3KZIU

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
total genus 28
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3kziU01
3A0BU 1S5LU 5E79U 3A0HU 5H2FU 3KZIU 5GTIU 5KAIU 5B5EU 4UB6U 3WU2U 4PJ0U 4IL6U 2AXTU 2DUYA 4UB8U 5TISU 5GTHU 5B66U 5KAFU
chains in the Genus database with same CATH superfamily
3ED5A 2DKXA 1FO4A 1N61A 2LYBA 3ZDEA 7ICMA 4KX3A 2DPIA 2F1HA 1MA7A 2MUTB 2ZJAA 4DCCA 5KG7A 1AROP 2AQ0A 5CJ7A 3MR3A 4ECRA 2A3VA 5DQHA 5ALQA 4HAIA 4MFCA 1ZQXA 1VLBA 3ISDA 2FPMA 3NS1A 2E8MA 5KFRA 3A0HU 1ZQEA 2ISOA 4F3OA 2KN7A 8ICCA 9ICCA 1U45A 2KSOB 5ALRA 2DF4B 4RPXA 1S0VA 2LKYA 4IL6U 3R9KA 3HJEA 3QUCA 1KFSA 2F44A 1FIQA 4ED0A 4O3MA 2FJ6A 4M6WB 3KHHA 3CP8A 1TK5A 2RP5A 4Z6CA 4RNOA 2BQ3A 2E1FA 2HHXA 2UVUA 2KJ8A 2QB0A 2YMMA 4P0QA 1SL0A 3HKZC 5HMLA 4BGDA 4DOBA 3PSFA 3K4GA 3M1YA 2HBLA 3RB4A 5KFJA 3D6JA 1XSPA 1WUDA 4M0AA 2HBJA 3ZD8A 4C8LA 1NK0A 2KIWA 1NZBA 4CF5A 1Z1BA 2N1RA 1HUOA 5EE0A 5AM2A 2Y9TA 5HMMA 1BPXA 1BPDA 4TQRA 3H8SA 4EZ9A 2ZIVB 8ICMA 1ZQQA 1NJZA 2Q4TA 4UBCA 5KTQA 1NOMA 1Z00B 1JMSA 2KOBA 4DFKA 3GFKB 1NKEA 5KFEA 8ICOA 5ALWA 5EWFA 1B4FA 1XS9D 4GXKA 1C7YA 1NK5A 2HBKA 2HHQA 1PK3A 4PZNA 3WK9A 4Q8EA 3ZDBA 4O3PA 3PR4A 3AM9A 2YTUA 1WWVA 2KZMA 3PX6A 2AU0A 2GO7A 2CXYA 2LMRA 5J8YC 3NVZA 1RYSA 4IS7A 2OCEA 7ICPA 4FBUA 2KJ5A 4I2CA 2KKVA 3TAQA 8ICSA 5AKEA 2DBYA 2JEJA 1D8LA 2W7PA 1L3SA 3B0XA 4F5NA 2GH1A 2PFPA 5J0TA 4P0QB 9ICGA 1AQ6A 2W7OA 4J9RA 5J2AA 2D3DA 4KLSA 2XCAA 3UXPA 1M6YA 5D49A 5AIAA 2ZIXA 5TZVA 3VCBA 4PZOA 3NVWA 4OD0A 1ZQKA 2ZXIA 9ICTA 1ZQZA 3EYZA 3QEBZ 4OJPA 3I28A 2D6FC 3KBBA 2KIVA 3L5KA 3GV7B 4F4WA 2FMPA 3RRGA 2G0AA 1S0MA 2WF8A 3M8SA 2ZUCA 3T5KA 3SQIA 4FO6A 2B6GA 5KFYA 4TURA 2E3TA 2VANA 2UVWA 1NK4A 3PO5A 2JHDA 3N7PD 2W9BA 8ICBA 5KT4A 5KFAA 4KLUA 1FEZA 1RQLA 5KFTA 4YVZA 2QB1A 3RBDA 1ZQJA 4TQSA 3QU5A 3C29A 1L7OA 3RTVA 3C5GA 5DB6A 3T5HA 3BS7A 3PMNA 4YR2A 1KQQA 5J0WA 2RRDA 2HBMA 1ZQHA 4ACOA 4DL4A 5KFWA 2PKEA 4P4OA 2EANA 4ZH4A 4B9LA 4UAWA 4DS5A 2HOQA 4OJOA 3D2SA 2KZ3A 3V7LA 5HP4A 2ZTCA 1XWLA 3WKEA 5AI9A 4UW9A 2PFQA 4CRXA 5AKKA 5DBAA 2Y1IA 3ORYA 4YXJA 2BZFA 3FC4A 1WWUA 5DLFA 1XSNA 3L3FX 5ALDA 2EAPA 2V4QA 5CEHA 1ZXIA 8ICQA 4Y2TA 4QZ9A 4IQVA 1NK8A 2BCRA 4Z6EA 1KFTA 4UARA 5ALZA 3ISCA 1T8EA 2WB1C 3T5JA 3ETLA 4F50A 9ICEA 1XC9A 3RJEA 4DO9A 5J2EA 1XO0A 2FMSA 2HCFA 3OTQA 3RJFA 4QZGA 1SL1A 1L3UA 4RNMA 4XUSA 2J6SA 3IV6A 1TAQA 5AK4A 3A0BU 9ICOA 2KJ9A 2LM4A 1O03A 9ICBA 5B5EU 3KFUF 2K89A 5D4BA 4YR0A 5AI8A 2JH1A 8ICPA 4KMUA 1UA1A 2H3FA 4C7ZA 1RZTA 4O5CA 4DFPA 1LB2B 5KT3A 1ZQIA 8ICRA 4MHVA 1NK6A 3T3FA 4O3SA 1DOQA 3KHLA 3SR6A 4AYBC 4M04A 3HX0A 2E1EA 2YN4A 2PXIA 3SI8A 2H3QA 5DDMA 3BS5A 1KDHA 3N97B 4EYHB 4UBBA 4J9LA 4RQ5A 4DLGA 2C28A 3V6JA 1S0NA 2EAMA 2NRWA 3GIMA 4JMUA 1QSSA 4F4ZA 2DL0A 5AM4A 3PV8A 1RG6A 4C4SA 5F9NA 3GQCA 3F5AA 3TFRA 1ZQWA 4F5PA 2PMZC 1SZPA 3TAPA 2HMXA 5KFGA 3GZFA 3KZXA 2YMQA 4K4HA 3KHGA 5ALKA 5ALUA 2G5HB 2PMZF 1KLNA 4P4MA 5HHIA 2GWSA 4C8MA 3EWAA 2AGPA 8ICZA 5ALXA 3OJUA 4UB4A 3NVYA 3PO4A 4CDGA 4CF4A 3UMCA 4GC6A 2R8IA 5HR7A 1S0OA 2YQEA 1RYRA 1S8OA 2CRXA 4F4XA 3H8JA 5TISU 2JRZA 4ECWA 5IIIA 1ZD2P 1JXEA 3C2MA 8ICXA 2KVSA 1N60A 4UB5A 3PW7A 1L7MA 4NLZA 3D2QA 8ICVA 4OO1J 1X40A 1UT5A 1MQ2A 4KLOA 2AJQA 1S10A 4X5VA 5CP2A 5KFCA 1NJXA 1A0PA 3LVVA 5IIKA 5ALGA 1F5SA 4GC7A 2F8KA 3MFHA 1ZJMA 4EBEA 7ICJA 5AI5A 5DGAA 1Z3EB 1TFRA 3BS5B 4R64A 4YN4A 4PL1A 4QJFB 3M9MB 2JEIA 1PUZA 1F0MA 1ZOLA 4FS1A 3TACB 3Q8PB 4O3QA 5KFLA 2QARA 3CYMA 3M9NB 3QU4A 2OM6A 4EZ6A 5G5GA 1Q3VA 3SAFA 2KMDA 5AKJA 7ICRA 3MGVA 2XGQA 3CW2C 5T14A 2G09A 4YQWA 3RH5A 4M9JA 5KNIA 2ISPA 4UAZA 4FE3A 4ECUA 1UT8A 1QCKA 1X6IA 2DUYA 3H7IA 2Y1JA 5KT7A 2VA2A 5KAIU 2H5XA 5AI6A 1KRPA 1L5UA 1EXNA 1SIJA 2FLNA 4KLGA 5DBCA 5EWGA 3GIIA 9ICRA 4M6WA 4MFAA 1DK2A 1X9XA 4YMOA 9ICLA 5ALOA 1PVQA 4ELUA 2V9WA 4F2SA 2RDIA 4F4KA 2DKZA 4DSEA 2NYVA 4NLGA 3IG8A 5J2DA 4O9MA 2W03A 5KFKA 1H38A 5HNKA 1D8YA 4QZBA 5ALSA 3AUOA 2PI4A 4BDPA 4ECQA 5ALEA 1WCNA 3C28A 3E2EA 1JROA 3ALRA 3WK7A 2VJ5A 2KHVA 5AM3A 4YP3A 3C2LA 1QH9A 3AMZA 4B9MA 1YZ7A 3RJGA 3UQ2A 1V97A 4DSKA 3B0YA 5AIBA 3F2CA 1NK9A 2BCQA 4BX9C 2LYHA 4IC9A 5AKGA 5DB9A 4OJ5A 1PK1B 2RDJA 1QSYA 3MGIA 1L6NA 1SWWA 2ZIVA 5KFSA 3UPQA 3ZDCA 4DFMA 4JV2A 3QZ7A 2HDOA 3RB3A 2WF5A 3LWLA 5DB8A 1TAUA 1Z00A 3C5FA 1NJYA 2L5YA 2QARB 4NLNA 4DL7A 3AN1A 5J0SA 5AKIA 1ZD3A 4FBTA 4C4RA 2F2AB 2YB1A 7ICFA 3JPOA 2KNJA 7ICIA 3UQ0A 2EDUA 1X6JA 4M47A 2XICA 1JALA 7ICLA 7ICNA 9ICNA 4M2YA 4BWJA 2R8GA 3BZKA 1ZRNA 3N4MB 5EE9A 3RB0A 2JZBA 3PZPA 1VJ5A 3QXGA 2LPEA 4G9BA 3WK8A 3QE9Y 4P0PB 3DEEA 1N56A 3KZIU 3K1RB 4YMNA 3NUQA 3J81j 5AKLA 1QQ6A 3HP6A 2JEFA 8ICHA 5KFNA 1UCVA 3NASA 1U48A 1ZQMA 4JUZA 5KG4A 2G08A 2I6XA 4EX6A 1NZPA 3T5LA 4LZGA 4ED6A 3RBEA 4RQ7A 3UXOA 3HKZF 3IHQB 4EELA 1B43A 3QEAZ 1N2XA 5AKYA 1NNLA 4EBDA 3QNMA 5EE3A 4Q45A 2W8KA 2MSNA 3HPOA 2K4PA 3SAGA 2JH7A 4PGYA 2MAXA 5AM5A 5KFPA 4QNLA 4KLHA 2A1JB 4F72A 5KFDA 4UB6U 3BQTA 2FE9A 3JPTA 2XY5A 4I2GA 5KG6A 2K60A 3H0MB 2JEGA 3TFSA 2F3NA 4QZHA 2C2DA 3AEVA 3HT3A 3GIJA 5J8YA 3GV8B 2ZIUB 5ALNA 2JXJA 2YMLA 2KK0A 2KVCA 3MFIA 2HHSA 3QYPA 1KW4A 4U6PA 4QZDA 3HILA 3SMVA 4B9TA 3V6HA 3TI0A 3RAXA 4DSJA 2YY6A 5J0OA 4PL2A 2JZBB 4RUAA 1KEJA 4BUGA 2K8BB 5KFQA 4M9GA 1SGGA 4KLJA 2P6UA 1U47A 1ZQTA 1X66A 4GXIA 2P6RA 5C0YA 3KHRA 3NRWA 9ICIA 3ZD9A 3E58A 1V9PA 5J2KA 1TAMA 1TK0A 3WK5A 5ALFA 1SKWA 4M9NA 4FFDA 3UXNA 4F5QA 1XU4A 4O3NA 4DSFA 4F4YA 5KG0A 3RR8A 3BQ1A 3KKAC 4NM2A 4Z6FA 4RQ0A 4WJ3B 3GU3A 4J9MA 1K1QA 9ICXA 2E5SA 3PMLA 3RJHA 1NJWA 2H3ZA 4K4IA 1V85A 2H3IA 2W9CB 3H4BA 4U7CA 3M6ZA 3C2KA 5ALYA 1KL9A 4NLKA 4PGXA 3TADC 2LI6A 1SV0C 1BVSA 3MR5A 2G06A 4FS2A 5ALVA 3V6KA 1UPHA 2XGPA 1QLNA 4PH5A 3PY8A 3RH6A 1HJPA 5BOMA 2R8HA 4KLIA 2ASLA 2BKEA 4JK1A 2BDUA 3RFAA 2WF9A 4P2HA 1X42A 1BPZA 1U9LA 4NY8A 2ZJ5A 3JPSA 4PHDA 3WK4A 5JTIA 3IN5A 4ELTA 4EENA 2VA3A 8ICIA 1SXDA 2ODGA 1TE2A 2XVTA 4EBCA 2KG5A 2ESEA 5AI0A 5L1MA 4O3OA 4YCXA 2IBKA 3OJSA 1ZQFA 2EH9A 1COKA 1MN8A 5EE1A 4IRDA 3I1YA 3QX7A 5KFMA 2KEYA 3IP4B 3LYSA 5KL8B 2KFZA 2W9AA 2IA6A 3ZDAA 4J03A 4B9UA 2ZUBA 2OWOA 3M6KA 1HIWA 1PVRA 5DBBA 2WB1F 1BPYA 4J9QA 2LM1A 5J0XA 5EWEA 4KX5A 3V7KA 5ALLA 4EYIB 3HW8A 1LVHA 3RJKA 1CRXA 4KLDA 4NLCA 3BDPA 1N62A 1QQ7A 5H2FU 4RUCA 4QW8A 1UQVA 3M9OB 4OCZA 1HUZA 3H0LB 1Z4NA 4RQ2A 5J0QA 1U4BA 9ICKA 5IIMA 4M9HA 4J9SA 5DG7A 2KFNA 2NRTA 4DSLA 1XO1A 1X2IA 2VKQA 4F5OA 1ZQSA 1CI4A 1NI3A 2NRXA 1ZQLA 4JWMA 2BGWA 3RF9A 4Q8FA 3Q8QB 4UASA 2OXOA 7ICHA 2O6KA 4QWEA 1B0XA 2ATLA 4YXMA 1J97A 1T4GA 5L1IA 1SKSA 4O0IA 4EX7A 4UQGA 3H4DA 2HHVA 4AYBF 5KG3A 2F8LA 5J2BA 1VDVA 4QIWC 4MFFA 3TKAA 2HHTA 3OHAA 2AQ4A 4C7YA 5KFXA 3EPIA 1KKXA 1COOA 1DRGA 3RJJA 4QIWF 4O5KA 2Y9UA 4ECSA 4GFJA 2ZTEA 1JX4A 4UAUA 2FPLA 4RPYA 5DLGA 4IQUA 4DLEA 2I9GA 2JV3A 4UB2A 3QZ8A 3FDSA 4IR9A 2M9NA 1X9MA 3RAQA 1N63A 2W04A 7ICOA 1T94A 4I2IA 3RJIA 2W43A 1K1SA 2NV3A 1ZQRA 1QQ5A 1J2MA 5L9XA 3JPPA 4NL9C 3AQEA 1V38A 2QLTA 4GXJA 2EAOA 4Y2PA 1SZHA 2IOHA 7ICQA 5AKHA 3PW4A 1ZQVA 3PW5A 4RT3A 1DXSA 2HVIA 5IINA 4LJXA 2AGQA 7ICEA 4NM1A 1L7PA 5A0LA 1YZ6A 2H3VA 2Q0ZX 3EUB2 5J0YA 3I76A 4NWIA 3UMBA 2V4RA 4XA5A 2BCUA 2D8CA 1S76D 4ECTA 1MQ3A 5G5HA 4QZIA 8ICWA 1KFDA 3NVVA 1A77A 5JUMA 5KG2A 3N7SC 3GILA 2EZYA 1PK1A 2R8JA 7ICSA 4IQWA 3NRZA 1JIHA 1WYGA 4DQQA 1ZQYA 1SXEA 4GLXA 4ECXA 3LWMA 4NJ8A 1ZQPA 2HHWA 2MA1A 1ZQBA 2PI5A 2Y0SC 4QZAA 2RHFA 1ZQAA 3IDWA 3H40A 5J2IA 4O5EA 5AK6A 4ED2A 5KL1B 3Q8SB 3KOOA 2XY6A 4A8EA 7ICVA 4UB1A 2OEHA 1LV5A 4RU9A 2Y0SF 4CNQA 3QU9A 1OXJA 5KG5A 1HEKA 1L3TA 1BPEA 4DF8A 5FP0A 3F5EA 2WFAA 2LYAA 2XC9A 3DDHA 4DL5A 5ALHA 3LDAA 2C22A 4ELVA 4DS4A 1T3NA 8ICGA 2BHNA 4P0PA 4F91B 5ALJA 4I2AA 4PGQA 5J2JA 3M8RA 1ZRMA 3OHBA 3MDAA 4QWCA 1WCLA 1T7PA 1ZQ1C 2I5HA 2F76X 5KFOA 2RQ5A 5J2GA 2XCPA 4QZCA 4IRCA 2KICA 2C2EA 2YMPA 5DKWA 4B9NA 2XO7A 4G3IA 2BQUA 4OJ6A 2AHOB 2AGOA 3O0FA 3TANA 5KFBA 8ICJA 3QU7A 1TV9A 4QW9A 2NRVA 1D9FA 3MDCA 1KTQA 2E8OA 4TUSA 4PHAA 2A1JA 3RR7A 4KLEA 4IRKA 5J0PA 1Q46A 5AM0A 2A1AA 4TUQA 1A6SA 4KLFA 5J2FA 3ICXA 4KLLA 3N7RC 1QSLA 4CF3A 2C2RA 4DL2A 3SZ2A 4KLMA 7ICTA 1IV8A 3PX0A 4CGZA 2ZIUA 4RQ6A 1RPLA 4AP9A 9ICFA 3T79A 3AU2A 2KHQA 1QTMA 3OGUA 2KP7A 9ICQA 4Q44A 5DDYA 4I27A 8ICFA 5L1JA 5GTHU 3SV3A 3JPNA 1BPBA 2HVHA 2ZJ8A 1IIPA 5L1KA 2ASJA 3QUTA 9ICHA 2XI9A 1ED1A 1D9DA 5KFVA 4JB3A 3BQ7A 3FM9A 3TQ1A 2BPFA 1SV4A 3PR5B 5BOLA 1SB3C 2XIDA 3RRHA 4I28A 1N5XA 3CNHA 4US9A 1IXRA 5ALMA 1TKDA 9ICVA 1A76A 4O3RA 3KD3A 2W54A 1RDFA 4KMOB 4UAVA 1CEZA 2IOFK 4YFKA 2MU2A 3F53A 1Y88A 3HRDD 5KAFU 4DQRA 2M0NA 5J0RA 2WF7A 2AH5A 9ICWA 2JMGA 1KN5A 5HR6A 8ICYA 4NLBA 2EQYA 3M7DA 3ISBA 4DEZA 3SEIA 4RQ4A 1D8BA 2W9CA 1LKYA 4YD2A 3GDXA 3JPRA 4I2BA 3UM9A 3SYZA 3E0FA 5KFIA 4BWMA 5GTIU 3DV9A 2WTFA 1URJA 4YD1A 4Y2UA 2R8KA 2NO5A 4B9VA 1JN3A 1FFVA 2F1IA 2BPCA 5B66U 1ZYQA 3PSPA 4I2JA 9ICAA 1O08A 2ZUDA 2BPGA 2GOLA 5DQIA 3F2DA 4J9OA 2HW3A 3TARA 4Z6DA 3ETRA 4PHPA 3WK6A 4DQSA 4USAA 2IHNA 2QKQA 4B6JA 4J9PA 2W11A 1ZQOA 3MC1A 1ECWA 2W9MA 1FFUA 5ALIA 4UB3A 3MR2A 5AKZA 2KD1A 3EPGA 4ED7A 3Q8LA 2BCSA 4I2HA 2QB0B 1ZQNA 4MF8A 3F2BA 2NO4A 4Q43A 2W8LA 3KKAA 4DL6A 1S77D 2ZTDA 5CA7A 5JRTA 2ALZA 4KN4A 1Z19A 4DQPA 5F3XB 2G07A 3LK9A 4DOAA 1T3QA 5EOZA 4Y2SA 3OSPA 2ES6A 4DQIA 2HI0A 2EZXA 5IILA 3WKBA 3QU2A 4ED3A 2ZG6A 3PSTA 2HOIA 2VIXA 4ZOHC 3TADA 3RB6A 1LKYB 4PJ0U 1SV0A 3HWTA 4RQ1A 4MEXA 1NK7A 2ZIWA 4R63A 3V72A 4QZ8A 3PW0A 3KTQA 4JV0A 4B9SA 1UHUA 3OSNA 5DQGA 1JI7A 5KT6A 3LVWA 9ICUA 1N48A 1S5LU 2J6TA 4KTQA 5CWRA 1MSWD 5DG8A 4XQ8A 4J9NA 2XY7A 4C8KA 4I2EA 3FYHA 4CCHA 5J2HA 2UVVA 2DPJA 2FMQA 3UMGA 5F9LA 1ZETA 9ICJA 5DG9A 4K4GA 3IG5A 9ICPA 3B9JA 3Q8KA 2YB4A 3G6XA 3D2NA 5KG1A 3SAHA 8ICAA 4RQ3A 4UAYA 1Q8KA 4QWAA 4R66A 4BXOA 3H0RB 4ECVA 1CUKA 1YT3A 3IRUA 3C1YA 2OH2A 4F2RA 1K5OA 2F77X 1JXLA 4KN7A 1J2NA 4YG2A 4US8A 2DFLA 2E8NA 2FLLA 1IG6A 3K75D 4R65A 4MF2A 1Z4OA 2GLEA 3AL0B 3ZDDA 4QZFA 4F5RA 2B0CA 4RQMA 2A19A 2ZIXB 1B22A 3VC8A 7ICUA 2WAQC 3MBYA 2K4HA 2BQRA 1X9WA 1ZQDA 2I1QA 1MC8A 2Z7JA 3H8MA 1S9FA 1P7DA 1JUDA 2F1JA 4PPXA 2NRZA 2WAQF 5J2CA 1DGJA 5KFFA 5IIJA 4Y2YA 2ZIWB 4RT2A 1PVPA 2BCVA 3L4PA 2W9BB 3NTUA 4FZMA 1ZQGA 2E8PA 2G5IB 1X9SA 5BPCA 1TVAA 4RQNA 3MR6A 4I2FA 3G6YA 2OYYA 2P35A 5CB1A 4C4TA 5C5JA 4F92B 4Y2JA 3S6JA 5K4LA 5L1LA 5KFHA 1IM4A 1N5WA 1RXVA 1GO3F 4CE6A 1Z1VA 3WKCA 3NGDA 3EW9A 1ZD5A 4RQ8A 1KSPA 1ZD4A 5AICA 4I29A 4M9LA 3BJYA 4FZLA 4LZDA 4F8RA 5KFUA 3SENA 4DFJA 5KFZA 4QWDA 4ICAA 1U49A 4BXOB 5AK3A 4EEYA 1S97A 3PVXA 2DQNB 4LVSA 2UVRA 5DB7A 3C1ZA 4TUPA 2KTQA 4DOCA 3AU6A 3ONNA 3GIKA 4C80A 1L3VA 3U26A 4PHEA 1NKBA 4C8NA 1BNPA 3G6VA 4Y2XA 2KE7A 4DSIA 2FDRA 4NL9A 1JRPA 4YMMA 3QUQA 4KITB 2DGZA 4RPZA 5KT2A 2B21A 1ZQCA 1C20A 4C8OA 2BR0A 2W3SA 3FAHA 1OUQA 3WKDA 4UB8U 1DK3A 2HHUA 3PX4A 4I2DA 2K8AA 2W3RA 4RNNA 4IR1A 1RYUA 3BQ0A 5DGBA 2JR5A 2IOFA 3C21A 2BDPA 2IHMA 9ICSA 3WU2U 3MGHA 3SD7A 4FZNA 4IQTA 5AKXA 4DF4A 3QUBA 1SWVA 3BQ2A 4J9KA 2PFNA 3C23A 1TK8A 3EZ5A 1OW5A 4NXZA 2K8CB 2KKPA 3AQFA 5E79U 3JPQA 4C0ZA 5CR0A 5HHHA 4P4PA 2EZZA 4ECZA 8ICLA 4XRHA 3Q8MA 5ALTA 2R18A 2HOFA 3OPXA 3IM1A 2WF6A 1F44A 1L7NA 4R8UA 4MEYA 2RLTA 1PZNA 2VJ4A 4EEKA 1RM6C 3H8WA 1KBUA 5KT5A 2LBOA 5IIOA 2JGAA 4RZRA 3RH4A 4JWNA 5CRXA 2FI1A 2MUTA 1L8OA 4DL3A 3Q8RB 4Y2QA 3K1ZA 2CN1A 1BGXT 4DFDA 1NKCA 3N28A 4NV0A 1ZJNA 4ECYA 3MABA 2OHFA 1SL2A 4QWBA 4F93B 3V7JA 3GV5B 5D46A 1L8LA 5AK5A 3THVA 5AM1A 5J29A 1Q3UA 5AHXA 2KSOA 4BJQA 2PFOA 4UATA 4JV1A 8ICNA 2AXTU 3PSIA 2J6UA 4E0DA 2YX8A 1UA0A 5JU5A 9ICMA 2DWQA 2K4EA 3PW2A 5J0UA 2HSZA 4HYKA 3PNCA 4Y2VA 2LHTA 2ZXHA 4OJLA 8ICKA 1RXWA 2IMWP 1RQNA 2FPKA 4GIBA 7ICKA 2K4IA 4ED8A 1BNOA 2W55A 4KLTA 8ICUA 1WG8A 4KLQA 3BZCA 2MRLA 4Y2RA 2KV2A 2KZZA 3ZI4A 7ICGA 2VA8A 4DWIA 4QZEA 2ASDA 1ZQUA 2WHEA 1XNSA 3CRXA 4ED1A 1SKRA 4F71A 5AI4A 3SV4A 2FLPA 8ICTA 2P66A 4R8UB 8ICEA 5ALPA 5CHGA 4YR3A 2CPRA 3WKAA 1XSLA 1DGSA
chains in the Genus database with same CATH topology
3A0BU 1S5LU 5E79U 3A0HU 5H2FU 3KZIU 5GTIU 5KAIU 5B5EU 4UB6U 3WU2U 4PJ0U 4IL6U 2AXTU 2DUYA 4UB8U 5TISU 5GTHU 5B66U 5KAFU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B U;  1S5L U;  5E79 U;  3A0H U;  5H2F U;  3KZI U;  5GTI U;  5KAI U;  5B5E U;  4UB6 U;  3WU2 U;  4PJ0 U;  4IL6 U;  2AXT U;  2DUY A;  4UB8 U;  5TIS U;  5GTH U;  5B66 U;  5KAF U; 
#chains in the Genus database with same CATH topology
 3ED5 A;  2DKX A;  1FO4 A;  1N61 A;  2LYB A;  3ZDE A;  7ICM A;  4KX3 A;  2DPI A;  2F1H A;  1MA7 A;  2MUT B;  2ZJA A;  4DCC A;  5KG7 A;  1ARO P;  2AQ0 A;  5CJ7 A;  3MR3 A;  4ECR A;  2A3V A;  5DQH A;  5ALQ A;  4HAI A;  4MFC A;  1ZQX A;  1VLB A;  3ISD A;  2FPM A;  3NS1 A;  2E8M A;  5KFR A;  3A0H U;  1ZQE A;  2ISO A;  4F3O A;  2KN7 A;  8ICC A;  9ICC A;  1U45 A;  2KSO B;  5ALR A;  2DF4 B;  4RPX A;  1S0V A;  2LKY A;  4IL6 U;  3R9K A;  3HJE A;  3QUC A;  1KFS A;  2F44 A;  1FIQ A;  4ED0 A;  4O3M A;  2FJ6 A;  4M6W B;  3KHH A;  3CP8 A;  1TK5 A;  2RP5 A;  4Z6C A;  4RNO A;  2BQ3 A;  2E1F A;  2HHX A;  2UVU A;  2KJ8 A;  2QB0 A;  2YMM A;  4P0Q A;  1SL0 A;  3HKZ C;  5HML A;  4BGD A;  4DOB A;  3PSF A;  3K4G A;  3M1Y A;  2HBL A;  3RB4 A;  5KFJ A;  3D6J A;  1XSP A;  1WUD A;  4M0A A;  2HBJ A;  3ZD8 A;  4C8L A;  1NK0 A;  2KIW A;  1NZB A;  4CF5 A;  1Z1B A;  2N1R A;  1HUO A;  5EE0 A;  5AM2 A;  2Y9T A;  5HMM A;  1BPX A;  1BPD A;  4TQR A;  3H8S A;  4EZ9 A;  2ZIV B;  8ICM A;  1ZQQ A;  1NJZ A;  2Q4T A;  4UBC A;  5KTQ A;  1NOM A;  1Z00 B;  1JMS A;  2KOB A;  4DFK A;  3GFK B;  1NKE A;  5KFE A;  8ICO A;  5ALW A;  5EWF A;  1B4F A;  1XS9 D;  4GXK A;  1C7Y A;  1NK5 A;  2HBK A;  2HHQ A;  1PK3 A;  4PZN A;  3WK9 A;  4Q8E A;  3ZDB A;  4O3P A;  3PR4 A;  3AM9 A;  2YTU A;  1WWV A;  2KZM A;  3PX6 A;  2AU0 A;  2GO7 A;  2CXY A;  2LMR A;  5J8Y C;  3NVZ A;  1RYS A;  4IS7 A;  2OCE A;  7ICP A;  4FBU A;  2KJ5 A;  4I2C A;  2KKV A;  3TAQ A;  8ICS A;  5AKE A;  2DBY A;  2JEJ A;  1D8L A;  2W7P A;  1L3S A;  3B0X A;  4F5N A;  2GH1 A;  2PFP A;  5J0T A;  4P0Q B;  9ICG A;  1AQ6 A;  2W7O A;  4J9R A;  5J2A A;  2D3D A;  4KLS A;  2XCA A;  3UXP A;  1M6Y A;  5D49 A;  5AIA A;  2ZIX A;  5TZV A;  3VCB A;  4PZO A;  3NVW A;  4OD0 A;  1ZQK A;  2ZXI A;  9ICT A;  1ZQZ A;  3EYZ A;  3QEB Z;  4OJP A;  3I28 A;  2D6F C;  3KBB A;  2KIV A;  3L5K A;  3GV7 B;  4F4W A;  2FMP A;  3RRG A;  2G0A A;  1S0M A;  2WF8 A;  3M8S A;  2ZUC A;  3T5K A;  3SQI A;  4FO6 A;  2B6G A;  5KFY A;  4TUR A;  2E3T A;  2VAN A;  2UVW A;  1NK4 A;  3PO5 A;  2JHD A;  3N7P D;  2W9B A;  8ICB A;  5KT4 A;  5KFA A;  4KLU A;  1FEZ A;  1RQL A;  5KFT A;  4YVZ A;  2QB1 A;  3RBD A;  1ZQJ A;  4TQS A;  3QU5 A;  3C29 A;  1L7O A;  3RTV A;  3C5G A;  5DB6 A;  3T5H A;  3BS7 A;  3PMN A;  4YR2 A;  1KQQ A;  5J0W A;  2RRD A;  2HBM A;  1ZQH A;  4ACO A;  4DL4 A;  5KFW A;  2PKE A;  4P4O A;  2EAN A;  4ZH4 A;  4B9L A;  4UAW A;  4DS5 A;  2HOQ A;  4OJO A;  3D2S A;  2KZ3 A;  3V7L A;  5HP4 A;  2ZTC A;  1XWL A;  3WKE A;  5AI9 A;  4UW9 A;  2PFQ A;  4CRX A;  5AKK A;  5DBA A;  2Y1I A;  3ORY A;  4YXJ A;  2BZF A;  3FC4 A;  1WWU A;  5DLF A;  1XSN A;  3L3F X;  5ALD A;  2EAP A;  2V4Q A;  5CEH A;  1ZXI A;  8ICQ A;  4Y2T A;  4QZ9 A;  4IQV A;  1NK8 A;  2BCR A;  4Z6E A;  1KFT A;  4UAR A;  5ALZ A;  3ISC A;  1T8E A;  2WB1 C;  3T5J A;  3ETL A;  4F50 A;  9ICE A;  1XC9 A;  3RJE A;  4DO9 A;  5J2E A;  1XO0 A;  2FMS A;  2HCF A;  3OTQ A;  3RJF A;  4QZG A;  1SL1 A;  1L3U A;  4RNM A;  4XUS A;  2J6S A;  3IV6 A;  1TAQ A;  5AK4 A;  3A0B U;  9ICO A;  2KJ9 A;  2LM4 A;  1O03 A;  9ICB A;  5B5E U;  3KFU F;  2K89 A;  5D4B A;  4YR0 A;  5AI8 A;  2JH1 A;  8ICP A;  4KMU A;  1UA1 A;  2H3F A;  4C7Z A;  1RZT A;  4O5C A;  4DFP A;  1LB2 B;  5KT3 A;  1ZQI A;  8ICR A;  4MHV A;  1NK6 A;  3T3F A;  4O3S A;  1DOQ A;  3KHL A;  3SR6 A;  4AYB C;  4M04 A;  3HX0 A;  2E1E A;  2YN4 A;  2PXI A;  3SI8 A;  2H3Q A;  5DDM A;  3BS5 A;  1KDH A;  3N97 B;  4EYH B;  4UBB A;  4J9L A;  4RQ5 A;  4DLG A;  2C28 A;  3V6J A;  1S0N A;  2EAM A;  2NRW A;  3GIM A;  4JMU A;  1QSS A;  4F4Z A;  2DL0 A;  5AM4 A;  3PV8 A;  1RG6 A;  4C4S A;  5F9N A;  3GQC A;  3F5A A;  3TFR A;  1ZQW A;  4F5P A;  2PMZ C;  1SZP A;  3TAP A;  2HMX A;  5KFG A;  3GZF A;  3KZX A;  2YMQ A;  4K4H A;  3KHG A;  5ALK A;  5ALU A;  2G5H B;  2PMZ F;  1KLN A;  4P4M A;  5HHI A;  2GWS A;  4C8M A;  3EWA A;  2AGP A;  8ICZ A;  5ALX A;  3OJU A;  4UB4 A;  3NVY A;  3PO4 A;  4CDG A;  4CF4 A;  3UMC A;  4GC6 A;  2R8I A;  5HR7 A;  1S0O A;  2YQE A;  1RYR A;  1S8O A;  2CRX A;  4F4X A;  3H8J A;  5TIS U;  2JRZ A;  4ECW A;  5III A;  1ZD2 P;  1JXE A;  3C2M A;  8ICX A;  2KVS A;  1N60 A;  4UB5 A;  3PW7 A;  1L7M A;  4NLZ A;  3D2Q A;  8ICV A;  4OO1 J;  1X40 A;  1UT5 A;  1MQ2 A;  4KLO A;  2AJQ A;  1S10 A;  4X5V A;  5CP2 A;  5KFC A;  1NJX A;  1A0P A;  3LVV A;  5IIK A;  5ALG A;  1F5S A;  4GC7 A;  2F8K A;  3MFH A;  1ZJM A;  4EBE A;  7ICJ A;  5AI5 A;  5DGA A;  1Z3E B;  1TFR A;  3BS5 B;  4R64 A;  4YN4 A;  4PL1 A;  4QJF B;  3M9M B;  2JEI A;  1PUZ A;  1F0M A;  1ZOL A;  4FS1 A;  3TAC B;  3Q8P B;  4O3Q A;  5KFL A;  2QAR A;  3CYM A;  3M9N B;  3QU4 A;  2OM6 A;  4EZ6 A;  5G5G A;  1Q3V A;  3SAF A;  2KMD A;  5AKJ A;  7ICR A;  3MGV A;  2XGQ A;  3CW2 C;  5T14 A;  2G09 A;  4YQW A;  3RH5 A;  4M9J A;  5KNI A;  2ISP A;  4UAZ A;  4FE3 A;  4ECU A;  1UT8 A;  1QCK A;  1X6I A;  2DUY A;  3H7I A;  2Y1J A;  5KT7 A;  2VA2 A;  5KAI U;  2H5X A;  5AI6 A;  1KRP A;  1L5U A;  1EXN A;  1SIJ A;  2FLN A;  4KLG A;  5DBC A;  5EWG A;  3GII A;  9ICR A;  4M6W A;  4MFA A;  1DK2 A;  1X9X A;  4YMO A;  9ICL A;  5ALO A;  1PVQ A;  4ELU A;  2V9W A;  4F2S A;  2RDI A;  4F4K A;  2DKZ A;  4DSE A;  2NYV A;  4NLG A;  3IG8 A;  5J2D A;  4O9M A;  2W03 A;  5KFK A;  1H38 A;  5HNK A;  1D8Y A;  4QZB A;  5ALS A;  3AUO A;  2PI4 A;  4BDP A;  4ECQ A;  5ALE A;  1WCN A;  3C28 A;  3E2E A;  1JRO A;  3ALR A;  3WK7 A;  2VJ5 A;  2KHV A;  5AM3 A;  4YP3 A;  3C2L A;  1QH9 A;  3AMZ A;  4B9M A;  1YZ7 A;  3RJG A;  3UQ2 A;  1V97 A;  4DSK A;  3B0Y A;  5AIB A;  3F2C A;  1NK9 A;  2BCQ A;  4BX9 C;  2LYH A;  4IC9 A;  5AKG A;  5DB9 A;  4OJ5 A;  1PK1 B;  2RDJ A;  1QSY A;  3MGI A;  1L6N A;  1SWW A;  2ZIV A;  5KFS A;  3UPQ A;  3ZDC A;  4DFM A;  4JV2 A;  3QZ7 A;  2HDO A;  3RB3 A;  2WF5 A;  3LWL A;  5DB8 A;  1TAU A;  1Z00 A;  3C5F A;  1NJY A;  2L5Y A;  2QAR B;  4NLN A;  4DL7 A;  3AN1 A;  5J0S A;  5AKI A;  1ZD3 A;  4FBT A;  4C4R A;  2F2A B;  2YB1 A;  7ICF A;  3JPO A;  2KNJ A;  7ICI A;  3UQ0 A;  2EDU A;  1X6J A;  4M47 A;  2XIC A;  1JAL A;  7ICL A;  7ICN A;  9ICN A;  4M2Y A;  4BWJ A;  2R8G A;  3BZK A;  1ZRN A;  3N4M B;  5EE9 A;  3RB0 A;  2JZB A;  3PZP A;  1VJ5 A;  3QXG A;  2LPE A;  4G9B A;  3WK8 A;  3QE9 Y;  4P0P B;  3DEE A;  1N56 A;  3KZI U;  3K1R B;  4YMN A;  3NUQ A;  3J81 j;  5AKL A;  1QQ6 A;  3HP6 A;  2JEF A;  8ICH A;  5KFN A;  1UCV A;  3NAS A;  1U48 A;  1ZQM A;  4JUZ A;  5KG4 A;  2G08 A;  2I6X A;  4EX6 A;  1NZP A;  3T5L A;  4LZG A;  4ED6 A;  3RBE A;  4RQ7 A;  3UXO A;  3HKZ F;  3IHQ B;  4EEL A;  1B43 A;  3QEA Z;  1N2X A;  5AKY A;  1NNL A;  4EBD A;  3QNM A;  5EE3 A;  4Q45 A;  2W8K A;  2MSN A;  3HPO A;  2K4P A;  3SAG A;  2JH7 A;  4PGY A;  2MAX A;  5AM5 A;  5KFP A;  4QNL A;  4KLH A;  2A1J B;  4F72 A;  5KFD A;  4UB6 U;  3BQT A;  2FE9 A;  3JPT A;  2XY5 A;  4I2G A;  5KG6 A;  2K60 A;  3H0M B;  2JEG A;  3TFS A;  2F3N A;  4QZH A;  2C2D A;  3AEV A;  3HT3 A;  3GIJ A;  5J8Y A;  3GV8 B;  2ZIU B;  5ALN A;  2JXJ A;  2YML A;  2KK0 A;  2KVC A;  3MFI A;  2HHS A;  3QYP A;  1KW4 A;  4U6P A;  4QZD A;  3HIL A;  3SMV A;  4B9T A;  3V6H A;  3TI0 A;  3RAX A;  4DSJ A;  2YY6 A;  5J0O A;  4PL2 A;  2JZB B;  4RUA A;  1KEJ A;  4BUG A;  2K8B B;  5KFQ A;  4M9G A;  1SGG A;  4KLJ A;  2P6U A;  1U47 A;  1ZQT A;  1X66 A;  4GXI A;  2P6R A;  5C0Y A;  3KHR A;  3NRW A;  9ICI A;  3ZD9 A;  3E58 A;  1V9P A;  5J2K A;  1TAM A;  1TK0 A;  3WK5 A;  5ALF A;  1SKW A;  4M9N A;  4FFD A;  3UXN A;  4F5Q A;  1XU4 A;  4O3N A;  4DSF A;  4F4Y A;  5KG0 A;  3RR8 A;  3BQ1 A;  3KKA C;  4NM2 A;  4Z6F A;  4RQ0 A;  4WJ3 B;  3GU3 A;  4J9M A;  1K1Q A;  9ICX A;  2E5S A;  3PML A;  3RJH A;  1NJW A;  2H3Z A;  4K4I A;  1V85 A;  2H3I A;  2W9C B;  3H4B A;  4U7C A;  3M6Z A;  3C2K A;  5ALY A;  1KL9 A;  4NLK A;  4PGX A;  3TAD C;  2LI6 A;  1SV0 C;  1BVS A;  3MR5 A;  2G06 A;  4FS2 A;  5ALV A;  3V6K A;  1UPH A;  2XGP A;  1QLN A;  4PH5 A;  3PY8 A;  3RH6 A;  1HJP A;  5BOM A;  2R8H A;  4KLI A;  2ASL A;  2BKE A;  4JK1 A;  2BDU A;  3RFA A;  2WF9 A;  4P2H A;  1X42 A;  1BPZ A;  1U9L A;  4NY8 A;  2ZJ5 A;  3JPS A;  4PHD A;  3WK4 A;  5JTI A;  3IN5 A;  4ELT A;  4EEN A;  2VA3 A;  8ICI A;  1SXD A;  2ODG A;  1TE2 A;  2XVT A;  4EBC A;  2KG5 A;  2ESE A;  5AI0 A;  5L1M A;  4O3O A;  4YCX A;  2IBK A;  3OJS A;  1ZQF A;  2EH9 A;  1COK A;  1MN8 A;  5EE1 A;  4IRD A;  3I1Y A;  3QX7 A;  5KFM A;  2KEY A;  3IP4 B;  3LYS A;  5KL8 B;  2KFZ A;  2W9A A;  2IA6 A;  3ZDA A;  4J03 A;  4B9U A;  2ZUB A;  2OWO A;  3M6K A;  1HIW A;  1PVR A;  5DBB A;  2WB1 F;  1BPY A;  4J9Q A;  2LM1 A;  5J0X A;  5EWE A;  4KX5 A;  3V7K A;  5ALL A;  4EYI B;  3HW8 A;  1LVH A;  3RJK A;  1CRX A;  4KLD A;  4NLC A;  3BDP A;  1N62 A;  1QQ7 A;  5H2F U;  4RUC A;  4QW8 A;  1UQV A;  3M9O B;  4OCZ A;  1HUZ A;  3H0L B;  1Z4N A;  4RQ2 A;  5J0Q A;  1U4B A;  9ICK A;  5IIM A;  4M9H A;  4J9S A;  5DG7 A;  2KFN A;  2NRT A;  4DSL A;  1XO1 A;  1X2I A;  2VKQ A;  4F5O A;  1ZQS A;  1CI4 A;  1NI3 A;  2NRX A;  1ZQL A;  4JWM A;  2BGW A;  3RF9 A;  4Q8F A;  3Q8Q B;  4UAS A;  2OXO A;  7ICH A;  2O6K A;  4QWE A;  1B0X A;  2ATL A;  4YXM A;  1J97 A;  1T4G A;  5L1I A;  1SKS A;  4O0I A;  4EX7 A;  4UQG A;  3H4D A;  2HHV A;  4AYB F;  5KG3 A;  2F8L A;  5J2B A;  1VDV A;  4QIW C;  4MFF A;  3TKA A;  2HHT A;  3OHA A;  2AQ4 A;  4C7Y A;  5KFX A;  3EPI A;  1KKX A;  1COO A;  1DRG A;  3RJJ A;  4QIW F;  4O5K A;  2Y9U A;  4ECS A;  4GFJ A;  2ZTE A;  1JX4 A;  4UAU A;  2FPL A;  4RPY A;  5DLG A;  4IQU A;  4DLE A;  2I9G A;  2JV3 A;  4UB2 A;  3QZ8 A;  3FDS A;  4IR9 A;  2M9N A;  1X9M A;  3RAQ A;  1N63 A;  2W04 A;  7ICO A;  1T94 A;  4I2I A;  3RJI A;  2W43 A;  1K1S A;  2NV3 A;  1ZQR A;  1QQ5 A;  1J2M A;  5L9X A;  3JPP A;  4NL9 C;  3AQE A;  1V38 A;  2QLT A;  4GXJ A;  2EAO A;  4Y2P A;  1SZH A;  2IOH A;  7ICQ A;  5AKH A;  3PW4 A;  1ZQV A;  3PW5 A;  4RT3 A;  1DXS A;  2HVI A;  5IIN A;  4LJX A;  2AGQ A;  7ICE A;  4NM1 A;  1L7P A;  5A0L A;  1YZ6 A;  2H3V A;  2Q0Z X;  3EUB 2;  5J0Y A;  3I76 A;  4NWI A;  3UMB A;  2V4R A;  4XA5 A;  2BCU A;  2D8C A;  1S76 D;  4ECT A;  1MQ3 A;  5G5H A;  4QZI A;  8ICW A;  1KFD A;  3NVV A;  1A77 A;  5JUM A;  5KG2 A;  3N7S C;  3GIL A;  2EZY A;  1PK1 A;  2R8J A;  7ICS A;  4IQW A;  3NRZ A;  1JIH A;  1WYG A;  4DQQ A;  1ZQY A;  1SXE A;  4GLX A;  4ECX A;  3LWM A;  4NJ8 A;  1ZQP A;  2HHW A;  2MA1 A;  1ZQB A;  2PI5 A;  2Y0S C;  4QZA A;  2RHF A;  1ZQA A;  3IDW A;  3H40 A;  5J2I A;  4O5E A;  5AK6 A;  4ED2 A;  5KL1 B;  3Q8S B;  3KOO A;  2XY6 A;  4A8E A;  7ICV A;  4UB1 A;  2OEH A;  1LV5 A;  4RU9 A;  2Y0S F;  4CNQ A;  3QU9 A;  1OXJ A;  5KG5 A;  1HEK A;  1L3T A;  1BPE A;  4DF8 A;  5FP0 A;  3F5E A;  2WFA A;  2LYA A;  2XC9 A;  3DDH A;  4DL5 A;  5ALH A;  3LDA A;  2C22 A;  4ELV A;  4DS4 A;  1T3N A;  8ICG A;  2BHN A;  4P0P A;  4F91 B;  5ALJ A;  4I2A A;  4PGQ A;  5J2J A;  3M8R A;  1ZRM A;  3OHB A;  3MDA A;  4QWC A;  1WCL A;  1T7P A;  1ZQ1 C;  2I5H A;  2F76 X;  5KFO A;  2RQ5 A;  5J2G A;  2XCP A;  4QZC A;  4IRC A;  2KIC A;  2C2E A;  2YMP A;  5DKW A;  4B9N A;  2XO7 A;  4G3I A;  2BQU A;  4OJ6 A;  2AHO B;  2AGO A;  3O0F A;  3TAN A;  5KFB A;  8ICJ A;  3QU7 A;  1TV9 A;  4QW9 A;  2NRV A;  1D9F A;  3MDC A;  1KTQ A;  2E8O A;  4TUS A;  4PHA A;  2A1J A;  3RR7 A;  4KLE A;  4IRK A;  5J0P A;  1Q46 A;  5AM0 A;  2A1A A;  4TUQ A;  1A6S A;  4KLF A;  5J2F A;  3ICX A;  4KLL A;  3N7R C;  1QSL A;  4CF3 A;  2C2R A;  4DL2 A;  3SZ2 A;  4KLM A;  7ICT A;  1IV8 A;  3PX0 A;  4CGZ A;  2ZIU A;  4RQ6 A;  1RPL A;  4AP9 A;  9ICF A;  3T79 A;  3AU2 A;  2KHQ A;  1QTM A;  3OGU A;  2KP7 A;  9ICQ A;  4Q44 A;  5DDY A;  4I27 A;  8ICF A;  5L1J A;  5GTH U;  3SV3 A;  3JPN A;  1BPB A;  2HVH A;  2ZJ8 A;  1IIP A;  5L1K A;  2ASJ A;  3QUT A;  9ICH A;  2XI9 A;  1ED1 A;  1D9D A;  5KFV A;  4JB3 A;  3BQ7 A;  3FM9 A;  3TQ1 A;  2BPF A;  1SV4 A;  3PR5 B;  5BOL A;  1SB3 C;  2XID A;  3RRH A;  4I28 A;  1N5X A;  3CNH A;  4US9 A;  1IXR A;  5ALM A;  1TKD A;  9ICV A;  1A76 A;  4O3R A;  3KD3 A;  2W54 A;  1RDF A;  4KMO B;  4UAV A;  1CEZ A;  2IOF K;  4YFK A;  2MU2 A;  3F53 A;  1Y88 A;  3HRD D;  5KAF U;  4DQR A;  2M0N A;  5J0R A;  2WF7 A;  2AH5 A;  9ICW A;  2JMG A;  1KN5 A;  5HR6 A;  8ICY A;  4NLB A;  2EQY A;  3M7D A;  3ISB A;  4DEZ A;  3SEI A;  4RQ4 A;  1D8B A;  2W9C A;  1LKY A;  4YD2 A;  3GDX A;  3JPR A;  4I2B A;  3UM9 A;  3SYZ A;  3E0F A;  5KFI A;  4BWM A;  5GTI U;  3DV9 A;  2WTF A;  1URJ A;  4YD1 A;  4Y2U A;  2R8K A;  2NO5 A;  4B9V A;  1JN3 A;  1FFV A;  2F1I A;  2BPC A;  5B66 U;  1ZYQ A;  3PSP A;  4I2J A;  9ICA A;  1O08 A;  2ZUD A;  2BPG A;  2GOL A;  5DQI A;  3F2D A;  4J9O A;  2HW3 A;  3TAR A;  4Z6D A;  3ETR A;  4PHP A;  3WK6 A;  4DQS A;  4USA A;  2IHN A;  2QKQ A;  4B6J A;  4J9P A;  2W11 A;  1ZQO A;  3MC1 A;  1ECW A;  2W9M A;  1FFU A;  5ALI A;  4UB3 A;  3MR2 A;  5AKZ A;  2KD1 A;  3EPG A;  4ED7 A;  3Q8L A;  2BCS A;  4I2H A;  2QB0 B;  1ZQN A;  4MF8 A;  3F2B A;  2NO4 A;  4Q43 A;  2W8L A;  3KKA A;  4DL6 A;  1S77 D;  2ZTD A;  5CA7 A;  5JRT A;  2ALZ A;  4KN4 A;  1Z19 A;  4DQP A;  5F3X B;  2G07 A;  3LK9 A;  4DOA A;  1T3Q A;  5EOZ A;  4Y2S A;  3OSP A;  2ES6 A;  4DQI A;  2HI0 A;  2EZX A;  5IIL A;  3WKB A;  3QU2 A;  4ED3 A;  2ZG6 A;  3PST A;  2HOI A;  2VIX A;  4ZOH C;  3TAD A;  3RB6 A;  1LKY B;  4PJ0 U;  1SV0 A;  3HWT A;  4RQ1 A;  4MEX A;  1NK7 A;  2ZIW A;  4R63 A;  3V72 A;  4QZ8 A;  3PW0 A;  3KTQ A;  4JV0 A;  4B9S A;  1UHU A;  3OSN A;  5DQG A;  1JI7 A;  5KT6 A;  3LVW A;  9ICU A;  1N48 A;  1S5L U;  2J6T A;  4KTQ A;  5CWR A;  1MSW D;  5DG8 A;  4XQ8 A;  4J9N A;  2XY7 A;  4C8K A;  4I2E A;  3FYH A;  4CCH A;  5J2H A;  2UVV A;  2DPJ A;  2FMQ A;  3UMG A;  5F9L A;  1ZET A;  9ICJ A;  5DG9 A;  4K4G A;  3IG5 A;  9ICP A;  3B9J A;  3Q8K A;  2YB4 A;  3G6X A;  3D2N A;  5KG1 A;  3SAH A;  8ICA A;  4RQ3 A;  4UAY A;  1Q8K A;  4QWA A;  4R66 A;  4BXO A;  3H0R B;  4ECV A;  1CUK A;  1YT3 A;  3IRU A;  3C1Y A;  2OH2 A;  4F2R A;  1K5O A;  2F77 X;  1JXL A;  4KN7 A;  1J2N A;  4YG2 A;  4US8 A;  2DFL A;  2E8N A;  2FLL A;  1IG6 A;  3K75 D;  4R65 A;  4MF2 A;  1Z4O A;  2GLE A;  3AL0 B;  3ZDD A;  4QZF A;  4F5R A;  2B0C A;  4RQM A;  2A19 A;  2ZIX B;  1B22 A;  3VC8 A;  7ICU A;  2WAQ C;  3MBY A;  2K4H A;  2BQR A;  1X9W A;  1ZQD A;  2I1Q A;  1MC8 A;  2Z7J A;  3H8M A;  1S9F A;  1P7D A;  1JUD A;  2F1J A;  4PPX A;  2NRZ A;  2WAQ F;  5J2C A;  1DGJ A;  5KFF A;  5IIJ A;  4Y2Y A;  2ZIW B;  4RT2 A;  1PVP A;  2BCV A;  3L4P A;  2W9B B;  3NTU A;  4FZM A;  1ZQG A;  2E8P A;  2G5I B;  1X9S A;  5BPC A;  1TVA A;  4RQN A;  3MR6 A;  4I2F A;  3G6Y A;  2OYY A;  2P35 A;  5CB1 A;  4C4T A;  5C5J A;  4F92 B;  4Y2J A;  3S6J A;  5K4L A;  5L1L A;  5KFH A;  1IM4 A;  1N5W A;  1RXV A;  1GO3 F;  4CE6 A;  1Z1V A;  3WKC A;  3NGD A;  3EW9 A;  1ZD5 A;  4RQ8 A;  1KSP A;  1ZD4 A;  5AIC A;  4I29 A;  4M9L A;  3BJY A;  4FZL A;  4LZD A;  4F8R A;  5KFU A;  3SEN A;  4DFJ A;  5KFZ A;  4QWD A;  4ICA A;  1U49 A;  4BXO B;  5AK3 A;  4EEY A;  1S97 A;  3PVX A;  2DQN B;  4LVS A;  2UVR A;  5DB7 A;  3C1Z A;  4TUP A;  2KTQ A;  4DOC A;  3AU6 A;  3ONN A;  3GIK A;  4C80 A;  1L3V A;  3U26 A;  4PHE A;  1NKB A;  4C8N A;  1BNP A;  3G6V A;  4Y2X A;  2KE7 A;  4DSI A;  2FDR A;  4NL9 A;  1JRP A;  4YMM A;  3QUQ A;  4KIT B;  2DGZ A;  4RPZ A;  5KT2 A;  2B21 A;  1ZQC A;  1C20 A;  4C8O A;  2BR0 A;  2W3S A;  3FAH A;  1OUQ A;  3WKD A;  4UB8 U;  1DK3 A;  2HHU A;  3PX4 A;  4I2D A;  2K8A A;  2W3R A;  4RNN A;  4IR1 A;  1RYU A;  3BQ0 A;  5DGB A;  2JR5 A;  2IOF A;  3C21 A;  2BDP A;  2IHM A;  9ICS A;  3WU2 U;  3MGH A;  3SD7 A;  4FZN A;  4IQT A;  5AKX A;  4DF4 A;  3QUB A;  1SWV A;  3BQ2 A;  4J9K A;  2PFN A;  3C23 A;  1TK8 A;  3EZ5 A;  1OW5 A;  4NXZ A;  2K8C B;  2KKP A;  3AQF A;  5E79 U;  3JPQ A;  4C0Z A;  5CR0 A;  5HHH A;  4P4P A;  2EZZ A;  4ECZ A;  8ICL A;  4XRH A;  3Q8M A;  5ALT A;  2R18 A;  2HOF A;  3OPX A;  3IM1 A;  2WF6 A;  1F44 A;  1L7N A;  4R8U A;  4MEY A;  2RLT A;  1PZN A;  2VJ4 A;  4EEK A;  1RM6 C;  3H8W A;  1KBU A;  5KT5 A;  2LBO A;  5IIO A;  2JGA A;  4RZR A;  3RH4 A;  4JWN A;  5CRX A;  2FI1 A;  2MUT A;  1L8O A;  4DL3 A;  3Q8R B;  4Y2Q A;  3K1Z A;  2CN1 A;  1BGX T;  4DFD A;  1NKC A;  3N28 A;  4NV0 A;  1ZJN A;  4ECY A;  3MAB A;  2OHF A;  1SL2 A;  4QWB A;  4F93 B;  3V7J A;  3GV5 B;  5D46 A;  1L8L A;  5AK5 A;  3THV A;  5AM1 A;  5J29 A;  1Q3U A;  5AHX A;  2KSO A;  4BJQ A;  2PFO A;  4UAT A;  4JV1 A;  8ICN A;  2AXT U;  3PSI A;  2J6U A;  4E0D A;  2YX8 A;  1UA0 A;  5JU5 A;  9ICM A;  2DWQ A;  2K4E A;  3PW2 A;  5J0U A;  2HSZ A;  4HYK A;  3PNC A;  4Y2V A;  2LHT A;  2ZXH A;  4OJL A;  8ICK A;  1RXW A;  2IMW P;  1RQN A;  2FPK A;  4GIB A;  7ICK A;  2K4I A;  4ED8 A;  1BNO A;  2W55 A;  4KLT A;  8ICU A;  1WG8 A;  4KLQ A;  3BZC A;  2MRL A;  4Y2R A;  2KV2 A;  2KZZ A;  3ZI4 A;  7ICG A;  2VA8 A;  4DWI A;  4QZE A;  2ASD A;  1ZQU A;  2WHE A;  1XNS A;  3CRX A;  4ED1 A;  1SKR A;  4F71 A;  5AI4 A;  3SV4 A;  2FLP A;  8ICT A;  2P66 A;  4R8U B;  8ICE A;  5ALP A;  5CHG A;  4YR3 A;  2CPR A;  3WKA A;  1XSL A;  1DGS A; 
#chains in the Genus database with same CATH homology
 3A0B U;  1S5L U;  5E79 U;  3A0H U;  5H2F U;  3KZI U;  5GTI U;  5KAI U;  5B5E U;  4UB6 U;  3WU2 U;  4PJ0 U;  4IL6 U;  2AXT U;  2DUY A;  4UB8 U;  5TIS U;  5GTH U;  5B66 U;  5KAF U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...