2Y1IA

Crystal structure of a s-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1iA01
4QCLA 3C6UA 4QWCA 3U3GA 5CA7A 2OA8A 1QSSA 4NYNA 3VQCA 2IOCA 3HT3A 2V4RA 4NM1A 4FJ7A 4IRKA 1NJXA 3NGDA 2KZ3A 4PGYA 4YMNA 2RPIA 2W9CA 4IFVA 4O5BA 4Q5VA 1JIHA 4TQRA 4TUPA 4YQWA 3O3GA 4M45A 3S3MA 2D0BA 1BVSA 2IDOA 3WNEA 3U6FA 3RB3A 4O4GA 4CJUA 9ICIA 5SWMA 4O5KA 2KFZA 1LWFA 2X74A 2R8GA 1H38A 3T5HA 1Z3EB 4NLGA 1KVBA 2DY4A 2XHBA 3D45A 3PV8A 3ZT4A 4ECWA 3OYMA 4I9LA 4E19A 1KTQA 2FC0A 2BHNA 3ZSZA 1YVUA 3I8DA 3H8JA 1FXXA 3EZ5A 3V81A 3MBYA 3L2VA 1A5XA 5J0UA 1RT5A 1WAJA 1S0OA 1HNVA 1Q8IA 2HVHA 1LW0A 3SQ0A 4KLGA 1TKDA 3LZIA 1LWCA 4JK1A 4FZYA 3CFPA 3ZT2A 5CHGA 1K1QA 1ZQZA 4CEAA 1TK8A 4CK1A 2ATQA 2FPMA 3NTUA 3OYNA 5EOZA 3BQ1A 5DLGA 3KHLA 1U04A 3OYEA 2DPIA 1XSNA 3PY8A 2ZD1A 1C0TA 1Z25A 4IR9A 4Y1DA 1SZPA 4ECVA 1N48A 1KDHA 3PMLA 1X9MA 2R8JA 1S1XA 1TAQA 4FM0A 4DTRA 3OYGA 5KFAA 4PPXA 4NCAA 2VA3A 2RDJA 3KHHA 4O0IA 3KLHA 1RT3A 2FPLA 1GOCA 2Y1JA 4N47A 4H8KA 4BDZA 1SV5A 2R7YA 2HHTA 4FLVA 3OYHA 3C2LA 3Q8RB 2P6RA 4CHQA 3MR6A 4GXJA 5F9LA 4DTNA 3B0XA 4DFPA 2WOMA 4FZXC 1XSLA 4ELVA 3OVNA 2PZSA 1C1AA 4KHNA 1Z00A 4XA5A 4E7LA 4CJTA 3JPSA 4J2BA 1RBTA 4AH9A 3LAMA 3MXIA 3AVKA 4JUZA 2XY7A 2E6LA 1HUZA 2MUTA 4LZDA 2W9BA 3UIQA 4OPJA 1R0AA 4IG0A 3OY9A 5KFJA 4DL3A 3D0PA 3SJJA 4M3UA 4B8AB 3V6DA 1TL3A 1XU4A 2HW3A 2OPQA 5J2BA 3MR5A 3RJHA 1RNHA 5TZVA 3C1ZA 2WTFA 1ZBUA 5I3UA 2YHBA 2JEIA 2Z1IA 1L3TA 3LP0A 3E01A 1IKXA 2DFFA 5CZ1A 1VSFA 3K58A 5BOLA 1RT6A 2UVWA 5KG3A 4MFBA 1BIUA 4DMNA 4GW6A 2GBZA 3DRSA 1ZQFA 2YNIA 2P6UA 1REVA 3SQ4A 3RBDA 3VQAA 2AJQA 3QIOA 3BDPA 1RILA 1I3AA 4RPYA 1IH7A 1HUOA 3SPZA 1NK6A 5J2AA 2OYQA 3LP3A 3RJIA 3PX6A 4DU3A 1ASWA 4KLMA 4AHSA 3AVNA 4I9QA 3DYAA 1TL1A 4DQRA 4Z6FA 4GMJB 5J2PA 1NKCA 4R8UA 7ICEA 1S0VA 3AA3A 4KLQA 1BPBA 4HHTA 4CIFA 4E3SA 4KHWA 2QKKA 1WN7A 2X6NA 4FW1A 1S97A 4TUQA 4KLEA 3HVRA 5I42A 4HUFA 1A76A 2PI5A 4DSJA 5DK5A 3PO5A 4KLLA 4RW7A 4CFDA 4O44A 2HMIA 3C5GA 1MSWD 5DDYA 4CECA 1QTMA 3AA5X 5J1EA 2G8WA 4G3IA 3HVTA 3V9ZA 1S5JA 4Z6EA 4FLWA 4HCCA 5EWGA 5D46A 3FDSA 4OGCA 2IC3A 4F5OA 1UAXA 3NF7A 2Q0ZX 1SKRA 3KHRA 3K5LA 3T5JA 2I5JA 7ICUA 1L3SA 5CWRA 3DLHA 3AU6A 4QW8A 4I2EA 1DTTA 5KFQA 2F96A 4KN4A 3V7LA 3GIMA 3KLEA 3JPQA 1SL1A 4W5TA 2BCRA 1MU2A 9ICEA 1UT8A 3HPOA 5FRMA 5KFYA 4ED3A 2FMQA 3TARA 2YKMA 3NGZA 2W8KA 4M2YA 1EKEA 1Z00B 1T7PA 5KG2A 1RT2A 2W9AA 2P5OA 1VSMA 4PA1A 3OS1A 4KLOA 4CGDA 1L3UA 3H08A 4M9JA 9ICTA 5J2MA 4PUOA 3TWHA 5KFCA 4LZGA 8ICHA 3C2MA 1U47A 4CFBA 2JEGA 1A77A 5KT3A 3OGUA 5KFFA 2FBYA 3RJKA 4FBUA 3DLRA 3SUPA 2XGQA 5KFSA 5HHHA 3C94A 4IFYA 2DFHA 5IINA 3NFAA 1K1SA 5C25A 4IR1A 4LSLA 4UB4A 4MFAA 4KB1A 4PHDA 3SV4A 3AVMA 1ZQYA 2ZJAA 1ZJMA 1TK5A 3CFRA 2BQUA 1WLJA 2FPKA 3OYJA 3ZD8A 1ZQPA 4F5QA 1WAFA 3SI6A 3PW0A 5HMLA 5DBCA 5C24A 3NH1A 1U48A 4IQUA 4CJPA 4JRQA 7ICIA 2BCVA 8ICAA 3NHGA 3QEAZ 4F4WA 3V6HA 1RDCA 3K59A 3F73A 4KV8A 3RMBA 4QZIA 4RPZA 4N56A 4DWIA 2KZZA 3UXPA 3H8SA 3ZDBA 3MEGA 3ZSYA 3SNNA 4RUCA 4GC7A 3V4IA 1WCNA 2AGOA 3PX4A 1KVCA 1RDDA 9ICCA 5KFMA 2ZUDA 4NCBA 3DOLA 1LAVA 4AHTA 2HNDA 2PYJA 2DTUA 4Q45A 3V7KA 9ICBA 1JLAA 4ZH4A 3VA0A 4C8LA 5D3GA 2FLPA 3MR2A 5IIJA 4DFKA 8ICWA 4ELUA 3LP1A 4M41A 5KFXA 4OLBA 3M8PA 4DS5A 4QZFA 1TV6A 3FFIA 5HROA 9ICRA 4R63A 5J2JA 8ICMA 1RT4A 4DL4A 4DF4A 1ZQCA 2QK9A 4C8MA 4YNQA 3AUOA 1G15A 3LZJA 3GV5B 4I27A 3K2PA 2ISPA 4RQ1A 1TGOA 1CEZA 1BQMA 4W5RA 1FK9A 1RDBA 3PX0A 3Q8LA 4UB1A 4BXOB 1BPZA 4UB5A 2G8HA 3O3HA 2BPGA 3AVLA 4F4ZA 4JRPA 4LSNA 1ZQTA 1NOMA 1JL1A 2A1JA 4J2AA 1U49A 1XS9D 2NRZA 4DQIA 4BE2A 3M8RA 5DDMA 1HJPA 4YMOA 4N76A 2XRIA 1GOBA 4RNOA 4CERA 1GOAA 3ZT1A 3MABA 3ISBA 4F91B 2ATLA 4YXJA 4P4MA 5KFKA 4ECSA 2E6MA 1S0NA 3TAQA 3E2EA 4QZEA 1KFDA 4JV2A 3MXJA 1N5YA 4QWEA 1NK7A 3AO4A 3OS0A 5KFPA 3VQ4A 4UBBA 4Z6CA 1KLMA 4PGXA 1N56A 3RB0A 1DOQA 4AHCA 5SZTA 4YCXA 1QE1A 2D0CA 4M3RA 4C8KA 3KLGA 4KB0A 4YR2A 4E7HA 9ICKA 3EPGA 3MR3A 2GUIA 3TABA 3ORYA 5D4BA 5KFNA 3LALA 3BQTA 1BGXT 4BWMA 4UQGA 1BQNA 2UVRA 4AHRA 3Q8QB 1L3VA 1A5WA 3K5MA 3KK3A 3KLFA 3JPRA 1LWEA 1RBVA 5KFOA 4ED0A 1HYZA 1JN3A 4CJEA 1W0HA 3EWAA 4HUGA 4QZHA 4I2JA 5DQGA 3QLHA 4PH5A 3ZSQA 5DQIA 3QEPA 1XI1A 4QW9A 1S10A 2BE2A 1WSJA 4N41A 4B9UA 3V1RA 1VSHA 5J2QA 4MFFA 9ICQA 4KHUA 3V9UA 3NCIA 3V1OA 4F8RA 3MFHA 4XQ8A 3GILA 3NH0A 1BPDA 3DLEA 1JXEA 4FM2A 2D0AA 4RQ2A 5DG9A 4KMUA 1RBSA 2VG7A 5IIIA 1B22A 2KZMA 3VQ6A 5CYMA 3JPOA 1XO1A 1RBRA 1WSGA 5J2GA 5HRPA 4YD2A 3K4GA 3OJSA 4M9LA 4CGIA 3LK9A 3UXNA 5DKWA 1CXUA 4H4OA 4F4YA 3LANA 1ZQSA 4CIGA 4DQPA 3KK2A 2IMWP 4Z4HA 4YXMA 4DLEA 1UOCA 4RZRA 5HP1A 4Q43A 2ITGA 3AO5A 3KIOA 4KLSA 3QEBZ 1X1PA 4ECXA 4CEDA 1V9PA 2F1JA 4CJKA 2QKBA 4DG1A 3MECA 5DQHA 2KQ2A 4LD0A 2A1JB 5FDLA 8ICCA 1XHXA 3OHBA 1ZQRA 4KFBA 4FJ8A 5CY4A 4J9MA 1ZBHA 1S9GA 3G10A 3V72A 5C5JA 9ICUA 4Q8EA 2ETJA 2BQ3A 4WE1A 3TAGA 3S3NA 3A2FA 3V9SA 5L1LA 3O4QA 5KFZA 8ICXA 3ZSOA 1X2IA 4NLNA 5J2EA 3H8WA 3L2WA 1NK0A 3AU2A 2C22A 3OJUA 1KVAA 5KFGA 2G8VA 3MGIA 3QIPA 1JLQA 4K4GA 2LYHA 2ZUCA 5BOMA 5J0PA 3B6PA 3RMDA 1JXLA 4YD1A 1ZQXA 4KLFA 5L1KA 1J54A 4EBDA 4FVMA 2QXFA 4J9QA 3U3YA 4F5RA 4FO6A 3H7IA 1SL2A 3TFSA 5KFRA 4W5OA 4OKKA 4QZGA 3HSTB 3AO2A 4O3PA 2BGWA 3UQ2A 1JLBA 1W9HA 5IIOA 5J29A 4IQWA 5IILA 3HP6A 3RH4A 4F92B 4YN4A 1KLNA 8ICNA 1ASUA 4PHEA 4ED7A 5KG6A 1B9DA 9ICLA 3MEDA 3FYHA 4EP4A 4DQQA 1QSYA 4X5VA 2BR0A 5J2FA 4ECZA 4TURA 1IO2A 3C2KA 2AQ0A 2W8LA 2C2RA 2OWOA 3C6TA 1RTDA 2AGQA 4C8NA 4DOAA 1HJRA 3VQBA 7ICOA 1ZQQA 3SUNA 2VA2A 4AHVA 4J9KA 9ICFA 4N5SA 1IKVA 2IA6A 1BIZA 4KTQA 3GIKA 4K8ZA 4KHYA 3HPHA 1CZ9A 2P5GA 1ZQIA 4FLUA 1NOZA 1SL0A 3HW8A 1ZQDA 5KFVA 3AV9A 4H4MA 1S1WA 4M6WA 2EX3A 2XY8A 4QZDA 1C0MA 4OJRA 2YNGA 5T7BA 4TSXA 4IQTA 5J0XA 3QZ7A 4ECYA 5HP4A 4YFUA 3Q8PB 3EYZA 3DI6A 2PY5A 3I0RA 4I2AA 7ICGA 4RQ6A 4M0AA 5KFWA 4PGQA 4FYDA 1Y97A 3L8BA 1NJZA 2BDPA 7ICQA 4DOCA 1C6VA 2A1RA 5KGXA 4E7IA 4DTPA 2IHMA 3M8QA 3S3OA 4M47A 3AVFA 3DMJA 7ICHA 4FS1A 2RDIA 4CEFA 4RU9A 3BQ0A 2XC9A 4I2FA 4PQUA 2FLLA 4ZHRA 2OPPA 4B9VA 1NJWA 5JS2A 4HYKA 4F93B 4J9LA 1S9FA 9ICAA 5EU7A 3EY1A 3PNCA 3RRGA 3ZDAA 3HYFA 4ECUA 3CG7A 2IS3A 3ISNC 5DG8A 4Z0UA 4CE9A 4CF0A 4JWNA 1KFTA 2E4LA 2BQRA 7ICMA 5IIMA 2VA8A 4F50A 1WSHA 1XSPA 4EYIB 2B5JA 4O3QA 1RT7A 4RQ4A 2VG6A 2I1QA 4UAYA 4DSFA 1U45A 3M8SA 3OSPA 1C0UA 2X78A 4KI4A 4Q44A 3L2RA 1QSLA 3AO1A 4W5NA 2VG5A 4QWAA 1EETA 3H4BA 5KG4A 8ICZA 3LP2A 3T3FA 4FZZA 4DTOA 2ZJ8A 1T3NA 4FLYA 3T5KA 1ZQHA 1WCLA 4F4KA 1JLGA 1ZQNA 5DMRA 5CP2A 4RQ0A 1B92A 4IKFA 4EZ6A 4KTWA 4BXOA 1BPEA 4FM1A 4BE1A 5KT7A 2KFNA 1C1BA 3RBEA 2XO7A 2P51A 3CQ8A 3RWUA 5KFIA 4E89A 4OPKA 1WSFA 2PYLA 1B9FA 3KHGA 4ID1A 4XUSA 1BISA 4MEYA 1D8YA 4MF2A 4KO0A 4AILC 4JS4A 2FMSA 3LWLA 3HX0A 3ETLA 1RTIA 4GVMA 3TI0A 4NLKA 4CF2A 4PY5A 4YR3A 5JUMA 1RBUA 5DBBA 4FJNA 5E41A 3QNOA 8ICVA 2Y1IA 8ICIA 4J2DA 3C95A 4F3TA 5KT2A 5DLFA 4QZ9A 1EP4A 4ID5A 1X9SA 4GXKA 2GV9A 2JEJA 3ZDDA 2MAXA 1T4GA 1VK0A 1ZJNA 3HK2A 5IIKA 1PZNA 4KKOA 1U4BA 3SYZA 3BJYA 2BPCA 5F9NA 4RQ5A 4J2EA 1HPZA 5CJ7A 2FBVA 2ISOA 2YNFA 5CZ2A 1EXQA 4DTMA 4MEXA 1AROP 1S6QA 4M6WB 1BCOA 1ZQLA 1TV9A 4CJQA 4FLTA 5HBMA 4DSLA 1VSJA 7ICFA 3K57A 1CUKA 1ZQAA 4B9SA 2R8HA 1EX4A 1S1VA 4MF8A 4RW9A 4CGHA 1Q9XA 3AVBA 3F9KA 4JS5A 3AVJA 3L3VA 3OYAA 7ICKA 5J2DA 4CHOA 4QWDA 5J0RA 3VQQA 5KFTA 3RB6A 3NF9A 4M3YA 3RH6A 3RJFA 3VA3A 4RNMA 3Q8SB 1HQEA 3VQEA 2H5XA 3JSMA 1JKHA 4FXDA 2UVVA 3RTVA 4Q0BA 4R64A 1UWBA 3RJEA 3ZD9A 4RT2A 4GLXA 1VSIA 2JZBB 5J0WA 7ICNA 5KFBA 4YP3A 4ECTA 2YNHA 3ZDEA 1MQ3A 3DRPA 5KRTA 4HUEA 3M9MB 3G6XA 4RQ7A 4RUAA 3ALYA 3NDKA 2V4QA 1IG9A 1RDAA 3ULDA 2BKEA 1SUQA 4OKJA 1S9EA 4CK2A 1COOA 1RZTA 5DBAA 4E0DA 3QNNA 4FJIA 1S1TA 1ZBIA 1RPLA 3OYLA 2F1IA 2Z1HA 2XGPA 3TANA 4FJKA 2PFNA 5KG5A 4O3RA 4I2QA 4I2PA 4CHZA 4E1NA 4B3OA 3PUFA 3CM5A 3TQ1A 3QETA 4J9OA 1X9WA 2F8TA 4M9HA 4FJXA 1ZYQA 3C5FA 4MFCA 3L3UA 3IRXA 1B43A 1XC9A 1Z26A 4O3NA 2DPJA 3GIJA 4M3TA 3AO3A 4DFMA 3OYKA 1O1WA 4IDKA 1NK9A 2HHQA 4F5PA 4P2HA 8ICLA 2BCQA 2HHWA 1CXQA 4QWBA 4CIEA 2KN7A 4NY8A 3RJGA 4P4PA 5DB8A 4UB3A 4KTZA 3G0ZA 4UAZA 1KSPA 1YT3A 3RJJA 4KRFA 4DS4A 3T19A 4Z6DA 3L2QA 1BHLA 5J0QA 4QZBA 4UBCA 2ZTDA 1JL2A 4RT3A 3SQ1A 4BE0A 4Z4GA 2B6AA 1IXRA 4PWDA 5HRSA 2O4GA 3RAXA 1VSEA 5J2CA 2WONA 1IM4A 2UVUA 3DLBA 2HHVA 2JEFA 2RN2A 1IKWA 1SKSA 3OYDA 4MQ3A 4ED2A 1TVAA 9ICJA 4I2GA 1ASVA 4DU4A 4YMMA 1RYRA 4P4OA 2X6SA 5DB9A 1RTJA 4DL6A 2C28A 4Q8FA 1ZBFA 1ZQVA 4OVLA 2YV0X 3K75D 4HVJA 3HP9A 1WSIA 4XRHA 1J5OA 4L8RB 3GV7B 5HRNA 4DSEA 1ZQMA 4I2CA 4B8CA 8ICRA 2HHXA 2F1HA 4CFAA 7ICVA 1D5AA 3SQ2A 8ICTA 7ICSA 4J9PA 4Z4FA 2ZQBA 1KCFA 3QINA 3P1GA 1BI4A 1XHZA 3C23A 1ITGA 1NOYA 3HPGA 5DG7A 1KEJA 4KLTA 4I2BA 2YKNA 2BGGA 2O4IA 1J9AA 4CF8A 4K4HA 4RW4A 2M9NA 2XCPA 3QEWA 4IRCA 1F21A 4CF1A 3DM2A 4CHPA 1S1UA 5KTQA 8ICOA 4EBEA 2R8IA 2Z1GA 4M04A 4RQ8A 2YHAA 3ZSVA 4NYFA 4ECRA 2IHNA 1ZQBA 3N4MB 4M9GA 5KFDA 3P83D 3GQCA 1ZQKA 1T03A 5KFLA 3ZCMA 4KHSA 9ICHA 3IHQB 4EZ9A 5KGWA 2HHUA 4EYHB 3PW2A 4B9MA 1T05A 5KFUA 3TAEA 4FCYA 3B0YA 3OYFA 2KTQA 3O3FA 1HNIA 1TK0A 2HVIA 1YTAA 5CB1A 1NKEA 3GFKB 4FW2A 4DU1A 3HO1A 1S6PA 4UAWA 2RKIA 1HRHA 3HWTA 1WSEA 1NK4A 5KFHA 4O55A 4O9MA 3NF8A 4NCGA 3IAYA 4FJ9A 3QE9Y 1BPYA 3ZDCA 3QERA 4KLHA 3ZSWA 5JS1A 4DSKA 4ED8A 4E7JA 3KLIA 4B9TA 4KPYA 8ICFA 2F8SA 1NJYA 2ASDA 4FLXA 4DTSA 7ICPA 3LWMA 1S76D 3MEEA 2Z1JA 3TR8A 4RPXA 2XY5A 4KN7A 4CJVA 4DOBA 3P5JA 5KG7A 1YTUA 4F3OA 2OZMA 2BANA 1KFSA 9ICVA 4CJLA 4IQVA 3PW7A 5KG1A 5K14A 5C42A 1ZQUA 3MAQA 4BDPA 5J2KA 3RMAA 4ED1A 1A5VA 4NM2A 2KW4A 4KLUA 1U9LA 5J0SA 4CGGA 3LDSA 3GV8B 1Y88A 5HHIA 2NRVA 9ICSA 1LB2B 1VSLA 1ZQEA 4F4XA 4DQSA 5KT5A 4NLZA 4IBNA 3AA2A 4JV0A 3NGIA 1BL3A 1D9DA 3S9HA 2W9MA 3QEXA 1LW2A 1L5UA 2P66A 4I28A 1DLOA 4CGJA 1MQ2A 4B9NA 3V9XA 1BI4B 3WNHA 3PMNA 4ZTFA 2NRTA 4M3XA 2J6TA 3B6OA 5HNKA 3DOKA 2PFOA 3ASMA 3DLKA 9ICGA 4CJFA 4O0JA 3JPPA 4KAZA 4CEEA 3ZT3A 2P1JA 2ASLA 3KD5E 4I29A 1ZQGA 1QQCA 3RAQA 3QZ8A 4FBTA 8ICYA 4LY7A 3QESA 3M9OB 2W9CB 2J6UA 4FJMA 3I0SA 4FJGA 3NE6A 4CJ4A 3K5OA 3NF6A 8ICKA 3H4DA 3JPTA 3KTQA 2NRXA 1FKPA 2I9GA 4Z4CA 3PW5A 4FJ5A 2DFEA 2BCSA 3SZ2A 8ICGA 1HYVA 5CR0A 3ISCA 5EWFA 9ICPA 3HM9A 3RB4A 2XCAA 3LAKA 2W42A 5HLFA 5L9XA 4OLAA 1IKYA 3V1QA 4I7FA 4BDYA 3DLGA 4ED6A 4FJJA 4FK4A 3NGYA 4R65A 3JPNA 3MFIA 1QS4A 4G1QA 1RXWA 3AVGA 4ELTA 3SCXA 3ZT0A 9ICMA 3V7JA 1LV5A 5DGBA 3MGHA 4GC6A 4CJ5A 2PXIA 1RXVA 3QEVA 2VANA 3AVCA 3Q8MA 2G8UA 3RR8A 2V9WA 7ICLA 8ICSA 4FJLA 1ZQJA 2BPFA 1ZBLA 3OYCA 2JZBA 3TFRA 2D5RA 3ZSRA 8ICPA 3N97B 2EHGA 3MDCA 4E1MA 3TAFA 3SV3A 4KI6A 1UA0A 1JXBA 4CFCA 2JLEA 1KRPA 3ZSXA 4O5EA 3BGRA 3IG1A 3CM6A 8ICQA 1K6YA 2IGIA 1ZQOA 1ZETA 1S0MA 2C2DA 4PHAA 3SI8A 4FS2A 4PHPA 4FJHA 4E7KA 3LPUA 5KRSA 4NXZA 3AVIA 2HNZA 3H40A 3LPTA 2VWKA 4CJWA 3UPQA 1J53A 5KT4A 1QLNA 2G8FA 1DGSA 4BGDA 2ALZA 2AQ4A 2IAJA 2AU0A 2B21A 5J2IA 4Z4IA 4DL2A 4ECQA 1UA1A 4EEYA 3K5NA 4OKEA 2FLNA 3RR7A 1RTHA 4CK3A 8ICUA 4B9LA 5J2NA 4QOZB 3SPYA 5HMMA 4YR0A 5J0YA 4CEZA 3MDAA 1BCMA 2BCUA 3JYTA 3VQPA 5KI6A 3LDAA 1FKOA 3RH5A 7ICRA 3ITHA 4DTJA 1HYSA 2HHSA 1S77D 2OPSA 4KLIA 2G8IA 5DB6A 2PFQA 2ZTEA 3VQ9A 3V6JA 3IM1A 2J6SA 4M3WA 2RF2A 4LH4A 3Q8KA 1JMSA 3HL8A 2PFPA 4F2RA 2MUTB 2W9BB 1VSKA 4AHUA 2NRWA 4I2HA 2HB5A 4DTXA 4K4IA 1DTQA 4JV1A 4IG3A 7ICTA 4YG2A 5EWEA 3PO4A 1ZQWA 1TAUA 3L2UA 3KD1E 4KITB 4LVSA 3T1AA 4Z4EA 3PW4A 3AVAA 3SUOA 1TVRA 2OPRA 4CJRA 1JX4A 9ICWA 2JGUA 5J2HA 4CEOA 4W5QA 1BPXA 5DGAA 4CJSA 4I2DA 1EXNA 3VN5A 1RYSA 4QZAA 4KLDA 3G6YA 4UB2A 3BQ2A 4J9NA 3GDXA 2B4JA 3V6KA 4M42A 3WNGA 2DFLA 3VQDA 4FK2A 1VRUA 1HMVA 3HXMA 4RW6A 3IS9A 4O3OA 4R8UB 2NUBA 1CLQA 3UXOA 5L1JA 1Q9YA 4KHQA 4EP5A 5L1IA 3OYBA 4C8OA 4TUSA 4OGEA 4LH5A 4DL5A 4M3ZA 5FROA 4R66A 4YVZA 5J0OA 3RRHA 5KG0A 2FBXA 1JLFA 3C21A 4DFJA 1CZBA 3HJFA 5KT6A 9ICNA 4DO9A 2ZTCA 2PI4A 4CJ3A 4DTUA 2FBTA 4ICLA 8ICBA 3OYIA 2G8KA 1LAWA 2OZSA 4FK0A 1RCHA 1WNSA 3KKSA 3PVXA 3ISDA 2LSNA 4RW8A 4XIUA 8ICJA 4F2SA 2AGPA 4CESA 3G6VA 4GXIA 3EPIA 1I39A 5DB7A 4CHNA 3KK1A 4CF9A 3VQ8A 2GWSA 4CCHA 3GIIA 3QEIA 3CYMA 2C2EA 9ICOA 4DEZA 4B08A 2R8KA 1HQUA 3O4NA 3TAPA 1QHTA 1TFRA 5D49A 2HNYA 4RG8A 1TKZA 2ZJ5A 3OS2A 3EW9A 4QZCA 3C1YA 2Q3SA 3PR4A 3NBPA 3KJVA 4DLGA 1RT1A 1VRTA 3OHAA 3NH2A 4CGFA 3KKRA 4DSIA 2ZUBA 4JLHA 8ICEA 4CEQA 7ICJA 4O3SA 4JWMA 4EBCA 2ZE2A 5HRRA 1TKXA 4J9RA 4CEBA 1UT5A 4DL7A 3TAMA 4ZTJA 4I2IA 1SKWA 3VQ7A 3UQ0A 3AA4A 3QO9A 4QZ8A 1NK5A 4TQSA 4J9SA 1NK8A 1NKBA 4RQ3A 5CYQA 3CFOA 3VQ5A 4M9NA 2ASJA 1C7YA 2FMPA 5J0TA 4QAGA 3SUQA 4BACA 2A1SA 2VWJA 4KLJA 1JLEA 3NAEA 5BPCA 2XY6A 4K8XA 3V9WA 4YFKA 4HTUA 3PR5B 3T5LA 1D9FA 3DRRA 4HCBA 4O5CA 9ICXA 1N6QA 1VSDA 4DF8A 1T8EA 5KFEA 3WNFA 3THVA 1JLCA 4CHYA 3RMCA 1XWLA 4IRDA 2IBKA 3M9NB 4RNNA 4FLZA 4Y1CA 1MC8A 4KREA 1D8LA 3OSNA 1TKTA 4F5NA 5FRNA 4R5PA 4BWJA 3MXMA 3AVHA 1C1CA
chains in the Genus database with same CATH superfamily
4ZPTR 4DUTA 4M94A 2RS2A 3C6UA 4LFCF 2W54A 3IRWP 4Q2LA 3DOLB 4LFAF 1NO8A 2HNDB 4IRKA 2ZIUB 1NJXA 3TSUA 3NGDA 1SWWA 5AI4A 4PGYA 2CXYA 3IBCB 1EWQA 1ATNA 4O5BA 3DOMA 4ICLB 3QGIA 1JIHA 3AM9A 2IVMA 1HWIA 4M45A 2OSRA 3WNEA 4NLTA 1TV6B 3D5MA 2QWRA 2LI6A 3CC2N 5E84A 2QA2A 2PO4A 3SAGA 3UCZP 4P7VA 3CJ5A 3CSKA 1VK8A 5LMUF 3IO1A 3R3TA 4NLGA 4TY8A 3C8YA 2HGLA 4F0MA 3AGRA 2DPNA 1XO0A 2FHJD 2QA4S 1BQMB 1E4GT 1YQHA 3AXMA 1RAGB 1VQNS 4DR7F 2FC0A 3F9MA 3I8DA 3H8JA 1FXXA 1RT1B 3ZXWA 3AXKA 4H0PA 2ZBQA 2LU2A 3SEIA 4EX7A 2UUCJ 3BR8A 2VKZG 4HR2A 5AKJA 1WAJA 2LXIA 2UU9K 2J76E 3SQ0A 1UVMA 2MQOA 4C3LA 1LWCA 2D6FC 4EGLA 1N34K 4WKYA 1BHNA 3H0LB 3WX8A 2K7JA 2G2YA 4I6WA 1SCJB 2W24A 4IJNA 2ATQA 2FPMA 5CYQB 4X4VA 4AYBC 2ROGA 1S12A 1KHVA 1U2CA 3WQPA 2NPFA 1OYEA 1VC5A 3EGVA 4MK7A 1YJ7A 3PY8A 4BLGA 1KDHA 1S1XA 4FM0A 4ATNA 3BH7B 2IRXA 2RDJA 3AD8C 3ID8A 4O0IA 2VCPA 2FPLA 3A3OB 3KLFB 4N47A 4H8KA 1LWEB 3ZYYX 2UP1A 1JLCB 4BDZA 4FLVA 5A0LA 5KAFU 3HOSA 2BJ3A 2QZ8A 3FSXA 1T9YA 4CHQA 2P6RA 4DUYF 4PL7A 3MR6A 4GXJA 4DTNA 3MWPA 2WOMA 3N4WA 1Q53A 2PGCA 4RQMA 4TVAB 3JSRA 4KT0C 3BGOP 2MSNA 5ETRA 2VIHA 2D0OA 1GMWD 3C6UB 2LQ5A 2B6GA 1F9FA 3QATA 4LC9B 3R7BB 3LAMA 5IV4A 2MQNA 3MXIA 2B9WA 4DHVA 2CJQA 2E6LA 5ALTA 1Y9OA 5B0CA 5KFJA 4ZP8A 4YB6A 1D0EA 3MURP 3CCMN 3AH6A 3SCKE 4B8AB 3NVWA 1XU4A 4J03A 3DOMB 3LDNA 4EELA 4YHHK 2OPQA 1PJ5A 3QGPA 2YHBA 2JEIA 4Y2JA 3EWGA 1HNWF 3E01A 2DFFA 3K5PA 4JYAK 5EE1A 1AFIA 2Q79A 3D7EO 5KG3A 4MFBA 5KL8B 4CLKA 3SBMA 4AXIA 5KNIA 4WKRA 1REVA 3ZTOA 1PVPA 3SQ4A 2QYCA 3BDPA 2KHDA 2L08A 2N4DA 2DVIA 1CLFA 1IH7A 2LA4A 5AQSA 4ZLLA 3SPZA 2MA1A 4ZPBA 2OYQA 5MLCV 1G99A 1L7PA 1KQSR 2OMLA 3N6NA 4NRUA 5IT9U 3UNGC 1YX2A 3WK6A 4BRGA 2UUBJ 4EO6A 2ZG6A 4OX9J 4MTPA 4HHUA 5AM2A 4FKXA 5J2PA 1LNQA 4ZLPA 2VBZA 4KLQA 3GONA 1U1RA 4NXNJ 3D67A 1LWCB 2R7QA 2QMUB 4DX5A 4JI2K 2M5YA 1APSA 4TUQA 3HVRA 1TL7A 4DV1F 5M1NA 2PI5A 3VOVA 2GJIA 2QEXN 3CJ0A 4O44A 3W66A 4JI0K 5AK6A 3K9JA 4DX6A 5H2FU 1L8LA 5DDYA 4CECA 3W3DA 2G8WA 3HVTA 3V9ZA 4FLWA 1S1XB 3L7OA 1LKYB 4QYZK 2FJVA 1FRMA 5D46A 2PN6A 1UZHA 3VAJA 2LEAA 1JNRB 4MK8A 1UAXA 2HVDA 3NF7A 2Q0ZX 2AA4A 4BBYA 4A2AA 4FKYA 3CW2C 1C20A 5AI6A 4I2EA 3GSDA 2ERRA 1X40A 1T9XA 5HQMA 3KLEA 3JPQA 1JLBB 2WOMB 2BCRA 1UT8A 9ICEA 1MU2A 2KU7A 2UV8G 3NGZA 2W8KA 1G3OA 4LR7A 3FQLA 3AJDA 1T7PA 3PYGA 3TYTA 3O8WA 2WVBA 2W9AA 4WZQA 4PA1A 2MKHA 3OS1A 2GV1A 1RK8A 1RQLA 3H08A 4OCZA 2E1AA 1X4AA 2BXJA 3SFUA 1YIJN 2XSJA 5KFCA 3E9OA 1IBKJ 3G6EN 2G07A 3UN2A 3N4PA 3K7RA 4P73A 1A77A 3JQMA 5KFFA 3DLRA 3SUPA 3F5AA 4K8RA 2GO7A 5JVHQ 4DV5K 2ZVIA 3NGSA 2RQ4A 2HQ3A 5E5NA 3E01B 1NWKA 3CPWM 1IR0A 3BREA 3H3OB 4KB1A 2GFFA 1YHQN 1L7OA 2FQQB 4PHDA 3AVMA 2D3OR 3CJ9A 2JWNA 1RAOA 2YX4A 1FXLA 4K7QA 2FPKA 3QPIA 3EE8A 3HKZF 3EXYA 3ZD8A 1ZQPA 1WAFA 3SI6A 1UEVA 1JCFA 5AXMA 5C24A 4CZIA 1U48A 4IQUA 4NRTA 4LF7K 2XS2A 8ICAA 4OIXA 3QEAZ 3SAFA 4HTJA 3S7RA 3OW2M 2E1MC 4PKGA 1RA7A 3F73A 3P39A 4C4SA 2UU9F 4NA3A 3RMBA 3UXPA 3H8SA 4IXCA 3MEGA 4CLSA 3I1YA 3VR1A 3ZSYA 1CQNA 5J2PB 4FVCA 1U1OA 3FM9A 2JHDA 3SAHA 3C65A 3T9NA 2E8PA 2HOIA 4GC7A 3BP8A 1N34F 4C11A 3NAIA 3PX4A 1OPIA 4OHYA 5KFMA 3QMQA 2GGPA 2DTUA 4USJC 1FDAA 5FJ4A 4CLPA 2W2MP 3U1NA 4DV0K 4O44B 3ALRA 2V8HA 1HLUA 2XIDA 2FLPA 3IM8A 3MR2A 1NMDA 5IIJA 4CZMA 2ADBA 4OLBA 3HVTB 4DS5A 2ROEA 2CH5A 2CQDA 3QICA 5A8RA 1M90T 5HROA 5JVGQ 3D2WA 1PYSB 5CHCB 2B8QA 5AQPA 1GO3F 4B3RK 5E7OB 3L3CA 2KE7A 2VG5B 2XYPB 2QK9A 3FZBA 3QFWA 3GV5B 4ETXA 4RQ1A 3A13A 4W5RA 3KLEB 4UB1A 3LL3A 1WHXA 4M8LA 1MU2B 3IWNC 3AVLA 5ALNA 1NOMA 4LMZA 4LF8K 4BRNA 4LRFA 5EDWA 4LBHA 1U49A 1XS9D 3MXHP 4US9A 1WI8A 3OTDA 1NDPA 3OFGA 4BE2A 4K41A 4YMOA 4N76A 2XRIA 2KIVA 1GOBA 4CERA 3CD6S 3L6QA 3M05A 1ZM3A 4P4MA 2GTDA 3L09A 4YHHF 3O08A 1Z4NA 2IHR1 1GX6A 3MXJA 3VMFB 1NK7A 1VIXA 2A41A 3FZKA 3G25A 3OS0A 3PDNA 2CXEA 4PGXA 1EP4B 4FPRA 2RAQA 2UXBJ 1DOQA 4AHCA 1VYAA 5SZTA 4YCXA 1QE1A 2ZZTA 4EMDA 1R43A 4C8KA 4YR2A 2NLWA 2KM8C 4BRHA 3EPGA 3MR3A 4G65A 1YTYA 2GUIA 5D4BA 3IG8A 4BWMA 2HZCA 4NLDA 4RL1A 1BQNA 2NREA 1W25A 2E8AA 1GFWB 1RAFB 2MLYA 2B0CA 3KMSA 3NGKA 5C24B 3M6VA 2JRZA 5KFOA 3IP0A 3C28A 1HYZA 1X6JA 1U2FA 2F8LA 3SIPB 5J8YA 5LMNJ 3ZZPA 4P52A 4PH5A 4U7UK 2P35A 3MEGB 3KFUF 1I94J 3J7AP 4WYLA 1GLLO 4N41A 1FHTA 4F04B 4H0TB 5L1MA 4C11B 3UDLA 2W11A 1VSHA 1SVDA 3I4HX 3ZTSA 2GGPB 3CJSA 3ILJA 2JH3A 5D4PA 1KC8T 3HHLC 4V1Ak 4JI0F 3FAHA 3NH0A 2L5YA 1NM1A 1GXLA 4FNIA 4WJBA 2VG7A 1RBSA 3ATUA 3SLCA 4C80A 2LYBA 3P38A 4A59A 2QLXA 4W90B 5B0BA 4NXMJ 1XO1A 3MK6A 4X62J 1RBRA 3C16A 1IBMF 5HROB 4YD2A 1FRJA 4CGIA 1WKKA 2CA9A 5DKWA 2OGUA 2RE1A 3LANA 3UVJA 3KK2A 3HBTA 4Z4HA 3F2DA 4DLEA 4RZRA 3RRKA 4ILLA 4X64F 2YVSA 4PG7A 2ITGA 1CULA 2HBMA 3QEBZ 4BVOA 4Y2TA 4DG1A 3HI9A 2I1RA 3X3UA 3VGKA 1WG1A 4JI3K 2DR5A 5BPLA 1UJ6A 1ZQRA 1FERA 2YTCA 2DNLA 5CY4A 5E0OA 3N5BA 3QRQA 3G10A 1K73O 5C5JA 2HURA 9ICUA 4NEYA 3OTQA 5KPTA 4OJPA 4K2XA 3BN7A 2FJXA 1W97L 4CM0A 1ZM9A 3TEHB 3M6GA 4P72A 1SJQA 2P9UB 1QE1B 1NK0A 3ZZUA 2N7CA 3OJUA 2G8VA 5KFGA 4ZMMA 4PZVA 4PEOA 4PWDB 3OHRA 4OI4A 2OXOA 1R0BG 3WKEA 5BOMA 1MMNA 1KBRA 3RMDA 5L1KA 2W2OP 1TUYA 4LF7F 4DR2J 4J9QA 4BC2A 2QLJB 3H7IA 2JNJA 3B4DA 4JMUA 2ZJPL 2F63A 2DXEA 5HMXA 1FTCA 3CRXA 3ZX0A 2BGWA 4GO5X 3AOCA 5J29A 4JI1F 5DRKA 1OQ3A 2E5LK 5IILA 5BRDA 3RH4A 2IIHA 3QAEA 4JI7K 1KLNA 4B1YB 2GMHA 4FWSA 5ETNA 1KTVA 1U7LA 3TUPA 4KHPJ 1D9AA 2V69A 4ISEA 4DQQA 4DV0F 2BR0A 5RUBA 4DCPB 3OTEA 2NO5A 3KUHA 2C2RA 2OWOA 1PSDA 3E58A 4C8NA 3MCSA 1K8KA 2YKNB 4NJ8A 2A0FB 1UCNA 2E1FA 4ER8A 4MHVA 7ICOA 1ZZFA 1EKSA 3C16B 1HBNB 4B3RF 3WKCA 3LA0A 3VAKA 2EZZA 2F4VK 2P5GA 1ULRA 3UVJB 3KK2B 2RHKA 1SL0A 5KFVA 3OR2A 4H4MA 3AV9A 2WFBA 3MM7B 1UZDA 2H3FA 4QZDA 1C0MA 5ALKA 4TSXA 4IQTA 3CCJS 1CC8A 4DG1B 1URRA 2DNGA 2DGZA 4LF8F 5M1OA 3I0RA 2XLIA 2DITA 5KFWA 3NMRA 4FYDA 3R2DJ 3CE8A 1QZ6A 3BGLA 5H9EJ 3CCEN 4DOCA 5AKKA 3WIUA 4WQ4C 2IHMA 3S3OA 5C2FA 2GZOA 4DUZK 2Y0SD 4PQUA 4ZHRA 3THTA 5JS2A 4HYKA 5ETLA 5EU7A 3PNCA 1VQOS 2B9XA 4XTTA 5M1PA 4GIBA 2ITMA 2IS3A 4CM2A 3MEEB 3P45B 2ZWHA 2RT3A 5D0HA 5ETSA 1BU6O 4FL9A 2EQYA 1RT7A 2I1QA 4XK8C 1YJVA 2DGVA 2ZWOA 4Y2SA 3MMAA 3M8SA 3OSPA 1C0UA 3VPZA 3L2RA 3AO1A 4W5NA 3W60A 1FRLA 3H4BA 2KICA 5C42B 4ZOSA 2WRMA 1NLVA 1ZQHA 3CJ3A 4F4KA 1JLGA 4FPIA 1B92A 1P9YA 1Q82O 4FM1A 2Y3YA 4DCJB 2GHVC 2KFNA 2CJKA 4F02A 1C1BA 3QJLA 3IA0A 4ZVOB 3G8TA 2XO7A 1UJ5A 3RWUA 5F8IA 5KFIA 4DR3J 1WSFA 2JSXA 2GWJA 2WVFA 2FMSA 3TADA 4HT5A 5THWA 3LWLA 1S49A 4PKIA 4GVMA 1U1KA 2JDJA 4CF2A 1RBUA 5E41A 3QNOA 3DLKB 3T1HJ 2ZJPQ 1AUDA 3CCUN 1K8KB 4PRFA 2PA3A 3C15B 4ZITA 3SXLA 3TWZA 1WG8A 2JEJA 2F5GA 2MAXA 2LEBA 1CJUA 2APOA 1SIJA 1WWHA 2BPCA 2FB0A 2IRYA 3T6JA 2XZTB 3QUTA 5CJ7A 2Z57B 2RHFA 2VQEK 3J81O 2YNFA 2ZH2A 4BC4A 2VDIA 4TLQA 4H4MB 1AROP 2I7NA 1WACA 2F7TA 4NL9A 4RTFD 4MMOA 2CQ1A 3CDBA 3SK3A 3RUBL 1KVJA 3K57A 1VSJA 1N36K 4JI3F 4OYWA 4FWLA 4RW9A 2FC8A 3D2FA 3AVBA 4I7FB 2Y0BB 2HHHJ 7ICKA 4CHOA 5J0RA 1NB7A 1FNMA 4K4TA 3NNHA 3TADC 4G1QB 2GIFA 3NF9A 4M3YA 1Z05A 1BQXA 3RJFA 1TL4A 5AI8A 1IQTA 2QB0A 2ZGZA 4PQUB 4NYOA 4ZHRB 3JSMA 1Q95G 2WC9A 1ZTTA 3VEVA 2UVVA 4KGXB 1NNDA 5HL7L 1UWBA 3BDEA 1C0FA 3RJEA 3HVAA 3ET6A 3CI5A 4J37A 5ALQA 3V4MA 4USTA 3PRBA 1VSIA 4X65K 2ZIXB 5KRTA 3DRPA 4C0BA 4RQ7A 2PD1A 2WCXA 4MKAA 1H7XA 4C1NI 3CCQN 1COOA 2O8DA 1RZTA 2VC1A 1VQ4N 4FJIA 3HFZB 3MMAB 4X4TA 1ZBIA 2QA1A 4X4PA 1GT8A 4LVNP 4NL9C 2XGPA 3PTWA 3RW6A 2PFNA 3SMPA 2ZXHA 4I2PA 4B3OA 4E1NA 2WBRA 4J9OA 2G2ZA 3QJPA 4U7CA 3CJTA 3OTBA 4DX7A 4YB1P 1NI3A 4A57A 4FJXA 1NGEA 4MFCA 1C1BB 1XC9A 5I4MA 2V8GA 1Z26A 2DPJA 3GIJA 3S8SA 1BC6A 4DFMA 2NYHA 3OYKA 1O1WA 2QLFB 3TJ9A 5A6PA 1WD6A 3VCBA 4FWMA 3IGNA 2KKPA 3L4BC 1UFKA 3I5AA 1HUXA 2KN7A 3RJGA 4BC9A 4P4PA 5M2UA 2WW8A 4DQ8A 1S4FA 3HILA 4B3TK 3A0BU 1HKAA 4IWVA 4OJGA 2QTDA 1NXIA 5EGYA 2ZUAA 4ZLNA 2QG9B 1ZM4A 3ZX2A 4UBCA 1JWWA 2F4VF 1N52B 3SQ1A 5ALWA 3UO0A 3M7DA 2IVNA 2CRXA 4BE0A 1IXRA 1XR6A 1GQEA 3J80U 1RWKB 3QUBA 2B9EA 5J2CA 2R7WA 3VC8A 3QJJA 2YNFB 3ISZA 2D1KA 1SQGA 1B99A 1OH8A 3KKAA 2A3JA 3OYDA 3BN4A 3HFKA 4JKFA 2AX1A 5AXKA 3K1RB 2RRAA 5LJ5Y 4MQ3A 2A6MA 1Z1ZA 3NVYA 1X4CA 4IO9L 1G1XA 4RW9B 4DL6A 3MM9B 3Q83A 4M63A 3NKYA 1BWFO 3WK5A 2MTLA 1RSCA 4XRHA 2YB1A 2P9SA 3VTIA 3GB0A 3GV7B 1ZQMA 2GLEA 2F9DA 3J7ZT 3BSNA 3GJQB 2F1HA 3N6MA 3O0FA 4V19X 3NEKA 5IT9Y 1KCFA 1NNEA 5AHXA 1NOYA 5TISU 5ALHA 5DG7A 2QA4G 1J9AA 4ZJLA 2XCPA 3HF5A 3QEWA 4IRCA 3O9UA 4CHPA 1S1UA 1U8WA 2GO9A 4IH5A 4WZMA 2QGFB 2O8DB 4OJLA 1YJRA 3W8GA 4RQ8A 3KKAC 3ZSVA 4JD2B 1H2UX 4HT7A 2VJ5A 3P83D 3GQCA 3CXCR 1U25A 1T03A 3ZX3A 3TA0A 3Q24A 4I2PB 4EYHB 3PW2A 5HL7Q 2W1BA 4RW8B 1PYTA 5KFUA 3TAEA 8ATCB 2AEFA 4FCYA 3B0YA 4IOAQ 3O3FA 2NXEA 3BSAA 3NY0A 3KK1B 3HO1A 1EHWA 2HWIA 2NXJA 4CT8A 3HWTA 3P96A 1QQNA 3HJVA 3NRWA 4O55A 4NCGA 1HI0P 4FJ9A 1AB8A 2IYGA 2ZH9A 1RWXB 3M2RA 3MAAA 1YG0A 4PQAA 4LFBK 5B7WA 3GJSB 2KSOB 4KLHA 4OMFG 3ZSWA 2XMJA 2C2MB 4DSKA 3W65A 2VICA 1JQGA 2A19A 4GKJJ 5FPEA 2F8SA 5AKYA 2QWNA 4CP5A 4ALZA 2G0CA 4AF1A 1X6IA 3B82A 1YWXA 3VETA 1T9VA 1S76D 3E9LA 5KL1B 1S72N 2AD9A 4PHTX 1WC3A 2WF6A 1ZAWA 1JJ2R 1V97A 3ZEUA 5HJYA 3PM9A 4ISFA 4H5WA 2MGZB 3UR3C 2VQEF 2E2QA 4LF5J 2CG8A 5KG7A 3OFHA 4BVPA 2OZMA 1O6XA 3CNQP 2YQ0A 3PW7A 1N36F 1S4EA 1ZQUA 3MAQA 5J2KA 4ED1A 4XH4A 5AI0A 2E3TA 5J0SA 3AJ2A 3TA2A 2XNQA 3LDSA 1QCKA 3DRRB 2NRVA 2ZH4A 4NLQA 4WCEL 1ZQEA 2YN4A 1RG6A 3AA2A 2EWSA 2IY5B 4KBIA 2WBNA 2HDOA 2NS1B 1LW2A 4I28A 3MN9A 3NMAA 4X65F 3EUB2 5F8LA 4DU8A 1R0CB 1MWMA 2J6TA 2YY3A 2EBGA 3O44A 2OEMA 1UJ4A 2X51A 4N77A 3O1LA 4IO9Q 4KAZA 5E33A 4F4AA 4XDDA 2P1JA 1HKBA 4CD1A 1S1UB 1RHKB 1ZRMA 3QZ8A 4LY7A 3M9OB 3A0IX 4NX9A 1SB6A 1T03B 3H4DA 2IDLA 3THXA 3M1VB 2CPHA 4Z4CA 4C1NK 2BCSA 1W26A 4P2FA 4BR5A 5GIPA 3SZ2A 1LWFB 2N3OA 5EWFA 1EKRA 5K20B 3FZLA 1QZ5A 2ZITA 1VQ8N 1MLAA 2DEJA 1YVNA 3NGYA 3MD3A 4NYZA 1R8AA 2W4PA 3S01A 4M5DB 2Y8WA 1RWUA 3PJ9A 5LMUJ 4H4KC 1QS4A 4OZ3A 2HQGA 3M2RB 3AVGA 3V7JA 1NGFA 2HSTA 4GC6A 1S6OA 4Y34A 1WEYA 3L9ZA 5AQQA 2PXIA 3M6WA 5IS2A 2VANA 3QRPA 4DR7J 2G8UA 1UCVA 1FJGJ 2KG5A 4K59A 3OYCA 2JZBA 2NZ4A 4OO1J 3UMBA 3K9KA 2XMKA 3QU2A 3ULHA 2MKKA 2HVZA 2XHWA 3ZEUB 4KI6A 1UA0A 5DM6L 2CQIA 4YB5A 3ZSXA 3P5TL 4O5EA 3BGRA 2VKQA 1NRKA 1DFDA 2M3DA 8ICQA 1LEOA 1K6YA 3GTYX 4TNOA 2IGIA 5H1SV 2YX1A 2MKCA 2GQQA 4PHPA 5K9FA 4E7KA 4OJHA 1WHWA 2HNZA 3D1QA 1Z2ZA 2DB1A 3LDPA 3UPQA 1QLNA 1DGSA 2YBVA 5HANA 2ALZA 2DWQA 2V94A 1H7WA 3EKSA 3L4QA 4DL2A 4ECQA 2I6XA 2E5SA 4LSZB 4IUFA 4CK3A 1R3NA 4ZVRB 4CLLA 2LVWA 2X7IA 2YPZA 2EZYA 1GMWA 7FDRA 3H0MB 1NJIT 5F0UA 3TEGA 4BHQA 5HMMA 1MDUB 2UUAK 1LW2B 1PK1A 2VOOA 4DUYJ 3CCLN 3I28A 3RH5A 7ICRA 3KWIA 3GR1A 4UB6U 3VF6A 4DTJA 1S77D 1R6VA 1FFUA 1SPBP 4GKKK 1S22A 2ZTEA 2QI2A 3GYNA 4M3WA 2YWGA 4MLHA 1X8DA 2MUTB 3QMLA 3GYXB 4O8KA 3V6DB 1GX5A 2FY1A 2D1CA 2FJBB 1RLCL 3BQ7A 1YRTA 4X84A 1EWRA 2VQFK 3EICA 1SZHA 4ILMA 2R7XA 2J8SA 1SC4B 1Z1BA 3PO4A 1TAUA 2MZSA 3DHXA 2DISA 2NQPA 1HJOA 1HNWJ 2NRHA 2F9WA 4M5MA 2HAFA 1YZ7A 4LVSA 3T1AA 4Z4EA 3PW4A 2HWTA 1TVRA 3L0QA 2IFXA 4CJRA 9ICWA 2YNIB 5J2HA 2VU5A 1VQYA 5EUHA 5HR7A 1J97A 2M0GB 4I2DA 3A8YA 4BR2A 1EXNA 3VN5A 4C48A 2HZAA 2HFVA 4DPOA 4KGVB 1O8BA 2OMOA 2CPRA 1NZ8A 4J9NA 2WVDA 1LFWA 3PZPA 3GDXA 4UUWA 4NLSA 3POTB 2VOPA 3H5UA 1UFWA 2JWLA 2DFLA 3KHYA 1VRUA 2DNKA 3AFGA 4BQZA 4EEKA 5GAEU 2ASPA 2RNEA 4FF4A 2OELA 4C0ZA 4USVA 2NUBA 5ETMA 4IO1A 1NCLA 1BE4A 3NCRA 4OGEA 2EAMA 4R66A 3I31A 2A1AA 5I42B 3E8OA 1JLFA 4TU9A 4IJAA 3I56N 3CCTA 3SSRA 5KT6A 4NLXA 5CD4H 2FBTA 1KOOA 1JCGA 3OBYA 3OYIA 1RB0A 4DV1J 4BS2A 1Q4RA 1RA6A 2G8KA 3M5RA 5K8MA 1CG2A 2CZVC 1WDDA 5ALEA 2NYIA 4DBQA 2N7YA 3H20A 4USWA 5CHIA 3ISDA 2LSNA 3CO9A 2CGLA 2E7VA 2EAPA 3G6VA 4GXIA 2DNYA 3EPIA 1MA9B 1MNEA 4CF9A 2CDRB 1TFWA 3VQ8A 3M6ZA 2DGUA 3GIIA 3QEIA 1U24A 2I5JB 5DM6Q 2C1EB 3EZWA 2BA9A 4I64A 1QHTA 4HH1A 1JROA 1TFRA 5AK4A 3UE5A 5AM5A 3MPYA 1G2EA 3KDNA 3OS2A 3EW9A 3CMAS 1M1HA 4B3SJ 3KG0A 2Q3SA 4FWRA 3PR4A 3NBPA 1G7CB 1VRTA 3CCMS 2I7PA 1WB9A 2ZUBA 1FF2A 3CCWA 7ICJA 2EC0A 1RHMB 2B0GA 3D0HE 4HAIA 4KAIA 5BYSA 1BA0A 5J2MB 4PUOB 2WTUA 5HRRA 1TKXA 1PCAA 3TAMA 4CEBA 3U27A 5MAOA 2V50A 4IL6U 3I9ZA 2L9NA 3VQ7A 3UQ0A 4F0KA 1U1NA 4OZLA 4ILHA 4QZ8A 1NK5A 3VEOA 1URJA 3RGIA 3F2KA 2A18A 3E3XA 4HVZA 4IFYB 1NKBA 1N60A 1V38A 1VGYA 3Q7BA 3PRDA 3MM5A 3W61A 3ID6A 3EMTA 4LIWA 4HTUA 4DU7A 2DHHA 2CQPA 2CNOB 2OH2A 4O5CA 2NSBA 3TUJC 1N6QA 4DF8A 3BSOA 1DJ0A 3THWA 3THVA 3BF4A 1HNXK 4QPTA 2DJWA 2AF6A 4IRDA 3RMCA 2ZM6F 1FRKA 2IBKA 2XI3A 3M9NB 3N4QA 2OKQA 4FLZA 2QSFA 3MAHA 3LVWA 4Y1CA 3M2VA 5GIOA 2KJ8A 5FRNA 4R5PA 2YXLA 4BWJA 2QEXS 3AVHA 1C1CA 2J9EA 2PEBA 4Y3CA 3PJXA 3AB2B 3DN9A 2Q3PA 4CH1A 2OA8A 1N34J 2V4RA 4NM1A 4YDUA 3N7PD 5JLHA 4Y0FA 1Q81O 1V9OA 3PHEA 3C29A 4BQLA 2RPIA 4IFVA 4ZP9A 2MZ1A 4TQRA 4YQWA 3MOZA 3EZUA 2IDOA 1G6BA 4O4GA 2PAVA 3AD7C 4DN9A 2HHPA 1WC4A 1QVFM 1RKJA 2HF4A 1Q8KA 2KFZA 1EZZB 1SV4A 3H25A 3CCZA 2X74A 1X0PA 4MYUA 2YX6A 3OL8A 2PIIA 3TA1A 2I0XA 3AQEA 3ZETA 3HCXA 2UUAF 1RHUB 1VAZA 2XHBA 3ZT4A 3CCSS 4FP9A 4DL0C 4C7YA 1KQFB 3MMCA 2DYAA 4I9LA 3VF2A 3MCOA 2OEKA 2GIRA 2BHNA 1T11A 3NBPB 3BS5B 3V81A 1VRTB 4C23A 1ZTWA 4GKKF 5CR4A 3ADAC 1C4CA 1RWPB 1RT5A 1N8RO 1Q8IA 2MDAA 4DR4F 5GMDA 2HVHA 2PMZC 3WXJA 1TKXB 1HKGA 3TAMB 1TUUA 1H72C 3C19A 4FZYA 2F3JA 4ZJOA 4YHHJ 4CK1A 3FBFA 1ESVA 3OYNA 4QBUA 4LF9F 1U04A 2Q0RA 3PIPQ 1RTZA 1NZAA 2DPIA 2L9DA 3Q8UA 2QXLA 2VV5A 1XSNA 2ZD1A 4GNIA 3MX2A 4IR9A 5BR8K 4JI6K 3EGWB 1TAQA 3HSZA 4CW7B 3HKZD 2PMZF 2BABA 2VA3A 2DK2A 2JJ4D 3A1YG 3AB4B 1RT3A 1Q7YT 4ZVFA 4KHRA 1N6QB 3HSCA 2Y1JA 1X4EA 2H3VA 4AUKA 5HN0A 3THWB 1SV5A 1VCTA 4JKAA 3NP5A 2WAQC 1IN0A 5F9LA 2L48A 3QT8A 4ELVA 3HRDD 1TU0B 4I68A 3U9ZA 5A2QY 2KG1A 1Z00A 3LTOA 3R9LA 6FD1A 4OHXA 2G09A 1C1CB 1F3FA 5E3QA 4CJTA 3JPSA 5B09A 3BZCA 4J2BA 1RBTA 1T6CA 4ZIVA 4DMZA 2XY7A 3CIMA 1HUZA 4LZDA 1F1BB 1R0AA 2CQ3A 3EX7B 4DL3A 1VQ5N 3D0PA 5DO2A 3CMEN 3DLEB 3ZZTA 2DRBA 1WHVA 4JI0J 5TZVA 5C2CA 1ZBUA 2N82B 5I3UA 4O4GB 1L3TA 3LP0A 2QM1A 3A8IA 2B3TB 5DM7L 1IKXA 4JI8K 2B9YA 5FPDA 2BJEA 3G87A 2ZHBA 2RRBA 3B9JA 1FD8A 2KFYA 4GW6A 1IV0A 2GBZA 1IBMJ 2V2KA 1ZQFA 1A6LA 3EUNA 2MSSA 1TP7A 4EK2A 2XMUA 1DHMA 3RBDA 2AJQA 3QIOA 1RILA 3K1ZA 1N2XA 3MMCB 4WYBA 4RPYA 2Z4PA 5AJ3F 4X64J 2V0NA 4Q7AA 3IR7B 1NK6A 5LY3A 1HEKA 5D4LA 3LP3A 4RU2A 3PX6A 3PIOQ 4DU3A 1IJFB 4WYWA 1YJWN 3DYAA 1TL1A 4NLVA 2IPOB 2F2AB 7ICEA 1QAXA 4PZNA 1S0VA 4PL8A 2QB1A 1S79A 2R42A 3NOCA 4UF4A 1BPBA 3CDAA 4HHTA 4KH4A 4ZVUB 4WE1B 1O0PA 2UUWA 2B51A 3OXLA 4E3SA 1PYOB 4M95A 1N5VA 2FZCB 1WN7A 2X6NA 5AXLA 3SQGA 1S97A 1VQ9N 3QQCD 4JHDA 2NYVA 3ENHA 2VBWA 3D6TB 4CO2A 1A76A 2KXHA 4CNQA 2V68A 3PO5A 1UQVA 4RW7A 4CFDA 1FT8A 2QW9A 2HFOA 5LOQA 4Q2MA 2NSCA 2RD5C 2PFUA 5J1EA 1JLQB 3G86A 4G3IA 4HCCA 2RQ5A 2XB2D 1KD1O 5EWGA 1CJTA 4HI1A 3X1LB 4JV5K 1CBKA 2DR7A 5JLFA 3MTKA 1L6NA 3J80Y 2IM3A 3GFHA 1RT3B 2FVPA 3QWUA 1SH2A 1TUGB 3T5JA 4QR2A 3VAHA 4D3GA 4AQYK 7ICUA 5CWRA 4UOHA 3AU6A 4LF7J 2LKYA 2LYAA 2FPHX 4LF6K 2LA6A 1E6YB 1TUVA 2BRLA 1ZM2A 2E8NA 4W5TA 5FRMA 3HPOA 5KFYA 5ETOA 3TARA 3M7VA 1EKEA 1X66A 4P0PA 3AMZA 4WP3A 3S41A 1Z00B 5KG2A 1I51B 4ZLJA 4JI1J 2P5OA 1KONA 1D1UA 5GADU 4R0JA 1L3UA 1HR0F 5TKWA 3FC4A 4M9JA 9ICTA 2B4VA 2HWHA 5K5MA 1TMMA 1R0AB 1OIAA 2VGMA 2BRKA 8ICHA 3C2MA 2XZDB 1R31A 4CFBA 2JEGA 3L7PA 3C6TB 4DV0J 3RJKA 2G5HB 3D66A 5KFSA 3G2XA 2CYYA 3C94A 4BCAA 5IINA 2J4RA 2DD8S 3RW7A 1R27B 4LSLA 3AAQA 1IKXB 3VAFA 1IBLF 4MFAA 1HPMA 3D6FB 4WFNQ 3L3FX 4IOBA 2V7YA 2QFJA 2C2OB 2ZJAA 2F76X 2HGMA 2W7AA 1RAIB 4B3RJ 3LUYA 2BQUA 2Q36A 3JQKA 1ZC6A 2MYFA 1A7GE 3UD3P 3UB5A 4KX5A 3OYJA 3MMBA 1O13A 5HMLA 5DBCA 1T9UA 5AZJA 3CJCA 1VQ7N 3Q0AA 2DCLA 4NWBA 4CJPA 4UW2A 2BCVA 3NHGA 3W7BA 4F4WA 3V6HA 3K59A 4P2XA 3BO4A 4LF8J 1Z6RA 4QZIA 4JKHA 4N56A 4CZKA 3DYAB 5DM7Q 2N4CA 2QV6A 2LKZA 2GJFA 2VZ9A 3ZLJA 2CQGA 2GVZB 3NOGA 4G6VB 3V4IA 4DFDA 2EFOA 2ZUDA 1UPMB 3SQGB 3VQSA 1LAVA 4DZ6A 4JHDB 3CCRS 2HBRB 5ALZA 4C8LA 5D3GA 4RW7B 2ASMA 1KQKA 3CHWA 5BR8F 4RUBA 4DFKA 8ICWA 2D0PA 3LP1A 1HWLA 4OHVA 3D0GE 4P74A 1SGGA 4QZFA 2KIWA 3DXSX 5DZ7A 1RU1A 1H98A 3DU5A 9ICRA 4BG8A 2QL9B 3KWMA 2HMXA 2FSKA 4DF4A 1ZQCA 5IZHA 4C8MA 2H3EB 4DV7K 1G15A 2G2OA 2H51B 3VZHA 3LZJA 3US5A 3LM9A 2ISPA 3CIZA 3QNMA 4K4VA 1RDBA 3PX0A 3Q8LA 5EE9A 2AYMA 2G8HA 2RUGA 2BPGA 3O3HA 4F4ZA 2PEHA 4JRPA 3BO2A 4CQ1A 4LSNA 1ZQTA 1XNRJ 1BDGA 2LQ9A 2A1JA 2PKEA 3TZYA 2EW9A 4QS8A 2KJ9A 3M8RA 5CCLA 2CQCA 4RNOA 3TUIC 3ZT1A 3F56A 4F91B 3O80A 2ATLA 4YXJA 2ZWPA 3QUCA 1NPPA 1S0NA 1X5TA 3D3BJ 3TAQA 3E2EA 2BZFA 1N5YA 1BLUA 3AL0B 3AO4A 2VONA 4GV3A 4UBBA 2BE7D 4Z6CA 4JI8F 3JXOA 1DKGD 1N56A 3RB0A 2MKYA 1F3VA 3O6QA 3WC0A 2D0CA 4M3RA 2N1RA 9ICKA 1Y5LB 1SB3C 3CDWA 2XNRA 5KFNA 3C2PA 1ED1A 3LALA 1OY8A 3UDCA 4Y6IA 4I1TA 2UVRA 2VPWB 1S6QB 3K5MA 3KK3A 3PJWA 4BR7A 3LPEA 4ITSA 3CC4S 3MF5A 4H0XB 3NRZA 4P2MA 2NLXA 2EFVA 4FVUA 3T1YK 2DTJA 4ED0A 3WDOA 4MN4C 2BX6A 3FEYB 2KG0A 3KFWX 4ZS6A 4CYUA 4HUGA 1RGIA 2NO4A 4I2JA 1UPPA 4ZVSB 5DQGA 2QLTA 3QLHA 1YJNN 2YI1A 2Y9HA 1S10A 1WSJA 1WC0A 4QOTA 4KE5A 2FZGB 3V4IB 4WIIA 3R97A 4KHUA 2O8CA 4F8RA 2HFSA 5AKGA 2EK6A 4A48A 1NZPA 4XQ8A 2M0NA 3QBXA 1M1KT 5D3GB 3FZFA 1BPDA 2FY8A 2QWMA 3EZOA 2L9WA 3MPUB 5FPNA 3VGSA 1B22A 3WQUA 2E1EA 5FLXO 5B8HA 4K4SA 1S9EB 5AQNA 2W4CA 1TAMA 5J2GA 4ZVEA 4NZ6A 5HRPA 1CXUA 4AQYF 5LM7E 3RG6A 1ZQSA 4CIGA 3IRUA 5JRTA 2PBDA 4PPZA 1AUSL 2H3ZA 2Z8QA 4LF6F 3D7SB 4U7UD 3EVWA 5HP1A 4Q43A 2YTUA 1IUJA 3AO5A 2Z2LA 4LRAA 3KIOA 1BA1A 1X1PA 4CEDA 1Y11A 2QKBA 3MECA 3OR1A 2P9KA 4LSNB 2VYPA 3D6MB 2A1JB 3M32B 3KXDA 1RHRB 3A5LC 1RDRA 5B66U 3VVTA 3CCUS 4QPXA 4M5HA 4OI0A 5G5HA 4U67L 4Q8EA 2YPYA 4UW9A 2QSWA 3R5JB 3S3NA 3OD2A 3V9SA 3NRBA 3N9UC 4LF4K 5KFZA 3OLBA 1X2IA 1OVQA 3CD5A 4CF5A 1DEJA 4LF1A 4NOHA 1UAWA 4C2MA 3H8WA 1YSJA 2EG1A 3L2WA 4OHWA 1Q79A 1XBWA 1WUAA 2ASOA 3K0JA 2G06A 5G0RA 1VQSA 4K4GA 3WEEA 2AJ1A 2YWWA 2ZUCA 4F36A 2I8EA 2F4VJ 1YAGA 1OVYA 1YGYA 4KLFA 1V5IB 4YDDB 1Q86T 3B4MA 1BMQB 1J54A 4FVMA 3T6BA 3U3YA 1LOTB 1SL2A 3MGJA 2R2SA 4I0WA 3QSIA 4RKUC 2BJ8A 5KFRA 3VAGA 2KT3A 4M5JA 3AO2A 1NGIA 4CYUB 4O3PA 3H42A 3SEOA 3UQ2A 3IBPA 3QLHB 1SAZA 5IIOA 2MHEA 2O8BB 1P27B 4OI1A 3HP6A 1S8OA 3TJAA 4YOVA 4KJIA 2M7SA 1UVLA 4OX8A 4PHEA 1AT1B 2R18A 3HFVA 1HBUA 4ZCIA 4JKBA 3WKAA 2O8CB 2IJNA 4ECZA 2A2DA 1UWAA 2AQ0A 2V67A 4LREA 3QNWB 1RTDA 3CC7S 5C15A 3VGUA 4O0NA 3O8MA 1N32K 4KGMA 1IJJA 1VQPS 1VQKS 3QRRA 5F41A 1PC5A 2VA2A 4AHVA 1ECWA 2OCEA 1JXVA 2HLTA 9ICFA 4CRXA 3E0FA 1IKVA 2WHEA 4DV6J 1XMQJ 4DV7F 4K25A 2M8HA 3HPHA 1CZ9A 4FLUA 3KMQA 1N5QA 5HP1B 3CJ4A 3MD1A 1ZQDA 2XYHB 4HLBA 2CNNB 4EUVA 1S1WA 2XY8A 9ATCB 3TPQA 2YNGA 5J0XA 3QZ7A 3H5YA 1DK2A 3MECB 3MWTA 1U1LA 3C7NB 2FJWA 3Q8PB 2CVIA 3IM9A 4E2FB 4EWTA 2WF8A 4RQ6A 3L4PA 1ZA1B 1NJZA 2K3KA 3DLLQ 1M0SA 2AEMA 4E7IA 3M8QA 4ZN3A 4M47A 3AVFA 1IXKA 2QWQA 4ZCMA 2RDIA 2ABYA 4RU9A 3BQ0A 4I2FA 4CEFA 4KB7A 1SZ2A 2OPPA 2L3MA 4DR6F 2LDYA 3R9KA 1NJWA 3HULA 1VQ6N 2PSZA 4ZKAA 3LVVA 1PC4A 2DO4A 3CG7A 1KN5A 3ISNC 4NASA 1WBBA 3BF1A 4UOFA 3SBGA 4BR4A 1I5OB 2F1FA 2HEKA 2RB7A 7ICMA 5IIMA 2VA8A 1WSHA 2Q31A 4EYIB 2B5JA 2L41A 4RQ4A 2DKOB 8AT1B 3VAIA 1U45A 2VQEJ 4QS9A 4Q44A 1QSLA 1VBZA 2K4EA 2E9RX 4QWAA 1EETA 4GRSA 2NCKL 4JKDA 5KG4A 3LP2A 2F8HA 4FZZA 1QHAA 4DTOA 4YORA 3T5KA 2MQPA 4HDHA 3FZ2A 1N36J 5DMRA 3TTCA 4RQ0A 4ZPWR 4IKFA 4BXOA 1BPEA 4I6AA 3ILOA 1CC7A 1WC1A 2OD6A 3AOAA 3H8YA 2D3ZA 2N3LA 1OPZA 2CPZA 2QTWA 5HR6A 5AQWA 4OX9K 1JUDA 4Y2YA 3RYLA 1HBUB 3JTOA 2ZJQQ 1BISA 1F9EB 4KO0A 1IWAA 4AILC 2QYGA 1VQNN 4NXNK 3CPWR 2BDUA 3ETLA 1RTIA 4PY5A 5C7PA 5DBBA 8ICVA 2Y1IA 4X65J 8ICIA 1FEHA 3C95A 2Z2YB 2DY1A 4WF9L 5DLFA 4ID5A 4HTLA 1X9SA 1GLEG 2WHOA 4GXKA 1VLBA 2GV9A 2D8CA 2BJ7A 4YY3F 3R1XA 2EH9A 1T4GA 1HLWA 2E5HA 4C4WA 3T69A 1IKVB 3SYZA 1NU0A 4AL5A 4B1ZA 1KW4A 3A3NB 5F9NA 1QQ5A 1HPZA 2KH9A 3CB4A 4MK9A 1RGVA 1EXQA 2RH3A 4MEXA 5AQJA 4B3MK 1S1WB 3G71S 1ZQLA 2MY8A 2YNGB 5GAHU 4CWBA 4FLTA 4L3KA 4DSLA 2CJAA 4B1UB 2R7UA 1PIEA 1SJRA 1S1VA 3EE9A 1Q9XA 1FE4A 3AVJA 4PG4A 1N61A 3OYAA 5J2DA 1BG3A 2C3MA 5C2DA 2BJ1A 2WSFC 3RB6A 2DGOA 3RH6A 2VB6A 2BKPA 2AT1B 3M8QB 2DH7A 2RQCA 3VA3A 3DCAA 4LF4F 2F8EX 3VQEA 2H5XA 3PACA 3JB9k 3EN9A 1VLYA 5D0GA 4Q0BA 3WU2U 4R64A 1ZD2P 4GLXA 4CO3A 4CO5A 2DNNA 1KAXA 7ICNA 4ECTA 4HUEA 5GAGU 3M9MB 4J7CA 3OFFA 2I6WA 4RUAA 4W92B 2XLJA 3DDKA 2QIFA 5BXIA 2V4QA 3N0VA 5AI9A 3ULDA 2BKEA 3I55S 3FRYA 1SUQA 2RMLA 2C3OA 3NWGA 2Q4TA 5AFUA 4E0DA 3QNNA 2LMIA 1S1TA 3EGNA 4M1KA 4FJKA 1ITPA 3LP2B 3G82A 3BBFA 4LQ9A 3H90A 4MT1A 4FSVA 3K17A 4C3MA 3QETA 3SQIA 3SENA 4M5IA 1X9WA 4M9HA 1MMDA 4C97A 3O9TA 1ZYQA 1S6UA 3M6UA 4FZLA 5EX5A 3L3UA 4EHTA 3UN3A 4X2BA 4M3TA 3KOAA 3MUMP 5IWAK 5B0AA 1SJ4P 4OI2A 4KO0B 5A8KB 3WT0A 4GMKA 3JYTB 1RTIB 2EK1A 1MN8A 4UB3A 4KTZA 1LQ9A 1FTRA 3GE9A 2OAUA 2ZIVA 5F0WA 1N32F 3JXUA 1YT3A 7AT1B 2KKVA 2DNMA 4ZVQB 1L7NA 3FSYA 4A8QA 4KRFA 4DS4A 2RF2B 3UWTA 1A0PA 4JP8A 5CABA 3PYEA 3IXQA 4Z2XA 4QIGA 2ZTDA 1JL2A 2HQDA 3UMGA 3J81j 1WOSA 2QN6B 1D8ZA 3RVCA 5LSOA 3NASA 1QQOA 3IFEA 3K2YA 2ZIWA 1FI4A 2RP5A 1VS3A 1NGBA 1HPZB 1VSEA 2P9PB 2WONA 2D69A 4OI3A 4KX3A 3R9PA 4MH8A 4IG3B 1IM4A 3GG0A 4CO0A 3DLBA 5AQIA 2YWEA 3PFOA 3D2SA 1IKWA 4XPCA 1SKSA 2IVOA 3KUEA 2CPXA 4AXJA 4ED2A 1IG8A 4DU4A 3BPSP 4BRQA 3AY0A 2OPRB 4WF9Q 4BR9A 2OI2A 1ZBFA 1ZQVA 3AGKA 4O4RA 4OVLA 2YV0X 3R1HA 2EKNA 5E2QA 2AJ2A 2AP1A 1U6ZA 1WEZA 2ZUGA 4BRMA 4BRPA 4DSEA 3FEXB 4Z7YA 1YLXA 4BY9C 8ICTA 3W5YA 7ICSA 2ZHOA 4Q0BB 4Z7CA 4CNZA 2ZQBA 1BI4A 2I5HA 1FDBA 4NZ7A 4CH0S 4KLTA 1TYQB 2XEXA 3FNNA 2M52A 2BGGA 2O4IA 2OP5A 4ANEA 4RW4A 2M9NA 1CQMA 4CF1A 1EARA 5KPZA 2R8IA 3IKMA 3W62A 1ZD5A 2NZTA 2W3RA 2IHNA 3MEKA 2JRSA 1E4FT 4M9GA 5CZVA 3A8JA 4OYBA 3G82B 5KFLA 4CGZA 2HFZA 9ICHA 3OVAA 3IHQB 3OLAA 2HHUA 2Q0UA 2FSJA 4XO0A 1T05A 3ZFVA 2JVOA 3OYFA 1ACMB 4A8XA 1HNIA 1NGAA 1WDTA 5CB1A 3GFKB 1S6PA 3CCLS 5LMNK 4MYTA 4UAWA 1HRHA 1K44A 1NK4A 5L39A 1I94K 1HQUB 4OYOA 3N7SC 4NXNF 1J2VA 3IAYA 1TKZB 4YOYA 4WBFA 2P9IA 3QT7A 4OV1A 4P71A 2Q97A 1WC5A 3QUQA 2HMPA 3IN5A 3GCXP 2ZIVB 3FCHA 3KLIA 3A5NC 3OPKA 4WTOB 4KPYA 1SI9A 1RAAB 1OY9A 3MTJA 4DTSA 3O1WA 1IVZA 4A61A 5DDRC 2K4PA 1RYUA 3GP9A 2JMGA 4NXMK 1VBXA 4X62K 4NLCA 4CJVA 2WONB 3P5JA 4B3MF 4PYAA 3H6EA 1IIPA 4PKHA 2XYGB 1KFSA 2ZHAA 1FVSA 1RQ0A 9ICVA 3U1MA 3RSEB 1IKWB 3OXFA 3UKRA 5K14A 2VDHA 1FWLA 4ILRA 4BDPA 2YH1A 4CVNE 1AW0A 3RMAA 3CQXA 3TUZC 1F2GA 4USAA 1A5VA 4S0MA 4NM2A 3W2VB 4KLUA 2ZZNA 3P4IA 3ILLA 3GV8B 2M4MA 4MIAA 2HBJA 9ICSA 1LB2B 5M2PA 3E66A 5AM1A 5B0FA 3S9HA 5JVHL 3P8BB 4AYBF 2WSEC 2V7ZA 2P66A 1DLOA 2KDOA 1MQ2A 1TKTB 4DR1F 2ZM6J 2OEHA 2RS8A 1BI4B 2V2VA 2NRTA 5HNKA 4OYPA 3VF4A 2AMCB 3CIPA 4Y2UA 3P31A 4K0KJ 4RW4B 4KH6A 3ZT3A 1D8BA 2ASLA 3KD5E 4I29A 2X3DA 4P9SA 1YK9A 1B3TA 1T0TV 4BC5A 2E1YA 8ICYA 3QESA 5AKHA 1Q8LA 2J6UA 4FJMA 4FO0A 4JB8B 3NE6A 4ZIWA 1UETA 3NF6A 1V4TA 2CZ4A 2BOAA 3JPTA 1NU4A 1K9MO 1HI8A 1U0SA 1WUDA 4CLZA 4KMOB 3EM1A 3EDRB 1DARA 2OTLN 2NNWA 2K06A 2PFDA 1F9HA 1T05B 5I9EB 1UVIA 1E6VA 4HI2A 5IT0A 2DFEA 5ALFA 4KYZA 2M9KA 1HYVA 4G1PA 9ICPA 4KH1B 4PXDA 1S6PB 2XCAA 2CRLA 3LAKA 3AQFA 2HFNA 5HLFA 4X66K 5L9XA 4OLAA 1IKYA 5IWAF 5ALOA 3GPAA 4TY8B 5KAIU 1L8OA 1RM6C 3R7NB 4DDFA 1J2MA 1RXWA 2FVSA 4K42A 2UUAJ 3UM9A 2P9IB 4ELTA 3ZT0A 9ICMA 1YJ9S 3M3ZA 1LV5A 5DGBA 4AP9A 4KHPK 3CD7A 1T9TA 4HH0A 2ZBIA 3VALA 2NUHA 4UT4A 2AJ0A 3QEVA 2YX7A 3MCPA 2GC8A 3AVCA 3RR8A 2V9WA 5D8HB 4RNHA 2X1FA 1NZBA 4GKKJ 5JVGL 3R3LA 3TFRA 4LUBA 3ZSRA 3CCVS 4HHHA 3MDCA 3UMCA 4DR4J 2IVPA 4Y65A 3CTRA 1JXBA 1U2RA 2DRAA 2MXYA 1ZAXA 4Y2CA 2A42A 3ENWA 3LF0A 4PHAA 3SI8A 3VZIA 1TFYA 5K14B 2NUUG 4LF9J 3WKBA 3LM2A 2CGJA 2W7OA 3QU9A 4DV3F 2VWKA 1HBOA 1CI4A 2IAJA 2AU0A 4Z4IA 1FO1A 1BWEA 1UA1A 2NXCA 5ALLA 3K5NA 3RR7A 3RF9A 1M5PC 3OXGA 4B9LA 3CEDA 5J2NA 5AXNA 3JAMO 2V34A 2FUG9 2RIJA 1BCMA 2IA0A 4JEPA 1DLOB 3LDAA 1HYSA 1NM2A 2HHSA 2OPSA 2A2CA 2W7PA 2G8IA 5BYRA 2R7VA 2Z0GA 5DB6A 4OYXA 1WOQA 3QU5A 2LLZA 3IM1A 2NZCA 4RPFA 2X1BA 3IBFB 4LH4A 1OH5A 3QT5A 2PFPA 3DXBA 3S1TA 1QUVA 2QC3A 2R2RA 1EQYA 1WTFA 3QU4A 1Y10A 4WXWA 4I2HA 2F8MA 2DBBA 1KKXA 1WF1A 2OPQB 2HB5A 4K4IA 3HRGA 1DTQA 4JV1A 1XIQA 4WJ3B 7ICTA 4YG2A 5EWEA 1NGHA 3N5FA 3MN7A 4G1IA 2DGWA 1ZQWA 3UD5A 1E6VB 3KD1E 3DRYA 5ADXA 1EQ0A 4LVOP 4MFBB 4KITB 2MQMA 5AQUA 1G4CA 5HLFB 3SUOA 1IKYB 1JX4A 2JGUA 1REVB 2HBYB 3NNAA 4W5QA 1BPXA 3BZQA 2JH7A 3TNVA 1JB0C 2M70A 5DGAA 2WFAA 1KN6A 1KQQA 3ULEA 4QZAA 4I6YA 1B0TA 1Z2LA 4FFDA 4UB2A 3BQ2A 2GEMA 3T9ZA 2B4JA 3V6KA 4M42A 5AJ3J 3VQDA 2X3GA 4FK2A 4HDGA 1L7MA 1HMVA 2U2FA 1AQ6A 3QBCA 5A0YA 4BREA 3TSPA 4RW6A 4YOEA 3IS9A 1NEEA 1WF0A 5L1JA 4KHQA 1K0TA 3HHEA 3T1HK 2G0IA 4TU7A 1S3XA 2FHMA 1YRXA 1NGCA 4YDXA 4LH5A 2OHFA 5C0YA 4DL5A 3BY5A 4M3ZA 2J7WA 1GMVA 3T41A 3CJKA 4P7TA 1TL7B 2AIRB 1K0VA 3C21A 1SH0A 9ICNA 1QUPA 3J81U 4DPYA 3ED5A 2ZTCA 4CJ3A 5KAKA 2LEPA 3I5BA 2Y0SC 1JJHA 4ZCKA 5KPRA 3KUGA 1N33K 3PVXA 2PMZD 4F25A 3AHPA 4GVBA 4EI2A 2XS7A 4CESA 1WKLA 2IAJB 2ZNYA 4C0OC 2ZF5O 4CTAA 4ZA1A 2GHWA 4TY9A 1I39A 3R1LA 4DCHA 4QJVA 3CYMA 2HHHK 2CNLB 4DEZA 4CZGA 5LJ3Y 5J2NB 2HNYA 2VODA 3CCJN 1FE0A 2K89A 4YOXA 2QMWA 4QZCA 3FQKA 4JKGA 2P9EA 3O2IA 3KJVA 1OH7A 2LQJA 3OHAA 3NH2A 2BE9B 4CGFA 4DV2K 3KKRA 4DSIA 4JLHA 4O3SA 1D3WA 4JWMA 5ALYA 4MKVA 3J7Z5 3FR0A 1DRGA 3F0NA 1QQ7A 4DL7A 2W4DA 2XSJB 2E5IA 4ZTJA 4E1JA 1HR0J 4J9UE 4BR0A 4PG6A 3W63A 5IOLA 3PSPA 5DS7A 3QO9A 2WAQD 2DGQA 4A8EA 4J9SA 1NK8A 3H3NO 1PGZA 2FJEB 3BYRA 3CJ8A 4BRAA 1DTQB 2WVCA 3HHLA 4JYAF 1ZPVA 4OPHA 2R7OA 3LO3A 3M4XA 4PCQA 5GAHI 3R5DA 3TOQA 4ES3A 4FF2A 4BACA 3LPYA 2A1SA 2VWJA 3QGGA 5F8JA 1OUQA 4X66F 2YWKA 1JLEA 2Y1RI 1IBLJ 3EXCX 3HHKA 4PXEA 3NAEA 4K4XA 5BPCA 3SMVA 3HZ6A 1WUUA 2PDAA 1X9XA 1D9FA 2RE2A 1VK3A 5DETA 1PVQA 2HQCA 4P10A 1YJWS 4U7BA 2YB4A 4URQU 1VSDA 1T8EA 2E1RA 2D4WA 1RJJA 4RNNA 3RBZA 1HMVB 4KREA 1D8LA 4FZVA 1VQ9S 3AEVA 2E2PA 4F5NA 3IS9B 1KR4A 1BO5O 1HNZK 4ZN1A 3NS5A 3JS6A 1RBLA 4JI2F 4B6JA 4QCLA 1K8AO 2GA7A 3TP2A 1WG5A 4BGAA 1LKZA 3U3GA 5AKXA 5CA7A 2UXDK 4NYNA 3VQCA 2IOCA 4FJ7A 3A12A 3CJKB 2KHOA 4NI2A 2W9CA 4URSA 3QYPA 4Q5VA 1DBDA 4U95A 5FP0A 1X60A 3ZNUA 1FEEA 3HVWA 3UR0A 1H3DA 4NE9C 1RHJB 2MEWA 5BR8J 1IBCB 3CF5L 2DH9A 4N8NA 4GVBB 5A8RB 2C3YA 2KM8B 5I3PA 4BRLA 4CTAB 1KVIA 2R8GA 2Z30B 3BUZB 1Y3KA 4JKCA 3T5HA 2LPEA 2M2BA 1Z3EB 1A9NB 4IQMA 1IM6A 1KVBA 2DY4A 3PKMA 3D45A 3PV8A 2G4BA 2HNYB 2ALYB 2AP6A 4JKGB 1B7FA 2AYEA 1HW9A 1YVUA 3EZ5A 2YCHA 5AQOA 3MBYA 2CJ9A 1OSCA 4QNLA 5KQDA 3L2VA 1A5XA 3H2VE 1S0OA 3EEQA 3PLAA 3I9V9 3WK9A 5A6WA 1LW0A 3FMWA 4CE6A 1TKDA 2YKOA 5F0XA 1ZXIA 1FD2A 2ZXIA 2XMAA 1VHIA 4GV6A 2XMWA 3ZT2A 2FI1A 4DV5F 3QO9B 4CRJA 4JI4K 4CEAA 3NTUA 5JTIA 3BQ1A 3QX7A 5DLGA 2DNOA 4JI8J 4NLPA 2RHQB 2LBOA 3NCPA 1VQ7S 2VL1A 1JLEB 1C0TA 4Y1DA 1ZBTA 4XH5A 4DTRA 4B1XB 4UARA 1BQNB 3LH2S 2V51B 1BXNA 4UZCA 3OYGA 5KFAA 4PPXA 4FYYB 2W04A 3KHHA 2E1PA 3KLHA 2QFIA 1GOCA 4B1VA 2K1RA 1UP1A 3DEEA 2R7YA 1QTNB 3OYHA 2IM1A 3Q8RB 1HBMA 2DR6A 1FDDA 2V9KA 4FZXC 1XSLA 3OVNA 2PZSA 4LIRA 4KHNA 1JI7A 4E7LA 5J1NA 3K0SA 2H1YA 3BYPA 3DGPA 5KQ8A 2AWZA 6AT1B 3AVKA 5AE3A 4UY8O 1YJTA 2W9BA 3UIQA 1FIQA 4IG0A 2KKZA 4NI2B 4WQ4A 3OY9A 3TTDA 2W3SA 5K8PA 1TL3A 1MMLA 3S6JA 2VG7B 1N33F 5J2BA 2AKWB 2QL5B 1VHXA 2BH1A 3C1ZA 2VBYA 2IVYA 2J0QD 3P6YC 3MWBA 5JJBA 5CZ1A 1VSFA 3B54A 3K58A 2NXNA 4OZJA 2HBQB 5BOLA 1RU2A 1RT6A 2OFHX 2UVWA 1JJCB 1BIUA 4DMNA 2ZH3A 3DRSA 2MQ8A 5IXUA 1WWVA 2P6UA 2KVSA 1FFGB 4CLYA 3D2NA 2H54B 4AQYJ 1CULB 3OTCA 4LF6J 3TZXA 1ZQ1C 3GL1A 1HUOA 3F2BA 3QFUA 3HLUA 4DV2F 3VCDA 4LF2A 2HSEB 5AT1B 4H03B 3RJIA 2XS5A 3AODA 2HKEA 1ASWA 2HOQA 2ZOFA 4OZ5A 1TZ0A 4KLMA 4AHSA 3AVNA 3CF5Q 4GMJB 4R8UA 5AQLA 2DNHA 2XHCA 1XTZA 2H4YB 2VFTA 2DR9A 4A62A 4UOCA 2IIRA 3DV9A 5AM0A 4KHWA 2BEFA 3FKBA 2P2CB 4FYWB 3OTOK 4HUFA 5GAEP 5DK5A 4KLLA 2HMIA 3CNHA 3C5GA 4DX8H 1RACB 1XMBA 1NUEA 1QTMA 3AA5X 4FOEA 1C0TB 5ALMA 2CNKB 2BKNA 1S5JA 1VIOA 4KC5A 2EANA 4R79A 3MPVA 5IT4A 3LOUA 1SXEA 3VGMA 3ZTPA 2EPIA 4KRWA 1SKRA 2KT5A 4A8YA 3KHRA 3K5LA 2K1RB 1DAXA 1J5EK 4QIFA 5EXWA </