2LM1A

Solution nmr structure of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium target fr824d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEVYTSGKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Lysine-specific demethylase lid
publication title Northeast Structural Genomics Consortium Target FR824D
rcsb
source organism Drosophila melanogaster
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2lm1A00
1KQQA 2OEHA 5K4LA 1C20A 2LI6A 2JRZA 2KK0A 1IG6A 2LM1A 2CXYA 2EQYA 2RQ5A 5CEHA 1KKXA 2YQEA 1RYUA 4LJXA 1KN5A 2JXJA 2EH9A
chains in the Genus database with same CATH superfamily
2P6RA 8ICBA 1T94A 4OO1J 2LYBA 8ICEA 1X9SA 4YXMA 4DSIA 5AIAA 2MA1A 5B66U 3Q8LA 1T3NA 3AU6A 3GIIA 1WYGA 5KL1B 2FLPA 5KG7A 5KG5A 1XS9D 2OHFA 1YT3A 2KD1A 4QZ8A 4R65A 3ONNA 3AU2A 2ZIXA 5KFLA 4O3OA 7ICLA 4I2AA 4AYBF 5ALQA 4DFDA 2W55A 2A1JA 2R18A 2IMWP 2OWOA 2F8KA 3JPRA 4JMUA 5ALVA 4K4GA 4ECXA 1RXVA 4KLUA 3BJYA 5KG6A 4QWEA 2BQUA 4F4KA 5L1IA 5ALXA 4RQ8A 8ICOA 8ICWA 3ZI4A 5KT4A 4J9KA 9ICNA 3N28A 2F1HA 2BDUA 3V6JA 4ELUA 2Q4TA 4OJLA 1NKEA 4ECRA 3ED5A 2W9MA 3TAPA 3RAXA 1UQVA 5J2EA 2ZUCA 2E8NA 2HOQA 4DLEA 1XNSA 1F44A 3ZD9A 2EANA 2HVHA 3L5KA 1ZQDA 2XY6A 1SV4A 4MHVA 1TFRA 5GTHU 4R64A 4O5EA 1N56A 5DDMA 3SD7A 5KFPA 3PW2A 2LYHA 3JPQA 3EPGA 4M9LA 5IIMA 3DDHA 3RB3A 4EX6A 5EE3A 5HNKA 1DGJA 1SWVA 4I29A 3KD3A 4C8KA 2KMDA 2DBYA 4EBDA 5L1JA 4C8OA 5J2DA 2JEIA 2WB1F 2WFAA 5AM5A 2HBMA 3UMBA 3SENA 2E5SA 2LYAA 3DV9A 1KFSA 2KFNA 2ODGA 1JIHA 1KDHA 4YVZA 3GFKB 2XC9A 4P4PA 3KOOA 5KL8B 3B0YA 4UAYA 1TK8A 3HT3A 9ICXA 4DO9A 3KHHA 3QUQA 4M9GA 2FE9A 4C8MA 2FPMA 4KLMA 1TAQA 4Y2XA 5KFSA 3RBDA 2AHOB 3RJKA 3BQ7A 4O5CA 4U7CA 2BR0A 1ZD3A 2ZTDA 2HOFA 5IILA 2NRTA 1AQ6A 1ZYQA 1COKA 3ZDDA 2DWQA 1VJ5A 5ALPA 2ZIXB 2M0NA 4YD1A 3HRDD 2HHXA 3RH5A 1ZQBA 1XC9A 4CDGA 3SV3A 3TFSA 3UXOA 3HWTA 2A1JB 5KFVA 4NL9C 3PVXA 4ECYA 3WK4A 3KHRA 4F92B 4CF4A 2IOFA 1L7NA 4P4OA 4ECVA 3SMVA 2F1JA 1HIWA 4EELA 2ZIWA 1ZQWA 4Y2QA 1MA7A 1KN5A 8ICLA 1XSPA 2HSZA 1N5WA 4NM1A 4IRKA 4YMNA 2KVCA 1RQNA 3WKBA 3BDPA 2KK0A 4YN4A 3FAHA 3T3FA 3PNCA 1BNPA 2F8LA 4NM2A 2LM4A 4O3PA 5KFNA 5AKLA 7ICFA 3N97B 3RBEA 2K8BB 2H5XA 1ZQZA 4DL5A 4FS2A 4QIWC 3RFAA 1Z3EB 4R63A 1ECWA 3KKAC 2LMRA 1SV0C 1SL2A 2KTQA 4RNOA 3ZDBA 2K4HA 1JXEA 1RZTA 5EWFA 3MDCA 4FE3A 4F5RA 1X9WA 2NYVA 4EZ9A 2NO4A 3OTQA 2VA8A 1NKCA 1MC8A 4QZFA 2FPLA 2XCPA 4GXIA 1RYSA 4C7YA 3BQ2A 1D8YA 3GIMA 2W8KA 3JPNA 1HJPA 4F93B 2KJ9A 4QWCA 4DSKA 1S5LU 4I2GA 4DEZA 2BPFA 3QNMA 2K60A 5KFDA 1ZQXA 1DOQA 1Y88A 2KN7A 3V72A 2Y1IA 3MGVA 2G06A 1RYUA 4CF5A 1TAMA 3LWLA 3TQ1A 3NVVA 5ALLA 4F3OA 5DGAA 5DG7A 3TAQA 1H38A 4FZLA 2ESEA 1L5UA 2I9GA 4R66A 2E8MA 3PR4A 3MGIA 5KAIU 5AKYA 3BS5A 3TFRA 4QZAA 1F5SA 1ZQUA 3UQ2A 3F53A 3SEIA 3PR5B 1ZQRA 4B9VA 2MRLA 3WK9A 4UASA 1K1QA 3T79A 3PO5A 2WF9A 3C5FA 4I28A 5AM4A 4MFAA 2QB1A 1CUKA 3LVVA 2OYYA 3NVWA 3FC4A 5ALNA 2NRWA 1TAUA 2YY6A 1COOA 1LVHA 4OJ5A 4UAVA 4KLDA 5KFTA 1MQ2A 1KFDA 2KZZA 1NOMA 2EAMA 5JRTA 4CRXA 2ZIWB 5KAFU 3K1RB 3LWMA 2ATLA 3IN5A 1PK3A 2WTFA 3C5GA 4RQ5A 3VCBA 3GQCA 1V9PA 2VA3A 4IRDA 1B0XA 2F44A 3ETRA 2Y1JA 2QB0A 3BQ0A 5ALSA 5D46A 5IIOA 2DPJA 5L1MA 5KFBA 3M8SA 4YXJA 3LYSA 2RRDA 1JROA 4O3RA 2AGPA 3H8MA 3RRHA 5KT6A 4OCZA 1ZQPA 3ZDAA 4ZOHC 9ICMA 3S6JA 2FI1A 5ALMA 2L5YA 1XSLA 4RQ4A 4BXOA 2VJ4A 5F9LA 2Y0SC 8ICXA 4DLGA 2JR5A 1ZQ1C 2FLLA 4RNNA 3OJSA 8ICFA 4NLGA 4RUAA 3AQFA 5CR0A 3PW7A 5KTQA 2ASLA 1WCLA 1A0PA 4QZHA 1PVPA 3QU7A 4XRHA 2KICA 5AICA 5CWRA 3PSFA 1U4BA 5KFFA 3PSIA 3UPQA 4BX9C 1FFUA 4J9SA 2ZUBA 2AQ4A 3KHGA 5CB1A 2HHQA 3C28A 4Y2SA 3HKZC 2HBJA 1ZQCA 3IHQB 7ICKA 5DKWA 1UA1A 4Z6DA 5ALRA 5DBCA 3WK5A 1N61A 1Z19A 1ZQGA 1JN3A 3MGHA 2Z7JA 5ALFA 3BS5B 2LHTA 1TK5A 2IOHA 2UVUA 1L8OA 3ALRA 1ZD2P 5AKKA 1AROP 1ZQVA 1NI3A 1RQLA 1FO4A 4F4ZA 2WF7A 2AGOA 2MUTA 4DWIA 4I2JA 1MQ3A 4RU9A 2YMMA 4XA5A 5KT3A 1N60A 1NK4A 1A77A 1JRPA 3GIKA 3IG5A 2I5HA 4EENA 4RT2A 7ICUA 3SI8A 4YQWA 3MC1A 2A3VA 3GV5B 4UB8U 3M9MB 1S10A 4HYKA 2E8OA 2EZXA 4YP3A 3H8WA 2JEGA 2E1FA 1XWLA 2XO7A 2ZTCA 5B5EU 2EQYA 4FFDA 1ZQAA 4P4MA 5KFZA 4FS1A 2IBKA 1NJWA 4ACOA 4RPXA 2EAOA 2VKQA 1NK0A 2QB0B 1B4FA 1NK6A 5JU5A 1IXRA 2HMXA 4F2SA 5AK3A 5EE1A 5EWGA 8ICIA 1V38A 5DQHA 5JTIA 1QH9A 4JK1A 2JHDA 3HX0A 4J9LA 2KP7A 5ALIA 4KITB 2V4RA 3CRXA 2KJ5A 1X2IA 1WWVA 9ICHA 1DGSA 1ZETA 2W3RA 4Y2RA 4C8NA 4F2RA 3C1YA 3O0FA 4RNMA 8ICMA 4I27A 4BXOB 5KFAA 4DQQA 1ZQLA 4KLLA 1T7PA 4F8RA 3L4PA 3RTVA 2HHWA 4JB3A 1SKSA 1L7OA 1QSYA 2P66A 5CRXA 1B43A 3UXNA 4EEYA 5DB9A 4Q8EA 2NV3A 3F2CA 5EOZA 2FMSA 3KBBA 2P6UA 3NGDA 3RJGA 2ISOA 4JUZA 1KQQA 2FMPA 1BGXT 2GO7A 4KLQA 1ZOLA 2RHFA 4ZH4A 4BGDA 7ICIA 2B0CA 9ICTA 3BS7A 2W8LA 4UB4A 1UCVA 4TUSA 3ISBA 4RT3A 5G5HA 4M9JA 4ECSA 4M0AA 4DQIA 3FM9A 1L3VA 5IIJA 2YMLA 4GC6A 4NXZA 2ISPA 9ICAA 1LB2B 5ALTA 5J0SA 2HHUA 4FZMA 4C80A 2YB4A 4DL2A 2G5HB 4DQSA 4F4WA 4O3MA 4I2FA 3RR7A 7ICJA 5KFCA 3RJFA 2C22A 2MUTB 3RRGA 4KLFA 2ZJ8A 5ALZA 8ICJA 1KRPA 3MBYA 2G09A 4RQMA 3TADA 1ZRMA 2BQ3A 1C7YA 1WUDA 5T14A 2J6UA 3EUB2 2W54A 2BCRA 5KFKA 3BZKA 3TANA 3CP8A 1X66A 4M9NA 4F5PA 4ELTA 2K4EA 3OSNA 1QCKA 2ZIUB 5J8YA 3EW9A 4US8A 1KSPA 4UARA 4RQ6A 3MR5A 3TARA 1L3TA 2E8PA 3Q8QB 3AUOA 4AYBC 2EAPA 4ECZA 2PI5A 4TQRA 5DDYA 4M47A 1M6YA 1VDVA 1Z00A 4B9LA 3CW2C 3KHLA 3M6ZA 4NLBA 4BUGA 1CRXA 1S77D 2KVSA 5AKJA 2V9WA 4JV0A 1BPYA 4RQ0A 3PW4A 5AI8A 3ETLA 4O3NA 1QQ6A 3AMZA 1JI7A 5AM2A 2BKEA 2WAQF 2ZTEA 8ICTA 2PMZF 4F5OA 1XO0A 2NRZA 1HUZA 2K8CB 2ASJA 2ZIVA 4I2HA 3V6HA 1JX4A 4QZEA 5AK5A 4EBCA 3D2QA 3SQIA 5E79U 4LVSA 2OEHA 1PK1A 3RJHA 7ICHA 1C20A 3CNHA 1ZQFA 1J2MA 3M7DA 1TK0A 2Y9TA 5DB8A 4F4XA 4DL3A 3L3FX 2W9BA 4P0QA 3GZFA 1WWUA 2AH5A 4YMMA 4O5KA 2ES6A 1UA0A 4CGZA 4LZDA 4J9MA 5D4BA 2KHQA 2MSNA 3C21A 3PZPA 3WKEA 2F2AB 2WB1C 1KTQA 3QZ7A 3KTQA 8ICCA 2MAXA 1J2NA 2F76X 5J0WA 4O3QA 4DOAA 5KFJA 3RB4A 3NTUA 5DB6A 4JWNA 3MR2A 5J2IA 2FJ6A 3A0BU 3GV8B 1X42A 8ICPA 2H3VA 3G6YA 3IDWA 2KV2A 2BCQA 2OCEA 4G9BA 3RR8A 9ICGA 3NVYA 2F77X 2QARA 1ZXIA 4BJQA 2G5IB 2XY7A 1SKRA 1OXJA 3MDAA 4UB6U 3SV4A 3AQEA 1V97A 7ICSA 2RDIA 3SAGA 2BHNA 5ALJA 4MF8A 2G0AA 2RQ5A 2H3IA 1BPEA 4GC7A 3V6KA 3UMCA 3QX7A 1Z00B 4DOBA 3OHAA 4RUCA 4UB5A 4US9A 5HMMA 4UW9A 4QJFB 4DF8A 4NLNA 2ZXIA 4RQNA 2LM1A 2AQ0A 3ZDEA 1NK5A 2R8HA 2OXOA 3SZ2A 2W7OA 2CPRA 2YQEA 3Q8PB 8ICQA 4C4SA 2W3SA 2ZIVB 4U6PA 4M6WA 3MABA 2IA6A 4DF4A 1PK1B 5AKXA 4WJ3B 9ICIA 9ICQA 4PGYA 3HP6A 3WU2U 2E1EA 3HJEA 1FFVA 3THVA 4IR1A 2B6GA 2W9BB 2PFOA 4P0QB 1NJZA 4KLGA 2JV3A 5AK6A 5KFQA 4R8UA 4DCCA 3IRUA 1FIQA 4DL7A 2A1AA 1N2XA 1SGGA 3A0HU 3C2LA 2CRXA 1NNLA 1ZQNA 1LKYA 2EDUA 2CN1A 3V7JA 3LVWA 4Q43A 2EZZA 3JPSA 4PPXA 4E0DA 5HR7A 4Y2UA 3SAHA 5KFXA 3NRWA 1Z1BA 4IR9A 4ED6A 4QZIA 5EWEA 2XVTA 4M9HA 4BWMA 1PUZA 1U48A 1SZPA 4EYIB 4J9NA 2KZMA 4Q8FA 2KHVA 3UMGA 1XSNA 4O0IA 4KMUA 1PVRA 2UVVA 5L9XA 2JEJA 1GO3F 7ICPA 5JUMA 2QARB 3N7SC 4DFKA 2HVIA 1RG6A 2MU2A 2FLNA 5A0LA 1J97A 4QZGA 5J2CA 5ALKA 4EYHB 3QYPA 1TV9A 3H4BA 3GIJA 3IP4B 4B9SA 4DOCA 3KZXA 2YN4A 4CE6A 4C7ZA 4KLJA 3QU5A 3JPPA 1DK2A 5DGBA 3T5JA 3QEBZ 4F5QA 1P7DA 4UATA 4Y2VA 1U45A 1X40A 3RAQA 3N7RC 4YFKA 2H3ZA 3WK6A 2GWSA 1KL9A 9ICFA 7ICMA 5TISU 5ALHA 3N4MB 3OGUA 3ZD8A 1S0NA 4DFJA 4FZNA 1F0MA 1V85A 4G3IA 4QZDA 9ICBA 4Z6FA 1A6SA 5KG2A 4MEXA 3H7IA 1DK3A 7ICOA 3U26A 1DXSA 5J0UA 2BCSA 3LK9A 4RPZA 4JWMA 1ZRNA 1Q8KA 4GXKA 4NLCA 4M6WB 3E2EA 2ZUDA 3SAFA 2JZBA 4J9QA 4DSLA 4Q45A 4YCXA 3R9KA 2R8JA 4PZOA 5BPCA 3ZDCA 2HBLA 2XI9A 4IL6U 4R8UB 3Q8RB 2VA2A 3E58A 4K4IA 2WF5A 3FYHA 4PJ0U 1LKYB 4OJ6A 1K1SA 4F5NA 1UHUA 3GU3A 3GILA 4J03A 1QQ5A 3VC8A 2J6TA 1YZ7A 4F72A 4KLOA 2FDRA 7ICTA 1S97A 4KMOB 4ED1A 2JH1A 3IG8A 4DFPA 2JGAA 4RQ3A 1CI4A 4KLTA 2ZJAA 3WK7A 5AM0A 1SIJA 7ICGA 9ICCA 3H40A 3RB6A 3PW5A 9ICPA 3RJEA 2IOFK 1SXDA 4NLKA 1BPBA 1ZQIA 1S76D 2WF8A 5J0TA 1Q3VA 2D8CA 3T5KA 3ISDA 3OJUA 9ICRA 5AI0A 4XQ8A 3PY8A 4RZRA 4QZ9A 2G08A 4K4HA 5KFHA 2PFPA 3PMLA 3AM9A 1ZQQA 3PX0A 2RLTA 2C28A 1PZNA 3OHBA 5K4LA 5IIKA 1K5OA 4DSFA 4IC9A 4UB1A 1JMSA 1T4GA 4F91B 2BPGA 9ICKA 2F1IA 5ALUA 2G07A 5DQGA 5ALGA 3GV7B 1PVQA 2D6FC 2GLEA 4Y2JA 4O9MA 3WKDA 1ZQYA 4RPYA 4ED2A 4C4RA 1KW4A 2JXJA 4PL1A 2KG5A 1ZD4A 3UXPA 3Q8KA 3BQ1A 2KJ8A 5KFOA 1QLNA 4J9OA 2Q0ZX 4ECUA 5ALDA 3KZIU 4UQGA 3H4DA 3I1YA 5AKHA 4ED7A 1BNOA 3EWAA 1ZJNA 3V7KA 4RQ1A 2ZJ5A 4NV0A 2JZBB 3T5HA 2BPCA 3IM1A 3HILA 4UB2A 3C29A 1RM6C 1VLBA 5J29A 2DF4B 3SR6A 2HHSA 5J2JA 5KFWA 1KEJA 2I6XA 3PX4A 3EYZA 1ZQTA 4AP9A 4YG2A 2KSOA 1KFTA 4DQRA 4UBCA 4PHEA 4UB3A 3H0RB 4UAWA 2A19A 3HW8A 5CJ7A 3JPOA 1X9XA 9ICOA 1ZQHA 1D8BA 3NVZA 5DB7A 2V4QA 5CHGA 3Q8MA 5CEHA 4DSJA 5CP2A 1N63A 4QW9A 3ISCA 1D9DA 5J2KA 5KT2A 2NRVA 2NRXA 1T3QA 2DL0A 3DEEA 2IHMA 4DS5A 1HEKA 4M2YA 2GOLA 2YX8A 8ICSA 2BCVA 4PHAA 1S0VA 3OPXA 3WK8A 3B0XA 4F50A 4C0ZA 4CF3A 9ICEA 2KKVA 4JV2A 2YMQA 4LZGA 1ZQEA 3MFHA 2J6SA 4KLSA 4ED8A 3PSPA 4YD2A 3GDXA 3RH6A 2JH7A 3C1ZA 2ASDA 4ED3A 3F5AA 3PSTA 1NZPA 3QUTA 2XGPA 1N5XA 3G6XA 4QZCA 1L3SA 1NJYA 3F2DA 3UQ0A 5KG0A 4ICAA 4IQVA 4M04A 4J9RA 4KLIA 8ICRA 3RB0A 5J0QA 1RYRA 4GXJA 4IRCA 2OM6A 4NL9A 2KNJA 1QTMA 4Y2YA 5KFGA 2HHVA 1UT5A 1S9FA 2K89A 1HUOA 2W9AA 2F3NA 3NUQA 1L6NA 2BQRA 2W11A 4OJPA 4PL2A 3PV8A 2WAQC 3C23A 2C2EA 4QNLA 2PMZC 3QE9Y 2QLTA 5D49A 3C2MA 5FP0A 2BZFA 1NK7A 1RDFA 2AJQA 2GH1A 4Y2TA 4YR2A 2UVWA 1T8EA 1SL0A 1TVAA 3KKAA 3PO4A 2VIXA 1SV0A 2KSOB 1KLNA 1UT8A 3TADC 5AI5A 2BDPA 1U49A 5DG9A 7ICRA 9ICSA 4B9MA 5L1KA 5J8YC 3MR6A 4ECWA 5HHIA 3H8SA 3FDSA 4JV1A 2KIWA 5DQIA 4B9UA 2KFZA 5J2FA 4KLEA 5GTIU 1URJA 2JEFA 2CXYA 4F4YA 4YR3A 4YR0A 8ICKA 5CA7A 1Q3UA 3D6JA 5DG8A 5DBBA 4C8LA 1FEZA 1BPDA 1XO1A 5KFYA 2YTUA 3K4GA 2DGZA 1NZBA 3PMNA 2UVRA 5J2AA 1ZQJA 1NJXA 4GFJA 4KX5A 1TE2A 4KLHA 2VJ5A 4Z6EA 4XUSA 3AN1A 2I1QA 3BZCA 4QWBA 5L1LA 5H2FU 5KFEA 2LKYA 3I28A 1IIPA 2BGWA 2VANA 4EX7A 2FMQA 3F5EA 4GIBA 3F2BA 1KKXA 4UBBA 1WG8A 2PFQA 2PKEA 4QIWF 1MSWD 2PFNA 1SXEA 1IM4A 3D2NA 2HDOA 4FBUA 2AGQA 5J0PA 4MEYA 2N1RA 3B9JA 5KFUA 5HP4A 4X5VA 2JMGA 3TI0A 4KX3A 5F3XB 5KG3A 4I2IA 3TKAA 3QEAZ 8ICHA 5AKZA 2XGQA 1SL1A 5HMLA 2ZG6A 2B21A 4LJXA 1YZ6A 4B6JA 2H3FA 3I76A 5AIBA 5HHHA 5EE9A 5AI6A 2R8GA 5J2GA 2XICA 3MFIA 5KG1A 4ED0A 3H0MB 3BQTA 3UM9A 4FBTA 2H3QA 9ICWA 1WCNA 8ICGA 1Z4OA 3H8JA 1NK9A 4MFFA 5J0OA 3WKAA 4NY8A 2HBKA 4EZ6A 2W04A 4OD0A 1ZQOA 3RF9A 5KG4A 8ICUA 2W9CA 5J0XA 4I2DA 4BDPA 3AL0B 4DSEA 4I2CA 1N48A 2OH2A 1NK8A 5DBAA 4KTQA 2NO5A 5ALOA 1KBUA 8ICYA 1L8LA 3QZ8A 5KT5A 5F9NA 5DLGA 4B9NA 1ED1A 1SKWA 3RJJA 2Y9UA 2E3TA 1SB3C 2C2DA 1SWWA 1ZD5A 2DQNB 4FO6A 5ALYA 3D2SA 2WF6A 4RQ2A 4PGXA 1IV8A 2AU0A 5EE0A 2K4PA 4EEKA 2KKPA 2DFLA 3TACB 1B22A 2RDJA 3CYMA 4NJ8A 5ALEA 1S0MA 2JRZA 1N62A 2K4IA 4PZNA 4O3SA 1OUQA 3K1ZA 5KNIA 4DQPA 3J81j 1XU4A 3QXGA 4PGQA 4NWIA 5J0RA 4PHDA 1MN8A 3K75D 3NRZA 4Q44A 1RXWA 1BPXA 2HW3A 2HI0A 1EXNA 4CNQA 9ICUA 2KZ3A 3M6KA 4EBEA 5BOLA 3T5LA 1JUDA 2M9NA 1S8OA 4IQWA 1ZQMA 1IG6A 5AM1A 4GLXA 5ALWA 1JXLA 4Y2PA 1X6JA 3M9OB 3M1YA 2KIVA 4IQTA 2QKQA 2YB1A 2XCAA 3E0FA 2XY5A 2HOIA 1U9LA 8ICZA 3EPIA 2KOBA 2YMPA 2ALZA 2Y0SF 4DL6A 2RP5A 3M9NB 7ICQA 7ICNA 4P0PA 4P2HA 2DPIA 3V7LA 4F71A 4MFCA 2HHTA 5AKEA 8ICNA 2W03A 5AK4A 3IV6A 3HPOA 4YMOA 1Z4NA 5AKGA 4B9TA 3Q8SB 4OJOA 4Z6CA 1JALA 1X6IA 4ECQA 4NLZA 2P35A 5BOMA 1D9FA 1DRGA 1RPLA 3QUBA 4HAIA 2EZYA 4RQ7A 2W9CB 3HKZF 4I2BA 1LV5A 5J2BA 2W7PA 3C2KA 1SZHA 4KN7A 4DS4A 5IINA 2R8IA 3ORYA 2KEYA 2PXIA 4UAZA 4DFMA 4ECTA 1O08A 5AI4A 4TQSA 1OW5A 1U47A 2DKXA 1QSSA 2W43A 3G6VA 5G5GA 7ICVA 3LDAA 3JPTA 1D8LA 3WKCA 4CCHA 2BCUA 4I2EA 2HCFA 2ZXHA 5KFIA 1BPZA 4QWAA 4ELVA 5C5JA 5J2HA 4DL4A 4C4TA 2PI4A 3QUCA 3EZ5A 2IHNA 5AI9A 5J0YA 3QU4A 2LPEA 5IIIA 3H0LB 1O03A 2WHEA 1S0OA 1CEZA 1TKDA 3KFUF 1QSLA 2AXTU 3NASA 3RH4A 2DKZA 4PH5A 1NKBA 3PW0A 9ICJA 5C0YA 5TZVA 2O6KA 3M8RA 2LI6A 2ZIUA 3PX6A 3NS1A 3QU2A 4IQUA 2LBOA 4J9PA 3ICXA 2R8KA 1L7MA 8ICAA 5AM3A 3SYZA 4KN4A 1L7PA 4UAUA 4A8EA 4TUQA 1ZQSA 1A76A 9ICLA 2K8AA 4TURA 2XIDA 2EH9A 1X9MA 2C2RA 5HR6A 1QQ7A 1UPHA 5AHXA 5DLFA 1ZQKA 3OSPA 4QZBA 1ZJMA 3RJIA 4P0PB 5KFMA 1Q46A 4BWJA 3MR3A 8ICVA 3N7PD 4QW8A 9ICVA 2D3DA 4IS7A 2FPKA 1BVSA 1L3UA 2DUYA 4QWDA 4TUPA 3AEVA 4USAA 3QU9A 2KE7A 7ICEA 5KFRA 4PHPA 5KT7A 5AKIA 1Z1VA 4MF2A
chains in the Genus database with same CATH topology
1KQQA 2OEHA 5K4LA 1C20A 2LI6A 2JRZA 2KK0A 1IG6A 2LM1A 2CXYA 2EQYA 2RQ5A 5CEHA 1KKXA 2YQEA 1RYUA 4LJXA 1KN5A 2JXJA 2EH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQQ A;  2OEH A;  5K4L A;  1C20 A;  2LI6 A;  2JRZ A;  2KK0 A;  1IG6 A;  2LM1 A;  2CXY A;  2EQY A;  2RQ5 A;  5CEH A;  1KKX A;  2YQE A;  1RYU A;  4LJX A;  1KN5 A;  2JXJ A;  2EH9 A; 
#chains in the Genus database with same CATH topology
 2P6R A;  8ICB A;  1T94 A;  4OO1 J;  2LYB A;  8ICE A;  1X9S A;  4YXM A;  4DSI A;  5AIA A;  2MA1 A;  5B66 U;  3Q8L A;  1T3N A;  3AU6 A;  3GII A;  1WYG A;  5KL1 B;  2FLP A;  5KG7 A;  5KG5 A;  1XS9 D;  2OHF A;  1YT3 A;  2KD1 A;  4QZ8 A;  4R65 A;  3ONN A;  3AU2 A;  2ZIX A;  5KFL A;  4O3O A;  7ICL A;  4I2A A;  4AYB F;  5ALQ A;  4DFD A;  2W55 A;  2A1J A;  2R18 A;  2IMW P;  2OWO A;  2F8K A;  3JPR A;  4JMU A;  5ALV A;  4K4G A;  4ECX A;  1RXV A;  4KLU A;  3BJY A;  5KG6 A;  4QWE A;  2BQU A;  4F4K A;  5L1I A;  5ALX A;  4RQ8 A;  8ICO A;  8ICW A;  3ZI4 A;  5KT4 A;  4J9K A;  9ICN A;  3N28 A;  2F1H A;  2BDU A;  3V6J A;  4ELU A;  2Q4T A;  4OJL A;  1NKE A;  4ECR A;  3ED5 A;  2W9M A;  3TAP A;  3RAX A;  1UQV A;  5J2E A;  2ZUC A;  2E8N A;  2HOQ A;  4DLE A;  1XNS A;  1F44 A;  3ZD9 A;  2EAN A;  2HVH A;  3L5K A;  1ZQD A;  2XY6 A;  1SV4 A;  4MHV A;  1TFR A;  5GTH U;  4R64 A;  4O5E A;  1N56 A;  5DDM A;  3SD7 A;  5KFP A;  3PW2 A;  2LYH A;  3JPQ A;  3EPG A;  4M9L A;  5IIM A;  3DDH A;  3RB3 A;  4EX6 A;  5EE3 A;  5HNK A;  1DGJ A;  1SWV A;  4I29 A;  3KD3 A;  4C8K A;  2KMD A;  2DBY A;  4EBD A;  5L1J A;  4C8O A;  5J2D A;  2JEI A;  2WB1 F;  2WFA A;  5AM5 A;  2HBM A;  3UMB A;  3SEN A;  2E5S A;  2LYA A;  3DV9 A;  1KFS A;  2KFN A;  2ODG A;  1JIH A;  1KDH A;  4YVZ A;  3GFK B;  2XC9 A;  4P4P A;  3KOO A;  5KL8 B;  3B0Y A;  4UAY A;  1TK8 A;  3HT3 A;  9ICX A;  4DO9 A;  3KHH A;  3QUQ A;  4M9G A;  2FE9 A;  4C8M A;  2FPM A;  4KLM A;  1TAQ A;  4Y2X A;  5KFS A;  3RBD A;  2AHO B;  3RJK A;  3BQ7 A;  4O5C A;  4U7C A;  2BR0 A;  1ZD3 A;  2ZTD A;  2HOF A;  5IIL A;  2NRT A;  1AQ6 A;  1ZYQ A;  1COK A;  3ZDD A;  2DWQ A;  1VJ5 A;  5ALP A;  2ZIX B;  2M0N A;  4YD1 A;  3HRD D;  2HHX A;  3RH5 A;  1ZQB A;  1XC9 A;  4CDG A;  3SV3 A;  3TFS A;  3UXO A;  3HWT A;  2A1J B;  5KFV A;  4NL9 C;  3PVX A;  4ECY A;  3WK4 A;  3KHR A;  4F92 B;  4CF4 A;  2IOF A;  1L7N A;  4P4O A;  4ECV A;  3SMV A;  2F1J A;  1HIW A;  4EEL A;  2ZIW A;  1ZQW A;  4Y2Q A;  1MA7 A;  1KN5 A;  8ICL A;  1XSP A;  2HSZ A;  1N5W A;  4NM1 A;  4IRK A;  4YMN A;  2KVC A;  1RQN A;  3WKB A;  3BDP A;  2KK0 A;  4YN4 A;  3FAH A;  3T3F A;  3PNC A;  1BNP A;  2F8L A;  4NM2 A;  2LM4 A;  4O3P A;  5KFN A;  5AKL A;  7ICF A;  3N97 B;  3RBE A;  2K8B B;  2H5X A;  1ZQZ A;  4DL5 A;  4FS2 A;  4QIW C;  3RFA A;  1Z3E B;  4R63 A;  1ECW A;  3KKA C;  2LMR A;  1SV0 C;  1SL2 A;  2KTQ A;  4RNO A;  3ZDB A;  2K4H A;  1JXE A;  1RZT A;  5EWF A;  3MDC A;  4FE3 A;  4F5R A;  1X9W A;  2NYV A;  4EZ9 A;  2NO4 A;  3OTQ A;  2VA8 A;  1NKC A;  1MC8 A;  4QZF A;  2FPL A;  2XCP A;  4GXI A;  1RYS A;  4C7Y A;  3BQ2 A;  1D8Y A;  3GIM A;  2W8K A;  3JPN A;  1HJP A;  4F93 B;  2KJ9 A;  4QWC A;  4DSK A;  1S5L U;  4I2G A;  4DEZ A;  2BPF A;  3QNM A;  2K60 A;  5KFD A;  1ZQX A;  1DOQ A;  1Y88 A;  2KN7 A;  3V72 A;  2Y1I A;  3MGV A;  2G06 A;  1RYU A;  4CF5 A;  1TAM A;  3LWL A;  3TQ1 A;  3NVV A;  5ALL A;  4F3O A;  5DGA A;  5DG7 A;  3TAQ A;  1H38 A;  4FZL A;  2ESE A;  1L5U A;  2I9G A;  4R66 A;  2E8M A;  3PR4 A;  3MGI A;  5KAI U;  5AKY A;  3BS5 A;  3TFR A;  4QZA A;  1F5S A;  1ZQU A;  3UQ2 A;  3F53 A;  3SEI A;  3PR5 B;  1ZQR A;  4B9V A;  2MRL A;  3WK9 A;  4UAS A;  1K1Q A;  3T79 A;  3PO5 A;  2WF9 A;  3C5F A;  4I28 A;  5AM4 A;  4MFA A;  2QB1 A;  1CUK A;  3LVV A;  2OYY A;  3NVW A;  3FC4 A;  5ALN A;  2NRW A;  1TAU A;  2YY6 A;  1COO A;  1LVH A;  4OJ5 A;  4UAV A;  4KLD A;  5KFT A;  1MQ2 A;  1KFD A;  2KZZ A;  1NOM A;  2EAM A;  5JRT A;  4CRX A;  2ZIW B;  5KAF U;  3K1R B;  3LWM A;  2ATL A;  3IN5 A;  1PK3 A;  2WTF A;  3C5G A;  4RQ5 A;  3VCB A;  3GQC A;  1V9P A;  2VA3 A;  4IRD A;  1B0X A;  2F44 A;  3ETR A;  2Y1J A;  2QB0 A;  3BQ0 A;  5ALS A;  5D46 A;  5IIO A;  2DPJ A;  5L1M A;  5KFB A;  3M8S A;  4YXJ A;  3LYS A;  2RRD A;  1JRO A;  4O3R A;  2AGP A;  3H8M A;  3RRH A;  5KT6 A;  4OCZ A;  1ZQP A;  3ZDA A;  4ZOH C;  9ICM A;  3S6J A;  2FI1 A;  5ALM A;  2L5Y A;  1XSL A;  4RQ4 A;  4BXO A;  2VJ4 A;  5F9L A;  2Y0S C;  8ICX A;  4DLG A;  2JR5 A;  1ZQ1 C;  2FLL A;  4RNN A;  3OJS A;  8ICF A;  4NLG A;  4RUA A;  3AQF A;  5CR0 A;  3PW7 A;  5KTQ A;  2ASL A;  1WCL A;  1A0P A;  4QZH A;  1PVP A;  3QU7 A;  4XRH A;  2KIC A;  5AIC A;  5CWR A;  3PSF A;  1U4B A;  5KFF A;  3PSI A;  3UPQ A;  4BX9 C;  1FFU A;  4J9S A;  2ZUB A;  2AQ4 A;  3KHG A;  5CB1 A;  2HHQ A;  3C28 A;  4Y2S A;  3HKZ C;  2HBJ A;  1ZQC A;  3IHQ B;  7ICK A;  5DKW A;  1UA1 A;  4Z6D A;  5ALR A;  5DBC A;  3WK5 A;  1N61 A;  1Z19 A;  1ZQG A;  1JN3 A;  3MGH A;  2Z7J A;  5ALF A;  3BS5 B;  2LHT A;  1TK5 A;  2IOH A;  2UVU A;  1L8O A;  3ALR A;  1ZD2 P;  5AKK A;  1ARO P;  1ZQV A;  1NI3 A;  1RQL A;  1FO4 A;  4F4Z A;  2WF7 A;  2AGO A;  2MUT A;  4DWI A;  4I2J A;  1MQ3 A;  4RU9 A;  2YMM A;  4XA5 A;  5KT3 A;  1N60 A;  1NK4 A;  1A77 A;  1JRP A;  3GIK A;  3IG5 A;  2I5H A;  4EEN A;  4RT2 A;  7ICU A;  3SI8 A;  4YQW A;  3MC1 A;  2A3V A;  3GV5 B;  4UB8 U;  3M9M B;  1S10 A;  4HYK A;  2E8O A;  2EZX A;  4YP3 A;  3H8W A;  2JEG A;  2E1F A;  1XWL A;  2XO7 A;  2ZTC A;  5B5E U;  2EQY A;  4FFD A;  1ZQA A;  4P4M A;  5KFZ A;  4FS1 A;  2IBK A;  1NJW A;  4ACO A;  4RPX A;  2EAO A;  2VKQ A;  1NK0 A;  2QB0 B;  1B4F A;  1NK6 A;  5JU5 A;  1IXR A;  2HMX A;  4F2S A;  5AK3 A;  5EE1 A;  5EWG A;  8ICI A;  1V38 A;  5DQH A;  5JTI A;  1QH9 A;  4JK1 A;  2JHD A;  3HX0 A;  4J9L A;  2KP7 A;  5ALI A;  4KIT B;  2V4R A;  3CRX A;  2KJ5 A;  1X2I A;  1WWV A;  9ICH A;  1DGS A;  1ZET A;  2W3R A;  4Y2R A;  4C8N A;  4F2R A;  3C1Y A;  3O0F A;  4RNM A;  8ICM A;  4I27 A;  4BXO B;  5KFA A;  4DQQ A;  1ZQL A;  4KLL A;  1T7P A;  4F8R A;  3L4P A;  3RTV A;  2HHW A;  4JB3 A;  1SKS A;  1L7O A;  1QSY A;  2P66 A;  5CRX A;  1B43 A;  3UXN A;  4EEY A;  5DB9 A;  4Q8E A;  2NV3 A;  3F2C A;  5EOZ A;  2FMS A;  3KBB A;  2P6U A;  3NGD A;  3RJG A;  2ISO A;  4JUZ A;  1KQQ A;  2FMP A;  1BGX T;  2GO7 A;  4KLQ A;  1ZOL A;  2RHF A;  4ZH4 A;  4BGD A;  7ICI A;  2B0C A;  9ICT A;  3BS7 A;  2W8L A;  4UB4 A;  1UCV A;  4TUS A;  3ISB A;  4RT3 A;  5G5H A;  4M9J A;  4ECS A;  4M0A A;  4DQI A;  3FM9 A;  1L3V A;  5IIJ A;  2YML A;  4GC6 A;  4NXZ A;  2ISP A;  9ICA A;  1LB2 B;  5ALT A;  5J0S A;  2HHU A;  4FZM A;  4C80 A;  2YB4 A;  4DL2 A;  2G5H B;  4DQS A;  4F4W A;  4O3M A;  4I2F A;  3RR7 A;  7ICJ A;  5KFC A;  3RJF A;  2C22 A;  2MUT B;  3RRG A;  4KLF A;  2ZJ8 A;  5ALZ A;  8ICJ A;  1KRP A;  3MBY A;  2G09 A;  4RQM A;  3TAD A;  1ZRM A;  2BQ3 A;  1C7Y A;  1WUD A;  5T14 A;  2J6U A;  3EUB 2;  2W54 A;  2BCR A;  5KFK A;  3BZK A;  3TAN A;  3CP8 A;  1X66 A;  4M9N A;  4F5P A;  4ELT A;  2K4E A;  3OSN A;  1QCK A;  2ZIU B;  5J8Y A;  3EW9 A;  4US8 A;  1KSP A;  4UAR A;  4RQ6 A;  3MR5 A;  3TAR A;  1L3T A;  2E8P A;  3Q8Q B;  3AUO A;  4AYB C;  2EAP A;  4ECZ A;  2PI5 A;  4TQR A;  5DDY A;  4M47 A;  1M6Y A;  1VDV A;  1Z00 A;  4B9L A;  3CW2 C;  3KHL A;  3M6Z A;  4NLB A;  4BUG A;  1CRX A;  1S77 D;  2KVS A;  5AKJ A;  2V9W A;  4JV0 A;  1BPY A;  4RQ0 A;  3PW4 A;  5AI8 A;  3ETL A;  4O3N A;  1QQ6 A;  3AMZ A;  1JI7 A;  5AM2 A;  2BKE A;  2WAQ F;  2ZTE A;  8ICT A;  2PMZ F;  4F5O A;  1XO0 A;  2NRZ A;  1HUZ A;  2K8C B;  2ASJ A;  2ZIV A;  4I2H A;  3V6H A;  1JX4 A;  4QZE A;  5AK5 A;  4EBC A;  3D2Q A;  3SQI A;  5E79 U;  4LVS A;  2OEH A;  1PK1 A;  3RJH A;  7ICH A;  1C20 A;  3CNH A;  1ZQF A;  1J2M A;  3M7D A;  1TK0 A;  2Y9T A;  5DB8 A;  4F4X A;  4DL3 A;  3L3F X;  2W9B A;  4P0Q A;  3GZF A;  1WWU A;  2AH5 A;  4YMM A;  4O5K A;  2ES6 A;  1UA0 A;  4CGZ A;  4LZD A;  4J9M A;  5D4B A;  2KHQ A;  2MSN A;  3C21 A;  3PZP A;  3WKE A;  2F2A B;  2WB1 C;  1KTQ A;  3QZ7 A;  3KTQ A;  8ICC A;  2MAX A;  1J2N A;  2F76 X;  5J0W A;  4O3Q A;  4DOA A;  5KFJ A;  3RB4 A;  3NTU A;  5DB6 A;  4JWN A;  3MR2 A;  5J2I A;  2FJ6 A;  3A0B U;  3GV8 B;  1X42 A;  8ICP A;  2H3V A;  3G6Y A;  3IDW A;  2KV2 A;  2BCQ A;  2OCE A;  4G9B A;  3RR8 A;  9ICG A;  3NVY A;  2F77 X;  2QAR A;  1ZXI A;  4BJQ A;  2G5I B;  2XY7 A;  1SKR A;  1OXJ A;  3MDA A;  4UB6 U;  3SV4 A;  3AQE A;  1V97 A;  7ICS A;  2RDI A;  3SAG A;  2BHN A;  5ALJ A;  4MF8 A;  2G0A A;  2RQ5 A;  2H3I A;  1BPE A;  4GC7 A;  3V6K A;  3UMC A;  3QX7 A;  1Z00 B;  4DOB A;  3OHA A;  4RUC A;  4UB5 A;  4US9 A;  5HMM A;  4UW9 A;  4QJF B;  4DF8 A;  4NLN A;  2ZXI A;  4RQN A;  2LM1 A;  2AQ0 A;  3ZDE A;  1NK5 A;  2R8H A;  2OXO A;  3SZ2 A;  2W7O A;  2CPR A;  2YQE A;  3Q8P B;  8ICQ A;  4C4S A;  2W3S A;  2ZIV B;  4U6P A;  4M6W A;  3MAB A;  2IA6 A;  4DF4 A;  1PK1 B;  5AKX A;  4WJ3 B;  9ICI A;  9ICQ A;  4PGY A;  3HP6 A;  3WU2 U;  2E1E A;  3HJE A;  1FFV A;  3THV A;  4IR1 A;  2B6G A;  2W9B B;  2PFO A;  4P0Q B;  1NJZ A;  4KLG A;  2JV3 A;  5AK6 A;  5KFQ A;  4R8U A;  4DCC A;  3IRU A;  1FIQ A;  4DL7 A;  2A1A A;  1N2X A;  1SGG A;  3A0H U;  3C2L A;  2CRX A;  1NNL A;  1ZQN A;  1LKY A;  2EDU A;  2CN1 A;  3V7J A;  3LVW A;  4Q43 A;  2EZZ A;  3JPS A;  4PPX A;  4E0D A;  5HR7 A;  4Y2U A;  3SAH A;  5KFX A;  3NRW A;  1Z1B A;  4IR9 A;  4ED6 A;  4QZI A;  5EWE A;  2XVT A;  4M9H A;  4BWM A;  1PUZ A;  1U48 A;  1SZP A;  4EYI B;  4J9N A;  2KZM A;  4Q8F A;  2KHV A;  3UMG A;  1XSN A;  4O0I A;  4KMU A;  1PVR A;  2UVV A;  5L9X A;  2JEJ A;  1GO3 F;  7ICP A;  5JUM A;  2QAR B;  3N7S C;  4DFK A;  2HVI A;  1RG6 A;  2MU2 A;  2FLN A;  5A0L A;  1J97 A;  4QZG A;  5J2C A;  5ALK A;  4EYH B;  3QYP A;  1TV9 A;  3H4B A;  3GIJ A;  3IP4 B;  4B9S A;  4DOC A;  3KZX A;  2YN4 A;  4CE6 A;  4C7Z A;  4KLJ A;  3QU5 A;  3JPP A;  1DK2 A;  5DGB A;  3T5J A;  3QEB Z;  4F5Q A;  1P7D A;  4UAT A;  4Y2V A;  1U45 A;  1X40 A;  3RAQ A;  3N7R C;  4YFK A;  2H3Z A;  3WK6 A;  2GWS A;  1KL9 A;  9ICF A;  7ICM A;  5TIS U;  5ALH A;  3N4M B;  3OGU A;  3ZD8 A;  1S0N A;  4DFJ A;  4FZN A;  1F0M A;  1V85 A;  4G3I A;  4QZD A;  9ICB A;  4Z6F A;  1A6S A;  5KG2 A;  4MEX A;  3H7I A;  1DK3 A;  7ICO A;  3U26 A;  1DXS A;  5J0U A;  2BCS A;  3LK9 A;  4RPZ A;  4JWM A;  1ZRN A;  1Q8K A;  4GXK A;  4NLC A;  4M6W B;  3E2E A;  2ZUD A;  3SAF A;  2JZB A;  4J9Q A;  4DSL A;  4Q45 A;  4YCX A;  3R9K A;  2R8J A;  4PZO A;  5BPC A;  3ZDC A;  2HBL A;  2XI9 A;  4IL6 U;  4R8U B;  3Q8R B;  2VA2 A;  3E58 A;  4K4I A;  2WF5 A;  3FYH A;  4PJ0 U;  1LKY B;  4OJ6 A;  1K1S A;  4F5N A;  1UHU A;  3GU3 A;  3GIL A;  4J03 A;  1QQ5 A;  3VC8 A;  2J6T A;  1YZ7 A;  4F72 A;  4KLO A;  2FDR A;  7ICT A;  1S97 A;  4KMO B;  4ED1 A;  2JH1 A;  3IG8 A;  4DFP A;  2JGA A;  4RQ3 A;  1CI4 A;  4KLT A;  2ZJA A;  3WK7 A;  5AM0 A;  1SIJ A;  7ICG A;  9ICC A;  3H40 A;  3RB6 A;  3PW5 A;  9ICP A;  3RJE A;  2IOF K;  1SXD A;  4NLK A;  1BPB A;  1ZQI A;  1S76 D;  2WF8 A;  5J0T A;  1Q3V A;  2D8C A;  3T5K A;  3ISD A;  3OJU A;  9ICR A;  5AI0 A;  4XQ8 A;  3PY8 A;  4RZR A;  4QZ9 A;  2G08 A;  4K4H A;  5KFH A;  2PFP A;  3PML A;  3AM9 A;  1ZQQ A;  3PX0 A;  2RLT A;  2C28 A;  1PZN A;  3OHB A;  5K4L A;  5IIK A;  1K5O A;  4DSF A;  4IC9 A;  4UB1 A;  1JMS A;  1T4G A;  4F91 B;  2BPG A;  9ICK A;  2F1I A;  5ALU A;  2G07 A;  5DQG A;  5ALG A;  3GV7 B;  1PVQ A;  2D6F C;  2GLE A;  4Y2J A;  4O9M A;  3WKD A;  1ZQY A;  4RPY A;  4ED2 A;  4C4R A;  1KW4 A;  2JXJ A;  4PL1 A;  2KG5 A;  1ZD4 A;  3UXP A;  3Q8K A;  3BQ1 A;  2KJ8 A;  5KFO A;  1QLN A;  4J9O A;  2Q0Z X;  4ECU A;  5ALD A;  3KZI U;  4UQG A;  3H4D A;  3I1Y A;  5AKH A;  4ED7 A;  1BNO A;  3EWA A;  1ZJN A;  3V7K A;  4RQ1 A;  2ZJ5 A;  4NV0 A;  2JZB B;  3T5H A;  2BPC A;  3IM1 A;  3HIL A;  4UB2 A;  3C29 A;  1RM6 C;  1VLB A;  5J29 A;  2DF4 B;  3SR6 A;  2HHS A;  5J2J A;  5KFW A;  1KEJ A;  2I6X A;  3PX4 A;  3EYZ A;  1ZQT A;  4AP9 A;  4YG2 A;  2KSO A;  1KFT A;  4DQR A;  4UBC A;  4PHE A;  4UB3 A;  3H0R B;  4UAW A;  2A19 A;  3HW8 A;  5CJ7 A;  3JPO A;  1X9X A;  9ICO A;  1ZQH A;  1D8B A;  3NVZ A;  5DB7 A;  2V4Q A;  5CHG A;  3Q8M A;  5CEH A;  4DSJ A;  5CP2 A;  1N63 A;  4QW9 A;  3ISC A;  1D9D A;  5J2K A;  5KT2 A;  2NRV A;  2NRX A;  1T3Q A;  2DL0 A;  3DEE A;  2IHM A;  4DS5 A;  1HEK A;  4M2Y A;  2GOL A;  2YX8 A;  8ICS A;  2BCV A;  4PHA A;  1S0V A;  3OPX A;  3WK8 A;  3B0X A;  4F50 A;  4C0Z A;  4CF3 A;  9ICE A;  2KKV A;  4JV2 A;  2YMQ A;  4LZG A;  1ZQE A;  3MFH A;  2J6S A;  4KLS A;  4ED8 A;  3PSP A;  4YD2 A;  3GDX A;  3RH6 A;  2JH7 A;  3C1Z A;  2ASD A;  4ED3 A;  3F5A A;  3PST A;  1NZP A;  3QUT A;  2XGP A;  1N5X A;  3G6X A;  4QZC A;  1L3S A;  1NJY A;  3F2D A;  3UQ0 A;  5KG0 A;  4ICA A;  4IQV A;  4M04 A;  4J9R A;  4KLI A;  8ICR A;  3RB0 A;  5J0Q A;  1RYR A;  4GXJ A;  4IRC A;  2OM6 A;  4NL9 A;  2KNJ A;  1QTM A;  4Y2Y A;  5KFG A;  2HHV A;  1UT5 A;  1S9F A;  2K89 A;  1HUO A;  2W9A A;  2F3N A;  3NUQ A;  1L6N A;  2BQR A;  2W11 A;  4OJP A;  4PL2 A;  3PV8 A;  2WAQ C;  3C23 A;  2C2E A;  4QNL A;  2PMZ C;  3QE9 Y;  2QLT A;  5D49 A;  3C2M A;  5FP0 A;  2BZF A;  1NK7 A;  1RDF A;  2AJQ A;  2GH1 A;  4Y2T A;  4YR2 A;  2UVW A;  1T8E A;  1SL0 A;  1TVA A;  3KKA A;  3PO4 A;  2VIX A;  1SV0 A;  2KSO B;  1KLN A;  1UT8 A;  3TAD C;  5AI5 A;  2BDP A;  1U49 A;  5DG9 A;  7ICR A;  9ICS A;  4B9M A;  5L1K A;  5J8Y C;  3MR6 A;  4ECW A;  5HHI A;  3H8S A;  3FDS A;  4JV1 A;  2KIW A;  5DQI A;  4B9U A;  2KFZ A;  5J2F A;  4KLE A;  5GTI U;  1URJ A;  2JEF A;  2CXY A;  4F4Y A;  4YR3 A;  4YR0 A;  8ICK A;  5CA7 A;  1Q3U A;  3D6J A;  5DG8 A;  5DBB A;  4C8L A;  1FEZ A;  1BPD A;  1XO1 A;  5KFY A;  2YTU A;  3K4G A;  2DGZ A;  1NZB A;  3PMN A;  2UVR A;  5J2A A;  1ZQJ A;  1NJX A;  4GFJ A;  4KX5 A;  1TE2 A;  4KLH A;  2VJ5 A;  4Z6E A;  4XUS A;  3AN1 A;  2I1Q A;  3BZC A;  4QWB A;  5L1L A;  5H2F U;  5KFE A;  2LKY A;  3I28 A;  1IIP A;  2BGW A;  2VAN A;  4EX7 A;  2FMQ A;  3F5E A;  4GIB A;  3F2B A;  1KKX A;  4UBB A;  1WG8 A;  2PFQ A;  2PKE A;  4QIW F;  1MSW D;  2PFN A;  1SXE A;  1IM4 A;  3D2N A;  2HDO A;  4FBU A;  2AGQ A;  5J0P A;  4MEY A;  2N1R A;  3B9J A;  5KFU A;  5HP4 A;  4X5V A;  2JMG A;  3TI0 A;  4KX3 A;  5F3X B;  5KG3 A;  4I2I A;  3TKA A;  3QEA Z;  8ICH A;  5AKZ A;  2XGQ A;  1SL1 A;  5HML A;  2ZG6 A;  2B21 A;  4LJX A;  1YZ6 A;  4B6J A;  2H3F A;  3I76 A;  5AIB A;  5HHH A;  5EE9 A;  5AI6 A;  2R8G A;  5J2G A;  2XIC A;  3MFI A;  5KG1 A;  4ED0 A;  3H0M B;  3BQT A;  3UM9 A;  4FBT A;  2H3Q A;  9ICW A;  1WCN A;  8ICG A;  1Z4O A;  3H8J A;  1NK9 A;  4MFF A;  5J0O A;  3WKA A;  4NY8 A;  2HBK A;  4EZ6 A;  2W04 A;  4OD0 A;  1ZQO A;  3RF9 A;  5KG4 A;  8ICU A;  2W9C A;  5J0X A;  4I2D A;  4BDP A;  3AL0 B;  4DSE A;  4I2C A;  1N48 A;  2OH2 A;  1NK8 A;  5DBA A;  4KTQ A;  2NO5 A;  5ALO A;  1KBU A;  8ICY A;  1L8L A;  3QZ8 A;  5KT5 A;  5F9N A;  5DLG A;  4B9N A;  1ED1 A;  1SKW A;  3RJJ A;  2Y9U A;  2E3T A;  1SB3 C;  2C2D A;  1SWW A;  1ZD5 A;  2DQN B;  4FO6 A;  5ALY A;  3D2S A;  2WF6 A;  4RQ2 A;  4PGX A;  1IV8 A;  2AU0 A;  5EE0 A;  2K4P A;  4EEK A;  2KKP A;  2DFL A;  3TAC B;  1B22 A;  2RDJ A;  3CYM A;  4NJ8 A;  5ALE A;  1S0M A;  2JRZ A;  1N62 A;  2K4I A;  4PZN A;  4O3S A;  1OUQ A;  3K1Z A;  5KNI A;  4DQP A;  3J81 j;  1XU4 A;  3QXG A;  4PGQ A;  4NWI A;  5J0R A;  4PHD A;  1MN8 A;  3K75 D;  3NRZ A;  4Q44 A;  1RXW A;  1BPX A;  2HW3 A;  2HI0 A;  1EXN A;  4CNQ A;  9ICU A;  2KZ3 A;  3M6K A;  4EBE A;  5BOL A;  3T5L A;  1JUD A;  2M9N A;  1S8O A;  4IQW A;  1ZQM A;  1IG6 A;  5AM1 A;  4GLX A;  5ALW A;  1JXL A;  4Y2P A;  1X6J A;  3M9O B;  3M1Y A;  2KIV A;  4IQT A;  2QKQ A;  2YB1 A;  2XCA A;  3E0F A;  2XY5 A;  2HOI A;  1U9L A;  8ICZ A;  3EPI A;  2KOB A;  2YMP A;  2ALZ A;  2Y0S F;  4DL6 A;  2RP5 A;  3M9N B;  7ICQ A;  7ICN A;  4P0P A;  4P2H A;  2DPI A;  3V7L A;  4F71 A;  4MFC A;  2HHT A;  5AKE A;  8ICN A;  2W03 A;  5AK4 A;  3IV6 A;  3HPO A;  4YMO A;  1Z4N A;  5AKG A;  4B9T A;  3Q8S B;  4OJO A;  4Z6C A;  1JAL A;  1X6I A;  4ECQ A;  4NLZ A;  2P35 A;  5BOM A;  1D9F A;  1DRG A;  1RPL A;  3QUB A;  4HAI A;  2EZY A;  4RQ7 A;  2W9C B;  3HKZ F;  4I2B A;  1LV5 A;  5J2B A;  2W7P A;  3C2K A;  1SZH A;  4KN7 A;  4DS4 A;  5IIN A;  2R8I A;  3ORY A;  2KEY A;  2PXI A;  4UAZ A;  4DFM A;  4ECT A;  1O08 A;  5AI4 A;  4TQS A;  1OW5 A;  1U47 A;  2DKX A;  1QSS A;  2W43 A;  3G6V A;  5G5G A;  7ICV A;  3LDA A;  3JPT A;  1D8L A;  3WKC A;  4CCH A;  2BCU A;  4I2E A;  2HCF A;  2ZXH A;  5KFI A;  1BPZ A;  4QWA A;  4ELV A;  5C5J A;  5J2H A;  4DL4 A;  4C4T A;  2PI4 A;  3QUC A;  3EZ5 A;  2IHN A;  5AI9 A;  5J0Y A;  3QU4 A;  2LPE A;  5III A;  3H0L B;  1O03 A;  2WHE A;  1S0O A;  1CEZ A;  1TKD A;  3KFU F;  1QSL A;  2AXT U;  3NAS A;  3RH4 A;  2DKZ A;  4PH5 A;  1NKB A;  3PW0 A;  9ICJ A;  5C0Y A;  5TZV A;  2O6K A;  3M8R A;  2LI6 A;  2ZIU A;  3PX6 A;  3NS1 A;  3QU2 A;  4IQU A;  2LBO A;  4J9P A;  3ICX A;  2R8K A;  1L7M A;  8ICA A;  5AM3 A;  3SYZ A;  4KN4 A;  1L7P A;  4UAU A;  4A8E A;  4TUQ A;  1ZQS A;  1A76 A;  9ICL A;  2K8A A;  4TUR A;  2XID A;  2EH9 A;  1X9M A;  2C2R A;  5HR6 A;  1QQ7 A;  1UPH A;  5AHX A;  5DLF A;  1ZQK A;  3OSP A;  4QZB A;  1ZJM A;  3RJI A;  4P0P B;  5KFM A;  1Q46 A;  4BWJ A;  3MR3 A;  8ICV A;  3N7P D;  4QW8 A;  9ICV A;  2D3D A;  4IS7 A;  2FPK A;  1BVS A;  1L3U A;  2DUY A;  4QWD A;  4TUP A;  3AEV A;  4USA A;  3QU9 A;  2KE7 A;  7ICE A;  5KFR A;  4PHP A;  5KT7 A;  5AKI A;  1Z1V A;  4MF2 A; 
#chains in the Genus database with same CATH homology
 1KQQ A;  2OEH A;  5K4L A;  1C20 A;  2LI6 A;  2JRZ A;  2KK0 A;  1IG6 A;  2LM1 A;  2CXY A;  2EQY A;  2RQ5 A;  5CEH A;  1KKX A;  2YQE A;  1RYU A;  4LJX A;  1KN5 A;  2JXJ A;  2EH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...