2LM1A

Solution nmr structure of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium target fr824d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEVYTSGKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase lid
publication title Northeast Structural Genomics Consortium Target FR824D
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2lm1A00
2RQ5A 1KQQA 2CXYA 5K4LA 1RYUA 1C20A 1KN5A 2LI6A 2KK0A 1KKXA 2JXJA 2LM1A 5CEHA 2EQYA 2OEHA 4LJXA 2JRZA 2YQEA 1IG6A 2EH9A
chains in the Genus database with same CATH superfamily
4QWBA 2EANA 2W7PA 2ZIVA 2W9CB 1B43A 5J0WA 9ICFA 4Y2VA 5KFGA 2BDPA 1S76D 2KNJA 2B6GA 2DWQA 2NRZA 2ZTDA 4TQSA 2ZXIA 3KKAA 4I2IA 4IQUA 4DLEA 1S97A 1CUKA 4NM2A 5KFQA 2H3ZA 1NI3A 4GLXA 2JXJA 2KE7A 1LKYA 3HPOA 2B21A 4OO1J 2F1HA 2F3NA 2MSNA 2FJ6A 2XGQA 5KT6A 2XC9A 7ICGA 2A3VA 2LMRA 1ZD4A 2QKQA 9ICOA 1RM6C 1LKYB 4EBDA 3I76A 4NM1A 1ZQVA 4QZDA 3ISDA 1KDHA 4KLTA 1B22A 3SEIA 1UQVA 1KSPA 3WK6A 3WK5A 7ICQA 3DEEA 2Y1IA 4I2HA 1IG6A 5AKEA 8ICPA 2AQ0A 3H8MA 1RZTA 1NK5A 4KLFA 3GDXA 4FO6A 1PK1B 4KMUA 1V9PA 5DLFA 2E3TA 4RPZA 1ZQQA 5ALRA 2VJ4A 2XY7A 5KL8B 5HR7A 2GO7A 5CWRA 1WWUA 2ZG6A 5J0XA 5AI8A 2RQ5A 1SKRA 4F8RA 5KG6A 3B9JA 4GC6A 2FPKA 1N5WA 4OD0A 9ICAA 2RLTA 2BPFA 2DPIA 5HNKA 5HR6A 4PH5A 4LJXA 2M0NA 1U4BA 1SWWA 2BQUA 2HHVA 4YMNA 4UW9A 3DV9A 3AU2A 1C20A 4FS2A 1DOQA 4PGQA 4B9MA 3H8JA 1RXWA 3L4PA 1A77A 2YMLA 4XQ8A 5DGBA 4ECRA 4QWCA 1DXSA 1X42A 1N48A 4YCXA 2HBJA 3FAHA 4X5VA 1DRGA 4DSJA 2ASJA 1N61A 3AEVA 1RYRA 1SKSA 4UB4A 4EENA 3GU3A 8ICSA 8ICFA 2O6KA 1U9LA 1BPZA 2KTQA 3UQ2A 1TVAA 5AI6A 3HWTA 7ICTA 3M8SA 3EWAA 8ICZA 4C4TA 4NJ8A 5KFSA 3ISCA 3V7LA 3PNCA 1ZRNA 4QW9A 3UXPA 2WF7A 2ISOA 1XNSA 4NXZA 3V6HA 3PR4A 2ZUBA 1N56A 2KFZA 3BQTA 4UB2A 1U45A 5DGAA 3Q8LA 1NZPA 3JPNA 1DGSA 2MRLA 3WK7A 4RQ6A 3TQ1A 1JXEA 5AI5A 2G06A 4KLEA 1NK7A 1XO0A 2KVCA 1SL2A 8ICHA 2ZJAA 2JMGA 3CYMA 4JV2A 1OXJA 4YMOA 4ELUA 2H3QA 1T4GA 3MFIA 3NGDA 2V4QA 3PX0A 4B9TA 2HHWA 1NJYA 3RH4A 3GQCA 5KG5A 2AXTU 2QB0A 3JPOA 9ICLA 3KKAC 2VA2A 1JI7A 1AROP 5AKKA 4OJLA 3PW7A 1N2XA 3AQEA 2UVWA 2CPRA 1TAQA 5J0TA 4F71A 3TI0A 3HRDD 3HKZC 2NO5A 3TKAA 5J2BA 5DG8A 3RB6A 3M9NB 9ICBA 4P0QB 2NRWA 4LZGA 7ICUA 1JIHA 1WUDA 4CNQA 1Z4OA 3PW5A 3EYZA 1QQ5A 1OW5A 1L6NA 4YXJA 3VCBA 5KFDA 8ICUA 1BVSA 2WF9A 4NV0A 5KT4A 1SL1A 2QARB 1T7PA 4ECSA 3OTQA 3ED5A 1JX4A 3PO4A 3SAGA 1UT8A 5L1LA 2IOHA 1L3TA 7ICSA 4Y2RA 4TQRA 4Q8FA 2YX8A 2H3VA 4F4XA 2K4PA 5DB6A 1TK5A 8ICCA 3J81j 4OJ5A 4Y2UA 4BGDA 2HBMA 3RF9A 3SV4A 1EXNA 4I2BA 1ZQ1C 3N97B 2ASLA 3IRUA 2YN4A 5ALHA 4O5CA 2VA3A 3PO5A 2R8JA 7ICOA 1U48A 5T14A 1L8OA 1ZQCA 1ZQGA 1ZQZA 1ZQJA 3RH6A 4KLQA 2YB4A 1S0MA 2BGWA 2XIDA 3ALRA 1WG8A 3EPIA 4M9NA 4YFKA 2RHFA 1L8LA 3IP4B 3LDAA 4UQGA 2HOFA 4DSLA 4P4PA 3QXGA 4UB5A 3PVXA 3THVA 3MC1A 5ALXA 1COKA 5ALSA 2K4IA 1C7YA 5EE3A 4QW8A 5KFLA 3OJSA 2UVUA 1UA0A 2KOBA 1X40A 2L5YA 1NKBA 1KFDA 1XO1A 3D2SA 3AL0B 3BS5B 2KHVA 5A0LA 3V7JA 1SZHA 2GWSA 1XU4A 2I1QA 5KTQA 3ZDDA 3GV5B 4YD2A 4ECVA 5ALFA 4PJ0U 3F5EA 4A8EA 4KMOB 2R8HA 4RPYA 2WAQC 3AM9A 1QSSA 2HHUA 5KFPA 4AP9A 1B4FA 4DL4A 5ALEA 2PI5A 1YT3A 5KAIU 2F8LA 3MR5A 4NLZA 8ICKA 2EZZA 4DEZA 4GC7A 4UARA 3TFSA 5ALGA 3V6JA 4R8UA 1S0NA 2KZ3A 4RQMA 4BUGA 2LBOA 4M47A 2NRXA 4C80A 4O3OA 2OHFA 5L1KA 2F1JA 1NKCA 2QB1A 9ICTA 5DBAA 1ZQIA 2C28A 4J9QA 1X9MA 4R8UB 2A1AA 3KBBA 3QX7A 3NRZA 5J2JA 5DB7A 5HMMA 1SXEA 5KFZA 2H3FA 1ZXIA 5L1JA 4UB6U 3WKDA 4YXMA 2XY6A 4DL5A 2EDUA 1KLNA 8ICMA 4Y2YA 3PR5B 3GV7B 4DQQA 2KIVA 2I9GA 9ICIA 2HCFA 5KFYA 2OCEA 3C23A 3BZKA 2FE9A 3PX6A 5DKWA 2P66A 3QUBA 2KSOB 4Z6DA 2Z7JA 5B5EU 2F76X 2FMPA 1OUQA 2G09A 1GO3F 2W54A 1Q3VA 5J0PA 3GIIA 1LB2B 3L5KA 3QUTA 5CRXA 4YP3A 4F5RA 2KFNA 1L7PA 3GZFA 1PK3A 3IHQB 2UVVA 1U47A 4F92B 3C28A 3HJEA 3RBDA 4ZOHC 3QUQA 2WF5A 4AYBF 3ZI4A 5AK6A 3TAQA 1D8YA 5J2HA 3QE9Y 2H5XA 2JH7A 4Q43A 2G5HB 1T3QA 2K89A 9ICRA 2XCPA 2DBYA 2JEIA 2NYVA 3GV8B 4O3NA 1IXRA 5G5GA 1O08A 2KEYA 4EX7A 1U49A 3GIKA 4PHEA 4C8KA 5AM2A 1ZQLA 1N62A 4EEKA 1ZETA 1JALA 3IDWA 1KL9A 4US9A 4QZIA 3PZPA 3KTQA 2DGZA 2R18A 4I2DA 3H0RB 2FDRA 2UVRA 5EE1A 2PFPA 1FEZA 5J29A 8ICJA 5KG4A 4CF3A 3H40A 2W11A 2KJ5A 2GH1A 2W8KA 3ETRA 4DL3A 3KHGA 1Q8KA 8ICWA 4DOCA 4B9UA 4F2RA 1NOMA 3QYPA 4I29A 4I2EA 2EQYA 9ICNA 2W04A 3M6KA 2PMZC 2FPMA 5KAFU 2VKQA 4YR2A 4RT3A 3UXOA 4F4YA 2IBKA 3C5GA 1UA1A 1XSLA 4EYHB 5AKZA 3WK9A 1X9XA 5EWEA 4O9MA 3RB4A 4K4IA 3EUB2 4KX5A 4YQWA 2E1FA 1HUOA 4RQNA 4Y2JA 4C4RA 3IN5A 1D8LA 4ELTA 1T94A 4NLKA 1SB3C 1NJZA 2AJQA 4GXJA 2ZIVB 2JZBA 3WKBA 1SWVA 5AI4A 2AGOA 4ICAA 4Z6EA 5AM3A 1V38A 2WTFA 1PVQA 2IHMA 1Z3EB 5C0YA 1S0OA 2FLNA 1D8BA 4I27A 5KFEA 4DSEA 5IILA 4M04A 4IRCA 1V97A 3KFUF 5J2CA 4P4OA 5KG1A 4BWMA 9ICSA 1NNLA 2OXOA 3RJJA 4F50A 4I2FA 3OHBA 1ZQAA 2KG5A 3Q8RB 1YZ7A 5KFAA 4C7ZA 5DDYA 1MQ2A 3BS7A 4YR3A 3KHLA 5HP4A 5TZVA 4TUSA 5KT5A 3RJFA 4RPXA 4ED3A 3RAQA 1PUZA 2GLEA 4JV1A 1MC8A 4LZDA 4DQSA 2PXIA 4C8NA 3GFKB 8ICEA 2HHQA 3MR3A 3RR8A 2LI6A 1YZ6A 1L7NA 1BPXA 2KJ9A 3PSTA 3K1ZA 1ZYQA 4F4KA 1ZQWA 5AKIA 1MN8A 5ALQA 4QWEA 4UB3A 4PL1A 2KHQA 4DS4A 4NWIA 2YB1A 2KZZA 5B66U 2JEGA 4IQVA 5AKLA 1RYUA 5J2AA 2C2DA 7ICRA 3OGUA 2OM6A 3EW9A 2G08A 3BJYA 1PVRA 2HHSA 2M9NA 4IL6U 3LWLA 4J9KA 1ZQTA 4DSKA 9ICHA 1S0VA 3RB0A 2HI0A 1S5LU 4ACOA 3GIMA 2JEJA 5CB1A 3MGHA 4IRKA 2F1IA 4BX9C 4F4ZA 5E79U 3GIJA 2PFNA 4EYIB 4QZGA 7ICPA 4QZFA 5L1IA 3Q8KA 2F77X 1ZQEA 5J2DA 4PHPA 4ED7A 3H0MB 1LVHA 1JXLA 1AQ6A 5KFWA 3TARA 5KFNA 4KLDA 2K8CB 1QCKA 2W55A 1NK0A 4DOAA 1MA7A 3T79A 9ICPA 1IV8A 2RP5A 1KEJA 3SD7A 1IIPA 4RQ4A 1XSPA 3PX4A 2LM4A 1N63A 3FDSA 3FM9A 3T5KA 4EZ9A 2MUTA 3TFRA 3H7IA 5KFTA 1ZQFA 2A19A 2NRVA 5J8YA 4M9LA 1F5SA 4RQ7A 3MR2A 4C8OA 3WKAA 5EOZA 4RQ1A 4MHVA 2EAOA 4DL6A 4ECUA 3NTUA 5KFOA 5CHGA 8ICNA 4J9SA 4ECYA 1ZQHA 8ICTA 9ICVA 4MF8A 4PHAA 5ALLA 5JTIA 1PVPA 5DDMA 2VA8A 2BCUA 2XCAA 3MBYA 5EE0A 1SKWA 2JRZA 2KMDA 1L5UA 3BZCA 4QZ8A 3LK9A 3V6KA 4O3SA 4FZNA 3HKZF 2YMMA 4C0ZA 4WJ3B 1LV5A 4QIWC 1DGJA 5J0UA 4YD1A 2HHTA 4XRHA 4R65A 2ZIUA 2YMQA 4MEYA 3IG5A 4USAA 3L3FX 1RQLA 2BZFA 3HW8A 1QSLA 2JGAA 2C2RA 4RNMA 4O0IA 2QB0B 2IMWP 5CJ7A 4MF2A 5HHHA 4J9RA 3M6ZA 4Y2XA 4CF4A 2AH5A 8ICXA 2ZTCA 4GIBA 4DL7A 3N28A 4FZLA 3SYZA 2NV3A 4RT2A 3BQ1A 3KHHA 4UATA 2ZXHA 5KG0A 4DSFA 2LYHA 2K60A 2KIWA 4B9VA 3PW4A 5AICA 4F91B 2ZIWA 2DL0A 4QWAA 2P35A 1JMSA 4F5QA 5ALWA 8ICRA 2HSZA 1ZQRA 1MQ3A 4DCCA 1RDFA 2P6UA 4OCZA 3OSPA 1L3UA 2C2EA 4UAUA 2AHOB 4KLJA 2DKXA 9ICUA 4B9NA 5KL1B 2YQEA 4YG2A 1F0MA 1Z1VA 1V85A 8ICYA 3SAHA 2FMQA 5DBBA 1ZOLA 5ALKA 4UBBA 3SQIA 3ONNA 5BOLA 1JN3A 4RNNA 5EE9A 4G3IA 2HBKA 2ZJ5A 1A0PA 4JUZA 4F3OA 4KLMA 2HVIA 1HUZA 7ICLA 2K8AA 4UASA 5JRTA 3QEAZ 2WAQF 3RJGA 4FFDA 2ZUDA 1D9FA 2YY6A 1ZRMA 5ALPA 4DFDA 1F44A 5ALIA 3RR7A 4EELA 3WKEA 4E0DA 5KT2A 1ZQMA 3TADA 1X6IA 1TKDA 4RUCA 2BCVA 5ALMA 4JV0A 5IIJA 2ISPA 3QU9A 2K4EA 1NJWA 1XC9A 9ICXA 4DLGA 1K1SA 2BCSA 5J8YC 5GTHU 2A1JA 2KN7A 1CEZA 4U6PA 4UAZA 4ECTA 2I5HA 3N7RC 4QZBA 1CRXA 2KD1A 3RJKA 5KFFA 2JR5A 2FLLA 4YVZA 5HMLA 5DLGA 4FZMA 3KOOA 4HAIA 3F5AA 2C22A 2LKYA 3PV8A 1URJA 1X9WA 7ICHA 3LVVA 2R8KA 2EZXA 1JROA 1HEKA 4RU9A 2OWOA 2HBLA 5ALVA 3PMNA 5AIBA 4RQ2A 1NK9A 4JWMA 3SI8A 5IIIA 3UMGA 5G5HA 5DG9A 2AU0A 4TUPA 4DS5A 3C2KA 4EZ6A 1T8EA 2WF8A 4RUAA 4OJ6A 2XO7A 3AQFA 3F2CA 4F5NA 3QZ8A 1K1QA 4FE3A 3C29A 4F5OA 4DFPA 4BXOA 2Y0SF 4M6WA 1BGXT 5ALTA 4EBEA 3JPPA 5ALJA 2J6TA 3ZDAA 4ED0A 5EWFA 1BNPA 3UPQA 2XVTA 1KFSA 4KX3A 3GILA 4I2JA 3H0LB 4KLOA 1RYSA 4M6WB 1ZJMA 2HVHA 4O3QA 4O3PA 4UAYA 3SR6A 1HJPA 1ED1A 2RDIA 3WK8A 2WFAA 4FBTA 4JK1A 5KNIA 9ICKA 5J0YA 2ZJ8A 4MEXA 1XS9D 3ZDBA 2Y0SC 1A6SA 4ZH4A 4I2CA 2ZTEA 4F93B 5F9NA 4Q45A 4LVSA 4ECZA 2E8MA 1FFVA 3IG8A 1NJXA 3NRWA 4DQIA 1J2NA 1QQ7A 3KHRA 1ZQOA 1SGGA 9ICCA 1ZD2P 1UHUA 3ZD8A 5BPCA 2IOFA 2DF4B 4OJOA 3M9MB 2PMZF 3BQ2A 5KFVA 1Z19A 5JUMA 4KLGA 4O5EA 4B6JA 2ATLA 4J9OA 3UMBA 3F2BA 1ZQKA 2PFQA 9ICGA 8ICOA 4QZCA 3NVZA 3C21A 4PL2A 1NK4A 1DK2A 3OJUA 4Y2TA 4KTQA 4NLBA 5AIAA 2MA1A 1SL0A 1ZQPA 4QZEA 5J2IA 5CP2A 1RXVA 3RTVA 5AK3A 9ICWA 2Q0ZX 1WCNA 4P0PA 3VC8A 8ICAA 3SZ2A 2FMSA 3TADC 1KN5A 2ZIXA 4F72A 3NVVA 4OJPA 2K4HA 3C2MA 3H4BA 4JMUA 4KN4A 4M9JA 3AN1A 8ICGA 2WB1F 3RJEA 1ZQSA 4DWIA 3PW0A 4I28A 1IM4A 3WKCA 5DQHA 2ZIXB 1KTQA 3ZD9A 1JRPA 1FIQA 2PI4A 2N1RA 3TACB 2E5SA 1K5OA 3F53A 4QZAA 1SIJA 3HP6A 4Q8EA 4QWDA 4FS1A 3K4GA 5CEHA 3TANA 5ALUA 5L9XA 4UAVA 3ORYA 8ICLA 7ICJA 2XGPA 2JZBB 1H38A 2WB1C 3T3FA 4IC9A 2AGPA 4P4MA 4UAWA 4G9BA 1D9DA 4UB8U 3BDPA 1NK6A 5AKHA 3AU6A 3D2QA 1SV0A 5AK5A 2W3SA 3UQ0A 4Z6CA 1TFRA 4IR1A 2BPCA 4PGXA 9ICMA 3JPQA 1ECWA 2IOFK 2ZUCA 5ALYA 2HMXA 4RQ5A 2R8GA 4PZOA 5FP0A 4C8MA 4KLHA 1PK1A 4KN7A 4ED6A 1WCLA 5KG3A 3F2DA 3Q8QB 3M9OB 5C5JA 8ICIA 4NLNA 4P2HA 2LPEA 4DSIA 5AHXA 4XA5A 5AKYA 2JV3A 2E1EA 4K4HA 3CP8A 3M7DA 3E0FA 4QNLA 5J0OA 3K75D 1O03A 2ODGA 3G6XA 1QQ6A 1FFUA 5H2FU 4NY8A 5IIOA 1JUDA 1QSYA 2DKZA 1L3VA 4F5PA 3T5LA 4K4GA 1XSNA 1SZPA 1BPBA 5EWGA 3FYHA 2KZMA 1L3SA 9ICQA 7ICEA 4EEYA 3JPTA 1J2MA 3IM1A 2D8CA 2ES6A 3CRXA 4M9HA 1NK8A 4O5KA 2EAPA 4IRDA 2WHEA 3JPRA 1QH9A 4TURA 3MFHA 3RJHA 3V72A 4R64A 4TUQA 5KFUA 2V9WA 2OH2A 2EAMA 4FBUA 2J6UA 1KRPA 3G6VA 2Q4TA 1KFTA 5J2EA 1X9SA 7ICFA 4Z6FA 1S77D 5AI0A 3MR6A 5JU5A 1QLNA 7ICMA 3Q8PB 3HILA 2VANA 3AUOA 3D2NA 2MUTB 5KFBA 2IHNA 9ICJA 1TK8A 1BPYA 5J0QA 1ZD3A 4QIWF 3QNMA 2QLTA 3WU2U 1VJ5A 5KFRA 5DG7A 1NZBA 2OEHA 4GXKA 1Z4NA 2KJ8A 1KBUA 2XY5A 8ICBA 4CDGA 2W03A 2JEFA 3PSIA 3K1RB 3RRHA 1TV9A 1J97A 2DPJA 2BQ3A 5K4LA 4HYKA 3NVYA 4RZRA 3PSFA 3C5FA 1KKXA 3C1YA 2KICA 1S8OA 3M1YA 3RAXA 3MGVA 2JH1A 1TAMA 2W9MA 3I1YA 2Y9UA 4RQ0A 5F9LA 2DUYA 3SMVA 1Z00A 3U26A 4KLUA 1TAUA 1T3NA 4IQTA 1SV4A 2BDUA 2RDJA 1VDVA 3SAFA 1Q3UA 2LM1A 1HIWA 3OSNA 3NUQA 2E8OA 1M6YA 2ZIUB 4YN4A 2KKVA 1UT5A 4GFJA 1Z00B 3LVWA 4J03A 2CRXA 2KVSA 4P0QA 2ASDA 5HHIA 1UCVA 5KFXA 1SV0C 1WWVA 2CXYA 5AM0A 3NASA 2AGQA 1ZQDA 3QU7A 5TISU 3E2EA 2KK0A 4DF8A 3EZ5A 3N7SC 4ED8A 4JWNA 4Q44A 2QARA 2W8LA 4BJQA 4EBCA 2IA6A 5DBCA 2W9AA 4QJFB 3C2LA 4J9NA 3PY8A 7ICIA 1A76A 4MFCA 2F2AB 3RBEA 4US8A 4DF4A 2PKEA 2BCQA 1BPEA 4DO9A 4M2YA 2ZIWB 3M8RA 8ICQA 1XWLA 2YMPA 3ZDEA 3D6JA 1QTMA 3PSPA 4QZHA 4RNOA 2I6XA 3A0BU 4U7CA 3JPSA 2D3DA 3N7PD 5DB8A 5AM4A 3QZ7A 3BQ7A 1DK3A 4ECQA 4NL9A 3R9KA 1BPDA 2YTUA 2P6RA 1ZD5A 1X66A 4PZNA 4DQRA 2F44A 5KT7A 3BQ0A 4NLGA 4PHDA 4CGZA 5DB9A 5BOMA 5J0RA 4CCHA 1SXDA 1L7MA 1ZJNA 1KQQA 3G6YA 4KLIA 5F3XB 7ICKA 3H4DA 4DL2A 3MDAA 2NRTA 2LHTA 2VIXA 3WK4A 4M9GA 3S6JA 3PMLA 2RRDA 3RRGA 3BS5A 3OPXA 4XUSA 4BDPA 4CRXA 5KFMA 4F2SA 4B9LA 3QU4A 5ALOA 1FO4A 3V7KA 5L1MA 3H8SA 2D6FC 2KKPA 3NS1A 4DFKA 2K8BB 3B0YA 1WYGA 3Q8SB 5J2GA 1S9FA 3I28A 2LYBA 2LYAA 3MABA 5D46A 4IR9A 4BWJA 3LWMA 3T5HA 2FI1A 4C7YA 5IIKA 1UPHA 2BQRA 1ZQUA 4Y2QA 3QU2A 1KW4A 5AK4A 3QEBZ 3RJIA 5KFHA 2W9BA 2A1JB 2G0AA 3HT3A 3LYSA 1PZNA 2HW3A 4DFMA 7ICNA 3SV3A 4QZ9A 3QUCA 3ZDCA 2BKEA 1N60A 1ZQNA 2W9BB 2KV2A 4EX6A 1BNOA 4RQ8A 2J6SA 2H3IA 5ALZA 4PPXA 2HOIA 2ALZA 4J9PA 2MAXA 1ZQYA 1COOA 4GXIA 3T5JA 4CF5A 2W7OA 5AM5A 3QU5A 2E8PA 4DOBA 1RQNA 4ED2A 4IS7A 4KLLA 5J0SA 2KSOA 5KG7A 5J2FA 2R8IA 3A0HU 1X2IA 3N4MB 5D49A 4J9MA 4UBCA 2W43A 2HDOA 2JHDA 2V4RA 4RQ3A 3SENA 1P7DA 4ED1A 4I2AA 3RFAA 4ECXA 2EZYA 1ZQXA 4MFFA 2KP7A 3AMZA 4O3MA 7ICVA 5ALNA 3RB3A 4BXOB 1Q46A 1CI4A 2BPGA 4ECWA 3H8WA 5AKXA 3Q8MA 1B0XA 3KZIU 1ZQBA 2PFOA 2G5IB 4J9LA 4M0AA 4ELVA 2GOLA 4KLSA 2B0CA 5DQGA 3O0FA 2Y9TA 3ISBA 2CN1A 1X6JA 3UM9A 3OHAA 4R63A 2F8KA 4UB1A 4NLCA 2EH9A 2E8NA 3CNHA 3IV6A 3B0XA 2VJ5A 5DQIA 5KFCA 4DQPA 4Y2SA 4F4WA 5J2KA 5CA7A 2DFLA 9ICEA 2BCRA 3C1ZA 1TE2A 2XI9A 4I2GA 3MGIA 4PGYA 3TAPA 3UXNA 3FC4A 4KITB 5D4BA 4NL9C 2XICA 3UMCA 1L7OA 2BHNA 3KD3A 2MU2A 5KFJA 3DDHA 4DFJA 2W3RA 5AKGA 4O3RA 1N5XA 2HOQA 4AYBC 5KFKA 8ICVA 3ICXA 5AKJA 2AQ4A 3E58A 1S10A 5CR0A 2Y1JA 4CE6A 4YR0A 4JB3A 1NKEA 4MFAA 4Y2PA 1RG6A 5ALDA 5IIMA 1TK0A 1MSWD 3RH5A 1Z1BA 1Y88A 3CW2C 2NO4A 1VLBA 1RPLA 3KZXA 5IINA 3HX0A 5AM1A 4R66A 2ESEA 2OYYA 4IQWA 2WF6A 2FPLA 5AI9A 3NVWA 2BR0A 3EPGA 4C4SA 3ETLA 4C8LA 2HHXA 5GTIU 3MDCA 5KG2A 3PW2A 2W9CA 2G07A 5KFIA 4B9SA 4YMMA 5KT3A 2FLPA 4P0PB 2DQNB
chains in the Genus database with same CATH topology
2RQ5A 1KQQA 2CXYA 5K4LA 1RYUA 1C20A 1KN5A 2LI6A 2KK0A 1KKXA 2JXJA 2LM1A 5CEHA 2EQYA 2OEHA 4LJXA 2JRZA 2YQEA 1IG6A 2EH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQ5 A;  1KQQ A;  2CXY A;  5K4L A;  1RYU A;  1C20 A;  1KN5 A;  2LI6 A;  2KK0 A;  1KKX A;  2JXJ A;  2LM1 A;  5CEH A;  2EQY A;  2OEH A;  4LJX A;  2JRZ A;  2YQE A;  1IG6 A;  2EH9 A; 
#chains in the Genus database with same CATH topology
 4QWB A;  2EAN A;  2W7P A;  2ZIV A;  2W9C B;  1B43 A;  5J0W A;  9ICF A;  4Y2V A;  5KFG A;  2BDP A;  1S76 D;  2KNJ A;  2B6G A;  2DWQ A;  2NRZ A;  2ZTD A;  4TQS A;  2ZXI A;  3KKA A;  4I2I A;  4IQU A;  4DLE A;  1S97 A;  1CUK A;  4NM2 A;  5KFQ A;  2H3Z A;  1NI3 A;  4GLX A;  2JXJ A;  2KE7 A;  1LKY A;  3HPO A;  2B21 A;  4OO1 J;  2F1H A;  2F3N A;  2MSN A;  2FJ6 A;  2XGQ A;  5KT6 A;  2XC9 A;  7ICG A;  2A3V A;  2LMR A;  1ZD4 A;  2QKQ A;  9ICO A;  1RM6 C;  1LKY B;  4EBD A;  3I76 A;  4NM1 A;  1ZQV A;  4QZD A;  3ISD A;  1KDH A;  4KLT A;  1B22 A;  3SEI A;  1UQV A;  1KSP A;  3WK6 A;  3WK5 A;  7ICQ A;  3DEE A;  2Y1I A;  4I2H A;  1IG6 A;  5AKE A;  8ICP A;  2AQ0 A;  3H8M A;  1RZT A;  1NK5 A;  4KLF A;  3GDX A;  4FO6 A;  1PK1 B;  4KMU A;  1V9P A;  5DLF A;  2E3T A;  4RPZ A;  1ZQQ A;  5ALR A;  2VJ4 A;  2XY7 A;  5KL8 B;  5HR7 A;  2GO7 A;  5CWR A;  1WWU A;  2ZG6 A;  5J0X A;  5AI8 A;  2RQ5 A;  1SKR A;  4F8R A;  5KG6 A;  3B9J A;  4GC6 A;  2FPK A;  1N5W A;  4OD0 A;  9ICA A;  2RLT A;  2BPF A;  2DPI A;  5HNK A;  5HR6 A;  4PH5 A;  4LJX A;  2M0N A;  1U4B A;  1SWW A;  2BQU A;  2HHV A;  4YMN A;  4UW9 A;  3DV9 A;  3AU2 A;  1C20 A;  4FS2 A;  1DOQ A;  4PGQ A;  4B9M A;  3H8J A;  1RXW A;  3L4P A;  1A77 A;  2YML A;  4XQ8 A;  5DGB A;  4ECR A;  4QWC A;  1DXS A;  1X42 A;  1N48 A;  4YCX A;  2HBJ A;  3FAH A;  4X5V A;  1DRG A;  4DSJ A;  2ASJ A;  1N61 A;  3AEV A;  1RYR A;  1SKS A;  4UB4 A;  4EEN A;  3GU3 A;  8ICS A;  8ICF A;  2O6K A;  1U9L A;  1BPZ A;  2KTQ A;  3UQ2 A;  1TVA A;  5AI6 A;  3HWT A;  7ICT A;  3M8S A;  3EWA A;  8ICZ A;  4C4T A;  4NJ8 A;  5KFS A;  3ISC A;  3V7L A;  3PNC A;  1ZRN A;  4QW9 A;  3UXP A;  2WF7 A;  2ISO A;  1XNS A;  4NXZ A;  3V6H A;  3PR4 A;  2ZUB A;  1N56 A;  2KFZ A;  3BQT A;  4UB2 A;  1U45 A;  5DGA A;  3Q8L A;  1NZP A;  3JPN A;  1DGS A;  2MRL A;  3WK7 A;  4RQ6 A;  3TQ1 A;  1JXE A;  5AI5 A;  2G06 A;  4KLE A;  1NK7 A;  1XO0 A;  2KVC A;  1SL2 A;  8ICH A;  2ZJA A;  2JMG A;  3CYM A;  4JV2 A;  1OXJ A;  4YMO A;  4ELU A;  2H3Q A;  1T4G A;  3MFI A;  3NGD A;  2V4Q A;  3PX0 A;  4B9T A;  2HHW A;  1NJY A;  3RH4 A;  3GQC A;  5KG5 A;  2AXT U;  2QB0 A;  3JPO A;  9ICL A;  3KKA C;  2VA2 A;  1JI7 A;  1ARO P;  5AKK A;  4OJL A;  3PW7 A;  1N2X A;  3AQE A;  2UVW A;  2CPR A;  1TAQ A;  5J0T A;  4F71 A;  3TI0 A;  3HRD D;  3HKZ C;  2NO5 A;  3TKA A;  5J2B A;  5DG8 A;  3RB6 A;  3M9N B;  9ICB A;  4P0Q B;  2NRW A;  4LZG A;  7ICU A;  1JIH A;  1WUD A;  4CNQ A;  1Z4O A;  3PW5 A;  3EYZ A;  1QQ5 A;  1OW5 A;  1L6N A;  4YXJ A;  3VCB A;  5KFD A;  8ICU A;  1BVS A;  2WF9 A;  4NV0 A;  5KT4 A;  1SL1 A;  2QAR B;  1T7P A;  4ECS A;  3OTQ A;  3ED5 A;  1JX4 A;  3PO4 A;  3SAG A;  1UT8 A;  5L1L A;  2IOH A;  1L3T A;  7ICS A;  4Y2R A;  4TQR A;  4Q8F A;  2YX8 A;  2H3V A;  4F4X A;  2K4P A;  5DB6 A;  1TK5 A;  8ICC A;  3J81 j;  4OJ5 A;  4Y2U A;  4BGD A;  2HBM A;  3RF9 A;  3SV4 A;  1EXN A;  4I2B A;  1ZQ1 C;  3N97 B;  2ASL A;  3IRU A;  2YN4 A;  5ALH A;  4O5C A;  2VA3 A;  3PO5 A;  2R8J A;  7ICO A;  1U48 A;  5T14 A;  1L8O A;  1ZQC A;  1ZQG A;  1ZQZ A;  1ZQJ A;  3RH6 A;  4KLQ A;  2YB4 A;  1S0M A;  2BGW A;  2XID A;  3ALR A;  1WG8 A;  3EPI A;  4M9N A;  4YFK A;  2RHF A;  1L8L A;  3IP4 B;  3LDA A;  4UQG A;  2HOF A;  4DSL A;  4P4P A;  3QXG A;  4UB5 A;  3PVX A;  3THV A;  3MC1 A;  5ALX A;  1COK A;  5ALS A;  2K4I A;  1C7Y A;  5EE3 A;  4QW8 A;  5KFL A;  3OJS A;  2UVU A;  1UA0 A;  2KOB A;  1X40 A;  2L5Y A;  1NKB A;  1KFD A;  1XO1 A;  3D2S A;  3AL0 B;  3BS5 B;  2KHV A;  5A0L A;  3V7J A;  1SZH A;  2GWS A;  1XU4 A;  2I1Q A;  5KTQ A;  3ZDD A;  3GV5 B;  4YD2 A;  4ECV A;  5ALF A;  4PJ0 U;  3F5E A;  4A8E A;  4KMO B;  2R8H A;  4RPY A;  2WAQ C;  3AM9 A;  1QSS A;  2HHU A;  5KFP A;  4AP9 A;  1B4F A;  4DL4 A;  5ALE A;  2PI5 A;  1YT3 A;  5KAI U;  2F8L A;  3MR5 A;  4NLZ A;  8ICK A;  2EZZ A;  4DEZ A;  4GC7 A;  4UAR A;  3TFS A;  5ALG A;  3V6J A;  4R8U A;  1S0N A;  2KZ3 A;  4RQM A;  4BUG A;  2LBO A;  4M47 A;  2NRX A;  4C80 A;  4O3O A;  2OHF A;  5L1K A;  2F1J A;  1NKC A;  2QB1 A;  9ICT A;  5DBA A;  1ZQI A;  2C28 A;  4J9Q A;  1X9M A;  4R8U B;  2A1A A;  3KBB A;  3QX7 A;  3NRZ A;  5J2J A;  5DB7 A;  5HMM A;  1SXE A;  5KFZ A;  2H3F A;  1ZXI A;  5L1J A;  4UB6 U;  3WKD A;  4YXM A;  2XY6 A;  4DL5 A;  2EDU A;  1KLN A;  8ICM A;  4Y2Y A;  3PR5 B;  3GV7 B;  4DQQ A;  2KIV A;  2I9G A;  9ICI A;  2HCF A;  5KFY A;  2OCE A;  3C23 A;  3BZK A;  2FE9 A;  3PX6 A;  5DKW A;  2P66 A;  3QUB A;  2KSO B;  4Z6D A;  2Z7J A;  5B5E U;  2F76 X;  2FMP A;  1OUQ A;  2G09 A;  1GO3 F;  2W54 A;  1Q3V A;  5J0P A;  3GII A;  1LB2 B;  3L5K A;  3QUT A;  5CRX A;  4YP3 A;  4F5R A;  2KFN A;  1L7P A;  3GZF A;  1PK3 A;  3IHQ B;  2UVV A;  1U47 A;  4F92 B;  3C28 A;  3HJE A;  3RBD A;  4ZOH C;  3QUQ A;  2WF5 A;  4AYB F;  3ZI4 A;  5AK6 A;  3TAQ A;  1D8Y A;  5J2H A;  3QE9 Y;  2H5X A;  2JH7 A;  4Q43 A;  2G5H B;  1T3Q A;  2K89 A;  9ICR A;  2XCP A;  2DBY A;  2JEI A;  2NYV A;  3GV8 B;  4O3N A;  1IXR A;  5G5G A;  1O08 A;  2KEY A;  4EX7 A;  1U49 A;  3GIK A;  4PHE A;  4C8K A;  5AM2 A;  1ZQL A;  1N62 A;  4EEK A;  1ZET A;  1JAL A;  3IDW A;  1KL9 A;  4US9 A;  4QZI A;  3PZP A;  3KTQ A;  2DGZ A;  2R18 A;  4I2D A;  3H0R B;  2FDR A;  2UVR A;  5EE1 A;  2PFP A;  1FEZ A;  5J29 A;  8ICJ A;  5KG4 A;  4CF3 A;  3H40 A;  2W11 A;  2KJ5 A;  2GH1 A;  2W8K A;  3ETR A;  4DL3 A;  3KHG A;  1Q8K A;  8ICW A;  4DOC A;  4B9U A;  4F2R A;  1NOM A;  3QYP A;  4I29 A;  4I2E A;  2EQY A;  9ICN A;  2W04 A;  3M6K A;  2PMZ C;  2FPM A;  5KAF U;  2VKQ A;  4YR2 A;  4RT3 A;  3UXO A;  4F4Y A;  2IBK A;  3C5G A;  1UA1 A;  1XSL A;  4EYH B;  5AKZ A;  3WK9 A;  1X9X A;  5EWE A;  4O9M A;  3RB4 A;  4K4I A;  3EUB 2;  4KX5 A;  4YQW A;  2E1F A;  1HUO A;  4RQN A;  4Y2J A;  4C4R A;  3IN5 A;  1D8L A;  4ELT A;  1T94 A;  4NLK A;  1SB3 C;  1NJZ A;  2AJQ A;  4GXJ A;  2ZIV B;  2JZB A;  3WKB A;  1SWV A;  5AI4 A;  2AGO A;  4ICA A;  4Z6E A;  5AM3 A;  1V38 A;  2WTF A;  1PVQ A;  2IHM A;  1Z3E B;  5C0Y A;  1S0O A;  2FLN A;  1D8B A;  4I27 A;  5KFE A;  4DSE A;  5IIL A;  4M04 A;  4IRC A;  1V97 A;  3KFU F;  5J2C A;  4P4O A;  5KG1 A;  4BWM A;  9ICS A;  1NNL A;  2OXO A;  3RJJ A;  4F50 A;  4I2F A;  3OHB A;  1ZQA A;  2KG5 A;  3Q8R B;  1YZ7 A;  5KFA A;  4C7Z A;  5DDY A;  1MQ2 A;  3BS7 A;  4YR3 A;  3KHL A;  5HP4 A;  5TZV A;  4TUS A;  5KT5 A;  3RJF A;  4RPX A;  4ED3 A;  3RAQ A;  1PUZ A;  2GLE A;  4JV1 A;  1MC8 A;  4LZD A;  4DQS A;  2PXI A;  4C8N A;  3GFK B;  8ICE A;  2HHQ A;  3MR3 A;  3RR8 A;  2LI6 A;  1YZ6 A;  1L7N A;  1BPX A;  2KJ9 A;  3PST A;  3K1Z A;  1ZYQ A;  4F4K A;  1ZQW A;  5AKI A;  1MN8 A;  5ALQ A;  4QWE A;  4UB3 A;  4PL1 A;  2KHQ A;  4DS4 A;  4NWI A;  2YB1 A;  2KZZ A;  5B66 U;  2JEG A;  4IQV A;  5AKL A;  1RYU A;  5J2A A;  2C2D A;  7ICR A;  3OGU A;  2OM6 A;  3EW9 A;  2G08 A;  3BJY A;  1PVR A;  2HHS A;  2M9N A;  4IL6 U;  3LWL A;  4J9K A;  1ZQT A;  4DSK A;  9ICH A;  1S0V A;  3RB0 A;  2HI0 A;  1S5L U;  4ACO A;  3GIM A;  2JEJ A;  5CB1 A;  3MGH A;  4IRK A;  2F1I A;  4BX9 C;  4F4Z A;  5E79 U;  3GIJ A;  2PFN A;  4EYI B;  4QZG A;  7ICP A;  4QZF A;  5L1I A;  3Q8K A;  2F77 X;  1ZQE A;  5J2D A;  4PHP A;  4ED7 A;  3H0M B;  1LVH A;  1JXL A;  1AQ6 A;  5KFW A;  3TAR A;  5KFN A;  4KLD A;  2K8C B;  1QCK A;  2W55 A;  1NK0 A;  4DOA A;  1MA7 A;  3T79 A;  9ICP A;  1IV8 A;  2RP5 A;  1KEJ A;  3SD7 A;  1IIP A;  4RQ4 A;  1XSP A;  3PX4 A;  2LM4 A;  1N63 A;  3FDS A;  3FM9 A;  3T5K A;  4EZ9 A;  2MUT A;  3TFR A;  3H7I A;  5KFT A;  1ZQF A;  2A19 A;  2NRV A;  5J8Y A;  4M9L A;  1F5S A;  4RQ7 A;  3MR2 A;  4C8O A;  3WKA A;  5EOZ A;  4RQ1 A;  4MHV A;  2EAO A;  4DL6 A;  4ECU A;  3NTU A;  5KFO A;  5CHG A;  8ICN A;  4J9S A;  4ECY A;  1ZQH A;  8ICT A;  9ICV A;  4MF8 A;  4PHA A;  5ALL A;  5JTI A;  1PVP A;  5DDM A;  2VA8 A;  2BCU A;  2XCA A;  3MBY A;  5EE0 A;  1SKW A;  2JRZ A;  2KMD A;  1L5U A;  3BZC A;  4QZ8 A;  3LK9 A;  3V6K A;  4O3S A;  4FZN A;  3HKZ F;  2YMM A;  4C0Z A;  4WJ3 B;  1LV5 A;  4QIW C;  1DGJ A;  5J0U A;  4YD1 A;  2HHT A;  4XRH A;  4R65 A;  2ZIU A;  2YMQ A;  4MEY A;  3IG5 A;  4USA A;  3L3F X;  1RQL A;  2BZF A;  3HW8 A;  1QSL A;  2JGA A;  2C2R A;  4RNM A;  4O0I A;  2QB0 B;  2IMW P;  5CJ7 A;  4MF2 A;  5HHH A;  4J9R A;  3M6Z A;  4Y2X A;  4CF4 A;  2AH5 A;  8ICX A;  2ZTC A;  4GIB A;  4DL7 A;  3N28 A;  4FZL A;  3SYZ A;  2NV3 A;  4RT2 A;  3BQ1 A;  3KHH A;  4UAT A;  2ZXH A;  5KG0 A;  4DSF A;  2LYH A;  2K60 A;  2KIW A;  4B9V A;  3PW4 A;  5AIC A;  4F91 B;  2ZIW A;  2DL0 A;  4QWA A;  2P35 A;  1JMS A;  4F5Q A;  5ALW A;  8ICR A;  2HSZ A;  1ZQR A;  1MQ3 A;  4DCC A;  1RDF A;  2P6U A;  4OCZ A;  3OSP A;  1L3U A;  2C2E A;  4UAU A;  2AHO B;  4KLJ A;  2DKX A;  9ICU A;  4B9N A;  5KL1 B;  2YQE A;  4YG2 A;  1F0M A;  1Z1V A;  1V85 A;  8ICY A;  3SAH A;  2FMQ A;  5DBB A;  1ZOL A;  5ALK A;  4UBB A;  3SQI A;  3ONN A;  5BOL A;  1JN3 A;  4RNN A;  5EE9 A;  4G3I A;  2HBK A;  2ZJ5 A;  1A0P A;  4JUZ A;  4F3O A;  4KLM A;  2HVI A;  1HUZ A;  7ICL A;  2K8A A;  4UAS A;  5JRT A;  3QEA Z;  2WAQ F;  3RJG A;  4FFD A;  2ZUD A;  1D9F A;  2YY6 A;  1ZRM A;  5ALP A;  4DFD A;  1F44 A;  5ALI A;  3RR7 A;  4EEL A;  3WKE A;  4E0D A;  5KT2 A;  1ZQM A;  3TAD A;  1X6I A;  1TKD A;  4RUC A;  2BCV A;  5ALM A;  4JV0 A;  5IIJ A;  2ISP A;  3QU9 A;  2K4E A;  1NJW A;  1XC9 A;  9ICX A;  4DLG A;  1K1S A;  2BCS A;  5J8Y C;  5GTH U;  2A1J A;  2KN7 A;  1CEZ A;  4U6P A;  4UAZ A;  4ECT A;  2I5H A;  3N7R C;  4QZB A;  1CRX A;  2KD1 A;  3RJK A;  5KFF A;  2JR5 A;  2FLL A;  4YVZ A;  5HML A;  5DLG A;  4FZM A;  3KOO A;  4HAI A;  3F5A A;  2C22 A;  2LKY A;  3PV8 A;  1URJ A;  1X9W A;  7ICH A;  3LVV A;  2R8K A;  2EZX A;  1JRO A;  1HEK A;  4RU9 A;  2OWO A;  2HBL A;  5ALV A;  3PMN A;  5AIB A;  4RQ2 A;  1NK9 A;  4JWM A;  3SI8 A;  5III A;  3UMG A;  5G5H A;  5DG9 A;  2AU0 A;  4TUP A;  4DS5 A;  3C2K A;  4EZ6 A;  1T8E A;  2WF8 A;  4RUA A;  4OJ6 A;  2XO7 A;  3AQF A;  3F2C A;  4F5N A;  3QZ8 A;  1K1Q A;  4FE3 A;  3C29 A;  4F5O A;  4DFP A;  4BXO A;  2Y0S F;  4M6W A;  1BGX T;  5ALT A;  4EBE A;  3JPP A;  5ALJ A;  2J6T A;  3ZDA A;  4ED0 A;  5EWF A;  1BNP A;  3UPQ A;  2XVT A;  1KFS A;  4KX3 A;  3GIL A;  4I2J A;  3H0L B;  4KLO A;  1RYS A;  4M6W B;  1ZJM A;  2HVH A;  4O3Q A;  4O3P A;  4UAY A;  3SR6 A;  1HJP A;  1ED1 A;  2RDI A;  3WK8 A;  2WFA A;  4FBT A;  4JK1 A;  5KNI A;  9ICK A;  5J0Y A;  2ZJ8 A;  4MEX A;  1XS9 D;  3ZDB A;  2Y0S C;  1A6S A;  4ZH4 A;  4I2C A;  2ZTE A;  4F93 B;  5F9N A;  4Q45 A;  4LVS A;  4ECZ A;  2E8M A;  1FFV A;  3IG8 A;  1NJX A;  3NRW A;  4DQI A;  1J2N A;  1QQ7 A;  3KHR A;  1ZQO A;  1SGG A;  9ICC A;  1ZD2 P;  1UHU A;  3ZD8 A;  5BPC A;  2IOF A;  2DF4 B;  4OJO A;  3M9M B;  2PMZ F;  3BQ2 A;  5KFV A;  1Z19 A;  5JUM A;  4KLG A;  4O5E A;  4B6J A;  2ATL A;  4J9O A;  3UMB A;  3F2B A;  1ZQK A;  2PFQ A;  9ICG A;  8ICO A;  4QZC A;  3NVZ A;  3C21 A;  4PL2 A;  1NK4 A;  1DK2 A;  3OJU A;  4Y2T A;  4KTQ A;  4NLB A;  5AIA A;  2MA1 A;  1SL0 A;  1ZQP A;  4QZE A;  5J2I A;  5CP2 A;  1RXV A;  3RTV A;  5AK3 A;  9ICW A;  2Q0Z X;  1WCN A;  4P0P A;  3VC8 A;  8ICA A;  3SZ2 A;  2FMS A;  3TAD C;  1KN5 A;  2ZIX A;  4F72 A;  3NVV A;  4OJP A;  2K4H A;  3C2M A;  3H4B A;  4JMU A;  4KN4 A;  4M9J A;  3AN1 A;  8ICG A;  2WB1 F;  3RJE A;  1ZQS A;  4DWI A;  3PW0 A;  4I28 A;  1IM4 A;  3WKC A;  5DQH A;  2ZIX B;  1KTQ A;  3ZD9 A;  1JRP A;  1FIQ A;  2PI4 A;  2N1R A;  3TAC B;  2E5S A;  1K5O A;  3F53 A;  4QZA A;  1SIJ A;  3HP6 A;  4Q8E A;  4QWD A;  4FS1 A;  3K4G A;  5CEH A;  3TAN A;  5ALU A;  5L9X A;  4UAV A;  3ORY A;  8ICL A;  7ICJ A;  2XGP A;  2JZB B;  1H38 A;  2WB1 C;  3T3F A;  4IC9 A;  2AGP A;  4P4M A;  4UAW A;  4G9B A;  1D9D A;  4UB8 U;  3BDP A;  1NK6 A;  5AKH A;  3AU6 A;  3D2Q A;  1SV0 A;  5AK5 A;  2W3S A;  3UQ0 A;  4Z6C A;  1TFR A;  4IR1 A;  2BPC A;  4PGX A;  9ICM A;  3JPQ A;  1ECW A;  2IOF K;  2ZUC A;  5ALY A;  2HMX A;  4RQ5 A;  2R8G A;  4PZO A;  5FP0 A;  4C8M A;  4KLH A;  1PK1 A;  4KN7 A;  4ED6 A;  1WCL A;  5KG3 A;  3F2D A;  3Q8Q B;  3M9O B;  5C5J A;  8ICI A;  4NLN A;  4P2H A;  2LPE A;  4DSI A;  5AHX A;  4XA5 A;  5AKY A;  2JV3 A;  2E1E A;  4K4H A;  3CP8 A;  3M7D A;  3E0F A;  4QNL A;  5J0O A;  3K75 D;  1O03 A;  2ODG A;  3G6X A;  1QQ6 A;  1FFU A;  5H2F U;  4NY8 A;  5IIO A;  1JUD A;  1QSY A;  2DKZ A;  1L3V A;  4F5P A;  3T5L A;  4K4G A;  1XSN A;  1SZP A;  1BPB A;  5EWG A;  3FYH A;  2KZM A;  1L3S A;  9ICQ A;  7ICE A;  4EEY A;  3JPT A;  1J2M A;  3IM1 A;  2D8C A;  2ES6 A;  3CRX A;  4M9H A;  1NK8 A;  4O5K A;  2EAP A;  4IRD A;  2WHE A;  3JPR A;  1QH9 A;  4TUR A;  3MFH A;  3RJH A;  3V72 A;  4R64 A;  4TUQ A;  5KFU A;  2V9W A;  2OH2 A;  2EAM A;  4FBU A;  2J6U A;  1KRP A;  3G6V A;  2Q4T A;  1KFT A;  5J2E A;  1X9S A;  7ICF A;  4Z6F A;  1S77 D;  5AI0 A;  3MR6 A;  5JU5 A;  1QLN A;  7ICM A;  3Q8P B;  3HIL A;  2VAN A;  3AUO A;  3D2N A;  2MUT B;  5KFB A;  2IHN A;  9ICJ A;  1TK8 A;  1BPY A;  5J0Q A;  1ZD3 A;  4QIW F;  3QNM A;  2QLT A;  3WU2 U;  1VJ5 A;  5KFR A;  5DG7 A;  1NZB A;  2OEH A;  4GXK A;  1Z4N A;  2KJ8 A;  1KBU A;  2XY5 A;  8ICB A;  4CDG A;  2W03 A;  2JEF A;  3PSI A;  3K1R B;  3RRH A;  1TV9 A;  1J97 A;  2DPJ A;  2BQ3 A;  5K4L A;  4HYK A;  3NVY A;  4RZR A;  3PSF A;  3C5F A;  1KKX A;  3C1Y A;  2KIC A;  1S8O A;  3M1Y A;  3RAX A;  3MGV A;  2JH1 A;  1TAM A;  2W9M A;  3I1Y A;  2Y9U A;  4RQ0 A;  5F9L A;  2DUY A;  3SMV A;  1Z00 A;  3U26 A;  4KLU A;  1TAU A;  1T3N A;  4IQT A;  1SV4 A;  2BDU A;  2RDJ A;  1VDV A;  3SAF A;  1Q3U A;  2LM1 A;  1HIW A;  3OSN A;  3NUQ A;  2E8O A;  1M6Y A;  2ZIU B;  4YN4 A;  2KKV A;  1UT5 A;  4GFJ A;  1Z00 B;  3LVW A;  4J03 A;  2CRX A;  2KVS A;  4P0Q A;  2ASD A;  5HHI A;  1UCV A;  5KFX A;  1SV0 C;  1WWV A;  2CXY A;  5AM0 A;  3NAS A;  2AGQ A;  1ZQD A;  3QU7 A;  5TIS U;  3E2E A;  2KK0 A;  4DF8 A;  3EZ5 A;  3N7S C;  4ED8 A;  4JWN A;  4Q44 A;  2QAR A;  2W8L A;  4BJQ A;  4EBC A;  2IA6 A;  5DBC A;  2W9A A;  4QJF B;  3C2L A;  4J9N A;  3PY8 A;  7ICI A;  1A76 A;  4MFC A;  2F2A B;  3RBE A;  4US8 A;  4DF4 A;  2PKE A;  2BCQ A;  1BPE A;  4DO9 A;  4M2Y A;  2ZIW B;  3M8R A;  8ICQ A;  1XWL A;  2YMP A;  3ZDE A;  3D6J A;  1QTM A;  3PSP A;  4QZH A;  4RNO A;  2I6X A;  3A0B U;  4U7C A;  3JPS A;  2D3D A;  3N7P D;  5DB8 A;  5AM4 A;  3QZ7 A;  3BQ7 A;  1DK3 A;  4ECQ A;  4NL9 A;  3R9K A;  1BPD A;  2YTU A;  2P6R A;  1ZD5 A;  1X66 A;  4PZN A;  4DQR A;  2F44 A;  5KT7 A;  3BQ0 A;  4NLG A;  4PHD A;  4CGZ A;  5DB9 A;  5BOM A;  5J0R A;  4CCH A;  1SXD A;  1L7M A;  1ZJN A;  1KQQ A;  3G6Y A;  4KLI A;  5F3X B;  7ICK A;  3H4D A;  4DL2 A;  3MDA A;  2NRT A;  2LHT A;  2VIX A;  3WK4 A;  4M9G A;  3S6J A;  3PML A;  2RRD A;  3RRG A;  3BS5 A;  3OPX A;  4XUS A;  4BDP A;  4CRX A;  5KFM A;  4F2S A;  4B9L A;  3QU4 A;  5ALO A;  1FO4 A;  3V7K A;  5L1M A;  3H8S A;  2D6F C;  2KKP A;  3NS1 A;  4DFK A;  2K8B B;  3B0Y A;  1WYG A;  3Q8S B;  5J2G A;  1S9F A;  3I28 A;  2LYB A;  2LYA A;  3MAB A;  5D46 A;  4IR9 A;  4BWJ A;  3LWM A;  3T5H A;  2FI1 A;  4C7Y A;  5IIK A;  1UPH A;  2BQR A;  1ZQU A;  4Y2Q A;  3QU2 A;  1KW4 A;  5AK4 A;  3QEB Z;  3RJI A;  5KFH A;  2W9B A;  2A1J B;  2G0A A;  3HT3 A;  3LYS A;  1PZN A;  2HW3 A;  4DFM A;  7ICN A;  3SV3 A;  4QZ9 A;  3QUC A;  3ZDC A;  2BKE A;  1N60 A;  1ZQN A;  2W9B B;  2KV2 A;  4EX6 A;  1BNO A;  4RQ8 A;  2J6S A;  2H3I A;  5ALZ A;  4PPX A;  2HOI A;  2ALZ A;  4J9P A;  2MAX A;  1ZQY A;  1COO A;  4GXI A;  3T5J A;  4CF5 A;  2W7O A;  5AM5 A;  3QU5 A;  2E8P A;  4DOB A;  1RQN A;  4ED2 A;  4IS7 A;  4KLL A;  5J0S A;  2KSO A;  5KG7 A;  5J2F A;  2R8I A;  3A0H U;  1X2I A;  3N4M B;  5D49 A;  4J9M A;  4UBC A;  2W43 A;  2HDO A;  2JHD A;  2V4R A;  4RQ3 A;  3SEN A;  1P7D A;  4ED1 A;  4I2A A;  3RFA A;  4ECX A;  2EZY A;  1ZQX A;  4MFF A;  2KP7 A;  3AMZ A;  4O3M A;  7ICV A;  5ALN A;  3RB3 A;  4BXO B;  1Q46 A;  1CI4 A;  2BPG A;  4ECW A;  3H8W A;  5AKX A;  3Q8M A;  1B0X A;  3KZI U;  1ZQB A;  2PFO A;  2G5I B;  4J9L A;  4M0A A;  4ELV A;  2GOL A;  4KLS A;  2B0C A;  5DQG A;  3O0F A;  2Y9T A;  3ISB A;  2CN1 A;  1X6J A;  3UM9 A;  3OHA A;  4R63 A;  2F8K A;  4UB1 A;  4NLC A;  2EH9 A;  2E8N A;  3CNH A;  3IV6 A;  3B0X A;  2VJ5 A;  5DQI A;  5KFC A;  4DQP A;  4Y2S A;  4F4W A;  5J2K A;  5CA7 A;  2DFL A;  9ICE A;  2BCR A;  3C1Z A;  1TE2 A;  2XI9 A;  4I2G A;  3MGI A;  4PGY A;  3TAP A;  3UXN A;  3FC4 A;  4KIT B;  5D4B A;  4NL9 C;  2XIC A;  3UMC A;  1L7O A;  2BHN A;  3KD3 A;  2MU2 A;  5KFJ A;  3DDH A;  4DFJ A;  2W3R A;  5AKG A;  4O3R A;  1N5X A;  2HOQ A;  4AYB C;  5KFK A;  8ICV A;  3ICX A;  5AKJ A;  2AQ4 A;  3E58 A;  1S10 A;  5CR0 A;  2Y1J A;  4CE6 A;  4YR0 A;  4JB3 A;  1NKE A;  4MFA A;  4Y2P A;  1RG6 A;  5ALD A;  5IIM A;  1TK0 A;  1MSW D;  3RH5 A;  1Z1B A;  1Y88 A;  3CW2 C;  2NO4 A;  1VLB A;  1RPL A;  3KZX A;  5IIN A;  3HX0 A;  5AM1 A;  4R66 A;  2ESE A;  2OYY A;  4IQW A;  2WF6 A;  2FPL A;  5AI9 A;  3NVW A;  2BR0 A;  3EPG A;  4C4S A;  3ETL A;  4C8L A;  2HHX A;  5GTI U;  3MDC A;  5KG2 A;  3PW2 A;  2W9C A;  2G07 A;  5KFI A;  4B9S A;  4YMM A;  5KT3 A;  2FLP A;  4P0P B;  2DQN B; 
#chains in the Genus database with same CATH homology
 2RQ5 A;  1KQQ A;  2CXY A;  5K4L A;  1RYU A;  1C20 A;  1KN5 A;  2LI6 A;  2KK0 A;  1KKX A;  2JXJ A;  2LM1 A;  5CEH A;  2EQY A;  2OEH A;  4LJX A;  2JRZ A;  2YQE A;  1IG6 A;  2EH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...