2Y1IA

Crystal structure of a s-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE I
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1iA01
1BVSA 2NRTA 5J29A 4CGHA 2HNYA 1L3UA 3AUOA 1RT5A 3KHLA 5HRRA 3SI6A 2DTUA 1L5UA 4E7IA 4IDKA 2RDJA 3KLFA 3LALA 1S9FA 5KG2A 3BQ0A 2YV0X 3CM6A 9ICOA 3TWHA 5JS1A 4CHPA 3CG7A 1D8LA 4F92B 1S9GA 1JLBA 2NRVA 5J2HA 1UT8A 4MFBA 4OGCA 4KHUA 3DLGA 4HUEA 2XHBA 3B0YA 2W9AA 2ATLA 1HPZA 1YT3A 1RBVA 4KFBA 4EZ6A 2XY8A 4QZDA 3GQCA 3OJSA 2ETJA 1T03A 4CJRA 3RH6A 1LW2A 1S77D 1RYRA 3AVFA 3LP0A 5DG9A 2XCPA 1D8YA 4J2BA 3HK2A 1LWFA 4CEBA 2C22A 4IRDA 1WSEA 1QSLA 4IQUA 2OA8A 1JN3A 3NF7A 3DI6A 2OZSA 3MAQA 8ICPA 4RQ0A 4KB0A 1TKZA 4TUSA 4CJWA 4B8AB 4I2HA 5CR0A 4DLEA 1WCNA 3PR4A 1KFSA 3C21A 1T3NA 4TQSA 4DU1A 3QEIA 3PV8A 4M3XA 4Y1DA 2Z1HA 2ATQA 3H08A 4CJUA 3RJKA 2P51A 5KG0A 3CFOA 4R66A 1Y88A 5KFCA 3RB3A 4ID1A 3SJJA 4M3ZA 2AJQA 3DOKA 1ZQGA 3QEAZ 4KHWA 4EZ9A 2P66A 1HQUA 2ZUBA 3DOLA 5HRSA 2OPRA 4M41A 3SNNA 1ZQZA 3V9ZA 4JUZA 3Q8LA 4CJFA 5HHIA 3V6JA 4FJXA 2FLPA 3PX0A 1KFDA 2ZTDA 5KT4A 4K8XA 2VA3A 3ZDBA 1G15A 4H8KA 4AILC 4NLKA 2ZQBA 4EP5A 3AVJA 1NKBA 1S0VA 1VSHA 2ISPA 3Q8QB 4CECA 4QOZB 2V4RA 3VQ9A 3ASMA 3PMNA 4RU9A 3RB0A 4QZ8A 1A5XA 2IHMA 7ICTA 3MR3A 8ICTA 1FKOA 1JXBA 1RDBA 1VSLA 4KLJA 3T3FA 5DDYA 2EX3A 1QLNA 2HHVA 5CB1A 1IKVA 4I9LA 4CHNA 1KEJA 3HT3A 4DFPA 3AVIA 3K58A 1NOMA 3SQ2A 1ZBUA 2XGPA 4X5VA 4RW7A 5EWEA 4Y1CA 3OYKA 4FW2A 4C8LA 4B9TA 2C2RA 4KLOA 2V4QA 1NK9A 5J2BA 3TFRA 9ICJA 4CJ5A 3TAEA 4Q0BA 4Q43A 3PVXA 1KLNA 4IQWA 1VSKA 3OVNA 9ICWA 4BE1A 1K6YA 4RQ2A 4ECUA 4IQTA 4ED7A 2OZMA 5J2AA 2GWSA 3AU6A 2A1JA 2PZSA 4I28A 2FPKA 5EU7A 4MF8A 4M6WA 3TFSA 3VQEA 4PPXA 2DPJA 9ICLA 2UVWA 1VSEA 3MR5A 4I27A 4UAYA 2UVUA 5KFGA 4ED3A 5CZ1A 3ZT0A 3DLBA 3TANA 3WNGA 5C42A 1NKCA 2O4IA 9ICKA 2JLEA 4IQVA 1WSFA 3ZSWA 4YMMA 5KT2A 1T7PA 4DS4A 1BI4A 3C5GA 1VSDA 5KG1A 7ICHA 4Z6CA 4J9RA 4FJ8A 4CHOA 2MUTA 2KQ2A 4XRHA 1Z00A 3V6HA 4YNQA 1TAQA 1RBRA 3HP9A 2Y1IA 1N48A 1Y97A 1NOYA 4JV2A 3OYIA 2D5RA 1COOA 4QZHA 4J9NA 3G10A 1GOAA 3KJVA 1L3VA 1QQCA 4FXDA 5E41A 2ASDA 5CJ7A 2RKIA 3LZJA 3GIIA 1WNSA 2BGGA 4JRPA 3L2WA 2J6TA 3RJJA 8ICEA 5CY4A 3HX0A 1KRPA 4FJNA 3TI0A 4CCHA 1L3SA 5IIJA 2ZTCA 3AA5X 4BXOA 4M3TA 1IH7A 3MR6A 4GVMA 3HSTB 1CZBA 3AVGA 3OYMA 3QNNA 5FRMA 4F3TA 3N97B 3K5LA 3TQ1A 3SUNA 1PZNA 5KFAA 8ICUA 4OJRA 3EY1A 4HHTA 3G6YA 4ZTJA 1BIZA 8ICGA 4CJPA 4UB3A 1JLGA 4Z4IA 1DOQA 4FLXA 4DSIA 3JPQA 2HHXA 1J5OA 4IRKA 3C2KA 4GW6A 1VRUA 3GV8B 3AA4A 3EPGA 2FBVA 2ALZA 1QS4A 1JXLA 1TV6A 2HHUA 2F96A 4FJ7A 4TSXA 1BCOA 3M8PA 4R8UB 2ZJAA 4BGDA 4F5NA 2BCQA 3FFIA 3HJFA 1HYVA 1RTDA 2BANA 3HVRA 5L1LA 4HCBA 3VQ4A 4BACA 2PYLA 2XGQA 3PW5A 4FS1A 2DPIA 2R8HA 4YCXA 5KI6A 4CFAA 1ZBLA 1AROP 4DO9A 1KLMA 4DTXA 4QWBA 1TV9A 3IG1A 3L3UA 4Q45A 1TGOA 2Q3SA 1BPZA 2OWOA 4GLXA 3EW9A 3H4DA 3NGYA 4CF0A 3KLEA 4ELVA 5HP1A 4CEFA 3LP1A 3OYGA 3P83D 4F4KA 4DTMA 2M9NA 3MGHA 7ICMA 1JKHA 1RT2A 4Z6FA 3ORYA 4CJVA 4PQUA 2A1RA 4YFKA 4FLZA 2BGWA 2FBYA 3CFRA 4NY8A 4KMUA 1JMSA 1BPEA 4RW4A 4ECQA 4ZH4A 3EZ5A 3AVMA 4B9UA 3RH5A 2GBZA 5KT3A 4M3WA 3T1AA 2X78A 3MFIA 1X9SA 4YMNA 1UAXA 2ZTEA 2PXIA 1KDHA 1TFRA 3C1YA 5IIOA 1S1WA 3G0ZA 2YNHA 1NJXA 2IDOA 1RTHA 5EWGA 1HNIA 1LB2B 5KG6A 4DWIA 4RNMA 3LK9A 4UAZA 3ZD8A 4M9NA 2AQ0A 3GIMA 2G8IA 4Z6EA 3AVKA 1WAFA 4ECRA 1A77A 2WOMA 4ELUA 4NYFA 5J0UA 4GXKA 4O3SA 3H8SA 4GC6A 2G8FA 3P1GA 1YTUA 4ECTA 3ZD9A 8ICCA 4NCAA 2PYJA 2FBXA 3QEBZ 1RDAA 3K5NA 3KTQA 4YR0A 1XSPA 1J53A 3AO4A 3JSMA 4QZBA 3K59A 3RR7A 5KFOA 4EYIB 4F4ZA 2AU0A 2G8KA 1NKEA 1BGXT 2JZBB 4O5EA 3UQ0A 1S76D 1UOCA 5HMMA 3HYFA 3THVA 1D9DA 1ZBHA 5F9NA 2FPLA 4O3QA 5IIMA 4UBBA 4UB2A 2MAXA 4KN4A 1T05A 2Z1JA 3Q8PB 3AA3A 2IMWP 5CWRA 4FLYA 2YNGA 4KKOA 4OKEA 4TUPA 1JLFA 1ZQYA 4QWCA 1KCFA 3L2RA 3OYNA 7ICGA 4EP4A 4PHEA 4P4MA 1NK8A 5FDLA 3T19A 4E89A 4ELTA 4HUFA 2DFFA 4JK1A 4JWMA 4DQIA 1IM4A 4DQSA 4JV0A 4LH4A 2HHQA 4F3OA 5KFDA 2AGOA 3U6FA 8ICBA 4YXMA 4RW6A 1GOCA 3P5JA 4F5QA 4DS5A 1A76A 4M04A 2IS3A 3I8DA 3ISDA 4DSLA 3AVCA 2ASLA 4AHRA 3G6XA 3SV3A 4B9LA 3LWMA 1S1UA 4IR9A 4DL5A 3Q8MA 4TUQA 3ITHA 1XSNA 4BWJA 1B43A 5DQHA 1CZ9A 3QERA 4O0IA 4O3RA 4E7HA 4KLUA 1FK9A 4M9HA 4I2CA 1NJWA 1TKXA 3KHHA 8ICKA 4BDPA 3ZCMA 3O3HA 1IXRA 1HYZA 3CM5A 4KTWA 3JPNA 1XWLA 1KSPA 4ECXA 5HNKA 1VK0A 3AO5A 4PUOA 1C0UA 4O0JA 4XUSA 4EEYA 3S3MA 2LSNA 3PO5A 4UB5A 4F8RA 1SL2A 5J0PA 9ICUA 4RW8A 3VQ5A 3NCIA 1XU4A 9ICQA 4P4OA 4YR2A 2QK9A 5C25A 5KTQA 4QW9A 9ICRA 4QZFA 1ZBFA 4CK2A 1ZQPA 3TARA 4KLFA 1QE1A 3M8QA 2WTFA 1Z3EB 2DFLA 4R63A 3A2FA 1S6QA 3TABA 4DOBA 1RTIA 3AO3A 1BISA 2OPPA 2JEJA 4B3OA 1N6QA 3RTVA 4CHZA 4PGQA 4NLNA 4YP3A 3IS9A 3ZSYA 1CEZA 1HMVA 4BWMA 3PMLA 3ZDDA 4B08A 4NLZA 2BCSA 4FW1A 4OLAA 4DLGA 2PFPA 9ICVA 4E7KA 4ED2A 3DYAA 3HXMA 3ULDA 2W9CB 2ZJ8A 4CERA 4CJLA 2O4GA 3PO4A 4RPXA 1T4GA 4K4IA 4TURA 3CQ8A 5KFMA 1HNVA 1N5YA 3C2LA 8ICIA 3PY8A 4CK3A 4B9MA 4C8OA 1DTQA 4E19A 4CF2A 4CF1A 2BR0A 1HYSA 2VG6A 3HPHA 4KTQA 4KTZA 2R8GA 4CIFA 1JL2A 1GOBA 1S1VA 2PI4A 4YD2A 3V4IA 3FYHA 5HHHA 1X9MA 5D49A 5DBAA 4GXIA 3PW4A 1DLOA 5KG7A 4FM1A 4KHQA 3RJGA 3HL8A 4R8UA 5KG4A 5KFTA 4UB1A 4FJJA 5EWFA 1JLCA 4RT2A 4G1QA 1V9PA 2G8HA 4O4GA 5J2GA 4B9SA 1KFTA 1VSIA 2F1HA 3RRGA 2P1JA 4ID5A 4I9QA 3ZSXA 1JXEA 7ICEA 3NDKA 3QZ7A 1CXQA 4MEXA 4RQ5A 3C6UA 4KLDA 4DOAA 5DG8A 1FXXA 4ECWA 4CJTA 4DTJA 3T5JA 4W5OA 3NGIA 5I42A 4IFVA 2W8KA 1NOZA 3KK1A 1NK7A 3SQ1A 1JX4A 3K57A 1IKXA 3RMCA 4KLGA 8ICXA 4DTOA 3KK2A 5KRSA 3OS1A 5J2KA 2G8UA 3AVHA 3C95A 4CK1A 2E6LA 3JPSA 2YNFA 9ICCA 2PY5A 4M9GA 3NF6A 3ZT1A 4FCYA 4CJKA 4DQQA 4RQ6A 1RTJA 3GIKA 3HPOA 3NF8A 4FJGA 2I1QA 3DRRA 5J2IA 5KFPA 1ZQOA 2BCUA 3VN5A 3HPGA 2J6UA 3V1OA 5KGWA 4F4XA 2BKEA 5KFEA 2HVIA 4DTRA 3SQ4A 5C5JA 3TR8A 2XC9A 4RQ7A 4NM1A 7ICUA 3LWLA 1U48A 1SKWA 1IKYA 1HUZA 5DGAA 4K8ZA 2XCAA 3WNHA 7ICFA 4RPYA 1CLQA 4FO6A 5DQGA 4F5OA 1JLAA 4J2DA 3IM1A 1BL3A 4CJQA 5CHGA 1ZQTA 1EX4A 1NJYA 3KLHA 3JPTA 2BCVA 2XRIA 4K4HA 1SUQA 3BGRA 5J2DA 5D46A 2RF2A 4JLHA 3MFHA 3MXMA 3ZSOA 3L2UA 4DFKA 4AH9A 4J9LA 1ASUA 4RG8A 1KVCA 3RJFA 2P6RA 1TAUA 4FLWA 1Z25A 1X9WA 1S0MA 1J54A 4FLUA 4E1NA 2C2EA 5FROA 3C94A 3NHGA 3TAMA 2A1SA 2HMIA 1RILA 4KLQA 4NLGA 2W9BA 2XO7A 3KLGA 3KLIA 1SZPA 2BPCA 4I2EA 4CJ4A 3O3FA 4NCGA 3HW8A 1BHLA 4DL7A 7ICSA 1VSFA 3ZT3A 3QZ8A 2LYHA 4F91B 4ECYA 4P4PA 4FBUA 2KZZA 4CE9A 3MDAA 4HUGA 8ICVA 5CZ2A 4J2EA 3HM9A 4PHAA 4KAZA 2I9GA 1XS9D 3K5MA 3NH1A 4CEQA 1TVAA 3RMDA 1WSIA 8ICAA 4I2FA 4QWDA 3AVNA 3M9NB 4BDZA 3QINA 4M9LA 2VWKA 4LZDA 1RBUA 4IFYA 1U4BA 2RN2A 5KFRA 2E4LA 2FLNA 4C8KA 2FBTA 1S0OA 3BQTA 1IG9A 3JYTA 4MFAA 9ICNA 2VG5A 5J2NA 3LAMA 4OGEA 5DK5A 1TK0A 1BPYA 7ICQA 2QKBA 4DSEA 4J9QA 4KLMA 1IKWA 4J9SA 1ZYQA 7ICOA 2JGUA 4DTSA 4XA5A 3HO1A 2HHTA 2DFHA 3LZIA 3OYHA 4QZGA 4F4YA 2VA8A 3G6VA 4GC7A 2R8JA 2KTQA 4CGIA 8ICSA 3RB4A 4XIUA 4TQRA 5D3GA 3JPOA 1ZQSA 4J9OA 4CEDA 4F4WA 4ED6A 3OYJA 1WSJA 4PGXA 1ZQUA 1MSWD 4N5SA 1S6PA 4M45A 8ICFA 1S5JA 4CIEA 4IKFA 1C1CA 3ZSQA 2F8SA 3V7KA 4DTUA 2B6AA 1ZQEA 1ZQMA 3T5KA 8ICMA 5KG5A 7ICLA 1RNHA 4FJIA 2UVRA 4I2QA 4QWAA 4ECVA 1X1PA 1MQ2A 2BPFA 3OSNA 3MEDA 3NTUA 3PUFA 3NBPA 5KFBA 2BDPA 4ECSA 4YD1A 5KFFA 1RCHA 4DSKA 5KG3A 3AA2A 1D9FA 2B4JA 5DGBA 4PHDA 5BPCA 2X74A 5KFUA 1I39A 5DB8A 4FK0A 3NGZA 1ZQHA 7ICIA 4QW8A 1I3AA 3RRHA 4FJMA 1H38A 4E7JA 5C24A 4RNNA 2FMPA 4QZCA 4YXJA 4F2SA 3C6TA 4UBCA 3AVAA 3MR2A 1RPLA 4H4OA 4Z4FA 3MBYA 3ISCA 3T5HA 4P2HA 4GXJA 3C23A 4DFJA 1NK5A 5J2FA 4M9JA 4YMOA 1K1QA 5KFHA 4OKJA 4YFUA 3H8JA 4KHNA 3U3GA 9ICBA 5KFLA 3C2MA 1EP4A 4N76A 1XHXA 5KFZA 5KT6A 2W42A 2AQ4A 1K1SA 3UXPA 2F8TA 3IAYA 2YHBA 9ICXA 2A1JB 4KHYA 4LY7A 3O3GA 4M6WB 4FZYA 3V7LA 2DFEA 2B5JA 1D5AA 5DB6A 4DTPA 3PW2A 4RQ3A 3VA3A 4AHCA 4J9MA 3F73A 3UQ2A 4Z6DA 3MABA 4M3UA 3MECA 1ASVA 1BPDA 1S97A 4G3IA 2NRWA 5KFVA 1ZQCA 4FLTA 2HHWA 2ZUCA 3KK3A 3H8WA 4RUCA 4FLVA 3VQ8A 1Z00B 4OPJA 4M3YA 4J2AA 3DLEA 1U45A 5DDMA 3D0PA 4KLSA 1ZETA 5KFYA 1ZQJA 4Z0UA 4QAGA 4CF8A 4I2JA 4C8NA 4HYKA 3VA0A 5T7BA 4FJLA 4CHYA 2IC3A 3IHQB 9ICAA 5SWMA 3EYZA 4FM0A 5FRNA 3AVBA 4CEEA 4W5QA 2NRZA 1KVBA 3B0XA 1JL1A 1Q9YA 4PWDA 4KV8A 1B92A 4PGYA 2JEGA 1ITGA 3AO2A 2VWJA 4YR3A 1RT1A 4CHQA 3SUPA 2W9MA 3NH0A 3SYZA 4FVMA 3RBEA 3UXOA 4O5KA 7ICPA 1SL0A 4M0AA 3CFPA 3MXIA 2QXFA 5J0TA 1X2IA 4LZGA 1ZQAA 1S1XA 2HW3A 3PW0A 5L1JA 3K75D 1RBTA 4Q8EA 1L3TA 3L3VA 2VA2A 1NK0A 3V6DA 4DQPA 4I2BA 1BCMA 2C28A 9ICSA 4RQ4A 4K4GA 4Q5VA 1U47A 3VQ7A 4B9VA 4IBNA 4BE2A 4YQWA 3TAPA 4RUAA 4O3NA 1HJPA 2E6MA 5DLFA 4ED8A 4QWEA 5DQIA 3JPPA 3NH2A 1ASWA 4O5CA 1SKSA 2FMSA 8ICYA 5CA7A 5IINA 8ICHA 4OKKA 4E1MA 4N41A 1ZJNA 9ICEA 4ZHRA 3S9HA 2JEFA 2BQRA 2XY7A 4QZAA 1TK8A 2R8KA 4NM2A 1WN7A 4O3OA 4LH5A 3KD5E 1CUKA 5DLGA 1JLQA 2FMQA 4KITB 1RBSA 3O4QA 8ICRA 2P5GA 7ICRA 4LSLA 3LDSA 4FK4A 1W0HA 2OYQA 4I2PA 4WE1A 3VQ6A 4YG2A 4N56A 4LSNA 1XI1A 3H40A 1EETA 1S10A 4RQ1A 3SI8A 1BQMA 3Q8KA 4RQ8A 4YN4A 4I7FA 3SZ2A 3RJHA 4RNOA 4EYHB 3LANA 4QZEA 4RT3A 4I2IA 5DKWA 4KI6A 8ICJA 4E0DA 4DFMA 5KFNA 1RXWA 4ED1A 3BQ2A 1S9EA 1W9HA 3GILA 1SKRA 3AU2A 2ZD1A 3DRPA 2YKMA 5HMLA 4J9PA 4FZXC 1ZQXA 3VQDA 4CJEA 4M3RA 3QESA 4XQ8A 3TAGA 4KRFA 1QSSA 1WSGA 3GFKB 2BQ3A 3RMBA 3T5LA 3L2VA 4KHSA 1BPBA 4KB1A 1ZJMA 4FK2A 2FC0A 3QE9Y 2IOCA 4FJKA 3RAXA 3NGDA 3M9OB 3Q8SB 1XC9A 3B6PA 4RW9A 2PFNA 2WONA 1TL3A 7ICJA 4Z4EA 4QCLA 1LAWA 4LD0A 2IBKA 1NK6A 5J2JA 5J2CA 2X6SA 3RWUA 3RR8A 3OJUA 3S3OA 3LP3A 4Z4GA 3C5FA 4JS4A 4CF9A 1XHZA 5EOZA 3NF9A 3LAKA 2UVVA 2X6NA 1A5WA 5L9XA 4IG0A 4FZZA 5J2PA 1KTQA 3VQBA 3K4GA 5KFXA 3V9WA 4ED0A 2NRXA 2XY5A 3BQ1A 1RZTA 1REVA 5J0QA 4MEYA 1C0TA 7ICVA 2Z1IA 1ZQDA 4JS5A 4Q8FA 3SPZA 4CGGA 3ZSRA 1C0MA 1IO2A 4Q44A 3PW7A 4F50A 3OS2A 3MXJA 2H5XA 1YTAA 4J9KA 3GIJA 1MU2A 3KIOA 4I2GA 4AHVA 3V9UA 3RJEA 8ICZA 4CIGA 3KHGA 1XO1A 4PA1A 4KPYA 4DU3A 4O3PA 5KT7A 5HP4A 3RAQA 3VQQA 3QLHA 1R0AA 3QIOA 3BDPA 2ZE2A 1TVRA 2IHNA 3ZT2A 1C6VA 3LPTA 4FM2A 3M9MB 3U3YA 3OYBA 2Q0ZX 3PX4A 1JLEA 4NYNA 3VQPA 1HUOA 9ICPA 2C2DA 3UPQA 8ICLA 4KLLA 1YVUA 2HNDA 5HBMA 1VSJA 1WAJA 5KFJA 4M42A 3UXNA 4DL2A 8ICWA 3OYLA 3N4MB 1VSMA 4IG3A 2OPSA 3HP6A 3LPUA 1Q9XA 2KFZA 4DEZA 3OGUA 4KLHA 2I5JA 5DB7A 5JS2A 4I29A 3L2QA 4R5PA 2JEIA 4CGFA 4CEZA 1KVAA 2F1JA 1RDCA 1ZQVA 4GMJB 4EBEA 4F2RA 1A5VA 3AV9A 3SUOA 3HVTA 3K5OA 5HRPA 3OYDA 2BQUA 3NFAA 3V9XA 3D45A 2NUBA 4HCCA 3HWTA 2JZBA 4FYDA 1RDDA 1JIHA 3GV5B 3E01A 3VQAA 4W5NA 1ZQWA 4NCBA 1HJRA 4E7LA 5CP2A 3OS0A 3QEWA 2HVHA 5CYQA 4BDYA 3V6KA 5IIIA 2IGIA 1ZQFA 4DL6A 1C1AA 4MFCA 4M2YA 4ICLA 3MDCA 1QTMA 4JV1A 4YVZA 8ICNA 3O4NA 4R64A 4O44A 1C7YA 4CJ3A 4OPKA 4DSJA 3DRSA 4CGDA 1UT5A 4KO0A 4B8CA 5BOMA 4FJ9A 4DTNA 4O55A 4F93B 5KFKA 3OY9A 1ZQIA 3V81A 1EXNA 3DLRA 4FS2A 5I3UA 3PX6A 2EHGA 4DU4A 2DY4A 3V72A 2ZJ5A 3M8RA 3RJIA 5TZVA 3E2EA 3QETA 4W5RA 2BHNA 5J1EA 3OYCA 1HQEA 4OLBA 1RXVA 2D0BA 3OYEA 1QSYA 1SL1A 1ZBIA 2KFNA 3CYMA 1EXQA 3RH4A 4FJHA 4HTUA 2KW4A 9ICMA 2J6SA 3I0SA 3QEXA 1U49A 5KFWA 4N47A 5J2QA 5DG7A 2P5OA 1UA0A 2FLLA 1XSLA 1ZQLA 4UAWA 4M47A 1ZQNA 2BCRA 1TL1A 4DSFA 2V9WA 1BQNA 1DTTA 4QZIA 1LWEA 4CEOA 3NAEA 5J0YA 2GUIA 5K14A 4CFDA 4KREA 3FDSA 5KFIA 2GV9A 4NXZA 7ICKA 4F5RA 4RPZA 2YKNA 3BJYA 8ICOA 5KRTA 2ISOA 3DLKA 1LAVA 3DLHA 3GV7B 3SCXA 1LW0A 4FJ5A 4EBDA 3OYAA 3SV4A 9ICTA 1Q8IA 4DL3A 1LV5A 1WSHA 3QIPA 5J0OA 4PHPA 4O5BA 3RMAA 5JUMA 1B9DA 1SV5A 1VRTA 2VANA 4E3SA 3ZT4A 1NK4A 2ITGA 2PI5A 2G8VA 1NJZA 1U9LA 2KZMA 3QEVA 2XY6A 3AVLA 3F9KA 5L1KA 4EBCA 2AGQA 3KKRA 1DGSA 3L8BA 1FKPA 4AHTA 4DOCA 3MGIA 3C1ZA 2VG7A 2PFOA 4UB4A 2KZ3A 3QEPA 5HLFA 3SQ0A 3AO1A 1QHTA 3ZDCA 2R7YA 3ISBA 4C8MA 1TKTA 3PNCA 2Z1GA 1J9AA 3S3NA 2Y1JA 5HRNA 4BE0A 2ASJA 3KHRA 4MQ3A 2YHAA 3OHAA 5DBBA 1TK5A 5F9LA 3DMJA 1HRHA 3H4BA 3M8SA 2IA6A 4CJSA 1RT3A 2YNIA 3EPIA 2P6UA 2W9CA 4KN7A 2KN7A 4DQRA 1BPXA 3MEEA 4IRCA 4O9MA 1ZQKA 4CESA 4Z4HA 3WNFA 4ZTFA 2QKKA 4R65A 4DL4A 4QZ9A 2BPGA 9ICGA 1B9FA 4I2DA 1F21A 4KLIA 1S0NA 1ZQBA 3V1RA 4H4MA 1BI4B 5KFSA 2HNZA 2MUTB 1RT6A 3UIQA 1S1TA 2HB5A 4B9NA 5J2MA 4MF2A 2F1IA 5J0XA 5SZTA 2D0CA 8ICQA 4CFBA 4I2AA 5L1IA 3ALYA 3LDAA 4HVJA 3RBDA 5J0SA 5D4BA 3OHBA 4FBTA 2AGPA 2W9BB 1MQ3A 5J0WA 1MC8A 2R8IA 5IILA 4BXOB 1Z26A 3Q8RB 3GDXA 1UA1A 1WLJA 3ETLA 3DM2A 4CEAA 2BE2A 4KLTA 9ICHA 3SUQA 1RT7A 4MFFA 4PH5A 1T8EA 3ISNC 7ICNA 1C1BA 4AHUA 4DG1A 3OYFA 3JPRA 5HROA 4RZRA 3ZDEA 4ECZA 2RPIA 4F5PA 3ZSVA 3B6OA 2IAJA 1ZQRA 3LP2A 3SPYA 4DF4A 2W8LA 5DMRA 2FPMA 5J2EA 3K2PA 1O1WA 3V9SA 4DF8A 5DB9A 1U04A 2D0AA 2B21A 4JRQA 4CFCA 1RYSA 2HHSA 1LWCA 3QNOA 3PR5B 5IIKA 1BIUA 3V7JA 5KT5A 3NE6A 1B22A 9ICIA 4LVSA 3ZDAA 4W5TA 1N56A 3IRXA 5BOLA 4CGJA 3H7IA 4OVLA 5CYMA 2RDIA 4KI4A 4Z4CA 3MEGA 3WNEA 4KLEA 3TAQA 4PY5A 1RT4A 3TAFA 1TKDA 5J0RA 1CXUA 2G8WA 4DMNA 5DBCA 4UQGA 9ICFA 2PFQA 1ZQQA 5KGXA 1WCLA 2OPQA 3KKSA 3EWAA 3OSPA 3KD1E 2ZUDA 1UWBA 3VQCA 3ZSZA 3V1QA 3RB6A 1EKEA 4L8RB 5KFQA 4JWNA 3I0RA 4AHSA 3QO9A 4IR1A
chains in the Genus database with same CATH superfamily
2OGUA 3N6MA 2HNYA 3CPWM 3BB5A 3CC7N 1RT5A 3KHLA 4LRCA 1SQFA 4M95A 3WXLA 5KG2A 3BQ0A 5HSPA 1FXLA 2AP1A 4NPOA 9ICOA 1XTZA 5AXMA 1X4GA 4CHPA 3CG7A 1D8LA 4LREA 1XK8A 1MW7A 2NRVA 4RU2A 2YB1A 3T6JA 4KHUA 2CPIA 4HUEA 1V3SA 3G6EN 1UMJA 1YT3A 2JH1A 1RBVA 5K8NA 3ZNUA 1QQNA 4JHDA 3ENAA 2IVOA 1AW0A 4DHVA 4DXLA 2E7XA 1N0UA 3VAJA 3I55N 1RYRA 3AVFA 3LP0A 3CMES 3L3CA 1SPBP 4ZJOA 1I94K 4CEBA 1QVFR 2UUAJ 4JKHA 2YHXA 1FERA 1WSEA 2UUBF 2GHVC 1OH5A 3G8QA 1V6HA 5JMNA 1B7YB 3PR4A 5AK5A 2DGOA 2W01A 3C21A 4TQSA 3QEIA 1W2IA 3DXKB 2XI2A 3PV8A 4TN2A 4CJUA 2P51A 3CFOA 3SJHA 3IWLA 1RCXB 2E5IA 3THWA 2O8FA 3DOKA 1ZQGA 1OYDA 3QEAZ 2YNGB 2K89A 1HQUA 2EAMA 2DO0A 3G87A 3UFCX 3DOLA 5IC6B 4M41A 2W6LA 3VR1A 3V9ZA 2XBPA 1Y9OA 5TKWA 3C29A 3V6JA 4A8WA 1IBMJ 3Q7CA 3TR5A 3AJ2A 2G0IA 4G9BA 2ZTDA 4K8XA 4B02A 1RA7A 4ZS6A 4KH4A 1PCAA 1AFIA 4JOUA 2ZQBA 4EP5A 3I96A 4OCZA 2ISPA 2QEXN 4PWDB 1NXIA 4CECA 2V4RA 3CJ8A 1TU0B 2B4UA 3ASMA 5BN9A 4AL5A 5D0RA 1NAQA 4CZMA 4YDUC 2KN4A 4M5DB 1V4TA 3AOCA 3DOMB 3SAFA 2LYBA 3GJTB 2X51A 3K0JA 1VSLA 3T3FA 5CD4H 1W97L 4FFDA 1RWXB 5CB1A 1IKVA 4DPXA 3CMAS 2HQDA 8AT1B 3G8SA 1KEJA 1T95A 4DFPA 3AVIA 3MM5A 4OYOA 1FNXH 1U0HB 3SMPA 1TUWA 1IR2A 4X5VA 4GKKK 2XB2D 1V97A 4OYBA 4NX9A 4FW2A 4OJPA 3A5MC 3SD7A 4NI2B 4P75A 2I5HA 2QARA 3WEEA 4TU8A 3AQOA 2HOEA 3PVXA 4QU6A 1VSKA 4DQ8A 1GLEG 9ICWA 4BE1A 1DJ0A 3QAUA 4RW8B 4ECUA 4MTPA 1N5SA 2BKOA 2OZMA 4BVOA 3I4HX 2H3EB 4I28A 2FPKA 3N5FA 4M6WA 3TFSA 4EMDA 4PPXA 2UVWA 2ZVSA 4BQLA 4KHPJ 1FFSB 3UMGA 4CI6A 5AQJA 5C2CA 2KXHA 5C42A 9ICKA 2JLEA 3R1XA 4IQVA 4B6JA 2QA4S 1WSFA 1BI4A 2YB4A 3ENOA 4CHOA 2KQ2A 3ZZTA 3GBTA 4RBVA 3IKMA 1RBRA 4XEIA 2MLZA 1LXJA 4I64A 1N48A 5HVGA 3UM9A 2HCFA 1YBAA 4QZHA 2HBRB 2GZOA 1OH6A 5B5EU 3GLJA 1GOAA 3KJVA 1QQCA 2ASDA 5CJ7A 5BXIA 1WNSA 4Y2CA 4WE1B 5A2QU 3KFWX 5CY4A 3HX0A 1KRPA 2HZCA 4JYAF 3VEYA 1OQ3A 1L3SA 2ZTCA 4BC9A 3MR6A 1V3ZA 3HSTB 3MPDA 4OYIA 3E9OA 3WT0A 1HNVB 2Q0UA 4F3TA 1DTQB 1RWUA 3SUNA 1PZNA 1S9EB 1YK9A 3RYLA 2ZJPQ 2XVTA 4ZTJA 1BIZA 1NGEA 2E66A 3P38A 4H0PA 1HHQA 1DOQA 4FLXA 3B6BA 1KTVA 3UN5A 3C2PA 2P9IB 1J5OA 4DV5F 4IRKA 1VRUA 4USJC 3ETMA 4DV1J 5CHIA 1W7WA 3EPGA 4PABA 2ALZA 1VQ6S 4QIGA 4C2MA 3R2DJ 3IWXA 1TV6A 1XBWA 2HS0A 1KP6A 1SXEA 3GP9A 1HD0A 2QLWA 1BCOA 3BF3A 4F5NA 4BGDA 1F9EB 1TL3B 1IBLJ 1HYVA 3G96A 2HFNA 2PYLA 1IN0A 4FS1A 3MAHA 3PYFA 2LBOA 4PG8A 1ZBLA 3HKZD 1FA0A 1AROP 5B66U 1C4CA 1YVFA 4IG0B 1UEUA 1TFWA 4Q45A 4YB7A 1MWYA 1IQZA 2F9WA 3NGYA 3ETRA 4CEFA 3LP1A 3P83D 4F4KA 4ISEA 2M9NA 1H2TZ 1JKHA 4ILMA 4YS2A 5M1KA 5KAKA 3N0VA 3G71S 2OD4A 4CJVA 5A8KA 3EXCX 3FKBA 2B9XA 4U7UK 2E5HA 4ECQA 5EUHA 1B0XA 3RH5A 3W9IA 4J37A 5KT3A 4CBXA 3T1AA 3UR0A 2X78A 1FTRA 3UQSA 2HSEB 1RLCL 3IXQA 1R0AB 2Y9UA 2PXIA 1KDHA 2LYVA 1VHIA 1OO0B 1TFRA 5IIOA 3HLUA 1MN9A 3KZIU 3I5AA 3LDQA 3RU0A 1A0PA 5KG6A 4DWIA 4EWTA 4RNMA 3CD6S 3I5CA 3J81U 1K8AO 1XNRF 2AQ0A 4DV3J 3CD5A 2PFDA 2Y9TA 3W2WB 2PBDA 1I5OB 1WAFA 1UKUA 3NL0A 3H8SA 3MMCA 1GAOA 1OSCA 2FSJA 2DNQA 4U67Q 4IJNA 3CC4S 2G8FA 4ZP8A 4C0OC 4WFZA 3OW2M 2OFHX 2ZOGA 1XEZA 5H9EK 4JI8K 4DV6K 3ZYYX 3BEGB 3Q8UA 3LQVA 1XSPA 4PRFA 3THXB 3JSMA 4BR0A 2YX7A 5KFOA 1G3OA 2V8PA 2AU0A 1BGXT 4O5EA 3SCKE 3K1RB 1VQ4N 4DPYA 3BSOA 4IOCL 3THVA 5F9NA 3FK4A 1ZOLA 5AKYA 1MMNA 5I3PA 4B1WB 1ZOTA 2DKZA 5E7OB 4MK8A 3AAQA 4CH1A 1LCUA 2MAXA 2Z1JA 3KJNB 3EXYA 3UKRA 3Q8PB 2P9SA 3AA3A 2IVPA 2YNGA 3MTKA 4ZCLA 4ICLB 4JI6F 4LF6J 3OPXA 1NMDA 2VGMA 3QBWA 2JXJA 7ICGA 4FWPA 2E2NA 1RE1B 2J8SA 2KXNB 3T69A 2Z57B 5FDLA 2NQPA 4E89A 1KBUA 2V94A 5EN1A 1HW9A 2ZH7A 2QLFB 1WTBA 3HCXA 3R3TA 2AV5A 1X9XA 2MTLA 3QU7A 1UCVA 3M1VA 4Y65A 1GOCA 1KWMA 4CE6A 1KQQA 4DSLA 3B78A 1HQEB 1NM1A 3AVCA 1HFEL 2QA2A 2ASLA 4AHRA 2P9CA 2YKAA 2YTUA 3G6XA 5GAGI 4B9LA 1WUAA 2MZTA 2D1KA 2E1FA 4DL5A 1LNQA 2COLA 1YHQN 4BWJA 2YWGA 2HAIA 1A9NB 4KLUA 4IOCQ 4PKIA 3WXJA 3CULA 3KHHA 8ICKA 3G4SS 1YI2S 4R0EA 3O3HA 3L7PA 1HYZA 1N34K 3O1LA 1XWLA 4AM6A 5ALFA 4BG9A 1KSPA 4RNHA 1IJJA 1K9MT 4ECXA 1ESVA 1VK0A 2N82B 1R89A 3D2FA 3FLCO 1V5IB 3LGMA 1C0UA 4Y2AA 3AD7C 1GXTA 4A8FA 2DTJA 3ONQA 2KYXA 3PO5A 2KVCA 4PPDA 5ALMA 1OVQA 1PO6A 3PRBA 4RW8A 3NCIA 3J7YU 4YR2A 3NXZA 4QZFA 4PG6A 4RUHA 2EH9A 2Q1NA 2C1EB 2K7KA 3A8JA 3PACA 4HACA 1VBXA 4R63A 2QKQA 1PK3A 4K41A 2K06A 2KHDA 3FCHA 1FKPB 2BE9B 2UU9J 2HGMA 5IXUA 5BR8J 1WNEA 1S72S 2DNYA 2JEJA 4KMOB 3CJ3A 2BZFA 3F2KA 2I7PA 4FWNA 4Y0FA 3DRYA 2CVEA 2W04A 4U8VA 3O3LA 4ES3A 4DV0J 2KE7A 2M0NA 3PMLA 4KB7A 2FE9A 1RABB 4PCQA 2AJ0A 4K5RA 5D4PA 1RHJB 4DLGA 2W4DA 4C11B 5E3QA 3CWJA 2M8HA 5IV4A 3ULDA 1RU1A 5G5HA 1WKJA 1RLDA 4CJLA 2RH3A 4DR2K 1JNRB 1JJCB 3CQ8A 4JI5K 1VGYA 1HNVA 3PKMA 1N5YA 4B1XB 4B9MA 1DTQA 3W61A 2N4CA 2ZM6F 4V19J 2BR0A 4M94A 2YKOA 4DR6F 4KTZA 2F8HA 3TUJC 4YD2A 5AR0A 2P9IA 3FYHA 4UB8U 5F3XB 5HHHA 1KEKA 1X9MA 2ZKTA 2XULA 2ZIWB 1LKZA 4CZJA 3Q86A 4H54A 1DLOA 4OHVA 4GNIA 1MWKA 1WF1A 2UXBK 1QVGR 2MMYA 2WVEA 2J9EA 2VJ5A 3OQ2A 1SXLA 3ZZUA 2IJRA 1UQVA 4X62K 2UUTA 3CO9A 4QIFA 3T41A 2F1HA 3RRGA 2M7SA 2VHGA 1Q79A 2WB4A 1IV0A 2Y0SD 1JXEA 7ICEA 2ESEA 3NDKA 3I56S 1RT7B 1E6YB 4HHJA 5A0YB 3CIZA 4MEXA 1DT9A 4RQ5A 2VB6A 1YVNA 5DG8A 3ZZ0A 2O67A 4ECWA 4FF2A 4CJTA 3WX4A 1WEYA 1X4CA 1FXDA 2XWXA 3H0LB 3CCZA 3IN5A 3H25A 3VMFB 2Q6CA 1TUUA 5LT5A 2MQNA 5K8MA 3A12A 3KK2A 2R42A 4IO1A 1F1BB 3JPSA 4NWIA 2RHQB 4NA2A 3H0PA 1FJEB 2ZJRL 3W5YA 4FCYA 4DQQA 4RQ6A 5HVHA 3GIKA 1XQSC 3FEYB 3NF8A 1NJIO 4FJGA 4BCAA 4ZOSA 1G7CB 5A6WA 2ZJQL 2OTJN 3T1HF 4MIBA 1NWKA 2J6UA 1U8SA 3MEGB 2MQOA 4MKAA 5KFEA 1R7IA 2BM0A 4DTRA 3H3NO 3TR8A 3S6EA 2FF6A 2H4WB 3LWLA 3PDNA 2QWQA 1WWUA 1IKYA 2OFGX 1HUZA 2OPQB 3W2WA 5EE1A 2GX9A 2GQQA 1IWAA 2OSQA 4D3HA 4FO6A 3OUYA 4AYBF 5B0AA 1JLAA 4HT7A 2FD2A 2MZ1A 2KXFA 2I7NA 2MXYA 2XMJA 1CS4A 1NJYA 3KLHA 3Q22A 4F36A 2CPFA 4N7TA 4JLHA 2NUHA 3ZSOA 5L8RC 3THXA 4B3TK 3UN3A 3W65A 1CJVB 4DFKA 2NLWA 4DCJB 1ASUA 4AH9A 5FP0A 1BD6A 1TL5A 2AD9A 2M0GB 2FJEB 1WC4A 1X9WA 1S9GB 2HIQA 3R97A 3U9DA 5ETRA 4LSLB 2ZJRQ 1BOTO 3NHGA 2ZH6A 3TAMA 4NEZA 2A1SA 5A8WB 4KLQA 2H3IA 2JR5A 2KHOA 2V8DA 2W9BA 3M8WA 2BPCA 4JI7J 3FQLA 1BQMB 3LVWA 4CLYA 5M1NA 5F8IA 3QBXA 4I7FB 4DL7A 3A13A 4ECYA 3GR0A 2GVZA 5L9NA 4J2EA 1NGHA 4CRXA 3AD8C 3HM9A 5DZ6A 1WHWA 2ZD1B 4PHAA 4TVAB 5F8JA 2F8KA 1AB8A 3FFKB 4JMUA 3DI6B 3RMDA 5TISU 4OZLA 4PXEA 1MN8A 3R5CA 3MC1A 3H5XA 2NRRA 4LZDA 1HNZJ 5LJWA 2DJWA 3IRWP 2HYIB 3ET6B 9ICNA 2VG5A 3LAMA 2AXTU 3DU6A 4J7CA 4PXBA 1TK0A 3ZTQA 1SV4A 5J8YC 4H4KC 7ICQA 3M6WA 4ISFA 1J5EJ 4J9SA 1ZYQA 2JGUA 1U6FA 3NMRA 4DUYK 1YG0A 3WKDA 4GC7A 3VEWA 2XHCA 1DK3A 5ALKA 4WP8A 8ICSA 4C3LA 4TQRA 5J2PB 2DGWA 2HKEA 3S7RA 4ED6A 3DXSX 1ZQUA 4M45A 8ICFA 4IKFA 2KG5A 1N33K 5ALWA 1R8CA 2ZZTA 4O3MA 1YJ9N 7ICLA 1RNHA 1UTAA 4MKBA 3W1YC 1VFJA 2UVRA 3JXUA 1TL7A 4URSA 4LUBA 3V4MA 1VQ9N 1MQ2A 3VZIA 2V34A 3J8AA 2KM8C 4GKJJ 3ENVA 1FEHA 3HRGA 3CCUS 4LFCJ 2BDPA 3CJQA 5KFFA 1RCHA 2EAOA 5KG3A 2B4JA 1Q7LB 5DGBA 2ZH5A 4PHDA 1ROFA 3GYXB 4TKTA 1U1LA 5KFUA 1I39A 1OY9A 1I3AA 2HGLA 4E7JA 1BUXA 4YXJA 3NNCA 3MR2A 2DF4B 2V69A 3JTPA 1RPLA 4H4OA 5HBMB 4W90B 3ISCA 3D7EO 2HK2A 5CABA 1T3OA 4FPRA 1P27B 3HZEA 3X1LB 3CC7S 3NCQA 3LH2S 3H8JA 1UHUA 2VQEK 1EKRA 3NVZA 4C11A 4JV5K 5KFZA 3AA8A 1S8OA 1K9MO 2E5GA 1NDPA 1VC0A 3V7LA 2ASPA 1N2XA 5DB6A 4AHCA 2W24A 5ETVA 3UQ2A 4Z6DA 3G6ES 3QNWB 3H46O 1RHKB 2NSCA 2L9NA 5EX5A 1QM9A 2NXJA 2DNRA 2X1GA 2NRWA 5CAAA 2QMWA 4O8UA 5GIPA 4FLTA 4YMEA 2UXCK 3H2VE 2YH1A 4FLVA 2WW4A 4J2AA 3DLEA 1KQSR 1EWRA 3FEZA 5DDRC 4CW7B 3I55S 3D0PA 2W2QP 3WKEA 5BR9A 3JSYA 3AAWB 1XR6A 2DGSA 4KLSA 1U6ZA 2CIMA 4YB1P 2R2TA 5AQFA 2G09A 3KDOA 3IM9A 1U1KA 2VBXA 3QB0A 3OTCA 3IG8A 4CF8A 1VLYA 4C8NA 4ZPCA 1HR0K 3W66A 5T7BA 1A6SA 4CHYA 1U1PA 2RE1A 4RTFD 4X4OA 4FM0A 2PMWA 3OL7A 1Q3VA 3GG0A 2UUCF 4W5QA 3NGKA 2H51B 3D0IE 4LFBJ 1ZTWA 4TY8B 2JEGA 2RSQA 1OS5A 1N5QA 4HDHA 1JLGB 3LF0A 1H2VZ 5AQLA 4PWUA 5AQYA 4K4WA 1VS3A 3O5TB 2PD1A 1O13A 3MXIA 3KZBA 2QXFA 3BN7A 4DCPB 4FVUA 1OUQA 1X66A 1ZQAA 4P9SA 4XPEA 1SQKA 3PW0A 3N7PD 3DXMA 1VQYA 3ZC4A 2IOFK 4XH1A 1LWEB 4XAKA 3O9SA 4I2BA 2ZZNA 5IWAK 2OMOA 4K4GA 3PHEA 1F9HA 4MYUA 2O3DA 1KLMB 3TA2A 1QVFM 3JSBA 3HJVA 3J7AP 1NDKA 2JL9A 3N01A 2F63A 4PYDA 3QMLA 4IZ9A 1HJPA 4ZPVR 2V8VA 3KLEB 2XM3A 2V6AA 2VKZG 3JPPA 1SKSA 4C7ZA 2FMSA 2QLBB 4FN5A 2R7VA 8ICHA 5ALJA 2WCXA 4E1MA 3MDFA 1FI4A 4H0VB 4ZHRA 1S22A 4RW4B 2DGUA 2Z7JA 2FYXA 2QWRA 4WJBA 4AL6A 4ILRA 1TK8A 3D2EA 5E5NA 3PYEA 5A0LA 5LMUK 4ZMMA 3IR7B 3SQOP 1TKTB 4RBTA 2FZCB 1Y7PA 2BOAA 3OL9A 2XNQA 3O4QA 5AQXA 1URJA 4LSLA 2XNRA 2VGNA 1AXQA 1W0HA 2RS8A 3SBTA 5A8WA 4LSNA 5AI4A 4RNFA 4UY85 1XI1A 1DFDA 5ETNA 4ZPBA 4CTAB 1EETA 1S10A 1BQMA 2PIIA 3MM8B 2Y3YA 3HFKA 4I7FA 1Q18A 3RJHA 4RNOA 2MQMA 5CQGA 2ROEA 1WOPA 3UDEA 4I2IA 5DKWA 8ICJA 3OXLA 3BQ2A 1W9HA 3GILA 5DM6Q 1RWPB 2ZD1A 1X4FA 5HMLA 1Q3UA 1KQFB 2HNZB 5GAEI 5T7LA 4DR4F 4FZXC 4AYBC 1ZQXA 2IIRA 3AA9A 3QESA 2G0JA 3HILA 3ZNJ1 3TAGA 4UOFA 4JEPA 3GFKB 2BQ3A 1RAHB 3T5LA 3L2VA 4PKHA 1T44A 4NXNF 4KHSA 4XO0A 2VV5A 4LVOP 4NLDA 2WZ1A 4AQYK 5AK6A 3M9OB 2W2OP 4F4AA 2PFNA 1TTHB 1WWVA 1LAWA 1U26A 4K50A 4CVNE 3OJUA 3LP3A 1KONA 4JS4A 5EOZA 3PHTA 5F8HA 2X6NA 4DR5K 1JLFB 2A1BA 4FZZA 1RDUA 5J2PA 3VQBA 1UZHA 2DRDA 2DR8A 4I6YA 4ED0A 2ABYA 2NRXA 3GE9A 1C0TA 2VIXA 3TEGA 3Q8VA 3RW7A 4JS5A 1PAEX 1Q86T 3SPZA 5AK4A 3SIPB 3VALA 2FB0A 3CD0A 4WBFA 3PW7A 4F50A 1ZAWA 1YTAA 5GAHU 4J9KA 2WAQD 1B99A 4BLGA 5IT0A 3GIJA 2MLXA 3VTHA 5AIBA 8ICZA 4EX6A 4YEAA 3ITHB 2VFUA 4YB5A 4S0MA 1UJ5A 2I1RA 2NSBA 3CO0P 3KHGA 1RI7A 3O80A 5L38A 4KPYA 5HP4A 3RAQA 1FK9B 1RACB 2ZE2A 2A3JA 3D2SA 1OVYA 1DURA 1C6VA 3U3YA 3M9MB 3OYBA 4JI8J 4MT1A 4ILLA 2UYTA 4DV2F 3FR0A 2CNOB 4DV6J 2C2DA 1IBCB 2EFVA 1S5LU 5C15A 4LRBA 3POTA 4X66F 3MDQA 3EL2A 5MAOA 5HBMA 2VH7A 2E8OA 3ULHA 2QWOA 3U4LA 5KFJA 1FT8A 4F0KA 2I2YA 4M42A 3CPEA 2LDYA 8ICWA 1UWBB 3KNGA 2KT5A 2H3QA 3N4MB 1EWQA 2HRUA 3N6LA 4HWIA 3LPUA 1KVKA 2KFZA 2LKYA 4DEZA 2ZBCA 3EX7B 1XNRJ 3SBGA 1XMOK 3AODA 2LECA 2EZXA 3NCRA 4CEZA 4ZPDA 5AT1B 3U02A 3QYYA 5D0EA 1S4EA 4GMJB 4F2RA 3KLFB 4JI1K 3K5OA 4G9ZA 1ULRA 3LPYA 1QUVA 3OA9A 3V9XA 3KOAA 1YBTA 1NHVA 4KIAA 4P2XA 2BJ8A 5M1QA 4F25A 2LVWA 2OPPB 1N52B 1GH8A 2D3OR 3M1FA 4NL5A 4W5NA 4B3OB 1CRXA 4U7UD 4Y2QA 1S6UA 1CJKB 4JKGA 3OS0A 3IS9B 3K5PA 3PJ9A 5F0UA 5G5GA 3ZZRA 1C1AA 2DUYA 4MFCA 2IOHA 1ZM4A 3D9BA 2VQFK 4R64A 1MROB 4P2SA 5ETPA 3OY9A 4LFAK 1OJ4A 2MLYA 3L0QA 1EXNA 2CG4A 2R7SA 4LF9K 5EX3A 4WXWA 3HHLB 4Y2YA 4W98A 7FDRA 1SGGA 4NLQA 4LRDA 3TZXA 2LM1A 5ALIA 1ITPA 3EGNA 1QQOA 4X4QA 2Z0GA 4LRAA 3FC4A 3TWZA 1HQ2A 4PG5A 3D1QA 2EFGA 4OLBA 4MO5A 1SL1A 3M4XA 4CZIA 3CYMA 4IDHA 1KQGB 3M2VA 2WSCC 1FXRA 2KW4A 3R6MA 3SCJE 3TEHB 3TKAA 3GL1A 3DEEA 5LXYA 4MK9A 5J2QA 4UB6U 4B17A 3K1ZA 4YORA 4V19S 3HRDD 1ZQNA 2BCRA 4N77A 1DTTA 1PK1B 4DR1K 1LWEA 4CEOA 4KREA 5K14A 3TVYA 4B1YB 2CPEA 1TE2A 4F5RA 2CXYA 2ADCA 4BUGA 1H72C 4OHWA 5T41A 3GZFA 1LW0A 4EBDA 1RAJA 2DNMA 3OLAA 3C6UB 3H2UB 3SV4A 2I8EA 1Q8IA 4DL3A 4PHPA 2CQIA 5JUMA 1G6BA 2D1CA 2F8EX 4LR8A 4E3SA 1NK4A 4URQU 3NEKA 1NJZA 2IIHA 2KZMA 3QEVA 2Q1LA 3OFFA 3F5TA 1UAWA 3CQYA 4NLWA 2AGQA 3KKRA 3L8BA 2Y8YA 4RW7B 2YNFB 3ZZYA 2X1BA 1D8ZA 3C1ZA 2VG7A 4RUBA 4LF4K 1Q7YT 1QHTA 1VR6A 2R7YA 2DGZA 4K4UA 1SIWB 2KNJA 4JI5J 4C8MA 1TKTA 1FTCA 2ES6A 4WZMA 1HNWK 3A0BU 2Y1JA 3T1YK 4DZ6A 4ZVHA 2FXUA 3KHRA 4MQ3A 4A57A 3OHAA 5F9LA 1EKSA 5BRHA 3H4BA 3M8SA 1TYQB 2AWZA 3RZAA 1PVRA 3QQCD 2IA6A 4CO5A 2YNIA 3NGUA 1YTYA 3NMAA 4KN7A 1BY9A 2KHCA 3O4WA 4DQRA 5BYRA 4IH5A 4O9MA 1ZQKA 4Z4HA 1X60A 1PC4A 1M5HA 3CCEN 2BPGA 1F21A 3QJPA 1HBUA 3HI0A 3D1OA 1CVJA 1SB6A 3WK8A 4GVBB 4YDXA 3ZZZA 2HNZA 2KI2A 2CQGA 1F2GA 1UPMB 3M2RA 4FZMA 4M7XA 1RAOA 1GXLA 1PILA 2CDQA 4ZN1A 4DR6J 2F1IA 4LF7K 3NGSA 2F44A 3LDPA 4OPHA 2E1CA 2GFFA 4ANDA 2NZCA 3LDAA 2FC8A 5F0XA 2RKIB 3CVKA 2V4JA 1ELOA 3RBDA 5J0SA 2KJWA 3OHBA 2AGPA 1X5PA 3D5MA 1NGDA 3IBCB 5DS7A 4QQBA 1N34F 3D7SB 5AM3A 2RRAA 3CC2N 5F2RA 1S6OA 3VF2A 1RWVB 4NCGB 2HK3A 2GIRA 4FDFA 1WLJA 4Y2KA 4NYPA 5AKIA 4DV7F 2DCUB 2DYAA 4IOBA 4IH6A 4PH5A 5B0DA 3IFRA 2FSNA 2OEMA 1M90O 4DG1A 3OYFA 2UV8G 3JPRA 3A3PB 3QSYB 3OTDA 3QPIA 3C66A 4DFDA 1X4EA 4F5PA 2J9CA 3L7UA 3B6OA 1ZQRA 3JAMU 2BMBA 2H5JB 4B1UB 2FPMA 1FD8A 1N5XA 3O1WA 1B0PA 3OL6A 2P9KB 3MPWA 2B21A 3P31A 4JRQA 4GVEA 2BANB 1LWCA 3MM7B 3Q0AA 1IKWB 3A8YA 1Q53A 5AE1A 3IFEA 5B0CA 2JLFA 1BIUA 4PL7A 3FNNA 3VGVA 2QYGA 3QRRA 3NG8A 1B22A 3NE6A 2J5AA 3ZDAA 4B1VA 1LEOA 1N56A 3IG1B 1K8KB 4CGJA 5E26A 1F2HA 3M6KA 4Z4CA 3Q83A 4CLLA 5AM4A 3WX8A 3TAQA 1CI4A 3GG1A 3ZO7A 4X84A 2DT9A 5H9FJ 1FCAA 2IOFA 2PFQA 1RJJA 3KKSA 3EWAA 3T1HJ 1NNDA 2ZUDA 1UWBA 3IR6B 1MMDA 3ID6A 2IRUA 2UZAA 3ZETB 3A8IA 5MLCV 4JI3K 1HHTP 4AHSA 1GLFO 4LQ9A 1BVSA 1ZRNA 5J29A 1L3UA 4B3RF 2KLAA 1Q78A 3MI7X 3H5YA 4DUZK 3MMBB 4E7IA 4A8EA 2RDJA 3KLFA 1S9FA 4PZOA 2OTJS 1CULB 1QVGM 3CM6A 1Q86O 3TWHA 3A3OB 5JS1A 3UMBA 1U2CA 4F92B 4PHTX 4IEEA 5AQVA 3LDOA 1C20A 5BRDA 5GVQA 2KKHA 4ZJQA 4OGCA 3KHYA 3BKUA 2VKRA 1VQ5N 3MN7A 2A6OA 4EFHA 4FNIA 4LMZA 1PYSB 1XNQF 4X64K 2B4PA 4JI4F 4EZ6A 4NEYA 1NG9A 3FMWA 2MZRA 3OJSA 1NM2A 4CJRA 2WOMB 3RH6A 4C98A 3HSZA 1LW2A 3RG6A 2XCPA 4FKYA 1X4HA 4I67A 2GGPA 4HI1A 5G0RA 1NGBA 4J90A 1RK8A 2I6WA 4WCEQ 2OA8A 4NA1A 3R9LA 3MAQA 5A2QY 4DB3A 4RQ0A 2B5JB 4KB0A 4LF5K 2K8CB 4KAIA 4ZVUB 2AEMA 4MHVA 4B8AB 4HAIA 2MQ8A 1GTHA 3CCJN 1B4SA 5GINA 4DU1A 3TSQA 4M3XA 5JVHL 1N33J 3A8KA 3EM1A 2QSWA 3H08A 4R66A 1Y88A 5KFCA 3RB3A 4W4MA 1T05B 3CHWA 3SJJA 4ACOA 4C0BA 2MQLA 3SCLE 2FPHX 4KKOB 4EZ9A 3QFHA 4AFFA 2ZUBA 4M5GA 4QBUA 1EIYB 3NNAA 4X4VA 2OPRA 1NGJA 2I0XA 3SNNA 3J7Z5 2CGLA 1T11A 4CJFA 2C3UA 4MIAA 3FVYA 2K4IA 3VQSA 4ZLJA 1KFDA 3H98A 5KT4A 2VA3A 3ZDBA 1G15A 4H8KA 1WG5A 5JXSA 1BWEA 4DJBA 3AVJA 1NKBA 1S0VA 3N7RC 4KV8B 1SJFA 3VQ9A 2N7YA 1LXNA 3CCRN 3WK7A 3RB0A 4QZ8A 3AARA 1S1UB 1RT1B 2QWNA 8ICTA 1FKOA 2WB1F 1BA1A 1RDBA 3BZQA 2JGAA 1QLNA 4WFXA 2HHVA 4Y2IA 4CHNA 2WF6A 3EE9A 2ZOMA 3K58A 1FX2A 3CJ2A 1ZBUA 2RU9A 4RW7A 4ES2A 1YJ9S 3OTOF 2KO1A 1S99A 1M1KT 3H45C 1S7IA 1X40A 4L75A 4FYXB 3VPZA 1COKA 2M2BA 1NK9A 5J2BA 1RM6C 1VQ9S 4PR6A 9ICJA 2HLTA 4CJ5A 3TAEA 1ICEB 4LF2A 3M3ZA 2DXEA 5ETLA 3O9UA 4A61A 4U7CA 4Q43A 4DX5A 4C9DA 2M52A 1O8BA 2RJZA 2JH7A 4PL1A 3AXMA 1TP7A 3K17A 3S41A 3THYA 2PT0A 2MKSA 2HHHF 1MWQA 1CQNA 4ANCA 2A1JA 3VERA 5EU7A 5ALGA 3OTBA 1ZM2A 3VQEA 3AQEA 3T9NA 2QLXA 9ICLA 1YX2A 3LOUA 5ADZA 4YHHF 1YAGA 2WBNA 3MR5A 1H3DA 2RQ4A 4P6QA 1X5SA 3ZT0A 3TANA 1ATNA 5KOWA 4A2BA 1E4GT 2FY1A 2FDRA 1HI0P 4YMMA 3LO3A 4Z6CA 4BRCA 4FJ8A 1Z00A 2GTDA 1F0XA 1TAQA 2LKZA 3DCAA 4UZCA 1DGKN 2UXDK 3PSIA 1PIEA 2FQQB 1RHMB 2CQBA 3OYIA 1Y4ZB 4CZLA 4AXIA 3UDVA 4PYAA 5E41A 1FEZA 5IOLA 4NZ6A 2RKIA 4I2PB 4B3SK 3GIIA 3ENQA 4JRPA 5E3AA 4PZNA 5E0OA 4CO1A 3L2WA 8ICEA 4OI3A 1NCLA 2NV3A 2K60A 1M1GA 2VICA 4C0HA 3AA5X 4BQZA 2HFOA 4GVMA 3BEXA 1KHWA 2DNZA 3CJ7A 3L4IA 2L9DA 1QJHA 2YWFA 3VEZA 8ICUA 3EY1A 1RWNB 3DRPB 3G6YA 2YKMB 1V9OA 8ICGA 4Z4IA 4BRMA 5IWAJ 2UUCJ 1T9YA 1FWPA 3W8GA 2AYBA 3GV8B 3GJRB 3HOSA 3TZZA 2PE8A 2AX1A 1YJVA 3WUHA 2KB2A 1YRUA 2FUG9 2F96A 1PBAA 2FVSA 2Q31A 2YWEA 3M8PA 4R8UB 1Y3KA 4JKAA 3FGUA 2WONB 3HJFA 2BANA 3HVRA 2N3LA 5L1LA 3TO8A 2UUAK 4BACA 3GCXP 1M5PC 3WXIA 4YCXA 2D0OA 4DN0A 4MIWA 4DO9A 4C6AA 3W2VB 3IG1A 3L3UA 2MKCA 2LFVA 3P49B 3EW9A 3H4DA 4J5OA 4WYBA 2OEHA 3OYGA 2AJ2A 3VAFA 4DTMA 3MGHA 3AAPA 7ICMA 1YJWN 3OTQA 5L39A 3D0HE 4DV4K 3ORYA 4JV5F 1NZPA 3KK1B 3ZETA 2BGWA 1R27B 1KQSM 1JMSA 5ALUA 5AI9A 3W8PA 1MU2B 3KBBA 2GBZA 3A5NC 2VFTA 1IBMK 2OP5A 3O6WA 3PEHA 3R5JB 2WRMA 3H6EA 4YMNA 1CULA 1FFWB 3O2IA 2PN6A 2P9NB 1WG8A 2V50A 4WIQA 1S1WA 3ALRA 3TADC 1NJXA 4ED5A 1CC8A 2IDOA 3NVVA 1HNIA 5AM5A 4OIXA 1X8DA 5LJVA 2MA1A 4KPCA 1B7FA 3UDLA 2R7XA 3U8XA 3SQGB 2CKWA 2G8IA 4Z6EA 2A41A 1BNPA 3M7VA 3AFGA 4OYMA 2OPSB 4ECRA 1A77A 2WOMA 5HL7Q 2E88A 4GXKA 1B0TA 1Z2LA 3RBZA 4M5IA 2D3ZA 3L5KA 4CD3A 3P1GA 2EKNA 3MCAB 1U0SA 3HHDA 3OTEA 4NCAA 2LP4A 3QGIA 1NGGA 3HVTB 3EGWB 3KTQA 2JX2A 4A4JA 3F0NA 1H74A 4QZBA 4UAUA 2HMPA 1FJ7A 3RR7A 3CDWA 1T9WA 3GJQB 4IQMA 1NKEA 2IJNA 3UQ0A 4FOEA 1S76D 4DR4J 3NWRA 1UOCA 5HMMA 3BR8A 3FBFA 1D9DA 4K8RA 3E01B 4O3QA 1Z1BA 2RDDA 5AQSA 1UWAA 3CTRA 4C4WA 3CCWA 3HF5A 4UB2A 3UI3A 4V1Ak 4KN4A 5THWA 4EO6A 1T05A 3O8WA 5L46A 4F0HA 3CP8A 1RDWX 3NVYA 4KKOA 1PYOB 2B0CA 1FX4A 4QWCA 3L2RA 2QM1A 3IR5B 3MCMA 1GQEA 5AJ3F 2WHOA 3V81B 1M5SA 3BGLA 2DFFA 5JLHA 2XI3A 4DQIA 2ZIVA 2G1DA 2HQCA 1IM4A 2CJBA 3DRXA 1RQLA 1V85A 1QAIA 4YDDB 2AGOA 1KN6A 3IO1A 4FZLA 3P5JA 2RVJA 4DS5A 1A76A 2IS3A 3I5BA 2N7CA 1WORA 3SV3A 3LWMA 1IUJA 1S1UA 2AA4A 4A8KA 5M2RA 3Q8MA 2H3GX 3WKCA 1CJTB 5BPLA 1B43A 2DISA 3I0SB 1CZ9A 4E7HA 3AEVA 5M2UA 2PMHA 4M9HA 1TKXA 2DGVA 1PAUB 3O9RA 2V68A 4NLOA 3BO4A 3CCLN 2AJFE 5HNKA 1C1CB 3ED5A 4OL8A 3I8BA 2ZH3A 4PUOA 3IM8A 1N60A 4C23A 3QATA 2X1FA 2QE5A 4QIEA 1VBYA 4GRSA 4EEYA 4QJFB 5B0GA 2VF3A 5FD1A 2LSNA 1Q16B 5SUHA 4X66J 1MG7A 4F8RA 2PFUA 4WP9A 1SL2A 3MM9A 4CF3A 2J0SD 3GPAA 2RLTA 2QTWA 3HI9A 1IBLK 4R25A 4P4OA 4QW9A 9ICRA 3L4QA 2X3GA 2OUGA 1EAYC 3VZHA 3TARA 4KLFA 2ZIUA 4CI0B 5D0HA 2WB1C 3A2FA 3ENWA 2CXEA 5F3ZA 3TABA 5FPNA 4Y2XA 2J7UA 2CADA 1KS2A 1X0FA 3AQPA 1M5VC 3GCWP 3H2LA 4DOBA 3C16A 2A42A 3AO3A 3W9HA 3QUTA 3C6TB 2DR5A 3RTVA 4PGQA 5HLFB 5AQNA 4YP3A 3KUGA 2DRBA 1CEZA 4CDGA 4DX8H 3MHYA 3ZDDA 2CQ1A 3D66A 1FRIA 5KQDA 3G82B 4KGKA 1WD6A 2PFPA 4P0QB 5ETQA 2CGKA 5HAOA 3SFGA 2W9CB 1KHVA 4HI2A 2WHEA 2ZJ8A 5H1SV 3ZTSA 4CERA 3MEEB 3BBFA 3VAIA 3HFZB 3E9PA 1T4GA 5KFMA 4BR9A 3MECB 4BGAA 2DBBA 4E19A 1OY8A 2WVDA 1T9TA 1Q8LA 4CF1A 1HYSA 2VG6A 3HPHA 3O8MA 2PI4A 3IDHA 3TJ8A 4TYAA 1I1GA 4DV3K 5AIAA 2BVZA 3P39A 2V51B 5U47A 1G4CA 2EW9A 2ZDPA 1FRXA 2DH7A 2E1RA 4OZ1A 2V67A 3TU5A 5F8NA 1RWWB 2CZ4A 3HL8A 4R8UA 1RKIA 1SJQA 5F41A 3OVAA 1U02A 4H03B 1HIWA 2KJ8A 4ZN3A 3SR6A 2EDUA 1O5JA 2D69A 3BDEA 4KGXB 4TLRA 3KWIA 4TNOA 2EFOA 1GFWB 1Z4UA 2BE2B 2IVYA 3BUZB 3ZSXA 4X4PA 3QZ7A 3VTIA 4LSZB 1CXQA 3O08A 3H90A 2MJNA 2RUGA 1C1BB 3NAHA 5HROB 1JALA 4LF4J 3T5JA 2O8CB 5I42A 4IFVA 3KK1A 3K89A 2RMLA 1HHSA 1DBDA 3CJ9A 1CJUB 1JX4A 1IKXA 1RU2A 1R3NA 4DTOA 2YHYA 1HKAA 4JN4A 5KRSA 1S1XB 3OS1A 2G8UA 3MZIA 4CK1A 3ZEUB 2E1AA 3J7YI 2PY5A 4M9GA 3R5GA 1R0BG 4NA3A 3N4QA 3NF6A 2R7QA 2QV6A 2GVDB 2P9PB 3UCZP 3FZFA 2Z2MA 2FZGB 3HPOA 1IBKF 2F4VK 5KQ8A 1LK7A 3IRXB 2KU7A 5J2IA 1VBKA 1R6VA 2BCUA 5IM0A 4L74A 3EZOA 4F4XA 2AT1B 3AQFA 2BKEA 2IM1A 2HVIA 5C5JA 2K7JA 2E8MA 4RQ7A 4NM1A 3SQGA 3MUVP 4I69A 5A6PA 3C65A 3VENA 4BRDA 2CNNB 1RHQB 3ZTOA 2XCAA 4RPYA 1DKGD 3ONNA 1WF0A 1QAXA 1RGIA 2QWLA 3RAMA 3MMVA 2WBMA 4CJQA 2HNYB 2E2QA 2B43A 1V4SA 2QWPA 2YMQA 3JPTA 4PG4A 2CQHA 4K4HA 4DU7A 3BGRA 1FDNA 5D46A 3MXMA 3L2UA 2KM8B 3CI5A 4RG8A 2JLGA 4PJ0U 3RJFA 2P6RA 3R3LA 1TAUA 2F7TA 4FLWA 1Z25A 1DK2A 2EBGA 2C2EA 3MOJB 1SZ2A 2WVCA 3C94A 4BG8A 4BRFA 5AXNA 1PJ5A 4FVCA 1H73A 1KL9A 2M5YA 2PKEA 2QGFB 3CCES 1XC3A 4JHDB 1NGAA 2XO7A 2VJ4A 2KRBA 3LW5C 4I2EA 2G13A 5CA5A 1N36F 4CJ4A 1WJ9A 3E51A 4OZ0A 2W4PA 1D0EA 3HW8A 1BHLA 7ICSA 3ZT3A 3QZ8A 5DZ7A 4M1KA 2LYHA 2HBLA 4XDDA 2HWTA 3LP0B 2FC9A 3X3UA 4USHA 5F3TA 2MKIA 2UU9K 4MKYA 5BR8K 4HH1A 4KGVB 3K5MA 3NH1A 4CEQA 2IHR1 1Z05A 4YN3B 4HVZA 1Q46A 1WSIA 1YLXA 2CJYB 4DV7J 4I2FA 4G65A 4BDZA 4X4NA 3W9JA 5AKZA 4Y34A 4DV0K 2BW2A 4IFYA 2HBZB 1HI8A 4C8KA 4TY9A 4RL1A 1S79A 1IG9A 3CC2S 2LMRA 5J2NA 3P45B 1KD1O 5DK5A 2Z56B 1GLDG 2QX0A 1BPYA 4OI4A 2QKBA 4K25A 4DSEA 2YVSA 4J9QA 2NXEA 1X4DA 2O8FB 1CJTA 2Z4PA 3DOKB 1VLOA 2E2PA 4UOCA 2G5HB 2HHTA 5ALSA 2DFHA 1DRGA 1XNSA 2QJ3A 4F4YA 3G6VA 2R8JA 2IFXA 4JI3J 3DOLB 3Q8YA 3MEKA 2ZH9A 1EQYA 4L3QA 4QYZJ 4J9OA 3UR3C 4F4WA 2LQ9A 3T1YF 3UWTA 4PGXA 1Q82O 1S5JA 1C1CA 2ASOA 2F8SA 4P0PB 3CF5Q 4DTUA 1ZQMA 5AKJA 4JI0F 8ICMA 1ZQ1C 3GTYX 3FCWA 5ALXA 2BM1A 1EX8A 5D4LA 2YJFA 4ETXA 5M1PA 1LKYA 2HVEA 1SH0A 4JAXA 1BO5O 4BR5A 3PUFA 3NBPA 2GO7A 2KVSA 4YD1A 4WQ4A 4OJGA 4NRUA 1IKVB 1NUEA 1XMQF 3QLHB 4QIWF 4DN9A 2YMMA 2DPNA 1BWVA 4PWWA 2EZZA 2HFUA 3MM5B 4LF1A 5DB8A 1ZQHA 4DL0C 4K0KF 1N63A 2WF5A 5C24A 4RNNA 5FPMA 3C6TA 3M7DA 4Y2JA 1BHNA 2W7PA 3FSIA 3MAAA 3ENBA 4GY2B 4Z4FA 1V38A 4ENOA 2QARB 4GXJA 3C23A 4CJ7A 4M9JA 4YMOA 2LPEA 4IG3B 5KFHA 2JV3A 4IOAL 2NXCA 3AOAA 1BC6A 9ICBA 4CT9A 5KFLA 3HHLC 1WBBA 1EP4A 4MAKA 2AYMA 5KT6A 2AQ4A 1K1SA 3UXPA 3L4BC 2YHBA 1VQLN 2XS5A 1J2MA 3PCOB 3R2CJ 3O3GA 2ZUGA 3E3XA 4M6WB 1NMNA 5IT4A 1VQ5S 1D5AA 4DTPA 2CPZA 1HBOA 4C4RA 3MECA 2F8LA 2IDEA 5AI5A 1S97A 5C42B 5KFVA 5GTHU 4FF4A 4A5BA 3DNCA 4EO8A 1L7NA 2ZUCA 3H8WA 3VQ8A 5JLFA 3C14A 3EN9A 1SC4B 1JRPA 3QUBA 2BTFA 2W43A 1ZAVA 5KFYA 4WFBQ 3PM9A 4Z0UA 4TU9A 3LL3A 3KJVB 3WXMB 3W62A 4QAGA 3GYGA 1ATSA 4QU7A 4I2JA 4KO0B 1VJWA 4HYKA 4F04B 1NDCA 2IC3A 3PIOL 9ICAA 2GMLA 3I6PA 3N79A 5FRNA 3CCJS 4HL9A 3AVBA 3QSIA 2J4RA 2HQGA 3D6JA 1YJRA 4WFNL 3BGFA 4ZPWR 4K2JA 2MEWA 3NS5A 1JL1A 1Q9YA 1RBLA 3BGOP 3PSTA 3KUHA 2XI9A 3AO2A 4D3GA 3GFHA 4YR3A 2E5LF 4XDCA 2W9MA 1VRUB 3RBEA 4JI7K 1SL0A 4PXCA 2L08A 5F8LA 5K20B 2V7ZA 4A46A 2ZGZA 1TV6B 3C7NB 5H2FU 1X2IA 4GMKA 1PG5B 4A8OA 4FSVA 1F5SA 1S1XA 3ICXA 1V3RA 2KL8A 3ZEUA 1PKUA 3B4MA 2XMWA 1TL1B 1K8AT 2ILZA 2YX1A 4Y2VA 2JC1A 2VA2A 3QT8A 1NK0A 1YWXA 1BA0A 1TFYA 9ICSA 3IBFB 1JROA 3CCRS 4N8OA 4B9VA 4IBNA 1QQ6A 3W5XA 4USKA 4YQWA 5J1PA 4CNYA 3OTOJ 1HNZK 2E6MA 3W64A 3VV2B 4LBPA 1ASWA 2XICA 1VHFA 2CQ0A 3D3CJ 2GJ2A 1NGCA 4OHXA 2P6SA 1J5EK 8ICYA 1VRTB 5IINA 5A8KB 1APSA 4OKKA 1WTFA 4N41A 2L41A 1ZJNA 9ICEA 2NZTA 2B8QA 4HHHA 2OCEA 2XMAA 4LF5F 3EMTA 4B3SJ 3CJ4A 4X65K 2HHHJ 3R5AA 2XY7A 2BRLA 4QNLA 2EWSA 2R8KA 2A19A 4NM2A 5IT9Y 4YHHJ 2PO4A 2DHAA 1FRLA 4WTYA 1CUKA 2K3KA 1BG3A 1LK5A 1RCOB 2JVOA 1JLQA 2VUGA 4Z7CA 1P1LA 1S49A 3QFPA 2ACYA 3R6LB 2OYQA 1SJ4P 4GKJK 1HKCA 1J27A 1HEKA 4LFCK 4ZP7A 5K8OA 2ZIXB 1SJ3P 5JVGL 1U2FA 3LANA 3QWPA 3MMCB 2AW0A 1RXOB 4L76A 4YB6A 3N28A 1BE4A 2DHXA 3AOBA 2POKA 2O8BA 1RXWA 4ED1A 1SKRA 5HR6A 3MPVA 1RT6B 3WQUA 3JXOA 4XQ8A 3JSMB 2ODGA 1S1TB 3Q2TC 4OJOA 3MUMP 3CPWR 1BPBA 1VLBA 2B56A 1ZJMA 4FK2A 3VGMA 3MM6A 2K1RA 3QE9Y 2P9EA 3NGDA 3LGHA 4FP9A 1Y64A 3PFOA 7ICJA 2CJ9A 4LD0A 4DV4J 3NAIA 1NK6A 1KC8O 5J2CA 2X6SA 3UKRB 3RR8A 3RWUA 4Z4GA 2XMVA 2P9SB 3C5FA 3DGVA 4ZCMA 3MCSA 2VFVA 2LEPA 3LAKA 2DH8A 2EFQA 4QPTA 1A5WA 2YPYA 1S5ZA 1RQ0A 3CJCA 3K4GA 5KFXA 5FDLB 1R59O 4HTJA 2P5VA 3SXLA 2PMZD 4PEOA 2UUBK 2XY5A 2L9WA 3BQ1A 4UTGA 1REVA 4ZVSB 5J0QA 2B3TB 5JVGQ 4P0PA 5AKHA 2GW8A 4AD6A 3MOZA 2KDOA 1HBMA 5IQ6A 3M1VB 4Q8FA 3PRDA 4DPUA 3ZSRA 2RRNA 3R1HA 1XO0A 2R18A 2JZ5A 2H5XA 1PGZA 2G08A 3V9UA 1XR5A 4NLCA 2WSFC 3SMVA 1NHUA 4KYZA 2CRLA 2CN1A 2ZH8A 1RGVA 3OBYA 3QLHA 2CGJA 3A1YG 2OO4A 3GU3A 1KAZA 4OPAA 2HBJA 2IHNA 3UW1A 3ZT2A 1YJWS 2RHFA 4LFBK 4FM2A 1NU4A 1XERA 3VQPA 9ICPA 1WDTA 4JD2A 4B3MF 1YVUA 1RT4B 2HNDA 3D2FB 1SC6A 4X2BA 2F9DA 1VSJA 1C0UB 4I1TA 1WAJA 4DL2A 3PFEA 2QA4G 4IG3A 4MDAA 4G6VB 3HP6A 5FPEA 2RRDA 3OGUA 1FO4A 2I5JA 4BRIA 5JS2A 3QO9B 4R5PA 4KE5A 2JEIA 1KVAA 2F1JA 1MA7A 1ZQVA 2ZJPL 1YDLA 4IDKB 3F44A 1A5VA 3SUOA 3OYDA 2C3YA 2BQUA 3ILOA 3W7BA 3BREA 4HACB 5AZIA 3VC8A 2NO5A 5C12A 2W54A 4OHYA 2NUBA 3HWTA 2JZBA 4PQAA 3EZWA 4R79A 1JIHA 4QIWC 3DLGB 4OJ6A 4ILHA 3VQAA 2QA1A 1QY7A 3KOOA 4OX9F 3QFWA 4NCBA 4E7LA 3IG5A 3MWPA 2DR9A 4BDYA 2F77X 3V6KA 1KBRA 2IGIA 4FWMA 3PYGA 3MD1A 3ATVA 2UUAF 1T03B 1GO3F 1T9XA 2ROGA 3MDCA 4K4XA 1X5TA 2AYEA 2HPUA 2E2OA 1HJOA 3DFEA 1C7YA 2EFPA 4CJ3A 1SCJB 2B4OA 4KO0A 4K7QA 4B8CA 4FJ9A 4DTNA 4F93B 5KFKA 3JSRA 2H65B 5AM1A 3G9CA 5I3UA 2EHGA 4A8SA 3I82A 4LIWA 3MX2A 1N5YB 2BHNA 5AJ3J 5LMNJ 1U1RA 1OSDA 2ZWHA 5BRFA 1NZ8A 4A2AA 5KAFU 4NLPA 4RWTA 3OYEA 2LEBA 3CE8A 4UAVA 2KFNA 4ZLLA 4FJHA 1NJIT 9ICMA 2FHMA 2J6SA 3FMBA 5KFWA 3L9ZA 8RUCA 4N47A 4CF5A 1DLOB 3C7NA 5DG7A 2P5OA 2FLLA 3GSIA 1TR0A 1OY6A 5GAHI 4JYAK 3WKAA 4MLHA 3KKAA 1TL1A 3JAMY 3O0FA 3OBWA 3RSEA 3DLJA 2DR7A 2GUIA 2KVQE 5KFIA 7ICKA 3DLLQ 4NB4A 5FPDA 2R2UA 4RPZA 3M2UA 2C2KB 3DLKA 2EZYA 1LAVA 3DLHA 4CZGA 3SCXA 4FJ5A 1UJ6A 2JWNA 2JWKA 4QS7A 2LU1A 4U67L 5I9EB 3FBCA 2B9EA 5J0OA 2Y9HA 4O5BA 4E1JA 1P8GA 5A2QO 4CRJA 3NNHA 1VRTA 3L7OA 4ZVGA 3ZT4A 1VQPN 2WFAA 1OXJA 2WSEC 5GMEA 3CCMN 1RQNA 4UW2A 1GLLO 3CCLS 3KK2B 2BE7D 3F9KA 1QDUB 1VBZA 2YQEA 4JB3A 3BR9A 1IJFB 1DGSA 3M1YA 1P90A 4AHTA 4DOCA 2MKKA 2YKQA 4ZP6A 2K8GA 4UB4A 3U1MA 3BZCA 3ZDCA 4DPWA 3HKZF 3ISBA 2VIHA 2I38A 1C2PA 4OV6A 1J9AA 1N32F 1CC7A 4Q0BB 2KKVA 5HI7A 5HRNA 4BE0A 5CZXA 5HK4A 2YQ0A 4H5NA 2LQBA 1LWXA 4BY9C 4KHPF 1HRHA 3I32A 4CJSA 1Z6RA 2HZAA 4EIAA 1IKYB 1K73T 2ZIXA 4OZNA 2BYCA 1U25A 4IRCA 2CNKB 5GADP 3ZTRA 2RD5C 3WNFA 1FNMA 3OUYB 2B8PA 4QZ9A 1JLAB 1G99A 3DXBA 3P5TL 1F3FA 1S0NA 3O9TA 1K5OA 3V1RA 1S7HA 1CS4B 3KLHB 2WK4A 3OR2B 1RT6A 3HHEA 4YY3F 3BYRA 3FJ2A 2Y8WA 1OWXA 3FRYA 1S1TA 2HB5A 5J2MA 5GMKa 2R2RA 2R7WA 1IQTA 2DVIA 1S48A 5AKGA 4MF2A 3NMUA 1HBNA 3TUPA 2ZITA 5SZTA 2D0CA 8ICQA 2IPOB 5L1IA 2W6KA 3F2CA 1XNRK 4HTLA 2DHHA 3TAMB 1ILYA 1XJWB 2ZH2A 1VQ6N 1T3VA 2IMOA 5AE3A 2NNWA 1S4FA 4FBTA 4WU2A 2W9BB 5J0WA 1MC8A 4WFAQ 5IILA 3VF4A 4DPTA 3GDXA 1UA1A 3DC2A 3ETLA 5CYJA 2LA4A 2CQCA 2GVZB 4DV1F 1T8EA 3ISNC 2Z8QA 3PJXA 1HI1A 4I6MB 1BWFO 2RPIA 3MPUB 2DH9A 3BSNA 2F4VJ 4P7VA 3J81O 3SQIA 3QJLA 3D4JA 1AUDA 1TELA 4DCCA 3SDEB 4IWVA 3SPYA 4DF4A 2W8LA 5DMRA 3BSAA 4KHRA 2DITA 4Y6IA 1Z1VA 1O1WA 3V9SA 1B64A 2HDOA 5DB9A 3LGNA 2VG5B 3KG1A 1U04A 2D0AA 1NEEA 4ALZA 4CFCA 1NBWA 3PR5B 1VIOA 2W2PP 3DV9A 4C1NI 5KT5A 3OPKA 3S01A 3FE1A 1TUVA 2X7IA 3VGKA 1WHVA 4ZKAA 2PSZA 5HQLA 2M3DA 2FSKA 2N1RA 5CYMA 4KI4A 2FVRA 4KLEA 4NL9A 4PL8A 1IBKJ 1RT4A 3R7NB 1X7VA 5CEHA 1QUPA 5DBCA 2R2SA 1WCLA 1LFWA 1EKEA 2UV8A 4L8RB 5KFQA 1TL7B 2GIFA 5JMVA 2G9OA 4JWNA 3I0RA 3CERA 3QO9A 1K0VA 3RJMB 1WI6A 3T79A 4CDIA 4M5JA 3AUOA 1R31A 5HRRA 2DTUA 1L5UA 1RSCA 4IDKA 3Q89A 2IYGA 3LALA 3OFGA 1Q81T 4CD1A 4L3KA 2E7VA 2NCKL 1JLBA 1REGX 4CP5A 1UT8A 3BSCA 2CA9A 3DLGA 4LQ3A 2B51A 1HPZA 1FF2A 4H4OB 2BKNA 3D54A 2XY8A 2GHPA 4QZDA 2UP1A 2XSFA 2V0NA 3GQCA 2EC2A 4KSEB 1T03A 2ETJA 2GELA 3PIPQ 2YMLA 4AP9A 1S77D 1D8YA 1N62A 4QR2A 4C4TA 5CH7B 2C22A 4IRDA 3KG0A 5LSRA 1QSLA 1WC6A 1A7GE 2JDJA 5EHHA 8ICPA 2V2VA 2VC1A 1TKZA 4TUSA 1WOQA 1ZD3A 4AL7A 1WCNA 3F2DA 1KFSA 1VYAA 2YPZA 3BH7B 4USVA 2HBMA 4LF6F 2G2OA 2F9JA 3T6BA 2GS8A 2E8AA 4Y1DA 2YI1A 4HKQA 3DLEB 3HZGA 3C6HA 2QT7A 1N5WA 2BXJA 1NB7A 2JSXA 3VVUA 3UD3P 1R8HA 1DRZA 4LF8F 2DD8S 4KHWA 2P66A 2VPXB 2ZNZA 2W55A 3Q2SC 3U27A 4WWSA 1ZQZA 2WTUA 3CJKA 2BX6A 2HBQB 3Q8LA 2FJDB 3JS9A 4FJXA 2MKYA 3QXGA 2PFFB 1WC0A 4FWRA 4NLKA 1OKJA 2ZM6K 3CQXA 4DR6K 2WF9A 3PMNA 5D8HB 4RU9A 4H5RA 3EICA 4WQ4C 3VAKA 1A5XA 3KWMA 3MR3A 4V19X 4L73A 2QB1A 4IEIA 1N5VA 5DDYA 4CLFA 2EX3A 4XH4A 2XMTA 4CZEA 1RUSA 1NOMA 4Q2MA 3W63A 2CJXB 2XGPA 4KQZA 3DXMB 2CZ9A 5EWEA 1UFLA 4Y1CA 4U6PA 1XMQJ 2K8BB 1QD1A 3OYKA 4NXMF 4OJ3A 4B9TA 3QBCA 2C2RA 4FZVA 1F0MA 3TFRA 1F44A 4Y00A 4K0KJ 4TXSA 4Q0BA 2Y0SF 2V8HA 4ILGB 4IQWA 3UB5A 1K6YA 4RQ2A 5DJBA 1X3NA 2KHVA 5TKYA 5J2AA 3E8OA 2GWSA 3HFVA 2ASYA 1QQMA 2PZSA 4UQTA 2DPJA 2LI6A 4UW9A 4ZHRB 2KICA 1EJ7L 2AIRB 3W60A 3VVTA 2DNLA 4I27A 2E29A 5KFGA 4ED3A 5ALLA 1NKCA 3JQMA 1O08A 4FXVA 3ZSWA 2HRTA 5KT2A 4DV0F 4DS4A 2A2DA 5C7PA 1VSDA 3VGTA 3OR2A 6FD1A 3A8EA 4J9RA 3PLAA 4WF9Q 3D2EB 3NVKA 5H9FK 2APOA 4BC5A 1Y97A 1W2BM 3T1HK 2HBYB 4JV2A 2AMCB 4WIIA 2D5RA 4J9NA 3G10A 1FEEA 1L3VA 2OM6A 4M5HA 4FXDA 1C4AA 1VQLS 3HKZC 3R5BA 2BGGA 2IY5B 1DAXA 4LSNB 1PVPA 4CLSA 4EAHD 1EETB 2AKWB 1DHMA 3M8ZA 4JI2F 5DM7L 5FRMA 2KOBA 1Y5IB 3N97B 3TQ1A 4ID8A 2DXDA 5KFAA 2DIVA 5F0WA 4HHTA 1OW5A 1KOHA 5T14A 3MCPA 4CJPA 4UB3A 5T7LB 4I6MA 3TACB 4DSIA 2NREA 3V4IB 4BX9C 3AA4A 1K73O 1FJGF 2FBVA 4RLEA 3SDEA 3L4PA 4BC2A 2BJEA 1QS4A 1UETA 2D74B 2XYGB 2CWXA 3M6ZA 4JKFA 3ZX0A 2HHUA 4ZCIA 2QXLA 3TW0A 2E5LJ 4TSXA 4ZIWA 1KN5A 3FFIA 5CCMA 2NPFA 1WC5A 4H5TA 4GV9A 3TVZA 1BNOA 4HCBA 3VQ4A 2VPWB 4MKVA 2XGQA 3PW5A 5HR7A 2DPIA 2R8HA 2C3MA 4O4GB 4J9UE 4CFAA 1GTEA 4IC9A 5AI0A 2I6XA 1TV9A 1TGOA 1WUDA 2G4BA 2OWOA 3F41A 2OHFA 1GT8A 4X65J 1UW4A 5A76A 2F40A 4ELVA 5HP1A 4OO1J 2GEMA 3IMXA 2LHTA 2QMXA 4DR3J 5D15A 4HR2A 2EAPA 1C0TB 5BREA 2VFSA 5DM7Q </