1ZQX A;  5J2G A;  4C7Z A;  4KLG A;  5TZV A;  3F2D A;  1Q46 A;  3KHR A;  4KMU A;  1YZ7 A;  8ICE A;  4YG2 A;  1MQ2 A;  1KEJ A;  8ICG A;  2G0A A;  2G07 A;  2OXO A;  1ZET A;  4RPZ A;  3ZDC A;  3B0X A;  3EZ5 A;  2KHV A;  2H3F A;  1A0P A;  1ZQJ A;  2ZIU B;  3QEB Z;  4GIB A;  4QZF A;  5KT5 A;  3SYZ A;  4CF5 A;  2EQY A;  3DV9 A;  4UB6 U;  2KP7 A;  5BOM A;  4XRH A;  4B9N A;  4PH5 A;  4MEX A;  3H8M A;  4B6J A;  9ICH A;  3SR6 A;  4M47 A;  4RQM A;  1A6S A;  4I2E A;  4QWD A;  2FPK A;  4IL6 U;  4CDG A;  2DPI A;  2HHX A;  5DDM A;  1KW4 A;  5KFP A;  1ZQ1 C;  4YP3 A;  2VJ4 A;  4NV0 A;  2KMD A;  3I1Y A;  3PVX A;  4J9N A;  1OW5 A;  3OSN A;  4KLJ A;  2JHD A;  2QAR B;  3MDA A;  2VKQ A;  3HIL A;  3JPT A;  4R8U A;  2MUT B;  4F2S A;  1T8E A;  5DG7 A;  1TKD A;  1X9M A;  4IQU A;  5DG9 A;  3RH6 A;  2FI1 A;  1ZQZ A;  2AU0 A;  3A0H U;  1DK3 A;  3WK8 A;  3PW0 A;  4MEY A;  4PGQ A;  1RM6 C;  3C23 A;  2H3Q A;  2ZUD A;  2BQR A;  2E8N A;  5ALK A;  4M9G A;  2K4P A;  5JTI A;  2OH2 A;  2KIW A;  2DFL A;  3IDW A;  3F2B A;  5J0O A;  3PX6 A;  4JK1 A;  4OJP A;  5DDY A;  5J2I A;  4IR1 A;  5DB6 A;  3SMV A;  9ICG A;  3CRX A;  3GDX A;  1RYR A;  2BQ3 A;  3QUC A;  2G08 A;  3SD7 A;  2IMW P;  1ZQU A;  4KMO B;  4FO6 A;  8ICM A;  1WG8 A;  4JWN A;  7ICQ A;  1S0V A;  4F50 A;  2RLT A;  1NJX A;  3H0L B;  4BWM A;  2Y1J A;  1K1Q A;  1SIJ A;  2E8P A;  1PVP A;  2HHQ A;  3EUB 2;  1VLB A;  3HWT A;  2WF8 A;  5J2H A;  4NLN A;  2LPE A;  1N62 A;  2KOB A;  2ASJ A;  2CRX A;  5KG6 A;  2D3D A;  4Y2P A;  3GFK B;  4NLG A;  3BJY A;  3NVW A;  2L5Y A;  2KHQ A;  3K1R B;  1Z00 A;  2BCR A;  5EOZ A;  4Q8F A;  1F0M A;  1NK8 A;  2XI9 A;  1IXR A;  3PML A;  3ZD9 A;  3BS7 A;  3KBB A;  1QQ6 A;  2W7P A;  4LZG A;  1NK5 A;  4UB1 A;  1NK9 A;  3MGI A;  4LZD A;  3Q8Q B;  3FAH A;  1ZQK A;  3JPQ A;  1D9F A;  4Z6D A;  3SI8 A;  4C7Y A;  2ZUB A;  5KFU A;  2FPM A;  4DEZ A;  3C1Z A;  1TK8 A;  1BNO A;  3H0R B;  1ZQA A;  4DQS A;  1ZD3 A;  1QLN A;  2CXY A;  3BQ7 A;  3AM9 A;  2H3I A;  4Z6C A;  3O0F A;  5AKX A;  2KV2 A;  2NRX A;  4BGD A;  5ALR A;  8ICH A;  4QZI A;  4C0Z A;  4UAV A;  5ALJ A;  5KFO A;  4BUG A;  2KVS A;  3KKA A;  2K89 A;  3PW4 A;  2FLN A;  1N60 A;  3D2N A;  2MU2 A;  2IHN A;  4EEL A;  5J2E A;  4DSF A;  3RJI A;  1J2N A;  5AIC A;  5KFX A;  4C8N A;  2HMX A;  2DGZ A;  5AM0 A;  2KVC A;  3IG5 A;  3WK6 A;  4P0P A;  9ICB A;  5TIS U;  1ZQD A;  3LVV A;  4ED7 A;  3TFR A;  1YT3 A;  4F2R A;  1Q3U A;  1U45 A;  2WTF A;  4Z6E A;  1ZQH A;  3V7K A;  1XO1 A;  2HBK A;  3BQ2 A;  2ZIV A;  1S76 D;  4ED0 A;  2AQ0 A;  4YMN A;  3JPP A;  5CWR A;  4Y2V A;  5AM4 A;  3TAQ A;  1ZQO A;  1SL0 A;  2LYA A;  3WK4 A;  2HBM A;  4GC7 A;  4CE6 A;  4O3Q A;  1ZQB A;  3IP4 B;  2P66 A;  2BZF A;  5HML A;  3EPI A;  1KKX A;  5DB8 A;  4HAI A;  2NO5 A;  5JUM A;  4IS7 A;  1SKR A;  5AIA A;  4RNM A;  4F4W A;  4J9M A;  2GLE A;  2W7O A;  1NKE A;  4MF8 A;  2A19 A;  2NRZ A;  2AGP A;  1S0M A;  3QUB A;  1N63 A;  2DF4 B;  2H3V A;  3PR4 A;  2H5X A;  1JIH A;  2KNJ A;  2PXI A;  3F5E A;  4FZL A;  4DQI A;  5J2A A;  1NOM A;  3OJS A;  1L8O A;  2C2R A;  1X6I A;  5AK3 A;  3BZC A;  4JV1 A;  3KZI U;  4OCZ A;  3ISB A;  1BPB A;  5J29 A;  2B21 A;  2EDU A;  4C8M A;  3NVV A;  4MHV A;  2IOF A;  4P4M A;  1WCN A;  5KFH A;  4I2B A;  1L7P A;  3PO5 A;  3MDC A;  5KFL A;  1BPZ A;  2F3N A;  3T5K A;  5HHI A;  1XS9 D;  1D8Y A;  4TQR A;  2ZIW B;  4BJQ A;  3PNC A;  2LBO A;  1RZT A;  2LMR A;  3MGV A;  1J2M A;  5BOL A;  2BHN A;  5KFJ A;  4RQ6 A;  1UA0 A;  3KTQ A;  2XGQ A;  3C21 A;  1MN8 A;  3UXO A;  5J0Q A;  4ECU A;  2WFA A;  4J9Q A;  5DB9 A;  3JPN A;  5EWF A;  1ZQR A;  4DFP A;  1M6Y A;  1T94 A;  2W11 A;  1Q8K A;  4J03 A;  2ZIV B;  5ALN A;  2MSN A;  2D6F C;  3H0M B;  2WHE A;  1TAM A;  3F2C A;  3KHL A;  5ALM A;  3D2S A;  3HT3 A;  4M9L A;  9ICS A;  1LKY A;  2KIC A;  2Y0S C;  4OJ6 A;  9ICO A;  4IQW A;  3FM9 A;  1X9S A;  2JEG A;  1V9P A;  1U49 A;  3VC8 A;  3SV4 A;  2JV3 A;  1HEK A;  1C20 A;  4RQ3 A;  9ICI A;  1Z3E B;  4YD1 A;  2JGA A;  1BVS A;  3WK7 A;  2I1Q A;  5B5E U;  2WF7 A;  4ED1 A;  4CRX A;  1WUD A;  2KE7 A;  2A1A A;  4RQ1 A;  2ISP A;  3IM1 A;  5HP4 A;  3PSF A;  1U48 A;  1KFT A;  2Y9U A;  4DL4 A;  3RH4 A;  2G09 A;  4DF4 A;  4QZB A;  3NVZ A;  4TQS A;  1X40 A;  1X6J A;  2I9G A;  3QNM A;  2BDU A;  5KG0 A;  1ZQL A;  2KK0 A;  1U47 A;  4ELV A;  3QU9 A;  3GV5 B;  5KT3 A;  4M9J A;  8ICT A;  3CNH A;  4NLC A;  2HOQ A;  1KBU A;  3V6H A;  1A76 A;  2W43 A;  4I2D A;  1PK1 B;  3WKA A;  3RJH A;  4DL2 A;  1ZQI A;  3V7J A;  4I2C A;  3CW2 C;  1NK0 A;  4Y2R A;  4PL1 A;  5EE3 A;  3C2M A;  4O3P A;  2BCU A;  2HHV A;  2BPC A;  2PFO A;  4UAT A;  1RXV A;  1UT8 A;  3PW2 A;  4ECQ A;  3GV8 B;  1RYS A;  5AKJ A;  9ICA A;  3Q8P B;  4FZM A;  2RHF A;  4LJX A;  1QCK A;  1NKC A;  2JZB B;  4F4Z A;  4DL7 A;  3H4D A;  3QX7 A;  4O3N A;  4J9P A;  4DOB A;  3ZDD A;  1SZP A;  4J9R A;  9ICP A;  5F3X B;  3RB6 A;  1ZQQ A;  2KZZ A;  3PW7 A;  1SKS A;  1IIP A;  3ZDA A;  4QZ8 A;  3KKA C;  4CGZ A;  4BWJ A;  2A1J A;  2PMZ C;  5KT7 A;  3N97 B;  5KFI A;  1B4F A;  2KN7 A;  4DSJ A;  3N7P D;  5DKW A;  1LKY B;  4DQP A;  5III A;  3K75 D;  2C22 A;  2F77 X;  8ICY A;  2J6U A;  1JAL A;  3C2K A;  2K60 A;  3NGD A;  2OYY A;  3M1Y A;  4ZH4 A;  3E0F A;  2KSO B;  1FFV A;  2ZTE A;  4CCH A;  3PV8 A;  2ASL A;  4EZ6 A;  3Q8K A;  3NS1 A;  4UBB A;  3EPG A;  5L1K A;  5IIO A;  5E79 U;  3BQ1 A;  5J0R A;  3AUO A;  4F92 B;  3TAP A;  4QZG A;  5J0U A;  4OJO A;  4O0I A;  3NRW A;  5J2F A;  5KFN A;  3G6Y A;  3V6J A;  4ED8 A;  2F44 A;  1Z4O A;  2XCP A;  3IRU A;  5DQI A;  5KT4 A;  1ARO P;  3M6K A;  4KLH A;  2E8M A;  5A0L A;  3M9M B;  2HI0 A;  7ICE A;  5H2F U;  3GU3 A;  7ICF A;  9ICJ A;  7ICS A;  4NWI A;  2JEJ A;  3ZD8 A;  4J9L A;  4J9O A;  4QZD A;  4GXI A;  3HKZ C;  2V9W A;  3ICX A;  5KL1 B;  4RQ2 A;  1SB3 C;  1V85 A;  3LDA A;  3B9J A;  4QNL A;  5JRT A;  3C28 A;  5KFT A;  3M9O B;  2ALZ A;  5KT6 A;  3PW5 A;  5ALX A;  1KN5 A;  5KAI U;  2Y1I A;  7ICH A;  2JR5 A;  3RF9 A;  4M6W A;  1X9X A;  2LI6 A;  8ICZ A;  3HW8 A;  4KN4 A;  1JUD A;  4B9M A;  2W8K A;  1OXJ A;  4UB2 A;  4F5Q A;  4BDP A;  1ZD5 A;  4RQ8 A;  1ZQF A;  5DLG A;  3OSP A;  2FDR A;  9ICR A;  3WK9 A;  1RPL A;  1COK A;  2QB1 A;  2I6X A;  1H38 A;  3RB4 A;  1F44 A;  2LYB A;  2WF5 A;  5F9L A;  4EYI B;  3H7I A;  3SQI A;  5AKK A;  5IIL A;  2R8K A;  4BXO A;  4PHP A;  4RPX A;  2VA2 A;  4B9S A;  2A1J B;  4X5V A;  4MFA A;  2D8C A;  2EH9 A;  4UB5 A;  2KJ5 A;  4B9V A;  2EAO A;  2LM4 A;  1S8O A;  9ICC A;  5KFC A;  3ZDE A;  4J9S A;  4ECT A;  2RDI A;  4YD2 A;  4B9U A;  2G5H B;  4CNQ A;  5DLF A;  3HX0 A;  2BQU A;  1T4G A;  1XWL A;  5DBA A;  1D8B A;  7ICV A;  4YN4 A;  3M7D A;  1RG6 A;  1X2I A;  5CB1 A;  4DSL A;  1N5X A;  3PO4 A;  5IIJ A;  1SXE A;  3E2E A;  8ICW A;  4JWM A;  3AEV A;  5DBC A;  2YQE A;  4UB4 A;  3UQ0 A;  3PSI A;  5AM1 A;  4IR9 A;  5KFK A;  2LHT A;  2R8H A;  2YX8 A;  8ICC A;  1NZB A;  1L3S A;  9ICW A;  2W9B A;  3WKC A;  8ICN A;  1NK6 A;  3M8R A;  4AP9 A;  2I5H A;  3GQC A;  9ICX A;  2Z7J A;  3RB0 A;  1C7Y A;  3G6V A;  1KL9 A;  3T5L A;  4PZO A;  5K4L A;  3AU2 A;  4JV2 A;  2NYV A;  1WYG A;  5KNI A;  4U7C A;  1FO4 A;  2EAP A;  3I28 A;  2FJ6 A;  5AI8 A;  1IV8 A;  4RNN A;  3FC4 A;  5J0Y A;  5GTH U;  1SL1 A;  8ICF A;  2Y0S F;  2EZY A;  4OJL A;  3NRZ A;  5ALF A;  4M2Y A;  4YMO A;  3RFA A;  4DLE A;  4Z6F A;  4F5O A;  2VJ5 A;  1YZ6 A;  4QZE A;  3RBD A;  2UVU A;  1B22 A;  2F1H A;  4R8U B;  3Q8L A;  2HVI A;  2AHO B;  1SKW A;  4O3S A;  2IBK A;  4UW9 A;  4Y2U A;  2KD1 A;  2XVT A;  4NM2 A;  4F5R A;  3TFS A;  1SL2 A;  1QSS A;  5DQH A;  7ICO A;  3BZK A;  2RQ5 A;  2F1J A;  5J0S A;  4FS2 A;  5F9N A;  5KFG A;  1LB2 B;  1B0X A;  5ALE A;  3CP8 A;  2K8C B;  4QZH A;  1T3Q A;  1UT5 A;  5EWE A;  5D46 A;  2ASD A;  5D4B A;  2AJQ A;  3N4M B;  2FMS A;  4Y2Q A;  4KLL A;  2HHS A;  1N61 A;  5GTI U;  1V38 A;  3RBE A;  4KLE A;  3ALR A;  3RJE A;  4P4O A;  7ICR A;  3UM9 A;  4U6P A;  2RP5 A;  2NO4 A;  4GLX A;  5KFW A;  4OD0 A;  4Y2X A;  2Y9T A;  5AKZ A;  2JH7 A;  3WKE A;  1SV0 A;  5AI6 A;  1NI3 A;  1ZYQ A;  3HRD D;  1DGJ A;  4EYH B;  1TE2 A;  4ED6 A;  2W9B B;  4F4Y A;  4M9N A;  4NLZ A;  4DO9 A;  1JRP A;  1S0N A;  5J2K A;  1NJW A;  2PFN A;  2ZXI A;  4DSK A;  4RQ7 A;  4P4P A;  5ALV A;  1XO0 A;  1RXW A;  4UAU A;  3LWM A;  1VDV A;  2PMZ F;  4GXK A;  1Z00 B;  2NRV A;  4JV0 A;  1SGG A;  9ICN A;  3HP6 A;  5KG5 A;  3AQF A;  3KHG A;  2FMP A;  2W3R A;  2UVR A;  1WCL A;  4PGY A;  4F4X A;  4NJ8 A;  2W8L A;  5IIM A;  1NJZ A;  4QWC A;  5AM5 A;  1KFS A;  3OPX A;  4I2F A;  5ALY A;  2E3T A;  2ODG A;  4KLI A;  1P7D A;  2HBJ A;  1U4B A;  5KFD A;  4R63 A;  5B66 U;  3LYS A;  4UAS A;  4YR2 A;  2YMM A;  5KFY A;  1BPE A;  4IQT A;  2GO7 A;  1X66 A;  2KFN A;  2N1R A;  3D6J A;  3NVY A;  4EEN A;  2UVW A;  3SAG A;  5J8Y A;  4PL2 A;  5DGB A;  1ZQG A;  2HCF A;  2LYH A;  3QEA Z;  1KQQ A;  3F5A A;  5J0W A;  1ZJN A;  2B0C A;  5DBB A;  3H40 A;  1NJY A;  4PZN A;  5JU5 A;  8ICB A;  2VA3 A;  5ALT A;  2RRD A;  3RJG A;  2M9N A;  3KD3 A;  1J97 A;  2XID A;  2QB0 A;  2WAQ C;  5HHH A;  3ISD A;  2R8I A;  1T3N A;  4IRD A;  9ICF A;  3HKZ F;  4J9K A;  3PX0 A;  3IN5 A;  3H8J A;  3WKB A;  2BCV A;  1LVH A;  2HOF A;  1ZQY A;  3I76 A;  5AKE A;  4P0P B;  3PX4 A;  5AKG A;  7ICG A;  3GIL A;  2C28 A;  5KTQ A;  5AI5 A;  4EEY A;  4F5P A;  3BS5 A;  2HSZ A;  4YR0 A;  2KTQ A;  2W9C A;  2XY7 A;  4C8K A;  4F4K A;  4R66 A;  4ECY A;  4PHA A;  3PMN A;  4I29 A;  4F72 A;  5KFA A;  3TAN A;  2ZIX A;  3QZ7 A;  2W55 A;  2W04 A;  1MQ3 A;  3RJK A;  5AKI A;  3UMC A;  1L5U A;  2DBY A;  1SZH A;  1Z19 A;  5AKH A;  2OHF A;  4KLU A;  2J6T A;  4P0Q A;  3M9N B;  3F53 A;  5FP0 A;  3C1Y A;  4PHD A;  1RYU A;  3V72 A;  4Q45 A;  2FE9 A;  1N2X A;  4I2J A;  4Y2S A;  3V6K A;  2BPF A;  4DFD A;  3QUQ A;  5DQG A;  2E5S A;  3RTV A;  9ICM A;  3OHA A;  2ZIU A;  1IG6 A;  4QW9 A;  4ELT A;  2K8B B;  5DB7 A;  4MF2 A;  8ICQ A;  4G3I A;  3PY8 A;  2DQN B;  1ZQC A;  2VIX A;  1SWV A;  2FLL A;  4A8E A;  4ACO A;  1NNL A;  1L7M A;  9ICT A;  1KRP A;  2F76 X;  4DF8 A;  4K4G A;  1KLN A;  3QYP A;  3UMG A;  8ICO A;  2GH1 A;  4XUS A;  1DK2 A;  3LVW A;  2Q4T A;  4QZA A;  3MGH A;  2HHT A;  3EYZ A;  4EX7 A;  3LWL A;  1TVA A;  3SEN A;  8ICK A;  2LM1 A;  4I2H A;  4ICA A;  3R9K A;  3KOO A;  4UAR A;  4KLM A;  2R18 A;  5L9X A;  2QLT A;  3TAC B;  4NXZ A;  1JXE A;  1S77 D;  3BS5 B;  4O9M A;  5KG2 A;  5EE9 A;  3H8S A;  2W9M A;  2E1F A;  1MC8 A;  2W9C B;  3ZI4 A;  2F2A B;  1Y88 A;  2OWO A;  2MUT A;  2YB4 A;  4FZN A;  3PZP A;  1N56 A;  8ICV A;  1L3T A;  4CF3 A;  1XU4 A;  2YMP A;  4DSI A;  1F5S A;  2OCE A;  4QWE A;  2AH5 A;  3AQE A;  3S6J A;  3RRH A;  4O3O A;  4B9L A;  1CRX A;  4DS4 A;  1SV0 C;  4I2G A;  1WWV A;  5IIK A;  2BGW A;  3C29 A;  1ZQS A;  1UCV A;  2MA1 A;  3ORY A;  2G5I B;  8ICA A;  5J2J A;  4P0Q B;  3U26 A;  3B0Y A;  5AM3 A;  8ICR A;  3G6X A;  1GO3 F;  4Y2J A;  8ICL A;  5KFQ A;  2ZUC A;  4KLD A;  3GIM A;  1QTM A;  1SXD A;  3RAQ A;  2ISO A;  4K4I A;  2R8G A;  2W3S A;  5AK4 A;  2KJ8 A;  4RQ5 A;  4M04 A;  5ALZ A;  3T3F A;  1HIW A;  4DL3 A;  1NKB A;  4DFM A;  5KG7 A;  3NTU A;  4YR3 A;  1VJ5 A;  4C4T A;  2HVH A;  4R65 A;  2FLP A;  5ALS A;  2OM6 A;  3M6Z A;  4EZ9 A;  5CHG A;  3VCB A;  4F71 A;  2NV3 A;  4O5C A;  3H8W A;  4DCC A;  1MSW D;  1L8L A;  2P35 A;  4BX9 C;  2GOL A;  5AI0 A;  2ZJ8 A;  4DQR A;  4HYK A;  3L5K A;  1S0O A;  3J81 j;  2ZG6 A;  1TAU A;  4NLK A;  3OGU A;  3IG8 A;  4TUP A;  1L3V A;  2NRT A;  4F91 B;  2DL0 A;  1ED1 A;  2JRZ A;  5KFZ A;  9ICV A;  1D9D A;  2IOH A;  5AHX A;  2AGO A;  4P2H A;  2EZZ A;  1UPH A;  4NM1 A;  3MC1 A;  4K4H A;  5KG3 A;  5J2D A;  4KN7 A;  4DQQ A;  2IOF K;  5J8Y C;  5G5H A;  2BR0 A;  2IA6 A;  5CR0 A;  2JEF A;  3UPQ A;  1QQ5 A;  3BQ0 A;  4YMM A;  4Q44 A;  7ICI A;  2CPR A;  4KLF A;  2YB1 A;  5KG4 A;  5ALW A;  1ZXI A;  3H4B A;  4QIW F;  2BCQ A;  4ECW A;  5CEH A;  4E0D A;  5CP2 A;  4QW8 A;  1QSL A;  3SAF A;  5AI9 A;  1UQV A;  7ICT A;  1UHU A;  3RAX A;  4G9B A;  2ZTD A;  2XC9 A;  1SWW A;  5T14 A;  5J0X A;  1O03 A;  4IC9 A;  3TAD A;  1DRG A;  2JXJ A;  1ZQV A;  1XC9 A;  1DGS A;  4JB3 A;  3RRG A;  3QE9 Y;  1FEZ A;  4TUS A;  5J0T A;  1PUZ A;  3UXP A;  1ZJM A;  5AKY A;  2PFP A;  9ICQ A;  2XO7 A;  2DWQ A;  3QU7 A;  1JN3 A;  1ZD4 A;  5ALO A;  1WWU A;  4RUA A;  1BNP A;  1ZQE A;  4O5E A;  5KFS A;  1U9L A;  1JX4 A;  4F3O A;  2PI4 A;  3QUT A;  5ALP A;  4KX3 A;  8ICP A;  5KG1 A;  5KFV A;  1RDF A;  2EAN A;  5ALD A;  2V4R A;  2WAQ F;  1COO A;  3KHH A;  5L1I A;  2DKZ A;  9ICK A;  2EZX A;  4ECV A;  8ICU A;  3PSP A;  1FFU A;  2DPJ A;  5CRX A;  5KFM A;  4DWI A;  5J0P A;  2RDJ A;  4FFD A;  2DUY A;  4RQ0 A;  3GII A;  2H3Z A;  3M8S A;  1KTQ A;  3E58 A;  1Z1B A;  4ELU A;  2WB1 C;  1HUZ A;  1ZQM A;  4RNO A;  3DEE A;  1DOQ A;  3HPO A;  4KLS A;  3UXN A;  4ZOH C;  5AK5 A;  4FBU A;  4ECX A;  4M0A A;  4Q8E A;  3UMB A;  2XIC A;  4RPY A;  5J2C A;  2PFQ A;  2AQ4 A;  3EW9 A;  3WU2 U;  1HJP A;  1ZRN A;  2K4E A;  5L1L A;  2FMQ A;  3LK9 A;  4PHE A;  4KTQ A;  3RH5 A;  1O08 A;  4XA5 A;  3DDH A;  5KL8 B;  4EBC A;  2BDP A;  3AN1 A;  5EE0 A;  4M6W B;  1CUK A;  4FE3 A;  5CA7 A;  4Y2Y A;  5ALH A;  3A0B U;  3RJF A;  2ZXH A;  4UAZ A;  4C8O A;  3SEI A;  3TI0 A;  3Q8R B;  3L3F X;  2A3V A;  2HW3 A;  1N5W A;  1QSY A;  4KLO A;  3JPS A;  2MAX A;  1EXN A;  1XNS A;  2YN4 A;  7ICP A;  2KJ9 A;  2ESE A;  4MFF A;  7ICL A;  4F5N A;  4BXO B;  1JRO A;  5IIN A;  1MA7 A;  4MFC A;  1NK4 A;  1RQL A;  4DSE A;  2KEY A;  7ICJ A;  2XY6 A;  2K4I A;  2CN1 A;  2Q0Z X;  1CI4 A;  2GWS A;  2NRW A;  5DGA A;  5AK6 A;  5KT2 A;  4OJ5 A;  3NAS A;  1L7O A;  5AIB A;  3AL0 B;  4NY8 A;  4NL9 A;  4FS1 A;  3MR3 A;  2OEH A;  2O6K A;  4C4S A;  3GIK A;  4FBT A;  2ZIW A;  2C2E A;  2B6G A;  4XQ8 A;  4AYB F;  1S9F A;  2BCS A;  2M0N A;  3RJJ A;  2KG5 A;  3FDS A;  4JUZ A;  3QZ8 A;  3OJU A;  2F1I A;  2YMQ A;  4IRK A;  4TUQ A;  1KDH A;  1PK3 A;  1AQ6 A;  8ICJ A; 
#chains in the Genus database with same CATH homology
 3C2K A;  3PR5 B;  2W9C A;  2XY7 A;  5DDY A;  4C8K A;  2JEI A;  5J2I A;  3NGD A;  4IR1 A;  4F4K A;  3MR6 A;  1KFD A;  4R66 A;  4ZH4 A;  5DB6 A;  2P6R A;  2ZJA A;  4ECY A;  9ICG A;  2ZTE A;  5BPC A;  4PHA A;  3GDX A;  3PV8 A;  2BQ3 A;  2ASL A;  1RYR A;  1LV5 A;  4CCH A;  3PMN A;  4EZ6 A;  2VAN A;  3Q8K A;  2IMW P;  1ZQU A;  3MBY A;  4I29 A;  1XSN A;  4UBB A;  4M9H A;  3BDP A;  3EPG A;  4R64 A;  5KFA A;  5L1K A;  4UAW A;  3TAN A;  5IIO A;  4FO6 A;  8ICM A;  1BGX T;  1CEZ A;  3BQ1 A;  4JWN A;  3GV7 B;  3QZ7 A;  7ICQ A;  5J0R A;  3AUO A;  3T5J A;  1MQ3 A;  4F92 B;  1S0V A;  3RJK A;  3TAP A;  4QZG A;  5J0U A;  1L5U A;  4F50 A;  4YXM A;  4O0I A;  1JXL A;  5J2F A;  4QZC A;  5KFN A;  3G6Y A;  1NJX A;  4BWM A;  3V6J A;  2Y1J A;  1K1Q A;  4I27 A;  5DG8 A;  4GXJ A;  2UVV A;  4ED8 A;  4KLU A;  2J6T A;  2HHQ A;  5HNK A;  4UAY A;  3M9N B;  5L1J A;  3HWT A;  1BPX A;  2XCP A;  3C1Y A;  5J2H A;  2BPG A;  4PHD A;  4NLN A;  4DLG A;  5DQI A;  5KT4 A;  1A77 A;  1ARO P;  3V72 A;  4KLH A;  3SZ2 A;  1HUO A;  4DOC A;  4Q45 A;  5CJ7 A;  2ASJ A;  3M9M B;  5KG6 A;  7ICE A;  4I2J A;  3V6K A;  2BPF A;  3V7L A;  3GFK B;  2AGQ A;  3BJY A;  5DQG A;  4NLG A;  4KLT A;  7ICF A;  9ICJ A;  2XY5 A;  3RTV A;  2JEJ A;  3T5H A;  9ICM A;  3OHA A;  9ICE A;  1Z00 A;  3ZD8 A;  4QW9 A;  4J9L A;  4YCX A;  5EOZ A;  2BCR A;  2IHM A;  4ELT A;  4Q8F A;  4J9O A;  1NK8 A;  7ICN A;  1IXR A;  5DB7 A;  4QZD A;  3PML A;  4GXI A;  4DFJ A;  4MF2 A;  8ICQ A;  2V9W A;  3ZD9 A;  4YFK A;  2XGP A;  4G3I A;  3PY8 A;  4RQ2 A;  5KFB A;  4LZG A;  3LDA A;  1S10 A;  1TFR A;  1NK5 A;  1ZQC A;  4PGX A;  4UB1 A;  2FLL A;  1NK9 A;  5KFT A;  3MGI A;  4LZD A;  3Q8Q B;  3MFI A;  3M9O B;  3Q8M A;  2ALZ A;  1ZQK A;  9ICT A;  7ICU A;  5KT6 A;  3JPQ A;  5J2B A;  3PW5 A;  1TK5 A;  1D9F A;  4Z6D A;  3JPO A;  3SI8 A;  2Y1I A;  1KRP A;  2ZUB A;  5KFU A;  7ICH A;  4DF8 A;  4K4G A;  4M6W A;  2FPM A;  4PPX A;  8ICZ A;  1KLN A;  3HW8 A;  4KN4 A;  4DEZ A;  3Q8S B;  2XCA A;  3ZDB A;  4QZ9 A;  8ICO A;  4B9M A;  4XUS A;  2W8K A;  3C1Z A;  4YXJ A;  4RUC A;  4QZA A;  4RT2 A;  3MGH A;  4UB2 A;  4F5Q A;  4BDP A;  2HHT A;  4RQ8 A;  1ZQF A;  5DLG A;  3OSP A;  3EYZ A;  1TK8 A;  9ICR A;  2ATL A;  3LWL A;  1TVA A;  1RPL A;  8ICK A;  1TK0 A;  1H38 A;  3RB4 A;  1ZQA A;  4I2H A;  4TUR A;  4DQS A;  4DFK A;  5F9L A;  1QLN A;  9ICL A;  4KLM A;  3OHB A;  4EYI B;  3H7I A;  4EBD A;  1NK7 A;  5IIL A;  2R8K A;  4BXO A;  5L9X A;  4Z6C A;  4PHP A;  4RPX A;  2W9A A;  4DL6 A;  1ZQN A;  4DOA A;  2A1J B;  4X5V A;  2VA2 A;  4B9S A;  4MFA A;  4NXZ A;  1JXE A;  2NRX A;  4RZR A;  4BGD A;  5KFF A;  3ISC A;  4UB5 A;  1S77 D;  1L3U A;  8ICH A;  4O9M A;  5KG2 A;  3ETL A;  3TQ1 A;  1KSP A;  4B9V A;  4IQV A;  4QZI A;  4B9T A;  3H8S A;  1BPY A;  2W9M A;  5KFO A;  9ICC A;  2ZJ5 A;  1MC8 A;  3PW4 A;  2W9C B;  2FLN A;  4UB3 A;  3RR8 A;  1ZQW A;  1Y88 A;  3ZDE A;  5KFC A;  2MUT A;  4J9S A;  4ECT A;  1N56 A;  2OWO A;  2RDI A;  4YD2 A;  3MAB A;  1L3T A;  2IHN A;  8ICV A;  5J2E A;  4B9U A;  1XU4 A;  4DSI A;  4LVS A;  4DSF A;  5DLF A;  3RJI A;  4QWE A;  3HX0 A;  2BQU A;  2KFZ A;  5KFX A;  3RRH A;  2ZTC A;  1T4G A;  4O3O A;  4C8N A;  2JZB A;  2HHU A;  1TV9 A;  1XWL A;  4QWB A;  5DBA A;  7ICV A;  4B9L A;  9ICB A;  4YN4 A;  4RQ4 A;  1ZQD A;  5CB1 A;  1X2I A;  4DS4 A;  4DSL A;  4I2G A;  4ED7 A;  3TFR A;  8ICI A;  4F2R A;  4F8R A;  1U45 A;  2WTF A;  5IIK A;  2FPL A;  3PO4 A;  4Z6E A;  5IIJ A;  2BGW A;  1ZQH A;  3V7K A;  1XO1 A;  1ZQS A;  4KLQ A;  3BQ2 A;  1S76 D;  4EBE A;  4ED0 A;  3ORY A;  1S97 A;  2AQ0 A;  4YMN A;  3JPP A;  4GC6 A;  3E2E A;  5CWR A;  5D49 A;  5EWG A;  4JWM A;  8ICW A;  2V4Q A;  2C2D A;  8ICA A;  5J2J A;  2PI5 A;  3EWA A;  5DBC A;  3TAQ A;  1ZQO A;  4UB4 A;  3UQ0 A;  3B0Y A;  8ICR A;  1SL0 A;  3G6X A;  4IRC A;  2P6U A;  8ICL A;  5KFQ A;  2ZUC A;  4IR9 A;  5KFK A;  4KLD A;  2R8H A;  2J6S A;  3GIM A;  1QTM A;  8ICC A;  3RAQ A;  1L3S A;  4GC7 A;  2ISO A;  3RR7 A;  2W9B A;  2R8G A;  4K4I A;  9ICW A;  1IM4 A;  4O3Q A;  3IHQ B;  4RQ5 A;  1ZQB A;  4M04 A;  9ICU A;  3T3F A;  2P66 A;  8ICN A;  3FYH A;  3M8R A;  1BPD A;  5HML A;  4UQG A;  1NK6 A;  3EPI A;  4DL3 A;  3THV A;  5DB8 A;  3GQC A;  1NKB A;  9ICX A;  3RB0 A;  4DFM A;  5KG7 A;  3NTU A;  4YR3 A;  3AU6 A;  4UBC A;  5JUM A;  1SKR A;  3C2L A;  3G6V A;  3T5L A;  1C7Y A;  4RNM A;  4R65 A;  1B43 A;  2HVH A;  3AU2 A;  4F4W A;  4J9M A;  1ZQP A;  2FLP A;  4JV2 A;  4Q43 A;  1NKE A;  3SV3 A;  4EZ9 A;  5CHG A;  4MF8 A;  2R8J A;  2NRZ A;  3BQT A;  2AGP A;  4O5C A;  3H8W A;  1S0M A;  1MSW D;  1TAQ A;  4RNN A;  5J0Y A;  1SL1 A;  8ICF A;  1N48 A;  3JPR A;  2ZJ8 A;  3PR4 A;  4DQR A;  4C8L A;  3C5G A;  4HYK A;  1S0O A;  2H5X A;  1UA1 A;  1K1S A;  1TAU A;  4NLK A;  1JIH A;  3MR5 A;  3OGU A;  4TUP A;  1L3V A;  2NRT A;  4M2Y A;  4YMO A;  4F91 B;  2PXI A;  4DLE A;  4Z6F A;  4F5O A;  4DQI A;  5KFZ A;  9ICV A;  1D9D A;  4O3R A;  4KIT B;  1NOM A;  4QZE A;  5J2A A;  3OJS A;  2AGO A;  4P2H A;  3RBD A;  2C2R A;  2UVU A;  1B22 A;  4NM1 A;  4K4H A;  4JV1 A;  2F1H A;  5KG3 A;  3C5F A;  4R8U B;  3ISB A;  3Q8L A;  2HVI A;  5J2D A;  4KN7 A;  1BPB A;  4DQQ A;  5J29 A;  2HHW A;  2B21 A;  1JMS A;  1SKW A;  4O3S A;  2BR0 A;  2IBK A;  4C8M A;  5CR0 A;  2IA6 A;  2JEF A;  4P4M A;  7ICM A;  1WCN A;  5KFH A;  4YQW A;  3UPQ A;  4I2B A;  4NM2 A;  4F5R A;  3MDC A;  3PO5 A;  5KFL A;  4YVZ A;  3BQ0 A;  4YMM A;  4Q44 A;  7ICI A;  3TFS A;  1SL2 A;  1BPZ A;  1ZQT A;  4KLF A;  3T5K A;  5KG4 A;  5HHI A;  3H4B A;  1XSP A;  1D8L A;  1XS9 D;  1QSS A;  4TQR A;  1D8Y A;  2BCQ A;  5DQH A;  4ECW A;  4ED2 A;  7ICO A;  3PNC A;  1XSL A;  4E0D A;  5CP2 A;  4DL5 A;  2KZM A;  1RZT A;  7ICK A;  4QW8 A;  1QSL A;  4I28 A;  8ICX A;  4DS5 A;  2F1J A;  5C5J A;  5J0S A;  5BOL A;  7ICT A;  2BHN A;  5KFJ A;  4RQ6 A;  4FS2 A;  3RAX A;  1UA0 A;  2XGQ A;  2ZTD A;  5F9N A;  2XC9 A;  3UQ2 A;  5KFG A;  3KTQ A;  3C21 A;  3UXO A;  5J0Q A;  5J0X A;  4ECU A;  1LB2 B;  3MFH A;  1ZQV A;  4QZH A;  4I2I A;  4QWA A;  4J9Q A;  1XC9 A;  5KFE A;  1DGS A;  5DB9 A;  4ECS A;  3RRG A;  3QE9 Y;  4TUS A;  1UT5 A;  5EWE A;  5D46 A;  3JPN A;  1T7P A;  2ASD A;  5D4B A;  2AJQ A;  3N4M B;  5EWF A;  2BKE A;  5J0T A;  2FMS A;  3RB3 A;  3UXP A;  3GIJ A;  1ZJM A;  1X9W A;  4DFP A;  1ZQR A;  2PFP A;  9ICQ A;  4KLL A;  2XO7 A;  2HHS A;  3K4G A;  8ICS A;  1JN3 A;  5KFR A;  4RT3 A;  4O5K A;  3RBE A;  4ECR A;  4KLE A;  4RUA A;  3RJE A;  4P4O A;  1ZQE A;  7ICR A;  4RU9 A;  4O5E A;  2VA8 A;  5KFS A;  4GLX A;  4ECZ A;  1U9L A;  5KFW A;  3MR2 A;  1JX4 A;  4ED3 A;  4F3O A;  2PI4 A;  4F93 B;  2KZ3 A;  3KHL A;  4I2A A;  5HMM A;  1ZYQ A;  3TAR A;  1PZN A;  3HT3 A;  8ICP A;  4M9L A;  4EYH B;  9ICS A;  5KG1 A;  5KFV A;  4ED6 A;  2V4R A;  2W9B B;  4F4Y A;  1COO A;  3KHH A;  5L1I A;  1ZQX A;  9ICK A;  5J2G A;  4ECV A;  8ICU A;  4M9N A;  4NLZ A;  9ICO A;  4IQW A;  4DO9 A;  1X9S A;  2JEG A;  2DPJ A;  5KFM A;  4DWI A;  5J0P A;  1V9P A;  2RDJ A;  1U49 A;  4KLG A;  5TZV A;  3KHR A;  4KMU A;  3SV4 A;  4RQ0 A;  3GII A;  8ICE A;  1S0N A;  5J2K A;  3M8S A;  1KTQ A;  4YG2 A;  4RQ3 A;  1KEJ A;  1NJW A;  1MQ2 A;  2PFN A;  4ELU A;  8ICG A;  1ZET A;  4DSK A;  9ICI A;  1HUZ A;  4RPZ A;  3ZDC A;  3B0X A;  4RQ7 A;  3EZ5 A;  1Z3E B;  4P4P A;  4YD1 A;  1RXW A;  1ZQM A;  4RNO A;  1BVS A;  1DOQ A;  3LWM A;  3HPO A;  4KLS A;  1ZQJ A;  4GXK A;  2I1Q A;  3UXN A;  1Z00 B;  2NRV A;  4FBU A;  3QEB Z;  4ECX A;  4M0A A;  4Q8E A;  4JV0 A;  9ICN A;  4QZF A;  4ED1 A;  5KT5 A;  4RPY A;  5J2C A;  3SYZ A;  2PFQ A;  3HP6 A;  5KG5 A;  3KHG A;  2AQ4 A;  3EW9 A;  4RQ1 A;  2FMP A;  2ISP A;  2UVR A;  3IM1 A;  1WCL A;  4PGY A;  4F4X A;  5HP4 A;  5IIM A;  2W8L A;  1NJZ A;  5BOM A;  4QWC A;  1HJP A;  1KFS A;  1U48 A;  4XRH A;  5L1L A;  4B9N A;  2FMQ A;  4I2F A;  1KFT A;  4DL4 A;  3LK9 A;  3RH4 A;  4PHE A;  4PH5 A;  4DF4 A;  4QZB A;  4MEX A;  4KTQ A;  3RH5 A;  9ICH A;  4TQS A;  4M47 A;  4XA5 A;  2I9G A;  4I2E A;  4KLI A;  4QWD A;  4EBC A;  2BDP A;  1U4B A;  2FPK A;  4M6W B;  1CUK A;  5KFD A;  5KG0 A;  4R63 A;  5CA7 A;  1ZQL A;  7ICS A;  3RJF A;  1U47 A;  4UAZ A;  4ELV A;  4C8O A;  3GV5 B;  2DPI A;  5KT3 A;  2HHX A;  4YR2 A;  3TI0 A;  3Q8R B;  5KFY A;  1BPE A;  4M9J A;  5DDM A;  2HW3 A;  4IQT A;  8ICT A;  5KFP A;  1QSY A;  4KLO A;  2KFN A;  4YP3 A;  3JPS A;  2MAX A;  3V6H A;  1A76 A;  1EXN A;  2UVW A;  7ICP A;  4I2D A;  4MFF A;  7ICL A;  4F5N A;  3RJH A;  4BXO B;  4DL2 A;  5IIN A;  4MFC A;  1NK4 A;  4DSE A;  5DGB A;  1ZQI A;  3V7J A;  1ZQG A;  4I2C A;  3PVX A;  1NK0 A;  2LYH A;  3QEA Z;  7ICJ A;  4J9N A;  5J0W A;  1ZJN A;  3OSN A;  2XY6 A;  4KLJ A;  3C2M A;  5DBB A;  3H40 A;  4O3P A;  2BCU A;  1NJY A;  2HHV A;  2Q0Z X;  3MDA A;  2BPC A;  2PFO A;  8ICB A;  2VA3 A;  1RXV A;  3JPT A;  2GWS A;  2NRW A;  5DGA A;  1UT8 A;  4R8U A;  3RJG A;  2M9N A;  5KT2 A;  2MUT B;  3PW2 A;  4F2S A;  1T8E A;  5DG7 A;  4ECQ A;  5HHH A;  3GV8 B;  3ISD A;  2R8I A;  1T3N A;  1RYS A;  1TKD A;  4IRD A;  1X9M A;  9ICA A;  4IQU A;  4NY8 A;  9ICF A;  3Q8P B;  4J9K A;  3PX0 A;  5DG9 A;  3RH6 A;  3H8J A;  1NKC A;  2JZB B;  4F4Z A;  4DL7 A;  2BCV A;  1ZQZ A;  3H4D A;  2AU0 A;  1ZQY A;  4O3N A;  4J9P A;  4FS1 A;  4DOB A;  3ZDD A;  3MR3 A;  1SZP A;  4J9R A;  9ICP A;  3PX4 A;  3PW0 A;  3RB6 A;  4MEY A;  4PGQ A;  3PW7 A;  1ZQQ A;  3GIK A;  1SKS A;  3ZDA A;  2KZZ A;  4FBT A;  4QZ8 A;  3C23 A;  2ZUD A;  2BQR A;  2C2E A;  4BWJ A;  2A1J A;  7ICG A;  5KT7 A;  4XQ8 A;  3GIL A;  1S9F A;  2C28 A;  4M9G A;  5KTQ A;  2BCS A;  3N97 B;  5KFI A;  4F5P A;  4EEY A;  3RJJ A;  3FDS A;  4JUZ A;  3QZ8 A;  3OJU A;  2DFL A;  2KN7 A;  4DSJ A;  2F1I A;  5DKW A;  5J0O A;  4DQP A;  4YR0 A;  5III A;  3K75 D;  4TUQ A;  1KDH A;  4IRK A;  3PX6 A;  8ICJ A;  2KTQ A;  2C22 A;  4JK1 A;  8ICY A;  2J6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...