2HHWA

Ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*TP*GP*AP*CP*TP*CP*(DDG))-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 210
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhwA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhwA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhwA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhwA01
3ZT3A 3DLGA 5KT4A 1REVA 2LSNA 3LAKA 5KT6A 3VQBA 5KFCA 4AHRA 4CERA 5DQHA 2RF2A 4OLBA 1ASVA 9ICIA 3H4BA 4M6WA 3AO1A 4PGXA 4CFAA 4J9OA 1TK5A 4DQSA 1SZPA 3QEBZ 4GC7A 2C2RA 4FZXC 3RWUA 4I9QA 4CF2A 3DOKA 3H8WA 4UAWA 4FJ5A 3LWLA 2P6UA 5J0QA 4FJXA 4AHCA 1XC9A 2XGQA 4RU9A 4CJWA 3KLFA 2MAXA 2UVWA 4KPYA 4B9LA 1CUKA 2AQ0A 3PX4A 1TAQA 3JPTA 1LAVA 3KK1A 3M9NB 4FZZA 3LDAA 1GOCA 1S0VA 4CFDA 2GWSA 4HTUA 1DTTA 3PMNA 3DRSA 1B9DA 4Z4GA 4KHQA 4FJ7A 2HVHA 2ATLA 2F8SA 3HK2A 1U04A 3TAEA 4DL3A 4IQWA 3L2RA 5DGBA 2NRXA 4KKOA 4ZTJA 3V6DA 4I27A 1B43A 4FZYA 3VQPA 3SNNA 4E3SA 5FRNA 2UVRA 4DQQA 4JRQA 4DTRA 3DMJA 5KFIA 3UXOA 4O3SA 2B5JA 4F2SA 3FFIA 3OYFA 5CA7A 4KLMA 2R7YA 8ICSA 1ZQLA 2YNIA 1FKOA 4ECWA 4CHNA 4I2GA 1BPZA 3JPNA 4IR1A 1B22A 4DS5A 1RNHA 5HP4A 2FBXA 5KFPA 3QIPA 4DFKA 7ICOA 1ZQTA 2IMWP 9ICKA 1LAWA 1ZQBA 1BVSA 1TV9A 5J0SA 2Q3SA 4YNQA 4Q8EA 1TVRA 4TQSA 4CHZA 1Q9YA 4DO9A 1WAJA 5DB9A 8ICFA 1ZQXA 4F5OA 3BQTA 1ZQSA 3RR7A 3DI6A 5L1KA 3C5FA 3HYFA 1WSJA 3TAFA 1KVAA 2YNGA 5HRSA 3C1YA 1RT5A 3VQEA 4FK4A 3F9KA 3Q8PB 3QO9A 4CJTA 2YV0X 4QZCA 5CB1A 1BIUA 9ICSA 5DKWA 4FLYA 4CHPA 1DTQA 5JS1A 3AVKA 4F5PA 4ED2A 2BCVA 1QSLA 1G15A 1VSMA 2FBVA 5DB8A 3L2QA 4Z4IA 3LP1A 4G3IA 1KRPA 4DSEA 2AU0A 5CYQA 7ICUA 3K4GA 2W9BA 5D4BA 2M9NA 5J2AA 1ZQDA 8ICIA 5J2KA 3WNFA 3T5KA 1BPEA 3CG7A 1ZYQA 8ICGA 2VA8A 1BGXT 3S3MA 3ZSWA 3V7KA 1JLFA 2HVIA 3K5OA 2NRWA 3DRRA 3FDSA 1QSSA 3UQ2A 4ECQA 9ICAA 3M8PA 3QESA 4CEQA 2J6TA 5E41A 4J2EA 3TFRA 1ASWA 3TABA 4YFUA 4J2AA 2P1JA 3ZT0A 2YKNA 8ICTA 4DG1A 5J0UA 5J2MA 1RDDA 5C42A 1WCNA 4W5TA 2G8VA 1SKSA 3AVFA 2PI4A 2BCUA 3LPTA 3C95A 3WNGA 3KHHA 4FLZA 4FM0A 5FROA 3I0SA 8ICQA 1A5WA 2IA6A 4EBDA 2NRTA 3Q8SB 3GFKB 2PFPA 8ICVA 4CJPA 2HMIA 5I3UA 4BDYA 3RMDA 8ICZA 3MR3A 3VQCA 4M9LA 2QKBA 2BGWA 1U45A 4O9MA 9ICOA 1NOMA 3M9MB 2KFNA 4CGGA 4B9SA 5IIKA 2BGGA 4I7FA 3RJFA 2QK9A 4QWEA 4PGQA 2EHGA 3EYZA 4CGFA 1DLOA 3Q8MA 1WSFA 4ZHRA 4J9LA 4AHSA 3DM2A 5HMLA 2IDOA 2ITGA 4AHUA 3UIQA 3HT3A 2BQUA 4B9NA 4Q43A 2FMSA 1S0MA 1LV5A 5L9XA 4CF1A 5J2BA 4Z6DA 3HJFA 4CEAA 4M9HA 3RTVA 4DL2A 4TUSA 4L8RB 1CXUA 5KT3A 3CFPA 3JPQA 2KN7A 3VN5A 3VQ5A 3SI8A 2OYQA 7ICKA 1W0HA 4QZAA 3V6HA 7ICMA 4O5BA 4DL5A 2FC0A 4B08A 3D45A 4M3WA 4GMJB 5J2JA 3C6UA 2R8IA 1HYZA 3A2FA 3V9ZA 2ZJAA 4Y1DA 4CJ4A 4KO0A 3N97B 4Z6CA 9ICNA 5KG6A 4OVLA 1JMSA 1RDBA 3JYTA 3ZT2A 4RW4A 3VQQA 7ICRA 2FLLA 1QLNA 1Z00A 3ORYA 2IBKA 4FJIA 4M3RA 4TQRA 2W8LA 5KFLA 1I3AA 1S97A 2I5JA 3KLIA 3LP0A 2YHAA 1WCLA 3G6VA 2W9AA 1TKZA 1TVAA 3PW5A 3V81A 1RYRA 3Q8KA 5KT2A 5TZVA 5KFAA 4ED3A 3AVCA 3EPIA 2DFLA 4E7JA 4B9VA 1KFTA 4PPXA 3V9WA 8ICKA 2DY4A 4PH5A 2WOMA 4UB5A 3QEAZ 4CGHA 3VQ9A 3OYJA 3O3FA 2ZJ5A 4QCLA 2Z1HA 4RNOA 2BR0A 3VQ6A 1HUZA 2O4IA 4E7IA 3LPUA 1FK9A 4F4XA 4KN4A 1Y97A 3ZSYA 2G8IA 3JPSA 4MEXA 4YVZA 4QAGA 1UA1A 4KFBA 1ZBLA 3CYMA 4Q0BA 3ITHA 8ICNA 2B6AA 3TI0A 4YMNA 4KI4A 1HQEA 9ICBA 3V6KA 4EBEA 5KFBA 1JLBA 3DLKA 4GXKA 5KFSA 1HQUA 2VWJA 1ZQIA 3OYEA 3LZJA 2G8FA 4BXOB 1NKEA 4UBCA 3KD1E 4O4GA 1S9FA 1JKHA 4E7KA 2PFQA 5DB7A 4KLSA 3OYAA 4YQWA 3KK3A 4QW9A 3G6XA 1XS9D 2I9GA 5DQGA 3HP9A 3HXMA 3SJJA 3QETA 3JSMA 2OPPA 9ICFA 4OKKA 3BGRA 4ED8A 7ICVA 2HHSA 1VSHA 4N76A 1GOAA 3T1AA 1ZJMA 4KTWA 1C0MA 1L3SA 3OYIA 3AVJA 1NK6A 3B0YA 2I1QA 1RBRA 2HHVA 1EP4A 4HUFA 1WN7A 4BACA 3QEIA 4J9NA 5I42A 3OYNA 2XGPA 2HHQA 3AVNA 3GV7B 4RNNA 3DLRA 1CLQA 4KREA 1ZBHA 4LSNA 2JGUA 4IG0A 1X2IA 2Z1GA 3RBEA 4ED7A 1J53A 3TAGA 3AO5A 4OGCA 1ZQPA 2PXIA 2PZSA 4ECXA 4KMUA 3D0PA 4FLVA 3DLBA 4FLWA 1FKPA 3ASMA 5KFOA 5HNKA 2G8KA 3MXMA 1XHXA 5J0TA 4HYKA 3TAPA 1HNIA 4EYIB 4CIFA 1QTMA 2F1JA 1RT4A 1O1WA 2Z1JA 5CWRA 3H8JA 4MF8A 9ICTA 4DFJA 3AVGA 4DU1A 1NOYA 3CM6A 4DMNA 3K58A 1ZQRA 1S77D 5J2DA 3L2VA 3SPZA 4M3YA 5J0WA 3H08A 4LZGA 4IFYA 4N5SA 2BDPA 4I2DA 1UT8A 1TAUA 1XU4A 4YFKA 4FJMA 4O5EA 3KIOA 4KV8A 1Z25A 4CJRA 1IKYA 2RDIA 3JPPA 1WSHA 1ZBIA 4NYFA 3VA3A 5CJ7A 5SWMA 4I2PA 3KKRA 4N56A 4DSIA 4R65A 3NGDA 1IXRA 4RQ7A 3CFOA 1W9HA 3KLGA 3U3GA 4CEDA 1X9SA 4FJ8A 4BWJA 3OYCA 1TK8A 1TL3A 4DTSA 1YVUA 4RQ5A 4F4KA 3BQ2A 1LWCA 4M47A 4RQ4A 3TQ1A 2FBTA 4P4OA 3SUOA 4QZ9A 3C2LA 3SPYA 2WONA 3OJUA 5L1LA 4ELUA 3QZ7A 1ZQFA 2RPIA 4DFMA 1BHLA 1EKEA 3C5GA 3K5MA 4J2BA 4I2IA 1LW2A 1RT1A 5CYMA 1KEJA 4GXIA 1RT7A 2H5XA 3N4MB 4DTJA 4KAZA 3IS9A 3MGHA 9ICGA 3QEWA 1ZQOA 4KLHA 4ICLA 5C5JA 4DTUA 4C8NA 7ICGA 1PZNA 4KLDA 4Z6EA 5KFEA 1S6QA 3QLHA 4C8LA 3B6PA 2E4LA 3K59A 1RBSA 5KG4A 5L1IA 4IKFA 1JXBA 3OS2A 1SL1A 4M9NA 3SI6A 2GV9A 2XY8A 4IFVA 3PMLA 4X5VA 1TFRA 1S1TA 2EX3A 4AILC 2OZMA 2R8JA 2NRZA 5J2CA 3OYKA 3K57A 4CE9A 2A1JB 4DQPA 5J2EA 4Z0UA 1TKTA 3AA4A 2DTUA 1A5XA 4P4MA 4I2BA 4TUQA 4Z6FA 4XA5A 2HHTA 3KJVA 4W5NA 3KHLA 1HUOA 7ICSA 3QEPA 4JV1A 4B8CA 1XO1A 4KRFA 3MABA 5K14A 1YTUA 3ZD8A 5KT7A 2R8KA 1X9MA 3OYHA 2ASDA 1D9DA 3TWHA 1HPZA 2P5OA 4Q8FA 2G8HA 5CZ2A 1RDCA 3KLEA 2B4JA 3CM5A 1KVBA 4DF4A 4Y1CA 5KFDA 4GLXA 4DTOA 1D8YA 4M42A 2OWOA 4M9JA 1S1XA 1UOCA 5KGWA 3QERA 3HO1A 3PO4A 4NLGA 4KN7A 4DTMA 4CIEA 4F91B 4FCYA 2VWKA 4DF8A 3KHRA 4Q5VA 4O44A 1ZQHA 1EETA 4JLHA 4ED1A 1YTAA 3V9SA 4BE0A 3IHQB 5DBCA 3AA5X 9ICWA 3O4NA 4YR0A 3ZDCA 4K4IA 1K1QA 3ETLA 5IIIA 1NOZA 3VQAA 4DOBA 1RBTA 5HRNA 4KHSA 1ZJNA 3KKSA 1U47A 2OPRA 5HP1A 1VRTA 4ECYA 5FDLA 2VG7A 5KG1A 3Q8LA 3VQ4A 2IC3A 4NCAA 4ECVA 4IRKA 3U6FA 1S0OA 4R8UB 3HPOA 4MFBA 1CXQA 4KI6A 2OZSA 2C28A 9ICCA 3MXJA 3LZIA 4FK2A 1S1VA 1RXVA 5JUMA 4EYHB 8ICUA 4J9PA 4M3TA 9ICLA 3OYDA 7ICPA 1T8EA 5KFFA 4M2YA 5CR0A 3LP3A 1JLGA 1L3TA 1IO2A 4DL4A 2YNFA 3RMCA 3ISCA 4DLEA 5SZTA 4AHTA 5KFKA 4RQ6A 3OJSA 3DRPA 3V7JA 4QW8A 1ZQAA 4JWMA 3TANA 4KLGA 4ECSA 1RZTA 4DSJA 1RT3A 1WLJA 3RB3A 1T05A 8ICRA 4RUAA 2D0BA 3IRXA 4KHWA 4IBNA 4BE2A 1S0NA 4UAZA 5CP2A 1WSGA 4RW7A 1HRHA 1QE1A 3TAMA 4FLXA 5HLFA 2AGQA 4I29A 1WAFA 5BOLA 5BPCA 4ZH4A 1RTHA 2BQRA 3ZSRA 4ECTA 4F4ZA 3IG1A 4LH5A 2E6MA 1KFSA 2HB5A 4F5QA 1TV6A 4JRPA 4KB1A 4PUOA 4CEZA 3C2MA 3HVRA 3K2PA 4FW1A 4CGJA 4FM2A 3MR6A 3WNEA 2ZUCA 4F8RA 4F3OA 4HHTA 1BPDA 4BXOA 5KFUA 3ISBA 3SZ2A 1IKVA 2P6RA 4CEFA 3NGYA 2FPMA 1UA0A 4I2CA 4QZIA 2WTFA 2YNHA 2MUTB 9ICVA 2VA3A 4FS1A 4C8KA 4W5RA 2FMPA 3B0XA 3MGIA 2FPLA 3NE6A 4KLOA 4IQTA 4CJUA 9ICPA 4R63A 3PX6A 4ID5A 3GIJA 4J9KA 2BQ3A 1C0UA 4J2DA 4B8AB 3PV8A 5KGXA 4FJJA 1JLAA 1L5UA 2RN2A 1T03A 4PWDA 3OS1A 4CHQA 5F9LA 3S9HA 5KTQA 1KTQA 2RDJA 4RQ0A 3NDKA 4QZEA 4CJFA 9ICJA 1NK9A 4UAYA 8ICYA 2W42A 3ZDAA 2IGIA 4MQ3A 4DOAA 2ALZA 4DSFA 1J5OA 4M0AA 4K4HA 4QWDA 8ICPA 4PA1A 3HPHA 3PR4A 4JS4A 1BQNA 3VQ7A 5DDMA 1C1BA 3SUPA 2JEFA 5DBAA 2VG5A 4ECZA 9ICMA 4E89A 4E1NA 4HCCA 5HMMA 3VQDA 5F9NA 5KT5A 4O0JA 3V1OA 4MFFA 3SUQA 1JN3A 2VA2A 5D49A 2LYHA 3C6TA 1RILA 4HUEA 4J9SA 4UB2A 2HHXA 3MEEA 3NTUA 5D46A 5KFQA 2JLEA 4GVMA 1Q9XA 3AU2A 5DK5A 4HVJA 1AROP 4QOZB 3PNCA 4IG3A 1JL1A 3EY1A 1ZQCA 4NCGA 4IR9A 4QWBA 5DMRA 2IHNA 3MDAA 4GXJA 1XSPA 1ZQQA 5J2IA 2D0AA 3OYGA 4CHOA 4QZGA 4Z4EA 4KHNA 5J0XA 5DLFA 3NCIA 4CGIA 4FJ9A 4CGDA 4IDKA 3L2WA 3M8QA 4O55A 2BPGA 2NUBA 3NBPA 4RQ3A 4DWIA 2KZZA 3NH1A 4CJLA 1KCFA 4F5RA 3NH0A 3NAEA 1SKWA 4RPZA 1HJRA 1KLMA 3NF7A 4F2RA 1FXXA 5DG8A 2PYJA 4OLAA 9ICXA 4QWCA 3OSNA 3QIOA 8ICBA 2ZQBA 4MFCA 3OYBA 2ATQA 4CEEA 4JS5A 2QXFA 4CEOA 1NKCA 3OHAA 4M9GA 1V9PA 5KG2A 3C94A 3G10A 3HWTA 1MU2A 5IIMA 2VANA 3QINA 8ICHA 2KZ3A 4I9LA 1IM4A 5KFNA 3C1ZA 3JPRA 3HVTA 1UAXA 4YP3A 3RRHA 2F1HA 4J9QA 1HJPA 4ED6A 3DOLA 4DOCA 2IAJA 5J1EA 1NK8A 3THVA 1C1CA 3GV8B 1B92A 1IG9A 2E6LA 4W5QA 4I2EA 4N47A 5HHIA 5KFWA 3MBYA 1BPYA 4CEBA 1R0AA 3ZDDA 3PR5B 1ZQMA 5CHGA 3OYMA 4QZHA 2DFEA 1EXNA 3RBDA 3V72A 3MDCA 2ISOA 4K8ZA 3UPQA 5KFMA 2A1JA 4O0IA 1XWLA 5J0PA 2W8KA 4ELTA 1K6YA 4C8MA 4OPJA 7ICHA 2YHBA 5DG9A 4RW9A 4LZDA 1TKDA 2F8TA 4KTZA 5KG3A 3OY9A 4NLKA 1IH7A 5J0OA 8ICJA 1JLCA 4DU4A 4GC6A 4F4YA 4DSLA 3HP6A 3PX0A 2IOCA 2ZD1A 5KFJA 2PFNA 3QNNA 8ICLA 5DBBA 3OSPA 8ICMA 5HHHA 3SCXA 3HSTB 1BCOA 3LDSA 2Z1IA 4RNMA 1X9WA 5DQIA 3RJGA 7ICJA 4YD1A 4O5CA 2P5GA 3NFAA 2BANA 4M3XA 4QZBA 3ZT4A 1BI4B 4ID1A 4JWNA 3GQCA 4DS4A 4OGEA 1BL3A 4FK0A 1RBUA 3HPGA 3UXNA 1U48A 4Z4CA 2JEGA 3LAMA 3OHBA 3RJKA 2X6SA 2OA8A 1NJYA 3EPGA 1EX4A 3IAYA 3CQ8A 4NXZA 5IIOA 7ICLA 1MSWD 2BCRA 3L3VA 3M8RA 3V7LA 5EOZA 1IKXA 3QZ8A 4M3UA 4I2HA 5DLGA 4H8KA 1DGSA 4KLLA 4F4WA 3RH5A 3LP2A 4I2AA 4PHPA 4EP5A 3MXIA 5CY4A 4R8UA 1MQ2A 1C0TA 2G8UA 1T3NA 1QHTA 2YKMA 1KDHA 3RJEA 1U49A 3GV5B 4KTQA 4I2FA 4M41A 4LY7A 3PUFA 4KLTA 5KFVA 4O3OA 1RYSA 2ASLA 4CK2A 3HL8A 4JK1A 3RJHA 1VRUA 4CF0A 2PI5A 4EZ9A 3SV3A 3UXPA 3AV9A 3T5LA 5KFXA 4CF9A 1BQMA 2KZMA 1NJXA 3KK2A 3RJJA 4UBBA 2A1SA 2PFOA 4FYDA 4CJ3A 3AVLA 3BQ1A 3BJYA 1HMVA 1UT5A 3S3NA 4EEYA 3S3OA 3V1QA 2HHUA 3AO2A 3T5HA 1JX4A 4KHYA 4DFPA 1S76D 2W9CB 3SUNA 3QEVA 3T3FA 3RRGA 3RR8A 1MQ3A 3MEDA 3TR8A 3NF9A 2FPKA 4FS2A 1ZQUA 2XRIA 5C24A 1NK0A 8ICEA 4PGYA 2XO7A 4PHEA 4DL7A 4BDPA 2XY6A 3AVBA 3LALA 5L1JA 4OKJA 2BCQA 5KFGA 4Z4FA 1CEZA 5EWGA 3OGUA 4CK1A 3RJIA 1RTIA 4RW8A 3C21A 2DPIA 4KLIA 5KG0A 1DOQA 2MUTA 2W9MA 2JEJA 1TL1A 4N41A 2GUIA 1ZETA 4JUZA 2BPCA 4H4MA 4CECA 4B9MA 4FJGA 3V9UA 1D8LA 2X74A 2Y1IA 3O4QA 4FJLA 2PY5A 3P1GA 4KB0A 4UB4A 3VA0A 4F3TA 3NHGA 1VSEA 3AO4A 2JZBB 4J9MA 4KLEA 4FW2A 3L2UA 3K75D 2PYLA 5DDYA 1A77A 3SV4A 4NYNA 3GILA 1VSLA 3B6OA 1C6VA 4DSKA 4YXJA 4PHDA 2X78A 2C2DA 1D5AA 3U3YA 1TGOA 3ZT1A 3H40A 1RXWA 4DEZA 4EP4A 3V4IA 2HHWA 7ICFA 1XI1A 2QKKA 3L3UA 3C2KA 3GIKA 2JEIA 1IKWA 1EXQA 1BPXA 4XUSA 3AO3A 7ICNA 2XCAA 4FJKA 2HNDA 4OKEA 4IRCA 4W5OA 2BE2A 4CF8A 2ZTDA 1HNVA 3V6JA 3DLEA 4WE1A 2DPJA 2AGOA 1S6PA 4I2QA 3ZSOA 3O3HA 3T19A 4QWAA 3MR2A 3H4DA 1NK4A 2J6SA 2R8GA 1WSIA 1L3UA 3FYHA 3E01A 2DFFA 3SQ0A 4B3OA 4CHYA 3KHGA 2ETJA 4CJQA 3KLHA 4UB3A 1ASUA 4R66A 2FLPA 3RMBA 3ZCMA 4R5PA 2KW4A 4C8OA 4HCBA 1XHZA 4YR3A 1ZQWA 3KTQA 1ZQGA 3AVIA 2Q0ZX 1U4BA 3LANA 1QSYA 1Q8IA 4LVSA 2J6UA 2P51A 2AQ4A 3PO5A 4XRHA 4XQ8A 4CJVA 2XY5A 4M6WB 5J0RA 5J2QA 4BGDA 4RQ8A 4YR2A 1BIZA 3P83D 1U9LA 4M04A 3SQ4A 4TUPA 3SQ1A 3PY8A 4PQUA 4KLQA 1JLQA 3ZSXA 2C22A 2NRVA 5KRTA 4F93B 2XHBA 3ZSZA 1C7YA 8ICAA 1S5JA 4TURA 4EZ6A 2DFHA 1Z26A 1KLNA 3HX0A 1RT2A 3JPOA 2IHMA 1UWBA 1HYVA 3K5NA 5IILA 5CZ1A 1T4GA 4QZDA 3ZDEA 4KLFA 2V4QA 3MFHA 2RKIA 3P5JA 8ICOA 1N48A 5J2NA 3V1RA 3KD5E 2KFZA 4E1MA 1S1WA 1ZQKA 4P4PA 1QQCA 3RH6A 4LSLA 3C23A 4DTXA 4E7HA 1JXEA 4IQVA 5KG5A 1LWFA 7ICIA 4MF2A 4ZTFA 4DTNA 4NLNA 9ICQA 4UB1A 1S10A 2O4GA 2GBZA 1ZQZA 2ZTEA 2FLNA 2C2EA 3RH4A 4E7LA 3ISNC 1LW0A 1NKBA 4NLZA 3BDPA 2ASJA 3NF8A 4FJNA 5J2GA 4QZ8A 4RT3A 4AHVA 4DLGA 3ZSVA 1CZ9A 4CK3A 8ICXA 4EBCA 5HBMA 4YN4A 1N5YA 1ITGA 1KFDA 3NH2A 4CJEA 3HW8A 5D3GA 5KFHA 3M8SA 4F92B 2Y1JA 3GDXA 4KLUA 3Q8RB 3ZSQA 5HRRA 2D0CA 3F73A 3HM9A 5BOMA 1TKXA 3G0ZA 1RTJA 4RPXA 4HUGA 7ICQA 1BI4A 2XY7A 3PW0A 4FJHA 3EW9A 2FBYA 4I2JA 1BPBA 2R8HA 3Q8QB 2W9BB 3G6YA 4J9RA 1SUQA 4ELVA 3NF6A 3PW2A 3EZ5A 4NM2A 1VSKA 1WNSA 3L8BA 4DQIA 1Z3EB 3WNHA 3I8DA 3BQ0A 1S9EA 4GW6A 5DB6A 5IIJA 2XCPA 4F50A 1ZBUA 2XC9A 1C1AA 5DG7A 5EU7A 3QNOA 3I0RA 4DU3A 2ZJ8A 4IRDA 2HNYA 1VSJA 5KFZA 1ZQYA 2HW3A 1SKRA 3AUOA 1H38A 1KSPA 1JL2A 1SV5A 4Z4HA 1BISA 4ED0A 4O3RA 7ICTA 2V4RA 4CFCA 4KLJA 4BWMA 4RQ1A 2ZE2A 1ZQVA 1XSLA 4O3QA 5KRSA 4FLUA 4DTPA 3GIIA 1WSEA 2BPFA 4RW6A 4NY8A 3SYZA 1S9GA 3OS0A 4UQGA 4JV0A 9ICEA 4RUCA 3AA3A 1I39A 2A1RA 3PVXA 4MFAA 3ALYA 4CFBA 1LB2B 3PW4A 1B9FA 1KVCA 2P66A 4Q44A 1NJZA 2V9WA 4YG2A 4YMOA 8ICWA 3AU6A 3MECA 1N56A 2BKEA 3LWMA 4YXMA 3E2EA 4R64A 2ZUDA 4RQ2A 1JLEA 5HROA 3GIMA 4YCXA 1TK0A 3MFIA 1BCMA 3TAQA 2D5RA 2F96A 1D9FA 2W9CA 3TARA 2BCSA 3NGZA 4DL6A 1VK0A 1X1PA 5J2PA 1HYSA 1F21A 1Y88A 4OJRA 3CFRA 3RB4A 1T7PA 4I28A 3RAXA 1NJWA 3PW7A 1XSNA 2ZTCA 5KFTA 4RG8A 2AGPA 4ECRA 5IINA 4O3PA 3RB0A 3IM1A 3OVNA 5HRPA 3LK9A 3ZDBA 3K5LA 4NCBA 3DLHA 3UQ0A 1RT6A 1CZBA 4NM1A 5EWEA 2ZUBA 5FRMA 4JV2A 9ICRA 1L3VA 1A76A 4QZFA 4CIGA 4P2HA 4BDZA 4M3ZA 1ZQJA 1RBVA 4KITB 3H7IA 4O3NA 1QS4A 3ISDA 4FM1A 5EWFA 2G8WA 4FBUA 1Z00B 3T5JA 3MAQA 1N6QA 3VQ8A 1NK5A 2UVUA 1MC8A 3SQ2A 2BHNA 4MEYA 5JS2A 3MEGA 3V9XA 4PY5A 1JIHA 2JZBA 5KG7A 5KFRA 3AA2A 4FVMA 1RCHA 4CJSA 7ICEA 1NK7A 4B9UA 4YD2A 1VSIA 9ICHA 2HNZA 2AJQA 9ICUA 4RZRA 2X6NA 5KFYA 4IQUA 1J54A 8ICCA 1RDAA 4TSXA 3RAQA 4LH4A 4K8XA 2KQ2A 4K4GA 3MR5A 4F5NA 1SL0A 4ECUA 3AVAA 3M9OB 4OPKA 5J2FA 1JXLA 2F1IA 2KTQA 4E19A 4BE1A 5DGAA 3EWAA 2VG6A 5J0YA 4XIUA 1LWEA 1GOBA 3RMAA 4FLTA 4E0DA 4KHUA 1ZQNA 3NGIA 4O5KA 3AVMA 3QE9Y 4CJKA 3H8SA 4Q45A 1J9AA 2ISPA 4G1QA 4FXDA 1VSDA 4H4OA 5C25A 3DYAA 1VSFA 5KI6A 3ULDA 3O3GA 4FO6A 3RB6A 1YT3A 3TFSA 4YMMA 3AVHA 3OYLA 1RPLA 1RTDA 1S1UA 1SL2A 3ZD9A 2IS3A 4PHAA 4FBTA 4DQRA 4M45A 5T7BA 5J29A 2OPQA 5J2HA 4CJ5A 2UVVA 4RT2A 1K1SA 3QEXA 2FMQA 4LD0A 4CESA 1A5VA 4CCHA 1ZQEA 2B21A 1ZBFA 2OPSA 4AH9A 1COOA 4RPYA 4B9TA
chains in the Genus database with same CATH superfamily
1F5SA 4BGAA 4BVPA 2QLXA 2QJ3A 5BRHA 4AHRA 4FP9A 3C28A 2ZZTA 4ZVQB 3C6HA 2YMQA 5J2PB 3TTFA 4CM2A 5DQHA 3AD8C 2VJ4A 1EP4B 2RF2A 2CPZA 4RNFA 2VDHA 2XB2D 3W8PA 1TL7B 3D0GE 5DRKA 4QIEA 3BGOP 4NEZA 2QEXS 2BV3A 1I3OB 3G71S 2ZH9A 1TK5A 4RWXA 2B4VA 5F0UA 4QYZJ 4I9QA 4CF2A 3DOKA 3ZZZA 4IG0B 2Z57B 4UAWA 3N28A 3WIUA 1XC9A 2GJ2A 4RU9A 2XNRA 3KLFA 1CUKA 3Q83A 3CETA 2EPIA 3LDAA 1S0VA 1Y3JA 3OTQA 1DTTA 1B9DA 2R7WA 3KJQB 4FJ7A 2R2UA 2HVHA 4QBUA 2ATLA 4OX9J 2YN4A 2P9NA 4J03A 2UUCF 1HKCA 4DR7K 2KP7A 1G2EA 3G2XA 2E2NA 4X84A 4ZTJA 5HAOA 3CB4A 4TU9A 3VQSA 5B0CA 2RQCA 1QAIA 1IKYB 1YJRA 4B1ZA 2W04A 1ZRMA 2A3VA 3KK7A 5KFIA 2QKQA 3AA9A 3BF1A 5I9EB 1YQHA 3D5MA 2CPEA 4U7CA 4OYAA 3S41A 4KLMA 2R7YA 3U1MA 8ICSA 1ZQLA 2YNIA 2OCEA 4CZFA 4I6WA 1VR6A 3M6WA 1QVFR 4I2GA 4JYAF 4OJGA 4P0QB 1AQ6A 2FBXA 5KFPA 7ICOA 1HX1A 2ZH3A 4QS7A 2DIUA 9ICKA 3A5LC 1M90O 5J0SA 4YNQA 4M5DB 4LREA 1UQVA 4DO9A 1Q86T 1WAJA 5DB9A 3RJMB 1ZQXA 5DETA 1N54B 3SEOA 4E98A 2E1PA 5L1KA 1EX8A 1LW2B 1RT1B 5CYMB 1Z4UA 1RUSA 1WSJA 2RNEA 2CQPA 2QXLA 1KQSM 2Z56B 4JI8K 1F5BA 2H5IB 1RT7B 3KWGA 4IO1A 3R5DA 1U2RA 2DVIA 5DKWA 4IQMA 3NGTA 4CHPA 4GKJK 1LKYB 4F5PA 4ED2A 4WP3A 3W1YC 1VFJA 4X66F 3LP1A 3DHXA 4DSEA 3T9NA 1F2GA 7ICUA 2ZIUA 1XR7A 1S6QB 1WI8A 2W9BA 3QLHB 2M9NA 3U9DA 1HHQA 1FDNA 2EZXA 4P0PA 2VUGA 1ZQDA 2HIQA 3JAMO 2IJRA 4IFVB 8ICGA 1OQ6A 2VA8A 2DD8S 4X4RA 2HVIA 2ZNZA 3K5OA 1N32F 2G09A 1R0BG 3BZQA 4HWIA 2G1DA 1GLFO 1BQXA 3FDSA 3N5FA 3UQ2A 4F02A 2QWLA 4TY8B 1N4LA 4YB5A 3CJBA 1SC3B 3ID6A 3M32A 4J2EA 2VOOA 3TABA 3THWB 6FD1A 2P1JA 2DISA 2YKNA 2XMAA 3HSDA 3OQ2A 1AB8A 3P3DA 2HK3A 2B9XA 5K14B 3CC2N 1SKSA 3EEQA 4B3RF 1AUSL 3WNGA 4OZ0A 4KH0B 3KHHA 1N33K 3IUCA 3K5PA 4EBDA 1KAZA 2OEKA 3S8SA 1IBKF 2PFPA 2HMIA 1UEKA 3QWPA 5I3UA 2RVJA 1U2FA 2XMMA 3VQCA 2QKBA 2CPIA 3HHEA 4QIWC 4BRPA 2ESEA 9ICOA 1C0GA 2KFNA 2CADA 3EZUA 4GVBB 4H4KA 4I7FA 1UWAA 1VQ8S 3VAGA 4ZHRA 2GIQA 4O44B 4AHSA 3DM2A 3Q8VA 5B0FA 4C4SA 5HMLA 1CC7A 1ZM9A 4B9NA 3QGHA 2G08A 4Q43A 1T3VA 1HW8A 4AQYJ 2QWQA 1OMSA 5J2BA 4Z6DA 3ENHA 1U25A 5U47A 4CEAA 4FWSA 4L8RB 2XHWA 3AQFA 4H5RA 2OPRB 4F3QA 5KT3A 1MNEA 3O08A 3CD7A 3SI8A 4J91A 5IWAJ 3UI3A 7ICMA 2JX2A 4DL5A 3D45A 1ZS6A 2DR5A 3IXQA 2HBYB 4WF9Q 2KKZA 3A2FA 3V9ZA 3BPDA 1UZHA 2QLWA 4Y2JA 1Q8BA 2K8GA 3NNHA 2DHGA 4KH5A 1JMSA 3TP2A 3JYTA 1UVLA 3EZWA 2VQFF 4RW4A 2RS8A 2W7AA 1SPBP 5G5HA 5F41A 2B7CB 4UAUA 1A6SA 4M3RA 4TQRA 4PXCA 3ENAA 5KFLA 1I3AA 1S97A 4X66K 3KLIA 5KL1B 3G6VA 1TVAA 3PW5A 3V81A 5ALEA 5KPZA 2I6XA 2DFLA 3V9WA 1ATNA 1OIAA 4P9SA 4RQNA 4PH5A 4C97A 5ADXA 3VQ9A 4A47A 4USAA 3UPFA 3R6LB 3MGVA 2GMLA 4RNOA 9ATCB 1F44A 1T05B 3VGMA 3MAAA 2FSJA 2BR0A 4MDBA 2Y8YA 4RW7B 2O4IA 2IM1A 2L9WA 4H5VA 4PR6A 1Y97A 1IBMJ 4K50A 3HKWA 1FRMA 4MEXA 4QAGA 4L76A 1UA1A 1K8AO 4Q0BA 2W03A 3OTEA 3IG1B 3ITHA 3T9ZA 1FJ7A 1TV6B 4YMNA 2Z58B 3ICXA 1HQEA 2FVCA 3QAUA 3CCUN 1N62A 5KFSA 4B3RK 4Z94A 1GLBG 2EKYA 1FRHA 1VGYA 1IBKK 3MX5A 4O4GA 5M1OA 4OYOA 1S9FA 1JKHA 2PFQA 2CNKB 1IJJA 3PJWA 4DCHA 3G6XA 2ZC3A 2MJUA 4ATNA 2HBMA 3SLCA 2I9GA 4CZKA 3H2UB 3J7YP 1HBNB 1M1GA 3PSIA 5THWA 4ED8A 2BW7A 3BBBA 2HHSA 1QH9A 1UMJA 1VSHA 4BRAA 3D2EA 1MWYA 3T1AA 4FSVA 2CZ9A 4JV5F 4CBWA 1NK6A 1TU0B 1K73O 3HT0A 2HHVA 3H20A 2PGCA 2Q3PA 2R2RA 3QU7A 1FDBA 1BWVA 5I42A 3WZ0A 2XSJA 3OYNA 2J8SA 4M7YA 2J9DA 3AVNA 2J8AA 2A1BA 1HNWF 2BDUA 5EX3A 4LSNA 5L8RC 5ADZA 4ED4A 3CCJS 5ITHA 2Z1GA 3WQPA 3MUMP 2FC8A 5J1PA 1T44A 3C3LA 3CJ5A 1B0PA 4LJXA 3NMUA 2L41A 4WP8A 2PZSA 4FLVA 3ASMA 5KFOA 2NRHA 1XHXA 2R4FA 3I76A 1LXJA 4DFDA 3TAPA 1HNIA 3SCJE 2CQGA 2F1JA 1RT4A 2VQFK 5CWRA 4CZEA 3C6TB 2UU9J 4DFJA 2DO4A 1KQKA 4DU1A 1NOYA 4KT0C 2ZHBA 1RDRA 2W2NP 3L2VA 3SPZA 4DV5J 4M3YA 3BH7B 2K3KA 4F7VA 1WUDA 2I6WA 2F8EX 4FVCA 4IG3B 4LFCJ 4M63A 3K9KA 1Z25A 3MN6A 4CLUA 2RDIA 4JMUA 5GADI 3MMBB 2F8MA 5C15A 5CJ7A 1CJKA 3SDEB 4I2PA 3KNGA 4MYTA 4N56A 4DSIA 1RQNA 5HOOA 1F60B 4CLSA 2LYAA 4RQ7A 4K4VA 3WK8A 2RT3A 3ZNJ1 3IFRA 2HGMA 3U3GA 3TZYA 1GLDG 3M8QB 4BWJA 1XMQK 4DTSA 5F8MA 2XQCA 3FZLA 4F4KA 2F9TA 4M47A 4RQ4A 2Y1LB 3GE9A 2FBTA 2FZGB 5AM1A 2M2BA 4KHRA 9RUBA 3PYFA 5A0YA 2WONA 5ETQA 1ZD2P 1N5XA 2YKQA 2RPIA 3ULEB 5CR4A 3K5MA 5ALWA 5JICA 1S99A 2C42A 3P96A 1CQMA 1WWUA 3IWLA 3QYPA 3NGUA 3EX7B 5A8RA 4ZCKA 5AQGA 4KAZA 2DHXA 4X2BA 3IS9A 3D2WA 3FSYA 3JS6A 4QPTA 4CLZA 1OY8A 4FPIA 1RAIB 4QR0A 3MDFA 2LPEA 1CC8A 1I1GA 3J7ZT 5C5JA 2CQBA 4FWPA 2OEMA 4N7TA 4WYWA 3JSMB 4BRDA 5LMNK 5IT4A 4KLDA 3VPZA 1YBTA 4Z6EA 3KG4A 2FYXA 2Z7JA 4C8LA 3LGNA 3VEWA 3OFGA 3B6PA 4TLQA 2E4LA 6FDRA 1RBSA 4IKFA 2A6MA 1RAEB 3MN9A 4N8NA 3SI6A 1RU1A 1FEHA 3O1WA 1XNRK 3FZHA 2EX3A 1S1TA 4CO5A 2OZMA 3JTOA 5JMNA 4HACB 1NLKL 4DV1J 2CPRA 4PL1A 2A1JB 1GMWD 4DQPA 1HHSA 4OYPA 3JS9A 1TKTA 4B3SF 3D7EO 3BKUA 3HHDA 2DTUA 2Y3YA 2F65A 1W2IA 4TUQA 2MLZA 1WDTA 2HHTA 3AT1B 2JV3A 2Y0SF 3GYNA 4W5NA 1HI8A 1FHTA 3BO3A 4YOVA 2HYIB 4B8CA 1WC3A 2IM0A 3EGVA 4JKAA 2R8KA 2UUTA 2ZOGA 2Q2RA 3OYHA 2ASDA 3TWHA 1PGZA 2P5OA 4Q8FA 3TWZA 4KX3A 2RSQA 3Q89A 2XNQA 2Z2ZA 3F41A 4NLQA 1RDCA 1Q82T 4MK9A 4DR1K 3UR0A 3H0MB 4FOIA 3AMZA 3VENA 1D8YA 4M42A 4M9JA 3QERA 3HO1A 2QARB 3PO4A 2ZXIA 2DYAA 4NLGA 4KN7A 3R8EA 1M5PC 2O1PA 3VF2A 2NYIA 2O67A 4FCYA 3M8WA 3O1LA 4UARA 3JSYA 1EETA 3TJ9A 4OYWA 3C46A 4JLHA 4BE0A 1FEZA 5AZJB 9ICWA 2VZ9A 5TKWA 2O8CA 3E58A 2WHOA 2Q43A 4PWWA 2W6LA 5IIIA 3T1HF 1NOZA 2MGZA 3D6TB 1IWGA 5HRNA 1IBLJ 4K4XA 2AXTU 4AFFA 1EKSA 1IN0A 3D0IE 5FDLA 4WU3A 3LP2B 5M2PA 3ZZRA 2VG7A 4X4TA 1NDKA 3Q8LA 1YJVA 3W2WA 1AA1B 2B8QA 2CPHA 2MPUA 3HPOA 3AAWB 4UW9A 3RBZA 1FTRA 4ILRA 1X5PA 4KI6A 3TA1A 3LPYA 3U02A 1R27B 3UD4P 3MXJA 4PAAA 3GFZA 3LZIA 1RXVA 3OR1A 5GAEI 8ICUA 1H2TZ 1VRUB 4M3TA 2XI3A 2WB1D 4LIRA 4JHDA 2E1RA 3MCNA 4M1KA 1TQLA 2HS4A 1SKUB 2LBOA 1T8EA 1OH7A 5KFFA 1BQMB 1JLGA 2YNFA 2XS7A 2X3GA 3KK2B 3ISCA 2HG4A 1RHQB 1TYQB 4TNOA 2LQJA 4TXSA 3D6MB 3DRPA 2G5HB 4RQ6A 2JDJA 5AXLA 4QW8A 3D66A 3NUQA 5AKZA 3S1TA 3OL8A 3UD5A 4KLGA 4H03B 1RZTA 3FC4A 3BS5A 1RT3A 3NCPA 1WLJA 3OPKA 2D0BA 4F72A 5ETKA 3QBWA 4IBNA 1S0NA 4KH6A 1HRHA 1QE1A 2GHVC 2OLWA 2VDIA 1S5LU 2AYGA 5LJVA 3LQVA 2K60A 4OPAA 3BB5A 4ECTA 2D1CA 4PG4A 4LH5A 4CLYA 4FPAA 2YKAA 1JMTA 1KFSA 2J0SD 1OH8A 1YHQN 4KB1A 4CEZA 3HVRA 4OO1J 2KLAA 3GZ7A 3K2PA 1U1QA 1VMBA 2ZUCA 4F8RA 4ZOSA 3VHQA 1ITPA 2HVZA 3ISBA 1IKVA 5B08A 1U1PA 1S48A 4ZLNA 1X3MA 3UKRA 4RW8B 3L95X 5AI6A 4YHHJ 2D8CA 5GAHU 2MUTB 1CZAN 2W54A 3C19A 2FMPA 3B0XA 2ZIXB 4KLOA 2I1RA 4IQTA 3MUTP 4BC9A 4CJUA 2ZH1A 1CQNA 3GIJA 4J9KA 3ENWA 1DBDA 4ILLA 3PRBA 2KI2A 3D6RA 1C0UA 3IGVA 2YX8A 1JI7A 1X3NA 5ETTA 1JLAA 5BREA 2WVDA 2KU7A 2RRDA 2RN2A 2BJEA 5KTQA 3EDRB 4QZEA 1GLEG 4CJFA 1L7MA 1NK9A 4PXDA 2OTJN 2P9IA 4CT9A 2IIHA 4YMEA 3NRZA 1SC4B 3PYGA 4DSFA 2A3JA 4K4HA 5F3TA 4Q2MA 3HPHA 3PR4A 1E4FT 3I82A 4JS4A 2AMCB 1XNQK 3SUPA 5CHIA 3WEEA 2P9PB 2WSCC 2VG5A 4ECZA 1DHMA 3AY9A 4O4RA 3CIZA 4HCCA 4LF5F 3KJFB 1F3VA 2ZUAA 2HNDB 1UVNA 2A6AA 1NDPA 1O03A 2EWSA 1JN3A 2JLGA 2GZOA 3H1VX 1MMLA 1S6PB 1VQLN 4I2QB 3NS6A 2VA2A 5JXSA 3SMPA 5ALJA 1FRIA 5AKHA 3SD7A 1T9TA 2JLEA 4B3OB 3M6ZA 1HWLA 4A8SA 1MWQA 2A2DA 3QAEA 2Z2MA 3EMTA 3N0VA 1AROP 3AQPA 3PNCA 3QU5A 3BSCA 4RX6A 3CMEN 4USWA 4JKGA 2C2ZB 1JL1A 4UB6U 3UMCA 4JKFA 1WACA 4GXJA 1RGIA 2D0AA 3NL0A 4Z4EA 2VFVA 4KHNA 5J0XA 5DLFA 4FJ9A 4CGDA 3JQMA 2VCPA 2F4VF 3NBPA 2R7UA 1P1LA 2LVWA 1WG8A 3CC2S 2F9JA 4P7VA 3NAEA 2QYGA 1VYAA 5DG8A 2PYJA 2JH3A 3CSKA 4F4AA 1WSVA 9ICXA 1UVJA 3QIOA 4CE6A 4LC9B 1VAZA 4YDDB 1MG7A 2DNZA 2QXFA 1RKJA 4CEOA 1NKCA 1U2CA 5B5EU 1J97A 4M9GA 3CJSA 4JI2J 3BH6B 2YBVA 3HWTA 2B9EA 1VJWA 4BRGA 5IIMA 2VANA 1UWBB 8ICHA 2E2PA 4BG9A 5AR0A 2CGKA 3DLJA 4CDGA 2OGUA 3JPRA 2WF8A 5BR8J 5FLXU 4YP3A 3RRHA 2F1HA 4J9QA 1HJPA 1FESA 5SUHA 4DR3J 3DOLA 4ZPDA 4DOCA 4WK1A 1URNA 4LR9A 2UZAA 3D9BA 2RKIB 1IG9A 4I2EA 4N47A 3SENA 2D1KA 1MMDA 4NLDA 4QR1A 1HD0A 1R0AA 2VH7A 5AKIA 3PR5B 1ZQMA 5GADP 3UO0A 1V38A 1VQSA 4LF4F 1T11A 1N0UA 3EL2A 3BQ7A 1KC8O 3UPQA 2QT7A 5KFMA 1XMOJ 2VV5A 1R8HA 3T6BA 4YDXA 4C8MA 2YY6A 4K43A 4CRXA 2QL9B 3O9QA 4RW9A 5CYJA 1Z6RA 4NLKA 5AKEA 5J0OA 1LW0B 3D54A 3MM6B 5IT9U 2MSSA 4UY8O 4DU4A 2RHFA 1SC1B 3TVYA 5B7WA 3GONA 3IFEA 3HP6A 3MM9B 2RE1A 3R7SB 4XTTA 1SAZA 1SIWB 2PFNA 3VV2B 4IDHA 5DBBA 1N5YB 5AQKA 1FVSA 5A6PA 4ZLJA 4WKYA 2MKHA 3HSTB 3AL0B 1VQYA 3LDSA 4RNMA 2G07A 1VC6A 5K8PA 3UCUP 1YF5L 1SJ4P 1F6TA 3F5AA 2D3UA 4Y2UA 3TA0A 4H0OA 3RFAA 4RL1A 3N4QA 2WF9A 1VQ9S 4JWNA 5ETSA 2UXCK 1A6LA 2ZJQL 4ZP9A 1E6VA 2W1BA 3LAMA 8AT1B 5ALYA 2IOFA 2V69A 2CG4A 1KHVA 3HHLA 1NJYA 1EX4A 1IV0A 3SQOP 2VFUA 3UVJB 3CJKA 1JNZB 1TL5A 3BM7A 3W3DA 4CD1A 4OHZA 3V7LA 4KHPK 2JGAA 2KSOA 3NEKA 5DLGA 4H8KA 4I6YA 4JI3J 3CCUS 2M8HA 1B70B 3RH5A 2CNLB 4C7QA 4I2AA 4MDAA 4PHPA 1AXQA 2K2PA 5CY4A 3ZNUA 1O6XA 5IS2A 2G8UA 1JK9B 1QHTA 2HNYB 4I1TA 4CQ1A 3RJEA 1U49A 3GV5B 1FJGK 3E1YA 4KTQA 2Y9TA 4I2FA 5CCLA 3O1BA 1ZXOA 2PE8A 3PUFA 4KLTA 5KFVA 5HR6A 1FJCA 4LFBF 3HHKA 3TJ8A 2CPDA 4NX9A 4A46A 3MPYA 3FUYA 1S9GB 4USHA 3SV3A 4I68A 5KFXA 4IKAA 4G9BA 4S0MA 5F0WA 4C23A 2NPIA 2VIHA 2KVQE 4FYDA 2DNMA 2HAIA 3AVLA 3MECB 5A76A 3M2VB 5AKJA 3FQLA 3BJYA 3CW2C 4P2XA 2LYBA 4LF9K 1HMVA 1B64A 4CH1A 5HROB 1VQMN 2G1HA 3IBFB 2YWKA 2ZBPA 4MLHA 3QEVA 2W43A 3THXB 1IQZA 2DRDA 3RR8A 1MQ3A 3TR8A 2VFSA 3CJ2A 4Y2XA 3H25A 5ETMA 3PG9A 3H98A 2QLFB 5C24A 4DBQA 1EZZB 3D3CJ 8ICEA 4PGYA 5AI5A 2VQEK 4JI1J 3MCOA 3HVWA 3EO3A 3U9ZA 2XY6A 3AVBA 4OX9F 3T69A 4OKJA 3G8QA 3SSRA 5AQLA 1CEZA 3GJSB 2ACMA 2MKSA 3CJ1A 3OGUA 4B1YB 4FWRA 3D3BJ 5HVFA 2ZZNA 2JWLA 4CK1A 1HNZK 1WNEA 2W9MA 2JEJA 3CCSN 1K5OA 1X4EA 3BBCA 2LCWA 4BRHA 4CECA 4B9MA 4LF8J 3OUYB 5AQHA 2E3TA 2ZJRL 1ZM4A 4ZOHC 3NAHA 2LXFA 2WZ1A 1N6QB 1SXEA 3IAM9 3KUHA 3TADA 4Y34A 2OUGA 3AO4A 4J9MA 2G13A 5AKKA 1WG5A 3K75D 4BUGA 2Q1LA 4DV6K 3OR2A 3B6OA 1K44A 5F8LA 4CNQA 1C6VA 1IR1A 4PHDA 3EVMA 2CRXA 2F1FA 4FNIA 4TKTA 3VVTA 5IV4A 1D5AA 2V63A 3H40A 2D69A 3QIDA 5HR7A 2K3IA 1T02A 4EP4A 2HHWA 1M6YA 7ICFA 1LWEB 3L3UA 5A8KA 1FRXA 3W61A 4DV3K 4USUA 1EXQA 1E6YB 1WKJA 3R6MA 2JH7A 1RADB 7ICNA 4OKEA 4IRCA 4W5OA 2BE2A 4P73A 2V4JB 3CE8A 1HNVA 2GOLA 3KKAC 3DYAB 5M2UA 2WC9A 1FA0A 5AQXA 4X4QA 5F0XA 2XI2A 4EIAA 1WOPA 4I6AA 4ZMMA 1K73T 3AARA 1D9AA 2PMZD 3GG1A 5LMUK 1WSIA 3FYHA 5K8OA 1ELOA 1SWWA 2XEXA 2QN6B 5IV3A 4MO5A 2IFXA 4OYIA 3KLHA 1ASUA 1OO0B 3VZHA 5DJBA 4R5PA 2FDRA 4I0WA 1IG8A 3GYXB 1X5TA 4YR3A 3KTQA 1ZQGA 4LJMA 1FD8A 3TX8A 5AJ3J 4DCJB 3GCWP 1U4BA 1Q8IA 5KAKA 3MPUB 2P51A 2N1RA 2FHMA 4XRHA 3HHNB 2RF2B 5RUBA 4XQ8A 1KD1O 2P9EA 2HGLA 1R8AA 2XY5A 2V94A 2NREA 4BGDA 3P83D 4M04A 3EWGA 4LF7J 1F9FA 3POTA 4KMOB 4BRIA 4OX9K 1U0HA 4CGZA 5KRTA 3ETRA 2DNPA 3I6PA 2LU2A 1C7YA 3KLFB 2H3EB 4TURA 3LH2S 5AICA 2FIUA 1KLNA 3HX0A 4NLPA 3JQKA 1DTTB 4DR4J 2N7CA 2P2CB 1ZBSA 5CZ1A 4BCAA 2PA8D 4QZDA 2DNLA 1GLJO 4KLFA 2V4QA 2EC2A 2KHOA 2P9NB 4B9QA 4DPYA 1ZA2B 5J2NA 1D1UA 1VQNS 2MLYA 5A2QY 3V1RA 1REGX 3KD5E 2KFZA 4E1MA 4GV6A 5GAGP 3QMLA 5IWAF 5FJ4A 4LSLA 3VGLA 4CZLA 3BGFA 4NL5A 4NB4A 2FI1A 5DZ6A 7ICIA 3GCXP 1OWXA 2YNIB 2F8KA 3CC4N 3AB4B 4IOXA 1DT9A 5G0RA 4P2MA 2GBZA 1ZQZA 2C2EA 4RUHA 4BR4A 1KOHA 4FJNA 3W5YA 5J2GA 2CWXA 3N01A 1C0FA 2Y8WA 3IGNA 1R6VA 4AHVA 5F1XA 1NPRA 2QRRA 4AXIA 1X7VA 1ZAXA 1ITGA 1ESVA 3MM5A 4CLFA 1KFDA 2C3YA 1QM9A 4USTA 1RHJB 3M8SA 4F92B 1JROA 2AKWB 2YPYA 1KKXA 3Q8RB 5HRRA 4HAIA 3EUNA 2D0CA 3F73A 5BOMA 3G0ZA 2XMTA 1RTJA 2DNOA 2CJBA 4FJHA 2JSXA 3LP1B 1K9MO 3CD0A 3CIPA 3K9JA 2FBYA 4I2JA 2QC3A 4QZVB 1H1VA 2ZIUB 3Q8QB 2W9BB 4J9RA 2A0FB 3QPIA 3MXHP 2GS8A 3IM8A 2HZAA 1U7LA 4P0PB 3ZTPA 5A6WA 2CGJA 3UN5A 1TTHB 3BQ0A 2WW4A 4JKEA 3OTOK 4EENA 5IIJA 1N36K 4ZP6A 3SFGA 3AODA 1YHQS 1NBWA 3Q8YA 3W9JA 1C1AA 5DG7A 3KMSA 2OEHA 1TMJA 2F8HA 3H90A 1BLUA 3QNOA 2WF7A 4HT7A 4KSEB 4ZPCA 2ROPA 3O80A 4IRDA 2OKQA 3M32B 4ETXA 2V2VA 5KFZA 2NO4A 3N79A 2YKNB 3AUOA 1P90A 2AJ2A 1JL2A 4CFCA 4L3QA 1KQSR 1PYSB 5IT9O 2PMZF 4RW6A 1WSEA 4NY8A 3SYZA 4B3TJ 2RAQA 4DPUA 4UQGA 5D0RA 4JV0A 1QZ5A 1N8RT 2EZZA 9ICEA 2HMIB 4AL7A 5I3UB 2A1RA 4PWUA 4WIQA 4CFBA 4AQYK 1LB2B 1D8BA 4NLCA 2LLZA 3PW4A 3JB9k 4RBVA 1B9FA 2WK4A 4LRCA 2XULA 4NXNJ 3AM9A 5D4LA 2MZQA 3LWMA 4I7FB 3FZBA 4YXMA 2KNJA 3E2EA 2ZUDA 3GIMA 5IWAK 2EK1A 2ZKUA 4XPCA 4MK7A 3VGVA 4ZHRB 1BCMA 3TAQA 2D5RA 4FXWA 2UUBJ 2E44A 2QSFA 3R5CA 3DM2B 4BR9A 2W9CA 1XIQA 2WB4A 2V5HG 1DRGA 2VL1A 5J2PA 1LWXA 1Y88A 3J8AA 4CZJA 4USVA 3WK4A 3RAXA 1NJWA 2ZWOA 3VAHA 4CWBA 2ZTCA 2H3QA 2CIMA 1VQLS 2UU9F 3IWXA 4RG8A 1EHWA 5IINA 2DHAA 3FRYA 3SCIE 3IM1A 3CJQA 3OVNA 2Q36A 1OY6A 4DR6K 1KVIA 3ZDBA 4NCBA 2ZH5A 3AY0A 2ZHAA 4FE3A 1PIEA 4JV2A 3ZLJA 4LFCF 2Y0SC 2KN4A 3RSEA 1BDGA 4WPAA 3CMES 2LXIA 4P2HA 3JYTB 2QB1A 4KR0B 4RW4B 3C15A 4WWSA 3ISDA 4PZOA 1XJWB 3PRVA 2X1BA 3MAQA 3VQ8A 3DRYA 1NK5A 3PXGa 3CPWR 2BHNA 3KLIB 2OXOA 3QUQA 3V81B 1IBMK 3TU5A 2JZBA 3OD2A 5KFRA 2J9EA 4FVMA 1NK7A 4X4OA 4YD2A 2HOIA 9ICHA 5AXNA 2HNZA 2R7VA 4RZRA 2XYPB 5L46A 1J54A 2I8EA 3LF0A 2D3OR 4CO0A 3JTPA 4NMLA 2KJWA 1HWIA 3P39A 4JI4K 4F5NA 3MAAB 4ECUA 2BVZA 2P8IA 5J2FA 1JXLA 4E19A 3ETOA 4DN9A 4FF2A 3HRDD 2BKOA 3WKEA 2VG6A 5I3PA 3RYLA 5AQYA 1ZXIA 3CCVN 4XIUA 4ZN1A 4K0KJ 5AFUH 1WWHA 4DR2F 3CJTA 4E0DA 2CQDA 4KHUA 7FDRA 5E5NA 2R2SA 4Q0BB 1SIZA 3QE9Y 1M5KC 3ITHB 3OTCA 1RWKB 5ALHA 4IOCL 3QSIA 5DO2A 3ZO7A 4IJNA 3TACB 2J4RA 2DBBA 2YWWA 3T79A 4DOZA 1HQEB 2C2OB 5E3CA 1W97L 3ULDA 2F7TA 3RB6A 3VALA 3AVHA 1RTDA 1WDDA 4C11A 3GWCA 4HI2A 1NDCA 2IS3A 4FBTA 4DQRA 3FEYB 4O4GB 1ECWA 5J29A 3G8TA 5J2HA 1JKHB 2BABA 2UVVA 4RT2A 1K1SA 3DU6A 3UB5A 4LD0A 4ERDA 4CESA 4NA1A 1YI2N 1F1BB 2F8LA 4DV1F 5AK6A 3MD3A 4CCHA 3HJVA 3P38A 1ZQEA 3EE3A 4UOCA 3MOJB 1CPZA 3H5SA 1Y11A 4AH9A 1CULA 1CXQA 3O44A 3ZT3A 3D2EB 3VEXA 2LSNA 3LAKA 5KT6A 3VQBA 4YY3K 1PBUA 2LI6A 2DR6A 3QMQA 2IM3A 3R2DJ 1UJ4A 4MKAA 1YJTA 1ASVA 2A6OA 1T95A 5I42B 2XSJB 2NYVA 2KMDA 3BO4A 5M2RA 3QICA 4DQSA 3HSCA 3QEBZ 4LSNB 3RWUA 2NUHA 4DV5K 3LWLA 2P6UA 1AT1B 3H5UA 2PEHA 4ANEA 3EJMA 1E3MA 2KT3A 4KPYA 2AQ0A 3TEHB 1TAQA 3WXMB 5E79U 1LAVA 2KRBA 3KK1A 3OL6A 4FZZA 3GOIA 4CFDA 1X4CA 4HTUA 1HNIB 1TFYA 1RT4B 4Z4GA 5EXWA 5GIPA 2VGNA 5BR9A 3HK2A 2YMMA 4DL3A 5HANA 4IQWA 2FJWA 5GTIU 4KKOA 1IBLF 2MQOA 2E5LK 5LL6Z 1J2VA 3ENQA 5ETOA 4E3SA 1ED1A 1YGYA 4DQQA 4DTRA 1V3ZA 5HK4A 2PD1A 1Q46A 1CJKB 5H2FU 4I2PB 5DDOC 5CXTA 2UYTA 4G1IA 1FKOA 1PUZA 3JPNA 4IR1A 1RNHA 3MWTA 2UUCJ 1ZQTA 2IMWP 4KX5A 1LAWA 1WTFA 3MM8A 2Q3SA 5MAOA 1TVRA 5A0YB 2WONB 3C8YA 2X1GA 2RDDA 1Q9YA 2FJBB 3SBTA 8ICFA 3MPVA 3MUVP 3BQTA 2GEMA 1ZQSA 2H5JB 3J81j 2C2MB 5E26A 3TAFA 1KVAA 2YNGA 5HRSA 1LOTB 2MKYA 3C1YA 3FCVA 3X1LB 5A8RB 3M1VA 3QO9A 4CJTA 3SFUA 2LHTA 3BBFA 3F2KA 4QZCA 2N7YA 3HTVA 3IS9B 1NZ8A 4YB6A 5JS1A 2DXDA 5K8MA 2FBVA 2YQ0A 4FYXB 4DV1K 1NHVA 1CJTA 2GUPA 5AM4A 1TMMA 4H0YB 4UY8T 5D4BA 3DJCA 2M52A 2E29A 5B09A 3WNFA 2DKXA 2DGSA 1F5AA 1SV0C 1YBUA 4OJ5A 2XG8A 3S3MA 3ZSWA 3BEXA 4NXMJ 1S1TB 3IN5A 1M5OC 4PKHA 2NRWA 1U1RA 5HO4A 4C0OC 3M8PA 2FUG9 1TKTB 2HLUA 4YHHF 4NE9C 3KOAA 1ASWA 2YHYA 5T41A 2HFZA 5E3PA 3IP0A 4DG1A 5MLCQ 4BRCA 1Y0HA 5J2MA 5C42A 1WCNA 4ZCLA 2YMPA 1SZHA 2PI4A 4KH1B 3NMRA 1YJWN 2BTFA 3I0SA 8ICQA 2AZ3A 4NI2A 3Q8SB 3MR7A 2XZTB 4CJPA 4IOCQ 2B4UA 5ETVA 2VC1A 4ACOA 1HQ2A 2JJ4D 1VDHA 4O9MA 2IY5B 1NOMA 3VAIA 3PM9A 4Y2CA 3RJFA 2QK9A 4QWEA 2D74B 4IH7A 4PGQA 5EVZA 1F9EB 1OQ3A 3EYZA 4CGFA 1PK1A 1QJHA 3Q8MA 1XERA 1PYOB 2JH1A 1RBLA 1EETB 4R79A 4AHUA 3UIQA 2BQUA 2DHHA 1YRXA 5ETRA 1PCAA 3V5RA 4F0KA 2ZNYA 1S0MA 4A8YA 4HDGA 2O8CB 2ROEA 3A5MC 5ALIA 3HJFA 1B0XA 2N82B 2MGZB 4CRJA 4PL8A 2UXBJ 5JTIA 4TUSA 2CUYA 2OANA 3AD9C 3K7RA 5FDLB 2J7UA 2VG7B 7ICKA 2HWTA 4DV4J 3W2WB 4CZMA 3V2UC 3V6HA 4AP9A 2FC0A 1YKWA 4M3WA 1RAAB 4WFBL 5L38A 4PEOA 4A8FA 1VDVA 3VGTA 2KKHA 1NEEA 5KG6A 3CIMA 2DCUB 3OR1B 2FJ6A 3ZT2A 1H3DA 4K5RA 4JHDB 3VQQA 7ICRA 2FLLA 3HZGA 2WFBA 2KJ8A 3FSIA 3ORYA 1RJJA 1ZM2A 3WK6A 5JVGL 3H0RB 2I5JA 1JLGB 2YNFB 4PKIA 3LP0A 2W9AA 2B4PA 1VK8A 1RYRA 4BC3A 1FE0A 5TZVA 3AVCA 3EKSA 3DRPB 4OZ5A 2OSQA 1KKHA 1QAYA 3O4WA 2M5YA 3QEAZ 2GW8A 3DLLQ 3FZKA 2CPJA 3QFHA 5D78A 3BS5B 3QT7A 1RT3B 4DV2J 2P6TA 1HARA 4KAIA 5G4DA 1NGFA 1MLAA 1QE1B 1EKRA 2Z0GA 3WQUA 4JI2F 1FK9A 3IR6B 4TYBA 5EY4A 4YHHK 5IT0A 3ZSYA 4WQ5C 4QS9A 3IR5B 2AA4A 1ZBLA 4KFBA 3CYMA 4EX7A 4XO0A 3SJHA 4P7TA 1DY3A 4A5BA 4U7UK 3NCQA 8ICNA 4DR3F 2ZM6J 4KI4A 2ZDPA 9ICBA 5AZIA 1IJFB 4EBEA 1JLBA 3LZJA 1NKEA 1IKVB 4AL5A 3CERA 1VQ7N 2HEKA 5DDPC 3D6JA 4A62A 3KD1E 3UKRB 4YUDA 1VIXA 1LKZA 2C2KB 3R1XA 2UP1A 5DB7A 4KLSA 3OYAA 3KK3A 1NGDA 2MKKA 1XS9D 2UV8G 5B0AA 3VTIA 4KGZB 1O08A 3HXMA 3SJJA 1U24A 1XMOF 4LRBA 5AK5A 3JSMA 3B6BA 1NGEA 2R7SA 4XDCA 4K41A 1C4CA 3QRRA 9ICFA 4ZPTR 3BGRA 3CC4S 7ICVA 1H7WA 2AYEA 1C0UB 4LT6A 2V8HA 3KVGA 1ZJMA 4KTWA 1JLAB 4Q7AA 3AVJA 4X4VA 1DK2A 1WN7A 4LR8A 3AQOA 5AXKA 3HKZD 4KYZA 2P9IB 2G0CA 3G6EN 3J7YU 2GA7A 3U4LA 2XGPA 2HHQA 3GV7B 3LO3A 4RNHA 2KYZA 2IVPA 3F53A 3ET6A 4Y2IA 5HMXA 2HZVA 3LL3A 2PSZA 1SC6A 4FOEA 3CXCM 1VC0A 4ED7A 3WEEB 3TAGA 2VG5B 3OLBA 3L7PA 4FWMA 5CEHA 2PXIA 4OZLA 2ES6A 5H9EJ 4RBUA 3D0PA 1FKPA 1EWRA 3LOUA 3J80Y 2EG1A 3U8XA 2XWYA 5BPNA 3FMWA 2R18A 4DV7J 1KD1T 4MH8A 3O9TA 1H6KX 3SBMA 4LZGA 4N5SA 2BDPA 4I2DA 1JJHA 1UT8A 4JI3F 1TAUA 1XU4A 4X65J 2VD3A 4FJMA 4HL9A 4JKGB 4CJRA 3JPPA 1ZBIA 3OFHA 3H42A 3THPA 3SEIA 4KQZA 2U2FA 3O2IA 3N4WA 4CO4A 3NGDA 3CFOA 4WFXA 1YLXA 4ZVPB 2AJFE 1V9OA 4UAVA 4CEDA 1WEZA 1TL3A 3NBPB 1JCEA 2BBEA 4P4OA 2CPXA 3SUOA 3NOCA 1F0MA 5LY3A 5BR8K 3C2LA 3OJUA 3FZFA 2DR7A 4DR3K 2LKZA 1ZQFA 3QFPA 3Q0AA 2H48B 1SZ2A 1S7IA 2PMWA 4JI7K 2RE2A 5D0GA 3QU2A 2IVMA 1DXSA 2ZDOA 3UMBA 3N4MB 2BM1A 3AJ2A 4DTJA 2FF6A 3MGHA 2AZ1A 2XBPA 1ZQOA 3OXGA 4KLHA 1G99A 2HBLA 2NSCA 4DTUA 2XM3A 1XMOK 4DL0C 4C8NA 3DOLB 3GFYA 4LF6J 2E5JA 3CJRA 3T6JA 3T1YK 4DI6A 1ATRA 5D8HB 2KV2A 3H1QA 4B1UB 4MYUA 3K59A 1V5VA 3OS2A 3BF3A 2XI9A 1QCKA 1SL1A 1R0AB 4X5VA 5GINA 4OJ6A 5LJ3Y 4AILC 5F3ZA 4ENOA 3LTOA 2R8JA 1VQPN 2NRZA 4ZJQA 1RZMA 2DL0A 4JAXA 2FDNA 4ILGB 4G9ZA 2F44A 4OI0A 4Z0UA 3AA4A 4OX7A 2MZJA 2X3DA 4I2BA 4RW9B 3IAS9 1VHIA 4Z6FA 2DWQA 3QT8A 3KJVA 2B51A 4LF8F 4NASA 3KHLA 1HUOA 3UCGA 2EANA 4HKQA 1U8WA 1XO1A 4YEAA 4E1JA 3FBFA 1X9MA 4WQ4C 4U67L 1D9DA 1HPZA 4A8EA 4ISEA 1JRPA 1OS5A 1Z19A 4FF4A 4MMOA 2DNGA 5LSOA 3CCRN 2B4JA 3ALRA 1SIJA 3CDAA 4B3SJ 3DCAA 1KVBA 4DF4A 3OV7A 5DM7L 1LXNA 2RRNA 2KEYA 3BGLA 5KFDA 1UOCA 2XYGB 1S1XA 4DUYK 2KJ5A 4JI6J 4F91B 5M1FA 1UVMA 3NS7B 1VISA 4URGA 2FGOA 1E6VB 1RWPB 3F9MA 4DX6A 3V9SA 4D3GA 4FFDA 2HFSA 4BX9C 3W2VA 3AA5X 3PDNA 3WK9A 3HHLB 4YR0A 3CJKB 5FP0A 4ZVTB 2DGWA 3MMAA 3HKZF 2HZCA 4LFAJ 2KSOB 4CZGA 3KKSA 1U47A 1MW7A 4FZMA 1NZAA 1GLCG 4ECYA 2CDQA 3A4TA 5EDWA 2YKPA 1S49A 2QTWA 5KG1A 4IRKA 2LU1A 3B8HA 2IBOA 4EI2A 1S0OA 2NZ4A 2VICA 2E9TA 4MFBA 2JOQA 3MI7X 5FPMA 2KG5A 2IVYA 2FZKB 2C28A 2ZWHA 3H0LB 9ICCA 3A3PB 4FK2A 5JUMA 3R7BB 1KAXA 5AJ3F 4O5FA 1GT8A 1BUPA 4AF1A 3P5BP 4LRAA 9ICLA 2KFYA 3DV9A 3C7NA 1JJ2M 1VHFA 5AI0A 7ICPA 2HF3A 3VF4A 4M2YA 4F9OA 1IO2A 4DL4A 3RMCA 1R8CA 2R7OA 4ANDA 4OI6A 5A2QU 3CCLS 5SZTA 1X4HA 4JI1K 5KFKA 3M5RA 2UUAF 4LF7F 1HMVB 2NXJA 3RAMA 3TANA 1BHNA 3ED5A 1IJEB 2GMHA 3RB3A 2G0AA 4V19J 1KVJA 2D6FC 3IRXA 2CXYA 2GO7A 4UAZA 1MDUB 4FLXA 5HLFA 4A48A 3NVVA 1KNZA 2HIYA 1U1KA 5C24B 1RTHA 4DR4F 1ZD4A 5BRFA 3BN4A 3CVKA 3BKFA 1BWFO 2E6MA 4F5QA 4C0ZA 1YSJA 3BYRA 2QWNA 2XLIA 4PUOA 2WHEA 3C2MA 1FD2A 2HQCA 3N9UC 4F3OA 4ZVGA 1BPDA 3SBGA 4BXOA 2P9SA 5KFUA 4GVEA 3SZ2A 4Z7CA 4C4TA 3D67A 2DR8A 4TVAB 2FPMA 4CP5A 4I2CA 2ZH7A 1BD6A 5CA5A 4ZJLA 3B8AX 4W5RA 2PMZC 4IZ9A 3ZI4A 2FPLA 3H8MA 4JB8B 2WAQD 5T7LA 3CD6S 9ICPA 1HW9A 4V1Ak 3G86A 2C3UA 2IPOB 4DXLA 2BQ3A 5LL6d 4J2DA 4UOFA 1SJFA 3L4QA 2P9KA 2YWFA 1M1KT 3QFWA 2HFNA 1L5UA 1B7FA 4RO0A 1WG1A 3AXKA 4B1VA 3QBCA 1T03A 4PWDA 3EVWA 4CHQA 3CGIA 2ZBIA 3OR2B 1K0VA 2RDJA 2HHHJ 4RQ0A 4FF3A 3NDKA 1K0TA 9ICJA 4UAYA 1FXLA 2AX1A 4CF5A 4DOAA 2ACYA 4MO4A 4ZP8A 8ICPA 2J0QD 4DR5K 1BQNA 5CHCB 3BDEA 1C1BA 2WF5A 5A8KB 4CDIA 9ICMA 2E8PA 5AE3A 5HMMA 1PC5A 1RABB 5KT5A 2I7PA 2BE2B 2MKJA 1NU0A 1HNVB 1X5SA 3V1OA 4MFFA 2E8OA 3SUQA 2OI2A 2LYHA 1RILA 1MWZA 4J9SA 4NPOA 3VTHA 4NRTA 4UB2A 2Q6CA 2EVZA 5D46A 1U1OA 3JAMY 5KFQA 3FVYA 2D41A 1G1XA 1Q9XA 3VF0B 3AU2A 2OFHX 1FW6A 3BKTA 3KLHB 3RW7A 4QOZB 2DJWA 3NCRA 3HOTA 3EY1A 3MGJA 4R5PB 1ZQCA 4NCGA 4LF7K 4IR9A 5F3XB 2FJVA 4X4NA 2H4WB 3S6EA 3L6QA 2PKEA 1WJ9A 5J2IA 3OYGA 4CHOA 2LDIA 2VJUA 4IDKA 1V97A 2UV8A 4Y00A 1RTZA 2KG0A 4CJLA 4OHXA 3WU2U 3NH0A 4XAKA 4B3TF 1YJWS 3CCQN 5CZVA 1HJRA 3NF7A 4F2RA 3CCZA 3POTB 3L9ZA 5ALQA 3GMGA 4PPDA 3D6HB 1U0HB 2CYYA 2JC1A 1Q1KA 3DDKA 4QWCA 2A10A 8ICBA 4NXNF 2ZQBA 4MFCA 1S4FA 3KFWX 3OYBA 4CEEA 4QPXA 5KG2A 1VQON 3C94A 1NGIA 3G10A 3EKUA 1O0PA 2F4VJ 1MU2A 2ZF5O 4CBXA 2UUBF 1IIPA 1IWAA 4IOAL 4I9LA 5KFNA 2Q1NA 1UAXA 5D77A 2LQ9A 2M8DB 2XZDB 1ZTTA 3GLJA 2W3SA 3THVA 2YTUA 3ZFVA 2GQ2A 1WD6A 4W5QA 1HPMA 3MBYA 5KFWA 5J2NB 1Q0NA 2E88A 4CEBA 2DPNA 3M2VA 5M1NA 3VAJA 4H4KC 2ZBCA 4LSLB 3A0HU 4NLBA 3I8BA 4FYVB 4FWKA 2KVIA 3V72A 2FSKA 3MDCA 1QVFM 2ISOA 4K8ZA 2EFPA 3GJRB 3WX8A 3IBPA 1XWLA 5J0PA 4ELTA 5ALSA 5G0RB 4NOHA 2LEBA 3DHWC 5DG9A 2KYXA 4LZDA 2DGZA 5KG3A 5CRXA 1IH7A 2R7QA 3CCMN 5GADU 3LDLA 2O8BA 1SXDA 1QQ7A 3PX0A 1GX6A 1ZOLA 1FWLA 4NLTA 4Y65A 2K1RA 1RP5A 3QNNA 8ICLA 2BYCA 2P9LA 3BREA 2XMUA 2DH7A 2E66A 3MM5B 1DARA 4C3LA 3MEEB 5DQIA 2G4BA 1ILYA 7ICJA 1PJ6A 1TAMA 4QJFB 2WAQF 2GQCA 4CJ7A 1RTJB 1NM1A 4ID1A 3MF5A 4PG7A 4OGEA 1WHXA 1KDNA 2I38A 4GV9A 1BL3A 4YB1P 1V4TA 2Y0BB 4K0KF 3EGZA 4IH6A 5GMKa 2CQ4A 3RJKA 4OYMA 2ZH2A 4C9DA 5IM0A 3CQ8A 1RI7A 1U26A 1MSWD 3L3VA 4DR7J 4K5SA 4H5WA 3ZTSA 1A9NB 3QZ8A 4I2HA 2ZKTA 4ZPVR 2EFVA 1DGSA 3Q22A 4KLLA 2M0GB 3I4PA 2GCFA 3CJCA 5AT1B 4EP5A 3MXIA 3H0PA 3RBXA 4R8UA 4X62J 1MQ2A 1X66A 5CH7B 1F2HA 1KDHA 2NR0A 3VEVA 3R97A 1DAXA 2M4MA 1WTBA 4A8KA 4NL9A 1RYSA 4M95A 4RW6B 3F5EA 2PI5A 1KAYA 4EZ9A 2KXHA 3CMAS 1IV8A 4BBYA 1J6ZA 2MEWA 3T5LA 4M5KA 4CF9A 3U26A 2MZ1A 2JNJA 2A1SA 4CZCA 1VK3A 5CABA 2PFOA 1T9YA 2ZJPQ 1NSPA 4JI8J 2JHDA 3IG5A 2WVBA 3ZX2A 3S3NA 4EEYA 3CWJA 5HATA 3S3OA 3THTA 2HHUA 4L6V3 2Q0UA 3AO2A 1R31A 3T5HA 2NUUG 5HI7A 2PFDA 2DNHA 3SK3A 2VKRA 1S76D 2W9CB 3SUNA 2FJEB 2GWKA 3EXYA 4Z2XA 2KHDA 4GFJA 3LVVA 3C2PA 1ZC6A 2J7WA 4JP8A 2D0OA 1ICEB 4OI3A 1NK0A 4QOTA 4WF9L 1H7XA 1WB9A 2OAUA 3HILA 3K2YA 2ASPA 4BDPA 4A59A 2F2AB 5L1JA 4OMFG 2D0PA 4NLWA 2P6SA 3NLCA 2HQ3A 4HHHA 1KN6A 1Q7YO 4P74A 1VQKN 5IFMA 4OIXA 3RSEB 3C21A 3FZ2A 4F71A 2XTJP 1VI7A 1TL1A 4Y2KA 4N41A 4NO7A 1L8LA 4JUZA 1ZAVA 5CD4H 5KQDA 3R5JB 4L74A 3C15B 2FY8A 4FJLA 4DV0J 2GHPA 4UB4A 2RUGA 3VA0A 4OJ3A 2GH1A 1YWXA 3N6LA 1N33J 1WF2A 2FD2A 2JZBB 4KLEA 3QGIA 4IOAQ 3W0LA 2OHDA 3L2UA 2BE7D 1S5ZA 2HNZB 4M63C 4PQAA 5DDYA 1A77A 4U6PA 3N7RC 3GILA 4EX6A 3DRXA 3M6XA 3RVCA 3NVYA 3BS9A 2KHVA 3OVSA 2HRTA 1TGOA 3ZT1A 5BN8A 1WF1A 4PL2A 3R5AA 4HH1A 3CJAA 1RXWA 2E1CA 1SI9A 5AE1A 3V4IA 4CBUA 2VG6B 3M3ZA 1RAJA 1UEVA 1IKWA 3F56A 2ZVIA 3AO3A 1DGJA 2XCAA 5F8GA 2DGVA 1FJEB 1KBUA 3P45B 5ETLA 3DLEA 3H3NO 4WE1A 4PHTX 4OJPA 3Q2SC 2AGOA 3CCTA 3UNGC 4WZQA 1UP1A 3ZSOA 3O3HA 4QWAA 1RTDB 2IMOA 1HUXA 2D9OA 1NK4A 4C11B 1NMEB 4NZ7A 3MAHA 2OD6A 1DURA 5JVHQ 1NJIT 1UCNA 2V67A 1SH3A 4NXMF 3SQ0A 3CD5A 4CHYA 2PDAA 2AYMA 4UB3A 1VQ6N 3L7OA 2IOHA 4NZ0A 1VQPS 1EAYC 2POKA 2W4PA 4DX5A 4HCBA 1XHZA 1VBZA 3PACA 1CULB 2FJDB 5LT5A 4EMDA 2ZOMA 2BH1A 5D6GA 1YBAA 4BR0A 2GIRA 1GH8A 1P8ZA 1Y3KA 1UAWA 4MN4C 1S4EA 3D2SA 4F25A 2K4HA 5ALZA 2A5XA 3ICLA 3A0IX 2NRRA 5J2QA 4YR2A 1U9LA 4IYQA 4DUTA 4NA3A 3SQ1A 4PQUA 2FLOA 1FX2A 2BXJA 3GIRA 4NLVA 4EFAC 3HI0A 4KBOA 2VODA 3MMVA 2DFHA 2QFIA 3KK1B 3CULA 4FWNA 3VEOA 1RT2A 3JPOA 3AAQA 2V8VA 2BJ3A 4HR2A 2VHGA 4F36A 3CCEN 2EWHA 3LA0A 4EEKA 4JI5J 1T4GA 3ZDEA 1RLCL 2MQLA 4ZVHA 2DK2A 3VCDA 2UXBF 3P5JA 4KKOB 2UUCK 1N48A 4ZVFA 4DZ6A 3PLAA 3QJJA 1YVNA 4P4PA 4DV4F 1X4FA 1DKGD 2Q31A 3C23A 4DTXA 1UVKA 2H5EA 4PKDB 5AQUA 1NNEA 4IQVA 3THYA 5KG5A 3OT9A 1HHTP 1D4XA 3KUEA 5ALUA 1FKOB 2XZWA 3VEZA 9ICQA 2O4GA 2FZCB 4JYAK 4ICAA 3R1HA 1NKBA 3R3LA 4M5HA 5GAGU 3U1LA 3MM8B 1TVRB 4RR5A 4QZ8A 3M05A 8ICXA 4EBCA 4CYUA 3I5CA 1YJUA 2YNGB 4ZK7M 1N61A 5KFHA 3M1VB 4YORA 3QO9B 2QWOA 4KLUA 3ZSQA 4NXMK 1TKXA 1LK7A 5L39A 4DV2F 3DOMA 2XS5A 1BI4A 1CJTB 4EU0A 4X4PA 3OL9A 2AIRB 3G4SN 4ZP7A 1QTNB 4TY9A 4WTOB 2R8HA 3G6YA 4EHUA 1SJ3P 4EWTA 3NF6A 3EZ5A 1X9XA 1WNSA 2R7RA 4DQIA 4OPHA 3QQCD 2G06A 4KY3A 2ZM6F 4ETZA 4GW6A 1P6TA 5DB6A 4F50A 3L0QA 2VYPA 4B1XB 3EE8A 2XC9A 2RB7A 3VQTA 1N32K 1XNSA 5EU7A 5BPLA 3M8PB 3UD3P 3I0RA 3TZWA 1T3OA 2NLWA 5ALTA 3TEGA 2MYFA 4M5JA 2QI2A 1Q81T 4Y2RA 2BACA 4K7QA 1NHKL 2HW3A 4DG1B 2V6AA 1BISA 5J2MB 5C42B 2Y0SD 1XMQJ 1OYEA 4OHYA 2MQMA 3J80U 5KRSA 1HKAA 1TUVA 4DTPA 3GIIA 1N5QA 2BPFA 4AD6A 1B4SA 2MTLA 2YVSA 3AGKA 3I0SB 4NI2B 4ZN3A 2PMHA 4GO7X 4ED5A 3NVZA 1I39A 3FEXB 2FHJD 4PG6A 1ZZFA 4Q44A 1Z1ZA 2PFFB 2BRKA 2CQ2A 3R1LA 2BKEA 2H1YA 7AT1B 3CNHA 1O13A 4RQ2A 1IR2A 4YCXA 3L3CA 4DV4K 1BWEA 1TK0A 1PK1B 5ALOA 4LVNP 3UNYA 2DXEA 4YOTA 2Y1RI 2ATCB 5LMNJ 3KKFA 1ZTWA 4DL6A 1VK0A 1BG3A 1SJQA 5AQSA 5K4LA 3WX4A 2CFXA 4OJRA 2KG1A 2Y9UA 4YS2A 5F8IA 4G1PA 2RQMA 3PW7A 3HFZB 1X42A 3A5OC 4ECRA 1IM6A 1XNRJ 4DV7F 3AJDA 4CI0B 1RHKB 3G71N 3KWIA 5HJXA 3LK9A 2LXUA 3K5LA 5BXIA 2DCLA 3UQ0A 4X65F 2ZUBA 3OXLA 3K17A 1RAHB 1UETA 3OHRA 4QZFA 4CIGA 1JWWA 4BDZA 4FZNA 3MK6A 3OW2M 1RFQA 2IDLA 1X4DA 3LDPA 3AA8A 3TZXA 1U09A 4DV2K 5EWFA 2ZFHA 1YG0A 2OSRA 1PJ7A 2EZYA 2UVUA 1XMBA 2I5JB 3SQ2A 4MEYA 5JS2A 1NUEA 1P27B 3MEGA 1HKBA 3LP0B 1PVRA 2QA2A 3UR3C 2ASMA 4HTIA 1P7DA 3LW5C 2ITMA 4CJSA 7ICEA 4DR1J 3CC7S 2AJQA 2Z2YB 5KFYA 4AYBF 3CCQS 3N7SC 3A3OB 3L09A 2XWXA 2ZM6K 1Y7PA 1RDAA 1M5SA 3DGVA 2BKNA 3GBTA 2ZIWA 4WFYA 1HLUA 3TTDA 2W7OA 4RWTA 2F1IA 2LQBA 3Q2TC 2B0CA 1FK9B 5J0YA 3HKZC 4KBIA 3VR1A 3B82A 4KFBB 4WFZA 1ZQNA 3KNAA 3H8SA 4Q45A 1UW4A 4LF6F 1BUXA 4H4OA 1Q8LA 2YB4A 5C25A 1NHUA 3VZIA 5HMZA 1VSFA 5DZ7A 5AZIB 3FM9A 5KPTA 1JLBB 1YT3A 3TFSA 3OYLA 4FDFA 3CF5Q 4L73A 3KHYA 2G5IB 2QW9A 1P9QC 1KL9A 2HK2A 4XH4A 4M45A 2NXNA 1NXIA 5M1QA 2OPQA 5T7BA 2MU2A 3KK3B 4LRDA 4DR2J 2KM8B 4NLRA 4K4TA 5EX0A 3I1YA 4WK3A 3KG1A 4C0BA 1ZBFA 1NH8A 2YQ3A 2E5SA 3BGRB 4YDUA 4PCQA 2YHAA 3QU9A 2DITA 5KT4A 3KWMA 5EN1A 4FWLA 1NMDA 2DNKA 2JVRA 1YITS 1OVYA 4K8RA 5H9EK 4IXCA 4JV5K 1EQYA 3ULHA 2W11A 3WK5A 1Z2LA 1RBOB 3QGGA 2NXEA 2HOEA 4J9OA 1SZPA 2QV6A 1F3FA 2HVDA 2C2RA 4ZVUB 4YOUA 3WKBA 2O8FA 3ET6B 2VPYB 1HNWK 3H8WA 3PSFA 3WBZA 3W9HA 2GVDA 4FJ5A 3WUHA 1UKUA 1JCGA 4ES3A 2GJIA 4AHCA 1UPHA 4R25A 4OI1A 2XGQA 3NMAA 4JK8A 4X65K 2H3GX 1UPMB 2UVWA 3NRWA 1K8KA 4B9LA 1WHVA 3OXFA 3PX4A 4JI6F 1FKPB 2YXLA 4JOUA 3M9NB 1GOCA 2GWSA 3PMNA 4IO9Q 1ROFA 2ZXHA 5KPRA 3HM8A 4KHQA 2DNYA 3HD2A 3US5A 3N6NA 1U04A 2VWBA 1FXDA 1LEOA 1X4AA 2H3VA 4ZPBA 3L2RA 2J7KA 2OMLA 4LFAF 4WCEQ 3MMCA 1YJ9N 2NRXA 4JI0F 1VJ5A 4I27A 2W2PP 4FZYA 1IQTA 3ZZPA 3SNNA 4ALZA 5FRNA 4JRQA 5E33A 2OD4A 3DMJA 3FRZA 4O3SA 2B5JA 3M1YA 2IM2A 5DM6Q 4F2SA 3FFIA 3OYFA 1BY9A 2RIJA 3UWTA 1RWMB 5HVGA 3MDQA 1VQ8N 1BMQB 3HHLC 2U1AA 5MLCV 1S72S 4NYOA 3DXKA 1B22A 1QZ6A 4DS5A 4HHUA 5HP4A 3QIPA 1PYTA 1TL3B 4P75A 1TV9A 2HS3A 4JKHA 2YHWA 1QVGR 1OVQA 4CHZA 2M70A 2AF6A 4F5OA 2ADBA 3PIPL 4NLOA 4NMXA 3DI6A 3C5FA 3HYFA 4P10A 4PXBA 1RHUB 3VQEA 4FK4A 2VC0A 3MM7A 5LOQA 1XNQJ 4KGMA 3AFGA 2HSZA 1RG6A 1DTQA 3AVKA 5D4OA 2HWHA 3NASA 1QSLA 1G15A 4ZVRB 1VSMA 3L2QA 3KXDA 3CQXA 2YX4A 2GO9A 2AU0A 2EXUA 5GIOA 2A40A 1OH6A 1UJ6A 5AHXA 4BY9C 4P52A 5J2AA 3NRBA 1VBYA 3T5KA 4KRWA 1BPEA 1ZYQA 1IVZA 1MWMA 4CTAA 4OL8A 4KE5A 1DRZA 1KR4A 3G9CA 3DRRA 3VC8A 2RQKA 4WFNL 9ICAA 4ZVOB 1VQKS 4CEQA 5AQQA 4PYAA 5E41A 1NGBA 4B3SK 8ICTA 3KJVB 1FRJA 5J0UA 5ALNA 1S7HA 3QFUA 5AI9A 4W5TA 2G8VA 4JI6K 1AW0A 2BCUA 1EQ0A 4H54A 4FM0A 5FROA 3W62A 1HPZB 8ICVA 2B3TB 2J9CA 3BYPA 4BDYA 3RMDA 1RACB 2X1AA 8ICZA 3MR3A 3C16B 3EUB2 4USIA 2HHHF 3CDUA 4LFAK 2C1EB 2YJFA 1U45A 3BR9A 3M9MB 3KZIU 3EDQB 1S1XB 4UOGA 3BSOA 4G65A 2EHGA 1U1MA 1M5HA 3TADC 1DLOA 4J9LA 2PEBA 3FR0A 2IDOA 1RE1B 3CI5A 3WC2A 3HT3A 1DQAA 3W2VB 2YQ1A 2FMSA 1OH5A 1LV5A 1SQEA 5EE9A 1HR0J