3KZIU

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
total genus 28
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3kziU01
5KAFU 4UB8U 3A0HU 5B5EU 3WU2U 5GTIU 5TISU 2DUYA 4UB6U 5KAIU 2AXTU 4IL6U 5E79U 4PJ0U 3A0BU 5H2FU 1S5LU 5B66U 3KZIU 5GTHU
chains in the Genus database with same CATH superfamily
1KRPA 2LPEA 2H5XA 2KJ5A 3IG8A 1QSSA 1TAMA 2FE9A 4Y2UA 5K4LA 4O5KA 2Y1JA 1L3VA 3PNCA 4RPYA 2JMGA 4YR3A 2KD1A 3HX0A 3OPXA 2HHUA 5AKHA 5AM5A 4O3MA 1N61A 2YMLA 4RNNA 2BGWA 1Q3UA 3GV8B 4M9JA 3RB3A 4I2DA 5AKEA 3MR2A 4FZNA 1L6NA 3GIIA 5KFUA 1IG6A 3JPTA 4QZ9A 1S0NA 2H3ZA 2CN1A 1NZBA 5AM4A 1QQ6A 2EAOA 2F77X 4RZRA 3LWLA 1SZHA 2OXOA 7ICKA 2WF6A 3V7KA 3K75D 4P0QB 1FIQA 4Y2JA 3JPQA 4DFJA 1VLBA 1S10A 8ICLA 2ZJ8A 2LBOA 4F2RA 1PZNA 2KN7A 2FDRA 3V7JA 5ALLA 5KT3A 1Z19A 2MAXA 4ED0A 1XSLA 5KL1B 4KX3A 3VC8A 1BPYA 1X9WA 2ES6A 4Y2XA 1TKDA 2I6XA 1TK5A 2HHSA 2OHFA 4DQIA 4NXZA 2GWSA 1X6JA 7ICTA 5KFXA 1H38A 1QLNA 3TI0A 1BPXA 1ZQ1C 1UPHA 5J2DA 4M2YA 5ALZA 1T7PA 5KG4A 3HT3A 2G08A 4YMOA 3V6KA 3ISBA 3H0RB 2C2RA 1PUZA 4PH5A 3SZ2A 3H8JA 2Y1IA 2BQRA 2JH1A 4F4KA 4QZCA 1O08A 1LKYB 3OGUA 3HKZC 3RB0A 4B9TA 2Y0SF 3HP6A 2K8AA 4ECRA 3AUOA 3QEAZ 2MUTB 3PSFA 2ASJA 1ZQWA 1ZJNA 1NKCA 4TUSA 4F2SA 5L1LA 2XVTA 4ED3A 1QSLA 1Z4OA 5F9NA 4Q45A 4R65A 1SKWA 4B9LA 7ICHA 8ICZA 2VANA 5DB8A 3IG5A 5BOLA 1BVSA 4UATA 1UHUA 2PFQA 3AL0B 4DS4A 2QARA 3LDAA 1FFVA 4I29A 1A76A 4NM2A 5J2HA 1FFUA 2ALZA 3RJEA 4PHDA 2J6UA 5KFRA 2HBJA 4USAA 2PI5A 2AH5A 2NRXA 5AI8A 4JV0A 4JWMA 4MF2A 3PSPA 1ZOLA 4KITB 5KFCA 2V4QA 4JWNA 3SV3A 5ALTA 1LB2B 3ONNA 2P66A 5T14A 4DQQA 2NV3A 9ICPA 2ZIWA 5J0RA 2F76X 1X9SA 1U4BA 4ECVA 4KLUA 1ZJMA 3ZDAA 1KLNA 4QZDA 3ZDEA 5EOZA 2KHVA 1TFRA 5AKJA 2HHVA 2W04A 4YD1A 2OH2A 4KLMA 4PZNA 2PI4A 4TQRA 9ICUA 2JGAA 2XY6A 3IRUA 3KHRA 4TURA 4DSLA 3BQ2A 2ZJAA 4CF4A 4ED6A 1FO4A 1Z1VA 2KZ3A 4ZOHC 4I28A 5AK4A 4IC9A 4C8MA 1LV5A 3QE9Y 2DPIA 4M9GA 3KTQA 1NJZA 5ALKA 3MDCA 2DFLA 2FI1A 1UQVA 4QW9A 3PX4A 4DSIA 3V6JA 4IQTA 7ICQA 1KTQA 5KL8B 1V38A 2R8JA 1KSPA 4AP9A 1ZRMA 4R64A 3RH4A 2C28A 2K8BB 4ELUA 1ZQIA 1SXEA 4GLXA 4B9VA 4YP3A 4Y2TA 3MBYA 2NRWA 2EDUA 1NZPA 3BS5B 4YD2A 1U48A 4O3PA 4ECZA 5KTQA 5KFYA 8ICVA 3UMGA 2M9NA 4F5PA 4KLFA 5J29A 3WK6A 2UVUA 5ALIA 9ICLA 2DBYA 4F71A 3FAHA 1NOMA 2W9BA 2D6FC 5AK3A 1UT5A 1J97A 1JIHA 2CRXA 2DKXA 2F1HA 1SL1A 7ICUA 5KFSA 2HOQA 1S0VA 1SL0A 2BR0A 1BPEA 4BJQA 3WK8A 2ATLA 2UVWA 3B9JA 3GU3A 3LVVA 4UB4A 1ZQHA 1T8EA 1XU4A 3MFHA 4F50A 2I9GA 9ICKA 5G5HA 5A0LA 2LKYA 3C5FA 4KLSA 4P4OA 1TE2A 1ZQQA 1ZQVA 3WKDA 5KFQA 4RQ4A 5DDMA 1MA7A 4DCCA 1L7PA 3NVZA 4UB3A 2EAMA 5KFNA 3BZKA 1L7MA 4YCXA 3DDHA 1XO0A 5L1KA 2HHQA 4EX6A 2LM1A 2IOHA 3ZDBA 1S76D 2XIDA 3WK5A 8ICNA 2RQ5A 2A19A 4Y2QA 3KKAC 3KKAA 9ICHA 1GO3F 4DOAA 3RR8A 2MSNA 1JXEA 3M7DA 1RXVA 5KFBA 4NV0A 3T5JA 4ZH4A 4F5NA 4KLGA 3FC4A 3IN5A 2L5YA 5D46A 5J8YC 4ECSA 5ALNA 4Z6DA 2G0AA 4US8A 4TUPA 5DB6A 2WAQC 2ZIVA 5GTIU 1ZQRA 1RYSA 1X6IA 2K4PA 4OJ5A 5J0QA 4JV1A 5IILA 2ZTEA 2R8GA 3SMVA 3GZFA 1ZQTA 1WCLA 2OYYA 2YMQA 4CGZA 3QUBA 1Y88A 4XQ8A 2KKVA 1IIPA 3QEBZ 1C7YA 2XI9A 4YG2A 1L3TA 2JEIA 2XCAA 2ZXIA 1QSYA 5JUMA 5CEHA 4EENA 1KN5A 2VA8A 5DQGA 3PW5A 4OJLA 2WF5A 4UW9A 4RQ3A 4FBUA 1X40A 9ICIA 1Z00A 2XCPA 1PK1B 1IV8A 8ICSA 1QCKA 5ALRA 3RH5A 4C4TA 3WKAA 2QB0A 1S9FA 1J2NA 4RUAA 3Q8MA 1HIWA 5J0XA 2HI0A 2CXYA 4J9NA 1N48A 3SAFA 2H3FA 2O6KA 4NLBA 2P6RA 2ZIXA 3IP4B 2ZUBA 3LYSA 4XA5A 3T79A 3M9NB 2VIXA 2K4EA 1SKSA 5ALDA 4Z6CA 4NLZA 4C8OA 1KKXA 3ALRA 4B6JA 4O0IA 4FFDA 1ZQJA 9ICCA 4NM1A 5CP2A 4QZGA 9ICJA 2G07A 1D8BA 4PGYA 4CF5A 1VJ5A 4F3OA 4CF3A 5ALXA 2VKQA 3LWMA 3NS1A 4RU9A 2RLTA 4PPXA 3KBBA 3TADC 1MN8A 3C23A 4IRCA 1K1QA 5KFOA 2KP7A 3MR6A 4UBBA 5F3XB 5AM3A 3F2BA 5DGBA 4G3IA 3V72A 1NJWA 3TFSA 5CWRA 2HVIA 4UAVA 2R8HA 8ICRA 8ICUA 4QWDA 2J6TA 2ZIWB 1PVQA 1ZD4A 2NO4A 1BNPA 1A6SA 5B66U 3PW0A 3PW4A 3CW2C 5CB1A 2OM6A 3N7SC 1Q46A 2FPLA 1EXNA 2JV3A 4NLCA 1YZ7A 3NVWA 1ZQLA 2BCSA 1S0OA 1QQ5A 4RQMA 1ZQMA 5HR6A 2F44A 4KLHA 3MGHA 4FZMA 3PV8A 3QNMA 4OO1J 3RRGA 4O3OA 5JTIA 4I2JA 4YMNA 7ICSA 2ZTDA 3KFUF 3RH6A 4GXKA 5DQIA 1XS9D 5J0SA 1HUZA 2BCRA 2H3VA 4P4PA 4YR0A 2ZTCA 5J2EA 9ICXA 2XO7A 4PHEA 2B6GA 4AYBC 2EANA 2HBLA 1KFSA 3U26A 5ALWA 2YMPA 4K4HA 1TAQA 1D9FA 5KFAA 4M04A 3NGDA 4KTQA 3WU2U 3Q8KA 1UA1A 2VA3A 3PSIA 5J2JA 4EYIB 2YB4A 2HCFA 2K8CB 2PMZC 1ED1A 4M9LA 4O5EA 4IR9A 3GILA 4BGDA 1NI3A 2R18A 3AN1A 5CR0A 5C5JA 1TK8A 2W9BB 5EWFA 4MEXA 1KQQA 1ZD5A 1NK6A 3WK9A 4B9MA 4QZBA 3I1YA 2J6SA 3RJHA 2WFAA 5IIJA 2EZXA 2NO5A 4IL6U 3A0BU 4C7ZA 8ICIA 4YVZA 7ICEA 1FEZA 1L8OA 2JRZA 4DO9A 3CP8A 2HHXA 4YQWA 2PFPA 5AKZA 2F8KA 3GDXA 9ICVA 3GV7B 4ED7A 8ICHA 1ZQBA 4I2FA 3ED5A 5C0YA 3UQ0A 3JPRA 2RDJA 3K1RB 5EWGA 1QQ7A 2WB1F 4OJOA 5AI4A 3RB4A 4R63A 7ICRA 3JPOA 4DFMA 8ICOA 2C2DA 5HMMA 5KFTA 3NRWA 4PL1A 4U7CA 4UAYA 4UARA 1Q8KA 4EEKA 3V7LA 4QNLA 3PSTA 2DL0A 3RFAA 5ALYA 4C4RA 4F4WA 1N56A 4QIWF 4DLGA 4IRDA 4FS1A 1HUOA 3CNHA 5DQHA 2W43A 3SQIA 1V97A 5CRXA 2E1EA 5DG8A 2AGQA 4J9LA 4JB3A 2N1RA 2WTFA 3M9OB 4X5VA 1NJXA 1ZD3A 3BJYA 4PHPA 5CJ7A 3KHGA 4NL9C 4RQNA 2KK0A 4UB2A 3H4DA 4MF8A 2BCVA 2ZIVB 3OHAA 1CI4A 7ICIA 1SB3C 2KE7A 2KFNA 1MQ3A 3L4PA 3FM9A 4ECXA 3QXGA 5L9XA 1SL2A 4ICAA 2GLEA 5IIKA 2IHMA 1P7DA 3BZCA 5J2CA 3OJSA 4B9NA 3PX6A 7ICLA 2AGPA 5BPCA 1ZETA 3RTVA 2MA1A 2BCQA 4PZOA 1V85A 4F4XA 2W3RA 1HJPA 4RQ8A 2OCEA 4DSKA 1L7OA 3F2DA 2DWQA 2JH7A 5AHXA 1U45A 4YN4A 3RF9A 4I2EA 3QU2A 1T4GA 3D6JA 5J0UA 4UAZA 5DDYA 1RPLA 4C8NA 4M9HA 2KIVA 2DUYA 5AI9A 1SWWA 3RAQA 8ICKA 3MC1A 2W9CA 2PMZF 9ICSA 5EE9A 4ACOA 3ZD8A 1U49A 1Q3VA 2LHTA 3ZDDA 3MFIA 1DOQA 1RYUA 4Z6EA 1PVPA 3QUTA 2DKZA 2RDIA 4OJ6A 4DQPA 1RQLA 4YMMA 1ZQZA 4DFPA 4I2HA 2HSZA 4DL3A 3CYMA 3S6JA 3Q8QB 4NLKA 1WWVA 4C7YA 5GTHU 3PMLA 5DBAA 1ZQKA 4B9SA 1KDHA 1B0XA 5IIMA 3TKAA 3C1YA 3JPNA 3PZPA 1OW5A 5AK5A 1D9DA 2A3VA 3B0XA 3H8SA 1NK9A 2DGZA 1SGGA 3Q8RB 9ICEA 3ICXA 3SEIA 1IXRA 4KLEA 3L5KA 1S8OA 5AKKA 2E1FA 1PVRA 1RZTA 2Q4TA 5KNIA 1ZRNA 2C2EA 1D8LA 5DKWA 3PO5A 5DG9A 4Q8FA 4F8RA 4GC6A 4DL7A 3OJUA 1RYRA 1ZQGA 1F44A 3KOOA 4J9PA 2WF8A 4K4IA 4DOBA 2R8KA 1A0PA 2A1AA 5KG0A 2K60A 3B0YA 3E0FA 1S5LU 4OCZA 2W7OA 1B22A 4TQSA 3D2SA 3CRXA 5KFJA 5EE0A 1SWVA 2KZZA 1NKEA 2QB1A 1DK3A 3MDAA 3ETLA 4R8UA 1DXSA 1ZQSA 2G5HB 4E0DA 2HHWA 2KG5A 3WK7A 5L1JA 5ALGA 2ZXHA 5DB9A 2FLLA 4GFJA 2FJ6A 1UCVA 1WWUA 4DL5A 3HKZF 2FPMA 1UA0A 2F2AB 3ZI4A 2NRVA 2W7PA 3BQTA 5KAFU 4ED2A 4J9SA 1CUKA 2NRZA 5DG7A 4QWBA 4XUSA 5CA7A 9ICOA 1BPZA 5KG1A 3BQ7A 3UPQA 4I2IA 4Y2SA 4BXOA 4LVSA 4QWEA 3JPPA 2G09A 2GO7A 3T5HA 1KL9A 3NASA 9ICMA 1MC8A 3GIJA 2DPJA 5KG5A 3QYPA 5AKGA 1WCNA 1KFTA 2AQ0A 3PW7A 2WF7A 3R9KA 2LYAA 9ICFA 2D3DA 3UM9A 2E8NA 5DBCA 2BZFA 4F5QA 5J2IA 4BWMA 2BKEA 3QU7A 4P0QA 4C8LA 3SAHA 4C80A 1LVHA 3N4MB 4ECQA 3RJJA 4Y2RA 5D49A 3FDSA 3TARA 3DV9A 1NK8A 5AIBA 5B5EU 2EH9A 4RNMA 5AK6A 5IIIA 4R66A 1XSPA 3I76A 3SENA 1SV4A 4MEYA 1BPBA 2KNJA 5ALMA 4KLJA 3Q8PB 4ECWA 1VDVA 3SV4A 5DLGA 4DWIA 2IOFA 3QUCA 4TUQA 1JUDA 5J8YA 5ALOA 3C1ZA 4IR1A 5HMLA 4Q44A 3NRZA 3DEEA 1C20A 2ASDA 3GFKB 4PGXA 2LM4A 9ICGA 3WKEA 4M0AA 2F1IA 3SR6A 1XWLA 8ICPA 4DF4A 2JZBA 4DFDA 1RXWA 3F5AA 5HHIA 4IQWA 4CNQA 5AI5A 3UXOA 2KKPA 4MFAA 4Q43A 2MUTA 1JRPA 3F2CA 3IM1A 1JXLA 4DQRA 3D2QA 1S0MA 5KT5A 2AGOA 1MSWD 3RR7A 4F93B 4UB5A 1AQ6A 4O3QA 2Z7JA 3NTUA 1S97A 2HOIA 2DQNB 1N63A 1RDFA 1WG8A 3V6HA 2XICA 4O5CA 4P0PA 3M6ZA 3AQEA 1XNSA 4O9MA 4DSJA 1NK7A 4F91B 3RBEA 2QARB 2M0NA 5F9LA 3H8MA 3NUQA 1NJYA 3EPIA 4MFCA 3TADA 3G6YA 2XY7A 3TFRA 8ICCA 2LYBA 8ICXA 2JHDA 3AMZA 3Q8SB 4CE6A 2D8CA 4KLOA 2F1JA 1ZQUA 5L1IA 2W9MA 5AKYA 5HR7A 3M8SA 5TISU 1DGJA 2HBKA 2XGPA 3ETRA 3BQ1A 3E58A 3PO4A 4B9UA 3FYHA 4LZDA 1B43A 4EEYA 4DL6A 4M47A 1K1SA 4DS5A 4KN7A 2I5HA 3H40A 4RT3A 3EYZA 3K4GA 4QJFB 5L1MA 5KFKA 4UQGA 4M9NA 8ICEA 3AQFA 1ZQOA 5J2GA 2CPRA 3T5LA 2PFNA 2K89A 4U6PA 1S77D 3QUQA 4CDGA 5KAIU 3ISDA 2PKEA 9ICRA 1OXJA 2P6UA 3N97B 4EBCA 3QZ8A 1RG6A 7ICVA 4F92B 3HJEA 2E3TA 1CRXA 2W8LA 5ALJA 1XC9A 3F53A 3SI8A 3M9MB 5ALEA 3D2NA 2ZUCA 3C5GA 4BDPA 3MABA 2WAQF 2Y9TA 2AXTU 2W11A 2E8OA 4FBTA 1U9LA 3TACB 4NWIA 1AROP 4GXJA 4OD0A 3THVA 1SKRA 2VA2A 1SV0C 3BS7A 1V9PA 1ECWA 3BQ0A 5JU5A 4RUCA 3VCBA 2KICA 2W3SA 2F8LA 2HHTA 4KLIA 3QU4A 4RT2A 1Z4NA 1WYGA 4PHAA 5HHHA 4R8UB 1SXDA 4M6WA 1ZQYA 1TAUA 2I1QA 2RP5A 5J0OA 2KVCA 3HRDD 2ODGA 5KFMA 1CEZA 2KOBA 7ICJA 1T3QA 2H3IA 2R8IA 4DLEA 2Q0ZX 4O3SA 1NK4A 3C21A 4MFFA 3RJIA 4US9A 2V4RA 4IS7A 2B0CA 8ICTA 4NJ8A 1X2IA 4JMUA 4HYKA 1TK0A 4BXOB 3HPOA 2KSOA 1ZQAA 1DK2A 4PL2A 3WKCA 2QLTA 1JROA 5ALQA 3C29A 7ICFA 9ICTA 3G6XA 5AM0A 3PR5B 2BQ3A 3RJKA 2JEJA 3QU5A 4UAUA 1T3NA 3TQ1A 5KG3A 4RQ5A 4K4GA 7ICMA 3RJFA 3GV5B 2KFZA 4F4ZA 4UAWA 4I2CA 1T94A 2K4IA 5ALFA 5J0PA 3IDWA 3G6VA 2W9AA 2C22A 3HW8A 4ELVA 3O0FA 3EW9A 1J2MA 1N5XA 4QWCA 3Q8LA 5AI6A 1BNOA 2ISPA 2UVRA 2FPKA 4QZFA 3OSNA 5KFGA 3UMBA 2BDUA 2BPFA 4O3NA 5KT2A 3N28A 1RM6C 4EZ9A 3GIKA 4ELTA 3OSPA 4LJXA 1O03A 2LMRA 3GIMA 2JR5A 4DL2A 8ICFA 4NL9A 3AU6A 5EE1A 3TAQA 1F0MA 1URJA 1KW4A 3EPGA 3SD7A 5KT7A 2LI6A 4C4SA 1PK1A 1ZQPA 2JZBB 2HMXA 2K4HA 4RPXA 4GC7A 2A1JA 2MU2A 2KTQA 4Z6FA 5J0WA 4BWJA 2KJ8A 1ZQDA 4NLNA 4AYBF 5EWEA 1Z00B 3NVYA 1QH9A 4DQSA 1U47A 3H0MB 2MRLA 2QB0B 4P4MA 2H3QA 3N7RC 2ISOA 9ICQA 1JI7A 4CRXA 4KMUA 2ZIXB 2IBKA 4I2AA 7ICNA 5IINA 1L3SA 2GOLA 1A77A 9ICWA 2VJ4A 1Z1BA 1N5WA 4J9OA 4F4YA 2UVVA 4KX5A 4P0PB 3C28A 2DF4B 5AKLA 2RHFA 3A0HU 4DEZA 4RQ2A 3GQCA 1TVAA 2XC9A 1X66A 5KT6A 1ZQFA 2ESEA 1XO1A 4DSFA 2EZZA 2HOFA 1BPDA 2PXIA 4FO6A 4GXIA 2HDOA 4I27A 4Y2VA 4IQVA 4A8EA 1BGXT 2BPCA 4UB8U 3MR3A 4ECTA 1JX4A 2FMQA 4QWAA 3IV6A 3TAPA 4KLQA 2B21A 2ASLA 4FS2A 8ICQA 2F3NA 1TV9A 3AU2A 8ICBA 2W55A 3H0LB 3RJGA 5AM2A 5H2FU 5JRTA 4NY8A 5DB7A 4UBCA 1B4FA 2LYHA 4YR2A 4ECYA 5KG2A 5KFHA 3ZD9A 1ZQNA 3TANA 4QZEA 4QZHA 4JUZA 4UB6U 4KN4A 8ICGA 3C2KA 2KVSA 4PJ0U 1YZ6A 2XGQA 2P35A 4DSEA 3KZIU 2IA6A 1SZPA 4C8KA 3LVWA 2HVHA 2ZIUA 4QW8A 5D4BA 5KG6A 1L7NA 3BDPA 4CCHA 3UXPA 4RQ7A 3KHHA 2BDPA 2WHEA 3UMCA 4EELA 4Y2PA 3OHBA 3F5EA 5J2FA 1KFDA 2E5SA 5KFZA 4EX7A 3HILA 1IM4A 5TZVA 4GIBA 4LZGA 1COOA 5G5GA 4IQUA 3UXNA 2G06A 4JK1A 3LK9A 4RQ6A 1X9MA 3AM9A 1N60A 3EWAA 2FLNA 4M6WB 1N62A 3NVVA 4RQ1A 2FLPA 1N2XA 3RRHA 5FP0A 3KHLA 4RQ0A 4F5OA 3KD3A 3SAGA 2JEFA 4DF8A 3PY8A 3E2EA 4KMOB 4MHVA 2KZMA 1NNLA 1X9XA 4HAIA 2YN4A 2KSOB 3OTQA 3ZDCA 7ICOA 1UT8A 5J0YA 2KEYA 5AIAA 5CHGA 2KMDA 1KEJA 2FMSA 2YB1A 1NK5A 2AQ4A 1ZQCA 2BPGA 1MQ2A 4RNOA 2WF9A 1XSNA 2YQEA 2OEHA 4KLDA 1RQNA 4EYHB 3PMNA 1QTMA 5HNKA 2KIWA 1JMSA 3H7IA 2NRTA 3RB6A 1L3UA 2NYVA 5E79U 3PVXA 4QZ8A 5DGAA 2YTUA 5ALPA 4J03A 3KZXA 4G9BA 1F5SA 2HBMA 2YX8A 4BX9C 1LKYA 2XY5A 4I2BA 1M6YA 5J2BA 5ALUA 5KFLA 5AI0A 5KFWA 2E8PA 2OWOA 3T3FA 1ZQXA 3WK4A 4Q8EA 3I28A 2KJ9A 2GH1A 8ICYA 2ZJ5A 5AM1A 4QZAA 4ED8A 4P2HA 5KFDA 2V9WA 1DRGA 4EBEA 4J9MA 3UQ2A 2BQUA 3RAXA 1OUQA 5BOMA 5KT4A 4O3RA 5DLFA 2KHQA 2BHNA 3MGVA 5KFIA 4KLTA 5ALHA 1NK0A 2YMMA 4BUGA 2A1JB 3RBDA 3EZ5A 1X42A 3JPSA 3QU9A 4C0ZA 4WJ3B 3SYZA 1L5UA 2W03A 4NLGA 4UASA 3WKBA 4J9RA 1COKA 1JN3A 3QX7A 4J9QA 3ISCA 1PK3A 3C2MA 4OJPA 1YT3A 1HEKA 1KBUA 4J9KA 2JEGA 3IHQB 5DBBA 1DGSA 2W8KA 1ZYQA 8ICWA 4DFKA 4KLLA 9ICBA 2W9CB 3ORYA 2RRDA 1ZQEA 5KFVA 2WB1C 1NKBA 3PX0A 3MR5A 4ECUA 3EUB2 3QZ7A 2VJ5A 4UB1A 2YY6A 2E8MA 4DOCA 4QZIA 1ZD2P 1JALA 4YXJA 3T5KA 5IIOA 5J2AA 3M1YA 5AICA 5KFEA 1ZXIA 4ED1A 4XRHA 2G5IB 4F72A 7ICGA 9ICNA 3AEVA 2Y9UA 3M6KA 2W54A 2BCUA 3PW2A 3MGIA 4IRKA 3PR4A 4YXMA 2JXJA 4QIWC 3N7PD 5KFFA 3J81j 2QKQA 5ALVA 5AKIA 4F5RA 8ICJA 3H4BA 2EZYA 8ICMA 4JV2A 3HWTA 3L3FX 2IOFK 4PGQA 1Z3EB 5J0TA 2IMWP 5EE3A 2Y0SC 9ICAA 2AHOB 4EZ6A 4Y2YA 2EQYA 3C2LA 4YFKA 4DL4A 4I2GA 2ZUDA 5KG7A 8ICAA 2HW3A 1SIJA 2ZG6A 2EAPA 3BS5A 5AKXA 3K1ZA 5HP4A 4EBDA 1SV0A 2AJQA 2ZIUB 1D8YA 5J2KA 7ICPA 1K5OA 4FZLA 2AU0A 1L8LA 2IHNA 4RPZA 2KV2A 5ALSA 2FMPA 1WUDA 5KFPA 3M8RA 3H8WA 2PFOA 4FE3A
chains in the Genus database with same CATH topology
5KAFU 4UB8U 3A0HU 5B5EU 3WU2U 5GTIU 5TISU 2DUYA 4UB6U 5KAIU 2AXTU 4IL6U 5E79U 4PJ0U 3A0BU 5H2FU 1S5LU 5B66U 3KZIU 5GTHU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF U;  4UB8 U;  3A0H U;  5B5E U;  3WU2 U;  5GTI U;  5TIS U;  2DUY A;  4UB6 U;  5KAI U;  2AXT U;  4IL6 U;  5E79 U;  4PJ0 U;  3A0B U;  5H2F U;  1S5L U;  5B66 U;  3KZI U;  5GTH U; 
#chains in the Genus database with same CATH topology
 1KRP A;  2LPE A;  2H5X A;  2KJ5 A;  3IG8 A;  1QSS A;  1TAM A;  2FE9 A;  4Y2U A;  5K4L A;  4O5K A;  2Y1J A;  1L3V A;  3PNC A;  4RPY A;  2JMG A;  4YR3 A;  2KD1 A;  3HX0 A;  3OPX A;  2HHU A;  5AKH A;  5AM5 A;  4O3M A;  1N61 A;  2YML A;  4RNN A;  2BGW A;  1Q3U A;  3GV8 B;  4M9J A;  3RB3 A;  4I2D A;  5AKE A;  3MR2 A;  4FZN A;  1L6N A;  3GII A;  5KFU A;  1IG6 A;  3JPT A;  4QZ9 A;  1S0N A;  2H3Z A;  2CN1 A;  1NZB A;  5AM4 A;  1QQ6 A;  2EAO A;  2F77 X;  4RZR A;  3LWL A;  1SZH A;  2OXO A;  7ICK A;  2WF6 A;  3V7K A;  3K75 D;  4P0Q B;  1FIQ A;  4Y2J A;  3JPQ A;  4DFJ A;  1VLB A;  1S10 A;  8ICL A;  2ZJ8 A;  2LBO A;  4F2R A;  1PZN A;  2KN7 A;  2FDR A;  3V7J A;  5ALL A;  5KT3 A;  1Z19 A;  2MAX A;  4ED0 A;  1XSL A;  5KL1 B;  4KX3 A;  3VC8 A;  1BPY A;  1X9W A;  2ES6 A;  4Y2X A;  1TKD A;  2I6X A;  1TK5 A;  2HHS A;  2OHF A;  4DQI A;  4NXZ A;  2GWS A;  1X6J A;  7ICT A;  5KFX A;  1H38 A;  1QLN A;  3TI0 A;  1BPX A;  1ZQ1 C;  1UPH A;  5J2D A;  4M2Y A;  5ALZ A;  1T7P A;  5KG4 A;  3HT3 A;  2G08 A;  4YMO A;  3V6K A;  3ISB A;  3H0R B;  2C2R A;  1PUZ A;  4PH5 A;  3SZ2 A;  3H8J A;  2Y1I A;  2BQR A;  2JH1 A;  4F4K A;  4QZC A;  1O08 A;  1LKY B;  3OGU A;  3HKZ C;  3RB0 A;  4B9T A;  2Y0S F;  3HP6 A;  2K8A A;  4ECR A;  3AUO A;  3QEA Z;  2MUT B;  3PSF A;  2ASJ A;  1ZQW A;  1ZJN A;  1NKC A;  4TUS A;  4F2S A;  5L1L A;  2XVT A;  4ED3 A;  1QSL A;  1Z4O A;  5F9N A;  4Q45 A;  4R65 A;  1SKW A;  4B9L A;  7ICH A;  8ICZ A;  2VAN A;  5DB8 A;  3IG5 A;  5BOL A;  1BVS A;  4UAT A;  1UHU A;  2PFQ A;  3AL0 B;  4DS4 A;  2QAR A;  3LDA A;  1FFV A;  4I29 A;  1A76 A;  4NM2 A;  5J2H A;  1FFU A;  2ALZ A;  3RJE A;  4PHD A;  2J6U A;  5KFR A;  2HBJ A;  4USA A;  2PI5 A;  2AH5 A;  2NRX A;  5AI8 A;  4JV0 A;  4JWM A;  4MF2 A;  3PSP A;  1ZOL A;  4KIT B;  5KFC A;  2V4Q A;  4JWN A;  3SV3 A;  5ALT A;  1LB2 B;  3ONN A;  2P66 A;  5T14 A;  4DQQ A;  2NV3 A;  9ICP A;  2ZIW A;  5J0R A;  2F76 X;  1X9S A;  1U4B A;  4ECV A;  4KLU A;  1ZJM A;  3ZDA A;  1KLN A;  4QZD A;  3ZDE A;  5EOZ A;  2KHV A;  1TFR A;  5AKJ A;  2HHV A;  2W04 A;  4YD1 A;  2OH2 A;  4KLM A;  4PZN A;  2PI4 A;  4TQR A;  9ICU A;  2JGA A;  2XY6 A;  3IRU A;  3KHR A;  4TUR A;  4DSL A;  3BQ2 A;  2ZJA A;  4CF4 A;  4ED6 A;  1FO4 A;  1Z1V A;  2KZ3 A;  4ZOH C;  4I28 A;  5AK4 A;  4IC9 A;  4C8M A;  1LV5 A;  3QE9 Y;  2DPI A;  4M9G A;  3KTQ A;  1NJZ A;  5ALK A;  3MDC A;  2DFL A;  2FI1 A;  1UQV A;  4QW9 A;  3PX4 A;  4DSI A;  3V6J A;  4IQT A;  7ICQ A;  1KTQ A;  5KL8 B;  1V38 A;  2R8J A;  1KSP A;  4AP9 A;  1ZRM A;  4R64 A;  3RH4 A;  2C28 A;  2K8B B;  4ELU A;  1ZQI A;  1SXE A;  4GLX A;  4B9V A;  4YP3 A;  4Y2T A;  3MBY A;  2NRW A;  2EDU A;  1NZP A;  3BS5 B;  4YD2 A;  1U48 A;  4O3P A;  4ECZ A;  5KTQ A;  5KFY A;  8ICV A;  3UMG A;  2M9N A;  4F5P A;  4KLF A;  5J29 A;  3WK6 A;  2UVU A;  5ALI A;  9ICL A;  2DBY A;  4F71 A;  3FAH A;  1NOM A;  2W9B A;  2D6F C;  5AK3 A;  1UT5 A;  1J97 A;  1JIH A;  2CRX A;  2DKX A;  2F1H A;  1SL1 A;  7ICU A;  5KFS A;  2HOQ A;  1S0V A;  1SL0 A;  2BR0 A;  1BPE A;  4BJQ A;  3WK8 A;  2ATL A;  2UVW A;  3B9J A;  3GU3 A;  3LVV A;  4UB4 A;  1ZQH A;  1T8E A;  1XU4 A;  3MFH A;  4F50 A;  2I9G A;  9ICK A;  5G5H A;  5A0L A;  2LKY A;  3C5F A;  4KLS A;  4P4O A;  1TE2 A;  1ZQQ A;  1ZQV A;  3WKD A;  5KFQ A;  4RQ4 A;  5DDM A;  1MA7 A;  4DCC A;  1L7P A;  3NVZ A;  4UB3 A;  2EAM A;  5KFN A;  3BZK A;  1L7M A;  4YCX A;  3DDH A;  1XO0 A;  5L1K A;  2HHQ A;  4EX6 A;  2LM1 A;  2IOH A;  3ZDB A;  1S76 D;  2XID A;  3WK5 A;  8ICN A;  2RQ5 A;  2A19 A;  4Y2Q A;  3KKA C;  3KKA A;  9ICH A;  1GO3 F;  4DOA A;  3RR8 A;  2MSN A;  1JXE A;  3M7D A;  1RXV A;  5KFB A;  4NV0 A;  3T5J A;  4ZH4 A;  4F5N A;  4KLG A;  3FC4 A;  3IN5 A;  2L5Y A;  5D46 A;  5J8Y C;  4ECS A;  5ALN A;  4Z6D A;  2G0A A;  4US8 A;  4TUP A;  5DB6 A;  2WAQ C;  2ZIV A;  5GTI U;  1ZQR A;  1RYS A;  1X6I A;  2K4P A;  4OJ5 A;  5J0Q A;  4JV1 A;  5IIL A;  2ZTE A;  2R8G A;  3SMV A;  3GZF A;  1ZQT A;  1WCL A;  2OYY A;  2YMQ A;  4CGZ A;  3QUB A;  1Y88 A;  4XQ8 A;  2KKV A;  1IIP A;  3QEB Z;  1C7Y A;  2XI9 A;  4YG2 A;  1L3T A;  2JEI A;  2XCA A;  2ZXI A;  1QSY A;  5JUM A;  5CEH A;  4EEN A;  1KN5 A;  2VA8 A;  5DQG A;  3PW5 A;  4OJL A;  2WF5 A;  4UW9 A;  4RQ3 A;  4FBU A;  1X40 A;  9ICI A;  1Z00 A;  2XCP A;  1PK1 B;  1IV8 A;  8ICS A;  1QCK A;  5ALR A;  3RH5 A;  4C4T A;  3WKA A;  2QB0 A;  1S9F A;  1J2N A;  4RUA A;  3Q8M A;  1HIW A;  5J0X A;  2HI0 A;  2CXY A;  4J9N A;  1N48 A;  3SAF A;  2H3F A;  2O6K A;  4NLB A;  2P6R A;  2ZIX A;  3IP4 B;  2ZUB A;  3LYS A;  4XA5 A;  3T79 A;  3M9N B;  2VIX A;  2K4E A;  1SKS A;  5ALD A;  4Z6C A;  4NLZ A;  4C8O A;  1KKX A;  3ALR A;  4B6J A;  4O0I A;  4FFD A;  1ZQJ A;  9ICC A;  4NM1 A;  5CP2 A;  4QZG A;  9ICJ A;  2G07 A;  1D8B A;  4PGY A;  4CF5 A;  1VJ5 A;  4F3O A;  4CF3 A;  5ALX A;  2VKQ A;  3LWM A;  3NS1 A;  4RU9 A;  2RLT A;  4PPX A;  3KBB A;  3TAD C;  1MN8 A;  3C23 A;  4IRC A;  1K1Q A;  5KFO A;  2KP7 A;  3MR6 A;  4UBB A;  5F3X B;  5AM3 A;  3F2B A;  5DGB A;  4G3I A;  3V72 A;  1NJW A;  3TFS A;  5CWR A;  2HVI A;  4UAV A;  2R8H A;  8ICR A;  8ICU A;  4QWD A;  2J6T A;  2ZIW B;  1PVQ A;  1ZD4 A;  2NO4 A;  1BNP A;  1A6S A;  5B66 U;  3PW0 A;  3PW4 A;  3CW2 C;  5CB1 A;  2OM6 A;  3N7S C;  1Q46 A;  2FPL A;  1EXN A;  2JV3 A;  4NLC A;  1YZ7 A;  3NVW A;  1ZQL A;  2BCS A;  1S0O A;  1QQ5 A;  4RQM A;  1ZQM A;  5HR6 A;  2F44 A;  4KLH A;  3MGH A;  4FZM A;  3PV8 A;  3QNM A;  4OO1 J;  3RRG A;  4O3O A;  5JTI A;  4I2J A;  4YMN A;  7ICS A;  2ZTD A;  3KFU F;  3RH6 A;  4GXK A;  5DQI A;  1XS9 D;  5J0S A;  1HUZ A;  2BCR A;  2H3V A;  4P4P A;  4YR0 A;  2ZTC A;  5J2E A;  9ICX A;  2XO7 A;  4PHE A;  2B6G A;  4AYB C;  2EAN A;  2HBL A;  1KFS A;  3U26 A;  5ALW A;  2YMP A;  4K4H A;  1TAQ A;  1D9F A;  5KFA A;  4M04 A;  3NGD A;  4KTQ A;  3WU2 U;  3Q8K A;  1UA1 A;  2VA3 A;  3PSI A;  5J2J A;  4EYI B;  2YB4 A;  2HCF A;  2K8C B;  2PMZ C;  1ED1 A;  4M9L A;  4O5E A;  4IR9 A;  3GIL A;  4BGD A;  1NI3 A;  2R18 A;  3AN1 A;  5CR0 A;  5C5J A;  1TK8 A;  2W9B B;  5EWF A;  4MEX A;  1KQQ A;  1ZD5 A;  1NK6 A;  3WK9 A;  4B9M A;  4QZB A;  3I1Y A;  2J6S A;  3RJH A;  2WFA A;  5IIJ A;  2EZX A;  2NO5 A;  4IL6 U;  3A0B U;  4C7Z A;  8ICI A;  4YVZ A;  7ICE A;  1FEZ A;  1L8O A;  2JRZ A;  4DO9 A;  3CP8 A;  2HHX A;  4YQW A;  2PFP A;  5AKZ A;  2F8K A;  3GDX A;  9ICV A;  3GV7 B;  4ED7 A;  8ICH A;  1ZQB A;  4I2F A;  3ED5 A;  5C0Y A;  3UQ0 A;  3JPR A;  2RDJ A;  3K1R B;  5EWG A;  1QQ7 A;  2WB1 F;  4OJO A;  5AI4 A;  3RB4 A;  4R63 A;  7ICR A;  3JPO A;  4DFM A;  8ICO A;  2C2D A;  5HMM A;  5KFT A;  3NRW A;  4PL1 A;  4U7C A;  4UAY A;  4UAR A;  1Q8K A;  4EEK A;  3V7L A;  4QNL A;  3PST A;  2DL0 A;  3RFA A;  5ALY A;  4C4R A;  4F4W A;  1N56 A;  4QIW F;  4DLG A;  4IRD A;  4FS1 A;  1HUO A;  3CNH A;  5DQH A;  2W43 A;  3SQI A;  1V97 A;  5CRX A;  2E1E A;  5DG8 A;  2AGQ A;  4J9L A;  4JB3 A;  2N1R A;  2WTF A;  3M9O B;  4X5V A;  1NJX A;  1ZD3 A;  3BJY A;  4PHP A;  5CJ7 A;  3KHG A;  4NL9 C;  4RQN A;  2KK0 A;  4UB2 A;  3H4D A;  4MF8 A;  2BCV A;  2ZIV B;  3OHA A;  1CI4 A;  7ICI A;  1SB3 C;  2KE7 A;  2KFN A;  1MQ3 A;  3L4P A;  3FM9 A;  4ECX A;  3QXG A;  5L9X A;  1SL2 A;  4ICA A;  2GLE A;  5IIK A;  2IHM A;  1P7D A;  3BZC A;  5J2C A;  3OJS A;  4B9N A;  3PX6 A;  7ICL A;  2AGP A;  5BPC A;  1ZET A;  3RTV A;  2MA1 A;  2BCQ A;  4PZO A;  1V85 A;  4F4X A;  2W3R A;  1HJP A;  4RQ8 A;  2OCE A;  4DSK A;  1L7O A;  3F2D A;  2DWQ A;  2JH7 A;  5AHX A;  1U45 A;  4YN4 A;  3RF9 A;  4I2E A;  3QU2 A;  1T4G A;  3D6J A;  5J0U A;  4UAZ A;  5DDY A;  1RPL A;  4C8N A;  4M9H A;  2KIV A;  2DUY A;  5AI9 A;  1SWW A;  3RAQ A;  8ICK A;  3MC1 A;  2W9C A;  2PMZ F;  9ICS A;  5EE9 A;  4ACO A;  3ZD8 A;  1U49 A;  1Q3V A;  2LHT A;  3ZDD A;  3MFI A;  1DOQ A;  1RYU A;  4Z6E A;  1PVP A;  3QUT A;  2DKZ A;  2RDI A;  4OJ6 A;  4DQP A;  1RQL A;  4YMM A;  1ZQZ A;  4DFP A;  4I2H A;  2HSZ A;  4DL3 A;  3CYM A;  3S6J A;  3Q8Q B;  4NLK A;  1WWV A;  4C7Y A;  5GTH U;  3PML A;  5DBA A;  1ZQK A;  4B9S A;  1KDH A;  1B0X A;  5IIM A;  3TKA A;  3C1Y A;  3JPN A;  3PZP A;  1OW5 A;  5AK5 A;  1D9D A;  2A3V A;  3B0X A;  3H8S A;  1NK9 A;  2DGZ A;  1SGG A;  3Q8R B;  9ICE A;  3ICX A;  3SEI A;  1IXR A;  4KLE A;  3L5K A;  1S8O A;  5AKK A;  2E1F A;  1PVR A;  1RZT A;  2Q4T A;  5KNI A;  1ZRN A;  2C2E A;  1D8L A;  5DKW A;  3PO5 A;  5DG9 A;  4Q8F A;  4F8R A;  4GC6 A;  4DL7 A;  3OJU A;  1RYR A;  1ZQG A;  1F44 A;  3KOO A;  4J9P A;  2WF8 A;  4K4I A;  4DOB A;  2R8K A;  1A0P A;  2A1A A;  5KG0 A;  2K60 A;  3B0Y A;  3E0F A;  1S5L U;  4OCZ A;  2W7O A;  1B22 A;  4TQS A;  3D2S A;  3CRX A;  5KFJ A;  5EE0 A;  1SWV A;  2KZZ A;  1NKE A;  2QB1 A;  1DK3 A;  3MDA A;  3ETL A;  4R8U A;  1DXS A;  1ZQS A;  2G5H B;  4E0D A;  2HHW A;  2KG5 A;  3WK7 A;  5L1J A;  5ALG A;  2ZXH A;  5DB9 A;  2FLL A;  4GFJ A;  2FJ6 A;  1UCV A;  1WWU A;  4DL5 A;  3HKZ F;  2FPM A;  1UA0 A;  2F2A B;  3ZI4 A;  2NRV A;  2W7P A;  3BQT A;  5KAF U;  4ED2 A;  4J9S A;  1CUK A;  2NRZ A;  5DG7 A;  4QWB A;  4XUS A;  5CA7 A;  9ICO A;  1BPZ A;  5KG1 A;  3BQ7 A;  3UPQ A;  4I2I A;  4Y2S A;  4BXO A;  4LVS A;  4QWE A;  3JPP A;  2G09 A;  2GO7 A;  3T5H A;  1KL9 A;  3NAS A;  9ICM A;  1MC8 A;  3GIJ A;  2DPJ A;  5KG5 A;  3QYP A;  5AKG A;  1WCN A;  1KFT A;  2AQ0 A;  3PW7 A;  2WF7 A;  3R9K A;  2LYA A;  9ICF A;  2D3D A;  3UM9 A;  2E8N A;  5DBC A;  2BZF A;  4F5Q A;  5J2I A;  4BWM A;  2BKE A;  3QU7 A;  4P0Q A;  4C8L A;  3SAH A;  4C80 A;  1LVH A;  3N4M B;  4ECQ A;  3RJJ A;  4Y2R A;  5D49 A;  3FDS A;  3TAR A;  3DV9 A;  1NK8 A;  5AIB A;  5B5E U;  2EH9 A;  4RNM A;  5AK6 A;  5III A;  4R66 A;  1XSP A;  3I76 A;  3SEN A;  1SV4 A;  4MEY A;  1BPB A;  2KNJ A;  5ALM A;  4KLJ A;  3Q8P B;  4ECW A;  1VDV A;  3SV4 A;  5DLG A;  4DWI A;  2IOF A;  3QUC A;  4TUQ A;  1JUD A;  5J8Y A;  5ALO A;  3C1Z A;  4IR1 A;  5HML A;  4Q44 A;  3NRZ A;  3DEE A;  1C20 A;  2ASD A;  3GFK B;  4PGX A;  2LM4 A;  9ICG A;  3WKE A;  4M0A A;  2F1I A;  3SR6 A;  1XWL A;  8ICP A;  4DF4 A;  2JZB A;  4DFD A;  1RXW A;  3F5A A;  5HHI A;  4IQW A;  4CNQ A;  5AI5 A;  3UXO A;  2KKP A;  4MFA A;  4Q43 A;  2MUT A;  1JRP A;  3F2C A;  3IM1 A;  1JXL A;  4DQR A;  3D2Q A;  1S0M A;  5KT5 A;  2AGO A;  1MSW D;  3RR7 A;  4F93 B;  4UB5 A;  1AQ6 A;  4O3Q A;  2Z7J A;  3NTU A;  1S97 A;  2HOI A;  2DQN B;  1N63 A;  1RDF A;  1WG8 A;  3V6H A;  2XIC A;  4O5C A;  4P0P A;  3M6Z A;  3AQE A;  1XNS A;  4O9M A;  4DSJ A;  1NK7 A;  4F91 B;  3RBE A;  2QAR B;  2M0N A;  5F9L A;  3H8M A;  3NUQ A;  1NJY A;  3EPI A;  4MFC A;  3TAD A;  3G6Y A;  2XY7 A;  3TFR A;  8ICC A;  2LYB A;  8ICX A;  2JHD A;  3AMZ A;  3Q8S B;  4CE6 A;  2D8C A;  4KLO A;  2F1J A;  1ZQU A;  5L1I A;  2W9M A;  5AKY A;  5HR7 A;  3M8S A;  5TIS U;  1DGJ A;  2HBK A;  2XGP A;  3ETR A;  3BQ1 A;  3E58 A;  3PO4 A;  4B9U A;  3FYH A;  4LZD A;  1B43 A;  4EEY A;  4DL6 A;  4M47 A;  1K1S A;  4DS5 A;  4KN7 A;  2I5H A;  3H40 A;  4RT3 A;  3EYZ A;  3K4G A;  4QJF B;  5L1M A;  5KFK A;  4UQG A;  4M9N A;  8ICE A;  3AQF A;  1ZQO A;  5J2G A;  2CPR A;  3T5L A;  2PFN A;  2K89 A;  4U6P A;  1S77 D;  3QUQ A;  4CDG A;  5KAI U;  3ISD A;  2PKE A;  9ICR A;  1OXJ A;  2P6U A;  3N97 B;  4EBC A;  3QZ8 A;  1RG6 A;  7ICV A;  4F92 B;  3HJE A;  2E3T A;  1CRX A;  2W8L A;  5ALJ A;  1XC9 A;  3F53 A;  3SI8 A;  3M9M B;  5ALE A;  3D2N A;  2ZUC A;  3C5G A;  4BDP A;  3MAB A;  2WAQ F;  2Y9T A;  2AXT U;  2W11 A;  2E8O A;  4FBT A;  1U9L A;  3TAC B;  4NWI A;  1ARO P;  4GXJ A;  4OD0 A;  3THV A;  1SKR A;  2VA2 A;  1SV0 C;  3BS7 A;  1V9P A;  1ECW A;  3BQ0 A;  5JU5 A;  4RUC A;  3VCB A;  2KIC A;  2W3S A;  2F8L A;  2HHT A;  4KLI A;  3QU4 A;  4RT2 A;  1Z4N A;  1WYG A;  4PHA A;  5HHH A;  4R8U B;  1SXD A;  4M6W A;  1ZQY A;  1TAU A;  2I1Q A;  2RP5 A;  5J0O A;  2KVC A;  3HRD D;  2ODG A;  5KFM A;  1CEZ A;  2KOB A;  7ICJ A;  1T3Q A;  2H3I A;  2R8I A;  4DLE A;  2Q0Z X;  4O3S A;  1NK4 A;  3C21 A;  4MFF A;  3RJI A;  4US9 A;  2V4R A;  4IS7 A;  2B0C A;  8ICT A;  4NJ8 A;  1X2I A;  4JMU A;  4HYK A;  1TK0 A;  4BXO B;  3HPO A;  2KSO A;  1ZQA A;  1DK2 A;  4PL2 A;  3WKC A;  2QLT A;  1JRO A;  5ALQ A;  3C29 A;  7ICF A;  9ICT A;  3G6X A;  5AM0 A;  3PR5 B;  2BQ3 A;  3RJK A;  2JEJ A;  3QU5 A;  4UAU A;  1T3N A;  3TQ1 A;  5KG3 A;  4RQ5 A;  4K4G A;  7ICM A;  3RJF A;  3GV5 B;  2KFZ A;  4F4Z A;  4UAW A;  4I2C A;  1T94 A;  2K4I A;  5ALF A;  5J0P A;  3IDW A;  3G6V A;  2W9A A;  2C22 A;  3HW8 A;  4ELV A;  3O0F A;  3EW9 A;  1J2M A;  1N5X A;  4QWC A;  3Q8L A;  5AI6 A;  1BNO A;  2ISP A;  2UVR A;  2FPK A;  4QZF A;  3OSN A;  5KFG A;  3UMB A;  2BDU A;  2BPF A;  4O3N A;  5KT2 A;  3N28 A;  1RM6 C;  4EZ9 A;  3GIK A;  4ELT A;  3OSP A;  4LJX A;  1O03 A;  2LMR A;  3GIM A;  2JR5 A;  4DL2 A;  8ICF A;  4NL9 A;  3AU6 A;  5EE1 A;  3TAQ A;  1F0M A;  1URJ A;  1KW4 A;  3EPG A;  3SD7 A;  5KT7 A;  2LI6 A;  4C4S A;  1PK1 A;  1ZQP A;  2JZB B;  2HMX A;  2K4H A;  4RPX A;  4GC7 A;  2A1J A;  2MU2 A;  2KTQ A;  4Z6F A;  5J0W A;  4BWJ A;  2KJ8 A;  1ZQD A;  4NLN A;  4AYB F;  5EWE A;  1Z00 B;  3NVY A;  1QH9 A;  4DQS A;  1U47 A;  3H0M B;  2MRL A;  2QB0 B;  4P4M A;  2H3Q A;  3N7R C;  2ISO A;  9ICQ A;  1JI7 A;  4CRX A;  4KMU A;  2ZIX B;  2IBK A;  4I2A A;  7ICN A;  5IIN A;  1L3S A;  2GOL A;  1A77 A;  9ICW A;  2VJ4 A;  1Z1B A;  1N5W A;  4J9O A;  4F4Y A;  2UVV A;  4KX5 A;  4P0P B;  3C28 A;  2DF4 B;  5AKL A;  2RHF A;  3A0H U;  4DEZ A;  4RQ2 A;  3GQC A;  1TVA A;  2XC9 A;  1X66 A;  5KT6 A;  1ZQF A;  2ESE A;  1XO1 A;  4DSF A;  2EZZ A;  2HOF A;  1BPD A;  2PXI A;  4FO6 A;  4GXI A;  2HDO A;  4I27 A;  4Y2V A;  4IQV A;  4A8E A;  1BGX T;  2BPC A;  4UB8 U;  3MR3 A;  4ECT A;  1JX4 A;  2FMQ A;  4QWA A;  3IV6 A;  3TAP A;  4KLQ A;  2B21 A;  2ASL A;  4FS2 A;  8ICQ A;  2F3N A;  1TV9 A;  3AU2 A;  8ICB A;  2W55 A;  3H0L B;  3RJG A;  5AM2 A;  5H2F U;  5JRT A;  4NY8 A;  5DB7 A;  4UBC A;  1B4F A;  2LYH A;  4YR2 A;  4ECY A;  5KG2 A;  5KFH A;  3ZD9 A;  1ZQN A;  3TAN A;  4QZE A;  4QZH A;  4JUZ A;  4UB6 U;  4KN4 A;  8ICG A;  3C2K A;  2KVS A;  4PJ0 U;  1YZ6 A;  2XGQ A;  2P35 A;  4DSE A;  3KZI U;  2IA6 A;  1SZP A;  4C8K A;  3LVW A;  2HVH A;  2ZIU A;  4QW8 A;  5D4B A;  5KG6 A;  1L7N A;  3BDP A;  4CCH A;  3UXP A;  4RQ7 A;  3KHH A;  2BDP A;  2WHE A;  3UMC A;  4EEL A;  4Y2P A;  3OHB A;  3F5E A;  5J2F A;  1KFD A;  2E5S A;  5KFZ A;  4EX7 A;  3HIL A;  1IM4 A;  5TZV A;  4GIB A;  4LZG A;  1COO A;  5G5G A;  4IQU A;  3UXN A;  2G06 A;  4JK1 A;  3LK9 A;  4RQ6 A;  1X9M A;  3AM9 A;  1N60 A;  3EWA A;  2FLN A;  4M6W B;  1N62 A;  3NVV A;  4RQ1 A;  2FLP A;  1N2X A;  3RRH A;  5FP0 A;  3KHL A;  4RQ0 A;  4F5O A;  3KD3 A;  3SAG A;  2JEF A;  4DF8 A;  3PY8 A;  3E2E A;  4KMO B;  4MHV A;  2KZM A;  1NNL A;  1X9X A;  4HAI A;  2YN4 A;  2KSO B;  3OTQ A;  3ZDC A;  7ICO A;  1UT8 A;  5J0Y A;  2KEY A;  5AIA A;  5CHG A;  2KMD A;  1KEJ A;  2FMS A;  2YB1 A;  1NK5 A;  2AQ4 A;  1ZQC A;  2BPG A;  1MQ2 A;  4RNO A;  2WF9 A;  1XSN A;  2YQE A;  2OEH A;  4KLD A;  1RQN A;  4EYH B;  3PMN A;  1QTM A;  5HNK A;  2KIW A;  1JMS A;  3H7I A;  2NRT A;  3RB6 A;  1L3U A;  2NYV A;  5E79 U;  3PVX A;  4QZ8 A;  5DGA A;  2YTU A;  5ALP A;  4J03 A;  3KZX A;  4G9B A;  1F5S A;  2HBM A;  2YX8 A;  4BX9 C;  1LKY A;  2XY5 A;  4I2B A;  1M6Y A;  5J2B A;  5ALU A;  5KFL A;  5AI0 A;  5KFW A;  2E8P A;  2OWO A;  3T3F A;  1ZQX A;  3WK4 A;  4Q8E A;  3I28 A;  2KJ9 A;  2GH1 A;  8ICY A;  2ZJ5 A;  5AM1 A;  4QZA A;  4ED8 A;  4P2H A;  5KFD A;  2V9W A;  1DRG A;  4EBE A;  4J9M A;  3UQ2 A;  2BQU A;  3RAX A;  1OUQ A;  5BOM A;  5KT4 A;  4O3R A;  5DLF A;  2KHQ A;  2BHN A;  3MGV A;  5KFI A;  4KLT A;  5ALH A;  1NK0 A;  2YMM A;  4BUG A;  2A1J B;  3RBD A;  3EZ5 A;  1X42 A;  3JPS A;  3QU9 A;  4C0Z A;  4WJ3 B;  3SYZ A;  1L5U A;  2W03 A;  4NLG A;  4UAS A;  3WKB A;  4J9R A;  1COK A;  1JN3 A;  3QX7 A;  4J9Q A;  3ISC A;  1PK3 A;  3C2M A;  4OJP A;  1YT3 A;  1HEK A;  1KBU A;  4J9K A;  2JEG A;  3IHQ B;  5DBB A;  1DGS A;  2W8K A;  1ZYQ A;  8ICW A;  4DFK A;  4KLL A;  9ICB A;  2W9C B;  3ORY A;  2RRD A;  1ZQE A;  5KFV A;  2WB1 C;  1NKB A;  3PX0 A;  3MR5 A;  4ECU A;  3EUB 2;  3QZ7 A;  2VJ5 A;  4UB1 A;  2YY6 A;  2E8M A;  4DOC A;  4QZI A;  1ZD2 P;  1JAL A;  4YXJ A;  3T5K A;  5IIO A;  5J2A A;  3M1Y A;  5AIC A;  5KFE A;  1ZXI A;  4ED1 A;  4XRH A;  2G5I B;  4F72 A;  7ICG A;  9ICN A;  3AEV A;  2Y9U A;  3M6K A;  2W54 A;  2BCU A;  3PW2 A;  3MGI A;  4IRK A;  3PR4 A;  4YXM A;  2JXJ A;  4QIW C;  3N7P D;  5KFF A;  3J81 j;  2QKQ A;  5ALV A;  5AKI A;  4F5R A;  8ICJ A;  3H4B A;  2EZY A;  8ICM A;  4JV2 A;  3HWT A;  3L3F X;  2IOF K;  4PGQ A;  1Z3E B;  5J0T A;  2IMW P;  5EE3 A;  2Y0S C;  9ICA A;  2AHO B;  4EZ6 A;  4Y2Y A;  2EQY A;  3C2L A;  4YFK A;  4DL4 A;  4I2G A;  2ZUD A;  5KG7 A;  8ICA A;  2HW3 A;  1SIJ A;  2ZG6 A;  2EAP A;  3BS5 A;  5AKX A;  3K1Z A;  5HP4 A;  4EBD A;  1SV0 A;  2AJQ A;  2ZIU B;  1D8Y A;  5J2K A;  7ICP A;  1K5O A;  4FZL A;  2AU0 A;  1L8L A;  2IHN A;  4RPZ A;  2KV2 A;  5ALS A;  2FMP A;  1WUD A;  5KFP A;  3M8R A;  3H8W A;  2PFO A;  4FE3 A; 
#chains in the Genus database with same CATH homology
 5KAF U;  4UB8 U;  3A0H U;  5B5E U;  3WU2 U;  5GTI U;  5TIS U;  2DUY A;  4UB6 U;  5KAI U;  2AXT U;  4IL6 U;  5E79 U;  4PJ0 U;  3A0B U;  5H2F U;  1S5L U;  5B66 U;  3KZI U;  5GTH U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...