3QU2A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu2A01
2CN1A 4KNWA 1ZRNA 2HF7A 5AM5A 2MSNA 5AVSA 1ZD3A 1K1EA 3S6JA 2I54A 2CFSA 3KBBA 5ALIA 1YDFA 1XPJA 3AR9A 2G09A 3KC2A 5AK4A 5ALXA 1Z88A 1S8OA 3HYCA 3I28A 2ZG6A 2YJ3A 2HDOA 4I9FA 3PGLA 3AR2A 3KDPA 1U02A 2FEAA 2I7DA 2YMMA 3KZXA 3E8MA 4BX0A 3QU9A 3L0YA 3OCVA 1Z4LA 1NRWA 3MC1A 5AW7A 4Y2XA 4FYPA 3U13A 3U19A 1RMTA 2IA5A 1O03A 3QNMA 2HSZA 2GMWA 5AW9A 2BY4A 1EK1A 1JUDA 2AH5A 2W43A 5ALOA 4BX3A 3A1EA 2DQSA 2ZBEA 5ALDA 3ESRA 1SWWA 4EX6A 1EK2A 1AQ6A 3DDHA 3MMZA 2HO4A 4J2TA 4EX7A 5IT4A 3ZVLA 1U2TA 4BNDB 3ZI4A 3L0CA 5ALKA 2B0CA 2YMPA 1Z4JA 2G08A 3ZX5A 5AICA 4GIBA 4YH1A 4F71A 2ZBDA 4EENA 3AR5A 5ALJA 4I9GA 1L7PA 3WKBA 3AR3A 5AI4A 4C4SA 3EF0A 3EWIA 3RF6A 2FDRA 4OCZA 1ZJJA 3N07A 3NUQA 3M1YA 2GO7A 4C4TA 1Z4QA 4Y2VA 3FM9A 5ALPA 5AW2A 3FPSA 4E88A 3A3YA 2IOFK 3AR4A 5ALSA 2X4DA 1TJ4A 5AW4A 2YN4A 3E81A 5ALEA 4KX3A 4OHFA 3NALA 2AUTA 2YMQA 2EARA 3L8FA 4FFDA 5AIAA 4KX5A 3CNHA 2GHQA 3WGVA 5AW8A 2HX1A 1RC8A 1Z5UA 2R8ZA 3D6JA 3B9RA 5AW5A 4BYGA 5ALNA 2AMYA 3ZVMA 3WKCA 4KN8A 1L7NA 3N1UA 3W5DA 3NAMA 5ALQA 2RBKA 4UMDA 5AKZA 4CF5A 3WK4A 1ZD4A 5AKIA 2FPXA 4IG4A 4HYTA 2EAUA 1SWVA 4L6AA 4BNDA 3UMGA 4AS2A 2HCFA 1RQLA 3R4CA 2G0AA 2O2XA 4L6CA 5IS2A 3PDWA 5AKGA 1YNSA 4XOUA 2FPRA 1RMYA 4MWOA 2JGAA 3FGOA 4GXTA 4UMFA 4UMVA 2FUEA 5AKLA 1RPZA 3W5AA 3NIWA 2G06A 2C88A 4UASA 4UARA 2JARA 4Y2UA 3QYPA 3I1YA 3A1CA 4UU1A 3I6BA 4PNHA 2I6XA 3BA6A 2G80A 4F72A 1RKUA 1TA0A 2B30A 5AW1A 1S2OA 3SHQA 5AM1A 1Z4KA 3VAYA 3OCZA 4OFZA 2Q4RA 2JAUA 3WK7A 5AW3A 4HAIA 4CF3A 4NAVA 3U26A 2FPUA 3UMCA 4YIHA 5ALYA 3IJ5A 3E84A 3AR6A 5AKKA 2GFHA 4RESA 5AVTA 5AVYA 4HGRA 4EEKA 2HHLA 3WKDA 3SKXA 2QYHA 2OA0A 1TJ3A 1RKVA 3L8EA 2B8JA 1LTQA 5AVZA 2ZOSA 2ZBFA 4NFLA 4H1WA 3L1UA 3ZTWA 1QQ7A 4Y2SA 3L8GA 5AVRA 1Y8AA 3PCTA 2O9JA 3W5BA 3OCUA 3WK5A 3OTQA 3QLEA 5AVQA 1L7OA 3L1VA 4DWOA 2B1RA 5ALMA 3QGMA 2VKQA 4OD0A 1F5SA 3BWVA 1Z5GA 3AR8A 4XPZA 3UM9A 1J97A 1VJRA 1Z4PX 3U7HB 3U7GA 1O08A 2WM8A 1RDFA 3P96A 3OPXA 3SMVA 4XQ0A 3U7EB 4B6JA 5AK5A 3SKYA 1U7OA 3UMBA 5ALVA 5AKJA 3QU2A 5ALZA 2ZBGA 5ALFA 5AVVA 1ZS9A 3K1ZA 2BDEA 1U2SA 5ALLA 3L7YA 3J7TA 3QU4A 5AI6A 2IYEA 2FUCA 1SU4A 2B1QA 3KOOA 2FPWA 3EPRA 4YCNA 4UATA 2Q4TA 3W5CA 3I76A 2WF5A 1Q92A 5ALGA 4YGYA 2I55A 5ALTA 3PGVA 2C8KA 1PW5A 4ZEWA 2PKEA 1RLTA 4DFDA 2RARA 1QH9A 5AW6A 2RAVA 1Z4MA 2HEGA 2CFRA 3RFUA 1VFPA 3OCXA 1X42A 3SF0A 2OM6A 1L8LA 4HGPA 4NABA 3QUCA 4YCLA 3ZU6A 3DAOA 4Y2RA 2I33A 1Q91A 3ZW7A 5AVXA 5AK6A 4HGOA 3ZWKA 3F9RA 5AESA 1MH9A 4DW8A 4Y2JA 1ZOLA 5AKHA 3FVVA 2Q5EA 2EATA 3IB6A 5AVWA 4UU0A 4BBJA 2P9JA 2C4NA 2NO5A 2WF6A 3ET5A 2HF2A 2B82A 3ESQA 3B8EA 1J8DA 1XVIA 4CNQA 1CR6A 2HOQA 2FPSA 3CZ4A 2WHEA 4CE6A 4Y2YA 4UAUA 2MU2A 5IT0A 4YIKA 4BEWA 2NYVA 5AI9A 2GHTA 3NASA 2PR7A 3N5KA 3QUBA 4DCCA 3SLRA 5AKYA 1L6RA 3QU5A 5T41A 3R9KA 1QYIA 3HLTA 3DNPA 3FZQA 3ONNA 5ALHA 2BDUA 1WZCA 1N9KA 4G9BA 2P27A 1Z4OA 2JAWA 1KYTA 4Y2TA 3KD3A 4UW9A 2CFTA 3QU7A 4EELA 2WF8A 1T9ZA 2IOFA 4UM5A 1L8OA 2WFAA 1RRCA 1RLMA 4QJBA 4BKMA 4L57A 4UMEA 2HI0A 4Y2QA 4CF4A 4ZEXA 5AIBA 2G1AA 2C8LA 4HGQA 2RB5A 2P69A 2R8EA 3U7FB 1L7MA 2YFYA 2QLTA 1YV9A 5ALUA 1TE2A 2YJ4A 1U7PA 3N8GA 4KYTA 1QQ6A 2YJ6A 3L0BA 1T5SA 4RETA 4C4RA 5E0OA 1WVIA 3DV9A 2PQ0A 3R09A 5AHXA 2R8XA 2OYCA 5AKEA 3TLMA 4Y3UA 2NO4A 2YJ5A 2YY6A 2ZXEA 4NWIA 3ZWDA 3L5KA 3IRUA 3SD7A 1YMQA 2I34A 1RLOA 1IWOA 4JB3A 2G07A 3OCYA 1TJ5A 4KNVA 3AR7A 3WK9A 1WPGA 4G63A 4YCMA 1XP5A 3L8HA 3ZVNA 4BX2A 3WGUA 1WR8A 1N8NA 1RQNA 1VJ5A 5AM3A 3E58A 1FEZA 2FI1A 5AKXA 2YMLA 2AGVA 4HGNA 4O8CA 1Z4NA 1LVHA 4XE5A 3MN1A 4AP9A 4ZEVA 3N28A 3M9LA 5AI5A 1CQZA 3WKEA 3QUQA 2P11A 3ZUPA 4J03A 5A3RA 2B8EA 5AW0A 4FE3A 4QQFA 1ZD5A 5ALWA 2MU1A 3EF1A 5AM2A 3OCWA 4JDPA 5AVUA 5AI8A 2W4MA 1YJ5A 3WK8A 2WF9A 5AK3A 2D2VA 4AS3A 3B9BA 3ET4A 3GYGA 2YBDA 2ODAA 1YS9A 5AM0A 4MUMA 4BEVA 1ZRMA 3FPBA 3NANA 3ED5A 3A1DA 4EZEA 1QQ5A 5FP0A 3NRJA 1RMQA 5JJBA 3QXGA 1RKQA 3QX7A 5AI0A 4Y2PA 2R8YA 1T5TA 2IOHA 3MPOA 5A3SA 1NNLA 5ALRA 1NF2A 2C9MA 4IFTA 2W11A 4NV0A 1ZD2P 4UAVA 2WF7A 4UM7A 5AM4A 3ZTYA 3ZX4A 3QUTA 3WKAA 3WK6A 2JAOA 1Z4IA 5A3QA 2OBBA
chains in the Genus database with same CATH superfamily
5FA5A 5FI0B 3DQZA 2GDZA 5E4JA 4OLAA 2OLEA 2Q7XA 1K1QA 3N53A 4G3IA 4QRHA 4EAAA 1RXYA 3B7WA 5DE3A 5GWXA 1IHXA 2FMFA 1X1AA 1RQ7A 2EX1A 3D0RA 3L3BA 4BCCA 3R6LA 2H2DA 1M0SA 3FF4A 2EP8A 4GRDA 4EYHB 3CNNA 3KETA 4Z99A 3CRZA 1KQOA 5HR6A 1ESMA 3RS5A 4CT0A 2IJGX 2NX2A 3PE4A 3MCTA 2OSBA 4OXRA 3SYLA 2BGTA 3O8RA 2XZLA 2CVFA 3MEQA 1WZIA 4ZOEA 2KB0A 2G5PA 1K0FA 3L8MA 4UU8A 2DXIA 3VR5H 1EUDA 1PX0A 1UEJA 3FKSD 4RIIA 3TZBA 1P75A 1A2OA 2MYUA 3O9MA 4BRSA 3W5VA 4G2NA 2A35A 2V54A 4MWBA 4OA8A 3KJHA 2VXYA 1TGYA 3NTLA 2H8GA 3LCCA 3LUKA 1R6TA 1TEHA 2JA1A 4NS1A 1V3VA 3WK4A 3IKTA 4Y18A 3DAHA 3PNCA 2EAUA 4B7UA 4I28A 3HPOA 5K6TA 4FI3F 1I30A 4JVMA 3IP4B 3I8SA 1C7JA 1DBIA 4IJ6A 2BHLA 2IXTA 1M8GA 3JYQA 2OZLA 5KCZA 4KC0A 1MEOA 2ILTA 2F55A 2R7NA 4YDHB 2JLVA 2C98A 4F9EA 2FWPA 4CMHA 2ZDQA 2EIHA 5IAOA 3A1NA 5DMHA 4IJUA 5GY7A 4AJJA 3BTOA 4AXBA 2FPUA 3GLUA 3ZC3A 3K09C 5DTEA 4RTPA 4N3GA 2F6RA 3M9WA 2YN0A 4TT3D 1X86B 1WCNA 5EHXA 4YMOA 5A5VA 4TLBA 4NDAA 1E59A 2L0XA 1BDJA 2GERA 2Q9CA 4EUEA 1P4JA 5CA0B 4RFVA 1SMKA 2R11A 2YB1A 3D54D 1RXEA 2GYVA 1BPEA 3IIEA 4XGKA 4XQ0A 3AETA 3A9UA 1H05A 2CXQA 4DSFA 5KUTA 4M04A 2E4VA 1AUOA 2G1UA 7ICSA 3N8KA 4ZV9A 1ND6A 4CLHA 4I5IA 1BROA 3EUEA 2OR3A 1JPNA 2FMIA 3V6HA 1J70A 5C53B 2RAVA 1E3LA 4TUYB 4CM9D 2JFNA 5J0TA 3WSVA 2F1IA 4JLAA 1RM4A 3W8RA 5AVXA 4EKNB 1ZQIA 9ICQA 4RS3A 2H3QA 1GLNA 3WYFA 2FVYA 4KXFB 3VTKA 4E33A 5C7OO 3ZJYA 4EPRA 1ZH4A 5GADl 1TQDA 1SBYA 3OJFA 2RQ5A 2MU2A 5IT0A 1FFBA 3LK9A 5JZSA 1XLTC 3NV7A 4JBIA 2OQRA 1JBEA 3GGCA 1U48A 5L1JA 1VZ2A 2YIVX 1R3DA 4IFBA 1TJPB 5LIPA 3AU8A 3GVXA 4JI4B 1QLWA 2VH5R 2XUHA 1WAMA 3LRPA 2NV3A 2P2SA 4HGQA 3LO8A 3S5JA 3T1QA 1NONA 1J0DA 4XEHA 1AHNA 2YNMD 2VJMA 3ZE0B 4CFSA 4MF8A 2PQ0A 3GROA 4Q37A 1HURA 1PUXA 4U3JB 1V9CA 1NG1A 2ZROA 4RA6A 1MTZA 1IWOA 3ZWCA 4ZJUA 4IILA 2FI1A 2AGVA 3I9V6 1OZ0A 2LMRA 3M70A 1JEJA 2J5BA 3NHUA 3OZWA 4FOTA 3VC1A 4NY1A 1OF1A 1REQB 5FLXA 4G1VA 2I65A 1NZJA 3TEFA 2BMFA 4FBLA 1VL0A 4AS3A 4LXXA 5KTYA 3ROZA 2HV8A 5BOVA 4UB8U 2AD1A 4F97A 1Q17A 5E7IA 3V80A 4QLOA 1H1LA 2WUGA 4UM7A 2VQDA 4FYMA 3UA3A 3THYA 4DO9A 5IDYA 2PSDA 5CLIA 3IAHA 1QRRA 4L8WB 2VBIA 5FQOA 1QV7A 5IYZF 1CUJA 1QMPA 1ML3A 1XCJA 4IR9A 2HWWA 2NYUA 4L4RA 4Q6WA 2LCIA 1DQSA 2AC4A 2AFVA 1ISIA 2CDAA 2VG8A 3WQBA 3IP6A 4WFJA 1CJBA 3CH6A 4ZYUA 3IEVA 3C3DA 3TNFA 5C46F 2YMPA 2ZRHA 3RROA 2C5FA 4BLVA 4LXGA 4HLDA 1NL3A 3WJ7A 1L7BA 4DM7A 3MBOA 3AEKA 4MW4A 4X60A 5TQVA 3UT0A 1SVWA 1UBTS 1BJRE 1ZO8A 1SV0C 5J0QA 2IOFK 1FP1D 3CO0S 4R3UC 3GD5A 2VHEA 4OSPA 2DKOA 2GWRA 4MKIA 2BCQA 2PX5A 1SA0B 5HTOA 4ITUA 1S77D 2F76X 5HILA 2BFNA 1RRPA 2PBLA 1RKXA 1W25A 1YFZA 2BHTA 3B6KA 3KOYA 5DLPA 3FGOA 4MICA 3EIFA 2EJTA 3M83A 4CM4A 4ECTA 1WP9A 1JJFA 3VR4A 5EEGA 3U4AA 2XMGA 2IHBA 3Q8XB 3UVEA 1V35A 1AXGA 5BT8A 1KJYA 2OVBA 2KG5A 1NBWB 3K09A 4UTVA 2H08A 2DBZA 3IEIA 4Z4FA 1XU7A 4Y9SA 3U0BA 4EQ6B 1DT3A 4QECA 1VI5A 4DOCA 6GPBA 4RDHA 1G8HA 3L1UA 1OH6A 3IUQA 1GCAA 2PGNA 2E1FA 3O3CA 2DFPA 4LJKA 3UPDA 4COKA 1X9MA 1QGZA 4J91A 3HFJA 4RK7A 3BGSA 4QOJA 4M54A 2DLCX 3B6IA 3MTQA 4O4JF 1ZN9A 3HA2A 4LF8B 3N97B 4WA7A 5GGYA 4ZKDA 1GGMA 2E4ZA 4E30A 3MJFA 1M2GA 2B3DA 2Z3WA 2IS6A 1IZ8A 2O2JA 3DVQX 1OIWA 1K89A 4K4GA 5CEFA 1HNNA 1E1QD 2CJPA 3OIGA 2I3BA 2H2IA 2OXCA 2W4QA 3B89A 1OKKD 1BHSA 4DEZA 1M6NA 3Q7IA 4E7OA 2IUFA 4PSCA 4CEIB 1PP4A 2BR3A 3VPFA 1LZLA 1TK2A 2ID9A 5FORA 2YHIA 1XLTA 4EGFA 4FZRA 5JECA 4X1KA 1MOQA 1XTJA 4HKTA 4WJ3B 1EGQA 1NVVQ 5KYTA 2HIAA 3EARA 2ODWA 3C1OA 2OBYA 4UDYX 3OOYA 4LFBB 1DKPA 4N76A 4BQIA 4WINA 2HRRA 4RZUA 4GGOA 1QH8B 3FCOA 4L02A 1DLIA 1KC1A 3BH6A 2J3HA 4G1BA 3PW0A 1NLZA 1JL3A 2YOHA 1EP1B 1CZOA 2HLNA 2Z2KA 4J6FA 1GZ7A 2IYQA 2ID4A 3R7DA 2D8AA 3Q7RA 3V4PB 4W9NC 4EG8A 2FN9A 3FZNA 3F0TA 3U3KA 3CEMA 1WUTA 2JGIA 1AKMA 1L3UA 1OA0A 1XDDA 3LLUA 5F1YA 1UOOA 4WY8A 4JDPA 1W93A 2HFKA 5G5HA 2I0FA 1V11B 1ZK0A 4M7WA 3GARA 1V96A 2IUTA 3NVVA 2XX3A 2B5WA 4I1PA 4AJKA 2BCEA 1A77A 4BJ5A 3BK2A 3HGMA 3QYJA 5EEHA 4UBCA 3V4SA 1I4TD 3WKAA 3TI9A 4IHAA 1F9AA 2OBBA 5LMUB 5DB4A 3ASUA 1FTSA 3AIIA 4F3CA 3W3AA 3I2KA 4JGIA 2P2NA 4MRRA 1UF9A 1W36D 3PGLA 4N82A 4JXZA 1ABBA 3THXB 3UMFA 3DM5A 1SZJG 1KSHA 1K5OA 3QVJA 3EEYA 4CIYA 1AA6A 1A9QA 4R05A 5FYDA 1AKYA 1GKLA 4DFKA 3RH5A 3SZMA 3VR6D 2O8VA 3CVWA 4RZSA 4LDNA 5JAMA 3GK3A 3VKHA 1FUKA 4WW0A 4RX1A 5TPWB 4C05A 1WTCA 3S99A 2D6FC 3LP6A 3D0KA 3QY0A 4DY4A 3IT0A 1Z22A 4EYKA 1SV0A 3ETEA 4NY8A 3GFFA 2W0MA 2JHAA 4D79A 3U4HA 2UZ1A 3RU2A 4Y6OA 5E8RA 3VPAA 2ZRQA 4IW3B 5KFUA 4LC1A 1XRJA 4Q4HA 2JGEA 2X4GA 1JMSA 2OO7A 1IG0A 2VA8A 3BRCA 2O7RA 3HPQA 3EDCA 4R2LA 3NOQA 4DCTA 3KSAC 2W8BB 5T4FA 2O2XA 3L2OB 1KDOA 1RMYA 1HDXA 2JLWA 3N2EA 4LYJA 5CUQA 4RH1A 5MGNA 2BGWA 1Q8KA 4GMXA 1CY2A 2EDUA 3B1YA 5T8KC 4J4HA 4RZXA 1AQYA 2JJ1A 2J1LA 4DSNA 2AOUB 3S2UA 1ORWA 3C21A 4LRYA 4OGGA 1QO0D 3NS7A 4DC0A 2O0JA 3D3KA 3KJQA 4NLNA 2W8ZA 3AI1A 4ZJPA 1XZPA 3CPJB 5J59A 1O4VA 4QGGA 2XGQA 2H06A 1BVUA 4OD0A 4GLFA 2ZE7A 3CKYA 2ZJ5A 3G17A 2J6BA 5AK5A 4Q00A 1XLVA 1GQQA 1XVUA 3O8OB 4EWLA 3KSUA 4PG6A 3HCWA 3W5CA 4WESA 4OBEA 4L5YA 2RGXA 1Q0ZA 4LGMA 3TZKA 4DLPA 2EX0A 3H2ZA 1XROA 4GX1A 1YBMA 4MB0A 5DP2A 2CSUA 5K8LA 4MHOA 3FWNA 4Y2JA 4Q1AA 2QSYA 3KPYA 2Q4OA 4L4XA 5DRTA 4USAA 3BGWA 2OGSA 5KG3A 1FNDA 2GHRA 7YASA 4NC9A 5KBYA 2Q5IA 3O94A 4KNYA 3PFWO 3J81k 1C7YA 3UMYA 2A9QA 3W5UA 3PC8C 2XXAB 5CM9C 1JLKA 2XMDA 2ZS7A 4QTTB 3FTQA 1TQ4A 5GP1A 3C5FA 1M2VA 1T5LA 2XUJA 4MYRA 4G9BA 1OZHA 1CEXA 4RQTA 4M9CA 3CUEF 1JXOA 3IVAA 4RL4A 1K97A 2IX3A 4B2LA 3U7FB 5HZGA 3A28A 3DBOB 4E4TA 3LRXA 1T35A 4CG0A 3JALB 4BMSA 3BZUA 4KXUA 3IOEA 4IH1A 5KG6A 1YCHA 4B9NA 1QIJA 2I34A 4MOWA 2H1WA 4BFZA 5AJVB 3T5LA 3AVQA 4UVIA 1DC3A 3KOXA 3M4XA 1XDZA 4DEXA 2QRZA 5TISU 2WUWE 1FYFA 4EVRA 3AF4A 1ADYA 5IX8A 3IDWA 4W9NA 2XO7A 1FZQA 4I36A 4GLOA 4CIAA 4PZUA 1HZJA 3QUQA 1E2FA 4P4OA 5AW0A 1PZXA 3IEUA 2CNLA 3HHEA 4IM7A 4IR7A 5CLQA 1B2RA 3BZKA 3ABRB 1UP4A 3W6NA 2ZE8A 4TYQA 4PYNA 1ECBA 1OYYA 4FYJA 1JXAA 1J8VA 2C07A 1NM5C 4HXFB 4YRRA 4IIFA 5B36A 2A3VA 2C7GA 4DQLA 4AN1A 1UDBA 4AZ3A 3UICA 4H7EA 4LZLA 1AS0A 4AUMA 4QM6A 1TGVA 1OAAA 2VDJA 3JAKA 3TSYA 4G0VA 1TKAA 3RRYA 3PNSA 5J63A 1JLSA 2WVGA 3MF4A 1G2OA 1WMEA 4HAWA 3RBDA 3K6KA 5ULLA 5JVDA 4ND5A 1VL5A 1K9VF 2WWHA 3AEYA 4JLNA 3OLCX 4IXNA 1WY5A 2FMKA 4C3OB 3ZE9A 1B3RA 2ORIA 1TU3A 5E4YA 3WDSA 1O97C 1AVTA 2BEJA 2D6FA 3UMVA 3CX8A 2JBAB 4C6TB 4QHYA 5AWFC 4MTLA 5ALPA 4M1QA 1SVUA 4E88A 2G28A 2BEWA 3MAAC 3FPJA 3TVYA 2AEJA 1IY9A 4IIJF 2UYHA 3ORQA 1NFFA 4GOLD 5FL7D 1B6GA 2H51A 3MR6A 3WKCA 3R7BA 3RUIA 4GC5A 5E6SB 1GIAA 1M34E 4DV3B 2WWIA 1E8MA 2WD7A 1L5MA 4FYIA 2BTOA 3RT1A 4WFQA 3JCZA 5LKAA 4O9MA 5IVIA 1JIXA 5CDUA 2E5SA 2R3SA 2ZSUA 4DRXA 4YAOA 3K8OE 4QATA 5T8KA 3SU8A 1KP3A 2M6LA 2L82A 3KB2A 1KZ4A 1D9ZA 4BX9C 3LGXA 4QEDA 1GNTA 2M0NA 4HOYA 4MHSA 2P1DA 5KMGA 5JMPA 4IIEA 3CW9A 1PYOA 3LT5A 2D5LA 4L95C 2IFTA 1LK7A 2YVLA 2WYUA 4DJEC 1ZJMA 3H18A 4V2IA 3IPRA 1FS4A 2F3UA 3F96A 1MDBA 4ATNA 1I9GA 4NENB 3DYVA 1LB1B 1UJNA 3TM5A 2HPZA 2HHUA 5CB4F 1DQPA 2Q27A 1NJ2A 1DAFA 1WU8A 4MV9A 1DTSA 4XFDA 2JEYA 3GVHA 4EGCB 1C9JA 4OQZA 3PPYA 3G02A 1N2BA 2B1QA 1BA3A 1V16B 3QENA 4UHFA 2I5PO 3VX3A 5EERA 4MJ7A 2OK7A 3RHZA 3GT3A 1S2MA 5KTMA 3QUCA 4XWTA 4DWVA 1FBNA 2NXJA 2HQSA 4C8MA 1NHGA 5ECWA 5CHGA 3EZ7A 5JVDB 3IPAA 2P4HX 1ZGJA 1GL7A 1A4UA 3CRXA 4Y1RB 4R98A 5A3VA 1DIAA 4EA7A 4B84A 3KJEA 4D8VA 5KT7A 4LXUA 1VB3A 3UJDA 4TN1A 3HHPA 1TZMA 3SIRA 3PC8A 4F12A 3D2BA 3EVNA 4BIIA 3RJHA 2HA5A 4OHMA 1R0XA 3IAUA 3OPNA 1LNSA 4WLEA 2JJ2D 2ECFA 3AVYA 4J9UE 5KNBD 4L4ZA 3CVYA 1A8SA 3RT7A 4WE3A 3L04A 5ECDA 3N2NA 1ZIYA 3HADA 1TEXA 1E58A 2NXWA 2ILVA 2ZZNA 1OBOA 4UZEA 1A0OA 1NGSA 4B33A 1Z8HA 4O2AB 3OE7D 2YJGA 2X7JA 4MWCA 1F8GA 1HE8B 1W8IA 2W03A 3RC8A 2VUHB 1KMQA 4RDCA 1IAVA 2GGSA 1ZI9A 3FIJA 1IJBA 3OH8A 4R68A 4WT7A 5M04A 4G1FA 1OFTA 1VDVA 3PP8A 3D2LA 4LCEA 1JLHA 2YQEA 1E2UA 4DQQA 2W4MA 3T7EA 4EJ2A 1YS1X 4EBEA 2FOXA 3BL6A 3FXAA 1LU9A 3E3MA 1ZQVA 4M53A 3ZV5A 1NM5A 1SC9A 4ZMRA 2G36A 2I8AA 5IWAB 4ILKA 5FBVB 4BLOA 1NJFA 2JFHA 7MDHA 1F6DA 1I13A 4Q4DA 1U3FA 3HYRA 1F6WA 4PFJA 1ZQCA 5DBBA 2O2DA 1N48A 1M54A 5F2KA 5IVDA 5AJTA 1K63A 5K8JB 4BX0A 4BC1A 4PHTA 3VSBA 5LZ7A 4CLEA 3A26A 3NXSA 1L8AA 5AUQA 4XA5A 5TT0A 1R5OA 1EDBA 3OQMA 4JL6A 2GAFA 2EJCA 3MOIA 3R7LA 1NBMD 2O23A 4MF2A 4NYJQ 2XNDA 2O6LA 3LV8A 4Z7JA 3QPBA 3GQBA 3NDIA 3HB5X 4JBWA 4WNIA 4LGYA 3LI2A 1G0NA 2FWIA 2VL7A 1JEOA 3BJRA 1HLGA 4Z53A 4N0DA 1A9XA 3Q9SA 1NTRA 3FPGA 4OQQA 3Q0EA 4DKXA 4RF3A 1PQPA 5FA6A 2P30A 2LM4A 2C5EA 4U7JA 2AOVA 4KYVA 4YR9A 5IP5A 1Z8FA 3H5RA 2PZAA 1F20A 3ELUA 4NMXB 1W5FA 3R3YA 4IJQA 8ICLA 1N9GA 3FDIA 2NSLA 3UUGA 5EKTA 5BN3B 5TJ9A 3M5DA 3IR5A 4BX9A 5CNJA 4ENRA 2IEBA 3U39A 1ONPA 3UMCA 4MUEA 2C2XA 2LPMA 5DBHX 5DTQA 3KHHA 3C43A 3FNFA 3FOAA 4AN0A 4U6SA 1JEYA 4TZ6A 3FDZA 4B4UA 4PC6A 4TZKA 5AVZA 1PT7A 1K27A 3AU2A 3QKTA 3W7BA 1GVHA 4MGHA 2VSNA 3PFFA 3F5EA 2B36A 3GUYA 1MB0A 4KR0A 3S2SA 1JIVA 2ZJ0A 4MUGA 5SYAA 4YO8A 4JYBA 2JI4A 4N0EA 4YECA 1IN7A 1AZWA 3UMBA 1VLVA 3Q8MA 1KO5A 4NH4A 1EQAA 1U2SA 1NE7A 1QIKA 4XAQA 5KTNA 3DFZA 2JFOA 3ZWOA 5TMPA 2UV8A 2XI9A 5HUJA 5LQAA 1DZ3A 4LXQA 1QGOA 4D3ZA 1V8PA 4WMLA 6ABPA 3FOFC 1ZCAA 2QD3A 4XVHA 4BO5A 1CF4A 4UU0A 3MM4A 2R6HA 1Y34E 4CWAA 3JQ6A 5HQ3B 5H83A 4J0HA 3LW7A 4WRRA 1IBSA 4W9MC 4B75A 1N2SA 5J2DA 1D8YA 4QGHA 1QFJA 2ZJYA 3WDLA 3TVDA 3DONA 4YQEA 3ZCXA 4ZO7A 4UHJA 2R97A 2QE7A 4HT3B 4D26A 4NYMQ 2Q5FA 5C5EA 2NU6B 2WFAA 3TRJA 4QWAA 1JFLA 2PUWA 4UBLA 2IZZA 1OBHA 4YMIA 4YRMA 2YWRA 1A1VA 3PSPA 3QMVA 2JZBA 1FFXA 5CRIA 4B3CA 3VYWA 5G0WA 4V39A 2HRBA 2ZIUA 4M1EA 5BOMA 3Q72A 3NMUF 1YMQA 4PANA 3KHUA 3T3DA 1YZFA 6CHYA 3X1XA 5B12A 1NYRA 2ZPAA 2PUCA 3OG9A 3OX3A 1I6KA 2JH3A 4HI0E 4M9XA 2CLOB 2PLAA 4C1BA 5KYGA 4EZBA 1JLLA 4Y1GA 5F98A 2KW5A 1YVEI 2QLLA 1NJ1A 1NR1A 4ZVPA 3QNWA 1GCOA 4BMZA 2WNIA 3ADKA 1X7YB 4X7MA 3WFIA 1OW5A 4BNIA 4JR1A 4PHDA 2JVIA 5EMJA 4QRDA 1GUDA 4Q44A 2FKAA 4H27A 4YBRA 5C37A 2JRZA 2KTQA 4DABA 3GV7B 1BXRB 2PN1A 2VJNA 3I64A 1BQEA 4CIXA 5DNYB 2Z8YA 2XDQB 4RLHA 4BO8A 1SIOA 1ENPA 5KJ6A 1S9HA 1OAOC 5HM6A 1O3YA 2Q62A 1V5EA 1N32B 2WTFA 2OXIA 2JF0A 3LG2A 1G20A 5ECGC 2NSHA 4A10A 1NT2A 3C14C 3SDBA 3GT0A 1QTNA 5F9FA 1YJXA 3LSYA 1DXHA 3VDNB 9ICAA 1RWWA 2BMDA 4P93A 3IA2A 5LD2C 2BR5A 1DEHA 4OHZA 5FF9A 1UJ4A 5ESXA 4K2AA 1QHFA 2GBGA 2XE7A 3IBYA 4M0PA 2Z57A 3PW5A 4FFMA 3HKZC 4Z0TA 1CDDA 1BG6A 5DG9A 3IUJA 1KEEA 3IT2A 2PUGA 3RVSA 4WLUA 4LF7B 1QPZA 4BJQA 5TY0A 5JS6A 4WK6A 3O31A 3HCAA 4L74A 5J2CA 4R1TA 4MH0R 1RLIA 3BAZA 3ONEA 4HNRA 1HUOA 3LUPA 5DGCA 3R9WA 5AW2A 4OHWA 3KJNA 2G25A 3EIHA 2BOVA 4FGUA 5EWFA 4KWCA 3QSGA 1HORA 1KZHA 2EARA 1JHPA 2HB6A 4DSEA 1WMSA 4MK4A 3RRBA 4EHDA 5B58C 3PEEA 2PGLA 2IXAA 3AV0B 4CCYB 1JU4A 4TTPA 4YRSA 1SCUA 1C8VB 2LWIA 3DBRB 3RIEA 3PKIA 4OM8A 3WO0A 1SWVA 5I9MA 4E32A 4JT4A 1SG6A 1UFRA 3KR0A 2GEUA 3W5JA 2O8CA 2ZBRA 3H83A 2OBLA 2JARA 3D4BA 2J0VA 1N5DA 1E5DA 3GLIB 1Y1TA 3BEOA 3V4ZA 5K8UA 2Q5OA 1X19A 1SQFA 2REBA 1UMBB 1XIVA 2XXJA 1U4SA 5HQJA 3I2GA 1U0NA 3PHBE 2GN4A 5LP6B 3UGJA 2V58A 2N9UA 1PHRA 2O5CA 1UOEA 4OO1J 4CBVA 3OKPA 2G4LA 3BS7A 4FFVA 4Z0HO 1XMJA 2D2XA 3SKYA 5KJEA 1SPBS 4U2BA 1V0JA 5KU7A 1DOAA 2DBVO 1YR7A 2POCA 1GPBA 1AKTA 1BNOA 1KL7A 4JP1A 3HB7A 4DQPA 4ALLA 1Z73A 4FJ1A 2GKGA 3IM1A 1YMVA 1VPVA 1SVLA 2J67A 2ZBUA 1XCPA 2GF9A 3JYNA 3FHJA 3TUJC 4X8MA 2WSYB 1BDIA 5J2BA 1M33A 4NMHA 2R96A 1GKUB 3G0GA 3HJHA 1N2IA 4LWPA 4WEOA 3H1TA 3GO4A 1C4OA 3ZLBA 4U6PA 4H0NA 4QQNA 2UVUA 4AP5A 5A6VA 2ZDGA 1PJRA 4CUKA 1RLJA 1Q5PA 1JG4A 1U7XA 3CRVA 1LDYA 4IWXA 4AJNA 3OJXA 3PRJA 5LYJA 2ZUVA 1RRCA 3CX7A 2WJWA 4IIDA 2B8TA 3NM6B 1KJ8A 2QI9F 2XIJA 4GNRA 4QUGA 4TN5A 3KE8A 3RYIB 3KVVA 5EPOA 3C1UA 4AX4A 2WHPA 1TM3E 2Y1GA 3DZGA 1SKRA 4AD8A 3H7AA 1GTJ1 4WK0B 5FYQA 5B7PA 1JWAB 4LMAA 2G9QA 1RWBA 2QTLA 3KQOA 2WLTA 3LCVB 2FMPA 2PIDA 5EP4A 3D7LA 5GJBA 3QEMA 4AFNA 1I7PA 1WR8A 4M36A 3IB3A 3UKDA 4JITA 4J0IA 4PNPA 2XKBA 5D4BA 4UZSA 2V7GA 1E2IA 1A5BB 2F77X 3RD5A 2AS0A 3RVLA 3CXUA 1SGWA 3QV1A 1N2OA 2AKEA 4X54A 3RRGA 2YZGA 2CMGA 2ABWA 3W8FA 5AI0A 3SXPA 1TD1A 2W11A 2LKCA 5KKCA 3OBBA 3GCZA 1XMQB 2V6BA 3GCXA 1KFKB 4GMFA 1QR6A 5AHOA 1D07A 1QRAA 1Q50A 3KDPA 5TGDA 2CXNA 4OK3A 4YRFA 1FMFA 1TF5A 4ED8A 3VH3A 5C81A 3VUFA 1RMTA 3UPUA 3QEBZ 2WSSA 4G4IA 4I1YA 3I5XA 2X9GA 2VJDA 1TFUA 2O1EA 1A7UA 4PLHA 4O4IF 2DYKA 4P4SA 2DJIA 1CY8A 1G8SA 3OFNA 3FLAA 1XDSA 1ZBDA 4FSDA 5KX5A 1HQYE 1V45E 3RF6A 2P0YA 5IMSA 2OH2A 4NBRA 3SBXA 2DH6A 1ETUA 2E8PA 2PL3A 3N0VA 2WI8A 3IMFA 2RG7A 2R85A 5B3AA 1Y4UA 4AWBA 4CV3A 2Z8ZA 3STYA 1WKBA 3CUYA 5LYJB 1CP2A 5C0YA 4D99A 2QJOA 5G2OA 3WRVA 4FGKA 1QHEA 3P2YA 1LPNA 2R8GA 4ZO8A 2O5RA 4A2CA 2H8KA 3T5MA 4UVDA 4UFNA 4XRGA 1OWMA 4LOIA 4KUHA 3I1FA 2JH9A 1G8KA 3TLBA 1XZQA 4IWYA 3EYAA 2IIBA 2GUWA 1NI3A 2PL9A 3MB5A 5IWCA 4FMPA 2IYSA 3RR8A 4P7BA 2NUPB 2JLCA 1UPBA 4BLPA 1Q3UA 1RHQA 5DKFA 4RWZA 3NQ41 1ORIA 3ZXYA 4RESA 3K2QA 3AN1A 1Z6PA 1LFDB 4NCKA 1FP6A 4HB4A 3T12A 1Z7GA 4DLRA 3LDAA 3A05A 3TMKA 5D5HA 4AKIA 2Y1DA 5JWHA 3GP5A 3EDYA 1NE2A 4LIPD 3BWVA 1FP2A 1VJRA 4R9NA 5JNWA 3P96A 1R8YA 5HX7A 1SC3A 3SQOA 3O8CA 1U7OA 4PTYA 3M8RA 1IMJA 1JSCA 4P7GA 3Q11A 3H84A 2P9YA 4N01A 3WTCA 3TD2A 2AMJA 1EFRD 5CT5A 3LQRA 3I01A 4RD6A 1WCWA 4FEEA 1EQUA 3D4IA 3JQCA 2HRCA 5CJJA 5HOEA 5DOZA 1VA5A 1A04A 3LL7A 4KXNA 5JMOA 4D4MA 3F6BX 4UZFA 1YMUA 4ME6A 1WWKA 2F3RA 4UEKA 1I6MA 1X80B 3HWRA 5CA0A 4JUIA 3N5CA 4JLMA 1U6IA 1YULA 2XY6A 3ZGNA 5JS1A 2NPFA 1SIWA 1NPDA 3Q41A 5FB3A 3RS9A 5JANA 1GZVA 3K31A 3FX2A 2YBEA 4UNQA 4MRMB 4KQ6A 4XCXA 1OILA 2AZDA 1XRSB 3K9QO 3V4VB 1L5GB 3MK31 3WYBA 4C6RA 4YAUA 3BFVA 4C7KA 3OI7A 4NYIR 4TUYA 5FLYA 1ZNYA 1ZM2A 5CDTA 1R8XA 1TPZA 4YROA 5ALUA 5HFNA 4DHWA 1P9WA 3QI7A 3UH0A 3LX4A 4IGEA 4YP5A 5HXAA 2A9PA 1DV1A 1FFWA 1M9NA 4XM0A 1DBWA 2JDID 2JFZA 4XJSA 4J0CA 1RXCA 3LK6A 5KT6A 4XGNA 4PJ0U 3V1TC 3FMOB 1HDRA 1WE2A 3EUFA 1SB8A 2E18A 5DTJA 4MZXA 1UC9A 3LCJA 1JQ3A 2ZANA 2OFPA 4TTVA 1G8GA 3N0XA 3KQWA 2W6ID 2EFEB 4UE6A 2HF9A 4GGMX 4S0XA 5DXFA 3FWPA 2DFVA 4JJ7A 2TMDA 1DX4A 1V4VA 1XFDA 3DR3A 2NV6A 3FSGD 3U6KA 4MPTA 3MCAA 1ZFNA 1RXSA 1G19A 2BIFA 1EK5A 3K0AB 2LI6A 5FJJA 3RHSA 1GT6A 4GM4A 3ROMA 1YZUA 4U3JA 2HA6A 1JJBA 3K30A 2O57A 4A2PA 4MB2A 1ZVKA 3QG5A 5H16A 1HUQA 2W2QA 3GIJA 2QE6A 1QS0B 4JJAA 2HBQA 3A3NA 3T1TA 3TUZC 1CZUA 1XQ9A 4MQFB 4Q7MB 3RV4A 4YP3A 3M7DA 3T5DA 1X9SA 2OAP1 4IDNA 2COEA 1EBFA 1REQA 3FFBA 3ZD9A 1Z06A 5KTOA 2YIJA 1UWCA 4QZEA 1X1QA 2ZBEA 3JATB 5INTA 1DJNA 2BGGA 1NW4A 2P9EA 3IKMB 3ABQB 1D2HA 3O90A 2P6NA 4X92A 1TAGA 1ZOSA 4B7XA 3TZLA 4H7PA 5HJ2A 1F0MA 4BDPA 2CZGA 3TOXA 3ZEAA 5L3SB 4BGDA 8ATCA 5CFPA 3HY3A 2YJNA 1Y1LA 3ADDA 3OIYA 5B58T 2DP4E 2XHEA 3BJMA 1P5JA 1MQSA 1UPTA 1J06A 3G5LA 2PMDA 3GNQA 2LUOA 4YMUA 2D3DA 5EVCA 3CLRD 2DQZA 1O58A 1E0AA 3GL9A 3HM2A 2BZSA 2KSQA 4LY9A 5EP3A 4CT4B 1SC1A 2AYZA 4TM7A 2V8BA 2BGNA 4TXNA 3RIYA 1F4LA 4D6PA 2NW6A 4FN5A 3RSOA 1C1XB 4DL5A 1JFSA 2OQVA 3R77A 1E7SA 3A1CA 3WL7A 5SY6A 3NG1A 1HF3A 4UBOA 4NP6A 1N3BA 1VI6A 2ESEA 4A6PA 2WV9A 3NRWA 3I5AA 3DDZX 5DN6A 5HF9A 4XPIB 1A8UA 2VTDA 4RKQA 5GV7A 1EHYA 3QW2A 1SA0A 3IUSA 4RQ6A 3GGGA 3LC2O 4LRSB 1ST3A 1XTBA 1E3SA 3MBYA 5GTDA 2GD2A 2KYRA 4DQ0A 3ZDEA 4AUNA 4RMNA 3PNMA 1VYTA 4Z6CA 2LP4Y 2FYTA 2RGCA 5BPHA 4GNKA 5M34A 4LC0A 1K3FA 2QZ4A 4QTUB 4X44A 4EA8A 3E2PA 4ZCTA 1NPTO 3V2IA 1M76A 4TRRA 1T4MA 1VIDA 4N39A 2XYQA 3SHVA 3EPRA 2X9VA 3W9BA 4RENA 3RJIA 3KLBA 3RRZA 4NU0A 1W2HA 3ZDYB 3W2GA 4YQWA 4RT2A 1NN1A 5K0FA 1PWYE 5UKDA 4EQ6A 2VJ5A 4KE9A 9ICBA 5FPQA 3GGOA 1XMSA 1DMSA 1BQ4A 2CNWA 1UKAA 3ESQA 5BR4A 4NHOA 1DIOB 4MZDA 4ZV4A 5B6JA 2WVHA 1W4ZA 2RGGA 3OHPA 2LGJA 3T3IA 5CPBA 2IH4A 2XY7A 3MGAA 2ZLBA 1P7ZA 4KN5A 3CUVA 1RLMA 4W4TA 1JT9A 3DMDA 3K1YA 1NY5A 2WUDA 5KFFA 3TLAA 2WIDA 2YVKA 1F1BA 1CX9B 1JDTA 4DUPA 4B32A 2XMCA 4N5LA 4HDSB 1KFEB 4EKGA 1ID1A 4WKBA 5EMNA 3I2IA 4BX8A 4REOA 2FWRA 5ESWA 3R3SA 5CR9A 3SIWA 3RTVA 4ELVA 4CEIA 3RRHA 1PR4A 2VJCA 2QVLA 4YDQA 3QPVA 1C3VA 3B9QA 1DKUA 5EINA 3MYYA 5JUMA 1T1IA 4BQPA 2ZRDA 2RIRA 4F91B 2H5JA 3H2YA 1KEWA 2Q4BA 1GFWA 1XJWA 2H0AA 3KQQA 13PKA 3UK6A 3JPSA 9ICCA 1NK9A 4YWJA 1ZSNA 3EPJA 5KPJA 4I9HA 1YDWA 3O4JA 3X44A 1ZRMA 3FPBA 5IBCA 1U8UA 3Q12A 3W7VA 2LCFA 4F8EA 1QH8A 1FNMA 3Q88A 2GM9A 2C9MA 3OPYB 5KYUB 3GJQA 4LVOA 1EAMA 5LZ5A 3CWQA 2IZ7A 5DRYA 1XWFA 5FPKA 4I2BA 4C04A 3ERCA 3DHVA 5HKAA 3V4RA 3B6JA 2VHCA 6LDHA 1PR6A 4EL5A 5F23A 4RORA 2PFOA 2PMCA 5LBTA 3WLRA 2P2CA 3C41J 3QFHA 1RC1A 1BPXA 2JCGA 3DP9A 4J3FA 1V11A 1QTIA 4M8IA 2RHBA 2ETXA 5GTIU 1MEEA 2OP1A 1QIMA 5KFDA 2CGEA 1QP8A 4QVIA 1H6AA 1SHJA 4TWJA 3HCFA 4HB3A 2BL4A 3AR5A 3QWIA 4Z4CA 1M2HA 1WABA 3EF0A 2SKCA 1Q1BA 1OROA 4XUEA 1YAHA 3MUEA 5CG2A 2HNBA 1VKJA 2V6GA 2SNIE 4Y7DA 4PLPA 1L4YA 5AW4A 5B64A 3FAZA 3BXEA 1VLMA 2W6JA 3ZDRA 3THXA 1FUEA 2IEAA 4QWDA 2VF4X 2W98A 4U5QA 8ICVA 4HWGA 5I48A 5CVVA 1ZWLA 4CDNA 3F5SA 4LYAA 4LK3A 4O4LF 4GRIA 3RF7A 2DGDA 4NATA 4CDMA 1QO7A 4M9LA 1CRZA 5TPWA 4UASA 1W29A 2HNAA 3JRXA 4BWJA 2IY7A 1OGYA 3DNMA 2CJFA 1U2QA 4J9NA 1ZQAA 4N6GA 4DB2A 1JAYA 4BAZA 2ZB2A 4H7DA 3PT5A 4MWTA 3IJ5A 3V1KA 2GVNA 5AKKA 1OFUA 2QVBA 4LJAA 4Z6EA 1SCJA 4QVKA 1A95A 1IB6A 4ML3A 3K75D 4Y2SA 1NQVA 5G41A 2Y67A 2W8BA 1GPKA 3EY4A 3HY4A 4DWOA 2HCBA 5A03A 3F7MA 1JDSA 1KJZA 3HN7A 1SR8A 3K4GA 3ICWA 2PUDA 3V33A 3W1VA 4TSKA 5IJAA 2IK8A 3OE1A 4K46A 2DX7A 3GG9A 4EHJA 1RTKA 4UVGA 2AOUA 3KZNA 3G9XA 2H3IA 1I5OA 1H4SA 4KODA 3T7DA 3JQAD 2Q0ZX 2PKYX 2LIVA 2ATLA 1XO0A 2V5VA 3WGLA 3B12A 1YU6A 4MDYA 1UK8A 1XCMA 2M6SA 1W48A 4CIDA 1G6KA 1ZI6A 1UIMA 1XD9A 3I05A 2NUBA 1RYBA 3AF6A 1VKZA 2YB4A 3WB0A 4QZ9A 3H2HA 2AQIA 3WGTA 2IW3A 2V45A 4E2WA 3O8OA 4BEWA 5BR7A 1K4MA 3G2NA 3ECSA 5EIBC 1E1MA 3SLRA 3R9KA 4U39A 2Q1XA 2O8FB 1GAEO 1LLFA 7ICLA 2FSHA 1XA0A 4TQAA 1YJQA 2X0RA 2ZIXB 3VRHA 3AJDA 5FAKA 4Y2QA 1GRQA 3SN6A 2V4QA 1V8OA 2H2AA 4OHBA 5HHIA 2VATA 5LDGA 4YACA 1HEIA 2I7VA 1GL9B 1DT5A 4JA2A 2DPHA 1IQPA 2NAPA 3O7MA 1MORA 3HCBA 3X2EA 1FYXA 4NWIA 3SD7A 1Y7IA 2FCAA 2FZWA 3NBFA 2DGZA 4E1AA 1W4CA 2EFJA 2XXAA 4IO0A 1VE5A 1DKNA 1VKHA 3H9BA 3O2QB 4KG7A 2B4QA 4EGSA 1NOJA 2PK3A 2WJJA 3NEPX 3RB0A 3PC4A 4Y8VA 1CHNA 3FY4A 1CQZA 4X63A 2UKDA 2XGJA 3IUBA 1WSBA 1YB7A 3VU0A 2RDJA 2UYGA 2NIPA 2A1JB 3KHTA 2WKWA 1AGYA 5F3DA 5ESDA 2ZYSA 1OFHA 3NRJA 3GMTA 1YUMA 3JALA 4B83A 1ONSA 2WB2A 3RADC 1NNI1 1QM5A 8ICHA 1N5OX 5EIAA 4CKYA 3GLTA 3W78A 1E99A 1T3TA 1KY5A 3W05A 3JPOA 3KC2A 2VPTA 5F4BA 1OY1A 4EHFA 1G6OA 1IRIA 3IL2A 1EEXB 1N36B 3D8HA 1XWLA 2PTGA 3MSCA 5H02A 4RULA 2VO1A 3DAFA 4EW1A 1V71A 1M7GA 2UVPB 2CBXA 1H5QA 4RK5A 4GLLA 5EJ7A 1HY3A 2EFDB 3RIGA 2R8JA 2Z3ZA 4HZIA 5J2UB 3BBPA 4B3BA 1ZQHA 5E4FA 2CLHB 1KDYA 1JI0A 1JIQA 4I7EA 1U0FA 1XLWA 1Q84A 2FFRA 4RQ4A 4M88A 2GLEA 4CM5A 7MHTA 4EB3A 1QE5A 2BM0A 4H1UA 1CDEA 1ZOPA 3IVMA 1IN5A 1D04A 1TKCA 3USZA 2R8ZA 2FEWB 3KLPX 3SEQA 2Y77A 3JQFC 5IHXA 5EY5B 4WCDA 2PYDA 1PJAA 4HQRA 3WNCA 1F6BA 2FQYA 3TTYA 1TB4A 5DB7A 1Z26A 1KLNA 4FC6A 5A1JA 1C80A 3GUCA 3ZCUA 2Z5GA 5HKKD 2JBAA 5CLFA 4C6TA 1R8QA 2EQBA 4JJFA 1HG0A 1C9YA 1KC3A 4RGQA 5F3RA 4F2PA 1XRQA 1KHTA 3PT9A 1X74A 3EGXA 3FCYA 3L18A 1E20A 5JNVA 5E6SA 2PZKA 4CMIB 3GJSA 2N1RA 1BX3A 1VL6A 4RLQA 3NP7A 4YJHB 3F49S 3W5BA 4JB2A 4WCFC 4DL2A 1X9IA 3K0EA 1JECA 3EDMA 5EOVA 5JLJA 5KSYA 1YZVA 4HG2A 4LDRA 1WVGA 3T5BA 2HAEA 2QM7A 3ZG6A 1CIPA 4JC8A 1X1BA 4UJ5A 3ZZ1A 3KYCB 4OJNA 3PW4A 4YFYA 2FPWA 3BBLA 3LUCA 2FZ5A 2FPGB 4C0SA 1KO1A 1YS2X 5LZ8A 3EQZA 3GAFA 4V0QA 2KEYA 1BQ3A 1NRIA 2A14A 1VSBA 3B6ZA 3C4QA 4DPKA 4MDHA 2VT2A 1JXLA 5EUCA 3IR7A 1L8LA 4FCVA 4Y2RA 5J0OA 5AESA 4L0CA 1TTTA 4LXTA 2QK4A 1SZDA 5AVWA 4NENA 3VYRB 4BHTA 1K86A 3VKUA 3OY7A 2ZR8A 5FA8A 1I36A 2O2GA 1PVQA 1T3HA 3RVKA 3DB2A 3K4QA 4R16A 3RM3A 4LBYA 5CX1B 2BGKA 2GCOB 1OWOA 2F44A 4X3CA 1Y37A 2YWDA 3RVJA 4XW2A 3MGVA 1V16A 3E5HA 4M46A 3ZDAA 3W4IA 2M1XA 3WYGA 3FA2A 4PLFA 1OYOA 2Z2YA 4M0UA 3SS9X 4B8YA 5CGZA 3VR2D 5CH5A 1GU0A 1PNRA 4MULA 1PJTA 3G85A 1UXKA 5AJYA 1JZSA 5EPUA 3OQHA 4HLCA 4ZZ1A 3CT4A 3GLIE 4L72A 2JAHA 1KNXA 5CCDA 4Y1RA 1B7GO 3DL2A 3TG8A 4JUDX 6Q21A 1KDPA 4O5CA 4MVJM 5LIRA 2WKQA 3H4TA 1ZAYA 4LE1A 4IV5A 2QTCA 4JLSA 4B9VA 2QD2A 2C9OA 3HB9A 2R8RA 2IEZA 3LVFO 1E92A 1VHDA 4QUAA 1AM4D 4JLPA 1II8B 3AY7A 1JDBC 5I01A 4TURA 3L8DA 3EGXB 1L4BA 4RJTA 3C15C 4ZT2A 1G18A 3BN3A 4J9SA 3D2AA 4O2AA 1KH2A 2KV2A 3BQ1A 1JQEA 4S2EA 5LXTB 3SJCA 3GP3A 1PJ3A 1TCBA 3H8WA 3IDSA 1QH1B 4WXMA 4YFKA 1G20E 3VI3B 4YRBA 3FETA 3EIXA 5CJ2A 1WXDA 2HUNA 3UWDA 3NJRA 5I4IA 2Y2VA 1PT5A 2CXUA 2IODA 5J2AA 1MAAA 1QP0A 1SL0A 4N0MA 1UDCA 2IYXA 1P7PA 1SCDA 2WUEA 4C3VA 1BOFA 1S0OA 2GH1A 5FXMA 2XQGA 3LY9A 4MVJH 3UJPA 4DJDC 3C7KA 2IH5A 1AJEA 4G36A 1KYXA 4IR1A 1A72A 4LYDA 3BHIA 4C8KA 3C5VA 5SY4A 3L3FX 3SQIA 5IXSA 1TMOA 3G8YA 3T79A 1IZZA 4UB6U 1WBDA 2R87A 5FLEX 3LYUA 1E1RD 2QT0A 1YFJA 3O26A 3RIXA 4B3IA 1VLQA 1YZYA 2BEKA 4LHXA 3Q7PA 1BU8A 2PAAA 2YMQA 2CV2A 1E5TA 3OAAD 3V7JA 2H9IA 2HSEA 2PT6A 2QTNA 3JQFA 4QZHA 4CM1A 4ELTA 2CD7A 4K9LA 3M9MB 1ZQGA 1E7QA 2PQ6A 4XLZA 3EAQA 1PJ8A 1UWLA 1EXVA 1AS2A 4YCXA 4QPCA 1DSSG 4R66A 3RVMA 5BXYA 3I61A 2C82A 3GMDA 1RQRA 4LX8A 3JTEA 5DASA 3PEWA 2IEIA 4TLLB 4Q9AA 1U2PA 2HU2A 3TGLA 4JLVA 2V3WA 3BD6A 4KAJA 5JY6A 2PVSA 1X1RA 1RRKA 3BQ7A 3HR7A 1G98A 5E1MA 3RTGA 2JXJA 1NJYA 1O4WA 1CQPA 4A6XA 4OA5A 1AB6A 1UBLS 4MEYA 1T2AA 4U2DA 5AH0A 2GESA 2PSJA 2CUTA 3CX6A 5CGQB 7REQB 5I3CA 4HR7A 3EEBA 4GC6A 1O0SA 4AMVA 5BN3A 1D7OA 2WF5A 1Q92A 1WCIB 2UYQA 5SZIA 4IDAA 4KAXA 2X13A 2PRIA 4D3YA 5KFZA 4EHHA 3GLHB 5HRCA 4Q3EA 5IABA 2VN8A 1QTMA 4M4SA 1CY4A 1N2HA 2TECE 2XUOA 5LP6C 2QWXA 1NYQA 2CHFA 3C5WP 2O2CA 1A2QA 3DLPX 2KE5A 4HUQB 2YWEA 4ZK6A 4OMDA 4E15A 3EMDA 4C0WA 1LI7A 3SYZA 5LUBA 2DULA 2VRCD 3WMXA 3BCUA 2HH9A 3FHCB 1XT6A 2P6MA 1OWPA 2ZVQX 1WDWB 1Z2EA 4F7DA 1KS9A 2X5NA 4R9UC 2Q50A 2BSQA 2YHBA 1QAQA 1F1JA 4QNLA 1HBJA 1UZLA 3KG2A 8ADHA 3WJ1A 1LW6E 3CSDA 2JV3A 2MAXA 3NYWA 5KT4A 1XN1A 4BB5A 1Y42X 2GJ4A 3UENA 4HXEB 4NNPA 3EGEA 4BUZA 2YFYA 4RQMA 1A82A 3W5SA 1MP0A 2YJ4A 2HXGA 1E3MA 3KSRA 3JXEA 1ILEA 2C4VA 4Q93A 4HEA6 4UXIA 5HQ3A 1PSWA 4BU1A 3IRUA 2HT6A 1PKEA 1KJWA 2R86A 3PJDA 4K9SA 4NBKA 3M2TA 3EXG2 3EDQA 2QNRA 3RG8A 2DWCA 5IDWA 3ITKA 3BL5A 2I4OA 5KNDD 1ZH6A 1HSOA 4MPDA 2NU6A 5IZCC 3IHTA 2HJWA 4EL0A 3VVCA 1NK6A 5KS2A 5EMLA 4UHCA 1VBMA 3RYTC 1SU7A 4JJKA 3WZLA 1MB3A 2P41A 4Q3NA 4KQHA 5E6RB 1DI0A 4GM1A 1N25A 3P2JA 2CVHA 4M7RA 4Z8YA 4WCFB 2IWHA 4DANA 4CLXA 4BUJA 2G72A 4PBRA 4ZU3A 1FRFS 2PX2A 3F71A 4D46A 1CRLA 3ULKA 1H8HD 2OO3A 4Q4JA 3WRYC 5TVGA 3LVQE 5J1TB 1I3NA 4MX8A 1N4DA 4M8SA 5BORA 4PWZA 1SBHA 3IJPA 1Z34A 1JG1A 3TOSA 4WLNA 1X7YA 3X1WA 4TRNA 5J43A 2GF2A 2IF0A 2WU1A 3QBTA 1BXRA 1JR3D 1CBUA 2KSOB 1ZLXA 2HO4A 3OQPA 1Z0JA 3ZXXA 2XDQA 4ZDKA 2FZLA 1ZAKA 2GOLA 1V85A 2HC9A 3THSA 1B42A 1M6WA 5IZ4A 4IZ6A 2XGSA 1AC5A 3LUHA 5BR8B 4AQYB 3N07A 3S2FA 3K3PA 2BGMA 4B3TB 1UPUA 4BLTA 4KO4S 1CNEA 2PEYA 4WOBA 2BGRA 4BFYA 1C7RA 3HYTA 1JIJA 5ES4B 5JRDS 2F3SA 5IAEA 5L51A 2FDXA 4JJIA 1L5YA 4MUAA 5EJMA 1U0TA 4YRIA 3ESZA 3F98A 2PAFA 1XYYA 3RWBA 4BV9A 1CJVC 4H59A 3F8SA 3AMZA 1EUCB 1VHQA 2XF8A 1QGDA 3JYOA 4TS9A 5L8VA 4ZVVA 4YQZA 4PU0A 2RI0A 5L1KA 2QQGA 4YRLA 3DVRX 2KLHA 5BPCA 4HBZA 5DYYA 2R0QC 4G0UA 3VMMA 1II0A 5IINA 2OOKA 3HO8A 1SUWA 2ACKA 3CUUA 3MELA 3U26A 3GBVA 1I7DA 4IAOA 4OLJA 1HEKA 3E4DA 4M0CA 2IGBA 3A2KA 5I4CA 4MINA 1JDBB 3GLVA 4CCYA 1ULSA 1PW7A 1QQ7A 3DBRA 2ZI5A 4MV4A 4JJ6A 4FHDA 1EDEA 3EZ9A 4QARA 3O4RA 2JH7A 3WFZA 2QL7A 3AR8A 2FN3A 3LXMA 1GNVA 1IUOA 3U7EB 3OQBA 3GLIA 4R2XA 5EIWA 2ZYDA 1UMBA 2C2KA 4OP1A 4Q4JB 2J3IA 1QU2A 4MFCA 4ZYXA 1M8JA 3TCKA 4V0OA 1CUIA 1IFXA 2LBPA 2QSJA 2XI4A 3WJAA 3P27A 2ZTDA 2JANA 4PINA 3JYLA 2HRQA 2IPOA 4Q7QA 2IHNA 2O52A 2J8ZA 5LP6A 1BMDA 4HJRA 4AIIA 1FUIA 1PYDA 1GSAA 4EMTA 4ZVOA 2ODPA 2WKPA 3L07A 1MXFA 1Y7HA 1QZZA 5GIPE 3GEHA 4GBGA 4PRKA 3CP8A 2QBYB 4ED7A 1CQWA 1UXOA 4L9RA 4F4YA 1NP6A 1TJYA 4KQIA 3ESCA 4I4CA 4E21A 4ZVTA 1FLDA 3BH0A 1TK8A 5KQLA 4WCVA 3UHJA 4WJKB 3RC9A 2ZB4A 5FL3A 4M83A 4XR4A 3S2GA 2L17A 1L3BA 5DHQA 1G9XA 4EP1A 1WCLA 2NADA 2VAMA 1FFHA 3OURA 2C2DA 2OCDA 3NT2A 2EX4A 1FRQA 1T2UA 3FTFA 4MUNA 2FX3A 4FPXA 2C2EA 1P80A 5AXCA 3PX4A 2VJPA 1XP5A 5LL6P 4HAYA 4BNKA 4JY7A 3G8AA 1MC5A 7ICUA 6ADHA 4FZ5A 5IARA 2VZ0A 4TWAA 2QN3A 4URFA 1EVJA 3QVKA 2NSYA 5J2TB 1TQ2A 4J03A 1EFAA 3UEOA 2HXSA 4UHKA 1GZUA 5IZCA 1R6UA 2J4CA 3EF1A 3RYHB 3RYIA 4RSRA 5EIOA 2B4TO 4IZOA 1W75A 2XY4A 3E03A 2KZ3A 2C0CA 1ACMA 2I78A 2WAMA 3MPOA 4GR9A 5HGJA 2NP7A 3BL8A 3T3MB 4D0LB 2JFGA 4PX9A 3R3XA 1VL2A 4LK2A 1LK5A 3OMLA 2QD4A 1PEDA 4E1BA 5T4EA 4OHUA 2ZAIA 2LV8A 2C5GA 4DHEA 2OCEA 2PUEA 3WRYA 3VO9A 4HAVA 2P9ZA 5EJAA 5TQJA 8ICSA 3A4MA 1E2QA 2I7DA 4N6NA 1SV4A 3FLEA 3B9PA 2CD9A 2Z5FA 1WTAA 5SYMA 3HI4A 2PKCA 1RM6C 2AH5A 2MR6A 2PKXA 1GAQA 3C97A 1KH1A 4PGMA 4ECUA 1P91A 1AOXA 5T4HA 3J80A 5IT4A 1FFUA 5A7FA 3PE6A 1NU6A 2UZIR 4RACA 3MHPA 4I3HA 3MWEB 4R8LA 4IDDA 4ZDJA 1NVWQ 1AHHA 3JZFA 1HDOA 4XQGA 3D2NA 4ZVSA 3RSLA 1RCTE 3OQVA 2QY6A 5GONB 1I2DA 3L9XA 1SQGA 4H1VA 3KKKA 3C2MA 4DBVO 1Q0PA 3OIFA 4F8RA 2DRIA 4OGWA 1FVFA 2JCVA 2GLUA 1UBJS 2JI6A 2RDMA 4EUSA 1Z18A 2VNIA 4OYRA 1Z82A 3AIMA 2JFQA 4PHFA 1GGJA 1M7HA 2Z2ZA 4XOUA 5CP2A 2C3PA 4LJ9A 5D01A 1GGEA 2IE0A 3PXDA 1GV1A 2ERCA 4IUCS 1R27A 4HAZA 1PZGA 3Q0IA 3FPHA 4AJEA 3QMMA 4QU0A 1RD4A 1JJAA 3M7IA 2AXNA 5K3DA 2IZ5A 2JKZA 2XE4A 4GF5A 1E4VA 3DMGA 3B3AA 5CD9A 5C31A 5EI5A 2VS1A 1GSIA 1T34A 5CLGA 2B8JA 2ZATA 1XCBA 2EF1A 3W04A 5EGNA 3LOPA 4CODB 3GJ7A 1I4DD 5HJ7A 4R81A 3M6WA 1OB2A 1KDRA 5DCUA 3QNUA 1TT5B 3LQ4A 2PSHA 2XYRA 3CNOA 1U3TA 3PWSA 1KAOA 1LB2B 3GGSA 5ALFA 3TIXB 4BO4A 2OMEA 4O3QA 1ZZEA 4LJSA 3O38A 2KICA 4M98A 3CW2C 2NUPA 4DGQA 1JF8A 3PL5A 4G01B 3IE0A 2KI5A 3LBHA 5JSZB 5DW0A 2ZYHA 3VYUB 4A27A 4KJZA 1KYWA 2VPXA 2AMLA 5DJ5A 2NQ2C 2R4QA 2HJVA 1P17A 3WWCA 2X58A 3ENZA 2WNSA 1S3GA 2C20A 1R0WA 2B6HA 4KFRA 1OAOA 1WW8A 4WQMA 1L6RA 1G2QA 4DC1A 1T5IA 1OTHA 4XXHA 5JBQA 3NHAA 5KVQA 1VG9B 1GFIA 3I1JA 3QVWA 2HV9A 4J4TA 3RIHA 3EJ6A 2YOGA 9ICJA 5GVRA 4Q6BA 1XQWA 2DPMA 4JI5B 4FHEA 3V3TA 1A9ZA 1FTWA 1X80A 5L95A 3BTUA 4DV1B 1U99A 5E0OA 4ESEA 3I73A 1N78A 3LUJA 1ZRHA 5FUMA 2QS9A 3U4IA 1Y5RA 3WIBA 1JXQA 3WIDA 4MS4B 4MRMA 2M2IA 1XHEA 4YJ2F 2CVOA 1Y1SA 1Q83A 2QX4A 4X9XA 3FYCA 2FEKA 1F8UA 1J0CA 3M9LA 4LOLA 2WFMA 1YRBA 4D2IA 3I37X 1Q7CA 1VIMA 1PZHA 1LJ8A 2GLTA 1W7AA 2EFHB 5FADA 1LSUA 2OGWA 4FGJA 3P2OA 3Q9UA 1IDN1 1G63A 5KHLB 2PMZC 4UQOA 1Q3TA 2VXOA 4LF6B 3V1NA 2R62A 5AOVA 1Z15A 1NNLA 4U63A 5IC5A 4IDCA 4CMAA 4NBVA 1MQ8B 4B0PA 5E79U 2Z58A 5K0CA 5F9LA 2QW8A 1HYEA 5AM5A 4X84A 2EFYA 5ELMA 3HLYA 1XPJA 1CZKA 1XALA 1P33A 2EAOA 4PC3A 5AMXA 2GM5A 1U0GA 2Q0XA 3RG2A 5BQ3A 4UREA 5AW7A 1OIVA 4EGJA 2D5IA 4Y67A 1JHOA 1E7WA 4YG2A 1OVGA 1AKUA 5H7XA 5HRUA 3ZV4A 3ROFA 1ZQ9A 4D9MA 3K0AA 4AW9A 1JPVA 3CZ9A 4K87A 5AVJA 1P0FA 2BMAA 1GVNB 4NZYA 5CAEB 3NHRA 2AE1A 2EG9A 4IF4A 4QDJA 3BZCA 3K71B 3Q7QA 3HX0A 1QS0A 3RS4A 1J2EA 2VSXA 5ITZB 1RP1A 4MQFA 1XTTA 4AKTA 5CTAA 2P90A 2E4AA 2KHVA 4AJPA 4PY2A 3FPEA 2CLLB 3N8IA 4OHOA 2C2MA 1FYEA 2PFGA 3HCRA 3SHTA 1Y3DE 2GFIA 5E4TA 3JATA 1YQEA 3SI8A 5CB8A 4ER7A 4LSMA 2WB1F 2AW3A 2HXYA 1JN0A 5HR5A 3EQ9A 1V26A 1VGRA 3CG4A 2PLWA 3IC5A 4RZRA 4QT4A 2HUPA 2F8LA 3OC0A 3WADA 4GMDA 4KLZA 2IGTA 5L3SA 1SM4A 1WU7A 5FWDA 1YDEA 4FXPA 5F73A 3B2NA 3ELBA 3ORRA 4FW8A 4YVFA 4BO0A 4I55F 1KRPA 1S8NA 1Z6QA 1TZJA 4TMKA 2K87A 2DVMA 3KM0A 4NF2A 2ALZA 1M7BA 1AT1A 2GZSA 3GCWA 1TYZA 5BNWA 4UM8B 2WPDD 5JMWA 4B3RB 1VIAA 2DPYA 1Y8AA 4R8MA 1QE0A 3GEDA 4QW8A 1CP3A 5JDIC 1F5SA 5DGTA 2PEZA 4WZAB 3USES 1C1XA 2XQIA 3GRKA 2VK2A 5C8YA 3W8DA 5I7AA 2BV3A 2VJKA 1VSQA 5AVVA 3H3XA 1EE2A 4OYHA 5BMOA 4NPCA 1WS6A 3TXXA 2XWQA 1NW9B 4DQRA 3MD9A 4A23A 1O5TA 4EG3A 5LQSA 3CW2A 2HBJA 5KFCA 3X1MA 3QFFA 1C29B 4XPIA 2W6NA 1TAQA 1HQKA 2B8WA 2CLEB 1HTBA 4F5WA 4IMIB 4UU7A 4CVNA 4BMNA 2GBPA 2Q5EA 4TXHA 2VHTA 3IB6A 4YVZA 2PGDA 3V8PA 3U1BA 5EE1A 4FFOA 1GFSA 2YZMA 1P7DA 5K7SA 2WWFA 4GL4A 2AYXA 4LMBA 5KFKA 1T2NA 1HDGO 3HP7A 3BX1A 2Y0EA 3CLSC 2CY0A 5KO2A 4ZOHC 5D6NA 3WMEA 3PNBA 4C30A 1JSZA 1L2TA 3ORYA 1QVVA 1ZHHA 1WZCA 4DR2B 2RHRA 2JH1A 3CY6A 3KRTA 2WWRA 3FCAA 4RKEA 1DEAA 4ND4A 3ESXA 5IIJA 5FAXA 4ZEXA 4F7WA 2BFMA 5JTTA 1P1KA 3A1UA 2ORED 1I3MA 1LPBB 1V41E 3L0BA 3ECCA 4A7PA 3PF8A 1DQYA 3FBTA 5JXWA 1AGXA 3IP3A 3NDBB 3SIXA 2NO4A 3H19A 2EP7A 3IIMA 3AHIA 4LRWA 4JU9A 5B1EA 4JEMA 5D3ZA 5L1IA 4LKRA 1IL0A 3NRCA 5FHRA 2D7CA 1YZTA 4KAAA 2QXUA 1ZMTA 1ZRSA 1SOWA 4NRDA 3IDQA 2NRVA 4HRVA 2IYFA 4KSBA 4NXMB 2QX6A 3SBEA 4D6YA 1QCZA 2R4UA 4ZHQB 1XEAA 1QHYA 3GV0A 3TRDA 3W6UA 4GOJA 3NC4A 1E89A 2J31A 5IFKA 4IZHA 5KTQA 4CJXA 4QZGA 4H31A 3FGPA 4HDSA 1SQ0A 3RB4A 4OK5A 1GR0A 3NAZA 4RA9B 1SKQA 1OLSB 1XCLA 4R8RA 2QTTA 1K66A 1KMMA 4FIZA 5DNCA 1ZM4A 4P3XA 4RD4A 5C8YB 2BCVA 2H4XA 5LVAA 3A0HU 1CUGA 1AQIA 2VT7A 5H81A 1OFVA 4HCJA 4IXMA 1FPMA 2FZGA 1ZL0A 4Y7CA 2JIZA 1NQOA 2Q3MA 1D6SA 3HN2A 4TLDA 1PKXA 3RS0A 3AP1A 5HMLA 4FSXA 2CCKA 1F3LA 1R5NA 4L78A 2I4IA 4LQLA 1BGWA 4X1YB 1DWOA 2D1RA 3OPYA 5KYUA 4OTZA 3RBEA 2WSMA 4JENA 1PGNA 4KLDA 1YQXA 3D6AA 3ECAA 2HIMA 1ABFA 3NHWA 4CQMD 1Q7EA 3GGPA 3GMIA 1ENOA 2Y0DA 3WICA 4RVFA 3G8CA 2P3QA 2X4LA 5H5JA 2KWIA 2P75A 1TT7A 2HPAA 4MYCA 1FYDA 3JPYA 3E70C 3NWPA 3D6JA 3REFA 4KN8A 2G5IB 4U7PB 4ALJA 3R3WA 4QOEA 5EHZA 3LPAA 4DF3A 4ECEA 1U1GA 2ZYVX 3ZDBA 5IS2A 5M7EA 3OO0A 3S68A 1URJA 2X5OA 1OR8A 1ZGAA 1D0SA 4L3WA 5BUQA 3PD7A 1F2UB 3NTRA 4IY1A 4MI1A 4QWEA 4C88A 4DQSA 4IMPA 2NU9B 4H7IA 5DDMA 2UVVA 3DZBA 1A8IA 3RTBA 1KJNA 1E3IA 2QPLA 1UMDB 3GJ6A 3SNKA 2DUMA 2WY2D 5LZ2A 1D09A 1NKSA 3GDOA 3B7PA 5CFLA 1I3OA 1J0XO 4AT1A 1FSFA 1YO6A 2DPXA 3L41A 3U60B 1LDMA 4ECQA 2AX4A 2IRWA 3BWYA 4W5QA 4S12A 1CU1A 2A8YA 3SBDA 2A94A 2QT9A 4JBNA 5JDIA 2QMQA 3GIMA 4MV1A 1PR9A 5FTKA 1QLHA 3HLKA 4D97A 4DXHA 1W85B 3NLLA 4NAUA 2TS1A 1FNBA 1AHPA 3G88A 4IBOA 5B2EA 1XWWA 1J49A 4AQDA 4GZ5A 1QV9A 1Z45A 1IBMB 4G07A 4BNUA 4JV5B 3E15A 1J8QA 1KVQA 3HP4A 3HO1A 4JBGA 1TW3A 1Z4MA 1RJEA 3NGXA 1EFPB 2Z4RA 4QT0A 3CZRA 1FDOA 5IUNC 4ED1A 9MHTA 3EFOB 2O7SA 6AT1A 2HBLA 5TX7A 4IEIA 2WVJA 4FT2A 1YTUA 2JEGA 3F9IA 2FJ0A 5TMBA 2AOTB 1YQQA 1BVRA 2QSZA 4FOOA 3QTLA 1HE5A 4MUJA 1USUA 3WNVA 4BWYA 2QUKA 1ACJA 2ZFUA 1IN8A 3ONNA 2EEPA 5ALHA 1S96A 5B4TA 1DC5A 3DZDA 1MA7A 1ODFA 1B0UA 1I94B 4MR9B 4NE2A 3HWSA 2C78A 5CNMA 4ZAWA 5C34B 1Y5LA 2A1AA 3B82A 1ZQBA 2LM1A 1H69A 3WP0A 3TJZA 1OXBB 3VU8A 4YMHA 5JI2E 4AC9A 2QDXA 2RJ3A 1RLOA 3QLJA 2JKVA 2VJAA 4GXNA 4V1CI 3CBGA 1PV2A 5LA6F 1NW8A 2D0DA 3BHMA 3NVAA 4NXZA 3S7TA 2ECOA 1KFTA 2O8FA 2FY8A 4D02A 3MQFA 1IEQA 4KLRA 3TEJA 3KALA 3QPAA 2ZIXA 3M5WA 4QULA 2DT8A 5KT3A 1J8MF 1XEWY 2ZUDA 2MOKA 4RVOA 3BWCA 4MR8B 3L4EA 3FPCA 1AROP 3QE4A 3EPPA 1C4XA 4E12A 4H6XA 4TLCA 4FBUA 3ADCA 5KIAA 3DV2A 1MPXA 2AN1A 4ZGWA 4LNHA 1THGA 2OYRA 1IC6A 4H3SA 3UMMA 3GEBA 4MARA 3C7TA 3OTWA 3VNSA 2Z43A 4Q9JA 4PYJA 1H4VB 4EDFA 3TDNA 3EMBA 3N7UA 5CNIA 3U19A 1J20A 4J43A 4IO1A 2A1JA 1EH5A 3RQSA 4GQBA 5IKPA 2BY4A 9ICVA 3IDOA 5FPPA 3H7IA 2C96A 1AQ6A 2CEKA 2Q3HA 1OTYA 1Q2XA 2YZ7A 4YP7A 1JQLB 5DBCA 1L4LA 3FZYA 3PEVA 4OXQA 4H16A 4CR7A 5EC8A 1NHWA 2BQUA 4K7JA 3IQEA 3H1BA 3TRIA 1F8FA 4HVLA 1L5VA 3K6SB 3U3OA 1HE1C 3H9QA 3T3NA 1MDFA 1E2BA 2VP9A 3NDPA 3BXHA 2QYTA 1R6AA 3WLFA 4D4LA 3EWNA 2XTNA 4B5KA 1NBHA 2VKTA 3FVWA 4LZOA 2X3FA 4YUXA 1V2HE 3DEZA 3BZBA 5C3MA 3PJFA 2UVPA 3TLEA 3KFUF 2F4NA 3KPUA 1HMYA 2VQFB 4L0DA 3IPCA 2A5YB 1TK3A 1UBHS 1E3JA 1PHPA 5J2UA 3IESA 4LBVA 1ULBA 3ZJUA 3VC8A 3TO5A 1V7CA 4KSYA 3LXRA 3COVA 3LGSA 1SCNE 2ZJ4A 7ICGA 4YD2A 2FOIA 4JYPA 3PNLA 1DDGA 3H4DA 3KDSE 2PT5A 4KZPA 5EFOA 4JQYA 1GO3F 4ACAA 4OKIA 1T3LA 2WRZA 3F53A 1WLYA 5GAJA 4J9OA 4ZAXA 2J0EA 2V1XA 4BGIA 1WO8A 1GNQA 1QVWA 3SLKA 5ERYA 5KHOC 4MRSA 4GUDA 5HK9A 2UZ0A 1FXWF 2XZPA 2X86A 3ANYB 3E5MA 5F21A 3DNFA 2JATA 3QZ7A 5SY9A 3L43A 3HP6A 1JIUA 3LDHA 5JOQA 2WAXA 1K8ZB 1KI9A 1DU4A 3IMGA 3TLZA 1JA1A 2XICA 9ICWA 1FVOA 2JIOA 1S02A 3C1YA 4RSMA 1HGXA 1EFUA 4ZQFA 3IXLA 3PUYA 1XSLA 4UB1A 3AONB 2OM6A 4AY4A 3N74A 1WW3A 3PX3A 5B53A 3U6BA 1LZKA 2FB9A 4EUNA 1LX6A 2ZW9A 3MINB 4CMIA 4ZJZA 2WSLA 3SHFA 5HSGA 3FVVA 4GECA 5BUSA 4YJHA 3JWEA 4RDXA 2XCUA 3GUZA 2XY5A 3MMNA 5KDLA 1WB4A 1GO2A 1W2WB 3ZQ4A 1DO2A 3SV4A 2C2GA 4LOAA 4RD1A 5CR0A 3KYCA 3QKIA 4UEQA 2FJPA 2FZ4A 2HF8A 1X39A 3JPQA 2MJLA 2FPGA 1HYBA 1KBOA 1YF3A 1W8DA 3K35A 3K05A 4LJ4A 4AF6A 2YX8A 3IAXA 4NULA 1H2AS 4CKXA 3VPBA 3WXMA 3DZ8A 1C3EA 2WPNA 3ZU3A 4PO3X 5T14A 4LWZA 1ZR4A 1SVKA 3H1PA 4DJTA 1PZNA 4G41A 4C0JA 2H63A 1SUEA 3UWMA 5JWRA 3KB8A 5CX1A 4UE3S 4R7GA 4X71A 4DQXA 2DKXA 2GCOA 3R74A 1MVNA 3T0IA 1ETHA 1PG2A 1XCOA 2Q6OA 3DZCA 5DBOA 3DE5X 5LQNA 3TOVA 3B2EA 1YR9A 4AJHA 4BJ3A 1CJCA 1NV9A 1P6UA 2RKBA 4LOHA 5DNEA 3QVGB 2VSYA 2CRXA 3A58B 2YQ4A 3LJKA 4RVDA 4ZQCB 1L5KA 1ISRA 2L19A 2KQUA 1USIA 9LDBA 4KLJA 4JQOA 1NKBA 3GHHA 1KERA 5EHGA 3ZCTA 5IFLA 1E5VA 2GN8A 4L15A 3ZNNA 3CPHA 4ETIA 3TE7A 3TNLA 2XVYA 3FB1A 2H3FA 1WYGA 3R6WA 3K1AB 1SXJD 2PV0A 1LRLA 2XKKA 3CNBA 4I1UA 3KKQA 1QV6A 1XAIA 3GXBA 4FYPA 1UCFA 1II8A 4MDFA 4N8EA 3CIOA 2V7VA 3E9YA 2I1QA 1S9DA 1GAJA 1P72A 5IIMA 3KAJA 3ESRA 2VDPB 3EOAI 1BS2A 3BMXA 3ST7A 4ASUD 1X0XA 5TEVA 4R5HA 2QD5A 1D2CA 1G4HA 3O8NA 3KQSA 5LXTA 3BFJA 4A03A 1QH1A 3QUSA 1P1JA 2NN3C 3UXMA 3AGPA 5T3UA 4NZMA 2WIJA 5EXSA 2Y27A 1GA6A 1JI7A 4L07A 3RRNA 4FNOA 5LNK1 4QFMA 3TAXA 1WEHA 4R83A 2IQ5A 2XRFA 3I34X 3TZEA 2MSLA 2UYYA 1T8TA 2ZRNA 4TYNA 1GT91 1HFKA 1S4QA 1NJXA 3SZ2A 3IBTA 3KOZA 1XSNA 1KY4A 1ZGGA 3ICEA 2IZ0A 1P4HA 1B4DA 4ZOQI 2VAWA 1F14A 2KMLA 4FT4A 1XTQA 4R2MA 3A2MA 3M2PA 1Q77A 3IE1A 1H65A 2Q4RA 4KE7A 2X0DA 4B81A 4JU8A 1NUAA 3E84A 3GIIA 1JFFB 5AVYA 1E79A 1JHUA 1ZK4A 4YPVA 2D13A 5DN9A 3HT3A 3G2KA 2JLAA 1YI0A 4Z54A 3TOCA 2VHXA 2QP3A 5AVQA 3PNVA 1GRCA 2B1RA 1D2AA 1E1NA 1FCJA 1XS9D 3FI0A 1ZCBA 4PCVA 1BZYA 4G09A 5A5FA 5B5SA 3B5JA 4O4HA 4CF6A 3EGIA 5F3XB 5JS8A 1GZ4A 4Q82A 4A1OA 3EEQA 3O8DA 3MRTA 2V03A 2AGPA 2XWPA 1PVVA 3CBQA 4LJRA 1PX2A 5DSTA 4KO1S 2WJ6A 1U98A 1DK3A 4R1QA 3B48A 1WWVA 5I7WA 1JBKA 2WMDA 3LKVA 4C03A 5J0SA 3COJA 5DF1A 2D3TA 1ZOLA 5JIBA 1SUPA 2A9OA 3HUUA 4M2YA 4DRYA 2GVDC 3PC7A 4D56A 3KQTA 4N40A 2HTFA 2C57A 2BGJA 2YL2A 3D0OA 1I4OA 5DM0A 2J09A 7REQA 3RB8A 2BMEA 3VO2A 5ILQA 2A88A 4G0YA 1LUAA 1I2BA 1K7XB 1IOWA 1LRKA 1FMTA 2B8NA 5KG4A 3DF9A 3FZQA 3QE0A 1WCIA 3F90A 4XCVA 3A10A 5KNCD 2HRDA 3F3MA 2J87A 3K72B 1Q1GA 4UM5A 4RPKA 4S1NA 3GLHA 2C4TA 3U3MA 4MIYA 4N6OA 4HDCA 5D5QA 3D1LA 1HNWB 2OL4A 1R4AA 3OHMA 1Y63A 3T9EA 1SD2A 4HUQA 1Z6GA 4F3NA 1TPYA 2F9LA 2DBYA 1T3NA 3HWWA 3B1KA 4YMTA 1SBNE 3BPSA 3FTNA 3VOBA 3IPXA 3VR0A 2O6KA 4HJXA 3ZVNA 2P6UA 5IEJA 1NK4A 1CRPA 4J1QA 2QVGA 2BFAA 3RU3A 4F3YA 1LTHR 4PM4A 1HOTA 2IVFA 3RH0A 3I83A 2P11A 1YC2A 1K7FB 2GD0A 2CL5A 2FRDC 1T26A 4NVRA 1SBTA 3UKOA 3B9BA 3VTZA 4BEVA 2QROA 3QLTA 5B1DA 3G0OA 4GX0A 4UUQA 1GG8A 5A9SB 1XTZA 2AJBA 1K8RA 2IOHA 3E27A 4B47A 2Z30A 2R9VA 1MABB 4JJZA 2OHGA 3N0WA 4QLAA 3JPTA 2CB9A 3VR5A 1WXQA 1XPOA 4QAQA 1E1CA 1O95C 3P0EA 4F3OA 4BO2A 4O4HB 5HBRA 5JZOA 4PGYA 4NS4A 1LLCA 4ED6A 4BKPA 1VKRA 4XA8A 2YW9A 3R3ZA 2ZBPA 3AU6A 1WSWA 3LIPA 1AK2A 4MI6A 3HXQA 4RQAA 2JFUA 8ICRA 1TVKB 5LQUA 4HNHA 3KOWA 2VPWA 1H5NA 1PEAA 2WOOA 1WM1A 3DAYA 2QN1A 5E6RA 3SZGA 4D42A 4CQNA 5TB5A 2GK3A 4KLOA 5B66U 3TR0A 4U0JA 4WCFA 3HJFA 1LDNA 3PX6A 1I10A 2HSJA 2OLJA 4KQKA 1BVSA 5FUBA 3VHQA 3GGDA 4B9LA 2F9FA 1X7DA 1XZBA 3QIAA 2Q1SA 1FW8A 2RGEA 3K9CA 3CJQA 4MAMA 2W6MA 3ZGXA 1DGJA 2GJSA 4QOHA 3U7JA 2Q21A 2C9DA 2RAPA 4OM7A 2I2FA 1QG4A 1E9RA 1COWD 1P29A 3IP9A 3KAKA 4KK4A 2QUJA 2KSOA 1UWVA 4Y98A 5AKIA 5K3SA 5T57A 3MS4A 1CRQA 1DAGA 1QRSA 1ZN7A 3TIIA 4RQ8A 3T41A 3O3MB 3VNQA 3ALRA 1FU8A 3P0JA 2V1UA 2NACA 1O6GA 1LI4A 3S8MA 2JFVA 3IAAA 2N0SA 2I6XA 1UBNA 3D02A 3GVPA 1ONBA 1RFGE 4QPDA 3NWOA 5BQFA 5AQ1A 1H93A 3E1GA 3IA7A 1IATA 4H7FA 1RI1A 1P45A 1E63A 1LV8A 4YAIA 3K9FC 3C8MA 3HQ4O 3HXTA 1NNUA 1SUFA 1ULUA 1ZXLA 4GXRA 4WKGA 2I4MA 4NX2A 3PFHA 4UNSA 4MUXA 4QZVA 5F7JA 3L7BA 5HDQA 2WZDA 1EUCA 2WWYA 1CB0A 1PR0A 4CCAA 3RK1A 2O59A 2IYAA 3OE5A 2ISCA 4L4YA 3K32A 3FG9A 3F6PA 5LWQA 3CTPA 1P9LA 1BWRA 4HK4A 3K2BA 3BIOA 4RY2A 4IRUB 1E1CB 1PV4A 2H3VA 5K6RA 3IIIA 2RFLA 2OCGA 2TMYA 5ADVA 3EIWA 3MJCA 4MUBA 3PRKE 1ZN8A 4WX2B 4YUAA 3OM8A 3U3RA 3FNQA 1UPFA 4U7TB 5HVNA 3LECA 1OCEA 3ZIDA 7ICJA 4NKRA 3BE8A 2PUAA 1EFVB 1NN0A 2PUVA 4IXDA 3RLIA 3UJAA 4DW8A 3BJEA 3V4FA 2VYCA 3N7AA 2C4NA 2O2EA 3C3XA 1Q7GA 1Y4DE 3WGGA 1O8BA 1UP7A 4BFXA 2X8JB 3PJEA 4REQB 1BO6A 3JRNA 2YQ5A 2VSOA 2ESRA 4UAUA 1TF2A 2NYVA 3VHRA 3DTVB 1UPCA 3HYLA 2KJ9A 4XUSA 1X9WA 1BYUA 2XKJE 3FTDA 2QIPA 5KDOA 4FR2A 5EFZA 2G6TA 4LV8B 5AUOB 3OQNA 2DHEA 2R1TB 4YGXB 2O8BA 9ICMA