4IS7A

Crystal structure of the caskin2 sam domain tandem
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
GADAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Caskin-2
publication title Crystal Structure of the CASKIN2 SAM Domain Tandem
rcsb
source organism Homo sapiens
total genus 42
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A01
2F44A 3TACB 3KKAC 1COKA 2F8KA 2LMRA 2EAOA 3K1RB 2F3NA 2KG5A 1SV4A 1SXDA 2E8PA 2EAPA 3KKAA 2DL0A 4PZOA 4PZNA 2K60A 2QB0B 5F3XB 5L1MA 2EANA 2E8NA 2QB1A 2KE7A 1Z1VA 1KW4A 1WWVA 2KSOB 3BS7A 2KSOA 5JU5A 2D3DA 2L5YA 2Y9UA 5KNIA 3BQ7A 2ES6A 4IS7A 1PK3A 5JRTA 1JI7A 1PK1B 2K4PA 1X66A 2ESEA 3SEIA 1PK1A 2QB0A 1OW5A 1SV0C 3TADC 3HILA 2Y9TA 1UCVA 2QARB 4NL9C 2QARA 3SENA 3IDWA 1OXJA 2JV3A 1UQVA 4RQMA 1SV0A 3TADA 5JTIA 2B6GA 4NL9A 2LPEA 3BS5B 2KMDA 4RQNA 3BS5A 2DKXA 1LKYB 1X9XA 2DKZA 1LKYA 2FE9A 2E8OA 1F0MA 2EAMA 5J8YC 2E8MA 4NJ8A 1B4FA 1X40A 2D8CA 4MHVA 1V85A 3H8MA 1B0XA 1V38A 2KIVA 1SXEA 5J8YA 1SGGA 1DXSA 2GLEA 1WWUA 2QKQA 1RG6A 2YTUA
chains in the Genus database with same CATH superfamily
3N7PD 4K4HA 5HMLA 2LYHA 4KLUA 3RRHA 4ED8A 2EAOA 3FAHA 2ISPA 3AU2A 2FPLA 3Q8QB 9ICLA 5KFRA 5ALWA 4B9VA 4ZH4A 2W9BA 3HRDD 1XNSA 5DKWA 4M9GA 3HKZC 4OJ5A 3HX0A 2JEGA 2W7OA 2FMSA 2BDPA 3DDHA 4RQ4A 5CWRA 5KFIA 3AN1A 3BS7A 4O3SA 2MA1A 3RAQA 7ICSA 1U47A 4YXJA 3BZKA 2JEJA 4EZ6A 5KFTA 2ATLA 5F9NA 5KG1A 3SAFA 4UW9A 5AI5A 4C4RA 5DQHA 2XGQA 3N4MB 2BR0A 2YQEA 2KZMA 3T5JA 4DSFA 3TFSA 4DF8A 2MUTA 4AP9A 5HP4A 4ED6A 7ICIA 4NL9A 4RT2A 9ICMA 8ICTA 4B9LA 3WK6A 5B5EU 2XCAA 1L3SA 5DBBA 3RH6A 2VKQA 3T5LA 4R8UB 1SKWA 1VLBA 5L1JA 4UATA 3PSFA 3GILA 4XUSA 5KFSA 2G0AA 2G06A 3IP4B 5J0PA 2HHXA 4IL6U 2F77X 1S10A 4U6PA 2HSZA 1JUDA 8ICCA 1ZQMA 5KG5A 2W9BB 2D6FC 3DV9A 2ZUDA 2HHTA 1JROA 4TQRA 1T3QA 3KD3A 4IQWA 1S0NA 2A1JB 3B0XA 4GXKA 1S9FA 7ICPA 1PUZA 4RQ3A 1X9SA 5J0UA 1JMSA 1WYGA 3FYHA 4G3IA 3TAPA 2AJQA 2PKEA 2HOQA 3TARA 9ICOA 2BPFA 8ICGA 3Q8SB 2EH9A 2RDIA 2LYBA 2BQRA 2AGQA 4AYBF 5KG2A 2DGZA 4QZ9A 5DDMA 2YN4A 5IIKA 4NXZA 5DG8A 4ZOHC 1IIPA 1ZQBA 3LWLA 4PH5A 3G6VA 4B9TA 2WAQF 4ECZA 4YD1A 3F53A 3ZDDA 3QU4A 3BQ7A 2OWOA 3PW5A 3C2KA 2KNJA 4DL5A 4G9BA 1ZETA 5KFVA 3UQ0A 1XSPA 5CA7A 1OW5A 3WK5A 4F4XA 5KT7A 4B6JA 5AKLA 2KK0A 5J2GA 4UB8U 5AM1A 3G6YA 3H4DA 4ED2A 2IHMA 4AYBC 4QZEA 3C28A 5KT2A 3H0RB 4OJLA 3SQIA 2MRLA 5DB9A 5EWEA 5ALLA 3KOOA 1Z00A 2B21A 5J0YA 4QJFB 1L7OA 5EE0A 1SZPA 4KN7A 9ICPA 2KJ9A 2VANA 2JGAA 2FMQA 1RYRA 4R65A 2KKPA 1ZQAA 3WKEA 4RU9A 3ETLA 4MFAA 2V4QA 3LYSA 7ICHA 4C8LA 3RJKA 1XC9A 1JALA 1T94A 2K4IA 1ZD3A 3OSPA 4CGZA 5AM4A 1NK9A 4FS2A 3BZCA 4JB3A 4Y2PA 4FE3A 4QW9A 3TANA 2Y0SF 3ZDCA 3J81j 2XY5A 5AICA 1ZXIA 3ALRA 3OGUA 4I2BA 1NZBA 4HAIA 5KFHA 3TKAA 4PZOA 4QZHA 1RQLA 5D4BA 5F9LA 2HHVA 4R66A 3PMNA 3PW7A 4JMUA 4PJ0U 4XQ8A 3RB0A 1X6JA 5AKHA 3PX6A 3SR6A 3AQFA 4UAUA 4EEYA 2FI1A 3GQCA 4DSEA 3VCBA 7ICRA 2KD1A 4Q43A 2ZXIA 7ICLA 1Z00B 4FO6A 4NLGA 5J2BA 4MFFA 3EUB2 4YMMA 2FLLA 1KSPA 2VIXA 1PVPA 2W9CA 3IG5A 3ISDA 2JRZA 4DL4A 1N56A 2WF6A 1UCVA 4P4PA 1Z4OA 4NL9C 1N61A 4Y2YA 4JV0A 3C21A 4P0QA 2KFNA 1KEJA 4O0IA 3PZPA 2VJ5A 1X9WA 3ICXA 5KFFA 4BX9C 1ZQHA 2KMDA 4GLXA 4QNLA 3BS5A 1LKYA 3G6XA 5KFCA 1Q3VA 3NTUA 4ECYA 2PI5A 1N60A 2NRTA 3MR3A 4ECQA 9ICFA 3Q8KA 1VJ5A 3H8MA 3E58A 1YZ7A 4RPXA 2WB1F 4QWEA 4B9MA 1JXEA 2HBLA 3ZDBA 3N97B 4PGXA 4P0PA 3GFKB 3QZ7A 2MAXA 5J2JA 5DG9A 4J9QA 1A77A 2I1QA 1N5XA 4ICAA 1U49A 4I2HA 1CEZA 2A19A 2BQUA 4PHDA 4QZIA 1ZRMA 4RQ1A 4O5CA 3HW8A 1K5OA 1ZQLA 1O08A 3MBYA 4JWNA 5J0RA 5J2FA 3ZDEA 1JRPA 1TK5A 2E8NA 2OH2A 2A3VA 4PHEA 8ICPA 4FFDA 4F5OA 3QU9A 4P0QB 1RZTA 3OTQA 2AH5A 4QZBA 1ZRNA 4DQIA 3UMBA 2KSOA 3F2DA 3JPQA 2Y9UA 4OJPA 5KT5A 4ECXA 3Q8MA 3H8WA 4TUSA 3IM1A 4DFDA 5J0WA 1YT3A 4JWMA 1HUOA 1PK1B 1ZQWA 4UB2A 5L1LA 1MN8A 2KVSA 3UMCA 2HOIA 2BCVA 2XC9A 4NM1A 4RQ2A 3TQ1A 3MR2A 1RPLA 2IMWP 4KX3A 4DF4A 3RFAA 1UQVA 8ICBA 5D46A 4QIWC 5TISU 4P0PB 3BQTA 5C5JA 3FDSA 1BPDA 2JR5A 3ZD9A 3OPXA 4UBBA 1BVSA 3CRXA 4YD2A 2WFAA 4C8MA 1NKEA 1KTQA 1MQ3A 2FPMA 3WKDA 2ZIUA 3PR5B 2R8KA 3V6JA 5ALDA 2LM4A 1KQQA 1JXLA 1ZQNA 4DFKA 4KLDA 2AU0A 2YMPA 3I76A 4LZGA 1A76A 1DXSA 2BCUA 3WK7A 1DGSA 8ICEA 2XY6A 1ZD5A 2YTUA 4O5EA 3E0FA 4US9A 2CXYA 2NV3A 4RPYA 2K89A 4RZRA 5AI6A 3H40A 4YMNA 4UAWA 3AEVA 3I1YA 1SWVA 4U7CA 1S0MA 4GC7A 4KN4A 4UAZA 2RLTA 5KFLA 1L7MA 2W3RA 4RQ5A 4QZCA 2DL0A 4M9LA 4DLEA 4LJXA 4EBCA 1ZQJA 4RNNA 3GIKA 5EOZA 3F5AA 2ASJA 2WTFA 7ICMA 5IIMA 1ZQEA 4ELVA 4CE6A 1D8BA 2VA2A 4O5KA 3ED5A 2CRXA 3RJGA 5HR7A 5AKIA 2GOLA 9ICUA 1PK3A 5DLGA 2IOFK 3MABA 1PVRA 1H38A 5KFMA 3JPRA 3GIIA 1NJZA 4IRKA 2ZIUB 3WU2U 1NJWA 3QU2A 1KFTA 3MGHA 1TAMA 2BKEA 2H3QA 3HT3A 2ZIVB 2LM1A 1NK5A 2P66A 4RQMA 4J9NA 2YY6A 2VJ4A 4UQGA 1TAUA 2UVWA 4GC6A 4GXIA 2WF5A 2C28A 1LVHA 4E0DA 4F71A 4Q8FA 4F50A 4JV1A 1ZJMA 4MHVA 2GO7A 4LVSA 3KZIU 4EBDA 5DBAA 3C2LA 3PV8A 4DL2A 3SV4A 1L6NA 1J2MA 5HNKA 2W11A 2ZUCA 1RG6A 1TE2A 2OEHA 1A6SA 2WF9A 1V9PA 5KFUA 1SB3C 4UB6U 4J9OA 2YMMA 5AK5A 4FZNA 5DQGA 4IQUA 4PGQA 2BZFA 8ICKA 8ICHA 5J0TA 5EE9A 4CNQA 5AI8A 2E1EA 2J6SA 3EYZA 3RJJA 3GU3A 2C2EA 4QWCA 2V4RA 1COOA 4I2FA 4ECWA 1ZQRA 1ZQQA 3UXNA 2KP7A 4K4GA 4Y2RA 3KHHA 2HHSA 4IRCA 4DSIA 3U26A 4F5NA 2K4PA 1X66A 5DLFA 3SMVA 2Y9TA 5CB1A 5DBCA 4UARA 5DGBA 4NWIA 3NS1A 4DFPA 3NUQA 3JPSA 1OXJA 5DG7A 1Z19A 1DK2A 1ZQYA 5HHHA 3QU7A 2KHQA 4IRDA 9ICWA 5ALUA 2LPEA 2EDUA 2DKXA 2IBKA 1F0MA 1S0VA 2JZBA 1XWLA 1T7PA 3QZ8A 4NY8A 2ALZA 4YR0A 3RH4A 1WUDA 5KL8B 3Q8LA 5DB7A 2NYVA 1N62A 1WWUA 4HYKA 3AU6A 1X42A 2Y1IA 3NVYA 5FP0A 1SIJA 4QWDA 5J2DA 2VA3A 1RM6C 3QX7A 4FZMA 2PXIA 3H0MB 2DPIA 2HHQA 1D8YA 2YMQA 5KG6A 4F4WA 4RNOA 4KLLA 3N28A 2KEYA 3GIJA 3M6KA 3AM9A 3KBBA 8ICUA 2HI0A 1SKRA 3ZI4A 4B9UA 5ALIA 5F3XB 2B0CA 1ZQSA 3M9NB 4IC9A 2JEFA 5IIOA 2D3DA 2I6XA 3PR4A 1KN5A 3KHLA 1NK4A 1NK7A 2W04A 4F91B 4I2DA 5L9XA 3AL0B 2IHNA 2K4HA 3L4PA 2MUTB 2DFLA 5KFKA 3QYPA 2KFZA 4FBUA 4EBEA 4IQTA 2G09A 4J9LA 3RR7A 5L1KA 2ZJ5A 4DCCA 9ICXA 4DL6A 3ETRA 3QXGA 4XA5A 5CJ7A 5EWGA 3PSTA 1JN3A 1S5LU 3OHAA 5JUMA 4ECVA 4O3PA 4Y2XA 2FMPA 2YB4A 3NRZA 3BQ1A 2J6UA 2KIVA 1SGGA 5KFPA 4DWIA 5AK4A 5B66U 3GZFA 9ICGA 2YB1A 1RXWA 4X5VA 2F8KA 1SL1A 3SZ2A 4J9RA 3GV8B 2C22A 3NVWA 1QQ7A 1UA1A 1SV4A 4F4KA 1L5UA 2ASDA 1JIHA 4CF5A 2Z7JA 5HMMA 4YR3A 2BGWA 1K1SA 5ALJA 2RRDA 2XI9A 1U9LA 2G07A 1ZQZA 3K75D 3EWAA 3RTVA 4PHAA 4O3RA 4ECUA 3GIMA 4Z6DA 3S6JA 3UXOA 4OJOA 4EEKA 4ECSA 2NRXA 2ZTCA 1L3VA 5EWFA 4CDGA 3ORYA 2UVVA 4JK1A 4DO9A 1KFSA 4DS5A 2QARA 5KFOA 2KICA 1BPYA 1T3NA 1A0PA 1B22A 3PSIA 3BQ0A 4ED3A 4RQ8A 5KG4A 3LVWA 1PZNA 3OSNA 4XRHA 4RQNA 2F8LA 4YQWA 1N63A 8ICNA 3OHBA 2E8MA 1WG8A 1U4BA 4TUPA 2D8CA 4NLZA 4KLMA 4Z6FA 2YMLA 3D2NA 2P35A 5A0LA 5AKEA 4Z6CA 3V7LA 2AGOA 1Q8KA 2Q0ZX 4J9SA 4Y2JA 3PMLA 4KLOA 1MSWD 8ICJA 5KFAA 4TQSA 9ICBA 4M9NA 2AGPA 5J2IA 8ICZA 3BQ2A 2C2DA 1QLNA 1WCNA 4UB4A 2KG5A 4O9MA 1FFUA 4UAYA 4C80A 2KZZA 4CRXA 4QW8A 2W9AA 1Z1BA 2ZUBA 8ICMA 3Q8RB 4ECRA 2QB1A 2KVCA 5ALRA 1TK8A 1AQ6A 2LI6A 4GFJA 5AI4A 1CI4A 4EYIB 1TFRA 5J2HA 4QWBA 1ZQTA 4IR1A 5AKXA 3KHRA 4RPZA 4C0ZA 3ISBA 5KT3A 2K4EA 3MDCA 3CNHA 2KN7A 5KG3A 3PX0A 2J6TA 5AM5A 2NRVA 2I5HA 2W9CB 2PFOA 4OCZA 4R64A 2K8BB 1HIWA 3B0YA 3M6ZA 4QIWF 3C1ZA 3HPOA 2DPJA 8ICYA 1KLNA 3IDWA 2RP5A 5KG0A 1XU4A 4QZAA 2W54A 3RJEA 2KHVA 2W3SA 4EYHB 2JXJA 4BWJA 4M0AA 1FIQA 1CRXA 2KOBA 2NRWA 3BS5B 1BGXT 1LKYB 4ELUA 3M1YA 2IOHA 1KFDA 2EZZA 2HOFA 3RJIA 2MU2A 1TV9A 4RQ0A 1KDHA 1IG6A 1Q46A 3L3FX 1MC8A 1ZD4A 3V72A 4IQVA 1V38A 5J8YA 4GIBA 4RUAA 3QEAZ 1S97A 4Y2QA 2LYAA 3B9JA 3WK4A 1KBUA 1SL0A 2BCSA 2KKVA 4O3NA 4DQQA 3MR5A 2W03A 1NZPA 4BDPA 3QU5A 1SKSA 2OCEA 4DL3A 5CR0A 4KLIA 2KTQA 1Z3EB 2EZXA 3C2MA 4KLGA 1F44A 3RJFA 1SXDA 2R8GA 5AKGA 3LK9A 2K8AA 4BUGA 2H3VA 5J2AA 2I9GA 4UB5A 5AI0A 1ZQGA 1HJPA 4UBCA 2BQ3A 2R8JA 5L1MA 3WKBA 5KAIU 5ALKA 2W8KA 3LWMA 4TURA 4RNMA 4DSKA 4UAVA 3E2EA 4KMUA 4DQRA 1ZQXA 4JV2A 2KSOB 2G5HB 5JU5A 2ZTEA 1T4GA 5J2KA 3QUTA 1V97A 1F5SA 4QZ8A 4KLTA 7ICFA 3QUQA 3C1YA 3SD7A 5GTHU 3H7IA 1NI3A 9ICSA 9ICCA 1ZQCA 1D9DA 1TKDA 3RF9A 3UXPA 1HEKA 1TAQA 4Y2SA 5IILA 1U48A 5J2CA 2M9NA 1VDVA 2BCQA 3K4GA 5AKKA 3NVZA 3SAHA 1QH9A 1P7DA 4KMOB 1FO4A 2R18A 2FLPA 5KFNA 2W43A 2HVIA 3RBDA 2ASLA 2H5XA 4RQ7A 3QUCA 1MA7A 4J9MA 4CCHA 3MDAA 5ALTA 3C5FA 3WK8A 3PO5A 2YX8A 3M7DA 3RRGA 4LZDA 1B0XA 4QZDA 3AUOA 2PFQA 1S77D 4DOAA 2ZIWA 3GDXA 4EENA 1QTMA 4M2YA 5AHXA 3I28A 3THVA 1X2IA 4I2EA 2GWSA 1C7YA 4RUCA 4YMOA 2XVTA 5KFXA 4YN4A 2R8IA 3RBEA 3K1RB 2KIWA 4YP3A 4I27A 3RB3A 3KKAA 3KTQA 2XY7A 3PW2A 3MC1A 3DEEA 4UASA 1NNLA 2A1AA 2ZJAA 8ICAA 2NO4A 3M9MB 9ICRA 8ICXA 4A8EA 1IXRA 1Z1VA 4OD0A 4I2JA 1QSLA 3CW2C 4PL1A 4JUZA 2F76X 7ICOA 1L8LA 4IS7A 4NLNA 4DSLA 4OO1J 3V7JA 4YXMA 4I2CA 4EX7A 4RT3A 2BHNA 4FS1A 1N2XA 3D2QA 9ICNA 3JPNA 3SAGA 1URJA 4MFCA 3D2SA 1Q3UA 2JV3A 4DQSA 1RQNA 3NRWA 1ZQPA 2LKYA 3O0FA 2HBKA 4UB3A 2B6GA 5AK3A 3RH5A 4F93B 2G5IB 3A0BU 1WCLA 9ICEA 4ELTA 3KFUF 1X9XA 8ICSA 2FE9A 3H0LB 4F3OA 2KV2A 4US8A 5J8YC 2H3ZA 1EXNA 4C4SA 4DS4A 2ZG6A 1SZHA 1Z4NA 4R8UA 2Q4TA 3F5EA 1V85A 4C7ZA 3PSPA 3M8RA 1J97A 4NLCA 1SXEA 1FFVA 4NV0A 5KG7A 3MGIA 1XSLA 5KFBA 3WKCA 3V6KA 2F44A 4Z6EA 3WKAA 1DK3A 4Y2TA 2CPRA 5AIBA 2A1JA 4KLQA 3TFRA 2F3NA 4F2SA 4M47A 2W9MA 5KT4A 3QUBA 1ZOLA 3H4BA 7ICTA 5AKYA 3F2BA 2WF7A 5ALXA 4B9SA 1QSSA 3IG8A 1T8EA 7ICUA 1BNOA 2BPCA 7ICGA 5ALEA 2XCPA 2L5YA 1QSYA 5KNIA 3MFIA 5AKJA 1JI7A 5H2FU 2ESEA 4P4OA 5KAFU 5KFJA 2HBMA 3UQ2A 1ZQOA 4ECTA 4F8RA 3SENA 4MF2A 7ICKA 1ZQVA 5G5HA 3T79A 5ALSA 2N1RA 4YG2A 3VC8A 1L7PA 1L7NA 2ZTDA 2O6KA 2F1IA 3JPOA 1SV0A 4QZFA 5AM2A 5AM0A 3TADA 2XGPA 2UVRA 4F4ZA 2RQ5A 2WHEA 4J9PA 3RAXA 3N7RC 5HR6A 3M8SA 2IA6A 4EX6A 3JPPA 2JZBB 4OJ6A 2EZYA 1KRPA 2OXOA 5KFYA 2JHDA 8ICWA 1ZD2P 5C0YA 1N5WA 2AQ4A 4FBTA 4ACOA 1RXVA 5KFZA 3QNMA 1UPHA 2QKQA 4DFJA 5DB6A 2OYYA 5BOLA 3KKAC 2HDOA 4I29A 9ICHA 5ALZA 1BPBA 2FJ6A 1BPZA 3V6HA 5J29A 4DLGA 4DEZA 4YCXA 2EAPA 4YR2A 2XO7A 4C8OA 2CN1A 4F72A 1PVQA 2K60A 1QQ5A 1K1QA 2NO5A 1CUKA 1NKBA 3R9KA 1KW4A 1ZJNA 4PGYA 2ZIXA 3CP8A 3LVVA 1QQ6A 3PNCA 1ZYQA 1SL2A 2P6RA 2K8CB 3QE9Y 5G5GA 2F2AB 3SEIA 2WAQC 2E3TA 3D6JA 4F5QA 1XSNA 1S0OA 5GTIU 1OUQA 4F4YA 5KFWA 2EQYA 1IV8A 2OM6A 5CP2A 5DDYA 3IV6A 2JEIA 1ZQKA 2ZJ8A 4DOBA 3ZDAA 2F1JA 3MR6A 7ICJA 3NGDA 3Q8PB 1RYUA 5EE1A 4P4MA 2EAMA 4EELA 2KJ8A 5CRXA 1SWWA 4IR9A 1B4FA 4BGDA 5J0OA 2F1HA 1BPEA 4QWAA 3OJSA 4Q44A 3OJUA 4K4IA 3HP6A 2XIDA 5EE3A 1J2NA 2FDRA 1D9FA 5J2EA 3RJHA 1IM4A 3C29A 3RB4A 1ED1A 2ISOA 5KTQA 2HMXA 3EW9A 1KL9A 2ZIXB 2HHWA 1ZQ1C 2KZ3A 3IRUA 1XO1A 3PY8A 2Y0SC 9ICJA 2PFNA 4C7YA 2JH1A 4DL7A 3PVXA 8ICVA 3WK9A 4J9KA 3HJEA 4I2GA 1RYSA 4C4TA 5J0XA 9ICVA 4NLBA 5KFGA 5ALNA 1S76D 4PPXA 2DBYA 1M6YA 1PK1A 1L3UA 1NK0A 1SV0C 5ALGA 4MEYA 3TADC 1RDFA 2ODGA 2DF4B 1MQ2A 8ICQA 2FLNA 5KL1B 2QARB 4M04A 4P2HA 3SV3A 1LV5A 2DUYA 3UPQA 2WF8A 2E5SA 4KLEA 1Y88A 5ALMA 1XO0A 2M0NA 7ICVA 5JTIA 5DB8A 4ED1A 4C8KA 1S8OA 2IOFA 1QCKA 2PMZF 5J0QA 4KLFA 3H8JA 5J0SA 4EZ9A 4ED7A 4DSJA 5IINA 3MFHA 4DOCA 2DQNB 1NK6A 2RHFA 1X40A 5ALFA 4KLHA 4KITB 3N7SC 3C5GA 2DWQA 1UA0A 5ALVA 2AXTU 3M9OB 3F2CA 1ZQUA 3BDPA 1NJYA 2OHFA 4UB1A 4C8NA 3EPIA 2AHOB 4QZGA 1ZQFA 2WB1C 4RQ6A 2LMRA 1O03A 1NOMA 2BDUA 2PMZC 4DQPA 5T14A 4BJQA 4WJ3B 2E8PA 4Q8EA 5CEHA 5ALOA 4BXOA 2JH7A 8ICIA 2QLTA 4MEXA 9ICTA 4MF8A 4R63A 4PHPA 4Y2UA 1UT8A 1DGJA 3TAQA 9ICIA 1L8OA 2NRZA 4DFMA 5KFEA 3PO4A 5AM3A 4M6WA 3SYZA 4Q45A 3UMGA 1C20A 3FC4A 5AKZA 2BCRA 2ZXHA 2FPKA 8ICRA 3NVVA 3CYMA 3LDAA 4YFKA 2ES6A 3NASA 1UHUA 2P6UA 5JRTA 4ED0A 3PW0A 4I28A 1JX4A 1DRGA 2QB0A 3EPGA 3HILA 4I2IA 2PI4A 3FM9A 4F5PA 3ONNA 3JPTA 5KFQA 1NKCA 2ZIVA 4CF4A 3T3FA 1N48A 3TI0A 1HUZA 2Y1JA 2HCFA 2HHUA 2E8OA 3AQEA 3K1ZA 5IIJA 9ICQA 7ICQA 4BWMA 3T5HA 1BNPA 2AQ0A 3MGVA 9ICKA 3L5KA 4BXOB 5DGAA 5ALQA 2V9WA 5AK6A 3PW4A 3TACB 4KTQA 1COKA 2LHTA 5K4LA 4Y2VA 3IN5A 1GO3F 4J03A 4M6WB 9ICAA 3RR8A 1TVAA 1FEZA 2R8HA 2GH1A 7ICEA 2LBOA 5L1IA 8ICOA 1XS9D 2VA8A 3ISCA 4F2RA 2HW3A 3GV7B 4F92B 1DOQA 5D49A 5KFDA 2H3IA 3GV5B 4I2AA 4O3MA 2C2RA 3EZ5A 4F5RA 2W7PA 4PZNA 3SI8A 4KLSA 2QB0B 5TZVA 2W8LA 4KX5A 1KKXA 5E79U 2EANA 3C23A 1NJXA 3A0HU 2H3FA 1D8LA 2KE7A 5IIIA 5ALHA 1X6IA 3HWTA 2XICA 5KT6A 1YZ6A 5AIAA 1NK8A 1L3TA 2KJ5A 1WWVA 3QEBZ 8ICFA 3PX4A 1BPXA 3T5KA 1ZQDA 4FZLA 4GXJA 1ZQIA 5AI9A 3BJYA 4KLJA 4USAA 2E1FA 5ALPA 7ICNA 2HVHA 8ICLA 1UT5A 4PL2A 1AROP 4TUQA 4M9HA 5BPCA 4NLKA 3ZD8A 1TK0A 2BPGA 1LB2B 2HBJA 5CHGA 5DQIA 4B9NA 3H8SA 2MSNA 4CF3A 3V7KA 2DKZA 2G08A 4NM2A 1ECWA 5BOMA 4NJ8A 5ALYA 3RB6A 3IHQB 3UM9A 4YVZA 1U45A 4O3QA 1B43A 1X9MA 2PFPA 2JMGA 2W55A 3KZXA 4M9JA 3KHGA 5HHIA 3AMZA 2RDJA 2GLEA 2UVUA 3HKZF 2ZIWB 4O3OA
chains in the Genus database with same CATH topology
2F44A 3TACB 3KKAC 1COKA 2F8KA 2LMRA 2EAOA 3K1RB 2F3NA 2KG5A 1SV4A 1SXDA 2E8PA 2EAPA 3KKAA 2DL0A 4PZOA 4PZNA 2K60A 2QB0B 5F3XB 5L1MA 2EANA 2E8NA 2QB1A 2KE7A 1Z1VA 1KW4A 1WWVA 2KSOB 3BS7A 2KSOA 5JU5A 2D3DA 2L5YA 2Y9UA 5KNIA 3BQ7A 2ES6A 4IS7A 1PK3A 5JRTA 1JI7A 1PK1B 2K4PA 1X66A 2ESEA 3SEIA 1PK1A 2QB0A 1OW5A 1SV0C 3TADC 3HILA 2Y9TA 1UCVA 2QARB 4NL9C 2QARA 3SENA 3IDWA 1OXJA 2JV3A 1UQVA 4RQMA 1SV0A 3TADA 5JTIA 2B6GA 4NL9A 2LPEA 3BS5B 2KMDA 4RQNA 3BS5A 2DKXA 1LKYB 1X9XA 2DKZA 1LKYA 2FE9A 2E8OA 1F0MA 2EAMA 5J8YC 2E8MA 4NJ8A 1B4FA 1X40A 2D8CA 4MHVA 1V85A 3H8MA 1B0XA 1V38A 2KIVA 1SXEA 5J8YA 1SGGA 1DXSA 2GLEA 1WWUA 2QKQA 1RG6A 2YTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F44 A;  3TAC B;  3KKA C;  1COK A;  2F8K A;  2LMR A;  2EAO A;  3K1R B;  2F3N A;  2KG5 A;  1SV4 A;  1SXD A;  2E8P A;  2EAP A;  3KKA A;  2DL0 A;  4PZO A;  4PZN A;  2K60 A;  2QB0 B;  5F3X B;  5L1M A;  2EAN A;  2E8N A;  2QB1 A;  2KE7 A;  1Z1V A;  1KW4 A;  1WWV A;  2KSO B;  3BS7 A;  2KSO A;  5JU5 A;  2D3D A;  2L5Y A;  2Y9U A;  5KNI A;  3BQ7 A;  2ES6 A;  4IS7 A;  1PK3 A;  5JRT A;  1JI7 A;  1PK1 B;  2K4P A;  1X66 A;  2ESE A;  3SEI A;  1PK1 A;  2QB0 A;  1OW5 A;  1SV0 C;  3TAD C;  3HIL A;  2Y9T A;  1UCV A;  2QAR B;  4NL9 C;  2QAR A;  3SEN A;  3IDW A;  1OXJ A;  2JV3 A;  1UQV A;  4RQM A;  1SV0 A;  3TAD A;  5JTI A;  2B6G A;  4NL9 A;  2LPE A;  3BS5 B;  2KMD A;  4RQN A;  3BS5 A;  2DKX A;  1LKY B;  1X9X A;  2DKZ A;  1LKY A;  2FE9 A;  2E8O A;  1F0M A;  2EAM A;  5J8Y C;  2E8M A;  4NJ8 A;  1B4F A;  1X40 A;  2D8C A;  4MHV A;  1V85 A;  3H8M A;  1B0X A;  1V38 A;  2KIV A;  1SXE A;  5J8Y A;  1SGG A;  1DXS A;  2GLE A;  1WWU A;  2QKQ A;  1RG6 A;  2YTU A; 
#chains in the Genus database with same CATH topology
 3N7P D;  4K4H A;  5HML A;  2LYH A;  4KLU A;  3RRH A;  4ED8 A;  2EAO A;  3FAH A;  2ISP A;  3AU2 A;  2FPL A;  3Q8Q B;  9ICL A;  5KFR A;  5ALW A;  4B9V A;  4ZH4 A;  2W9B A;  3HRD D;  1XNS A;  5DKW A;  4M9G A;  3HKZ C;  4OJ5 A;  3HX0 A;  2JEG A;  2W7O A;  2FMS A;  2BDP A;  3DDH A;  4RQ4 A;  5CWR A;  5KFI A;  3AN1 A;  3BS7 A;  4O3S A;  2MA1 A;  3RAQ A;  7ICS A;  1U47 A;  4YXJ A;  3BZK A;  2JEJ A;  4EZ6 A;  5KFT A;  2ATL A;  5F9N A;  5KG1 A;  3SAF A;  4UW9 A;  5AI5 A;  4C4R A;  5DQH A;  2XGQ A;  3N4M B;  2BR0 A;  2YQE A;  2KZM A;  3T5J A;  4DSF A;  3TFS A;  4DF8 A;  2MUT A;  4AP9 A;  5HP4 A;  4ED6 A;  7ICI A;  4NL9 A;  4RT2 A;  9ICM A;  8ICT A;  4B9L A;  3WK6 A;  5B5E U;  2XCA A;  1L3S A;  5DBB A;  3RH6 A;  2VKQ A;  3T5L A;  4R8U B;  1SKW A;  1VLB A;  5L1J A;  4UAT A;  3PSF A;  3GIL A;  4XUS A;  5KFS A;  2G0A A;  2G06 A;  3IP4 B;  5J0P A;  2HHX A;  4IL6 U;  2F77 X;  1S10 A;  4U6P A;  2HSZ A;  1JUD A;  8ICC A;  1ZQM A;  5KG5 A;  2W9B B;  2D6F C;  3DV9 A;  2ZUD A;  2HHT A;  1JRO A;  4TQR A;  1T3Q A;  3KD3 A;  4IQW A;  1S0N A;  2A1J B;  3B0X A;  4GXK A;  1S9F A;  7ICP A;  1PUZ A;  4RQ3 A;  1X9S A;  5J0U A;  1JMS A;  1WYG A;  3FYH A;  4G3I A;  3TAP A;  2AJQ A;  2PKE A;  2HOQ A;  3TAR A;  9ICO A;  2BPF A;  8ICG A;  3Q8S B;  2EH9 A;  2RDI A;  2LYB A;  2BQR A;  2AGQ A;  4AYB F;  5KG2 A;  2DGZ A;  4QZ9 A;  5DDM A;  2YN4 A;  5IIK A;  4NXZ A;  5DG8 A;  4ZOH C;  1IIP A;  1ZQB A;  3LWL A;  4PH5 A;  3G6V A;  4B9T A;  2WAQ F;  4ECZ A;  4YD1 A;  3F53 A;  3ZDD A;  3QU4 A;  3BQ7 A;  2OWO A;  3PW5 A;  3C2K A;  2KNJ A;  4DL5 A;  4G9B A;  1ZET A;  5KFV A;  3UQ0 A;  1XSP A;  5CA7 A;  1OW5 A;  3WK5 A;  4F4X A;  5KT7 A;  4B6J A;  5AKL A;  2KK0 A;  5J2G A;  4UB8 U;  5AM1 A;  3G6Y A;  3H4D A;  4ED2 A;  2IHM A;  4AYB C;  4QZE A;  3C28 A;  5KT2 A;  3H0R B;  4OJL A;  3SQI A;  2MRL A;  5DB9 A;  5EWE A;  5ALL A;  3KOO A;  1Z00 A;  2B21 A;  5J0Y A;  4QJF B;  1L7O A;  5EE0 A;  1SZP A;  4KN7 A;  9ICP A;  2KJ9 A;  2VAN A;  2JGA A;  2FMQ A;  1RYR A;  4R65 A;  2KKP A;  1ZQA A;  3WKE A;  4RU9 A;  3ETL A;  4MFA A;  2V4Q A;  3LYS A;  7ICH A;  4C8L A;  3RJK A;  1XC9 A;  1JAL A;  1T94 A;  2K4I A;  1ZD3 A;  3OSP A;  4CGZ A;  5AM4 A;  1NK9 A;  4FS2 A;  3BZC A;  4JB3 A;  4Y2P A;  4FE3 A;  4QW9 A;  3TAN A;  2Y0S F;  3ZDC A;  3J81 j;  2XY5 A;  5AIC A;  1ZXI A;  3ALR A;  3OGU A;  4I2B A;  1NZB A;  4HAI A;  5KFH A;  3TKA A;  4PZO A;  4QZH A;  1RQL A;  5D4B A;  5F9L A;  2HHV A;  4R66 A;  3PMN A;  3PW7 A;  4JMU A;  4PJ0 U;  4XQ8 A;  3RB0 A;  1X6J A;  5AKH A;  3PX6 A;  3SR6 A;  3AQF A;  4UAU A;  4EEY A;  2FI1 A;  3GQC A;  4DSE A;  3VCB A;  7ICR A;  2KD1 A;  4Q43 A;  2ZXI A;  7ICL A;  1Z00 B;  4FO6 A;  4NLG A;  5J2B A;  4MFF A;  3EUB 2;  4YMM A;  2FLL A;  1KSP A;  2VIX A;  1PVP A;  2W9C A;  3IG5 A;  3ISD A;  2JRZ A;  4DL4 A;  1N56 A;  2WF6 A;  1UCV A;  4P4P A;  1Z4O A;  4NL9 C;  1N61 A;  4Y2Y A;  4JV0 A;  3C21 A;  4P0Q A;  2KFN A;  1KEJ A;  4O0I A;  3PZP A;  2VJ5 A;  1X9W A;  3ICX A;  5KFF A;  4BX9 C;  1ZQH A;  2KMD A;  4GLX A;  4QNL A;  3BS5 A;  1LKY A;  3G6X A;  5KFC A;  1Q3V A;  3NTU A;  4ECY A;  2PI5 A;  1N60 A;  2NRT A;  3MR3 A;  4ECQ A;  9ICF A;  3Q8K A;  1VJ5 A;  3H8M A;  3E58 A;  1YZ7 A;  4RPX A;  2WB1 F;  4QWE A;  4B9M A;  1JXE A;  2HBL A;  3ZDB A;  3N97 B;  4PGX A;  4P0P A;  3GFK B;  3QZ7 A;  2MAX A;  5J2J A;  5DG9 A;  4J9Q A;  1A77 A;  2I1Q A;  1N5X A;  4ICA A;  1U49 A;  4I2H A;  1CEZ A;  2A19 A;  2BQU A;  4PHD A;  4QZI A;  1ZRM A;  4RQ1 A;  4O5C A;  3HW8 A;  1K5O A;  1ZQL A;  1O08 A;  3MBY A;  4JWN A;  5J0R A;  5J2F A;  3ZDE A;  1JRP A;  1TK5 A;  2E8N A;  2OH2 A;  2A3V A;  4PHE A;  8ICP A;  4FFD A;  4F5O A;  3QU9 A;  4P0Q B;  1RZT A;  3OTQ A;  2AH5 A;  4QZB A;  1ZRN A;  4DQI A;  3UMB A;  2KSO A;  3F2D A;  3JPQ A;  2Y9U A;  4OJP A;  5KT5 A;  4ECX A;  3Q8M A;  3H8W A;  4TUS A;  3IM1 A;  4DFD A;  5J0W A;  1YT3 A;  4JWM A;  1HUO A;  1PK1 B;  1ZQW A;  4UB2 A;  5L1L A;  1MN8 A;  2KVS A;  3UMC A;  2HOI A;  2BCV A;  2XC9 A;  4NM1 A;  4RQ2 A;  3TQ1 A;  3MR2 A;  1RPL A;  2IMW P;  4KX3 A;  4DF4 A;  3RFA A;  1UQV A;  8ICB A;  5D46 A;  4QIW C;  5TIS U;  4P0P B;  3BQT A;  5C5J A;  3FDS A;  1BPD A;  2JR5 A;  3ZD9 A;  3OPX A;  4UBB A;  1BVS A;  3CRX A;  4YD2 A;  2WFA A;  4C8M A;  1NKE A;  1KTQ A;  1MQ3 A;  2FPM A;  3WKD A;  2ZIU A;  3PR5 B;  2R8K A;  3V6J A;  5ALD A;  2LM4 A;  1KQQ A;  1JXL A;  1ZQN A;  4DFK A;  4KLD A;  2AU0 A;  2YMP A;  3I76 A;  4LZG A;  1A76 A;  1DXS A;  2BCU A;  3WK7 A;  1DGS A;  8ICE A;  2XY6 A;  1ZD5 A;  2YTU A;  4O5E A;  3E0F A;  4US9 A;  2CXY A;  2NV3 A;  4RPY A;  2K89 A;  4RZR A;  5AI6 A;  3H40 A;  4YMN A;  4UAW A;  3AEV A;  3I1Y A;  1SWV A;  4U7C A;  1S0M A;  4GC7 A;  4KN4 A;  4UAZ A;  2RLT A;  5KFL A;  1L7M A;  2W3R A;  4RQ5 A;  4QZC A;  2DL0 A;  4M9L A;  4DLE A;  4LJX A;  4EBC A;  1ZQJ A;  4RNN A;  3GIK A;  5EOZ A;  3F5A A;  2ASJ A;  2WTF A;  7ICM A;  5IIM A;  1ZQE A;  4ELV A;  4CE6 A;  1D8B A;  2VA2 A;  4O5K A;  3ED5 A;  2CRX A;  3RJG A;  5HR7 A;  5AKI A;  2GOL A;  9ICU A;  1PK3 A;  5DLG A;  2IOF K;  3MAB A;  1PVR A;  1H38 A;  5KFM A;  3JPR A;  3GII A;  1NJZ A;  4IRK A;  2ZIU B;  3WU2 U;  1NJW A;  3QU2 A;  1KFT A;  3MGH A;  1TAM A;  2BKE A;  2H3Q A;  3HT3 A;  2ZIV B;  2LM1 A;  1NK5 A;  2P66 A;  4RQM A;  4J9N A;  2YY6 A;  2VJ4 A;  4UQG A;  1TAU A;  2UVW A;  4GC6 A;  4GXI A;  2WF5 A;  2C28 A;  1LVH A;  4E0D A;  4F71 A;  4Q8F A;  4F50 A;  4JV1 A;  1ZJM A;  4MHV A;  2GO7 A;  4LVS A;  3KZI U;  4EBD A;  5DBA A;  3C2L A;  3PV8 A;  4DL2 A;  3SV4 A;  1L6N A;  1J2M A;  5HNK A;  2W11 A;  2ZUC A;  1RG6 A;  1TE2 A;  2OEH A;  1A6S A;  2WF9 A;  1V9P A;  5KFU A;  1SB3 C;  4UB6 U;  4J9O A;  2YMM A;  5AK5 A;  4FZN A;  5DQG A;  4IQU A;  4PGQ A;  2BZF A;  8ICK A;  8ICH A;  5J0T A;  5EE9 A;  4CNQ A;  5AI8 A;  2E1E A;  2J6S A;  3EYZ A;  3RJJ A;  3GU3 A;  2C2E A;  4QWC A;  2V4R A;  1COO A;  4I2F A;  4ECW A;  1ZQR A;  1ZQQ A;  3UXN A;  2KP7 A;  4K4G A;  4Y2R A;  3KHH A;  2HHS A;  4IRC A;  4DSI A;  3U26 A;  4F5N A;  2K4P A;  1X66 A;  5DLF A;  3SMV A;  2Y9T A;  5CB1 A;  5DBC A;  4UAR A;  5DGB A;  4NWI A;  3NS1 A;  4DFP A;  3NUQ A;  3JPS A;  1OXJ A;  5DG7 A;  1Z19 A;  1DK2 A;  1ZQY A;  5HHH A;  3QU7 A;  2KHQ A;  4IRD A;  9ICW A;  5ALU A;  2LPE A;  2EDU A;  2DKX A;  2IBK A;  1F0M A;  1S0V A;  2JZB A;  1XWL A;  1T7P A;  3QZ8 A;  4NY8 A;  2ALZ A;  4YR0 A;  3RH4 A;  1WUD A;  5KL8 B;  3Q8L A;  5DB7 A;  2NYV A;  1N62 A;  1WWU A;  4HYK A;  3AU6 A;  1X42 A;  2Y1I A;  3NVY A;  5FP0 A;  1SIJ A;  4QWD A;  5J2D A;  2VA3 A;  1RM6 C;  3QX7 A;  4FZM A;  2PXI A;  3H0M B;  2DPI A;  2HHQ A;  1D8Y A;  2YMQ A;  5KG6 A;  4F4W A;  4RNO A;  4KLL A;  3N28 A;  2KEY A;  3GIJ A;  3M6K A;  3AM9 A;  3KBB A;  8ICU A;  2HI0 A;  1SKR A;  3ZI4 A;  4B9U A;  5ALI A;  5F3X B;  2B0C A;  1ZQS A;  3M9N B;  4IC9 A;  2JEF A;  5IIO A;  2D3D A;  2I6X A;  3PR4 A;  1KN5 A;  3KHL A;  1NK4 A;  1NK7 A;  2W04 A;  4F91 B;  4I2D A;  5L9X A;  3AL0 B;  2IHN A;  2K4H A;  3L4P A;  2MUT B;  2DFL A;  5KFK A;  3QYP A;  2KFZ A;  4FBU A;  4EBE A;  4IQT A;  2G09 A;  4J9L A;  3RR7 A;  5L1K A;  2ZJ5 A;  4DCC A;  9ICX A;  4DL6 A;  3ETR A;  3QXG A;  4XA5 A;  5CJ7 A;  5EWG A;  3PST A;  1JN3 A;  1S5L U;  3OHA A;  5JUM A;  4ECV A;  4O3P A;  4Y2X A;  2FMP A;  2YB4 A;  3NRZ A;  3BQ1 A;  2J6U A;  2KIV A;  1SGG A;  5KFP A;  4DWI A;  5AK4 A;  5B66 U;  3GZF A;  9ICG A;  2YB1 A;  1RXW A;  4X5V A;  2F8K A;  1SL1 A;  3SZ2 A;  4J9R A;  3GV8 B;  2C22 A;  3NVW A;  1QQ7 A;  1UA1 A;  1SV4 A;  4F4K A;  1L5U A;  2ASD A;  1JIH A;  4CF5 A;  2Z7J A;  5HMM A;  4YR3 A;  2BGW A;  1K1S A;  5ALJ A;  2RRD A;  2XI9 A;  1U9L A;  2G07 A;  1ZQZ A;  3K75 D;  3EWA A;  3RTV A;  4PHA A;  4O3R A;  4ECU A;  3GIM A;  4Z6D A;  3S6J A;  3UXO A;  4OJO A;  4EEK A;  4ECS A;  2NRX A;  2ZTC A;  1L3V A;  5EWF A;  4CDG A;  3ORY A;  2UVV A;  4JK1 A;  4DO9 A;  1KFS A;  4DS5 A;  2QAR A;  5KFO A;  2KIC A;  1BPY A;  1T3N A;  1A0P A;  1B22 A;  3PSI A;  3BQ0 A;  4ED3 A;  4RQ8 A;  5KG4 A;  3LVW A;  1PZN A;  3OSN A;  4XRH A;  4RQN A;  2F8L A;  4YQW A;  1N63 A;  8ICN A;  3OHB A;  2E8M A;  1WG8 A;  1U4B A;  4TUP A;  2D8C A;  4NLZ A;  4KLM A;  4Z6F A;  2YML A;  3D2N A;  2P35 A;  5A0L A;  5AKE A;  4Z6C A;  3V7L A;  2AGO A;  1Q8K A;  2Q0Z X;  4J9S A;  4Y2J A;  3PML A;  4KLO A;  1MSW D;  8ICJ A;  5KFA A;  4TQS A;  9ICB A;  4M9N A;  2AGP A;  5J2I A;  8ICZ A;  3BQ2 A;  2C2D A;  1QLN A;  1WCN A;  4UB4 A;  2KG5 A;  4O9M A;  1FFU A;  4UAY A;  4C80 A;  2KZZ A;  4CRX A;  4QW8 A;  2W9A A;  1Z1B A;  2ZUB A;  8ICM A;  3Q8R B;  4ECR A;  2QB1 A;  2KVC A;  5ALR A;  1TK8 A;  1AQ6 A;  2LI6 A;  4GFJ A;  5AI4 A;  1CI4 A;  4EYI B;  1TFR A;  5J2H A;  4QWB A;  1ZQT A;  4IR1 A;  5AKX A;  3KHR A;  4RPZ A;  4C0Z A;  3ISB A;  5KT3 A;  2K4E A;  3MDC A;  3CNH A;  2KN7 A;  5KG3 A;  3PX0 A;  2J6T A;  5AM5 A;  2NRV A;  2I5H A;  2W9C B;  2PFO A;  4OCZ A;  4R64 A;  2K8B B;  1HIW A;  3B0Y A;  3M6Z A;  4QIW F;  3C1Z A;  3HPO A;  2DPJ A;  8ICY A;  1KLN A;  3IDW A;  2RP5 A;  5KG0 A;  1XU4 A;  4QZA A;  2W54 A;  3RJE A;  2KHV A;  2W3S A;  4EYH B;  2JXJ A;  4BWJ A;  4M0A A;  1FIQ A;  1CRX A;  2KOB A;  2NRW A;  3BS5 B;  1BGX T;  1LKY B;  4ELU A;  3M1Y A;  2IOH A;  1KFD A;  2EZZ A;  2HOF A;  3RJI A;  2MU2 A;  1TV9 A;  4RQ0 A;  1KDH A;  1IG6 A;  1Q46 A;  3L3F X;  1MC8 A;  1ZD4 A;  3V72 A;  4IQV A;  1V38 A;  5J8Y A;  4GIB A;  4RUA A;  3QEA Z;  1S97 A;  4Y2Q A;  2LYA A;  3B9J A;  3WK4 A;  1KBU A;  1SL0 A;  2BCS A;  2KKV A;  4O3N A;  4DQQ A;  3MR5 A;  2W03 A;  1NZP A;  4BDP A;  3QU5 A;  1SKS A;  2OCE A;  4DL3 A;  5CR0 A;  4KLI A;  2KTQ A;  1Z3E B;  2EZX A;  3C2M A;  4KLG A;  1F44 A;  3RJF A;  1SXD A;  2R8G A;  5AKG A;  3LK9 A;  2K8A A;  4BUG A;  2H3V A;  5J2A A;  2I9G A;  4UB5 A;  5AI0 A;  1ZQG A;  1HJP A;  4UBC A;  2BQ3 A;  2R8J A;  5L1M A;  3WKB A;  5KAI U;  5ALK A;  2W8K A;  3LWM A;  4TUR A;  4RNM A;  4DSK A;  4UAV A;  3E2E A;  4KMU A;  4DQR A;  1ZQX A;  4JV2 A;  2KSO B;  2G5H B;  5JU5 A;  2ZTE A;  1T4G A;  5J2K A;  3QUT A;  1V97 A;  1F5S A;  4QZ8 A;  4KLT A;  7ICF A;  3QUQ A;  3C1Y A;  3SD7 A;  5GTH U;  3H7I A;  1NI3 A;  9ICS A;  9ICC A;  1ZQC A;  1D9D A;  1TKD A;  3RF9 A;  3UXP A;  1HEK A;  1TAQ A;  4Y2S A;  5IIL A;  1U48 A;  5J2C A;  2M9N A;  1VDV A;  2BCQ A;  3K4G A;  5AKK A;  3NVZ A;  3SAH A;  1QH9 A;  1P7D A;  4KMO B;  1FO4 A;  2R18 A;  2FLP A;  5KFN A;  2W43 A;  2HVI A;  3RBD A;  2ASL A;  2H5X A;  4RQ7 A;  3QUC A;  1MA7 A;  4J9M A;  4CCH A;  3MDA A;  5ALT A;  3C5F A;  3WK8 A;  3PO5 A;  2YX8 A;  3M7D A;  3RRG A;  4LZD A;  1B0X A;  4QZD A;  3AUO A;  2PFQ A;  1S77 D;  4DOA A;  2ZIW A;  3GDX A;  4EEN A;  1QTM A;  4M2Y A;  5AHX A;  3I28 A;  3THV A;  1X2I A;  4I2E A;  2GWS A;  1C7Y A;  4RUC A;  4YMO A;  2XVT A;  5KFX A;  4YN4 A;  2R8I A;  3RBE A;  3K1R B;  2KIW A;  4YP3 A;  4I27 A;  3RB3 A;  3KKA A;  3KTQ A;  2XY7 A;  3PW2 A;  3MC1 A;  3DEE A;  4UAS A;  1NNL A;  2A1A A;  2ZJA A;  8ICA A;  2NO4 A;  3M9M B;  9ICR A;  8ICX A;  4A8E A;  1IXR A;  1Z1V A;  4OD0 A;  4I2J A;  1QSL A;  3CW2 C;  4PL1 A;  4JUZ A;  2F76 X;  7ICO A;  1L8L A;  4IS7 A;  4NLN A;  4DSL A;  4OO1 J;  3V7J A;  4YXM A;  4I2C A;  4EX7 A;  4RT3 A;  2BHN A;  4FS1 A;  1N2X A;  3D2Q A;  9ICN A;  3JPN A;  3SAG A;  1URJ A;  4MFC A;  3D2S A;  1Q3U A;  2JV3 A;  4DQS A;  1RQN A;  3NRW A;  1ZQP A;  2LKY A;  3O0F A;  2HBK A;  4UB3 A;  2B6G A;  5AK3 A;  3RH5 A;  4F93 B;  2G5I B;  3A0B U;  1WCL A;  9ICE A;  4ELT A;  3KFU F;  1X9X A;  8ICS A;  2FE9 A;  3H0L B;  4F3O A;  2KV2 A;  4US8 A;  5J8Y C;  2H3Z A;  1EXN A;  4C4S A;  4DS4 A;  2ZG6 A;  1SZH A;  1Z4N A;  4R8U A;  2Q4T A;  3F5E A;  1V85 A;  4C7Z A;  3PSP A;  3M8R A;  1J97 A;  4NLC A;  1SXE A;  1FFV A;  4NV0 A;  5KG7 A;  3MGI A;  1XSL A;  5KFB A;  3WKC A;  3V6K A;  2F44 A;  4Z6E A;  3WKA A;  1DK3 A;  4Y2T A;  2CPR A;  5AIB A;  2A1J A;  4KLQ A;  3TFR A;  2F3N A;  4F2S A;  4M47 A;  2W9M A;  5KT4 A;  3QUB A;  1ZOL A;  3H4B A;  7ICT A;  5AKY A;  3F2B A;  2WF7 A;  5ALX A;  4B9S A;  1QSS A;  3IG8 A;  1T8E A;  7ICU A;  1BNO A;  2BPC A;  7ICG A;  5ALE A;  2XCP A;  2L5Y A;  1QSY A;  5KNI A;  3MFI A;  5AKJ A;  1JI7 A;  5H2F U;  2ESE A;  4P4O A;  5KAF U;  5KFJ A;  2HBM A;  3UQ2 A;  1ZQO A;  4ECT A;  4F8R A;  3SEN A;  4MF2 A;  7ICK A;  1ZQV A;  5G5H A;  3T79 A;  5ALS A;  2N1R A;  4YG2 A;  3VC8 A;  1L7P A;  1L7N A;  2ZTD A;  2O6K A;  2F1I A;  3JPO A;  1SV0 A;  4QZF A;  5AM2 A;  5AM0 A;  3TAD A;  2XGP A;  2UVR A;  4F4Z A;  2RQ5 A;  2WHE A;  4J9P A;  3RAX A;  3N7R C;  5HR6 A;  3M8S A;  2IA6 A;  4EX6 A;  3JPP A;  2JZB B;  4OJ6 A;  2EZY A;  1KRP A;  2OXO A;  5KFY A;  2JHD A;  8ICW A;  1ZD2 P;  5C0Y A;  1N5W A;  2AQ4 A;  4FBT A;  4ACO A;  1RXV A;  5KFZ A;  3QNM A;  1UPH A;  2QKQ A;  4DFJ A;  5DB6 A;  2OYY A;  5BOL A;  3KKA C;  2HDO A;  4I29 A;  9ICH A;  5ALZ A;  1BPB A;  2FJ6 A;  1BPZ A;  3V6H A;  5J29 A;  4DLG A;  4DEZ A;  4YCX A;  2EAP A;  4YR2 A;  2XO7 A;  4C8O A;  2CN1 A;  4F72 A;  1PVQ A;  2K60 A;  1QQ5 A;  1K1Q A;  2NO5 A;  1CUK A;  1NKB A;  3R9K A;  1KW4 A;  1ZJN A;  4PGY A;  2ZIX A;  3CP8 A;  3LVV A;  1QQ6 A;  3PNC A;  1ZYQ A;  1SL2 A;  2P6R A;  2K8C B;  3QE9 Y;  5G5G A;  2F2A B;  3SEI A;  2WAQ C;  2E3T A;  3D6J A;  4F5Q A;  1XSN A;  1S0O A;  5GTI U;  1OUQ A;  4F4Y A;  5KFW A;  2EQY A;  1IV8 A;  2OM6 A;  5CP2 A;  5DDY A;  3IV6 A;  2JEI A;  1ZQK A;  2ZJ8 A;  4DOB A;  3ZDA A;  2F1J A;  3MR6 A;  7ICJ A;  3NGD A;  3Q8P B;  1RYU A;  5EE1 A;  4P4M A;  2EAM A;  4EEL A;  2KJ8 A;  5CRX A;  1SWW A;  4IR9 A;  1B4F A;  4BGD A;  5J0O A;  2F1H A;  1BPE A;  4QWA A;  3OJS A;  4Q44 A;  3OJU A;  4K4I A;  3HP6 A;  2XID A;  5EE3 A;  1J2N A;  2FDR A;  1D9F A;  5J2E A;  3RJH A;  1IM4 A;  3C29 A;  3RB4 A;  1ED1 A;  2ISO A;  5KTQ A;  2HMX A;  3EW9 A;  1KL9 A;  2ZIX B;  2HHW A;  1ZQ1 C;  2KZ3 A;  3IRU A;  1XO1 A;  3PY8 A;  2Y0S C;  9ICJ A;  2PFN A;  4C7Y A;  2JH1 A;  4DL7 A;  3PVX A;  8ICV A;  3WK9 A;  4J9K A;  3HJE A;  4I2G A;  1RYS A;  4C4T A;  5J0X A;  9ICV A;  4NLB A;  5KFG A;  5ALN A;  1S76 D;  4PPX A;  2DBY A;  1M6Y A;  1PK1 A;  1L3U A;  1NK0 A;  1SV0 C;  5ALG A;  4MEY A;  3TAD C;  1RDF A;  2ODG A;  2DF4 B;  1MQ2 A;  8ICQ A;  2FLN A;  5KL1 B;  2QAR B;  4M04 A;  4P2H A;  3SV3 A;  1LV5 A;  2DUY A;  3UPQ A;  2WF8 A;  2E5S A;  4KLE A;  1Y88 A;  5ALM A;  1XO0 A;  2M0N A;  7ICV A;  5JTI A;  5DB8 A;  4ED1 A;  4C8K A;  1S8O A;  2IOF A;  1QCK A;  2PMZ F;  5J0Q A;  4KLF A;  3H8J A;  5J0S A;  4EZ9 A;  4ED7 A;  4DSJ A;  5IIN A;  3MFH A;  4DOC A;  2DQN B;  1NK6 A;  2RHF A;  1X40 A;  5ALF A;  4KLH A;  4KIT B;  3N7S C;  3C5G A;  2DWQ A;  1UA0 A;  5ALV A;  2AXT U;  3M9O B;  3F2C A;  1ZQU A;  3BDP A;  1NJY A;  2OHF A;  4UB1 A;  4C8N A;  3EPI A;  2AHO B;  4QZG A;  1ZQF A;  2WB1 C;  4RQ6 A;  2LMR A;  1O03 A;  1NOM A;  2BDU A;  2PMZ C;  4DQP A;  5T14 A;  4BJQ A;  4WJ3 B;  2E8P A;  4Q8E A;  5CEH A;  5ALO A;  4BXO A;  2JH7 A;  8ICI A;  2QLT A;  4MEX A;  9ICT A;  4MF8 A;  4R63 A;  4PHP A;  4Y2U A;  1UT8 A;  1DGJ A;  3TAQ A;  9ICI A;  1L8O A;  2NRZ A;  4DFM A;  5KFE A;  3PO4 A;  5AM3 A;  4M6W A;  3SYZ A;  4Q45 A;  3UMG A;  1C20 A;  3FC4 A;  5AKZ A;  2BCR A;  2ZXH A;  2FPK A;  8ICR A;  3NVV A;  3CYM A;  3LDA A;  4YFK A;  2ES6 A;  3NAS A;  1UHU A;  2P6U A;  5JRT A;  4ED0 A;  3PW0 A;  4I28 A;  1JX4 A;  1DRG A;  2QB0 A;  3EPG A;  3HIL A;  4I2I A;  2PI4 A;  3FM9 A;  4F5P A;  3ONN A;  3JPT A;  5KFQ A;  1NKC A;  2ZIV A;  4CF4 A;  3T3F A;  1N48 A;  3TI0 A;  1HUZ A;  2Y1J A;  2HCF A;  2HHU A;  2E8O A;  3AQE A;  3K1Z A;  5IIJ A;  9ICQ A;  7ICQ A;  4BWM A;  3T5H A;  1BNP A;  2AQ0 A;  3MGV A;  9ICK A;  3L5K A;  4BXO B;  5DGA A;  5ALQ A;  2V9W A;  5AK6 A;  3PW4 A;  3TAC B;  4KTQ A;  1COK A;  2LHT A;  5K4L A;  4Y2V A;  3IN5 A;  1GO3 F;  4J03 A;  4M6W B;  9ICA A;  3RR8 A;  1TVA A;  1FEZ A;  2R8H A;  2GH1 A;  7ICE A;  2LBO A;  5L1I A;  8ICO A;  1XS9 D;  2VA8 A;  3ISC A;  4F2R A;  2HW3 A;  3GV7 B;  4F92 B;  1DOQ A;  5D49 A;  5KFD A;  2H3I A;  3GV5 B;  4I2A A;  4O3M A;  2C2R A;  3EZ5 A;  4F5R A;  2W7P A;  4PZN A;  3SI8 A;  4KLS A;  2QB0 B;  5TZV A;  2W8L A;  4KX5 A;  1KKX A;  5E79 U;  2EAN A;  3C23 A;  1NJX A;  3A0H U;  2H3F A;  1D8L A;  2KE7 A;  5III A;  5ALH A;  1X6I A;  3HWT A;  2XIC A;  5KT6 A;  1YZ6 A;  5AIA A;  1NK8 A;  1L3T A;  2KJ5 A;  1WWV A;  3QEB Z;  8ICF A;  3PX4 A;  1BPX A;  3T5K A;  1ZQD A;  4FZL A;  4GXJ A;  1ZQI A;  5AI9 A;  3BJY A;  4KLJ A;  4USA A;  2E1F A;  5ALP A;  7ICN A;  2HVH A;  8ICL A;  1UT5 A;  4PL2 A;  1ARO P;  4TUQ A;  4M9H A;  5BPC A;  4NLK A;  3ZD8 A;  1TK0 A;  2BPG A;  1LB2 B;  2HBJ A;  5CHG A;  5DQI A;  4B9N A;  3H8S A;  2MSN A;  4CF3 A;  3V7K A;  2DKZ A;  2G08 A;  4NM2 A;  1ECW A;  5BOM A;  4NJ8 A;  5ALY A;  3RB6 A;  3IHQ B;  3UM9 A;  4YVZ A;  1U45 A;  4O3Q A;  1B43 A;  1X9M A;  2PFP A;  2JMG A;  2W55 A;  3KZX A;  4M9J A;  3KHG A;  5HHI A;  3AMZ A;  2RDJ A;  2GLE A;  2UVU A;  3HKZ F;  2ZIW B;  4O3O A; 
#chains in the Genus database with same CATH homology
 2F44 A;  3TAC B;  3KKA C;  1COK A;  2F8K A;  2LMR A;  2EAO A;  3K1R B;  2F3N A;  2KG5 A;  1SV4 A;  1SXD A;  2E8P A;  2EAP A;  3KKA A;  2DL0 A;  4PZO A;  4PZN A;  2K60 A;  2QB0 B;  5F3X B;  5L1M A;  2EAN A;  2E8N A;  2QB1 A;  2KE7 A;  1Z1V A;  1KW4 A;  1WWV A;  2KSO B;  3BS7 A;  2KSO A;  5JU5 A;  2D3D A;  2L5Y A;  2Y9U A;  5KNI A;  3BQ7 A;  2ES6 A;  4IS7 A;  1PK3 A;  5JRT A;  1JI7 A;  1PK1 B;  2K4P A;  1X66 A;  2ESE A;  3SEI A;  1PK1 A;  2QB0 A;  1OW5 A;  1SV0 C;  3TAD C;  3HIL A;  2Y9T A;  1UCV A;  2QAR B;  4NL9 C;  2QAR A;  3SEN A;  3IDW A;  1OXJ A;  2JV3 A;  1UQV A;  4RQM A;  1SV0 A;  3TAD A;  5JTI A;  2B6G A;  4NL9 A;  2LPE A;  3BS5 B;  2KMD A;  4RQN A;  3BS5 A;  2DKX A;  1LKY B;  1X9X A;  2DKZ A;  1LKY A;  2FE9 A;  2E8O A;  1F0M A;  2EAM A;  5J8Y C;  2E8M A;  4NJ8 A;  1B4F A;  1X40 A;  2D8C A;  4MHV A;  1V85 A;  3H8M A;  1B0X A;  1V38 A;  2KIV A;  1SXE A;  5J8Y A;  1SGG A;  1DXS A;  2GLE A;  1WWU A;  2QKQ A;  1RG6 A;  2YTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...