2Y1IA

Crystal structure of a s-diastereomer analogue of the spore photoproduct in complex with fragment dna polymerase i from bacillus stearothermophilus
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPESALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNKGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE I
publication title Crystal Structures and Repair Studies Reveal the Identity and the Base-Pairing Properties of the Uv-Induced Spore Photoproduct DNA Lesion.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2y1iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2y1iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2y1iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2y1iA01
4M9NA 3G6XA 3HL8A 4FLVA 5BOMA 3QEBZ 1ZYQA 1UA1A 7ICGA 3QEIA 4KLJA 2XC9A 4TQSA 4KLQA 4DL7A 1FK9A 3Q8LA 3RJJA 4CF1A 3BQ2A 4YCXA 3VA3A 4O9MA 2XGPA 2AGQA 1HRHA 4RW9A 3SPZA 3LWLA 4QCLA 4ZTJA 2W8KA 3CYMA 3QEVA 2J6SA 3RRGA 3SUQA 1HUOA 1WSEA 2DFLA 4RQ8A 4JV0A 2W9CB 5I3UA 1SL2A 5J0SA 4J9KA 4LH4A 4J2AA 2BQUA 4CJUA 3RMDA 3VQQA 1RT7A 3NH2A 2ALZA 1EETA 3RBEA 1U49A 2HHVA 1RBTA 4KTWA 3ALYA 3C94A 1BGXT 1IM4A 4FLTA 1UT8A 3B0YA 3QLHA 5DB9A 3QERA 1RBSA 3EPIA 5J0QA 4ICLA 8ICVA 3L3VA 4ED7A 4KLLA 9ICWA 1RT4A 1JXBA 4KN7A 1NKBA 5KFGA 1ZQIA 4RNOA 1VSEA 1ZQMA 2NUBA 3ZT4A 1GOAA 1TKTA 3QEXA 1NOMA 1N56A 4DG1A 1Y97A 3NH0A 3AVBA 3H8SA 2AJQA 1AROP 4PHPA 1QSYA 2HVHA 1A5XA 4O3OA 4I2PA 2ZJ8A 3NH1A 3G6YA 4O3SA 3SI8A 3S9HA 5JS1A 4JRPA 4JV1A 5DBBA 4RQ7A 4BDPA 4FJ9A 4CF2A 5J2KA 4UB3A 3Q8MA 3SQ1A 4NM2A 3AVIA 3GFKB 7ICIA 1KFTA 4J9NA 4K8XA 4PGYA 1K6YA 4DFPA 3PR4A 3OYIA 2G8FA 5KG7A 4QZCA 3WNHA 9ICXA 2R8KA 4RPYA 1RTHA 4FM2A 3PV8A 4YMOA 2YKNA 4E19A 4E89A 1RXVA 1BVSA 5KG3A 7ICPA 9ICQA 3P83D 1COOA 3TAQA 4E3SA 5KFVA 4NYNA 4R63A 1SUQA 2ZJ5A 3MXMA 4M9LA 1HMVA 3LDSA 4RQ3A 4JRQA 3PO5A 4AHSA 3KLEA 5BOLA 3MEDA 3MDAA 3M8PA 2FPKA 4DU1A 3TI0A 3VQ4A 3PX4A 4IRCA 3AVFA 1YVUA 1EXQA 5J2AA 7ICUA 4HCCA 4O3NA 4YP3A 1RTJA 4ZTFA 4CJRA 1HNVA 3SPYA 3NTUA 5J0PA 3KK1A 5L1JA 3T5KA 3O4QA 3TANA 3JPQA 1KLNA 3OYLA 1IKXA 4CE9A 3PX6A 4ECZA 1UT5A 1HPZA 1VSJA 5HP1A 4KITB 5DMRA 4KLEA 4PGQA 1X2IA 1UWBA 1WN7A 3LP1A 3SV3A 4UAZA 3C21A 1UOCA 4FLZA 5KGXA 4M3RA 3G6VA 2RF2A 5KFPA 2DPJA 4MFBA 5T7BA 2P6RA 3AO4A 4CERA 1PZNA 1JKHA 2R7YA 5DGBA 1JXLA 3PMNA 4DOCA 4CJLA 5KT5A 3K5LA 2YNIA 4CGFA 4NXZA 1RDBA 4M9JA 5JS2A 4YFUA 2XY5A 4JLHA 4QOZB 4TSXA 5KI6A 4JUZA 1V9PA 5CWRA 4QZDA 3PNCA 2PZSA 4I2FA 1ZJMA 2ZUCA 4PH5A 4DF8A 2D0AA 4F50A 3QZ7A 4GXJA 4RQ6A 3HX0A 2JEJA 2BQ3A 1HNIA 1TKXA 2Y1IA 2BCVA 4EYHB 4MFFA 2XO7A 4PUOA 4I2AA 2XGQA 2O4IA 2OPRA 1U04A 2A1SA 3V9XA 5J0YA 3HK2A 4I28A 2XCPA 2ZJAA 2YV0X 1JLEA 4M9HA 4O44A 2ISOA 3L2VA 2X78A 4G3IA 4DO9A 2IAJA 4DQRA 1CZBA 5C5JA 1D8YA 3EW9A 3V9SA 4LZGA 4RPZA 3EPGA 1NJXA 5EU7A 5HRRA 4FJJA 1S1TA 3DMJA 5JUMA 3MR5A 3ISDA 4F5RA 8ICQA 4GW6A 4CF0A 1B9DA 2Y1JA 3ZSOA 4B9SA 1KVBA 4PQUA 1JN3A 4DF4A 4M9GA 4QZFA 3JPPA 2IHMA 3G0ZA 3T1AA 5DB6A 3AO3A 5DBCA 1S6PA 4CEEA 3V6JA 3S3OA 1X1PA 1W9HA 2QXFA 4FJKA 3ISNC 1B92A 4KKOA 4M3YA 3QNNA 3GV7B 3PW4A 4LVSA 1C6VA 3NAEA 4FJNA 3QINA 2FPLA 3RR7A 4FJMA 4JK1A 5KFQA 4UBCA 4H8KA 2PFOA 4FK4A 1VSKA 3RJEA 7ICFA 8ICCA 4PHEA 4J9OA 3HP9A 2HHQA 4FK0A 3V7KA 5D3GA 1IO2A 4IRDA 5KTQA 7ICMA 8ICGA 4KB1A 4HTUA 1ZQFA 1T3NA 3RRHA 4QZ9A 4PA1A 4I9LA 3V9UA 1RT1A 5DDMA 3VQ9A 5J0WA 4ELVA 3KD5E 4I2JA 3M9MB 4I2QA 4DQIA 3HXMA 1C1BA 4FJ8A 4YMNA 5IILA 4RZRA 4DSEA 2HHXA 1TKZA 3L2WA 5KFTA 3RAXA 3C5FA 3H8JA 4RQ4A 1VSDA 4QAGA 4FJ5A 1B9FA 1WSIA 3I8DA 4BWJA 4R64A 4EZ6A 4MEYA 1RILA 4UAWA 3GIMA 3C2MA 4YR3A 2ZE2A 3GIJA 3TAEA 4FJ7A 1HJPA 5KFWA 2B21A 2JEIA 3L3UA 7ICNA 2Z1JA 3SQ4A 5K14A 2FLPA 1B22A 4DFMA 3OYEA 4GVMA 5EWGA 3EY1A 8ICUA 5D49A 3NF8A 2F8SA 4J9MA 5KFFA 1S9EA 3NBPA 4I2BA 3BJYA 5J2GA 2P1JA 4KLIA 4F92B 2IC3A 5KFIA 3KD1E 2BPFA 4HUGA 3QEPA 3L2QA 4DTUA 1HYZA 1XC9A 4K4IA 3IG1A 5KG1A 3OYBA 5KFEA 4UB2A 1ZQHA 2LYHA 2B5JA 1RYRA 2XRIA 1CEZA 4W5NA 1IKWA 1ZQVA 2PI5A 3RH4A 4HUEA 3VQDA 1VSFA 4I27A 3AA5X 2Z1GA 3HPGA 4BE2A 4LSNA 2H5XA 3KKSA 4FM0A 3LZJA 3SV4A 3GV5B 5IIIA 3RB3A 3K58A 4CHPA 2BANA 3HP6A 4C8KA 4FM1A 2E6MA 4ED1A 2PFNA 3AA4A 2B4JA 9ICSA 1RT3A 5CJ7A 4O5KA 4XUSA 9ICCA 5J29A 5CR0A 3JPSA 5J2NA 7ICOA 2W9MA 1U4BA 4KAZA 4DTRA 4W5QA 5J0OA 3K5MA 2VA2A 1TL3A 4I2GA 2BPGA 5HMMA 2OZSA 8ICYA 4WE1A 1Z00A 2KZMA 1NJYA 4DOAA 4Z4GA 9ICEA 4CHQA 3O3FA 1TAUA 3MAQA 1ZQAA 4CK2A 1U48A 2VG7A 2ZTDA 4IQVA 2ZD1A 3EYZA 3SCXA 2YNGA 3BQ1A 4J9RA 1BQMA 3L2RA 4F5OA 3A2FA 4FW2A 1DTTA 4CJ4A 4BDYA 2A1JA 1REVA 3LP0A 4DTSA 1WSGA 3Q8KA 2Q3SA 2IGIA 4QZEA 4QWEA 3HVRA 4LZDA 4CJPA 5F9LA 1XHXA 4DLEA 3JYTA 4J2EA 1S1WA 3Q8QB 1ASVA 2RKIA 3DLBA 1XO1A 2IBKA 1ZBUA 4HVJA 3ORYA 2NRZA 1QQCA 4RUAA 1SV5A 4PHDA 1JX4A 4GC7A 5I42A 1BI4B 4IG0A 4KHNA 3OGUA 3Q8RB 3ITHA 1ZQXA 1XSPA 3NGYA 3ZSQA 1TGOA 3TWHA 2G8VA 4FYDA 5J2HA 4P2HA 3ASMA 4F4ZA 3SQ2A 2NRVA 1FKPA 4UB5A 4C8NA 4FLYA 4R65A 2W8LA 3D0PA 1U45A 3KK3A 1DLOA 2ATQA 4Z4IA 3K75D 4QW8A 5KFMA 1QS4A 5KFBA 4CJSA 1NOYA 2V4QA 1U47A 2RPIA 5DLFA 4M3XA 2YNFA 1ZQDA 1LWFA 5CY4A 4P4OA 1D5AA 1JLCA 4QWBA 3B6PA 4CEZA 4DTJA 1JMSA 1YTUA 4I9QA 4NCAA 4E7HA 2VG5A 3GILA 4TUQA 4IDKA 1QTMA 4YR0A 4EBCA 2AGPA 3D45A 4M3UA 3QEWA 4YXMA 4KFBA 4FW1A 1MQ3A 8ICPA 3JPOA 1NK4A 4BE1A 3MXIA 1WSFA 8ICSA 4M47A 5CYMA 5BPCA 3SYZA 2FMQA 2X6SA 1QSLA 8ICIA 4B8CA 4QZAA 4F2SA 4PPXA 4Z6EA 4FJXA 4NLGA 3VQCA 1CXQA 3KIOA 3HYFA 2HMIA 4DTXA 4R66A 2XY7A 3MGHA 8ICEA 1Z26A 2J6UA 3UXNA 2KZZA 4KLDA 3WNGA 7ICEA 4N47A 5DQGA 5KFKA 1I39A 4NLKA 3KLGA 1TV6A 4MF2A 2DTUA 1RT5A 1VSLA 4QZGA 4UB1A 3CM6A 4NLZA 1S6QA 4DQSA 1N6QA 5J2BA 2WONA 4CEDA 5KFXA 3DRSA 3FYHA 4DTOA 4ID1A 1BCMA 3OYJA 1JIHA 4YG2A 2FLLA 4F4XA 2G8UA 1N5YA 4Q43A 3C2KA 4YNQA 1ZBHA 3HPOA 1S0MA 2ATLA 2ISPA 3GIIA 5CZ2A 2HHSA 1JL1A 1NK0A 3ISBA 4H4MA 3LDAA 2UVWA 4AHUA 8ICBA 4FS2A 2YKMA 1S0NA 4EZ9A 4IR9A 1TV9A 5KFHA 4BACA 1F21A 1IKYA 4TQRA 3TARA 1KFSA 3ZSVA 3C2LA 1RYSA 3KJVA 4DOBA 1SZPA 2BDPA 4KRFA 3NF9A 4CEOA 4LH5A 4IFVA 3NDKA 5FDLA 4ED3A 5J2CA 4RPXA 1W0HA 3K2PA 5IIJA 1NK8A 4N5SA 2JEFA 3LWMA 4OPJA 1T8EA 1IXRA 4J9SA 1N48A 4GC6A 4E1NA 1B43A 2BGGA 1TFRA 3ZDBA 1SKSA 3ISCA 2GV9A 3QO9A 4F4WA 3H7IA 3VQPA 1I3AA 3C23A 1KSPA 4BWMA 2R8JA 2W42A 3MBYA 2EX3A 4FZZA 4YMMA 2Q0ZX 4W5TA 4Z6CA 7ICTA 2G8WA 3ZD9A 4DQPA 3TAFA 2OZMA 2R8IA 1NOZA 4CHNA 8ICTA 4Z4HA 4QZBA 2OPSA 2OWOA 5C25A 4DLGA 3RB0A 3NE6A 3HT3A 1KTQA 3PY8A 4OKEA 2RN2A 3RJGA 1HQUA 3NGIA 1DGSA 3O4NA 1T03A 4B9TA 3DLEA 2W9CA 4AHTA 1EX4A 4IG3A 4CF8A 4FS1A 3QESA 3AVMA 4CEFA 4FJGA 4KLGA 4IQTA 4CIGA 4O3QA 3ZT1A 3ETLA 3QNOA 4Z4EA 3Q8PB 1Q8IA 3KLIA 1ZETA 4C8OA 8ICMA 5HBMA 3T19A 3QZ8A 4RQ1A 1C0UA 2MUTB 4R8UB 4I2DA 4M04A 5TZVA 1MSWD 4Y1CA 4M6WB 4E1MA 1HJRA 4QWCA 2I5JA 4M3TA 3HW8A 2VA3A 1ZJNA 4M41A 3JPRA 2PYJA 2XCAA 4IQUA 3V4IA 2W9BB 3F73A 5KFDA 3M8SA 4KV8A 4QZHA 4KTQA 1X9MA 1L3TA 3KTQA 3NGDA 3OHAA 3OYGA 2BQRA 1RTDA 4I7FA 1CXUA 1Z3EB 2QK9A 2F1JA 3PX0A 3TAGA 3VQAA 4F2RA 4KHSA 3NFAA 3MEGA 4FBUA 9ICNA 4F91B 4E7LA 4CGHA 3RMAA 1BPEA 3UIQA 3VQ7A 3AO5A 2PXIA 3OSPA 3AVAA 1BIZA 1WCNA 1CLQA 3T5HA 5HNKA 2DFFA 2P5OA 1KEJA 3FFIA 3RH6A 3OYMA 4DFJA 2BGWA 1RT6A 4RUCA 3CFRA 2IS3A 5IIOA 5DG9A 3ZT3A 1L3UA 1DOQA 3H08A 1K1SA 5L1KA 5DLGA 3LAMA 3V1RA 1IKVA 1XSNA 4DU4A 4UQGA 2PY5A 3UXOA 2BR0A 3SNNA 5J2MA 1WAJA 2EHGA 2JEGA 4CFBA 3TFRA 5HRNA 3OJSA 1C1CA 3OY9A 7ICLA 3TAPA 1BCOA 4DEZA 1O1WA 2XY6A 3OYDA 4E7JA 3DI6A 4O5CA 4KLHA 2OPQA 3CM5A 3C1YA 3OYHA 4J9LA 4QWAA 5J2PA 3V6DA 1JLBA 4IR1A 2IOCA 4ECTA 4DFKA 4B9LA 3OVNA 4NCBA 4M2YA 5KFAA 1TVAA 1JLGA 3VA0A 4QWDA 4ECYA 9ICIA 2VWJA 3TR8A 4E0DA 9ICBA 3NF7A 4KO0A 2OPPA 1UA0A 1SL1A 1XU4A 1KVAA 4MFCA 3LPUA 3QIPA 5J0UA 1L5UA 3U6FA 2DFHA 3B0XA 4FJLA 5FRMA 1C0MA 1YTAA 2Z1HA 4Y1DA 3C6UA 1UAXA 4JS5A 3MFHA 3GQCA 4BXOB 4HUFA 3DLGA 3S3MA 1S0OA 4Q5VA 4AILC 5KG0A 1BHLA 3RB4A 3PMLA 4CGJA 4KLTA 1NK7A 4ECXA 4MEXA 7ICVA 2DFEA 4DMNA 4J2DA 5KFSA 3MFIA 3C95A 3RJIA 4N41A 4JV2A 1Q9XA 1LWEA 2PI4A 4DSIA 3LALA 3IM1A 1ZQWA 4M3ZA 4F3TA 3E2EA 1S9GA 4OVLA 2JZBB 5J2EA 4CGDA 1BISA 3LP2A 5KFRA 3H40A 4RU9A 3MGIA 8ICNA 3EZ5A 1FKOA 2G8IA 3ZDDA 3AVJA 4IRKA 5IINA 2C2RA 2ETJA 1A5VA 4GLXA 5KT6A 3H4BA 4CHZA 2G8HA 3PW2A 4IBNA 2OA8A 2V4RA 4AH9A 3NCIA 4DL4A 1JLQA 1TK8A 3AUOA 5KFOA 4N76A 1RXWA 4ID5A 2RDIA 1ZQYA 4Q45A 1MU2A 3GIKA 2P51A 1NJZA 1ZQEA 3K5NA 8ICHA 2X6NA 3KHRA 5EOZA 3UQ2A 1ZBIA 5J1EA 4J9QA 3C5GA 2NRTA 3M9NB 1RCHA 5F9NA 3RMCA 1ZQBA 2BKEA 5L9XA 1BL3A 5D4BA 3SUPA 3RTVA 1C1AA 3DLRA 1D8LA 4CHOA 3HO1A 1A76A 3P5JA 3T5LA 2OYQA 4OGCA 5DQIA 1VRTA 5KFNA 3O3GA 3QETA 4B9UA 4DL3A 1T4GA 4E7KA 1BPZA 4CIEA 1ZBFA 2ITGA 3MABA 4OLBA 4RT3A 1S10A 3AVKA 1S97A 3ZCMA 4RW7A 1QLNA 3OHBA 2D0CA 8ICKA 5HMLA 2B6AA 4QZ8A 1LB2B 3PR5B 4HHTA 4KREA 4KPYA 1G15A 2XHBA 5DDYA 3PVXA 1VRUA 3AV9A 1SL0A 5KG5A 3U3GA 3DLHA 4YVZA 3NF6A 1T05A 4KHQA 4LD0A 5IIMA 3UXPA 2V9WA 1RZTA 4RQ2A 4EYIB 1A77A 2UVRA 1BQNA 1GOBA 3SI6A 3HM9A 3LANA 5J0XA 1YT3A 4OPKA 4KI4A 1ZQKA 5CZ1A 8ICZA 3V6KA 4F3OA 4ELTA 4KLUA 4YD2A 3LAKA 2A1RA 1J5OA 5KFLA 1RDAA 8ICJA 4Z4CA 3OYFA 1ZQNA 2HB5A 3VN5A 4M42A 4LSLA 3QEAZ 2D0BA 5J2QA 1TAQA 2C22A 4ED8A 4KHWA 4O0JA 3OS0A 5E41A 1CZ9A 1WSHA 4CJ3A 3K57A 4M0AA 4KMUA 2C2DA 1T7PA 2FBTA 3Q8SB 1X9SA 1ZQSA 3RWUA 2F96A 3IHQB 2IA6A 2JGUA 3ZSYA 3KLHA 1RBRA 1KCFA 5CB1A 4CJEA 2ZUDA 2KTQA 4OKJA 3LPTA 1HQEA 2HW3A 3K5OA 4BGDA 1WNSA 1ZQGA 4F5NA 2YHBA 2ASJA 5DBAA 4TURA 4CEQA 2BPCA 3V9ZA 4CEAA 2ZTCA 1VSHA 2IDOA 1L3SA 3IS9A 3PW7A 1EKEA 3MEEA 5J2FA 4OKKA 4CFAA 4B9MA 3PO4A 1ZQTA 2ZTEA 5D46A 4B08A 5C24A 1WSJA 1S1VA 3V9WA 2X74A 1RNHA 4F4YA 3B6OA 1WLJA 3G10A 2ZQBA 2PFPA 4RW6A 1ZQCA 1H38A 2WOMA 2FMSA 4MF8A 8ICFA 4I2EA 3RAQA 2ASDA 3HSTB 4DSLA 5J2IA 3P1GA 4ECRA 1TK5A 3RH5A 5KGWA 3ZT2A 9ICKA 1SKRA 5DB7A 4DL5A 4EP5A 1TKDA 3AVNA 3K59A 1BI4A 1X9WA 1S76D 3AO1A 3V7LA 4I2HA 1DTQA 4KHUA 1TK0A 1RBUA 4KLFA 4KN4A 4C8LA 3MXJA 2M9NA 9ICVA 5KFZA 1VK0A 1C0TA 4YQWA 3SUNA 3C1ZA 3SUOA 4FK2A 4Z4FA 7ICSA 3HPHA 2UVUA 3ZD8A 5DKWA 1LW0A 5DQHA 2F1HA 4ED6A 7ICQA 2P5GA 4OGEA 4K4GA 4B3OA 3PUFA 3S3NA 4RW8A 1J53A 1Y88A 4DWIA 4CGGA 5KFCA 1QSSA 3OYKA 1KVCA 4AHCA 3T3FA 2HVIA 3DOKA 4KB0A 9ICAA 4YD1A 1KFDA 2AQ0A 1ASWA 4Q0BA 4ED0A 4ECQA 4EEYA 2KW4A 4KI6A 5J2JA 4CJ5A 4EBDA 1LW2A 1SKWA 1D9DA 2AGOA 4CHYA 3M9OB 3TFSA 4XRHA 4DS5A 2YNHA 1XS9D 3KLFA 4RNNA 3UPQA 2ASLA 7ICKA 4CJKA 2KN7A 4QW9A 3AO2A 5EWEA 3QIOA 4CK1A 3ZDEA 3ZSWA 1S0VA 2PYLA 4B9NA 4NLNA 1BIUA 3T5JA 4P4PA 4H4OA 4O3PA 2HHUA 4RG8A 1JXEA 4G1QA 4W5RA 1NK9A 2I9GA 1XHZA 1HYVA 4DL6A 3WNFA 4LY7A 4BE0A 4DTPA 4CK3A 5DG8A 4F4KA 1GOCA 1JLAA 1ZBLA 5CYQA 4O3RA 1LWCA 3ZSRA 5KFUA 3F9KA 4W5OA 1KRPA 4FLUA 1KDHA 9ICHA 3V72A 1ZQLA 4JWNA 1BPBA 3AU2A 1XWLA 3OYAA 2QKBA 3NHGA 4ECWA 1ASUA 4FXDA 3K4GA 3OJUA 4J2BA 3N97B 3RMBA 3DRRA 5HROA 5KG6A 1ZQOA 4K4HA 2G8KA 4AHRA 1NKCA 2J6TA 2Z1IA 3MDCA 3VQ5A 2BCQA 2AQ4A 4I2CA 4C8MA 1S1XA 1QHTA 1TL1A 5KG4A 2RDJA 3HWTA 4DSFA 2FBVA 1NK5A 2BCUA 2MAXA 2BHNA 3SJJA 2UVVA 4CFCA 4DU3A 3RJKA 3V6HA 2ZUBA 1D9FA 4IQWA 4DTMA 4RT2A 3JSMA 1HUZA 2WTFA 2FBXA 1ITGA 4N56A 4E7IA 4PHAA 1EXNA 5DG7A 9ICTA 2P6UA 4UAYA 2R8HA 2PFQA 3JPNA 4KTZA 7ICHA 8ICAA 5L1IA 1JLFA 1ZQPA 4O0IA 4FJHA 3EWAA 4NCGA 5KG2A 4XIUA 1BPYA 4MFAA 4RNMA 4ZHRA 3CFPA 4P4MA 5CHGA 4HYKA 2P66A 3DLKA 3JPTA 3AVLA 4FBTA 3WNEA 3RB6A 2HNDA 2IMWP 4ECUA 1JL2A 3RBDA 4CF9A 4YFKA 1LV5A 2KQ2A 4Z6DA 5J2DA 4KLSA 3AA2A 4I2IA 2BCRA 5L1LA 1ZQJA 1S1UA 2QKKA 1MQ2A 9ICLA 2HNZA 4YR2A 5EWFA 3IAYA 4Q8FA 3BQ0A 1J9AA 3VQEA 2VANA 3O3HA 5CA7A 4FZXC 3ZDCA 3CFOA 2KFNA 1FXXA 1U9LA 4QZIA 4CJQA 1KLMA 4GMJB 2F8TA 5KT3A 5KRSA 1VSMA 1BPDA 1Z00B 8ICWA 4XA5A 4GXKA 4JWMA 1CUKA 3DM2A 3MR3A 4ED2A 3C6TA 3FDSA 4B9VA 2XY8A 2JLEA 3LP3A 4YXJA 3U3YA 3AA3A 4TUSA 4ELUA 1L3VA 1RBVA 2E6LA 4PY5A 9ICOA 1EP4A 2A1JB 5J0RA 3I0SA 3ZSZA 2MUTA 4R8UA 5FROA 2E4LA 3ZSXA 2NRXA 5KT7A 2HHWA 4M6WA 4DS4A 3SQ0A 2R8GA 5HHHA 2C28A 2BCSA 4J9PA 4DQQA 4JS4A 4TUPA 4IFYA 1MC8A 2NRWA 1XI1A 4AHVA 4FLXA 4FVMA 1VSIA 4I29A 5FRNA 2W9BA 4CIFA 7ICJA 4X5VA 1RDCA 4EBEA 2IHNA 3CG7A 2DY4A 4CFDA 1WAFA 5SZTA 1NJWA 1QE1A 3OYCA 5J0TA 1RPLA 3V81A 4F5PA 3VQ8A 4B8AB 1NKEA 1LAVA 3L8BA 8ICOA 4CGIA 2FC0A 4KLMA 3OSNA 5IIKA 3KK2A 5KT2A 3NGZA 4FZYA 2KFZA 2VA8A 3LK9A 4O5BA 3MR2A 3VQ6A 4CECA 5KFYA 5DB8A 2W9AA 2HHTA 4O55A 1HYSA 9ICFA 4RQ5A 4CESA 2D5RA 4CJVA 1R0AA 4Z0UA 1K1QA 4CEBA 3V1QA 5DK5A 4UB4A 5HP4A 2VG6A 3GV8B 1NK6A 3V7JA 5DGAA 1S77D 5HRPA 4MQ3A 4ZH4A 4FJIA 3AVHA 3THVA 3OS1A 2BE2A 4UBBA 4Q8EA 4YN4A 5SWMA 4DTNA 3RJFA 3OYNA 4FCYA 4NY8A 3ZT0A 4RW4A 2FBYA 1BPXA 2YHAA 3I0RA 3M8RA 5HRSA 3MR6A 2O4GA 3AU6A 3H4DA 3RJHA 3BGRA 3L2UA 4FLWA 9ICRA 4CJWA 2LSNA 1IH7A 9ICUA 4PWDA 9ICGA 3LZIA 2DPIA 3ZDAA 1ZQUA 3QE9Y 3N4MB 5KRTA 3TQ1A 4GXIA 5KFJA 3OS2A 1J54A 4O4GA 4IKFA 3KKRA 4CJTA 2HNYA 3KHHA 3GDXA 2GBZA 3AVCA 4HCBA 4ECVA 3E01A 8ICXA 2F1IA 3KHGA 1S9FA 5KT4A 1LAWA 1ZQQA 4XQ8A 5C42A 5HHIA 4PGXA 3TAMA 4FO6A 2VWKA 3KHLA 9ICPA 2FLNA 2GUIA 9ICJA 1Q9YA 4CCHA 1ZQZA 4F93B 1TVRA 3ULDA 1RT2A 3AVGA 3V1OA 4DSJA 3MECA 4BXOA 4KHYA 3M8QA 3BDPA 5CP2A 3DOLA 4NYFA 3VQBA 5HLFA 3HJFA 4R5PA 2AU0A 3RR8A 3CQ8A 4Z6FA 4OLAA 8ICRA 3HVTA 2FPMA 4CJFA 4BDZA 3PW5A 4M3WA 3IRXA 4M45A 4L8RB 4O5EA 1IG9A 2GWSA 1RTIA 4NM1A 3BQTA 3PW0A 4F5QA 4RQ0A 2C2EA 3DYAA 4K8ZA 2KZ3A 2JZBA 1ZQRA 4ECSA 1S5JA 4Q44A 2I1QA 4KLOA 4F8RA 3H8WA 8ICLA 1C7YA 7ICRA 1Z25A 4EP4A 1RDDA 3DRPA 1A5WA 3TABA 2FMPA 3SZ2A 1WCLA 4OJRA 4DL2A 1XSLA 9ICMA 3UQ0A 4DSKA
chains in the Genus database with same CATH superfamily
4M9NA 2K06A 1KDNA 3HL8A 2ZIVB 5BOMA 2GJIA 4JK7A 4BUGA 1A0OB 3FK4A 4TQSA 2ASOA 3VGUA 3WC2A 2MY7A 3MD1A 1NXIA 5HQ8A 4F04B 3CIZA 3ED5A 2DNQA 1QVGR 4MAKA 5C25B 3KLFB 3DU6A 2MZ1A 1KQSM 1HRHA 2G06A 4RW9A 4JI7J 3LWLA 4L72B 2W8KA 2YTCA 3QEVA 3RRGA 1QHAA 4OX9K 1FKAF 1T03B 4OI1A 2WB1D 4K25A 2YKAA 3DLEB 4IYQA 3QFUA 4QR2A 2P9NB 3P3DA 1SL2A 1WHVA 4G1QB 3MZIA 4G6VB 3BO4A 4CJUA 3CD5A 4PKIA 3VQQA 2ALZA 1NH8A 1RBTA 1O08A 2QWOA 2LECA 1HWKA 5L9NA 1NHVA 1IM4A 1V38A 1IV8A 1HNXF 4U96A 4C23A 5J0QA 4GO5X 4ATNA 4ZITA 9ICWA 3OPXA 4KN7A 2FY8A 1ZOTA 2VF3A 2E5LK 3MWPA 2P2CB 2N7CA 1VSEA 1ZQMA 2NUBA 3EDRB 3ZT4A 1TKTA 2BJ8A 1UPPA 3V4IB 3NH0A 2FGOA 3Q7CA 3KFWX 2L9DA 3GFXA 2F63A 2FJDB 4PHPA 4GVBA 4KV8B 3H0LB 2ZJ8A 4O3SA 2CWXA 3SI8A 2Y8WA 5JS1A 4NLWA 4JRPA 4AT1B 5J1NA 3MM5A 3CMAS 3Q8MA 3SQ1A 3D2QA 3AVIA 4C0OC 2JH1A 1FFVA 3C15A 1Q95G 3CCSS 5FLXU 3E3XA 4PGYA 3L09A 3ETRA 2OFHX 2QLJB 4JNEA 3WT0A 5HI7A 5KG7A 9ICXA 4OI4A 3Q23A 3RBXA 4FM2A 1B64A 4N8NA 4YMOA 5FP0A 2KSOA 1D8BA 1IQTA 4E89A 5F41A 1NJIO 3NCQA 3T69A 5E3PA 2GVDB 1J2NA 4NYNA 5EXWA 4DV1J 4EX6A 1CS4A 4A8WA 2RILA 3H8YA 3TOQA 4M9LA 1IBKK 1ZD4A 3AARA 3LDSA 3KLEA 1HWLA 1IR0A 3JS6A 3FSYA 3MEDA 2WHOA 2Q6CA 3N79A 2RSQA 3W2WB 3L95X 3VQ4A 3AJDA 4DV6J 4CT9A 3NVWA 3HRGA 4O3NA 4ZTFA 1C1CB 1HNVA 2KIWA 3ILIA 3NTUA 1WG5A 1EAYC 5ALGA 3O4QA 4DV2F 3GR0A 1XMOJ 3TANA 1KLNA 4ECZA 1H2UX 5JXSA 3UWTA 5HP1A 2I7NA 4H5TA 2V8GA 4KLEA 2NZ4A 5EDWA 3AOCA 5J2PB 4OYAA 5HN0A 2XLKA 3D2EB 1ZAXA 4L3QA 1QH9A 3SV3A 3C21A 2KHDA 2ABYA 3HT0A 5T7BA 2P6RA 3AO4A 5BRFA 4LRBA 4DR7K 2R7YA 3PMNA 1RHRB 4DOCA 4CJLA 3WKAA 2YNIA 4WYBA 4NA1A 2BM0A 1RI7A 4DUYK 4ERDA 1RLCL 1KVIA 2XY5A 1H98A 4LUBA 2KL8A 2HOEA 3M30A 1VOMA 4QZDA 4QYRA 4PYAA 5IV3A 4CZIA 2VICA 4PH5A 1E6VB 2QLWA 2BUPA 4F50A 4GXJA 4QJVA 1N0UA 4IL6U 3SBMA 2KO1A 4CBXA 1TKXA 1FRXA 3UDLA 5AQJA 1FRMA 1LWEB 3L7PA 2JFDA 1J97A 4XH1A 3R5BA 2YJFA 4I28A 1VC0A 1JLEA 1GX5A 3E58A 3L2VA 4G3IA 3DLLQ 1ZH5A 4FOIA 2CQ4A 3MM7A 1D8YA 4RPZA 5EU7A 3H2UB 5HRRA 3J7ZT 1F1BB 4K42A 2IYIA 5JUMA 3ISDA 1NI3A 3OLBA 3BSCA 3EE9A 1N5QA 3M2VA 2H3IA 2DXDA 2PMZC 2P9IA 4PQUA 1PKUA 1VQPS 1JLQB 1JN3A 2G1DA 5IC6B 4M9GA 4QZFA 4U7UD 4M1KA 3AO3A 5DBCA 1S6PA 1MU2B 4Q7AA 4CD3A 3S3OA 1H73A 1X1PA 2QXFA 1NCLA 3OR1B 2QLBB 5FD1A 1HD1A 4FJKA 5AZJA 1RCXB 5J1EB 1WUDA 2W1BA 3NAEA 4JK1A 4BRLA 4FK4A 3QUCA 4YOVA 3RJEA 3J7ZO 4PHEA 1Q8LA 4J9OA 2Z2ZA 4NLUA 3DDKA 4CO2A 1DQ9A 3UPFA 3HOTA 2EZZA 4KJIA 5B0BA 4A8SA 4QIFA 4GNIA 5D3GA 4IRDA 1RBOB 4KB1A 3QU4A 1GQEA 1TYQB 1R8CA 3RRHA 2BJ7A 4PPDA 2BOAA 1XERA 3VF0B 3SMVA 5J0WA 4E8UA 1Q4RA 4ELVA 1PSDA 3M9MB 4DQIA 4OYXA 1SZHA 3ILJA 3F5TA 3RSEB 2LFVA 2GMJA 4PXCA 4YMNA 4MK7A 1Q78A 1R7IA 5H9FK 1TKZA 5GIPA 1YKWA 5KFTA 3RAXA 4K4SA 4ZCKA 3HSZA 3A0HU 3H8JA 2UXCK 4LF4J 3QUTA 3MPUB 2HLTA 3AD9C 1XMQK 3C2MA 5CZXA 1CQNA 3BV8A 3H45C 4YR3A 4AFFA 1KAXA 4FJ7A 1MWMA 1HJPA 5KFWA 1BQNB 2IA0A 2B21A 1CI4A 1D0EA 3PIOL 3IBCB 1U8WA 2ZWOA 4H5VA 1U0HB 5IWAJ 1SJRA 3E9OA 1UVIA 2F8SA 4J9MA 3ZZYA 4CF4A 4GV3A 4I2BA 3BJYA 5J2GA 1SQKA 4NB4A 4F92B 3DDIA 3MF5A 4HUGA 3PIOQ 3NGRA 3TX8A 5J2QB 5ALNA 3OYBA 5KPZA 1RM6C 4UB2A 2DEIA 2VDHA 3QSIA 4NLQA 3CHWA 2XRIA 5EE3A 4W5NA 5AM4A 1ZQVA 1VSFA 3W63A 2Z1GA 4A46A 2WW8A 2HYIB 3ENWA 3KKSA 2B56A 3KLHB 2RD5C 5C15A 3K58A 3RZAA 4XH5A 4WJBA 2IM3A 4CHPA 5A76A 4CM2A 4YDDB 3HP6A 1MDUB 2PFNA 2FPHX 5M2UA 1R59O 3UW1A 1RT3A 5C2GA 1D3WA 2UUWA 9ICCA 3CJ5A 5J29A 4V19J 2AXTU 4YDXA 1QUVA 3SDEB 1EKRA 1FEHA 4QR1A 2MKKA 4CZFA 4W5QA 5J0OA 1TL3A 2HLUA 3CETA 4WE1A 1Z00A 1Y11A 1OIAA 3CO9A 2AX0A 1U1RA 2DHXA 9ICEA 1QVGM 3FR0A 1ZQAA 2WSEC 4DKWA 3IS9B 3AB4B 3CPWM 3SCXA 3WXMB 2CQGA 1FA0A 3HKZC 2HQCA 3MEEB 1AA1B 2CJ9A 4F5OA 5HAOA 4LF7F 1LOTB 1FNOA 4USIA 1S1VB 1REVA 4J5OA 5AQQA 2DNMA 2Q3SA 1L7PA 2ACMA 4ZLJA 2GX8A 2HPUA 4LT6A 1M5KC 3BEXA 1PVPA 4QWEA 2NS1B 4JD2A 4J2EA 4Y2VA 4DFDA 3A5NC 3M5RA 3HHNB 4CT8A 4KHPJ 4X4UA 2O6KA 3R3TA 4R0EA 1PBUA 1NU0A 4HVJA 1QQCA 4UB6U 1RZMA 1BA1A 1MWKA 3SQOP 4PHDA 1MNEA 5I42A 2MQQA 1BI4B 4IG0A 3OGUA 3Q8RB 1RAEB 1RA6A 2LA4A 3NGYA 3ZSQA 3WXIA 3TWHA 5AQVA 4ILJA 2YQ0A 2K89A 2J9DA 4P2HA 4HT7A 1S22A 2NRVA 1FKPA 1ILYA 4C8NA 4FLYA 4R65A 1T3OA 3B8HA 1U45A 3KK3A 2Q1NA 1DLOA 4UARA 2ATQA 2H3QA 3BGFA 3K75D 2K8AA 1LW0B 1U1NA 2V34A 2XICA 2LU2A 5KNIA 3B9JA 3MDFA 1U47A 2XYHB 2RPIA 5DLFA 1LWFA 5CY4A 1RHMB 1JLCA 3DOKB 4KH0B 2BXJA 5T7LA 1JMSA 1YTUA 3FZBA 4E7HA 5AQFA 3GILA 3CO0P 4YR0A 2AGPA 3D45A 4FPBA 2V2KA 3B78A 2KN4A 4KFBA 4X62K 2G2OA 2HFNA 4USUA 1NK4A 4BE1A 2A6AA 1WSFA 5A8KA 4LRCA 4M47A 4TYAA 3TEGA 3SYZA 5LT5A 2FHJD 2LMRA 1QSLA 4U8YA 2EFQA 5RUBA 3LL3A 4FJXA 2B8QA 2HKEA 2EC2A 3CEDA 3ZETA 4WQ4A 1CXQA 2F3NA 3OBIA 4H4OB 4ALZA 3KIOA 2QWPA 2DNYA 2GWJA 4JYAF 4LF9K 2KIVA 1Z2LA 4A48A 2XY7A 4K4YA 3MGHA 2J6UA 2YWFA 3O6QA 3WNGA 1JLAB 3MCPA 2DTUA 4MF2A 1LWCB 1RT5A 1VSLA 2FDRA 3CM6A 4UB1A 2AW0A 1DEJA 4K0KK 4DPWA 3OV7A 4UATA 3KD3A 1WORA 1KQQA 5J2BA 2WONA 3IWNC 2NLXA 5AJ3K 3FYHA 2DXFA 2FZKB 4B1VA 3H3OB 3JXOA 1DBDA 3B6BA 4NPOA 2EZYA 2PMWA 3EUB2 1S79A 2FLLA 5GMKa 3R7SB 4CYUA 5H9EK 2PN6A 3CJSA 1N5YA 2GELA 1WKJA 2BJ9A 4WFXA 3HPOA 4YY3F 2ATLA 2ISPA 3EL2A 3ISBA 3G4SN 1VQMN 1VQLN 1YGYA 2YKMA 2R2TA 3MI7X 2QL7B 4B02A 2QWNA 2YWWA 2P9LA 3WC0A 3LDQA 1VLBA 3ZSVA 1DRZA 1YJUA 1RYSA 3PSTA 2V63A 5JLFA 2OD4A 4ZOHC 3D6JA 4YHHJ 4PG5A 2O66A 4RNFA 3CJRA 1RWKB 4BY9C 5AI0A 4Y0FA 4LH5A 4IFVA 3NDKA 4A8XA 3ZZTA 5FDLA 4ED3A 1VQ6N 3FCHA 5AKHA 3K2PA 5IIJA 4B3MK 4N5SA 5AM2A 3CCLS 1Q81O 4KHMA 3W2VB 1KAYA 1T8EA 3ENOA 5F0XA 1VQ9S 1WEYA 1N48A 1EARA 3ENHA 4ZHRB 4E1NA 2BGGA 5JMNA 3EGVA 3UQSA 3UE2A 1GMUA 1IG6A 3SBTA 3N4PA 5IT9O 4CZMA 1CG2A 3H7IA 5A8RB 2PO4A 5HQLA 3VF4A 2R8JA 3U8XA 4UW2A 1N8RO 2H4WB 4ZLLA 2UUAK 1V5IB 4W5TA 4Z6CA 1JJ4A 5LSRA 2G8WA 4NWIA 3ZD9A 2YQ3A 3TO8A 4LF4F 1RAGB 5BRDA 1ACMB 3SQGA 1WSVA 4KX5A 2R8IA 1HI1A 8ICTA 2W40A 3DGPB 4ZJQA 2QMXA 2QXLA 2PA3A 3TSPA 2C3YA 2RRAA 1PC5A 1Z2ZA 3CD6S 3NVZA 3X1LB 1XMBA 2DHGA 3AH6A 1KLMB 1ZA1B 3HT3A 4OKEA 2J8SA 2RN2A 3W3SA 1X31C 3C14B 2KM8B 3MOJB 1BUPA 2Z2MA 4YDUA 4AHTA 2Z58B 1EX4A 4CF8A 4FS1A 5U47A 1G1XA 3I8BA 3AL0B 4IQTA 4L3KA 3CCMS 4US9A 2Z7JA 3ADAC 2BMBA 1S5LU 3C46A 1X4EA 2E8PA 2YX1A 2HIYA 2C3PA 5ALDA 3PRBA 1U2FA 3QZ8A 3I87A 5K8MA 2P5VA 2J7UA 5B0AA 5K5MA 2YWEA 4LF1A 2V7YA 2B0GA 5TZVA 1VIOA 3QT7A 4J9VA 3E51A 3R5GA 4M6WB 1K73O 2R7SA 2CAJA 4E1MA 4NA3A 4IFYB 1JI7A 4CLZA 2I5JA 5ETSA 3M1FA 3TZWA 2PYJA 5DJBA 5M1OA 2DD8S 4QZHA 1L8LA 1P1LA 2KHVA 3OHAA 3OYGA 3R97A 2BQRA 2B9EA 1RTDA 1KONA 2I2YA 2LXIA 1Z3EB 3THXB 4BR0A 1RWVB 4K2XA 1QZ5A 4BQZA 3VQAA 3NNCA 5ALVA 4FBUA 4F91B 1NWKA 3KMQA 4UZBA 4CLSA 2DGXA 3AVAA 2I6XA 2V8DA 2EK6A 2JMGA 2R2SA 1NBWA 3T5HA 4IJNA 3PLAA 3RH6A 4DFJA 4OJ3A 3S1TA 1D4XA 4QIWF 3KMSA 4C8ZA 3VENA 5GMDA 1RT6A 3CFRA 3K0SA 2CNKB 3MN7A 4IQMA 1VQ8S 4RX6A 5AM1A 2P9UA 2M3DA 2C3MA 3QBXA 3TZXA 2ASYA 3KG4A 2W7PA 3EXCX 3GBTA 2OEKA 3D6HB 3EE8A 4Y6IA 4TU8A 2UU9J 4U95A 4YORA 4G9ZA 1R8HA 1BCOA 1FESA 1Z4NA 2HQ3A 1HBMB 3M2RB 1WC3A 4ZMMA 3O6WA 4FWKA 2M88A 3BP8A 3R8YA 4GKKJ 4OJ1A 3SD7A 3CM5A 3C1YA 3OYHA 5AQIA 4LVNP 4M2YA 3SXLA 3QJJA 1JLGA 4KBIA 3VA0A 4QWDA 4XK8C 1M5OC 4A8KA 2GA7A 4BC5A 1RYUA 2OPPA 3UCGA 2HK3A 1H7WA 3NS6A 5C42B 1KVAA 2CPEA 9RUBA 3QIPA 3P49B 3T1YF 2M8HA 2QN6B 4QIWD 2Z1HA 1RACB 1UAXA 1RT2B 3MM6B 2F4VJ 3VEXA 1F2HA 2JHEA 3VC8A 4R5PB 1BWFO 1R8AA 2C42A 2LYAA 2D7SA 4DMNA 1FWLA 4CZLA 3A8KA 3IGNA 3LQVA 2W25A 2QLTA 2W6LA 5HK4A 2BM1A 1ZQWA 3UMBA 3KZXA 2B4VA 4OVLA 4E1JA 4CGDA 3DRXA 1RWXB 4WP9A 2O3DA 3MGIA 8ICNA 1XR7A 1RWOB 2G8IA 3RUBL 4DR1J 1FHTA 5IINA 3AQOA 1X0PA 4K41A 5HOOA 2M70A 2AD9A 2G8HA 1KL9A 2G2YA 2NO4A 4WIQA 4AP9A 4AH9A 1R0BG 3BQ7A 4N76A 2I8EA 3NNAA 4ID5A 4NXNF 3UDEA 3I55N 1VJQA 3GIKA 1NNDA 5IT9Y 3EKSA 2P51A 1HWJA 1NJZA 1ZQEA 5T14A 8ICHA 2J9DE 2LQ8A 5GAGP 5M2PA 5ALYA 4RW9B 1TMMA 2OCEA 1ZQBA 4GMKA 5CHIA 2GNKA 1BL3A 3GL1A 5BPMA 4FDFA 1D8LA 3TJ8A 4I6AA 1CC8A 2DBBA 1HA1A 3HZGA 3N5FA 4U6PA 2EFVA 2MMYA 1VRTA 3BKFA 3MCMA 2LKYA 3TTDA 3QETA 3S6JA 2OTJN 1IJJA 5AI8A 5ALIA 3J8AA 1FJ7A 4E7KA 1WC4A 1BPZA 2LQJA 1LNQA 4P7VA 2BABA 4CO0A 2CJKA 1R3NA 2AX1A 3AVKA 3S41A 2CQ0A 3ZCMA 3HDSA 3OHBA 2D0CA 2CYYA 2K3KA 8ICKA 3SFUA 3SQIA 2MY8A 2VDIA 4HHTA 5F0WA 5K20B 2EFPA 4KREA 5DDYA 5D0EA 1VRUA 3RW6A 1TKTB 3AV9A 4DPTA 4H0VB 4LFAJ 3MPVA 4C9DA 1RB0A 4ZVTB 4ED4A 5AE1A 4B3TK 4GVBB 3UXPA 3H5SA 3IC1A 4ZA1A 4PXDA 4WJ3B 2UVRA 4UOFA 4JI6J 1GOBA 1HHSA 1EJ7L 1SI9A 2KJ5A 2EWSA 3SI6A 3MM5B 1BNPA 3OTQA 1GO3F 3LANA 3QSYB 3C15B 4CLLA 4TU9A 4M5GA 8RUCA 5J8YC 2NYVA 4ELTA 4XPCA 4A2BA 1KTVA 1N36J 1FFGB 3R1LA 2R2RA 5AM3A 4M5LA 2CQ3A 4U7UK 4BRIA 1ECWA 5IT4A 2KSOB 1F9FA 3QEAZ 2UP1A 2D0BA 3U1LA 1YJNS 4ED8A 4WQ5C 5THWA 2UV8G 3IKMA 1NGBA 1C0FA 1CZ9A 3QJPA 1CS4B 2C2DA 4IOCL 4BROA 1T7PA 1TMJA 3Q8SB 1ZQSA 2RRDA 2JC0A 3LA0A 3MMBA 2N4CA 3MEDB 4Z2XA 1NPRA 4I69A 4OV1A 1YI2N 3PFEA 4CDGA 3NCPA 3QBWA 4IOCQ 3VTHA 1FJGK 4CJEA 2KTQA 1HNVB 4OKJA 4F0KA 1T9UA 3A8YA 1RU2A 3GJRB 2VFRA 3CJ0A 1GNKA 1I6JA 5HP1B 1GAOA 3V9ZA 3WBZA 1VSHA 2OP5A 1WTFA 2HF4A 1MG7A 1XNRJ 1GLFO 3CC2S 1BLUA 1EKEA 4PWUA 2FF3B 4CFAA 2JNJA 1ATSA 3Q86A 1ZQTA 5D46A 1RQNA 2V9KA 3DRYA 1NSQA 4IUFA 2XS5A 3V9WA 1RNHA 4F4YA 3B6OA 3M4XA 4ACOA 4RW6A 3G10A 1FFUA 1FI4A 2DNRA 1ZQCA 1X4GA 3FSIA 1H38A 2FMSA 8ATCB 2YNIB 2N1RA 3F2CA 2CJQA 1NGHA 1U2VA 8ICFA 1W25A 4BGAA 3CP8A 5J2IA 1FJEB 3DXKA 1Y0HA 3P1GA 3R1XA 4BRPA 3M30B 5KGWA 2OSQA 1HBOA 5GAGI 3O1LA 1URNA 5DB7A 4EIAA 3MXHP 1TKDA 4YMEA 3K59A 3GZFA 5A2QO 3M1YA 1DTQA 1RLDA 4KHUA 1RBUA 1NAQA 2ZOFA 1KWMA 1TKXB 2V50A 2MKIA 2M9NA 5KFZA 4MIWA 2RQ4A 3SUNA 4NI2B 3VAGA 3C1ZA 2V6AA 3SUOA 1B7YB 3GU0A 7ICSA 3HPHA 1JLEB 1RKIA 3ZD8A 5DKWA 7ICQA 2F1HA 4PQAA 2KG0A 4B3OA 1HHQA 3CI5A 3MM7B 1BNOA 1QSSA 3OYKA 1ZM2A 2CN1A 2IVFB 3L3FX 3CCES 4OHYA 3T3FA 1RKJA 4X2BA 1M90O 1RAJA 2ZXIA 1PAEX 2CVIA 5GAHU 4ECQA 3MGJA 4PZVA 4ES3A 3M2VB 2VGMA 2XNQA 4KI6A 4YOTA 2P9IB 5J2JA 2LDYA 1SKWA 4C2MA 2IVNA 4CHYA 3FQKA 5FPMA 3OTOF 3M9OB 2W11A 4A5AA 1S6PB 4C4RA 1GLBG 4XRHA 4DS5A 4KPCA 1SJ3P 2YNHA 4JOUA 2DITA 3UPQA 3TACB 5ETTA 2ASLA 4OL8A 5AZJB 3HSJA 4M5IA 2KN7A 2XEXA 3QIOA 3NMRA 1S0VA 5AI4A 1BIUA 1P7DA 4PG7A 2IHR1 4O3PA 1ZXOA 1B7FA 2Q2RA 4W5RA 1N33K 2QTDA 1HKAA 2CZ9A 4NA2A 1HYVA 2R7WA 4DTPA 3NWGA 2E1FA 2ZZTA 2GQCA 5D3GB 1JJHA 5KFUA 2ADCA 3F9KA 4W5OA 3AFGA 4GKJF 4C4WA 3IXQA 4FLUA 3V6DB 1ZQLA 3SAHA 4JWNA 4DR1F 2PEHA 4DX8H 4ECWA 1ASUA 3BR8A 1RDWX 2E5IA 3P4IA 3K4GA 3O2IA 2YPZA 3DRRA 5HVGA 3B4MA 3L6QA 3VCBA 2KOBA 1ZM9A 1Q7YT 3OBYA 1TKZB 3VQ5A 2MXYA 4DV5K 4LF8J 2MAXA 2BHNA 4DU3A 2NNWA 2ROGA 3QU5A 5AICA 2FLOA 4QBUA 2X51A 4QZVB 4B3RJ 3K9KA 1ITGA 3PKYA 2P9CA 4JAXA 9ICTA 2P6UA 2VKRA 2R8HA 2XO6A 7ICHA 4OX8A 4FF3A 1JLFA 3GU3A 5L1IA 1UEVA 4ANCA 4NCGA 1H74A 5D6GA 1BPYA 1K47A 1S6UA 3CFPA 2LU1A 4P4MA 5CHGA 3H0MB 3BM7A 3EUNA 4PPZA 2DO4A 3WNEA 3RB6A 2BKNA 2CXYA 4YFKA 1LOUA 3ULEA 3FJ2A 4LBPA 3BSOA 1ZQJA 3MMVA 1S1UA 4TLQA 2HNZA 2F40A 2YB4A 3AM9A 1UW4A 1WC1A 4Q8FA 3BQ0A 4WFZA 2GJ2A 2IJRA 2F77X 3VGLA 4AL6A 1L7OA 3QPIA 1Y3JA 4PR6A 1DGKN 1YJ9S 4AM6A 4BRMA 3UI3A 2BW7A 4OHVA 1TL3B 2HVDA 2CPFA 4DR6K 1VSMA 4WE1B 1Z00B 2Q66A 3KJFB 2WRMA 4XA5A 3EO3A 4ZP6A 2KXNB 3NLCA 4LF5J 1N36F 4ED2A 4B9VA 2DNGA 1T94A 1S57A 3IGVA 5HVFA 2XY8A 4J7CA 4BR5A 4P74A 4IH5A 1GXUA 4WKYA 2UUCJ 1ZC6A 4ELUA 1L3VA 3B54A 1RBVA 3CCRN 3AB2B 2E1YA 4PY5A 4MKAA 5LMNK 1MA7A 3DNCA 4OJ6A 1EP4A 2LQBA 1REVB 1T9YA 3I0SA 2V7ZA 4R8UA 2IRXA 4PCQA 3G71S 3ZSXA 2NRXA 3FBFA 4RW7B 3VAJA 2Y3YA 2XZWA 2C28A 1UVKA 5IT9U 4JD2B 5E3AA 2CPJA 2WK4A 2WB4A 2ROEA 4TUPA 3CCZA 2QV6A 2MZTA 4PXEA 6AT1B 4OI0A 4RCHA 4AYBC 2W9BA 1U1KA 2OMLA 5I42B 3EVMA 2UXBJ 2YX6A 4AQYF 1WAFA 3GSDA 4IG0B 5D77A 3VEOA 1QE1A 1RWNB 1AB8A 3I4PA 3F56A 4USMA 4JI5F 3VQ8A 1L8OA 2QB0A 3CJ3A 2E8MA 1LAVA 3NP5A 3P5TL 1FKPB 4C48A 3CVKA 3GJSB 1W7AA 8ICOA 3NGSA 5EUHA 4AL5A 3OSNA 4OHXA 3KK3B 1DLOB 5KT2A 4EK2A 2LEAA 1V85A 1LQ9A 2KYXA 2EFGA 3LK9A 5A2QY 3MR2A 5AQRA 3SCIE 5JICA 1LWFB 1JLCB 2HHTA 2FGCA 4MO5A 2J8AA 2QL5B 3AA9A 3BREA 5T7LB 2DR9A 1B4SA 2B4UA 2W7AA 4CESA 3QT6A 4Z0UA 3DAWA 4G9BA 2HBKA 5ALEA 1J27A 4YY3K 2HFUA 2HOIA 1Y4ZB 5DK5A 2GAGC 2UUTA 4KFBB 2RS8A 5HRPA 3LM9A 5A8KB 4MQ3A 4ZH4A 3AVHA 2BE2A 4MYTA 4UBBA 4Q8EA 2GMHA 1T9WA 2R7QA 4FVUA 4FCYA 3CB4A 3IDHA 1YVNA 3QYYA 2IDEA 2KT2A 3ZETB 2DNLA 3M8RA 4B1UB 2IVYA 2NXEA 4J9UE 1BUXA 2QLXA 1BMQB 2O4GA 3RJHA 1JJCB 3BGRA 3THPA 1N60A 3ZO7A 1YJ7A 4CJWA 4F25A 2KXFA 1IH7A 4CH7A 1PVQA 3LZIA 1ZQUA 1N5WA 1L6NA 1RT5B 2FUG9 2G13A 3C16B 5KRTA 3TQ1A 4O4GA 4OX9J 5LJVA 2WONB 4U8VA 2GBZA 4HLBA 2KXHA 1AXQA 1YJTA 2HRYA 2DCUB 2NREA 5J1PA 2F1IA 3KHGA 4F0HA 1LAWA 4CYUB 1N5YB 2ZZNA 4WBFA 3FCVA 4CLWA 2D8CA 5HMYA 1ZQZA 3ULDA 4P2MA 5EE0A 3MECA 1M5PC 1QQ6A 4BXOA 4KQZA 3QX7A 3DOLA 3HJFA 5D4LA 1IN0A 4Z6FA 4M5JA 2O8DA 3OA9A 2FPMA 2P9LB 2E5LJ 3PW5A 4M3WA 4DHVA 1K44A 3K8VA 4JK9A 2MKHA 3H2VE 4HEA9 1G6BA 1NPPA 4W90B 2GWSA 1KKXA 3WX8A 4IFVB 5FDLB 2C2EA 3LOUA 2KZ3A 1SZ2A 2Q36A 2IVOA 3OT9A 5B0CA 2CGLA 3ZZUA 3IUCA 1FDAA 3D2FA 1QDUB 3F0NA 3TSUA 1C7YA 4EP4A 1NGCA 1VK3A 3CDEA 4KH6A 5K9FA 2I6WA 4OJRA 4DL2A 3UQ0A 1QAJA 1X4FA 3UD4P 2ERRA 1HWIA 4V19X 3VVTA 3SQGB 3QEIA 4LF8F 4KLJA 1DGJA 1NDCA 5BYRA 3RJJA 2EK1A 4GV6A 2GIFA 4WXWA 3BQ2A 2VFUA 1REGX 2WAQC 4FKXA 1UWAA 3SPZA 5D0GA 1IBKJ 5M1NA 4ZTJA 4JB8B 2J6SA 2ZC3A 1WSEA 1GLLO 2DFLA 3VAMA 1IWGA 1AYEA 1FWPA 4JV0A 4O4RA 5A0YB 4LH4A 1F5BA 1Y64A 3RMDA 1RT7A 3NH2A 1EETA 1S99A 1U49A 2HHVA 1S7HA 4C8YA 5AI9A 5DM7Q 3CMAN 5GAGU 3C94A 2POKA 4FLTA 2XG8A 3D2NA 3CCSN 1CZAN 4LBIA 3QERA 4OJHA 2ZUGA 4JI3F 1XC3A 3MN5A 5ALTA 3K5PA 2IY5B 2DNOA 4KX3A 3EZOA 3VERA 4KLLA 1JXBA 2GHPA 1NKBA 1FFWB 3CMES 2VIHA 2KEYA 2I5JB 2CVEA 4FO0A 5G5GA 4MLHA 5J8YA 1NOMA 1N56A 4DG1A 3H8SA 4L76A 3CGIA 3L0QA 4DR7J 3SMPA 4HR2A 2VUGA 1F5CA 2XVTA 1AROP 3TW0A 2OJ3A 2WBRA 3BBFA 2HIQA 4K7QA 2O5DA 4ED5A 4JV1A 4DUYJ 5AK4A 4RQ7A 4BDPA 4FOEA 4CF2A 4WQ5A 3EICA 4UB3A 1JCFA 3EKUA 1UQVA 2RVJA 2CDRB 1VQ7S 1DQ8A 3OYIA 3BBBA 3JAMU 2R8KA 4RPYA 3ZYYX 4LFBK 1M5SA 4DR2K 4CWBA 3GIRA 3W64A 3GP9A 3PV8A 4EAHD 1U6BA 4E19A 2DR5A 3BY5A 3C28A 1COOA 2ZHAA 1CJTA 3DLKB 4OLPA 2B9YA 1VQMS 2P9UB 4HI2A 1A7GE 3J7YP 3IWXA 3MXMA 5B66U 2ZH3A 4NMXA 1VQSA 4RQ3A 5BXIA 2VZ9A 3SJHA 3ZZRA 4Y00A 1VJWA 4FWMA 2F9JA 4DU1A 2MRLA 3TI0A 3M6XA 2ZNZA 1ZD5A 3AVFA 1YRUA 7ICUA 2FSKA 3BGOP 4ILMA 4EFAC 2H3ZA 4JI1K 3SPYA 2C2MB 2DHSA 4YEAA 1VQ6S 5AIBA 5J0PA 4K4UA 2OAUA 1P27B 5FIIA 3T5KA 2WVBA 1XQSC 3OYLA 1IKXA 2VH7A 3ZTQA 2MQ8A 1DARA 2HQDA 5DMRA 3WXKA 1HNZF 5AIAA 2A3VA 3LP1A 2F5GA 2LCWA 2KVQE 5I3PA 4M3RA 1B0TA 3Q22A 3BEGB 2DPJA 2WFBA 1PZNA 1JKHA 2OPPB 3FVYA 3O5TB 2E20A 4KMOB 4RBUA 3CW2C 3QIPB 4NXNK 4C7QA 3K5LA 2EDUA 4CGFA 5T41A 2M0GB 1UP1A 5AE2A 3NVVA 1Q5YA 1W2IA 5JS2A 4YFUA 2G08A 1NMEB 3N9UC 1BOTO 3BDEA 4FWOA 2VJ4A 1ZJMA 2ZUCA 4DF8A 1VQPN 2F8EX 1QQ7A 5H9FJ 1WDDA 2JEJA 2BQ3A 1HNIA 2UXCJ 2JVRA 4ETXA 4Y2UA 2Y1IA 4OQJA 2KP7A 2XO7A 5HVHA 1XMQJ 2XGQA 4DJBA 2O4IA 3BPSP 2XWXA 2H5JB 5J0YA 3HK2A 4AF1A 4QPTA 2YV0X 4QR0A 4JV5K 3RG6A 1NNEA 3MX5A 1CZBA 1SV4A 3IDWA 4BRFA 3V9SA 3O44A 4OZ1A 3EPGA 1YBAA 5CE3A 1T9VA 1MN9A 4F5RA 4UOGA 5ETVA 3MCNA 2Y1JA 4WPAA 1U6ZA 2E5JA 2A42A 1KVBA 4X66K 2DJWA 3D2WA 4NRUA 2VPZB 2IHMA 3G0ZA 4UY8O 4ID5B 5DB6A 4IEEA 1Z1BA 3LPYA 1A9NB 1YF5L 5IQ6A 2ZJPQ 2AJ0A 3ZNUA 5ADZA 4UUWA 2ITMA 4I4BA 3GV7B 1KXPA 2YCHA 5DRKA 3KJNB 4LVSA 4FJNA 3BS5A 3QINA 2FPLA 2MKSA 4UBCA 2PFOA 1HQ2A 2CNOB 3QT5A 2N82B 3H1QA 8ICCA 1VQNN 4DV0F 4U9RA 5BR9A 3VAIA 3MC1A 2EPIA 1VRTB 1SS6A 2MJNA 2AJFE 3L9ZA 4CI6A 3UD3P 4HTUA 3SAGA 2HDOA 7FDRA 4S0MA 2YMMA 1SH0A 2HNYB 2HCFA 2A5XA 3KD5E 4XEIA 4I2JA 3NRBA 3ZZ0A 3J7YI 1FNMA 3HXMA 4FJ8A 4RZRA 4DSEA 3G9CA 3L2WA 1VRUB 4H4KC 1IG8A 4RQ4A 3FRZA 1VSDA 4QAGA 2QARA 4FJ5A 2AZ1A 2MQLA 2L41A 5DS7A 1DRGA 1RILA 3AGRA 3SCLE 3GIJA 5C2DA 3VCDA 2KHOA 3QUQA 5I3QA 1NHKL 5KAFU 2VBYA 1I51B 4A61A 1S6OA 1CJVA 2JL9A 2JX2A 3A3PB 4DFMA 1GX6A 3NS1A 1Y3KA 2V5HG 1JJ2R 4ZIWA 2WF6A 1S9EA 3NBPA 5JVGQ 3KD1E 3QEPA 4WP8A 1HYZA 1XC9A 4QS9A 4BR2A 4JK8A 5KG1A 3BKTA 4CO1A 5JVHL 1ZQHA 2LYHA 4UUXA 2AEFA 4B3SF 1IKWA 4DUTA 2PI5A 2BVZA 3CCQS 1HKBA 4QPXA 1OWXA 2GHWA 3MK6A 5DDQC 2MGZA 1G7CB 5A6PA 3FCWA 2H5XA 3W65A 3MMBB 2OTLN 4DR7F 3GV5B 2M5YA 4DV7F 2BANA 4FM1A 2NCKL 4LIRA 3U27A 3AA4A 2PSZA 4IWVA 4DUYF 4XUSA 3NGUA 4X62J 3CRXA 1WNEA 3DN9A 2F76X 2MSNA 2W4CA 4DI6A 3HRDD 2DPNA 3VWSA 1WEZA 2YTUA 4I2GA 2BPGA 4XPEA 8ICYA 3BO3A 1F0MA 4WZQA 3O1WA 3M7VA 3FZKA 4Z4GA 4L6V3 4JB3A 3O3FA 3P4UB 2RQ5A 1FE0A 2ZD1A 1TTHB 2EVZA 2YNGA 2FVPA 3CD0A 4LF9J 2LKZA 3L2RA 1FRJA 2GH1A 2CUYA 3A2FA 4FW2A 1DTTA 2OANA 4CJ4A 1X66A 4A2AA 3VZHA 4DTSA 4RW6B 5MAOA 3TP2A 3OTOK 4Y2JA 4K0KJ 2L9NA 2KG5A 4IKAA 3MPYA 1U2VB 2QLFB 5F9LA 4DLEA 5AJ3J 1ASVA 2RKIA 1JMTA 3IMXA 5F8LA 1L7NA 3DXKB 2IBKA 1N5SA 1MWZA 1HBOB 4DR4F 2HSTA 3ORYA 5H9EJ 2HVZA 4KGZB 5ALKA 3KFUF 3ID6A 1RAHB 2C2KB 1DTQB 2FB0A 4OV6A 5BR8F 4K50A 4FYDA 3AY9A 5J2HA 5AKJA 2E8NA 3OTEA 3SQ2A 2JWLA 2VFSA 2W8LA 3D0PA 4GKJK 3GE1A 1N2XA 2DK2A 1NZ8A 3CNQP 3FSXA 1R31A 4DL0C 4B3OB 3O9RA 4ILLA 4CJSA 3B82A 2GVZA 1D5AA 4QWBA 1PGZA 3P39A 5E0OA 2JWKA 4USVA 4X4NA 1XJWB 3FC4A 4B3MJ 3OVBA 3KLVA 5LSLA 2O8BA 1RBAA 3UVJA 3MR7A 4V1Ak 1CRXA 1UCVA 4EO6A 4YXMA 3QEWA 5F2RA 3JPOA 1YHQS 4QU7A 4OYPA 5CYMA 3H3NO 5BPCA 2YNHB 2HMPA 2WVFA 2G07A 5B8HA 2VASA 1KEKA 2VOOA 2FMQA 2X6SA 4B8CA 4QZAA 4F2SA 4PPXA 4CP5A 4NLGA 2E8AA 2UUAJ 4NL9A 1BWVA 4YOWA 4JKEA 3BS7A 3FNNA 2UXCF 4DX5A 3DKDA 1WOSA 2E7VA 2HMIA 3PSFA 1XMQF 1WACA 2R42A 8ICEA 1BY9A 4BHQA 1Z26A 3UXNA 1PYTA 1QY7A 4P72A 7ICEA 4N47A 5DQGA 2R2UA 5KFKA 3KLGA 3H6EA 4KGKA 3ETMA 2FSNA 2QM1A 4QZGA 2YWGA 1HPZB 4K5RA 4M5KA 2VJUA 4A5BA 4ZVRB 2G0JA 3WK9A 1N34F 4DTOA 2DWQA 5D78A 1JIHA 4EWTA 1N32F 3DRRB 3QB0A 1V5VA 4MFBB 3CCLN 5AI6A 3UR3C 3IO1A 3C2KA 4YNQA 1VQ9N 1CLFA 2LHTA 2N7YA 4L75A 1ZBHA 1FXLA 1S0MA 3TUIC 2LVWA 4CIOA 1DK3A 3BZKA 2HHSA 1ITPA 4H4MA 3MMCA 2UVWA 1MROA 3EGZA 1FX4A 2JC1A 1S0NA 2MB0B 4EZ9A 4IR9A 2BE7D 3TKAA 1IKYA 4TQRA 3TARA 5ETRA 2OMOA 3IRWP 2YB1A 2FJ6A 2ZIWA 3C2LA 2M7SA 2D0OA 2XHCA 4USHA 1K9MO 3NKYA 3QGGA 2A2DA 4RPXA 1JLFB 2F8HA 4ZJOA 2JEFA 3EZUA 3CD6N 4NCGB 1IXRA 4URGA 2G4BA 4MJKA 3FAHA 3LGMA 2Y0SC 5ADXH 1SKSA 1SV0C 2RP5A 4TXSA 1I3AA 4DPYA 1KSPA 3CCMN 4FZNA 3ULEB 4JI7K 2EX3A 3PEJA 3IRUA 2RUGA 4ZVHA 4YMMA 2Q0ZX 4O8UA 1S1UB 7ICTA 4BBYA 2HNZB 3JSBA 1EKSA 2OZMA 3C66A 1PK1A 4AQYK 4K43A 5L38A 3U7JA 1NM1A 2OPSA 1HLWA 3VHQA 4JI5K 3C7NA 2MLXA 4EUVA 3TUJC 4DLGA 3W5YA 3NE6A 1OMSA 1AQ6A 1X9JA 2GS8A 4RJVA 3TJ9A 3QU2A 4A8EA 2W9CA 2ZBIA 2UUBK 1CULB 2D3UA 3G6ES 2NV3A 4O3QA 3ETLA 2J5AA 2E29A 3Q8PB 1LFPA 2RRNA 5AQWA 4DV4F 2EWHA 2I9SA 3N4WA 3QWPA 3VMFB 3V2UC 3I0SB 4R8UB 1GMWA 4A62A 4LR8A 4F36A 1BWEA 2VV5A 5EN1A 1DQAA 1FF2A 2KJ9A 3JQKA 4KGXB 2IJNA 2VA3A 2IBOA 5HSPA 3CDWA 2W9BB 2ROPA 5AI5A 5KFDA 3WX4A 2KHQA 1YZ7A 2VB6A 1X9MA 1L3TA 4KH4A 3NGDA 1QE1B 2ZKTA 5EY4A 1UCNA 4I7FA 1K8AT 3I82A 4RKUC 2QK9A 4JI2K 2QB0B 3PX0A 4MO4A 4KHSA 5ALHA 3MEGA 4E7LA 4OZJA 2YH0A 4CGHA 4WFNQ 2F65A 3UIQA 1U02A 2PXIA 1B0VA 3OSPA 1WCNA 1CLQA 4NWBA 1AUDA 5HNKA 2DFFA 3D28A 4MDAA 5E84A 1KEJA 5AQKA 3FFIA 1J5EF 4NEZA 1NU4A 1JJ2M 3KOOA 3ZT3A 2H5EA 1DOQA 2NSCA 1K8AO 5AJ3F 5L1KA 3LAMA 4RQNA 1IKVA 1XSNA 3AOAA 3V1RA 1Q86O 3R5DA 3WQUA 2BE2B 2BR0A 3FKBA 4HH1A 3SNNA 5J2MA 2YHWA 3OQ2A 2K1RA 2RU9A 1QQOA 6FDRA 1CJUA 3OTCA 3OJSA 3KWMA 2CPRA 2W4DA 3TAPA 3AODA 4DEZA 1O1WA 4DV3F 3BGRB 2B3TB 4E7JA 5ETMA 4FWPA 4ZOSA 5BPLA 3CUNA 4C3KA 1H2TZ 4WZMA 4CLPA 1JLBA 3D6TB 4IR1A 2IOCA 4ECTA 3I5BA 4LSZB 3C3LA 2GGPA 4O4GB 2FJVA 3A8EA 3HI9A 4I64A 9ICIA 4WFAL 2FHMA 1B4FA 2KRBA 3VZIA 3TR8A 4E0DA 4B3MF 4EHTA 9ICBA 3NF7A 4KO0A 4EX7A 1C4CA 3EWGA 2ADBA 3HZEA 4MFCA 2V8VA 1L5UA 3U6FA 2Y9TA 1SQGA 5AFUA 4FJLA 3C0BA 2L9WA 2CPXA 2R3VA 3BYPA 3C6UA 2HGNA 1VBKA 3MN9A 3MECB 3QAUA 4JS5A 3EX7B 5IOLA 4BXOB 2FHOB 4HUFA 3S3MA 2IVMA 3DOLB 4NZ6A 2UUAF 4Q5VA 4PG8A 4AILC 1COKA 2CZVC 2O8DB 2BOPA 4C4SA 3RB4A 3D66A 2W2QP 2DRBA 3PJWA 4I1TA 3S7RA 2RLTA 3M1VA 5LL6d 5I9EB 5ALSA 2DFEA 4USKA 4J2DA 2W54A 1KOHA 2BW2A 1WTBA 4N41A 1KNZA 3T6BA 4B3TJ 1S9GA 3F53A 3BZCA 3CCRS 4DV2J 3J80O 5ALMA 3LP2A 1BISA 3CJ9A 3ZZOA 4OYWA 3D2FB 4BRNA 6FD1A 3P38A 4JI3K 1FKOA 2W4PA 5BREA 2WW4A 4OZ2A 3OXLA 4H03B 4YS2A 1X0FA 2H51B 5AQSA 2ETJA 4CNZA 2FHKA 4GLXA 1VLYA 5KT6A 3U9DA 4CVNE 4CHZA 3R5CA 4OHWA 4IBNA 2DYAA 3EE3A 1TELA 2V4RA 3H7HB 3NCIA 3LVWA 2HEKA 2JH3A 3M6WA 3H0PA 1UPHA 2ZBPA 2B7CB 3HHLA 2DEJA 1P9QC 1TU0B 3K5NA 3UE5A 4Y2KA 3N7SC 2X6NA 3KHRA 1OUQA 4KY3A 3BGLA 3UQ2A 2YPYA 1EX8A 5HJXA 2NRTA 4NYZA 3PTWA 2MPUA 4CZHA 5D4BA 1OO0B 2BJDA 3Q8YA 2DH8A 3DLRA 4CHOA 2OD6A 5LY3A 1A76A 2KNJA 2A6OA 3J7AN 2M52A 1IBLK 2KU7A 4OGCA 1M0SA 1HW8A 3TUZC 3PXGa 4NLDA 1FJGJ 1RT7B 1EETB 1Q79A 3O3GA 3TJAA 4DCOB 4B9UA 4H4KA 1C0GA 1U1OA 1RWUA 3DDNA 1T4GA 1WC0A 1EQ0A 2O8FA 4H0OA 4CJ7A 4RT3A 4ANDA 4F4AA 4YOUA 5AXNA 1ZBSA 3DRSB 3UMGA 4DUZF 1OH7A 4FNHA 2B7BB 3UKUA 1HIYA 2B6AA 4NLPA 1G15A 3N7PD 1APSA 1SL0A 1YJNN 2I1RA 3NEKA 3UN2A 5IWAK 4DG1B 4DBQA 4XDDA 4YVZA 1T05A 1XIQA 2A10A 4LD0A 4A47A 4DB3A 1WG8A 2D1CA 3AXMA 4FKYA 5AQTA 2Q97A 4FWLA 4WFYA 5ETLA 4CLUA 1HR0F 1HNZK 5IQQA 2ZH4A 2ZH2A 4KI4A 1SVDA 1ZQKA 3HMJG 3MUVP 5CZ1A 3V6KA 4F3OA 3SEOA 2GIQA 4YD2A 1J5OA 2CQ1A 2P9PA 3OYFA 4M42A 4M5HA 5L39A 3NRWA 4JHDA 2A18A 2C22A 3BPDA 1RHKB 4KHWA 4O0JA 1YXQA 1U6FA 1CJTB 1RQLA 3ZZPA 3K57A 1PVRA 2MZRA 4KMUA 4ZPCA 3CC2N 1Q1KA 3QGIA 2DBYA 3RWUA 1SIZA 4USWA 3IHQB 2FVCA 1X3MA 2HFSA 2CRXA 5AKYA 1B99A 1RBRA 2YHYA 2NXJA 1I1GA 2XB2D 5F8JA 3OUYA 4A57A 1YLXA 1T0TV 3LPTA 1FIQA 1HQEA 2H9ZA 2KE7A 3I32A 4PG6A 3K5OA 1FDBA 1QVFR 2JH7A 1ZQGA 1IKXB 2ASJA 3ZTOA 1HQUB 4CEQA 2BPCA 1QQ5A 5ETKA 1NGIA 1L3SA 3AY0A 2J0SD 3LP1B 3PW7A 2QWLA 4X4VA 2ZTEA 3IG5A 4MKBA 1R8BA 2C1EB 2CQIA 1LCUA 5F8MA 2CFXA 1JKHB 3A5OC 5HBMB 1RSCA 2X74A 5ALXA 3HM8A 3KDNA 2WOMA 3NGKA 3KUEA 2QO3A 4YDUC 3RAQA 3PSIA 3CCEN 2ASDA 4ZPBA 2CRLA 1NLKL 4ECRA 3RH5A 1NPKA 2ZZMA 3KWIA 1SKRA 3FGUA 1RQ0A 2EBGA 1X9WA 1IIPA 1NSAA 4DV0K 3C19A 3LPEA 4KN4A 4DV5J 3SCJE 1VK0A 2Q31A 1NG9A 3UO0A 1C0TA 4QOTA 1M5VC 4Z4FA 4KH1B 3M05A 1EWQA 2UVUA 2FIUA 2YN4A 5DQHA 4ED6A 2W3RA 1RADB 2QEXS 4BS2A 1O5JA 4RW8A 2WF8A 4DWIA 5KFCA 3A3NB 2E1EA 3BF4A 3PACA 3RW7A 4KB0A 5BPNA 1KFDA 1ASWA 2ZBCA 4Q0BA 4ED0A 4X4OA 3J80Y 1AFIA 1KBUA 2VJVA 4LF7J 2HF3A 4FL9A 1V3RA 2U2FA 4EBDA 3QDKA 1LW2A 5F1XA 2B6GA 2ESEA 2XWYA 3TFSA 2K8CB 1KC8T 4DX7A 1RK8A 2GCFA 2KVSA 3KLFA 1GTEA 2W55A 2HFOA 3S6EA 1HNWK 2XSFA 7ICKA 2NXUA 2MLYA 2CGJA 4QW9A 3AO2A 1VC5A 4XTTA 1VC6A 4CK1A 3FBEA 2PYLA 4B9NA 3BS5B 4P4PA 3M8WA 2AKWB 2MZQA 4B3TF 1FRHA 1JXEA 4G1QA 1NK9A 2I9GA 3W61A 4DL6A 4NLTA 2ZH5A 4BE0A 4CLTA 1MMLA 4K4TA 2ZUAA 1KN6A 1ZBLA 2XM3A 4O3RA 3ZSRA 4QNLA 5JLHA 2EZXA 1KRPA 5AT1B 3JS9A 1U1PA 1RHJB 3OYAA 1XWLA 1FERA 1KC8O 3NHGA 4WU3A 4UZCA 2APOA 4B3SK 4DR6J 1KHVA 3CCJS 1EHWA 2Y8YA 1I94F 1W2BM 2J7WA 5HROA 2HVEA 3CXCM 1PK3A 5GVQA 3CQYA 3THWA 5KG6A 1TL7A 1WI8A 1SC3B 1NKCA 4DV7K 2G0CA 1TUWA 4KAIA 2BCQA 4C8MA 1S1XA 5LMNJ 3O9QA 3F2KA 2QARB 2UVVA 2A2CA 1RDFA 2CA9A 4PHTX 4X65K 3OL7A 4CLFA 1SV0A 2DUYA 3JSMA 3T7ZA 1WKKA 1CJVB 5HATA 4NO7A 5AQPA 1TL4A 3WUHA 5FPEA 4GVLA 3HD1A 3DLLL 4UAYA 1FJGF 3MMJA 2PFQA 4M63A 4KTZA 4HTJA 4Y28C 2HZCA 4UW9A 1S9EB 3NBPB 4JYAJ 2D9OA 3EWAA 1YJ9N 5KG2A 4XIUA 3GB0A 5ALQA 4MFAA 1HL6A 1CQMA 5IZHA 1FD2A 2IYGA 2YMPA 1FCAA 4CI0B 3FBCA 2HSEB 2P66A 2MA1A 3D67A 3GONA 4JI4F 4FZVA 3CMQA 4GO7X 3I56S 1JL2A 4CM0A 1IKWB 4BC7A 1Q8KA 1VCTA 2BCRA 1PIEA 1WOPA 2J4RA 1ZRNA 4DR4K 4YR2A 2ILYA 1A0PA 4ISGA 3HI0A 5DM6L 2DY9A 5K8OA 3RYLA 3O3HA 2BANB 3BBCA 3G71N 4YY3J 2ZJQQ 3ZEUA 4FZXC 3R27A 4X4TA 1FXXA 5BR8K 2KLAA 1LKYA 3UNGC 2IVPA 1R6VA 4QZIA 4HDHA 2XMAA 1Z4UA 5DM6Q 3ILOA 2Y1RI 4CH1A 4GMJB 2Z56B 5DZ7A 5KT3A 1T9XA 1BPDA 4GXKA 2DO0A 2OUGA 3KG0A 2CJBA 1VQ5S 2ZD1B 3FLCO 2JLEA 2YNGB 1WD6A 2CJYB 2Y9UA 3N6MA 1X6JA 4TUSA 4X84A 1DTTB 9ICOA 2VQEK 3UKRA 1V6HA 1VRQC 2RHQB 2MUTA 1Z19A 2FC9A 3TSQA 3HVWA 3JTNA 1O51A 5KT7A 2HHWA 1VBYA 2PD1A 3SQ0A 5HHHA 2QKQA 4JS4A 3SR6A 2RKIB 1CSJA 1MC8A 4Y2XA 4IOAQ 3MUTP 3ENBA 4FVMA 3ONQA 4FLXA 2PBDA 5FRNA 5ALFA 1RDCA 2WHEA 4EBEA 2IHNA 3CG7A 1NLVA 2DY4A 3I9ZA 4CFDA 5SZTA 1VQNS 3SMZA 5J0TA 3HFZB 3HHKA 4YUDA 2OIHA 4DPOA 4F5PA 1NKEA 4ZN3A 4FWRA 2W2NP 3VF6A 3L8BA 3DLJA 2HHHK 1UFLA 4KLMA 1FT8A 1RISA 3NGZA 1N34K 3KJQB 1X5TA 5GADU 2KFZA 2WVEA 2VA8A 2R7XA 3VQ6A 1GTHA 1N33F 3RVCA 1YWXA 1N32K 5DB8A 1X5PA 1X4CA 2B9WA 5ADXA 2GVZB 2MDAA 9ICFA 1FO1A 4PKGA 1FVQA 4X64F 2D5RA 3CIMA 1R0AA 1DAXA 3FZFA 3D2SA 1K1QA 2O8BB 3UVJB 3I4HX 1TQLA 2VG6A 2GZOA 3VOVA 2IIRA 3IR5B 1NK6A 1TZ0A 5DGAA 2DNPA 1S77D 1GLAG 4X4SA 2WSFC 3THVA 3OS1A 2PAVA 2U1AA 4YN4A 4DTNA 4QQBA 3C2PA 5FLXO 2QWMA 4XAKA 4M5NA 2NSBA 4NL5A 3GJTB 1BPXA 4RLEA 4BC4A 2ZH9A 2YHAA 3QUBA 3I0RA 5E3QA 2CZ4A 4DV5F 2HMIB 2NXCA 3NNHA 3AU6A 3H4DA 3G25A 1ZPVA 3L2UA 1OPZA 4USAA 3A5LC 1OPIA 5SUHA 2DPIA 3KLGB 4ZP7A 3GZ7A 3N4MB 2DXEA 4GXIA 3UR0A 3OS2A 2HWTA 2JR5A 1J54A 3KKRA 1R6YA 4OZ3A 4CJTA 1SXLA 1JALA 4Z7YA 3MWTA 2XHWA 3I5AA 3E01A 8ICXA 5ALLA 1XTZA 2OTLS 1F2GA 4XQ8A 5HHIA 3TAMA 3GSIA 4R0JA 2HWHA 1M5HA 4BCAA 3KHLA 3ICLA 9ICJA 1TVRA 1YK9A 1YBTA 2E1PA 4H4MB 3MMCB 1MROB 4G1PA 3E8OA 5GIOA 3BDPA 2V4JA 5CP2A 5HLFA 3VQBA 3RR8A 1YJWS 2EXUA 4A8OA 3HVTA 3HD2A 2M0NA 1EZZB 4JI8F 2G09A 2ZIWB 3EXYA 4O5EA 1IG9A 1X6IA 1HKGA 1RTIA 2GC8A 3FC9A 4WK3A 1B0PA 1S72S 5GAHP 4K8ZA 5B0FA 1RA7A 1ZQRA 4ECSA 2LQ5A 3H25A 4O3MA 4DV4K 4P0PA 2HS4A 4DR6F 4H0TB 4AD6A 1Z25A 1A5WA 2VFTA 2MKYA 3VGMA 4LRFA 3SZ2A 3G8SA 4LFBJ 1SWVA 3CCWA 2EANA 4DR2J 1XSLA 4B9QA 4X4RA 4DSKA 3MFIA 2W01A 3ZX2A 5LMNF 2PEBA 2V2ZA 2NRRA 4KT0C 1PJ5A 1ZYQA 2LXUA 2DTJA 1UA1A 7ICGA 1PK1B 2MQNA 2XC9A 2ZJRQ 3T1YJ 4RUHA 1LKZA 5E5NA 4DL7A 2OPSB 4Q2MA 1VHIA 4PZOA 4PYDA 3UFCX 4IO9L 4YCXA 3C7NB 3SDEA 4O9MA 4HL9A 2XGPA 5C7PA 2AGQA 3GE9A 4BR9A 3CMEN 4J90A 3BB5A 4QCLA 1FDDA 4LF6F 4M95A 3CYMA 4IFEA 5C0YA 3HILA 4MMOA 2W9CB 1DFDA 3UM9A 5B0DA 2BQUA 4J2AA 4IO9Q 4USJC 5ALUA 4JI1J 4JI0K 3RBEA 1J5EK 4FF4A 3BH6B 2AYMA 1YIJS 1BGXT 3MUMP 1VBZA 1UT8A 3B0YA 1JWWA 5DB9A 5ITHA 2B9XA 1VQ7N 3MAAA 3LGHA 2CADA 1PAUB 1KAZA 4EGLA 8ICVA 3L3VA 4ED7A 1RT4A 4YB7A 1ZQIA 5KFGA 3JQJA 2VCPA 2F8MA 1Z05A 1SAZA 2AJ4A 4WK1A 3QEXA 2DB1A 1ZRMA 3JTOA 2K7JA 4CNYA 5IM0A 2AJQA 3M8YA 1QSYA 2QA4S 5B5EU 2ZOGA 4O3OA 4I2PA 4NXNJ 3G6YA 1OJ4A 4DV3K 3BF3A 1RWMB 2UZAA 4I7FB 3ZI4A 3HJVA 1P6TA 4Y2PA 4NM2A 3GFKB 7ICIA 1AT1B 4FPAA 3MEGB 2HRUA 2WB1C 4K8XA 4DFPA 2K4IA 1SBRA 2G8FA 5CYJA 1R8PA 2HBZB 3NS7B 1Y5IB 4F3QA 2PMZF 2YKNA 1VDVA 3A8JA 3FFIB 1RWWB 2JZ5A 3R6MA 1P8ZA 1BVSA 2DH7A 1IR2A 3ENQA 9ICQA 2E1CA 1KQSR 5KFVA 4TU7A 1NGAA 1SUQA 4JV5J 4WKRA 5ETOA 1IKVB 1EO1A 2LLZA 4MT1A 4CDIA 4UAVA 3PO5A 3VETA 4AHSA 3SENA 5J2MB 2K1RB 5DZ6A 3PX4A 1CJUB 2EI5A 1DY3A 2NZCA 4HCCA 2QG9B 4X66J 4YP3A 4CJRA 2LA6A 2E88A 3AAPA 2CNNB 3HSCA 3KK1A 2RE2A 2ZGZA 2DY1A 3G8QA 5L1JA 1HEKA 2XYGB 3A12A 3JPQA 5GAHI 4QYZK 4CE9A 3PX6A 5FLXY 3I76A 2Y1LB 1RAOA 1UT5A 1VSJA 1V4TA 2ZBRA 5DDRC 4PGQA 1HD0A 1X2IA 1JLBB 5AXLA 1N88A 2GGPB 1WN7A 3PYDA 4C3MA 3POTA 1UOCA 4QIGA 5HMXA 4P75A 5LMUF 4E2FB 3G6VA 2RF2A 5KFPA 3ELHA 2WSCC 4CERA 4KO0B 1KBRA 1NZPA 2RH3A 4DOZA 1RXOB 3L7UA 2PMZD 2IM2A 1NZBA 2RE1A 3R9KA 4P6QA 2ZM6F 2G0AA 4NXZA 4M9JA 3H90A 3NASA 3C6UB 2LM4A 1YDLA 4JLHA 4M5MA 2PFUA 4QOZB 5E3RA 4W98A 2BRKA 3PNIA 3H46O 2ILZA 5CQGA 1OY9A 4OX6A 2F1FA 5EE9A 3M1VB 4RQ6A 3E66A 3HX0A 3NVYA 4FNIA 2OM6A 1G2EA 4EYHB 4MFFA 5L46A 4HTLA 3B8AX 1S9GB 3ZX0A 1U04A 1KR4A 2A1SA 3D0GE 5KQ8A 2YI1A 4PG4A 3PYGA 2XCPA 3LP2B 2XTJP 3QU7A 4CO5A 4C4TA 1T6DA 2IAJA 5FPNA 1FKOB 5M1QA 4DUZK 3U02A 3EW9A 1NJXA 1U26A 3W1YC 2HK2A 1K0TA 3MR5A 8ICQA 2P9GA 4CF0A 2F4FA 1B9DA 2YH1A 2GOLA 4GV9A 5LJWA 3H59A 4DF4A 5GINA 3HCXA 2O01C 3HHLB 4CEEA 1ZM4A 3V6JA 2JRZA 1E6YA 3GPAA 1W9HA 2MJUA 1T11A 3T1HK 4KKOA 2MZSA 3HHDA 3PW4A 2X1BA 1C6VA 1HR0K 4FWNA 4NLBA 1T6CA 3RR7A 3PZPA 5KFQA 3HKZF 3UMCA 5AE3A 2ZKUA 2ALYB 1VSKA 5GAEP 7ICFA 2XIDA 9ATCB 4HH0A 4NLSA 3SSRA 4U67Q 3D3CJ 3VAHA 4FFDA 1T02A