2Y1IA

Crystal structure of a s-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1iA01
5BPCA 5KFGA 4I9QA 3TAMA 2XO7A 4FCYA 2KZZA 4CHOA 3Q8KA 4IQWA 3MXIA 4M41A 5J2EA 1T05A 3SQ1A 5KFQA 1SZPA 4CJKA 3LZIA 4F91B 3O3GA 7ICJA 4CEFA 4RUCA 5J2PA 3SUPA 3HWTA 3O3HA 3NBPA 3AO1A 3JPQA 4FJIA 3TQ1A 4YD2A 3AU2A 4KLJA 2HB5A 4KB0A 4O55A 4CJLA 2ZJ5A 4FJXA 2FBYA 3C2MA 5CYMA 5SWMA 3K5NA 4F4WA 1MQ2A 3LP3A 4DU1A 4CF8A 1K1QA 8ICUA 1QQCA 4KITB 2BPGA 2J6UA 8ICXA 3Q8QB 4PHDA 1ZETA 5TZVA 3PO4A 2ZUDA 5IIKA 2BR0A 9ICIA 3KLEA 4C8LA 4ZHRA 3GIKA 2FLPA 4RW7A 5DBCA 4R63A 2R8HA 1JLGA 2VWJA 3TAEA 4KLMA 1Y88A 3HPOA 1ZQCA 4IG0A 4RT3A 3WNEA 1ZQZA 3K57A 4Z4GA 8ICVA 4HCCA 2YKMA 1S1UA 1XWLA 7ICRA 1UT5A 1I3AA 4FK2A 3H08A 5CY4A 3AVNA 4BDZA 4Z0UA 3SCXA 4ZH4A 4JK1A 3IM1A 4DTSA 4KLGA 4IQUA 1C0TA 9ICNA 4ED3A 3MEGA 2ATLA 4HYKA 4CJVA 2IA6A 2R8GA 2G8WA 1J5OA 3I0RA 1TKDA 3ZT1A 1NK0A 4ECRA 4FJHA 4TUSA 1WSGA 3QEAZ 2IHMA 3MXMA 4MEXA 4DL3A 3GIMA 4CFAA 3VA0A 1KVBA 3SQ2A 4F4ZA 4N76A 1S9GA 1BCMA 2AU0A 3V7KA 4KLTA 1U9LA 4CHPA 3VQQA 1JMSA 4J9QA 4OKJA 4DWIA 8ICGA 4I2EA 2XC9A 5HP4A 3VQ8A 4DOCA 4FLVA 4YMOA 4I2HA 2Y1IA 2BPCA 4DTUA 5KFUA 2BE2A 4CJFA 4OPJA 2ZJAA 1RBUA 1JLEA 1HYSA 3AO5A 2BCVA 2E6MA 4DL6A 4OKEA 4G1QA 4FLXA 5KFEA 4DSFA 4KLIA 4QZDA 2NRZA 1BVSA 4DQRA 5J2HA 1NKBA 1C1CA 4BDPA 4IRDA 4PGQA 1C1BA 4CEEA 4BE2A 5J2BA 1LWCA 4NM2A 3MBYA 4K8ZA 2VA3A 7ICOA 9ICBA 5JS2A 4Y1CA 3DM2A 1ZQLA 3VN5A 2A1JB 1A5VA 4JV0A 2X78A 4EYIB 2PI4A 5HRSA 2D0AA 3NGZA 4HTUA 2Z1GA 1CZBA 1LAVA 1TV9A 5HRPA 2D0CA 3QERA 4OKKA 3QEBZ 1ZQIA 2AGQA 4B9LA 4J9SA 3TARA 2IDOA 4O0IA 1BISA 2B21A 4PGYA 3SPZA 3C6UA 3L2VA 4QZCA 1WN7A 4YR2A 3V6DA 5KFBA 5J2JA 1IM4A 2FPKA 4RQ4A 3PR4A 2YNIA 4QCLA 3QNOA 1VSEA 5J2IA 4O3NA 2W9BB 3MFHA 4QZEA 5EWGA 5KFNA 5KFLA 2IGIA 4KREA 3NH0A 1NOMA 1IH7A 2ZTDA 4KI4A 4OPKA 3HXMA 1TL1A 4O3PA 4GXKA 3K75D 3LZJA 3V9ZA 1XSNA 4DTOA 4DF8A 4IRKA 1HNVA 2NRVA 1VSHA 3QE9Y 3GIIA 1C0UA 3H8SA 3RR8A 4J2AA 5CZ2A 3THVA 4QZ9A 1C1AA 3MABA 4B3OA 1B43A 3ZD8A 2Y1JA 2F1HA 4CEAA 4F2RA 3N4MB 1D5AA 4YMNA 2C28A 3KHLA 2C2DA 5KG2A 1L3SA 4NLKA 1ZQBA 1JKHA 3RJGA 1TGOA 4H4MA 2FPMA 3F9KA 4FK4A 4CE9A 3RRGA 2QK9A 2I1QA 1VSFA 2F8TA 3P1GA 1T3NA 5J0UA 4NLGA 1BHLA 5DLGA 2J6TA 1S10A 3RAXA 9ICSA 3H4BA 4O3QA 4FK0A 1TFRA 1SKRA 3ZSXA 3AA5X 4EP4A 4UB2A 3NGYA 5KFJA 1HNIA 3VQ9A 3TAFA 3ZDDA 5J0YA 1ZQUA 3HO1A 4K4GA 3M9MB 3RH4A 4J9MA 4JUZA 3T5HA 4UB3A 4CGFA 1XO1A 2X6SA 3QIPA 4R8UB 1ZQEA 2VG5A 5KFYA 1R0AA 3Q8SB 4NLNA 2M9NA 5IILA 3FYHA 1U47A 1WSIA 2PYJA 3AVMA 1ZBLA 5I42A 4XIUA 1LWFA 4QAGA 1RCHA 4HUEA 2YHAA 3ZSVA 1B9DA 4MFCA 2HHUA 3RJJA 4JRQA 4DL2A 1L5UA 4O5EA 7ICFA 3OYMA 2QKBA 1I39A 3OJSA 4RNMA 1XHZA 2XHBA 1S1WA 3KJVA 3LWMA 4DLGA 2F1JA 3C2KA 5J2AA 3LDSA 5DG8A 4M6WA 7ICNA 4ECSA 2KW4A 2HHVA 5IIJA 1ZQOA 2QXFA 2ZUCA 3S3OA 4FJKA 1SV5A 4R66A 4ED2A 3RJIA 4Q8EA 2LSNA 2ZD1A 2DY4A 4EBEA 1ZBFA 4EEYA 3RBEA 4EP5A 5EU7A 3RB3A 4QWDA 2FC0A 1C0MA 1WSFA 4DL5A 1ZQKA 1T4GA 2PFQA 3OYNA 3SJJA 3MEDA 7ICGA 4C8KA 3KTQA 3AVKA 1IXRA 1NJZA 5KFSA 1BPZA 3K5LA 4RQ5A 3ZDEA 4FJJA 2ISOA 9ICUA 4UAZA 5KFHA 4L8RB 3SUNA 3PW2A 3TWHA 4AILC 8ICLA 2PXIA 4Z6FA 4UAYA 4PA1A 2KFZA 4LY7A 2IMWP 3JPTA 1NK6A 3VA3A 4I28A 2I5JA 3UIQA 3E01A 3HM9A 4PWDA 8ICBA 4EYHB 2UVRA 4R64A 2UVWA 3OYJA 3SQ4A 3MDAA 5J0XA 3V1QA 5KRSA 1ZQRA 9ICJA 3G0ZA 5KT7A 1NK4A 5CP2A 3HW8A 4DSLA 3ORYA 8ICCA 4MFAA 2NRXA 5J29A 2OYQA 3EWAA 2UVVA 3AO2A 3AVAA 3SZ2A 1UA1A 5J0SA 4MF2A 4ED8A 4KV8A 3C1ZA 4JV2A 3UXNA 3NF7A 1RT1A 3AVJA 3OYIA 7ICMA 1CEZA 4KLLA 4CESA 1X9SA 5J2FA 2DFLA 5J1EA 5J2GA 4KLSA 2BKEA 3NGIA 1A77A 3MR2A 3OS0A 1TK0A 1IKYA 4O3RA 4CHYA 1A76A 5KFWA 1CUKA 3DOLA 1N48A 5IIOA 2AQ0A 1DLOA 1BL3A 3SUQA 1YVUA 3NF6A 2HHXA 3L2WA 1RT4A 1XU4A 4F92B 4QZBA 2JEFA 4KO0A 4C8MA 3HP9A 4CIGA 1WCLA 2DPIA 5KRTA 5CYQA 1D8YA 2YKNA 1LWEA 4I9LA 2H5XA 4YN4A 4YFKA 4K8XA 1C6VA 3Q8PB 3NCIA 2W9CB 2GBZA 1UA0A 3OYFA 4B9UA 4CJ5A 5KFXA 3KHHA 4Q44A 3AV9A 4M9GA 4HHTA 4DEZA 3BJYA 4KB1A 4NLZA 3QO9A 3OSPA 4OVLA 4GC6A 1DTTA 4CJPA 2QKKA 5CWRA 2VWKA 1Z00B 3RAQA 5KT3A 3PW0A 1L3UA 2KFNA 5KT6A 4TQSA 5C24A 4CK2A 4Z4EA 1ZJMA 3RR7A 4GXJA 4M04A 4CEDA 5HP1A 8ICIA 2EHGA 4O3SA 3U3YA 3VQEA 3OHAA 4DFMA 3H40A 4PPXA 1TAUA 5D49A 5E41A 4KPYA 5KG5A 8ICSA 5KFPA 9ICAA 3V72A 1XI1A 4DMNA 1RDAA 2PFPA 3RMBA 4YXMA 1BPYA 4M0AA 4CFCA 4RPYA 1CXQA 3U3GA 4E7HA 2NRTA 4M3TA 4Z6CA 4IFVA 4AH9A 5D46A 1MC8A 3GV8B 4UAWA 1NK5A 3DLRA 9ICWA 7ICHA 1UAXA 2RN2A 3RJKA 4QZHA 4DS4A 3RRHA 3HPGA 3HX0A 3VQCA 4PHPA 1RZTA 3OY9A 4FW2A 1RTJA 5F9NA 4Z4IA 4LSNA 4B8AB 2G8FA 5KT5A 4UBBA 3DI6A 3ZT0A 2E6LA 3N97B 2PY5A 2F96A 3EPGA 4FLZA 5KFAA 3VQBA 4PHAA 3VQ4A 3QNNA 4FXDA 2A1SA 3GV5B 4DU4A 4MQ3A 3Q8RB 3RJEA 4CHZA 5KG0A 1O1WA 3QEWA 4KTQA 4Q45A 3H7IA 3V4IA 4BXOB 1ZQFA 3SV3A 1ZQDA 2BCRA 2G8HA 4TUPA 1WLJA 3PX0A 4DF4A 4UB5A 5KGWA 2YNHA 4ECYA 1U49A 4H4OA 2XY8A 4WE1A 2WOMA 2OPPA 4CF1A 4CFDA 4NYNA 4FLYA 1D8LA 4Q5VA 1VSIA 3H8JA 4ED7A 1N56A 4DU3A 1C7YA 4KHQA 4ED6A 3KHGA 4FJ8A 1PZNA 3C2LA 3HSTB 1HJRA 3RH5A 4M3YA 4QWAA 2OWOA 3LK9A 2AGOA 3U6FA 3OS2A 4RW6A 4CEZA 4BWMA 4P4OA 4DFPA 1JXEA 2G8KA 1ZQMA 2JEGA 4I2DA 3OS1A 4MFBA 3K58A 8ICQA 4LZDA 1U4BA 3MAQA 4KTWA 4DQSA 9ICLA 2HHTA 3O4NA 1X1PA 4AHVA 1WCNA 1ZQPA 4KLFA 4JRPA 3K4GA 3NDKA 1KRPA 3GIJA 3OGUA 1ZQXA 4J9OA 2O4GA 3UPQA 5K14A 4ICLA 4DTRA 2ZJ8A 4DSEA 3ZSWA 4FJMA 2ZQBA 4F8RA 4OLBA 3MDCA 5JS1A 1Q9XA 2BQRA 1YT3A 4B9TA 2BGWA 2X74A 3NF8A 1RDDA 3ITHA 4RQ1A 1SL2A 4KHUA 4M2YA 5CJ7A 2AGPA 1N6QA 1W9HA 4FLWA 4M3XA 1LV5A 4CECA 3RMCA 1G15A 3TFSA 1RDBA 4RW8A 9ICCA 1XSPA 1RNHA 2BCUA 8ICNA 4JS5A 2OA8A 5DQIA 5DB7A 4FJ5A 2PZSA 1KSPA 3K2PA 1NK9A 1TKTA 3HJFA 3DLEA 4QOZB 5HMMA 3AVBA 3NE6A 3IG1A 3LALA 4DTJA 3BQ0A 1S9FA 2HVHA 4IR1A 3DMJA 4YVZA 4CEBA 1YTAA 1COOA 3FDSA 3IHQB 7ICSA 3G6YA 1Z26A 2RDJA 1IO2A 1RTHA 4DOAA 2FBXA 4CJUA 4UQGA 2R8KA 4PGXA 2W9MA 2GUIA 3SI6A 1UT8A 9ICOA 4O5BA 3O3FA 5DMRA 1BQNA 1MSWD 3I8DA 2WTFA 4FO6A 3ZD9A 1BPEA 4XRHA 5DB8A 2EX3A 4ID5A 4M9HA 2KTQA 4E19A 5EWFA 4IKFA 4W5NA 1IKVA 3TAQA 3PMLA 3HP6A 5L1KA 1ZQWA 4GC7A 4N41A 3RB6A 4RUAA 7ICKA 3OYDA 5HROA 3JSMA 2NUBA 5KFMA 3C5FA 3RMDA 9ICEA 2IAJA 3T5LA 1JN3A 5KFVA 3NHGA 3CFRA 4JWNA 1S9EA 1REVA 4CIFA 4CF2A 1QS4A 2O4IA 3PO5A 3LPTA 1TKZA 4NY8A 2BQ3A 5L1IA 4R5PA 3PR5B 1S97A 3DLHA 3UXOA 2YNGA 4FLTA 1QLNA 1UOCA 4KHSA 4FZYA 1LW2A 3MFIA 1B22A 3T5JA 3B0XA 4YG2A 5HMLA 5DQGA 1CZ9A 1RXVA 4ELUA 2P6RA 4YNQA 3ULDA 4F3OA 1WSHA 4B9MA 3ASMA 4BDYA 4KLHA 1SUQA 3LPUA 5EOZA 3TANA 3AVLA 1SKWA 3DLBA 4K4IA 3VQDA 4QWCA 4CGGA 1ZQGA 4XA5A 5J0WA 4W5TA 4RQ7A 5DG7A 4E7KA 4IBNA 3T5KA 9ICMA 1F21A 3RB0A 4LD0A 4FJ7A 1RT6A 4M6WB 3SI8A 1RXWA 3V81A 4O44A 4R65A 3NFAA 3VQ7A 3M9NB 4W5QA 2OZSA 3ZSZA 3AU6A 1XHXA 1U04A 1TV6A 5KFRA 3DLGA 4P4MA 3VQPA 5BOLA 4ZTFA 5JUMA 1BPXA 5I3UA 1QSLA 3TAPA 1RTIA 4YFUA 1U45A 1TK8A 8ICHA 9ICVA 3LDAA 1ZQQA 4AHUA 1BIZA 1ZQTA 5KG4A 1RDCA 3QZ7A 4FW1A 1KFDA 5IIIA 1WAFA 5L1LA 4QWBA 4F50A 3AA2A 3MXJA 3KLFA 3HT3A 3Q8MA 3V9WA 3NGDA 4CERA 4OJRA 4KN4A 1WNSA 4FJNA 5HRRA 7ICLA 1ZQYA 7ICUA 1Z25A 3NAEA 4YP3A 4W5OA 2KZ3A 1RT3A 4DSKA 4GMJB 5KFCA 1L3TA 3VQ6A 2P5OA 1S5JA 2Z1HA 3OVNA 4YCXA 1X2IA 3EW9A 3V7JA 3K59A 4DSJA 4IG3A 3L2RA 1Z00A 2BHNA 1K6YA 4P4PA 4J9NA 3NH1A 3AO4A 4I2AA 2XCPA 2ASJA 4IQVA 3M8RA 3B0YA 4YR0A 4KKOA 3QEIA 2RDIA 1JLQA 4J9KA 4N5SA 3PX6A 1ZBUA 1EP4A 3OYEA 3KKSA 2ASDA 1KFSA 3AVIA 3LAKA 1RT5A 1WSJA 1LW0A 2F1IA 2B6AA 1QSYA 2BDPA 1FXXA 2VANA 1QE1A 1CXUA 4Q43A 3ZSQA 4Z6DA 1ZJNA 2DPJA 2ZUBA 3PX4A 5KFKA 1S1XA 3H4DA 1GOCA 5KG6A 4DQPA 2W9CA 3KLGA 2G8VA 3GV7B 4J2EA 4JWMA 4Z4HA 3CG7A 4W5RA 1S0OA 1ASVA 4BE0A 3JPSA 4Q8FA 2E4LA 1KLMA 3RTVA 3G6XA 2JGUA 4KLDA 3VQ5A 1U48A 1Z3EB 2VA2A 1DOQA 5FRNA 4BE1A 4NXZA 1A5XA 2JEJA 1JLFA 9ICTA 5FDLA 4RPZA 3C94A 4F2SA 3DRPA 1B9FA 3CQ8A 3ISBA 5KG3A 3WNGA 1TL3A 4ECWA 3C6TA 4ECZA 1NJYA 3JPOA 3K5MA 1ZYQA 4E1MA 5J2DA 1EXNA 5J2CA 1RBTA 5J2MA 2Z1IA 1GOAA 8ICKA 3CM5A 5KFZA 9ICRA 5KG1A 2A1RA 2HNZA 3M9OB 3GFKB 4NM1A 4PHEA 4HCBA 2V4RA 3QEPA 5DK5A 4O0JA 3L3UA 4J9PA 1KTQA 3V9UA 3MR3A 3AVGA 3KD1E 4FJGA 5C5JA 4KLQA 2OPSA 4XUSA 4M9NA 2HVIA 2HHQA 3AUOA 4FZZA 1JXBA 3F73A 3M8QA 2D5RA 3MECA 1BI4A 2VA8A 2ZE2A 2VG6A 3V7LA 1GOBA 3LP0A 4JLHA 3ZDAA 4CGIA 1EXQA 4FM1A 1ZQAA 3OYGA 2XY6A 1HMVA 4TURA 4B8CA 4ECUA 1JX4A 1S1TA 8ICYA 5T7BA 4DSIA 2FBTA 3JPRA 4QW9A 4IDKA 4K4HA 3QINA 3G6VA 1RTDA 4GLXA 1MU2A 4M3UA 4CGDA 1S1VA 4RNNA 2W8KA 4C8NA 4KHYA 2PI5A 2XY7A 2R8IA 2XGPA 4FVMA 2C2RA 1VSJA 4EZ6A 2ZTCA 2DFEA 3RJHA 8ICRA 4NCAA 2P1JA 3I0SA 3ISCA 8ICJA 4MFFA 3NH2A 4F5OA 1BPDA 2JZBB 4FJLA 4E1NA 4CJTA 2W42A 1BIUA 2P51A 4RT2A 4O9MA 3WNFA 1NOYA 2RKIA 1HJPA 4QWEA 8ICTA 3ZT4A 3OHBA 1Q9YA 3PY8A 4H8KA 3ZDCA 2HW3A 4PQUA 1RBSA 2DTUA 1QTMA 3LWLA 3B6PA 3EY1A 1RT7A 4DTXA 4KI6A 1BPBA 4BXOA 2ASLA 2HHWA 2Q3SA 4RU9A 7ICIA 4CJEA 4CCHA 2RPIA 3CM6A 3G10A 2W9AA 9ICKA 3KLIA 1RBVA 4O3OA 3SPYA 4KHNA 1RYRA 4TSXA 4CIEA 4BWJA 5DGAA 4LH5A 3CFPA 1IKXA 2XRIA 4TUQA 2V4QA 3LAMA 2BCQA 2MAXA 2MUTB 4FLUA 1XSLA 4CF9A 1JL2A 3DRSA 4DQIA 1W0HA 3KLHA 5DKWA 1ASWA 8ICMA 4UB4A 3MR6A 1T03A 4HUFA 4DG1A 3P5JA 5CB1A 4I2QA 2RF2A 4F5NA 4BACA 3FFIA 3OYLA 3V9XA 4DL4A 3M8PA 5J0TA 5J2KA 1XC9A 9ICQA 4KLUA 4DL7A 3DOKA 4QZ8A 3ISNC 5DDMA 3PW4A 1JXLA 3PNCA 2IOCA 1X9WA 4Y1DA 2ATQA 2OPQA 5FRMA 2XGQA 4RZRA 3QETA 4DLEA 4DO9A 1TK5A 3RMAA 3OYAA 1VSLA 5L9XA 2KZMA 4E7LA 2IC3A 4QW8A 4ED0A 4RW4A 3PW5A 4I2BA 3QIOA 4IRCA 4I2GA 1LAWA 1S77D 7ICTA 1S6PA 3BQ2A 1DTQA 4UB1A 3EPIA 4F93B 3S9HA 2OZMA 4Z4FA 3KK2A 5KFIA 2P6UA 3ZCMA 5KG7A 4CF0A 3BQTA 3ISDA 4CFBA 4LZGA 3E2EA 4YXJA 2GV9A 3M8SA 1JIHA 1TKXA 3ZSOA 4DTMA 4J2DA 3O4QA 2HMIA 1RILA 5HLFA 2HHSA 4Q0BA 3RWUA 1Q8IA 5CZ1A 3KIOA 1JL1A 4RG8A 3SV4A 4N56A 4DS5A 4GW6A 2P5GA 8ICZA 2PFOA 4GXIA 4I2JA 4CEOA 1KEJA 3CFOA 3OJUA 5C42A 2IBKA 2FMSA 3TI0A 4FYDA 4IQTA 5CR0A 4E0DA 3S3MA 1A5WA 5C25A 5DB6A 4F4YA 3PV8A 3KK3A 3JYTA 3RH6A 4FBTA 1YTUA 4Z4CA 1RT2A 8ICWA 1S76D 5D3GA 3B6OA 4OLAA 3CYMA 3BDPA 3IAYA 2OPRA 2FBVA 3D45A 3QLHA 5KFFA 4ECQA 4O5CA 4RW9A 4X5VA 4XQ8A 3D0PA 1B92A 4QZFA 3C5GA 4M3ZA 5DQHA 2AJQA 8ICAA 4RQ2A 4F3TA 4YMMA 4CJQA 1H38A 4O4GA 1HQUA 2Z1JA 3L2QA 1XS9D 1ZQSA 2UVUA 1UWBA 2DFHA 4I2PA 4DTPA 1RYSA 4FBUA 3NF9A 2ITGA 4FZXC 5FROA 1ZQJA 3TR8A 2KQ2A 4J9RA 1BQMA 2FMQA 4M9LA 3UQ0A 5HHIA 5KFOA 2KN7A 4M9JA 5F9LA 5KFDA 4QZAA 2IHNA 2R7YA 2FLNA 1VSKA 3DRRA 4E3SA 3OYKA 2AQ4A 2I9GA 4F4KA 4NCBA 3ZDBA 4M3WA 4KRFA 1VRTA 2GWSA 2G8UA 1QHTA 3JPPA 4YR3A 7ICEA 4N47A 3V9SA 4ELVA 2P66A 4F4XA 4ZTJA 4B9NA 7ICQA 1K1SA 4KTZA 1KFTA 1J54A 4Z6EA 4LH4A 5KI6A 4AHTA 5DLFA 4I29A 2W9BA 3HVRA 3S3NA 4ECVA 1ZQHA 1KVAA 1VRUA 7ICVA 3OYCA 4B9SA 3OYBA 3C23A 1L3VA 4DFKA 4I2FA 3SQ0A 1BGXT 4TQRA 2D0BA 4ECXA 4FM2A 1DGSA 4I2IA 1HUZA 9ICPA 3GILA 1WAJA 4F5PA 3AVFA 3TFRA 3V6JA 5J0QA 3ZT3A 3MGHA 4E89A 8ICPA 3Q8LA 1TVAA 5BOMA 2YV0X 4AHSA 4AHRA 1Y97A 1KLNA 5KT4A 1D9DA 4R8UA 2ISPA 4I7FA 4RQ6A 1S6QA 3KHRA 8ICFA 4E7JA 3HL8A 3LANA 3WNHA 4CK3A 4O5KA 1KVCA 2IS3A 2Q0ZX 3V1OA 4M42A 2W8LA 4HVJA 4QZIA 2A1JA 3VQAA 1ASUA 2F8SA 1IKWA 2FLLA 4I2CA 3PVXA 3AO3A 1CLQA 2YNFA 4NYFA 4CEQA 5CHGA 4KLEA 1AROP 4HUGA 3SUOA 4FS2A 3OSNA 4I27A 1SL0A 4RQ3A 1SL1A 5IIMA 3HVTA 1ZBHA 5DB9A 5J0OA 3GQCA 2BGGA 2ALZA 2R8JA 4YD1A 1FK9A 4G3IA 2JLEA 3MEEA 2LYHA 1NJXA 1RPLA 4OGCA 3QEXA 1J53A 1HQEA 4OGEA 3V6HA 2C22A 4CJRA 1VSMA 4F5QA 5HNKA 3K5OA 3QZ8A 4RNOA 1HRHA 1NK7A 3DYAA 1JLCA 5J0RA 3MR5A 3JPNA 9ICXA 3ZT2A 4DOBA 4IFYA 1D9FA 5KFTA 3RB4A 2HNYA 5CA7A 1T8EA 3DLKA 1ITGA 2G8IA 2J6SA 3HK2A 5L1JA 1T7PA 2BQUA 5HRNA 1HYZA 2WONA 1HYVA 4P2HA 3QEVA 4KMUA 4PY5A 5HBMA 5IINA 9ICHA 4MF8A 4NCGA 4CGJA 4ED1A 1HUOA 2V9WA 4CJSA 3QESA 3LP1A 4KAZA 3L2UA 2C2EA 4QZGA 4UBCA 9ICFA 3H8WA 2XCAA 4B9VA 4ECTA 1X9MA 1NJWA 3UQ2A 1MQ3A 3NTUA 1S0MA 3PW7A 5J0PA 1EETA 2ZTEA 2XY5A 1KDHA 3T19A 5J2NA 1HPZA 4E7IA 3GDXA 7ICPA 1QSSA 3PUFA 4DQQA 1N5YA 4EBCA 4AHCA 3IS9A 3BGRA 2FPLA 3V1RA 4CGHA 4CHQA 3LP2A 5KGXA 4CK1A 4IR9A 3KD5E 3C95A 4BGDA 3UXPA 4B08A 1BCOA 1EX4A 1WSEA 4YQWA 2BANA 4EBDA 1BI4B 2VG7A 1FKOA 1FKPA 2PYLA 4CJ3A 3IRXA 3C1YA 5EWEA 3TAGA 1NKCA 3T3FA 5HHHA 3ZSRA 3KK1A 4KHWA 4JS4A 5DGBA 3P83D 1NOZA 1KCFA 3SYZA 2ETJA 3HPHA 2JEIA 1JLBA 4ELTA 4LSLA 2FMPA 2X6NA 1ZQNA 2HNDA 4RQ0A 5KTQA 4RPXA 8ICEA 3TABA 1V9PA 5DDYA 4LVSA 1TVRA 3AA4A 2YHBA 2B4JA 2B5JA 1NK8A 4J2BA 4ID1A 3BQ1A 3EYZA 4CJ4A 3A2FA 3EZ5A 4M3RA 2PFNA 4PUOA 3V6KA 2BCSA 1EKEA 4DTNA 1TAQA 3L8BA 3L3VA 5J2QA 3RJFA 5DBBA 4PH5A 4RQ8A 3ALYA 4J9LA 4C8OA 4FS1A 2BPFA 4CHNA 5DBAA 1J9AA 3ETLA 1IG9A 4CJWA 1S0VA 1VSDA 1LB2B 2DFFA 3KKRA 1SKSA 4KLOA 1VK0A 3OYHA 3ZSYA 4M47A 1NKEA 4KN7A 4DFJA 9ICGA 1S0NA 1JLAA 3AVHA 4FM0A 5KT2A 3AA3A 3AVCA 2NRWA 3T1AA 4JV1A 3PMNA 1ZQVA 4KFBA 3RBDA 1RBRA 4M45A 3C21A 3HYFA 5SZTA 1ZBIA 5D4BA 2JZBA 4GVMA 2MUTA 4EZ9A 5DG9A 3MGIA 4F5RA 3SNNA 8ICOA 4MEYA 4FJ9A
chains in the Genus database with same CATH superfamily
3CJSA 3TSQA 2EZYA 4NZ6A 3CQXA 4CHOA 3Q8KA 4IQWA 4M41A 3W0LA 5FPDA 3BKFA 3S8SA 4CF5A 4Z37A 1T05A 3CCLN 3SQ1A 3K17A 5KFQA 4OZ2A 4F91B 3O3GA 4OHZA 2DO4A 3HD2A 3SUPA 2RMLA 2OSRA 2Y0SD 2Q3PA 4QS9A 4P6QA 2KHCA 5CA5A 4FJIA 3TQ1A 2YMQA 2AX0A 1SWVA 2DNKA 2R7UA 4OYOA 3PJXA 1GMWD 4KX3A 3UE5A 3M3ZA 2F8EX 4BRMA 4FJXA 2VJVA 5SWMA 5CD4A 1CJUB 4DU1A 4TLQA 4G6VB 4FNIA 8ICUA 3Q8YA 1UWAA 3POTA 2OCEA 1ICEB 4PHDA 3IG8A 1P9QC 2D9PA 2ZH5A 2BR0A 1B0PA 5IOLA 3KLEA 2EFNA 3TA2A 4C8LA 1VQLN 1YLXA 3I6PA 1FTCA 5IZHA 2RRBA 1UPHA 4R63A 2CXEA 1DK3A 1XQIA 2VWJA 3TAEA 1EQMA 2HOQA 1ZQCA 4O23A 4EI2A 2W11A 1KXPA 3G8QA 3MF5A 4Z4GA 2QARB 3N7PD 8ICVA 3FZ2A 3K1ZA 2HKEA 2CDRB 2E66A 4FK2A 3H08A 3J7ZO 3PTWA 2H3IA 1L7NA 3CC2S 3SCXA 3LDQA 4Y00A 4I1TA 1X40A 1VC6A 4IQUA 2XHCA 5C25B 1GFWB 9ICNA 2EG2A 5FP0A 4FSVA 3BZKA 4ED3A 3JYTB 3MEGA 3EE9A 4CJVA 2IA6A 4WFNQ 2R8GA 3F5EA 8AT1B 1EX8A 3I0RA 2ALYB 1VC5A 3ZT1A 3H5XA 4FJHA 5AE3A 4JV5F 4DL3A 3WK6A 5ALGA 3QDKA 1KVBA 4CW7B 1BCMA 3TUZC 3ZEUB 2UZAA 4PL7A 4RW6B 4CDIA 4GNIA 2WAQF 1WI6A 1N61A 3EUNA 1GXTA 1QTNB 1PCAA 2ZEJA 4LF9K 3IWNC 4I2HA 2CXYA 4DR4J 2AT1B 4RKUC 4WYWA 1TFWA 2O8EA 3HSDA 2BE2A 4OPJA 5AM2A 3H3NO 2MJNA 4LBIA 5F2RA 3I56N 1WG5A 4ZMMA 4G1QA 4FLXA 4C48A 2WRMA 4DSFA 1R6YA 3RU0A 5KQ8A 5D8HB 2K8GA 5AQKA 4PGQA 2CIMA 1LWCA 4NM2A 1NXIA 4K8ZA 5HMZA 2VA3A 4OZ5A 4U95A 2YKQA 5JS2A 5GMKa 3DM2A 2VONA 2DRDA 4BQZA 2A1JB 2X78A 5ALNA 4EYIB 3HVAA 3NGZA 1SBRA 4ZP6A 1CZBA 2DGWA 1OYDA 4LF5J 2J8AA 1I1GA 2NNWA 2IDOA 4O0IA 2B21A 1M1HA 4PJ0U 5KFBA 3NEKA 2KRRA 3VF6A 2FPKA 3SQGA 2UUTA 3C46A 5CZVA 4NLPA 4QZEA 4K2XA 1VLOA 4O8UA 2IGIA 4NASA 3H8YA 2P2CB 3CP8A 2I5HA 1LCUA 5ALKA 1V97A 5HMWA 4OPKA 3DOMB 2P9LA 1KAZA 4BX9C 3V9ZA 1V4SA 1G3OA 1W2BR 4YEAA 2E29A 3GIIA 3FZBA 3RR8A 5A2QO 4DPOA 2HQ3A 3IBWA 4QZ9A 2B9EA 1C1AA 3MABA 1LW2B 4B3OA 3L9ZA 1B43A 3HOTA 1URRA 1D5AA 3ITHB 3QRPA 3CMQA 3KHLA 2C2DA 4ZLNA 3J81j 1T9TA 3T1HJ 3F44A 3MPWA 4JI6K 4NLKA 2NZCA 1VQMS 3CD7A 1QHAA 2F9WA 3VGUA 1JKHA 1HHQA 4WKYA 3F9KA 4FK4A 4LBHA 3H8MA 2WB1D 5KNIA 1S8OA 2VYPA 5J0UA 2PT0A 3A3OB 1BHLA 2Z30B 1SC4B 3L7UA 4JI0K 9ICSA 3H4BA 4FK0A 1TFRA 3DLEB 3ZSXA 3AA5X 2MZSA 4UB2A 5AZIB 4KGZB 4I6YA 5J0YA 4LF2A 4K4GA 5ALZA 5B0BA 4KBOA 3BYPA 2OHDA 3BS5A 4P73A 4NA2A 2MZJA 5KFYA 4WP3A 1OJ4A 2B9XA 3NAIA 3T1YK 2YX4A 3ZZOA 3MAAA 1DHMA 1WSIA 4FWNA 1GLBG 2XNQA 1XMOJ 3CCRS 4XIUA 5I42A 4HUEA 4RR5A 2E1CA 4M7XA 3GYNA 4OIXA 4K59A 4C7ZA 1M5SA 1L5UA 3OJSA 3ET6B 4OZLA 2XHBA 2FY8A 2R7WA 2PBDA 4DLGA 1R6VA 1JLBB 5DG8A 1RT6B 1AXQA 2R7RA 5IIJA 1ZQOA 2OKQA 3H45C 3S3OA 3J80Y 4F3QA 3I55S 1FWPA 4MTPA 3IP4B 3ILLA 3KXDA 3K9JA 4EBEA 1ZBFA 4EEYA 2HFSA 2IVOA 3ULEA 1SVDA 2Z58B 4OI6A 2FC0A 2WBMA 4OJHA 3ZXWA 1C0MA 1WSFA 4KHPF 4WIIA 1CZAN 3H5UA 4CO2A 2A6OA 5KFSA 3K5LA 1WB9A 5E26A 4DV1J 4YDDB 2A3VA 5J2NB 4FJJA 4KRWA 4ZPTR 4UAZA 4WFXA 4L8RB 2OTLS 4ISGA 4EIAA 4YOUA 4IJNA 2K2PA 5TISU 1DT9A 4Z6FA 4UAYA 4QIGA 4DR6J 4PABA 3W65A 2D1KA 2ZXHA 1Q7LB 2W40A 3IC1A 8ICBA 4DCHA 2KYZA 4CD3A 2WSFC 3OW2R 1SUQB 3V1QA 2APOA 4Y0FA 1ZQRA 5KT7A 1FJ7A 4GMKA 3GMGA 3T1HF 4MKBA 3PSIA 5J29A 2OYQA 3GONA 1D3WA 3G96A 4DUYF 3UMCA 3J7YU 5J0SA 4MF2A 4KV8A 2FSNA 2BA9A 3CJ2A 2PMZF 3D9BA 3SQGB 3G6EN 3UXNA 3NF7A 4Y2XA 3AVJA 3OYIA 7ICMA 4XAKA 2MKIA 2Z2MA 3U26A 1X9SA 4A8OA 1DEJA 3PIPQ 2DR8A 4NE9C 2V2QA 3DOMA 2Q66A 5J2PB 1TK0A 2E2NA 4IEIA 5BREA 2CPZA 1Y0HA 3CNHA 2VZ9A 1U0HA 1P1LA 2VKQA 4A59A 3QMLA 3E3XA 1KL9A 3FK4A 4F92B 3QQCD 4LIRA 4XH5A 3IBCB 4JI5F 2YKNA 2KM8B 4YB5A 1KVKA 1S7HA 3WQUA 4YFKA 3AAQA 1CRXA 2HGNA 4DV2F 4YOEA 2W9CB 2GBZA 1UA0A 3GR0A 3OYFA 4B9UA 1RABB 1VDVA 1F5AA 1WSVA 4NLUA 3AV9A 3IKMA 4M9GA 3J7ZT 4KB1A 4NJ8A 3DHXA 4WBFA 4QJFB 1URNA 3EEQA 2HBRB 2B8PA 3CCUS 2QKKA 5KT3A 2KFNA 1R43A 4TY9A 3JAMU 4TQSA 2R18A 3HHLC 4Z4EA 1ZJMA 1PVRA 3JQJA 4GXJA 5HP1A 4V19X 2EHGA 1QVFR 4DFMA 1X3NA 3H40A 4PPXA 5ETPA 4FZVA 1WC0A 3UDEA 5E41A 4U8VA 1S72S 1CC8A 4IH7A 1XI1A 1EP4B 1SIZA 2UXCJ 3KJFB 5LMNF 4DMNA 3MD1A 3DXSX 2K7JA 3CPWR 3W2VB 3RMBA 1HNZF 5ALRA 2DCLA 3PZPA 2O3DA 1U2RA 4RPYA 2NPFA 2QFIA 3BGFA 3NNAA 5LMUK 3IGVA 4CIOA 1OO0B 1WOSA 2CJQA 3NGRA 1ZTWA 4AH9A 3C7NB 5D46A 3PYGA 1MU2B 4V19S 3NAHA 3WK5A 1UAXA 4EFAC 3AJ1A 3WK4A 2VDHA 3RRHA 2F3JA 1TL7A 3HX0A 3VQCA 1K44A 4XTTA 5BRFA 2OPSB 2XVTA 1NBWA 3QATA 3UN5A 4LSNA 4B8AB 2ZG6A 3PRVA 4OQJA 3DI6A 3AA8A 4NLTA 1HWIA 2YNGB 3J81Y 2MEWA 4G9ZA 4NPOA 3CI5A 4FLZA 3UI3A 4FXDA 2KJWA 3Q8RB 1RAFB 1KAYA 4K4UA 2GCFA 1O1WA 4DV3K 1C0TB 1D9AA 2PMWA 1TUWA 3V4IA 1SS6A 3CCES 4WFNL 4TUPA 1Y11A 4UB5A 5KGWA 4B3TK 3QU2A 5EX3A 1DARA 2BZ2A 2HFUA 2OPPA 2WOMA 5RUBA 2ZM6J 1HNWF 1SAZA 4LJXA 2RHKA 4Q5VA 3DCAA 4WTOB 4ED6A 4FJ8A 2BTFA 3P45B 3C2LA 1HJRA 2W6LA 3U6FA 1TL5A 2GO8A 3H0MB 1NH7A 2A19A 1A9NB 2G8KA 1QVGM 4A8EA 1JJ2R 1N63A 4ES2A 4I2DA 3ELHA 3TX0A 4M5NA 5GAHP 3OS1A 3SMVA 2A1AA 2XM3A 1V5VA 8ICQA 2V8GA 3H90A 4MDAA 2PA8D 5A0LA 1T9VA 4WCEL 4CTAA 4CBXA 4V1Ak 3DLGB 2Q36A 2QWQA 2HHTA 2RQKA 1RZMA 3BS7A 3BM7A 5HQLA 4FOEA 4JRPA 3NLCA 1HNVB 4NXNJ 3RUBL 3C29A 5E3CA 3OGUA 2CDQA 1Y3KA 4J9OA 4DV3J 3M6GA 2YJEA 2ZJ8A 3A13A 2ZHOA 5JS1A 4B9TA 2D3UA 2YKNB 4GKJJ 3EE8A 2AF6A 1N6QA 4EGLA 2MZTA 4FLWA 3N79A 4CI0B 2ZGYA 3BEGB 3TFSA 1YJWN 2BCUA 5FLXU 2MKSA 1SV0C 4F36A 1HEKA 8ICNA 2CQ4A 4JS5A 3UMGA 4FJ5A 3DXKB 4WJ3B 2BE2B 1EJ7L 3K2PA 1NK9A 5F8JA 2FGOA 2XWYA 3AVBA 4KH4A 1S9FA 3MM5A 2CPDA 2JFKA 2UU9J 1LQ9A 1FE4A 2RKIB 1J5EF 3AXKA 2CQCA 1COOA 1YI2S 5A8KB 2F77X 5AK5A 1RTHA 1WORA 2R8KA 5LY3A 2O8FB 3CJBA 1UFKA 3DM2B 3ATUA 2KIVA 3T1YF 4KH0B 2OLWA 4JD2A 3HRGA 2J9DE 2WTFA 4CZIA 3W2VA 1H2VZ 3ZD9A 1BPEA 5DB8A 4M9HA 2KTQA 2XMUA 4E19A 4IKFA 4L3QA 4W5NA 3TAQA 1JJ4A 4DCCA 2PMZC 3OYDA 3GU3A 2DBBA 3R2DJ 1U24A 4Y2KA 4WFBL 1JNZB 2M52A 1VQKS 3NHGA 3NGUA 2JRSA 1IBLJ 3CFRA 2I38A 2V68A 1TFYA 2HG4A 2HLUA 4CNZA 2O8CA 2I7NA 4YDUC 2AJFE 3KVGA 2NRRA 5LMUF 2KT3A 1NZ8A 5EVZA 4CF2A 2O4IA 3PO5A 4B3RK 2BQ3A 3KMSA 5F3XB 3PR5B 1S97A 3Q0AA 4QYZK 5J1NA 5AM1A 4F4AA 2YNGA 3IAM9 3CEDA 3HHNB 2IJFA 2OHFA 4LF6J 4FZYA 1LW2A 3T5JA 2IJNA 2H65B 5ALUA 1Y7PA 2EZXA 3LO3A 3DV9A 3UM9A 1HA1A 4ELUA 2P6RA 1PBAA 3HFVA 4F3OA 3HSZA 1VQYA 3IFRA 4GFJA 4MO4A 4B9MA 3ASMA 1HKGA 4KLHA 3CCUN 3X3UA 4OI4A 3LPUA 3D6HB 2E9TA 3G87A 3PIPL 3P39A 2MQLA 4NMLA 3ZFVA 3UW1A 1F21A 3RB0A 1VQKN 4M6WB 4B3MK 1RXWA 1DJ0A 4O8KA 3UCGA 3ZC4A 3LF0A 4O5FA 2JC0A 3VQ7A 2K3KA 4W5QA 2VICA 1NZBA 1PYTA 2E1RA 5DS7A 4QZVB 4M5IA 3DLGA 3VQPA 1YZ6A 2E9ZA 4UY8O 1BPXA 4UASA 1QSLA 4JHDB 1JJCB 3TAPA 5AQPA 4US8A 4YFUA 5I42B 1Q18A 4ES3A 1U2VB 1Q81T 9ICVA 1KBUA 2ZIVB 2GGPA 1XMBA 3OXLA 2HOFA 2BJ7A 4AHUA 1BIZA 1XR5A 2F4VJ 3H0PA 4FW1A 5IIIA 1L8OA 5ALTA 3ZYYX 1WAFA 1EO1A 1J2VA 3SIPB 3HT3A 4JI6F 4HT5A 4TXSA 4CERA 4OJRA 1WNSA 4PWDB 4H5NA 3EJMA 1ZQYA 2HS3A 1Z25A 2DNNA 3FMBA 4DSKA 1L3TA 5F1XA 2GHWA 1NJIO 1IN0A 1S5JA 2BUPA 5JU5A 2ZZMA 2HHPA 2H48B 3VERA 3K59A 3M8WA 4JI3J 4IG3A 4FZLA 2QA1A 1Z00A 3D54A 4J9NA 1TZ0A 3AO4A 1BE4A 8ATCB 4DR3F 1FNOA 2O67A 3S7RA 4ED5A 4RLEA 2DGXA 1JXVA 2QEXN 3B0YA 2DIUA 2IDEA 1JK9B 4AL5A 4Y6IA 3FEXB 4DDFA 1S57A 4A62A 1ZBUA 1EP4A 4JV5J 3OYEA 3KKSA 2ASDA 4KGKA 1FWKA 1U2CA 3ZLJA 1RT5A 4DX8H 2VHGA 3G6ES 1WSJA 2F1IA 4X64K 2BDPA 2GQQA 2QA4S 1VQNN 2VANA 1YBTA 4Z6DA 1S6OA 4CZCA 2DPJA 3MMCB 2O8BA 1S1XA 2JHDA 5KG6A 2LA6A 4ITSA 2AH5A 5ETTA 3D1QA 2WONB 4EENA 4J2EA 2XI9A 4P0PA 5HBMB 3R5DA 3CG7A 1XBWA 2MQOA 3OTOK 1QQOA 2HOEA 3HHLA 2O8CB 5D4NA 4JK9A 5AQWA 1F44A 1YRTA 3DRXA 2G1HA 2VKRA 1G99A 3UPFA 2VA2A 1DOQA 3EGZA 2BACA 4BE1A 3UNYA 2RILA 3DXMA 2KJVA 2F9JA 2BE7D 1VQ7N 5H9FJ 5C0YA 1RACB 4RPZA 3MM8A 3DRPA 4BC2A 3ISBA 1EKRA 2VOPA 1Q5YA 1NGFA 4LBPA 2X1AA 4RUBA 1D09B 4ECZA 1NJYA 1OY9A 4ZVUB 3I5AA 3K5MA 3MI7X 2IYGA 4NCGB 1FVQA 4E1MA 1BXNA 5J2DA 4MYTA 1LK7A 1EXNA 2XZWA 1K0TA 5FPEA 2K4IA 3KKFA 4ZP9A 1GOAA 3S01A 3CM5A 3F9MA 3SXLA 1UETA 2CQPA 2A1RA 4PHEA 2GAHC 3FEZA 3PLAA 2HRTA 4HCBA 2V4RA 3QEPA 4RUHA 1S49A 1PILA 4J9PA 2OANA 4WFBQ 1T6CA 3V9UA 5EE1A 3MR3A 3BGRB 5D77A 3CD6N 1S3XA 5AT1B 3A5OC 1WHYA 1PBUA 3SDEB 4QQBA 5JLFA 2XMAA 3F73A 4EK2A 2D5RA 5LL6d 4X4OA 1BI4A 3TU5A 2ZE2A 1N2XA 1HR0K 3FCWA 3ISZA 1FTRA 2KB2A 4JLHA 4IFYB 3VGTA 2VFRA 3ZDAA 1VQ6S 1WEYA 2HNYB 4FM1A 3OYGA 2XY6A 1HMVA 2E5LF 1S1TA 8ICYA 2Y1RI 3EWGA 2F8KA 4LFBF 3DDHA 2G09A 2WHEA 1UEVA 4QW9A 5AE2A 2LFVA 2V8VA 4GLXA 1MU2A 2EW9A 4M3UA 4CGDA 2PI5A 4AQYK 2YTUA 5IC4B 2CQ0A 2XGPA 2DH7A 2DFEA 2FE9A 4JI1F 2P1JA 1RQ0A 2MKYA 4MFFA 4DR3J 1RWPB 2DISA 4MIBA 1SXLA 3DI6B 2JZBB 2VFTA 4FJLA 3P38A 3ZZRA 3ZZPA 4CJTA 2ZVSA 4RT2A 3UN3A 5E84A 4QWEA 4X66F 2E8NA 1DQ8A 2KH9A 2FXUA 3OHBA 3OVAA 3CULA 3BGOP 3ZDCA 4PQUA 3U4LA 2DTUA 1GLJO 3EL2A 3IFEA 4JKFA 4BXOA 1MA9B 2EWHA 3VEXA 3MM9B 4DV4K 2HHWA 5I3QA 1YRXA 2DT9A 4CCHA 3H25A 1NGDA 4USIA 1J27A 2W3RA 3M2RA 3AOAA 4DI6A 4LFAK 4LF4F 4CZMA 3W64A 5F41A 4TSXA 4OLPA 5DGAA 1FEZA 1EARA 3FSXA 2CGLA 2MZ1A 1IKXA 3LAMA 2VPXB 2MUTB 3HILA 3MN7A 3THWB 1XSLA 3O8WA 1WKKA 1W0HA 2EFPA 4DPTA 4ZITA 2DGVA 3KBBA 4G9BA 1OIAA 1J6ZA 1OYEA 5F3ZA 3WU2U 4KHPJ 2RF2A 3VZIA 1WSRA 3OYLA 1PSDA 3V9XA 4BR2A 1FFGB 4I6MA 3QNWB 4MLEA 4TU7A 3O5BA 1JNRB 1XC9A 1JJ2M 2G0JA 1FXDA 3DOKA 4QZ8A 5DDMA 1JXLA 1FO4A 1VQ8S 2JOQA 5EE0A 2HAIA 2FLOA 4AD6A 4HI2A 1Q81O 2ATQA 3WXMB 5FRMA 2XGQA 2DWQA 3FZHA 2DBYA 2HIYA 4E7LA 3NCQA 4QW8A 4MKYA 3R9PA 4UY8T 4ZKAA 3M1YA 2IRYA 3QIOA 2VOOA 1LAWA 1S6PA 3BQ2A 3MR7A 2I6WA 4F93B 3FUYA 1KD1T 5LXYA 3WDOA 1YWXA 4A8WA 3AMZA 2FHOB 1K0VA 4KGXB 3BO4A 2L9WA 5CYJA 2EBEA 2GV9A 4YHHF 2XWXA 4DTMA 4J2DA 2XHWA 3BSCA 5HLFA 4Q0BA 1HBUB 3TEHB 2QARA 1RLDA 5CZ1A 2W4CA 1BWVA 1FKAF 1S1UB 1MNEA 3SV4A 4DS5A 4K0KJ 2PFUA 4OV6A 1KEJA 3K1RB 1P8GA 5EXWA 3B82A 2IBKA 1PYSB 5IT9O 2Y0SF 3TI0A 4IQTA 1TUGB 1ZAWA 4X66J 3PV8A 3GSIA 3KK3A 1Z19A 4JKEA 4XPCA 3TVKA 2KXFA 3QSYB 2FPHX 3MCAB 5D3GA 4FKYA 4OLAA 2FBVA 1VLBA 2HBJA 3QLHA 5AQOA 1FRHA 5KFFA 1UZHA 4DV7F 4WQ4C 1S1TB 3IXQA 2HYIB 2V67A 4I6WA 3N0VA 3BYRA 4QZFA 3C5GA 2M88A 3E9PA 2ZJQL 4K7QA 3HKZF 2UXDF 1N34J 4JB8B 2HVEA 2RVJA 4DU8A 4UF4A 1FDAA 3GBTA 4F3TA 2PA3A 4Z7YA 2EAPA 4CJQA 1H38A 3ID6A 1JLGB 3AB4B 5EHHA 2KKHA 4IG3B 2G1DA 4P2XA 4I2PA 2NO5A 2UVUA 4LF1A 1RYSA 1CS4A 1IVZA 4FZXC 2GC8A 3AXMA 1NHUA 5BPNA 1BQMA 2AWZA 2W2NP 1YJRA 1OMSA 3ZX0A 4M9JA 2DR5A 4CZFA 5F9LA 2XQCA 5CEHA 5KFDA 4M5HA 1ZAVA 3HX9A 2RT3A 5HAOA 2HAFA 4PQUB 1VSKA 3M8ZA 1VHIA 3WT0A 1UJ5A 4AL7A 4JKHA 3B4MA 3NUQA 2AQ4A 2Z0GA 1PO6A 4OX9K 4F4KA 4NCBA 1RT7B 4DUZJ 5ETMA 1TAMA 2FJVA 1FO1A 2LKZA 4CO0A 4M8LA 5IM0B 2BEFA 3HF5A 4Z7CA 2JVOA 1IUJA 2MKJA 3CIMA 1MWZA 1RDUA 3VEYA 4N47A 5IT9U 3V9SA 3MMCA 1UEKA 1RHRB 1IQTA 2M8HA 4P74A 3VGLA 2W2OP 3BBFA 7ICQA 1K1SA 5ALHA 4Z6EA 1HWUA 3QPIA 1HBOA 4H03B 1ZPWX 4CLFA 1KVAA 5AQNA 3GL1A 5EN1A 2KD1A 3SSSA 4B9SA 4UAVA 1L3VA 4JI3F 2QRRA 2XS2A 1BUXA 2RF2B 1QVFM 1N32J 2P9LB 3MMJA 1HJOA 3TUJC 1QJHA 4MYUA 3RYLA 9ICPA 2LA4A 1JLEB 3TFRA 3F0NA 3QFHA 2DHXA 5KAIU 3F5TA 3MGHA 3KHYA 1I51B 5D0RA 4OX7A 4KHMA 3O0FA 1Y97A 5B0CA 2ISPA 4ZLPA 3ZTRA 2W2QP 1AYEA 1S6QA 8ICFA 4B6JA 3EGWB 3JTNA 1TL4A 3IBFB 1RKIA 3I55N 4KY3A 4ZCLA 3B54A 1URJA 3MWTA 1LEOA 2FLLA 4FVCA 1NPPA 3GE1A 4FWKA 4I2CA 2K4HA 3D2EA 3M1VB 2ZHBA 4E8UA 4IOAL 3SCIE 1SC3B 4FS2A 4AYBC 5B08A 5HOOA 4BRIA 4PXEA 2L9DA 2X3DA 4FFDA 3OL8A 2HDOA 5DB9A 5J0OA 1YF5L 4UAUA 4CO5A 2H3FA 4QR1A 1N8RT 5AI6A 4LRFA 1SIWB 2F7TA 1RPLA 1HQEA 1J53A 1OWXA 2CJYB 2VQEJ 3V6HA 4WF9L 2CVIA 5HNKA 4PL8A 1JLCA 2Y3YA 1VQ9S 5J0RA 3MR5A 5C2CA 2HVZA 4JBCA 3OBYA 1WYGA 5CHCB 4BR0A 3C14B 4ANCA 2QT7A 4FF3A 4DOBA 1BY9A 2C3OA 3LUYA 2K8CB 1N8RO 3E51A 3KZXA 4A8SA 2HNYA 3GCXP 4BREA 2BQUA 5AQIA 4X65F 5AQZA 3GJQB 1HYZA 1U6FA 3PSPA 1HYVA 3V5RA 5BYRA 3AOCA 1S1VB 1PG5B 1MLAA 1SPBP 3T69A 2FY1A 4G1IA 2YQ1A 4R25A 3CCMN 4IO9L 3LP1A 2NXJA 1WDDA 3L2UA 2GH1A 4UBCA 4LF4K 4DUYK 1VQLS 3D0IE 1X9MA 3L09A 1HNXK 5LSLA 3NTUA 1RAHB 2XY5A 3T19A 2CAJA 2VH7A 7ICPA 3SAHA 2XSJB 4LF5K 3PUFA 2WF9A 4CZLA 4DQQA 4EBCA 3AM9A 4BRDA 3V1RA 3G82B 5DJBA 4X66K 4IFEA 3LP2A 4CK1A 3KD5E 3L7PA 5ETVA 3UXPA 2DEIA 1VQPN 4NOHA 1FKOA 2VG7A 4IWVA 2AD9A 3OTDA 1MG7A 3SMZA 1NKCA 3AQPA 1IKXB 1VQON 4DHYA 5K4LA 1NAQA 3T6BA 1QCKA 2FB0A 4IH6A 2BRLA 2N1RA 1NDKA 3D3CJ 1TVRA 3AA4A 2B4JA 1BU6O 2QG9B 4J2BA 2MGZA 2AIRB 1P8ZA 2IIRA 5AIBA 3RAMA 3EYZA 3CMAN 5DDOC 3OXFA 5B7WA 4PUOA 3Q86A 1QAYA 3NS6A 1TAQA 4JNEA 3L8BA 2OTJS 3FE1A 6FD1A 2K8AA 2OPQB 1XNRK 3IA0A 5DBBA 1E6YA 4J9LA 3PYEA 3F2KA 4CHNA 4M5JA 4C3MA 4GV6A 5AKXA 5DBAA 2DK2A 2P6TA 3ETLA 3BEXA 1IG9A 1S6QB 4CJWA 2GOLA 3T6JA 1VSDA 2QW9A 3MWBA 1RSCA 4KLOA 2P35A 2YWGA 2AYMA 4JI2K 3ZSYA 3PFOA 4MIWA 2L5YA 5AQRA 5ADXA 1PUZA 5DM6Q 4IQMA 3AVHA 1SB6A 1KN5A 3M1VA 4WXWA 2P9EA 3WQPA 4AYBF 1DY3A 3DLLL 4IFVB 2DGOA 3C21A 2G07A 2LYBA 3OW2M 2JZBA 2MYFA 2CFXA 4EZ9A 1F5SA 2VBZA 4WK3A 2DNOA 4GY2B 1FA0A 2E5HA 2KM8C 3LDLA 3KLHB 5BPCA 2WBRA 1K8AT 2XZTB 5KFGA 5ADZA 5C42B 3TAMA 5G4DA 3MXIA 1R27B 4OHWA 3HM8A 1NM2A 2AJ0A 3TOQA 4RUCA 2QEXS 2BV3A 1IKYB 3O3HA 1RCXB 2LVWA 3AO1A 4E1JA 3PRBA 3JPQA 1RBLA 4C2MA 4U9RA 3AU2A 3GJRB 1FFVA 4KLJA 2A3ZA 2HB5A 5ALFA 1Q86O 4CJLA 2LBOA 2R42A 3C14A 1XMOF 1HD1A 3C2MA 1MQ2A 3LP3A 3DGVA 3EVOA 2ABYA 3K9KA 2RE2A 3Q8QB 4B1WB 1M5HA 5TZVA 3PO4A 2ZUDA 3WEEA 1Q95G 2MQ8A 3FBEA 5ITHA 3KKAC 3NP5A 4DN0A 1T03B 1EB0A 1KP6A 3O44A 3UD4P 4ZHRA 3GIKA 2QMXA 4X4SA 2R8HA 3LVWA 1JLGA 1DGKN 3NS7B 4M5GA 3R5AA 1R8PA 1CS4B 3WNEA 3BY5A 1NSKL 1GNKA 1L7MA 4JYAK 1RG6A 1GMUA 3OV7A 2YKMA 3W60A 1XWLA 3FRYA 4MFBB 1QVGR 3DDIA 3AVNA 4BDZA 3QIPB 5IQ6A 3OTQA 2Q4TA 2XB2D 2VG5B 4RQNA 3G82A 1X9XA 1C0TA 1O6XA 2ATCB 1ZD2P 3V4IB 5E5NA 1YHQN 2ATLA 4HYKA 2D3OR 5IM0A 1J5OA 1TKDA 3IMXA 4H4OB 2OPPB 1NDLA 1L7PA 3U9ZA 4TUSA 3R1HA 3CJ5A 1WSGA 3KDOA 1GMWA 4DR5J 2IHMA 3BH7B 2PEBA 2FJBB 3GIMA 3VA0A 3TO8A 2NUUG 2MMYA 4KLTA 1U9LA 3FQLA 4CHPA 3OT9A 4J9QA 2NZTA 4ILRA 5AZJB 1Q16B 4ZPAA 1F6TA 4QR2A 2JLGA 5AKJA 1UHUA 4DOCA 5CQGA 4FLVA 2UU9F 2J76E 2MGZB 5AIAA 1X0FA 1UJ6A 2Y1IA 4TLRA 4FWPA 4B17A 1LKZA 4K5RA 4DTUA 4CJFA 2MXYA 4CLYA 1RBUA 3KWGA 1HYSA 1NBEB 4L76A 4LR7A 2W1BA 2E6MA 1VJQA 4OKEA 5K14B 5KFEA 4KBIA 2GW8A 3QJLA 2IY5B 1QZ6A 1AFIA 1BVSA 1BO5O 1NKBA 3NVZA 2WAQD 4Y2QA 5AQVA 5J2BA 3MBYA 1U09A 3WXJA 7ICOA 3N01A 1RDRA 4A5AA 1KS2A 1T44A 1XMQK 5GVQA 3VN5A 4JV0A 1KEKA 2D0AA 4HTUA 1NLVA 1K8KB 3EZUA 1KAXA 1LAVA 1ZZNA 1XR6A 1T11A 4DCOB 4CRJA 4OKKA 3QEBZ 2K1RA 3TX8A 3TARA 1KR4A 5D4OA 3C6UA 2YB4A 4QZCA 3T79A 3SFUA 1IM4A 2NS1B 1Y5LB 3PR4A 2VBWA 2YNIA 5CH7B 4QCLA 5J2IA 3J81O 2LEBA 3FCHA 2IVPA 5KFNA 4KREA 2NV3A 5H9EK 3C3LA 1VQ6N 3PEJA 3MUMP 2Q0RA 1IH7A 3OBIA 1JALA 3K2YA 3UB5A 2W54A 2YHWA 1HKAA 2VV5A 3DWLA 1XSNA 2LQJA 3I5CA 4KB7A 4DTOA 1TKZB 4IRKA 4PL1A 1JLCB 1OPIA 1OQ6A 1L8LA 1C0UA 3EVWA 2AV5A 3OFHA 4FYVB 2VQEF 4JI1J 1ZQ1C 1E6VA 4J2AA 3G8SA 3J7A1 1HBNB 2DNQA 1C4AA 3ZD8A 4LT6A 4F2RA 2ASPA 2BOAA 4YMNA 2KHDA 1YJ7A 3VTIA 2FI1A 3P8BB 1C2PA 4EO6A 3KMQA 1L3SA 3CO9A 4OJ3A 4P71A 1TGOA 4WPAA 4CE9A 2I1QA 4MKVA 2B43A 3ICXA 1ZD4A 3KG0A 4XH1A 5DLGA 2J6TA 4BS2A 1SKRA 4R79A 1FEHA 4EP4A 2VJUA 4UZCA 3NGYA 5KFJA 3VQ9A 4OZ1A 4ZPWR 3HO1A 5CZXA 2F9TA 3DDKA 1U8WA 2L48A 2P5VA 3OR2A 3EDQB 3W9HA 4R8UB 4QIWF 3O2IA 1FNMA 2VG5A 3TTDA 4TVAB 4FOIA 4DV6F 3O08A 2CNLB 4ILGB 5LMNJ 1SJRA 5B8HA 3CJ0A 1FIQA 1RTIB 4B3RJ 3DXBA 4QAGA 3L4QA 2J9CA 4MFCA 4AXIA 3RJJA 4JRQA 7ICFA 3OYMA 1I39A 2KFYA 3D2EB 2DKXA 1IJJA 1X4BA 2RRAA 2B0GA 1S1WA 2QSFA 1ZA2B 3KLFB 2F1JA 2R7SA 3N7SC 1IV0A 4M6WA 2MLXA 4B1VA 2CG8A 2QXFA 1F0MA 3BBCA 5HVGA 1SV5A 2EFQA 2QI2A 1PGZA 4KPCA 4P7TA 3PSFA 4EP5A 3RB3A 4JI4J 3ZETA 1HL6A 3L4BC 2NXUA 4DL5A 1ZQKA 3KNGA 4FWOA 3PKYA 3OYNA 1VMBA 3NS1A 1IXRA 1NJZA 1PC5A 4RQ5A 3ZDEA 3M4XA 4YHHJ 1YGYA 2CQBA 3CWJA 4M5LA 5KFHA 4X65J 2LDIA 4WIQA 3TWHA 4AILC 2NYVA 1XNQJ 3TPQA 3DLKB 2XS7A 3IS9B 4LY7A 2IMWP 2UU9K 3P31A 1NK6A 3K7RA 5J1PA 4ZP8A 3UIQA 3E01A 5ALLA 4DZ6A 4I4BA 4PWDA 3NVMA 4C4SA 2UVRA 4R64A 3OYJA 3M6ZA 1JCFA 3J81U 3TNVA 5KRSA 2KSOB 3G0ZA 1NK4A 3I5BA 3HW8A 4DSLA 2NRXA 3EWAA 1RP5A 3AO2A 3Q7CA 1JUDA 3OUYB 2R4FA 4C0OC 4JV2A 3CNQP 3IN5A 1CEZA 5HMYA 4KLLA 3RBXA 3C8YA 4YOXA 4O44B 1BUPA 1XR7A 1ZTTA 4KKOB 5J1EA 3I31A 4PZOA 2BKEA 3EXYA 4PKGA 3PFEA 2DXDA 3OS0A 1SKUB 4QS7A 2DGQA 3C16B 4ETZA 1CUKA 1N48A 2BJ1A 4EX7A 2LCWA 5G0RA 3D6MB 1BL3A 2QX0A 1C0UB 3SUQA 5J2QB 3NF6A 2HHXA 1HKBA 3L2WA 1RT4A 4QZBA 1Z4NA 2JEFA 3CJQA 4KO0A 4LUBA 2DNHA 3HP9A 2VWBA 1WCLA 4CIGA 3HULA 5CYMB 5KRTA 2QXLA 4PKIA 4I9LA 2H5XA 4YN4A 3SMPA 4OLOA 4K8XA 2OP5A 2W4PA 2Z2LA 4LVOP 2E1YA 2H4YB 4P0PB 4CJ5A 5KFXA 3I8BA 4DEZA 4X4VA 2CPXA 1ZM9A 4NLZA 3W3SA 1D0EA 3PYFA 2A5XA 1G7CB 2AZ3A 1SXDA 5CWRA 1RI7A 3H2VE 5KT6A 2AEMA 4OJPA 2NYHA 1HD0A 2O66A 1H98A 4OL8A 8ICIA 1KQFB 4O3SA 4KHRA 1YQHA 3OR2B 1UVLA 1RWNB 3DC2A 4DV7K 6FDRA 3CW2C 3W61A 3GYGA 9ICAA 1M1KT 3V72A 3KD3A 2N7YA 2V7YA 3W3DA 1RFQA 4OJLA 1EWRA 3CCVS 1RDAA 3MECB 3UKUB 2PFPA 2H5IB 3RZAA 4DN9A 4F25A 4YXMA 1BPYA 4ZPBA 3ZNUA 3CD5A 3GB0A 3MCNA 2YKOA 4WYBA 4ILMA 4E7HA 5D78A 3WC2A 2H5JB 3WK9A 3AGRA 5DRKA 4LF8F 3POTB 1MC8A 3FSYA 3L4PA 4UAWA 1NSPA 3D1OA 1SJFA 9ICWA 2V4JB 1XNRJ 4QZHA 3HPGA 4PHPA 3OY9A 3D6JA 4Z4IA 5CCLA 2KN4A 2UXDK 3BSAA 3CC2N 3LDNA 1I3OB 1NZAA 2ASYA 1WWUA 4EHTA 4LJMA 4JKGB 3J80U 2PAVA 3I76A 3JS6A 3N97B 4LR9A 2F96A 5B0EA 3C28A 3E1YA 3EPGA 4PHAA 4OZ0A 1T0TV 2HS0A 1X4AA 3SAFA 2A1SA 3GV5B 3CMAS 2HK3A 4IOCL 3QEWA 4KTQA 3MX5A 2G5HB 4Q45A 1NI3A 4U8YA 2I2YA 1RHJB 3SV3A 1ZQDA 1WLJA 3PX0A 4DF4A 3VC8A 3AFGA 1U49A 1A6SA 1IR1A 5ALXA 1X31C 2HFVA 3L6QA 3A8KA 2P9NB 4CFDA 4FLYA 1D8LA 5E2QA 3H0RB 3KHGA 1N36K 2RHFA 4NB4A 3NNHA 1PAEX 3HSTB 2OWOA 2AGOA 3THTA 4UUXA 1XK8A 3O1LA 4RW6A 2DNRA 4YHHK 1VQPS 4FWRA 2AJ2A 3KOAA 5AQQA 4XH4A 2BKOA 3MAQA 4KTWA 9ICLA 4BRQA 4UY85 5AI8A 4AHVA 1QQ7A 1U1OA 2A41A 1ZQPA 3MMBB 5F3TA 4AM6A 1KRPA 1J5OB 3UDLA 5EY4A 5C12A 2O4GA 3UPQA 2P9GA 3WKBA 4DTRA 1VJWA 1IV8A 4DSEA 4FJMA 2ZNYA 2ZQBA 4ICAA 1FXLA 2IA0A 4OLBA 4OO1J 1ZD5A 3VZHA 1Q9XA 2BQRA 1YT3A 2IRXA 5AI4A 2BGWA 3NF8A 1VAZA 2IVFB 1RDDA 4MDBA 2D9OA 1MMNA 4FF2A 2GMLA 5GAHI 2D3O1 3ADAC 2YY6A 2UV8G 4MMOA 1LV5A 4CECA 1X4CA 2V94A 1GO3F 3RMCA 9ICCA 1RNHA 2ZVIA 3QO9B 4O3MA 3LDOA 1U1LA 1TKXB 1R31A 1TU0B 3I9ZA 5HMMA 3RRKA 3NE6A 4H0XB 3IG1A 2A6AA 2VD3A 4JI0F 4IR1A 5EE3A 2BJ3A 4HEA9 4YVZA 2OD6A 2JXJA 1OH6A 5AKIA 2ZIXB 3FDSA 4PRFA 4C7YA 4C80A 1DRZA 2XNRA 1VHXA 1O13A 1F60B 1F9EB 4JOUA 2Q6BA 4PGXA 3HMJG 2GUIA 2VUGA 4NLXA 1S6PB 5BJRA 3SI6A 1UT8A 9ICOA 4O5BA 4OI0A 1JROA 5DMRA 1Y4ZB 1BQNA 3I8DA 2D8CA 4PEOA 2C2OB 4FO6A 2RSQA 3D67A 3AGKA 4RBTA 2BW2A 4DV5K 1MMLA 1IKVA 2EFVA 3HP6A 4GC7A 3RB6A 2PD1A 5IWAF 3VGMA 5HROA 1BQXA 2MRLA 1LNQA 3CSKA 5KFMA 3C5FA 2N7CA 3CCZA 1IR2A 4M7YA 3MWPA 2J9DA 1GLEG 1T3VA 4QJVA 4WF9Q 4BR7A 1RWMB 2W7PA 2KT2A 3QT8A 4KAIA 4CIFA 3NMAA 3GFZA 3FRZA 4YY3J 2KG0A 5F8MA 2E5LK 2GVDA 3CCSS 3MX2A 2XLIA 3DLHA 1QLNA 3R8YA 5D3GB 1UOCA 1N33J 2HSEB 4LQ3A 4KH5A 2E8MA 3MFIA 4YG2A 5HMLA 2F1FA 4DV6K 3FKBA 4ZS6A 3EO3A 1ZM4A 4YNQA 2OMOA 2NLWA 3W5XA 5LJ5Y 1X42A 3AL0B 5IQQA 2ZNZA 1DTQB 2KL8A 4LRBA 3Q22A 1UTAA 1N4LA 4WFZA 1Z6RA 4LF7J 3NVVA 3TANA 3AVLA 1JI7A 2MHNA 3HHEA 5M1KA 3VQDA 2J0SD 2F8LA 1ZQGA 2FYXA 4DR2J 4DUZK 4DV1F 4I6AA 4E7KA 3EM1A 4FXWA 1CJTA 2WVCA 3T5KA 3PYDA 4EMDA 3UCZP 4WZMA 1UVKA 1P9YA 2EWSA 1WG8A 3NKYA 3RJMB 4J5OA 2WAQC 1ATRA 3AHPA 4OZJA 4R65A 3NFAA 1VRQC 1YHQS 1Y5NB 2VGMA 2CQDA 2B7CB 2DRBA 2YMPA 3MN9A 1U04A 4NXMF 3ULEB 5BOLA 4EELA 3UFCX 5JUMA 3IRUA 1KW4A 2CQGA 2LEAA 3CJAA 4UARA 1WF1A 1RTIA 5ALSA 1ZRMA 1U45A 4OFZA 3LDAA 2P9SB 2XMTA 5H2FU 1RDCA 4DV2K 3QZ7A 5E3PA 4ERDA 1LWEB 1Q46A 4QWBA 4F50A 3KJVB 3D2WA 3UVJB 1PVPA 2Q1NA 2FC8A 3NGDA 3M2VB 4OJ1A 4YB1P 3CQYA 4USJC 5DDRC 2L41A 2ZFHA 4MK9A 3NAEA 5M1QA 3K89A 2V51B 2ZIWB 4JI6J 5A76A 2GTDA 4CBWA 4OJOA 2FHJD 2P5OA 2Z1HA 3OVNA 3NCRA 3KJQB 4CZEA 1WC6A 4IUFA 3M8YA 4BR9A 1NHVA 1CQNA 1Q7YT 1VQMN 1K6YA 4P4PA 4KV8B 1IBLF 3QUQA 2ZWHA 3Q89A 4M95A 2FVQA 4K0KK 2ZKUA 3ETRA 1EIYB 1G4CA 1N33F 2MY7A 1HKCA 1JLQA 5HQMA 1U1PA 3SMSA 2WFBA 4BGAA 4J9KA 4N5SA 2DITA 1MWKA 3VGSA 1X0PA 1OY6A 1SJ1A 1KFSA 4KH6A 3LAKA 2XLKA 1KN6A 2DF4B 1NGAA 5BN9A 2EC0A 1QSYA 4NLRA 4KH1B 1FXXA 2ZC4A 1R89A 3TZXA 1DBDA 2MSNA 2GIQA 1ZJNA 4LRAA 1IKVB 1AZSA 2GHVC 5KFKA 2G0CA 1IR0A 3H4DA 1FDBA 2Y1LB 4DQPA 1VQNS 1GOCA 3O9QA 3THXA 1FX2A 5KPRA 1ROFA 2GO9A 2MKCA 3KLGA 3R8EA 3ENOA 4N7TA 4XPEA 5AK3A 4Z4HA 4BE0A 4I2QB 2VU5A 4WCEQ 3P3DA 7FDRA 4Q8FA 1HFEL 3UDCA 2Y0SC 3RTVA 2AJ4A 5K20B 4BY9C 3VVUA 1Z3EB 5FRNA 1EETB 2OAUA 1N60A 1UPMB 4HTJA 2JEJA 3FZMA 3HKZD 4KO0B 9ICTA 5FDLA 5DZ7A 4RW4B 1TMMA 5ALEA 2NRHA 1B9FA 1YVNA 3CQ8A 1SIJA 3H59A 1WD6A 3FCVA 3JTPA 1RWKB 5KG3A 1XTZA 4B9QA 4DV0K 5IT4A 3AA9A 4ER8A 2N3OA 1NSQA 4NYOA 3MUVP 4NLOA 2K60A 2JL9A 1UCNA 2F65A 5J2CA 4A8KA 1RBTA 1YUWA 1YBUA 2FJDB 1N88A 4DL0C 1NMDA 1GX5A 3OR1B 5LOQA 2PMZD 5KFZA 4ZVFA 9ICRA 4UQTA 4DR1F 4OYIA 2C3PA 3GFKB 3E8OA 2F76X 1RCOB 4ZN1A 4IOXA 3V81B 4NXMJ 5DK5A 1NU0A 3WK8A 4Y2MA 2HLTA 2PDAA 3L3UA 2QYGA 3E66A 2W55A 3JXOA 3SBMA 2YX6A 2OPSA 3CC4S 2NUHA 4LFAF 2HF3A 1VQ9N 2V2KA 4KT0C 3QU5A 2KMDA 3D28A 3J7YI 2VA8A 1X60A 2VG6A 4WP9A 1GOBA 2P9SA 4G65A 5TKYA 4ZVHA 3F5AA 2VDIA 3CGIA 2E5JA 5E3RA 4CO1A 3Q2SC 4Y2JA 2FBTA 3JPRA 4BC4A 5KOXA 1Q5VA 2RU9A 4J90A 4GVLA 2AMCB 2ZOFA 4AFFA 1X4DA 4C98A 4KHYA 4LFBK 2XY7A 1S5ZA 4DQ8A 1VSJA 2ZTCA 4NCAA 3I0SA 3GYXB 1TKTB 3CVKA 2QSWA 2A2DA 1RBOB 1N5QA 4DCPB 1BPDA 3U1NA 4Y2IA 3ZTQA 2MJUA 4CF3A 4DPUA 2P51A 1RAAB 3DJCA 2V8HA 3ZT4A 1SV4A 1B64A 3LQVA 2AP1A 1Q9YA 2K7KA 3CD6S 2MSTA 1E3MA 1XNQF 3VGKA 2BJ9A 1QTMA 5AKEA 4KI6A 2ASLA 2PMHA 1WUDA 4RU9A 3WXIA 4CJEA 2RPIA 2ZBCA 2EC2A 3B8HA 3CM6A 3KLIA 3QUBA 5HK4A 3PXGa 4DR7F 3J8AA 3BBBA 4BWJA 4LRCA 4LH5A 3DLJA 4CIEA 4EFHA 1TUYA 2XRIA 4HACA 2VBXA 1Q8BA 3GLJA 3SJHA 5AM4A 4CF9A 2DH9A 1K9MO 3KLHA 3MC1A 3HI0A 8ICMA 4UB4A 3HFKA 3MURP 3KKAA 4HUFA 3ILIA 1BD6A 1SC1B 1YBAA 4I2QA 4HTIA 4B3SK 2EZZA 2QA4N 4BACA 2D3ZA 2WZ1A 3TSPA 3M8PA 2Q1LA 5J0TA 3MMBA 5IT0A 4JYAF 9ICQA 4AQYF 1BLUA 1ZC6A 3MGVA 4H0OA 3PNCA 2IOCA 4Y1DA 2YH0A 3RBZA 1LVHA 2JC1A 3Q83A 4YY3F 4RZRA 2F63A 3MTJA 3LOUA 5FLXY 2BJEA 4ED0A 2KG1A 1FXRA 2UUBK 2V2VA 3MOJB 4I2BA 4AYBD 4RU2A 2R2UA 2O8FA 2HZVA 1GLDG 3A0HU 4FZMA 2O8DA 2OTJN 4LF5F 1IBKF 2V8PA 2ZH9A 4U7BA 2OZMA 1HQ2A 2QL5B 5MAOA 5F0XA 4CF0A 4LIWA 4WFAQ 4ID5B 4ZHRB 3RF9A 3FQKA 4CFBA 5AJ3F 3C6HA 3GPAA 4D3GA 1CJTB 1TKXA 4KFBB 1YITN 2HMIA 1BMQB 2ZIUA 1E4FT 3RWUA 2GX8A 4MN4C 1Q8IA 1HW9A 4JI8K 1JL1A 5CE3A 8ICZA 1N0VC 2WVBA 1YIJS 3FZKA 4ZP7A 3CIPA 2UUAK 4QIWC 2FMSA 2DEJA 5ALWA 1SJ4P 4FYDA 3MK6A 5CR0A 3S3MA 1A5WA 2G13A 1U1NA 1GLLO 1SQFA 1ZZFA 4PAAA 2E7XA 3VGVA 1Z2LA 2CRXA 4R5PB 3CCQS 2KLAA 4Z4CA 1RT2A 4NI2A 1ZBTA 1WC5A 2HQIA 1I94J 4HWIA 3CYMA 1DZ5A 2OPRA 2EH9A 3H2UB 3PJ9A 2Z2ZA 1NMEB 1CJUA 4O5CA 2B9WA 2DRAA 5AK4A 4RW9A 3HZEA 4X5VA 4US9A 2RIJA 4CZGA 2F4VK 2YI1A 3AARA 1U25A 1RHQB 2W03A 2WC9A 1FJCA 2KT5A 4YMMA 1GT8A 3TYTA 5IC6B 1XNRF 4RCHA 2YQ0A 3W7BA 3OPKA 4MLHA 2JH1A 3CF5L 4FBUA 3NF9A 2V50A 2ITGA 3FM9A 4Y2VA 3OLAA 3IAS9 2QV6A 2C1EB 2FMQA 2C2ZB 4NXNF 2YWEA 2JWKA 5M2UA 5HHIA 2KN7A 1M6YA 5AM5A 1FRLA 2R7YA 5HVHA 1RHKB 2CPHA 3OL7A 3OYKA 3DKDA 4DFDA 2CVEA 5ETOA 3MPYA 4M3WA 4P10A 2HSTA 4GKJF 4M63A 3CERA 4F04B 2DGZA 3I0RB 1QHTA 2DNZA 2HQCA 1S48A 4X62F 3JPPA 2ZIVA 2GGPB 3BF3A 3CMEN 4YR3A 7ICEA 4WK1A 1AZSB 3CRXA 5T7LB 4F4XA 5AFUH 4B9NA 2ZZTA 4Q7AA 1NGCA 3IDHA 5KI6A 5DLFA 4I29A 1RXOB 3BH6B 3AJDA 2KNJA 3P96A 2M3DA 3OYBA 4LRDA 4I2FA 1BGXT 2ERRA 2WB4A 1IBCB 4FM2A 3BSOA 1WHWA 4I2IA 3PNIA 1CBKA 2R7XA 4F5PA 3GP9A 1QH9A 3N5BA 5J0QA 3IG5A 3KK7A 4USMA 2HOIA 1E6VB 2OFHX 4E89A 8ICPA 2FZKB 4FP9A 4B3RF 1HBNA 3BN7A 2NCKL 1C1CB 3PM9A 1BOTO 5AXMA 2YV0X 4AHRA 5HL7L 1D9DA 4I7FA 3UCUP 4UOCA 2QZ8A 3LANA 2ZH4A 1Z1VA 3W5YA 2IS3A 5M1FA 1FRJA 3UD3P 3TZYA 2W8LA 2A1JA 2LQBA 1RT3B 4BC3A 4PR6A 1IKWA 1JWWA 5EE9A 5J2MB 1VK8A 4RPFA 3GDQA 4A8YA 3OHRA 3AO3A 2YNFA 2F5GA 3GE9A 5CHGA 3CCJN 1X5PA 5LMNK 4KLEA 4HUGA 4L3NA 2FVCA 2HBQB 4X64J 2IOFK 2GO7A 4CH7A 4RQ3A 1G6BA 3QUTA 2W24A 4IXCA 2E5LJ 3QU9A 1PYOB 1QAJA 4KJIA 1VDHA 2M4MA 4YD1A 4JI8F 4OHVA 1G1XA 2LYHA 2HURA 1NJXA 1JLQB 1Y9OA 3DNCA 3TRGA 4F5QA 1B0TA 5AI5A 4CQ1A 3K5OA 3QZ8A 3A5MC 1WHXA 1XNSA 4JI5K 3MOZA 1ESVA 3ZT2A 4DR6F 3QFWA 2A18A 1DRGA 4CLKA 1RWVB 3ICLA 1U6BA 3RB4A 1T8EA 5CA7A 3VAGA 4B3OB 2WSEC 1UPPA 3QFPA 1JMTA 3NGTA 1VR6A 4K2JA 4NA3A 2E2OA 3HK2A 2J7WA 5L1JA 4RW9B 4FNHA 2XIDA 3JS9A 5HRNA 1OPZA 3SSRA 1N5TA 4KMUA 1O8BA 3AD7C 5IINA 1VIOA 4MF8A 1YZ7A 4ED1A 2MLYA 2YB1A 4CJSA 1QAXA 3QESA 2E44A 4KAZA 5CD4H 1GEHA 1MROB 3I0SB 4LF7F 4ENOA 1AUDA 4ZVRB 1MQ3A 3C66A 5J0PA 4UB8U 4UZBA 1OH5A 5L39A 4TU8A 3O8MA 4CZHA 1YAGA 4I69A 3FC4A 4AHCA 3IS9A 2FPLA 3AQOA 4CGHA 4K0KF 1C4CA 3C95A 3O9RA 3SCKE 3C6TB 3V4MA 4FPBA 2CRLA 2BANA 4ISEA 1VHFA 3ZZUA 4L6V3 1BI4B 2GIFA 3D6RA 1FKPA 1HIYA 1BA1A 3MM6A 2PYLA 1YVFA 2KEYA 3IRXA 4KE5A 3KUHA 4W92B 2BH1A 2FF6A 3GG0A 1MN8A 5HHHA 3OR1A 5DGBA 4H5WA 2WK4A 1KCFA 3HPHA 1OUQA 1HI8A 1JLBA 4ELTA 1H7XA 1DQ9A 5AQUA 1RTDB 5KTQA 1QD1A 4RPXA 8ICEA 4OJ5A 3TABA 2MA1A 4J91A 4A48A 1NK8A 3RG6A 2VPWB 4QR0A 4JI7J 4CJ4A 2JH7A 2OO4A 3A8EA 4DPYA 4M3RA 4YUDA 3EGNA 2I9SA 3IM9A 3OTCA 2KK0A 4B3SF 2BCSA 1VS3A 1MMDA 3D5MA 5BN8A 1ITPA 3L3VA 3U27A 2G06A 5J2QA 5DETA 1RT4B 4FN5A 4RQ8A 5D6GA 5HP1B 4M94A 4FS1A 2AX1A 1HI0P 4H0PA 3NCPA 1T6DA 4DJBA 3D2NA 2C3MA 4ISFA 5ALOA 2NZ4A 2NLXA 4C4TA 1X4FA 4H4KC 2RLTA 1WWVA 3CD0A 3AQEA 1J2NA 2F9DA 4S0MA 3R7SB 4ZA1A 3M2RB 2GEMA 1JLAA 2VF3A 2E9RX 3AVCA 4JV1A 3PMNA 5IXUA 2QL9B 1ZQVA 2X1FA 3AY9A 3RBDA 2JDJA 4M45A 4OPHA 5SZTA 1HNZK 1Q4RA 5H9FK 1ZBIA 3AD8C 2LKYA 2YX1A 5DG9A 4JI4K 3MGJA 2OIHA 3MGIA 1UAWA 2IBOA 4AUKA 8ICOA 4ZVGA 5HVFA 4MEYA 2XO7A 3T7ZA 5J2EA 4JYAJ 1SZPA 1TL1B 1W7WA 2XI3A 3LZIA 2ZZNA 5J2PA 3GG1A 3CPEA 3HWTA 3NBPA 2RB7A 2IFXA 2IRUA 5AKKA 3NNCA 5HO4A 4YD2A 3UKUA 1SH2A 1HPMA 1L3KA 7AT1B 4O55A 3HOSA 3SCJE 4QPXA 2UUCJ 5H1SQ 2FBYA 5HN0A 1UKUA 3M05A 4F4WA 4CF8A 4C1NK 4FPAA 4KITB 2J6UA 4URSA 2CJAA 3ZTSA 4CDGA 4RNHA 4R0JA 3VTHA 2V69A 5IIKA 9ICIA 1EQYA 2WOMB 4AL6A 4FZNA 2FLPA 4RW7A 2DJWA 5L1MA 1V38A 1SC6A 5MLCV 2X51A 1MROA 1Y88A 3R1LA 1CULB 4O4RA 4IG0A 2Q97A 4RT3A 3M2UA 1VISA 4JI4F 5E3QA 2EK1A 3UO0A 3VAKA 4HCCA 1O0PA 1S1UA 2H54B 2GVZA 1NPKA 2PN6A 1I3AA 3CDWA 2V5HG 4BRGA 1FEEA 4ZH4A 5ALVA 3IM1A 1RAIB 1N5YB 3DRRB 4DTSA 4KLGA 4USUA 2BDUA 4J8FA 2GMJA 1T9XA 3VVTA 3KDNA 2O8DB 1VFJA 3DRYA 1VRTB 2G8WA 4F26A 2HGMA 3LH2S 3FMWA 3W63A 3QGHA 3THYB 1FKPB 2BRKA 4JI5J 2R7VA 1ZA1B 4EX6A 3NOGA 4IKAA 3EUB2 3SQ2A 4F4ZA 2CWKA 4N76A 3EKUA 1S9GA 3O1BA 3V7KA 4UOGA 2JFDA 3SQIA 4PPDA 2ZIUB 2H9ZA 3VQQA 3P49B 1N6QB 4OKJA 2KDOA 5AQGA 1B99A 1QAIA 1FHTA 3S6EA 2U2FA 4DWIA 2XMWA 2LXIA 4JI7F 3ISND 4MJKA 4HI1A 8ICGA 5HP4A 2GX9A 3VQ8A 2M0NA 1I5OB 2C2KB 4IO8A 1PIEA 2CPEA 2BPCA 3NS5A 1X9JA 1WHVA 5TKWA 2ZJAA 3CJ3A 3PKMA 1FT8A 3AO5A 2MZQA 4DL6A 3WXLA 4KC5A 4KLIA 4QZDA 4FF4A 1WWHA 4CO4A 2LM4A 3VPZA 1C1CA 4BDPA 4HAIA 2C2NA 3MN6A 1MN7A 2D7SA 3SD7A 4L74A 4YOVA 4BE2A 3A8IA 1VQ7S 3P4IA 4FL9A 2VFSA 3GZ7A 3WBZA 2HFNA 5E79U 1XC3A 4NLBA 2K4EA 2CUYA 4EEKA 1HUXA 1F0XA 4JD2B 1KNZA 1PAUB 1TV9A 5HRPA 5JVHQ 4H5RA 3TZZA 2ZH2A 4J9SA 1XMOK 3BSNA 2YNFB 2LQ5A 1BISA 3BPSP 3L2VA 3MM7B 4OYWA 1WN7A 4DR5F 3V6DA 4NLSA 5J2JA 1U1KA 2CKWA 2ZJRL 3C2PA 4YS2A 1PJ7A 1HBOB 4UTGA 2QA2A 2KKZA 3M7DA 3VESA 4O3NA 2W9BB 3VENA 1IBKK 4OX6A 3MFHA 1JCGA 5I3PA 2BUNA 5EWGA 5KFLA 3NH0A 1S9EB 2POKA 1NOMA 2ZTDA 4OYMA 1APSA 4HH1A 4KI4A 3HXMA 1TL1A 3OPXA 1YI2N 2V6AA 3TW0A 4ED4A 4DF8A 3NRWA 1HNVA 1VSHA 4LF4J 3QE9Y 3OTOF 3MCSA 3H98A 2GQCA 4ZPVR 3AEVA 4OI3A 2CPYA 3CC7S 1UVNA 3THVA 2ZKTA 5BPLA 1YSJA 4CJ7A 3TJ9A 3BQ7A 3HKWA 5T7LA 2Y1JA 4CEAA 3W5ZA 4NRTA 4DR7J 2DR9A 2CWXA 2HSZA 3HTVA 2IJRA 2C28A 4P0QA 2C3UA 4DOZA 4Y2CA 2O01C 4RW8B 2PO4A 3RRGA 2F8TA 1Q79A 4NLGA 4U96A 3U8XA 2ZM6F 1TP7A 4Y2UA 1F2HA 1IM6A 1S10A 2GJ2A 3RAXA 2GHPA 1VI7A 4X4PA 2Y9HA 1N54B 3F56A 1HNIA 4JI7K 3ZDDA 1ZQUA 1XO0A 1L6NA 2RE1A 1VIXA 2QO3A 5GIOA 1GQEA 2RHSB 4J9MA 3CPWM 1XO1A 3FZFA 1A6LA 1ZQEA 3MCMA 3H0LB 4P52A 1GLAG 2DY9A 3WUHA 1NDCA 3VALA 4JHDA 5K8PA 1WKJA 1F3VA 5HQ8A 2PYJA