2LM1A

Solution nmr structure of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium target fr824d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEVYTSGKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase lid
publication title Northeast Structural Genomics Consortium Target FR824D
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2lm1A00
2LI6A 1KQQA 1KN5A 2JRZA 1RYUA 2OEHA 2EH9A 1KKXA 1IG6A 1C20A 2KK0A 2YQEA 2EQYA 2RQ5A 5CEHA 2CXYA 2LM1A 4LJXA 5K4LA 2JXJA
chains in the Genus database with same CATH superfamily
5KFFA 4ECSA 2WAQF 4B9SA 2KHQA 4JWNA 5KG3A 3SV3A 1V9PA 2RHFA 4ECYA 5KL8B 1RYUA 4NJ8A 4R63A 3H0RB 4RQ8A 4MF8A 1COOA 2E8MA 4DL4A 7ICUA 3ICXA 1ZOLA 4QWCA 4YXMA 1XO1A 8ICMA 3V7LA 1MQ2A 4ECTA 4KLDA 4Y2YA 3WK9A 2QLTA 2WB1C 4DFJA 2B6GA 5KG7A 1KDHA 5J8YA 4LVSA 3OPXA 9ICPA 1ZQUA 8ICOA 4QWDA 4J9QA 1ZQDA 3HPOA 4B9LA 1URJA 1TAQA 4I2FA 4ECWA 5L1KA 3RR7A 4DSIA 1S10A 1X42A 1QSYA 1IV8A 2HW3A 4UQGA 1SV0A 4KMUA 2RDIA 4C4SA 8ICHA 7ICFA 4C8MA 9ICLA 3DDHA 5G5GA 1JIHA 2R18A 1JALA 1K1SA 7ICTA 5IIIA 1C20A 4YN4A 1UCVA 3AMZA 3WK7A 3MR3A 1A76A 1RYSA 2JEIA 1JROA 5DBBA 2JH1A 4DS5A 1M6YA 3TANA 3RH6A 2KSOA 2W9BB 3BZCA 5AK6A 4NY8A 5IIOA 4Y2UA 2XY6A 3SAHA 4GXJA 2QB0B 5DBAA 4F5NA 4F5OA 4UAVA 5BOMA 5KFIA 3MR6A 1QQ5A 5AKXA 1SKSA 4I29A 4FO6A 2H3VA 3AM9A 4BX9C 2HOFA 4YR0A 3E0FA 3C29A 3VC8A 1SL1A 1Q3VA 4LZGA 1ZQXA 2G5IB 4F50A 5L1LA 4O3QA 3NVWA 2ZIVA 1A77A 9ICJA 4J9MA 2F76X 2FDRA 3H0LB 2QB1A 2EAMA 3U26A 1N5XA 3ETRA 1WCNA 1PZNA 3MR2A 9ICRA 3IG8A 1ZQMA 4YG2A 2LM1A 4QWBA 1JX4A 9ICKA 1X9SA 3Q8RB 4EX6A 3G6VA 1YT3A 2D3DA 4JV1A 4QZHA 1JRPA 5J2CA 1NK7A 1TKDA 2HHSA 5ALQA 2KIWA 2OCEA 3SAFA 5DDMA 3C2LA 2QARA 2K89A 4TUSA 4UAZA 3ZD9A 3PSPA 4QW9A 1J2NA 5ALPA 5AM0A 2XI9A 5EWGA 3SV4A 4PL1A 5ALHA 4ELVA 4UAUA 3PSTA 1L7PA 3H8JA 1Z4NA 5KT5A 8ICWA 3LVVA 1YZ6A 5GTIU 1L3TA 4DSJA 4DSLA 3RR8A 2DFLA 5L1MA 1Q3UA 5DKWA 1BPBA 3M7DA 1D8BA 3WK4A 7ICRA 2HBMA 2A3VA 1S5LU 1S0MA 2OWOA 4UW9A 3M8RA 3FDSA 4BWJA 4DL6A 2XIDA 1XO0A 1L8OA 5AI0A 3KHLA 3AU2A 2LYAA 3Q8KA 5F9NA 2P35A 4F93B 4IR9A 5KFWA 4YR2A 5KNIA 2IMWP 3T3FA 1FO4A 2GLEA 4NLNA 5JU5A 4ED7A 5KFMA 2BDPA 2AH5A 4ICAA 4F4KA 2KZ3A 5D46A 4OJOA 3HX0A 9ICBA 9ICXA 7ICHA 3RH4A 2XGQA 3FC4A 3Q8LA 1ZD4A 3EPGA 4Y2RA 4YMOA 3ISCA 2H5XA 1BPEA 5J0UA 1XU4A 3D6JA 1PK1B 1BPXA 5ALYA 4YXJA 2AQ4A 2PI4A 1MSWD 4KN4A 9ICIA 5C5JA 1MC8A 3HP6A 2MUTA 2I9GA 2NRVA 4O3SA 4KLLA 5HHHA 2QARB 5HMLA 5ALGA 5KFKA 1N5WA 2XY7A 4O9MA 4C80A 1DRGA 3GDXA 2W11A 3TARA 1FFUA 3B0YA 3F2DA 3RJIA 1DGJA 2HMXA 1RXVA 5IILA 3QU7A 3TADA 4DCCA 2E3TA 3JPSA 4RPYA 2FPKA 1DOQA 1MQ3A 4I2CA 3TAPA 4NM1A 1ECWA 5ALXA 3HILA 4JK1A 3BS5A 2HHXA 1NNLA 3CP8A 4QZ8A 2AGOA 4DFKA 5KT6A 4Q8EA 2B0CA 3QNMA 1X40A 7ICEA 5JRTA 2KFNA 3HWTA 9ICQA 1SZPA 3Q8SB 4IRDA 3RB3A 3AL0B 3KFUF 1S0VA 9ICVA 3RJEA 1IG6A 4ECVA 8ICCA 2RQ5A 5DG8A 2AGPA 4UB4A 2W9AA 4MHVA 3L4PA 1NK5A 4RQ5A 1BPYA 3RJKA 3QUTA 3PW5A 1KTQA 4DOBA 4PH5A 2HHVA 5ALRA 2HOIA 1KLNA 9ICNA 2KK0A 2FPLA 3SQIA 1PK3A 2KFZA 2FLLA 1RZTA 3R9KA 4FBUA 1JXLA 3JPTA 4HYKA 4QJFB 4DOCA 4UB2A 3H8SA 4F92B 4C8LA 8ICIA 1QCKA 4DL3A 5CR0A 5AKGA 2AHOB 2YB1A 2HBJA 1UT8A 4M6WB 5KFSA 1UA1A 3K75D 3SMVA 1B0XA 2HOQA 3CYMA 1NZBA 1COKA 3NRZA 2IOFA 4RT2A 1U48A 1C7YA 1ZQBA 2E8NA 4PHPA 3N7PD 4O5EA 5KTQA 3IP4B 3QU4A 2H3ZA 2FI1A 3BS5B 3SAGA 3BQTA 1ZQAA 3D2SA 4CDGA 1A6SA 2MA1A 2BQ3A 5A0LA 2LKYA 2ZIWB 2ZUBA 9ICAA 2EANA 5ALIA 4M2YA 2VA3A 4F2RA 4KLUA 5AK3A 1ZD5A 4R8UA 1X66A 9ICOA 5HNKA 2GH1A 4BUGA 1JMSA 3TKAA 3PW7A 2FMSA 2AGQA 3ED5A 4LZDA 2C2DA 4FZMA 1S76D 4DLEA 5FP0A 7ICIA 2V9WA 1ZQPA 8ICNA 1TAMA 4RUCA 3JPOA 2W7PA 2KKVA 1D9DA 3HT3A 1ZQHA 5AIBA 5J2IA 3L3FX 1U47A 3WKDA 4P0QA 4OO1J 1S9FA 3BDPA 4EYIB 4F5PA 1KFTA 5ALWA 2UVWA 2W3RA 4K4IA 1ZQQA 3SI8A 2OYYA 1ZQCA 4OCZA 5L9XA 2DGZA 8ICRA 2E8OA 4Z6EA 3GIJA 1F5SA 3JPRA 3NGDA 1ZJMA 2L5YA 4QZCA 4DL2A 8ICYA 4ED0A 4IL6U 5KFVA 1TK0A 5HMMA 1Z19A 8ICVA 4QZFA 5DQGA 3OJSA 1UA0A 1D8LA 3IV6A 1JI7A 2YY6A 4RQ2A 5F9LA 1RYRA 2IHNA 5EE9A 3ORYA 2WF8A 2WFAA 2EH9A 2FMPA 1HEKA 4GIBA 1EXNA 2I5HA 1NI3A 2DBYA 3KHRA 2PFPA 1RDFA 5J2AA 4GFJA 4ZH4A 3NTUA 3GIKA 7ICMA 5J0XA 8ICFA 4UARA 4KX5A 4CRXA 4PHAA 1AROP 3M8SA 4P2HA 3H0MB 4BDPA 3BJYA 3PZPA 4A8EA 1K5OA 1HIWA 4GXKA 1VLBA 2H3IA 2PFNA 4RNNA 3EPIA 3AU6A 2YTUA 3AN1A 2BPCA 2LMRA 4F91B 1KW4A 4YMMA 2BGWA 1QTMA 2PI5A 1RG6A 1KQQA 3RB6A 1MN8A 3ZDCA 3RF9A 1ZQIA 4KLQA 5KG5A 1TAUA 4AYBF 5ALOA 2BPFA 1N62A 1XSNA 1UQVA 2Y9TA 3QZ7A 1V97A 2Y1JA 3HRDD 4EEKA 4B9TA 4RQNA 3OSPA 4IS7A 1Z00B 2LYBA 1QSLA 2KJ8A 2NYVA 2LBOA 2FJ6A 3GV7B 4EBDA 4YCXA 2EQYA 4QWEA 3QEAZ 4F5RA 7ICSA 5BOLA 4CGZA 4Y2PA 3BS7A 2JZBA 4TUPA 3PV8A 3NVZA 4KMOB 1B4FA 2KTQA 1X6IA 3PR5B 2YB4A 5DQIA 3WKAA 1KFDA 3RJGA 3JPNA 4IRKA 1L8LA 4BJQA 1NK6A 5J0RA 1SZHA 1Z1VA 1O03A 5AKLA 2DKZA 3JPQA 4Z6CA 2ZTCA 1VJ5A 3LK9A 3MBYA 4TQRA 5B5EU 4NLBA 2J6SA 4QIWF 4KLHA 3KKAA 3N97B 1UT5A 4MEXA 3Q8PB 4I2AA 3ZI4A 4K4GA 2A1JB 2GO7A 2F1JA 4RU9A 3PR4A 4DFPA 4M47A 1J2MA 2HVHA 5ALTA 3PO5A 3PMLA 5GTHU 2YX8A 1SKRA 1ZQJA 2BCUA 3T5KA 3TFSA 1L7OA 1IM4A 2FMQA 4JUZA 3IN5A 3JPPA 4UAYA 1LV5A 4XQ8A 5KFJA 5J8YC 2DPJA 4OJLA 2WB1F 4C0ZA 4CCHA 4GC6A 5DBCA 4YR3A 8ICUA 4YVZA 3G6XA 1FEZA 5TISU 2XCPA 5AK5A 4UBBA 2BPGA 2VJ5A 2Z7JA 9ICGA 4Y2VA 5AKZA 2VA2A 2M9NA 1NOMA 1ZD2P 4F2SA 9ICHA 2NRTA 3CRXA 4Q8FA 1SV0C 4PL2A 4U7CA 4JWMA 1UPHA 5H2FU 2EZZA 5AM1A 1V85A 4DQSA 5KFOA 3OHAA 1TK5A 1PVQA 2J6UA 2RRDA 1NK9A 3SR6A 5TZVA 2KKPA 1RM6C 3L5KA 4F4XA 4QZDA 4RQMA 5J2KA 4RQ4A 3V7KA 3MGHA 2YMMA 4O3PA 5ALEA 2ODGA 2K4PA 5DG9A 2BR0A 1ZQ1C 2DL0A 4GC7A 4B9UA 1BVSA 2F2AB 4I2BA 5CEHA 3PSFA 2KSOB 1ZQFA 4MFFA 4RPZA 1BGXT 2LHTA 1WCLA 3PX4A 5EE3A 5AM3A 1Q46A 1A0PA 5ALKA 4C4RA 2W3SA 3PX6A 4KLGA 1OW5A 4KLEA 8ICEA 2B21A 3C5FA 4K4HA 3RRHA 3MR5A 5AIAA 5HR6A 4ED8A 4BWMA 5CJ7A 4O0IA 5AI4A 2KZZA 1ZQSA 4J03A 3H4BA 2ZIVB 4UB8U 3F2CA 1LKYA 3C5GA 1XS9D 3LDAA 4EYHB 4C8KA 1T4GA 4I2GA 2HI0A 1ZETA 5AM4A 2CN1A 1D9FA 1SIJA 2K8BB 2KZMA 1SWWA 1ZJNA 3VCBA 5AI9A 2E5SA 5DLGA 4I2IA 1ZQEA 5G5HA 1X2IA 4R66A 3QX7A 2KJ9A 3H4DA 1ZRNA 4C8OA 4ECXA 2MRLA 2JGAA 1ZXIA 1BNOA 1JN3A 4DL7A 5KFGA 5EWFA 2ASJA 2ZIXA 5ALNA 2KNJA 5J0TA 1NKCA 1B43A 2HHTA 5J0WA 1ZQYA 1WWUA 3QYPA 4O5KA 2C22A 1YZ7A 4J9SA 4F4YA 4NLGA 4RUAA 3WKBA 2FLNA 2BCVA 2PMZC 4RQ1A 3Q8MA 1N63A 4Y2TA 5J0QA 2XCAA 2C2EA 4IQVA 2W9CA 3H7IA 2XGPA 2JHDA 5D4BA 4ECUA 3Q8QB 2WF9A 2RLTA 5DB7A 5KL1B 3RJHA 4FS2A 1NK0A 2FE9A 2AJQA 2Y0SC 2WF7A 2LPEA 2R8HA 4NLKA 1X6JA 3RTVA 1Z3EB 1H38A 2IOFK 3FYHA 3RAXA 2CXYA 1U45A 3I1YA 1L6NA 1T3QA 1KFSA 2A19A 1RXWA 1SWVA 5AI5A 4KLFA 2F44A 5KFCA 4PGYA 1ZYQA 2IBKA 4F3OA 7ICJA 4PHEA 4JV0A 4NLCA 1N48A 2XVTA 2I1QA 5CHGA 2KE7A 1IIPA 4O3NA 2Y9UA 1LKYB 1TVAA 2ES6A 5KFAA 3N4MB 3V72A 3HW8A 4UATA 1ZD3A 2ISPA 5IIJA 3UMCA 1ZQVA 2YMPA 5D49A 1SV4A 4M9HA 2N1RA 2W54A 2MUTB 3RRGA 4PPXA 1PVPA 4B9MA 5KFPA 3K1RB 3GZFA 5J2JA 1DK3A 4CF3A 1ZQLA 1ZQGA 1TFRA 3WK6A 3UQ0A 8ICXA 1L3SA 3C21A 4UB3A 3TAQA 3RJJA 1AQ6A 4NL9A 3OTQA 2JXJA 3MGVA 1RQNA 3TADC 5CA7A 1JUDA 5E79U 1MA7A 3O0FA 2F77X 2NRXA 4NLZA 3D2QA 2JH7A 3I28A 3ONNA 2I6XA 5CB1A 5CWRA 5J2DA 3AEVA 4OD0A 2IHMA 3PX0A 3NRWA 3RBEA 3UMGA 5T14A 1WG8A 3ZDAA 8ICKA 4KN7A 3NVYA 1O08A 5KG2A 4NWIA 5AKJA 2C28A 4YD2A 3HKZC 7ICOA 4DF8A 2DPIA 3T5HA 3RJFA 3MFHA 1ZQOA 3UM9A 1QSSA 2W9MA 5AI8A 4NM2A 5IIMA 4M9JA 5EWEA 2KOBA 3T5LA 2VJ4A 2BQUA 2GWSA 3ZDDA 4ECRA 5AM2A 3WU2U 2WAQC 1DXSA 5J2EA 4P4OA 5AKKA 5KFEA 9ICUA 1RPLA 3M9NB 1IXRA 4Y2JA 2ZG6A 1S97A 4B9NA 4RQ0A 3H8MA 4Z6DA 1XWLA 5F3XB 1KSPA 4DQQA 4PZOA 4ACOA 5ALSA 1GO3F 3QU9A 4DQPA 3GILA 3H40A 3PW4A 3NS1A 5KFRA 4UAWA 2ZTDA 3GIIA 1DGSA 4WJ3B 1XSLA 5KAIU 3TI0A 3SD7A 4J9OA 4CF4A 4Y2SA 3UMBA 1WUDA 3ISBA 4EEYA 3PNCA 1L7NA 2JR5A 4EX7A 2PKEA 1ED1A 3M9OB 1CRXA 2F8LA 5KFYA 2DWQA 4QZAA 4R65A 1U49A 4Y2QA 4PGXA 4O3OA 5KT2A 4PGQA 4XA5A 1HUOA 5KFHA 1XNSA 2ALZA 2W55A 5EOZA 2YMQA 1CUKA 2ATLA 4KLSA 4DOAA 1KKXA 5JTIA 3QUCA 1NKEA 4DQRA 9ICMA 2ZXHA 2W9BA 4J9LA 5AI6A 4IQUA 4EZ9A 5KFUA 5DLFA 2PFOA 2VA8A 3MDCA 2QB0A 3KD3A 3KBBA 1CI4A 1WWVA 4JB3A 4YMNA 1ZRMA 3SYZA 2R8GA 4IR1A 3B9JA 3EYZA 4F72A 5KFTA 3MC1A 5KFNA 4R8UB 5ALFA 1RQLA 2XC9A 3RAQA 4J9NA 2KIVA 4U6PA 4I28A 8ICTA 3T79A 3A0BU 2K4EA 3E58A 4HAIA 7ICPA 3GU3A 5J29A 4E0DA 1L7MA 2W8KA 3CW2C 4O3RA 1F0MA 3M6ZA 4CE6A 2W04A 3ZDBA 2H3FA 3D2NA 4F5QA 1B22A 2ZTEA 4P0QB 4M04A 5J2FA 3E2EA 2A1AA 1V38A 3A0HU 5BPCA 2BCSA 5EE0A 1T94A 1NKBA 5ALZA 3UPQA 3ISDA 5J0PA 3PMNA 2BKEA 4NV0A 3SENA 2IA6A 5C0YA 2ZXIA 1QQ7A 3KZIU 5J0SA 8ICZA 4FZLA 4DFDA 4QZIA 2RDJA 2J6TA 4ED2A 4YP3A 1NJZA 1DK2A 2YN4A 1T8EA 2H3QA 2G5HB 4YD1A 1N61A 5KFBA 1PUZA 4F8RA 2EZYA 2R8IA 4C8NA 2E1FA 2G0AA 4PZNA 3GIMA 2OH2A 4Q44A 4UB1A 4KITB 3THVA 9ICSA 4MF2A 4UBCA 3SEIA 1S0NA 1NK4A 1ZQNA 5J2GA 3TFRA 2F3NA 3PW0A 3PW2A 3C2KA 1T3NA 2RP5A 1KL9A 2Q0ZX 4IQTA 2MAXA 1XSPA 5EE1A 4P4PA 4P4MA 4IC9A 2OXOA 2G07A 4TQSA 2YMLA 2HBLA 2KVSA 3CNHA 2M0NA 4RQ3A 4RNMA 4AP9A 5CRXA 4YQWA 2UVRA 4DQIA 2VKQA 2P6UA 4M9GA 2JEJA 4MFAA 4US9A 3IRUA 9ICFA 3T5JA 1SXEA 3IDWA 4I2JA 3QE9Y 1TE2A 4QZBA 3AQFA 4DSEA 3BQ0A 2KMDA 4M0AA 4DF4A 3LWLA 3PY8A 4ED1A 4UASA 3PO4A 1U9LA 4MEYA 4EENA 2KV2A 2C2RA 4DFMA 1TV9A 1PK1A 2R8KA 5AM5A 2ASLA 1OXJA 2ZIUA 4FFDA 4KTQA 3IG5A 3BQ2A 4KLIA 3RFAA 4B6JA 1L3VA 2FPMA 3ETLA 3V6KA 4QNLA 4NXZA 2ZUDA 5KT4A 2EAPA 4ECZA 1P7DA 2XY5A 4QW8A 3LWMA 2V4QA 4FZNA 2KG5A 2GOLA 4O3MA 5KT7A 3ALRA 2UVUA 1PVRA 3LYSA 2JRZA 3OHBA 3AQEA 3BQ1A 2W03A 4MFCA 2V4RA 2JZBB 4RNOA 1N2XA 4BXOA 2ZUCA 3M6KA 5AK4A 5KFLA 5ALLA 4RPXA 1BNPA 8ICJA 1CEZA 2VIXA 2XICA 3K1ZA 5AKYA 1D8YA 2HHQA 5J0OA 2LYHA 3C28A 3UQ2A 2KHVA 4GLXA 1ZQRA 3KKAC 3HJEA 2NO5A 3V6JA 2CPRA 5DG7A 2JV3A 3V7JA 1L3UA 3WKEA 4YFKA 4QZEA 3WK5A 4ELTA 2HSZA 1SGGA 1JXEA 2OHFA 2IOHA 3N7SC 7ICNA 3BZKA 3QEBZ 2DQNB 4XRHA 4R64A 2ZJ8A 2AQ0A 3WKCA 4EELA 4ECQA 3PSIA 1S77D 2AXTU 5ALMA 2NRWA 3GQCA 2ZJAA 5IIKA 2ESEA 2ISOA 2NO4A 4I2DA 1HUZA 4DEZA 3KHHA 9ICTA 8ICLA 3TQ1A 4UB5A 1N60A 1T7PA 3PVXA 2KP7A 4US8A 2DF4B 2E8PA 3FM9A 4ED6A 3ZDEA 3RB4A 2ZIUB 5HHIA 5ALJA 5JUMA 2BDUA 2CRXA 3F2BA 1X9XA 3M1YA 3RB0A 1SL0A 3TACB 4OJPA 1TK8A 3EZ5A 3NVVA 1Z1BA 5K4LA 3S6JA 2JEFA 2PFQA 3NUQA 1N56A 2HHWA 4ZOHC 1ZQWA 3UXNA 4PHDA 3EW9A 4M6WA 2EAOA 2HVIA 5L1IA 4EZ6A 2OM6A 2K4HA 2O6KA 4XUSA 5CP2A 4CF5A 1X9WA 5DB6A 4DO9A 4OJ6A 5ALDA 1ZQKA 2BCRA 3N7RC 4O5CA 4BXOB 4M9LA 2KD1A 3RBDA 3N28A 4TURA 4M9NA 2BQRA 3V6HA 4KLTA 4QZGA 8ICGA 1ZQTA 4DS4A 8ICQA 1QH9A 2ZIWA 3C23A 4KLOA 1VDVA 3QUBA 1KBUA 1J97A 5AKEA 2Q4TA 3F53A 2LM4A 4EBEA 2AU0A 3EUB2 3G6YA 4BGDA 2KN7A 4I2HA 4DWIA 4J9PA 1SL2A 2G06A 3ZD8A 2K4IA 2ASDA 1LVHA 1WYGA 2K60A 5DDYA 2D6FC 4Y2XA 1SKWA 2P6RA 3MDAA 5KG6A 4F4WA 5KFQA 4P0PA 3C1ZA 5B66U 1NJWA 3K4GA 5IINA 3FAHA 4Q43A 1Q8KA 5KG4A 2KEYA 1XC9A 3I76A 7ICVA 3MGIA 5DB9A 4F4ZA 4IRCA 3NASA 5DQHA 3UXPA 3WK8A 4QZ9A 2WF6A 1LB2B 4ED3A 2XO7A 1U4BA 4Q45A 3QU2A 7ICQA 4KLMA 5AICA 2ZIXB 4C4TA 3IM1A 7ICLA 3M9MB 3B0XA 4FS1A 1F44A 5ALUA 1SB3C 1FIQA 5HP4A 2G09A 2BZFA 3KOOA 5AHXA 2W8LA 1X9MA 2UVVA 2PMZF 1QLNA 4DL5A 2MU2A 5DGAA 1QQ6A 3BQ7A 2K8AA 3MABA 1S0OA 2DUYA 4GXIA 3MFIA 1ZQZA 2EZXA 4RZRA 1Z4OA 4B9VA 4QWAA 2D8CA 2W9CB 5J2HA 2WF5A 1UHUA 2JEGA 5AKIA 5J2BA 3QUQA 3LVWA 2F8KA 2R8JA 1NK8A 4JV2A 3GV5B 2Y0SF 5J0YA 2WTFA 2NRZA 4KX3A 5KG1A 4G9BA 5KT3A 2BCQA 4UB6U 2MSNA 1NZPA 1SXDA 4OJ5A 4Z6FA 3DV9A 3QU5A 4I27A 2HBKA 5KAFU 2FLPA 3UXOA 4I2EA 4PJ0U 1HJPA 8ICPA 4CNQA 4FBTA 3H8WA 4DLGA 3IHQB 5AKHA 3RH5A 5KFDA 5DB8A 1S8OA 2BHNA 4X5VA 1OUQA 7ICGA 1L5UA 2K8CB 1Y88A 2PXIA 2KJ5A 5L1JA 1BPDA 2YQEA 4JMUA 8ICSA 3KHGA 4DSKA 4P0PB 2Y1IA 2NV3A 4C7ZA 2F1IA 4RQ7A 3QZ8A 9ICWA 4LJXA 4AYBC 3F5AA 3F5EA 4NL9C 5DGBA 1KN5A 4IQWA 4RQ6A 1FFVA 4G3IA 4EBCA 4ELUA 2ZJ5A 5HR7A 8ICBA 3DEEA 4RT3A 1Z00A 3AUOA 2W7OA 9ICCA 2DKXA 4C7YA 4F71A 2HHUA 2WHEA 2HCFA 4J9KA 2LI6A 1NJYA 1NJXA 5ALVA 2W43A 9ICEA 1KRPA 3GFKB 2E1EA 2EDUA 4TUQA 4USAA 1BPZA 3QXGA 3J81j 2QKQA 3C1YA 3OGUA 4J9RA 2F1HA 4KLJA 5KG0A 7ICKA 3HKZF 2P66A 2KVCA 2JMGA 5KFZA 1KEJA 2VANA 3OSNA 1K1QA 3C2MA 3SZ2A 2OEHA 4DSFA 2KICA 5KFXA 8ICAA 4QIWC 3KTQA 4FE3A 2HDOA 3KZXA 3OJUA 3GV8B 2A1JA 3EWAA 2G08A
chains in the Genus database with same CATH topology
2LI6A 1KQQA 1KN5A 2JRZA 1RYUA 2OEHA 2EH9A 1KKXA 1IG6A 1C20A 2KK0A 2YQEA 2EQYA 2RQ5A 5CEHA 2CXYA 2LM1A 4LJXA 5K4LA 2JXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LI6 A;  1KQQ A;  1KN5 A;  2JRZ A;  1RYU A;  2OEH A;  2EH9 A;  1KKX A;  1IG6 A;  1C20 A;  2KK0 A;  2YQE A;  2EQY A;  2RQ5 A;  5CEH A;  2CXY A;  2LM1 A;  4LJX A;  5K4L A;  2JXJ A; 
#chains in the Genus database with same CATH topology
 5KFF A;  4ECS A;  2WAQ F;  4B9S A;  2KHQ A;  4JWN A;  5KG3 A;  3SV3 A;  1V9P A;  2RHF A;  4ECY A;  5KL8 B;  1RYU A;  4NJ8 A;  4R63 A;  3H0R B;  4RQ8 A;  4MF8 A;  1COO A;  2E8M A;  4DL4 A;  7ICU A;  3ICX A;  1ZOL A;  4QWC A;  4YXM A;  1XO1 A;  8ICM A;  3V7L A;  1MQ2 A;  4ECT A;  4KLD A;  4Y2Y A;  3WK9 A;  2QLT A;  2WB1 C;  4DFJ A;  2B6G A;  5KG7 A;  1KDH A;  5J8Y A;  4LVS A;  3OPX A;  9ICP A;  1ZQU A;  8ICO A;  4QWD A;  4J9Q A;  1ZQD A;  3HPO A;  4B9L A;  1URJ A;  1TAQ A;  4I2F A;  4ECW A;  5L1K A;  3RR7 A;  4DSI A;  1S10 A;  1X42 A;  1QSY A;  1IV8 A;  2HW3 A;  4UQG A;  1SV0 A;  4KMU A;  2RDI A;  4C4S A;  8ICH A;  7ICF A;  4C8M A;  9ICL A;  3DDH A;  5G5G A;  1JIH A;  2R18 A;  1JAL A;  1K1S A;  7ICT A;  5III A;  1C20 A;  4YN4 A;  1UCV A;  3AMZ A;  3WK7 A;  3MR3 A;  1A76 A;  1RYS A;  2JEI A;  1JRO A;  5DBB A;  2JH1 A;  4DS5 A;  1M6Y A;  3TAN A;  3RH6 A;  2KSO A;  2W9B B;  3BZC A;  5AK6 A;  4NY8 A;  5IIO A;  4Y2U A;  2XY6 A;  3SAH A;  4GXJ A;  2QB0 B;  5DBA A;  4F5N A;  4F5O A;  4UAV A;  5BOM A;  5KFI A;  3MR6 A;  1QQ5 A;  5AKX A;  1SKS A;  4I29 A;  4FO6 A;  2H3V A;  3AM9 A;  4BX9 C;  2HOF A;  4YR0 A;  3E0F A;  3C29 A;  3VC8 A;  1SL1 A;  1Q3V A;  4LZG A;  1ZQX A;  2G5I B;  4F50 A;  5L1L A;  4O3Q A;  3NVW A;  2ZIV A;  1A77 A;  9ICJ A;  4J9M A;  2F76 X;  2FDR A;  3H0L B;  2QB1 A;  2EAM A;  3U26 A;  1N5X A;  3ETR A;  1WCN A;  1PZN A;  3MR2 A;  9ICR A;  3IG8 A;  1ZQM A;  4YG2 A;  2LM1 A;  4QWB A;  1JX4 A;  9ICK A;  1X9S A;  3Q8R B;  4EX6 A;  3G6V A;  1YT3 A;  2D3D A;  4JV1 A;  4QZH A;  1JRP A;  5J2C A;  1NK7 A;  1TKD A;  2HHS A;  5ALQ A;  2KIW A;  2OCE A;  3SAF A;  5DDM A;  3C2L A;  2QAR A;  2K89 A;  4TUS A;  4UAZ A;  3ZD9 A;  3PSP A;  4QW9 A;  1J2N A;  5ALP A;  5AM0 A;  2XI9 A;  5EWG A;  3SV4 A;  4PL1 A;  5ALH A;  4ELV A;  4UAU A;  3PST A;  1L7P A;  3H8J A;  1Z4N A;  5KT5 A;  8ICW A;  3LVV A;  1YZ6 A;  5GTI U;  1L3T A;  4DSJ A;  4DSL A;  3RR8 A;  2DFL A;  5L1M A;  1Q3U A;  5DKW A;  1BPB A;  3M7D A;  1D8B A;  3WK4 A;  7ICR A;  2HBM A;  2A3V A;  1S5L U;  1S0M A;  2OWO A;  4UW9 A;  3M8R A;  3FDS A;  4BWJ A;  4DL6 A;  2XID A;  1XO0 A;  1L8O A;  5AI0 A;  3KHL A;  3AU2 A;  2LYA A;  3Q8K A;  5F9N A;  2P35 A;  4F93 B;  4IR9 A;  5KFW A;  4YR2 A;  5KNI A;  2IMW P;  3T3F A;  1FO4 A;  2GLE A;  4NLN A;  5JU5 A;  4ED7 A;  5KFM A;  2BDP A;  2AH5 A;  4ICA A;  4F4K A;  2KZ3 A;  5D46 A;  4OJO A;  3HX0 A;  9ICB A;  9ICX A;  7ICH A;  3RH4 A;  2XGQ A;  3FC4 A;  3Q8L A;  1ZD4 A;  3EPG A;  4Y2R A;  4YMO A;  3ISC A;  2H5X A;  1BPE A;  5J0U A;  1XU4 A;  3D6J A;  1PK1 B;  1BPX A;  5ALY A;  4YXJ A;  2AQ4 A;  2PI4 A;  1MSW D;  4KN4 A;  9ICI A;  5C5J A;  1MC8 A;  3HP6 A;  2MUT A;  2I9G A;  2NRV A;  4O3S A;  4KLL A;  5HHH A;  2QAR B;  5HML A;  5ALG A;  5KFK A;  1N5W A;  2XY7 A;  4O9M A;  4C80 A;  1DRG A;  3GDX A;  2W11 A;  3TAR A;  1FFU A;  3B0Y A;  3F2D A;  3RJI A;  1DGJ A;  2HMX A;  1RXV A;  5IIL A;  3QU7 A;  3TAD A;  4DCC A;  2E3T A;  3JPS A;  4RPY A;  2FPK A;  1DOQ A;  1MQ3 A;  4I2C A;  3TAP A;  4NM1 A;  1ECW A;  5ALX A;  3HIL A;  4JK1 A;  3BS5 A;  2HHX A;  1NNL A;  3CP8 A;  4QZ8 A;  2AGO A;  4DFK A;  5KT6 A;  4Q8E A;  2B0C A;  3QNM A;  1X40 A;  7ICE A;  5JRT A;  2KFN A;  3HWT A;  9ICQ A;  1SZP A;  3Q8S B;  4IRD A;  3RB3 A;  3AL0 B;  3KFU F;  1S0V A;  9ICV A;  3RJE A;  1IG6 A;  4ECV A;  8ICC A;  2RQ5 A;  5DG8 A;  2AGP A;  4UB4 A;  2W9A A;  4MHV A;  3L4P A;  1NK5 A;  4RQ5 A;  1BPY A;  3RJK A;  3QUT A;  3PW5 A;  1KTQ A;  4DOB A;  4PH5 A;  2HHV A;  5ALR A;  2HOI A;  1KLN A;  9ICN A;  2KK0 A;  2FPL A;  3SQI A;  1PK3 A;  2KFZ A;  2FLL A;  1RZT A;  3R9K A;  4FBU A;  1JXL A;  3JPT A;  4HYK A;  4QJF B;  4DOC A;  4UB2 A;  3H8S A;  4F92 B;  4C8L A;  8ICI A;  1QCK A;  4DL3 A;  5CR0 A;  5AKG A;  2AHO B;  2YB1 A;  2HBJ A;  1UT8 A;  4M6W B;  5KFS A;  1UA1 A;  3K75 D;  3SMV A;  1B0X A;  2HOQ A;  3CYM A;  1NZB A;  1COK A;  3NRZ A;  2IOF A;  4RT2 A;  1U48 A;  1C7Y A;  1ZQB A;  2E8N A;  4PHP A;  3N7P D;  4O5E A;  5KTQ A;  3IP4 B;  3QU4 A;  2H3Z A;  2FI1 A;  3BS5 B;  3SAG A;  3BQT A;  1ZQA A;  3D2S A;  4CDG A;  1A6S A;  2MA1 A;  2BQ3 A;  5A0L A;  2LKY A;  2ZIW B;  2ZUB A;  9ICA A;  2EAN A;  5ALI A;  4M2Y A;  2VA3 A;  4F2R A;  4KLU A;  5AK3 A;  1ZD5 A;  4R8U A;  1X66 A;  9ICO A;  5HNK A;  2GH1 A;  4BUG A;  1JMS A;  3TKA A;  3PW7 A;  2FMS A;  2AGQ A;  3ED5 A;  4LZD A;  2C2D A;  4FZM A;  1S76 D;  4DLE A;  5FP0 A;  7ICI A;  2V9W A;  1ZQP A;  8ICN A;  1TAM A;  4RUC A;  3JPO A;  2W7P A;  2KKV A;  1D9D A;  3HT3 A;  1ZQH A;  5AIB A;  5J2I A;  3L3F X;  1U47 A;  3WKD A;  4P0Q A;  4OO1 J;  1S9F A;  3BDP A;  4EYI B;  4F5P A;  1KFT A;  5ALW A;  2UVW A;  2W3R A;  4K4I A;  1ZQQ A;  3SI8 A;  2OYY A;  1ZQC A;  4OCZ A;  5L9X A;  2DGZ A;  8ICR A;  2E8O A;  4Z6E A;  3GIJ A;  1F5S A;  3JPR A;  3NGD A;  1ZJM A;  2L5Y A;  4QZC A;  4DL2 A;  8ICY A;  4ED0 A;  4IL6 U;  5KFV A;  1TK0 A;  5HMM A;  1Z19 A;  8ICV A;  4QZF A;  5DQG A;  3OJS A;  1UA0 A;  1D8L A;  3IV6 A;  1JI7 A;  2YY6 A;  4RQ2 A;  5F9L A;  1RYR A;  2IHN A;  5EE9 A;  3ORY A;  2WF8 A;  2WFA A;  2EH9 A;  2FMP A;  1HEK A;  4GIB A;  1EXN A;  2I5H A;  1NI3 A;  2DBY A;  3KHR A;  2PFP A;  1RDF A;  5J2A A;  4GFJ A;  4ZH4 A;  3NTU A;  3GIK A;  7ICM A;  5J0X A;  8ICF A;  4UAR A;  4KX5 A;  4CRX A;  4PHA A;  1ARO P;  3M8S A;  4P2H A;  3H0M B;  4BDP A;  3BJY A;  3PZP A;  4A8E A;  1K5O A;  1HIW A;  4GXK A;  1VLB A;  2H3I A;  2PFN A;  4RNN A;  3EPI A;  3AU6 A;  2YTU A;  3AN1 A;  2BPC A;  2LMR A;  4F91 B;  1KW4 A;  4YMM A;  2BGW A;  1QTM A;  2PI5 A;  1RG6 A;  1KQQ A;  3RB6 A;  1MN8 A;  3ZDC A;  3RF9 A;  1ZQI A;  4KLQ A;  5KG5 A;  1TAU A;  4AYB F;  5ALO A;  2BPF A;  1N62 A;  1XSN A;  1UQV A;  2Y9T A;  3QZ7 A;  1V97 A;  2Y1J A;  3HRD D;  4EEK A;  4B9T A;  4RQN A;  3OSP A;  4IS7 A;  1Z00 B;  2LYB A;  1QSL A;  2KJ8 A;  2NYV A;  2LBO A;  2FJ6 A;  3GV7 B;  4EBD A;  4YCX A;  2EQY A;  4QWE A;  3QEA Z;  4F5R A;  7ICS A;  5BOL A;  4CGZ A;  4Y2P A;  3BS7 A;  2JZB A;  4TUP A;  3PV8 A;  3NVZ A;  4KMO B;  1B4F A;  2KTQ A;  1X6I A;  3PR5 B;  2YB4 A;  5DQI A;  3WKA A;  1KFD A;  3RJG A;  3JPN A;  4IRK A;  1L8L A;  4BJQ A;  1NK6 A;  5J0R A;  1SZH A;  1Z1V A;  1O03 A;  5AKL A;  2DKZ A;  3JPQ A;  4Z6C A;  2ZTC A;  1VJ5 A;  3LK9 A;  3MBY A;  4TQR A;  5B5E U;  4NLB A;  2J6S A;  4QIW F;  4KLH A;  3KKA A;  3N97 B;  1UT5 A;  4MEX A;  3Q8P B;  4I2A A;  3ZI4 A;  4K4G A;  2A1J B;  2GO7 A;  2F1J A;  4RU9 A;  3PR4 A;  4DFP A;  4M47 A;  1J2M A;  2HVH A;  5ALT A;  3PO5 A;  3PML A;  5GTH U;  2YX8 A;  1SKR A;  1ZQJ A;  2BCU A;  3T5K A;  3TFS A;  1L7O A;  1IM4 A;  2FMQ A;  4JUZ A;  3IN5 A;  3JPP A;  4UAY A;  1LV5 A;  4XQ8 A;  5KFJ A;  5J8Y C;  2DPJ A;  4OJL A;  2WB1 F;  4C0Z A;  4CCH A;  4GC6 A;  5DBC A;  4YR3 A;  8ICU A;  4YVZ A;  3G6X A;  1FEZ A;  5TIS U;  2XCP A;  5AK5 A;  4UBB A;  2BPG A;  2VJ5 A;  2Z7J A;  9ICG A;  4Y2V A;  5AKZ A;  2VA2 A;  2M9N A;  1NOM A;  1ZD2 P;  4F2S A;  9ICH A;  2NRT A;  3CRX A;  4Q8F A;  1SV0 C;  4PL2 A;  4U7C A;  4JWM A;  1UPH A;  5H2F U;  2EZZ A;  5AM1 A;  1V85 A;  4DQS A;  5KFO A;  3OHA A;  1TK5 A;  1PVQ A;  2J6U A;  2RRD A;  1NK9 A;  3SR6 A;  5TZV A;  2KKP A;  1RM6 C;  3L5K A;  4F4X A;  4QZD A;  4RQM A;  5J2K A;  4RQ4 A;  3V7K A;  3MGH A;  2YMM A;  4O3P A;  5ALE A;  2ODG A;  2K4P A;  5DG9 A;  2BR0 A;  1ZQ1 C;  2DL0 A;  4GC7 A;  4B9U A;  1BVS A;  2F2A B;  4I2B A;  5CEH A;  3PSF A;  2KSO B;  1ZQF A;  4MFF A;  4RPZ A;  1BGX T;  2LHT A;  1WCL A;  3PX4 A;  5EE3 A;  5AM3 A;  1Q46 A;  1A0P A;  5ALK A;  4C4R A;  2W3S A;  3PX6 A;  4KLG A;  1OW5 A;  4KLE A;  8ICE A;  2B21 A;  3C5F A;  4K4H A;  3RRH A;  3MR5 A;  5AIA A;  5HR6 A;  4ED8 A;  4BWM A;  5CJ7 A;  4O0I A;  5AI4 A;  2KZZ A;  1ZQS A;  4J03 A;  3H4B A;  2ZIV B;  4UB8 U;  3F2C A;  1LKY A;  3C5G A;  1XS9 D;  3LDA A;  4EYH B;  4C8K A;  1T4G A;  4I2G A;  2HI0 A;  1ZET A;  5AM4 A;  2CN1 A;  1D9F A;  1SIJ A;  2K8B B;  2KZM A;  1SWW A;  1ZJN A;  3VCB A;  5AI9 A;  2E5S A;  5DLG A;  4I2I A;  1ZQE A;  5G5H A;  1X2I A;  4R66 A;  3QX7 A;  2KJ9 A;  3H4D A;  1ZRN A;  4C8O A;  4ECX A;  2MRL A;  2JGA A;  1ZXI A;  1BNO A;  1JN3 A;  4DL7 A;  5KFG A;  5EWF A;  2ASJ A;  2ZIX A;  5ALN A;  2KNJ A;  5J0T A;  1NKC A;  1B43 A;  2HHT A;  5J0W A;  1ZQY A;  1WWU A;  3QYP A;  4O5K A;  2C22 A;  1YZ7 A;  4J9S A;  4F4Y A;  4NLG A;  4RUA A;  3WKB A;  2FLN A;  2BCV A;  2PMZ C;  4RQ1 A;  3Q8M A;  1N63 A;  4Y2T A;  5J0Q A;  2XCA A;  2C2E A;  4IQV A;  2W9C A;  3H7I A;  2XGP A;  2JHD A;  5D4B A;  4ECU A;  3Q8Q B;  2WF9 A;  2RLT A;  5DB7 A;  5KL1 B;  3RJH A;  4FS2 A;  1NK0 A;  2FE9 A;  2AJQ A;  2Y0S C;  2WF7 A;  2LPE A;  2R8H A;  4NLK A;  1X6J A;  3RTV A;  1Z3E B;  1H38 A;  2IOF K;  3FYH A;  3RAX A;  2CXY A;  1U45 A;  3I1Y A;  1L6N A;  1T3Q A;  1KFS A;  2A19 A;  1RXW A;  1SWV A;  5AI5 A;  4KLF A;  2F44 A;  5KFC A;  4PGY A;  1ZYQ A;  2IBK A;  4F3O A;  7ICJ A;  4PHE A;  4JV0 A;  4NLC A;  1N48 A;  2XVT A;  2I1Q A;  5CHG A;  2KE7 A;  1IIP A;  4O3N A;  2Y9U A;  1LKY B;  1TVA A;  2ES6 A;  5KFA A;  3N4M B;  3V72 A;  3HW8 A;  4UAT A;  1ZD3 A;  2ISP A;  5IIJ A;  3UMC A;  1ZQV A;  2YMP A;  5D49 A;  1SV4 A;  4M9H A;  2N1R A;  2W54 A;  2MUT B;  3RRG A;  4PPX A;  1PVP A;  4B9M A;  5KFP A;  3K1R B;  3GZF A;  5J2J A;  1DK3 A;  4CF3 A;  1ZQL A;  1ZQG A;  1TFR A;  3WK6 A;  3UQ0 A;  8ICX A;  1L3S A;  3C21 A;  4UB3 A;  3TAQ A;  3RJJ A;  1AQ6 A;  4NL9 A;  3OTQ A;  2JXJ A;  3MGV A;  1RQN A;  3TAD C;  5CA7 A;  1JUD A;  5E79 U;  1MA7 A;  3O0F A;  2F77 X;  2NRX A;  4NLZ A;  3D2Q A;  2JH7 A;  3I28 A;  3ONN A;  2I6X A;  5CB1 A;  5CWR A;  5J2D A;  3AEV A;  4OD0 A;  2IHM A;  3PX0 A;  3NRW A;  3RBE A;  3UMG A;  5T14 A;  1WG8 A;  3ZDA A;  8ICK A;  4KN7 A;  3NVY A;  1O08 A;  5KG2 A;  4NWI A;  5AKJ A;  2C28 A;  4YD2 A;  3HKZ C;  7ICO A;  4DF8 A;  2DPI A;  3T5H A;  3RJF A;  3MFH A;  1ZQO A;  3UM9 A;  1QSS A;  2W9M A;  5AI8 A;  4NM2 A;  5IIM A;  4M9J A;  5EWE A;  2KOB A;  3T5L A;  2VJ4 A;  2BQU A;  2GWS A;  3ZDD A;  4ECR A;  5AM2 A;  3WU2 U;  2WAQ C;  1DXS A;  5J2E A;  4P4O A;  5AKK A;  5KFE A;  9ICU A;  1RPL A;  3M9N B;  1IXR A;  4Y2J A;  2ZG6 A;  1S97 A;  4B9N A;  4RQ0 A;  3H8M A;  4Z6D A;  1XWL A;  5F3X B;  1KSP A;  4DQQ A;  4PZO A;  4ACO A;  5ALS A;  1GO3 F;  3QU9 A;  4DQP A;  3GIL A;  3H40 A;  3PW4 A;  3NS1 A;  5KFR A;  4UAW A;  2ZTD A;  3GII A;  1DGS A;  4WJ3 B;  1XSL A;  5KAI U;  3TI0 A;  3SD7 A;  4J9O A;  4CF4 A;  4Y2S A;  3UMB A;  1WUD A;  3ISB A;  4EEY A;  3PNC A;  1L7N A;  2JR5 A;  4EX7 A;  2PKE A;  1ED1 A;  3M9O B;  1CRX A;  2F8L A;  5KFY A;  2DWQ A;  4QZA A;  4R65 A;  1U49 A;  4Y2Q A;  4PGX A;  4O3O A;  5KT2 A;  4PGQ A;  4XA5 A;  1HUO A;  5KFH A;  1XNS A;  2ALZ A;  2W55 A;  5EOZ A;  2YMQ A;  1CUK A;  2ATL A;  4KLS A;  4DOA A;  1KKX A;  5JTI A;  3QUC A;  1NKE A;  4DQR A;  9ICM A;  2ZXH A;  2W9B A;  4J9L A;  5AI6 A;  4IQU A;  4EZ9 A;  5KFU A;  5DLF A;  2PFO A;  2VA8 A;  3MDC A;  2QB0 A;  3KD3 A;  3KBB A;  1CI4 A;  1WWV A;  4JB3 A;  4YMN A;  1ZRM A;  3SYZ A;  2R8G A;  4IR1 A;  3B9J A;  3EYZ A;  4F72 A;  5KFT A;  3MC1 A;  5KFN A;  4R8U B;  5ALF A;  1RQL A;  2XC9 A;  3RAQ A;  4J9N A;  2KIV A;  4U6P A;  4I28 A;  8ICT A;  3T79 A;  3A0B U;  2K4E A;  3E58 A;  4HAI A;  7ICP A;  3GU3 A;  5J29 A;  4E0D A;  1L7M A;  2W8K A;  3CW2 C;  4O3R A;  1F0M A;  3M6Z A;  4CE6 A;  2W04 A;  3ZDB A;  2H3F A;  3D2N A;  4F5Q A;  1B22 A;  2ZTE A;  4P0Q B;  4M04 A;  5J2F A;  3E2E A;  2A1A A;  1V38 A;  3A0H U;  5BPC A;  2BCS A;  5EE0 A;  1T94 A;  1NKB A;  5ALZ A;  3UPQ A;  3ISD A;  5J0P A;  3PMN A;  2BKE A;  4NV0 A;  3SEN A;  2IA6 A;  5C0Y A;  2ZXI A;  1QQ7 A;  3KZI U;  5J0S A;  8ICZ A;  4FZL A;  4DFD A;  4QZI A;  2RDJ A;  2J6T A;  4ED2 A;  4YP3 A;  1NJZ A;  1DK2 A;  2YN4 A;  1T8E A;  2H3Q A;  2G5H B;  4YD1 A;  1N61 A;  5KFB A;  1PUZ A;  4F8R A;  2EZY A;  2R8I A;  4C8N A;  2E1F A;  2G0A A;  4PZN A;  3GIM A;  2OH2 A;  4Q44 A;  4UB1 A;  4KIT B;  3THV A;  9ICS A;  4MF2 A;  4UBC A;  3SEI A;  1S0N A;  1NK4 A;  1ZQN A;  5J2G A;  3TFR A;  2F3N A;  3PW0 A;  3PW2 A;  3C2K A;  1T3N A;  2RP5 A;  1KL9 A;  2Q0Z X;  4IQT A;  2MAX A;  1XSP A;  5EE1 A;  4P4P A;  4P4M A;  4IC9 A;  2OXO A;  2G07 A;  4TQS A;  2YML A;  2HBL A;  2KVS A;  3CNH A;  2M0N A;  4RQ3 A;  4RNM A;  4AP9 A;  5CRX A;  4YQW A;  2UVR A;  4DQI A;  2VKQ A;  2P6U A;  4M9G A;  2JEJ A;  4MFA A;  4US9 A;  3IRU A;  9ICF A;  3T5J A;  1SXE A;  3IDW A;  4I2J A;  3QE9 Y;  1TE2 A;  4QZB A;  3AQF A;  4DSE A;  3BQ0 A;  2KMD A;  4M0A A;  4DF4 A;  3LWL A;  3PY8 A;  4ED1 A;  4UAS A;  3PO4 A;  1U9L A;  4MEY A;  4EEN A;  2KV2 A;  2C2R A;  4DFM A;  1TV9 A;  1PK1 A;  2R8K A;  5AM5 A;  2ASL A;  1OXJ A;  2ZIU A;  4FFD A;  4KTQ A;  3IG5 A;  3BQ2 A;  4KLI A;  3RFA A;  4B6J A;  1L3V A;  2FPM A;  3ETL A;  3V6K A;  4QNL A;  4NXZ A;  2ZUD A;  5KT4 A;  2EAP A;  4ECZ A;  1P7D A;  2XY5 A;  4QW8 A;  3LWM A;  2V4Q A;  4FZN A;  2KG5 A;  2GOL A;  4O3M A;  5KT7 A;  3ALR A;  2UVU A;  1PVR A;  3LYS A;  2JRZ A;  3OHB A;  3AQE A;  3BQ1 A;  2W03 A;  4MFC A;  2V4R A;  2JZB B;  4RNO A;  1N2X A;  4BXO A;  2ZUC A;  3M6K A;  5AK4 A;  5KFL A;  5ALL A;  4RPX A;  1BNP A;  8ICJ A;  1CEZ A;  2VIX A;  2XIC A;  3K1Z A;  5AKY A;  1D8Y A;  2HHQ A;  5J0O A;  2LYH A;  3C28 A;  3UQ2 A;  2KHV A;  4GLX A;  1ZQR A;  3KKA C;  3HJE A;  2NO5 A;  3V6J A;  2CPR A;  5DG7 A;  2JV3 A;  3V7J A;  1L3U A;  3WKE A;  4YFK A;  4QZE A;  3WK5 A;  4ELT A;  2HSZ A;  1SGG A;  1JXE A;  2OHF A;  2IOH A;  3N7S C;  7ICN A;  3BZK A;  3QEB Z;  2DQN B;  4XRH A;  4R64 A;  2ZJ8 A;  2AQ0 A;  3WKC A;  4EEL A;  4ECQ A;  3PSI A;  1S77 D;  2AXT U;  5ALM A;  2NRW A;  3GQC A;  2ZJA A;  5IIK A;  2ESE A;  2ISO A;  2NO4 A;  4I2D A;  1HUZ A;  4DEZ A;  3KHH A;  9ICT A;  8ICL A;  3TQ1 A;  4UB5 A;  1N60 A;  1T7P A;  3PVX A;  2KP7 A;  4US8 A;  2DF4 B;  2E8P A;  3FM9 A;  4ED6 A;  3ZDE A;  3RB4 A;  2ZIU B;  5HHI A;  5ALJ A;  5JUM A;  2BDU A;  2CRX A;  3F2B A;  1X9X A;  3M1Y A;  3RB0 A;  1SL0 A;  3TAC B;  4OJP A;  1TK8 A;  3EZ5 A;  3NVV A;  1Z1B A;  5K4L A;  3S6J A;  2JEF A;  2PFQ A;  3NUQ A;  1N56 A;  2HHW A;  4ZOH C;  1ZQW A;  3UXN A;  4PHD A;  3EW9 A;  4M6W A;  2EAO A;  2HVI A;  5L1I A;  4EZ6 A;  2OM6 A;  2K4H A;  2O6K A;  4XUS A;  5CP2 A;  4CF5 A;  1X9W A;  5DB6 A;  4DO9 A;  4OJ6 A;  5ALD A;  1ZQK A;  2BCR A;  3N7R C;  4O5C A;  4BXO B;  4M9L A;  2KD1 A;  3RBD A;  3N28 A;  4TUR A;  4M9N A;  2BQR A;  3V6H A;  4KLT A;  4QZG A;  8ICG A;  1ZQT A;  4DS4 A;  8ICQ A;  1QH9 A;  2ZIW A;  3C23 A;  4KLO A;  1VDV A;  3QUB A;  1KBU A;  1J97 A;  5AKE A;  2Q4T A;  3F53 A;  2LM4 A;  4EBE A;  2AU0 A;  3EUB 2;  3G6Y A;  4BGD A;  2KN7 A;  4I2H A;  4DWI A;  4J9P A;  1SL2 A;  2G06 A;  3ZD8 A;  2K4I A;  2ASD A;  1LVH A;  1WYG A;  2K60 A;  5DDY A;  2D6F C;  4Y2X A;  1SKW A;  2P6R A;  3MDA A;  5KG6 A;  4F4W A;  5KFQ A;  4P0P A;  3C1Z A;  5B66 U;  1NJW A;  3K4G A;  5IIN A;  3FAH A;  4Q43 A;  1Q8K A;  5KG4 A;  2KEY A;  1XC9 A;  3I76 A;  7ICV A;  3MGI A;  5DB9 A;  4F4Z A;  4IRC A;  3NAS A;  5DQH A;  3UXP A;  3WK8 A;  4QZ9 A;  2WF6 A;  1LB2 B;  4ED3 A;  2XO7 A;  1U4B A;  4Q45 A;  3QU2 A;  7ICQ A;  4KLM A;  5AIC A;  2ZIX B;  4C4T A;  3IM1 A;  7ICL A;  3M9M B;  3B0X A;  4FS1 A;  1F44 A;  5ALU A;  1SB3 C;  1FIQ A;  5HP4 A;  2G09 A;  2BZF A;  3KOO A;  5AHX A;  2W8L A;  1X9M A;  2UVV A;  2PMZ F;  1QLN A;  4DL5 A;  2MU2 A;  5DGA A;  1QQ6 A;  3BQ7 A;  2K8A A;  3MAB A;  1S0O A;  2DUY A;  4GXI A;  3MFI A;  1ZQZ A;  2EZX A;  4RZR A;  1Z4O A;  4B9V A;  4QWA A;  2D8C A;  2W9C B;  5J2H A;  2WF5 A;  1UHU A;  2JEG A;  5AKI A;  5J2B A;  3QUQ A;  3LVW A;  2F8K A;  2R8J A;  1NK8 A;  4JV2 A;  3GV5 B;  2Y0S F;  5J0Y A;  2WTF A;  2NRZ A;  4KX3 A;  5KG1 A;  4G9B A;  5KT3 A;  2BCQ A;  4UB6 U;  2MSN A;  1NZP A;  1SXD A;  4OJ5 A;  4Z6F A;  3DV9 A;  3QU5 A;  4I27 A;  2HBK A;  5KAF U;  2FLP A;  3UXO A;  4I2E A;  4PJ0 U;  1HJP A;  8ICP A;  4CNQ A;  4FBT A;  3H8W A;  4DLG A;  3IHQ B;  5AKH A;  3RH5 A;  5KFD A;  5DB8 A;  1S8O A;  2BHN A;  4X5V A;  1OUQ A;  7ICG A;  1L5U A;  2K8C B;  1Y88 A;  2PXI A;  2KJ5 A;  5L1J A;  1BPD A;  2YQE A;  4JMU A;  8ICS A;  3KHG A;  4DSK A;  4P0P B;  2Y1I A;  2NV3 A;  4C7Z A;  2F1I A;  4RQ7 A;  3QZ8 A;  9ICW A;  4LJX A;  4AYB C;  3F5A A;  3F5E A;  4NL9 C;  5DGB A;  1KN5 A;  4IQW A;  4RQ6 A;  1FFV A;  4G3I A;  4EBC A;  4ELU A;  2ZJ5 A;  5HR7 A;  8ICB A;  3DEE A;  4RT3 A;  1Z00 A;  3AUO A;  2W7O A;  9ICC A;  2DKX A;  4C7Y A;  4F71 A;  2HHU A;  2WHE A;  2HCF A;  4J9K A;  2LI6 A;  1NJY A;  1NJX A;  5ALV A;  2W43 A;  9ICE A;  1KRP A;  3GFK B;  2E1E A;  2EDU A;  4TUQ A;  4USA A;  1BPZ A;  3QXG A;  3J81 j;  2QKQ A;  3C1Y A;  3OGU A;  4J9R A;  2F1H A;  4KLJ A;  5KG0 A;  7ICK A;  3HKZ F;  2P66 A;  2KVC A;  2JMG A;  5KFZ A;  1KEJ A;  2VAN A;  3OSN A;  1K1Q A;  3C2M A;  3SZ2 A;  2OEH A;  4DSF A;  2KIC A;  5KFX A;  8ICA A;  4QIW C;  3KTQ A;  4FE3 A;  2HDO A;  3KZX A;  3OJU A;  3GV8 B;  2A1J A;  3EWA A;  2G08 A; 
#chains in the Genus database with same CATH homology
 2LI6 A;  1KQQ A;  1KN5 A;  2JRZ A;  1RYU A;  2OEH A;  2EH9 A;  1KKX A;  1IG6 A;  1C20 A;  2KK0 A;  2YQE A;  2EQY A;  2RQ5 A;  5CEH A;  2CXY A;  2LM1 A;  4LJX A;  5K4L A;  2JXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...