3QU2A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 80
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu2A01
1RDFA 5AI8A 4EX7A 3K1ZA 4UM5A 1XVIA 4NABA 3E58A 2WM8A 4L6AA 4YIKA 4YCNA 1RRCA 3NASA 4OHFA 2GHQA 1RPZA 2WHEA 2GHTA 3IRUA 3N8GA 5AKJA 3FPSA 3W5AA 3CNHA 4ZEVA 1ZD2P 3IJ5A 4UMVA 5AKEA 2ZBFA 5AVUA 5AICA 5AKZA 2IYEA 5ALJA 5AK4A 1QH9A 3QYPA 2AUTA 5ALEA 3E84A 1IWOA 2DQSA 2R8YA 1XPJA 3MC1A 5AVSA 3J7TA 1ZS9A 1WR8A 3BWVA 3R4CA 3BA6A 3DDHA 4UATA 4BBJA 2YN4A 5A3RA 4KYTA 3R09A 3W5BA 5IS2A 4I9FA 3WGUA 4F72A 1RLTA 3L8GA 1TJ4A 5ALIA 4J03A 4Y2JA 1Z4IA 2B8EA 3ZWKA 2FPXA 1AQ6A 3SF0A 3FPBA 2JAWA 5AW7A 2FDRA 5ALNA 1S8OA 3NAMA 3OCXA 1RKVA 4F71A 2GMWA 5AW2A 4YCLA 2MU2A 4OCZA 3IB6A 2RB5A 5ALRA 1RMYA 2FPWA 2G80A 5AW4A 3UMBA 1NF2A 3ZUPA 3NIWA 4HGQA 2YJ5A 5ALPA 4UARA 5AKLA 5AM2A 2IOFA 2WFAA 4DCCA 2D2VA 4GIBA 4OD0A 4L6CA 3DV9A 5AW1A 4MWOA 2WF6A 4BX2A 2W4MA 2EATA 3WKCA 4FYPA 3L5KA 2CFRA 1SWWA 2VKQA 2YFYA 3AR2A 5AKIA 2B82A 3KD3A 2YMLA 2C9MA 2YJ6A 2W43A 2B30A 3OCZA 2PR7A 4UW9A 4JB3A 1T5SA 1U02A 1Z5UA 2JAOA 1Z4QA 1TE2A 3QU9A 4BEWA 5AKYA 3ET5A 5AK6A 3WK4A 1J8DA 2WF7A 4DFDA 1Z4MA 5AIBA 1Y8AA 3D6JA 3HYCA 2G09A 5ALTA 3E81A 1L6RA 5AVYA 2HI0A 3DAOA 5AVZA 1SWVA 2HEGA 1T9ZA 1Q91A 2PKEA 4EENA 3B9BA 1TA0A 2R8XA 5AW5A 2I55A 3WK7A 2P27A 1L8LA 2FI1A 3AR4A 3ZTWA 1RLOA 3HLTA 4Y2PA 2YJ4A 2OM6A 3NALA 5AW9A 2YMMA 5AM1A 1O08A 4NV0A 3VAYA 4DW8A 5IT4A 1JUDA 1ZD3A 3ESRA 3ZW7A 4C4SA 5AIAA 2X4DA 3QU4A 4YIHA 3A1EA 3WKBA 3PGLA 3SD7A 1N8NA 2ZG6A 1SU4A 4UU1A 2FPUA 3QU7A 4EZEA 3L7YA 4BNDB 3E8MA 3QX7A 4IG4A 1RQLA 3U7FB 3N28A 1RC8A 5ALVA 3UM9A 4YCMA 4Y3UA 3AR3A 3RF6A 2MU1A 1QQ7A 4ZEXA 1QYIA 5AHXA 2B1QA 4Y2SA 3NUQA 1S2OA 3GYGA 1ZJJA 4C4TA 4CF5A 2R8EA 1F5SA 2OA0A 5A3QA 1QQ6A 5ALQA 3PDWA 3WK5A 3N5KA 1RKQA 4UAUA 2AGVA 1WVIA 2HF2A 1YJ5A 4Y2YA 5ALHA 3WKDA 1U2SA 3TLMA 4BNDA 3W5DA 3UMCA 1O03A 2FUEA 3QUCA 4UM7A 4BX0A 2NO5A 3SKYA 2P69A 4KX5A 5AKKA 1RMQA 3L0CA 2IOHA 4NAVA 1Z88A 4JDPA 3CZ4A 4OFZA 2RARA 5AK5A 2FUCA 4UMFA 3QUTA 3U7GA 1L7OA 3KOOA 5AW8A 3A3YA 4HGRA 3EF1A 2YBDA 1L7MA 1ZRNA 3FGOA 5ALMA 4E88A 5ALYA 1L7NA 2BDUA 2Q4TA 2GO7A 4ZEWA 3ED5A 4AS3A 3QU5A 2WF9A 2FPSA 4HYTA 4YH1A 5AVVA 3L1UA 2ZBEA 3ZVLA 1K1EA 3MN1A 1FEZA 2AMYA 3B8EA 3SKXA 4NWIA 3B9RA 5T41A 2HHLA 4HGOA 4NFLA 1RQNA 5AVTA 1YV9A 3ESQA 4HAIA 4DWOA 5AVRA 3I28A 2NO4A 3M1YA 2PQ0A 3SHQA 2FPRA 4UU0A 5AM4A 1X42A 3DNPA 3P96A 2C8KA 1EK2A 4BX3A 4HGNA 2MSNA 3U7HB 2JARA 4XE5A 4Y2XA 2W11A 2I34A 3WK6A 5A3SA 3ZX5A 1ZD5A 2G06A 5AM3A 1KYTA 2BDEA 1EK1A 2HDOA 3AR7A 3OCWA 3M9LA 4RETA 2NYVA 3I6BA 3OPXA 3A1DA 3NRJA 1U7PA 3QU2A 4UMEA 1RMTA 5AI4A 1VJRA 5FP0A 4C4RA 3U26A 2B1RA 5ALWA 2I7DA 4UMDA 4AP9A 2IA5A 5AI5A 4AS2A 1Q92A 5AI9A 4L57A 5ALGA 5AK3A 4BKMA 4EEKA 1Z4NA 2C4NA 1T5TA 4RESA 4BYGA 3WGVA 2YMQA 5AESA 2IOFK 5ALDA 4B6JA 1QQ5A 1RKUA 1ZD4A 3NANA 2HSZA 2WF8A 5ALOA 3KC2A 4QQFA 2FEAA 3QXGA 3S6JA 3FM9A 4EELA 2O2XA 3WK9A 3EWIA 3N1UA 4HGPA 5AVXA 4XOUA 2QYHA 1CQZA 2HF7A 1LVHA 5AKXA 3KDPA 1U7OA 4PNHA 3L0BA 5AKHA 3A1CA 5ALZA 2G1AA 1Z4OA 4UASA 5ALFA 3L8HA 3EPRA 1U2TA 1YNSA 2ZBDA 1LTQA 2CFSA 1PW5A 2I54A 5AM5A 1WZCA 2G08A 2Q5EA 4MUMA 3OCUA 1Z4LA 4KNWA 4Y2UA 2BY4A 3ZWDA 1ZOLA 1WPGA 1Z4KA 2WF5A 2C88A 2Q4RA 2HCFA 4XPZA 2C8LA 3AR8A 3SLRA 3ZI4A 3L8EA 1YS9A 3SMVA 2JGAA 5AW6A 2YY6A 3N07A 3WK8A 4O8CA 3UMGA 5ALKA 3ZX4A 1L7PA 4H1WA 5AW0A 4CNQA 3L1VA 2I33A 3RFUA 4XQ0A 4FFDA 3I76A 5E0OA 1TJ3A 5IT0A 2ZBGA 3L8FA 5AI0A 3F9RA 2I6XA 4CF3A 4I9GA 5AVQA 2EAUA 4QJBA 2AH5A 3L0YA 1NRWA 2O9JA 2HOQA 2CFTA 3R9KA 1J97A 5ALUA 3ET4A 4FE3A 2HO4A 3KZXA 3U13A 3MMZA 3U19A 4IFTA 1Z5GA 2ODAA 2B0CA 3OCVA 5AM0A 4UAVA 2P9JA 3OCYA 4J2TA 1N9KA 4KNVA 1NNLA 3WKAA 2YJ3A 5AW3A 1VJ5A 3QNMA 3ZTYA 3AR9A 3AR5A 5ALLA 2ZOSA 4Y2VA 3ONNA 2HX1A 5ALSA 1YMQA 3FZQA 5AVWA 2EARA 5AKGA 2P11A 5AI6A 2R8ZA 2QLTA 3ZVNA 2B8JA 1CR6A 2OYCA 3ZVMA 3WKEA 4CE6A 3OTQA 2RAVA 1ZRMA 4Y2QA 3QLEA 2G0AA 3ZU6A 4YGYA 4KX3A 3QGMA 4CF4A 1Z4PX 5JJBA 3PGVA 4KN8A 2JAUA 3KBBA 2RBKA 3MPOA 3EF0A 3QUQA 2CN1A 4G63A 2GFHA 4BEVA 1RLMA 1YDFA 1TJ5A 1XP5A 2G07A 1VFPA 2ZXEA 4EX6A 3FVVA 5ALXA 3AR6A 2OBBA 1L8OA 4G9BA 2YMPA 3U7EB 3QUBA 3W5CA 4Y2RA 3PCTA 4Y2TA 1MH9A 4GXTA 3I1YA 1Z4JA
chains in the Genus database with same CATH superfamily
1BEUB 3ALRA 1BJTA 4UBCA 4EX7A 1IXRC 2DP4E 2FLKA 3KU4A 3PCRB 1MOPA 1SZCA 4UM5A 1CUHA 2A1IA 5EINA 1GDTA 1LDMA 1G0NA 1GFSA 5K8IA 1C3VA 4K86A 4HAYA 3BREA 1IONA 3L2OB 3WWEA 3FW1A 3ROZA 5CD1A 5BWCA 4M47A 3OHPA 121PA 2I78A 3ZDRA 4H7HA 3IRUA 2ONJA 4P5DA 1FP6A 3FPSA 4ZEVA 2ZATA 1HE8B 4RIFA 3IJ5A 2QG6A 3D1JA 1NVAA 4LFCB 1H3NA 1SBYA 4ASUD 2VF5X 5AOBA 2QYOA 1WXEA 1PWHA 3U4AA 1ZAYA 3WWOA 3RAFC 3V4SA 4IDGA 1C0KA 5I3ZA 2YQ4A 1GARA 3MG9A 1T5BA 1V4BA 2B21A 5HMLA 1VSUA 4MJ7A 2JZBB 2PU5A 2VJMB 3LQFA 3ZHXA 2H1IA 3Q8XB 1U9CA 2KI5A 4RELA 1QMGA 2BRUA 2ATIA 2CNWD 1OQAA 2IPLA 3CPHA 3P2KA 1ZQHA 4DSFA 2FZEA 3DE0X 4AIIA 3HXTA 3HR7A 4Q16A 1XPJA 3D4BA 3IG8A 4EMBA 7ICGA 2C4VA 4DBLE 5KX5B 1TZMA 1RXIA 3G02A 2OO5A 4XSHA 1UF9A 4KLQA 3H8JA 1E2DA 1WD7A 5DT9A 2LZ0A 2R65A 3P94A 4O2BB 1ZQKA 2J7PD 4A2PA 4RDHA 5KFUA 1EX9A 4N3BA 2VPIA 4XCQA 4ARBA 1M1YA 1PQYA 3L8GA 1JFLA 1RXEA 4LNHA 2QY6A 1YD7A 2FJ0A 4LECA 2YZNA 4Q4HA 3K72B 3CYFA 1IJEA 5K3FB 5F7JA 3NGMA 2G40A 4G1VA 3TH5A 3DDOA 4BQSA 5CCXA 2CB9A 2OUIA 5K2MA 3WO1A 1JU4A 2OCPA 4W5WA 5LU8A 4BL5A 2C3PA 1G2PA 5K01A 1QTIA 3EMBA 3KOYA 3GV7B 3KSMA 1YRAA 3ZTTA 1YBMA 3NAMA 3CB4A 3GJ6A 4HNUA 5BUCA 1DFIA 4B6SA 1EVLA 1IDOA 1DBPA 2P6NA 5CRXA 1C1XB 1VECA 2Q1WA 2R1VA 1NQ5A 2RI0A 2XPCA 3NJ8A 3RIYA 2Q3BA 2P41A 2RGAA 2YWFA 4NOMA 5SZJA 1OR8A 3NUZA 4MS3B 1TIBA 3RWOA 4DTCA 1FP1D 1NMQA 3NIWA 1XA4A 3V4RA 3K2EA 2CVOA 4AO6A 2FEMA 1GGFA 1RRPA 3D5QA 3SEIA 1DOZA 1EH5A 1P0QA 5IBPA 2IEYA 5HRUA 1A4RA 1XTZA 4ALKA 5JDIC 4MO2A 1SCIA 4EJ6A 1NLFA 1NKVA 1RYBA 2X5KO 1NVKA 2ZAIA 3ORQA 3WMFA 4EY7A 7ICRA 2NAPA 2R6FA 1M2WA 2RCNA 2WF6A 3CJTA 1A1SA 2XMQA 1BS2A 3T5AA 1DRVA 1LI4A 3MR3A 2FW7A 3H0RB 1JG6A 2KM1A 2WIDA 4YGXB 5DE3A 1RYZA 3I2KA 5TQ0B 2FNAA 4GOJA 5IUNC 1GNPA 1MRSA 4BFCA 2YFYA 2PXHA 2UYHA 1DC3A 1TM2A 2B98A 2V9CA 4FZ3A 5KNBA 1C29B 1OYVA 4E03A 2UZ4A 1BPEA 1XI2A 5K0SA 3P2EA 1VCHA 2QM3A 5DX0A 3U1VA 1RXCA 2R66A 4FJ2A 4N82A 4X95A 4M87A 2IW3A 4QHSA 1CLUA 1V1JA 1PI3A 2VUTA 3KB8A 4DWVA 3I53A 2DYKA 1AMUA 4GPTA 4PGGA 5DNDA 5I9IA 4MVJP 5AK6A 4EYGA 3SVLA 1UJ2A 1BPDA 2KN7A 1PJAA 4H1HA 3FYHA 3TOVA 4YAUA 5HMMA 4RZUA 1JDZA 3V1MA 2ZT6A 4TQRA 1JQAA 2ZYVX 4ZDKA 1Z5WA 4RIIA 5A62A 3U09A 1HXHA 4WFJA 5ED0A 1SD2A 3VNUA 3QVLA 1Y8AA 4GRAA 1G5FA 1A9ZA 1YJXA 1DX9A 1X13A 2J5XA 1FBTA 1BN7A 3OPNA 1QO9A 3DAOA 3ABOB 1PJQA 2YQZA 3VU1A 3IEKA 3KR1A 4AI6A 4JT8A 2BOVA 2E18A 3QH4A 4FEEA 1LBEA 4AJ4A 4EENA 2I5PO 3R5JA 2IU4A 4I55F 3FDZB 4D82A 1SIWA 1Q7GA 4RTQA 2AOVA 3K2QA 2QMEA 4C7ZA 4J7UA 2QRHA 4KLDA 1V7ZA 2GBFA 3AXTA 3ZS8A 3N74A 4BVLA 2ZYIA 3BS7A 1R10A 2QDKA 1NN3A 3K2IA 1LLCA 1KORA 3KLPX 2MMGA 3FHCB 1O94A 3JARB 1N8NA 2F2AB 3LVFO 2X3FA 4ACBA 1NN5A 3HDVA 4A73A 1MJGA 1SU4A 4Q5IA 3FJYA 5L51A 5DM70 4F2SA 5B3KA 1UBJS 3HN7A 3VZBA 4QM7A 4YMLA 2OBNA 5BWMA 5HM6A 4CMIA 4R2IA 1Q46A 4LSGA 2Q45A 2BQRA 2WSSD 3EZFA 4QJ5A 1ADGA 1IH8A 4CIYA 3OE7D 1ZH6A 4HS4A 5EZYF 4EDHA 1QFXA 4KGDA 4A5OA 1H1LB 3OP1A 5HKAA 1MPXA 5DFAA 2QRMA 2IVFA 4ZEXA 1I8TA 2Q3EA 3DD5A 2NU8B 1II8A 1UQTA 1ZGHA 3ZWAA 1HFJA 4IIJA 2F6RA 2GZMA 3WAGA 3B7GA 2GARA 1YACA 3G17A 2QARB 1W581 3TR6A 2BGMA 1XZBA 4BO8A 2QLMA 3Q12A 1YC2A 4ABYA 3QVUA 4QQKA 2IX3A 4TYWA 1E61A 1JF8A 4UAUA 2VXOA 3B2EA 4GX0A 4XDHA 4BFYA 2HJHA 1OFIA 3BHMA 2BP7A 3IKJA 4HC4A 1RP1A 3W5DA 1DG9A 3OLXA 4ITUA 2VOJA 4CR6A 3QW2A 1UFVA 2XUIA 3F96A 4ALIA 1NVWQ 4AJ9A 1E5XA 2R00A 4RPYA 3H11B 4UM7A 5L53A 4ONEA 1LX7A 1C9NA 3WIDA 2QHXA 4X7RA 3X3HA 1P2SA 1XDBA 3GT3A 1AZSC 3BZUA 3DVQX 3O8DA 1LNSA 1R64A 7ICMA 2H11A 1QE0A 1YR9A 3KPJA 2E37A 4G84A 2NZXA 3AFIA 4X6XA 5BVGA 4MP8A 4WW0A 1X0XA 4DCMA 5JUMA 5EHNA 4LI0A 3C28A 3WJAA 2VNKA 1A0PA 3GNTA 3GJ7A 3IALA 3L0SA 1XNJA 4O4IA 4MIYA 2JGKA 2G0TA 4XEHA 2JG3A 4MUGA 8ICGA 3NRCA 2NWQA 4A5SA 3RBVA 3CU5A 3QTBA 3ZKWA 5LLTA 4J7CA 3ITDA 4UVHA 1U0RA 4LQDA 1M2GA 2VF2A 4FS2A 5CT9A 1L7MA 4F84A 3PW4A 1KC3A 4HR7A 4YAWA 4ZQCB 2BDUA 4UB2A 2Q4TA 1F44A 1MJHA 1Q1NA 3A7EA 4FZMA 4ENTA 1E3MA 3CUKA 4QATA 3DLHA 1WUTA 4W1PA 2N0SA 1OZHA 4ALJA 1VDZA 1NQOA 2WF9A 1Q44A 3AHCA 4HGZA 2D8MA 3FIUA 3NKVA 3UK2A 3WYAA 2E55A 1XRJA 2FEWB 2GEKA 3GIKA 2ZJ2A 5C4MA 4CR7A 1JJAA 3LDUA 1E8NA 3M7IA 3SDZA 2DHDA 4CV1A 4H1TA 4C08A 4E6PA 1QK4A 1UBHS 2P6OA 3QUAA 3DEKA 4QDXA 3GC6A 2G5HB 3CZ9A 3D8HA 4CIVA 4FM9A 2DRIA 2Y4NA 4HNAA 4NFLA 1DAIA 4X97A 1C9JA 5AVTA 1XO1A 1V9PA 4BAGA 2VHXA 4JZYA 1Y5LA 3SHOA 1UBEA 4F3YA 1SG6A 1U94A 2R8HA 1DDIA 2CZCA 1KK0A 3H2GA 3SQIA 1CUIA 2H54A 2ONYA 3A9WA 3C5EA 1O77A 3LKDA 3NHKA 2J0UA 3ASZA 2YINC 5IP5A 1SKRA 3GYBA 3TW8B 2GGSA 2HADA 4BN0A 3MCTA 4KYIB 1I4OA 2B92A 2EL7A 1EK2A 3QKWA 3AU8A 2NU6A 2YV5A 4MGKR 3S1AA 2NRWA 2RKOA 1MLDA 2O8DA 1ZD5A 2R8JA 2B61A 1GRCA 1QNFA 3BM5A 3CKMA 3VTKA 1UMDA 3LWBA 3SFVA 4B9AA 1M72A 4DC1A 1EHCA 1VLLA 1YH3A 3IGFA 2BEKA 4QUIA 2P2LA 4NHOA 4HNSA 1Q0PA 3A9VA 4EGSA 2GN0A 2FZ4A 4OHOA 1TUBB 4Z7NB 4Z7OB 5CFLA 2C84A 5MGBA 2YYAA 3OT4A 4EYEA 1HZZC 1M6VB 2K60A 2JI8A 4IHJF 1TPYA 4RKWA 4X94A 2DF4B 5AR1A 4DY6A 2CJWA 4G5RA 3MFHA 4WEQA 2Q1YA 1SIBE 3FWYA 2GNOA 3GWGA 3TZLA 3EIOA 2A9OA 2WSBA 3PUIA 3IT3A 5L3ZA 1LDYA 1NOKA 3BXZA 1N2HA 1SZPA 1O89A 1OW3B 3E5HA 3HP4A 3ZHBA 1T5HX 4BUZA 3F2DA 5E3HA 3MDCA 4L57A 4F91B 3C1UA 4OJMX 3RNLA 4D4JA 4OXQA 1FU7A 3M6XA 2I1LA 5DP2A 5B58C 1YTUA 3EFOA 3C3YA 1DWQA 1LFDB 3R76A 2RJNA 1RYFA 5BN3B 4BWFB 3KYDA 2ZPUA 3U1BA 5TMEA 4DUYB 1XGKA 3EVTA 1BDJA 1JSZA 3TVDA 3LF2A 3ZU3A 1IZ0A 1TQ2A 2POQX 3BRWD 3EFOB 3G9TA 1LRKA 5FV7A 1SZJG 2P8JA 4RZIA 5DI3A 4B3DA 3A37A 2WF8A 3K20A 3OUTA 4YMIA 3TL6A 3UAVA 4EJFA 2NZVG 2DB3A 2HD4A 1HE5A 1JLLB 5C8YA 3CMCO 3RYHA 4US9A 1T3TA 3PJEA 1J0EA 3V8MA 3GIWA 2D2FA 5DSXA 3AXSA 4HQLA 3P1JA 2YWEA 2FMPA 4BP8A 2DY0A 2X2OA 1UBCA 2VK2A 2AG0A 3ECSA 2C7QA 2D2IA 2PRKA 2FMHA 4ZVSA 4CLDA 1R7RA 4OJOA 1IMJA 3GXBA 3IHKA 4P08A 2X3YA 2AX3A 2E1RA 1KNQA 4H4CA 2C82A 2ZR9A 5IX8A 1A95A 2GEVA 5DG7A 5ESDA 1QHGA 1XEXA 4R7TA 2PMZC 2C22A 4XAQA 3B20A 3ND7A 3PUVA 4HY3A 3PEWA 1MXHA 5HRAA 4L1KA 5H02A 8ICIA 3BBLA 2Q5EA 4IRUB 4Z53A 4QL3A 4V0ME 2XY5A 1ABFA 1Z4LA 2OZKA 4KNWA 1FP4A 2HPZA 1PLLA 4WERA 1ZQXA 5ADHA 1SO8A 4Y2UA 1PNVA 4W7HA 2O7NA 3GJZA 4B3IA 2FSFA 3PSPA 2CWDA 5DGCA 4ARSA 1NSFA 3AEKA 1T0HB 2I1WA 4F38A 2ZDQA 3FROA 3SZUA 4KO8A 2QI9F 1QOPB 3FOCA 4IXNA 1XF1A 4QEZA 5KREA 4HWRA 3ZDZB 4TZ0A 1CEEA 1II9A 3QVWA 4I36A 5FPPA 1P6UA 3IHLA 2ZJ5A 3ELYA 1LQTA 3QVGB 4F97A 5K8JB 3N07A 5F9LA 1YS2X 4CM9D 1C7IA 3RW9A 2P62A 1L7PA 1VCIA 4C8OA 2P9GA 3MOGA 1BQ4A 4NYMR 3UYKA 1L4NA 4LVCA 2C94A 4OXNA 2PSJA 2W5UA 4XQ0A 4F4CA 4DMGA 4CTNA 2NO7A 2MIIA 4ZOBA 1XYYA 3HC7A 1VG0B 3TRIA 4RQ8A 4GUAA 5CWRA 4HH0A 3GEPA 3NTLA 4QTXA 5E7QA 1PS9A 4E2YA 4LRTB 3E9ZA 2BUBA 3KZIU 4TZKA 4MTLA 1W2GA 4CF3A 4WI1A 5ERXA 2BEUB 1KBUA 2X0DA 3VZQA 1CUFA 1LC3A 1PTJC 4TQUS 1MO4A 4ZCIA 5AUOB 1F9AA 3BL6A 2X8LA 4Q03A 2PPLA 1M7HA 1TMKA 1C3XA 2FJUA 1JHPA 1YT3A 5C34B 2JAPA 1MIHA 2P5UA 1IQ0A 3HS3A 4OH1A 3VSEA 4BNMA 1N9GB 3GZTB 1F1BA 3WC4A 4DR6B 4FQ8A 1M75A 2GPNA 3GIJA 1WCXA 4G1EB 2XF8A 4M9ZA 2AUMA 3GLFE 1MF7A 3DOCA 4UD6A 1QHEA 2FCAA 2ZM5A 2W03A 3RQIA 3EGXB 3PEFA 3Q9NA 5AM0A 1SXPA 3ZI0A 3B1FA 4PHGA 1TK9A 5BQ3A 1QYVA 7GPBA 1YVEI 3EWNA 1XAHA 1N9KA 1UIMA 1TK8A 4UPVA 4XM0A 3AUJB 2YJ3A 3VQTA 1QGED 3UB3A 2PKXA 3P9QA 2ZK7A 2K8AA 1AMNA 2W6JA 4ND1A 3JYQA 3LFTA 1HETA 3HRKA 2RKBA 4IIDA 1ZLXA 5JVDB 4C4ZA 4QOGA 1DMRA 4P2BA 4KO3S 1DWUA 1D4FA 2H8GA 1ORWA 3OJ0A 4HDSA 4YWJA 3FPJA 2B25A 5TISU 3L04A 4PRZA 4FIDA 2HMAA 4L4XA 1I2CA 4LSMA 1MSWD 5KFZA 4Q1DA 4XPIA 3ZOZA 1UJNA 4B6RA 1E1RA 1XVUA 3D8UA 5HBRA 4ZVUA 3M9XA 1BGVA 2VBGA 4JFRA 4ECZA 4PHDA 2BIFA 2C5GA 3DL7A 1M8GA 4B43A 2WQ6A 3QA3E 1SUAA 1RKBA 4ZVVA 1GO3F 2R9VA 4XPIB 1B8UA 4K9PA 1ZXXA 1OX6A 2JZCA 2REOA 3BMNB 3T9CA 4M6WB 1RJEA 1UFQA 3T3EA 3KTQA 5DM60 1KDPA 3H8MA 4LYHA 3GPIA 5DGIA 1NV8A 3OEHD 4CTMA 5TQ2A 4EPWA 1TT7A 5A7FA 2RDIA 3BJRA 3E18A 4JJ4A 1GPLA 5FHQA 5BYBA 2AN5A 3VDMA 4GXIA 1Q19A 2PXXA 5EHZA 2PNFA 2QV0A 4PVDA 2PTHA 4DKJA 1Z56C 5F4BA 1VGVA 4ZMRA 4AICA 1HG0A 5TY0A 1VFPA 3TBFA 1G8GA 3NB0A 1Q3UA 3NC1C 1WCIA 1XDDA 1YAHA 3GJSA 5IXSA 3MABA 4I2IA 4JV1A 2O4CA 5T4HA 3M9OB 3JQ8A 3L4JA 4MV5A 5K4LA 3LPNA 5TS3A 1CJTC 3BH6A 1VIYA 4MV8A 1SH7A 3IDSA 5DSZA 4FC7A 1KOLA 4P38A 1SKSA 2NZUG 3PCTA 4FYYA 3I12A 4D57A 2RGNC 2J9ZB 3KR0A 2F90A 5DISB 2EJWA 3A3NA 4HUQA 3HKDB 3FTDA 4DMHA 2I0FA 1LS6A 4Q15A 3SEZA 4D4LA 5IIOA 5JBNA 1EP9A 1QBGA 1LW7A 2QSJA 3L77A 5JNVA 1PNTA 1L4MA 4U7WA 1O94D 4JSRA 2C58A 5B1IA 2B2CA 4MAAA 3UGJA 3NNNA 4AY2A 1KVUA 4G9EA 1RRCA 1IRXA 4PS0A 3M1AA 4US0R 3L7NA 4OHFA 1V7CA 4EWLA 4JL6A 4C78A 1SL1A 2WHEA 9ICVA 1WIWA 2JASA 4BTEA 4KXLA 3VRHA 4DIBA 3MBOA 4ZHQB 3ULKA 3W7AA 3NIBA 3NM5A 5EJFA 3K0CA 3NW9A 1QC5A 2XYPA 3M3HA 1JG7A 4OQZA 4DLKA 2JLUA 3MR5A 2PNJA 4YQZA 2JVJA 3D59A 1IN1A 3AEZA 3UK1A 4F6RA 1KY2A 1T9GS 4ZT5A 5FEUA 5JJIA 1ZYQA 4C3VA 5LB2A 3G8BA 3NVAA 4KOAA 2J3IA 1ACJA 4UU7A 3HM9A 1RXVA 2E87A 2ZBPA 4OGLA 1D5CA 1W6UA 3C97A 3KKLA 3TIFA 3D0OA 1UQRA 4M7RA 2CD7A 1P18A 4UB4A 1WCV1 4KE7A 3V8PA 3VC3A 2B4KA 4LE1A 1GNRA 5EQDA 5DBBA 1LK5A 1U1CA 1FCJA 1GG2A 2O8DB 4KYTA 5IS2A 5HK8A 1H2FA 4FDUA 3RB3A 1HTTA 4FFPA 4I1UA 4L85A 4ESEA 3UOWA 4OLAA 1BMTA 1LJLA 1Z3CA 2IZ0A 1GG5A 3FCEA 2QX8A 3KUUA 1K08A 3JTEA 1LKZA 5SZHB 4R1PA 3CN9A 3PK0A 4CLEA 4DLYA 3IUSA 1P1IA 4JBGA 3SX0A 1K06A 4BDSA 1XTSA 5JHHB 1WHSB 5D1HA 2CHVA 5IIIA 1SMKA 1UOOA 2OV1A 2WPNA 2B34A 4E2FA 3ZJUA 5DQIA 4DL5A 3LNCA 3F6YA 3FF1A 4UZFA 1UC9A 3LG2A 1RWMA 2G80A 3O8OA 2OBYA 4JLNA 5DMXA 5FQNA 4EUNA 5B3JA 1JPVA 2K4PA 4HGQA 2WJAA 3LY8A 4RMHA 1XSNA 1RWWA 3C3KA 5LL6P 2A1JB 2XRYA 4NYIR 1DJOA 4JELA 1UZUA 4R8VA 4E07A 1ITZA 1NBIA 2CVQA 2OK7A 3FOWA 4LJLA 3TQSA 5J4HA 2DT5A 3AUSA 5EWMA 3F47A 3FLAA 5L45A 3VKUA 3IURA 3CXUA 1NJWA 4DCCA 1YIDA 2QZ9A 4GBJA 4ZU6X 3VYVA 2XGQA 3RREA 3ROTA 1OZAA 3W05A 3O26A 4PYKA 4C7BA 4WK6A 3BGWA 2A9QA 3TB4A 5BNIA 2WT9A 1D6MA 1H38A 4R64A 2M1XA 2PA0A 3DM9B 3W9UA 4CI9A 2C2RA 1X9XA 2G76A 2VCEA 1JWBB 1RQ7A 4DSEA 5TGZA 3KE9A 4JNCA 4UOQA 3TZQA 1H8EA 3RKSA 5EC8A 2BGNA 3UHOA 2GYVA 3ZKAA 3FTEA 4Z4FA 1P7YA 1W0JD 4FUTA 3AI2A 1VKHA 4XUGB 3CLUD 1M2NA 1YVPA 3TRHA 4RPCA 2XVZA 3JQ9A 3L06A 2B30A 4PSDA 4GZLA 3SM3A 4BLWA 3AVXA 2HHAA 1FYVA 2PX2A 1X7ZB 2XMDA 3D6HA 4WXMA 4Z0HO 1JU3A 4BB6A 4LPSA 1WB6A 4GKVA 1VTKA 1X86B 3UWPA 5C7LO 3K75D 2C28A 2V7TA 4FX5A 4K2AA 3VZPA 1N1EA 2NRZA 3T5JA 2I4RA 2G72A 4I8XA 4CGYA 4YDQA 3RV3A 1ESCA 1KJYA 1T25A 4HLUA 5KJCA 5D6OA 3NFRA 2IDMA 1OBFO 5KFTA 1KS9A 2OKCA 2YB1A 3UN1A 4O5CA 2ZBUA 4FYKA 2VC2B 1CE8B 3VBCA 1O87A 1XQXA 3HYCA 5DASA 4KWTA 2PUDA 3WZ2A 4AKEA 3L93A 4TV9F 5D3KA 3T3GA 2VIIA 1MD9A 4MUAA 4A6DA 1GOTA 1NXVA 1FDIA 2H00A 1BPXA 2PKEA 1HM5A 2VP5A 1Z6AA 1YI1A 3T1YB 1YRBA 3T7RA 1G291 1NI4B 1AK2A 1S0UA 2DJIA 4BVBA 1G7TA 5D5QA 2UYOA 4DZZA 1C3JA 2FMXA 2ASEA 2IHVA 1IATA 3IAM1 3M2PA 3ND6A 2D7JA 3UXMA 2UZAA 4EB8A 1UINA 2IYUA 3FWKA 2AB0A 1TA9A 3I1FA 5E3IA 1MAAA 2C3MA 5EHGA 3TTXA 2BGWA 2PXCA 5AJZA 3F9IA 1OXBB 1UMCB 1WY7A 2WM9B 1CJBA 1O08A 4NV0A 4YFYA 4MW2A 3G0IA 1DPFA 3UHPA 4ADSG 1EHIA 1K7CA 2B4AA 1X9IA 5DX1A 1XZQA 2C8JA 3ZHYA 1YWGO 4FHDA 3PC8C 1QHHB 3WBKA 3ZDEA 3KSBC 1EDBA 4GPEA 4OXYA 3DMFA 2FPOA 3K6KA 3L7YA 4NMHA 4TTVA 1PF7E 4NYJQ 1ZONA 2WAMA 3ETDA 3OZIA 5H81A 1RQLA 3UAOA 1JB9A 1RXSA 4RAQA 1PDWA 5IAKA 3A9RA 2ZT5A 4IXMA 4CL3A 3R0VA 3VFDA 5TJ9A 2DQ4A 2E49A 4JI5B 1J4AA 3UXOA 1ZNQO 1YXMA 2IEAA 3H87A 3EDRA 5CVVA 2XODA 1KWKA 4DEVA 3DXZA 2AV6A 2PH1A 4WRRA 5H7XA 3SFTA 3EZ5A 1CVLA 4E11A 3D2LA 5IILA 5F77A 1RAAA 5F2NA 2W6PA 4EHLA 1F5SA 1LF0A 2GN4A 5DRYA 3IO3A 2RHCA 2QZJA 3N5KA 3WSVA 4IDCA 3IKMB 4MJLA 2HCTA 3OM0A 3FBWA 4BIMA 2MR5A 1ZRHA 1T8EA 3P0IA 4C43A 3DZBA 1J70A 2PSEA 4PVCA 1G66A 1KDRA 1XFAA 4OAOA 3DMPA 1OY1A 4RSGA 2QLNA 2Y76A 1Z6PA 2FUEA 3ND9A 5KFWA 3G2NA 2QMQA 2YFKA 4BASA 4OU5A 2HXGA 5B53A 1WW3A 3VOBA 3AUOA 4DLLA 2P69A 4KO2S 3SHVA 1K4KA 4IQ8A 1BNPA 1K92A 4JWKA 1MB2A 2QP9X 3CRVA 5KT3A 3IB3A 4RLSA 1H93A 4QZBA 2YXBA 4X1KB 1T6XA 3LLCA 4C0SA 5KVVA 1YZVA 1JQKA 4JBLA 5DHTA 2WTAA 4BTVA 1ZM9A 5DBFA 1ZKDA 5JSUA 2XJ9A 4Y9UA 4B74A 3NV9A 1A5TA 2GKGA 2PPVA 3LX8A 3D7RA 2EFCB 1WXWA 2GCGA 1C1DA 1CNEA 2H3EA 1UPCA 5IPFA 2OAGA 2BKUA 2FB9A 2FQWA 1CR1A 2IXGA 2XT0A 2DQKA 4G1MB 3T9AA 4OMCA 4R1SA 2LBOA 1HUOA 3ETHA 4CMEA 1VL2A 1QR2A 4M1EA 3ED5A 5GM1A 5M5BA 2IS6A 1J2UA 1CZHA 4JMUA 1QHNA 3CA8A 1UKEA 2VA9A 4XARA 3IV9A 2ZAMA 3Q2KA 2KBEA 5TRTA 1UOEA 2ISCA 1B93A 1EUDB 1P1JA 4RGBA 4WUTA 1WV1A 2F2TA 4R1OA 1X7GA 1P8AA 2FMFA 3RV4A 2HJGA 4A7PA 3HJUA 1EB8A 4EKYA 2QD1A 5DM0A 4ND2A 2A1TS 5HE9A 1X7YB 2XUDA 3SN6A 4EIWA 3GJRA 2HMSA 2FDXA 5A4MS 1X87A 4AB1A 4EGJA 4G24A 2QE6A 2BR3A 2GPWA 5C5CA 2NXCA 4X54A 4FT2A 4TTPA 1BWPA 4EEZA 2XF2A 1J8QA 5JXGA 3M9NB 2CBGA 3QG5A 2HBKA 3KQHA 1FYXA 1L4UA 4YR3A 1XXHA 1S2LA 2C59A 2I66A 1T1JA 3KTFA 3DB2A 4HDRB 4QBKA 4ZOAA 4YPVA 5LP6B 1FPQA 4RTJA 4UVIA 2J0VA 2V8BA 3DFUA 3L0DA 2IYPA 1TF7A 4LHVA 4MZDA 4RZ3A 5IIKA 1NKSA 1OCEA 1XMPA 3LF1A 4RZHA 3ILYA 3LC1O 4Q3LA 4ER7A 1DTEA 1L8AA 1XXHE 5IHPA 3TFOA 2PFPA 2WYOA 2P9TA 2Y4OA 3ZX5A 1PLKA 3SJBA 2BCEA 3EDYA 4EM6A 4LF4B 2P8SA 5CMLA 3LBNA 621PA 2P9QA 4RF3A 1NQAO 1LQUA 4M9GA 1C2YA 3CLSC 1U7WA 3SJAA 6AT1A 1B15A 1KOJA 1Z2CA 2AI1A 1P9NA 3JR3A 3P2YA 2YWJA 5ELMA 4EYSA 1W2HA 5B6PA 2OBLA 4RNNA 2OOKA 2VS1A 3UJNA 1Z63A 2H4WA 5TE9A 1LKYB 4WNAA 1FRQA 2QNBA 3DYVA 2WD7A 3LMKA 4TROA 4FWBA 1X39A 2GLTA 2VZEA 1A7KA 5EE5B 5FTWA 3OX4A 4JLDA 4Q4LA 1XZKA 2ZZNA 1XU4A 1JG2A 4PPQA 4AP9A 3WGGA 2ZSDA 1SUDA 3LWZA 3AJ9A 1UQVA 1CQXA 2H2HA 2WD7B 5AI9A 3NEAA 1KJWA 2OCXA 1PR1A 2MINA 5D51S 2A8YA 2IYAA 3PRYA 3WTCA 4EBCA 2PUWA 4FXPA 5LCXA 3C39A 3F6BX 2KK0A 1NK8A 1VYTA 4J0JA 2FSVC 3B3QA 1Z4NA 3PZBA 4PFQA 4ZO4A 3AV3A 3WL7A 4DJDC 1DO0A 4UJ3A 3K0HA 3ZGOA 3AOGA 2QRVA 3CUWA 2Q4EA 3GCWA 3GLHA 1W6RA 3Q0IA 4GQAA 2GILA 4EO7A 1W1IA 2LKYA 1YQXA 4BGDA 3B8HA 1J0AA 1Q3KA 3ASVA 4ECVA 5H2FU 5KAPA 4BGUA 4EG0A 4WHMA 2VDVE 5BN1A 3WDLA 1WVMA 3U9SA 1E96A 2C3YA 4KE8A 5JSHA 4Q8FA 4KV9A 2PRYA 2Z30A 5FTNA 5JROA 2Q5JA 1UZMA 1NK9A 3HBNA 2E7ZA 3Q2IA 4PPGA 4X7PA 4QJ3A 1R0ZA 2M9MA 5K0CA 1THGA 3E1KA 4MS4A 4XOUA 5H0IA 1P4JA 4TOIA 2Q2QA 4AN1A 2I80A 1R27A 2CXSA 1ZGZA 3T79A 4IOMA 3D2AA 1RI5A 4G1CA 4DGSA 4X62B 2BE9A 5GV7A 5EWMB 3SZRA 3WJ1A 3DV0B 3SU8A 4BNYA 4H27A 2P9HA 3OZSA 2I5HA 2P5YA 4GI1A 4HLUC 1N2SA 3A0BU 1YO6A 2HHSA 1RHKA 1NFRA 2HQRA 2WWTA 1ORTA 1P17A 1WTCA 4RZXA 2H4HA 3DWEX 3NH6A 3LOPA 4YLGA 5THXA 2NPFA 3TTYA 1X8KA 2CFSA 4TT3D 5D01A 1YK0A 2C57A 5CA0F 3HR4A 1B0UA 4RKYA 3H3JA 4EYIB 2DX7A 5DGHA 3W7VA 4ERNA 1BPZA 3JVDA 1JNXX 4KKVA 3QPAA 1ENPA 5EJ4A 5KYKA 4MQEB 4L0CA 6Q21A 3RADC 1G17A 4KN6A 5KWEA 2QZ4A 3I5MA 4B3SB 3SLRA 3RJKA 1F48A 4RWEA 4H1UA 1PGPA 1HBJA 1N48A 4GSLA 3OAAA 5DG9A 5LQSA 2QY9A 2FG6C 5A3VA 1Q12A 5F3RA 3H0LB 3PR5B 1GFZA 1KJ9A 7ICUA 2A57A 2WR8A 1HPLA 1P44A 3FDZA 2PCJA 4PRYA 4PC3A 4PZLA 1KETA 3AERB 2KVCA 1VLHA 3GZ4A 2NZ8A 2G5TA 2FHSA 2O3UA 1BPYA 2R2AA 3ZY2A 2IUYA 1RAIA 1OVMA 1E9VA 2J30A 4R1NA 2WILA 4EA9A 1B22A 1J42A 5G0WA 1PJ3A 3B53X 4WN9A 4FS8A 3PX0A 2H3FA 4YRAA 4JLUA 4OX9Y 2O8BB 4PIPA 4BEJA 2EZYA 4J16C 4D9KA 4J2HA 3VKWA 4PYQA 4V39A 2EIXA 1EFRA 1YZFA 1KQ3A 3I2JA 1MNQA 3QEMB 4M8LA 3F9RA 4LVOA 4RA9B 4BUJA 2AQ0A 3ONWA 4YRMA 2O8EB 3AX6A 3DJYA 1NJSA 3BJZA 4IJKA 3TRFA 2R0QC 1T3GA 4UTOA 1U3UA 1B8PA 2H1LA 2PBFA 4Q6WA 4AIRA 2DPJA 2O9JA 3PXBA 2JCGA 3VJMA 2GESA 2IGBA 1O5IA 2J32A 1G3MA 3S2YA 1M6YA 5REQB 1ZNXA 3E3NA 3WYGA 4RJKA 3Q8RB 1TF2A 3X43A 3QZ8A 1PKEA 2Z95A 4CMEC 3LZCA 2JKZA 5CLLA 2FWBA 2OCEA 1Y9AA 2RGXA 4W6ZA 1RCTE 4HB4A 1Z6GA 2ZYWX 3A9TA 3NJ4A 5G0UA 3SXJA 2CV2A 1GU7A 2D54A 3KDSE 4LIPD 2RHOA 3DDNA 2I1QA 4MEAA 4PYNA 5DBIA 4KQCA 4EUFA 3G9UA 2IJGX 3ZD7A 4LY9A 4YG2A 4GMKA 1R4MB 4XIFA 1VJ5A 2O19A 2QB1A 5IDQA 1P80A 3QELB 3KOZA 3T6KA 1X3SA 2JHDA 4EO9A 2FW1A 3DBLB 3DKKA 5ALSA 4BXOA 3BXOA 1ETUA 4PGHA 1BE1A 2I6QA 1EQ2A 4X5VA 1U8CB 3IUBA 4Z3OA 3TZHA 1AF4A 2L69A 1YS7A 3GEHA 4BFZA 4CODB 3J80A 2EARA 3A3KA 2FUG1 5H3LA 5AI6A 3D5EA 3KP1A 1ZRSA 1CR6A 1T0IA 4RV4A 3CLUC 5EHIA 3W4IA 3ZWQA 4CE6A 2BFEB 2ZB7A 5EWFA 1F2UB 2RBEA 3M5DA 2EC5A 4KAXA 2QPTA 5A05A 4ZYUA 2DR2A 2DTEA 3RBAA 4CM8B 4B9EA 3ZNNA 4AUMA 4KC0A 4HADA 3JYNA 1SCUB 2VYCA 1Q21A 1OX4A 1DVRA 1OI3A 2A4KA 5DIZA 5AXDA 3NYRA 4YN4A 2C2YA 1EP1B 1CEQA 5IBQA 3EF0A 3RRMA 3UOAB 3VPDA 3W5UA 4UVGA 3WWYA 4F5WA 4CMKA 5BSUA 2VXBA 1PQUA 2ZJ8A 2CHQA 3QI2A 4IKEA 4QYIB 5I8PA 1Z13A 1U8YA 3WNZA 3QYFA 3CH7A 4F46A 4XVCA 3NM6B 4P0TA 2OLJA 1ZMOA 5A0FA 2P68A 4ECUA 2Q4BA 2BBSA 4GZ6A 4X91A 5ALXA 5FULA 3C5VA 4LF7B 4P3YA 1TFUA 3SHFA 1RWPA 3L6BA 1K7EB 3FGPA 3HWSA 1FF9A 4FBUA 2EX4A 3KVVA 4MVJG 3W2IA 2PEZA 3ZYZA 4B9SA 1ISGA 1WCYA 1XF9A 2V0GA 2KFNA 3SR6A 3B1XA 4DLPA 3FNIA 1FU4A 1SNYA 3DXXA 5D3MA 1NI5A 5JJKA 2W22A 2BFFA 4ZHQA 1OZFA 1N5OX 5LIRA 3AJRA 1U31A 3TVYA 1RT9A 1ISJA 1GZ5A 3MA0A 1TEXA 5KFMA 2NP6A 3GDOA 1NMZA 1A69A 1JJBA 1KZ6A 1GQSA 1U1FA 1XRQA 2RHDA 3MAJA 1I10A 3N58A 4O63O 3B5JA 3TAPA 2OO3A 3RHSA 1OHHA 4OMUA 1SHKA 4HNQA 5EFZA 2YX8A 2A3VA 3T4XA 4BO0A 3DBRB 4UBLA 5L3RA 5E2AA 2Q29A 3S5UA 1ZD2P 3STXA 5JUWA 3LKBA 3EH1A 4KUHA 1UIRA 1ZX1A 1Z7WA 2D3DA 4D8VA 2VDNB 1L3VA 1EE9A 3D3WA 5K9ZA 3FTFA 1AGNA 1UFKA 1QH9A 1C81A 1VG1A 4PSVA 4ZOHC 2OZPA 2X9VA 3MS7A 1QGUA 3LUKA 4J0EA 5SY6A 3BOSA 4YBRA 3RB8A 5BXQC 2OBMA 2C7RA 2OEPA 3KTDA 3LLSA 5ITVA 3GAZA 4YMUA 1UPFA 3J7TA 5C37A 2UVRA 3NHJA 1WR8A 1CW2B 4TQSA 1A7JA 1MOZA 2YN4A 2ZYTX 4C7KA 4JI3B 4CM8A 4LXXA 1X7WB 4MUYA 3WRYC 1YUNA 3BRSA 1JLRA 2TYSB 4QDZA 4S12A 3X1DA 2VHZA 2JVIA 2ZUFA 3UK7A 3KV3O 1NQXA 5TC4A 3C1ZA 1EXWA 3ENKA 4A0HA 2GK4A 1CF4A 2HDNB 3ZWKA 3HJCA 4YUAA 4C8LA 3CVUA 4WK0B 3BMQA 4LQLA 5T4BA 4CM5A 1GPWB 1JJFA 1GAEO 3EEBA 5HHHA 4J16A 3ZHOA 1D9ZA 1W25A 2AQIA 4OCZA 3QFTA 2E5FA 3ZBUA 2KE5A 2P3LA 4ZYTA 5JI2E 2HK8A 4JX9A 3M1IA 2QVYX 3G5MA 3U7QB 4CDGA 2XCQA 3ZUPA 1GPYA 2C0PA 2UZ0A 5IDVA 3LD9A 4KXNA 2F44A 4HWKA 4L2IA 4BZQA 4F5YA 3ESXA 4TKMA 5EUBA 3D9QX 3KHLA 2VHVA 2D13A 1MP0A 1U65A 1J39A 1NY5A 1A9PA 3A04A 1CY4A 1UCFA 4O4LA 3ZGVA 3ZE7A 4EJMA 2CF5A 3G5UA 4DCGA 5IW8A 3UPQA 1HDRA 3HFRA 4N6NA 5DH9A 3VTAA 4BNGA 2H92A 3C2QA 4D96A 2E85A 4DL2A 5C1DA 3PG5A 4KRGA 4LHEA 3RIMA 5JARA 1EA7A 3OKPA 4RTNA 5JZBA 5DNUA 1T4DA 2J3LA 3MEQA 4CKWA 3PSIA 3T1OA 3USES 2XMGA 3LFHA 3C3AA 3DE5X 4EQZA 2I2DA 4DWIA 5LYJF 1VB3A 3ABIA 3N7TA 1TCUA 2BH9A 4LOLA 1L5NA 5KOHA 3RI3A 3WWPA 3NTXA 3ROPA 4UE3S 4LC0A 2QMUA 1QE3A 2HIAA 4RTSA 2OH2A 1W5SA 4Z6CA 1OFHA 4BVAA 1XCBA 4D79A 3C5CA 4P80A 3SAFA 5TEWA 2NXJA 3RLFA 3VAZA 5A4FS 4N01A 3PUYA 4MW7A 5FBWB 3X1JA 2F8TA 5FBZA 2CL5A 5ABPA 5EIOA 1V7QA 1A8SA 1Q1QA 2P9ZA 2WTNA 3QWHA 3T0GA 4CCSA 4TQAA 3QBVA 4FEYA 4ED1A 2WF7A 4O4JF 4PTZA 1LFAA 4QC2A 5C32A 2AEEA 1CG6A 5D00A 5AMXA 3EXFA 2W7TA 3EXIB 2R85A 5DCLA 4M9NA 1CUWA 1TTPB 1X70A 2QGFA 3LP6A 3M33A 5KQSA 1EGMB 4D9JA 1E3IA 1V47A 3UXPA 5KNDH 1E1YA 1K5PA 2HJSA 2BFWA 4OO3A 5DB4A 3LW7A 3FMIA 2YV4A 1A2OA 5AXAA 4X3OA 1SUCA 3FRHA 4QU9A 1NU6A 3WK7A 2IC5A 2GM9A 4GW3A 2H7YA 4RQBA 1N1DA 4U7PB 1AGRA 1VHWA 3QENA 1WZIA 2VPZA 1N2CB 3HLTA 3LVBA 3BSSA 1XLWA 1JHMA 3PR2B 5KOIA 1M7GA 6PFKA 2H5XA 1Y1RA 3L1IA 4TMFA 1W5FA 4NP6A 5EUCA 3AT1A 1ZD3A 1ZQCA 2DPGA 3PNKA 2NRXA 1MN6A 8ADHA 5J4VA 1WP4A 1R6TA 2H1HA 2XOKD 4NXZA 4PHEA 1NTOA 3BXPA 1KBOA 3L7OA 3NHAA 2XDAA 4ND3A 1DIGA 1H22A 1JRLA 3ZWPA 4E08A 1JR3A 1K4YA 1PJ8A 3S27A 5LFAA 3UQZA 5KFXA 4BP9A 4NBTA 3ST7A 5L1LA 2C2KA 3E8MA 5EJ2A 5F2EA 1VL5A 1YU9A 4CN8A 2HN9A 4IG4A 5JXHA 1M8FA 1EP3B 1Q1EA 3CFYA 3EZ7A 4Y0NA 3JARA 5EZQA 2FFBA 1BHSA 2QM7A 1OKKD 4Y3UA 4YRTA 4AO7A 3BCUA 2MU1A 3HP1A 3W6NA 1TC1A 3UXHA 3VJLA 3BT7A 3U40A 3CG4A 3BIOA 4DT1B 3B78A 4IUDS 2CL6X 5E3JA 2O59A 4CF5A 3FWHA 4XDGA 5C46F 4EPVA 2CVZA 2JDIA 1X1CA 2AC2A 1RKQA 4EYHB 4QXPA 3DGEC 1A8QA 4C8NA 1Q74A 3EDCA 1F6DA 5FI5A 3TQOA 4DTIA 1GEGA 1VXOA 1ZOOA 5DOVA 3UZUA 1GTVA 4A1FA 3WKDA 2HVHA 5IABA 2LI6A 2QUJA 2Y9PB 4L75A 4OHWA 4WESB 3SJZA 3PSTA 1USGA 3TB6A 3R6DA 2Q5LA 3AF4A 3G1WA 3PPYA 2XYRA 4GLBA 4YI5A 3O3OB 5H68A 4BMOB 2B1IA 3QELA 1W8IA 3HGQA 4I2AA 1E7SA 2A9KA 2XRFA 4LOIA 4WZBB 3RDPA 1U4SA 3UWKA 4DSOA 5JH7F 2NTJA 1EUCB 3EA4A 3MK31 2QBYA 1NR5A 1XZCA 5FQOA 1WAMA 5JS2A 1IC6A 1ZVKA 1YONA 4M60A 5KYYB 1IPFA 4UDYX 3CRNA 4Q4CA 4D42A 3W5JA 3ZWBA 3PNPA 1L7OA 3KOOA 2G77B 3SZMA 3H2YA 4Z3KA 2JRZA 4HX5A 5AOVA 1JIXA 1H42A 5EMMA 4CDNA 3PD1A 4JOCA 3DMGA 5UKDA 3BMXA 5HJ5A 3OZDA 4E88A 2Q5HA 4ALLA 3TQCA 1SL0A 3WBJA 4Z9XA 3ESZA 3TSWA 4BNFA 1NBMD 2QTMA 1DUVG 1GQOA 3GPLA 2NMVA 1ENOA 2D1SA 2ID4A 1IK6A 2YWDA 3ISTA 2JLQA 2Q28A 3P20A 2FX2A 2PBLA 4AY3A 3G6YA 3K9NA 1XXHB 3PYLA 2BEWA 5K3BA 4QZAA 4I08A 4J76A 2AXQA 3SXPA 5CLFA 5KSYA 1TK5A 1DKQA 4KTTE 3ORYA 4W9MC 3KQNA 4PGYA 4TLDA 3MN1A 3AQ4A 3DEFA 4C4PA 2X13A 5LJIA 2WWVD 1KYVA 2A9JA 1HTWA 1JVNA 1SVKA 3H86A 1OXMA 4GQIA 3UGTA 5C35A 3IULA 1BN6A 3U6KA 4JI2B 4OHYA 4HPXB 5LB4A 3NT4A 1GRQA 2P2SA 1Q57A 2LW7A 3H83A 3NHZA 4H6PA 5C80A 4G8CA 4QZFA 1NULA 1RWQA 4GPAA 2QN8A 5C1IA 1ED1A 4X44A 2QYSA 3DLTA 5C18A 1WPRA 1WDKA 4WV3A 2WAQC 2HHXA 1KVRA 3JALB 4DNOA 4CG2A 5K3FA 1S4QA 4AYTA 2JB9A 1N5WA 2J3HA 1E63A 3C48A 4RA6A 4GGMX 4D9IA 1T6YA 1TW2A 4Z51A 3IVMA 3EXG2 1A4XA 1NUUA 5AM3A 1UDAA 3LT2A 3MGCA 3F5FA 3IV6A 3QNWA 5B2FA 1VPWA 1PQPA 3EIQA 4KXVA 4PS1A 4LJ8A 3D02A 4AUKA 4WJKB 1Q0HA 4CKEB 3M9LA 4AKIA 2DHQA 3V48A 4EHIA 1TQ8A 2PRSA 4C0XA 2WJZB 4ZCSA 3HCWA 2AT1A 3TIIA 3W79A 5IVKA 2P4SA 3B5EA 3AHEA 2W7PA 3AOEA 1FYDA 2V9PA 3I6IA 3MLAA 3ER9A 2VPPA 1SQFA 3SS8A 3T1HB 3ZE1B 1QGUB 1KRWA 3ESBA 1H0SA 3TFSA 5EQJB 4L4UA 1E5TA 1VJRA 3T9DA 4FHZA 3NTQA 1XD9A 4RD0A 2I2BA 4TRRA 2F8LA 1XSEA 2GF9A 5G5GA 2QRVB 2G04A 2R87A 4OHRA 1ID8A 4TYMA 3JZDA 2E1FA 3NVDA 5BV1A 8ICLA 3ZXYA 2DGDA 1Y33E 2ASJA 3KPVA 3KJFA 1O94C 4ZYYA 2QT1A 4MQFB 4JV5B 3ITEA 1ZQJA 2J3QA 5DCYA 2B2NA 1P72A 2EKQA 2WPDA 2JH8A 3LRXA 5KYVA 5EJ9A 5IAEA 4LF5B 1ZN8A 3IJRA 2BPFA 2EAMA 1L5WA 1ZQZA 3HO6A 4R16A 4ZVMA 3RTAA 1CNFA 4WADA 4B6JA 1CY1A 1U0TA 3JRWA 2EW1A 3B0XA 3LT4A 3O92A 4ND6A 5DM1A 3W2EA 1F12A 5C81A 4PO1A 2I7TA 4G26A 1G42A 5EVJA 1R12A 3NBYC 3OZAA 4E33A 5CDTA 4IIUA 5FUVA 5AJTA 2W6IA 3TBHA 3QXGA 5B7GA 1TIPA 2XQFA 1XWLA 4TWBA 2ZSEA 3UMVA 5DB9A 4C14A 1CP3A 3AL2A 1VL8A 1AGXA 3C7TA 1IZ8A 2P1RA 1YOVA 3SBEA 2QYHA 2REXB 2V1XA 1PYGA 5DBAA 2JEYA 3C7CB 3FDJA 4NG4A 4OXRA 1FFHA 4XWTA 4E51A 3L6RA 5IF3A 1U7OA 3ROKA 3OM9A 1PUJA 3UK6A 3CNQS 4ZT3A 2Y93A 4GZ5A 4BJHB 4E4TA 3SC4A 4AUEA 1K3UB 1R0BA 4K46A 2WDPA 2J08A 3LVQE 4O4LB 4Y0VA 1J0CA 4DABA 1GRNA 1IOZA 1NJ8A 1P4HA 2SECE 1N63A 5EHXA 3TSOA 5LWQA 1G16A 2IBTA 3QWFA 4YCDA 2IYXA 2IPNA 3LSYA 2GETA 1SU8A 4QXRA 4WBNA 3NVWA 1DELA 2FQ1A 3RVBA 3O2JA 3R74A 4EHJA 4W1QA 3OCUA 3OUZA 2I4MA 1TW3A 1F9EA 2A7XA 3VV3A 4IUCS 4TUYB 2GBLA 3BL5A 4R9VA 5T4FA 4DOAA 3G0CA 2PGOA 2O57A 4KG7A 2DR3A 4NBRA 4BLUA 2E8OA 2C78A 3H9JA 4EAAA 3H0CA 3O4HA 3FYDA 3RH6A 2AOTA 4LWQA 4KITB 3UJHA 1N4DA 4L4YA 1Z62A 3VYWA 1G98A 1NK5A 2E3TA 1ZD1A 2GR9A 2M9NA 3BKXA 3C41J 1Q2UA 4ZCRA 2WUFA 5B1EA 4OA8A 4ZXPA 5LP1A 2B6NA 2VVTA 1SXJE 3C6BA 4XIIA 5I7FA 5EPEA 5CG1A 3KHTA 1WHTA 1XQWA 2PEYA 5T8KC 4DVGA 5KTSA 8AT1A 1BS9A 3AG5A 1N34B 1TTTA 3VDRA 3LT1A 3LDGA 4G09A 1VPDA 1L4FA 2O8FA 1DEOA 2QVXX 2ZE8A 1MJNA 4YD1A 3M5PA 4I2VA 3EGEA 1JI7A 4KB5A 3S2ZA 3FZEA 1EUYA 3JQBA 1IZYA 4HNAB 2KVSA 6REQA 5IT0A 4DV1B 4WNYA 4B9UA 1WNFA 4JA0A 1ZM4A 3KWJA 1K6MA 4UPDA 5F12A 5F5XA 2G0NA 4MLCA 5SYMA 4LRYA 4N3CA 3F98A 1SKWA 4TL7A 2I71A 3MFQA 4OTZA 2HRRA 3ZLJA 4MKIA 5I48A 3GI1A 3S1LA 3W34A 3B7PA 4POAA 2HLDD 1UWLA 2GAOA 4EW1A 1RZTA 2NUTB 1LUAA 2ACEA 4P32A 4BKRA 3R9KA 1A88A 3JQDA 4QBTA 1I5OA 1GZDA 1TGVA 2ZQZA 4ZZ0A 4N7JA 4HTFB 3F7NA 4DQQA 3O74A 2FZVA 2PVPA 4D8YA 5IULC 4QUBA 3GVIA 3E3OA 2O20A 2X7XA 3PNMA 4JBYA 4Z6KA 2JIDA 2QW1A 5ERYA 3ZLVA 2J6SA 4FLEA 4BMDA 5LIPA 3JWPA 3MTDA 4MHTA 1R4NA 4M8IA 5NULA 5I4KA 3QWBA 2IIPA 3GFKB 1LBIA 4CCHA 4EARA 4FS1A 4TV9A 1U0LA 1J7KA 1TK3A 4UTXA 4BVGA 2GTHA 3V32A 1TJYA 2DF8A 3CIOA 3KWMA 4JYPA 4TN5A 4G4SO 3ZTYA 3ZLTA 2EWMA 3VPBA 1NKBA 3AR5A 4PO8A 4A8JC 3AL3A 2CHEA 4DIEA 4MR8A 3ONNA 2HX1A 4EUKA 2VJLA 4U2FA 4PZCA 2DUUA 4F8RA 1CUKA 3N8IA 1KDTA 4D45A 2YCBA 3U9TA 4EG6A 4MCJA 1CRPA 2NV2B 4DG5A 3GDFA 9LDBA 1GRRA 3WL8A 3A2MA 1ONBA 4K88A 1KFDA 4H4DA 3AEQA 1KSPA 4JP1A 4KQ2A 3KVOA 1GSIA 3T95A 3PX6A 2FWNA 3SSNA 1ZYUA 4JJIA 5GOTA 5D85A 3OT1A 2IPXA 5DLFA 1X92A 1YZLA 4X60A 4XA5A 2JBAA 1LW6E 4HLCA 3VHRA 2CMFA 2VJAA 4I66A 4AXBA 2I9GA 2I6UA 1JDSA 1FW8A 3EPPA 4TWJA 1ABBA 2RHTA 1IXRA 1WWKA 1Z9BA 3SZOA 3UT5A 4BQEA 2CN1A 4DJFC 1H6BA 4BCCA 1T94A 4D3YA 1AVTA 2WTFA 5FA6A 3RS7A 3UTCA 2PBRA 4NOJA 2G6BA 2WD8A 3N2ZB 3KXDA 1E8DA 4C3OB 4BBZA 3R24A 4WK4B 3NHPA 4NULA 4BNZA 4OVKA 4KI0A 4OLBA 4XGKA 2VWGA 3WA7A 3IQZA 2BBTA 5TZVA 1FTGA 4GWGA 3R3ZA 3EG9B 3CNLA 3E15A 3B70A 2YY5A 4WZ6A 1A6SA 3MRSA 4PX5A 1KJIA 2V3VA 3VZRA 4Z49A 1S10A 2A1UA 4CM6A 3SQWA 3TD9A 2FN9A 4Q3NA 3UIEA 4YAKA 4W8HA 1KE2A 3I6YA 4ILEA 1D8TA 2XTNA 4I46A 4ZZ2A 3UWMA 3RFFA 2OFPA 1Y8RA 1DEXA 5JTTA 3ZCSA 1P0FA 1TVKA 2Q4OA 2QVBA 4V0QA 3OJOA 4C22A 2WEKA 2A33A 4PBRA 2IYLD 4HUQB 3C14C 2WZCA 2GKSA 3Q7EA 5HVNA 5DOZA 4RUCA 4OYLA 1TQ4A 2AYXA 4YJDA 4D9BA 1RJ9B 2IITA 3PR4A 4QUGA 5JMPA 2IEIA 5GJBA 2BZ1A 2EAPA 4LZDA 4FD3A 5JZMA 3L0OA 2D5BA 4Y6LA 1KO1A 4ZODA 3BGSA 1NMXA 2XNDD 3CONA 3OO1A 3QYPA 3WLTA 3STUA 3X2FA 1USVA 3W6ZA 2PX8A 2O52A 1JW9B 2R8YA 2XZPA 4NBKA 4CCAA 3VHXB 3ZV4A 1F7UA 4QYXA 2PRZA 2UYQA 3LCMA 3IR5A 4IW3B 4L9WA 2MMCA 4R1LA 1E2FA 5TT0A 4D8UA 3TUZC 4EI9A 3IP4B 1RPTA 1WWVA 2QAGA 5A3RA 4IJ5A 2PI5A 3MMNA 3L4KA 3NWPA 2HVIA 4NBWA 1UJ6A 5DK4A 1KRXA 4NLNA 1OREA 1FFGA 1COKA 4JC5A 3UJ7A 1I36A 5IC6A 1PG0A 4M9LA 1PWXA 1ZI9A 2GM3A 1CY2A 2QTWB 1C4OA 2X0IA 3GH1A 5GTHU 9ICAA 2XW6A 4ZAWA 4ZCPA 2XT9A 5JCZA 4YP3A 1XNHA 3HB9A 4D0LB 4RGYA 3ZXUB 4L08A 1P31A 4NMXB 2N3ZA 3AH8A 2NSYA 2C9OA 3N7AA 1W46A 3TLYA 2P1ZA 3ICOA 1U9JA 2FZ5A 3MJ4A 1JGTA 1SVIA 2R8KA 4Q3CA 3HU1A 4RHYA 2RGCA 3SYLA 4YRLA 4P0PA 1IBCA 3E27A 3SJCA 4UNPA 4B81A 1FDOA 5CVDA 2GT1A 2QYTA 4OPMA 1CDZA 4PZUA 3LHIA 2GPYA 1FNCA 1JBQA 2Y1WA 3AWDA 3LH5A 4HQ6A 4W9NA 5JDIA 4RJIA 1GM5A 3ZR4B 1T9AA 3EGCA 1QSSA 4PRKA 3RSZA 1RSZA 1GXSB 3H7AA 3G0OA 3EIXA 4UQOA 4AY6A 4PZ0A 2O7VA 5AKLA 2C2XA 2BCQA 2G36A 3EIFA 3D3NA 4AX8A 2W6QA 2ZBVA 1VKNA 3VR3D 3NBAA 4ECAA 1DT3A 4XGQA 5CB0A 4ELTA 1Z36A 3H9QA 8ICXA 4O1MA 4QKQA 2ZI4A 2X6TA 3CURA 3PGMA 2K4EA 2D8AA 2Q5FA 2IWHA 2QQ5A 4P3OA 7ICHA 5FDFA 1I4DD 3A28A 2BKLA 2JFVA 4B44A 1AQIA 2N75A 4O3SA 3T5KA 3C5WP 4YQWA 3GEGA 3FHLA 4TMXA 3UHAA 1T2FA 2HUPA 2X6QA 5JSZB 4O5AA 1R1DA 2F3QA 2O2SA 4NL9A 1KEEB 3O0FA 1Z19A 1YCDA 2FWPA 2HCRA 3CF2A 4FONA 4U8GA 5IK2A 1DG1G 1AX9A 1Z5UA 5DMHA 1L5FA 3IXQA 3ICEA 4C8MA 1EM6A 1HKHA 1O6ZA 2AJDA 3UXYA 1QAQA 1GGVA 2VHUA 1GPBA 3R44A 2WYWA 5C31A 4YUYA 3C5FA 2Z04A 4XB1A 3RKUA 3SZ2A 1MX1A 3K0FA 4IFBA 5FYQA 5B3AA 1KXZA 1VLBA 4RVUA 4UHDA 5DYWA 4YV2A 3N8HA 3GDWA 1I6MA 1DIRA 3F6EX 3O93A 1ONNA 1CU1A 1FDWA 2C2EA 4RK1A 3E81A 4JI1B 3FYUB 1YB6A 2XBLA 1RI3A 2HGSA 1T2CA 2J9FB 4MLDA 4Q34A 1ZK3A 2MSDB 4E21A 5LYJB 1SZHA 1D8BA 2H2IA 2PMEA 5IEJA 2W2TA 4DN6A 5AW5A 2IKQA 2R48A 2ZI5A 3SFZA 4F7WA 3CC8A 2AD1A 2C2WA 2FSGA 3IH5A 3PRKE 4DREA 2NM0A 3ACBA 2OM6A 3HI6A 4PHFA 4ETNA 1EXVA 1VIAA 1D1TA 4JUAA 4DW8A 3H42B 5J0UA 4QDKA 5J2UF 3DTVB 1FU8A 1YR2A 3LWMA 4I28A 1FDUA 1IDN1 1N7IA 2P3OA 2X8AA 2ZDHA 3A3OA 4LRUA 2H6EA 1BE8A 3W1EA 4RU1A 4RVSA 4NU6A 1XNGA 2GZHA 4OHZA 4P22A 1PVRA 4TXNA 1T4BA 1SHZA 4RF2A 2IDJA 4HWTA 1BROA 2H4JA 4J0HA 5DB7A 1GAJA 2Z1MA 3FRIA 1Q2XA 2FRXA 3VNRA 2JJ8A 2C8VA 3GMDA 3V4FA 4OX9B 1JEAA 1QU3A 3AO0B 1H3FA 1QIGA 2Z3ZA 3DOHA 5HIMA 1FBNA 3CLTC 2CE7A 1G3RA 1XALA 4FBMA 2VSQA 4F50A 4DAEA 1U0GA 5IAAA 3HU2A 1ORIA 3AIIA 3OTIA 4KIFA 4BQRA 5E6UA 1CZLA 1X1TA 2R25B 2B1QA 3W5HA 1Z1VA 1K3FA 2HWKA 4A10A 1G6Q1 1H0RA 4E5UA 2QD5A 2FZKA 1DBQA 1IAQA 2G83A 2IYYA 4F4DA 3FTQA 4B71A 4ZIRB 1KFCB 3PDWA 3UQ0A 1F4PA 2JDID 3LC0A 4UU8A 1DRKA 2QR5A 4MFFA 2FVXA 4O2AA 1V3QE 1NOIA 5FBRB 4OI1A 4C6SA 5M29A 1JIVA 2BFDA 3M6VA 4E5YA 1S2GA 2XUHA 3KHKA 3PXAA 4OFXA 3D43A 2QKQA 1XG5A 4E6EA 3AIMA 4RJJA 2X9NA 1G3UA 2GS9A 2A9PA 3VJKA 1I2ZA 4EKNB 1PV2A 3OSUA 1JA9A 1PJRA 3N6RA 1SU6A 1WUYA 2CJWB 4P1ZA 2HQOA 3KKNA 3ECAA 1Z88A 1H2EA 1V11A 3OKAA 3JPRA 1SK8A 2WHPB 1DPGA 3Q3GE 1P3DA 4GL2A 1CP2A 1K98A 2FUCA 2GF2A 2XUZA 3PNLA 4HXGA 4UVDA 1COWA 2XB4A 5HGJA 2AE2A 4P4NA 1BG6A 1TLFA 2PKCA 3RLIA 4CJXA 3I4LA 4DG8A 1V11B 4KMRA 1F8GA 4ND7A 4R41A 2B69A 4TLMB 4MFCA 1YDGA 2AG5A 1UBKS 3OJEA 1C7ZA 3HADA 4H4EA 1Y1QA 2J41A 4P92A 3UTDA 4XWKA 3U4QA 1ZU4A 1R4AA 2ZEJA 3EUAA 2CVFA 1KQOA 4I4TB 4AU1A 2BTEA 3Q8KA 2ERXA 3ILVA 1L9KA 7ICQA 1FSFA 1P81A 3IT1A 4XXHA 1ZQWA 2V58A 2ZULA 2AHOA 2XCUA 1JLSA 3LAWA 4JBXA 4KIUA 4HYTA 4OUKX 4U1RA 3ELDA 4YJFA 5KKAA 4RQAA 4TXLA 4C21A 1YDHA 3G6VA 1XWWA 1OI2A 4HAZA 2RSLA 1KO5A 3FGNA 1MORA 3QFSA 4YUVA 5TQVA 3IUYA 1UUFA 3B8EA 4RHEA 3Q6IA 4KQFA 2XITA 3EFBA 1ZQVA 5DEOA 4KJXA 4GL4A 4TLBA 4Y67A 1RQNA 4UBIA 1PJ2A 1UWKA 1T7PA 2D06A 2HQBA 3ZCUA 3DWFA 3Q7PA 2R00C 1XAJA 1KU0A 4K3VA 4XQGA 2HNAA 2IDKA 2PS9A 1AG9A 4NPAA 1BDMA 3P9CA 4G2TA 3K9WA 2GLUA 4LWOA 1J8VA 2FPRA 4ISBA 3PQ7A 4Z86A 5BUZA 3DAPA 4HSEA 2HSDA 2OHJA 1YSCA 3ESCA 1PO7A 4DZRA 1OLSB 2VAVA 3QVJA 1U0HC 4J6EA 3F3MA 3N05A 2XVXA 3AVOA 3N2GA 1KTVA 2DU8A 4WJZA 4J9RA 4L3OA 1KA9H 3TLGA 3WP0A 1TM5E 2F9LA 3G2JA 5A3SA 4LGYA 2HZ7A 1YBAA 4EKDA 4J9OA 5IC4A 9ICOA 1Y7TA 2XUOA 5B58T 3AR7A 1KY4A 4HWGA 2H51A 2YICA 1BCSA 1T2UA 2FUG6 3DEHA 4RQNA 1YT5A 2B7CA 3Q15C 2BDPA 2CPRA 2QZSA 4KGXA 3UWSA 1JZTA 4KN5A 3C2KA 5JJ5A 4L76A 4BGIA 1Y3CE 5AUNB 1TLLA 2FN4A 3DE2X 5A5FA 4QUEA 1FFWA 1CYEA 4C0QC 4RM3A 4KJZA 4EEXA 4P0QA 4HX9A 1B2RA 4RHUA 1RMTA 1EFVA 2JI7A 4ETMA 1APBA 4E0DA 2PWBA 3DKRA 4FGJA 3FWZA 5KT4A 4QREA 4MUJA 5JXIA 1MOSA 1V25A 3TZCA 2JAXA 4BO4A 1TM4E 2ZU6A 4WQMA 4CIDA 1AV6A 5CM8B 5DHRA 4C2BA 1XD2A 2QIOA 2ZR8A 3TQFA 2PS0A 3CS3A 2R6GA 4LY6A 5CGZA 4UBNA 5AK3A 3FTPA 4N39A 4HXYA 3NI2A 4YV1A 4IG9A 3AESA 3GP5A 3U3DA 2CXHA 5I9MA 1T5TA 1G41A 4LISA 3MGHA 3GRFA 3HB1A 7ICVA 5DNWA 2IY8A 1MTOA 3QKTA 1N6LA 4AYBF 4N3AA 1NVEA 1P2FA 4RENA 4TTIA 1KSGA 3ZK8A 4HMOA 1FIQA 3E2PA 3B52X 2AUNA 5L4LA 3VHLB 3TINA 3VR2D 3LO5A 3V1UA 5H80A 5K05A 1U1DA 3RFTA 1QSYA 3M8KA 1AK1A 1T0BA 2E48A 4IOJA 2ZAGA 1UOPA 2VT2A 4DPMA 2HM7A 4IJUA 4YAEA 1XC7A 3WRYA 3LU1A 2IS4A 2IU6A 1CDDA 1Q20A 1X6VA 3R2JA 4RK7A 2MUTA 3LYUA 4CL2A 3ZE8A 5JQGB 2QRZA 3N7PD 1QLWA 3FETA 4FFBB 3SK0A 4G4IA 4ISCA 2GEDA 3EBPA 2O5RA 2ZROA 4I19A 4LJSA 1JZQA 1E4EB 7ICNA 4QW8A 3ICXA 1WBJB 2V5UA 1P2BA 3G8DA 4KO4S 4TUYA 3SICE 5DTIA 4A4DA 4FFBA 1GCIA 3CH6A 4LRSB 5EZ5A 1HT2E 2OXEA 4DMMA 2JLXA 1LC0A 4K87A 1M8KA 2ECFA 2IZZA 2CK3D 2K4HA 3G6WA 7MDHA 1V48A 4TM8A 5CB4A 3FG9A 1I13A 2AFRA 3JQ6A 4IDQA 1YOBA 4L4ZA 3DBVO 1XKTA 4IDOA 3F7MA 2O7SA 4MPPA 5FL7A 4GNRA 3UNXA 3ZWDA 3I6QA 1RS0A 1FMFA 4YMHA 3L3FX 2ODPA 3GJTA 3T7EA 6ADHA 1UMCA 5A7GA 3DTTA 4AD8A 4WL0A 1KMIY 2JLSA 4IV0A 5ER6A 5EYPA 2C8LA 3D4OA 3ZE0B 3OC0A 4IEFB 3R6WA 3L6EA 2FOLA 3KEGA 4QUKA 5SYNA 2OV8A 3K70D 1EBUA 1NK7A 1MJ5A 4ZGWA 4DY4A 1JA1A 1T4CB 1U9ZA 4NKRA 4NF2A 1DTSA 1GL3A 2XADA 2PO5A 4NEQA 5IUJC 1KVSA 2EJTA 3EVNA 4LUCA 4DNXA 4X1IB 1HL7A 1Z00B 2VK8A 2VPWA 1ZNWA 1EUDA 1BGWA 3WE7A 4N41A 4LDRA 3PA8A 2BCUA 4RQ2A 4BUGA 2DM6A 2FWRA 5J2DA 2QMHA 3FUXA 1O4WA 1X7XA 4W9NC 1XP8A 5A9SB 2FW0A 4IRCA 3SZLA 1RJWA 2C9BA 4ZMBA 9ICEA 3NBMA 3OIDA 1A72A 4KLJA 5GONB 3SYKA 3F71A 1PIWA 1QCYA 1P2TA 1WB4A 1WG8A 3L8FA 4KRXA 4X7MA 5LYJA 2JD0A 1XR3A 2P1DA 3KKPA 1SGWA 2O2JA 2I6XA 4M9SA 4D9CA 2MTBA 3G5AA 1O6GA 4P3PA 2EAUA 5FWXA 3Q98A 4IYRA 3W3AD 2AH5A 1XKLA 2ICAA 4OI0A 4QWDA 5CLGA 1G9SA 2JLVA 1X7DA 2Q0QA 3LUDA 3MDAA 3CBQA 4RMJA 4ZVNA 1E3SA 1CB7A 1JNYA 4BECA 1GEEA 4I2EA 2ZE6A 1N8TA 1CUBA 2WD9A 4F3KA 2EVWX 4KUGA 1GU1A 5CUQA 2RRDA 2QWXA 3ANLA 3WA6A 1IAVA 2P2GA 2ODNA 2QN1A 1AGYA 3GX1A 3GFQA 4P4LA 4Q1AA 2C7GA 1GO2A 4IFIA 2JLRA 2QAGC 3WO0A 2C2MA 2B0CA 1L3IA 1V2GA 4MB0A 3T5BA 1FK8A 3ZBQA 4BKPA 4OQFA 3FPEA 4ZCTA 1PHRA 2PXAA 4DDTA 3CSDA 3N2YA 3FOFC 3TTUA 5H82A 2F8SA 1IQRA 2ZJOA 3UB2A 2X9GA 1OTYA 2C3OA 4RBNA 4D3XA 3GHYA 4TTSA 3DFMA 4HB0A 1GHTA 2PDAA 4PHTA 1E3QA 5FNVA 4FQ5A 3R7WA 3HH8A 3Q7SA 5I4IA 3RNOA 1CBUA 1KS2A 4AMUA 1MC5A 1Y8CA 1H4QA 1AXEA 3Q3VA 1ZL2A 2X5OA 3L05A 2EIHA 1FMCA 1U3TA 1FLNA 1QHFA 2JIMA 2B8JA 2GOLA 4GRIA 3KKQA 2G28A 3RYCA 3GZFA 1Z12A 3DLAA 5JCJD 1F6BA 2RE8A 3KQVA 5TQ2B 2KZZA 3OWXA 3K1RB 1L2TA 4YR0A 1SUWA 1QYXA 2A5LA 2FZLA 3GG2A 1KC1A 2CLMB 4XRRA 4YGYA 3TFRA 3B82A 4OXXA 5SY9A 4RTMA 2YZ7A 1GL7A 4HEHA 4B9NA 1T5OA 5JYBA 1MO5A 4LTDA 4MGHA 1XZFA 4IO1A 4LVSA 1EBBA 4MGEA 1Z2AA 3NGXA 4H6XA 3ZH2A 3VXKA 4KLAA 1JXEA 2V4UA 2DPXA 4HZIA 4C80A 1IXZA 2ACVA 2YX1A 4GMDA 3K8OE 4REMA 4DQIA 1NQUA 3DOUA 4Y2GA 4JT4A 3RAXA 8ICBA 1Z6QA 3BPSA 3CWZA 2QX6A 4K05A 4P4TA 3K31A 4HEJA 3VU9B 2VAPA 2B1JA 4BMZA 2GLEA 5TPWA 4C30A 2Z9DA 3IDQA 4PCLA 4XW2A 1WDTA 1OF1A 2QL5A 3JQEA 3B1VA 4DJ5X 1LXCA 5LOVA 2JPDA 3NKFA 1W76A 5FNVF 1SJ9A 3W78A 1YHZA 3EXG1 4OLJA 2N1MA 3UJCA 5BVHB 3U56A 1JFTA 1P91A 5G4KA 4QDTA 2ZAOA 2XVAA 4US8A 5LDHA 3K70C 3LIIA 2NQTA 3UATA 4GXTA 3M49A 2WAAA 3GOQA 2FP4B 3AUXA 4RD2A 1RDFA 4LA4A 4UAJA 2EBWA 2HW3A 1I1QB 2H48A 1ZQOA 2F1IA 2Q3LA 3FCUB 3H5IA 5J2UA 4OSPA 3UA4A 5KVCA 4C87A 5C8YF 3PF8A 5J40A 3UG7A 3I9KA 2W9CB 1YQEA 1NT4A 3R0XA 3SV4A 3QY9A 1GGEA 2V59A 1HG1A 2H5EA 2P3SA 2NAFA 2GAJA 3F3SA 4MV3A 1GU0A 4N03A 1DHTA 3RGWS 3ANTA 1O2DA 2X0JA 4F9TA 2D1FA 3M6UA 1BPBA 1R15A 2NVUB 1C0EA 3FKSD 1AHPA 3KYCB 3CEAA 4QHTA 4ZREA 1BVSA 3O84A 4TSFD 4RZRA 3C2MA 2B5OA 5DV9A 2UVUA 4U9IS 2QD3A 2QTCA 4ED9A 5AO9A 2JFFA 4S04A 2AN9A 1WDWB 4Z6EA 2X1MA 2X2FA 2ZWIA 4JVNA 5DDMA 2ZVJA 2OAEA 5C3MA 5EE3A 2YFHA 4X1YB 3D4IA 2G5GX 3HJEA 1R6XA 1LBHA 2E3JA 1ZGGA 3H1EA 5J2BA 2A78A 3H9EO 1CI4A 1QONA 1ZJYA 3BA6A 4PLFA 5HBGA 4KQMA 1S2IA 3DOOA 3HKBA 1ZQYA 2OHFA 2HY7A 2O05A 4RFLA 4ZDJA 3SQMA 4TGLA 1BDHA 4IQGA 1TQHA 4AMBA 3I62A 4XI9A 3WGUA 1JHDA 2Z4SA 1E1RD 1DB3A 1DDOA 2ZUUA 1FDTA 5CP2A 1C7QA 5DNEA 1KR5A 2BN4A 2JFNA 2RK6A 3RS5A 3OU7A 1TECE 4PG5A 5FUXA 2WKRA 1D2NA 4J0KA 2VP3A 1AQ6A 3KJGA 4M88A 4MR9B 2XDQB 4YR2A 4YCAA 4F3CA 4FYHA 3D6NB 2CY0A 2YOFA 4N9WA 4X8OA 4B34A 5BMVA 1A9QA 3OCXA 4E5MA 1D1PA 3EASA 1UDRA 1W7AA 2C4KA 1ONSA 3D4PA 3IR7A 4M53A 4MR9A 1HFEL 3RHTA 1JBKA 3VISA 1GAWA 4Q9HA 3OMXA 1LTKA 2RB5A 1RMYA 4F92B 3E2MA 2PZEA 3NBXX 3HY4A 5KDDA 1XL1A 7ICTA 4GGPA 1FOEB 2QVLA 3QMVA 1AT1A 1RYHA 1ZOSA 2FP3A 2JGRA 1MN8A 2QRUA 3BMQB 5KQRA 1O96A 4DV5B 3L79A 1DC6A 2GZRA 1WO8A 4UTPA 4B3HA 2A5FA 4IQ0A 1SUBA 1ARZA 5TSDA 2PFGA 3BH7A 4IAOA 4QODA 1GT6A 3I8XA 3KVNA 2JH9A 5AVRA 3LI2A 1X0VA 3CG0A 3Q9LA 2GCEA 4GHWA 4Q21A 5KDOA 1ULZA 5AP9A 2JW5A 4HTFA 2I22A 2ZT8A 9GPBA 2O2YA 4U2DA 3OFKA 3K5WA 3REQA 3KXKA 1VMEA 2JH7A 2Q1TA 4HG2A 1XHFA 2O0KA 4LJ7A 3R20A 1E60A 4PN7A 5ITWA 1XFDA 2F3TA 3AVPA 1U2EA 4G23A 3WYCA 3QX9A 4BLTA 5L1MA 1RHJA 1Y6ZA 4TV9B 3K7EA 3NVKI 3RBDA 1GCGA 4FZVA 4EABA 3PGA1 2JZOA 4OHCA 1COZA 2F64A 2Q9CA 4B09A 2ADMA 5BVGB 4TT3A 2GD6A 1NPTO 1YDWA 3WQBA 3GHHA 5LC1A 2EZ4A 2JKYA 1GPUA 3WNDA 2DKXA 4XUSA 2Y99A 4YAOA 4MPRA 4QVGA 1O6BA 4C4YA 3WK4A 4UAYA 1VYVA 5F5LA 4DRXA 1BDIA 1CE8A 4W8OA 1G5HA 3TS1A 1HWYA 3Q3JB 4AJHA 3NBZC 2D5CA 3O1IC 1O7JA 2CJFA 2XA1A 1UP4A 2OV6A 3NRZA 1NJ2A 3NNDA 4S2UA 1P73A 5AQ1A 2V8OA 2PZAA 5M2QA 2AFIE 1UHUA 1SWVA 4RV5A 1T9ZA 1TMOA 1EEHA 3NOQA 4WLVA 4DAOA 1LBTA 5CA7A 4JJGA 8ICPA 1B16A 3GEEA 1A5AB 2FW8A 2O3RA 2VP0A 3S55A 4DLRA 1OLOA 5EP2A 1PFUA 3ZGNA 4CKCB 2Y1IA 2JGLA 4DSIA 2IHJA 1PX2A 1PP4A 3GP3A 2I8LA 3EEFA 3L7CA 1DQSA 3B7WA 1H1LA 1U45A 5GJVC 1DJPA 4IR9A 3KCQA 2HK6A 2R4TA 3O21A 3PFCA 3UAZA 2C0QA 3CKKA 2X23A 4UJ5A 2QW0X 3P9SA 4F5DA 1GGHA 2JI6A 4C4SA 2PKQO 1PFKA 1QPZA 3IBSA 4HS9A 4OREX 4J9UE 5JO0A 3LUJA 4HWOA 1JQLB 1AXGA 1ZCAA 3PEYA 4GXKA 3KKEA 3ME5A 5IDWA 2AJ8A 3VYSB 5HGXA 3NDPA 4B7ZA 4WNIA 5DPMA 3GLHE 1PUIA 3OE5A 1OB2A 3NDBB 4LZGA 2PFKA 5KC8A 4NCAA 5ALVA 1L7DA 1IN5A 1F0MA 4OJLA 1LSSA 2B9VA 3AR3A 3KXPA 2MCFA 2YKGA 4RK5A 1U99A 1OROA 2EKDA 2V5AA 2ZTDA 4WY2A 3TI9A 3Q8QB 1QPBA 3FHOA 5F9MA 3CY6A 3X1KA 3HPOA 3MSXA 4Y2SA 5FI0B 5HKOA 1CYDA 2HH9A 1W8DA 4UULA 5BPHA 3W4JA 2VTBB 4G5GA 3Q41A 2LWIA 4CV3A 4LGCA 3D54D 5KX5A 1Z35A 4I4TF 4MA4A 3NOOA 2ZJ4A 3BWCA 3GDHA 3JAWA 4BAZA 4B32A 1KPGA 1EINA 2QG9A 3INGA 3RR7A 2Q27A 4ER5A 1KARA 1N7HA 3V8NA 1KEPA 2MA1A 5DXAA 3H4DA 2A86A 4D99A 4RULA 3GV5B 1R50A 2BZ0A 3NGDA 3BFXA 1PVDA 1DLIA 3IT2A 3IVRA 5FOSA 4NXNB 1NVGA 4ZCQA 3G82C 4RJ2A 5JANA 1QHIA 2XH8A 3IEIA 2A6PA 1KDOA 2VKTA 5EJAA 3PSAA 2C3UA 4Q9KA 3ZH9B 2C7PA 2VTDA 1W49A 3IPRA 4IQTA 2I9PA 4UNIA 2VYNA 5H5JA 3V42A 3C3XA 1XTJA 3EHEA 1XQVA 1M5RA 4Q4AB 5J2EA 1G6OA 2QUZA 3DJFA 4H15A 4JODA 2QX7A 4QTZA 4XQEA 1RCUA 4ZOQI 1XPRA 1B6GA 5A04A 2RHFA 5G40A 1VGQA 2PS1A 1G0OA 1XZPA 4BRZA 2YBDA