2Y1IA

Crystal structure of a s-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1iA01
5KFWA 3JPPA 1WNSA 3H4DA 3OHAA 3V9SA 5L1JA 2B21A 5HRRA 4O0JA 1IXRA 1RT2A 3DLKA 9ICFA 1ZBIA 3HVTA 2ZUCA 3VQ9A 1CXQA 4M6WA 5J2QA 7ICEA 1V9PA 3QEPA 4F2RA 5J0TA 1QSLA 3K59A 3CYMA 4PA1A 1S77D 3SQ0A 1BCMA 2BQUA 5KFVA 4LY7A 7ICUA 3MAQA 4QZAA 5J0XA 4DLEA 4DL6A 2KQ2A 3ZSWA 4CF9A 4UQGA 3SI8A 1VSJA 4KLQA 2QK9A 3HPHA 7ICSA 2BQ3A 2ZE2A 1BIZA 2PZSA 4CERA 4W5TA 3EYZA 3ALYA 1NK9A 3RMBA 3HP6A 3P5JA 3MR3A 1NK5A 4M0AA 4KLEA 3KK3A 2HVIA 4CK1A 3KLIA 5KT6A 3TAMA 4Q44A 1KFTA 3ZDAA 4RNOA 3TI0A 2F1JA 4CJ5A 1JLCA 3GIJA 5KFBA 2KW4A 3OVNA 1ASVA 3MBYA 3RH5A 1WN7A 4DFMA 1Z26A 4PHAA 3GILA 2HMIA 7ICNA 3D0PA 5KT7A 3VQDA 2FC0A 4DL2A 8ICSA 4C8KA 4GW6A 2O4GA 3RH4A 3KLGA 5J2IA 9ICKA 2YKNA 2AGOA 4QWCA 4FLZA 2Z1HA 3PMLA 4Z6CA 4N56A 3SPYA 1Q9YA 4QZHA 5KFCA 3OYCA 4FLYA 2ZJ5A 4E7IA 4JUZA 4KLMA 5DG9A 4ECYA 3QEAZ 2ALZA 3Q8MA 1BQMA 4BE1A 2NUBA 3GIMA 4CEBA 3C6TA 1ZQEA 5DDYA 4Z6DA 4CESA 3MXMA 1ZQWA 2DTUA 4KB0A 2YNGA 8ICAA 1Q8IA 1EX4A 4J9RA 3TFRA 4M47A 8ICNA 2YNIA 3EPGA 4DTXA 1TK8A 3ZSQA 1NJYA 1RT5A 2OWOA 4R5PA 2P5OA 1H38A 1L5UA 2YHBA 1L3SA 4P4OA 4IG3A 4IBNA 3AVIA 4O5KA 2C2RA 3AA5X 2D0AA 4EP5A 1CZBA 1IM4A 3NF6A 1HYZA 3N97B 3JPQA 4P4PA 2YKMA 3EWAA 4NY8A 3MGHA 4MEXA 2D0CA 3TAGA 5D3GA 4DFJA 1NJZA 1TAQA 4M9LA 8ICWA 1TV9A 4BACA 4KN7A 4MFAA 5KT5A 1VK0A 3IM1A 1TK0A 1BCOA 1WSHA 4QW9A 1ZQOA 4QZDA 4DL7A 3ISBA 4KHWA 4E7HA 1EXNA 3RJGA 4NCGA 1D9FA 1UA1A 3VQPA 3LP1A 4I29A 4IRDA 2ZUDA 4KMUA 4KLIA 3T5HA 3Q8SB 5CYQA 2ZD1A 3OYLA 4RT3A 1KRPA 1RDAA 3L2WA 4N76A 4LH4A 2R8KA 5KFRA 3BQ0A 2ASLA 4WE1A 2HHVA 3E2EA 3C21A 1NK0A 1ZQUA 2JEGA 4CK3A 3S3OA 3NGZA 4DQSA 1GOAA 3C95A 1C1CA 4F3TA 2PFNA 5HP4A 3NDKA 1CZ9A 4J9NA 2IAJA 3SPZA 2GV9A 4KTZA 4ED8A 2QKBA 4IRCA 1GOCA 2RPIA 3Q8LA 5KFIA 3UXPA 4G3IA 4F4YA 4MQ3A 5CZ2A 4CHPA 1HMVA 2XY7A 4UBCA 1A5WA 4RQ8A 8ICFA 1WSEA 5KFNA 3PW5A 4F4WA 3BDPA 4NM1A 1C1BA 1ZQHA 2M9NA 1N56A 1ZQJA 1G15A 3VA0A 9ICMA 5DGBA 3EPIA 4PHEA 3NH0A 3CM6A 2OA8A 3L2RA 4BWJA 1RBVA 3EY1A 1A5VA 2W42A 3SZ2A 4M9JA 2EX3A 2ATQA 2IS3A 1HYVA 2B5JA 8ICEA 4RQ2A 1AROP 3OYBA 3PUFA 3TWHA 1RILA 4CEFA 2HW3A 1S0MA 2WONA 1VSMA 4PGQA 2H5XA 1ZQBA 1ZJMA 2PYLA 4CEAA 1BISA 4DO9A 4HCBA 4E0DA 3ZT2A 3SNNA 4ED3A 3RJIA 4CHOA 7ICKA 5KFEA 2XY8A 4CJFA 2BHNA 4DTJA 1LWEA 4ELVA 1BPEA 8ICPA 1RZTA 2RDJA 4K4GA 1IKWA 5DBCA 2XCPA 2FBXA 3QNNA 3JPSA 4E7LA 3CFRA 2J6UA 3AVNA 1JN3A 3UPQA 4DL3A 4K8ZA 1VSDA 3HPGA 3ZSRA 3OJSA 4W5OA 1MSWD 5KT3A 9ICBA 1Y88A 5J2JA 3AVKA 1U47A 4DG1A 2XY5A 3TABA 1HRHA 4KPYA 4F91B 5DB6A 3QINA 4MF8A 2C22A 3AVAA 5DB8A 4YD2A 4I28A 4LSLA 1K1QA 1R0AA 5EU7A 5HHHA 3SUPA 7ICHA 4UB2A 4GXKA 5HBMA 5HNKA 4DSIA 4KLLA 4LZDA 9ICUA 4PPXA 3ZT3A 4CJWA 3KD5E 3QEWA 1ASWA 5DQGA 2Q0ZX 4CJ4A 3KLHA 3KKSA 3FDSA 3T19A 4B9VA 4O4GA 3QETA 1NKBA 4K4HA 5D4BA 4FZXC 1TKTA 4L8RB 3V6KA 2J6SA 5CYMA 2IMWP 5SZTA 3AU2A 4F4XA 3QZ7A 4RPYA 1NOYA 3JSMA 1XC9A 3MFHA 2X74A 3GV7B 4DEZA 3AVMA 4KHQA 4ZTJA 3K5OA 1WSGA 3VQ6A 4NYFA 5DMRA 3KIOA 2XY6A 1KTQA 4AH9A 1S0VA 1C0TA 5KTQA 5KT2A 1S1UA 1ZQIA 4YCXA 1ITGA 3WNHA 3C1YA 4OPKA 4R8UB 3G6XA 3WNEA 2WOMA 4YP3A 3C5FA 4RG8A 3RRHA 3DOKA 3LALA 2OZMA 1S1XA 2FLNA 1UAXA 4FM0A 3K2PA 2G8FA 3NAEA 4C8OA 4HUGA 3I8DA 3MDAA 4YMMA 1VSFA 3KK1A 4KO0A 4YNQA 3V4IA 4JS4A 3NF9A 4J2AA 4F5QA 4N47A 5IIJA 1ZBFA 1IKXA 5CB1A 3OSPA 1LWCA 4CIEA 3VQ8A 4AHSA 3V9ZA 3C2KA 2BDPA 4KLGA 3PNCA 5J1EA 2ZTCA 3ASMA 4CHYA 4PH5A 4EZ6A 2VANA 1ZYQA 5IILA 3THVA 5J2EA 3AVGA 7ICIA 1TVAA 3TR8A 4FJMA 4CGHA 4RW4A 3QEVA 9ICCA 4FZYA 4I2GA 3AA4A 5KFPA 2PI4A 1BPXA 3PO5A 1RT7A 1BIUA 4YFUA 5EWGA 3AA2A 3K5LA 1I3AA 4DTSA 3B0YA 2FMSA 2E4LA 4DSFA 7ICQA 5KFQA 4DU3A 3AO1A 1DGSA 3H8JA 4KLJA 3OYDA 5KFYA 1COOA 5KFSA 2V4QA 4NM2A 1XI1A 3PY8A 5F9NA 4CCHA 3AVCA 1C6VA 2MUTA 3IHQB 4KAZA 2VWKA 4CGFA 1ZQAA 1RBSA 4TUSA 2LYHA 4UBBA 3NGDA 2YHAA 4IQWA 4KLDA 4ED7A 3SYZA 7ICLA 8ICCA 1VSEA 2BGWA 4IRKA 4FK2A 4TSXA 4CHQA 1BI4A 3VQ4A 3V1QA 1WSJA 3PMNA 3AO4A 3QEBZ 2BQRA 3V1OA 5L9XA 1QSYA 2HB5A 4ID1A 3K58A 4DTUA 4B3OA 4RUCA 3ZSVA 1ZJNA 4LH5A 4M41A 2G8HA 1S6QA 4CJKA 2HNDA 3KHRA 1JLFA 3VQ7A 1JLEA 4KI4A 4UB4A 9ICSA 1JIHA 1ZQMA 2ZQBA 2P66A 3NH1A 2R8GA 2A1JA 5EOZA 1HQEA 5KG4A 3PW2A 4IR9A 2OYQA 1QE1A 2DPIA 5J0RA 1LAVA 3QO9A 3SQ1A 4BXOB 3RB0A 4O3QA 1J54A 4J2DA 4KHNA 4FXDA 2VA8A 1NJXA 2YNFA 3H08A 4Z4HA 3RJJA 3LK9A 3LDSA 4M9NA 5FRNA 2RN2A 2G8VA 8ICQA 3LWLA 4ED6A 2FBYA 1HJPA 3Q8PB 3C1ZA 4GC7A 1TK5A 2P51A 5IINA 1RXVA 4F8RA 3RAXA 4J9PA 4YMNA 4O3SA 4KLTA 3AVHA 4Z0UA 9ICVA 4ZH4A 4Z4EA 1ZQZA 3FYHA 9ICRA 1S76D 3NH2A 3UXNA 4QZ9A 1SL2A 2JEFA 2D0BA 3AVFA 1Z00A 3PVXA 4UB5A 5J2KA 5IIKA 1TV6A 3A2FA 1RBTA 3AVBA 2JLEA 2I5JA 3TFSA 1XHZA 4ECZA 3RAQA 3OS0A 1SKSA 4M3TA 1DTQA 2AU0A 1WLJA 1KFSA 4ZTFA 4FLXA 4Z6EA 2AGPA 4M3YA 2ASJA 4AHRA 5KG3A 1Q9XA 3CQ8A 3F9KA 4NLZA 2F96A 3RH6A 4DOBA 4FJ5A 4DF4A 4FVMA 4KFBA 2KZ3A 3HW8A 3NF7A 4ID5A 1SZPA 4PGYA 4YG2A 1JLAA 3MR2A 3K75D 2HHXA 3DI6A 4FYDA 3DMJA 3U3YA 1Z25A 3LPTA 5IIMA 9ICWA 2Z1JA 1VRUA 1KLNA 4KV8A 4ICLA 4DTMA 2ISOA 3ZD8A 3VQQA 4IFVA 1XWLA 5KT4A 4W5RA 3VQBA 3RTVA 4MFFA 5JS2A 4M9GA 1T8EA 4M2YA 3KLFA 3G6VA 4MEYA 5FROA 2YV0X 4PHDA 2X78A 2ATLA 4F5NA 3VQCA 4DOAA 1LWFA 1HNVA 4NYNA 4RQ7A 3B0XA 3RB3A 1T7PA 2IDOA 4KN4A 3M8SA 3ZSOA 4GMJB 4F5PA 2R8JA 3MECA 3GQCA 4XA5A 3ZCMA 4EBDA 4ECUA 3RJKA 4M3XA 4M45A 1S9GA 4DU1A 3F73A 3OS1A 1ZQTA 4CIGA 4YMOA 1L3VA 2B4JA 1S9EA 3LWMA 2A1SA 4H4OA 1CEZA 1VRTA 4YVZA 5DDMA 4IDKA 1C0UA 2O4IA 3HP9A 1NJWA 4CJRA 4W5NA 3RRGA 3LDAA 4FM2A 4TUQA 1IH7A 5J2AA 1EP4A 4HUEA 4YQWA 5DB7A 4KB1A 4DU4A 1BGXT 4E7JA 5J0WA 4X5VA 1NKCA 3O4NA 5KFMA 4HCCA 1EKEA 4H4MA 4F92B 3OGUA 1RTJA 4Q0BA 4DSEA 3PR4A 4RW8A 4IG0A 2G8UA 3QEXA 2P6UA 4EYIB 2IHNA 4YFKA 1ZBLA 3AUOA 2ZUBA 1A77A 3PX4A 1KSPA 3LPUA 4IQUA 1REVA 3B6PA 4ED2A 4KLHA 2VA2A 4M3UA 3DYAA 2P6RA 4RPXA 4JV0A 3HL8A 3LZIA 1KCFA 4K8XA 4RT2A 2MAXA 4JWNA 9ICIA 4DS5A 1ZBUA 3DLEA 4OJRA 1FKOA 4JK1A 2BPGA 3SQ4A 1ZBHA 5KFAA 1RDDA 4Y1DA 2GWSA 4CJQA 4M3ZA 5J2DA 4TUPA 2FPMA 4BE0A 5F9LA 4CEOA 2R7YA 1ZQDA 4CFAA 5J0SA 3RWUA 4KTQA 1WAFA 4AHTA 4FJ7A 1VSKA 3MXIA 1BVSA 1JKHA 1S0NA 3HXMA 5J29A 4NCAA 3DRSA 4KHUA 4CGIA 3TQ1A 3V9XA 1RYRA 2ASDA 4O3OA 3ZD9A 4EYHB 2G8WA 7ICJA 3OYJA 5KG7A 5J0PA 4CEZA 3Q8QB 3IRXA 3WNFA 4IQTA 2KN7A 3PX6A 3RR8A 2HVHA 3CG7A 4JRQA 1L3UA 2D5RA 5KFJA 1ZQVA 4FLWA 2BCSA 2ISPA 3DLRA 2DFLA 3DRRA 9ICGA 4B9UA 1X2IA 4RNNA 3MR5A 1WCNA 3H8SA 4J9LA 4BGDA 5HLFA 4HYKA 1MQ2A 4CGDA 4OPJA 3EW9A 8ICVA 3EZ5A 4I2BA 2OPSA 4G1QA 4B9TA 1QLNA 1WSFA 3O3GA 1U45A 1XSPA 1RDBA 1Z00B 4KKOA 4EZ9A 1D8YA 4N41A 1IKVA 4RW9A 1KVCA 3NHGA 4UB1A 3HO1A 7ICOA 1RT3A 1RT1A 2ZJAA 5CA7A 2Z1GA 1TKZA 4FJKA 3ISDA 3BQ2A 1WSIA 3HM9A 1B9FA 2AQ0A 1D5AA 4PHPA 1JL2A 1TL1A 2NRZA 2ITGA 1RXWA 4B8CA 3ISCA 3MEEA 2Q3SA 1PZNA 1BL3A 3AVJA 3KTQA 3V7KA 4I9QA 4RQ5A 1D8LA 1S1TA 4GVMA 4MFBA 4CJ3A 4I2CA 1X9SA 8ICBA 4I2FA 4M3RA 4ECRA 4QWBA 3PR5B 2BCUA 4BWMA 3H4BA 4ECTA 4M04A 4EBEA 1NK8A 4FM1A 3P83D 4CJEA 3V9UA 3NFAA 4Q8EA 2W9MA 5HMLA 3TAQA 1X9WA 3RMCA 4J9QA 4IKFA 3M8PA 5D49A 3M9OB 1BQNA 1U04A 2E6MA 1JX4A 1JXEA 4AHCA 4FJLA 1TAUA 4C8NA 1XSLA 5DK5A 4RNMA 4I2AA 3HSTB 3VQ5A 4ECXA 4XUSA 1Z3EB 2IBKA 9ICNA 3MEDA 2V4RA 3OS2A 4YR2A 4M9HA 1LW0A 1I39A 3Q8KA 2P5GA 1WAJA 1EETA 4LD0A 4KREA 1CLQA 2C2DA 4FJIA 3CFPA 4J9OA 4F4ZA 4O55A 4O5EA 1U48A 3MFIA 2UVRA 4NLNA 4DL5A 3TARA 2BCVA 3AU6A 4CEEA 5J2BA 4GXIA 4XIUA 2NRVA 4YN4A 2XHBA 3UQ0A 4JS5A 4FLVA 7ICVA 5DGAA 3BJYA 3H8WA 4CF1A 4FJJA 2A1RA 2OPPA 4RW7A 2BE2A 5DLGA 2KTQA 4KI6A 3GIIA 4DSLA 3JPRA 1HPZA 5L1IA 5CWRA 1C0MA 3VQAA 1QS4A 4Z4IA 1F21A 1EXQA 5FDLA 4Q5VA 4Z4FA 2JZBA 4C8LA 9ICHA 3V6JA 1BPBA 4RW6A 1UA0A 4JWMA 5C42A 1ZETA 3OYKA 3IS9A 5KRTA 3L2QA 4CFBA 3SUQA 3HVRA 2W8LA 4B08A 5D46A 1XSNA 3KKRA 1XU4A 4YD1A 5KI6A 4E1MA 1J53A 3QESA 1ZQGA 2YNHA 3TANA 4CJTA 4BE2A 1JL1A 4CEQA 4QOZB 2IOCA 4QZ8A 4O5BA 5KFFA 1MQ3A 1VSIA 4CGJA 3NGIA 3MDCA 4YR3A 4IFYA 4FLUA 4E1NA 4QWAA 1C1AA 1TFRA 5KG1A 5DQIA 1JLBA 4LSNA 2OPQA 1S5JA 2W9CA 2RDIA 3GFKB 3LP2A 1HNIA 2GUIA 3DOLA 9ICPA 2HHWA 1RTDA 5DB9A 4I2QA 5KFLA 2FMQA 1W9HA 3RMDA 3SUOA 3KD1E 3WNGA 3NE6A 2AJQA 4QAGA 1JXLA 1UT5A 4KLUA 1T4GA 4CFCA 4J2BA 1ZQXA 8ICTA 2DPJA 2PFQA 3ZSZA 1TKDA 2OZSA 2RKIA 4RQ0A 4TURA 1RPLA 3HPOA 4CE9A 4FZZA 2MUTB 3JPTA 5KFGA 3AVLA 2XCAA 8ICUA 1YTUA 5J0UA 4OKJA 4XQ8A 4CK2A 1NK7A 1WCLA 2KZZA 3T5KA 3ZDCA 3BQTA 2LSNA 5C5JA 7ICFA 3ETLA 3ZSXA 2VG5A 5CJ7A 1VSHA 2KFZA 1RBRA 3LP0A 3KJVA 1ZQLA 4UAWA 3HWTA 1UWBA 3HJFA 3OY9A 1O1WA 3QEIA 4DQIA 3RJFA 2FLPA 3LANA 2R8IA 4DFPA 3CM5A 1U9LA 4DSJA 3RR7A 3K4GA 1FK9A 3JPOA 4F4KA 9ICLA 3E01A 3FFIA 1SKWA 3NBPA 1RT4A 3GIKA 4CJVA 2JEIA 4YXJA 4I2IA 2E6LA 4OKEA 1N6QA 4P2HA 3C23A 4FK0A 3AO2A 4HTUA 4J2EA 4GC6A 3M8RA 1BPYA 5TZVA 8ICLA 4R64A 1RDCA 3LZJA 5EWEA 4PQUA 1CUKA 4AHVA 4I27A 3C2LA 3O3FA 5JS1A 2GBZA 2JGUA 3OYHA 4Z6FA 3T3FA 5J0QA 1SV5A 3T5JA 4FK4A 4F3OA 4I2DA 4DTRA 4BDPA 2BR0A 2J6TA 1QQCA 3JPNA 3DLGA 4M6WB 4RQ1A 2W9CB 3HX0A 2B6AA 4RQ3A 5C25A 2X6SA 4RUAA 1KVBA 5SWMA 3PW0A 2VG6A 3IG1A 3ZSYA 4NXZA 2F8SA 4KITB 5J2HA 4J9MA 3PX0A 8ICYA 1B43A 1LV5A 4BDYA 8ICGA 4PY5A 5KFUA 4QZCA 4XRHA 2W8KA 1NKEA 3VN5A 3SV4A 5KG0A 1S97A 4TQRA 3KLEA 3DLHA 5KG6A 7ICRA 1FXXA 4FW1A 1YT3A 5KG5A 3GDXA 4ECQA 9ICAA 1XS9D 2F1HA 4PUOA 4I2EA 2W9BB 1NK6A 4DQRA 4DQPA 2FPLA 4Z4CA 2AGQA 5J2PA 3P1GA 3LAMA 3SV3A 3S9HA 3ZT0A 3K57A 4RU9A 4FBUA 3D45A 3RBDA 1HUOA 3C2MA 4M3WA 3O4QA 1MC8A 4FJNA 2XC9A 2KFNA 3V6DA 2Y1IA 1K1SA 3NF8A 4Q8FA 1TL3A 1LB2B 1SL1A 1A5XA 4P4MA 4DTOA 2P1JA 4Q43A 4B9SA 2BGGA 2W9AA 3H40A 1TKXA 3C6UA 4UAZA 4FCYA 5KG2A 1XO1A 5DKWA 4F50A 3UXOA 1S6PA 1KEJA 1GOBA 3L2UA 1VSLA 4CGGA 3L8BA 2HHSA 5DLFA 3MGIA 2VA3A 1BI4B 4PWDA 4LVSA 4R8UA 1T05A 3V72A 1ZQPA 4HVJA 5DG7A 4JV2A 4ED0A 3V9WA 5JUMA 1B92A 3TAPA 1SKRA 4CF0A 4NLGA 4DOCA 4RQ6A 5T7BA 4CJPA 1JMSA 1HQUA 5J2GA 1IKYA 1DOQA 3G0ZA 3U6FA 3N4MB 2VWJA 2JZBB 1KFDA 4FS2A 4FJXA 3OSNA 2X6NA 1BPZA 3SUNA 4ECVA 4I7FA 4C8MA 9ICEA 2PI5A 2VG7A 1RCHA 3V81A 4CECA 5C24A 1ZQCA 1RBUA 4QWDA 4DF8A 3RJEA 5CP2A 2NRTA 8ICXA 3RB6A 3MXJA 3OYEA 3KK2A 4NCBA 9ICXA 2IC3A 2BPCA 4NLKA 3JYTA 1U49A 5I3UA 5I42A 1SL0A 2HHUA 3L3UA 3ORYA 2RF2A 3KHLA 1UT8A 9ICTA 4O3NA 5IIOA 1ZQQA 4O5CA 4J9KA 4RZRA 4IR1A 1YVUA 4F5OA 1KDHA 3AV9A 3DLBA 5CZ1A 2FMPA 3ISNC 4LZGA 1T03A 3T1AA 8ICMA 3IAYA 5HRPA 3AA3A 2DFEA 1J9AA 5KFDA 4DTPA 4CIFA 2WTFA 4CFDA 3QZ8A 1S9FA 4CEDA 2Z1IA 4EP4A 2EHGA 1XHXA 3NGYA 5K14A 4MF2A 3OHBA 4MFCA 2BPFA 2KZMA 3OYAA 3L2VA 1N5YA 1FKPA 3KHGA 3OYIA 1ZQRA 1CXUA 4E19A 1JXBA 3SI6A 3UIQA 3M8QA 4TQSA 1C7YA 5KFXA 1NOMA 3VQEA 3K5NA 3RB4A 2UVUA 3G6YA 3S3NA 3PO4A 2HNYA 4DMNA 4OVLA 4PGXA 3OJUA 2V9WA 5J2MA 8ICKA 2DY4A 3M9NB 1QTMA 2FBVA 3CFOA 1J5OA 2A1JB 3ZDEA 1RTIA 3SCXA 4ED1A 4CHNA 4UB3A 5KFZA 3BQ1A 4DL4A 1ZQFA 1S1WA 2PYJA 1KVAA 1SUQA 2PXIA 1DLOA 3H7IA 4ELTA 1ZQKA 2FPKA 2F1IA 1X9MA 4F5RA 1ASUA 4B9NA 2HNZA 1A76A 3T5LA 2HHQA 3KHHA 3ZT1A 4FJ9A 5BOMA 3HK2A 1RYSA 4JRPA 5L1LA 4GXJA 2PFOA 3RJHA 1YTAA 4CF8A 4CF2A 4BXOA 2XGQA 3U3GA 3OYNA 4KRFA 4I9LA 1S10A 1BHLA 2C28A 1S0OA 4RQ4A 5E41A 4OLAA 4IQVA 4DLGA 1TVRA 4DS4A 5BOLA 1ZQNA 4E89A 5IIIA 5KFKA 1T3NA 2BKEA 2AQ4A 3RMAA 5DBAA 4QZIA 4O3PA 2OPRA 3PV8A 3V6HA 2ETJA 4CJLA 4O9MA 3AO3A 4Y1CA 3SJJA 1ZQYA 3PW4A 4I2HA 4QWEA 3GV8B 5J2FA 2DFHA 8ICOA 5CY4A 2IA6A 5KFTA 1NOZA 4ECSA 3QE9Y 4FS1A 4CJUA 3PW7A 2UVWA 4BDZA 4ELUA 4QZFA 3MEGA 4I2PA 5HMMA 3HT3A 2IHMA 4HUFA 1JLGA 3MR6A 9ICJA 1B9DA 3QERA 3O3HA 4FW2A 4RPZA 3UQ2A 1ZQSA 5DG8A 5KFOA 3ITHA 1MU2A 5HRNA 5KRSA 2XRIA 4FLTA 3ZT4A 4DWIA 8ICHA 3AO5A 1K6YA 4O3RA 3HYFA 4R65A 1HUZA 2Y1JA 3QLHA 2PY5A 4FJ8A 4KLSA 2XGPA 4AHUA 3C5GA 5CR0A 4KTWA 4KHYA 2UVVA 4M42A 4R63A 4EBCA 5FRMA 4O0IA 1DTTA 4FJHA 2ZTDA 5J2CA 4R66A 2NRWA 3C94A 2ZTEA 1QSSA 4F93B 2G8KA 4FO6A 2ZJ8A 1TGOA 4AILC 7ICMA 4OGEA 2PFPA 1RT6A 2JEJA 2C2EA 4OGCA 3DRPA 3K5MA 3M9MB 5J2NA 4KLOA 3VA3A 3BGRA 1LW2A 4GLXA 4F2SA 4O44A 3ULDA 5DBBA 1KLMA 1U4BA 3RBEA 4Q45A 7ICGA 4J9SA 2FLLA 4ZHRA 1L3TA 1HYSA 5L1KA 2HHTA 1W0HA 2I9GA 5EWFA 4EEYA 3LAKA 5J0OA 4CJSA 3NTUA 2QXFA 4N5SA 4JV1A 4JLHA 1NK4A 4KHSA 5CHGA 5BPCA 4YXMA 1IG9A 3S3MA 4DQQA 4QCLA 4DTNA 3OYGA 4FBTA 4QZGA 3I0SA 4H8KA 4B9MA 4YR0A 1D9DA 8ICRA 4QZBA 1LAWA 1S1VA 3TAFA 3SQ2A 4CHZA 3V1RA 2BCRA 1X1PA 1Y97A 2FBTA 3Q8RB 2BANA 9ICQA 3GV5B 4ECWA 3LP3A 4QW8A 3DM2A 5KGXA 2BCQA 4OKKA 3L3VA 3QIPA 4B8AB 5HRSA 4UAYA 8ICJA 1UOCA 3ZDDA 4DFKA 3V7JA 7ICTA 3QNOA 1RNHA 1BPDA 1HJRA 3QIOA 2I1QA 3V7LA 2DFFA 4QZEA 3I0RA 4W5QA 2XO7A 5KGWA 1IO2A 3B6OA 3NCIA 3MABA 1N48A 1QHTA 5DQHA 3TAEA 5J0YA 3ZDBA 3G10A 4E7KA 2NRXA 4DSKA 9ICOA 4FJGA 3OYFA 4KLFA 3OYMA 7ICPA 5KFHA 2W9BA 4E3SA 2QKKA 2G8IA 5HP1A 2R8HA 5HROA 4HHTA 1RTHA 4K4IA 4I2JA 4Z4GA 1B22A 5HHIA 1JLQA 4B9LA 8ICIA 2IGIA 4OLBA 8ICZA 2F8TA
chains in the Genus database with same CATH superfamily
2RAQA 4MKYA 2IVMA 3NRBA 2W7OA 3QBWA 3H4DA 1T95A 2WFBA 2F7VA 3WXLA 4FWOA 5F0UA 3SQGB 3CJBA 3WK5A 4OX9F 2MMYA 1CXQA 2XMVA 1YITN 3N7PD 7ICEA 1OVQA 1V9PA 1HBMB 5ALUA 1QSLA 3AMZA 2BOAA 5AKKA 4FKYA 4N77A 1KQGB 4DBQA 1W25A 5IZHA 4Y6IA 2E8AA 3P96A 2DD8S 2GA7A 4LY7A 3BF4A 7ICUA 1DLOB 2I5HA 3MAQA 5C24B 3TO8A 1R6VA 4DL6A 3QJPA 3R7BB 4YOWA 2BW7A 2JJ4D 4UQGA 1VSJA 2QK9A 2CJ9A 3HPHA 3D6JA 2YN4A 5KQDA 2FF3B 3CJQA 4CERA 2RU3A 4M5IA 3RMBA 1TUWA 4A47A 2UXBJ 3C6UB 5AFUA 2CDRB 2FE9A 1NK5A 3A3NB 2D4WA 4KLEA 3KK1B 3F5EA 5ALNA 1VBKA 1KFTA 1DARA 1S1XB 3L6QA 5KL8B 1JLCA 3GIJA 3QUQA 4PABA 1ASVA 2GJIA 3VEVA 2BRKA 4OJLA 2H5IB 3NGUA 2ZDOA 3GILA 3CGIA 1FE0A 1RT6B 2FC0A 3NRWA 1WWHA 1VQ6S 3I1YA 3UDVA 3S41A 2OANA 3G4SN 4OZ0A 1D0EA 3VF6A 4FZVA 3KLGA 2YKNA 3LL3A 4AP9A 3IM8A 2Z1HA 4BRLA 2FZCB 2I9SA 3FBBA 2OFHX 4USKA 3GYNA 4G9ZA 4LMZA 2MSNA 4CI6A 2ALZA 2LMRA 3UVJA 1M5SA 2KO1A 3ILOA 4PCQA 3NOCA 3D7SB 3FSYA 1BQMA 3H42A 3R5AA 1BU6O 4OYOA 1Q8BA 3C6TA 1ZQEA 2D3UA 3KWIA 1RB0A 4M8LA 5DDYA 2Z2MA 5I3UB 4CESA 3MXMA 1GMVA 2VIHA 3PM9A 4TY8A 2V50A 3TFRA 4Y2CA 3EPGA 2DR5A 2XLIA 1YK9A 3PDNA 4DTXA 2LPEA 4RX6A 5HMYA 2P9PA 2OWOA 3BZCA 3T1HF 1SQKA 4ANEA 3QAUA 4QOTA 4WP9A 1XR6A 2CQ0A 4I1TA 5JLHA 5AI6A 3CCEN 1IM4A 1SJFA 1S49A 4K8RA 1QQ5A 4PHTX 4C0ZA 4H0XB 3EWAA 2CPXA 3MGHA 2V8DA 4TVAB 4DFJA 1NJZA 5HROB 4LIWA 1RFQA 4DOZA 3CCLN 5J8YC 4ZMMA 3CCTA 3A0BU 2E66A 2YQEA 1VK0A 2CJYB 1U8WA 1BCOA 4QW9A 3ENAA 4QZDA 4DL7A 1KAZA 2XNQA 3WU2U 2UUCK 4UOHA 3CCVN 3KLFB 4DV3F 3LP1A 1L6NA 4AT1B 2H5JB 3GL1A 3ZEUA 2ZUDA 4KMUA 1BUPA 2VG5B 4HH0A 5IT4A 1KS2A 5B0AA 2V52B 3OYLA 4RT3A 1KRPA 1O13A 5LSRA 4OJ5A 1H0HB 4HI1A 5KFRA 3FFKB 3P31A 1WC1A 3O08A 4DHVA 2QA4S 2EZYA 5ALWA 3C21A 1D8BA 2RF2B 1UEKA 1BNOA 1HBNA 3MM7B 3NGZA 3R9PA 3C95A 1BE4A 2PFNA 3NDKA 3UVJB 2LU1A 4J9NA 1TELA 4YN3B 3NNCA 1NGEA 5BN8A 1FJCA 3BSNA 4ZLJA 2G0AA 3UB5A 3GG0A 3VWSA 1GOCA 3CCRS 5KOWA 4USMA 5KFIA 1IQZA 4FWSA 4DPXA 3P39A 3MPVA 1WSEA 1LNQA 3PW5A 1K44A 3MMCB 3IWLA 4R25A 1G15A 1RCOB 5EHHA 2ILYA 2EI5A 3HZ6A 1Q7YT 2P9SB 4OHZA 3R6LB 1K8AT 2W42A 4M7YA 3M6ZA 3NAIA 1YBAA 3SZ2A 1SC1B 4M9JA 2KN4A 5M1NA 2ATQA 3CDEA 2GAGC 8ICEA 4CBWA 2H3ZA 2HQDA 3IM9A 3TWHA 3GE1A 1S0MA 2WONA 4AL5A 1ZQBA 3G9CA 4LFAK 3ZX2A 1X7VA 3UQSA 4CEAA 2GO8A 3ONNA 4ZP8A 3ITHB 1R8BA 3AJ1A 3H2VE 2RQ4A 5KFEA 2HNYB 3BPDA 5BRDA 2BHNA 1BPEA 2RDJA 1OMSA 1TR0A 4L6V3 3JPSA 4F7VA 4E7LA 1FRKA 3UPQA 2GWKA 1X4FA 1X4GA 3TJ9A 2UUBF 3OJSA 1N4LA 1ILYA 5J2JA 1M5HA 3EZUA 3RF9A 1HRHA 4BR4A 1XMOF 3JAMY 3LM9A 3EXYA 1K5OA 1VJQA 4JI0F 2C22A 4X65K 2YMMA 3AVAA 1QQ6A 1QHAA 3Q2TC 1UVJA 4LSLA 1R0AA 5EU7A 5HHHA 2WBNA 5A8WB 3HILA 4NWIA 5EUHA 4GXKA 2DXEA 5HNKA 5HBMA 1CS4B 4OJOA 2VC0A 2F40A 3GCXP 3UN3A 3ZT3A 4CJWA 4JKAA 3KD5E 1X4EA 1NGGA 4CJ4A 4PZNA 3KLHA 3KKSA 1YJRA 2OP5A 1HHQA 4FO0A 3MEDB 3ZLJA 4K4HA 1VQ8S 1ED1A 4L8RB 5C25B 1FNMA 4JI0J 3CJ8A 1TL7B 4ZP7A 3SQIA 1U2CA 3GV7B 4DEZA 1IG6A 1N34F 2XWYA 4PXEA 4R0JA 3CE8A 3UR3C 2M88A 3L09A 4NYFA 2EH9A 1KTQA 3HHKA 3R5BA 2QG9B 2XEXA 4X4UA 3TTCA 5AQKA 4CYUA 3G25A 2MLYA 3QRRA 4LFBJ 4YCXA 1TL4A 4B3MJ 3CHWA 3EGZA 1FDNA 3WNHA 3CJ3A 4PG7A 3WNEA 3CCWA 1UAXA 2WAQD 3NAEA 4C8OA 4HUGA 1UHUA 3I8DA 2ZHAA 4Y2MA 3T6BA 4YMMA 1YJVA 3UN5A 3KK1A 3V4IA 3ULHA 4JS4A 1WACA 4AQYF 1RU2A 5CB1A 2FVCA 2B9YA 4DUZK 4AHSA 1D4XA 3PIPL 4L3QA 3TADC 4KLGA 3DRPB 1OJ4A 4UOFA 3ASMA 1E6VA 2Z57B 1U24A 3MOJB 1N33F 1BO5O 2X3GA 1GLBG 5IILA 1E6VB 1UCNA 3IFEA 3CD6S 2RILA 2J7UA 3M6XA 1SXEA 3DRRB 4AYBD 1TVAA 3SDEB 4IO9Q 4EEKA 4ZPTR 3QEVA 5U47A 2PAVA 4GKKK 4QIEA 5ETKA 5KFPA 3G4SS 4YFUA 3BSAA 1U1PA 1D8ZA 2KP7A 2LFVA 4DPUA 3M2UA 3H8JA 5GAEI 3OYDA 2N3LA 2MGZB 1X9JA 2HLUA 3QU5A 2VHGA 1FDBA 4DCCA 3I6PA 4KAZA 2RKIB 2ZG6A 3MCOA 2YHAA 5K8MA 3PG9A 4AL7A 4ED7A 3NCPA 5GAGU 5AJ3J 2MA1A 5ALKA 3SYZA 7ICLA 8ICCA 1XMOJ 1IWAA 2Y0SF 2OD6A 1BI4A 2JFKA 2V2VA 3VQ4A 3BO3A 3ZO7A 3V1QA 2V94A 2MLZA 3R9KA 3PMNA 3AO4A 3E58A 2CN1A 2CADA 4B3RK 2HB5A 4HL9A 3K58A 4B3OA 4PWUA 2Y9UA 3TZZA 5HVHA 4LH5A 4M41A 4FXWA 1S6QA 4UY85 4CJKA 5B0FA 2HNDA 2DGVA 2DR6A 5HJYA 3V81B 3KHRA 2VASA 4M63A 2YKAA 3VQ7A 2AWZA 3MX2A 1N54B 3HI0A 4C9DA 2A1JA 1HQEA 4X62F 5KG4A 4ERDA 1T9UA 3U4LA 1QE1A 2I2YA 2XSFA 5EX3A 4BXOB 2KB2A 4DV1J 4GIBA 4N7TA 4J2DA 4ICAA 2HPUA 4BQZA 2YNFA 3W7BA 4FPIA 4FOIA 1S99A 2R2SA 4DX7A 3M8QB 1HI8A 2CWXA 3LM2A 5FPMA 3E3XA 4ZVOB 2F8LA 2P51A 3I5AA 1ROFA 4J9PA 4NLYA 1NCLA 4DR2J 4BG8A 3IO1A 4Z0UA 9ICVA 1ZQZA 9ICRA 3UXNA 3FR0A 4QZ9A 1D09B 2JEFA 1DKGD 3P5BP 3AVFA 1P7DA 2LEAA 3BS9A 1XMQF 3HSDA 2MHEA 4UB5A 4DR4J 1GAOA 2E7XA 2QLWA 3UD5A 4DB3A 3M32A 3A2FA 1HJOA 2E5LK 3ZTRA 3FEYB 4KGMA 5F8GA 2W11A 5KPZA 2ZOFA 3D2NA 3OS0A 5K20B 4X4RA 4M3TA 4EX7A 1DTQA 1WLJA 1KFSA 1REGX 2X51A 4FLXA 4C3LA 4M3YA 1RLDA 3F9KA 4NLZA 3GFYA 3D6FB 4LBHA 2DH7A 1V5VA 3OFHA 4ID5A 3D67A 3QRQA 1FFGB 1JLAA 1JLFB 1RBOB 5B0CA 3K75D 1Z25A 5IIMA 2Z1JA 1VRUA 3C8YA 2OUGA 2DNOA 3M4XA 3ZZOA 2FVPA 3NKYA 3ZD8A 3BGUA 3VQQA 1Y5NB 2QEXS 1X3NA 4JKHA 2L41A 4LF8F 1YJ9S 2M2BA 3VQBA 4MFFA 1T8EA 5E2QA 4J9UE 1TV6B 1U2VB 3G6VA 4ZVUB 1UAWA 4WKYA 4X4PA 2ATLA 5D4LA 3LDPA 4A8YA 2P8IA 1V4TA 5ALXA 4DOAA 5M1OA 3W2WA 4NYNA 1T3OA 3B0XA 2QMUB 3VGMA 1HWIA 1CJKB 4GMJB 4F5PA 5AI5A 2R8JA 3MECA 2BM1A 1Y10A 1RM6C 3PKMA 4IXCA 4EBDA 4LFCJ 3RJKA 4LQ9A 3RRKA 1LWEB 4YB5A 1ZQTA 4IUFA 1L3VA 2CAJA 1S9EA 3LWMA 4H4OA 2DY1A 1GEHA 4IDKA 3M5RA 2WVEA 3HP9A 3TUZC 1NJWA 4CJRA 1U6ZA 2RIJA 1FRLA 3QWPA 1Q16B 3WQUA 1UJ5A 1YI2N 2CJKA 1P1LA 1NKCA 3O4NA 1K47A 1BWFO 1C4AA 4MYUA 4HCCA 5GTHU 1RTJA 3US5A 3PR4A 4IG0A 3QEXA 4EYIB 2KT3A 2IHNA 2W24A 2P9UB 1NPRA 4DX6A 1N32J 1ZBLA 5F8MA 2ZUBA 1A77A 3PX4A 2CQPA 5KPTA 4XK8C 3LPUA 3MCSA 1XNQJ 2KM8C 1REVA 2R7QA 4DDFA 4M3UA 2ITMA 2P6RA 4RPXA 2Q3PA 4JV0A 3HL8A 3LZIA 4DV1F 3OPKA 1JKHB 1UFKA 4K43A 4RT2A 4JWNA 2AJ0A 1VQMS 4KH6A 4LVOP 2QC3A 1VLYA 5AQGA 4JK1A 4DZ6A 2VBXA 3FVYA 3HSCA 1YJ7A 4JI8F 3SQ4A 2WK4A 1ZBHA 3TSQA 5KFAA 5HN0A 2GWSA 2WZ1A 1UEVA 1QUVA 3T1YJ 3DLLL 5M1KA 4TUPA 3SD7A 4BE0A 3MAAB 4CEOA 4CFAA 3OHRA 5K8OA 1SIWB 3BYPA 3K2YA 4CLZA 3VF2A 5J29A 1J5EJ 3J7AP 3L95X 3PEJA 4O3OA 5HVGA 3VAGA 2BX6A 2G8WA 3OYJA 2KOBA 2A2CA 2JRSA 2IRYA 3Q8QB 5HK4A 2FJDB 2B8PA 3S6JA 2KN7A 4OMFG 4OHYA 1OSCA 3CIPA 3R7SB 4BRFA 2LQ9A 3AB2B 5E33A 2B9XA 3PX6A 4B3TK 1RTDB 2FPHX 2VQFJ 4JRQA 3DOLB 3UNYA 3UKUA 3MOZA 1WEXA 5F3XB 4KX5A 2KMDA 5KFJA 3W8PA 1NXIA 4OHVA 4CW7B 2DFLA 4CD1A 2BVZA 1GXUA 5ALJA 3MR5A 4J9LA 2A0FB 4HYKA 3A0IX 4CGDA 8ICVA 3MUMP 1WELA 5LMNK 3SR6A 2AXTU 2AJFE 4B9TA 3KFWX 2JLGA 1WSFA 1FNOA 4L3NA 3O3GA 1U45A 2GX8A 1XSPA 2WAQF 3D28A 4MH8A 3KDOA 4ZVEA 2WSCC 2D0PA 1Z00B 1EX8A 4N41A 1YZ7A 1IKVA 1KVCA 2PA8D 4ZLLA 2M70A 2NXEA 2ZJAA 3MCPA 2WVBA 3IGVA 1EQ0A 4BX9C 1WD6A 4WJ3B 5AQIA 1DGKN 4JK7A 3JTPA 5C2GA 5AZJB 3PXGa 5M1QA 1BMQB 1RISA 1WC5A 1EETB 1FIQA 1LW0B 1TL1A 2SXLA 4DUTA 1RXWA 3ISCA 1CI4A 2X1AA 2FQQB 1PZNA 1BL3A 2WVFA 2ZWHA 1MMLA 1GLJO 5B66U 3V7KA 1Z4UA 3NP5A 3HRGA 2Z4PA 4I2CA 2N3OA 3L9ZA 8ICBA 2KJVA 4P0PB 4QWBA 2NZ4A 3PR5B 3GTYX 4BWMA 2RRBA 4M04A 5LJWA 4LBIA 3S01A 2AEJA 3M8WA 4X66F 3DDKA 3EEQA 4LJXA 4CJEA 3V9UA 1J2MA 3NFAA 4Q8EA 2IDLA 3CPEA 2F4VJ 1BQNA 2E6MA 4CZLA 2M8HA 1AUDA 3SBGA 1RWPB 4A2BA 2ZZNA 3PEHA 1TAUA 4C8NA 2JWNA 4ZA1A 2ZH8A 5HMWA 4UASA 4IOCQ 9ICNA 3MEDA 2V4RA 2P9IB 4O4GB 2P6TA 4X65J 4M9HA 5IV4A 2IA0A 2RRAA 4ILMA 2E7VA 3NY0A 2E20A 3HHLC 1NDLA 2P9PB 1H2VZ 3N6LA 5CH7B 1PK1A 1BD6A 1YGYA 4NLNA 2XZTB 1Q81O 2UUAF 1VK3A 2VQFK 2BCVA 3BR8A 4USAA 3O1WA 3OTQA 3SCKE 2NRVA 2BDUA 4ZCIA 4FLVA 5DGAA 3BJYA 4FJJA 1RDWX 2AKWB 4E1JA 4M5GA 2BE2A 2XMUA 5DLGA 3ZZZA 3GIIA 4KI6A 5LMUJ 3SIPB 5L1IA 1UFWA 1C0MA 4DV4J 1U25A 4PKIA 3SEIA 2CPJA 2XMMA 3WIVA 2KV2A 1B99A 1B3TA 2JZBA 2KE7A 4KH0B 4RW6A 2HVDA 4ZCKA 3OYKA 4UUXA 3IS9A 4JI2K 5JLFA 3I4PA 2PDAA 1LWFB 1IKVB 4CFBA 4K41A 3T69A 1YJWS 3Q86A 1XU4A 4NLVA 3A4TA 5E3PA 4E1MA 4BE2A 1FERA 1ATRA 1JL1A 3ZTQA 4QR1A 4MO4A 4QOZB 2IOCA 2N1RA 4EHUA 2KIWA 2H65B 3I31A 1MQ3A 2Z8QA 4JKBA 3ZZ0A 3UCGA 3NVZA 1QAIA 3QU7A 2PMZF 3RYLA 3SAFA 4E1NA 3BREA 4QWAA 3FJ2A 5KQ8A 2HBMA 4I56A 3CP8A 5IT9O 1JLBA 3D1HA 4C6AA 4YEAA 2H51B 3DOLA 3G96A 2AEMA 4L76A 9ICPA 2HFOA 1RTDA 2FMQA 2C2MB 3IR7B 3SUOA 3KD1E 3NE6A 4QAGA 1VRUB 1JXLA 3M1FA 4LFBF 1ZRNA 1SQGA 1NMEB 1IBLF 2ZIXA 1RHMB 3KG4A 5JJBA 4RQ0A 2RKIA 2YWWA 4CE9A 4FZZA 4C0OC 5DZ7A 2UUTA 1YTUA 5J0UA 4CK2A 5LSLA 1WCLA 1UPPA 3BQTA 2LYAA 2LSNA 1K73O 3IKMA 4MK9A 3I55S 4DV2F 5CRXA 1C2PA 2ZNYA 2KFZA 1RBRA 4EMDA 2ZWPA 1F5CA 3R97A 3QEIA 2M0NA 2FLPA 3WQPA 2R8IA 4IG3B 4A8QA 4IFYB 1UWBB 3IC1A 4JI4J 1S9GB 4FF1A 1FK9A 2VBYA 2QXLA 1N33K 3DXMB 4F4KA 1EAYC 1MN9A 2UXBF 3FFIA 1SKWA 4MHVA 3BH7B 3CC4S 2G0JA 3LTOA 4DZDA 3TPQA 2NPIA 2JEIA 4YXJA 3CCLS 1A6LA 3ELHA 4J2EA 3J7YU 1QJHA 1LFPA 3GJSB 1BPYA 2KT5A 5TZVA 8ICLA 1UWAA 1LKYA 1PUZA 2I6WA 5IOLA 4DR3J 5EWEA 2HWHA 4C3MA 2PE8A 2VFUA 3G8QA 3C2LA 3UO0A 3SMPA 4LF4F 3RJMB 4Z6FA 3OL8A 3T3FA 1GLDG 4FK4A 4QPTA 4F3OA 4I2DA 7AT1B 3J81U 3AY9A 2BR0A 2EFGA 2MZTA 2LXFA 2MZQA 3EDRB 3VGKA 1XR7A 3DLGA 3PCOB 2E5JA 2W9CB 3W5XA 3HX0A 1BG3A 3KZBA 1Q82T 3DI6B 2KKVA 3CJKB 4A5AA 2ZZTA 2Q43A 4RUAA 2Q31A 2DITA 2XYGB 2D41A 2ROEA 2OELA 3ETRA 4GRSA 3A0HU 1I94F 1KOHA 3TW0A 4JI7F 2YKOA 1B43A 4J03A 1LV5A 4QR0A 1PK3A 2O3DA 4C4TA 4TU7A 2NR0A 3VN5A 3CTRA 3O0FA 4FVUA 2HMPA 2FSNA 2J9EA 5IS2A 3D6HB 1KQQA 1S97A 5IV3A 5KG6A 7ICRA 1TP7A 1FXXA 5KG5A 3N01A 2QWPA 3T7ZA 9ICAA 2F1HA 4PUOA 4GO7X 4WBFA 2W9BB 1NK6A 4KH4A 3T1HK 2KRBA 3P1GA 3SV3A 3S9HA 2PFFB 3DXSX 1HUOA 3H20A 1Y00A 2BRLA 4M3WA 3O4QA 1ULRA 4WE1B 1MC8A 3GFZA 2QB0A 2L08A 4L74A 2QFJA 4GV3A 3NS7B 2D3DA 1J5EF 4ZN3A 1S7IA 2NZCA 2J9CA 5TKYA 1NMDA 4B9SA 3TVZA 1S1WB 4FCYA 5KG2A 1XO1A 4PPZA 4C3KA 1SAZA 3ZTOA 2Q6BA 4H54A 2GMJA 3NMRA 2HHSA 1X0PA 4JKGA 3DXKB 3MGIA 3BN4A 3JQMA 5G0RB 4R8UA 1IV0A 3AL0B 3NBPB 5M2PA 1ZQPA 2J0WA 4P52A 1K9MO 2NYHA 4BRHA 5DG7A 1XN9A 3Q8VA 1NWKA 1R0BG 5T7BA 1SKRA 2Q1NA 4RQ6A 4F0HA 2KVCA 2FY8A 4EI2A 4ZIWA 1KAXA 4CBUA 1HQUA 1RZMA 4Y2QA 2VZ9A 2YI1A 1XUPO 4H5WA 5A2QY 3THWB 4EWTA 2XLJA 1VRQC 3I5CA 4DV5F 5MLCQ 2LXIA 3G0ZA 3P8BB 5E0OA 5B08A 5GTIU 2BYCA 2JZBB 4RL1A 1VQ7N 2XG8A 5HSPA 2FI1A 1G99A 2F1FA 4FJXA 3OSNA 2VQEF 3UM9A 3THYB 4OI6A 4C1NK 4M95A 1RCHA 3O9RA 1HBUA 5GAGP 2FJ6A 3AQPA 1BOTO 3MR7A 2NYIA 4QWDA 3OFGA 2QLJB 3O6QA 5BPLA 2NRTA 1G7CB 2YX1A 2N82B 1FFUA 2XHWA 3KK2A 2UU9F 3HBTA 2O1PA 1PGZA 9ICXA 4A8WA 5AQMA 2IC3A 3FBCA 3JYTA 1U49A 5I42A 2HHUA 3SQGA 4JKFA 1LXNA 1TQLA 1HKCA 9ICTA 2RS8A 1JJ2R 3NWGA 2IMOA 1IBLJ 3LDQA 5AQSA 1YVUA 1KDHA 5LJ3Y 3DLBA 5CZ1A 2FMPA 3WBZA 4LZGA 1T03A 3T1AA 5AM1A 4XPEA 2W40A 5AQPA 3AA3A 1S59A 4DR1F 1J9AA 2MSTA 3U8XA 2E44A 4DTPA 4IL6U 2JH3A 4Z2XA 4FZMA 1U1RA 4CFDA 4ER8A 4LIRA 4IYQA 4ID5B 5B0GA 3M1VB 4A5BA 1UZDA 1VS3A 1TYQB 1NGCA 1XHXA 2IYGA 3FNNA 2XNRA 3OHBA 2J9DE 4N8OA 3TZXA 2BPFA 3BYRA 4NZ6A 4LF8J 3U9DA 2DGZA 3L2VA 3F53A 1H3DA 3F41A 2KKHA 1WOQA 3CXCM 2LQJA 1FKPA 3KKAC 4I68A 3CEDA 1S22A 1PJ7A 2ZE2B 1DTQB 3ZZUA 1KAYA 2CA9A 4I69A 3UIQA 5EGYA 3WKCA 2E3TA 1C7YA 3DMJB 5KFXA 1HFEL 3K5NA 3S3NA 2QA4N 1RK8A 5DM6Q 1FRHA 3OBWA 3T9ZA 1IXKA 3OJUA 4NL5A 4DN9A 2V9WA 8ICKA 3CJ4A 3BPSP 2ABYA 3CFOA 3U02A 3EX7B 1GLEG 1RBAA 4K4TA 3RSEB 1PYTA 4UB3A 3CWJA 5EE1A 2J0QD 3QAEA 4ISEA 1YUWA 1ZM3A 2PXIA 2V8GA 3H7IA 1DLOA 3DXBA 5EOYA 2FPKA 4LF6K 1X9MA 4F5RA 2RVJA 3PLAA 5AFUH 4A4JA 3KHHA 2Z7JA 4WK1A 4YY3K 1X4DA 3HK2A 1RYSA 2Y9TA 3H5SA 4YORA 5ETMA 4CF8A 4CF2A 3U3GA 5HI7A 4I9LA 3N28A 2C28A 2Z58B 4P0QB 2F76X 4NV0A 3BN7A 4GY2B 5E5NA 2GIFA 4TY8B 3F2DA 4IQVA 4P72A 3OT9A 2YY6A 3QSIA 4V1Ak 1K8KB 1ZQNA 1S72S 2HBYB 2AQ4A 3RMAA 5DBAA 3LGMA 2VC1A 2UV8A 1L3KA 2B4OA 3V6HA 3SJJA 1YJ9N 2F5GA 2FVSA 5HAOA 3A8EA 1ZTWA 4QWEA 3CDBA 1YF5L 2C3UA 1XMQJ 2IYIA 3FM9A 3OXLA 5KFTA 1X60A 4ECSA 4UZCA 2PFUA 2ZD1B 3VVTA 3I9V9 4BDZA 4ELUA 1A0OB 3CO0P 3MEGA 3OR1A 1RBLA 3B9JA 3KLGB 5AQNA 3JTOA 4ILJA 2KRRA 4HUFA 3U7JA 2DYAA 4Q2LA 4FYVB 2R7OA 3L4PA 2YXLA 3MR6A 3CNQP 1SC4B 4YB1P 1B9DA 1IG8A 5M1FA 1Q7YO 2YJFA 3UQ2A 4RPZA 2ZUGA 3HZEA 3S7RA 5KFOA 2ZUAA 1VMBA 4FLTA 4DWIA 1RLCL 4V19S 2HZAA 5CD4H 4C11B 4A61A 1HUZA 3M7VA 5HATA 1OQ3A 5LMNJ 4FJ8A 1HHTP 5BR8K 3PYEA 4KLSA 1EQMA 2E1CA 1X8DA 3VV2B 1S6QB 1MWMA 4R63A 2C42A 1DTTA 3MD3A 3QMLA 3NVMA 3EWGA 2J7KA 2OEHA 3G86A 1HBUB 2RJZA 2QWMA 4JI4K 5FPEA 4BREA 4F93B 5D6GA 4FO6A 2ZJ8A 2PFPA 1Y3JA 2V67A 2JEJA 5FD1A 4JI7J 4OGCA 1J2VA 3FK4A 1N8RO 2VUGA 5GVQA 1CBKA 1HQ2A 3ZNJ1 4WTYA 3FZLA 1HWUA 3HFZB 2B5JB 4O44A 5ADZA 3ULDA 1KLMA 4GNIA 1U4BA 4JI2J 4F0KA 3ZI4A 5ETSA 1Y7PA 7ICGA 4J9SA 2FLLA 4LRCA 3CCUN 2JGAA 2DGSA 4NLSA 5IQQA 2P9GA 2W43A 3LAKA 5AI4A 5J0OA 3R27A 4CJSA 3CCQS 1SJ3P 2LLZA 3OUYB 2PKEA 4X4SA 4MIBA 4DV0K 2HK2A 3S3MA 3D2EA 4FBTA 5AJ3F 4FL9A 5AQOA 4BC5A 2JL9A 2XVTA 1EHWA 1Z2LA 1MMNA 4YY3J 4CT8A 2DF4B 4QZBA 1S1VA 1N32F 1VJ5A 3AHPA 4K0KJ 3O9UA 2CNNB 1IBKJ 1U1KA 1X1PA 3OTCA 3GV5B 4X64J 4ZPVR 5KGXA 2QARB 1RA7A 5F3ZA 3L3VA 3R5CA 3PRBA 1P90A 4CLUA 3ZDDA 2KJ8A 4DFKA 7ICTA 1F0MA 2W2MP 3E01B 4NLPA 1BPDA 2I1QA 4G1PA 3I0RA 2UXDK 2OJ3A 1IO2A 5KGWA 3B6OA 2WF7A 3I5BA 3AXMA 2MQ8A 3ZDBA 4WQ4C 3TEGA 2E9RX 2D7SA 1TE2A 4KR0B 1PC5A 5H9FK 3F5AA 2D1CA 4H4KC 3OYMA 2W9BA 1HX1A 4HH1A 4WFNQ 2R8HA 1HKAA 4KE5A 5EE9A 4HLBA 4Z4GA 3MCAB 1APSA 1RTHB 4H5RA 2C3MA 3B4MA 3PJXA 5LOQA 3JPPA 4LFCF 3OVBA 3AA8A 4UT4A 3OHAA 5GAHI 3DRXA 4F9OA 2B21A 2CQCA 1IXRA 4C4RA 4G1QB 1WJ9A 9ICFA 4ZPAA 3RU0A 2ZUCA 2CQ2A 4UQTA 3VCDA 5ALRA 4J37A 3ZTPA 1OKJA 2LECA 5F8JA 2ZH7A 2WF6A 3I56N 1BCMA 1ZBTA 2ZH9A 2PEHA 4CM0A 4ILGB 1WDTA 3GG4A 4PL1A 2F9WA 5GINA 3CC7N 4QZAA 5J0XA 3CIMA 1DQ9A 4WFNL 3PSFA 4U7UD 3V4IB 1HKBA 3TSPA 2ES6A 4CF9A 1NM1A 4ES3A 4KLQA 1NZ8A 1HNWK 1M0SA 7ICSA 3GLJA 4ITSA 5LY3A 2BQ3A 2ZE2A 2AW0A 2EPIA 2RHSB 4IDKB 3CJ1A 2CQ3A 3EYZA 1U0SA 1NK9A 3SCLE 4NI2B 3HP6A 2QSWA 3MR3A 2P9IA 4P7TA 2IDEA 3N6NA 4EFHA 2HVIA 2HSEB 2ZBQA 2G2ZA 5LJVA 3TAMA 1H1VA 3SBTA 3ZDAA 1NDKA 3KLEB 4OJHA 3VEYA 1RAEB 3W65A 3C2PA 5KFBA 3HHNB 3C14A 3UE5A 2QV6A 4TU9A 3BO4A 3HMJG 4A8MP 4WFZA 1OWXA 1UPMB 4PHAA 1VQ8N 2HMIA 4DV7K 3D0PA 5KT7A 3VQDA 3T9NA 1IKWB 2I1RA 1Z4OA 2CH5A 4DL2A 2EKYA 3DRYA 1RKIA 4BGAA 3SK3A 2O4GA 3UDEA 4OX9J 4MMOA 2XQCA 1L7NA 3KJFB 2E8PA 2MQQA 4QWCA 3GZFA 1XTZA 3U1MA 2HS0A 4JN4A 4Y2XA 4N56A 5LJ5Y 3SPYA 1Q9YA 4FLYA 3THPA 4ILLA 5AQTA 3IDHA 3QEAZ 2EK6A 3MEEB 1VQ5S 4KO0B 3NMAA 2JDJA 2CPRA 4BE1A 3CJRA 3Q7CA 4FF3A 5AZJA 1QY7A 1PILA 4HDGA 4ZN1A 1JI7A 4XH1A 2DTUA 3CJ0A 4KB0A 2YNGA 4P2FA 3R1XA 3D1OA 3DLGB 4I0WA 1EX4A 3MM5A 2E2OA 1NJYA 1WOOA 1RT5A 4R5PA 1J2NA 5KAIU 2MQLA 1L3SA 2HLTA 2IVYA 4C0BA 1RHKB 2ACYA 4P4OA 3HRDD 2KVQE 4IBNA 3AVIA 2C2RA 1BUXA 4DV6K 4P75A 3NS6A 5AK4A 3R8EA 4ZJQA 4H0TB 1NO8A 2OSRA 3NF6A 4GVBA 1NBWA 4P4PA 2YKMA 2BJEA 1HR0F 2GUPA 3K89A 3WXMB 1XERA 1U7LA 4MKVA 5ALYA 5G0RA 3TAGA 3DGVA 5GMKa 1RYUA 5LM7E 5IC4B 5GAGI 2DKOB 8ICWA 1J27A 3TA2A 5D15A 1YLXA 4JV5F 3BS7A 4KRWA 2QARA 4IJAA 3IM1A 1TK0A 4CI0B 1HLUA 1ZQOA 1D1UA 1LXJA 3ISBA 2MQPA 4E7HA 1BWEA 1VLOA 1D9FA 4IOAL 4LFAJ 1BWVA 3CD7A 2K06A 3Q8SB 5ALZA 2AT1B 3MN5A 3M6UA 4M5NA 2O67A 2Y1RI 2PMZD 4BR9A 3BQ0A 4U8VA 1GX6A 2HHVA 2B51A 3MM6A 3C16A 2U2FA 1RXOB 2KKZA 1QDUB 3THXB 2JEGA 1UZHA 2XTJP 1WG5A 4DQSA 3CCRN 1C1CA 5HP4A 5CABA 3DDIA 5ETOA 2DK2A 4B9QA 2IAJA 2IC3B 3MX5A 3A3OB 4LF1A 1M1HA 2RPIA 4F4YA 4MQ3A 2G13A 3TA1A 2FVRA 4CO1A 1HMVA 4LF5F 2KVSA 1A5WA 1IUJA 1DTTB 5KFNA 3HKZC 3KOAA 4XEIA 3KYLA 3QGGA 1VQON 3BDPA 3H25A 1QH9A 2LDIA 3N5FA 3BBCA 2M9NA 1N56A 1ZQJA 1S72N 4P0QA 3VA0A 2IJRA 5DGBA 4PHEA 4P0PA 4TXSA 3QLHB 3H3OB 5D8HB 4FWMA 1OSDA 1A5VA 3EZWA 3EY1A 1BNPA 4WYWA 2Q1LA 4OI4A 1Q5YA 2QWQA 1T9WA 1WI6A 2FHKA 4OZJA 3M6VA 3P49B 1WBDA 2B5JA 4RQ2A 3A5LC 1T9XA 5AXLA 3OYBA 3PUFA 2E8NA 2GHWA 3CMES 1VSMA 4PGQA 2WF5A 1EB0A 1YWXA 1FDDA 3PSTA 5ALPA 4NA1A 3BKFA 2AP6A 3N7RC 4BRGA 3CC2N 2K7JA 4WJBA 4QZVB 1ZD4A 4I6YA 1IJJA 1RWMB 5AQQA 5EVZA 3H8YA 3ZT2A 1L7PA 3RJIA 4CHOA 2E1MC 4KY3A 3CQXA 2OMLA 4ZJOA 5IT0A 5F8HA 2XY8A 4CJFA 3BZQA 4DV7F 1N36J 4ELVA 3ZZPA 4QIVA 2HAIA 4ZLPA 2XCPA 3QNNA 2PEBA 4GKJJ 2J6UA 4IQXA 3AVNA 3CFRA 1JN3A 1PIEA 2E5LJ 1RAFB 3HPGA 3TX0A 3ZSRA 3D7EO 3VF4A 4W5OA 1VGYA 9ICBA 1Y88A 1B7FA 3AVKA 2GH1A 4V19X 2PMWA 3CW2C 2GV1A 4MF8A 4A57A 3J7A1 4X64K 4CIOA 2XULA 4I28A 1K1QA 1VQNS 4C7QA 4AXJA 3RFAA 1PYOB 1W97L 2MY8A 4DSIA 2XS2A 3EMTA 1RG6A 4LZDA 1ZA1B 4NL9A 2WF8A 4R79A 1OPZA 1W2BM 2KG5A 3EUB2 3C6HA 4U9RA 2M8DB 3M7DA 3IV6A 4LF2A 1ASWA 3GSDA 3KMSA 2W3RA 4QYRA 4P2SA 4J91A 4PR6A 3T19A 1JLBB 2R7SA 2MPUA 3QETA 1A7GE 4JI5K 2EKNA 4YOYA 5D3GB 2ZBCA 4LF9J 2IMWP 3AU2A 4OJGA 3BEGB 4F4XA 4OYXA 2CXYA 3TRGA 4HTLA 5E3CA 1NOYA 1R8CA 1LCUA 4JI6J 3UMCA 4KHQA 4KHMA 2J76E 1VBYA 3K5OA 1WSGA 4AH9A 3RGIA 2RP5A 1OH6A 4V19J 3H0PA 1U8SA 5KT2A 1S1UA 1ZQIA 4CGZA 2BE7D 2G09A 1ZXOA 1O03A 1PJ5A 1AFJA 3C1YA 4JV5K 4XH4A 2CPZA 4YP3A 2IOHA 4NRUA 3RRHA 3VCBA 3DOKA 4BRIA 2OZMA 2FLNA 2AF6A 3H45C 2KSOA 4HR2A 3MDAA 3SXLA 4YNQA 4F5QA 2CPHA 4N47A 4OLOA 1LW2B 3D54A 2HMXA 5TISU 3OSPA 2HNZB 4C11A 2EAOA 4CIEA 1K73T 5IWAK 1GO3F 4QYZK 3C2KA 1FFSB 3DXKA 3PNCA 5J1EA 2KKPA 1HQEB 2E1AA 2P9CA 3DOKB 1EKSA 1T44A 4QS8A 4BRQA 4TYBA 2VANA 2WONB 3TOQA 4A8EA 2COLA 7ICIA 4F25A 3M1VA 3SBMA 2XYHB 2NYVA 4I2GA 1PVPA 3R6MA 4Y2TA 3PO5A 4FE3A 1RT7A 1BIUA 2DGWA 5EWGA 4K0KK 3H46O 3K5LA 1I3AA 2P9LA 4DTSA 5LL6Z 2E4LA 3ATVA 7ICQA 3DLKB 2VIXA 3LA0A 3UN2A 1EARA 3R3TA 5KFSA 3TTFA 4NLBA 1ZD5A 1XI1A 2HQGA 4RUBA 5F9NA 1RA6A 3W2VA 3AVCA 2O6KA 2RB7A 2O8BB 3IHQB 4DUYJ 3L7UA 4UBBA 5D78A 3NS1A 1B0TA 2KT2A 1QAJA 4KLDA 2CRLA 2HF4A 3P4UB 1P8GA 2WVCA 5I3PA 2BGWA 2MLXA 3MHYA 4RW8B 4PL2A 2H4WB 5L9XA 1X5OA 1WUAA 3ZSVA 1ZJNA 3VGLA 4H4KA 1JLFA 1KN6A 1TL1B 5H1SV 4KI4A 9ICSA 3O1LA 1JIHA 2ZQBA 3BKUA 3NH1A 2R8GA 5EOZA 5ALHA 2DPIA 1PCAA 3QO9A 3D2FA 1KOOA 3MK6A 4IG0B 4CNZA 4KHNA 1I94J 3RJJA 1ZD3A 3LDSA 3VZIA 4M9NA 3ULEA 3J81O 5FRNA 4CO5A 2UUAK 4JOUA 1NH7A 2C2ZB 2HRYA 2F9TA 4FYXB 1YSJA 4WQ5A 1RXVA 1SB6A 1FKPB 1CULA 4F8RA 2KK0A 4X4VA 3C7NB 2LMIA 4FWRA 5L9NA 4Z4EA 2OCEA 3FYHA 3DKDA 1FK9B 1SL2A 3FZ2A 2LDYA 2IBOA 2KEYA 3DU5A 1YZ6A 2K3KA 2KHVA 5C0YA 5B7WA 4TNOA 3WEEA 1U1QA 1ZZNA 4MKBA 1RBTA 2VG6B 3AVBA 1G3OA 3RAQA 1AXQA 1Z4NA 2VFTA 3NWRA 2RE2A 2Z0GA 2E8OA 2AU0A 4GV6A 4OYIA 4UUWA 2YB1A 2AYBA 4DI6A 1TFWA 1CQMA 1LKZA 4ED5A 3TNVA 2V68A 4DFDA 2VF3A 2AP1A 5KG3A 5HR7A 5ALMA 4JHDB 4KFBA 3LP2B 1R8AA 4PGYA 3P5TL 3MM9B 4OI3A 3VC8A 3MR2A 4IOXA 1PAUB 1UKUA 4FYDA 2YHYA 4CH0S 4ICLA 1U1LA 4URGA 1N5SA 1OY9A 3J7YI 2HMIB 1MA7A 4IFVA 2ZIVA 1XWLA 1VK8A 2HWTA 1FA0A 5FPDA 2VFSA 5J1PA 1RT4B 4M9GA 4M2YA 1WHVA 2EFNA 1HNZF 4B3TJ 4MEYA 4M5DA 4MAKA 3EXCX 2EFPA 4F5NA 4BR2A 2K8BB 3O8WA 2CNOB 1G6BA 1S12A 3RB3A 2HKEA 3GONA 1N63A 2IDOA 4KN4A 3OUYA 1PVQA 2DNGA 3GQCA 4XA5A 3QSYB 2RNEA 5EY4A 3UFCX 3M1YA 2CVEA 1RWXB 2CGJA 4Y2KA 2AYGA 2FJAB 2QSFA 3KLIB 3Q7BA 5EE3A 2CPYA 4YMOA 2GX9A 4DR1K 1CEZA 1YJWN 1LKYB 4YVZA 1GFWB 5L8RC 4B17A 4IH7A 5H9EJ 2DRDA 2BOPA 2O4IA 4ID8A 2ZBIA 3MWPA 3N4QA 5J2AA 4NYZA 4CZGA 4GVEA 1WG4A 2CJQA 1Q78A 5JVHL 2FZKB 1RQ0A 2LQ5A 2DNHA 1EKEA 4F92B 3VENA 1WSVA 2G8UA 4B1YB 2P6UA 3F0NA 1R89A 1RTIB 3O5TB 4YFKA 5KAFU 1HBOA 1KSPA 1RWKB 1JNZB 3FSIA 2MY7A 5J2MB 1KXPA 5AZIB 1VFJA 1U2FA 2HS3A 4ZOHC 1UJ6A 5EDWA 1R7IA 3LW5C 7FD1A 3QIDA 3TUPA 1KCFA 9ICIA 3R5JB 4DG1B 5F8NA 3DLEA 3EZOA 1UVMA 2MJUA 4EIAA 2C2KB 2BPGA 2HBRB 2DBYA 4Y1DA 2VFRA 1R8HA 2ZIUB 4CLSA 2N7CA 2V2KA 3BR9A 2OIHA 2A2DA 3JQJA 1EQYA 2JH7A 5F9LA 2QJ3A 1IVZA 3THXA 1XC3A 2VOPA 1S7HA 3DJCA 1BVSA 3K0SA 2CQBA 2Q36A 2ZJRQ 3FLCO 3A8JA 3MAHA 3R7NB 3DRSA 4NCAA 2P9KB 2XZDB 1RYRA 3UMGA 1JJCB 2ASDA 4EYHB 5AQUA 5J0PA 3CCMS 2XMKA 4IQTA 4PAAA 1FRJA 1HR0K 4CZKA 2YQ1A 3EN9A 4PXCA 1ZOTA 3ZZRA 2D5RA 1ZQVA 4WCEL 2ZEJA 8RUCA 4DN0A 2BCSA 2IVNA 4OYAA 3DLRA 3DRRA 4WF9Q 4JV5J 1FFVA 4B9UA 1X2IA 2NS1B 4RNNA 3PIOL 3IBFB 5F1XA 3H8SA 4DCJB 4C8YA 5HLFA 4OPJA 3EW9A 3LH2S 2GS8A 5AKEA 1E3MA 1WEYA 1FEHA 2ZIUA 4GVBB 4WIIA 2BE2B 5A6WA 1HWJA 1KEKA 2W7AA 1F9HA 4Q7AA 1ZM4A 1IBKK 1D8YA 3H90A 4M1KA 3SSQA 3HO1A 7ICOA 1RT3A 2WAQC 4UY8O 3KJNB 1TKZA 2O8FA 4FJKA 3ISDA 3BQ2A 3BS5A 2ZM6F 3HM9A 1B9FA 3CJSA 4A8XA 4ZVSB 1D5AA 1UP1A 4H0PA 2YWKA 4PHPA 3RBXA 1JL2A 1OQ6A 5HMXA 4B8CA 1Q8KA 4BC9A 3MEEA 2JWKA 3PIOQ 2Q3SA 4AM6A 4IS7A 1S1TB 3B4DA 3KTQA 5ALGA 3A5MC 2NCKL 4NJ8A 3P38A 3QFHA 4O4RA 4I64A 3AM9A 1Q82O 1S1TA 4MFBA 4CJ3A 4Y2UA 2HOIA 3NGRA 2OLWA 4M63C 4PPDA 1F0XA 4ECTA 4U95A 2YKMB 3ILLA 3P83D 5GADP 2W9MA 2EC2A 2VV5A 3RMCA 4PUOB 1K9MT 3RVCA 1V38A 2W55A 2CQHA 1Q5VA 4AHCA 1ICEB 2PC6A 4HACB 4I6AA 1HPMA 1I1GA 4DUZF 3KOOA 4EX6A 3HSTB 3HOTA 4ECXA 3TVKA 3ZFVA 5FJ4A 3VEOA 4K4ZA 4FNIA 4OJ3A 3QFPA 1Q53A 4RWTA 3O1BA 1GH8A 2QWNA 4K4SA 5MLCV 2C2DA 1ZBSA 3CFPA 2A1BA 1G4CA 4F4ZA 3CCQN 5IT9Y 3C7NA 5T41A 2RUSA 4O55A 2UVRA 3MFIA 3IMXA 3CCUS 4JNEA 3HD2A 5BXIA 3G87A 2YWGA 2EFVA 3NVWA 1V85A 4CLYA 2M3DA 2F7TA 3CD0A 2YMPA 3UKRB 1HI0P 1C0UB 2OPQB 3UMBA 7ICVA 2GIQA 3GYGA 3AARA 4DV2J 4DJBA 3FCWA 3J7AN 3R2DJ 3KWMA 2CUYA 1TL3B 4DSLA 3JPRA 3ENWA 3EE9A 1HPZA 2VPZB 4KFBB 3VQAA 1GLFO 1QS4A 4Z4IA 2QN6B 1F21A 4I6WA 3CCJN 2OTLN 2Q2RA 2GO9A 4C8LA 9ICHA 2WSFC 1KQKA 2FDRA 2ZC3A 5AQZA 1O0PA 3FQLA 5CCLA 4DU7A 2OTJS 3M2VA 3QBCA 1ZETA 3BF1A 2NV3A 4RW9B 4B08A 3CMEN 5D46A 3MCNA 5KI6A 2ZH1A 1J53A 4TLRA 3QESA 2OSQA 4CQ1A 3TANA 4CJTA 3GJTB 2CPFA 1T9TA 1U6BA 4AXIA 3NLCA 4O5BA 1YJNN 5KFFA 4WP8A 2OPRB 3TZWA 3MDCA 3R3LA 5GIOA 1AYEA 4PYDA 2CQDA 4DR3K 2CG8A 4ISGA 3W2VB 5DQIA 2OPQA 2RDIA 3GFKB 2RDDA 5AZIA 3LP2A 4ZP9A 2GUIA 2YH0A 4DR6F 5K8NA 2CDQA 2CVIA 1ATNA 2GC8A 5I42B 2Y9HA 3NG8A 4IH5A 3AAPA 3RMDA 4MDBA 3U1NA 3L4BC 5FLXY 1C4CA 4RCHA 1WHXA 1LQ9A 2N4DA 3LDLA 3PZPA 1YDLA 4Q0BB 2PFQA 4K42A 3QPIA 3L7OA 2OGUA 1RPLA 1HIWA 3WKBA 3HPOA 1WEZA 2HHPA 1NZPA 2GQCA 3JPTA 4OYPA 5CXTA 3G6EN 1NRKA 4KBOA 3AVLA 1F3FA 2DPNA 1LWXA 2J8SA 1UVLA 2B7BB 3LQVA 1HIYA 3OA9A 1T0TV 4WYLA 2E1FA 2UUCF 1WUDA 1YTYA 3ETLA 3ZSXA 1RT2B 2VG5A 5I9EB 4UF4A 1VSHA 3LP0A 1WKLA 3TUJC 2H3QA 1IBCB 5LXRA 1WF0A 3I32A 3OY9A 1O1WA 4FKXA 4PEOA 1LOUA 3LANA 4DFPA 2JSXA 4DSJA 1W2IA 4B1VA 1DQAA 9ICLA 4TKTA 2CQ4A 5GAEU 2MZJA 3E01A 3A5NC 1B0VA 1RT4A 3NBPA 2DNQA 2PD1A 3AGKA 2ZIWB 4CJVA 4I2IA 1FTCA 2CXEA 4Z7YA 3AO2A 3O4WA 4C8ZA 1COKA 3ZX3A 2Y8YA 3OR2A 3BUZB 1F9EB 4LRBA 1KD1T 1RDCA 1CUKA 4LF6J 2EAMA 1NMNA 5JS1A 1BQXA 4PZVA 3OYHA 4CZEA 5ALQA 2DUYA 2O8DA 1L8LA 2E2PA 3T5JA 1P9YA 3SAGA 3K0JA 2ZH5A 1T3VA 3MWBA 4I2QB 2ADCA 3VR1A 2J6TA 5DZ6A 4LBPA 2K3IA 1NJIO 1QQCA 1HHSA 2ODGA 4ZPBA 1HNWF 2OPPB 3FEZA 1N5WA 3R1HA 4QU6A 3H98A 1KVBA 2VG6A 2HIQA 3K1ZA 3ZSYA 9ATCB 3M32B 5AK3A 3MMCA 2QLTA 1VCTA 5EN1A 5LT5A 4ETZA 2VGNA 5KFUA 4XRHA 2R7XA 1RAJA 4WZQA 3SV4A 4X4QA 1KW4A 1RHUB 3KLEA 3DLJA 3HULA 4ICLB 2F4VF 2A3ZA 1C20A 2CNKB 2XS5A 1OVYA 1UMJA 1GLAG 3C29A 4ECQA 4NLQA 4DQPA 3M2VB 3DAWA 1NNLA 5J2PA 3ZT0A 1KP6A 2CJBA 3U1LA 4A62A 3C2MA 3C16B 2JHEA 2CQIA 4K50A 4BRNA 1VJWA 5JVGQ 3O2IA 4L75A 2XC9A 2KFNA 3V6DA 1B7YB 2KXHA 4Q8FA 1TL3A 3ZC4A 4A8OA 1PAEX 1FKOB 2IFXA 2BM0A 4CZCA 5AI8A 1WKKA 1U6FA 2Z2LA 4IWVA 4Z7CA 2UUAJ 3C3LA 1F5SA 2BGGA 3H40A 3C6UA 5ETRA 5DKWA 2J5AA 3LDNA 3UXOA 1S6PA 4IOAQ 2IIHA 4K25A 2K8GA 4CGGA 3NUQA 2A3VA 2NNWA 3L8BA 3FC9A 5EE0A 2UUWA 3AN1A 1DRZA 3IAM9 2UXCF 4PWDA 2FHMA 3H8MA 1JJHA 2NPFA 1VQMN 2AYEA 4JV2A 5ALOA 4ED0A 4USUA 3RW6A 4IC9A 1GX5A 3W61A 3V9WA 4MK7A 3GIRA 4DOCA 3HHLB 2E9TA 3KK3B 1JMSA 1IBMJ 2L48A 4YOEA 2YVSA 1ZD2P 1GTHA 1DOQA 1N6QB 3C65A 4OX8A 3EGVA 5BJRA 4FS2A 3UNGC 1V4SA 4FWKA 4X66J 1JALA 3VGUA 1NJIT 3MDQA 4IO9L 2GVZA 5E84A 3UD3P 1BPZA 3SUNA 2KHCA 3FMBA 4DR7F 4CLPA 1ZQCA 5F3TA 1IWGA 1YKWA 1CJVB 4QIWC 1UTAA 2JVOA 1BQMB 2M0GB 8ICXA 3UKUB 1OPIA 4OPHA 4U67L 3MXJA 4NCBA 3J7Z5 2CGLA 1TL7A 2CGKA 3CC2S 4NLKA 2FSJA 2BMBA 2HQ3A 3HHLD 3L3UA 2FJBB 3WXJA 4KGVB 1Q4RA 4FPRA 3J80U 2RF2A 3VGVA 2N7YA 1ZQQA 3LGNA 4URQU 4O5CA 4LF8K 1RDRA 4F5OA 2K4PA 4P6QA 2O66A 2KG0A 1CLFA 4XH5A 8ICMA 5ETPA 2RQ5A 1V3RA 2YQ3A 2EK1A 1VQKS 3DRSB 2WTFA 3QZ8A 3WK6A 2W7PA 3POTA 4BR5A 4CEDA 2Z1IA 1HD1A 1BDGA 2EHGA 2MTLA 2HCFA 1IJEB 3D3CJ 1Y3KA 3J81Y 2JOQA 4OQJA 2KZMA 4J8FA 5M2RA 1XNQF 2QLFB 1N5YA 1NLKL 4WCEQ 4BRDA 4P71A 2VWBA 3FFIB 4ZKAA 4C4SA 1ZQRA 2EG1A 2HEKA 4DR5F 4PZOA 3IWNC 2DJWA 3O9TA 3E66A 3AQOA 3MUVP 1W26A 3BP8A 3RB4A 2XB2D 1WWUA 2HNYA 2YNFB 5AICA 1PBAA 4B1XB 3VGTA 2HBLA 2QZ8A 4Y2AA 2WSEC 4F02A 2DY4A 2RQKA 3WIUA 3M9NB 2J4RA 1QTMA 1M5VC 3T79A 3VAJA 2HZVA 2CFXA 2JV3A 2G06A 3SCXA 5IT9U 4CHNA 2VB6A 1Q3VA 1BY9A 5KFZA 1ZQFA 1S1WA 2YPYA 1KVAA 1NDCA 4OIXA 1ZQKA 3MWTA 1ASUA 1V5IB 1LWCB 1HLWA 3G8TA 3T5LA 2HHQA 1RAHB 4KH5A 2DT9A 1NGJA 4FJ9A 5BPMA 1IN0A 2Y0BB 3L4IA 2CQGA 5FPNA 4DQ8A 2PFDA 5D4OA 2PFOA 3RJHA 4QYZJ 1YTAA 2JH1A 1KR4A 3M2RA 3OYNA 1XMOK 4KRFA 1S10A 1XO0A 2BKNA 4CZHA 5THWA 4ED4A 3O8MA 2R7TA 4BC3A 1TVRA 3KJQB 4YHHF 2B4PA 5EX0A 2XMJA 5G5HA 3THWA 2PN6A 1ZOLA 3MD1A 1VQNN 1T3NA 2BKEA 3PKYA 4JI8K 2OPRA 2DIVA 3CB4A 2VJUA 4Y1CA 3FRZA 3PW4A 5J2FA 3M2RB 3CVKA 4FDFA 5FLXO 5CY4A 1NOZA 5CEHA 5HP1B 3LP0B 4RJVA 3AFGA 1N88A 3PW7A 1U09A 4QIWF 3DM2B 4QZFA 1FFWB 3WX4A 3MMBB 4I2PA 2NQPA 3SCJE 3TJAA 2GELA 3JS6A 4FWNA 4DUYK 2KU7A 1ZZFA 1X5TA 5AKLA 4FW2A 3CD5A 1OIAA 4NOHA 3NCQA 1KN5A 1ZQSA 5HRNA 5KRSA 2E29A 5CA5A 3ZT4A 3P3DA 1K6YA 4O3RA 1F5AA 3HYFA 3FQKA 3QLHA 2PY5A 5AM0A 4J9VA 4LF4J 5CZVA 3BGLA 3WC2A 2HFUA 3S1TA 1VYAA 2XGPA 3RAMA 4AHUA 1VQLS 5ADXA 2DKZA 4KTWA 1V3SA 3BB5A 2V34A 4KHYA 2UVVA 1WSRA 4EU0A 4M42A 3J80Y 4KC5A 2VQEK 1DK3A 1DZ5A 3U9ZA 2ZTDA 2ZM6J 1SWVA 3FUYA 4P9SA 5D4PA 1QSSA 1Y5LB 2G8KA 2MSSA 4AILC 1ELOA 3ED5A 3M9MB 1S1UB 2ZBRA 3F2CA 3HT0A 2KH9A 1TYQA 4NLWA 2IAJB 5J2NA 4K0KF 2MDAA 2YQ0A 1IKXB 1RT7B 2UUCJ 3I33A 2YNHB 4CZJA 1F5BA 4LREA 1SV4A 1XIQA 4CE6A 5DBBA 4UW2A 1PJ6A 4EUVA 3O9QA 3O6WA 2ACMA 4ZHRA 4FXVA 3CF5L 2AJ4A 3W60A 5L1KA 1SJRA 3ADAC 4BG9A 2I9GA 1VQYA 4EEYA 2HGLA 2Z56B 2QXFA 4JLHA 3T6JA 1NK4A 1IBMF 2EVZA 4DR4K 2EFOA 3SENA 1RHQB 2QIFA 1Q81T 4DQQA 1RWVB 2KYXA 3SMZA 4DPYA 3OYGA 3I0SA 4RPFA 5C2FA 1HPZB 3ILJA 2FHJD 4YR0A 2W01A 1JLEB 8ICRA 3TAFA 3V1RA 2BCRA 1X9XA 3HJVA 4KGZB 1VQSA 3NVKA 1HARA 3Q8RB 2BANA 2HFNA 3LP3A 2BCQA 4OKKA 4B8AB 5HRSA 3FBEA 8ICJA 5HANA 1OXJA 1DAXA 4CH7A 3IFRA 1QQ7A 1RDFA 4WKRA 2J0XA 4A8FA 1HJRA 2DFFA 2XO7A 2C3PA 2D8CA 3MABA 1QHTA 3CJ7A 3TAEA 2E7WA 5LXYA 5J0YA 3G10A 3AOBA 1Y9OA 4DSKA 1RSCA 4FJGA 1NAQA 4DR2F 4KLFA 4FPBA 2FIUA 4E3SA 1K8KA 5HP1A 1SC6A 1U02A 4HHTA 2QA4G 1U1OA 1KVKA 5HQMA 2YWEA 3M2UB 4M5KA 3PACA 3CPWM 4ZJLA 4IEIA 1JLQA 4B9LA 4WTOB 1Q0NA 2RQCA 8ICIA 2IGIA 8ICZA 3I9ZA 3HTVA 2AH5A 3WXKA 2F8TA 3ULEB 5GIPA 3V9SA 1BA0A 1VHXA 3TWZA 5HRRA 4I7FB 4O0JA 2XI9A 5ADXH 1Y4ZB 1RT2A 3DLKA 1YJTA 3HVTA 3SSSA 3WKEA 2VD3A 4M6WA 2LM4A 4IOCL 3QEPA 4I67A 5JTIA 3K59A 4JYAJ 1QD1A 1VBZA 4PA1A 1FRXA 2G2YA 3EL2A 5C10A 5KFVA 3NAHA 3B54A 2CQ1A 2YMLA 1Z6RA 4DLEA 3ISND 4PQUB 2KQ2A 2G0IA 3W9HA 4U67Q 3ZSWA 3SI8A 3C15B 4NXMJ 4NLCA 2DWQA 2E9ZA 5IM0B 2B7CB 4IO1A 2LA6A 1CZAN 3HVWA 4WK3A 5AQVA 2F44A 2HWIA 3ETMA 4M0AA 3FC4A 4CF3A 3R5GA 3D2WA 3EM1A 1N52B 3QU9A 3EICA 5AI9A 4O3MA 1KHVA 1SGGA 1FD8A 4RNOA 3VEZA 3BBBA 3H0LB 3TI0A 3BEXA 4IFEA 4CJ5A 1NLVA 2FYXA 2JC1A 2KW4A 3OVNA 4U8YA 1KQSM 3MBYA 3RH5A 1WN7A 4DFMA 4RTFD 1Z19A 7ICNA 2GQQA 4HKQA 5HLFB 2JC0A 2YKNB 2ZKTA 4C8KA 4ZPDA 2W6LA 1Q86T 5AIAA 3DGPB 4CLKA 5J2IA 1YBUA 2RS2A 2AGOA 1VQPS 1UETA 1R27B 1TAMA 1FESA 4QQBA 5KAKA 4DR4F 4FLZA 2W04A 1R0CB 3K8WA 4JI5J 3WXIA 2QTWA 3VGSA 5L39A 4BRMA 3IP4B 3OYCA 3A3PB 5IQ6A 5M2UA 4E7IA 4JUZA 4KLMA 5DG9A 4ECYA 2DGQA 4J90A 1R31A 3AD9C 1VQ9S 4ILHA 3P4IA 2MQOA 4KHRA 1UW4A 4NLDA 3F2KA 2FGCA 2NUBA 4CEBA 1SZHA 3KNGA 3Q23A 4CP5A 1ZQWA 5LMUK 4I2PB 4XDCA 4J9RA 5AQXA 3MM8B 3DWLA 2POKA 1RAOA 8ICNA 2YNIA 2QM1A 2DB1A 2PGCA 3FE1A 4IOBA 5H2FU 1LK7A 4NA2A 3VALA 2P35A 1IBMK 3Q2SC 3AA5X 3P45B 2A19A 3KZIU 2HOQA 3M3ZA 1JXVA 3LOUA 3VPZA 3JPQA 2K7KA 2MKKA 4X66K 2CNLB 2QTDA 1TUYA 2JZ5A 2D0CA 3MECB 2DVIA 5D3GA 2DY9A 3J7ZT 2B3TB 4ZPWR 2XI2A 4M9LA 4JKEA 1TV9A 3OTOJ 4BACA 3LO3A 4KN7A 4NLOA 3AJDA 5K14B 3TA0A 4OJPA 1YRXA 2HURA 3GSIA 4JI3K 4KHWA 1S9EB 2QL9B 1EXNA 3RJGA 4JB3A 4OX7A