2LYHA

Structure of faap24 residues 141-215
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
b'SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2lyhA00
1NK0A 5KFHA 4DEZA 4XUSA 1S76D 1A76A 3C5FA 4R63A 3RR7A 4UAYA 4PGXA 4K4IA 1S0VA 1TAQA 9ICBA 1NOMA 5J0UA 1ZQDA 4F2RA 4O3OA 3HX0A 5L9XA 4YVZA 3M8RA 4Q45A 7ICHA 5DG7A 1XO1A 1UA0A 4NLGA 4KLMA 2KZMA 4ELTA 3Q8RB 2ASLA 3BQ1A 2P6RA 1L3TA 3Q8PB 4LVSA 3JPNA 3BDPA 4BWJA 3G6XA 2FLNA 4O3PA 2JZBB 3UXPA 3Q8QB 2C2DA 3HPOA 3PW5A 4J9KA 4XQ8A 1NJZA 2PFNA 8ICLA 1SL0A 1MC8A 4M9GA 4C8MA 5HNKA 1UT5A 5DB7A 5KG2A 5J2AA 1RZTA 3RJFA 3JPSA 5J2BA 4TUQA 4BDPA 1KEJA 3ISBA 2AQ4A 3V6HA 1BPYA 4RNNA 4M04A 2KFNA 9ICFA 3ZD9A 1UT8A 3JPOA 4DS5A 3H40A 2C22A 5KFZA 5KT7A 3PVXA 2BGWA 4FBUA 2WTFA 5DQIA 9ICTA 4J9SA 3HWTA 8ICGA 9ICHA 4JK1A 3GIJA 3AU6A 3C21A 3IM1A 2F1JA 4O3QA 4KMUA 5DLFA 7ICEA 5HHHA 2JEJA 2ZTCA 2ALZA 5HHIA 4KLQA 1TK5A 5J0PA 1ZQCA 1TVAA 4QZCA 4QWAA 1XSPA 5HMMA 4RUAA 2OWOA 1S0MA 3THVA 4YD2A 2DPJA 4JV2A 2V4QA 1MQ3A 3AU2A 4DLEA 4KN4A 4C8LA 3RH5A 3ETLA 4J9PA 3RJGA 3UXNA 4GXJA 5KFYA 3QE9Y 1BPXA 7ICKA 1ZQIA 2F1IA 4RPYA 2DFLA 5J0OA 1ZQHA 3TI0A 2J6SA 8ICEA 9ICVA 4QZAA 5KFXA 2PFOA 2ZUCA 4TQRA 1UA1A 4B9VA 1U4BA 5KG1A 2XY7A 4G3IA 5KT6A 3GFKB 4DQIA 1KTQA 4KLDA 4F91B 4RQ4A 3EZ5A 3E2EA 1JMSA 4MF8A 4ECVA 4DQSA 2AU0A 4NXZA 8ICWA 3SV4A 8ICAA 4RQ3A 1SZPA 1NKEA 4EBEA 2FMSA 4DQPA 3KHLA 1XSNA 1JN3A 4ED1A 5DB6A 5J29A 2UVVA 8ICVA 4QZBA 5J0TA 4RQ1A 3PMLA 3HT3A 3GIKA 1XSLA 4QZGA 2W8KA 3C2LA 2BPFA 2PXIA 2RDJA 4I2JA 5CA7A 3RR8A 3H7IA 5KTQA 1QTMA 2BQRA 3MR5A 4F2SA 5KG4A 5KFOA 5J0RA 3C2MA 8ICTA 1TAUA 5KT2A 4DQQA 3G6YA 5L1LA 4Q8FA 4RPXA 2KFZA 4YR3A 4YCXA 1KDHA 4DOCA 2VANA 2W8LA 1BVSA 3QEAZ 3MGHA 1NKCA 9ICEA 4KLLA 4R64A 1X9MA 4IR1A 4DWIA 5DDMA 4YN4A 3M9NB 2BR0A 4IRKA 4LZGA 2KN7A 1LV5A 1TFRA 2XGQA 4I2HA 2NRZA 4JV1A 8ICYA 1NJYA 2DPIA 2BPCA 4F5OA 4RQ2A 4YR2A 2R8KA 5KFNA 1ZQOA 4QWEA 3GIMA 1T4GA 4DOBA 2PFPA 2UVWA 3JPQA 1XS9D 2HHSA 9ICXA 3H8JA 1NKBA 1K1SA 2BCQA 4BXOA 4Z6EA 4DSIA 1MSWD 4EZ6A 8ICUA 5KFVA 1BPBA 2BCSA 3Q8KA 1NK5A 5DBCA 4ELUA 4MF2A 4QW8A 5KFJA 1X9WA 4FS1A 2KZZA 2FPKA 9ICMA 8ICFA 2UVUA 5IINA 3GV7B 4KLFA 5F9LA 4XA5A 4UBBA 4IR9A 1QLNA 2JEGA 3KTQA 3RJKA 3GQCA 9ICPA 3ZDCA 4KLUA 4UAZA 1RYRA 7ICIA 3H4BA 5J2KA 1C7YA 4B9TA 2ASJA 1SKRA 4RQ6A 4YMOA 1S0OA 7ICVA 5IIIA 5D46A 5TZVA 4ED6A 2AGOA 2I1QA 9ICOA 4BGDA 4P4PA 7ICJA 4EZ9A 4F8RA 4M0AA 3UQ0A 1BPEA 1D9FA 3PR4A 4F4KA 1ZJMA 1IXRA 5KG3A 4NY8A 3C5GA 7ICGA 1L3SA 4ED0A 1U45A 5CR0A 4KITB 4B9UA 3TANA 3BQ2A 3KHHA 4DLGA 4NLKA 2ISOA 4QWBA 5DQGA 5IILA 1QSSA 3JPRA 3ORYA 4ECQA 2HHVA 5IIMA 1ZETA 2AQ0A 4DFKA 1NK7A 1ZQLA 1HJPA 3RAQA 1ZQZA 1U48A 2PFQA 3QZ7A 2PI5A 4JWNA 3BQ0A 3RB0A 9ICSA 3GV5B 4F4XA 2ZUBA 1ZQBA 1NK9A 1ZQAA 1DGSA 5CB1A 2ZTEA 4P2HA 2HHXA 4EYHB 7ICTA 3TFSA 5KFMA 4I2FA 5DLGA 3Q8LA 9ICJA 5DDYA 3OJSA 1S9FA 8ICOA 1ZQKA 1T7PA 4F4ZA 4HYKA 1U47A 3JPTA 4ECRA 1N56A 1S97A 1ZQMA 8ICJA 5J0XA 1Y88A 2RDIA 2XC9A 2FMPA 3MFIA 3RJHA 4O3SA 2J6UA 4KLHA 4KN7A 5KFLA 4DS4A 1D9DA 2IA6A 1WCNA 3ZD8A 3ISCA 9ICLA 2HHTA 4J9LA 4ECSA 4BWMA 8ICHA 3RBDA 3GIIA 1TK0A 4KLEA 2ZJ5A 4DL3A 2BPGA 4DO9A 4NM2A 1JXLA 2XCPA 3MBYA 2R8HA 4KTQA 3MDAA 4PGYA 4O5KA 3Q8MA 4KLJA 4QZEA 4E0DA 2Y1JA 3V6KA 3ZDEA 4YD1A 5KFKA 3EPGA 3T3FA 4DSKA 4IQWA 4I2BA 4J9OA 4PHPA 3RTVA 1CEZA 2VA2A 3H4DA 4PH5A 4UB5A 4Q43A 4ECTA 5KFTA 3MABA 2BCRA 3ZDBA 3K75D 5DG9A 9ICCA 3RRGA 3TAPA 5KFRA 3LK9A 8ICBA 2BKEA 4F4YA 4ECZA 8ICQA 4IRCA 5J2JA 3EW9A 3QZ8A 1ZYQA 3SYZA 4MEXA 1COOA 4PPXA 4J9QA 1RPLA 2NRWA 5J0QA 1BPZA 5KFDA 4O3NA 1Z00B 2W9MA 4RNMA 4FBTA 4TURA 4F3OA 4DQRA 1ZQEA 2GWSA 4DL6A 4UAWA 4RPZA 5KFSA 5BOLA 2JEFA 5L1KA 1NJXA 1Z3EB 7ICRA 3V6JA 2BDPA 3SV3A 5J0YA 3PV8A 1ZQXA 7ICOA 3B0YA 3IHQB 5L1IA 1JIHA 4YXMA 3MGIA 1D8YA 2IHNA 2HHUA 4GXKA 2ATLA 3H8SA 1ZQQA 1B22A 4NLNA 1ZQWA 1QSYA 4IQTA 1H38A 2P66A 7ICSA 5DGAA 5KFCA 2HHWA 1KLNA 5CP2A 1X9SA 2MAXA 5J2HA 3PO4A 5KG0A 4ECUA 4F5NA 4M6WA 3LWLA 3TARA 2HVHA 3RH6A 3N97B 1U9LA 2XCAA 2MUTB 4R8UA 5JUMA 1K1QA 4RT3A 2NRVA 4TUSA 3TFRA 4BXOB 5J2FA 4C8KA 3FYHA 2V9WA 4C8OA 3EYZA 3KHRA 1AROP 4YFKA 4EBDA 2M9NA 4RNOA 1KFSA 4EEYA 1KSPA 3ZDDA 3OGUA 2HHQA 8ICSA 2W9BA 4MEYA 4DSFA 5J2GA 3BJYA 3PW0A 4I27A 2AGPA 4RQ0A 3SZ2A 3ISDA 4DL2A 4MFFA 3EWAA 4DL7A 2V4RA 3NTUA 4PGQA 2AGQA 3ZDAA 4DF8A 4I2GA 5DG8A 4Z6FA 2C28A 2A1JA 1RXWA 1V9PA 4K4HA 7ICLA 5L1JA 4DL4A 2UVRA 1B43A 1ZQUA 1ZQJA 4GLXA 2R8GA 5KFGA 4EYIB 1T8EA 3UQ2A 5KFQA 4F5RA 1ZQRA 4PHAA 3PO5A 4I2AA 2P6UA 3GILA 2KZ3A 3RB6A 5KFPA 3SI8A 1HUOA 2IHMA 4F93B 4ELVA 4KLIA 8ICPA 1HUZA 5KFFA 4UB3A 5KFAA 5DBAA 5KT5A 2ISPA 5KFUA 5KG6A 4IRDA 4QWCA 3T5JA 4B9MA 3Q8SB 4P4OA 4GXIA 4TQSA 2FLPA 2R8JA 3HP6A 4FS2A 3LDAA 2JEIA 2B21A 4JV0A 5KFWA 5HP4A 4YP3A 4Z6DA 2FPMA 4F92B 5KG5A 4YQWA 4ED2A 1ZQTA 7ICPA 4RQ8A 3B0XA 3T5HA 5CWRA 1JX4A 1D8LA 2ZJAA 4O0IA 9ICQA 3V72A 5BOMA 2XY5A 5CJ7A 3OSPA 3EPIA 4UQGA 2W9CA 1RYSA 5DB8A 4UB1A 5DGBA 4IQVA 4QWDA 7ICUA 3M9MB 4I2DA 4QZ8A 5D4BA 3BQTA 5D49A 4RUCA 4R65A 4GC6A 3T5LA 1T3NA 1ZQNA 4ECXA 5KFIA 3G6VA 5J2DA 2IMWP 7ICQA 3FDSA 4M9JA 3M8SA 3V7KA 1IM4A 9ICIA 2Y1IA 3V7LA 3UXOA 2HW3A 2FMQA 3C1YA 5EWEA 4RU9A 4F5PA 4QW9A 1N48A 2BQUA 2ZUDA 3OHBA 1RXVA 3OJUA 2JZBA 4M9NA 3JPPA 4QZHA 5BPCA 4DF4A 1U49A 4M9LA 4X5VA 1KFTA 5HMLA 5KFEA 5KT3A 3RBEA 5J2CA 4ED3A 3MR3A 1CUKA 4I29A 2HVIA 4PHEA 4NM1A 3C2KA 4EBCA 4Z6CA 4YMNA 1TV9A 3OHAA 4O5EA 1NK8A 1PZNA 4F4WA 3MR2A 4LZDA 5DKWA 4PHDA 3RRHA 4R66A 1A77A 3MR6A 3C1ZA 3MDCA 5IIOA 4RQ5A 3M9OB 4F50A 3QEBZ 1ZJNA 4J9NA 2PI4A 2BCUA 4O9MA 4M9HA 5KFBA 4RQ7A 2R8IA 4J9RA 1ZQPA 4ED7A 3PX0A 3RB3A 2XGPA 2I9GA 4RZRA 5DB9A 1ZQSA 8ICCA 4K4GA 1WCLA 9ICKA 5EWFA 5IIJA 5C5JA 4B9SA 8ICIA 2VA3A 1LB2B 9ICWA 7ICFA 2FPLA 1TK8A 4IQUA 1SKSA 9ICNA 4M6WB 4P4MA 5J0WA 4UB4A 3NGDA 1S0NA 4ECYA 2VA8A 5DBBA 2C2RA 1BGXT 2FLLA 4ECWA 3RJJA 8ICKA 2ASDA 3PR5B 4I2EA 3RB4A 4NLZA 4Q44A 1XC9A 3RAXA 4R8UB 4DL5A 4M47A 4J9MA 1BPDA 5J2IA 1Z00A 4YG2A 4ED8A 1L5UA 1JXEA 4DFPA 2KTQA 3RJEA 1SL1A 2AJQA 5EWGA 1SKWA 1L3UA 5J2EA 3HW8A 4XRHA 2W9BB 4I2IA 4I28A 4QZFA 7ICNA 3PNCA 8ICNA 4CCHA 2BHNA 8ICZA 1QSLA 3H8WA 4YXJA 1KRPA 4M2YA 2J6TA 8ICXA 2ZJ8A 4DSLA 4F5QA 4KLTA 4ZH4A 1ZQVA 3C23A 4KLGA 3PW2A 4JWMA 4MFCA 2BCVA 2XO7A 3AUOA 9ICGA 4GC7A 2A1JB 3UPQA 2C2EA 1NJWA 3K4GA 1X2IA 4JUZA 1SL2A 3PX4A 4YR0A 4QZDA 4FO6A 3T5KA 4O5CA 5CHGA 2H5XA 1NK6A 4KLOA 2BQ3A 1S10A 5IIKA 4RT2A 8ICMA 5EOZA 5J0SA 4YMMA 4QZIA 2W9AA 4C8NA 3PW4A 1EXNA 3MFHA 3RH4A 1KFDA 1ZQGA 2MUTA 4DOAA 5DQHA 4DSEA 9ICAA 4DFMA 4DSJA 5KT4A 4Q8EA 3PW7A 3RJIA 2F1HA 4MFAA 4UBCA 1DOQA 2XY6A 4UB2A 1NK4A 4I2CA 2NRTA 8ICRA 4B9NA 9ICUA 2ZTDA 3PMNA 4DFJA 7ICMA 1ZQYA 3TAQA 9ICRA 3KHGA 1TKDA 1ZQFA 2IBKA 3OSNA 3PY8A 4O3RA 4B9LA 1XU4A 3GDXA 1S77D 2Q0ZX 4TUPA 3LWMA 5F9NA 2LYHA 3V7JA 2NRXA 3GV8B 2W9CB 1MQ2A 1XWLA 4QZ9A 3PX6A 1L3VA 3TQ1A 3N4MB 5KG7A 4KLSA
chains in the Genus database with same CATH superfamily
3E58A 1NK0A 5KFHA 2B6GA 2LM4A 3RR7A 1RYUA 1NOMA 3PSPA 1UCVA 5ALEA 1ZD2P 3BQ1A 1L3TA 3QYPA 3JPNA 4BWJA 3G6XA 3UXPA 4RQMA 2C2DA 1NJZA 2WF9A 3IDWA 3JPSA 5AI4A 2AQ4A 3ISBA 4M04A 1BPYA 3ZD9A 2BGWA 5KFZA 5KT7A 3PVXA 3M6KA 2WTFA 2DUYA 3NVWA 9ICTA 3HWTA 3IRUA 8ICGA 2LYBA 2HBJA 3VCBA 5HHHA 1TVAA 3HILA 2ZIWA 3THVA 4NL9A 2V4QA 3RH5A 3RJGA 2A1AA 5KFYA 1BPXA 7ICKA 2F1IA 2DFLA 9ICVA 4QZAA 2PFOA 3H0MB 1S5LU 4B9VA 1U4BA 5KG1A 3NS1A 2HBLA 1KTQA 1JMSA 4DQSA 4OO1J 8ICWA 8ICAA 2OCEA 1JN3A 5DB6A 4QZBA 1ZXIA 1L7PA 2F8LA 4QNLA 2QARA 2W8KA 2PXIA 1QQ7A 3H7IA 5KTQA 3MR5A 3BZCA 4AP9A 2ZXIA 5KT2A 3I1YA 2PKEA 3LVWA 4RPXA 1Q3UA 2W8LA 3QEAZ 1NKCA 2F76X 1X9MA 2BR0A 4IL6U 4I2HA 1SV0A 1ZQOA 4F71A 3BZKA 1JALA 4OJ5A 1TE2A 2FE9A 1K1SA 4Z6EA 4EZ6A 1HIWA 2BCSA 5DBCA 2JHDA 2VJ4A 3GV7B 5F9LA 1QLNA 3KTQA 1RYRA 2I5HA 3E0FA 4YMOA 4ED6A 1L7MA 7ICJA 1L7NA 4F4KA 3PR4A 7ICGA 1LKYB 2VIXA 4ED0A 2YMLA 1U45A 4KITB 4ZOHC 5JRTA 2NO5A 5AIAA 3BQ2A 2E1FA 1WYGA 3TKAA 1JRPA 4DFKA 1ZQLA 4JWNA 3HKZC 2WAQC 9ICSA 2G5IB 3SAFA 3TFSA 4CF4A 3Q8LA 5ALNA 1T7PA 1M6YA 4ECRA 2GO7A 1N56A 1S97A 1KBUA 5J0XA 3K1RB 3RJHA 1D9DA 5J8YA 3ISCA 1X6JA 3QUCA 4BWMA 1CI4A 3NRWA 4DO9A 4NM2A 1F44A 3MDAA 4PGYA 5KNIA 3OPXA 3EPGA 5FP0A 4I2BA 4J9OA 3NRZA 4PH5A 1UQVA 4ECTA 3ZDBA 3K75D 3LK9A 2KSOA 8ICQA 3EW9A 3QZ8A 1MA7A 2NRWA 1SWWA 2W9MA 4RNMA 3CP8A 4TURA 4FBTA 1JROA 2GWSA 4DL6A 5L1KA 2WF6A 5J0YA 2KICA 2OYYA 1ZQQA 4Y2PA 2LBOA 2JRZA 4IQTA 1H38A 1KLNA 3IG5A 2MAXA 2QB0A 5KG0A 3PZPA 2E8MA 4F5NA 2HI0A 3LWLA 3RH6A 1U9LA 5ALVA 3GZFA 3TFRA 4C8KA 5JU5A 2Y9UA 4OJ6A 3OGUA 4I27A 2AHOB 3ISDA 2NV3A 4GFJA 2L5YA 1L7OA 2XI9A 3ZDAA 4C7YA 5AM0A 1O03A 2A1JA 4K4HA 2UVRA 4CNQA 2E1EA 2LM1A 5KFPA 3SI8A 5AKXA 5KFAA 2ISPA 5KFUA 3K1ZA 3T5JA 3HP6A 2B21A 5HP4A 3M7DA 3N7PD 3WK6A 5BOMA 4Y2YA 2E5SA 4UQGA 4IQVA 3M9MB 3KZXA 5D49A 1Q8KA 4GC6A 3F53A 5ALUA 1T3NA 5KFIA 1DK2A 3ETRA 5J2DA 2K60A 4PL2A 3V7KA 4AYBF 3UXOA 2FMQA 5EWEA 1DXSA 4RU9A 4F5PA 2BQUA 2ZUDA 2G08A 4M9NA 5BPCA 4M9LA 3AQFA 5J2CA 1F0MA 1RDFA 4NM1A 3C2KA 4Z6CA 1TV9A 2WFAA 2K4IA 1A77A 4RQ5A 1ZJNA 1LVHA 3I28A 2QARB 3PX0A 2XGPA 3NVVA 2F44A 9ICKA 5EWFA 2H3FA 1IV8A 7ICFA 1TK8A 2CPRA 2HCFA 1P7DA 4IQUA 9ICNA 1S0NA 4ECYA 2VA8A 5DBBA 5AKKA 2FLLA 3RJJA 4ECWA 2N1RA 3PR5B 2LYAA 3RB4A 1XC9A 5ALSA 4R8UB 4J9MA 1BPDA 4ED8A 4C4SA 5AM3A 4EELA 5E79U 2HOIA 3HW8A 2W9BB 4I28A 8ICNA 3PNCA 2YB4A 1QSLA 2DGZA 2J6TA 2H3ZA 4ZH4A 2JH1A 3AUOA 1S8OA 2KJ8A 2F77X 3UPQA 1KKXA 4JUZA 2KNJA 3LVVA 4QZIA 5J0SA 2W9AA 3D2NA 5AM1A 3F2DA 1EXNA 3MFHA 4Y2VA 9ICAA 3FC4A 3RJIA 2XY6A 8ICRA 4I2CA 2NRTA 4B9NA 2ZTDA 3PMNA 4DFJA 7ICMA 1SXEA 1ZQYA 3TAQA 9ICRA 3KHGA 1QH9A 4US8A 4O3RA 4B9LA 1XU4A 4NWIA 2NRXA 5AI0A 4QIWC 2NYVA 5KG7A 1SZHA 4DEZA 2RP5A 1RG6A 3SEIA 5C0YA 9ICBA 5J0UA 3MC1A 2ZXHA 7ICHA 4OCZA 5AKJA 2HBMA 1UA0A 4NLGA 4KLMA 4ELTA 1COKA 4G9BA 4O3PA 2JZBB 2PFNA 8ICLA 4IC9A 4C8MA 2D3DA 1UT5A 3QU4A 1RZTA 5J2AA 2AH5A 3JPOA 1RQNA 4FBUA 5KL8B 4J9SA 2H3VA 3GIJA 3AU6A 3IM1A 2F1JA 4O3QA 7ICEA 2JEJA 3BS7A 2ZTCA 2ALZA 2IOHA 4QWAA 4RUAA 2LHTA 4YD2A 3WKAA 2K4HA 1Q46A 1V85A 3AU2A 4J9PA 4GXJA 2IOFK 2H3IA 2G06A 5J0OA 8ICEA 1ZQHA 3TI0A 4ACOA 2ZUCA 5ALHA 3GFKB 4DQIA 4RQ4A 4MF8A 4CGZA 1J2MA 2D6FC 4ED1A 8ICVA 2Y0SF 3TADC 3N28A 3GIKA 1X9XA 4NV0A 2RDJA 2KHVA 3RR8A 1QTMA 4BX9C 5KFOA 5L1LA 5ALOA 4YR3A 1KDHA 9ICEA 4KLLA 4DWIA 3M9NB 2KN7A 2XGQA 1CRXA 4UARA 4F5OA 2R8KA 4YR2A 5KFNA 4C4RA 3GIMA 1T4GA 4DOBA 2PFPA 2UVWA 3NASA 3JPQA 3SAHA 1XS9D 2HHSA 4KX3A 3H8JA 3D2SA 2EAPA 1X40A 1BPBA 3Q8KA 4ELUA 4MF2A 2KZZA 4QW8A 3QX7A 1X9WA 4FS1A 8ICFA 2UVUA 2JH7A 1Z4OA 4XA5A 1ZRMA 3BS5B 4PJ0U 3ZDCA 4UAZA 5AKLA 7ICIA 4USAA 2KVSA 1S0OA 7ICVA 5IIIA 2AGOA 9ICOA 4P4PA 2WB1C 4F8RA 1HEKA 1BPEA 2KD1A 4DLGA 2O6KA 4C80A 2W11A 1Z4NA 2ISOA 3QU2A 2KE7A 3WKDA 1HJPA 3RAQA 3QZ7A 3SMVA 3GV5B 2ZUBA 1NK9A 2YMMA 3NVYA 4F72A 3BQ7A 5KFMA 4I2FA 3OJSA 3UMBA 1ZQMA 1Y88A 3MFIA 4O3SA 4DS4A 3ZD8A 2HOFA 1IG6A 3GIIA 4DL3A 2BPGA 1JXLA 2I6XA 4QZEA 2Y1JA 3T3FA 2FI1A 1AQ6A 2YN4A 3KBBA 3PSIA 2KIVA 5KFTA 3MABA 2G09A 3RRGA 5KFRA 4F4YA 4ECZA 4IRCA 3ALRA 3AQEA 4J9QA 5J0QA 4O3NA 1MN8A 1ZQEA 2Q4TA 1OUQA 2ESEA 4BJQA 2BDPA 3PV8A 3LYSA 1JIHA 2E8OA 2KEYA 4YXMA 3F5EA 3H8SA 4NLNA 1KQQA 5DGAA 5KFCA 2HHWA 3L5KA 3PO4A 3N97B 4NL9C 2XCAA 4R8UA 5JUMA 1K1QA 4P0PA 4TUSA 3EYZA 1AROP 1KFSA 3C28A 2W9BA 4DSFA 3PW0A 3BJYA 2AGPA 2EAMA 4DL2A 4MFFA 5AK5A 3NTUA 4PGQA 5ALJA 3VC8A 1KN5A 2ZIVB 4Z6FA 1RXWA 1ED1A 1ZQJA 4CDGA 5AIBA 4GLXA 4EYIB 3UQ2A 3PO5A 4I2AA 1D8BA 3GILA 2KZ3A 4ELVA 4F93B 2KJ9A 1YZ7A 4UB3A 5KT5A 4QWCA 3CRXA 4B9MA 3Q8SB 3ZI4A 4GXIA 2W55A 5AHXA 4HAIA 5KFWA 4YP3A 5K4LA 4F92B 4YQWA 4ED2A 2M0NA 4RQ8A 5B5EU 5CWRA 1D8LA 4IS7A 5CJ7A 3EPIA 2YMPA 4JMUA 5DGBA 4QZ8A 3BQTA 2KOBA 2MRLA 4RUCA 1ZQNA 2K8BB 2KV2A 3SAGA 3G6VA 2IMWP 7ICQA 3FDSA 4PZNA 3M8SA 3NUQA 2HW3A 3C1YA 2ZG6A 1QCKA 2R18A 3OHBA 2JZBA 5KL1B 3SD7A 5GTIU 1U49A 5HMLA 2YTUA 3RBEA 4ED3A 3MR3A 1CUKA 1L8LA 4YMNA 2QLTA 5EE3A 4F4WA 4LZDA 1DGJA 3MR6A 4AYBC 3M9OB 5A0LA 4M9HA 5KFBA 4RQ7A 1ZQPA 4ED7A 3RB3A 8ICCA 2P35A 5IIJA 5C5JA 4B9SA 2VA3A 2G5HB 4M6WB 5TISU 5J0WA 4UB4A 8ICMA 1V38A 2ASDA 3WKCA 1L6NA 3RAXA 5J2IA 1Z00A 5CRXA 4YG2A 4DFPA 3RJEA 2JMGA 4B6JA 2DL0A 5EWGA 1IIPA 2EQYA 5ALWA 1SKWA 2AJQA 4I2IA 7ICNA 2BHNA 3IN5A 4YXJA 2RHFA 8ICXA 3PW2A 4JWMA 4MFCA 2BCVA 3IV6A 9ICGA 1FFVA 2C2EA 3K4GA 4O5CA 5G5GA 5EE1A 2DF4B 1BNPA 1ZQGA 2MUTA 1NI3A 4DOAA 1URJA 1XO0A 5DQHA 2LKYA 4Q8EA 2F1HA 4MFAA 1NK4A 2K8CB 4EX6A 2WAQF 2W7OA 1TKDA 1S77D 5AKIA 4NLBA 4TUPA 3BS5A 2LYHA 3A0BU 3CW2C 3GV8B 2W9CB 1XWLA 4QZ9A 3N4MB 1X66A 4R63A 1S0VA 1TAQA 1ZQDA 2DBYA 3SENA 3HX0A 3M8RA 2YY6A 5DG7A 2KZMA 2OXOA 2ASLA 2P6RA 3QUBA 2GH1A 3U26A 1A0PA 1N5XA 5JTIA 2ODGA 2FLNA 1OXJA 4J9KA 4M9GA 5HNKA 3A0HU 5DB7A 5J2BA 4BDPA 9ICFA 2HOQA 2C22A 3H40A 1ZQ1C 2Y9TA 3UMGA 4CE6A 5DQIA 5ALRA 3ED5A 4JK1A 3HRDD 4UB8U 4KMUA 3WK5A 2LMRA 4KLQA 3QU7A 5J0PA 1ZQCA 4OJLA 3AL0B 5ALKA 4DLEA 5AM2A 3RFAA 3WK4A 3QE9Y 1ZQIA 2J6SA 2QB1A 4UASA 4TQRA 3WKEA 4KLDA 5GTHU 3E2EA 4ECVA 2AU0A 4NXZA 1NKEA 4Y2UA 4EBEA 2FMSA 1XSNA 2UVVA 4P0PB 5J29A 3PMLA 3QNMA 3QU9A 1XSLA 3C2LA 2BPFA 2KHQA 4I2JA 5CA7A 1OW5A 2BQRA 4F2SA 2PMZC 5J0RA 1TAUA 4MHVA 1X42A 2MA1A 4Q8FA 2JR5A 4YCXA 4R64A 2W7PA 4IRKA 3L4PA 1LV5A 1TFRA 5AK6A 2NRZA 5L1MA 1NJYA 4OJPA 1SWVA 4RQ2A 9ICXA 2BCQA 3KFUF 1MSWD 5KFVA 2KJ5A 1N61A 5KFJA 2FPKA 2F8KA 4KLFA 3AM9A 5ALGA 2EZXA 4UBBA 4IR9A 5AM5A 3RJKA 9ICPA 3T79A 4KLUA 3H4BA 5J2KA 3SR6A 1C7YA 4B9TA 1SKRA 4EEKA 5TZVA 2ZIVA 2I1QA 1FO4A 1ZJMA 1IXRA 5KG3A 4NY8A 3C5GA 4WJ3B 1PVQA 5CR0A 4B9UA 4NLKA 3IP4B 4DFDA 4ICAA 5IILA 5ALIA 1QSSA 3JPRA 3ORYA 4ECQA 2HHVA 2AQ0A 5F3XB 1NK7A 1ZQZA 2PFQA 5AKEA 3BQ0A 1ZQBA 4P2HA 1ZQAA 1DGSA 2ZTEA 5DLGA 2G0AA 5DDYA 1S9FA 1ZQKA 1GO3F 4F4ZA 4HYKA 2E8NA 3CYMA 1ECWA 4GIBA 2J6UA 1WWUA 2WF8A 1N5WA 2HHTA 4J9LA 3H8MA 1TK0A 4KLEA 1PVPA 5AKZA 3AMZA 2R8HA 2LI6A 4O5KA 3Q8MA 2EZZA 4E0DA 2MSNA 3ZDEA 4FE3A 3TADA 5KFKA 4DSKA 1CEZA 2VA2A 5AK3A 2JGAA 1XNSA 4UB5A 3KZIU 3QU5A 4NLCA 5AI9A 5DG9A 9ICCA 2EAOA 1VJ5A 5J2JA 3CNHA 2EH9A 4C0ZA 1RPLA 1BPZA 1X6IA 5KFDA 1Z00B 3QUQA 4F3OA 4DQRA 2YX8A 4UAWA 4RPZA 5KFSA 2WHEA 1Z3EB 7ICRA 3V6JA 7ICOA 3B0YA 2W43A 3MGIA 4LJXA 4GXKA 3KOOA 1QSYA 7ICSA 2VKQA 5CP2A 2OHFA 4U7CA 4M6WA 3FAHA 2EANA 2MUTB 4RT3A 2NRVA 4BXOB 2HBKA 3KKAC 3FYHA 2V9WA 4C8OA 4Y2QA 3KHRA 4EBDA 2M9NA 2OEHA 1WG8A 4EEYA 3WKBA 8ICSA 5J2GA 4RQ0A 1TAMA 2E3TA 2FJ6A 3QUTA 1V97A 3EWAA 4DL7A 2AGQA 4DF8A 4I2GA 2C28A 4QIWF 7ICLA 5ALTA 5L1JA 4DL4A 1B43A 2IOFA 1RQLA 5KFQA 4F5RA 1ZQRA 4PHAA 2P6UA 2IHMA 1PUZA 2OH2A 8ICPA 5KFFA 5DBAA 4IRDA 4P4OA 4TQSA 2R8JA 4FS2A 3D2QA 4UAVA 5KG5A 3T5HA 2ZJAA 9ICQA 4O0IA 2DQNB 3V72A 2XY5A 2W9CA 5DB8A 4UB1A 4QWDA 7ICUA 3AN1A 4I2DA 4R65A 3T5LA 1PVRA 1SIJA 5ALQA 1WWVA 4KMOB 4M9JA 4FZNA 1ZD4A 9ICIA 2Y1IA 1RM6C 1RXVA 1YT3A 3JPPA 1B0XA 4X5VA 3WK9A 5KFEA 4I29A 2HVIA 2CRXA 5AICA 2RRDA 4RQNA 1PZNA 3MR2A 5DKWA 1N63A 2EZYA 5IIOA 4DCCA 2BCUA 1BNOA 4EENA 4J9RA 2YQEA 2DKZA 4RZRA 5DB9A 2EDUA 4Y2SA 1LB2B 5AKYA 4P4MA 3NGDA 2C2RA 8ICKA 3O0FA 1NZBA 4NLZA 2XVTA 4FZLA 4QJFB 1L8OA 1L5UA 1JXEA 2KTQA 1SL1A 5AKHA 5ALPA 1L3UA 4CCHA 1KRPA 2ZJ8A 4F5QA 4KLTA 1ZQVA 4KLGA 2AXTU 1NJWA 4YR0A 4QZDA 4FO6A 2WB1F 5CHGA 2H5XA 2BQ3A 1S10A 5IIKA 2W54A 4P0QA 5EOZA 3AEVA 4C8NA 3PW4A 3RH4A 3TACB 2CXYA 5ALMA 3H0LB 4DSEA 3L3FX 5ALXA 3PW7A 1DOQA 9ICUA 5EE9A 4UB2A 3OSNA 3PY8A 3GDXA 5ALDA 3LWMA 5F9NA 1MQ2A 4EX7A 3PX6A 3TQ1A 3KD3A 4KLSA 1SV0C 4XUSA 1S76D 1A76A 3C5FA 3UMCA 4UAYA 4PGXA 4PL1A 3F2CA 1ZOLA 4K4IA 5CEHA 4F2RA 4O3OA 5L9XA 4YVZA 4Q45A 1XO1A 2E8PA 5HR6A 3IG8A 3Q8RB 2K4PA 4FZMA 3Q8PB 4LVSA 1WUDA 1Z1BA 3BDPA 2VJ5A 3Q8QB 3HPOA 3PW5A 4XQ8A 1SL0A 1MC8A 3RJFA 3S6JA 5KG2A 1K5OA 4TUQA 1KEJA 3V6HA 4RNNA 2KFNA 1UT8A 4DS5A 9ICHA 2HDOA 2BDUA 2G07A 3C21A 2A19A 5HR7A 5DLFA 5ALZA 5HHIA 1TK5A 1FIQA 2WF7A 2A3VA 4QZCA 1XSPA 5HMMA 2F3NA 2OWOA 1S0MA 2DPJA 4JV2A 1MQ3A 2WF5A 4KN4A 1DK3A 4C8LA 3ETLA 5KAIU 3UXNA 3RF9A 4RPYA 5KFXA 1UA1A 4G3IA 2XY7A 5J8YC 5KT6A 1O08A 4F91B 3EZ5A 4Y2JA 3SV4A 4RQ3A 1N62A 1SZPA 4OJOA 4DQPA 3KHLA 5J0TA 4RQ1A 5AKGA 1JUDA 3HT3A 1F5SA 4QZGA 2YB1A 1PK1A 2XIDA 5KG4A 1PK3A 3C2MA 8ICTA 4DQQA 3G6YA 3FM9A 3ONNA 4O3MA 2KFZA 3F5AA 4DOCA 2VANA 1Z19A 1BVSA 3MGHA 4IR1A 3F2BA 5DDMA 4YN4A 4LZGA 4JV1A 8ICYA 2DPIA 2BPCA 2D8CA 2RLTA 2ZIUB 3H0RB 4OD0A 4QWEA 5AI6A 1DRGA 1VLBA 1NKBA 8ICUA 4BXOA 4DSIA 1NK5A 1Q3VA 2B0CA 3PSFA 3WK8A 9ICMA 1A6SA 2ZIXA 5IINA 2RQ5A 1SV4A 2JEGA 3HKZF 2KG5A 3GQCA 2ASJA 4RQ6A 4CF5A 5D46A 1VDVA 4CF3A 4BGDA 4A8EA 4UB6U 2K89A 4C4TA 4EZ9A 4M0AA 3UQ0A 2JV3A 1D9FA 1L3SA 2W04A 3TANA 3KHHA 3M6ZA 4QWBA 5DQGA 2KVCA 5IIMA 1ZETA 2DWQA 2PI5A 1U48A 3MGVA 3RB0A 4UW9A 2KK0A 4F4XA 1T3QA 3WU2U 7ICTA 5CB1A 2HHXA 3HJEA 4EYHB 9ICJA 8ICOA 4CRXA 1U47A 3JPTA 5ALLA 8ICJA 2XC9A 2FMPA 2RDIA 4KLHA 4KN7A 5KFLA 2IA6A 1WCNA 4UAUA 3C29A 9ICLA 4ECSA 8ICHA 3N7RC 3RBDA 2ZIWB 2HSZA 2ZJ5A 2W03A 2XCPA 3MBYA 4KTQA 4KLJA 3R9KA 5AI5A 3V6KA 4YD1A 4KX5A 4IQWA 4NJ8A 4PHPA 3RTVA 1C20A 3H4DA 2MU2A 4Q43A 2BCRA 3TAPA 4US9A 8ICBA 2BKEA 1ZYQA 3SYZA 4MEXA 1COOA 4PPXA 1SXDA 1KW4A 1J97A 1NZPA 2JEFA 5BOLA 1NJXA 3SV3A 1ZQXA 3IHQB 5L1IA 1D8YA 2IHNA 2HHUA 2ATLA 1B22A 1ZQWA 2P66A 3J81j 1UHUA 2KIWA 2BZFA 1X9SA 5AM4A 5J2HA 5H2FU 4ECUA 3TARA 4P0QB 2HVHA 3WK7A 5J2FA 1SB3C 3ZDDA 2Y0SC 4YFKA 4RNOA 1UPHA 1FFUA 1KSPA 2HHQA 4MEYA 5EE0A 3SZ2A 2JXJA 1JI7A 2V4RA 5DG8A 1V9PA 2F2AB 1ZQUA 2R8GA 5KFGA 1T8EA 2KMDA 4Y2TA 3I76A 3N7SC 3RB6A 1HUOA 2W3RA 4KLIA 1HUZA 1T94A 2K8AA 3OTQA 5KG6A 4C7ZA 4Y2RA 2FLPA 3LDAA 2JEIA 2DKXA 2LPEA 4JV0A 5KAFU 4Z6DA 2FPMA 7ICPA 1ZQTA 3QXGA 3B0XA 1ZD3A 1JX4A 3PSTA 3OSPA 3DV9A 1RYSA 4J03A 5D4BA 1LKYA 4ECXA 1J2NA 2ES6A 3UM9A 1KL9A 3SQIA 5T14A 2KKPA 1IM4A 3V7LA 2OM6A 4JB3A 2XICA 4QW9A 2W3SA 2FDRA 1N48A 3OJUA 2GOLA 4QZHA 4DF4A 1KFTA 5ALFA 4FFDA 1N2XA 2KP7A 5KT3A 1QQ6A 3DEEA 4U6PA 4PHEA 2KSOB 1ZRNA 4EBCA 3OHAA 4O5EA 2CN1A 3DDHA 1NK8A 4PHDA 3RRHA 4R66A 3MDCA 3C1ZA 4F50A 3QEBZ 2H3QA 4J9NA 2PI4A 1FEZA 4O9MA 3KKAA 2Z7JA 5G5HA 2R8IA 3EUB2 2PMZF 1PK1B 2I9GA 3M1YA 1ZQSA 4K4GA 1WCLA 4BUGA 8ICIA 9ICWA 2FPLA 1YZ6A 2QB0B 1QQ5A 1SKSA 1Z1VA 1BGXT 4I2EA 4Q44A 1B4FA 3NVZA 4DL5A 4M47A 5B66U 5J2EA 5ALYA 2QKQA 4XRHA 4QZFA 4Y2XA 5AK4A 2GLEA 8ICZA 3H8WA 4UATA 4M2YA 2ZIXB 4DSLA 3C23A 1NNLA 2YMQA 2XO7A 4GC7A 2A1JB 1SGGA 2NO4A 1X2IA 1SL2A 3PX4A 3T5KA 1NK6A 4KLOA 4RT2A 4YMMA 5AI8A 1KFDA 3ICXA 3B9JA 2ZIUA 4DFMA 4DSJA 5KT4A 2K4EA 3D6JA 4UBCA 2KKVA 1ZQFA 1ZD5A 2IBKA 1N60A 3GU3A 2Q0ZX 3V7JA 2HMXA 1L3VA 4PZOA
chains in the Genus database with same CATH topology
1NK0A 5KFHA 4DEZA 4XUSA 1S76D 1A76A 3C5FA 4R63A 3RR7A 4UAYA 4PGXA 4K4IA 1S0VA 1TAQA 9ICBA 1NOMA 5J0UA 1ZQDA 4F2RA 4O3OA 3HX0A 5L9XA 4YVZA 3M8RA 4Q45A 7ICHA 5DG7A 1XO1A 1UA0A 4NLGA 4KLMA 2KZMA 4ELTA 3Q8RB 2ASLA 3BQ1A 2P6RA 1L3TA 3Q8PB 4LVSA 3JPNA 3BDPA 4BWJA 3G6XA 2FLNA 4O3PA 2JZBB 3UXPA 3Q8QB 2C2DA 3HPOA 3PW5A 4J9KA 4XQ8A 1NJZA 2PFNA 8ICLA 1SL0A 1MC8A 4M9GA 4C8MA 5HNKA 1UT5A 5DB7A 5KG2A 5J2AA 1RZTA 3RJFA 3JPSA 5J2BA 4TUQA 4BDPA 1KEJA 3ISBA 2AQ4A 3V6HA 1BPYA 4RNNA 4M04A 2KFNA 9ICFA 3ZD9A 1UT8A 3JPOA 4DS5A 3H40A 2C22A 5KFZA 5KT7A 3PVXA 2BGWA 4FBUA 2WTFA 5DQIA 9ICTA 4J9SA 3HWTA 8ICGA 9ICHA 4JK1A 3GIJA 3AU6A 3C21A 3IM1A 2F1JA 4O3QA 4KMUA 5DLFA 7ICEA 5HHHA 2JEJA 2ZTCA 2ALZA 5HHIA 4KLQA 1TK5A 5J0PA 1ZQCA 1TVAA 4QZCA 4QWAA 1XSPA 5HMMA 4RUAA 2OWOA 1S0MA 3THVA 4YD2A 2DPJA 4JV2A 2V4QA 1MQ3A 3AU2A 4DLEA 4KN4A 4C8LA 3RH5A 3ETLA 4J9PA 3RJGA 3UXNA 4GXJA 5KFYA 3QE9Y 1BPXA 7ICKA 1ZQIA 2F1IA 4RPYA 2DFLA 5J0OA 1ZQHA 3TI0A 2J6SA 8ICEA 9ICVA 4QZAA 5KFXA 2PFOA 2ZUCA 4TQRA 1UA1A 4B9VA 1U4BA 5KG1A 2XY7A 4G3IA 5KT6A 3GFKB 4DQIA 1KTQA 4KLDA 4F91B 4RQ4A 3EZ5A 3E2EA 1JMSA 4MF8A 4ECVA 4DQSA 2AU0A 4NXZA 8ICWA 3SV4A 8ICAA 4RQ3A 1SZPA 1NKEA 4EBEA 2FMSA 4DQPA 3KHLA 1XSNA 1JN3A 4ED1A 5DB6A 5J29A 2UVVA 8ICVA 4QZBA 5J0TA 4RQ1A 3PMLA 3HT3A 3GIKA 1XSLA 4QZGA 2W8KA 3C2LA 2BPFA 2PXIA 2RDJA 4I2JA 5CA7A 3RR8A 3H7IA 5KTQA 1QTMA 2BQRA 3MR5A 4F2SA 5KG4A 5KFOA 5J0RA 3C2MA 8ICTA 1TAUA 5KT2A 4DQQA 3G6YA 5L1LA 4Q8FA 4RPXA 2KFZA 4YR3A 4YCXA 1KDHA 4DOCA 2VANA 2W8LA 1BVSA 3QEAZ 3MGHA 1NKCA 9ICEA 4KLLA 4R64A 1X9MA 4IR1A 4DWIA 5DDMA 4YN4A 3M9NB 2BR0A 4IRKA 4LZGA 2KN7A 1LV5A 1TFRA 2XGQA 4I2HA 2NRZA 4JV1A 8ICYA 1NJYA 2DPIA 2BPCA 4F5OA 4RQ2A 4YR2A 2R8KA 5KFNA 1ZQOA 4QWEA 3GIMA 1T4GA 4DOBA 2PFPA 2UVWA 3JPQA 1XS9D 2HHSA 9ICXA 3H8JA 1NKBA 1K1SA 2BCQA 4BXOA 4Z6EA 4DSIA 1MSWD 4EZ6A 8ICUA 5KFVA 1BPBA 2BCSA 3Q8KA 1NK5A 5DBCA 4ELUA 4MF2A 4QW8A 5KFJA 1X9WA 4FS1A 2KZZA 2FPKA 9ICMA 8ICFA 2UVUA 5IINA 3GV7B 4KLFA 5F9LA 4XA5A 4UBBA 4IR9A 1QLNA 2JEGA 3KTQA 3RJKA 3GQCA 9ICPA 3ZDCA 4KLUA 4UAZA 1RYRA 7ICIA 3H4BA 5J2KA 1C7YA 4B9TA 2ASJA 1SKRA 4RQ6A 4YMOA 1S0OA 7ICVA 5IIIA 5D46A 5TZVA 4ED6A 2AGOA 2I1QA 9ICOA 4BGDA 4P4PA 7ICJA 4EZ9A 4F8RA 4M0AA 3UQ0A 1BPEA 1D9FA 3PR4A 4F4KA 1ZJMA 1IXRA 5KG3A 4NY8A 3C5GA 7ICGA 1L3SA 4ED0A 1U45A 5CR0A 4KITB 4B9UA 3TANA 3BQ2A 3KHHA 4DLGA 4NLKA 2ISOA 4QWBA 5DQGA 5IILA 1QSSA 3JPRA 3ORYA 4ECQA 2HHVA 5IIMA 1ZETA 2AQ0A 4DFKA 1NK7A 1ZQLA 1HJPA 3RAQA 1ZQZA 1U48A 2PFQA 3QZ7A 2PI5A 4JWNA 3BQ0A 3RB0A 9ICSA 3GV5B 4F4XA 2ZUBA 1ZQBA 1NK9A 1ZQAA 1DGSA 5CB1A 2ZTEA 4P2HA 2HHXA 4EYHB 7ICTA 3TFSA 5KFMA 4I2FA 5DLGA 3Q8LA 9ICJA 5DDYA 3OJSA 1S9FA 8ICOA 1ZQKA 1T7PA 4F4ZA 4HYKA 1U47A 3JPTA 4ECRA 1N56A 1S97A 1ZQMA 8ICJA 5J0XA 1Y88A 2RDIA 2XC9A 2FMPA 3MFIA 3RJHA 4O3SA 2J6UA 4KLHA 4KN7A 5KFLA 4DS4A 1D9DA 2IA6A 1WCNA 3ZD8A 3ISCA 9ICLA 2HHTA 4J9LA 4ECSA 4BWMA 8ICHA 3RBDA 3GIIA 1TK0A 4KLEA 2ZJ5A 4DL3A 2BPGA 4DO9A 4NM2A 1JXLA 2XCPA 3MBYA 2R8HA 4KTQA 3MDAA 4PGYA 4O5KA 3Q8MA 4KLJA 4QZEA 4E0DA 2Y1JA 3V6KA 3ZDEA 4YD1A 5KFKA 3EPGA 3T3FA 4DSKA 4IQWA 4I2BA 4J9OA 4PHPA 3RTVA 1CEZA 2VA2A 3H4DA 4PH5A 4UB5A 4Q43A 4ECTA 5KFTA 3MABA 2BCRA 3ZDBA 3K75D 5DG9A 9ICCA 3RRGA 3TAPA 5KFRA 3LK9A 8ICBA 2BKEA 4F4YA 4ECZA 8ICQA 4IRCA 5J2JA 3EW9A 3QZ8A 1ZYQA 3SYZA 4MEXA 1COOA 4PPXA 4J9QA 1RPLA 2NRWA 5J0QA 1BPZA 5KFDA 4O3NA 1Z00B 2W9MA 4RNMA 4FBTA 4TURA 4F3OA 4DQRA 1ZQEA 2GWSA 4DL6A 4UAWA 4RPZA 5KFSA 5BOLA 2JEFA 5L1KA 1NJXA 1Z3EB 7ICRA 3V6JA 2BDPA 3SV3A 5J0YA 3PV8A 1ZQXA 7ICOA 3B0YA 3IHQB 5L1IA 1JIHA 4YXMA 3MGIA 1D8YA 2IHNA 2HHUA 4GXKA 2ATLA 3H8SA 1ZQQA 1B22A 4NLNA 1ZQWA 1QSYA 4IQTA 1H38A 2P66A 7ICSA 5DGAA 5KFCA 2HHWA 1KLNA 5CP2A 1X9SA 2MAXA 5J2HA 3PO4A 5KG0A 4ECUA 4F5NA 4M6WA 3LWLA 3TARA 2HVHA 3RH6A 3N97B 1U9LA 2XCAA 2MUTB 4R8UA 5JUMA 1K1QA 4RT3A 2NRVA 4TUSA 3TFRA 4BXOB 5J2FA 4C8KA 3FYHA 2V9WA 4C8OA 3EYZA 3KHRA 1AROP 4YFKA 4EBDA 2M9NA 4RNOA 1KFSA 4EEYA 1KSPA 3ZDDA 3OGUA 2HHQA 8ICSA 2W9BA 4MEYA 4DSFA 5J2GA 3BJYA 3PW0A 4I27A 2AGPA 4RQ0A 3SZ2A 3ISDA 4DL2A 4MFFA 3EWAA 4DL7A 2V4RA 3NTUA 4PGQA 2AGQA 3ZDAA 4DF8A 4I2GA 5DG8A 4Z6FA 2C28A 2A1JA 1RXWA 1V9PA 4K4HA 7ICLA 5L1JA 4DL4A 2UVRA 1B43A 1ZQUA 1ZQJA 4GLXA 2R8GA 5KFGA 4EYIB 1T8EA 3UQ2A 5KFQA 4F5RA 1ZQRA 4PHAA 3PO5A 4I2AA 2P6UA 3GILA 2KZ3A 3RB6A 5KFPA 3SI8A 1HUOA 2IHMA 4F93B 4ELVA 4KLIA 8ICPA 1HUZA 5KFFA 4UB3A 5KFAA 5DBAA 5KT5A 2ISPA 5KFUA 5KG6A 4IRDA 4QWCA 3T5JA 4B9MA 3Q8SB 4P4OA 4GXIA 4TQSA 2FLPA 2R8JA 3HP6A 4FS2A 3LDAA 2JEIA 2B21A 4JV0A 5KFWA 5HP4A 4YP3A 4Z6DA 2FPMA 4F92B 5KG5A 4YQWA 4ED2A 1ZQTA 7ICPA 4RQ8A 3B0XA 3T5HA 5CWRA 1JX4A 1D8LA 2ZJAA 4O0IA 9ICQA 3V72A 5BOMA 2XY5A 5CJ7A 3OSPA 3EPIA 4UQGA 2W9CA 1RYSA 5DB8A 4UB1A 5DGBA 4IQVA 4QWDA 7ICUA 3M9MB 4I2DA 4QZ8A 5D4BA 3BQTA 5D49A 4RUCA 4R65A 4GC6A 3T5LA 1T3NA 1ZQNA 4ECXA 5KFIA 3G6VA 5J2DA 2IMWP 7ICQA 3FDSA 4M9JA 3M8SA 3V7KA 1IM4A 9ICIA 2Y1IA 3V7LA 3UXOA 2HW3A 2FMQA 3C1YA 5EWEA 4RU9A 4F5PA 4QW9A 1N48A 2BQUA 2ZUDA 3OHBA 1RXVA 3OJUA 2JZBA 4M9NA 3JPPA 4QZHA 5BPCA 4DF4A 1U49A 4M9LA 4X5VA 1KFTA 5HMLA 5KFEA 5KT3A 3RBEA 5J2CA 4ED3A 3MR3A 1CUKA 4I29A 2HVIA 4PHEA 4NM1A 3C2KA 4EBCA 4Z6CA 4YMNA 1TV9A 3OHAA 4O5EA 1NK8A 1PZNA 4F4WA 3MR2A 4LZDA 5DKWA 4PHDA 3RRHA 4R66A 1A77A 3MR6A 3C1ZA 3MDCA 5IIOA 4RQ5A 3M9OB 4F50A 3QEBZ 1ZJNA 4J9NA 2PI4A 2BCUA 4O9MA 4M9HA 5KFBA 4RQ7A 2R8IA 4J9RA 1ZQPA 4ED7A 3PX0A 3RB3A 2XGPA 2I9GA 4RZRA 5DB9A 1ZQSA 8ICCA 4K4GA 1WCLA 9ICKA 5EWFA 5IIJA 5C5JA 4B9SA 8ICIA 2VA3A 1LB2B 9ICWA 7ICFA 2FPLA 1TK8A 4IQUA 1SKSA 9ICNA 4M6WB 4P4MA 5J0WA 4UB4A 3NGDA 1S0NA 4ECYA 2VA8A 5DBBA 2C2RA 1BGXT 2FLLA 4ECWA 3RJJA 8ICKA 2ASDA 3PR5B 4I2EA 3RB4A 4NLZA 4Q44A 1XC9A 3RAXA 4R8UB 4DL5A 4M47A 4J9MA 1BPDA 5J2IA 1Z00A 4YG2A 4ED8A 1L5UA 1JXEA 4DFPA 2KTQA 3RJEA 1SL1A 2AJQA 5EWGA 1SKWA 1L3UA 5J2EA 3HW8A 4XRHA 2W9BB 4I2IA 4I28A 4QZFA 7ICNA 3PNCA 8ICNA 4CCHA 2BHNA 8ICZA 1QSLA 3H8WA 4YXJA 1KRPA 4M2YA 2J6TA 8ICXA 2ZJ8A 4DSLA 4F5QA 4KLTA 4ZH4A 1ZQVA 3C23A 4KLGA 3PW2A 4JWMA 4MFCA 2BCVA 2XO7A 3AUOA 9ICGA 4GC7A 2A1JB 3UPQA 2C2EA 1NJWA 3K4GA 1X2IA 4JUZA 1SL2A 3PX4A 4YR0A 4QZDA 4FO6A 3T5KA 4O5CA 5CHGA 2H5XA 1NK6A 4KLOA 2BQ3A 1S10A 5IIKA 4RT2A 8ICMA 5EOZA 5J0SA 4YMMA 4QZIA 2W9AA 4C8NA 3PW4A 1EXNA 3MFHA 3RH4A 1KFDA 1ZQGA 2MUTA 4DOAA 5DQHA 4DSEA 9ICAA 4DFMA 4DSJA 5KT4A 4Q8EA 3PW7A 3RJIA 2F1HA 4MFAA 4UBCA 1DOQA 2XY6A 4UB2A 1NK4A 4I2CA 2NRTA 8ICRA 4B9NA 9ICUA 2ZTDA 3PMNA 4DFJA 7ICMA 1ZQYA 3TAQA 9ICRA 3KHGA 1TKDA 1ZQFA 2IBKA 3OSNA 3PY8A 4O3RA 4B9LA 1XU4A 3GDXA 1S77D 2Q0ZX 4TUPA 3LWMA 5F9NA 2LYHA 3V7JA 2NRXA 3GV8B 2W9CB 1MQ2A 1XWLA 4QZ9A 3PX6A 1L3VA 3TQ1A 3N4MB 5KG7A 4KLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK0 A;  5KFH A;  4DEZ A;  4XUS A;  1S76 D;  1A76 A;  3C5F A;  4R63 A;  3RR7 A;  4UAY A;  4PGX A;  4K4I A;  1S0V A;  1TAQ A;  9ICB A;  1NOM A;  5J0U A;  1ZQD A;  4F2R A;  4O3O A;  3HX0 A;  5L9X A;  4YVZ A;  3M8R A;  4Q45 A;  7ICH A;  5DG7 A;  1XO1 A;  1UA0 A;  4NLG A;  4KLM A;  2KZM A;  4ELT A;  3Q8R B;  2ASL A;  3BQ1 A;  2P6R A;  1L3T A;  3Q8P B;  4LVS A;  3JPN A;  3BDP A;  4BWJ A;  3G6X A;  2FLN A;  4O3P A;  2JZB B;  3UXP A;  3Q8Q B;  2C2D A;  3HPO A;  3PW5 A;  4J9K A;  4XQ8 A;  1NJZ A;  2PFN A;  8ICL A;  1SL0 A;  1MC8 A;  4M9G A;  4C8M A;  5HNK A;  1UT5 A;  5DB7 A;  5KG2 A;  5J2A A;  1RZT A;  3RJF A;  3JPS A;  5J2B A;  4TUQ A;  4BDP A;  1KEJ A;  3ISB A;  2AQ4 A;  3V6H A;  1BPY A;  4RNN A;  4M04 A;  2KFN A;  9ICF A;  3ZD9 A;  1UT8 A;  3JPO A;  4DS5 A;  3H40 A;  2C22 A;  5KFZ A;  5KT7 A;  3PVX A;  2BGW A;  4FBU A;  2WTF A;  5DQI A;  9ICT A;  4J9S A;  3HWT A;  8ICG A;  9ICH A;  4JK1 A;  3GIJ A;  3AU6 A;  3C21 A;  3IM1 A;  2F1J A;  4O3Q A;  4KMU A;  5DLF A;  7ICE A;  5HHH A;  2JEJ A;  2ZTC A;  2ALZ A;  5HHI A;  4KLQ A;  1TK5 A;  5J0P A;  1ZQC A;  1TVA A;  4QZC A;  4QWA A;  1XSP A;  5HMM A;  4RUA A;  2OWO A;  1S0M A;  3THV A;  4YD2 A;  2DPJ A;  4JV2 A;  2V4Q A;  1MQ3 A;  3AU2 A;  4DLE A;  4KN4 A;  4C8L A;  3RH5 A;  3ETL A;  4J9P A;  3RJG A;  3UXN A;  4GXJ A;  5KFY A;  3QE9 Y;  1BPX A;  7ICK A;  1ZQI A;  2F1I A;  4RPY A;  2DFL A;  5J0O A;  1ZQH A;  3TI0 A;  2J6S A;  8ICE A;  9ICV A;  4QZA A;  5KFX A;  2PFO A;  2ZUC A;  4TQR A;  1UA1 A;  4B9V A;  1U4B A;  5KG1 A;  2XY7 A;  4G3I A;  5KT6 A;  3GFK B;  4DQI A;  1KTQ A;  4KLD A;  4F91 B;  4RQ4 A;  3EZ5 A;  3E2E A;  1JMS A;  4MF8 A;  4ECV A;  4DQS A;  2AU0 A;  4NXZ A;  8ICW A;  3SV4 A;  8ICA A;  4RQ3 A;  1SZP A;  1NKE A;  4EBE A;  2FMS A;  4DQP A;  3KHL A;  1XSN A;  1JN3 A;  4ED1 A;  5DB6 A;  5J29 A;  2UVV A;  8ICV A;  4QZB A;  5J0T A;  4RQ1 A;  3PML A;  3HT3 A;  3GIK A;  1XSL A;  4QZG A;  2W8K A;  3C2L A;  2BPF A;  2PXI A;  2RDJ A;  4I2J A;  5CA7 A;  3RR8 A;  3H7I A;  5KTQ A;  1QTM A;  2BQR A;  3MR5 A;  4F2S A;  5KG4 A;  5KFO A;  5J0R A;  3C2M A;  8ICT A;  1TAU A;  5KT2 A;  4DQQ A;  3G6Y A;  5L1L A;  4Q8F A;  4RPX A;  2KFZ A;  4YR3 A;  4YCX A;  1KDH A;  4DOC A;  2VAN A;  2W8L A;  1BVS A;  3QEA Z;  3MGH A;  1NKC A;  9ICE A;  4KLL A;  4R64 A;  1X9M A;  4IR1 A;  4DWI A;  5DDM A;  4YN4 A;  3M9N B;  2BR0 A;  4IRK A;  4LZG A;  2KN7 A;  1LV5 A;  1TFR A;  2XGQ A;  4I2H A;  2NRZ A;  4JV1 A;  8ICY A;  1NJY A;  2DPI A;  2BPC A;  4F5O A;  4RQ2 A;  4YR2 A;  2R8K A;  5KFN A;  1ZQO A;  4QWE A;  3GIM A;  1T4G A;  4DOB A;  2PFP A;  2UVW A;  3JPQ A;  1XS9 D;  2HHS A;  9ICX A;  3H8J A;  1NKB A;  1K1S A;  2BCQ A;  4BXO A;  4Z6E A;  4DSI A;  1MSW D;  4EZ6 A;  8ICU A;  5KFV A;  1BPB A;  2BCS A;  3Q8K A;  1NK5 A;  5DBC A;  4ELU A;  4MF2 A;  4QW8 A;  5KFJ A;  1X9W A;  4FS1 A;  2KZZ A;  2FPK A;  9ICM A;  8ICF A;  2UVU A;  5IIN A;  3GV7 B;  4KLF A;  5F9L A;  4XA5 A;  4UBB A;  4IR9 A;  1QLN A;  2JEG A;  3KTQ A;  3RJK A;  3GQC A;  9ICP A;  3ZDC A;  4KLU A;  4UAZ A;  1RYR A;  7ICI A;  3H4B A;  5J2K A;  1C7Y A;  4B9T A;  2ASJ A;  1SKR A;  4RQ6 A;  4YMO A;  1S0O A;  7ICV A;  5III A;  5D46 A;  5TZV A;  4ED6 A;  2AGO A;  2I1Q A;  9ICO A;  4BGD A;  4P4P A;  7ICJ A;  4EZ9 A;  4F8R A;  4M0A A;  3UQ0 A;  1BPE A;  1D9F A;  3PR4 A;  4F4K A;  1ZJM A;  1IXR A;  5KG3 A;  4NY8 A;  3C5G A;  7ICG A;  1L3S A;  4ED0 A;  1U45 A;  5CR0 A;  4KIT B;  4B9U A;  3TAN A;  3BQ2 A;  3KHH A;  4DLG A;  4NLK A;  2ISO A;  4QWB A;  5DQG A;  5IIL A;  1QSS A;  3JPR A;  3ORY A;  4ECQ A;  2HHV A;  5IIM A;  1ZET A;  2AQ0 A;  4DFK A;  1NK7 A;  1ZQL A;  1HJP A;  3RAQ A;  1ZQZ A;  1U48 A;  2PFQ A;  3QZ7 A;  2PI5 A;  4JWN A;  3BQ0 A;  3RB0 A;  9ICS A;  3GV5 B;  4F4X A;  2ZUB A;  1ZQB A;  1NK9 A;  1ZQA A;  1DGS A;  5CB1 A;  2ZTE A;  4P2H A;  2HHX A;  4EYH B;  7ICT A;  3TFS A;  5KFM A;  4I2F A;  5DLG A;  3Q8L A;  9ICJ A;  5DDY A;  3OJS A;  1S9F A;  8ICO A;  1ZQK A;  1T7P A;  4F4Z A;  4HYK A;  1U47 A;  3JPT A;  4ECR A;  1N56 A;  1S97 A;  1ZQM A;  8ICJ A;  5J0X A;  1Y88 A;  2RDI A;  2XC9 A;  2FMP A;  3MFI A;  3RJH A;  4O3S A;  2J6U A;  4KLH A;  4KN7 A;  5KFL A;  4DS4 A;  1D9D A;  2IA6 A;  1WCN A;  3ZD8 A;  3ISC A;  9ICL A;  2HHT A;  4J9L A;  4ECS A;  4BWM A;  8ICH A;  3RBD A;  3GII A;  1TK0 A;  4KLE A;  2ZJ5 A;  4DL3 A;  2BPG A;  4DO9 A;  4NM2 A;  1JXL A;  2XCP A;  3MBY A;  2R8H A;  4KTQ A;  3MDA A;  4PGY A;  4O5K A;  3Q8M A;  4KLJ A;  4QZE A;  4E0D A;  2Y1J A;  3V6K A;  3ZDE A;  4YD1 A;  5KFK A;  3EPG A;  3T3F A;  4DSK A;  4IQW A;  4I2B A;  4J9O A;  4PHP A;  3RTV A;  1CEZ A;  2VA2 A;  3H4D A;  4PH5 A;  4UB5 A;  4Q43 A;  4ECT A;  5KFT A;  3MAB A;  2BCR A;  3ZDB A;  3K75 D;  5DG9 A;  9ICC A;  3RRG A;  3TAP A;  5KFR A;  3LK9 A;  8ICB A;  2BKE A;  4F4Y A;  4ECZ A;  8ICQ A;  4IRC A;  5J2J A;  3EW9 A;  3QZ8 A;  1ZYQ A;  3SYZ A;  4MEX A;  1COO A;  4PPX A;  4J9Q A;  1RPL A;  2NRW A;  5J0Q A;  1BPZ A;  5KFD A;  4O3N A;  1Z00 B;  2W9M A;  4RNM A;  4FBT A;  4TUR A;  4F3O A;  4DQR A;  1ZQE A;  2GWS A;  4DL6 A;  4UAW A;  4RPZ A;  5KFS A;  5BOL A;  2JEF A;  5L1K A;  1NJX A;  1Z3E B;  7ICR A;  3V6J A;  2BDP A;  3SV3 A;  5J0Y A;  3PV8 A;  1ZQX A;  7ICO A;  3B0Y A;  3IHQ B;  5L1I A;  1JIH A;  4YXM A;  3MGI A;  1D8Y A;  2IHN A;  2HHU A;  4GXK A;  2ATL A;  3H8S A;  1ZQQ A;  1B22 A;  4NLN A;  1ZQW A;  1QSY A;  4IQT A;  1H38 A;  2P66 A;  7ICS A;  5DGA A;  5KFC A;  2HHW A;  1KLN A;  5CP2 A;  1X9S A;  2MAX A;  5J2H A;  3PO4 A;  5KG0 A;  4ECU A;  4F5N A;  4M6W A;  3LWL A;  3TAR A;  2HVH A;  3RH6 A;  3N97 B;  1U9L A;  2XCA A;  2MUT B;  4R8U A;  5JUM A;  1K1Q A;  4RT3 A;  2NRV A;  4TUS A;  3TFR A;  4BXO B;  5J2F A;  4C8K A;  3FYH A;  2V9W A;  4C8O A;  3EYZ A;  3KHR A;  1ARO P;  4YFK A;  4EBD A;  2M9N A;  4RNO A;  1KFS A;  4EEY A;  1KSP A;  3ZDD A;  3OGU A;  2HHQ A;  8ICS A;  2W9B A;  4MEY A;  4DSF A;  5J2G A;  3BJY A;  3PW0 A;  4I27 A;  2AGP A;  4RQ0 A;  3SZ2 A;  3ISD A;  4DL2 A;  4MFF A;  3EWA A;  4DL7 A;  2V4R A;  3NTU A;  4PGQ A;  2AGQ A;  3ZDA A;  4DF8 A;  4I2G A;  5DG8 A;  4Z6F A;  2C28 A;  2A1J A;  1RXW A;  1V9P A;  4K4H A;  7ICL A;  5L1J A;  4DL4 A;  2UVR A;  1B43 A;  1ZQU A;  1ZQJ A;  4GLX A;  2R8G A;  5KFG A;  4EYI B;  1T8E A;  3UQ2 A;  5KFQ A;  4F5R A;  1ZQR A;  4PHA A;  3PO5 A;  4I2A A;  2P6U A;  3GIL A;  2KZ3 A;  3RB6 A;  5KFP A;  3SI8 A;  1HUO A;  2IHM A;  4F93 B;  4ELV A;  4KLI A;  8ICP A;  1HUZ A;  5KFF A;  4UB3 A;  5KFA A;  5DBA A;  5KT5 A;  2ISP A;  5KFU A;  5KG6 A;  4IRD A;  4QWC A;  3T5J A;  4B9M A;  3Q8S B;  4P4O A;  4GXI A;  4TQS A;  2FLP A;  2R8J A;  3HP6 A;  4FS2 A;  3LDA A;  2JEI A;  2B21 A;  4JV0 A;  5KFW A;  5HP4 A;  4YP3 A;  4Z6D A;  2FPM A;  4F92 B;  5KG5 A;  4YQW A;  4ED2 A;  1ZQT A;  7ICP A;  4RQ8 A;  3B0X A;  3T5H A;  5CWR A;  1JX4 A;  1D8L A;  2ZJA A;  4O0I A;  9ICQ A;  3V72 A;  5BOM A;  2XY5 A;  5CJ7 A;  3OSP A;  3EPI A;  4UQG A;  2W9C A;  1RYS A;  5DB8 A;  4UB1 A;  5DGB A;  4IQV A;  4QWD A;  7ICU A;  3M9M B;  4I2D A;  4QZ8 A;  5D4B A;  3BQT A;  5D49 A;  4RUC A;  4R65 A;  4GC6 A;  3T5L A;  1T3N A;  1ZQN A;  4ECX A;  5KFI A;  3G6V A;  5J2D A;  2IMW P;  7ICQ A;  3FDS A;  4M9J A;  3M8S A;  3V7K A;  1IM4 A;  9ICI A;  2Y1I A;  3V7L A;  3UXO A;  2HW3 A;  2FMQ A;  3C1Y A;  5EWE A;  4RU9 A;  4F5P A;  4QW9 A;  1N48 A;  2BQU A;  2ZUD A;  3OHB A;  1RXV A;  3OJU A;  2JZB A;  4M9N A;  3JPP A;  4QZH A;  5BPC A;  4DF4 A;  1U49 A;  4M9L A;  4X5V A;  1KFT A;  5HML A;  5KFE A;  5KT3 A;  3RBE A;  5J2C A;  4ED3 A;  3MR3 A;  1CUK A;  4I29 A;  2HVI A;  4PHE A;  4NM1 A;  3C2K A;  4EBC A;  4Z6C A;  4YMN A;  1TV9 A;  3OHA A;  4O5E A;  1NK8 A;  1PZN A;  4F4W A;  3MR2 A;  4LZD A;  5DKW A;  4PHD A;  3RRH A;  4R66 A;  1A77 A;  3MR6 A;  3C1Z A;  3MDC A;  5IIO A;  4RQ5 A;  3M9O B;  4F50 A;  3QEB Z;  1ZJN A;  4J9N A;  2PI4 A;  2BCU A;  4O9M A;  4M9H A;  5KFB A;  4RQ7 A;  2R8I A;  4J9R A;  1ZQP A;  4ED7 A;  3PX0 A;  3RB3 A;  2XGP A;  2I9G A;  4RZR A;  5DB9 A;  1ZQS A;  8ICC A;  4K4G A;  1WCL A;  9ICK A;  5EWF A;  5IIJ A;  5C5J A;  4B9S A;  8ICI A;  2VA3 A;  1LB2 B;  9ICW A;  7ICF A;  2FPL A;  1TK8 A;  4IQU A;  1SKS A;  9ICN A;  4M6W B;  4P4M A;  5J0W A;  4UB4 A;  3NGD A;  1S0N A;  4ECY A;  2VA8 A;  5DBB A;  2C2R A;  1BGX T;  2FLL A;  4ECW A;  3RJJ A;  8ICK A;  2ASD A;  3PR5 B;  4I2E A;  3RB4 A;  4NLZ A;  4Q44 A;  1XC9 A;  3RAX A;  4R8U B;  4DL5 A;  4M47 A;  4J9M A;  1BPD A;  5J2I A;  1Z00 A;  4YG2 A;  4ED8 A;  1L5U A;  1JXE A;  4DFP A;  2KTQ A;  3RJE A;  1SL1 A;  2AJQ A;  5EWG A;  1SKW A;  1L3U A;  5J2E A;  3HW8 A;  4XRH A;  2W9B B;  4I2I A;  4I28 A;  4QZF A;  7ICN A;  3PNC A;  8ICN A;  4CCH A;  2BHN A;  8ICZ A;  1QSL A;  3H8W A;  4YXJ A;  1KRP A;  4M2Y A;  2J6T A;  8ICX A;  2ZJ8 A;  4DSL A;  4F5Q A;  4KLT A;  4ZH4 A;  1ZQV A;  3C23 A;  4KLG A;  3PW2 A;  4JWM A;  4MFC A;  2BCV A;  2XO7 A;  3AUO A;  9ICG A;  4GC7 A;  2A1J B;  3UPQ A;  2C2E A;  1NJW A;  3K4G A;  1X2I A;  4JUZ A;  1SL2 A;  3PX4 A;  4YR0 A;  4QZD A;  4FO6 A;  3T5K A;  4O5C A;  5CHG A;  2H5X A;  1NK6 A;  4KLO A;  2BQ3 A;  1S10 A;  5IIK A;  4RT2 A;  8ICM A;  5EOZ A;  5J0S A;  4YMM A;  4QZI A;  2W9A A;  4C8N A;  3PW4 A;  1EXN A;  3MFH A;  3RH4 A;  1KFD A;  1ZQG A;  2MUT A;  4DOA A;  5DQH A;  4DSE A;  9ICA A;  4DFM A;  4DSJ A;  5KT4 A;  4Q8E A;  3PW7 A;  3RJI A;  2F1H A;  4MFA A;  4UBC A;  1DOQ A;  2XY6 A;  4UB2 A;  1NK4 A;  4I2C A;  2NRT A;  8ICR A;  4B9N A;  9ICU A;  2ZTD A;  3PMN A;  4DFJ A;  7ICM A;  1ZQY A;  3TAQ A;  9ICR A;  3KHG A;  1TKD A;  1ZQF A;  2IBK A;  3OSN A;  3PY8 A;  4O3R A;  4B9L A;  1XU4 A;  3GDX A;  1S77 D;  2Q0Z X;  4TUP A;  3LWM A;  5F9N A;  2LYH A;  3V7J A;  2NRX A;  3GV8 B;  2W9C B;  1MQ2 A;  1XWL A;  4QZ9 A;  3PX6 A;  1L3V A;  3TQ1 A;  3N4M B;  5KG7 A;  4KLS A; 
#chains in the Genus database with same CATH topology
 3E58 A;  1NK0 A;  5KFH A;  2B6G A;  2LM4 A;  3RR7 A;  1RYU A;  1NOM A;  3PSP A;  1UCV A;  5ALE A;  1ZD2 P;  3BQ1 A;  1L3T A;  3QYP A;  3JPN A;  4BWJ A;  3G6X A;  3UXP A;  4RQM A;  2C2D A;  1NJZ A;  2WF9 A;  3IDW A;  3JPS A;  5AI4 A;  2AQ4 A;  3ISB A;  4M04 A;  1BPY A;  3ZD9 A;  2BGW A;  5KFZ A;  5KT7 A;  3PVX A;  3M6K A;  2WTF A;  2DUY A;  3NVW A;  9ICT A;  3HWT A;  3IRU A;  8ICG A;  2LYB A;  2HBJ A;  3VCB A;  5HHH A;  1TVA A;  3HIL A;  2ZIW A;  3THV A;  4NL9 A;  2V4Q A;  3RH5 A;  3RJG A;  2A1A A;  5KFY A;  1BPX A;  7ICK A;  2F1I A;  2DFL A;  9ICV A;  4QZA A;  2PFO A;  3H0M B;  1S5L U;  4B9V A;  1U4B A;  5KG1 A;  3NS1 A;  2HBL A;  1KTQ A;  1JMS A;  4DQS A;  4OO1 J;  8ICW A;  8ICA A;  2OCE A;  1JN3 A;  5DB6 A;  4QZB A;  1ZXI A;  1L7P A;  2F8L A;  4QNL A;  2QAR A;  2W8K A;  2PXI A;  1QQ7 A;  3H7I A;  5KTQ A;  3MR5 A;  3BZC A;  4AP9 A;  2ZXI A;  5KT2 A;  3I1Y A;  2PKE A;  3LVW A;  4RPX A;  1Q3U A;  2W8L A;  3QEA Z;  1NKC A;  2F76 X;  1X9M A;  2BR0 A;  4IL6 U;  4I2H A;  1SV0 A;  1ZQO A;  4F71 A;  3BZK A;  1JAL A;  4OJ5 A;  1TE2 A;  2FE9 A;  1K1S A;  4Z6E A;  4EZ6 A;  1HIW A;  2BCS A;  5DBC A;  2JHD A;  2VJ4 A;  3GV7 B;  5F9L A;  1QLN A;  3KTQ A;  1RYR A;  2I5H A;  3E0F A;  4YMO A;  4ED6 A;  1L7M A;  7ICJ A;  1L7N A;  4F4K A;  3PR4 A;  7ICG A;  1LKY B;  2VIX A;  4ED0 A;  2YML A;  1U45 A;  4KIT B;  4ZOH C;  5JRT A;  2NO5 A;  5AIA A;  3BQ2 A;  2E1F A;  1WYG A;  3TKA A;  1JRP A;  4DFK A;  1ZQL A;  4JWN A;  3HKZ C;  2WAQ C;  9ICS A;  2G5I B;  3SAF A;  3TFS A;  4CF4 A;  3Q8L A;  5ALN A;  1T7P A;  1M6Y A;  4ECR A;  2GO7 A;  1N56 A;  1S97 A;  1KBU A;  5J0X A;  3K1R B;  3RJH A;  1D9D A;  5J8Y A;  3ISC A;  1X6J A;  3QUC A;  4BWM A;  1CI4 A;  3NRW A;  4DO9 A;  4NM2 A;  1F44 A;  3MDA A;  4PGY A;  5KNI A;  3OPX A;  3EPG A;  5FP0 A;  4I2B A;  4J9O A;  3NRZ A;  4PH5 A;  1UQV A;  4ECT A;  3ZDB A;  3K75 D;  3LK9 A;  2KSO A;  8ICQ A;  3EW9 A;  3QZ8 A;  1MA7 A;  2NRW A;  1SWW A;  2W9M A;  4RNM A;  3CP8 A;  4TUR A;  4FBT A;  1JRO A;  2GWS A;  4DL6 A;  5L1K A;  2WF6 A;  5J0Y A;  2KIC A;  2OYY A;  1ZQQ A;  4Y2P A;  2LBO A;  2JRZ A;  4IQT A;  1H38 A;  1KLN A;  3IG5 A;  2MAX A;  2QB0 A;  5KG0 A;  3PZP A;  2E8M A;  4F5N A;  2HI0 A;  3LWL A;  3RH6 A;  1U9L A;  5ALV A;  3GZF A;  3TFR A;  4C8K A;  5JU5 A;  2Y9U A;  4OJ6 A;  3OGU A;  4I27 A;  2AHO B;  3ISD A;  2NV3 A;  4GFJ A;  2L5Y A;  1L7O A;  2XI9 A;  3ZDA A;  4C7Y A;  5AM0 A;  1O03 A;  2A1J A;  4K4H A;  2UVR A;  4CNQ A;  2E1E A;  2LM1 A;  5KFP A;  3SI8 A;  5AKX A;  5KFA A;  2ISP A;  5KFU A;  3K1Z A;  3T5J A;  3HP6 A;  2B21 A;  5HP4 A;  3M7D A;  3N7P D;  3WK6 A;  5BOM A;  4Y2Y A;  2E5S A;  4UQG A;  4IQV A;  3M9M B;  3KZX A;  5D49 A;  1Q8K A;  4GC6 A;  3F53 A;  5ALU A;  1T3N A;  5KFI A;  1DK2 A;  3ETR A;  5J2D A;  2K60 A;  4PL2 A;  3V7K A;  4AYB F;  3UXO A;  2FMQ A;  5EWE A;  1DXS A;  4RU9 A;  4F5P A;  2BQU A;  2ZUD A;  2G08 A;  4M9N A;  5BPC A;  4M9L A;  3AQF A;  5J2C A;  1F0M A;  1RDF A;  4NM1 A;  3C2K A;  4Z6C A;  1TV9 A;  2WFA A;  2K4I A;  1A77 A;  4RQ5 A;  1ZJN A;  1LVH A;  3I28 A;  2QAR B;  3PX0 A;  2XGP A;  3NVV A;  2F44 A;  9ICK A;  5EWF A;  2H3F A;  1IV8 A;  7ICF A;  1TK8 A;  2CPR A;  2HCF A;  1P7D A;  4IQU A;  9ICN A;  1S0N A;  4ECY A;  2VA8 A;  5DBB A;  5AKK A;  2FLL A;  3RJJ A;  4ECW A;  2N1R A;  3PR5 B;  2LYA A;  3RB4 A;  1XC9 A;  5ALS A;  4R8U B;  4J9M A;  1BPD A;  4ED8 A;  4C4S A;  5AM3 A;  4EEL A;  5E79 U;  2HOI A;  3HW8 A;  2W9B B;  4I28 A;  8ICN A;  3PNC A;  2YB4 A;  1QSL A;  2DGZ A;  2J6T A;  2H3Z A;  4ZH4 A;  2JH1 A;  3AUO A;  1S8O A;  2KJ8 A;  2F77 X;  3UPQ A;  1KKX A;  4JUZ A;  2KNJ A;  3LVV A;  4QZI A;  5J0S A;  2W9A A;  3D2N A;  5AM1 A;  3F2D A;  1EXN A;  3MFH A;  4Y2V A;  9ICA A;  3FC4 A;  3RJI A;  2XY6 A;  8ICR A;  4I2C A;  2NRT A;  4B9N A;  2ZTD A;  3PMN A;  4DFJ A;  7ICM A;  1SXE A;  1ZQY A;  3TAQ A;  9ICR A;  3KHG A;  1QH9 A;  4US8 A;  4O3R A;  4B9L A;  1XU4 A;  4NWI A;  2NRX A;  5AI0 A;  4QIW C;  2NYV A;  5KG7 A;  1SZH A;  4DEZ A;  2RP5 A;  1RG6 A;  3SEI A;  5C0Y A;  9ICB A;  5J0U A;  3MC1 A;  2ZXH A;  7ICH A;  4OCZ A;  5AKJ A;  2HBM A;  1UA0 A;  4NLG A;  4KLM A;  4ELT A;  1COK A;  4G9B A;  4O3P A;  2JZB B;  2PFN A;  8ICL A;  4IC9 A;  4C8M A;  2D3D A;  1UT5 A;  3QU4 A;  1RZT A;  5J2A A;  2AH5 A;  3JPO A;  1RQN A;  4FBU A;  5KL8 B;  4J9S A;  2H3V A;  3GIJ A;  3AU6 A;  3IM1 A;  2F1J A;  4O3Q A;  7ICE A;  2JEJ A;  3BS7 A;  2ZTC A;  2ALZ A;  2IOH A;  4QWA A;  4RUA A;  2LHT A;  4YD2 A;  3WKA A;  2K4H A;  1Q46 A;  1V85 A;  3AU2 A;  4J9P A;  4GXJ A;  2IOF K;  2H3I A;  2G06 A;  5J0O A;  8ICE A;  1ZQH A;  3TI0 A;  4ACO A;  2ZUC A;  5ALH A;  3GFK B;  4DQI A;  4RQ4 A;  4MF8 A;  4CGZ A;  1J2M A;  2D6F C;  4ED1 A;  8ICV A;  2Y0S F;  3TAD C;  3N28 A;  3GIK A;  1X9X A;  4NV0 A;  2RDJ A;  2KHV A;  3RR8 A;  1QTM A;  4BX9 C;  5KFO A;  5L1L A;  5ALO A;  4YR3 A;  1KDH A;  9ICE A;  4KLL A;  4DWI A;  3M9N B;  2KN7 A;  2XGQ A;  1CRX A;  4UAR A;  4F5O A;  2R8K A;  4YR2 A;  5KFN A;  4C4R A;  3GIM A;  1T4G A;  4DOB A;  2PFP A;  2UVW A;  3NAS A;  3JPQ A;  3SAH A;  1XS9 D;  2HHS A;  4KX3 A;  3H8J A;  3D2S A;  2EAP A;  1X40 A;  1BPB A;  3Q8K A;  4ELU A;  4MF2 A;  2KZZ A;  4QW8 A;  3QX7 A;  1X9W A;  4FS1 A;  8ICF A;  2UVU A;  2JH7 A;  1Z4O A;  4XA5 A;  1ZRM A;  3BS5 B;  4PJ0 U;  3ZDC A;  4UAZ A;  5AKL A;  7ICI A;  4USA A;  2KVS A;  1S0O A;  7ICV A;  5III A;  2AGO A;  9ICO A;  4P4P A;  2WB1 C;  4F8R A;  1HEK A;  1BPE A;  2KD1 A;  4DLG A;  2O6K A;  4C80 A;  2W11 A;  1Z4N A;  2ISO A;  3QU2 A;  2KE7 A;  3WKD A;  1HJP A;  3RAQ A;  3QZ7 A;  3SMV A;  3GV5 B;  2ZUB A;  1NK9 A;  2YMM A;  3NVY A;  4F72 A;  3BQ7 A;  5KFM A;  4I2F A;  3OJS A;  3UMB A;  1ZQM A;  1Y88 A;  3MFI A;  4O3S A;  4DS4 A;  3ZD8 A;  2HOF A;  1IG6 A;  3GII A;  4DL3 A;  2BPG A;  1JXL A;  2I6X A;  4QZE A;  2Y1J A;  3T3F A;  2FI1 A;  1AQ6 A;  2YN4 A;  3KBB A;  3PSI A;  2KIV A;  5KFT A;  3MAB A;  2G09 A;  3RRG A;  5KFR A;  4F4Y A;  4ECZ A;  4IRC A;  3ALR A;  3AQE A;  4J9Q A;  5J0Q A;  4O3N A;  1MN8 A;  1ZQE A;  2Q4T A;  1OUQ A;  2ESE A;  4BJQ A;  2BDP A;  3PV8 A;  3LYS A;  1JIH A;  2E8O A;  2KEY A;  4YXM A;  3F5E A;  3H8S A;  4NLN A;  1KQQ A;  5DGA A;  5KFC A;  2HHW A;  3L5K A;  3PO4 A;  3N97 B;  4NL9 C;  2XCA A;  4R8U A;  5JUM A;  1K1Q A;  4P0P A;  4TUS A;  3EYZ A;  1ARO P;  1KFS A;  3C28 A;  2W9B A;  4DSF A;  3PW0 A;  3BJY A;  2AGP A;  2EAM A;  4DL2 A;  4MFF A;  5AK5 A;  3NTU A;  4PGQ A;  5ALJ A;  3VC8 A;  1KN5 A;  2ZIV B;  4Z6F A;  1RXW A;  1ED1 A;  1ZQJ A;  4CDG A;  5AIB A;  4GLX A;  4EYI B;  3UQ2 A;  3PO5 A;  4I2A A;  1D8B A;  3GIL A;  2KZ3 A;  4ELV A;  4F93 B;  2KJ9 A;  1YZ7 A;  4UB3 A;  5KT5 A;  4QWC A;  3CRX A;  4B9M A;  3Q8S B;  3ZI4 A;  4GXI A;  2W55 A;  5AHX A;  4HAI A;  5KFW A;  4YP3 A;  5K4L A;  4F92 B;  4YQW A;  4ED2 A;  2M0N A;  4RQ8 A;  5B5E U;  5CWR A;  1D8L A;  4IS7 A;  5CJ7 A;  3EPI A;  2YMP A;  4JMU A;  5DGB A;  4QZ8 A;  3BQT A;  2KOB A;  2MRL A;  4RUC A;  1ZQN A;  2K8B B;  2KV2 A;  3SAG A;  3G6V A;  2IMW P;  7ICQ A;  3FDS A;  4PZN A;  3M8S A;  3NUQ A;  2HW3 A;  3C1Y A;  2ZG6 A;  1QCK A;  2R18 A;  3OHB A;  2JZB A;  5KL1 B;  3SD7 A;  5GTI U;  1U49 A;  5HML A;  2YTU A;  3RBE A;  4ED3 A;  3MR3 A;  1CUK A;  1L8L A;  4YMN A;  2QLT A;  5EE3 A;  4F4W A;  4LZD A;  1DGJ A;  3MR6 A;  4AYB C;  3M9O B;  5A0L A;  4M9H A;  5KFB A;  4RQ7 A;  1ZQP A;  4ED7 A;  3RB3 A;  8ICC A;  2P35 A;  5IIJ A;  5C5J A;  4B9S A;  2VA3 A;  2G5H B;  4M6W B;  5TIS U;  5J0W A;  4UB4 A;  8ICM A;  1V38 A;  2ASD A;  3WKC A;  1L6N A;  3RAX A;  5J2I A;  1Z00 A;  5CRX A;  4YG2 A;  4DFP A;  3RJE A;  2JMG A;  4B6J A;  2DL0 A;  5EWG A;  1IIP A;  2EQY A;  5ALW A;  1SKW A;  2AJQ A;  4I2I A;  7ICN A;  2BHN A;  3IN5 A;  4YXJ A;  2RHF A;  8ICX A;  3PW2 A;  4JWM A;  4MFC A;  2BCV A;  3IV6 A;  9ICG A;  1FFV A;  2C2E A;  3K4G A;  4O5C A;  5G5G A;  5EE1 A;  2DF4 B;  1BNP A;  1ZQG A;  2MUT A;  1NI3 A;  4DOA A;  1URJ A;  1XO0 A;  5DQH A;  2LKY A;  4Q8E A;  2F1H A;  4MFA A;  1NK4 A;  2K8C B;  4EX6 A;  2WAQ F;  2W7O A;  1TKD A;  1S77 D;  5AKI A;  4NLB A;  4TUP A;  3BS5 A;  2LYH A;  3A0B U;  3CW2 C;  3GV8 B;  2W9C B;  1XWL A;  4QZ9 A;  3N4M B;  1X66 A;  4R63 A;  1S0V A;  1TAQ A;  1ZQD A;  2DBY A;  3SEN A;  3HX0 A;  3M8R A;  2YY6 A;  5DG7 A;  2KZM A;  2OXO A;  2ASL A;  2P6R A;  3QUB A;  2GH1 A;  3U26 A;  1A0P A;  1N5X A;  5JTI A;  2ODG A;  2FLN A;  1OXJ A;  4J9K A;  4M9G A;  5HNK A;  3A0H U;  5DB7 A;  5J2B A;  4BDP A;  9ICF A;  2HOQ A;  2C22 A;  3H40 A;  1ZQ1 C;  2Y9T A;  3UMG A;  4CE6 A;  5DQI A;  5ALR A;  3ED5 A;  4JK1 A;  3HRD D;  4UB8 U;  4KMU A;  3WK5 A;  2LMR A;  4KLQ A;  3QU7 A;  5J0P A;  1ZQC A;  4OJL A;  3AL0 B;  5ALK A;  4DLE A;  5AM2 A;  3RFA A;  3WK4 A;  3QE9 Y;  1ZQI A;  2J6S A;  2QB1 A;  4UAS A;  4TQR A;  3WKE A;  4KLD A;  5GTH U;  3E2E A;  4ECV A;  2AU0 A;  4NXZ A;  1NKE A;  4Y2U A;  4EBE A;  2FMS A;  1XSN A;  2UVV A;  4P0P B;  5J29 A;  3PML A;  3QNM A;  3QU9 A;  1XSL A;  3C2L A;  2BPF A;  2KHQ A;  4I2J A;  5CA7 A;  1OW5 A;  2BQR A;  4F2S A;  2PMZ C;  5J0R A;  1TAU A;  4MHV A;  1X42 A;  2MA1 A;  4Q8F A;  2JR5 A;  4YCX A;  4R64 A;  2W7P A;  4IRK A;  3L4P A;  1LV5 A;  1TFR A;  5AK6 A;  2NRZ A;  5L1M A;  1NJY A;  4OJP A;  1SWV A;  4RQ2 A;  9ICX A;  2BCQ A;  3KFU F;  1MSW D;  5KFV A;  2KJ5 A;  1N61 A;  5KFJ A;  2FPK A;  2F8K A;  4KLF A;  3AM9 A;  5ALG A;  2EZX A;  4UBB A;  4IR9 A;  5AM5 A;  3RJK A;  9ICP A;  3T79 A;  4KLU A;  3H4B A;  5J2K A;  3SR6 A;  1C7Y A;  4B9T A;  1SKR A;  4EEK A;  5TZV A;  2ZIV A;  2I1Q A;  1FO4 A;  1ZJM A;  1IXR A;  5KG3 A;  4NY8 A;  3C5G A;  4WJ3 B;  1PVQ A;  5CR0 A;  4B9U A;  4NLK A;  3IP4 B;  4DFD A;  4ICA A;  5IIL A;  5ALI A;  1QSS A;  3JPR A;  3ORY A;  4ECQ A;  2HHV A;  2AQ0 A;  5F3X B;  1NK7 A;  1ZQZ A;  2PFQ A;  5AKE A;  3BQ0 A;  1ZQB A;  4P2H A;  1ZQA A;  1DGS A;  2ZTE A;  5DLG A;  2G0A A;  5DDY A;  1S9F A;  1ZQK A;  1GO3 F;  4F4Z A;  4HYK A;  2E8N A;  3CYM A;  1ECW A;  4GIB A;  2J6U A;  1WWU A;  2WF8 A;  1N5W A;  2HHT A;  4J9L A;  3H8M A;  1TK0 A;  4KLE A;  1PVP A;  5AKZ A;  3AMZ A;  2R8H A;  2LI6 A;  4O5K A;  3Q8M A;  2EZZ A;  4E0D A;  2MSN A;  3ZDE A;  4FE3 A;  3TAD A;  5KFK A;  4DSK A;  1CEZ A;  2VA2 A;  5AK3 A;  2JGA A;  1XNS A;  4UB5 A;  3KZI U;  3QU5 A;  4NLC A;  5AI9 A;  5DG9 A;  9ICC A;  2EAO A;  1VJ5 A;  5J2J A;  3CNH A;  2EH9 A;  4C0Z A;  1RPL A;  1BPZ A;  1X6I A;  5KFD A;  1Z00 B;  3QUQ A;  4F3O A;  4DQR A;  2YX8 A;  4UAW A;  4RPZ A;  5KFS A;  2WHE A;  1Z3E B;  7ICR A;  3V6J A;  7ICO A;  3B0Y A;  2W43 A;  3MGI A;  4LJX A;  4GXK A;  3KOO A;  1QSY A;  7ICS A;  2VKQ A;  5CP2 A;  2OHF A;  4U7C A;  4M6W A;  3FAH A;  2EAN A;  2MUT B;  4RT3 A;  2NRV A;  4BXO B;  2HBK A;  3KKA C;  3FYH A;  2V9W A;  4C8O A;  4Y2Q A;  3KHR A;  4EBD A;  2M9N A;  2OEH A;  1WG8 A;  4EEY A;  3WKB A;  8ICS A;  5J2G A;  4RQ0 A;  1TAM A;  2E3T A;  2FJ6 A;  3QUT A;  1V97 A;  3EWA A;  4DL7 A;  2AGQ A;  4DF8 A;  4I2G A;  2C28 A;  4QIW F;  7ICL A;  5ALT A;  5L1J A;  4DL4 A;  1B43 A;  2IOF A;  1RQL A;  5KFQ A;  4F5R A;  1ZQR A;  4PHA A;  2P6U A;  2IHM A;  1PUZ A;  2OH2 A;  8ICP A;  5KFF A;  5DBA A;  4IRD A;  4P4O A;  4TQS A;  2R8J A;  4FS2 A;  3D2Q A;  4UAV A;  5KG5 A;  3T5H A;  2ZJA A;  9ICQ A;  4O0I A;  2DQN B;  3V72 A;  2XY5 A;  2W9C A;  5DB8 A;  4UB1 A;  4QWD A;  7ICU A;  3AN1 A;  4I2D A;  4R65 A;  3T5L A;  1PVR A;  1SIJ A;  5ALQ A;  1WWV A;  4KMO B;  4M9J A;  4FZN A;  1ZD4 A;  9ICI A;  2Y1I A;  1RM6 C;  1RXV A;  1YT3 A;  3JPP A;  1B0X A;  4X5V A;  3WK9 A;  5KFE A;  4I29 A;  2HVI A;  2CRX A;  5AIC A;  2RRD A;  4RQN A;  1PZN A;  3MR2 A;  5DKW A;  1N63 A;  2EZY A;  5IIO A;  4DCC A;  2BCU A;  1BNO A;  4EEN A;  4J9R A;  2YQE A;  2DKZ A;  4RZR A;  5DB9 A;  2EDU A;  4Y2S A;  1LB2 B;  5AKY A;  4P4M A;  3NGD A;  2C2R A;  8ICK A;  3O0F A;  1NZB A;  4NLZ A;  2XVT A;  4FZL A;  4QJF B;  1L8O A;  1L5U A;  1JXE A;  2KTQ A;  1SL1 A;  5AKH A;  5ALP A;  1L3U A;  4CCH A;  1KRP A;  2ZJ8 A;  4F5Q A;  4KLT A;  1ZQV A;  4KLG A;  2AXT U;  1NJW A;  4YR0 A;  4QZD A;  4FO6 A;  2WB1 F;  5CHG A;  2H5X A;  2BQ3 A;  1S10 A;  5IIK A;  2W54 A;  4P0Q A;  5EOZ A;  3AEV A;  4C8N A;  3PW4 A;  3RH4 A;  3TAC B;  2CXY A;  5ALM A;  3H0L B;  4DSE A;  3L3F X;  5ALX A;  3PW7 A;  1DOQ A;  9ICU A;  5EE9 A;  4UB2 A;  3OSN A;  3PY8 A;  3GDX A;  5ALD A;  3LWM A;  5F9N A;  1MQ2 A;  4EX7 A;  3PX6 A;  3TQ1 A;  3KD3 A;  4KLS A;  1SV0 C;  4XUS A;  1S76 D;  1A76 A;  3C5F A;  3UMC A;  4UAY A;  4PGX A;  4PL1 A;  3F2C A;  1ZOL A;  4K4I A;  5CEH A;  4F2R A;  4O3O A;  5L9X A;  4YVZ A;  4Q45 A;  1XO1 A;  2E8P A;  5HR6 A;  3IG8 A;  3Q8R B;  2K4P A;  4FZM A;  3Q8P B;  4LVS A;  1WUD A;  1Z1B A;  3BDP A;  2VJ5 A;  3Q8Q B;  3HPO A;  3PW5 A;  4XQ8 A;  1SL0 A;  1MC8 A;  3RJF A;  3S6J A;  5KG2 A;  1K5O A;  4TUQ A;  1KEJ A;  3V6H A;  4RNN A;  2KFN A;  1UT8 A;  4DS5 A;  9ICH A;  2HDO A;  2BDU A;  2G07 A;  3C21 A;  2A19 A;  5HR7 A;  5DLF A;  5ALZ A;  5HHI A;  1TK5 A;  1FIQ A;  2WF7 A;  2A3V A;  4QZC A;  1XSP A;  5HMM A;  2F3N A;  2OWO A;  1S0M A;  2DPJ A;  4JV2 A;  1MQ3 A;  2WF5 A;  4KN4 A;  1DK3 A;  4C8L A;  3ETL A;  5KAI U;  3UXN A;  3RF9 A;  4RPY A;  5KFX A;  1UA1 A;  4G3I A;  2XY7 A;  5J8Y C;  5KT6 A;  1O08 A;  4F91 B;  3EZ5 A;  4Y2J A;  3SV4 A;  4RQ3 A;  1N62 A;  1SZP A;  4OJO A;  4DQP A;  3KHL A;  5J0T A;  4RQ1 A;  5AKG A;  1JUD A;  3HT3 A;  1F5S A;  4QZG A;  2YB1 A;  1PK1 A;  2XID A;  5KG4 A;  1PK3 A;  3C2M A;  8ICT A;  4DQQ A;  3G6Y A;  3FM9 A;  3ONN A;  4O3M A;  2KFZ A;  3F5A A;  4DOC A;  2VAN A;  1Z19 A;  1BVS A;  3MGH A;  4IR1 A;  3F2B A;  5DDM A;  4YN4 A;  4LZG A;  4JV1 A;  8ICY A;  2DPI A;  2BPC A;  2D8C A;  2RLT A;  2ZIU B;  3H0R B;  4OD0 A;  4QWE A;  5AI6 A;  1DRG A;  1VLB A;  1NKB A;  8ICU A;  4BXO A;  4DSI A;  1NK5 A;  1Q3V A;  2B0C A;  3PSF A;  3WK8 A;  9ICM A;  1A6S A;  2ZIX A;  5IIN A;  2RQ5 A;  1SV4 A;  2JEG A;  3HKZ F;  2KG5 A;  3GQC A;  2ASJ A;  4RQ6 A;  4CF5 A;  5D46 A;  1VDV A;  4CF3 A;  4BGD A;  4A8E A;  4UB6 U;  2K89 A;  4C4T A;  4EZ9 A;  4M0A A;  3UQ0 A;  2JV3 A;  1D9F A;  1L3S A;  2W04 A;  3TAN A;  3KHH A;  3M6Z A;  4QWB A;  5DQG A;  2KVC A;  5IIM A;  1ZET A;  2DWQ A;  2PI5 A;  1U48 A;  3MGV A;  3RB0 A;  4UW9 A;  2KK0 A;  4F4X A;  1T3Q A;  3WU2 U;  7ICT A;  5CB1 A;  2HHX A;  3HJE A;  4EYH B;  9ICJ A;  8ICO A;  4CRX A;  1U47 A;  3JPT A;  5ALL A;  8ICJ A;  2XC9 A;  2FMP A;  2RDI A;  4KLH A;  4KN7 A;  5KFL A;  2IA6 A;  1WCN A;  4UAU A;  3C29 A;  9ICL A;  4ECS A;  8ICH A;  3N7R C;  3RBD A;  2ZIW B;  2HSZ A;  2ZJ5 A;  2W03 A;  2XCP A;  3MBY A;  4KTQ A;  4KLJ A;  3R9K A;  5AI5 A;  3V6K A;  4YD1 A;  4KX5 A;  4IQW A;  4NJ8 A;  4PHP A;  3RTV A;  1C20 A;  3H4D A;  2MU2 A;  4Q43 A;  2BCR A;  3TAP A;  4US9 A;  8ICB A;  2BKE A;  1ZYQ A;  3SYZ A;  4MEX A;  1COO A;  4PPX A;  1SXD A;  1KW4 A;  1J97 A;  1NZP A;  2JEF A;  5BOL A;  1NJX A;  3SV3 A;  1ZQX A;  3IHQ B;  5L1I A;  1D8Y A;  2IHN A;  2HHU A;  2ATL A;  1B22 A;  1ZQW A;  2P66 A;  3J81 j;  1UHU A;  2KIW A;  2BZF A;  1X9S A;  5AM4 A;  5J2H A;  5H2F U;  4ECU A;  3TAR A;  4P0Q B;  2HVH A;  3WK7 A;  5J2F A;  1SB3 C;  3ZDD A;  2Y0S C;  4YFK A;  4RNO A;  1UPH A;  1FFU A;  1KSP A;  2HHQ A;  4MEY A;  5EE0 A;  3SZ2 A;  2JXJ A;  1JI7 A;  2V4R A;  5DG8 A;  1V9P A;  2F2A B;  1ZQU A;  2R8G A;  5KFG A;  1T8E A;  2KMD A;  4Y2T A;  3I76 A;  3N7S C;  3RB6 A;  1HUO A;  2W3R A;  4KLI A;  1HUZ A;  1T94 A;  2K8A A;  3OTQ A;  5KG6 A;  4C7Z A;  4Y2R A;  2FLP A;  3LDA A;  2JEI A;  2DKX A;  2LPE A;  4JV0 A;  5KAF U;  4Z6D A;  2FPM A;  7ICP A;  1ZQT A;  3QXG A;  3B0X A;  1ZD3 A;  1JX4 A;  3PST A;  3OSP A;  3DV9 A;  1RYS A;  4J03 A;  5D4B A;  1LKY A;  4ECX A;  1J2N A;  2ES6 A;  3UM9 A;  1KL9 A;  3SQI A;  5T14 A;  2KKP A;  1IM4 A;  3V7L A;  2OM6 A;  4JB3 A;  2XIC A;  4QW9 A;  2W3S A;  2FDR A;  1N48 A;  3OJU A;  2GOL A;  4QZH A;  4DF4 A;  1KFT A;  5ALF A;  4FFD A;  1N2X A;  2KP7 A;  5KT3 A;  1QQ6 A;  3DEE A;  4U6P A;  4PHE A;  2KSO B;  1ZRN A;  4EBC A;  3OHA A;  4O5E A;  2CN1 A;  3DDH A;  1NK8 A;  4PHD A;  3RRH A;  4R66 A;  3MDC A;  3C1Z A;  4F50 A;  3QEB Z;  2H3Q A;  4J9N A;  2PI4 A;  1FEZ A;  4O9M A;  3KKA A;  2Z7J A;  5G5H A;  2R8I A;  3EUB 2;  2PMZ F;  1PK1 B;  2I9G A;  3M1Y A;  1ZQS A;  4K4G A;  1WCL A;  4BUG A;  8ICI A;  9ICW A;  2FPL A;  1YZ6 A;  2QB0 B;  1QQ5 A;  1SKS A;  1Z1V A;  1BGX T;  4I2E A;  4Q44 A;  1B4F A;  3NVZ A;  4DL5 A;  4M47 A;  5B66 U;  5J2E A;  5ALY A;  2QKQ A;  4XRH A;  4QZF A;  4Y2X A;  5AK4 A;  2GLE A;  8ICZ A;  3H8W A;  4UAT A;  4M2Y A;  2ZIX B;  4DSL A;  3C23 A;  1NNL A;  2YMQ A;  2XO7 A;  4GC7 A;  2A1J B;  1SGG A;  2NO4 A;  1X2I A;  1SL2 A;  3PX4 A;  3T5K A;  1NK6 A;  4KLO A;  4RT2 A;  4YMM A;  5AI8 A;  1KFD A;  3ICX A;  3B9J A;  2ZIU A;  4DFM A;  4DSJ A;  5KT4 A;  2K4E A;  3D6J A;  4UBC A;  2KKV A;  1ZQF A;  1ZD5 A;  2IBK A;  1N60 A;  3GU3 A;  2Q0Z X;  3V7J A;  2HMX A;  1L3V A;  4PZO A; 
#chains in the Genus database with same CATH homology
 1NK0 A;  5KFH A;  4DEZ A;  4XUS A;  1S76 D;  1A76 A;  3C5F A;  4R63 A;  3RR7 A;  4UAY A;  4PGX A;  4K4I A;  1S0V A;  1TAQ A;  9ICB A;  1NOM A;  5J0U A;  1ZQD A;  4F2R A;  4O3O A;  3HX0 A;  5L9X A;  4YVZ A;  3M8R A;  4Q45 A;  7ICH A;  5DG7 A;  1XO1 A;  1UA0 A;  4NLG A;  4KLM A;  2KZM A;  4ELT A;  3Q8R B;  2ASL A;  3BQ1 A;  2P6R A;  1L3T A;  3Q8P B;  4LVS A;  3JPN A;  3BDP A;  4BWJ A;  3G6X A;  2FLN A;  4O3P A;  2JZB B;  3UXP A;  3Q8Q B;  2C2D A;  3HPO A;  3PW5 A;  4J9K A;  4XQ8 A;  1NJZ A;  2PFN A;  8ICL A;  1SL0 A;  1MC8 A;  4M9G A;  4C8M A;  5HNK A;  1UT5 A;  5DB7 A;  5KG2 A;  5J2A A;  1RZT A;  3RJF A;  3JPS A;  5J2B A;  4TUQ A;  4BDP A;  1KEJ A;  3ISB A;  2AQ4 A;  3V6H A;  1BPY A;  4RNN A;  4M04 A;  2KFN A;  9ICF A;  3ZD9 A;  1UT8 A;  3JPO A;  4DS5 A;  3H40 A;  2C22 A;  5KFZ A;  5KT7 A;  3PVX A;  2BGW A;  4FBU A;  2WTF A;  5DQI A;  9ICT A;  4J9S A;  3HWT A;  8ICG A;  9ICH A;  4JK1 A;  3GIJ A;  3AU6 A;  3C21 A;  3IM1 A;  2F1J A;  4O3Q A;  4KMU A;  5DLF A;  7ICE A;  5HHH A;  2JEJ A;  2ZTC A;  2ALZ A;  5HHI A;  4KLQ A;  1TK5 A;  5J0P A;  1ZQC A;  1TVA A;  4QZC A;  4QWA A;  1XSP A;  5HMM A;  4RUA A;  2OWO A;  1S0M A;  3THV A;  4YD2 A;  2DPJ A;  4JV2 A;  2V4Q A;  1MQ3 A;  3AU2 A;  4DLE A;  4KN4 A;  4C8L A;  3RH5 A;  3ETL A;  4J9P A;  3RJG A;  3UXN A;  4GXJ A;  5KFY A;  3QE9 Y;  1BPX A;  7ICK A;  1ZQI A;  2F1I A;  4RPY A;  2DFL A;  5J0O A;  1ZQH A;  3TI0 A;  2J6S A;  8ICE A;  9ICV A;  4QZA A;  5KFX A;  2PFO A;  2ZUC A;  4TQR A;  1UA1 A;  4B9V A;  1U4B A;  5KG1 A;  2XY7 A;  4G3I A;  5KT6 A;  3GFK B;  4DQI A;  1KTQ A;  4KLD A;  4F91 B;  4RQ4 A;  3EZ5 A;  3E2E A;  1JMS A;  4MF8 A;  4ECV A;  4DQS A;  2AU0 A;  4NXZ A;  8ICW A;  3SV4 A;  8ICA A;  4RQ3 A;  1SZP A;  1NKE A;  4EBE A;  2FMS A;  4DQP A;  3KHL A;  1XSN A;  1JN3 A;  4ED1 A;  5DB6 A;  5J29 A;  2UVV A;  8ICV A;  4QZB A;  5J0T A;  4RQ1 A;  3PML A;  3HT3 A;  3GIK A;  1XSL A;  4QZG A;  2W8K A;  3C2L A;  2BPF A;  2PXI A;  2RDJ A;  4I2J A;  5CA7 A;  3RR8 A;  3H7I A;  5KTQ A;  1QTM A;  2BQR A;  3MR5 A;  4F2S A;  5KG4 A;  5KFO A;  5J0R A;  3C2M A;  8ICT A;  1TAU A;  5KT2 A;  4DQQ A;  3G6Y A;  5L1L A;  4Q8F A;  4RPX A;  2KFZ A;  4YR3 A;  4YCX A;  1KDH A;  4DOC A;  2VAN A;  2W8L A;  1BVS A;  3QEA Z;  3MGH A;  1NKC A;  9ICE A;  4KLL A;  4R64 A;  1X9M A;  4IR1 A;  4DWI A;  5DDM A;  4YN4 A;  3M9N B;  2BR0 A;  4IRK A;  4LZG A;  2KN7 A;  1LV5 A;  1TFR A;  2XGQ A;  4I2H A;  2NRZ A;  4JV1 A;  8ICY A;  1NJY A;  2DPI A;  2BPC A;  4F5O A;  4RQ2 A;  4YR2 A;  2R8K A;  5KFN A;  1ZQO A;  4QWE A;  3GIM A;  1T4G A;  4DOB A;  2PFP A;  2UVW A;  3JPQ A;  1XS9 D;  2HHS A;  9ICX A;  3H8J A;  1NKB A;  1K1S A;  2BCQ A;  4BXO A;  4Z6E A;  4DSI A;  1MSW D;  4EZ6 A;  8ICU A;  5KFV A;  1BPB A;  2BCS A;  3Q8K A;  1NK5 A;  5DBC A;  4ELU A;  4MF2 A;  4QW8 A;  5KFJ A;  1X9W A;  4FS1 A;  2KZZ A;  2FPK A;  9ICM A;  8ICF A;  2UVU A;  5IIN A;  3GV7 B;  4KLF A;  5F9L A;  4XA5 A;  4UBB A;  4IR9 A;  1QLN A;  2JEG A;  3KTQ A;  3RJK A;  3GQC A;  9ICP A;  3ZDC A;  4KLU A;  4UAZ A;  1RYR A;  7ICI A;  3H4B A;  5J2K A;  1C7Y A;  4B9T A;  2ASJ A;  1SKR A;  4RQ6 A;  4YMO A;  1S0O A;  7ICV A;  5III A;  5D46 A;  5TZV A;  4ED6 A;  2AGO A;  2I1Q A;  9ICO A;  4BGD A;  4P4P A;  7ICJ A;  4EZ9 A;  4F8R A;  4M0A A;  3UQ0 A;  1BPE A;  1D9F A;  3PR4 A;  4F4K A;  1ZJM A;  1IXR A;  5KG3 A;  4NY8 A;  3C5G A;  7ICG A;  1L3S A;  4ED0 A;  1U45 A;  5CR0 A;  4KIT B;  4B9U A;  3TAN A;  3BQ2 A;  3KHH A;  4DLG A;  4NLK A;  2ISO A;  4QWB A;  5DQG A;  5IIL A;  1QSS A;  3JPR A;  3ORY A;  4ECQ A;  2HHV A;  5IIM A;  1ZET A;  2AQ0 A;  4DFK A;  1NK7 A;  1ZQL A;  1HJP A;  3RAQ A;  1ZQZ A;  1U48 A;  2PFQ A;  3QZ7 A;  2PI5 A;  4JWN A;  3BQ0 A;  3RB0 A;  9ICS A;  3GV5 B;  4F4X A;  2ZUB A;  1ZQB A;  1NK9 A;  1ZQA A;  1DGS A;  5CB1 A;  2ZTE A;  4P2H A;  2HHX A;  4EYH B;  7ICT A;  3TFS A;  5KFM A;  4I2F A;  5DLG A;  3Q8L A;  9ICJ A;  5DDY A;  3OJS A;  1S9F A;  8ICO A;  1ZQK A;  1T7P A;  4F4Z A;  4HYK A;  1U47 A;  3JPT A;  4ECR A;  1N56 A;  1S97 A;  1ZQM A;  8ICJ A;  5J0X A;  1Y88 A;  2RDI A;  2XC9 A;  2FMP A;  3MFI A;  3RJH A;  4O3S A;  2J6U A;  4KLH A;  4KN7 A;  5KFL A;  4DS4 A;  1D9D A;  2IA6 A;  1WCN A;  3ZD8 A;  3ISC A;  9ICL A;  2HHT A;  4J9L A;  4ECS A;  4BWM A;  8ICH A;  3RBD A;  3GII A;  1TK0 A;  4KLE A;  2ZJ5 A;  4DL3 A;  2BPG A;  4DO9 A;  4NM2 A;  1JXL A;  2XCP A;  3MBY A;  2R8H A;  4KTQ A;  3MDA A;  4PGY A;  4O5K A;  3Q8M A;  4KLJ A;  4QZE A;  4E0D A;  2Y1J A;  3V6K A;  3ZDE A;  4YD1 A;  5KFK A;  3EPG A;  3T3F A;  4DSK A;  4IQW A;  4I2B A;  4J9O A;  4PHP A;  3RTV A;  1CEZ A;  2VA2 A;  3H4D A;  4PH5 A;  4UB5 A;  4Q43 A;  4ECT A;  5KFT A;  3MAB A;  2BCR A;  3ZDB A;  3K75 D;  5DG9 A;  9ICC A;  3RRG A;  3TAP A;  5KFR A;  3LK9 A;  8ICB A;  2BKE A;  4F4Y A;  4ECZ A;  8ICQ A;  4IRC A;  5J2J A;  3EW9 A;  3QZ8 A;  1ZYQ A;  3SYZ A;  4MEX A;  1COO A;  4PPX A;  4J9Q A;  1RPL A;  2NRW A;  5J0Q A;  1BPZ A;  5KFD A;  4O3N A;  1Z00 B;  2W9M A;  4RNM A;  4FBT A;  4TUR A;  4F3O A;  4DQR A;  1ZQE A;  2GWS A;  4DL6 A;  4UAW A;  4RPZ A;  5KFS A;  5BOL A;  2JEF A;  5L1K A;  1NJX A;  1Z3E B;  7ICR A;  3V6J A;  2BDP A;  3SV3 A;  5J0Y A;  3PV8 A;  1ZQX A;  7ICO A;  3B0Y A;  3IHQ B;  5L1I A;  1JIH A;  4YXM A;  3MGI A;  1D8Y A;  2IHN A;  2HHU A;  4GXK A;  2ATL A;  3H8S A;  1ZQQ A;  1B22 A;  4NLN A;  1ZQW A;  1QSY A;  4IQT A;  1H38 A;  2P66 A;  7ICS A;  5DGA A;  5KFC A;  2HHW A;  1KLN A;  5CP2 A;  1X9S A;  2MAX A;  5J2H A;  3PO4 A;  5KG0 A;  4ECU A;  4F5N A;  4M6W A;  3LWL A;  3TAR A;  2HVH A;  3RH6 A;  3N97 B;  1U9L A;  2XCA A;  2MUT B;  4R8U A;  5JUM A;  1K1Q A;  4RT3 A;  2NRV A;  4TUS A;  3TFR A;  4BXO B;  5J2F A;  4C8K A;  3FYH A;  2V9W A;  4C8O A;  3EYZ A;  3KHR A;  1ARO P;  4YFK A;  4EBD A;  2M9N A;  4RNO A;  1KFS A;  4EEY A;  1KSP A;  3ZDD A;  3OGU A;  2HHQ A;  8ICS A;  2W9B A;  4MEY A;  4DSF A;  5J2G A;  3BJY A;  3PW0 A;  4I27 A;  2AGP A;  4RQ0 A;  3SZ2 A;  3ISD A;  4DL2 A;  4MFF A;  3EWA A;  4DL7 A;  2V4R A;  3NTU A;  4PGQ A;  2AGQ A;  3ZDA A;  4DF8 A;  4I2G A;  5DG8 A;  4Z6F A;  2C28 A;  2A1J A;  1RXW A;  1V9P A;  4K4H A;  7ICL A;  5L1J A;  4DL4 A;  2UVR A;  1B43 A;  1ZQU A;  1ZQJ A;  4GLX A;  2R8G A;  5KFG A;  4EYI B;  1T8E A;  3UQ2 A;  5KFQ A;  4F5R A;  1ZQR A;  4PHA A;  3PO5 A;  4I2A A;  2P6U A;  3GIL A;  2KZ3 A;  3RB6 A;  5KFP A;  3SI8 A;  1HUO A;  2IHM A;  4F93 B;  4ELV A;  4KLI A;  8ICP A;  1HUZ A;  5KFF A;  4UB3 A;  5KFA A;  5DBA A;  5KT5 A;  2ISP A;  5KFU A;  5KG6 A;  4IRD A;  4QWC A;  3T5J A;  4B9M A;  3Q8S B;  4P4O A;  4GXI A;  4TQS A;  2FLP A;  2R8J A;  3HP6 A;  4FS2 A;  3LDA A;  2JEI A;  2B21 A;  4JV0 A;  5KFW A;  5HP4 A;  4YP3 A;  4Z6D A;  2FPM A;  4F92 B;  5KG5 A;  4YQW A;  4ED2 A;  1ZQT A;  7ICP A;  4RQ8 A;  3B0X A;  3T5H A;  5CWR A;  1JX4 A;  1D8L A;  2ZJA A;  4O0I A;  9ICQ A;  3V72 A;  5BOM A;  2XY5 A;  5CJ7 A;  3OSP A;  3EPI A;  4UQG A;  2W9C A;  1RYS A;  5DB8 A;  4UB1 A;  5DGB A;  4IQV A;  4QWD A;  7ICU A;  3M9M B;  4I2D A;  4QZ8 A;  5D4B A;  3BQT A;  5D49 A;  4RUC A;  4R65 A;  4GC6 A;  3T5L A;  1T3N A;  1ZQN A;  4ECX A;  5KFI A;  3G6V A;  5J2D A;  2IMW P;  7ICQ A;  3FDS A;  4M9J A;  3M8S A;  3V7K A;  1IM4 A;  9ICI A;  2Y1I A;  3V7L A;  3UXO A;  2HW3 A;  2FMQ A;  3C1Y A;  5EWE A;  4RU9 A;  4F5P A;  4QW9 A;  1N48 A;  2BQU A;  2ZUD A;  3OHB A;  1RXV A;  3OJU A;  2JZB A;  4M9N A;  3JPP A;  4QZH A;  5BPC A;  4DF4 A;  1U49 A;  4M9L A;  4X5V A;  1KFT A;  5HML A;  5KFE A;  5KT3 A;  3RBE A;  5J2C A;  4ED3 A;  3MR3 A;  1CUK A;  4I29 A;  2HVI A;  4PHE A;  4NM1 A;  3C2K A;  4EBC A;  4Z6C A;  4YMN A;  1TV9 A;  3OHA A;  4O5E A;  1NK8 A;  1PZN A;  4F4W A;  3MR2 A;  4LZD A;  5DKW A;  4PHD A;  3RRH A;  4R66 A;  1A77 A;  3MR6 A;  3C1Z A;  3MDC A;  5IIO A;  4RQ5 A;  3M9O B;  4F50 A;  3QEB Z;  1ZJN A;  4J9N A;  2PI4 A;  2BCU A;  4O9M A;  4M9H A;  5KFB A;  4RQ7 A;  2R8I A;  4J9R A;  1ZQP A;  4ED7 A;  3PX0 A;  3RB3 A;  2XGP A;  2I9G A;  4RZR A;  5DB9 A;  1ZQS A;  8ICC A;  4K4G A;  1WCL A;  9ICK A;  5EWF A;  5IIJ A;  5C5J A;  4B9S A;  8ICI A;  2VA3 A;  1LB2 B;  9ICW A;  7ICF A;  2FPL A;  1TK8 A;  4IQU A;  1SKS A;  9ICN A;  4M6W B;  4P4M A;  5J0W A;  4UB4 A;  3NGD A;  1S0N A;  4ECY A;  2VA8 A;  5DBB A;  2C2R A;  1BGX T;  2FLL A;  4ECW A;  3RJJ A;  8ICK A;  2ASD A;  3PR5 B;  4I2E A;  3RB4 A;  4NLZ A;  4Q44 A;  1XC9 A;  3RAX A;  4R8U B;  4DL5 A;  4M47 A;  4J9M A;  1BPD A;  5J2I A;  1Z00 A;  4YG2 A;  4ED8 A;  1L5U A;  1JXE A;  4DFP A;  2KTQ A;  3RJE A;  1SL1 A;  2AJQ A;  5EWG A;  1SKW A;  1L3U A;  5J2E A;  3HW8 A;  4XRH A;  2W9B B;  4I2I A;  4I28 A;  4QZF A;  7ICN A;  3PNC A;  8ICN A;  4CCH A;  2BHN A;  8ICZ A;  1QSL A;  3H8W A;  4YXJ A;  1KRP A;  4M2Y A;  2J6T A;  8ICX A;  2ZJ8 A;  4DSL A;  4F5Q A;  4KLT A;  4ZH4 A;  1ZQV A;  3C23 A;  4KLG A;  3PW2 A;  4JWM A;  4MFC A;  2BCV A;  2XO7 A;  3AUO A;  9ICG A;  4GC7 A;  2A1J B;  3UPQ A;  2C2E A;  1NJW A;  3K4G A;  1X2I A;  4JUZ A;  1SL2 A;  3PX4 A;  4YR0 A;  4QZD A;  4FO6 A;  3T5K A;  4O5C A;  5CHG A;  2H5X A;  1NK6 A;  4KLO A;  2BQ3 A;  1S10 A;  5IIK A;  4RT2 A;  8ICM A;  5EOZ A;  5J0S A;  4YMM A;  4QZI A;  2W9A A;  4C8N A;  3PW4 A;  1EXN A;  3MFH A;  3RH4 A;  1KFD A;  1ZQG A;  2MUT A;  4DOA A;  5DQH A;  4DSE A;  9ICA A;  4DFM A;  4DSJ A;  5KT4 A;  4Q8E A;  3PW7 A;  3RJI A;  2F1H A;  4MFA A;  4UBC A;  1DOQ A;  2XY6 A;  4UB2 A;  1NK4 A;  4I2C A;  2NRT A;  8ICR A;  4B9N A;  9ICU A;  2ZTD A;  3PMN A;  4DFJ A;  7ICM A;  1ZQY A;  3TAQ A;  9ICR A;  3KHG A;  1TKD A;  1ZQF A;  2IBK A;  3OSN A;  3PY8 A;  4O3R A;  4B9L A;  1XU4 A;  3GDX A;  1S77 D;  2Q0Z X;  4TUP A;  3LWM A;  5F9N A;  2LYH A;  3V7J A;  2NRX A;  3GV8 B;  2W9C B;  1MQ2 A;  1XWL A;  4QZ9 A;  3PX6 A;  1L3V A;  3TQ1 A;  3N4M B;  5KG7 A;  4KLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...