2DF4B

Structure of trna-dependent amidotransferase gatcab complexed with mn2+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
399
structure length
399
Chain Sequence
HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 117
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2df4B02
2F2AB 2DF4B 1ZQ1C 2G5HB 3H0MB 2D6FC 2DQNB 3KFUF 4WJ3B 3AL0B 3H0RB 3IP4B 3H0LB 2G5IB
chains in the Genus database with same CATH superfamily
2NO5A 4J03A 4KX5A 2JHDA 2HHWA 3F2CA 2DGZA 5ALXA 2KKPA 3RH4A 2G06A 7ICMA 2I5HA 2W8KA 2KE7A 3PSTA 2K4HA 3QEAZ 4ELUA 4RQ7A 5ALGA 3PSIA 3MGHA 2A19A 4QZEA 8ICPA 2WF5A 3ZDCA 3UMGA 1L3UA 1KFDA 3KZIU 2HOFA 4IRKA 1JRPA 1LKYB 4GC6A 2HBLA 2MUTA 3QX7A 3IDWA 2B6GA 4GXKA 4P0QB 5KFCA 5H2FU 2R18A 9ICOA 3PSPA 2JRZA 3QZ8A 3RAQA 2HDOA 3FDSA 4FFDA 2C2EA 2HOIA 5AI6A 1U48A 2M0NA 1KQQA 2KKVA 5AM1A 2BDUA 4B9SA 4R8UB 1L7MA 4RPXA 3RJEA 4IS7A 5D49A 2ASJA 2PFOA 4ED3A 4YFKA 3TAPA 4M9JA 4KLQA 1J2NA 2J6SA 2AH5A 1A0PA 8ICGA 4FO6A 3IM1A 2Y9TA 4KLJA 2AXTU 2F76X 4O5KA 4KLUA 4BX9C 1JUDA 4M6WA 5IIJA 4RUCA 4C8NA 2KOBA 1L6NA 4O0IA 5AK6A 2JZBB 3KTQA 4F93B 5J2IA 3BS7A 5J2AA 4C7YA 3ED5A 3MFIA 8ICSA 3ZD9A 4ECYA 7ICFA 4M2YA 4Q45A 1X9SA 4DSKA 2B21A 2C22A 4EBCA 4ECUA 3PMNA 3VCBA 3M7DA 4TUSA 1BPZA 3OSNA 2XO7A 3PW0A 3GZFA 1Q8KA 4Y2RA 3T5KA 4GXIA 1NK8A 4KLMA 2KK0A 4EX6A 1PK3A 2G09A 3D2NA 4K4HA 4BGDA 2ZJ8A 1KBUA 2W9CB 3U26A 4ECTA 3KBBA 2MAXA 2EANA 4QZ9A 5J2JA 1MSWD 1L8OA 4Y2QA 4QZFA 1ZD3A 1ZQPA 1RXVA 3RRGA 4TUPA 1Z3EB 2Z7JA 1BNPA 1SIJA 1L5UA 1L3TA 2I1QA 1B4FA 3OJUA 4RPZA 1ZQUA 3KOOA 2LHTA 5KTQA 7ICOA 2W7OA 9ICGA 2PFPA 1NK0A 4QZBA 2BCQA 1NOMA 4R63A 2ZTCA 1P7DA 1RQLA 3F5EA 4DFPA 4OJLA 3CRXA 2W04A 3QU9A 5KFGA 3C2MA 3HT3A 3SAGA 1LB2B 4XRHA 3Q8RB 1B43A 2CRXA 2E8NA 3KKAC 4UAUA 3GDXA 1ZQGA 2FPKA 2R8IA 4FS1A 1N2XA 1NK7A 3GFKB 4YVZA 2C2RA 3GIJA 5DB8A 4RNNA 1SV0A 3QXGA 1MC8A 3UXNA 4Y2YA 4ACOA 3NUQA 4UARA 1QQ6A 4C80A 4EYHB 8ICZA 1ZJMA 4O5CA 1IG6A 3UXOA 4YXMA 4ED0A 3PX4A 1ZOLA 4PHEA 4J9OA 3WK5A 1RYRA 2BCUA 4RQMA 2RQ5A 1V9PA 2YB1A 1VDVA 1F44A 4KLEA 4C4TA 3SV4A 5DLGA 2BQ3A 1ZQHA 4MF2A 3RB6A 3RBDA 2K89A 3AQFA 5AK3A 3NASA 4I2GA 5D4BA 5J0YA 1MQ3A 1XO1A 5TISU 3IRUA 4M0AA 2G5HB 4JV1A 1N5WA 2BQRA 1BVSA 1J2MA 4UQGA 1KSPA 2V4RA 1JI7A 3MABA 5J2FA 3GV5B 5ALLA 3PZPA 1TVAA 2HI0A 2KP7A 1RYUA 1DGJA 3MR6A 3FYHA 2N1RA 5CJ7A 4PHPA 1NKCA 5AKYA 4DS5A 3KFUF 3V7KA 1COOA 2OHFA 2ZIUA 4CDGA 8ICXA 3LDAA 4PHAA 3GQCA 1T8EA 1ZQEA 1S77D 2ZIVA 3NS1A 3PX0A 4EZ9A 2FLPA 3GU3A 4ICAA 2ATLA 1PVPA 1Z4NA 2R8HA 2VIXA 1BPXA 2RLTA 2ZUCA 4M6WB 4OD0A 1SB3C 4YR0A 4UAVA 2W55A 4NM2A 4DOCA 4DL4A 5AKJA 1YT3A 1S0NA 5ALEA 3K1RB 4EELA 2WB1F 1XNSA 5KFVA 5EWGA 5AKKA 3MR5A 4ECWA 4DCCA 5DGAA 3AMZA 3UXPA 1ZJNA 2A1AA 2QLTA 5L1IA 2DFLA 2G07A 4O3QA 3C1ZA 4QZCA 1T94A 4IR1A 1H38A 2G08A 1B0XA 3BQ1A 4CE6A 2WB1C 4F4KA 3SEIA 4J9RA 3UMCA 7ICPA 4O5EA 1Z1VA 5FP0A 2EAPA 3WKBA 3AU2A 3TADC 3R9KA 2E5SA 1O03A 2YMLA 5KFFA 3F2BA 1QLNA 1L3VA 2E8PA 3THVA 3M9NB 2W43A 3PO4A 4ED8A 5J2DA 4F50A 5ALZA 5HP4A 9ICSA 4QW8A 4E0DA 2EZZA 1QCKA 4NLNA 2IBKA 3KZXA 1UQVA 1UPHA 3AEVA 4LVSA 3NVZA 4UB8U 1JN3A 1UCVA 5EWFA 2XCAA 3LVWA 5AKLA 9ICEA 1K1SA 1S8OA 4O3PA 4ECRA 9ICTA 1CI4A 4NLBA 4DF4A 8ICAA 1ZQSA 2KTQA 1U49A 2E1FA 5EOZA 1L7NA 5KG7A 4PHDA 4TURA 1WUDA 5GTIU 2AGPA 4MFCA 2E1EA 2NRZA 1PUZA 1NJWA 5KT3A 5J2HA 3ISDA 2HW3A 5KFEA 5L1KA 2KD1A 1UA1A 1WCNA 5IINA 4O3RA 1A6SA 2YTUA 1VLBA 4J9NA 5ALMA 3KD3A 2O6KA 3WK6A 5ALWA 5BOLA 1OXJA 2F77X 5ALDA 3PW5A 4MFFA 2KIVA 3N4MB 8ICLA 5AM4A 2IHMA 2KSOA 4G9BA 4FS2A 5KG1A 2OCEA 2PFNA 2CPRA 3WK7A 5KL1B 3H7IA 3MC1A 4O3SA 4B6JA 1N48A 3MGVA 5DBCA 2XGPA 5AI0A 5AIBA 3WU2U 1JIHA 4J9KA 3E2EA 3UQ0A 2LMRA 1XSLA 1TAMA 3H8JA 4MF8A 5KT7A 2CXYA 5DG9A 8ICTA 4NWIA 2KEYA 3TAQA 1C20A 2RRDA 2VANA 4EYIB 1PZNA 4QZDA 3EPIA 3JPQA 2P66A 2ISOA 5HHIA 5DB9A 9ICJA 2UVVA 2JEFA 4QWEA 1S9FA 4M9GA 4Z6EA 2XY7A 2ZTEA 2GO7A 4YQWA 1TE2A 2VJ4A 2VKQA 4DQIA 5KFRA 2ZIUB 2W03A 3UM9A 4NXZA 7ICLA 3C5FA 5ALYA 4YG2A 1Q3VA 2KJ9A 4U6PA 1F5SA 9ICPA 1U47A 2DUYA 2H3VA 1QQ7A 2KV2A 1F0MA 2AU0A 5DGBA 4MEXA 4KLIA 4FZNA 2ASDA 4DFKA 3L3FX 4USAA 1ZD4A 9ICCA 2BQUA 1X9XA 2ESEA 5CWRA 1L8LA 4OJ6A 4OJPA 2BPCA 1QSLA 4F4YA 3GIMA 2V9WA 1PK1B 4PPXA 2H3QA 4P0PB 8ICYA 4YR2A 4QZHA 3H0LB 5J29A 4P4MA 1D8LA 3ALRA 1ZQVA 4IQVA 1QTMA 3EYZA 2NRXA 3ZDEA 2HVIA 1ZQIA 2ZIXA 3PO5A 2W9BA 2PI5A 3NTUA 5KFNA 2IOFA 3RJJA 5KL8B 4P4OA 5ALSA 3C23A 3AUOA 1ZQRA 2WHEA 1DOQA 2W3RA 4ECSA 1HUZA 4CGZA 3TFRA 2DKXA 4RUAA 3QE9Y 4Q8FA 2EQYA 2LI6A 2JH1A 4F5NA 4DSLA 5HMLA 4MEYA 4PGYA 5L1JA 3NVVA 1ZRMA 5AIAA 2HSZA 3I1YA 4PJ0U 4DSFA 1Z1BA 4I29A 2WF6A 1JALA 1SXDA 2RHFA 2A1JA 4BWMA 3K1ZA 1NNLA 4OO1J 4RU9A 5ALVA 2PFQA 2HCFA 3T5JA 5KFTA 3M8RA 2NYVA 5ALKA 4YP3A 3RR7A 1Q3UA 4TUQA 3OJSA 2Q0ZX 4Q43A 7ICKA 1ZRNA 4KLLA 1XU4A 2GH1A 4BXOA 5DBBA 5AKIA 5AM5A 4CCHA 4ED2A 5ALTA 1TV9A 2PXIA 2R8GA 4NLCA 1A77A 2FPMA 4I27A 2ISPA 1X6JA 2OXOA 5F3XB 2QARB 4R64A 1SKRA 2LYHA 4F2RA 3SAFA 2ZUDA 4KTQA 4GC7A 4ED7A 4DL6A 4HAIA 4KLDA 4F72A 2ASLA 1NZPA 3SQIA 2LYAA 2BR0A 5KFDA 2K8CB 4C8OA 4CNQA 3DEEA 2VA3A 2AQ4A 3H4DA 2DWQA 3QUCA 3LYSA 1NI3A 2KSOB 5J8YC 2KZ3A 1SL1A 4C0ZA 4J9LA 3O0FA 5KFXA 4EEKA 9ICVA 5D46A 3QUQA 4QJFB 1X40A 4TQSA 3G6XA 1TAUA 4JK1A 1JXEA 4RQ0A 5KG0A 5J2GA 4EENA 4YXJA 3V6JA 5AKEA 3F53A 3I76A 4RT2A 3RTVA 2XC9A 3JPNA 4EBDA 3ORYA 3E58A 1TK0A 5CRXA 8ICMA 1KL9A 3KHHA 3PMLA 4O9MA 5ALOA 2ZIWA 4UAZA 3PV8A 4FBTA 5JUMA 3RH6A 2BPFA 2EZYA 3BQTA 3BS5B 2K60A 4AP9A 4PZOA 3M9MB 2JEJA 3ETLA 3V6KA 2HHQA 2MRLA 4KMUA 4UB1A 1T4GA 3T5HA 2DBYA 5KG6A 8ICRA 4RPYA 5HMMA 4RQ1A 4JMUA 4I2FA 3V7LA 3WKDA 1TKDA 2EAMA 4Y2XA 1SKWA 4DL2A 8ICFA 2KN7A 3DV9A 3CYMA 5EWEA 3GIIA 2YN4A 3D2SA 2FMQA 4B9MA 5AI5A 2HHSA 4JV2A 4K4IA 4ECXA 2BDPA 2NRTA 1PVRA 2YMQA 7ICGA 1FO4A 4QZIA 5AI9A 4C8LA 1URJA 8ICBA 2H5XA 3K4GA 9ICNA 3OPXA 2OM6A 4I2EA 4FBUA 1S5LU 4Y2UA 4CRXA 5AK5A 2W9BB 4RQ8A 1V85A 2E3TA 2W11A 1ZQCA 4QNLA 5KFIA 2R8KA 2LPEA 1FIQA 1WCLA 3TACB 4EBEA 5ALJA 3KHGA 1ZD2P 5DQIA 3GIKA 2HHUA 1S76D 4US9A 5DBAA 1ZQFA 4B9VA 2G5IB 9ICAA 3ETRA 4YMMA 1CEZA 2W7PA 4XQ8A 5KFMA 4Y2JA 3SD7A 1XC9A 3TI0A 4R66A 4IL6U 2K8AA 3NVWA 2MUTB 1MQ2A 4F5RA 4F5QA 3A0HU 2AGOA 1XS9D 1X9MA 2MU2A 5A0LA 1IM4A 3QZ7A 5HNKA 1BGXT 1IV8A 5KG4A 3T79A 4UW9A 3F5AA 1A76A 2W3SA 4TQRA 4DS4A 4M04A 3MGIA 4Y2VA 3WK8A 2FLNA 4QWAA 4A8EA 1WWVA 5J2KA 4BUGA 3LWMA 4C7ZA 4KLSA 2EZXA 1GO3F 3G6VA 3SI8A 3KKAA 5J0PA 1BPYA 4G3IA 3SV3A 2NO4A 3IN5A 4DSEA 2AGQA 4JWMA 5ALHA 5EE9A 9ICUA 4US8A 3Q8QB 1JXLA 2WF8A 1X42A 2Y0SF 4PL1A 4NLZA 4KX3A 4NL9C 3KHLA 7ICQA 5ALQA 1MA7A 4J9QA 1HJPA 4CF3A 5AM0A 2C2DA 5ALUA 2PMZF 2Y0SC 2YY6A 2ZXHA 5AKHA 2WFAA 2KVCA 5DQGA 5J0XA 2D8CA 4ED1A 5HR7A 2K4EA 3NRZA 3EZ5A 3ZDAA 4F4WA 2PI4A 4RNMA 2HMXA 3SZ2A 1ZQNA 1QSYA 2IHNA 1WWUA 4BWJA 3QNMA 2RDJA 4UBBA 3ZDBA 2M9NA 3C5GA 3PY8A 3RJKA 4J9SA 3RJFA 2K4PA 2HBMA 4DLEA 3UPQA 4DFDA 4MFAA 1NK9A 2D3DA 4KLHA 2F3NA 3WKAA 1YZ6A 2KVSA 2OWOA 2YB4A 4I2IA 2BGWA 3PVXA 5TZVA 2FI1A 2ODGA 2GWSA 2DQNB 2FMSA 3RJIA 1ZQMA 2IOFK 5CB1A 1Z4OA 2NRWA 2UVUA 2W54A 4QIWF 3H8WA 2LM4A 4UB3A 2LYBA 1UT8A 1OUQA 4QWBA 2GLEA 4R8UA 5J0OA 4Q44A 1N63A 4M47A 5KFZA 4QIWC 4NLKA 3PR4A 1MN8A 2KJ5A 2AQ0A 5AI4A 3B0XA 2HHTA 2KMDA 2DPIA 2F8KA 3QU2A 3QYPA 4HYKA 5KFQA 9ICQA 3MBYA 1DK2A 2I6XA 4ZOHC 4I2BA 3ICXA 3N7PD 2VA8A 1S0VA 1RQNA 3CP8A 3LVVA 5GTHU 2RDIA 7ICIA 5KNIA 4JUZA 2JZBA 5F9NA 1KRPA 1L3SA 1X2IA 5IIMA 4AYBF 2P6UA 4RNOA 5ALIA 1JMSA 1RYSA 1V97A 4PZNA 7ICHA 3PR5B 3TADA 4X5VA 1NK4A 2WF7A 8ICOA 3K75D 2YMMA 5ALPA 2YMPA 4AYBC 2FPLA 1WYGA 4LZDA 1ZQTA 2G0AA 2C28A 7ICRA 1SXEA 1TK8A 9ICLA 1N60A 1XSPA 5CR0A 4DSIA 4KLFA 2W9CA 3EPGA 5J2BA 3ZD8A 5BPCA 1ZQDA 2XCPA 4OJ5A 1ED1A 1NKEA 1UHUA 2FJ6A 5KFWA 2MA1A 2RP5A 2YX8A 1XO0A 9ICHA 4R65A 5ALFA 2ZTDA 2ZIVB 2KJ8A 2QB1A 4DQQA 4F91B 1DK3A 1D8BA 4I2JA 4DLGA 3JPSA 5J2CA 3BJYA 4YCXA 3AU6A 1BPDA 5DG7A 1BNOA 7ICUA 2WAQF 2E8MA 1PVQA 2F8LA 2P35A 3ZDDA 4F3OA 1UA0A 3TKAA 4F5PA 1TFRA 3RRHA 4DFMA 1SWVA 2KICA 2JV3A 3C29A 3NGDA 4C8KA 2WAQC 3BZCA 4KN7A 2HHVA 3MR2A 5J0WA 5DDYA 4JWNA 1OW5A 3HX0A 2OYYA 1SWWA 3DDHA 3ONNA 4KMOB 3BQ7A 4NLGA 2XICA 4DFJA 2UVRA 3V72A 4YR3A 1SL0A 4KLGA 4FZLA 5IIKA 4LJXA 3T3FA 1QSSA 2JEIA 5KFPA 2H3IA 3IV6A 5KFAA 3TARA 1X66A 1ZYQA 5KFJA 8ICKA 2KIWA 3D2QA 1Q46A 4YD2A 1ZQWA 3HP6A 3H4BA 2HVHA 4ECZA 4J9PA 8ICWA 4F92B 5J0TA 3ISCA 1RXWA 1N62A 5DB6A 3TFSA 5C0YA 3ISBA 2WF9A 1UT5A 4F4ZA 2ZUBA 1RZTA 1Y88A 3E0FA 2XVTA 4FE3A 2KFZA 3L4PA 5KT4A 3HRDD 2F1IA 1LV5A 4QWCA 1DRGA 8ICNA 4I28A 5KAFU 3N7RC 5KT2A 4QZGA 3J81j 4ED6A 3BZKA 4WJ3B 3IP4B 1SZPA 2R8JA 3A0BU 4XA5A 8ICIA 2ES6A 3OHAA 4YMNA 2J6TA 1QH9A 4M9LA 4Z6FA 1ZQKA 3WKEA 2WTFA 9ICKA 9ICWA 4IQUA 5EE0A 3UQ2A 1KDHA 1K1QA 1T3QA 2P6RA 1N61A 5KFHA 3RR8A 1U45A 4OCZA 3NRWA 1CRXA 1SV0C 5HHHA 1ZQLA 4RQNA 4O3MA 5J0SA 3Q8SB 2BZFA 4NV0A 3HJEA 5AKGA 5KFSA 1FFUA 8ICUA 3C2KA 3NVYA 3EUB2 1ZQOA 3IG5A 4DOAA 2IMWP 1ZQJA 4F8RA 4QZAA 5KFKA 1ZQ1C 3OGUA 4DEZA 4KLTA 3N97B 4NY8A 5DKWA 2XGQA 1L7OA 2W9AA 3WKCA 5KT5A 5AICA 3PW4A 3M1YA 3RH5A 4B9TA 3MDAA 1S0MA 8ICCA 2PKEA 4KLOA 1NJYA 4UB6U 1SV4A 4UB5A 5IILA 1M6YA 2LM1A 3IHQB 1FFVA 4DF8A 2Y1JA 3SENA 1S10A 3GILA 4MHVA 1DGSA 1LVHA 4EX7A 5F9LA 1TAQA 3RB4A 4DQPA 4CF5A 1C7YA 4IC9A 9ICXA 5AM3A 1NK6A 1KFTA 4Z6DA 4JB3A 4YMOA 1SL2A 2KFNA 4DQRA 4I2AA 1SZHA 2DKZA 1KLNA 2V4QA 4DOBA 4DL5A 4UB4A 2VA2A 4Z6CA 4Q8EA 3JPOA 2BPGA 1NJZA 4IRDA 2OEHA 5DLFA 3C2LA 3PNCA 1YZ7A 1D9DA 4P2HA 7ICSA 4M9NA 4F71A 1NJXA 1JX4A 4PGQA 8ICQA 5E79U 3TQ1A 3M9OB 1K5OA 2JMGA 4PH5A 5B66U 4QW9A 3IG8A 2E8OA 4QWDA 5KT6A 4XUSA 2ZIXB 3B0YA 4YN4A 5J8YA 4DSJA 3RFAA 2QB0A 3S6JA 4PL2A 9ICMA 3HW8A 9ICRA 1HEKA 3PSFA 4GIBA 2L5YA 1EXNA 2ZG6A 1ZQYA 2GOLA 5DG8A 3M6ZA 4RQ6A 2IA6A 4DQSA 4RQ5A 3JPPA 2H3ZA 5AK4A 4RQ3A 3Q8KA 3C28A 1N5XA 2A1JB 2ZJAA 5KG3A 2F2AB 2XIDA 2Y9UA 1U4BA 5CEHA 3RJHA 5DB7A 4DL7A 1RG6A 3QU5A 5L9XA 3EW9A 3QEBZ 2J6UA 5AKZA 2JXJA 3V7JA 4ECVA 2BHNA 5CHGA 3MDCA 5CP2A 4P4PA 4UB2A 3N28A 2K8BB 1Z00A 1CUKA 5EE3A 4BXOB 1X6IA 5IIIA 2AHOB 1V38A 8ICVA 1DXSA 2LBOA 1U9LA 1XSNA 3V6HA 4O3OA 5KFOA 7ICTA 1RM6C 1RDFA 3GV8B 1ZETA 2DL0A 3HILA 4M9HA 5J2EA 1KEJA 5IIOA 5KG2A 2HOQA 2UVWA 4GXJA 2NV3A 4BJQA 3H0MB 5G5GA 5AKXA 3FC4A 1XWLA 3LWLA 2KNJA 2BKEA 1SGGA 1VJ5A 4UATA 4B9UA 3RF9A 2CN1A 4ZH4A 3HKZF 5DDMA 2JEGA 2W8LA 2IOHA 9ICBA 3AM9A 2KZMA 4Y2PA 3PW7A 3M6KA 4I2DA 3N7SC 3AN1A 4C4RA 2MSNA 3L5KA 7ICNA 4DL3A 2BCVA 8ICJA 1PK1A 3HKZC 1Z19A 2KG5A 2JR5A 2JGAA 4P0PA 5KFBA 5C5JA 4Y2TA 1SKSA 9ICIA 5EE1A 4DWIA 4UAYA 3HPOA 2XY5A 3RJGA 1ECWA 3FM9A 3LK9A 4U7CA 2HBJA 2PMZC 3H8SA 3JPRA 4NJ8A 1KN5A 9ICFA 2EDUA 4RT3A 2F1HA 3C1YA 1HUOA 4IRCA 2EH9A 3KHRA 1AROP 2EAOA 4C8MA 3Q8LA 4JV0A 5AHXA 3G6YA 4GFJA 3AL0B 2ZIWB 5JTIA 4Y2SA 3TANA 1D9FA 3B9JA 3MFHA 3SAHA 3BDPA 4UASA 3SR6A 1LKYA 4ELTA 4QZ8A 2LKYA 3RAXA 1N56A 4P0QA 1WG8A 2DF4B 2DPJA 2A3VA 1RPLA 3I28A 3D6JA 1IXRA 3H0RB 1FEZA 2HBKA 3CW2C 3JPTA 2FMPA 5KG5A 3H8MA 5ALRA 1X9WA 3QU7A 1S0OA 5CA7A 5T14A 5HR6A 2K4IA 5AM2A 2KHQA 2ZJ5A 5J0UA 5JRTA 4IR9A 2Q4TA 4OJOA 4NL9A 3ZI4A 3QUTA 3C21A 7ICEA 2QARA 2OH2A 5ALNA 1HIWA 1ZXIA 5KFLA 2QKQA 4B9LA 7ICVA 4RZRA 1QQ5A 3T5LA 4IQTA 2ALZA 2QB0B 4ECQA 4NM1A 3RBEA 1KFSA 3FAHA 3F2DA 2FLLA 1ZQAA 3MR3A 3RB3A 2ZXIA 8ICEA 2KHVA 1NZBA 5BOMA 1S97A 5KFYA 4KN4A 2F1JA 2BCRA 3AQEA 4F2SA 1D8YA 7ICJA 1BPEA 4I2CA 4J9MA 3QUBA 4UBCA 3OHBA 1L7PA 1BPBA 1KKXA 1KW4A 4KITB 2AJQA 2XI9A 3VC8A 3OSPA 3SYZA 3M8SA 2JH7A 2FE9A 4PGXA 5B5EU 2NRVA 1COKA 3CNHA 3EWAA 1Z00B 5L1MA 2XY6A 1NK5A 2FDRA 5DQHA 1T3NA 2B0CA 1TK5A 2HHXA 3UMBA 3WK4A 1KTQA 3H40A 4DO9A 2Y1IA 3OTQA 4BDPA 5L1LA 5K4LA 4F5OA 1ZD5A 2H3FA 3QU4A 5KAIU 1T7PA 1O08A 5J0RA 3HWTA 1J97A 3RB0A 3PX6A 4IQWA 3BQ2A 8ICHA 3BS5A 4EZ6A 5G5HA 1JROA 3PW2A 5AI8A 5KFUA 1AQ6A 3BQ0A 2KZZA 1IIPA 2W9MA 5J0QA 5JU5A 3WK9A 2F44A 4RQ4A 2VJ5A 1B22A 2D6FC 3Q8MA 4ELVA 4O3NA 1ZQZA 3GV7B 1ZQQA 4FZMA 4LZGA 4B9NA 2BCSA 4F4XA 2I9GA 4EEYA 4I2HA 3Q8PB 1ZQXA 4C4SA 4CF4A 4YD1A 4RQ2A 1ZQBA 4GLXA 4K4GA 2YQEA 3SMVA 4UAWA 1NKBA
chains in the Genus database with same CATH topology
3F5AA 1NZBA 2KOBA 2H3ZA 2G0AA 2VIXA 2KIWA 1L6NA 3C28A 2H3VA 2KV2A 2JHDA 2YB4A 3D2QA 4KX5A 1WUDA 4U7CA 2MRLA 4FZNA 4NLCA 2HBJA 3F2CA 2F2AB 2PMZC 4ACOA 2DGZA 2XIDA 2DQNB 3L3FX 2OXOA 3AQEA 2KKPA 3NUQA 2E1EA 2G06A 4A8EA 1YT3A 4BUGA 3SAFA 1GO3F 4OJ6A 4OJPA 4JMUA 3PSTA 4QIWF 5C0YA 2K4HA 2KD1A 2XI9A 4OJ5A 3VC8A 4GFJA 3VCBA 2WB1F 1ED1A 3M7DA 1XNSA 3AL0B 1A6SA 2MA1A 2RP5A 2YX8A 2H3QA 3CYMA 3E0FA 1XO0A 2ZIWB 4P0PB 2JH7A 2K8BB 2ZIVB 4IC9A 3IN5A 2XVTA 2YB1A 3GZFA 2LYAA 2LYBA 3SQIA 1F44A 3PSIA 3D2SA 2KJ8A 3H0LB 2LBOA 4FE3A 1D8BA 3SAHA 2K8CB 1PVRA 3ALRA 1OUQA 2F77X 3DEEA 2G09A 3D2NA 1SZHA 2ZIXA 4QIWC 2G07A 2K89A 2LKYA 2Y0SF 3AQFA 4PL1A 1DRGA 1T94A 4KX3A 2HOFA 2G08A 1URJA 2KJ5A 3LYSA 4P0QA 2WB1C 5KL8B 1KBUA 3N7RC 2OM6A 3OPXA 2HOQA 2WAQF 2DF4B 2CPRA 5KL1B 2HBLA 4WJ3B 4CRXA 3IP4B 2A3VA 1PVQA 2NV3A 4CGZA 4BJQA 3MGVA 4P0QB 2F8LA 2G5HB 3H0MB 1MA7A 4C0ZA 2R18A 3O0FA 2H3FA 2JH1A 3H0RB 2E5SA 4QNLA 2HBKA 3PSPA 4QJFB 1TAMA 2KICA 2KNJA 3F2BA 2PMZF 3ICXA 2HOIA 2Y0SC 1Z1BA 3N7PD 2Z7JA 2JMGA 3C29A 3PZPA 2ZXHA 3IG8A 2M0NA 4NWIA 3RF9A 2CN1A 2KKVA 5T14A 3CP8A 2BDUA 3LVVA 2K4IA 2KVCA 2WAQC 2KEYA 5HR6A 2KHQA 2RRDA 2LHTA 3HKZF 5HR7A 2RHFA 2G5IB 2Q4TA 4OJOA 2N1RA 3K1ZA 2W7OA 2K4EA 3F53A 2W7PA 3NRWA 1CRXA 1IIPA 2ZIXB 4AYBF 4OO1J 4O3MA 3KZXA 1UPHA 2OYYA 2VJ5A 2HMXA 4NV0A 3RFAA 2D6FC 2OH2A 1P7DA 3KFUF 3F5EA 1HIWA 4OJLA 2K8AA 2W04A 4FZMA 2ZIUA 4PL2A 3CRXA 4CDGA 3LVWA 3ONNA 4KMOB 3M6KA 3SAGA 5CRXA 1Q3UA 1HEKA 3N7SC 2XICA 3PSFA 2VJ4A 2CRXA 2VKQA 1A0PA 3HKZC 1Z19A 2ZIUB 2W03A 3IG5A 4FZLA 2JGAA 4NLBA 2ZIWA 5A0LA 2ZG6A 4P0PA 2HBMA 2GOLA 2GH1A 2ZIVA 4AYBC 2F76X 3M6ZA 1ZQ1C 3F2DA 1Q3VA 2KJ9A 4BX9C 2H3IA 3GU3A 4U6PA 2E1FA 3SMVA 1ECWA 3T79A 2ZXIA 4ICAA 2KHVA 1PVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  2DF4 B;  1ZQ1 C;  2G5H B;  3H0M B;  2D6F C;  2DQN B;  3KFU F;  4WJ3 B;  3AL0 B;  3H0R B;  3IP4 B;  3H0L B;  2G5I B; 
#chains in the Genus database with same CATH topology
 2NO5 A;  4J03 A;  4KX5 A;  2JHD A;  2HHW A;  3F2C A;  2DGZ A;  5ALX A;  2KKP A;  3RH4 A;  2G06 A;  7ICM A;  2I5H A;  2W8K A;  2KE7 A;  3PST A;  2K4H A;  3QEA Z;  4ELU A;  4RQ7 A;  5ALG A;  3PSI A;  3MGH A;  2A19 A;  4QZE A;  8ICP A;  2WF5 A;  3ZDC A;  3UMG A;  1L3U A;  1KFD A;  3KZI U;  2HOF A;  4IRK A;  1JRP A;  1LKY B;  4GC6 A;  2HBL A;  2MUT A;  3QX7 A;  3IDW A;  2B6G A;  4GXK A;  4P0Q B;  5KFC A;  5H2F U;  2R18 A;  9ICO A;  3PSP A;  2JRZ A;  3QZ8 A;  3RAQ A;  2HDO A;  3FDS A;  4FFD A;  2C2E A;  2HOI A;  5AI6 A;  1U48 A;  2M0N A;  1KQQ A;  2KKV A;  5AM1 A;  2BDU A;  4B9S A;  4R8U B;  1L7M A;  4RPX A;  3RJE A;  4IS7 A;  5D49 A;  2ASJ A;  2PFO A;  4ED3 A;  4YFK A;  3TAP A;  4M9J A;  4KLQ A;  1J2N A;  2J6S A;  2AH5 A;  1A0P A;  8ICG A;  4FO6 A;  3IM1 A;  2Y9T A;  4KLJ A;  2AXT U;  2F76 X;  4O5K A;  4KLU A;  4BX9 C;  1JUD A;  4M6W A;  5IIJ A;  4RUC A;  4C8N A;  2KOB A;  1L6N A;  4O0I A;  5AK6 A;  2JZB B;  3KTQ A;  4F93 B;  5J2I A;  3BS7 A;  5J2A A;  4C7Y A;  3ED5 A;  3MFI A;  8ICS A;  3ZD9 A;  4ECY A;  7ICF A;  4M2Y A;  4Q45 A;  1X9S A;  4DSK A;  2B21 A;  2C22 A;  4EBC A;  4ECU A;  3PMN A;  3VCB A;  3M7D A;  4TUS A;  1BPZ A;  3OSN A;  2XO7 A;  3PW0 A;  3GZF A;  1Q8K A;  4Y2R A;  3T5K A;  4GXI A;  1NK8 A;  4KLM A;  2KK0 A;  4EX6 A;  1PK3 A;  2G09 A;  3D2N A;  4K4H A;  4BGD A;  2ZJ8 A;  1KBU A;  2W9C B;  3U26 A;  4ECT A;  3KBB A;  2MAX A;  2EAN A;  4QZ9 A;  5J2J A;  1MSW D;  1L8O A;  4Y2Q A;  4QZF A;  1ZD3 A;  1ZQP A;  1RXV A;  3RRG A;  4TUP A;  1Z3E B;  2Z7J A;  1BNP A;  1SIJ A;  1L5U A;  1L3T A;  2I1Q A;  1B4F A;  3OJU A;  4RPZ A;  1ZQU A;  3KOO A;  2LHT A;  5KTQ A;  7ICO A;  2W7O A;  9ICG A;  2PFP A;  1NK0 A;  4QZB A;  2BCQ A;  1NOM A;  4R63 A;  2ZTC A;  1P7D A;  1RQL A;  3F5E A;  4DFP A;  4OJL A;  3CRX A;  2W04 A;  3QU9 A;  5KFG A;  3C2M A;  3HT3 A;  3SAG A;  1LB2 B;  4XRH A;  3Q8R B;  1B43 A;  2CRX A;  2E8N A;  3KKA C;  4UAU A;  3GDX A;  1ZQG A;  2FPK A;  2R8I A;  4FS1 A;  1N2X A;  1NK7 A;  3GFK B;  4YVZ A;  2C2R A;  3GIJ A;  5DB8 A;  4RNN A;  1SV0 A;  3QXG A;  1MC8 A;  3UXN A;  4Y2Y A;  4ACO A;  3NUQ A;  4UAR A;  1QQ6 A;  4C80 A;  4EYH B;  8ICZ A;  1ZJM A;  4O5C A;  1IG6 A;  3UXO A;  4YXM A;  4ED0 A;  3PX4 A;  1ZOL A;  4PHE A;  4J9O A;  3WK5 A;  1RYR A;  2BCU A;  4RQM A;  2RQ5 A;  1V9P A;  2YB1 A;  1VDV A;  1F44 A;  4KLE A;  4C4T A;  3SV4 A;  5DLG A;  2BQ3 A;  1ZQH A;  4MF2 A;  3RB6 A;  3RBD A;  2K89 A;  3AQF A;  5AK3 A;  3NAS A;  4I2G A;  5D4B A;  5J0Y A;  1MQ3 A;  1XO1 A;  5TIS U;  3IRU A;  4M0A A;  2G5H B;  4JV1 A;  1N5W A;  2BQR A;  1BVS A;  1J2M A;  4UQG A;  1KSP A;  2V4R A;  1JI7 A;  3MAB A;  5J2F A;  3GV5 B;  5ALL A;  3PZP A;  1TVA A;  2HI0 A;  2KP7 A;  1RYU A;  1DGJ A;  3MR6 A;  3FYH A;  2N1R A;  5CJ7 A;  4PHP A;  1NKC A;  5AKY A;  4DS5 A;  3KFU F;  3V7K A;  1COO A;  2OHF A;  2ZIU A;  4CDG A;  8ICX A;  3LDA A;  4PHA A;  3GQC A;  1T8E A;  1ZQE A;  1S77 D;  2ZIV A;  3NS1 A;  3PX0 A;  4EZ9 A;  2FLP A;  3GU3 A;  4ICA A;  2ATL A;  1PVP A;  1Z4N A;  2R8H A;  2VIX A;  1BPX A;  2RLT A;  2ZUC A;  4M6W B;  4OD0 A;  1SB3 C;  4YR0 A;  4UAV A;  2W55 A;  4NM2 A;  4DOC A;  4DL4 A;  5AKJ A;  1YT3 A;  1S0N A;  5ALE A;  3K1R B;  4EEL A;  2WB1 F;  1XNS A;  5KFV A;  5EWG A;  5AKK A;  3MR5 A;  4ECW A;  4DCC A;  5DGA A;  3AMZ A;  3UXP A;  1ZJN A;  2A1A A;  2QLT A;  5L1I A;  2DFL A;  2G07 A;  4O3Q A;  3C1Z A;  4QZC A;  1T94 A;  4IR1 A;  1H38 A;  2G08 A;  1B0X A;  3BQ1 A;  4CE6 A;  2WB1 C;  4F4K A;  3SEI A;  4J9R A;  3UMC A;  7ICP A;  4O5E A;  1Z1V A;  5FP0 A;  2EAP A;  3WKB A;  3AU2 A;  3TAD C;  3R9K A;  2E5S A;  1O03 A;  2YML A;  5KFF A;  3F2B A;  1QLN A;  1L3V A;  2E8P A;  3THV A;  3M9N B;  2W43 A;  3PO4 A;  4ED8 A;  5J2D A;  4F50 A;  5ALZ A;  5HP4 A;  9ICS A;  4QW8 A;  4E0D A;  2EZZ A;  1QCK A;  4NLN A;  2IBK A;  3KZX A;  1UQV A;  1UPH A;  3AEV A;  4LVS A;  3NVZ A;  4UB8 U;  1JN3 A;  1UCV A;  5EWF A;  2XCA A;  3LVW A;  5AKL A;  9ICE A;  1K1S A;  1S8O A;  4O3P A;  4ECR A;  9ICT A;  1CI4 A;  4NLB A;  4DF4 A;  8ICA A;  1ZQS A;  2KTQ A;  1U49 A;  2E1F A;  5EOZ A;  1L7N A;  5KG7 A;  4PHD A;  4TUR A;  1WUD A;  5GTI U;  2AGP A;  4MFC A;  2E1E A;  2NRZ A;  1PUZ A;  1NJW A;  5KT3 A;  5J2H A;  3ISD A;  2HW3 A;  5KFE A;  5L1K A;  2KD1 A;  1UA1 A;  1WCN A;  5IIN A;  4O3R A;  1A6S A;  2YTU A;  1VLB A;  4J9N A;  5ALM A;  3KD3 A;  2O6K A;  3WK6 A;  5ALW A;  5BOL A;  1OXJ A;  2F77 X;  5ALD A;  3PW5 A;  4MFF A;  2KIV A;  3N4M B;  8ICL A;  5AM4 A;  2IHM A;  2KSO A;  4G9B A;  4FS2 A;  5KG1 A;  2OCE A;  2PFN A;  2CPR A;  3WK7 A;  5KL1 B;  3H7I A;  3MC1 A;  4O3S A;  4B6J A;  1N48 A;  3MGV A;  5DBC A;  2XGP A;  5AI0 A;  5AIB A;  3WU2 U;  1JIH A;  4J9K A;  3E2E A;  3UQ0 A;  2LMR A;  1XSL A;  1TAM A;  3H8J A;  4MF8 A;  5KT7 A;  2CXY A;  5DG9 A;  8ICT A;  4NWI A;  2KEY A;  3TAQ A;  1C20 A;  2RRD A;  2VAN A;  4EYI B;  1PZN A;  4QZD A;  3EPI A;  3JPQ A;  2P66 A;  2ISO A;  5HHI A;  5DB9 A;  9ICJ A;  2UVV A;  2JEF A;  4QWE A;  1S9F A;  4M9G A;  4Z6E A;  2XY7 A;  2ZTE A;  2GO7 A;  4YQW A;  1TE2 A;  2VJ4 A;  2VKQ A;  4DQI A;  5KFR A;  2ZIU B;  2W03 A;  3UM9 A;  4NXZ A;  7ICL A;  3C5F A;  5ALY A;  4YG2 A;  1Q3V A;  2KJ9 A;  4U6P A;  1F5S A;  9ICP A;  1U47 A;  2DUY A;  2H3V A;  1QQ7 A;  2KV2 A;  1F0M A;  2AU0 A;  5DGB A;  4MEX A;  4KLI A;  4FZN A;  2ASD A;  4DFK A;  3L3F X;  4USA A;  1ZD4 A;  9ICC A;  2BQU A;  1X9X A;  2ESE A;  5CWR A;  1L8L A;  4OJ6 A;  4OJP A;  2BPC A;  1QSL A;  4F4Y A;  3GIM A;  2V9W A;  1PK1 B;  4PPX A;  2H3Q A;  4P0P B;  8ICY A;  4YR2 A;  4QZH A;  3H0L B;  5J29 A;  4P4M A;  1D8L A;  3ALR A;  1ZQV A;  4IQV A;  1QTM A;  3EYZ A;  2NRX A;  3ZDE A;  2HVI A;  1ZQI A;  2ZIX A;  3PO5 A;  2W9B A;  2PI5 A;  3NTU A;  5KFN A;  2IOF A;  3RJJ A;  5KL8 B;  4P4O A;  5ALS A;  3C23 A;  3AUO A;  1ZQR A;  2WHE A;  1DOQ A;  2W3R A;  4ECS A;  1HUZ A;  4CGZ A;  3TFR A;  2DKX A;  4RUA A;  3QE9 Y;  4Q8F A;  2EQY A;  2LI6 A;  2JH1 A;  4F5N A;  4DSL A;  5HML A;  4MEY A;  4PGY A;  5L1J A;  3NVV A;  1ZRM A;  5AIA A;  2HSZ A;  3I1Y A;  4PJ0 U;  4DSF A;  1Z1B A;  4I29 A;  2WF6 A;  1JAL A;  1SXD A;  2RHF A;  2A1J A;  4BWM A;  3K1Z A;  1NNL A;  4OO1 J;  4RU9 A;  5ALV A;  2PFQ A;  2HCF A;  3T5J A;  5KFT A;  3M8R A;  2NYV A;  5ALK A;  4YP3 A;  3RR7 A;  1Q3U A;  4TUQ A;  3OJS A;  2Q0Z X;  4Q43 A;  7ICK A;  1ZRN A;  4KLL A;  1XU4 A;  2GH1 A;  4BXO A;  5DBB A;  5AKI A;  5AM5 A;  4CCH A;  4ED2 A;  5ALT A;  1TV9 A;  2PXI A;  2R8G A;  4NLC A;  1A77 A;  2FPM A;  4I27 A;  2ISP A;  1X6J A;  2OXO A;  5F3X B;  2QAR B;  4R64 A;  1SKR A;  2LYH A;  4F2R A;  3SAF A;  2ZUD A;  4KTQ A;  4GC7 A;  4ED7 A;  4DL6 A;  4HAI A;  4KLD A;  4F72 A;  2ASL A;  1NZP A;  3SQI A;  2LYA A;  2BR0 A;  5KFD A;  2K8C B;  4C8O A;  4CNQ A;  3DEE A;  2VA3 A;  2AQ4 A;  3H4D A;  2DWQ A;  3QUC A;  3LYS A;  1NI3 A;  2KSO B;  5J8Y C;  2KZ3 A;  1SL1 A;  4C0Z A;  4J9L A;  3O0F A;  5KFX A;  4EEK A;  9ICV A;  5D46 A;  3QUQ A;  4QJF B;  1X40 A;  4TQS A;  3G6X A;  1TAU A;  4JK1 A;  1JXE A;  4RQ0 A;  5KG0 A;  5J2G A;  4EEN A;  4YXJ A;  3V6J A;  5AKE A;  3F53 A;  3I76 A;  4RT2 A;  3RTV A;  2XC9 A;  3JPN A;  4EBD A;  3ORY A;  3E58 A;  1TK0 A;  5CRX A;  8ICM A;  1KL9 A;  3KHH A;  3PML A;  4O9M A;  5ALO A;  2ZIW A;  4UAZ A;  3PV8 A;  4FBT A;  5JUM A;  3RH6 A;  2BPF A;  2EZY A;  3BQT A;  3BS5 B;  2K60 A;  4AP9 A;  4PZO A;  3M9M B;  2JEJ A;  3ETL A;  3V6K A;  2HHQ A;  2MRL A;  4KMU A;  4UB1 A;  1T4G A;  3T5H A;  2DBY A;  5KG6 A;  8ICR A;  4RPY A;  5HMM A;  4RQ1 A;  4JMU A;  4I2F A;  3V7L A;  3WKD A;  1TKD A;  2EAM A;  4Y2X A;  1SKW A;  4DL2 A;  8ICF A;  2KN7 A;  3DV9 A;  3CYM A;  5EWE A;  3GII A;  2YN4 A;  3D2S A;  2FMQ A;  4B9M A;  5AI5 A;  2HHS A;  4JV2 A;  4K4I A;  4ECX A;  2BDP A;  2NRT A;  1PVR A;  2YMQ A;  7ICG A;  1FO4 A;  4QZI A;  5AI9 A;  4C8L A;  1URJ A;  8ICB A;  2H5X A;  3K4G A;  9ICN A;  3OPX A;  2OM6 A;  4I2E A;  4FBU A;  1S5L U;  4Y2U A;  4CRX A;  5AK5 A;  2W9B B;  4RQ8 A;  1V85 A;  2E3T A;  2W11 A;  1ZQC A;  4QNL A;  5KFI A;  2R8K A;  2LPE A;  1FIQ A;  1WCL A;  3TAC B;  4EBE A;  5ALJ A;  3KHG A;  1ZD2 P;  5DQI A;  3GIK A;  2HHU A;  1S76 D;  4US9 A;  5DBA A;  1ZQF A;  4B9V A;  2G5I B;  9ICA A;  3ETR A;  4YMM A;  1CEZ A;  2W7P A;  4XQ8 A;  5KFM A;  4Y2J A;  3SD7 A;  1XC9 A;  3TI0 A;  4R66 A;  4IL6 U;  2K8A A;  3NVW A;  2MUT B;  1MQ2 A;  4F5R A;  4F5Q A;  3A0H U;  2AGO A;  1XS9 D;  1X9M A;  2MU2 A;  5A0L A;  1IM4 A;  3QZ7 A;  5HNK A;  1BGX T;  1IV8 A;  5KG4 A;  3T79 A;  4UW9 A;  3F5A A;  1A76 A;  2W3S A;  4TQR A;  4DS4 A;  4M04 A;  3MGI A;  4Y2V A;  3WK8 A;  2FLN A;  4QWA A;  4A8E A;  1WWV A;  5J2K A;  4BUG A;  3LWM A;  4C7Z A;  4KLS A;  2EZX A;  1GO3 F;  3G6V A;  3SI8 A;  3KKA A;  5J0P A;  1BPY A;  4G3I A;  3SV3 A;  2NO4 A;  3IN5 A;  4DSE A;  2AGQ A;  4JWM A;  5ALH A;  5EE9 A;  9ICU A;  4US8 A;  3Q8Q B;  1JXL A;  2WF8 A;  1X42 A;  2Y0S F;  4PL1 A;  4NLZ A;  4KX3 A;  4NL9 C;  3KHL A;  7ICQ A;  5ALQ A;  1MA7 A;  4J9Q A;  1HJP A;  4CF3 A;  5AM0 A;  2C2D A;  5ALU A;  2PMZ F;  2Y0S C;  2YY6 A;  2ZXH A;  5AKH A;  2WFA A;  2KVC A;  5DQG A;  5J0X A;  2D8C A;  4ED1 A;  5HR7 A;  2K4E A;  3NRZ A;  3EZ5 A;  3ZDA A;  4F4W A;  2PI4 A;  4RNM A;  2HMX A;  3SZ2 A;  1ZQN A;  1QSY A;  2IHN A;  1WWU A;  4BWJ A;  3QNM A;  2RDJ A;  4UBB A;  3ZDB A;  2M9N A;  3C5G A;  3PY8 A;  3RJK A;  4J9S A;  3RJF A;  2K4P A;  2HBM A;  4DLE A;  3UPQ A;  4DFD A;  4MFA A;  1NK9 A;  2D3D A;  4KLH A;  2F3N A;  3WKA A;  1YZ6 A;  2KVS A;  2OWO A;  2YB4 A;  4I2I A;  2BGW A;  3PVX A;  5TZV A;  2FI1 A;  2ODG A;  2GWS A;  2DQN B;  2FMS A;  3RJI A;  1ZQM A;  2IOF K;  5CB1 A;  1Z4O A;  2NRW A;  2UVU A;  2W54 A;  4QIW F;  3H8W A;  2LM4 A;  4UB3 A;  2LYB A;  1UT8 A;  1OUQ A;  4QWB A;  2GLE A;  4R8U A;  5J0O A;  4Q44 A;  1N63 A;  4M47 A;  5KFZ A;  4QIW C;  4NLK A;  3PR4 A;  1MN8 A;  2KJ5 A;  2AQ0 A;  5AI4 A;  3B0X A;  2HHT A;  2KMD A;  2DPI A;  2F8K A;  3QU2 A;  3QYP A;  4HYK A;  5KFQ A;  9ICQ A;  3MBY A;  1DK2 A;  2I6X A;  4ZOH C;  4I2B A;  3ICX A;  3N7P D;  2VA8 A;  1S0V A;  1RQN A;  3CP8 A;  3LVV A;  5GTH U;  2RDI A;  7ICI A;  5KNI A;  4JUZ A;  2JZB A;  5F9N A;  1KRP A;  1L3S A;  1X2I A;  5IIM A;  4AYB F;  2P6U A;  4RNO A;  5ALI A;  1JMS A;  1RYS A;  1V97 A;  4PZN A;  7ICH A;  3PR5 B;  3TAD A;  4X5V A;  1NK4 A;  2WF7 A;  8ICO A;  3K75 D;  2YMM A;  5ALP A;  2YMP A;  4AYB C;  2FPL A;  1WYG A;  4LZD A;  1ZQT A;  2G0A A;  2C28 A;  7ICR A;  1SXE A;  1TK8 A;  9ICL A;  1N60 A;  1XSP A;  5CR0 A;  4DSI A;  4KLF A;  2W9C A;  3EPG A;  5J2B A;  3ZD8 A;  5BPC A;  1ZQD A;  2XCP A;  4OJ5 A;  1ED1 A;  1NKE A;  1UHU A;  2FJ6 A;  5KFW A;  2MA1 A;  2RP5 A;  2YX8 A;  1XO0 A;  9ICH A;  4R65 A;  5ALF A;  2ZTD A;  2ZIV B;  2KJ8 A;  2QB1 A;  4DQQ A;  4F91 B;  1DK3 A;  1D8B A;  4I2J A;  4DLG A;  3JPS A;  5J2C A;  3BJY A;  4YCX A;  3AU6 A;  1BPD A;  5DG7 A;  1BNO A;  7ICU A;  2WAQ F;  2E8M A;  1PVQ A;  2F8L A;  2P35 A;  3ZDD A;  4F3O A;  1UA0 A;  3TKA A;  4F5P A;  1TFR A;  3RRH A;  4DFM A;  1SWV A;  2KIC A;  2JV3 A;  3C29 A;  3NGD A;  4C8K A;  2WAQ C;  3BZC A;  4KN7 A;  2HHV A;  3MR2 A;  5J0W A;  5DDY A;  4JWN A;  1OW5 A;  3HX0 A;  2OYY A;  1SWW A;  3DDH A;  3ONN A;  4KMO B;  3BQ7 A;  4NLG A;  2XIC A;  4DFJ A;  2UVR A;  3V72 A;  4YR3 A;  1SL0 A;  4KLG A;  4FZL A;  5IIK A;  4LJX A;  3T3F A;  1QSS A;  2JEI A;  5KFP A;  2H3I A;  3IV6 A;  5KFA A;  3TAR A;  1X66 A;  1ZYQ A;  5KFJ A;  8ICK A;  2KIW A;  3D2Q A;  1Q46 A;  4YD2 A;  1ZQW A;  3HP6 A;  3H4B A;  2HVH A;  4ECZ A;  4J9P A;  8ICW A;  4F92 B;  5J0T A;  3ISC A;  1RXW A;  1N62 A;  5DB6 A;  3TFS A;  5C0Y A;  3ISB A;  2WF9 A;  1UT5 A;  4F4Z A;  2ZUB A;  1RZT A;  1Y88 A;  3E0F A;  2XVT A;  4FE3 A;  2KFZ A;  3L4P A;  5KT4 A;  3HRD D;  2F1I A;  1LV5 A;  4QWC A;  1DRG A;  8ICN A;  4I28 A;  5KAF U;  3N7R C;  5KT2 A;  4QZG A;  3J81 j;  4ED6 A;  3BZK A;  4WJ3 B;  3IP4 B;  1SZP A;  2R8J A;  3A0B U;  4XA5 A;  8ICI A;  2ES6 A;  3OHA A;  4YMN A;  2J6T A;  1QH9 A;  4M9L A;  4Z6F A;  1ZQK A;  3WKE A;  2WTF A;  9ICK A;  9ICW A;  4IQU A;  5EE0 A;  3UQ2 A;  1KDH A;  1K1Q A;  1T3Q A;  2P6R A;  1N61 A;  5KFH A;  3RR8 A;  1U45 A;  4OCZ A;  3NRW A;  1CRX A;  1SV0 C;  5HHH A;  1ZQL A;  4RQN A;  4O3M A;  5J0S A;  3Q8S B;  2BZF A;  4NV0 A;  3HJE A;  5AKG A;  5KFS A;  1FFU A;  8ICU A;  3C2K A;  3NVY A;  3EUB 2;  1ZQO A;  3IG5 A;  4DOA A;  2IMW P;  1ZQJ A;  4F8R A;  4QZA A;  5KFK A;  1ZQ1 C;  3OGU A;  4DEZ A;  4KLT A;  3N97 B;  4NY8 A;  5DKW A;  2XGQ A;  1L7O A;  2W9A A;  3WKC A;  5KT5 A;  5AIC A;  3PW4 A;  3M1Y A;  3RH5 A;  4B9T A;  3MDA A;  1S0M A;  8ICC A;  2PKE A;  4KLO A;  1NJY A;  4UB6 U;  1SV4 A;  4UB5 A;  5IIL A;  1M6Y A;  2LM1 A;  3IHQ B;  1FFV A;  4DF8 A;  2Y1J A;  3SEN A;  1S10 A;  3GIL A;  4MHV A;  1DGS A;  1LVH A;  4EX7 A;  5F9L A;  1TAQ A;  3RB4 A;  4DQP A;  4CF5 A;  1C7Y A;  4IC9 A;  9ICX A;  5AM3 A;  1NK6 A;  1KFT A;  4Z6D A;  4JB3 A;  4YMO A;  1SL2 A;  2KFN A;  4DQR A;  4I2A A;  1SZH A;  2DKZ A;  1KLN A;  2V4Q A;  4DOB A;  4DL5 A;  4UB4 A;  2VA2 A;  4Z6C A;  4Q8E A;  3JPO A;  2BPG A;  1NJZ A;  4IRD A;  2OEH A;  5DLF A;  3C2L A;  3PNC A;  1YZ7 A;  1D9D A;  4P2H A;  7ICS A;  4M9N A;  4F71 A;  1NJX A;  1JX4 A;  4PGQ A;  8ICQ A;  5E79 U;  3TQ1 A;  3M9O B;  1K5O A;  2JMG A;  4PH5 A;  5B66 U;  4QW9 A;  3IG8 A;  2E8O A;  4QWD A;  5KT6 A;  4XUS A;  2ZIX B;  3B0Y A;  4YN4 A;  5J8Y A;  4DSJ A;  3RFA A;  2QB0 A;  3S6J A;  4PL2 A;  9ICM A;  3HW8 A;  9ICR A;  1HEK A;  3PSF A;  4GIB A;  2L5Y A;  1EXN A;  2ZG6 A;  1ZQY A;  2GOL A;  5DG8 A;  3M6Z A;  4RQ6 A;  2IA6 A;  4DQS A;  4RQ5 A;  3JPP A;  2H3Z A;  5AK4 A;  4RQ3 A;  3Q8K A;  3C28 A;  1N5X A;  2A1J B;  2ZJA A;  5KG3 A;  2F2A B;  2XID A;  2Y9U A;  1U4B A;  5CEH A;  3RJH A;  5DB7 A;  4DL7 A;  1RG6 A;  3QU5 A;  5L9X A;  3EW9 A;  3QEB Z;  2J6U A;  5AKZ A;  2JXJ A;  3V7J A;  4ECV A;  2BHN A;  5CHG A;  3MDC A;  5CP2 A;  4P4P A;  4UB2 A;  3N28 A;  2K8B B;  1Z00 A;  1CUK A;  5EE3 A;  4BXO B;  1X6I A;  5III A;  2AHO B;  1V38 A;  8ICV A;  1DXS A;  2LBO A;  1U9L A;  1XSN A;  3V6H A;  4O3O A;  5KFO A;  7ICT A;  1RM6 C;  1RDF A;  3GV8 B;  1ZET A;  2DL0 A;  3HIL A;  4M9H A;  5J2E A;  1KEJ A;  5IIO A;  5KG2 A;  2HOQ A;  2UVW A;  4GXJ A;  2NV3 A;  4BJQ A;  3H0M B;  5G5G A;  5AKX A;  3FC4 A;  1XWL A;  3LWL A;  2KNJ A;  2BKE A;  1SGG A;  1VJ5 A;  4UAT A;  4B9U A;  3RF9 A;  2CN1 A;  4ZH4 A;  3HKZ F;  5DDM A;  2JEG A;  2W8L A;  2IOH A;  9ICB A;  3AM9 A;  2KZM A;  4Y2P A;  3PW7 A;  3M6K A;  4I2D A;  3N7S C;  3AN1 A;  4C4R A;  2MSN A;  3L5K A;  7ICN A;  4DL3 A;  2BCV A;  8ICJ A;  1PK1 A;  3HKZ C;  1Z19 A;  2KG5 A;  2JR5 A;  2JGA A;  4P0P A;  5KFB A;  5C5J A;  4Y2T A;  1SKS A;  9ICI A;  5EE1 A;  4DWI A;  4UAY A;  3HPO A;  2XY5 A;  3RJG A;  1ECW A;  3FM9 A;  3LK9 A;  4U7C A;  2HBJ A;  2PMZ C;  3H8S A;  3JPR A;  4NJ8 A;  1KN5 A;  9ICF A;  2EDU A;  4RT3 A;  2F1H A;  3C1Y A;  1HUO A;  4IRC A;  2EH9 A;  3KHR A;  1ARO P;  2EAO A;  4C8M A;  3Q8L A;  4JV0 A;  5AHX A;  3G6Y A;  4GFJ A;  3AL0 B;  2ZIW B;  5JTI A;  4Y2S A;  3TAN A;  1D9F A;  3B9J A;  3MFH A;  3SAH A;  3BDP A;  4UAS A;  3SR6 A;  1LKY A;  4ELT A;  4QZ8 A;  2LKY A;  3RAX A;  1N56 A;  4P0Q A;  1WG8 A;  2DF4 B;  2DPJ A;  2A3V A;  1RPL A;  3I28 A;  3D6J A;  1IXR A;  3H0R B;  1FEZ A;  2HBK A;  3CW2 C;  3JPT A;  2FMP A;  5KG5 A;  3H8M A;  5ALR A;  1X9W A;  3QU7 A;  1S0O A;  5CA7 A;  5T14 A;  5HR6 A;  2K4I A;  5AM2 A;  2KHQ A;  2ZJ5 A;  5J0U A;  5JRT A;  4IR9 A;  2Q4T A;  4OJO A;  4NL9 A;  3ZI4 A;  3QUT A;  3C21 A;  7ICE A;  2QAR A;  2OH2 A;  5ALN A;  1HIW A;  1ZXI A;  5KFL A;  2QKQ A;  4B9L A;  7ICV A;  4RZR A;  1QQ5 A;  3T5L A;  4IQT A;  2ALZ A;  2QB0 B;  4ECQ A;  4NM1 A;  3RBE A;  1KFS A;  3FAH A;  3F2D A;  2FLL A;  1ZQA A;  3MR3 A;  3RB3 A;  2ZXI A;  8ICE A;  2KHV A;  1NZB A;  5BOM A;  1S97 A;  5KFY A;  4KN4 A;  2F1J A;  2BCR A;  3AQE A;  4F2S A;  1D8Y A;  7ICJ A;  1BPE A;  4I2C A;  4J9M A;  3QUB A;  4UBC A;  3OHB A;  1L7P A;  1BPB A;  1KKX A;  1KW4 A;  4KIT B;  2AJQ A;  2XI9 A;  3VC8 A;  3OSP A;  3SYZ A;  3M8S A;  2JH7 A;  2FE9 A;  4PGX A;  5B5E U;  2NRV A;  1COK A;  3CNH A;  3EWA A;  1Z00 B;  5L1M A;  2XY6 A;  1NK5 A;  2FDR A;  5DQH A;  1T3N A;  2B0C A;  1TK5 A;  2HHX A;  3UMB A;  3WK4 A;  1KTQ A;  3H40 A;  4DO9 A;  2Y1I A;  3OTQ A;  4BDP A;  5L1L A;  5K4L A;  4F5O A;  1ZD5 A;  2H3F A;  3QU4 A;  5KAI U;  1T7P A;  1O08 A;  5J0R A;  3HWT A;  1J97 A;  3RB0 A;  3PX6 A;  4IQW A;  3BQ2 A;  8ICH A;  3BS5 A;  4EZ6 A;  5G5H A;  1JRO A;  3PW2 A;  5AI8 A;  5KFU A;  1AQ6 A;  3BQ0 A;  2KZZ A;  1IIP A;  2W9M A;  5J0Q A;  5JU5 A;  3WK9 A;  2F44 A;  4RQ4 A;  2VJ5 A;  1B22 A;  2D6F C;  3Q8M A;  4ELV A;  4O3N A;  1ZQZ A;  3GV7 B;  1ZQQ A;  4FZM A;  4LZG A;  4B9N A;  2BCS A;  4F4X A;  2I9G A;  4EEY A;  4I2H A;  3Q8P B;  1ZQX A;  4C4S A;  4CF4 A;  4YD1 A;  4RQ2 A;  1ZQB A;  4GLX A;  4K4G A;  2YQE A;  3SMV A;  4UAW A;  1NKB A; 
#chains in the Genus database with same CATH homology
 3F5A A;  1NZB A;  2KOB A;  2H3Z A;  2G0A A;  2VIX A;  2KIW A;  1L6N A;  3C28 A;  2H3V A;  2KV2 A;  2JHD A;  2YB4 A;  3D2Q A;  4KX5 A;  1WUD A;  4U7C A;  2MRL A;  4FZN A;  4NLC A;  2HBJ A;  3F2C A;  2F2A B;  2PMZ C;  4ACO A;  2DGZ A;  2XID A;  2DQN B;  3L3F X;  2OXO A;  3AQE A;  2KKP A;  3NUQ A;  2E1E A;  2G06 A;  4A8E A;  1YT3 A;  4BUG A;  3SAF A;  1GO3 F;  4OJ6 A;  4OJP A;  4JMU A;  3PST A;  4QIW F;  5C0Y A;  2K4H A;  2KD1 A;  2XI9 A;  4OJ5 A;  3VC8 A;  4GFJ A;  3VCB A;  2WB1 F;  1ED1 A;  3M7D A;  1XNS A;  3AL0 B;  1A6S A;  2MA1 A;  2RP5 A;  2YX8 A;  2H3Q A;  3CYM A;  3E0F A;  1XO0 A;  2ZIW B;  4P0P B;  2JH7 A;  2K8B B;  2ZIV B;  4IC9 A;  3IN5 A;  2XVT A;  2YB1 A;  3GZF A;  2LYA A;  2LYB A;  3SQI A;  1F44 A;  3PSI A;  3D2S A;  2KJ8 A;  3H0L B;  2LBO A;  4FE3 A;  1D8B A;  3SAH A;  2K8C B;  1PVR A;  3ALR A;  1OUQ A;  2F77 X;  3DEE A;  2G09 A;  3D2N A;  1SZH A;  2ZIX A;  4QIW C;  2G07 A;  2K89 A;  2LKY A;  2Y0S F;  3AQF A;  4PL1 A;  1DRG A;  1T94 A;  4KX3 A;  2HOF A;  2G08 A;  1URJ A;  2KJ5 A;  3LYS A;  4P0Q A;  2WB1 C;  5KL8 B;  1KBU A;  3N7R C;  2OM6 A;  3OPX A;  2HOQ A;  2WAQ F;  2DF4 B;  2CPR A;  5KL1 B;  2HBL A;  4WJ3 B;  4CRX A;  3IP4 B;  2A3V A;  1PVQ A;  2NV3 A;  4CGZ A;  4BJQ A;  3MGV A;  4P0Q B;  2F8L A;  2G5H B;  3H0M B;  1MA7 A;  4C0Z A;  2R18 A;  3O0F A;  2H3F A;  2JH1 A;  3H0R B;  2E5S A;  4QNL A;  2HBK A;  3PSP A;  4QJF B;  1TAM A;  2KIC A;  2KNJ A;  3F2B A;  2PMZ F;  3ICX A;  2HOI A;  2Y0S C;  1Z1B A;  3N7P D;  2Z7J A;  2JMG A;  3C29 A;  3PZP A;  2ZXH A;  3IG8 A;  2M0N A;  4NWI A;  3RF9 A;  2CN1 A;  2KKV A;  5T14 A;  3CP8 A;  2BDU A;  3LVV A;  2K4I A;  2KVC A;  2WAQ C;  2KEY A;  5HR6 A;  2KHQ A;  2RRD A;  2LHT A;  3HKZ F;  5HR7 A;  2RHF A;  2G5I B;  2Q4T A;  4OJO A;  2N1R A;  3K1Z A;  2W7O A;  2K4E A;  3F53 A;  2W7P A;  3NRW A;  1CRX A;  1IIP A;  2ZIX B;  4AYB F;  4OO1 J;  4O3M A;  3KZX A;  1UPH A;  2OYY A;  2VJ5 A;  2HMX A;  4NV0 A;  3RFA A;  2D6F C;  2OH2 A;  1P7D A;  3KFU F;  3F5E A;  1HIW A;  4OJL A;  2K8A A;  2W04 A;  4FZM A;  2ZIU A;  4PL2 A;  3CRX A;  4CDG A;  3LVW A;  3ONN A;  4KMO B;  3M6K A;  3SAG A;  5CRX A;  1Q3U A;  1HEK A;  3N7S C;  2XIC A;  3PSF A;  2VJ4 A;  2CRX A;  2VKQ A;  1A0P A;  3HKZ C;  1Z19 A;  2ZIU B;  2W03 A;  3IG5 A;  4FZL A;  2JGA A;  4NLB A;  2ZIW A;  5A0L A;  2ZG6 A;  4P0P A;  2HBM A;  2GOL A;  2GH1 A;  2ZIV A;  4AYB C;  2F76 X;  3M6Z A;  1ZQ1 C;  3F2D A;  1Q3V A;  2KJ9 A;  4BX9 C;  2H3I A;  3GU3 A;  4U6P A;  2E1F A;  3SMV A;  1ECW A;  3T79 A;  2ZXI A;  4ICA A;  2KHV A;  1PVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...