3QU2A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 80
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu2A01
3SD7A 1RMTA 2R8EA 1YJ5A 3QU2A 4HGOA 3A1CA 4KYTA 1YS9A 1Z5UA 3EWIA 5AVZA 5IT0A 3QYPA 1J8DA 1Y8AA 3NIWA 1CR6A 1L7PA 2HO4A 5AK4A 2IOHA 3UMBA 5AM3A 3EF0A 3W5BA 3R09A 2I54A 3PDWA 1QQ7A 2JGAA 2ODAA 2RARA 3OCXA 2PKEA 1ZS9A 4GXTA 4Y2QA 4Y2SA 5AI4A 4F71A 2CFTA 4KN8A 1RMQA 4HYTA 4MUMA 3L0CA 4KNVA 2AUTA 2G1AA 2OYCA 4I9FA 2Q4RA 3ET4A 2BDUA 2R8ZA 4YIKA 3IB6A 3AR2A 5AKGA 3ZWDA 1T5TA 3N5KA 2O9JA 4Y2PA 4EX6A 3KDPA 3QU9A 4UMEA 2C9MA 3KBBA 1T5SA 3HYCA 2W11A 4L57A 2ZBEA 1ZD4A 3WKCA 1T9ZA 5AKLA 1NRWA 2EAUA 2JARA 4L6CA 2FPXA 3R4CA 5AW6A 4YGYA 5ALIA 1FEZA 1RKQA 4IG4A 1RRCA 4G9BA 4JDPA 1IWOA 3FPSA 2I6XA 5AKJA 4RESA 1ZD5A 2VKQA 3A1EA 3BWVA 4Y3UA 4BYGA 1RDFA 5ALYA 3U19A 3N8GA 5AI0A 1SU4A 2WHEA 1N9KA 1Z4KA 1NNLA 2NYVA 4CE6A 1X42A 5AKEA 5ALSA 4UAVA 4ZEWA 5FP0A 3E84A 3U13A 1Z88A 4BX0A 1VFPA 2P9JA 5AW2A 5AM2A 4XPZA 3FM9A 1L7OA 2RBKA 3B9BA 2Q5EA 4KX5A 1XP5A 2IOFK 4MWOA 3E8MA 2AGVA 5AVWA 5AW1A 4Y2XA 4FE3A 2HCFA 1PW5A 1TJ5A 4NAVA 2YBDA 4EEKA 1WZCA 4XQ0A 2ZG6A 1O08A 5A3SA 3QUBA 3N07A 1U7OA 3W5DA 4J03A 3UMCA 2D2VA 3OCZA 3MN1A 1RQNA 3OCUA 3ET5A 1TA0A 3AR5A 5AI5A 1L8LA 1RKUA 5AW9A 2EARA 3QUQA 4UARA 5AKYA 2WFAA 3NANA 3RF6A 1Z4JA 4BKMA 2B30A 1QQ6A 3DV9A 3QUTA 3R9KA 2OM6A 1YV9A 2WM8A 3ESQA 3WK7A 1XPJA 2YY6A 4AS2A 3IJ5A 2G07A 2HSZA 3CZ4A 5JJBA 3ZX4A 3MC1A 2I34A 3L1UA 1YDFA 2FI1A 5ALDA 4C4RA 1Z4MA 2ZBGA 4Y2JA 3OPXA 2CFRA 4OCZA 3WK9A 1Z4LA 4AP9A 2B1RA 5AK6A 1RKVA 2QLTA 4Y2VA 3DAOA 3ZWKA 1U7PA 5AK3A 2C8KA 3GYGA 2JAUA 2W43A 2GO7A 2WF5A 1TJ4A 1ZRNA 2FUEA 3I28A 2CFSA 5AM5A 1N8NA 1S2OA 1QQ5A 3QUCA 5AM4A 2RB5A 3NAMA 3VAYA 1RMYA 3WK8A 2P69A 4BBJA 3KC2A 5AKIA 5ALLA 2G09A 3OTQA 5AK5A 3ZW7A 3AR4A 2G06A 2I7DA 2AMYA 2R8XA 4NABA 3WKEA 1LVHA 5ALPA 4E88A 5AKHA 4O8CA 3RFUA 3U7EB 2YJ5A 1JUDA 2I55A 3DDHA 4C4SA 3QGMA 4DFDA 4XOUA 4BX2A 3KD3A 2G0AA 3B8EA 4F72A 1MH9A 3E81A 3TLMA 2DQSA 3P96A 2RAVA 1RLOA 4YCNA 3DNPA 5AVUA 3AR6A 2HEGA 5IT4A 3SKYA 2ZBDA 2ZBFA 2YJ3A 4QJBA 3QU4A 4HGNA 2FDRA 5ALFA 3ZTYA 3L8HA 5T41A 3B9RA 2FPUA 4B6JA 3CNHA 1L7NA 3I6BA 5AKZA 5ALOA 3KZXA 5AIBA 4EZEA 4YCLA 2MSNA 3U26A 2JAOA 3A1DA 5AI9A 3MPOA 4UU1A 3AR9A 4YCMA 3ZX5A 1VJ5A 3WK5A 2PQ0A 5AW8A 2OA0A 2WF8A 4Y2RA 2WF7A 5AM1A 2BDEA 2FUCA 2P27A 5ALQA 5ALHA 3L8EA 3SMVA 2YN4A 4IFTA 4FYPA 5ALKA 1AQ6A 4Y2YA 2ZXEA 4UAUA 1TJ3A 4UU0A 1YNSA 3UM9A 2FPSA 3SLRA 4OD0A 1Z4IA 2FEAA 2HHLA 3A3YA 1QYIA 1J97A 2GHQA 2MU1A 3FPBA 1U2TA 3ZU6A 3NUQA 3ZVMA 5ALTA 3WGUA 1ZD3A 2JAWA 4OFZA 3QXGA 2B8EA 5AVSA 5IS2A 4Y2UA 1CQZA 4CF4A 4UM5A 5A3QA 3U7HB 2IOFA 4DCCA 4UM7A 3QU7A 2EATA 3ESRA 1EK1A 3W5CA 2W4MA 3F9RA 2WF6A 3QU5A 5ALEA 3QNMA 4NFLA 3S6JA 1U02A 4CNQA 5AVQA 5AW0A 2FPRA 1Z5GA 2AH5A 2YMMA 2HF2A 2C88A 4EENA 2GHTA 5AVYA 1ZD2P 2R8YA 2G80A 3ZVNA 3L8FA 1ZOLA 2ZOSA 3ZUPA 4ZEVA 3PGVA 3WGVA 4Y2TA 3QLEA 2CN1A 3N28A 4EELA 5A3RA 3J7TA 4C4TA 3L8GA 4YH1A 4AS3A 3WKAA 1SWVA 4I9GA 3QX7A 1EK2A 2B0CA 4UW9A 2GFHA 4RETA 3U7FB 3ZI4A 3AR7A 5ALXA 1VJRA 3WKBA 5AICA 2Q4TA 5ALWA 1YMQA 4CF5A 1L6RA 2B1QA 3L0BA 1WPGA 4G63A 3NALA 3D6JA 4BNDA 5ALMA 4HAIA 3OCVA 4QQFA 3I1YA 5AVVA 4BNDB 2YMQA 3FVVA 5AI8A 4KX3A 2PR7A 1Z4QA 1Q92A 5AVXA 4KNWA 4OHFA 3OCWA 2G08A 2C8LA 2C4NA 4CF3A 5AW4A 2YJ6A 1WR8A 3ED5A 4JB3A 3BA6A 2O2XA 3UMGA 3L7YA 2MU2A 1ZRMA 4BEVA 4HGQA 5ALRA 4ZEXA 3HLTA 5AM0A 4NV0A 5ALVA 3EF1A 4EX7A 1S8OA 4BX3A 2FPWA 2HX1A 3M1YA 1Z4OA 3WK4A 1NF2A 5ALGA 3K1ZA 3IRUA 1TE2A 3NASA 5AI6A 3WK6A 1Q91A 3E58A 2IYEA 4L6AA 5E0OA 3M9LA 1RQLA 1RC8A 1KYTA 2OBBA 4UMFA 2BY4A 4H1WA 1RPZA 2NO5A 1WVIA 5AESA 1ZJJA 4DWOA 2YMPA 5AW7A 5AKKA 5AW5A 5ALUA 3SHQA 5AKXA 1U2SA 5AHXA 3OCYA 4HGRA 2X4DA 3L0YA 4PNHA 2YMLA 2HDOA 5ALZA 1F5SA 1L8OA 4XE5A 1SWWA 2HOQA 3L1VA 4UASA 1Z4NA 2HI0A 5ALNA 3U7GA 1Z4PX 3I76A 3MMZA 3EPRA 3ZVLA 4DW8A 3L5KA 3WKDA 5ALJA 4UMVA 2NO4A 2GMWA 3FZQA 3SF0A 4UATA 3W5AA 4GIBA 3AR3A 2B8JA 2WF9A 1LTQA 1QH9A 4J2TA 5AIAA 3KOOA 4NWIA 2IA5A 1RLMA 3PCTA 1XVIA 2P11A 3N1UA 3AR8A 3ZTWA 5AW3A 5AVTA 1O03A 1K1EA 1L7MA 2QYHA 4HGPA 2I33A 2YJ4A 3NRJA 4YIHA 2HF7A 3PGLA 2YFYA 5AVRA 4BEWA 4FFDA 1RLTA 3SKXA 3FGOA 2B82A 4UMDA 3ONNA
chains in the Genus database with same CATH superfamily
1GGMA 3EXHC 4C7VA 4LBYA 4JI7B 3GIKA 2APJA 2CLOB 2OBFA 3MSCA 4U0KA 5KSZA 1N62A 3QU2A 3H2YA 4B6RA 1P1CA 2PXCA 4MI9A 4JI3B 2Q3JA 2JGFA 3KHHA 2DPLA 2I8CA 3WMFA 4BQQA 2C07A 5IT0A 3FMOB 1AZLA 3RJMA 4NXZA 1ZMRA 5B1DA 1J25A 1GQRA 4E31A 2OLJA 3JPRA 5KAMA 1UT5A 4OQLA 3QWIA 1JRLA 1M6HA 4CXMA 3NHSA 1OHHD 1MR3F 4YXMA 5KT2A 3UGKA 1U0HC 3DBHA 2RBEA 1SC3A 3PQ6A 4RJIA 2MJLA 4QTTB 1ZQKA 3WADA 4FZJA 4EMBA 3T5GA 1W73A 4J0HA 1M2WA 4Y6LA 2YFKA 121PA 1OXXK 3GIJA 1Z0SA 2FSVC 1HI9A 2QSZA 4ZO9A 2XNHA 3REGA 5EWEA 1H5UA 3UGTA 2E4XA 3EYZA 1GNLA 1IOWA 1G60A 1XJQA 1EP9A 3B5IA 3H3JA 3Q3HA 4OU4A 1YQWA 1JFLA 3F4BA 3JRNA 2EEPA 3OM9A 4R9RA 8ICHA 1Z33A 1QHSA 3SZ3A 3V33A 2HMUA 2G9RA 4IR7A 2C58A 2OXFA 2ILVA 2J1LA 4IQGA 4YMNA 2RFLA 4N5NA 4X8HA 4MRNA 4WL0A 4F21A 1DOQA 3H9JA 4RZQA 3DGEC 3WQRA 2Z9CA 4TROA 4EGFA 1VL6A 1LBQA 2Q6KA 2QTZA 4K9LA 4RA6A 5HTOA 3Q8LA 1E4VA 3HUUA 4BPBA 4DQDA 3AR2A 1ZVJA 4ER5A 1K68A 1DGQA 3LK9A 5B58T 5JWHA 4HNSA 2ORYA 2QDXA 2QVCA 2VH1A 4XSVA 4CLEA 1ZXIA 1KTIA 1ZLXA 4EX6A 1U28C 4YFKA 4PNPA 2YDYA 4TSKA 1JB9A 1U4BA 2PXIA 1G42A 1ZEMA 2I1LA 3OZ7A 3Q85A 4OHUA 9ICFA 1R0LA 2V8BA 4LVNA 1XA4A 1V9PA 3P2YA 4GPZA 4XXHA 5E1DA 2HA6A 3KV3O 3B3AA 4FI3F 4HWOA 4ZI3A 2W8KA 1QVVA 2QT0A 4JUIA 3BSSA 2EKLA 3CRMA 4S24A 3UXYA 1KS9A 1CZLA 1X1RA 4QSHA 3M3DA 2YB1A 4DA8A 5BURA 3TB4A 1MDBA 5F5XA 5I45A 4RK0A 4Z3OA 4BJ5A 1CC1S 4IVQA 221PA 1LBSA 1HE1C 1RYYA 1U7HA 1MRSA 3VPGA 4DNPA 4ZGGA 1DIHA 4ZOCA 4AO8A 5ALIA 1KKUA 1RJWA 3RVOA 4ZYWA 1E7QA 1FCJA 3G6VA 3DLCA 4IMJB 1E3WB 5JI2E 1ZK0A 3CKMA 2NTEA 5IXYA 1C0LA 2JGMA 5JSHA 3DW1X 2P41A 1SPXA 3MWKA 1L5KA 3S81A 1MXFA 4MW0A 3OETA 1O94D 1X2BA 4PZYA 3LWMA 5LDGA 1CUVA 1H23A 1E89A 4Y3UA 4TQAA 4QO8A 1KBUA 4JYBA 4MRPA 1HLGA 3AI1A 2QE6A 1H3NA 4REQA 4TRRA 3OOYA 4PPFA 5LBIA 1LC0A 1WHTB 1JIJA 1JJFA 3K4PA 2ADFA 3PPWA 2F3RA 3KOXA 1DGSA 3ESAA 2NRTA 3EFOB 5BOSA 4DCVA 4K46A 1RWNA 4GI1A 5DI3B 3KTQA 3KM0A 3D2SA 1DV2A 1I14A 1PKXA 3CUSA 3G1UA 3LP5A 1MW9X 4OUDA 4YK7A 4M36A 5FOVA 2YWRA 2F1HA 4E5YA 4REOA 1P4HA 1DUIA 1WSBA 2EZTA 4PL2A 4MYRA 4P3KA 5LMCA 4M8KA 1T8PA 3ADKA 5B5SA 1FP2A 1GUFA 3RVLA 1IJKA 2NZVG 2CEAA 5AM2A 2WP0A 2X1MA 7ICJA 3LZDA 1SO8A 1Q7BA 2VHJA 1V95A 4W5JA 2DGZA 3VR3A 3HWTA 2F77X 2G6BA 1KJYA 1ATZA 1H9AA 1Y8RB 2KLHA 3GLKA 3KELA 3OZDA 3TN7A 2BSQA 4QZ8A 4PONA 4CUZA 5AJWA 2WU1A 4LZOA 4E5UA 5BNZA 1YU9A 1QP8A 3FNIA 5J4VA 2WM3A 2IXAA 4OMCA 2HMAA 3JYHA 3CZ9A 1V11A 3JRWA 3EDCA 4WY5A 5KMGA 4ZT2A 1TJ5A 5IYZB 1MB2A 2GGSA 1ML4A 2XCAA 4I1YA 4KPUB 1RKXA 2IPMA 2P35A 4BXOA 2D3TA 4JLPA 1S9DA 4BB5A 2IXBA 4ARIA 3U3JA 3K32A 3O8QA 5F2OA 5KWEA 4UNRA 2E5SA 2XVMA 3MTEA 3OQ6A 5GTDA 3SDBA 2YHBA 2X5XA 1TA0A 4B3RB 3O5AA 1L8LA 5AI5A 4QATA 2YDXA 3DFZA 3DP9A 4FHZA 2XYRA 2UVQA 1AGRA 2PO7A 1XZGA 1NKBA 1KRHA 4G2NA 4GM4A 4QDUA 4J7XA 5E3HA 5JPCA 3T1VA 3GOHA 1DHTA 4E14A 3O4FA 4F5QA 3PGKA 4WEQA 1BO6A 3CF6R 3PYMA 1P9RA 2YXLA 2AFIE 2C2HA 3CX4A 2G70A 1TUGA 3C28A 2B30A 2RGXA 3FVWA 3FYDA 4QUEA 4R1SA 2Q3DA 5EPUA 2XH8A 4PF1A 3TRIA 1CJSA 2NZXA 1XLTC 2D7CA 3P9SA 3MNFA 2OO3A 3OHAA 3H05A 3B60A 4TSRA 2LDXA 3JWIA 5BQXA 3THOA 1XPUA 1M6WA 3KAJA 4JQZA 3DCIA 3TAPA 4O5CA 5JSYA 2VG8A 2WB1F 2ZRAA 3FGZA 4JV0A 4C4RA 3EXG2 2FMIA 4L8GA 3ZWBA 4I4TF 3WWDA 2GH1A 1HDIA 1LWNA 4BJ6A 1QNFA 1JEJA 3GFOA 1W49A 1NFFA 1KRPA 3L79A 1MO2A 3DTNA 4O02B 3MT0A 5DZSA 4JBIA 3I61A 4F91B 2WQZA 2FMHA 3R3XA 4IM7A 1X80A 5H0IA 1N6OA 2Z1MA 2IH4A 3WOHA 4CKEB 2YWXA 4X90A 2JAUA 2R8BA 3GELA 2A78A 2QTTA 1MORA 3C8HA 1E1CB 4HHEA 3HABA 4XCXA 4UU7A 5C5IA 3OQMA 1E3IA 4RHUA 2LYAA 1BW9A 3GJ3A 3ZI0A 1ISIA 3MYYA 3NAMA 4WFQA 4DL9A 1D8AA 4NF2A 4CR7A 4LPSA 4ZQEA 4DSUA 2WSIA 2Y4OA 3RM3A 3ZXUB 1XQ6A 3JSXA 3KZMA 4MTCA 5IAJA 2G09A 5IAOA 1UP4A 3OTQA 2EZ4A 3GLIE 1OE0A 3I52A 1WUIS 2ZPUA 1G18A 3AP3A 2PKCA 3CLVA 3TZBA 4Q7QA 3K0KA 2KJQA 2CL6X 3AX6A 4DXAA 3EZ5A 4DQRA 2R8XA 4IWXA 4PQFA 5FI0B 3TYXA 3CPSA 2VCYA 2HT1A 3EEQA 1J7KA 2R00A 2LCQA 1QTIA 1Z2NX 2YJNA 3SYRA 3VV2A 4HAOA 3TJMA 3DZ8A 3GDOA 4DFDA 3G2PA 4PFKA 1VOTA 4WOKA 4E4TA 5K0CA 3E81A 3TLMA 1V9SA 3DE7X 1NJ2A 5JYEA 3THXB 3B51X 5TJHA 4ZCPA 3EX7C 5ENDA 3ZLUA 1ULSA 1JXAA 2BMDA 4D1YA 1J33A 1GTMA 3DHVA 2FZGA 1B41A 4AN1A 3E2MA 1CUGA 3QITA 3C5GA 1A9XA 4CQNA 1DG3A 4BMXA 3GPDG 3VZRA 5TQJA 5DHUA 5U9CA 2WB2A 4DF8A 1VCIA 3KJHA 3G0IA 1MT3A 5CT5A 4LHEA 4OXQA 4ZVNA 1Z0DA 3K0FA 3Q3VA 3RC3A 1PJLA 3SE7A 5ITWA 2UYHA 4J3JA 3SLGA 4EP1A 2W6NA 2GUGA 2J0UB 1MV5A 1TKRA 4F96A 3U26A 2PGIA 4AC9A 1JG7A 4AZ0A 4DMRA 1RCFA 1XN1A 3GOQA 2GHIA 2XOKA 4H7KA 4TYPA 1KIFA 2PGJA 3WXMA 4JQOA 4DUGA 4YCMA 5JEEA 5HE8A 4IDDA 1T2AA 4I9UA 4RPJA 3WK5A 3BEDA 5IVIA 3V6JA 3ADBA 2PEYA 4LHYA 1EDEA 4HH0A 4KPEC 1BPYA 4G5GA 4ZVVA 1MQ2A 1OXTA 4QOFA 2VP6A 2YUIA 5C3MA 4AYTA 1GITA 3OU7A 4NEGA 2NUBA 2J8ZA 4YMOA 2KYRA 5CNKA 3O82A 1CIPA 3AF3A 4JT4A 5DLYA 1VDMA 3RVPA 3SS8A 3D2AA 1IIBA 2WC1A 4EFLA 3IEKA 1TU0A 4IGFA 5LZ9A 2YNMD 2ATIA 2XVXA 3K9CA 5I51A 5LP6A 4RPXA 2VWQA 2HHQA 1KY4A 2JANA 3JPNA 2HHLA 3NOVA 4XUDA 2XYPA 2X42A 2PCJA 5CAEB 2QZSA 3W9SA 1PR0A 2KZ3A 4LK2A 4FM9A 4U8GA 1C29B 2NV0A 3RBDA 3E9EA 2JL1A 2IHTA 4CMEC 1DT5A 3SF8A 4MMZB 4F6RA 4GXKA 4NE2A 3MGIA 1FFDA 1G0NA 3TKAA 1OUQA 1M34E 1DKNA 4FINA 2XVTA 4F50A 2NUPA 3K0CA 4I3HA 3ZPXA 5B7GA 4Y2UA 2IZOA 4OP1A 2ZJ5A 3JASB 2FSFA 3HA5A 1ZJZA 1OLXA 3RJIA 4UM7A 1AUQA 1G5QA 1NVDA 4PXYA 2X6TA 1EVEA 3T34A 2QXUA 4G1VA 1QH8A 3CMCO 4H7IA 2JLWA 5IUJC 4KAXA 5C53B 3E61A 4KK3A 1TADA 3AFGA 5CFLA 2W4MA 2WJ6A 3DZIA 1QCZA 4N8SA 4XSHA 1EGVB 4Y0AA 5AD1A 5M5BA 3WLRA 5HDBB 5L3ZA 2RGEA 1NJGA 1NR1A 3IAAA 3UG7A 4HNUA 1J09A 1JVBA 1OI7A 1S96A 5ED4A 5ALEA 1N57A 1L5YA 2OCKA 3EGDB 3FXAA 3RS8A 4MA5A 2QG6A 4FFOA 4RJKA 2BEVB 3I5YA 2CV0A 1M0TA 2PANA 3JSAA 4J8PA 1OBHA 3HCWA 1ZQXA 2V4RA 3RFCA 1HQCA 4NC9A 3TUZC 2GHTA 4DYDA 2D59A 1ZMXA 2PTGA 3AY3A 3K9BA 3Q7IA 4EI7A 4Q6WA 1I7QB 3F90A 1A04A 5LQUA 1TUBB 1BGWA 2WLTA 5E7MA 1FMFA 4RIGA 1C20A 1RI1A 3GWGA 1ULBA 2OV3A 2CCJA 2ZRFA 3IOMA 2P30A 3IOCA 4YLEA 3HKZC 2HUPA 4AW9A 1RM3A 4YJFB 2O8VA 3THWA 2PHZA 4JYCA 5KDDA 1ZICA 1XNGA 4CMKA 2QRJA 4PYIA 4YH1A 2TMKA 4AS3A 4GWKA 1R0SA 2PDAA 3HJBA 3OHPA 4CKYA 3NO4A 4AZVA 4D46A 4AUKA 3KT6A 2DBVO 1WKVA 2R2AA 4YS6A 5BN3B 2P68A 4UW9A 1P62B 2O2SA 2O3UA 4PXAA 4QUDA 3O4VA 2B2NA 3L18A 4FBLA 5H70A 2FPGB 5I3CA 5L53A 4EYGA 1E5TA 3SI8A 1I32A 2CJYA 4HC4A 3UJ7A 4AQ7A 3WKBA 4R9NA 3PUZA 1PV2A 3K6SB 4ALMA 4V3CA 4DDWA 1SCKA 4HNHA 4D96A 2BOVA 1G0OA 3GMDA 1C3LA 2J08A 3WGHA 1YKGA 2Z4TA 4KACA 1XA0A 3HR8A 5AJHA 1DXSA 3GF4A 4HZUB 1DDIA 1I2AA 1SCUA 1UM9B 1L5VA 4GYWA 4AD8A 2YV1A 4EEYA 4LJKA 1W96A 3T95A 4DDHA 4EYOA 1STOA 3NALA 4RHCA 5FUQA 2VNKA 3A11A 2C5HA 4Q1VA 2JVIA 4L74A 1K7XB 1S0MA 2DF4B 1WPQA 3D8HA 3HDYA 2AMVA 5DBBA 4M46A 4NDAA 4MIYA 1AKYA 3VNAA 3SXUB 2J48A 3OLCX 5J2DA 3DZKA 3ETCA 3OT1B 2XBMA 5IT9A 1MB3A 1XU7A 1FNSA 1XXHA 3CX7A 4BDSA 3LT2A 2I9PA 5K9ZA 3IV9A 3DMDA 1IRXA 1DAOA 7ICUA 2Y77A 3FZNA 2R5NA 2FLNA 5HMLA 3L1IA 5TC4A 3ZIDA 4JB3A 1V5GA 5KJ6A 2OO5A 2PVCA 3I9JA 5FULA 4F12A 1ZRMA 1OV6A 1WCIB 4GPD1 1ZOIA 4NSNA 3P2MA 4RF4A 5CM9C 4BX3A 1R5OA 1PD1A 4GKAA 5J0UA 4IH4A 4YUZA 2D00A 4QM6A 1GGFA 4LYJA 5DHTA 4O3MA 3WK6A 3NYIA 4LWQA 2IYEA 3V55A 3OTOB 4F2RA 1IN8A 1R9GA 1RTKA 1EK5A 1VGQA 1W93A 1YONA 1CJCA 2EV9A 3M9LA 2H5IA 3N87A 2Z2IA 3EUAA 4C80A 4LSWA 4NHOA 2B98A 3V8NA 2HNAA 1W19A 2FE1A 5AESA 3V2GA 4O3SA 3R5SA 3MAAC 1NVVR 1KL9A 1WOMA 4YWHA 4XFJA 5KYYA 4LFBB 3ISCA 2QLBA 1YJCA 1A8HA 5EUMA 3SDZA 4QZGA 3KSZO 2A1AA 2WRZA 5HJ2A 2QVLA 2IYUA 4XVCA 1Y9JA 1YASA 3ANTA 3TMYA 4TMZA 5IMSA 4ZZ2A 2VNHA 1OBVA 3TAQA 4OB8A 4GF5A 3RH4A 5FL7A 5L3QB 3FI0A 4KUEA 5B64A 3DE4X 3DZBA 5J4KA 4Q12A 5CYOA 2A92A 4DV4B 3MDCA 2Z2KA 3LZCA 3MMZA 1C50A 4QPDA 3GAAA 5E2IA 3G8AA 1JSCA 2EAMA 3L5KA 3HCOA 3UMFA 3MLAA 5C18A 4JC0A 3OEHD 4I3GA 1DQNA 2NM0A 5FJJA 3ENQA 1U3VA 5DYWA 4B3CA 2B8JA 3A0RB 3O84A 2A67A 4X00A 3PGA1 4B9UA 1GGVA 3W2FA 5LP6F 5CNIA 1VJGA 4A03A 3MR5A 3BGVA 3RTCA 5J0XA 3JQ7A 5IXJA 1XCOA 3AVTA 2QARB 4RZRA 3HDJA 2O14A 1ZNQO 3Q87B 4KMOA 1X74A 2WAYA 4DUZB 2EH9A 1KVRA 2Q41A 1U90A 2Q99A 3L40A 4WXHA 1T2EA 3SM3A 4BUZA 4E6EA 3EY4A 5AVTA 5LUBA 2NVBA 2QPLA 1IATA 4XIGS 5FNZA 2F1KA 3DUFA 3LCRA 3MZ0A 5TB5A 3QY9A 2HHWA 2LHTA 1DAHA 2AQIA 2X3FA 3IUYA 3UHFA 3FYSA 2MSLA 3GNSA 4QFMA 4WA7A 3ZKWA 5KNLA 2HF7A 2VDWA 1TC2A 1OWLA 3DOCA 1ZC3A 2B3TA 2I78A 2P3LA 2WKQA 3KYDA 1E3JA 3UVEA 2QUIA 4AN0A 4EUFA 1U5BB 4MQFB 2A88A 3ESXA 5GINE 5C46F 5BSGA 2ZQYA 5IAKA 4JT2A 2I7TA 5DQIA 2IW1A 2J3HA 2V9ZA 1Q74A 2Y2UA 5KINB 1D7AA 4M49A 5EJAA 3W3AH 2WIJA 5B3KA 4HJRA 3K96A 2R62A 2PBZA 2XODA 2VHUA 4CIWA 4EBEA 1FRQA 1PSWA 2ZGVA 3F6RA 3VNBA 1Q46A 2AL7A 4HB2A 4LJ4A 5AOCA 3PXXA 2B69A 4IR1A 3RAGA 4AMBA 1DRWA 1U0SY 3ASUA 3BFKA 4LZAA 3FOBA 1JH9A 2YVKA 1W36C 4UHFA 1PG2A 1B4FA 2Q0ZX 2R6FA 5K8LA 1KR2A 4B43A 1YCDA 3KQHA 2XQVA 3G9TA 1HT2E 1BVHA 1P80A 4E1VA 3NWBA 1PAUA 3FC4A 1CJUC 2XVYA 4HUQA 5F98A 1B74A 4BLVA 4UNPA 1S76D 4EHKA 2I7CA 3B70A 2O3QA 3PNBA 2OOKA 2CVOA 4XIJA 1Z36A 1R00A 2Q2NA 1FP6A 2GEUA 2W6ZA 3EBOA 2QYOA 4NL4H 2ZXIA 4YJ3F 1HEUA 4PG7A 4KE7A 3MA0A 4JP5A 5JSZA 4GC5A 4G0ZA 2PWAA 4G36A 2W8BA 1AROP 4DFJA 3A9TA 5EAIA 2I2DA 5BYBA 1ORWA 2C94A 2OAEA 5DTJA 1HE5A 4LXGA 4DT1A 4O29A 1SKBA 1O95D 1XCGB 3E6AA 4PZLA 4ZVSA 9ICOA 3R2JA 5DBFA 1V85A 5H83A 4BTVA 3E4DA 4NLBA 3AUJB 5G0SA 3TLYA 5C8VA 3QU9A 4Y1EA 3DDZX 2A58A 4PQEA 5ITZB 3N58A 2C9MA 4PGXA 5I9BA 1A9YA 3C2LA 1L5SA 1I3OA 1JQBA 2C59A 3CLUC 4MW5A 3S5JA 4C1BA 1UJNA 4G81A 3DYIA 4FOTA 1UDWA 2UUPA 3WKCA 3HDQA 5BSTA 4BNTA 1Z0JA 4MHTA 1WCNA 5HZGA 1IQ0A 3AQ4A 1DK3A 1THGA 2LMRA 1M5TA 3TCKA 2ZB7A 4J90A 4DADA 1FEZA 4Y8VA 1NXVA 4S2EA 5CXSA 4OGWA 5H4GA 1Q57A 3QLVC 3BD8A 4O2AA 1FSFA 3I42A 4JDPA 4P4SA 2C2WA 2KZMA 1IULA 3E3AA 4PYOA 2VQEB 5DKWA 1E96A 2BKUA 2LUOA 1ND6A 1VLQA 4JJ7A 2M6LA 4FCCA 2ZRHA 4H0CA 1IQUA 3ZHVA 3N2EA 3ZHCA 4DDKA 3E5MA 3PXBA 4LMBA 2C04A 3L6CA 3M0EA 4UE6A 2Q49A 2GA9A 3OQOA 2WHEA 2VYVA 2VA9A 1N9KA 2X8JA 4DLWA 5FI3A 2PKYX 2ZS8A 3BMNA 3KEMA 4X65B 4CE6A 2W6JD 3ZWAA 1NYRA 2BP7B 4CLXA 2B9VA 3M82A 5EE1A 3S2YA 1A71A 2CB9A 3DCYA 5HRCA 2LVBA 2JB9A 4PHCA 1K6MA 1J2UA 2PX5A 2R7LA 2QN3A 3KO8A 3N6VA 2JLZA 3VX3A 4ITUA 1JPNA 4XLZA 1TKCA 1YZLA 2P8SA 3E84A 3U13A 3ZQ4A 1W0JD 4RJLA 3QE4A 2P9JA 3TBHA 3WOVA 1Y48E 4MVJD 4U7GA 2I71A 3C48A 4TUQA 5DM0A 1OC4A 4N47A 3WYBA 5LXTB 4HPJB 2CLCX 3UF0A 3X1MA 2JEYA 3K0AA 3KT3A 1JA9A 2JF0A 2PGLA 1Z8NA 3ICWA 1E99A 2QT9A 2IHJA 3B9BA 2NACA 3FROA 2CL5A 2KPOA 3JARB 1Y88A 1X9SA 2WU4A 5GPBA 3TW6A 3GUYA 3PKIA 3HCRA 3MG9A 3WL8A 1YTUA 2WWTA 1W2GA 4J1TC 5HIIA 4EYQA 4G89A 2EFJA 5C7OO 1DG9A 4QOGA 4W5TA 3EQZA 2ZJYA 3C3EA 5KQGA 1JR3A 4X95A 3U4IA 5DJ5A 4W9MC 1M72A 3CW2A 5CP8A 5I5GA 1WW3A 4RQ0A 5L9XA 2IDJA 5GJVC 4Q1CA 1ILEA 3NRWA 3AUAA 5DM4A 4BXOB 3CRXA 2G63A 5T3YA 4BE9A 1N1GA 1U3WA 4HSEA 4GWLA 4HYYA 1OGJA 2ZIGA 1JPJA 4HSGA 4MZXA 4Q18A 1QU3A 3BXHA 4C3ZA 2I1VB 1TCCA 3DMGA 2JH9A 3EVDA 3HB0A 3O26A 4CQJA 4FMDF 3DVAB 3NANA 4JI1B 2NPOA 4GU5A 4ZZ1A 1CZUA 5F2KA 1NOIA 2R66A 4JLBA 4BKMA 4CPDA 3M6XA 1Y8RA 4JSYA 2F62A 2Q21A 5KG1A 3CMMA 3BWCA 3FYTA 1U0RA 1U3DA 2M32A 2NT4A 3X0DA 4EUSA 2C98A 4FWTA 2P4UA 3RUIA 3QYJA 4U2KA 3JASA 3ZK8A 3ZIAD 3IJ5A 2Q8PA 4ZT4A 3H9QA 2HSZA 2K4EA 1CS0B 3WHIA 2WAOA 2UVDA 4NIMA 4K6CA 4DJDC 1PT8A 4OXKA 1UKCA 3VOSA 3O7MA 2GPSA 2OBYA 3NBYC 5J8YA 1DTWB 4PSCA 2GILA 1GEEA 5B30A 1WDTA 2WIDA 1R4MA 2W2OA 2X19A 3BMOB 1P1JA 1I5EA 4JNCA 4OMUA 5CVUA 5H5JA 4AICA 3THXA 1K86A 2G5TA 3TI7A 1Y7IA 5CIWA 1W36B 1OIXA 3MVEA 3PD7A 4JA0A 5KB3A 4J4TA 2R65A 1H2BA 2ZCVA 2CXRA 1R0ZA 2PZEA 3S27A 4AUNA 3A1NA 4JHLA 3BCHA 3ZWKA 4DBLC 4F4XA 3O0DA 3TH5A 1QOZA 2XRFA 5IP5A 3UY4A 1S8AA 1VIVA 3UZUA 1KZ7B 3GPCA 2GO7A 1NN5A 4GFJA 2R8JA 4UUNA 2IYXA 3GV8B 3U5ZB 1W5TA 1Y9DA 2W83A 4CT5A 4QUJA 5BVGA 3W8FA 5CEEA 2XJ4A 1S2OA 3IAM6 3DE2X 3QUCA 3GAMA 3GJYA 3KQYA 5A5GA 3WNVA 1PT6A 1KGSA 1NJ6A 1O0BA 1QQTA 5DRTA 1XBTA 2OR3A 8ICXA 5E2AA 4AIRA 2C2ZA 1IN4A 3G89A 1FSZA 3W6NA 7GPBA 1S4MA 5CTJA 9LDTA 1EP3B 3JQRA 2BVNA 3VVCA 4BWGA 3ZZ1A 3WKEA 2ZT6A 1VJTA 3TOZA 3T5TA 1KS2A 1CZOA 5TIIA 4A8JA 3R5XA 1A8UA 4ZV9A 2YX8A 1GUDA 2HRCA 2ORVA 3VR6H 1RVDA 3H6HA 4HF7A 4N5IX 1ZI9A 1MH9A 1NNUA 1FNNA 4GZMA 4CEHB 4FOPA 3FAKA 4YCCA 1I2DA 2FMSA 2DCUA 2HPAA 3R3VA 5FO0A 3FOAA 4M3NA 4WVLA 3UAZA 2DVMA 4C4PA 1PQWA 2NX2A 3AJEA 1KBOA 2P2CA 3I73A 5B1HA 3KKAC 2AG1A 1SOMA 1K8XB 4FI3C 2BGIA 3EMVA 5KWVA 1NQUA 3GIWA 1Q0ZA 2IS6A 2FW1A 4P4GA 5CK4A 4RAQA 5EWFA 4TL6A 4HEA1 4C29A 5FCDA 1MB0A 4U6SA 3KZXA 4M1SA 1Q77A 1AN9A 3BRCA 2AF3C 1OLSA 4BEJA 4HDOB 3PTZA 1A2QA 2JAOA 1DFGA 2QUHA 3IDAA 5TZVA 7ICKA 1A5ZA 1E3DA 5EJFA 1JI7A 1H0HA 1SHJA 5K2MA 3Q41A 2IP4A 2C03A 3TWOA 1L8AA 4CQLB 3LBNA 2D74A 3IIJA 4ED1A 1VHJA 4LDNA 4TT8A 4PSVA 4YBRA 4NG5A 1MPTA 4O08A 2WF8A 3PX7A 2JFNA 4JT9A 4A5OA 3AEYA 2VJYA 1GPMA 1F8UA 3D5EA 2P27A 3I0ZA 4HQFA 3B6JA 4NZOA 3K6SA 5ALHA 2B92A 1GTSA 2GBCA 3FDFA 5JHGB 4QPNA 3NAGA 1N33B 5D7NA 1BIFA 2NADA 4ZIRB 3WYAA 4FYPA 5IYZA 1WM1A 2XA9A 3IOYA 2QZJA 5ALKA 3BZWA 2PX8A 4Y67A 1V26A 2DFPA 1ZJ4A 1N5WA 2OCEA 2EF1A 4MWTA 1L4FA 3BH7A 1BE8A 4TMYA 5EUCA 4FBTA 4ZCSA 4B40A 5JRJA 8ICOA 3MLEA 5EMKA 3ZJVA 3M7IA 2HBQA 3DMTA 3LUCA 4G0UA 4IW3B 3HT3A 1P7PA 3ANSA 2JIBA 2VJMA 3ACCA 4R1MA 3QVTA 4GYKA 3T9CA 4BVKA 5BYKA 4DMHA 4DPMA 4KHZA 3DT9A 1VKOA 1XQYA 1FP7A 1EAMA 5EQTA 2R1UA 1CK4A 1JBQA 5K0BA 2YWBA 4P33A 3M8KA 3RWMB 2QSJA 3TZLA 4ER3A 2WTXA 4FSHA 3BG5A 1PR6A 4US1R 3H5WA 1W1UA 4RPGA 5D6OA 2VJQA 3IPYA 5D2CA 4JXKA 4AULA 2YN2A 1VL1A 2EW8A 2Q2VA 3BIJA 4DCCA 2P4HX 1Q83A 4I8XA 2ID7A 3E8XA 4IINA 1QKJA 5IRCD 1Z2CA 3E7FA 4V0LA 2Z3ZA 5FPYA 1EFPB 4QYTA 1BE0A 3OP4A 2FFAA 4WLVA 2PMZC 1ML3A 2AR0A 1TNDA 1EK1A 1UXJA 1XQWA 1LKYA 2RKOA 3M33A 5IUKC 4URWR 4A0SA 5KYGA 2DKZA 1SB8A 4I4TA 3LLCA 1QVWA 4R1LA 1R8YA 2QLLA 3FB1A 3JD3A 1OWPA 1RPLA 2ZJOA 1EMDA 4LXUA 1MAWA 2O1SA 3CLRD 5C32A 2A4MA 4Z4QA 3TTVA 4IGIA 2N0SA 5LZ8A 4CIAA 2FZVA 2KD1A 2P2YA 2PWYA 2UZ0A 4YCAA 3T0IA 4ECAA 2FPPB 3OKFA 1ZD2P 1MGPA 5JC8A 2LI6A 2OLKA 2MRLA 4MCAA 3TZEA 1M2NA 1NK5A 1OIVA 3LIIA 1U0FA 3V00A 1Y7PA 3DL2A 2RGDA 1D2CA 2WWIA 2IE0A 4ILKA 4WCFB 3WFZA 1S01A 2C61A 4GI2A 5KFGA 2N3ZA 2YVUA 4BO4A 4DEYA 3WMXA 4DRXA 3NI2A 4MUNA 3TLEA 4D4MA 2XLCA 3S4YA 5EMLA 1V96A 4GOXA 3FSRA 2VYND 1L4MA 1LNQA 3AMVA 3WNCA 4P4LA 2JGKA 4JX9A 4CKWA 4J49A 5I9NA 2DT5A 4KDRA 1XSNA 2F1RA 3DE6X 2WMOB 1SKQA 1XNRB 3FVTA 2J3JA 3ROEA 1DQZA 2ZQZA 1FNCA 1YRQA 3VBEA 3RHFA 3I2IA 2PPVA 1HG0A 2BONA 1GV0A 4PS1A 5DNVA 5FADA 1DO8A 2Q4TA 3L4JA 2V6MA 4PH5A 1V1MB 1YJQA 1L5MA 3KEOA 4U00A 4RU1A 4FYVA 2CLSA 4I2HA 1OSNA 1XRQA 2AN4A 1L4BA 5KNDA 1XNJA 2DJIA 4QBKA 5JAIA 5CITA 1ZK2A 2C2OA 3H2IA 3JQ9C 1HYBA 2GM5A 5LDDC 1JHOA 1WPGA 3SHFA 5KFMA 1SKYE 5ALMA 5JE8A 1FC0A 2M9MA 5KT7A 1WO8A 2W5UA 4UTOA 5FBRB 2CVPA 2QN7A 3B9PA 3L4BA 4JROA 3W2IA 5BSHA 5HJ5A 1V5WA 5AUOB 4I2AA 1KFCB 1THZA 3FZGA 8ABPA 2IS4A 3CEPB 3NP9A 4Z6KA 1RBMA 1DADA 3T0GA 4XLLA 3A2NA 3KQWA 4ZYUA 4BQOA 1KI7A 2A1TS 2VVTA 2CLMB 1QKIA 2XE4A 1ST3A 4M83A 4DR7B 4PVDA 4B4KA 3ED5A 3AHEA 3L46A 2Y1XA 4RSHA 2H48A 4YREA 5U4XA 1YKFA 4P3YA 3EMBA 2RSLA 3EODA 1HLFA 1NJYA 4HWKA 3AY6A 4M37A 4ZEXA 1WMBA 3CQ9A 1ZQDA 2F1IA 1IAQA 4R9UC 3TSCA 4YQFA 5BSEA 1Y6ZA 4HMOA 4Q24A 3M6ZA 1KEJA 1B3BA 2P9YA 5HF5A 3NMUF 2VPWA 1XO0A 5AI6A 1SBNE 3TZKA 1Y6GA 2R8RA 1F17A 3RANA 3IDSA 2Z2XA 1RC8A 2Q6LA 1JYEA 1Z15A 3TNJA 5K20A 3M4JA 4BFSA 1FW6A 1CRXA 1J0DA 2VCHA 5AXAA 3B52X 4O0LA 2Z6QA 1Y1LA 3KCNA 3T1NA 4WJKB 2ZROA 1ZEJA 1J1IA 4UXIA 3AF6A 1E6WA 3EXEA 4TXJA 1ZJJA 1TD1A 3RVRA 5DLQC 4I2NA 3VPBA 3A05A 3EG9B 5FA6A 2QTVA 2X7HA 4DJAA 4PO9A 2ZI4A 3PC8C 5IMBA 5LA6B 3SHQA 3L3BA 9ICRA 4XYBA 1LF0A 1AY0A 4L8LA 4N5LA 3AYZB 3OOSA 2IV7A 3BDPA 1QYVA 2X4DA 5J0YA 4G56A 4QDKA 3T15A 2AJLI 3H2KA 2WJ4A 4XE5A 4UJ3A 4WY8A 4WE3A 3F5QA 2O07A 2HI0A 2IZ0A 3AZPA 4MI3A 1NOKA 4UM8B 4F2PA 1Y7TA 4I6EA 5HK8A 2XMZA 3TG2A 4YT2A 2FCAA 2ZUFA 3QRWA 4OTZA 4PAOA 3BMNB 4P7JA 1J5XA 3RUPA 3RRFA 4AJ9A 1LH0A 4AUMA 2JAPA 1T2FA 5F3WB 4GKKB 4EW3A 4X6UA 3K31A 4M2LA 1AHPA 3F97A 2VAPA 2G0NA 1BE6A 5HPYB 1RHRA 1NK9A 1CVIA 3AR3A 2HA2A 4BFCA 4OJMX 1J4AA 3C7DB 4NCAA 2UVWA 3PE6A 2GRUA 1LTHR 1V5EA 5IYZF 1F9AA 4AJ2A 1X1BA 3AL2A 4O2AB 3EVFA 4YRPA 1WV0A 1S1MA 3MMPA 1T9GR 4H0NA 4QXAA 3DKKA 5EJ2A 3BQNB 1EDBA 3MGGA 4I5EA 4DSAA 4L9AA 4KVAA 2ZSBA 1KI9A 1ISHA 3AR8A 3DXFA 2FRXA 5FBHA 4ZVKA 3T52A 1UEIA 2Q3LA 2WJPA 3EF3A 3EPPA 1OZGA 2FE4A 3KBOA 4FD3A 4OIFA 4QUBA 3SQDA 3HRHA 3PW7A 1WQ1R 2AWOA 3CUEF 3NRJA 1P0QA 4JB0A 2JW5A 2W2TA 4J07A 4J0GA 2QP9X 1YA4A 1JIXA 4XYLA 1QX3A 4FFDA 2FWIA 3QPDA 2AR9A 1A4RA 3NYWA 4HN9A 5KYYB 1KHTA 2VXBA 1KDHA 1HUOA 2XOKD 3O3MB 4PSDA 2YVLA 3ESYA 3DH0A 4PFSA 1HG1A 4UHJA 3SIRA 2VDNB 3R5JA 5LZ5A 1SBCA 3CH6A 5CB0A 1G20E 1T6ZA 1SGGA 1PI3A 1RQ2A 1VPEA 2XYGA 2BBWA 2GD1O 3IE2A 1NK6A 4Z6DA 3FRJA 4FMBB 1PGQA 4MDEA 2PNFA 3TRKA 2OOSA 3TQQA 4Z51A 4RPKA 2HBKA 1B6RA 4EA6A 1HDCA 1OBOA 3OQIA 3PKJA 4JK1A 4ER6A 3V7YA 3FETA 1L7PA 1K66A 4DSKA 4BJ3A 2IEZA 3HU1A 3D4BA 4K26A 4UBMA 1CSEE 1HM5A 4D6XA 2OM2A 5GOZA 5C5JA 3B1FA 1YDMA 3PDWA 3R76A 1SCDA 4RA9A 1BXGA 5CU7A 3OZEA 1KZYC 3T99A 4MV9A 1JDBC 3CKYA 4MV4A 4B7UA 4MEJA 2OV6A 4BQNA 1P7WA 3W78A 3R6LA 1KWKA 4U0JA 3EZNA 2IUYA 3TBKA 4B8YA 3HKZF 5C31A 1JYSA 3OT4A 3MLBA 2KJ8A 4JI2B 2J59A 4HYTA 1ULAA 2V9PA 4PTLA 2HW3A 5CLHA 2ZWOA 5I8PA 1J9EA 4RTLA 3RRMA 3HBFA 3LQKA 2Y1OA 3IBTA 3Q3GE 1CUJA 4GVXA 1X1DA 4KNVA 1TT7A 5DDIP 3EGXB 1EGQA 3PV8A 5GGXA 2EYUA 5I7EA 4IIJA 4Q82A 3QWAA 3WRWA 5FWXA 3GU3A 1ZA1A 4FWIB 1QGYA 1VIMA 1GZVA 2R8ZA 4AMUA 5L1MA 1KI6A 4HS9A 4L4XA 4P9NA 4LBWA 2NV2B 1WXXA 4Q1EA 4Z9BA 2GLUA 2H2FA 4PYJA 5ADWA 4ARBA 1QIHA 4QREA 3KWFA 2R8GA 1HH4A 1RYHA 4XIFA 4GI3A 3ZZ0A 4BGDA 2PKXA 1QFSA 3QI2A 1RAAA 2PU5A 5CW1A 3RHTA 1N1MA 3DBRA 3AI3A 1CKEA 3HJGA 1KMHB 2CMFA 3K0AB 3OIFA 4XM1A 3T4PA 1DX9A 2D2XA 1NXPA 2VP3A 4LI0A 2QTVB 3GMIA 3F7TA 3QEBZ 2HMVA 3KVVA 1FS6A 1J9ZA 3CBQA 3B1JA 1LXCA 4Y6SA 4H6VA 3CY6A 2JGLA 4WESB 3BRWA 1VECA 3EXIB 1UXOA 3OJXA 4AURA 1MRZA 1VE9A 5A62A 3LA8A 4A4DA 1SOWA 4NBNA 4W5NA 3MGVA 3KTAA 3OX1A 5C4GB 2DRIA 2EKDA 3VTZA 3I01M 1QGDA 1BG6A 1JHRA 1NLZA 3N8GA 1M74A 1RP7A 4MW6A 4NBWA 4AZSA 4N76A 8ICTA 1JMVA 1O94C 3GH1A 3WISA 1M2OA 4HV4A 3H16A 1D04A 2YIJA 2EZYA 4M1EA 5D1NA 2RH4A 1NNLA 2J9RA 5SV2A 3F5MA 3WE7A 3U3KA 5ALSA 2ZUWA 4D9CA 3ZZTA 4O5OA 4YO7A 5KFNA 4DXDA 2ZTLA 2QTRA 3VJRA 4KYIB 2CDAA 4G0WA 3FDIA 4ESEA 3ZHZA 5GONB 2GQ0A 4TKUA 2J6SA 3W8EA 2A4KA 1Z88A 1T5LA 2C1XA 4EZ6A 2F59A 2PGXA 3C1ZA 5KCMA 1HTBA 1T8TA 2VPPA 3LKVA 4RM3A 1R8SA 1WP4A 4QWMA 5CCXA 4Q45A 4OOEA 4EPTA 2NYUA 2D2EA 4UBNA 2D4AA 4QWCA 4O0IA 1AU9A 2PFSA 1GDDA 1HURA 4S1NA 5E1BA 4PO8A 1NHGA 1ECGA 3F2CA 1X7DA 2CXXA 3E8MA 3QMVA 1ORHA 4PRKA 2NVUB 1B6TA 5JH7B 4KN7A 2YVQA 3PHGA 3W1EA 4FE3A 1SFRA 3IAM1 4NAVA 2I3BA 4ZP1A 4EG4A 1VCHA 2O7RA 1Y1SA 5I7VA 2YBDA 4EEKA 1C0KA 2BTEA 2V4MA 5CLQA 3ZJUA 1O08A 3VO9A 3O8DA 5DK4A 3QUBA 3SEIA 2HK7A 3N07A 3ZZNA 1J2EA 3O1IC 2VOJA 4GQIA 3GN2A 1EM6A 4REQB 4S0ZA 4A9AA 2QJOA 4YRLA 2XGPA 1T1JA 4TQSA 2JBAA 4FX2A 1SVOA 1T3GA 4D6PA 3P1JA 2JCBA 1OMOA 2Q1UA 3D2BA 3EUEA 5TPZD 2XITA 3URKA 1WW2A 2C5SA 3ELWA 2QTWB 3IP6A 1OPRA 4DM4A 9ATCA 2ZJ8A 2BGWA 5EVCA 1L3SA 5CPBA 1BFUA 3RYIB 4BMPB 5HE9A 4XVRA 4CTMA 1QF7A 4MPPA 4ZWNA 1ADFA 2ERYA 4U5XA 2XEXA 1U11A 3D0RA 5K5EA 1U7WA 4JP8A 1NASA 1S9FA 1NJZA 1RQPA 2OZVA 2X9VA 1A50B 3GA0A 3GNLA 3K05A 3O2QB 4GLOA 4TN5A 1XTTA 1QQ6A 3DV9A 1WDWB 4GXNA 2OM6A 2H0RA 3ESQA 3GJTA 3RJ5A 3A6JA 1DC6A 1T9KA 4Y9DA 1WZEA 4IFBA 4QU5A 1XTZA 3PSHA 1JAHA 4IZIA 4QAQA 3NJ8A 3LX4A 5BW4A 1YDFA 2FI1A 4S1TA 4RSMA 4YR7A 1O0SA 1PV1A 2XKJE 3NGXA 5KG7A 3EDOA 3GEHA 3MPUA 4Q3BA 4RLQA 1IPHA 4LTMA 1YZVA 4AF7A 1QP4A 2A94A 3Q8XB 3R3UA 2VBCA 4JCCA 1KOGA 1EFDN 1EWRA 1BX3A 1TYBE 2ZK7A 4AP9A 4HAVA 1TCAA 4QL3A 3FNEA 4LGMA 4RLFA 2JNWA 3TO5A 4CODB 4A10A 2XQJA 2BH9A 4KIWA 4W99A 3Q3IA 3T35A 4GBGA 3V4ZA 4AO6A 1UK9A 3BL5A 1GZ6A 1BPEA 3HXQA 1M33A 4LKOA 4AYWA 3GCZA 3LO8A 4ZI2A 4ZO8A 2WD9A 4W82A 2O50A 2XECA 4CWAA 4HPWA 4C0XA 3MGAA 4BZQA 1ZNYA 4YI3A 3WHKA 8OHMA 5KI6A 3V2IA 2H2WA 4TN1A 1PJBA 2IYNA 1N8NA 3ZYZA 4ZXPA 3FFTA 1QQ5A 3KHKA 4M4SA 1KBZA 2GJAA 3AOGA 3JPYA 5D86A 2PJRA 1SRQA 1Q1GA 4MH0R 1QMPA 1XIVA 3CNOA 2ZIUA 3RVQA 1IZ0A 3ILYA 4P5PA 5HNKA 3KC2A 4JN6B 5DIZA 2OG1A 2AC2A 1I0LA 1BEEA 4RVGA 3BWXA 3UJBA 4B31A 4BO9A 1ZH0A 2IDMA 7ICFA 1X7XB 2ST1A 3CX6A 4B2YA 4ENVA 5J2TF 1K5GA 3I8XA 3UAOA 5IKMA 4DTCA 5JBIA 2H1FA 5DIFA 1JU4A 4O2BF 4IYJA 1NVTA 3EHEA 1R88A 3EPHA 1MHTA 1LV8A 1YHZA 3BJYA 5SYNA 2P1RA 4PG8A 4XYMA 3N4MB 2W3SA 3IUMA 3L1KA 2G0AA 1L7AA 1VKNA 1N5RA 4X6XA 3IYLW 4RGBA 2YH2A 4WV3A 3I9KA 1OKKD 4RTSA 3QYAA 1I36A 1KE2A 2AOUA 4B85A 7ICVA 3BTVA 5K8VA 3C5WP 3J81j 3T3DA 3C14C 5EWGA 5WRFA 3ASYA 4PZNA 3LKZA 2FN4A 4W5OA 4Z4FA 4C0QC 3L8DA 3I64A 4XVUA 5IM4A 4OJ6A 3CS3A 4JFAA 2L2QA 4AK9A 4IFIA 2VDMB 1RAGA 2GJKA 1U5BA 4MQFA 4DBZA 1KOJA 4D9MA 2R8OA 1SXJA 5FHQA 2G04A 4F8EA 2GN1A 2F9FA 5GP1A 1DI0A 1NK4A 5EWJB 3BQ9A 1IHYA 4KN4A 3I4CA 4H7PA 5IJ0A 3UQ0A 5KFSA 1Q2UA 1UMBA 2Q9CA 3E9RA 1CFZA 1R10A 4S1OA 1NBEA 2CJFA 4BP8A 3U16A 2PMKA 4JUZA 4KLNA 5CGQB 3NW9A 4E13A 3FPEA 3GIIA 4W1PA 4R66A 3IKLA 4UQOA 5EQFA 4ZDKA 3AUKA 3GJSA 1W0KD 2YWDA 4MQ6A 3L8EA 4O2LA 3EPGA 5SY4A 1L5GB 1HDEA 1TQ6A 4JJIA 3RUHA 2AHOB 2LPEA 1CNMA 1ZO8A 3FTPA 1MRNA 2BHLA 3HFRA 4K03A 1YS6A 5ADUS 1AQ6A 5HGXA 4GOKA 1Y9EA 4IOJA 1W1IA 2IY8A 2HBYA 4PS0A 4WLFA 4P4PA 3QENA 4QELA 1B15A 3NGDA 2VRBA 3DZGA 1ONOA 3VR2A 2C8JA 1NWCA 2BCEA 5TEVA 5FDFA 2P5UA 3QZ8A 4YUYA 3GJ4A 5KC8A 1OROA 2N42A 1M6VA 2NZJA 3C1TA 4KRXA 4MRRA 5JMPA 4BIIA 2WOOA 1CJVC 5JYCA 4XJVA 2JAWA 5EKSA 1SVWA 4WBNB 1PEDA 5J0SA 3L5OA 2WJZB 4OFZA 1SKAA 4PHAA 3BS5A 3B38A 4MR8B 2B8EA 2FOIA 1PJ8A 4H18A 1YS1X 4QHTA 2Y9MB 3U4QB 2HQOA 2HC9A 2J6BA 4N0QA 2Y76A 5ADVA 3CNEA 2GD6A 3D8UA 2CVZA 4HQKA 4L72A 3AG5A 1CDZA 3DBVO 2X0NA 1GOTA 3SDSA 3VYVA 2X8AA 1NJ5A 1N25A 2WG2A 3EDQA 4J3NA 1KYZA 2A9FA 2Y0SF 1L5RA 5EP4A 2AN3A 1XZAA 3IDOA 3IL2A 2RIRA 3ZEIA 2XR1A 4JI4B 1HK7A 4FKMA 3OWHA 2IHKA 3GWZA 3JTMA 4BVHA 3ZE6A 2O3JA 3VTKA 1S9HA 3U60B 2WHQA 3NRZA 2ATVA 3WYDA 3F2DA 2Z08A 4GLFA 4PHGA 3CXRA 1PX0A 1V5FA 5ELLA 1RCUA 5CXUA 5JAZA 3ER8A 3G2IA 3IE1A 3Q72A 4TVSA 4J16C 1ZY2A 2FXVA 1H94A 1PN3A 3ITEA 3NTUA 1AD2A 3ZVNA 4IRKA 1V8BA 1USKA 4NESA 4C0KA 2W90A 3ZHXA 1NW9B 2HV8A 4J29A 1LVUA 1F0KA 3HBNA 1WMEA 4UCFA 3G1WA 1TQ8A 2ZAGA 3JQAD 5E8JA 4I2CA 4RTJA 1FFGA 3AHJA 2X0JA 5E6SB 3MGHA 3LKBA 4MFCA 3WVNA 3B9QA 1NG1A 5KFFA 1WY7A 2FUG6 4MR8A 5HGJA 4DQUA 1UPFA 4OKSA 2E55A 4KR0A 1DV1A 2IIPA 3R7BA 5LIPA 4U7HA 1RS0A 4V1CI 2Z4RA 2VIIA 4A92A 4AI6A 1BCRA 1TEZA 4WH0A 4FNMA 5HKBA 3U7RA 1ISFA 4AM8A 1QNLA 3DMHA 3NEYA 2O19A 1KOLA 4GMXA 4FFSA 4F3TA 2K2QB 4CMJA 1EUDA 5ILGA 2R751 2P7HA 2GYVA 4WK2B 1JR3D 2QTBA 1Q0TA 3Q88A 5IKEA 2KKVA 4JIGA 1PK1A 4TUSA 3HKBA 3WJ2A 3JR3A 4D0LB 3W8DA 2FSVA 1YVEI 5F52A 4F8RA 2Q3HA 4KPFC 7REQB 5KNCA 1JDUA 3EVNA 3JARA 2ZT5A 4L2IA 2LYHA 3GEEA 1G7TA 4DLXA 2PUHA 4M1MA 1LBHA 4B2IA 4RKYA 2QVXX 1EUYA 1WU8A 3R1IA 5DCWA 4OX9B 2Y9PB 3LT4A 2K89A 5DQHA 4UQPA 3BB4A 3GT0A 2ISPA 1DX4A 1H2WA 4IXMA 4EITA 2XC9A 5HZKA 4MRSA 3EFEA 3VYTB 4N9WA 1XMQB 4NDNE 1YVDA 2QRNA 3OCWA 4XFKA 4PAGA 3F5FA 3BGWA 1XCMA 3V7NA 3L7AA 1F14A 4HOYA 1B14A 2VSQA 4JHXA 2B4YA 2PR2A 4PYNA 4LY6A 3NVDA 3ZY5A 4MCHA 1VBMA 1G7RA 2V65A 5D3ZA 1QIEA 2O2XA 2X15A 2W2VA 3GQBA 3KZOA 4QBIA 2E1FA 5G4LA 2HDHA 3WRXA 5FUXA 1I8TA 2QN9A 4NZPA 5AM0A 3MTAA 1E98A 4H2DA 1EA7A 4FSDA 4QPCA 2JZBB 9ICKA 3I1IA 3NASA 2YN0A 3AEUA 3PYXA 4QVIA 1Z7EA 2GK3A 1PZFA 5FWNA 3P20A 2BY4A 1Q16A 2ZXUA 4TURA 1KZ6A 3KYCB 4KQWA 3SYMA 3PF8A 4OHZA 2P3QA 4XWKA 1L7EA 1ZOPA 3BZCA 4F1KA 3B1YA 5KHLB 3F5AA 5JWRA 3HI6A 2X2FA 1QH0A 4CQLA 3ZE8A 3B48A 4MGZR 4AJ4A 3SAFA 2UAGA 1Y4AE 3C43A 5AHXA 3I92A 1U0JA 2F3UA 3TLZA 2SECE 3RG2A 3RODA 2Q3EA 5KT6A 2X2PA 4YJGA 4C2AA 1E79A 2YMLA 4MIKA 4Q7MB 3G85A 5JDIA 1UBUS 1DK2A 3JPOA 3HN6A 3L1VA 3QPBA 3C1AA 1JEQB 4ZGBA 1DBSA 1X9MA 1Q1QA 1D6NA 2HWYA 2YIVX 1J8MF 1ZBQA 2QORA 5GMOA 4GM0A 4DW8A 1X86B 5AJYA 2M9NA 5FOQA 5EHXA 1JAIA 5ALJA 1I7NA 4F2GA 3H6GA 2PH7A 3I58A 3LUHA 3T54A 2D8MA 3CGGA 4GQBA 1H4TA 1WEHA 3TSZA 1KTQA 4DMKA 4DLVA 5JSZB 2PL3A 1W88B 1RPNA 2DHDA 2H0QA 1HT0A 4DREA 3PC2A 4RT3A 2D54A 4E51A 4YXWD 2O20A 2W4QA 1QSYA 3BTSA 2Z30A 4J2TA 3PMNA 4TWAA 2V03A 1EG2A 5KYXA 1E7MA 4IJUA 1QHIA 1Z07A 2QSUA 3R41A 3IVMA 1W76A 4G09A 4F4DA 5K0EA 3EEOA 1NVFA 1D6MA 5I9MA 4YXJA 3BORA 4FJ1A 4OYYA 5LWHA 2V1XA 5JS8A 2QD2A 2YFHA 3HYRA 5FLEX 2EIXA 1EAYA 1ESZA 1RXSA 3HA2A 4RS3A 3B53X 3AQFA 4BDPA 1FDRA 2OHVA 2FPPA 4Q19A 1MP0A 4A27A 2ZJZA 3OM1A 3PNLA 4KU4A 3IAS1 1XTKA 2XI4A 3ODGA 1R6XA 1OAOC 1FFAA 2MWMA 1PO7A 1NR7A 2PVPA 4QYXA 2J9YB 3I6MA 2R87A 5FBZA 2AQKA 2PMZF 3SEZA 1F6DA 4BTLA 1GL9B 4ENRA 1U2ZA 2L0XA 2ZKLA 4BWFB 2X9QA 4KLZA 4RUAA 4GI5A 1A27A 4R8MA 1GPAA 5HR6A 4PX5A 1FJXA 1BTOA 4B8WA 4C0HA 3ILHA 4KXLA 2C4KA 2I3DA 4PWYA 4I2IA 1KA9H 4XWWA 4YQYA 3FPCA 4K9NA 1TQ2A 5HBRA 2HJGA 1QHXA 2ZVPX 4LOLA 2HK6A 1PR3A 1LWOA 1ZCJA 4KLGA 3H5NA 1GO2A 1DG1G 4DLEA 1GNPA 4X94A 4ADSG 5AM3A 3C87A 3HUTA 1ZOSA 4DILA 2VUSA 1OXUA 2A9OA 1RXYA 3FN4A 4FP9A 5CLLA 4DTIA 2Y1DA 1ST2A 3OIDA 4J76A 3J81A 4E22A 3TFOA 1EINA 1W6UA 3ICCA 2B3DA 2BCUA 4KC0A 4P36A 3UAGA 1RYBA 2PS3A 3IQZA 1PK8A 1R16A 3B3FA 3MM4A 4TL9A 1YNOA 1DP4A 4NENB 1CY2A 1VLMA 3ZDRA 5MF6A 3BXPA 4XGNA 5KYTA 3GEBA 3BC1A 1E1QD 1Q0SA 1EJ0A 1F0PA 1NONA 4Y2SA 1QF9A 4XJSA 4EL5A 3THVA 4I19A 3U09A 4OHPA 1GDTA 3RH5A 1Z45A 2PT6A 2PSFA 4MUMA 2QV0A 3FCCA 2OCXA 3DGFC 3L7KA 3FJOA 1QYWA 3AHFA 2VK4A 3ORRA 4TMFA 5G5GA 1RC0A 1T8RA 3KAKA 5JAUA 2H65A 5KT3A 5H7XA 4G0XA 4UOEA 8ATCA 4EHJA 3REFA 1KVUA 3ITDA 4QFDA 5EJ8A 4MVJE 2KJ5A 2C95A 3WQHA 4HUJA 5JNSA 5KUTA 1KGDA 3D2NA 5G2OA 3U4QA 1SBIA 4DNQA 2ZM5A 2MMCA 4TXNA 3TI0A 3AEUB 4Y0NA 6PFKA 5IK2D 3HXLA 3FAZA 3QKIA 2IIBA 3DQQA 1N7GA 3GG9A 4FS8A 5FAXA 3KDSE 1CQJA 4YRZA 4OLBA 3K20A 3BD9A 2GS9A 3L6EA 3QWFA 4MI1A 2OFXA 4FIDA 4DLBA 5LQRA 2ZBEA 5M29A 3Q1KA 5BWCA 5I9LA 2XB8A 5BW6B 1TYCA 3KTAB 3WDLA 1UC9A 3ZE7A 1T9ZA 2QKQA 5B4UA 2NZ8A 2W6QA 3PJFA 2IT1A 3GBVA 3JAKB 3MGCA 4M98A 4X8LA 3R4CA 5DTEA 1CUIA 4WWHA 3SZOA 5JNRA 1FP4A 4BMNA 4M76B 1UUFA 1E4OA 5I7FA 1U9LA 2JAXA 3IBYA 1RQXA 2ZIVB 1IWOA 1FFCA 2C2XA 2DQZA 4Q8FA 1LZLA 3B78A 3CX3A 3FPHA 3R0ZA 2PL5A 3R4VA 3OLVA 4X7RA 4DJFC 3FTFA 1ZD5A 2C96A 1NLYA 2EWVA 3WGTA 3ZGYA 1J8QA 2JK0A 3GZNA 3OY7A 4LDRA 6NULA 3G2QA 3K4QA 2UUOA 3H9BA 3TD2A 2VRCD 3ASZA 1XMIA 2ZWMA 4ZU3A 5AVOA 1IVNA 2Q45A 4UBBA 3MJRA 4IZOA 4M9LA 2J9ZB 2XWQA 4WEOA 4TL7A 4DLSA 5A3JA 3ABSB 4DLGA 3C15C 3WZ2A 3TMAA 3BGIA 1WUHS 4AZTA 3JPSA 4I36A 2HGSA 4Z9FA 4CRXA 5T6MA 5KWIA 2A84A 2Q6TA 3G0HA 1RRGA 3X1WA 1YR2A 1XRJA 2BJHA 2LDBA 4KJZA 1ZD9A 4ZRMA 2W70A 1VFPA 5DLPA 4ARZA 5IDWA 2EEZA 2A9RA 4NYJR 1CE8B 1MCZA 4Q9HA 1IOLA 1TLTA 3W77A 4B3DA 4EKNB 1HWYA 1ZN8A 1ZSYA 4TS4A 5FXMA 3IVXA 4C89A 4LWZA 4U2BA 1OLOA 4QC2A 1Y5MA 3HVJA 4RZXA 5CRIA 4C6SA 1EVLA 3BL8A 3CH7A 3RIXA 5J2GA 4A91A 4OFWA 1YB2A 4CKWB 2BPCA 1T36B 2EWWA 3HUFA 4K3UA 4X8OA 4DM3A 1FTYA 1TQDA 1VJ0A 2WE8A 2W3RA 2GZRA 1JJAA 2QG4A 3GJZA 4I4LA 2PIDA 4UD6A 3K94A 1IN1A 1U7ZA 3HJFA 1UBRS 1ZMTA 4ITVA 3S1LA 3WL4A 4NHEA 4KIUA 4BAGA 1QP0A 1B00A 3GPBA 1V47A 1EQAA 2CFOA 4R0NA 1QHHB 4NXNB 2BHNA 3SSAA 5JARA 1FDUA 1W35A 1W0JA 1FTWA 1FNDA 5JCJD 1C81A 1RADA 3QSGA 3EXAA 2Z6UA 2OCLA 3SI7A 2IEAA 3DTVB 4KFSA 1ZVVA 3QQPA 1G5PA 1KVQA 3G7SA 1J1ZA 2EP8A 4KXXA 8ICWA 3PE4A 4MX8A 3IERA 3O0FA 2BI7A 3OE1A 4G1UC 1VIDA 2WWWA 5H82A 2E5LB 3NTXA 5E7IA 4YP7A 4Z7OB 3DJFA 1F6WA 4EJMA 3WIDA 3S2ZA 1X77A 4BO8A 5FFMA 1CUHA 1JAYA 1SA0A 4Z7QB 1EQ2A 4EY3A 1KFTA 2P6MA 2YR0A 1U9IC 4A8TA 4PHDA 1DRUA 1ZITA 5DG9A 1SXJE 1XZJA 2GBGA 2VFAA 3I30X 1FU8A 1X3LA 2FQYA 2J3IA 1HTWA 2OO5C 1QAOA 2JJ1D 4IEIA 4II3A 2IZZA 4MO2A 1ZR4A 1UFOA 5BP7A 4DDTA 1XCBA 3MC1A 3S2FA 1WABA 4KO8A 2D0OB 1MJFA 2OP1A 1I0IA 3OH8A 2EIHA 4NS4A 5LYJB 5MGBA 3OKAA 1DNPA 3LO5A 2EHJA 1R7RA 2P65A 3LQQA 2ZBGA 1L4UA 1REQB 2P4SA 3BHJA 3I8SA 3T5MA 2Z2JA 2CFRA 4UULA 2NW6A 4WKBA 5J43A 3G0CA 3VJKA 2DE0X 4HEA6 1Q7RA 1WXFA 3P27A 5CB6A 3ENZA 1T1RA 1U8XX 3OM0A 3JZAA 7YASA 1XWIA 1AUOA 1U0GA 3E9MA 5AK3A 3IPRA 1MC5A 3NIFB 3PB3A 3ESDA 1I2MA 1X7WA 2XMDA 1PNTA 3HTXA 1C2TA 4R98A 4YR0A 3DLIA 3PI6A 3AF5A 2R6JA 1ACMA 2D2IA 3EW7A 1B76A 4F5NA 1BPDA 3GA5A 2H3EA 3KJEA 5F33A 4P22A 4TTVA 1BZYA 1YZHA 1OXVA 2P91A 3T5JA 2H5LA 4L78A 3DPSA 1Z7YA 3F73A 4FHEA 1T0PA 3LXXA 4GC7A 1WMFA 3O1LA 2A86A 1ZQUA 1OXKB 1QZXA 2XSZD 3AOEC 1G8KA 3CUUA 2HY7A 4OMDA 4IUBS 4KN6A 5CHEA 1PV4A 2DWOA 1EXDA 1F2DA 1NU6A 3KOYA 2I9KA 2AN1A 2GJ8A 4E5PA 1MV8A 3WIEA 1SXEA 3BQ0A 1HC7A 3WYEA 1FFUA 4ASUD 5A9SB 2FKAA 4L0QA 2D3WA 3U9SA 2YYSA 2FNAA 2YV2A 3FPFA 2GTIA 2BEKA 2W58A 1MO4A 4WKPA 1IZZA 3PXEA 1EJBA 4MWZA 3W7BA 2DEUA 3MIIA 5DX8A 1EFRA 1SUAA 3KIPA 4G0QA 1X1TA 4DUYB 1E4YA 4DJEC 1RW4A 3D1JA 2CJPA 4BX2A 5BY2A 4YCXA 1LFDB 2R8KA 1ZJ5A 2FMFA 3A4YA 3LBIA 5HFNA 4JD5A 2QY6A 3RHZA 4I6JA 3V4PB 2OCBA 5LIRA 4RQ8A 4ESOA 2DQSA 1PK1B 1WB4A 2G5GX 2X0KA 4G1MB 4BE7B 4M9QA 5KG0A 2J6UA 2W9BA 5LJIA 3KPVA 2CLKB 5G53C 4MWBA 4BNNA 3RJJA 1PWEA 4MPTA 2HJWA 1E62A 1KZGB 3V4SA 4BVFA 2GBPA 3E9ZA 1KK3A 1GG5A 4B7XA 5H8WA 3UK0A 3PENA 1EPUA 3ITKA 1VP3A 2RDIA 4M53A 1ETHA 4ZVTA 4GMKA 2XXJA 3P2EA 4QARA 4C05A 5KG2A 2HU5A 2X2EA 4RLHA 5KFOA 2YZKA 5C81A 4CEIA 5AIBA 4XI9A 3WTBA 1BWPA 1UBEA 5DEOA 4FE4A 2Y99A 4ZEMA 4DL6A 1R0CA 3ASVA 3JYOA 4R8RA 3NBZC 3MGBA 2BFCA 1P1FA 3HDGA 5TXGA 1H0RA 3UV7A 3JTEA 1KC3A 1TM1E 3ME5A 4CL3A 5CM8B 2KHQA 5JQGF 1VGRA 3JQ9A 2ZWPA 5J5AA 4D5EA 1FLAA 1NUSA 3G7UA 4F1WA 1E63A 4UD2A 1CQIA 3TR6A 5AM1A 2DKXA 1O9GA 4UREA 1ZUNA 5G41A 3PDIB 2A19A 3K0HA 2QRVA 2Q7DA 4CG0A 3HWSA 2IY7A 4QO7A 1VG8A 5DF1A 5I8ZA 3G5TA 4OUDB 4NYIR 4E32A 4JCOA 4IGAA 5L3QA 4TSFA 1PTKA 1Z2AA 2B4RO 1CQIB 4J43A 4MVYA 2JFXA 1M8KA 3ISBA 8ICZA 1ZI6A 3LWDA 3SQOA 1XJ0A 4OGLA 3STWA 4NBUA 1P9NA 1P4SA 4G5OA 5D5PA 4CM8B 1Z4IA 3O3OB 5LP6C 1VRCA 2VANA 3O9MA 5TNXA 4Z5XA 1RWOA 3QKRB 3GB9A 1HUZA 2F9LA 1Z6ZA 5A7HA 4N4AA 1QDUA 4K9MA 1VI6A 4IF6A 5FWAA 1OTHA 1T1EA 1K7EB 2OV1A 4HJXA 1MJ5A 1GN9A 1U65A 4HATA 1HIWA 1JWAB 1X1EA 4MOWA 2AWNA 2ZBRA 3E7PA 3H0KA 1PZEA 4KB5A 4NPCA 4NOMA 3WP1B 4PPYA 1ENYA 1PGOA 3M5DA 5IAGA 4OHRA 5AW7A 1AOXA 3KQUA 1YZ3A 1UQVA 2WG1A 5KL8B 3RWBA 3JPTA 5T8KA 3RS4A 3SOZA 5JJLA 3X43A 2EU8A 1EIWA 2KB0A 3EXFA 5CA0A 3O8NA 3PSPA 4LTNA 1IE3A 1QGAA 1TT5B 1FUYB 5D3MB 2QXYA 3B85A 2AJDA 4MQUA 3VKGA 3TE7A 4YCSA 2OCYC 5KVQA 2WF6A 4GFDA 1TDJA 1K9VF 3JQ8A 4D25A 2KICA 1E4EB 1HT1E 4UB5A 1GR0A 2X2OA 2XDQA 3ESCA 1QXSA 3TOVA 2CXHA 3RR8A 2XTAA 4QYIB 2WR8A 4BGIA 4HX2A 5GZ1A 4WECA 1TW2A 2F90A 3IO3A 3HYTA 2XMRA 1Z16A 3R7LA 3SX4A 3AM5A 1PR2A 3B36A 1NA5A 4H4DA 4TV9B 1GQ2A 3FTCA 4MR9A 1YI0A 1JAXA 1P60A 4D8UA 1M7GA 1VA5A 2B94A 2JLRA 2V7QD 1NDUA 4ZEVA 3EPJA 1XYYA 2AXQA 4IV8A 4AJJA 2WYVA 2ZJ0A 1D6JA 2Q3CA 3O2JA 3FA2A 5TT0A 2XUDA 5JTUA 2ZIVA 3NATA 4Y2TA 4R2HA 1LC3A 1NX9A 4B7CA 5FA5A 1H2AS 3PW2A 4MA4A 3QG1A 3H0MB 1NUPA 3J7TA 4CDRA 4QPPA 5JQGB 5KSYA 3ZHUA 2V6JA 3SR6A 1YFZA 4PCUA 3QBTA 3CLTD 1DKLA 3E9YA 3LP6A 4Q7EA 4BP3A 3OURA 2B78A 2W7PA 1OLUB 2FGKA 5BUQA 3GEGA 3NYQA 2X0IA 1H1LB 1VJRA 1IHXA 4UFPA 4DMLA 1NG9A 3RUDA 5BSMA 4DKJA 5AICA 3BQ1A 1QH1B 4FUQA 1UADA 1VTKA 5ALWA 3T41A 4BGUA 3LPNA 1ABEA 4Q3DA 4BFYA 4HYQA 3BRSA 3QTBA 4I50B 3AB3A 3SQNA 1SHKA 1WMSA 2FSUA 4BWVA 4TMKA 4II7A 1Y1PA 1KYXA 1PYOA 1YK1A 3N2YA 1J2MA 5DG7A 1P2SA 3OIGA 4PGGA 5EJMA 8ICNA 2CD7A 2HA4A 2JGJA 3D7KA 3K16A 4GUDA 2AVDA 3W2GA 3GZTB 2I4LA 1E6UA 2NO7A 3FNFA 1FF9A 3NGMA 3FTDA 3ANNA 5LP1A 3V8BA 2H2GA 5IM4F 2VP4A 1Z4QA 4EUHA 4GO1A 3H9GA 9ABPA 3EC7A 1PBNA 3Q3EA 4KVFA 2QGNA 4H6XA 4TXMA 1YT3A 4GGMX 2FQQA 3P9XA 2NU8A 5FD8A 1FK8A 4P53A 4B7AA 1CF2O 3IJPA 4E12A 3OU2A 1FSSA 1U1EA 4M60A 2QW8A 3S2UA 4G85A 5BV8A 3NHUA 1K6IA 3W5VA 3L3FX 2MU2A 5JROA 1GGJA 4BJHB 4ZO4A 5CAEA 3HLTA 2E89A 3IMFA 5DBCA 4JBYA 4OAQA 3PX4A 3QHAA 4WCDA 2Y1CA 4IDAA 3OMLA 4WX2B 3WK4A 3BSFA 3G2KA 4N01A 4X9XA 3EVAA 4PAWA 2OGWA 3L7OA 1INLA 2Q3FA 5KFCA 3SAJA 3RH0A 5DLGA 4AF8A 1EWTA 3CR8A 3OI7A 4JP1A 2C5GA 1U2GA 4LX8A 2WICA 5A4MS 3EPLA 4WCFC 5GV8A 1H2HA 2B6GA 1RJ9B 4LTDA 2QS9A 5GTHU 3KETA 4OXRA 1YB4A 3OIVA 2B4TO 1P0CA 1NM5C 1TTPB 2QGFA 4W1RA 3H4BA 3UV3A 1XX6A 2OG2A 5GJWC 4IMPA 4P6VF 4C5CA 5AKKA 1SJ9A 3P2JA 2EAOA 4JS0A 3AY0A 1PL6A 3COPA 1HOTA 1KZ9A 1S8NA 2HA7A 2ZSKA 4O2RA 3RFVA 1UP7A 3ZCSA 4BO6A 1JWLA 1U2SA 3RUEA 2KIVA 1K5PA 3AG6A 3L0YA 5E6RA 3PZPA 1HFJA 1GAXA 3LGAA 1Z4NA 1FMCA 3VKVA 1CRZA 1R66A 1FL9A 2W71A 1QWSA 5DRYA 4DMMA 4DVJA 1DJPA 2W37A 4YC7A 5DHFA 3VSCA 4RQAA 2PSEA 4RE6A 2AX3A 3OZRA 3QLJA 1V3TA 3ZDDA 2QUZA 3B3GA 1PSDA 1L5FA 1A7KA 1JKIA 1GPLA 2FW8A 1LKYB 1U49A 1ZQBA 1BMFD 3EQ7A 3IDZA 3O4HA 3T3MB 5IF3A 5LQJA 5CG1A 2IYZA 1GUAA 1NHWA 1Z0FA 4U6QA 3FSEA 3IVRA 3KUUA 3ZXXA 1N3YA 4ECWA 4XARA 3NHKA 3V4RA 2ZBQA 1DC3A 1SIUA 4ICIA 2XUPA 3H5LA 3NOQA 1TUIA 1YIDA 2BFNA 4V0ME 2CJXA 3KKKA 4GP6A 4L3VA 5KIAA 5I9IA 4D8TA 2NVUA 5KYNA 2NO0A 2JLVA 3EXEB 1VG1A 4LHSA 2R6GA 1SC9A 3ANMA 4CCAA 3ZE1B 3I6ZA 1H2EA 2I03A 3O8CA 1JKJA 3CZMA 3GCDA 4BN0A 1C9EA 4WJZA 2E9SA 2YFYA 2G7MC 3TANA 1HL7A 4KXWA 3MELA 4WBXC 4WFIA 3TQFA 2V6FA 3WYFA 5G0WA 2WFZA 3F47A 3K70B 2C0PA 3KR2A 9ICAA 1MOQA 4GPEA 3HZZA 1JXLA 2CMDA 2IX9A 1W5BA 4EHIA 3C98A 2HTEA 3IR7A 1JHYA 4UMDA 3SD7A 2UVRA 1GPH1 4TS3A 2FSSA 5DNWA 2W0SA 1OX5A 3KNZA 1GU1A 2C4WA 4ZOHC 4RMNA 1R18A 1VPTA 2P9GA 3OTHA 3QVKA 5G1OA 4ECYA 1NKTA 4J1NA 1Y63A 3SMQA 4D3XA 1TKAA 4CIVA 1QB7A 2OGZA 4G5QA 2LCIA 1XZHA 3RB8A 1BDHA 3BFPA 1AH2A 2BHTA 3H5OA 2XE6A 3E1SA 4OKNA 4C88A 4EB0A 1B0XA 1PYGA 1T8YA 2Q1WA 2Q5FA 1AKQA 3K6JA 2J9FB 5JO9A 1Z0ZA 5CX1B 4HH3C 3SSNA 4ECXA 2QJTA 3FPLA 3FW1A 3OA2A 5AHKA 3U6KA 1FNBA 2YV5A 4DCUA 2QPAA 5L7TA 1KYWA 1KMQA 2AEJA 4OA5A 5FOUA 1ZISA 3C8ZA 3NKVA 4IO0A 2SBTA 3D7MA 2GTHA 3WBKA 5K05A 3HEAA 3O74A 1U6JA 1VM6A 1KMCA 3B2QA 3TXXA 4INAA 5BNTA 1V0JA 4D4IA 3H5RA 1V1MA 1IXYA 1RM4A 1ZM4A 1YI1A 3D7NA 3DD5A 2A0YA 2O52A 3LFUA 2VPYA 3RRHA 1CCWA 4HWSA 4KXQA 2ZIFA 2WWVD 2ZCJA 4L4UA 4RX1A 1UFQA 3VHQA 4RY2A 4KNYA 4PYKA 1G1AA 5EIBD 2VF5X 5L1IA 1A95A 3WIOA 3FJYA 1NMZA 2BF7A 2Q4RA 3K0CC 2CNBA 4YIKA 4QGGA 3F1KA 2POCA 2R7KA 5IJWA 3ENNA 4JXZA 3EN0A 4RFSB 2DT8A 1ZQHA 4MKZA 2YY7A 4CEJB 1B8VA 1UF9A 1UPXA 2J09A 1X9XA 4XFDA 1V25A 2ZP1A 3L0DA 1WAMA 2VQDA 4RH3A 5EY5B 1UA0A 5EYPB 3R8FA 2ZIXA 3VO2A 5CDSA 3HA7A 4IKOA 4NNJA 2OHFA 3OJWA 1UBHS 3C2KA 1JNXX 3IELA 1XU4A 2H5EA 4L57A 3RIHA 3ROFA 4LJLA 1CUCA 4EQ6A 2NXNA 3NYRA 8ICEA 1NVAA 1V6AA 2HBMA 1P7YA 2QM7A 2ECOA 3AEXA 3F98A 1YCGA 2ORWA 2O6HA 1YRWA 2XB9A 5DM1A 3INGA 2JD2A 3TQRA 1NLFA 1DIRA 1IC6A 2AQHA 5HP4A 3EGWA 2QHXA 4C20A 4HVAA 1G63A 1C7ZA 2VBGA 3HLYA 3Q9SA 4AZ3B 4F3OA 2CHVA 2PBLA 1ZXLA 2ZRLA 1U7UA 2JJMA 3C3JA 1J2JA 3D6VA 3OKPA 3L8CA 3RO7A 1YFJA 2HRQA 3FPSA 2EJBA 4BVLA 5CFZA 1L4GA 5KG5A 4V3BA 1P2TA 1T4CB 4XW2A 2CFIA 1FFBA 1X15A 4PX2A 4Z49A 1T2UA 1USGA 2WU8A 4CMIB 4LIPD 1L9XA 1H1TA 1US8B 1XNQB 3N53A 1FRNA 2R00C 5ICFA 4G24A 1VMDA 2ZZMA 1DAGA 1PJ2A 3BIFA 2XT6A 5C34B 1H3FA 2CYAA 4YB8A 4D3YA 1BX0A 1TAUA 1HSZA 2AFHA 3KEFA 5BOSB 2REXB 5DWDA 4NK4A 1QCDA 2PUCA 1Q44A 4ZI7A 5J23A 3DAGA 2CNWA 2XY7A 1O2DA 2WYOA 3PGMA 5BN1A 4LF4B 5A4FS 3KFXA 1CZKA 2EW2A 3MJEA 2V0GA 4FGZA 9ICCA 2OYSA 3GDWA 3LNTA 1HA3A 4TUYB 2C77A 2WFMA 3C29A 5K3BA 4MKGA 3V3KA 4C2BA 3WGIA 3R0QA 4BNWA 5TF4A 1WUYA 5CVVA 4ZD6A 5FOXA 1L7OA 2D5IA 3PPIA 2OC4A 4M04A 4R0MA 1VJDA 2VYFA 1IHPA 3FVRA 1SN7A 1FU4A 2A1UB 3DWGA 3I6YA 1UJ6A 4HFNA 2R6CA 4FYJA 3MUNA 4PHPA 1VKHA 2C2MA 2H08A 1LS6A 1ZQWA 3OLWA 1JJ7A 2OPHA 4F4KA 1P7VA 4MQEA 4LRYA 1B22A 4EHBA 3PEYA 4FGKA 1L4HA 2HCFA 4GPAA 2Q4DA 2VNSA 3JQQA 2BPFA 1A2KC 3CA8A 4OHOA 4Z1OA 1AKVA 1RYEA 1V16B 2WOJA 5KYUB 1DMRA 1WZCA 1VG9B 1X80B 4OB7A 2P9CA 3T3IA 2J3DA 4PGYA 2CLLB 2GCNA 1F8YA 3OCZA 3FLEA 4CKEA 3W6UA 2YXPX 1VGVA 5F5LA 4G5FA 2ZE8A 1JEAA 1V2GA 3DFIA 1G66A 4LJYA 1YQEA 3PC6A 4D56A 4EVQA 4UFOA 2XE7A 4FYIA 4LJ5A 1VKRA 3PEWA 2WMDA 2R7AA 1GFIA 4QDZA 3SFVA 2BFMA 3MXTA 5KWJA 4C2UA 2O8EA 2ZRIA 4NLZA 1E7RA 2NRXA 2E4VA 5SZKB 3ND8A 5J40A 4Q8EA 3IHLA 4NFSA 1SM4A 3B1KA 5J2HA 3OO1A 3GVCA 2F43A 4O4HB 4ACAA 2HBRA 1S10A 1DRGA 2WM8A 3VXKA 2VDWB 1ZIXA 421PA 2OILA 1O4WA 2GVNA 3QQ5A 3N0XA 3MABA 3ZUGA 1YMVA 2JEFA 3Q8PB 2ZBVA 2H9AA 1FS4A 2XQFA 3H5VA 3PVCA 2G4VA 2QRGA 3CNBA 4I08A 1V71A 2PRZA 1NVEA 1JDJA 4Y2JA 1NYTA 1PL7A 5DXAA 4IDFA 4JBXA 5DHQA 2D3DA 1GNVA 3JQ8B 3CINA 3AIMA 1WXGA 5IHXA 5AK6A 2PFQA 1FJ2A 2VQSA 3O3NB 5JCJA 5AUPB 3GP8A 1MMFB 5FL3A 1J1UA 1B42A 5HQ3B 3L8ZA 1RLIA 1XK7A 3GFQA 5KAIU 1RYRA 4DQKA 1J8FA 3MRXA 4KGVA 4IXDA 2BLNA 4C5AA 1ORIA 4JBNA 5L7YA 3EGCA 3RIGA 3DUWA 4RQMA 3PNVA 1NMYA 1YJ8A 4KR9A 2DG2A 1WBBA 2R0QC 1R5NA 2YHAA 3I9V6 4WBNF