2LYHA

Structure of faap24 residues 141-215
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fanconi anemia-associated protein of 24 kDa
publication title The Fanconi anemia associated protein FAAP24 uses two substrate specific binding surfaces for DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12826 HHH_2 Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2lyhA00
5D49A 4ECQA 2XGPA 2ALZA 1LV5A 2HVIA 8ICSA 4R64A 4YXJA 4KN4A 2NRXA 4J9QA 4KLGA 1S0NA 4DSJA 2VANA 5EOZA 4Q43A 4F93B 2PI4A 3OGUA 1S0OA 4KITB 2W8KA 1NKBA 4M04A 5KFRA 2FLPA 4F5OA 1QSSA 4O3NA 4IRKA 3JPRA 3OJUA 4PHPA 5J0PA 5D4BA 4NLZA 4IQTA 4O3SA 4QWAA 9ICOA 4K4HA 5KG1A 4QZCA 1NK0A 8ICEA 2AQ0A 3RR8A 1ZQPA 2Y1IA 1NK9A 3N4MB 8ICFA 3B0YA 4DSEA 4J9MA 5DB9A 2AQ4A 1KFTA 2I1QA 1K1SA 2RDIA 4DQQA 3T3FA 1EXNA 5DBBA 2UVUA 4MEYA 8ICUA 4QZIA 8ICXA 4DOCA 4YR3A 2M9NA 2IMWP 3PX6A 4DFPA 3MR3A 5BPCA 3HWTA 3M9OB 3UQ2A 5F9NA 3ZDEA 4DFJA 4DLGA 1H38A 4YVZA 1D9DA 5DKWA 4JV0A 4QZHA 2BCRA 1RPLA 4I2DA 5L1IA 1ZQBA 4I28A 4QZAA 3MDCA 3UXNA 2J6UA 2HHUA 2F1IA 1RYRA 3TI0A 8ICHA 2Q0ZX 3MABA 7ICGA 2ZJAA 8ICOA 4IR1A 3EWAA 4ELUA 3MR5A 4UBCA 4GXJA 1JN3A 2F1HA 3PW7A 1QSLA 4BDPA 9ICRA 2XCAA 7ICKA 1XO1A 2IA6A 4ECRA 9ICKA 2A1JB 1ZQIA 8ICLA 5DQGA 4RZRA 4Z6CA 5J0SA 4TQRA 4DL7A 4IRCA 4KLEA 9ICPA 2W9CA 2R8JA 5J2AA 3BJYA 3H40A 5KFVA 5KFJA 4EBEA 5DG7A 3Q8RB 1A76A 3V7JA 3T5KA 5KFYA 7ICQA 4YXMA 4NM2A 3T5JA 3NGDA 1NJZA 8ICKA 4ED0A 3GDXA 3RBDA 5KFPA 5HHHA 4FS2A 4KLIA 4M6WA 5DGAA 4DL6A 1IXRA 3MFHA 1KEJA 3PO5A 4MEXA 3GIMA 1T7PA 4B9LA 4UB3A 4J9PA 3ZDBA 5KFAA 5KFUA 4O3PA 4XQ8A 5KFFA 1ZQAA 4M9GA 1MSWD 7ICLA 4I2CA 2KZMA 2W9CB 1LB2B 1MC8A 1ZQNA 2UVWA 4RPXA 3GV8B 1ZJMA 8ICAA 4RUAA 4O0IA 1JMSA 5IIOA 4RNOA 3LK9A 4ECZA 4RQ6A 5IIJA 3MBYA 4F5QA 4J9SA 4EEYA 2BCSA 4JWNA 2KFNA 1NJYA 9ICUA 3FYHA 4M6WB 2BQRA 5J0QA 3EW9A 5J2BA 4B9TA 4K4IA 2W9AA 5KTQA 3K75D 4O3QA 4DOAA 5DG8A 2XGQA 3BDPA 1ZQQA 2R8HA 5J29A 4DOBA 1BGXT 2BHNA 3JPPA 3PX4A 3Q8QB 4ELTA 4F92B 2W9BA 3AUOA 5J2EA 3C23A 4KLLA 4F4WA 3QZ7A 4FS1A 3PW5A 4NLKA 1JX4A 7ICPA 4B9NA 3RAXA 1TK5A 5DDYA 4RQ7A 4PHEA 4DFKA 5DBCA 3TQ1A 2BPFA 4KLFA 4I2IA 3G6YA 8ICBA 5IIKA 1X9WA 5D46A 3NTUA 3RJEA 3IM1A 3QZ8A 1T3NA 1QLNA 7ICTA 1TFRA 4KLOA 4B9UA 2ZTDA 3BQ0A 3HX0A 4ED1A 4PHDA 5BOLA 5DLGA 3C5GA 1COOA 1SL2A 2HVHA 4YN4A 2HHQA 3PW2A 2J6TA 4Z6FA 2B21A 5KFCA 4DSKA 7ICIA 2MUTA 4XRHA 4NLNA 4MFAA 2BQUA 1RYSA 4KLMA 2DFLA 4LVSA 1ZQXA 5KT2A 4ED3A 3JPOA 3PR5B 5IILA 2ZUCA 3HP6A 5KFQA 3PW0A 1ZQEA 4X5VA 4J9NA 1NKCA 3OJSA 8ICCA 1KLNA 5EWEA 2BR0A 4I2BA 4P2HA 5KFWA 9ICIA 4QWEA 1BPYA 2KTQA 9ICGA 5DQIA 1KFSA 7ICUA 3ZDAA 5J2GA 3Q8PB 4MFFA 2HW3A 2MUTB 4DS5A 2ISPA 5KT7A 4KLSA 3MGHA 1NK8A 4Z6DA 5KG4A 2ZUDA 3H8JA 4QZ9A 4LZGA 8ICVA 5KT6A 1XSNA 1U4BA 1X9SA 1ZQZA 4O5EA 2F1JA 1V9PA 4DQPA 8ICMA 4UBBA 4F5NA 3ZDDA 4KLJA 4IQUA 4QZDA 1XSLA 1ZQCA 3RB6A 1DGSA 5EWGA 3RTVA 5J0TA 4YD2A 1NK6A 1BPXA 2AJQA 2ASJA 1X9MA 3EPGA 1JXEA 4QZGA 4F5PA 1TK8A 3MR2A 5F9LA 2OWOA 4FO6A 1ZQJA 4NXZA 4MF2A 2P6RA 4KLHA 4F4ZA 9ICQA 2PFQA 3KTQA 1SZPA 3KHGA 2A1JA 3SYZA 1NK4A 5KT3A 2C2RA 1TAUA 1U48A 3JPNA 8ICRA 4KLDA 1C7YA 8ICJA 5J0RA 4RQ4A 4I2HA 3EYZA 2PI5A 4J9RA 4NLGA 5HP4A 4DSLA 4IQVA 4PH5A 5HNKA 1KFDA 2KZ3A 4DSIA 4F5RA 4I2JA 1BPEA 1X2IA 3M9MB 3H4DA 2PXIA 3Q8MA 4UQGA 4C8LA 3GFKB 4IRDA 3UXOA 5J2DA 1ZQDA 3V7LA 2ASDA 1XS9D 4ZH4A 4QZ8A 3LWMA 9ICJA 4J9KA 4R63A 4TUQA 2XC9A 5DLFA 5IINA 1Y88A 3ISDA 5KT5A 4EBCA 2XY5A 1B22A 1JXLA 4QW9A 1HJPA 4MFCA 3RRGA 2P66A 4PGXA 3HW8A 4JWMA 5KFEA 3GV5B 3V6KA 1NK7A 4FBTA 8ICWA 5J0YA 4PPXA 1KSPA 7ICNA 1RXWA 8ICPA 5J2KA 2PFPA 4RUCA 4RQ1A 2JZBA 5DBAA 4I2AA 3AU6A 4XA5A 3K4GA 3RH5A 3GIIA 2BDPA 4JUZA 1SKRA 4HYKA 1RZTA 2FMSA 2XO7A 3RRHA 1ZJNA 1SL0A 2JEIA 4QZFA 4RPYA 4I29A 4BXOA 2BCVA 1TV9A 4I2GA 2J6SA 2P6UA 4JV1A 5KFLA 4KLUA 1SKWA 3RR7A 5J0OA 4DL4A 2HHTA 1TVAA 1UA1A 8ICYA 3TFSA 2V9WA 2JZBB 1L5UA 4YD1A 5KFDA 5KFMA 1ZETA 1HUZA 4C8OA 1N48A 1S97A 8ICTA 5KFKA 4ED2A 2DPJA 4O3OA 3C1YA 9ICVA 4TQSA 4BXOB 9ICSA 2ATLA 3UQ0A 4Q45A 1NJWA 4R8UA 4UB2A 4GXIA 8ICGA 9ICWA 5J2JA 3PW4A 3PX0A 2KFZA 8ICNA 5J0WA 4F4YA 4RQ8A 5KFHA 4C8KA 4QZEA 3SZ2A 5CP2A 4DL2A 4DL5A 2PFOA 9ICMA 5L1KA 2W9MA 4B9VA 2LYHA 5HMMA 4RQ0A 3JPTA 9ICHA 4E0DA 2DPIA 2ZUBA 1XU4A 2JEGA 4F4XA 5CR0A 5L1LA 4EBDA 2FMPA 3V72A 2VA8A 2V4QA 3MFIA 4R8UB 5J2FA 3ISCA 1N56A 1S77D 5KT4A 1NK5A 3KHLA 4F3OA 1XC9A 3PMNA 9ICTA 3N97B 3RB0A 2R8KA 2C28A 9ICCA 5HHIA 1KRPA 2R8GA 5TZVA 3PR4A 4R66A 1T4GA 1L3VA 4TUPA 3UPQA 3RH4A 1TKDA 4GLXA 4DQSA 4CCHA 4M47A 4J9OA 2BPGA 5KG2A 2PFNA 4NM1A 3IHQB 5DB8A 1BPZA 2ZTCA 1WCLA 4XUSA 1L3SA 1MQ3A 8ICZA 8ICIA 2FPKA 2NRZA 4IQWA 3BQTA 4PGYA 2AGPA 3MGIA 1BVSA 4KMUA 4UB4A 2NRTA 4QWCA 3G6VA 4EZ9A 1Z00B 4RNNA 4Q44A 4O5KA 3QE9Y 3ZD8A 1ZQRA 4C8NA 2NRWA 5KFBA 4M9NA 3QEAZ 4UAZA 3GIKA 4DQIA 4F8RA 4P4OA 1QTMA 3MR6A 5L1JA 4ED6A 3PY8A 4ECSA 1SKSA 3Q8LA 4EYIB 3ZD9A 2HHSA 7ICOA 3FDSA 2V4RA 5DB6A 4ECTA 7ICJA 2IHMA 1KDHA 3M8RA 4RNMA 1D9FA 4TUSA 1L3TA 4F2SA 2XY6A 3OHAA 3THVA 1ZQWA 2HHVA 3PMLA 1BPDA 2H5XA 1UT5A 4UB5A 3JPSA 4YMNA 5CB1A 2W8LA 3H8WA 4O5CA 2HHWA 1IM4A 3T5HA 7ICSA 2BGWA 2NRVA 1K1QA 3Q8SB 4RQ2A 4MF8A 5JUMA 4PHAA 3TAPA 1ZQGA 3RAQA 5IIIA 4I2EA 4ECYA 5CA7A 1UA0A 5J0XA 4F4KA 5DQHA 4YG2A 2IBKA 4ED8A 4B9MA 3MDAA 1S0MA 1NKEA 4Q8EA 1ZQSA 4BGDA 5KFOA 4GXKA 2FMQA 5KFGA 4YFKA 1TK0A 3TARA 4DL3A 2JEJA 4GC6A 3TANA 2BPCA 5DB7A 2VA2A 5DG9A 4QW8A 3G6XA 2ZJ5A 3OHBA 1U45A 3RJFA 4P4MA 2BCQA 3LDAA 3HPOA 1MQ2A 1ZQFA 1A77A 3EZ5A 4DLEA 4M9HA 1TAQA 4Q8FA 3SV3A 5CJ7A 1QSYA 2FLLA 4GC7A 4FBUA 3H7IA 4UAYA 2JEFA 1T8EA 1NOMA 5IIMA 3TAQA 1ZQLA 4DEZA 5KFIA 4QZBA 3V7KA 1L3UA 4EZ6A 9ICFA 2GWSA 3LWLA 3E2EA 3H8SA 5KG0A 3H4BA 4M9LA 1UT8A 4YP3A 4RPZA 5CHGA 1B43A 4M0AA 5BOMA 9ICNA 5KG7A 1S0VA 3OSNA 4P4PA 5C5JA 2HHXA 4C8MA 4R65A 5EWFA 1U49A 3RJJA 3V6JA 4ECVA 1WCNA 2UVRA 2KZZA 1XWLA 5KG3A 4DF8A 3OSPA 3HT3A 1CUKA 3C2KA 1S10A 3BQ1A 2R8IA 3RJHA 4QWBA 2UVVA 2RDJA 3PVXA 4KN7A 4IR9A 4JK1A 1PZNA 4QWDA 5J2IA 5J0UA 9ICEA 4G3IA 3SV4A 3SI8A 1U47A 2C2EA 3RJKA 3T5LA 9ICAA 2BKEA 3B0XA 5KG5A 4DWIA 4YQWA 4Z6EA 1U9LA 3KHHA 3PV8A 3V6HA 4RT2A 2XCPA 9ICBA 4YR0A 2I9GA 4DS4A 3Q8KA 4YR2A 2KN7A 2FPLA 5KFZA 3JPQA 1ZQKA 2FPMA 3EPIA 3UXPA 1D8YA 3QEBZ 3RBEA 4M9JA 4DF4A 4ECWA 4YMOA 1D8LA 4LZDA 2Y1JA 1HUOA 1ZQYA 4PGQA 3GIJA 3C2LA 4KTQA 4NY8A 2FLNA 2MAXA 4RQ3A 2AGOA 4ECXA 3PO4A 3RJGA 2BCUA 4KLTA 1S76D 4BWJA 4BWMA 4DFMA 2AU0A 3GV7B 2IHNA 3TFRA 4O3RA 2ASLA 5L9XA 1KTQA 5KFSA 4K4GA 2XY7A 3RB4A 7ICRA 5DDMA 1ZQHA 3AU2A 4F2RA 8ICQA 3ETLA 1S9FA 4RT3A 1Z00A 4UB1A 9ICLA 4I27A 7ICVA 5KFNA 9ICXA 3ORYA 4TURA 4DO9A 1XSPA 3GILA 4KLQA 1ZYQA 1AROP 3M9NB 7ICHA 7ICEA 3ISBA 4O9MA 1JIHA 4JV2A 1DOQA 1ZQUA 4YMMA 1ZQMA 4M2YA 3ZDCA 5DGBA 3KHRA 4DQRA 4F91B 5J2HA 2ISOA 3C2MA 2AGQA 2ZJ8A 4EYHB 3RH6A 7ICMA 7ICFA 5CWRA 4RU9A 1ZQVA 4RQ5A 3RJIA 1CEZA 4ELVA 4UAWA 1SL1A 2BQ3A 4F50A 4ED7A 3GQCA 4DSFA 3RB3A 1ZQOA 1NJXA 3PNCA 2ZTEA 3C21A 5KFXA 3C1ZA 5KG6A 5J2CA 5HMLA 2C22A 1BPBA 2W9BB 1Z3EB 4YCXA 1RXVA 3M8SA 3BQ2A 2C2DA 1ZQTA 2VA3A 3C5FA 4I2FA 2WTFA 4ECUA 5KFTA 4B9SA 4J9LA
chains in the Genus database with same CATH superfamily
1LV5A 3DDHA 2NO5A 5G5HA 4DSJA 2FJ6A 5EOZA 4Q43A 4F93B 1S0OA 2E5SA 2HBKA 2RQ5A 4F5OA 2PKEA 4IRKA 3D2SA 3OJUA 5J0PA 4OJLA 5D4BA 4O3SA 1RM6C 4F72A 1ZQPA 2E3TA 2JMGA 4DSEA 3I76A 3UMBA 3K1RB 4J9MA 3WK7A 1EXNA 2UVUA 4MEYA 1Q3VA 2KVCA 4DOCA 4YR3A 3MR3A 3SQIA 5BPCA 3HWTA 3ZDEA 2WFAA 1WYGA 5DKWA 4QZHA 1F44A 1ZQBA 3MDCA 3UXNA 4CF4A 1DK2A 1RYRA 3TI0A 2Q0ZX 2DKZA 1ZRMA 3MABA 8ICOA 4UBCA 1JN3A 2HSZA 2XCAA 4Z6CA 5J0SA 4TQRA 4IRCA 1MN8A 2R8JA 5J2AA 3H40A 5KFJA 5DG7A 1A76A 3V7JA 7ICQA 2F8KA 4YXMA 3T5JA 1NJZA 2F3NA 3IDWA 2DQNB 3RBDA 5HHHA 4KLIA 2AH5A 5DGAA 3SAFA 3TACB 3WKCA 4C4RA 1KEJA 3PO5A 4B9LA 5KFFA 7ICLA 1MSWD 3AEVA 1ZJMA 3AMZA 8ICAA 4RUAA 5IIOA 3LK9A 2GLEA 1ZD5A 4F5QA 3IN5A 1JALA 4M6WB 5J0QA 2K4IA 2QB0A 4K4IA 3K75D 4O3QA 5DG8A 2XGQA 1ZQQA 2R8HA 4KX3A 4DOBA 2WAQC 2F8LA 1L8LA 4KLLA 1DXSA 3BS5A 4FS1A 1JX4A 2MA1A 1TK5A 2KHQA 5DDYA 2ES6A 2PMZF 4KLFA 8ICBA 3ED5A 5IIKA 5FP0A 1QLNA 7ICTA 2YMLA 2AHOB 4KLOA 3HX0A 4ED1A 3QUBA 5BOLA 2EANA 2KD1A 2J6TA 5KFCA 4DSKA 2FE9A 4KLMA 2DFLA 4HAIA 4MHVA 2E8NA 4DCCA 4CE6A 1ZQXA 4ED3A 1UPHA 2GO7A 5ALOA 2KHVA 5AI4A 5KAIU 3PW0A 4X5VA 1Z1BA 3HJEA 4JB3A 4P2HA 4I2BA 2ZG6A 1BPYA 5AKGA 2LM1A 5J2GA 2HW3A 2RLTA 1NK8A 4Z6DA 2PMZC 2YB1A 1U4BA 8ICMA 1GO3F 4UBBA 4F5NA 3ZDDA 2YTUA 4QZDA 3RB6A 1DRGA 4QZGA 1TK8A 1SB3C 5F9LA 4FO6A 2GOLA 4Y2QA 3JPNA 1U48A 4RQ4A 1LVHA 5HP4A 1Z4NA 4PH5A 3KOOA 5EE9A 4BJQA 1PUZA 3Q8MA 3GFKB 3HKZC 5B5EU 3LWMA 9ICJA 4J9KA 3TADC 2XC9A 4EBCA 1X6IA 3RRGA 2P66A 4PGXA 3V6KA 1TE2A 5AM3A 7ICNA 4USAA 1FIQA 5HR7A 2W7OA 1F0MA 1ZD3A 1SKRA 2OXOA 1RZTA 2FMSA 1B0XA 2H3FA 1SL0A 2JEIA 3PSIA 4JV1A 2ZXHA 3OPXA 3TFSA 2V9WA 2JZBB 2R18A 1HUZA 4C8OA 1S97A 4DFDA 3J81j 4B6JA 1NJWA 2E1EA 5A0LA 1JUDA 1RYUA 2KFZA 2RHFA 5J0WA 4C8KA 4QZEA 5ALNA 2PFOA 1WWVA 3JPTA 3HRDD 2ZIUB 2ZUBA 2JEGA 3CP8A 2KIWA 5L1LA 4EBDA 3V72A 1PK1A 5ALXA 5J2FA 1N56A 1NK5A 3KHLA 4F3OA 1XC9A 4EENA 3N97B 5AKLA 3RB0A 2A1AA 3PR4A 4R66A 1T4GA 4GLXA 2BZFA 5DB8A 1RQLA 4XUSA 1L3SA 4O3MA 8ICIA 4IQWA 1BVSA 2OCEA 2Z7JA 2NRTA 4QWCA 3G6VA 3QE9Y 3ICXA 2QARA 5L1JA 4ECSA 1SKSA 2DWQA 2WB1C 1N62A 4EYIB 3WK8A 2KSOA 1KDHA 5ALVA 2XY6A 3OHAA 1UT5A 5JRTA 1NI3A 2W8LA 1VLBA 3TAPA 5CA7A 4F4KA 3WKEA 1DK3A 1S0MA 5KL8B 3NRZA 2D8CA 2YX8A 5KFGA 1TK0A 3SAGA 4QW8A 1SV4A 3G6XA 1U45A 5ALIA 2BCQA 1ZQFA 1MQ2A 4M9HA 3SV3A 2FLLA 4GC7A 4UAYA 5F3XB 1SXDA 9ICFA 1CI4A 3E2EA 3H4BA 5BOMA 5KG7A 2W3SA 4C8MA 3RJJA 3V6JA 1S10A 3NVZA 4QWBA 2UVVA 3PVXA 4KN7A 4JK1A 2A3VA 5J2IA 3SI8A 1U47A 2C2EA 3B0XA 4Z6EA 3PV8A 2XCPA 4YR0A 5EE3A 2I9GA 1D8YA 5J8YA 3PSTA 4M9JA 4YMOA 1SV0C 4RQ3A 4Y2PA 3QU2A 4BWJA 5ALFA 2AU0A 4O3RA 1N60A 5L9XA 4K4GA 2E8OA 2XY7A 1PVPA 4OJ6A 5DDMA 3FM9A 3F2CA 1S9FA 7ICVA 2H3VA 4KLQA 1ZYQA 3M9NB 7ICHA 3ISBA 4O9MA 1JIHA 4JV2A 1ZQUA 1FO4A 4UB8U 3ZI4A 4DQRA 4F91B 2ZJ8A 4EYHB 4UAUA 4RU9A 3RJIA 2XIDA 4Y2SA 1CEZA 2HOIA 4UAWA 2BQ3A 4US8A 2YQEA 1UQVA 5C0YA 2A19A 2HMXA 5J2CA 3M1YA 1Z3EB 2C2DA 3F5EA 1ZQTA 1L8OA 3IG8A 2PI4A 5D49A 3CNHA 2ALZA 2HVIA 8ICSA 4WJ3B 2N1RA 4YXJA 2NRXA 2EAOA 1S0NA 3KKAA 1D8BA 1NKBA 3LVVA 5KFRA 2FLPA 4O3NA 3JPRA 2LYBA 4QWAA 9ICOA 4K4HA 3GU3A 3RR8A 8ICFA 5DB9A 2AQ4A 2NYVA 1K1SA 5ALHA 2M9NA 1KW4A 1H38A 4C7ZA 2BCRA 5E79U 1L7NA 2LHTA 4OJPA 3L3FX 4OJ5A 4ELUA 1FEZA 4OD0A 2IA6A 8ICLA 1URJA 1L6NA 2OM6A 2DGZA 3PSPA 2W9CA 5KFVA 3NGDA 2K60A 8ICKA 3GDXA 5KFPA 4FFDA 5ALGA 3MFHA 4MEXA 1AQ6A 4UB3A 1COKA 5IIJA 3MBYA 2KFNA 4EEYA 1NJYA 3FYHA 2HDOA 2MSNA 2OYYA 4KMOB 4QJFB 4DOAA 3AN1A 3KZIU 1BGXT 2BHNA 2B6GA 3PX4A 3VC8A 3Q8QB 2H3ZA 3AUOA 3B9JA 5J2EA 3KBBA 5JU5A 4C0ZA 3PW5A 4NLKA 3QYPA 3RAXA 4RQMA 2QB0B 4Y2JA 5DBCA 4FZNA 1X9WA 5D46A 3IM1A 3QZ8A 1TFRA 2KJ5A 3BQ0A 4PHDA 1SL2A 4YN4A 3PW2A 1OUQA 2B21A 4XRHA 5AIBA 3BS5B 2BQUA 4UATA 4BX9C 1NZBA 2EZZA 3PR5B 4NJ8A 2H3QA 1ZQEA 3SENA 2LKYA 1KLNA 3UM9A 2ISPA 4KLSA 5KT7A 8ICGA 3M7DA 3H0RB 5KG4A 4QZ9A 3H8JA 8ICVA 5KT6A 4O5EA 2G06A 1ZQZA 2FDRA 2F1JA 2KK0A 1DGSA 3RTVA 2AJQA 1JXEA 4F5PA 1WG8A 3MR2A 5EE0A 3KTQA 1NK4A 2HBMA 8ICRA 8ICJA 4AYBF 4J9RA 4NLGA 5HNKA 3I1YA 5AK5A 3H4DA 3UXOA 2E8PA 1KL9A 2JR5A 3V7LA 2ASDA 4R63A 2JXJA 1JXLA 1HJPA 4MFCA 2DKXA 1HEKA 1SXEA 3QXGA 5KFEA 2EQYA 4FBTA 5J2KA 4EEKA 4RQ1A 3WK6A 3AU6A 3GIIA 2XO7A 3RRHA 4RPYA 4PZOA 2OEHA 5ALJA 2L5YA 1SKWA 2EAPA 2YMMA 2CPRA 2K4PA 1ZETA 1N48A 2W11A 5KFKA 4ED2A 1TAMA 4O3OA 4UW9A 1BNOA 8ICNA 3SZ2A 2JRZA 2W04A 9ICMA 4B9VA 2W9MA 1L7PA 4CDGA 1SWVA 2DPIA 1XU4A 2Y0SF 3MGVA 3QU4A 2VA8A 2V4QA 3QU9A 5ALRA 1S77D 2R8KA 3F2BA 5HHIA 2R8GA 1QQ7A 3RH4A 1TKDA 4CCHA 4DQSA 1V85A 5KG2A 2ZTCA 3O0FA 2FPKA 2F76X 4PGYA 3MGIA 1PK1B 4UB4A 4EZ9A 1XNSA 4O5KA 3ZD8A 3N28A 4M9NA 3GIKA 4F8RA 4P4OA 4ED6A 3PY8A 3Q8LA 2QKQA 2HHSA 2E8MA 2Y0SC 4ECTA 4U7CA 7ICJA 1YT3A 2IOFK 1D9FA 1IV8A 4TUSA 1L3TA 4F2SA 3THVA 1ZQWA 2H5XA 4UB5A 2LYAA 4YMNA 3H8WA 1IM4A 2QARB 5T14A 4RQ2A 4MF8A 4NL9C 4I2EA 2G5IB 3MDAA 2KSOB 2FMQA 4YFKA 3TARA 4GC6A 3TANA 2BPCA 2VA2A 5DG9A 2KVSA 3OHBA 4P0QA 3C28A 2WF9A 1TAQA 5AHXA 4PL1A 1OXJA 1SWWA 4FBUA 3ALRA 3H7IA 1NOMA 4UAVA 5IIMA 1ZQLA 1L3UA 2HBLA 4US9A 5KG0A 4M0AA 4RPZA 4OCZA 4Y2VA 4P4PA 2HHXA 3NVYA 4FZLA 5AM4A 4ECVA 3SAHA 4PL2A 3HT3A 3BQ1A 1DGJA 1PZNA 4QWDA 4G3IA 3SV4A 9ICAA 2BKEA 5KG5A 4DWIA 1ED1A 3JPQA 5KFZA 1ZQKA 3EPIA 3QEBZ 3RBEA 4ECWA 1Q8KA 3FC4A 2Y1JA 1ZQYA 2AGOA 3AQFA 2BCUA 4KLTA 3K1ZA 3GV7B 3TFRA 3RB4A 7ICRA 1ZQHA 3NASA 3H0LB 2D6FC 8ICQA 2ZIXA 4RT3A 2JH1A 4I27A 9ICXA 1XSPA 4DO9A 3GILA 2JGAA 1AROP 7ICEA 5ALQA 1PVRA 1O03A 3ZDCA 5DGBA 5ALMA 5CWRA 4RQ5A 5GTHU 1SL1A 4F50A 4DSFA 3RB3A 1NJXA 1X6JA 5ALWA 2ZTEA 5AM5A 3C1ZA 5KG6A 2LI6A 1KKXA 1BPBA 2W9BB 3BQ2A 3AQEA 2VA3A 3R9KA 4I2FA 2EZXA 4DQIA 5KFTA 2XGPA 4R64A 1RG6A 3IV6A 4KLGA 4FE3A 3WK9A 3NVWA 1QSSA 4NLZA 2ZIWA 4LJXA 1NK0A 2AQ0A 2Y1IA 1NK9A 3N4MB 2G09A 1ZRNA 5KL1B 2K8AA 2I1QA 2RDIA 4DQQA 3T3FA 5DBBA 8ICXA 1P7DA 4QZIA 3PSFA 5B66U 2VIXA 4DFPA 2W7PA 3M9OB 3UQ2A 5F9NA 4DFJA 4JMUA 4YVZA 1D9DA 4JV0A 5ALYA 1YZ6A 5L1IA 4I28A 1HIWA 2J6UA 2HHUA 2HOFA 2ZJAA 3MR5A 4GXJA 1QSLA 4BDPA 1X9XA 2KMDA 5DQGA 4KLEA 4NWIA 3BJYA 5CRXA 4EBEA 3Q8RB 3T5KA 1Q46A 4NM2A 1L7OA 2AXTU 2WF5A 4ED0A 4FS2A 1V38A 3IG5A 4DL6A 1IXRA 1LKYA 1T7PA 4OJOA 4J9PA 3ZDBA 5KFAA 5KFUA 1ZQAA 4M9GA 1ECWA 1QH9A 1X40A 2KZMA 2W9CB 1LB2B 1MC8A 1ZQNA 2UVWA 4RPXA 2MRLA 1QQ6A 5K4LA 4O0IA 4ECZA 2BCSA 4J9SA 9ICUA 4J03A 4B9TA 5J2BA 3OTQA 4CRXA 3BDPA 1N63A 3JPPA 4OO1J 3F5AA 2K4HA 2W9BA 4F4WA 3QZ7A 3UMCA 4B9NA 4DFKA 3TQ1A 3G6YA 3RJEA 1T3NA 5AKEA 1RDFA 4B9UA 1NNLA 5DLGA 3C5GA 1COOA 1N5WA 3L5KA 2CRXA 2MUTA 4NLNA 1A0PA 1RYSA 2W03A 4LVSA 3QU7A 2XI9A 3JPOA 1PK3A 2ZUCA 3HP6A 2KV2A 4C4TA 4J9NA 1NKCA 3OJSA 4C7YA 5AM0A 3L4PA 9ICIA 1Q3UA 2KTQA 9ICGA 2RP5A 5DQIA 3ZDAA 3Q8PB 2BDUA 4DS5A 2ZUDA 1IIPA 2ZIVB 1X9SA 4Y2YA 1V9PA 2KE7A 1M6YA 4KLJA 1XSLA 1ZQCA 5J0TA 4YD2A 1NK6A 4BUGA 3EPGA 2OWOA 2Y9TA 2Q4TA 2P6RA 4MF2A 1K5OA 2WHEA 4F4ZA 3LYSA 2PFQA 3KHGA 1TAUA 2C2RA 1C7YA 5J0RA 3GZFA 3EYZA 4DSLA 4F5RA 1BPEA 2PXIA 4UQGA 4C8LA 1SV0A 3ONNA 4ZH4A 3N7SC 4QZ8A 4TUQA 3BZKA 5IINA 1Y88A 3WKBA 3ISDA 5KT5A 5ALEA 4QW9A 5AI5A 2XVTA 4JWMA 1RQNA 5J0YA 2ESEA 4PPXA 1RXWA 1ZXIA 2G07A 4RUCA 4P0PB 2Y9UA 4XA5A 4JUZA 4I29A 4BXOA 3N7PD 4I2GA 2P6UA 1J2NA 4NLCA 4PJ0U 5J0OA 2HHTA 1TVAA 2G5HB 1UA1A 8ICYA 1ZOLA 2G08A 4YD1A 5KFDA 5KFMA 2JV3A 4RQNA 8ICTA 1N2XA 2DPJA 3C1YA 9ICVA 4TQSA 9ICSA 4Q45A 4NV0A 4R8UA 4GXIA 5HR6A 3PW4A 1S5LU 4RQ8A 5KFHA 5CP2A 4DL5A 1X42A 5L1KA 2LYHA 2K4EA 4RQ0A 1MA7A 4E0DA 4F4XA 1SGGA 4CGZA 5CR0A 2FMPA 2FI1A 3ISCA 1KQQA 2C28A 9ICCA 1L3VA 2ZIVA 3UPQA 4M47A 2JHDA 2BPGA 2PFNA 4NM1A 1NZPA 2NRZA 3BQTA 2AGPA 2RRDA 3E58A 1Z00B 4RNNA 2NRWA 4UAZA 1C20A 1QTMA 3MR6A 5CEHA 1J2MA 7ICOA 2V4RA 5DB6A 3F53A 4UB6U 3M8RA 2HHVA 3QNMA 5ALDA 2HCFA 3QX7A 3JPSA 5ALZA 4O5CA 2BGWA 3Q8SB 1ZQGA 3RAQA 5IIIA 1UA0A 5J0XA 4ED8A 4Q8EA 1NKEA 1ZD4A 1ZQSA 5AKKA 4NLBA 5AKXA 4I2CA 2JEJA 5DB7A 2ZJ5A 2W3RA 3PZPA 4P0PA 3KZXA 1J97A 3RJFA 3WK5A 3EZ5A 4DLEA 2YMQA 1QSYA 5ALSA 3TAQA 4DEZA 4QZBA 2GWSA 3LWLA 3H8SA 2VJ5A 4M9LA 1UT8A 4YP3A 3I28A 9ICNA 3M6ZA 2K89A 3OSNA 3CYMA 3WK4A 4R65A 4P0QB 1U49A 2KZZA 1WCNA 1XWLA 4DF8A 3VCBA 1CUKA 4AYBC 2R8IA 2RDJA 3WKAA 3RJKA 2KOBA 2WAQF 1U9LA 2K8CB 2WF6A 4RT2A 9ICBA 3DV9A 4DS4A 2LM4A 3EUB2 3UXPA 2W54A 5AM1A 4DF4A 2O6KA 1WUDA 1FFVA 1D8LA 4LZDA 1HUOA 3GIJA 3C2LA 4NY8A 2KEYA 2FLNA 4ECXA 3PO4A 1N5XA 1QCKA 1S76D 4BWMA 4DFMA 2IHNA 3F2DA 3D2NA 2ASLA 1VJ5A 5KFSA 3AU2A 1CRXA 1N61A 1Z00A 3ORYA 2W55A 1DOQA 4YMMA 3KHRA 5J2HA 3C2MA 4UARA 3RH6A 7ICMA 1ZQVA 4ED7A 2B0CA 1ZQOA 2ZIXB 3C21A 5KFXA 5HMLA 2C22A 2CN1A 5ALLA 1VDVA 1RXVA 2WTFA 5AKZA 4ECUA 7ICFA 4J9LA 4ECQA 2GH1A 1SZHA 4KN4A 4J9QA 2VANA 1Z1VA 3OGUA 4KITB 2W8KA 4M04A 4PHPA 4IQTA 3HKZF 2IOHA 5KG1A 4QZCA 8ICEA 3KD3A 1T3QA 3B0YA 2NV3A 5AKHA 1KFTA 3C29A 8ICUA 1X66A 4ACOA 2IMWP 1XO0A 3PX6A 1L7MA 2YN4A 2ZIWB 4DLGA 1RPLA 4I2DA 4QZAA 5AKJA 3SR6A 2F1IA 2F44A 8ICHA 1A6SA 7ICGA 4IR1A 3EWAA 2F1HA 3PW7A 9ICRA 4IL6U 7ICKA 1XO1A 4ECRA 5EE1A 9ICKA 2A1JB 1ZQIA 3SD7A 4RZRA 4DL7A 4CF5A 9ICPA 1S8OA 5AKYA 2ODGA 5KFYA 4M6WA 1JI7A 3LVWA 3GIMA 3U26A 1SIJA 3BQ7A 4O3PA 4XQ8A 2DBYA 3E0FA 2DUYA 3GV8B 1JMSA 3A0HU 1O08A 2OH2A 4RNOA 4RQ6A 4JWNA 2JH7A 1ZD2P 4QNLA 2BQRA 3QUCA 3EW9A 5AKIA 2W9AA 5KTQA 1KBUA 1LKYB 5J29A 3SMVA 2MU2A 2KIVA 3QU5A 4ELTA 4F92B 3C23A 5JTIA 4U6PA 7ICPA 2VKQA 4RQ7A 4PHEA 2HBJA 2I5HA 2BPFA 4I2IA 2WB1F 4QIWF 4NL9A 3NTUA 4ZOHC 2ZTDA 5ALTA 4C4SA 2HHQA 2HVHA 4KX5A 3AM9A 4Z6FA 3IRUA 7ICIA 2EDUA 4MFAA 5J8YC 5KT2A 5IILA 3TADA 5KFQA 3AL0B 5KAFU 3KFUF 8ICCA 5G5GA 2DL0A 5EWEA 2BR0A 3MC1A 5KFWA 4QWEA 2DF4B 1KFSA 7ICUA 4MFFA 5ALUA 2MUTB 3MGHA 5AI6A 1XSNA 1FFUA 3QUQA 4QIWC 4DQPA 3RFAA 4IQUA 5KNIA 5EWGA 5ALPA 1BPXA 2W43A 2ASJA 1X9MA 7ICSA 4KLHA 2KNJA 2ZXIA 1ZQJA 4NXZA 9ICQA 4UASA 3NVVA 1SZPA 3SYZA 2A1JA 5KT3A 3H0MB 4KLDA 5AI9A 4I2HA 2PI5A 3CW2C 4IQVA 1KFDA 2KZ3A 3NRWA 4DSIA 4GFJA 4I2JA 5AK3A 1X2IA 3M9MB 4EX7A 4IRDA 5J2DA 1ZQDA 1XS9D 2YB4A 5TISU 4Y2UA 5DLFA 3HILA 2XY5A 1B22A 3KKAC 2K8BB 2LBOA 1BNPA 3HW8A 8ICWA 1NK7A 3GV5B 1KSPA 2KKPA 8ICPA 2PFPA 3CRXA 2JZBA 5DBAA 4I2AA 3K4GA 3RH5A 5ALKA 2BDPA 4HYKA 2EZYA 1ZJNA 2E1FA 4QZFA 2BCVA 1TV9A 2J6SA 3UMGA 5KFLA 4KLUA 4ICAA 3ETRA 3RR7A 4DL4A 1L5UA 4CF3A 2ZIUA 2WF7A 4EX6A 1Z4OA 2H3IA 4BXOB 2ATLA 1UHUA 3UQ0A 4UB2A 9ICWA 5J2JA 3PX0A 2YMPA 4F4YA 5AK4A 4DL2A 1YZ7A 5HMMA 3DEEA 9ICHA 4Y2TA 1B4FA 3MFIA 4R8UB 1F5SA 5KT4A 2KKVA 3PMNA 9ICTA 2F2AB 3SEIA 1KRPA 5TZVA 3NUQA 3WKDA 4TUPA 4J9OA 3IHQB 1BPZA 2WF8A 1WCLA 2QB1A 1MQ3A 4PZNA 8ICZA 4KMUA 3H8MA 3D2QA 4Q44A 5AICA 4EELA 1ZQRA 4C8NA 5KFBA 3QEAZ 3D6JA 3FAHA 2HOQA 2CXYA 4AP9A 3ZD9A 1PVQA 3FDSA 2M0NA 2IHMA 5AK6A 2KJ8A 4RNMA 4FZMA 5AI8A 2HI0A 5H2FU 3PMLA 2I6XA 1BPDA 3T79A 3S6JA 5CB1A 3NS1A 2HHWA 1Z19A 3T5HA 3N7RC 2NRVA 1K1QA 5JUMA 4PHAA 4ECYA 5DQHA 4YG2A 4G9BA 2IBKA 4B9MA 4Y2RA 2XICA 4BGDA 5KFOA 4GXKA 4LZGA 4DL3A 2QLTA 1UCVA 4IC9A 4P4MA 3LDAA 3HPOA 1A77A 4Q8FA 2EH9A 5CJ7A 2D3DA 5AM2A 2JEFA 4F71A 1T8EA 5KFIA 3V7KA 4EZ6A 3TKAA 3M6KA 5CHGA 1B43A 1S0VA 5C5JA 2NO4A 2KICA 5EWFA 2UVRA 2EAMA 2VJ4A 5KG3A 2KJ9A 3OSPA 3C2KA 3RJHA 2KG5A 4IR9A 4A8EA 9ICEA 5J0UA 4IS7A 1WWUA 2KP7A 1JROA 1QQ5A 3T5LA 5AI0A 3WU2U 5GTIU 4YQWA 2OHFA 3KHHA 3V6HA 1IG6A 3Q8KA 4Y2XA 3A0BU 4YR2A 2KN7A 2FPLA 3IP4B 2FPMA 1KN5A 2LPEA 4C80A 2P35A 3RF9A 1V97A 4PGQA 4KTQA 2MAXA 3RJGA 2YY6A 2LMRA 4CNQA 3BZCA 1T94A 1KTQA 5L1MA 2F77X 4GIBA 4F2RA 3ETLA 4UB1A 9ICLA 5KFNA 4TURA 3QUTA 1ZQ1C 4M2YA 1ZQMA 3BS7A 2ISOA 2AGQA 2G0AA 4ELVA 3GQCA 3PNCA 5AIAA 1JRPA 1OW5A 4YCXA 3M8SA 3C5FA 2IOFA 4B9SA
chains in the Genus database with same CATH topology
5D49A 4ECQA 2XGPA 2ALZA 1LV5A 2HVIA 8ICSA 4R64A 4YXJA 4KN4A 2NRXA 4J9QA 4KLGA 1S0NA 4DSJA 2VANA 5EOZA 4Q43A 4F93B 2PI4A 3OGUA 1S0OA 4KITB 2W8KA 1NKBA 4M04A 5KFRA 2FLPA 4F5OA 1QSSA 4O3NA 4IRKA 3JPRA 3OJUA 4PHPA 5J0PA 5D4BA 4NLZA 4IQTA 4O3SA 4QWAA 9ICOA 4K4HA 5KG1A 4QZCA 1NK0A 8ICEA 2AQ0A 3RR8A 1ZQPA 2Y1IA 1NK9A 3N4MB 8ICFA 3B0YA 4DSEA 4J9MA 5DB9A 2AQ4A 1KFTA 2I1QA 1K1SA 2RDIA 4DQQA 3T3FA 1EXNA 5DBBA 2UVUA 4MEYA 8ICUA 4QZIA 8ICXA 4DOCA 4YR3A 2M9NA 2IMWP 3PX6A 4DFPA 3MR3A 5BPCA 3HWTA 3M9OB 3UQ2A 5F9NA 3ZDEA 4DFJA 4DLGA 1H38A 4YVZA 1D9DA 5DKWA 4JV0A 4QZHA 2BCRA 1RPLA 4I2DA 5L1IA 1ZQBA 4I28A 4QZAA 3MDCA 3UXNA 2J6UA 2HHUA 2F1IA 1RYRA 3TI0A 8ICHA 2Q0ZX 3MABA 7ICGA 2ZJAA 8ICOA 4IR1A 3EWAA 4ELUA 3MR5A 4UBCA 4GXJA 1JN3A 2F1HA 3PW7A 1QSLA 4BDPA 9ICRA 2XCAA 7ICKA 1XO1A 2IA6A 4ECRA 9ICKA 2A1JB 1ZQIA 8ICLA 5DQGA 4RZRA 4Z6CA 5J0SA 4TQRA 4DL7A 4IRCA 4KLEA 9ICPA 2W9CA 2R8JA 5J2AA 3BJYA 3H40A 5KFVA 5KFJA 4EBEA 5DG7A 3Q8RB 1A76A 3V7JA 3T5KA 5KFYA 7ICQA 4YXMA 4NM2A 3T5JA 3NGDA 1NJZA 8ICKA 4ED0A 3GDXA 3RBDA 5KFPA 5HHHA 4FS2A 4KLIA 4M6WA 5DGAA 4DL6A 1IXRA 3MFHA 1KEJA 3PO5A 4MEXA 3GIMA 1T7PA 4B9LA 4UB3A 4J9PA 3ZDBA 5KFAA 5KFUA 4O3PA 4XQ8A 5KFFA 1ZQAA 4M9GA 1MSWD 7ICLA 4I2CA 2KZMA 2W9CB 1LB2B 1MC8A 1ZQNA 2UVWA 4RPXA 3GV8B 1ZJMA 8ICAA 4RUAA 4O0IA 1JMSA 5IIOA 4RNOA 3LK9A 4ECZA 4RQ6A 5IIJA 3MBYA 4F5QA 4J9SA 4EEYA 2BCSA 4JWNA 2KFNA 1NJYA 9ICUA 3FYHA 4M6WB 2BQRA 5J0QA 3EW9A 5J2BA 4B9TA 4K4IA 2W9AA 5KTQA 3K75D 4O3QA 4DOAA 5DG8A 2XGQA 3BDPA 1ZQQA 2R8HA 5J29A 4DOBA 1BGXT 2BHNA 3JPPA 3PX4A 3Q8QB 4ELTA 4F92B 2W9BA 3AUOA 5J2EA 3C23A 4KLLA 4F4WA 3QZ7A 4FS1A 3PW5A 4NLKA 1JX4A 7ICPA 4B9NA 3RAXA 1TK5A 5DDYA 4RQ7A 4PHEA 4DFKA 5DBCA 3TQ1A 2BPFA 4KLFA 4I2IA 3G6YA 8ICBA 5IIKA 1X9WA 5D46A 3NTUA 3RJEA 3IM1A 3QZ8A 1T3NA 1QLNA 7ICTA 1TFRA 4KLOA 4B9UA 2ZTDA 3BQ0A 3HX0A 4ED1A 4PHDA 5BOLA 5DLGA 3C5GA 1COOA 1SL2A 2HVHA 4YN4A 2HHQA 3PW2A 2J6TA 4Z6FA 2B21A 5KFCA 4DSKA 7ICIA 2MUTA 4XRHA 4NLNA 4MFAA 2BQUA 1RYSA 4KLMA 2DFLA 4LVSA 1ZQXA 5KT2A 4ED3A 3JPOA 3PR5B 5IILA 2ZUCA 3HP6A 5KFQA 3PW0A 1ZQEA 4X5VA 4J9NA 1NKCA 3OJSA 8ICCA 1KLNA 5EWEA 2BR0A 4I2BA 4P2HA 5KFWA 9ICIA 4QWEA 1BPYA 2KTQA 9ICGA 5DQIA 1KFSA 7ICUA 3ZDAA 5J2GA 3Q8PB 4MFFA 2HW3A 2MUTB 4DS5A 2ISPA 5KT7A 4KLSA 3MGHA 1NK8A 4Z6DA 5KG4A 2ZUDA 3H8JA 4QZ9A 4LZGA 8ICVA 5KT6A 1XSNA 1U4BA 1X9SA 1ZQZA 4O5EA 2F1JA 1V9PA 4DQPA 8ICMA 4UBBA 4F5NA 3ZDDA 4KLJA 4IQUA 4QZDA 1XSLA 1ZQCA 3RB6A 1DGSA 5EWGA 3RTVA 5J0TA 4YD2A 1NK6A 1BPXA 2AJQA 2ASJA 1X9MA 3EPGA 1JXEA 4QZGA 4F5PA 1TK8A 3MR2A 5F9LA 2OWOA 4FO6A 1ZQJA 4NXZA 4MF2A 2P6RA 4KLHA 4F4ZA 9ICQA 2PFQA 3KTQA 1SZPA 3KHGA 2A1JA 3SYZA 1NK4A 5KT3A 2C2RA 1TAUA 1U48A 3JPNA 8ICRA 4KLDA 1C7YA 8ICJA 5J0RA 4RQ4A 4I2HA 3EYZA 2PI5A 4J9RA 4NLGA 5HP4A 4DSLA 4IQVA 4PH5A 5HNKA 1KFDA 2KZ3A 4DSIA 4F5RA 4I2JA 1BPEA 1X2IA 3M9MB 3H4DA 2PXIA 3Q8MA 4UQGA 4C8LA 3GFKB 4IRDA 3UXOA 5J2DA 1ZQDA 3V7LA 2ASDA 1XS9D 4ZH4A 4QZ8A 3LWMA 9ICJA 4J9KA 4R63A 4TUQA 2XC9A 5DLFA 5IINA 1Y88A 3ISDA 5KT5A 4EBCA 2XY5A 1B22A 1JXLA 4QW9A 1HJPA 4MFCA 3RRGA 2P66A 4PGXA 3HW8A 4JWMA 5KFEA 3GV5B 3V6KA 1NK7A 4FBTA 8ICWA 5J0YA 4PPXA 1KSPA 7ICNA 1RXWA 8ICPA 5J2KA 2PFPA 4RUCA 4RQ1A 2JZBA 5DBAA 4I2AA 3AU6A 4XA5A 3K4GA 3RH5A 3GIIA 2BDPA 4JUZA 1SKRA 4HYKA 1RZTA 2FMSA 2XO7A 3RRHA 1ZJNA 1SL0A 2JEIA 4QZFA 4RPYA 4I29A 4BXOA 2BCVA 1TV9A 4I2GA 2J6SA 2P6UA 4JV1A 5KFLA 4KLUA 1SKWA 3RR7A 5J0OA 4DL4A 2HHTA 1TVAA 1UA1A 8ICYA 3TFSA 2V9WA 2JZBB 1L5UA 4YD1A 5KFDA 5KFMA 1ZETA 1HUZA 4C8OA 1N48A 1S97A 8ICTA 5KFKA 4ED2A 2DPJA 4O3OA 3C1YA 9ICVA 4TQSA 4BXOB 9ICSA 2ATLA 3UQ0A 4Q45A 1NJWA 4R8UA 4UB2A 4GXIA 8ICGA 9ICWA 5J2JA 3PW4A 3PX0A 2KFZA 8ICNA 5J0WA 4F4YA 4RQ8A 5KFHA 4C8KA 4QZEA 3SZ2A 5CP2A 4DL2A 4DL5A 2PFOA 9ICMA 5L1KA 2W9MA 4B9VA 2LYHA 5HMMA 4RQ0A 3JPTA 9ICHA 4E0DA 2DPIA 2ZUBA 1XU4A 2JEGA 4F4XA 5CR0A 5L1LA 4EBDA 2FMPA 3V72A 2VA8A 2V4QA 3MFIA 4R8UB 5J2FA 3ISCA 1N56A 1S77D 5KT4A 1NK5A 3KHLA 4F3OA 1XC9A 3PMNA 9ICTA 3N97B 3RB0A 2R8KA 2C28A 9ICCA 5HHIA 1KRPA 2R8GA 5TZVA 3PR4A 4R66A 1T4GA 1L3VA 4TUPA 3UPQA 3RH4A 1TKDA 4GLXA 4DQSA 4CCHA 4M47A 4J9OA 2BPGA 5KG2A 2PFNA 4NM1A 3IHQB 5DB8A 1BPZA 2ZTCA 1WCLA 4XUSA 1L3SA 1MQ3A 8ICZA 8ICIA 2FPKA 2NRZA 4IQWA 3BQTA 4PGYA 2AGPA 3MGIA 1BVSA 4KMUA 4UB4A 2NRTA 4QWCA 3G6VA 4EZ9A 1Z00B 4RNNA 4Q44A 4O5KA 3QE9Y 3ZD8A 1ZQRA 4C8NA 2NRWA 5KFBA 4M9NA 3QEAZ 4UAZA 3GIKA 4DQIA 4F8RA 4P4OA 1QTMA 3MR6A 5L1JA 4ED6A 3PY8A 4ECSA 1SKSA 3Q8LA 4EYIB 3ZD9A 2HHSA 7ICOA 3FDSA 2V4RA 5DB6A 4ECTA 7ICJA 2IHMA 1KDHA 3M8RA 4RNMA 1D9FA 4TUSA 1L3TA 4F2SA 2XY6A 3OHAA 3THVA 1ZQWA 2HHVA 3PMLA 1BPDA 2H5XA 1UT5A 4UB5A 3JPSA 4YMNA 5CB1A 2W8LA 3H8WA 4O5CA 2HHWA 1IM4A 3T5HA 7ICSA 2BGWA 2NRVA 1K1QA 3Q8SB 4RQ2A 4MF8A 5JUMA 4PHAA 3TAPA 1ZQGA 3RAQA 5IIIA 4I2EA 4ECYA 5CA7A 1UA0A 5J0XA 4F4KA 5DQHA 4YG2A 2IBKA 4ED8A 4B9MA 3MDAA 1S0MA 1NKEA 4Q8EA 1ZQSA 4BGDA 5KFOA 4GXKA 2FMQA 5KFGA 4YFKA 1TK0A 3TARA 4DL3A 2JEJA 4GC6A 3TANA 2BPCA 5DB7A 2VA2A 5DG9A 4QW8A 3G6XA 2ZJ5A 3OHBA 1U45A 3RJFA 4P4MA 2BCQA 3LDAA 3HPOA 1MQ2A 1ZQFA 1A77A 3EZ5A 4DLEA 4M9HA 1TAQA 4Q8FA 3SV3A 5CJ7A 1QSYA 2FLLA 4GC7A 4FBUA 3H7IA 4UAYA 2JEFA 1T8EA 1NOMA 5IIMA 3TAQA 1ZQLA 4DEZA 5KFIA 4QZBA 3V7KA 1L3UA 4EZ6A 9ICFA 2GWSA 3LWLA 3E2EA 3H8SA 5KG0A 3H4BA 4M9LA 1UT8A 4YP3A 4RPZA 5CHGA 1B43A 4M0AA 5BOMA 9ICNA 5KG7A 1S0VA 3OSNA 4P4PA 5C5JA 2HHXA 4C8MA 4R65A 5EWFA 1U49A 3RJJA 3V6JA 4ECVA 1WCNA 2UVRA 2KZZA 1XWLA 5KG3A 4DF8A 3OSPA 3HT3A 1CUKA 3C2KA 1S10A 3BQ1A 2R8IA 3RJHA 4QWBA 2UVVA 2RDJA 3PVXA 4KN7A 4IR9A 4JK1A 1PZNA 4QWDA 5J2IA 5J0UA 9ICEA 4G3IA 3SV4A 3SI8A 1U47A 2C2EA 3RJKA 3T5LA 9ICAA 2BKEA 3B0XA 5KG5A 4DWIA 4YQWA 4Z6EA 1U9LA 3KHHA 3PV8A 3V6HA 4RT2A 2XCPA 9ICBA 4YR0A 2I9GA 4DS4A 3Q8KA 4YR2A 2KN7A 2FPLA 5KFZA 3JPQA 1ZQKA 2FPMA 3EPIA 3UXPA 1D8YA 3QEBZ 3RBEA 4M9JA 4DF4A 4ECWA 4YMOA 1D8LA 4LZDA 2Y1JA 1HUOA 1ZQYA 4PGQA 3GIJA 3C2LA 4KTQA 4NY8A 2FLNA 2MAXA 4RQ3A 2AGOA 4ECXA 3PO4A 3RJGA 2BCUA 4KLTA 1S76D 4BWJA 4BWMA 4DFMA 2AU0A 3GV7B 2IHNA 3TFRA 4O3RA 2ASLA 5L9XA 1KTQA 5KFSA 4K4GA 2XY7A 3RB4A 7ICRA 5DDMA 1ZQHA 3AU2A 4F2RA 8ICQA 3ETLA 1S9FA 4RT3A 1Z00A 4UB1A 9ICLA 4I27A 7ICVA 5KFNA 9ICXA 3ORYA 4TURA 4DO9A 1XSPA 3GILA 4KLQA 1ZYQA 1AROP 3M9NB 7ICHA 7ICEA 3ISBA 4O9MA 1JIHA 4JV2A 1DOQA 1ZQUA 4YMMA 1ZQMA 4M2YA 3ZDCA 5DGBA 3KHRA 4DQRA 4F91B 5J2HA 2ISOA 3C2MA 2AGQA 2ZJ8A 4EYHB 3RH6A 7ICMA 7ICFA 5CWRA 4RU9A 1ZQVA 4RQ5A 3RJIA 1CEZA 4ELVA 4UAWA 1SL1A 2BQ3A 4F50A 4ED7A 3GQCA 4DSFA 3RB3A 1ZQOA 1NJXA 3PNCA 2ZTEA 3C21A 5KFXA 3C1ZA 5KG6A 5J2CA 5HMLA 2C22A 1BPBA 2W9BB 1Z3EB 4YCXA 1RXVA 3M8SA 3BQ2A 2C2DA 1ZQTA 2VA3A 3C5FA 4I2FA 2WTFA 4ECUA 5KFTA 4B9SA 4J9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D49 A;  4ECQ A;  2XGP A;  2ALZ A;  1LV5 A;  2HVI A;  8ICS A;  4R64 A;  4YXJ A;  4KN4 A;  2NRX A;  4J9Q A;  4KLG A;  1S0N A;  4DSJ A;  2VAN A;  5EOZ A;  4Q43 A;  4F93 B;  2PI4 A;  3OGU A;  1S0O A;  4KIT B;  2W8K A;  1NKB A;  4M04 A;  5KFR A;  2FLP A;  4F5O A;  1QSS A;  4O3N A;  4IRK A;  3JPR A;  3OJU A;  4PHP A;  5J0P A;  5D4B A;  4NLZ A;  4IQT A;  4O3S A;  4QWA A;  9ICO A;  4K4H A;  5KG1 A;  4QZC A;  1NK0 A;  8ICE A;  2AQ0 A;  3RR8 A;  1ZQP A;  2Y1I A;  1NK9 A;  3N4M B;  8ICF A;  3B0Y A;  4DSE A;  4J9M A;  5DB9 A;  2AQ4 A;  1KFT A;  2I1Q A;  1K1S A;  2RDI A;  4DQQ A;  3T3F A;  1EXN A;  5DBB A;  2UVU A;  4MEY A;  8ICU A;  4QZI A;  8ICX A;  4DOC A;  4YR3 A;  2M9N A;  2IMW P;  3PX6 A;  4DFP A;  3MR3 A;  5BPC A;  3HWT A;  3M9O B;  3UQ2 A;  5F9N A;  3ZDE A;  4DFJ A;  4DLG A;  1H38 A;  4YVZ A;  1D9D A;  5DKW A;  4JV0 A;  4QZH A;  2BCR A;  1RPL A;  4I2D A;  5L1I A;  1ZQB A;  4I28 A;  4QZA A;  3MDC A;  3UXN A;  2J6U A;  2HHU A;  2F1I A;  1RYR A;  3TI0 A;  8ICH A;  2Q0Z X;  3MAB A;  7ICG A;  2ZJA A;  8ICO A;  4IR1 A;  3EWA A;  4ELU A;  3MR5 A;  4UBC A;  4GXJ A;  1JN3 A;  2F1H A;  3PW7 A;  1QSL A;  4BDP A;  9ICR A;  2XCA A;  7ICK A;  1XO1 A;  2IA6 A;  4ECR A;  9ICK A;  2A1J B;  1ZQI A;  8ICL A;  5DQG A;  4RZR A;  4Z6C A;  5J0S A;  4TQR A;  4DL7 A;  4IRC A;  4KLE A;  9ICP A;  2W9C A;  2R8J A;  5J2A A;  3BJY A;  3H40 A;  5KFV A;  5KFJ A;  4EBE A;  5DG7 A;  3Q8R B;  1A76 A;  3V7J A;  3T5K A;  5KFY A;  7ICQ A;  4YXM A;  4NM2 A;  3T5J A;  3NGD A;  1NJZ A;  8ICK A;  4ED0 A;  3GDX A;  3RBD A;  5KFP A;  5HHH A;  4FS2 A;  4KLI A;  4M6W A;  5DGA A;  4DL6 A;  1IXR A;  3MFH A;  1KEJ A;  3PO5 A;  4MEX A;  3GIM A;  1T7P A;  4B9L A;  4UB3 A;  4J9P A;  3ZDB A;  5KFA A;  5KFU A;  4O3P A;  4XQ8 A;  5KFF A;  1ZQA A;  4M9G A;  1MSW D;  7ICL A;  4I2C A;  2KZM A;  2W9C B;  1LB2 B;  1MC8 A;  1ZQN A;  2UVW A;  4RPX A;  3GV8 B;  1ZJM A;  8ICA A;  4RUA A;  4O0I A;  1JMS A;  5IIO A;  4RNO A;  3LK9 A;  4ECZ A;  4RQ6 A;  5IIJ A;  3MBY A;  4F5Q A;  4J9S A;  4EEY A;  2BCS A;  4JWN A;  2KFN A;  1NJY A;  9ICU A;  3FYH A;  4M6W B;  2BQR A;  5J0Q A;  3EW9 A;  5J2B A;  4B9T A;  4K4I A;  2W9A A;  5KTQ A;  3K75 D;  4O3Q A;  4DOA A;  5DG8 A;  2XGQ A;  3BDP A;  1ZQQ A;  2R8H A;  5J29 A;  4DOB A;  1BGX T;  2BHN A;  3JPP A;  3PX4 A;  3Q8Q B;  4ELT A;  4F92 B;  2W9B A;  3AUO A;  5J2E A;  3C23 A;  4KLL A;  4F4W A;  3QZ7 A;  4FS1 A;  3PW5 A;  4NLK A;  1JX4 A;  7ICP A;  4B9N A;  3RAX A;  1TK5 A;  5DDY A;  4RQ7 A;  4PHE A;  4DFK A;  5DBC A;  3TQ1 A;  2BPF A;  4KLF A;  4I2I A;  3G6Y A;  8ICB A;  5IIK A;  1X9W A;  5D46 A;  3NTU A;  3RJE A;  3IM1 A;  3QZ8 A;  1T3N A;  1QLN A;  7ICT A;  1TFR A;  4KLO A;  4B9U A;  2ZTD A;  3BQ0 A;  3HX0 A;  4ED1 A;  4PHD A;  5BOL A;  5DLG A;  3C5G A;  1COO A;  1SL2 A;  2HVH A;  4YN4 A;  2HHQ A;  3PW2 A;  2J6T A;  4Z6F A;  2B21 A;  5KFC A;  4DSK A;  7ICI A;  2MUT A;  4XRH A;  4NLN A;  4MFA A;  2BQU A;  1RYS A;  4KLM A;  2DFL A;  4LVS A;  1ZQX A;  5KT2 A;  4ED3 A;  3JPO A;  3PR5 B;  5IIL A;  2ZUC A;  3HP6 A;  5KFQ A;  3PW0 A;  1ZQE A;  4X5V A;  4J9N A;  1NKC A;  3OJS A;  8ICC A;  1KLN A;  5EWE A;  2BR0 A;  4I2B A;  4P2H A;  5KFW A;  9ICI A;  4QWE A;  1BPY A;  2KTQ A;  9ICG A;  5DQI A;  1KFS A;  7ICU A;  3ZDA A;  5J2G A;  3Q8P B;  4MFF A;  2HW3 A;  2MUT B;  4DS5 A;  2ISP A;  5KT7 A;  4KLS A;  3MGH A;  1NK8 A;  4Z6D A;  5KG4 A;  2ZUD A;  3H8J A;  4QZ9 A;  4LZG A;  8ICV A;  5KT6 A;  1XSN A;  1U4B A;  1X9S A;  1ZQZ A;  4O5E A;  2F1J A;  1V9P A;  4DQP A;  8ICM A;  4UBB A;  4F5N A;  3ZDD A;  4KLJ A;  4IQU A;  4QZD A;  1XSL A;  1ZQC A;  3RB6 A;  1DGS A;  5EWG A;  3RTV A;  5J0T A;  4YD2 A;  1NK6 A;  1BPX A;  2AJQ A;  2ASJ A;  1X9M A;  3EPG A;  1JXE A;  4QZG A;  4F5P A;  1TK8 A;  3MR2 A;  5F9L A;  2OWO A;  4FO6 A;  1ZQJ A;  4NXZ A;  4MF2 A;  2P6R A;  4KLH A;  4F4Z A;  9ICQ A;  2PFQ A;  3KTQ A;  1SZP A;  3KHG A;  2A1J A;  3SYZ A;  1NK4 A;  5KT3 A;  2C2R A;  1TAU A;  1U48 A;  3JPN A;  8ICR A;  4KLD A;  1C7Y A;  8ICJ A;  5J0R A;  4RQ4 A;  4I2H A;  3EYZ A;  2PI5 A;  4J9R A;  4NLG A;  5HP4 A;  4DSL A;  4IQV A;  4PH5 A;  5HNK A;  1KFD A;  2KZ3 A;  4DSI A;  4F5R A;  4I2J A;  1BPE A;  1X2I A;  3M9M B;  3H4D A;  2PXI A;  3Q8M A;  4UQG A;  4C8L A;  3GFK B;  4IRD A;  3UXO A;  5J2D A;  1ZQD A;  3V7L A;  2ASD A;  1XS9 D;  4ZH4 A;  4QZ8 A;  3LWM A;  9ICJ A;  4J9K A;  4R63 A;  4TUQ A;  2XC9 A;  5DLF A;  5IIN A;  1Y88 A;  3ISD A;  5KT5 A;  4EBC A;  2XY5 A;  1B22 A;  1JXL A;  4QW9 A;  1HJP A;  4MFC A;  3RRG A;  2P66 A;  4PGX A;  3HW8 A;  4JWM A;  5KFE A;  3GV5 B;  3V6K A;  1NK7 A;  4FBT A;  8ICW A;  5J0Y A;  4PPX A;  1KSP A;  7ICN A;  1RXW A;  8ICP A;  5J2K A;  2PFP A;  4RUC A;  4RQ1 A;  2JZB A;  5DBA A;  4I2A A;  3AU6 A;  4XA5 A;  3K4G A;  3RH5 A;  3GII A;  2BDP A;  4JUZ A;  1SKR A;  4HYK A;  1RZT A;  2FMS A;  2XO7 A;  3RRH A;  1ZJN A;  1SL0 A;  2JEI A;  4QZF A;  4RPY A;  4I29 A;  4BXO A;  2BCV A;  1TV9 A;  4I2G A;  2J6S A;  2P6U A;  4JV1 A;  5KFL A;  4KLU A;  1SKW A;  3RR7 A;  5J0O A;  4DL4 A;  2HHT A;  1TVA A;  1UA1 A;  8ICY A;  3TFS A;  2V9W A;  2JZB B;  1L5U A;  4YD1 A;  5KFD A;  5KFM A;  1ZET A;  1HUZ A;  4C8O A;  1N48 A;  1S97 A;  8ICT A;  5KFK A;  4ED2 A;  2DPJ A;  4O3O A;  3C1Y A;  9ICV A;  4TQS A;  4BXO B;  9ICS A;  2ATL A;  3UQ0 A;  4Q45 A;  1NJW A;  4R8U A;  4UB2 A;  4GXI A;  8ICG A;  9ICW A;  5J2J A;  3PW4 A;  3PX0 A;  2KFZ A;  8ICN A;  5J0W A;  4F4Y A;  4RQ8 A;  5KFH A;  4C8K A;  4QZE A;  3SZ2 A;  5CP2 A;  4DL2 A;  4DL5 A;  2PFO A;  9ICM A;  5L1K A;  2W9M A;  4B9V A;  2LYH A;  5HMM A;  4RQ0 A;  3JPT A;  9ICH A;  4E0D A;  2DPI A;  2ZUB A;  1XU4 A;  2JEG A;  4F4X A;  5CR0 A;  5L1L A;  4EBD A;  2FMP A;  3V72 A;  2VA8 A;  2V4Q A;  3MFI A;  4R8U B;  5J2F A;  3ISC A;  1N56 A;  1S77 D;  5KT4 A;  1NK5 A;  3KHL A;  4F3O A;  1XC9 A;  3PMN A;  9ICT A;  3N97 B;  3RB0 A;  2R8K A;  2C28 A;  9ICC A;  5HHI A;  1KRP A;  2R8G A;  5TZV A;  3PR4 A;  4R66 A;  1T4G A;  1L3V A;  4TUP A;  3UPQ A;  3RH4 A;  1TKD A;  4GLX A;  4DQS A;  4CCH A;  4M47 A;  4J9O A;  2BPG A;  5KG2 A;  2PFN A;  4NM1 A;  3IHQ B;  5DB8 A;  1BPZ A;  2ZTC A;  1WCL A;  4XUS A;  1L3S A;  1MQ3 A;  8ICZ A;  8ICI A;  2FPK A;  2NRZ A;  4IQW A;  3BQT A;  4PGY A;  2AGP A;  3MGI A;  1BVS A;  4KMU A;  4UB4 A;  2NRT A;  4QWC A;  3G6V A;  4EZ9 A;  1Z00 B;  4RNN A;  4Q44 A;  4O5K A;  3QE9 Y;  3ZD8 A;  1ZQR A;  4C8N A;  2NRW A;  5KFB A;  4M9N A;  3QEA Z;  4UAZ A;  3GIK A;  4DQI A;  4F8R A;  4P4O A;  1QTM A;  3MR6 A;  5L1J A;  4ED6 A;  3PY8 A;  4ECS A;  1SKS A;  3Q8L A;  4EYI B;  3ZD9 A;  2HHS A;  7ICO A;  3FDS A;  2V4R A;  5DB6 A;  4ECT A;  7ICJ A;  2IHM A;  1KDH A;  3M8R A;  4RNM A;  1D9F A;  4TUS A;  1L3T A;  4F2S A;  2XY6 A;  3OHA A;  3THV A;  1ZQW A;  2HHV A;  3PML A;  1BPD A;  2H5X A;  1UT5 A;  4UB5 A;  3JPS A;  4YMN A;  5CB1 A;  2W8L A;  3H8W A;  4O5C A;  2HHW A;  1IM4 A;  3T5H A;  7ICS A;  2BGW A;  2NRV A;  1K1Q A;  3Q8S B;  4RQ2 A;  4MF8 A;  5JUM A;  4PHA A;  3TAP A;  1ZQG A;  3RAQ A;  5III A;  4I2E A;  4ECY A;  5CA7 A;  1UA0 A;  5J0X A;  4F4K A;  5DQH A;  4YG2 A;  2IBK A;  4ED8 A;  4B9M A;  3MDA A;  1S0M A;  1NKE A;  4Q8E A;  1ZQS A;  4BGD A;  5KFO A;  4GXK A;  2FMQ A;  5KFG A;  4YFK A;  1TK0 A;  3TAR A;  4DL3 A;  2JEJ A;  4GC6 A;  3TAN A;  2BPC A;  5DB7 A;  2VA2 A;  5DG9 A;  4QW8 A;  3G6X A;  2ZJ5 A;  3OHB A;  1U45 A;  3RJF A;  4P4M A;  2BCQ A;  3LDA A;  3HPO A;  1MQ2 A;  1ZQF A;  1A77 A;  3EZ5 A;  4DLE A;  4M9H A;  1TAQ A;  4Q8F A;  3SV3 A;  5CJ7 A;  1QSY A;  2FLL A;  4GC7 A;  4FBU A;  3H7I A;  4UAY A;  2JEF A;  1T8E A;  1NOM A;  5IIM A;  3TAQ A;  1ZQL A;  4DEZ A;  5KFI A;  4QZB A;  3V7K A;  1L3U A;  4EZ6 A;  9ICF A;  2GWS A;  3LWL A;  3E2E A;  3H8S A;  5KG0 A;  3H4B A;  4M9L A;  1UT8 A;  4YP3 A;  4RPZ A;  5CHG A;  1B43 A;  4M0A A;  5BOM A;  9ICN A;  5KG7 A;  1S0V A;  3OSN A;  4P4P A;  5C5J A;  2HHX A;  4C8M A;  4R65 A;  5EWF A;  1U49 A;  3RJJ A;  3V6J A;  4ECV A;  1WCN A;  2UVR A;  2KZZ A;  1XWL A;  5KG3 A;  4DF8 A;  3OSP A;  3HT3 A;  1CUK A;  3C2K A;  1S10 A;  3BQ1 A;  2R8I A;  3RJH A;  4QWB A;  2UVV A;  2RDJ A;  3PVX A;  4KN7 A;  4IR9 A;  4JK1 A;  1PZN A;  4QWD A;  5J2I A;  5J0U A;  9ICE A;  4G3I A;  3SV4 A;  3SI8 A;  1U47 A;  2C2E A;  3RJK A;  3T5L A;  9ICA A;  2BKE A;  3B0X A;  5KG5 A;  4DWI A;  4YQW A;  4Z6E A;  1U9L A;  3KHH A;  3PV8 A;  3V6H A;  4RT2 A;  2XCP A;  9ICB A;  4YR0 A;  2I9G A;  4DS4 A;  3Q8K A;  4YR2 A;  2KN7 A;  2FPL A;  5KFZ A;  3JPQ A;  1ZQK A;  2FPM A;  3EPI A;  3UXP A;  1D8Y A;  3QEB Z;  3RBE A;  4M9J A;  4DF4 A;  4ECW A;  4YMO A;  1D8L A;  4LZD A;  2Y1J A;  1HUO A;  1ZQY A;  4PGQ A;  3GIJ A;  3C2L A;  4KTQ A;  4NY8 A;  2FLN A;  2MAX A;  4RQ3 A;  2AGO A;  4ECX A;  3PO4 A;  3RJG A;  2BCU A;  4KLT A;  1S76 D;  4BWJ A;  4BWM A;  4DFM A;  2AU0 A;  3GV7 B;  2IHN A;  3TFR A;  4O3R A;  2ASL A;  5L9X A;  1KTQ A;  5KFS A;  4K4G A;  2XY7 A;  3RB4 A;  7ICR A;  5DDM A;  1ZQH A;  3AU2 A;  4F2R A;  8ICQ A;  3ETL A;  1S9F A;  4RT3 A;  1Z00 A;  4UB1 A;  9ICL A;  4I27 A;  7ICV A;  5KFN A;  9ICX A;  3ORY A;  4TUR A;  4DO9 A;  1XSP A;  3GIL A;  4KLQ A;  1ZYQ A;  1ARO P;  3M9N B;  7ICH A;  7ICE A;  3ISB A;  4O9M A;  1JIH A;  4JV2 A;  1DOQ A;  1ZQU A;  4YMM A;  1ZQM A;  4M2Y A;  3ZDC A;  5DGB A;  3KHR A;  4DQR A;  4F91 B;  5J2H A;  2ISO A;  3C2M A;  2AGQ A;  2ZJ8 A;  4EYH B;  3RH6 A;  7ICM A;  7ICF A;  5CWR A;  4RU9 A;  1ZQV A;  4RQ5 A;  3RJI A;  1CEZ A;  4ELV A;  4UAW A;  1SL1 A;  2BQ3 A;  4F50 A;  4ED7 A;  3GQC A;  4DSF A;  3RB3 A;  1ZQO A;  1NJX A;  3PNC A;  2ZTE A;  3C21 A;  5KFX A;  3C1Z A;  5KG6 A;  5J2C A;  5HML A;  2C22 A;  1BPB A;  2W9B B;  1Z3E B;  4YCX A;  1RXV A;  3M8S A;  3BQ2 A;  2C2D A;  1ZQT A;  2VA3 A;  3C5F A;  4I2F A;  2WTF A;  4ECU A;  5KFT A;  4B9S A;  4J9L A; 
#chains in the Genus database with same CATH topology
 1LV5 A;  3DDH A;  2NO5 A;  5G5H A;  4DSJ A;  2FJ6 A;  5EOZ A;  4Q43 A;  4F93 B;  1S0O A;  2E5S A;  2HBK A;  2RQ5 A;  4F5O A;  2PKE A;  4IRK A;  3D2S A;  3OJU A;  5J0P A;  4OJL A;  5D4B A;  4O3S A;  1RM6 C;  4F72 A;  1ZQP A;  2E3T A;  2JMG A;  4DSE A;  3I76 A;  3UMB A;  3K1R B;  4J9M A;  3WK7 A;  1EXN A;  2UVU A;  4MEY A;  1Q3V A;  2KVC A;  4DOC A;  4YR3 A;  3MR3 A;  3SQI A;  5BPC A;  3HWT A;  3ZDE A;  2WFA A;  1WYG A;  5DKW A;  4QZH A;  1F44 A;  1ZQB A;  3MDC A;  3UXN A;  4CF4 A;  1DK2 A;  1RYR A;  3TI0 A;  2Q0Z X;  2DKZ A;  1ZRM A;  3MAB A;  8ICO A;  4UBC A;  1JN3 A;  2HSZ A;  2XCA A;  4Z6C A;  5J0S A;  4TQR A;  4IRC A;  1MN8 A;  2R8J A;  5J2A A;  3H40 A;  5KFJ A;  5DG7 A;  1A76 A;  3V7J A;  7ICQ A;  2F8K A;  4YXM A;  3T5J A;  1NJZ A;  2F3N A;  3IDW A;  2DQN B;  3RBD A;  5HHH A;  4KLI A;  2AH5 A;  5DGA A;  3SAF A;  3TAC B;  3WKC A;  4C4R A;  1KEJ A;  3PO5 A;  4B9L A;  5KFF A;  7ICL A;  1MSW D;  3AEV A;  1ZJM A;  3AMZ A;  8ICA A;  4RUA A;  5IIO A;  3LK9 A;  2GLE A;  1ZD5 A;  4F5Q A;  3IN5 A;  1JAL A;  4M6W B;  5J0Q A;  2K4I A;  2QB0 A;  4K4I A;  3K75 D;  4O3Q A;  5DG8 A;  2XGQ A;  1ZQQ A;  2R8H A;  4KX3 A;  4DOB A;  2WAQ C;  2F8L A;  1L8L A;  4KLL A;  1DXS A;  3BS5 A;  4FS1 A;  1JX4 A;  2MA1 A;  1TK5 A;  2KHQ A;  5DDY A;  2ES6 A;  2PMZ F;  4KLF A;  8ICB A;  3ED5 A;  5IIK A;  5FP0 A;  1QLN A;  7ICT A;  2YML A;  2AHO B;  4KLO A;  3HX0 A;  4ED1 A;  3QUB A;  5BOL A;  2EAN A;  2KD1 A;  2J6T A;  5KFC A;  4DSK A;  2FE9 A;  4KLM A;  2DFL A;  4HAI A;  4MHV A;  2E8N A;  4DCC A;  4CE6 A;  1ZQX A;  4ED3 A;  1UPH A;  2GO7 A;  5ALO A;  2KHV A;  5AI4 A;  5KAI U;  3PW0 A;  4X5V A;  1Z1B A;  3HJE A;  4JB3 A;  4P2H A;  4I2B A;  2ZG6 A;  1BPY A;  5AKG A;  2LM1 A;  5J2G A;  2HW3 A;  2RLT A;  1NK8 A;  4Z6D A;  2PMZ C;  2YB1 A;  1U4B A;  8ICM A;  1GO3 F;  4UBB A;  4F5N A;  3ZDD A;  2YTU A;  4QZD A;  3RB6 A;  1DRG A;  4QZG A;  1TK8 A;  1SB3 C;  5F9L A;  4FO6 A;  2GOL A;  4Y2Q A;  3JPN A;  1U48 A;  4RQ4 A;  1LVH A;  5HP4 A;  1Z4N A;  4PH5 A;  3KOO A;  5EE9 A;  4BJQ A;  1PUZ A;  3Q8M A;  3GFK B;  3HKZ C;  5B5E U;  3LWM A;  9ICJ A;  4J9K A;  3TAD C;  2XC9 A;  4EBC A;  1X6I A;  3RRG A;  2P66 A;  4PGX A;  3V6K A;  1TE2 A;  5AM3 A;  7ICN A;  4USA A;  1FIQ A;  5HR7 A;  2W7O A;  1F0M A;  1ZD3 A;  1SKR A;  2OXO A;  1RZT A;  2FMS A;  1B0X A;  2H3F A;  1SL0 A;  2JEI A;  3PSI A;  4JV1 A;  2ZXH A;  3OPX A;  3TFS A;  2V9W A;  2JZB B;  2R18 A;  1HUZ A;  4C8O A;  1S97 A;  4DFD A;  3J81 j;  4B6J A;  1NJW A;  2E1E A;  5A0L A;  1JUD A;  1RYU A;  2KFZ A;  2RHF A;  5J0W A;  4C8K A;  4QZE A;  5ALN A;  2PFO A;  1WWV A;  3JPT A;  3HRD D;  2ZIU B;  2ZUB A;  2JEG A;  3CP8 A;  2KIW A;  5L1L A;  4EBD A;  3V72 A;  1PK1 A;  5ALX A;  5J2F A;  1N56 A;  1NK5 A;  3KHL A;  4F3O A;  1XC9 A;  4EEN A;  3N97 B;  5AKL A;  3RB0 A;  2A1A A;  3PR4 A;  4R66 A;  1T4G A;  4GLX A;  2BZF A;  5DB8 A;  1RQL A;  4XUS A;  1L3S A;  4O3M A;  8ICI A;  4IQW A;  1BVS A;  2OCE A;  2Z7J A;  2NRT A;  4QWC A;  3G6V A;  3QE9 Y;  3ICX A;  2QAR A;  5L1J A;  4ECS A;  1SKS A;  2DWQ A;  2WB1 C;  1N62 A;  4EYI B;  3WK8 A;  2KSO A;  1KDH A;  5ALV A;  2XY6 A;  3OHA A;  1UT5 A;  5JRT A;  1NI3 A;  2W8L A;  1VLB A;  3TAP A;  5CA7 A;  4F4K A;  3WKE A;  1DK3 A;  1S0M A;  5KL8 B;  3NRZ A;  2D8C A;  2YX8 A;  5KFG A;  1TK0 A;  3SAG A;  4QW8 A;  1SV4 A;  3G6X A;  1U45 A;  5ALI A;  2BCQ A;  1ZQF A;  1MQ2 A;  4M9H A;  3SV3 A;  2FLL A;  4GC7 A;  4UAY A;  5F3X B;  1SXD A;  9ICF A;  1CI4 A;  3E2E A;  3H4B A;  5BOM A;  5KG7 A;  2W3S A;  4C8M A;  3RJJ A;  3V6J A;  1S10 A;  3NVZ A;  4QWB A;  2UVV A;  3PVX A;  4KN7 A;  4JK1 A;  2A3V A;  5J2I A;  3SI8 A;  1U47 A;  2C2E A;  3B0X A;  4Z6E A;  3PV8 A;  2XCP A;  4YR0 A;  5EE3 A;  2I9G A;  1D8Y A;  5J8Y A;  3PST A;  4M9J A;  4YMO A;  1SV0 C;  4RQ3 A;  4Y2P A;  3QU2 A;  4BWJ A;  5ALF A;  2AU0 A;  4O3R A;  1N60 A;  5L9X A;  4K4G A;  2E8O A;  2XY7 A;  1PVP A;  4OJ6 A;  5DDM A;  3FM9 A;  3F2C A;  1S9F A;  7ICV A;  2H3V A;  4KLQ A;  1ZYQ A;  3M9N B;  7ICH A;  3ISB A;  4O9M A;  1JIH A;  4JV2 A;  1ZQU A;  1FO4 A;  4UB8 U;  3ZI4 A;  4DQR A;  4F91 B;  2ZJ8 A;  4EYH B;  4UAU A;  4RU9 A;  3RJI A;  2XID A;  4Y2S A;  1CEZ A;  2HOI A;  4UAW A;  2BQ3 A;  4US8 A;  2YQE A;  1UQV A;  5C0Y A;  2A19 A;  2HMX A;  5J2C A;  3M1Y A;  1Z3E B;  2C2D A;  3F5E A;  1ZQT A;  1L8O A;  3IG8 A;  2PI4 A;  5D49 A;  3CNH A;  2ALZ A;  2HVI A;  8ICS A;  4WJ3 B;  2N1R A;  4YXJ A;  2NRX A;  2EAO A;  1S0N A;  3KKA A;  1D8B A;  1NKB A;  3LVV A;  5KFR A;  2FLP A;  4O3N A;  3JPR A;  2LYB A;  4QWA A;  9ICO A;  4K4H A;  3GU3 A;  3RR8 A;  8ICF A;  5DB9 A;  2AQ4 A;  2NYV A;  1K1S A;  5ALH A;  2M9N A;  1KW4 A;  1H38 A;  4C7Z A;  2BCR A;  5E79 U;  1L7N A;  2LHT A;  4OJP A;  3L3F X;  4OJ5 A;  4ELU A;  1FEZ A;  4OD0 A;  2IA6 A;  8ICL A;  1URJ A;  1L6N A;  2OM6 A;  2DGZ A;  3PSP A;  2W9C A;  5KFV A;  3NGD A;  2K60 A;  8ICK A;  3GDX A;  5KFP A;  4FFD A;  5ALG A;  3MFH A;  4MEX A;  1AQ6 A;  4UB3 A;  1COK A;  5IIJ A;  3MBY A;  2KFN A;  4EEY A;  1NJY A;  3FYH A;  2HDO A;  2MSN A;  2OYY A;  4KMO B;  4QJF B;  4DOA A;  3AN1 A;  3KZI U;  1BGX T;  2BHN A;  2B6G A;  3PX4 A;  3VC8 A;  3Q8Q B;  2H3Z A;  3AUO A;  3B9J A;  5J2E A;  3KBB A;  5JU5 A;  4C0Z A;  3PW5 A;  4NLK A;  3QYP A;  3RAX A;  4RQM A;  2QB0 B;  4Y2J A;  5DBC A;  4FZN A;  1X9W A;  5D46 A;  3IM1 A;  3QZ8 A;  1TFR A;  2KJ5 A;  3BQ0 A;  4PHD A;  1SL2 A;  4YN4 A;  3PW2 A;  1OUQ A;  2B21 A;  4XRH A;  5AIB A;  3BS5 B;  2BQU A;  4UAT A;  4BX9 C;  1NZB A;  2EZZ A;  3PR5 B;  4NJ8 A;  2H3Q A;  1ZQE A;  3SEN A;  2LKY A;  1KLN A;  3UM9 A;  2ISP A;  4KLS A;  5KT7 A;  8ICG A;  3M7D A;  3H0R B;  5KG4 A;  4QZ9 A;  3H8J A;  8ICV A;  5KT6 A;  4O5E A;  2G06 A;  1ZQZ A;  2FDR A;  2F1J A;  2KK0 A;  1DGS A;  3RTV A;  2AJQ A;  1JXE A;  4F5P A;  1WG8 A;  3MR2 A;  5EE0 A;  3KTQ A;  1NK4 A;  2HBM A;  8ICR A;  8ICJ A;  4AYB F;  4J9R A;  4NLG A;  5HNK A;  3I1Y A;  5AK5 A;  3H4D A;  3UXO A;  2E8P A;  1KL9 A;  2JR5 A;  3V7L A;  2ASD A;  4R63 A;  2JXJ A;  1JXL A;  1HJP A;  4MFC A;  2DKX A;  1HEK A;  1SXE A;  3QXG A;  5KFE A;  2EQY A;  4FBT A;  5J2K A;  4EEK A;  4RQ1 A;  3WK6 A;  3AU6 A;  3GII A;  2XO7 A;  3RRH A;  4RPY A;  4PZO A;  2OEH A;  5ALJ A;  2L5Y A;  1SKW A;  2EAP A;  2YMM A;  2CPR A;  2K4P A;  1ZET A;  1N48 A;  2W11 A;  5KFK A;  4ED2 A;  1TAM A;  4O3O A;  4UW9 A;  1BNO A;  8ICN A;  3SZ2 A;  2JRZ A;  2W04 A;  9ICM A;  4B9V A;  2W9M A;  1L7P A;  4CDG A;  1SWV A;  2DPI A;  1XU4 A;  2Y0S F;  3MGV A;  3QU4 A;  2VA8 A;  2V4Q A;  3QU9 A;  5ALR A;  1S77 D;  2R8K A;  3F2B A;  5HHI A;  2R8G A;  1QQ7 A;  3RH4 A;  1TKD A;  4CCH A;  4DQS A;  1V85 A;  5KG2 A;  2ZTC A;  3O0F A;  2FPK A;  2F76 X;  4PGY A;  3MGI A;  1PK1 B;  4UB4 A;  4EZ9 A;  1XNS A;  4O5K A;  3ZD8 A;  3N28 A;  4M9N A;  3GIK A;  4F8R A;  4P4O A;  4ED6 A;  3PY8 A;  3Q8L A;  2QKQ A;  2HHS A;  2E8M A;  2Y0S C;  4ECT A;  4U7C A;  7ICJ A;  1YT3 A;  2IOF K;  1D9F A;  1IV8 A;  4TUS A;  1L3T A;  4F2S A;  3THV A;  1ZQW A;  2H5X A;  4UB5 A;  2LYA A;  4YMN A;  3H8W A;  1IM4 A;  2QAR B;  5T14 A;  4RQ2 A;  4MF8 A;  4NL9 C;  4I2E A;  2G5I B;  3MDA A;  2KSO B;  2FMQ A;  4YFK A;  3TAR A;  4GC6 A;  3TAN A;  2BPC A;  2VA2 A;  5DG9 A;  2KVS A;  3OHB A;  4P0Q A;  3C28 A;  2WF9 A;  1TAQ A;  5AHX A;  4PL1 A;  1OXJ A;  1SWW A;  4FBU A;  3ALR A;  3H7I A;  1NOM A;  4UAV A;  5IIM A;  1ZQL A;  1L3U A;  2HBL A;  4US9 A;  5KG0 A;  4M0A A;  4RPZ A;  4OCZ A;  4Y2V A;  4P4P A;  2HHX A;  3NVY A;  4FZL A;  5AM4 A;  4ECV A;  3SAH A;  4PL2 A;  3HT3 A;  3BQ1 A;  1DGJ A;  1PZN A;  4QWD A;  4G3I A;  3SV4 A;  9ICA A;  2BKE A;  5KG5 A;  4DWI A;  1ED1 A;  3JPQ A;  5KFZ A;  1ZQK A;  3EPI A;  3QEB Z;  3RBE A;  4ECW A;  1Q8K A;  3FC4 A;  2Y1J A;  1ZQY A;  2AGO A;  3AQF A;  2BCU A;  4KLT A;  3K1Z A;  3GV7 B;  3TFR A;  3RB4 A;  7ICR A;  1ZQH A;  3NAS A;  3H0L B;  2D6F C;  8ICQ A;  2ZIX A;  4RT3 A;  2JH1 A;  4I27 A;  9ICX A;  1XSP A;  4DO9 A;  3GIL A;  2JGA A;  1ARO P;  7ICE A;  5ALQ A;  1PVR A;  1O03 A;  3ZDC A;  5DGB A;  5ALM A;  5CWR A;  4RQ5 A;  5GTH U;  1SL1 A;  4F50 A;  4DSF A;  3RB3 A;  1NJX A;  1X6J A;  5ALW A;  2ZTE A;  5AM5 A;  3C1Z A;  5KG6 A;  2LI6 A;  1KKX A;  1BPB A;  2W9B B;  3BQ2 A;  3AQE A;  2VA3 A;  3R9K A;  4I2F A;  2EZX A;  4DQI A;  5KFT A;  2XGP A;  4R64 A;  1RG6 A;  3IV6 A;  4KLG A;  4FE3 A;  3WK9 A;  3NVW A;  1QSS A;  4NLZ A;  2ZIW A;  4LJX A;  1NK0 A;  2AQ0 A;  2Y1I A;  1NK9 A;  3N4M B;  2G09 A;  1ZRN A;  5KL1 B;  2K8A A;  2I1Q A;  2RDI A;  4DQQ A;  3T3F A;  5DBB A;  8ICX A;  1P7D A;  4QZI A;  3PSF A;  5B66 U;  2VIX A;  4DFP A;  2W7P A;  3M9O B;  3UQ2 A;  5F9N A;  4DFJ A;  4JMU A;  4YVZ A;  1D9D A;  4JV0 A;  5ALY A;  1YZ6 A;  5L1I A;  4I28 A;  1HIW A;  2J6U A;  2HHU A;  2HOF A;  2ZJA A;  3MR5 A;  4GXJ A;  1QSL A;  4BDP A;  1X9X A;  2KMD A;  5DQG A;  4KLE A;  4NWI A;  3BJY A;  5CRX A;  4EBE A;  3Q8R B;  3T5K A;  1Q46 A;  4NM2 A;  1L7O A;  2AXT U;  2WF5 A;  4ED0 A;  4FS2 A;  1V38 A;  3IG5 A;  4DL6 A;  1IXR A;  1LKY A;  1T7P A;  4OJO A;  4J9P A;  3ZDB A;  5KFA A;  5KFU A;  1ZQA A;  4M9G A;  1ECW A;  1QH9 A;  1X40 A;  2KZM A;  2W9C B;  1LB2 B;  1MC8 A;  1ZQN A;  2UVW A;  4RPX A;  2MRL A;  1QQ6 A;  5K4L A;  4O0I A;  4ECZ A;  2BCS A;  4J9S A;  9ICU A;  4J03 A;  4B9T A;  5J2B A;  3OTQ A;  4CRX A;  3BDP A;  1N63 A;  3JPP A;  4OO1 J;  3F5A A;  2K4H A;  2W9B A;  4F4W A;  3QZ7 A;  3UMC A;  4B9N A;  4DFK A;  3TQ1 A;  3G6Y A;  3RJE A;  1T3N A;  5AKE A;  1RDF A;  4B9U A;  1NNL A;  5DLG A;  3C5G A;  1COO A;  1N5W A;  3L5K A;  2CRX A;  2MUT A;  4NLN A;  1A0P A;  1RYS A;  2W03 A;  4LVS A;  3QU7 A;  2XI9 A;  3JPO A;  1PK3 A;  2ZUC A;  3HP6 A;  2KV2 A;  4C4T A;  4J9N A;  1NKC A;  3OJS A;  4C7Y A;  5AM0 A;  3L4P A;  9ICI A;  1Q3U A;  2KTQ A;  9ICG A;  2RP5 A;  5DQI A;  3ZDA A;  3Q8P B;  2BDU A;  4DS5 A;  2ZUD A;  1IIP A;  2ZIV B;  1X9S A;  4Y2Y A;  1V9P A;  2KE7 A;  1M6Y A;  4KLJ A;  1XSL A;  1ZQC A;  5J0T A;  4YD2 A;  1NK6 A;  4BUG A;  3EPG A;  2OWO A;  2Y9T A;  2Q4T A;  2P6R A;  4MF2 A;  1K5O A;  2WHE A;  4F4Z A;  3LYS A;  2PFQ A;  3KHG A;  1TAU A;  2C2R A;  1C7Y A;  5J0R A;  3GZF A;  3EYZ A;  4DSL A;  4F5R A;  1BPE A;  2PXI A;  4UQG A;  4C8L A;  1SV0 A;  3ONN A;  4ZH4 A;  3N7S C;  4QZ8 A;  4TUQ A;  3BZK A;  5IIN A;  1Y88 A;  3WKB A;  3ISD A;  5KT5 A;  5ALE A;  4QW9 A;  5AI5 A;  2XVT A;  4JWM A;  1RQN A;  5J0Y A;  2ESE A;  4PPX A;  1RXW A;  1ZXI A;  2G07 A;  4RUC A;  4P0P B;  2Y9U A;  4XA5 A;  4JUZ A;  4I29 A;  4BXO A;  3N7P D;  4I2G A;  2P6U A;  1J2N A;  4NLC A;  4PJ0 U;  5J0O A;  2HHT A;  1TVA A;  2G5H B;  1UA1 A;  8ICY A;  1ZOL A;  2G08 A;  4YD1 A;  5KFD A;  5KFM A;  2JV3 A;  4RQN A;  8ICT A;  1N2X A;  2DPJ A;  3C1Y A;  9ICV A;  4TQS A;  9ICS A;  4Q45 A;  4NV0 A;  4R8U A;  4GXI A;  5HR6 A;  3PW4 A;  1S5L U;  4RQ8 A;  5KFH A;  5CP2 A;  4DL5 A;  1X42 A;  5L1K A;  2LYH A;  2K4E A;  4RQ0 A;  1MA7 A;  4E0D A;  4F4X A;  1SGG A;  4CGZ A;  5CR0 A;  2FMP A;  2FI1 A;  3ISC A;  1KQQ A;  2C28 A;  9ICC A;  1L3V A;  2ZIV A;  3UPQ A;  4M47 A;  2JHD A;  2BPG A;  2PFN A;  4NM1 A;  1NZP A;  2NRZ A;  3BQT A;  2AGP A;  2RRD A;  3E58 A;  1Z00 B;  4RNN A;  2NRW A;  4UAZ A;  1C20 A;  1QTM A;  3MR6 A;  5CEH A;  1J2M A;  7ICO A;  2V4R A;  5DB6 A;  3F53 A;  4UB6 U;  3M8R A;  2HHV A;  3QNM A;  5ALD A;  2HCF A;  3QX7 A;  3JPS A;  5ALZ A;  4O5C A;  2BGW A;  3Q8S B;  1ZQG A;  3RAQ A;  5III A;  1UA0 A;  5J0X A;  4ED8 A;  4Q8E A;  1NKE A;  1ZD4 A;  1ZQS A;  5AKK A;  4NLB A;  5AKX A;  4I2C A;  2JEJ A;  5DB7 A;  2ZJ5 A;  2W3R A;  3PZP A;  4P0P A;  3KZX A;  1J97 A;  3RJF A;  3WK5 A;  3EZ5 A;  4DLE A;  2YMQ A;  1QSY A;  5ALS A;  3TAQ A;  4DEZ A;  4QZB A;  2GWS A;  3LWL A;  3H8S A;  2VJ5 A;  4M9L A;  1UT8 A;  4YP3 A;  3I28 A;  9ICN A;  3M6Z A;  2K89 A;  3OSN A;  3CYM A;  3WK4 A;  4R65 A;  4P0Q B;  1U49 A;  2KZZ A;  1WCN A;  1XWL A;  4DF8 A;  3VCB A;  1CUK A;  4AYB C;  2R8I A;  2RDJ A;  3WKA A;  3RJK A;  2KOB A;  2WAQ F;  1U9L A;  2K8C B;  2WF6 A;  4RT2 A;  9ICB A;  3DV9 A;  4DS4 A;  2LM4 A;  3EUB 2;  3UXP A;  2W54 A;  5AM1 A;  4DF4 A;  2O6K A;  1WUD A;  1FFV A;  1D8L A;  4LZD A;  1HUO A;  3GIJ A;  3C2L A;  4NY8 A;  2KEY A;  2FLN A;  4ECX A;  3PO4 A;  1N5X A;  1QCK A;  1S76 D;  4BWM A;  4DFM A;  2IHN A;  3F2D A;  3D2N A;  2ASL A;  1VJ5 A;  5KFS A;  3AU2 A;  1CRX A;  1N61 A;  1Z00 A;  3ORY A;  2W55 A;  1DOQ A;  4YMM A;  3KHR A;  5J2H A;  3C2M A;  4UAR A;  3RH6 A;  7ICM A;  1ZQV A;  4ED7 A;  2B0C A;  1ZQO A;  2ZIX B;  3C21 A;  5KFX A;  5HML A;  2C22 A;  2CN1 A;  5ALL A;  1VDV A;  1RXV A;  2WTF A;  5AKZ A;  4ECU A;  7ICF A;  4J9L A;  4ECQ A;  2GH1 A;  1SZH A;  4KN4 A;  4J9Q A;  2VAN A;  1Z1V A;  3OGU A;  4KIT B;  2W8K A;  4M04 A;  4PHP A;  4IQT A;  3HKZ F;  2IOH A;  5KG1 A;  4QZC A;  8ICE A;  3KD3 A;  1T3Q A;  3B0Y A;  2NV3 A;  5AKH A;  1KFT A;  3C29 A;  8ICU A;  1X66 A;  4ACO A;  2IMW P;  1XO0 A;  3PX6 A;  1L7M A;  2YN4 A;  2ZIW B;  4DLG A;  1RPL A;  4I2D A;  4QZA A;  5AKJ A;  3SR6 A;  2F1I A;  2F44 A;  8ICH A;  1A6S A;  7ICG A;  4IR1 A;  3EWA A;  2F1H A;  3PW7 A;  9ICR A;  4IL6 U;  7ICK A;  1XO1 A;  4ECR A;  5EE1 A;  9ICK A;  2A1J B;  1ZQI A;  3SD7 A;  4RZR A;  4DL7 A;  4CF5 A;  9ICP A;  1S8O A;  5AKY A;  2ODG A;  5KFY A;  4M6W A;  1JI7 A;  3LVW A;  3GIM A;  3U26 A;  1SIJ A;  3BQ7 A;  4O3P A;  4XQ8 A;  2DBY A;  3E0F A;  2DUY A;  3GV8 B;  1JMS A;  3A0H U;  1O08 A;  2OH2 A;  4RNO A;  4RQ6 A;  4JWN A;  2JH7 A;  1ZD2 P;  4QNL A;  2BQR A;  3QUC A;  3EW9 A;  5AKI A;  2W9A A;  5KTQ A;  1KBU A;  1LKY B;  5J29 A;  3SMV A;  2MU2 A;  2KIV A;  3QU5 A;  4ELT A;  4F92 B;  3C23 A;  5JTI A;  4U6P A;  7ICP A;  2VKQ A;  4RQ7 A;  4PHE A;  2HBJ A;  2I5H A;  2BPF A;  4I2I A;  2WB1 F;  4QIW F;  4NL9 A;  3NTU A;  4ZOH C;  2ZTD A;  5ALT A;  4C4S A;  2HHQ A;  2HVH A;  4KX5 A;  3AM9 A;  4Z6F A;  3IRU A;  7ICI A;  2EDU A;  4MFA A;  5J8Y C;  5KT2 A;  5IIL A;  3TAD A;  5KFQ A;  3AL0 B;  5KAF U;  3KFU F;  8ICC A;  5G5G A;  2DL0 A;  5EWE A;  2BR0 A;  3MC1 A;  5KFW A;  4QWE A;  2DF4 B;  1KFS A;  7ICU A;  4MFF A;  5ALU A;  2MUT B;  3MGH A;  5AI6 A;  1XSN A;  1FFU A;  3QUQ A;  4QIW C;  4DQP A;  3RFA A;  4IQU A;  5KNI A;  5EWG A;  5ALP A;  1BPX A;  2W43 A;  2ASJ A;  1X9M A;  7ICS A;  4KLH A;  2KNJ A;  2ZXI A;  1ZQJ A;  4NXZ A;  9ICQ A;  4UAS A;  3NVV A;  1SZP A;  3SYZ A;  2A1J A;  5KT3 A;  3H0M B;  4KLD A;  5AI9 A;  4I2H A;  2PI5 A;  3CW2 C;  4IQV A;  1KFD A;  2KZ3 A;  3NRW A;  4DSI A;  4GFJ A;  4I2J A;  5AK3 A;  1X2I A;  3M9M B;  4EX7 A;  4IRD A;  5J2D A;  1ZQD A;  1XS9 D;  2YB4 A;  5TIS U;  4Y2U A;  5DLF A;  3HIL A;  2XY5 A;  1B22 A;  3KKA C;  2K8B B;  2LBO A;  1BNP A;  3HW8 A;  8ICW A;  1NK7 A;  3GV5 B;  1KSP A;  2KKP A;  8ICP A;  2PFP A;  3CRX A;  2JZB A;  5DBA A;  4I2A A;  3K4G A;  3RH5 A;  5ALK A;  2BDP A;  4HYK A;  2EZY A;  1ZJN A;  2E1F A;  4QZF A;  2BCV A;  1TV9 A;  2J6S A;  3UMG A;  5KFL A;  4KLU A;  4ICA A;  3ETR A;  3RR7 A;  4DL4 A;  1L5U A;  4CF3 A;  2ZIU A;  2WF7 A;  4EX6 A;  1Z4O A;  2H3I A;  4BXO B;  2ATL A;  1UHU A;  3UQ0 A;  4UB2 A;  9ICW A;  5J2J A;  3PX0 A;  2YMP A;  4F4Y A;  5AK4 A;  4DL2 A;  1YZ7 A;  5HMM A;  3DEE A;  9ICH A;  4Y2T A;  1B4F A;  3MFI A;  4R8U B;  1F5S A;  5KT4 A;  2KKV A;  3PMN A;  9ICT A;  2F2A B;  3SEI A;  1KRP A;  5TZV A;  3NUQ A;  3WKD A;  4TUP A;  4J9O A;  3IHQ B;  1BPZ A;  2WF8 A;  1WCL A;  2QB1 A;  1MQ3 A;  4PZN A;  8ICZ A;  4KMU A;  3H8M A;  3D2Q A;  4Q44 A;  5AIC A;  4EEL A;  1ZQR A;  4C8N A;  5KFB A;  3QEA Z;  3D6J A;  3FAH A;  2HOQ A;  2CXY A;  4AP9 A;  3ZD9 A;  1PVQ A;  3FDS A;  2M0N A;  2IHM A;  5AK6 A;  2KJ8 A;  4RNM A;  4FZM A;  5AI8 A;  2HI0 A;  5H2F U;  3PML A;  2I6X A;  1BPD A;  3T79 A;  3S6J A;  5CB1 A;  3NS1 A;  2HHW A;  1Z19 A;  3T5H A;  3N7R C;  2NRV A;  1K1Q A;  5JUM A;  4PHA A;  4ECY A;  5DQH A;  4YG2 A;  4G9B A;  2IBK A;  4B9M A;  4Y2R A;  2XIC A;  4BGD A;  5KFO A;  4GXK A;  4LZG A;  4DL3 A;  2QLT A;  1UCV A;  4IC9 A;  4P4M A;  3LDA A;  3HPO A;  1A77 A;  4Q8F A;  2EH9 A;  5CJ7 A;  2D3D A;  5AM2 A;  2JEF A;  4F71 A;  1T8E A;  5KFI A;  3V7K A;  4EZ6 A;  3TKA A;  3M6K A;  5CHG A;  1B43 A;  1S0V A;  5C5J A;  2NO4 A;  2KIC A;  5EWF A;  2UVR A;  2EAM A;  2VJ4 A;  5KG3 A;  2KJ9 A;  3OSP A;  3C2K A;  3RJH A;  2KG5 A;  4IR9 A;  4A8E A;  9ICE A;  5J0U A;  4IS7 A;  1WWU A;  2KP7 A;  1JRO A;  1QQ5 A;  3T5L A;  5AI0 A;  3WU2 U;  5GTI U;  4YQW A;  2OHF A;  3KHH A;  3V6H A;  1IG6 A;  3Q8K A;  4Y2X A;  3A0B U;  4YR2 A;  2KN7 A;  2FPL A;  3IP4 B;  2FPM A;  1KN5 A;  2LPE A;  4C80 A;  2P35 A;  3RF9 A;  1V97 A;  4PGQ A;  4KTQ A;  2MAX A;  3RJG A;  2YY6 A;  2LMR A;  4CNQ A;  3BZC A;  1T94 A;  1KTQ A;  5L1M A;  2F77 X;  4GIB A;  4F2R A;  3ETL A;  4UB1 A;  9ICL A;  5KFN A;  4TUR A;  3QUT A;  1ZQ1 C;  4M2Y A;  1ZQM A;  3BS7 A;  2ISO A;  2AGQ A;  2G0A A;  4ELV A;  3GQC A;  3PNC A;  5AIA A;  1JRP A;  1OW5 A;  4YCX A;  3M8S A;  3C5F A;  2IOF A;  4B9S A; 
#chains in the Genus database with same CATH homology
 5D49 A;  4ECQ A;  2XGP A;  2ALZ A;  1LV5 A;  2HVI A;  8ICS A;  4R64 A;  4YXJ A;  4KN4 A;  2NRX A;  4J9Q A;  4KLG A;  1S0N A;  4DSJ A;  2VAN A;  5EOZ A;  4Q43 A;  4F93 B;  2PI4 A;  3OGU A;  1S0O A;  4KIT B;  2W8K A;  1NKB A;  4M04 A;  5KFR A;  2FLP A;  4F5O A;  1QSS A;  4O3N A;  4IRK A;  3JPR A;  3OJU A;  4PHP A;  5J0P A;  5D4B A;  4NLZ A;  4IQT A;  4O3S A;  4QWA A;  9ICO A;  4K4H A;  5KG1 A;  4QZC A;  1NK0 A;  8ICE A;  2AQ0 A;  3RR8 A;  1ZQP A;  2Y1I A;  1NK9 A;  3N4M B;  8ICF A;  3B0Y A;  4DSE A;  4J9M A;  5DB9 A;  2AQ4 A;  1KFT A;  2I1Q A;  1K1S A;  2RDI A;  4DQQ A;  3T3F A;  1EXN A;  5DBB A;  2UVU A;  4MEY A;  8ICU A;  4QZI A;  8ICX A;  4DOC A;  4YR3 A;  2M9N A;  2IMW P;  3PX6 A;  4DFP A;  3MR3 A;  5BPC A;  3HWT A;  3M9O B;  3UQ2 A;  5F9N A;  3ZDE A;  4DFJ A;  4DLG A;  1H38 A;  4YVZ A;  1D9D A;  5DKW A;  4JV0 A;  4QZH A;  2BCR A;  1RPL A;  4I2D A;  5L1I A;  1ZQB A;  4I28 A;  4QZA A;  3MDC A;  3UXN A;  2J6U A;  2HHU A;  2F1I A;  1RYR A;  3TI0 A;  8ICH A;  2Q0Z X;  3MAB A;  7ICG A;  2ZJA A;  8ICO A;  4IR1 A;  3EWA A;  4ELU A;  3MR5 A;  4UBC A;  4GXJ A;  1JN3 A;  2F1H A;  3PW7 A;  1QSL A;  4BDP A;  9ICR A;  2XCA A;  7ICK A;  1XO1 A;  2IA6 A;  4ECR A;  9ICK A;  2A1J B;  1ZQI A;  8ICL A;  5DQG A;  4RZR A;  4Z6C A;  5J0S A;  4TQR A;  4DL7 A;  4IRC A;  4KLE A;  9ICP A;  2W9C A;  2R8J A;  5J2A A;  3BJY A;  3H40 A;  5KFV A;  5KFJ A;  4EBE A;  5DG7 A;  3Q8R B;  1A76 A;  3V7J A;  3T5K A;  5KFY A;  7ICQ A;  4YXM A;  4NM2 A;  3T5J A;  3NGD A;  1NJZ A;  8ICK A;  4ED0 A;  3GDX A;  3RBD A;  5KFP A;  5HHH A;  4FS2 A;  4KLI A;  4M6W A;  5DGA A;  4DL6 A;  1IXR A;  3MFH A;  1KEJ A;  3PO5 A;  4MEX A;  3GIM A;  1T7P A;  4B9L A;  4UB3 A;  4J9P A;  3ZDB A;  5KFA A;  5KFU A;  4O3P A;  4XQ8 A;  5KFF A;  1ZQA A;  4M9G A;  1MSW D;  7ICL A;  4I2C A;  2KZM A;  2W9C B;  1LB2 B;  1MC8 A;  1ZQN A;  2UVW A;  4RPX A;  3GV8 B;  1ZJM A;  8ICA A;  4RUA A;  4O0I A;  1JMS A;  5IIO A;  4RNO A;  3LK9 A;  4ECZ A;  4RQ6 A;  5IIJ A;  3MBY A;  4F5Q A;  4J9S A;  4EEY A;  2BCS A;  4JWN A;  2KFN A;  1NJY A;  9ICU A;  3FYH A;  4M6W B;  2BQR A;  5J0Q A;  3EW9 A;  5J2B A;  4B9T A;  4K4I A;  2W9A A;  5KTQ A;  3K75 D;  4O3Q A;  4DOA A;  5DG8 A;  2XGQ A;  3BDP A;  1ZQQ A;  2R8H A;  5J29 A;  4DOB A;  1BGX T;  2BHN A;  3JPP A;  3PX4 A;  3Q8Q B;  4ELT A;  4F92 B;  2W9B A;  3AUO A;  5J2E A;  3C23 A;  4KLL A;  4F4W A;  3QZ7 A;  4FS1 A;  3PW5 A;  4NLK A;  1JX4 A;  7ICP A;  4B9N A;  3RAX A;  1TK5 A;  5DDY A;  4RQ7 A;  4PHE A;  4DFK A;  5DBC A;  3TQ1 A;  2BPF A;  4KLF A;  4I2I A;  3G6Y A;  8ICB A;  5IIK A;  1X9W A;  5D46 A;  3NTU A;  3RJE A;  3IM1 A;  3QZ8 A;  1T3N A;  1QLN A;  7ICT A;  1TFR A;  4KLO A;  4B9U A;  2ZTD A;  3BQ0 A;  3HX0 A;  4ED1 A;  4PHD A;  5BOL A;  5DLG A;  3C5G A;  1COO A;  1SL2 A;  2HVH A;  4YN4 A;  2HHQ A;  3PW2 A;  2J6T A;  4Z6F A;  2B21 A;  5KFC A;  4DSK A;  7ICI A;  2MUT A;  4XRH A;  4NLN A;  4MFA A;  2BQU A;  1RYS A;  4KLM A;  2DFL A;  4LVS A;  1ZQX A;  5KT2 A;  4ED3 A;  3JPO A;  3PR5 B;  5IIL A;  2ZUC A;  3HP6 A;  5KFQ A;  3PW0 A;  1ZQE A;  4X5V A;  4J9N A;  1NKC A;  3OJS A;  8ICC A;  1KLN A;  5EWE A;  2BR0 A;  4I2B A;  4P2H A;  5KFW A;  9ICI A;  4QWE A;  1BPY A;  2KTQ A;  9ICG A;  5DQI A;  1KFS A;  7ICU A;  3ZDA A;  5J2G A;  3Q8P B;  4MFF A;  2HW3 A;  2MUT B;  4DS5 A;  2ISP A;  5KT7 A;  4KLS A;  3MGH A;  1NK8 A;  4Z6D A;  5KG4 A;  2ZUD A;  3H8J A;  4QZ9 A;  4LZG A;  8ICV A;  5KT6 A;  1XSN A;  1U4B A;  1X9S A;  1ZQZ A;  4O5E A;  2F1J A;  1V9P A;  4DQP A;  8ICM A;  4UBB A;  4F5N A;  3ZDD A;  4KLJ A;  4IQU A;  4QZD A;  1XSL A;  1ZQC A;  3RB6 A;  1DGS A;  5EWG A;  3RTV A;  5J0T A;  4YD2 A;  1NK6 A;  1BPX A;  2AJQ A;  2ASJ A;  1X9M A;  3EPG A;  1JXE A;  4QZG A;  4F5P A;  1TK8 A;  3MR2 A;  5F9L A;  2OWO A;  4FO6 A;  1ZQJ A;  4NXZ A;  4MF2 A;  2P6R A;  4KLH A;  4F4Z A;  9ICQ A;  2PFQ A;  3KTQ A;  1SZP A;  3KHG A;  2A1J A;  3SYZ A;  1NK4 A;  5KT3 A;  2C2R A;  1TAU A;  1U48 A;  3JPN A;  8ICR A;  4KLD A;  1C7Y A;  8ICJ A;  5J0R A;  4RQ4 A;  4I2H A;  3EYZ A;  2PI5 A;  4J9R A;  4NLG A;  5HP4 A;  4DSL A;  4IQV A;  4PH5 A;  5HNK A;  1KFD A;  2KZ3 A;  4DSI A;  4F5R A;  4I2J A;  1BPE A;  1X2I A;  3M9M B;  3H4D A;  2PXI A;  3Q8M A;  4UQG A;  4C8L A;  3GFK B;  4IRD A;  3UXO A;  5J2D A;  1ZQD A;  3V7L A;  2ASD A;  1XS9 D;  4ZH4 A;  4QZ8 A;  3LWM A;  9ICJ A;  4J9K A;  4R63 A;  4TUQ A;  2XC9 A;  5DLF A;  5IIN A;  1Y88 A;  3ISD A;  5KT5 A;  4EBC A;  2XY5 A;  1B22 A;  1JXL A;  4QW9 A;  1HJP A;  4MFC A;  3RRG A;  2P66 A;  4PGX A;  3HW8 A;  4JWM A;  5KFE A;  3GV5 B;  3V6K A;  1NK7 A;  4FBT A;  8ICW A;  5J0Y A;  4PPX A;  1KSP A;  7ICN A;  1RXW A;  8ICP A;  5J2K A;  2PFP A;  4RUC A;  4RQ1 A;  2JZB A;  5DBA A;  4I2A A;  3AU6 A;  4XA5 A;  3K4G A;  3RH5 A;  3GII A;  2BDP A;  4JUZ A;  1SKR A;  4HYK A;  1RZT A;  2FMS A;  2XO7 A;  3RRH A;  1ZJN A;  1SL0 A;  2JEI A;  4QZF A;  4RPY A;  4I29 A;  4BXO A;  2BCV A;  1TV9 A;  4I2G A;  2J6S A;  2P6U A;  4JV1 A;  5KFL A;  4KLU A;  1SKW A;  3RR7 A;  5J0O A;  4DL4 A;  2HHT A;  1TVA A;  1UA1 A;  8ICY A;  3TFS A;  2V9W A;  2JZB B;  1L5U A;  4YD1 A;  5KFD A;  5KFM A;  1ZET A;  1HUZ A;  4C8O A;  1N48 A;  1S97 A;  8ICT A;  5KFK A;  4ED2 A;  2DPJ A;  4O3O A;  3C1Y A;  9ICV A;  4TQS A;  4BXO B;  9ICS A;  2ATL A;  3UQ0 A;  4Q45 A;  1NJW A;  4R8U A;  4UB2 A;  4GXI A;  8ICG A;  9ICW A;  5J2J A;  3PW4 A;  3PX0 A;  2KFZ A;  8ICN A;  5J0W A;  4F4Y A;  4RQ8 A;  5KFH A;  4C8K A;  4QZE A;  3SZ2 A;  5CP2 A;  4DL2 A;  4DL5 A;  2PFO A;  9ICM A;  5L1K A;  2W9M A;  4B9V A;  2LYH A;  5HMM A;  4RQ0 A;  3JPT A;  9ICH A;  4E0D A;  2DPI A;  2ZUB A;  1XU4 A;  2JEG A;  4F4X A;  5CR0 A;  5L1L A;  4EBD A;  2FMP A;  3V72 A;  2VA8 A;  2V4Q A;  3MFI A;  4R8U B;  5J2F A;  3ISC A;  1N56 A;  1S77 D;  5KT4 A;  1NK5 A;  3KHL A;  4F3O A;  1XC9 A;  3PMN A;  9ICT A;  3N97 B;  3RB0 A;  2R8K A;  2C28 A;  9ICC A;  5HHI A;  1KRP A;  2R8G A;  5TZV A;  3PR4 A;  4R66 A;  1T4G A;  1L3V A;  4TUP A;  3UPQ A;  3RH4 A;  1TKD A;  4GLX A;  4DQS A;  4CCH A;  4M47 A;  4J9O A;  2BPG A;  5KG2 A;  2PFN A;  4NM1 A;  3IHQ B;  5DB8 A;  1BPZ A;  2ZTC A;  1WCL A;  4XUS A;  1L3S A;  1MQ3 A;  8ICZ A;  8ICI A;  2FPK A;  2NRZ A;  4IQW A;  3BQT A;  4PGY A;  2AGP A;  3MGI A;  1BVS A;  4KMU A;  4UB4 A;  2NRT A;  4QWC A;  3G6V A;  4EZ9 A;  1Z00 B;  4RNN A;  4Q44 A;  4O5K A;  3QE9 Y;  3ZD8 A;  1ZQR A;  4C8N A;  2NRW A;  5KFB A;  4M9N A;  3QEA Z;  4UAZ A;  3GIK A;  4DQI A;  4F8R A;  4P4O A;  1QTM A;  3MR6 A;  5L1J A;  4ED6 A;  3PY8 A;  4ECS A;  1SKS A;  3Q8L A;  4EYI B;  3ZD9 A;  2HHS A;  7ICO A;  3FDS A;  2V4R A;  5DB6 A;  4ECT A;  7ICJ A;  2IHM A;  1KDH A;  3M8R A;  4RNM A;  1D9F A;  4TUS A;  1L3T A;  4F2S A;  2XY6 A;  3OHA A;  3THV A;  1ZQW A;  2HHV A;  3PML A;  1BPD A;  2H5X A;  1UT5 A;  4UB5 A;  3JPS A;  4YMN A;  5CB1 A;  2W8L A;  3H8W A;  4O5C A;  2HHW A;  1IM4 A;  3T5H A;  7ICS A;  2BGW A;  2NRV A;  1K1Q A;  3Q8S B;  4RQ2 A;  4MF8 A;  5JUM A;  4PHA A;  3TAP A;  1ZQG A;  3RAQ A;  5III A;  4I2E A;  4ECY A;  5CA7 A;  1UA0 A;  5J0X A;  4F4K A;  5DQH A;  4YG2 A;  2IBK A;  4ED8 A;  4B9M A;  3MDA A;  1S0M A;  1NKE A;  4Q8E A;  1ZQS A;  4BGD A;  5KFO A;  4GXK A;  2FMQ A;  5KFG A;  4YFK A;  1TK0 A;  3TAR A;  4DL3 A;  2JEJ A;  4GC6 A;  3TAN A;  2BPC A;  5DB7 A;  2VA2 A;  5DG9 A;  4QW8 A;  3G6X A;  2ZJ5 A;  3OHB A;  1U45 A;  3RJF A;  4P4M A;  2BCQ A;  3LDA A;  3HPO A;  1MQ2 A;  1ZQF A;  1A77 A;  3EZ5 A;  4DLE A;  4M9H A;  1TAQ A;  4Q8F A;  3SV3 A;  5CJ7 A;  1QSY A;  2FLL A;  4GC7 A;  4FBU A;  3H7I A;  4UAY A;  2JEF A;  1T8E A;  1NOM A;  5IIM A;  3TAQ A;  1ZQL A;  4DEZ A;  5KFI A;  4QZB A;  3V7K A;  1L3U A;  4EZ6 A;  9ICF A;  2GWS A;  3LWL A;  3E2E A;  3H8S A;  5KG0 A;  3H4B A;  4M9L A;  1UT8 A;  4YP3 A;  4RPZ A;  5CHG A;  1B43 A;  4M0A A;  5BOM A;  9ICN A;  5KG7 A;  1S0V A;  3OSN A;  4P4P A;  5C5J A;  2HHX A;  4C8M A;  4R65 A;  5EWF A;  1U49 A;  3RJJ A;  3V6J A;  4ECV A;  1WCN A;  2UVR A;  2KZZ A;  1XWL A;  5KG3 A;  4DF8 A;  3OSP A;  3HT3 A;  1CUK A;  3C2K A;  1S10 A;  3BQ1 A;  2R8I A;  3RJH A;  4QWB A;  2UVV A;  2RDJ A;  3PVX A;  4KN7 A;  4IR9 A;  4JK1 A;  1PZN A;  4QWD A;  5J2I A;  5J0U A;  9ICE A;  4G3I A;  3SV4 A;  3SI8 A;  1U47 A;  2C2E A;  3RJK A;  3T5L A;  9ICA A;  2BKE A;  3B0X A;  5KG5 A;  4DWI A;  4YQW A;  4Z6E A;  1U9L A;  3KHH A;  3PV8 A;  3V6H A;  4RT2 A;  2XCP A;  9ICB A;  4YR0 A;  2I9G A;  4DS4 A;  3Q8K A;  4YR2 A;  2KN7 A;  2FPL A;  5KFZ A;  3JPQ A;  1ZQK A;  2FPM A;  3EPI A;  3UXP A;  1D8Y A;  3QEB Z;  3RBE A;  4M9J A;  4DF4 A;  4ECW A;  4YMO A;  1D8L A;  4LZD A;  2Y1J A;  1HUO A;  1ZQY A;  4PGQ A;  3GIJ A;  3C2L A;  4KTQ A;  4NY8 A;  2FLN A;  2MAX A;  4RQ3 A;  2AGO A;  4ECX A;  3PO4 A;  3RJG A;  2BCU A;  4KLT A;  1S76 D;  4BWJ A;  4BWM A;  4DFM A;  2AU0 A;  3GV7 B;  2IHN A;  3TFR A;  4O3R A;  2ASL A;  5L9X A;  1KTQ A;  5KFS A;  4K4G A;  2XY7 A;  3RB4 A;  7ICR A;  5DDM A;  1ZQH A;  3AU2 A;  4F2R A;  8ICQ A;  3ETL A;  1S9F A;  4RT3 A;  1Z00 A;  4UB1 A;  9ICL A;  4I27 A;  7ICV A;  5KFN A;  9ICX A;  3ORY A;  4TUR A;  4DO9 A;  1XSP A;  3GIL A;  4KLQ A;  1ZYQ A;  1ARO P;  3M9N B;  7ICH A;  7ICE A;  3ISB A;  4O9M A;  1JIH A;  4JV2 A;  1DOQ A;  1ZQU A;  4YMM A;  1ZQM A;  4M2Y A;  3ZDC A;  5DGB A;  3KHR A;  4DQR A;  4F91 B;  5J2H A;  2ISO A;  3C2M A;  2AGQ A;  2ZJ8 A;  4EYH B;  3RH6 A;  7ICM A;  7ICF A;  5CWR A;  4RU9 A;  1ZQV A;  4RQ5 A;  3RJI A;  1CEZ A;  4ELV A;  4UAW A;  1SL1 A;  2BQ3 A;  4F50 A;  4ED7 A;  3GQC A;  4DSF A;  3RB3 A;  1ZQO A;  1NJX A;  3PNC A;  2ZTE A;  3C21 A;  5KFX A;  3C1Z A;  5KG6 A;  5J2C A;  5HML A;  2C22 A;  1BPB A;  2W9B B;  1Z3E B;  4YCX A;  1RXV A;  3M8S A;  3BQ2 A;  2C2D A;  1ZQT A;  2VA3 A;  3C5F A;  4I2F A;  2WTF A;  4ECU A;  5KFT A;  4B9S A;  4J9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...