2HHWA

Ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhwA01
1DLOA 3SQ4A 4QZDA 4I2PA 3HW8A 4N5SA 4N76A 5J0XA 3ZSOA 3OJSA 4E3SA 2VANA 4QOZB 4KHQA 4JWNA 4KI6A 5C24A 4QWCA 5IIKA 3UQ0A 3P1GA 5KFYA 4G1QA 3L2QA 2ZJAA 4Z0UA 4HHTA 1NKBA 3IM1A 3ZDBA 3ZD9A 1ZQOA 2HVHA 1FXXA 3LZJA 4RW9A 2V4QA 3AO2A 2JEGA 3WNFA 2AQ4A 2V9WA 2X6SA 1TKZA 3FYHA 4RPXA 7ICQA 3NGZA 4FJ8A 1N5YA 8ICZA 3HPGA 4RQ1A 4M3YA 2B6AA 3N4MB 5J0QA 3VQCA 4DSFA 1ZBLA 3ZSVA 3HVTA 7ICMA 1QQCA 3DOKA 1S0OA 1ZQQA 1NOZA 1RBSA 3L3UA 4KFBA 3C6TA 4NCAA 2R8IA 4W5OA 5KFDA 3H08A 4YR3A 5L9XA 1YT3A 1ZBHA 4CIGA 3DLHA 5KG1A 1MC8A 3V81A 2DPJA 5KFNA 3HSTB 5CZ2A 4PGQA 2BR0A 4IFVA 1KDHA 4UBBA 4F4KA 3PUFA 4CJ5A 4QWAA 3KHHA 1WSFA 1KSPA 4CF1A 2XRIA 4XA5A 1KTQA 3AVBA 4NCBA 1A76A 1RZTA 2BDPA 1RTIA 4J9MA 2F8TA 2G8UA 3KHRA 1ZQPA 4KLTA 4F5PA 2BE2A 4I28A 1MU2A 3MABA 5DBAA 2BQ3A 3PW2A 9ICQA 3MBYA 1ASUA 1NOMA 1U49A 4Q0BA 3GV5B 3EWAA 1XWLA 3JPNA 3LANA 2IHNA 4DLEA 2UVUA 3TANA 3SCXA 1L3TA 3QEWA 4TQRA 5KFZA 4M9JA 3NBPA 3Q8LA 5J2PA 2PFQA 4QAGA 4RG8A 3BQ0A 4IQTA 4YP3A 1ZJMA 3ZSXA 3LP3A 1EETA 3SQ1A 1L3UA 4MEYA 3T19A 2R8GA 5HHIA 1LWCA 1BCMA 3IS9A 1RDDA 3O4QA 3HK2A 4B9NA 2R7YA 1RBRA 1NOYA 2NRXA 3NGDA 3RR7A 2VWJA 4ECWA 3RH5A 1HQEA 3QLHA 4QWBA 3HX0A 4DQRA 2Z1IA 8ICSA 2F1JA 4FJGA 2GUIA 1NK5A 4M3ZA 2C2RA 5IIOA 3LZIA 3DRPA 1D8LA 1RCHA 4IRKA 2ZTCA 9ICGA 4ZHRA 2PYJA 9ICVA 3MXIA 4J2AA 1VSFA 4ECTA 3U3GA 3PMLA 3OYIA 4O5CA 1RT2A 4DTOA 3V4IA 4I2GA 1ZQAA 4Y1CA 3I0SA 3OYAA 4RQ3A 4Z4EA 3F73A 4B9UA 4Q8EA 1KLNA 7ICNA 4CJPA 1TL3A 4I2HA 8ICNA 5EU7A 2M9NA 3PX4A 1BCOA 3B6PA 3OJUA 4MF8A 3ZT4A 4E1NA 5IILA 4FJXA 3RMBA 5KG7A 1LV5A 1A5WA 3HYFA 4C8LA 1ZQBA 3HP6A 1QHTA 2FMPA 3OHAA 1ZQFA 3ZSZA 3OSPA 1XU4A 3SNNA 4B9MA 5DBCA 3K5MA 2ZQBA 3C1ZA 2OYQA 4DU4A 3M8PA 4I2EA 5J2MA 8ICIA 4CHPA 3M9MB 3TI0A 5C5JA 4PHPA 1CLQA 1BHLA 3KD5E 3ZD8A 2BPCA 3C23A 4IRCA 4AHVA 4DMNA 4KHNA 4CIFA 1IXRA 1J53A 3OYEA 1RPLA 4RT2A 1RILA 1JLGA 2HNZA 4DL7A 5J2HA 1QSLA 4FJ9A 1BQNA 3K58A 3QNNA 4KTQA 4W5RA 3C2MA 5FDLA 3M9OB 1EXNA 4O55A 1TK5A 1RDBA 4CJUA 4CEQA 3UQ2A 4O3NA 3KLHA 1X1PA 9ICRA 3HP9A 2P6RA 1U45A 4ECYA 5JS1A 4AH9A 2HW3A 4XRHA 1LW0A 4TQSA 2KFZA 8ICRA 1FKPA 2Z1HA 1TAQA 4O44A 2D0BA 3NH0A 4XQ8A 4RNOA 4RU9A 3DMJA 5HRSA 4KHWA 4WE1A 5EWGA 5HHHA 3V6JA 3NCIA 3IAYA 4IDKA 5J0PA 4CJQA 4CGDA 1QSYA 1ZETA 5HRNA 3JPTA 2KTQA 1EXQA 1S1WA 1Q8IA 2WONA 3EPIA 3AU2A 2IDOA 5FRNA 4DSKA 1NJYA 1SKSA 1XC9A 1IKYA 2W8KA 3SYZA 4Z4FA 4F4YA 2YNIA 4K4GA 3JYTA 3OVNA 3CYMA 3NGYA 2OWOA 1CZBA 4KLLA 1W9HA 2EHGA 4LH4A 3JPPA 3O3GA 1BPBA 5D46A 5DGBA 1Z26A 4R65A 5KRSA 4YFKA 4FM1A 9ICCA 3O3HA 1GOCA 4FW1A 2W8LA 4CEZA 5L1JA 2PFNA 1COOA 3MEGA 4E7IA 9ICSA 4PA1A 4FXDA 3RJIA 4GVMA 1IKWA 4NM2A 3AU6A 2W9MA 2ATLA 1CUKA 3C5GA 1TV9A 1TVAA 4O5BA 3PV8A 4OPJA 2B4JA 4RW8A 4B08A 4P2HA 1T05A 3G6YA 5DDMA 1S0NA 4FJLA 2BHNA 3RRHA 2O4GA 5J2AA 4PHAA 2ZUBA 1HNIA 2ISPA 4I2DA 3DLBA 3JPRA 4CHQA 4FYDA 4EZ9A 3JSMA 1ASWA 1C6VA 1QS4A 4G3IA 3PW7A 1HJPA 4FJ7A 2W9AA 5SZTA 3VQPA 3CQ8A 4KMUA 3OYHA 1HPZA 3Q8PB 4EYHB 4GXJA 1HUOA 3CG7A 1MSWD 3AO5A 4FM0A 1JKHA 1O1WA 2F1HA 4RQ7A 3E2EA 2ZTDA 3BGRA 3AA3A 4JLHA 4UQGA 1HQUA 4LSLA 3K5LA 5KRTA 2F96A 5KFTA 3NE6A 5KFKA 4ED6A 3SUPA 3ISCA 2KFNA 3TR8A 1JIHA 3RH6A 4DSEA 1HYZA 1ZQRA 9ICNA 3PO5A 1KLMA 1RXWA 3L3VA 2KZ3A 4FLVA 2HHWA 3K59A 1N6QA 3VN5A 4NCGA 5KFAA 1TAUA 1JLFA 4OGEA 1RDAA 3H8WA 3TAMA 3VA0A 4M3RA 3TARA 2XCPA 1Z3EB 4C8KA 2VA8A 4JUZA 1C1CA 5D49A 4CJEA 5DQHA 4E7KA 3C5FA 2ZD1A 1SL2A 2OPQA 1ZQDA 3NF8A 5KFEA 5J0SA 5DB8A 3WNEA 1Q9YA 5J2EA 2FBVA 4OKJA 3RB6A 2G8KA 5FRMA 2JGUA 4JV1A 4KV8A 3OS1A 4QCLA 3OYKA 4DTRA 3PW5A 4HCBA 4JS4A 4DFJA 3NFAA 4RUAA 1WLJA 4IBNA 4KHYA 5KG3A 1DTQA 1ZQMA 1SL0A 4QW9A 1ZQEA 1RT6A 3MR6A 4FK2A 4UAWA 1BI4B 1KFTA 2W9CA 2QKKA 5EWFA 3M8RA 4MFBA 1BPXA 4CGGA 1DGSA 2YNFA 5KT3A 3THVA 1Q9XA 5KFXA 4UB4A 3EPGA 2ZJ8A 9ICLA 4M3TA 1A5VA 1U9LA 4RPZA 4KB0A 4IQUA 2AGPA 4QZCA 3RH4A 3Q8MA 4YVZA 2IC3A 9ICBA 4KAZA 4QZ9A 4DOBA 4EYIB 4FLXA 4YD1A 3V7JA 2YHBA 4KLFA 4J9QA 5C25A 8ICQA 3Q8QB 3PR5B 3RBDA 4H4OA 2ZUCA 1X9WA 7ICRA 4PWDA 1RT3A 5KFLA 4RQ2A 8ICFA 5IINA 4RT3A 4R66A 1UA1A 2YV0X 2RDIA 2BPGA 4F93B 4BXOA 1RTHA 3ULDA 1XHXA 4ECUA 4O4GA 3TWHA 2JLEA 4QZGA 1KVCA 3ITHA 1LAVA 3EY1A 3TFRA 3RMDA 5DKWA 2KZZA 4CK3A 1RBVA 1JLBA 4YMOA 4BE0A 1T8EA 4LH5A 3RJKA 3C95A 5CA7A 4ECXA 2A1SA 4X5VA 1W0HA 4Q8FA 2B5JA 3RB0A 2Y1IA 4KLDA 1B9DA 3VQBA 1ZBUA 3DLEA 3ZSYA 3TAPA 3GIIA 3TABA 1S6PA 4ZTJA 1ITGA 1RBTA 2P51A 7ICVA 1JLAA 3L2WA 3L2RA 4UB3A 3S3MA 4PH5A 4BGDA 3ORYA 4I27A 3PNCA 5HBMA 1ZBFA 3ETLA 4YCXA 2HNDA 3SPYA 2D0CA 2C28A 3N97B 4CK1A 2O4IA 4J2EA 2XY7A 9ICHA 4AHRA 4QWEA 4LY7A 1WSHA 1VSIA 3OYFA 4O5EA 4FK0A 7ICPA 4M3UA 4F92B 4CGIA 1XS9D 1IKVA 2DFEA 1WSIA 1Z00A 4TSXA 4AILC 3RBEA 1VRUA 1ZQWA 1G15A 4BE1A 3TAFA 4CEOA 5J2GA 4F8RA 5HRPA 3CFRA 3DLRA 3SUNA 4FZXC 4KKOA 2NUBA 2IS3A 1TK0A 2E6LA 2BCSA 4KN4A 1RYRA 3QEAZ 1NK8A 4E89A 1YTAA 4CGHA 2IHMA 1UWBA 4F5RA 1NK7A 4H4MA 4KPYA 3QNOA 5J2KA 3PW0A 4EP5A 3HPOA 1KFDA 4CJRA 4M41A 2ZJ5A 1BVSA 1NK0A 3M8SA 3KD1E 3NH2A 4MFAA 4FK4A 4CCHA 1JLCA 3P83D 4KB1A 4ECZA 1FKOA 5HMLA 3AO1A 1RNHA 2F1IA 4DLGA 3S3OA 3GV7B 4ED3A 1S1VA 4DFKA 1UOCA 1ZQZA 5KT7A 5I42A 4I7FA 1C1AA 5DGAA 4IG3A 1NKEA 1IKXA 1IH7A 4FJHA 4DTUA 4OLBA 4QZEA 2I5JA 2OPPA 4K4HA 3Q8RB 1VSLA 2Q3SA 2R8KA 5KG5A 4CHOA 4DO9A 3RAXA 1BPZA 2EX3A 4CJFA 4DL2A 2DTUA 5D3GA 1TKDA 2XCAA 3OY9A 1BIZA 8ICWA 2UVWA 5KFWA 1BQMA 3L8BA 4LSNA 4RQ6A 3C21A 3AO4A 4BE2A 1IO2A 1D5AA 4EBCA 4CF9A 3HT3A 3SI8A 2C22A 3ZSRA 3P5JA 2AGOA 3MXMA 2IAJA 4RPYA 3C2LA 5KT4A 3DI6A 3SV3A 4E19A 3A2FA 4R8UA 4C8MA 5DG9A 3PW4A 1Z25A 2NRZA 2XY6A 3CM6A 4JWMA 3SI6A 4PY5A 2HHUA 2FPLA 5DBBA 4L8RB 5KG4A 5CP2A 4CGFA 4RQ0A 2G8VA 3HPHA 3LALA 3ZT2A 5J2JA 4DF4A 4OJRA 4AHCA 3RRGA 4IQVA 4DU3A 3FFIA 5IIIA 4IR9A 1A77A 4FJMA 4R63A 5J0WA 4DQPA 4KLGA 3H40A 3VQQA 1ZJNA 4FS2A 4K4IA 5EWEA 7ICJA 2OZSA 1GOAA 3LDAA 4Y1DA 3RJJA 4M9NA 4DTPA 4CJSA 4FLTA 5J2BA 3TAQA 3VQ8A 3B6OA 5HLFA 3DLGA 4F2SA 4QZ8A 1DTTA 1HRHA 1VSMA 1NKCA 1QTMA 1J9AA 2PZSA 4ED1A 1T03A 4UAZA 1T3NA 1VSKA 4IKFA 1ASVA 5KFQA 3QETA 3GQCA 3G6XA 5KGWA 5BOMA 4Q43A 2FLPA 3GIJA 2ATQA 3NTUA 2YKNA 1LB2B 9ICPA 1ZBIA 5JS2A 4KLOA 4FLUA 3NGIA 2A1JA 4QZBA 4YR0A 4DTJA 1IG9A 4UAYA 5E41A 7ICUA 2I9GA 3MEDA 3H7IA 3VQ4A 1NK4A 8ICLA 3T5JA 3ZT1A 2VG7A 4DQQA 4FO6A 3LPUA 1U04A 2G8HA 4FJJA 1EKEA 2VA3A 7ICLA 8ICVA 1LW2A 1K1QA 1WAJA 3V9XA 1S9FA 3VA3A 1Z00B 3OYNA 1ZQKA 5KFIA 1TFRA 3RB3A 3NDKA 2G8WA 1XSLA 1U4BA 3PY8A 2D5RA 4DF8A 4R5PA 3MECA 2ITGA 1JN3A 2FBXA 4PGXA 3MXJA 8ICCA 4F91B 3RJFA 2RDJA 4YN4A 2YHAA 1CZ9A 2ASJA 4DSLA 1QLNA 3LAMA 5J0OA 4O9MA 1B9FA 4YFUA 3H4BA 8ICMA 3SV4A 1S97A 3DM2A 3VQ5A 4LVSA 4PQUA 4BACA 1NJZA 4E7JA 4B9VA 5F9NA 3ZCMA 2ALZA 1TKTA 3PMNA 1S77D 4GMJB 2FMSA 4DSJA 5KG0A 4P4MA 1RT5A 4CJKA 4DL3A 4ED8A 5KFFA 3QIPA 3AVIA 5KFJA 1A5XA 2OPRA 3TQ1A 4ZH4A 2HHSA 1ZQUA 5KGXA 3K5OA 4N41A 4M3WA 4RNNA 2MUTB 3GILA 4NLGA 5J0TA 4DTXA 4MEXA 4FJKA 5DK5A 4DFPA 7ICKA 2ETJA 3QESA 1TVRA 4NLKA 1K1SA 2AGQA 2J6TA 4FM2A 8ICEA 1S9EA 2XGQA 1BGXT 1ZQLA 3PO4A 4N56A 4AHUA 5KG6A 4EP4A 1JLEA 4Z6DA 4LD0A 3AVKA 3OS2A 4DWIA 4O3PA 2NRWA 2W42A 4JS5A 3QZ8A 4ZTFA 3PX6A 5IIJA 1NJXA 1CXQA 4M42A 1KFSA 9ICKA 4B3OA 1EP4A 1VSHA 5KFCA 3AA2A 3JPOA 5CB1A 1N56A 3BDPA 2ASLA 4EEYA 2Y1JA 2AJQA 2HMIA 8ICAA 5J2DA 4ED2A 1RXVA 3ZDEA 2E4LA 4O0IA 1BISA 4KTZA 3G10A 3LWLA 1ZQSA 3O4NA 5TZVA 4O3SA 4NY8A 3JPQA 5L1LA 3MFHA 2FMQA 9ICOA 4M9LA 3AA5X 4M2YA 2JZBB 3KIOA 8ICOA 4N47A 4J2BA 4FLZA 3D45A 3AVCA 4J9NA 4PPXA 5J0RA 5J0UA 3KK1A 2Z1GA 1ZQNA 4Q45A 4UB5A 3OS0A 3ZT3A 5DDYA 5KT6A 2UVVA 1BI4A 3M9NB 2RN2A 7ICGA 2VA2A 4FBUA 3HWTA 3K75D 4NXZA 1REVA 3V1QA 2IMWP 4IFYA 1ZQXA 1ZQYA 3EZ5A 3FDSA 9ICMA 2ZTEA 1UAXA 1LWEA 4O3RA 2FLNA 4ED7A 1JL1A 2VWKA 5CHGA 4ECQA 4CFAA 1KEJA 3E01A 4DS5A 2X6NA 2R8JA 5SWMA 4E1MA 1PZNA 2GV9A 5DQIA 3KKSA 2XC9A 4F3OA 1B92A 4FJNA 3ZDDA 1BPEA 3QIOA 8ICUA 3V6KA 2RKIA 1D9FA 3KKRA 4M47A 3ZDAA 5KT2A 2V4RA 1BIUA 2P5OA 4I29A 4W5NA 4KLMA 4HUGA 1RT4A 2YKMA 3U3YA 3KLGA 4CERA 2UVRA 4CJTA 1RDCA 4CJ4A 2W9BA 3IG1A 3QEBZ 3PR4A 2ZE2A 2A1RA 4QZAA 3ISBA 8ICKA 3ZDCA 3QINA 4JK1A 4KREA 4NM1A 3UPQA 4B8AB 3KHGA 2BCRA 4RQ8A 4J9OA 2LYHA 4CHNA 2AQ0A 3SZ2A 4F2RA 5DB9A 4LZGA 4FS1A 2MAXA 3ISDA 3L2VA 1L3SA 2FLLA 3H8JA 1JXBA 2LSNA 4E7LA 5J2NA 1SUQA 4J9PA 2IGIA 3IHQB 1JX4A 3GDXA 2DPIA 1HJRA 4ELUA 4J9SA 1T7PA 4CEBA 3V7LA 1GOBA 3V1OA 5KT5A 5DB7A 1ZQIA 4GC7A 4C8NA 3PVXA 1ZQTA 5J2IA 1ZQHA 2XY8A 2E6MA 3UIQA 2DFLA 3V9ZA 4Z4HA 1MQ2A 4DEZA 8ICYA 2W9BB 3NAEA 2Q0ZX 1S1XA 3L2UA 3WNGA 3NF7A 2NRTA 4GLXA 2OPSA 9ICXA 2R8HA 5HNKA 1JXEA 3IRXA 5J2QA 4J9RA 1LWFA 4Z6CA 1WSEA 3TAEA 2AU0A 1CXUA 4CK2A 1RYSA 1RT1A 2FBTA 4HYKA 3CFOA 4HCCA 2Z1JA 5J1EA 4FZZA 1RTJA 3O3FA 3AV9A 4OGCA 4KLIA 4HUEA 5HP4A 4NLZA 4E7HA 4J9KA 3AUOA 9ICIA 2OA8A 5BOLA 3MR2A 3T5HA 3SUQA 4IR1A 5D4BA 5K14A 2OZMA 2JEJA 3HO1A 4F4XA 4KLHA 5KFUA 1C7YA 1S5JA 4OKKA 3SQ0A 4JV2A 3QEXA 2J6SA 2GBZA 1JLQA 4HUFA 4KITB 4B9LA 7ICOA 1Y88A 3AVAA 4HVJA 3UXOA 5L1IA 1VSDA 4J9LA 1SZPA 2NRVA 2ASDA 2HHVA 1ZQVA 5KG2A 1JMSA 2X78A 3C94A 2GWSA 2PFOA 4CEAA 2P1JA 2PFPA 4F5QA 3UXNA 8ICGA 4K8XA 4CEDA 4IG0A 4MFCA 4UBCA 3UXPA 2BQUA 5I3UA 1WAFA 4M9HA 1EX4A 3K4GA 7ICIA 3NF6A 4GXIA 4NYFA 4HTUA 4RQ5A 1KRPA 4DU1A 1RBUA 1B43A 3AO3A 5FROA 3JPSA 4OLAA 2BPFA 3MR3A 3AVJA 2F8SA 4JRPA 3BJYA 4Q5VA 4KTWA 5KTQA 2PYLA 1T4GA 5IIMA 4KO0A 1RTDA 4M6WA 3ISNC 3H8SA 4YNQA 4ECVA 4H8KA 4FZYA 3HL8A 4KLSA 3OYMA 4LZDA 3OYLA 3EW9A 1ZQGA 4ECRA 3QE9Y 5L1KA 3RAQA 3QEIA 5J0YA 4W5TA 4K8ZA 3I8DA 2BGWA 4UB2A 2QK9A 3VQ6A 4QZFA 4EBEA 3QERA 2RF2A 5DQGA 2HNYA 4PUOA 2P66A 1S6QA 1Y97A 3VQEA 4NLNA 4CECA 2FBYA 2IBKA 2G8IA 1VSJA 9ICUA 4RQ4A 5KFRA 2VG6A 3OYDA 1ZQJA 1BPYA 3GIKA 2XY5A 2WOMA 2P5GA 9ICWA 2H5XA 3GV8B 3GIMA 3MAQA 4YR2A 3OYCA 4RW4A 3AA4A 1QSSA 1BPDA 1ZYQA 3OSNA 9ICFA 4DG1A 8ICXA 2KZMA 2HVIA 4CF2A 4F4WA 5KI6A 4CFDA 1NJWA 3HVRA 4OKEA 1CEZA 4FCYA 4C8OA 1S76D 4CGJA 4DSIA 1S1TA 4CHYA 4JV0A 3VQ7A 4M9GA 4I2FA 3KK2A 4BWMA 1UT8A 4F5NA 8ICBA 3ZT0A 3G6VA 2HHTA 3PX0A 2HHQA 2HHXA 5KFBA 3QEPA 4YMMA 4R64A 1WN7A 3OYBA 1TKXA 5CZ1A 3BQTA 4FBTA 2IA6A 4KLUA 3V9SA 3V6DA 5J2FA 5CJ7A 1ZQCA 1C1BA 3LP0A 8ICHA 4DOCA 1JL2A 4B9SA 3RMCA 2BQRA 2JEIA 3DRRA 4DS4A 3DOLA 3LAKA 1SV5A 3V1RA 4PHDA 1U47A 3Q8KA 4ELTA 3NH1A 1S10A 4ED0A 3OYGA 5KFOA 4TURA 3MEEA 4PGYA 3B0YA 5DG8A 4P4PA 2KN7A 4NYNA 3QZ7A 4YMNA 4FW2A 4DOAA 5DG7A 1XSNA 4AHTA 4YD2A 4DTNA 7ICHA 5DLFA 3KJVA 4PHEA 2BCQA 4B8CA 4Z4IA 3KK3A 3CFPA 4M04A 1FK9A 3S9HA 4YXJA 4YXMA 1MQ3A 1B22A 3QEVA 3OGUA 2ISOA 4CFBA 1XHZA 5J2CA 5KFHA 4I2JA 3SJJA 4CEFA 4IQWA 4Q44A 2PI4A 3V7KA 4J2DA 5KFPA 4BDPA 3DLKA 1S9GA 4FVMA 4O0JA 4ID5A 2FPKA 1S0VA 4YG2A 3M8QA 4F5OA 3AVMA 4DL4A 2RPIA 3V72A 4QZHA 4CEEA 4M0AA 4W5QA 4CESA 2W9CB 3ZSWA 1WNSA 3KTQA 4RUCA 3K5NA 1K6YA 3EYZA 2QXFA 4DQIA 4XIUA 3D0PA 2PY5A 4TUQA 1TK8A 3HXMA 3VQDA 4M45A 4ECSA 8ICPA 5BPCA 1C0UA 3LP2A 3V9UA 4CF8A 1S0MA 2BKEA 1X9MA 2MUTA 4ELVA 2PXIA 3T5KA 4DL5A 1TV6A 4MQ3A 3OYJA 3RJHA 2DFHA 4KHUA 3MDCA 4ID1A 4O3QA 3RTVA 5DLGA 2D0AA 2DFFA 5T7BA 4I2IA 1XI1A 4M3XA 3C1YA 3AVGA 3MDAA 4Z6EA 2C2DA 1X9SA 3V6HA 5C42A 7ICTA 4O5KA 1VRTA 4CF0A 2BCVA 1F21A 2ZUDA 3LWMA 1U48A 8ICJA 3ASMA 4F4ZA 1WSGA 3MGIA 1NK9A 4MF2A 4KN7A 2VG5A 3BQ1A 1V9PA 3H4DA 3NF9A 1HNVA 2FC0A 9ICTA 1VSEA 3B0XA 2XO7A 1C0MA 1KVAA 3SUOA 1XSPA 2DY4A 5DMRA 5J29A 2PI5A 5F9LA 3TAGA 4I2QA 2X74A 3SQ2A 4FJIA 2BANA 1WCLA 4P4OA 4O3OA 5JUMA 3V9WA 1J5OA 4I2AA 3HM9A 4GW6A 3RMAA 4KI4A 7ICFA 4XUSA 1WSJA 4E0DA 3AVHA 3HJFA 3F9KA 2C2EA 4RNMA 4BDZA 4YQWA 3KLEA 3T1AA 3Q8SB 2WTFA 2JEFA 4DTSA 1J54A 1HYSA 3KHLA 4CHZA 3TFSA 3QO9A 3VQ9A 3G0ZA 5KFVA 1JXLA 3AVFA 8ICTA 1N48A 9ICEA 3U6FA 3DRSA 3RB4A 5CYQA 4AHSA 4Z6FA 4KLJA 7ICEA 4GXKA 1BL3A 1KCFA 1R0AA 4QZIA 4DFMA 5KFSA 4I9LA 2XHBA 1KVBA 1D8YA 4CIEA 1S1UA 1HYVA 3NHGA 3I0RA 4FLYA 4DL6A 3MFIA 2YNGA 2JZBA 2KW4A 4BWJA 1UT5A 2FPMA 4KLQA 1LAWA 4OVLA 5HMMA 3GFKB 4RW6A 3AVNA 3T3FA 4BDYA 1AROP 5KFMA 9ICJA 4DQSA 1L3VA 2BGGA 3RJEA 3DYAA 4TUPA 4I9QA 3WNHA 3ALYA 3KLIA 1RT7A 2HB5A 4QWDA 3LPTA 1I3AA 4CE9A 4M6WB 4OPKA 5KFGA 3OHBA 4FJ5A 4I2CA 4Z4GA 1SL1A 3BQ2A 3VQAA 4GC6A 2I1QA 4FLWA 1UA0A 5CY4A 2BCUA 4IRDA 2IOCA 4CJVA 1C0TA 4Z4CA 1TL1A 4RZRA 5EOZA 4MFFA 3KLFA 4EBDA 1YVUA 1WCNA 1X2IA 5CWRA 5HP1A 1XO1A 3AVLA 2XGPA 3SPZA 4RW7A 1D9DA 4B9TA 4BXOB 1H38A 1QE1A 4UB1A 3K2PA 4QW8A 3RR8A 4JRQA 1L5UA 4CJ3A 3S3NA 1I39A 3ZSQA 1SKWA 3MGHA 4TUSA 4KRFA 4KHSA 4F50A 2B21A 2P6UA 3LDSA 1TGOA 3LK9A 1HUZA 2YNHA 4CFCA 2QKBA 5CR0A 3CM5A 3LP1A 4CJLA 4ICLA 2KQ2A 2A1JB 5HROA 1HMVA 4KLEA 4EZ6A 2G8FA 5DB6A 3C6UA 4DTMA 9ICAA 5HRRA 1YTUA 5CYMA 4CJWA 1DOQA 4R8UB 3RJGA 4I2BA 3C2KA 2J6UA 3MR5A 3T5LA 4F3TA 1IM4A 1NK6A 3K57A 1VK0A 3RWUA 1SKRA 7ICSA
chains in the Genus database with same CATH superfamily
3M1VB 2HGLA 2P9LB 4WF9L 1HWJA 3SQ4A 4QZDA 4AE5A 3U7JA 5J0XA 4OPAA 4X65F 4KHQA 4JWNA 3M2RA 4KI6A 3UMGA 4C98A 3P1GA 3N4PA 1HYSB 3W3DA 4LRDA 1NKBA 1BMQB 3ZDBA 2O1PA 2V9WA 4G65A 1Q8LA 5IS2A 4GKKF 2WF6A 3D1HA 1PVQA 4RPXA 1UZHA 2V8GA 3PYGA 1N5YA 2NYIA 1VDVA 2W2MP 2B6AA 5EGYA 3N4MB 4P9SA 4ID5B 5ETNA 5GAEI 1HNWJ 1CRXA 4C48A 1I94K 5F8MA 3ZTPA 4I2QB 1QQCA 2I5HA 3DOKA 1S0OA 2RQCA 4XH5A 1NOZA 4DUYJ 1RBSA 4KFBA 4NCAA 3DXMA 5KQ8A 5KFDA 3V2UC 3H08A 4LVOP 1IBLJ 4H0PA 1YT3A 2YKNB 4GKJJ 4DJBA 2EFGA 1FERA 1RAGB 4BG8A 2DQNB 4PGQA 3GYXB 3M2VB 2EK6A 1QH9A 2BR0A 3V4MA 3DKDA 1KDHA 3M6VA 3DRSB 3G4SS 1RDFA 4CJ5A 3A8JA 3VAMA 3CTRA 1AQ6A 1HBUA 1KTQA 2ZGZA 4Z7CA 5IT4A 3O08A 1RTIA 4J9MA 3PIPL 2G8UA 4NWIA 1ZQPA 2G0IA 4F5PA 1MU2A 2CH6A 2DD8S 2ROEA 3H6EA 2BZFA 1NMEB 5DJBA 3GSDA 4LFBJ 2DF4B 3GV5B 3EWAA 1XWLA 2RU9A 5CRXA 3H1QA 2OLWA 4C11B 3S6JA 2XWXA 3DOMB 4H5TA 3TSUA 3QEWA 2XSJA 1VOMA 5BR9A 4PRFA 4M9JA 1XEZA 5G0RB 4NLYA 1L7MA 3NBPA 5EOYA 2NQPA 4U67Q 3T41A 1NCLA 1ZJMA 4YP3A 4DUTA 2YX6A 3GDQA 3HI9A 5ELZA 2ZITA 5E3PA 3SQ1A 1EWRA 1Q1KA 3WQUA 1T02A 5AFUA 3T19A 3R8EA 2YHYA 1RDDA 2R7YA 4GO7X 3AARA 4ECWA 2F1JA 4FJGA 3DN9A 2IM2A 4C0ZA 3OBWA 5IIOA 2OEHA 1O5JA 3LZIA 1D8LA 3M3ZA 2XSFA 5L39A 4BQLA 4CIOA 3SJHA 4IRKA 4NPOA 4KMOB 2E9TA 4ZP7A 4ZHRA 2W7OA 1BO5O 5AICA 5A0YA 2OYYA 2Q97A 9RUBA 3DXKA 2MHNA 4J2AA 2WONB 2FJBB 2VQFK 2QYCA 3TZXA 1RQNA 4B1VA 1BA0A 1X4DA 5M1KA 4K59A 3QSIA 1ZQAA 2IIHA 4BR2A 3A8EA 4OYZA 3WXLA 2YB4A 1RE1B 4B9UA 3DFEA 1KLNA 3PG9A 5JICA 3HKWA 2JC1A 2Q31A 2CRXA 1YRXA 3CGIA 3OJUA 2GVZB 3ZT4A 2DCUB 2VJUA 3OFFA 2RILA 2BZ2A 1RLCL 2O8EA 5B7WA 2OXOA 2GHPA 2V4JB 3QU2A 5C7PA 3WX8A 8RUCA 3MPUB 1ZQFA 3R97A 4QZVB 2B0CA 1TUUA 2HMXA 5LSRA 1XU4A 1FO1A 4ZITA 5JVGQ 5LT5A 1Q8KA 2HFZA 1NMDA 1XNQK 4WFAL 4OJOA 1KN6A 2M4MA 4DU4A 3QGGA 3N7SC 1Z1ZA 4X66K 2R7SA 2C3OA 4BREA 1IKVB 1R6YA 3M1FA 3KD5E 3D6TB 2BPCA 3ZNJ1 4HHJA 2I38A 3DLKB 4KHNA 3ET6A 3VGUA 5AKEA 3OYEA 1N5QA 4KQZA 1RPLA 2QLTA 4RT2A 2QWMA 4CLKA 1VISA 2OGUA 4JHDA 3ZX0A 2J0SD 3OTDA 4RW9B 1CJTB 3M9OB 4HH0A 4O55A 5C2FA 4P0QA 1X1PA 9ICRA 1HNXK 2DNZA 2M2BA 1YBAA 2K7JA 5JS1A 3S6EA 4U9RA 2NXUA 2HW3A 3WKDA 4TQSA 2KFZA 4OI0A 2Z1HA 2YWEA 3G9CA 2RHQB 4JNEA 1TAQA 4O44A 4AP9A 2ADBA 3NH0A 5AQLA 4RNOA 3DMJA 5GAGP 5HRSA 1RT6B 5CR4A 4H54A 1OUQA 1B0VA 2ZBRA 2YX7A 4CZFA 3B8AX 4MIBA 2XYPB 4DV7F 1UJ4A 3THYB 2FSJA 3H0MB 1SB6A 4CGDA 3O6WA 1QSYA 4CI0B 1MA7A 1ZETA 5HRNA 2I0XA 2DNQA 1S1WA 1EXQA 4FVUA 3J7YU 3EPIA 2WONA 3CJ5A 1N34F 4IZ9A 4NYOA 1NJYA 5A8RB 1IKYA 1D1UA 3SYZA 1D8BA 3BYPA 5HI7A 2CH5A 2EZXA 3TW0A 7FD1A 4CLUA 4KLLA 1K8KB 5AQNA 5HN0A 1W9HA 2W01A 2F8MA 3N5FA 2SXLA 1HIYA 1MNEA 4R65A 2J7WA 4CH1A 3J7A1 4YFKA 3FEYB 3THYA 4P72A 2OHFA 3O3HA 5J2NB 1VS3A 2F4VK 2W8LA 4EK2A 3RZAA 2B3TB 1HBOB 4MKVA 1DLOB 2E2OA 2ZH8A 5GADU 2DVIA 9ICSA 4PA1A 2D9PA 1DGJA 4OX8A 2IC3B 1U25A 3TA0A 5AJ3K 2H4WB 2ZWPA 1M5KC 2NXNA 4BC7A 1HWUA 2KHQA 2QN6B 4UW2A 2ATLA 1TV9A 1BNPA 4JV5J 2QWLA 5BYSA 4OPJA 4OYMA 2DR6A 3C29A 3QO9B 4DPOA 1XMQK 1OY6A 2MYFA 3A0BU 4BX9C 5LMUJ 3QJLA 2WK4A 3CIZA 1TKZB 4J9UE 5J2AA 4PHAA 1Q86O 2I5JB 3DLBA 3FRYA 1ZD2P 2EDUA 1ZD4A 4X4VA 4V19X 1UEVA 1ASWA 2W9AA 2GJFA 2RAQA 1Y10A 4JI3F 4KHMA 4KMUA 3OYHA 1HPZA 1UWBB 2J9DA 3U4LA 4A8FA 1HUOA 5AXKA 2IDLA 3CG7A 4K42A 4YOUA 1IXKA 1Q81O 1O1WA 3HHLB 4RQ7A 3FSYA 2AZ1A 2DGTA 2FHJD 2VPYB 1PK3A 2VJ4A 1RB0A 3PFEA 4CF4A 2WTUA 2F96A 3W65A 1EJ7L 1E4GT 1JQGA 1JIHA 3RH6A 4EI2A 3NS7B 3OVBA 1UWAA 1HYZA 9ICNA 4PL1A 3PO5A 1KLMA 1RXWA 4M5GA 4QR2A 3D2QA 2YY3A 5CH7B 5M2UA 3LDNA 5KFAA 2FDRA 1YK9A 2A1AA 2DXEA 1EB0A 1LK5A 1SJQA 1XMQF 2XCPA 3BY5A 1H7XA 2WB1D 5B09A 5A6PA 2UXBF 2BE9B 4RW8B 2ZBIA 2FZGB 2DNLA 4ZLNA 1C1CA 2RRDA 5DQHA 4E7KA 2IOHA 1C1CB 1SL2A 3MTKA 3NWGA 3U1LA 4US9A 5J1PA 3B78A 2N1RA 4ZVFA 1ESVA 2FBVA 3SDEB 4OKJA 5GTIU 1QUPA 3MCAB 3EE3A 2R2UA 3E66A 2FQQB 3K0SA 3IV6A 5HATA 3PW5A 3O9SA 2IOFK 4DFJA 4BC4A 2FHMA 1WKKA 2FUG9 3O44A 3FKBA 5KAKA 2IJFA 2PC6A 3DAWA 1XR7A 2KVCA 1NRKA 4FK2A 4MLEA 1V9OA 1BI4B 2QKKA 4JI2K 3M8RA 2NXCA 1BPXA 4CGGA 1F9HA 2HIQA 2IDEA 2YNFA 4QR1A 2VKZG 3OFEA 2ASOA 2DY1A 2M3DA 3LGHA 3FZMA 4M3TA 4DR2F 1A5VA 3N7PD 1XTZA 4B1UB 4OV6A 5B66U 2E3TA 2J0XA 3RYLA 4LF6K 3EVWA 2HURA 4K0KJ 1SQGA 4DOBA 3V7JA 1VAZA 3HSCA 3EUNA 3Q8QB 1C4AA 4D3HA 3CCMS 4ZVUB 1TE2A 2WSEC 1JUDA 3H90A 3UD4P 3CC4S 4AL7A 8ICFA 1ILYA 3ZZTA 2YNFB 4RT3A 5J1NA 2RDIA 2D8CA 1T3OA 4NJ8A 1VQ7S 4BXOA 2HSTA 1N34K 2QGFB 1H1VA 1RTHA 1GLBG 2P9UA 1SWWA 4ECUA 4JK7A 2JLEA 4QZGA 3ITHA 3E0FA 3CWJA 5BREA 3PTWA 4LJXA 4EX7A 2HIYA 1O08A 4CK3A 2EG2A 1T44A 2VODA 4O3MA 2OMOA 5CA7A 4ECXA 1Z2LA 4ILRA 4X5VA 2IM1A 1B7YB 1TFWA 4KLDA 2QA1A 1FFVA 3GIIA 4B3SK 4MK8A 1QJHA 1PJ5A 1HQUB 2BVZA 3I6PA 3S3MA 3L2RA 1HR0F 4BGDA 1H74A 2IVMA 2LEPA 1HHTP 3R2CJ 3VTHA 5HBMA 2DT9A 4YCXA 2D0CA 3JTOA 2KG1A 4BC9A 2MQOA 4CK1A 3MUVP 2O4IA 2GIQA 9ICHA 2RUSA 2KRBA 3OFGA 4TY9A 4PXEA 4EX6A 4AHRA 1WSHA 2IM0A 4BGBA 2VJ5A 7ICPA 4M3UA 4FE3A 2RHSB 3NGRA 5E5NA 3VZHA 2DNKA 4US8A 4AILC 3RBEA 5AZIA 4GNIA 5DS7A 1ICEB 2DKZA 1QAJA 5J2GA 4F8RA 3DLRA 3D0IE 3CJSA 4FPAA 1DAXA 1TK0A 1RYRA 3OL7A 1YTAA 5ALSA 1WBDA 4J5OA 4DR2J 5J2KA 3PW0A 1NO8A 4EGLA 4KYZA 4PQAA 5AM4A 4PKGA 4RL1A 2BACA 2NUHA 3DHWC 2HWHA 4M41A 4CJRA 1JB0C 4ALZA 3NH2A 3SENA 3W60A 1K9MT 4KB1A 4PZOA 2P6SA 3RFAA 5H9FJ 5HMLA 4KPCA 1O0PA 1RNHA 3DRXA 4CBUA 1S1VA 2Z4PA 2Y9TA 3VAJA 4M5MA 2V68A 2GEMA 1C1AA 2MQPA 2L9WA 4FJHA 4OLBA 1JNZB 4WP9A 4K4HA 2H5JB 2Q3SA 4CHOA 2LFVA 3CRXA 1JI7A 5CA5A 3CC2N 2VIHA 4JKFA 3I9V9 4NXNK 1GXTA 4CJFA 2Q1NA 3GLJA 1Q4RA 3OY9A 2KXFA 2PFDA 5B0DA 4LSNA 4ETZA 4RQ6A 2KT5A 2IY5B 4BE2A 4LBPA 1D5AA 4EBCA 4CF9A 2YHWA 2C22A 3ZSRA 2KKVA 3CD5A 1S7HA 1HNXJ 4H0OA 4UOHA 1SC4B 5D6GA 3C2LA 1SXEA 3DI6A 5AI5A 4G1IA 1KBRA 3A2FA 1VHIA 3ZFVA 1VK8A 4BRCA 3C8YA 2NRZA 3GJTB 3CPWR 3UB5A 2KM8B 4AQYK 3PNIA 3CM6A 5I42B 2R7TA 4CLLA 2G08A 2HHUA 3MR7A 5KG4A 4CZIA 5CP2A 4CGFA 3BM7A 3TO8A 4GKJK 3WXKA 4IQVA 3IGVA 3GZ7A 1TYQB 2DH8A 4A8SA 4IR9A 4UY8T 3VEXA 2VFRA 3CDUA 1S4FA 4JHDB 3DV9A 4R63A 4KLGA 4I7FB 2W25A 1ZS6A 2RT3A 4Y1DA 3RJJA 4M9NA 1S48A 3ADAC 4LFAJ 4DUZJ 3DRRB 2XMKA 2JR5A 3J81Y 2P9KA 3VQ8A 3UDVA 5HLFA 3B6OA 3KWMA 1YIJS 2WFAA 1KKHA 1RBOB 2W7PA 2EZYA 1B0XA 1FF2A 3MHYA 5BYQA 3W5XA 3ZTOA 3QGPA 3G6XA 3GIJA 2NSBA 3J7AN 4NLTA 1ELOA 5C2GA 1RQLA 2V6AA 1ZBIA 4JV5F 1FEEA 3F0NA 2A1JA 1PGZA 5E7OB 2CFXA 1DKGD 2VQEK 3MEDA 4UATA 5DDPC 3FBBA 3EDQB 1IBMK 4ILJA 5T41A 1LCUA 2XHWA 3TEGA 7ICLA 2HWIA 2KI2A 1WAJA 1RWUA 2CNNB 3WK7A 4NLQA 1UETA 3I9ZA 1S7IA 4A61A 3TUZC 1TFRA 3C6AA 4QS7A 4RBVA 2CJYB 3MM9A 4CTAA 4LIRA 3MECA 2VCPA 4PGXA 1U6ZA 3J7YI 4IFVB 2RDJA 1NPKA 4YN4A 2B56A 1HEKA 3DU5A 3IWLA 1B9FA 4DR4K 5B08A 4HR2A 4PQUA 2ZH1A 2CIMA 4NO7A 4YY3J 1NJZA 4DR7J 4E7JA 3ZCMA 3PSIA 2CQHA 2FMSA 2QO3A 1R89A 4MO4A 5KFFA 1I94J 3A8KA 3TA2A 1ZRMA 2GNKA 2ZH5A 5KFJA 1GLFO 4DV4K 1RYUA 1A5XA 4LRBA 1IKYB 2VH7A 3VGVA 3TZWA 4RBUA 3X1LB 1ZQUA 3UWTA 4FF4A 1P90A 3T1HJ 4F3MA 3GPAA 2MUTB 4DTXA 4MEXA 2XI3A 4WQ4A 3QESA 2KT2A 4BLGA 4Y0WA 4NLKA 2AGQA 4CF3A 5G5HA 3FZKA 5LJVA 8ICEA 2XGQA 2MMYA 4OX6A 1BGXT 1ZQLA 4LR9A 1U1MA 3AVKA 3M6KA 4PXDA 2XTJP 3CIPA 3ZYYX 2NRWA 2H9ZA 4H0XB 3QZ8A 1X5SA 3PX6A 2DNPA 3BP8A 3MMAB 4M42A 2X1FA 3KJNB 2HVDA 5EDWA 2XS7A 5KFCA 1R0CB 3BDPA 2HMIA 5ALZA 1WELA 2PMWA 1F5CA 3TUIC 5LM7E 4TNOA 2ZJRL 2DYAA 1K0TA 4W90B 2OH2A 1ZQSA 4X62J 8ATCB 4IJNA 4O3SA 3E3XA 1KC8O 4NY8A 1NGAA 5L1LA 3SMSA 3MFHA 3MM7B 1UVJA 1CG2A 4M2YA 1MWYA 2JZBB 3N01A 1HLWA 4N47A 2CZ4A 4CZLA 3KK1A 2UXBJ 3IR7B 5ALHA 4BS2A 2WZ1A 3UCUP 4WFBL 2HLTA 3QU5A 4H03B 4WTOB 1W7WA 5KT6A 4I1TA 1BI4A 5ALWA 4WIQA 4AXJA 2H3ZA 3VQSA 3HWTA 2KB2A 2PDAA 4MYTA 5F8LA 2MKKA 3V1QA 2IMWP 4IFYA 2NXEA 1ZQXA 1ZQYA 3QGHA 1K8AT 9ICMA 1EP4B 2CNKB 4ED7A 2VWKA 2OPQB 4DR1J 2YX8A 2FJDB 5AM2A 4UB6U 5SWMA 4MT1A 3CCLS 4CRXA 1KLMB 4FJNA 3SEIA 3MM5B 3NMAA 1BPEA 2YX4A 8ICUA 3O6QA 4IOBA 2RKIA 1VK3A 3ENAA 4F0HA 3ZDAA 4Q7AA 1BIUA 3VPZA 4C4WA 1OO0B 2E1CA 3CD6S 2C3YA 2HKEA 4CO1A 5I9EB 3CCUN 1CVJA 2P9CA 3EZOA 2XLKA 2E2PA 2HK3A 3UKUA 2UVRA 1PUZA 2AJ0A 5IZHA 1WUUA 4CJ4A 2YX1A 3QRPA 2DHXA 3AH6A 4B02A 3GE9A 2DHGA 3IG1A 3WU2U 1RT5B 3QEBZ 4LF4K 5AFUH 4F0MA 4QZAA 2E5LJ 1HKCA 4ILGB 1WKJA 2ZGYA 1HNVB 3LA0A 4DR6J 4NM1A 3UPQA 4IOCL 4B8AB 1L8OA 4MHVA 3KHGA 2GH1A 4B3RJ 2C3UA 4C4RA 2GIRA 3THWA 5AKXA 1G6BA 4CLFA 4QOTA 3VF0B 1REVB 4DR5J 2LMIA 2MAXA 5CHIA 3L2VA 1W2BR 3G87A 1L3SA 5DRKA 1JXBA 3TRGA 3AL0B 4JI7K 4TU7A 3GDXA 2DPIA 1WNEA 4J9SA 3C14A 4GC7A 1S1UB 4RWWA 5J2IA 2XY8A 4LJMA 2DFLA 4DPYA 3F5AA 1U0HB 4DEZA 2KOBA 1YJRA 1W7AA 2W9BB 2ILYA 5ADXA 1S1XA 3L2UA 5HBMB 1S22A 4EEKA 3NF7A 1RI7A 4GLXA 4ES1A 9ICXA 3HZEA 2WVBA 3VEYA 1TL7A 2ZKUA 2F2AB 3GMGA 2XS5A 2ZJQL 3TA1A 1SC6A 4BBYA 1FK9B 3KLHB 1TL7B 2V8VA 1RYSA 1Q8BA 3LM2A 2K4IA 2FBTA 4HCCA 1QVGR 2FPHX 2Z1JA 3LPEA 4CF5A 1A0PA 4R79A 3K7RA 5AXLA 2FHOB 1NNDA 4KLIA 1QQ5A 2P9GA 4LF4J 2GWKA 4J9KA 2OA8A 3SUQA 5D4BA 2D3DA 1N54B 4OFZA 1HNWF 4FYYB 3BKUA 3MCOA 3CJRA 4FPIA 2XB2D 4OYAA 2VPWB 3HSDA 4JV2A 3QEXA 2J6SA 3NCQA 1DQ8A 2V52B 4B9LA 4QR0A 4BY9C 3AVAA 4IFEA 3GYGA 4HEA9 1LW2B 1NU0A 3PSFA 3UXOA 4QPTA 2NRVA 1YJVA 2VUGA 3LL3A 1JMSA 1O03A 4L3NA 3Q8YA 2GWSA 3FMBA 1U7LA 2PFOA 3QPIA 1IBLK 2B9EA 4DV3F 2PFPA 4LREA 4K8XA 2ZIUA 4QS9A 1FNXH 3UXPA 3E9LA 2CJKA 1F5AA 3WDOA 1UW9A 2CPIA 4RQ5A 3ZETA 1AYEA 1UPHA 2KICA 2LYVA 2JGAA 2QKQA 5AQIA 1OSDA 3AOAA 5AK5A 3F53A 3SEOA 3CJ7A 3GIRA 5A2QU 1RTDB 4HDGA 3MCMA 4AYBC 3OR2B 5IIMA 3BO3A 1RTDA 4M6WA 3ISNC 3VAHA 3H8SA 4ECVA 3KZXA 4ZK7M 4KHRA 2V2QA 5E2QA 2EFNA 1VBXA 2Z2MA 4ECRA 3CCSN 1K47A 4JMUA 4OHXA 5L1KA 1RAIB 3QEIA 4U8VA 3I8DA 1VQPS 4UB2A 2GX8A 4C3MA 4DCCA 3MPYA 5AZIB 4QIWF 2HNYA 1XNSA 2C2KB 2RQMA 1RADB 4CECA 1RT2B 4Z94A 2IBKA 3CJ4A 3V4IB 9ICUA 4LQ9A 3FLCO 4DR3J 1R0BG 1REGX 1E6YA 3DNCA 5ADXH 2XY5A 1TUWA 3UN3A 3GIMA 1TMJA 1P8GA 4RW4A 3SCKE 3GZFA 1PJ7A 3NVWA 1GLJO 2HS4A 3RU0A 1UW4A 4BROA 1NJWA 2D4WA 5AQKA 4C8OA 3DGPA 3WK6A 3T1YJ 4CGJA 1S1TA 4BR5A 3IGNA 2KO1A 2E8MA 4Y2CA 3HFKA 3PJ9A 1P9QC 1WF0A 3CXCR 1SXDA 2HCFA 3ZT0A 3G6VA 4PYDA 1RGIA 2HHXA 5KFBA 1S1VB 1XQIA 3W9HA 3SMZA 1Y3KA 4OJ6A 5A76A 1S72S 5GMDA 4XH4A 1H7WA 1Y9OA 2CQGA 3V9SA 3V6DA 5CJ7A 1C1BA 3BN7A 1JL2A 4DOCA 4DFDA 4CNYA 4QJFB 3DRYA 1U1LA 3KWIA 1X4EA 5DM6Q 1TELA 1NG9A 5HR7A 4DS4A 1U8SA 2J7KA 3CD7A 5D0HA 4O8KA 3TX8A 2CG8A 3Q8KA 3NH1A 3IM9A 3G4SN 3CXCM 1Z19A 3CF5Q 4QIWC 4IO1A 4C3LA 5KFOA 1YJ7A 3MEEA 4J7CA 3R5CA 3CC2S 3QZ7A 5HQ8A 2PAVA 1X5TA 5DG7A 3O8MA 4ZDNA 2FVCA 5DLFA 1OH8A 4B6JA 1LKYA 2FF3B 5JMVA 4PHEA 1E6VB 2NYVA 2O67A 2BCQA 2D7SA 3KK3A 3JSMB 5ETVA 2O8FB 4LUBA 4NXNF 1SUQB 3S9HA 4G6VB 4YXJA 4P0QB 3QICA 2P2CB 2G5HB 1X4CA 2KJVA 1MQ3A 1B22A 4NA3A 3NVMA 3CDAA 3KLVA 1N36K 4LF5J 3SSSA 1XHZA 3PFOA 3M8ZA 2LU1A 4MO5A 5GAHU 4IQWA 4Q44A 1VLBA 2GVDB 3V7KA 1VQMN 4J2DA 4BDPA 3C19A 2M7SA 1RG6A 1IBKJ 4YG2A 1IBCB 4EUVA 3M8QA 1XERA 5HP1B 2A41A 2F8EX 2PBDA 1I3OB 4M0AA 1RWPB 4W5QA 1WDDA 2W9CB 2AW0A 2F40A 4RUCA 3K5NA 2IHR1 2MEWA 4LF7K 2DGQA 2XQCA 1N33K 2QXFA 4G9BA 5GADI 3AFGA 5A8RA 3HXMA 2UUCF 4M45A 4FWQA 5H9EJ 1S0MA 2MUTA 2PXIA 2VG5B 3T5KA 4DL5A 3MMAA 4MQ3A 1SJRA 2W04A 2E8AA 4WK1A 3OYJA 2CQBA 5EX0A 1JALA 4O3QA 2FJVA 1IJFB 3CERA 3EKSA 3CCES 5CE3A 3C1YA 4X4RA 3M8QB 3AVGA 2HBKA 3MDAA 1YJTA 2VKQA 4G1PA 4OYWA 4Z6EA 4NZ7A 4GVEA 1PVPA 4FXWA 3MPVA 5AM5A 1E3MA 1XNRF 4N77A 1F21A 4X66J 4EFAC 4ZOSA 2VONA 3VAFA 5HMYA 3LWMA 4JI0F 4LF7F 2CPYA 5CQGA 3MGIA 4MF2A 2VG5A 3SBGA 5F8NA 3NF9A 3KKAA 2DJWA 4OYIA 1ZPVA 2CJAA 3JQJA 3UM9A 3G8QA 1C0MA 1PK1A 1KQSR 1KVAA 2D0OA 4CTAB 4RNHA 2DY4A 4UB8U 2IMOA 2IVOA 3EICA 2PI5A 2WOMB 2VHGA 1KEKA 2WFBA 3AB2B 2ZHOA 1ZTTA 4I2QA 2DBBA 2VBYA 1V5VA 2JHDA 4JI2F 3UN2A 2X74A 2LMRA 1FJEB 2BANA 4FJIA 1WCLA 4FNHA 3J7YP 1J5OA 2E7VA 4PR6A 4JK9A 4USTA 3RMAA 2YNIB 1BU6O 4KI4A 3HILA 7ICFA 3KMSA 3RBXA 4K5RA 1NGEA 4C3KA 3CQXA 2UUAF 2YKPA 5K20B 3MM9B 4Y2PA 3TFSA 3QO9A 4JI3J 4LBHA 3G0ZA 4WFZA 2HS3A 3WKEA 4DV3J 2X3GA 3KD3A 3U6FA 1PO6A 2WVFA 4H0VB 4Z6FA 4BRGA 4RO0A 2R9LA 1IJJA 2WAQC 7ICEA 1HKGA 1ZQ1C 3FEXB 4DV5K 2MPUA 4DV0F 4ZP9A 2B4OA 3B9JA 2DR8A 5ALYA 3BPDA 1NNLA 3B54A 1PAUB 2X1AA 2ABYA 1KVBA 3P45B 1ZPWX 3H5SA 5AXMA 1S1UA 3BB5A 3I0RA 3NHGA 5AQJA 2JZBA 1UT5A 4H4KC 2FPMA 2G2ZA 1AB8A 4BRIA 4X65J 2M0NA 2ZOFA 2OD6A 3DEEA 2MGZB 1C0TB 4OZ0A 4Y65A 2HMIB 1L3VA 3RJEA 1FXRA 5E3RA 1UPMB 3AGKA 2CQ3A 1O8BA 1T3QA 3L5KA 4KIAA 4DV2K 2QIFA 2JHEA 4FJ5A 1LWCB 3H0RB 1R6VA 4KH6A 3W2WB 2PIIA 3MWTA 4GC6A 1PBUA 1RHQB 8AT1B 1V4SA 3CDWA 4CLWA 1C0TA 3VR1A 1X4AA 3VF4A 3U1MA 4P2XA 3CCVN 5EOZA 4MFFA 3KLFA 3FZHA 2JRZA 1JK9B 3B8HA 3M32A 4KBOA 4BJQA 3PDNA 4BXOB 3K89A 1QE1A 2HFSA 3BGFA 5AI4A 4UB1A 3K2PA 3RR8A 4CH7A 3S3NA 4LRAA 5M1OA 2LECA 2E9RX 2YN4A 4JI5F 1NGIA 3J81O 1VC0A 2P6UA 3QFPA 1X0PA 1M1HA 1TGOA 3ZTRA 3C2PA 3LK9A 1AT1B 2YNHA 2Z2LA 1NJIO 4CYUB 2V69A 3LP1A 4NZ0A 3K9JA 3LP2B 1YHQN 4FNIA 2DY9A 1HMVA 2P9SB 1MWKA 4KLEA 4OJ5A 5DB6A 4FWPA 4PL7A 5HRRA 4B3SF 4JI4K 4CJWA 3P6YC 1WBBA 4I2BA 3MR5A 1RAJA 4F0KA 3X3UA 3OHRA 5M1FA 3K57A 2V7YA 2YXLA 3GB0A 3H46O 3HW8A 1FCAA 3QUQA 4M5IA 4IJAA 4E3SA 1HUXA 2K7KA 4QOZB 4DR6F 1S59A 2KVIA 2OEJA 5IIKA 2YNHB 3ZZZA 2Y9UA 4PPDA 4HHTA 3MOZA 3Q22A 4YOXA 3ZD9A 3HZGA 1ZQOA 2HVHA 3CB4A 1FXXA 4RW9A 2V4QA 3LDPA 3AO2A 1C0FA 2OPRB 1YBUA 2XWYA 1IV8A 3FQLA 1U0HA 2Z30B 3CCQS 2H3IA 1F60B 2OEKA 3JQMA 1RAAB 5HJXA 3NMUA 5ALNA 7ICQA 3NGZA 4FJ8A 3C28A 2MKIA 4RQ1A 1VC5A 5J0QA 3VQCA 4DSFA 3RBZA 2HRUA 2GIFA 3C6TA 2R8IA 4W5OA 4CW7B 4NLSA 3JAMO 3FAHA 1NHKL 2UXBK 1ZBHA 3DLHA 5E26A 4CIGA 2HBYB 3BGLA 1SV0C 3V81A 4PL2A 3P5TL 3HSTB 4ZLJA 3U02A 3LDQA 4MIAA 2BRLA 2KXNB 1CC7A 3BO4A 4UBBA 3CDEA 3PUFA 5CYMB 3KHHA 3MD3A 1SWVA 4ZVEA 2O8BA 1KSPA 4K8RA 4CF1A 2XRIA 4XA5A 2Q79A 4JK8A 1P7DA 4IXCA 1RZTA 1EETB 3RUBL 4ZVGA 4YS2A 2BDPA 1UEKA 3R9LA 1WF1A 3KHRA 1FI4A 9ATCB 1N63A 3Q7BA 2Q0UA 2F76X 2BE2A 3MWPA 3CCLN 3PW2A 2XMVA 4ISEA 4Q0BA 1DTQB 1RJJA 2IHNA 3L7PA 4DLEA 3TANA 3SCXA 1L3TA 1WACA 1NEEA 3VF6A 5J2PA 3D6RA 2PFQA 3AT1B 1G1XA 3T7ZA 4RU2A 2DNOA 4U8YA 4RG8A 3ZSXA 4F3QA 1EETA 1SZHA 3HCXA 4MEYA 5HHIA 4JI6K 2BJ9A 3BF1A 3ENHA 3O5BA 3O4QA 1YSJA 4B9NA 2VGNA 2ZJQQ 3QLHB 1NOYA 3RR7A 1YITN 3QLHA 3HX0A 3TYTA 8ICSA 3MAAB 5LOQA 2GUIA 3CHWA 2KYZA 3CCQN 4LC9B 3NASA 1MA9B 3DRPA 3NL0A 4OZ3A 5ALMA 3RGIA 1JLAB 2ZOGA 1T95A 1WORA 9ICGA 5KPZA 3MK6A 9ICVA 2ITMA 3WQTA 4WZQA 1MDUB 1VRQC 1VSFA 5IWAJ 2V67A 3PMLA 2DKXA 1VQYA 1RT2A 4DTOA 3V4IA 4Y1CA 1GAOA 3I0SA 1NPRA 2P9PA 2P9IA 4BRQA 4Z4EA 3F73A 1EWQA 2WF8A 7ICNA 4C8ZA 3L7UA 1TL3A 7FDRA 3C6TB 3PX4A 2F65A 1PAEX 2HSZA 2B51A 4MF8A 2B4VA 4E1NA 3CF5L 2UUBF 4U7BA 3QYPA 1UZDA 1KD1O 1XO0A 3RMBA 4FJXA 1LV5A 3LO3A 3HP6A 2ZH9A 3AJ1A 2FMPA 2CJQA 2CDRB 1UVKA 1GO3F 2W1BA 1N5VA 4RNFA 3UD5A 5BR8K 4B9MA 1NSPA 2E29A 2MLZA 2OYQA 2NNWA 4I2EA 3OTQA 5J2MA 1CJUB 4OO1J 5C5JA 4P52A 3Q8UA 5F3ZA 1MG7A 2AJFE 1FWPA 3O0FA 1RISA 2UUCK 4AHVA 3R1HA 4P2SA 4GKKK 1AZSA 1GEHA 2HNZA 5DZ6A 5IT9U 4ZCLA 1BQNA 4M5JA 1ZH5A 2QG9B 3QNNA 1FJGK 4KTQA 2W6KA 2D0PA 4W5RA 3ETOA 3D3CJ 3R5JB 1EXNA 2L3MA 1RDBA 2WF5A 4FVCA 4FDFA 3HP9A 1GLAG 4FXVA 1XMOJ 1LW0A 4M5HA 3M2VA 5GINA 4OYXA 4TY8A 4A46A 1FDNA 2OTJN 4NLUA 4XQ8A 5KL1B 1NZ8A 2JWKA 5DDOC 4L74A 3T1HK 1ROFA 1OY8A 4RW7B 5HO4A 2Y9HA 4IDKA 2R18A 1J5EK 3HMJG 3TZZA 4EELA 3FRZA 4KFBB 3WC2A 3WK8A 1Q8IA 4UT4A 3AU2A 3PM9A 2IDOA 2CPHA 4JKGB 1T6DA 1XC9A 4MH8A 2G09A 4F4YA 2YNIA 3EXYA 4ANCA 3JYTA 1R43A 2B9WA 5IXUA 3OVAA 3OVNA 5B8HA 1GLLO 4OZNA 3UMBA 2CA9A 3NGYA 3NMRA 5B5EU 4RLEA 5DO2A 1S9GB 2RJZA 3GSIA 3O3GA 3BF3A 4USWA 4AD6A 5DGBA 2POKA 3CUNA 3QJPA 2QB1A 2ZJPQ 4KX5A 3VMFB 4GRSA 4FM1A 3ZZOA 2V50A 3SFUA 4OHVA 2V0NA 1CC8A 2HQIA 2HRTA 1VQ8S 5AE3A 2PFNA 3FBCA 3J7ZO 4FXDA 3KK7A 4GVMA 4I6AA 1TAMA 2HBLA 3I4PA 4DBQA 2W9MA 2HQGA 1LVHA 1TVAA 4X4OA 2V94A 3PV8A 4H0TB 3HJEA 2DHSA 5I3QA 4RW8A 3HRDD 4P2HA 4ACOA 3FNNA 3ATUA 5H1SQ 2BHNA 2YI1A 4YDUC 5GMKa 1VI7A 2R2TA 4LT6A 5EN1A 4NWBA 5E3CA 1RK8A 1C6VA 3PW7A 3NAIA 1GLDG 4JI8K 4FJ7A 4BHQA 5SZTA 2GJIA 3VQPA 2HQDA 3BS9A 1NPPA 3Q8PB 2V7ZA 3C7NB 3SAFA 4NASA 1B7FA 3IR6B 1MSWD 3AO5A 4HT5A 5LMUF 2YKOA 3MMJA 2XMMA 3QJJA 3F5EA 3EJMA 3KK1B 3E2EA 1N0UA 2ZTDA 3KKAC 4LSLA 3K5LA 2UXCF 1SXLA 3H7HB 2BBEA 5KFTA 3KLGB 3NNAA 3NE6A 5KFKA 4NLPA 2KJ9A 3VAIA 2KFNA 4OI2A 2Y1LB 3ATVA 1SH0A 3UD3P 2PFFB 1N62A 4FLVA 2YH1A 1N6QA 1R8PA 1X60A 4NCGA 2LM4A 2J5AA 4U7UK 2QI2A 3C7NA 2ZIWB 2OCEA 3CC4N 5AKJA 4BC3A 3TARA 1Z3EB 5HVGA 4Y2IA 2QE5A 3ET6B 5AQGA 2EFOA 1N8RO 4CD1A 1BG3A 2XZWA 2QB0B 1RDRA 3I0RB 1CULB 3UVJA 3C5FA 3H3OB 2ZD1A 2ZJPL 3R6GB 2VPZB 2KKHA 2W03A 4WBFA 3JAMU 3UR0A 3DXSX 5J0SA 1Q3VA 1CJVA 3D2NA 2UUAJ 1S79A 3DJCA 2GV1A 3JB9k 1NXIA 3RB6A 2KXHA 4M1KA 1LOTB 5FRMA 2JGUA 3OS1A 3OYKA 3DOLB 4WK3A 4JS4A 1XR6A 3JXOA 5MLCV 1YTYA 2XLJA 1ZQEA 4B1ZA 1NHVA 1RT6A 1HARA 3MR6A 1BUXA 4UAWA 1RBAA 3MN5A 5AQOA 3TACB 1DGSA 2HWTA 3CP8A 3IG5A 3THVA 3AAPA 3JTPA 4DV1F 4H4MB 2QL9B 3I76A 2ZJ8A 4AQYJ 4HAIA 2WBNA 3K0JA 2VBXA 4JN4A 4WJ3B 2V8HA 4O4GB 3W61A 2H54B 3HD1A 4IQUA 2AGPA 2G13A 4YVZA 9ICBA 4WFXA 3EGZA 2K4PA 4YD1A 5C25A 3R7SB 3BH7B 3IWNC 2YQEA 2C2OB 4RQ2A 3IAS9 3BYRA 4ZPWR 2F44A 3CJKB 4DB3A 4BUGA 4FFDA 2BJ1A 4F93B 3PACA 2E5HA 2F8KA 4P6QA 4F9OA 1ED1A 4LF5K 4HHUA 5FD1A 4O4GA 4Y0FA 3TFRA 2DGVA 5DKWA 3OTBA 1M5PC 2KZZA 4M7YA 1SS6A 1T8EA 3RJKA 3C95A 4DX5A 1X66A 2AT1B 4R0JA 2L9DA 1W0HA 3SAHA 2B5JA 5B0AA 2PGCA 5HL7Q 1B9DA 1DK2A 2F8LA 3EL2A 1Z4OA 3QIDA 2ZEJA 3PRDA 5K8OA 1S6PA 5J2QB 1GMWD 1XNRJ 1ITGA 3H2UB 7ICVA 4Y2KA 1JLAA 2UXCJ 3MCPA 2W24A 4I27A 3M8WA 3AMZA 1ZBFA 1HFEL 2C28A 4ATNA 3N97B 2ACMA 1TKTB 1SIZA 1VJQA 1YWXA 3I5AA 2DISA 1HLUA 5BPNA 2CKWA 1HBUB 1NUEA 3H42A 2IVPA 1VSIA 3OYFA 5AI8A 4FK0A 1C0UB 1P1TA 4V19J 1KTVA 3P39A 1XS9D 1IKVA 3QT6A 2DFEA 1FEHA 2F3NA 2F5GA 1ZQWA 3TAFA 1R8CA 1MLAA 3CFRA 3SUNA 5MLCQ 3GG0A 4FZXC 2NUBA 2W3RA 2DNHA 2E6LA 2Z56B 4E89A 2HNYB 1RT1B 3S41A 1UWBA 4F5RA 2RH3A 4H4MA 5G0RA 5C12A 1BD6A 1GTEA 3HPOA 1H73A 4K0KK 1MN8A 4P74A 2YB1A 4C1NK 4LF6J 2E1YA 2ZJ5A 1BVSA 3MZIA 3MN9A 1KL9A 3A5MC 4M94A 4L3QA 4FK4A 3SCLE 5HVFA 3RSEA 2KKZA 1RM6C 4XH1A 3TTCA 3G82B 2CVEA 2JSXA 3AO1A 3QRRA 1NDLA 1FNOA 4DLGA 3MF5A 1ATRA 2KE7A 4DFKA 2FDNA 1ZQZA 1WWUA 4I7FA 2GA7A 1NKEA 1IH7A 4LFBF 5AQUA 4DTUA 4ZIWA 4QZEA 4ILLA 1YG0A 2HVZA 4P0PA 1WOQA 1N5XA 4Y2JA 2ODGA 2YQ3A 4ANEA 3RAXA 3CJ3A 4YB1P 1VQLS 2LQ9A 5J1EB 2AIRB 4QNLA 3W64A 2GAGC 2R3VA 2MU2A 4RW4B 5D3GA 2MKSA 1XBWA 2ZVIA 2E1FA 1LWXA 4J37A 1BIZA 5GIPA 3DDHA 2IFXA 1RAHB 1EZZB 2KG5A 2VG6B 1ZM9A 3C21A 1FRIA 3AO4A 1RXOB 1GMWA 1WHYA 1WYGA 3A3NB 4R25A 2AGOA 2FSKA 2ROGA 4RPYA 4LF9F 4P0PB 4E19A 4R8UA 4C8MA 1AXQA 3HKZD 5DG9A 4OZ5A 1UEUA 2K8GA 2UU9J 4JWMA 1NB7A 3SI6A 4PY5A 1F2GA 1WDTA 4WP8A 4RQ0A 3IWXA 4FWNA 3LALA 3VERA 1SZ2A 4DF4A 4OJRA 4AHCA 5EVZA 4DU3A 3AXKA 5IIIA 4NL9A 3HSGA 1OQ6A 1HNXF 4FJMA 1MMNA 2ZH6A 3ZZYA 5J0WA 3DRPB 4FS2A 5EWEA 7ICJA 4BRLA 1GOAA 1H0HB 2CQ4A 3CNQP 4CDIA 1RTIB 3NGTA 4IQXA 2UXDJ 4FLTA 1KAXA 3Q23A 5KPTA 1UL3A 3R2DJ 2DH9A 1NKCA 1QTMA 4BC5A 1T9YA 1VLOA 2QWNA 1V38A 2CGJA 1VSKA 2FJAB 5AXNA 1GX5A 2D41A 5KFQA 1KP6A 3BBFA 3GQCA 2MKJA 5AQTA 1WHWA 5BOMA 5A2QO 3NTUA 2GW8A 9ICPA 1HR0K 1P6TA 4FLUA 3NGIA 3K1RB 5E41A 2LXIA 2MZQA 3IRXB 5ADZA 3H20A 1SQKA 1UFKA 1PC4A 4Y2XA 1HBMB 8ICLA 5LMNK 4LFCK 2VG7A 4FO6A 2ALYB 2K1RA 1KDNA 1HI8A 1BDGA 4TU9A 2ZZMA 1U04A 3LPUA 1B64A 2HNZB 4USJC 1EKEA 8ICVA 1PC5A 2OD4A 2PMHA 3AA9A 4KHPF 1TV6B 5K9FA 4O23A 1RFQA 2BKOA 3AAWB 3QUTA 1IUJA 5KFIA 2F9JA 2J7UA 1K73O 2G8WA 1U4BA 2MJUA 1NGDA 4WZMA 2D5RA 3N7RC 4ZHRB 1JN3A 2FBXA 4F91B 3RJFA 1FTRA 3EGNA 3ONQA 2ZWHA 1QLNA 6FD1A 2DH7A 2D6FC 5AIAA 1KW4A 8ICMA 2XMAA 1S97A 3VQ5A 2P8IA 1LQ9A 5AQRA 2EBEA 4LR7A 4B3MJ 4ZJQA 5F9NA 2B4PA 1RT7B 1E4FT 4RX6A 5AE2A 3PMNA 1S77D 4XTTA 3ID8A 3C66A 2KSOB 3IN5A 3AJ2A 5EX3A 4DL3A 3KLEB 3HKZC 3E9PA 3QIPA 5FIIA 2PSZA 2HRYA 1MWZA 4ZH4A 4RW6B 1M90O 2FI1A 4N41A 2VIXA 3HHDA 1RT4B 3GILA 4K4YA 3KVGA 3IBWA 3S01A 5DK5A 4DFPA 2BM1A 1N5YB 7ICKA 3JQKA 2ASMA 2ETJA 2DRBA 1TVRA 3VZIA 4C0OC 1K1SA 5BRFA 1YJ9S 3MDFA 4FM2A 1S9EA 3UMCA 4OJ1A 4N56A 3PLAA 3SMPA 4WYBA 2BUPA 2Y8WA 2M88A 4CI6A 4Y2RA 5D78A 1HNWK 3HHLC 4OHWA 5IIJA 4DI6A 1NJXA 4DU8A 1MMLA 3ICLA 2EFQA 2I7NA 1KFSA 2XYHB 4YHHF 4UZBA 2B43A 3MOJB 3RW7A 4DX6A 2J8AA 3AA2A 3JPOA 5CB1A 1VC6A 2DEIA 2AJQA 5GAEU 2MJNA 2E20A 2ASPA 1VR6A 5EHHA 4NZ6A 1RACB 1BISA 2KK0A 1MROA 4KTZA 2E1AA 1L3KA 3P5BP 3FFKB 1U6BA 4HACA 1J5OB 9ICOA 1Y11A 3AA5X 3DXMB 3PRBA 2DXDA 3F9MA 5FJ4A 1TR0A 2GX9A 1U1NA 8ICOA 4J2BA 4FKXA 2QB0A 2VDHA 4KH0B 5J0RA 5J0UA 2PMZF 1ZQNA 1B0PA 1X6IA 3NVKA 4CQ1A 3A8IA 4DUYK 4YHHK 4NXMK 2UVVA 4K4WA 2RN2A 3K75D 1S1WB 2QW9A 3JS6A 1M1KT 1REVA 1QQ7A 2KL8A 1MWMA 2H5IB 3A4TA 2ZTEA 1QAXA 4K4XA 3LPYA 4NLRA 3L4IA 1KEJA 1YDLA 2V8PA 3T1YF 3RAMA 4DS5A 2HOFA 2R8JA 1VQKN 5EE9A 2GV9A 5DQIA 4JYAF 1B92A 2R7XA 4OX7A 5GAGI 1F5SA 4JYAJ 3SQGA 2BH1A 4TKTA 1GNKA 3GE1A 1Q5VA 4M47A 1VHXA 4EHUA 1GX6A 2P5OA 1FFSB 3H1VX 4KLMA 1F0MA 2ZNZA 1E6YB 1ATNA 2K8AA 1YZ6A 1KVKA 1RT4A 3U3YA 4M63C 5IV3A 3SK3A 3KLGA 2R7QA 4CERA 2ZH4A 3P4IA 3SSQA 3WK4A 2GWJA 3ETRA 1TTHB 3QT5A 3FJ2A 1R31A 4FPRA 3PR4A 4B3RF 1QCKA 2WF7A 2DNRA 1NGCA 1MN7A 5C2CA 1VQ4S 3Q2TC 2G06A 3VHQA 2LA6A 2Q6CA 4DV4F 2RE2A 4J9OA 4FWLA 4RTFD 4CHNA 2P9NB 5M1PA 4M8LA 3V6DB 5FDLB 3QMQA 1NGBA 4M5LA 1CPZA 2FLLA 3OXLA 4GKJF 3H8JA 2M9KA 3F2BA 2LSNA 4E7LA 4A2AA 4WPAA 1EX8A 1JLEB 4MK7A 4AM7A 3IHQB 1RWNB 4PKDB 1OVQA 5MAOA 4ZJLA 3BF4A 1B3TA 4L76A 3V1OA 5KT5A 2ZXHA 4XAKA 3IS9B 3FEZA 1ZQTA 1KKXA 2YPYA 4K50A 1RU2A 1RWXB 4P2FA 3IP0A 4C1NI 1JJHA 4URQU 1KVJA 3V9ZA 3H25A 4DV6J 4KH1B 2A6AA 1P9YA 2VQEJ 4YUDA 2Q0ZX 2EBGA 4JI5J 4ZLPA 2ZHBA 1XMBA 2U2FA 2NRTA 2OPSA 4UOGA 2ZD1B 2MRLA 2R8HA 1N34J 5HNKA 2AD9A 3BPSP 3FZ2A 1J97A 2QL7B 5KOXA 3R5BA 1Q7YO 2O8FA 4J9RA 2AU0A 4CDGA 1CXUA 4DV0K 3EO3A 1RT1A 3C46A 4C23A 2DHAA 1CBKA 5J1EA 4IDHA 2CJ9A 3GL1A 2DL0A 1OWXA 4LF9J 4DV0J 3AV9A 5HP4A 3AUOA 4O44B 2BEFA 4DUZK 5K14A 3GCXP 2OZMA 5M2RA 4FWKA 4DCHA 3HO1A 4F4XA 1C7YA 4LRCA 3A13A 2H5EA 1VQMS 3SQ0A 4M5DB 3HVTB 5CZVA 1QVFR 1J27A 1IR1A 2K89A 3K9KA 4PXCA 4FWOA 3D0HE 5T14A 2BRKA 1Y88A 4ZVQB 1DY3A 1U2CA 3KG1A 4ISFA 2NO4A 5JVHQ 1S1XB 2G2YA 3R3TA 3G71N 3KJQB 5L1IA 1VSDA 3CIMA 2ASDA 2HHVA 5KG2A 2ZC4A 1AUSL 4OLOA 3SBMA 3KJFB 4CEAA 1T9XA 4PWWA 2P1JA 1WC3A 3EM1A 3UXNA 4C9DA 4Q0BB 4FZVA 4CEDA 4IG0A 4UBCA 2HDOA 4DPTA 5I3UA 4I56A 4M9HA 2XMJA 1EX4A 3K4GA 4BCAA 4NYFA 4GXIA 4QYZK 1YQHA 2YWFA 2QXLA 1KRPA 1CI4A 4DU1A 1RBUA 4BR9A 2BW2A 1U6FA 3C16A 3H98A 4WQ5C 2BPFA 3MR3A 1Y00A 3A0IX 3QQCD 3BJYA 4Q5VA 2G0CA 5KTQA 1T4GA 4KO0A 2FGOA 3LTOA 2ZFHA 4YNQA 2UU9F 4FZYA 1JRPA 4KLSA 2HK2A 3D2EA 3EW9A 1ZQGA 2DGXA 3QE9Y 4PZNA 2C42A 1QAIA 2D3O1 3W1YC 1CS4B 2BGWA 1HW8A 1DK3A 2R42A 3M6GA 3BKFA 3CC7S 4AXIA 3VQ6A 2HBZB 2RF2A 5DQGA 2EFVA 4PUOA 1S6QA 3KK2B 2NSCA 1KQGB 2FBYA 2G8IA 1VSJA 3NOGA 1S6QB 3UCGA 2CQ0A 4RQ4A 1ZQJA 1FDDA 2KDOA 4M7XA 4QYZJ 1JNRB 5LXYA 3KFWX 1QHAA 5HL7L 3MAQA 4YR2A 3AOBA 4OJGA 1VDHA 3HX9A 3J7ZT 4URSA 9ICFA 5HSPA 1U2RA 2ZHAA 1Z1VA 4KE5A 3HVRA 2JC0A 1GH8A 3D7EO 2FB0A 5FP0A 3ZX3A 3VQ7A 3KK2A 5ETSA 3TNVA 1N32J 3I56S 4BWMA 8ICBA 2HHTA 1IWGA 3EZUA 2VF3A 4UZCA 2KHOA 4BGAA 5D0GA 1WN7A 3D6JA 1RWOB 1XMQJ 2HGMA 3OYBA 2A5XA 5CZ1A 3BQTA 2IA6A 3BREA 1KXPA 2B8QA 3AOCA 5J2FA 2A18A 5D4NA 8ICHA 4X64K 2RDDA 4B9SA 4M63A 2JEIA 2J0QD 2QA4S 3DRRA 2OFGX 2RNEA 4GV6A 3LAKA 4DR3F 4PHDA 2IRXA 3J81U 2KH9A 1ZOTA 1S10A 2RQ5A 1FFUA 3E58A 1ULRA 4KHPJ 4ED0A 1CSJA 4FOIA 2HZAA 3U9DA 5DG8A 3AXMA 3G86A 2MZSA 4NYNA 1Y5IB 4YMNA 2WB4A 3HLUA 4CZJA 3CJ9A 1U2FA 2DGWA 2X1BA 4DTNA 1TVRB 3AD7C 1DTTB 3C14B 5IV4A 3GYNA 4B8CA 4Z4IA 4ES3A 3CMAS 3VGMA 3M2RB 1RHRB 2ZKTA 4M04A 2H3VA 3GU3A 1X8DA 4YXMA 2A3JA 2AJ1A 3QEVA 3TJ8A 2ISOA 1VBKA 3N28A 4DV3K 3QUBA 4PPZA 4CFBA 5ALDA 5KFHA 2FY1A 3ZNUA 4I2JA 3R6LB 3SJJA 3B4DA 4KGVB 4HI2A 4NLVA 5L8RC 2G0JA 3NS6A 2XMTA 2N3OA 2BXJA 3HM8A 4FVMA 1S9GA 1YKWA 2YKMB 1RTHB 4ID5A 4JI7F 2O66A 3UDLA 4PUOB 3LH2S 2HPUA 5AQPA 1JWWA 1Z4NA 3EN9A 4CEEA 2HQ3A 1HNZJ 2CWKA 4FWRA 2CAJA 1KQQA 3IM8A 3AQOA 2K1RB 4TUQA 3M6XA 5FPNA 4ECSA 3LP2A 3EDRB 1FVQA 3EUB2 3WX4A 4PG8A 2PN6A 1NGJA 3POTB 1TV6A 2ZNYA 4F67A 4UOCA 3U27A 1SJ3P 4KHUA 4ID1A 1HWIA 2P9UB 4I6MB 2EKNA 3R7NB 5T7BA 4JKBA 4DV2J 5KNIA 4ILMA 3HSZA 2UYTA 1X9SA 2RHFA 4FWMA 1U1OA 3R5AA 1QTNB 2RU3A 1VRTA 5ALFA 2BCVA 2ZUDA 2HBRB 3H8MA 4QIVA 2ZM6J 3UE2A 4XPCA 1NK9A 4KN7A 2XSJB 3DDNA 1GTHA 2N3LA 2DRAA 2VOOA 1HNVA 4ETXA 2FC0A 4YEAA 1RTJB 3P3DA 1VSEA 4MAKA 2AHOB 4DKWA 5CCMA 2E7WA 3SUOA 2JMGA 5AKZA 3D67A 1D0EA 3G25A 3TAGA 4Z7YA 4ICAA 2N82B 2CJBA 4KJIA 4MDBA 4A57A 2IBOA 3QDKA 4AQYF 2QJ3A 5FPDA 3HM9A 4GW6A 2EXUA 3UNYA 2P9LA 3UKRB 4OI6A 4Z2XA 2EKYA 3NCPA 4E0DA 3HJFA 2GLEA 3F9KA 4RNMA 1FRHA 1NM2A 3QYYA 2APOA 2E8NA 4YQWA 3KLEA 3ZETB 3Q8SB 4HLBA 2JEFA 2WC9A 4DTSA 1HYSA 3KHLA 4CHZA 1V85A 4FL9A 3FGUA 4W98A 1JXLA 2DCLA 3AVFA 2O8EB 2LYBA 8ICTA 4ZVRB 4DN9A 3UDEA 5CYQA 4ZCMA 2MKHA 1J6ZA 4DV7K 5KOWA 3CCEN 2R7UA 4OLPA 4JEPA 3RG6A 2K3IA 3JXUA 1BL3A 4H5RA 1KCFA 3UKRA 1CJVB 5JRTA 4QZIA 2NLWA 1YUWA 2VFUA 1A6SA 4KGXB 2GMJA 2XHBA 1OYDA 3WQPA 1JMTA 1Q95G 5K8NA 4CIEA 3TZYA 1HYVA 4DV5J 4A59A 4UUWA 4FLYA 1G3OA 1F5BA 5GAEP 4Y00A 2KW4A 2U1AA 3W8PA 3K8VA 4KLQA 3AA8A 3HFVA 5HMZA 3KNAA 5HMMA 1WG5A 4RW6A 5EE0A 5ALJA 4J90A 4BDYA 5ETQA 2OELA 5LL6Z 5GAHP 2E5IA 2FGCA 4OV1A 3H8YA 3DYAA 1UCNA 3CSKA 3TU5A 1MN9A 3PKMA 2HB5A 4QWDA 1YJNS 2FJ6A 1TUYA 2HAIA 3BBCA 2PEBA 2PO4A 4PHTX 2B7BB 5ITHA 4UW9A 1WC1A 1ZBTA 5K8PA 2XHCA 3S1TA 4I2CA 1SL1A 2AYBA 2F4VJ 4K5SA 4RJVA 3UFCX 2RS2A 1UA0A 2E1RA 3MMBA 5CY4A 4EO8A 1MMDA 3BZKA 1TL1A 1JXVA 4YOEA 3MX5A 2HFNA 1X2IA 5HP1A 1XO1A 3PIPQ 2NPFA 4B9TA 2DO4A 1H38A 4FZMA 2CZ9A 4QW8A 4JRQA 1EKRA 5D0RA 2IOFA 1F44A 4PWDB 4KRFA 2O8DA 1IN0A 1KWMA 3A5NC 4CH0S 2B21A 3FR0A 3MC1A 4RWTA 2O8DB 4C8YA 4OD0A 3TOQA 2WVEA 4C0HA 4LF6F 4NI2B 2Q2RA 2ZH2A 3MMBB 1HUZA 1GLCG 2GHVC 4KY3A 4CJLA 4CP5A 4BQZA 4DUZF 4IO9Q 2DBYA 1IG6A 2A1JB 3CD6N 3PIOQ 2Y3YA 3CNHA 1QQOA 1YTUA 5CYMA 2E5LF 1DOQA 4IH5A 2JX2A 2VYPA 3ELHA 1NK6A 2HVEA 5KAFU 3SIPB 7ICSA 3FBEA 1DLOA 4I2PA 1F3FA 3ZSOA 1Q53A 2LM1A 2VL1A 5HMWA 2H65B 3N6MA 4CO3A 3M8PB 2RLTA 2QL5B 3UQ0A 5HAOA 5KFYA 4TVAB 1K8KA 5AI6A 3Q86A 2ZJAA 3N5BA 3L3FX 2UXCK 1HBNB 2AYMA 3QBXA 1NZPA 1RCOB 2AQ4A 2CQ2A 2X6SA 1TKZA 4USIA 1UAWA 2JH7A 2QEXN 3FYHA 1IV0A 5GIOA 4A8MP 2RE1A 4CD3A 2D1KA 2IVNA 2K2PA 3SD7A 2F3JA 3WK5A 1RQ0A 1ZBLA 2KHDA 2WHOA 2QEXS 1ZQQA 1WKLA 4KO0B 3N9UC 4GMKA 4RPFA 1VQNS 4YR3A 5L9XA 5KG1A 1MC8A 3I5BA 5KFNA 2KEYA 4WWSA 4BRKA 4OI1A 2VDIA 3ID6A 3GR0A 4GVBB 2VGMA 4IFVA 1PSDA 4F4KA 3EVMA 1N5TA 4QWAA 1FWKA 2OPPB 3IBCB 1VJWA 1K9MO 4NA2A 1CQNA 3AVBA 4DV7J 1DFDA 2GO8A 3ONNA 3NGKA 1Y0HA 4ZA1A 4AYBD 1HNIB 4I28A 1SIJA 2MZJA 4DHVA 5AKLA 9ICQA 3MBYA 1U49A 1R8BA 4PG7A 2DITA 4ZN3A 3FCVA 3JPNA 3SSRA 2H3EB 4Y2SA 3LANA 4XDDA 2CPRA 2I2YA 4K4SA 1RLDA 4JAXA 2UVUA 4ZPCA 4TQRA 5KFZA 4IWVA 5FPEA 1NLKL 3HD2A 2IAJB 4JB3A 2Z7JA 2WF9A 1NM1A 3VGLA 4BRAA 4HH1A 4ZP6A 3LP3A 4I4BA 3ZX2A 4ERDA 1C2PA 1NMNA 2R8GA 1LWCA 3ETMA 1YAGA 4NLOA 5BYRA 3RW6A 4DPXA 1RBRA 1FNMA 5C10A 3LYSA 4X4PA 3CPEA 1DBDA 3R7BB 2NRXA 1Z05A 1BA1A 2VWJA 3RH5A 3ILOA 1D3WA 4PYAA 2Z1IA 3GJSB 2RQKA 2WB1C 1IKWB 1ACMB 4TU8A 4ZJOA 4FZLA 1X4BA 1NK5A 2OTLS 2ZIXA 2EWSA 1FX4A 2HZCA 3OXFA 4ANDA 5BRHA 2R7OA 1NSKL 3QFUA 2X1GA 1MWQA 1SQEA 3MXIA 5ALIA 4USVA 4DR4J 4ECTA 1RAFB 4TLRA 2CQPA 2LLZA 3VCDA 3U3GA 3MXHP 2Y0SD 4H4KA 4O5CA 4KH4A 1SBRA 2D74B 1QUVA 3KLIB 2UV8G 3BV8A 3FMWA 2Q66A 4RQ3A 2E5SA 2GQCA 1Q5YA 5LY3A 1WHVA 2OM6A 1PBAA 4YB7A 4P7TA 5ALXA 2M9NA 1BCOA 1ZM4A 3B6PA 5LSLA 2F8HA 1UVMA 3AM9A 2ZZTA 5IILA 3NRZA 1N60A 5KG7A 1A5WA 1FRLA 4C8LA 1ZQBA 2QA2A 3Q89A 2DGZA 4A47A 1QHTA 3M6ZA 4JYAK 3GCWP 3QU7A 2LYAA 4WFNL 3KDNA 3ZSZA 3OSPA 3VWSA 1WI6A 1NNEA 3N79A 5U47A 1WJ9A 3SNNA 5DBCA 3K5MA 3C1ZA 2CG4A 2JVRA 4A5BA 3F2KA 2W4DA 4C7YA 4DR6K 3WZ0A 3VENA 8ICIA 4CHPA 3M9MB 1CLQA 3TUJC 2O5DA 1BHLA 5K8MA 2HFVA 3ZD8A 3C23A 4I6YA 4WYWA 1ITPA 2FY8A 1J53A 5CCLA 4OCZA