1SGGA

The solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
YTSFNTVDEWLDAIKMSQYKESFASAGFTTFDIVSQMTVEDILRVGVTLAGHQKKILNSIQVMRAQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHRIN TYPE-B RECEPTOR 2
publication title Solution structure of the receptor tyrosine kinase EphB2 SAM domain and identification of two distinct homotypic interaction sites.
pubmed rcsb
source organism Gallus gallus
molecule tags Tyrosine-protein kinase
total genus 12
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sggA00
1UCVA 2LPEA 2Y9TA 1OXJA 5JU5A 1WWVA 3KKAC 5JTIA 1Z1VA 2KG5A 2ES6A 2QB0A 2K4PA 1LKYB 1COKA 1SV4A 1SXEA 2D3DA 3SENA 2Y9UA 2LMRA 4NJ8A 1WWUA 1SGGA 3TADA 2B6GA 3HILA 2GLEA 1PK3A 2DKZA 1OW5A 3K1RB 2JV3A 4NL9C 1SV0C 2QB1A 1RG6A 2F8KA 1LKYA 2F3NA 5J8YA 5F3XB 2KE7A 4RQNA 2KSOB 1PK1B 2E8OA 5KNIA 5L1MA 2FE9A 2QARB 2F44A 1JI7A 1X40A 2KIVA 4PZNA 4MHVA 2QKQA 3H8MA 3TADC 2DL0A 1UQVA 5JRTA 2KMDA 1V85A 2E8MA 1SXDA 4RQMA 2EAMA 2ESEA 1PK1A 2DKXA 3BS5B 1SV0A 1X9XA 3TACB 4PZOA 2EANA 3SEIA 3KKAA 1V38A 2E8NA 3BQ7A 2EAPA 3IDWA 2YTUA 1X66A 2EAOA 2D8CA 2L5YA 3BS5A 2QB0B 1B0XA 3BS7A 2KSOA 1DXSA 1F0MA 4NL9A 2K60A 1B4FA 2E8PA 4IS7A 2QARA 1KW4A 5J8YC
chains in the Genus database with same CATH superfamily
2HBMA 2JH7A 9ICHA 1SL0A 2Y9TA 3AQFA 3HKZF 5DG8A 2XGQA 1L6NA 2FLLA 1KLNA 2PMZF 3SI8A 9ICLA 4C8OA 2BCVA 4F71A 4Z6EA 2KFNA 3IP4B 4ZOHC 4NY8A 1HJPA 4FZNA 1QQ6A 1JN3A 3HRDD 3ZDEA 5CWRA 4C8LA 4TUPA 3PMNA 4XUSA 3MBYA 3KHHA 4EZ6A 1CI4A 3PNCA 3IG5A 2XC9A 1XC9A 3C5FA 5L1MA 2N1RA 5KFCA 4QZBA 3F53A 5AKLA 2KJ5A 1QSYA 2QKQA 1COOA 3UXPA 3L5KA 3MDCA 2NV3A 2BGWA 5JRTA 2CPRA 4MF2A 1FFVA 5E79U 3H0RB 4J9LA 2EAMA 2YY6A 1BPXA 2Y0SC 4EZ9A 7ICRA 4EBCA 1IIPA 1YZ6A 1X9WA 5ALHA 3BQ7A 3QU7A 5KT2A 2R8HA 1KQQA 8ICQA 3TAPA 1X9MA 2RQ5A 1K1SA 1S5LU 3QNMA 4M6WB 3C23A 2HBKA 3F5AA 1KTQA 5J0YA 2G0AA 4I2BA 5J0SA 1PVPA 3PW0A 3JPTA 2W8LA 4B6JA 8ICMA 4YMMA 1ZRMA 2ZG6A 3PW2A 4NXZA 2ES6A 4EX7A 2BCQA 7ICQA 1D8LA 2OCEA 2IOFK 9ICFA 4TQSA 4NM1A 2H3QA 4RPXA 5KG1A 5ALOA 3M8SA 4R64A 2JV3A 4CGZA 5ALEA 1S0NA 1RYUA 2HSZA 4ED0A 3UM9A 5HHIA 3VC8A 5J2JA 4M6WA 1QSSA 3OJUA 5K4LA 3BQ1A 1PK1B 1NJXA 3LVWA 4YXMA 2LYBA 1TK0A 3H8JA 2OYYA 2W7PA 3F2BA 1RM6C 3N4MB 4DL4A 2W9BB 3HPOA 4OCZA 2XO7A 4QZHA 3EPGA 2WFAA 5ALRA 2AGQA 3RB0A 2A19A 3SD7A 1X6JA 4KN7A 4YQWA 1MQ3A 4RQ2A 3PR5B 2AGOA 1CUKA 4AP9A 3MR6A 4J9MA 1SL2A 3SR6A 1V38A 1T3QA 1WG8A 3IV6A 4J9QA 4CF3A 3RR8A 4DQPA 2JXJA 4RQ6A 4JV2A 1ZQUA 2ASJA 4C7ZA 2HW3A 2YQEA 4X5VA 5F9NA 4DL2A 3THVA 2JGAA 3K4GA 4P4OA 3M6ZA 2JRZA 1Q8KA 4F5NA 4UAYA 3UXOA 4F92B 5IIIA 2BQ3A 1BPDA 2ZXHA 5KFNA 5AI8A 2NO5A 5J2DA 2YN4A 4F3OA 3WK6A 3FYHA 3PVXA 3C2KA 1QH9A 5DG7A 5DB9A 3MGHA 1WYGA 1ZQPA 3GIJA 4KLFA 2WAQC 3ZDCA 3RB3A 3TAQA 4RNNA 3MGIA 4Q8FA 2Y9UA 4RPZA 1A0PA 1FEZA 4DL3A 4KLHA 3NRZA 2H3FA 3TKAA 2GH1A 3B9JA 4BUGA 5KFJA 2W8KA 1BVSA 1DK3A 5KG0A 2VA2A 4BXOB 3AUOA 5G5GA 2WTFA 2IHMA 2KHVA 2ASDA 5KT5A 3GV7B 4O3RA 4YP3A 3HT3A 3QU9A 2W04A 4O3PA 3IG8A 2ALZA 4Q8EA 4RT3A 4QZ8A 2KD1A 4GXKA 2VA3A 1NKBA 4J9RA 2E8OA 1K5OA 2J6SA 1XSLA 5KFKA 7ICMA 9ICXA 2O6KA 5DLGA 2ZUCA 4KLOA 4MFFA 1MA7A 4Y2VA 3RRGA 3QEBZ 4ELVA 4XRHA 2HHWA 2YMLA 3H0MB 1M6YA 2VKQA 2E1EA 5ALTA 1KN5A 4KLLA 8ICAA 3PSPA 2CXYA 3PX4A 4F93B 2F8LA 5IIJA 3SAFA 3AU6A 1ZYQA 1HUOA 4Q43A 3LDAA 2ZIVA 5AM4A 2WF5A 4C4RA 3M9NB 2H3VA 3KBBA 4TUQA 2VIXA 4QWEA 3Q8PB 3GIIA 3KHRA 3G6YA 4KLEA 9ICRA 3WK5A 2VJ5A 1NK5A 1NJZA 1ZQWA 4DF8A 4JWMA 4YD2A 2W9CB 3M7DA 4YR0A 1NNLA 5AHXA 5AK4A 3QUCA 2HVIA 2KIWA 5KTQA 3I28A 3B0YA 3C21A 2D6FC 3SAGA 3NUQA 5J0RA 4P4MA 5BOLA 1L7MA 1FO4A 4JV0A 3PZPA 3MABA 3QE9Y 4NLKA 4MFAA 5J0QA 3E58A 4RQ5A 4HYKA 1LKYB 3UPQA 2ASLA 5GTIU 5CB1A 2P66A 3V7JA 3LWLA 4O5EA 1HEKA 1NK4A 4EELA 3GFKB 5KFIA 4KN4A 4UQGA 4PPXA 2JEGA 2LI6A 8ICPA 1HIWA 1VJ5A 2WF7A 1D9DA 2HHQA 3MR5A 3D2QA 4R65A 4BDPA 8ICZA 1SL1A 4EX6A 1X2IA 4YD1A 5TZVA 1J2NA 2RRDA 2PMZC 4GIBA 3H4BA 1ZQOA 1PVRA 1SB3C 4DFKA 1X40A 3EPIA 5KFPA 1BNOA 5J2CA 4MFCA 2AHOB 4B9VA 3TADC 4RU9A 2KKVA 1N5WA 5B66U 5DB8A 1ZQQA 5IINA 2W3RA 5KG2A 2YMQA 2ESEA 1J2MA 3PV8A 3RAXA 2G5IB 9ICSA 5AIAA 3RH6A 1JUDA 4DQSA 4ED2A 1KEJA 4KX5A 3OHBA 2EZYA 8ICXA 4Z6CA 2W7OA 1L3UA 2ZIXA 1S77D 4GC6A 3EYZA 4DSIA 4LZDA 2R18A 8ICRA 4QZFA 1XNSA 2EH9A 4YN4A 5EE1A 5AK3A 1XO1A 4XQ8A 1Y88A 1U49A 4ECRA 1NJYA 1ZQCA 2V9WA 5J8YC 3D2NA 3AN1A 5KG3A 4PH5A 4FFDA 2YB1A 2ZJ8A 5JU5A 1TE2A 2AXTU 4FS1A 4DQRA 5DQIA 2RP5A 4P0QB 1TAMA 4F5QA 2KZMA 4BX9C 5KFHA 4AYBF 1A6SA 2NRTA 2KV2A 3T79A 2I9GA 3ZDBA 8ICCA 1A77A 2AJQA 4O3SA 4DLEA 1L7PA 4EENA 1OW5A 3K1RB 1SKWA 5CEHA 1KBUA 2IA6A 1ZQSA 2AQ0A 3S6JA 3WKCA 2EQYA 1JROA 5F3XB 4OJLA 2G5HB 2LM1A 1U48A 4U6PA 3D2SA 4YMNA 4Z6DA 3TFSA 5HMMA 5KFXA 4MEXA 2LYAA 4P4PA 1L5UA 4QNLA 4PZNA 2MU2A 2LHTA 3H8MA 4DL6A 3K75D 3QEAZ 4E0DA 1YT3A 1ZQIA 4Y2UA 5HMLA 4QZIA 2KN7A 8ICHA 9ICPA 2NRWA 5KT3A 4EYHB 3KKAA 4YFKA 4Y2SA 1H38A 4Y2JA 4Y2RA 2DPIA 3JPSA 2Z7JA 2A1AA 2V4RA 2GWSA 2FLPA 4J03A 3BS5A 2K89A 4NM2A 4RQ3A 2P6UA 4O0IA 4DEZA 1VLBA 2XY6A 1X9SA 3TQ1A 7ICSA 3PO5A 5IIKA 5EE9A 1ZJNA 3BQ2A 4J9SA 5BPCA 1IXRA 2F1IA 3H4DA 1ZQAA 2UVUA 4RQ8A 5CA7A 1Z1VA 3H40A 8ICNA 4DFPA 5KFUA 1JRPA 4CF4A 4RQ1A 2I1QA 5DGBA 3U26A 4M9NA 1UA0A 3PY8A 3AU2A 4RQ7A 5J2IA 4FZMA 1U4BA 4UB8U 4RPYA 3KOOA 4ED3A 7ICPA 1RYSA 2KEYA 3GU3A 5EWFA 5ALYA 2KSOB 7ICOA 5J0TA 4DO9A 1ED1A 1QCKA 1O03A 4RT2A 3SZ2A 1NI3A 3AL0B 3R9KA 1ZQDA 2UVWA 4DFMA 1X42A 1D8YA 4NWIA 1S97A 4DQIA 3O0FA 1B43A 1JX4A 2K8AA 4JB3A 5H2FU 3BDPA 7ICLA 5KFGA 4NLGA 3HX0A 4F91B 9ICOA 3EW9A 1RXWA 4ECYA 3HP6A 1ZQKA 5J0OA 3SV4A 1CRXA 5JUMA 2YTUA 2C2RA 3T5JA 4KLTA 7ICTA 2DPJA 4M9HA 5KAFU 3N97B 2EZZA 1NK6A 4YXJA 2W03A 2KSOA 4IQVA 3RH4A 1F0MA 4NV0A 2MAXA 1J97A 3Q8QB 4RNMA 3GDXA 2R8KA 5G5HA 4I28A 1T94A 4F2SA 5AM2A 2PXIA 1XSNA 5KFBA 3JPPA 2V4QA 3RJIA 1SV4A 1N61A 4A8EA 5IIOA 1HUZA 4I2FA 3F5EA 5KFTA 3E2EA 4JWNA 3N7SC 3PMLA 5J2HA 1WCNA 4US8A 4IRDA 1MC8A 4YMOA 3GZFA 2HHUA 5ALWA 8ICLA 3FM9A 1N63A 2KOBA 2W3SA 5ALPA 2UVRA 4PHAA 2ZIUA 3NTUA 2C2EA 2XCAA 3G6VA 4DOAA 2DGZA 2KTQA 5HP4A 4QZAA 2R8GA 2A1JA 4PGYA 2DBYA 2LBOA 2KIVA 2LM4A 4B9UA 4ZH4A 1BPBA 3VCBA 1ZQMA 2ISOA 2JMGA 2H5XA 4UB1A 4R63A 1SXDA 4RQMA 3C1YA 4K4GA 1DK2A 4FBTA 4GXJA 4RQ4A 2YMMA 2BCRA 3TACB 4NLZA 1OUQA 2EDUA 1ZQGA 5KFLA 3C2LA 5D49A 5DBCA 2M9NA 4OJOA 2Y1IA 3CYMA 1BPZA 1X66A 2FI1A 2XICA 4Y2TA 1NKEA 1UT8A 1Z19A 3GV8B 5EE0A 4C4TA 5AK6A 1TK8A 2OEHA 4ECQA 1T8EA 2VA8A 1QLNA 1NK8A 3BZCA 4JK1A 4BWJA 3NVYA 2CN1A 3Q8SB 1WWVA 5J0XA 3JPQA 2BCSA 2JH1A 2K4PA 5ALJA 4DFJA 2BZFA 1ZQLA 2ZIWA 4O3OA 4ED7A 2E3TA 2OM6A 4G9BA 4OJ5A 5L9XA 1K1QA 1DGSA 3ISBA 5F9LA 3CNHA 4DS5A 4UW9A 3RAQA 2PI4A 4RUCA 4UB2A 4ICAA 3T5LA 4M04A 4Z6FA 3QUTA 9ICAA 5KFDA 1S8OA 4K4HA 1S10A 5AKGA 4UB3A 1SZHA 2FPMA 4F2RA 3V7LA 4QIWC 2BHNA 4AYBC 2QARB 1QSLA 1U47A 3M9OB 1NZBA 4LVSA 2ZIVB 3DDHA 1T3NA 4QWCA 4QZCA 3OSPA 2FMPA 1JALA 1Q3UA 1PUZA 3MR2A 1L3VA 3LVVA 3UMCA 1NJWA 2E1FA 1ECWA 4IQTA 4JMUA 1BPYA 2UVVA 2E8NA 3J81j 2IMWP 1ZD2P 4M0AA 4UATA 3AMZA 1FFUA 4Q45A 2C2DA 4UBCA 2FMQA 4ELUA 5J29A 5AKJA 1B0XA 5DB7A 4BGDA 4Y2QA 2HCFA 1DXSA 5D46A 3M9MB 4NL9A 5L1JA 5J0UA 4I2DA 2ATLA 2QARA 5ALVA 5KT7A 1B22A 4BWMA 5L1IA 2W9AA 2HHTA 1OXJA 7ICEA 4Y2PA 3Q8KA 4DSFA 4TUSA 4QZGA 2Y0SF 3EWAA 2WF9A 3FC4A 4JV1A 1ZD3A 1PK3A 5ALFA 2HI0A 3RB4A 2ODGA 2EZXA 2F2AB 4F4KA 1SV0C 1NZPA 3MFHA 4UBBA 2HOFA 2BDPA 2W43A 2F3NA 3OSNA 3SYZA 1NK9A 3V7KA 4PL2A 4FS2A 3RJEA 8ICBA 2ZJ5A 9ICKA 2IHNA 2YB4A 4KMOB 3ONNA 2FE9A 1ZD4A 8ICEA 4PGQA 3QZ7A 9ICEA 3K1ZA 2ZTEA 2RLTA 1GO3F 5ALMA 4J9KA 2ZIXB 3B0XA 5DDYA 4C0ZA 4O3NA 3HKZC 5ALDA 3Q8RB 4F72A 4DF4A 4R8UB 5ALUA 8ICVA 1BGXT 4ECUA 3MDAA 2EAPA 4IC9A 3CRXA 3GIKA 2XI9A 3NASA 3M6KA 2MUTA 2WB1F 3H0LB 2C28A 5AICA 5IIMA 2EAOA 2K4EA 1XO0A 2WF8A 5GTHU 4F4WA 3WK9A 1L7OA 4KLUA 2JHDA 4F4ZA 3PSTA 4YG2A 3RJJA 4UB6U 4PHEA 2KP7A 2BR0A 1ZQYA 2DFLA 3WK7A 3L3FX 1JXEA 3NVWA 9ICMA 2HDOA 1SIJA 5FP0A 4KMUA 4UAWA 3KKAC 4DLGA 4G3IA 4F5PA 1WUDA 4EYIB 5AI5A 2B21A 2LMRA 4R8UA 1RZTA 4R66A 1QQ7A 2MA1A 4IR9A 2FDRA 3WKAA 2GLEA 5DGAA 1UPHA 1S0MA 3QU2A 4O9MA 3NVVA 5ALZA 1ZXIA 4IL6U 3UQ2A 2DUYA 4O3QA 3SAHA 3RJGA 3RJHA 2KE7A 1ZQZA 1IV8A 5AI0A 3UMGA 9ICWA 5ALKA 3RFAA 2OHFA 3NRWA 4KLIA 4I2CA 2BPFA 3ALRA 4ECXA 3TFRA 9ICUA 2WAQF 8ICTA 2DL0A 1UQVA 5HR7A 2KMDA 2E8MA 5ALIA 2F1JA 1SZPA 5AK5A 4UARA 3BS5B 4IR1A 3KFUF 2KHQA 2W55A 5CJ7A 2GOLA 2JZBA 3GIMA 4U7CA 4TQRA 1Z3EB 3QXGA 4UAZA 3CP8A 1UHUA 4TURA 1BPEA 5IILA 3FDSA 3M1YA 3H8WA 2L5YA 3A0BU 5B5EU 1LVHA 3HJEA 3LWMA 2E5SA 4USAA 4YR2A 4F8RA 2JEIA 4FE3A 4M2YA 1KW4A 2NYVA 2K8CB 4ED8A 5L1KA 2ZUDA 1XS9D 2DWQA 4O5KA 4I2EA 3QZ8A 4YCXA 3V72A 1UT5A 4C7YA 4Y2XA 2QB0A 4CRXA 4CDGA 5AIBA 3QU5A 3UQ0A 3M8RA 1SXEA 3PX6A 2NO4A 4C8MA 2MSNA 1SGGA 4I2GA 2DKZA 4B9LA 2DF4B 5EOZA 2PI5A 4DOBA 5DDMA 5C0YA 9ICIA 1PZNA 2AH5A 3EUB2 5J8YA 4KITB 2KK0A 1CEZA 2IBKA 2W54A 2NRVA 4PJ0U 3PW4A 1KL9A 2J6UA 4ED6A 2P6RA 3NS1A 4F5RA 4RQ0A 2HHSA 2J6TA 4PHPA 1IG6A 4MHVA 5HHHA 5KAIU 1X6IA 1TV9A 3JPOA 3ISDA 1EXNA 1ZQ1C 2KKPA 3C1ZA 3UMBA 1F5SA 1ZQXA 3IN5A 2G09A 4DCCA 5CRXA 3CW2C 3MR3A 2G08A 3BZKA 1XU4A 1Q46A 4DL7A 5DQGA 2FPKA 1U45A 1S9FA 2F1HA 4J9PA 1T7PA 9ICJA 2FJ6A 1U9LA 1C20A 2ZXIA 1L3SA 1ZQEA 4DWIA 5KFVA 3T3FA 4YR3A 2D8CA 1RXVA 1D9FA 7ICKA 4ELTA 3LK9A 4QW9A 4QWDA 1DRGA 3EZ5A 2ZJAA 3ORYA 1B4FA 2E8PA 2Q0ZX 4OD0A 1UA1A 1MSWD 4RUAA 3GQCA 5ALGA 3C5GA 2LPEA 5HNKA 5J2KA 3AQEA 4QW8A 4P0PA 1ZRNA 2KG5A 1LB2B 1ZD5A 2M0NA 4DSEA 1L7NA 2VANA 4KLSA 2ZIUB 5J2BA 3G6XA 1D8BA 2I6XA 5KFZA 2B6GA 4NLNA 2DQNB 2KNJA 1N2XA 4DOCA 3ETRA 4KX3A 3ZI4A 2A1JB 3LYSA 1RG6A 5KFQA 2XCPA 3V6KA 4B9NA 4KLQA 3PO4A 1RQNA 3V6JA 2JEFA 4I27A 3PR4A 1XSPA 4IRKA 5TISU 4KLJA 3KHLA 2K4HA 5CHGA 5AM5A 3KHGA 5A0LA 5AM0A 2K4IA 1V97A 3RRHA 2FPLA 1JI7A 1JXLA 4I2AA 1DOQA 2BCUA 1RPLA 3GV5B 7ICJA 1WCLA 1BNPA 3WKBA 3NGDA 2G07A 2KFZA 2B0CA 5AKHA 1Q3VA 4I2HA 1O08A 4DS4A 3SEIA 1ZQFA 5DBAA 2OXOA 4FBUA 5ALQA 1L8OA 3ISCA 2CRXA 8ICKA 3TANA 5ALLA 4CNQA 2G06A 2AQ4A 1AQ6A 9ICVA 2RDIA 5AI4A 3BS7A 2KVSA 4F4YA 3ZD9A 4EBDA 4QJFB 5DQHA 3JPNA 2RHFA 2ZIWB 1ZQBA 1Z4OA 4UAVA 3Q8MA 3T5KA 2BQUA 2BPGA 5J0WA 3I1YA 3TI0A 1RYRA 3ICXA 1N5XA 5KFOA 2HVHA 4ECWA 9ICNA 2BQRA 2ZTCA 4ECTA 5KFWA 5AM3A 3GILA 5KFYA 3RBEA 2WB1C 2A3VA 5ALNA 4IQUA 5DB6A 4M9LA 2Q4TA 2YX8A 5J0PA 2F76X 4J9OA 4P2HA 1V9PA 3N7PD 2GO7A 4NL9C 9ICCA 2QB1A 3RJFA 1IM4A 5ALSA 1ZOLA 3DEEA 3ED5A 2BPCA 4CE6A 2PFOA 4RQNA 1S0OA 3KZIU 8ICOA 1URJA 1C7YA 5J2FA 1ZJMA 3V6HA 4KTQA 3PX0A 5AKIA 1NK7A 9ICQA 4QWAA 1KDHA 3MFIA 8ICWA 2HOQA 5CP2A 3ZD8A 1L3TA 1AROP 3AEVA 3AM9A 3PSIA 3QYPA 4OJ6A 9ICTA 1PK1A 4DSJA 2XVTA 4UAUA 3OGUA 4F50A 4DFDA 4F5OA 2KZZA 2ZUBA 2R8JA 2W9BA 8ICFA 2VJ4A 2P35A 4CCHA 4KLDA 4WJ3B 4RZRA 5AI6A 4NLCA 1TAQA 4I29A 2H3ZA 8ICSA 4DL5A 4GFJA 1Z1BA 7ICGA 4PL1A 7ICFA 3OPXA 4UB4A 3C2MA 3RF9A 4EBEA 3C28A 3KTQA 3Q8LA 4IS7A 1NKCA 1SWVA 5KG4A 2OH2A 5EWGA 2AU0A 1ZETA 4RNOA 1ZQVA 2LKYA 2XIDA 5JTIA 1QTMA 5KT4A 1N48A 4QZ9A 2H3IA 3SENA 1TKDA 4NJ8A 4CF5A 2HHVA 3HILA 4PHDA 5L1LA 4DQQA 2HBLA 4GLXA 2W11A 2NRXA 5HR6A 7ICIA 4Y2YA 8ICJA 8ICUA 1SWWA 4O5CA 2KVCA 4LJXA 1TFRA 4OJPA 1N62A 2HBJA 4I2JA 5KFRA 2KZ3A 4QZEA 4O3MA 1F44A 3QX7A 4BXOA 4US9A 2ISPA 4C80A 1JIHA 1A76A 1L8LA 2HOIA 2MUTB 1N60A 1N56A 4I2IA 5KFSA 1RDFA 2HMXA 2JR5A 5KL8B 7ICNA 3H7IA 3C29A 1KSPA 2BKEA 2WHEA 3KZXA 3JPRA 2XGPA 3BQ0A 2LYHA 4QZDA 4B9TA 5KG5A 3BQTA 4M9GA 2KJ9A 3T5HA 2FLNA 3ETLA 3HWTA 4ECSA 3RB6A 1KFDA 5EWEA 4EEKA 4NLBA 5J2AA 3SQIA 3H8SA 2I5HA 5DG9A 2W9MA 1UCVA 1KFTA 1TAUA 5AKXA 3QUBA 2W9CA 4UB5A 5D4BA 4KLMA 5CR0A 1WWUA 3WK8A 4EEYA 3WU2U 4J9NA 9ICBA 8ICIA 5KFFA 3RTVA 3ZDAA 4M47A 5KFMA 1ZQHA 4KLGA 3F2CA 3L4PA 3KD3A 3WK4A 5J2GA 3BJYA 1LKYA 5BOMA 1MN8A 5AKZA 4GC7A 2ZTDA 1YZ7A 4C4SA 3WKEA 2K8BB 8ICGA 1SKSA 5KNIA 2F77X 4ECVA 2JZBB 4ECZA 7ICUA 4GXIA 1KKXA 3NVZA 5KFEA 4BJQA 4PGXA 4K4IA 3RH5A 3D6JA 1V85A 2QLTA 2YMPA 3A0HU 5AM1A 1T4GA 4FO6A 5DBBA 2DKXA 2RDJA 2PFPA 1SV0A 8ICYA 2C22A 4PZOA 5AKEA 5AI9A 2JEJA 4FZLA 3SV3A 1ZQJA 1TK5A 2XY5A 3SMVA 3OJSA 3IDWA 3DV9A 2IOHA 1PVQA 4DSKA 1JMSA 4QIWF 1Z00B 1ZQRA 2QB0B 2AGPA 5J2EA 1Z4NA 3IRUA 3WKDA 1SKRA 3RBDA 1LV5A 3RR7A 3QU4A 2K60A 2XY7A 2IOFA 1ZQTA 4Q44A 4DSLA 5DLFA 1KRPA 3N7RC 3OTQA 2KJ8A 4QWBA 4IRCA 2Y1JA 3IHQB 5T14A 2WF6A 4C8NA 3HW8A 3TARA 3N28A 1COKA 3ZDDA 2D3DA 1NOMA 2HHXA 2FMSA 3TADA 3PW7A 5KG7A 3OHAA 5C5JA 3PW5A 2NRZA 2PKEA 4ED1A 4ACOA 1MQ2A 7ICHA 2PFNA 1KFSA 4B9SA 3F2DA 4P0QA 1Z00A 2F8KA 5AKYA 5KT6A 1XWLA 4XA5A 4YVZA 3PSFA 2R8IA 1NK0A 4C8KA 5ALXA 3RJKA 1VDVA 1S0VA 3MC1A 2F44A 4IQWA 4UASA 4LZGA 3I76A 3UXNA 2KICA 4OO1J 1ZQNA 3MGVA 4F4XA 4MEYA 7ICVA 5KFAA 9ICGA 2MRLA 1X9XA 1S76D 2EANA 3QUQA 5DKWA 4B9MA 4JUZA 4HAIA 1QQ5A 4MF8A 2BDUA 5AKKA 1TVAA 1FIQA 1P7DA 5KG6A 1DGJA 4P0PB 3FAHA 2PFQA 2OWOA 3IM1A 5EE3A 1RQLA 5KL1B 4M9JA 3E0FA
chains in the Genus database with same CATH topology
1UCVA 2LPEA 2Y9TA 1OXJA 5JU5A 1WWVA 3KKAC 5JTIA 1Z1VA 2KG5A 2ES6A 2QB0A 2K4PA 1LKYB 1COKA 1SV4A 1SXEA 2D3DA 3SENA 2Y9UA 2LMRA 4NJ8A 1WWUA 1SGGA 3TADA 2B6GA 3HILA 2GLEA 1PK3A 2DKZA 1OW5A 3K1RB 2JV3A 4NL9C 1SV0C 2QB1A 1RG6A 2F8KA 1LKYA 2F3NA 5J8YA 5F3XB 2KE7A 4RQNA 2KSOB 1PK1B 2E8OA 5KNIA 5L1MA 2FE9A 2QARB 2F44A 1JI7A 1X40A 2KIVA 4PZNA 4MHVA 2QKQA 3H8MA 3TADC 2DL0A 1UQVA 5JRTA 2KMDA 1V85A 2E8MA 1SXDA 4RQMA 2EAMA 2ESEA 1PK1A 2DKXA 3BS5B 1SV0A 1X9XA 3TACB 4PZOA 2EANA 3SEIA 3KKAA 1V38A 2E8NA 3BQ7A 2EAPA 3IDWA 2YTUA 1X66A 2EAOA 2D8CA 2L5YA 3BS5A 2QB0B 1B0XA 3BS7A 2KSOA 1DXSA 1F0MA 4NL9A 2K60A 1B4FA 2E8PA 4IS7A 2QARA 1KW4A 5J8YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCV A;  2LPE A;  2Y9T A;  1OXJ A;  5JU5 A;  1WWV A;  3KKA C;  5JTI A;  1Z1V A;  2KG5 A;  2ES6 A;  2QB0 A;  2K4P A;  1LKY B;  1COK A;  1SV4 A;  1SXE A;  2D3D A;  3SEN A;  2Y9U A;  2LMR A;  4NJ8 A;  1WWU A;  1SGG A;  3TAD A;  2B6G A;  3HIL A;  2GLE A;  1PK3 A;  2DKZ A;  1OW5 A;  3K1R B;  2JV3 A;  4NL9 C;  1SV0 C;  2QB1 A;  1RG6 A;  2F8K A;  1LKY A;  2F3N A;  5J8Y A;  5F3X B;  2KE7 A;  4RQN A;  2KSO B;  1PK1 B;  2E8O A;  5KNI A;  5L1M A;  2FE9 A;  2QAR B;  2F44 A;  1JI7 A;  1X40 A;  2KIV A;  4PZN A;  4MHV A;  2QKQ A;  3H8M A;  3TAD C;  2DL0 A;  1UQV A;  5JRT A;  2KMD A;  1V85 A;  2E8M A;  1SXD A;  4RQM A;  2EAM A;  2ESE A;  1PK1 A;  2DKX A;  3BS5 B;  1SV0 A;  1X9X A;  3TAC B;  4PZO A;  2EAN A;  3SEI A;  3KKA A;  1V38 A;  2E8N A;  3BQ7 A;  2EAP A;  3IDW A;  2YTU A;  1X66 A;  2EAO A;  2D8C A;  2L5Y A;  3BS5 A;  2QB0 B;  1B0X A;  3BS7 A;  2KSO A;  1DXS A;  1F0M A;  4NL9 A;  2K60 A;  1B4F A;  2E8P A;  4IS7 A;  2QAR A;  1KW4 A;  5J8Y C; 
#chains in the Genus database with same CATH topology
 2HBM A;  2JH7 A;  9ICH A;  1SL0 A;  2Y9T A;  3AQF A;  3HKZ F;  5DG8 A;  2XGQ A;  1L6N A;  2FLL A;  1KLN A;  2PMZ F;  3SI8 A;  9ICL A;  4C8O A;  2BCV A;  4F71 A;  4Z6E A;  2KFN A;  3IP4 B;  4ZOH C;  4NY8 A;  1HJP A;  4FZN A;  1QQ6 A;  1JN3 A;  3HRD D;  3ZDE A;  5CWR A;  4C8L A;  4TUP A;  3PMN A;  4XUS A;  3MBY A;  3KHH A;  4EZ6 A;  1CI4 A;  3PNC A;  3IG5 A;  2XC9 A;  1XC9 A;  3C5F A;  5L1M A;  2N1R A;  5KFC A;  4QZB A;  3F53 A;  5AKL A;  2KJ5 A;  1QSY A;  2QKQ A;  1COO A;  3UXP A;  3L5K A;  3MDC A;  2NV3 A;  2BGW A;  5JRT A;  2CPR A;  4MF2 A;  1FFV A;  5E79 U;  3H0R B;  4J9L A;  2EAM A;  2YY6 A;  1BPX A;  2Y0S C;  4EZ9 A;  7ICR A;  4EBC A;  1IIP A;  1YZ6 A;  1X9W A;  5ALH A;  3BQ7 A;  3QU7 A;  5KT2 A;  2R8H A;  1KQQ A;  8ICQ A;  3TAP A;  1X9M A;  2RQ5 A;  1K1S A;  1S5L U;  3QNM A;  4M6W B;  3C23 A;  2HBK A;  3F5A A;  1KTQ A;  5J0Y A;  2G0A A;  4I2B A;  5J0S A;  1PVP A;  3PW0 A;  3JPT A;  2W8L A;  4B6J A;  8ICM A;  4YMM A;  1ZRM A;  2ZG6 A;  3PW2 A;  4NXZ A;  2ES6 A;  4EX7 A;  2BCQ A;  7ICQ A;  1D8L A;  2OCE A;  2IOF K;  9ICF A;  4TQS A;  4NM1 A;  2H3Q A;  4RPX A;  5KG1 A;  5ALO A;  3M8S A;  4R64 A;  2JV3 A;  4CGZ A;  5ALE A;  1S0N A;  1RYU A;  2HSZ A;  4ED0 A;  3UM9 A;  5HHI A;  3VC8 A;  5J2J A;  4M6W A;  1QSS A;  3OJU A;  5K4L A;  3BQ1 A;  1PK1 B;  1NJX A;  3LVW A;  4YXM A;  2LYB A;  1TK0 A;  3H8J A;  2OYY A;  2W7P A;  3F2B A;  1RM6 C;  3N4M B;  4DL4 A;  2W9B B;  3HPO A;  4OCZ A;  2XO7 A;  4QZH A;  3EPG A;  2WFA A;  5ALR A;  2AGQ A;  3RB0 A;  2A19 A;  3SD7 A;  1X6J A;  4KN7 A;  4YQW A;  1MQ3 A;  4RQ2 A;  3PR5 B;  2AGO A;  1CUK A;  4AP9 A;  3MR6 A;  4J9M A;  1SL2 A;  3SR6 A;  1V38 A;  1T3Q A;  1WG8 A;  3IV6 A;  4J9Q A;  4CF3 A;  3RR8 A;  4DQP A;  2JXJ A;  4RQ6 A;  4JV2 A;  1ZQU A;  2ASJ A;  4C7Z A;  2HW3 A;  2YQE A;  4X5V A;  5F9N A;  4DL2 A;  3THV A;  2JGA A;  3K4G A;  4P4O A;  3M6Z A;  2JRZ A;  1Q8K A;  4F5N A;  4UAY A;  3UXO A;  4F92 B;  5III A;  2BQ3 A;  1BPD A;  2ZXH A;  5KFN A;  5AI8 A;  2NO5 A;  5J2D A;  2YN4 A;  4F3O A;  3WK6 A;  3FYH A;  3PVX A;  3C2K A;  1QH9 A;  5DG7 A;  5DB9 A;  3MGH A;  1WYG A;  1ZQP A;  3GIJ A;  4KLF A;  2WAQ C;  3ZDC A;  3RB3 A;  3TAQ A;  4RNN A;  3MGI A;  4Q8F A;  2Y9U A;  4RPZ A;  1A0P A;  1FEZ A;  4DL3 A;  4KLH A;  3NRZ A;  2H3F A;  3TKA A;  2GH1 A;  3B9J A;  4BUG A;  5KFJ A;  2W8K A;  1BVS A;  1DK3 A;  5KG0 A;  2VA2 A;  4BXO B;  3AUO A;  5G5G A;  2WTF A;  2IHM A;  2KHV A;  2ASD A;  5KT5 A;  3GV7 B;  4O3R A;  4YP3 A;  3HT3 A;  3QU9 A;  2W04 A;  4O3P A;  3IG8 A;  2ALZ A;  4Q8E A;  4RT3 A;  4QZ8 A;  2KD1 A;  4GXK A;  2VA3 A;  1NKB A;  4J9R A;  2E8O A;  1K5O A;  2J6S A;  1XSL A;  5KFK A;  7ICM A;  9ICX A;  2O6K A;  5DLG A;  2ZUC A;  4KLO A;  4MFF A;  1MA7 A;  4Y2V A;  3RRG A;  3QEB Z;  4ELV A;  4XRH A;  2HHW A;  2YML A;  3H0M B;  1M6Y A;  2VKQ A;  2E1E A;  5ALT A;  1KN5 A;  4KLL A;  8ICA A;  3PSP A;  2CXY A;  3PX4 A;  4F93 B;  2F8L A;  5IIJ A;  3SAF A;  3AU6 A;  1ZYQ A;  1HUO A;  4Q43 A;  3LDA A;  2ZIV A;  5AM4 A;  2WF5 A;  4C4R A;  3M9N B;  2H3V A;  3KBB A;  4TUQ A;  2VIX A;  4QWE A;  3Q8P B;  3GII A;  3KHR A;  3G6Y A;  4KLE A;  9ICR A;  3WK5 A;  2VJ5 A;  1NK5 A;  1NJZ A;  1ZQW A;  4DF8 A;  4JWM A;  4YD2 A;  2W9C B;  3M7D A;  4YR0 A;  1NNL A;  5AHX A;  5AK4 A;  3QUC A;  2HVI A;  2KIW A;  5KTQ A;  3I28 A;  3B0Y A;  3C21 A;  2D6F C;  3SAG A;  3NUQ A;  5J0R A;  4P4M A;  5BOL A;  1L7M A;  1FO4 A;  4JV0 A;  3PZP A;  3MAB A;  3QE9 Y;  4NLK A;  4MFA A;  5J0Q A;  3E58 A;  4RQ5 A;  4HYK A;  1LKY B;  3UPQ A;  2ASL A;  5GTI U;  5CB1 A;  2P66 A;  3V7J A;  3LWL A;  4O5E A;  1HEK A;  1NK4 A;  4EEL A;  3GFK B;  5KFI A;  4KN4 A;  4UQG A;  4PPX A;  2JEG A;  2LI6 A;  8ICP A;  1HIW A;  1VJ5 A;  2WF7 A;  1D9D A;  2HHQ A;  3MR5 A;  3D2Q A;  4R65 A;  4BDP A;  8ICZ A;  1SL1 A;  4EX6 A;  1X2I A;  4YD1 A;  5TZV A;  1J2N A;  2RRD A;  2PMZ C;  4GIB A;  3H4B A;  1ZQO A;  1PVR A;  1SB3 C;  4DFK A;  1X40 A;  3EPI A;  5KFP A;  1BNO A;  5J2C A;  4MFC A;  2AHO B;  4B9V A;  3TAD C;  4RU9 A;  2KKV A;  1N5W A;  5B66 U;  5DB8 A;  1ZQQ A;  5IIN A;  2W3R A;  5KG2 A;  2YMQ A;  2ESE A;  1J2M A;  3PV8 A;  3RAX A;  2G5I B;  9ICS A;  5AIA A;  3RH6 A;  1JUD A;  4DQS A;  4ED2 A;  1KEJ A;  4KX5 A;  3OHB A;  2EZY A;  8ICX A;  4Z6C A;  2W7O A;  1L3U A;  2ZIX A;  1S77 D;  4GC6 A;  3EYZ A;  4DSI A;  4LZD A;  2R18 A;  8ICR A;  4QZF A;  1XNS A;  2EH9 A;  4YN4 A;  5EE1 A;  5AK3 A;  1XO1 A;  4XQ8 A;  1Y88 A;  1U49 A;  4ECR A;  1NJY A;  1ZQC A;  2V9W A;  5J8Y C;  3D2N A;  3AN1 A;  5KG3 A;  4PH5 A;  4FFD A;  2YB1 A;  2ZJ8 A;  5JU5 A;  1TE2 A;  2AXT U;  4FS1 A;  4DQR A;  5DQI A;  2RP5 A;  4P0Q B;  1TAM A;  4F5Q A;  2KZM A;  4BX9 C;  5KFH A;  4AYB F;  1A6S A;  2NRT A;  2KV2 A;  3T79 A;  2I9G A;  3ZDB A;  8ICC A;  1A77 A;  2AJQ A;  4O3S A;  4DLE A;  1L7P A;  4EEN A;  1OW5 A;  3K1R B;  1SKW A;  5CEH A;  1KBU A;  2IA6 A;  1ZQS A;  2AQ0 A;  3S6J A;  3WKC A;  2EQY A;  1JRO A;  5F3X B;  4OJL A;  2G5H B;  2LM1 A;  1U48 A;  4U6P A;  3D2S A;  4YMN A;  4Z6D A;  3TFS A;  5HMM A;  5KFX A;  4MEX A;  2LYA A;  4P4P A;  1L5U A;  4QNL A;  4PZN A;  2MU2 A;  2LHT A;  3H8M A;  4DL6 A;  3K75 D;  3QEA Z;  4E0D A;  1YT3 A;  1ZQI A;  4Y2U A;  5HML A;  4QZI A;  2KN7 A;  8ICH A;  9ICP A;  2NRW A;  5KT3 A;  4EYH B;  3KKA A;  4YFK A;  4Y2S A;  1H38 A;  4Y2J A;  4Y2R A;  2DPI A;  3JPS A;  2Z7J A;  2A1A A;  2V4R A;  2GWS A;  2FLP A;  4J03 A;  3BS5 A;  2K89 A;  4NM2 A;  4RQ3 A;  2P6U A;  4O0I A;  4DEZ A;  1VLB A;  2XY6 A;  1X9S A;  3TQ1 A;  7ICS A;  3PO5 A;  5IIK A;  5EE9 A;  1ZJN A;  3BQ2 A;  4J9S A;  5BPC A;  1IXR A;  2F1I A;  3H4D A;  1ZQA A;  2UVU A;  4RQ8 A;  5CA7 A;  1Z1V A;  3H40 A;  8ICN A;  4DFP A;  5KFU A;  1JRP A;  4CF4 A;  4RQ1 A;  2I1Q A;  5DGB A;  3U26 A;  4M9N A;  1UA0 A;  3PY8 A;  3AU2 A;  4RQ7 A;  5J2I A;  4FZM A;  1U4B A;  4UB8 U;  4RPY A;  3KOO A;  4ED3 A;  7ICP A;  1RYS A;  2KEY A;  3GU3 A;  5EWF A;  5ALY A;  2KSO B;  7ICO A;  5J0T A;  4DO9 A;  1ED1 A;  1QCK A;  1O03 A;  4RT2 A;  3SZ2 A;  1NI3 A;  3AL0 B;  3R9K A;  1ZQD A;  2UVW A;  4DFM A;  1X42 A;  1D8Y A;  4NWI A;  1S97 A;  4DQI A;  3O0F A;  1B43 A;  1JX4 A;  2K8A A;  4JB3 A;  5H2F U;  3BDP A;  7ICL A;  5KFG A;  4NLG A;  3HX0 A;  4F91 B;  9ICO A;  3EW9 A;  1RXW A;  4ECY A;  3HP6 A;  1ZQK A;  5J0O A;  3SV4 A;  1CRX A;  5JUM A;  2YTU A;  2C2R A;  3T5J A;  4KLT A;  7ICT A;  2DPJ A;  4M9H A;  5KAF U;  3N97 B;  2EZZ A;  1NK6 A;  4YXJ A;  2W03 A;  2KSO A;  4IQV A;  3RH4 A;  1F0M A;  4NV0 A;  2MAX A;  1J97 A;  3Q8Q B;  4RNM A;  3GDX A;  2R8K A;  5G5H A;  4I28 A;  1T94 A;  4F2S A;  5AM2 A;  2PXI A;  1XSN A;  5KFB A;  3JPP A;  2V4Q A;  3RJI A;  1SV4 A;  1N61 A;  4A8E A;  5IIO A;  1HUZ A;  4I2F A;  3F5E A;  5KFT A;  3E2E A;  4JWN A;  3N7S C;  3PML A;  5J2H A;  1WCN A;  4US8 A;  4IRD A;  1MC8 A;  4YMO A;  3GZF A;  2HHU A;  5ALW A;  8ICL A;  3FM9 A;  1N63 A;  2KOB A;  2W3S A;  5ALP A;  2UVR A;  4PHA A;  2ZIU A;  3NTU A;  2C2E A;  2XCA A;  3G6V A;  4DOA A;  2DGZ A;  2KTQ A;  5HP4 A;  4QZA A;  2R8G A;  2A1J A;  4PGY A;  2DBY A;  2LBO A;  2KIV A;  2LM4 A;  4B9U A;  4ZH4 A;  1BPB A;  3VCB A;  1ZQM A;  2ISO A;  2JMG A;  2H5X A;  4UB1 A;  4R63 A;  1SXD A;  4RQM A;  3C1Y A;  4K4G A;  1DK2 A;  4FBT A;  4GXJ A;  4RQ4 A;  2YMM A;  2BCR A;  3TAC B;  4NLZ A;  1OUQ A;  2EDU A;  1ZQG A;  5KFL A;  3C2L A;  5D49 A;  5DBC A;  2M9N A;  4OJO A;  2Y1I A;  3CYM A;  1BPZ A;  1X66 A;  2FI1 A;  2XIC A;  4Y2T A;  1NKE A;  1UT8 A;  1Z19 A;  3GV8 B;  5EE0 A;  4C4T A;  5AK6 A;  1TK8 A;  2OEH A;  4ECQ A;  1T8E A;  2VA8 A;  1QLN A;  1NK8 A;  3BZC A;  4JK1 A;  4BWJ A;  3NVY A;  2CN1 A;  3Q8S B;  1WWV A;  5J0X A;  3JPQ A;  2BCS A;  2JH1 A;  2K4P A;  5ALJ A;  4DFJ A;  2BZF A;  1ZQL A;  2ZIW A;  4O3O A;  4ED7 A;  2E3T A;  2OM6 A;  4G9B A;  4OJ5 A;  5L9X A;  1K1Q A;  1DGS A;  3ISB A;  5F9L A;  3CNH A;  4DS5 A;  4UW9 A;  3RAQ A;  2PI4 A;  4RUC A;  4UB2 A;  4ICA A;  3T5L A;  4M04 A;  4Z6F A;  3QUT A;  9ICA A;  5KFD A;  1S8O A;  4K4H A;  1S10 A;  5AKG A;  4UB3 A;  1SZH A;  2FPM A;  4F2R A;  3V7L A;  4QIW C;  2BHN A;  4AYB C;  2QAR B;  1QSL A;  1U47 A;  3M9O B;  1NZB A;  4LVS A;  2ZIV B;  3DDH A;  1T3N A;  4QWC A;  4QZC A;  3OSP A;  2FMP A;  1JAL A;  1Q3U A;  1PUZ A;  3MR2 A;  1L3V A;  3LVV A;  3UMC A;  1NJW A;  2E1F A;  1ECW A;  4IQT A;  4JMU A;  1BPY A;  2UVV A;  2E8N A;  3J81 j;  2IMW P;  1ZD2 P;  4M0A A;  4UAT A;  3AMZ A;  1FFU A;  4Q45 A;  2C2D A;  4UBC A;  2FMQ A;  4ELU A;  5J29 A;  5AKJ A;  1B0X A;  5DB7 A;  4BGD A;  4Y2Q A;  2HCF A;  1DXS A;  5D46 A;  3M9M B;  4NL9 A;  5L1J A;  5J0U A;  4I2D A;  2ATL A;  2QAR A;  5ALV A;  5KT7 A;  1B22 A;  4BWM A;  5L1I A;  2W9A A;  2HHT A;  1OXJ A;  7ICE A;  4Y2P A;  3Q8K A;  4DSF A;  4TUS A;  4QZG A;  2Y0S F;  3EWA A;  2WF9 A;  3FC4 A;  4JV1 A;  1ZD3 A;  1PK3 A;  5ALF A;  2HI0 A;  3RB4 A;  2ODG A;  2EZX A;  2F2A B;  4F4K A;  1SV0 C;  1NZP A;  3MFH A;  4UBB A;  2HOF A;  2BDP A;  2W43 A;  2F3N A;  3OSN A;  3SYZ A;  1NK9 A;  3V7K A;  4PL2 A;  4FS2 A;  3RJE A;  8ICB A;  2ZJ5 A;  9ICK A;  2IHN A;  2YB4 A;  4KMO B;  3ONN A;  2FE9 A;  1ZD4 A;  8ICE A;  4PGQ A;  3QZ7 A;  9ICE A;  3K1Z A;  2ZTE A;  2RLT A;  1GO3 F;  5ALM A;  4J9K A;  2ZIX B;  3B0X A;  5DDY A;  4C0Z A;  4O3N A;  3HKZ C;  5ALD A;  3Q8R B;  4F72 A;  4DF4 A;  4R8U B;  5ALU A;  8ICV A;  1BGX T;  4ECU A;  3MDA A;  2EAP A;  4IC9 A;  3CRX A;  3GIK A;  2XI9 A;  3NAS A;  3M6K A;  2MUT A;  2WB1 F;  3H0L B;  2C28 A;  5AIC A;  5IIM A;  2EAO A;  2K4E A;  1XO0 A;  2WF8 A;  5GTH U;  4F4W A;  3WK9 A;  1L7O A;  4KLU A;  2JHD A;  4F4Z A;  3PST A;  4YG2 A;  3RJJ A;  4UB6 U;  4PHE A;  2KP7 A;  2BR0 A;  1ZQY A;  2DFL A;  3WK7 A;  3L3F X;  1JXE A;  3NVW A;  9ICM A;  2HDO A;  1SIJ A;  5FP0 A;  4KMU A;  4UAW A;  3KKA C;  4DLG A;  4G3I A;  4F5P A;  1WUD A;  4EYI B;  5AI5 A;  2B21 A;  2LMR A;  4R8U A;  1RZT A;  4R66 A;  1QQ7 A;  2MA1 A;  4IR9 A;  2FDR A;  3WKA A;  2GLE A;  5DGA A;  1UPH A;  1S0M A;  3QU2 A;  4O9M A;  3NVV A;  5ALZ A;  1ZXI A;  4IL6 U;  3UQ2 A;  2DUY A;  4O3Q A;  3SAH A;  3RJG A;  3RJH A;  2KE7 A;  1ZQZ A;  1IV8 A;  5AI0 A;  3UMG A;  9ICW A;  5ALK A;  3RFA A;  2OHF A;  3NRW A;  4KLI A;  4I2C A;  2BPF A;  3ALR A;  4ECX A;  3TFR A;  9ICU A;  2WAQ F;  8ICT A;  2DL0 A;  1UQV A;  5HR7 A;  2KMD A;  2E8M A;  5ALI A;  2F1J A;  1SZP A;  5AK5 A;  4UAR A;  3BS5 B;  4IR1 A;  3KFU F;  2KHQ A;  2W55 A;  5CJ7 A;  2GOL A;  2JZB A;  3GIM A;  4U7C A;  4TQR A;  1Z3E B;  3QXG A;  4UAZ A;  3CP8 A;  1UHU A;  4TUR A;  1BPE A;  5IIL A;  3FDS A;  3M1Y A;  3H8W A;  2L5Y A;  3A0B U;  5B5E U;  1LVH A;  3HJE A;  3LWM A;  2E5S A;  4USA A;  4YR2 A;  4F8R A;  2JEI A;  4FE3 A;  4M2Y A;  1KW4 A;  2NYV A;  2K8C B;  4ED8 A;  5L1K A;  2ZUD A;  1XS9 D;  2DWQ A;  4O5K A;  4I2E A;  3QZ8 A;  4YCX A;  3V72 A;  1UT5 A;  4C7Y A;  4Y2X A;  2QB0 A;  4CRX A;  4CDG A;  5AIB A;  3QU5 A;  3UQ0 A;  3M8R A;  1SXE A;  3PX6 A;  2NO4 A;  4C8M A;  2MSN A;  1SGG A;  4I2G A;  2DKZ A;  4B9L A;  2DF4 B;  5EOZ A;  2PI5 A;  4DOB A;  5DDM A;  5C0Y A;  9ICI A;  1PZN A;  2AH5 A;  3EUB 2;  5J8Y A;  4KIT B;  2KK0 A;  1CEZ A;  2IBK A;  2W54 A;  2NRV A;  4PJ0 U;  3PW4 A;  1KL9 A;  2J6U A;  4ED6 A;  2P6R A;  3NS1 A;  4F5R A;  4RQ0 A;  2HHS A;  2J6T A;  4PHP A;  1IG6 A;  4MHV A;  5HHH A;  5KAI U;  1X6I A;  1TV9 A;  3JPO A;  3ISD A;  1EXN A;  1ZQ1 C;  2KKP A;  3C1Z A;  3UMB A;  1F5S A;  1ZQX A;  3IN5 A;  2G09 A;  4DCC A;  5CRX A;  3CW2 C;  3MR3 A;  2G08 A;  3BZK A;  1XU4 A;  1Q46 A;  4DL7 A;  5DQG A;  2FPK A;  1U45 A;  1S9F A;  2F1H A;  4J9P A;  1T7P A;  9ICJ A;  2FJ6 A;  1U9L A;  1C20 A;  2ZXI A;  1L3S A;  1ZQE A;  4DWI A;  5KFV A;  3T3F A;  4YR3 A;  2D8C A;  1RXV A;  1D9F A;  7ICK A;  4ELT A;  3LK9 A;  4QW9 A;  4QWD A;  1DRG A;  3EZ5 A;  2ZJA A;  3ORY A;  1B4F A;  2E8P A;  2Q0Z X;  4OD0 A;  1UA1 A;  1MSW D;  4RUA A;  3GQC A;  5ALG A;  3C5G A;  2LPE A;  5HNK A;  5J2K A;  3AQE A;  4QW8 A;  4P0P A;  1ZRN A;  2KG5 A;  1LB2 B;  1ZD5 A;  2M0N A;  4DSE A;  1L7N A;  2VAN A;  4KLS A;  2ZIU B;  5J2B A;  3G6X A;  1D8B A;  2I6X A;  5KFZ A;  2B6G A;  4NLN A;  2DQN B;  2KNJ A;  1N2X A;  4DOC A;  3ETR A;  4KX3 A;  3ZI4 A;  2A1J B;  3LYS A;  1RG6 A;  5KFQ A;  2XCP A;  3V6K A;  4B9N A;  4KLQ A;  3PO4 A;  1RQN A;  3V6J A;  2JEF A;  4I27 A;  3PR4 A;  1XSP A;  4IRK A;  5TIS U;  4KLJ A;  3KHL A;  2K4H A;  5CHG A;  5AM5 A;  3KHG A;  5A0L A;  5AM0 A;  2K4I A;  1V97 A;  3RRH A;  2FPL A;  1JI7 A;  1JXL A;  4I2A A;  1DOQ A;  2BCU A;  1RPL A;  3GV5 B;  7ICJ A;  1WCL A;  1BNP A;  3WKB A;  3NGD A;  2G07 A;  2KFZ A;  2B0C A;  5AKH A;  1Q3V A;  4I2H A;  1O08 A;  4DS4 A;  3SEI A;  1ZQF A;  5DBA A;  2OXO A;  4FBU A;  5ALQ A;  1L8O A;  3ISC A;  2CRX A;  8ICK A;  3TAN A;  5ALL A;  4CNQ A;  2G06 A;  2AQ4 A;  1AQ6 A;  9ICV A;  2RDI A;  5AI4 A;  3BS7 A;  2KVS A;  4F4Y A;  3ZD9 A;  4EBD A;  4QJF B;  5DQH A;  3JPN A;  2RHF A;  2ZIW B;  1ZQB A;  1Z4O A;  4UAV A;  3Q8M A;  3T5K A;  2BQU A;  2BPG A;  5J0W A;  3I1Y A;  3TI0 A;  1RYR A;  3ICX A;  1N5X A;  5KFO A;  2HVH A;  4ECW A;  9ICN A;  2BQR A;  2ZTC A;  4ECT A;  5KFW A;  5AM3 A;  3GIL A;  5KFY A;  3RBE A;  2WB1 C;  2A3V A;  5ALN A;  4IQU A;  5DB6 A;  4M9L A;  2Q4T A;  2YX8 A;  5J0P A;  2F76 X;  4J9O A;  4P2H A;  1V9P A;  3N7P D;  2GO7 A;  4NL9 C;  9ICC A;  2QB1 A;  3RJF A;  1IM4 A;  5ALS A;  1ZOL A;  3DEE A;  3ED5 A;  2BPC A;  4CE6 A;  2PFO A;  4RQN A;  1S0O A;  3KZI U;  8ICO A;  1URJ A;  1C7Y A;  5J2F A;  1ZJM A;  3V6H A;  4KTQ A;  3PX0 A;  5AKI A;  1NK7 A;  9ICQ A;  4QWA A;  1KDH A;  3MFI A;  8ICW A;  2HOQ A;  5CP2 A;  3ZD8 A;  1L3T A;  1ARO P;  3AEV A;  3AM9 A;  3PSI A;  3QYP A;  4OJ6 A;  9ICT A;  1PK1 A;  4DSJ A;  2XVT A;  4UAU A;  3OGU A;  4F50 A;  4DFD A;  4F5O A;  2KZZ A;  2ZUB A;  2R8J A;  2W9B A;  8ICF A;  2VJ4 A;  2P35 A;  4CCH A;  4KLD A;  4WJ3 B;  4RZR A;  5AI6 A;  4NLC A;  1TAQ A;  4I29 A;  2H3Z A;  8ICS A;  4DL5 A;  4GFJ A;  1Z1B A;  7ICG A;  4PL1 A;  7ICF A;  3OPX A;  4UB4 A;  3C2M A;  3RF9 A;  4EBE A;  3C28 A;  3KTQ A;  3Q8L A;  4IS7 A;  1NKC A;  1SWV A;  5KG4 A;  2OH2 A;  5EWG A;  2AU0 A;  1ZET A;  4RNO A;  1ZQV A;  2LKY A;  2XID A;  5JTI A;  1QTM A;  5KT4 A;  1N48 A;  4QZ9 A;  2H3I A;  3SEN A;  1TKD A;  4NJ8 A;  4CF5 A;  2HHV A;  3HIL A;  4PHD A;  5L1L A;  4DQQ A;  2HBL A;  4GLX A;  2W11 A;  2NRX A;  5HR6 A;  7ICI A;  4Y2Y A;  8ICJ A;  8ICU A;  1SWW A;  4O5C A;  2KVC A;  4LJX A;  1TFR A;  4OJP A;  1N62 A;  2HBJ A;  4I2J A;  5KFR A;  2KZ3 A;  4QZE A;  4O3M A;  1F44 A;  3QX7 A;  4BXO A;  4US9 A;  2ISP A;  4C80 A;  1JIH A;  1A76 A;  1L8L A;  2HOI A;  2MUT B;  1N60 A;  1N56 A;  4I2I A;  5KFS A;  1RDF A;  2HMX A;  2JR5 A;  5KL8 B;  7ICN A;  3H7I A;  3C29 A;  1KSP A;  2BKE A;  2WHE A;  3KZX A;  3JPR A;  2XGP A;  3BQ0 A;  2LYH A;  4QZD A;  4B9T A;  5KG5 A;  3BQT A;  4M9G A;  2KJ9 A;  3T5H A;  2FLN A;  3ETL A;  3HWT A;  4ECS A;  3RB6 A;  1KFD A;  5EWE A;  4EEK A;  4NLB A;  5J2A A;  3SQI A;  3H8S A;  2I5H A;  5DG9 A;  2W9M A;  1UCV A;  1KFT A;  1TAU A;  5AKX A;  3QUB A;  2W9C A;  4UB5 A;  5D4B A;  4KLM A;  5CR0 A;  1WWU A;  3WK8 A;  4EEY A;  3WU2 U;  4J9N A;  9ICB A;  8ICI A;  5KFF A;  3RTV A;  3ZDA A;  4M47 A;  5KFM A;  1ZQH A;  4KLG A;  3F2C A;  3L4P A;  3KD3 A;  3WK4 A;  5J2G A;  3BJY A;  1LKY A;  5BOM A;  1MN8 A;  5AKZ A;  4GC7 A;  2ZTD A;  1YZ7 A;  4C4S A;  3WKE A;  2K8B B;  8ICG A;  1SKS A;  5KNI A;  2F77 X;  4ECV A;  2JZB B;  4ECZ A;  7ICU A;  4GXI A;  1KKX A;  3NVZ A;  5KFE A;  4BJQ A;  4PGX A;  4K4I A;  3RH5 A;  3D6J A;  1V85 A;  2QLT A;  2YMP A;  3A0H U;  5AM1 A;  1T4G A;  4FO6 A;  5DBB A;  2DKX A;  2RDJ A;  2PFP A;  1SV0 A;  8ICY A;  2C22 A;  4PZO A;  5AKE A;  5AI9 A;  2JEJ A;  4FZL A;  3SV3 A;  1ZQJ A;  1TK5 A;  2XY5 A;  3SMV A;  3OJS A;  3IDW A;  3DV9 A;  2IOH A;  1PVQ A;  4DSK A;  1JMS A;  4QIW F;  1Z00 B;  1ZQR A;  2QB0 B;  2AGP A;  5J2E A;  1Z4N A;  3IRU A;  3WKD A;  1SKR A;  3RBD A;  1LV5 A;  3RR7 A;  3QU4 A;  2K60 A;  2XY7 A;  2IOF A;  1ZQT A;  4Q44 A;  4DSL A;  5DLF A;  1KRP A;  3N7R C;  3OTQ A;  2KJ8 A;  4QWB A;  4IRC A;  2Y1J A;  3IHQ B;  5T14 A;  2WF6 A;  4C8N A;  3HW8 A;  3TAR A;  3N28 A;  1COK A;  3ZDD A;  2D3D A;  1NOM A;  2HHX A;  2FMS A;  3TAD A;  3PW7 A;  5KG7 A;  3OHA A;  5C5J A;  3PW5 A;  2NRZ A;  2PKE A;  4ED1 A;  4ACO A;  1MQ2 A;  7ICH A;  2PFN A;  1KFS A;  4B9S A;  3F2D A;  4P0Q A;  1Z00 A;  2F8K A;  5AKY A;  5KT6 A;  1XWL A;  4XA5 A;  4YVZ A;  3PSF A;  2R8I A;  1NK0 A;  4C8K A;  5ALX A;  3RJK A;  1VDV A;  1S0V A;  3MC1 A;  2F44 A;  4IQW A;  4UAS A;  4LZG A;  3I76 A;  3UXN A;  2KIC A;  4OO1 J;  1ZQN A;  3MGV A;  4F4X A;  4MEY A;  7ICV A;  5KFA A;  9ICG A;  2MRL A;  1X9X A;  1S76 D;  2EAN A;  3QUQ A;  5DKW A;  4B9M A;  4JUZ A;  4HAI A;  1QQ5 A;  4MF8 A;  2BDU A;  5AKK A;  1TVA A;  1FIQ A;  1P7D A;  5KG6 A;  1DGJ A;  4P0P B;  3FAH A;  2PFQ A;  2OWO A;  3IM1 A;  5EE3 A;  1RQL A;  5KL1 B;  4M9J A;  3E0F A; 
#chains in the Genus database with same CATH homology
 1UCV A;  2LPE A;  2Y9T A;  1OXJ A;  5JU5 A;  1WWV A;  3KKA C;  5JTI A;  1Z1V A;  2KG5 A;  2ES6 A;  2QB0 A;  2K4P A;  1LKY B;  1COK A;  1SV4 A;  1SXE A;  2D3D A;  3SEN A;  2Y9U A;  2LMR A;  4NJ8 A;  1WWU A;  1SGG A;  3TAD A;  2B6G A;  3HIL A;  2GLE A;  1PK3 A;  2DKZ A;  1OW5 A;  3K1R B;  2JV3 A;  4NL9 C;  1SV0 C;  2QB1 A;  1RG6 A;  2F8K A;  1LKY A;  2F3N A;  5J8Y A;  5F3X B;  2KE7 A;  4RQN A;  2KSO B;  1PK1 B;  2E8O A;  5KNI A;  5L1M A;  2FE9 A;  2QAR B;  2F44 A;  1JI7 A;  1X40 A;  2KIV A;  4PZN A;  4MHV A;  2QKQ A;  3H8M A;  3TAD C;  2DL0 A;  1UQV A;  5JRT A;  2KMD A;  1V85 A;  2E8M A;  1SXD A;  4RQM A;  2EAM A;  2ESE A;  1PK1 A;  2DKX A;  3BS5 B;  1SV0 A;  1X9X A;  3TAC B;  4PZO A;  2EAN A;  3SEI A;  3KKA A;  1V38 A;  2E8N A;  3BQ7 A;  2EAP A;  3IDW A;  2YTU A;  1X66 A;  2EAO A;  2D8C A;  2L5Y A;  3BS5 A;  2QB0 B;  1B0X A;  3BS7 A;  2KSO A;  1DXS A;  1F0M A;  4NL9 A;  2K60 A;  1B4F A;  2E8P A;  4IS7 A;  2QAR A;  1KW4 A;  5J8Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...