2LM1A

Solution nmr structure of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium target fr824d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEVYTSGKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Northeast Structural Genomics Consortium Target FR824D
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords Lysine-specific demethylase lid
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2lm1A00
5CEHA 1C20A 5K4LA 2CXYA 1KN5A 4LJXA 2OEHA 1RYUA 2EH9A 2JXJA 2JRZA 1KKXA 2YQEA 1IG6A 2EQYA 2KK0A 1KQQA 2RQ5A 2LM1A 2LI6A
chains in the Genus database with same CATH superfamily
2B0CA 3KOOA 5JU5A 3C2LA 4DSJA 2KHQA 1TAMA 4MEYA 5ALZA 3LYSA 4UQGA 4EX6A 3L3FX 4QZGA 1QTMA 4TUPA 1OXJA 3A0BU 2AH5A 2W9AA 1TKDA 2W9CA 2PKEA 1QQ5A 5HHIA 1X40A 1N61A 4UATA 4KLHA 4JUZA 4GXKA 4YD1A 2LPEA 3K75D 5J0PA 3FDSA 4IRDA 1S76D 2JHDA 3GIJA 2BCQA 3B9JA 1L7PA 1WYGA 4Y2TA 3GILA 4DSIA 8ICJA 4UBBA 2ATLA 3EWAA 4O3NA 3VC8A 2NV3A 5J29A 3QU5A 4AYBC 2A19A 2MAXA 3EYZA 3AUOA 2R18A 4US8A 2P6UA 3FM9A 3K4GA 2OCEA 2B21A 5BOMA 3I76A 5KAFU 4UBCA 4ED2A 4O3RA 2JV3A 2EDUA 3ZD8A 3I1YA 4YXMA 5GTIU 2O6KA 4QZ9A 4AYBF 1ZQRA 4RUCA 2ZIVA 4GFJA 3KHHA 3HPOA 4YXJA 1RYUA 3M6KA 1JIHA 3H8JA 1QQ7A 4PHEA 1B4FA 9ICXA 2H3FA 4B6JA 3D2SA 4FBUA 1B43A 2K4PA 9ICPA 4CNQA 3F2BA 2G06A 4M9LA 2C2DA 3O0FA 1U48A 1NZPA 7ICPA 4O3QA 2NYVA 1PK3A 3PSTA 1TAUA 2V9WA 5KFIA 3V7LA 4IL6U 1F44A 4KLOA 4BWJA 4Q43A 3G6XA 5ALGA 2AQ0A 3BQ1A 2XGPA 4DQQA 3B0YA 3PSFA 3NGDA 1NJZA 4R65A 1COOA 4DOCA 1N63A 2FLNA 7ICRA 3UQ2A 1ZQAA 4YR0A 1A6SA 2A1JB 1ZQHA 5EWGA 5GTHU 3N4MB 1L3VA 5J2JA 4J9NA 2DWQA 2IHMA 5EWFA 2IOFK 1BVSA 4F50A 5AK5A 2EAPA 1LV5A 1SWWA 8ICCA 5ALVA 2KEYA 5EE0A 1KFDA 3A0HU 3N28A 4RPYA 5KL8B 1S0MA 3PR5B 5KTQA 1SXEA 4DF4A 2BCUA 4P2HA 2BDUA 2FPLA 4PL1A 1SZPA 3SV4A 3BZCA 2WF7A 3CW2C 3ZDCA 1BNPA 1QSYA 3GU3A 3SENA 5IIIA 1SZHA 5J8YA 1A76A 4QZCA 2XY5A 3RBEA 2HBLA 1SGGA 8ICYA 2JXJA 8ICVA 4ZOHC 4RNOA 4WJ3B 3NVWA 5TZVA 3CRXA 1EXNA 4F5PA 1TK5A 4M9GA 3WK7A 1X6JA 2XY7A 3H0MB 5L1JA 4DSKA 1OUQA 1Q3UA 2NRVA 5ALUA 1URJA 4ECZA 4UB6U 2K4HA 3QXGA 4KX3A 3KZXA 4Y2PA 5KFXA 4NXZA 4JK1A 5ALYA 1C7YA 5AI9A 3PO5A 3DEEA 4IR9A 4YQWA 1UA1A 2HHXA 2WFAA 4I29A 2KVCA 4JWNA 4EBDA 4J9MA 4B9NA 2WF8A 4I27A 4IRCA 2ZUDA 4MFCA 2PXIA 5KG0A 1S77D 2OHFA 5D4BA 2DBYA 4QZIA 4OJOA 1ZQIA 3F53A 2EZZA 4QJFB 3UXPA 2I6XA 1KW4A 2ESEA 1SV0A 5J0RA 2BPFA 4NM1A 4TQRA 5J2DA 2F77X 1ZQWA 3ISCA 4RQ4A 4B9UA 3HWTA 3TANA 5AKIA 4MF2A 3N7PD 3QUQA 3UXOA 2WB1C 2W9BA 2PI5A 3TADA 4KLUA 7ICFA 3KTQA 3WK6A 3C21A 3Q8LA 1IG6A 4K4HA 3KKAC 1TE2A 1A0PA 3MR2A 5KT5A 8ICHA 3LVVA 1T3QA 1ZQQA 3TKAA 2HHUA 3F5AA 2J6UA 2NRWA 5KFJA 3MBYA 1SV4A 1ZQZA 2UVUA 4YMOA 5AI8A 3ZDDA 4F4YA 3E0FA 3UPQA 3RTVA 3MGVA 4HAIA 4YR3A 3PX0A 4QIWC 4R64A 4DS4A 5ALPA 4RQ5A 4I2FA 3Q8PB 1VLBA 4PGQA 4Q8FA 1HIWA 1SIJA 4M47A 4RZRA 1KTQA 1WUDA 2HVHA 5B5EU 2LKYA 4P0PA 3AEVA 2Y1JA 4RNNA 1TV9A 1Q8KA 2XICA 2YY6A 3BQTA 2L5YA 5KT6A 1ED1A 5DQHA 5AI0A 3Q8KA 5F9LA 5KFZA 1IV8A 2AGQA 1BPYA 1U47A 4KLIA 1BGXT 5KG1A 2KVSA 7ICIA 2Q4TA 3IP4B 2P66A 5DDMA 3G6YA 8ICBA 7ICOA 5KG6A 5DGBA 2I1QA 4NL9A 4Y2QA 1PUZA 5KFRA 3OSPA 1ZD4A 1SL2A 4E0DA 4RU9A 5KFUA 1RYSA 4YG2A 5KFPA 1N60A 4FBTA 1ZJNA 5AKGA 1BPEA 1RPLA 5AKLA 9ICNA 3PNCA 4EELA 3GZFA 4M0AA 3OJUA 4KLSA 1MA7A 5DKWA 1CRXA 5H2FU 3RH5A 2KZZA 4Y2UA 3H40A 7ICKA 4DCCA 2KIVA 1XNSA 1TK0A 5ALTA 5DLFA 4J9OA 4JV2A 5J2HA 5J2FA 1T7PA 2ZG6A 1V85A 3E2EA 3SMVA 1P7DA 2MU2A 4XA5A 2W43A 5J2AA 4ELUA 5DBCA 2DGZA 4B9TA 2DKZA 5CEHA 7ICGA 4FO6A 3HJEA 4O3SA 3HT3A 1DGJA 2PFPA 4OJLA 3THVA 2W9CB 4O5EA 1UPHA 1JX4A 4O3PA 2FI1A 2LYAA 3C29A 3V6JA 3C2MA 3FAHA 5HMLA 9ICBA 2D3DA 2W3RA 1ZQSA 2W04A 1KFSA 5CP2A 4M6WA 2HHQA 4MFFA 4DSFA 4ED0A 1RZTA 1DOQA 1JUDA 4XUSA 1U45A 5ALKA 4YD2A 4GLXA 3EW9A 2K60A 1L8OA 3KD3A 2PI4A 2YTUA 2QARA 3V72A 3MFHA 5AKKA 2AU0A 5ALQA 4G3IA 2BZFA 4F4ZA 2HOFA 3NVZA 2HVIA 3QEAZ 4R8UB 3AU2A 9ICAA 4B9SA 1SWVA 3T5JA 1MN8A 2VJ5A 2D8CA 2CPRA 3ICXA 4I2HA 3AQFA 1XSLA 2E1FA 1Z4NA 4QW8A 1ECWA 5DBAA 3U26A 3AQEA 1S0OA 2KFNA 1FFVA 3M9NB 3GFKB 3ISBA 2XCAA 3RB6A 5IIKA 4TUSA 3ISDA 1MQ2A 4ACOA 1N62A 3QU9A 3QEBZ 2BDPA 8ICPA 4PPXA 7ICTA 2YMPA 3LWLA 3Q8MA 2ZIUB 1O03A 1X9MA 4DEZA 1L8LA 4RQ0A 2KICA 1D9FA 9ICKA 3CYMA 1NZBA 7ICEA 5ALHA 1C20A 4NLCA 3QYPA 2WHEA 5AKJA 4UB3A 1JN3A 3N7SC 1ZQJA 1N5WA 3D2QA 5DLGA 2F1HA 4KLTA 3OHAA 8ICSA 1SL1A 4I2CA 2JEJA 4KLEA 1IXRA 1H38A 3MR5A 3TQ1A 4DOAA 2E8NA 2LM1A 9ICJA 2XIDA 5AM0A 3QUBA 4CRXA 1NKBA 1L7OA 2IOHA 2W9MA 2WAQC 1FFUA 4ELTA 1WCNA 2LYBA 1ZQVA 1Q3VA 3RJGA 5ALMA 3JPPA 2ZJAA 2OM6A 3L5KA 4KLFA 9ICMA 2DPJA 4Y2XA 4IQVA 1TK8A 3RR8A 4NLGA 4UAZA 3Q8QB 1HUOA 2VIXA 5L1LA 5AI4A 2VKQA 5E79U 3SQIA 4YMMA 4RQ1A 4ED3A 2ZUBA 3ZDEA 4KTQA 5CHGA 4QWCA 1S0VA 4DWIA 4ED1A 5KFYA 4PGYA 4RQ2A 3AU6A 3RH4A 5DG8A 2KSOB 3PZPA 3QX7A 3SV3A 2IOFA 4ECSA 2FLPA 4GXIA 5J0SA 2HOIA 1IM4A 4M04A 3UQ0A 2ISPA 3JPSA 3C5GA 1ZD3A 5ALXA 4X5VA 2R8KA 1Y88A 2FJ6A 5C5JA 3TI0A 3UMGA 1N2XA 4IR1A 5HR7A 2KZMA 4BGDA 1PZNA 8ICKA 5KG5A 4P4OA 5KFCA 4DFPA 4ED6A 3T5KA 9ICCA 4Z6CA 3QUTA 5AK6A 2MRLA 2VJ4A 5AKYA 3MFIA 3MR3A 3RB3A 3PO4A 4Z6DA 1SKWA 4ICAA 3GIIA 4DFJA 2HHWA 9ICGA 4C8LA 2ZJ5A 3QE9Y 3JPQA 4JV0A 1UQVA 2R8IA 2A1AA 3NTUA 3SAFA 2YMLA 1X9WA 1VDVA 4M2YA 4UAUA 3LWMA 4ED8A 1KL9A 5KAIU 5ALWA 1KQQA 2DKXA 2K4IA 2Q0ZX 4UB4A 3K1ZA 4R66A 4NLNA 3GV7B 5L1KA 4QZBA 5KNIA 1L7NA 2W54A 2PFOA 9ICIA 1X9XA 5JRTA 1BPBA 1RQLA 9ICQA 3H0LB 4XQ8A 4PHPA 3OSNA 4U7CA 2MSNA 2A3VA 5K4LA 4A8EA 1COKA 3EZ5A 3ETLA 1ZQEA 2PMZF 4PHDA 3ZDAA 2OEHA 5KFWA 3F2CA 2C2RA 1J2NA 7ICJA 2MUTB 1U4BA 3AM9A 4NWIA 3TFSA 2LYHA 5AICA 2HBMA 5ALLA 2ZJ8A 4C8NA 4CGZA 2DQNB 9ICVA 2KN7A 2F2AB 2KZ3A 4DQRA 4P0QB 1JALA 2LHTA 1N5XA 4KLJA 4KLQA 1QCKA 1S10A 5CA7A 3ORYA 2GH1A 3KFUF 4DQPA 3R9KA 2ZUCA 2VA8A 3RB0A 4EENA 4O0IA 2W3SA 4J03A 3EPIA 1A77A 1S9FA 4NLZA 1XWLA 2KJ9A 4OCZA 4Y2VA 4DF8A 4FE3A 3V7KA 7ICNA 3F5EA 4GXJA 8ICWA 1XO1A 3QNMA 4RQ8A 4J9PA 1MQ3A 1ZQFA 3N7RC 4DQSA 2YB4A 1ZQOA 2KKVA 4ECTA 3KBBA 3QZ7A 2OWOA 4DFKA 3H7IA 1ZD5A 2ZIWA 3C1YA 1NJYA 1PK1A 4ECWA 4EEYA 9ICHA 5KFSA 1NK9A 4O5CA 2ASDA 2G0AA 2F1JA 1X6IA 2YN4A 1RG6A 3RH6A 5G5HA 5BPCA 3D6JA 2QARB 4NLBA 2ZXIA 2RDJA 2BHNA 1NKCA 3RJFA 1ZYQA 5B66U 4ELVA 4MHVA 2W9BB 1PVPA 3L4PA 2E5SA 2C2EA 5J0OA 9ICSA 4UASA 2IBKA 3EUB2 4KLLA 2BCVA 4CE6A 3PW2A 1Z1VA 2OYYA 3MGHA 5AI5A 2E8MA 4IS7A 2IHNA 4NLKA 3DDHA 1SKRA 4TQSA 4P0QA 3RRHA 3SZ2A 3BQ2A 1UCVA 2F76X 4C8MA 2LBOA 2ASJA 2BCRA 1DXSA 3KKAA 1DRGA 4ECYA 4C80A 4Z6EA 3OTQA 4DL3A 4B9VA 1BPZA 4QZ8A 5DB7A 5F9NA 4KLMA 9ICLA 2YB1A 4FZMA 4I2EA 4KLGA 4RQ6A 4C8KA 3SYZA 3WKAA 3NVYA 3ZI4A 2F1IA 3AMZA 2BKEA 3TAQA 1U9LA 1ZQGA 1JXEA 3HILA 4BXOA 4I2GA 3RJJA 2DUYA 2P35A 1KEJA 1GO3F 1DGSA 2QB0A 2GOLA 4RQNA 5CWRA 4Y2JA 1DK2A 1NK8A 1FO4A 4Q44A 2K8CB 4EYHB 5J0TA 2IMWP 3H4DA 4KN4A 1BPDA 4YMNA 3J81j 1JMSA 1SKSA 1ZQMA 3CP8A 4K4GA 4UB1A 1RYRA 3PX4A 4F5RA 2W7OA 5AKXA 2HCFA 2NRZA 2WB1F 1WCLA 1WWUA 1J2MA 3SR6A 1ZQYA 3OJSA 2W8KA 4C7ZA 1XO0A 5KT3A 2AGPA 1SV0C 2BPGA 8ICMA 1RDFA 5ALFA 4TUQA 1ZQNA 5HMMA 2OXOA 2ZIXB 8ICZA 9ICOA 3PMLA 1KN5A 2G09A 3B0XA 4YCXA 3KHGA 3TARA 8ICRA 2Y9UA 4RT2A 5J2CA 1Z1BA 1L3TA 4UB8U 7ICLA 4DLEA 1X9SA 2YMMA 3PSPA 1CUKA 2JZBB 1T8EA 2W55A 4C4RA 3GDXA 2WTFA 2AXTU 3T5HA 2ASLA 3BQ0A 1O08A 2Z7JA 4GC7A 1SL0A 1ZQLA 1ZETA 1CI4A 2ZIUA 1MSWD 4F2RA 8ICNA 1ZQ1C 1LKYB 2HHVA 4RUAA 4Y2YA 2BR0A 4CCHA 5DGAA 4B9LA 2HW3A 2CN1A 4LVSA 1KKXA 2H3VA 4EEKA 1QQ6A 4RQMA 2BQRA 3RJEA 8ICEA 8ICUA 3LK9A 4TURA 3PW7A 1V97A 4RNMA 4F3OA 4KITB 5AM5A 2ZXHA 3M8SA 1HJPA 2KOBA 4EYIB 4J9RA 2HHTA 5J0UA 3BJYA 4DL4A 2Y0SF 3QUCA 2KE7A 1NNLA 7ICVA 3MDAA 3PW5A 1X42A 4Z6FA 3WU2U 2I9GA 3ETRA 2FLLA 4PJ0U 3HW8A 4I2DA 5J2EA 5KT2A 2PFNA 4I2IA 9ICUA 2V4QA 3C23A 3PV8A 1XU4A 4LZDA 3IN5A 4QWBA 3KHRA 4LZGA 3ZD9A 1L7MA 4Q45A 1UT5A 2QB1A 3PVXA 3QU4A 5DDYA 4ECUA 1ZQCA 2UVWA 2Y1IA 7ICHA 2MA1A 1T3NA 2XI9A 4QWEA 4ECXA 4F93B 3GQCA 2JH7A 2D6FC 3SD7A 4R8UA 3WK9A 3C5FA 4M9NA 2F3NA 4PL2A 5AHXA 1KSPA 3GV8B 4FZLA 1D8YA 5IINA 3M7DA 1XS9D 2HHSA 2QLTA 4CF4A 3IRUA 2HDOA 3WK4A 5BOLA 4OO1J 8ICIA 2JR5A 3MDCA 1FEZA 3N97B 2JGAA 2HBJA 3G6VA 3T5LA 1Z00B 4F5OA 1F0MA 3PX6A 2NRTA 2RRDA 3JPRA 1TFRA 4MFAA 4F4KA 2NRXA 3QZ8A 4PHAA 4RQ3A 3RJHA 3TAPA 3QU7A 1V38A 8ICFA 1S8OA 4DQIA 2Y9TA 5AM2A 4CDGA 1N48A 4M9HA 2DF4B 4FZNA 4F91B 4HYKA 1KLNA 1ZD2P 1X2IA 3ONNA 9ICTA 2RQ5A 9ICEA 2WAQF 2ZTCA 1VJ5A 1ZQUA 5J8YC 1QSSA 2KP7A 2RLTA 3Q8SB 1ZQPA 3KHLA 3M9OB 5J2GA 2R8HA 3K1RB 4EX7A 5A0LA 4DL6A 4EBCA 2K89A 5HNKA 1MC8A 3M1YA 5ALNA 2PMZC 4JB3A 2KHVA 5AIBA 5KFEA 5ALSA 4US9A 2H3IA 3WKCA 1B22A 5KFLA 4QWDA 8ICTA 7ICQA 5DQGA 2KG5A 3NRWA 1QSLA 3V7JA 4IQWA 3SI8A 2YQEA 2B6GA 3FC4A 3RFAA 4BWMA 4OD0A 3WKDA 4O9MA 3UMBA 3OPXA 3BDPA 1QH9A 1KRPA 3C2KA 2ISOA 4EZ6A 1YZ7A 3F2DA 5HP4A 1ZQDA 1ZQTA 1LVHA 2OH2A 5KL1B 2NO5A 4QZDA 3KZIU 1U49A 2Y0SC 2GO7A 2LMRA 4PZOA 2C22A 2P6RA 1FIQA 2KMDA 2KKPA 4NV0A 4J9SA 4EBEA 3OHBA 3IM1A 5KFFA 1S97A 3HKZF 2GWSA 4BUGA 1HUZA 3NASA 9ICRA 1LKYA 2K8BB 2FMQA 3IG5A 5D46A 3NRZA 2FE9A 3V6HA 3NUQA 1L6NA 3D2NA 5IIMA 2R8JA 3UM9A 3BS7A 5KFNA 4RPZA 3HX0A 2F8KA 1V9PA 4I28A 2K4EA 2VA2A 1BNOA 1TVAA 3NVVA 3PSIA 5DBBA 2KK0A 5AK3A 2EZYA 4F71A 4XRHA 5DB6A 4F4WA 2HSZA 2PFQA 2HI0A 5L9XA 1T94A 3IV6A 4NY8A 5T14A 1NJXA 2QKQA 3JPTA 2ALZA 1JXLA 1QLNA 4OJ6A 3HRDD 4QWAA 5KFGA 3WKBA 4MF8A 4DSEA 4IQTA 1UA0A 1UHUA 3TFRA 4QW9A 5AKZA 5J2IA 4KX5A 1X66A 4UB5A 4RQ7A 3IDWA 2XCPA 1Z19A 2CRXA 5J2KA 4BJQA 4F72A 2JZBA 2BQUA 2ZTEA 1YT3A 4UAWA 3H4BA 5J0QA 8ICGA 3S6JA 1PK1B 1JRPA 4F5QA 2LI6A 4F4XA 4P4PA 2VANA 3EPGA 2EH9A 5KFDA 4U6PA 5KFHA 4F8RA 5AM3A 1N56A 5KFMA 1XSPA 4BXOB 4USAA 5ALIA 3PR4A 1D8BA 1Z3EB 4BDPA 5AKHA 4PGXA 2XY6A 4DSLA 3Q8RB 2KTQA 5DG7A 1B0XA 2W8LA 5J0XA 1CEZA 1AQ6A 2GLEA 1T4GA 4P0PB 2WF5A 3TADC 4C4TA 1JROA 1SB3C 3BQ7A 1M6YA 4J9LA 1ZQXA 2BPCA 4O5KA 3M6ZA 5DB9A 2KIWA 4KMUA 1PVRA 4IQUA 2E8OA 3I28A 4FFDA 4I2JA 3SAGA 2WF9A 2G07A 2J6TA 5C0YA 2EQYA 4EZ9A 4YP3A 3CNHA 5AIAA 1S5LU 5EWEA 1D9DA 2FMPA 1J97A 4ED7A 4C8OA 1XSNA 4Y2RA 4DL7A 4CF5A 4QZEA 5EE9A 3QU2A 1TAQA 4ECVA 2LM4A 1D8LA 4DS5A 3H8WA 2ZTDA 4AP9A 2JEIA 4I2BA 9ICWA 2EAOA 1ZQKA 4O3MA 3AL0B 2YX8A 1RXVA 3PW0A 2JEGA 4GIBA 1BPXA 4RPXA 2BCSA 1L5UA 5JUMA 3H0RB 1NK0A 2XO7A 1JI7A 4G9BA 2ZIXA 5KT7A 4C0ZA 5KG3A 2E3TA 1NJWA 3WK8A 4DLGA 5KFAA 4NL9C 1UT8A 3HKZC 5HHHA 5KT4A 3ZDBA 3AN1A 1ZQBA 2H5XA 1K1QA 3RAQA 1ZRMA 2F44A 2H3QA 2EZXA 2M9NA 2HMXA 1AROP 2W7PA 3SEIA 5KG2A 5KFBA 4F2SA 4KN7A 3C1ZA 2FMSA 1OW5A 5EE3A 4KMOB 2E1EA 5CRXA 4YN4A 4RT3A 2N1RA 3UXNA 1SXDA 2BQ3A 2JMGA 5AM4A 4ECQA 2UVVA 5ALJA 2G5HB 2BGWA 3ALRA 4QNLA 4JMUA 3OGUA 2R8GA 2XGQA 4DL5A 3RR7A 2H3ZA 2A1JA 4O3OA 1NK7A 2RHFA 4UB2A 2JRZA 3PY8A 4JV1A 1DK3A 3C28A 1NK5A 2ES6A 2FDRA 2RDIA 2G5IB 5F3XB 4ZH4A 4J9QA 4YFKA 3E58A 3T3FA 2G08A 4M9JA 2JEFA 1NI3A 3T79A 5KFTA 5ALEA 4Q8EA 5KG7A 5DB8A 1F5SA 2E8PA 3WK5A 2HBKA 3DV9A 2F8LA 2RP5A 5CB1A 2ODGA 2AQ4A 4KLDA 5AM1A 5KG4A 3RRGA 8ICOA 1NOMA 2HOQA 1K5OA 2KJ5A 3JPNA 3RBDA 1Q46A 4UARA 2KFZA 2KNJA 4F92B 2AGOA 3PMNA 3RB4A 4PH5A 5J0YA 2FPMA 1PVQA 4DFMA 4QZFA 1Z4OA 4PZNA 4DOBA 2KD1A 4K4IA 4OJPA 1K1SA 3MABA 3RJIA 2VA3A 2DFLA 3NS1A 4J9KA 4FS1A 5AKEA 4JWMA 1RM6C 5ALDA 5KFKA 4Y2SA 2J6SA 4QZAA 2UVRA 4YVZA 2ZIWB 2AJQA 3H8SA 5KFQA 1Z00A 5EE1A 2C28A 4DO9A 1NKEA 1ZJMA 4UAYA 3M9MB 2IA6A 3GIKA 2EAMA 1XC9A 5L1MA 3ED5A 2ZIVB 4I2AA 5CR0A 5L1IA 3JPOA 5KFVA 3SAHA 4QZHA 3HP6A 2W03A 1LB2B 1S0NA 2V4RA 4MEXA 3LDAA 4QIWF 3WKEA 5HR6A 5JTIA 1RXWA 1KBUA 4ECRA 5J0WA 5AI6A 2I5HA 2CXYA 3MC1A 2QB0B 2XC9A 3RAXA 2DPIA 5KFOA 2YMQA 4FS2A 1KDHA 1KFTA 4DL2A 3UMCA 1L3SA 1RQNA 2WF6A 2M0NA 5J2BA 1NK6A 5TISU 2JH1A 4NM2A 9ICFA 3BZKA 2K8AA 1ZXIA 4LJXA 3IG8A 5D49A 1NK4A 5DQIA 5EOZA 2KJ8A 4UW9A 1HEKA 3GV5B 7ICUA 4R63A 4IRKA 4UAVA 4C4SA 4F5NA 4IC9A 4YR2A 2EANA 1WG8A 3RJKA 5ALRA 5CJ7A 5IIJA 1WWVA 3H8MA 3RF9A 5G5GA 7ICSA 3MGIA 4DFDA 2MUTA 2W11A 2AHOB 2KSOA 4GC6A 3MR6A 4M6WB 2DL0A 2KV2A 8ICLA 4OJ5A 3VCBA 1ZRNA 5IILA 4BX9C 3BS5A 4CF3A 2FPKA 4C7YA 1L3UA 1YZ6A 3IHQB 7ICMA 3BS5B 8ICAA 4P4MA 3GIMA 1IIPA 3FYHA 1ZOLA 2XVTA 5ALOA 4NJ8A 3LVWA 5AK4A 3PW4A 2NO4A 3M8RA 5FP0A 5IIOA 8ICQA 5DG9A 3TACB 3V6KA 8ICXA 4B9MA
chains in the Genus database with same CATH topology
5CEHA 1C20A 5K4LA 2CXYA 1KN5A 4LJXA 2OEHA 1RYUA 2EH9A 2JXJA 2JRZA 1KKXA 2YQEA 1IG6A 2EQYA 2KK0A 1KQQA 2RQ5A 2LM1A 2LI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEH A;  1C20 A;  5K4L A;  2CXY A;  1KN5 A;  4LJX A;  2OEH A;  1RYU A;  2EH9 A;  2JXJ A;  2JRZ A;  1KKX A;  2YQE A;  1IG6 A;  2EQY A;  2KK0 A;  1KQQ A;  2RQ5 A;  2LM1 A;  2LI6 A; 
#chains in the Genus database with same CATH topology
 2B0C A;  3KOO A;  5JU5 A;  3C2L A;  4DSJ A;  2KHQ A;  1TAM A;  4MEY A;  5ALZ A;  3LYS A;  4UQG A;  4EX6 A;  3L3F X;  4QZG A;  1QTM A;  4TUP A;  1OXJ A;  3A0B U;  2AH5 A;  2W9A A;  1TKD A;  2W9C A;  2PKE A;  1QQ5 A;  5HHI A;  1X40 A;  1N61 A;  4UAT A;  4KLH A;  4JUZ A;  4GXK A;  4YD1 A;  2LPE A;  3K75 D;  5J0P A;  3FDS A;  4IRD A;  1S76 D;  2JHD A;  3GIJ A;  2BCQ A;  3B9J A;  1L7P A;  1WYG A;  4Y2T A;  3GIL A;  4DSI A;  8ICJ A;  4UBB A;  2ATL A;  3EWA A;  4O3N A;  3VC8 A;  2NV3 A;  5J29 A;  3QU5 A;  4AYB C;  2A19 A;  2MAX A;  3EYZ A;  3AUO A;  2R18 A;  4US8 A;  2P6U A;  3FM9 A;  3K4G A;  2OCE A;  2B21 A;  5BOM A;  3I76 A;  5KAF U;  4UBC A;  4ED2 A;  4O3R A;  2JV3 A;  2EDU A;  3ZD8 A;  3I1Y A;  4YXM A;  5GTI U;  2O6K A;  4QZ9 A;  4AYB F;  1ZQR A;  4RUC A;  2ZIV A;  4GFJ A;  3KHH A;  3HPO A;  4YXJ A;  1RYU A;  3M6K A;  1JIH A;  3H8J A;  1QQ7 A;  4PHE A;  1B4F A;  9ICX A;  2H3F A;  4B6J A;  3D2S A;  4FBU A;  1B43 A;  2K4P A;  9ICP A;  4CNQ A;  3F2B A;  2G06 A;  4M9L A;  2C2D A;  3O0F A;  1U48 A;  1NZP A;  7ICP A;  4O3Q A;  2NYV A;  1PK3 A;  3PST A;  1TAU A;  2V9W A;  5KFI A;  3V7L A;  4IL6 U;  1F44 A;  4KLO A;  4BWJ A;  4Q43 A;  3G6X A;  5ALG A;  2AQ0 A;  3BQ1 A;  2XGP A;  4DQQ A;  3B0Y A;  3PSF A;  3NGD A;  1NJZ A;  4R65 A;  1COO A;  4DOC A;  1N63 A;  2FLN A;  7ICR A;  3UQ2 A;  1ZQA A;  4YR0 A;  1A6S A;  2A1J B;  1ZQH A;  5EWG A;  5GTH U;  3N4M B;  1L3V A;  5J2J A;  4J9N A;  2DWQ A;  2IHM A;  5EWF A;  2IOF K;  1BVS A;  4F50 A;  5AK5 A;  2EAP A;  1LV5 A;  1SWW A;  8ICC A;  5ALV A;  2KEY A;  5EE0 A;  1KFD A;  3A0H U;  3N28 A;  4RPY A;  5KL8 B;  1S0M A;  3PR5 B;  5KTQ A;  1SXE A;  4DF4 A;  2BCU A;  4P2H A;  2BDU A;  2FPL A;  4PL1 A;  1SZP A;  3SV4 A;  3BZC A;  2WF7 A;  3CW2 C;  3ZDC A;  1BNP A;  1QSY A;  3GU3 A;  3SEN A;  5III A;  1SZH A;  5J8Y A;  1A76 A;  4QZC A;  2XY5 A;  3RBE A;  2HBL A;  1SGG A;  8ICY A;  2JXJ A;  8ICV A;  4ZOH C;  4RNO A;  4WJ3 B;  3NVW A;  5TZV A;  3CRX A;  1EXN A;  4F5P A;  1TK5 A;  4M9G A;  3WK7 A;  1X6J A;  2XY7 A;  3H0M B;  5L1J A;  4DSK A;  1OUQ A;  1Q3U A;  2NRV A;  5ALU A;  1URJ A;  4ECZ A;  4UB6 U;  2K4H A;  3QXG A;  4KX3 A;  3KZX A;  4Y2P A;  5KFX A;  4NXZ A;  4JK1 A;  5ALY A;  1C7Y A;  5AI9 A;  3PO5 A;  3DEE A;  4IR9 A;  4YQW A;  1UA1 A;  2HHX A;  2WFA A;  4I29 A;  2KVC A;  4JWN A;  4EBD A;  4J9M A;  4B9N A;  2WF8 A;  4I27 A;  4IRC A;  2ZUD A;  4MFC A;  2PXI A;  5KG0 A;  1S77 D;  2OHF A;  5D4B A;  2DBY A;  4QZI A;  4OJO A;  1ZQI A;  3F53 A;  2EZZ A;  4QJF B;  3UXP A;  2I6X A;  1KW4 A;  2ESE A;  1SV0 A;  5J0R A;  2BPF A;  4NM1 A;  4TQR A;  5J2D A;  2F77 X;  1ZQW A;  3ISC A;  4RQ4 A;  4B9U A;  3HWT A;  3TAN A;  5AKI A;  4MF2 A;  3N7P D;  3QUQ A;  3UXO A;  2WB1 C;  2W9B A;  2PI5 A;  3TAD A;  4KLU A;  7ICF A;  3KTQ A;  3WK6 A;  3C21 A;  3Q8L A;  1IG6 A;  4K4H A;  3KKA C;  1TE2 A;  1A0P A;  3MR2 A;  5KT5 A;  8ICH A;  3LVV A;  1T3Q A;  1ZQQ A;  3TKA A;  2HHU A;  3F5A A;  2J6U A;  2NRW A;  5KFJ A;  3MBY A;  1SV4 A;  1ZQZ A;  2UVU A;  4YMO A;  5AI8 A;  3ZDD A;  4F4Y A;  3E0F A;  3UPQ A;  3RTV A;  3MGV A;  4HAI A;  4YR3 A;  3PX0 A;  4QIW C;  4R64 A;  4DS4 A;  5ALP A;  4RQ5 A;  4I2F A;  3Q8P B;  1VLB A;  4PGQ A;  4Q8F A;  1HIW A;  1SIJ A;  4M47 A;  4RZR A;  1KTQ A;  1WUD A;  2HVH A;  5B5E U;  2LKY A;  4P0P A;  3AEV A;  2Y1J A;  4RNN A;  1TV9 A;  1Q8K A;  2XIC A;  2YY6 A;  3BQT A;  2L5Y A;  5KT6 A;  1ED1 A;  5DQH A;  5AI0 A;  3Q8K A;  5F9L A;  5KFZ A;  1IV8 A;  2AGQ A;  1BPY A;  1U47 A;  4KLI A;  1BGX T;  5KG1 A;  2KVS A;  7ICI A;  2Q4T A;  3IP4 B;  2P66 A;  5DDM A;  3G6Y A;  8ICB A;  7ICO A;  5KG6 A;  5DGB A;  2I1Q A;  4NL9 A;  4Y2Q A;  1PUZ A;  5KFR A;  3OSP A;  1ZD4 A;  1SL2 A;  4E0D A;  4RU9 A;  5KFU A;  1RYS A;  4YG2 A;  5KFP A;  1N60 A;  4FBT A;  1ZJN A;  5AKG A;  1BPE A;  1RPL A;  5AKL A;  9ICN A;  3PNC A;  4EEL A;  3GZF A;  4M0A A;  3OJU A;  4KLS A;  1MA7 A;  5DKW A;  1CRX A;  5H2F U;  3RH5 A;  2KZZ A;  4Y2U A;  3H40 A;  7ICK A;  4DCC A;  2KIV A;  1XNS A;  1TK0 A;  5ALT A;  5DLF A;  4J9O A;  4JV2 A;  5J2H A;  5J2F A;  1T7P A;  2ZG6 A;  1V85 A;  3E2E A;  3SMV A;  1P7D A;  2MU2 A;  4XA5 A;  2W43 A;  5J2A A;  4ELU A;  5DBC A;  2DGZ A;  4B9T A;  2DKZ A;  5CEH A;  7ICG A;  4FO6 A;  3HJE A;  4O3S A;  3HT3 A;  1DGJ A;  2PFP A;  4OJL A;  3THV A;  2W9C B;  4O5E A;  1UPH A;  1JX4 A;  4O3P A;  2FI1 A;  2LYA A;  3C29 A;  3V6J A;  3C2M A;  3FAH A;  5HML A;  9ICB A;  2D3D A;  2W3R A;  1ZQS A;  2W04 A;  1KFS A;  5CP2 A;  4M6W A;  2HHQ A;  4MFF A;  4DSF A;  4ED0 A;  1RZT A;  1DOQ A;  1JUD A;  4XUS A;  1U45 A;  5ALK A;  4YD2 A;  4GLX A;  3EW9 A;  2K60 A;  1L8O A;  3KD3 A;  2PI4 A;  2YTU A;  2QAR A;  3V72 A;  3MFH A;  5AKK A;  2AU0 A;  5ALQ A;  4G3I A;  2BZF A;  4F4Z A;  2HOF A;  3NVZ A;  2HVI A;  3QEA Z;  4R8U B;  3AU2 A;  9ICA A;  4B9S A;  1SWV A;  3T5J A;  1MN8 A;  2VJ5 A;  2D8C A;  2CPR A;  3ICX A;  4I2H A;  3AQF A;  1XSL A;  2E1F A;  1Z4N A;  4QW8 A;  1ECW A;  5DBA A;  3U26 A;  3AQE A;  1S0O A;  2KFN A;  1FFV A;  3M9N B;  3GFK B;  3ISB A;  2XCA A;  3RB6 A;  5IIK A;  4TUS A;  3ISD A;  1MQ2 A;  4ACO A;  1N62 A;  3QU9 A;  3QEB Z;  2BDP A;  8ICP A;  4PPX A;  7ICT A;  2YMP A;  3LWL A;  3Q8M A;  2ZIU B;  1O03 A;  1X9M A;  4DEZ A;  1L8L A;  4RQ0 A;  2KIC A;  1D9F A;  9ICK A;  3CYM A;  1NZB A;  7ICE A;  5ALH A;  1C20 A;  4NLC A;  3QYP A;  2WHE A;  5AKJ A;  4UB3 A;  1JN3 A;  3N7S C;  1ZQJ A;  1N5W A;  3D2Q A;  5DLG A;  2F1H A;  4KLT A;  3OHA A;  8ICS A;  1SL1 A;  4I2C A;  2JEJ A;  4KLE A;  1IXR A;  1H38 A;  3MR5 A;  3TQ1 A;  4DOA A;  2E8N A;  2LM1 A;  9ICJ A;  2XID A;  5AM0 A;  3QUB A;  4CRX A;  1NKB A;  1L7O A;  2IOH A;  2W9M A;  2WAQ C;  1FFU A;  4ELT A;  1WCN A;  2LYB A;  1ZQV A;  1Q3V A;  3RJG A;  5ALM A;  3JPP A;  2ZJA A;  2OM6 A;  3L5K A;  4KLF A;  9ICM A;  2DPJ A;  4Y2X A;  4IQV A;  1TK8 A;  3RR8 A;  4NLG A;  4UAZ A;  3Q8Q B;  1HUO A;  2VIX A;  5L1L A;  5AI4 A;  2VKQ A;  5E79 U;  3SQI A;  4YMM A;  4RQ1 A;  4ED3 A;  2ZUB A;  3ZDE A;  4KTQ A;  5CHG A;  4QWC A;  1S0V A;  4DWI A;  4ED1 A;  5KFY A;  4PGY A;  4RQ2 A;  3AU6 A;  3RH4 A;  5DG8 A;  2KSO B;  3PZP A;  3QX7 A;  3SV3 A;  2IOF A;  4ECS A;  2FLP A;  4GXI A;  5J0S A;  2HOI A;  1IM4 A;  4M04 A;  3UQ0 A;  2ISP A;  3JPS A;  3C5G A;  1ZD3 A;  5ALX A;  4X5V A;  2R8K A;  1Y88 A;  2FJ6 A;  5C5J A;  3TI0 A;  3UMG A;  1N2X A;  4IR1 A;  5HR7 A;  2KZM A;  4BGD A;  1PZN A;  8ICK A;  5KG5 A;  4P4O A;  5KFC A;  4DFP A;  4ED6 A;  3T5K A;  9ICC A;  4Z6C A;  3QUT A;  5AK6 A;  2MRL A;  2VJ4 A;  5AKY A;  3MFI A;  3MR3 A;  3RB3 A;  3PO4 A;  4Z6D A;  1SKW A;  4ICA A;  3GII A;  4DFJ A;  2HHW A;  9ICG A;  4C8L A;  2ZJ5 A;  3QE9 Y;  3JPQ A;  4JV0 A;  1UQV A;  2R8I A;  2A1A A;  3NTU A;  3SAF A;  2YML A;  1X9W A;  1VDV A;  4M2Y A;  4UAU A;  3LWM A;  4ED8 A;  1KL9 A;  5KAI U;  5ALW A;  1KQQ A;  2DKX A;  2K4I A;  2Q0Z X;  4UB4 A;  3K1Z A;  4R66 A;  4NLN A;  3GV7 B;  5L1K A;  4QZB A;  5KNI A;  1L7N A;  2W54 A;  2PFO A;  9ICI A;  1X9X A;  5JRT A;  1BPB A;  1RQL A;  9ICQ A;  3H0L B;  4XQ8 A;  4PHP A;  3OSN A;  4U7C A;  2MSN A;  2A3V A;  5K4L A;  4A8E A;  1COK A;  3EZ5 A;  3ETL A;  1ZQE A;  2PMZ F;  4PHD A;  3ZDA A;  2OEH A;  5KFW A;  3F2C A;  2C2R A;  1J2N A;  7ICJ A;  2MUT B;  1U4B A;  3AM9 A;  4NWI A;  3TFS A;  2LYH A;  5AIC A;  2HBM A;  5ALL A;  2ZJ8 A;  4C8N A;  4CGZ A;  2DQN B;  9ICV A;  2KN7 A;  2F2A B;  2KZ3 A;  4DQR A;  4P0Q B;  1JAL A;  2LHT A;  1N5X A;  4KLJ A;  4KLQ A;  1QCK A;  1S10 A;  5CA7 A;  3ORY A;  2GH1 A;  3KFU F;  4DQP A;  3R9K A;  2ZUC A;  2VA8 A;  3RB0 A;  4EEN A;  4O0I A;  2W3S A;  4J03 A;  3EPI A;  1A77 A;  1S9F A;  4NLZ A;  1XWL A;  2KJ9 A;  4OCZ A;  4Y2V A;  4DF8 A;  4FE3 A;  3V7K A;  7ICN A;  3F5E A;  4GXJ A;  8ICW A;  1XO1 A;  3QNM A;  4RQ8 A;  4J9P A;  1MQ3 A;  1ZQF A;  3N7R C;  4DQS A;  2YB4 A;  1ZQO A;  2KKV A;  4ECT A;  3KBB A;  3QZ7 A;  2OWO A;  4DFK A;  3H7I A;  1ZD5 A;  2ZIW A;  3C1Y A;  1NJY A;  1PK1 A;  4ECW A;  4EEY A;  9ICH A;  5KFS A;  1NK9 A;  4O5C A;  2ASD A;  2G0A A;  2F1J A;  1X6I A;  2YN4 A;  1RG6 A;  3RH6 A;  5G5H A;  5BPC A;  3D6J A;  2QAR B;  4NLB A;  2ZXI A;  2RDJ A;  2BHN A;  1NKC A;  3RJF A;  1ZYQ A;  5B66 U;  4ELV A;  4MHV A;  2W9B B;  1PVP A;  3L4P A;  2E5S A;  2C2E A;  5J0O A;  9ICS A;  4UAS A;  2IBK A;  3EUB 2;  4KLL A;  2BCV A;  4CE6 A;  3PW2 A;  1Z1V A;  2OYY A;  3MGH A;  5AI5 A;  2E8M A;  4IS7 A;  2IHN A;  4NLK A;  3DDH A;  1SKR A;  4TQS A;  4P0Q A;  3RRH A;  3SZ2 A;  3BQ2 A;  1UCV A;  2F76 X;  4C8M A;  2LBO A;  2ASJ A;  2BCR A;  1DXS A;  3KKA A;  1DRG A;  4ECY A;  4C80 A;  4Z6E A;  3OTQ A;  4DL3 A;  4B9V A;  1BPZ A;  4QZ8 A;  5DB7 A;  5F9N A;  4KLM A;  9ICL A;  2YB1 A;  4FZM A;  4I2E A;  4KLG A;  4RQ6 A;  4C8K A;  3SYZ A;  3WKA A;  3NVY A;  3ZI4 A;  2F1I A;  3AMZ A;  2BKE A;  3TAQ A;  1U9L A;  1ZQG A;  1JXE A;  3HIL A;  4BXO A;  4I2G A;  3RJJ A;  2DUY A;  2P35 A;  1KEJ A;  1GO3 F;  1DGS A;  2QB0 A;  2GOL A;  4RQN A;  5CWR A;  4Y2J A;  1DK2 A;  1NK8 A;  1FO4 A;  4Q44 A;  2K8C B;  4EYH B;  5J0T A;  2IMW P;  3H4D A;  4KN4 A;  1BPD A;  4YMN A;  3J81 j;  1JMS A;  1SKS A;  1ZQM A;  3CP8 A;  4K4G A;  4UB1 A;  1RYR A;  3PX4 A;  4F5R A;  2W7O A;  5AKX A;  2HCF A;  2NRZ A;  2WB1 F;  1WCL A;  1WWU A;  1J2M A;  3SR6 A;  1ZQY A;  3OJS A;  2W8K A;  4C7Z A;  1XO0 A;  5KT3 A;  2AGP A;  1SV0 C;  2BPG A;  8ICM A;  1RDF A;  5ALF A;  4TUQ A;  1ZQN A;  5HMM A;  2OXO A;  2ZIX B;  8ICZ A;  9ICO A;  3PML A;  1KN5 A;  2G09 A;  3B0X A;  4YCX A;  3KHG A;  3TAR A;  8ICR A;  2Y9U A;  4RT2 A;  5J2C A;  1Z1B A;  1L3T A;  4UB8 U;  7ICL A;  4DLE A;  1X9S A;  2YMM A;  3PSP A;  1CUK A;  2JZB B;  1T8E A;  2W55 A;  4C4R A;  3GDX A;  2WTF A;  2AXT U;  3T5H A;  2ASL A;  3BQ0 A;  1O08 A;  2Z7J A;  4GC7 A;  1SL0 A;  1ZQL A;  1ZET A;  1CI4 A;  2ZIU A;  1MSW D;  4F2R A;  8ICN A;  1ZQ1 C;  1LKY B;  2HHV A;  4RUA A;  4Y2Y A;  2BR0 A;  4CCH A;  5DGA A;  4B9L A;  2HW3 A;  2CN1 A;  4LVS A;  1KKX A;  2H3V A;  4EEK A;  1QQ6 A;  4RQM A;  2BQR A;  3RJE A;  8ICE A;  8ICU A;  3LK9 A;  4TUR A;  3PW7 A;  1V97 A;  4RNM A;  4F3O A;  4KIT B;  5AM5 A;  2ZXH A;  3M8S A;  1HJP A;  2KOB A;  4EYI B;  4J9R A;  2HHT A;  5J0U A;  3BJY A;  4DL4 A;  2Y0S F;  3QUC A;  2KE7 A;  1NNL A;  7ICV A;  3MDA A;  3PW5 A;  1X42 A;  4Z6F A;  3WU2 U;  2I9G A;  3ETR A;  2FLL A;  4PJ0 U;  3HW8 A;  4I2D A;  5J2E A;  5KT2 A;  2PFN A;  4I2I A;  9ICU A;  2V4Q A;  3C23 A;  3PV8 A;  1XU4 A;  4LZD A;  3IN5 A;  4QWB A;  3KHR A;  4LZG A;  3ZD9 A;  1L7M A;  4Q45 A;  1UT5 A;  2QB1 A;  3PVX A;  3QU4 A;  5DDY A;  4ECU A;  1ZQC A;  2UVW A;  2Y1I A;  7ICH A;  2MA1 A;  1T3N A;  2XI9 A;  4QWE A;  4ECX A;  4F93 B;  3GQC A;  2JH7 A;  2D6F C;  3SD7 A;  4R8U A;  3WK9 A;  3C5F A;  4M9N A;  2F3N A;  4PL2 A;  5AHX A;  1KSP A;  3GV8 B;  4FZL A;  1D8Y A;  5IIN A;  3M7D A;  1XS9 D;  2HHS A;  2QLT A;  4CF4 A;  3IRU A;  2HDO A;  3WK4 A;  5BOL A;  4OO1 J;  8ICI A;  2JR5 A;  3MDC A;  1FEZ A;  3N97 B;  2JGA A;  2HBJ A;  3G6V A;  3T5L A;  1Z00 B;  4F5O A;  1F0M A;  3PX6 A;  2NRT A;  2RRD A;  3JPR A;  1TFR A;  4MFA A;  4F4K A;  2NRX A;  3QZ8 A;  4PHA A;  4RQ3 A;  3RJH A;  3TAP A;  3QU7 A;  1V38 A;  8ICF A;  1S8O A;  4DQI A;  2Y9T A;  5AM2 A;  4CDG A;  1N48 A;  4M9H A;  2DF4 B;  4FZN A;  4F91 B;  4HYK A;  1KLN A;  1ZD2 P;  1X2I A;  3ONN A;  9ICT A;  2RQ5 A;  9ICE A;  2WAQ F;  2ZTC A;  1VJ5 A;  1ZQU A;  5J8Y C;  1QSS A;  2KP7 A;  2RLT A;  3Q8S B;  1ZQP A;  3KHL A;  3M9O B;  5J2G A;  2R8H A;  3K1R B;  4EX7 A;  5A0L A;  4DL6 A;  4EBC A;  2K89 A;  5HNK A;  1MC8 A;  3M1Y A;  5ALN A;  2PMZ C;  4JB3 A;  2KHV A;  5AIB A;  5KFE A;  5ALS A;  4US9 A;  2H3I A;  3WKC A;  1B22 A;  5KFL A;  4QWD A;  8ICT A;  7ICQ A;  5DQG A;  2KG5 A;  3NRW A;  1QSL A;  3V7J A;  4IQW A;  3SI8 A;  2YQE A;  2B6G A;  3FC4 A;  3RFA A;  4BWM A;  4OD0 A;  3WKD A;  4O9M A;  3UMB A;  3OPX A;  3BDP A;  1QH9 A;  1KRP A;  3C2K A;  2ISO A;  4EZ6 A;  1YZ7 A;  3F2D A;  5HP4 A;  1ZQD A;  1ZQT A;  1LVH A;  2OH2 A;  5KL1 B;  2NO5 A;  4QZD A;  3KZI U;  1U49 A;  2Y0S C;  2GO7 A;  2LMR A;  4PZO A;  2C22 A;  2P6R A;  1FIQ A;  2KMD A;  2KKP A;  4NV0 A;  4J9S A;  4EBE A;  3OHB A;  3IM1 A;  5KFF A;  1S97 A;  3HKZ F;  2GWS A;  4BUG A;  1HUZ A;  3NAS A;  9ICR A;  1LKY A;  2K8B B;  2FMQ A;  3IG5 A;  5D46 A;  3NRZ A;  2FE9 A;  3V6H A;  3NUQ A;  1L6N A;  3D2N A;  5IIM A;  2R8J A;  3UM9 A;  3BS7 A;  5KFN A;  4RPZ A;  3HX0 A;  2F8K A;  1V9P A;  4I28 A;  2K4E A;  2VA2 A;  1BNO A;  1TVA A;  3NVV A;  3PSI A;  5DBB A;  2KK0 A;  5AK3 A;  2EZY A;  4F71 A;  4XRH A;  5DB6 A;  4F4W A;  2HSZ A;  2PFQ A;  2HI0 A;  5L9X A;  1T94 A;  3IV6 A;  4NY8 A;  5T14 A;  1NJX A;  2QKQ A;  3JPT A;  2ALZ A;  1JXL A;  1QLN A;  4OJ6 A;  3HRD D;  4QWA A;  5KFG A;  3WKB A;  4MF8 A;  4DSE A;  4IQT A;  1UA0 A;  1UHU A;  3TFR A;  4QW9 A;  5AKZ A;  5J2I A;  4KX5 A;  1X66 A;  4UB5 A;  4RQ7 A;  3IDW A;  2XCP A;  1Z19 A;  2CRX A;  5J2K A;  4BJQ A;  4F72 A;  2JZB A;  2BQU A;  2ZTE A;  1YT3 A;  4UAW A;  3H4B A;  5J0Q A;  8ICG A;  3S6J A;  1PK1 B;  1JRP A;  4F5Q A;  2LI6 A;  4F4X A;  4P4P A;  2VAN A;  3EPG A;  2EH9 A;  5KFD A;  4U6P A;  5KFH A;  4F8R A;  5AM3 A;  1N56 A;  5KFM A;  1XSP A;  4BXO B;  4USA A;  5ALI A;  3PR4 A;  1D8B A;  1Z3E B;  4BDP A;  5AKH A;  4PGX A;  2XY6 A;  4DSL A;  3Q8R B;  2KTQ A;  5DG7 A;  1B0X A;  2W8L A;  5J0X A;  1CEZ A;  1AQ6 A;  2GLE A;  1T4G A;  4P0P B;  2WF5 A;  3TAD C;  4C4T A;  1JRO A;  1SB3 C;  3BQ7 A;  1M6Y A;  4J9L A;  1ZQX A;  2BPC A;  4O5K A;  3M6Z A;  5DB9 A;  2KIW A;  4KMU A;  1PVR A;  4IQU A;  2E8O A;  3I28 A;  4FFD A;  4I2J A;  3SAG A;  2WF9 A;  2G07 A;  2J6T A;  5C0Y A;  2EQY A;  4EZ9 A;  4YP3 A;  3CNH A;  5AIA A;  1S5L U;  5EWE A;  1D9D A;  2FMP A;  1J97 A;  4ED7 A;  4C8O A;  1XSN A;  4Y2R A;  4DL7 A;  4CF5 A;  4QZE A;  5EE9 A;  3QU2 A;  1TAQ A;  4ECV A;  2LM4 A;  1D8L A;  4DS5 A;  3H8W A;  2ZTD A;  4AP9 A;  2JEI A;  4I2B A;  9ICW A;  2EAO A;  1ZQK A;  4O3M A;  3AL0 B;  2YX8 A;  1RXV A;  3PW0 A;  2JEG A;  4GIB A;  1BPX A;  4RPX A;  2BCS A;  1L5U A;  5JUM A;  3H0R B;  1NK0 A;  2XO7 A;  1JI7 A;  4G9B A;  2ZIX A;  5KT7 A;  4C0Z A;  5KG3 A;  2E3T A;  1NJW A;  3WK8 A;  4DLG A;  5KFA A;  4NL9 C;  1UT8 A;  3HKZ C;  5HHH A;  5KT4 A;  3ZDB A;  3AN1 A;  1ZQB A;  2H5X A;  1K1Q A;  3RAQ A;  1ZRM A;  2F44 A;  2H3Q A;  2EZX A;  2M9N A;  2HMX A;  1ARO P;  2W7P A;  3SEI A;  5KG2 A;  5KFB A;  4F2S A;  4KN7 A;  3C1Z A;  2FMS A;  1OW5 A;  5EE3 A;  4KMO B;  2E1E A;  5CRX A;  4YN4 A;  4RT3 A;  2N1R A;  3UXN A;  1SXD A;  2BQ3 A;  2JMG A;  5AM4 A;  4ECQ A;  2UVV A;  5ALJ A;  2G5H B;  2BGW A;  3ALR A;  4QNL A;  4JMU A;  3OGU A;  2R8G A;  2XGQ A;  4DL5 A;  3RR7 A;  2H3Z A;  2A1J A;  4O3O A;  1NK7 A;  2RHF A;  4UB2 A;  2JRZ A;  3PY8 A;  4JV1 A;  1DK3 A;  3C28 A;  1NK5 A;  2ES6 A;  2FDR A;  2RDI A;  2G5I B;  5F3X B;  4ZH4 A;  4J9Q A;  4YFK A;  3E58 A;  3T3F A;  2G08 A;  4M9J A;  2JEF A;  1NI3 A;  3T79 A;  5KFT A;  5ALE A;  4Q8E A;  5KG7 A;  5DB8 A;  1F5S A;  2E8P A;  3WK5 A;  2HBK A;  3DV9 A;  2F8L A;  2RP5 A;  5CB1 A;  2ODG A;  2AQ4 A;  4KLD A;  5AM1 A;  5KG4 A;  3RRG A;  8ICO A;  1NOM A;  2HOQ A;  1K5O A;  2KJ5 A;  3JPN A;  3RBD A;  1Q46 A;  4UAR A;  2KFZ A;  2KNJ A;  4F92 B;  2AGO A;  3PMN A;  3RB4 A;  4PH5 A;  5J0Y A;  2FPM A;  1PVQ A;  4DFM A;  4QZF A;  1Z4O A;  4PZN A;  4DOB A;  2KD1 A;  4K4I A;  4OJP A;  1K1S A;  3MAB A;  3RJI A;  2VA3 A;  2DFL A;  3NS1 A;  4J9K A;  4FS1 A;  5AKE A;  4JWM A;  1RM6 C;  5ALD A;  5KFK A;  4Y2S A;  2J6S A;  4QZA A;  2UVR A;  4YVZ A;  2ZIW B;  2AJQ A;  3H8S A;  5KFQ A;  1Z00 A;  5EE1 A;  2C28 A;  4DO9 A;  1NKE A;  1ZJM A;  4UAY A;  3M9M B;  2IA6 A;  3GIK A;  2EAM A;  1XC9 A;  5L1M A;  3ED5 A;  2ZIV B;  4I2A A;  5CR0 A;  5L1I A;  3JPO A;  5KFV A;  3SAH A;  4QZH A;  3HP6 A;  2W03 A;  1LB2 B;  1S0N A;  2V4R A;  4MEX A;  3LDA A;  4QIW F;  3WKE A;  5HR6 A;  5JTI A;  1RXW A;  1KBU A;  4ECR A;  5J0W A;  5AI6 A;  2I5H A;  2CXY A;  3MC1 A;  2QB0 B;  2XC9 A;  3RAX A;  2DPI A;  5KFO A;  2YMQ A;  4FS2 A;  1KDH A;  1KFT A;  4DL2 A;  3UMC A;  1L3S A;  1RQN A;  2WF6 A;  2M0N A;  5J2B A;  1NK6 A;  5TIS U;  2JH1 A;  4NM2 A;  9ICF A;  3BZK A;  2K8A A;  1ZXI A;  4LJX A;  3IG8 A;  5D49 A;  1NK4 A;  5DQI A;  5EOZ A;  2KJ8 A;  4UW9 A;  1HEK A;  3GV5 B;  7ICU A;  4R63 A;  4IRK A;  4UAV A;  4C4S A;  4F5N A;  4IC9 A;  4YR2 A;  2EAN A;  1WG8 A;  3RJK A;  5ALR A;  5CJ7 A;  5IIJ A;  1WWV A;  3H8M A;  3RF9 A;  5G5G A;  7ICS A;  3MGI A;  4DFD A;  2MUT A;  2W11 A;  2AHO B;  2KSO A;  4GC6 A;  3MR6 A;  4M6W B;  2DL0 A;  2KV2 A;  8ICL A;  4OJ5 A;  3VCB A;  1ZRN A;  5IIL A;  4BX9 C;  3BS5 A;  4CF3 A;  2FPK A;  4C7Y A;  1L3U A;  1YZ6 A;  3IHQ B;  7ICM A;  3BS5 B;  8ICA A;  4P4M A;  3GIM A;  1IIP A;  3FYH A;  1ZOL A;  2XVT A;  5ALO A;  4NJ8 A;  3LVW A;  5AK4 A;  3PW4 A;  2NO4 A;  3M8R A;  5FP0 A;  5IIO A;  8ICQ A;  5DG9 A;  3TAC B;  3V6K A;  8ICX A;  4B9M A; 
#chains in the Genus database with same CATH homology
 5CEH A;  1C20 A;  5K4L A;  2CXY A;  1KN5 A;  4LJX A;  2OEH A;  1RYU A;  2EH9 A;  2JXJ A;  2JRZ A;  1KKX A;  2YQE A;  1IG6 A;  2EQY A;  2KK0 A;  1KQQ A;  2RQ5 A;  2LM1 A;  2LI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...