3KZIU

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
molecule tags Electron transport
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
total genus 28
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3kziU01
4PJ0U 3A0BU 3KZIU 2DUYA 4UB8U 5GTIU 5KAFU 4UB6U 1S5LU 5B66U 3A0HU 5GTHU 4IL6U 2AXTU 5H2FU 5KAIU 5TISU 5B5EU 5E79U 3WU2U
chains in the Genus database with same CATH superfamily
1JIHA 2IOFA 1FO4A 4YVZA 4DFKA 1X6IA 1ZRNA 1FFVA 2LBOA 3S6JA 3EUB2 3KKAA 4IQUA 4RU9A 5ALOA 4YR3A 8ICEA 2LPEA 1S8OA 5ALJA 2A1AA 4EX6A 3NVZA 3C2LA 4UAUA 3QYPA 5IINA 4BXOB 4DQIA 4P0PB 2BCQA 4KN7A 3GV7B 3MR6A 2OCEA 2FI1A 2FMSA 5J0QA 2W43A 5JRTA 5KFMA 1SB3C 5DB7A 2QLTA 2HBKA 1OW5A 4JV1A 4DFPA 2ZTDA 2EDUA 1A6SA 2EZXA 4Z6EA 1NI3A 4JV2A 3V7KA 2KSOA 2HHWA 3RH5A 5HNKA 4UBBA 1NJZA 3LYSA 4Q8EA 3HKZC 4I29A 5EE1A 3C23A 3T5KA 2W7OA 4DQRA 1ZQLA 1JXEA 1N60A 8ICVA 5G5GA 9ICSA 2KFZA 4E0DA 8ICFA 1L7MA 3D6JA 3RAXA 7ICFA 1A0PA 1Z19A 1SWVA 4FZLA 4M9NA 3UXNA 2E8MA 5ALUA 2V9WA 5KFHA 3ICXA 2FLLA 3OJSA 2W54A 4NLCA 1XS9D 1NK5A 2VKQA 5EWFA 3ORYA 4KLLA 4QZ8A 2KKVA 5ALKA 4QWEA 2LMRA 1NK6A 4DSEA 5JTIA 3C1ZA 3NRZA 4F2RA 4Y2QA 3K75D 3MR3A 2HI0A 1PVRA 2OYYA 5A0LA 2W9AA 3PSPA 3AEVA 3UQ0A 1WYGA 2F76X 5J2AA 3FDSA 4K4HA 4WJ3B 5DQGA 1ZQEA 2W9BB 4ED2A 2DBYA 3V72A 4BJQA 7ICHA 1XO1A 3K1ZA 5AK6A 4C7YA 3WKDA 5DLGA 3PX4A 2BCUA 1TAUA 5ALHA 3ZDEA 5BOLA 1NK9A 5EOZA 1SL1A 1EXNA 4Y2TA 3RB6A 5CP2A 1KFTA 2BCRA 5AKZA 4QW8A 4RUCA 1ZJMA 3WK4A 2JRZA 2K60A 4YCXA 3IN5A 4F5OA 9ICMA 2EH9A 1BVSA 2QB0B 3H7IA 4RQ5A 3WK8A 1ZYQA 1U47A 4NLZA 2OM6A 5KFVA 2KICA 3IP4B 4QJFB 1P7DA 2NYVA 5T14A 1T3NA 1ZQYA 3QU4A 4KLHA 3BQ2A 2W8LA 1SKRA 1JALA 2BPFA 2H3FA 4KLDA 3FYHA 2FPLA 8ICNA 3C28A 3MFHA 1BNPA 5KFZA 2NRVA 2EAPA 2HHSA 3V6HA 1L3SA 3RJKA 2KVSA 1QSLA 1UA0A 1TVAA 5KG0A 2W9CA 1SL0A 2DPIA 5GTIU 2WF9A 2C28A 1C20A 2KJ9A 2KSOB 4DL5A 2AGQA 5AIAA 5AK4A 2HDOA 1QCKA 4QWDA 3NUQA 1TE2A 3BZKA 4US8A 2JHDA 3PW5A 3TFRA 4OJOA 3PV8A 2H3ZA 4Y2UA 4KTQA 4YXJA 4CF4A 1L5UA 4UARA 2FMPA 3WK6A 2RQ5A 5HP4A 5KFOA 2P66A 5H2FU 2MUTA 3BQTA 3JPSA 1M6YA 5AI6A 4DS5A 7ICMA 1LV5A 4BGDA 4O0IA 2LM4A 9ICRA 5J8YC 2W3RA 4J03A 1NKCA 3QU9A 3ZDAA 3HJEA 4C8NA 4PGQA 3C5GA 3OSNA 1XU4A 2KIWA 2WAQC 3WK7A 1IIPA 3M1YA 5HR6A 1FIQA 7ICSA 2YQEA 3LWLA 3CNHA 1WWUA 1L7PA 4GFJA 4F3OA 1KL9A 4EEKA 4NLGA 3N7RC 4C4TA 3SZ2A 2KP7A 5EE0A 3C21A 3AU2A 5KTQA 5CRXA 4M9JA 3HKZF 5KFDA 4RQNA 3MBYA 3RJGA 4AYBC 4RQ0A 3E0FA 4JWNA 2HBMA 9ICWA 2ASJA 2WF6A 1NK0A 5KG5A 2VA8A 3PZPA 2KV2A 3QEAZ 4ZH4A 8ICXA 1ZQRA 7ICNA 2AQ4A 2NRXA 3CW2C 4O3SA 2F1IA 3WK9A 2R8KA 3NRWA 1ZQAA 4DL6A 4KLTA 4TUQA 3EYZA 1WG8A 5G5HA 3T5HA 3V7LA 4C8KA 1K5OA 2YB4A 3QUBA 7ICLA 1IV8A 1U9LA 5AM4A 2XICA 7ICEA 2O6KA 3H0LB 3DDHA 1MA7A 5CB1A 4DOCA 9ICPA 4C7ZA 3QU7A 1UA1A 4F50A 3OJUA 4TUSA 3PW2A 5IIOA 4X5VA 2Q0ZX 1RM6C 2HOIA 4IRKA 4Y2RA 1ZQMA 3HWTA 3UM9A 4F4WA 1CUKA 5KFTA 2AQ0A 2DL0A 2FPMA 5J29A 1NNLA 3MFIA 4RPZA 2BQRA 8ICLA 2P35A 4MF2A 4ZOHC 5EWGA 1SXEA 1NKBA 4QIWC 4DOBA 2VIXA 3T5LA 1BPBA 2F8LA 3RB3A 2WAQF 2AGOA 1N63A 4B6JA 5J2CA 2HCFA 3L5KA 4QZHA 3C1YA 4CF5A 1Z1BA 3N97B 3A0HU 5K4LA 4UB8U 4J9MA 3EPGA 3HX0A 5J0XA 4QW9A 5AKEA 2DKZA 4EENA 4YG2A 5DQHA 1TAQA 2HHQA 1DXSA 5AKYA 1SWWA 2BKEA 4DL2A 4KMUA 3WKCA 4BWMA 1N61A 1AROP 1KSPA 5ALMA 3ZDDA 1MQ2A 3HRDD 5ALVA 5J2EA 5J2HA 1PZNA 5ALNA 9ICTA 2RDJA 5B66U 3H0MB 3M8SA 4F5QA 4MEYA 4RT3A 5DBCA 4ED7A 5J2IA 5AM3A 4I2DA 2K8AA 3RH6A 2PFPA 3RH4A 1KEJA 4B9SA 2IOFK 1QQ7A 8ICOA 4YMNA 4ACOA 2ODGA 4UBCA 5KFPA 3ZI4A 2OH2A 3QU5A 2JXJA 2OEHA 3OHAA 1VDVA 4FE3A 1ZQNA 4JMUA 4J9PA 5FP0A 3HPOA 4KLUA 1D8LA 5ALFA 3M9NB 8ICKA 4F2SA 2W04A 1ZQDA 2D3DA 3GIJA 1ZQCA 2YMLA 3H8SA 5IIIA 2QARB 4UAWA 2RDIA 4Q45A 4YD1A 2G08A 2KJ8A 5ALGA 4RQMA 4OD0A 3AU6A 2KKPA 3QE9Y 2LI6A 3GU3A 2GOLA 4IC9A 1A76A 3IG8A 4M0AA 2W3SA 2DF4B 4I2GA 2F8KA 3SD7A 4I28A 4QZBA 4G3IA 2K4IA 3NVWA 5J0TA 4Y2PA 4O3QA 5J8YA 5D49A 2KVCA 2I9GA 1L6NA 1BPDA 3RRHA 2I6XA 3UQ2A 5ALWA 4IRDA 4ECQA 1URJA 2IHMA 1ZOLA 2XY7A 3LWMA 3RJJA 1BNOA 4ECSA 8ICUA 4QZCA 1J2NA 4J9KA 2IA6A 3F2CA 2A1JB 4NXZA 2W9CB 4Q8FA 3AM9A 1DOQA 2W03A 4IR9A 4KLOA 1RZTA 1ZQPA 4P0QA 3H8WA 2ZIVB 2UVVA 1TK0A 3F53A 3BZCA 3KHRA 4MEXA 3ETLA 3F2DA 4CCHA 4DSKA 1S0OA 5C5JA 5KT5A 2HHUA 4C8OA 1X9XA 4EBCA 2EAMA 2G09A 5KG4A 4USAA 3WK5A 2PFQA 3AL0B 1OXJA 1SGGA 1NJWA 1D9DA 2G5HB 2KEYA 1N62A 3Q8MA 2UVWA 4QZDA 1LVHA 4ECVA 2W7PA 3TAPA 2JH1A 3PVXA 2D8CA 5AM0A 3T3FA 3RJEA 1WWVA 4ECZA 3TANA 4I2IA 2RRDA 1YZ6A 5F9NA 4DF8A 2K8BB 5HR7A 2B6GA 2HMXA 4RUAA 3Q8SB 1BPYA 2BHNA 1Q3UA 4QZFA 4CNQA 3QX7A 2JH7A 1ZD5A 8ICYA 2FLPA 1H38A 2KIVA 2H3IA 2D6FC 1L8LA 1KW4A 3K4GA 4C4SA 1MN8A 2E8PA 1XNSA 5KT3A 4O3PA 3G6YA 2BQ3A 5CJ7A 2KZMA 3N28A 4J9RA 4GC7A 3M6ZA 1U49A 5KFUA 2MA1A 2YMPA 3RRGA 2YB1A 1PK1A 1T3QA 4OJLA 9ICXA 1NKEA 3F5AA 5AM1A 2ASDA 3SENA 2E3TA 4F92B 1CRXA 2LYAA 4LZDA 4Y2SA 5HMLA 1SL2A 1DGSA 1RYUA 1V85A 4KLJA 7ICQA 4FFDA 2KK0A 1RXWA 3AUOA 4M9HA 1XC9A 1JXLA 2PI4A 1DK3A 4DQQA 3RAQA 2GWSA 1S5LU 3MDAA 3BS7A 2BR0A 1S9FA 4QZEA 3KHHA 4Z6FA 1Z3EB 2HOFA 1XO0A 4DL4A 2KZ3A 1NOMA 2VJ4A 4PPXA 2NRZA 4U6PA 2YMMA 2P6UA 4Z6CA 3L3FX 2ASLA 4F8RA 3K1RB 4DSFA 5DB8A 3PR4A 7ICGA 5KL1B 3QXGA 2VJ5A 4ELVA 2KOBA 5GTHU 2XC9A 3GV8B 2C2EA 2ZUDA 3ED5A 5KFXA 2EZZA 3RBDA 3PSFA 3M9MB 4R66A 2QB1A 5AI5A 4RQ1A 3JPTA 4I2CA 1DRGA 1QTMA 1UPHA 2ISPA 3IM1A 4ELUA 3ETRA 4QWCA 1N48A 4Z6DA 3OHBA 2UVRA 3EWAA 5DGBA 8ICTA 5EWEA 9ICOA 4EYHB 1RDFA 5AKHA 3I1YA 7ICJA 2DQNB 1UHUA 1ZD2P 4DQSA 1QSSA 5DDYA 2IBKA 5KFEA 4O5KA 4RQ2A 4M2YA 2GH1A 1KQQA 1SKWA 5EE9A 5KAIU 1RQLA 2ZXHA 1NK8A 1XWLA 1Y88A 2NV3A 4MFAA 3PX0A 2K89A 3M9OB 7ICUA 2BCSA 4NM2A 9ICBA 4NL9A 4P4PA 1YZ7A 4O5EA 3RF9A 5AHXA 3M8RA 3J81j 1SV0A 2AGPA 3WKBA 2WF5A 9ICJA 4JUZA 2KNJA 4Q44A 2UVUA 4DSJA 4MFFA 3KHGA 2B21A 9ICFA 5J2GA 7ICKA 3MABA 3JPPA 1D9FA 5JU5A 4NJ8A 5KFYA 1L3VA 1F5SA 3PMNA 2Y0SF 3I28A 5ALXA 2JEGA 2ALZA 5CR0A 1AQ6A 1JX4A 1ZQKA 5BOMA 2K4EA 5F9LA 4F72A 4BX9C 3D2QA 3RFAA 2E8NA 1PUZA 5ALZA 3SAHA 5IIJA 1TK8A 3KTQA 4PHAA 4PZOA 1KRPA 4F5RA 3OGUA 5AKLA 4J9QA 4QZAA 2F3NA 3IV6A 5KG1A 2A19A 3T79A 3Q8LA 3UPQA 3JPQA 3A0BU 4F4ZA 4KX3A 5J2BA 4UB6U 4TQSA 3NGDA 3QEBZ 1IXRA 4HAIA 5KFAA 2G0AA 1HUZA 1WCNA 4NLBA 4IQVA 3QZ8A 2HVHA 1V97A 3OTQA 1BPZA 2PI5A 2HHTA 4C0ZA 1RYSA 1XSPA 5IIKA 5TZVA 3QNMA 2PXIA 4OO1J 3SI8A 3Q8QB 3SQIA 5KFWA 4Y2XA 3KHLA 2FPKA 5AKJA 2KE7A 1V38A 4KX5A 2AJQA 1ZD4A 3RJIA 4IRCA 4K4GA 4ED3A 1MSWD 4GXJA 2PFNA 1KKXA 3SYZA 3CRXA 4KMOB 8ICZA 5J0OA 4O9MA 1NZBA 3KD3A 3RJFA 2VANA 3GV5B 3CYMA 2W55A 2WB1F 7ICIA 2PFOA 3KZIU 2ZXIA 3QUCA 3DV9A 4M47A 7ICVA 3H40A 1ZQTA 3QU2A 1JN3A 1S0MA 4PH5A 9ICIA 4UW9A 7ICPA 4M6WA 4QWBA 2JV3A 4PGYA 1ZQHA 4DFMA 3EPIA 4B9TA 3VC8A 3RBEA 2ESEA 1TAMA 4BXOA 2E5SA 3QZ7A 4C80A 2J6TA 1ED1A 5ALPA 2GO7A 3GZFA 5HHIA 4ECTA 5DQIA 3AMZA 2I5HA 2HW3A 4OJ5A 2A3VA 4QWAA 2KFNA 3IRUA 3THVA 2P6RA 3KFUF 2B0CA 1S0VA 2E1FA 2Y9TA 2YY6A 2BGWA 1ZQ1C 2FJ6A 4Q43A 1TFRA 2ZJ5A 4RQ8A 4RQ4A 3MR5A 1QSYA 1HEKA 5J0YA 1FEZA 4EELA 4U7CA 4FS2A 4P4OA 2GLEA 3PW4A 3WKEA 5TISU 1Q3VA 4LVSA 4DSIA 2R8GA 4IQWA 4IL6U 5L1JA 8ICWA 3N7SC 4GIBA 9ICEA 1UT5A 3UXPA 1PVPA 4DLEA 1N5XA 4NLKA 5AIBA 1ZRMA 3Q8RB 9ICKA 4F4KA 5KG7A 1SZHA 1K1QA 4DO9A 1CEZA 5ALTA 3TADA 2DFLA 4EZ6A 4KLGA 2XI9A 5J0SA 4ELTA 5CHGA 2MRLA 1HUOA 2H3QA 5AKKA 4I2JA 1UCVA 4CF3A 2XIDA 5J0RA 1B0XA 4PHDA 3I76A 5KAFU 3PX6A 9ICGA 1X6JA 2KD1A 4TQRA 4B9NA 5DBBA 4KN4A 4YR0A 1NZPA 1XSLA 1T94A 4I2AA 3ISCA 1Z4NA 3LK9A 5ALDA 4BDPA 1B22A 2IMWP 3UXOA 4F4YA 2HSZA 3M6KA 5HMMA 5ALQA 4US9A 4ED8A 2N1RA 1NJXA 4B9MA 3B0YA 2OWOA 3H8MA 3H4BA 3E58A 4TURA 4ECRA 1ZXIA 2K8CB 1HJPA 4Y2JA 1V9PA 1LB2B 4IQTA 2NRWA 4MHVA 3ALRA 3HP6A 3IG5A 4F71A 1RYRA 2WHEA 2K4HA 3NVVA 4FBTA 2W9MA 3C2MA 4IS7A 2KMDA 3RB0A 2FDRA 1ZQOA 5CEHA 5J0UA 2ZJAA 3Q8KA 4MF8A 1JROA 4DWIA 3OSPA 4JV0A 3WU2U 5DGAA 5DG9A 4DL3A 2CPRA 4F5NA 2KJ5A 1RQNA 2AHOB 2ZIUA 2XY6A 4FBUA 2C2DA 2I1QA 1MC8A 1VJ5A 3ISDA 2ZIUB 4Y2YA 2WF8A 3JPNA 8ICBA 1NK7A 2XCPA 9ICNA 2JGAA 4J9SA 1RPLA 3MDCA 4DEZA 1DK2A 4I2HA 5EE3A 1D8BA 4YMMA 1RG6A 2L5YA 2FLNA 7ICRA 2VA2A 2Y1JA 1WUDA 2OHFA 2QB0A 4PGXA 3BS5A 4XA5A 1SXDA 4PZNA 4QZGA 4O3NA 4O5CA 5AI8A 1KFDA 2ZTEA 3D2SA 9ICQA 3NS1A 2BCVA 3TARA 3C29A 4RT2A 8ICJA 4OCZA 3PR5B 1Q8KA 1X9WA 1S76D 2BDUA 5ALSA 2KTQA 1YT3A 5HHHA 1B4FA 2JEJA 4YQWA 4UB1A 1SKSA 3QUQA 1ZQSA 2Z7JA 3L4PA 5CA7A 1UQVA 1KN5A 3FM9A 4LJXA 4C8LA 9ICAA 1TK5A 4J9OA 3NVYA 4DQPA 4O3OA 2JEFA 2R8JA 1ZETA 2FE9A 2DKXA 2R8IA 4FS1A 4ECWA 2MSNA 2BPCA 4GXKA 4GXIA 3RTVA 1K1SA 4QZ9A 4OJPA 4F93B 2FMQA 3UMCA 3TQ1A 5J2JA 4I2BA 1J97A 5KFQA 4YD2A 1N56A 4K4IA 5KT6A 3KZXA 3PO4A 3E2EA 1Z1VA 3QUTA 4ECUA 1WCLA 1X9MA 4IR1A 3DEEA 3GQCA 5J2FA 5AK5A 4O3MA 3CP8A 4M6WB 1VLBA 1U45A 2PKEA 2EAOA 5C0YA 5BPCA 4KLFA 4RNOA 3AQFA 2WFAA 4M9GA 2IOHA 1C7YA 1KTQA 1LKYB 5DG8A 4YXMA 3HILA 4FO6A 3PO5A 2ZIVA 4RPYA 3MR2A 2MUTB 1ZQVA 5AI0A 3HT3A 2Y1IA 2LHTA 3TAQA 2A1JA 3B9JA 2CN1A 2K4PA 5CWRA 5DDMA 1NJYA 2JZBB 1O08A 1KFSA 1GO3F 4UAYA 4NL9C 3WKAA 3TACB 4J9LA 3BQ0A 5KFKA 2F77X 1Z4OA 1CI4A 4I2FA 4DS4A 2W11A 2NRTA 3SR6A 2ZIXA 5KFLA 2DPJA 1X9SA 4TUPA 2EQYA 3H4DA 1L3UA 3FAHA 5DKWA 3G6VA 3GIMA 2AH5A 3C2KA 5KG2A 1RXVA 1ZQGA 3LVVA 1T7PA 5ALEA 5AICA 1QQ6A 2G07A 4YR2A 7ICOA 1OUQA 5AK3A 3G6XA 1D8YA 4RQ6A 5AM2A 8ICQA 2J6UA 4AYBF 1ZQFA 5AI9A 2KZZA 2PMZF 2R18A 4UB5A 4P2HA 4R64A 3RJHA 5ALLA 2YMQA 3HW8A 5J2DA 3GIKA 2ZTCA 2MU2A 3BQ1A 2BZFA 4QZIA 3O0FA 1X42A 3GFKB 1B43A 2F1HA 2Y0SC 3BQ7A 2KN7A 1S97A 2BPGA 3D2NA 3SEIA 4DL7A 3M7DA 4P0PA 4UB4A 1N5WA 2OXOA 4YMOA 3SMVA 4P4MA 1COKA 4C4RA 5AKGA 3MGIA 3MGVA 4DSLA 5KFJA 2HHVA 3H0RB 1F0MA 4KLEA 4KLSA 2C22A 4ECXA 4M04A 4FZMA 3F2BA 4PL2A 4JWMA 1ZQUA 1XSNA 2G06A 5KT2A 2LKYA 4UB2A 5IILA 4KLQA 2AXTU 2EZYA 4MFCA 9ICUA 4PHPA 4J9NA 2W8KA 1ZQWA 3TKAA 5AM5A 1BPEA 1BGXT 5KFRA 3ISBA 3SV3A 2DWQA 3ZDCA 1ECWA 2IHNA 4PL1A 4RNNA 1IM4A 4RNMA 5KG3A 2QKQA 2ZIWA 2ISOA 2MAXA 1Z00A 2CRXA 3AN1A 1JRPA 5IIMA 4UAZA 2XCAA 4ICAA 1U48A 2ES6A 1O03A 1Z00B 4UQGA 4YN4A 3EW9A 4R8UB 3GDXA 1TKDA 4R8UA 3PSTA 3TI0A 8ICCA 4XUSA 4RZRA 5J0PA 1QLNA 4EBDA 3MC1A 5D46A 4NWIA 1COOA 5AI4A 4R63A 1L7NA 2XGQA 2XY5A 1X40A 5L1MA 5KG6A 1ZQIA 2XO7A 3IHQB 5L9XA 5J2KA 2JEIA 3ONNA 4EBEA 5ALYA 2ZJ8A 1JUDA 4JB3A 4KITB 3JPOA 4CE6A 5D4BA 4M9LA 4EX7A 2G5IB 4NLNA 2NO5A 4C8MA 2QARA 1FFUA 1ZJNA 1T4GA 2WB1C 4DCCA 2KHVA 4UASA 3VCBA 5JUMA 3PMLA 9ICCA 4HYKA 4RQ7A 4NV0A 3RB4A 4EZ9A 4QIWF 3PW0A 3B0XA 1KDHA 5F3XB 2Y9UA 4AP9A 5KFGA 7ICTA 4DOAA 3H8JA 5KFCA 4UATA 1QH9A 2YN4A 8ICPA 1JMSA 2WTFA 2V4QA 2RP5A 1PK1B 5DB9A 5B5EU 4GLXA 4ED6A 1SV0C 5AKIA 4CGZA 4EEYA 4CRXA 2HBLA 3KOOA 8ICHA 1A77A 4F4XA 1DGJA 3OPXA 2CXYA 1ZD3A 1IG6A 3IDWA 4RQ3A 2M0NA 3RR7A 3BJYA 9ICLA 3LVWA 3T5JA 2DUYA 2LM1A 4Y2VA 1MQ3A 2XGPA 3NTUA 4YP3A 4NY8A 2YTUA 3KKAC 1L3TA 1ZQBA 8ICSA 8ICGA 3KBBA 2HHXA 4R65A 2HBJA 2EANA 2ZUCA 2JR5A 1UT8A 4ED1A 2JZBA 4OJ6A 4ECYA 1HIWA 2ZG6A 3PNCA 2Q4TA 4XRHA 5ALRA 3UMBA 3PY8A 8ICRA 2KG5A 2RHFA 2F2AB 2NO4A 5ALIA 4G9BA 5L1KA 3ZD9A 4XQ8A 1KLNA 4DFDA 4DLGA 3PSIA 1JI7A 3V6KA 4CDGA 3C5FA 3EZ5A 5KNIA 2J6SA 4KLMA 4FZNA 2E1EA 2HVIA 2HOQA 4F5PA 2W9BA 9ICHA 3PW7A 1SZPA 3ZD8A 4UAVA 1ZQJA 2ZIXB 8ICAA 2E8OA 4NM1A 2H5XA 2R8HA 1KBUA 2LYHA 1BPXA 4P0QB 3TFSA 4JK1A 2C2RA 1QQ5A 2RLTA 3Q8PB 3NASA 4YFKA 1NK4A 3JPRA 2F44A 3N7PD 9ICVA 4ED0A 1S10A 2VA3A 3V6JA 1X2IA 3SAFA 1S0NA 3AQEA 2WF7A 4BWJA 3SAGA 1L8OA 5E79U 3SV4A 3V7JA 2BDPA 5KFFA 5KT7A 2ZUBA 4I27A 3F5EA 2BQUA 1S77D 2XVTA 2V4RA 2ZIWB 2M9NA 1Q46A 1LKYA 1ZQQA 4B9UA 4I2EA 4BUGA 8ICMA 4RPXA 2YX8A 1ZQZA 5DB6A 4LZGA 2F1JA 1N2XA 1F44A 4A8EA 2JMGA 5L1IA 4EYIB 1SV4A 3RR8A 5KT4A 8ICIA 4UB3A 3R9KA 4PHEA 3BDPA 5KFSA 1TV9A 1U4BA 1ZQXA 5KFIA 5KFBA 3FC4A 2AU0A 5J0WA 4QNLA 1T8EA 3GIIA 5DG7A 3N4MB 1SIJA 3U26A 5KL8B 2KHQA 2H3VA 4O3RA 2DGZA 4DFJA 3GILA 5AKXA 3UMGA 3BS5B 4B9LA 3LDAA 2PMZC 1X66A 4F91B 1PVQA 3ZDBA 2LYBA 1J2MA 5DBAA 4KLIA 4DF4A 4GC6A 4B9VA 3TADC 1PK3A 1L7OA 4PJ0U 5KFNA 5L1LA 3MGHA 2ATLA 5DLFA
chains in the Genus database with same CATH topology
4PJ0U 3A0BU 3KZIU 2DUYA 4UB8U 5GTIU 5KAFU 4UB6U 1S5LU 5B66U 3A0HU 5GTHU 4IL6U 2AXTU 5H2FU 5KAIU 5TISU 5B5EU 5E79U 3WU2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 U;  3A0B U;  3KZI U;  2DUY A;  4UB8 U;  5GTI U;  5KAF U;  4UB6 U;  1S5L U;  5B66 U;  3A0H U;  5GTH U;  4IL6 U;  2AXT U;  5H2F U;  5KAI U;  5TIS U;  5B5E U;  5E79 U;  3WU2 U; 
#chains in the Genus database with same CATH topology
 1JIH A;  2IOF A;  1FO4 A;  4YVZ A;  4DFK A;  1X6I A;  1ZRN A;  1FFV A;  2LBO A;  3S6J A;  3EUB 2;  3KKA A;  4IQU A;  4RU9 A;  5ALO A;  4YR3 A;  8ICE A;  2LPE A;  1S8O A;  5ALJ A;  2A1A A;  4EX6 A;  3NVZ A;  3C2L A;  4UAU A;  3QYP A;  5IIN A;  4BXO B;  4DQI A;  4P0P B;  2BCQ A;  4KN7 A;  3GV7 B;  3MR6 A;  2OCE A;  2FI1 A;  2FMS A;  5J0Q A;  2W43 A;  5JRT A;  5KFM A;  1SB3 C;  5DB7 A;  2QLT A;  2HBK A;  1OW5 A;  4JV1 A;  4DFP A;  2ZTD A;  2EDU A;  1A6S A;  2EZX A;  4Z6E A;  1NI3 A;  4JV2 A;  3V7K A;  2KSO A;  2HHW A;  3RH5 A;  5HNK A;  4UBB A;  1NJZ A;  3LYS A;  4Q8E A;  3HKZ C;  4I29 A;  5EE1 A;  3C23 A;  3T5K A;  2W7O A;  4DQR A;  1ZQL A;  1JXE A;  1N60 A;  8ICV A;  5G5G A;  9ICS A;  2KFZ A;  4E0D A;  8ICF A;  1L7M A;  3D6J A;  3RAX A;  7ICF A;  1A0P A;  1Z19 A;  1SWV A;  4FZL A;  4M9N A;  3UXN A;  2E8M A;  5ALU A;  2V9W A;  5KFH A;  3ICX A;  2FLL A;  3OJS A;  2W54 A;  4NLC A;  1XS9 D;  1NK5 A;  2VKQ A;  5EWF A;  3ORY A;  4KLL A;  4QZ8 A;  2KKV A;  5ALK A;  4QWE A;  2LMR A;  1NK6 A;  4DSE A;  5JTI A;  3C1Z A;  3NRZ A;  4F2R A;  4Y2Q A;  3K75 D;  3MR3 A;  2HI0 A;  1PVR A;  2OYY A;  5A0L A;  2W9A A;  3PSP A;  3AEV A;  3UQ0 A;  1WYG A;  2F76 X;  5J2A A;  3FDS A;  4K4H A;  4WJ3 B;  5DQG A;  1ZQE A;  2W9B B;  4ED2 A;  2DBY A;  3V72 A;  4BJQ A;  7ICH A;  1XO1 A;  3K1Z A;  5AK6 A;  4C7Y A;  3WKD A;  5DLG A;  3PX4 A;  2BCU A;  1TAU A;  5ALH A;  3ZDE A;  5BOL A;  1NK9 A;  5EOZ A;  1SL1 A;  1EXN A;  4Y2T A;  3RB6 A;  5CP2 A;  1KFT A;  2BCR A;  5AKZ A;  4QW8 A;  4RUC A;  1ZJM A;  3WK4 A;  2JRZ A;  2K60 A;  4YCX A;  3IN5 A;  4F5O A;  9ICM A;  2EH9 A;  1BVS A;  2QB0 B;  3H7I A;  4RQ5 A;  3WK8 A;  1ZYQ A;  1U47 A;  4NLZ A;  2OM6 A;  5KFV A;  2KIC A;  3IP4 B;  4QJF B;  1P7D A;  2NYV A;  5T14 A;  1T3N A;  1ZQY A;  3QU4 A;  4KLH A;  3BQ2 A;  2W8L A;  1SKR A;  1JAL A;  2BPF A;  2H3F A;  4KLD A;  3FYH A;  2FPL A;  8ICN A;  3C28 A;  3MFH A;  1BNP A;  5KFZ A;  2NRV A;  2EAP A;  2HHS A;  3V6H A;  1L3S A;  3RJK A;  2KVS A;  1QSL A;  1UA0 A;  1TVA A;  5KG0 A;  2W9C A;  1SL0 A;  2DPI A;  5GTI U;  2WF9 A;  2C28 A;  1C20 A;  2KJ9 A;  2KSO B;  4DL5 A;  2AGQ A;  5AIA A;  5AK4 A;  2HDO A;  1QCK A;  4QWD A;  3NUQ A;  1TE2 A;  3BZK A;  4US8 A;  2JHD A;  3PW5 A;  3TFR A;  4OJO A;  3PV8 A;  2H3Z A;  4Y2U A;  4KTQ A;  4YXJ A;  4CF4 A;  1L5U A;  4UAR A;  2FMP A;  3WK6 A;  2RQ5 A;  5HP4 A;  5KFO A;  2P66 A;  5H2F U;  2MUT A;  3BQT A;  3JPS A;  1M6Y A;  5AI6 A;  4DS5 A;  7ICM A;  1LV5 A;  4BGD A;  4O0I A;  2LM4 A;  9ICR A;  5J8Y C;  2W3R A;  4J03 A;  1NKC A;  3QU9 A;  3ZDA A;  3HJE A;  4C8N A;  4PGQ A;  3C5G A;  3OSN A;  1XU4 A;  2KIW A;  2WAQ C;  3WK7 A;  1IIP A;  3M1Y A;  5HR6 A;  1FIQ A;  7ICS A;  2YQE A;  3LWL A;  3CNH A;  1WWU A;  1L7P A;  4GFJ A;  4F3O A;  1KL9 A;  4EEK A;  4NLG A;  3N7R C;  4C4T A;  3SZ2 A;  2KP7 A;  5EE0 A;  3C21 A;  3AU2 A;  5KTQ A;  5CRX A;  4M9J A;  3HKZ F;  5KFD A;  4RQN A;  3MBY A;  3RJG A;  4AYB C;  4RQ0 A;  3E0F A;  4JWN A;  2HBM A;  9ICW A;  2ASJ A;  2WF6 A;  1NK0 A;  5KG5 A;  2VA8 A;  3PZP A;  2KV2 A;  3QEA Z;  4ZH4 A;  8ICX A;  1ZQR A;  7ICN A;  2AQ4 A;  2NRX A;  3CW2 C;  4O3S A;  2F1I A;  3WK9 A;  2R8K A;  3NRW A;  1ZQA A;  4DL6 A;  4KLT A;  4TUQ A;  3EYZ A;  1WG8 A;  5G5H A;  3T5H A;  3V7L A;  4C8K A;  1K5O A;  2YB4 A;  3QUB A;  7ICL A;  1IV8 A;  1U9L A;  5AM4 A;  2XIC A;  7ICE A;  2O6K A;  3H0L B;  3DDH A;  1MA7 A;  5CB1 A;  4DOC A;  9ICP A;  4C7Z A;  3QU7 A;  1UA1 A;  4F50 A;  3OJU A;  4TUS A;  3PW2 A;  5IIO A;  4X5V A;  2Q0Z X;  1RM6 C;  2HOI A;  4IRK A;  4Y2R A;  1ZQM A;  3HWT A;  3UM9 A;  4F4W A;  1CUK A;  5KFT A;  2AQ0 A;  2DL0 A;  2FPM A;  5J29 A;  1NNL A;  3MFI A;  4RPZ A;  2BQR A;  8ICL A;  2P35 A;  4MF2 A;  4ZOH C;  5EWG A;  1SXE A;  1NKB A;  4QIW C;  4DOB A;  2VIX A;  3T5L A;  1BPB A;  2F8L A;  3RB3 A;  2WAQ F;  2AGO A;  1N63 A;  4B6J A;  5J2C A;  2HCF A;  3L5K A;  4QZH A;  3C1Y A;  4CF5 A;  1Z1B A;  3N97 B;  3A0H U;  5K4L A;  4UB8 U;  4J9M A;  3EPG A;  3HX0 A;  5J0X A;  4QW9 A;  5AKE A;  2DKZ A;  4EEN A;  4YG2 A;  5DQH A;  1TAQ A;  2HHQ A;  1DXS A;  5AKY A;  1SWW A;  2BKE A;  4DL2 A;  4KMU A;  3WKC A;  4BWM A;  1N61 A;  1ARO P;  1KSP A;  5ALM A;  3ZDD A;  1MQ2 A;  3HRD D;  5ALV A;  5J2E A;  5J2H A;  1PZN A;  5ALN A;  9ICT A;  2RDJ A;  5B66 U;  3H0M B;  3M8S A;  4F5Q A;  4MEY A;  4RT3 A;  5DBC A;  4ED7 A;  5J2I A;  5AM3 A;  4I2D A;  2K8A A;  3RH6 A;  2PFP A;  3RH4 A;  1KEJ A;  4B9S A;  2IOF K;  1QQ7 A;  8ICO A;  4YMN A;  4ACO A;  2ODG A;  4UBC A;  5KFP A;  3ZI4 A;  2OH2 A;  3QU5 A;  2JXJ A;  2OEH A;  3OHA A;  1VDV A;  4FE3 A;  1ZQN A;  4JMU A;  4J9P A;  5FP0 A;  3HPO A;  4KLU A;  1D8L A;  5ALF A;  3M9N B;  8ICK A;  4F2S A;  2W04 A;  1ZQD A;  2D3D A;  3GIJ A;  1ZQC A;  2YML A;  3H8S A;  5III A;  2QAR B;  4UAW A;  2RDI A;  4Q45 A;  4YD1 A;  2G08 A;  2KJ8 A;  5ALG A;  4RQM A;  4OD0 A;  3AU6 A;  2KKP A;  3QE9 Y;  2LI6 A;  3GU3 A;  2GOL A;  4IC9 A;  1A76 A;  3IG8 A;  4M0A A;  2W3S A;  2DF4 B;  4I2G A;  2F8K A;  3SD7 A;  4I28 A;  4QZB A;  4G3I A;  2K4I A;  3NVW A;  5J0T A;  4Y2P A;  4O3Q A;  5J8Y A;  5D49 A;  2KVC A;  2I9G A;  1L6N A;  1BPD A;  3RRH A;  2I6X A;  3UQ2 A;  5ALW A;  4IRD A;  4ECQ A;  1URJ A;  2IHM A;  1ZOL A;  2XY7 A;  3LWM A;  3RJJ A;  1BNO A;  4ECS A;  8ICU A;  4QZC A;  1J2N A;  4J9K A;  2IA6 A;  3F2C A;  2A1J B;  4NXZ A;  2W9C B;  4Q8F A;  3AM9 A;  1DOQ A;  2W03 A;  4IR9 A;  4KLO A;  1RZT A;  1ZQP A;  4P0Q A;  3H8W A;  2ZIV B;  2UVV A;  1TK0 A;  3F53 A;  3BZC A;  3KHR A;  4MEX A;  3ETL A;  3F2D A;  4CCH A;  4DSK A;  1S0O A;  5C5J A;  5KT5 A;  2HHU A;  4C8O A;  1X9X A;  4EBC A;  2EAM A;  2G09 A;  5KG4 A;  4USA A;  3WK5 A;  2PFQ A;  3AL0 B;  1OXJ A;  1SGG A;  1NJW A;  1D9D A;  2G5H B;  2KEY A;  1N62 A;  3Q8M A;  2UVW A;  4QZD A;  1LVH A;  4ECV A;  2W7P A;  3TAP A;  2JH1 A;  3PVX A;  2D8C A;  5AM0 A;  3T3F A;  3RJE A;  1WWV A;  4ECZ A;  3TAN A;  4I2I A;  2RRD A;  1YZ6 A;  5F9N A;  4DF8 A;  2K8B B;  5HR7 A;  2B6G A;  2HMX A;  4RUA A;  3Q8S B;  1BPY A;  2BHN A;  1Q3U A;  4QZF A;  4CNQ A;  3QX7 A;  2JH7 A;  1ZD5 A;  8ICY A;  2FLP A;  1H38 A;  2KIV A;  2H3I A;  2D6F C;  1L8L A;  1KW4 A;  3K4G A;  4C4S A;  1MN8 A;  2E8P A;  1XNS A;  5KT3 A;  4O3P A;  3G6Y A;  2BQ3 A;  5CJ7 A;  2KZM A;  3N28 A;  4J9R A;  4GC7 A;  3M6Z A;  1U49 A;  5KFU A;  2MA1 A;  2YMP A;  3RRG A;  2YB1 A;  1PK1 A;  1T3Q A;  4OJL A;  9ICX A;  1NKE A;  3F5A A;  5AM1 A;  2ASD A;  3SEN A;  2E3T A;  4F92 B;  1CRX A;  2LYA A;  4LZD A;  4Y2S A;  5HML A;  1SL2 A;  1DGS A;  1RYU A;  1V85 A;  4KLJ A;  7ICQ A;  4FFD A;  2KK0 A;  1RXW A;  3AUO A;  4M9H A;  1XC9 A;  1JXL A;  2PI4 A;  1DK3 A;  4DQQ A;  3RAQ A;  2GWS A;  1S5L U;  3MDA A;  3BS7 A;  2BR0 A;  1S9F A;  4QZE A;  3KHH A;  4Z6F A;  1Z3E B;  2HOF A;  1XO0 A;  4DL4 A;  2KZ3 A;  1NOM A;  2VJ4 A;  4PPX A;  2NRZ A;  4U6P A;  2YMM A;  2P6U A;  4Z6C A;  3L3F X;  2ASL A;  4F8R A;  3K1R B;  4DSF A;  5DB8 A;  3PR4 A;  7ICG A;  5KL1 B;  3QXG A;  2VJ5 A;  4ELV A;  2KOB A;  5GTH U;  2XC9 A;  3GV8 B;  2C2E A;  2ZUD A;  3ED5 A;  5KFX A;  2EZZ A;  3RBD A;  3PSF A;  3M9M B;  4R66 A;  2QB1 A;  5AI5 A;  4RQ1 A;  3JPT A;  4I2C A;  1DRG A;  1QTM A;  1UPH A;  2ISP A;  3IM1 A;  4ELU A;  3ETR A;  4QWC A;  1N48 A;  4Z6D A;  3OHB A;  2UVR A;  3EWA A;  5DGB A;  8ICT A;  5EWE A;  9ICO A;  4EYH B;  1RDF A;  5AKH A;  3I1Y A;  7ICJ A;  2DQN B;  1UHU A;  1ZD2 P;  4DQS A;  1QSS A;  5DDY A;  2IBK A;  5KFE A;  4O5K A;  4RQ2 A;  4M2Y A;  2GH1 A;  1KQQ A;  1SKW A;  5EE9 A;  5KAI U;  1RQL A;  2ZXH A;  1NK8 A;  1XWL A;  1Y88 A;  2NV3 A;  4MFA A;  3PX0 A;  2K89 A;  3M9O B;  7ICU A;  2BCS A;  4NM2 A;  9ICB A;  4NL9 A;  4P4P A;  1YZ7 A;  4O5E A;  3RF9 A;  5AHX A;  3M8R A;  3J81 j;  1SV0 A;  2AGP A;  3WKB A;  2WF5 A;  9ICJ A;  4JUZ A;  2KNJ A;  4Q44 A;  2UVU A;  4DSJ A;  4MFF A;  3KHG A;  2B21 A;  9ICF A;  5J2G A;  7ICK A;  3MAB A;  3JPP A;  1D9F A;  5JU5 A;  4NJ8 A;  5KFY A;  1L3V A;  1F5S A;  3PMN A;  2Y0S F;  3I28 A;  5ALX A;  2JEG A;  2ALZ A;  5CR0 A;  1AQ6 A;  1JX4 A;  1ZQK A;  5BOM A;  2K4E A;  5F9L A;  4F72 A;  4BX9 C;  3D2Q A;  3RFA A;  2E8N A;  1PUZ A;  5ALZ A;  3SAH A;  5IIJ A;  1TK8 A;  3KTQ A;  4PHA A;  4PZO A;  1KRP A;  4F5R A;  3OGU A;  5AKL A;  4J9Q A;  4QZA A;  2F3N A;  3IV6 A;  5KG1 A;  2A19 A;  3T79 A;  3Q8L A;  3UPQ A;  3JPQ A;  3A0B U;  4F4Z A;  4KX3 A;  5J2B A;  4UB6 U;  4TQS A;  3NGD A;  3QEB Z;  1IXR A;  4HAI A;  5KFA A;  2G0A A;  1HUZ A;  1WCN A;  4NLB A;  4IQV A;  3QZ8 A;  2HVH A;  1V97 A;  3OTQ A;  1BPZ A;  2PI5 A;  2HHT A;  4C0Z A;  1RYS A;  1XSP A;  5IIK A;  5TZV A;  3QNM A;  2PXI A;  4OO1 J;  3SI8 A;  3Q8Q B;  3SQI A;  5KFW A;  4Y2X A;  3KHL A;  2FPK A;  5AKJ A;  2KE7 A;  1V38 A;  4KX5 A;  2AJQ A;  1ZD4 A;  3RJI A;  4IRC A;  4K4G A;  4ED3 A;  1MSW D;  4GXJ A;  2PFN A;  1KKX A;  3SYZ A;  3CRX A;  4KMO B;  8ICZ A;  5J0O A;  4O9M A;  1NZB A;  3KD3 A;  3RJF A;  2VAN A;  3GV5 B;  3CYM A;  2W55 A;  2WB1 F;  7ICI A;  2PFO A;  3KZI U;  2ZXI A;  3QUC A;  3DV9 A;  4M47 A;  7ICV A;  3H40 A;  1ZQT A;  3QU2 A;  1JN3 A;  1S0M A;  4PH5 A;  9ICI A;  4UW9 A;  7ICP A;  4M6W A;  4QWB A;  2JV3 A;  4PGY A;  1ZQH A;  4DFM A;  3EPI A;  4B9T A;  3VC8 A;  3RBE A;  2ESE A;  1TAM A;  4BXO A;  2E5S A;  3QZ7 A;  4C80 A;  2J6T A;  1ED1 A;  5ALP A;  2GO7 A;  3GZF A;  5HHI A;  4ECT A;  5DQI A;  3AMZ A;  2I5H A;  2HW3 A;  4OJ5 A;  2A3V A;  4QWA A;  2KFN A;  3IRU A;  3THV A;  2P6R A;  3KFU F;  2B0C A;  1S0V A;  2E1F A;  2Y9T A;  2YY6 A;  2BGW A;  1ZQ1 C;  2FJ6 A;  4Q43 A;  1TFR A;  2ZJ5 A;  4RQ8 A;  4RQ4 A;  3MR5 A;  1QSY A;  1HEK A;  5J0Y A;  1FEZ A;  4EEL A;  4U7C A;  4FS2 A;  4P4O A;  2GLE A;  3PW4 A;  3WKE A;  5TIS U;  1Q3V A;  4LVS A;  4DSI A;  2R8G A;  4IQW A;  4IL6 U;  5L1J A;  8ICW A;  3N7S C;  4GIB A;  9ICE A;  1UT5 A;  3UXP A;  1PVP A;  4DLE A;  1N5X A;  4NLK A;  5AIB A;  1ZRM A;  3Q8R B;  9ICK A;  4F4K A;  5KG7 A;  1SZH A;  1K1Q A;  4DO9 A;  1CEZ A;  5ALT A;  3TAD A;  2DFL A;  4EZ6 A;  4KLG A;  2XI9 A;  5J0S A;  4ELT A;  5CHG A;  2MRL A;  1HUO A;  2H3Q A;  5AKK A;  4I2J A;  1UCV A;  4CF3 A;  2XID A;  5J0R A;  1B0X A;  4PHD A;  3I76 A;  5KAF U;  3PX6 A;  9ICG A;  1X6J A;  2KD1 A;  4TQR A;  4B9N A;  5DBB A;  4KN4 A;  4YR0 A;  1NZP A;  1XSL A;  1T94 A;  4I2A A;  3ISC A;  1Z4N A;  3LK9 A;  5ALD A;  4BDP A;  1B22 A;  2IMW P;  3UXO A;  4F4Y A;  2HSZ A;  3M6K A;  5HMM A;  5ALQ A;  4US9 A;  4ED8 A;  2N1R A;  1NJX A;  4B9M A;  3B0Y A;  2OWO A;  3H8M A;  3H4B A;  3E58 A;  4TUR A;  4ECR A;  1ZXI A;  2K8C B;  1HJP A;  4Y2J A;  1V9P A;  1LB2 B;  4IQT A;  2NRW A;  4MHV A;  3ALR A;  3HP6 A;  3IG5 A;  4F71 A;  1RYR A;  2WHE A;  2K4H A;  3NVV A;  4FBT A;  2W9M A;  3C2M A;  4IS7 A;  2KMD A;  3RB0 A;  2FDR A;  1ZQO A;  5CEH A;  5J0U A;  2ZJA A;  3Q8K A;  4MF8 A;  1JRO A;  4DWI A;  3OSP A;  4JV0 A;  3WU2 U;  5DGA A;  5DG9 A;  4DL3 A;  2CPR A;  4F5N A;  2KJ5 A;  1RQN A;  2AHO B;  2ZIU A;  2XY6 A;  4FBU A;  2C2D A;  2I1Q A;  1MC8 A;  1VJ5 A;  3ISD A;  2ZIU B;  4Y2Y A;  2WF8 A;  3JPN A;  8ICB A;  1NK7 A;  2XCP A;  9ICN A;  2JGA A;  4J9S A;  1RPL A;  3MDC A;  4DEZ A;  1DK2 A;  4I2H A;  5EE3 A;  1D8B A;  4YMM A;  1RG6 A;  2L5Y A;  2FLN A;  7ICR A;  2VA2 A;  2Y1J A;  1WUD A;  2OHF A;  2QB0 A;  4PGX A;  3BS5 A;  4XA5 A;  1SXD A;  4PZN A;  4QZG A;  4O3N A;  4O5C A;  5AI8 A;  1KFD A;  2ZTE A;  3D2S A;  9ICQ A;  3NS1 A;  2BCV A;  3TAR A;  3C29 A;  4RT2 A;  8ICJ A;  4OCZ A;  3PR5 B;  1Q8K A;  1X9W A;  1S76 D;  2BDU A;  5ALS A;  2KTQ A;  1YT3 A;  5HHH A;  1B4F A;  2JEJ A;  4YQW A;  4UB1 A;  1SKS A;  3QUQ A;  1ZQS A;  2Z7J A;  3L4P A;  5CA7 A;  1UQV A;  1KN5 A;  3FM9 A;  4LJX A;  4C8L A;  9ICA A;  1TK5 A;  4J9O A;  3NVY A;  4DQP A;  4O3O A;  2JEF A;  2R8J A;  1ZET A;  2FE9 A;  2DKX A;  2R8I A;  4FS1 A;  4ECW A;  2MSN A;  2BPC A;  4GXK A;  4GXI A;  3RTV A;  1K1S A;  4QZ9 A;  4OJP A;  4F93 B;  2FMQ A;  3UMC A;  3TQ1 A;  5J2J A;  4I2B A;  1J97 A;  5KFQ A;  4YD2 A;  1N56 A;  4K4I A;  5KT6 A;  3KZX A;  3PO4 A;  3E2E A;  1Z1V A;  3QUT A;  4ECU A;  1WCL A;  1X9M A;  4IR1 A;  3DEE A;  3GQC A;  5J2F A;  5AK5 A;  4O3M A;  3CP8 A;  4M6W B;  1VLB A;  1U45 A;  2PKE A;  2EAO A;  5C0Y A;  5BPC A;  4KLF A;  4RNO A;  3AQF A;  2WFA A;  4M9G A;  2IOH A;  1C7Y A;  1KTQ A;  1LKY B;  5DG8 A;  4YXM A;  3HIL A;  4FO6 A;  3PO5 A;  2ZIV A;  4RPY A;  3MR2 A;  2MUT B;  1ZQV A;  5AI0 A;  3HT3 A;  2Y1I A;  2LHT A;  3TAQ A;  2A1J A;  3B9J A;  2CN1 A;  2K4P A;  5CWR A;  5DDM A;  1NJY A;  2JZB B;  1O08 A;  1KFS A;  1GO3 F;  4UAY A;  4NL9 C;  3WKA A;  3TAC B;  4J9L A;  3BQ0 A;  5KFK A;  2F77 X;  1Z4O A;  1CI4 A;  4I2F A;  4DS4 A;  2W11 A;  2NRT A;  3SR6 A;  2ZIX A;  5KFL A;  2DPJ A;  1X9S A;  4TUP A;  2EQY A;  3H4D A;  1L3U A;  3FAH A;  5DKW A;  3G6V A;  3GIM A;  2AH5 A;  3C2K A;  5KG2 A;  1RXV A;  1ZQG A;  3LVV A;  1T7P A;  5ALE A;  5AIC A;  1QQ6 A;  2G07 A;  4YR2 A;  7ICO A;  1OUQ A;  5AK3 A;  3G6X A;  1D8Y A;  4RQ6 A;  5AM2 A;  8ICQ A;  2J6U A;  4AYB F;  1ZQF A;  5AI9 A;  2KZZ A;  2PMZ F;  2R18 A;  4UB5 A;  4P2H A;  4R64 A;  3RJH A;  5ALL A;  2YMQ A;  3HW8 A;  5J2D A;  3GIK A;  2ZTC A;  2MU2 A;  3BQ1 A;  2BZF A;  4QZI A;  3O0F A;  1X42 A;  3GFK B;  1B43 A;  2F1H A;  2Y0S C;  3BQ7 A;  2KN7 A;  1S97 A;  2BPG A;  3D2N A;  3SEI A;  4DL7 A;  3M7D A;  4P0P A;  4UB4 A;  1N5W A;  2OXO A;  4YMO A;  3SMV A;  4P4M A;  1COK A;  4C4R A;  5AKG A;  3MGI A;  3MGV A;  4DSL A;  5KFJ A;  2HHV A;  3H0R B;  1F0M A;  4KLE A;  4KLS A;  2C22 A;  4ECX A;  4M04 A;  4FZM A;  3F2B A;  4PL2 A;  4JWM A;  1ZQU A;  1XSN A;  2G06 A;  5KT2 A;  2LKY A;  4UB2 A;  5IIL A;  4KLQ A;  2AXT U;  2EZY A;  4MFC A;  9ICU A;  4PHP A;  4J9N A;  2W8K A;  1ZQW A;  3TKA A;  5AM5 A;  1BPE A;  1BGX T;  5KFR A;  3ISB A;  3SV3 A;  2DWQ A;  3ZDC A;  1ECW A;  2IHN A;  4PL1 A;  4RNN A;  1IM4 A;  4RNM A;  5KG3 A;  2QKQ A;  2ZIW A;  2ISO A;  2MAX A;  1Z00 A;  2CRX A;  3AN1 A;  1JRP A;  5IIM A;  4UAZ A;  2XCA A;  4ICA A;  1U48 A;  2ES6 A;  1O03 A;  1Z00 B;  4UQG A;  4YN4 A;  3EW9 A;  4R8U B;  3GDX A;  1TKD A;  4R8U A;  3PST A;  3TI0 A;  8ICC A;  4XUS A;  4RZR A;  5J0P A;  1QLN A;  4EBD A;  3MC1 A;  5D46 A;  4NWI A;  1COO A;  5AI4 A;  4R63 A;  1L7N A;  2XGQ A;  2XY5 A;  1X40 A;  5L1M A;  5KG6 A;  1ZQI A;  2XO7 A;  3IHQ B;  5L9X A;  5J2K A;  2JEI A;  3ONN A;  4EBE A;  5ALY A;  2ZJ8 A;  1JUD A;  4JB3 A;  4KIT B;  3JPO A;  4CE6 A;  5D4B A;  4M9L A;  4EX7 A;  2G5I B;  4NLN A;  2NO5 A;  4C8M A;  2QAR A;  1FFU A;  1ZJN A;  1T4G A;  2WB1 C;  4DCC A;  2KHV A;  4UAS A;  3VCB A;  5JUM A;  3PML A;  9ICC A;  4HYK A;  4RQ7 A;  4NV0 A;  3RB4 A;  4EZ9 A;  4QIW F;  3PW0 A;  3B0X A;  1KDH A;  5F3X B;  2Y9U A;  4AP9 A;  5KFG A;  7ICT A;  4DOA A;  3H8J A;  5KFC A;  4UAT A;  1QH9 A;  2YN4 A;  8ICP A;  1JMS A;  2WTF A;  2V4Q A;  2RP5 A;  1PK1 B;  5DB9 A;  5B5E U;  4GLX A;  4ED6 A;  1SV0 C;  5AKI A;  4CGZ A;  4EEY A;  4CRX A;  2HBL A;  3KOO A;  8ICH A;  1A77 A;  4F4X A;  1DGJ A;  3OPX A;  2CXY A;  1ZD3 A;  1IG6 A;  3IDW A;  4RQ3 A;  2M0N A;  3RR7 A;  3BJY A;  9ICL A;  3LVW A;  3T5J A;  2DUY A;  2LM1 A;  4Y2V A;  1MQ3 A;  2XGP A;  3NTU A;  4YP3 A;  4NY8 A;  2YTU A;  3KKA C;  1L3T A;  1ZQB A;  8ICS A;  8ICG A;  3KBB A;  2HHX A;  4R65 A;  2HBJ A;  2EAN A;  2ZUC A;  2JR5 A;  1UT8 A;  4ED1 A;  2JZB A;  4OJ6 A;  4ECY A;  1HIW A;  2ZG6 A;  3PNC A;  2Q4T A;  4XRH A;  5ALR A;  3UMB A;  3PY8 A;  8ICR A;  2KG5 A;  2RHF A;  2F2A B;  2NO4 A;  5ALI A;  4G9B A;  5L1K A;  3ZD9 A;  4XQ8 A;  1KLN A;  4DFD A;  4DLG A;  3PSI A;  1JI7 A;  3V6K A;  4CDG A;  3C5F A;  3EZ5 A;  5KNI A;  2J6S A;  4KLM A;  4FZN A;  2E1E A;  2HVI A;  2HOQ A;  4F5P A;  2W9B A;  9ICH A;  3PW7 A;  1SZP A;  3ZD8 A;  4UAV A;  1ZQJ A;  2ZIX B;  8ICA A;  2E8O A;  4NM1 A;  2H5X A;  2R8H A;  1KBU A;  2LYH A;  1BPX A;  4P0Q B;  3TFS A;  4JK1 A;  2C2R A;  1QQ5 A;  2RLT A;  3Q8P B;  3NAS A;  4YFK A;  1NK4 A;  3JPR A;  2F44 A;  3N7P D;  9ICV A;  4ED0 A;  1S10 A;  2VA3 A;  3V6J A;  1X2I A;  3SAF A;  1S0N A;  3AQE A;  2WF7 A;  4BWJ A;  3SAG A;  1L8O A;  5E79 U;  3SV4 A;  3V7J A;  2BDP A;  5KFF A;  5KT7 A;  2ZUB A;  4I27 A;  3F5E A;  2BQU A;  1S77 D;  2XVT A;  2V4R A;  2ZIW B;  2M9N A;  1Q46 A;  1LKY A;  1ZQQ A;  4B9U A;  4I2E A;  4BUG A;  8ICM A;  4RPX A;  2YX8 A;  1ZQZ A;  5DB6 A;  4LZG A;  2F1J A;  1N2X A;  1F44 A;  4A8E A;  2JMG A;  5L1I A;  4EYI B;  1SV4 A;  3RR8 A;  5KT4 A;  8ICI A;  4UB3 A;  3R9K A;  4PHE A;  3BDP A;  5KFS A;  1TV9 A;  1U4B A;  1ZQX A;  5KFI A;  5KFB A;  3FC4 A;  2AU0 A;  5J0W A;  4QNL A;  1T8E A;  3GII A;  5DG7 A;  3N4M B;  1SIJ A;  3U26 A;  5KL8 B;  2KHQ A;  2H3V A;  4O3R A;  2DGZ A;  4DFJ A;  3GIL A;  5AKX A;  3UMG A;  3BS5 B;  4B9L A;  3LDA A;  2PMZ C;  1X66 A;  4F91 B;  1PVQ A;  3ZDB A;  2LYB A;  1J2M A;  5DBA A;  4KLI A;  4DF4 A;  4GC6 A;  4B9V A;  3TAD C;  1PK3 A;  1L7O A;  4PJ0 U;  5KFN A;  5L1L A;  3MGH A;  2ATL A;  5DLF A; 
#chains in the Genus database with same CATH homology
 4PJ0 U;  3A0B U;  3KZI U;  2DUY A;  4UB8 U;  5GTI U;  5KAF U;  4UB6 U;  1S5L U;  5B66 U;  3A0H U;  5GTH U;  4IL6 U;  2AXT U;  5H2F U;  5KAI U;  5TIS U;  5B5E U;  5E79 U;  3WU2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...