3QU2A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
b'KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu2A01
5AKYA 1WVIA 3EF1A 5AM0A 4UMEA 5ALNA 5E0OA 3SF0A 1ZD3A 4GXTA 2YMLA 3TLMA 4JB3A 2P9JA 2WF5A 3W5CA 4DFDA 2ZBDA 1L8OA 1YS9A 5ALXA 5ALYA 1YMQA 1YDFA 2WF6A 4L6AA 4UW9A 4Y2UA 2CFSA 2IOFK 3WKCA 3FPSA 4L6CA 1FEZA 1L8LA 3ESQA 3WK8A 4YCMA 4EENA 3ZTYA 1N8NA 2YJ3A 2W4MA 3PGLA 2DQSA 4OHFA 2FPSA 3SLRA 2C9MA 3OCYA 4Y2YA 4AS2A 3KBBA 5ALIA 5A3RA 5AIBA 1SU4A 3W5DA 3UMBA 1CR6A 3WK7A 2EATA 4NFLA 4HGOA 4I9FA 3FVVA 5AVZA 5AICA 1CQZA 5AVYA 3KD3A 1T5SA 3B9RA 5AK6A 2Q4RA 3P96A 3IJ5A 3WK4A 3PGVA 3DNPA 2GHTA 5ALFA 2G80A 4NWIA 3RFUA 3NRJA 5AHXA 2W11A 1J97A 4CNQA 4YGYA 3ZVLA 5AI8A 3OCXA 5AVXA 2WF7A 3WGVA 2ZBEA 1ZRMA 5T41A 3AR2A 5ALJA 1YNSA 4EZEA 3QU4A 3M9LA 2G1AA 4KNVA 3AR3A 1J8DA 3QNMA 1TJ3A 1VFPA 1RC8A 3A1CA 2JARA 5AW1A 3EPRA 3SMVA 4Y3UA 2YJ5A 2MU1A 2IOFA 3DAOA 5AESA 1TA0A 4KYTA 5ALSA 4Y2PA 2C8KA 5AW8A 4RETA 1QQ7A 2G06A 3QU2A 5AM2A 2P11A 5ALDA 3OCWA 3A1EA 1L7PA 5AW3A 5AI6A 4JDPA 4NV0A 4Y2QA 1Q91A 4KN8A 3WKDA 3F9RA 2B1RA 1Z4KA 1YV9A 2B1QA 4L57A 4C4TA 1RLTA 2FEAA 2RAVA 4QJBA 4ZEVA 4CE6A 2P69A 4BBJA 1S2OA 2HHLA 4G63A 3D6JA 5AM5A 3QYPA 1VJRA 3NASA 3ZWKA 5AKXA 3PCTA 1XPJA 2HSZA 4AS3A 3N28A 3QUCA 3N1UA 5ALRA 2I33A 3SHQA 1NNLA 3L8HA 4CF4A 2VKQA 2FPRA 3DV9A 1PW5A 5ALVA 2BDUA 2HDOA 2FPWA 2OYCA 4C4SA 5ALKA 3ZW7A 5FP0A 4EELA 2PQ0A 2B8EA 3WK9A 4IG4A 4Y2VA 2YFYA 4UM5A 3BWVA 1NF2A 2I55A 1RLMA 4NAVA 2C4NA 2YJ4A 1RKVA 2AUTA 1RMTA 3AR9A 3OTQA 2JAOA 2R8ZA 5AM1A 1RLOA 1QQ6A 2FPXA 2HCFA 2OA0A 3E81A 1U2TA 3ZTWA 4XPZA 3QUBA 2AMYA 3FGOA 2HF2A 5ALWA 3BA6A 1LTQA 3CZ4A 2HX1A 4NABA 3L8EA 2WFAA 4EEKA 1O03A 2NO4A 1X42A 3AR8A 3ZVNA 3E84A 1ZS9A 5AVTA 1T5TA 1Z5UA 4KNWA 1TE2A 4EX7A 4J03A 3ZI4A 3FZQA 5AW7A 3NANA 3S6JA 3QUTA 2JGAA 3NIWA 3GYGA 2IA5A 2WHEA 2C8LA 5ALTA 2G07A 2AGVA 4YH1A 2C88A 4C4RA 1VJ5A 2CN1A 1Y8AA 1RRCA 3I6BA 2YMMA 3NALA 3UM9A 3WKBA 4OD0A 2EARA 3L8GA 3KC2A 1U02A 3ZWDA 2ZXEA 5ALHA 3WKEA 4YIHA 3KZXA 4RESA 4ZEWA 1S8OA 2AH5A 4IFTA 3ZU6A 1Z4OA 4HGPA 2PKEA 3QXGA 2G09A 3WKAA 3I76A 2HO4A 4UU1A 1U7PA 4CF5A 1TJ4A 1L7OA 2GO7A 4Y2XA 5AW6A 3HLTA 1O08A 3R4CA 2HEGA 5AKLA 3QGMA 5AW0A 3L0BA 4HGQA 3L5KA 2D2VA 5ALZA 2OBBA 3QX7A 1U7OA 3N5KA 4BEWA 2WF8A 3E58A 2YBDA 3U26A 2YMQA 1LVHA 3NAMA 1RMYA 3OCZA 4BYGA 4UM7A 3QU5A 1QQ5A 1EK2A 2FUEA 4BKMA 4I9GA 4FFDA 1Z4MA 3J7TA 3NUQA 1N9KA 1RDFA 2Q4TA 3I28A 4QQFA 2YJ6A 5ALLA 1K1EA 3FPBA 2R8EA 3EWIA 1RKQA 3OCVA 2RBKA 4PNHA 2NYVA 5AW5A 2GMWA 2HI0A 2GHQA 4DW8A 1Z4QA 4XOUA 5AI0A 4Y2TA 3ED5A 3W5AA 1XP5A 5AK3A 3U7EB 4HAIA 3ZVMA 4OCZA 5IT0A 4G9BA 4MWOA 4J2TA 3HYCA 4UMVA 4H1WA 3K1ZA 1WR8A 3CNHA 5AK4A 5AI5A 3WK5A 1Z4JA 4B6JA 4Y2SA 2O9JA 3RF6A 2NO5A 2O2XA 1XVIA 3QU9A 3UMCA 3MC1A 5AKKA 3L8FA 2WF9A 4XQ0A 4ZEXA 3EF0A 2B0CA 5ALGA 1Q92A 5AI9A 1IWOA 3L0YA 1Z4NA 3AR6A 5AVSA 1ZD5A 2B30A 1U2SA 2I34A 3M1YA 1ZD2P 2ZG6A 1YJ5A 3ESRA 3W5BA 1L7MA 4Y2RA 5AK5A 2FI1A 4BNDA 3I1YA 4BX3A 3QLEA 3U7HB 5AVQA 1RPZA 4KX3A 2ZBFA 2OM6A 2JAWA 5AW2A 2RB5A 1F5SA 3IRUA 2X4DA 2IYEA 4UAVA 1Z5GA 3QUQA 4UMFA 4YIKA 5A3SA 2FPUA 2FUCA 4DWOA 2QYHA 4FE3A 5AVRA 2BDEA 2CFTA 5ALUA 3U13A 2PR7A 2EAUA 4HYTA 3WK6A 4MUMA 2ZOSA 2YY6A 3A1DA 4OFZA 3VAYA 5JJBA 3AR5A 3AR4A 5ALQA 3ET5A 3ONNA 3AR7A 5AM4A 4BX0A 3ZUPA 3B9BA 4GIBA 4UAUA 4UMDA 5AIAA 3PDWA 3SKYA 3ZX5A 3U7GA 4Y2JA 5ALMA 5AKIA 4UARA 3L1UA 3KOOA 5AKZA 5AKHA 2I6XA 4UU0A 1ZJJA 2I54A 2YN4A 4O8CA 1Z4PX 1SWWA 1WZCA 1RQNA 3R09A 1KYTA 4EX6A 2ODAA 5AVUA 2FDRA 4YCLA 3R9KA 3OPXA 5AI4A 3ET4A 1NRWA 2B82A 3ZX4A 3QU7A 3DDHA 4UATA 2I7DA 2GFHA 3E8MA 2G08A 3WGUA 2P27A 4FYPA 2BY4A 2RARA 3IB6A 4XE5A 4F71A 1Z88A 4BNDB 4BEVA 1AQ6A 1EK1A 4AP9A 4E88A 3B8EA 2YMPA 2HF7A 1ZD4A 2R8XA 5AW4A 5A3QA 4UASA 2CFRA 1Z4IA 4YCNA 2R8YA 2QLTA 1Z4LA 2G0AA 3L0CA 2MSNA 5IT4A 1QH9A 4F72A 3L1VA 2IOHA 5AKEA 3SD7A 3N07A 3KDPA 3U19A 2MU2A 1L6RA 5ALPA 5IS2A 1RKUA 3U7FB 1RQLA 5AKGA 2HOQA 1TJ5A 5AKJA 3L7YA 2W43A 4HGNA 1WPGA 1SWVA 4DCCA 5AVWA 3MMZA 1ZOLA 1L7NA 2B8JA 3A3YA 1ZRNA 1T9ZA 5ALEA 3OCUA 3MPOA 3N8GA 1QYIA 2ZBGA 4HGRA 2Q5EA 3FM9A 5AW9A 5AM3A 3MN1A 4BX2A 4CF3A 1MH9A 4KX5A 1RMQA 1JUDA 5ALOA 5AVVA 3UMGA 2WM8A 3SKXA 2JAUA
chains in the Genus database with same CATH superfamily
3TINA 2SICE 4WVFA 1MBZA 1SPXA 2IPMA 3SDBA 3DZJA 3SF0A 4G8BA 4EJFA 3PD1A 2AXPA 3DTVA 2H3QA 2FFQA 5ANRB 3AL3A 1VA5A 1N9GB 2O8FA 2QSJA 2Y9TA 2GYWA 1OX4B 1NJSA 3LSYA 1YUNA 4B9TA 4O3FA 3TOVA 3PNQA 2FSVC 3FVVA 4FN5A 4MAMA 5JAZA 5T4EA 1GA6A 1FUEA 3KVNA 5KFQA 3ISDA 3BK7A 4TWRA 2Q7XA 3KKAC 4MVJM 5COBA 1SXJB 8ADHA 1P1CA 5FDFA 3VKHA 3VYUB 2P1RA 2NZUG 2WJAA 2FGKA 1C20A 2C7VA 2H9IA 3R5HA 2WTAA 1SQ0A 3DTVB 1TLTA 2UKDA 2O8FB 1VE3A 3RW9A 1M2WA 3BFVA 1WB5A 4U7DA 4QJBA 3IKJA 1WP4A 1WW2A 3KE8A 5CDTA 1SQSA 5K0SA 3G8YA 3DF9A 3CRZA 3ZUGA 4BJQA 4N4AA 1W581 5KNDA 2FHSA 2XSZA 2HHJA 4KO1S 2D2IA 4S2EA 3M9XA 1YIOA 2W03A 3S8EA 3KJZA 1NNLA 3CUSA 5LOVF 2FPWA 3OEHD 2G88A 2WKPA 1W4BA 4OGGA 3HPQA 1HPLA 2GHRA 3AK4A 1NZFA 1WXHA 1D6JA 2GWHA 2FE9A 3I61A 2IYUA 4RD1A 2J08A 1UDBA 3OESA 1X9GA 2OA0A 3U3KA 1DPGA 1ZGAA 4UNRA 3TG8A 1G41A 2XTAA 5F3RA 3NIWA 1G3QA 1W2WB 4DIBA 1YL5A 3R2JA 1BWQA 1WDMA 2AD5A 3MFIA 5KIAA 4W6QA 3SZLA 4QREA 4KXVA 2EEZA 4H31A 3M81A 2A5JA 2QTWB 3I76A 4OQYA 3TIXB 1OPXA 2FA9A 2UVRA 1X7XA 4NJMA 1RRMA 3QLVC 4DLPA 1O94A 1DC4A 2NRZA 1SEVA 4JSTA 4LZPA 3ZLVA 3K0CC 3V46A 4LE0A 4DR1B 2YRWA 2RGRA 1XCJA 5L3QA 2HJWA 3DOJA 1B73A 1UKZA 1TFRA 3R0ZA 3PQ7A 2W8BA 4PNHA 2Y27A 2WP8J 1ZWKA 3RFFA 3RI3A 3DA8A 1H0KA 5LOVA 5FFFA 2XYRA 4FGJA 5ELXA 1YQWA 1WEKA 2ARKA 4H4DA 4QUIA 1QP0A 1NG1A 1DBIA 1KGDA 1JSLA 5G41A 4AJPA 4GLBA 4UAZA 3UICA 3G6KA 1GTZA 1T1GA 1X7XB 4P32A 3ESBA 4IH4A 5AKKA 1C7YA 4RJJA 3CZPA 3CNEA 4KWIA 3QP9A 3PGA1 2G63A 1CNEA 2WWFA 2QNIA 2W8ZA 1X7HA 2QIPA 1YJ5A 1Q0ZA 5L3QB 9ICSA 4WK0B 4CI9A 4P80A 2BI8A 2O7SA 2W8BB 2HMXA 3VOBA 5DOVA 2R84A 3GRKA 3BE5A 1NQ5A 1VC2A 4IS3A 4OMDA 5LOVB 1UBEA 3U9LA 2XZPA 5IP5A 4MV6A 5TSDA 2I6GA 1K7EB 1KI9A 3DWIA 5IWAB 1B8VA 3A27A 4DLUA 3SQWA 1E62A 3FTDA 4WLVA 4JVOA 4KGXA 3I8XA 2EKQA 2FJUA 4F56A 3NUGA 4JQYA 4U7HA 1NJWA 3BRQA 1AO0A 2CKMA 1QB7A 3Q15C 1X3SA 4WOBA 5C5IA 4XWTA 3F6RA 3HNPA 1SBNE 4ECSA 5L7YA 4L9RA 3M82A 2IOHA 3ZBPA 2ES6A 1DV2A 2ZBUA 1BDBA 3FPKA 2ZE6A 1B14A 3TCKA 1NMZA 3JX9A 1NBIA 4PSKA 1L7EA 4KBFA 4UQOA 2P4QA 3BSSA 3MMSA 4ZA2A 1HR0B 1FQJA 3ASZA 4EKNB 2CHQA 3PYLA 2PFQA 3KLMX 4AL4A 3THOA 4I9HA 3Q0TA 4KRYA 2VRBA 5C9ZA 1VHTA 3PHHA 5AXCA 2FR8C 2INGX 4KV9A 4A36A 2ZSDA 4DCVA 1AO3A 5K3EA 2WKWA 4LDQA 4YJFA 4LXGA 5JJKA 1CZKA 2Q9UA 1V6SA 5ERXA 2FMSA 2Z4RA 1T5HX 5CWRA 5H68A 3E9RA 4JI1B 5CD1A 1VPTA 3S2SA 4JBLA 1UCVA 2PO7A 1V4NA 3AUKA 1GTL1 2HBYA 4FW8A 3IV6A 1KIAA 4ZOCA 4OJ5A 2HHHB 2VJAA 4Q3NA 4BLOA 5KC9A 4RHXA 1CCWA 2HPHA 4ISCA 4YJFB 5FUMA 4B0PA 4B47A 4AS3A 1B4FA 2BPOA 2CHGA 3B2EA 2NXEA 4I0WB 4MSUA 1BDMA 3ZW7A 5CITA 5THXA 2FUKA 1A7KA 2IEDA 4LSZA 4OOEA 2YJ4A 2Z2JA 4YBZA 2I2AA 3MT0A 2JHFA 4UCXA 1RPAA 4AXXA 2NUPA 2RP5A 3DEYX 2FKAA 4PC2A 1JR4A 2HW3A 1B1AA 2P2ZA 3IT1A 3BTVA 3ZWQA 1TEXA 1Z38A 4PIMA 2FQXA 1XKXA 4UZSA 4BE4A 2WG2A 3LZDA 4UM9D 3Q85A 3AKYA 3PRKE 4XRGA 4RESA 1UIMA 1CF4A 2Q4DA 1NW3A 1U2QA 2PZEA 4WNYA 4KO4S 1MOQA 3PX2A 1PUIA 4X3CA 4R9RA 4LC1A 2NUPB 1O5OA 1FUYB 4E3WA 2IE0A 4N49A 2CVPA 4X65B 3J7TA 1PJCA 4R5MA 2LV8A 3C16C 1ZQ1C 4URUR 4L74A 2ZS8A 4QW9A 1T4BA 5GJWC 5JD3A 1E2UA 2B94A 1RZVA 2D7CA 2JFVA 4B2YA 3WWEA 2NP7A 5DM2A 1KPIA 5J0QA 5H8WA 3GMTA 3X1MA 3PW4A 1N7GA 3I8SA 4RZXA 3EXHA 4ZJYA 3HU1A 3TBHA 3C7CB 4B1FA 1ZU5A 4I55F 5JASA 1RM3A 3MCWA 4YRFA 1V3VA 3TW6A 3CYFA 2CDBA 1EVJA 5BWMA 1FNDA 4BWVA 1OXUA 5J2BA 1PNVA 5DV9A 3SSNA 4KQ9A 3K6KA 3ZWWA 1Z6QA 1E89A 3OM1A 4W5WA 2OYSA 1I2AA 1R4NA 4M99A 1AMOA 3LYHA 2AR7A 2PBZA 3K31A 3T7JA 5KG3A 3P0IA 3ZWNA 2ZJ7A 3ORQA 2Q0ZX 4I5DA 4HAOA 4FD3A 3RC8A 3EXHB 3PCRB 3U0BA 4WHMA 3IDAA 2BI4A 2IUUA 3C3CA 1UA0A 1NDQA 1YS2X 2BR5A 2FUNB 4FFBA 4X20A 5AVUA 5L1JA 4DLXA 1BGVA 4AMVA 2PGLA 3PPWA 4UUPA 3UENA 3GA0A 1PTKA 5TC4A 2AF4C 4OQQA 4QA9A 3TTTA 4J7XA 2H2GA 4L95C 3JVUA 2HQ1A 4RY9A 1ZD4A 3G0OA 4MV3A 1HYEA 1S2LA 1R4NB 2GF0A 1E2KA 2JLYA 3N2KA 4KFCA 3JPSA 2H2HA 4IIBA 4UVIA 3PHLA 4NDAA 4E11A 1AKVA 2QUZA 4HTFA 4LQCA 4H1TA 1BYUA 1UPTA 2JLVA 1M1UA 2Z5FA 4M88A 1IVYA 3SXJA 5ITZA 3GEHA 4FFBB 4X20B 1X15A 5KFAA 2CB0A 3G6XA 4DF3A 3KQOA 3C3YA 2UUCB 4YCMA 1U3TA 4JJEA 3ZE8A 2VSQA 3A37A 3ZQJA 5J0PA 2F7SA 1DXHA 5LNK1 2JLWA 2POQX 4GXIA 1V38A 5C8DA 4Z49A 1Z7EA 2MWMA 3NX4A 1ZIYA 1QU3A 3N2KB 1KEEA 2KN7A 4XQ9A 1A0OA 3N2NA 1IFXA 5FO0A 1X77A 3IBGA 4HTFB 5FOWA 4KPYA 5HF9A 2I2BA 5KQMA 2IHMA 3Q7QA 5FR1A 2OSVA 3D2SA 4YQYA 2A14A 1K68A 2YHSA 4BUCA 4A5OA 4UBCA 1Y9AA 3LK9A 3EVEA 4B3GA 4OUDB 1P2UA 3C97A 5LIRA 2M2IA 1G98A 1V11A 1Z0UA 4HDCA 1MB3A 4HNUA 1V43A 1EUCA 1JFSA 4HBZA 3ADCA 2MCFA 1QQ7A 1OVMA 1E3LA 5LQNA 1YTUA 3V7KA 3FG9A 1X66A 1WXGA 2DGZA 1JU9A 2ODGA 1Z5WA 3A9TA 4LY0A 2WIAA 1KEEB 2JLCA 1Z6XA 3K9HA 5HHIA 4ARAA 1H4SA 3ZTTA 3IIMA 5IXSA 2JGJA 4PFSA 3ZWYA 3T52A 4IWXA 5KFOA 4LF6B 1L3CA 3GJQA 2OYRA 2YS7A 2YN2A 4KSBA 2H18A 3FF1A 1Z25A 4B9LA 1M5UA 1YZUA 5IIKA 1V11B 2XEDA 3VC7A 2HCFA 2XRYA 4DBVO 1EUCB 1GCGA 1L9XA 4ZARA 5F78A 2FK8A 1P4AA 3M4JA 4TSFD 1WXEA 3CJQA 5JNSA 4ZOLA 1PJAA 3WLJA 2P3SA 4B84A 1NIJA 3P2IA 4M3NA 3O95A 5IPFA 3T95A 3P4YA 5BYBA 1QE5A 1A04A 1U7PA 1BVYF 4XQEA 1T4MA 3H3FA 2F90A 5E0KB 3KR2A 2AN9A 2OFXA 4X00A 3QFRA 3R7NA 2UZAA 1NZJA 4K40A 1RBZA 1X14A 4D9EA 5B4UA 1ZQFA 2FWBA 4CUKA 3KEGA 2UYYA 2FJ6A 1XYGA 4ITRC 4LZOA 5BNTA 5C1BA 4F2SA 3IGFA 4ZOLB 3OPNA 3GBPA 5LYJA 4M1OA 4YD2A 3KZNA 2O3SA 3A9CA 2WSIA 1M8PA 2D1RA 5ARDA 1I51A 1WOMA 2VJQA 4LQ4A 2RC5A 3G8AA 3VHXA 1DEKA 4XSVA 4EL5A 5TMEA 2VT3A 1UXGA 3EGIA 5DNWA 2EIHA 1D7OA 2FG7C 4CQMA 4E12A 4IYJA 1IN7A 3M6KA 3W5BA 1S8NA 1KKMA 2QN8A 3GIWA 2NRXA 4I08A 1YZ6A 4H7PA 5LYJB 2X5JO 5KFXA 2BGIA 5IBRA 4LXYA 1RQXA 2I2WA 3V5NA 5IIOA 2G1UA 4DSEA 5ALQA 3MTQA 4YRJA 2YC4C 5BN4A 1GKLA 1XZIA 1US8A 3P45A 8ICPA 1U0BB 1B6RA 5AQ1A 1IUOA 4QTYA 3PSPA 3VHXB 2ZYDA 1XZCA 3TSCA 1Q0TA 4ZYZA 3PC2A 4EKGA 1J2MA 2ODWA 2CYAA 1TGVA 2JH8A 3R9KA 4CQMB 4M87A 4ZJUA 5F9LA 1G8GA 4PHPA 1E6CA 2CXRA 1TRHA 1W2HA 3TQHA 4R2LA 1FXWF 3L6RA 1E8NA 2IV3A 3WGQA 5KYVA 1LBEA 3ZE9A 4I2CA 3L0CA 1WV0A 1ZP6A 3H83A 3GMIA 2PKWA 2WU1A 5EIWA 2REXB 4ZCLA 3B1ZA 4NBRA 5BN4B 2P6RA 2PEZA 1EG7A 4FLFA 5H3CA 3B52X 2PUVA 3G2OA 1BNOA 2C2KA 5ALEA 2H4JA 5E1OA 4TV9F 1DE0A 3KE9A 5JATA 2X2PA 1EGMB 4YG2A 4YRCA 2ZIVA 3GI1A 5KFLA 3JD1A 4K9SA 4OREX 4MX8A 2W7OA 1DS6A 3L07A 2BQRA 2QN1A 3M6UA 1U47A 2C5LA 4EF5A 2AJQA 1MQ3A 2X0EA 1X7ZA 2WYOA 4MWBA 1NK5A 1WUYA 2VDWB 4D9MA 4QJ4A 2BMJA 5C1PA 1RJWA 4P58A 1WMSA 3AOGA 4OQLA 3F97A 4W63A 3IKTA 2PL3A 1IUKA 5CYOA 3ND7A 1E2BA 1E3DA 1T8UA 1XQXA 4UHDA 2OZPA 1FUUA 2ZIVB 4K1LA 1J8DA 4M1YA 2PZ8A 3BD8A 2AR9A 1QOPB 2C98A 2OCLA 3MEQA 2C8KA 5JO0A 1AKUA 5AM2A 2OG2A 3PICA 1Q7EA 2F2TA 1X7ZB 4GYYA 4MV5A 4ENVA 1CEXA 3HKZF 3SFZA 1OPRA 2VG8A 3HA7A 4POAA 2IGBA 1XQ6A 4WCDA 4EFNA 2I99A 5CXSA 2ODEA 3LW7A 3IEKA 1UDWA 3HY6A 5E1BA 2AJCA 5K5EA 4W9MC 3FYTA 3IAEA 2G5IB 2GZ3A 1O4WA 1UPUA 2G3YA 3PS9A 2PE5A 4JJFA 2RHCA 2AKYA 4KDRA 3RAEC 2NOAA 1KBOA 2VJCA 4K1XA 4D99A 1BRMA 4MR8A 4YFKA 1HMPA 1RYMA 2QP9X 3LZCA 4GMFA 3CR8A 1UDAA 3FNRA 1TAHA 2J45A 3ICXA 1AKEA 5CB8A 4RKQA 3WNZA 1M66A 2QX8A 3RBEA 1SHUX 3PUIA 2HMYB 1IIBA 3HJBA 1FTWA 1YQEA 3K6SA 3EPPA 2VTKA 4I5EA 4RJLA 1ZPDA 1A3CA 3LHDA 2FF7A 1ZMXA 2O2HA 1UXKA 3PZRA 2F9FA 3UMFA 1UPFA 1AHIA 2WSSD 4XRHA 1ZQPA 3DO8A 5EC8A 3C6BA 5G1NA 1C14A 2XNDD 3LH5A 3WB2A 4RS4A 1T43A 3CZ5A 1U1FA 1P0IA 4MR8B 4YCBA 3OQJA 5SY4A 3CCCA 2HHWA 1K9SA 3D0KA 3GUHA 3LG2A 5JT1A 2ZIAA 1DOAA 2EEPA 4WA7A 2HA7A 4FKZA 4IKPA 3C5HA 4PZCA 1D4ZA 2XA9A 4KGZA 3LBAA 3ZIAD 4E7OA 2ZR8A 3A31A 1GSAA 4ALLA 2Y1IA 2FXVA 3M49A 3HUFA 5FI0B 3JQEA 3F6YA 4TZTA 3AJDA 4J9QA 1QM5A 4JI3B 1V71A 4CT4B 1PYDA 3RSGA 4JC4A 1FFYA 1IPHA 1MOSA 3H5AA 4TWBA 1FFUA 4IXMA 2BE7A 3S8YA 4X71A 2E4ZA 3R44A 3ZXSA 4JKIA 3LZ6A 3EIXA 1SXIA 4R83A 4NL9C 1T2VA 13PKA 2KJQA 5LA6F 2Q5QA 3E3OA 3JAMA 3N2LA 1Z39A 2QAGA 4A0SA 2AW3A 3QEKA 2BPFA 4M9QA 1MIOB 3ZYZA 4IJ5A 4S3MA 2IDMA 3PC3A 1SCBA 4NOLA 1H9AA 5DBOA 5BRJA 4E5NA 1K7FB 4R71A 3H5OA 3OJUA 4HB4A 4U3JA 3L6EA 2K4HA 4OGWA 3AHJA 3C14C 5EJ4A 1UKAA 3RT9A 4BLSA 3CKKA 3BIXA 5KFJA 1Z4PX 5K09A 3H16A 4JS0A 4W8HA 1S76D 4RENA 3EW9A 1WCIA 2QMQA 4EZBA 1NYTA 2VP9A 5JBIA 4PLYA 1L5HA 3QRWA 5HFJA 2FMXA 3KG2A 4UNIA 1MOZA 2G0NA 3HEBA 1G19A 1BO6A 3TW0A 1JQEA 4RVSA 2PVCA 3QBJA 3U0VA 3ACBA 4ASUD 1J0EA 4WACA 4MWDA 1TJ5A 5DYTA 4U3JB 5E2AA 5AK0A 1QHHA 5AVWA 4W1QA 3NHJA 3UJBA 4ZVQA 3RJTA 3PKZA 3EOBI 3ZS9A 2VS1A 3WGKA 5FFNA 3UWKA 2DUYA 4FZMA 1Y9DA 1S5LU 1WCIB 4QBGB 4V0MA 4PO1A 1L5HB 5YASA 1DEOA 5KOJA 5G02A 3I4CA 3NZEA 4D26A 5H82A 3CHYA 1H4QA 1G7CA 1R8SA 1B23P 3KKNA 4BO3A 3MCUA 2P6PA 2VXOA 1VECA 4HL6A 1QBKC 4B9SA 2WWWA 2Y1EA 5KG4A 4D9HA 1DQYA 1C8BA 2ONYA 3STYA 2RFLA 2B4KA 3QEOA 1QOQB 2QVXX 1P4RA 4XEHA 3G7UA 3EEIA 5K4AA 4I1RA 1KWGA 4UEKA 4Q9KA 3WMXA 3NVDA 4F9TA 5EAIA 3OT4A 5C4IA 3LWBA 4ACAA 5KOJB 4OPMA 4BQOA 2H29A 4OI1A 2ZVQX 3TL3A 1YCGA 1JQKA 1D4OA 1V5WA 3ND8A 5AWFC 4TTIA 2ATEA 2VZEA 2O2DA 1B2RA 8ICRA 1J8YF 4L15A 3T0FA 1DWUA 5KFTA 1XSPA 4W8GA 3JQAD 3EARA 3V1NA 5IAGA 4YR0A 1GNPA 2J7KA 1JMVA 4XYGA 4X95A 2FZCA 5HMLA 3AFOA 1X0XA 5J2GA 2P9ZA 4EW3A 1Y5MA 2H4YA 5JSHA 4TVBA 1V7PC 3KOYA 5AM1A 3N7UA 1LA2A 2ORYA 5G4LA 5BQOA 3T3HA 2BFEA 3KZCA 7GPBA 3W8EA 3TUJC 1NMXA 3MS4A 2ZTCA 4YBRA 1BPYA 5FFMA 5JDCA 1EVIA 1KK3A 5KMGA 1KZGB 3RRNA 1PS8A 1TEVA 1GG2A 3GNLA 4YT5A 3LS2A 4KIJA 2WM9B 2AXEA 4MI1A 1XJ5A 4L3WA 2OHOA 1GQYA 5T4BA 3RE1A 4EH1A 5K3OA 7ADHA 4HFJA 3D6UA 3L0IB 4QT0A 3HV0A 5HJ5A 3KJEA 3WIVA 4EL0A 4UFPA 1PWYE 2BFEB 5I7VA 4GP7A 1L7QA 4LYHA 4M55A 1J49A 1R4ZA 1DSSG 2L2QA 1O6FA 2GPJA 1R2QA 3WP0A 1Q7TA 1UEIA 5LL6P 1HDCA 4JV5B 1X7YA 4JBWA 5ARBA 2XQGA 4OA5A 3K9GA 4MW6A 3GPDG 3DAGA 5KMGB 4RKFA 4A8HA 4DMRA 4YDSA 3RAGA 4DIDA 5LBUA 4TTJA 3EEBA 4TMYA 1AHHA 2J9YB 4B6QA 4CQJA 3A10A 3E3LA 3GJ5A 3I9MA 5HZMA 4NFSA 3W8RA 3I32A 4DIFA 3TK1A 1NJ2A 1L7MA 3LA6A 1IEQA 2DF8A 2IYEA 4RIGA 5DKWA 1X7YB 2W71A 1MORA 1I30A 5COAA 4FBLA 2Z30A 4QIWC 2PRKA 4ZQIA 3GP8A 3FYSA 4UU7A 1FFHA 3PDWA 4L1KA 1XNJA 1H2XA 1A0PA 3AVVA 2V1XA 1IM5A 5KNDH 4I2HA 5FOQA 5TPZA 4ZO6A 2VPPA 1NJGA 1WUTA 1XD8A 1GJRA 1CUAA 5T4HA 3SC2A 4IRDA 2WHYA 3AF1A 1JEEA 2AQ8A 3AXTA 1ZQHA 2A6PA 1OHHA 4GF5A 2C1XA 4RHTA 4L9WA 4MO9A 1FMTA 1ETUA 2NO0A 3L04A 5DDIP 4HD8A 3CUWA 1PFYA 3K73O 1BA2A 5LNK6 4YRIA 2HJSA 1WHTB 5JLJA 1THTA 4LZZA 3MGKA 4P5DA 5EGSA 1R0YA 3EF3A 3PUHA 1A7JA 1OYVA 5JANA 1DVRA 2P5YA 1Z18A 1N7JA 2K4EA 5BW8A 1U5AA 1WSDA 1VSVA 1QE0A 2Q50A 2ENUA 3KD2A 2PL5A 4X60A 3SC2B 1WWUA 1NMQA 3PR5B 3KQTA 5K1ZA 2FMHA 2HR1A 2IOFK 3C5GA 2LMRA 1SIJA 4LF5B 2WLSA 2WPDD 1TZ2A 3TJMA 2KM1A 3NHPA 1V8OA 2E6KA 9ICVA 3F6CA 5K0LA 1NUUA 2ZUEA 1CBUA 2ZI9A 1CZOA 3G6WA 1NP6A 2HRRA 2PDAA 4BDTA 4ZODA 3AVTA 1LPPA 3KL2A 4EHAA 3ZVLA 2Q4OA 3DDSA 3ANXA 4MA0A 1S8FA 4DNQA 2VNIA 5CHYA 5KNCD 4I99A 2ZUCA 1GGJA 3EDRA 2AGOA 1BIFA 2GM4A 4UXIA 1BMQA 4HLUC 3QQ5A 4HADA 1G64A 3QPUA 1QS0A 5DDYA 5FTJA 4NYJR 1Y81A 1EWTA 3NASA 2WU3A 3EFOA 2YFHA 1PNRA 1FNNA 4DLLA 4MKRA 4RKYA 1HDYA 1X1QA 1CZNA 4LPKA 3BFPA 3OH8A 4KH1A 1QNFA 1U7DA 3WNBA 1PEAA 4INZA 3ZN2A 2CHUA 2BMWA 1ZN7A 4PX3A 4H59A 2JAOA 3SZ2A 3L9XA 7ICKA 4L4ZA 2EQ5A 4Z8YA 1UFKA 4YONB 1PL6A 2FLLA 3IL2A 4WLUA 3IMGA 1QS0B 4X8OA 3G1TA 3KLBA 4ILEA 3HGQA 4UAJA 3EFOB 3KHTA 2QA5A 5FA6A 1VKJA 8ICCA 2LUOA 3HWSA 2PNJA 4C04A 3AIIA 3HJNA 2IQ5A 2C4WA 16PKA 5J0UA 3WV5A 3IUNA 4G09A 1JX6A 4LHWA 2R6HA 1NBAA 4L3OA 2WQZA 5HCUA 2EAOA 4BYGA 3P94A 2IW3A 1FBNA 2V4UA 1KKXA 4FNMA 2GN9A 2HF9A 4FFLA 2RDIA 3AUSA 4EHNA 3W2TA 2Q1UA 4ZQHA 3PUZA 1Z4QA 4B75A 3WB0A 2FN8A 4NNPA 4A91A 3KQMA 3ORSA 3ZVMA 1M3SA 1XXLA 3DE0X 1YHNA 4PHAA 1QSLA 4G9BA 3UATA 1JR6A 1XHFA 3VX3A 1NR7A 4IINA 2O2JA 3UG6A 3ZWBA 3WK5A 1U3DA 5GWXA 4F8YA 2BSXA 3RF6A 2VPTA 3VR3D 1XTZA 3WVNA 5FX2A 2LKCA 1S6YA 4I8XA 4Y9SA 3AM5A 3BHIA 1WMEA 1KS9A 4DHWA 1D4FA 1C30A 5C1IA 4LYEA 1UJBA 5BR8B 2OM6A 2A5GA 1HYQA 5FTKA 3DLPX 1NUQA 1AQNA 3A9VA 4XVQA 1DK3A 5CK4A 2FWMX 5DLFA 2B9EA 3H0LB 2BDEA 4JI8B 3N8KA 3AIOA 4DSUA 3PDHA 1TAQA 2VSYA 2VBIA 2A19A 1UZNA 4I3FA 4DWWA 2WT9A 1IK4A 5EWEA 3TLJA 4Y2JA 2QE7D 2BFNA 3RH0A 1XTIA 3PUKA 5CUQA 1XMVA 3R3HA 1SWWA 3FJYA 1YULA 2D7JA 1Q21A 8ICKA 1PGJA 4OBWA 1C30B 3ROEA 2GJ4A 4LVNA 5DE3A 4B34A 3H1FA 4ES6A 3IHLA 3SPXA 4NM2A 1EWKA 4NM1A 5DHUA 2M6LA 3L1VA 3OT1A 4CL3A 4C76A 3VTZA 1Q0SA 1KJZA 3FBTA 4GR4A 4OYRA 5E2BA 2AFRA 4HVTA 4G0XA 4GSYA 1EAMA 1AA6A 3DFFA 3SHVA 1U6IA 3V8BA 3DEZA 1SULA 2OBLA 3KP1A 2VUTA 5H1YA 3EFBA 3S2YA 4ZN6A 4MWTA 1XROA 3X0DA 3ZGZA 4L6AA 3BB1A 1LC0A 1N6OA 5EQTA 4PHDA 3LL4A 2QB0A 2PZAA 3CW2A 3RIEA 5EE9A 3R3YA 5J58A 3VSDA 2W83A 3OT1B 7ICSA 1G66A 1EAYA 1U3VA 3CZQA 2IHYA 2GOYA 3SQNA 4OXRA 1S2GA 2Y1DA 2P78A 3ANMA 4FS1A 3RFXA 1VJ0A 4OGKA 5CIYA 1DMSA 4QE3A 1QIHA 3KAKA 4IZOA 5T41A 3A7DA 4U1RA 4KPGA 3M9LA 2XODA 3AR3A 1NX9A 2H16A 3ETRA 4CTKA 3O7WA 3S8MA 1EFPB 3RUPA 1UWVA 4BZQA 3WLMA 3E35A 4AJIA 1NF8A 2QB0B 5KNLA 4EHLA 2ZYGA 3VKFA 4HP8A 1Z7GA 1YVRA 4D02A 4R2KA 2D0IA 4A7PA 4UBKA 3KTAB 3GLQA 4MH0R 5G1PA 3ZZNA 2PUBA 4R41A 1VLMA 3N9IA 2GKSA 4CKEA 3VR2D 1P17A 4BVAA 3ZWMA 4RMIA 5FLKA 3GPBA 2VJMA 4ZICA 1SUAA 3S5JA 2WMNB 1E5LA 2NADA 4S24A 4PAOA 1ZUD1 4YWHA 3VR4A 5TPWB 4FM9A 4CM1A 1AS3A 3I04M 4K9MA 2J6HA 4S05A 2C82A 2DWPA 2JLSA 1Z5UA 4RFVA 1V95A 3ZI4A 4O2LA 2IPNA 3GLKA 4FQ5A 3HCFA 5FLXA 2GPWA 1K06A 2YC2C 2RGBA 2PS0A 3H5IA 3WXMA 3D2QA 2CF5A 2CVOA 1N5KA 5JECA 4A8EA 3JALA 3GT4A 1N8TA 4EFKA 1CUXA 4EYKA 5J4KA 1BS2A 1VL0A 3KU4A 5K6AC 1K86A 3V00A 2VJMB 5AKLA 4QZDA 3AC0A 4R0MA 3AZPA 3LUJA 1DQSA 4Q4CA 1BJRE 4B5KA 4UNSA 1LQUA 3ETNA 4TXNA 1ZSYA 2Q4TA 3ZGOA 5KG5A 4N0QA 4ZRMA 1EFCA 3GLGA 4D3XA 1Z0DA 4DMCA 4WAUA 1I7QB 3MFYA 1AG9A 4US1R 3OA0A 3HVHA 1XN4A 2WT4A 3DTYA 3JALB 3NVMB 4UEOA 2PX3A 4AJJA 2EXXA 3TQQA 1FSPA 1GCAA 3GVXA 4TT3A 1C9KA 4BNNA 4FHFA 1Q44A 3WGGA 3C39A 3RVSA 3B9JA 3GAMA 2HRCA 2JPDA 4Q7LA 4C4AA 5IHXA 3T7IA 1TO1E 4RXTA 1K63A 3D31A 1PT9A 3A6KA 5SZJA 1E6WA 1PDWA 4JWTA 1NJFA 3GLGB 1XJQA 4R1QA 2GI4A 2ATXA 4IFIA 2X58A 1ENPA 3W6UA 4A73A 3DZIA 4PL1A 3VAYA 2O0KA 4M7PA 4X94A 1JYEA 1ESNA 1ETHA 6REQA 2O7VA 3U7GA 2Y4OA 3EBOA 3H4VA 8ICBA 2BEVA 2JFFA 1WZCA 1MRSA 1H2HA 2I6UA 2RH4A 2F9LA 4DSKA 4N5DA 1B7GO 3T9CA 2PM8A 3PIRA 1UJMA 4EBBA 2MIIA 3O8LA 4G0NA 3A6JA 3CR7A 3EVNA 4R8MA 2Z1NA 4ZTZB 2QP3A 2X0IA 3PC4A 2CLSA 2HF7A 1V4VA 1VI6A 4RMHA 1KKUA 5A3QA 2B35A 2ISCA 2B0JA 2GN6A 1IG3A 4QXPA 3IKVA 3B51X 3KETA 3MWGA 1XJ0A 1MC1A 3P97A 3Q4GA 5EZYF 5JXJA 3H04A 1E0AA 3KEOA 5B3LA 2BRUC 1BVUA 1IB0A 6REQB 1H2BA 1QKKA 4EHBA 1SVLA 3DMGA 1SUSA 1PK9A 2F1KA 3QLUA 2BEVB 3MOGA 1M5TA 5IJAA 2VF4X 5ALOA 3GJ6A 4B44A 1ELOA 5CT5A 3R8CA 1NXSA 1P7VA 3C5CA 3K9QO 4JV0A 1RU3A 1FX1A 3AJ9A 1U94A 1M8KA 4CM5A 1U65A 4AMBA 2VDLB 1DJPA 2JI9A 2GM9A 4MAAA 2E5FA 3F47A 3TFOA 4L8VA 2LTAA 5EIEA 3FFXA 2ADMA 1YQDA 2YX8A 3RK0A 3IP5A 5AIBA 4CV2A 5FR2A 2EQYA 3V7LA 5D4BA 4X9XA 3WRVA 2XT9A 2KD1A 5EXPA 4PZAA 5MN6A 1DKUA 4DS5A 3H7AA 5BV1A 3CG4A 2ZSKA 5EIXA 1PWEA 2BZ0A 1E7MA 1ZMBA 3TSYA 3R9XA 4NQRA 1HDIA 1RHUA 1ZYQA 4NFHA 3S1SA 3ZD7A 1Q0LA 4KIFA 1F44A 1DOQA 1T34A 1ECCA 2PUAA 2KS6A 1GGNA 4KREA 1E9VA 4M9CA 3W4JA 1BCSA 4C4TA 1EJ2A 5CDSA 1K5OA 1EFAA 5EZYA 1SVWA 2ZYWX 1KEVA 1UANA 3ZWKA 1ZNZA 2YQ4A 2HUNA 5AKXA 3FBWA 4KWTA 3F49S 3N1UA 3RHZA 3HCOA 3F90A 2Z4TA 3A6GA 1O95A 2V5AA 1K2VN 2JGIA 5FTWA 2VRCA 2QN9A 2GB4A 1OIVA 5KTMA 3IP9A 2W5UA 4JMLA 3FPJA 3R9XB 3IBYA 2ZITA 3K30A 4R3UC 2DQKA 3GAAA 3QOYA 2PUFA 3P52A 4NYIQ 4FMCB 1PQUA 1JB1A 1NW9B 4Y6LA 4EYHB 1BCSB 3D6VA 5IF9A 1Y4ZA 5HQJA 4LY3A 5EZYB 4ZZ2A 1E5VA 3QVWA 2IW1A 3BX1A 1G4UR 1TM5E 3RADC 4KLHA 2QRUA 3OE4A 2Z6UA 1KMNA 3EXAA 4R66A 4LSGA 3OCJA 3SKVA 1G20E 3FWHA 4UHKA 1LPMA 4QWAA 2HHTA 2PH1A 3FWNA 4XYMA 4DQLA 2J48A 4ZT6A 4HQNA 4FOSA 4KTVE 3R5TA 3SXPA 3NHBA 5MDHA 4G0QA 2VHZA 1L8XA 4R1SA 5EWFA 4EHJA 5IABA 4NU6A 4U7JA 1WXWA 1EWVA 2ZP1A 3DLBA 4RKWA 1GILA 3BQNB 4NU5A 3KOUA 4CFYA 3KELA 1E32A 5E3IA 1U2GC 4DGQA 1Q3VA 2GD1O 1YGPA 3GJRA 1ZO8A 4BJ3A 3HY4A 3KKQA 4A23A 3IXLA 2FRVA 3MERA 3UPUA 2DQZA 4EUKA 4YMIA 2KKPA 4DL6A 4TTAA 2YINC 1EFRD 2JGNA 4QEKA 2B4QA 1BQ4A 3AZQA 2QR5A 4Y6QA 2F62A 2XITA 2R18A 3BL6A 3HUTA 1WXFA 1G63A 1B74A 2R96A 5A3SA 4F4FA 5AVRA 3WQSB 2ERYA 5CIQA 1U8XX 2IYSA 4XYLA 2C0PA 3BYZA 5GVSA 2NV3A 1A5AB 2C5GA 1Z0SA 4UMDA 2YZ2A 4ZYUA 3UJ9A 1Y9EA 4AD8A 3HGTA 2ZRCA 3F9CA 4OXKA 5EEGA 1XCPA 4JT2A 1NTRA 1WG8A 1G8YA 5AJYA 2HCJB 2X9NA 3UKOA 1PFWA 1IH8A 2WDPA 5EE5B 2C9ZA 3TPZA 3GGJA 5C5DA 5TISU 5HRUA 2QLTA 2IUSA 3FB1A 5E3HA 5F5NA 1E2GA 4IGAA 3MD9A 3D1VA 2H4XA 3H4BA 2JFQA 5JUWA 3VDRA 2ZI5A 1NY5A 1KXJA 2Q41A 1WZNA 4UTZA 2ODQA 2ZCJA 2VLBA 1MJGA 3FVQA 4EO4A 4DSIA 5A5VA 2XOXA 1T3HA 4YXJA 3TOZA 2HPZA 1PHRA 3BWYA 5GTIU 1TD9A 1ZD3A 1AF7A 2H52A 2P41A 2ZBDA 1W0KA 3NHAA 1NK8A 3AM3A 1NV9A 1BVSA 1AKMA 1M6NA 2P91A 1FEZA 3FD8A 4W1SA 1M2FA 4AROA 1A97A 5L3ZA 4DRZA 1LPNA 1PQPA 4QDTA 5AVZA 2D1SA 5FV4A 2WAAA 1Z2DA 3A11A 3H7IA 2W2LD 4B2LA 2DR3A 4D81A 4DUZB 4G4GA 3MNFA 2CJYA 4J0EA 3L43A 3ROFA 3HJHA 5CFPA 4N8EA 1MX3A 4NV3A 4JB2A 3PUYA 2V9WA 1Z6AA 2HWWA 3LOUA 1GUDA 1ZI6A 3FMIA 3CEJA 3QVOA 2YWJA 3RTAA 3NHMA 2FW1A 1ZHOA 3SMVA 3AWIA 3M4YA 3ZW9A 1M1ZA 1RHKA 1N2OA 3AY0A 2FWJA 4MFAA 1W36D 2XF8A 2ONZA 3JYQA 4ZAYA 3C4JA 2Q6LA 4K0KB 1RC0A 2WIKA 3FF4A 3QMMA 3HSYA 5BSVA 4H1VA 4Z2YA 4PSUA 3C1AA 3C6MA 2AG6A 4CTOA 1XE3A 2YHIA 4EYEA 4ZCSA 4R6XA 2FX2A 5DZSA 1QH1A 3FHJA 2R8ZA 5K01A 3DGFC 2JEFA 3MRSA 4WOCA 4QJ3A 2FG5A 1GZ4A 3THWA 5B12A 1QRAA 1TMYA 3DTTA 2H54A 3RTDA 4DDHA 3HG7A 3VRHA 3S44A 4PHGA 2OB1A 5IEBA 2VT6A 2SHKA 1VIAA 2QMHA 4IDQA 1XLWA 4FS3A 1RPTA 4CM9A 4TYYA 2ENWA 4B87A 1OFUA 2YHIB 5J5CA 2QHXA 3UAXA 3MMXA 3G2PA 3LBFA 3OQBA 3LYAA 1QH1B 5CFMA 2D6FC 1W5SA 4MINA 1N33B 3N0XA 5HFNA 1OYOA 3TZLA 1QRSA 4L02A 4LA4A 1QDUA 3THWB 4FQ7A 2J4CA 3QU5A 2R8OA 4A5SA 1QQ5A 3DXFA 5ECYA 3WL6A 1IQUA 5CT9A 4PS1A 1B26A 1CD5A 1QIIA 1S8AA 2RHLA 1G8KA 1QHGA 4G9EA 3CG0A 4ZREA 1LFAA 2H51A 4HNHA 3K1TA 4IHKA 4P93A 4F4WA 1RCUA 4DFMA 3VDQA 4M2LA 4L51A 5JJCA 3O47A 4J9PA 2XE7A 3PQFA 2D5LA 4CR7A 1Q46A 4F2RA 3IQIX 1K0UA 3UMCA 1E9RA 4N3NA 4F3YA 2M0NA 1VKOA 2JEGA 3E9NA 4QRHA 4OUDA 3K71B 2IU4A 1Z1BA 4INJA 2RI1A 5C34B 1A5BB 3LCCA 1XZAA 3HXQA 5DGTA 3UJAA 2FI1A 2QPAA 1TJPB 4GKVA 5MF6A 3GIMA 1L5SA 3GIIA 4GX0A 2X4DA 3C28A 2ZJBA 2ZQYA 4PZPA 2ECOA 2FRDA 5KFFA 4PONA 4ZOLF 3ILVA 4JWMA 3PFHA 3SQIA 3U4AA 2OBYA 1OGYA 1II0A 4BWMA 3IV9A 3M5DA 4YCSA 3N5CA 5AKIA 5KSPA 2PQMA 3MR5A 1R5BA 1KETA 2QUBA 2A1JA 1PYOA 1EFKA 4QIHA 2FJ0A 1E8MA 4HBGA 2I4LA 2VHQA 1U3GA 4C5AA 4HWSA 4E09A 1RYSA 2CWWA 2W37A 4DV0B 4H3KB 4J0QA 1W94A 4LXQA 1PJZA 2ST1A 2ZRLA 2CNWD 4U02A 1ZN8A 3ESZA 3NHYA 5DYNA 3SM9A 2R8XA 2PIDA 3KAQA 1OFIA 2VF8A 4Q45A 4YDQA 9ICFA 1M74A 4HOYA 1N57A 5LYJF 1IVNA 2QDXA 4QU5A 2AG1A 2X8JA 2FLVA 4ZVSA 1ZJ5A 5LD2C 1Q6YA 3NLLA 2A1JB 3JZIA 1WABA 1K6JA 2IC5A 4H0NA 1II8A 4IAOA 3BAZA 3MWJA 4LOHA 5KFSA 1SURA 3IQXA 2X42A 3FMFA 3OLXA 5K8VA 1FP2A 2C9CA 4Y2UA 1XJCA 2OLJA 1KH1A 4LSMA 3K53A 1KMCA 5J2IA 1KAOA 2D1QA 3ROKA 8OHMA 2X8JB 2VKTA 1FLDA 3H2IA 3SVLA 4JLUA 4MROA 4P3KA 4KKXB 2PYZA 3B7PA 4Q15A 4TLAA 1II8B 3SN6A 3IP7A 5F4BA 4FOTA 2OO5C 3CPHA 4N0EA 4KQ2A 2PBRA 3JS5A 1PT6A 3I30X 4EYOA 4O3OA 5AESA 1TA0A 3A14A 1JHYA 3FMOB 3UMJA 3CO0S 3PITA 1L3TA 1C81A 1G0NA 1MKYA 3STXA 3SR4A 4BRUA 4B7UA 4GBGA 1VCMA 4IDAA 3LYSA 1GFZA 4Y8VA 4ANFA 3BK2A 2O05A 1JDBB 2CFIA 2YIDA 5G4KA 3DDNA 4ND4A 4OHVA 2R44A 3UK0A 3EZNA 4GNRA 1T2EA 4YB8A 3X1XA 4JQCA 2EH9A 4WKGA 2XTMA 4HQRA 5F7XA 4EW2A 1JXOA 3FTCA 1BNPA 1VE5A 4Z5XA 4RA6A 1OU0A 3I0ZA 1GITA 4KLSA 3GD7A 2CV0A 3QXJA 4BFCA 4BNIA 4XVUA 5IFKA 3U31A 4D6YA 1Z8DA 4K4HA 2K4MA 2HLDA 4GFDA 4DPMA 4IDPA 2EZZA 1P1IA 1UUFA 4Z0HO 4NDZA 3AESA 4UUAA 3UV7A 4M86A 2CRXA 5LQDA 5G4KB 4C4RA 4ITUA 1E4OA 1KBQA 4JJKA 4BTVA 4WPGA 3UJ8A 3E2IA 2IY9A 3CNNA 3GG9A 2EFHB 4R1TA 3RFVA 1NUSA 2P79A 4GX2A 4RA6B 1ZLXA 1JSRA 2PFGA 4MW9A 4K28A 2ZWVA 4UUBA 3N2ZB 1X2IA 2ISSD 1HOXA 1JZTA 1FF9A 3IA2A 1ULZA 4MQ6A 4DG8A 5CDFA 4DIMA 5G40A 1PZFA 5I3ZA 4RZHA 2OORA 3BOSA 3AESB 3CLUD 4FR2A 2VDWA 4D0SA 3IR5A 5H70A 4Q8EA 2GNAA 3DZKA 5KI6A 1ZM7A 4RJKA 1NMYA 1H69A 4A0QA 2FP4A 4RSGA 2BCGY 3H1AA 1RC1A 2IDKA 1KPGA 1P3JA 1QV7A 3PUXA 3EXEA 2MYNA 2RGEA 4ZT3A 1E7SA 3NVVA 3ZCQA 2BR0A 3VSBA 4R84A 4R1UA 3V4VB 2JLUA 4PO3X 3SEFA 3B7WA 1ZH6A 2OZVA 1TO6A 2QRMA 4DTIA 2OD9A 3F2VA 5K8JB 4AY5A 2CVZA 3EB9A 4R0NA 2QNRA 3TO5A 3ZY4A 3O84A 2VK2A 1T6XA 4I19A 5T57A 3Q8SB 1ZD1A 3COVA 4H9GA 2FP4B 1XTPA 1OB5A 5CFNA 3IAUA 4BX0A 3AHIA 1U31A 1NF9A 2WWTA 3EXEB 3L1UA 3TJZA 3TW4A 1EB9A 3UWMA 4F5ZA 1HK7A 4EX6A 2JJQA 1G6KA 4BN5A 4MDFA 4GPBA 4RD0A 4UATA 2ID7A 5EJIA 1PK7A 4IOLA 2OHIA 3RUCA 3VC8A 3HCNA 1W4LA 1Q0RA 3JPOA 1WKCA 3PHJA 1CUJA 5BVHA 1MXFA 5EMMA 3WICA 1ZJZA 1J5PA 4YP5A 1MB0A 4ZKEA 1WX1A 2Q1SA 3NTXA 1ONNA 3D7NA 2LYBA 1P2TA 1NVTA 2O1WA 3D0OA 4I2JA 1JL3A 2HPVA 3GFQA 2IP2A 1WPGA 2QL9A 3BICA 4M9XA 3U3OA 1G7RA 3OFJA 5EE3A 3H8MA 3LY9A 2Q29A 3OCCA 3FPLA 1XZGA 3R7DA 1SK9A 4DQPA 2P65A 4IIJF 4C21A 1E77A 1IBRA 1TFUA 2HADA 5B7GA 5EPEA 1YI0A 3TI7A 2C31A 3Q8XB 3NWPA 4HVCA 1RVV1 3QEJA 4KE9A 3UXHA 4C06A 4O1HA 3C3WA 1K66A 5BVHB 2HK8A 4B9EA 3NHUA 1XUOA 4A0GA 5ENDA 1P18A 1SOAA 2OGTA 4ALIA 2K2WA 4JU8A 4EMBA 4OQDA 5AICA 5I9BA 3LFUA 3GFKB 2JJYA 4MMYB 5AUPB 1N36B 4WZBA 1M83A 2YV4A 3SSOA 2V6JA 4FFMA 2IEGA 5AI8A 2QJOA 1Y8RA 2RDJA 3EGVA 2DR2A 4M0AA 3ECSA 1UM9A 1CUVA 2ZJ0A 4Q34A 3T9FA 4X5VA 2RK3A 2LYAA 3QU2A 1KGSA 1JXQA 3FHOA 1Q91A 1DKLA 1FYDA 1PNOA 1K1QA 2Q99A 2ZROA 3PF9A 2ZJFA 3FYDA 1ZVKA 2W4QA 5LP6A 1MIOA 4ZMRA 1KZHA 3L77A 3U2QA 2XTNA 1GZVA 4HDRA 3CRVA 3INYA 1R6TA 4RPGA 5FPKA 2H63A 3FXAA 3K1JA 2WJPA 4WZBB 5DULA 1MAWA 4D3DA 4IIJA 1OA1A 2IU6A 1ZQZA 1Y8RB 1RKVA 1UM9B 3GF4A 5KFRA 4PVDA 4IEFB 4G01B 4C1BA 3M8KA 4LRWA 3I72A 4RKRA 2GAOA 5KTNA 4KDFA 2CXOA 4D96A 3WGLA 2NO4A 4KLEA 4F38A 3N0RA 2Z7JA 4U39A 2VYVA 1QHXA 5FPHA 5LP6B 2VZ9A 4FZJA 4J0IA 4M0CA 2I6SA 1YGYA 4HDRB 1T0UA 5I7WA 3N0VA 4ZGWA 1V3QE 1RPJA 4FDVA 4YIHA 4MVWA 3PXAA 1Q3HA 1FDOA 4RSMA 4IIJB 2HM7A 3WDKA 1X1RA 4MCAA 2FZ4A 3MTDA 1W6UA 2PX4A 5FCDA 4GDMA 4R81A 2NRWA 3N5KA 3UJHA 2GZ1A 2R7LA 2VXBA 4QXQA 3MQ2A 1JPJA 4BVHA 2R8EA 1W48A 2HYDA 4E5DA 2UVVA 3DO6A 3VNRA 1OR8A 1QJ4A 1PVDA 1LNQA 3BGVA 3UCXA 5BT9A 3DLTA 1BU5A 4V1CI 2A5DA 1SGGA 8ICZA 1XWLA 5DG7A 3V6LA 2OR3A 5IAKA 2LXNA 1YZ3A 2EX4A 2OKGA 3ZNOA 1FQKA 3TKYA 4LYFA 4BN0A 3CNBA 4UB6U 4JX9A 4ZCRA 4C30A 1OIXA 5H7XA 3F2CA 2B4AA 2AQHA 5INTA 4KJXA 4RPHA 5IWCA 1X19A 4OLBA 1P75A 3FI9A 4YVZA 3UAGA 3VV3A 3G5AA 2RAUA 5IVDA 3MS2A 2V7XA 3F73A 3PA8A 4WT7A 1DAEA 4DLKA 1ATZA 2ZE5A 2AK3A 3SBXA 5A7GA 1L6NA 4AY2A 2ZPUA 2HSEA 4J3JA 5A05A 3QTTA 3Q3JB 3HYRA 3L4PA 2GRAA 3GNTA 2VJOA 1HF3A 4E5PA 4L2IA 3PXEA 4EY6A 1NBOA 2ZT7A 5ELLA 3U60B 2P6OA 3C5VA 4UREA 2YJTD 4R7GA 3NC0C 3TACB 4HFRA 2X86A 2FK7A 3VR4H 6AT1A 2JGDA 2ZBRA 4AYBC 3ICCA 4JMPA 1E3WA 2OHHA 4ABYA 3Q9SA 2ZVPX 4NPCA 3TADC 1OFGA 1T24A 5DTRA 2XMSA 1UOOA 4BNWA 4KQHA 1HG0A 4EP1A 3TLAA 4FYKA 2GBLC 4JSYA 1CF2O 3I6ZA 4L2IB 2XB4A 3DEHA 3W5CA 3TZCA 1L5NA 5MFPA 4FX5A 2R1UA 1JB9A 1DG9A 4ROSA 4LE1A 2XGJA 4ZI7F 4PXAA 5FHRA 5DN6D 3NXKA 3SLRA 4U5QA 2P67A 5CM9C 4C7JA 1N25A 2JGDB 2QENA 3GG2A 2HU5A 3NHFA 1AKTA 2WJJA 2W6QA 3KD3A 3TW8A 1E3WB 1W88A 2YN0A 4CETA 5BOLA 4K9QA 1SKQA 2JGKA 3QZ7A 4GHWA 1WW8A 3FSRA 1OD6A 1EVZA 2I7XA 4LQLA 3VVCA 2IZ5A 3F5QA 3K70D 1VIVA 3DMNA 4JMUA 3H97A 1ZK1A 1H8ED 3M6VA 5KSOA 3JWIA 1AUVA 1D8AA 4PTYA 1EVKA 3FRJA 4MF8A 3ZE0B 1S5PA 2IEAA 4DL2A 3G7SA 4QFDA 3TW8B 5ALVA 3WWDA 2PWBA 1W88B 2LM1A 2KLBA 1JYSA 4HEJA 3Q8KA 4PV7A 1OAAA 3FA2A 3NBKA 1DBWA 4IJQA 1SVSA 1PN3A 1OAKA 5GOTA 4RIFA 5K0FA 2EKBA 1P1BA 1W5FA 2BFAA 1NM5C 1ZCJA 3OTHA 9ICGA 1VGRA 4ZI7A 3PQ5A 5F1PA 4MVJG 1FVXA 4HXEB 1B42A 3Q5GA 3MM4A 4YQWA 1OC4A 5A4MS 2ZDGA 1LW6E 4I14A 1DTSA 1EK6A 4AB1A 4QLBA 1KZ1A 2PUHA 2XKAA 2D13A 5K3SA 1D3AA 6YASA 2IIQA 1WHTA 4QUJA 5TARA 4ZCMA 5HKBA 5FOTA 2KB0A 4M38A 3B85A 1TQDA 6LDHA 1L5GB 1NU6A 1HQKA 4CMCA 1BTOA 4KO2S 4LRUA 2P7IA 1VJCA 3WC4A 2OFFA 1F8YA 5KNBD 1GVNB 5BXYA 5IDYA 1EP1B 4ZI7B 4YR3A 3UWSA 2BCJQ 1IATA 4B3DA 2R87A 3BDPA 3GFRA 3WB1A 3DHEA 1ZIOA 3GNQA 2JI6A 3AUFA 1H2YA 3ZHUA 3I1JA 3CMCO 4KLAA 3HKEA 4C0BA 2P4HX 3BWDD 1N2HA 1DKRA 2DCMA 5AK4A 1FNCA 4OATA 1OI2A 3VR6D 1XVIA 2GPYA 5DN9A 5D5PA 4IV0A 2OK8A 1Z5OA 3NJ4A 3AEQB 1E2LA 4FI3C 3UQ2A 1I4EB 4MQBA 4ZYTA 5C1DA 4LMPA 4KBYA 1YS7A 2IU0A 2Z8YA 1FVHA 4KQWA 5JAPA 4P7FA 5C0YA 4RIHA 3MTAA 4QQNA 2PGNA 2XMGA 2NQTA 3IOEA 3IAAA 4Q39A 5EP3A 2R85A 2O8EB 4O29A 1COWD 1AMNA 2F1HA 5DEOA 3E0XA 3PPYA 3MB5A 1X6IA 3F1LA 2VTBA 3HKEB 3QM1A 3LT4A 1T1EA 2ZAIA 4XJXA 4CYMA 5J2KA 1Z7YA 4X7PA 1P0FA 4BWJA 1NOMA 3T7AA 4MB0A 4UU0A 1JQBA 5BUZA 2Z2YA 1RQNA 1R66A 2QZSA 3OOEA 2Y2UA 3D6FA 4KR2A 2X3YA 1OE0A 5DIFA 5IJ0A 2YJGA 4HO1X 3WL7A 1YDHA 2FSPA 3MAAC 3QI2A 4W9RA 1BN6A 3ABOB 3ETCA 2WKQA 5JRTA 4MGHA 4ARIA 2D8MA 4ADSG 1E2IA 4TURA 4GGMX 4C88A 4D4JA 3L0PA 1BW9A 3R75A 2VTBB 3GJ8A 2YYZA 2F55A 1ORTA 3AKEA 2H0AA 3GYBA 1T91A 1U9CA 4UHFA 1MGPA 3NHKA 2QX7A 2ZIXA 1Z35A 2QAIA 3F3SA 3PYXA 2FVYA 5IJ0B 3C3BA 2ID8A 2W2NA 5HJEA 1L7VC 3WBJA 1BAPA 4RF3A 3WLOA 2V5UA 3DH0A 2B34A 4G1FA 4HN4B 3DXXA 1S7CA 1C7RA 3TRHA 2GWSA 1FS6A 1BW9B 1SBCA 2Y1FA 3BDAA 2H8GA 1X2EA 4FT2A 1MH1A 3A04A 3EXIB 1FMFA 3U3MA 4FMDB 3UOAB 4UQLA 4V0LA 5DYIA 4EIWA 3B6EA 2ZIXB 4EG4A 3FRIA 3QKIA 4Y3UA 1RM0A 3OF3A 3H05A 3FHTA 4Q7KA 3MJEA 1ZEMA 1J9ZA 2G1KA 3KB6A 3DYVA 1WTAA 4H7EA 3RH6A 5J29A 4YLEA 3W3AA 1RT9A 1N77A 4B6PA 4CIWA 4EVRA 4YMNA 3KS9A 2QTNA 5DYYA 3IUJA 1XPJA 1GXSA 3Q7PA 3JVEA 3TKAA 1JHAA 5A4FS 3G5LA 3SHQA 4MYTA 4PANA 3Q9UA 3LRPA 1NT2A 5FWNA 3QKRA 1PZGA 3BGIA 4DXAA 3T3PB 1P6XA 1XZJA 3QBDA 4R3WA 3CVOA 3AUAA 3QH4A 3PD0A 1QIEA 4A9AA 1NXVA 3OQIA 2ZVJA 3O0DA 5EGNA 4G86A 2AMYA 3FSJX 1QO7A 1TYEB 2ZCVA 3OEWA 4KLUA 3RYFA 2NO6A 3IEPA 4IDDA 4HPXB 4D8TA 3U6KA 1ISMA 5IKXA 4PGXA 2CXYA 4KXUA 1S3SA 1AKWA 3EVGA 2YYAA 3GGPA 4L85A 2BP7A 2H7VA 2AR0A 1GR0A 1T0HB 1GXSB 3K9BA 3LKZA 3OZSA 2W8KA 3KC2A 1M6YA 1UKVY 2XNSA 3VZPA 3QKRB 4HMPA 4RK0A 3HSKA 3I3OA 2DPHA 5FD8A 4P7JA 3KXKA 1ORDA 2HAEA 1SCJA 4GBJA 2V7GA 1XCMA 1SC1A 4MW4A 3NTQA 3OQIB 3H5NA 3K2QA 1BPZA 4LXIA 4HDMA 4M83A 1WMFA 4G0WA 2JIZA 3RYFB 4QBKA 1D2EA 1GZ3A 5KSWB 3DAPA 4NP6A 1CR2A 4B3TB 2KTQA 2OV6A 5KFKA 4MWZA 2EFEB 2BP7B 1X38A 2FMTA 2BBWA 1YA4A 1UDCA 1QGOA 2FN9A 1RFLA 2H3EA 2X14A 3U6BA 5KG0A 3ETLA 2VZLA 3FYCA 4ND7A 3BFXA 2IYXA 2JHGA 2ZSIA 4FFWA 2JJ2D 5BW5A 2HF8A 4LYYA 2OWDA 3B6MA 3IDSA 5DU2A 3JXEA 4RTSA 2H1SA 3AR6A 5CA0A 4KQFA 3AFNA 4HDMB 3KUXA 4AKGA 4AKHA 1RRVA 4LGCA 2REQA 1EFPA 1AK9A 2A5FA 1FK8A 1M75A 1VG1A 1XZMA 2CLHB 4MLZA 1LKZA 3S5UA 3QKTA 4W99A 1WW3A 4QZHA 2FPOA 4C08A 3EUEA 3DCJA 3BIFA 3JD3A 1RRKA 3LXXA 3KTAA 4I4IA 1T3ZA 5FJJA 2D62A 4TRJA 1B76A 5HKOA 2LP4Y 5DXJA 5CA0B 3KZIU 1KDYA 1JJFA 1BCRA 3RODA 1PV4A 2Q2WA 3ICWA 3TAXA 2XOEA 3Q0EA 3RLIA 4HYQA 1XDSA 2AJ8A 5TPWA 2REQB 3CLVA 3FAKA 4B46A 2AQ4A 1UXIA 3VU0A 3TI9A 4LDPA 1E9SA 5BORA 3ZS8A 5JPDA 2X6RA 4O5AA 1ZL0A 1V9LA 2X5NA 2YS6A 1D0IA 1PL0A 3VO9A 4Z1MA 4I2BA 4OQFA 4RD3A 1GKIA 1EE9A 3EGEA 3SNKA 4R8KA 3BE4A 5CW1A 2C5SA 2ZULA 4IW3B 2JZOA 1FY2A 2J9GA 2O5EA 1CJMA 3D5QA 2IYOA 1KEUA 2Y0DA 3HI6A 5CT4A 2WWRA 4XWWA 4RF2A 2J5KA 1BCRB 2FSIA 1ZOOA 3L6UA 4RTKA 3DUWA 3AVXA 1GQFA 4Z9BA 2CDNA 2JRCA 1ZIXA 3QF4A 1KJIA 2G9QA 3UYLA 3SAJA 5JWOA 3F2IA 2X7HA 2JDID 2LRHA 4W82A 5DNAA 5IH7A 1SCUA 1NR5A 4GX5A 3UJPA 3FDZA 5BSFA 2CT8A 4J43A 2QKYA 5ITVA 2BMEA 4F6LA 2QMOA 5HQTA 1EG2A 4RZIA 5DNDA 4H35A 5LPNA 1U6KA 5L1KA 1LI7A 2PFKA 3QUAA 1J9EA 3I01A 4L4SA 1XP8A 2YB4A 3FTNA 1G8JA 1RG6A 5AJUA 1RRGA 2I9GA 3NUZA 4HN9A 3M3DA 1MQ2A 4OL0A 3LYLA 3QF4B 4TZ6A 5BMVA 5TE9A 3D2CA 2AQKA 1FFDA 2JIMA 1SCUB 4F5EA 4V3BA 1I3NA 3FDZB 2VR1A 4KIUA 2KJ5A 4ENRA 1PGNA 4NX2A 3WYFA 1W0JA 1R00A 3QKUA 1S2NA 2BMVA 3FFAA 3ICQB 1KEPA 2GEKA 5AUQA 2XVZA 1UZMA 3RM3A 2X9GA 3C3AA 4UEJA 3H84A 1I9GA 3TEMA 4YX9A 4NXMB 2HX1A 2ZB8A 4BNTA 1H9BA 3L7OA 3ZBUA 5REQA 1KAMA 3IDQA 2B2XA 2QT0A 4Y6OA 5BMVB 4NXNB 1IDOA 4YJGA 2Q6OA 4E21A 4JQSA 1CRZA 2H2DA 3T99A 4F4XA 5ALHA 1L4GA 2WIDA 2Q8PA 2BUCA 1MJNA 3EZ9A 3LDAA 2WJIA 2BMFA 3TRDA 2ISQA 1UDXA 2W0MA 4NLGA 1IEXA 1ZQ9A 1P72A 2R48A 5FQNA 4F93B 4UULA 2C54A 4QAJA 3UQZA 1GPWB 4NTZA 4Q9AA 2CXNA 4EHHA 4WBNA 1JQLB 2CD7A 1OXKB 5REQB 3I64A 2ZT6A 1GUAA 3T7SA 2FW8A 3KTOA 3NYIA 4J0KA 4FMCF 4YJGB 3PVCA 2D3TA 4PCAA 3SU8A 1W34A 3LVFO 4LMAA 2C22A 5KWIA 2ZSBA 4B3IA 1NT4A 3VZQA 3L82B 1QMGA 3FVTA 2DY1A 5IM4F 1FCJA 5I01A 1E94E 1AHPA 1JXLA 1C8LA 4WBNB 4DXHA 1PJLA 4B9NA 1HFWA 3W5JA 4BO4A 3K9WA 1ZJMA 4QOFA 4S1NA 5AXBA 4F4KA 2C03A 4Q4DA 1JKXA 2RI6A 5LSAA 5IW8A 3G5MA 3R0IA 2ZRAA 3WLKX 3W1WA 3EUB2 3OLYA 2OQRA 3HKDB 4J0GA 2AUNA 5I7FA 2Q5LA 4M49A 1O4VA 4WH0A 3ACDA 3OHBA 4U9UA 2H6EA 1SXEA 1ZINA 2YICA 1ORHA 3F5FA 5CVJA 3ZXIA 2PT5A 3JQFA 8ICVA 2ZRBA 3UGKA 4Z9AA 2KWIA 4KGVA 4TLDA 1UOEA 4V39A 5KFWA 2X7XA 3IPAA 2R8YA 4ESHA 4UKDA 3MJVA 3UB3A 2C2DA 2X3FA 4FFSA 3TMAA 1ZONA 3IVRA 4RZSA 1UBJS 1VLLA 3WGJA 1CNFA 1FYEA 2AEFA 5KSYA 3UBTA 2VWPA 2OXFA 3DDCA 3KXLA 2QD5A 1QTMA 4KSYA 1ID8A 4CLOA 1N56A 2CF6A 5IM4A 2C3YA 1T10A 3DKIA 1SELA 3OFNA 1HTTA 2XT0A 3JQBA 3EDQA 1QCKA 4LF8B 1D9DA 4WK2B 5U1PA 4FIDA 1F0KA 2A9FA 3SF8A 4ZVPA 4K3UA 3PBKA 3HDJA 1CK4A 3IMKA 4JZKA 1VP9A 2P6NA 4UUOA 5DCWA 1MUUA 1NSFA 1TCVA 4WX2B 4J49A 1T9BA 1I4WA 4P4UA 2DM6A 3NB0A 5CU7A 4JCCA 4F4JA 4QTZA 4ENTA 4W1PA 4CLOB 1J0XO 4B40A 2W11A 2UDPA 1KRHA 2C2GA 1F0YA 4RTJA 2NAFA 1JV2B 4OMCA 4Q02A 3JPYA 3IULA 4M1TA 5JARA 4YEDA 1Z37A 4DV4B 1YBMA 3SF8B 3Q6IA 4QHSA 1AOXA 2NWQA 1RI5A 2P0EA 4F9FA 2ERXA 3G0HA 3FPHA 1ZG3A 3MTJA 5C80A 6ADHA 2XKBA 1I4OA 2HDOA 5LLDA 4NCHA 1UJ4A 1TLLA 2DWOA 1D9ZA 2M32A 1EK5A 4L3VA 4BYMA 2QB1A 4YP6A 1UKYA 3NJ8A 3IXQA 4DEVA 1OH6A 1AZTA 1KQFA 1F7VA 4RUAA 3WBFA 1LZLA 3QEAZ 1NFFA 1WVMA 4YP1A 4ATNA 3BBPA 2AMVA 3L8EA 2CBXA 4R9NA 1OUMA 4CJXA 1PZEA 2OD2A 3SXUA 1TE2A 2NM0A 4Q9JA 4L8LA 1JJIA 1PQWA 1TDJA 2WHEA 3GFBA 1A27A 2IUYA 4WI1A 4YHBA 3T5AA 1SBHA 4MKFA 1JFTA 2ZYRA 5K6TA 1HKHA 1PZXA 1YJCA 1ULHA 1ODFA 3WLNA 4H7FA 1XDWA 4RPLA 1Q1NA 2V3CC 5F4ZA 4DLGA 1HEKA 1IZ9A 1SOUA 5KQGA 3CGGA 1YF3A 1ENOA 4Y0VA 5TQJA 3UIEA 5CXXA 4HNTA 8ICGA 1XTVA 2UUPA 4LWOA 4G5QA 4JEHA 1LVHA 3P5SA 3RC9A 2AOWA 2B78A 5I9SA 4AKTA 3LVRE 1FSGA 4ZCPA 3NUQA 3F7MA 3SXUB 2H1CA 4GMHA 3ZK9A 1UBOS 3QV1A 2PMEA 4DQUA 3PV0A 2ZPTX 4ZK6A 3TL6A 4ZVTA 1K5DA 3X44A 3PNYA 4EFMA 3ZJTA 3H40A 2OPBA 4YWJA 5K3CA 1WCV1 4NZZA 1IZZA 2ZUWA 2DVMA 4G9GA 5HHHA 2D74A 1YU9A 1PLJA 4M22A 4CDMA 2CD9A 4PLWA 3LBIA 3QVKA 3TQOA 1P2BA 3TM5A 3Q3EA 4MVJD 4P6VF 4TKLA 4B6RA 1QANA 4KFUA 2AOUA 4HJRA 2IIBA 2BT4A 5D8DA 1JROA 3EWNA 3N7SC 3L01A 1BHJA 1U1DA 1KAQA 2FLKA 3UXYA 1RYRA 4JLBA 2PR7A 5MFZA 1Z82A 3T3FA 2YNMA 3OX3A 4UHBA 3WRXC 5B3KA 4UAUA 4FNOA 4I1PA 3OPQA 3KOOA 3DO5A 1WF3A 3L1KA 1PJBA 3Q7EA 2KSOA 1PR4A 3HR7A 4JLMA 1KYTA 3S1LA 4KQCA 4Q3BA 1YCFA 2X4GA 3NM6B 4HXYA 2RARA 3ITEA 1U2ZA 4XGQA 4PHEA 3ZV5A 1A9ZA 2VYQA 4G65A 2E4VA 3CF6R 2AOUB 4RVGA 2OV4A 4FINA 2IIVA 4B85A 3DKPA 5AKEA 4I6EA 5F9MA 4TUQA 3CXRA 1QO9A 4IIEA 2PL9A 4P38A 4QUBA 4XASA 3MMZA 1XXHE 4N6NA 5T5QA 2G40A 3BXFA 1P31A 3MPOA 5JADA 4U5XA 4KMSA 1K1SA 1L9KA 2KSOB 4M2YA 2C5AA 4R8VA 5DMHA 1SIWA 4BC1A 3VJLA 1P4HA 4UMEA 2BIFA 1XRMA 1VIDA 2DBYA 4JP5A 3NOQA 3EZLA 1REQA 3E3MA 3COJA 2IZ6A 3WKCA 2ZSHA 3WK8A 1DIRA 2IYQA 1E9EA 2I76A 3RTVA 4PZEA 4ODIA 3RT1A 3B7GA 4OP1A 2MHCA 3UKJA 4PGQA 2GK4A 3ZHRA 2HREA 4II2A 2KHZA 3C7DB 5C4MA 5DB8A 2QRQA 3EVTA 5HIMA 4DG5A 1ILWA 4B4KA 1T5OA 5ES3A 1WY5A 2E37A 1HA3A 4C1NA 2RGNA 4KNVA 2NXJA 4E30A 2HHQA 3ML1A 1Z6PA 2R00A 1CEZA 2IEIA 4XDZA 1NKVA 5LQSA 5FAKA 4I2GA 1LV7A 2LBOA 1REQB 5SYNA 1QIJA 2NTVA 3KSDO 1NGSA 3KPYA 2XQKA 4ZI2A 3TX6A 4MUXA 3IP4B 2JIBA 5P8WA 2EJUA 2PT9A 3O8RA 1W6RA 5TVKA 4UTPA 3WWZA 1AGPA 2APJA 4Z4FA 4AP6A 4DQVA 7YASA 3ASUA 3R6DA 4JUZA 1YRWA 2ZSFA 3L4EA 4D7AA 1GZ5A 3UZUA 4DUPA 1AUOA 5HM8A 2A9OA 2X6QA 4I46A 1T0JB 1PR0A 2WOOA 3CZAA 2GWRA 2RQ5A 1TLFA 2Q5IA 4ML3A 4I29A 3ESYA 1ZSNA 4HUJA 2B92A 5E8RA 2JFNA 2RJOA 5AOAA 4CIBA 2RGCA 2NU6A 3IIKA 3MCTA 2VDPB 4H1HA 2XVXA 1CJSA 5KOHA 2XH8A 4KGDA 3W2EA 3LQKA 1M0TA 1OF1A 5LQRA 2H3ZA 4RU9A 5FUYA 3GN2A 3FCSB 5DOZA 2HC9A 5J0SA 3BDIA 4HDKA 3FVRA 2JAQA 5JDIA 3NAMA 3NDBB 3JASA 1XNHA 3QY9A 4CI0B 3K9CA 3WGIA 3SEIA 3RASA 4QNLA 2NYVA 4GXQA 5CTAA 3EH2A 3BE8A 1X8JA 2NU6B 2EL7A 4Y2TA 3NONA 4PXSA 5KKAA 4FD2A 1NOKA 2HOFA 1BJKA 3OTOB 3OLZA 4DOAA 5KOHB 4J2TA 2LPMA 4KQXA 2QY9A 1N6KA 1RCTE 4BX9C 3W5VA 4GC9A 2R8KA 1YU6A 2WMYA 4F8JA 3PC7A 3MC1A 5LZ9A 5FV7A 3EPIA 3NXSA 5LVAA 3A6EA 4HDKB 1WNFA 1YRHA 1ZD9A 1GPYA 3Q1KA 4A4DA 5IKEA 4LJYA 3I1IA 3RBZA 4L9AA 3JASB 4BIIA 5NLLA 5DPMA 1FUKA 1Y1LA 4L8FA 3IIJA 5B58T 1YR2A 1Y37A 4GOOD 2RB5A 3CTMA 4HAYA 1W9HA 2QLJA 2JA2A 3GZNA 3KXDA 1GN8A 3WE7A 4QGFA 1WCYA 3OQMA 2WFMA 2W2VA 4XR4A 3O82A 1KDTA 1T6NA 4B9AA 3ZU5A 3HB5X 1NSYA 4QODA 9LDTA 4KQKA 2Y9MB 5T6MA 1Z45A 4LJ7A 5F77A 1NVEA 3IEVA 5BNZA 4LK3A 4F12A 1ICEA 5C81A 1YJBA 2Z6VA 1KERA 1KR5A 5CNKA 2GYVA 5FUWA 3GLUA 1EXVA 2V7BA 3ZE1B 3KZVA 1O6GA 2NP6A 3GZNB 4EKDA 1PT8A 5BN5A 1SUIA 3RUAA 3OWOA 4PZDA 4QPJC 1T9CA 1ADFA 4F1KA 3R3ZA 1A2KC 1JDZA 4JBXA 3USZA 3SX4A 2Q5HA 1XBTA 3ANYB 5B30A 3ELWA 1RS0A 1W4RA 3ZE6A 1LRJA 3KYCA 2BKVA 4MVCA 4CLXA 2QVBA 5K6RA 1MEOA 2B37A 2EJWA 5ABPA 3QW4B 2H4HA 3H9JA 3ZPXA 3LL7A 3GIKA 4EGJA 1M0SA 5ALYA 2HN9A 4KIWA 4KLMA 1U1CA 1NPYA 4NARA 3MGVA 3HP4A 1LLFA 4RPXA 1VL6A 2WFLA 1XCBA 2PWZA 2Z0MA 3WB9A 2PRIA 3THVA 4N8SA 5BN5B 4KFTA 1VLBA 1E1RA 4GRAA 1RJEA 1ZUWA 2IWHA 2I8CA 3A3KA 4KLZA 2XKKA 3C85A 1L1EA 3O8BA 1NNEA 5BW6B 3Q7IA 3FPEA 4JK1A 3KAJA 3KYCB 3IM1A 3X43A 5FUXA 1M2EA 4X91A 1IV8A 2QN3A 4Y2QA 1E0KA 2EAMA 4AF8A 5BPFA 2WFLB 2FV8A 5DHFA 4IEIA 3AL0C 3BMOA 3IHKA 2VL7A 5ENZA 4F86A 4UFOA 2EGGA 4OLAA 4J9RA 2UZ4A 2OYCA 3DLCA 1FUIA 1TK0A 8ICWA 3WGMA 1BS1A 6CHYA 3LX4A 1DKOA 3LUHA 3ZZUA 3BF8A 3C4QA 1TA9A 2EP5A 3RRHA 3VC3A 4PZYA 4OKIA 5C31A 4D45A 1BHO1 4JYAB 3BH0A 4EY3A 4LVOA 2ZTDA 3OIVA 3GH3A 1PVVA 5BN1A 3U7RA 5A5GA 1FSFA 1TCBA 1VYHA 1WL8A 3AOEA 1A8IA 2AT1A 4QAQA 2BFMA 3QEBZ 2AGVA 4OP2A 3BMOB 4E5KA 3W6ZA 1N2JA 1VJ5A 1XKLA 1AKQA 3HVUA 5DASA 2O3QA 3W5IA 1WB6A 3HKZC 4R0VA 1M5RA 3WKAA 4PLHA 2WSLA 2KEYA 3VPGA 4IZHA 3P9CA 3HUUA 3D8HA 3GOQA 1H2RS 4MP6A 2E3TA 2EDUA 2G7MC 4TL6A 3NBUA 1P62B 1RAHA 3I6IA 5C3MA 4OGFA 4MTCA 5A0FA 2XA2A 3CR3C 4LCEA 1Z3CA 2OCDA 3BWXA 4DNOA 4DL7A 4G4IA 4I36A 1VL8A 1JKJA 2J67A 2X40A 2LHTA 3RU2A 5AK3A 3W9SA 4EG8A 2SCUB 5LP6F 4M9NA 4HMQA 3PUWA 1JG6A 1CV2A 1QTIA 4F8RA 1ES9A 2I8AA 3EN0A 2GTHA 4B43A 3TI0A 1ZQCA 2ODPA 1EX9A 3WLPA 2QNBA 4YRPA 3RARA 2OFWA 5K0EA 3DB1A 2W2MA 3R74A 1FMLA 4LY6A 3L7JA 4UDOA 3HFGA 4KLRA 3FUCA 1SG6A 3UAWA 3RVBA 2O3TA 3TMYA 4MYCA 4YJKA 1LV5A 3RJZA 1F4PA 4UXJA 7ICIA 1JKJB 4YMLA 3L02A 3TXYA 5F21A 3NRCA 4EJMA 1QO0D 2CDRA 2X1MA 5A0TA 2UYOA 2Z8XA 5FQOA 1I36A 4QNMA 4A0RA 3HB1A 3CISA 4XCVA 3SIRA 5CCXA 2DMRA 3W3AH 1GYQA 4JLWA 1LDBA 4PCVA 4PF1A 4WBSA 4DM3A 1HNXB 3PFCA 3O4VA 2HBLA 2YFQA 1JTVA 9ICBA 1Z26A 2C0QA 4N5LA 4PQRA 1I0IA 3J81k 1ZM4A 1BSVA 5CJJA 3C2KA 4J29A 3WYAA 1SWVA 1ZISA 5LLTA 4PSDA 3OU6A 4DVJA 1MX9A 2PA3A 3H11A 1GNSA 3TCXB 1U3FA 2GN8A 3RJ5A 1JIQA 3B3AA 4KPFC 2NNLD 3MILA 3OZAA 2HT1A 4QPZA 8ICJA 5HFAA 3TLMA 3NYQA 3R9IA 1RI3A 3H2KA 2ZTSA 3NRZA 3FIUA 3TLKA 3ZJUA 3BB3A 5D6OA 2NQ2C 1USUA 1FZTA 2QGZA 7ICPA 4X84A 3B9RA 5AK6A 1SZCA 2A0FA 3B12A 4KB5A 2P2DA 5FKJA 3H11B 1NI3A 3VO8A 1PG5A 4QL3A 1Y7IA 1QQBA 3BZCA 5K20A 3GDOA 4CLRA 3K15A 4D92A 1BQ3A 3WG9A 1NLZA 2B4RO 2H59A 2NZWA 1WETA 1N2IA 1T9HA 3S28A 4OH1A 3NRBA 3SIPA 2GFIA 2C2MA 4BO2A 3MGHA 1HLDA 5KHOC 2NRVA 2QM8A 5JAHA 5BNFA 1W19A 5HE9A 4DR2B 2XVMA 8ICIA 5ALRA 1XTBA 4YNBA 3SYKA 1J0DA 2HKIA 3EBPA 2IZ7A 3A1NA 3EYWA 3JRWA 1A71A 1DXQA 3LQRA 5JEDA 2G1PA 4CLRB 4Z6FA 4TS1A 3NFRA 2ONCA 1S3FA 5L1IA 4GXRA 1TT7A 2PS1A 2UYQA 4CTNA 1IOLA 1PLKA 3SIXA 4YAIA 1J07A 2E1PA 1C8KA 2RH8A 4XVRA 3VH2A 1JQJC 4Q37A 4ZZ3A 3RJ9A 1XPUA 1P7ZA 3S6JA 2HMTA 5LU8A 1VSBA 4LHXA 1SCKA 4Q9DA 4Z9YA 4CMIA 2XI4A 2IL1A 4YAUA 1UH5A 3WGOA 5FI5A 3TIGA 2PMCA 4L5BA 2K7FA 1EBFA 5FOUA 1QG6A 4BTLA 4MR7A 4QFBA 2F44A 4GG1A 2H5EA 1TK5A 5IIJA 1BA3A 1CLEA 4AN0A 1XHEA 2L18A 4G0ZA 3EGCA 4L50A 1Z47A 5CLLA 3ODPA 1XJWA 5G5HA 2ZAGA 3EVZA 4DB2A 3UQ0A 2Q49A 4QQFA 4M0MA 3JQPA 2VNAA 3PJFA 5F98A 4PPFA 5ESRA 1SVKA 5AI0A 4NV1A 1BFKA 4N6GA 4JI4B 4WKBA 2AXNA 4BE9A 4O1IA 3IG8A 4CMIB 1GPJA 4QLAA 5E7JA 1P2FA 2Q2NA 4QXAA 2PANA 1R16A 1RWWA 2QZ4A 2WTUA 3LX6A 4KRGA 1HORA 4MR7B 1H8HA 4WKPA 1JLKA 2H31A 3PUJA 1WCWA 3IT0A 4WXPA 4B45A 1Z2CA 2XVTA 4UOZA 3OY2A 2YVQA 2BOVA 4EYQA 4CLEA 3DE4X 3LHKA 5HHTA 4ZMSA 1T1RA 5TQVA 1E79A 1PE0A 5IC4A 3LX8A 1QGED 4NCAA 4EYSA 1YASA 5JAQA 3K75D 5B3AA 3REFA 4LJ5A 1QGYA 4RZRA 1KVSA 3KVOA 2YN4A 2Y1XA 4G37A 2BUAA 5BNIA 3A06A 3UQYS 2F3UA 4Z7OB