2HHWA

Ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhwA01
1UA0A 4M0AA 4QZ9A 3RWUA 3VA0A 2PFOA 2HNYA 4Q5VA 4HYKA 9ICKA 4DTNA 1S1UA 3JPRA 1SL2A 2PZSA 1A76A 1NK4A 4QZFA 4KFBA 4KITB 4DQIA 4UB3A 3ZDAA 1JLAA 4IQWA 4Z4IA 4DTPA 3MEEA 5DG8A 4R8UB 1XWLA 1VSDA 3C6TA 1WSIA 3HXMA 4I2CA 2R8IA 5KG0A 4CESA 1B22A 2C28A 4NLGA 2XGPA 1HUOA 4KLDA 4DQPA 4DQQA 3CFRA 3SUPA 4I2QA 9ICBA 3FYHA 1K6YA 2P5OA 4YN4A 2AGOA 1S9GA 3AVKA 4I2IA 5EWGA 3OGUA 3VQAA 1JX4A 1RT2A 4OKJA 4JK1A 3SCXA 2XGQA 1XI1A 3EPGA 5DLFA 3CM6A 5J2NA 3QNNA 3C21A 4W5QA 3V1OA 1IO2A 1Q9XA 3SQ2A 4CJPA 5J1EA 4DF8A 2ASLA 4FLXA 2NRTA 2PI5A 4CEFA 3H8SA 4R63A 8ICXA 3LP1A 2HNDA 2DPIA 4N5SA 3LK9A 4XA5A 3JPTA 2PFNA 4YCXA 3PO5A 5J2CA 1RNHA 4OKEA 3OS0A 4EBDA 4FZYA 3KKRA 4PQUA 4KN7A 2I5JA 2HMIA 4JWMA 3AVHA 4CK3A 5IILA 2P5GA 1ZQDA 2RPIA 4ECYA 1NK9A 4GXIA 4DSFA 5DDMA 1A77A 3BQ0A 3AVAA 2G8KA 3AVBA 5JS1A 3EY1A 4F3OA 3AO3A 2F8SA 3DRSA 4CEEA 3T3FA 5J2EA 2RKIA 1NKCA 3D45A 4RG8A 1ZQUA 2PY5A 1AROP 4ZHRA 1NJXA 1WSHA 2W8KA 3HPOA 4C8KA 2XY7A 3QEIA 2W42A 1RPLA 5J0RA 4CGFA 3UPQA 4IQTA 3GFKB 5KG4A 1JLBA 1NOZA 4OLBA 8ICIA 3RAQA 2ISOA 3Q8PB 2FLNA 3RRGA 1T4GA 4Y1DA 4PHEA 4Z4EA 3ZSZA 2FPKA 1DTTA 2W9CB 3KTQA 4KLLA 4DSIA 4GW6A 2W9MA 4BE2A 4N76A 4CEDA 5DQHA 3I8DA 4F2RA 3B0YA 3G10A 4CF8A 5KG7A 5DB8A 5HBMA 4DLEA 2AGPA 4ZTJA 4I2PA 4PHDA 3H40A 5KFOA 5L1LA 3UIQA 3ISBA 3MGIA 5HRRA 4JS4A 1QSLA 4F4XA 2FBXA 3TWHA 4UB2A 1WLJA 3LWLA 4J9SA 4TUPA 2V4QA 3Q8MA 3ZD9A 4ECXA 4FZZA 2F1HA 2H5XA 5D49A 1ZQJA 2BR0A 8ICLA 9ICUA 4KHWA 1VSMA 3VQDA 5KG3A 4ED2A 3I0RA 1GOCA 3PMNA 3NBPA 4M9LA 3ALYA 3AO4A 1S76D 4JLHA 4F4ZA 4FJMA 4M3ZA 4NLKA 2XC9A 4O3NA 5IINA 1ASWA 5HROA 4QWBA 4CFBA 3HWTA 4IR9A 4HCBA 3L3UA 1ASVA 3V7LA 4EYIB 3K5LA 1D9FA 4RT3A 3QERA 2FMSA 4BXOA 3QIOA 4RQ2A 4FJ7A 3RMAA 3HSTB 4KLTA 2QKKA 2KW4A 5KI6A 1TKTA 9ICAA 3RJIA 4JV2A 3V6KA 4BE0A 4AHTA 2BPGA 1LWEA 5KFFA 4PH5A 4CF1A 1NOMA 4Z6FA 7ICMA 4BWMA 3S3MA 1DGSA 4RQ1A 4DL5A 4CHQA 9ICQA 1XSLA 5J2IA 9ICSA 9ICIA 3CM5A 4DTMA 4CEBA 5CP2A 3VQ5A 1TV6A 4IG3A 3GIKA 4DOCA 2ZUDA 2P1JA 7ICLA 4DSLA 2G8FA 3HO1A 3NF6A 3C6UA 4J9QA 1C7YA 4ZH4A 4GVMA 2Y1JA 1UOCA 3WNGA 4M3XA 4B3OA 3G6VA 3L2WA 1C0TA 4KB1A 5KT5A 2C2EA 4KLEA 4M45A 4KREA 1LAWA 4YVZA 4FJLA 3VA3A 3MFIA 5TZVA 4OPJA 2FBYA 8ICUA 3QLHA 1JL1A 4DMNA 3MDAA 1BQMA 1N6QA 1ZQXA 1B9FA 1HJPA 1I3AA 2DFFA 1BPXA 3LPTA 1S9FA 4TQRA 3LWMA 1S0VA 1WSGA 1EXNA 3IAYA 1BPBA 3OSNA 4ED8A 1BIUA 3BJYA 4IQVA 4RPXA 4DL2A 5KRSA 4J2DA 5HRNA 1SKWA 3H7IA 4KLGA 3RR8A 1UWBA 3B6PA 3IS9A 3NGIA 1TKXA 2P51A 1S1XA 3QETA 1U49A 5L1JA 1COOA 4YXJA 1A5VA 2BCSA 4B8AB 1MQ3A 3NGDA 4YR2A 4QZIA 1WAJA 4F5PA 4M9NA 4RW7A 3OYKA 5HRSA 3NFAA 5SWMA 1ITGA 3S9HA 1MSWD 4F5NA 4NYFA 4AHCA 4E3SA 1T3NA 1WN7A 1Y97A 4NYNA 1BCOA 4H8KA 2BE2A 2WTFA 8ICYA 9ICOA 1S97A 1D9DA 5DQIA 3C5GA 3ZDEA 2JZBA 4YD2A 3C95A 4RQ6A 5CA7A 1RT7A 3PW2A 1CLQA 4ICLA 1VSHA 4J2AA 4GXJA 2BGWA 4W5OA 2JLEA 4QWAA 4K4GA 3OYIA 4CGGA 2D0CA 1TGOA 1S5JA 3NH0A 4DSJA 4O0IA 3BQ2A 4JS5A 4FS1A 4CHNA 4FYDA 5J0XA 4N56A 3OJSA 3D0PA 4LH4A 4CF9A 2AU0A 4CEAA 5IIJA 4M3RA 3RBDA 5KFQA 5KFUA 3LAKA 1C1AA 1GOAA 4I2GA 3HYFA 1XC9A 7ICVA 8ICEA 2FPLA 4UBCA 4RT2A 3PO4A 5KGWA 3ITHA 3ZSYA 3KLIA 3E2EA 2B6AA 4IFVA 3NCIA 1S6QA 5KRTA 3HW8A 2BQUA 4DS4A 5KFTA 4CE9A 2EX3A 4IDKA 1KCFA 4QZDA 4FJXA 1ZBUA 2ATLA 7ICHA 2ITGA 3LZIA 2XCAA 4F5RA 4F50A 4DLGA 4XIUA 3NF8A 3MEGA 1RTJA 2PYJA 4H4OA 8ICBA 3IRXA 3T5KA 2PYLA 1MC8A 3RJFA 4DL6A 1NK5A 3ZT1A 1D8YA 2ZUBA 2X78A 5I42A 1ZQLA 3OS2A 3SNNA 1SL1A 5HP1A 2GWSA 7ICOA 3AO1A 1Z26A 3TR8A 2OWOA 1S0MA 4YMMA 3HX0A 4O3RA 7ICJA 5J29A 3C2MA 9ICTA 4O0JA 3E01A 4UB5A 1MU2A 3BDPA 4FM0A 5KG1A 5KFZA 5J2GA 5HMMA 3MR2A 4M04A 4M3YA 4QW9A 4QOZB 2ZE2A 1KFDA 9ICRA 4FLUA 4Q43A 4PHPA 4O5KA 2O4GA 4B9SA 5BOLA 4MFCA 2OA8A 4LD0A 4MF2A 3C1YA 4HUEA 4TUQA 4E89A 2B5JA 3OJUA 3V9UA 4B9TA 1HPZA 5J0TA 5J0OA 5CZ2A 2BANA 2XY8A 3ISNC 2XRIA 4CFDA 8ICNA 2HHVA 8ICCA 1A5WA 4CJFA 4DTUA 4TSXA 1JL2A 1Z00A 4E1MA 2B21A 2Y1IA 3C1ZA 5CYQA 4RU9A 1IH7A 3B6OA 3SUQA 2MUTA 3UXOA 2IA6A 2UVUA 2W9BA 4O4GA 4P4OA 5HP4A 1BPYA 5EWEA 9ICLA 3T5JA 4M2YA 3Q8SB 4J9MA 8ICKA 4ECTA 4NY8A 8ICJA 1TKZA 4CHOA 1EP4A 2QK9A 5L1IA 4DOAA 4C8MA 4J9RA 1T7PA 4RNOA 3CYMA 4EBCA 3ZDDA 4FW2A 3AA3A 3ZCMA 3L8BA 1EKEA 5KFKA 1U04A 4P4MA 3VQ4A 3CG7A 2J6TA 4MF8A 5KFAA 8ICGA 3HVRA 5KFBA 1ZBIA 4F4KA 2P6RA 5KFXA 4I27A 4IRKA 4FJ8A 1RDAA 2Z1GA 4CEZA 1S0OA 3DM2A 2HNZA 4M3WA 4FS2A 4FLVA 4FZXC 1RYSA 3KJVA 1RBVA 5KFPA 1S1WA 1VSJA 3OYBA 5KT6A 4B9UA 5KFRA 4Z6DA 1JIHA 4BXOB 3MGHA 3RJKA 3MXJA 4TURA 1XHXA 4YFKA 4JUZA 3VQ8A 1TK0A 1U47A 1LWCA 4FK0A 2ZTEA 2R8GA 1S1TA 3QEAZ 4B9LA 4PHAA 2D5RA 2UVWA 3KHHA 3O3HA 4M3TA 5DKWA 4DF4A 3G6XA 4M6WA 3LDSA 1HNIA 7ICSA 4C8NA 4GC6A 4AHUA 4YQWA 3SUNA 3HK2A 1IKYA 1WAFA 4FLTA 5FDLA 4I9QA 3OYHA 2HVIA 2BPFA 3T5HA 2J6UA 2ZUCA 4FW1A 4PUOA 1QE1A 4CEQA 1UT5A 3Q8LA 5J0PA 7ICKA 4ECZA 4E1NA 3K57A 3Q8RB 4OVLA 3GIMA 5HMLA 3ZT2A 4MFBA 4M41A 1S6PA 3ZSVA 1ZQWA 2Z1JA 5CWRA 4KTQA 2HB5A 3L2VA 4Z4CA 8ICMA 1IKWA 4EZ6A 4FLYA 2A1JA 1ZQEA 4CJUA 4KLOA 5DBCA 3LP3A 4KLFA 1ZQYA 4JV1A 1QTMA 3DOKA 1ZJNA 3HP6A 3M9NB 4E0DA 5J2QA 4J9OA 3OS1A 3MFHA 2OPPA 2YNIA 4CHPA 4CGJA 4ED0A 4CJWA 3K5MA 3MR6A 2UVRA 2KZZA 1LV5A 1S77D 3RAXA 4RQ0A 3ZSOA 4KAZA 1BPDA 4TUSA 5CR0A 3AVFA 5EOZA 3SQ4A 4CIEA 2MAXA 5CB1A 1KDHA 2PI4A 5CJ7A 1ZQCA 1LW0A 1BVSA 2VA3A 5BPCA 4QZAA 4RQ8A 2NUBA 4CK2A 3V6DA 2R8HA 1BPZA 1VSLA 3K75D 3ULDA 1XO1A 4FCYA 3IM1A 5KG2A 3JPSA 4KLMA 4F3TA 3ASMA 3AU2A 3C2KA 3RMBA 4W5RA 4QZ8A 3PW4A 1HQUA 3NTUA 4E7KA 4QZHA 7ICIA 4ED1A 1TL3A 1KFTA 3H4DA 4M9GA 4B9NA 5KFCA 3BQ1A 1SKRA 4ECRA 8ICRA 3OYLA 5J2AA 4ECVA 2DPJA 4M3UA 4YNQA 4J2BA 2VG5A 3TFSA 9ICNA 3JPQA 3TQ1A 4XQ8A 4RQ7A 2BQRA 5KFYA 3TARA 4O3QA 4PGQA 3QESA 4OJRA 3AUOA 2HHSA 3V6HA 4LZGA 9ICGA 4MEXA 4FJNA 4KLQA 1BPEA 4HTUA 4IRDA 4CGDA 3QEBZ 4KPYA 4O3OA 1X1PA 4ECQA 3VQEA 4LZDA 1YTAA 3SPYA 4OLAA 2X6NA 4R8UA 3G6YA 4GMJB 4DU1A 4GLXA 2GV9A 5DB7A 4GXKA 5EU7A 4M42A 3A2FA 4KHYA 5KTQA 3K5NA 2VWJA 3TANA 3WNEA 4Y1CA 4KB0A 4E7JA 2WONA 2IGIA 4BWJA 3GDXA 2Z1IA 1JLQA 4I9LA 4FM2A 3JPPA 5CHGA 5J2HA 2JEGA 7ICPA 2DTUA 2Z1HA 4MFAA 3NDKA 4CJTA 2V4RA 3AA5X 2RDIA 2FLLA 4Z4GA 2RN2A 4PGYA 1TK8A 9ICJA 4Z4FA 3IHQB 2C2RA 1K1SA 5C25A 3SV4A 1KTQA 4ELTA 4I28A 1IM4A 3CFOA 3OHAA 1ZYQA 1DOQA 2ZQBA 1S9EA 4DFKA 5KFMA 3V81A 4IG0A 5J2BA 2DFHA 4FJ9A 3VQQA 3DRRA 5J0SA 1RT5A 4IFYA 4DTJA 3K5OA 2E6LA 5KFJA 3N97B 5J0WA 3PVXA 3RTVA 3QIPA 3ZSXA 3OVNA 1ZETA 3CQ8A 3G0ZA 5JS2A 1WSJA 1RBTA 7ICUA 4ELUA 1L3UA 2O4IA 4PY5A 1XS9D 3OYMA 4MQ3A 4DFJA 3OYDA 2ISPA 1C0MA 4YR3A 3V9SA 4EBEA 3M9MB 4G1QA 1RT6A 3SQ1A 2JEFA 1VSIA 4Q45A 4BDPA 3LZJA 2YHAA 2RDJA 1BCMA 1NK6A 3RJGA 2ETJA 4NLZA 4QZGA 4KO0A 1ZQRA 1UAXA 2D0AA 4UAWA 2ALZA 4LVSA 4OGEA 5KFEA 5CYMA 1X9WA 1N5YA 3K4GA 4IBNA 5KGXA 5J2PA 1O1WA 1J5OA 4EZ9A 1ZQIA 1J53A 1C6VA 1JLGA 1HJRA 1RTDA 4CIGA 4DU4A 4DTSA 1RDBA 2MUTB 4DQSA 2VG6A 1L3VA 2OYQA 2KZMA 1LWFA 2A1SA 4F93B 5KFVA 1DLOA 3S3OA 2IMWP 4YMOA 1TVAA 4K4IA 1TAUA 3O4QA 4QZEA 3EPIA 4Z6EA 1ZQGA 1VSEA 4RNNA 3RH6A 3PMLA 4NCBA 2WOMA 3PV8A 4O5CA 3KK2A 4E7IA 1CEZA 3NE6A 5KT4A 4RW6A 4O3SA 2F96A 4AHSA 1BQNA 3SJJA 9ICMA 1WSFA 1RDDA 3IG1A 3KLEA 4NCGA 4FBTA 1JLFA 3DLEA 2HVHA 1ZQPA 4CJ3A 3M8RA 4O5BA 1RT3A 3EW9A 2IHNA 4C8OA 3H08A 1WNSA 1RTHA 4LH5A 4DFPA 1LAVA 3QINA 4DFMA 4EP4A 3QEPA 8ICQA 1NJYA 9ICHA 3LP2A 2NRXA 4EYHB 5BOMA 2JEIA 1Y88A 5KFNA 4I29A 4R5PA 3KHLA 3V7KA 2X74A 3L2RA 1ZBHA 4KLUA 4DWIA 3F9KA 5FROA 1UA1A 2IBKA 8ICTA 3KD1E 2VG7A 4XRHA 2YNGA 3ZT4A 3OYGA 2W8LA 4N47A 2M9NA 8ICPA 3JPNA 3MBYA 4AH9A 5D3GA 3NAEA 4QZCA 3TAEA 3HJFA 3M8QA 2KFZA 9ICWA 3SI6A 3PW7A 3V9WA 3AV9A 2OPRA 4UB1A 4I2EA 1KLMA 4IQUA 1RCHA 5C42A 2ASJA 1SUQA 3UXPA 3AVMA 4JRPA 4J2EA 7ICTA 1KFSA 3PR5B 3AO2A 9ICPA 3VQ9A 3MR3A 2KQ2A 5KG5A 1LB2B 3ISCA 2IAJA 1F21A 3T1AA 1JMSA 1T03A 3MXMA 1ZQBA 1ZQNA 1V9PA 4DU3A 1NK7A 3F73A 2XO7A 5D46A 4KN4A 4E7LA 5DG7A 1RTIA 2G8IA 3S3NA 8ICOA 2VA2A 3PW5A 5DB9A 3AVCA 3NF7A 3OYJA 3AU6A 3OSPA 1RBUA 4CJEA 4RPZA 1HQEA 4DTOA 1TAQA 2DFLA 3C94A 3C5FA 2HHUA 3V4IA 1Q9YA 1SL0A 3BQTA 2ZJ5A 3LP0A 4CF2A 1L5UA 4CJRA 3ZDBA 1R0AA 4YFUA 1JN3A 4IR1A 4RUCA 4JV0A 4R64A 3KKSA 1PZNA 4O44A 2OZSA 4KLHA 3OYNA 3SPZA 5DBBA 3HVTA 4JWNA 1A5XA 2OZMA 4O3PA 1TK5A 1TKDA 3AVLA 4KI6A 4KKOA 3VQ6A 5KG6A 7ICFA 2QXFA 2NRZA 3RMCA 4FJJA 3JPOA 3RB6A 3L2QA 4LSNA 3H8WA 3AVGA 4QZBA 4NM2A 2BGGA 2BCRA 3NH1A 4KTWA 4I2FA 9ICVA 4DO9A 4CHYA 5KFIA 1I39A 2IS3A 4RQ5A 3V7JA 1CXQA 3TFRA 4KV8A 1HYVA 2LYHA 1ZQSA 2I9GA 4B8CA 3FDSA 2QKBA 5I3UA 5J2FA 3LAMA 3EZ5A 4DL4A 1HYZA 1KSPA 2FLPA 4DQRA 1ZQMA 1UT8A 1T8EA 4Q8EA 3ZT3A 4F5QA 1VSFA 1S10A 1GOBA 4ECWA 2R7YA 3VQPA 2BHNA 2BQ3A 2VANA 4DTRA 2R8KA 3H4BA 3U3GA 2ZJ8A 1NK0A 4HUGA 1XSPA 1JKHA 4QWCA 3UXNA 2ZTCA 5DDYA 2ASDA 4XUSA 4KLSA 3GIJA 4FBUA 4YXMA 2OPQA 4DS5A 3V1RA 5J2MA 4J9NA 2ZD1A 3ORYA 4BE1A 1RT1A 2R8JA 1L3SA 1XSNA 1TV9A 4IRCA 5J2JA 4J9KA 1NJZA 4UB4A 4EP5A 4NCAA 4YMNA 5DB6A 1D5AA 3GV7B 1B92A 3NF9A 4B08A 4FO6A 3O3FA 8ICZA 1W9HA 1TL1A 3MXIA 1ZQZA 4JRQA 4R65A 1QLNA 1RBSA 2FC0A 4ED3A 4NM1A 2YNFA 4I2DA 4CFAA 3PX4A 4F91B 3WNFA 3U6FA 1W0HA 3C2LA 3P83D 1NKEA 4ID1A 2XHBA 5CZ1A 3QEXA 4FXDA 4UAYA 4R66A 3DI6A 4UAZA 5KFLA 3RB0A 5DGBA 8ICSA 4FJIA 4ELVA 1CXUA 3OHBA 4LSLA 3HT3A 4RZRA 1DTQA 5EWFA 1S1VA 4Z4HA 1SV5A 2EHGA 3PR4A 3GILA 4FJKA 4Z0UA 2E4LA 4OGCA 5T7BA 2HHXA 4KLJA 2F1JA 1EX4A 5HNKA 3TAMA 5L9XA 5HHHA 5KFSA 4ECUA 1HYSA 1JLCA 1ZQKA 4E19A 4RQ3A 1ZJMA 7ICRA 1BI4A 4FJGA 3RRHA 1NK8A 4O5EA 4CK1A 4HUFA 4CIFA 2FPMA 4YP3A 1N56A 1LW2A 1ZQAA 4N41A 3SYZA 1N48A 2KFNA 3KHRA 5J0YA 4QW8A 3DLRA 1YT3A 4CERA 4I2BA 2FMQA 3TABA 1IG9A 1IKVA 3HPGA 3OY9A 4FVMA 2D0BA 5C5JA 1H38A 4F5OA 4DSEA 3LALA 4CJ4A 4FLZA 3K58A 3TAFA 2FBVA 2JGUA 3VQCA 2ZTDA 4ZTFA 2F8TA 1QQCA 4P4PA 8ICAA 2JZBB 1XHZA 3BGRA 1C1BA 4C8LA 3QZ7A 2XCPA 7ICNA 3NGYA 3NHGA 3TAGA 4CJQA 1U9LA 3I0SA 1QSSA 4KHSA 4Q0BA 4M47A 1QS4A 1TFRA 3TI0A 4UQGA 2F1IA 3MR5A 1BL3A 2NRVA 5C24A 2VWKA 3Q8QB 4BDYA 3SUOA 4KI4A 5D4BA 3PUFA 2BPCA 4FM1A 4TQSA 5HHIA 3TAQA 3HPHA 3H8JA 2RF2A 4ECSA 1RILA 5IIKA 4QWDA 3OYCA 5F9LA 3FFIA 4K8XA 1U45A 3VQ7A 4RNMA 3RJHA 2JEJA 3RR7A 3PW0A 3T5LA 4DG1A 4OKKA 5E41A 2ATQA 3AVIA 4CFCA 4G3IA 8ICFA 1ZQTA 2Q0ZX 3DLGA 4BACA 2AJQA 4KMUA 5KFGA 1JLEA 3HL8A 1S0NA 1NKBA 2YKNA 1FXXA 7ICGA 3NGZA 2B4JA 1T05A 1SZPA 5JUMA 2I1QA 3UQ0A 4P2HA 1JXLA 2HHTA 3KLHA 5KFHA 3CFPA 2V9WA 4NLNA 3O4NA 3RJEA 5J0UA 1KVAA 1G15A 3OYAA 4CJVA 4HCCA 3PNCA 1ZQFA 1KLNA 4RQ4A 1KRPA 5IIOA 2BKEA 4FK4A 1HNVA 3MECA 3PY8A 5DGAA 2UVVA 2G8WA 1JXBA 3MEDA 3THVA 1L3TA 3DLHA 1EXQA 5KFWA 4O55A 3EWAA 5IIIA 4WE1A 1B43A 2PXIA 3ZSRA 3JSMA 4KLIA 1CUKA 4ED6A 9ICFA 3M8PA 1FKOA 1ZQOA 3TAPA 1RZTA 2HW3A 1REVA 1X9SA 3SZ2A 4W5TA 3EYZA 2BCUA 2E6MA 3K59A 2AQ4A 1U48A 3OYEA 3QEWA 5DMRA 4I2HA 4DTXA 2XY6A 3DYAA 3MABA 3MAQA 4F2SA 1ZQHA 3KD5E 3Q8KA 4RW8A 3B0XA 1KEJA 3DRPA 5K14A 2BCVA 4KTZA 1CZ9A 1RDCA 3AVJA 1TVRA 7ICQA 4KRFA 1RXVA 3RB4A 2X6SA 3LDAA 1SKSA 1RT4A 3VN5A 4NXZA 2KTQA 4DSKA 2DFEA 1NOYA 3M9OB 2W9CA 5HRPA 1ASUA 1KVCA 4YD1A 3QEVA 4Z6CA 1K1QA 1Z00B 3LPUA 3QE9Y 3AA4A 3V9ZA 3DMJA 3M8SA 3ZT0A 5IIMA 1WSEA 2W9BB 5SZTA 4GC7A 1BIZA 3P1GA 1ZBLA 4DL7A 1B9DA 1RBRA 1BISA 1QSYA 4F4YA 3JYTA 4F4WA 5DG9A 1IXRA 2IHMA 4CJKA 9ICXA 2FBTA 4CGIA 5FRMA 4BDZA 4Q8FA 3DLKA 4RW9A 1RYRA 3QNOA 3RH5A 4EEYA 2XY5A 2P66A 4CECA 1YVUA 4ED7A 4KHNA 1Q8IA 2J6SA 4I7FA 1FK9A 2P6UA 5F9NA 4CJLA 3AO5A 5KT2A 4W5NA 3ZDCA 3SV3A 4YG2A 5HLFA 2KN7A 4KHQA 2HHWA 1YTUA 4RW4A 4DEZA 2YHBA 4ID5A 3V1QA 4AILC 2NRWA 3KHGA 3QO9A 4HHTA 3RMDA 2IC3A 5J2KA 3KK1A 4MEYA 3DLBA 3NH2A 3UQ2A 3PX0A 4FK2A 1WCLA 4AHRA 2ZJAA 8ICWA 4LY7A 3L2UA 3U3YA 3RH4A 1FKPA 4DL3A 4PWDA 1HRHA 4PA1A 2VA8A 5CY4A 7ICEA 4J9LA 9ICCA 3PX6A 3KLGA 3P5JA 5KT7A 2C22A 2GUIA 5FRNA 4B9MA 3GV5B 1D8LA 1XU4A 2YV0X 1J9AA 2PFPA 2DY4A 3N4MB 1U4BA 1KVBA 4RPYA 4M9JA 8ICHA 9ICEA 1Z3EB 3LANA 3GQCA 2AGQA 1JXEA 4YR0A 4M6WB 5KT3A 4RUAA 1Z25A 2C2DA 3OYFA 3DOLA 3HP9A 4IKFA 3MDCA 1BHLA 4CF0A 4CCHA 2YNHA 3V72A 3V6JA 4CEOA 2AQ0A 2W9AA 3VQBA 4CJ5A 3WNHA 1WCNA 1X9MA 1RXWA 5DLGA 4KHUA 4CGHA 4AHVA 3K2PA 1ZBFA 2GBZA 2KZ3A 4QWEA 3RJJA 3ZSQA 4O9MA 4FJHA 1ZQVA 4F8RA 1HUZA 5DBAA 3ZSWA 3AVNA 3AA2A 3L3VA 4Q44A 3KIOA 2A1JB 3KK3A 4OPKA 4CHZA 2G8HA 2OPSA 3V9XA 2BCQA 2A1RA 4X5VA 5KFDA 4CJSA 3KLFA 3O3GA 3ISDA 4PGXA 1QHTA 1VRUA 3RBEA 3ETLA 2BDPA 5L1KA 4QAGA 4K8ZA 4BGDA 1BGXT 1VSKA 1IKXA 5DK5A 2YKMA 4HVJA 1HMVA 4QCLA 5J0QA 3C23A 5J2DA 4UBBA 4J9PA 1C0UA 4MFFA 2G8UA 3SQ0A 2HHQA 1BI4B 1CZBA 4FLWA 1C1CA 1NJWA 4I2AA 3GV8B 2FMPA 3T19A 5DQGA 3QZ8A 4I2JA 2PFQA 4FJ5A 1ZQQA 4E7HA 3RB3A 2IOCA 4B9VA 3SI8A 2G8VA 3HM9A 1MQ2A 3GIIA 4M9HA 2Q3SA 4PPXA 1J54A 3ZD8A 1VK0A 1VRTA 4DOBA 1X2IA 2LSNA 1EETA 4L8RB 4K4HA 8ICVA 4H4MA 2IDOA 4F92B
chains in the Genus database with same CATH superfamily
3HD1A 2RDDA 2JFKA 3I0SB 3T1YK 2L9WA 2HNYA 3ONQA 4HYKA 1Q86O 1XR7A 2NSCA 3R7NB 1S1UA 2G07A 1SL2A 4F25A 1A76A 4UARA 1NK4A 3TA1A 4QZFA 2C1EB 4KFBA 3MMBA 4BRKA 3R6LB 4HT7A 4MIBA 1QD1A 4DTPA 4R8UB 2VC1A 1VSDA 5AQIA 3H8MA 1YTYA 1BNOA 2KG5A 2CFXA 2XGPA 2QB0B 2OIHA 2D41A 1P6TA 3S8SA 3CFRA 4CRJA 1RWWB 2IM1A 1BOTO 1LFWA 1K6YA 1F0XA 4I2IA 5EWGA 2XLIA 1S59A 3MZIA 2BTFA 2PD1A 4FP9A 5A6PA 1RT2A 1GK8A 1FWPA 4EI2A 2CJAA 1HPMA 3EPGA 5DLFA 3L4IA 4K0KF 1NNDA 1IO2A 3SQ2A 3FNNA 1NG9A 4WQ5C 3AB2B 2C2MB 2MQQA 1ATNA 2PI5A 4CEFA 3FAHA 5C25B 2CJKA 1YITN 4DV1K 4S0MA 4PL8A 5E79U 8ICXA 1R27B 2QX0A 1S4EA 3MEDB 3PO5A 1WELA 1RNHA 2FGCA 5IT0A 4FZYA 3KKRA 2C2ZB 2I5JA 2HMIA 4DR4F 4JWMA 3AVHA 5IILA 2RPIA 4ECYA 5LMUF 2HIQA 1UHUA 2KM8C 4IG0B 1XMQJ 3QT8A 1A77A 3US5A 2UP1A 3H6EA 1S7HA 4JOUA 3AVAA 3M6UA 5AQPA 3M8PB 1C0GA 3O3LA 3JSYA 3AO3A 2W40A 2AJ4A 1HNWJ 4CEEA 1NKCA 5BPLA 4RG8A 2PY5A 1NJXA 1WSHA 2M3DA 4C8KA 4G1QB 4DV4J 3SSRA 3R5GA 2KL8A 3QEIA 1PAEX 2CKWA 2W42A 4CGFA 5AZIA 5LXYA 3RAQA 2ISOA 2LYVA 4IO8A 3Q8PB 1UVKA 5CYMB 2B8PA 3BUZB 1FXDA 2J8AA 3ZSZA 2YMMA 3P49B 2JHDA 3NS1A 3KTQA 3AL0B 4ZDNA 5ALHA 1Z1VA 4GW6A 4UW2A 5F8MA 2D1KA 3TJAA 5JMNA 3QSYB 4BE2A 1AB8A 1RTDB 3I8DA 5KNIA 3B0YA 1YSJA 1P8ZA 1LCUA 5DB8A 5HBMA 2N7CA 2VG6B 3KBBA 3A8IA 3ISBA 4M5GA 1OH8A 1F2GA 2XZWA 1DLOB 2YHYA 2VBWA 2DHGA 5FPDA 4UB2A 1PO6A 3LWLA 2JRSA 1X42A 5FLXU 4TUPA 2V4QA 1F5AA 2VQFF 4FZZA 2CGKA 1FHTA 3L9ZA 4EFAC 2ZG6A 4QR2A 3AGRA 1UVLA 3HSGA 2A5XA 4IOAQ 4RW6B 2RIJA 2XG8A 2UV8G 1PYTA 5DZ6A 4ZVSB 4JI8F 4LF5J 1VSMA 3VQDA 5KG3A 1SC4B 1U1PA 3KLEB 2V8PA 3FBBA 1ASWA 4R79A 4GV3A 4UATA 3TQEA 5F0XA 1Y4ZB 2HS4A 4IR9A 4NLWA 3CCEN 5ALWA 4C8YA 3L3UA 2ZKTA 1SJFA 3K5LA 4RT3A 2JWNA 2NS1B 1U1QA 3QERA 2HAFA 4RQ2A 5U47A 3VGMA 4X4SA 3HSTB 4BGBA 1HI0P 1TKTA 1F60B 3H46O 3LM2A 4K4XA 2O8EB 1Q4RA 1HHSA 2FGOA 2W04A 5KFFA 1X4CA 7ICMA 2M8HA 4JI7F 1CVJA 4RQ1A 3A1YG 4HHUA 3FZBA 2LKYA 1Z4OA 3NY0A 3SBMA 2HBJA 3DRYA 1ZXOA 5J2IA 9ICIA 2ASMA 1QQ5A 4H54A 3CM5A 1F3VA 2YWWA 4TLRA 2JC0A 4CF5A 1TV6A 5D3GB 3GIKA 2V8DA 4JI1K 2HZAA 5JU5A 4DSLA 2DH9A 2G8FA 3THTA 5C42B 1KN6A 1SUQB 2QEXS 1C7YA 1PAUB 2XTJP 3J7ZT 4MLHA 3GJQB 2Y1JA 3TOQA 2MQ8A 3C66A 2DO4A 3L2WA 2RVJA 4KLEA 5AKKA 4NLRA 3T1HJ 3N5FA 3MFIA 2DD8S 4OPJA 5IC6B 5HJYA 3MDAA 4DV7J 5EX5A 1N6QA 4B1VA 3EN9A 3KWIA 4MLEA 2UU9J 4DR5J 4JI3J 4JI6K 1S9FA 2OFHX 1S0VA 1WSGA 2BJ9A 4DU7A 4BREA 2KJ8A 2WF7A 1BIUA 4UUXA 3PIPQ 3BJYA 1BO5O 4DB3A 4ED4A 4DL2A 5IC4B 2DF4B 3V4IB 1CI4A 5HRNA 1SKWA 3NGIA 3RR8A 3B6PA 4OI4A 1S1XA 3QETA 4UB8U 4JI2K 1T95A 5L1JA 4GV6A 1VQ8N 1C1CB 1MA7A 4QIWD 2GHPA 3D54A 3HFZB 3NS6A 2KVQE 4FKYA 4RW7A 1ZXIA 2QLBB 1PSDA 4LRBA 5HRSA 3NFAA 1ITGA 2YTCA 2ZITA 2HF4A 4F5NA 2M70A 1WN7A 1WG5A 2HDOA 1BCOA 4NYNA 3K0SA 2BE2A 1X3NA 2WTFA 9ICOA 1HWLA 3JSBA 2XULA 2LMIA 4JP8A 5GIOA 3GZ7A 5T7LA 2QIFA 1YJNS 1BLUA 4Y2KA 1VSHA 2A3ZA 1N36F 3OLBA 3FCWA 3I96A 1VHXA 4I67A 1U1MA 2V94A 4ZPTR 4YY3F 4QWAA 4CH1A 1TFWA 3VOVA 4OJLA 1EJ7L 3O8MA 4JMUA 1OSDA 5A76A 4XK8C 1VLOA 1S5JA 2JH3A 4RWTA 2V8VA 2Y8YA 1WHVA 3P5BP 1HW8A 3DOMA 3THYA 4FYDA 4FS1A 2CQBA 4A5BA 1R0BG 2E9TA 2H3EB 4LH4A 5AFUA 2AU0A 4CEAA 1Y5NB 4M3RA 2HS3A 2XQCA 1NHUA 2F2AB 2BUPA 5BRHA 3QGHA 4FOEA 2K4HA 3HYFA 3THWA 1XC9A 1QJHA 2EZXA 3VVTA 4RT2A 3FSYA 4JYAK 3KLIA 4KYZA 2B6AA 4IFVA 4I64A 5M1NA 2LQ8A 5C12A 2NYVA 2BQUA 3UKUB 4DS4A 1F5BA 3DEEA 1S3XA 3FR0A 3NKYA 2RMLA 1KCFA 2YKAA 2NQPA 4UZBA 1ZBUA 3THPA 3O5TB 3FEZA 4F5RA 3NF8A 4IFEA 1EQYA 1EQMA 3JAMY 4H4OA 3GB0A 2JR5A 1YJTA 5HMYA 3T5KA 2VKQA 1MC8A 2CQIA 3RYLA 4DL6A 4H5RA 4LF7F 5J2NB 3H0RB 1OPIA 4FPIA 1HNZF 1X4FA 3J80Y 2GWSA 2ASYA 1H1VA 3PDNA 1Z26A 1NGGA 2ZUAA 2PE8A 2J0SD 3QNMA 3HX0A 1WHXA 4YDDB 1SI9A 4O0JA 2DHSA 1UTAA 1E6YB 4ZN1A 3MR2A 2IMOA 2OSQA 3J81O 1CQMA 2ROGA 4BC7A 3NCRA 2OJ3A 1DXSA 1O13A 3T79A 4CT9A 2OA8A 4L76A 4WKYA 3TEHB 1ZM3A 1HPZA 1DK2A 4ZHRB 3HHLC 5J0TA 5T14A 2VFTA 4LFCK 3SCKE 1FX4A 4WYBA 2QB1A 2UXDF 1GEHA 4N7TA 3IN5A 3W1YC 1UEKA 3EGWB 8ICCA 4Y2XA 1Q46A 4TSXA 4B3SJ 1FEHA 1CQNA 4KJIA 2Y1IA 1RAFB 1PILA 3NRZA 2E2NA 5HVFA 4WZQA 4NA1A 4U8VA 1OVYA 4IZ9A 2UVUA 3NNAA 2DGUA 3Q7BA 2UUCF 1HQ2A 2NXNA 2G08A 2HBRB 3Q8SB 1GX5A 2DR9A 4CVNE 1S22A 3DXSX 8ICKA 3VQSA 3M05A 4JI4F 1WKJA 3O44A 4CHOA 1NZPA 2QK9A 4C8MA 4J9RA 1T7PA 4RNOA 4PKDB 3T6JA 2JWKA 2CJ9A 3CMES 4HDHA 3OFFA 4FW2A 3AA3A 1EKEA 3LPYA 1KQSR 3H5YA 3H42A 3K8WA 1RWMB 4OYMA 3R2DJ 4QIGA 4Q0BB 1P9QC 2BKOA 3EE3A 2LXUA 5C24B 5AM1A 2FHOB 4MF8A 8ICGA 1ZH5A 1B0XA 5KFXA 4I27A 2RF2B 3A5NC 1TQLA 4AQYK 3DM2A 1R59O 4LJMA 3FRZA 3I55N 1CJKB 2GVDA 4WFYA 2BJDA 5KFPA 2UXCK 4LJXA 2WCXA 1S1WA 1VSJA 5KT6A 4B9UA 5KFRA 1E4FT 4TU9A 1HL6A 1GAOA 3A3PB 4J9VA 4BXOB 4MHVA 2IOFA 3TKAA 4TURA 4JUZA 4JI5J 3MM5A 3VQ8A 3KWGA 3QJJA 2ZTEA 1KS2A 4KR0B 3QEAZ 1KQQA 1HBMA 3O3HA 2CQ4A 4DF4A 1VQMS 2KSOB 7ICSA 1IBKF 1LWEB 5M1KA 1WC4A 1VIOA 1IKYA 1KOOA 4CTAA 2FDNA 2HVIA 5AZJB 4IOXA 3MECB 4OX9J 4FW1A 2GO8A 2W2OP 5A8WA 7ICKA 5GTIU 1NBWA 4UOCA 3Q8RB 4OVLA 3NMUA 2EKYA 2VDIA 5HMLA 1IWAA 2QO3A 4FYVB 2QZ8A 4MFBA 3ZSVA 3CCSN 2HB5A 3L2VA 3VGSA 4Z4CA 2E88A 3A8KA 4ZPDA 2E1AA 5FJ4A 1FE4A 4KLOA 5DBCA 1C0TB 4YDUA 3ZZUA 2U1AA 1NWKA 2OLWA 4E0DA 5C2GA 1UEVA 1RHUB 3R3LA 2XLJA 2OPPA 2QT7A 4KPCA 2YNIA 1N62A 3MR6A 2W2MP 2KZZA 4QJVA 1LV5A 3DRPB 4RQ0A 1OKJA 5IS2A 5CR0A 3IBPA 2JVRA 3AVFA 3WQUA 4CIEA 2MAXA 1QAXA 2HRTA 1ZTTA 2PI4A 4G1PA 1BVSA 4NXMF 1HUXA 5LL6Z 3T7ZA 1KKXA 1GXUA 1BQXA 5BPCA 1WYGA 3LPEA 4QZAA 4RQ8A 2DIUA 5CA5A 4PCQA 1ZRMA 4DUYJ 2R8HA 1BPZA 2KO1A 2B9YA 2PFDA 1JK9B 1V3SA 5DDQC 1XO1A 4GNIA 2XM3A 2P9NB 3P4UB 1KXPA 1TUWA 5F1XA 4KQZA 4WFXA 5JVGL 3VETA 1RWXB 1YK9A 2FPHX 3NVWA 1GQEA 1GMWD 3KUEA 2DH8A 4OYAA 4W5RA 3L7UA 4QZ8A 1HQUA 2DBBA 2DIVA 2E8MA 4I69A 3FK4A 1IBMK 3K5PA 2HOQA 4P75A 2E1RA 1FCAA 5IM0A 1QUPA 3RAMA 3MCPA 5J2AA 5CQGA 4M3UA 2RQCA 4HT5A 2OI2A 4K42A 4J2BA 2P8IA 3JPQA 1UZDA 4AM7A 2HHSA 3DDIA 4ZJLA 3SLCA 3VEZA 4DV1J 1QVGR 2BOPA 3OTOF 2UUBJ 2LMRA 9ICGA 1V3RA 3HI0A 4FJNA 4HTUA 4GKKK 2WBNA 1N52B 2L9DA 2GX9A 4KPYA 4O3OA 4CO1A 2W01A 3F5TA 3FMWA 1RWVB 4A57A 2Q0UA 1KONA 2E7WA 2DT9A 4R8UA 4DU1A 5BPMA 1YUWA 2K1RA 1HBUB 4DV3J 1H73A 4OZNA 4GXKA 4M42A 2E9ZA 3LDPA 4WK1A 3KG1A 5AKEA 2YMQA 1FX2A 4DV5K 3WNEA 4E7JA 3HHEA 4C98A 1V4TA 2W6KA 4BWJA 3V2UC 2Z1IA 1DBDA 2FJEB 5DJBA 5GAGU 4B3TF 2OTJS 5J2HA 2JEGA 1N5TA 3DOLB 1XNRF 2AT1B 2Z1HA 3GJTB 4MFAA 4TLQA 2OHFA 2ZIWA 4LMZA 4WP8A 2FLLA 4Z4GA 3O08A 3N7PD 1B70B 3LGHA 1HI1A 1WHYA 4PGYA 5CHIA 9ICJA 2QL5B 5C25A 2V2QA 4J7CA 3AAWB 3TADC 3BF4A 2ZWPA 3W2WA 4ZIVA 2QLWA 1GXLA 3KDOA 3OHAA 3BH6B 4YS2A 1NZ8A 4IG0A 1XNSA 2DFHA 1VBZA 2OPSB 2QL7B 1Z1BA 5HSPA 5B0CA 3VZIA 1MU2B 4GVEA 3RTVA 3ZSXA 3OVNA 3CQ8A 1WKLA 3G0ZA 3ZTOA 2BEFA 1WSJA 7ICUA 4PKIA 4TXSA 2O4IA 2ZE2B 4ZCIA 3OYMA 3ILLA 4PKHA 2YKMB 4YR3A 3M9MB 4G1QA 1HMVB 2YHWA 4BDPA 3WQTA 4DUZF 2A6MA 1BCMA 1K8AO 3RJGA 2K4EA 4QZGA 1VQNN 1VGYA 4KO0A 1UAXA 2EI5A 4CZIA 4LF6K 2ALZA 3B4MA 3RF9A 5CYMA 1N5YA 3OW2R 1RHKB 3KG0A 3PSIA 2AMCB 3QT6A 3JTOA 2ZVSA 1YJWS 5M1QA 1O1WA 2MEWA 3EX7B 2NSBA 2YWFA 3LGNA 4EZ9A 1RTDA 4LF4K 3UR3C 4L75A 1VQLN 4DQSA 1J5EK 2VG6A 2V9KA 5GIPA 2YJEA 4OV6A 2KHVA 1J97A 2GAHC 1BUPA 4ISEA 1FNXH 1DLOA 3S3OA 1I1GA 3PM9A 1N88A 3IG8A 3CJSA 4DV0K 3FJ2A 3O4QA 1X60A 3RGIA 4Z6EA 2OYYA 5LJ5Y 2VZ9A 1QTNB 4USMA 1FO1A 1NGAA 3PMLA 2F9TA 2WOMA 3GCXP 1T9WA 1TZ0A 3OTBA 2VPYB 3C8YA 1CEZA 3NE6A 5KT4A 4RW6A 9RUBA 3JSRA 3F44A 3KLEA 2NXEA 2HVHA 3M1YA 1JRPA 5ETQA 1NGCA 4CJ3A 3M8RA 2IHNA 3BV8A 2VPZB 4UTGA 3J7YU 2F5GA 4AD6A 1WDDA 4BRCA 3M7DA 1IR1A 3WU2U 2MXYA 3KJVB 1N0VC 4ZP7A 8ICQA 2E1EA 4EYHB 5BOMA 3O1BA 2BM1A 4TY8B 4I2QB 4DR3F 2VJ5A 2O8EA 2V8GA 1C4CA 4DWIA 4Y2IA 1UA1A 4EWTA 3U27A 2IBKA 5D0HA 4OYBA 8ICTA 4NWBA 4JI2J 5D77A 3DU6A 4LIRA 3UQSA 4XRHA 4L3NA 2CZVC 2R7QA 3OYGA 2W8LA 3BPSP 2VQEK 5J1EB 1UL3A 3JPNA 4YORA 5D3GA 2DKXA 2FJAB 3HJFA 2DISA 3SI6A 3V9WA 3AV9A 1ZZFA 2G4BA 1NAQA 4IO9Q 4I2EA 1VQ6S 5C42A 3UVJB 1SUQA 3UXPA 2ZJQL 5KAFU 2F40A 1P1TA 4F0MA 4JRPA 4PQUB 2PDAA 3QBCA 1PVQA 3BF3A 4UUWA 2DNOA 4PEOA 3Q2SC 3CMAS 2W2PP 3AO2A 5C2FA 4A62A 3RSEB 2GMLA 3VQ9A 1WOPA 3MDFA 5KG5A 3KZXA 4NLTA 3GYGA 2IAJA 3HX9A 1V38A 1VLYA 3OFEA 1WC5A 1V9PA 3OTDA 3DRSB 1B0PA 4DU3A 1NK7A 3MURP 1N5QA 2XO7A 5E5NA 1YQHA 1UVNA 4X4TA 4E7LA 1RTIA 3S3NA 4ZPVR 3QGIA 3HKZD 2RHFA 5DB9A 4NWIA 1DQ8A 1XN9A 2EANA 4A5AA 4RPZA 1EX8A 2ES6A 4PXCA 5AI8A 3ZO7A 1JLBB 3V4IA 1AT1B 2ZJ5A 4AFFA 3CJTA 1H7XA 1FD8A 4RUCA 4PL7A 3UN5A 3UD3P 2V67A 4A8EA 1PZNA 1VCTA 4DHYA 4KLHA 5DBBA 1TU0B 4DV6J 4ATNA 4F72A 1X9JA 3HVTA 4JWNA 2I7NA 4DR2F 5B8HA 2W7PA 3J81Y 1TK5A 3AHPA 2YQ3A 3VWSA 4YB5A 1P27B 2FF3B 2QLTA 4CI0B 5SUHA 1NJIT 5HR6A 2RAQA 2V2VA 2XNQA 4US9A 1D1UA 4J5OA 4I2FA 4KHRA 5KFIA 1OY6A 2IS3A 3MM8B 4RQ5A 4BVOA 3ATUA 3MCNA 2I9GA 4C0ZA 3EZ5A 3NGKA 4MO4A 3FZMA 2FLPA 4FZNA 3DDHA 3ZT3A 4F5QA 1S10A 4MO5A 3I32A 3S6EA 2BHNA 1H2TZ 3R6MA 4OZ2A 1CC7A 3CDWA 3H4BA 3LVVA 3U3GA 2O66A 2DGQA 2X1AA 1VMBA 3THXA 3UXNA 2ZTCA 2ASDA 4C3LA 4FDFA 1GH8A 2R7SA 1YIJN 3V1RA 4LVNP 2AYBA 3ORYA 2KXNB 3HKWA 3UE2A 3ISND 2QSWA 2W7AA 1ZPWX 4DR4K 4X65F 3L6QA 4J9KA 5E84A 2F1FA 1NJZA 1X4BA 3CJ0A 3D2SA 1VOMA 5DB6A 1QQ6A 2JV3A 1V5IB 2EVZA 3GV7B 1JLQB 1Y5IB 4B08A 5CZVA 3HHDA 8ICZA 2BJ1A 2I6WA 4CDIA 3D0GE 3W62A 3MXIA 5MLCV 4LT6A 1EKSA 4C8ZA 3EXYA 4IG3B 5M1PA 2ZWHA 2RSQA 4LRAA 4CLFA 4I2DA 3PX4A 5IT4A 3ZLJA 2BW7A 1OS5A 3CC4S 2J7KA 1VDVA 4DZ6A 3N6MA 4R66A 3KUHA 3DI6A 2CWXA 3RB0A 1LVHA 1IR0A 5AKYA 4DKWA 3V81B 4RZRA 5ALJA 3H0LB 1RABB 3WXKA 5ADXH 3PR4A 4BR9A 2D6FC 4IDHA 1Q3UA 2XS5A 3T9ZA 3OL7A 3PJ9A 2GNKA 4IKAA 3TAMA 4DPOA 3S41A 3W3SA 1OH6A 4AQYJ 2ILZA 3HCXA 1RT6B 3M8YA 1A0PA 1UWBB 4CK1A 3VEWA 1HKAA 3C15A 2HZCA 4M8LA 3D3CJ 1NSQA 1YJ9N 2FPMA 1RWKB 4RL1A 1RE1B 1ZQAA 4B1XB 3VV2B 1WWHA 3KHRA 2P9UB 4QW8A 4CERA 2FMQA 2DKZA 2CVEA 1DHMA 4YOUA 3WHIA 4M7XA 2GV1A 4MYUA 1IKVA 4X2BA 2W6LA 1J5OB 3M8WA 5F8LA 1WACA 4FVMA 3UWTA 3UCZP 4AL6A 4DSEA 3AY0A 2XMKA 3ZZOA 4CJ4A 4ILHA 4CLUA 3DC2A 2JGUA 2F8TA 2YMPA 2JZBB 1XHZA 2AEJA 1RDWX 2K60A 5G4DA 1BMQB 3TVYA 1M5VC 4YOVA 3CGIA 3BEXA 1MWQA 3TAGA 4Q0BA 4KE5A 1YJVA 5C24A 1ZZNA 4TYBA 1BL3A 4CDGA 3B4DA 3SUOA 2F65A 3WEEA 2QWNA 2BPCA 4RNHA 2BJ8A 3H8JA 2RF2A 3HSJA 3SJHA 2PEBA 2Z4PA 1RILA 1IN0A 5IIKA 5F9LA 4K8XA 3GE9A 1JLFB 4HLBA 1CJKA 4OKKA 4WF9Q 4CZKA 1SZHA 4DBQA 3HFKA 4B1YB 5E41A 1FESA 3AVIA 1KL9A 2EZZA 3ITHB 4CFCA 4NX9A 5HVGA 2HZVA 1S6QB 1ZQTA 1PVPA 2AJQA 4KMUA 5KFGA 3LP2B 4YOWA 4QIWC 1S0NA 3HL8A 1FXXA 2B3TB 3QMQA 2B4JA 3NGZA 1F2HA 2K8CB 2UU9F 2EXUA 4DR5F 3GFYA 1NHKL 1RB0A 5KAKA 3LA0A 2JLGA 3VERA 4ZMMA 4UAVA 2MGZB 2LVWA 5A2QO 1KVAA 2RU3A 3OYAA 2DNHA 2F4VJ 1KLNA 4RQ4A 1GLFO 3EJMA 5IIOA 2O01C 1HNVA 5AZJA 3MECA 3PY8A 5I42B 2ZIVB 4NLQA 2IM0A 4FWQA 2KRBA 1K0TA 3TUZC 3VTIA 4O55A 1SPBP 2WTUA 3IR6B 1KLMB 1IBMJ 2PXIA 4PXEA 2C2NA 5BN9A 1CUKA 1L7NA 1HWKA 1RU1A 1X0PA 4WYLA 1FFSB 1RZTA 2HW3A 4QYZK 1SQEA 2DH7A 4WU3A 5AKZA 2E6MA 3C6HA 3OYEA 2KJWA 2VKRA 1SQKA 3MABA 4AUKA 5GAHP 3BM7A 4L72B 3OV7A 4F2SA 1ZQHA 3Q8KA 1AFJA 4DPWA 3DRPA 4UY8T 3K8VA 4GKKJ 4KTZA 1RWUA 3EICA 3NL0A 1CZ9A 5GMKa 1MLAA 1BA1A 2UUTA 3AVJA 3OR1A 1TVRA 1YJ7A 1A6LA 1SXLA 2A1BA 3SSQA 1RXVA 4IS7A 3LDAA 1SKSA 4CLSA 3ETRA 1HQEB 4NXZA 2OEKA 4NMLA 2AYEA 2C2KB 3M7VA 5M2PA 1N36K 7FDRA 1URJA 1NRKA 2K8BB 5AJ3K 3OXLA 4C0BA 1S48A 3VPZA 3ZT0A 4DV5J 1WSEA 1V3ZA 3P5TL 1OXJA 1U1NA 1BIZA 5GTHU 1ZBLA 5FLXY 4F4WA 3T69A 4NLBA 1IXRA 2LQ9A 1ZAVA 3F41A 4YHHJ 5FRMA 4BDZA 4Q8FA 2JFDA 2FTRA 2NLWA 1TUVA 3PYGA 3MCOA 2XY5A 2P66A 3UNYA 8RUCA 2GUPA 2DGTA 2A19A 2R7OA 1JQGA 1Q8IA 3J7AP 4DR1J 2P6UA 2ZOMA 4WU2A 3AO5A 2WW4A 3SR6A 3SV3A 4YG2A 2KN7A 4ZA1A 3CC7S 1UJ4A 3HJEA 4GO7X 2ZM6J 3MCSA 4OHYA 3V1QA 3D2EB 5AQKA 2A3JA 4AILC 5I3UB 2IC3A 4PZVA 4JV5F 3HMJG 4IOAL 3UQ2A 5GVQA 1PVRA 4FVCA 4CLZA 4IQMA 4DCJB 2ROEA 3OFHA 2GQ2A 3WQPA 5L39A 4ER8A 4DL3A 3L4PA 2HVZA 1HBUA 1NDPA 1IJEB 2HSEB 2Q2RA 1OYDA 2B9EA 2LM4A 9ICCA 1R8HA 4DR7F 4OZ3A 4M5DA 5KT7A 4NEZA 2GUIA 5FRNA 3U7JA 1XU4A 2YV0X 1J9AA 3R7BB 3MWBA 3W9IA 1W2BR 1QQ7A 3NAHA 2DY4A 1U4BA 1S1TB 2IJFA 4KHPK 9ICEA 1Z3EB 3LANA 2AGQA 4YR0A 4M6WB 2JDJA 5JXSA 1IV0A 3DOLA 3QRPA 3TSQA 2XI2A 2FVPA 3OHRA 3MDCA 4F9OA 4CH7A 5FDLB 1DK3A 4PR6A 5A8KA 3VEYA 4GRSA 1OWXA 4CJ5A 3QUTA 1WCNA 3M6GA 4LF4J 3W8GA 2R7TA 3HM8A 4CGHA 4B3SF 3SBGA 5AI0A 1J5EJ 3JQJA 1QAJA 3ZSQA 3W66A 1BNPA 4F8RA 4UT4A 2OTLS 2AJ2A 3DV9A 4UB6U 2ASOA 3ZSWA 2UXDK 3AVNA 3VCDA 2CH6A 3L3VA 1BY9A 2A1JB 3KK3A 4DV0J 2OPSA 3UNGC 3X3UA 3OBYA 3QU4A 2BCQA 2OUGA 5E0OA 2A1RA 3IUCA 2D3DA 2YB1A 1HIYA 2CQ3A 4U67L 3RBEA 3ETLA 1NMDA 3SMSA 5J2QB 1HWIA 5AE1A 1FDNA 4M5JA 4QZVB 1BGXT 1RI7A 3BQ7A 2YKMA 3IP4B 2E9RX 3C3LA 3IBCB 4ZPWR 2B8QA 1HMVA 4OV1A 4QCLA 3P45B 5GAEU 4JI4K 1C0UA 3VAGA 4MFFA 3M2UB 2C3OA 3ICXA 3PIPL 4UASA 1RBOB 2DHXA 1OJ4A 2ZHAA 3GV8B 4JI0J 3V6DB 2W43A 3H0PA 2X1BA 4KC5A 4HWIA 3WXIA 4KB7A 2PFQA 4FJ5A 3RB3A 1NI3A 3MUVP 2G8VA 1FEZA 2A10A 4PYDA 4PPDA 3N4PA 4BRHA 2M8DB 1Z4NA 4KH0B 5C7PA 4OHZA 4ES1A 5EE9A 3BGRB 4YDUC 3AQEA 4K4HA 8ICVA 1IBCB 3PIOL 4F92B 2KYXA 2YCHA 1YJRA 1U24A 5ALZA 4QZ9A 5AE2A 3RWUA 1NGFA 2ZWOA 3FRYA 3C0BA 3V4MA 2R2UA 4YN3B 2PZSA 1RKJA 4DQIA 5AXLA 2A42A 1IBKK 3QQCD 4IQWA 5D15A 2UXBJ 5AQYA 1Z2ZA 1XWLA 4LQ9A 1Q53A 1WSIA 4CZJA 3HXMA 1WI8A 1VQYA 2VGNA 4BRGA 5KG0A 2MMYA 2NO4A 2W11A 2C28A 4NE9C 3M2VA 3CF5Q 2OELA 2M2BA 1HUOA 4DQPA 3SAFA 4DQQA 3OT9A 1NLKL 5MLCQ 5E33A 4I2QA 9ICBA 3F2DA 1S9GA 2Z58B 3DLGB 5EX0A 3T1YF 1PK1B 1JX4A 3C28A 4OKJA 3SCXA 2GA7A 4ETZA 2XGQA 2WC9A 3VAFA 3CM6A 2LU1A 4W5QA 2Y9HA 1Q9XA 5J1EA 1TL7B 4DF8A 3OVAA 2QTWA 2ASLA 4RO0A 1T3VA 1SH2A 3CNQP 4HVZA 4N5SA 3LK9A 3BS7A 3UVJA 2PFNA 1K5OA 4OKEA 4EBDA 2RP5A 2HS0A 4PQUA 3F0NA 4KN7A 2MJNA 3TX8A 4NLUA 3GFZA 2GELA 3HSZA 4NXMK 1S9EB 2KMDA 2ZBQA 1NK9A 4OI2A 4GXIA 2D3ZA 4DSFA 4QNLA 4C7YA 1FDBA 1FKOB 1RT5B 4IFYB 5JS1A 5IQQA 2FI1A 3DRSA 1Y0HA 2EAOA 1RXOB 3T3FA 3Q83A 3FC9A 3D45A 2EG1A 3FGUA 1VQPN 3QRQA 4NA2A 1RG6A 3HPOA 4CIOA 3G25A 1SWWA 2PMZF 1S49A 2GTDA 5K14B 5J0RA 1MNEA 2MKSA 1F5CA 3UPQA 4RQMA 4DN9A 5KG4A 1JLBA 5I3PA 4QU7A 3D1OA 3PXGa 1H2UX 3AAQA 2PA8D 4K0KJ 2E29A 2GQQA 3ZX3A 4U7UD 1DTTA 2W9CB 4KLLA 3AOBA 4Y3CA 4ZS6A 2W9MA 3A13A 2X51A 5AM5A 5DQHA 1NDCA 5D0GA 4FWRA 3K7RA 3G10A 2IVPA 4DR4J 5KG7A 2ZNYA 2H3ZA 5KFOA 2WBRA 5LMUJ 2H51B 3UIQA 1UPPA 2D9PA 1QSLA 4K4SA 1FWLA 4CT8A 2D74B 4J9SA 3CTRA 2HFUA 3U02A 4OJ3A 2QMUB 5HI7A 3Q8MA 3IBWA 3D2QA 1X4DA 4K7QA 3PRDA 3LTOA 5HLFB 2E66A 3AA9A 4ED2A 2FHMA 3NBPA 3IG1B 4M9LA 3AO4A 2FXUA 4BLGA 3UMBA 3KMQA 4B3TK 4F4ZA 4FJMA 3DLEB 1WUAA 3ZZZA 4M3ZA 4NLKA 3KK1B 4O3NA 2WUSA 3SCJE 4CFBA 4M5MA 4BGAA 4HCBA 1ASVA 4EYIB 4IL6U 3QIOA 1Q7LB 4WFBQ 4BC5A 2YI1A 3A5MC 1U2VB 2KW4A 3BO3A 5KI6A 2PKEA 9ICAA 1YBUA 4JV2A 4AL5A 2KVIA 3LDQA 4XDCA 1NOMA 3H25A 1N4LA 4BWMA 2V4JB 2UUAK 3HD2A 2JGAA 1DGSA 2V52B 4TU7A 3VF0B 2YH1A 3VAKA 2VG7B 4CHQA 1M6YA 4KBOA 5ALSA 3SIPB 4OO1J 3D6JA 2J7WA 5AM3A 4P52A 3MN5A 1NDLA 2J8SA 4IG3A 2DRAA 2Z30B 4DOCA 2K8AA 4CBUA 2ZIUB 2P1JA 7ICLA 1EB0A 2V50A 3GP9A 3HO1A 2LEAA 2BKPA 2PO4A 3N28A 1UETA 4J9QA 1JB0C 1FFVA 4L3KA 2OHDA 1CPZA 4M3XA 3P6YC 2H5IB 1JXVA 4M1KA 1HKCA 1WSVA 3FCHA 3ENAA 2UZAA 4EHUA 4ZVRB 2FBYA 4FL9A 3G96A 8ICUA 4K4YA 3H5UA 3PHEA 4BR2A 2K7KA 4UAUA 1OVQA 1SQFA 1ILYA 1BPXA 5A2QY 4URSA 1X4GA 1EXNA 3OL9A 5AK4A 1O5JA 1Q1KA 4JI1F 2HBKA 4IQVA 3NUQA 4J2DA 4KGVB 3M5RA 2GGPA 3H7IA 4KLGA 1M5HA 1UWBA 3I28A 4G9ZA 2P51A 1U49A 5FPEA 1GT8A 3E9PA 3TEGA 3I31A 1COOA 1A5VA 4E8UA 4QZIA 4M9NA 4H0XB 4B1ZA 1KOHA 3OYKA 4B6JA 1LK7A 2Q4TA 3WKBA 3S9HA 1GNKA 1DAXA 4NYFA 1T3NA 2OMLA 2MZQA 4JI6F 4Y00A 2CIMA 4K4VA 1YGYA 1S97A 4MDBA 1ZD4A 2JZBA 4YD2A 2HVEA 1RT7A 3PW2A 1SC6A 2ZNZA 4J2AA 2BGWA 4BQLA 1NM2A 2BUNA 1JJHA 1XR5A 4W5OA 3N5BA 2JLEA 4JI2F 4JKHA 3EE8A 3U9DA 4NL9A 4KV8B 3VALA 1G2EA 4K4GA 2FE9A 1RHRB 2F8KA 4H4MB 3FZHA 5ETLA 3G86A 4WTYA 4DR3K 2B4VA 1TGOA 3NH0A 3MTJA 3C46A 1NGEA 4FXVA 4X62K 5AQFA 4ENOA 2G5HB 3HKZC 2O8BB 1S1UB 2H54B 2G09A 1BE4A 5IIJA 4KFBB 1X66A 3MMBB 4Y2VA 1JKHB 1J2VA 2GH1A 3A5OC 4AP9A 1YAGA 7ICVA 5LY3A 2FPLA 3QBXA 3PO4A 5KGWA 3ITHA 4ZPAA 3ZSYA 4NLXA 3NCIA 1S6QA 2LFVA 1RT1B 3CDAA 1KP6A 4MK7A 5KFTA 1Q8LA 4CE9A 2ACYA 1VBKA 2E5LK 4IDKA 2ATLA 7ICHA 3CPEA 1KC8O 3LZIA 3F5EA 2XCAA 3AD9C 4F50A 2XMAA 5AI4A 4RWWA 1D3WA 3IBFB 1NSAA 3HT0A 1N36J 3DWLA 2QEXN 2PYLA 5AJ3J 4LBHA 3KKAA 1NK5A 1IJFB 4YY3J 3OA9A 2ZUBA 1I51B 3CCUS 5F3TA 5I42A 2ZIVA 2GHVC 1SL1A 5HN0A 1AQ6A 2E1FA 5DDRC 4CLLA 4OLOA 2W25A 4JYAF 1BU6O 2V51B 3QFPA 2MY7A 2ZBRA 5GINA 3NS5A 1S0MA 1BXNA 1GX6A 1ZS6A 5D4NA 2HMIB 3CJ1A 4M5KA 1UKUA 4UB5A 5ETRA 4FM0A 5KG1A 5KFZA 3A0BU 4LSLB 3I8BA 3DLLQ 1DTQB 4Y2SA 1KFDA 2ATCB 3SDEA 4FLUA 4RLEA 1N8RT 2OKQA 4O5KA 3BF1A 5BOLA 4DR2K 4LD0A 3C1YA 3HRDD 4TUQA 4X4UA 1JALA 3L95X 2LDYA 3H7HB 3IMXA 1WI6A 3ISNC 2A6AA 2GMHA 2MQNA 3GMGA 4CFDA 2EPIA 5AZIB 3TX0A 1A5WA 4CJFA 4DTUA 1LW2B 4USIA 1RCXB 1JL2A 4LF7J 3P96A 1YI2S 4E1MA 3QAEA 4X66K 5JJBA 4QPTA 3TU5A 1WC0A 3SUQA 2IA6A 4O4GA 5DM6Q 5GAHU 2J0QD 1VQ4N 2FF6A 1RBAA 3IMQJ 3QIDA 2ZIXB 1SH0A 3MCAB 1U26A 5HBMB 4NY8A 8ICJA 1TKZA 3G8TA 1D9AA 1N34K 3P38A 1EO1A 2W1BA 2PFFB 4LFCF 4EK2A 4USHA 2E20A 5D4PA 2QRRA 1S72N 1WKKA 4NYOA 3J7AN 2ZEJA 1V9OA 3MTKA 1U04A 4MKBA 3VQ4A 4KIAA 4NOHA 4DJBA 4EO8A 4RQNA 3U9ZA 3IC1A 1Y7PA 2ZKUA 3OQ2A 4NO7A 4WIQA 3D2EA 1SJ1A 5KFBA 1JI7A 1ZBIA 4F4KA 2UXDJ 2E7VA 2YX6A 2I1RA 3CI5A 3I56S 5H9FK 2VFVA 1P90A 2Z1GA 1WWUA 4CEZA 2HNZA 2IJRA 4FS2A 4FO0A 1R8BA 2H65B 5E2QA 1UCVA 1RBVA 4DG1B 1JUDA 3GYNA 5AQXA 2UUCJ 1YLXA 3CCES 5DDOC 1SAZA 3MGHA 3RJKA 4ZJOA 2KKVA 2VU5A 1XHXA 4AM6A 1RCOB 2YKNB 1U47A 3F56A 3UKRA 1S57A 4JI4J 5TKWA 3MCMA 3CDUA 3DNCA 2R8GA 3QU9A 2MSSA 1S1TA 4D3GA 2EWHA 4B9LA 3BGOP 3KLHB 2P9SB 1K8AT 4M3TA 3K9JA 1I3OB 4M6WA 3LDSA 4F04B 3WXMB 2YWKA 1A0OB 1H3DA 2VPWB 4AHUA 1Z6RA 3HK2A 3KZIU 5ADXA 5AKXA 5FDLA 4AQYF 4I9QA 2YXLA 4J8FA 2RS8A 4ICAA 3AT1B 2X1FA 4CEQA 1UT5A 2MZTA 4X4NA 5KL8B 2HF3A 4BRIA 2UXCF 4JK7A 4Z2XA 1TV6B 3GIMA 4MN4C 5LJ3Y 4RWXA 3ENOA 4Y2QA 3ZT2A 3O9UA 2K4PA 4ZLLA 5A0YA 3JSMB 4M41A 5C15A 1VC6A 1S6PA 4IO9L 2Z1JA 5E3CA 1CG2A 4TYAA 8ICMA 2K89A 1IKWA 2A1JA 2G1DA 4BVPA 2Q31A 5EXWA 4KLFA 4DFDA 3DOKA 2IRXA 3M9NB 3GDQA 3TSUA 5J2QA 4J9OA 5JICA 5DM7Q 1D4XA 3K5MA 1KVJA 1UVIA 3RAXA 2Y0SD 3ZSOA 4P2SA 3H2UB 5IWAK 2WW8A 5LJVA 1KD1O 4P73A 1IBKJ 3O8WA 5MAOA 5CB1A 4KH4A 1MMDA 1LW0A 2VA3A 1WG1A 3PKMA 1FRIA 3IDWA 4UQTA 4NJ8A 1M5KC 3V6DA 4CK2A 1HFEL 2F7VA 3K75D 1WF2A 3DMJB 3K1RB 2KOBA 3IM1A 5E7OB 1IQTA 4HACB 2ZZMA 5AQVA 5KG2A 4KLMA 4RW7B 3PW4A 4E7KA 4QZHA 3JQMA 4CWBA 1BA0A 2ZJPL 5LL6d 4B1UB 1TL3A 1KFTA 1O6XA 4M9GA 1WORA 4CM2A 5KFCA 1SKRA 3U1MA 5HL7Q 2J0XA 1HEKA 9ATCB 3CJAA 2W24A 3RRKA 4BC9A 2C3YA 2CXYA 2RQMA 3ELHA 3FBFA 3C14B 5L9NA 3TWZA 4O3QA 2KJ9A 2BX6A 2CPIA 1WTFA 3V6HA 2EFPA 4TN2A 3QO9B 4IRDA 1H98A 5JRTA 3QEBZ 2A41A 4NXMJ 3CJ7A 4MAKA 3LW5C 4NPOA 1FWKA 3DJCA 3CJRA 4RTFD 4FWPA 3DOMB 2P9PA 3BH7B 3G6EN 4AF1A 3GZFA 5B0BA 1VHFA 3SPYA 2HWHA 1MW7A 2GIFA 3IP0A 3C6AA 4PWDB 1EZZB 1PBAA 2GV9A 3K89A 4H4KA 5ETKA 1N60A 4W98A 1VQMN 4MJKA 5KTQA 3IR5B 3K5NA 2VWJA 4HL9A 4BRDA 4Y1CA 3LYSA 2WONA 3KLIB 1MMNA 3GDXA 2O8FB 4C23A 3LF0A 2GFFA 1H7WA 5AK3A 4I9LA 1RWPB 1XIQA 2U2FA 1PKUA 4JK9A 2RN2A 1OUQA 2YX8A 4Z4FA 2C2RA 1K1SA 3WBZA 3IA0A 3RFAA 3OVSA 2EFQA 4I28A 4JKDA 3A5LC 1JWWA 4DV5F 1IM4A 4CZCA 2WZ1A 2CH5A 2V34A 4OMFG 1HW9A 1S9EA 1U6BA 4FJ9A 3CHWA 1FF2A 1RT5A 4IFYA 2ZH5A 4Q7AA 2QA4S 1SGGA 4N8OA 1ZETA 1U0SA 1T6CA 3HDSA 3FZFA 4QIFA 2MZJA 4ELUA 1L3UA 1T0TV 3KOOA 2ZBPA 3R5AA 2AX0A 2UYTA 4DFJA 1C0MA 3MEKA 1VQON 1B4FA 1URNA 3VC8A 2H5EA 2UUWA 3AXKA 4B3TJ 4PG4A 2JEFA 4Q45A 3LZJA 2BOAA 2YHAA 3EEQA 1XNRJ 1TL5A 1ZQRA 2AV5A 4UAWA 2WVDA 4LVSA 5KFEA 1CS4B 3BN7A 1YDLA 2YQ1A 3K4GA 1OY9A 4IBNA 2ZGZA 5J2PA 4WQ4C 4RCHA 1ZQIA 5THWA 1J53A 5GADP 4WXWA 1JLGA 1CJTB 1FDAA 2F3NA 2MYFA 3NGTA 2LP4A 3CCLN 4DU4A 4PPZA 2YN4A 1SXDA 4GFJA 2KZMA 5AI5A 4FWSA 1Y00A 5CEHA 3SQIA 2A1SA 2KICA 2UUAJ 2V7ZA 2E1MC 3MUTP 1FE0A 5KFVA 1FJGK 1VC0A 2RD5C 1VRTB 2DCUB 4OPAA 3EPIA 1ZQGA 1VSEA 3TZZA 1CULA 4LF6F 3CIPA 1A6SA 3RH6A 2KHQA 1G4CA 3J81U 2LQ5A 1SIWB 4B9QA 3BZKA 4E7IA 2O8DA 4O3SA 1UFWA 2IVMA 5A8RA 1MG7A 3SJJA 9ICMA 1WSFA 3IG1A 1RDDA 2H3GX 3OL6A 2F8MA 4LF4F 4PG7A 1PBUA 4NCGA 4FBTA 3DLEA 4XO0A 1N5VA 1RHMB 1YKWA 2EDUA 1R8PA 5ALKA 1JLAB 4C8OA 1NDKA 5CCLA 3H08A 1SVDA 3MEEB 4DFPA 3DM2B 1O0PA 2RS2A 5J8YA 4DV0F 1NJYA 3I55S 2MA1A 1YHQS 2JEIA 1U2VA 2OTJN 3CXCM 5KFNA 1Y9OA 3QYPA 4KGKA 3BEGB 3R1HA 1S6OA 3L2RA 2YBVA 1U1OA 1GTHA 4KLUA 3BGFA 2D69A 3MM5B 2HLUA 4IJAA 1CRXA 2MB0B 2A18A 3TJ9A 3WK4A 3KD1E 2VG7A 3R5CA 2C3MA 1HBMB 1IVZA 2DNYA 1NHVA 2E7XA 2CPJA 2QV6A 3BGLA 3VAMA 3TVZA 1IKYB 1TUGB 2YMLA 3AJ2A 3RW6A 2M9NA 3N9UC 5F8JA 4AH9A 4QZCA 2XSFA 9ICWA 3ZFVA 3PW7A 2ZIUA 1TMJA 2DNGA 2HNDB 3IFEA 2J76E 3KKFA 4UB1A 4P2MA 5AR0A 4IH6A 2V0NA 1RACB 2VOOA 3AVMA 2RT3A 3BSAA 3PR5B 4JK8A 3CVKA 2WSEC 4I6AA 7FD1A 3HHNB 2WB4A 1YF5L 4EELA 4MFBB 1VIXA 4BG9A 1JMSA 1T03A 3G87A 3GLJA 3F73A 2RKIB 1NGJA 4TU8A 3MX5A 4JKEA 4DR3J 5ALUA 2G8IA 4BRNA 2VQEF 2JH7A 2O5DA 2VA2A 3PW5A 2R3VA 3NF7A 3OYJA 3AU6A 2YNIB 3OSPA 3Q8UA 1T9XA 3M6ZA 4DX8H 1U2FA 3O9QA 1YJWN 2H3IA 1T44A 4ZK7M 5E3AA 2CXEA 3C94A 2RNEA 3MI7X 3ZETB 2QYGA 4CF2A 3ZDBA 4IR1A 1AA1B 1U1KA 4FWKA 2YX1A 2RLTA 1WOOA 2VJVA 3BKFA 1OH5A 4LFAK 1A5XA 2OZMA 4C1NI 2MQPA 2KI2A 1TKDA 4KKOA 2E5LJ 2POKA 5AQJA 4A8XA 4BR5A 3L2QA 3H8WA 4C11A 1RUSA 3WK9A 2G0CA 4QZBA 4NM2A 3NH1A 4KTWA 1RP5A 1Y64A 4URGA 3DAWA 1Q81O 3L3FX 5GADI 3TFRA 4KV8A 1HYVA 2LYHA 5LT5A 3FDSA 5J2FA 1OPZA 1NGHA 1SV0C 4DL4A 2I0XA 2AKWB 3FC4A 1ZQMA 4UY8O 1T8EA 5DO2A 4X4RA 4ECWA 3LQVA 2O8BA 2R7YA 2AEFA 3VQPA 4DTRA 1X8DA 3CC2N 5HROB 2R8KA 1NK0A 4USTA 2CG4A 3O9RA 3QFHA 1XSPA 1JKHA 3DXKA 5DDYA 2GOLA 4KH6A 2NV3A 3EUB2 3QU5A 2K1RB 2XHCA 4DV2F 1O51A 4DR2J 4DS5A 2HQFA 2G5IB 1UAWA 3QPIA 4IYQA 3AQOA 4BY9C 2QKQA 1RT1A 2HQCA 2WFBA 2R8JA 1XSNA 1RTZA 3HF5A 3WIUA 4C0OC 4IRCA 2MU2A 5IV3A 3W5ZA 3N4QA 4UB4A 4EP5A 1IBLK 4Z7CA 1H74A 2M4MA 1B92A 3NF9A 5B66U 1VQ6N 4MIWA 4IJNA 3O2IA 5EOYA 1W9HA 3IV6A 1TL1A 2VHGA 2FJ6A 4JRQA 4C4SA 1RBSA 3CMAN 2ZIWB 3L0QA 2FC0A 1Q5VA 3ATVA 3ILOA 3H45C 2CPZA 3D0IE 3L4BC 3WNFA 3U6FA 3P83D 3C2LA 5H1SV 1NKEA 2O3DA 3CCRS 3W2WB 2AA4A 4UAYA 3BBFA 5AQWA 4C6AA 4UAZA 2QI2A 2BYCA 3ENBA 4FF4A 4ELVA 4LSLA 2J9EA 2W4PA 1DTQA 5M2UA 3AH6A 1LFPA 3QLHB 1VQSA 1K8KA 4Z4HA 1BQMB 3TUJC 4OJHA 3GILA 3K2YA 2E4LA 4Y65A 5LSOA 5T7BA 2F1JA 4X65J 2CQHA 2XBPA 4ECUA 2ZOFA 5H9FJ 4RQ3A 3TA2A 1BI4A 4FJGA 3RRHA 1NK8A 2QARA 2E8AA 1F6TA 3IS9B 1YVNA 4KGMA 4QU6A 3H8YA 4C1NK 5ALXA 4KO0B 1XMOK 3U26A 1LW2A 2RHSB 4NASA 2MKIA 4U9RA 4USUA 3RJMB 1MWKA 1YT3A 2YH0A 3UO0A 3W9HA 5F3ZA 1N5YB 4OL8A 5I9EB 4F7VA 1R3NA 1QZ6A 4A2AA 1IG9A 5G5HA 3E66A 1BG3A 3A0IX 1G6BA 4QS9A 3FEXB 3LALA 2ZIXA 1YX2A 3TAFA 3PEHA 1O8BA 4KSEB 2FZKB 3HTVA 2FIUA 3VQCA 2QWQA 2ZTDA 2H4YB 3V5RA 1VQLS 4LC9B 1OY8A 8ICAA 2PBDA 1BHNA 5J1PA 4QPXA 2QFIA 1RJJA 4FE3A 3QZ7A 3NGYA 4RNFA 2WF6A 2HOFA 3OTEA 1U9LA 1QSSA 4CZFA 4H0YB 1PUZA 2VFSA 1HLWA 2E5IA 3CCQS 1HD0A 2APOA 5BR8F 2WOMB 5B0GA 3GG0A 2VWKA 4BDYA 2OXOA 4KI4A 3M6XA 4TQSA 5HHIA 2V6AA 1B7YB 2RRNA 4QWDA 4PJ0U 2Z2LA 3NOCA 3RJHA 1WD6A 2JEJA 4DG1A 3CJQA 4ILLA 2FUG9 3KJQB 4X64F 2IPOB 5G0RB 2ACMA 5LMNK 3MR7A 4E2FB 1JLEA 1P8GA 4CNZA 2YKNA 4XPCA 4ZCLA 3W0LA 1SZPA 5TISU 1R6VA 2XICA 3UQ0A 1JXLA 3KLHA 2P9SA 2E5JA 4EENA 2LPEA 3MEGB 3RJEA 2JSXA 3IRXB 3W5YA 2H3VA 4HH0A 3R9LA 1KRPA 3D2FB 1FT8A 3VGUA 2VV5A 2G8WA 1PJ5A 3DLHA 5HP1B 2D3O1 4CI6A 2HEKA 2YWEA 1RAHB 1WF0A 3JSMA 1EAYC 4KLIA 3MMVA 3M1VB 9ICFA 1SC3B 3UPFA 2CJXB 2ABYA 4JKGA 1X4EA 1ZQOA 4RJVA 3TAPA 3SZ2A 2V2ZA 4Y2TA 3EYZA 1OH7A 3PSTA 3I4PA 4ALZA 2BCUA 1XQIA 2AH5A 2AQ4A 4ZLNA 2IAJB 3QEWA 2WSFC 1VLBA 3SFUA 2OM6A 5ADZA 3WDOA 3QNWB 1KEJA 1RTIB 1I94K 4BRPA 4MKYA 1PCAA 4B3RK 3O6QA 3RB4A 1GO3F 2KEYA 3FGVA 3UDVA 1QQNA 1NOYA 1M90T 4DX7A 2PA3A 5HRPA 1ASUA 1KVCA 4CBXA 2YKPA 4NXNK 5HQMA 3QEVA 2JHEA 3QE9Y 4JB8B 3AA4A 1SIZA 3V9ZA 3DMJA 3KKAC 5CYQB 3WZ0A 4HACA 5IIMA 4BC3A 1ITPA 3TA0A 1VBXA 2MQLA 3HVTB 4F4YA 2DY1A 4QQBA 4K41A 2B4PA 4FYWB 4YOEA 4RBUA 2Y0BB 1GLDG 3DLKA 1KN5A 3QNOA 3UM9A 2H9ZA 4C7QA 1DRGA 1IM6A 2IIHA 1YVUA 5B5EU 2XEXA 4PHTX 4I7FA 1FK9A 3C14A 4CJLA 2QN6B 4NYPA 4ZP6A 1FFWB 3R9PA 4Y28C 3Q2TC 2NYHA 2CPXA 3IGNA 2N3OA 5AJ3F 2G2OA 1T9VA 3AOCA 2YHBA 1WWVA 4ID5A 5IT9O 3QO9A 3KHGA 3NNCA 1BC6A 1DGKN 2V2KA 4MEYA 4OFZA 3A4TA 3DLBA 3EVMA 2DXDA 1Q7YT 5AKLA 8ICWA 2RQ4A 4P7TA 2V7YA 3QWUA 4UY85 2YWHA 4PWDA 4OJ5A 2YKQA 4CZHA 1ZQ1C 3U1NA 3THXB 4J9LA 4IEIA 3PX6A 3KLGA 3P5JA 1GXTA 3GV5B 1Y3JA 4WFBL 2HOIA 4E98A 1LWCB 1YIJS 3N4MB 2O8FA 4X84A 4FYXB 2NXJA 1U09A 3GTYX 1HNIB 1Z25A 3OYFA 3HP9A 4GY2B 3KXDA 2CRLA 1UQVA 2ZH3A 3H2VE 2R4FA 5AQTA 4CCHA 1DZ5A 3PTWA 3V72A 3EZOA 2QMWA 3BSOA 4PUOB 1QE1B 3M2RB 1RXWA 1VQKS 4KHUA 3ADAC 1WC3A 3NAIA 3K2PA 4NRTA 1KAXA 3DHXA 1ZBFA 4JV5J 4QWEA 4DL0C 3RJJA 4O9MA 2E5GA 5DBAA 4A48A 4IH7A 4OPKA 3PYEA 4PXDA 4KHPF 2G8HA 4V1Ak 4CW7B 4BX9C 3W61A 3DI6B 3ISDA 4DR7J 4PGXA 1BWFO 3MF5A 3CD6S 1FXLA 5AQSA 1LNQA 3W9JA 5L1KA 4P0PB 2FY8A 2YQ0A 5CHCB 3GR1A 1NMEB 1VSKA 3ENQA 2XNRA 1QQOA 2MTLA 3NOGA 3D9BA 3TAMB 1IR2A 4UBBA 5BYSA 4ILJA 1HLUA 4J9PA 4GKJK 2QE5A 3SQ0A 5JVGQ 4FLWA 3VZHA 1CS4A 4AT1B 2VPXB 1LXJA 4W92B 5CR4A 2FMPA 2YWGA 3C15B 2HCFA 1FVSA 3IAS9 3SAGA 2NR0A 2HURA 1DJ0A 4FF1A 4KBIA 4KX5A 3D7SB 3BO4A 1CJTA 4B9VA 3SI8A 2G2YA 1Q82T 1RDFA 1IKVB 5BR9A 1S7IA 3HM9A 3N4WA 2F9JA 1Q79A 4LFBK 3CC7N 3FZKA 2Q3SA 3QUQA 4PPXA 3KG4A 1KAZA 1J54A 4O3MA 3ZD8A 1VK0A 1VRTA 2AX1A 1KKHA 2F8HA 3R1XA 1Q78A 4CD1A 4USWA 5FIIA 3VAHA 4LBPA 4L8RB 4M0AA 3G71S 2IIRA 5F3XB 1VK3A 4OHWA 4FZMA 1CSJA 2MKCA 3VA0A 2PFOA 2QTDA 5ALRA 9ICKA 4W90B 2P2CB 5CRXA 1W7WA 2J5AA 3WEEB 2K06A 2MSNA 1B7FA 4UB3A 3OPXA 3PHTA 2Y0SC 3ZDAA 1JLAA 4M5NA 1NBEB 3MEEA 3C6TA 1HWUA 3MM9B 3QSIA 2W4CA 2LQJA 3R7SB 2GX8A 4CESA 1B22A 4MKVA 1C2PA 4BC2A 4NLGA 4ISGA 2HBYB 3VEXA 4EGLA 4YMEA 2W3RA 1RHJB 3D6HB 3BKTA 1MWMA 3SUPA 4OPHA 2PFUA 3FYHA 2P5OA 2K7JA 3AVKA 2VJ4A 2R2TA 3VQAA 1LOTB 4WZMA 3CCMS 2KXFA 2W55A 3F5AA 2KG1A 2DY9A 3NCQA 2R7XA 2OTLN 3V1OA 2D8CA 4ZOSA 4R25A 2JZ5A 4CJPA 3O9SA 4LR9A 4CF4A 2BH1A 4JD2A 4FLXA 4OQJA 2NRTA 4XH5A 1HNVB 3H8SA 4LF5K 1VISA 2OMOA 2XHWA 2HNDA 3VEOA 2VIXA 5HOOA 3FMBA 4XA5A 3OS0A 4YB1P 4K4UA 4YOYA 1KDNA 3BREA 4CK3A 2P5GA 2F77X 3QT7A 1ZQDA 3QFUA 2DJWA 5B0AA 1ZRNA 3DRRB 3BQ0A 3AVBA 2IDEA 1KBUA 4KGZB 3EY1A 4F3OA 2F8SA 4FVUA 1HR0F 2KK0A 3SXLA 2WF5A 2RKIA 4RR5A 2BW2A 2JMGA 1ZQUA 1Y3KA 3HILA 3M6WA 4A59A 3T1YJ 4IEEA 1SIJA 3QT5A 2XY7A 4YOXA 4ANDA 3S1TA 4YB6A 3GFKB 4OZ0A 4OLBA 3OR1B 1TVRB 3BZQA 5HMWA 3ZETA 2FLNA 3I82A 1T4GA 3UFCX 4Y1DA 2AP1A 4Z4EA 3IG5A 2FPKA 2FJDB 3GFXA 1DKGD 5A2QU 2PSZA 4B3MF 4DSIA 3I5CA 4DR6F 4CEDA 4V19X 2WRMA 3ULEA 4OZ1A 4Y2UA 2BJ3A 4DLEA 2AGPA 4CLTA 4ZTJA 5ALYA 3H40A 5DM6L 3MAAB 3C19A 5KAIU 3T1HK 4ZVQB 1KC8T 3HRGA 4F4XA 2FBXA 4MK9A 3TWHA 4UOHA 3ZTPA 4DCOB 1WLJA 2VDHA 1HX1A 3CO9A 1JJ2M 4DV7K 4E1JA 1H2VZ 1I6JA 4PG6A 4KGXB 2HMPA 5AXKA 4JI3K 1UCNA 2VKZG 1N8RO 2NPFA 5D49A 3KK2B 1ZQJA 3E51A 5F8GA 9ICUA 2LU2A 4BCAA 3FQLA 3I0RA 4HHHA 3JXOA 4JLHA 3KJNB 2WVFA 4XH1A 2IC3B 5IINA 5HROA 4QWBA 2CWKA 3HWTA 3BSNA 3TYTA 1RA7A 5ETVA 2MKJA 2LHTA 1D9FA 1OYEA 2GJFA 4L6V3 2FMSA 1WBDA 3PFOA 3RMAA 2QKKA 3N7RC 3ETOA 2Q1LA 3RJIA 1UJ5A 2YJFA 4BE0A 4M5DB 4KT0C 1F44A 2EFGA 4HH1A 3MUMP 4CF1A 4Z6FA 4U8YA 2QLXA 4I0WA 1N5XA 3FZ2A 1ZA2B 4DL5A 1L8OA 1N33K 3K0JA 3CO0P 3ZI4A 1L7OA 4L74A 4DTMA 2W03A 4M5HA 1JMTA 1RWOB 4AXJA 2A0FB 3L5KA 3NMRA 1ATSA 1NNEA 3RW7A 5A8KB 1R89A 4LF1A 2ZUDA 1UVJA 2OPRB 4H0VB 3NF6A 3A8YA 5D4LA 4ZH4A 4I1TA 2PAVA 4BRMA 2VIHA 4PXBA 4G6VB 4JN4A 4CBWA 1HARA 5KT5A 1RAOA 4M45A 3BSCA 3Q8YA 4YVZA 4FJLA 3VA3A 5TZVA 1U0HB 2UUAF 3KK3B 3QLHA 1JL1A 4DMNA 1BQMA 2FQQB 1NSPA 2CQDA 4EFHA 3FVYA 3UD5A 1I3AA 1VBYA 4TQRA 2CN1A 3GSIA 3AD7C 3IAYA 2WMMA 1DFDA 1BPBA 5DM7L 2G1HA 4ED8A 4K2JA 1U8SA 4RPXA 1BWVA 1JCFA 2J4RA 5KRSA 3IFRA 3IS9A 3D67A 3LP0B 1TKXA 3D2WA