2DF4B

Structure of trna-dependent amidotransferase gatcab complexed with mn2+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
399
structure length
399
Chain Sequence
b'HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 117
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2df4B02
2F2AB 3H0RB 3H0MB 2D6FC 3IP4B 3KFUF 3H0LB 2G5HB 2DF4B 1ZQ1C 3AL0B 4WJ3B 2G5IB 2DQNB
chains in the Genus database with same CATH superfamily
4KLDA 2KZMA 3M9OB 2KJ8A 3CYMA 1UHUA 1BPYA 4I29A 3UQ0A 4TUQA 3ORYA 3LK9A 1NZBA 8ICGA 1U9LA 5AKHA 5BPCA 8ICTA 1HEKA 7ICEA 5DB6A 5CA7A 4IRCA 4DSEA 4B9LA 2LYHA 3RH5A 4F4YA 8ICKA 2HBKA 5HR7A 4I28A 1Q3UA 1Q46A 1HIWA 4C0ZA 4KLGA 3K1ZA 3S6JA 1JXEA 1NZPA 3QEBZ 5KAFU 3T5HA 5DB8A 2IHNA 2G5IB 3PVXA 4K4IA 1BGXT 3KKAA 3QUTA 4NL9C 4YFKA 4QZFA 5L1LA 3O0FA 3UXOA 3ZD9A 5C0YA 2J6UA 4YCXA 3HKZC 4R8UA 3ETRA 5KT4A 3TAPA 2VA3A 1J2NA 1S0VA 1JMSA 4RQ1A 4KLTA 4KITB 3N28A 5KFHA 3OSPA 3UMBA 4RPZA 5ALOA 1KFSA 4YR2A 2MUTA 1PK1B 1L6NA 1A77A 5KG2A 2PMZC 5DDMA 8ICRA 4KTQA 1KL9A 3EWAA 3RB4A 2H3VA 3SV4A 1SXEA 4FZLA 5ALVA 4DSKA 2KNJA 2VA8A 4DQSA 2FLLA 5KFJA 4KLFA 3IM1A 4QWAA 4GC6A 1HUOA 9ICIA 3QYPA 4Q45A 4MFFA 5AI8A 4IC9A 1T3QA 1L5UA 3RJFA 3AN1A 1NKCA 2RDJA 4DOBA 4KLLA 5AM2A 2KVSA 3ALRA 5KFEA 3MFIA 4UAZA 2PFQA 4O3SA 5CJ7A 3EPGA 4KLUA 4Y2SA 4DLGA 2I9GA 1L8OA 3M8SA 4UBBA 2MAXA 5ALPA 5AKJA 4O0IA 8ICSA 1O03A 2KKVA 3WK7A 5DKWA 4PJ0U 4JK1A 3NASA 2W04A 1TAMA 4C4SA 4KMOB 9ICAA 3SENA 1KW4A 1FEZA 4YP3A 2OCEA 4I2AA 5KG3A 4QZEA 2YMLA 3QEAZ 1SL0A 4F4WA 4LJXA 1A6SA 3GILA 5HHHA 3JPQA 2W8LA 2EZXA 5ALUA 4OJLA 5JU5A 3TAQA 2NRXA 5KT6A 2W54A 2WAQF 5A0LA 3ISCA 4IQTA 2YTUA 2ZIUB 3AU6A 4I2FA 5AM3A 2JZBB 4QZGA 3LWLA 3V7JA 4DL2A 4DL4A 4I2IA 2F8LA 5IILA 4O9MA 4BWMA 5EWFA 2HHVA 3LWMA 4EYIB 1X6JA 4GLXA 1IM4A 3IP4B 1ZQWA 5ALRA 3PSIA 4U7CA 2NRZA 4U6PA 4EBDA 1X40A 4I2HA 1PVRA 5AKGA 1N56A 4YD2A 3TFRA 2NRWA 2E8MA 5JUMA 5J0TA 4Y2XA 3QNMA 5D4BA 1TKDA 5KFOA 1SKWA 2W55A 5HMMA 1XS9D 1QSLA 3RH6A 1ED1A 2KIWA 3TACB 4DFJA 2FPMA 3UQ2A 5KFFA 4F5NA 4F5PA 4O3PA 1ECWA 3RJEA 3C21A 5BOLA 3GV8B 3KZXA 5KFGA 2YY6A 1SV0C 2K8CB 2LKYA 1J97A 4Y2RA 5ALXA 2YB4A 3H8JA 4ZOHC 2IOFA 1K1SA 3UM9A 4QZAA 5CHGA 2HDOA 5J2FA 4J9MA 1HJPA 3NRZA 1KEJA 1ZRNA 5TISU 4RQ6A 3K4GA 2JEJA 3H0MB 4KLHA 2V4RA 2E8NA 2J6TA 1N60A 3N7RC 3PMLA 1B0XA 1HUZA 2PFPA 4Y2YA 1ZQFA 4B9VA 4NM2A 1WG8A 5IIJA 2KZZA 3PR4A 2K8AA 3PZPA 1D9FA 1COKA 1DXSA 3LYSA 4OD0A 8ICEA 3H0LB 7ICHA 3QU5A 1BVSA 4DSLA 1NK8A 4GFJA 3C5GA 2W9MA 4EYHB 1QQ5A 3M6KA 7ICSA 2ESEA 9ICFA 5G5GA 2IOHA 4ED6A 4DQIA 4M04A 3KOOA 3LDAA 5HNKA 1KFTA 3H40A 3UMGA 4QNLA 3ZDCA 4OCZA 3HT3A 2MU2A 5E79U 2A3VA 2KOBA 3SYZA 5J2IA 5HMLA 2KFNA 2FJ6A 2BDUA 8ICMA 9ICOA 1B4FA 1F5SA 4Z6EA 3KHHA 4B9SA 2ZUCA 3RJGA 1RPLA 1ZQMA 2R18A 4BUGA 4O5KA 4MEYA 3GV5B 2DKZA 4QJFB 4DO9A 1RM6C 1IG6A 1Z3EB 4M6WB 2YX8A 2K4EA 4F50A 1X9WA 2DPJA 4NLNA 4IQWA 1MN8A 2G0AA 4M9HA 2FLNA 1ZQCA 1H38A 2UVUA 4EBCA 4DQQA 3QUBA 1YT3A 5J0SA 1ZETA 3MBYA 2B21A 2ZIUA 2DL0A 8ICCA 2JZBA 1BPXA 3JPPA 1ZQXA 5DBCA 3FAHA 5KFUA 3G6VA 4PL1A 1RQLA 4DSIA 4AP9A 1L3SA 4J9SA 2I5HA 1DRGA 2IA6A 4DOAA 2LM1A 5IIKA 4RQ2A 3F53A 2K4HA 2BQRA 4TQSA 3BQ2A 5EOZA 1SL1A 4QW8A 4RQ5A 2LPEA 4CF5A 2F1HA 5AK5A 2PI4A 2LM4A 2IOFK 4DL5A 9ICGA 3RJKA 3H4BA 1FFUA 2HHQA 2MUTB 1S97A 5AK4A 5EE1A 2K8BB 2W9AA 2YMMA 1J2MA 4NLBA 3AL0B 2F76X 4O3QA 4JWNA 1TK5A 4FS2A 4MF2A 1ZQAA 1CRXA 3G6YA 4DFDA 1L7OA 5DBBA 3H7IA 4XRHA 4BDPA 3V6HA 1MQ2A 2HW3A 3MC1A 3B9JA 8ICZA 3BDPA 5C5JA 1O08A 5ALTA 4PZNA 4J9QA 5KT5A 2PFNA 2UVRA 2HCFA 3NVYA 1XC9A 3TI0A 2H3QA 4ED7A 4EX6A 2R8KA 3OPXA 4M9JA 5CRXA 4F5QA 4P0QB 3BQ1A 2BDPA 4BX9C 2W8KA 1ZRMA 1ZQHA 1ZD5A 3SD7A 4CCHA 5ALWA 5G5HA 2FLPA 1FO4A 4UB6U 5DLGA 8ICJA 2XY6A 1Q8KA 3Q8KA 3IG8A 1ZQVA 3SEIA 1WWVA 2CPRA 5ALJA 7ICIA 4YMMA 3H8WA 4NLKA 1N48A 2PXIA 2OYYA 9ICJA 2OM6A 2HMXA 2EH9A 5B5EU 4KN7A 5AI5A 5D49A 1V97A 4YQWA 3CRXA 3FDSA 1PVQA 1SXDA 2BCQA 1NJZA 4QWCA 4ECSA 2KEYA 1JALA 5AK6A 5J0PA 1KSPA 1RYUA 4XA5A 4IR9A 1S0MA 7ICLA 8ICIA 1JROA 1IXRA 2D3DA 2ZTCA 1F44A 2CXYA 5HR6A 5J2EA 4J03A 4DWIA 2W7PA 4I2DA 2IHMA 1NK7A 2XGQA 3C23A 5AKKA 3MR2A 4M6WA 3JPTA 2A1JB 3TADC 5DG8A 2HOIA 1JI7A 3NVVA 9ICUA 3RR8A 1JIHA 4YXMA 5KFKA 4PGQA 4Z6CA 1S10A 4ECXA 9ICHA 1T7PA 4ECYA 3JPSA 4G3IA 2JEIA 2L5YA 1ZQLA 2VJ4A 4OJ5A 5KT2A 2AXTU 1DOQA 4CNQA 1BPZA 2ZXHA 4QWBA 5DQIA 2EAOA 5J2DA 3M7DA 3F2DA 4RQ3A 1VDVA 1COOA 4DFPA 1P7DA 3PW4A 1ZQTA 1A76A 5J0XA 4YR0A 4PGXA 4M2YA 4F2SA 4KLOA 3PY8A 1N5XA 2LMRA 3C2LA 4F71A 4QW9A 1X66A 1Q3VA 1LVHA 3NS1A 1TK0A 7ICKA 4Y2QA 1SZHA 3QXGA 4BGDA 3CP8A 1K5OA 1ZQIA 3GFKB 1WCLA 4Y2UA 1NJYA 2KICA 1BNOA 4I2GA 4UB1A 3AM9A 3BZCA 2I6XA 2ZUDA 3I28A 5ALGA 1B22A 5L1KA 2XCAA 5ALYA 2O6KA 2F2AB 3WK5A 3OHBA 1KTQA 3PSTA 3IRUA 4J9LA 2BGWA 4F4KA 2ZTEA 2OHFA 4GIBA 4RU9A 4PHAA 3PW5A 5DGBA 1MSWD 2KD1A 4JB3A 4RQ8A 4RQ4A 4PZOA 3SMVA 9ICPA 3QU7A 3JPNA 3ETLA 3DEEA 9ICWA 4C8NA 3BQ0A 5ALKA 4IQVA 1YZ6A 4CRXA 4XQ8A 1U45A 2YMPA 2AHOB 1X2IA 4PHPA 1NK5A 3V7KA 4O3NA 4DS5A 2EZZA 1KBUA 2Z7JA 1SGGA 4P0QA 4ED8A 4E0DA 5IIOA 4GC7A 3V6KA 9ICVA 3MDAA 3MABA 4C7YA 2EAMA 5KG6A 3L3FX 5DDYA 2HHWA 2AH5A 2K89A 3QUQA 4NM1A 2HVHA 3D2NA 1QH9A 4DQRA 1KRPA 3ISDA 3L5KA 4Q8EA 2YMQA 5EE0A 3C2MA 2A19A 2DF4B 1Z4OA 1NK0A 1BPBA 2JH7A 1SV4A 5KG5A 4C8KA 3OJSA 1TE2A 1A0PA 3PSFA 5HP4A 3LVWA 8ICYA 4IL6U 4PGYA 4YVZA 3AMZA 2E8OA 4NL9A 2C28A 4NV0A 3J81j 1UT5A 2RHFA 1UA1A 2NYVA 1RYRA 2FE9A 2KVCA 4US9A 3GV7B 1PUZA 3UPQA 1S0NA 3JPOA 3HPOA 4M9LA 1YZ7A 4KX5A 2GLEA 4EX7A 3ZD8A 2OH2A 4I2JA 2A1JA 3PX4A 4FE3A 3PNCA 2P6RA 2BPCA 4O5CA 4RQMA 2QARB 2KK0A 1CI4A 2XICA 4RT3A 2Y0SF 4EEKA 3RR7A 1ZQGA 2P6UA 4C4TA 3EYZA 3SAFA 3WKDA 1XSPA 4C8OA 2ALZA 4IR1A 2HSZA 4P4OA 3HJEA 3MR6A 3HILA 1TFRA 2WF8A 1NK9A 4FZMA 2NO4A 1D8YA 4OJ6A 2ZIXB 2WAQC 4DQPA 1RXWA 4P4PA 5ALHA 4CGZA 2OXOA 5BOMA 1DK2A 5KTQA 4PL2A 3Q8RB 2BCVA 5J0WA 1BPEA 5CR0A 2BHNA 2D6FC 2JMGA 3N7SC 3KD3A 4EZ9A 4DL6A 3M8RA 2EAPA 3MGVA 3QE9Y 3F5EA 1ZQSA 3AU2A 2ZIWB 3Q8LA 3H8SA 7ICOA 3PW7A 5J0QA 3TFSA 2IBKA 3E58A 3QX7A 2W3RA 1IIPA 4LZDA 7ICGA 1SWVA 1JUDA 5KFLA 2ZJ5A 2LI6A 2KP7A 4ED3A 3HP6A 3BJYA 9ICMA 9ICCA 2HI0A 3RRGA 2HVIA 2B6GA 2G5HB 1VJ5A 1L7PA 2EANA 1OW5A 4ZH4A 4P0PA 2DGZA 3SZ2A 1L3UA 7ICFA 4ACOA 5ALIA 1RXVA 2AGPA 2BCSA 3GDXA 1D8LA 4YMOA 4ECQA 1WYGA 5AIBA 3GU3A 5KFZA 1XNSA 3RB0A 4RPXA 4RZRA 5DG7A 2W3SA 5DLFA 4BXOA 7ICMA 1BPDA 5KFAA 2VIXA 2FDRA 2UVVA 3K1RB 2E5SA 5GTIU 1VLBA 3IDWA 4GXIA 4DS4A 1LKYB 1JN3A 2KHVA 3MR5A 1Z00B 4G9BA 3NTUA 5ALFA 4PH5A 2AJQA 4TURA 3UXPA 1U47A 9ICEA 3U26A 8ICNA 2FMQA 5AI6A 1AQ6A 4IRDA 1N63A 1NI3A 3F2BA 4J9NA 2C2RA 4QWDA 1T3NA 1ZQEA 1B43A 4Y2TA 2F1JA 4HYKA 2EDUA 5KFIA 3H4DA 3D2SA 1SV0A 3ISBA 5J0OA 3KTQA 1RZTA 3M1YA 3KHLA 2PKEA 7ICJA 1FIQA 1WWUA 5L9XA 2F8KA 3T5KA 9ICTA 5EE9A 1QQ7A 4QZ9A 5EWEA 3L4PA 3GIJA 4FBUA 4F3OA 3RRHA 3MGHA 5AI4A 1TVAA 4F72A 5KT3A 4B9NA 8ICVA 5IIIA 4RNMA 3RJJA 8ICHA 4Q43A 1RYSA 5KG7A 1XSLA 1TV9A 2GO7A 2KHQA 1ZQUA 3DDHA 5KFQA 2QARA 2UVWA 1KQQA 3V7LA 5KAIU 2H3IA 2P66A 3RF9A 2JH1A 3MDCA 4F4XA 1ZQBA 1Y88A 4MF8A 3RAXA 1RG6A 4RNNA 2ZJ8A 4PHEA 4F4ZA 2G07A 2K60A 4RQNA 2W7OA 1LV5A 5J8YC 2XY5A 1UCVA 3ZDEA 4AYBF 5F9LA 2IMWP 4HAIA 3FC4A 2ZIXA 4RPYA 3QU9A 5KNIA 3FYHA 5D46A 7ICRA 4F8RA 3KFUF 5KFPA 2N1RA 2DWQA 9ICNA 1ZQPA 1JXLA 3FM9A 4UASA 4QIWF 7ICPA 3RTVA 1DGJA 1XO1A 4F5OA 4NWIA 4A8EA 4X5VA 4DL3A 2EQYA 3SV3A 3M6ZA 3RJHA 4EELA 4MFAA 2KJ5A 2ZIWA 1SIJA 5K4LA 5DBAA 2R8JA 4M9GA 1ZD3A 4DSFA 4R63A 4WJ3B 4PPXA 2KE7A 4DF4A 1SB3C 4FO6A 4I2EA 3PW2A 5KG0A 4DCCA 1C7YA 5DB9A 3A0BU 2W9BB 5J0RA 3WK4A 4C8LA 4O3MA 1XO0A 3KKAC 2Q4TA 2C2DA 3IN5A 4RUCA 5AM4A 2ZJAA 4UARA 4NY8A 1ZQDA 3NUQA 4AYBC 1OUQA 2KIVA 2FMSA 4M47A 3HWTA 4C8MA 1ZJNA 1ZXIA 2KFZA 1S8OA 1QTMA 2XC9A 3R9KA 3SI8A 2WHEA 4GXJA 1S77D 4IQUA 2K4IA 4RUAA 4NJ8A 4JMUA 1LKYA 1Z00A 2QB1A 5J2CA 4US8A 5KFMA 1MC8A 1FFVA 1MQ3A 2XGPA 8ICAA 2KZ3A 2XI9A 2E3TA 2WF6A 3PO5A 8ICLA 4YR3A 1ZQQA 4KLIA 3NGDA 4DFKA 3BS5B 2CN1A 3QZ8A 2FPLA 3ZI4A 4EZ6A 2ZIVB 2G06A 5F9NA 4FBTA 5AKXA 2WF7A 4ELTA 2QKQA 4CE6A 4ELVA 1UPHA 2H3FA 2W03A 2PMZF 3C2KA 5AM1A 3IV6A 5L1MA 3IG5A 2ASLA 2H5XA 3F5AA 8ICBA 1TAUA 1OXJA 3E2EA 3OSNA 2AQ4A 3K75D 1UQVA 5KFXA 2NV3A 3ZDBA 1EXNA 4FZNA 4PHDA 4P2HA 3VC8A 1TK8A 4ECUA 1NJWA 3GIKA 4UATA 5IIMA 4P4MA 2HOQA 3PX0A 5CWRA 4CF4A 3SAGA 3RBDA 3WK8A 5DG9A 1ZQJA 4C80A 3WKAA 4JV0A 5AKZA 4DSJA 3UXNA 2A1AA 3WU2U 8ICXA 5KFVA 2DQNB 3RAQA 3ZDDA 4MEXA 4K4HA 5AKEA 3ONNA 2RDIA 2QB0B 2DBYA 2E8PA 4MFCA 4P0PB 2MRLA 3VCBA 9ICBA 5KFTA 8ICUA 3Q8MA 4UB2A 3TANA 4LVSA 3TKAA 2M9NA 1UT8A 1RDFA 2BPFA 2OEHA 2J6SA 1F0MA 4YMNA 3D2QA 7ICNA 5ALZA 1X9MA 3BZKA 3F2CA 4KN4A 5AKYA 1NKBA 2ZXIA 2GWSA 4BXOB 9ICSA 2W11A 1MA7A 1ZQ1C 5J29A 4YD1A 2BKEA 4DLEA 4DOCA 4M9NA 2LYAA 3WKCA 3TADA 3SAHA 2E1FA 3EPIA 4Z6DA 1ZQYA 1SKSA 1ZQKA 4R66A 1X9XA 3PMNA 1L7NA 1N5WA 4NXZA 1JRPA 4B9UA 2W9BA 3RB6A 2YN4A 5ALQA 4UB3A 2FPKA 5ALEA 1L3TA 4NLGA 4TUPA 5J2GA 4KMUA 2JEFA 2HHUA 4KLMA 3N97B 5J2HA 3CNHA 1L8LA 3H0RB 2RLTA 4YXJA 2AGOA 3A0HU 4B6JA 3M9NB 2C2EA 3KHRA 4M0AA 2K4PA 5AI9A 4QZCA 2GOLA 4F2RA 1XWLA 2DPIA 2JEGA 2G09A 2BCRA 3UMCA 2D8CA 2Y1JA 2R8GA 2ZUBA 3E0FA 3B0XA 2LHTA 5H2FU 3OGUA 3C28A 2WF5A 1X9SA 3ED5A 1T4GA 1ZD4A 4KLQA 3T5LA 2HHXA 2FI1A 1SZPA 5KFDA 4QWEA 3Q8SB 3RBEA 1ZQNA 7ICVA 2ISPA 2WF9A 2BQ3A 1WUDA 3BS5A 3I76A 4I2CA 5L1IA 1ZOLA 2XVTA 3KBBA 1V38A 2HOFA 1X42A 1DGSA 1SWWA 3EW9A 3OJUA 2ZIVA 2HBJA 5DB7A 2HBLA 2MA1A 2F44A 1URJA 1SL2A 5J0UA 1NJXA 2VA2A 3PX6A 3WK6A 5KFNA 4Y2VA 1T94A 3QU4A 2P35A 2NRVA 2BCUA 3GZFA 4YN4A 2XO7A 1ZYQA 3QZ7A 3SQIA 9ICLA 4BJQA 4QZBA 4RQ7A 3BQTA 4F93B 2KSOB 1KN5A 2AU0A 2RQ5A 4RT2A 4ECTA 9ICRA 2I1QA 2XCPA 3C1ZA 1CEZA 2GH1A 2HHTA 3SR6A 3KZIU 3C5FA 2KG5A 1IV8A 3HRDD 5AICA 5ALDA 1ZD2P 4UB8U 2ASJA 1S0OA 5CP2A 2ODGA 2NRTA 1XSNA 5KL8B 2DKXA 1Z1BA 3DV9A 1D8BA 3T5JA 1KFDA 4TUSA 2XIDA 4QZHA 4UAVA 3PV8A 3AUOA 5CB1A 3HX0A 3V6JA 5DGAA 5KFBA 5KFSA 1N62A 4ECWA 5CEHA 4QZDA 8ICWA 2G08A 2W9CB 3GQCA 4IRKA 1KKXA 3I1YA 1NK4A 3N7PD 4KLJA 2DUYA 2Y0SC 3QU2A 4ED1A 1PVPA 4GXKA 2QB0A 4F91B 4EEYA 2KMDA 1M6YA 5AKLA 1S76D 1PK1A 4RNOA 4UAYA 5J2JA 2JR5A 2JRZA 4IS7A 2WB1F 3ICXA 2YQEA 4CF3A 4XUSA 4ED2A 4F92B 5KFWA 3H8MA 2FMPA 1ZQRA 4JV1A 2AQ0A 2JXJA 4Q44A 2B0CA 3EZ5A 4KLEA 3GIMA 9ICXA 5ALMA 2LYBA 4Y2PA 1PK3A 4J9PA 4Q8FA 1X6IA 5AKIA 5KFYA 4O5EA 3BS7A 4C4RA 5AM5A 3MR3A 4EENA 2Y9UA 7ICUA 2JHDA 9ICQA 1Z1VA 1GO3F 5AI0A 3OHAA 8ICPA 1N2XA 4DL7A 3ZDAA 4I2BA 4UB4A 3Q8PB 3TARA 1TAQA 3NRWA 2BPGA 4CDGA 1QLNA 2V9WA 7ICQA 2VANA 2NO5A 5GTHU 4OJPA 5ALNA 2VKQA 4UW9A 1XU4A 1C20A 3T79A 4YG2A 4BWJA 5EE3A 1T8EA 5FP0A 4KLSA 3RJIA 4J9RA 4R64A 9ICKA 4JV2A 4UAWA 3T3FA 2F1IA 4J9KA 4UB5A 1ZJMA 3RH4A 2WTFA 5KG4A 2ISOA 3N4MB 3MFHA 2DFLA 2RRDA 2WB1C 2KTQA 5J2BA 1QCKA 5EWGA 4ELUA 1KLNA 2M0NA 2XY7A 4R65A 4QZIA 5AIAA 4NLCA 2HBMA 4B9TA 3AQFA 1U4BA 4UQGA 3PW0A 1NNLA 1AROP 4Y2JA 3QUCA 2RP5A 3RFAA 2VJ5A 3C29A 5KL1B 3JPRA 3RB3A 2PI5A 1D9DA 3G6XA 4F5RA 5JTIA 5J0YA 2CRXA 4R8UB 7ICTA 2ES6A 4OJOA 4DF8A 1KDHA 4LZGA 3LVVA 1SKRA 1Z4NA 1NKEA 1QQ6A 2MSNA 8ICQA 1L7MA 3NVWA 2R8IA 4ED0A 5HHIA 2BR0A 2QLTA 2JGAA 1WCNA 5L1JA 5F3XB 2F77X 1LB2B 1L3VA 1QSSA 2Y1IA 5ALSA 5KG1A 4DEZA 2KSOA 4O3OA 2HHSA 1NOMA 4OO1J 5AM0A 3Q8QB 3PO4A 2Q0ZX 1S5LU 2E1EA 1ZQOA 1RQNA 4UBCA 4FFDA 3V72A 4TQRA 3PSPA 5AHXA 1N61A 3WKBA 4DFMA 4FS1A 2AGQA 4I27A 3PR5B 4J9OA 5J2KA 1QSYA 4NLZA 4C7ZA 3D6JA 2Y9TA 1ZQZA 2W43A 2W9CA 4RQ0A 4UAUA 4EBEA 5DQGA 3KHGA 2EZYA 1DK3A 2ZTDA 1PZNA 5TZVA 4JWMA 2ASDA 1U49A 3HW8A 5KFRA 3OTQA 2WFAA 3C1YA 4ECVA 1Z19A 2OWOA 3WK9A 2F3NA 1UA0A 3AQEA 4ICAA 4Z6FA 2KV2A 3BQ7A 5JRTA 4USAA 1JX4A 4O3RA 5AK3A 5DQHA 8ICFA 1S9FA 2BZFA 3IHQB 3THVA 3TQ1A 8ICOA 3B0YA 4QIWC 3GIIA 2C22A 2H3ZA 3M9MB 1NK6A 4ECRA 1CUKA 5J2AA 5KFCA 2KKPA 4ECZA 4K4GA 1BNPA 2KN7A 2PFOA 1V9PA 5ALLA 2ATLA 2KJ9A 3EUB2 4B9MA 1V85A 2JV3A 3NVZA 2LBOA 4KX3A 1U48A 4MHVA 1K1QA 3HKZF 5IINA 5J8YA 2BQUA 4JUZA 3AEVA 5B66U 2R8HA 2ZG6A 3WKEA 4QZ8A 5KT7A 5T14A 3MGIA 2YB1A 2V4QA 3CW2C
chains in the Genus database with same CATH topology
3VC8A 4NV0A 1XO0A 4O3MA 4IC9A 4QNLA 2G5HB 2KJ8A 2A3VA 2RHFA 2KOBA 3CYMA 5KL8B 2Q4TA 1Z1BA 3H0RB 2HOQA 1D8BA 2K8BB 3IN5A 1F44A 5HR6A 3MGVA 1ED1A 2BDUA 4NLBA 3AL0B 4P0PA 2F76X 2KVCA 2KD1A 2KIWA 2DGZA 2XIDA 3ALRA 1NZBA 3NUQA 4AYBC 3SAGA 1OUQA 4ACOA 3SMVA 2WB1C 1ECWA 2RRDA 2W7PA 1CRXA 1HEKA 4KX5A 2OH2A 2KHQA 2GOLA 4FE3A 2R18A 4BUGA 2M0NA 3DEEA 2G09A 2G08A 4QJFB 3KZXA 3GU3A 1XNSA 2HOIA 2H3IA 2HBKA 2K4EA 2K8CB 2DQNB 2HBMA 2LKYA 2YX8A 3E0FA 2Y0SC 2LHTA 3N7PD 3RF9A 5HR7A 2JH1A 2XICA 2KKVA 2YB4A 3AQFA 1PVPA 1Q3UA 4CRXA 3C28A 2W04A 1TAMA 4KMOB 1HIWA 2Y0SF 4C0ZA 3ONNA 2VIXA 3T79A 2K4IA 3K1ZA 2G0AA 2E5SA 2G07A 4JMUA 2W7OA 3SAFA 4P0PB 2MRLA 3VCBA 1Z19A 1KBUA 2H3QA 2Z7JA 4P0QA 2KHVA 4AYBF 4NLCA 2RP5A 3RFAA 2VJ5A 2VJ4A 3C29A 3OPXA 3AQEA 2WB1F 3ICXA 4OJ5A 2G5IB 5KL1B 5CRXA 2ZIXA 4P0QB 2XI9A 4ICAA 1A6SA 2ZXHA 2KV2A 3O0FA 4BX9C 4FZMA 4OJ6A 2ZIXB 5C0YA 1YT3A 4OJLA 3D2QA 2WAQC 1WUDA 3HKZC 3H0MB 3L3FX 3M7DA 3F2DA 3KFUF 2XVTA 2ZIUA 3F2CA 2WAQF 4CGZA 2K89A 2N1RA 2OXOA 3F2BA 1P7DA 5A0LA 2CRXA 4QIWC 3N7RC 2LYBA 2ZXIA 2H3ZA 4OJOA 2HOFA 2ZIUB 4PL2A 3D2NA 3IG8A 1MA7A 4QIWF 1ZQ1C 2ZIVA 3LVVA 2HBJA 2CPRA 2HBLA 2CN1A 2KKPA 2MA1A 2D6FC 4NWIA 2JMGA 4A8EA 3N7SC 2ZIVB 1URJA 2G06A 3M6ZA 1Q3VA 3PZPA 2K8AA 2OYYA 3D2SA 2KJ5A 2F8LA 2LYAA 4PL1A 2PMZC 1L6NA 3SAHA 1SZHA 2E1FA 2KJ9A 2ZIWA 1T94A 1UPHA 2H3FA 2JHDA 2OM6A 2HMXA 2W03A 3H0LB 2DF4B 2JGAA 3F5EA 2PMZF 1GO3F 2JH7A 2F77X 2ZIWB 3GZFA 3IG5A 3CP8A 3F5AA 1DRGA 2LBOA 2H3VA 3SQIA 4GFJA 2KICA 4KX3A 4BJQA 4FZLA 4WJ3B 1A0PA 3HKZF 3F53A 2K4HA 3PSFA 1IIPA 3M6KA 3CRXA 2KNJA 3IP4B 4OO1J 3NRWA 3LYSA 3LVWA 4CDGA 3PSIA 1PVQA 4U7CA 2NV3A 2E1EA 2ZG6A 2F2AB 4U6PA 4FZNA 2GH1A 4OJPA 5T14A 2YB1A 2VKQA 1PVRA 2KEYA 3PSTA 3PSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2A B;  3H0R B;  3H0M B;  2D6F C;  3IP4 B;  3KFU F;  3H0L B;  2G5H B;  2DF4 B;  1ZQ1 C;  3AL0 B;  4WJ3 B;  2G5I B;  2DQN B; 
#chains in the Genus database with same CATH topology
 4KLD A;  2KZM A;  3M9O B;  2KJ8 A;  3CYM A;  1UHU A;  1BPY A;  4I29 A;  3UQ0 A;  4TUQ A;  3ORY A;  3LK9 A;  1NZB A;  8ICG A;  1U9L A;  5AKH A;  5BPC A;  8ICT A;  1HEK A;  7ICE A;  5DB6 A;  5CA7 A;  4IRC A;  4DSE A;  4B9L A;  2LYH A;  3RH5 A;  4F4Y A;  8ICK A;  2HBK A;  5HR7 A;  4I28 A;  1Q3U A;  1Q46 A;  1HIW A;  4C0Z A;  4KLG A;  3K1Z A;  3S6J A;  1JXE A;  1NZP A;  3QEB Z;  5KAF U;  3T5H A;  5DB8 A;  2IHN A;  2G5I B;  3PVX A;  4K4I A;  1BGX T;  3KKA A;  3QUT A;  4NL9 C;  4YFK A;  4QZF A;  5L1L A;  3O0F A;  3UXO A;  3ZD9 A;  5C0Y A;  2J6U A;  4YCX A;  3HKZ C;  4R8U A;  3ETR A;  5KT4 A;  3TAP A;  2VA3 A;  1J2N A;  1S0V A;  1JMS A;  4RQ1 A;  4KLT A;  4KIT B;  3N28 A;  5KFH A;  3OSP A;  3UMB A;  4RPZ A;  5ALO A;  1KFS A;  4YR2 A;  2MUT A;  1PK1 B;  1L6N A;  1A77 A;  5KG2 A;  2PMZ C;  5DDM A;  8ICR A;  4KTQ A;  1KL9 A;  3EWA A;  3RB4 A;  2H3V A;  3SV4 A;  1SXE A;  4FZL A;  5ALV A;  4DSK A;  2KNJ A;  2VA8 A;  4DQS A;  2FLL A;  5KFJ A;  4KLF A;  3IM1 A;  4QWA A;  4GC6 A;  1HUO A;  9ICI A;  3QYP A;  4Q45 A;  4MFF A;  5AI8 A;  4IC9 A;  1T3Q A;  1L5U A;  3RJF A;  3AN1 A;  1NKC A;  2RDJ A;  4DOB A;  4KLL A;  5AM2 A;  2KVS A;  3ALR A;  5KFE A;  3MFI A;  4UAZ A;  2PFQ A;  4O3S A;  5CJ7 A;  3EPG A;  4KLU A;  4Y2S A;  4DLG A;  2I9G A;  1L8O A;  3M8S A;  4UBB A;  2MAX A;  5ALP A;  5AKJ A;  4O0I A;  8ICS A;  1O03 A;  2KKV A;  3WK7 A;  5DKW A;  4PJ0 U;  4JK1 A;  3NAS A;  2W04 A;  1TAM A;  4C4S A;  4KMO B;  9ICA A;  3SEN A;  1KW4 A;  1FEZ A;  4YP3 A;  2OCE A;  4I2A A;  5KG3 A;  4QZE A;  2YML A;  3QEA Z;  1SL0 A;  4F4W A;  4LJX A;  1A6S A;  3GIL A;  5HHH A;  3JPQ A;  2W8L A;  2EZX A;  5ALU A;  4OJL A;  5JU5 A;  3TAQ A;  2NRX A;  5KT6 A;  2W54 A;  2WAQ F;  5A0L A;  3ISC A;  4IQT A;  2YTU A;  2ZIU B;  3AU6 A;  4I2F A;  5AM3 A;  2JZB B;  4QZG A;  3LWL A;  3V7J A;  4DL2 A;  4DL4 A;  4I2I A;  2F8L A;  5IIL A;  4O9M A;  4BWM A;  5EWF A;  2HHV A;  3LWM A;  4EYI B;  1X6J A;  4GLX A;  1IM4 A;  3IP4 B;  1ZQW A;  5ALR A;  3PSI A;  4U7C A;  2NRZ A;  4U6P A;  4EBD A;  1X40 A;  4I2H A;  1PVR A;  5AKG A;  1N56 A;  4YD2 A;  3TFR A;  2NRW A;  2E8M A;  5JUM A;  5J0T A;  4Y2X A;  3QNM A;  5D4B A;  1TKD A;  5KFO A;  1SKW A;  2W55 A;  5HMM A;  1XS9 D;  1QSL A;  3RH6 A;  1ED1 A;  2KIW A;  3TAC B;  4DFJ A;  2FPM A;  3UQ2 A;  5KFF A;  4F5N A;  4F5P A;  4O3P A;  1ECW A;  3RJE A;  3C21 A;  5BOL A;  3GV8 B;  3KZX A;  5KFG A;  2YY6 A;  1SV0 C;  2K8C B;  2LKY A;  1J97 A;  4Y2R A;  5ALX A;  2YB4 A;  3H8J A;  4ZOH C;  2IOF A;  1K1S A;  3UM9 A;  4QZA A;  5CHG A;  2HDO A;  5J2F A;  4J9M A;  1HJP A;  3NRZ A;  1KEJ A;  1ZRN A;  5TIS U;  4RQ6 A;  3K4G A;  2JEJ A;  3H0M B;  4KLH A;  2V4R A;  2E8N A;  2J6T A;  1N60 A;  3N7R C;  3PML A;  1B0X A;  1HUZ A;  2PFP A;  4Y2Y A;  1ZQF A;  4B9V A;  4NM2 A;  1WG8 A;  5IIJ A;  2KZZ A;  3PR4 A;  2K8A A;  3PZP A;  1D9F A;  1COK A;  1DXS A;  3LYS A;  4OD0 A;  8ICE A;  3H0L B;  7ICH A;  3QU5 A;  1BVS A;  4DSL A;  1NK8 A;  4GFJ A;  3C5G A;  2W9M A;  4EYH B;  1QQ5 A;  3M6K A;  7ICS A;  2ESE A;  9ICF A;  5G5G A;  2IOH A;  4ED6 A;  4DQI A;  4M04 A;  3KOO A;  3LDA A;  5HNK A;  1KFT A;  3H40 A;  3UMG A;  4QNL A;  3ZDC A;  4OCZ A;  3HT3 A;  2MU2 A;  5E79 U;  2A3V A;  2KOB A;  3SYZ A;  5J2I A;  5HML A;  2KFN A;  2FJ6 A;  2BDU A;  8ICM A;  9ICO A;  1B4F A;  1F5S A;  4Z6E A;  3KHH A;  4B9S A;  2ZUC A;  3RJG A;  1RPL A;  1ZQM A;  2R18 A;  4BUG A;  4O5K A;  4MEY A;  3GV5 B;  2DKZ A;  4QJF B;  4DO9 A;  1RM6 C;  1IG6 A;  1Z3E B;  4M6W B;  2YX8 A;  2K4E A;  4F50 A;  1X9W A;  2DPJ A;  4NLN A;  4IQW A;  1MN8 A;  2G0A A;  4M9H A;  2FLN A;  1ZQC A;  1H38 A;  2UVU A;  4EBC A;  4DQQ A;  3QUB A;  1YT3 A;  5J0S A;  1ZET A;  3MBY A;  2B21 A;  2ZIU A;  2DL0 A;  8ICC A;  2JZB A;  1BPX A;  3JPP A;  1ZQX A;  5DBC A;  3FAH A;  5KFU A;  3G6V A;  4PL1 A;  1RQL A;  4DSI A;  4AP9 A;  1L3S A;  4J9S A;  2I5H A;  1DRG A;  2IA6 A;  4DOA A;  2LM1 A;  5IIK A;  4RQ2 A;  3F53 A;  2K4H A;  2BQR A;  4TQS A;  3BQ2 A;  5EOZ A;  1SL1 A;  4QW8 A;  4RQ5 A;  2LPE A;  4CF5 A;  2F1H A;  5AK5 A;  2PI4 A;  2LM4 A;  2IOF K;  4DL5 A;  9ICG A;  3RJK A;  3H4B A;  1FFU A;  2HHQ A;  2MUT B;  1S97 A;  5AK4 A;  5EE1 A;  2K8B B;  2W9A A;  2YMM A;  1J2M A;  4NLB A;  3AL0 B;  2F76 X;  4O3Q A;  4JWN A;  1TK5 A;  4FS2 A;  4MF2 A;  1ZQA A;  1CRX A;  3G6Y A;  4DFD A;  1L7O A;  5DBB A;  3H7I A;  4XRH A;  4BDP A;  3V6H A;  1MQ2 A;  2HW3 A;  3MC1 A;  3B9J A;  8ICZ A;  3BDP A;  5C5J A;  1O08 A;  5ALT A;  4PZN A;  4J9Q A;  5KT5 A;  2PFN A;  2UVR A;  2HCF A;  3NVY A;  1XC9 A;  3TI0 A;  2H3Q A;  4ED7 A;  4EX6 A;  2R8K A;  3OPX A;  4M9J A;  5CRX A;  4F5Q A;  4P0Q B;  3BQ1 A;  2BDP A;  4BX9 C;  2W8K A;  1ZRM A;  1ZQH A;  1ZD5 A;  3SD7 A;  4CCH A;  5ALW A;  5G5H A;  2FLP A;  1FO4 A;  4UB6 U;  5DLG A;  8ICJ A;  2XY6 A;  1Q8K A;  3Q8K A;  3IG8 A;  1ZQV A;  3SEI A;  1WWV A;  2CPR A;  5ALJ A;  7ICI A;  4YMM A;  3H8W A;  4NLK A;  1N48 A;  2PXI A;  2OYY A;  9ICJ A;  2OM6 A;  2HMX A;  2EH9 A;  5B5E U;  4KN7 A;  5AI5 A;  5D49 A;  1V97 A;  4YQW A;  3CRX A;  3FDS A;  1PVQ A;  1SXD A;  2BCQ A;  1NJZ A;  4QWC A;  4ECS A;  2KEY A;  1JAL A;  5AK6 A;  5J0P A;  1KSP A;  1RYU A;  4XA5 A;  4IR9 A;  1S0M A;  7ICL A;  8ICI A;  1JRO A;  1IXR A;  2D3D A;  2ZTC A;  1F44 A;  2CXY A;  5HR6 A;  5J2E A;  4J03 A;  4DWI A;  2W7P A;  4I2D A;  2IHM A;  1NK7 A;  2XGQ A;  3C23 A;  5AKK A;  3MR2 A;  4M6W A;  3JPT A;  2A1J B;  3TAD C;  5DG8 A;  2HOI A;  1JI7 A;  3NVV A;  9ICU A;  3RR8 A;  1JIH A;  4YXM A;  5KFK A;  4PGQ A;  4Z6C A;  1S10 A;  4ECX A;  9ICH A;  1T7P A;  4ECY A;  3JPS A;  4G3I A;  2JEI A;  2L5Y A;  1ZQL A;  2VJ4 A;  4OJ5 A;  5KT2 A;  2AXT U;  1DOQ A;  4CNQ A;  1BPZ A;  2ZXH A;  4QWB A;  5DQI A;  2EAO A;  5J2D A;  3M7D A;  3F2D A;  4RQ3 A;  1VDV A;  1COO A;  4DFP A;  1P7D A;  3PW4 A;  1ZQT A;  1A76 A;  5J0X A;  4YR0 A;  4PGX A;  4M2Y A;  4F2S A;  4KLO A;  3PY8 A;  1N5X A;  2LMR A;  3C2L A;  4F71 A;  4QW9 A;  1X66 A;  1Q3V A;  1LVH A;  3NS1 A;  1TK0 A;  7ICK A;  4Y2Q A;  1SZH A;  3QXG A;  4BGD A;  3CP8 A;  1K5O A;  1ZQI A;  3GFK B;  1WCL A;  4Y2U A;  1NJY A;  2KIC A;  1BNO A;  4I2G A;  4UB1 A;  3AM9 A;  3BZC A;  2I6X A;  2ZUD A;  3I28 A;  5ALG A;  1B22 A;  5L1K A;  2XCA A;  5ALY A;  2O6K A;  2F2A B;  3WK5 A;  3OHB A;  1KTQ A;  3PST A;  3IRU A;  4J9L A;  2BGW A;  4F4K A;  2ZTE A;  2OHF A;  4GIB A;  4RU9 A;  4PHA A;  3PW5 A;  5DGB A;  1MSW D;  2KD1 A;  4JB3 A;  4RQ8 A;  4RQ4 A;  4PZO A;  3SMV A;  9ICP A;  3QU7 A;  3JPN A;  3ETL A;  3DEE A;  9ICW A;  4C8N A;  3BQ0 A;  5ALK A;  4IQV A;  1YZ6 A;  4CRX A;  4XQ8 A;  1U45 A;  2YMP A;  2AHO B;  1X2I A;  4PHP A;  1NK5 A;  3V7K A;  4O3N A;  4DS5 A;  2EZZ A;  1KBU A;  2Z7J A;  1SGG A;  4P0Q A;  4ED8 A;  4E0D A;  5IIO A;  4GC7 A;  3V6K A;  9ICV A;  3MDA A;  3MAB A;  4C7Y A;  2EAM A;  5KG6 A;  3L3F X;  5DDY A;  2HHW A;  2AH5 A;  2K89 A;  3QUQ A;  4NM1 A;  2HVH A;  3D2N A;  1QH9 A;  4DQR A;  1KRP A;  3ISD A;  3L5K A;  4Q8E A;  2YMQ A;  5EE0 A;  3C2M A;  2A19 A;  2DF4 B;  1Z4O A;  1NK0 A;  1BPB A;  2JH7 A;  1SV4 A;  5KG5 A;  4C8K A;  3OJS A;  1TE2 A;  1A0P A;  3PSF A;  5HP4 A;  3LVW A;  8ICY A;  4IL6 U;  4PGY A;  4YVZ A;  3AMZ A;  2E8O A;  4NL9 A;  2C28 A;  4NV0 A;  3J81 j;  1UT5 A;  2RHF A;  1UA1 A;  2NYV A;  1RYR A;  2FE9 A;  2KVC A;  4US9 A;  3GV7 B;  1PUZ A;  3UPQ A;  1S0N A;  3JPO A;  3HPO A;  4M9L A;  1YZ7 A;  4KX5 A;  2GLE A;  4EX7 A;  3ZD8 A;  2OH2 A;  4I2J A;  2A1J A;  3PX4 A;  4FE3 A;  3PNC A;  2P6R A;  2BPC A;  4O5C A;  4RQM A;  2QAR B;  2KK0 A;  1CI4 A;  2XIC A;  4RT3 A;  2Y0S F;  4EEK A;  3RR7 A;  1ZQG A;  2P6U A;  4C4T A;  3EYZ A;  3SAF A;  3WKD A;  1XSP A;  4C8O A;  2ALZ A;  4IR1 A;  2HSZ A;  4P4O A;  3HJE A;  3MR6 A;  3HIL A;  1TFR A;  2WF8 A;  1NK9 A;  4FZM A;  2NO4 A;  1D8Y A;  4OJ6 A;  2ZIX B;  2WAQ C;  4DQP A;  1RXW A;  4P4P A;  5ALH A;  4CGZ A;  2OXO A;  5BOM A;  1DK2 A;  5KTQ A;  4PL2 A;  3Q8R B;  2BCV A;  5J0W A;  1BPE A;  5CR0 A;  2BHN A;  2D6F C;  2JMG A;  3N7S C;  3KD3 A;  4EZ9 A;  4DL6 A;  3M8R A;  2EAP A;  3MGV A;  3QE9 Y;  3F5E A;  1ZQS A;  3AU2 A;  2ZIW B;  3Q8L A;  3H8S A;  7ICO A;  3PW7 A;  5J0Q A;  3TFS A;  2IBK A;  3E58 A;  3QX7 A;  2W3R A;  1IIP A;  4LZD A;  7ICG A;  1SWV A;  1JUD A;  5KFL A;  2ZJ5 A;  2LI6 A;  2KP7 A;  4ED3 A;  3HP6 A;  3BJY A;  9ICM A;  9ICC A;  2HI0 A;  3RRG A;  2HVI A;  2B6G A;  2G5H B;  1VJ5 A;  1L7P A;  2EAN A;  1OW5 A;  4ZH4 A;  4P0P A;  2DGZ A;  3SZ2 A;  1L3U A;  7ICF A;  4ACO A;  5ALI A;  1RXV A;  2AGP A;  2BCS A;  3GDX A;  1D8L A;  4YMO A;  4ECQ A;  1WYG A;  5AIB A;  3GU3 A;  5KFZ A;  1XNS A;  3RB0 A;  4RPX A;  4RZR A;  5DG7 A;  2W3S A;  5DLF A;  4BXO A;  7ICM A;  1BPD A;  5KFA A;  2VIX A;  2FDR A;  2UVV A;  3K1R B;  2E5S A;  5GTI U;  1VLB A;  3IDW A;  4GXI A;  4DS4 A;  1LKY B;  1JN3 A;  2KHV A;  3MR5 A;  1Z00 B;  4G9B A;  3NTU A;  5ALF A;  4PH5 A;  2AJQ A;  4TUR A;  3UXP A;  1U47 A;  9ICE A;  3U26 A;  8ICN A;  2FMQ A;  5AI6 A;  1AQ6 A;  4IRD A;  1N63 A;  1NI3 A;  3F2B A;  4J9N A;  2C2R A;  4QWD A;  1T3N A;  1ZQE A;  1B43 A;  4Y2T A;  2F1J A;  4HYK A;  2EDU A;  5KFI A;  3H4D A;  3D2S A;  1SV0 A;  3ISB A;  5J0O A;  3KTQ A;  1RZT A;  3M1Y A;  3KHL A;  2PKE A;  7ICJ A;  1FIQ A;  1WWU A;  5L9X A;  2F8K A;  3T5K A;  9ICT A;  5EE9 A;  1QQ7 A;  4QZ9 A;  5EWE A;  3L4P A;  3GIJ A;  4FBU A;  4F3O A;  3RRH A;  3MGH A;  5AI4 A;  1TVA A;  4F72 A;  5KT3 A;  4B9N A;  8ICV A;  5III A;  4RNM A;  3RJJ A;  8ICH A;  4Q43 A;  1RYS A;  5KG7 A;  1XSL A;  1TV9 A;  2GO7 A;  2KHQ A;  1ZQU A;  3DDH A;  5KFQ A;  2QAR A;  2UVW A;  1KQQ A;  3V7L A;  5KAI U;  2H3I A;  2P66 A;  3RF9 A;  2JH1 A;  3MDC A;  4F4X A;  1ZQB A;  1Y88 A;  4MF8 A;  3RAX A;  1RG6 A;  4RNN A;  2ZJ8 A;  4PHE A;  4F4Z A;  2G07 A;  2K60 A;  4RQN A;  2W7O A;  1LV5 A;  5J8Y C;  2XY5 A;  1UCV A;  3ZDE A;  4AYB F;  5F9L A;  2IMW P;  4HAI A;  3FC4 A;  2ZIX A;  4RPY A;  3QU9 A;  5KNI A;  3FYH A;  5D46 A;  7ICR A;  4F8R A;  3KFU F;  5KFP A;  2N1R A;  2DWQ A;  9ICN A;  1ZQP A;  1JXL A;  3FM9 A;  4UAS A;  4QIW F;  7ICP A;  3RTV A;  1DGJ A;  1XO1 A;  4F5O A;  4NWI A;  4A8E A;  4X5V A;  4DL3 A;  2EQY A;  3SV3 A;  3M6Z A;  3RJH A;  4EEL A;  4MFA A;  2KJ5 A;  2ZIW A;  1SIJ A;  5K4L A;  5DBA A;  2R8J A;  4M9G A;  1ZD3 A;  4DSF A;  4R63 A;  4WJ3 B;  4PPX A;  2KE7 A;  4DF4 A;  1SB3 C;  4FO6 A;  4I2E A;  3PW2 A;  5KG0 A;  4DCC A;  1C7Y A;  5DB9 A;  3A0B U;  2W9B B;  5J0R A;  3WK4 A;  4C8L A;  4O3M A;  1XO0 A;  3KKA C;  2Q4T A;  2C2D A;  3IN5 A;  4RUC A;  5AM4 A;  2ZJA A;  4UAR A;  4NY8 A;  1ZQD A;  3NUQ A;  4AYB C;  1OUQ A;  2KIV A;  2FMS A;  4M47 A;  3HWT A;  4C8M A;  1ZJN A;  1ZXI A;  2KFZ A;  1S8O A;  1QTM A;  2XC9 A;  3R9K A;  3SI8 A;  2WHE A;  4GXJ A;  1S77 D;  4IQU A;  2K4I A;  4RUA A;  4NJ8 A;  4JMU A;  1LKY A;  1Z00 A;  2QB1 A;  5J2C A;  4US8 A;  5KFM A;  1MC8 A;  1FFV A;  1MQ3 A;  2XGP A;  8ICA A;  2KZ3 A;  2XI9 A;  2E3T A;  2WF6 A;  3PO5 A;  8ICL A;  4YR3 A;  1ZQQ A;  4KLI A;  3NGD A;  4DFK A;  3BS5 B;  2CN1 A;  3QZ8 A;  2FPL A;  3ZI4 A;  4EZ6 A;  2ZIV B;  2G06 A;  5F9N A;  4FBT A;  5AKX A;  2WF7 A;  4ELT A;  2QKQ A;  4CE6 A;  4ELV A;  1UPH A;  2H3F A;  2W03 A;  2PMZ F;  3C2K A;  5AM1 A;  3IV6 A;  5L1M A;  3IG5 A;  2ASL A;  2H5X A;  3F5A A;  8ICB A;  1TAU A;  1OXJ A;  3E2E A;  3OSN A;  2AQ4 A;  3K75 D;  1UQV A;  5KFX A;  2NV3 A;  3ZDB A;  1EXN A;  4FZN A;  4PHD A;  4P2H A;  3VC8 A;  1TK8 A;  4ECU A;  1NJW A;  3GIK A;  4UAT A;  5IIM A;  4P4M A;  2HOQ A;  3PX0 A;  5CWR A;  4CF4 A;  3SAG A;  3RBD A;  3WK8 A;  5DG9 A;  1ZQJ A;  4C80 A;  3WKA A;  4JV0 A;  5AKZ A;  4DSJ A;  3UXN A;  2A1A A;  3WU2 U;  8ICX A;  5KFV A;  2DQN B;  3RAQ A;  3ZDD A;  4MEX A;  4K4H A;  5AKE A;  3ONN A;  2RDI A;  2QB0 B;  2DBY A;  2E8P A;  4MFC A;  4P0P B;  2MRL A;  3VCB A;  9ICB A;  5KFT A;  8ICU A;  3Q8M A;  4UB2 A;  3TAN A;  4LVS A;  3TKA A;  2M9N A;  1UT8 A;  1RDF A;  2BPF A;  2OEH A;  2J6S A;  1F0M A;  4YMN A;  3D2Q A;  7ICN A;  5ALZ A;  1X9M A;  3BZK A;  3F2C A;  4KN4 A;  5AKY A;  1NKB A;  2ZXI A;  2GWS A;  4BXO B;  9ICS A;  2W11 A;  1MA7 A;  1ZQ1 C;  5J29 A;  4YD1 A;  2BKE A;  4DLE A;  4DOC A;  4M9N A;  2LYA A;  3WKC A;  3TAD A;  3SAH A;  2E1F A;  3EPI A;  4Z6D A;  1ZQY A;  1SKS A;  1ZQK A;  4R66 A;  1X9X A;  3PMN A;  1L7N A;  1N5W A;  4NXZ A;  1JRP A;  4B9U A;  2W9B A;  3RB6 A;  2YN4 A;  5ALQ A;  4UB3 A;  2FPK A;  5ALE A;  1L3T A;  4NLG A;  4TUP A;  5J2G A;  4KMU A;  2JEF A;  2HHU A;  4KLM A;  3N97 B;  5J2H A;  3CNH A;  1L8L A;  3H0R B;  2RLT A;  4YXJ A;  2AGO A;  3A0H U;  4B6J A;  3M9N B;  2C2E A;  3KHR A;  4M0A A;  2K4P A;  5AI9 A;  4QZC A;  2GOL A;  4F2R A;  1XWL A;  2DPI A;  2JEG A;  2G09 A;  2BCR A;  3UMC A;  2D8C A;  2Y1J A;  2R8G A;  2ZUB A;  3E0F A;  3B0X A;  2LHT A;  5H2F U;  3OGU A;  3C28 A;  2WF5 A;  1X9S A;  3ED5 A;  1T4G A;  1ZD4 A;  4KLQ A;  3T5L A;  2HHX A;  2FI1 A;  1SZP A;  5KFD A;  4QWE A;  3Q8S B;  3RBE A;  1ZQN A;  7ICV A;  2ISP A;  2WF9 A;  2BQ3 A;  1WUD A;  3BS5 A;  3I76 A;  4I2C A;  5L1I A;  1ZOL A;  2XVT A;  3KBB A;  1V38 A;  2HOF A;  1X42 A;  1DGS A;  1SWW A;  3EW9 A;  3OJU A;  2ZIV A;  2HBJ A;  5DB7 A;  2HBL A;  2MA1 A;  2F44 A;  1URJ A;  1SL2 A;  5J0U A;  1NJX A;  2VA2 A;  3PX6 A;  3WK6 A;  5KFN A;  4Y2V A;  1T94 A;  3QU4 A;  2P35 A;  2NRV A;  2BCU A;  3GZF A;  4YN4 A;  2XO7 A;  1ZYQ A;  3QZ7 A;  3SQI A;  9ICL A;  4BJQ A;  4QZB A;  4RQ7 A;  3BQT A;  4F93 B;  2KSO B;  1KN5 A;  2AU0 A;  2RQ5 A;  4RT2 A;  4ECT A;  9ICR A;  2I1Q A;  2XCP A;  3C1Z A;  1CEZ A;  2GH1 A;  2HHT A;  3SR6 A;  3KZI U;  3C5F A;  2KG5 A;  1IV8 A;  3HRD D;  5AIC A;  5ALD A;  1ZD2 P;  4UB8 U;  2ASJ A;  1S0O A;  5CP2 A;  2ODG A;  2NRT A;  1XSN A;  5KL8 B;  2DKX A;  1Z1B A;  3DV9 A;  1D8B A;  3T5J A;  1KFD A;  4TUS A;  2XID A;  4QZH A;  4UAV A;  3PV8 A;  3AUO A;  5CB1 A;  3HX0 A;  3V6J A;  5DGA A;  5KFB A;  5KFS A;  1N62 A;  4ECW A;  5CEH A;  4QZD A;  8ICW A;  2G08 A;  2W9C B;  3GQC A;  4IRK A;  1KKX A;  3I1Y A;  1NK4 A;  3N7P D;  4KLJ A;  2DUY A;  2Y0S C;  3QU2 A;  4ED1 A;  1PVP A;  4GXK A;  2QB0 A;  4F91 B;  4EEY A;  2KMD A;  1M6Y A;  5AKL A;  1S76 D;  1PK1 A;  4RNO A;  4UAY A;  5J2J A;  2JR5 A;  2JRZ A;  4IS7 A;  2WB1 F;  3ICX A;  2YQE A;  4CF3 A;  4XUS A;  4ED2 A;  4F92 B;  5KFW A;  3H8M A;  2FMP A;  1ZQR A;  4JV1 A;  2AQ0 A;  2JXJ A;  4Q44 A;  2B0C A;  3EZ5 A;  4KLE A;  3GIM A;  9ICX A;  5ALM A;  2LYB A;  4Y2P A;  1PK3 A;  4J9P A;  4Q8F A;  1X6I A;  5AKI A;  5KFY A;  4O5E A;  3BS7 A;  4C4R A;  5AM5 A;  3MR3 A;  4EEN A;  2Y9U A;  7ICU A;  2JHD A;  9ICQ A;  1Z1V A;  1GO3 F;  5AI0 A;  3OHA A;  8ICP A;  1N2X A;  4DL7 A;  3ZDA A;  4I2B A;  4UB4 A;  3Q8P B;  3TAR A;  1TAQ A;  3NRW A;  2BPG A;  4CDG A;  1QLN A;  2V9W A;  7ICQ A;  2VAN A;  2NO5 A;  5GTH U;  4OJP A;  5ALN A;  2VKQ A;  4UW9 A;  1XU4 A;  1C20 A;  3T79 A;  4YG2 A;  4BWJ A;  5EE3 A;  1T8E A;  5FP0 A;  4KLS A;  3RJI A;  4J9R A;  4R64 A;  9ICK A;  4JV2 A;  4UAW A;  3T3F A;  2F1I A;  4J9K A;  4UB5 A;  1ZJM A;  3RH4 A;  2WTF A;  5KG4 A;  2ISO A;  3N4M B;  3MFH A;  2DFL A;  2RRD A;  2WB1 C;  2KTQ A;  5J2B A;  1QCK A;  5EWG A;  4ELU A;  1KLN A;  2M0N A;  2XY7 A;  4R65 A;  4QZI A;  5AIA A;  4NLC A;  2HBM A;  4B9T A;  3AQF A;  1U4B A;  4UQG A;  3PW0 A;  1NNL A;  1ARO P;  4Y2J A;  3QUC A;  2RP5 A;  3RFA A;  2VJ5 A;  3C29 A;  5KL1 B;  3JPR A;  3RB3 A;  2PI5 A;  1D9D A;  3G6X A;  4F5R A;  5JTI A;  5J0Y A;  2CRX A;  4R8U B;  7ICT A;  2ES6 A;  4OJO A;  4DF8 A;  1KDH A;  4LZG A;  3LVV A;  1SKR A;  1Z4N A;  1NKE A;  1QQ6 A;  2MSN A;  8ICQ A;  1L7M A;  3NVW A;  2R8I A;  4ED0 A;  5HHI A;  2BR0 A;  2QLT A;  2JGA A;  1WCN A;  5L1J A;  5F3X B;  2F77 X;  1LB2 B;  1L3V A;  1QSS A;  2Y1I A;  5ALS A;  5KG1 A;  4DEZ A;  2KSO A;  4O3O A;  2HHS A;  1NOM A;  4OO1 J;  5AM0 A;  3Q8Q B;  3PO4 A;  2Q0Z X;  1S5L U;  2E1E A;  1ZQO A;  1RQN A;  4UBC A;  4FFD A;  3V72 A;  4TQR A;  3PSP A;  5AHX A;  1N61 A;  3WKB A;  4DFM A;  4FS1 A;  2AGQ A;  4I27 A;  3PR5 B;  4J9O A;  5J2K A;  1QSY A;  4NLZ A;  4C7Z A;  3D6J A;  2Y9T A;  1ZQZ A;  2W43 A;  2W9C A;  4RQ0 A;  4UAU A;  4EBE A;  5DQG A;  3KHG A;  2EZY A;  1DK3 A;  2ZTD A;  1PZN A;  5TZV A;  4JWM A;  2ASD A;  1U49 A;  3HW8 A;  5KFR A;  3OTQ A;  2WFA A;  3C1Y A;  4ECV A;  1Z19 A;  2OWO A;  3WK9 A;  2F3N A;  1UA0 A;  3AQE A;  4ICA A;  4Z6F A;  2KV2 A;  3BQ7 A;  5JRT A;  4USA A;  1JX4 A;  4O3R A;  5AK3 A;  5DQH A;  8ICF A;  1S9F A;  2BZF A;  3IHQ B;  3THV A;  3TQ1 A;  8ICO A;  3B0Y A;  4QIW C;  3GII A;  2C22 A;  2H3Z A;  3M9M B;  1NK6 A;  4ECR A;  1CUK A;  5J2A A;  5KFC A;  2KKP A;  4ECZ A;  4K4G A;  1BNP A;  2KN7 A;  2PFO A;  1V9P A;  5ALL A;  2ATL A;  2KJ9 A;  3EUB 2;  4B9M A;  1V85 A;  2JV3 A;  3NVZ A;  2LBO A;  4KX3 A;  1U48 A;  4MHV A;  1K1Q A;  3HKZ F;  5IIN A;  5J8Y A;  2BQU A;  4JUZ A;  3AEV A;  5B66 U;  2R8H A;  2ZG6 A;  3WKE A;  4QZ8 A;  5KT7 A;  5T14 A;  3MGI A;  2YB1 A;  2V4Q A;  3CW2 C; 
#chains in the Genus database with same CATH homology
 3VC8 A;  4NV0 A;  1XO0 A;  4O3M A;  4IC9 A;  4QNL A;  2G5H B;  2KJ8 A;  2A3V A;  2RHF A;  2KOB A;  3CYM A;  5KL8 B;  2Q4T A;  1Z1B A;  3H0R B;  2HOQ A;  1D8B A;  2K8B B;  3IN5 A;  1F44 A;  5HR6 A;  3MGV A;  1ED1 A;  2BDU A;  4NLB A;  3AL0 B;  4P0P A;  2F76 X;  2KVC A;  2KD1 A;  2KIW A;  2DGZ A;  2XID A;  3ALR A;  1NZB A;  3NUQ A;  4AYB C;  3SAG A;  1OUQ A;  4ACO A;  3SMV A;  2WB1 C;  1ECW A;  2RRD A;  2W7P A;  1CRX A;  1HEK A;  4KX5 A;  2OH2 A;  2KHQ A;  2GOL A;  4FE3 A;  2R18 A;  4BUG A;  2M0N A;  3DEE A;  2G09 A;  2G08 A;  4QJF B;  3KZX A;  3GU3 A;  1XNS A;  2HOI A;  2H3I A;  2HBK A;  2K4E A;  2K8C B;  2DQN B;  2HBM A;  2LKY A;  2YX8 A;  3E0F A;  2Y0S C;  2LHT A;  3N7P D;  3RF9 A;  5HR7 A;  2JH1 A;  2XIC A;  2KKV A;  2YB4 A;  3AQF A;  1PVP A;  1Q3U A;  4CRX A;  3C28 A;  2W04 A;  1TAM A;  4KMO B;  1HIW A;  2Y0S F;  4C0Z A;  3ONN A;  2VIX A;  3T79 A;  2K4I A;  3K1Z A;  2G0A A;  2E5S A;  2G07 A;  4JMU A;  2W7O A;  3SAF A;  4P0P B;  2MRL A;  3VCB A;  1Z19 A;  1KBU A;  2H3Q A;  2Z7J A;  4P0Q A;  2KHV A;  4AYB F;  4NLC A;  2RP5 A;  3RFA A;  2VJ5 A;  2VJ4 A;  3C29 A;  3OPX A;  3AQE A;  2WB1 F;  3ICX A;  4OJ5 A;  2G5I B;  5KL1 B;  5CRX A;  2ZIX A;  4P0Q B;  2XI9 A;  4ICA A;  1A6S A;  2ZXH A;  2KV2 A;  3O0F A;  4BX9 C;  4FZM A;  4OJ6 A;  2ZIX B;  5C0Y A;  1YT3 A;  4OJL A;  3D2Q A;  2WAQ C;  1WUD A;  3HKZ C;  3H0M B;  3L3F X;  3M7D A;  3F2D A;  3KFU F;  2XVT A;  2ZIU A;  3F2C A;  2WAQ F;  4CGZ A;  2K89 A;  2N1R A;  2OXO A;  3F2B A;  1P7D A;  5A0L A;  2CRX A;  4QIW C;  3N7R C;  2LYB A;  2ZXI A;  2H3Z A;  4OJO A;  2HOF A;  2ZIU B;  4PL2 A;  3D2N A;  3IG8 A;  1MA7 A;  4QIW F;  1ZQ1 C;  2ZIV A;  3LVV A;  2HBJ A;  2CPR A;  2HBL A;  2CN1 A;  2KKP A;  2MA1 A;  2D6F C;  4NWI A;  2JMG A;  4A8E A;  3N7S C;  2ZIV B;  1URJ A;  2G06 A;  3M6Z A;  1Q3V A;  3PZP A;  2K8A A;  2OYY A;  3D2S A;  2KJ5 A;  2F8L A;  2LYA A;  4PL1 A;  2PMZ C;  1L6N A;  3SAH A;  1SZH A;  2E1F A;  2KJ9 A;  2ZIW A;  1T94 A;  1UPH A;  2H3F A;  2JHD A;  2OM6 A;  2HMX A;  2W03 A;  3H0L B;  2DF4 B;  2JGA A;  3F5E A;  2PMZ F;  1GO3 F;  2JH7 A;  2F77 X;  2ZIW B;  3GZF A;  3IG5 A;  3CP8 A;  3F5A A;  1DRG A;  2LBO A;  2H3V A;  3SQI A;  4GFJ A;  2KIC A;  4KX3 A;  4BJQ A;  4FZL A;  4WJ3 B;  1A0P A;  3HKZ F;  3F53 A;  2K4H A;  3PSF A;  1IIP A;  3M6K A;  3CRX A;  2KNJ A;  3IP4 B;  4OO1 J;  3NRW A;  3LYS A;  3LVW A;  4CDG A;  3PSI A;  1PVQ A;  4U7C A;  2NV3 A;  2E1E A;  2ZG6 A;  2F2A B;  4U6P A;  4FZN A;  2GH1 A;  4OJP A;  5T14 A;  2YB1 A;  2VKQ A;  1PVR A;  2KEY A;  3PST A;  3PSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...