4IS7A

Crystal structure of the caskin2 sam domain tandem
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
GADAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the CASKIN2 SAM Domain Tandem
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Caskin-2
total genus 42
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A01
2E8NA 1PK3A 2K60A 2F44A 3BS5B 2K4PA 5JRTA 2Y9UA 4IS7A 3TACB 3KKAC 2YTUA 2KG5A 2ES6A 5F3XB 2QARB 2KSOB 1SV4A 2EAOA 1V85A 2QB1A 3KKAA 5KNIA 2DKXA 2DKZA 2L5YA 2D3DA 4RQMA 5J8YA 3TADA 3H8MA 4NL9A 2LMRA 2KMDA 1Z1VA 1OXJA 2KIVA 1DXSA 1V38A 1SXEA 3BS5A 1SV0A 1LKYB 1OW5A 1X40A 2D8CA 4RQNA 1X9XA 2EAPA 2KE7A 2QARA 2F3NA 2KSOA 2E8MA 1UQVA 1F0MA 1SGGA 3TADC 4PZNA 2GLEA 2QB0A 2QKQA 3BQ7A 3SENA 2Y9TA 1SV0C 4PZOA 1PK1A 2DL0A 3K1RB 2E8PA 3HILA 1X66A 2FE9A 4MHVA 2E8OA 2QB0B 5L1MA 1WWUA 4NL9C 3IDWA 2LPEA 1RG6A 1COKA 1SXDA 2ESEA 1JI7A 3BS7A 2EAMA 3SEIA 1B4FA 1KW4A 5JU5A 1LKYA 5J8YC 1PK1B 1B0XA 2EANA 5JTIA 1UCVA 2JV3A 2B6GA 1WWVA 2F8KA 4NJ8A
chains in the Genus database with same CATH superfamily
3PZPA 3SAGA 1XS9D 7ICTA 2PMZF 4O3PA 3TFRA 1U45A 4KMUA 5ALRA 2KKPA 5KFOA 2ZUDA 4P0QA 4J9SA 2ES6A 3TFSA 3RBEA 4UASA 2YMMA 2LBOA 3M1YA 8ICKA 1ZQXA 2F1IA 1TK8A 1RDFA 5KFYA 8ICFA 5KFIA 3RH5A 4KLMA 3BS5A 4NLCA 1OW5A 2BPFA 1KN5A 1SIJA 9ICIA 1S0NA 4Y2TA 1ZD4A 4CRXA 1Z00B 3C23A 2BQRA 5D46A 3RF9A 5AKIA 2D6FC 3ZDEA 4ZOHC 9ICQA 2NRZA 3V6KA 5KG1A 7ICRA 1MC8A 3KTQA 2BQ3A 8ICVA 3GILA 2FI1A 5TZVA 4YR0A 5C5JA 5KFKA 4GXJA 3RFAA 2BCUA 7ICJA 4NL9C 3WK6A 2ZTDA 4UB2A 2J6SA 4DFMA 5DB9A 2ZIVB 1TVAA 7ICKA 1WG8A 1SZHA 3QE9Y 3IM1A 1RYUA 2ZIXA 4IQWA 1ZQKA 1JALA 3OTQA 4LVSA 3FC4A 3M6KA 5JUMA 3WKEA 1LVHA 4GC7A 4O5CA 2YQEA 3CP8A 3ZD8A 2N1RA 2Y0SC 2KEYA 5AM2A 3WU2U 2HHTA 1ZQLA 1UPHA 1D9DA 5DKWA 4UATA 3Q8KA 4CDGA 4ECSA 4R8UB 3JPSA 1SB3C 2ZJ8A 4FZMA 3EPGA 4ECXA 2D3DA 3TI0A 3TADA 7ICSA 5DLGA 2I1QA 4ECRA 4F4YA 3KHGA 1A0PA 3EZ5A 1OXJA 3GV7B 3M9NB 3LVWA 2PFPA 5ALPA 5ALXA 2XY6A 1C20A 4C80A 4ECWA 4DSIA 5KT7A 1Z4OA 4J9OA 1RQLA 3N97B 5DG7A 2KNJA 4ELUA 5A0LA 3OHAA 1NKBA 5KAIU 8ICBA 2KJ9A 1CI4A 5AKLA 1QSLA 1IM4A 4Y2QA 3EYZA 2QKQA 3L5KA 2Q0ZX 4JWNA 2RDIA 2E8PA 1QQ6A 3NRZA 5DDYA 4OJ6A 3IV6A 4O3QA 2WB1F 4KN7A 4IRCA 5AM0A 1SL2A 2AH5A 2CXYA 2ZUBA 2BPGA 4O3NA 9ICUA 2H3FA 2AGOA 3UXNA 1N5XA 3DDHA 4TUQA 4OJLA 3BQ1A 4DOBA 3KFUF 4QZBA 1H38A 4BDPA 4LJXA 3H0LB 4FO6A 2G08A 2BGWA 5AKXA 2G0AA 4J9LA 1ZRNA 3PSFA 5AIBA 4IL6U 3JPQA 4DLEA 1NK5A 4F2RA 4J9RA 1J97A 4FBTA 1C7YA 1GO3F 1J2MA 4QWEA 1KFSA 1KQQA 1F5SA 2W9BB 2XICA 5KG3A 3PW4A 5KFPA 1SWVA 4Q44A 1ZQNA 2JEGA 3UQ0A 2IA6A 1BVSA 4YVZA 3HJEA 5F9LA 2W9BA 3TACB 5KT6A 5KT4A 4KLFA 1JUDA 2DGZA 4BJQA 1K1SA 4M9HA 3PW2A 1V85A 5IIJA 2P6UA 3MR6A 1Q3VA 3VCBA 4MEYA 2KICA 3HKZC 2OXOA 1TAMA 2KHVA 4DQSA 4CNQA 3KHLA 3EPIA 3ETRA 3MR3A 5IIOA 4NY8A 2GWSA 1HJPA 5EWGA 1PVRA 1XSLA 1HUZA 5J2AA 1S5LU 2EDUA 1N63A 4ED3A 1UHUA 4DL2A 5HMMA 3C5FA 2J6TA 4RPZA 4KLQA 4KLTA 1DGSA 1XC9A 5ALYA 4ACOA 1U4BA 4QNLA 4OJ5A 4Y2SA 3BQ2A 1PK1A 3ZDAA 2DF4B 3R9KA 3QUCA 4QZFA 8ICUA 4DQPA 2H3QA 4UAWA 5L1MA 4Q45A 4IRKA 8ICAA 4RQ3A 4RQ8A 4I2JA 3RJKA 8ICHA 3KOOA 2DWQA 4ECVA 3B9JA 3PW7A 2PFQA 1JI7A 3BS7A 4M47A 3RTVA 4EZ6A 2B21A 4QIWC 4RQ0A 1KBUA 3THVA 1L3UA 1UA0A 5J8YC 2BZFA 4P4MA 3LK9A 4PHEA 5CB1A 4ECYA 3GV5B 3A0HU 4NJ8A 4Z6EA 4DFKA 1FFVA 4DOAA 1S0OA 2E8NA 5BPCA 1Z00A 3H0MB 4DFJA 4RNMA 4GLXA 5L1IA 1VDVA 3N4MB 3NUQA 4LZDA 1ZQGA 1MQ2A 4ED2A 4UBCA 3H7IA 1DOQA 4DSEA 2UVRA 3RJJA 3ISDA 2AGQA 4YQWA 3NVWA 4XA5A 1RM6C 1DXSA 4RZRA 2ISPA 2HSZA 4QW9A 2D8CA 4RPYA 4C8MA 3AL0B 2XY5A 1KKXA 3ICXA 4QWCA 4I28A 3SAHA 1HEKA 1B22A 2GLEA 2K8CB 2EZZA 1K5OA 3H4BA 1QTMA 2J6UA 3LYSA 1XSNA 4DL5A 1SL1A 1D8YA 5KG0A 3M9MB 4EYHB 3SR6A 1RQNA 1SKRA 5J0TA 4XQ8A 4HAIA 2JXJA 3JPTA 3TANA 3MFIA 1TK5A 1ZRMA 3ED5A 3AMZA 1L7OA 3PMLA 1JROA 2HHUA 1DGJA 2W43A 5EWEA 2HHXA 9ICSA 2JV3A 1JRPA 2YMLA 3ZD9A 5J0YA 2H3IA 1KEJA 1S9FA 3TAQA 3FAHA 4I2BA 4PL2A 2V4RA 3F5AA 3OSPA 1A6SA 5DBAA 2ZG6A 1RYRA 4U7CA 5J0XA 1X9MA 2I9GA 3PW0A 4U6PA 4PGXA 2YTUA 4DFPA 5AI5A 1NK7A 2JH1A 4FS1A 4M2YA 4UW9A 3RAQA 2WF9A 3SV4A 4F3OA 3OPXA 3HX0A 3T5LA 3WKDA 1YT3A 2ZIWA 5D49A 1ZQTA 1U49A 3GQCA 2OWOA 1Z1VA 2RHFA 5KG5A 3QZ7A 3GIMA 1ZJNA 1N2XA 4Q43A 3UQ2A 1SKSA 4F4ZA 2WFAA 4M6WA 2G5IB 4QZCA 4DL3A 2PI4A 4C7YA 2CN1A 2F3NA 3B0XA 2FPMA 4RQ6A 1MSWD 1ZQEA 3M7DA 2GOLA 3NS1A 3QUQA 1FO4A 2HVHA 1RXWA 4PZOA 2KKVA 3RB0A 3ZI4A 5AK6A 1X66A 2CPRA 3C2LA 1WCNA 4PHDA 3JPOA 4EELA 5AM3A 2UVWA 5IIIA 5AK5A 4G3IA 3QUTA 1IIPA 1NZPA 5KG7A 9ICRA 2O6KA 2H3ZA 1WCLA 2IOHA 3LWLA 1T8EA 4DLGA 5J2GA 2HBJA 1ZQCA 1Y88A 2ZIUB 2ZIWB 4PPXA 4M9NA 2DQNB 3I76A 3SAFA 5KFDA 4YXMA 5KTQA 1ZQFA 1ZD3A 3JPPA 4OJOA 1BPYA 5DB6A 2KZMA 7ICOA 3QZ8A 5KFXA 1BPXA 1AQ6A 3H40A 3M6ZA 2QB1A 9ICVA 3HT3A 3EWAA 3QXGA 2W3RA 3FM9A 3MBYA 4F50A 5J0RA 3NVZA 5IILA 4DFDA 3Q8QB 4B6JA 5ALMA 4Y2XA 2I6XA 3V6JA 4RQ5A 2KIVA 1FFUA 3NASA 3J81j 3JPRA 1SKWA 4RNOA 3F53A 3V72A 4G9BA 3WKBA 4AYBC 3HKZF 3Q8LA 1ZQBA 1QCKA 1MQ3A 4KLSA 2E8MA 2ASLA 4RQ7A 2W9AA 2E1EA 2ZXHA 2FMQA 3H8SA 4KLHA 1ZQPA 4I2FA 1UA1A 4QZ9A 5ALDA 4QZHA 3MFHA 7ICGA 2CRXA 4ICAA 8ICXA 4OCZA 5J2BA 4YCXA 2MUTA 5BOMA 1S0VA 4EEKA 1NK6A 2Y0SF 4KX3A 4F4WA 1NI3A 4F4XA 9ICWA 3KZXA 1XO0A 3ZDDA 1KW4A 4F8RA 4PJ0U 9ICKA 5HNKA 5AI4A 2AQ4A 2B6GA 3WK4A 4YXJA 3GIIA 8ICYA 5ALSA 5J2IA 2VA3A 3AM9A 2FDRA 2F76X 1SL0A 5DLFA 5ALTA 2NO4A 5EE9A 3HW8A 1KDHA 4RQ1A 4B9VA 1T3NA 3ISCA 3D2NA 1NJXA 5H2FU 3AU6A 5KNIA 3OJUA 9ICAA 1Z3EB 5EE1A 4I29A 3H8MA 4NL9A 4PGQA 4QZEA 2IHMA 1MN8A 3AQEA 3N7PD 3H8JA 2KIWA 4NLBA 4QWBA 2ZXIA 4IQUA 4DOCA 5AKJA 9ICGA 3G6VA 2KVSA 2KE7A 5KFMA 4BUGA 2NV3A 2W03A 2XO7A 1N60A 5KAFU 7ICLA 4JMUA 2XGPA 3NRWA 3OGUA 1BNPA 2ODGA 1QH9A 2VJ4A 4B9LA 4ECUA 5J2CA 3ZDBA 2IHNA 5ALEA 2W9CB 1TFRA 3T79A 2IOFA 3PR5B 4FZNA 3V6HA 4EENA 4KTQA 9ICTA 3PO4A 2KJ8A 1TKDA 2W9CA 4NV0A 4PHPA 3M8RA 1DK2A 3IDWA 4FE3A 4C8OA 2WAQF 4RQ4A 1SXDA 1WYGA 4EX7A 4NM1A 3AN1A 4FS2A 4QZIA 4YN4A 1B0XA 2WAQC 1PVQA 4P4OA 1QQ5A 1WWVA 5F9NA 1JXLA 1KRPA 2BKEA 5ALHA 5DQIA 5CA7A 5AI0A 1ZQAA 4P0PB 1NZBA 2K60A 2F44A 5L1KA 4YP3A 3SV3A 3BS5B 4DQRA 4I2DA 7ICVA 4DS4A 4F93B 2ALZA 2JEJA 4F4KA 2KG5A 3Q8SB 4RPXA 1XO1A 4YR2A 2C22A 1ZQDA 3RR7A 4KN4A 3HPOA 1S10A 4F5RA 2AJQA 2YY6A 2ASDA 1NKCA 5DB8A 2ZUCA 4RQMA 2ZJ5A 4EBDA 2KMDA 5AICA 4YMMA 1O03A 5GTHU 5KFSA 3ALRA 2EZXA 4MF2A 1TAQA 8ICMA 2A1JB 5ALUA 2FLNA 1ZXIA 4Q8EA 4DF4A 4UAUA 2IBKA 5HHIA 3B0YA 3GIKA 3MGVA 5ALNA 3SI8A 4F5OA 4Y2VA 2JHDA 1ZQVA 4MFCA 5J2DA 2DL0A 4R63A 2YB4A 4I2AA 1JXEA 3ORYA 2LYHA 4QZ8A 1ZQ1C 2ZIXB 4M9JA 2P66A 2VIXA 2KK0A 1NK8A 1S97A 4R64A 2HBLA 2AHOB 2HOQA 2G5HB 2IMWP 3H4DA 4TUPA 5AM1A 3C1ZA 2HVIA 4PGYA 1LKYA 2DBYA 3GDXA 2OH2A 2ISOA 4Y2JA 1UT5A 3K1ZA 4O3MA 2YMPA 3WK5A 2WB1C 1KLNA 1XSPA 1VLBA 3WKCA 4EBEA 5EOZA 5KFTA 1VJ5A 3GZFA 3KHHA 5ALVA 4FFDA 2ZTEA 2JH7A 4CF5A 2P35A 4Y2YA 3MDAA 2BCVA 2KN7A 3RBDA 5AHXA 2RP5A 5HHHA 4KLEA 5ALGA 2LKYA 3BJYA 2OHFA 5DG9A 4KX5A 3RJEA 2KFZA 3OJSA 4EYIB 3RR8A 5KFEA 1V38A 3CYMA 5EWFA 4B9SA 9ICCA 1ZYQA 4TUSA 1SV0A 1B43A 1LKYB 3IHQB 4UB6U 4RQNA 4M9GA 4UAVA 4IR1A 2BCQA 4O3RA 4GXKA 5KFJA 2KSOA 3UMCA 2WF6A 2HOIA 1ECWA 1SGGA 4F5PA 4YFKA 3NVVA 3NVYA 1IG6A 1D9FA 5J0PA 2M9NA 2YB1A 2NRTA 5KFUA 1RPLA 4UB5A 4O9MA 1K1QA 2FE9A 5KL1B 4DSLA 1L8LA 3MR2A 2E8OA 4F71A 1T4GA 4RT2A 3BQTA 2PKEA 2KV2A 4UB1A 8ICPA 4Q8FA 2H5XA 1YZ7A 3IP4B 5KT2A 5IIMA 2W8KA 1P7DA 4DS5A 1COKA 3PY8A 2YX8A 2HBKA 4UARA 1B4FA 4RUCA 3QU7A 3PV8A 5JU5A 3F2CA 3PX0A 2VA8A 2EANA 5DBCA 1M6YA 5JTIA 4P4PA 2XIDA 5CJ7A 5J2JA 2XCAA 8ICQA 2F8KA 5AKYA 1KFTA 1X9SA 2OYYA 2ZTCA 1EXNA 5E79U 7ICFA 3MC1A 4O3SA 3M9OB 3QU5A 2GH1A 1TV9A 2GO7A 2KSOB 2R18A 4F91B 1XWLA 3RJIA 5J8YA 1BPZA 2R8IA 4EBCA 4KMOB 3E0FA 1ZQIA 4C8NA 4J9MA 1N48A 2FMPA 1TK0A 1ZQHA 3CRXA 4ZH4A 1X40A 2PI5A 8ICRA 1X9XA 5ALZA 2ATLA 4DL7A 1F44A 8ICTA 5CP2A 3LWMA 5ALQA 5ALLA 5G5HA 1L8OA 7ICMA 3BDPA 4BWJA 3Q8MA 4BWMA 1SWWA 2JZBA 3V7LA 1FEZA 3SENA 1ZQZA 3UPQA 2DPJA 2LM4A 5KFLA 4RQ2A 2HCFA 4DSKA 4F92B 3T5JA 2YMQA 3KBBA 2W11A 3NGDA 5J2FA 1ZQMA 2HBMA 5AKGA 3N28A 3MGHA 4P0QB 2Y1JA 1T7PA 2W04A 4GFJA 2R8KA 5GTIU 2JGAA 2VANA 2HOFA 4J9PA 3C1YA 3ETLA 4C0ZA 1NKEA 5L1LA 2A1JA 3AEVA 4O5EA 4ECQA 1UCVA 4DQQA 1AROP 4OD0A 2JEFA 5BOLA 3T5HA 4J9NA 5DGAA 3D2QA 4UBBA 1ZQYA 1DRGA 2KFNA 2AU0A 1BPEA 2PFNA 2Y9UA 2WHEA 3PX6A 2P6RA 1OUQA 4BGDA 1NK9A 4J9QA 4GXIA 3IN5A 3G6YA 2RLTA 4PHAA 5J2HA 4NLGA 4B9UA 1L5UA 4F5NA 9ICPA 2LM1A 5CHGA 1A77A 2BCSA 2FJ6A 1JIHA 1NJWA 5IINA 1KL9A 3RB3A 1L6NA 3O0FA 3I28A 1SXEA 3K4GA 4J03A 5KFQA 2KVCA 1L3TA 2YN4A 4MFFA 2K89A 1BPBA 5EE0A 4KLDA 1U48A 5T14A 2Q4TA 2NRWA 3WK7A 1NOMA 4ECZA 2LHTA 3C5GA 3JPNA 3S6JA 2BPCA 2QB0A 1PZNA 2C28A 5KFRA 3BQ7A 4UAYA 5AM4A 4ED7A 2F77X 1JX4A 1BGXT 4I27A 5HR6A 3HILA 3H8WA 1MA7A 1DK3A 4QW8A 1ZQOA 3FYHA 5TISU 1LV5A 5AIAA 3QU9A 1WWUA 3DV9A 5AM5A 1ZQRA 2UVVA 5KFVA 8ICSA 5AKHA 2XY7A 4NXZA 3N7SC 2W8LA 4ED6A 5KFBA 2EAMA 3UXPA 2W9MA 2HMXA 4JB3A 5G5GA 3GFKB 5J2KA 1RYSA 3PW5A 4KLOA 3F2DA 5ALOA 5ALFA 9ICBA 4YD1A 1UT8A 3QX7A 5HP4A 4YMNA 1URJA 4R8UA 3I1YA 2LYBA 4K4HA 3E58A 4JV0A 2WF7A 1ED1A 1V9PA 8ICWA 4Y2RA 5B66U 1NJYA 1ZD2P 2MU2A 2WF5A 2EAOA 3WK8A 4CF4A 1JN3A 5KFGA 4C7ZA 2K8AA 3K75D 3A0BU 4BX9C 2AGPA 1ZQJA 3T5KA 7ICPA 2R8HA 1CRXA 4UB4A 4USAA 4PL1A 1TE2A 3RH4A 1N56A 4KLJA 2W7PA 8ICGA 2LYAA 4R65A 2QARA 2W54A 2BQUA 4RT3A 2HDOA 1Z1BA 5L1JA 4DCCA 1V97A 3LVVA 1U9LA 1ZJMA 3C2KA 1RZTA 2K8BB 4RU9A 5AKKA 2PFOA 4ELVA 3U26A 2W55A 1J2NA 5DQGA 2NRVA 1ZETA 4RUAA 1COOA 2K4EA 3V7JA 4Z6DA 3IG5A 3PSIA 2NYVA 5K4LA 4M9LA 1PUZA 2JRZA 4NWIA 4DSJA 4HYKA 1X6JA 5AK3A 2ESEA 4XRHA 1IV8A 3VC8A 2XCPA 4K4GA 4K4IA 4P2HA 2AXTU 4DL6A 1QQ7A 1HIWA 5DDMA 2EH9A 3IG8A 3HWTA 5ALIA 1PK1B 4RNNA 3GU3A 3ISBA 3D2SA 2XI9A 7ICNA 3RH6A 2IOFK 2HHQA 1PVPA 9ICXA 2A3VA 1PK3A 3BZKA 4FBUA 3QNMA 2RDJA 4IS7A 4MF8A 3QU4A 4PH5A 1N62A 5KFFA 1L3SA 2KZZA 2EZYA 4DO9A 3OSNA 2DKXA 3Q8RB 2OM6A 5IIKA 4DSFA 2DKZA 2ASJA 2HI0A 2KD1A 4Z6CA 2LMRA 3TQ1A 8ICLA 1XU4A 3L3FX 5J0WA 5C0YA 4GIBA 5ALKA 3MDCA 4CGZA 4B9TA 2C2RA 3PVXA 2KTQA 3PSPA 2FLPA 2A1AA 4US8A 2KOBA 4ELTA 5ALJA 1F0MA 3CW2C 2HHSA 2JR5A 3TADC 4QZAA 7ICHA 3RAXA 2VJ5A 2BHNA 4I2EA 1IXRA 2F1JA 4IQVA 3UMBA 3Q8PB 1ZQWA 3K1RB 3RRHA 3GIJA 2MRLA 9ICNA 5KFCA 4QWAA 4F72A 7ICEA 2OEHA 2M0NA 3PR4A 4ED1A 3C28A 5KT3A 2R8GA 4KITB 3H0RB 4JV2A 4NM2A 2E1FA 4Y2UA 4YMOA 3CNHA 1X9WA 9ICFA 1Z4NA 3EW9A 4A8EA 3PNCA 3M8SA 4X5VA 5AI8A 1Q3UA 4B9MA 4IC9A 2A19A 2ZJAA 1N61A 3FDSA 4TURA 5KFAA 4YD2A 3D6JA 1BPDA 2XGQA 3PO5A 2HW3A 2OCEA 4KLIA 2NO5A 5JRTA 4DL4A 4P0PA 2Z7JA 3KKAC 9ICOA 5AI9A 2W7OA 2I5HA 5KG6A 2DUYA 5DG8A 3PMNA 8ICNA 2V9WA 3KKAA 5J0OA 3F5EA 4UAZA 5CRXA 4QZDA 4QJFB 2L5YA 2K4IA 2FLLA 2LI6A 2JEIA 2JZBB 4MEXA 1KSPA 7ICQA 2C2DA 1WUDA 2R8JA 4C8KA 3AUOA 9ICHA 3TKAA 3G6XA 4EEYA 4EZ9A 1NNLA 1KTQA 1S8OA 2BDUA 1UQVA 2XVTA 4PZNA 5AKZA 3SMVA 3SYZA 3RJGA 3AQFA 1HUOA 5DBBA 8ICCA 2K4HA 7ICUA 1SZPA 1S76D 4ED8A 3C21A 3QYPA 1QSYA 2WF8A 2QB0B 4AP9A 2KZ3A 9ICMA 4BXOB 2ZIVA 3L4PA 8ICZA 2E3TA 2F2AB 1CUKA 1T3QA 2KHQA 4F2SA 4BXOA 3KD3A 4NLZA 1RXVA 1KFDA 3F2BA 4M04A 3EUB2 8ICOA 5HMLA 2E5SA 3PSTA 2H3VA 4US9A 2HHWA 3UXOA 1NJZA 1FIQA 4I2HA 5FP0A 3AU2A 3UMGA 4CF3A 3SQIA 5CR0A 4KLGA 2K4PA 3MR5A 3KHRA 3RB6A 5J0SA 5ALWA 5KG2A 1Z19A 1QSSA 4JK1A 5DQHA 5KT5A 1L3VA 1CEZA 5F3XB 3RRGA 1X42A 2QLTA 4FZLA 4C4SA 1X2IA 4IRDA 4O5KA 4IQTA 4DEZA 1BNOA 2G07A 2VKQA 1N5WA 4O0IA 3BZCA 1Q46A 2V4QA 3MABA 8ICIA 3SZ2A 2PMZC 5CEHA 1L7MA 3HP6A 3N7RC 5J2EA 5HR7A 3WKAA 2FMSA 4M6WB 2UVUA 3QEAZ 5L9XA 1NK0A 3QU2A 3RJFA 5AK4A 4QIWF 2EAPA 3UM9A 2MA1A 4I2GA 3SD7A 4M0AA 5AKEA 2PXIA 4E0DA 5CWRA 1JMSA 4YR3A 2DFLA 3ONNA 4NLKA 4F5QA 1L7NA 5DGBA 3OHBA 2RRDA 3QUBA 5EE3A 8ICJA 2Y9TA 4IR9A 1SV0C 3MGIA 3RB4A 3DEEA 2XC9A 5D4BA 4CCHA 4MHVA 1ZQSA 1L7PA 3T3FA 2KP7A 4JWMA 1D8LA 1O08A 1NK4A 9ICLA 4ED0A 3E2EA 2LPEA 2ZIUA 4TQSA 4OO1J 4AYBF 5DB7A 2C2EA 4ECTA 5KFWA 4JV1A 3SEIA 2WTFA 4JUZA 3C29A 2BR0A 4QZGA 3QEBZ 4CE6A 1U47A 2F8LA 2G09A 4C4RA 2MAXA 5KFHA 2FPKA 2W3SA 3TAPA 9ICJA 4YG2A 2MUTB 2BCRA 2RQ5A 2VA2A 4B9NA 4Y2PA 1ZD5A 1LB2B 2HHVA 1A76A 2DPIA 1TAUA 1S77D 3TARA 5KFZA 5KFNA 2QARB 1SV4A 3KZIU 2EQYA 1ZQUA 2KJ5A 4R66A 1XNSA 3C2MA 4C8LA 4I2CA 4TQRA 1QLNA 4OJPA 3RJHA 1D8BA 4XUSA 4Z6FA 3NTUA 3BQ0A 3PX4A 2NRXA 5KG4A 4KLUA 2BDPA 4GC6A 5J29A 1X6IA 4MFAA 5KL8B 4UB3A 2Y1IA 4J9KA 1T94A 2B0CA 3WK9A 1ZOLA 4DWIA 9ICEA 4LZGA 4DQIA 4WJ3B 2JMGA 2FPLA 4UB8U 3IRUA 3LDAA 4QWDA 1YZ6A 1RG6A 3HRDD 4NLNA 2AQ0A 4EX6A 4C4TA 5J0QA 5J0UA 2G06A 5B5EU 3GV8B 4I2IA 4O3OA 7ICIA 1ZQQA 4DF8A 3V7KA 5AI6A 4KLLA 1Q8KA 2MSNA 4UQGA 1S0MA 2F1HA 8ICEA 3ZDCA
chains in the Genus database with same CATH topology
2E8NA 1PK3A 2K60A 2F44A 3BS5B 2K4PA 5JRTA 2Y9UA 4IS7A 3TACB 3KKAC 2YTUA 2KG5A 2ES6A 5F3XB 2QARB 2KSOB 1SV4A 2EAOA 1V85A 2QB1A 3KKAA 5KNIA 2DKXA 2DKZA 2L5YA 2D3DA 4RQMA 5J8YA 3TADA 3H8MA 4NL9A 2LMRA 2KMDA 1Z1VA 1OXJA 2KIVA 1DXSA 1V38A 1SXEA 3BS5A 1SV0A 1LKYB 1OW5A 1X40A 2D8CA 4RQNA 1X9XA 2EAPA 2KE7A 2QARA 2F3NA 2KSOA 2E8MA 1UQVA 1F0MA 1SGGA 3TADC 4PZNA 2GLEA 2QB0A 2QKQA 3BQ7A 3SENA 2Y9TA 1SV0C 4PZOA 1PK1A 2DL0A 3K1RB 2E8PA 3HILA 1X66A 2FE9A 4MHVA 2E8OA 2QB0B 5L1MA 1WWUA 4NL9C 3IDWA 2LPEA 1RG6A 1COKA 1SXDA 2ESEA 1JI7A 3BS7A 2EAMA 3SEIA 1B4FA 1KW4A 5JU5A 1LKYA 5J8YC 1PK1B 1B0XA 2EANA 5JTIA 1UCVA 2JV3A 2B6GA 1WWVA 2F8KA 4NJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8N A;  1PK3 A;  2K60 A;  2F44 A;  3BS5 B;  2K4P A;  5JRT A;  2Y9U A;  4IS7 A;  3TAC B;  3KKA C;  2YTU A;  2KG5 A;  2ES6 A;  5F3X B;  2QAR B;  2KSO B;  1SV4 A;  2EAO A;  1V85 A;  2QB1 A;  3KKA A;  5KNI A;  2DKX A;  2DKZ A;  2L5Y A;  2D3D A;  4RQM A;  5J8Y A;  3TAD A;  3H8M A;  4NL9 A;  2LMR A;  2KMD A;  1Z1V A;  1OXJ A;  2KIV A;  1DXS A;  1V38 A;  1SXE A;  3BS5 A;  1SV0 A;  1LKY B;  1OW5 A;  1X40 A;  2D8C A;  4RQN A;  1X9X A;  2EAP A;  2KE7 A;  2QAR A;  2F3N A;  2KSO A;  2E8M A;  1UQV A;  1F0M A;  1SGG A;  3TAD C;  4PZN A;  2GLE A;  2QB0 A;  2QKQ A;  3BQ7 A;  3SEN A;  2Y9T A;  1SV0 C;  4PZO A;  1PK1 A;  2DL0 A;  3K1R B;  2E8P A;  3HIL A;  1X66 A;  2FE9 A;  4MHV A;  2E8O A;  2QB0 B;  5L1M A;  1WWU A;  4NL9 C;  3IDW A;  2LPE A;  1RG6 A;  1COK A;  1SXD A;  2ESE A;  1JI7 A;  3BS7 A;  2EAM A;  3SEI A;  1B4F A;  1KW4 A;  5JU5 A;  1LKY A;  5J8Y C;  1PK1 B;  1B0X A;  2EAN A;  5JTI A;  1UCV A;  2JV3 A;  2B6G A;  1WWV A;  2F8K A;  4NJ8 A; 
#chains in the Genus database with same CATH topology
 3PZP A;  3SAG A;  1XS9 D;  7ICT A;  2PMZ F;  4O3P A;  3TFR A;  1U45 A;  4KMU A;  5ALR A;  2KKP A;  5KFO A;  2ZUD A;  4P0Q A;  4J9S A;  2ES6 A;  3TFS A;  3RBE A;  4UAS A;  2YMM A;  2LBO A;  3M1Y A;  8ICK A;  1ZQX A;  2F1I A;  1TK8 A;  1RDF A;  5KFY A;  8ICF A;  5KFI A;  3RH5 A;  4KLM A;  3BS5 A;  4NLC A;  1OW5 A;  2BPF A;  1KN5 A;  1SIJ A;  9ICI A;  1S0N A;  4Y2T A;  1ZD4 A;  4CRX A;  1Z00 B;  3C23 A;  2BQR A;  5D46 A;  3RF9 A;  5AKI A;  2D6F C;  3ZDE A;  4ZOH C;  9ICQ A;  2NRZ A;  3V6K A;  5KG1 A;  7ICR A;  1MC8 A;  3KTQ A;  2BQ3 A;  8ICV A;  3GIL A;  2FI1 A;  5TZV A;  4YR0 A;  5C5J A;  5KFK A;  4GXJ A;  3RFA A;  2BCU A;  7ICJ A;  4NL9 C;  3WK6 A;  2ZTD A;  4UB2 A;  2J6S A;  4DFM A;  5DB9 A;  2ZIV B;  1TVA A;  7ICK A;  1WG8 A;  1SZH A;  3QE9 Y;  3IM1 A;  1RYU A;  2ZIX A;  4IQW A;  1ZQK A;  1JAL A;  3OTQ A;  4LVS A;  3FC4 A;  3M6K A;  5JUM A;  3WKE A;  1LVH A;  4GC7 A;  4O5C A;  2YQE A;  3CP8 A;  3ZD8 A;  2N1R A;  2Y0S C;  2KEY A;  5AM2 A;  3WU2 U;  2HHT A;  1ZQL A;  1UPH A;  1D9D A;  5DKW A;  4UAT A;  3Q8K A;  4CDG A;  4ECS A;  4R8U B;  3JPS A;  1SB3 C;  2ZJ8 A;  4FZM A;  3EPG A;  4ECX A;  2D3D A;  3TI0 A;  3TAD A;  7ICS A;  5DLG A;  2I1Q A;  4ECR A;  4F4Y A;  3KHG A;  1A0P A;  3EZ5 A;  1OXJ A;  3GV7 B;  3M9N B;  3LVW A;  2PFP A;  5ALP A;  5ALX A;  2XY6 A;  1C20 A;  4C80 A;  4ECW A;  4DSI A;  5KT7 A;  1Z4O A;  4J9O A;  1RQL A;  3N97 B;  5DG7 A;  2KNJ A;  4ELU A;  5A0L A;  3OHA A;  1NKB A;  5KAI U;  8ICB A;  2KJ9 A;  1CI4 A;  5AKL A;  1QSL A;  1IM4 A;  4Y2Q A;  3EYZ A;  2QKQ A;  3L5K A;  2Q0Z X;  4JWN A;  2RDI A;  2E8P A;  1QQ6 A;  3NRZ A;  5DDY A;  4OJ6 A;  3IV6 A;  4O3Q A;  2WB1 F;  4KN7 A;  4IRC A;  5AM0 A;  1SL2 A;  2AH5 A;  2CXY A;  2ZUB A;  2BPG A;  4O3N A;  9ICU A;  2H3F A;  2AGO A;  3UXN A;  1N5X A;  3DDH A;  4TUQ A;  4OJL A;  3BQ1 A;  4DOB A;  3KFU F;  4QZB A;  1H38 A;  4BDP A;  4LJX A;  3H0L B;  4FO6 A;  2G08 A;  2BGW A;  5AKX A;  2G0A A;  4J9L A;  1ZRN A;  3PSF A;  5AIB A;  4IL6 U;  3JPQ A;  4DLE A;  1NK5 A;  4F2R A;  4J9R A;  1J97 A;  4FBT A;  1C7Y A;  1GO3 F;  1J2M A;  4QWE A;  1KFS A;  1KQQ A;  1F5S A;  2W9B B;  2XIC A;  5KG3 A;  3PW4 A;  5KFP A;  1SWV A;  4Q44 A;  1ZQN A;  2JEG A;  3UQ0 A;  2IA6 A;  1BVS A;  4YVZ A;  3HJE A;  5F9L A;  2W9B A;  3TAC B;  5KT6 A;  5KT4 A;  4KLF A;  1JUD A;  2DGZ A;  4BJQ A;  1K1S A;  4M9H A;  3PW2 A;  1V85 A;  5IIJ A;  2P6U A;  3MR6 A;  1Q3V A;  3VCB A;  4MEY A;  2KIC A;  3HKZ C;  2OXO A;  1TAM A;  2KHV A;  4DQS A;  4CNQ A;  3KHL A;  3EPI A;  3ETR A;  3MR3 A;  5IIO A;  4NY8 A;  2GWS A;  1HJP A;  5EWG A;  1PVR A;  1XSL A;  1HUZ A;  5J2A A;  1S5L U;  2EDU A;  1N63 A;  4ED3 A;  1UHU A;  4DL2 A;  5HMM A;  3C5F A;  2J6T A;  4RPZ A;  4KLQ A;  4KLT A;  1DGS A;  1XC9 A;  5ALY A;  4ACO A;  1U4B A;  4QNL A;  4OJ5 A;  4Y2S A;  3BQ2 A;  1PK1 A;  3ZDA A;  2DF4 B;  3R9K A;  3QUC A;  4QZF A;  8ICU A;  4DQP A;  2H3Q A;  4UAW A;  5L1M A;  4Q45 A;  4IRK A;  8ICA A;  4RQ3 A;  4RQ8 A;  4I2J A;  3RJK A;  8ICH A;  3KOO A;  2DWQ A;  4ECV A;  3B9J A;  3PW7 A;  2PFQ A;  1JI7 A;  3BS7 A;  4M47 A;  3RTV A;  4EZ6 A;  2B21 A;  4QIW C;  4RQ0 A;  1KBU A;  3THV A;  1L3U A;  1UA0 A;  5J8Y C;  2BZF A;  4P4M A;  3LK9 A;  4PHE A;  5CB1 A;  4ECY A;  3GV5 B;  3A0H U;  4NJ8 A;  4Z6E A;  4DFK A;  1FFV A;  4DOA A;  1S0O A;  2E8N A;  5BPC A;  1Z00 A;  3H0M B;  4DFJ A;  4RNM A;  4GLX A;  5L1I A;  1VDV A;  3N4M B;  3NUQ A;  4LZD A;  1ZQG A;  1MQ2 A;  4ED2 A;  4UBC A;  3H7I A;  1DOQ A;  4DSE A;  2UVR A;  3RJJ A;  3ISD A;  2AGQ A;  4YQW A;  3NVW A;  4XA5 A;  1RM6 C;  1DXS A;  4RZR A;  2ISP A;  2HSZ A;  4QW9 A;  2D8C A;  4RPY A;  4C8M A;  3AL0 B;  2XY5 A;  1KKX A;  3ICX A;  4QWC A;  4I28 A;  3SAH A;  1HEK A;  1B22 A;  2GLE A;  2K8C B;  2EZZ A;  1K5O A;  3H4B A;  1QTM A;  2J6U A;  3LYS A;  1XSN A;  4DL5 A;  1SL1 A;  1D8Y A;  5KG0 A;  3M9M B;  4EYH B;  3SR6 A;  1RQN A;  1SKR A;  5J0T A;  4XQ8 A;  4HAI A;  2JXJ A;  3JPT A;  3TAN A;  3MFI A;  1TK5 A;  1ZRM A;  3ED5 A;  3AMZ A;  1L7O A;  3PML A;  1JRO A;  2HHU A;  1DGJ A;  2W43 A;  5EWE A;  2HHX A;  9ICS A;  2JV3 A;  1JRP A;  2YML A;  3ZD9 A;  5J0Y A;  2H3I A;  1KEJ A;  1S9F A;  3TAQ A;  3FAH A;  4I2B A;  4PL2 A;  2V4R A;  3F5A A;  3OSP A;  1A6S A;  5DBA A;  2ZG6 A;  1RYR A;  4U7C A;  5J0X A;  1X9M A;  2I9G A;  3PW0 A;  4U6P A;  4PGX A;  2YTU A;  4DFP A;  5AI5 A;  1NK7 A;  2JH1 A;  4FS1 A;  4M2Y A;  4UW9 A;  3RAQ A;  2WF9 A;  3SV4 A;  4F3O A;  3OPX A;  3HX0 A;  3T5L A;  3WKD A;  1YT3 A;  2ZIW A;  5D49 A;  1ZQT A;  1U49 A;  3GQC A;  2OWO A;  1Z1V A;  2RHF A;  5KG5 A;  3QZ7 A;  3GIM A;  1ZJN A;  1N2X A;  4Q43 A;  3UQ2 A;  1SKS A;  4F4Z A;  2WFA A;  4M6W A;  2G5I B;  4QZC A;  4DL3 A;  2PI4 A;  4C7Y A;  2CN1 A;  2F3N A;  3B0X A;  2FPM A;  4RQ6 A;  1MSW D;  1ZQE A;  3M7D A;  2GOL A;  3NS1 A;  3QUQ A;  1FO4 A;  2HVH A;  1RXW A;  4PZO A;  2KKV A;  3RB0 A;  3ZI4 A;  5AK6 A;  1X66 A;  2CPR A;  3C2L A;  1WCN A;  4PHD A;  3JPO A;  4EEL A;  5AM3 A;  2UVW A;  5III A;  5AK5 A;  4G3I A;  3QUT A;  1IIP A;  1NZP A;  5KG7 A;  9ICR A;  2O6K A;  2H3Z A;  1WCL A;  2IOH A;  3LWL A;  1T8E A;  4DLG A;  5J2G A;  2HBJ A;  1ZQC A;  1Y88 A;  2ZIU B;  2ZIW B;  4PPX A;  4M9N A;  2DQN B;  3I76 A;  3SAF A;  5KFD A;  4YXM A;  5KTQ A;  1ZQF A;  1ZD3 A;  3JPP A;  4OJO A;  1BPY A;  5DB6 A;  2KZM A;  7ICO A;  3QZ8 A;  5KFX A;  1BPX A;  1AQ6 A;  3H40 A;  3M6Z A;  2QB1 A;  9ICV A;  3HT3 A;  3EWA A;  3QXG A;  2W3R A;  3FM9 A;  3MBY A;  4F50 A;  5J0R A;  3NVZ A;  5IIL A;  4DFD A;  3Q8Q B;  4B6J A;  5ALM A;  4Y2X A;  2I6X A;  3V6J A;  4RQ5 A;  2KIV A;  1FFU A;  3NAS A;  3J81 j;  3JPR A;  1SKW A;  4RNO A;  3F53 A;  3V72 A;  4G9B A;  3WKB A;  4AYB C;  3HKZ F;  3Q8L A;  1ZQB A;  1QCK A;  1MQ3 A;  4KLS A;  2E8M A;  2ASL A;  4RQ7 A;  2W9A A;  2E1E A;  2ZXH A;  2FMQ A;  3H8S A;  4KLH A;  1ZQP A;  4I2F A;  1UA1 A;  4QZ9 A;  5ALD A;  4QZH A;  3MFH A;  7ICG A;  2CRX A;  4ICA A;  8ICX A;  4OCZ A;  5J2B A;  4YCX A;  2MUT A;  5BOM A;  1S0V A;  4EEK A;  1NK6 A;  2Y0S F;  4KX3 A;  4F4W A;  1NI3 A;  4F4X A;  9ICW A;  3KZX A;  1XO0 A;  3ZDD A;  1KW4 A;  4F8R A;  4PJ0 U;  9ICK A;  5HNK A;  5AI4 A;  2AQ4 A;  2B6G A;  3WK4 A;  4YXJ A;  3GII A;  8ICY A;  5ALS A;  5J2I A;  2VA3 A;  3AM9 A;  2FDR A;  2F76 X;  1SL0 A;  5DLF A;  5ALT A;  2NO4 A;  5EE9 A;  3HW8 A;  1KDH A;  4RQ1 A;  4B9V A;  1T3N A;  3ISC A;  3D2N A;  1NJX A;  5H2F U;  3AU6 A;  5KNI A;  3OJU A;  9ICA A;  1Z3E B;  5EE1 A;  4I29 A;  3H8M A;  4NL9 A;  4PGQ A;  4QZE A;  2IHM A;  1MN8 A;  3AQE A;  3N7P D;  3H8J A;  2KIW A;  4NLB A;  4QWB A;  2ZXI A;  4IQU A;  4DOC A;  5AKJ A;  9ICG A;  3G6V A;  2KVS A;  2KE7 A;  5KFM A;  4BUG A;  2NV3 A;  2W03 A;  2XO7 A;  1N60 A;  5KAF U;  7ICL A;  4JMU A;  2XGP A;  3NRW A;  3OGU A;  1BNP A;  2ODG A;  1QH9 A;  2VJ4 A;  4B9L A;  4ECU A;  5J2C A;  3ZDB A;  2IHN A;  5ALE A;  2W9C B;  1TFR A;  3T79 A;  2IOF A;  3PR5 B;  4FZN A;  3V6H A;  4EEN A;  4KTQ A;  9ICT A;  3PO4 A;  2KJ8 A;  1TKD A;  2W9C A;  4NV0 A;  4PHP A;  3M8R A;  1DK2 A;  3IDW A;  4FE3 A;  4C8O A;  2WAQ F;  4RQ4 A;  1SXD A;  1WYG A;  4EX7 A;  4NM1 A;  3AN1 A;  4FS2 A;  4QZI A;  4YN4 A;  1B0X A;  2WAQ C;  1PVQ A;  4P4O A;  1QQ5 A;  1WWV A;  5F9N A;  1JXL A;  1KRP A;  2BKE A;  5ALH A;  5DQI A;  5CA7 A;  5AI0 A;  1ZQA A;  4P0P B;  1NZB A;  2K60 A;  2F44 A;  5L1K A;  4YP3 A;  3SV3 A;  3BS5 B;  4DQR A;  4I2D A;  7ICV A;  4DS4 A;  4F93 B;  2ALZ A;  2JEJ A;  4F4K A;  2KG5 A;  3Q8S B;  4RPX A;  1XO1 A;  4YR2 A;  2C22 A;  1ZQD A;  3RR7 A;  4KN4 A;  3HPO A;  1S10 A;  4F5R A;  2AJQ A;  2YY6 A;  2ASD A;  1NKC A;  5DB8 A;  2ZUC A;  4RQM A;  2ZJ5 A;  4EBD A;  2KMD A;  5AIC A;  4YMM A;  1O03 A;  5GTH U;  5KFS A;  3ALR A;  2EZX A;  4MF2 A;  1TAQ A;  8ICM A;  2A1J B;  5ALU A;  2FLN A;  1ZXI A;  4Q8E A;  4DF4 A;  4UAU A;  2IBK A;  5HHI A;  3B0Y A;  3GIK A;  3MGV A;  5ALN A;  3SI8 A;  4F5O A;  4Y2V A;  2JHD A;  1ZQV A;  4MFC A;  5J2D A;  2DL0 A;  4R63 A;  2YB4 A;  4I2A A;  1JXE A;  3ORY A;  2LYH A;  4QZ8 A;  1ZQ1 C;  2ZIX B;  4M9J A;  2P66 A;  2VIX A;  2KK0 A;  1NK8 A;  1S97 A;  4R64 A;  2HBL A;  2AHO B;  2HOQ A;  2G5H B;  2IMW P;  3H4D A;  4TUP A;  5AM1 A;  3C1Z A;  2HVI A;  4PGY A;  1LKY A;  2DBY A;  3GDX A;  2OH2 A;  2ISO A;  4Y2J A;  1UT5 A;  3K1Z A;  4O3M A;  2YMP A;  3WK5 A;  2WB1 C;  1KLN A;  1XSP A;  1VLB A;  3WKC A;  4EBE A;  5EOZ A;  5KFT A;  1VJ5 A;  3GZF A;  3KHH A;  5ALV A;  4FFD A;  2ZTE A;  2JH7 A;  4CF5 A;  2P35 A;  4Y2Y A;  3MDA A;  2BCV A;  2KN7 A;  3RBD A;  5AHX A;  2RP5 A;  5HHH A;  4KLE A;  5ALG A;  2LKY A;  3BJY A;  2OHF A;  5DG9 A;  4KX5 A;  3RJE A;  2KFZ A;  3OJS A;  4EYI B;  3RR8 A;  5KFE A;  1V38 A;  3CYM A;  5EWF A;  4B9S A;  9ICC A;  1ZYQ A;  4TUS A;  1SV0 A;  1B43 A;  1LKY B;  3IHQ B;  4UB6 U;  4RQN A;  4M9G A;  4UAV A;  4IR1 A;  2BCQ A;  4O3R A;  4GXK A;  5KFJ A;  2KSO A;  3UMC A;  2WF6 A;  2HOI A;  1ECW A;  1SGG A;  4F5P A;  4YFK A;  3NVV A;  3NVY A;  1IG6 A;  1D9F A;  5J0P A;  2M9N A;  2YB1 A;  2NRT A;  5KFU A;  1RPL A;  4UB5 A;  4O9M A;  1K1Q A;  2FE9 A;  5KL1 B;  4DSL A;  1L8L A;  3MR2 A;  2E8O A;  4F71 A;  1T4G A;  4RT2 A;  3BQT A;  2PKE A;  2KV2 A;  4UB1 A;  8ICP A;  4Q8F A;  2H5X A;  1YZ7 A;  3IP4 B;  5KT2 A;  5IIM A;  2W8K A;  1P7D A;  4DS5 A;  1COK A;  3PY8 A;  2YX8 A;  2HBK A;  4UAR A;  1B4F A;  4RUC A;  3QU7 A;  3PV8 A;  5JU5 A;  3F2C A;  3PX0 A;  2VA8 A;  2EAN A;  5DBC A;  1M6Y A;  5JTI A;  4P4P A;  2XID A;  5CJ7 A;  5J2J A;  2XCA A;  8ICQ A;  2F8K A;  5AKY A;  1KFT A;  1X9S A;  2OYY A;  2ZTC A;  1EXN A;  5E79 U;  7ICF A;  3MC1 A;  4O3S A;  3M9O B;  3QU5 A;  2GH1 A;  1TV9 A;  2GO7 A;  2KSO B;  2R18 A;  4F91 B;  1XWL A;  3RJI A;  5J8Y A;  1BPZ A;  2R8I A;  4EBC A;  4KMO B;  3E0F A;  1ZQI A;  4C8N A;  4J9M A;  1N48 A;  2FMP A;  1TK0 A;  1ZQH A;  3CRX A;  4ZH4 A;  1X40 A;  2PI5 A;  8ICR A;  1X9X A;  5ALZ A;  2ATL A;  4DL7 A;  1F44 A;  8ICT A;  5CP2 A;  3LWM A;  5ALQ A;  5ALL A;  5G5H A;  1L8O A;  7ICM A;  3BDP A;  4BWJ A;  3Q8M A;  4BWM A;  1SWW A;  2JZB A;  3V7L A;  1FEZ A;  3SEN A;  1ZQZ A;  3UPQ A;  2DPJ A;  2LM4 A;  5KFL A;  4RQ2 A;  2HCF A;  4DSK A;  4F92 B;  3T5J A;  2YMQ A;  3KBB A;  2W11 A;  3NGD A;  5J2F A;  1ZQM A;  2HBM A;  5AKG A;  3N28 A;  3MGH A;  4P0Q B;  2Y1J A;  1T7P A;  2W04 A;  4GFJ A;  2R8K A;  5GTI U;  2JGA A;  2VAN A;  2HOF A;  4J9P A;  3C1Y A;  3ETL A;  4C0Z A;  1NKE A;  5L1L A;  2A1J A;  3AEV A;  4O5E A;  4ECQ A;  1UCV A;  4DQQ A;  1ARO P;  4OD0 A;  2JEF A;  5BOL A;  3T5H A;  4J9N A;  5DGA A;  3D2Q A;  4UBB A;  1ZQY A;  1DRG A;  2KFN A;  2AU0 A;  1BPE A;  2PFN A;  2Y9U A;  2WHE A;  3PX6 A;  2P6R A;  1OUQ A;  4BGD A;  1NK9 A;  4J9Q A;  4GXI A;  3IN5 A;  3G6Y A;  2RLT A;  4PHA A;  5J2H A;  4NLG A;  4B9U A;  1L5U A;  4F5N A;  9ICP A;  2LM1 A;  5CHG A;  1A77 A;  2BCS A;  2FJ6 A;  1JIH A;  1NJW A;  5IIN A;  1KL9 A;  3RB3 A;  1L6N A;  3O0F A;  3I28 A;  1SXE A;  3K4G A;  4J03 A;  5KFQ A;  2KVC A;  1L3T A;  2YN4 A;  4MFF A;  2K89 A;  1BPB A;  5EE0 A;  4KLD A;  1U48 A;  5T14 A;  2Q4T A;  2NRW A;  3WK7 A;  1NOM A;  4ECZ A;  2LHT A;  3C5G A;  3JPN A;  3S6J A;  2BPC A;  2QB0 A;  1PZN A;  2C28 A;  5KFR A;  3BQ7 A;  4UAY A;  5AM4 A;  4ED7 A;  2F77 X;  1JX4 A;  1BGX T;  4I27 A;  5HR6 A;  3HIL A;  3H8W A;  1MA7 A;  1DK3 A;  4QW8 A;  1ZQO A;  3FYH A;  5TIS U;  1LV5 A;  5AIA A;  3QU9 A;  1WWU A;  3DV9 A;  5AM5 A;  1ZQR A;  2UVV A;  5KFV A;  8ICS A;  5AKH A;  2XY7 A;  4NXZ A;  3N7S C;  2W8L A;  4ED6 A;  5KFB A;  2EAM A;  3UXP A;  2W9M A;  2HMX A;  4JB3 A;  5G5G A;  3GFK B;  5J2K A;  1RYS A;  3PW5 A;  4KLO A;  3F2D A;  5ALO A;  5ALF A;  9ICB A;  4YD1 A;  1UT8 A;  3QX7 A;  5HP4 A;  4YMN A;  1URJ A;  4R8U A;  3I1Y A;  2LYB A;  4K4H A;  3E58 A;  4JV0 A;  2WF7 A;  1ED1 A;  1V9P A;  8ICW A;  4Y2R A;  5B66 U;  1NJY A;  1ZD2 P;  2MU2 A;  2WF5 A;  2EAO A;  3WK8 A;  4CF4 A;  1JN3 A;  5KFG A;  4C7Z A;  2K8A A;  3K75 D;  3A0B U;  4BX9 C;  2AGP A;  1ZQJ A;  3T5K A;  7ICP A;  2R8H A;  1CRX A;  4UB4 A;  4USA A;  4PL1 A;  1TE2 A;  3RH4 A;  1N56 A;  4KLJ A;  2W7P A;  8ICG A;  2LYA A;  4R65 A;  2QAR A;  2W54 A;  2BQU A;  4RT3 A;  2HDO A;  1Z1B A;  5L1J A;  4DCC A;  1V97 A;  3LVV A;  1U9L A;  1ZJM A;  3C2K A;  1RZT A;  2K8B B;  4RU9 A;  5AKK A;  2PFO A;  4ELV A;  3U26 A;  2W55 A;  1J2N A;  5DQG A;  2NRV A;  1ZET A;  4RUA A;  1COO A;  2K4E A;  3V7J A;  4Z6D A;  3IG5 A;  3PSI A;  2NYV A;  5K4L A;  4M9L A;  1PUZ A;  2JRZ A;  4NWI A;  4DSJ A;  4HYK A;  1X6J A;  5AK3 A;  2ESE A;  4XRH A;  1IV8 A;  3VC8 A;  2XCP A;  4K4G A;  4K4I A;  4P2H A;  2AXT U;  4DL6 A;  1QQ7 A;  1HIW A;  5DDM A;  2EH9 A;  3IG8 A;  3HWT A;  5ALI A;  1PK1 B;  4RNN A;  3GU3 A;  3ISB A;  3D2S A;  2XI9 A;  7ICN A;  3RH6 A;  2IOF K;  2HHQ A;  1PVP A;  9ICX A;  2A3V A;  1PK3 A;  3BZK A;  4FBU A;  3QNM A;  2RDJ A;  4IS7 A;  4MF8 A;  3QU4 A;  4PH5 A;  1N62 A;  5KFF A;  1L3S A;  2KZZ A;  2EZY A;  4DO9 A;  3OSN A;  2DKX A;  3Q8R B;  2OM6 A;  5IIK A;  4DSF A;  2DKZ A;  2ASJ A;  2HI0 A;  2KD1 A;  4Z6C A;  2LMR A;  3TQ1 A;  8ICL A;  1XU4 A;  3L3F X;  5J0W A;  5C0Y A;  4GIB A;  5ALK A;  3MDC A;  4CGZ A;  4B9T A;  2C2R A;  3PVX A;  2KTQ A;  3PSP A;  2FLP A;  2A1A A;  4US8 A;  2KOB A;  4ELT A;  5ALJ A;  1F0M A;  3CW2 C;  2HHS A;  2JR5 A;  3TAD C;  4QZA A;  7ICH A;  3RAX A;  2VJ5 A;  2BHN A;  4I2E A;  1IXR A;  2F1J A;  4IQV A;  3UMB A;  3Q8P B;  1ZQW A;  3K1R B;  3RRH A;  3GIJ A;  2MRL A;  9ICN A;  5KFC A;  4QWA A;  4F72 A;  7ICE A;  2OEH A;  2M0N A;  3PR4 A;  4ED1 A;  3C28 A;  5KT3 A;  2R8G A;  4KIT B;  3H0R B;  4JV2 A;  4NM2 A;  2E1F A;  4Y2U A;  4YMO A;  3CNH A;  1X9W A;  9ICF A;  1Z4N A;  3EW9 A;  4A8E A;  3PNC A;  3M8S A;  4X5V A;  5AI8 A;  1Q3U A;  4B9M A;  4IC9 A;  2A19 A;  2ZJA A;  1N61 A;  3FDS A;  4TUR A;  5KFA A;  4YD2 A;  3D6J A;  1BPD A;  2XGQ A;  3PO5 A;  2HW3 A;  2OCE A;  4KLI A;  2NO5 A;  5JRT A;  4DL4 A;  4P0P A;  2Z7J A;  3KKA C;  9ICO A;  5AI9 A;  2W7O A;  2I5H A;  5KG6 A;  2DUY A;  5DG8 A;  3PMN A;  8ICN A;  2V9W A;  3KKA A;  5J0O A;  3F5E A;  4UAZ A;  5CRX A;  4QZD A;  4QJF B;  2L5Y A;  2K4I A;  2FLL A;  2LI6 A;  2JEI A;  2JZB B;  4MEX A;  1KSP A;  7ICQ A;  2C2D A;  1WUD A;  2R8J A;  4C8K A;  3AUO A;  9ICH A;  3TKA A;  3G6X A;  4EEY A;  4EZ9 A;  1NNL A;  1KTQ A;  1S8O A;  2BDU A;  1UQV A;  2XVT A;  4PZN A;  5AKZ A;  3SMV A;  3SYZ A;  3RJG A;  3AQF A;  1HUO A;  5DBB A;  8ICC A;  2K4H A;  7ICU A;  1SZP A;  1S76 D;  4ED8 A;  3C21 A;  3QYP A;  1QSY A;  2WF8 A;  2QB0 B;  4AP9 A;  2KZ3 A;  9ICM A;  4BXO B;  2ZIV A;  3L4P A;  8ICZ A;  2E3T A;  2F2A B;  1CUK A;  1T3Q A;  2KHQ A;  4F2S A;  4BXO A;  3KD3 A;  4NLZ A;  1RXV A;  1KFD A;  3F2B A;  4M04 A;  3EUB 2;  8ICO A;  5HML A;  2E5S A;  3PST A;  2H3V A;  4US9 A;  2HHW A;  3UXO A;  1NJZ A;  1FIQ A;  4I2H A;  5FP0 A;  3AU2 A;  3UMG A;  4CF3 A;  3SQI A;  5CR0 A;  4KLG A;  2K4P A;  3MR5 A;  3KHR A;  3RB6 A;  5J0S A;  5ALW A;  5KG2 A;  1Z19 A;  1QSS A;  4JK1 A;  5DQH A;  5KT5 A;  1L3V A;  1CEZ A;  5F3X B;  3RRG A;  1X42 A;  2QLT A;  4FZL A;  4C4S A;  1X2I A;  4IRD A;  4O5K A;  4IQT A;  4DEZ A;  1BNO A;  2G07 A;  2VKQ A;  1N5W A;  4O0I A;  3BZC A;  1Q46 A;  2V4Q A;  3MAB A;  8ICI A;  3SZ2 A;  2PMZ C;  5CEH A;  1L7M A;  3HP6 A;  3N7R C;  5J2E A;  5HR7 A;  3WKA A;  2FMS A;  4M6W B;  2UVU A;  3QEA Z;  5L9X A;  1NK0 A;  3QU2 A;  3RJF A;  5AK4 A;  4QIW F;  2EAP A;  3UM9 A;  2MA1 A;  4I2G A;  3SD7 A;  4M0A A;  5AKE A;  2PXI A;  4E0D A;  5CWR A;  1JMS A;  4YR3 A;  2DFL A;  3ONN A;  4NLK A;  4F5Q A;  1L7N A;  5DGB A;  3OHB A;  2RRD A;  3QUB A;  5EE3 A;  8ICJ A;  2Y9T A;  4IR9 A;  1SV0 C;  3MGI A;  3RB4 A;  3DEE A;  2XC9 A;  5D4B A;  4CCH A;  4MHV A;  1ZQS A;  1L7P A;  3T3F A;  2KP7 A;  4JWM A;  1D8L A;  1O08 A;  1NK4 A;  9ICL A;  4ED0 A;  3E2E A;  2LPE A;  2ZIU A;  4TQS A;  4OO1 J;  4AYB F;  5DB7 A;  2C2E A;  4ECT A;  5KFW A;  4JV1 A;  3SEI A;  2WTF A;  4JUZ A;  3C29 A;  2BR0 A;  4QZG A;  3QEB Z;  4CE6 A;  1U47 A;  2F8L A;  2G09 A;  4C4R A;  2MAX A;  5KFH A;  2FPK A;  2W3S A;  3TAP A;  9ICJ A;  4YG2 A;  2MUT B;  2BCR A;  2RQ5 A;  2VA2 A;  4B9N A;  4Y2P A;  1ZD5 A;  1LB2 B;  2HHV A;  1A76 A;  2DPI A;  1TAU A;  1S77 D;  3TAR A;  5KFZ A;  5KFN A;  2QAR B;  1SV4 A;  3KZI U;  2EQY A;  1ZQU A;  2KJ5 A;  4R66 A;  1XNS A;  3C2M A;  4C8L A;  4I2C A;  4TQR A;  1QLN A;  4OJP A;  3RJH A;  1D8B A;  4XUS A;  4Z6F A;  3NTU A;  3BQ0 A;  3PX4 A;  2NRX A;  5KG4 A;  4KLU A;  2BDP A;  4GC6 A;  5J29 A;  1X6I A;  4MFA A;  5KL8 B;  4UB3 A;  2Y1I A;  4J9K A;  1T94 A;  2B0C A;  3WK9 A;  1ZOL A;  4DWI A;  9ICE A;  4LZG A;  4DQI A;  4WJ3 B;  2JMG A;  2FPL A;  4UB8 U;  3IRU A;  3LDA A;  4QWD A;  1YZ6 A;  1RG6 A;  3HRD D;  4NLN A;  2AQ0 A;  4EX6 A;  4C4T A;  5J0Q A;  5J0U A;  2G06 A;  5B5E U;  3GV8 B;  4I2I A;  4O3O A;  7ICI A;  1ZQQ A;  4DF8 A;  3V7K A;  5AI6 A;  4KLL A;  1Q8K A;  2MSN A;  4UQG A;  1S0M A;  2F1H A;  8ICE A;  3ZDC A; 
#chains in the Genus database with same CATH homology
 2E8N A;  1PK3 A;  2K60 A;  2F44 A;  3BS5 B;  2K4P A;  5JRT A;  2Y9U A;  4IS7 A;  3TAC B;  3KKA C;  2YTU A;  2KG5 A;  2ES6 A;  5F3X B;  2QAR B;  2KSO B;  1SV4 A;  2EAO A;  1V85 A;  2QB1 A;  3KKA A;  5KNI A;  2DKX A;  2DKZ A;  2L5Y A;  2D3D A;  4RQM A;  5J8Y A;  3TAD A;  3H8M A;  4NL9 A;  2LMR A;  2KMD A;  1Z1V A;  1OXJ A;  2KIV A;  1DXS A;  1V38 A;  1SXE A;  3BS5 A;  1SV0 A;  1LKY B;  1OW5 A;  1X40 A;  2D8C A;  4RQN A;  1X9X A;  2EAP A;  2KE7 A;  2QAR A;  2F3N A;  2KSO A;  2E8M A;  1UQV A;  1F0M A;  1SGG A;  3TAD C;  4PZN A;  2GLE A;  2QB0 A;  2QKQ A;  3BQ7 A;  3SEN A;  2Y9T A;  1SV0 C;  4PZO A;  1PK1 A;  2DL0 A;  3K1R B;  2E8P A;  3HIL A;  1X66 A;  2FE9 A;  4MHV A;  2E8O A;  2QB0 B;  5L1M A;  1WWU A;  4NL9 C;  3IDW A;  2LPE A;  1RG6 A;  1COK A;  1SXD A;  2ESE A;  1JI7 A;  3BS7 A;  2EAM A;  3SEI A;  1B4F A;  1KW4 A;  5JU5 A;  1LKY A;  5J8Y C;  1PK1 B;  1B0X A;  2EAN A;  5JTI A;  1UCV A;  2JV3 A;  2B6G A;  1WWV A;  2F8K A;  4NJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...