2LYHA

Structure of faap24 residues 141-215
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Fanconi anemia-associated protein of 24 kDa
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2lyhA00
3UXOA 1ZJNA 1S76D 8ICKA 3OHAA 5J2HA 2W9BA 1MC8A 1TKDA 4IR1A 3RJHA 3RJKA 2OWOA 3NTUA 2KTQA 2BPGA 4DSLA 9ICMA 1HUZA 2ZJ8A 4YP3A 2PI5A 3T5JA 7ICUA 4YVZA 5TZVA 4DO9A 2KZMA 5EWEA 4QZEA 5L1LA 4P2HA 4MF8A 5EWGA 3RB4A 1NJWA 4RQ2A 4DQQA 3ZDCA 5KFOA 1ZYQA 5KG4A 4QW9A 3MGHA 4I2DA 3PO5A 5DDMA 3GV8B 2P66A 3OSNA 1EXNA 4QZAA 1UT5A 3PNCA 4I2EA 4QZ9A 5KT2A 2J6UA 1TK5A 4DSEA 2ZJ5A 3MFHA 3OSPA 2ASJA 2ZJAA 1KTQA 5DB9A 2BCUA 3EWAA 4B9MA 2IMWP 4ELTA 3RJJA 3FDSA 4GLXA 8ICNA 7ICRA 3BQTA 5KT6A 2HHQA 4RUCA 4RNNA 4EBEA 4DL5A 4P4MA 1LV5A 3K75D 1WCLA 4B9TA 8ICUA 3MBYA 5KFKA 2DPIA 3B0YA 4G3IA 1KEJA 4QZIA 4XRHA 4TQRA 3QZ8A 4DF4A 3PW0A 1NJYA 1ZQPA 5HHIA 5KFBA 4ED1A 7ICSA 2Y1IA 1QTMA 9ICJA 1JMSA 4ELVA 4O5EA 1NK8A 1S97A 1RZTA 8ICXA 1Z00A 2XO7A 8ICGA 8ICRA 5J0UA 1TV9A 4KLSA 4EZ6A 3RBDA 3BQ1A 4DFPA 4F5QA 8ICFA 4YMOA 5KT5A 4K4GA 5F9LA 2Q0ZX 4LVSA 3GIIA 3ZD8A 4I27A 3MDAA 1C7YA 4EEYA 1SKRA 1N56A 2BKEA 5KFMA 4JV2A 1ZQYA 3M9MB 4B9LA 1X9WA 4JK1A 3SI8A 3RR7A 4M2YA 5KG1A 2ALZA 2C2DA 2BPFA 3Q8SB 4F2SA 4RQ0A 5DQGA 3OHBA 3RB0A 4DQIA 3JPQA 1AROP 4TQSA 5J2AA 4Q8EA 1RXWA 1TAUA 1ZQDA 1WCNA 5DB7A 1D8LA 9ICXA 3RJGA 3LK9A 2BCVA 1BVSA 3PW2A 5KFSA 3PMNA 4C8MA 2JZBB 2F1HA 5KFLA 2XY7A 1ZQNA 4B9SA 5KG3A 3GILA 3TANA 8ICIA 2XY5A 2ZTDA 2FMPA 2UVRA 3MR6A 4PHEA 4RQ4A 4B9NA 7ICMA 2V9WA 1NK9A 1B22A 3AU2A 1JN3A 1SKSA 3C5FA 4DSKA 1HUOA 3ZD9A 4Q44A 5DQHA 4DFJA 1XWLA 2ATLA 3SYZA 9ICUA 4O3NA 5KFPA 2R8HA 3ZDBA 4I2IA 4IQWA 4R65A 4IRKA 2BPCA 4GXKA 1XSPA 2ISPA 1A77A 1JIHA 4O3RA 4YXJA 3C2LA 2HHVA 8ICSA 2BGWA 1ZQVA 5KFJA 5KFHA 1KFTA 4KTQA 4QZHA 4DL2A 9ICOA 1UT8A 4DQPA 5DG7A 2BCSA 1S77D 2Y1JA 4FS2A 5JUMA 4RNMA 3PW4A 1UA1A 3BQ0A 4DL6A 4ED8A 2MUTB 8ICCA 2KFNA 1KFDA 3RAXA 4RNOA 1D8YA 3KHRA 4YD2A 3GV5B 2BHNA 7ICEA 1NK6A 3HT3A 3ZDEA 5HHHA 1ZQWA 2NRVA 4R66A 4UAZA 3UQ0A 1MQ3A 4ED7A 2PFPA 4DFMA 4M9JA 3RH5A 4M04A 5D49A 4Z6CA 3PY8A 4PHDA 1ZQMA 4YCXA 7ICGA 4F4KA 3V6JA 3QEBZ 8ICWA 1T3NA 3EYZA 2BQUA 4I2CA 1SKWA 3RAQA 3LWLA 5J2JA 3MR5A 2FMQA 2J6TA 1ZJMA 2P6UA 5J2CA 5DLFA 4KLJA 3Q8PB 1ZQRA 2HHSA 1ZQXA 3C1ZA 4DWIA 4IQVA 1JXEA 1ZQTA 3RH4A 4O3OA 4UAYA 3SV3A 1XSLA 4KMUA 3Q8MA 1U49A 3PX6A 3RBEA 4GXJA 2AGPA 2ZTEA 2PFQA 1XU4A 4IQUA 3TFRA 1L3TA 4J9NA 2UVVA 3C23A 1K1QA 3G6YA 4DEZA 1U9LA 1BPBA 5KTQA 1ZQQA 9ICAA 3TAPA 4DQSA 7ICTA 1T7PA 4ED6A 2NRWA 4YMMA 2W9CA 1JXLA 1MSWD 3RJFA 2HW3A 4FBTA 4M47A 2I1QA 2GWSA 4X5VA 3RTVA 3AU6A 1BPYA 9ICPA 4DSJA 4UBBA 2I9GA 3H8SA 4KN4A 4P4OA 3TAQA 2ISOA 2JEJA 5IIJA 4F5OA 1D9FA 2AU0A 4ECUA 2ASLA 2H5XA 3JPTA 3M8SA 5KT4A 5EWFA 3PX4A 4BDPA 3N97B 3MGIA 9ICSA 5J0RA 3ISCA 3OGUA 4KLLA 3M9NB 8ICVA 3KHLA 5KFAA 2NRTA 2IHMA 2NRZA 5DQIA 3GIMA 1TK8A 1RXVA 4O0IA 1H38A 2F1IA 2A1JB 2W9CB 2W8KA 3TFSA 4M9NA 4KLGA 3PVXA 4QZGA 2C28A 5HMLA 1L3UA 2IBKA 4K4HA 9ICIA 5DGBA 4EYIB 4DOAA 1L3SA 4O5KA 5J0SA 4EBCA 3EPIA 4F4YA 4FS1A 2P6RA 3H40A 7ICNA 1RYSA 1ZQIA 4XQ8A 5KFEA 4TURA 2XGQA 4JV0A 4NLZA 4J9OA 5J29A 3QEAZ 4KLIA 5IIOA 2XY6A 4QWDA 2ZTCA 3Q8LA 1D9DA 4DQRA 5KFQA 5DG9A 1ZQJA 4RPYA 4O3QA 1ZQAA 9ICKA 4Q8FA 1QSYA 4F4WA 4RQ1A 2W9BB 3RRHA 4KLFA 4QZBA 3C21A 2AQ0A 1L3VA 4LZGA 2R8IA 2J6SA 4YQWA 4YR2A 3AUOA 1S9FA 2HVIA 3H4BA 4YG2A 5J2FA 9ICTA 4DSFA 4YR0A 3MDCA 4ECXA 1S0NA 9ICGA 1IXRA 5HMMA 1XC9A 1KSPA 3Q8QB 4DL7A 2PFOA 8ICAA 5DLGA 5J2DA 4DLEA 4F5PA 1IM4A 4IQTA 3UPQA 5IINA 4QWBA 4J9QA 4KLUA 3HPOA 1TFRA 4E0DA 8ICYA 4YD1A 1XSNA 3SZ2A 4FO6A 4F3OA 5DG8A 3GIKA 5J2BA 5IIIA 3C2KA 4DL4A 4RQ8A 3G6XA 5KFNA 4F5NA 4XUSA 5DGAA 1BPDA 4UBCA 2AGQA 5KFZA 5J2KA 4P4PA 4UB3A 1BPEA 5CR0A 2WTFA 3T5LA 1ZQLA 8ICPA 4F4XA 4J9LA 1K1SA 4O5CA 4M9LA 4NY8A 5DB6A 5KFTA 3H8WA 2HHUA 3T5HA 4PGXA 3N4MB 4R63A 4Z6EA 2DFLA 5KT3A 4RU9A 1U47A 2KZ3A 3PR5B 4KLEA 3JPPA 4IRDA 4UB5A 2XCAA 2JEIA 1QLNA 5CWRA 4BXOA 4UB2A 3RR8A 1ZETA 5KFVA 4DOBA 4I29A 4Z6DA 4IR9A 2HHWA 2FPKA 4NM2A 1S0VA 1SZPA 4PGQA 3IHQB 2VANA 1Z3EB 4MFAA 3MR2A 4QZ8A 4DSIA 3TQ1A 2V4QA 4HYKA 4RPXA 5KG7A 4ZH4A 3GFKB 2XCPA 3M9OB 1NKEA 2JEFA 4J9MA 5IIKA 2C2RA 5J0XA 3JPRA 2W9AA 2VA2A 3BJYA 3T3FA 4MEXA 3GDXA 4M0AA 3V72A 5KFXA 5J2GA 4GXIA 1NK4A 2UVUA 5DB8A 4QWAA 2BCQA 8ICMA 3HX0A 3PMLA 5DBBA 4YXMA 4TUPA 4ECWA 2VA8A 4C8OA 4KLTA 4UB1A 7ICPA 7ICOA 2FLNA 4C8KA 3PW5A 3RH6A 4NLNA 8ICOA 1X9MA 3GQCA 3TARA 2KN7A 4C8LA 4F91B 4RT2A 2RDIA 3HWTA 3Q8KA 4PGYA 3V7JA 1ZQKA 4NXZA 5KG2A 2C2EA 2XC9A 4MFCA 1CEZA 1NK5A 1KDHA 4ED2A 3EPGA 1LB2B 4KLDA 4EZ9A 2A1JA 1NK7A 1QSSA 8ICQA 8ICZA 3ISDA 5EOZA 2HHXA 4MF2A 4DS5A 2BR0A 1TVAA 4KLHA 3H7IA 4Q43A 5L9XA 5L1IA 3ZDAA 4UQGA 3KTQA 1ZQCA 3LDAA 4LZDA 4DFKA 2AGOA 1BPZA 8ICLA 4YFKA 1A76A 5J0PA 4ED3A 4PHAA 3MFIA 3UQ2A 2VA3A 4O3PA 5KFYA 1KFSA 1DOQA 1NOMA 3GIJA 3RJEA 1ZQOA 7ICIA 5J2IA 2NRXA 5HP4A 2BDPA 3G6VA 2W8LA 4ECTA 1HJPA 4QWEA 2HVHA 2KZZA 1U4BA 4UB4A 1L5UA 4RZRA 1X2IA 1Y88A 3V6HA 4O3SA 4RQ5A 4ECSA 3PR4A 4EBDA 4F93B 1SL2A 5CB1A 3UXNA 3ISBA 4MFFA 5KT7A 3KHGA 3V7KA 5KFWA 4K4IA 1U48A 8ICJA 1NKBA 1RYRA 4J9RA 9ICWA 2JEGA 1QSLA 2IA6A 3C1YA 3PV8A 3BQ2A 4TUQA 3Q8RB 3H8JA 4DOCA 5J0TA 3JPOA 4DF8A 2HHTA 5KFRA 9ICQA 5DBCA 3QZ7A 1TAQA 4M6WA 4BGDA 3C5GA 4QWCA 4DS4A 3LWMA 8ICEA 3THVA 2IHNA 3RB3A 8ICHA 4DL3A 5J0QA 1BGXT 1BPXA 4O9MA 3TI0A 4KITB 4JWMA 3KHHA 9ICNA 4RUAA 1TK0A 1ZQHA 4ED0A 1B43A 2LYHA 4QZFA 5J0YA 2PI4A 4I2BA 3MABA 9ICFA 2JZBA 4ECQA 4ECVA 3ZDDA 3IM1A 5KFDA 4F92B 2R8KA 4IRCA 3C2MA 2ZUDA 5KFGA 1MQ2A 4M9GA 4NM1A 3V7LA 4QZCA 2F1JA 5L1JA 1ZQEA 1ZQFA 4CCHA 2MAXA 3V6KA 2AJQA 4Q45A 3JPNA 3HW8A 4F8RA 1XS9D 3NGDA 4PPXA 9ICLA 4RQ3A 5KFFA 3FYHA 3BDPA 3PO4A 2B21A 4FBUA 4KLMA 5DBAA 7ICHA 2V4RA 4GC7A 1KRPA 5DKWA 1DGSA 4EYHB 3ORYA 3E2EA 2UVWA 2PXIA 5KFIA 3RB6A 7ICJA 1PZNA 1N48A 5D4BA 4C8NA 1SL1A 4ECYA 7ICQA 4RT3A 2FLPA 1V9PA 1SL0A 4TUSA 4Z6FA 5IIMA 5J0WA 3OJSA 1NKCA 1ZQGA 2FLLA 2BCRA 1CUKA 4YN4A 3PW7A 5CHGA 4GC6A 1NJZA 2C22A 5KG5A 3RRGA 4MEYA 2R8GA 9ICEA 1X9SA 1S0MA 1ZQSA 4RQ7A 1ZQUA 3ETLA 4R8UB 2BQ3A 4KLOA 5KFUA 4I2GA 1JX4A 4NLKA 9ICHA 4PHPA 9ICCA 4F2RA 3EW9A 9ICVA 5F9NA 4F50A 1S10A 2ZUCA 1UA0A 4M6WB 4BWJA 4R8UA 4YR3A 2AQ4A 4UAWA 2R8JA 3H4DA 1COOA 1XO1A 3UXPA 5IILA 4KLQA 8ICBA 4YMNA 7ICLA 1NK0A 8ICTA 2ZUBA 4PH5A 3M8RA 4BXOB 5CJ7A 3PX0A 3RJIA 9ICRA 3K4GA 4JUZA 3SV4A 1NJXA 1U45A 4BWMA 7ICVA 3T5KA 4J9SA 4JV1A 5BPCA 2MUTA 4ECZA 5KG0A 1T4GA 1T8EA 2FMSA 5C5JA 4B9UA 7ICFA 2FPMA 3EZ5A 5D46A 5L1KA 4QW8A 5J2EA 3GV7B 2FPLA 3MR3A 2DPJA 4R64A 4JWNA 2M9NA 7ICKA 1Z00B 1ZQZA 2W9MA 4KN7A 4ECRA 1ZQBA 4M9HA 4I2FA 3QE9Y 4ELUA 4F5RA 1RPLA 4NLGA 4QZDA 3HP6A 5CA7A 5KFCA 5BOMA 3JPSA 2ASDA 5BOLA 2PFNA 4DLGA 5KG6A 4B9VA 2KFZA 3B0XA 4F4ZA 1KLNA 4RPZA 4I28A 4I2JA 4J9PA 4RQ6A 5J0OA 2XGPA 4XA5A 5CP2A 5HNKA 2RDJA 4J9KA 2BQRA 5DDYA 4I2HA 3OJUA 4I2AA 9ICBA 1S0OA
chains in the Genus database with same CATH superfamily
3UXOA 3AEVA 1TKDA 2RHFA 4GFJA 2OWOA 2F8KA 4BUGA 4YP3A 3WK4A 1WWVA 4YVZA 5TZVA 2KZMA 5EWEA 4QZEA 4MHVA 3ZDCA 1ZYQA 3WK7A 5ALKA 3GZFA 2ODGA 1FFVA 5DDMA 2P66A 3OSNA 4C0ZA 1UT5A 2H3FA 2ASJA 2BCUA 4B9MA 2RRDA 3FDSA 4GLXA 3BQTA 2JMGA 2FDRA 2ZIUA 5ALIA 1WCLA 2KVCA 4FZMA 5ALLA 4XRHA 3QZ8A 1NJYA 2ESEA 1KW4A 1KL9A 9ICJA 3KFUF 3BS5A 1S97A 2XO7A 2KJ5A 1CRXA 2HOFA 8ICGA 1L6NA 5EE0A 1TV9A 4K4GA 5F9LA 3MDAA 5KFMA 3M9MB 1L8LA 3SI8A 4M2YA 2KSOA 4F2SA 5DQGA 2QB0A 4DQIA 5J2AA 1RXWA 1WCNA 3F53A 5FP0A 3LK9A 3PW2A 1ZQNA 2V9WA 1SKSA 4DSKA 3C5FA 4Q44A 2ATLA 5DQHA 4I2IA 3IN5A 4IQWA 1S8OA 4IRKA 4GXKA 1XSPA 2ISPA 2EZXA 3QU5A 8ICSA 2IOFA 2WF6A 4Y2UA 5KFHA 2W43A 5L1MA 2MU2A 2BCSA 5ALGA 2Y1JA 3SR6A 5AI6A 5JUMA 1UA1A 2HBLA 1N61A 1D8YA 3FC4A 3KHRA 2NO5A 5HHHA 1ZQWA 2NRVA 3RH5A 2XICA 4PHDA 1ZQMA 7ICGA 3E58A 8ICWA 2ZXHA 3EYZA 4I2CA 3RAQA 2HSZA 2F76X 2FMQA 4USAA 1L7NA 4DWIA 4IQVA 3AMZA 1ZQTA 5KAFU 3RH4A 2GLEA 1D8BA 1U49A 2KEYA 4GXJA 2ZTEA 2PFQA 1L3TA 2N1RA 3BS7A 4DEZA 7ICTA 4YMMA 1JXLA 1MSWD 2GWSA 1X9XA 4X5VA 4UBBA 2I9GA 4P4OA 2ISOA 3KKAA 4ECUA 3JPTA 5EE9A 5KT4A 4CF5A 1SXEA 5AM5A 3ISCA 4EEKA 3M9NB 1QCKA 2BDUA 2K8CB 2NRZA 5DQIA 4KX5A 1TK8A 2EAMA 1RXVA 1H38A 4OCZA 1Z1VA 4KLGA 1SB3C 4QZGA 2IBKA 4K4HA 2EANA 4EYIB 4DOAA 4EBCA 3QX7A 1SV0C 1RYSA 2XGQA 2CXYA 5J29A 4KLIA 5IIOA 4QWDA 5KFQA 5DG9A 5AKKA 3RRHA 4KLFA 3C21A 2J6SA 1SV4A 1ZXIA 3AUOA 9ICTA 3H4BA 5J2FA 2W3SA 1S0NA 2QB1A 1KSPA 3Q8QB 4DLEA 4F5PA 5IINA 2KG5A 3HPOA 1XSNA 3GIKA 4DL4A 3C2KA 4UB3A 5CR0A 1ZQLA 3T5LA 4O5CA 4M9LA 2EAOA 2DL0A 2YQEA 3TADC 4R63A 4Z6EA 5KT3A 3SAGA 3JPPA 4C4RA 4UB5A 1X40A 5ALVA 1QLNA 5CWRA 5ALWA 2JH1A 1QQ5A 4I29A 4Z6DA 2FPKA 2CPRA 1L8OA 3IHQB 1Z3EB 4NLCA 3MR2A 3BQ7A 5ALJA 3TQ1A 5KG7A 4Q8EA 2XCPA 3M9OB 4J9MA 1IV8A 5J0XA 3E0FA 2Y0SF 2EQYA 4C8OA 2XVTA 7ICOA 2WAQF 2FLNA 8ICOA 3GQCA 5KNIA 4F91B 1N5WA 3V7JA 1NK5A 1KDHA 2A1JA 5A0LA 3ZDAA 4UW9A 3EUB2 8ICLA 4YFKA 2EH9A 2W54A 1NOMA 1ZQOA 2K4HA 2NRXA 2ZG6A 3BZKA 2HVHA 3KOOA 1U4BA 1L5UA 4RZRA 1X2IA 4O3SA 5GTIU 1SL2A 5KFWA 4K4IA 1NKBA 1RYRA 2F2AB 2JEGA 1QSLA 3C1YA 3H8JA 4DOCA 5J0TA 1A6SA 3UM9A 3KZXA 2K4EA 1SWWA 2IHNA 3RB3A 8ICHA 1BPXA 2DGZA 5C0YA 1DK2A 4RUAA 1B43A 2MSNA 2JZBA 3ZDDA 4FZLA 3SQIA 2R8KA 2ZUDA 2F1JA 2MAXA 3JPNA 1XS9D 3BDPA 3FYHA 1DXSA 3D2NA 5DBAA 2V4RA 1P7DA 3H8MA 2PXIA 3D6JA 5D4BA 1SL1A 2YB4A 4RT3A 5AIBA 4TUSA 1WUDA 3H0RB 2BCRA 1CUKA 3QUTA 9ICEA 1VLBA 4RQMA 3QUCA 1S0MA 1ZQUA 4R8UB 2F3NA 4PHPA 4F2RA 4BWJA 4R8UA 3S6JA 1T94A 2KK0A 2AQ4A 1NK0A 3UMCA 5J8YC 4BXOB 9ICRA 4JUZA 2A1AA 4UAVA 2H3IA 4OJ6A 5BPCA 4ECZA 1T8EA 1T4GA 4B9UA 7ICFA 2FPMA 1Q3UA 3EZ5A 5D46A 3RFAA 7ICKA 1ZQZA 4ECRA 4M9HA 3BS5B 4CE6A 2G07A 3PSIA 3WKAA 4ELUA 2DUYA 3JPSA 2KFZA 4RPZA 2FJ6A 1XNSA 4J9KA 2XGPA 5J0OA 2RDJA 5CP2A 5HNKA 3VC8A 4I2HA 8ICRA 9ICBA 9ICWA 1CI4A 4CF3A 4QJFB 1DGJA 1MC8A 5ALMA 3RJKA 3FAHA 2BPGA 3NVVA 7ICUA 2ZIXA 5L1LA 3RB4A 5KFOA 3IRUA 3IDWA 3PO5A 1EXNA 3SENA 1Q8KA 4QIWF 1TK5A 3MFHA 3OSPA 2YMMA 2E8OA 1KTQA 2IMWP 3D2QA 4ELTA 3DEEA 2KKVA 7ICRA 2HHQA 5KFKA 2DPIA 1IIPA 4DF4A 5AKXA 5KFBA 3L5KA 1JMSA 4AP9A 4ACOA 2LYAA 8ICXA 1Z00A 4JB3A 4JMUA 2E8NA 4F5QA 4ICAA 4YMOA 4B6JA 2KHVA 3ZD8A 4I27A 1UHUA 3C29A 4NL9C 2NO4A 4RQNA 4GIBA 2E8PA 1RQLA 3Q8SB 5AI5A 4OJLA 2XI9A 1BNOA 3L3FX 4TQSA 1ZQDA 5DB7A 4IL6U 1BVSA 5KFLA 2JZBB 2XY7A 3GILA 8ICIA 4PHEA 5ALEA 1F5SA 2EAPA 1JN3A 4DFJA 1XWLA 3SYZA 2G0AA 2W11A 5KFPA 3ZDBA 2CN1A 3WK8A 2BPCA 2HHVA 2BGWA 1KFTA 4KTQA 2WF5A 3BZCA 2KE7A 1VJ5A 4DQPA 2DWQA 5AM3A 5DG7A 1S77D 3QXGA 3LVWA 5AKEA 2Q4TA 4Y2VA 3BQ0A 4ED8A 2KFNA 4AYBC 1KFDA 4UAUA 4YD2A 3GV5B 2BHNA 1NK6A 3HT3A 4M9JA 4UAZA 1MQ3A 1KQQA 4ED7A 1X42A 3V6JA 3QEBZ 1T3NA 1SKWA 2K4IA 3MR5A 1ZJMA 5J2CA 5DLFA 3AN1A 3C1ZA 5AKJA 3SV3A 3Q8MA 3QUBA 1DK3A 5EE1A 4C7YA 1BPBA 2YY6A 3TAPA 4DQSA 4EENA 2JGAA 5ALXA 4ED6A 2NRWA 3RJFA 1UQVA 3IP4B 4FBTA 2I1QA 2LYBA 2HOIA 3NRWA 5G5GA 2FI1A 3TAQA 3H8SA 2YN4A 3A0BU 2H3ZA 4LJXA 2JEJA 5IIJA 2I5HA 1ZD4A 2ASLA 2H5XA 2WHEA 3M8SA 3HKZF 4BDPA 3OGUA 8ICVA 3KHLA 5KFAA 3PVXA 2C28A 2W04A 1L3UA 2EZYA 2LM1A 2W3RA 3EPIA 4FS1A 2P6RA 1ZQIA 5AK6A 4TURA 4XQ8A 5KFEA 4UB6U 4OJOA 2GH1A 2YMPA 3MC1A 4RQ1A 1L3VA 2AQ0A 4LZGA 4YR2A 2G5IB 1L7MA 2LPEA 4DSFA 3MDCA 4ECXA 9ICGA 1QH9A 2G06A 1AQ6A 1IM4A 1RQNA 1TFRA 1PVPA 8ICYA 2WF9A 4Y2JA 5IIIA 3G6XA 2VKQA 3SAHA 5DGAA 1BPDA 1RYUA 2AGQA 5KFZA 2WTFA 1HEKA 1K1SA 3H8WA 2HHUA 5HR6A 5ALSA 4RU9A 2KZ3A 4KLEA 1UCVA 3HILA 4PZOA 4BXOA 1SZHA 5KFVA 4IR9A 5AM1A 2D3DA 1Z1BA 4NM2A 1SZPA 2H3QA 1YZ7A 2B6GA 5AI9A 4RPXA 3RJJA 3GFKB 2JEFA 2KJ9A 2W9AA 3JPRA 3GDXA 3V72A 5KFXA 2UVUA 3TACB 5DB8A 3H0MB 4QWAA 3O0FA 3PMLA 5DBBA 4YXMA 4TUPA 4KLTA 7ICPA 2DBYA 4C8KA 3PW5A 4NLNA 2YMLA 4CRXA 2KN7A 3N28A 2RDIA 2W7PA 2D8CA 3KBBA 1ZQKA 3NS1A 4NXZA 3RF9A 5KG2A 2XC9A 3EPGA 3F5EA 8ICQA 8ICZA 2F44A 5EOZA 2HHXA 4MF2A 5E79U 2LKYA 3H7IA 2ZIUB 4LZDA 4U6PA 1BPZA 1JROA 2W7OA 4PHAA 3MFIA 3UQ2A 4O3PA 5KFYA 1KFSA 3QU9A 5J2IA 5ALDA 2W8LA 3AQEA 2KZZA 3ZI4A 1JUDA 4EX7A 4ECSA 4FZNA 3UXNA 3ISBA 1X66A 4G9BA 1U48A 4F72A 1RDFA 2KD1A 2O6KA 2IA6A 3PV8A 4TUQA 5JU5A 4P0QA 2OEHA 9ICQA 1TAQA 4M6WA 4NJ8A 3THVA 4DL3A 5J0QA 3TI0A 3KHHA 9ICNA 1ZQHA 3QU4A 4ED0A 2LYHA 4P0PA 2HCFA 3DV9A 4I2BA 3NUQA 9ICFA 4ECQA 4IRCA 3C2MA 2AJQA 2HBMA 5AI0A 5KFFA 3PO4A 2B21A 4KLMA 4GC7A 3GU3A 1PZNA 4Z6FA 3OJSA 4YN4A 3PW7A 5CHGA 4GC6A 1NJZA 2C22A 2R8GA 1X9SA 2DQNB 1FEZA 2YX8A 5ALNA 1V38A 3D2SA 4I2GA 1JX4A 2DF4B 3EW9A 4F50A 3I1YA 1S10A 2ZUCA 1UA0A 2E5SA 5ALHA 3H4DA 2IOFK 3UXPA 4KLQA 3B9JA 8ICBA 2ZIVA 3SD7A 7ICLA 1PK1B 4FE3A 4PH5A 3M8RA 4NLBA 3SV4A 3T5KA 2P35A 4CDGA 4JV1A 2A3VA 2MUTA 2RLTA 5KG0A 3IG8A 1C20A 2FMSA 1ECWA 5AK4A 4QW8A 5J2EA 3GV7B 3MR3A 2DPJA 1Z00B 3J81j 1ZQBA 2QLTA 4F5RA 2KNJA 1RPLA 4NLGA 4QZDA 5KFCA 2K4PA 5BOLA 2PFNA 4B9VA 3B0XA 4I28A 1TE2A 4I2JA 4RQ6A 4KLLA 4UB8U 5DDYA 4I2AA 1X6IA 1ZJNA 1S76D 2HBJA 2W9BA 4IR1A 9ICMA 4DSLA 3IG5A 2ZJ8A 2PI5A 3T5JA 4US8A 4DO9A 4P2HA 4MF8A 4DQQA 1F0MA 3TKAA 2OXOA 3MGHA 4I2DA 1NZBA 3GV8B 4I2EA 5KT2A 2J6UA 1ZOLA 2RQ5A 2ZJ5A 4DSEA 2ZJAA 1Z4NA 2ZIVB 3EWAA 5DB9A 5KT6A 4RUCA 1SGGA 3CNHA 4EBEA 4P4MA 4DL5A 2KJ8A 4B9TA 2PKEA 3MBYA 4G3IA 4QZIA 4TQRA 3PW0A 5HHIA 2IOHA 1QTMA 1ZQ1C 2QKQA 2KKPA 4O5EA 1NK8A 4EZ6A 3RBDA 2MRLA 3I76A 3GIIA 5KL1B 3FM9A 1N56A 4JV2A 2VJ4A 3RR7A 1S5LU 4WJ3B 5AKIA 2BPFA 2GOLA 3WK5A 2KV2A 2KVSA 3RB0A 1AROP 2YTUA 1ZRNA 3RJGA 2BCVA 2OH2A 1KBUA 4C8MA 5TISU 4B9SA 5KG3A 3TANA 5ALUA 2XY5A 2UVRA 2Z7JA 3MR6A 4RQ4A 3UMBA 1XO0A 1B22A 9ICUA 1PK3A 1WG8A 4O3NA 4CGZA 1Z19A 4R65A 1A77A 1JIHA 4YXJA 3C2LA 5AICA 2F8LA 4QZHA 9ICOA 2E1FA 4DL6A 8ICCA 5AM2A 3RAXA 4RNOA 2HDOA 1FFUA 2MA1A 4M9GA 2HHSA 2WAQC 7ICNA 2PFPA 3QU7A 4Y2PA 5AKYA 4YCXA 4F4KA 4KX3A 2BQUA 3LWLA 5J2JA 2J6TA 1ZQRA 1O03A 1PVRA 5ALTA 1JXEA 3SAFA 1XSLA 4KMUA 3PX6A 3RBEA 2AGPA 1XU4A 4C80A 3C23A 1K1QA 4PJ0U 1U9LA 9ICAA 1ZQQA 1T7PA 2W9CA 1L7OA 2YMQA 3N7PD 2HW3A 5H2FU 4M47A 1FO4A 1N62A 3AU6A 9ICPA 4DSJA 4O3MA 3CP8A 5AK3A 2H3VA 4KN4A 1JI7A 2AU0A 5T14A 3PX4A 3AQFA 3MGIA 9ICSA 5J0RA 2NRTA 2IHMA 3GIMA 4NL9A 3WKDA 1TAMA 4O0IA 2D6FC 2F1IA 2A1JB 3TFSA 4M9NA 4NWIA 2DKZA 5HMLA 5DGBA 1DRGA 3H40A 2G08A 2JH7A 4JV0A 4NLZA 3PSTA 4J9OA 2XY6A 3M6KA 2ZTCA 1SV0A 2HMXA 5AK5A 4RPYA 4O3QA 1ZQAA 3KZIU 4F4WA 2W9BB 2KIWA 2EZZA 3LVVA 1S9FA 3WKCA 3QU2A 2LBOA 1J2NA 1RG6A 2PFOA 4UASA 8ICAA 4IQTA 4QWBA 4EELA 2ZIWA 3SZ2A 4FO6A 4F3OA 4UBCA 5J2KA 4P4PA 1BPEA 3CW2C 3M7DA 4F4XA 3WU2U 4NY8A 5DB6A 5KFTA 3T5HA 4P0QB 3N4MB 2DFLA 4OD0A 4A8EA 4QNLA 2XCAA 3RR8A 2Y0SC 2HHWA 3N7SC 1KN5A 2NYVA 4PGQA 2ZIXB 4MFAA 4UATA 4QZ8A 4DSIA 1ZD2P 2V4QA 4HYKA 4MFFA 1NKEA 2VA2A 5IIKA 1V85A 2OHFA 4MEXA 4GXIA 1NK4A 2JHDA 2BCQA 8ICMA 2K60A 4FFDA 4ECWA 1HIWA 2XIDA 1X9MA 3TARA 4C8LA 1JRPA 1COKA 3HWTA 4PGYA 1B4FA 1CEZA 1LB2B 4KLDA 4EZ9A 1NK7A 5KAIU 1QSSA 1LKYB 1TVAA 4KLHA 4Q43A 4UQGA 3KTQA 4J03A 2AGOA 4DFKA 1QQ6A 1NNLA 5J0PA 1DOQA 1ED1A 4US9A 5HP4A 5B5EU 2M0NA 3G6VA 1HJPA 4UB4A 1ZRMA 4C4TA 4RQ5A 4EBDA 2WFAA 4F93B 1Q3VA 5CB1A 5ALPA 1JALA 2JRZA 3V7KA 2HBKA 3WK6A 3Q8RB 3JPOA 1J97A 2HHTA 4CNQA 4BGDA 8ICEA 4DS4A 4DFDA 2FE9A 4UARA 1BGXT 3HKZC 4KITB 4Y2RA 2W55A 1TK0A 4QZFA 5J0YA 3MABA 3IM1A 5KFDA 1MQ2A 5L1JA 3V6KA 4Q45A 3HW8A 5CRXA 3NGDA 4PPXA 4RQ3A 2EDUA 4OJ5A 7ICHA 4BJQA 4BX9C 1LVHA 4PL1A 5AKLA 2KHQA 1MN8A 3ORYA 2HOQA 5KFIA 7ICJA 5GTHU 1N48A 4C8NA 2FLPA 1V9PA 3F2CA 5J0WA 2VJ5A 5B66U 4MEYA 1ZQSA 2QARA 2JR5A 5ALRA 4KLOA 4NLKA 9ICHA 3WK9A 9ICCA 3QUQA 5F9NA 4M6WB 4UAWA 2R8JA 1COOA 5IILA 8ICTA 2OYYA 3PX0A 3RJIA 1NJXA 1U45A 7ICVA 4F71A 1N60A 3LYSA 1PVQA 1N5XA 5ALZA 5L1KA 2FPLA 4CF4A 4R64A 2M9NA 2W9MA 4KN7A 4I2FA 3QE9Y 3HP6A 3NVWA 3ICXA 4F4ZA 2AXTU 1KLNA 4DCCA 2WB1C 4J9PA 2K89A 4Y2QA 2BQRA 1S0OA 8ICKA 5AM0A 4KMOB 2B0CA 3OHAA 5J2HA 1B0XA 2WF7A 3RJHA 3NTUA 2KTQA 3L4PA 1HUZA 2G09A 5EWGA 2KMDA 4RQ2A 1NJWA 1BNPA 5KG4A 4QW9A 2E1EA 4IS7A 1UPHA 1KKXA 4QZAA 3F2DA 3PNCA 4QZ9A 1SIJA 1L7PA 4OJPA 2G5HB 5HR7A 8ICNA 5AM4A 4RNNA 1LV5A 3K75D 1URJA 8ICUA 2LI6A 4HAIA 3B0YA 1KEJA 1ZQPA 4ED1A 2E8MA 7ICSA 2Y1IA 3CYMA 4ELVA 4IC9A 1RZTA 3U26A 5J0UA 3MGVA 4KLSA 3BQ1A 4DFPA 8ICFA 5KT5A 1WYGA 2Q0ZX 3R9KA 2LMRA 4LVSA 1C7YA 4EEYA 1SKRA 4OO1J 2KICA 2BKEA 1ZQYA 4B9LA 4NV0A 1X9WA 4JK1A 2CRXA 5KG1A 2ALZA 5K4LA 2JXJA 2ES6A 2C2DA 4RQ0A 3OHBA 2OM6A 3JPQA 2E3TA 1TAUA 2BZFA 1D8LA 9ICXA 5KFSA 3PMNA 1ZD5A 2F1HA 5ALYA 2FMPA 2ZTDA 1N63A 4B9NA 7ICMA 1NK9A 3AU2A 1Q46A 2AHOB 2WB1F 1HUOA 3ZD9A 3ETRA 2ZXIA 3C28A 2R8HA 5AKGA 3ONNA 4O3RA 3AL0B 1ZQVA 5KFJA 3HRDD 4DL2A 1SXDA 1UT8A 3PSPA 4FS2A 4RNMA 3PW4A 2MUTB 4Y2YA 5ALFA 2LM4A 2Y9TA 7ICEA 3ZDEA 4R66A 3WKEA 3UQ0A 4DFMA 4M04A 5D49A 4Z6CA 3PY8A 2KOBA 3N7RC 2K8BB 2P6UA 4KLJA 3Q8PB 2I6XA 1ZQXA 4O3OA 4UAYA 2KIVA 4IQUA 3TFRA 4J9NA 2UVVA 2WF8A 3G6YA 5KTQA 1NZPA 5ALOA 2NV3A 2YB1A 3KD3A 3TADA 3RTVA 3F5AA 1NI3A 1BPYA 2F77X 3ALRA 5ALQA 1OXJA 3QNMA 4F5OA 1D9FA 1ZD3A 4PZNA 1T3QA 5EWFA 3N97B 4Y2TA 4AYBF 2QARB 4QIWC 2W9CB 2W8KA 9ICIA 1K5OA 1L3SA 4O5KA 2K8AA 5J0SA 4F4YA 5EE3A 2PMZC 1LKYA 2W03A 5F3XB 3QEAZ 4Y2SA 2R18A 3Q8LA 5JRTA 1D9DA 4DQRA 2KSOB 1ZQJA 1FIQA 9ICKA 4Q8FA 1QSYA 1PK1A 3OTQA 1MA7A 5CEHA 4QZBA 1WWUA 2R8IA 4YQWA 2HVIA 4YG2A 4YR0A 3NRZA 1IXRA 5HMMA 1XC9A 3CRXA 4DL7A 5DLGA 1IG6A 5J2DA 3UPQA 4ZOHC 4J9QA 4KLUA 4E0DA 2DKXA 4YD1A 5DG8A 5J2BA 2JV3A 3VCBA 4RQ8A 1PUZA 5KFNA 4F5NA 4XUSA 5AKHA 1F44A 8ICPA 4J9LA 5G5HA 4PGXA 1U47A 3PR5B 3PZPA 4IRDA 2JEIA 4UB2A 2HI0A 1ZETA 4DOBA 3M1YA 1S0VA 2VANA 2PMZF 4C4SA 4ZH4A 3K1RB 2C2RA 3BJYA 3T3FA 4M0AA 5J2GA 2KP7A 3HX0A 2L5YA 2VA8A 4UB1A 3M6ZA 5AIAA 3RH6A 4PL2A 5AI8A 4RT2A 3H0LB 1X6JA 3Q8KA 4C7ZA 2C2EA 4MFCA 4ED2A 3OPXA 3ISDA 4DS5A 2BR0A 5AI4A 5L1IA 5L9XA 1ZQCA 3LDAA 1J2MA 3NVYA 3IV6A 4ED3A 1A76A 2VA3A 3GIJA 3SMVA 3RJEA 7ICIA 1RM6C 2BDPA 3WKBA 4ECTA 4QWEA 5AHXA 3V6HA 1Y88A 5AKZA 3PR4A 1OW5A 5KT7A 3KHGA 1QQ7A 8ICJA 4J9RA 3QYPA 3BQ2A 2RP5A 4DF8A 5KFRA 2GO7A 4Y2XA 5DBCA 3QZ7A 1VDVA 3C5GA 4QWCA 3F2BA 3LWMA 4O9MA 4JWMA 3NASA 4P0PB 2PI4A 4ECVA 4F92B 1YZ6A 4NM1A 5KFGA 3V7LA 4QZCA 1ZQEA 1ZQFA 4CCHA 4F8RA 9ICLA 3I28A 1M6YA 4FBUA 5KL8B 3PSFA 1KRPA 5DKWA 3ED5A 1DGSA 4EYHB 3AM9A 3E2EA 2UVWA 3RB6A 5JTIA 1OUQA 3HJEA 3SEIA 4ECYA 7ICQA 1SL0A 5IIMA 1NKCA 2FLLA 1ZQGA 2AH5A 4EX6A 5KG5A 1Z4OA 3RRGA 3T79A 3UMGA 4RQ7A 3ETLA 3NVZA 2BQ3A 5KFUA 3DDHA 3KKAC 9ICVA 4YR3A 5J8YA 1XO1A 1A0PA 4YMNA 1O08A 2ZUBA 1YT3A 1V97A 5CJ7A 3K4GA 2A19A 4BWMA 2QB0B 4J9SA 5C5JA 2Y9UA 3A0HU 3K1ZA 4JWNA 1GO3F 2LHTA 2ZIWB 1SWVA 5CA7A 5BOMA 2ASDA 4DLGA 5KG6A 2OCEA 4U7CA 2VIXA 1N2XA 4XA5A 3OJUA
chains in the Genus database with same CATH topology
3UXOA 1ZJNA 1S76D 8ICKA 3OHAA 5J2HA 2W9BA 1MC8A 1TKDA 4IR1A 3RJHA 3RJKA 2OWOA 3NTUA 2KTQA 2BPGA 4DSLA 9ICMA 1HUZA 2ZJ8A 4YP3A 2PI5A 3T5JA 7ICUA 4YVZA 5TZVA 4DO9A 2KZMA 5EWEA 4QZEA 5L1LA 4P2HA 4MF8A 5EWGA 3RB4A 1NJWA 4RQ2A 4DQQA 3ZDCA 5KFOA 1ZYQA 5KG4A 4QW9A 3MGHA 4I2DA 3PO5A 5DDMA 3GV8B 2P66A 3OSNA 1EXNA 4QZAA 1UT5A 3PNCA 4I2EA 4QZ9A 5KT2A 2J6UA 1TK5A 4DSEA 2ZJ5A 3MFHA 3OSPA 2ASJA 2ZJAA 1KTQA 5DB9A 2BCUA 3EWAA 4B9MA 2IMWP 4ELTA 3RJJA 3FDSA 4GLXA 8ICNA 7ICRA 3BQTA 5KT6A 2HHQA 4RUCA 4RNNA 4EBEA 4DL5A 4P4MA 1LV5A 3K75D 1WCLA 4B9TA 8ICUA 3MBYA 5KFKA 2DPIA 3B0YA 4G3IA 1KEJA 4QZIA 4XRHA 4TQRA 3QZ8A 4DF4A 3PW0A 1NJYA 1ZQPA 5HHIA 5KFBA 4ED1A 7ICSA 2Y1IA 1QTMA 9ICJA 1JMSA 4ELVA 4O5EA 1NK8A 1S97A 1RZTA 8ICXA 1Z00A 2XO7A 8ICGA 8ICRA 5J0UA 1TV9A 4KLSA 4EZ6A 3RBDA 3BQ1A 4DFPA 4F5QA 8ICFA 4YMOA 5KT5A 4K4GA 5F9LA 2Q0ZX 4LVSA 3GIIA 3ZD8A 4I27A 3MDAA 1C7YA 4EEYA 1SKRA 1N56A 2BKEA 5KFMA 4JV2A 1ZQYA 3M9MB 4B9LA 1X9WA 4JK1A 3SI8A 3RR7A 4M2YA 5KG1A 2ALZA 2C2DA 2BPFA 3Q8SB 4F2SA 4RQ0A 5DQGA 3OHBA 3RB0A 4DQIA 3JPQA 1AROP 4TQSA 5J2AA 4Q8EA 1RXWA 1TAUA 1ZQDA 1WCNA 5DB7A 1D8LA 9ICXA 3RJGA 3LK9A 2BCVA 1BVSA 3PW2A 5KFSA 3PMNA 4C8MA 2JZBB 2F1HA 5KFLA 2XY7A 1ZQNA 4B9SA 5KG3A 3GILA 3TANA 8ICIA 2XY5A 2ZTDA 2FMPA 2UVRA 3MR6A 4PHEA 4RQ4A 4B9NA 7ICMA 2V9WA 1NK9A 1B22A 3AU2A 1JN3A 1SKSA 3C5FA 4DSKA 1HUOA 3ZD9A 4Q44A 5DQHA 4DFJA 1XWLA 2ATLA 3SYZA 9ICUA 4O3NA 5KFPA 2R8HA 3ZDBA 4I2IA 4IQWA 4R65A 4IRKA 2BPCA 4GXKA 1XSPA 2ISPA 1A77A 1JIHA 4O3RA 4YXJA 3C2LA 2HHVA 8ICSA 2BGWA 1ZQVA 5KFJA 5KFHA 1KFTA 4KTQA 4QZHA 4DL2A 9ICOA 1UT8A 4DQPA 5DG7A 2BCSA 1S77D 2Y1JA 4FS2A 5JUMA 4RNMA 3PW4A 1UA1A 3BQ0A 4DL6A 4ED8A 2MUTB 8ICCA 2KFNA 1KFDA 3RAXA 4RNOA 1D8YA 3KHRA 4YD2A 3GV5B 2BHNA 7ICEA 1NK6A 3HT3A 3ZDEA 5HHHA 1ZQWA 2NRVA 4R66A 4UAZA 3UQ0A 1MQ3A 4ED7A 2PFPA 4DFMA 4M9JA 3RH5A 4M04A 5D49A 4Z6CA 3PY8A 4PHDA 1ZQMA 4YCXA 7ICGA 4F4KA 3V6JA 3QEBZ 8ICWA 1T3NA 3EYZA 2BQUA 4I2CA 1SKWA 3RAQA 3LWLA 5J2JA 3MR5A 2FMQA 2J6TA 1ZJMA 2P6UA 5J2CA 5DLFA 4KLJA 3Q8PB 1ZQRA 2HHSA 1ZQXA 3C1ZA 4DWIA 4IQVA 1JXEA 1ZQTA 3RH4A 4O3OA 4UAYA 3SV3A 1XSLA 4KMUA 3Q8MA 1U49A 3PX6A 3RBEA 4GXJA 2AGPA 2ZTEA 2PFQA 1XU4A 4IQUA 3TFRA 1L3TA 4J9NA 2UVVA 3C23A 1K1QA 3G6YA 4DEZA 1U9LA 1BPBA 5KTQA 1ZQQA 9ICAA 3TAPA 4DQSA 7ICTA 1T7PA 4ED6A 2NRWA 4YMMA 2W9CA 1JXLA 1MSWD 3RJFA 2HW3A 4FBTA 4M47A 2I1QA 2GWSA 4X5VA 3RTVA 3AU6A 1BPYA 9ICPA 4DSJA 4UBBA 2I9GA 3H8SA 4KN4A 4P4OA 3TAQA 2ISOA 2JEJA 5IIJA 4F5OA 1D9FA 2AU0A 4ECUA 2ASLA 2H5XA 3JPTA 3M8SA 5KT4A 5EWFA 3PX4A 4BDPA 3N97B 3MGIA 9ICSA 5J0RA 3ISCA 3OGUA 4KLLA 3M9NB 8ICVA 3KHLA 5KFAA 2NRTA 2IHMA 2NRZA 5DQIA 3GIMA 1TK8A 1RXVA 4O0IA 1H38A 2F1IA 2A1JB 2W9CB 2W8KA 3TFSA 4M9NA 4KLGA 3PVXA 4QZGA 2C28A 5HMLA 1L3UA 2IBKA 4K4HA 9ICIA 5DGBA 4EYIB 4DOAA 1L3SA 4O5KA 5J0SA 4EBCA 3EPIA 4F4YA 4FS1A 2P6RA 3H40A 7ICNA 1RYSA 1ZQIA 4XQ8A 5KFEA 4TURA 2XGQA 4JV0A 4NLZA 4J9OA 5J29A 3QEAZ 4KLIA 5IIOA 2XY6A 4QWDA 2ZTCA 3Q8LA 1D9DA 4DQRA 5KFQA 5DG9A 1ZQJA 4RPYA 4O3QA 1ZQAA 9ICKA 4Q8FA 1QSYA 4F4WA 4RQ1A 2W9BB 3RRHA 4KLFA 4QZBA 3C21A 2AQ0A 1L3VA 4LZGA 2R8IA 2J6SA 4YQWA 4YR2A 3AUOA 1S9FA 2HVIA 3H4BA 4YG2A 5J2FA 9ICTA 4DSFA 4YR0A 3MDCA 4ECXA 1S0NA 9ICGA 1IXRA 5HMMA 1XC9A 1KSPA 3Q8QB 4DL7A 2PFOA 8ICAA 5DLGA 5J2DA 4DLEA 4F5PA 1IM4A 4IQTA 3UPQA 5IINA 4QWBA 4J9QA 4KLUA 3HPOA 1TFRA 4E0DA 8ICYA 4YD1A 1XSNA 3SZ2A 4FO6A 4F3OA 5DG8A 3GIKA 5J2BA 5IIIA 3C2KA 4DL4A 4RQ8A 3G6XA 5KFNA 4F5NA 4XUSA 5DGAA 1BPDA 4UBCA 2AGQA 5KFZA 5J2KA 4P4PA 4UB3A 1BPEA 5CR0A 2WTFA 3T5LA 1ZQLA 8ICPA 4F4XA 4J9LA 1K1SA 4O5CA 4M9LA 4NY8A 5DB6A 5KFTA 3H8WA 2HHUA 3T5HA 4PGXA 3N4MB 4R63A 4Z6EA 2DFLA 5KT3A 4RU9A 1U47A 2KZ3A 3PR5B 4KLEA 3JPPA 4IRDA 4UB5A 2XCAA 2JEIA 1QLNA 5CWRA 4BXOA 4UB2A 3RR8A 1ZETA 5KFVA 4DOBA 4I29A 4Z6DA 4IR9A 2HHWA 2FPKA 4NM2A 1S0VA 1SZPA 4PGQA 3IHQB 2VANA 1Z3EB 4MFAA 3MR2A 4QZ8A 4DSIA 3TQ1A 2V4QA 4HYKA 4RPXA 5KG7A 4ZH4A 3GFKB 2XCPA 3M9OB 1NKEA 2JEFA 4J9MA 5IIKA 2C2RA 5J0XA 3JPRA 2W9AA 2VA2A 3BJYA 3T3FA 4MEXA 3GDXA 4M0AA 3V72A 5KFXA 5J2GA 4GXIA 1NK4A 2UVUA 5DB8A 4QWAA 2BCQA 8ICMA 3HX0A 3PMLA 5DBBA 4YXMA 4TUPA 4ECWA 2VA8A 4C8OA 4KLTA 4UB1A 7ICPA 7ICOA 2FLNA 4C8KA 3PW5A 3RH6A 4NLNA 8ICOA 1X9MA 3GQCA 3TARA 2KN7A 4C8LA 4F91B 4RT2A 2RDIA 3HWTA 3Q8KA 4PGYA 3V7JA 1ZQKA 4NXZA 5KG2A 2C2EA 2XC9A 4MFCA 1CEZA 1NK5A 1KDHA 4ED2A 3EPGA 1LB2B 4KLDA 4EZ9A 2A1JA 1NK7A 1QSSA 8ICQA 8ICZA 3ISDA 5EOZA 2HHXA 4MF2A 4DS5A 2BR0A 1TVAA 4KLHA 3H7IA 4Q43A 5L9XA 5L1IA 3ZDAA 4UQGA 3KTQA 1ZQCA 3LDAA 4LZDA 4DFKA 2AGOA 1BPZA 8ICLA 4YFKA 1A76A 5J0PA 4ED3A 4PHAA 3MFIA 3UQ2A 2VA3A 4O3PA 5KFYA 1KFSA 1DOQA 1NOMA 3GIJA 3RJEA 1ZQOA 7ICIA 5J2IA 2NRXA 5HP4A 2BDPA 3G6VA 2W8LA 4ECTA 1HJPA 4QWEA 2HVHA 2KZZA 1U4BA 4UB4A 1L5UA 4RZRA 1X2IA 1Y88A 3V6HA 4O3SA 4RQ5A 4ECSA 3PR4A 4EBDA 4F93B 1SL2A 5CB1A 3UXNA 3ISBA 4MFFA 5KT7A 3KHGA 3V7KA 5KFWA 4K4IA 1U48A 8ICJA 1NKBA 1RYRA 4J9RA 9ICWA 2JEGA 1QSLA 2IA6A 3C1YA 3PV8A 3BQ2A 4TUQA 3Q8RB 3H8JA 4DOCA 5J0TA 3JPOA 4DF8A 2HHTA 5KFRA 9ICQA 5DBCA 3QZ7A 1TAQA 4M6WA 4BGDA 3C5GA 4QWCA 4DS4A 3LWMA 8ICEA 3THVA 2IHNA 3RB3A 8ICHA 4DL3A 5J0QA 1BGXT 1BPXA 4O9MA 3TI0A 4KITB 4JWMA 3KHHA 9ICNA 4RUAA 1TK0A 1ZQHA 4ED0A 1B43A 2LYHA 4QZFA 5J0YA 2PI4A 4I2BA 3MABA 9ICFA 2JZBA 4ECQA 4ECVA 3ZDDA 3IM1A 5KFDA 4F92B 2R8KA 4IRCA 3C2MA 2ZUDA 5KFGA 1MQ2A 4M9GA 4NM1A 3V7LA 4QZCA 2F1JA 5L1JA 1ZQEA 1ZQFA 4CCHA 2MAXA 3V6KA 2AJQA 4Q45A 3JPNA 3HW8A 4F8RA 1XS9D 3NGDA 4PPXA 9ICLA 4RQ3A 5KFFA 3FYHA 3BDPA 3PO4A 2B21A 4FBUA 4KLMA 5DBAA 7ICHA 2V4RA 4GC7A 1KRPA 5DKWA 1DGSA 4EYHB 3ORYA 3E2EA 2UVWA 2PXIA 5KFIA 3RB6A 7ICJA 1PZNA 1N48A 5D4BA 4C8NA 1SL1A 4ECYA 7ICQA 4RT3A 2FLPA 1V9PA 1SL0A 4TUSA 4Z6FA 5IIMA 5J0WA 3OJSA 1NKCA 1ZQGA 2FLLA 2BCRA 1CUKA 4YN4A 3PW7A 5CHGA 4GC6A 1NJZA 2C22A 5KG5A 3RRGA 4MEYA 2R8GA 9ICEA 1X9SA 1S0MA 1ZQSA 4RQ7A 1ZQUA 3ETLA 4R8UB 2BQ3A 4KLOA 5KFUA 4I2GA 1JX4A 4NLKA 9ICHA 4PHPA 9ICCA 4F2RA 3EW9A 9ICVA 5F9NA 4F50A 1S10A 2ZUCA 1UA0A 4M6WB 4BWJA 4R8UA 4YR3A 2AQ4A 4UAWA 2R8JA 3H4DA 1COOA 1XO1A 3UXPA 5IILA 4KLQA 8ICBA 4YMNA 7ICLA 1NK0A 8ICTA 2ZUBA 4PH5A 3M8RA 4BXOB 5CJ7A 3PX0A 3RJIA 9ICRA 3K4GA 4JUZA 3SV4A 1NJXA 1U45A 4BWMA 7ICVA 3T5KA 4J9SA 4JV1A 5BPCA 2MUTA 4ECZA 5KG0A 1T4GA 1T8EA 2FMSA 5C5JA 4B9UA 7ICFA 2FPMA 3EZ5A 5D46A 5L1KA 4QW8A 5J2EA 3GV7B 2FPLA 3MR3A 2DPJA 4R64A 4JWNA 2M9NA 7ICKA 1Z00B 1ZQZA 2W9MA 4KN7A 4ECRA 1ZQBA 4M9HA 4I2FA 3QE9Y 4ELUA 4F5RA 1RPLA 4NLGA 4QZDA 3HP6A 5CA7A 5KFCA 5BOMA 3JPSA 2ASDA 5BOLA 2PFNA 4DLGA 5KG6A 4B9VA 2KFZA 3B0XA 4F4ZA 1KLNA 4RPZA 4I28A 4I2JA 4J9PA 4RQ6A 5J0OA 2XGPA 4XA5A 5CP2A 5HNKA 2RDJA 4J9KA 2BQRA 5DDYA 4I2HA 3OJUA 4I2AA 9ICBA 1S0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UXO A;  1ZJN A;  1S76 D;  8ICK A;  3OHA A;  5J2H A;  2W9B A;  1MC8 A;  1TKD A;  4IR1 A;  3RJH A;  3RJK A;  2OWO A;  3NTU A;  2KTQ A;  2BPG A;  4DSL A;  9ICM A;  1HUZ A;  2ZJ8 A;  4YP3 A;  2PI5 A;  3T5J A;  7ICU A;  4YVZ A;  5TZV A;  4DO9 A;  2KZM A;  5EWE A;  4QZE A;  5L1L A;  4P2H A;  4MF8 A;  5EWG A;  3RB4 A;  1NJW A;  4RQ2 A;  4DQQ A;  3ZDC A;  5KFO A;  1ZYQ A;  5KG4 A;  4QW9 A;  3MGH A;  4I2D A;  3PO5 A;  5DDM A;  3GV8 B;  2P66 A;  3OSN A;  1EXN A;  4QZA A;  1UT5 A;  3PNC A;  4I2E A;  4QZ9 A;  5KT2 A;  2J6U A;  1TK5 A;  4DSE A;  2ZJ5 A;  3MFH A;  3OSP A;  2ASJ A;  2ZJA A;  1KTQ A;  5DB9 A;  2BCU A;  3EWA A;  4B9M A;  2IMW P;  4ELT A;  3RJJ A;  3FDS A;  4GLX A;  8ICN A;  7ICR A;  3BQT A;  5KT6 A;  2HHQ A;  4RUC A;  4RNN A;  4EBE A;  4DL5 A;  4P4M A;  1LV5 A;  3K75 D;  1WCL A;  4B9T A;  8ICU A;  3MBY A;  5KFK A;  2DPI A;  3B0Y A;  4G3I A;  1KEJ A;  4QZI A;  4XRH A;  4TQR A;  3QZ8 A;  4DF4 A;  3PW0 A;  1NJY A;  1ZQP A;  5HHI A;  5KFB A;  4ED1 A;  7ICS A;  2Y1I A;  1QTM A;  9ICJ A;  1JMS A;  4ELV A;  4O5E A;  1NK8 A;  1S97 A;  1RZT A;  8ICX A;  1Z00 A;  2XO7 A;  8ICG A;  8ICR A;  5J0U A;  1TV9 A;  4KLS A;  4EZ6 A;  3RBD A;  3BQ1 A;  4DFP A;  4F5Q A;  8ICF A;  4YMO A;  5KT5 A;  4K4G A;  5F9L A;  2Q0Z X;  4LVS A;  3GII A;  3ZD8 A;  4I27 A;  3MDA A;  1C7Y A;  4EEY A;  1SKR A;  1N56 A;  2BKE A;  5KFM A;  4JV2 A;  1ZQY A;  3M9M B;  4B9L A;  1X9W A;  4JK1 A;  3SI8 A;  3RR7 A;  4M2Y A;  5KG1 A;  2ALZ A;  2C2D A;  2BPF A;  3Q8S B;  4F2S A;  4RQ0 A;  5DQG A;  3OHB A;  3RB0 A;  4DQI A;  3JPQ A;  1ARO P;  4TQS A;  5J2A A;  4Q8E A;  1RXW A;  1TAU A;  1ZQD A;  1WCN A;  5DB7 A;  1D8L A;  9ICX A;  3RJG A;  3LK9 A;  2BCV A;  1BVS A;  3PW2 A;  5KFS A;  3PMN A;  4C8M A;  2JZB B;  2F1H A;  5KFL A;  2XY7 A;  1ZQN A;  4B9S A;  5KG3 A;  3GIL A;  3TAN A;  8ICI A;  2XY5 A;  2ZTD A;  2FMP A;  2UVR A;  3MR6 A;  4PHE A;  4RQ4 A;  4B9N A;  7ICM A;  2V9W A;  1NK9 A;  1B22 A;  3AU2 A;  1JN3 A;  1SKS A;  3C5F A;  4DSK A;  1HUO A;  3ZD9 A;  4Q44 A;  5DQH A;  4DFJ A;  1XWL A;  2ATL A;  3SYZ A;  9ICU A;  4O3N A;  5KFP A;  2R8H A;  3ZDB A;  4I2I A;  4IQW A;  4R65 A;  4IRK A;  2BPC A;  4GXK A;  1XSP A;  2ISP A;  1A77 A;  1JIH A;  4O3R A;  4YXJ A;  3C2L A;  2HHV A;  8ICS A;  2BGW A;  1ZQV A;  5KFJ A;  5KFH A;  1KFT A;  4KTQ A;  4QZH A;  4DL2 A;  9ICO A;  1UT8 A;  4DQP A;  5DG7 A;  2BCS A;  1S77 D;  2Y1J A;  4FS2 A;  5JUM A;  4RNM A;  3PW4 A;  1UA1 A;  3BQ0 A;  4DL6 A;  4ED8 A;  2MUT B;  8ICC A;  2KFN A;  1KFD A;  3RAX A;  4RNO A;  1D8Y A;  3KHR A;  4YD2 A;  3GV5 B;  2BHN A;  7ICE A;  1NK6 A;  3HT3 A;  3ZDE A;  5HHH A;  1ZQW A;  2NRV A;  4R66 A;  4UAZ A;  3UQ0 A;  1MQ3 A;  4ED7 A;  2PFP A;  4DFM A;  4M9J A;  3RH5 A;  4M04 A;  5D49 A;  4Z6C A;  3PY8 A;  4PHD A;  1ZQM A;  4YCX A;  7ICG A;  4F4K A;  3V6J A;  3QEB Z;  8ICW A;  1T3N A;  3EYZ A;  2BQU A;  4I2C A;  1SKW A;  3RAQ A;  3LWL A;  5J2J A;  3MR5 A;  2FMQ A;  2J6T A;  1ZJM A;  2P6U A;  5J2C A;  5DLF A;  4KLJ A;  3Q8P B;  1ZQR A;  2HHS A;  1ZQX A;  3C1Z A;  4DWI A;  4IQV A;  1JXE A;  1ZQT A;  3RH4 A;  4O3O A;  4UAY A;  3SV3 A;  1XSL A;  4KMU A;  3Q8M A;  1U49 A;  3PX6 A;  3RBE A;  4GXJ A;  2AGP A;  2ZTE A;  2PFQ A;  1XU4 A;  4IQU A;  3TFR A;  1L3T A;  4J9N A;  2UVV A;  3C23 A;  1K1Q A;  3G6Y A;  4DEZ A;  1U9L A;  1BPB A;  5KTQ A;  1ZQQ A;  9ICA A;  3TAP A;  4DQS A;  7ICT A;  1T7P A;  4ED6 A;  2NRW A;  4YMM A;  2W9C A;  1JXL A;  1MSW D;  3RJF A;  2HW3 A;  4FBT A;  4M47 A;  2I1Q A;  2GWS A;  4X5V A;  3RTV A;  3AU6 A;  1BPY A;  9ICP A;  4DSJ A;  4UBB A;  2I9G A;  3H8S A;  4KN4 A;  4P4O A;  3TAQ A;  2ISO A;  2JEJ A;  5IIJ A;  4F5O A;  1D9F A;  2AU0 A;  4ECU A;  2ASL A;  2H5X A;  3JPT A;  3M8S A;  5KT4 A;  5EWF A;  3PX4 A;  4BDP A;  3N97 B;  3MGI A;  9ICS A;  5J0R A;  3ISC A;  3OGU A;  4KLL A;  3M9N B;  8ICV A;  3KHL A;  5KFA A;  2NRT A;  2IHM A;  2NRZ A;  5DQI A;  3GIM A;  1TK8 A;  1RXV A;  4O0I A;  1H38 A;  2F1I A;  2A1J B;  2W9C B;  2W8K A;  3TFS A;  4M9N A;  4KLG A;  3PVX A;  4QZG A;  2C28 A;  5HML A;  1L3U A;  2IBK A;  4K4H A;  9ICI A;  5DGB A;  4EYI B;  4DOA A;  1L3S A;  4O5K A;  5J0S A;  4EBC A;  3EPI A;  4F4Y A;  4FS1 A;  2P6R A;  3H40 A;  7ICN A;  1RYS A;  1ZQI A;  4XQ8 A;  5KFE A;  4TUR A;  2XGQ A;  4JV0 A;  4NLZ A;  4J9O A;  5J29 A;  3QEA Z;  4KLI A;  5IIO A;  2XY6 A;  4QWD A;  2ZTC A;  3Q8L A;  1D9D A;  4DQR A;  5KFQ A;  5DG9 A;  1ZQJ A;  4RPY A;  4O3Q A;  1ZQA A;  9ICK A;  4Q8F A;  1QSY A;  4F4W A;  4RQ1 A;  2W9B B;  3RRH A;  4KLF A;  4QZB A;  3C21 A;  2AQ0 A;  1L3V A;  4LZG A;  2R8I A;  2J6S A;  4YQW A;  4YR2 A;  3AUO A;  1S9F A;  2HVI A;  3H4B A;  4YG2 A;  5J2F A;  9ICT A;  4DSF A;  4YR0 A;  3MDC A;  4ECX A;  1S0N A;  9ICG A;  1IXR A;  5HMM A;  1XC9 A;  1KSP A;  3Q8Q B;  4DL7 A;  2PFO A;  8ICA A;  5DLG A;  5J2D A;  4DLE A;  4F5P A;  1IM4 A;  4IQT A;  3UPQ A;  5IIN A;  4QWB A;  4J9Q A;  4KLU A;  3HPO A;  1TFR A;  4E0D A;  8ICY A;  4YD1 A;  1XSN A;  3SZ2 A;  4FO6 A;  4F3O A;  5DG8 A;  3GIK A;  5J2B A;  5III A;  3C2K A;  4DL4 A;  4RQ8 A;  3G6X A;  5KFN A;  4F5N A;  4XUS A;  5DGA A;  1BPD A;  4UBC A;  2AGQ A;  5KFZ A;  5J2K A;  4P4P A;  4UB3 A;  1BPE A;  5CR0 A;  2WTF A;  3T5L A;  1ZQL A;  8ICP A;  4F4X A;  4J9L A;  1K1S A;  4O5C A;  4M9L A;  4NY8 A;  5DB6 A;  5KFT A;  3H8W A;  2HHU A;  3T5H A;  4PGX A;  3N4M B;  4R63 A;  4Z6E A;  2DFL A;  5KT3 A;  4RU9 A;  1U47 A;  2KZ3 A;  3PR5 B;  4KLE A;  3JPP A;  4IRD A;  4UB5 A;  2XCA A;  2JEI A;  1QLN A;  5CWR A;  4BXO A;  4UB2 A;  3RR8 A;  1ZET A;  5KFV A;  4DOB A;  4I29 A;  4Z6D A;  4IR9 A;  2HHW A;  2FPK A;  4NM2 A;  1S0V A;  1SZP A;  4PGQ A;  3IHQ B;  2VAN A;  1Z3E B;  4MFA A;  3MR2 A;  4QZ8 A;  4DSI A;  3TQ1 A;  2V4Q A;  4HYK A;  4RPX A;  5KG7 A;  4ZH4 A;  3GFK B;  2XCP A;  3M9O B;  1NKE A;  2JEF A;  4J9M A;  5IIK A;  2C2R A;  5J0X A;  3JPR A;  2W9A A;  2VA2 A;  3BJY A;  3T3F A;  4MEX A;  3GDX A;  4M0A A;  3V72 A;  5KFX A;  5J2G A;  4GXI A;  1NK4 A;  2UVU A;  5DB8 A;  4QWA A;  2BCQ A;  8ICM A;  3HX0 A;  3PML A;  5DBB A;  4YXM A;  4TUP A;  4ECW A;  2VA8 A;  4C8O A;  4KLT A;  4UB1 A;  7ICP A;  7ICO A;  2FLN A;  4C8K A;  3PW5 A;  3RH6 A;  4NLN A;  8ICO A;  1X9M A;  3GQC A;  3TAR A;  2KN7 A;  4C8L A;  4F91 B;  4RT2 A;  2RDI A;  3HWT A;  3Q8K A;  4PGY A;  3V7J A;  1ZQK A;  4NXZ A;  5KG2 A;  2C2E A;  2XC9 A;  4MFC A;  1CEZ A;  1NK5 A;  1KDH A;  4ED2 A;  3EPG A;  1LB2 B;  4KLD A;  4EZ9 A;  2A1J A;  1NK7 A;  1QSS A;  8ICQ A;  8ICZ A;  3ISD A;  5EOZ A;  2HHX A;  4MF2 A;  4DS5 A;  2BR0 A;  1TVA A;  4KLH A;  3H7I A;  4Q43 A;  5L9X A;  5L1I A;  3ZDA A;  4UQG A;  3KTQ A;  1ZQC A;  3LDA A;  4LZD A;  4DFK A;  2AGO A;  1BPZ A;  8ICL A;  4YFK A;  1A76 A;  5J0P A;  4ED3 A;  4PHA A;  3MFI A;  3UQ2 A;  2VA3 A;  4O3P A;  5KFY A;  1KFS A;  1DOQ A;  1NOM A;  3GIJ A;  3RJE A;  1ZQO A;  7ICI A;  5J2I A;  2NRX A;  5HP4 A;  2BDP A;  3G6V A;  2W8L A;  4ECT A;  1HJP A;  4QWE A;  2HVH A;  2KZZ A;  1U4B A;  4UB4 A;  1L5U A;  4RZR A;  1X2I A;  1Y88 A;  3V6H A;  4O3S A;  4RQ5 A;  4ECS A;  3PR4 A;  4EBD A;  4F93 B;  1SL2 A;  5CB1 A;  3UXN A;  3ISB A;  4MFF A;  5KT7 A;  3KHG A;  3V7K A;  5KFW A;  4K4I A;  1U48 A;  8ICJ A;  1NKB A;  1RYR A;  4J9R A;  9ICW A;  2JEG A;  1QSL A;  2IA6 A;  3C1Y A;  3PV8 A;  3BQ2 A;  4TUQ A;  3Q8R B;  3H8J A;  4DOC A;  5J0T A;  3JPO A;  4DF8 A;  2HHT A;  5KFR A;  9ICQ A;  5DBC A;  3QZ7 A;  1TAQ A;  4M6W A;  4BGD A;  3C5G A;  4QWC A;  4DS4 A;  3LWM A;  8ICE A;  3THV A;  2IHN A;  3RB3 A;  8ICH A;  4DL3 A;  5J0Q A;  1BGX T;  1BPX A;  4O9M A;  3TI0 A;  4KIT B;  4JWM A;  3KHH A;  9ICN A;  4RUA A;  1TK0 A;  1ZQH A;  4ED0 A;  1B43 A;  2LYH A;  4QZF A;  5J0Y A;  2PI4 A;  4I2B A;  3MAB A;  9ICF A;  2JZB A;  4ECQ A;  4ECV A;  3ZDD A;  3IM1 A;  5KFD A;  4F92 B;  2R8K A;  4IRC A;  3C2M A;  2ZUD A;  5KFG A;  1MQ2 A;  4M9G A;  4NM1 A;  3V7L A;  4QZC A;  2F1J A;  5L1J A;  1ZQE A;  1ZQF A;  4CCH A;  2MAX A;  3V6K A;  2AJQ A;  4Q45 A;  3JPN A;  3HW8 A;  4F8R A;  1XS9 D;  3NGD A;  4PPX A;  9ICL A;  4RQ3 A;  5KFF A;  3FYH A;  3BDP A;  3PO4 A;  2B21 A;  4FBU A;  4KLM A;  5DBA A;  7ICH A;  2V4R A;  4GC7 A;  1KRP A;  5DKW A;  1DGS A;  4EYH B;  3ORY A;  3E2E A;  2UVW A;  2PXI A;  5KFI A;  3RB6 A;  7ICJ A;  1PZN A;  1N48 A;  5D4B A;  4C8N A;  1SL1 A;  4ECY A;  7ICQ A;  4RT3 A;  2FLP A;  1V9P A;  1SL0 A;  4TUS A;  4Z6F A;  5IIM A;  5J0W A;  3OJS A;  1NKC A;  1ZQG A;  2FLL A;  2BCR A;  1CUK A;  4YN4 A;  3PW7 A;  5CHG A;  4GC6 A;  1NJZ A;  2C22 A;  5KG5 A;  3RRG A;  4MEY A;  2R8G A;  9ICE A;  1X9S A;  1S0M A;  1ZQS A;  4RQ7 A;  1ZQU A;  3ETL A;  4R8U B;  2BQ3 A;  4KLO A;  5KFU A;  4I2G A;  1JX4 A;  4NLK A;  9ICH A;  4PHP A;  9ICC A;  4F2R A;  3EW9 A;  9ICV A;  5F9N A;  4F50 A;  1S10 A;  2ZUC A;  1UA0 A;  4M6W B;  4BWJ A;  4R8U A;  4YR3 A;  2AQ4 A;  4UAW A;  2R8J A;  3H4D A;  1COO A;  1XO1 A;  3UXP A;  5IIL A;  4KLQ A;  8ICB A;  4YMN A;  7ICL A;  1NK0 A;  8ICT A;  2ZUB A;  4PH5 A;  3M8R A;  4BXO B;  5CJ7 A;  3PX0 A;  3RJI A;  9ICR A;  3K4G A;  4JUZ A;  3SV4 A;  1NJX A;  1U45 A;  4BWM A;  7ICV A;  3T5K A;  4J9S A;  4JV1 A;  5BPC A;  2MUT A;  4ECZ A;  5KG0 A;  1T4G A;  1T8E A;  2FMS A;  5C5J A;  4B9U A;  7ICF A;  2FPM A;  3EZ5 A;  5D46 A;  5L1K A;  4QW8 A;  5J2E A;  3GV7 B;  2FPL A;  3MR3 A;  2DPJ A;  4R64 A;  4JWN A;  2M9N A;  7ICK A;  1Z00 B;  1ZQZ A;  2W9M A;  4KN7 A;  4ECR A;  1ZQB A;  4M9H A;  4I2F A;  3QE9 Y;  4ELU A;  4F5R A;  1RPL A;  4NLG A;  4QZD A;  3HP6 A;  5CA7 A;  5KFC A;  5BOM A;  3JPS A;  2ASD A;  5BOL A;  2PFN A;  4DLG A;  5KG6 A;  4B9V A;  2KFZ A;  3B0X A;  4F4Z A;  1KLN A;  4RPZ A;  4I28 A;  4I2J A;  4J9P A;  4RQ6 A;  5J0O A;  2XGP A;  4XA5 A;  5CP2 A;  5HNK A;  2RDJ A;  4J9K A;  2BQR A;  5DDY A;  4I2H A;  3OJU A;  4I2A A;  9ICB A;  1S0O A; 
#chains in the Genus database with same CATH topology
 3UXO A;  3AEV A;  1TKD A;  2RHF A;  4GFJ A;  2OWO A;  2F8K A;  4BUG A;  4YP3 A;  3WK4 A;  1WWV A;  4YVZ A;  5TZV A;  2KZM A;  5EWE A;  4QZE A;  4MHV A;  3ZDC A;  1ZYQ A;  3WK7 A;  5ALK A;  3GZF A;  2ODG A;  1FFV A;  5DDM A;  2P66 A;  3OSN A;  4C0Z A;  1UT5 A;  2H3F A;  2ASJ A;  2BCU A;  4B9M A;  2RRD A;  3FDS A;  4GLX A;  3BQT A;  2JMG A;  2FDR A;  2ZIU A;  5ALI A;  1WCL A;  2KVC A;  4FZM A;  5ALL A;  4XRH A;  3QZ8 A;  1NJY A;  2ESE A;  1KW4 A;  1KL9 A;  9ICJ A;  3KFU F;  3BS5 A;  1S97 A;  2XO7 A;  2KJ5 A;  1CRX A;  2HOF A;  8ICG A;  1L6N A;  5EE0 A;  1TV9 A;  4K4G A;  5F9L A;  3MDA A;  5KFM A;  3M9M B;  1L8L A;  3SI8 A;  4M2Y A;  2KSO A;  4F2S A;  5DQG A;  2QB0 A;  4DQI A;  5J2A A;  1RXW A;  1WCN A;  3F53 A;  5FP0 A;  3LK9 A;  3PW2 A;  1ZQN A;  2V9W A;  1SKS A;  4DSK A;  3C5F A;  4Q44 A;  2ATL A;  5DQH A;  4I2I A;  3IN5 A;  4IQW A;  1S8O A;  4IRK A;  4GXK A;  1XSP A;  2ISP A;  2EZX A;  3QU5 A;  8ICS A;  2IOF A;  2WF6 A;  4Y2U A;  5KFH A;  2W43 A;  5L1M A;  2MU2 A;  2BCS A;  5ALG A;  2Y1J A;  3SR6 A;  5AI6 A;  5JUM A;  1UA1 A;  2HBL A;  1N61 A;  1D8Y A;  3FC4 A;  3KHR A;  2NO5 A;  5HHH A;  1ZQW A;  2NRV A;  3RH5 A;  2XIC A;  4PHD A;  1ZQM A;  7ICG A;  3E58 A;  8ICW A;  2ZXH A;  3EYZ A;  4I2C A;  3RAQ A;  2HSZ A;  2F76 X;  2FMQ A;  4USA A;  1L7N A;  4DWI A;  4IQV A;  3AMZ A;  1ZQT A;  5KAF U;  3RH4 A;  2GLE A;  1D8B A;  1U49 A;  2KEY A;  4GXJ A;  2ZTE A;  2PFQ A;  1L3T A;  2N1R A;  3BS7 A;  4DEZ A;  7ICT A;  4YMM A;  1JXL A;  1MSW D;  2GWS A;  1X9X A;  4X5V A;  4UBB A;  2I9G A;  4P4O A;  2ISO A;  3KKA A;  4ECU A;  3JPT A;  5EE9 A;  5KT4 A;  4CF5 A;  1SXE A;  5AM5 A;  3ISC A;  4EEK A;  3M9N B;  1QCK A;  2BDU A;  2K8C B;  2NRZ A;  5DQI A;  4KX5 A;  1TK8 A;  2EAM A;  1RXV A;  1H38 A;  4OCZ A;  1Z1V A;  4KLG A;  1SB3 C;  4QZG A;  2IBK A;  4K4H A;  2EAN A;  4EYI B;  4DOA A;  4EBC A;  3QX7 A;  1SV0 C;  1RYS A;  2XGQ A;  2CXY A;  5J29 A;  4KLI A;  5IIO A;  4QWD A;  5KFQ A;  5DG9 A;  5AKK A;  3RRH A;  4KLF A;  3C21 A;  2J6S A;  1SV4 A;  1ZXI A;  3AUO A;  9ICT A;  3H4B A;  5J2F A;  2W3S A;  1S0N A;  2QB1 A;  1KSP A;  3Q8Q B;  4DLE A;  4F5P A;  5IIN A;  2KG5 A;  3HPO A;  1XSN A;  3GIK A;  4DL4 A;  3C2K A;  4UB3 A;  5CR0 A;  1ZQL A;  3T5L A;  4O5C A;  4M9L A;  2EAO A;  2DL0 A;  2YQE A;  3TAD C;  4R63 A;  4Z6E A;  5KT3 A;  3SAG A;  3JPP A;  4C4R A;  4UB5 A;  1X40 A;  5ALV A;  1QLN A;  5CWR A;  5ALW A;  2JH1 A;  1QQ5 A;  4I29 A;  4Z6D A;  2FPK A;  2CPR A;  1L8O A;  3IHQ B;  1Z3E B;  4NLC A;  3MR2 A;  3BQ7 A;  5ALJ A;  3TQ1 A;  5KG7 A;  4Q8E A;  2XCP A;  3M9O B;  4J9M A;  1IV8 A;  5J0X A;  3E0F A;  2Y0S F;  2EQY A;  4C8O A;  2XVT A;  7ICO A;  2WAQ F;  2FLN A;  8ICO A;  3GQC A;  5KNI A;  4F91 B;  1N5W A;  3V7J A;  1NK5 A;  1KDH A;  2A1J A;  5A0L A;  3ZDA A;  4UW9 A;  3EUB 2;  8ICL A;  4YFK A;  2EH9 A;  2W54 A;  1NOM A;  1ZQO A;  2K4H A;  2NRX A;  2ZG6 A;  3BZK A;  2HVH A;  3KOO A;  1U4B A;  1L5U A;  4RZR A;  1X2I A;  4O3S A;  5GTI U;  1SL2 A;  5KFW A;  4K4I A;  1NKB A;  1RYR A;  2F2A B;  2JEG A;  1QSL A;  3C1Y A;  3H8J A;  4DOC A;  5J0T A;  1A6S A;  3UM9 A;  3KZX A;  2K4E A;  1SWW A;  2IHN A;  3RB3 A;  8ICH A;  1BPX A;  2DGZ A;  5C0Y A;  1DK2 A;  4RUA A;  1B43 A;  2MSN A;  2JZB A;  3ZDD A;  4FZL A;  3SQI A;  2R8K A;  2ZUD A;  2F1J A;  2MAX A;  3JPN A;  1XS9 D;  3BDP A;  3FYH A;  1DXS A;  3D2N A;  5DBA A;  2V4R A;  1P7D A;  3H8M A;  2PXI A;  3D6J A;  5D4B A;  1SL1 A;  2YB4 A;  4RT3 A;  5AIB A;  4TUS A;  1WUD A;  3H0R B;  2BCR A;  1CUK A;  3QUT A;  9ICE A;  1VLB A;  4RQM A;  3QUC A;  1S0M A;  1ZQU A;  4R8U B;  2F3N A;  4PHP A;  4F2R A;  4BWJ A;  4R8U A;  3S6J A;  1T94 A;  2KK0 A;  2AQ4 A;  1NK0 A;  3UMC A;  5J8Y C;  4BXO B;  9ICR A;  4JUZ A;  2A1A A;  4UAV A;  2H3I A;  4OJ6 A;  5BPC A;  4ECZ A;  1T8E A;  1T4G A;  4B9U A;  7ICF A;  2FPM A;  1Q3U A;  3EZ5 A;  5D46 A;  3RFA A;  7ICK A;  1ZQZ A;  4ECR A;  4M9H A;  3BS5 B;  4CE6 A;  2G07 A;  3PSI A;  3WKA A;  4ELU A;  2DUY A;  3JPS A;  2KFZ A;  4RPZ A;  2FJ6 A;  1XNS A;  4J9K A;  2XGP A;  5J0O A;  2RDJ A;  5CP2 A;  5HNK A;  3VC8 A;  4I2H A;  8ICR A;  9ICB A;  9ICW A;  1CI4 A;  4CF3 A;  4QJF B;  1DGJ A;  1MC8 A;  5ALM A;  3RJK A;  3FAH A;  2BPG A;  3NVV A;  7ICU A;  2ZIX A;  5L1L A;  3RB4 A;  5KFO A;  3IRU A;  3IDW A;  3PO5 A;  1EXN A;  3SEN A;  1Q8K A;  4QIW F;  1TK5 A;  3MFH A;  3OSP A;  2YMM A;  2E8O A;  1KTQ A;  2IMW P;  3D2Q A;  4ELT A;  3DEE A;  2KKV A;  7ICR A;  2HHQ A;  5KFK A;  2DPI A;  1IIP A;  4DF4 A;  5AKX A;  5KFB A;  3L5K A;  1JMS A;  4AP9 A;  4ACO A;  2LYA A;  8ICX A;  1Z00 A;  4JB3 A;  4JMU A;  2E8N A;  4F5Q A;  4ICA A;  4YMO A;  4B6J A;  2KHV A;  3ZD8 A;  4I27 A;  1UHU A;  3C29 A;  4NL9 C;  2NO4 A;  4RQN A;  4GIB A;  2E8P A;  1RQL A;  3Q8S B;  5AI5 A;  4OJL A;  2XI9 A;  1BNO A;  3L3F X;  4TQS A;  1ZQD A;  5DB7 A;  4IL6 U;  1BVS A;  5KFL A;  2JZB B;  2XY7 A;  3GIL A;  8ICI A;  4PHE A;  5ALE A;  1F5S A;  2EAP A;  1JN3 A;  4DFJ A;  1XWL A;  3SYZ A;  2G0A A;  2W11 A;  5KFP A;  3ZDB A;  2CN1 A;  3WK8 A;  2BPC A;  2HHV A;  2BGW A;  1KFT A;  4KTQ A;  2WF5 A;  3BZC A;  2KE7 A;  1VJ5 A;  4DQP A;  2DWQ A;  5AM3 A;  5DG7 A;  1S77 D;  3QXG A;  3LVW A;  5AKE A;  2Q4T A;  4Y2V A;  3BQ0 A;  4ED8 A;  2KFN A;  4AYB C;  1KFD A;  4UAU A;  4YD2 A;  3GV5 B;  2BHN A;  1NK6 A;  3HT3 A;  4M9J A;  4UAZ A;  1MQ3 A;  1KQQ A;  4ED7 A;  1X42 A;  3V6J A;  3QEB Z;  1T3N A;  1SKW A;  2K4I A;  3MR5 A;  1ZJM A;  5J2C A;  5DLF A;  3AN1 A;  3C1Z A;  5AKJ A;  3SV3 A;  3Q8M A;  3QUB A;  1DK3 A;  5EE1 A;  4C7Y A;  1BPB A;  2YY6 A;  3TAP A;  4DQS A;  4EEN A;  2JGA A;  5ALX A;  4ED6 A;  2NRW A;  3RJF A;  1UQV A;  3IP4 B;  4FBT A;  2I1Q A;  2LYB A;  2HOI A;  3NRW A;  5G5G A;  2FI1 A;  3TAQ A;  3H8S A;  2YN4 A;  3A0B U;  2H3Z A;  4LJX A;  2JEJ A;  5IIJ A;  2I5H A;  1ZD4 A;  2ASL A;  2H5X A;  2WHE A;  3M8S A;  3HKZ F;  4BDP A;  3OGU A;  8ICV A;  3KHL A;  5KFA A;  3PVX A;  2C28 A;  2W04 A;  1L3U A;  2EZY A;  2LM1 A;  2W3R A;  3EPI A;  4FS1 A;  2P6R A;  1ZQI A;  5AK6 A;  4TUR A;  4XQ8 A;  5KFE A;  4UB6 U;  4OJO A;  2GH1 A;  2YMP A;  3MC1 A;  4RQ1 A;  1L3V A;  2AQ0 A;  4LZG A;  4YR2 A;  2G5I B;  1L7M A;  2LPE A;  4DSF A;  3MDC A;  4ECX A;  9ICG A;  1QH9 A;  2G06 A;  1AQ6 A;  1IM4 A;  1RQN A;  1TFR A;  1PVP A;  8ICY A;  2WF9 A;  4Y2J A;  5III A;  3G6X A;  2VKQ A;  3SAH A;  5DGA A;  1BPD A;  1RYU A;  2AGQ A;  5KFZ A;  2WTF A;  1HEK A;  1K1S A;  3H8W A;  2HHU A;  5HR6 A;  5ALS A;  4RU9 A;  2KZ3 A;  4KLE A;  1UCV A;  3HIL A;  4PZO A;  4BXO A;  1SZH A;  5KFV A;  4IR9 A;  5AM1 A;  2D3D A;  1Z1B A;  4NM2 A;  1SZP A;  2H3Q A;  1YZ7 A;  2B6G A;  5AI9 A;  4RPX A;  3RJJ A;  3GFK B;  2JEF A;  2KJ9 A;  2W9A A;  3JPR A;  3GDX A;  3V72 A;  5KFX A;  2UVU A;  3TAC B;  5DB8 A;  3H0M B;  4QWA A;  3O0F A;  3PML A;  5DBB A;  4YXM A;  4TUP A;  4KLT A;  7ICP A;  2DBY A;  4C8K A;  3PW5 A;  4NLN A;  2YML A;  4CRX A;  2KN7 A;  3N28 A;  2RDI A;  2W7P A;  2D8C A;  3KBB A;  1ZQK A;  3NS1 A;  4NXZ A;  3RF9 A;  5KG2 A;  2XC9 A;  3EPG A;  3F5E A;  8ICQ A;  8ICZ A;  2F44 A;  5EOZ A;  2HHX A;  4MF2 A;  5E79 U;  2LKY A;  3H7I A;  2ZIU B;  4LZD A;  4U6P A;  1BPZ A;  1JRO A;  2W7O A;  4PHA A;  3MFI A;  3UQ2 A;  4O3P A;  5KFY A;  1KFS A;  3QU9 A;  5J2I A;  5ALD A;  2W8L A;  3AQE A;  2KZZ A;  3ZI4 A;  1JUD A;  4EX7 A;  4ECS A;  4FZN A;  3UXN A;  3ISB A;  1X66 A;  4G9B A;  1U48 A;  4F72 A;  1RDF A;  2KD1 A;  2O6K A;  2IA6 A;  3PV8 A;  4TUQ A;  5JU5 A;  4P0Q A;  2OEH A;  9ICQ A;  1TAQ A;  4M6W A;  4NJ8 A;  3THV A;  4DL3 A;  5J0Q A;  3TI0 A;  3KHH A;  9ICN A;  1ZQH A;  3QU4 A;  4ED0 A;  2LYH A;  4P0P A;  2HCF A;  3DV9 A;  4I2B A;  3NUQ A;  9ICF A;  4ECQ A;  4IRC A;  3C2M A;  2AJQ A;  2HBM A;  5AI0 A;  5KFF A;  3PO4 A;  2B21 A;  4KLM A;  4GC7 A;  3GU3 A;  1PZN A;  4Z6F A;  3OJS A;  4YN4 A;  3PW7 A;  5CHG A;  4GC6 A;  1NJZ A;  2C22 A;  2R8G A;  1X9S A;  2DQN B;  1FEZ A;  2YX8 A;  5ALN A;  1V38 A;  3D2S A;  4I2G A;  1JX4 A;  2DF4 B;  3EW9 A;  4F50 A;  3I1Y A;  1S10 A;  2ZUC A;  1UA0 A;  2E5S A;  5ALH A;  3H4D A;  2IOF K;  3UXP A;  4KLQ A;  3B9J A;  8ICB A;  2ZIV A;  3SD7 A;  7ICL A;  1PK1 B;  4FE3 A;  4PH5 A;  3M8R A;  4NLB A;  3SV4 A;  3T5K A;  2P35 A;  4CDG A;  4JV1 A;  2A3V A;  2MUT A;  2RLT A;  5KG0 A;  3IG8 A;  1C20 A;  2FMS A;  1ECW A;  5AK4 A;  4QW8 A;  5J2E A;  3GV7 B;  3MR3 A;  2DPJ A;  1Z00 B;  3J81 j;  1ZQB A;  2QLT A;  4F5R A;  2KNJ A;  1RPL A;  4NLG A;  4QZD A;  5KFC A;  2K4P A;  5BOL A;  2PFN A;  4B9V A;  3B0X A;  4I28 A;  1TE2 A;  4I2J A;  4RQ6 A;  4KLL A;  4UB8 U;  5DDY A;  4I2A A;  1X6I A;  1ZJN A;  1S76 D;  2HBJ A;  2W9B A;  4IR1 A;  9ICM A;  4DSL A;  3IG5 A;  2ZJ8 A;  2PI5 A;  3T5J A;  4US8 A;  4DO9 A;  4P2H A;  4MF8 A;  4DQQ A;  1F0M A;  3TKA A;  2OXO A;  3MGH A;  4I2D A;  1NZB A;  3GV8 B;  4I2E A;  5KT2 A;  2J6U A;  1ZOL A;  2RQ5 A;  2ZJ5 A;  4DSE A;  2ZJA A;  1Z4N A;  2ZIV B;  3EWA A;  5DB9 A;  5KT6 A;  4RUC A;  1SGG A;  3CNH A;  4EBE A;  4P4M A;  4DL5 A;  2KJ8 A;  4B9T A;  2PKE A;  3MBY A;  4G3I A;  4QZI A;  4TQR A;  3PW0 A;  5HHI A;  2IOH A;  1QTM A;  1ZQ1 C;  2QKQ A;  2KKP A;  4O5E A;  1NK8 A;  4EZ6 A;  3RBD A;  2MRL A;  3I76 A;  3GII A;  5KL1 B;  3FM9 A;  1N56 A;  4JV2 A;  2VJ4 A;  3RR7 A;  1S5L U;  4WJ3 B;  5AKI A;  2BPF A;  2GOL A;  3WK5 A;  2KV2 A;  2KVS A;  3RB0 A;  1ARO P;  2YTU A;  1ZRN A;  3RJG A;  2BCV A;  2OH2 A;  1KBU A;  4C8M A;  5TIS U;  4B9S A;  5KG3 A;  3TAN A;  5ALU A;  2XY5 A;  2UVR A;  2Z7J A;  3MR6 A;  4RQ4 A;  3UMB A;  1XO0 A;  1B22 A;  9ICU A;  1PK3 A;  1WG8 A;  4O3N A;  4CGZ A;  1Z19 A;  4R65 A;  1A77 A;  1JIH A;  4YXJ A;  3C2L A;  5AIC A;  2F8L A;  4QZH A;  9ICO A;  2E1F A;  4DL6 A;  8ICC A;  5AM2 A;  3RAX A;  4RNO A;  2HDO A;  1FFU A;  2MA1 A;  4M9G A;  2HHS A;  2WAQ C;  7ICN A;  2PFP A;  3QU7 A;  4Y2P A;  5AKY A;  4YCX A;  4F4K A;  4KX3 A;  2BQU A;  3LWL A;  5J2J A;  2J6T A;  1ZQR A;  1O03 A;  1PVR A;  5ALT A;  1JXE A;  3SAF A;  1XSL A;  4KMU A;  3PX6 A;  3RBE A;  2AGP A;  1XU4 A;  4C80 A;  3C23 A;  1K1Q A;  4PJ0 U;  1U9L A;  9ICA A;  1ZQQ A;  1T7P A;  2W9C A;  1L7O A;  2YMQ A;  3N7P D;  2HW3 A;  5H2F U;  4M47 A;  1FO4 A;  1N62 A;  3AU6 A;  9ICP A;  4DSJ A;  4O3M A;  3CP8 A;  5AK3 A;  2H3V A;  4KN4 A;  1JI7 A;  2AU0 A;  5T14 A;  3PX4 A;  3AQF A;  3MGI A;  9ICS A;  5J0R A;  2NRT A;  2IHM A;  3GIM A;  4NL9 A;  3WKD A;  1TAM A;  4O0I A;  2D6F C;  2F1I A;  2A1J B;  3TFS A;  4M9N A;  4NWI A;  2DKZ A;  5HML A;  5DGB A;  1DRG A;  3H40 A;  2G08 A;  2JH7 A;  4JV0 A;  4NLZ A;  3PST A;  4J9O A;  2XY6 A;  3M6K A;  2ZTC A;  1SV0 A;  2HMX A;  5AK5 A;  4RPY A;  4O3Q A;  1ZQA A;  3KZI U;  4F4W A;  2W9B B;  2KIW A;  2EZZ A;  3LVV A;  1S9F A;  3WKC A;  3QU2 A;  2LBO A;  1J2N A;  1RG6 A;  2PFO A;  4UAS A;  8ICA A;  4IQT A;  4QWB A;  4EEL A;  2ZIW A;  3SZ2 A;  4FO6 A;  4F3O A;  4UBC A;  5J2K A;  4P4P A;  1BPE A;  3CW2 C;  3M7D A;  4F4X A;  3WU2 U;  4NY8 A;  5DB6 A;  5KFT A;  3T5H A;  4P0Q B;  3N4M B;  2DFL A;  4OD0 A;  4A8E A;  4QNL A;  2XCA A;  3RR8 A;  2Y0S C;  2HHW A;  3N7S C;  1KN5 A;  2NYV A;  4PGQ A;  2ZIX B;  4MFA A;  4UAT A;  4QZ8 A;  4DSI A;  1ZD2 P;  2V4Q A;  4HYK A;  4MFF A;  1NKE A;  2VA2 A;  5IIK A;  1V85 A;  2OHF A;  4MEX A;  4GXI A;  1NK4 A;  2JHD A;  2BCQ A;  8ICM A;  2K60 A;  4FFD A;  4ECW A;  1HIW A;  2XID A;  1X9M A;  3TAR A;  4C8L A;  1JRP A;  1COK A;  3HWT A;  4PGY A;  1B4F A;  1CEZ A;  1LB2 B;  4KLD A;  4EZ9 A;  1NK7 A;  5KAI U;  1QSS A;  1LKY B;  1TVA A;  4KLH A;  4Q43 A;  4UQG A;  3KTQ A;  4J03 A;  2AGO A;  4DFK A;  1QQ6 A;  1NNL A;  5J0P A;  1DOQ A;  1ED1 A;  4US9 A;  5HP4 A;  5B5E U;  2M0N A;  3G6V A;  1HJP A;  4UB4 A;  1ZRM A;  4C4T A;  4RQ5 A;  4EBD A;  2WFA A;  4F93 B;  1Q3V A;  5CB1 A;  5ALP A;  1JAL A;  2JRZ A;  3V7K A;  2HBK A;  3WK6 A;  3Q8R B;  3JPO A;  1J97 A;  2HHT A;  4CNQ A;  4BGD A;  8ICE A;  4DS4 A;  4DFD A;  2FE9 A;  4UAR A;  1BGX T;  3HKZ C;  4KIT B;  4Y2R A;  2W55 A;  1TK0 A;  4QZF A;  5J0Y A;  3MAB A;  3IM1 A;  5KFD A;  1MQ2 A;  5L1J A;  3V6K A;  4Q45 A;  3HW8 A;  5CRX A;  3NGD A;  4PPX A;  4RQ3 A;  2EDU A;  4OJ5 A;  7ICH A;  4BJQ A;  4BX9 C;  1LVH A;  4PL1 A;  5AKL A;  2KHQ A;  1MN8 A;  3ORY A;  2HOQ A;  5KFI A;  7ICJ A;  5GTH U;  1N48 A;  4C8N A;  2FLP A;  1V9P A;  3F2C A;  5J0W A;  2VJ5 A;  5B66 U;  4MEY A;  1ZQS A;  2QAR A;  2JR5 A;  5ALR A;  4KLO A;  4NLK A;  9ICH A;  3WK9 A;  9ICC A;  3QUQ A;  5F9N A;  4M6W B;  4UAW A;  2R8J A;  1COO A;  5IIL A;  8ICT A;  2OYY A;  3PX0 A;  3RJI A;  1NJX A;  1U45 A;  7ICV A;  4F71 A;  1N60 A;  3LYS A;  1PVQ A;  1N5X A;  5ALZ A;  5L1K A;  2FPL A;  4CF4 A;  4R64 A;  2M9N A;  2W9M A;  4KN7 A;  4I2F A;  3QE9 Y;  3HP6 A;  3NVW A;  3ICX A;  4F4Z A;  2AXT U;  1KLN A;  4DCC A;  2WB1 C;  4J9P A;  2K89 A;  4Y2Q A;  2BQR A;  1S0O A;  8ICK A;  5AM0 A;  4KMO B;  2B0C A;  3OHA A;  5J2H A;  1B0X A;  2WF7 A;  3RJH A;  3NTU A;  2KTQ A;  3L4P A;  1HUZ A;  2G09 A;  5EWG A;  2KMD A;  4RQ2 A;  1NJW A;  1BNP A;  5KG4 A;  4QW9 A;  2E1E A;  4IS7 A;  1UPH A;  1KKX A;  4QZA A;  3F2D A;  3PNC A;  4QZ9 A;  1SIJ A;  1L7P A;  4OJP A;  2G5H B;  5HR7 A;  8ICN A;  5AM4 A;  4RNN A;  1LV5 A;  3K75 D;  1URJ A;  8ICU A;  2LI6 A;  4HAI A;  3B0Y A;  1KEJ A;  1ZQP A;  4ED1 A;  2E8M A;  7ICS A;  2Y1I A;  3CYM A;  4ELV A;  4IC9 A;  1RZT A;  3U26 A;  5J0U A;  3MGV A;  4KLS A;  3BQ1 A;  4DFP A;  8ICF A;  5KT5 A;  1WYG A;  2Q0Z X;  3R9K A;  2LMR A;  4LVS A;  1C7Y A;  4EEY A;  1SKR A;  4OO1 J;  2KIC A;  2BKE A;  1ZQY A;  4B9L A;  4NV0 A;  1X9W A;  4JK1 A;  2CRX A;  5KG1 A;  2ALZ A;  5K4L A;  2JXJ A;  2ES6 A;  2C2D A;  4RQ0 A;  3OHB A;  2OM6 A;  3JPQ A;  2E3T A;  1TAU A;  2BZF A;  1D8L A;  9ICX A;  5KFS A;  3PMN A;  1ZD5 A;  2F1H A;  5ALY A;  2FMP A;  2ZTD A;  1N63 A;  4B9N A;  7ICM A;  1NK9 A;  3AU2 A;  1Q46 A;  2AHO B;  2WB1 F;  1HUO A;  3ZD9 A;  3ETR A;  2ZXI A;  3C28 A;  2R8H A;  5AKG A;  3ONN A;  4O3R A;  3AL0 B;  1ZQV A;  5KFJ A;  3HRD D;  4DL2 A;  1SXD A;  1UT8 A;  3PSP A;  4FS2 A;  4RNM A;  3PW4 A;  2MUT B;  4Y2Y A;  5ALF A;  2LM4 A;  2Y9T A;  7ICE A;  3ZDE A;  4R66 A;  3WKE A;  3UQ0 A;  4DFM A;  4M04 A;  5D49 A;  4Z6C A;  3PY8 A;  2KOB A;  3N7R C;  2K8B B;  2P6U A;  4KLJ A;  3Q8P B;  2I6X A;  1ZQX A;  4O3O A;  4UAY A;  2KIV A;  4IQU A;  3TFR A;  4J9N A;  2UVV A;  2WF8 A;  3G6Y A;  5KTQ A;  1NZP A;  5ALO A;  2NV3 A;  2YB1 A;  3KD3 A;  3TAD A;  3RTV A;  3F5A A;  1NI3 A;  1BPY A;  2F77 X;  3ALR A;  5ALQ A;  1OXJ A;  3QNM A;  4F5O A;  1D9F A;  1ZD3 A;  4PZN A;  1T3Q A;  5EWF A;  3N97 B;  4Y2T A;  4AYB F;  2QAR B;  4QIW C;  2W9C B;  2W8K A;  9ICI A;  1K5O A;  1L3S A;  4O5K A;  2K8A A;  5J0S A;  4F4Y A;  5EE3 A;  2PMZ C;  1LKY A;  2W03 A;  5F3X B;  3QEA Z;  4Y2S A;  2R18 A;  3Q8L A;  5JRT A;  1D9D A;  4DQR A;  2KSO B;  1ZQJ A;  1FIQ A;  9ICK A;  4Q8F A;  1QSY A;  1PK1 A;  3OTQ A;  1MA7 A;  5CEH A;  4QZB A;  1WWU A;  2R8I A;  4YQW A;  2HVI A;  4YG2 A;  4YR0 A;  3NRZ A;  1IXR A;  5HMM A;  1XC9 A;  3CRX A;  4DL7 A;  5DLG A;  1IG6 A;  5J2D A;  3UPQ A;  4ZOH C;  4J9Q A;  4KLU A;  4E0D A;  2DKX A;  4YD1 A;  5DG8 A;  5J2B A;  2JV3 A;  3VCB A;  4RQ8 A;  1PUZ A;  5KFN A;  4F5N A;  4XUS A;  5AKH A;  1F44 A;  8ICP A;  4J9L A;  5G5H A;  4PGX A;  1U47 A;  3PR5 B;  3PZP A;  4IRD A;  2JEI A;  4UB2 A;  2HI0 A;  1ZET A;  4DOB A;  3M1Y A;  1S0V A;  2VAN A;  2PMZ F;  4C4S A;  4ZH4 A;  3K1R B;  2C2R A;  3BJY A;  3T3F A;  4M0A A;  5J2G A;  2KP7 A;  3HX0 A;  2L5Y A;  2VA8 A;  4UB1 A;  3M6Z A;  5AIA A;  3RH6 A;  4PL2 A;  5AI8 A;  4RT2 A;  3H0L B;  1X6J A;  3Q8K A;  4C7Z A;  2C2E A;  4MFC A;  4ED2 A;  3OPX A;  3ISD A;  4DS5 A;  2BR0 A;  5AI4 A;  5L1I A;  5L9X A;  1ZQC A;  3LDA A;  1J2M A;  3NVY A;  3IV6 A;  4ED3 A;  1A76 A;  2VA3 A;  3GIJ A;  3SMV A;  3RJE A;  7ICI A;  1RM6 C;  2BDP A;  3WKB A;  4ECT A;  4QWE A;  5AHX A;  3V6H A;  1Y88 A;  5AKZ A;  3PR4 A;  1OW5 A;  5KT7 A;  3KHG A;  1QQ7 A;  8ICJ A;  4J9R A;  3QYP A;  3BQ2 A;  2RP5 A;  4DF8 A;  5KFR A;  2GO7 A;  4Y2X A;  5DBC A;  3QZ7 A;  1VDV A;  3C5G A;  4QWC A;  3F2B A;  3LWM A;  4O9M A;  4JWM A;  3NAS A;  4P0P B;  2PI4 A;  4ECV A;  4F92 B;  1YZ6 A;  4NM1 A;  5KFG A;  3V7L A;  4QZC A;  1ZQE A;  1ZQF A;  4CCH A;  4F8R A;  9ICL A;  3I28 A;  1M6Y A;  4FBU A;  5KL8 B;  3PSF A;  1KRP A;  5DKW A;  3ED5 A;  1DGS A;  4EYH B;  3AM9 A;  3E2E A;  2UVW A;  3RB6 A;  5JTI A;  1OUQ A;  3HJE A;  3SEI A;  4ECY A;  7ICQ A;  1SL0 A;  5IIM A;  1NKC A;  2FLL A;  1ZQG A;  2AH5 A;  4EX6 A;  5KG5 A;  1Z4O A;  3RRG A;  3T79 A;  3UMG A;  4RQ7 A;  3ETL A;  3NVZ A;  2BQ3 A;  5KFU A;  3DDH A;  3KKA C;  9ICV A;  4YR3 A;  5J8Y A;  1XO1 A;  1A0P A;  4YMN A;  1O08 A;  2ZUB A;  1YT3 A;  1V97 A;  5CJ7 A;  3K4G A;  2A19 A;  4BWM A;  2QB0 B;  4J9S A;  5C5J A;  2Y9U A;  3A0H U;  3K1Z A;  4JWN A;  1GO3 F;  2LHT A;  2ZIW B;  1SWV A;  5CA7 A;  5BOM A;  2ASD A;  4DLG A;  5KG6 A;  2OCE A;  4U7C A;  2VIX A;  1N2X A;  4XA5 A;  3OJU A; 
#chains in the Genus database with same CATH homology
 3UXO A;  1ZJN A;  1S76 D;  8ICK A;  3OHA A;  5J2H A;  2W9B A;  1MC8 A;  1TKD A;  4IR1 A;  3RJH A;  3RJK A;  2OWO A;  3NTU A;  2KTQ A;  2BPG A;  4DSL A;  9ICM A;  1HUZ A;  2ZJ8 A;  4YP3 A;  2PI5 A;  3T5J A;  7ICU A;  4YVZ A;  5TZV A;  4DO9 A;  2KZM A;  5EWE A;  4QZE A;  5L1L A;  4P2H A;  4MF8 A;  5EWG A;  3RB4 A;  1NJW A;  4RQ2 A;  4DQQ A;  3ZDC A;  5KFO A;  1ZYQ A;  5KG4 A;  4QW9 A;  3MGH A;  4I2D A;  3PO5 A;  5DDM A;  3GV8 B;  2P66 A;  3OSN A;  1EXN A;  4QZA A;  1UT5 A;  3PNC A;  4I2E A;  4QZ9 A;  5KT2 A;  2J6U A;  1TK5 A;  4DSE A;  2ZJ5 A;  3MFH A;  3OSP A;  2ASJ A;  2ZJA A;  1KTQ A;  5DB9 A;  2BCU A;  3EWA A;  4B9M A;  2IMW P;  4ELT A;  3RJJ A;  3FDS A;  4GLX A;  8ICN A;  7ICR A;  3BQT A;  5KT6 A;  2HHQ A;  4RUC A;  4RNN A;  4EBE A;  4DL5 A;  4P4M A;  1LV5 A;  3K75 D;  1WCL A;  4B9T A;  8ICU A;  3MBY A;  5KFK A;  2DPI A;  3B0Y A;  4G3I A;  1KEJ A;  4QZI A;  4XRH A;  4TQR A;  3QZ8 A;  4DF4 A;  3PW0 A;  1NJY A;  1ZQP A;  5HHI A;  5KFB A;  4ED1 A;  7ICS A;  2Y1I A;  1QTM A;  9ICJ A;  1JMS A;  4ELV A;  4O5E A;  1NK8 A;  1S97 A;  1RZT A;  8ICX A;  1Z00 A;  2XO7 A;  8ICG A;  8ICR A;  5J0U A;  1TV9 A;  4KLS A;  4EZ6 A;  3RBD A;  3BQ1 A;  4DFP A;  4F5Q A;  8ICF A;  4YMO A;  5KT5 A;  4K4G A;  5F9L A;  2Q0Z X;  4LVS A;  3GII A;  3ZD8 A;  4I27 A;  3MDA A;  1C7Y A;  4EEY A;  1SKR A;  1N56 A;  2BKE A;  5KFM A;  4JV2 A;  1ZQY A;  3M9M B;  4B9L A;  1X9W A;  4JK1 A;  3SI8 A;  3RR7 A;  4M2Y A;  5KG1 A;  2ALZ A;  2C2D A;  2BPF A;  3Q8S B;  4F2S A;  4RQ0 A;  5DQG A;  3OHB A;  3RB0 A;  4DQI A;  3JPQ A;  1ARO P;  4TQS A;  5J2A A;  4Q8E A;  1RXW A;  1TAU A;  1ZQD A;  1WCN A;  5DB7 A;  1D8L A;  9ICX A;  3RJG A;  3LK9 A;  2BCV A;  1BVS A;  3PW2 A;  5KFS A;  3PMN A;  4C8M A;  2JZB B;  2F1H A;  5KFL A;  2XY7 A;  1ZQN A;  4B9S A;  5KG3 A;  3GIL A;  3TAN A;  8ICI A;  2XY5 A;  2ZTD A;  2FMP A;  2UVR A;  3MR6 A;  4PHE A;  4RQ4 A;  4B9N A;  7ICM A;  2V9W A;  1NK9 A;  1B22 A;  3AU2 A;  1JN3 A;  1SKS A;  3C5F A;  4DSK A;  1HUO A;  3ZD9 A;  4Q44 A;  5DQH A;  4DFJ A;  1XWL A;  2ATL A;  3SYZ A;  9ICU A;  4O3N A;  5KFP A;  2R8H A;  3ZDB A;  4I2I A;  4IQW A;  4R65 A;  4IRK A;  2BPC A;  4GXK A;  1XSP A;  2ISP A;  1A77 A;  1JIH A;  4O3R A;  4YXJ A;  3C2L A;  2HHV A;  8ICS A;  2BGW A;  1ZQV A;  5KFJ A;  5KFH A;  1KFT A;  4KTQ A;  4QZH A;  4DL2 A;  9ICO A;  1UT8 A;  4DQP A;  5DG7 A;  2BCS A;  1S77 D;  2Y1J A;  4FS2 A;  5JUM A;  4RNM A;  3PW4 A;  1UA1 A;  3BQ0 A;  4DL6 A;  4ED8 A;  2MUT B;  8ICC A;  2KFN A;  1KFD A;  3RAX A;  4RNO A;  1D8Y A;  3KHR A;  4YD2 A;  3GV5 B;  2BHN A;  7ICE A;  1NK6 A;  3HT3 A;  3ZDE A;  5HHH A;  1ZQW A;  2NRV A;  4R66 A;  4UAZ A;  3UQ0 A;  1MQ3 A;  4ED7 A;  2PFP A;  4DFM A;  4M9J A;  3RH5 A;  4M04 A;  5D49 A;  4Z6C A;  3PY8 A;  4PHD A;  1ZQM A;  4YCX A;  7ICG A;  4F4K A;  3V6J A;  3QEB Z;  8ICW A;  1T3N A;  3EYZ A;  2BQU A;  4I2C A;  1SKW A;  3RAQ A;  3LWL A;  5J2J A;  3MR5 A;  2FMQ A;  2J6T A;  1ZJM A;  2P6U A;  5J2C A;  5DLF A;  4KLJ A;  3Q8P B;  1ZQR A;  2HHS A;  1ZQX A;  3C1Z A;  4DWI A;  4IQV A;  1JXE A;  1ZQT A;  3RH4 A;  4O3O A;  4UAY A;  3SV3 A;  1XSL A;  4KMU A;  3Q8M A;  1U49 A;  3PX6 A;  3RBE A;  4GXJ A;  2AGP A;  2ZTE A;  2PFQ A;  1XU4 A;  4IQU A;  3TFR A;  1L3T A;  4J9N A;  2UVV A;  3C23 A;  1K1Q A;  3G6Y A;  4DEZ A;  1U9L A;  1BPB A;  5KTQ A;  1ZQQ A;  9ICA A;  3TAP A;  4DQS A;  7ICT A;  1T7P A;  4ED6 A;  2NRW A;  4YMM A;  2W9C A;  1JXL A;  1MSW D;  3RJF A;  2HW3 A;  4FBT A;  4M47 A;  2I1Q A;  2GWS A;  4X5V A;  3RTV A;  3AU6 A;  1BPY A;  9ICP A;  4DSJ A;  4UBB A;  2I9G A;  3H8S A;  4KN4 A;  4P4O A;  3TAQ A;  2ISO A;  2JEJ A;  5IIJ A;  4F5O A;  1D9F A;  2AU0 A;  4ECU A;  2ASL A;  2H5X A;  3JPT A;  3M8S A;  5KT4 A;  5EWF A;  3PX4 A;  4BDP A;  3N97 B;  3MGI A;  9ICS A;  5J0R A;  3ISC A;  3OGU A;  4KLL A;  3M9N B;  8ICV A;  3KHL A;  5KFA A;  2NRT A;  2IHM A;  2NRZ A;  5DQI A;  3GIM A;  1TK8 A;  1RXV A;  4O0I A;  1H38 A;  2F1I A;  2A1J B;  2W9C B;  2W8K A;  3TFS A;  4M9N A;  4KLG A;  3PVX A;  4QZG A;  2C28 A;  5HML A;  1L3U A;  2IBK A;  4K4H A;  9ICI A;  5DGB A;  4EYI B;  4DOA A;  1L3S A;  4O5K A;  5J0S A;  4EBC A;  3EPI A;  4F4Y A;  4FS1 A;  2P6R A;  3H40 A;  7ICN A;  1RYS A;  1ZQI A;  4XQ8 A;  5KFE A;  4TUR A;  2XGQ A;  4JV0 A;  4NLZ A;  4J9O A;  5J29 A;  3QEA Z;  4KLI A;  5IIO A;  2XY6 A;  4QWD A;  2ZTC A;  3Q8L A;  1D9D A;  4DQR A;  5KFQ A;  5DG9 A;  1ZQJ A;  4RPY A;  4O3Q A;  1ZQA A;  9ICK A;  4Q8F A;  1QSY A;  4F4W A;  4RQ1 A;  2W9B B;  3RRH A;  4KLF A;  4QZB A;  3C21 A;  2AQ0 A;  1L3V A;  4LZG A;  2R8I A;  2J6S A;  4YQW A;  4YR2 A;  3AUO A;  1S9F A;  2HVI A;  3H4B A;  4YG2 A;  5J2F A;  9ICT A;  4DSF A;  4YR0 A;  3MDC A;  4ECX A;  1S0N A;  9ICG A;  1IXR A;  5HMM A;  1XC9 A;  1KSP A;  3Q8Q B;  4DL7 A;  2PFO A;  8ICA A;  5DLG A;  5J2D A;  4DLE A;  4F5P A;  1IM4 A;  4IQT A;  3UPQ A;  5IIN A;  4QWB A;  4J9Q A;  4KLU A;  3HPO A;  1TFR A;  4E0D A;  8ICY A;  4YD1 A;  1XSN A;  3SZ2 A;  4FO6 A;  4F3O A;  5DG8 A;  3GIK A;  5J2B A;  5III A;  3C2K A;  4DL4 A;  4RQ8 A;  3G6X A;  5KFN A;  4F5N A;  4XUS A;  5DGA A;  1BPD A;  4UBC A;  2AGQ A;  5KFZ A;  5J2K A;  4P4P A;  4UB3 A;  1BPE A;  5CR0 A;  2WTF A;  3T5L A;  1ZQL A;  8ICP A;  4F4X A;  4J9L A;  1K1S A;  4O5C A;  4M9L A;  4NY8 A;  5DB6 A;  5KFT A;  3H8W A;  2HHU A;  3T5H A;  4PGX A;  3N4M B;  4R63 A;  4Z6E A;  2DFL A;  5KT3 A;  4RU9 A;  1U47 A;  2KZ3 A;  3PR5 B;  4KLE A;  3JPP A;  4IRD A;  4UB5 A;  2XCA A;  2JEI A;  1QLN A;  5CWR A;  4BXO A;  4UB2 A;  3RR8 A;  1ZET A;  5KFV A;  4DOB A;  4I29 A;  4Z6D A;  4IR9 A;  2HHW A;  2FPK A;  4NM2 A;  1S0V A;  1SZP A;  4PGQ A;  3IHQ B;  2VAN A;  1Z3E B;  4MFA A;  3MR2 A;  4QZ8 A;  4DSI A;  3TQ1 A;  2V4Q A;  4HYK A;  4RPX A;  5KG7 A;  4ZH4 A;  3GFK B;  2XCP A;  3M9O B;  1NKE A;  2JEF A;  4J9M A;  5IIK A;  2C2R A;  5J0X A;  3JPR A;  2W9A A;  2VA2 A;  3BJY A;  3T3F A;  4MEX A;  3GDX A;  4M0A A;  3V72 A;  5KFX A;  5J2G A;  4GXI A;  1NK4 A;  2UVU A;  5DB8 A;  4QWA A;  2BCQ A;  8ICM A;  3HX0 A;  3PML A;  5DBB A;  4YXM A;  4TUP A;  4ECW A;  2VA8 A;  4C8O A;  4KLT A;  4UB1 A;  7ICP A;  7ICO A;  2FLN A;  4C8K A;  3PW5 A;  3RH6 A;  4NLN A;  8ICO A;  1X9M A;  3GQC A;  3TAR A;  2KN7 A;  4C8L A;  4F91 B;  4RT2 A;  2RDI A;  3HWT A;  3Q8K A;  4PGY A;  3V7J A;  1ZQK A;  4NXZ A;  5KG2 A;  2C2E A;  2XC9 A;  4MFC A;  1CEZ A;  1NK5 A;  1KDH A;  4ED2 A;  3EPG A;  1LB2 B;  4KLD A;  4EZ9 A;  2A1J A;  1NK7 A;  1QSS A;  8ICQ A;  8ICZ A;  3ISD A;  5EOZ A;  2HHX A;  4MF2 A;  4DS5 A;  2BR0 A;  1TVA A;  4KLH A;  3H7I A;  4Q43 A;  5L9X A;  5L1I A;  3ZDA A;  4UQG A;  3KTQ A;  1ZQC A;  3LDA A;  4LZD A;  4DFK A;  2AGO A;  1BPZ A;  8ICL A;  4YFK A;  1A76 A;  5J0P A;  4ED3 A;  4PHA A;  3MFI A;  3UQ2 A;  2VA3 A;  4O3P A;  5KFY A;  1KFS A;  1DOQ A;  1NOM A;  3GIJ A;  3RJE A;  1ZQO A;  7ICI A;  5J2I A;  2NRX A;  5HP4 A;  2BDP A;  3G6V A;  2W8L A;  4ECT A;  1HJP A;  4QWE A;  2HVH A;  2KZZ A;  1U4B A;  4UB4 A;  1L5U A;  4RZR A;  1X2I A;  1Y88 A;  3V6H A;  4O3S A;  4RQ5 A;  4ECS A;  3PR4 A;  4EBD A;  4F93 B;  1SL2 A;  5CB1 A;  3UXN A;  3ISB A;  4MFF A;  5KT7 A;  3KHG A;  3V7K A;  5KFW A;  4K4I A;  1U48 A;  8ICJ A;  1NKB A;  1RYR A;  4J9R A;  9ICW A;  2JEG A;  1QSL A;  2IA6 A;  3C1Y A;  3PV8 A;  3BQ2 A;  4TUQ A;  3Q8R B;  3H8J A;  4DOC A;  5J0T A;  3JPO A;  4DF8 A;  2HHT A;  5KFR A;  9ICQ A;  5DBC A;  3QZ7 A;  1TAQ A;  4M6W A;  4BGD A;  3C5G A;  4QWC A;  4DS4 A;  3LWM A;  8ICE A;  3THV A;  2IHN A;  3RB3 A;  8ICH A;  4DL3 A;  5J0Q A;  1BGX T;  1BPX A;  4O9M A;  3TI0 A;  4KIT B;  4JWM A;  3KHH A;  9ICN A;  4RUA A;  1TK0 A;  1ZQH A;  4ED0 A;  1B43 A;  2LYH A;  4QZF A;  5J0Y A;  2PI4 A;  4I2B A;  3MAB A;  9ICF A;  2JZB A;  4ECQ A;  4ECV A;  3ZDD A;  3IM1 A;  5KFD A;  4F92 B;  2R8K A;  4IRC A;  3C2M A;  2ZUD A;  5KFG A;  1MQ2 A;  4M9G A;  4NM1 A;  3V7L A;  4QZC A;  2F1J A;  5L1J A;  1ZQE A;  1ZQF A;  4CCH A;  2MAX A;  3V6K A;  2AJQ A;  4Q45 A;  3JPN A;  3HW8 A;  4F8R A;  1XS9 D;  3NGD A;  4PPX A;  9ICL A;  4RQ3 A;  5KFF A;  3FYH A;  3BDP A;  3PO4 A;  2B21 A;  4FBU A;  4KLM A;  5DBA A;  7ICH A;  2V4R A;  4GC7 A;  1KRP A;  5DKW A;  1DGS A;  4EYH B;  3ORY A;  3E2E A;  2UVW A;  2PXI A;  5KFI A;  3RB6 A;  7ICJ A;  1PZN A;  1N48 A;  5D4B A;  4C8N A;  1SL1 A;  4ECY A;  7ICQ A;  4RT3 A;  2FLP A;  1V9P A;  1SL0 A;  4TUS A;  4Z6F A;  5IIM A;  5J0W A;  3OJS A;  1NKC A;  1ZQG A;  2FLL A;  2BCR A;  1CUK A;  4YN4 A;  3PW7 A;  5CHG A;  4GC6 A;  1NJZ A;  2C22 A;  5KG5 A;  3RRG A;  4MEY A;  2R8G A;  9ICE A;  1X9S A;  1S0M A;  1ZQS A;  4RQ7 A;  1ZQU A;  3ETL A;  4R8U B;  2BQ3 A;  4KLO A;  5KFU A;  4I2G A;  1JX4 A;  4NLK A;  9ICH A;  4PHP A;  9ICC A;  4F2R A;  3EW9 A;  9ICV A;  5F9N A;  4F50 A;  1S10 A;  2ZUC A;  1UA0 A;  4M6W B;  4BWJ A;  4R8U A;  4YR3 A;  2AQ4 A;  4UAW A;  2R8J A;  3H4D A;  1COO A;  1XO1 A;  3UXP A;  5IIL A;  4KLQ A;  8ICB A;  4YMN A;  7ICL A;  1NK0 A;  8ICT A;  2ZUB A;  4PH5 A;  3M8R A;  4BXO B;  5CJ7 A;  3PX0 A;  3RJI A;  9ICR A;  3K4G A;  4JUZ A;  3SV4 A;  1NJX A;  1U45 A;  4BWM A;  7ICV A;  3T5K A;  4J9S A;  4JV1 A;  5BPC A;  2MUT A;  4ECZ A;  5KG0 A;  1T4G A;  1T8E A;  2FMS A;  5C5J A;  4B9U A;  7ICF A;  2FPM A;  3EZ5 A;  5D46 A;  5L1K A;  4QW8 A;  5J2E A;  3GV7 B;  2FPL A;  3MR3 A;  2DPJ A;  4R64 A;  4JWN A;  2M9N A;  7ICK A;  1Z00 B;  1ZQZ A;  2W9M A;  4KN7 A;  4ECR A;  1ZQB A;  4M9H A;  4I2F A;  3QE9 Y;  4ELU A;  4F5R A;  1RPL A;  4NLG A;  4QZD A;  3HP6 A;  5CA7 A;  5KFC A;  5BOM A;  3JPS A;  2ASD A;  5BOL A;  2PFN A;  4DLG A;  5KG6 A;  4B9V A;  2KFZ A;  3B0X A;  4F4Z A;  1KLN A;  4RPZ A;  4I28 A;  4I2J A;  4J9P A;  4RQ6 A;  5J0O A;  2XGP A;  4XA5 A;  5CP2 A;  5HNK A;  2RDJ A;  4J9K A;  2BQR A;  5DDY A;  4I2H A;  3OJU A;  4I2A A;  9ICB A;  1S0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...