2HHWA

Ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhwA01
1X2IA 5CP2A 4KI6A 1C7YA 5J29A 1RZTA 1MSWD 3LAMA 4GVMA 3S3OA 3HVRA 1B9FA 5J1EA 4FJKA 4Z0UA 2UVWA 2W42A 5HLFA 2DTUA 4M6WA 4KLHA 5KFVA 5FDLA 4DTJA 4ELTA 4E7LA 3C2MA 3L8BA 2HW3A 4B9MA 3H8SA 4QZAA 3SUOA 3QEPA 1NJXA 4I9QA 4RUAA 7ICVA 3RB0A 3OGUA 4O3SA 4KHWA 4EP4A 3ZT1A 4FBTA 1W0HA 3JPOA 3C21A 1QE1A 4B9UA 2G8IA 4ED7A 3JYTA 3DYAA 3P83D 1NK8A 1RBTA 4YMMA 3MXMA 2HHQA 4M9HA 3PO4A 1ZBLA 4FLYA 4RG8A 1XSPA 3OS2A 4LSLA 1BPEA 4PUOA 2ZQBA 1VSIA 4E1MA 4F5RA 2D5RA 1TKTA 4Z6DA 9ICFA 4FLVA 3OS1A 5J0SA 5J2IA 2NUBA 1Z26A 4RNOA 4GW6A 4CEZA 2W8KA 4NCGA 4YQWA 4QZFA 4KHQA 5KFQA 4IFVA 1ZQYA 4M6WB 4I2HA 9ICJA 4F3TA 2J6SA 1RTDA 4CF8A 4PY5A 5KFRA 4O44A 3DLGA 2BCUA 1SKSA 2G8KA 4J9QA 1WSFA 4KV8A 1BPYA 2XY7A 3TAEA 5DB7A 7ICPA 1S6QA 1JXBA 3TR8A 4M3TA 3CG7A 2FLNA 3M9MB 5CYQA 3C2LA 3VQ7A 3HO1A 3QE9Y 5KFXA 1BQNA 2C22A 2X6NA 2WTFA 4IBNA 3MECA 1C1AA 5KGXA 2LYHA 1S1UA 3IAYA 1HMVA 2P1JA 3ZDBA 4J9RA 3JPTA 1LAVA 3OYLA 2F8SA 3HPHA 1EXNA 4Z6FA 4TQRA 4DSEA 2OPRA 3JPQA 1UOCA 3MR2A 4HTUA 2W9BA 2BE2A 1NOZA 3EYZA 3HXMA 8ICAA 1B9DA 5DB8A 3LP1A 2QKKA 4RQ8A 4PHEA 4ECWA 4I27A 3RJEA 2ZJ8A 4NLGA 4MQ3A 3IRXA 5DB6A 4JRPA 4CEFA 1HYSA 5DG7A 4MFFA 5J0YA 2YHBA 3G6XA 1BL3A 5J0TA 1H38A 5J2HA 3WNGA 4AH9A 3OHBA 3NGZA 3SUPA 1TV9A 4BWJA 1U49A 1CUKA 3ZT0A 3VN5A 3MXJA 3LDAA 4F4ZA 3S3NA 5DKWA 4RZRA 1EXQA 1BHLA 2MUTB 3B6PA 2A1JA 3ZSRA 1KCFA 4ECRA 4IG0A 3C6UA 4RQ2A 3QEVA 3NGDA 4ZTFA 2FMPA 1ASUA 3V9XA 9ICWA 3BQTA 4CECA 5HP4A 3PVXA 3UPQA 3Q8MA 2PZSA 3C2KA 1VSLA 3EPIA 1KFSA 3QETA 8ICYA 3C5GA 3LP3A 4DQQA 2W9MA 1JXLA 3HPGA 2NRZA 1MQ3A 4DSFA 3PX6A 2G8HA 4QAGA 1IH7A 2I9GA 1NK9A 1MQ2A 4MEXA 4AHUA 4R8UA 4IR9A 1BQMA 1UT5A 1SV5A 1HUZA 3DM2A 9ICAA 4ED0A 1U04A 1QSYA 3T5LA 3PX4A 3ISBA 1R0AA 3PW0A 4EBEA 1VK0A 2PYJA 8ICRA 1JN3A 4J9KA 1GOAA 4KLQA 2R7YA 2P5OA 1L5UA 3JPNA 5IIMA 4RQ6A 3KLFA 4ZHRA 5HHIA 2BPCA 4I2GA 4B9NA 4YFKA 5CY4A 3QIPA 1DOQA 2ZUBA 1EP4A 1Q9XA 4DOBA 3HJFA 5KFHA 1WSHA 3BDPA 3L3VA 3GV5B 1ZQIA 1RBUA 3K5LA 4DL3A 5KG2A 1RXWA 1BCMA 4TURA 2FBVA 4I2IA 3QEXA 3L2RA 5HRPA 1LWCA 1VRTA 4DMNA 3N4MB 2OA8A 4HVJA 4DTSA 2HHUA 2XO7A 1S76D 3D0PA 3LZIA 3Q8KA 5IIJA 1SL0A 2R8IA 8ICTA 4QZHA 1RYRA 1CZ9A 3RMAA 4BDPA 1RILA 2KFZA 2C2RA 1BPZA 4OGCA 3HP6A 1K1QA 4DL2A 4M9GA 4UB3A 2PFQA 3OSPA 5JUMA 1RTJA 3LANA 2BCVA 4YG2A 4J9LA 2Z1HA 4KLGA 5E41A 5KT2A 3RH4A 3VQCA 4I2BA 3V6DA 3T5KA 2D0CA 5FRMA 1JXEA 1NKEA 4NYNA 4FJJA 1SL1A 9ICLA 3OS0A 3KTQA 2IDOA 2VWKA 4DL7A 3SUQA 3GQCA 4O3PA 3UQ0A 1O1WA 3MR6A 4AHRA 2C2EA 1RT1A 3KHHA 3KHGA 1B22A 4KTQA 5CZ2A 4UQGA 1TAQA 4HCBA 2ATQA 1BPDA 3HW8A 3AVMA 1COOA 3VQQA 7ICUA 3ZD9A 1ZQNA 4JV0A 3EZ5A 3L2WA 3OYNA 8ICUA 4J9PA 1BIZA 4H4OA 2C28A 3AVFA 3GIJA 4FJHA 3ZSYA 4JK1A 2HVHA 3RB6A 7ICOA 4RW4A 3SQ4A 3CFRA 1ZQMA 1NK7A 4B08A 2IHNA 5L9XA 3K59A 4W5TA 4KTWA 4M3XA 1WCLA 1C0MA 4BE2A 3QEIA 1ZQUA 3MFIA 3M9OB 4IQUA 1JLCA 4NYFA 4FLWA 1U45A 4BACA 3NTUA 1YTAA 5KG5A 3M9NB 2PI5A 1K6YA 2IBKA 4KAZA 2ZJAA 8ICZA 3CQ8A 2XCPA 1HJPA 1WSIA 5KT3A 3NBPA 2BR0A 1RXVA 4GXKA 2DPIA 3Q8QB 2BHNA 2R8JA 1NOMA 2VA2A 4W5QA 5CR0A 4E0DA 4TUQA 4JUZA 1TGOA 3RH5A 4Z4FA 5TZVA 2ATLA 5F9NA 7ICFA 3I0SA 1BPBA 3BQ0A 2NRWA 4FJIA 2E6LA 3QEAZ 4MF2A 5HRSA 4DO9A 4E19A 4O3RA 3PW7A 1K1SA 3IHQB 4K4HA 4KLLA 4FJGA 2IC3A 3T3FA 1C0TA 1TL1A 3SQ0A 2BANA 4O5BA 4DWIA 3DOLA 3KD1E 2G8UA 1NK4A 4HCCA 1ZQZA 2HNDA 4BE0A 4O0IA 4QZGA 4G1QA 3EY1A 3CM6A 3KD5E 3QLHA 2VG6A 1ZBHA 4CEQA 1EKEA 4R8UB 1MC8A 1L3UA 3TAPA 3C23A 4PH5A 1RBSA 4E7KA 2V4RA 3VQBA 2ETJA 4FK0A 3MEEA 4TSXA 2HHSA 5KFGA 4F91B 4ECSA 4F93B 2AGQA 5KTQA 4DS5A 8ICXA 4CHOA 4DSLA 4ED6A 2VA3A 2Q3SA 1JLGA 2GBZA 4R5PA 4HHTA 4K8XA 4YP3A 8ICCA 4OVLA 4CJVA 3NDKA 1Z3EB 4Q43A 3MABA 3AVHA 2IMWP 3ZSVA 4PGYA 4DL5A 1C0UA 3AVIA 1U9LA 4CHQA 4C8KA 3L2UA 4F5QA 4DTXA 4M3RA 3SQ2A 4EEYA 2HVIA 3WNEA 5CYMA 1G15A 1WSJA 3IM1A 3DRPA 1B92A 4RUCA 2Z1GA 4JS5A 4ECYA 2B5JA 1ZQRA 4ED3A 3RAXA 5C5JA 1ZJNA 5CWRA 1Z25A 3AO3A 2P66A 5DK5A 3SJJA 2KZZA 8ICEA 2P6RA 3G0ZA 5C42A 4CERA 3QNNA 4XQ8A 4O3QA 1C1BA 2FC0A 1WLJA 1BPXA 3E2EA 7ICIA 4JV1A 3KLIA 4ICLA 2IHMA 4IRDA 5KFSA 3RH6A 5KRTA 4IG3A 1S9EA 1ZQPA 3AUOA 2GV9A 4M9NA 4CFAA 3ZSQA 3GFKB 2O4GA 3NHGA 3MFHA 1KFDA 3OYDA 2DPJA 2PFPA 3LP0A 7ICRA 1X9MA 2BQ3A 3HX0A 3RMBA 5J2QA 2AGPA 4UAWA 4RQ3A 1ZBFA 8ICMA 3OYMA 3RAQA 4P4OA 5D4BA 1QSSA 2Y1IA 3AA2A 4I2CA 2YKNA 1AROP 3QINA 1UWBA 3ULDA 4FJ9A 1S77D 3MR3A 2DFFA 3T19A 3HYFA 2FPKA 5DGAA 3C6TA 4M3WA 3HSTB 2FPLA 3OYHA 4F8RA 4DLEA 1S0OA 7ICHA 4CF9A 5KG1A 3PO5A 3N97B 3AVCA 4J2DA 4CIFA 4BGDA 7ICTA 4G3IA 3VA3A 1S5JA 1JX4A 3HM9A 2A1JB 4KLEA 1FXXA 1LB2B 1KVAA 4M9JA 3T5JA 1JL1A 5DLGA 2FPMA 2RDJA 2FLPA 4CF2A 2Y1JA 3G6VA 5FROA 3UQ2A 3SQ1A 4YXMA 4CHNA 8ICSA 2RF2A 4B9VA 4QCLA 2FMSA 4DLGA 3MEGA 5J2EA 1BCOA 5DDYA 1D9FA 3KLGA 1RDBA 3CFOA 1RT2A 3Q8PB 1CEZA 1KVBA 1TKDA 2JLEA 4YR3A 3T1AA 3BQ2A 4EBCA 1ZQQA 4Y1DA 1MU2A 3VQ5A 5EWEA 3S9HA 2JGUA 3RRGA 1DLOA 4XRHA 9ICCA 3TQ1A 4FZXC 1T05A 3EWAA 2OPQA 4MFBA 1CXQA 2IS3A 1L3SA 3ZDEA 1UA0A 5D46A 3K58A 1VRUA 1VSKA 5KT5A 3QO9A 1J5OA 3MR5A 4FYDA 9ICUA 3H7IA 4M41A 3DLKA 4HUEA 5C25A 4JRQA 2D0BA 4CHPA 4NLNA 4XUSA 5SZTA 8ICKA 3O3FA 4FJLA 5JS2A 3RJIA 4B3OA 4ZH4A 4FS1A 8ICQA 4QW8A 2HHTA 1XHXA 4I2DA 1KLNA 4CJ4A 3PMNA 5J2DA 1GOBA 2YNGA 1NJYA 4KLUA 2OWOA 3F9KA 1IKXA 3K5NA 1WSEA 5KRSA 5KI6A 9ICGA 1A5XA 1ZQVA 2ZUDA 3JPRA 3OJSA 3HT3A 4BXOB 2YHAA 1RTHA 3LZJA 2VG5A 4CGFA 4F5NA 3QESA 2J6UA 2V9WA 4JWMA 3MBYA 1TL3A 3MDAA 5D3GA 3K4GA 2MUTA 1T3NA 5F9LA 4O4GA 3QZ8A 1JL2A 5KFMA 4FXDA 1T03A 9ICEA 1KEJA 2FBXA 1ZETA 2XY5A 4PWDA 4YR0A 2PYLA 3H8WA 1XC9A 5IIIA 3TI0A 3H08A 1ZQLA 4YFUA 1TAUA 4TQSA 3C95A 4IQVA 3PR5B 5C24A 3SV4A 4KLFA 1ASVA 2X74A 1IKVA 2G8WA 2FMQA 3PMLA 4Z6CA 5K14A 4ID1A 5J0XA 3CYMA 2E6MA 2IA6A 3AA5X 1SKWA 1KVCA 2R8GA 3ISNC 8ICWA 3OHAA 4CGDA 4I2JA 1ZQSA 2UVRA 1BVSA 1J9AA 3OYEA 3LALA 1A76A 3MAQA 2KZMA 4CF0A 3V1RA 5J2BA 4M45A 4KN7A 5L1JA 2JEFA 2P5GA 3V7JA 3LP2A 4OLBA 3ASMA 4ECTA 3DLHA 4CJ5A 2DFLA 3ZT3A 3KHLA 4FW1A 4JLHA 5J2KA 1TFRA 4RNMA 4DSIA 3PUFA 5KT7A 3UXNA 4EBDA 4O9MA 3PY8A 3VQ4A 5DMRA 3PW5A 1I39A 4F50A 4Z4GA 1TK0A 2VG7A 1S0VA 1XU4A 5DBAA 4CJ3A 2VA8A 5KT4A 4DQIA 1SL2A 4R64A 3PV8A 2YNIA 4CJLA 2XGPA 2B4JA 9ICMA 4YMOA 1HUOA 4DTPA 4UB5A 1HNVA 4CK3A 1ZJMA 5EU7A 4O55A 3TANA 3DRSA 3RBEA 3PNCA 4IQWA 3RTVA 4MEYA 3LK9A 3PW2A 3S3MA 5CHGA 2BCRA 4I2FA 3Q8LA 1PZNA 4C8NA 3TWHA 4F3OA 3TFSA 4CCHA 4GMJB 1U4BA 3V81A 3AA3A 1X1PA 4PPXA 4O3OA 3RBDA 3AA4A 3AVBA 1ZQHA 4F4WA 4FJ8A 3Q8RB 4J9SA 4C8OA 4B9TA 2Z1JA 4CHYA 4FLZA 1RT3A 3E01A 4CFBA 3NFAA 5J2CA 1D5AA 3AVJA 4DU1A 4QWDA 1C1CA 4FZYA 4DU4A 1J54A 4YMNA 4JWNA 5J2PA 2VANA 1S97A 4RQ1A 3RRHA 2Z1IA 1RDCA 2XY8A 2D0AA 3ETLA 1HRHA 4LY7A 5I3UA 3WNFA 1DTQA 5KFJA 4KHNA 2BCSA 1ZQBA 8ICPA 3ISDA 3IS9A 1WCNA 4LH4A 1S1VA 3L2QA 2BKEA 1S1WA 4N41A 3K57A 5KFTA 3V9SA 4X5VA 3RJJA 4NY8A 3OY9A 1S10A 1UAXA 3VA0A 8ICGA 3VQ9A 2RDIA 3AO4A 2JEGA 3DI6A 1RDDA 3KJVA 4HUGA 1RTIA 7ICKA 5EOZA 4ID5A 2GUIA 4EP5A 4QZ8A 1VSDA 3GV8B 5DQIA 1TK5A 3U6FA 1LV5A 4DOAA 1T8EA 3BJYA 2JZBB 4CK1A 3V4IA 2ASLA 5J2NA 3RJKA 4IKFA 4I2EA 3OYBA 4AILC 8ICFA 2JEJA 7ICLA 2PI4A 3K75D 1RT4A 4F92B 4B8AB 4QZIA 8ICJA 3KK2A 4CFCA 1DGSA 3EPGA 5KG0A 4W5RA 1BI4A 4QWCA 5DDMA 5CJ7A 4M0AA 1NJZA 2ISOA 2F8TA 4O3NA 5JS1A 2I5JA 1FKPA 1FKOA 3UXOA 4IR1A 4N5SA 3NCIA 4DOCA 1BIUA 1FK9A 4FJ5A 3F73A 7ICJA 4F4XA 1TV6A 1IM4A 5KFOA 4P2HA 1ZQDA 4L8RB 3NGIA 3FYHA 4DTOA 2A1SA 4CESA 3KK3A 4DQSA 3U3YA 4E7IA 3B0XA 4DTRA 5DQGA 4DFJA 4CJSA 4KLIA 2PY5A 2B21A 1KSPA 1Q9YA 3ITHA 2IGIA 5KG3A 3VQDA 3KLHA 1HYZA 3MEDA 2DFHA 5KG4A 5DG9A 3MGIA 3RB3A 4FVMA 4NLKA 5KFLA 4KB0A 3DLEA 3RJFA 3BGRA 5SWMA 4E1NA 3SUNA 2BGWA 4KHSA 3U3GA 4UB2A 3M8PA 5KFAA 4OKJA 3AO5A 3B6OA 4CJQA 2B6AA 4RPZA 4KO0A 3QEBZ 3ORYA 4OKKA 5KT6A 3KKSA 1U47A 4M9LA 1N6QA 3H4DA 3V9WA 4GC7A 3SYZA 1JIHA 2AJQA 4UAYA 1TKXA 4DL4A 2XGQA 3OYCA 4CIGA 4YD1A 1IKWA 5CA7A 3OYJA 3JPSA 1CZBA 4BDZA 3HL8A 3QZ7A 1W9HA 1F21A 2W8LA 1LAWA 4FJMA 4FK4A 4P4MA 2W9AA 4CJRA 3ZT2A 3SI8A 4XA5A 4TUSA 1EX4A 2PFOA 1T4GA 4UBBA 4ECUA 4CEAA 3HK2A 1X9SA 8ICOA 2BPFA 4KHUA 1IXRA 3SV3A 3LPTA 4BE1A 1CLQA 5KFNA 3CM5A 2KQ2A 4UBCA 4YD2A 1D8LA 3OSNA 1S1XA 1S6PA 4CJUA 4Z4CA 5IIKA 3RJHA 2UVUA 2M9NA 4R66A 4Q5VA 2ZJ5A 4H4MA 3RR7A 3M8QA 4KLSA 1TVAA 3TAGA 4DQPA 4GC6A 1RCHA 4ECVA 1ZQCA 3G6YA 4BWMA 3MXIA 4QWBA 4DFKA 1HYVA 2XRIA 1S0MA 5IINA 3UXPA 4ELVA 3P5JA 4J9MA 2HNYA 1HPZA 2BGGA 4CGIA 4DF4A 4LSNA 2I1QA 1LW0A 4O5KA 3K5MA 4YNQA 3SZ2A 4AHSA 4NXZA 2R8KA 4EZ6A 5J0OA 4W5OA 3TFRA 1I3AA 1JMSA 1NOYA 8ICHA 1LWEA 1KFTA 1ZQXA 9ICOA 1Y88A 3TAMA 3NE6A 5DB9A 4QZEA 1YVUA 2G8FA 4LZGA 3V72A 4LH5A 3NF6A 3GIKA 1ITGA 1RT5A 2O4IA 5DBCA 5KG7A 4E3SA 3RMDA 4RQ5A 1NKCA 3NF9A 3C1YA 2BPGA 1D8YA 4YCXA 4QZ9A 1ZQEA 4FLTA 3M8SA 3AO2A 5KFIA 1ZQOA 4NM2A 3C94A 3V7LA 2PFNA 1ASWA 4B8CA 4BDYA 9ICHA 4FM0A 3KHRA 4Z4IA 1ZQAA 1WAFA 2J6TA 3LAKA 1JLQA 1S1TA 4C8LA 5J0PA 2F96A 3NGYA 4ED1A 3LDSA 2G8VA 3L2VA 4EZ9A 7ICEA 1RBVA 1BGXT 3RMCA 3TAQA 4J9OA 2FLLA 4ELUA 1ZYQA 2YNFA 4WE1A 4CGGA 4CK2A 5J2FA 1JKHA 1RT6A 3H4BA 4KLOA 3QEWA 4PQUA 4ZTJA 5KGWA 3V9ZA 4I2QA 4CJFA 5HP1A 2RN2A 4PA1A 1NJWA 2YNHA 3MGHA 4O0JA 1Z00B 3AVNA 1RDAA 5KFKA 3ISCA 4DEZA 3C5FA 1XSNA 5HHHA 4CJKA 1U48A 4FM2A 2AU0A 5DBBA 4DSKA 1ZBIA 5HRRA 2KN7A 4IRCA 2X6SA 3WNHA 3V6KA 3AU2A 3SNNA 4O5CA 4Z6EA 3D45A 7ICSA 1TVRA 5J0QA 5J2AA 3ZT4A 1C6VA 2UVVA 3VQAA 4P4PA 4FJNA 4F4KA 1RYSA 4FJXA 3V7KA 4GXJA 8ICLA 1UA1A 1DTTA 4DFPA 7ICNA 3P1GA 4AHCA 3ZSXA 4NCBA 2NRVA 5KFFA 3JPPA 3DRRA 4RW6A 2AQ4A 3ZSOA 5J0WA 3KKRA 8ICBA 1XI1A 3ALYA 4KB1A 4KMUA 4KN4A 1QS4A 2FBTA 3FDSA 4Q0BA 4Y1CA 2ZTDA 4DF8A 1NK5A 2LSNA 4FLXA 2C2DA 4FO6A 3MDCA 2IOCA 4KREA 4CHZA 4IFYA 4OJRA 1GOCA 3GDXA 3L3UA 4QZCA 4JV2A 5HMLA 3BQ1A 4KLJA 1Q8IA 2WOMA 3AVKA 1WN7A 1SUQA 5J2JA 4MFCA 3SI6A 3KLEA 4ECQA 3C1ZA 4FK2A 1ZQTA 5DLFA 3GV7B 3OYIA 1RT7A 9ICRA 4QWEA 4B9SA 3ZSZA 3KK1A 4OKEA 2JEIA 1VSHA 2DFEA 1YTUA 3VQPA 4E89A 4NCAA 5KFEA 1ZQWA 4RQ0A 2H5XA 4IRKA 3PW4A 7ICQA 4JS4A 4I29A 2OZSA 8ICIA 2ZUCA 1S9FA 1KLMA 4I9LA 4J9NA 4KLDA 5HMMA 1VSMA 2AQ0A 3DLBA 4RW7A 4QOZB 2OPPA 3AVAA 2F1HA 4CEDA 4KLMA 5EWGA 2VWJA 5BPCA 3PR4A 4FJ7A 4KHYA 4F4YA 4Q45A 4UB1A 1REVA 1IG9A 4CJWA 4B9LA 4J2EA 3I8DA 3SCXA 4C8MA 2HHVA 1X9WA 4LZDA 3RWUA 1S0NA 3FFIA 2XC9A 3TARA 5HROA 1UT8A 4CGJA 1WNSA 4N56A 2ALZA 5KFBA 3RJGA 4K4GA 5J2MA 3AU6A 4PGQA 4E7JA 2EHGA 2W9CB 3KIOA 5KFYA 1KRPA 1HQUA 5KFUA 5FRNA 1HJRA 2EX3A 4FCYA 1A77A 1QLNA 5J0RA 4CE9A 4DTUA 4DFMA 4KFBA 4CJPA 5DG8A 2RPIA 3QNOA 3AO1A 4I28A 3NH1A 1WAJA 3GIIA 3O4QA 3RB4A 4XIUA 4RQ4A 4ECXA 5L1IA 1N48A 5KFCA 4AHVA 2P6UA 5KFPA 2X78A 4FBUA 1WSGA 3LWMA 4NLZA 2PXIA 3EW9A 4RT3A 9ICXA 4M3YA 1QQCA 4I2PA 4GLXA 3ZDCA 4TUPA 2NRXA 4CF1A 2OYQA 4CEBA 3T5HA 9ICSA 4CJEA 4FM1A 4DG1A 4UB4A 3V1QA 4W5NA 1KTQA 1LWFA 1Z00A 3HVTA 3ZDDA 4F5OA 4M3ZA 2ZTEA 5EWFA 4DQRA 1NK0A 7ICMA 5HNKA 4CIEA 4EYIB 2YKMA 4CJTA 3AVGA 1KDHA 1SZPA 2BQUA 3HP9A 2MAXA 1L3VA 4IDKA 2Q0ZX 3O3GA 5DGBA 1T7PA 3SPYA 3TABA 4RT2A 3V1OA 2KZ3A 3H40A 4ED8A 1ZQGA 4RU9A 4PHPA 4FS2A 3LPUA 4Z4EA 3QIOA 1JLAA 4F5PA 9ICVA 3HPOA 1NKBA 2XY6A 3I0RA 3A2FA 5KG6A 3ZCMA 3TAFA 7ICGA 4MFAA 5BOLA 1EETA 1XO1A 4Q8EA 4AHTA 4H8KA 4ED2A 2ASDA 4J2BA 4KKOA 4N76A 3OYFA 3JSMA 3DMJA 5L1LA 3AV9A 3QERA 9ICTA 3NF7A 4QWAA 4CEOA 3K2PA 2QK9A 3CFPA 4LD0A 5J2GA 3HWTA 2GWSA 2QXFA 3OYAA 2E4LA 1XHZA 1RBRA 4RPXA 1J53A 3GIMA 1XSLA 4DSJA 4RW9A 4Z4HA 9ICPA 2ISPA 2NRTA 1HNIA 4HUFA 4Q8FA 3O3HA 3NF8A 3NAEA 2QKBA 4FZZA 2RKIA 4OGEA 4F2RA 9ICNA 4RW8A 1Y97A 1ZBUA 4YVZA 1TK8A 4I2AA 4R63A 3LWLA 4KI4A 1RNHA 3OYKA 1VSEA 4OPJA 2ZE2A 1XWLA 4ECZA 2V4QA 1CXUA 2KTQA 1LW2A 1JLBA 5J0UA 1A5WA 3ZDAA 4YN4A 3V9UA 2HNZA 5CB1A 3V6JA 1QHTA 4RPYA 3AVLA 1V9PA 3GILA 4QZBA 3K5OA 2OZMA 4DS4A 9ICIA 4KITB 1ZQJA 4KLTA 2IAJA 1SKRA 4KTZA 4HYKA 3M8RA 3OYGA 2FBYA 1QTMA 5IIOA 4K8ZA 5BOMA 2F1JA 3VQ8A 4LVSA 1TKZA 5HRNA 4CFDA 1N56A 8ICVA 1ZQFA 1L3TA 4O5EA 3DLRA 2JZBA 5HBMA 4YXJA 3THVA 1VSJA 4EYHB 1RPLA 4M3UA 4Q44A 9ICQA 2HMIA 4M47A 4M42A 4DL6A 2BDPA 4E7HA 1B43A 3SPZA 5KFDA 5KFWA 2ZTCA 3PX0A 3IG1A 2AGOA 4KPYA 1BI4B 3OVNA 4PHDA 5IILA 2ASJA 1XS9D 4RNNA 4I7FA 5D49A 2XHBA 2W9CA 2R8HA 2YV0X 4GXIA 2BQRA 3G10A 4OLAA 4RQ7A 2OPSA 4FW2A 3NH2A 4YR2A 4M04A 2WONA 2F1IA 4PGXA 4CGHA 1D9DA 2HB5A 1IKYA 4DU3A 4K4IA 2BCQA 2HHXA 2DY4A 3H8JA 9ICBA 4QW9A 1S9GA 4NM1A 2KW4A 3Q8SB 2ITGA 3NH0A 3ZSWA 5L1KA 4N47A 2W9BB 1NK6A 1JLFA 2P51A 3O4NA 3V6HA 4MF8A 3VQEA 2A1RA 2KFNA 1YT3A 1A5VA 4R65A 4KRFA 4J2AA 4DTMA 1N5YA 5I42A 5T7BA 1JLEA 1VSFA 3UIQA 3DOKA 3VQ6A 1QSLA 4CEEA 5CZ1A 2HHWA 8ICNA 1BISA 3B0YA 4PHAA 4QZDA 9ICKA 1ZQKA 1HQEA 3ZD8A 4FLUA 3RR8A 4M2YA 5DQHA 4BXOA 2ZD1A 3OJUA 4UAZA 5KFZA 4F2SA 4OPKA 1IO2A 4IQTA 4DTNA 2XCAA
chains in the Genus database with same CATH superfamily
4CO1A 1C7YA 4I67A 3KK3B 1QJHA 3Q24A 4V19X 1YX2A 2DO4A 3HVRA 2D3O1 4FJKA 1OIAA 1GLCG 2W42A 3S1TA 4M6WA 2ADBA 1UEUA 4KLHA 4ZVRB 1ZTWA 4DTJA 3V5RA 3C2MA 4HEA9 2WOMB 2QW9A 3BGLA 3MX5A 4Z94A 3MOJB 1KS2A 2VKQA 4FNHA 3H8SA 2EZYA 1T0TV 1NJXA 1N0UA 4K7QA 3G6ES 3OTCA 4O3SA 4YORA 4EP4A 4XEIA 4B3TK 1M5HA 3GJQB 2DNZA 4F3MA 1QE1A 4ED7A 2F3JA 1VIXA 4FVCA 2XB2D 2MRLA 4M9HA 3PO4A 4RG8A 3IR6B 2E8OA 1OH6A 1MN8A 2F8HA 2ZOMA 1NZ8A 4PUOA 2KB2A 3O9TA 1IV0A 1WUUA 2ZQBA 1SGGA 5JMNA 3D66A 3O2IA 2ASOA 3JSMB 1L8OA 4PQAA 1TKTA 1I5OB 2DR8A 3SEIA 2ZVIA 3BO4A 4FWOA 2HCFA 3OS1A 1F9HA 1UVIA 3G8TA 2KP7A 3ZTRA 2V7ZA 4CRJA 3GYGA 2P9LA 5AJ3K 5D0RA 5KFQA 1ZQYA 5LY3A 3CMAN 2G0AA 3KUEA 1RAAB 1U8SA 3TKAA 4WYBA 2CG8A 4O44A 4BQLA 2D9OA 1WSFA 1NSPA 1BPYA 4ZVTB 3OL6A 3N6NA 1T94A 4PZNA 2EBGA 1JXBA 2WHOA 3TR8A 1OPIA 2FZCB 3M9MB 2QN6B 3CCSN 2RQKA 3HO1A 3VF6A 2C22A 1TV6B 2BH1A 3IBWA 2X6NA 1R8AA 1Z1VA 1TU0B 4ZJLA 5AQRA 2LYHA 4IG3B 1HMVA 2WTUA 2V52B 4RUBA 4DR2K 1KHWA 3GJRB 4RW7B 5B5EU 4PQUB 2NXJA 2BE7D 2OPPB 2G07A 4FOEA 1YJ7A 1VJ5A 4FPRA 4ZP9A 3WK6A 2HFZA 2XS5A 4DBQA 1UQVA 3SQGA 3T69A 1MDUB 4B9QA 3TVKA 5IT9O 4JKCA 3KK7A 2NXUA 5EX5A 2P9LB 1O8BA 2E8NA 4B1XB 2JC0A 1V9OA 3LP1A 1B9DA 3QU9A 4LF5F 1G4CA 1SV4A 4ECWA 5AKLA 4PHEA 4I27A 3OLAA 2PEBA 3IRXA 3WT0A 5DB6A 1Y5NB 2YVSA 1EB0A 1ZD2P 4CEFA 4HH1A 3CCMS 4MFFA 4FPAA 2YHBA 1BL3A 2QL7B 5J0TA 5J2HA 2IIRA 4AH9A 5G5HA 4UOFA 3MCSA 4WP3A 3L3CA 2B6GA 3D2EA 2F3NA 4OYXA 5M2RA 3MXJA 3R6MA 3ZZTA 4G1IA 4LF7K 1BHLA 2MQLA 2MUTB 5KOWA 4LRCA 2LBOA 3M8YA 1PJ6A 1KCFA 1V5IB 3R8YA 1MG7A 3VEVA 1Q7YO 3FLCO 1Y3JA 4BRHA 2FMPA 1N5WA 3MPDA 2Q43A 3UB5A 2VOOA 1JNRB 4D3GA 2R7QA 3MEGB 1VSLA 1PBUA 4OHYA 8ICYA 2BUNA 3DOLB 4PKGA 1JXLA 1MWMA 5J2NB 4BR9A 3D0HE 3KWGA 3LF0A 2GQCA 4ILGB 2CQ3A 1WI6A 4BC5A 5IV4A 5H1SV 5AI9A 4A8WA 3NBPB 4ZP8A 2P9UB 1CG2A 2YKQA 2E29A 2BJ7A 3CJTA 1BQMA 2KLAA 2JR5A 4NXMF 1NHVA 4UB8U 2ACYA 2OFHX 3CCLS 2AYBA 1U24A 3VZHA 2Q66A 3T5LA 3PX4A 3QIDA 5EN1A 3JSRA 4NI2B 2IAJB 1N62A 1C2PA 2YY3A 3MTJA 4RCHA 2YWEA 3F2KA 2P5OA 3U27A 4MDAA 2QMWA 3S41A 2DKXA 4RQ6A 4DV7J 3KLFA 1KOHA 3ZZUA 5BRFA 5HHIA 3LPYA 3W3DA 1UVJA 5BN9A 1U6FA 5HBMB 1PCAA 1DOQA 1SB3C 1IN0A 1Q9XA 4LJXA 2ZJPQ 5GMKa 3BDPA 1C1CB 3C15A 3W5YA 4BC3A 2MSSA 1RTDB 2YTCA 4TVAB 1RBUA 3K5LA 4BR4A 5B66U 1Y64A 1BCMA 4YN3B 2HKEA 2FBVA 2N1RA 4I2IA 3QEXA 5AKIA 1LWCA 5AI5A 1VRTA 3ONQA 2XI3A 1SC4B 2DHGA 4A8KA 1BQMB 4RUHA 4OJLA 1S76D 2N4DA 2RHKA 3N6LA 1RQLA 3MMAA 4OJHA 1CZ9A 1RILA 4TY8B 2HVZA 2CPHA 1P1TA 4K43A 2H3GX 3H2VE 4OI2A 2M8DB 5K5MA 3OSPA 5L8RC 5JUMA 1RTJA 4RNHA 2W2MP 2KHOA 4YG2A 4J9LA 4K41A 5E41A 2A19A 2X1BA 3VQCA 2IY5B 3FFIB 5D77A 2UXDF 1WG1A 1RWNB 2ZM6K 2DR5A 4DR4K 1RDFA 4WXOA 5CAAA 3OS0A 1TAMA 3SUQA 5J2PB 1M90T 5BJRA 1FRJA 1RT1A 1B22A 4KTQA 4PCQA 4ETXA 4UQGA 2ZH7A 3LDOA 4HCBA 2PMHA 1DTQB 1BPDA 1COOA 3ZD9A 1N33F 2K1RB 1QQ7A 4J9PA 4H4OA 4FO0A 1ULRA 1YRTA 4D3HA 5KPZA 3R8EA 3AVFA 4FJHA 3H0RB 4OZ1A 2O1PA 3MAAB 1M5PC 1IKYB 5D15A 1RQ0A 1OY6A 2GWJA 2V6AA 3WQTA 3FSIA 3CC4N 2FE9A 3QSIA 4TY8A 3K59A 4BR0A 1J5EJ 3L09A 1VQYA 4M3XA 1WCLA 1C0MA 2GX8A 1D3WA 1ZQUA 2BJDA 2OPRB 3DGVA 4UQTA 1DZ5A 2EZZA 3BSAA 4WZMA 3V4IB 4BACA 3NTUA 2Z56B 2HBQB 5KG5A 5DZ7A 3P5BP 2E5GA 8ICZA 3ILJA 4ZMMA 3UCGA 1FKAF 3CQ8A 1HJPA 5KT3A 4OIXA 3I76A 3GU0A 1KQFB 2MQOA 1VQMN 1WOSA 3RBZA 1YJRA 2BHNA 4C6AA 1IR1A 2D3UA 3SDEA 5CR0A 4LR8A 4E0DA 1S72N 4TUQA 3KVGA 3RH5A 2B43A 1KP6A 4IJNA 2WAQD 5HVHA 4JKAA 1QVFM 2H3IA 4DUZK 3PDNA 5D8HB 2HHHF 2DNQA 4K50A 3I0SA 3OFFA 5KL1B 4FJIA 2WBMA 3ZNJ1 4DO9A 4J5OA 2F76X 1BDGA 3NAIA 3BH7B 3PW7A 2RKIB 4K4HA 4FJGA 4DHYA 1N52B 2VKZG 3T3FA 1RM6C 4IS7A 2G2OA 2BANA 4O5BA 1D8ZA 3ITHB 3GIRA 4YOWA 2G8UA 2FHJA 2QYCA 5GMDA 3EXCX 2KL8A 3DLEB 2XWXA 1OH8A 2CYYA 3CM6A 1RAEB 1X4EA 5I3UB 2V68A 3C14B 3I96A 1EKEA 3KZBA 2KKVA 1SJ1A 1SC3B 4RJVA 3I56S 1RBSA 4E7KA 3VQBA 1WB9A 3Q8YA 2OPSB 1AW0A 4KJIA 2JH1A 1PKUA 1NM2A 2NNWA 3GPAA 4GV3A 3GP9A 1RP5A 5M2PA 2ZH8A 1JLGA 4Y2PA 3LP0B 2GBZA 5ALVA 4HHTA 3UDCA 4PYDA 4CJVA 1T6CA 4DR4J 4Q43A 4DV4J 1C0UA 3AVIA 5BPNA 3L2UA 2DISA 2IC3B 4ZVOB 1K8KA 2ZH2A 2LVWA 1G15A 4LFCK 4BGAA 3H59A 3AEVA 3F0NA 4H0OA 3N7RC 4IDKB 3IFEA 4NWBA 5EGYA 1YITS 2VGNA 1TFWA 1LFWA 3SJJA 2P6RA 4HAIA 1BA0A 3NEKA 2IM2A 2VODA 4BG8A 2Q3PA 3O1BA 1BPXA 1WF0A 4JI0F 3AFGA 7ICIA 3KLIA 1XK8A 4AM6A 2IHMA 5FLXU 4IRDA 5BN8A 2GGPB 5KFSA 1B7YB 2EK1A 1N0VC 4IG3A 1S9EA 3AUOA 2VFVA 5K8OA 2NO4A 4CFAA 5FPEA 2OEHA 1GXTA 2CH6A 1IBLJ 1GLLO 4ZOHC 4O4RA 1ECWA 3J7ZT 2P35A 2O8EB 2DT9A 3QFWA 1KQQA 2W41A 5AQTA 4N8OA 4KH1B 4B3SK 1DKGD 5J2QA 3PFEA 1SQFA 3RAQA 5SUHA 2AYEA 4JKGA 2QX0A 3FBCA 4BRFA 1QSSA 3LP1B 3AA2A 4HACB 2JSXA 2JWKA 1S77D 3OLBA 2DFFA 3NAHA 4P0QA 5AKEA 2BV3A 3O3LA 1WOPA 2CNKB 3HZEA 1KOOA 2RJZA 5DGAA 3C6TA 5B0GA 3OYHA 4W98A 5GAHU 5KG1A 4USTA 3PO5A 2RNEA 2DNYA 3MMVA 1MROA 2OTLN 2YQ3A 4J2DA 3ENHA 4FOIA 4YOVA 4FWPA 1JX4A 2A1JB 3WZ0A 4LF4F 1FXXA 2FPMA 2FLPA 4CF2A 4F71A 2Y1JA 3BDEA 1Y3KA 1R0BG 3UQ2A 4Y2IA 4YXMA 1F5AA 1ZA2B 8ICSA 3NWRA 2FJDB 3AH6A 3M30B 4I2QB 4US9A 3BV8A 2FMSA 3MEGA 2O5DA 1BCOA 4JKHA 2OYYA 1T3VA 5AI6A 6FD1A 3KLHB 4P7TA 1RDBA 3D2FA 2E2OA 4LSZB 3CFOA 1LWFB 1CEZA 3HSJA 1KBRA 1Q82T 2EEYA 1KNZA 2R7XA 2HFNA 3I6PA 1SUQB 3R7SB 1TKDA 2QTDA 1ZQQA 4Y1DA 5M1QA 2J5AA 2LEBA 3I31A 1T9XA 3AOCA 3VQ5A 2KKHA 5EWEA 2CA9A 2JGUA 2DBBA 3TZZA 1LWCB 2QXLA 3QJLA 2RHFA 4FZXC 3QBWA 2GC8A 1T05A 3E58A 1HFEL 2F8KA 1L3SA 3ZDEA 2C3MA 2LXFA 1UA0A 3PHTA 3H5XA 3J7YU 2XYHB 4K0KK 3K58A 1VRUA 1JJ4A 1Q82O 4AM7A 1CS4A 1VSKA 4FYDA 9ICUA 3FZ2A 4M41A 2ASPA 1IXKA 3W8GA 5C25A 3K9JA 1RHKB 4CHPA 1IQTA 8ICKA 2YQ0A 3O3FA 2VJ4A 1UEVA 4IO9L 2KN4A 4ZH4A 3QFUA 8ICQA 2HHTA 4DCHA 5L39A 1XHXA 4I2DA 4YDXA 3D2FB 2HHPA 4DV0J 5JJBA 1RWMB 2V94A 4LQ3A 2OWOA 2E5LF 2XLJA 4RWXA 2VG6B 3K5NA 2EAPA 1WSEA 5KI6A 3HZ6A 5HATA 3B8HA 1C1BB 2ZUDA 2VPYB 4DUYF 1HNWF 3HT3A 3BKFA 3N9UC 4EK2A 2YHAA 4EWTA 2VG5A 4UZCA 2ZBPA 1KDNA 1M5OC 2XVTA 1TL3A 5D3GA 2MUTA 4L75A 1JL2A 9ICEA 1KEJA 3C6AA 2HAFA 4HDHA 3DKDA 1VRUB 3UD3P 3NGUA 2PYLA 1YBTA 5HLFB 4YFUA 2WAQF 4H5NA 1TAUA 5I4MA 3C95A 2V2QA 4CM0A 4M1KA 1S99A 1N36J 4PXEA 3SV4A 3J7ZO 1T02A 2X1FA 2P9NB 1ZD3A 4DV2F 4MYTA 4K4SA 1XNRJ 2DH8A 3G71N 2X74A 1IKVA 2YNIB 2MB0B 3BO3A 4NV0A 4X4PA 2WVCA 4ID1A 2OJ3A 1BWFO 3CYMA 5H9EK 1SKWA 3IKMA 4O0NA 3SMZA 1ZQSA 3EN9A 3AQFA 2KZMA 3C3LA 1Q1KA 5F8MA 4MTPA 2CXYA 4M45A 3WIUA 3MGJA 1Q4RA 1EETB 4QS8A 4ECTA 2GTDA 4CJ5A 1BMQB 2JRSA 4LFCJ 2AXTU 2AT1B 4ANDA 2CKWA 4FW1A 4JLHA 3QUCA 5IWAJ 1GTHA 3PUFA 2KSOB 5KT7A 3WKCA 3JTNA 2VC1A 3VQ4A 3VALA 2PBDA 1E3MA 2DR7A 3QSYB 1I39A 4GIBA 1TK0A 1KL9A 4NA1A 1S0VA 2DBYA 2E20A 3J81j 1SZHA 5BPMA 4DQIA 1A6LA 3HHLC 2B4PA 1HUOA 4BS2A 1XMOK 3DDNA 2DNOA 3WXLA 4NA3A 4KAIA 4UTGA 1FFUA 3RTVA 4MEYA 3JSYA 4A2BA 3GSDA 2BCRA 4I2FA 2RRBA 2W40A 3Q8LA 1PZNA 2YMMA 4A8YA 3VENA 1U4BA 5U47A 2WCXA 3V2UC 3PCOB 3CJKB 2MZTA 5B08A 3KG4A 1FX2A 2X3DA 4NZ7A 3UVJB 1ZM9A 4DN0A 3WKAA 3NFAA 5J2CA 5K20B 2A3VA 1T9YA 1J97A 4QWDA 1C1CA 1L7MA 1IBKJ 4OI1A 2HBMA 1HNWJ 2KNJA 1S97A 4RQ1A 2Z1IA 4A4JA 5H9FK 1B4SA 3GFHA 2LQJA 3JSBA 4LY7A 5AKHA 4DPWA 1DTQA 4KHNA 3C14A 5ETOA 2BCSA 2K1RA 2JHEA 1JCEA 4GKKJ 4PKDB 1W7WA 3NXZA 3BS7A 1PBAA 1G3OA 3B78A 2WRMA 2NZ4A 4Q7AA 4MKBA 1S10A 1WD6A 2OPQB 4CZEA 3VA0A 1YVNA 3HHLA 2V4JA 1PK1A 5LJ5Y 3FZHA 2RDIA 4WE1B 1RDDA 3KJVA 1RTIA 1VQLN 3MM8B 4TNOA 2XM3A 4EP5A 4QZ8A 5D0HA 4JN4A 4MHVA 1NMEB 4Y2RA 1VYAA 4LF4J 3HSGA 2QM1A 2P9IA 1FNOA 1U7LA 2KH9A 5D4OA 4W4MA 5FPDA 2HOEA 2HOIA 2V0NA 2CPYA 4IKFA 3OYBA 4OZ0A 4CH0S 5B0BA 3TA2A 8ICFA 2JEJA 7ICLA 2YKNB 2VHGA 4NRTA 2KT3A 4F92B 1UVNA 1UVLA 3TUZC 2POKA 1PILA 3S6EA 4CFCA 2GQQA 2D3ZA 1DGSA 3EPGA 1OJ4A 3FFKB 3CJ1A 1RU2A 2XHWA 3SMPA 3MPVA 4CWBA 1E6VA 1N36F 5CJ7A 4M0AA 2FY8A 1VQ4N 3SDEB 3PYDA 5EY4A 2GGPA 2I5JA 4IR1A 4N5SA 3NCIA 1BIUA 2FUG9 7ICJA 3FNNA 5KFOA 2Y1LB 4P2HA 4V1Ak 1ZQDA 2EFNA 3NRZA 4L8RB 3OTOJ 2YCHA 3MM9A 5AQLA 4MJKA 1LKYB 2C2MB 4FWNA 4MK9A 5F8GA 1MA7A 4DX6A 4E7IA 1CI4A 3B0XA 4DTRA 1J6ZA 5C24B 2IGIA 3KLHA 1S1XB 2RH3A 3QWUA 1HYZA 2JGAA 2ROEA 3DRYA 2DNPA 5DG9A 4WQ4A 4HWIA 4FVMA 2OHDA 3EL2A 5KFLA 4E1NA 3SIPB 3W7BA 4UB2A 4W90B 5KFAA 3NGRA 3AO5A 2YKPA 3QBCA 1KN6A 3ORYA 1NZAA 2HGNA 3CJ4A 4ISFA 2HVDA 1U47A 2LDIA 3H5SA 1N6QA 2FGCA 1NBWA 4GC7A 2PE8A 2V63A 1RGVA 3DRSB 1I51B 1NWKA 3CC7N 5CA7A 1CZBA 3MGVA 3T41A 4JKBA 2ZUAA 3D3BJ 1W9HA 1F21A 2W8LA 1LAWA 2XZDB 2W9AA 1RAHB 4BRIA 1WACA 4CIOA 4BR2A 2AP1A 4ECUA 3HK2A 4CEAA 1LKYA 4OHXA 1X9SA 2EXUA 4FWQA 2AV5A 3VR1A 1IXRA 3J81Y 4K25A 2XS2A 4RX6A 1CLQA 4GRSA 5AQKA 3M6ZA 2VJ5A 3ED5A 5M2UA 4YD2A 1S1XA 2E5LJ 5IIKA 2M9NA 1XMQJ 4R66A 3W66A 3RR7A 4LRAA 4XDDA 5AKZA 1TVAA 3A5OC 1RFQA 1VQPS 5T41A 3UKUA 4PG6A 2GV1A 3H8YA 2OTLS 4ECVA 3MEEB 1YXQA 4A62A 8AT1B 5AQMA 5ALRA 3CE8A 1SV0C 3U1NA 1S0MA 2MGZA 4S0MA 1MNEA 4J9MA 1KLMB 4OJOA 1NEEA 3GCWP 2EBEA 4DF4A 4LSNA 2I1QA 1SBRA 3PXGa 1VGYA 5GAHI 4OI0A 1KONA 3K5MA 2HS3A 4YNQA 1TE2A 4JV5F 5B7WA 1REVB 3KNAA 1I3AA 1JMSA 1RCOB 1NOYA 1LWEA 3M3ZA 1ZQXA 4XK8C 2J76E 1IBKK 3K8VA 5IFMA 2G8FA 4B1WB 3SQIA 1L6NA 2VIHA 5LMNF 2HQCA 2MLZA 5KG7A 3CGIA 5ALYA 3NF9A 1HI0P 2V2KA 4YCXA 2BPGA 4CZCA 4QZ9A 3VCDA 1KXPA 3AO2A 1X4FA 4ZJOA 2UUCJ 1N32J 1DTTB 3PZPA 3KHRA 3Q8UA 5HVFA 5G4DA 2E88A 4ZP7A 1S1TA 4C8LA 1MMDA 2F96A 4OV1A 2K4EA 2G8VA 4WBFA 3L2VA 1WF1A 1YJUA 4MYUA 1NPKA 5JLHA 1RT6A 3H4BA 4KLOA 1BUXA 4LF4K 2O8EA 1P6TA 2R2TA 2MKHA 2A10A 3VZIA 3V9ZA 1TUVA 3MN9A 3D0IE 3OXFA 4O0JA 4WZQA 2KD1A 1Z00B 3BZQA 1WC0A 4YB1P 5M1FA 1NLVA 4LT6A 2J9EA 3TVYA 4I56A 4QIVA 4DSKA 5E7OB 2WVDA 2LQ5A 3WNHA 2XMTA 3V6KA 3MMJA 1MN9A 3VAFA 7ICSA 4EX7A 3TW0A 4ZCLA 1C6VA 3NVVA 3AB4B 1SJQA 3VAIA 2FHJD 5AKJA 5K8NA 3BSCA 3W1YC 4GXJA 4NXNK 2MLYA 1DTTA 3HF5A 1XNSA 4AHCA 5F2RA 2JJ4D 1TELA 1T9VA 2MZSA 2ZIWA 3ZSOA 2EK6A 8ICBA 1FF2A 2BYCA 3MTKA 2W3SA 3P31A 1X66A 3AT1B 1HEKA 5ETQA 1UEKA 4DV3F 3HVWA 2D1CA 4OYMA 4NLBA 2ZTDA 2ZWPA 4C0ZA 3THWB 2HF4A 4FO6A 3MDCA 3RRKA 2N4CA 4OJRA 4LR9A 3Q8VA 3N79A 4QQBA 4BRKA 2GVDA 4JV2A 4ZKAA 5KNIA 5J2JA 3GG4A 3H3NO 2Y8YA 4L3QA 2IMOA 3SI6A 4FK2A 5DLFA 3ET6B 3O9SA 1RT7A 3ID6A 3OA9A 1AZSB 2W43A 4NA2A 3SXLA 3LVVA 4ES2A 2JEIA 2IVNA 5C2DA 1VSHA 4ICLB 4GKKK 1SV5B 1PIEA 4L76A 2V69A 4EELA 3H1QA 1YJNN 2G0CA 4LIWA 2H5XA 1RBLA 2UXCF 2K8GA 4Y34A 4IRKA 1LOUA 7ICQA 2IM3A 1VIOA 4JS4A 2HNYB 1LVHA 2WF5A 2RHSB 1V97A 5HMMA 4K4WA 4TXSA 2AQ0A 4C23A 1QZ6A 2DO0A 1PAEX 2GHPA 2Y8WA 2Y3YA 5AJ3J 2ZJRQ 2VWJA 5LSLA 5F8LA 2RLTA 1RT3B 3CCVS 2ILZA 2PN6A 3AD7C 2YMQA 1IG9A 4B9LA 1GLFO 5AQOA 4C0BA 2MTLA 1S0NA 3FFIA 2VD3A 3TARA 3SSRA 3QYPA 3WK7A 3AGKA 3K0SA 3D6JA 2NSCA 3T1HF 1WNSA 3SR6A 2ALZA 4V19J 5KFBA 3T1YF 4NL5A 3HSDA 3M2VA 4NLRA 1X40A 1B7FA 3RJGA 4K4GA 3GSIA 1FRHA 2MY7A 4G1QB 3CD6S 2Z4PA 2DRBA 4LF8J 2EHGA 2W9CB 1XR7A 1HQUA 2F63A 3TVZA 3AODA 2EKNA 4FCYA 5J0RA 2ES6A 4CE9A 3P45B 4EO6A 2GIQA 1SJ3P 5DG8A 3QNOA 2IRUA 1VQMS 2CJ9A 3CCJS 3DDIA 1X4GA 5AI0A 4ECXA 2EQYA 4GKJF 5L1IA 1NSQA 3MN6A 3K0JA 1FESA 2RRNA 1V38A 3IV6A 4NLCA 2ZBIA 4F0HA 4URGA 4GLXA 1QUVA 3ZDCA 3FZMA 4FFDA 3T5HA 3C65A 1YDLA 9ICSA 1RWKB 3V1QA 3KJNB 4C2MA 3ZDDA 3THYA 4F5OA 3R9LA 2VFSA 4M3ZA 3OTBA 4CGZA 4KH6A 4CIEA 5TKWA 3PIOQ 2HFUA 4X4TA 2YH0A 3OR1A 2P9SB 4ICAA 3O3GA 5DGBA 1X60A 3SPYA 4PXBA 3GFXA 2E7VA 1Q78A 1ZQGA 4RU9A 4FS2A 4Z4EA 1UPMB 1JLAA 3HPOA 4DV1K 3U9ZA 3CDAA 3A2FA 2DNKA 7ICGA 1EETA 1JWWA 2ZNYA 1XO1A 4Q8EA 5AIBA 4N76A 2FB0A 5L1LA 4L3NA 4JI1K 3NF7A 4QWAA 4CEOA 5C2FA 3K2PA 2E1FA 2C42A 3BREA 3A13A 1DXSA 3T79A 3HWTA 2WMMA 2E4LA 2QE5A 4H5RA 1HR0K 4RPXA 2QMXA 1XNQF 3HSCA 2VWBA 5I3QA 2K8AA 4HUFA 3FVYA 2H1YA 4FZZA 2RKIA 5EDWA 3CIPA 1RNHA 3OYKA 1VSEA 1CXUA 1LW2A 2E5JA 1RJJA 2ZDPA 1U1KA 2UV8G 1VISA 4IH5A 3ZDAA 2YKAA 3V9UA 2HNZA 1KBUA 1QAJA 4X65K 1QHTA 4PG7A 1WEYA 3AVLA 3K5OA 2HQ3A 4ALZA 3PNIA 2E66A 2AF6A 5IQQA 3JB9k 5IM0B 2YXLA 3DRRB 1SKRA 5AK3A 5J8YC 1B0XA 4NLWA 3A8EA 2LECA 3Q0AA 3ENOA 4CFDA 2M0GB 2E9ZA 3A5MC 3HOSA 4JI6J 2QWPA 5KAFU 3G8QA 2V2VA 2IRYA 1AT1B 2JZBA 2Y0SD 4YXJA 2GWKA 3THVA 4EYHB 5AR0A 2RU9A 4JYAK 4YEAA 3QICA 2L48A 4X4RA 4TY9A 1VQON 3VEOA 1OKJA 4WJBA 4C11A 4M47A 4M42A 2Z2MA 2Z7JA 4ZPCA 3D6RA 5KFDA 2VZ9A 1SIWB 1QDUB 3PX0A 2AGOA 1V5VA 3O9UA 3HBTA 4RNNA 3VAMA 4AUKA 4BVOA 2XHBA 2KIVA 2YV0X 2XHCA 3PYEA 4Z7CA 1HNWK 4ZIWA 3CCEN 1U09A 2OPSA 4NL9A 2V4JB 3NH2A 1OH7A 1YKWA 3SCJE 3DXKB 4BLGA 2CFXA 2APOA 4PGXA 1D9DA 2HB5A 2P6TA 4K4IA 1K47A 2HHXA 1UCNA 3Q8SB 2ITGA 4P2MA 3A3PB 3CIMA 5L1KA 2IFXA 2P51A 3BBFA 4W92B 2F4VF 1FDNA 4KGMA 4J2AA 3QXGA 5ALTA 2FSJA 1FEEA 3ALRA 5T7BA 4ZCMA 3UIQA 4GFJA 1QSLA 5CZ1A 3AJ2A 4L3KA 1U0HB 1UMJA 1RAJA 3A8IA 2KK0A 4XTTA 3QRPA 2JX2A 9ICKA 2I5JB 4H0PA 3ISZA 3NNAA 1DQ9A 3OJUA 2NYHA 4F2SA 2B0CA 3KFWX 2K60A 3SMVA 4KGKA 3DXKA 2XCAA 2NPFA 2LYVA 3CXCM 1HD0A 3VQTA 2KHDA 2I6WA 2NXCA 1I94J 3LYSA 1XJWB 2B4VA 3LAMA 2H65B 1Q18A 2ZIVA 4BY9C 1FI4A 4Z0UA 5F8JA 4LF7F 4RWWA 1J5EF 4ATNA 3MM7B 3HVTB 4H4KA 2HGLA 3N4WA 2YJFA 3FRYA 4I0WA 5HQMA 3H1VX 2HW3A 1CULA 3JS6A 2J9DE 1LOTB 3L7UA 1S3XA 1KW4A 4QZAA 4KV8B 3RB0A 4GMKA 1CSJA 1YZ7A 3HD1A 4KHWA 1RT7B 1W0HA 5GTIU 1UZHA 1VRTB 3Q86A 3C21A 5HQ8A 3VOVA 2G8IA 2IVOA 4K42A 3M2RA 3GLJA 1Z1ZA 4MN4C 1WHVA 2A0FB 3FQLA 3MXMA 1IV8A 2MSNA 2HHQA 5A76A 2DQNB 3DNCA 4FLYA 2VKRA 1CLFA 2IVFB 5JRTA 4LSLA 4DCPB 1TUWA 2MKCA 4E1JA 3QU2A 2LHTA 1HW8A 4ZHRB 1KAYA 3D5MA 2D5RA 2DIVA 3UR3C 9ICFA 4FLVA 2VASA 3MCNA 1WDDA 2OH2A 2QWLA 5J0SA 2NUBA 2FHOB 3DXBA 2DHAA 4M8LA 3VEWA 3BUZB 3ZZPA 2W8KA 5AT1B 3PFOA 3MK6A 4RW8B 1NDCA 2ZM6J 9ICJA 3QAUA 4OLPA 5ELZA 3DRPB 4CF8A 2EWHA 2H3EB 5KFRA 5F8NA 4QIWF 3DN9A 2G8KA 4KV8A 2XY7A 4HTJA 4H5VA 7ICPA 3P96A 4M3TA 2DCLA 3CG7A 3ELHA 3QE9Y 5KFXA 1TQLA 3VEXA 2AX0A 2W24A 1S1UA 3IAYA 3MUTP 4J8FA 4RW4B 4F25A 4X64F 5JLFA 1PAUB 2QZ8A 3JPTA 1VHXA 1VQNS 2RSQA 2PT0A 3C19A 1B3TA 2EFOA 4Z6FA 4DSEA 1UOCA 1D8BA 4HTUA 1UCVA 2FDNA 3CD0A 5AQJA 4JI6F 4H03B 5HK4A 3CCTA 2DYAA 1UL3A 4RQ8A 2E5LK 3RJEA 3JAMU 3J7AN 3G6EN 2FLOA 1QAIA 3I56N 4JI5J 4CZMA 1V4SA 4HDGA 4ZCIA 4FDFA 3M6GA 2VYPA 4BWJA 1LFPA 1ZRMA 1CUKA 3W9JA 4E2FB 3VN5A 4F4ZA 3S3NA 2MKSA 5DKWA 1RHQB 1NZBA 5A6WA 2DCUB 1RT6B 2DY1A 2QLWA 1CJTA 3SJHA 3ZSRA 1C4CA 2J0XA 1GH8A 2EC0A 2LKYA 3C6UA 4CYUA 1F60B 4RQ2A 3NGDA 1SC1B 1ASUA 4X4OA 2MKYA 3HRDD 1L3KA 4JKDA 1IBLK 3VTIA 4NB4A 1VBZA 5HP4A 4Y6IA 1U6BA 3Q8MA 3H6EA 2NR0A 1MN7A 5EVZA 4P71A 3C5GA 4L73A 3LP3A 4IOCL 4MKYA 1K8AO 1UWBB 1NM1A 2J7WA 4QIEA 2HLUA 2J7UA 1N61A 3WC2A 2G8HA 3KKAA 2I9GA 1MQ2A 4R8UA 2CPJA 1M6YA 4IR9A 2LXIA 1UT5A 1SV5A 4HR2A 2F9TA 1N32K 1NMNA 1U04A 4LF1A 1QSYA 1OQ3A 2PMZC 4CLUA 4DXLA 1NRKA 2BBEA 2ESEA 4EBEA 4OCZA 1MWYA 1VK0A 1JN3A 4KKOB 5JVGQ 3JQKA 4H0XB 3I0SB 1JLGB 3WK9A 3OBYA 2VC0A 3IBCB 3I9V9 3CCQS 2DUYA 1APSA 2BPCA 2JRZA 2HFSA 4RQMA 2KSOA 2GVZB 5CXTA 2R7WA 4YFKA 3T6JA 3QIPA 1WKJA 2ZUBA 5GAEP 1K8KB 2F8LA 1EP4A 1XNQK 3HJFA 3VF2A 1WSHA 2DNMA 1H73A 3BEXA 3GV5B 2ZJRL 3FCHA 3BM7A 3M2VB 3BKTA 2G08A 2KVQE 1ZQIA 3PJXA 3GL1A 4ID8A 4CD1A 3GR1A 4DMNA 3N4MB 2OA8A 4U67Q 2EC2A 1DEJA 2X51A 3CW2C 4BQZA 4V19S 5EHHA 1FEZA 3FBEA 4KHMA 3NUQA 4F67A 3OL7A 2ZH4A 4CDGA 3TYTA 1RYRA 1BHNA 1IIPA 2R18A 2WF8A 2QC3A 3HP6A 3BYRA 1K1QA 1WHYA 4WFBQ 5HP1B 1C0UB 4WCEL 4KGZB 2D3DA 3NWGA 2KICA 2OI2A 4UB3A 1M5SA 2PFQA 2BCVA 3BH6B 2R2UA 1JUDA 2MHNA 3RH4A 1OSDA 2P9IB 2QYGA 4I2BA 3V6DA 1Z6RA 3VAKA 1JMTA 1JXEA 1FVSA 3I87A 4FJJA 1ZM4A 2AX1A 5ALLA 9ICLA 3N28A 3KTQA 2VWKA 4DL7A 2QL5B 3U9DA 3VAGA 3DEEA 3HHNB 4WFAQ 4CRXA 4Y0FA 2QJ3A 3C6TB 3HW8A 3AVMA 7ICUA 3OW2R 4K4UA 4JI3K 2XICA 2HG4A 3OYNA 8ICUA 2K3KA 5CYQB 2ZJQQ 1YJNS 3GIJA 2CNLB 3KMQA 2J9DA 3CT9A 1X4CA 3CJ9A 3U26A 3E9PA 1RAFB 7ICOA 3VAJA 3CFRA 1NK7A 5ALGA 4B08A 5IOLA 5ALHA 1Q86O 5L9XA 2GOLA 2HMPA 4KTWA 4AYBC 1HBNB 5AK5A 1DK2A 2Q6BA 3MFIA 4AL7A 2V8HA 2E1CA 4NYFA 3VVUA 1XNRK 4X84A 1PYOB 3TR5A 1U45A 1ZS6A 4EENA 1GLDG 3CO9A 1K6YA 1VQOS 2DH9A 3MPWA 4A8FA 2M7SA 3CMAS 3AJ1A 3POTB 2IBKA 4KAZA 5D4LA 2ZBCA 2AJ4A 2XCPA 4U7BA 3T9ZA 4YUDA 2BR0A 1RXVA 2WHEA 3VGSA 1ZXOA 1S7IA 2R8JA 2N82B 4JD2A 2A1AA 4W5QA 4X62J 3DM2B 2I5HA 1NNDA 4JUZA 3CC7S 4BG9A 5TZVA 1R0AB 4NXNJ 2JVOA 2CZVC 3CCUS 2AIRB 4AP9A 4HH0A 2YB4A 1BPBA 2KJ5A 2NRWA 4WQ5C 3IG5A 3W2WA 5LM7E 4MF2A 1TKTB 1LK5A 1KAXA 5HRSA 5C25B 5GADU 2XNRA 4BX9C 1WC4A 4KLLA 4MT1A 2IC3A 2ZBQA 5M1NA 4QYRA 2H4YB 3QPIA 1C0TA 2YX6A 4DWIA 1TUYA 1HJOA 3I5AA 1FA0A 1ZQZA 4BE0A 4LF9F 3H5UA 2VBYA 3HULA 4QZGA 4OHVA 1CJUB 4WU3A 5ADZA 1HW9A 2IJNA 4C8YA 1M1HA 4Q2LA 4HTLA 4A59A 4KFBB 3C23A 2ZOGA 2ETJA 3MEEA 4LIRA 2HHSA 1EKSA 1S9EB 4OX8A 5KFGA 1N60A 4PR6A 4ECSA 1NB2A 5M1PA 1Y7PA 1V85A 4YS2A 3BN7A 2CQBA 1RACB 4DS5A 3SAGA 4PG4A 4CHOA 1NDPA 1SB6A 4ED6A 2VA3A 2Q3SA 2KOBA 4F26A 1RWWB 1S9GB 2MZ1A 4OYZA 2E5SA 4YP3A 4OVLA 3NDKA 2KRBA 1R31A 3SLCA 5FJ4A 5IC4B 3ZSVA 1Q46A 2YBVA 1P90A 4PGYA 3ATUA 4C8KA 4HI1A 4JKGB 4OZ3A 4I68A 4M3RA 3SQ2A 4GVBA 4EEYA 4HACA 2E1PA 1OPZA 2HEKA 3IM1A 3MUVP 1WF2A 2CJQA 4RUCA 3TADA 4CNQA 1ZQRA 3RAXA 5C5JA 3KJQB 2O8BA 3MPUB 1E4GT 5DK5A 4YDUA 2PMZD 4X62F 2NO5A 3CF5Q 5LJ3Y 2F9JA 5H9EJ 3L7OA 3G0ZA 4O3QA 2FC0A 1WLJA 2E1EA 1S6UA 2EAMA 1F0XA 3AQOA 1J27A 1PC4A 3P39A 2AJ1A 5CEHA 2RUSA 4NMXA 1HNXJ 4HL9A 5KRTA 2EDUA 2I8EA 2PC6A 3PJ9A 3EGWB 3FGVA 3GFKB 2HAIA 3IFRA 3MFHA 2E1RA 4IOXA 2BZ2A 2PFPA 1S4EA 3PRBA 2VJUA 7ICRA 4DCOB 2Q31A 1DAXA 3KMSA 1B0TA 3JTOA 3R6GB 4UAWA 3PEHA 1IBKF 2IYIA 5C0YA 2Z30B 2RIJA 5KOXA 2P8IA 2ZH6A 3TRGA 4WTYA 4OLOA 4I2CA 2XG8A 4GVBB 1UWBA 4BROA 5DRKA 1WNEA 4K4YA 2BKPA 2YB1A 2YN4A 1FHTA 4O8UA 2FPKA 4QIGA 4F8RA 3DYAB 4DLEA 1F5SA 7ICHA 3M2RB 5C15A 4ZVHA 4CF4A 4N8NA 1HLWA 3AVCA 5IQ6A 1V3SA 1X6JA 1RBAA 1S1TB 3CUNA 4BGDA 3ENWA 1Z4OA 1U1QA 4DMZA 4G3IA 1N34K 1S5JA 3HM9A 2BABA 2FYXA 2JWNA 1RA7A 2M4MA 2M2BA 1JL1A 2CJYB 5DS7A 3O0FA 3DLLQ 4JAXA 4FPBA 4CHNA 2RU3A 5F1XA 1XMQK 3TTDA 4DPYA 2HDOA 2WC9A 1OS5A 3ZO7A 1KAZA 1SQKA 4NMLA 4A5BA 1VQ5S 1D9FA 2YWHA 4DR6J 3Q8PB 1GXUA 3MD3A 1RCXB 5GMEA 1U25A 4ZK7M 1UFWA 3NCRA 4FXVA 3HHDA 3BQ2A 1XIQA 1FDBA 1Y5LB 1X4AA 3IM8A 1MU2A 2OHFA 2IDEA 3ET6A 2AA4A 3FGUA 1A0PA 3CP8A 1MWQA 3RRGA 3SENA 3UE2A 4J03A 4DJBA 5CQGA 3QLHB 2I9SA 2NV3A 4XRHA 9ICCA 3PIOL 3TQ1A 4U8VA 1PJ7A 4MIBA 2OEMA 2MLXA 2UUAK 1XQSC 5HI7A 3HHEA 2CVIA 3HHLB 4I64A 4M5IA 4P2XA 3SK3A 4DV3K 4Y2VA 4P75A 3CJKA 5F41A 5KT5A 2OTJS 1BD6A 5ETKA 1SH2A 3SCKE 1RTJB 2OD4A 2JNJA 2PIIA 1C4AA 1GXLA 4FJLA 5JS2A 1I6JA 2P9NA 1TMJA 4B3OA 1T95A 1W2BM 1DHMA 1HBMA 1VMBA 4JI8K 1PJ5A 4YHHK 3AN1A 2CQHA 2LPEA 3DOKB 2YNGA 4WQ4C 1JNZB 5HJYA 3KNGA 4M5DB 3VGKA 1DFDA 5ETVA 3F9KA 4P2SA 3SBTA 3M6UA 5KRSA 5DO2A 5K9FA 4UUXA 2KT2A 1FTRA 4J91A 3OJSA 1HQUB 4BXOB 4JP8A 4DV1F 3W5ZA 1DY3A 3EKUA 5HMZA 4UASA 4QPTA 2E7XA 3MDAA 5GAEI 3K4GA 2GNKA 1T3NA 3RBXA 4FXDA 3GMGA 4FF2A 4JHDA 1LCUA 1GMWD 5GAGU 1HNZJ 2XY5A 2VQFJ 4Y2CA 1R59O 3TJAA 5J1EB 4PWDA 4RPFA 3H8WA 1ZQLA 2OXOA 3M8ZA 4PZVA 3Q83A 4ILLA 3PR5B 4NEZA 4DCJB 2X7IA 5C24A 3HFVA 2OMLA 1XR6A 1MWZA 3L3FX 4KLFA 1VQKS 4F0KA 2YWWA 3IXQA 3AM9A 4BUGA 2G8WA 4QR2A 2GJIA 4Z6CA 4RTFD 3C28A 1RWUA 3UN3A 3CCSS 2E6MA 3HCXA 8ICWA 2YHYA 1KC8T 3FAHA 3OHAA 5LXYA 1YI2N 2UVRA 5ALDA 2DGOA 4RU2A 4UW2A 1J9AA 5A8WA 3OYEA 3CCMN 4LFBJ 4X4SA 2KJ8A 2KMDA 1YJTA 4A46A 1N32F 4DR5F 5J2BA 4YOTA 4USHA 4KBIA 3WEEB 3V7JA 4R0EA 2VJVA 2CQ1A 4ZVFA 3ASMA 2M88A 3B8AX 1WBDA 1NMDA 3DOMA 2D0PA 4QPXA 3KHLA 2R7OA 5AQQA 5D0GA 1TFRA 2M0NA 3NVKA 1FW6A 3MWTA 1JALA 1U1LA 2MZJA 1FEHA 1HD1A 4WFYA 4Z4GA 4Y2JA 5AKYA 2IJRA 3QGGA 4WJ3B 4CZHA 4JI5F 4M94A 5CZXA 3EJMA 1XU4A 4CJ3A 2VA8A 2OO4A 1RU1A 4M63A 4YDUC 2QSWA 3K1RB 2HBZB 2GAGC 4JOUA 1YITN 3TJ8A 2MZRA 4GNIA 1RSCA 1HNVA 4CK3A 1D4XA 2ZJPL 2UXCK 3CJ8A 4IXCA 2GQ2A 2CGLA 5DDRC 1HMVB 4X66F 1NUEA 3S3MA 3TWHA 3TFSA 5IM0A 3FJ2A 1RWOB 4QS7A 1FX4A 4XO0A 4U7UK 4CD3A 4HT7A 1X1PA 1IG6A 4PPXA 3RBDA 3D3CJ 1ZQHA 4FJ8A 3UKRB 4B9TA 3GG0A 4RNFA 4FLZA 2CZ4A 3A8JA 2MQNA 3VESA 2JL9A 4DU1A 4BRQA 2QGFB 4C4TA 2VANA 2XY8A 4ZN1A 1BOTO 4R79A 5I3UA 5J2MB 1ELOA 4B3RF 3IG1B 4HHUA 1WKKA 3TTCA 3IS9A 5CZVA 1WCNA 2AMCB 3QWPA 1HNZF 5EE0A 2Y1RI 4N41A 2ZWOA 3I8BA 4X5VA 2OLWA 1NU0A 1SXLA 2ZDOA 2BOAA 4MFBB 5AQFA 3VQ9A 2JEGA 5AFUH 3MC1A 2AP6A 1Z4NA 3R2CJ 4WWSA 1H2TZ 5DQIA 1GLJO 1N2XA 3U6FA 4OZNA 2QWQA 1XUPO 1T8EA 2VQEK 2JZBB 2ZWHA 5CA5A 1YJWN 4CK1A 4LRBA 3E01B 4I2EA 5KAKA 2KFYA 2W11A 3F5TA 1VQKN 3UCZP 1M1KO 4QZIA 1IWGA 2NS1B 2VPZB 4JK8A 3KK2A 4CLYA 4F0MA 5AKGA 2DR6A 2W04A 4TYBA 1SAZA 1J2VA 5DDMA 1WDTA 4CBXA 3O5BA 4UOGA 1VS3A 1EWRA 2MQMA 5T7LB 1FKPA 2FXUA 1FK9A 3I4HX 3F73A 3NVYA 4CLFA 3W60A 4AXIA 1Z2LA 2ZHBA 3A4TA 4F4XA 2R2RA 4YHHJ 2FJXA 3TSUA 3R5JB 5HJXA 4DTOA 1Y9OA 3M4XA 2A1SA 1BE4A 2HSEB 4DQSA 3U3YA 3BR9A 3S7RA 4DR6F 3A5LC 1H7WA 1KSPA 5KG3A 3MEDA 4US8A 4LF6J 1B0VA 3P49B 3RJFA 3FBBA 3BGRA 3R3LA 2BGWA 3SCIE 4KHSA 3SQOP 4K2JA 4OKJA 2Y0SC 4QR0A 5K14B 1QHAA 4ANCA 1K9MO 5B0CA 4KO0A 3QEBZ 2A5XA 1A6SA 2B9WA 5BREA 3IWLA 1D1UA 3NY0A 1FNXH 2WSEC 3RGIA 3D2EB 2DGXA 1R8PA 3NS7B 4CIGA 3OYJA 4KHPK 3HL8A 1BNOA 3AY9A 2Z2LA 3P38A 4R0JA 3HKZC 1VK8A 5FD1A 3OTOF 4FK4A 2HF3A 2QKQA 4DR5J 4CJRA 2P9CA 3EICA 5LMNK 4PKIA 2PFOA 2NRHA 3BPDA 3P5TL 2BPFA 4KHUA 5F8IA 4QR1A 2L41A 4MDBA 3JXOA 3LPTA 4FXWA 4BE1A 1SH3A 3KG1A 1SV0A 5KFNA 3MM7A 2ZE2B 3J7Z5 1A7GE 2XLIA 1R8CA 2GS8A 3PRDA 4Q5VA 2ZJ5A 3ZZOA 3BGRB 4DX5A 1O03A 1OQ6A 2QIFA 2UXBJ 1IUJA 2P9UA 4DQPA 4NLVA 5G0RA 3G6YA 4QWBA 2ADCA 2YX7A 4HVZA 3W61A 4M95A 3PSTA 3UXPA 3P5JA 2HNYA 1T6DA 2YNFB 3OVAA 2BGGA 3DGPA 4CGIA 1I1GA 4JI7J 1REGX 2HPUA 1XNQJ 4O5KA 4USWA 2OELA 3H98A 2KG1A 2R8KA 3ZZYA 1RUSA 1WKLA 1RHJB 3M32B 2GIFA 2EFQA 4KH4A 3NE6A 2J0WA 3V72A 2Q79A 3AD9C 2KKPA 3GIKA 2Z8QA 4LRDA 2O6KA 4DB3A 2BEFA 1QTNB 3RMDA 5AQNA 4YOXA 2HBLA 1WSVA 1O08A 4B1YB 5HN0A 4B8CA 3C94A 3V7LA 3TA0A 2GO7A 4MO4A 4CE6A 2WFAA 1WAFA 3LAKA 1JLQA 1LK7A 3M6XA 5J0PA 4KGVB 4ED1A 4MLHA 2FVPA 3VF4A 4L72B 7ICEA 3RMCA 3TAQA 4ELUA 3UR0A 2YNFA 3IBFB 5J2FA 5DDOC 3DGPB 5BRHA 3QEWA 3DOMB 4A8QA 4HKQA 3TEGA 2E1ZA 2XSJA 4IG0B 4YOEA 2D74B 1Z4UA 2ZXIA 2RN2A 2H48B 4I6AA 1NJWA 3MGHA 1ACMB 2E1YA 3N5BA 5BXIA 3AVNA 1VRQC 3ISCA 1OO0B 3C5FA 5HHHA 2HBRB 4FM2A 2AU0A 2ROGA 2UXBF 1ZBIA 4DR3F 2Y9TA 2KN7A 1PGZA 2X6SA 1LW2B 5A6PA 1WTFA 2OGUA 3UQSA 3D45A 2EVZA 3ZT4A 4JI4J 2MA1A 1P1LA 1HYSB 4OHZA 2AJ2A 3VQAA 2C2NA 1RWXB 2DPNA 3M2UB 4B1UB 3V7KA 8ICLA 1X5TA 1UA1A 4OI3A 7FD1A 2XZWA 1RAGB 5GAEU 3P1GA 3Q7CA 3HFZB 3DRRA 3PRVA 4EFAC 4RW6A 2DEIA 5J0WA 4DX7A 3KKRA 1P8ZA 1XI1A 4B02A 5AK4A 2ZH3A 3R1XA 5B0EA 4KMUA 1BWEA 2DGTA 4K5SA 1M0SA 3FDSA 4Y1CA 4DF8A 1NK5A 2HFOA 4FLXA 3IN5A 3UKRA 4KREA 1D0EA 4CHZA 4OZ5A 2MQQA 1GOCA 1IBMK 3VPZA 3LW5C 5HMLA 1Q8IA 1IR0A 4KMOB 2J0SD 1ZQTA 2RB7A 1KC8O 4B9SA 5ALMA 2LP4A 3KK1A 4RBUA 4FZLA 5JVGL 4I7FB 1JJ2R 3AAQA 2LEAA 4IKAA 1OXJA 3ICXA 4DV2J 4YMEA 1BC6A 4NE9C 1FERA 4LF5J 4RQ0A 1SXDA 3NG8A 4CT8A 2HRTA 2OZSA 2ABYA 5HQLA 3FZFA 3PTWA 4KLDA 1T3OA 3KJVB 3A1YG 3GR0A 4ER8A 1NHKL 2F1HA 3ADAC 1DRGA 4KLMA 5EWGA 1NU4A 5BPCA 3PR4A 1OYEA 1NZPA 4UB1A 2GAHC 2LQ8A 4MAKA 3SCXA 3H3OB 4MKVA 2XC9A 2FPHX 4H0TB 2ILYA 4GO5X 2J7KA 4EIAA 5ETMA 4N56A 3CJCA 5J2MA 4PGQA 4E7JA 1RDRA 3CCWA 5KFUA 1U2CA 1HJRA 1JCGA 2EX3A 1PC5A 2V5HG 1OYDA 4IOAQ 4CJPA 4Y2XA 4ISEA 2JFDA 2VDHA 3NH1A 3GIIA 3O4QA 4XIUA 1HNZK 1ZD5A 4ZPWR 1QQ6A 4K0KJ 2P6UA 3ZTOA 4FBUA 1WOQA 3O9QA 4PAAA 4CLTA 4NLZA 3OTDA 2FJAB 2UUAJ 5HVGA 4IFEA 2YPYA 2NRXA 4DPTA 4CEBA 4CO2A 1ITPA 3TA1A 3TUPA 4CJEA 4FM1A 3KG0A 4W5NA 1KTQA 1LWFA 4ERDA 3K5PA 1Q7YT 1FDDA 2JH3A 3DAWA 2ZTEA 2BDUA 2DB1A 2RS8A 5HNKA 4CJTA 3AVGA 1KDHA 4FKXA 3POTA 1F9EB 2K2PA 3HP9A 1BLUA 2A41A 2Q0ZX 4FSVA 4LF8F 5GADP 4OJPA 2UUBJ 1Z05A 3E3XA 4KO0B 2AKWB 2F4VK 3QFPA 1E6VB 4RT2A 2PDAA 3H5YA 2KJ9A 3V1OA 2VDIA 3EX7B 2C3UA 2HMXA 3VEYA 4FZNA 9ICVA 4QU6A 5AM2A 3CXCR 1FK9B 4NO7A 4GVLA 5KG6A 3J80Y 4MFAA 3LDQA 2CRXA 4DQ8A 4C1NK 4ED2A 2UV8A 7AT1B 3JSMA 3DMJA 3AV9A 4OO1J 2QK9A 4LD0A 4ZPAA 2GWSA 1MMNA 1RBRA 2EPIA 4Q0BB 2XMKA 5CHIA 2ISPA 1Y00A 1XNRF 2Y9UA 2YNHB 5KQDA 2KHVA 3O3HA 1VQ5N 2G1HA 2M3DA 3NAEA 2XMAA 3OFHA 4F2RA 4FWRA 4RW8A 3J8AA 1Y97A 3DXMB 4YVZA 1TK8A 3TWZA 2ZE2A 4DV3J 1VCTA 2IDLA 4PL7A 3LM9A 4YN4A 3CTRA 2AD9A 3QJJA 4ZVEA 4IL6U 3PSIA 2BA9A 4DV7K 4JK7A 3F44A 3TJ9A 4ZA1A 4PG5A 5E33A 2H54B 2KJWA 3C66A 2OZMA 4DS4A 4WFAL 2K89A 1SC6A 5E79U 3KLVA 1ZQJA 3L7PA 1WTBA 4BRLA 4HYKA 1GFWB 3M8RA 5CRXA 4LBPA 1X9XA 5BOMA 3VQ8A 1MA9B 3OTQA 1TKZA 3H20A 2FJEB 2LI6A 1XMBA 3ZZRA 4G9BA 1L3TA 4AQYJ 1R3NA 2FY1A 1GX6A 3KFUF 3KWIA 1Q5YA 5ALQA 2GH1A 1Q5VA 1VSJA 3NVMA 3AQPA 3M30A 1F6TA 2B9YA 2R7SA 2H3VA 3NVWA 1JI7A 1JLEB 2HMIA 1Q8BA 2O3DA 4OYIA 5E3QA 3GFZA 4E7HA 3GYXB 1CJUA 3QAEA 2ZTCA 3FEZA 3IG1A 1BI4B 1X4BA 3AOBA 1R89A 1UVMA 2KXNB 4HI2A 2P9KB 2FVCA 2WW8A 3O8MA 4UY8O 4OLAA 2WSCC 3FM9A 3CCLN 4FW2A 3ENAA 2FD2A 4ILHA 4OV6A 4F02A 2WONA 2F1IA 4UY85 5ALFA 1OY8A 5ALEA 3OQ2A 3MMBA 1S9GA 4NM1A 5AIAA 2KW4A 1FWKA 1FJGF 3ZSWA 5ALZA 4N47A 4I2PB 2BKNA 1LWEB 4ZIVA 4MF8A 2VQFF 1YT3A 1BXNA 1A5VA 4R65A 2E1AA 1SPBP 2ZIXB 4DTMA 3OFGA 1XBWA 3L5KA 1JLEA 1HWIA 3VQ6A 4CEEA 3AHPA 1TL4A 3CCRN 1GQEA 3B82A 1BISA 5AQPA 3B0YA 3R2DJ 3I28A 2LU2A 1SWWA 1HQEA 4KR0B 3OVSA 3ZD8A 1YUWA 4O3MA 3RR8A 4M2YA 1U26A 1TKXB 4HLBA 4DDFA 2ZD1A 1NGAA 4UAZA 2D69A 2AZ1A 5KFZA 4OPKA 3G2XA 4NEYA 1QAYA 4H4KC 5ADXA 1X2IA 3M7DA 2ZITA 5DJBA 2UUBF 2G0JA 2W4DA 1RZTA 5AQZA 5ETLA 4DR1F 4GVMA 2I7PA 3L4BC 5AQUA 3LA0A 1B9FA 2W3RA 2UVWA 3I32A 5DZ6A 1QY7A 4OZJA 5HLFA 1FRLA 5HOOA 2GCFA 1DURA 3CJ7A 4U8YA 1HWUA 3MEKA 3MCAB 2MJNA 4B9MA 5K8PA 1FFSB 3SUOA 3QEPA 7ICVA 1HKGA 4CDIA 1S6QB 3OGUA 4Z7YA 4G1PA 3KHYA 5AFUA 4FBTA 3CMQA 1F1BB 4DOZA 3B4DA 4C1NI 3JPOA 5G0RB 1WORA 1YF5L 3JAMY 1VQSA 4X64K 3DYAA 3RG6A 1NK8A 1XQIA 1RBTA 4NI2A 1DQAA 3BB5A 1XMOF 1V4TA 1VFJA 1ZBLA 3MAHA 3OS2A 2XEXA 3PKMA 1KQKA 3FKBA 1RTIB 2KT5A 1VSIA 1YZ6A 4F5RA 2MEWA 2OTJN 1NJIO 4C48A 2IOFK 1URNA 4K5RA 4XH1A 5EE3A 2QMUB 1BNPA 3C8YA 1Z26A 1UP1A 4RNOA 4GW6A 4CEZA 1X8DA 4FVUA 3L4PA 1TL1B 4YQWA 2RQ5A 2OP5A 5F8HA 4I2HA 1HPMA 3O80A 3ZX3A 2AHOB 2J6SA 1RTDA 2BACA 4PY5A 3THXB 4DUZJ 1HHSA 2BCUA 1RKIA 1SKSA 4J9QA 2YNGB 2PKEA 3DHWC 3TAEA 2DITA 2N3LA 1BU6O 5DB7A 1S6QA 2IRXA 3P8BB 3MPYA 4OJ3A 4FF3A 5CR4A 2QB1A 4P10A 2HWHA 4UOHA 4H4OB 5ITHA 3VQ7A 2YH1A 3MMAB 1KR4A 4IBNA 4B3TF 5KGXA 3QUBA 3SBMA 2V51B 3ZDBA 5EOYA 3LPEA 1T11A 1ZM2A 4J9RA 2BJ9A 4HT5A 3QB0A 2AEFA 2R7UA 4DPXA 1NNLA 4DR4F 3M32A 2CPEA 4TQRA 1D09B 2OPRA 3JPQA 3MR2A 3HJVA 3K17A 2W9BA 3ISND 2GZOA 1NOZA 3EYZA 2HIQA 2QRRA 5CYMB 3HXMA 3O4WA 3TADC 3CF5L 3W65A 3AAPA 1XC3A 2B8QA 2E2PA 2RP5A 1P8GA 1RWVB 3M6VA 2ZJ8A 2QT7A 3R27A 3DDHA 1SKUB 3CDUA 4JRPA 4KB7A 1HYSA 3NASA 5DG7A 5J0YA 5AQHA 3H42A 1H38A 1IKXB 3JQJA 3NGZA 3SUPA 3ZT0A 2IJFA 2DJWA 4KC5A 3CWJA 5JMVA 2C1EB 2XMUA 1FTCA 3M1VA 3J81O 1RDUA 4O4GB 3B6PA 2QSFA 2WF9A 2IOHA 2DIUA 4NZ6A 4TYAA 2XSJB 3I1YA 4IG0A 2RAQA 3NNCA 1FFGB 1WSRA 1NI3A 4ZTFA 3DFEA 4F7VA 9ICWA 2CG4A 2HVEA 1AA1B 3BQTA 1RZMA 3MM8A 2ASMA 3PVXA 3WXIA 3C2KA 3EPIA 1ICEB 3VTHA 3QETA 4DR6K 4EU0A 4CNZA 2LQ9A 1XEZA 2IIHA 1OMSA 3HPGA 4NPOA 5MLCQ 4H0VB 4WFNL 3G8SA 2W2PP 2G2YA 2NRZA 2HIYA 2Y0BB 1W26A 1RKJA 4DSFA 3DC2A 3UW1A 1M1GA 5CD4H 4QAGA 1IH7A 5HL7L 3OR1B 2P9SA 2WVFA 3OL9A 2DNGA 1HUZA 1HI1A 2KXFA 1JJ2M 1JJHA 9ICAA 2D6FC 4ED0A 2K06A 2DGVA 4DUTA 1K8AT 5E3CA 1UWAA 3IRUA 4Y3CA 2PYJA 1ZXIA 3FCWA 4KLQA 3LP2B 3VF0B 2YTUA 3VCBA 1F0MA 1L5UA 4A8MP 3JPNA 5IIMA 1NO8A 2BXJA 1DARA 2RF2B 3UM9A 2K8BB 4OI6A 4DFDA 3V6DB 4I2GA 1C0TB 1F44A 1VQNN 2BANB 3A12A 5BR8F 3QMLA 2XYGB 2K4PA 2U1AA 2VG7B 4OX9J 3EE9A 1FNMA 5KFHA 3KLEB 3J7YP 2IM1A 2DGSA 3L3VA 4NLTA 4PJ0U 1HKAA 3EVMA 2XQCA 5THWA 3QNWB 4CNYA 4DL3A 3M05A 5KG2A 2KVCA 3U02A 3DLGB 1UETA 2DKZA 5HRPA 3L2RA 2CWKA 2ITMA 3AL0B 4HVJA 4F72A 3LZIA 3Q8KA 5IIJA 3W9IA 3KYLA 2FSNA 1SS6A 2G5IB 4OJGA 4KIAA 3MI7X 4QZHA 3RMAA 4LVOP 2C2RA 2IVMA 4OGCA 1VHFA 3EXYA 3UMCA 4DL2A 3NVZA 4CF3A 1G2EA 4PKHA 2XMWA 1P9QC 3I82A 1X4DA 2WF7A 4P74A 1NGBA 1RLCL 2CQGA 4EHTA 4DG1B 5KT2A 2D0CA 3WDOA 5AM0A 1TUUA 2E8AA 2CPIA 2WBRA 4C7ZA 1RHMB 1NKEA 2KVIA 3TX8A 5LSOA 2ZIXA 2FVQA 3SAFA 3GQCA