3QU2A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 80
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu2A01
4HGOA 5AK5A 1QYIA 3UM9A 1L7NA 4NV0A 4KNVA 4KN8A 3WK6A 3I6BA 4Y2VA 5AW7A 3WK8A 1TJ5A 4C4SA 3ZU6A 1RMTA 3I1YA 3KC2A 1SWWA 1ZD3A 3OTQA 3NANA 3ZTWA 3M1YA 5ALQA 5AVSA 2DQSA 1J8DA 4YCMA 4UMVA 4YCNA 5AM0A 1WR8A 3N28A 2G1AA 2PR7A 4DWOA 5AESA 2AH5A 2GHQA 3EPRA 4Y2SA 5AHXA 4Y2PA 2HHLA 1XP5A 4UAUA 1IWOA 2Q4RA 2FDRA 3J7TA 4UATA 5JJBA 5ALRA 3ET5A 2W4MA 3D6JA 5ALMA 1RDFA 1U02A 3KOOA 3UMCA 2FUEA 1EK1A 3QU5A 1FEZA 1N8NA 3OCYA 5AIAA 1Q91A 5AW6A 4Y2YA 1AQ6A 1L7MA 1Z4JA 2ZOSA 1RRCA 3ET4A 2WF7A 2NO4A 2HO4A 2WF9A 3FPBA 4L57A 3WGVA 3ZI4A 4IFTA 3GYGA 2P27A 3OCUA 3AR3A 3I76A 4UM7A 1SU4A 3QGMA 2RAVA 4ZEVA 3QXGA 1QQ6A 5ALVA 2ZXEA 1RLMA 1TA0A 3NRJA 3MMZA 5AKJA 4I9FA 2HDOA 3ZW7A 3QNMA 2HOQA 3WK4A 1WZCA 2B0CA 2IYEA 5AW1A 2RBKA 3ED5A 3NASA 3OPXA 3WGUA 4BNDB 1O03A 1U7PA 3WKCA 1T5SA 1ZD2P 5ALZA 5ALYA 4DW8A 2YY6A 5ALDA 4J03A 3B9RA 2HCFA 2YMPA 5ALJA 2EARA 2WF6A 1YJ5A 2G80A 1KYTA 4I9GA 3DAOA 3IB6A 3WK9A 1NNLA 3ESRA 2FPWA 3L0BA 4NFLA 2Q4TA 5A3QA 3DDHA 4CF3A 1ZRMA 1TE2A 3CZ4A 1MH9A 5ALPA 3NUQA 3CNHA 4Y2XA 1L6RA 2W11A 4F71A 1S2OA 4F72A 3HYCA 2RB5A 5ALHA 4CF4A 2X4DA 4EX6A 5AKIA 2I7DA 3F9RA 1WPGA 5AW9A 4NABA 3A3YA 5ALWA 3WKDA 2B8JA 3EF0A 2YJ5A 5AW8A 3N07A 3U7FB 2IOFA 4PNHA 3PGVA 3U26A 5AVUA 2FPSA 1Z4NA 3SD7A 2YJ4A 2HEGA 3R09A 5AW0A 5AI4A 3ESQA 3PDWA 1RC8A 4MWOA 1CQZA 1YNSA 3N8GA 5AM1A 1JUDA 2O9JA 5AKLA 5AM2A 2BY4A 2G0AA 1RPZA 5AM4A 1YS9A 5AKYA 2HSZA 4MUMA 4C4RA 3L1VA 5AM5A 4BBJA 1RLTA 2CN1A 1YV9A 5FP0A 3FPSA 2NYVA 3PGLA 3L5KA 1RQLA 4Y2TA 1T9ZA 2YJ6A 2HF7A 1L8OA 4EELA 4HGRA 4NAVA 3AR4A 3TLMA 4OCZA 3ZX4A 3RFUA 1ZS9A 1T5TA 5AK3A 3RF6A 2MSNA 2QYHA 5AI6A 3DNPA 2ZBGA 2OA0A 1YMQA 1U2TA 3N5KA 3N1UA 4FFDA 1ZJJA 3L8FA 4YIKA 5AIBA 2ZBDA 4Y3UA 5AVXA 1RMYA 5AW3A 3AR6A 1X42A 3OCZA 4AP9A 3U7HB 2JARA 4BX3A 4RETA 2YMMA 5T41A 2OYCA 5AM3A 5AKZA 4B6JA 3W5CA 3MPOA 3FZQA 4L6CA 2B1RA 4GIBA 1L7PA 3PCTA 2VKQA 3R4CA 2B82A 3ZVLA 5ALSA 2IA5A 3E8MA 3NAMA 1CR6A 3AR2A 3EWIA 2HF2A 4Y2QA 5AKHA 4HGPA 3W5AA 3A1EA 3OCXA 4L6AA 1ZOLA 4FE3A 2IOFK 5AW2A 2YMQA 2C4NA 3QUTA 2RARA 4Y2UA 2IOHA 3SHQA 2O2XA 3A1CA 5AVTA 5IS2A 5AW5A 2HI0A 3ZWKA 3QUCA 3U7EB 4J2TA 3ZWDA 4DFDA 3QUBA 2WF8A 1Z4QA 4BX2A 5AI8A 4OFZA 2FEAA 4E88A 5AKKA 4UMEA 3IRUA 4EENA 4OD0A 2GMWA 2I6XA 3QU9A 2G06A 4Y2RA 3ZVMA 3OCVA 3ZX5A 5E0OA 4EZEA 3L8EA 4Y2JA 1QQ5A 2P11A 4IG4A 4C4TA 3SMVA 3L8HA 5AKGA 5AVVA 3NIWA 1QQ7A 5ALKA 3IJ5A 1VJRA 2AGVA 4JDPA 5AI5A 3SKYA 5AVQA 1S8OA 3P96A 3HLTA 2JAOA 1ZD4A 1VFPA 1PW5A 3OCWA 4EEKA 2NO5A 4DCCA 1Z4LA 2CFRA 1RKQA 3AR5A 4KX5A 4XOUA 3L7YA 2G07A 4KYTA 2I55A 3ZUPA 4O8CA 4QQFA 2ZBFA 3QU7A 2WHEA 3M9LA 4CNQA 1WVIA 4AS2A 2YMLA 1NRWA 3L0CA 3UMGA 4GXTA 2FPRA 5AVYA 3KD3A 5AI0A 5AI9A 2MU2A 4G9BA 4UU0A 1L7OA 2WF5A 5AKXA 2CFTA 1N9KA 1TJ3A 5ALXA 4BX0A 5AVZA 4CF5A 1Z5UA 1K1EA 3KBBA 4KX3A 3I28A 3SF0A 4RESA 5ALFA 3E81A 1ZRNA 3W5DA 1O08A 1RMQA 1Z4MA 4G63A 3S6JA 4UW9A 2D2VA 1VJ5A 2JGAA 3A1DA 5AW4A 2R8EA 5A3SA 1RKVA 1RQNA 3W5BA 3DV9A 2PKEA 5ALEA 1Z4OA 2G09A 4YH1A 5AKEA 3FVVA 1NF2A 1RLOA 3BA6A 4UU1A 1LVHA 3FM9A 4JB3A 3WK5A 3B8EA 2YN4A 2W43A 5ALNA 1TJ4A 1XPJA 4EX7A 3L1UA 1Q92A 1QH9A 3KDPA 2R8YA 4BKMA 1J97A 2R8ZA 3UMBA 2WFAA 1SWVA 1LTQA 2CFSA 2R8XA 2B1QA 5AICA 3WKBA 1Z4KA 4ZEWA 2G08A 2ODAA 2C8KA 2FI1A 5ALIA 5IT4A 3NALA 2I34A 2BDUA 5ALUA 2C9MA 3ONNA 3ZTYA 3QX7A 3ZVNA 1U7OA 2I33A 1Z4PX 4UMDA 2ZBEA 2EAUA 2OM6A 2OBBA 2GHTA 4BNDA 4YIHA 1Y8AA 2JAWA 1XVIA 4BYGA 4AS3A 5AK4A 2QLTA 2BDEA 4NWIA 4YCLA 5AVWA 1U2SA 3MN1A 3BWVA 4H1WA 1L8LA 2C8LA 1RKUA 2YBDA 3AR7A 4HGNA 3U13A 3QU4A 2FPUA 3VAYA 3E84A 5ALLA 2YJ3A 2ZG6A 1YDFA 2B30A 2GFHA 3SKXA 1Z88A 4OHFA 3U7GA 4HAIA 3L8GA 3QLEA 3MC1A 4QJBA 3QYPA 2WM8A 4UAVA 5ALTA 3AR8A 4YGYA 2PQ0A 4UASA 4BEVA 2HX1A 3QUQA 4UARA 3L0YA 4ZEXA 2Q5EA 3EF1A 4UM5A 1ZD5A 5ALGA 5IT0A 4HGQA 3WKAA 4HYTA 3B9BA 4XE5A 2AMYA 3U19A 1EK2A 3WK7A 4XQ0A 2I54A 4FYPA 2GO7A 3QU2A 3WKEA 4XPZA 2JAUA 2C88A 2FPXA 2EATA 2B8EA 5ALOA 1F5SA 4CE6A 4KNWA 2AUTA 2P69A 3R9KA 3SLRA 2FUCA 3FGOA 1Z4IA 3KZXA 2P9JA 1Z5GA 4UMFA 3K1ZA 3AR9A 2YFYA 3E58A 5A3RA 5AK6A 4BEWA 5AVRA 2MU1A
chains in the Genus database with same CATH superfamily
3WRXC 4P84A 3PD7A 5CRIA 2JIMA 3F73A 4HKTA 5JOQA 4C4SA 2OENG 2C9DA 4C0QC 2OZKA 4KLLA 3QQ5A 1T2CA 4PRKA 2VPTA 4BE7B 3OO1A 1D1SA 1ZGCA 7ICSA 1UC9A 1K97A 3HUEA 1PGPA 4NTZA 1OBHA 3I45A 3W7BA 3ZE9A 4JI0B 5HA5A 1XXHB 1CRXA 1GA1A 4E08A 3HKZC 3SYKA 2FPLA 4KXYA 2IBMA 5F9FA 3G0IA 3OPXA 4FB4A 1AK2A 3CM0A 4L5BA 4YUYA 1SKYB 4CV1A 1Q0RA 1LD3A 3WGKA 5ED0A 3ESRA 3A7DA 1KJQA 1Z6GA 2IZZA 2PS9A 4GLBA 1IEXA 2XRZA 1RI3A 4L0QA 1ODTC 2CKMA 3K31A 2IV7A 4E7PA 2DPXA 2DUNA 3Q8XB 4PGXA 3EQ6A 3WIVA 3WV5A 4KPGA 3GRYA 1E3TA 4QNRA 6REQA 3SC2B 1KPGA 2V6GA 2LD4A 1NYQA 4CMBA 4QZFA 3UJAA 3VO8A 4FDUA 2DWUA 5HW0A 1LGYA 1D04A 3EODA 1Z5VA 2MJLA 3UUFA 4TUYB 5FTNA 2XTAA 2VHJA 1EHCA 1G8KA 3EZFA 3UUWA 3IKVA 1UP4A 1KJYA 1X3SA 3EVEA 2UXCB 4KDEA 5AOVA 3P52A 1VDZA 3V7WA 3UFBA 2CBGA 3NBFA 2IZ5A 2JCSA 1Z74A 3KTFA 1C9NA 3X3HA 3SWWA 2AE1A 1VI5A 2ERXA 2CVQA 4NAUA 4RELA 5KFNA 5BRAA 4N65A 2GAIA 2W6ZA 3KFXA 4WKPA 3HSYA 2DKNA 3QBVA 3S5UA 3VYTB 2YCBA 4QDOA 1GQOA 5I47A 2HQOA 5TGDA 1Z18A 3RTAA 1M9NA 4BVHA 3CE6A 5BUQA 4RE5A 1KORA 1P0FA 5FDFA 2Q9BA 4CIAA 1T0HB 2Q3EA 4BUZA 2X0FA 2FVYA 2B25A 2QM7A 3DE2X 3FH0A 3KYDB 5FRDA 2ZXFA 3OCVA 3MYRA 1S97A 1QIKA 4UEJA 3KE8A 4NG4A 2F64A 4PIVA 5DASA 2B4RO 1XDZA 1VJRA 2ZUEA 2FWIA 3UGJA 3FR8A 1X1TA 2FZVA 4JITA 3ZTTA 1JV2B 1IZ0A 4E5YA 5BN5A 4OXXA 4EP1A 4EGCB 2WYOA 3D3KA 3HU5A 4TKVB 4ZYUA 5LPNA 1VP9A 1SPXA 3H16A 4BXOA 3D4IA 3PGJA 2Q3CA 1EVZA 2J9YB 2XI9A 3EMVA 3E9MA 2NUPB 8ICEA 2GBIA 2P90A 4IY1A 2JGDB 1KP9A 3G8AA 2WJWA 3N87A 3RHTA 3QNUA 3BXOA 4EBFA 4AJHA 1PJBA 1U45A 1QRTA 2HK6A 1LPSA 1PT6A 5DRYA 1GZHB 6YASA 4C05A 3DMYA 1WXDA 1NUHA 2GM5A 3OIVA 1ISHA 1DOQA 1HQYE 1T0BA 1XYGA 2PH5A 1UF9A 3LQ4A 4DBZA 3ZTYA 1BHSA 4RKYA 1VDMA 4W63A 4KLDA 2YQZA 1E8DA 2GPNA 3M1AA 2V7TA 5G0VA 1A88A 3OAAA 1E59A 3V9PA 2Q1UA 3IULA 8ICLA 4MAFA 5E3HA 3UT5A 2O7QA 4P0PA 4Z2YA 1JXEA 4LTNA 2VYVD 2VK4A 1OF1A 4QTXA 4LOAA 3N8KA 2HX1A 4R9SA 3KJHA 4LSMA 1Z8HA 3Q2KA 4KYVA 1NQXA 1G2IA 3CKYA 3FHLA 1ILEA 3HZOA 1AS0A 2VJMB 3OJCA 5B1EA 4GMGA 4EL0A 3TRHA 4YRCA 1NV8A 4A8PA 4P2HA 4Q9HA 4N3BA 3T1OA 2WILA 3UK7A 4M1YA 1SXJD 5J3JA 5A3RA 2P68A 3PNBA 1BNCA 1DIBA 3KU4A 2W7OA 2MDTA 4E5DA 1PTJC 1ZD8A 1ZLXA 1ORWA 2ZIUB 2E8OA 1RWNA 4G56A 1NVMB 4J1TC 3DPUA 2D1FA 4WV3A 3IALA 4FGLA 4G01B 1C9DB 3IIEA 2G1JA 3BE8A 3I09A 3ZCVA 4WZZA 1GT91 3YASA 3HYTA 2VCHA 4IZHA 4RZXA 3OJUA 1XU7A 3UCXA 3DHEA 2R79A 4TVKA 1V4BA 4DJ5X 5CYOA 5CPFA 2XCAA 2E87A 1OI2A 3ES9A 1YJXA 2DWOA 4PU0A 4TUYF 1NX9A 1GVNB 1QHXA 3RU9A 3CZCA 3Q7EA 3SJAA 3HEMA 3ZDXB 2Z56A 3FTNA 1ZL2A 2J0UA 5ALDA 2RGNC 1CEEA 3GZNB 2AN5A 4QZBA 1DJMA 1CP3A 2CDAA 3VNSA 2C03A 1E4VA 4BPBA 4CF3A 2WJGA 2XMSA 3LLSA 5JUMA 1L5GB 2LVBA 3AVPA 4ZQBA 2IXFA 1I4OA 4J9QA 1RHRA 3VMMA 2I4OA 4P7FA 3VQTA 1PR5A 4WZBA 4D8UA 1NR5A 5AW0A 3A1WA 3O1HB 2B4KA 1WDTA 9ICAA 2QLJA 3G9ZA 3VPSA 4ECAA 1CY6A 3NBMA 1VCMA 3D4NA 4BMVA 3RWMB 1VSUA 2AFRA 1PAUA 1ZN2A 2JIBA 2WVJA 1LDGA 1USGA 2XDYA 3OT1B 3E5RA 4C4PA 3MELA 3C48A 4DRXB 5I4IA 1RZTA 1TVMA 5CHYA 1L2TA 4M0KA 3C5GA 2YZKA 4JQOA 5GM2A 4DCTA 2EH9A 2J85A 2CCJA 3GB9A 1BQ4A 1X92A 2I87A 5IBPA 5HUJA 3OZBA 1XFDA 3HP4A 1AU9A 4RA9A 3IA7A 1KSPA 4LRUA 4QGGA 3L41A 5DIFA 2I4RA 1BGWA 2QSYA 3AL0B 2PRJA 2NTYC 1MX9A 3ETEA 2HMYB 5E4JA 4HH4A 3RJ9A 4CEJA 3ZNNA 3KUDA 1P7CA 2N3ZA 1SOMA 3C2QA 1NVXQ 4IPTA 4EB8A 3VI4B 2W22A 2G9VA 1MO5A 4TOIA 3AUOA 1TW3A 1CQIB 2JGJA 5T14A 1Q1BA 2XYQA 4PW0A 4HD8A 1V47A 2NVUB 1J2UA 1P0IA 1SC4A 2SICE 2J32A 1R0SA 2QOEA 4OI1A 4NQRA 1FFUA 2ZSAA 1BWQA 4IQ8A 4XSHA 3ANNA 3RUEA 2Y0SF 2D3WA 2X6QA 3SR6A 2JANA 5DP1A 1IM8A 3LVFO 3O26A 2J87A 2XBLA 2D2EA 4WXHA 1JI7A 3X0DA 3F8WA 1QTNA 3HXMA 1KIAA 1L5SA 2VQEB 5DF1A 4A27A 1QIDA 3DEZA 1JQDA 5TC4A 1DHTA 3F9IA 3VOBA 2YY5A 1UC5B 1E7MA 1NKBA 1K88A 2H1RA 5B1HA 2P2YA 5K3OA 1Q92A 4OAOA 2Z9CA 1ZQ9A 3SY8A 2NUTA 4TTIA 1IPFA 2OC9A 1JR3D 3OSPA 1A5BB 3UTCA 4YP5A 3HSKA 3RYCA 4WRRA 1B74A 1QK4A 2VDWB 4Q4HB 4RTPA 3DLAA 4XQ9A 4HVLA 1AK1A 5EEHA 1C8KA 1PDOA 3OJSA 2RGXA 3IAS6 2VP9A 2N75A 4WT7A 2JH9A 3ESZA 1KL9A 4BIIA 5ES3A 1NVTA 2UUPA 3N9IA 1EWYA 2Q5EA 3BMXA 3MYYA 3RJZA 1MRNA 2UYOA 3TQSA 5AP9A 1TKBA 3DJYA 3KPWA 2BMJA 3PUZA 2FA9A 3A2MA 3QFRA 4FS3A 2H1SA 4FYVA 4HDSA 4FYXA 3MWKA 1DQNA 1E9RA 4L4YA 421PA 3R9WA 4NMWA 1W5TA 4LWOA 3RH4A 4B7CA 1TVKA 1BYIA 2X1HA 3C29A 4GPIB 3MSXA 4OI2A 2IGBA 2ZIFA 1Q3TA 3G6WA 2AL7A 3NHRA 3EPRA 3Q8KA 4J29A 2HHLA 1VXRA 4EATA 3U9SA 4KLIA 3HI6A 3OIGA 2H1LA 3A0RB 9ATCA 3V2HA 3FYCA 4MO9A 4ZYVA 2Y0DA 1YXMA 3UICA 1AE1A 1XMXA 3AKEA 4UCXA 1IHYA 5KG6A 2WF9A 4XB2A 3SJBA 2H06A 3BL5A 3O7WA 4CLOB 3CW2C 1JR2A 2JLRA 4FFBB 2F1JA 3NRJA 3LT5A 2I2BA 3X1WA 2Z2ZA 4GC7A 2UKDA 1Z3CA 1USIA 3LLUA 4TUPA 3MGAA 3OU7A 3ADPA 5KFVA 3SP1A 4TKZA 4TWRA 4TGLA 3QXHA 3AY6A 4B34A 4LJAA 3P4YA 3P9QA 2DBZA 2XIDA 3TLAA 1KDHA 3BQNB 4QM6A 2XTZA 2K2QB 2QKYA 3EC1A 1X38A 3E9ZA 2HCJB 5AVUA 4AJJA 3QXJA 2BH2A 2K7FA 1WBBA 4G5FA 1VG8A 4HSEA 2P65A 2C4KA 3WGTA 2P0AA 3EUFA 2UYCA 2VRCD 1RXEA 2ZR7A 2NRVA 3JAKA 3TEFA 2GYYA 3BRWD 3I2HA 3A0UA 4PN3A 3ER9A 2PA0A 3OUZA 4N49A 1MQ2A 4M9LA 2PRKA 3RVBA 2Z8XA 1XXHE 1NMXA 2JARA 1X2BA 5T41A 5G41A 2A1UA 4P54A 3R75A 3G8CA 3EOBI 1P81A 1ZQWA 1SKYE 5ALSA 2P0EA 2HJRA 4UAJA 1JZSA 4JENA 2BUAA 5BNTA 5DM4A 1XZIA 3BZWA 3TQ1A 3A05A 2WT4A 4QECA 2CNKA 2G7MC 3UVEA 3LXXA 1YJAA 1KYZA 1HDRA 3QBDA 5KPDA 4BC0A 4JI5B 1HG0A 2WF8A 3TKYA 2BCRA 1ZQOA 4US8A 1FRVA 4L1KA 4NMHA 1G8YA 3S2FA 4W8GA 2F8TA 3D6UA 2ZYRA 3NIWA 3S81A 4JDPA 3KHTA 4ND5A 1GG2A 4CM7A 2CE2X 4ELVA 4EY5A 3NYQA 3T5CA 4MS1B 4YMTA 1R6BX 3D0RA 2ZREA 2QVCA 3WMRA 1PV1A 5CVVA 4ID9A 4LN1A 3VAZA 4ELTA 3RB6A 4KITB 1IYZA 5DGTA 1Y7HA 3UFXB 4PR0A 1ZBQA 3E81A 2W6MA 3FTQA 5JAPA 4B7UA 4HXGA 1T5OA 3DMPA 1AMOA 1U3CA 1THMA 2DQYA 2QMOA 4IDDA 4FYMA 3FPEA 4N47A 2BGMA 2OK8A 4GWKA 3UW3A 3ISDA 2DFNA 3KVVA 1YL5A 2X42A 5H4HA 3CN9A 1SUFA 3L7LA 1EM8A 2X41A 2J09A 3F6SA 3TTVA 4U7DA 3JWPA 2GHTA 3RSQA 5AHOA 1TIBA 3H2YA 3FWHA 3FC4A 5KFLA 3T3IA 2WYWA 3FKQA 2YQEA 3NUGA 1USKA 4AZWA 3DYBA 4B9UA 4RD3A 5DPMA 3MBYA 2XD4A 2BUCA 5CDGA 2X0DA 3SBXA 3G6YA 2O8DB 3R8XA 1CWUA 4QYWA 4BFWA 3I52A 3FRHA 1QFXA 1X1AA 4FI3C 4PG5A 1U0JA 5EINA 1Y7PA 3M7IA 3AESB 4IRMA 3WKEA 4XD7A 4EJ6A 1AK9A 3O8LA 2Z7JA 1J2NA 2P9JA 1ML4A 3FAHA 4FYIA 3NG1A 3QE3A 4UBKA 2ZJ1A 5HYVA 1H5UA 4WKBA 5KQRA 2JV3A 4Q7KA 1TC2A 4D9CA 3I6BA 5FOVA 3V8BA 3JQAA 2B6GA 1M2WA 1ZQKA 1GRNA 1YL6A 3L4BA 4OL9A 1U9CA 2MUTB 3IOCA 3MCWA 4FZ3A 2BSAA 4B9SA 4B33A 1N61A 2NRTA 4I19A 3EVGA 1SU7A 4YACA 4I5GA 1TC1A 4GDMA 2IEGA 1RAHA 4DCGA 2WRZA 1BMDA 5B37A 1FO4A 1GNPA 2DGDA 2YOHA 3BSSA 3PA8A 3RUDA 2QXYA 2K4IA 3OQ6A 3BIJA 5C46F 4IJQA 4QL3A 1RM0A 1FPMA 3LY8A 4IUYA 5DK4A 2PUGA 5F2EA 4IHKA 1HTBA 2AMLA 1VG1A 3DMRA 1IG0A 3FUUA 2BCVA 2JJ2A 2QZZA 5HFNA 1O9BA 2B6NA 2KN7A 3PKZA 3KJXA 2J3IA 2VUUA 2H51A 4JS0A 3DAPA 1NI4A 3R3JA 4O5AA 1P5JA 3VSEA 1B4FA 3L8DA 2AD1A 4MCIA 2F3QA 3FRJA 4QDXA 2HM7A 1YS1X 3H87A 1H2XA 3E5HA 3CPEA 4RL4A 3TAPA 1RS0A 1EHYA 1P91A 1SC1A 5AYVA 1Q3UA 4JBLA 5BV0A 4PHPA 5HUQA 1CUGA 1UAYA 5MN4A 3T06B 2WTMA 4PC6A 5DB8A 5EMJA 4PR3A 3A6KA 2I4TA 4MGIR 4E5KA 4DOMA 1M2EA 2QX9A 1FTNA 1C30B 5JU6A 4ICIA 3RF6A 4X94A 1MIOB 2VP0A 3DOEA 3SZOA 1ABBA 4C06A 4DV1B 1MT3A 4NM1A 2ZRPA 5KB3A 1RXUA 1JI0A 4RDIA 4B40A 1QP0A 3H2IA 4RC9A 4BFSA 1M7GA 3EXIB 4IXDA 4GVLA 4CN8A 3AJ9A 4DGQA 5EKTA 2W42A 5F7JA 3W5AA 4EQ6A 4WK4B 4Y2UA 2VT2A 4XEHA 4ATNA 2NRXA 2CCGA 4POOA 3RBEA 5TEVA 1D9ZA 3DM5A 3BSFA 1QX4A 2DKOA 4MHOA 4X66B 1TO2E 1KJJA 1AA6A 1BJTA 3GBPA 1ZJZA 3SF8A 1B16A 1DHRA 1G98A 3F98A 1HETA 3LX6A 5C1BA 1IOZA 4EEKA 1TVAA 2W9XA 1IQUA 3RUAA 1MQ3A 3RV3A 5BSUA 3JD0A 3CSSA 4DCJA 1V11A 1XNJA 3PNSA 3WHLA 5E6RB 2F00A 2Q9CA 4N8EA 2F8SA 3QVGA 1TYZA 4ZT5A 3KRTA 4IEIA 3UXOA 3C8ZA 4KX3A 1EP2B 5KIAA 2E5WA 4PQGA 4TLDA 1KK3A 3HKCB 1JDNA 2R8EA 1WE2A 2GRJA 3K9LA 1EB8A 2D1YA 1HEIA 1JNYA 3V7JA 5L6LB 1UMBA 2FUG6 4OUKX 5IK2D 2PXHA 3T9AA 1I7PA 4NJOA 3K9NA 1A27A 1IXKA 1JFSA 3F5EA 3TSZA 3TZEA 2O0LA 5I7RA 3ZJYA 3ZNPA 3TCNA 4ML3A 5J2UB 4K0KB 1M73E 4O5CA 2VAXA 3W5HA 4FWBA 4J1NA 3IJEB 4CT4B 3L6OO 2HMUA 4TT3D 3BQ1A 1NMYA 2ECQA 1HNZB 2Z09A 1NLMA 1SCKA 1QF6A 1N6PA 1K7EB 1VHQA 2X8JB 4BNTA 2PIAA 9ICBA 4P38A 3R7FA 4HLDA 5CLQA 1E3WB 1N7HA 1UZLA 1OAOC 1U2GA 2C3MA 2Z57A 1MZPA 1QYCA 4L5YA 1A8SA 4MV9A 4M38A 1O94D 2HU2A 2BMEA 1HFEL 3AR8A 4K3UA 1AO0A 3Q6NA 4DA0A 1U8FO 2DCUA 1OGIA 3RRFA 5DNVA 1H4QA 3F2DA 1JH9A 4KL8S 2WTEA 3NEAA 3ZWNA 2DQNB 2Q6LA 2A1TS 3R76A 1DGJA 4YN4A 3C4QA 2CW5A 4XM1A 3HBLA 1WDMA 4DLNA 3IEVA 1WULS 2RH8A 4FQ7A 3UHFA 1Q57A 1VZ2A 1JILA 3ND6A 4FXOA 2CJXA 5CEFA 1N3LA 3AL3A 1MB0A 1U8EA 1OLUB 2VKTA 3R0JA 2OEPA 3BN3A 3R7AA 2FWPA 4C2BA 4M60A 1ZN7A 4UTOA 1P1BA 4K6MA 2XUOA 3ZHQA 3SJCA 1AVTA 1R7RA 2JD2A 1ZHFA 4K9LA 2VDJA 5LP6C 3ICWA 4XUDA 4ZV7A 1EYZA 1JFVA 4Q21A 1HDCA 2JJQA 3WNQA 2NM0A 3AVVA 1RLMA 4LYFA 1DFGA 2Z95A 4RTOA 5JDCC 2ZTDA 3N0XA 4F2WA 4IIEA 1J0CA 1SL1A 5JARA 1KFCB 4HDRB 5BSVA 5C7OO 5FPSA 2QS9A 3W6UA 1E8MA 2H92A 2FEXA 4MA4A 1Y3DE 5ALHA 2YHSA 1YKFA 5EWMA 1QSSA 1SQGA 3D8HA 3MWLA 4LYGA 5K3SA 5IJ9A 2OV6A 1JR4A 4D81A 2JFYA 1EI9A 2CZQA 1TX4B 1M1YB 4KLCA 1GSIA 3PR5B 2JCVA 4BMOB 1FDUA 2AYZA 3ZC3A 4U3JB 4DFMA 4MS3A 1FLNA 2CXXA 3UB3A 1T94A 2HA3A 3FPCA 4MMYB 1NKCA 3AZOA 4JB0A 1R4ZA 3EGDA 4DIOA 6PFKA 4QBKA 1AUQA 4D4JA 1IIPA 1I7DA 4ZHQB 3N8HA 4A36A 1K3TA 5A1JA 1D8TA 2ZBDA 2IPAB 5CWRA 5K45A 5FFMA 2PSFA 3OEYA 1H8HA 1N48A 3PHBE 2EDAA 4IJKA 5JYEA 3RADC 1N60A 4IICA 3ONEA 3U4QA 1QVAA 1QH8B 2HF2A 3IIMA 5E2IA 4FOTA 1ZQZA 3NKFA 1HDEA 1YZQA 2B83A 2VC2B 4PAQA 1JR6A 3QF4B 1O0BA 5MFPA 4XYEA 4WE3A 4AWBA 4XUGB 3OQIB 2OCXA 1Z0KA 3W9UA 2O8FB 4KN9S 4YR2A 4IIJA 3RYIB 2QYTA 2P9GA 4OTZA 3SOZA 3J81j 5TGZA 5NULA 2BM0A 3H4VA 4I9HA 5IZCA 5KT6A 4R1UA 3V1KA 4RJTA 1Z7BA 1OZGA 3QHPA 1Z2OX 1FDIA 3V8EA 5BOSB 3THXA 1LPBB 2ZJOA 3WGIA 3GNTA 2BZ1A 2A5DA 2QUAA 1NBEA 2NT4A 1GPNA 3PVXA 4LDRA 1Z73A 2WHQA 2C77A 8ICYA 2BPGA 4JJZA 3AEKA 1HE8B 2R8OA 4QNNA 1CR1A 4UBCA 1BRMA 3DDZX 3L1UA 1E4EA 4HQKA 3UMBA 2DPMA 4G4JA 4AYWA 13PKA 1ULAA 3HBJA 4UPDA 2ALJA 3QUAA 5FUQA 3HY3A 2WAQC 2Y9UA 2P6UA 3D6TB 1U3WA 3LUBA 2CYAA 4LYHA 3TR0A 3E7PA 1TAGA 5K0EA 3OM9A 1NKTA 3QYFA 2EFHB 3NRCA 4RZHA 4Z5XA 4YP9A 2H29A 3DLTA 4P53A 1SK8A 3R40A 4Z4HA 2CHFA 4DIEA 2PT6A 3ZXYA 4ZEXA 1GUDA 2D2IA 4KQ2A 1BD3A 1QCKA 1GCGA 1X9IA 2Y2UA 3PNCA 1UANA 1E5TA 1NVKA 1L4EA 4Z4CA 1YHYA 1YRWA 3NORA 5ISMA 3CX7A 2LPMA 2PFSA 3P32A 4TTVA 2DR2A 3WDSA 5FI0B 4YAFA 3GZ4A 3RFAA 1TI7A 1PZEA 4MZDA 1W30A 1HFKA 3BQ9A 3ZDFA 1LDNA 4FZVA 2WU0A 3RBXA 1ZQMA 4GZMA 1NY5A 4DQVA 3W7AA 4ECUA 3MJDA 1EK0A 4LVCA 2B20A 5IVIA 5K8IA 2QIPA 5B55A 2W2OA 4AJLA 1V85A 4X5OA 1BXKA 1JKJA 1XDUA 1XYVA 1QMPA 3N5CA 1BFDA 1NK0A 1QV7A 1S8AA 4Z3KA 1JIQA 4XB1A 3TOZA 3F3SA 3V4ZA 4I2FA 1ONPA 4C3OB 4OK6A 4DXAA 2PBZA 5T8KA 2GJSA 4RD6A 2R8GA 2REQA 1JG1A 2GAJA 4F11A 3PX6A 3PBKA 4ZXFA 2B0CA 1VHLA 1GQSA 3A1SA 4PFKA 1VLZA 3BTVA 3E2PA 4DW8A 1O97C 2ZRQA 4UPEA 2GNOA 2WF6A 4ZHQF 3ECAA 2IDKA 3UTDA 3TXXA 2PMKA 2VT6A 1ZRMA 5KNDH 3I6QA 5LQAA 3N2LA 4LKRA 2RCNA 3V6MA 2RHCA 5CX1B 2GVZC 2DWQA 1T6XA 3TZLA 3GYBA 1DJQA 4GGOA 5BW5A 2WUVA 3NKVA 4PLVA 3WLLA 1KMCA 4MVYA 1AKWA 1GPAA 3S29A 4LSWA 3QMPA 4RHYA 4X1IB 3GP3A 5AKLA 3LK9A 3EPHA 1T9AA 1K8YB 4GI2A 5BURA 3A6LA 4M9NA 3HJBA 2VT7A 1I94B 4KMUA 1ZJ5A 2ZIZA 1T5TA 1FF9A 2DETA 3BICA 4TTSA 1DADA 4Q7EA 4N5HX 2HBLA 4WXEA 4FCCA 4TQUS 2WVGA 2ZE8A 1UFKA 5B12A 4I4TB 2RIPA 1WSBA 2B6HA 4BRZA 3PCTA 4NBTA 2V03A 2AG8A 3UJCA 1NVVR 4R81A 2AOUB 3RU3A 4M9JA 2CUNA 1D5WA 3EPKA 1A96A 4J2TA 4R8SA 2J8ZA 2PA3A 3HFGA 3N2YA 4DSIA 4KW7A 4S0XA 1XZMA 1GZ7A 4OD0A 2F3RA 3HCBA 1PUIA 3JQEA 2H4XA 3IJRA 4I27A 8ICRA 2ZZMA 5KVVA 3V6HA 1H3NA 2OHOA 3AWIA 1Y9DA 3BREA 5IAOA 5F23A 1NWHA 3N53A 4B4WA 4QXOA 2QRKA 2ZYVX 1YZGA 4C6HA 5CVJA 3NH9A 2NO5A 3KSBC 3DULA 4PZPA 1U7HA 2HXSA 2FPMA 1QANA 3M8KA 4H3VA 4JJAA 3K30A 3T3OA 3HM2A 2C78A 4CCWA 2WT8A 1FLDA 4G5QA 5F73A 3I28A 3TAHA 3QTBA 1EA7A 5JS8A 4EVSA 4M9HA 4Q00A 2ZT6A 1UBCA 3T3HA 4X54A 2PGJA 1Y8CA 2E7ZA 5ALEA 5I8ZA 1PGJA 4HH1A 4WHMA 1TUIA 5K3DA 4YALA 4BAZA 5DU2A 1MG5A 2R1VA 3GX1A 2G6BA 2YHUA 1C7QA 2FW6A 5T7BA 5IWCA 5ALIA 4MI3A 2VF5X 2EIXA 4DOBA 1Z82A 4GX0A 4JZKA 1RM5A 1KMIY 2DCMA 4CMHA 4B2YA 1ZSVA 3GIMA 1BG6A 1P3Y1 1U2SA 3DVLA 1MENA 3MSCA 2GVNA 1FX0A 4KYUA 4KC0A 4IX9A 4WESA 2ZG6A 2TRSB 4OHFA 3QI2A 2Z6QA 4X7MA 2OQIA 3L1IA 3NEPX 5KFYA 5E1MA 4HAUA 1SCNE 3WZLA 4YR7A 2D13A 4BKOA 5DEIA 1E63A 4GFJA 1E2FA 3T8YA 4EO4A 7REQA 4CM1A 3FBWA 1K8QA 1T6BY 3HR8A 1XSEA 3GAAA 5C4GB 4OMUA 4YPFA 5TQ2B 4F9TA 1STOA 1UXJA 1OIWA 2WWRA 1CIJA 2YWEA 3AHDA 3SN6A 1I7LA 3HO6A 3BWCA 4RVHA 1HLFA 3EGWA 2XWJI 3LQQA 3RU7A 4BFCA 1KVTA 2PPLA 1VJ1A 1QYIA 2QSUA 4RK4A 3RVJA 4BDSA 4G86A 3LD9A 2G8LA 4MW6A 4MHVA 4IHAA 2WK1A 3FFWA 1Q0SA 3WLHA 1RJ9A 4RDCA 4K88A 4FN5A 2BGIA 4XZ3A 1UKEA 3FFBA 3DLHA 4NU8X 5HM8A 2OBMA 2FCAA 3IV7A 4ZV9A 1XI2A 3L6DA 1Y6JA 2FGJA 5IBQA 2HBKA 4OB6A 5J2FA 5HKKA 4ECZA 3A4MA 4KXQA 3WE7A 4DLBA 5DBAA 3G2QA 2H1IA 4C3ZA 1JHXA 4J7XA 1Q1ZA 1PK9A 1RYZA 3K0CC 2XXAA 4MA5A 4XFDA 4MWGA 2XB6A 3TR6A 1UZMA 2WT9A 4E21A 4V3CA 5FBRB 3KTDA 2BKLA 1E1DA 1Y80A 5CT4A 3GRKA 2IFTA 1EEHA 3CZ5A 3LXUX 4MWSA 2ZAOA 1IY2A 2OHHA 4I4TF 1WXIA 1U5CA 4IQVA 1M2OA 4NABA 4KLOA 1ZAYA 3E3MA 3VZDA 3RODA 4N39A 3N0TA 1Z4NA 2ZB2A 1EWRA 4RPJA 2EVWX 3CLSC 3FCYA 2W2XA 4O3FA 5FV4A 3RB8A 2BEWA 5L8VA 3ROKA 5JY6A 3D6MA 4UREA 3ABOB 3ENWA 3ORRA 1B26A 3QWAA 3ZX4A 4ECEA 1T3QA 3RKSA 5EWJB 4IOLA 1KEEA 1PX0A 4J9NA 3JZIA 2PWBA 3GVPA 5AW3A 4RPCA 2EBFX 5KMGB 3KB1A 1AZWA 4B82A 5ECGC 3LCRA 1LI5A 1E77A 2HDNB 2BR3A 2F8KA 4AXBA 3NOQA 3KKZA 1VCOA 2C3YA 2AFIB 4YAIA 1E7SA 4QUJA 2CPRA 4EZBA 4CQLA 3IS3A 4RMJA 2VNSA 3BMOA 4Z6CA 1IG6A 1PQYA 1O96A 1O0CA 1EVLA 1AQYA 5KINB 1CUSA 4OFZA 3MBIA 4YCJA 1G8PA 3U56A 4EENA 3FMIA 2W8ZA 1CJVC 4HDNB 2G06A 4JNKA 2XE7A 1SOVA 2Z08A 3P27A 4Z2AA 4C4TA 1M1YE 1NJ8A 3A25A 3MTDA 3RS9A 2WFMA 1PWEA 1YZNA 4CZ2A 3N3AC 2RQ5A 1QS0B 4LV5B 3IG8A 4D9KA 1U5BB 1P44A 1O8CA 1OW3B 5AWFC 3FZGA 2PSSA 3HMQA 2BCJQ 1QPZA 2B1JA 3BERA 3OX4A 1ZIYA 2ZZKA 1KRWA 4J0CA 2QU8A 1FUEA 4Q9JA 4TSFA 5CJJA 4PGHA 2C7VA 3ZHCA 1DEOA 1XVTA 2PUWA 3KOWA 2AYYA 3FDXA 1EBFA 1E1CA 5LLTA 3FOZA 1ZC4A 3ZU4A 2XCTB 3O8RA 1NASA 3CINA 5KYXA 1W85A 3EZXA 3HM9A 1IUOA 1WNTA 3FIUA 1G8FA 2WB2A 3U44B 3RVSA 3HUTA 4EM6A 5KNBD 4YHHB 4LJ6A 3E2IA 1V96A 1R10A 3KPJA 1TCUA 1QX3A 3AR7A 4WXPA 3H84A 2GPTA 3T52A 1KS2A 2D5IA 5JV5A 5IVHA 3MFHA 4EW1A 1MC4A 1XTQA 2ZUCA 3H2GA 2YVLA 3OZEA 1M2VA 4RVSA 5EE0A 2J45A 3UHOA 4Y9TA 4NE7A 5JAZA 1ZM7A 2C9CA 1OYYA 1MABA 4H6PA 1W8IA 4MKGA 1AKRA 3F4KA 2K4HA 1Z2PX 4BQSA 1VJGA 3VYSB 3KVNA 2EQYA 3GWZA 1R15A 4FC7A 2B4YA 3TLEA 1J5PA 1LB1B 4PC7A 5CA1A 4XVRA 1S2GA 1HYGA 1KJIA 1O95C 1NRJB 4EG1A 1T0UA 1M5TA 3NTUA 4PAMA 3EASA 2H8KA 2EWVA 2CFOA 3UYKA 3K96A 1Y63A 1J22A 4AX4A 1LU9A 5EL0A 4L15A 3PVSA 2VF2A 3T7AA 1T9GR 1XP5A 1PCXA 2QHXA 2XKAA 3UGKA 2X14A 1ISPA 1SOAA 2P6RA 2NZUG 4JI8B 4CJXA 5IJXA 1ZVVA 3EY4A 3G2HA 1JX4A 2N47A 2WOOA 1GPJA 2V3VA 1QH1A 2NO9A 4Y1GA 1W0CA 1KKUA 5JG7A 3VA7A 1OW5A 3Q9NA 1CHDA 2QENA 4LECA 5DHPA 3H9BA 4MRMA 2OP1A 2OO5C 1VJ0A 1E94E 3EIUA 3GJ5A 2V3WA 3C16C 5K7SA 3UA4A 4ZGGA 4OV6B 4B83A 1YSCA 4LOJA 1ODCA 4GKVA 5FL7A 3M70A 3HCCA 3IUJA 5CYPA 2HN9A 4KMSA 1ISSA 3DDNA 3PPVA 4RDXA 5MGNA 3VNBA 5B2FA 4PZZA 3EFHA 3OY2A 4R51A 3E4CA 4IDQA 4H35A 2QAJA 1POXA 1BVHA 4F12A 2V6JA 3EDOA 1ZXLA 5E0KB 5AM5A 4IOKA 1P5HA 3SZGA 4F5RA 1P19A 3OD5A 3DLCA 4YAGA 4WWHA 5ADHA 5I7SA 3IT2A 1X1SA 1YR6A 4MKXA 1IDOA 4X64B 1EVIA 1L4LA 5JWOA 3CCFA 3WGJA 1YMUA 2GCOA 4NL9C 3NHUA 3M4JA 1Q8KA 4O02B 3Q8RB 5C9ZA 2V7QD 4F21A 3DMGA 1GV1A 4GQIA 4I50F 5L9AA 4DCMA 3DDOA 4BY9E 3K8YA 3KX2A 1PQUA 5DLQC 4PSUA 3BMNB 2VUSA 2P8JA 4V24A 3C2KA 2W2QA 2ZYUX 5AK0A 3EPIA 3HCFA 4MCHA 1L3IA 4D02A 3LNCA 5EPUA 1CF2O 1E3SA 4MR9A 4YMWA 4QDTA 1QWSA 1IN8A 5A62A 1WXFA 1QRDA 3JQ7A 3RLIA 4RPHA 4X8OA 3EYZA 4O9MA 3LCVB 3A4NA 4QUDA 2GMWA 4RVGA 4NP6A 3ZX5A 3EGXB 1PJ3A 3BK2A 3GA5A 3RBAA 1YQWA 3RWOA 4PVCA 5U4QA 4RA6B 4KO8A 4O0MA 4BB0A 4QJ3A 1DKOA 2I1WA 5KTYA 3QVOA 5JZ9A 1VGVA 4H60A 2F1OA 3OOEA 2ODNA 1SKMA 1RZUA 1XEWY 3URMA 5JI2E 4DLEA 4CM9D 4F2SA 4HX5A 4XWKA 4G5OA 2CB9A 2XA9A 3K4QA 1B2LA 2PKYX 4L95C 4UOZA 4TQGA 1ZQQA 3KZ1E 3V4VB 5K4AA 1WY5A 3DBLB 3TNFA 1E6KA 2PMWB 4DV3B 4ZYZA 4ZAGA 1JYSA 2JFZA 3VR2A 5JXWA 3HS3A 3KPUA 3WGZA 1JLSA 2W6JA 4EYSA 1IM2A 2SBTA 3TPZA 3R8CA 1PR4A 1E7WA 2WWWA 2XUJA 3WB0A 3KLOA 3I0MA 2CHGA 1V9SA 1UADA 1BWPA 2R8YA 4WOJA 1P74A 2YICA 3OE1A 2Q5LA 2AA3A 4JSYA 2OGSA 4DEVA 1GSHA 2AX3A 4QULA 3TJZA 1ZOOA 1T9DA 2XB9A 3OZSA 4HHEA 2WTXA 1LSJA 2BFCA 1PL7A 3D2AA 1NKEA 4NONA 5BN3A 3ZZ0A 1PUZA 3T3NA 3CF0A 4C30A 3N70A 3O9MA 3WAGA 2EKQA 4RQ6A 4UAVA 3F74A 2QTWB 4G0YA 3LBAA 4S1WA 1DC3A 1GKKA 2AOTB 8ATCA 1GFIA 4HB3A 1ND5A 4CGYA 2EKLA 2KNJA 2AN9A 1KI2A 3TB6A 2FU5C 5AR1A 4C43A 5G4LA 2VSYA 2EHDA 1IQPA 1ZX1A 3EVCA 4PQFA 2IE0A 3TNYA 3JATA 1DAGA 2MU1A 1GJRA 3I30X 4DDHA 1ZEMA 4LK3A 2PFNA 1Y4SA 3GT0A 3OEWA 1A82A 3KR1A 4QTUB 2R18A 1I1OA 3SI8A 1IHUA 2NU9B 3CPSA 2Q3HA 5AJHA 1K7XB 1OH5A 3KOOA 2JEZA 1WMFA 3U7RA 4Z9YA 4KZKA 4EO7A 2BFFB 1Z62A 4KBYA 3RWBA 4YCAA 3C6BA 2AXQA 3OP1A 3I76A 4DL4A 1L3VA 4RZUA 2J9FA 4OLHA 4CBVA 5I9SA 1DK2A 3IAM6 2H7YA 1FBNA 1EQAA 3D7RA 3EVBA 3MTAA 3RHZA 3OIUA 4GQAA 2UVPA 4B0PA 3GARA 3WJAA 3PX2A 4MUGA 2HDHA 4C7OB 3BF7A 4RLFA 1V16B 2W11A 4F72A 3UT6A 4KTVE 4DJEC 3BS5A 3GV0A 5B2ZA 3DVQX 4Y8VA 1XQWA 1XKLA 2IOFA 1DARA 1N3IA 3TIFA 2G5TA 3PDWA 4UE6A 3NAGA 1QOQB 5L4LA 5A4MS 5IDWA 2IIQA 2QBYA 3PZPA 4OHUA 2P3QA 4AG5A 1D9FA 4IQGA 3TPFA 1UJMA 1E3QA 1OREA 1V8PA 1E6LA 1EQ2A 4HYKA 1X94A 4LJYA 3FF1A 1DJNA 4AO7A 5CM2Z 2FZGA 5LDHA 5LD2C 3QG1A 3JWHA 1LJ8A 1FFXA 4C3UA 1ZQAA 2KJ9A 1F4PA 2ORIA 1L7PA 4WZAB 3RJEA 3HI4A 2YN0A 1DO2A 2VHVA 3BXFA 4ZAXA 1Z5PA 2X4GA 4O3MA 4HNRA 3ZGLA 1E2EA 3DE5X 4JI6B 3VM6A 3FNFA 3OF5A 2CEKA 1G2OA 2QD2A 3R7DA 5IS2A 1OFGA 2C61A 4PLPA 2GWHA 3T5BA 2SECE 4PTYA 3ZI0A 4FMBB 3HABA 1SB8A 4MQFA 1TAQA 4HO1X 1M8PA 4CKZA 4HH3C 1J6UA 4YXWD 5E0OA 4Q9KA 4CV3A 1SELA 3M9XA 5JD5A 4DOCA 5T4BA 1NJ6A 3GP8A 2OE2A 4YCDA 2Q21A 5AVQA 1A9XA 1DC6A 3GPLA 1N1MA 1NK4A 2X8LA 2C1ZA 3G0OA 4EF5A 4JYAB 4QPPA 3DTYA 5G3YA 4ZA2A 3QH4A 1T3NA 1IK4A 4PQYA 5INTA 1BH2A 5AVZA 3AV0B 4BO2A 1AQUA 4HZUB 2V0CA 3DMDA 3AUSA 2RBEA 2X1MA 4UEWA 4G63A 1J25A 3CX4A 3I34X 3MT8A 1HM5A 1RYRA 4QZDA 1O2DA 2A9QA 2AFIE 3ZD6A 1AGXA 1G4HA 1NF2A 1K6MA 5EOZA 4Q9AA 3BOSA 1B8VA 4EZ6A 3HA3A 4HL6A 4AKEA 1JHMA 1TU3A 3FE2A 5IT4A 3AHIA 3O4RA 4WERA 3D7LA 5A03A 3WWCA 1EG7A 4HRVA 5CP2A 3KETA 2BDEA 1K4MA 4IIXA 2WA1A 2BDPA 4O2AA 4DG9A 3DPIA 1Y1KE 4YFKA 1YU6A 3P5BA 3A9RA 1GRRA 3WBFA 4FBLA 3T95A 3JVDA 4OK5A 4J0GA 4CM6A 4WVLA 5BUZA 1KRPA 2WM8A 5C1OA 2X40A 1M2JA 3DZHA 4JYCA 2AEMA 3EVTA 1OLOA 2CLEB 1PKEA 2P5TB 4EYGA 1QR2A 4LJ7A 1P2VA 5IHPA 4AO8A 2IHUA 4UJ5A 5K03A 2ZJ2A 3JVVA 3KZXA 2WAOA 3HFRA 3VYUB 1IBLB 3C3MA 3D2SA 1NOMA 4AL4A 4CLXA 3OJLA 2BKEA 3B85A 2CK3A 5J2CA 3M6AA 2W83A 4RKQA 5CFZA 3BXGA 4LY6A 5IKXA 5EJ7A 2PBFA 3EGOA 1VE5A 4G9GA 4DMHA 3WTBA 4PONA 4B4DA 1KDOA 3IUQA 1COKA 3GEIA 4PPNA 2EERA 4G25A 4B6QA 2Z4SA 8ICUA 2G6TA 4S12A 1Z0SA 2AQ4A 4WBNB 1YE8A 1XO0A 2FPPA 1P9WA 2HBYA 1MJNA 3DH0A 4UCQA 1VKJA 1YZUA 2ISPA 1YR7A 1PD0A 1ZFNA 1CQPA 2X6TA 4NYMR 4IQWA 3EQ9A 3L4PA 1G6OA 4A8JA 3ROGA 3WGQA 2YTUA 1AKMA 4LZLA 4JCCA 5ALYA 1I01A 4RFLA 4J6EA 4BO6A 1F14A 4YRFA 2P2SA 2QB0B 1HNXB 4MITA 3O8DA 4AMBA 2FSFA 4MVXA 2L0XA 4OO3A 3OSNA 3HWRA 4HRXA 4F2RA 1UM9A 2V9CA 2IYXA 3W9BA 4C5CA 1EAYA 4DMKA 3LLCA 1IL0A 2JA2A 4KO3S 4YJHB 1XU4A 5DN9A 1JEQA 2QGZA 2C2EA 4BNVA 2YCLA 3QPVA 2Y0CA 1P5ZB 1IPHA 1JPUA 3RRXA 2HWKA 3T7DA 3SI7A 1JN0A 4WOPA 3AGQA 3I2IA 2EF0A 3ZBPA 1D8AA 3DZDA 2AJCA 4IVQA 1CR4A 2C5FA 3K8OE 4OFXA 4BRUA 1WUJS 4YT4A 5TMDA 3BGSA 2P3LA 1WWVA 5ERXA 5KFDA 1YUBA 1G3IA 3HFJA 9ICNA 4OQFA 2P9ZA 3CZRA 1L5KA 4M0EA 2BKXA 3UJHA 3VVCA 1XCBA 4Z0TA 3IVCA 2IK8A 3O94A 4X84A 2AI2A 1OSNA 4GE3A 1A8IA 5ECYA 3OCXA 3F2VA 2ZI5A 1TF5A 4KR2A 3LUAA 5DXFA 4X90A 3JWJA 2IC5A 1IIBA 1L7RA 2I03A 2VFAA 4YRMA 4RWZA 3K6JA 2FP4B 4F5YA 2J4FA 4ZRNA 3ORSA 2PH7A 1RADA 4LNHA 1EDOA 2VJQA 4C6TB 3LNTA 1N2IA 3ICPA 2YQ5A 3KKEA 2CLOB 4TLAA 3CNBA 4MI6A 4F06A 1H4SA 4AM8A 3CNEA 4WACA 1VE9A 3V4RA 3AM3A 1Y4AE 3INNA 5I01A 4Z4FA 1CUVA 4LFAB 3F6BX 3IJPA 1FNSA 5E9QA 5IHXA 4GM0A 3PGMA 1J42A 1DKRA 3L05A 4DBLC 2WJZB 1REQB 5HRUA 2GN4A 3ANSA 4K9OA 4Y1RB 1UFQA 1XJCA 2YWGA 1DSSG 5JCOA 1RQNA 1JLMA 4AD8A 5DN6A 3U60B 1LRKA 1R8QA 1I2MA 2ZRJA 4KV9A 4DSEA 2ISCA 4DAOA 2HKIA 4A1FA 3W05A 3LKVA 3S2EA 2I1VB 1QRAA 2HNAA 2I9PA 2C7PA 4KWCA 3RREA 4CL3A 4PY2A 5JFOA 5JVDA 2FSSA 5L53A 2IUFA 2DPLA 3A9CA 4MNTA 4DE5A 4BLSA 2DULA 3MJHA 3SXUA 1EDDA 1BE8A 1YJQA 2WKRA 3BUSA 2HHXA 1TDJA 2B69A 3FJOA 4N0PA 1S3IA 4OF4A 4G3XA 1N8TA 4U4AA 4P83A 4DMRA 3B3JA 5G1OA 4NYIR 4I6GA 4RTJA 4P98A 5EMHA 2HOFA 4WBNF 2ZM6B 2KS6A 2VAMA 3RR7A 3HA2A 2JAUA 1LRLA 5JTTA 1E2DA 1SXHA 5CB4B 4ECWA 2F3NA 2ZAYA 3WYAA 1SG6A 5L3VA 2NYAA 4ZH4A 4WKGA 1Y1SA 4K4GA 2I4IA 2XVMA 4QGBA 2M1ZA 2KBFA 5JSZB 4NMMA 2R11A 4UBLA 4PXAA 4MUAA 4F3CA 3BE4A 4FGUA 4YREA 2EZUA 4CHTA 5KJCA 3SJZA 1W7AA 5D51S 3BCSA 2DBQA 3QK7A 3IM1A 1BDBA 2JJYA 3ELDA 1K4YA 2VXCA 5BSFA 1TK9A 1N7GA 4L9WA 1XQ1A 3QOWA 4H9GA 3H0KA 3U7QA 5CX4A 1BMFD 5KTOA 1WHSA 1DBRA 1LC3A 3GT4A 4N9WA 5DDMA 1SU4A 1PVDA 1D2HA 1NSTA 2OOKA 3UGTA 5DT2A 3QKSB 2CVHA 3MDAA 2FX3A 2NU8B 4Z51A 1T5SA 5LDDC 2HJGA 3VDXA 2GZMA 3P0HA 1FYWA 3MUNA 3FSGA 3TLGB 2FPIB 4MRPA 1JBQA 4L0DA 3TUZC 3N8IA 3MWFA 5LJLA 3D6NB 2ZT8A 5JRTA 2V1UA 2YC2C 1CEZA 3NEYA 1Y8QB 3TZCA 2HMVA 5JO0A 4R8KA 1TADA 5F77A 4KDFA 1NG1A 5WRFA 3N0WA 2BCSA 2R85A 3H3JA 1NVDA 3IP9A 3F2CA 1CNMA 2O52A 4ECVA 2PHZA 1UXKA 3ZE8A 5JI3E 4R63A 4CCSA 1WSAA 3B9PA 5G0TA 4OHCA 1RYMA 5L95A 4AKTA 1F06A 3DE7X 5L3RA 5TQ0A 1XWIA 4PS0A 3OURA 1TZ2A 3H5LA 1R0YA 1YMQA 4RQ2A 1ZC3A 3BWXA 5DDYA 4QUIA 1RMYA 2WMDA 4BMNA 2PVCA 4JR1A 4HF7A 2WUWE 3OZTA 2B82A 3BJZA 3SV4A 3U9TA 3DGEC 4V38A 4KIWA 4DLZA 2FWNA 3DG9A 3A1EA 1OVGA 2NWQA 3K5IA 2YVQA 2RARA 3H13A 4TKMA 4KHZA 3LYSA 3AO0B 4NY1A 1Z4QA 5ECDA 1AQJA 5EWGA 3TLYA 1VSQA 2VTBB 2AXNA 5E6SB 5DQIA 5LR6A 1NZFA 3UEOA 3WRYC 3IUYA 1P5FA 2PZJA 4Y2JA 3UC9A 1KEWA 4AMGA 1X9HA 3PSTA 1WCWA 2JKZA 1HY3A 2D5LA 1J2MA 4IDEA 1QFMA 1KH3A 3PTLA 1QAMA 4R6WA 1L7AA 3OQNA 4IIGA 4PZYA 2IPOA 1S2NA 1E6MA 2BFDB 4AAYA 2IXTA 3V8NA 4RVNA 4V0RA 4O5OA 3ZDDA 3LT0A 4DM3A 5A9SB 3SF0A 1OAAA 4YBRA 2NV0A 1QHYA 3I9V6 4WZAE 4EI2A 1E1RA 2ZB4A 1O54A 4OMCA 1MO2A 1Q5PA 1RABA 2WSYB 1P1FA 1E9EA 3UBMA 5AKEA 2O06A 4L22A 4G1FA 3G17A 1N2XA 4NKRA 1T4CA 3DE0X 5GZ1A 4TWBA 5CB4F 1IXYA 1DIOB 3BXHA 3CO5A 2YX1A 5DQGA 4YO7A 3Q3JB 3SHWA 2XPCA 4PZNA 3ASVA 3MDCA 4F92B 3GEBA 4BNGA 2YUIA 5KSPA 1RTKA 5JNWA 5BP7A 5C0YA 1XQ9A 3GROA 4K6HA 3LQYA 1M34A 4JV1A 4FU0A 5HQTA 1WV0A 1SBZA 3DCNA 4Z6DA 1RVV1 2PJZA 4BO3A 1KI4A 3ZK9A 4QX6A 1R6VA 1Z6YA 2J3KA 3W5IA 1UPTA 4RGQA 3NBYC 4M0UA 1KR2A 2FEOA 4TSRA 1Z38A 5EUQB 2IQ5A 3PUJA 1BNOA 4WNAA 8ICXA 4ITVA 4A8TA 1Z15A 3QQPA 1OX4A 4M47A 2ZK7A 2WU8A 1QM5A 4ENPA 3HRIA 3OD1A 4LZAA 4U2FA 3EQ7A 4GWLA 1KQNA 2OZVA 3EPLA 4I28A 4DGSA 1UOPA 4UAZA 2HBJA 4ESEA 3JALB 3V8QA 4K4HA 4KQ1A 4Y6LA 2POQX 1DE0A 3NM5A 4PGYA 5ALMA 3GD7A 2JBHA 4R7GA 3SEIA 3G5TA 1BXZA 3GRZA 1W88A 3NP9A 3RIYA 1XD2A 3ESXA 3V33A 5K6AA 3L7KA 1OXXK 3QXSA 3VMFA 1QIGA 4BCCA 3ELYA 3LO8A 1UXHA 9ICKA 3QVUA 5JH7B 1E2QA 1M6VA 3JQGB 1NW6A 4KDCA 1O03A 4I2BA 4BVBA 2ADMA 2XMRA 2GDZA 5HCNA 4HQOA 1A5SB 7ICHA 4ESHA 3GG2A 1GIAA 4ZWNA 2VOEA 3QA9A 5EJ8A 2QN7A 4CPDA 5AKIA 3HPQA 4BRWA 3QKRB 1XGKA 5J2UF 2ET6A 2VZ9A 3BM5A 3COJA 2ZULA 3UWMA 1T9BA 3EYAA 1F2TA 4RF3A 3R5TA 4MUFA 3T7KA 1JTVA 4DXDA 1SBYA 1MDFA 4E32A 3KALA 2QVZX 2QQFA 5BMOA 1AV6A 1WZEA 5DB6A 5TPZD 1SXQA 3T6KA 2JGIA 3ZGNA 2GF2A 5GJWC 4XAQA 1N6LA 2O57A 2Z5LA 5BWLA 1SR8A 2I62A 2P40A 2PLFA 4YCSA 5IUJC 5KFZA 4IRDA 1H1DA 4RS4A 2IEAA 1U8TA 1IN4A 4CKBB 1JXOA 5KQPA 1X19A 5BV8A 1DPGA 4WOCA 2WTUA 1GSAA 1YQEA 4U2GA 2RAPA 4WMLA 1AUOA 1GG9A 4S05A 3OQJA 3PXGA 3V2GA 5EXTA 3U4HA 1XMOB 3BEOA 5JBIA 2Q6VA 1ISIA 1VLLA 4MQ6A 4NJEA 4TWAA 4DWWA 1CDZA 3MA0A 4MV0A 3RIMA 4EZEA 2ZU0C 1C9EA 2HPAA 1H2FA 3C6QA 3FI9A 3DAFA 1Z1BA 4BV2A 2GK3A 4LGCA 3PVCA 3VR3A 1POWA 3H99A 2CNWA 1P7YA 2WP8J 5F3RA 5C3MA 2HGZA 3TLKA 2WHEA 3CR3C 1YQUA 4BGIA 2RHBA 3LVWA 4BUCA 3Q1LA 3F4LA 2IIBA 1IJKA 4CF5A 1NLUA 4RSGA 1D6SA 5FNVB 3BGDA 4D7AA 3CPJB 4I36A 3R41A 3E0FA 3RS8A 2HGSA 1QSLA 3QHQA 1ZUWA 3LHIA 1A5TA 5KTPA 1BXRB 4NU0A 1E0JA 3C5HA 1AO3A 4JJ4A 2ZJ7A 5J63A 2I65A 3HP7A 4D8WA 2EQBA 5TV2A 4NBVA 4GMXA 1QORA 3KOZA 3MVEA 5IUNC 2YASA 4GX5A 3G85A 3DBIA 1U80A 3A36A 4QW8A 4C4AA 2LP4Y 4RV9A 1MOPA 5EWLA 5KI6A 3WLRA 1RKUA 2P2DA 4CDMA 4LF7B 1DG1G 1W34A 3BPSA 1JHOA 4P3XA 3GELA 4D56A 3K70B 4TMTA 4HY3A 1EWTA 5DI3A 3LW8A 2ZWIA 2C95A 3QIAA 3SFTA 4JYZA 1KEZA 1TCCA 5EMNA 2QVGA 5A02A 3RUIA 3S68A 3F2BA 2JEIA 1XKQA 2Q29A 3JASA 1UL1X 2QTZA 5J2IA 2DUUA 4X65B 1OIXA 4NEHB 1YGPA 3F96A 3CG0A 3OUUA 4R9RA 1OZHA 5JH7F 2WMNB 4NV0A 2JFHA 2DG2A 3JPSA 2B5VA 1IHXA 2WAYA 1OJLA 3QLVC 1T9GS 2VQ3A 4Q37A 3AUKA 1CLUA 3PENA 4MYDA 4HQRA 2O3SA 2WB1F 4H4EA 4B6SA 4KFTA 2B92A 4G9EA 4PE5B 1KZGB 4TLEA 2WF7A 1QZXA 4NCXA 2E5FA 2DWPA 1YFZA 3ZDCA 5A7GA 4W9NA 4KTQA 3HB9A 3D7KA 5LXTA 5I3ZA 1J99A 4GWGA 5FOWA 5AW1A 1C1XA 4WASA 2QARB 4Z9XA 1Q17A 3WKCA 2ECPA 1OXKB 4GH5A 1ONNA 2OV8A 2ZIWB 4EBEA 4FZ5A 3TZBA 2ERCA 2GYWA 2RB5A 2IW1A 1E7RA 3TUJC 1FJ2A 2Z04A 2YJ5A 3M3PA 3EW7A 2WWGA 1U1CA 5CDHA 1U7XA 2I2WA 2Z6UA 4DM7A 5BY2A 3K94A 3LC0A 3Q7SA 3S8YA 1CQZA 2YYSA 1L4KA 1BS2A 5DNAA 1PO7A 1YV9A 4FXPA 1EFRD 2VQFB 1KZ7B 4ENVA 3FDIA 5FOQA 4ZFNA 4XSGA 2ASVA 3ZWOA 2XY7A 2XNKA 5K09A 1NTOA 1FFVA 1BE1A 3WR5A 1GRCA 2WPDD 3LDFA 4DUGD 5CD9A 4DUPA 3RGGA 3T0FA 2RG1A 2H5XA 2OQVA 3WDKA 3REOA 3O5AA 4W1RA 1A7AA 4BZPA 4CDRA 1JFRA 3LGXA 3PC3A 1IBMB 3HJRA 1JYFA 2CLCX 2XNDA 3K0BA 4H3KB 4F85A 4U7PB 4PHDA 1EFCA 1B0AA 5K8JB 2BE7A 3VBCA 5KQMA 1PVQA 3UQZA 5FNVF 2PXXA 4GOND 1EH5A 3BKXA 5C5EA 5DB7A 2V54A 2OYYA 3MJCA 5EJEA 1CQXA 4GSKA 4MW1A 2MSLA 3IEIA 1FXWA 3N74A 3S3TA 3ACDA 1NE2A 3BD6A 3X43A 5IPFA 1NVEA 4LFBB 3HR4A 2EFJA 1ZCJA 3HKBB 3I9KA 2R8HA 3PDIA 3ESDA 3SYZA 1GCAA 2WIDA 4IS7A 1VKOA 3CR8A 3WLNA 3CCCA 2W2KB 5J0YA 2QG4A 2C5SA 2C2KA 1O6CA 1KO1A 3F1LA 1NJXA 4JELA 4X61A 3WYEA 1R9GA 2WAMA 4UNIA 1IOWA 5K8LA 1YFKA 4G41A 1TJ3A 4UHFA 3ZCUA 3NW9A 2VXOA 2ASJA 3PEEA 2LCQA 2LCIA 3L7BA 5AW4A 1ICEA 1YFLA 4L3WA 2BKUA 3STUA 2B99A 3KZIU 3ZV5A 4AJNA 1XTZA 3CSUA 3CEMA 1YQXA 1BMQA 4HAVA 3SC3A 2IELA 1U8ZA 5BR4A 4CQMD 2WKQA 1TTHA 4KLAA 1OXBB 3MLAA 1XTUA 1IIRA 3UJPA 2ODBA 1J7KA 2VUIB 2OM6A 2P6MA 4Y1EA 2UVDA 1FE8A 5H8WA 4OSEA 2J3LA 2XOEA 3PQ3A 5G1NA 5DYTA 1EUCA 1FTSA 5ITWA 3ZK8A 1J90A 4AB1A 1OOEA 1K7CA 4F8JA 1II8B 4AUNA 3M6IA 4G2TA 1ZP6A 1KQQA 1HF3A 3KYCB 3NLLA 4IWNA 1NG9A 1U28C 1EWKA 3T5DA 1FSSA 3GEMA 4MVWA 3A4VA 1KARA 4BYMA 3K71B 3ZJ5A 3TBHA 5J0SA 4NESA 2J0QA 2XD9A 4TZTA 5AJZA 5E4YA 4I4NA 1WXXA 1E4OA 1UOQA 1JDPA 1RQPA 5HKOA 2ZWMA 3T7IA 4MDYA 4FNOA 3NANA 1TD1A 3MR5A 3V72A 1G7CA 2DHQA 4FD2A 2PGDA 2EQAA 1JXAA 5B6PA 3CBQA 4OX9B 4C7XA 1ZMBA 1DELA 4QPZA 4BX8A 3TVDA 3AEUB 1GM5A 4R8VA 3P2KA 3FNHA 2ZJYA 2FN4A 2BGKA 5DTEA 4FYHA 4LDZA 4ECQA 1O6GA 3C3XA 3ZCSA 5L1LA 3M4XA 3G5LA 4IMJB 1N3BA 1T4MA 3N7PD 2CXYA 1IPEA 5FWXA 1L4GA 1MC8A 1JEYA 1HA3A 5BQFA 4BTVA 2GUWA 1YE3A 4J03A 4NENA 1HE5A 3EXG2 1XCPA 3ABIA 4ED1A 2C8JA 3QPBA 4Q34A 2OGTA 2FWBA 4YMIA 5H9WA 1U2QA 2ARKA 3OLWA 4KR7A 4CL2A 1YH3A 2DUJA 6CHYA 3TNLA 4UHEA 3PFNA 1ECCA 5KYKA 3D0KA 3U26A 1X8JA 3RTGA 2RHMA 2E4YA 4DV2B 4RXMA 2ZJ3A 3N8DA 4ZOLB 2IYNA 3FG9A 1ZQTA 2FQQA 4BQFA 5D49A 4AF7A 3AI1A 5EJ4A 5AK3A 1Y89A 2QJOA 3B1ZA 1PNOA 1DKLA 5DTJA 1TTTA 4E5MA 4M76B 2OA0A 1BCSB 3ZHRA 5T3YA 1JHRA 3FYUC 4UDXX 1RWMA 2J0VA 2GJ4A 1R5BA 4EMSA 2GHIA 2PX8A 1G2QA 1M8FA 4REQB 3M6MD 1AN0A 4BQNA 2HHSA 1U48A 4RNNA 1S01A 3K15A 4HB0A 2BSQA 4KLEA 4P0TA 3IXLA 2EEPA 1N4AA 1Z0IA 2H11A 1CD5A 1DC4A 4EGQA 2IXEA 4ZCTA 2QRHA 3ZCPA 3VCBA 2B1GA 2X3UA 4JGIA 3WZ2A 2ZI7A 1A50B 3WJ1A 1QHSA 3IERA 2ILVA 3EZYA 4GC6A 1K6XA 2D06A 3SGLA 3EA4A 3O31A 1VFPA 3PTZA 1QUEA 1RLJA 4O1HA 4FKBA 5CJPA 4WZ6A 4WY2A 2FXIA 1NR1A 4M9CA 1DL5A 3UB2A 5DRTA 2BZGA 2BJVA 3D3WA 4DHWA 2HVHA 4FHGA 1PZHA 2FQ1A 3STVA 4OYRA 4D4KA 4FS1A 1V8OA 3VKWA 3DL7A 3ANYB 2GS9A 4GYJA 4GPEA 4E1AA 3L43A 2GQ0A 4G07A 5LU9A 2NZYA 2HTEA 3PMNA 2IGTA 2AZ4A 1O08A 1BPXA 5JS1A 1RYDA 4MXDA 4HPXB 4D41A 4GOOD 5DX8A 3OOJA 2RLTA 5B57C 1E1QD 3HSSA 3V1TC 1RU3A 2KJ5A 2PLWA 1KDTA 1X9SA 5H3LA 1E2PA 2KMLA 1JWLA 4IX1A 2H16A 4JQZA 4B9VA 1FRZA 1B22A 2GPJA 1RAEA 3V7FA 1WL8A 3R3XA 1X7XB 2AV6A 5I7WA 4XVCA 2QLLA 4CW7A 2NMVA 1ZCZA 4NHEA 4BYGA 1M2GA 3IPCA 5A0VA 4X60A 3B6JA 2KI5A 4YRPA 4BJ6A 1XVVA 1NL3A 2WWIA 4ZAFA 4D9JA 9ICLA 4INAA 4JBXA 3C1UA 2W3RA 1OU4A 1GSOA 2JLSA 5K0NA 1GLNA 2O50A 1TO6A 4UM5A 4IR9A 1X7ZB 4JLDA 3AUTA 2I2XB 3RRZA 4W5NA 2A8YA 2QRGA 3N2IA 4RQTA 1Z34A 4CIDA 1AKNA 4UB5A 1OLSB 5BSRA 4B5KA 4IMIB 1JU9A 3RUCA 4CQMB 3FKSA 2CXQA 3IP1A 1KJ8A 4QPJC 2ZFUA 3EZLA 3NAZA 1TT5B 3WLEA 3G9XA 4D3YA 2VNIA 2DXIA 3W2FA 3P97A 4ND8B 5B3JC 1I8TA 3PW2A 3FB4A 5JU5A 5IAKA 3NCTA 1VLQA 2V7PA 1CBUA 3GDFA 2WIFA 9LDTA 3E3OA 1GGMA 5HQ3B 1SC9A 1FSZA 4DN6A 5FLXA 1JFFA 1OWNA 1QO0A 2FUEA 1EK1A 4RT3A 2QTTA 3EAFA 2ACEA 4G8BA 4TZKA 3CXRA 3WL5A 2FQXA 3EA5A 1D8BA 5BPHA 1QAOA 5AHWA 4ZOLF 9LDBA 2J7PA 2HT1A 4UM7A 1SK9A 1NXPA 2R2AA 4ZEVA 3E70C 2L19A 4I99A 1QIJA 3QNMA 4X00A 1CZKA 4ND2A 2H8GA 2C5EA 2CNDA 2Q2WA 5L3QA 4PHAA 2GI4A 3IVXA 3BWYA 3UWPA 3VVMA 1QQBA 1FSGA 4LJLA 3B3FA 3HBMA 3BYZA 2Z6VA 3LFUA 4AN0A 3H1GA 5HGXA 3FFTA 4QFDA 3RFVA 3DCYA 2XMPA 1N5OX 1T2UA 3BBLA 2NSHA 1JIXA 3K1TA 4Q9NA 4W5HA 2JCYA 4EY8A 1AKEA 3D2NA 3UAGA 2Y4OA 3ENKA 5AI4A 3AFMA 1GL6A 3JAMA 1YNSA 1H6AA 3PE6A 1U8CB 1EUYA 1U31A 4NECA 2HHHB 3BGWA 5IKEA 3VV2A 4Q45A 5J8YC 3CN7A 1FNMA 4MLCA 5FULA 4DCNA 3PGLA 3ZDZB 4W5RA 4C8MA 2JRLA 4QDZA 2CXRA 3AR4A 4U9HS 2BH9A 3FNQA 1L7VC 1U2TA 4JBHA 3AEYA 3KUCA 5JTUA 3EUAA 1J0XO 1KNXA 2EGUA 2WIGA 1PLJA 2G3YA 3M3DA 2ZIXB 1U8AA 5KG1A 2ATVA 2I3BA 3L9XA 1ZNYA 3F46A 1I24A 4NYJQ 5DJ5A 2XSZD 4L6AA 4QPNA 1WAMA 4IYJA 3CF2A 2HW8A 4FOLA 4ZU6X 3NNDA 1GA6A 5LP1A 2VO1A 4I6EA 4ZCSA 4IDGA 1F6DA 1M1ZA 5GIPE 3PC6A 4RK5A 1W46A 2KBEA 5AJTA 4I8XA 3KXDA 1SIJA 2XCQA 1JP7A 1UMDB 1RYUA 3M6VA 2ZRBA 4UHJA 2ZSJA 1G55A 3GOQA 5HCUA 4DY4A 3LBHA 3SJUA 5EJ9A 2AGVA 4R1LA 4WCFB 2D4AA 2EWWA 2DTXA 1PFUA 2JH1A 1N36B 3B38A 4B6GA 4KX5A 3HXOA 4BNHA 1JN3A 3W2IA 1AB5A 2FE9A 1PQWA 1YJCA 1ZGHA 4JMLA 4X71A 5FO1A 1FTQA 5AI0A 4NH0A 7ICRA 5IAEA 3CW9A 3PO5A 2JAHA 4DARA 3W7VA 3ZCXA 4OX9Y 1UDAA 1TCVA 4HB2A 3FNRA 8ICFA 4UBOA 1TLLA 3O84A 1PKXA 2JHDA 1NI5A 5D01A 1QHNA 3BHNA 1KE1A 4MWDA 4GXKA 3WWYA 4RIHA 3STYA 1Y9JA 2MOKA 3VPHA 2RGAA 4I1UA 3QWFA 3W3AA 1T15A 5JE8A 3C6MA 3O4IA 5BRNA 2KOBA 2YYZA 4ISBA 4UMDA 1Z12A 3SVTA 1DAOA 4F4HA 1GGFA 4LZPA 5IMSA 2TMYA 2C0CA 3HDJA 4DDUA 2E6UX 1R4NB 1DX9A 4C7JA 1ULBA 4TQ9A 4B76A 3E05A 2YJ3A 5BYBA 3S2ZA 3TECE 3ASUA 1W9HA 3C2LA 3FWZA 2QYOA 1HRKA 5EE1A 2BYTA 1PJCA 4UARA 1ESNA 4C7YA 3MRVA 1BW9B 4OUDA 1K7SN 1L1QA 4EG0A 1C7YA 4GUAA 4PRYA 2Q1XA 2AT1A 2XOXA 3HUDA 1XRRA 1Y6QA 1T9CA 2BRUC 3NRWA 4UHKA 4NJMA 4B2PA 1SIOA 2A0XA 4GBED 4E14A 4EKIA 4H3HB 1U9IC 1PR3A 2HLDD 1XK6A 3FTEA 4KNVA 3DJFA 3A6EA 1P3JA 4RTLA 2E2WA 5L45A 1DEXA 4YXMA 5D5HA 1C2TA 3GHHA 3W2HA 4A5OA 4D43A 3THRA 4RSHA 4XUEA 3VSDA 1X0XA 4ZOHC 4RVCA 3BEDA 3OBIA 2OSBA 5TF0A 4M0MA 4R7TA 1ZBDA 3UJ6A 2ZB3A 3USZA 4UQGA 1P8AA 1XHFA 1ODFA 3OUTA 3GPDG 4ZVNA 1GQYA 1HYBA 5I7HA 3Q2IA 3DBVO 4BNIA 1KBZA 1NDQA 5REQB 1DUSA 3DBHA 1G3QA 3AGPA 4X41A 2XGOA 1I6KA 1ODLA 2CD7A 4C0SA 4BNDB 4B3GA 4JSTA 5KL8B 4DCOA 4YP3A 3QLUA 2OV2A 4JHLA 3WL3A 4HADA 2JPDA 2GEDA 4EJSB 3BCRA 4HS4A 2HT6A 4PPGA 4RF2A 3NT5A 1QGOA 1ZI8A 3TQHA 3QYJA 1MH9A 4J49A 2GN8A 1BPDA 3MABA 2VBIA 1JDZA 2CL7X 2Z98A 4YQEA 2YNMD 2BCUA 1GEEA 1R66A 1TK8A 1G63A 2PGAA 3PUHA 3G5UA 4ZYYA 1WQ3A 3WNDA 3QVWA 3EZ6A 1UMCA 3T9EA 3H9CA 1TB4A 3OX1A 2BEJA 5K01A 1N62A 1P0CA 2GZ3A 2CN1A 4OJOA 5J0TA 3V4SA 4ENTA 1VPEA 1M6EX 2LTAA 3HCRA 4LGYA 2V4QA 2EZYA 5J0UA 9ICEA 4G09A 3L0IB 5ICFA 4XDYA 2RHWA 1Y48E 4IS3A 1S7GA 4DQSA 5KYYB 3O9ZA 1CUBA 3H5OA 2QPAA 4B6JA 4G26A 3DDSA 4DKXA 5BSMA 4NU5A 4P4SB 3CZPA 1SRRA 3EWIA 4FT2A 2EZ8A 1KI9A 3C1TA 5AUPB 1NZPA 1MAHA 2O2XA 3RD5A 1MSWD 1HZJA 2ATXA 2WPNA 1SVMA 1IOLA 3T1HB 5H59A 3LDGA 5A2QA 4GZLA 4D97A 4N6GA 3GUCA 4A6XA 1XT6A 2CDRA 1ACLA 5U4XA 2I5HA 5F2KA 4JEHA 4M1EA 2KM1A 4OSOA 3RK0A 2NGRA 4F9FA 5LZ8A 3CS3A 3EZ2A 3O1LA 2H00A 1J0DA 3GRVA 2NVWA 1VP3A 1QTRA 4DCCA 1JIJA 2P9HA 2C2WA 4H7EA 3WGHA 4O29A 1R8XA 1KYVA 2ANCA 1AS2A 3T9CA 4DQIA 4O3NA 4MTCA 3RNOA 1U0BB 3CYFA 2WZCA 4PINA 3QEMA 1QH0A 7ICQA 2FZEA 4ODIA 3F4BA 1LTHR 1N0WA 3OLVA 1EVJA 1JMKC 5KOHB 1NULA 2C2YA 3VPCA 4U63A 2A30A 4E2YA 1CJMA 1A69A 3PL1A 1YIOA 2BZFA 2J4CA 4KR6A 2QRZA 4EPVA 1W6RA 1FXUA 1CUWA 4QATA 1QGUA 4UFOA 3WLKX 3WK5A 2EJTA 5IU6A 1R16A 4F50A 3K53A 2VF4X 2PV7A 1J2RA 3TADC 1LTQA 3FNEA 5LA6B 4M99A 1N7JA 2Y0EA 1U7OA 2HLHA 3UPDA 5FWYB 1CRWG 1UBEA 2FXVA 3HB5X 1F6BA 1E96A 5AK4A 1PIWA 3UMJA 3UJ9A 2JVIA 4JN6B 3PT5A 2J3JA 4F60A 4JB2A 3IUBA 2QAGA 1VL1A 1E1KA 4HBZA 5HZKA 2SNIE 5FTLA 5KNBH 2IWRA 3GRUA 1OBOA 5EAIA 3L84A 2VEOA 1RWBA 1H9AA 3EN0A 4C0WA 1SUIA 4IHJA 3OF3A 1EXDA 5IZ4A 1L5ZA 1HURA 3F5QA 1K89A 4LXUA 3C3DA 4GBGA 3QELA 4JT4A 4LRWA 1CHNA 3QSGA 2OHFA 2AGPA 2QX4A 5KTTA 3ZHTA 4XQCA 4DKJA 1U3GA 2PKWA 3R9KA 1I13A 3D2LA 1L3BA 1NXOA 4BWYA 3WSWA 3VJMA 3G2MA 1PDWA 1LTKA 3T5KA 3V3TA 4ZIRB 3O7MA 3C3BA 4DA7A 1SCUB 3CUUA 1T0IA 3ROMA 1X13A 3OTOB 3TEMA 5KTKA 1PP4A 1SHJA 2E1EA 1P60A 2QRNA 1LLFA 2E5SA 3GDHA 2OWOA 3PE4A 2EG9A 4FEGA 3AU8A 3MLEA 2DLCX 1H2ZA 3KDSE 3M6WA 3GEHA 2EP8A 3RRJA 3C1OA 3TI9A 4L8VA 5IARA 4YMUA 1MAVA 1TQ8A 4U0KA 3K9QO 4D4GA 2MSDB 1RXVA 3S1LA 1XDWA 3SYLA 3OJXA 5KSYA 4I3HA 1EESA 1P75A 1JRLA 3IILA 5DBCA 5KJ1A 3ELUA 5FFFA 1G20A 5ALJA 4DJJA 4Z99A 3SQIA 4LFCB 2PMZF 4GT1A 1RFGE 2YJTD 2W8BB 1DKNA 1GL9B 2LZ0A 4XDHA 2Z9BA 2JZBB 2C28A 4MWBA 3FGZA 5DTMA 4CLHA 5KOIA 3TZ6A 2C2BA 5CVTA 5KTMA 5G4KA 4PZCA 4PYNA 4ZVVA 4U0JA 5IAAA 3HV0A 3VO2A 1FP1D 2CXPA 3OAAD 2OXFA 4AECA 1ZQUA 5IEBA 1S3GA 1BX3A 2ZCJA 1T36B 3RASA 1JVBA 1YZ7A 1AH2A 3KQTA 3KB6A 1CG6A 5TMBA 2DLNA 2H52A 2H1CA 2KG5A 2Y0SC 5IDYA 2I91A 2KMDA 2AF3C 1YVEI 2B2XA 2AJDA 3M81A 3CLRC 2W6ID 3D6FA 1DK3A 3IV6A 1UXOA 1XTTA 4O4IA 2EEZA 5JXJA 2F3PA 4XWWA 3EUB2 1H6BA 4MR7B 2A5GA 5AUOB 1H1LB 2BMVA 4NBNA 1DIRA 2ZAIA 3CVWA 1CR6A 2JLAA 4EB3A 1AROP 2VDRB 5HM6A 1QDLB 2V9ZA 3EEYA 1WLYA 2WBLC 3C8UA 2XNSA 1B14A 2A5JA 1KSHA 4OVKA 1WMSA 3HW8A 2H9IA 5A0TA 3P2YA 3LU1A 5IC4A 2BD0A 2XYVA 3ORQA 2ZRLA 3R7BA 3L3BA 3PFHA 3SHFA 1QZTA 3RUPA 3EH2A 5F3WB 1JB9A 2WIKA 3VGJA 2QLMA 3W78A 2VJBA 3KXPA 1VPVA 3MTIA 3BS4A 1B8UA 3IXMA 5LA6F 5EQDA 2AR7A 3I4FA 2VPQA 1UDRA 4MS4B 4BO5A 1G5HA 1BN7A 3K0FB 4DLKA 3UMGA 2YXEA 4PGGA 5EHNA 5EFZA 3GFGA 2PD6A 1UCVA 3VPAA 2DUYA 1S7CA 4QOIA 1GTG1 2QP4A 3VKFA 4ETMA 3OIFA 4BLWA 4UTNA 4NXMB 3A1DA 2B7BA 4X1KA 2WD7A 5G0SA 3UK0A 5HG0A 4PL2A 1M10A 3AT1A 1ATIA 1XPJA 2WUEA 4IMPA 1HLPA 3IOMA 4NNPA 4XYLA 1DXSA 3RS4A 3JS5A 2PH3A 4IWYA 4IJ6A 4WSOA 4KLNA 1IB0A 4MDFA 2QLTA 2V4RA 4KI0A 2VPPA 1Z35A 4KPFC 2W3SA 3QU4A 4HQ0A 4MV1A 2GEVA 4WD3A 3DKIA 4YHBA 3V48A 5CCEA 2P9TA 5IN4A 3CF4A 1F2DA 3IV9A 2BUBA 1KFJB 1I3MA 4PPQA 1QHFA 2H0RA 4X8LA 5TPWB 4E3WA 3LY5A 4L76A 1MEEA 4FNGA 4IQTA 3HEBA 1WVMA 4IZOA 3EH1A 3MBOA 1I5OA 1TXGA 2TSYB 1M1UA 1A77A 3A9UA 1SVWA 1MRSA 3RVLA 2R65A 5C51B 4D9FA 1FFDA 2XHZA 3RC3A 1OC2A 3OZFA 1JIVA 1NUAA 3GVHA 1OH6A 1NI3A 3V34A 4RVOA 5E1OA 4DMGA 5JATA 2XB8A 3THVA 1P9NA 3LUCA 4X1YB 3WIBA 3WJ2A 4C7KA 2DQSA 2HH9A 5KSWB 1NR7A 1MJGA 4RMGA 3AL0C 2JIOA 1BHQ1 2XJ9A 3AZQA 1THGA 1G6KA 1FLAA 3NEJA 2E4WA 1L9XA 2NXWA 5ERYA 4DF3A 5BSWA 1GDHA 2HIAA 3KU1A 1DWUA 1J23A 1M8JA 1MQAA 3KJZA 5B5EU 1F7UA 1T26A 4G0QA 4Q4CA 4D4HA 1H85A 3I83A 3N75A 3WLSA 2ASLA 2HA6A 4LZDA 3CPHA 2H4HA 2Q6TA 3K1YA 3GHYA 3JWGA 1PJLA 1PL8A 3NO4A 1G21A 2RAUA 5IBCA 5KFEA 4NFLA 1SMKA 1PU2A 1DC7A 2ETVA 4NZ9A 5CM9C 8ICWA 4N54A 4QU9A 3LPDA 1TMKA 4KSBA 1QIIA 5BMVA 1Z68A 1SIWA 2H85A 5MN5A 3PUWA 2DRIA 1UDBA 3WLJA 3O0DA 4AWAA 5IIMA 2DT5A 2O5RA 5KQSA 3LC2O 1O4VA 2J9RA 2Z58A 4AT1A 5KL1B 2ZU6A 3MGBA 3EHEA 4MJ7A 2VS1A 2Y3IA 1XN4A 4Z6KA 3K70D 4BXOB 1E4YA 4EELA 2V7XA 4Q1VA 5A71A 4PTZA 5FR1A 2FMHA 2XODA 2VP5A 1CE8A 2CHUA 2QDKA 2O0JA 4JGBA 3HWTA 3CRNA 5THQA 3DHNA 1GPMA 1NWCA 3R44A 4GIBA 3V1MA 2XF8A 2ZM5A 4LMBA 1RP7A 4EMTA 5AQEA 3THWB 3MD0A 4UXJA 1SVLA 1CZOA 3VPFA 4UTRA 4XLZA 4YP7A 3HL0A 4RT2A 2DP4E 1RPAA 5IC5A 3ZGYA 3OEHD 1A8PA 5FAXA 4J3FA 1VL0A 3UT5B 4P0PB 3K5HA 4GS5A 4C7ZA 1NW9B 4KXNA 2H1WA 2H4JA 4LF8B 1W2HA 1W0KA 4BWFB 2VCEA 1V2GA 4QQNA 4R1MA 4OHVA