1SGGA

The solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
YTSFNTVDEWLDAIKMSQYKESFASAGFTTFDIVSQMTVEDILRVGVTLAGHQKKILNSIQVMRAQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the receptor tyrosine kinase EphB2 SAM domain and identification of two distinct homotypic interaction sites.
pubmed rcsb
source organism Gallus gallus
molecule tags Tyrosine-protein kinase
molecule keywords EPHRIN TYPE-B RECEPTOR 2
total genus 12
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sggA00
2DKZA 1PK1B 1SV0A 2GLEA 3H8MA 3TACB 5JRTA 3BQ7A 2KSOA 4NL9C 2E8NA 3TADA 2E8OA 1DXSA 2KG5A 1SGGA 4RQMA 2ES6A 1WWUA 1V38A 3K1RB 2B6GA 1SV4A 1PK1A 2ESEA 2EAPA 2D3DA 1F0MA 2F8KA 3BS7A 2LPEA 4IS7A 2QB0B 4NJ8A 2DL0A 5J8YC 2F44A 3KKAC 4MHVA 1PK3A 5KNIA 2JV3A 1LKYA 4PZNA 1X66A 1UCVA 3BS5B 1OW5A 1KW4A 3SENA 1RG6A 1JI7A 2EANA 2EAOA 2K4PA 2QARB 2QKQA 2QB1A 1B4FA 1Z1VA 1UQVA 2KE7A 2KMDA 2LMRA 2DKXA 4RQNA 2K60A 5J8YA 1OXJA 3BS5A 3HILA 1SV0C 5L1MA 4PZOA 5F3XB 1X40A 3KKAA 1SXDA 4NL9A 2E8MA 2F3NA 5JU5A 1SXEA 2EAMA 2E8PA 2KSOB 2FE9A 2Y9UA 1LKYB 1X9XA 1V85A 2KIVA 2L5YA 2QB0A 1WWVA 3SEIA 3TADC 2QARA 2D8CA 1B0XA 5JTIA 2Y9TA 1COKA 2YTUA 3IDWA
chains in the Genus database with same CATH superfamily
3D2QA 5GTIU 5AKGA 4M47A 2W9MA 3M1YA 5KT6A 2KVSA 5ALPA 5AKKA 1DXSA 2W9BA 4RPYA 3ZDAA 5E79U 1K1QA 4DL3A 1S9FA 3H4BA 1X6JA 3NASA 4F2SA 2DF4B 2M0NA 2ALZA 5JUMA 3H7IA 1BPDA 1SZHA 3BZKA 5ALVA 3RR8A 1KQQA 2F8KA 2LYHA 9ICXA 5AM4A 4F91B 3OJUA 1U48A 4DQQA 2GOLA 3IRUA 1FEZA 2XVTA 2ASJA 2I5HA 2YY6A 1TK0A 4F93B 3EUB2 5DGBA 3JPPA 3THVA 3H8SA 1XO1A 1NK9A 2WFAA 4F2RA 1QSYA 4YR2A 2PFNA 3GIIA 1T4GA 4Q8FA 5BPCA 4RUAA 4QZFA 1RQLA 4YN4A 5DDYA 2QKQA 3M9OB 1UA1A 4NLBA 1Z1VA 2W8LA 2IA6A 3PSPA 3TKAA 1NK5A 1YZ6A 3M9MB 3M8RA 3RJGA 3G6YA 2VJ4A 5J0WA 1U4BA 1ZQQA 3FC4A 4Q45A 3KKAA 4ED6A 1SXDA 7ICJA 5JU5A 4TUQA 9ICGA 5KG0A 4Z6CA 3WU2U 4UQGA 4AP9A 5HP4A 4M04A 3C5GA 3SAHA 1V85A 4NY8A 4LJXA 4DL5A 1ZQJA 3JPQA 3KFUF 5ALQA 5J0OA 1B0XA 4RU9A 1JRPA 1Q46A 4F3OA 5ALZA 2W8KA 1COOA 5KTQA 3TACB 1TFRA 4F5PA 5JRTA 1ZQRA 7ICVA 2LM4A 4NL9C 1SL0A 2W9CA 1U9LA 2F1IA 2ZIUB 5KFOA 3DEEA 4J9LA 2FMPA 2F77X 4KLLA 3LK9A 4ECRA 5EE3A 3DDHA 5ALDA 7ICTA 2RDJA 5KFQA 4JV2A 2OXOA 2ISPA 3GIJA 1NJXA 1NK0A 3EW9A 4M9GA 3WKEA 2ZUBA 4XQ8A 3S6JA 4KLQA 4UB6U 3H0MB 4J9PA 2XY6A 2ATLA 1JX4A 3QZ8A 3EYZA 2BZFA 2KHQA 4J9MA 2XIDA 4PL1A 3AMZA 1JI7A 4F4YA 2EAOA 4DEZA 4NLKA 4TUPA 5G5GA 1ED1A 3N7SC 9ICIA 2BCQA 3BQ2A 4CF5A 2J6UA 2FMSA 5ALGA 4KLHA 4NM1A 3GQCA 5F3XB 5HHIA 2ZG6A 4BX9C 2MUTA 2EAMA 2E1EA 3RJJA 4YCXA 9ICSA 1HUOA 3H0LB 4PGQA 4IQTA 8ICCA 4QZIA 5J0PA 1KSPA 4DSIA 4CNQA 4UB3A 9ICHA 3F53A 3PO4A 1X42A 3K4GA 1X6IA 2BDUA 3UMCA 4YXMA 2HBJA 4ELUA 3NVYA 4GXJA 4O5KA 5EE0A 4M9NA 4KN7A 5KFVA 3PW5A 4PHPA 5J2GA 1KKXA 2E3TA 9ICKA 5KFRA 3HPOA 3T79A 4YG2A 3UXNA 1SV4A 3D2SA 1QTMA 4TQRA 2O6KA 4UBBA 5KFSA 4IR1A 4O3OA 4B9VA 9ICPA 4ED2A 2B21A 2ZXHA 4F92B 8ICTA 3LVVA 3KHLA 2W9AA 3JPTA 3EWAA 4U6PA 2KTQA 2WF9A 3KTQA 4YFKA 2BCUA 1ZJNA 4C4TA 2WTFA 4ELTA 4R63A 1KW4A 2BCSA 2XGPA 2H3QA 4IRDA 9ICUA 3SENA 3SQIA 3ZDEA 9ICAA 4IQUA 1NK8A 7ICUA 2FDRA 2DKXA 3CYMA 4PH5A 1L3SA 3PV8A 5TISU 5ALJA 2BPFA 3AQFA 4NLNA 1AQ6A 3C2KA 2VKQA 1Y88A 5DG8A 3TAQA 4PPXA 1BPYA 1D9DA 1HJPA 5KFBA 4Z6DA 2KOBA 2JGAA 2LKYA 2XO7A 4KX5A 1SWVA 4O3NA 4EEYA 5AM0A 3I28A 2NO4A 3QX7A 2IHNA 4NLZA 3MR6A 3SV4A 4GC6A 1T8EA 4QWBA 7ICIA 4RPZA 7ICKA 3RAXA 8ICSA 2PI4A 3HT3A 4JWMA 9ICMA 2DUYA 2IOFA 2NRTA 4EELA 3FAHA 1JXEA 3MABA 1DK3A 2V9WA 8ICXA 3SD7A 2I6XA 3RTVA 4ECWA 4KMOB 2K8CB 3HP6A 4YR0A 3ETRA 5KFGA 2YMMA 2V4QA 2OCEA 4CF4A 2ESEA 2D3DA 2HSZA 2H5XA 2YB4A 5KAIU 1NK7A 1ZD3A 5ALWA 1MN8A 2KV2A 4M6WA 4MHVA 2KZZA 4CDGA 4PZNA 1KFDA 4PGYA 4M6WB 2OH2A 2W04A 4M9HA 2FLPA 1MQ3A 5KFUA 2EH9A 3KD3A 5DB6A 5KT3A 1ZQLA 3Q8RB 2KK0A 2KICA 4QZHA 2K60A 4C8KA 3ISDA 3UQ0A 2AGPA 4RZRA 3EPIA 5L1MA 1X40A 3IN5A 2W9BB 3L4PA 4B9NA 8ICBA 2Y0SF 4ECUA 1JN3A 2HBLA 3BQ1A 1J97A 3SZ2A 2KSOB 3F2CA 7ICFA 4O3MA 5GTHU 1ZQZA 1NK4A 1UT8A 3ISCA 4XRHA 5A0LA 4R65A 1RM6C 7ICOA 3ICXA 2Y1JA 5KFHA 1PZNA 1ZQCA 1L7NA 4FS2A 4DSFA 1JUDA 5AICA 2Y9TA 2DKZA 5J2IA 5KG7A 2XCAA 2JMGA 5AK5A 4UAUA 1TV9A 1NZPA 1RYSA 5J29A 1TVAA 3RF9A 2QLTA 1XSLA 3V6HA 5DGAA 4P0QA 2E5SA 2EZZA 5KL1B 3RFAA 4RQMA 4QWDA 4F4XA 5CEHA 1PVQA 2HCFA 3M6ZA 3MR2A 3QU7A 4O3SA 2WAQF 3UXPA 2DPJA 4EBEA 3PX6A 1XWLA 3GV7B 2R8GA 4Y2UA 1AROP 2HBKA 4MEXA 3MDAA 1CI4A 3OHBA 1MA7A 2CXYA 1JIHA 4FS1A 4JK1A 5AM5A 1UPHA 1NI3A 1MC8A 1TE2A 1CUKA 3T3FA 1K5OA 2DBYA 4ECTA 4B9UA 2DQNB 2P6UA 4WJ3B 4C8LA 5L1JA 5DBBA 4YMOA 1FFUA 4R8UB 2XGQA 1D8YA 4O9MA 2PFQA 2XY5A 1KBUA 1D8LA 3HILA 3LYSA 2RLTA 3OPXA 3ZDDA 2LYBA 4J9QA 1FFVA 4F5NA 3QUBA 2FI1A 4BDPA 3RJHA 2C28A 4YVZA 8ICFA 1L6NA 8ICNA 4QWEA 4QZDA 5KT7A 5KFEA 2W55A 3Q8QB 1JXLA 1BGXT 3CNHA 3QU9A 4Y2SA 1CRXA 4ACOA 2BR0A 5DQIA 8ICGA 3TADC 1ZQTA 3IV6A 3C5FA 2PFOA 1ZD4A 4DFJA 5AM2A 3LWMA 1ZOLA 1SV0A 1LB2B 1BNOA 4NWIA 3IP4B 3QU4A 4A8EA 2W03A 4EX7A 4CGZA 1N60A 5AKHA 4UASA 5EWGA 2KG5A 5KG1A 3C23A 9ICLA 1WWUA 4C8NA 4F4ZA 3UMBA 5AI5A 4OCZA 4K4IA 2ZIXB 3RB6A 1BPBA 2WB1C 2ZXIA 3RAQA 3ZD9A 2EAPA 8ICPA 4LZGA 2HVIA 9ICTA 1BPXA 4I2CA 4DSEA 3GILA 3KKAC 4TQSA 4P0QB 3K1ZA 3RJIA 4DWIA 4PHAA 8ICYA 2FMQA 4ECQA 2DGZA 4E0DA 2R8HA 3BS5B 3PMNA 5KFFA 4DF8A 3V72A 1A0PA 4ZH4A 5J2DA 4RQ3A 2KFZA 3GFKB 3WK5A 1L7MA 4DLEA 5D46A 4ED3A 8ICEA 4OO1J 3M6KA 2KJ9A 2JZBB 1XC9A 2XCPA 5DKWA 5HR6A 4UAYA 4BUGA 2ZJ5A 4RPXA 2K89A 3N7PD 4NL9A 2FPLA 2F1JA 4I2EA 1B43A 4DSKA 2Y9UA 2BPCA 4IC9A 5HMMA 4Q44A 1ZETA 3SAGA 4FFDA 1QQ6A 5J0QA 2R18A 2IOHA 3EPGA 1SB3C 5JTIA 3C2MA 4PL2A 2BKEA 5EWFA 4MF2A 4P0PB 9ICWA 4DOAA 2A1AA 3RB0A 2KP7A 2HBMA 5L1IA 2R8JA 3JPSA 3EZ5A 4CF3A 2B6GA 4KLEA 2P66A 4YXJA 5CP2A 2G06A 2AQ4A 5CRXA 5KFIA 1PK1A 4I2AA 3T5JA 4RQ7A 3TI0A 3HX0A 8ICAA 1KRPA 4ED1A 4M2YA 3PR4A 3J81j 5EWEA 3D2NA 1YT3A 1KN5A 4UARA 2VJ5A 4R64A 1S0VA 1X9WA 2KVCA 4RUCA 4LVSA 4F5OA 3QYPA 3VCBA 3MDCA 3HJEA 2HHVA 2IHMA 3C21A 8ICKA 4QWCA 3QUTA 3PY8A 2K4PA 2W43A 3RH5A 4UB8U 4FZNA 4MF8A 2ZUCA 1LV5A 2ZJAA 4C0ZA 3CP8A 1C20A 2H3IA 5IIIA 9ICBA 2AQ0A 2D6FC 3ONNA 5AI0A 4CE6A 1L3VA 1KLNA 1S0NA 5F9LA 1L8LA 3OHAA 5DB9A 3PX0A 4QZ9A 4OD0A 1L8OA 1JALA 4QIWC 5ALNA 2NO5A 5C5JA 3PX4A 4P4PA 2ZIVA 5ALTA 2F8LA 1UT5A 5DDMA 4IQWA 2KKVA 2LHTA 5DB8A 4JMUA 1WG8A 4KLOA 1UA0A 3GIKA 3C29A 2QARA 1RPLA 2A19A 1COKA 5L1LA 4DFDA 1QH9A 2HHTA 1XS9D 3H8MA 2FLLA 3JPOA 4I2HA 3QE9Y 5L1KA 5J2CA 2P6RA 3C1YA 3RJEA 1SGGA 2YX8A 2AGQA 2PKEA 5IIMA 5IIKA 5F9NA 2MAXA 1QSLA 2GO7A 2W54A 4YD2A 3PW0A 5KFMA 3UPQA 1PVRA 1Z00A 1C7YA 2ZJ8A 4C7YA 3DV9A 3NRWA 2DWQA 4EYIB 4GC7A 3WK8A 5KG5A 5KG2A 4C4RA 4J03A 2K8AA 1X66A 2JH1A 3RBDA 1ZQFA 3FYHA 3QNMA 1O03A 1F5SA 1KL9A 1U47A 5KFLA 2QARB 4GIBA 2IMWP 1B4FA 3ZDCA 5D4BA 1Z00B 2ZIWA 1JMSA 5B66U 5KFXA 2ZIVB 3MGIA 2KFNA 1N62A 4EBCA 1KEJA 2KJ5A 1N5XA 4UB5A 2KD1A 2E8MA 4OJPA 3HW8A 4J9KA 2B0CA 1B22A 2RP5A 3PNCA 1UHUA 1URJA 5J0YA 1NK6A 5J2HA 4F8RA 9ICCA 5D49A 3A0HU 3HRDD 4ECYA 2KHVA 3QXGA 1L3UA 1YZ7A 3I1YA 2QB0A 5DBAA 5T14A 3TFRA 2C2EA 2XC9A 5HMLA 8ICVA 3IDWA 4C7ZA 4O5EA 1Q3VA 4QZEA 5C0YA 4PGXA 4C8OA 4UW9A 4I2GA 1NKCA 4GLXA 1ZQKA 3OSPA 3H40A 2G5HB 1RXWA 2H3FA 4PHEA 1V38A 2EDUA 5AI4A 3RJKA 2FPMA 3UQ2A 2JXJA 3FDSA 3MBYA 1X9MA 5ALHA 4EZ9A 4I2DA 1V97A 4KITB 4IS7A 3PSIA 5ALRA 1ZQSA 2AH5A 2LM1A 1CEZA 5KNIA 2R8IA 2JV3A 4P0PA 4ED7A 4YR3A 4UAZA 1X2IA 1Z19A 3JPRA 4XA5A 2YN4A 8ICRA 4MEYA 1Z3EB 8ICUA 3AU6A 4K4GA 2VA3A 3U26A 1TAMA 1HEKA 4LZDA 5HR7A 2LYAA 4US8A 3NRZA 2OHFA 1S0OA 2AU0A 1SKWA 4QZAA 2RDIA 3V7LA 3GV8B 2DPIA 1TK8A 3WK4A 4FO6A 1NKEA 3NGDA 4DSLA 5ALMA 4B9SA 3KBBA 3TARA 2MRLA 1X9XA 2L5YA 1QCKA 9ICVA 3R9KA 4IRCA 1ZQVA 4Y2YA 4I27A 2W3SA 2K4IA 3VC8A 4ECZA 2HOIA 2JEJA 3OSNA 4QZCA 2BGWA 3RBEA 5AI8A 4BWJA 1ZQ1C 4DS4A 1XO0A 8ICHA 5J2FA 3HKZF 5DG9A 4RQ0A 3Q8LA 5DQGA 4DFMA 3IHQB 2I9GA 1Z4OA 4KLUA 3K1RB 4FZLA 2JEIA 1VJ5A 5CJ7A 4DQRA 4IQVA 3KZIU 1ZQYA 2LI6A 8ICJA 5KG4A 4RQ4A 7ICNA 2YMQA 3AQEA 1F0MA 1WUDA 4K4HA 2LPEA 2RQ5A 3MGHA 7ICGA 4ELVA 1N56A 4DQPA 3IG5A 2KZ3A 4EX6A 5CWRA 4IL6U 4UAWA 5H2FU 5KFYA 8ICOA 4QZBA 3PW7A 7ICRA 5J0TA 3N4MB 2HOQA 4Y2RA 5AKLA 9ICRA 5IIJA 2JZBA 5ALIA 4QZGA 3C28A 1ZJMA 3O0FA 2WB1F 4Y2VA 4DQIA 5DB7A 4PZOA 2Q0ZX 2BPGA 4KMUA 3PMLA 4DOCA 1L3TA 5AM1A 4RNOA 4UB2A 3PVXA 4M9JA 3HKZC 1PUZA 1LKYB 2WF7A 4RNMA 5TZVA 5KT2A 2KN7A 4DFPA 3L5KA 2HI0A 4F5RA 2GH1A 4C4SA 3RJFA 4Q8EA 3NVVA 5EE9A 1U45A 5KAFU 2YMLA 4QJFB 7ICMA 4QNLA 2YB1A 5L9XA 4ZOHC 2D8CA 7ICHA 2BQ3A 1QLNA 2XY7A 2ZIUA 5J0UA 3SI8A 4KTQA 1NNLA 1J2MA 2NRWA 2ZTDA 2HOFA 4TURA 3V6KA 2E8OA 4EBDA 4J9OA 4CRXA 3MGVA 2RRDA 4JWNA 1TAQA 4RQ6A 1QQ5A 2OWOA 3GIMA 4DS5A 3WKCA 2C22A 5J2EA 3BZCA 2Z7JA 2KIWA 3BS7A 2YMPA 2BQUA 5AK6A 4NJ8A 2F44A 4BGDA 4ECSA 5AKEA 2VA8A 5KFJA 4C80A 1Q8KA 3H8JA 1HUZA 1IV8A 4F4WA 4QW9A 1FO4A 3PW2A 1N63A 2DFLA 3JPNA 7ICLA 1IM4A 1RG6A 4J9SA 3QU2A 1NOMA 4ECVA 3UMGA 2LMRA 3D6JA 3GZFA 4PHDA 1OXJA 4BXOA 3IG8A 3KOOA 3N7RC 2BDPA 2W3RA 4DQSA 1ZQOA 1NJZA 4HAIA 4IRKA 5J0XA 3NUQA 7ICEA 3L3FX 2W7OA 2C2RA 1SXEA 2W9CB 9ICQA 1KDHA 1TKDA 3SMVA 5CHGA 1Z1BA 5J2KA 3K75D 2WF8A 4YD1A 4P2HA 5ALEA 2F1HA 4OJOA 5IILA 5AIBA 3QUQA 2CPRA 1BPEA 5AKYA 3SEIA 4MFCA 3RRHA 4Y2QA 4KLJA 3C1ZA 4FE3A 3NVZA 3LDAA 9ICJA 2KSOA 4F71A 3QEAZ 1EXNA 3TADA 4DF4A 4B6JA 5B5EU 4QIWF 5KL8B 3H4DA 1VDVA 3F2BA 8ICZA 4KLMA 3ETLA 4XUSA 3PO5A 4X5VA 2J6SA 4YMMA 1DGSA 3TQ1A 4EYHB 2BQRA 1RXVA 1SKRA 5J0SA 1ZQPA 4PJ0U 3NTUA 2WF5A 3V7JA 4JB3A 1M6YA 3PSFA 5KFKA 4FZMA 4UAVA 5KFWA 3B0XA 1ZD2P 2EZXA 3MC1A 4DCCA 2NRXA 1RZTA 1HIWA 5AK4A 4QZ8A 1BNPA 2XICA 4P4OA 1OW5A 2HHSA 2BCRA 2AHOB 5CA7A 1S0MA 4KLSA 2G0AA 2K8BB 5KT4A 5EE1A 5KFDA 4HYKA 4CCHA 2VANA 2H3ZA 3I76A 2KMDA 5CR0A 5AM3A 2F76X 2YQEA 1ZQXA 3CW2C 3QZ7A 1S10A 4DL7A 1N2XA 2A1JA 1H38A 4KX3A 4KLGA 2FPKA 4Y2XA 2K4HA 4DL6A 2F3NA 2NRZA 1ZXIA 5ALYA 2NYVA 4O3QA 9ICFA 3ED5A 2ODGA 4RT2A 4EEKA 3T5LA 1WWVA 3PSTA 2E1FA 5KT5A 2Y1IA 2HHWA 3UM9A 5DG7A 2YTUA 1D8BA 1PK1B 2P35A 3QUCA 2GLEA 3ZDBA 3BQ7A 4AYBF 1ZQUA 2ISOA 1ZRNA 1A77A 3V7KA 2E8NA 4YMNA 4F5QA 4KLTA 1ZD5A 4C8MA 9ICEA 2KZMA 1XSNA 9ICNA 4M0AA 2EZYA 4UBCA 1ZQGA 4JV1A 2ZIXA 3G6VA 2G5IB 1T3QA 8ICLA 3LVWA 1FIQA 2K4EA 3AU2A 2MUTB 1BVSA 5ALLA 2KEYA 4NXZA 5BOMA 3AM9A 3SR6A 4M9LA 4I29A 2JRZA 3SV3A 4O0IA 2VIXA 2Y0SC 1ECWA 2PXIA 5G5HA 1D9FA 2KNJA 1TAUA 5IINA 2WHEA 1A6SA 5ALXA 4BXOB 3M7DA 5J2BA 8ICIA 3RH6A 5KFCA 5BOLA 1N61A 1SV0C 5J2JA 1Q3UA 4KLIA 4O3PA 2KKPA 2G09A 5AHXA 3KZXA 4JV0A 3MFHA 4QW8A 5AIAA 5AKJA 1ZQMA 1RYUA 4G9BA 4GXKA 4KLFA 3H8WA 3BQ0A 2G08A 5KFZA 2PFPA 2KIVA 3ZD8A 1GO3F 3MR3A 1NKBA 1ZQDA 1SL1A 4O3RA 2BHNA 4ICAA 4QWAA 2CRXA 3AL0B 2MSNA 4BJQA 1T7PA 2MA1A 1ZQNA 2ASLA 1S8OA 5KG6A 4EENA 4F72A 5HHHA 1BPZA 1WCNA 3RRGA 1NJWA 2FJ6A 2V4RA 3B9JA 5AKIA 2BCVA 3TFSA 2Q4TA 4G3IA 5KFNA 4J9RA 3ORYA 3NVWA 1IXRA 4DO9A 4EZ6A 3E2EA 5AKZA 2HHXA 2HHQA 2J6TA 1N5WA 2JEGA 2KJ8A 1WCLA 2HVHA 1NZBA 2NRVA 4OJLA 3RB4A 2DL0A 3ALRA 3V6JA 4RQ8A 2ZUDA 2WF6A 1KFSA 1LKYA 4B9TA 1ZQAA 3M8SA 7ICSA 1TK5A 1XU4A 5DLFA 3MR5A 4I2JA 3OGUA 4DFKA 1ZQEA 4RQNA 1NJYA 3BS5A 4YQWA 4R66A 1MQ2A 1SWWA 1O08A 2N1RA 1XSPA 3F5AA 5KFAA 3OTQA 5J0RA 3OJSA 3F2DA 2RHFA 2HW3A 3RR7A 3BJYA 1A76A 3WKAA 1PVPA 4I28A 5AI6A 4ECXA 7ICPA 5IIOA 2GWSA 3E0FA 1X9SA 5J8YC 2CN1A 4RQ1A 1XNSA 1ZYQA 1IG6A 4FBUA 4OJ6A 4Y2JA 1P7DA 2W7PA 3ISBA 7ICQA 4DL4A 4YP3A 4JUZA 4KN4A 1QSSA 1ZRMA 8ICQA 3Q8PB 1MSWD 1IIPA 2JEFA 4BWMA 4O5CA 4UATA 5HNKA 4NV0A 5CB1A 2FLNA 1JROA 5EOZA 2MU2A 5DBCA 3RB3A 3PR5B 3G6XA 5AI9A 4DSJA 1KTQA 4DLGA 4UB1A 8ICWA 1ZQWA 4I2BA 3CRXA 2UVRA 4J9NA 4Q43A 4B9MA 2UVVA 1UCVA 4R8UA 1RYRA 2OEHA 2JH7A 4KLDA 3KHHA 5AKXA 4OJ5A 1J2NA 2A1JB 1UQVA 2KE7A 1SKSA 2R8KA 2VA2A 3PW4A 1KFTA 4MFFA 2WAQC 4TUSA 3WK7A 5J8YA 3N28A 4IR9A 4NM2A 3AUOA 2EQYA 1QQ7A 3KHRA 5ALUA 2OM6A 1Z4NA 4DOBA 4GXIA 4RQ5A 1F44A 1SIJA 2PMZF 3Q8KA 2FE9A 3TAPA 3TANA 1V9PA 1L7OA 4ED8A 3WKBA 3GU3A 3C2LA 1ZQHA 2LBOA 1T3NA 3AEVA 4DL2A 3FM9A 4USAA 1SZPA 1DOQA 1DK2A 3AN1A 4MFAA 5K4LA 1K1SA 3ZI4A 4ED0A 2ZTCA 3BQTA 5FP0A 1OUQA 2ES6A 4I2IA 4Z6EA 3KHGA 1U49A 2I1QA 3WK6A 2G07A 4GFJA 4U7CA 2ASDA 5KG3A 3QEBZ 3NS1A 1LVHA 9ICOA 2ZIWB 1S77D 1VLBA 1WYGA 2H3VA 3BDPA 5ALSA 3LWLA 5DLGA 2AXTU 3GDXA 1RDFA 2QB0B 3Q8SB 4NLGA 5KFPA 3WKDA 2IOFK 3GV5B 1PK3A 4F4KA 3E58A 2OYYA 1N48A 4Y2TA 3HWTA 2M9NA 3F5EA 4RQ2A 4RT3A 1L5UA 1DGJA 2PMZC 4I2FA 2HDOA 5ALFA 2IBKA 2AJQA 2JR5A 2EANA 3WK9A 4P4MA 1ZQBA 5J2AA 4RNNA 2QB1A 4B9LA 2W11A 2JHDA 4Y2PA 3T5KA 2C2DA 3QU5A 3IM1A 2XI9A 4FBTA 1S76D 1ZQIA 1S5LU 1RQNA 1L7PA 1S97A 4AYBC 8ICMA 4NLCA 3N97B 4F50A 1DRGA 5ALKA 4UB4A 2AGOA 5DQHA 3UXOA 3RH4A 2E8PA 1SL2A 5AK3A 2NV3A 5KFTA 5ALOA 2A3VA 2PI5A 2HMXA 3M9NB 3H0RB 2HHUA 2UVUA 3B0YA 4US9A 4Z6FA 1T94A 3SAFA 2F2AB 3T5HA 2UVWA 3PZPA 2ZTEA 3MFIA 3SYZA 3Q8MA 3A0BU
chains in the Genus database with same CATH topology
2DKZA 1PK1B 1SV0A 2GLEA 3H8MA 3TACB 5JRTA 3BQ7A 2KSOA 4NL9C 2E8NA 3TADA 2E8OA 1DXSA 2KG5A 1SGGA 4RQMA 2ES6A 1WWUA 1V38A 3K1RB 2B6GA 1SV4A 1PK1A 2ESEA 2EAPA 2D3DA 1F0MA 2F8KA 3BS7A 2LPEA 4IS7A 2QB0B 4NJ8A 2DL0A 5J8YC 2F44A 3KKAC 4MHVA 1PK3A 5KNIA 2JV3A 1LKYA 4PZNA 1X66A 1UCVA 3BS5B 1OW5A 1KW4A 3SENA 1RG6A 1JI7A 2EANA 2EAOA 2K4PA 2QARB 2QKQA 2QB1A 1B4FA 1Z1VA 1UQVA 2KE7A 2KMDA 2LMRA 2DKXA 4RQNA 2K60A 5J8YA 1OXJA 3BS5A 3HILA 1SV0C 5L1MA 4PZOA 5F3XB 1X40A 3KKAA 1SXDA 4NL9A 2E8MA 2F3NA 5JU5A 1SXEA 2EAMA 2E8PA 2KSOB 2FE9A 2Y9UA 1LKYB 1X9XA 1V85A 2KIVA 2L5YA 2QB0A 1WWVA 3SEIA 3TADC 2QARA 2D8CA 1B0XA 5JTIA 2Y9TA 1COKA 2YTUA 3IDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKZ A;  1PK1 B;  1SV0 A;  2GLE A;  3H8M A;  3TAC B;  5JRT A;  3BQ7 A;  2KSO A;  4NL9 C;  2E8N A;  3TAD A;  2E8O A;  1DXS A;  2KG5 A;  1SGG A;  4RQM A;  2ES6 A;  1WWU A;  1V38 A;  3K1R B;  2B6G A;  1SV4 A;  1PK1 A;  2ESE A;  2EAP A;  2D3D A;  1F0M A;  2F8K A;  3BS7 A;  2LPE A;  4IS7 A;  2QB0 B;  4NJ8 A;  2DL0 A;  5J8Y C;  2F44 A;  3KKA C;  4MHV A;  1PK3 A;  5KNI A;  2JV3 A;  1LKY A;  4PZN A;  1X66 A;  1UCV A;  3BS5 B;  1OW5 A;  1KW4 A;  3SEN A;  1RG6 A;  1JI7 A;  2EAN A;  2EAO A;  2K4P A;  2QAR B;  2QKQ A;  2QB1 A;  1B4F A;  1Z1V A;  1UQV A;  2KE7 A;  2KMD A;  2LMR A;  2DKX A;  4RQN A;  2K60 A;  5J8Y A;  1OXJ A;  3BS5 A;  3HIL A;  1SV0 C;  5L1M A;  4PZO A;  5F3X B;  1X40 A;  3KKA A;  1SXD A;  4NL9 A;  2E8M A;  2F3N A;  5JU5 A;  1SXE A;  2EAM A;  2E8P A;  2KSO B;  2FE9 A;  2Y9U A;  1LKY B;  1X9X A;  1V85 A;  2KIV A;  2L5Y A;  2QB0 A;  1WWV A;  3SEI A;  3TAD C;  2QAR A;  2D8C A;  1B0X A;  5JTI A;  2Y9T A;  1COK A;  2YTU A;  3IDW A; 
#chains in the Genus database with same CATH topology
 3D2Q A;  5GTI U;  5AKG A;  4M47 A;  2W9M A;  3M1Y A;  5KT6 A;  2KVS A;  5ALP A;  5AKK A;  1DXS A;  2W9B A;  4RPY A;  3ZDA A;  5E79 U;  1K1Q A;  4DL3 A;  1S9F A;  3H4B A;  1X6J A;  3NAS A;  4F2S A;  2DF4 B;  2M0N A;  2ALZ A;  5JUM A;  3H7I A;  1BPD A;  1SZH A;  3BZK A;  5ALV A;  3RR8 A;  1KQQ A;  2F8K A;  2LYH A;  9ICX A;  5AM4 A;  4F91 B;  3OJU A;  1U48 A;  4DQQ A;  2GOL A;  3IRU A;  1FEZ A;  2XVT A;  2ASJ A;  2I5H A;  2YY6 A;  1TK0 A;  4F93 B;  3EUB 2;  5DGB A;  3JPP A;  3THV A;  3H8S A;  1XO1 A;  1NK9 A;  2WFA A;  4F2R A;  1QSY A;  4YR2 A;  2PFN A;  3GII A;  1T4G A;  4Q8F A;  5BPC A;  4RUA A;  4QZF A;  1RQL A;  4YN4 A;  5DDY A;  2QKQ A;  3M9O B;  1UA1 A;  4NLB A;  1Z1V A;  2W8L A;  2IA6 A;  3PSP A;  3TKA A;  1NK5 A;  1YZ6 A;  3M9M B;  3M8R A;  3RJG A;  3G6Y A;  2VJ4 A;  5J0W A;  1U4B A;  1ZQQ A;  3FC4 A;  4Q45 A;  3KKA A;  4ED6 A;  1SXD A;  7ICJ A;  5JU5 A;  4TUQ A;  9ICG A;  5KG0 A;  4Z6C A;  3WU2 U;  4UQG A;  4AP9 A;  5HP4 A;  4M04 A;  3C5G A;  3SAH A;  1V85 A;  4NY8 A;  4LJX A;  4DL5 A;  1ZQJ A;  3JPQ A;  3KFU F;  5ALQ A;  5J0O A;  1B0X A;  4RU9 A;  1JRP A;  1Q46 A;  4F3O A;  5ALZ A;  2W8K A;  1COO A;  5KTQ A;  3TAC B;  1TFR A;  4F5P A;  5JRT A;  1ZQR A;  7ICV A;  2LM4 A;  4NL9 C;  1SL0 A;  2W9C A;  1U9L A;  2F1I A;  2ZIU B;  5KFO A;  3DEE A;  4J9L A;  2FMP A;  2F77 X;  4KLL A;  3LK9 A;  4ECR A;  5EE3 A;  3DDH A;  5ALD A;  7ICT A;  2RDJ A;  5KFQ A;  4JV2 A;  2OXO A;  2ISP A;  3GIJ A;  1NJX A;  1NK0 A;  3EW9 A;  4M9G A;  3WKE A;  2ZUB A;  4XQ8 A;  3S6J A;  4KLQ A;  4UB6 U;  3H0M B;  4J9P A;  2XY6 A;  2ATL A;  1JX4 A;  3QZ8 A;  3EYZ A;  2BZF A;  2KHQ A;  4J9M A;  2XID A;  4PL1 A;  3AMZ A;  1JI7 A;  4F4Y A;  2EAO A;  4DEZ A;  4NLK A;  4TUP A;  5G5G A;  1ED1 A;  3N7S C;  9ICI A;  2BCQ A;  3BQ2 A;  4CF5 A;  2J6U A;  2FMS A;  5ALG A;  4KLH A;  4NM1 A;  3GQC A;  5F3X B;  5HHI A;  2ZG6 A;  4BX9 C;  2MUT A;  2EAM A;  2E1E A;  3RJJ A;  4YCX A;  9ICS A;  1HUO A;  3H0L B;  4PGQ A;  4IQT A;  8ICC A;  4QZI A;  5J0P A;  1KSP A;  4DSI A;  4CNQ A;  4UB3 A;  9ICH A;  3F53 A;  3PO4 A;  1X42 A;  3K4G A;  1X6I A;  2BDU A;  3UMC A;  4YXM A;  2HBJ A;  4ELU A;  3NVY A;  4GXJ A;  4O5K A;  5EE0 A;  4M9N A;  4KN7 A;  5KFV A;  3PW5 A;  4PHP A;  5J2G A;  1KKX A;  2E3T A;  9ICK A;  5KFR A;  3HPO A;  3T79 A;  4YG2 A;  3UXN A;  1SV4 A;  3D2S A;  1QTM A;  4TQR A;  2O6K A;  4UBB A;  5KFS A;  4IR1 A;  4O3O A;  4B9V A;  9ICP A;  4ED2 A;  2B21 A;  2ZXH A;  4F92 B;  8ICT A;  3LVV A;  3KHL A;  2W9A A;  3JPT A;  3EWA A;  4U6P A;  2KTQ A;  2WF9 A;  3KTQ A;  4YFK A;  2BCU A;  1ZJN A;  4C4T A;  2WTF A;  4ELT A;  4R63 A;  1KW4 A;  2BCS A;  2XGP A;  2H3Q A;  4IRD A;  9ICU A;  3SEN A;  3SQI A;  3ZDE A;  9ICA A;  4IQU A;  1NK8 A;  7ICU A;  2FDR A;  2DKX A;  3CYM A;  4PH5 A;  1L3S A;  3PV8 A;  5TIS U;  5ALJ A;  2BPF A;  3AQF A;  4NLN A;  1AQ6 A;  3C2K A;  2VKQ A;  1Y88 A;  5DG8 A;  3TAQ A;  4PPX A;  1BPY A;  1D9D A;  1HJP A;  5KFB A;  4Z6D A;  2KOB A;  2JGA A;  2LKY A;  2XO7 A;  4KX5 A;  1SWV A;  4O3N A;  4EEY A;  5AM0 A;  3I28 A;  2NO4 A;  3QX7 A;  2IHN A;  4NLZ A;  3MR6 A;  3SV4 A;  4GC6 A;  1T8E A;  4QWB A;  7ICI A;  4RPZ A;  7ICK A;  3RAX A;  8ICS A;  2PI4 A;  3HT3 A;  4JWM A;  9ICM A;  2DUY A;  2IOF A;  2NRT A;  4EEL A;  3FAH A;  1JXE A;  3MAB A;  1DK3 A;  2V9W A;  8ICX A;  3SD7 A;  2I6X A;  3RTV A;  4ECW A;  4KMO B;  2K8C B;  3HP6 A;  4YR0 A;  3ETR A;  5KFG A;  2YMM A;  2V4Q A;  2OCE A;  4CF4 A;  2ESE A;  2D3D A;  2HSZ A;  2H5X A;  2YB4 A;  5KAI U;  1NK7 A;  1ZD3 A;  5ALW A;  1MN8 A;  2KV2 A;  4M6W A;  4MHV A;  2KZZ A;  4CDG A;  4PZN A;  1KFD A;  4PGY A;  4M6W B;  2OH2 A;  2W04 A;  4M9H A;  2FLP A;  1MQ3 A;  5KFU A;  2EH9 A;  3KD3 A;  5DB6 A;  5KT3 A;  1ZQL A;  3Q8R B;  2KK0 A;  2KIC A;  4QZH A;  2K60 A;  4C8K A;  3ISD A;  3UQ0 A;  2AGP A;  4RZR A;  3EPI A;  5L1M A;  1X40 A;  3IN5 A;  2W9B B;  3L4P A;  4B9N A;  8ICB A;  2Y0S F;  4ECU A;  1JN3 A;  2HBL A;  3BQ1 A;  1J97 A;  3SZ2 A;  2KSO B;  3F2C A;  7ICF A;  4O3M A;  5GTH U;  1ZQZ A;  1NK4 A;  1UT8 A;  3ISC A;  4XRH A;  5A0L A;  4R65 A;  1RM6 C;  7ICO A;  3ICX A;  2Y1J A;  5KFH A;  1PZN A;  1ZQC A;  1L7N A;  4FS2 A;  4DSF A;  1JUD A;  5AIC A;  2Y9T A;  2DKZ A;  5J2I A;  5KG7 A;  2XCA A;  2JMG A;  5AK5 A;  4UAU A;  1TV9 A;  1NZP A;  1RYS A;  5J29 A;  1TVA A;  3RF9 A;  2QLT A;  1XSL A;  3V6H A;  5DGA A;  4P0Q A;  2E5S A;  2EZZ A;  5KL1 B;  3RFA A;  4RQM A;  4QWD A;  4F4X A;  5CEH A;  1PVQ A;  2HCF A;  3M6Z A;  3MR2 A;  3QU7 A;  4O3S A;  2WAQ F;  3UXP A;  2DPJ A;  4EBE A;  3PX6 A;  1XWL A;  3GV7 B;  2R8G A;  4Y2U A;  1ARO P;  2HBK A;  4MEX A;  3MDA A;  1CI4 A;  3OHB A;  1MA7 A;  2CXY A;  1JIH A;  4FS1 A;  4JK1 A;  5AM5 A;  1UPH A;  1NI3 A;  1MC8 A;  1TE2 A;  1CUK A;  3T3F A;  1K5O A;  2DBY A;  4ECT A;  4B9U A;  2DQN B;  2P6U A;  4WJ3 B;  4C8L A;  5L1J A;  5DBB A;  4YMO A;  1FFU A;  4R8U B;  2XGQ A;  1D8Y A;  4O9M A;  2PFQ A;  2XY5 A;  1KBU A;  1D8L A;  3HIL A;  3LYS A;  2RLT A;  3OPX A;  3ZDD A;  2LYB A;  4J9Q A;  1FFV A;  4F5N A;  3QUB A;  2FI1 A;  4BDP A;  3RJH A;  2C28 A;  4YVZ A;  8ICF A;  1L6N A;  8ICN A;  4QWE A;  4QZD A;  5KT7 A;  5KFE A;  2W55 A;  3Q8Q B;  1JXL A;  1BGX T;  3CNH A;  3QU9 A;  4Y2S A;  1CRX A;  4ACO A;  2BR0 A;  5DQI A;  8ICG A;  3TAD C;  1ZQT A;  3IV6 A;  3C5F A;  2PFO A;  1ZD4 A;  4DFJ A;  5AM2 A;  3LWM A;  1ZOL A;  1SV0 A;  1LB2 B;  1BNO A;  4NWI A;  3IP4 B;  3QU4 A;  4A8E A;  2W03 A;  4EX7 A;  4CGZ A;  1N60 A;  5AKH A;  4UAS A;  5EWG A;  2KG5 A;  5KG1 A;  3C23 A;  9ICL A;  1WWU A;  4C8N A;  4F4Z A;  3UMB A;  5AI5 A;  4OCZ A;  4K4I A;  2ZIX B;  3RB6 A;  1BPB A;  2WB1 C;  2ZXI A;  3RAQ A;  3ZD9 A;  2EAP A;  8ICP A;  4LZG A;  2HVI A;  9ICT A;  1BPX A;  4I2C A;  4DSE A;  3GIL A;  3KKA C;  4TQS A;  4P0Q B;  3K1Z A;  3RJI A;  4DWI A;  4PHA A;  8ICY A;  2FMQ A;  4ECQ A;  2DGZ A;  4E0D A;  2R8H A;  3BS5 B;  3PMN A;  5KFF A;  4DF8 A;  3V72 A;  1A0P A;  4ZH4 A;  5J2D A;  4RQ3 A;  2KFZ A;  3GFK B;  3WK5 A;  1L7M A;  4DLE A;  5D46 A;  4ED3 A;  8ICE A;  4OO1 J;  3M6K A;  2KJ9 A;  2JZB B;  1XC9 A;  2XCP A;  5DKW A;  5HR6 A;  4UAY A;  4BUG A;  2ZJ5 A;  4RPX A;  2K89 A;  3N7P D;  4NL9 A;  2FPL A;  2F1J A;  4I2E A;  1B43 A;  4DSK A;  2Y9U A;  2BPC A;  4IC9 A;  5HMM A;  4Q44 A;  1ZET A;  3SAG A;  4FFD A;  1QQ6 A;  5J0Q A;  2R18 A;  2IOH A;  3EPG A;  1SB3 C;  5JTI A;  3C2M A;  4PL2 A;  2BKE A;  5EWF A;  4MF2 A;  4P0P B;  9ICW A;  4DOA A;  2A1A A;  3RB0 A;  2KP7 A;  2HBM A;  5L1I A;  2R8J A;  3JPS A;  3EZ5 A;  4CF3 A;  2B6G A;  4KLE A;  2P66 A;  4YXJ A;  5CP2 A;  2G06 A;  2AQ4 A;  5CRX A;  5KFI A;  1PK1 A;  4I2A A;  3T5J A;  4RQ7 A;  3TI0 A;  3HX0 A;  8ICA A;  1KRP A;  4ED1 A;  4M2Y A;  3PR4 A;  3J81 j;  5EWE A;  3D2N A;  1YT3 A;  1KN5 A;  4UAR A;  2VJ5 A;  4R64 A;  1S0V A;  1X9W A;  2KVC A;  4RUC A;  4LVS A;  4F5O A;  3QYP A;  3VCB A;  3MDC A;  3HJE A;  2HHV A;  2IHM A;  3C21 A;  8ICK A;  4QWC A;  3QUT A;  3PY8 A;  2K4P A;  2W43 A;  3RH5 A;  4UB8 U;  4FZN A;  4MF8 A;  2ZUC A;  1LV5 A;  2ZJA A;  4C0Z A;  3CP8 A;  1C20 A;  2H3I A;  5III A;  9ICB A;  2AQ0 A;  2D6F C;  3ONN A;  5AI0 A;  4CE6 A;  1L3V A;  1KLN A;  1S0N A;  5F9L A;  1L8L A;  3OHA A;  5DB9 A;  3PX0 A;  4QZ9 A;  4OD0 A;  1L8O A;  1JAL A;  4QIW C;  5ALN A;  2NO5 A;  5C5J A;  3PX4 A;  4P4P A;  2ZIV A;  5ALT A;  2F8L A;  1UT5 A;  5DDM A;  4IQW A;  2KKV A;  2LHT A;  5DB8 A;  4JMU A;  1WG8 A;  4KLO A;  1UA0 A;  3GIK A;  3C29 A;  2QAR A;  1RPL A;  2A19 A;  1COK A;  5L1L A;  4DFD A;  1QH9 A;  2HHT A;  1XS9 D;  3H8M A;  2FLL A;  3JPO A;  4I2H A;  3QE9 Y;  5L1K A;  5J2C A;  2P6R A;  3C1Y A;  3RJE A;  1SGG A;  2YX8 A;  2AGQ A;  2PKE A;  5IIM A;  5IIK A;  5F9N A;  2MAX A;  1QSL A;  2GO7 A;  2W54 A;  4YD2 A;  3PW0 A;  5KFM A;  3UPQ A;  1PVR A;  1Z00 A;  1C7Y A;  2ZJ8 A;  4C7Y A;  3DV9 A;  3NRW A;  2DWQ A;  4EYI B;  4GC7 A;  3WK8 A;  5KG5 A;  5KG2 A;  4C4R A;  4J03 A;  2K8A A;  1X66 A;  2JH1 A;  3RBD A;  1ZQF A;  3FYH A;  3QNM A;  1O03 A;  1F5S A;  1KL9 A;  1U47 A;  5KFL A;  2QAR B;  4GIB A;  2IMW P;  1B4F A;  3ZDC A;  5D4B A;  1Z00 B;  2ZIW A;  1JMS A;  5B66 U;  5KFX A;  2ZIV B;  3MGI A;  2KFN A;  1N62 A;  4EBC A;  1KEJ A;  2KJ5 A;  1N5X A;  4UB5 A;  2KD1 A;  2E8M A;  4OJP A;  3HW8 A;  4J9K A;  2B0C A;  1B22 A;  2RP5 A;  3PNC A;  1UHU A;  1URJ A;  5J0Y A;  1NK6 A;  5J2H A;  4F8R A;  9ICC A;  5D49 A;  3A0H U;  3HRD D;  4ECY A;  2KHV A;  3QXG A;  1L3U A;  1YZ7 A;  3I1Y A;  2QB0 A;  5DBA A;  5T14 A;  3TFR A;  2C2E A;  2XC9 A;  5HML A;  8ICV A;  3IDW A;  4C7Z A;  4O5E A;  1Q3V A;  4QZE A;  5C0Y A;  4PGX A;  4C8O A;  4UW9 A;  4I2G A;  1NKC A;  4GLX A;  1ZQK A;  3OSP A;  3H40 A;  2G5H B;  1RXW A;  2H3F A;  4PHE A;  1V38 A;  2EDU A;  5AI4 A;  3RJK A;  2FPM A;  3UQ2 A;  2JXJ A;  3FDS A;  3MBY A;  1X9M A;  5ALH A;  4EZ9 A;  4I2D A;  1V97 A;  4KIT B;  4IS7 A;  3PSI A;  5ALR A;  1ZQS A;  2AH5 A;  2LM1 A;  1CEZ A;  5KNI A;  2R8I A;  2JV3 A;  4P0P A;  4ED7 A;  4YR3 A;  4UAZ A;  1X2I A;  1Z19 A;  3JPR A;  4XA5 A;  2YN4 A;  8ICR A;  4MEY A;  1Z3E B;  8ICU A;  3AU6 A;  4K4G A;  2VA3 A;  3U26 A;  1TAM A;  1HEK A;  4LZD A;  5HR7 A;  2LYA A;  4US8 A;  3NRZ A;  2OHF A;  1S0O A;  2AU0 A;  1SKW A;  4QZA A;  2RDI A;  3V7L A;  3GV8 B;  2DPI A;  1TK8 A;  3WK4 A;  4FO6 A;  1NKE A;  3NGD A;  4DSL A;  5ALM A;  4B9S A;  3KBB A;  3TAR A;  2MRL A;  1X9X A;  2L5Y A;  1QCK A;  9ICV A;  3R9K A;  4IRC A;  1ZQV A;  4Y2Y A;  4I27 A;  2W3S A;  2K4I A;  3VC8 A;  4ECZ A;  2HOI A;  2JEJ A;  3OSN A;  4QZC A;  2BGW A;  3RBE A;  5AI8 A;  4BWJ A;  1ZQ1 C;  4DS4 A;  1XO0 A;  8ICH A;  5J2F A;  3HKZ F;  5DG9 A;  4RQ0 A;  3Q8L A;  5DQG A;  4DFM A;  3IHQ B;  2I9G A;  1Z4O A;  4KLU A;  3K1R B;  4FZL A;  2JEI A;  1VJ5 A;  5CJ7 A;  4DQR A;  4IQV A;  3KZI U;  1ZQY A;  2LI6 A;  8ICJ A;  5KG4 A;  4RQ4 A;  7ICN A;  2YMQ A;  3AQE A;  1F0M A;  1WUD A;  4K4H A;  2LPE A;  2RQ5 A;  3MGH A;  7ICG A;  4ELV A;  1N56 A;  4DQP A;  3IG5 A;  2KZ3 A;  4EX6 A;  5CWR A;  4IL6 U;  4UAW A;  5H2F U;  5KFY A;  8ICO A;  4QZB A;  3PW7 A;  7ICR A;  5J0T A;  3N4M B;  2HOQ A;  4Y2R A;  5AKL A;  9ICR A;  5IIJ A;  2JZB A;  5ALI A;  4QZG A;  3C28 A;  1ZJM A;  3O0F A;  2WB1 F;  4Y2V A;  4DQI A;  5DB7 A;  4PZO A;  2Q0Z X;  2BPG A;  4KMU A;  3PML A;  4DOC A;  1L3T A;  5AM1 A;  4RNO A;  4UB2 A;  3PVX A;  4M9J A;  3HKZ C;  1PUZ A;  1LKY B;  2WF7 A;  4RNM A;  5TZV A;  5KT2 A;  2KN7 A;  4DFP A;  3L5K A;  2HI0 A;  4F5R A;  2GH1 A;  4C4S A;  3RJF A;  4Q8E A;  3NVV A;  5EE9 A;  1U45 A;  5KAF U;  2YML A;  4QJF B;  7ICM A;  4QNL A;  2YB1 A;  5L9X A;  4ZOH C;  2D8C A;  7ICH A;  2BQ3 A;  1QLN A;  2XY7 A;  2ZIU A;  5J0U A;  3SI8 A;  4KTQ A;  1NNL A;  1J2M A;  2NRW A;  2ZTD A;  2HOF A;  4TUR A;  3V6K A;  2E8O A;  4EBD A;  4J9O A;  4CRX A;  3MGV A;  2RRD A;  4JWN A;  1TAQ A;  4RQ6 A;  1QQ5 A;  2OWO A;  3GIM A;  4DS5 A;  3WKC A;  2C22 A;  5J2E A;  3BZC A;  2Z7J A;  2KIW A;  3BS7 A;  2YMP A;  2BQU A;  5AK6 A;  4NJ8 A;  2F44 A;  4BGD A;  4ECS A;  5AKE A;  2VA8 A;  5KFJ A;  4C80 A;  1Q8K A;  3H8J A;  1HUZ A;  1IV8 A;  4F4W A;  4QW9 A;  1FO4 A;  3PW2 A;  1N63 A;  2DFL A;  3JPN A;  7ICL A;  1IM4 A;  1RG6 A;  4J9S A;  3QU2 A;  1NOM A;  4ECV A;  3UMG A;  2LMR A;  3D6J A;  3GZF A;  4PHD A;  1OXJ A;  4BXO A;  3IG8 A;  3KOO A;  3N7R C;  2BDP A;  2W3R A;  4DQS A;  1ZQO A;  1NJZ A;  4HAI A;  4IRK A;  5J0X A;  3NUQ A;  7ICE A;  3L3F X;  2W7O A;  2C2R A;  1SXE A;  2W9C B;  9ICQ A;  1KDH A;  1TKD A;  3SMV A;  5CHG A;  1Z1B A;  5J2K A;  3K75 D;  2WF8 A;  4YD1 A;  4P2H A;  5ALE A;  2F1H A;  4OJO A;  5IIL A;  5AIB A;  3QUQ A;  2CPR A;  1BPE A;  5AKY A;  3SEI A;  4MFC A;  3RRH A;  4Y2Q A;  4KLJ A;  3C1Z A;  4FE3 A;  3NVZ A;  3LDA A;  9ICJ A;  2KSO A;  4F71 A;  3QEA Z;  1EXN A;  3TAD A;  4DF4 A;  4B6J A;  5B5E U;  4QIW F;  5KL8 B;  3H4D A;  1VDV A;  3F2B A;  8ICZ A;  4KLM A;  3ETL A;  4XUS A;  3PO5 A;  4X5V A;  2J6S A;  4YMM A;  1DGS A;  3TQ1 A;  4EYH B;  2BQR A;  1RXV A;  1SKR A;  5J0S A;  1ZQP A;  4PJ0 U;  3NTU A;  2WF5 A;  3V7J A;  4JB3 A;  1M6Y A;  3PSF A;  5KFK A;  4FZM A;  4UAV A;  5KFW A;  3B0X A;  1ZD2 P;  2EZX A;  3MC1 A;  4DCC A;  2NRX A;  1RZT A;  1HIW A;  5AK4 A;  4QZ8 A;  1BNP A;  2XIC A;  4P4O A;  1OW5 A;  2HHS A;  2BCR A;  2AHO B;  5CA7 A;  1S0M A;  4KLS A;  2G0A A;  2K8B B;  5KT4 A;  5EE1 A;  5KFD A;  4HYK A;  4CCH A;  2VAN A;  2H3Z A;  3I76 A;  2KMD A;  5CR0 A;  5AM3 A;  2F76 X;  2YQE A;  1ZQX A;  3CW2 C;  3QZ7 A;  1S10 A;  4DL7 A;  1N2X A;  2A1J A;  1H38 A;  4KX3 A;  4KLG A;  2FPK A;  4Y2X A;  2K4H A;  4DL6 A;  2F3N A;  2NRZ A;  1ZXI A;  5ALY A;  2NYV A;  4O3Q A;  9ICF A;  3ED5 A;  2ODG A;  4RT2 A;  4EEK A;  3T5L A;  1WWV A;  3PST A;  2E1F A;  5KT5 A;  2Y1I A;  2HHW A;  3UM9 A;  5DG7 A;  2YTU A;  1D8B A;  1PK1 B;  2P35 A;  3QUC A;  2GLE A;  3ZDB A;  3BQ7 A;  4AYB F;  1ZQU A;  2ISO A;  1ZRN A;  1A77 A;  3V7K A;  2E8N A;  4YMN A;  4F5Q A;  4KLT A;  1ZD5 A;  4C8M A;  9ICE A;  2KZM A;  1XSN A;  9ICN A;  4M0A A;  2EZY A;  4UBC A;  1ZQG A;  4JV1 A;  2ZIX A;  3G6V A;  2G5I B;  1T3Q A;  8ICL A;  3LVW A;  1FIQ A;  2K4E A;  3AU2 A;  2MUT B;  1BVS A;  5ALL A;  2KEY A;  4NXZ A;  5BOM A;  3AM9 A;  3SR6 A;  4M9L A;  4I29 A;  2JRZ A;  3SV3 A;  4O0I A;  2VIX A;  2Y0S C;  1ECW A;  2PXI A;  5G5H A;  1D9F A;  2KNJ A;  1TAU A;  5IIN A;  2WHE A;  1A6S A;  5ALX A;  4BXO B;  3M7D A;  5J2B A;  8ICI A;  3RH6 A;  5KFC A;  5BOL A;  1N61 A;  1SV0 C;  5J2J A;  1Q3U A;  4KLI A;  4O3P A;  2KKP A;  2G09 A;  5AHX A;  3KZX A;  4JV0 A;  3MFH A;  4QW8 A;  5AIA A;  5AKJ A;  1ZQM A;  1RYU A;  4G9B A;  4GXK A;  4KLF A;  3H8W A;  3BQ0 A;  2G08 A;  5KFZ A;  2PFP A;  2KIV A;  3ZD8 A;  1GO3 F;  3MR3 A;  1NKB A;  1ZQD A;  1SL1 A;  4O3R A;  2BHN A;  4ICA A;  4QWA A;  2CRX A;  3AL0 B;  2MSN A;  4BJQ A;  1T7P A;  2MA1 A;  1ZQN A;  2ASL A;  1S8O A;  5KG6 A;  4EEN A;  4F72 A;  5HHH A;  1BPZ A;  1WCN A;  3RRG A;  1NJW A;  2FJ6 A;  2V4R A;  3B9J A;  5AKI A;  2BCV A;  3TFS A;  2Q4T A;  4G3I A;  5KFN A;  4J9R A;  3ORY A;  3NVW A;  1IXR A;  4DO9 A;  4EZ6 A;  3E2E A;  5AKZ A;  2HHX A;  2HHQ A;  2J6T A;  1N5W A;  2JEG A;  2KJ8 A;  1WCL A;  2HVH A;  1NZB A;  2NRV A;  4OJL A;  3RB4 A;  2DL0 A;  3ALR A;  3V6J A;  4RQ8 A;  2ZUD A;  2WF6 A;  1KFS A;  1LKY A;  4B9T A;  1ZQA A;  3M8S A;  7ICS A;  1TK5 A;  1XU4 A;  5DLF A;  3MR5 A;  4I2J A;  3OGU A;  4DFK A;  1ZQE A;  4RQN A;  1NJY A;  3BS5 A;  4YQW A;  4R66 A;  1MQ2 A;  1SWW A;  1O08 A;  2N1R A;  1XSP A;  3F5A A;  5KFA A;  3OTQ A;  5J0R A;  3OJS A;  3F2D A;  2RHF A;  2HW3 A;  3RR7 A;  3BJY A;  1A76 A;  3WKA A;  1PVP A;  4I28 A;  5AI6 A;  4ECX A;  7ICP A;  5IIO A;  2GWS A;  3E0F A;  1X9S A;  5J8Y C;  2CN1 A;  4RQ1 A;  1XNS A;  1ZYQ A;  1IG6 A;  4FBU A;  4OJ6 A;  4Y2J A;  1P7D A;  2W7P A;  3ISB A;  7ICQ A;  4DL4 A;  4YP3 A;  4JUZ A;  4KN4 A;  1QSS A;  1ZRM A;  8ICQ A;  3Q8P B;  1MSW D;  1IIP A;  2JEF A;  4BWM A;  4O5C A;  4UAT A;  5HNK A;  4NV0 A;  5CB1 A;  2FLN A;  1JRO A;  5EOZ A;  2MU2 A;  5DBC A;  3RB3 A;  3PR5 B;  3G6X A;  5AI9 A;  4DSJ A;  1KTQ A;  4DLG A;  4UB1 A;  8ICW A;  1ZQW A;  4I2B A;  3CRX A;  2UVR A;  4J9N A;  4Q43 A;  4B9M A;  2UVV A;  1UCV A;  4R8U A;  1RYR A;  2OEH A;  2JH7 A;  4KLD A;  3KHH A;  5AKX A;  4OJ5 A;  1J2N A;  2A1J B;  1UQV A;  2KE7 A;  1SKS A;  2R8K A;  2VA2 A;  3PW4 A;  1KFT A;  4MFF A;  2WAQ C;  4TUS A;  3WK7 A;  5J8Y A;  3N28 A;  4IR9 A;  4NM2 A;  3AUO A;  2EQY A;  1QQ7 A;  3KHR A;  5ALU A;  2OM6 A;  1Z4N A;  4DOB A;  4GXI A;  4RQ5 A;  1F44 A;  1SIJ A;  2PMZ F;  3Q8K A;  2FE9 A;  3TAP A;  3TAN A;  1V9P A;  1L7O A;  4ED8 A;  3WKB A;  3GU3 A;  3C2L A;  1ZQH A;  2LBO A;  1T3N A;  3AEV A;  4DL2 A;  3FM9 A;  4USA A;  1SZP A;  1DOQ A;  1DK2 A;  3AN1 A;  4MFA A;  5K4L A;  1K1S A;  3ZI4 A;  4ED0 A;  2ZTC A;  3BQT A;  5FP0 A;  1OUQ A;  2ES6 A;  4I2I A;  4Z6E A;  3KHG A;  1U49 A;  2I1Q A;  3WK6 A;  2G07 A;  4GFJ A;  4U7C A;  2ASD A;  5KG3 A;  3QEB Z;  3NS1 A;  1LVH A;  9ICO A;  2ZIW B;  1S77 D;  1VLB A;  1WYG A;  2H3V A;  3BDP A;  5ALS A;  3LWL A;  5DLG A;  2AXT U;  3GDX A;  1RDF A;  2QB0 B;  3Q8S B;  4NLG A;  5KFP A;  3WKD A;  2IOF K;  3GV5 B;  1PK3 A;  4F4K A;  3E58 A;  2OYY A;  1N48 A;  4Y2T A;  3HWT A;  2M9N A;  3F5E A;  4RQ2 A;  4RT3 A;  1L5U A;  1DGJ A;  2PMZ C;  4I2F A;  2HDO A;  5ALF A;  2IBK A;  2AJQ A;  2JR5 A;  2EAN A;  3WK9 A;  4P4M A;  1ZQB A;  5J2A A;  4RNN A;  2QB1 A;  4B9L A;  2W11 A;  2JHD A;  4Y2P A;  3T5K A;  2C2D A;  3QU5 A;  3IM1 A;  2XI9 A;  4FBT A;  1S76 D;  1ZQI A;  1S5L U;  1RQN A;  1L7P A;  1S97 A;  4AYB C;  8ICM A;  4NLC A;  3N97 B;  4F50 A;  1DRG A;  5ALK A;  4UB4 A;  2AGO A;  5DQH A;  3UXO A;  3RH4 A;  2E8P A;  1SL2 A;  5AK3 A;  2NV3 A;  5KFT A;  5ALO A;  2A3V A;  2PI5 A;  2HMX A;  3M9N B;  3H0R B;  2HHU A;  2UVU A;  3B0Y A;  4US9 A;  4Z6F A;  1T94 A;  3SAF A;  2F2A B;  3T5H A;  2UVW A;  3PZP A;  2ZTE A;  3MFI A;  3SYZ A;  3Q8M A;  3A0B U; 
#chains in the Genus database with same CATH homology
 2DKZ A;  1PK1 B;  1SV0 A;  2GLE A;  3H8M A;  3TAC B;  5JRT A;  3BQ7 A;  2KSO A;  4NL9 C;  2E8N A;  3TAD A;  2E8O A;  1DXS A;  2KG5 A;  1SGG A;  4RQM A;  2ES6 A;  1WWU A;  1V38 A;  3K1R B;  2B6G A;  1SV4 A;  1PK1 A;  2ESE A;  2EAP A;  2D3D A;  1F0M A;  2F8K A;  3BS7 A;  2LPE A;  4IS7 A;  2QB0 B;  4NJ8 A;  2DL0 A;  5J8Y C;  2F44 A;  3KKA C;  4MHV A;  1PK3 A;  5KNI A;  2JV3 A;  1LKY A;  4PZN A;  1X66 A;  1UCV A;  3BS5 B;  1OW5 A;  1KW4 A;  3SEN A;  1RG6 A;  1JI7 A;  2EAN A;  2EAO A;  2K4P A;  2QAR B;  2QKQ A;  2QB1 A;  1B4F A;  1Z1V A;  1UQV A;  2KE7 A;  2KMD A;  2LMR A;  2DKX A;  4RQN A;  2K60 A;  5J8Y A;  1OXJ A;  3BS5 A;  3HIL A;  1SV0 C;  5L1M A;  4PZO A;  5F3X B;  1X40 A;  3KKA A;  1SXD A;  4NL9 A;  2E8M A;  2F3N A;  5JU5 A;  1SXE A;  2EAM A;  2E8P A;  2KSO B;  2FE9 A;  2Y9U A;  1LKY B;  1X9X A;  1V85 A;  2KIV A;  2L5Y A;  2QB0 A;  1WWV A;  3SEI A;  3TAD C;  2QAR A;  2D8C A;  1B0X A;  5JTI A;  2Y9T A;  1COK A;  2YTU A;  3IDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...