2LYHA

Structure of faap24 residues 141-215
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2lyhA00
9ICCA 4FS1A 1ZQZA 3TAPA 5HMLA 3RJEA 5J2GA 2PXIA 2B21A 1WCNA 4TUSA 2BQRA 3C21A 5CWRA 4ECUA 3RR8A 4UB2A 4DOAA 5J2HA 4Q43A 4LZDA 5KFYA 3RAQA 1BGXT 2FMPA 3IHQB 4PH5A 3BDPA 4EYHB 4I2BA 3PX4A 3B0XA 2LYHA 4RNOA 4TUQA 3HW8A 4UAYA 3E2EA 5J2KA 8ICQA 1ZQHA 1D8YA 1QTMA 5EWFA 4YR3A 3RB3A 4DQIA 4ELVA 4O5CA 4DSFA 5D49A 3H40A 3RB0A 4RT3A 3MGHA 4C8NA 3THVA 4QZHA 3RTVA 3C2KA 4NM2A 4RQ6A 2F1IA 2VA8A 5KFAA 3GV5B 5L1KA 3JPNA 2FLPA 4EEYA 4BDPA 1DOQA 2UVVA 5BOMA 7ICTA 2XCAA 4YG2A 1X2IA 3PMNA 3QEAZ 5TZVA 5BOLA 4DO9A 2KFNA 2V4RA 4RNMA 1ZQVA 4DQRA 2C28A 3EYZA 1Z00A 4ED0A 1U48A 2ZJ8A 1ZQEA 4B9LA 2JEIA 5KG3A 4QW9A 4KITB 2AQ4A 5DB8A 2ATLA 2ASDA 3C2LA 3RRGA 1NJWA 3RJGA 1IXRA 5DBAA 4J9SA 3C2MA 2PFPA 4KTQA 5DDMA 8ICPA 2BQ3A 5DQIA 2NRXA 4QZEA 4FS2A 1SL0A 1A77A 4KLIA 5KTQA 5IIJA 4TUPA 1NK9A 1ZQBA 4DSLA 4DQPA 8ICMA 1JN3A 3N97B 5J2BA 9ICBA 2XCPA 2FLLA 4KLSA 5DLGA 3UQ2A 5KFJA 4IR9A 4F8RA 5BPCA 4UQGA 2DFLA 1H38A 4RPYA 1NOMA 1TK5A 1NJYA 3T5KA 9ICJA 1HUZA 4EZ9A 4M9GA 5DG9A 2J6TA 2BCQA 9ICAA 5CB1A 5J2AA 5J0PA 5DB7A 4DSEA 4UB3A 2KFZA 5J0RA 5DLFA 3ETLA 4PHPA 2NRVA 3RJHA 4O5KA 9ICQA 1NK0A 2ZUDA 4B9MA 3Q8LA 5J0TA 1ZYQA 1JIHA 2FPMA 3C5FA 3BQ1A 3RB6A 1U45A 2HW3A 3V6JA 8ICLA 2Q0ZX 4FBUA 4PHAA 1T3NA 4I2FA 1SKRA 1UT8A 4F93B 4NLKA 5KT6A 5KFRA 1L3TA 4I2JA 4IRDA 8ICBA 2W9AA 1B43A 3EPIA 3HWTA 4QZIA 5JUMA 4GC6A 4DL4A 3KTQA 7ICIA 4QW8A 2HHVA 2KZZA 4KLMA 1S0VA 2FPLA 4RQ4A 3GDXA 2BQUA 3GFKB 1SZPA 4I2IA 4RPXA 2HHQA 2VA2A 8ICOA 4QZ8A 4JK1A 4GXJA 8ICEA 2F1JA 5J0XA 3T5HA 3RH4A 2W9MA 1Z00B 4Q44A 4RUCA 4QZCA 3HPOA 3LWLA 4ED2A 1S77D 4DFPA 3M8RA 5DKWA 1K1QA 3PV8A 3UPQA 2JZBB 1S10A 2JEFA 1KFDA 5F9LA 4TQRA 4ED3A 9ICPA 3H8JA 4MEXA 3EPGA 8ICKA 4KLEA 9ICRA 2GWSA 4Q45A 2BCSA 3M9NB 5J0UA 5L1JA 2V9WA 4DL6A 5DG8A 3C1ZA 3EW9A 5KFEA 3OHBA 4EBEA 4ED8A 4DS5A 3QEBZ 1UA1A 4DL7A 4C8MA 4Z6FA 1S9FA 4F3OA 1CEZA 4XRHA 4LVSA 2RDJA 3MGIA 3AU6A 2HVIA 1ZJNA 5IILA 4DL2A 2OWOA 4C8OA 4M9LA 1KTQA 4GXIA 4DWIA 4I2GA 1ZQFA 4RQ0A 4RU9A 3FDSA 3ZDAA 4R66A 2AJQA 1ZQPA 3TARA 1RYSA 3PW2A 2XO7A 3RAXA 4R64A 3RJFA 5HNKA 4EZ6A 4G3IA 9ICWA 2DPJA 2J6UA 2IHMA 3LWMA 1MQ3A 3BQTA 4UB1A 4O0IA 4K4HA 1NK5A 1N56A 3ZD9A 1TKDA 4NLZA 4UB5A 1CUKA 5D46A 4B9NA 9ICNA 1ZQUA 4PGXA 5HHHA 2KZ3A 4YMMA 3C23A 3NGDA 7ICVA 3PY8A 3K4GA 3GIJA 5KG0A 7ICQA 4GC7A 4M47A 7ICJA 5KFSA 5DGBA 4RQ5A 2JEJA 7ICFA 5CJ7A 8ICHA 3GIKA 1ZQDA 2FMQA 1ZQRA 4M6WB 4P4MA 2I1QA 5KFMA 5IIMA 1BPZA 5J2CA 1ZQKA 1KSPA 5J0OA 3K75D 1T7PA 2P66A 4J9RA 3KHGA 4ECRA 1NK8A 1U9LA 5HP4A 1RZTA 5KFZA 9ICLA 4F5PA 2BGWA 1C7YA 2KZMA 2XY6A 8ICGA 3ORYA 1WCLA 1T8EA 2W9BA 3RR7A 1XS9D 1ZQAA 2ZJ5A 4I2CA 2ZTEA 9ICUA 1NJXA 4QWBA 2BDPA 8ICRA 3MR6A 4DEZA 1MC8A 3HX0A 7ICHA 2ALZA 4I2EA 1KEJA 4DFMA 3V7LA 5KT4A 5KG6A 3TQ1A 2MAXA 7ICSA 1L3UA 1NJZA 3OSPA 5J2JA 4PGYA 1QLNA 4RUAA 3Q8SB 1L3VA 4F91B 3T5LA 4E0DA 2JZBA 2RDIA 4ELTA 2A1JA 3LK9A 4BXOB 4F4KA 4KLFA 1JX4A 5J2DA 3PR5B 4NLNA 3Q8PB 4F2SA 4DOBA 9ICIA 3ZDDA 2ZUBA 8ICJA 4ECVA 2ZTDA 1A76A 2ZJAA 5KG7A 3OSNA 5KFGA 2W8KA 4ECZA 1ZQIA 4QZBA 4YN4A 5KFHA 4F5QA 3G6VA 1SL1A 1ZQSA 7ICRA 5L1LA 3JPRA 1ZQYA 1ZQMA 3AUOA 1ZQOA 3PW4A 3PW7A 1AROP 3HP6A 3UXPA 1UT5A 4O3OA 5CR0A 3GIMA 1ZETA 2DPIA 8ICNA 4O3QA 4NY8A 8ICAA 4KMUA 5HMMA 4JWNA 3OJSA 3KHHA 2BPCA 3SYZA 4O3PA 1U49A 1BPXA 1ZQGA 2IHNA 4YVZA 4FO6A 5D4BA 4TURA 2FLNA 1NK6A 1TAQA 7ICEA 7ICOA 1HJPA 4ECTA 4DL5A 2VANA 4DF8A 8ICIA 4GXKA 3SI8A 2BPGA 4BGDA 2UVUA 1BPBA 4RPZA 4B9SA 2J6SA 1JMSA 2W9BB 4JV0A 5J0YA 4J9MA 2ZUCA 4YXJA 5J29A 1TV9A 4DOCA 1BPEA 4P2HA 4ECSA 4ECQA 2UVRA 4M6WA 3IM1A 3NTUA 3JPPA 3TI0A 4KN4A 5IIKA 3TANA 3H4DA 5KFPA 3FYHA 4UBCA 5DG7A 4C8KA 3KHLA 2WTFA 2AGQA 3ZDEA 2FPKA 4R8UB 4QZDA 2HHWA 3JPTA 1U47A 3Q8RB 1RXWA 5DB9A 3MBYA 1ZQTA 4K4IA 3MFIA 3H7IA 1Y88A 1EXNA 7ICGA 2A1JB 4RNNA 4MFFA 3SV3A 3MDCA 2I9GA 3PW5A 4MFAA 2AQ0A 4B9TA 3RJIA 3BQ0A 2Y1IA 2PI4A 1DGSA 1XO1A 5F9NA 2BCVA 1BPYA 3G6YA 4JWMA 4O3NA 5CP2A 3RRHA 1ZQJA 8ICYA 4YQWA 3BQ2A 3PX6A 3C1YA 4XUSA 3GV7B 1KDHA 3PO5A 4Z6CA 3V6HA 5C5JA 1TFRA 2VA3A 2P6UA 1NKEA 4RQ1A 1JXEA 2AGPA 1NK7A 5DB6A 4YMOA 4FBTA 3N4MB 2ISOA 1LV5A 1MSWD 4QWCA 4QWAA 5J2IA 9ICEA 4NXZA 2MUTB 4BXOA 1XWLA 2W8LA 4IR1A 4IQUA 7ICNA 4KLUA 4R65A 4DF4A 4DQSA 1SL2A 4F92B 5KFKA 3V72A 5KFIA 2XC9A 4ZH4A 4NM1A 9ICMA 3ZDBA 2NRZA 3ISBA 1SKSA 2IMWP 4MEYA 2P6RA 9ICKA 8ICSA 4I27A 5KG4A 3PX0A 1NKCA 4I2AA 3RH5A 4DSKA 3M8SA 1XSNA 2BCRA 5IIOA 1UA0A 4QWEA 1HUOA 4K4GA 4RQ8A 1D8LA 4YP3A 3H8WA 2R8IA 4QWDA 2ASLA 9ICOA 4Q8EA 4QZ9A 5KG5A 3QZ7A 3OGUA 1D9DA 7ICKA 4J9OA 1ZQLA 2F1HA 4ED1A 1KLNA 4F4YA 2BR0A 1U4BA 3Q8MA 4DSJA 4PHEA 3GV8B 1S0OA 5EWGA 4MF2A 4BWJA 5DBBA 5KFXA 3TAQA 3SV4A 2M9NA 2C22A 1S0NA 3JPOA 4DQQA 4QZGA 4ECXA 5HHIA 1QSSA 3B0YA 2HHSA 2IBKA 5J2EA 3RBEA 3Q8QB 1S0MA 4IQVA 5KT3A 4M9JA 4YMNA 2H5XA 4UAWA 5DGAA 1BPDA 4KLJA 2W9CB 1KFSA 5KG1A 5KFFA 4DFKA 3V7KA 3BJYA 4DFJA 4O3RA 7ICLA 4F50A 4YXMA 4R8UA 2KN7A 4QZFA 3TFRA 8ICCA 3RB4A 5KFUA 3PO4A 4KN7A 1T4GA 4YR0A 2AU0A 4NLGA 4J9NA 4Z6DA 4J9KA 2C2RA 4KLHA 4MFCA 5J0WA 4I28A 4I2HA 4IRCA 4BWMA 3PR4A 3HT3A 8ICWA 1X9SA 4IQWA 1Z3EB 3AU2A 4QZAA 3OJUA 5CA7A 5J0SA 4X5VA 4F4ZA 1MQ2A 2HHXA 2HHUA 1ZQXA 3M9OB 4F5RA 4ED6A 4B9UA 5IINA 2XY5A 3PVXA 7ICUA 4PGQA 5IIIA 3GQCA 4C8LA 4O9MA 2HVHA 2C2EA 4DLGA 1TAUA 1QSYA 5KFBA 3PNCA 2BPFA 4JV2A 1K1SA 4XA5A 5KFWA 1S97A 3T3FA 1L3SA 1PZNA 4EBDA 4F2RA 2Y1JA 5DQHA 3EZ5A 2PFNA 4LZGA 4Q8FA 2V4QA 3SZ2A 4O3SA 4Z6EA 1X9MA 4CCHA 2MUTA 4RQ3A 9ICSA 8ICXA 2BKEA 4HYKA 1XU4A 4J9QA 4KLQA 5KFNA 3JPSA 5L9XA 2R8GA 4DLEA 1ZQWA 3RBDA 4O5EA 2IA6A 5J0QA 5DBCA 3MR5A 9ICGA 4MF8A 1S76D 4F4WA 7ICMA 1ZQCA 1ZQNA 4JV1A 1L5UA 3M9MB 5KT5A 1XSLA 3LDAA 5DQGA 4R63A 1KFTA 8ICTA 2BCUA 4IRKA 2NRTA 3ZD8A 1IM4A 4ECYA 4KLLA 4GLXA 4IQTA 4P4OA 1QSLA 4DL3A 9ICHA 1RPLA 4M9NA 5KFQA 4I2DA 5KT2A 2HHTA 2BHNA 3V6KA 1NKBA 4PHDA 4F4XA 2PFOA 4DS4A 8ICFA 1KRPA 2XGPA 2R8KA 4YCXA 3QZ8A 3MABA 4KLTA 9ICTA 1TK8A 1BVSA 4B9VA 3C5GA 1ZQQA 4XQ8A 3ZDCA 4KLOA 3UXNA 4P4PA 4F5NA 4M0AA 1XC9A 2FMSA 4YR2A 3EWAA 4J9LA 4UB4A 3Q8KA 4DSIA 2ZTCA 3H8SA 3TFSA 5J2FA 4ED7A 2KTQA 5KFDA 4F5OA 1TVAA 2R8HA 2W9CA 4YD2A 5DDYA 5CHGA 4I29A 5EOZA 3RJKA 3H4BA 4KLGA 3ISDA 9ICVA 5L1IA 3V7JA 4J9PA 5KFCA 1V9PA 2XGQA 4YFKA 5KFVA 2JEGA 3G6XA 1B22A 3ISCA 4RT2A 4EYIB 4TQSA 1XSPA 5KFLA 4JUZA 3QE9Y 3PW0A 4ECWA 1D9FA 7ICPA 3GIIA 3RH6A 2C2DA 3MDAA 3OHAA 4EBCA 1X9WA 2PI5A 3GILA 2NRWA 1COOA 3MR2A 1ZJMA 4KLDA 8ICZA 1NK4A 3MFHA 3KHRA 9ICXA 1RYRA 1JXLA 5KFTA 5KFOA 1TK0A 3PMLA 2R8JA 8ICVA 4RQ7A 5KG2A 3UXOA 4UAZA 3JPQA 4M2YA 4M04A 4M9HA 8ICUA 2ISPA 2AGOA 1N48A 3RJJA 3T5JA 3MR3A 2ASJA 1LB2B 4RQ2A 2PFQA 4PPXA 2UVWA 4YD1A 2XY7A 9ICFA 4RZRA 5KT7A 4UBBA 5EWEA 4ELUA 3UQ0A 1RXVA 1SKWA
chains in the Genus database with same CATH superfamily
2QB0B 3TAPA 5HMLA 2EAPA 3RR8A 4PJ0U 4UB2A 5EE3A 2JH1A 2FMPA 3BDPA 4EYHB 4OO1J 3B0XA 3HW8A 3E2EA 5J2KA 1ZQHA 1D8YA 4UAUA 1QTMA 3IG5A 4DQIA 4DSFA 3KOOA 5D49A 2JR5A 5CRXA 3MGHA 5HR7A 4C4TA 2G0AA 3C2KA 2F1IA 1KBUA 4C4RA 2HMXA 5L1KA 4BDPA 3KZXA 1DOQA 7ICTA 2XCAA 3PMNA 5BOLA 2KFNA 1X40A 3I1YA 4RNMA 4F72A 3EYZA 1Z4OA 1Z00A 1ZQEA 2KEYA 2JEIA 2G5HB 2D6FC 4KITB 2KVSA 1B4FA 2MRLA 1WWUA 1IXRA 4J9SA 2NRXA 1A77A 5KTQA 1ZQBA 4P0QB 9ICBA 2NO5A 5J2BA 5KFJA 5BPCA 2DFLA 5HR6A 3WK4A 4EZ9A 2J6TA 5J2AA 2QARA 5DB7A 4PHPA 2DBYA 5E79U 3RB6A 8ICLA 2K8BB 2Q0ZX 2HBLA 4NLKA 4IRDA 2AH5A 7ICIA 2HHVA 2FPLA 4RQ4A 2BQUA 3GFKB 1SZPA 4RPXA 1V97A 1RQLA 2VA2A 2W43A 8ICEA 2F1JA 3T5HA 2W9MA 3M7DA 4QZCA 2DGZA 4CNQA 4ED3A 1FIQA 3H0MB 3N7PD 3EPGA 5AKGA 4Q45A 5L1JA 1ZXIA 5DG8A 3C1ZA 3RJHA 3ED5A 1IIPA 4UARA 4LVSA 2HVIA 3AU6A 2OWOA 4C8OA 1ZQFA 4ZOHC 2AJQA 2ZIUA 3PW2A 1OUQA 2JMGA 2W7PA 4O0IA 1NK5A 1TKDA 5ALEA 1CUKA 1QQ6A 1ZQUA 5AIAA 2NO4A 2WB1C 4YMMA 3C23A 7ICVA 3K4GA 2EQYA 7ICJA 5KFSA 7ICFA 1ZQRA 1BPZA 5IIMA 3K75D 3CYMA 3KHGA 4CRXA 9ICLA 3O0FA 1Z4NA 3RR7A 1WYGA 4I2CA 2ZTEA 1COKA 2XIDA 1ZD2P 8ICRA 1F5SA 2F8KA 4DEZA 2M0NA 2YMMA 1Z1VA 2ALZA 4I2EA 1KEJA 1X66A 3TQ1A 3QX7A 1NJZA 1QLNA 2ZXHA 4RUAA 1L3VA 3T5LA 2JZBA 4RQMA 4ELTA 2HOQA 4F4KA 2KKVA 4F2SA 9ICIA 2GO7A 8ICJA 4ECVA 2ZTDA 3ONNA 1A76A 2KNJA 2JGAA 5T14A 2K89A 7ICRA 2RHFA 5L1LA 1ZQYA 4NLCA 1PVQA 2NYVA 3HP6A 2DPIA 4O3QA 2W04A 4MHVA 4JWNA 2W11A 5K4LA 2YTUA 2FLNA 1TAQA 8ICIA 4GXKA 2GH1A 1Q3VA 1L7PA 1S8OA 2WHEA 2UVRA 3JPPA 4UASA 4UBCA 5DG7A 1PK1B 2E8OA 2AGQA 2A1AA 1D8BA 1RDFA 1U47A 3Q8RB 2XI9A 1EXNA 2WF6A 2WAQF 7ICGA 4MFFA 1BNOA 2IOHA 3PW5A 1BPYA 3G6YA 4O3NA 5CP2A 3RRHA 7ICOA 5AM4A 3C1YA 4XUSA 2VA3A 1FEZA 1NK7A 5DB6A 3N4MB 2ISOA 1LV5A 1MSWD 2E8MA 1A6SA 1XWLA 3GU3A 4DF4A 1SL2A 3V72A 2XC9A 4NM1A 2IMWP 5AK3A 5G5HA 4I27A 1C20A 3PX0A 1NKCA 1FFUA 1XSNA 5IIOA 4QWEA 4RQ8A 3H8WA 4LJXA 2R18A 9ICOA 4QZ9A 1D9DA 1Q8KA 5AM2A 2F1HA 4F4YA 5ALHA 3TAQA 5KL1B 2HHSA 3B0YA 3FC4A 5J2EA 1X6JA 4O3MA 4IQVA 2OYYA 3I76A 4RQNA 3BJYA 4O3RA 3A0BU 3TFRA 4YR0A 2AU0A 4J9KA 4I28A 4IRCA 2YN4A 3HT3A 1KN5A 3AU2A 3F2CA 4F4ZA 1MQ2A 3SEIA 2HHXA 4F5RA 3BS5B 2HVHA 3GQCA 2C2EA 4DLGA 3HRDD 5TISU 4EELA 1S97A 3T3FA 4Q8FA 5DQHA 1UQVA 3KKAC 9ICSA 5AI0A 4HYKA 5AI5A 4KLQA 5KFNA 3SQIA 2Z7JA 4HAIA 1ZQNA 4JV1A 4R63A 2KIWA 4IRKA 3BZKA 4ECYA 4KLLA 2DWQA 1RYUA 4P4OA 1RPLA 4QJFB 4M9NA 5KFQA 1NKBA 4DS4A 4BUGA 2XGPA 5AM0A 2ZIVA 1BVSA 4XQ8A 4NV0A 4F5NA 3FAHA 5ALGA 3D2QA 4J9LA 2LM4A 3EWAA 4NLBA 3H8SA 3TFSA 4F5OA 2W9CA 5DDYA 5CHGA 4KMOB 3PSTA 2G07A 2WF8A 5ALOA 1V9PA 2XGQA 1P7DA 3WKAA 5KFVA 2JEGA 1SV0C 3ISCA 4RT2A 2W55A 4ICAA 2E8NA 4CF5A 3SAFA 1D9FA 7ICPA 4EEKA 1LKYB 2KSOB 2PI5A 5AK4A 8ICZA 2KHVA 4JB3A 2ISPA 3AMZA 2AGOA 3RJJA 1YZ7A 2ASJA 1LB2B 4YD1A 1X42A 4Y2QA 5C0YA 3UQ0A 1SKWA 2GLEA 1V38A 3RJEA 2IOFA 2BQRA 3C21A 3VCBA 2EANA 4DOAA 5ALFA 4Q43A 5KFYA 4P0QA 3HILA 4CE6A 4PH5A 4I2BA 2B6GA 5ALSA 2W3RA 4UAYA 4CF3A 4YR3A 5AI9A 3RB3A 1SV0A 3E58A 1M6YA 4FZMA 3RB0A 2WF5A 2F44A 3T79A 5ALYA 4NM2A 4RQ6A 2FLPA 4EEYA 2KJ9A 4G9BA 4YG2A 3IG8A 1UPHA 2F2AB 3QEAZ 1QH9A 1NNLA 1S5LU 1WWVA 4DQRA 3IP4B 5ALQA 3WKEA 4UB6U 2ZJ8A 4B9LA 5F3XB 2RP5A 1KKXA 5DB8A 2YQEA 3WK8A 3C2LA 3NRWA 3C2MA 3B9JA 4KTQA 1N5WA 2KVCA 4PL1A 2KOBA 2PMZC 5IIJA 8ICMA 5ALVA 3N97B 2XCPA 3L4PA 4KLSA 4UQGA 1HIWA 1NJYA 3T5KA 9ICJA 5DG9A 9ICAA 5CB1A 5J0PA 4UB3A 3ETLA 9ICQA 5AM5A 5AKKA 4B9MA 2HW3A 2KG5A 3OPXA 3V6JA 1T3NA 4CGZA 4F93B 4EX7A 3HWTA 4GC6A 3KTQA 3MGVA 4I2IA 4PZNA 8ICOA 2VJ4A 5J0XA 3RH4A 3WK5A 4Q44A 3HPOA 1URJA 4ED2A 4DFPA 5ALUA 3FM9A 2JEFA 5F9LA 1L8LA 4TQRA 9ICPA 3BZCA 8ICKA 9ICRA 2BCSA 5ALZA 2V9WA 4FFDA 5H2FU 2KZZA 3OHBA 4DS5A 2KE7A 1UA1A 4DL7A 4F3OA 4Z6FA 2RDJA 3MGIA 3AEVA 5IILA 4GXIA 4DWIA 4RQ0A 3ZDAA 4R66A 3TARA 4G3IA 9ICWA 4EZ6A 2DPJA 3K1RB 4NL9C 2HI0A 1MQ3A 1N56A 5D46A 4B9NA 3PSIA 5KG0A 1MA7A 4GC7A 7ICQA 4KX3A 4C4SA 5AM1A 4RQ5A 2VKQA 4GIBA 4M6WB 3E0FA 2I1QA 8ICPA 3UMCA 1KSPA 1T7PA 5J0OA 2P66A 4J9RA 4ECRA 1NK8A 2YX8A 3C28A 4PZOA 2BGWA 2K4PA 2OM6A 2XY6A 1C7YA 8ICGA 3ORYA 1WCLA 2MSNA 2MU2A 1XS9D 2E8PA 3NVVA 2BDPA 7ICHA 3HX0A 4U7CA 1CRXA 1CI4A 1RQNA 4DFMA 3V7LA 2F76X 2MAXA 7ICSA 5J2JA 4PGYA 4E0DA 2RDIA 3GZFA 1LVHA 4BXOB 4KLFA 4NL9A 5J2DA 3PR5B 2YB4A 3IDWA 4FE3A 1YT3A 2FE9A 2ZJAA 1X6IA 3OSNA 4QZBA 5B5EU 4YN4A 1K5OA 2KHQA 3JPRA 2YMLA 1ZQMA 1AROP 1UT5A 4O3OA 5CR0A 3GIMA 8ICNA 8ICAA 5HMMA 3KHHA 2BPCA 4O3PA 1BPXA 1ZQGA 3QYPA 4AP9A 2I5HA 4TURA 4OJ5A 1HJPA 4ECTA 2VANA 5AICA 3NVWA 2DQNB 3SI8A 1BPBA 4B9SA 2J6SA 4JV0A 3SAGA 2ZUCA 4YXJA 1TV9A 3N7RC 1BPEA 2G5IB 1F44A 3NTUA 3TANA 4C8KA 5KFPA 3FYHA 3KHLA 4DCCA 1JUDA 4AYBF 2K8CB 3MFIA 1Y88A 1IG6A 2A1JB 2ZIXA 2GOLA 4B9TA 3RJIA 2PI4A 3PX6A 1KDHA 4Z6CA 3V6HA 1TFRA 5KL8B 4FBTA 4QWCA 5J2IA 4NXZA 2MUTB 1VLBA 4DQSA 1Q46A 5KFKA 5KFIA 2LI6A 4ZH4A 9ICMA 2NRZA 2LBOA 4I2AA 1ZQ1C 2BCRA 3NASA 4QWDA 5KG5A 3OGUA 3GV8B 5EWGA 4MF2A 5DBBA 5KFXA 3SV4A 4QZGA 1J97A 5HHIA 1S0MA 4M9JA 5KT3A 4YMNA 1BPDA 3UM9A 4DFKA 4R8UA 2KN7A 4QZFA 1T4GA 4J9NA 4KLHA 1N62A 1VDVA 4I2HA 4BWMA 3PR4A 2KKPA 5CEHA 4IQWA 3OJUA 4QZAA 4Y2TA 3M9OB 4ED6A 5IINA 3PVXA 2KICA 5IIIA 4C8LA 1QQ7A 1QSYA 3PNCA 2BPFA 4XA5A 2KD1A 4F2RA 2F8LA 4CCHA 2BZFA 1LKYA 2HOIA 2R8GA 4DLEA 4O5EA 2EZXA 5DBCA 3MR5A 9ICGA 2H3ZA 1ZQCA 3LDAA 8ICTA 2BCUA 2NRTA 1IM4A 1QSLA 9ICHA 3N28A 3QXGA 1BNPA 5KT2A 3V6KA 4F4XA 3BS7A 3KZIU 5GTIU 4YCXA 3QZ8A 5ALRA 3C5GA 4GFJA 4KLOA 4M0AA 5AK5A 4YR2A 4Y2JA 2ZTCA 2F77X 5J2FA 4ED7A 5KFDA 1TVAA 5EOZA 4IL6U 9ICVA 3ISDA 5L1IA 3SD7A 1KL9A 1KQQA 1B22A 2DL0A 1XSPA 4TQSA 4CF4A 3QE9Y 3RH6A 2C2DA 3MDAA 1X9WA 3F5EA 3MFHA 1RYRA 1TK0A 4RQ7A 4M2YA 4UAZA 3N7SC 4M04A 4KX5A 2WF9A 3MR3A 2CRXA 4P0PA 2UVWA 5KT7A 2K4HA 9ICCA 4FS1A 1ZQZA 2QARB 5J2GA 1VJ5A 2PXIA 2K4IA 4TUSA 1L6NA 4ECUA 3A0HU 3PSPA 3NVZA 5ALNA 2W3SA 1NZPA 3PX4A 1WG8A 3M6ZA 2OCEA 3S6JA 4RNOA 4TUQA 8ICQA 5EWFA 4ELVA 4O5CA 3QU7A 3AN1A 5L1MA 4IC9A 4C8NA 2LMRA 3THVA 4QZHA 2W54A 5FP0A 3GV5B 3JPNA 3WKDA 2UVVA 5BOMA 3ALRA 1IV8A 5TZVA 4DO9A 2V4RA 2JV3A 2C28A 4ED0A 5GTHU 5KG3A 4Y2SA 4QW9A 5JRTA 1L7MA 1T3QA 2KK0A 2ZIUB 3RJGA 5DBAA 2PFPA 4Y2PA 5DDMA 5AI8A 1O03A 2LPEA 1SL0A 4KLIA 4USAA 5AKJA 4TUPA 1NK9A 4DQPA 1JN3A 5B66U 2FLLA 2ZIWA 3SMVA 3UMBA 2YMQA 1H38A 1NOMA 2HBMA 2QB0A 3SR6A 2NV3A 3QU2A 5DLFA 4O5KA 2NRVA 4UB8U 1NK0A 2ZUDA 3HJEA 1JIHA 3BQ1A 3C5FA 4FBUA 4PHAA 1SKRA 1UT8A 3LVWA 5KT6A 5KFRA 4I2JA 2W9AA 1B43A 3EPIA 4QZIA 5JUMA 4DL4A 1ED1A 2VJ5A 4QW8A 4KLMA 1S0VA 2HHQA 2KJ5A 4GXJA 3R9KA 3QU9A 4RUCA 3LWLA 1JROA 1S77D 3M8RA 1ZD4A 3PV8A 2JZBB 3HKZF 1S10A 3H8JA 4MEXA 5ALWA 4KLEA 1J2MA 2GWSA 3WU2U 2LYBA 2HBJA 4ED8A 1S9FA 4M9LA 1KTQA 4I2GA 4RU9A 3FDSA 1ZQPA 1RYSA 3RAXA 2XO7A 3RJFA 1OW5A 5HNKA 3LWMA 3BQTA 4K4HA 4UB5A 3QUBA 2HBKA 1KW4A 4PGXA 3MC1A 2KZ3A 5ALPA 3IN5A 5DGBA 2JEJA 3GIKA 1ZQDA 2FMQA 4P4MA 4Y2UA 1ZQKA 3TADA 5KFZA 4F5PA 3VC8A 1SV4A 2E1EA 3CNHA 1T8EA 1ZQAA 9ICUA 2LKYA 3CRXA 1NJXA 4QWBA 2Q4TA 4PL2A 3MR6A 3L5KA 3CP8A 3F5AA 5KG6A 2BDUA 1L3UA 3OSPA 3Q8SB 4F91B 2Y0SF 2A1JA 3LK9A 2H3FA 4NLNA 2JXJA 4DOBA 4U6PA 4B6JA 4US8A 5KG7A 2W8KA 1PK3A 1ZQIA 4F5QA 5KFHA 1SL1A 3AUOA 5EE0A 3PW4A 3UXPA 1ZETA 4UAVA 1PVRA 2G06A 5G5GA 3OJSA 3SYZA 1U49A 5D4BA 1NK6A 7ICEA 5ALIA 4DL5A 4DF8A 2H3QA 4BGDA 1JMSA 2W9BB 5J0YA 2E5SA 4J9MA 4C80A 2CN1A 4ECSA 4ECQA 3TI0A 3IM1A 3Q8MA 1ZYQA 5IIKA 4QIWC 3H4DA 2KIVA 1JRPA 3CW2C 4IS7A 2WTFA 3ZDEA 3ICXA 1RXWA 3MBYA 2EAOA 4RNNA 1SWWA 3MDCA 4MFAA 2AQ0A 3BQ0A 2PMZF 1XO1A 5F9NA 2BCVA 2FJ6A 4JWMA 3BQ2A 3GV7B 5ALJA 3PO5A 5C5JA 1JXEA 4QWAA 9ICEA 1DGJA 5KAIU 2DKXA 4IR1A 4IQUA 3QU5A 7ICNA 3NVYA 5ALDA 4C0ZA 4R65A 2B0CA 4F92B 3QUTA 3QUQA 1J2NA 3ZDBA 1FO4A 3ISBA 1SKSA 4MEYA 2P6RA 2AXTU 9ICKA 5KG4A 1OXJA 1QCKA 2ZXIA 2AHOB 2E3TA 4K4GA 2HCFA 2QB1A 2HOFA 5AKYA 2ASLA 4Q8EA 3PZPA 2H3IA 3QZ7A 3NS1A 4J9OA 2ZIVB 1KLNA 3ZI4A 2BR0A 1U4BA 4DSJA 4PHEA 2CXYA 1S0OA 4BWJA 2OXOA 2LYAA 4OD0A 1S0NA 2C22A 1QSSA 4DQQA 4OJLA 4ECXA 3RBEA 3UMGA 3Q8QB 5DGAA 4KLJA 2W9CB 2A19A 1KFSA 5ALMA 5KG1A 5KFFA 1PK1A 2D3DA 4F50A 5KFUA 4KN7A 2E1FA 4NLGA 1XNSA 2C2RA 4MFCA 5J0WA 1SZHA 1X9SA 3WKBA 1V85A 2HHUA 5EE1A 4B9UA 2DUYA 2XY5A 4O9MA 1JI7A 1SWVA 3RFAA 5KFBA 1K1SA 5KFWA 1PZNA 2HSZA 2Y1JA 2F3NA 2PFNA 2V4QA 3SZ2A 4O3SA 1SXDA 2DKZA 1XU4A 1UHUA 4J9QA 3JPSA 1ZQWA 2K4EA 3RBDA 2IA6A 5J0QA 4AYBC 3NRZA 4MF8A 2XICA 2QKQA 3DEEA 5DQGA 1KFTA 3ZD8A 4DL3A 4I2DA 4ACOA 2HHTA 2BHNA 3D2SA 8ICFA 1NI3A 1KRPA 4KLTA 3MABA 2O6KA 2EZYA 1TK8A 4B9VA 9ICTA 1ZQQA 3WK7A 3UXNA 2N1RA 4UATA 1XC9A 4FZNA 2VIXA 3H0LB 2P35A 5AKLA 3F2BA 4UB4A 3Q8KA 1L7OA 4DSIA 4F71A 2R8HA 1GO3F 2ESEA 3H4BA 1F0MA 3V7JA 5KFCA 5AI4A 3G6XA 4EYIB 3PW0A 4ECWA 3OHAA 1YZ6A 5JU5A 2NRWA 1COOA 1ZJMA 4KLDA 9ICXA 3BS5A 3DDHA 5KFOA 3IRUA 2R8JA 8ICVA 2OHFA 5KG2A 1L7NA 3UXOA 4US9A 3EUB2 5AKXA 2D8CA 4RQ2A 2PFQA 3KD3A 2XY7A 1HEKA 4RZRA 4ELUA 5EWEA 2B21A 1WCNA 3AQEA 5CWRA 5J2HA 3M6KA 4LZDA 3RAQA 2RQ5A 1BGXT 3IHQB 2LYHA 2RRDA 5AKIA 4FZLA 3DV9A 5AK6A 4Y2YA 3RF9A 3H40A 3IV6A 4RT3A 1NZBA 3RTVA 1Q3UA 2KP7A 1N60A 3WK6A 2VA8A 5KFAA 3D6JA 1X2IA 3AL0B 2HDOA 2WB1F 3QU4A 2I6XA 1ZQVA 1SB3C 1U48A 3D2NA 2H3VA 3C29A 4CDGA 2XVTA 2KSOA 2AQ4A 2ATLA 2ASDA 3RRGA 1NJWA 3QUCA 1JALA 2WAQC 2BQ3A 5DQIA 2Y9TA 4QZEA 4FS2A 3KFUF 1UCVA 4DSLA 1N2XA 1SGGA 3WKCA 5DLGA 3UQ2A 4IR9A 4F8RA 1DXSA 4OJ6A 3SAHA 4RPYA 1TK5A 1HUZA 1TAMA 4M9GA 2BCQA 4DSEA 4JMUA 1N63A 2KFZA 5J0RA 5EE9A 5AKHA 2YMPA 1TE2A 1WUDA 3Q8LA 5J0TA 2FPMA 1U45A 3J81j 4C7YA 2EDUA 1ZD3A 4I2FA 1L3TA 8ICBA 3U26A 3I28A 2YB1A 3GDXA 4QZ8A 4JK1A 2OH2A 1Z00B 1SXEA 5DKWA 3ETRA 1K1QA 1ZD5A 5AKZA 3UPQA 1KFDA 3H8MA 4OJPA 4A8EA 5J0UA 3M9NB 2ODGA 4DL6A 3EW9A 5KFEA 4EBEA 3QEBZ 4C8MA 1DK3A 1CEZA 4XRHA 2G08A 1ZJNA 4DL2A 1XO0A 4R64A 3LVVA 2J6UA 2IHMA 2ES6A 4WJ3B 4UB1A 3ZD9A 4NLZA 4OJOA 4QNLA 5AIBA 9ICNA 5HHHA 2A3VA 3NGDA 3PY8A 3GIJA 4M47A 5CJ7A 8ICHA 1SIJA 5KFMA 5J2CA 1U9LA 5HP4A 3K1ZA 1RZTA 2KZMA 2W9BA 3AM9A 2FI1A 1DRGA 2ZJ5A 1L8OA 2ZIXB 2LM1A 2JRZA 2OEHA 2KMDA 5J8YC 1MC8A 2EZZA 2EAMA 5KT4A 2DF4B 1JX4A 1ZRMA 5ALLA 3Q8PB 3ZDDA 2ZUBA 4ECZA 5KFGA 1ZQSA 3G6VA 1ZQOA 3PW7A 4NY8A 4KMUA 4NJ8A 1N5XA 2IHNA 1RM6C 4YVZA 4FO6A 3HKZC 5AKEA 2BPGA 2WFAA 2K60A 2W7OA 2UVUA 4RPZA 2WF7A 3NUQA 2JH7A 5J29A 5J8YA 1B0XA 4DOCA 4P2HA 1N61A 3QNMA 2YY6A 4M6WA 4KN4A 5A0LA 2FPKA 4R8UB 4QZDA 1FFVA 3TADC 2HHWA 3JPTA 5DB9A 1ZQTA 4K4IA 3H7IA 1X9XA 3SV3A 2QLTA 2I9GA 2Y1IA 1DGSA 4UW9A 2KJ8A 1ZQJA 8ICYA 4YQWA 2EH9A 2P6UA 1NKEA 4RQ1A 2AGPA 3KKAA 1T94A 1Z1BA 3PSFA 4YMOA 4BXOA 2W8LA 4KLUA 1QQ5A 4OCZA 4DFDA 2W03A 5JTIA 1PVPA 8ICSA 3RH5A 4DSKA 3M8SA 1UA0A 2CPRA 3M1YA 1HUOA 3WK9A 1D8LA 4YP3A 2R8IA 7ICKA 2L5YA 1ZQLA 4ED1A 2Y0SC 4EX6A 1ZRNA 2M9NA 5ALXA 3JPOA 4C7ZA 2K8AA 2IBKA 5AI6A 1ECWA 2H5XA 4UAWA 3AQFA 2LHTA 3V7KA 7ICLA 4DFJA 4BX9C 4YXMA 8ICCA 3RB4A 3PO4A 4Z6DA 8ICWA 3H0RB 3OTQA 1PUZA 1Z3EB 2KV2A 5CA7A 2RLTA 5J0SA 4X5VA 1ZQXA 7ICUA 4Y2RA 4PGQA 1TAUA 4JV2A 3F53A 5ALKA 1L3SA 3SENA 4EBDA 4LZGA 3EZ5A 4Z6EA 1X9MA 2MUTA 2FDRA 4RQ3A 8ICXA 2BKEA 4P0PB 3BQ7A 5L9XA 4BJQA 1DK2A 3KBBA 1S76D 4F4WA 7ICMA 2JHDA 1O08A 1L5UA 3M9MB 5KT5A 1XSLA 2MA1A 5KNIA 4GLXA 4IQTA 1ZOLA 4EENA 1Z19A 4Y2XA 4PHDA 3TACB 2PFOA 2ZG6A 2R8KA 5AM3A 3ZDCA 4P4PA 5ALTA 2FMSA 3F2DA 4Y2VA 2KTQA 1MN8A 4YD2A 4I29A 3TKAA 3RJKA 4KLGA 4J9PA 1A0PA 4YFKA 4NWIA 2Y9UA 5KFLA 4JUZA 2G09A 3GIIA 1AQ6A 4EBCA 3GILA 5KAFU 3MR2A 1NK4A 3KHRA 2IOFK 3L3FX 5AHXA 5KFTA 1JXLA 3PMLA 3JPQA 1RG6A 4J03A 4M9HA 3LYSA 8ICUA 1N48A 3T5JA 2ZIWB 2PKEA 4PPXA 4QIWF 9ICFA 4UBBA 1RXVA
chains in the Genus database with same CATH topology
9ICCA 4FS1A 1ZQZA 3TAPA 5HMLA 3RJEA 5J2GA 2PXIA 2B21A 1WCNA 4TUSA 2BQRA 3C21A 5CWRA 4ECUA 3RR8A 4UB2A 4DOAA 5J2HA 4Q43A 4LZDA 5KFYA 3RAQA 1BGXT 2FMPA 3IHQB 4PH5A 3BDPA 4EYHB 4I2BA 3PX4A 3B0XA 2LYHA 4RNOA 4TUQA 3HW8A 4UAYA 3E2EA 5J2KA 8ICQA 1ZQHA 1D8YA 1QTMA 5EWFA 4YR3A 3RB3A 4DQIA 4ELVA 4O5CA 4DSFA 5D49A 3H40A 3RB0A 4RT3A 3MGHA 4C8NA 3THVA 4QZHA 3RTVA 3C2KA 4NM2A 4RQ6A 2F1IA 2VA8A 5KFAA 3GV5B 5L1KA 3JPNA 2FLPA 4EEYA 4BDPA 1DOQA 2UVVA 5BOMA 7ICTA 2XCAA 4YG2A 1X2IA 3PMNA 3QEAZ 5TZVA 5BOLA 4DO9A 2KFNA 2V4RA 4RNMA 1ZQVA 4DQRA 2C28A 3EYZA 1Z00A 4ED0A 1U48A 2ZJ8A 1ZQEA 4B9LA 2JEIA 5KG3A 4QW9A 4KITB 2AQ4A 5DB8A 2ATLA 2ASDA 3C2LA 3RRGA 1NJWA 3RJGA 1IXRA 5DBAA 4J9SA 3C2MA 2PFPA 4KTQA 5DDMA 8ICPA 2BQ3A 5DQIA 2NRXA 4QZEA 4FS2A 1SL0A 1A77A 4KLIA 5KTQA 5IIJA 4TUPA 1NK9A 1ZQBA 4DSLA 4DQPA 8ICMA 1JN3A 3N97B 5J2BA 9ICBA 2XCPA 2FLLA 4KLSA 5DLGA 3UQ2A 5KFJA 4IR9A 4F8RA 5BPCA 4UQGA 2DFLA 1H38A 4RPYA 1NOMA 1TK5A 1NJYA 3T5KA 9ICJA 1HUZA 4EZ9A 4M9GA 5DG9A 2J6TA 2BCQA 9ICAA 5CB1A 5J2AA 5J0PA 5DB7A 4DSEA 4UB3A 2KFZA 5J0RA 5DLFA 3ETLA 4PHPA 2NRVA 3RJHA 4O5KA 9ICQA 1NK0A 2ZUDA 4B9MA 3Q8LA 5J0TA 1ZYQA 1JIHA 2FPMA 3C5FA 3BQ1A 3RB6A 1U45A 2HW3A 3V6JA 8ICLA 2Q0ZX 4FBUA 4PHAA 1T3NA 4I2FA 1SKRA 1UT8A 4F93B 4NLKA 5KT6A 5KFRA 1L3TA 4I2JA 4IRDA 8ICBA 2W9AA 1B43A 3EPIA 3HWTA 4QZIA 5JUMA 4GC6A 4DL4A 3KTQA 7ICIA 4QW8A 2HHVA 2KZZA 4KLMA 1S0VA 2FPLA 4RQ4A 3GDXA 2BQUA 3GFKB 1SZPA 4I2IA 4RPXA 2HHQA 2VA2A 8ICOA 4QZ8A 4JK1A 4GXJA 8ICEA 2F1JA 5J0XA 3T5HA 3RH4A 2W9MA 1Z00B 4Q44A 4RUCA 4QZCA 3HPOA 3LWLA 4ED2A 1S77D 4DFPA 3M8RA 5DKWA 1K1QA 3PV8A 3UPQA 2JZBB 1S10A 2JEFA 1KFDA 5F9LA 4TQRA 4ED3A 9ICPA 3H8JA 4MEXA 3EPGA 8ICKA 4KLEA 9ICRA 2GWSA 4Q45A 2BCSA 3M9NB 5J0UA 5L1JA 2V9WA 4DL6A 5DG8A 3C1ZA 3EW9A 5KFEA 3OHBA 4EBEA 4ED8A 4DS5A 3QEBZ 1UA1A 4DL7A 4C8MA 4Z6FA 1S9FA 4F3OA 1CEZA 4XRHA 4LVSA 2RDJA 3MGIA 3AU6A 2HVIA 1ZJNA 5IILA 4DL2A 2OWOA 4C8OA 4M9LA 1KTQA 4GXIA 4DWIA 4I2GA 1ZQFA 4RQ0A 4RU9A 3FDSA 3ZDAA 4R66A 2AJQA 1ZQPA 3TARA 1RYSA 3PW2A 2XO7A 3RAXA 4R64A 3RJFA 5HNKA 4EZ6A 4G3IA 9ICWA 2DPJA 2J6UA 2IHMA 3LWMA 1MQ3A 3BQTA 4UB1A 4O0IA 4K4HA 1NK5A 1N56A 3ZD9A 1TKDA 4NLZA 4UB5A 1CUKA 5D46A 4B9NA 9ICNA 1ZQUA 4PGXA 5HHHA 2KZ3A 4YMMA 3C23A 3NGDA 7ICVA 3PY8A 3K4GA 3GIJA 5KG0A 7ICQA 4GC7A 4M47A 7ICJA 5KFSA 5DGBA 4RQ5A 2JEJA 7ICFA 5CJ7A 8ICHA 3GIKA 1ZQDA 2FMQA 1ZQRA 4M6WB 4P4MA 2I1QA 5KFMA 5IIMA 1BPZA 5J2CA 1ZQKA 1KSPA 5J0OA 3K75D 1T7PA 2P66A 4J9RA 3KHGA 4ECRA 1NK8A 1U9LA 5HP4A 1RZTA 5KFZA 9ICLA 4F5PA 2BGWA 1C7YA 2KZMA 2XY6A 8ICGA 3ORYA 1WCLA 1T8EA 2W9BA 3RR7A 1XS9D 1ZQAA 2ZJ5A 4I2CA 2ZTEA 9ICUA 1NJXA 4QWBA 2BDPA 8ICRA 3MR6A 4DEZA 1MC8A 3HX0A 7ICHA 2ALZA 4I2EA 1KEJA 4DFMA 3V7LA 5KT4A 5KG6A 3TQ1A 2MAXA 7ICSA 1L3UA 1NJZA 3OSPA 5J2JA 4PGYA 1QLNA 4RUAA 3Q8SB 1L3VA 4F91B 3T5LA 4E0DA 2JZBA 2RDIA 4ELTA 2A1JA 3LK9A 4BXOB 4F4KA 4KLFA 1JX4A 5J2DA 3PR5B 4NLNA 3Q8PB 4F2SA 4DOBA 9ICIA 3ZDDA 2ZUBA 8ICJA 4ECVA 2ZTDA 1A76A 2ZJAA 5KG7A 3OSNA 5KFGA 2W8KA 4ECZA 1ZQIA 4QZBA 4YN4A 5KFHA 4F5QA 3G6VA 1SL1A 1ZQSA 7ICRA 5L1LA 3JPRA 1ZQYA 1ZQMA 3AUOA 1ZQOA 3PW4A 3PW7A 1AROP 3HP6A 3UXPA 1UT5A 4O3OA 5CR0A 3GIMA 1ZETA 2DPIA 8ICNA 4O3QA 4NY8A 8ICAA 4KMUA 5HMMA 4JWNA 3OJSA 3KHHA 2BPCA 3SYZA 4O3PA 1U49A 1BPXA 1ZQGA 2IHNA 4YVZA 4FO6A 5D4BA 4TURA 2FLNA 1NK6A 1TAQA 7ICEA 7ICOA 1HJPA 4ECTA 4DL5A 2VANA 4DF8A 8ICIA 4GXKA 3SI8A 2BPGA 4BGDA 2UVUA 1BPBA 4RPZA 4B9SA 2J6SA 1JMSA 2W9BB 4JV0A 5J0YA 4J9MA 2ZUCA 4YXJA 5J29A 1TV9A 4DOCA 1BPEA 4P2HA 4ECSA 4ECQA 2UVRA 4M6WA 3IM1A 3NTUA 3JPPA 3TI0A 4KN4A 5IIKA 3TANA 3H4DA 5KFPA 3FYHA 4UBCA 5DG7A 4C8KA 3KHLA 2WTFA 2AGQA 3ZDEA 2FPKA 4R8UB 4QZDA 2HHWA 3JPTA 1U47A 3Q8RB 1RXWA 5DB9A 3MBYA 1ZQTA 4K4IA 3MFIA 3H7IA 1Y88A 1EXNA 7ICGA 2A1JB 4RNNA 4MFFA 3SV3A 3MDCA 2I9GA 3PW5A 4MFAA 2AQ0A 4B9TA 3RJIA 3BQ0A 2Y1IA 2PI4A 1DGSA 1XO1A 5F9NA 2BCVA 1BPYA 3G6YA 4JWMA 4O3NA 5CP2A 3RRHA 1ZQJA 8ICYA 4YQWA 3BQ2A 3PX6A 3C1YA 4XUSA 3GV7B 1KDHA 3PO5A 4Z6CA 3V6HA 5C5JA 1TFRA 2VA3A 2P6UA 1NKEA 4RQ1A 1JXEA 2AGPA 1NK7A 5DB6A 4YMOA 4FBTA 3N4MB 2ISOA 1LV5A 1MSWD 4QWCA 4QWAA 5J2IA 9ICEA 4NXZA 2MUTB 4BXOA 1XWLA 2W8LA 4IR1A 4IQUA 7ICNA 4KLUA 4R65A 4DF4A 4DQSA 1SL2A 4F92B 5KFKA 3V72A 5KFIA 2XC9A 4ZH4A 4NM1A 9ICMA 3ZDBA 2NRZA 3ISBA 1SKSA 2IMWP 4MEYA 2P6RA 9ICKA 8ICSA 4I27A 5KG4A 3PX0A 1NKCA 4I2AA 3RH5A 4DSKA 3M8SA 1XSNA 2BCRA 5IIOA 1UA0A 4QWEA 1HUOA 4K4GA 4RQ8A 1D8LA 4YP3A 3H8WA 2R8IA 4QWDA 2ASLA 9ICOA 4Q8EA 4QZ9A 5KG5A 3QZ7A 3OGUA 1D9DA 7ICKA 4J9OA 1ZQLA 2F1HA 4ED1A 1KLNA 4F4YA 2BR0A 1U4BA 3Q8MA 4DSJA 4PHEA 3GV8B 1S0OA 5EWGA 4MF2A 4BWJA 5DBBA 5KFXA 3TAQA 3SV4A 2M9NA 2C22A 1S0NA 3JPOA 4DQQA 4QZGA 4ECXA 5HHIA 1QSSA 3B0YA 2HHSA 2IBKA 5J2EA 3RBEA 3Q8QB 1S0MA 4IQVA 5KT3A 4M9JA 4YMNA 2H5XA 4UAWA 5DGAA 1BPDA 4KLJA 2W9CB 1KFSA 5KG1A 5KFFA 4DFKA 3V7KA 3BJYA 4DFJA 4O3RA 7ICLA 4F50A 4YXMA 4R8UA 2KN7A 4QZFA 3TFRA 8ICCA 3RB4A 5KFUA 3PO4A 4KN7A 1T4GA 4YR0A 2AU0A 4NLGA 4J9NA 4Z6DA 4J9KA 2C2RA 4KLHA 4MFCA 5J0WA 4I28A 4I2HA 4IRCA 4BWMA 3PR4A 3HT3A 8ICWA 1X9SA 4IQWA 1Z3EB 3AU2A 4QZAA 3OJUA 5CA7A 5J0SA 4X5VA 4F4ZA 1MQ2A 2HHXA 2HHUA 1ZQXA 3M9OB 4F5RA 4ED6A 4B9UA 5IINA 2XY5A 3PVXA 7ICUA 4PGQA 5IIIA 3GQCA 4C8LA 4O9MA 2HVHA 2C2EA 4DLGA 1TAUA 1QSYA 5KFBA 3PNCA 2BPFA 4JV2A 1K1SA 4XA5A 5KFWA 1S97A 3T3FA 1L3SA 1PZNA 4EBDA 4F2RA 2Y1JA 5DQHA 3EZ5A 2PFNA 4LZGA 4Q8FA 2V4QA 3SZ2A 4O3SA 4Z6EA 1X9MA 4CCHA 2MUTA 4RQ3A 9ICSA 8ICXA 2BKEA 4HYKA 1XU4A 4J9QA 4KLQA 5KFNA 3JPSA 5L9XA 2R8GA 4DLEA 1ZQWA 3RBDA 4O5EA 2IA6A 5J0QA 5DBCA 3MR5A 9ICGA 4MF8A 1S76D 4F4WA 7ICMA 1ZQCA 1ZQNA 4JV1A 1L5UA 3M9MB 5KT5A 1XSLA 3LDAA 5DQGA 4R63A 1KFTA 8ICTA 2BCUA 4IRKA 2NRTA 3ZD8A 1IM4A 4ECYA 4KLLA 4GLXA 4IQTA 4P4OA 1QSLA 4DL3A 9ICHA 1RPLA 4M9NA 5KFQA 4I2DA 5KT2A 2HHTA 2BHNA 3V6KA 1NKBA 4PHDA 4F4XA 2PFOA 4DS4A 8ICFA 1KRPA 2XGPA 2R8KA 4YCXA 3QZ8A 3MABA 4KLTA 9ICTA 1TK8A 1BVSA 4B9VA 3C5GA 1ZQQA 4XQ8A 3ZDCA 4KLOA 3UXNA 4P4PA 4F5NA 4M0AA 1XC9A 2FMSA 4YR2A 3EWAA 4J9LA 4UB4A 3Q8KA 4DSIA 2ZTCA 3H8SA 3TFSA 5J2FA 4ED7A 2KTQA 5KFDA 4F5OA 1TVAA 2R8HA 2W9CA 4YD2A 5DDYA 5CHGA 4I29A 5EOZA 3RJKA 3H4BA 4KLGA 3ISDA 9ICVA 5L1IA 3V7JA 4J9PA 5KFCA 1V9PA 2XGQA 4YFKA 5KFVA 2JEGA 3G6XA 1B22A 3ISCA 4RT2A 4EYIB 4TQSA 1XSPA 5KFLA 4JUZA 3QE9Y 3PW0A 4ECWA 1D9FA 7ICPA 3GIIA 3RH6A 2C2DA 3MDAA 3OHAA 4EBCA 1X9WA 2PI5A 3GILA 2NRWA 1COOA 3MR2A 1ZJMA 4KLDA 8ICZA 1NK4A 3MFHA 3KHRA 9ICXA 1RYRA 1JXLA 5KFTA 5KFOA 1TK0A 3PMLA 2R8JA 8ICVA 4RQ7A 5KG2A 3UXOA 4UAZA 3JPQA 4M2YA 4M04A 4M9HA 8ICUA 2ISPA 2AGOA 1N48A 3RJJA 3T5JA 3MR3A 2ASJA 1LB2B 4RQ2A 2PFQA 4PPXA 2UVWA 4YD1A 2XY7A 9ICFA 4RZRA 5KT7A 4UBBA 5EWEA 4ELUA 3UQ0A 1RXVA 1SKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICC A;  4FS1 A;  1ZQZ A;  3TAP A;  5HML A;  3RJE A;  5J2G A;  2PXI A;  2B21 A;  1WCN A;  4TUS A;  2BQR A;  3C21 A;  5CWR A;  4ECU A;  3RR8 A;  4UB2 A;  4DOA A;  5J2H A;  4Q43 A;  4LZD A;  5KFY A;  3RAQ A;  1BGX T;  2FMP A;  3IHQ B;  4PH5 A;  3BDP A;  4EYH B;  4I2B A;  3PX4 A;  3B0X A;  2LYH A;  4RNO A;  4TUQ A;  3HW8 A;  4UAY A;  3E2E A;  5J2K A;  8ICQ A;  1ZQH A;  1D8Y A;  1QTM A;  5EWF A;  4YR3 A;  3RB3 A;  4DQI A;  4ELV A;  4O5C A;  4DSF A;  5D49 A;  3H40 A;  3RB0 A;  4RT3 A;  3MGH A;  4C8N A;  3THV A;  4QZH A;  3RTV A;  3C2K A;  4NM2 A;  4RQ6 A;  2F1I A;  2VA8 A;  5KFA A;  3GV5 B;  5L1K A;  3JPN A;  2FLP A;  4EEY A;  4BDP A;  1DOQ A;  2UVV A;  5BOM A;  7ICT A;  2XCA A;  4YG2 A;  1X2I A;  3PMN A;  3QEA Z;  5TZV A;  5BOL A;  4DO9 A;  2KFN A;  2V4R A;  4RNM A;  1ZQV A;  4DQR A;  2C28 A;  3EYZ A;  1Z00 A;  4ED0 A;  1U48 A;  2ZJ8 A;  1ZQE A;  4B9L A;  2JEI A;  5KG3 A;  4QW9 A;  4KIT B;  2AQ4 A;  5DB8 A;  2ATL A;  2ASD A;  3C2L A;  3RRG A;  1NJW A;  3RJG A;  1IXR A;  5DBA A;  4J9S A;  3C2M A;  2PFP A;  4KTQ A;  5DDM A;  8ICP A;  2BQ3 A;  5DQI A;  2NRX A;  4QZE A;  4FS2 A;  1SL0 A;  1A77 A;  4KLI A;  5KTQ A;  5IIJ A;  4TUP A;  1NK9 A;  1ZQB A;  4DSL A;  4DQP A;  8ICM A;  1JN3 A;  3N97 B;  5J2B A;  9ICB A;  2XCP A;  2FLL A;  4KLS A;  5DLG A;  3UQ2 A;  5KFJ A;  4IR9 A;  4F8R A;  5BPC A;  4UQG A;  2DFL A;  1H38 A;  4RPY A;  1NOM A;  1TK5 A;  1NJY A;  3T5K A;  9ICJ A;  1HUZ A;  4EZ9 A;  4M9G A;  5DG9 A;  2J6T A;  2BCQ A;  9ICA A;  5CB1 A;  5J2A A;  5J0P A;  5DB7 A;  4DSE A;  4UB3 A;  2KFZ A;  5J0R A;  5DLF A;  3ETL A;  4PHP A;  2NRV A;  3RJH A;  4O5K A;  9ICQ A;  1NK0 A;  2ZUD A;  4B9M A;  3Q8L A;  5J0T A;  1ZYQ A;  1JIH A;  2FPM A;  3C5F A;  3BQ1 A;  3RB6 A;  1U45 A;  2HW3 A;  3V6J A;  8ICL A;  2Q0Z X;  4FBU A;  4PHA A;  1T3N A;  4I2F A;  1SKR A;  1UT8 A;  4F93 B;  4NLK A;  5KT6 A;  5KFR A;  1L3T A;  4I2J A;  4IRD A;  8ICB A;  2W9A A;  1B43 A;  3EPI A;  3HWT A;  4QZI A;  5JUM A;  4GC6 A;  4DL4 A;  3KTQ A;  7ICI A;  4QW8 A;  2HHV A;  2KZZ A;  4KLM A;  1S0V A;  2FPL A;  4RQ4 A;  3GDX A;  2BQU A;  3GFK B;  1SZP A;  4I2I A;  4RPX A;  2HHQ A;  2VA2 A;  8ICO A;  4QZ8 A;  4JK1 A;  4GXJ A;  8ICE A;  2F1J A;  5J0X A;  3T5H A;  3RH4 A;  2W9M A;  1Z00 B;  4Q44 A;  4RUC A;  4QZC A;  3HPO A;  3LWL A;  4ED2 A;  1S77 D;  4DFP A;  3M8R A;  5DKW A;  1K1Q A;  3PV8 A;  3UPQ A;  2JZB B;  1S10 A;  2JEF A;  1KFD A;  5F9L A;  4TQR A;  4ED3 A;  9ICP A;  3H8J A;  4MEX A;  3EPG A;  8ICK A;  4KLE A;  9ICR A;  2GWS A;  4Q45 A;  2BCS A;  3M9N B;  5J0U A;  5L1J A;  2V9W A;  4DL6 A;  5DG8 A;  3C1Z A;  3EW9 A;  5KFE A;  3OHB A;  4EBE A;  4ED8 A;  4DS5 A;  3QEB Z;  1UA1 A;  4DL7 A;  4C8M A;  4Z6F A;  1S9F A;  4F3O A;  1CEZ A;  4XRH A;  4LVS A;  2RDJ A;  3MGI A;  3AU6 A;  2HVI A;  1ZJN A;  5IIL A;  4DL2 A;  2OWO A;  4C8O A;  4M9L A;  1KTQ A;  4GXI A;  4DWI A;  4I2G A;  1ZQF A;  4RQ0 A;  4RU9 A;  3FDS A;  3ZDA A;  4R66 A;  2AJQ A;  1ZQP A;  3TAR A;  1RYS A;  3PW2 A;  2XO7 A;  3RAX A;  4R64 A;  3RJF A;  5HNK A;  4EZ6 A;  4G3I A;  9ICW A;  2DPJ A;  2J6U A;  2IHM A;  3LWM A;  1MQ3 A;  3BQT A;  4UB1 A;  4O0I A;  4K4H A;  1NK5 A;  1N56 A;  3ZD9 A;  1TKD A;  4NLZ A;  4UB5 A;  1CUK A;  5D46 A;  4B9N A;  9ICN A;  1ZQU A;  4PGX A;  5HHH A;  2KZ3 A;  4YMM A;  3C23 A;  3NGD A;  7ICV A;  3PY8 A;  3K4G A;  3GIJ A;  5KG0 A;  7ICQ A;  4GC7 A;  4M47 A;  7ICJ A;  5KFS A;  5DGB A;  4RQ5 A;  2JEJ A;  7ICF A;  5CJ7 A;  8ICH A;  3GIK A;  1ZQD A;  2FMQ A;  1ZQR A;  4M6W B;  4P4M A;  2I1Q A;  5KFM A;  5IIM A;  1BPZ A;  5J2C A;  1ZQK A;  1KSP A;  5J0O A;  3K75 D;  1T7P A;  2P66 A;  4J9R A;  3KHG A;  4ECR A;  1NK8 A;  1U9L A;  5HP4 A;  1RZT A;  5KFZ A;  9ICL A;  4F5P A;  2BGW A;  1C7Y A;  2KZM A;  2XY6 A;  8ICG A;  3ORY A;  1WCL A;  1T8E A;  2W9B A;  3RR7 A;  1XS9 D;  1ZQA A;  2ZJ5 A;  4I2C A;  2ZTE A;  9ICU A;  1NJX A;  4QWB A;  2BDP A;  8ICR A;  3MR6 A;  4DEZ A;  1MC8 A;  3HX0 A;  7ICH A;  2ALZ A;  4I2E A;  1KEJ A;  4DFM A;  3V7L A;  5KT4 A;  5KG6 A;  3TQ1 A;  2MAX A;  7ICS A;  1L3U A;  1NJZ A;  3OSP A;  5J2J A;  4PGY A;  1QLN A;  4RUA A;  3Q8S B;  1L3V A;  4F91 B;  3T5L A;  4E0D A;  2JZB A;  2RDI A;  4ELT A;  2A1J A;  3LK9 A;  4BXO B;  4F4K A;  4KLF A;  1JX4 A;  5J2D A;  3PR5 B;  4NLN A;  3Q8P B;  4F2S A;  4DOB A;  9ICI A;  3ZDD A;  2ZUB A;  8ICJ A;  4ECV A;  2ZTD A;  1A76 A;  2ZJA A;  5KG7 A;  3OSN A;  5KFG A;  2W8K A;  4ECZ A;  1ZQI A;  4QZB A;  4YN4 A;  5KFH A;  4F5Q A;  3G6V A;  1SL1 A;  1ZQS A;  7ICR A;  5L1L A;  3JPR A;  1ZQY A;  1ZQM A;  3AUO A;  1ZQO A;  3PW4 A;  3PW7 A;  1ARO P;  3HP6 A;  3UXP A;  1UT5 A;  4O3O A;  5CR0 A;  3GIM A;  1ZET A;  2DPI A;  8ICN A;  4O3Q A;  4NY8 A;  8ICA A;  4KMU A;  5HMM A;  4JWN A;  3OJS A;  3KHH A;  2BPC A;  3SYZ A;  4O3P A;  1U49 A;  1BPX A;  1ZQG A;  2IHN A;  4YVZ A;  4FO6 A;  5D4B A;  4TUR A;  2FLN A;  1NK6 A;  1TAQ A;  7ICE A;  7ICO A;  1HJP A;  4ECT A;  4DL5 A;  2VAN A;  4DF8 A;  8ICI A;  4GXK A;  3SI8 A;  2BPG A;  4BGD A;  2UVU A;  1BPB A;  4RPZ A;  4B9S A;  2J6S A;  1JMS A;  2W9B B;  4JV0 A;  5J0Y A;  4J9M A;  2ZUC A;  4YXJ A;  5J29 A;  1TV9 A;  4DOC A;  1BPE A;  4P2H A;  4ECS A;  4ECQ A;  2UVR A;  4M6W A;  3IM1 A;  3NTU A;  3JPP A;  3TI0 A;  4KN4 A;  5IIK A;  3TAN A;  3H4D A;  5KFP A;  3FYH A;  4UBC A;  5DG7 A;  4C8K A;  3KHL A;  2WTF A;  2AGQ A;  3ZDE A;  2FPK A;  4R8U B;  4QZD A;  2HHW A;  3JPT A;  1U47 A;  3Q8R B;  1RXW A;  5DB9 A;  3MBY A;  1ZQT A;  4K4I A;  3MFI A;  3H7I A;  1Y88 A;  1EXN A;  7ICG A;  2A1J B;  4RNN A;  4MFF A;  3SV3 A;  3MDC A;  2I9G A;  3PW5 A;  4MFA A;  2AQ0 A;  4B9T A;  3RJI A;  3BQ0 A;  2Y1I A;  2PI4 A;  1DGS A;  1XO1 A;  5F9N A;  2BCV A;  1BPY A;  3G6Y A;  4JWM A;  4O3N A;  5CP2 A;  3RRH A;  1ZQJ A;  8ICY A;  4YQW A;  3BQ2 A;  3PX6 A;  3C1Y A;  4XUS A;  3GV7 B;  1KDH A;  3PO5 A;  4Z6C A;  3V6H A;  5C5J A;  1TFR A;  2VA3 A;  2P6U A;  1NKE A;  4RQ1 A;  1JXE A;  2AGP A;  1NK7 A;  5DB6 A;  4YMO A;  4FBT A;  3N4M B;  2ISO A;  1LV5 A;  1MSW D;  4QWC A;  4QWA A;  5J2I A;  9ICE A;  4NXZ A;  2MUT B;  4BXO A;  1XWL A;  2W8L A;  4IR1 A;  4IQU A;  7ICN A;  4KLU A;  4R65 A;  4DF4 A;  4DQS A;  1SL2 A;  4F92 B;  5KFK A;  3V72 A;  5KFI A;  2XC9 A;  4ZH4 A;  4NM1 A;  9ICM A;  3ZDB A;  2NRZ A;  3ISB A;  1SKS A;  2IMW P;  4MEY A;  2P6R A;  9ICK A;  8ICS A;  4I27 A;  5KG4 A;  3PX0 A;  1NKC A;  4I2A A;  3RH5 A;  4DSK A;  3M8S A;  1XSN A;  2BCR A;  5IIO A;  1UA0 A;  4QWE A;  1HUO A;  4K4G A;  4RQ8 A;  1D8L A;  4YP3 A;  3H8W A;  2R8I A;  4QWD A;  2ASL A;  9ICO A;  4Q8E A;  4QZ9 A;  5KG5 A;  3QZ7 A;  3OGU A;  1D9D A;  7ICK A;  4J9O A;  1ZQL A;  2F1H A;  4ED1 A;  1KLN A;  4F4Y A;  2BR0 A;  1U4B A;  3Q8M A;  4DSJ A;  4PHE A;  3GV8 B;  1S0O A;  5EWG A;  4MF2 A;  4BWJ A;  5DBB A;  5KFX A;  3TAQ A;  3SV4 A;  2M9N A;  2C22 A;  1S0N A;  3JPO A;  4DQQ A;  4QZG A;  4ECX A;  5HHI A;  1QSS A;  3B0Y A;  2HHS A;  2IBK A;  5J2E A;  3RBE A;  3Q8Q B;  1S0M A;  4IQV A;  5KT3 A;  4M9J A;  4YMN A;  2H5X A;  4UAW A;  5DGA A;  1BPD A;  4KLJ A;  2W9C B;  1KFS A;  5KG1 A;  5KFF A;  4DFK A;  3V7K A;  3BJY A;  4DFJ A;  4O3R A;  7ICL A;  4F50 A;  4YXM A;  4R8U A;  2KN7 A;  4QZF A;  3TFR A;  8ICC A;  3RB4 A;  5KFU A;  3PO4 A;  4KN7 A;  1T4G A;  4YR0 A;  2AU0 A;  4NLG A;  4J9N A;  4Z6D A;  4J9K A;  2C2R A;  4KLH A;  4MFC A;  5J0W A;  4I28 A;  4I2H A;  4IRC A;  4BWM A;  3PR4 A;  3HT3 A;  8ICW A;  1X9S A;  4IQW A;  1Z3E B;  3AU2 A;  4QZA A;  3OJU A;  5CA7 A;  5J0S A;  4X5V A;  4F4Z A;  1MQ2 A;  2HHX A;  2HHU A;  1ZQX A;  3M9O B;  4F5R A;  4ED6 A;  4B9U A;  5IIN A;  2XY5 A;  3PVX A;  7ICU A;  4PGQ A;  5III A;  3GQC A;  4C8L A;  4O9M A;  2HVH A;  2C2E A;  4DLG A;  1TAU A;  1QSY A;  5KFB A;  3PNC A;  2BPF A;  4JV2 A;  1K1S A;  4XA5 A;  5KFW A;  1S97 A;  3T3F A;  1L3S A;  1PZN A;  4EBD A;  4F2R A;  2Y1J A;  5DQH A;  3EZ5 A;  2PFN A;  4LZG A;  4Q8F A;  2V4Q A;  3SZ2 A;  4O3S A;  4Z6E A;  1X9M A;  4CCH A;  2MUT A;  4RQ3 A;  9ICS A;  8ICX A;  2BKE A;  4HYK A;  1XU4 A;  4J9Q A;  4KLQ A;  5KFN A;  3JPS A;  5L9X A;  2R8G A;  4DLE A;  1ZQW A;  3RBD A;  4O5E A;  2IA6 A;  5J0Q A;  5DBC A;  3MR5 A;  9ICG A;  4MF8 A;  1S76 D;  4F4W A;  7ICM A;  1ZQC A;  1ZQN A;  4JV1 A;  1L5U A;  3M9M B;  5KT5 A;  1XSL A;  3LDA A;  5DQG A;  4R63 A;  1KFT A;  8ICT A;  2BCU A;  4IRK A;  2NRT A;  3ZD8 A;  1IM4 A;  4ECY A;  4KLL A;  4GLX A;  4IQT A;  4P4O A;  1QSL A;  4DL3 A;  9ICH A;  1RPL A;  4M9N A;  5KFQ A;  4I2D A;  5KT2 A;  2HHT A;  2BHN A;  3V6K A;  1NKB A;  4PHD A;  4F4X A;  2PFO A;  4DS4 A;  8ICF A;  1KRP A;  2XGP A;  2R8K A;  4YCX A;  3QZ8 A;  3MAB A;  4KLT A;  9ICT A;  1TK8 A;  1BVS A;  4B9V A;  3C5G A;  1ZQQ A;  4XQ8 A;  3ZDC A;  4KLO A;  3UXN A;  4P4P A;  4F5N A;  4M0A A;  1XC9 A;  2FMS A;  4YR2 A;  3EWA A;  4J9L A;  4UB4 A;  3Q8K A;  4DSI A;  2ZTC A;  3H8S A;  3TFS A;  5J2F A;  4ED7 A;  2KTQ A;  5KFD A;  4F5O A;  1TVA A;  2R8H A;  2W9C A;  4YD2 A;  5DDY A;  5CHG A;  4I29 A;  5EOZ A;  3RJK A;  3H4B A;  4KLG A;  3ISD A;  9ICV A;  5L1I A;  3V7J A;  4J9P A;  5KFC A;  1V9P A;  2XGQ A;  4YFK A;  5KFV A;  2JEG A;  3G6X A;  1B22 A;  3ISC A;  4RT2 A;  4EYI B;  4TQS A;  1XSP A;  5KFL A;  4JUZ A;  3QE9 Y;  3PW0 A;  4ECW A;  1D9F A;  7ICP A;  3GII A;  3RH6 A;  2C2D A;  3MDA A;  3OHA A;  4EBC A;  1X9W A;  2PI5 A;  3GIL A;  2NRW A;  1COO A;  3MR2 A;  1ZJM A;  4KLD A;  8ICZ A;  1NK4 A;  3MFH A;  3KHR A;  9ICX A;  1RYR A;  1JXL A;  5KFT A;  5KFO A;  1TK0 A;  3PML A;  2R8J A;  8ICV A;  4RQ7 A;  5KG2 A;  3UXO A;  4UAZ A;  3JPQ A;  4M2Y A;  4M04 A;  4M9H A;  8ICU A;  2ISP A;  2AGO A;  1N48 A;  3RJJ A;  3T5J A;  3MR3 A;  2ASJ A;  1LB2 B;  4RQ2 A;  2PFQ A;  4PPX A;  2UVW A;  4YD1 A;  2XY7 A;  9ICF A;  4RZR A;  5KT7 A;  4UBB A;  5EWE A;  4ELU A;  3UQ0 A;  1RXV A;  1SKW A; 
#chains in the Genus database with same CATH topology
 2QB0 B;  3TAP A;  5HML A;  2EAP A;  3RR8 A;  4PJ0 U;  4UB2 A;  5EE3 A;  2JH1 A;  2FMP A;  3BDP A;  4EYH B;  4OO1 J;  3B0X A;  3HW8 A;  3E2E A;  5J2K A;  1ZQH A;  1D8Y A;  4UAU A;  1QTM A;  3IG5 A;  4DQI A;  4DSF A;  3KOO A;  5D49 A;  2JR5 A;  5CRX A;  3MGH A;  5HR7 A;  4C4T A;  2G0A A;  3C2K A;  2F1I A;  1KBU A;  4C4R A;  2HMX A;  5L1K A;  4BDP A;  3KZX A;  1DOQ A;  7ICT A;  2XCA A;  3PMN A;  5BOL A;  2KFN A;  1X40 A;  3I1Y A;  4RNM A;  4F72 A;  3EYZ A;  1Z4O A;  1Z00 A;  1ZQE A;  2KEY A;  2JEI A;  2G5H B;  2D6F C;  4KIT B;  2KVS A;  1B4F A;  2MRL A;  1WWU A;  1IXR A;  4J9S A;  2NRX A;  1A77 A;  5KTQ A;  1ZQB A;  4P0Q B;  9ICB A;  2NO5 A;  5J2B A;  5KFJ A;  5BPC A;  2DFL A;  5HR6 A;  3WK4 A;  4EZ9 A;  2J6T A;  5J2A A;  2QAR A;  5DB7 A;  4PHP A;  2DBY A;  5E79 U;  3RB6 A;  8ICL A;  2K8B B;  2Q0Z X;  2HBL A;  4NLK A;  4IRD A;  2AH5 A;  7ICI A;  2HHV A;  2FPL A;  4RQ4 A;  2BQU A;  3GFK B;  1SZP A;  4RPX A;  1V97 A;  1RQL A;  2VA2 A;  2W43 A;  8ICE A;  2F1J A;  3T5H A;  2W9M A;  3M7D A;  4QZC A;  2DGZ A;  4CNQ A;  4ED3 A;  1FIQ A;  3H0M B;  3N7P D;  3EPG A;  5AKG A;  4Q45 A;  5L1J A;  1ZXI A;  5DG8 A;  3C1Z A;  3RJH A;  3ED5 A;  1IIP A;  4UAR A;  4LVS A;  2HVI A;  3AU6 A;  2OWO A;  4C8O A;  1ZQF A;  4ZOH C;  2AJQ A;  2ZIU A;  3PW2 A;  1OUQ A;  2JMG A;  2W7P A;  4O0I A;  1NK5 A;  1TKD A;  5ALE A;  1CUK A;  1QQ6 A;  1ZQU A;  5AIA A;  2NO4 A;  2WB1 C;  4YMM A;  3C23 A;  7ICV A;  3K4G A;  2EQY A;  7ICJ A;  5KFS A;  7ICF A;  1ZQR A;  1BPZ A;  5IIM A;  3K75 D;  3CYM A;  3KHG A;  4CRX A;  9ICL A;  3O0F A;  1Z4N A;  3RR7 A;  1WYG A;  4I2C A;  2ZTE A;  1COK A;  2XID A;  1ZD2 P;  8ICR A;  1F5S A;  2F8K A;  4DEZ A;  2M0N A;  2YMM A;  1Z1V A;  2ALZ A;  4I2E A;  1KEJ A;  1X66 A;  3TQ1 A;  3QX7 A;  1NJZ A;  1QLN A;  2ZXH A;  4RUA A;  1L3V A;  3T5L A;  2JZB A;  4RQM A;  4ELT A;  2HOQ A;  4F4K A;  2KKV A;  4F2S A;  9ICI A;  2GO7 A;  8ICJ A;  4ECV A;  2ZTD A;  3ONN A;  1A76 A;  2KNJ A;  2JGA A;  5T14 A;  2K89 A;  7ICR A;  2RHF A;  5L1L A;  1ZQY A;  4NLC A;  1PVQ A;  2NYV A;  3HP6 A;  2DPI A;  4O3Q A;  2W04 A;  4MHV A;  4JWN A;  2W11 A;  5K4L A;  2YTU A;  2FLN A;  1TAQ A;  8ICI A;  4GXK A;  2GH1 A;  1Q3V A;  1L7P A;  1S8O A;  2WHE A;  2UVR A;  3JPP A;  4UAS A;  4UBC A;  5DG7 A;  1PK1 B;  2E8O A;  2AGQ A;  2A1A A;  1D8B A;  1RDF A;  1U47 A;  3Q8R B;  2XI9 A;  1EXN A;  2WF6 A;  2WAQ F;  7ICG A;  4MFF A;  1BNO A;  2IOH A;  3PW5 A;  1BPY A;  3G6Y A;  4O3N A;  5CP2 A;  3RRH A;  7ICO A;  5AM4 A;  3C1Y A;  4XUS A;  2VA3 A;  1FEZ A;  1NK7 A;  5DB6 A;  3N4M B;  2ISO A;  1LV5 A;  1MSW D;  2E8M A;  1A6S A;  1XWL A;  3GU3 A;  4DF4 A;  1SL2 A;  3V72 A;  2XC9 A;  4NM1 A;  2IMW P;  5AK3 A;  5G5H A;  4I27 A;  1C20 A;  3PX0 A;  1NKC A;  1FFU A;  1XSN A;  5IIO A;  4QWE A;  4RQ8 A;  3H8W A;  4LJX A;  2R18 A;  9ICO A;  4QZ9 A;  1D9D A;  1Q8K A;  5AM2 A;  2F1H A;  4F4Y A;  5ALH A;  3TAQ A;  5KL1 B;  2HHS A;  3B0Y A;  3FC4 A;  5J2E A;  1X6J A;  4O3M A;  4IQV A;  2OYY A;  3I76 A;  4RQN A;  3BJY A;  4O3R A;  3A0B U;  3TFR A;  4YR0 A;  2AU0 A;  4J9K A;  4I28 A;  4IRC A;  2YN4 A;  3HT3 A;  1KN5 A;  3AU2 A;  3F2C A;  4F4Z A;  1MQ2 A;  3SEI A;  2HHX A;  4F5R A;  3BS5 B;  2HVH A;  3GQC A;  2C2E A;  4DLG A;  3HRD D;  5TIS U;  4EEL A;  1S97 A;  3T3F A;  4Q8F A;  5DQH A;  1UQV A;  3KKA C;  9ICS A;  5AI0 A;  4HYK A;  5AI5 A;  4KLQ A;  5KFN A;  3SQI A;  2Z7J A;  4HAI A;  1ZQN A;  4JV1 A;  4R63 A;  2KIW A;  4IRK A;  3BZK A;  4ECY A;  4KLL A;  2DWQ A;  1RYU A;  4P4O A;  1RPL A;  4QJF B;  4M9N A;  5KFQ A;  1NKB A;  4DS4 A;  4BUG A;  2XGP A;  5AM0 A;  2ZIV A;  1BVS A;  4XQ8 A;  4NV0 A;  4F5N A;  3FAH A;  5ALG A;  3D2Q A;  4J9L A;  2LM4 A;  3EWA A;  4NLB A;  3H8S A;  3TFS A;  4F5O A;  2W9C A;  5DDY A;  5CHG A;  4KMO B;  3PST A;  2G07 A;  2WF8 A;  5ALO A;  1V9P A;  2XGQ A;  1P7D A;  3WKA A;  5KFV A;  2JEG A;  1SV0 C;  3ISC A;  4RT2 A;  2W55 A;  4ICA A;  2E8N A;  4CF5 A;  3SAF A;  1D9F A;  7ICP A;  4EEK A;  1LKY B;  2KSO B;  2PI5 A;  5AK4 A;  8ICZ A;  2KHV A;  4JB3 A;  2ISP A;  3AMZ A;  2AGO A;  3RJJ A;  1YZ7 A;  2ASJ A;  1LB2 B;  4YD1 A;  1X42 A;  4Y2Q A;  5C0Y A;  3UQ0 A;  1SKW A;  2GLE A;  1V38 A;  3RJE A;  2IOF A;  2BQR A;  3C21 A;  3VCB A;  2EAN A;  4DOA A;  5ALF A;  4Q43 A;  5KFY A;  4P0Q A;  3HIL A;  4CE6 A;  4PH5 A;  4I2B A;  2B6G A;  5ALS A;  2W3R A;  4UAY A;  4CF3 A;  4YR3 A;  5AI9 A;  3RB3 A;  1SV0 A;  3E58 A;  1M6Y A;  4FZM A;  3RB0 A;  2WF5 A;  2F44 A;  3T79 A;  5ALY A;  4NM2 A;  4RQ6 A;  2FLP A;  4EEY A;  2KJ9 A;  4G9B A;  4YG2 A;  3IG8 A;  1UPH A;  2F2A B;  3QEA Z;  1QH9 A;  1NNL A;  1S5L U;  1WWV A;  4DQR A;  3IP4 B;  5ALQ A;  3WKE A;  4UB6 U;  2ZJ8 A;  4B9L A;  5F3X B;  2RP5 A;  1KKX A;  5DB8 A;  2YQE A;  3WK8 A;  3C2L A;  3NRW A;  3C2M A;  3B9J A;  4KTQ A;  1N5W A;  2KVC A;  4PL1 A;  2KOB A;  2PMZ C;  5IIJ A;  8ICM A;  5ALV A;  3N97 B;  2XCP A;  3L4P A;  4KLS A;  4UQG A;  1HIW A;  1NJY A;  3T5K A;  9ICJ A;  5DG9 A;  9ICA A;  5CB1 A;  5J0P A;  4UB3 A;  3ETL A;  9ICQ A;  5AM5 A;  5AKK A;  4B9M A;  2HW3 A;  2KG5 A;  3OPX A;  3V6J A;  1T3N A;  4CGZ A;  4F93 B;  4EX7 A;  3HWT A;  4GC6 A;  3KTQ A;  3MGV A;  4I2I A;  4PZN A;  8ICO A;  2VJ4 A;  5J0X A;  3RH4 A;  3WK5 A;  4Q44 A;  3HPO A;  1URJ A;  4ED2 A;  4DFP A;  5ALU A;  3FM9 A;  2JEF A;  5F9L A;  1L8L A;  4TQR A;  9ICP A;  3BZC A;  8ICK A;  9ICR A;  2BCS A;  5ALZ A;  2V9W A;  4FFD A;  5H2F U;  2KZZ A;  3OHB A;  4DS5 A;  2KE7 A;  1UA1 A;  4DL7 A;  4F3O A;  4Z6F A;  2RDJ A;  3MGI A;  3AEV A;  5IIL A;  4GXI A;  4DWI A;  4RQ0 A;  3ZDA A;  4R66 A;  3TAR A;  4G3I A;  9ICW A;  4EZ6 A;  2DPJ A;  3K1R B;  4NL9 C;  2HI0 A;  1MQ3 A;  1N56 A;  5D46 A;  4B9N A;  3PSI A;  5KG0 A;  1MA7 A;  4GC7 A;  7ICQ A;  4KX3 A;  4C4S A;  5AM1 A;  4RQ5 A;  2VKQ A;  4GIB A;  4M6W B;  3E0F A;  2I1Q A;  8ICP A;  3UMC A;  1KSP A;  1T7P A;  5J0O A;  2P66 A;  4J9R A;  4ECR A;  1NK8 A;  2YX8 A;  3C28 A;  4PZO A;  2BGW A;  2K4P A;  2OM6 A;  2XY6 A;  1C7Y A;  8ICG A;  3ORY A;  1WCL A;  2MSN A;  2MU2 A;  1XS9 D;  2E8P A;  3NVV A;  2BDP A;  7ICH A;  3HX0 A;  4U7C A;  1CRX A;  1CI4 A;  1RQN A;  4DFM A;  3V7L A;  2F76 X;  2MAX A;  7ICS A;  5J2J A;  4PGY A;  4E0D A;  2RDI A;  3GZF A;  1LVH A;  4BXO B;  4KLF A;  4NL9 A;  5J2D A;  3PR5 B;  2YB4 A;  3IDW A;  4FE3 A;  1YT3 A;  2FE9 A;  2ZJA A;  1X6I A;  3OSN A;  4QZB A;  5B5E U;  4YN4 A;  1K5O A;  2KHQ A;  3JPR A;  2YML A;  1ZQM A;  1ARO P;  1UT5 A;  4O3O A;  5CR0 A;  3GIM A;  8ICN A;  8ICA A;  5HMM A;  3KHH A;  2BPC A;  4O3P A;  1BPX A;  1ZQG A;  3QYP A;  4AP9 A;  2I5H A;  4TUR A;  4OJ5 A;  1HJP A;  4ECT A;  2VAN A;  5AIC A;  3NVW A;  2DQN B;  3SI8 A;  1BPB A;  4B9S A;  2J6S A;  4JV0 A;  3SAG A;  2ZUC A;  4YXJ A;  1TV9 A;  3N7R C;  1BPE A;  2G5I B;  1F44 A;  3NTU A;  3TAN A;  4C8K A;  5KFP A;  3FYH A;  3KHL A;  4DCC A;  1JUD A;  4AYB F;  2K8C B;  3MFI A;  1Y88 A;  1IG6 A;  2A1J B;  2ZIX A;  2GOL A;  4B9T A;  3RJI A;  2PI4 A;  3PX6 A;  1KDH A;  4Z6C A;  3V6H A;  1TFR A;  5KL8 B;  4FBT A;  4QWC A;  5J2I A;  4NXZ A;  2MUT B;  1VLB A;  4DQS A;  1Q46 A;  5KFK A;  5KFI A;  2LI6 A;  4ZH4 A;  9ICM A;  2NRZ A;  2LBO A;  4I2A A;  1ZQ1 C;  2BCR A;  3NAS A;  4QWD A;  5KG5 A;  3OGU A;  3GV8 B;  5EWG A;  4MF2 A;  5DBB A;  5KFX A;  3SV4 A;  4QZG A;  1J97 A;  5HHI A;  1S0M A;  4M9J A;  5KT3 A;  4YMN A;  1BPD A;  3UM9 A;  4DFK A;  4R8U A;  2KN7 A;  4QZF A;  1T4G A;  4J9N A;  4KLH A;  1N62 A;  1VDV A;  4I2H A;  4BWM A;  3PR4 A;  2KKP A;  5CEH A;  4IQW A;  3OJU A;  4QZA A;  4Y2T A;  3M9O B;  4ED6 A;  5IIN A;  3PVX A;  2KIC A;  5III A;  4C8L A;  1QQ7 A;  1QSY A;  3PNC A;  2BPF A;  4XA5 A;  2KD1 A;  4F2R A;  2F8L A;  4CCH A;  2BZF A;  1LKY A;  2HOI A;  2R8G A;  4DLE A;  4O5E A;  2EZX A;  5DBC A;  3MR5 A;  9ICG A;  2H3Z A;  1ZQC A;  3LDA A;  8ICT A;  2BCU A;  2NRT A;  1IM4 A;  1QSL A;  9ICH A;  3N28 A;  3QXG A;  1BNP A;  5KT2 A;  3V6K A;  4F4X A;  3BS7 A;  3KZI U;  5GTI U;  4YCX A;  3QZ8 A;  5ALR A;  3C5G A;  4GFJ A;  4KLO A;  4M0A A;  5AK5 A;  4YR2 A;  4Y2J A;  2ZTC A;  2F77 X;  5J2F A;  4ED7 A;  5KFD A;  1TVA A;  5EOZ A;  4IL6 U;  9ICV A;  3ISD A;  5L1I A;  3SD7 A;  1KL9 A;  1KQQ A;  1B22 A;  2DL0 A;  1XSP A;  4TQS A;  4CF4 A;  3QE9 Y;  3RH6 A;  2C2D A;  3MDA A;  1X9W A;  3F5E A;  3MFH A;  1RYR A;  1TK0 A;  4RQ7 A;  4M2Y A;  4UAZ A;  3N7S C;  4M04 A;  4KX5 A;  2WF9 A;  3MR3 A;  2CRX A;  4P0P A;  2UVW A;  5KT7 A;  2K4H A;  9ICC A;  4FS1 A;  1ZQZ A;  2QAR B;  5J2G A;  1VJ5 A;  2PXI A;  2K4I A;  4TUS A;  1L6N A;  4ECU A;  3A0H U;  3PSP A;  3NVZ A;  5ALN A;  2W3S A;  1NZP A;  3PX4 A;  1WG8 A;  3M6Z A;  2OCE A;  3S6J A;  4RNO A;  4TUQ A;  8ICQ A;  5EWF A;  4ELV A;  4O5C A;  3QU7 A;  3AN1 A;  5L1M A;  4IC9 A;  4C8N A;  2LMR A;  3THV A;  4QZH A;  2W54 A;  5FP0 A;  3GV5 B;  3JPN A;  3WKD A;  2UVV A;  5BOM A;  3ALR A;  1IV8 A;  5TZV A;  4DO9 A;  2V4R A;  2JV3 A;  2C28 A;  4ED0 A;  5GTH U;  5KG3 A;  4Y2S A;  4QW9 A;  5JRT A;  1L7M A;  1T3Q A;  2KK0 A;  2ZIU B;  3RJG A;  5DBA A;  2PFP A;  4Y2P A;  5DDM A;  5AI8 A;  1O03 A;  2LPE A;  1SL0 A;  4KLI A;  4USA A;  5AKJ A;  4TUP A;  1NK9 A;  4DQP A;  1JN3 A;  5B66 U;  2FLL A;  2ZIW A;  3SMV A;  3UMB A;  2YMQ A;  1H38 A;  1NOM A;  2HBM A;  2QB0 A;  3SR6 A;  2NV3 A;  3QU2 A;  5DLF A;  4O5K A;  2NRV A;  4UB8 U;  1NK0 A;  2ZUD A;  3HJE A;  1JIH A;  3BQ1 A;  3C5F A;  4FBU A;  4PHA A;  1SKR A;  1UT8 A;  3LVW A;  5KT6 A;  5KFR A;  4I2J A;  2W9A A;  1B43 A;  3EPI A;  4QZI A;  5JUM A;  4DL4 A;  1ED1 A;  2VJ5 A;  4QW8 A;  4KLM A;  1S0V A;  2HHQ A;  2KJ5 A;  4GXJ A;  3R9K A;  3QU9 A;  4RUC A;  3LWL A;  1JRO A;  1S77 D;  3M8R A;  1ZD4 A;  3PV8 A;  2JZB B;  3HKZ F;  1S10 A;  3H8J A;  4MEX A;  5ALW A;  4KLE A;  1J2M A;  2GWS A;  3WU2 U;  2LYB A;  2HBJ A;  4ED8 A;  1S9F A;  4M9L A;  1KTQ A;  4I2G A;  4RU9 A;  3FDS A;  1ZQP A;  1RYS A;  3RAX A;  2XO7 A;  3RJF A;  1OW5 A;  5HNK A;  3LWM A;  3BQT A;  4K4H A;  4UB5 A;  3QUB A;  2HBK A;  1KW4 A;  4PGX A;  3MC1 A;  2KZ3 A;  5ALP A;  3IN5 A;  5DGB A;  2JEJ A;  3GIK A;  1ZQD A;  2FMQ A;  4P4M A;  4Y2U A;  1ZQK A;  3TAD A;  5KFZ A;  4F5P A;  3VC8 A;  1SV4 A;  2E1E A;  3CNH A;  1T8E A;  1ZQA A;  9ICU A;  2LKY A;  3CRX A;  1NJX A;  4QWB A;  2Q4T A;  4PL2 A;  3MR6 A;  3L5K A;  3CP8 A;  3F5A A;  5KG6 A;  2BDU A;  1L3U A;  3OSP A;  3Q8S B;  4F91 B;  2Y0S F;  2A1J A;  3LK9 A;  2H3F A;  4NLN A;  2JXJ A;  4DOB A;  4U6P A;  4B6J A;  4US8 A;  5KG7 A;  2W8K A;  1PK3 A;  1ZQI A;  4F5Q A;  5KFH A;  1SL1 A;  3AUO A;  5EE0 A;  3PW4 A;  3UXP A;  1ZET A;  4UAV A;  1PVR A;  2G06 A;  5G5G A;  3OJS A;  3SYZ A;  1U49 A;  5D4B A;  1NK6 A;  7ICE A;  5ALI A;  4DL5 A;  4DF8 A;  2H3Q A;  4BGD A;  1JMS A;  2W9B B;  5J0Y A;  2E5S A;  4J9M A;  4C80 A;  2CN1 A;  4ECS A;  4ECQ A;  3TI0 A;  3IM1 A;  3Q8M A;  1ZYQ A;  5IIK A;  4QIW C;  3H4D A;  2KIV A;  1JRP A;  3CW2 C;  4IS7 A;  2WTF A;  3ZDE A;  3ICX A;  1RXW A;  3MBY A;  2EAO A;  4RNN A;  1SWW A;  3MDC A;  4MFA A;  2AQ0 A;  3BQ0 A;  2PMZ F;  1XO1 A;  5F9N A;  2BCV A;  2FJ6 A;  4JWM A;  3BQ2 A;  3GV7 B;  5ALJ A;  3PO5 A;  5C5J A;  1JXE A;  4QWA A;  9ICE A;  1DGJ A;  5KAI U;  2DKX A;  4IR1 A;  4IQU A;  3QU5 A;  7ICN A;  3NVY A;  5ALD A;  4C0Z A;  4R65 A;  2B0C A;  4F92 B;  3QUT A;  3QUQ A;  1J2N A;  3ZDB A;  1FO4 A;  3ISB A;  1SKS A;  4MEY A;  2P6R A;  2AXT U;  9ICK A;  5KG4 A;  1OXJ A;  1QCK A;  2ZXI A;  2AHO B;  2E3T A;  4K4G A;  2HCF A;  2QB1 A;  2HOF A;  5AKY A;  2ASL A;  4Q8E A;  3PZP A;  2H3I A;  3QZ7 A;  3NS1 A;  4J9O A;  2ZIV B;  1KLN A;  3ZI4 A;  2BR0 A;  1U4B A;  4DSJ A;  4PHE A;  2CXY A;  1S0O A;  4BWJ A;  2OXO A;  2LYA A;  4OD0 A;  1S0N A;  2C22 A;  1QSS A;  4DQQ A;  4OJL A;  4ECX A;  3RBE A;  3UMG A;  3Q8Q B;  5DGA A;  4KLJ A;  2W9C B;  2A19 A;  1KFS A;  5ALM A;  5KG1 A;  5KFF A;  1PK1 A;  2D3D A;  4F50 A;  5KFU A;  4KN7 A;  2E1F A;  4NLG A;  1XNS A;  2C2R A;  4MFC A;  5J0W A;  1SZH A;  1X9S A;  3WKB A;  1V85 A;  2HHU A;  5EE1 A;  4B9U A;  2DUY A;  2XY5 A;  4O9M A;  1JI7 A;  1SWV A;  3RFA A;  5KFB A;  1K1S A;  5KFW A;  1PZN A;  2HSZ A;  2Y1J A;  2F3N A;  2PFN A;  2V4Q A;  3SZ2 A;  4O3S A;  1SXD A;  2DKZ A;  1XU4 A;  1UHU A;  4J9Q A;  3JPS A;  1ZQW A;  2K4E A;  3RBD A;  2IA6 A;  5J0Q A;  4AYB C;  3NRZ A;  4MF8 A;  2XIC A;  2QKQ A;  3DEE A;  5DQG A;  1KFT A;  3ZD8 A;  4DL3 A;  4I2D A;  4ACO A;  2HHT A;  2BHN A;  3D2S A;  8ICF A;  1NI3 A;  1KRP A;  4KLT A;  3MAB A;  2O6K A;  2EZY A;  1TK8 A;  4B9V A;  9ICT A;  1ZQQ A;  3WK7 A;  3UXN A;  2N1R A;  4UAT A;  1XC9 A;  4FZN A;  2VIX A;  3H0L B;  2P35 A;  5AKL A;  3F2B A;  4UB4 A;  3Q8K A;  1L7O A;  4DSI A;  4F71 A;  2R8H A;  1GO3 F;  2ESE A;  3H4B A;  1F0M A;  3V7J A;  5KFC A;  5AI4 A;  3G6X A;  4EYI B;  3PW0 A;  4ECW A;  3OHA A;  1YZ6 A;  5JU5 A;  2NRW A;  1COO A;  1ZJM A;  4KLD A;  9ICX A;  3BS5 A;  3DDH A;  5KFO A;  3IRU A;  2R8J A;  8ICV A;  2OHF A;  5KG2 A;  1L7N A;  3UXO A;  4US9 A;  3EUB 2;  5AKX A;  2D8C A;  4RQ2 A;  2PFQ A;  3KD3 A;  2XY7 A;  1HEK A;  4RZR A;  4ELU A;  5EWE A;  2B21 A;  1WCN A;  3AQE A;  5CWR A;  5J2H A;  3M6K A;  4LZD A;  3RAQ A;  2RQ5 A;  1BGX T;  3IHQ B;  2LYH A;  2RRD A;  5AKI A;  4FZL A;  3DV9 A;  5AK6 A;  4Y2Y A;  3RF9 A;  3H40 A;  3IV6 A;  4RT3 A;  1NZB A;  3RTV A;  1Q3U A;  2KP7 A;  1N60 A;  3WK6 A;  2VA8 A;  5KFA A;  3D6J A;  1X2I A;  3AL0 B;  2HDO A;  2WB1 F;  3QU4 A;  2I6X A;  1ZQV A;  1SB3 C;  1U48 A;  3D2N A;  2H3V A;  3C29 A;  4CDG A;  2XVT A;  2KSO A;  2AQ4 A;  2ATL A;  2ASD A;  3RRG A;  1NJW A;  3QUC A;  1JAL A;  2WAQ C;  2BQ3 A;  5DQI A;  2Y9T A;  4QZE A;  4FS2 A;  3KFU F;  1UCV A;  4DSL A;  1N2X A;  1SGG A;  3WKC A;  5DLG A;  3UQ2 A;  4IR9 A;  4F8R A;  1DXS A;  4OJ6 A;  3SAH A;  4RPY A;  1TK5 A;  1HUZ A;  1TAM A;  4M9G A;  2BCQ A;  4DSE A;  4JMU A;  1N63 A;  2KFZ A;  5J0R A;  5EE9 A;  5AKH A;  2YMP A;  1TE2 A;  1WUD A;  3Q8L A;  5J0T A;  2FPM A;  1U45 A;  3J81 j;  4C7Y A;  2EDU A;  1ZD3 A;  4I2F A;  1L3T A;  8ICB A;  3U26 A;  3I28 A;  2YB1 A;  3GDX A;  4QZ8 A;  4JK1 A;  2OH2 A;  1Z00 B;  1SXE A;  5DKW A;  3ETR A;  1K1Q A;  1ZD5 A;  5AKZ A;  3UPQ A;  1KFD A;  3H8M A;  4OJP A;  4A8E A;  5J0U A;  3M9N B;  2ODG A;  4DL6 A;  3EW9 A;  5KFE A;  4EBE A;  3QEB Z;  4C8M A;  1DK3 A;  1CEZ A;  4XRH A;  2G08 A;  1ZJN A;  4DL2 A;  1XO0 A;  4R64 A;  3LVV A;  2J6U A;  2IHM A;  2ES6 A;  4WJ3 B;  4UB1 A;  3ZD9 A;  4NLZ A;  4OJO A;  4QNL A;  5AIB A;  9ICN A;  5HHH A;  2A3V A;  3NGD A;  3PY8 A;  3GIJ A;  4M47 A;  5CJ7 A;  8ICH A;  1SIJ A;  5KFM A;  5J2C A;  1U9L A;  5HP4 A;  3K1Z A;  1RZT A;  2KZM A;  2W9B A;  3AM9 A;  2FI1 A;  1DRG A;  2ZJ5 A;  1L8O A;  2ZIX B;  2LM1 A;  2JRZ A;  2OEH A;  2KMD A;  5J8Y C;  1MC8 A;  2EZZ A;  2EAM A;  5KT4 A;  2DF4 B;  1JX4 A;  1ZRM A;  5ALL A;  3Q8P B;  3ZDD A;  2ZUB A;  4ECZ A;  5KFG A;  1ZQS A;  3G6V A;  1ZQO A;  3PW7 A;  4NY8 A;  4KMU A;  4NJ8 A;  1N5X A;  2IHN A;  1RM6 C;  4YVZ A;  4FO6 A;  3HKZ C;  5AKE A;  2BPG A;  2WFA A;  2K60 A;  2W7O A;  2UVU A;  4RPZ A;  2WF7 A;  3NUQ A;  2JH7 A;  5J29 A;  5J8Y A;  1B0X A;  4DOC A;  4P2H A;  1N61 A;  3QNM A;  2YY6 A;  4M6W A;  4KN4 A;  5A0L A;  2FPK A;  4R8U B;  4QZD A;  1FFV A;  3TAD C;  2HHW A;  3JPT A;  5DB9 A;  1ZQT A;  4K4I A;  3H7I A;  1X9X A;  3SV3 A;  2QLT A;  2I9G A;  2Y1I A;  1DGS A;  4UW9 A;  2KJ8 A;  1ZQJ A;  8ICY A;  4YQW A;  2EH9 A;  2P6U A;  1NKE A;  4RQ1 A;  2AGP A;  3KKA A;  1T94 A;  1Z1B A;  3PSF A;  4YMO A;  4BXO A;  2W8L A;  4KLU A;  1QQ5 A;  4OCZ A;  4DFD A;  2W03 A;  5JTI A;  1PVP A;  8ICS A;  3RH5 A;  4DSK A;  3M8S A;  1UA0 A;  2CPR A;  3M1Y A;  1HUO A;  3WK9 A;  1D8L A;  4YP3 A;  2R8I A;  7ICK A;  2L5Y A;  1ZQL A;  4ED1 A;  2Y0S C;  4EX6 A;  1ZRN A;  2M9N A;  5ALX A;  3JPO A;  4C7Z A;  2K8A A;  2IBK A;  5AI6 A;  1ECW A;  2H5X A;  4UAW A;  3AQF A;  2LHT A;  3V7K A;  7ICL A;  4DFJ A;  4BX9 C;  4YXM A;  8ICC A;  3RB4 A;  3PO4 A;  4Z6D A;  8ICW A;  3H0R B;  3OTQ A;  1PUZ A;  1Z3E B;  2KV2 A;  5CA7 A;  2RLT A;  5J0S A;  4X5V A;  1ZQX A;  7ICU A;  4Y2R A;  4PGQ A;  1TAU A;  4JV2 A;  3F53 A;  5ALK A;  1L3S A;  3SEN A;  4EBD A;  4LZG A;  3EZ5 A;  4Z6E A;  1X9M A;  2MUT A;  2FDR A;  4RQ3 A;  8ICX A;  2BKE A;  4P0P B;  3BQ7 A;  5L9X A;  4BJQ A;  1DK2 A;  3KBB A;  1S76 D;  4F4W A;  7ICM A;  2JHD A;  1O08 A;  1L5U A;  3M9M B;  5KT5 A;  1XSL A;  2MA1 A;  5KNI A;  4GLX A;  4IQT A;  1ZOL A;  4EEN A;  1Z19 A;  4Y2X A;  4PHD A;  3TAC B;  2PFO A;  2ZG6 A;  2R8K A;  5AM3 A;  3ZDC A;  4P4P A;  5ALT A;  2FMS A;  3F2D A;  4Y2V A;  2KTQ A;  1MN8 A;  4YD2 A;  4I29 A;  3TKA A;  3RJK A;  4KLG A;  4J9P A;  1A0P A;  4YFK A;  4NWI A;  2Y9U A;  5KFL A;  4JUZ A;  2G09 A;  3GII A;  1AQ6 A;  4EBC A;  3GIL A;  5KAF U;  3MR2 A;  1NK4 A;  3KHR A;  2IOF K;  3L3F X;  5AHX A;  5KFT A;  1JXL A;  3PML A;  3JPQ A;  1RG6 A;  4J03 A;  4M9H A;  3LYS A;  8ICU A;  1N48 A;  3T5J A;  2ZIW B;  2PKE A;  4PPX A;  4QIW F;  9ICF A;  4UBB A;  1RXV A; 
#chains in the Genus database with same CATH homology
 9ICC A;  4FS1 A;  1ZQZ A;  3TAP A;  5HML A;  3RJE A;  5J2G A;  2PXI A;  2B21 A;  1WCN A;  4TUS A;  2BQR A;  3C21 A;  5CWR A;  4ECU A;  3RR8 A;  4UB2 A;  4DOA A;  5J2H A;  4Q43 A;  4LZD A;  5KFY A;  3RAQ A;  1BGX T;  2FMP A;  3IHQ B;  4PH5 A;  3BDP A;  4EYH B;  4I2B A;  3PX4 A;  3B0X A;  2LYH A;  4RNO A;  4TUQ A;  3HW8 A;  4UAY A;  3E2E A;  5J2K A;  8ICQ A;  1ZQH A;  1D8Y A;  1QTM A;  5EWF A;  4YR3 A;  3RB3 A;  4DQI A;  4ELV A;  4O5C A;  4DSF A;  5D49 A;  3H40 A;  3RB0 A;  4RT3 A;  3MGH A;  4C8N A;  3THV A;  4QZH A;  3RTV A;  3C2K A;  4NM2 A;  4RQ6 A;  2F1I A;  2VA8 A;  5KFA A;  3GV5 B;  5L1K A;  3JPN A;  2FLP A;  4EEY A;  4BDP A;  1DOQ A;  2UVV A;  5BOM A;  7ICT A;  2XCA A;  4YG2 A;  1X2I A;  3PMN A;  3QEA Z;  5TZV A;  5BOL A;  4DO9 A;  2KFN A;  2V4R A;  4RNM A;  1ZQV A;  4DQR A;  2C28 A;  3EYZ A;  1Z00 A;  4ED0 A;  1U48 A;  2ZJ8 A;  1ZQE A;  4B9L A;  2JEI A;  5KG3 A;  4QW9 A;  4KIT B;  2AQ4 A;  5DB8 A;  2ATL A;  2ASD A;  3C2L A;  3RRG A;  1NJW A;  3RJG A;  1IXR A;  5DBA A;  4J9S A;  3C2M A;  2PFP A;  4KTQ A;  5DDM A;  8ICP A;  2BQ3 A;  5DQI A;  2NRX A;  4QZE A;  4FS2 A;  1SL0 A;  1A77 A;  4KLI A;  5KTQ A;  5IIJ A;  4TUP A;  1NK9 A;  1ZQB A;  4DSL A;  4DQP A;  8ICM A;  1JN3 A;  3N97 B;  5J2B A;  9ICB A;  2XCP A;  2FLL A;  4KLS A;  5DLG A;  3UQ2 A;  5KFJ A;  4IR9 A;  4F8R A;  5BPC A;  4UQG A;  2DFL A;  1H38 A;  4RPY A;  1NOM A;  1TK5 A;  1NJY A;  3T5K A;  9ICJ A;  1HUZ A;  4EZ9 A;  4M9G A;  5DG9 A;  2J6T A;  2BCQ A;  9ICA A;  5CB1 A;  5J2A A;  5J0P A;  5DB7 A;  4DSE A;  4UB3 A;  2KFZ A;  5J0R A;  5DLF A;  3ETL A;  4PHP A;  2NRV A;  3RJH A;  4O5K A;  9ICQ A;  1NK0 A;  2ZUD A;  4B9M A;  3Q8L A;  5J0T A;  1ZYQ A;  1JIH A;  2FPM A;  3C5F A;  3BQ1 A;  3RB6 A;  1U45 A;  2HW3 A;  3V6J A;  8ICL A;  2Q0Z X;  4FBU A;  4PHA A;  1T3N A;  4I2F A;  1SKR A;  1UT8 A;  4F93 B;  4NLK A;  5KT6 A;  5KFR A;  1L3T A;  4I2J A;  4IRD A;  8ICB A;  2W9A A;  1B43 A;  3EPI A;  3HWT A;  4QZI A;  5JUM A;  4GC6 A;  4DL4 A;  3KTQ A;  7ICI A;  4QW8 A;  2HHV A;  2KZZ A;  4KLM A;  1S0V A;  2FPL A;  4RQ4 A;  3GDX A;  2BQU A;  3GFK B;  1SZP A;  4I2I A;  4RPX A;  2HHQ A;  2VA2 A;  8ICO A;  4QZ8 A;  4JK1 A;  4GXJ A;  8ICE A;  2F1J A;  5J0X A;  3T5H A;  3RH4 A;  2W9M A;  1Z00 B;  4Q44 A;  4RUC A;  4QZC A;  3HPO A;  3LWL A;  4ED2 A;  1S77 D;  4DFP A;  3M8R A;  5DKW A;  1K1Q A;  3PV8 A;  3UPQ A;  2JZB B;  1S10 A;  2JEF A;  1KFD A;  5F9L A;  4TQR A;  4ED3 A;  9ICP A;  3H8J A;  4MEX A;  3EPG A;  8ICK A;  4KLE A;  9ICR A;  2GWS A;  4Q45 A;  2BCS A;  3M9N B;  5J0U A;  5L1J A;  2V9W A;  4DL6 A;  5DG8 A;  3C1Z A;  3EW9 A;  5KFE A;  3OHB A;  4EBE A;  4ED8 A;  4DS5 A;  3QEB Z;  1UA1 A;  4DL7 A;  4C8M A;  4Z6F A;  1S9F A;  4F3O A;  1CEZ A;  4XRH A;  4LVS A;  2RDJ A;  3MGI A;  3AU6 A;  2HVI A;  1ZJN A;  5IIL A;  4DL2 A;  2OWO A;  4C8O A;  4M9L A;  1KTQ A;  4GXI A;  4DWI A;  4I2G A;  1ZQF A;  4RQ0 A;  4RU9 A;  3FDS A;  3ZDA A;  4R66 A;  2AJQ A;  1ZQP A;  3TAR A;  1RYS A;  3PW2 A;  2XO7 A;  3RAX A;  4R64 A;  3RJF A;  5HNK A;  4EZ6 A;  4G3I A;  9ICW A;  2DPJ A;  2J6U A;  2IHM A;  3LWM A;  1MQ3 A;  3BQT A;  4UB1 A;  4O0I A;  4K4H A;  1NK5 A;  1N56 A;  3ZD9 A;  1TKD A;  4NLZ A;  4UB5 A;  1CUK A;  5D46 A;  4B9N A;  9ICN A;  1ZQU A;  4PGX A;  5HHH A;  2KZ3 A;  4YMM A;  3C23 A;  3NGD A;  7ICV A;  3PY8 A;  3K4G A;  3GIJ A;  5KG0 A;  7ICQ A;  4GC7 A;  4M47 A;  7ICJ A;  5KFS A;  5DGB A;  4RQ5 A;  2JEJ A;  7ICF A;  5CJ7 A;  8ICH A;  3GIK A;  1ZQD A;  2FMQ A;  1ZQR A;  4M6W B;  4P4M A;  2I1Q A;  5KFM A;  5IIM A;  1BPZ A;  5J2C A;  1ZQK A;  1KSP A;  5J0O A;  3K75 D;  1T7P A;  2P66 A;  4J9R A;  3KHG A;  4ECR A;  1NK8 A;  1U9L A;  5HP4 A;  1RZT A;  5KFZ A;  9ICL A;  4F5P A;  2BGW A;  1C7Y A;  2KZM A;  2XY6 A;  8ICG A;  3ORY A;  1WCL A;  1T8E A;  2W9B A;  3RR7 A;  1XS9 D;  1ZQA A;  2ZJ5 A;  4I2C A;  2ZTE A;  9ICU A;  1NJX A;  4QWB A;  2BDP A;  8ICR A;  3MR6 A;  4DEZ A;  1MC8 A;  3HX0 A;  7ICH A;  2ALZ A;  4I2E A;  1KEJ A;  4DFM A;  3V7L A;  5KT4 A;  5KG6 A;  3TQ1 A;  2MAX A;  7ICS A;  1L3U A;  1NJZ A;  3OSP A;  5J2J A;  4PGY A;  1QLN A;  4RUA A;  3Q8S B;  1L3V A;  4F91 B;  3T5L A;  4E0D A;  2JZB A;  2RDI A;  4ELT A;  2A1J A;  3LK9 A;  4BXO B;  4F4K A;  4KLF A;  1JX4 A;  5J2D A;  3PR5 B;  4NLN A;  3Q8P B;  4F2S A;  4DOB A;  9ICI A;  3ZDD A;  2ZUB A;  8ICJ A;  4ECV A;  2ZTD A;  1A76 A;  2ZJA A;  5KG7 A;  3OSN A;  5KFG A;  2W8K A;  4ECZ A;  1ZQI A;  4QZB A;  4YN4 A;  5KFH A;  4F5Q A;  3G6V A;  1SL1 A;  1ZQS A;  7ICR A;  5L1L A;  3JPR A;  1ZQY A;  1ZQM A;  3AUO A;  1ZQO A;  3PW4 A;  3PW7 A;  1ARO P;  3HP6 A;  3UXP A;  1UT5 A;  4O3O A;  5CR0 A;  3GIM A;  1ZET A;  2DPI A;  8ICN A;  4O3Q A;  4NY8 A;  8ICA A;  4KMU A;  5HMM A;  4JWN A;  3OJS A;  3KHH A;  2BPC A;  3SYZ A;  4O3P A;  1U49 A;  1BPX A;  1ZQG A;  2IHN A;  4YVZ A;  4FO6 A;  5D4B A;  4TUR A;  2FLN A;  1NK6 A;  1TAQ A;  7ICE A;  7ICO A;  1HJP A;  4ECT A;  4DL5 A;  2VAN A;  4DF8 A;  8ICI A;  4GXK A;  3SI8 A;  2BPG A;  4BGD A;  2UVU A;  1BPB A;  4RPZ A;  4B9S A;  2J6S A;  1JMS A;  2W9B B;  4JV0 A;  5J0Y A;  4J9M A;  2ZUC A;  4YXJ A;  5J29 A;  1TV9 A;  4DOC A;  1BPE A;  4P2H A;  4ECS A;  4ECQ A;  2UVR A;  4M6W A;  3IM1 A;  3NTU A;  3JPP A;  3TI0 A;  4KN4 A;  5IIK A;  3TAN A;  3H4D A;  5KFP A;  3FYH A;  4UBC A;  5DG7 A;  4C8K A;  3KHL A;  2WTF A;  2AGQ A;  3ZDE A;  2FPK A;  4R8U B;  4QZD A;  2HHW A;  3JPT A;  1U47 A;  3Q8R B;  1RXW A;  5DB9 A;  3MBY A;  1ZQT A;  4K4I A;  3MFI A;  3H7I A;  1Y88 A;  1EXN A;  7ICG A;  2A1J B;  4RNN A;  4MFF A;  3SV3 A;  3MDC A;  2I9G A;  3PW5 A;  4MFA A;  2AQ0 A;  4B9T A;  3RJI A;  3BQ0 A;  2Y1I A;  2PI4 A;  1DGS A;  1XO1 A;  5F9N A;  2BCV A;  1BPY A;  3G6Y A;  4JWM A;  4O3N A;  5CP2 A;  3RRH A;  1ZQJ A;  8ICY A;  4YQW A;  3BQ2 A;  3PX6 A;  3C1Y A;  4XUS A;  3GV7 B;  1KDH A;  3PO5 A;  4Z6C A;  3V6H A;  5C5J A;  1TFR A;  2VA3 A;  2P6U A;  1NKE A;  4RQ1 A;  1JXE A;  2AGP A;  1NK7 A;  5DB6 A;  4YMO A;  4FBT A;  3N4M B;  2ISO A;  1LV5 A;  1MSW D;  4QWC A;  4QWA A;  5J2I A;  9ICE A;  4NXZ A;  2MUT B;  4BXO A;  1XWL A;  2W8L A;  4IR1 A;  4IQU A;  7ICN A;  4KLU A;  4R65 A;  4DF4 A;  4DQS A;  1SL2 A;  4F92 B;  5KFK A;  3V72 A;  5KFI A;  2XC9 A;  4ZH4 A;  4NM1 A;  9ICM A;  3ZDB A;  2NRZ A;  3ISB A;  1SKS A;  2IMW P;  4MEY A;  2P6R A;  9ICK A;  8ICS A;  4I27 A;  5KG4 A;  3PX0 A;  1NKC A;  4I2A A;  3RH5 A;  4DSK A;  3M8S A;  1XSN A;  2BCR A;  5IIO A;  1UA0 A;  4QWE A;  1HUO A;  4K4G A;  4RQ8 A;  1D8L A;  4YP3 A;  3H8W A;  2R8I A;  4QWD A;  2ASL A;  9ICO A;  4Q8E A;  4QZ9 A;  5KG5 A;  3QZ7 A;  3OGU A;  1D9D A;  7ICK A;  4J9O A;  1ZQL A;  2F1H A;  4ED1 A;  1KLN A;  4F4Y A;  2BR0 A;  1U4B A;  3Q8M A;  4DSJ A;  4PHE A;  3GV8 B;  1S0O A;  5EWG A;  4MF2 A;  4BWJ A;  5DBB A;  5KFX A;  3TAQ A;  3SV4 A;  2M9N A;  2C22 A;  1S0N A;  3JPO A;  4DQQ A;  4QZG A;  4ECX A;  5HHI A;  1QSS A;  3B0Y A;  2HHS A;  2IBK A;  5J2E A;  3RBE A;  3Q8Q B;  1S0M A;  4IQV A;  5KT3 A;  4M9J A;  4YMN A;  2H5X A;  4UAW A;  5DGA A;  1BPD A;  4KLJ A;  2W9C B;  1KFS A;  5KG1 A;  5KFF A;  4DFK A;  3V7K A;  3BJY A;  4DFJ A;  4O3R A;  7ICL A;  4F50 A;  4YXM A;  4R8U A;  2KN7 A;  4QZF A;  3TFR A;  8ICC A;  3RB4 A;  5KFU A;  3PO4 A;  4KN7 A;  1T4G A;  4YR0 A;  2AU0 A;  4NLG A;  4J9N A;  4Z6D A;  4J9K A;  2C2R A;  4KLH A;  4MFC A;  5J0W A;  4I28 A;  4I2H A;  4IRC A;  4BWM A;  3PR4 A;  3HT3 A;  8ICW A;  1X9S A;  4IQW A;  1Z3E B;  3AU2 A;  4QZA A;  3OJU A;  5CA7 A;  5J0S A;  4X5V A;  4F4Z A;  1MQ2 A;  2HHX A;  2HHU A;  1ZQX A;  3M9O B;  4F5R A;  4ED6 A;  4B9U A;  5IIN A;  2XY5 A;  3PVX A;  7ICU A;  4PGQ A;  5III A;  3GQC A;  4C8L A;  4O9M A;  2HVH A;  2C2E A;  4DLG A;  1TAU A;  1QSY A;  5KFB A;  3PNC A;  2BPF A;  4JV2 A;  1K1S A;  4XA5 A;  5KFW A;  1S97 A;  3T3F A;  1L3S A;  1PZN A;  4EBD A;  4F2R A;  2Y1J A;  5DQH A;  3EZ5 A;  2PFN A;  4LZG A;  4Q8F A;  2V4Q A;  3SZ2 A;  4O3S A;  4Z6E A;  1X9M A;  4CCH A;  2MUT A;  4RQ3 A;  9ICS A;  8ICX A;  2BKE A;  4HYK A;  1XU4 A;  4J9Q A;  4KLQ A;  5KFN A;  3JPS A;  5L9X A;  2R8G A;  4DLE A;  1ZQW A;  3RBD A;  4O5E A;  2IA6 A;  5J0Q A;  5DBC A;  3MR5 A;  9ICG A;  4MF8 A;  1S76 D;  4F4W A;  7ICM A;  1ZQC A;  1ZQN A;  4JV1 A;  1L5U A;  3M9M B;  5KT5 A;  1XSL A;  3LDA A;  5DQG A;  4R63 A;  1KFT A;  8ICT A;  2BCU A;  4IRK A;  2NRT A;  3ZD8 A;  1IM4 A;  4ECY A;  4KLL A;  4GLX A;  4IQT A;  4P4O A;  1QSL A;  4DL3 A;  9ICH A;  1RPL A;  4M9N A;  5KFQ A;  4I2D A;  5KT2 A;  2HHT A;  2BHN A;  3V6K A;  1NKB A;  4PHD A;  4F4X A;  2PFO A;  4DS4 A;  8ICF A;  1KRP A;  2XGP A;  2R8K A;  4YCX A;  3QZ8 A;  3MAB A;  4KLT A;  9ICT A;  1TK8 A;  1BVS A;  4B9V A;  3C5G A;  1ZQQ A;  4XQ8 A;  3ZDC A;  4KLO A;  3UXN A;  4P4P A;  4F5N A;  4M0A A;  1XC9 A;  2FMS A;  4YR2 A;  3EWA A;  4J9L A;  4UB4 A;  3Q8K A;  4DSI A;  2ZTC A;  3H8S A;  3TFS A;  5J2F A;  4ED7 A;  2KTQ A;  5KFD A;  4F5O A;  1TVA A;  2R8H A;  2W9C A;  4YD2 A;  5DDY A;  5CHG A;  4I29 A;  5EOZ A;  3RJK A;  3H4B A;  4KLG A;  3ISD A;  9ICV A;  5L1I A;  3V7J A;  4J9P A;  5KFC A;  1V9P A;  2XGQ A;  4YFK A;  5KFV A;  2JEG A;  3G6X A;  1B22 A;  3ISC A;  4RT2 A;  4EYI B;  4TQS A;  1XSP A;  5KFL A;  4JUZ A;  3QE9 Y;  3PW0 A;  4ECW A;  1D9F A;  7ICP A;  3GII A;  3RH6 A;  2C2D A;  3MDA A;  3OHA A;  4EBC A;  1X9W A;  2PI5 A;  3GIL A;  2NRW A;  1COO A;  3MR2 A;  1ZJM A;  4KLD A;  8ICZ A;  1NK4 A;  3MFH A;  3KHR A;  9ICX A;  1RYR A;  1JXL A;  5KFT A;  5KFO A;  1TK0 A;  3PML A;  2R8J A;  8ICV A;  4RQ7 A;  5KG2 A;  3UXO A;  4UAZ A;  3JPQ A;  4M2Y A;  4M04 A;  4M9H A;  8ICU A;  2ISP A;  2AGO A;  1N48 A;  3RJJ A;  3T5J A;  3MR3 A;  2ASJ A;  1LB2 B;  4RQ2 A;  2PFQ A;  4PPX A;  2UVW A;  4YD1 A;  2XY7 A;  9ICF A;  4RZR A;  5KT7 A;  4UBB A;  5EWE A;  4ELU A;  3UQ0 A;  1RXV A;  1SKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...