3QU2A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu2A01
2B8JA 3W5AA 4EELA 5AW4A 5AVTA 5AW1A 2IOFA 5AVYA 3ZVNA 5A3QA 3U19A 3WGVA 2WF8A 5ALMA 3AR9A 3FGOA 4BNDB 1ZOLA 4C4SA 4QQFA 3PCTA 3UMCA 4UW9A 5ALUA 1RKUA 4I9FA 1T9ZA 2RBKA 4J03A 3I6BA 3R9KA 1NRWA 4GIBA 5AVXA 2FPUA 2Q5EA 4Y2RA 3WGUA 2G07A 3EF1A 5AKHA 1YJ5A 5ALGA 1RMYA 1WR8A 2YY6A 3I1YA 1SWVA 3EF0A 3OCZA 3N07A 3FPBA 2C8KA 3OCUA 3R09A 1Y8AA 2FPWA 2BDEA 5ALJA 3L5KA 1ZD5A 2I6XA 4G9BA 5AICA 4BYGA 4NABA 4J2TA 1AQ6A 1RMQA 2CFSA 3DAOA 3M1YA 3ZU6A 3QGMA 2W11A 1LVHA 2FPRA 4C4RA 1RQNA 1TJ4A 3E81A 1WPGA 3I76A 2YN4A 1TE2A 2JAOA 5ALRA 5ALXA 2WFAA 5ALQA 4EX7A 1KYTA 3L0YA 3NASA 3N8GA 5ALEA 3A3YA 2W4MA 3D6JA 4XOUA 4Y2TA 1Z4IA 3WKCA 1L6RA 3MPOA 4XE5A 4BX0A 1RQLA 1Z4JA 2Q4RA 3ZX4A 5AVRA 1L7MA 4L6AA 2I55A 4UASA 1RPZA 2P9JA 2CN1A 5AKLA 3VAYA 3ZWKA 4ZEXA 3E84A 1L8LA 1U2SA 4Y3UA 2ODAA 2PQ0A 3RF6A 2I54A 1EK1A 3S6JA 2EARA 5ALYA 2C88A 4KNVA 2I34A 2WF6A 4O8CA 2ZBFA 3L8FA 2RARA 1TJ3A 2FPXA 3ESRA 5ALTA 4L6CA 5AK3A 4KX3A 4YH1A 4F71A 2R8ZA 1N8NA 3QUQA 1U7OA 3WKAA 3KC2A 4MUMA 3U26A 2FPSA 4Y2QA 3L1UA 1L8OA 2GHTA 3PGLA 4YGYA 3U7FB 2O2XA 3B9RA 1XP5A 4RESA 4FYPA 5AW2A 2YMMA 3SD7A 1MH9A 1YNSA 4OCZA 5AKJA 4CF5A 3L0CA 3L8HA 3ZWDA 1WVIA 4BEVA 5AM1A 4UU0A 1QQ7A 5ALLA 1S2OA 3AR3A 3W5CA 2OA0A 5A3SA 4Y2PA 3ZTWA 5AI9A 5ALPA 2YJ6A 2HDOA 3CNHA 2VKQA 3ONNA 3QU5A 5AM4A 3OCVA 5AK5A 4ZEWA 2R8YA 4Y2VA 1RDFA 2FEAA 3U7HB 3IJ5A 3IB6A 3A1DA 1Z4LA 2JGAA 3ET5A 2GMWA 5ALNA 1Z88A 4F72A 3KOOA 3WK7A 2AMYA 3N1UA 3PGVA 4BX3A 1QQ5A 1O03A 1EK2A 2YMPA 4DWOA 4UM7A 5AKGA 5AVQA 2MU1A 5AVZA 4XPZA 2YJ5A 3ZI4A 2B30A 5AI4A 1PW5A 1TA0A 3L7YA 3EWIA 2X4DA 5ALDA 2FDRA 2ZG6A 2W43A 3E8MA 4GXTA 3SHQA 1X42A 3RFUA 3NALA 2OBBA 5AI0A 5FP0A 3QNMA 2WF9A 1VJ5A 2YFYA 4CF3A 1XPJA 1TJ5A 2HI0A 3WKDA 2YBDA 3F9RA 2ZBGA 3A1CA 3NAMA 3SMVA 5AKXA 4JDPA 5AW0A 4JB3A 4RETA 3K1ZA 4AP9A 1VJRA 1QQ6A 5IS2A 2P27A 4E88A 1J97A 1RLTA 2P11A 5AK6A 1YS9A 2I7DA 1L7OA 4UAUA 2IOFK 3U13A 2MU2A 4NAVA 1JUDA 3HYCA 3QLEA 3I28A 1Z4MA 1ZD4A 4HGRA 1QH9A 3MN1A 3NANA 3E58A 4HYTA 1RKVA 1NF2A 2NO5A 1Z5UA 5ALZA 2R8EA 5AM2A 3UMBA 2G09A 2GO7A 4H1WA 2B82A 2IYEA 2QYHA 4EZEA 2AUTA 3QU9A 3U7GA 3MC1A 4EX6A 1ZD2P 2O9JA 3NIWA 5AW9A 1RC8A 2ZXEA 3WK9A 2QLTA 4DCCA 2C4NA 3N28A 1K1EA 1SU4A 1RLOA 5AI8A 4C4TA 1L7PA 3PDWA 3FVVA 3BA6A 2WM8A 4UMEA 2JAWA 2HCFA 2CFRA 5JJBA 3AR6A 4FE3A 4HGQA 3BWVA 2P69A 5AVUA 5AKEA 2B1RA 4HGPA 1RMTA 2NYVA 1Z4NA 4OFZA 1S8OA 4CE6A 3AR2A 3SKXA 5AVSA 1XVIA 5ALIA 5ALVA 3DV9A 2AGVA 5ALKA 2OM6A 5ALOA 3QUTA 3A1EA 5AM0A 2R8XA 1WZCA 3U7EB 3P96A 4Y2YA 2HX1A 3OCXA 2EAUA 1Z4KA 1U2TA 2PR7A 1Q91A 1VFPA 3KZXA 4BBJA 1L7NA 4Y2UA 2WF7A 3W5DA 2D2VA 4MWOA 2ZOSA 3UM9A 2C9MA 4KX5A 1RKQA 4OD0A 1FEZA 4EENA 2IOHA 4XQ0A 3FZQA 5IT0A 1RLMA 5AKYA 3WKBA 2ZBEA 3FPSA 5A3RA 5ALSA 2WHEA 3ET4A 3QU4A 4AS2A 2G1AA 2WF5A 5AM5A 4KNWA 3QUCA 4Y2JA 2HSZA 3AR8A 5AW3A 2HEGA 2C8LA 1Z4OA 3B9BA 2G08A 3UMGA 2GFHA 2GHQA 2HO4A 3AR7A 4HGNA 4CNQA 2AH5A 5AIAA 2NO4A 2JAUA 4IG4A 2G0AA 4YCNA 3OTQA 2EATA 3L1VA 5AM3A 3NRJA 1YV9A 4HGOA 4BEWA 3SKYA 1T5SA 1Z4PX 3QU7A 4NWIA 5AW6A 1YMQA 5ALFA 2IA5A 3ZTYA 4UMDA 5AHXA 3IRUA 4OHFA 3AR5A 1ZD3A 4I9GA 3KD3A 3DNPA 2Q4TA 2CFTA 1Q92A 2JARA 4UM5A 3OPXA 2ZBDA 4YCLA 4Y2XA 1Z5GA 2HOQA 5AKIA 4FFDA 3ZW7A 3L0BA 4CF4A 3R4CA 2YJ4A 2B8EA 3OCWA 3B8EA 2B0CA 5AI6A 2FUCA 3GYGA 4QJBA 3ED5A 3QXGA 1ZJJA 4DFDA 3KBBA 4IFTA 3L8GA 2MSNA 1QYIA 2YMLA 3AR4A 3ZX5A 4BX2A 1F5SA 4Y2SA 4YIHA 4UAVA 3QU2A 5E0OA 4KYTA 1ZRMA 3WKEA 2I33A 3KDPA 5ALHA 3ESQA 4UMVA 5AW8A 5AIBA 3QUBA 2FUEA 2HF2A 2RB5A 3N5KA 4UU1A 4L57A 5AESA 1CR6A 4G63A 1LTQA 3ZUPA 4NV0A 4BKMA 4YCMA 5AI5A 3SLRA 1YDFA 2DQSA 3MMZA 2PKEA 4UMFA 2BY4A 1IWOA 2YJ3A 1RRCA 4BNDA 3TLMA 1CQZA 1NNLA 3WK4A 2HF7A 1ZS9A 3QYPA 3SF0A 3EPRA 1SWWA 3L8EA 5AKKA 2G06A 3WK5A 4DW8A 3WK8A 3W5BA 3QX7A 5T41A 4PNHA 1U02A 3ZVLA 4UATA 4B6JA 3FM9A 1N9KA 2RAVA 2OYCA 4HAIA 1U7PA 4NFLA 1ZRNA 2HHLA 5IT4A 5AW7A 3ZVMA 4KN8A 4ZEVA 3WK6A 2YMQA 5AK4A 1Z4QA 1T5TA 2G80A 3J7TA 3M9LA 5AVVA 4AS3A 3HLTA 1O08A 5AKZA 3CZ4A 5AW5A 3NUQA 2BDUA 1J8DA 3OCYA 2FI1A 5ALWA 4YIKA 4EEKA 5AVWA 3DDHA 4UARA 2B1QA
chains in the Genus database with same CATH superfamily
4WFJA 1XG5A 4I2EA 2DBYA 3L3BA 5ALMA 3AR9A 3DZFA 2GK4A 5FWXA 4US2R 2QF7A 1YRAA 3G6KA 3WGZA 2ZRLA 3UNXA 3HB0A 4C05A 1S7GA 1CEEA 2A1TR 1U3CA 4YMWA 3PHGA 1AKEA 4M7PA 1C7QA 2FP4A 2XCOA 3O9MA 3A0BU 3DQPA 2XUGA 2XI9A 4YMLA 5CH5A 2NV2B 1LNZA 3P97A 4LMAA 3NPAA 3AI7A 3ZQJA 4QXMA 2AHRA 2P3SA 3QKIA 2R8JA 2OESA 4LDZA 4IINA 1OBHA 4I8IA 4DC1A 1FO4A 2RAUA 1Z4IA 3KBOA 3BQMB 4F4WA 5DP2A 1HA3A 2NWQA 4B87A 1HFKA 3G02A 3KTDA 5DQHA 2IXBA 3DVQX 3SZ2A 4X6LA 1WPXA 4TS3A 3U61B 2A3VA 1IC6A 2X0EA 3L8FA 4X8OA 4TUSA 3M6FA 1IZ9A 4QUIA 3IQFA 4BNJA 4KFSA 4I5GA 1E1CB 2C42A 1YC2A 1NW7A 4DM7A 3DBRA 4MKIA 1KMQA 5KYXB 4LX0A 1OYYA 3G7UA 3BMOA 3EISA 3BQTA 3OKPA 2Z6UA 5FB3A 3WXBA 4M36A 4M53A 1W59A 1W7AA 3EGIA 1P4GA 4ZEWA 2BEUB 2H1CA 2R11A 1VE9A 3M6VA 3WZ2A 4ZP1A 3CUYA 3AH8A 3H9EO 4GVLA 1COWA 4Q16A 1I51A 1R4ZA 3ER6A 3H40A 3CR3C 3F1LA 4JJFA 1HE2A 4CT4B 3UV6A 2YQ5A 4QDJA 2PFNA 4D74A 1RJFA 3T9CA 3RGWS 1N2XA 3EXHC 4ZALA 4LJ6A 3WB9A 2KWIA 5DX1A 2DSNA 3N7PD 2P6OA 4CODB 3T94A 3BF8A 3GILA 1COKA 4I5FA 2BJVA 3QLJA 1KI3A 2UZ1A 4KQMA 3GGJA 4LZOA 2KVCA 1KJJA 4J4BA 3OZCA 2B7BA 2CFOA 4A2PA 4UAWA 2LUOA 1ZQPA 3MA0A 2AXNA 4BWFB 5KINB 4Q00A 1ORHA 1VL6A 2NYVA 2ZJ1A 1N0UA 1GILA 4JUIA 13PKA 2FSPA 3P96A 2IUTA 1NTOA 3R0VA 2NADA 2C1XA 4F5PA 3PX3A 1QQBA 5KFTA 3RVJA 2Q41A 5JSZA 5EZSA 3DM9B 3K0HA 1UJ4A 4K4GA 5AM5A 1G5QA 4HJRA 1POWA 1ZQYA 2YNMC 1QO9A 2XIJA 4HWPA 4CEIA 1J49A 3A6ZA 3MDCA 1TQ8A 4UUBA 3QLUC 3A28A 4IQVA 1XRRA 2QYOA 4YDSA 2ZYHA 5ELLA 2AUMA 2DUNA 3FHTA 3ZLVA 4ND4A 1OI7A 2CNLA 4J0CA 4QM7A 2PUDA 3HA7A 3NH6A 1PS8A 2WFLA 3KPVA 3F46A 2RGYA 4MPTA 3BJYA 1ZMOA 1U11A 4QZBA 2VDJA 4WTOA 2L17A 4WY8A 1LKYA 3HN6A 4ZQHA 1K66A 3K70B 4KXLA 1AOXA 4QRHA 1UPXA 1UXOA 1BE0A 5DM1A 1M8KA 5LWHA 4UUAA 3GB9A 4Q9LA 1DO8A 2JLXA 4X6XA 4LXXA 4YRCA 1BVSA 3EPRA 1EVZA 1HK7A 5D4BA 4H7FA 4DQKA 4KB5A 4QG3A 3GJZA 4GS5A 1GG2A 1TT5A 2ECPA 1T8SA 4PX3A 4DLZA 3H16A 1T0IA 2XGMA 1IBKB 2VH1A 3V4OA 3CZAA 1BFUA 2H63A 3I6QA 1FDUA 3R7BA 4I50A 4F3TA 4O5AA 2CZCA 4DY4A 5CBPB 3BSYA 3FHOA 2QLJA 3FVWA 3W5AA 4HDSB 2H9YA 4NZMA 5EFZA 2GOLA 1C9YA 3ONEA 5LQRA 3IUJA 4GOLD 3Q10A 1GCAA 2Q9CA 3MINA 5DGTA 4GIBA 3UT6A 2BH2A 3FTPA 3OEEA 1YRWA 2O07A 5EWGA 2JKYA 5C3MA 4J29A 121PA 1X9GA 1R18A 5IARA 3CW2A 5FNVB 5IUKC 5DNYB 4WEQA 4D3YA 1A9RA 1XO0A 5HS4A 4PZYA 3QGMA 4QZAA 4B46A 5B5EU 4E31A 4O8ZA 2H6EA 4M2LA 4XWWA 3SIWA 4LXHA 3K0EA 1LC0A 1IQPA 4GXRA 1D6MA 3AJ8A 4Y2TA 5SY4A 3L8YA 3K2QA 4K9MA 2FR8C 2V7XA 4ZHQF 1UPHA 1MVLA 2YJNA 1EK1A 2O6HA 1JSCA 3EPIA 2QTWB 2A0UA 1YR2A 4TXLA 5BYJA 2NU8A 4MJ7A 4EM6A 4NG5A 4UJ3A 4BV8A 1T0UA 1KDRA 2V6GA 1B3RA 4ZKEA 3OICA 2C5HA 1E6WA 5A3SA 3DKRA 2JJMA 4ZYLA 1HMPA 1PSWA 2H2FA 3NIDB 1IEWA 2QRVB 4M9JA 4OH1A 4UM7A 4KTVE 3HB5X 4MVJI 4WJ3B 4YT4A 2GPAA 3BQ0A 5TQVA 4I4IA 4XIFA 4CU5A 4M86A 1NKEA 4P4LA 4L78A 1SU6A 4G86A 3KQKA 3GA7A 3IIJA 1CWUA 5CM2Z 4ELTA 1E6EA 1BPXA 4B75A 3EX7C 3EWAA 5KT4A 4QU9A 1AQIA 5DH9A 5TE9A 3TQTA 1O0SA 4GRIA 2LYBA 4Q21A 2JLQA 5K0EA 3EIHA 1GO2A 2C57A 4KYUA 3UMBA 1KNQA 4ZYZA 4OTZA 2QN6A 2G4CA 3KQVA 5CX4A 4MKFA 3WJ2A 1GJRA 4UEJA 1E7QA 3A6KA 1X14A 1ID8A 2H5IA 1Y7TA 1MIOB 3LPAA 3ER9A 4DDUA 1CRPA 4HVLA 4RFSB 3Q3IA 1PJ2A 5J0OA 4P4SA 3SKXA 1YJAA 3U4MA 2HX1A 4M04A 3NUZA 2O5CA 3WGOA 3CF0A 2PL5A 3H75A 3N0RA 3NNDA 5DT9A 4RTQA 4LISA 3OEHD 1FFCA 4BE4A 3DW3X 1CJSA 1K3UB 2YOFA 4QJ5A 1A72A 5DHPA 1U3VA 1Q1ZA 3LHSA 1K5GA 4ZTZB 3Q88A 4KYVA 4LF4B 2M6KA 1RYDA 3AFOA 5SZJA 3NONA 1H8HA 4MXDA 3G0GA 2QGZA 3UIEA 3CNBA 3PUIA 1O89A 3SQXA 5TX7A 2WTNA 3SBXA 1Z4PX 4LPSA 1B74A 5GMOA 4GKJB 1LLQA 4JC0A 5JVDF 3ORSA 2PTHA 4KN6A 2QT0A 3TD6A 4PSAA 4U0KA 2B0CA 3MWFA 2J5XA 4D56A 1VL8A 2FFBA 4IDEA 3LSTA 1OH8A 3PFBA 1F8YA 2VZLA 4G9EA 4PLYA 1Q84A 4H1UA 2II6A 1Q50A 1COOA 1E9CA 1K7SN 1LB1B 1NMEA 3S55A 2DYKA 3HJTA 1T3QA 1NFFA 4Q7EA 3QPCA 2XCTB 2YUTA 1XLUA 4R7TA 2VJMA 1W93A 2SICE 3ABRB 2NXWA 4ZVTA 3WQHA 1DAGA 1I0ZA 3EXEA 5DB7A 1R15A 3GLVA 1EZZA 1HUOA 1Z6PA 2JVJA 2E4ZA 4TQSA 3PHCA 2QENA 4PZNA 3RS5A 5EQDA 3BZBA 3GDOA 1A9PA 1Z56C 3R0XA 1WHTA 5ALWA 1H22A 2FN3A 2CF5A 4KG7A 4L85A 4YI3A 2QRMA 5GOZA 3SJUA 2YXLA 2NVUA 3ZZ0A 2XMSA 4CKCB 1PI3A 4GO1A 5L95A 1S5LU 4QPNA 4DOBA 2ODTX 4D26A 2NYUA 3U39A 2OBLA 3VTAA 5DLQC 5KT6A 5E4FA 4A5SA 5KFZA 3H5LA 3RVDA 4EYEA 3O3NB 2B3TA 4CMEC 1E62A 4HT3B 4I1SA 3RH4A 1TVEA 3ZV3A 1FUYB 2DPIA 1N6PA 3M1YA 3GP3A 1O5OA 4WY2A 4OB8A 5J1TB 4PPGA 1YE3A 1TE2A 4KQFA 1T2DA 2VT3A 3EIFA 5JOQA 2XCIA 1E2QA 4F60A 4C4PA 4E5UA 1GUBA 4WINA 3H5NA 3VSBA 4CM1A 3PC8A 2IHTA 5A5GA 1LPNA 1JXEA 5IT5A 5FUQA 1CUSA 4AZWA 1Y7PA 2WKPA 1W0CA 2R8ZA 1N8NA 3B1XA 4B40A 4K7JA 4RSMA 2ACKA 2ENUA 1G5PA 1Q0LA 2DZDA 2WUVA 1G2IA 4MV7A 7ICTA 1KU0A 2WWFA 1CQWA 1ICEA 2ONJA 2V0GA 4DQRA 2IU6A 3SJ7A 4U2KA 3L43A 2X8JB 1VL1A 3BTSA 5C5DA 2GJ8A 2W9CB 5K4AA 3A1NA 1KTIA 3ZH2A 2VKQA 3RH5A 9ICBA 1G3UA 3ANXA 4L75A 3UJ8A 1AS0A 5JTTA 3L7IA 1QAMA 4Y0NA 4ITRC 4LWZA 1RM3A 3M34A 1RU3A 3E3MA 1MTOA 3NKFA 1RYEA 4BKRA 3NRCA 2FJUA 2H07A 2HJGA 1ZN7A 4PN7A 1BQ4A 2GZDA 3L05A 5KWIA 5GIPE 4OXQA 1ZZEA 4M9GA 2QJTA 2R25B 4QYMA 2J31A 5J2FA 1YMUA 3F5AA 1LK5A 3UWPA 4K81B 1C1YA 3NAMA 2VHEA 4DLPA 5J2KA 4QNRA 4CXMA 2R7KA 4R2XA 3KOWA 3KR1A 4B6GA 1JJAA 2A35A 1SCNE 5A03A 3Q7PA 1IE3A 5G1OA 2W93A 1ODSA 1ZQZA 2XD9A 4EZEA 2OFPA 2IS2A 5LQDA 3B6EA 3NXKA 1JXLA 1GUDA 2ID8A 4FDVA 4PS0A 1PT5A 1ZQ9A 4XUDA 4WMLA 1NBEA 4BKPA 1QTRA 1T3GA 3EWNA 3PTZA 2W6NA 3C98A 2XGOA 3U7EB 2F4NA 4J6EA 3BFPA 2P6NA 3VR4A 5DKWA 1N9GA 4JI3B 4PZ9A 3QMMA 5J2TA 4MP3A 3PVSA 2IIVA 2OQRA 3CH4B 4MYHA 4FDLA 2XUZA 4DOMA 2PL1A 4I2DA 3ZY5A 3IMEA 1G7TA 1Z06A 2H11A 1AN0A 1H66A 3EVAA 4Z9XA 1S10A 2K8BB 3BWDD 5CFOA 1V8ZA 4QZFA 1H2FA 1LS1A 2JGIA 4XYEA 3M70A 1E5VA 4ALKA 3ENVA 1ZD8A 9ICFA 2DXIA 4F4KA 1U8XX 1YMVA 3WRVA 4COOA 3II6X 3AY6A 5DCYA 1Y3CE 4X3OA 4B0PA 5LDDC 1NOKA 2O3RA 4ZH4A 1T2CA 4DIBA 3FPAA 3WQBA 1ZN2A 2TSYB 5AW8A 2RB5A 4G8BA 1O94C 4NZOA 3ZV7A 2FGJA 2ZCUA 3SLGA 4GXJA 3ND7A 2I3AA 5EMKA 1RM0A 1SBHA 3LQFA 3AEKA 3GFQA 2Z5LA 3A32A 4W1QA 1CYEA 2GKGA 2WJGA 3CX8A 3HKDA 5F73A 3LOQA 2LR0A 3VQTA 3SV4A 4O2AB 4AYBC 4BLOA 1YT3A 4KWTA 1QRSA 3QPDA 1EGMB 1WV1A 4R98A 4DXAA 3M9LA 2G5CA 2HWWA 1E5DA 4G4JA 3U2QA 2IA6A 4UARA 4EG1A 1FS4A 1J70A 2YCLA 2E8NA 3CVXA 1T8TA 2IBKA 3I39X 3WBBA 1UPFA 1C7ZA 5ALUA 4KO3S 1P4RA 5IW8A 1JVNA 4FOLA 2JMGA 1OGYA 2Z7JA 3WGUA 3IT3A 5EUCA 4I8XA 3DKVA 2QHXA 5FL7A 1TZBA 3CYMA 3T4EA 3ZGOA 4A8PA 1P3DA 3NGMA 1RG6A 4X62B 5HKBA 1ECLA 3BXOA 1DG9A 1N2GA 3EB9A 3E1SA 3P9NA 3AQEA 1FA9A 2EXXA 1LPPA 4L95C 4CT0A 2HF8A 2ZJ0A 4KBGA 3OA0A 2PMWB 1U94A 5EJ4A 3O8NA 2IY9A 2FW1A 2WTXA 3T5PA 3ZLBA 3BWYA 3R5SA 2WR8A 2G7ZA 3ZXXA 3HGTA 4QBGB 4FT4A 2QUHA 2H57A 1U90A 2Y0SF 5HTOA 1C4OA 4PGGA 5JXWA 2P7IA 2ZDGA 2PGIA 3AFNA 5KYNA 2Y76A 1A4XA 3L1UA 1BNPA 4TTRA 1N2IA 2Z95A 1X7YB 2AN5A 1UJ6A 3F2IA 4FK8A 1A9XB 3K53A 2ZWVA 4QDTA 2XITA 4KLEA 1XF1A 2QN7A 4WN9A 2PS3A 1R50A 1OFVA 5C7OO 4Z7QB 4JBLA 5C8VA 5DGDA 2BRUA 2Q46A 1W0JA 5D5QA 1XAGA 2GEKA 1X7XB 2F67A 5JAUA 1DCTA 4JSTA 4NAUA 3JQAA 3RU9A 1TYZA 4K9RA 1AGXA 5K3AA 4G5OA 3JQBC 3UHAA 4HH3C 5EJIA 3U60B 2O8DA 3HBFA 2DU8A 2R5FA 1GTL1 4AKIA 3K0AA 3NWBA 3H65A 2OGUA 3ICEA 2CJFA 1N6HA 3K4PA 3FTNA 1FBNA 1WUYA 2WMNB 4MTLA 2EZZA 3A1UA 4QRIA 1YS9A 3ENKA 1TLFA 3GBSA 4BJ1A 4TYWA 1J24A 2CEKA 1ECGA 3ZG6A 1KQQA 4NS1A 3MCZA 1BMFD 4GGPA 4F50A 2AUTA 4E3WA 3K92A 4ZOLA 1U7XA 4EJ6A 3CEPB 4L2IB 1RLOA 4MH0R 1JB9A 5FWYA 1U0NA 3R7LA 4YV7A 5FORA 2Y66A 1KAEA 2P6PA 4MVCA 4LVSA 1CEQA 3FLEA 4CCWA 2IZ5A 3BGOS 2G71A 1D1SA 4RE5A 3D5TA 1U7DA 1VSUA 5KTMA 3F3MA 4Z5XA 8ICYA 3H4DA 1Z82A 1IMOA 1WLYA 1NBME 3UPQA 3ENQA 3JQRA 5BQ3A 3DT8A 3DOFA 1OA0A 1X8XA 1RPAA 3E22A 3QHAA 3GV5B 1F8XA 1E4EA 1CV2A 1E9EA 2H2GA 5GONA 3ISDA 4GM0A 2WHEA 5ICEA 1TKAA 4NTZA 2HEGA 5I7OA 3RLIA 4O4IA 4KE7A 4PO1A 2Z56A 1YBVA 4JR2A 3VV3A 3CX7A 4OP3A 5LZ4A 4WY5A 4BB0A 4EO7A 1SZHA 1K6XA 1M7BA 5TDHA 4A6DA 3KLOA 1E3JA 4PHTA 1DFGA 1UJNA 3W3AD 2EBFX 4TYQA 7REQA 3BJMA 3PCXA 2IEZA 5IANA 3SE0A 1V8PA 3BXEA 2F3RA 2PBZA 1K1QA 1SBZA 1VPEA 1S3FA 1Z7EA 1JAHA 3QX3A 3ZDAA 4X9XA 4URXR 2R48A 2DQSA 4MJLA 5KREA 2VHCA 4HK4A 4MAMA 4EKGA 4XGQA 1BH2A 4EZ9A 3IAM6 3DEAA 1OOEA 1YL7A 3M5CA 3AZPA 1S3GA 1DZIA 1G55A 4KPEC 5K8VA 3NCHA 4ZIRB 3WSVA 1XB2A 2HBKA 1L5QA 1GPUA 3IESA 4QYWA 3RRMA 4PFKA 4DSTA 1TC2A 4HCJA 2Z43A 1QRUA 2QT1A 2B2XA 4DREA 3EDYA 5DN6D 1Z62A 4B0OA 5BYBA 2EX4A 4ODIA 3CURA 2XA2A 1U5AA 5DPMA 1Q6ZA 4N3NA 5K0FA 2J3MA 1BE1A 3NDRA 1Z5NA 4TYMA 3TW8B 4UNSA 2J9ZB 4KCGA 3WAJA 1IG6A 2ZWMA 1SC4A 4L4UA 5JBNA 2WWGA 3OZRA 3KB6A 3JPYA 2J5QA 3WDMA 1IVSA 1A2BA 4G0VA 1H5QA 4EYSA 4F5OA 5E38A 4DSEA 3WP0A 4JB0A 1U9LA 3DOCA 3W7VA 1Y6ZA 5FV4A 3RJFA 3NP7A 1V95A 5EE9A 2PX4A 2IUSA 1P0CA 1QIHA 3C7DB 1USUA 1JHRA 4EYKA 5FFMA 3QVXA 4YFVA 3CZQA 3L84A 1GCOA 5CT6A 1TMGE 4CETA 3U4IA 4HXFB 3AI1A 5BMVB 3ZWKA 5DWDA 4IXWA 4W8OA 2YTZA 4YJDA 4IFBA 2D4AA 5ALYA 2ZYSA 3HM2A 3RVBA 3KVYA 4EI9A 1JHYA 4F3KA 4D9JA 1WSAA 2ORYA 2AHOA 1NOMA 1LF5A 1TF2A 2WT9A 2ERYA 2QV0A 3I52A 1R10A 1VGVA 4MV4A 1UMBA 4QUEA 3TTWA 4G2TA 3DR3A 1QVZA 3FMFA 3PNMA 2FA9A 1BZYA 2Q5IA 5EWMA 4ZJUA 1GPYA 3AI2A 3G2HA 1ZC3A 2QTTA 3QELA 2ZVPX 5DIZA 3KHHA 1Z88A 1OVMA 1AC5A 1VHQA 3V1KA 8ICBA 2KE7A 8ICAA 2RGDA 4E7PA 1ZIXA 2IDMA 3ZIDA 3ZN2A 4UVIA 3BQ1A 1X42A 2Q21A 2YWEA 1RPNA 3H05A 4U5XA 2YFYA 2M6SA 2I4TA 3JQ6A 3WKDA 5EVJA 2WMDA 2WZCA 3UUWA 4LF9B 4TLAA 1XLWA 4EG5A 2BUAA 4P3YA 4J0EA 1QU2A 5JNRA 2FMKA 3ZD6A 3CZ9A 1ECBA 4D45A 4O33A 3EW9A 5KOHA 3NVVA 4CG3A 1I6LA 1E6KA 4PQEA 5FUWA 4R3NA 5ARDA 4FT2A 1CY0A 5K6TA 4MLCA 2OCGA 3JWJA 1EXNA 3TOVA 1OWPA 1H3EA 4LYDA 3GLHA 5DG7A 3JD1A 3TLYA 4CUZA 1BDMA 3T5DA 2J08A 3VR2A 1DK3A 5TRTA 4FONA 1QFYA 2WG2A 4YS6A 3Q2OA 1N6KA 3W5DA 1Z0FA 1T5IA 1OXXK 3K6SB 2RLTA 1CEXA 4QQNA 3ND8A 2CK3A 3ONWA 3CN9A 4JEHA 4HDNB 4PZLA 4UNPA 4ARZA 4HVCA 4MB0A 1NSYA 2G5IB 1TK2A 2V1XA 4E07A 1XA0A 3PA6A 1SG0A 4EG4A 2V4QA 5BR8B 2I3GA 4YRAA 3PFIA 2JVKA 2PUFA 2OZLB 2K2WA 4AIRA 2PYDA 4KNYA 4LJ8A 3G2LA 3TW6A 1J6UA 2B6GA 1VL5A 3ZK8A 1E64A 3K2EA 2X4LA 1SM4A 2JKVA 3E9CA 3E48A 5JMOA 2ZTSA 4Y0AA 4GM4A 5EKXA 3AT1A 4F1KA 5GTDA 4AN1A 1F2UA 3VYSB 1GGKA 3QE9Y 4UB1A 4OHMA 3AF1A 3RS3A 2BY4A 3S81A 3HLYA 3JQGB 3QVKA 4BQEA 5IBPA 2JHGA 2IKSA 3UFXA 3M6WA 3LLVA 4KC0A 1CFZA 2H5LA 2IYOA 2IDKA 4U0JA 4EQ6B 1T3NA 5DMHA 1U7UA 4J4HA 2R8GA 2VAPA 4R9RA 3IP1A 3BXHA 2CMHA 1D1QA 4BDPA 3RIHA 3DDOA 1H69A 1O6ZA 4O3RA 3O93A 4C14A 1CE8B 1L7RA 3VR5A 4Z8YA 2I6SA 3PUHA 4GPZA 1DG1G 1FTWA 4A2CA 3NWEA 2BEJA 1E1DA 5CLFA 5A3QA 8ICNA 4GFDA 3THRA 1AS3A 1K92A 3FAZA 3HCNA 2XW6A 1K98A 1SUEA 3VCBA 1PL0A 3A4NA 7ADHA 3TPFA 4TQAA 1X3LA 3FX2A 4HQRA 3DW1X 2DM6A 2W6ZA 1NQUA 4H2DA 4Q4DA 3N07A 2A5LA 4MEBA 2XVZA 4F2SA 5FOTA 5IYZB 1Z22A 2VWPA 2XOXA 4XD2A 2WJYA 3K6KA 4IRCA 4A0HA 3CNQS 2QD5A 1BPEA 1UCVA 2TRSB 5JPDA 4EGAA 4TMXA 4WSOA 1N8TA 1XTQA 1UZNA 1IY2A 2EBWA 1V5IA 3UXOA 2H1RA 4KAFA 3BM5A 2QI9C 5I7RA 4C04A 3HB7A 2ZVJA 4MRMA 3PXAA 4REQA 2R60A 2I9KA 1VM6A 5K09A 4J2OA 4MUGA 2VDLB 1ZR2A 4BVFA 2GTHA 4CF5A 4DSJA 3VNVA 4Q4AB 2DPMA 3TMYA 3U48A 1UK8A 4RM2A 5J2EA 3EGEA 2VIXA 5IVHA 2QE7A 3J7AC 1FQJA 1P1FA 4MGKR 1F3OA 4N0DA 2ZE8A 2IU3A 4DV6B 4CKEA 4DEVA 5DCUA 2RCYA 3GV8B 3PCRB 4XFKA 1KETA 1RHJA 2TS1A 1X9XA 5E2AA 2NGRA 3RJZA 1JG2A 3WA6A 2J9YB 3H9GA 3E8MA 2RHOA 1YI8A 3NHAA 3AUFA 2HBMA 3SFZA 3BRSA 2F8LA 3BXPA 3JVDA 3GCGA 4JJ7A 1Z7YA 4LMBA 3EHEA 4GR4A 1TAUA 2J3EA 1KDYA 3OPVA 1UT8A 1V11A 4O2BF 4OXNA 2I76A 2R0QC 4KAJA 4DTIA 3SXUB 3MLAA 4BAUA 3CRZA 2HGSA 1P7YA 4UVEA 5EIEA 3EC1A 5CG1A 4PAOA 4X54A 4DA8A 4GPAA 3A1SA 1ESEA 4B4KA 4ECTA 2VF8A 5FBHA 1MHTA 2QUJA 3AKEA 5F3DA 4Q18A 2OR3A 3DG9A 4WCDA 1I6KA 5LKAA 5DBHX 2HHHB 4D0GA 3RTDA 2VBGA 2C3YA 4QBFA 2G72A 1V8BA 4B4VA 4O08A 1O97D 3LVQE 2XICA 4B9LA 4C2AA 1Y1QA 3MHPA 4ZDIA 1ZP6A 4MIYA 1XZQA 2EATA 4P3OA 4BFLA 4JT2A 5IX8A 3IAHA 3LX6A 4CRXA 4XVCA 1AROP 5TV2A 4N65A 2JARA 3QKSA 4D5GA 4ZYYA 1R74A 3LW7A 2HVIA 3M49A 4KGZA 4B4WA 4BO6A 1QGDA 1LWNA 2CVQA 1Q15A 3EGVA 1FMFA 3AQFA 2UUPA 1ORIA 3WTCA 4TQRA 5G0TA 4NS4A 4OAPA 4BVBA 4PRLA 3RJGA 2WABA 2V4MA 1RIIA 4AQDA 1U9ZA 2Q6OA 2GPYA 4ZKDA 1DB3A 3BMNA 2JIZA 1QM5A 2DKFA 4YDRA 4N82A 4B31A 4LFCB 4IIEA 1OSNA 2M98A 3MHTA 3F2VA 5I7WA 1NLMA 1ETUA 4QWMA 2VDWA 4AF8A 1R8XA 2CMGA 1BEZA 2XMRA 1E4VA 3A3KA 1XSNA 3V8PA 3VR3D 4WVLA 1C50A 3OM8A 3DDHA 5DHSA 2OYRA 1DC8A 5BVHB 5BNIA 4IG9A 1D8YA 2X14A 3OWHA 5EINA 5FF9A 3I83A 3KSAC 3MM4A 4JC8A 1DJLA 1JA0A 1N7GA 2XIQA 4YP5A 1S89A 4JI8B 3G6YA 4FB4A 2KVSA 1UKAA 2R44A 4MA0A 2NAPA 3AU2A 4MQFA 3KO8A 3PR1A 1C20A 1FW6A 1HUZA 1N5JA 3L92A 2WHRA 2VP0A 2IYZA 4XYGA 1V45E 2OO5A 1HOTA 3E9MA 2LP4Y 2L82A 2HA5A 2HPZA 3A27A 2XPCA 4I27A 4RYDA 1FFAA 1P6QA 2Q4RA 3GT7A 1R5BA 4YONB 2VSXA 4AMYA 3UFBA 4OI2A 2B1JA 3OIWA 4Z4FA 3THWB 1JFSA 3EVNA 1NSFA 4OHBA 3REFA 3M4ZA 2GBIA 3GRYA 1B1CA 2AFIB 2P2GA 1I0LA 1QIMA 2BMDA 2JDIA 3MPUA 3AVVA 4QLOA 3L9XA 1NI5A 3O1LA 2VA2A 1EUDB 4QFCA 3QYJA 4GOKA 5K3EA 3QNUA 4V0KA 2A84A 4BO3A 4BUGA 1EFTA 3L0CA 5E4YA 4P3PA 1W6UA 3AM1A 3MJHA 2CDNA 4AYXA 1ILEA 1GUFA 1IIPA 4Q4JB 4XEHA 4C4XA 5BN4A 1KGSA 1U0OC 2ZYTX 1RZVA 2AMYA 1KRPA 1WMAA 3PGVA 5HTKA 1NK7A 2XTJA 4O5KA 5ECGC 3B53X 2O5VA 3LK6A 1U8TA 2E0IA 3VH2A 2VXBA 5AI4A 2D7CA 3FPKA 4CQNA 1Y34E 2IU0A 1P1BA 3WWDA 3I0ZA 5FP0A 4ZCSA 4X1KB 3A1CA 3MMSA 4BVLA 3RR7A 2FRDC 5CD1A 1F8UA 4IDFA 2I7DA 2JL1A 4YR7A 1TO1E 1K86A 2IYWA 5BSTA 4N5MA 3KSBC 3F6PA 2C5FA 1C7YA 4D41A 5JLJA 5H2FU 2EU8A 3OPYB 1KEEB 1W1WA 1JX6A 3BZCA 4G01B 5E4JA 1BCSB 3C1YA 4GZLA 3AF6A 4PNZA 3J80A 3K1RB 4MPJA 3GJ3A 5KNBA 1P44A 4YCXA 3VM6A 2CFRA 2PFOA 2ZSHA 2WG0A 4UFPA 3BYZA 2XYGA 3QSYA 3PD1A 2ZJ8A 3LP8A 5KX5B 5ALVA 3Q9LA 4E3ZA 5LVAA 4QW9A 1L5OA 4RADA 2DF4B 3DF9A 2X5NA 1QS0A 2WUFA 1O96B 1W4LA 2W6IA 5FO1A 4LZLA 1KGDA 5FCDA 2P35A 4I7EA 1RLMA 2I6QA 3GUUA 5A3RA 2PFPA 1UZMA 3ZUGA 4RDHA 5A5FA 4MS1A 5FPTA 1HXHA 5A71A 5I7AA 2JZBA 3WHIA 3PGMA 1KFTA 3W90A 1DBSA 5EJ2A 1T6NA 2OCDA 3VZPA 4CLEA 3DMHA 2R66A 3I3SR 4GX1A 1ENOA 1Y8CA 4PN3A 4CMBA 1H8EA 5LP6C 1S96A 4YXWA 4QJBA 1MEJA 1K9VF 3DOEA 4DSAA 3C6YA 2DFNA 2FDXA 3E9QA 2RBGA 3DWGA 2W58A 1QP8A 4IDDA 3B9QA 1MNQA 1Y1PA 4UMVA 2OZEA 3QUBA 4I9NA 1ZVJA 2QY9A 4ED8A 2XLCA 5CD9A 4ND8A 3ZWVA 3IJRA 4TMVA 2XDWA 3SNHA 5L7TA 5CDFA 3A25A 1UMCA 4LFAB 5F3XB 3L01A 4PQFA 4YAJA 3KB1A 3DZHA 4AT1A 1HL7A 3GAFA 2DG2A 3HBJA 4HRXA 1DQPA 3OSNA 1VRCA 4DLBA 5BT9A 5G53C 4MW5A 4B4UA 2ZRIA 1PR2A 2IEDA 5HR6A 1GVNB 3R40A 1SIJA 5KCZA 2R6JA 3NM4A 1VHDA 4BZXA 3DFUA 4G6ZA 3BULA 4QARA 3SAGA 1QYVA 4QM6A 1XQWA 5DWQA 2VQEB 4M0AA 4ER6A 1HE5A 2WD7A 4PFSA 2BQRA 1Z3IX 4IZHA 2YN0A 1JHXA 8ICMA 1G21B 3WDLA 4CLDA 4ONEA 3HPQA 4QQFA 4QGHA 3W8FA 3AF3A 3KJZA 2DUUA 2VDUE 3STTA 4YXFA 3MVEA 3MGBA 3NFYA 2XVAA 1NI3A 3RFCA 1EHIA 3T3GA 1UC9A 2IS1A 4LDNA 2QUKA 2OHIA 4IY1A 4GX5A 4BRSA 5F7XA 2QTZA 2AFVA 1II0A 3PS9A 1TCUA 4JH0A 1ZJZA 3B7PA 2WWWA 1NN3A 2XMCA 2CGEA 4EX7A 4YRPA 3UGQA 3ADOA 3O3OB 2ZE5A 1CZKA 1VE1A 3KKOA 4BLPA 3OVMA 3IVCA 4NCIA 1F7UA 3V7FA 5A4DA 3UAGA 4LHZA 3QE4A 4BX9A 3DEIA 5IRCD 5JRTA 3T1QA 3DZIA 1FFUA 3SC6A 2QPOA 1RAFA 1QF7A 3EFOA 2YZKA 5EWLB 3U7FB 1Y9AA 3C39A 3L4BA 4CBVA 1Z7BA 3VU3A 4Q1CA 2IU4A 4ZMRA 2KP7A 3A3OA 2CLKB 4YWHA 1BQ3A 4KLFA 3LVFO 4U8GA 2HJWA 5WRFA 5A62A 3PDHA 3SEZA 3DLIA 1EWKA 5IK2A 3UPUA 4RTRA 1D09A 3PT5A 1I7LA 4FGJA 3GV7B 1UDAA 4BX3A 5EOZA 2VUIB 2CCJA 4C5CA 3BAZA 4UUOA 4FI3F 2LM4A 1FQKA 1XMPA 1NR5A 5IMSA 2HXYA 3N7AA 4DEXA 3OP1A 3ID6C 4FGSA 3TQIA 1W88B 2R7AA 3WLHA 1K7XB 3O92A 3GDWA 5J2GA 4R8RA 1JXAA 3F6YA 3MB8A 1XRSB 1LBEA 3IQHX 2P2LA 3LG2A 4O6VA 4EBFA 1KJIA 3MC1A 3KXPA 1S77D 1M6VA 4QBHA 1PSDA 2GSWA 2ZUBA 1CB7A 1IZZA 1KORA 3LCUA 4PCLA 3RUPA 3PW7A 2VF7A 3MTIA 3RPEA 5GZ3A 3GEMA 2DY1A 4TQUS 3V8MA 3IJEB 4C3ZA 3O8OB 2B1RA 5JFOA 2I1VB 3EXG1 4MPPA 4QXRA 1C41A 4N12A 2QXTA 4YCDA 4IZIA 4OYHA 4CLRA 1K5OA 1ZQKA 2QRNA 1A5BB 5DM60 2PBRA 4ZI2A 3WZLA 2AJTA 1SOUA 3HKZC 3PXDA 3FPSA 4A92A 1JI0A 4BGVA 2OVBA 2CDBA 4BNXA 1WXHA 2W42A 3C5GA 4P08A 1SIBE 5BMOA 2IJGX 1I7NA 4US8A 3KKLA 3OQ6A 3ZIAA 1MRZA 5L4NA 5CDHA 3QU7A 3WNVA 1DKRA 4YV1A 4OHFA 3U4CA 1N57A 5A2GA 4US0R 4KUEA 2ICAA 2VP4A 3S27A 2WJ6A 1C30B 4KRFA 4YAOA 4NE9A 2AT1A 4MUHA 4U63A 4D97A 3RYFB 5LZ2A 4EOGA 2PUGA 1RQ7A 3Q8KA 1ZGCA 3STHA 1QGYA 3TGWA 4ZOBA 4PZUA 3U37A 5ERXA 1JHPA 4FU0A 1VI6A 5KWJA 5AHWA 2O52A 5CG2A 1CQZA 1GTVA 4ZJYA 2TMDA 3W04A 3PWKA 1JDUA 3SDBA 2UXDB 3HO8A 5CAEB 3WV4A 3PG5A 3ZHRA 4M9HA 3AYXB 4WK4B 2J0QA 3TI9A 2I5HA 3LF1A 5BVGB 2OP1A 4TGLA 4HEJA 3BCRA 3RS0A 1JKJB 2ECFA 4IS2A 3CZRA 1E9BA 2CUZA 4OLBA 2CBGA 3HXKA 2JBAA 5E1MA 2J3JA 3LH5A 5C1DA 3AB3A 2IOFA 1OKKD 4MHOA 1C2YA 2XC9A 4NYIQ 2WYHA 1M34B 3RASA 4F6LA 3C3WA 4G67A 2Y1CA 4OHCA 4QC2A 4UHDA 4JYCA 2PH5A 1RMYA 5JMPA 2ZXIA 4K6MA 3OIVA 3EF0A 4BV3A 1BE8A 4EHAA 1HGXA 3KHSA 1V5EA 2NRZA 1NX6A 2HYIC 3IKLA 3FLBA 3KHTA 3HDHA 2DH6A 5EHQA 4PXAA 5CW2A 5C8DA 1D6NA 1O57A 3HXOA 5G1NA 4BUJA 2QU7A 3L0YA 5EVCA 5EUMA 4IDQA 3IUNA 4I08A 2JLZA 4MP8A 3MPOA 2HSEA 4URZR 2P1RA 3P9PA 4TWZA 2GCGA 4CIYA 4D8TA 1T8WA 5JXIA 1FNNA 4JBWA 3J81j 3WFIA 1V9LA 5U9CA 2VXOA 2ZXUA 2Q0XA 1XXHE 1I3MA 1KI2A 4G0ZA 4NCBA 2BJHA 5JQGB 4ROTA 4F1WA 4LDQA 2RJ3A 3IQXA 3R5HA 3FRHA 2ZVDA 4XSHA 4L0DA 1TAGA 5I9NA 1W85B 3OPNA 1JHMA 2WWRA 1VCMA 5F1YA 3DAFA 4G65A 4GLXA 2OFXA 3R41A 1H93A 4JVSB 1FYXA 3TUJC 3KEQA 4UAZA 3KKEA 5BWNA 1VYVA 2C7BA 1TJYA 3UKDA 4YAUA 1ZZGA 2QXYA 5FQOA 2C1ZA 1WCWA 4FNMA 1MEEA 1ND5A 3JV7A 4DCTA 3CJTA 1DKQA 1YFKA 4MGEA 4DUZB 1ZQQA 2F3UA 5E1OA 1NJFA 2QR2A 3JZMA 1HG0A 1K0FA 4PGAA 3EXIA 2GESA 4N3GA 3RYCA 4Z0TA 2GZRA 5BQPA 3TBKA 4K9NA 3KJHA 1N7HA 1NUQA 5IS2A 4FS3A 3Q85A 2J4CA 3FOZA 3BFJA 3BCSA 4PGXA 3T38A 4EJSC 3NVAA 2WU8A 3PRKE 2OD2A 1Y88A 3KEFA 1U0JA 2VQ3A 3HN7A 2KI5A 5LFAA 5AW9A 2FPMA 5B7NA 4DWWA 1F9EA 4FMDB 2JFWA 2WM8A 5ECYA 1L5SA 5TQ2B 3SZUA 2FDCA 2I2WA 1MQ3A 3T12A 3N97B 4JLDA 2C99A 3ICVA 5DLDA 1RT9A 5JDCC 4JMUA 3K0CA 4F9EA 1A71A 2X23A 3JSAA 3KVRA 2Z9DA 1U2EA 3A0UA 4C21A 4GD3Q 4MW9A 2RDMA 2CC2A 2HEIA 2OB2A 3RQSA 3UJAA 4F2PA 1NQ5A 1KQNA 4BC0A 4IV8A 3C74A 4QAQA 3GOQA 2WT4A 4ARAA 1UZAA 2JIBA 4CGZA 1EG7A 2I5PO 3A4YA 3EZ2A 2C00A 1EGHA 4F2HA 5AHXA 4OJLA 1CXZA 1DO2A 4BBZA 3RVLA 4NM1A 4YCLA 4YDHB 1W8IA 4CG1A 4NBSA 4BN5A 3VZSA 1NZJA 2QVCA 3V2HA 1JAXA 5J0TA 2GCIA 4HYEA 2E4YA 4MR7A 2WKQA 3FMIA 5GAJA 3WZMA 3ZXUB 2DKZA 4CQJA 4Z3KA 2ZSUA 2QU8A 1CF4A 1A0OA 3LRTA 3ZUPA 4KIWA 3SLRA 1EDDA 2JRZA 2F59A 1PVRA 2ID9A 2F8MA 4DZTA 3KTAA 3PEVA 4UFNA 1LI7A 4HPWA 1H94A 3P2OA 4A6EA 1QG6A 5LIPA 1GLNA 5DK6A 4OAOA 3SP1A 5FLEX 4QD3A 1IXRC 4LNUB 4QWCA 3I0MA 1UR5A 1W5FA 1HOXA 4RQ0A 2HHLA 1NJ6A 3U5ZB 2P65A 3QBJA 4KVZA 3FDSA 4NBKA 3D5EA 2DQYA 2PN1A 3VC1A 3BWXA 1ZJ5A 2YC2C 1KQGA 4XUSA 1CY7A 4ZT2A 2YR0A 3SHFA 2FZLA 1EGAA 3CXRA 2JR5A 2PL3A 3G9QA 1QH1B 2RD2A 3I9JA 1UBMS 4XX0B 5DB9A 1J20A 4ZK6A 4LS3A 4BNDB 3B5EA 1J7JA 4W9MC 4ED3A 5I01A 4CTJA 3M7IA 2MTBA 3MELA 1NVVQ 1CVRA 5FJIA 4DLLA 3KUXA 5TQJA 4R9SA 9ICNA 1Z6XA 1SHKA 1DAEA 4HAVA 2CY0A 3IOBA 4NCJA 5FOSA 2R47A 4DL5A 2EFYA 4PH5A 5DNDA 4WKOA 1PTKA 2V74B 5HIMA 4HRAA 4UEKA 2GJ4A 1MU0A 3DBIA 3V7UA 5B37A 1U81A 5DNCA 3HWTA 3DVRX 4D9CA 5CCBA 5A9SB 2O8NA 2CT8A 2C28A 1E2HA 3N6VA 1G8HA 4M1MA 1D2CA 4KQKA 2HU5A 2P9JA 3O4JA 4EW3A 3RSCA 5DYIA 1ZH8A 4PYNA 2PBFA 4DS4A 3SJCA 2WF6A 5KPJA 1E5LA 4L6CA 4EB0A 1KEWA 3C97A 2MYUA 2Q4DA 1L8OA 2O2XA 2JJ2D 2QL7A 5KHAA 3AHHA 2G25A 2QW0X 3UQ2A 5SY9A 3CVJA 1DIBA 2WVAA 3P4UA 1JR3E 4WESA 3MAGA 2JHFA 1X7WA 5ALPA 3AF5A 5D01A 1KAOA 3B6JA 3TX6A 2AIRA 1GTJ1 4DEYA 3WSWA 3QBVA 5BWCA 3PC3A 4Q03A 1ZM2A 5A7GA 4I29A 4WZ6A 1BXRA 4C0QC 2R1VB 3NR2A 4EGFA 4TS1A 3NO4A 4LGVA 4IGFA 3A9CA 1DBPA 4RZQA 2OEHA 3PD7A 3KL4A 1WUTA 5DSXA 5F5XA 4KPFC 5FPSA 8OHMA 3HILA 1KI6B 4KMOA 4UVDA 1YIAA 4LSZA 1GNTA 3DZ8A 3R5FA 4YT5A 2D5LA 2J48A 1T2EA 3KAJA 4M0CA 1L3CA 3TM5A 2MSCB 2HQOA 3W2EA 3ZR4B 3C41J 3BE4A 2KD1A 1VRWA 3H9QA 2I9GA 1XNRB 1MMFB 4G4IA 4HNAA 1EVKA 4BRUA 2YWGA 3CNNA 4RAQA 4W5QA 1V2HE 2C2ZA 4OFZA 1G66A 2I8CA 1OZHA 2GBFA 4NULA 4G0UA 1QO7A 2C2YA 1T9HA 5L3SA 2I4LA 2PEYA 3HFGA 5TPWA 4UBNA 3N8DA 2GCOB 3QVUA 2CXNA 3K9FC 1VG8A 1OX4B 3SQLA 1P1CA 2FMUA 1I10A 3O83A 2VWHA 4EHJA 3GEIA 3UANA 1AQUA 5A0FA 3QUCA 2A30A 5ECDA 2X76A 2DWCA 4QZDA 1A2KC 2UXCB 2ZSBA 4FJ0A 1OAOA 3JY6A 4XFDA 2HV9A 4GE0A 3EDMA 3TZLA 4C1BA 2B83A 1GG8A 5AR1A 1SZPA 5A0LA 5KFWA 4Q6BA 5ITWA 2HOQA 5HILA 1MAUA 2VC2B 3ZLJA 1PL8A 3H5TA 1J8VA 1VLVA 2XMBA 3JALB 4DM4A 2A3RA 5EHXA 4MUIA 4B8WA 2BBTA 2ZJ6A 4D81A 2FETA 4OQPA 2KIWA 1IV8A 2VHTA 5AIBA 5DYNA 4N18A 4CKBB 2ZGVA 3EXHB 1C7RA 8ICOA 4D42A 4UM9D 1ONOA 4FFPA 1AH2A 3RQIA 2VNIA 1TTTA 1RYBA 2ZIXA 5ICMA 4KSBA 3BEDA 3A6FA 1GDHA 3IN5A 1ORWA 1P9WA 3QW4B 3ELUA 3EMVA 3SFTA 1WCIB 4OJNA 5CW1A 2H4ZA 3ZK9A 2CLHB 1THGA 2W2VA 2AR0A 4J6FA 3VR4H 3EUAA 5AVVA 5SYMA 3L0SA 3PC7A 4JT8A 1JHQA 2YIJA 1VFNA 4I55B 3HKEB 5JXGA 3LP5A 3WOVA 3OZAA 2BSQA 3VU8A 5LA6F 4AJLA 2GF2A 1YR9A 4IIJA 2J9FB 2DQZA 1J2MA 1NW4A 1RWPA 2O0MA 2CLOB 5GGYA 1THZA 4PIVA 3LXRA 2MR5A 3VTFA 1N5DA 1Y6FA 3QVJA 1VZ3A 2IW3A 1E1CA 3DB2A 1MJGA 2EQBA 3HZHA 1Q1QA 4LOIA 5LXTF 5KYXA 2WTEA 4JD5A 1XKXA 3PX4A 1C0IA 4YACA 3I45A 1A76A 3FFTA 1VJ0A 5IIKA 1KZ1A 1TM3E 1OJLA 3ESAA 1WBBA 3QUSA 2IH5A 4WECA 3USZA 1WZIA 3RM3A 1SHLA 1YI0A 1P7WA 3CTPA 2QN1A 3VJKA 3J81A 4LCBA 3LBHA 3QBTA 3E84A 3QVVA 2ODAA 4DYVA 4MWDA 4DL6A 4AO6A 5JS8A 4MQBA 4W5TA 4Y6OA 1DC5A 3KALA 3DLHA 2Q1YA 1HUQA 2GVNA 2CVFA 3GWGA 1G59A 3CRXA 2UUOA 1H3NA 3KPYA 4MV0A 2XKJE 1Z0SA 4PLGA 3TN7A 1XTZA 1P8JA 4XARA 1NK4A 5ALLA 2YHBA 3H2SA 3I2FA 1L4UA 2HDOA 4MF2A 3LKDA 5KWVA 4F4CA 4MCAA 1G8AA 1V7ZA 3QYFA 2ZJ3A 5KAMA 4LQ4A 4JIGA 4Z9AA 5UKDA 4C1NA 2YW9A 4B6EA 3GN2A 4NYJQ 2ECKA 1X8LA 1QCYA 4RU9A 3OZXA 2ZIWA 2GN9A 1NBMD 3SLKA 4YT8A 1CSEE 4MIEA 2HMVA 3QPVA 1URPA 4CDMA 3RHSA 2XMDA 4BUZA 3LD9A 3SMVA 5AKXA 4GX0A 3H5IA 4AZSA 4IIDA 4JBNA 1J97A 2HJ9A 3H86A 4UDNA 1FJXA 1NF3A 3TOXA 1C8BA 4DR5B 2VJNA 3BGVA 3PUKA 1M2HA 1A95A 4IIYA 4D2IA 2C82A 2LDBA 1FNSA 3O4VA 4RCZA 1UP4A 4DQXA 4DQSA 1J2JA 1LSJA 3FSEA 4ASUD 1OA1A 1CK4A 5KNIA 3TAHA 3D6UA 5B3AA 4M8KA 3C16C 2J7PA 1V96A 4ER0A 4NFSA 4KGDA 4XLLA 3MMXA 3TQOA 2Z3WA 2JEFA 3PXBA 4R2JA 4TM7A 1F60A 5FI0B 3TAXA 1ISPA 1H1DA 2RI6A 4AWAA 4AULA 4BP8A 3DEKA 2QX9A 1L5NA 2E2WA 4HGNA 4AS1A 4IG4A 2LWIA 1OIVA 1LPBB 2E4AA 4H4EA 5IM5A 1QUEA 4ML3A 5LB2A 3SKYA 4B6PA 4MVYA 3F5FA 2I65A 4NQRA 1BPZA 5MN6A 1A7UA 4BFWA 1X9IA 4TTIA 3PEFA 1MAWA 3B82A 2JIPA 3EQZA 5J8YA 4DNPA 3B8EA 3NTVA 4UD6A 1MQ9A 3TCKA 5IM4A 3E6AA 4UHBA 5CCXA 1KK3A 2P9YA 3MTJA 3T5MA 1UBOS 2YVAA 1FJ2A 1QANA 2Z58A 5CBPA 4HDSA 1HTWA 2P8JA 5CB0A 1I8TA 1Z0IA 1HC7A 5KTRA 3MRSA 3ASUA 1YB5A 2LVBA 3E0QA 2JI7A 7ICJA 5JCJA 3ASVA 1V6CA 1NP6A 1FCJA 5IKEA 3U0BA 5JMTA 2OLEA 2Y4NA 1CVLA 1SVUA 5FNVA 3GZNB 1UIRA 2I6UA 1ISMA 1FIQA 1D8AA 2RGGA 4II3A 4YCCA 3M6KA 2XHEA 5HIKA 3P2MA 3JVEA 5TMBA 3FGNA 3PFKA 5EXPA 3K0FB 1CS0B 2Z0MA 2OLKA 2I6TA 1OGIA 3C6KA 1V85A 4AY2A 2TMKA 1OYWA 5K8TA 4Z6EA 1E2IA 1EA5A 4R01A 1HYHA 2PSDA 3ZHQA 4IUCS 3RROA 2H1LA 2H5EA 1UQTA 4B82A 2VTEA 1V3TA 4AL4A 3KM0A 3VUFA 1MX3A 1XJ5A 1KJWA 4RMHA 4C4RA 2BGTA 4OQQA 4KLTA 4ACAA 2Q0ZX 1O6BA 1HG1A 5FUYA 2FG5A 2PUWA 4UZEA 2PXXA 2DB3A 2BBSA 5KFYA 3BKWA 2M32A 5B4TA 5LMCA 4ZA2A 1XMJA 3BMXA 1MA0A 4YT2A 1XDBA 4Q82A 4MB2A 4I4CA 3RF6A 9ICGA 2QRVA 3S6JA 4V0MA 5MHTA 4FWTA 3N0WA 1FJHA 1TDJA 1AA6A 1XAJA 4IICA 1QCCA 2VJLA 3DVSX 3UAXA 1X8JA 1MAHA 3C3EA 5BO5A 1N5IA 5F77A 2XA1A 4BX8A 5TIIA 3KOXA 4TV8B 3ZDEA 2X9NA 3HV2A 4AG6A 1Z35A 3VZQA 5CHGA 4B7XA 2BM0A 1SGWA 1Z36A 1H6CA 2PI5A 3DKKA 1DBIA 4PRKA 1EK0A 3ZI4A 2PFKA 3GRUA 1YR7A 1ORVA 5EJFA 1QZUA 4BGUA 4CQLB 2P2SA 4H16A 3NHSA 1JAZA 1T43A 4ZI7A 3R7FA 4RFSA 1JIQA 2EKBA 4R4JA 3A6EA 3OIFA 2X4GA 3O2NA 4JV5B 4RD0A 3IR5A 1EP9A 1JA9A 2YFHA 1IJEA 2OCIA 2C94A 4C22A 3W9UA 1YR3A 4BEJA 3PHLA 4A8TA 5K0ZA 3N8KA 4Q39A 3LK9A 1E5QA 1H85A 5ES3A 5B3LA 5HCUA 4YRFA 1AKQA 1RQPA 4IMJB 1DBRA 3Q5GA 2GYWA 1AUXA 3HVJA 3F3KA 4QYXA 1VJGA 4JQOA 3D8RA 1VPTA 3G2MA 4KZPA 2DBRA 4JMLA 4H0CA 3E5HA 2VSQA 1U2TA 3FVTA 1SV0C 3V1MA 1Y3FE 2OV8A 3U6BA 5BSGA 1I1OA 1D2AA 3QHQA 1VLBA 3WG9A 3VV2A 9LDTA 2OB1A 3OLYA 3W06A 4A5OA 4KQ2A 1ECWA 2DQKA 5EE5B 4BDSA 3QTBA 2DKXA 3C5WP 4LSMA 4XWTA 4N8EA 1JR4A 3MWKA 5ADUS 2HY7A 4BS9A 3M1AA 1XDUA 1EWTA 5BN5B 2VPWA 5HHIA 3AR5A 1DC4A 5CDUA 3HL0A 1XZPA 1U3WA 1QNLA 3AIIA 3VNRA 4BWGA 2F3NA 5SZHB 2H2HA 4ENVA 4P82A 3KSMA 2HF9A 4F38A 1L4NA 3DE5X 5F2EA 1IFXA 3GD5A 4EGSA 2ILVA 4XDZA 1AURA 3G2KA 4RL6A 2ZPUA 3RK1A 3DNFA 2ESEA 3OU2A 4X1IB 5E9JA 4LJ5A 1F51E 1RCUA 2DCUA 3ACDA 1DIAA 1MO4A 3DXXA 3VDNB 3RRHA 4AM8A 2EJVA 3H0MB 4PPYA 4INOA 3UA4A 2IEYA 1M74A 2P6UA 2CDCA 1UBRS 2JJ8A 4L0CA 1A4UA 1WF3A 1KZ6A 5EJEA 4ZMSA 4IKPA 5HZMA 1AF4A 1V48A 2GHRA 5KNCD 1FDTA 7ICVA 2IYSA 2LZ0A 1A69A 3FE2A 3NJ8A 2FV8A 3QPUA 1ZQXA 4A4DA 5HKLA 1M10A 4JJ8A 3BB4A 2KEYA 3IX7A 1EJ0A 5JCPA 5KTKA 2H59A 1J2EA 3ZVNA 3KPWA 2BE9A 3L6DA 4NYMQ 5EWFA 3CQ9A 3NYIA 2PLWA 3I62A 1U80A 3RG8A 4Z49A 4RF2A 2AN9A 4MINA 3Q7EA 1PJSA 4JY7A 3WRXA 4BVGA 1R5JA 1CZHA 2CUTA 3OQJA 2FHSA 3H5AA 4B85A 1G8FA 5D7NA 5IVKA 5TS2A 3LLCA 4YVZA 3IIMA 3K15A 1GPMA 2A1IA 2IYXA 4C06A 4OGWA 2X5XA 3S1LA 1RPTA 2C2KA 4FINA 2GBLA 5KI6A 2X8JA 1Y37A 4L5IA 2QTVB 1DGQA 3ZHCA 3OE7D 1SBQA 1IG0A 1ML3A 2IUFA 4QQRA 2P9TA 3TPZA 2GYYA 5DBGA 1XUOA 3EEIA 5J0RA 1U2SA 2HN9A 4JZKA 2D1FA 4PE5B 1S97A 4V0NA 4FBTA 4B6RA 1XJWA 2X8LA 1KIAA 2C61A 5ADWA 2WUGA 1UXGA 1OX6A 3W9BA 1AD2A 1OF1A 3IURA 2FZEA 3HP4A 4CTNA 1VBFA 1UK9A 1JLHA 3VR5H 4RTMA 4MV5A 5IXSA 2R8PA 4IDCA 4CCYB 1LZLA 3DE7X 5EHZA 2G1JA 5LNK6 2JAQA 4I2VA 1WIWA 3G82C 3TTSA 1J2TA 1O03A 2JBWA 5C7LO 2OWOA 2X15A 1P2DA 2RK6A 3L1IA 2HH9A 3VH3A 2VRNA 4K5QA 2VJAA 5C52B 1TVKB 4WXMA 1HKUA 3TIIA 4BWYA 1DXQA 1OYVA 1GNLA 4UXIA 2OAGA 3UW1A 3FC4A 4B79A 2VEDA 3VX4A 2A86A 1GGNA 1QTMA 1QYRA 3HB1A 3S40A 1VCNA 2X40A 4GP6A 1SUBA 4ZU3A 3SIXA 1JFFA 1FLNA 1QYDA 3BHMA 1OH5A 3T6KA 5ARCA 4WFKA 4NXZA 2PXHA 4WBNB 2ANBA 5FWAA 4EBEA 3WLQA 4C4AA 1SCBA 5K0TA 3E4CA 3ITNA 421PA 1A0PA 4NEHB 4FZVA 1BFKA 5A9TA 4DJEC 3C29A 5B7PA 1L7PA 1PGQA 4Y6QA 5B1EA 1EE2A 2A0YA 2WSIA 5KT5A 2RB4A 2DPHA 3CXUA 1C7FA 3LWNA 2W90A 2OMKA 3V7LA 3STUA 2W5UA 4D44A 1XJQA 5F5NA 4HUJA 3JQQA 5KG7A 5CM8B 2HVHA 4O3SA 1ZCJA 2YHAA 1N0WA 2G1AA 4D8XA 4DWIA 3H7AA 3BS5B 5THQA 4L9WA 4N76A 2Q8PA 3ESCA 5HQJA 4Q12A 4LXYA 4EW1A 1AMOA 4HGOA 1P1RA 4ZCLA 1B4DA 1VIVA 3GQVA 4UM5A 2P2YA 2Y4OA 1XC7A 4EGQA 4K0KB 3GAZA 2YVQA 1F1JA 1KFSA 1OFTA 3BRQA 1LQTA 3NJRA 4ZQEA 2SCUB 2REXB 1ZSNA 2HHSA 4J7AA 3L8CA 5T3UA 1YQTA 4O2AA 2WHXA 3RU2A 3KPUA 3D3WB 4ALNA 1Y98A 1CUDA 1YJ8A 1E3SA 2P5YA 3O7WA 4FFSA 3WJ1A 3I72A 3QYPA 1FTQA 1BGWA 1H4TA 1WZEA 3WGIA 4RPGA 1PLKA 1PGPA 2ZDHA 1JQAA 1MQSA 1Z7GA 1I5EA 3AQ4A 2IQIA 3NC0C 5G4LA 2AZDA 3I4FA 3L82B 3TSAA 2XNHA 4NZNA 4F4XA 2JCYA 2PNJA 4J1TA 2F2AB 3ZYCA 1AQYA 2VBFA 2B1GA 3BBPA 2G36A 3K2IA 3FKSD 1I3CA 4ZOCA 1KZYC 3FCSB 5CFZA 4KH1A 2JI8A 2OL4A 4IRKA 2MSEB 3T3DA 4B4DA 3MW8A 3NDIA 4HNHA 1J25A 2OAEA 3AF4A 1U6IA 2RHGB 5IIMA 1YO6A 3G89A 1IAQA 4U1RA 3BD6A 1I2BA 1X2BA 4W5JA 3LLUA 5HBRA 4BNMA 3LYUA 3TJZA 1QORA 3V4RA 1M8GA 1E2PA 4MW7A 1GYPA 4XAQA 2EW8A 2QUIA 4YR2A 1LVHA 3WLSA 3RWBA 1JIJA 2XV1A 4KPUB 2V8BA 2PVCA 5J4YA 4IQGA 1GYQA 3DHNA 4WGFA 4Y9UA 1A9XA 4G1EB 3LAWA 4IQ4A 4W9NA 2PWBA 1PUXA 1Q1AA 3OF2A 2PZJA 4BNVA 2P1DA 4EJ0A 2BMJA 3VI4B 1WPQA 3HI4A 1T10A 3DD5A 4Q3CA 2YRXA 4F46A 2I3DA 2J67A 1SIWA 3SQMA 2XMQA 3K9BA 4YRZA 2W3SA 5F3WB 3OJ0A 4W1PA 4JLOA 2AG1A 4IGKA 4PNEA 2IXAA 3OJXA 2GZHA 1GNRA 9ICOA 1EE9A 3KHRA 4MLDA 4YJ3F 1L8QA 4M0EA 8MHTA 4BFYA 5E6UB 1DOZA 4Q9KA 1KE2A 3U4DA 1S2OA 4K2HA 1PUZA 4DB4A 4WCVA 3S2FA 1XWLA 1QAOA 3U1TA 2I2XB 3OCVA 4MLZA 1H65A 3MQ4A 3EVTA 2W6CX 4XD7A 1DBVO 5TEVA 2GD2A 5FTWA 1DTWB 3I12A 4L2IA 2HCJB 3IMCA 1GL6A 2HK8A 3CHYA 4WNCA 3F78A 2VYND 1GCGA 5CA0A 1JEJA 3TVTA 4P7JA 4K3VA 2F17A 3FWNA 1Y9EA 3LGXA 4G8DA 4HX5A 1F6WA 5HQ3A 4JLJA 4AWXA 1NF2A 4EGCB 1IN5A 1ZGAA 3DWEX 4HO1X 2PH7A 3LSYA 1UM9B 1ZN8A 1J22A 3JYQA 3HUUA 3TOCA 2HCFA 4XVQA 3QQ5A 1K89A 3BWVA 1J0EA 3IYLW 4JLSA 2OV3A 2P0YA 2P5TB 1KKUA 5GZ1A 4MGZR 4H6PA 5KCMA 5G41A 2IZ1A 1N77A 3BJIC 1CUEA 3DC7A 4J7UA 5C8YF 3TLZA 2AX3A 3WL7A 1RXSA 1JEAA 4YJKA 4ON9A 2PR7A 3CLUD 1C9JA 3LCRA 4P7FA 3K31A 2O2GA 5KNDA 2BFPA 4KGXA 1JDNA 4MOWA 2ORED 1GTG1 3LUFA 2P62A 1GXSB 1A2QA 1C1XB 2CF6A 4Q7MB 4F1JA 3COVA 4OHXA 4MDEA 4OKSA 5GTHU 3GGCA 1LPAB 2ZS9A 5K6AC 4WUTA 4DJJA 2W7OA 5CA1A 2YZNA 3N7SC 2VNAA 4J9NA 2V6JA 3FMOB 3ZDXB 4M99A 4QUJA 3JPTA 1QX4A 3TG8A 3N8HA 3T99A 5CDGA 4ZIRA 7ICKA 4AJ4A 1EZ4A 1BGXT 4HH1A 4FD2A 4KYTA 1KBZA 3ZQUA 3LTNC 1LLDA 4MW6A 4O63O 3GLFE 1EX7A 4KE6A 2E5SA 3RO7A 1MABB 3LQYA 4N7MA 2QZZA 3PMNA 1J5PA 4RBNA 1PL7A 4JVNA 5KNBH 5DT2A 4DUGA 3O1HB 2KYRA 2VATA 3N8IA 4QBKA 5I4CA 1HT2E 2ZWOA 4JLWA 3W5BA 3AUOA 2PXIA 1XAIA 3TW8A 3SZMA 2HHQA 1LH0A 5HGJA 3VHLB 4Q7KA 1OVGA 3SSAA 4IDAA 3OH8A 2OAQ1 5CYOA 3SSNA 3L93A 3UOAB 3OSZA 4H15A 1E2JA 1OW5A 4TL9A 4CG2A 2WLTA 4NMXB 1J2NA 1DQNA 3HNPA 1P0QA 2QTMA 3DV0B 4Y2RA 5BMVA 2NTNA 5E8RA 1SKYE 3M82A 3AUJB 4YYZA 1CJBA 1QLNA 1P9NA 3E1GA 3P4XA 2BDEA 4YCJA 1QX3A 4IO1A 2I1QA 5ESDA 3D59A 2AN3A 1V43A 1JP7A 1IMJA 1YDMA 2X8BA 3EIWA 3E81A 2GK7A 2E5LB 4MVJG 4U7HA 3RYHB 4QEZA 4A27A 2QAGC 3CZPA 3D3JA 3T7IA 2XRFA 4L51A 3HBAA 4IIHA 2NZWA 2C3PA 4LZNA 4PR3A 4NCNA 3CH5A 4F8JA 2PLFA 4BMYA 4E30A 1PTJC 1B0AA 4NQZA 1ESDA 3OOEA 1B2RA 2VSOA 5EHGA 3GRKA 1Y3DE 3KYDB 2WVHA 2RONA 1P0PA 2Z83A 2FYTA 4O5OA 3FA2A 1F9AA 4Q8FA 2WB2A 3FCXA 1IJKA 4EYOA 3ZEIA 5KVCA 1NXQA 4PXYA 4LGYA 4KK4A 4X66B 4X90A 1G6Q1 5F2OA 3KELA 4C2UA 3ROPA 3TKAA 4MEAA 1IN8A 2H0AA 1BH6A 2ISCA 1ZUNB 4NFYA 1O97C 1K8QA 4OJKA 5IUNC 4RTLA 2M1XA 2XEXA 4C8KA 4C43A 1PX2A 1RI5A 2X4DA 3HB9A 2ZG6A 2AGQA 3T5CA 4L07A 5DGAA 1EHYA 3O4IA 4R3UC 2WF9A 4Q45A 4K26A 4WX2B 3V46A 3OFNA 3FN4A 4HD8A 5B7QA 3PEEA 3NH9A 3LXXA 4LC9A 4NMLA 1GOTA 2PX5A 5EE3A 1XYVA 3ADPA 4AW9A 4F8EA 5JW6A 1JUDA 1JJ7A 1A2OA 4KU4A 1GGJA 3NANA 3FR8A 5BURA 1HDIA 4IUBS 1JS1X 1WNTA 2VP5A 1LW6E 5FI3A 3PIDA 3K6SA 1RXEA 1UBNA 2ZQ5A 2QVBA 4HDNA 2ZUSA 5KFDA 1R4MB 4P86A 1JRLA 1D2EA 4G5FA 3HNOA 3AHCA 3W2HA 1DKOA 3Q6NA 3S2GA 3B5JA 1JI7A 1PFVA 4FYIA 4WZBE 8ATCA 4BMSA 4BJ6A 5ALOA 2OZLA 2BBWA 1KL7A 1JG7A 1QC5A 1X9SA 2VQFB 3RRNA 3B51X 3MTGA 5EUQB 3BUSA 3C6MA 3KCNA 4JHLA 4G24A 3TINA 4WW0A 4E5VA 3B3FA 1HETA 1NDUA 5FL3A 1Y8QB 5IWCA 2Q49A 3L7BA 1B1AA 3L7MA 4CG0A 1QHNA 2H5JA 5E2IA 2PAAA 1IDN1 1VL2A 3HJBA 3MBOA 2W70A 4FSDA 1Z0DA 3A31A 1BXZA 1TEXA 1KRXA 3JQGA 1XP8A 4QPCA 3PX6A 2O1SA 4RZ2A 1BVYF 4C6TB 4XZ3A 1KTQA 1W44A 5DWVA 2GZ3A 1P2GA 5BUZA 4PGMA 2GEVA 5B64A 1YVUA 5ESXA 4BMDA 1QIDA 4M1EA 1RLIA 5AUNB 1RRVA 1ZOIA 5CJPA 4QDXA 4ZJPA 3TEFA 1W94A 5D7BA 3O4RA 1CB0A 1JECA 3PHJA 4G4SP 3B3JA 5DEIA 2VANA 1JEEA 4C4ZA 5E7JA 2VN8A 3DDCA 1FVOA 5D1NA 5FUXA 5KT3A 4F7WA 2G83A 3UXYA 1P5FA 3L8EA 5J0WA 2JEYA 3Q11A 1EZ1A 1JKXA 2QX6A 8ABPA 2OBNA 4CM5A 2DMRA 4E6EA 1NVXQ 4AN4A 5FD8A 4KO4S 1Z0ZA 3WO0A 2HPVA 3FZEA 2AJCA 5LOVB 4X41A 1RWKA 5IYZA 1RPJA 1O4VA 1BDJA 3OOWA 1QH8A 4BNHA 3A2KA 3OIUA 1GAQA 1TYDE 2FFHA 4CLHA 4MVXA 2X2OA 3N53A 3WMEA 3CC8A 4FIDA 1XVUA 1LDGA 1PLJA 4DUYB 3DL7A 4G9GA 3IP3A 3V4SA 4IL6U 3I1YA 3PO5A 1E9VA 2GASA 2FPWA 1TYAE 2OXRA 4AX8A 1OTHA 1SD1A 1T0PA 5AJHA 3P9QA 3OCJA 3I53A 1JFLA 3UXHA 1PGOA 2JIQA 1IZ0A 3MTEA 1RQNA 3I76A 2FPIB 4QUGA 5C0YA 4Q4AA 1D03A 4HC4A 3CRQA 3F5MA 5K51A 1ZUIA 1DLJA 1G63A 2XB2A 1QFMA 3H0LB 3HUEA 4FS8A 4QUDA 2O3QA 1L5GB 3H9BA 3OTOB 1LY1A 2BUBA 3GRCA 2CRXA 1QGUB 2IF2A 5HF6A 3NIBA 4LHSA 1WUDA 1ZN9A 2FPSA 2YV1A 4OBBA 2XZPA 1FLAA 4RUCA 3EMBA 2QZ9A 4P3KA 4A6PA 1ZYUA 3RB3A 3L1JA 4MRAA 1OZFA 4D9GA 2ZSFA 4YG2A 3ZJYA 5CDTA 4EW6A 4C08A 2HOFA 3KNZA 1MT3A 1OU0A 1RD4A 1Q16A 2E18A 5DOVA 1KMHB 3WYEA 5LN1A 3H1FA 1RYYA 1RQ2A 4L08A 1ZQJA 3PFCA 3HYSA 1TTQB 2D1TA 4QBIA 2J3LA 1GR0A 1I2CA 1G3QA 2JF0A 2W2LD 2GF9A 2OKGA 1G64A 2CMFA 1CEYA 1ZM7A 1VA5A 3I9FA 4DKJA 1TMOA 1T0JB 4HKTA 4RIFA 3ELYA 3AEUB 4EUHA 2FDRA 3T7AA 1EIWA 3A36A 5JZ9A 1QV6A 1XPJA 4JB3A 3H2JA 1CQJB 2CV1A 4XTCS 1CZOA 4PO9A 1XK6A 3KZKA 4JP5A 4ID3A 3B2NA 2FR0A 2RHTA 5DRYA 1E6UA 4J91A 4Z6KA 4D4IA 1D9XA 4ZOQI 3KT8A 3ICPA 1R0BA 5C32A 4FDUA 3NBYC 3P5SA 3VOTA 3V6KA 4DG9A 3QKUA 1ICIA 1NUAA 2ZR7A 2PQ6A 3H9JA 4G0WA 5LQUA 1I7PA 4ENTA 5TGDA 4J0FA 1WMSA 4AP5A 2WU4A 5J9FA 8ICEA 3B85A 1AKRA 4H3HB 3A4TA 4KJZA 2ZRMA 2GN0A 5T64A 2R00A 4CUKA 5HW0A 4DL4A 5AQ1A 5H80A 1X3SA 2BH9A 3LUKA 4V3BA 5EZYF 2VRCA 3Q6IA 5BNTA 4ARIA 2AOTB 3BRCA 4Y9SA 1NXXA 1YIOA 4OJQA 3EYWA 2BKUA 3BFVA 4J7CA 2G1KA 4MWEA 2Q9BA 4TSFA 2ZM5A 3A0HU 3K09C 1A1SA 4TROA 1HH4A 3EK2A 1GT6A 4XPIB 2G9ZA 4DF3A 1SUPA 2FUG6 2P9BA 3WQQA 5HP4A 3U3KA 1EU1A 4C07A 1IN1A 1RLJA 4JSYA 1QV9A 5KFPA 4YMIA 4A8HA 1I6MA 1WXGA 1EESA 1XL1A 1QYWA 2ZCJA 1QHGA 4MAFA 3WYCA 5FYDA 4QXPA 4IOLA 3MXOA 3DD1A 1YHNA 4I66A 4P84A 3CFYA 2QRLA 4L8GA 1M7GA 1FVXA 2ZS7A 2AQKA 4I19A 4KN4A 3FGPA 5BVHA 2B35A 3HBNA 1A8HA 3JTMA 4W6QA 4RVDA 1SURA 2AFHE 1D0VA 2ZT8A 1H2EA 4HQ0A 2Q6KA 1HEIA 4HQFA 3ELWA 4UATA 3KHLA 3K05A 4UNRA 2CCKA 4GXQA 2QMYA 4ZCQA 1BKYA 3RFFA 1GZ5A 1H2RS 2GRAA 3GXBA 4OJ6A 2G80A 4XWGA 1F2VA 4KK3A 3GHYA 4Q6WA 2Q7XA 1UDBA 2FSSA 3OZUA 2C9ZA 5K1ZA 4YD2A 2G1UA 7ICSA 2JHCA 3HJCA 3V55A 1ZD1A 1OLSB 3DNMA 2PUAA 4RIEA 1YASA 4R1SA 2XX3A 2RK4A 3THWA 1Y4DE 1S02A 3AILA 3D6VA 2BMWA 5CFNA 4ZTBA 1JR3D 3IKTA 1ZK3A 2RJNA 4LW8A 2AFIA 2X2FA 2ZJZA 4QW8A 2W6JA 4DADA 1FLVA 3QEJA 3WQSB 4KPYA 2CFSA 3ROGA 1EUDA 3BD7A 3EGOA 3WRYC 1WB9A 1GQSA 4AB1A 1TIPA 3BRWA 5GPBA 2WZQA 4MARA 4OQFA 1XDDA 2A8YA 1Z5OA 3Q9SA 2Z4RA 4KVGA 1MT0A 1QDLB 4Q4JA 4ZVOA 1QDEA 3ANSA 2Q2OA 2VPYA 1NRIA 1TKCA 1I9GA 2H7CA 1WCYA 3A2NA 3EBOA 4GM1A 5JDIC 4B3IA 3FPGA 2V7QD 2VPIA 1ADJA 1MEOA 4K0RA 2N1MA 1OT5A 2CMDA 3W1WA 3IEPA 4X1KA 2OCYC 2P2CA 1WF6A 3KYJB 1QWSA 5E3IA 2YIMA 2HFJA 4QZHA 5IAGA 3CNHA 4Z1MA 4DGSA 5AUQA 3IDFA 5HFNA 3TJRA 3LWZA 4GLLA 4YAIA 5I9TA 3OPYA 1C0EA 1N2HA 2XYQA 2RH9B 3JRNA 1RXCA 4O02B 4TRRA 3ZQKA 1T6BY 3BDIA 3RR2A 2IX3A 1N6NA 3JQ9C 5I5GA 3V2GA 1TA0A 1OLUA 3BDAA 4IXNA 5ESWA 4ZQIA 1Z0AA 3K9NA 1TTHA 4R9UC 2M6LA 2AMJA 4WZAA 1GQ2A 2O6KA 2KICA 4YPOA 5MDHA 2IXGA 2WPDD 1ZK1A 1FRFS 5L3RA 1O96A 3N0XA 3ZU2A 5DASA 2YZGA 2QLMA 4ICIA 1K68A 3H4TA 3DFKA 3BCUA 4G5HA 5BP7A 4S05A 2IYYA 4JK3A 2BONA 2YXDA 4NM2A 4W1SA 2XODA 4ME6A 4XM2A 2CE2X 2IHVA 4O1IA 1NJ1A 4DV4B 1PWXA 5KSPA 2ZTCA 1Z0JA 5AK0A 4RH3A 3R9WA 1FXUA 4P2BA 3RANA 4YN3A 4QXAA 1IEXA 5I7FA 2DEUA 4FUTA 3T1TA 2X13A 3H3JA 4LBVA 4NU5A 3U49A 4IL5A 5F1OA 4Y2YA 1ZUD1 1Z4KA 1M3SA 3DA8A 4TLDA 1GKKA 2BM1A 1WOYA 1ZQSA 1PN3A 3RAGA 1DX6A 3G79A 3V8BA 3KKAC 3UMMA 1N62A 1IXYA 2PKQP 3FYDA 2G08A 4IJQA 2RKBA 4OB6A 4E13A 1WL8A 3T1VA 1EVJA 4ZDWA 3RVNA 2DFLA 3ZXYA 2GNAA 2L69A 4WCFC 4BEBA 4NOKA 1M5TA 3RB8A 4JVMA 1ORTA 5FLKA 2H92A 5ITZB 1GRNA 1Z6QA 4UHEA 3QI2A 2A92A 3Q87B 4IDNA 3AEXA 2R6FA 5DGXA 3BB3A 1IL0A 4RQUA 2RI1A 2FUCA 2FVXA 3FDXA 3KFXA 5C2JB 1Z2PX 4HMOA 5KFKA 1DP4A 5JRDS 1GPBA 3CN7A 3PSIA 1Y5NA 3IM1A 4F5YA 4J76A 3VKWA 4RF3A 1IWOA 2OGWA 1RRCA 2VAVA 4ZRMA 4IMRA 2AVDA 4PLPA 3BE6A 1G21A 2BEUA 4YLYA 3RTEA 3BCHA 5C35A 2HL6A 1B14A 4ECRA 2V0CA 3C6QA 4I5DA 4H7IA 2X42A 4YN4A 1USIA 3UK2A 4DQLA 4DAOA 2QD3A 4B9UA 2FZ4A 4ZEVA 2CDRA 1UXKA 1PDVA 1J2UA 4LQDA 3D0RA 5EIOA 3WB0A 4J0JA 4BE9A 3TL2A 3DOHA 5PGMA 3CX3A 4X6YA 2GI4A 3AKDA 3VO9A 4NIMA 1BEUB 4GNKA 1J42A 1QK4A 1DPGA 2FFQA 4P4GA 2Y6UA 3IAFA 1A50B 3R6WA 3EZ9A 1R8QA 2XDAA 3FB1A 5AVXA 3SHOA 3G0HA 3BC1A 5GVSA 1GQRA 1N34B 3UMRA 5JSFA 4RK4A 3IE1A 4Y30A 3AXSA 4N5NA 2X2EA 4PTZA 3QZ8A 1IJFA 2BEKA 3L4JA 4HQ6A 2QGFA 4FUQA 5EWLA 1N4DA 4DLWA 1Z6ZA 1T13A 1KXJA 1OE0A 5IAKA 2CWDA 4EIWA 3QHPA 3SPXA 4DFMA 4KDFA 1U8ZA 3B7GA 4G5XA 3KXLA 5BV0A 3T79A 3VPAA 4KQ9A 4WVFA 3LBFA 1CUZA 3R3UA 4UOZA 1B8OA 1I4OA 2OC9A 1IHDA 3T1NA 4MR8B 2JLYA 1VJTA 3F97A 2VHVA 1I9CA 4JN6B 4PM4A 4O4LB 1AXRA 1G42A 4EECA 5C4GB 3OZGA 1W88A 4RMGA 4F56A 4HEA1 3WMRA 2UVVA 5JWRA 2KZ3A 1EFAA 2WNSA 3BT7A 1P7DA 3O0DA 3NOVA 3W5UA 3HDTA 1Q0QA 4RZXA 3H4IA 1BS2A 1NTRA 1PR6A 1KKXA 2JGAA 4F72A 1Y5LA 3VDXA 1X9HA 5HKKA 2E4UA 3DXZA 4L7VA 4D9KA 2BCRA 5M29A 4CFYA 4DNFA 2ATLA 5KYUB 2XE4A 5F64A 2ZZMA 4FR0A 1QQTA 3WLAA 2ECOA 3DLTA 2ZRGA 3IHQB 4MQ5A 1V2GA 3VR6A 3O8OA 3SCZA 3HB4X 3KETA 3OQHA 1QK3A 1KR5A 3ZXSA 1ADFA 5LC1A 4BGEA 3IMGA 2JANA 3C2LA 1DIOB 3EDQA 4R63A 3MLEA 5F2KA 1IY9A 3F7OA 4XGNA 3L7DA 2VPQA 3UWDA 3M2TA 4Y98A 1Y6GA 4JUZA 3GW8A 2R1ZA 4EYQA 5C5CA 4KREA 3ENWA 2ODPA 3PDWA 1N7IA 4UBJA 1WW8A 3JWPA 3S8MA 5HOEA 2J85A 2PD6A 2G0NA 3GFGA 3UMYA 1AHPA 3DBLB 4JV1A 3LKZA 1IHOA 6NULA 4ZT5A 3DE4X 4DF8A 3ESYA 4LZPA 4R6XA 1C30A 3ZZTA 1OY1A 3DEZA 3GIWA 4L22A 2C5AA 5C0OE 3SEAA 4WPGA 2HHUA 5F98A 1T4MA 4ISCA 4DIFA 2C95A 1AB6A 4KVAA 5F23A 1A1VA 5EKTA 1TAMA 2P9EA 5JSYA 2A14A 4ZZ2A 4ND5A