2DF4B

Structure of trna-dependent amidotransferase gatcab complexed with mn2+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
399
structure length
399
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 117
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2df4B02
2F2AB 3H0MB 3KFUF 2G5HB 2DF4B 2DQNB 1ZQ1C 3H0LB 3IP4B 4WJ3B 3AL0B 3H0RB 2G5IB 2D6FC
chains in the Genus database with same CATH superfamily
2UVVA 5KFFA 3QNMA 5J2HA 3UQ0A 5AIAA 3H40A 9ICLA 1ZQDA 1BGXT 2DWQA 4JK1A 4M6WA 2K4IA 5KAIU 3BQ7A 4R63A 5DB9A 4NV0A 4RUCA 5AM5A 2W7OA 2WF9A 4CF4A 3M1YA 4C4SA 4CF5A 3T3FA 3Q8MA 1QTMA 3ZDBA 4KMUA 4GFJA 3M6KA 1F5SA 2YMPA 5J8YA 3ZDDA 2HHQA 1RM6C 4KLTA 2XGPA 5AK4A 3SAHA 9ICWA 3PNCA 1Q3VA 4F5NA 5KG5A 3MDAA 5ALRA 2DFLA 4ELUA 5IIMA 4KX3A 4NY8A 3KD3A 4DSKA 5KT6A 1RQLA 1TV9A 1PVPA 8ICTA 2JV3A 4O5CA 4Y2XA 1ZQGA 5ALTA 2DUYA 1LKYB 1L7OA 5AK6A 5ALHA 4J9SA 4QZ9A 3D6JA 4DF8A 1D9FA 2FLNA 1WYGA 3F5EA 5J29A 4C4TA 4QW9A 5EE0A 4DFJA 2PXIA 8ICRA 8ICHA 3HRDD 4KLGA 4XRHA 4C8OA 2JR5A 1X9MA 4RQ0A 1Z1BA 5AKKA 5ALFA 3GDXA 1QSLA 1VJ5A 3WKCA 5L9XA 5DB8A 2RQ5A 3Q8KA 2DPJA 1WWUA 2F1IA 4CDGA 4O5KA 3FDSA 2OWOA 5KFNA 3MC1A 2E8NA 4UAYA 2YMLA 2Y1IA 1XU4A 2AH5A 3Q8QB 4NL9A 4KLHA 1URJA 2KHVA 4J03A 1JROA 2MUTA 1NK0A 2BZFA 2ZUBA 4CNQA 1XSLA 5ALXA 3ZD9A 4NWIA 2V4QA 1RG6A 2ISPA 2P6RA 5ALGA 3RJGA 2IOHA 3IM1A 5AKEA 1SZHA 4B9NA 5ALLA 4MHVA 2I9GA 2HOQA 4DQIA 1A6SA 1K5OA 2QLTA 7ICFA 4F8RA 4QW8A 4RNNA 2F77X 2WB1C 2PFQA 4QZGA 1TK5A 5L1LA 3G6VA 1XO0A 2YY6A 5ALZA 4JWNA 1V97A 1L8LA 5DB6A 2XIDA 4HYKA 3S6JA 2ZUCA 2NRWA 1SXDA 2C22A 2RLTA 2D3DA 4YMMA 4I2EA 2LM1A 3RBDA 5T14A 2Y0SF 3QXGA 1TE2A 4ELTA 3M8RA 3GV5B 2D6FC 3NRZA 5AM4A 3UPQA 7ICVA 3LYSA 5AICA 8ICGA 2RP5A 2QARA 5DQGA 3NASA 4JV0A 2YB4A 4R66A 3H8MA 4BXOA 1ZQEA 3AMZA 1B4FA 4CF3A 5DGAA 2JZBA 4UAUA 2BQRA 2HVHA 8ICQA 2M9NA 5A0LA 4Q8FA 4YN4A 2W8KA 2DPIA 3H7IA 2WF7A 3UXNA 2RDIA 1X40A 4DL2A 4KLDA 3PY8A 2IOFA 3WK4A 1ZOLA 2JEFA 4JV2A 5HP4A 3RB0A 4EEYA 4BGDA 3OJSA 1SV0C 3QYPA 1NKBA 1KN5A 4QJFB 1T3NA 1P7DA 5J2CA 2IBKA 4KLLA 5CWRA 2I6XA 1D8BA 2HSZA 2KJ9A 4UBCA 4F5RA 2EAPA 1NZBA 2H3FA 3MGVA 2BPFA 3UM9A 1DGSA 1Z19A 5CRXA 1ZXIA 1KTQA 4I2FA 3KZIU 2B0CA 5TISU 1UCVA 2IMWP 3K1RB 1C20A 4DSJA 4AP9A 3QZ8A 9ICMA 3MGHA 4F4ZA 4DFDA 4DEZA 3TAQA 4ELVA 5ALSA 4DS4A 1A77A 4LVSA 4MFAA 1ZQTA 2P6UA 1ED1A 1JUDA 2JH1A 7ICPA 1ZQSA 1L3TA 1N62A 2PFNA 2O6KA 3DDHA 3TANA 3THVA 2DKXA 4QNLA 4YD2A 4EZ6A 2F3NA 3NS1A 4Y2RA 3PSPA 4RQNA 3GIKA 1RPLA 4KLMA 1BPYA 3GIJA 2XVTA 3MR5A 9ICAA 2WAQC 2BGWA 2JHDA 5BOLA 5IINA 2G06A 4RQ3A 2V9WA 1FEZA 4FS2A 9ICIA 4DFMA 3MDCA 2G07A 3RRGA 2CRXA 1T94A 4KX5A 5JRTA 3ALRA 4ED0A 2E5SA 2EH9A 9ICRA 4UASA 1L7NA 1SWVA 2Q0ZX 4F2RA 2ZTDA 4YR0A 3OJUA 3KFUF 4O3SA 3PSTA 2E3TA 4ICAA 4PJ0U 3JPTA 5DDYA 4EBCA 1UT5A 2M0NA 2HHXA 8ICXA 1SZPA 3EPGA 2PMZC 2KKPA 2K60A 4KMOB 2CXYA 1NK8A 3JPRA 5HR6A 3AU6A 1NJXA 1SWWA 4DSLA 3RB3A 2KG5A 3MFIA 2HHWA 8ICAA 3T5HA 5CJ7A 4RQ8A 2KSOB 5J0XA 2ZIUB 4C80A 3RH6A 5AM1A 4RQ7A 2A1JA 4EELA 3PMNA 3T5KA 2KV2A 1ZQQA 8ICJA 9ICCA 5KAFU 1H38A 2VIXA 2CN1A 2K89A 7ICHA 3WK5A 1IM4A 2Q4TA 5HMMA 2NRTA 8ICIA 9ICJA 4Y2QA 2HMXA 4DLGA 2HBMA 5ALUA 4J9OA 2KHQA 4TUSA 4K4IA 5KG0A 2EZZA 3ZDAA 4YG2A 1NK4A 3QUBA 2ZIXB 1SKSA 4C8MA 5KFAA 4CCHA 2QB1A 3HWTA 7ICMA 4U6PA 2P66A 1V38A 4B6JA 4FZNA 2KICA 4QZAA 4RPZA 5ALIA 2W9BB 3PW5A 3E58A 1SL0A 3KOOA 1M6YA 2ODGA 3TADC 9ICVA 4QWEA 3OHAA 2KP7A 1U4BA 2E8PA 3NUQA 1JMSA 4C8KA 1N61A 3NGDA 4K4GA 5HNKA 3QUCA 3U26A 3HKZF 4UB2A 4GLXA 5KFHA 3L3FX 4EZ9A 2XCAA 2J6TA 3ZI4A 3C2LA 4U7CA 4GXKA 1WWVA 4OJPA 4O3NA 3PV8A 4RT2A 2C28A 3C2KA 1X6JA 3KTQA 3WKBA 4OJOA 5KFQA 3CW2C 4KLJA 1GO3F 1TKDA 4I29A 5C0YA 4UAWA 5KL1B 4BUGA 5H2FU 2AHOB 4DQSA 4PHAA 3D2QA 2BR0A 2KJ5A 3K1ZA 1NK5A 8ICUA 1TAUA 5DB7A 3F53A 1T3QA 3KZXA 4YCXA 1SV0A 5J0UA 4F4YA 5KFMA 2FPKA 4OD0A 3RJHA 4P4PA 3SAFA 4F2SA 1EXNA 4QWDA 1DK2A 5ALDA 3M9OB 3IG8A 1K1SA 3LWMA 1KBUA 2K8AA 4R8UB 2BCSA 3K75D 1UPHA 2F8KA 4DL5A 1KFDA 3Q8PB 4OJLA 2IHNA 4O3MA 2C2DA 4UBBA 2UVUA 5JUMA 5K4LA 4DQRA 2H3VA 7ICEA 3CP8A 4M9JA 5J0OA 4CGZA 4K4HA 3PW7A 4M04A 1U9LA 4QZ8A 2HCFA 2K4HA 3BS5A 5J2AA 3BJYA 2FMPA 3TI0A 8ICVA 4CRXA 4XUSA 1S0OA 3RBEA 2DF4B 3WU2U 4EBDA 3NVYA 3EUB2 2ZXHA 3WKEA 4PZNA 4LZGA 2YMMA 3SR6A 5HMLA 4PGYA 3V7JA 2W7PA 4DL4A 1LB2B 2MU2A 1NKEA 3G6YA 3SV4A 2LPEA 4PZOA 2P35A 2BDPA 4M0AA 5KFVA 4ECRA 2AJQA 4I2AA 4O5EA 1S77D 2PI5A 2XGQA 4ED8A 1ZD3A 1Z4OA 3IV6A 5KFIA 1PVQA 8ICEA 5D49A 4O3OA 1S10A 2R8GA 4US9A 9ICFA 4IC9A 2MAXA 1KDHA 1QSSA 2ZXIA 1S97A 4YXMA 2PFPA 1ZQLA 4NLNA 3HILA 5AI4A 2A1AA 4C7ZA 2FPLA 2W55A 5DBBA 3C5FA 4ED2A 5ALVA 5KG2A 4UB6U 5KFGA 4Z6DA 3PO5A 2VA8A 3MR3A 4TUPA 2EDUA 1YT3A 2EZYA 1Y88A 4DQPA 4RNMA 2VA3A 3M8SA 5KNIA 4I2IA 1ZQHA 3TFRA 4E0DA 1AQ6A 2GH1A 1JN3A 1KSPA 1ZQUA 2AGOA 5AKGA 5AKHA 2NRXA 9ICOA 2H5XA 4RZRA 4DWIA 1D8YA 3GQCA 4G3IA 1V85A 1BPBA 4NM1A 4ED1A 1L7MA 1HJPA 2UVWA 5KFSA 3OHBA 1IG6A 2XI9A 4XA5A 5KFLA 4KTQA 2NO4A 2W8LA 1L3SA 5ALOA 5KFWA 4MF2A 2YX8A 4C0ZA 5L1MA 3RH4A 4OCZA 4YVZA 3RJIA 2C2RA 4KLSA 1QH9A 3WKAA 3HT3A 2LYHA 4IR9A 3MBYA 3G6XA 4NLKA 3C29A 4DL6A 4F5PA 3RF9A 3M6ZA 4QZCA 2R8IA 3ZDCA 5CP2A 4DL3A 1O08A 2R8JA 2NYVA 5EE1A 1DK3A 4FZLA 4JB3A 2MSNA 4Y2SA 2B6GA 3ORYA 4F5QA 3BDPA 2GOLA 2JGAA 1UA0A 3TADA 4Z6FA 4PH5A 2XCPA 1XS9D 5KT5A 2WF6A 3HPOA 3RB4A 3RJFA 1X2IA 3V6JA 2ZJ8A 1X9SA 1SXEA 1MQ3A 3C28A 2DGZA 2DKZA 1QQ6A 2QKQA 4KLUA 1RXWA 2W9CB 1IXRA 5KFRA 2K8CB 5GTIU 4I27A 8ICPA 5DLFA 5ALNA 5KL8B 3BQ0A 5HHIA 8ICOA 1FIQA 1K1QA 2KJ8A 1NNLA 2KIWA 2ZIVB 1ZQYA 1U47A 2FMQA 3B9JA 1XSNA 3NRWA 5J0QA 3GIMA 1JI7A 1SKWA 4UB5A 3BQ1A 3B0XA 1F0MA 2G5HB 2WHEA 1ZQKA 4IR1A 3UMGA 3PMLA 4F4XA 2RDJA 2JRZA 5AM2A 3A0HU 5DG7A 1DRGA 1Z4NA 3DV9A 1RXVA 1UA1A 1ZQMA 1L8OA 3ZD8A 4PPXA 3C1ZA 1S76D 1FO4A 5L1KA 4IQUA 1TAQA 5G5HA 4NLBA 1SV4A 4CE6A 3RJJA 1N48A 9ICHA 2VKQA 1FFVA 5KFJA 4F50A 2BCQA 3RB6A 2ZIWA 3JPOA 4NM2A 2YQEA 2HHUA 4KLOA 3VCBA 4DSIA 4RQ5A 5J2KA 1L7PA 5CEHA 3HJEA 5DG9A 4IRKA 2WTFA 2BKEA 1PUZA 4ZH4A 3WK7A 4J9PA 4OJ6A 2NO5A 5EE9A 1ZQZA 1OUQA 5CB1A 4IQTA 4AYBF 4PHPA 8ICLA 5AI5A 5DQIA 3JPQA 2KOBA 4QZEA 4ACOA 2F8LA 5KG7A 4YMOA 4ZOHC 2QARB 3SEIA 3IN5A 1ECWA 2W11A 3N28A 2XC9A 2UVRA 1XC9A 3TARA 5JU5A 3RTVA 3LK9A 4JWMA 1Q3UA 1ZQOA 1N5WA 2JZBB 4ECZA 2W9AA 1BPZA 5ALYA 4US8A 4DSEA 3SQIA 5ALKA 3R9KA 1S0NA 4J9QA 4X5VA 3BS7A 4Y2TA 2W3SA 4C7YA 2Z7JA 4ECSA 5DDMA 2W9MA 3C21A 5KG6A 4DOCA 2GWSA 2KSOA 2PFOA 5IIIA 4ECXA 2NRZA 2N1RA 5AM0A 3N7RC 2VJ4A 3HW8A 3D2SA 3PX6A 4KN4A 3HKZC 3ISCA 2KZ3A 2QB0B 2I1QA 3M9MB 8ICNA 4MEXA 2HI0A 4FE3A 2LKYA 5KT3A 3EW9A 2HDOA 3N4MB 1S5LU 1NI3A 2AGPA 4IL6U 5AI0A 3ETRA 1N63A 4YMNA 3QU2A 4Q44A 1YZ7A 2PKEA 1RYUA 2NV3A 3K4GA 3NVWA 5IILA 2Y9UA 4QWCA 3C5GA 3BQTA 1PK1A 5KFKA 1MSWD 3EYZA 4NLZA 1BPDA 4QZDA 3RH5A 4IS7A 4DFPA 3C2MA 3HP6A 3AL0B 4PL2A 1ZQWA 4O3PA 3RJEA 4FO6A 3MGIA 3OTQA 1N60A 4P4MA 1L3VA 2J6UA 1CI4A 2MA1A 1L6NA 1ZRMA 3UMBA 4UB3A 2KIVA 3SENA 2OXOA 3T79A 2OH2A 1MC8A 4QIWF 4EX6A 5J2IA 1HEKA 5AKIA 2A3VA 1L3UA 5E79U 4ECYA 1C7YA 3GZFA 1ZQVA 2FLLA 2J6SA 2HBJA 4RUAA 4QWAA 1V9PA 3L4PA 4I2CA 5KT2A 1RQNA 4J9LA 8ICBA 3A0BU 2I5HA 4FBTA 8ICSA 3MR6A 1QQ5A 4R64A 4NLGA 4JV1A 1ZQPA 3V6HA 2JEGA 4KLEA 2FDRA 2AQ0A 3JPNA 2ZJ5A 1ZQBA 3F5AA 1O03A 4DLEA 4P0QA 1SKRA 4C8NA 2KFNA 1X6IA 3FYHA 4DOBA 5BOMA 1NJWA 2V4RA 2AQ4A 1JXEA 4DS5A 4UAVA 5G5GA 1N56A 2WF5A 3Q8RB 3H0RB 3GIIA 3VC8A 2OEHA 3MFHA 4WJ3B 4J9NA 4P0PB 1VLBA 1A76A 1COKA 3QEAZ 3H8JA 5TZVA 2C2EA 2G09A 1Z00A 4J9RA 4KLIA 5DBAA 2WAQF 4I28A 2HBKA 3ETLA 1NKCA 1ZQJA 2NRVA 5AKZA 1F44A 1L5UA 4BWJA 3NTUA 4G9BA 2A19A 3GV8B 4XQ8A 3T5JA 4DOAA 4I2GA 4IRCA 2RHFA 2E1EA 4M47A 2IOFK 1BPEA 2KVSA 5DLGA 7ICLA 3KKAC 4J9MA 5EWFA 2FMSA 4M9NA 4IQVA 3C23A 5ALPA 3PSFA 2F1HA 4F3OA 5ALQA 3PO4A 2LYBA 2ZTEA 2PMZF 5J0RA 3BZKA 5KG1A 4MFFA 4YP3A 1UT8A 1ZQNA 5KFYA 7ICTA 1XNSA 4I2HA 4PL1A 1JXLA 4ED7A 2YN4A 2BQUA 4GC6A 2KK0A 5B66U 4I2JA 5J0SA 3QU7A 1LVHA 3H0LB 5ALEA 1XO1A 3C1YA 5KFCA 1T8EA 2RRDA 3N7PD 5J2DA 4FBUA 3ZDEA 2F1JA 1UQVA 2ISOA 2KNJA 2HOIA 3V7KA 4FS1A 1LKYA 4M9GA 4QZFA 2BQ3A 4B9MA 3QX7A 3PX4A 1ZJMA 1OXJA 1J2NA 2G0AA 3H8WA 5CR0A 5EWGA 1X66A 2ATLA 3KHLA 2JXJA 3AUOA 3SV3A 4TUQA 2H3ZA 1HIWA 5AI9A 3BZCA 3UXOA 2H3IA 2Y1JA 4Y2VA 1U48A 2DBYA 1NK6A 5D46A 1WCLA 4DSFA 5KFZA 3WKDA 4EYIB 3MR2A 1CUKA 2E1FA 1TFRA 3QU4A 1IV8A 7ICKA 1B22A 4YQWA 2CPRA 3I28A 1PZNA 4GIBA 4NJ8A 1QQ7A 3JPPA 2Y0SC 3Q8SB 3JPSA 1SL1A 5B5EU 3N7SC 3OSNA 4MF8A 1MQ2A 5J2FA 1ZRNA 2XICA 2AU0A 1YZ6A 3RFAA 1MA7A 1B0XA 4F71A 4F92B 5HR7A 3ED5A 4RPYA 1RZTA 5EE3A 2YMQA 2D8CA 3IHQB 2KMDA 4UW9A 1SL2A 9ICGA 1U45A 3AN1A 3BS5B 4NLCA 2IHMA 3AEVA 2ZTCA 3N97B 1WUDA 1HUOA 1VDVA 2BCVA 2MRLA 2K4PA 4B9LA 2KKVA 2E8MA 4BJQA 2BPGA 2B21A 1T4GA 4B9SA 2LBOA 3ICXA 3PR4A 4RNOA 1U49A 2W9CA 5AK3A 4TURA 2JH7A 4A8EA 1ZQIA 3RRHA 4M6WB 1SIJA 9ICEA 3EWAA 3CYMA 4TQSA 1D9DA 2ZIVA 4YR2A 1Z1VA 2XY7A 4RQMA 4I2BA 3H0MB 1KQQA 4MFCA 3AM9A 2ESEA 1BVSA 5D4BA 3CRXA 4AYBC 3PVXA 2ZG6A 1UHUA 1SB3C 3AQEA 3QZ7A 4BWMA 2F76X 3OSPA 1JRPA 2IA6A 1KLNA 4I2DA 3RR8A 2WF8A 4Y2YA 1WG8A 2ASLA 1LV5A 1NOMA 2LYAA 3LVWA 1BPXA 3NVVA 5KFOA 2G08A 2LI6A 3PW2A 5J0PA 4F5OA 1X9WA 3SYZA 4YD1A 4UB4A 3QEBZ 9ICNA 2GO7A 3PW4A 1S8OA 1ZQCA 1ZQFA 1COOA 3WK6A 2K4EA 1KFTA 4GXJA 3I1YA 4F4KA 4Q43A 4OJ5A 9ICPA 4NXZA 9ICXA 3SI8A 2ZUDA 9ICKA 4ECWA 3LDAA 4B9UA 1DGJA 3GU3A 1ZD2P 4Y2UA 3UXPA 1NJYA 3KHGA 4EEKA 4DF4A 3PX0A 5DGBA 2BDUA 3UQ2A 2HHVA 3H4DA 4YFKA 3KKAA 4RQ1A 3V6KA 4BX9C 3RAXA 1X42A 5AKYA 2HHSA 5AM3A 1NJZA 3CNHA 2R8KA 2K8BB 1ZQ1C 4JUZA 5KFTA 1N2XA 4F91B 2MUTB 3PW0A 1DXSA 5J0TA 4FFDA 5DQHA 1SGGA 5AIBA 5J2BA 5JTIA 1S0MA 4FZMA 5AI8A 2R18A 7ICNA 5J0YA 2VANA 1A0PA 5AHXA 3LVVA 3F2CA 2DQNB 2XY6A 3IP4B 4QIWC 3NVZA 3M9NB 5F3XB 2DL0A 4R65A 1Q46A 2QB0A 2HOFA 2GLEA 4DFKA 4RQ4A 7ICGA 5J2JA 5KT4A 3PSIA 3F2DA 7ICUA 9ICBA 3AU2A 9ICSA 8ICZA 4QZIA 3V7LA 1TVAA 3D2NA 5KT7A 4OO1J 2W03A 1S0VA 3F2BA 3RJKA 9ICQA 4ECUA 2EANA 2F2AB 2E8OA 8ICWA 8ICCA 4DL7A 5C5JA 2KZZA 5IIKA 2HBLA 1PVRA 3SMVA 2KFZA 4F4WA 9ICTA 4BXOB 1JIHA 3FC4A 2XO7A 8ICMA 2JEJA 2HVIA 3IG5A 4LZDA 2W3RA 2KVCA 4KN7A 3DEEA 1NZPA 5L1JA 4YR3A 4F72A 4F93B 4MEYA 2W04A 3FM9A 3FAHA 1XSPA 2OHFA 4JMUA 5J0WA 5F9LA 3HX0A 3OGUA 2ZIUA 1QSYA 7ICJA 1ZQAA 7ICOA 4P4OA 2WB1F 5AKLA 9ICUA 4IRDA 5KG3A 5IIJA 1KL9A 1XWLA 4EYHB 5EWEA 2OM6A 2KE7A 2ALZA 5GTHU 5KFXA 4Z6CA 2ZIWB 2ZJAA 5F9NA 3KHHA 4RPXA 2FLPA 4QZHA 4EENA 2EQYA 5ALWA 1DOQA 2ZIXA 1RDFA 2KN7A 4M2YA 2FE9A 4UARA 4C4RA 3OPXA 2BHNA 1B43A 2YB1A 3V72A 5J8YC 1RYRA 4Y2PA 4KLQA 3GILA 1KRPA 2KEYA 4O0IA 2W9BA 5AI6A 3QUQA 1TK0A 1JX4A 1BNPA 2R8HA 2JMGA 3I76A 2XY5A 1TK8A 2FJ6A 1X9XA 3RR7A 5KTQA 4LJXA 3L5KA 2PI4A 1KEJA 4DQQA 2BPCA 2EZXA 3B0YA 4YXJA 4UQGA 4P0PA 1CRXA 2BCRA 5CA7A 4Y2JA 4ED6A 7ICIA 8ICYA 3SD7A 5EOZA 7ICRA 3BQ2A 1Z3EB 3KBBA 3PZPA 2H3QA 4DO9A 3ONNA 1MN8A 1NK9A 4Q8EA 4UAZA 2G5IB 4B9VA 4UATA 4EBEA 1RYSA 4M9HA 4UB8U 4IQWA 3T5LA 1CEZA 4KLFA 4ECQA 2LMRA 2FI1A 2KD1A 7ICSA 3SAGA 2HHTA 4C8LA 4P2HA 3EZ5A 2EAOA 1OW5A 4KITB 4M9LA 4PHDA 4ED3A 2ASJA 1ZJNA 3GFKB 3Q8LA 3E0FA 4PGXA 3UMCA 3O0FA 3MABA 4ECVA 2OYYA 4NL9C 3RAQA 3TKAA 3TQ1A 4R8UA 4TQRA 2FPMA 5KFUA 4Z6EA 1FFUA 1PK1B 1AROP 3AQFA 3QU9A 1KFSA 2F44A 4B9TA 3GV7B 2BCUA 4O3QA 2ES6A 5AKXA 5FP0A 4ECTA 3EPIA 1KKXA 3H8SA 1T7PA 4J9KA 5KFPA 3WK9A 2AGQA 1KW4A 1IIPA 2A1JB 2LHTA 2AXTU 2W54A 1PK3A 4USAA 2ASDA 2LM4A 3H4BA 3IRUA 1QCKA 2Y9TA 3TFSA 4DCCA 4BDPA 1ZD4A 5HHHA 3WK8A 5ALMA 8ICKA 4PGQA 5CHGA 2JEIA 1Q8KA 2WFAA 1J97A 4GC7A 4Q45A 1QLNA 3ISDA 4RU9A 1D8LA 3TAPA 5AKJA 5DBCA 4P0QB 5DG8A 2OCEA 1S9FA 2VA2A 4QZBA 8ICFA 1ZETA 5J2EA 4QWBA 1NK7A 2W43A 5BPCA 1HUZA 1N5XA 2EAMA 2YTUA 3QU5A 3LWLA 3M7DA 4RT3A 7ICQA 3ISBA 4PHEA 1ZQRA 1WCNA 1TAMA 5KG4A 5IIOA 4RQ6A 4UB1A 5KFBA 3KHRA 1ZYQA 5DKWA 5AK5A 4O3RA 1ZD5A 1Z00B 3QUTA 1BNOA 2KZMA 4HAIA 3QE9Y 2HW3A 5J2GA 3E2EA 3TACB 3SZ2A 5KFDA 4RQ2A 5L1IA 2VJ5A 1ZQXA 3PR5B 4O9MA 2KTQA 4EX7A 2L5YA 1J2MA 3IDWA 4GXIA 3J81j 5ALJA 1JALA 5KFEA
chains in the Genus database with same CATH topology
2KIWA 4U6PA 1Q3UA 1IIPA 2JMGA 4CGZA 4FZNA 1T94A 2G08A 3SQIA 2XICA 2KICA 2LHTA 3ALRA 4KX5A 2E5SA 3D2NA 4CDGA 3RFAA 3PSFA 1MA7A 2CRXA 4OO1J 2W03A 3F2BA 2LYBA 5HR7A 2PMZF 2K4HA 2F2AB 2XI9A 3KFUF 3NRWA 2Z7JA 4P0PA 1CRXA 1URJA 2K4IA 2KHVA 4CRXA 2K4EA 3PSTA 4NV0A 4QJFB 2DF4B 2HBLA 2YX8A 3SMVA 4ICAA 4C0ZA 1PVRA 1XNSA 1P7DA 2W7OA 4OJ5A 3PZPA 4PL1A 3NUQA 2N1RA 2H3QA 3N7RC 2VJ4A 2ZXHA 3D2SA 4NLCA 2G5HB 3HKZC 3IG5A 3N7SC 3F5AA 3ONNA 4GFJA 2KVCA 3HKZF 1WUDA 3DEEA 1D8BA 3M6KA 2KJ9A 3L3FX 2W7PA 2M0NA 4NWIA 4P0QA 3GU3A 3H0LB 1DRGA 1NZBA 2H3FA 3C29A 3MGVA 2G5IB 2PMZC 2MRLA 4U7CA 2KKPA 2W04A 4FE3A 3SAHA 3RF9A 4KMOB 2KKVA 5CRXA 1Z19A 1Q3VA 2LKYA 3M6ZA 1SZHA 4OJPA 4BJQA 2BDUA 5HR6A 2HOQA 4JMUA 1A6SA 2LBOA 3ICXA 4NLBA 2RRDA 3N7PD 4OJOA 4BX9C 1PVQA 2KD1A 4P0QB 1GO3F 3H0RB 3SAGA 2ZIUA 2KNJA 2VKQA 3VC8A 2HOIA 4KX3A 4FZLA 5C0YA 2F77X 2WB1C 4IC9A 5KL1B 2JH7A 4A8EA 4BUGA 4WJ3B 2WB1F 4P0PB 2ZIWA 2NV3A 1XO0A 2ZXIA 1PVPA 2K8BB 1ZQ1C 2G0AA 3D2QA 3E0FA 3CYMA 2KJ5A 3O0FA 3K1ZA 2XIDA 2G09A 2ZIVA 2ZIUB 3VCBA 2GOLA 2JGAA 2H3ZA 2OM6A 1HIWA 3F53A 3KZXA 3M7DA 2KV2A 2OYYA 2WAQF 1TAMA 2ZIWB 2H3IA 2Y0SF 5T14A 1ED1A 3H0MB 2ZIVB 2JH1A 1YT3A 4OJ6A 3AL0B 2HBKA 4PL2A 3SAFA 3F5EA 2VIXA 2CN1A 2D6FC 1OUQA 3CRXA 2K89A 4AYBC 3AQFA 4FZMA 2ZG6A 2E1FA 2Q4TA 2R18A 2ZIXA 3IG8A 4QNLA 4AYBF 3LYSA 1F44A 1A0PA 3C28A 2RP5A 2DGZA 2MA1A 3PSPA 1KBUA 2K8AA 2KOBA 2YB4A 3AQEA 3LVVA 3OPXA 2YB1A 2DQNB 3F2CA 1L6NA 2CPRA 3IP4B 4ACOA 2F76X 2HMXA 2HBMA 1UPHA 2KHQA 4QIWC 2OXOA 3T79A 2GH1A 2OH2A 2F8LA 2XVTA 4QIWF 2VJ5A 3F2DA 2K8CB 2ZIXB 2RHFA 2WAQC 1Z1BA 1HEKA 2JHDA 2E1EA 2Y0SC 2HOFA 2G06A 2A3VA 4OJLA 5A0LA 4O3MA 3IN5A 2KEYA 3GZFA 1ECWA 5KL8B 2LYAA 3LVWA 2H3VA 2HBJA 2G07A 3CP8A 2KJ8A 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  3H0M B;  3KFU F;  2G5H B;  2DF4 B;  2DQN B;  1ZQ1 C;  3H0L B;  3IP4 B;  4WJ3 B;  3AL0 B;  3H0R B;  2G5I B;  2D6F C; 
#chains in the Genus database with same CATH topology
 2UVV A;  5KFF A;  3QNM A;  5J2H A;  3UQ0 A;  5AIA A;  3H40 A;  9ICL A;  1ZQD A;  1BGX T;  2DWQ A;  4JK1 A;  4M6W A;  2K4I A;  5KAI U;  3BQ7 A;  4R63 A;  5DB9 A;  4NV0 A;  4RUC A;  5AM5 A;  2W7O A;  2WF9 A;  4CF4 A;  3M1Y A;  4C4S A;  4CF5 A;  3T3F A;  3Q8M A;  1QTM A;  3ZDB A;  4KMU A;  4GFJ A;  3M6K A;  1F5S A;  2YMP A;  5J8Y A;  3ZDD A;  2HHQ A;  1RM6 C;  4KLT A;  2XGP A;  5AK4 A;  3SAH A;  9ICW A;  3PNC A;  1Q3V A;  4F5N A;  5KG5 A;  3MDA A;  5ALR A;  2DFL A;  4ELU A;  5IIM A;  4KX3 A;  4NY8 A;  3KD3 A;  4DSK A;  5KT6 A;  1RQL A;  1TV9 A;  1PVP A;  8ICT A;  2JV3 A;  4O5C A;  4Y2X A;  1ZQG A;  5ALT A;  2DUY A;  1LKY B;  1L7O A;  5AK6 A;  5ALH A;  4J9S A;  4QZ9 A;  3D6J A;  4DF8 A;  1D9F A;  2FLN A;  1WYG A;  3F5E A;  5J29 A;  4C4T A;  4QW9 A;  5EE0 A;  4DFJ A;  2PXI A;  8ICR A;  8ICH A;  3HRD D;  4KLG A;  4XRH A;  4C8O A;  2JR5 A;  1X9M A;  4RQ0 A;  1Z1B A;  5AKK A;  5ALF A;  3GDX A;  1QSL A;  1VJ5 A;  3WKC A;  5L9X A;  5DB8 A;  2RQ5 A;  3Q8K A;  2DPJ A;  1WWU A;  2F1I A;  4CDG A;  4O5K A;  3FDS A;  2OWO A;  5KFN A;  3MC1 A;  2E8N A;  4UAY A;  2YML A;  2Y1I A;  1XU4 A;  2AH5 A;  3Q8Q B;  4NL9 A;  4KLH A;  1URJ A;  2KHV A;  4J03 A;  1JRO A;  2MUT A;  1NK0 A;  2BZF A;  2ZUB A;  4CNQ A;  1XSL A;  5ALX A;  3ZD9 A;  4NWI A;  2V4Q A;  1RG6 A;  2ISP A;  2P6R A;  5ALG A;  3RJG A;  2IOH A;  3IM1 A;  5AKE A;  1SZH A;  4B9N A;  5ALL A;  4MHV A;  2I9G A;  2HOQ A;  4DQI A;  1A6S A;  1K5O A;  2QLT A;  7ICF A;  4F8R A;  4QW8 A;  4RNN A;  2F77 X;  2WB1 C;  2PFQ A;  4QZG A;  1TK5 A;  5L1L A;  3G6V A;  1XO0 A;  2YY6 A;  5ALZ A;  4JWN A;  1V97 A;  1L8L A;  5DB6 A;  2XID A;  4HYK A;  3S6J A;  2ZUC A;  2NRW A;  1SXD A;  2C22 A;  2RLT A;  2D3D A;  4YMM A;  4I2E A;  2LM1 A;  3RBD A;  5T14 A;  2Y0S F;  3QXG A;  1TE2 A;  4ELT A;  3M8R A;  3GV5 B;  2D6F C;  3NRZ A;  5AM4 A;  3UPQ A;  7ICV A;  3LYS A;  5AIC A;  8ICG A;  2RP5 A;  2QAR A;  5DQG A;  3NAS A;  4JV0 A;  2YB4 A;  4R66 A;  3H8M A;  4BXO A;  1ZQE A;  3AMZ A;  1B4F A;  4CF3 A;  5DGA A;  2JZB A;  4UAU A;  2BQR A;  2HVH A;  8ICQ A;  2M9N A;  5A0L A;  4Q8F A;  4YN4 A;  2W8K A;  2DPI A;  3H7I A;  2WF7 A;  3UXN A;  2RDI A;  1X40 A;  4DL2 A;  4KLD A;  3PY8 A;  2IOF A;  3WK4 A;  1ZOL A;  2JEF A;  4JV2 A;  5HP4 A;  3RB0 A;  4EEY A;  4BGD A;  3OJS A;  1SV0 C;  3QYP A;  1NKB A;  1KN5 A;  4QJF B;  1T3N A;  1P7D A;  5J2C A;  2IBK A;  4KLL A;  5CWR A;  2I6X A;  1D8B A;  2HSZ A;  2KJ9 A;  4UBC A;  4F5R A;  2EAP A;  1NZB A;  2H3F A;  3MGV A;  2BPF A;  3UM9 A;  1DGS A;  1Z19 A;  5CRX A;  1ZXI A;  1KTQ A;  4I2F A;  3KZI U;  2B0C A;  5TIS U;  1UCV A;  2IMW P;  3K1R B;  1C20 A;  4DSJ A;  4AP9 A;  3QZ8 A;  9ICM A;  3MGH A;  4F4Z A;  4DFD A;  4DEZ A;  3TAQ A;  4ELV A;  5ALS A;  4DS4 A;  1A77 A;  4LVS A;  4MFA A;  1ZQT A;  2P6U A;  1ED1 A;  1JUD A;  2JH1 A;  7ICP A;  1ZQS A;  1L3T A;  1N62 A;  2PFN A;  2O6K A;  3DDH A;  3TAN A;  3THV A;  2DKX A;  4QNL A;  4YD2 A;  4EZ6 A;  2F3N A;  3NS1 A;  4Y2R A;  3PSP A;  4RQN A;  3GIK A;  1RPL A;  4KLM A;  1BPY A;  3GIJ A;  2XVT A;  3MR5 A;  9ICA A;  2WAQ C;  2BGW A;  2JHD A;  5BOL A;  5IIN A;  2G06 A;  4RQ3 A;  2V9W A;  1FEZ A;  4FS2 A;  9ICI A;  4DFM A;  3MDC A;  2G07 A;  3RRG A;  2CRX A;  1T94 A;  4KX5 A;  5JRT A;  3ALR A;  4ED0 A;  2E5S A;  2EH9 A;  9ICR A;  4UAS A;  1L7N A;  1SWV A;  2Q0Z X;  4F2R A;  2ZTD A;  4YR0 A;  3OJU A;  3KFU F;  4O3S A;  3PST A;  2E3T A;  4ICA A;  4PJ0 U;  3JPT A;  5DDY A;  4EBC A;  1UT5 A;  2M0N A;  2HHX A;  8ICX A;  1SZP A;  3EPG A;  2PMZ C;  2KKP A;  2K60 A;  4KMO B;  2CXY A;  1NK8 A;  3JPR A;  5HR6 A;  3AU6 A;  1NJX A;  1SWW A;  4DSL A;  3RB3 A;  2KG5 A;  3MFI A;  2HHW A;  8ICA A;  3T5H A;  5CJ7 A;  4RQ8 A;  2KSO B;  5J0X A;  2ZIU B;  4C80 A;  3RH6 A;  5AM1 A;  4RQ7 A;  2A1J A;  4EEL A;  3PMN A;  3T5K A;  2KV2 A;  1ZQQ A;  8ICJ A;  9ICC A;  5KAF U;  1H38 A;  2VIX A;  2CN1 A;  2K89 A;  7ICH A;  3WK5 A;  1IM4 A;  2Q4T A;  5HMM A;  2NRT A;  8ICI A;  9ICJ A;  4Y2Q A;  2HMX A;  4DLG A;  2HBM A;  5ALU A;  4J9O A;  2KHQ A;  4TUS A;  4K4I A;  5KG0 A;  2EZZ A;  3ZDA A;  4YG2 A;  1NK4 A;  3QUB A;  2ZIX B;  1SKS A;  4C8M A;  5KFA A;  4CCH A;  2QB1 A;  3HWT A;  7ICM A;  4U6P A;  2P66 A;  1V38 A;  4B6J A;  4FZN A;  2KIC A;  4QZA A;  4RPZ A;  5ALI A;  2W9B B;  3PW5 A;  3E58 A;  1SL0 A;  3KOO A;  1M6Y A;  2ODG A;  3TAD C;  9ICV A;  4QWE A;  3OHA A;  2KP7 A;  1U4B A;  2E8P A;  3NUQ A;  1JMS A;  4C8K A;  1N61 A;  3NGD A;  4K4G A;  5HNK A;  3QUC A;  3U26 A;  3HKZ F;  4UB2 A;  4GLX A;  5KFH A;  3L3F X;  4EZ9 A;  2XCA A;  2J6T A;  3ZI4 A;  3C2L A;  4U7C A;  4GXK A;  1WWV A;  4OJP A;  4O3N A;  3PV8 A;  4RT2 A;  2C28 A;  3C2K A;  1X6J A;  3KTQ A;  3WKB A;  4OJO A;  5KFQ A;  3CW2 C;  4KLJ A;  1GO3 F;  1TKD A;  4I29 A;  5C0Y A;  4UAW A;  5KL1 B;  4BUG A;  5H2F U;  2AHO B;  4DQS A;  4PHA A;  3D2Q A;  2BR0 A;  2KJ5 A;  3K1Z A;  1NK5 A;  8ICU A;  1TAU A;  5DB7 A;  3F53 A;  1T3Q A;  3KZX A;  4YCX A;  1SV0 A;  5J0U A;  4F4Y A;  5KFM A;  2FPK A;  4OD0 A;  3RJH A;  4P4P A;  3SAF A;  4F2S A;  1EXN A;  4QWD A;  1DK2 A;  5ALD A;  3M9O B;  3IG8 A;  1K1S A;  3LWM A;  1KBU A;  2K8A A;  4R8U B;  2BCS A;  3K75 D;  1UPH A;  2F8K A;  4DL5 A;  1KFD A;  3Q8P B;  4OJL A;  2IHN A;  4O3M A;  2C2D A;  4UBB A;  2UVU A;  5JUM A;  5K4L A;  4DQR A;  2H3V A;  7ICE A;  3CP8 A;  4M9J A;  5J0O A;  4CGZ A;  4K4H A;  3PW7 A;  4M04 A;  1U9L A;  4QZ8 A;  2HCF A;  2K4H A;  3BS5 A;  5J2A A;  3BJY A;  2FMP A;  3TI0 A;  8ICV A;  4CRX A;  4XUS A;  1S0O A;  3RBE A;  2DF4 B;  3WU2 U;  4EBD A;  3NVY A;  3EUB 2;  2ZXH A;  3WKE A;  4PZN A;  4LZG A;  2YMM A;  3SR6 A;  5HML A;  4PGY A;  3V7J A;  2W7P A;  4DL4 A;  1LB2 B;  2MU2 A;  1NKE A;  3G6Y A;  3SV4 A;  2LPE A;  4PZO A;  2P35 A;  2BDP A;  4M0A A;  5KFV A;  4ECR A;  2AJQ A;  4I2A A;  4O5E A;  1S77 D;  2PI5 A;  2XGQ A;  4ED8 A;  1ZD3 A;  1Z4O A;  3IV6 A;  5KFI A;  1PVQ A;  8ICE A;  5D49 A;  4O3O A;  1S10 A;  2R8G A;  4US9 A;  9ICF A;  4IC9 A;  2MAX A;  1KDH A;  1QSS A;  2ZXI A;  1S97 A;  4YXM A;  2PFP A;  1ZQL A;  4NLN A;  3HIL A;  5AI4 A;  2A1A A;  4C7Z A;  2FPL A;  2W55 A;  5DBB A;  3C5F A;  4ED2 A;  5ALV A;  5KG2 A;  4UB6 U;  5KFG A;  4Z6D A;  3PO5 A;  2VA8 A;  3MR3 A;  4TUP A;  2EDU A;  1YT3 A;  2EZY A;  1Y88 A;  4DQP A;  4RNM A;  2VA3 A;  3M8S A;  5KNI A;  4I2I A;  1ZQH A;  3TFR A;  4E0D A;  1AQ6 A;  2GH1 A;  1JN3 A;  1KSP A;  1ZQU A;  2AGO A;  5AKG A;  5AKH A;  2NRX A;  9ICO A;  2H5X A;  4RZR A;  4DWI A;  1D8Y A;  3GQC A;  4G3I A;  1V85 A;  1BPB A;  4NM1 A;  4ED1 A;  1L7M A;  1HJP A;  2UVW A;  5KFS A;  3OHB A;  1IG6 A;  2XI9 A;  4XA5 A;  5KFL A;  4KTQ A;  2NO4 A;  2W8L A;  1L3S A;  5ALO A;  5KFW A;  4MF2 A;  2YX8 A;  4C0Z A;  5L1M A;  3RH4 A;  4OCZ A;  4YVZ A;  3RJI A;  2C2R A;  4KLS A;  1QH9 A;  3WKA A;  3HT3 A;  2LYH A;  4IR9 A;  3MBY A;  3G6X A;  4NLK A;  3C29 A;  4DL6 A;  4F5P A;  3RF9 A;  3M6Z A;  4QZC A;  2R8I A;  3ZDC A;  5CP2 A;  4DL3 A;  1O08 A;  2R8J A;  2NYV A;  5EE1 A;  1DK3 A;  4FZL A;  4JB3 A;  2MSN A;  4Y2S A;  2B6G A;  3ORY A;  4F5Q A;  3BDP A;  2GOL A;  2JGA A;  1UA0 A;  3TAD A;  4Z6F A;  4PH5 A;  2XCP A;  1XS9 D;  5KT5 A;  2WF6 A;  3HPO A;  3RB4 A;  3RJF A;  1X2I A;  3V6J A;  2ZJ8 A;  1X9S A;  1SXE A;  1MQ3 A;  3C28 A;  2DGZ A;  2DKZ A;  1QQ6 A;  2QKQ A;  4KLU A;  1RXW A;  2W9C B;  1IXR A;  5KFR A;  2K8C B;  5GTI U;  4I27 A;  8ICP A;  5DLF A;  5ALN A;  5KL8 B;  3BQ0 A;  5HHI A;  8ICO A;  1FIQ A;  1K1Q A;  2KJ8 A;  1NNL A;  2KIW A;  2ZIV B;  1ZQY A;  1U47 A;  2FMQ A;  3B9J A;  1XSN A;  3NRW A;  5J0Q A;  3GIM A;  1JI7 A;  1SKW A;  4UB5 A;  3BQ1 A;  3B0X A;  1F0M A;  2G5H B;  2WHE A;  1ZQK A;  4IR1 A;  3UMG A;  3PML A;  4F4X A;  2RDJ A;  2JRZ A;  5AM2 A;  3A0H U;  5DG7 A;  1DRG A;  1Z4N A;  3DV9 A;  1RXV A;  1UA1 A;  1ZQM A;  1L8O A;  3ZD8 A;  4PPX A;  3C1Z A;  1S76 D;  1FO4 A;  5L1K A;  4IQU A;  1TAQ A;  5G5H A;  4NLB A;  1SV4 A;  4CE6 A;  3RJJ A;  1N48 A;  9ICH A;  2VKQ A;  1FFV A;  5KFJ A;  4F50 A;  2BCQ A;  3RB6 A;  2ZIW A;  3JPO A;  4NM2 A;  2YQE A;  2HHU A;  4KLO A;  3VCB A;  4DSI A;  4RQ5 A;  5J2K A;  1L7P A;  5CEH A;  3HJE A;  5DG9 A;  4IRK A;  2WTF A;  2BKE A;  1PUZ A;  4ZH4 A;  3WK7 A;  4J9P A;  4OJ6 A;  2NO5 A;  5EE9 A;  1ZQZ A;  1OUQ A;  5CB1 A;  4IQT A;  4AYB F;  4PHP A;  8ICL A;  5AI5 A;  5DQI A;  3JPQ A;  2KOB A;  4QZE A;  4ACO A;  2F8L A;  5KG7 A;  4YMO A;  4ZOH C;  2QAR B;  3SEI A;  3IN5 A;  1ECW A;  2W11 A;  3N28 A;  2XC9 A;  2UVR A;  1XC9 A;  3TAR A;  5JU5 A;  3RTV A;  3LK9 A;  4JWM A;  1Q3U A;  1ZQO A;  1N5W A;  2JZB B;  4ECZ A;  2W9A A;  1BPZ A;  5ALY A;  4US8 A;  4DSE A;  3SQI A;  5ALK A;  3R9K A;  1S0N A;  4J9Q A;  4X5V A;  3BS7 A;  4Y2T A;  2W3S A;  4C7Y A;  2Z7J A;  4ECS A;  5DDM A;  2W9M A;  3C21 A;  5KG6 A;  4DOC A;  2GWS A;  2KSO A;  2PFO A;  5III A;  4ECX A;  2NRZ A;  2N1R A;  5AM0 A;  3N7R C;  2VJ4 A;  3HW8 A;  3D2S A;  3PX6 A;  4KN4 A;  3HKZ C;  3ISC A;  2KZ3 A;  2QB0 B;  2I1Q A;  3M9M B;  8ICN A;  4MEX A;  2HI0 A;  4FE3 A;  2LKY A;  5KT3 A;  3EW9 A;  2HDO A;  3N4M B;  1S5L U;  1NI3 A;  2AGP A;  4IL6 U;  5AI0 A;  3ETR A;  1N63 A;  4YMN A;  3QU2 A;  4Q44 A;  1YZ7 A;  2PKE A;  1RYU A;  2NV3 A;  3K4G A;  3NVW A;  5IIL A;  2Y9U A;  4QWC A;  3C5G A;  3BQT A;  1PK1 A;  5KFK A;  1MSW D;  3EYZ A;  4NLZ A;  1BPD A;  4QZD A;  3RH5 A;  4IS7 A;  4DFP A;  3C2M A;  3HP6 A;  3AL0 B;  4PL2 A;  1ZQW A;  4O3P A;  3RJE A;  4FO6 A;  3MGI A;  3OTQ A;  1N60 A;  4P4M A;  1L3V A;  2J6U A;  1CI4 A;  2MA1 A;  1L6N A;  1ZRM A;  3UMB A;  4UB3 A;  2KIV A;  3SEN A;  2OXO A;  3T79 A;  2OH2 A;  1MC8 A;  4QIW F;  4EX6 A;  5J2I A;  1HEK A;  5AKI A;  2A3V A;  1L3U A;  5E79 U;  4ECY A;  1C7Y A;  3GZF A;  1ZQV A;  2FLL A;  2J6S A;  2HBJ A;  4RUA A;  4QWA A;  1V9P A;  3L4P A;  4I2C A;  5KT2 A;  1RQN A;  4J9L A;  8ICB A;  3A0B U;  2I5H A;  4FBT A;  8ICS A;  3MR6 A;  1QQ5 A;  4R64 A;  4NLG A;  4JV1 A;  1ZQP A;  3V6H A;  2JEG A;  4KLE A;  2FDR A;  2AQ0 A;  3JPN A;  2ZJ5 A;  1ZQB A;  3F5A A;  1O03 A;  4DLE A;  4P0Q A;  1SKR A;  4C8N A;  2KFN A;  1X6I A;  3FYH A;  4DOB A;  5BOM A;  1NJW A;  2V4R A;  2AQ4 A;  1JXE A;  4DS5 A;  4UAV A;  5G5G A;  1N56 A;  2WF5 A;  3Q8R B;  3H0R B;  3GII A;  3VC8 A;  2OEH A;  3MFH A;  4WJ3 B;  4J9N A;  4P0P B;  1VLB A;  1A76 A;  1COK A;  3QEA Z;  3H8J A;  5TZV A;  2C2E A;  2G09 A;  1Z00 A;  4J9R A;  4KLI A;  5DBA A;  2WAQ F;  4I28 A;  2HBK A;  3ETL A;  1NKC A;  1ZQJ A;  2NRV A;  5AKZ A;  1F44 A;  1L5U A;  4BWJ A;  3NTU A;  4G9B A;  2A19 A;  3GV8 B;  4XQ8 A;  3T5J A;  4DOA A;  4I2G A;  4IRC A;  2RHF A;  2E1E A;  4M47 A;  2IOF K;  1BPE A;  2KVS A;  5DLG A;  7ICL A;  3KKA C;  4J9M A;  5EWF A;  2FMS A;  4M9N A;  4IQV A;  3C23 A;  5ALP A;  3PSF A;  2F1H A;  4F3O A;  5ALQ A;  3PO4 A;  2LYB A;  2ZTE A;  2PMZ F;  5J0R A;  3BZK A;  5KG1 A;  4MFF A;  4YP3 A;  1UT8 A;  1ZQN A;  5KFY A;  7ICT A;  1XNS A;  4I2H A;  4PL1 A;  1JXL A;  4ED7 A;  2YN4 A;  2BQU A;  4GC6 A;  2KK0 A;  5B66 U;  4I2J A;  5J0S A;  3QU7 A;  1LVH A;  3H0L B;  5ALE A;  1XO1 A;  3C1Y A;  5KFC A;  1T8E A;  2RRD A;  3N7P D;  5J2D A;  4FBU A;  3ZDE A;  2F1J A;  1UQV A;  2ISO A;  2KNJ A;  2HOI A;  3V7K A;  4FS1 A;  1LKY A;  4M9G A;  4QZF A;  2BQ3 A;  4B9M A;  3QX7 A;  3PX4 A;  1ZJM A;  1OXJ A;  1J2N A;  2G0A A;  3H8W A;  5CR0 A;  5EWG A;  1X66 A;  2ATL A;  3KHL A;  2JXJ A;  3AUO A;  3SV3 A;  4TUQ A;  2H3Z A;  1HIW A;  5AI9 A;  3BZC A;  3UXO A;  2H3I A;  2Y1J A;  4Y2V A;  1U48 A;  2DBY A;  1NK6 A;  5D46 A;  1WCL A;  4DSF A;  5KFZ A;  3WKD A;  4EYI B;  3MR2 A;  1CUK A;  2E1F A;  1TFR A;  3QU4 A;  1IV8 A;  7ICK A;  1B22 A;  4YQW A;  2CPR A;  3I28 A;  1PZN A;  4GIB A;  4NJ8 A;  1QQ7 A;  3JPP A;  2Y0S C;  3Q8S B;  3JPS A;  1SL1 A;  5B5E U;  3N7S C;  3OSN A;  4MF8 A;  1MQ2 A;  5J2F A;  1ZRN A;  2XIC A;  2AU0 A;  1YZ6 A;  3RFA A;  1MA7 A;  1B0X A;  4F71 A;  4F92 B;  5HR7 A;  3ED5 A;  4RPY A;  1RZT A;  5EE3 A;  2YMQ A;  2D8C A;  3IHQ B;  2KMD A;  4UW9 A;  1SL2 A;  9ICG A;  1U45 A;  3AN1 A;  3BS5 B;  4NLC A;  2IHM A;  3AEV A;  2ZTC A;  3N97 B;  1WUD A;  1HUO A;  1VDV A;  2BCV A;  2MRL A;  2K4P A;  4B9L A;  2KKV A;  2E8M A;  4BJQ A;  2BPG A;  2B21 A;  1T4G A;  4B9S A;  2LBO A;  3ICX A;  3PR4 A;  4RNO A;  1U49 A;  2W9C A;  5AK3 A;  4TUR A;  2JH7 A;  4A8E A;  1ZQI A;  3RRH A;  4M6W B;  1SIJ A;  9ICE A;  3EWA A;  3CYM A;  4TQS A;  1D9D A;  2ZIV A;  4YR2 A;  1Z1V A;  2XY7 A;  4RQM A;  4I2B A;  3H0M B;  1KQQ A;  4MFC A;  3AM9 A;  2ESE A;  1BVS A;  5D4B A;  3CRX A;  4AYB C;  3PVX A;  2ZG6 A;  1UHU A;  1SB3 C;  3AQE A;  3QZ7 A;  4BWM A;  2F76 X;  3OSP A;  1JRP A;  2IA6 A;  1KLN A;  4I2D A;  3RR8 A;  2WF8 A;  4Y2Y A;  1WG8 A;  2ASL A;  1LV5 A;  1NOM A;  2LYA A;  3LVW A;  1BPX A;  3NVV A;  5KFO A;  2G08 A;  2LI6 A;  3PW2 A;  5J0P A;  4F5O A;  1X9W A;  3SYZ A;  4YD1 A;  4UB4 A;  3QEB Z;  9ICN A;  2GO7 A;  3PW4 A;  1S8O A;  1ZQC A;  1ZQF A;  1COO A;  3WK6 A;  2K4E A;  1KFT A;  4GXJ A;  3I1Y A;  4F4K A;  4Q43 A;  4OJ5 A;  9ICP A;  4NXZ A;  9ICX A;  3SI8 A;  2ZUD A;  9ICK A;  4ECW A;  3LDA A;  4B9U A;  1DGJ A;  3GU3 A;  1ZD2 P;  4Y2U A;  3UXP A;  1NJY A;  3KHG A;  4EEK A;  4DF4 A;  3PX0 A;  5DGB A;  2BDU A;  3UQ2 A;  2HHV A;  3H4D A;  4YFK A;  3KKA A;  4RQ1 A;  3V6K A;  4BX9 C;  3RAX A;  1X42 A;  5AKY A;  2HHS A;  5AM3 A;  1NJZ A;  3CNH A;  2R8K A;  2K8B B;  1ZQ1 C;  4JUZ A;  5KFT A;  1N2X A;  4F91 B;  2MUT B;  3PW0 A;  1DXS A;  5J0T A;  4FFD A;  5DQH A;  1SGG A;  5AIB A;  5J2B A;  5JTI A;  1S0M A;  4FZM A;  5AI8 A;  2R18 A;  7ICN A;  5J0Y A;  2VAN A;  1A0P A;  5AHX A;  3LVV A;  3F2C A;  2DQN B;  2XY6 A;  3IP4 B;  4QIW C;  3NVZ A;  3M9N B;  5F3X B;  2DL0 A;  4R65 A;  1Q46 A;  2QB0 A;  2HOF A;  2GLE A;  4DFK A;  4RQ4 A;  7ICG A;  5J2J A;  5KT4 A;  3PSI A;  3F2D A;  7ICU A;  9ICB A;  3AU2 A;  9ICS A;  8ICZ A;  4QZI A;  3V7L A;  1TVA A;  3D2N A;  5KT7 A;  4OO1 J;  2W03 A;  1S0V A;  3F2B A;  3RJK A;  9ICQ A;  4ECU A;  2EAN A;  2F2A B;  2E8O A;  8ICW A;  8ICC A;  4DL7 A;  5C5J A;  2KZZ A;  5IIK A;  2HBL A;  1PVR A;  3SMV A;  2KFZ A;  4F4W A;  9ICT A;  4BXO B;  1JIH A;  3FC4 A;  2XO7 A;  8ICM A;  2JEJ A;  2HVI A;  3IG5 A;  4LZD A;  2W3R A;  2KVC A;  4KN7 A;  3DEE A;  1NZP A;  5L1J A;  4YR3 A;  4F72 A;  4F93 B;  4MEY A;  2W04 A;  3FM9 A;  3FAH A;  1XSP A;  2OHF A;  4JMU A;  5J0W A;  5F9L A;  3HX0 A;  3OGU A;  2ZIU A;  1QSY A;  7ICJ A;  1ZQA A;  7ICO A;  4P4O A;  2WB1 F;  5AKL A;  9ICU A;  4IRD A;  5KG3 A;  5IIJ A;  1KL9 A;  1XWL A;  4EYH B;  5EWE A;  2OM6 A;  2KE7 A;  2ALZ A;  5GTH U;  5KFX A;  4Z6C A;  2ZIW B;  2ZJA A;  5F9N A;  3KHH A;  4RPX A;  2FLP A;  4QZH A;  4EEN A;  2EQY A;  5ALW A;  1DOQ A;  2ZIX A;  1RDF A;  2KN7 A;  4M2Y A;  2FE9 A;  4UAR A;  4C4R A;  3OPX A;  2BHN A;  1B43 A;  2YB1 A;  3V72 A;  5J8Y C;  1RYR A;  4Y2P A;  4KLQ A;  3GIL A;  1KRP A;  2KEY A;  4O0I A;  2W9B A;  5AI6 A;  3QUQ A;  1TK0 A;  1JX4 A;  1BNP A;  2R8H A;  2JMG A;  3I76 A;  2XY5 A;  1TK8 A;  2FJ6 A;  1X9X A;  3RR7 A;  5KTQ A;  4LJX A;  3L5K A;  2PI4 A;  1KEJ A;  4DQQ A;  2BPC A;  2EZX A;  3B0Y A;  4YXJ A;  4UQG A;  4P0P A;  1CRX A;  2BCR A;  5CA7 A;  4Y2J A;  4ED6 A;  7ICI A;  8ICY A;  3SD7 A;  5EOZ A;  7ICR A;  3BQ2 A;  1Z3E B;  3KBB A;  3PZP A;  2H3Q A;  4DO9 A;  3ONN A;  1MN8 A;  1NK9 A;  4Q8E A;  4UAZ A;  2G5I B;  4B9V A;  4UAT A;  4EBE A;  1RYS A;  4M9H A;  4UB8 U;  4IQW A;  3T5L A;  1CEZ A;  4KLF A;  4ECQ A;  2LMR A;  2FI1 A;  2KD1 A;  7ICS A;  3SAG A;  2HHT A;  4C8L A;  4P2H A;  3EZ5 A;  2EAO A;  1OW5 A;  4KIT B;  4M9L A;  4PHD A;  4ED3 A;  2ASJ A;  1ZJN A;  3GFK B;  3Q8L A;  3E0F A;  4PGX A;  3UMC A;  3O0F A;  3MAB A;  4ECV A;  2OYY A;  4NL9 C;  3RAQ A;  3TKA A;  3TQ1 A;  4R8U A;  4TQR A;  2FPM A;  5KFU A;  4Z6E A;  1FFU A;  1PK1 B;  1ARO P;  3AQF A;  3QU9 A;  1KFS A;  2F44 A;  4B9T A;  3GV7 B;  2BCU A;  4O3Q A;  2ES6 A;  5AKX A;  5FP0 A;  4ECT A;  3EPI A;  1KKX A;  3H8S A;  1T7P A;  4J9K A;  5KFP A;  3WK9 A;  2AGQ A;  1KW4 A;  1IIP A;  2A1J B;  2LHT A;  2AXT U;  2W54 A;  1PK3 A;  4USA A;  2ASD A;  2LM4 A;  3H4B A;  3IRU A;  1QCK A;  2Y9T A;  3TFS A;  4DCC A;  4BDP A;  1ZD4 A;  5HHH A;  3WK8 A;  5ALM A;  8ICK A;  4PGQ A;  5CHG A;  2JEI A;  1Q8K A;  2WFA A;  1J97 A;  4GC7 A;  4Q45 A;  1QLN A;  3ISD A;  4RU9 A;  1D8L A;  3TAP A;  5AKJ A;  5DBC A;  4P0Q B;  5DG8 A;  2OCE A;  1S9F A;  2VA2 A;  4QZB A;  8ICF A;  1ZET A;  5J2E A;  4QWB A;  1NK7 A;  2W43 A;  5BPC A;  1HUZ A;  1N5X A;  2EAM A;  2YTU A;  3QU5 A;  3LWL A;  3M7D A;  4RT3 A;  7ICQ A;  3ISB A;  4PHE A;  1ZQR A;  1WCN A;  1TAM A;  5KG4 A;  5IIO A;  4RQ6 A;  4UB1 A;  5KFB A;  3KHR A;  1ZYQ A;  5DKW A;  5AK5 A;  4O3R A;  1ZD5 A;  1Z00 B;  3QUT A;  1BNO A;  2KZM A;  4HAI A;  3QE9 Y;  2HW3 A;  5J2G A;  3E2E A;  3TAC B;  3SZ2 A;  5KFD A;  4RQ2 A;  5L1I A;  2VJ5 A;  1ZQX A;  3PR5 B;  4O9M A;  2KTQ A;  4EX7 A;  2L5Y A;  1J2M A;  3IDW A;  4GXI A;  3J81 j;  5ALJ A;  1JAL A;  5KFE A; 
#chains in the Genus database with same CATH homology
 2KIW A;  4U6P A;  1Q3U A;  1IIP A;  2JMG A;  4CGZ A;  4FZN A;  1T94 A;  2G08 A;  3SQI A;  2XIC A;  2KIC A;  2LHT A;  3ALR A;  4KX5 A;  2E5S A;  3D2N A;  4CDG A;  3RFA A;  3PSF A;  1MA7 A;  2CRX A;  4OO1 J;  2W03 A;  3F2B A;  2LYB A;  5HR7 A;  2PMZ F;  2K4H A;  2F2A B;  2XI9 A;  3KFU F;  3NRW A;  2Z7J A;  4P0P A;  1CRX A;  1URJ A;  2K4I A;  2KHV A;  4CRX A;  2K4E A;  3PST A;  4NV0 A;  4QJF B;  2DF4 B;  2HBL A;  2YX8 A;  3SMV A;  4ICA A;  4C0Z A;  1PVR A;  1XNS A;  1P7D A;  2W7O A;  4OJ5 A;  3PZP A;  4PL1 A;  3NUQ A;  2N1R A;  2H3Q A;  3N7R C;  2VJ4 A;  2ZXH A;  3D2S A;  4NLC A;  2G5H B;  3HKZ C;  3IG5 A;  3N7S C;  3F5A A;  3ONN A;  4GFJ A;  2KVC A;  3HKZ F;  1WUD A;  3DEE A;  1D8B A;  3M6K A;  2KJ9 A;  3L3F X;  2W7P A;  2M0N A;  4NWI A;  4P0Q A;  3GU3 A;  3H0L B;  1DRG A;  1NZB A;  2H3F A;  3C29 A;  3MGV A;  2G5I B;  2PMZ C;  2MRL A;  4U7C A;  2KKP A;  2W04 A;  4FE3 A;  3SAH A;  3RF9 A;  4KMO B;  2KKV A;  5CRX A;  1Z19 A;  1Q3V A;  2LKY A;  3M6Z A;  1SZH A;  4OJP A;  4BJQ A;  2BDU A;  5HR6 A;  2HOQ A;  4JMU A;  1A6S A;  2LBO A;  3ICX A;  4NLB A;  2RRD A;  3N7P D;  4OJO A;  4BX9 C;  1PVQ A;  2KD1 A;  4P0Q B;  1GO3 F;  3H0R B;  3SAG A;  2ZIU A;  2KNJ A;  2VKQ A;  3VC8 A;  2HOI A;  4KX3 A;  4FZL A;  5C0Y A;  2F77 X;  2WB1 C;  4IC9 A;  5KL1 B;  2JH7 A;  4A8E A;  4BUG A;  4WJ3 B;  2WB1 F;  4P0P B;  2ZIW A;  2NV3 A;  1XO0 A;  2ZXI A;  1PVP A;  2K8B B;  1ZQ1 C;  2G0A A;  3D2Q A;  3E0F A;  3CYM A;  2KJ5 A;  3O0F A;  3K1Z A;  2XID A;  2G09 A;  2ZIV A;  2ZIU B;  3VCB A;  2GOL A;  2JGA A;  2H3Z A;  2OM6 A;  1HIW A;  3F53 A;  3KZX A;  3M7D A;  2KV2 A;  2OYY A;  2WAQ F;  1TAM A;  2ZIW B;  2H3I A;  2Y0S F;  5T14 A;  1ED1 A;  3H0M B;  2ZIV B;  2JH1 A;  1YT3 A;  4OJ6 A;  3AL0 B;  2HBK A;  4PL2 A;  3SAF A;  3F5E A;  2VIX A;  2CN1 A;  2D6F C;  1OUQ A;  3CRX A;  2K89 A;  4AYB C;  3AQF A;  4FZM A;  2ZG6 A;  2E1F A;  2Q4T A;  2R18 A;  2ZIX A;  3IG8 A;  4QNL A;  4AYB F;  3LYS A;  1F44 A;  1A0P A;  3C28 A;  2RP5 A;  2DGZ A;  2MA1 A;  3PSP A;  1KBU A;  2K8A A;  2KOB A;  2YB4 A;  3AQE A;  3LVV A;  3OPX A;  2YB1 A;  2DQN B;  3F2C A;  1L6N A;  2CPR A;  3IP4 B;  4ACO A;  2F76 X;  2HMX A;  2HBM A;  1UPH A;  2KHQ A;  4QIW C;  2OXO A;  3T79 A;  2GH1 A;  2OH2 A;  2F8L A;  2XVT A;  4QIW F;  2VJ5 A;  3F2D A;  2K8C B;  2ZIX B;  2RHF A;  2WAQ C;  1Z1B A;  1HEK A;  2JHD A;  2E1E A;  2Y0S C;  2HOF A;  2G06 A;  2A3V A;  4OJL A;  5A0L A;  4O3M A;  3IN5 A;  2KEY A;  3GZF A;  1ECW A;  5KL8 B;  2LYA A;  3LVW A;  2H3V A;  2HBJ A;  2G07 A;  3CP8 A;  2KJ8 A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...