1SGGA

The solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
YTSFNTVDEWLDAIKMSQYKESFASAGFTTFDIVSQMTVEDILRVGVTLAGHQKKILNSIQVMRAQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tyrosine-protein kinase
molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Solution structure of the receptor tyrosine kinase EphB2 SAM domain and identification of two distinct homotypic interaction sites.
pubmed rcsb
source organism Gallus gallus
total genus 12
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sggA00
3TADC 1PK3A 5F3XB 1WWUA 1V38A 1SXDA 1OW5A 3K1RB 4RQNA 2QB0B 3BS5B 1SGGA 5J8YA 2D8CA 2KE7A 1B0XA 2F44A 1X9XA 2LMRA 2ES6A 1PK1A 2F8KA 2DL0A 1LKYA 3IDWA 3HILA 5JTIA 2DKZA 2K4PA 2EAMA 2QB0A 2QB1A 4NJ8A 3BS5A 5KNIA 1B4FA 2E8OA 1WWVA 2KSOB 2Y9TA 2QARB 3SENA 5L1MA 1RG6A 2K60A 1SV0C 2KG5A 1F0MA 1OXJA 4NL9C 1DXSA 2E8NA 2Y9UA 2EAPA 1KW4A 2QKQA 1Z1VA 2E8PA 4MHVA 1PK1B 2D3DA 3KKAC 1X40A 2LPEA 1LKYB 1SV0A 1SXEA 2L5YA 1X66A 1SV4A 1V85A 4NL9A 2DKXA 5JRTA 2KIVA 4RQMA 2E8MA 3SEIA 4PZNA 5JU5A 4IS7A 2F3NA 3KKAA 2GLEA 4PZOA 3BS7A 1UQVA 2JV3A 5J8YC 3TACB 2EANA 1UCVA 1COKA 3H8MA 1JI7A 3BQ7A 2YTUA 2KSOA 2ESEA 3TADA 2QARA 2KMDA 2EAOA 2FE9A 2B6GA
chains in the Genus database with same CATH superfamily
4FE3A 1X9SA 2RLTA 3FAHA 2KFZA 4USAA 1DRGA 4ED8A 3DEEA 1Z00A 1SGGA 4BJQA 1UT5A 2ALZA 1RDFA 3BDPA 2VKQA 3HP6A 4M9LA 2CXYA 5KT6A 5ALUA 4ECWA 2LMRA 4J03A 2KZZA 4DFPA 2YMMA 4DQIA 5DLGA 3I76A 2KZ3A 2NRXA 4YXMA 4YMOA 3AU6A 4YQWA 2A19A 1LV5A 2MRLA 8ICTA 3F5AA 2CRXA 5DBAA 2EZZA 2PXIA 8ICFA 3SENA 3FM9A 2IOFA 5J0RA 1XSLA 2H3FA 4UB1A 3V7JA 3PW2A 2AQ0A 3HW8A 1SZHA 4GXJA 5J0XA 4FZMA 2E8NA 1PVRA 1U48A 5AM5A 5AK4A 1SZPA 3OHAA 4QIWC 5J0WA 5CHGA 4DQQA 5KG2A 2W9CA 3TAQA 2WB1C 1Z19A 5KAIU 5IIJA 4C4SA 5AK5A 8ICGA 4DS4A 3RJFA 1TK5A 2K8CB 1NK9A 1Z4OA 2C2DA 4IQVA 1N63A 2F1IA 5AM2A 2XCAA 5G5HA 2JV3A 3ETLA 3J81j 5ALNA 1ZQIA 3MFHA 3G6YA 1J2NA 2KSOA 5CJ7A 2AGPA 2HHQA 3KBBA 3PR4A 3E58A 4J9SA 3AUOA 5DB8A 1UA0A 1MA7A 2D6FC 5K4LA 3JPOA 1K1SA 4EYHB 4F2RA 2DBYA 3SV4A 1ZQCA 1N56A 1UPHA 2OM6A 4DL3A 5AI5A 1N5WA 1S9FA 1L3TA 2WFAA 8ICCA 1L7PA 3V6JA 2D8CA 4F71A 5HR6A 1QQ6A 4BDPA 3BQTA 1VLBA 4QIWF 3SQIA 1MQ2A 4Y2RA 2HI0A 4US8A 4OJ5A 2HDOA 9ICWA 4DOAA 4CNQA 2W43A 2XO7A 5JTIA 2I9GA 4QW8A 1JRPA 2ZIUA 4KLDA 2XGPA 3NVVA 4LZDA 3H8WA 1ZQJA 2HBMA 3FDSA 1FO4A 3C1ZA 5GTHU 3I28A 2QARB 1EXNA 4UW9A 5AKIA 9ICQA 4ED7A 3KOOA 3C2MA 3PVXA 1SV0C 2G0AA 4QZAA 2GH1A 3PSPA 2W55A 1KKXA 4J9KA 5DG9A 2K4EA 3QU5A 2K4IA 3KHGA 3N7RC 2FPKA 5KTQA 4C8OA 3U26A 4KLQA 2OH2A 1KEJA 3SV3A 1CI4A 4DQSA 2PI4A 1RYUA 2FPMA 3N7SC 1LB2B 1IM4A 2DKXA 1X2IA 3RJGA 2F76X 4A8EA 2MAXA 4F3OA 4DQPA 3SEIA 3LDAA 4HYKA 2R8KA 3Q8LA 2YY6A 1ZQSA 8ICUA 2KVCA 3M9OB 3QX7A 3RJKA 1ZQDA 1U4BA 1J2MA 4I2JA 4KLLA 1D9FA 4OO1J 4FS1A 1RYRA 2FMQA 5ALKA 1ZQMA 2RQ5A 2OXOA 4P0PB 2ASDA 4M9HA 1JXEA 3QU2A 4YXJA 2PI5A 4UB2A 3QXGA 4F4YA 2JZBB 5DGAA 4J9PA 3T5JA 1OW5A 4F4ZA 4CF3A 7ICPA 1IV8A 3PY8A 3IN5A 3Q8PB 2WF6A 3NS1A 4KITB 3OJUA 2F8LA 2KKVA 4TURA 2HVHA 4DFKA 3UMBA 4EX6A 1U47A 5KFAA 5C5JA 3NASA 5AKYA 4Y2YA 5AI4A 1JALA 5ALFA 7ICMA 1F5SA 8ICJA 3C2LA 1L7OA 2JGAA 4YP3A 4R8UA 2BDPA 4Y2TA 3GV5B 5KFSA 3UQ2A 2HHTA 1Z3EB 5DG7A 2AU0A 8ICWA 2DWQA 2J6SA 1SIJA 4EELA 4GIBA 2RDJA 2HHSA 5FP0A 1N5XA 2Z7JA 1NK8A 2KV2A 3H0LB 3I1YA 2QKQA 4I2BA 1HEKA 3MBYA 4PJ0U 5J0SA 2UVVA 1LKYB 3IP4B 4YD2A 1YZ6A 4M9GA 7ICEA 4CGZA 4QZ8A 5KFQA 3SYZA 4O5EA 3H7IA 4QWEA 1DOQA 2W11A 4DF8A 1A0PA 3D6JA 1O08A 4J9NA 4MFCA 3ETRA 3EYZA 3TFSA 1CUKA 4PZNA 4F93B 3MGHA 4B9LA 2WF9A 3ZD8A 3L4PA 4UB5A 1BPEA 1UCVA 4O5KA 5ALZA 1PUZA 4PL1A 4DWIA 2ZUCA 3NUQA 4NM2A 1DGJA 1VDVA 1WWUA 2FJ6A 4CE6A 4DL2A 4C4TA 4IL6U 1NZPA 5KFEA 3WK9A 2PFNA 2AXTU 4UATA 2LYBA 2OCEA 1NI3A 4RQ5A 2ES6A 2PFQA 4I27A 2DFLA 2EQYA 1ZQXA 4QW9A 5AICA 2AH5A 4P2HA 5J2EA 4C80A 4WJ3B 1F44A 1JMSA 2Q4TA 5KG4A 1L5UA 1BPBA 3T5HA 3WK7A 4Z6FA 3UXPA 1KDHA 3KZIU 3EPIA 2YQEA 4DL6A 1XU4A 2KICA 3SI8A 2W8KA 4IRDA 4DSFA 5AKGA 4EENA 1DXSA 2NO5A 3MR2A 8ICVA 1BVSA 2KN7A 1IIPA 2ASLA 4OD0A 1Q3UA 4GLXA 4LVSA 3KKAC 4I29A 4Z6DA 2W7PA 1T3QA 2FDRA 3QEAZ 4LJXA 1DK3A 5KFCA 1ZQAA 2H3IA 1K1QA 2B0CA 2ZTCA 4C8NA 1QLNA 1WG8A 2BZFA 5EWGA 5J0TA 4JV1A 5IIOA 3H0RB 4KLSA 5KFHA 3BQ7A 1JN3A 4O3RA 4IRKA 5EWFA 2C2EA 2ISPA 5F9NA 5ALTA 1WCNA 3ISBA 4NV0A 4DO9A 3LWLA 1V38A 3WKAA 2IBKA 7ICIA 2W3RA 4MF8A 5J2BA 5DDMA 5ALEA 1PVPA 3HT3A 3LYSA 1QSYA 3N7PD 4PHEA 1T4GA 4RUAA 2BCVA 3R9KA 2IHMA 4ED3A 4MF2A 3BZCA 3WKDA 1SWWA 5AI9A 2ZJ5A 5ALOA 5D4BA 4ED0A 2E5SA 5J2DA 4F5OA 2NRZA 1Q8KA 3ZI4A 5EOZA 4F5PA 5KNIA 2AHOB 5DQIA 7ICGA 2XC9A 3WU2U 3HJEA 3JPQA 4J9LA 4F72A 3NVWA 5J0YA 3OJSA 4P4OA 3RR8A 3NTUA 3RB3A 1PZNA 1MSWD 5KG0A 1X9WA 4TUPA 1L3SA 2YB4A 4M6WB 1NKEA 4U7CA 1QTMA 2PFOA 1ECWA 4M9NA 2VA2A 1FFVA 5CEHA 5KT7A 3WKBA 5KT3A 4FZNA 4C8MA 3GU3A 1FEZA 3HKZF 5AKKA 1QSLA 1V85A 4B9TA 7ICKA 2HHVA 5J0QA 5AM3A 4YD1A 3K1ZA 4PGYA 3S6JA 5KFPA 4QJFB 2OYYA 3NGDA 2C28A 3EW9A 4ECTA 4Q43A 2YB1A 4ED2A 3FC4A 1LVHA 4B9VA 3RJJA 2XY5A 2E3TA 4KTQA 1X6IA 5DDYA 3T3FA 2Q0ZX 2YTUA 4UAUA 1MQ3A 3AL0B 5IIIA 5IILA 4TUQA 2ZJ8A 2FMPA 4EEYA 3MDAA 1ZD2P 4B9SA 2IHNA 4NLZA 4BXOB 1KSPA 5D49A 3RH6A 3RBEA 1ZQBA 4ELUA 3CNHA 2IMWP 4QZHA 2HBLA 2VANA 4RQ7A 4QWCA 1ZQLA 3JPPA 5KG5A 3LVVA 2BGWA 4I2DA 4RNNA 3HILA 2JHDA 1ZQTA 1XO0A 4P0PA 4DFMA 9ICFA 4JUZA 3ICXA 4NLNA 2JZBA 4UBCA 4DF4A 2JEFA 4QZBA 5ALMA 3WK6A 4F91B 3EWAA 1B4FA 4QZIA 3PW5A 5L1JA 1FFUA 2K60A 2G06A 1NOMA 2DQNB 5EE9A 2ZUBA 5KFIA 5TISU 1RYSA 3SMVA 3PMNA 9ICRA 4DSKA 3GQCA 2FLNA 2JMGA 3PSIA 9ICTA 1SV0A 2KP7A 4UAYA 1SXEA 4XA5A 1X66A 5DB7A 4KLEA 1KTQA 3ZD9A 5J29A 8ICAA 3H4BA 4JB3A 1ZQYA 2F2AB 2OWOA 4CF5A 3V72A 4C8LA 1BNPA 3OHBA 4KX5A 1D9DA 2ATLA 4QZGA 3RR7A 4KLMA 2W9BB 8ICXA 3Q8RB 2KMDA 3B0XA 3KHRA 2XI9A 2BHNA 4BUGA 3BQ2A 4RPXA 7ICRA 2ZIXB 1ZQZA 3RFAA 1A76A 2GWSA 5J0PA 1V9PA 1D8LA 2KIWA 7ICVA 1NZBA 9ICOA 9ICXA 2KJ5A 4OJ6A 9ICEA 5KFJA 4Q8EA 4EX7A 3ZDDA 2F8KA 2DL0A 1KN5A 4EYIB 1BPXA 4UAVA 3MR5A 5BPCA 1ZYQA 2EDUA 4UB8U 2C22A 2DKZA 4Z6CA 4QWAA 1Z4NA 5KT5A 2G5IB 2NYVA 3O0FA 4FBUA 4I2AA 2WF5A 4B9MA 4R66A 7ICLA 1ZQGA 5J2GA 2YN4A 1Q46A 3ISCA 3THVA 3M9NB 2ZTDA 4QZ9A 1U49A 3T79A 3ORYA 2NRWA 4DLEA 3G6VA 1ZRMA 4C7YA 3L5KA 1M6YA 1J97A 1Z1VA 3RB6A 2C2RA 4NXZA 3UMCA 5HHHA 3LVWA 1RM6C 1SV4A 5KFUA 1TKDA 2P35A 2KD1A 4EBDA 4B6JA 1QH9A 4Q8FA 3QUQA 4CCHA 3TKAA 4Y2PA 3KHHA 3N28A 2NRTA 1D8YA 2GLEA 3C1YA 4FFDA 2NRVA 1K5OA 3BS7A 3TACB 5J2AA 5CWRA 2KKPA 3BJYA 3UXOA 2G5HB 2ZXHA 3ONNA 5AKHA 3QU4A 2K8BB 2JEJA 1AQ6A 4DL4A 1SXDA 3Q8KA 4RQNA 4ED1A 3RH5A 5AHXA 2BR0A 2BCSA 4RQ1A 4JWNA 3RB0A 4KLTA 1SL1A 1ED1A 1XS9D 5DB9A 2F77X 3RB4A 5CA7A 4DOCA 4UB6U 5ALLA 3PX6A 5AM4A 2R18A 4OCZA 1S0NA 4O3QA 1NKBA 4C7ZA 5ALVA 4NLCA 2KNJA 5G5GA 3MGIA 4PGQA 4GC6A 1JROA 3EZ5A 4ECVA 4O9MA 4ECXA 1QCKA 1RXWA 5DB6A 3PZPA 4UB4A 5IIKA 5AKEA 4I2CA 2KG5A 5KFGA 4FS2A 9ICCA 2M0NA 5KAFU 3RAQA 3PO5A 3GFKB 1T94A 4PGXA 1KW4A 3F2BA 9ICPA 3PO4A 4CRXA 3RF9A 2RP5A 2ZIWB 1KFTA 2E1EA 4LZGA 9ICMA 1ZQEA 2P6UA 3PW4A 5HP4A 1ZQNA 3IG5A 2W9AA 4DSJA 4RQMA 5A0LA 1WCLA 5HMLA 4F4WA 4M0AA 5B5EU 2LM1A 1RZTA 3KKAA 1NJWA 2NO4A 1A77A 2V4QA 4MFFA 2OEHA 2WHEA 5KFBA 8ICMA 1MN8A 5AM1A 1JUDA 4DS5A 4IR9A 3RJEA 4E0DA 5E79U 2G09A 3H8JA 4PHPA 2HOIA 2QB0B 2K8AA 5L9XA 5CP2A 1S8OA 1IXRA 1SB3C 8ICSA 4KLOA 2I5HA 2JRZA 1X9XA 9ICVA 1PK1A 1KQQA 1T3NA 2AJQA 1OUQA 3QUBA 3PW0A 4RPYA 5CR0A 1DK2A 2KJ8A 2XIDA 3QU9A 2G08A 9ICIA 3H8SA 4G9BA 3RTVA 2JH1A 2PKEA 2BPCA 3C28A 4NJ8A 4ZH4A 9ICGA 4KX3A 2ZUDA 5GTIU 3C23A 2KSOB 4DSLA 5L1MA 5ALPA 2VIXA 4RZRA 5HHIA 1RG6A 3RRHA 1L6NA 1TAUA 3VCBA 4ECRA 3KZXA 4F50A 1ZQFA 4PHDA 3M9MB 2J6TA 1S0VA 4HAIA 3GIIA 7ICQA 4NL9C 3PW7A 3T5KA 2QLTA 4DFJA 3SAGA 3DDHA 5EE3A 2HOQA 4DOBA 2W8LA 2XY7A 2EZYA 5KFWA 1ZQVA 4PL2A 5ALIA 5KFDA 4GXIA 4J9QA 2HHWA 3GIMA 2HBJA 4P4PA 1YZ7A 5JRTA 4ECSA 1HUOA 2GOLA 2FLLA 3SR6A 5KFKA 4IS7A 4O5CA 3BQ1A 1D8BA 3M1YA 1UQVA 1S97A 2RDIA 4RQ3A 1L8OA 3A0HU 1VJ5A 5AK6A 3IV6A 5J2JA 1HIWA 2FE9A 4IRCA 4NLGA 2FMSA 1PK3A 3PV8A 1IG6A 4IR1A 2I6XA 5L1KA 4DSIA 3BS5B 2BCQA 5KFNA 3GV8B 1TK8A 2MUTB 5DLFA 4F5RA 2W9BA 3M6ZA 5DKWA 4IC9A 3MR3A 4DQRA 4AP9A 1S0MA 2ZIXA 3DV9A 5KFTA 1KRPA 1ZQUA 4YFKA 3QNMA 4I2HA 2EAMA 3F5EA 3QEBZ 4DL5A 3JPTA 2DPJA 1NJYA 2ZXIA 2EZXA 2Y9TA 2ODGA 3HKZC 3TI0A 4JV0A 2K4HA 3PSFA 5L1IA 3ZDEA 2VA8A 3C21A 5KFZA 4R65A 5HMMA 4Q45A 1JX4A 2ZG6A 5J0UA 4F92B 1S77D 4IQUA 4JMUA 4QWDA 1NK4A 8ICRA 4AYBC 5ALQA 4I2GA 5ALWA 1XSPA 3H4DA 5DG8A 3G6XA 4I28A 1UT8A 4F5NA 3TARA 4IQWA 2R8HA 4GC7A 9ICJA 4M04A 5HR7A 2O6KA 4PZOA 2R8JA 3SAFA 5CRXA 5ALXA 4EBCA 2AQ4A 2BPGA 1ZQPA 4MEXA 4QZDA 3TADA 5ALGA 2QARA 4QZFA 4R64A 1DGSA 5KFMA 8ICEA 2PMZF 8ICOA 2BQRA 4ED6A 4OJOA 8ICYA 3KD3A 4EEKA 1ZD4A 2KJ9A 2VJ4A 1BPDA 4F2SA 2XCPA 5F9LA 4GXKA 5KT4A 3NRZA 4OJLA 2HHXA 2KE7A 1XNSA 4DFDA 3NRWA 4AYBF 2BKEA 3ZDCA 1ZJNA 1Q3VA 4J9OA 2LBOA 4CF4A 4J9MA 3F2DA 1U45A 3ISDA 4YCXA 1NJZA 1ZRNA 3AM9A 4GFJA 1TV9A 5DBBA 1N61A 5DGBA 4O3SA 1Y88A 1RXVA 4NLKA 3HRDD 1ZETA 1TAMA 2A1JB 5AI0A 4NWIA 2YX8A 4YR2A 5KFXA 1NJXA 1S10A 4RNOA 4YR3A 2W54A 1C20A 5KL1B 2EAPA 3TANA 4X5VA 2BCUA 3RBDA 4KMOB 5EE1A 3C5FA 2HW3A 4QNLA 3AU2A 3N4MB 1RQLA 1C7YA 2DGZA 7ICUA 4UAZA 5J0OA 4O3NA 3T5LA 2IA6A 1PVQA 3ZDAA 2KVSA 2FLPA 4JK1A 1N2XA 4I2IA 1CEZA 2WTFA 4ELVA 2W9MA 2ZIVB 4RT3A 5J8YC 2EANA 4TQRA 2ZIWA 3CP8A 3D2NA 4FZLA 3K4GA 1XC9A 1ZJMA 4P0QB 2CN1A 1TK0A 3TADC 2F1JA 3OSPA 5AI6A 4KN4A 1XSNA 3PX4A 3K1RB 5BOLA 3L3FX 4RPZA 2JH7A 1ZXIA 4I2FA 3KTQA 1L7NA 4IQTA 4UAWA 5AIBA 1L3VA 4Y2XA 1LKYA 4TQSA 1ZOLA 3C5GA 1QQ5A 4KLUA 4Y2QA 2G07A 2B21A 2QB0A 4G3IA 3UXNA 4I2EA 1O03A 3MGVA 2CPRA 2E8OA 5JUMA 3OPXA 5EE0A 3SAHA 5AI8A 5KG6A 3SD7A 4B9UA 3WK4A 4BX9C 4RNMA 4M9JA 3AN1A 2F1HA 4UASA 4QWBA 2AGOA 5IIMA 2LI6A 7ICJA 1ZQ1C 3Q8MA 2R8GA 2Y9UA 2FPLA 2KZMA 3E0FA 2EH9A 2ISOA 4BWMA 3IHQB 3E2EA 2JEGA 1RPLA 5T14A 2Y1JA 3QZ8A 1N60A 5AKJA 3ED5A 4O3OA 4C0ZA 4ACOA 1WYGA 5KFLA 2BQUA 8ICQA 1NK7A 2A3VA 4KN7A 1SKWA 3V6HA 1TFRA 3PMLA 2WB1F 1URJA 1FIQA 1KLNA 3V7KA 4J9RA 3QE9Y 4Q44A 3QUTA 9ICUA 4DLGA 1ZQOA 3HX0A 4FBTA 2KFNA 5KFVA 5BOMA 4Z6EA 4KLFA 3HWTA 2XGQA 2XICA 1X9MA 3RJIA 5KFRA 7ICNA 1RQNA 3GILA 1MC8A 1L7MA 1UHUA 5D46A 2KTQA 2K4PA 9ICSA 8ICZA 2LHTA 3BS5A 5AKLA 1B22A 2H3ZA 3V6KA 3PR5B 5L1LA 1WWVA 4UB3A 2H5XA 3CW2C 2HBKA 4QZEA 2MUTA 3WKCA 3MC1A 2OHFA 3K75D 4P4MA 3AQFA 4YG2A 1U9LA 1F0MA 2WF8A 3WK5A 4US9A 4ZOHC 2ZTEA 3HPOA 9ICBA 2D3DA 2I1QA 2LPEA 2BPFA 1SL2A 1KFDA 4KLHA 4TUSA 1BGXT 3M8SA 4XQ8A 1KFSA 4RQ4A 8ICIA 3UM9A 4NL9A 2NV3A 1GO3F 3UMGA 2KHQA 5ALRA 1N62A 3LWMA 1SKRA 3D2SA 1Z00B 3B0YA 4K4HA 5JU5A 4DSEA 4QZCA 4F4XA 2W04A 2M9NA 1SKSA 4F8RA 1BPYA 2J6UA 3QUCA 3OSNA 4O3MA 5F3XB 1T8EA 2W3SA 5J2FA 2H3QA 5KG7A 4M2YA 2KOBA 3AMZA 9ICNA 3IM1A 1B43A 1T7PA 2VJ5A 4M6WA 2XVTA 5AM0A 2V9WA 4RQ2A 3WK8A 3MABA 3GDXA 2HVIA 3IRUA 4F4KA 2MSNA 3NVYA 4K4IA 3IDWA 2ZJAA 4Y2JA 7ICTA 4M47A 5KFYA 5C0YA 3C2KA 2WAQC 3AEVA 4C8KA 2QB1A 4O0IA 2WF7A 4JV2A 8ICKA 2W9CB 9ICAA 1A6SA 1NNLA 8ICPA 3KFUF 8ICLA 4ECYA 4C4RA 5KT2A 4YVZA 1QSSA 4F5QA 1OXJA 2LM4A 4YMMA 4B9NA 2Y1IA 3GV7B 1YT3A 1COOA 5ALJA 5AK3A 4RQ0A 4YR0A 4BXOA 2IOFK 4OJPA 2A1JA 5KL8B 5KFFA 3M6KA 4PH5A 4RQ6A 3PNCA 4DEZA 5AKXA 5ALHA 2E8MA 5DQGA 3H40A 2W03A 4DL7A 1UA1A 1BNOA 2FI1A 1S0OA 2KEYA 2WAQF 1V97A 4EZ6A 4XRHA 1JI7A 3H8MA 4U6PA 2BQ3A 4YMNA 1WUDA 2B6GA 3SZ2A 3MFIA 4PHAA 1L8LA 2PFPA 1JIHA 1S76D 4Y2UA 2ZIUB 5J2KA 2E1FA 2JR5A 4JWMA 5J2IA 3BZKA 1ZD3A 3RH4A 4NLBA 1B0XA 2ZIVA 5ALSA 3KHLA 2JXJA 1NK5A 3ZDBA 2BCRA 9ICHA 2P6RA 1X42A 1BPZA 3BQ0A 2RRDA 4MFAA 2Y0SC 3H0MB 8ICHA 4P0QA 2W7OA 3GZFA 5KG3A 5ALYA 2ASJA 7ICSA 2A1AA 3D2QA 4RQ8A 4CDGA 4UBBA 1ZQQA 1CRXA 1HJPA 1SL0A 2V4RA 4BGDA 3GIJA 4KLJA 2HOFA 1H38A 3EUB2 2MU2A 1SWVA 3FYHA 1XO1A 3UQ0A 3RRGA 4RT2A 4ECQA 3PX0A 4FO6A 1NK0A 2K89A 3Q8QB 1Z1BA 3LK9A 5AIAA 3RAXA 4ICAA 9ICKA 1KBUA 5DBCA 2YMLA 3RJHA 2LYHA 3TQ1A 2PMZC 4MEYA 3JPNA 3A0BU 2IOHA 1QQ7A 2L5YA 5KG1A 1XWLA 3M7DA 2N1RA 3AQEA 3JPSA 4ELTA 3M8RA 3V7LA 1ZQKA 2KIVA 3C29A 1S5LU 2Y0SF 5KFOA 1P7DA 3EPGA 4DCCA 5DQHA 2UVRA 1HUZA 2R8IA 4RUCA 1JXLA 1ZQHA 3QU7A 5CB1A 8ICBA 4EZ9A 3CRXA 1COKA 2ESEA 5IINA 7ICHA 1TAQA 3F2CA 4ECZA 1ZQRA 2BDUA 2KK0A 2UVWA 1KL9A 4UARA 3MDCA 4R8UB 4R63A 5H2FU 5J8YA 1L3UA 3IG8A 3PSTA 3B9JA 2GO7A 2F44A 1NK6A 2H3VA 4Y2SA 5B66U 1ZD5A 3N97B 1N48A 5J2HA 2HMXA 2MA1A 4NY8A 4PPXA 1X6JA 5J2CA 4NM1A 2KHVA 2P66A 2RHFA 2JEIA 3QZ7A 2AGQA 2DF4B 2VA3A 3F53A 3TFRA 4KMUA 3ALRA 2HHUA 4K4GA 3MR6A 1AROP 2LKYA 3VC8A 5EWEA 5AKZA 4ECUA 3NVZA 3OTQA 4Y2VA 2DPIA 4KLGA 3JPRA 5TZVA 2E8PA 4MHVA 4XUSA 4KLIA 1PK1B 2YMPA 1X40A 3Q8SB 1TE2A 3QYPA 4RU9A 2DUYA 5HNKA 4BWJA 2XY6A 2YMQA 2LYAA 2UVUA 4UQGA 5ALDA 4O3PA 4EBEA 1NKCA 9ICLA 4YN4A 7ICFA 2HSZA 8ICNA 2F3NA 3WKEA 2HCFA 3CYMA 1ZQWA 3OGUA 1TVAA 3GIKA 3UPQA 2EAOA 7ICOA 3TAPA
chains in the Genus database with same CATH topology
3TADC 1PK3A 5F3XB 1WWUA 1V38A 1SXDA 1OW5A 3K1RB 4RQNA 2QB0B 3BS5B 1SGGA 5J8YA 2D8CA 2KE7A 1B0XA 2F44A 1X9XA 2LMRA 2ES6A 1PK1A 2F8KA 2DL0A 1LKYA 3IDWA 3HILA 5JTIA 2DKZA 2K4PA 2EAMA 2QB0A 2QB1A 4NJ8A 3BS5A 5KNIA 1B4FA 2E8OA 1WWVA 2KSOB 2Y9TA 2QARB 3SENA 5L1MA 1RG6A 2K60A 1SV0C 2KG5A 1F0MA 1OXJA 4NL9C 1DXSA 2E8NA 2Y9UA 2EAPA 1KW4A 2QKQA 1Z1VA 2E8PA 4MHVA 1PK1B 2D3DA 3KKAC 1X40A 2LPEA 1LKYB 1SV0A 1SXEA 2L5YA 1X66A 1SV4A 1V85A 4NL9A 2DKXA 5JRTA 2KIVA 4RQMA 2E8MA 3SEIA 4PZNA 5JU5A 4IS7A 2F3NA 3KKAA 2GLEA 4PZOA 3BS7A 1UQVA 2JV3A 5J8YC 3TACB 2EANA 1UCVA 1COKA 3H8MA 1JI7A 3BQ7A 2YTUA 2KSOA 2ESEA 3TADA 2QARA 2KMDA 2EAOA 2FE9A 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD C;  1PK3 A;  5F3X B;  1WWU A;  1V38 A;  1SXD A;  1OW5 A;  3K1R B;  4RQN A;  2QB0 B;  3BS5 B;  1SGG A;  5J8Y A;  2D8C A;  2KE7 A;  1B0X A;  2F44 A;  1X9X A;  2LMR A;  2ES6 A;  1PK1 A;  2F8K A;  2DL0 A;  1LKY A;  3IDW A;  3HIL A;  5JTI A;  2DKZ A;  2K4P A;  2EAM A;  2QB0 A;  2QB1 A;  4NJ8 A;  3BS5 A;  5KNI A;  1B4F A;  2E8O A;  1WWV A;  2KSO B;  2Y9T A;  2QAR B;  3SEN A;  5L1M A;  1RG6 A;  2K60 A;  1SV0 C;  2KG5 A;  1F0M A;  1OXJ A;  4NL9 C;  1DXS A;  2E8N A;  2Y9U A;  2EAP A;  1KW4 A;  2QKQ A;  1Z1V A;  2E8P A;  4MHV A;  1PK1 B;  2D3D A;  3KKA C;  1X40 A;  2LPE A;  1LKY B;  1SV0 A;  1SXE A;  2L5Y A;  1X66 A;  1SV4 A;  1V85 A;  4NL9 A;  2DKX A;  5JRT A;  2KIV A;  4RQM A;  2E8M A;  3SEI A;  4PZN A;  5JU5 A;  4IS7 A;  2F3N A;  3KKA A;  2GLE A;  4PZO A;  3BS7 A;  1UQV A;  2JV3 A;  5J8Y C;  3TAC B;  2EAN A;  1UCV A;  1COK A;  3H8M A;  1JI7 A;  3BQ7 A;  2YTU A;  2KSO A;  2ESE A;  3TAD A;  2QAR A;  2KMD A;  2EAO A;  2FE9 A;  2B6G A; 
#chains in the Genus database with same CATH topology
 4FE3 A;  1X9S A;  2RLT A;  3FAH A;  2KFZ A;  4USA A;  1DRG A;  4ED8 A;  3DEE A;  1Z00 A;  1SGG A;  4BJQ A;  1UT5 A;  2ALZ A;  1RDF A;  3BDP A;  2VKQ A;  3HP6 A;  4M9L A;  2CXY A;  5KT6 A;  5ALU A;  4ECW A;  2LMR A;  4J03 A;  2KZZ A;  4DFP A;  2YMM A;  4DQI A;  5DLG A;  3I76 A;  2KZ3 A;  2NRX A;  4YXM A;  4YMO A;  3AU6 A;  4YQW A;  2A19 A;  1LV5 A;  2MRL A;  8ICT A;  3F5A A;  2CRX A;  5DBA A;  2EZZ A;  2PXI A;  8ICF A;  3SEN A;  3FM9 A;  2IOF A;  5J0R A;  1XSL A;  2H3F A;  4UB1 A;  3V7J A;  3PW2 A;  2AQ0 A;  3HW8 A;  1SZH A;  4GXJ A;  5J0X A;  4FZM A;  2E8N A;  1PVR A;  1U48 A;  5AM5 A;  5AK4 A;  1SZP A;  3OHA A;  4QIW C;  5J0W A;  5CHG A;  4DQQ A;  5KG2 A;  2W9C A;  3TAQ A;  2WB1 C;  1Z19 A;  5KAI U;  5IIJ A;  4C4S A;  5AK5 A;  8ICG A;  4DS4 A;  3RJF A;  1TK5 A;  2K8C B;  1NK9 A;  1Z4O A;  2C2D A;  4IQV A;  1N63 A;  2F1I A;  5AM2 A;  2XCA A;  5G5H A;  2JV3 A;  3ETL A;  3J81 j;  5ALN A;  1ZQI A;  3MFH A;  3G6Y A;  1J2N A;  2KSO A;  5CJ7 A;  2AGP A;  2HHQ A;  3KBB A;  3PR4 A;  3E58 A;  4J9S A;  3AUO A;  5DB8 A;  1UA0 A;  1MA7 A;  2D6F C;  5K4L A;  3JPO A;  1K1S A;  4EYH B;  4F2R A;  2DBY A;  3SV4 A;  1ZQC A;  1N56 A;  1UPH A;  2OM6 A;  4DL3 A;  5AI5 A;  1N5W A;  1S9F A;  1L3T A;  2WFA A;  8ICC A;  1L7P A;  3V6J A;  2D8C A;  4F71 A;  5HR6 A;  1QQ6 A;  4BDP A;  3BQT A;  1VLB A;  4QIW F;  3SQI A;  1MQ2 A;  4Y2R A;  2HI0 A;  4US8 A;  4OJ5 A;  2HDO A;  9ICW A;  4DOA A;  4CNQ A;  2W43 A;  2XO7 A;  5JTI A;  2I9G A;  4QW8 A;  1JRP A;  2ZIU A;  4KLD A;  2XGP A;  3NVV A;  4LZD A;  3H8W A;  1ZQJ A;  2HBM A;  3FDS A;  1FO4 A;  3C1Z A;  5GTH U;  3I28 A;  2QAR B;  1EXN A;  4UW9 A;  5AKI A;  9ICQ A;  4ED7 A;  3KOO A;  3C2M A;  3PVX A;  1SV0 C;  2G0A A;  4QZA A;  2GH1 A;  3PSP A;  2W55 A;  1KKX A;  4J9K A;  5DG9 A;  2K4E A;  3QU5 A;  2K4I A;  3KHG A;  3N7R C;  2FPK A;  5KTQ A;  4C8O A;  3U26 A;  4KLQ A;  2OH2 A;  1KEJ A;  3SV3 A;  1CI4 A;  4DQS A;  2PI4 A;  1RYU A;  2FPM A;  3N7S C;  1LB2 B;  1IM4 A;  2DKX A;  1X2I A;  3RJG A;  2F76 X;  4A8E A;  2MAX A;  4F3O A;  4DQP A;  3SEI A;  3LDA A;  4HYK A;  2R8K A;  3Q8L A;  2YY6 A;  1ZQS A;  8ICU A;  2KVC A;  3M9O B;  3QX7 A;  3RJK A;  1ZQD A;  1U4B A;  1J2M A;  4I2J A;  4KLL A;  1D9F A;  4OO1 J;  4FS1 A;  1RYR A;  2FMQ A;  5ALK A;  1ZQM A;  2RQ5 A;  2OXO A;  4P0P B;  2ASD A;  4M9H A;  1JXE A;  3QU2 A;  4YXJ A;  2PI5 A;  4UB2 A;  3QXG A;  4F4Y A;  2JZB B;  5DGA A;  4J9P A;  3T5J A;  1OW5 A;  4F4Z A;  4CF3 A;  7ICP A;  1IV8 A;  3PY8 A;  3IN5 A;  3Q8P B;  2WF6 A;  3NS1 A;  4KIT B;  3OJU A;  2F8L A;  2KKV A;  4TUR A;  2HVH A;  4DFK A;  3UMB A;  4EX6 A;  1U47 A;  5KFA A;  5C5J A;  3NAS A;  5AKY A;  4Y2Y A;  5AI4 A;  1JAL A;  5ALF A;  7ICM A;  1F5S A;  8ICJ A;  3C2L A;  1L7O A;  2JGA A;  4YP3 A;  4R8U A;  2BDP A;  4Y2T A;  3GV5 B;  5KFS A;  3UQ2 A;  2HHT A;  1Z3E B;  5DG7 A;  2AU0 A;  8ICW A;  2DWQ A;  2J6S A;  1SIJ A;  4EEL A;  4GIB A;  2RDJ A;  2HHS A;  5FP0 A;  1N5X A;  2Z7J A;  1NK8 A;  2KV2 A;  3H0L B;  3I1Y A;  2QKQ A;  4I2B A;  1HEK A;  3MBY A;  4PJ0 U;  5J0S A;  2UVV A;  1LKY B;  3IP4 B;  4YD2 A;  1YZ6 A;  4M9G A;  7ICE A;  4CGZ A;  4QZ8 A;  5KFQ A;  3SYZ A;  4O5E A;  3H7I A;  4QWE A;  1DOQ A;  2W11 A;  4DF8 A;  1A0P A;  3D6J A;  1O08 A;  4J9N A;  4MFC A;  3ETR A;  3EYZ A;  3TFS A;  1CUK A;  4PZN A;  4F93 B;  3MGH A;  4B9L A;  2WF9 A;  3ZD8 A;  3L4P A;  4UB5 A;  1BPE A;  1UCV A;  4O5K A;  5ALZ A;  1PUZ A;  4PL1 A;  4DWI A;  2ZUC A;  3NUQ A;  4NM2 A;  1DGJ A;  1VDV A;  1WWU A;  2FJ6 A;  4CE6 A;  4DL2 A;  4C4T A;  4IL6 U;  1NZP A;  5KFE A;  3WK9 A;  2PFN A;  2AXT U;  4UAT A;  2LYB A;  2OCE A;  1NI3 A;  4RQ5 A;  2ES6 A;  2PFQ A;  4I27 A;  2DFL A;  2EQY A;  1ZQX A;  4QW9 A;  5AIC A;  2AH5 A;  4P2H A;  5J2E A;  4C80 A;  4WJ3 B;  1F44 A;  1JMS A;  2Q4T A;  5KG4 A;  1L5U A;  1BPB A;  3T5H A;  3WK7 A;  4Z6F A;  3UXP A;  1KDH A;  3KZI U;  3EPI A;  2YQE A;  4DL6 A;  1XU4 A;  2KIC A;  3SI8 A;  2W8K A;  4IRD A;  4DSF A;  5AKG A;  4EEN A;  1DXS A;  2NO5 A;  3MR2 A;  8ICV A;  1BVS A;  2KN7 A;  1IIP A;  2ASL A;  4OD0 A;  1Q3U A;  4GLX A;  4LVS A;  3KKA C;  4I29 A;  4Z6D A;  2W7P A;  1T3Q A;  2FDR A;  3QEA Z;  4LJX A;  1DK3 A;  5KFC A;  1ZQA A;  2H3I A;  1K1Q A;  2B0C A;  2ZTC A;  4C8N A;  1QLN A;  1WG8 A;  2BZF A;  5EWG A;  5J0T A;  4JV1 A;  5IIO A;  3H0R B;  4KLS A;  5KFH A;  3BQ7 A;  1JN3 A;  4O3R A;  4IRK A;  5EWF A;  2C2E A;  2ISP A;  5F9N A;  5ALT A;  1WCN A;  3ISB A;  4NV0 A;  4DO9 A;  3LWL A;  1V38 A;  3WKA A;  2IBK A;  7ICI A;  2W3R A;  4MF8 A;  5J2B A;  5DDM A;  5ALE A;  1PVP A;  3HT3 A;  3LYS A;  1QSY A;  3N7P D;  4PHE A;  1T4G A;  4RUA A;  2BCV A;  3R9K A;  2IHM A;  4ED3 A;  4MF2 A;  3BZC A;  3WKD A;  1SWW A;  5AI9 A;  2ZJ5 A;  5ALO A;  5D4B A;  4ED0 A;  2E5S A;  5J2D A;  4F5O A;  2NRZ A;  1Q8K A;  3ZI4 A;  5EOZ A;  4F5P A;  5KNI A;  2AHO B;  5DQI A;  7ICG A;  2XC9 A;  3WU2 U;  3HJE A;  3JPQ A;  4J9L A;  4F72 A;  3NVW A;  5J0Y A;  3OJS A;  4P4O A;  3RR8 A;  3NTU A;  3RB3 A;  1PZN A;  1MSW D;  5KG0 A;  1X9W A;  4TUP A;  1L3S A;  2YB4 A;  4M6W B;  1NKE A;  4U7C A;  1QTM A;  2PFO A;  1ECW A;  4M9N A;  2VA2 A;  1FFV A;  5CEH A;  5KT7 A;  3WKB A;  5KT3 A;  4FZN A;  4C8M A;  3GU3 A;  1FEZ A;  3HKZ F;  5AKK A;  1QSL A;  1V85 A;  4B9T A;  7ICK A;  2HHV A;  5J0Q A;  5AM3 A;  4YD1 A;  3K1Z A;  4PGY A;  3S6J A;  5KFP A;  4QJF B;  2OYY A;  3NGD A;  2C28 A;  3EW9 A;  4ECT A;  4Q43 A;  2YB1 A;  4ED2 A;  3FC4 A;  1LVH A;  4B9V A;  3RJJ A;  2XY5 A;  2E3T A;  4KTQ A;  1X6I A;  5DDY A;  3T3F A;  2Q0Z X;  2YTU A;  4UAU A;  1MQ3 A;  3AL0 B;  5III A;  5IIL A;  4TUQ A;  2ZJ8 A;  2FMP A;  4EEY A;  3MDA A;  1ZD2 P;  4B9S A;  2IHN A;  4NLZ A;  4BXO B;  1KSP A;  5D49 A;  3RH6 A;  3RBE A;  1ZQB A;  4ELU A;  3CNH A;  2IMW P;  4QZH A;  2HBL A;  2VAN A;  4RQ7 A;  4QWC A;  1ZQL A;  3JPP A;  5KG5 A;  3LVV A;  2BGW A;  4I2D A;  4RNN A;  3HIL A;  2JHD A;  1ZQT A;  1XO0 A;  4P0P A;  4DFM A;  9ICF A;  4JUZ A;  3ICX A;  4NLN A;  2JZB A;  4UBC A;  4DF4 A;  2JEF A;  4QZB A;  5ALM A;  3WK6 A;  4F91 B;  3EWA A;  1B4F A;  4QZI A;  3PW5 A;  5L1J A;  1FFU A;  2K60 A;  2G06 A;  1NOM A;  2DQN B;  5EE9 A;  2ZUB A;  5KFI A;  5TIS U;  1RYS A;  3SMV A;  3PMN A;  9ICR A;  4DSK A;  3GQC A;  2FLN A;  2JMG A;  3PSI A;  9ICT A;  1SV0 A;  2KP7 A;  4UAY A;  1SXE A;  4XA5 A;  1X66 A;  5DB7 A;  4KLE A;  1KTQ A;  3ZD9 A;  5J29 A;  8ICA A;  3H4B A;  4JB3 A;  1ZQY A;  2F2A B;  2OWO A;  4CF5 A;  3V72 A;  4C8L A;  1BNP A;  3OHB A;  4KX5 A;  1D9D A;  2ATL A;  4QZG A;  3RR7 A;  4KLM A;  2W9B B;  8ICX A;  3Q8R B;  2KMD A;  3B0X A;  3KHR A;  2XI9 A;  2BHN A;  4BUG A;  3BQ2 A;  4RPX A;  7ICR A;  2ZIX B;  1ZQZ A;  3RFA A;  1A76 A;  2GWS A;  5J0P A;  1V9P A;  1D8L A;  2KIW A;  7ICV A;  1NZB A;  9ICO A;  9ICX A;  2KJ5 A;  4OJ6 A;  9ICE A;  5KFJ A;  4Q8E A;  4EX7 A;  3ZDD A;  2F8K A;  2DL0 A;  1KN5 A;  4EYI B;  1BPX A;  4UAV A;  3MR5 A;  5BPC A;  1ZYQ A;  2EDU A;  4UB8 U;  2C22 A;  2DKZ A;  4Z6C A;  4QWA A;  1Z4N A;  5KT5 A;  2G5I B;  2NYV A;  3O0F A;  4FBU A;  4I2A A;  2WF5 A;  4B9M A;  4R66 A;  7ICL A;  1ZQG A;  5J2G A;  2YN4 A;  1Q46 A;  3ISC A;  3THV A;  3M9N B;  2ZTD A;  4QZ9 A;  1U49 A;  3T79 A;  3ORY A;  2NRW A;  4DLE A;  3G6V A;  1ZRM A;  4C7Y A;  3L5K A;  1M6Y A;  1J97 A;  1Z1V A;  3RB6 A;  2C2R A;  4NXZ A;  3UMC A;  5HHH A;  3LVW A;  1RM6 C;  1SV4 A;  5KFU A;  1TKD A;  2P35 A;  2KD1 A;  4EBD A;  4B6J A;  1QH9 A;  4Q8F A;  3QUQ A;  4CCH A;  3TKA A;  4Y2P A;  3KHH A;  3N28 A;  2NRT A;  1D8Y A;  2GLE A;  3C1Y A;  4FFD A;  2NRV A;  1K5O A;  3BS7 A;  3TAC B;  5J2A A;  5CWR A;  2KKP A;  3BJY A;  3UXO A;  2G5H B;  2ZXH A;  3ONN A;  5AKH A;  3QU4 A;  2K8B B;  2JEJ A;  1AQ6 A;  4DL4 A;  1SXD A;  3Q8K A;  4RQN A;  4ED1 A;  3RH5 A;  5AHX A;  2BR0 A;  2BCS A;  4RQ1 A;  4JWN A;  3RB0 A;  4KLT A;  1SL1 A;  1ED1 A;  1XS9 D;  5DB9 A;  2F77 X;  3RB4 A;  5CA7 A;  4DOC A;  4UB6 U;  5ALL A;  3PX6 A;  5AM4 A;  2R18 A;  4OCZ A;  1S0N A;  4O3Q A;  1NKB A;  4C7Z A;  5ALV A;  4NLC A;  2KNJ A;  5G5G A;  3MGI A;  4PGQ A;  4GC6 A;  1JRO A;  3EZ5 A;  4ECV A;  4O9M A;  4ECX A;  1QCK A;  1RXW A;  5DB6 A;  3PZP A;  4UB4 A;  5IIK A;  5AKE A;  4I2C A;  2KG5 A;  5KFG A;  4FS2 A;  9ICC A;  2M0N A;  5KAF U;  3RAQ A;  3PO5 A;  3GFK B;  1T94 A;  4PGX A;  1KW4 A;  3F2B A;  9ICP A;  3PO4 A;  4CRX A;  3RF9 A;  2RP5 A;  2ZIW B;  1KFT A;  2E1E A;  4LZG A;  9ICM A;  1ZQE A;  2P6U A;  3PW4 A;  5HP4 A;  1ZQN A;  3IG5 A;  2W9A A;  4DSJ A;  4RQM A;  5A0L A;  1WCL A;  5HML A;  4F4W A;  4M0A A;  5B5E U;  2LM1 A;  1RZT A;  3KKA A;  1NJW A;  2NO4 A;  1A77 A;  2V4Q A;  4MFF A;  2OEH A;  2WHE A;  5KFB A;  8ICM A;  1MN8 A;  5AM1 A;  1JUD A;  4DS5 A;  4IR9 A;  3RJE A;  4E0D A;  5E79 U;  2G09 A;  3H8J A;  4PHP A;  2HOI A;  2QB0 B;  2K8A A;  5L9X A;  5CP2 A;  1S8O A;  1IXR A;  1SB3 C;  8ICS A;  4KLO A;  2I5H A;  2JRZ A;  1X9X A;  9ICV A;  1PK1 A;  1KQQ A;  1T3N A;  2AJQ A;  1OUQ A;  3QUB A;  3PW0 A;  4RPY A;  5CR0 A;  1DK2 A;  2KJ8 A;  2XID A;  3QU9 A;  2G08 A;  9ICI A;  3H8S A;  4G9B A;  3RTV A;  2JH1 A;  2PKE A;  2BPC A;  3C28 A;  4NJ8 A;  4ZH4 A;  9ICG A;  4KX3 A;  2ZUD A;  5GTI U;  3C23 A;  2KSO B;  4DSL A;  5L1M A;  5ALP A;  2VIX A;  4RZR A;  5HHI A;  1RG6 A;  3RRH A;  1L6N A;  1TAU A;  3VCB A;  4ECR A;  3KZX A;  4F50 A;  1ZQF A;  4PHD A;  3M9M B;  2J6T A;  1S0V A;  4HAI A;  3GII A;  7ICQ A;  4NL9 C;  3PW7 A;  3T5K A;  2QLT A;  4DFJ A;  3SAG A;  3DDH A;  5EE3 A;  2HOQ A;  4DOB A;  2W8L A;  2XY7 A;  2EZY A;  5KFW A;  1ZQV A;  4PL2 A;  5ALI A;  5KFD A;  4GXI A;  4J9Q A;  2HHW A;  3GIM A;  2HBJ A;  4P4P A;  1YZ7 A;  5JRT A;  4ECS A;  1HUO A;  2GOL A;  2FLL A;  3SR6 A;  5KFK A;  4IS7 A;  4O5C A;  3BQ1 A;  1D8B A;  3M1Y A;  1UQV A;  1S97 A;  2RDI A;  4RQ3 A;  1L8O A;  3A0H U;  1VJ5 A;  5AK6 A;  3IV6 A;  5J2J A;  1HIW A;  2FE9 A;  4IRC A;  4NLG A;  2FMS A;  1PK3 A;  3PV8 A;  1IG6 A;  4IR1 A;  2I6X A;  5L1K A;  4DSI A;  3BS5 B;  2BCQ A;  5KFN A;  3GV8 B;  1TK8 A;  2MUT B;  5DLF A;  4F5R A;  2W9B A;  3M6Z A;  5DKW A;  4IC9 A;  3MR3 A;  4DQR A;  4AP9 A;  1S0M A;  2ZIX A;  3DV9 A;  5KFT A;  1KRP A;  1ZQU A;  4YFK A;  3QNM A;  4I2H A;  2EAM A;  3F5E A;  3QEB Z;  4DL5 A;  3JPT A;  2DPJ A;  1NJY A;  2ZXI A;  2EZX A;  2Y9T A;  2ODG A;  3HKZ C;  3TI0 A;  4JV0 A;  2K4H A;  3PSF A;  5L1I A;  3ZDE A;  2VA8 A;  3C21 A;  5KFZ A;  4R65 A;  5HMM A;  4Q45 A;  1JX4 A;  2ZG6 A;  5J0U A;  4F92 B;  1S77 D;  4IQU A;  4JMU A;  4QWD A;  1NK4 A;  8ICR A;  4AYB C;  5ALQ A;  4I2G A;  5ALW A;  1XSP A;  3H4D A;  5DG8 A;  3G6X A;  4I28 A;  1UT8 A;  4F5N A;  3TAR A;  4IQW A;  2R8H A;  4GC7 A;  9ICJ A;  4M04 A;  5HR7 A;  2O6K A;  4PZO A;  2R8J A;  3SAF A;  5CRX A;  5ALX A;  4EBC A;  2AQ4 A;  2BPG A;  1ZQP A;  4MEX A;  4QZD A;  3TAD A;  5ALG A;  2QAR A;  4QZF A;  4R64 A;  1DGS A;  5KFM A;  8ICE A;  2PMZ F;  8ICO A;  2BQR A;  4ED6 A;  4OJO A;  8ICY A;  3KD3 A;  4EEK A;  1ZD4 A;  2KJ9 A;  2VJ4 A;  1BPD A;  4F2S A;  2XCP A;  5F9L A;  4GXK A;  5KT4 A;  3NRZ A;  4OJL A;  2HHX A;  2KE7 A;  1XNS A;  4DFD A;  3NRW A;  4AYB F;  2BKE A;  3ZDC A;  1ZJN A;  1Q3V A;  4J9O A;  2LBO A;  4CF4 A;  4J9M A;  3F2D A;  1U45 A;  3ISD A;  4YCX A;  1NJZ A;  1ZRN A;  3AM9 A;  4GFJ A;  1TV9 A;  5DBB A;  1N61 A;  5DGB A;  4O3S A;  1Y88 A;  1RXV A;  4NLK A;  3HRD D;  1ZET A;  1TAM A;  2A1J B;  5AI0 A;  4NWI A;  2YX8 A;  4YR2 A;  5KFX A;  1NJX A;  1S10 A;  4RNO A;  4YR3 A;  2W54 A;  1C20 A;  5KL1 B;  2EAP A;  3TAN A;  4X5V A;  2BCU A;  3RBD A;  4KMO B;  5EE1 A;  3C5F A;  2HW3 A;  4QNL A;  3AU2 A;  3N4M B;  1RQL A;  1C7Y A;  2DGZ A;  7ICU A;  4UAZ A;  5J0O A;  4O3N A;  3T5L A;  2IA6 A;  1PVQ A;  3ZDA A;  2KVS A;  2FLP A;  4JK1 A;  1N2X A;  4I2I A;  1CEZ A;  2WTF A;  4ELV A;  2W9M A;  2ZIV B;  4RT3 A;  5J8Y C;  2EAN A;  4TQR A;  2ZIW A;  3CP8 A;  3D2N A;  4FZL A;  3K4G A;  1XC9 A;  1ZJM A;  4P0Q B;  2CN1 A;  1TK0 A;  3TAD C;  2F1J A;  3OSP A;  5AI6 A;  4KN4 A;  1XSN A;  3PX4 A;  3K1R B;  5BOL A;  3L3F X;  4RPZ A;  2JH7 A;  1ZXI A;  4I2F A;  3KTQ A;  1L7N A;  4IQT A;  4UAW A;  5AIB A;  1L3V A;  4Y2X A;  1LKY A;  4TQS A;  1ZOL A;  3C5G A;  1QQ5 A;  4KLU A;  4Y2Q A;  2G07 A;  2B21 A;  2QB0 A;  4G3I A;  3UXN A;  4I2E A;  1O03 A;  3MGV A;  2CPR A;  2E8O A;  5JUM A;  3OPX A;  5EE0 A;  3SAH A;  5AI8 A;  5KG6 A;  3SD7 A;  4B9U A;  3WK4 A;  4BX9 C;  4RNM A;  4M9J A;  3AN1 A;  2F1H A;  4UAS A;  4QWB A;  2AGO A;  5IIM A;  2LI6 A;  7ICJ A;  1ZQ1 C;  3Q8M A;  2R8G A;  2Y9U A;  2FPL A;  2KZM A;  3E0F A;  2EH9 A;  2ISO A;  4BWM A;  3IHQ B;  3E2E A;  2JEG A;  1RPL A;  5T14 A;  2Y1J A;  3QZ8 A;  1N60 A;  5AKJ A;  3ED5 A;  4O3O A;  4C0Z A;  4ACO A;  1WYG A;  5KFL A;  2BQU A;  8ICQ A;  1NK7 A;  2A3V A;  4KN7 A;  1SKW A;  3V6H A;  1TFR A;  3PML A;  2WB1 F;  1URJ A;  1FIQ A;  1KLN A;  3V7K A;  4J9R A;  3QE9 Y;  4Q44 A;  3QUT A;  9ICU A;  4DLG A;  1ZQO A;  3HX0 A;  4FBT A;  2KFN A;  5KFV A;  5BOM A;  4Z6E A;  4KLF A;  3HWT A;  2XGQ A;  2XIC A;  1X9M A;  3RJI A;  5KFR A;  7ICN A;  1RQN A;  3GIL A;  1MC8 A;  1L7M A;  1UHU A;  5D46 A;  2KTQ A;  2K4P A;  9ICS A;  8ICZ A;  2LHT A;  3BS5 A;  5AKL A;  1B22 A;  2H3Z A;  3V6K A;  3PR5 B;  5L1L A;  1WWV A;  4UB3 A;  2H5X A;  3CW2 C;  2HBK A;  4QZE A;  2MUT A;  3WKC A;  3MC1 A;  2OHF A;  3K75 D;  4P4M A;  3AQF A;  4YG2 A;  1U9L A;  1F0M A;  2WF8 A;  3WK5 A;  4US9 A;  4ZOH C;  2ZTE A;  3HPO A;  9ICB A;  2D3D A;  2I1Q A;  2LPE A;  2BPF A;  1SL2 A;  1KFD A;  4KLH A;  4TUS A;  1BGX T;  3M8S A;  4XQ8 A;  1KFS A;  4RQ4 A;  8ICI A;  3UM9 A;  4NL9 A;  2NV3 A;  1GO3 F;  3UMG A;  2KHQ A;  5ALR A;  1N62 A;  3LWM A;  1SKR A;  3D2S A;  1Z00 B;  3B0Y A;  4K4H A;  5JU5 A;  4DSE A;  4QZC A;  4F4X A;  2W04 A;  2M9N A;  1SKS A;  4F8R A;  1BPY A;  2J6U A;  3QUC A;  3OSN A;  4O3M A;  5F3X B;  1T8E A;  2W3S A;  5J2F A;  2H3Q A;  5KG7 A;  4M2Y A;  2KOB A;  3AMZ A;  9ICN A;  3IM1 A;  1B43 A;  1T7P A;  2VJ5 A;  4M6W A;  2XVT A;  5AM0 A;  2V9W A;  4RQ2 A;  3WK8 A;  3MAB A;  3GDX A;  2HVI A;  3IRU A;  4F4K A;  2MSN A;  3NVY A;  4K4I A;  3IDW A;  2ZJA A;  4Y2J A;  7ICT A;  4M47 A;  5KFY A;  5C0Y A;  3C2K A;  2WAQ C;  3AEV A;  4C8K A;  2QB1 A;  4O0I A;  2WF7 A;  4JV2 A;  8ICK A;  2W9C B;  9ICA A;  1A6S A;  1NNL A;  8ICP A;  3KFU F;  8ICL A;  4ECY A;  4C4R A;  5KT2 A;  4YVZ A;  1QSS A;  4F5Q A;  1OXJ A;  2LM4 A;  4YMM A;  4B9N A;  2Y1I A;  3GV7 B;  1YT3 A;  1COO A;  5ALJ A;  5AK3 A;  4RQ0 A;  4YR0 A;  4BXO A;  2IOF K;  4OJP A;  2A1J A;  5KL8 B;  5KFF A;  3M6K A;  4PH5 A;  4RQ6 A;  3PNC A;  4DEZ A;  5AKX A;  5ALH A;  2E8M A;  5DQG A;  3H40 A;  2W03 A;  4DL7 A;  1UA1 A;  1BNO A;  2FI1 A;  1S0O A;  2KEY A;  2WAQ F;  1V97 A;  4EZ6 A;  4XRH A;  1JI7 A;  3H8M A;  4U6P A;  2BQ3 A;  4YMN A;  1WUD A;  2B6G A;  3SZ2 A;  3MFI A;  4PHA A;  1L8L A;  2PFP A;  1JIH A;  1S76 D;  4Y2U A;  2ZIU B;  5J2K A;  2E1F A;  2JR5 A;  4JWM A;  5J2I A;  3BZK A;  1ZD3 A;  3RH4 A;  4NLB A;  1B0X A;  2ZIV A;  5ALS A;  3KHL A;  2JXJ A;  1NK5 A;  3ZDB A;  2BCR A;  9ICH A;  2P6R A;  1X42 A;  1BPZ A;  3BQ0 A;  2RRD A;  4MFA A;  2Y0S C;  3H0M B;  8ICH A;  4P0Q A;  2W7O A;  3GZF A;  5KG3 A;  5ALY A;  2ASJ A;  7ICS A;  2A1A A;  3D2Q A;  4RQ8 A;  4CDG A;  4UBB A;  1ZQQ A;  1CRX A;  1HJP A;  1SL0 A;  2V4R A;  4BGD A;  3GIJ A;  4KLJ A;  2HOF A;  1H38 A;  3EUB 2;  2MU2 A;  1SWV A;  3FYH A;  1XO1 A;  3UQ0 A;  3RRG A;  4RT2 A;  4ECQ A;  3PX0 A;  4FO6 A;  1NK0 A;  2K89 A;  3Q8Q B;  1Z1B A;  3LK9 A;  5AIA A;  3RAX A;  4ICA A;  9ICK A;  1KBU A;  5DBC A;  2YML A;  3RJH A;  2LYH A;  3TQ1 A;  2PMZ C;  4MEY A;  3JPN A;  3A0B U;  2IOH A;  1QQ7 A;  2L5Y A;  5KG1 A;  1XWL A;  3M7D A;  2N1R A;  3AQE A;  3JPS A;  4ELT A;  3M8R A;  3V7L A;  1ZQK A;  2KIV A;  3C29 A;  1S5L U;  2Y0S F;  5KFO A;  1P7D A;  3EPG A;  4DCC A;  5DQH A;  2UVR A;  1HUZ A;  2R8I A;  4RUC A;  1JXL A;  1ZQH A;  3QU7 A;  5CB1 A;  8ICB A;  4EZ9 A;  3CRX A;  1COK A;  2ESE A;  5IIN A;  7ICH A;  1TAQ A;  3F2C A;  4ECZ A;  1ZQR A;  2BDU A;  2KK0 A;  2UVW A;  1KL9 A;  4UAR A;  3MDC A;  4R8U B;  4R63 A;  5H2F U;  5J8Y A;  1L3U A;  3IG8 A;  3PST A;  3B9J A;  2GO7 A;  2F44 A;  1NK6 A;  2H3V A;  4Y2S A;  5B66 U;  1ZD5 A;  3N97 B;  1N48 A;  5J2H A;  2HMX A;  2MA1 A;  4NY8 A;  4PPX A;  1X6J A;  5J2C A;  4NM1 A;  2KHV A;  2P66 A;  2RHF A;  2JEI A;  3QZ7 A;  2AGQ A;  2DF4 B;  2VA3 A;  3F53 A;  3TFR A;  4KMU A;  3ALR A;  2HHU A;  4K4G A;  3MR6 A;  1ARO P;  2LKY A;  3VC8 A;  5EWE A;  5AKZ A;  4ECU A;  3NVZ A;  3OTQ A;  4Y2V A;  2DPI A;  4KLG A;  3JPR A;  5TZV A;  2E8P A;  4MHV A;  4XUS A;  4KLI A;  1PK1 B;  2YMP A;  1X40 A;  3Q8S B;  1TE2 A;  3QYP A;  4RU9 A;  2DUY A;  5HNK A;  4BWJ A;  2XY6 A;  2YMQ A;  2LYA A;  2UVU A;  4UQG A;  5ALD A;  4O3P A;  4EBE A;  1NKC A;  9ICL A;  4YN4 A;  7ICF A;  2HSZ A;  8ICN A;  2F3N A;  3WKE A;  2HCF A;  3CYM A;  1ZQW A;  3OGU A;  1TVA A;  3GIK A;  3UPQ A;  2EAO A;  7ICO A;  3TAP A; 
#chains in the Genus database with same CATH homology
 3TAD C;  1PK3 A;  5F3X B;  1WWU A;  1V38 A;  1SXD A;  1OW5 A;  3K1R B;  4RQN A;  2QB0 B;  3BS5 B;  1SGG A;  5J8Y A;  2D8C A;  2KE7 A;  1B0X A;  2F44 A;  1X9X A;  2LMR A;  2ES6 A;  1PK1 A;  2F8K A;  2DL0 A;  1LKY A;  3IDW A;  3HIL A;  5JTI A;  2DKZ A;  2K4P A;  2EAM A;  2QB0 A;  2QB1 A;  4NJ8 A;  3BS5 A;  5KNI A;  1B4F A;  2E8O A;  1WWV A;  2KSO B;  2Y9T A;  2QAR B;  3SEN A;  5L1M A;  1RG6 A;  2K60 A;  1SV0 C;  2KG5 A;  1F0M A;  1OXJ A;  4NL9 C;  1DXS A;  2E8N A;  2Y9U A;  2EAP A;  1KW4 A;  2QKQ A;  1Z1V A;  2E8P A;  4MHV A;  1PK1 B;  2D3D A;  3KKA C;  1X40 A;  2LPE A;  1LKY B;  1SV0 A;  1SXE A;  2L5Y A;  1X66 A;  1SV4 A;  1V85 A;  4NL9 A;  2DKX A;  5JRT A;  2KIV A;  4RQM A;  2E8M A;  3SEI A;  4PZN A;  5JU5 A;  4IS7 A;  2F3N A;  3KKA A;  2GLE A;  4PZO A;  3BS7 A;  1UQV A;  2JV3 A;  5J8Y C;  3TAC B;  2EAN A;  1UCV A;  1COK A;  3H8M A;  1JI7 A;  3BQ7 A;  2YTU A;  2KSO A;  2ESE A;  3TAD A;  2QAR A;  2KMD A;  2EAO A;  2FE9 A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...