4IS7A

Crystal structure of the caskin2 sam domain tandem
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
GADAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the CASKIN2 SAM Domain Tandem
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Caskin-2
total genus 42
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A01
5L1MA 1B4FA 1SV4A 2DL0A 4MHVA 1X40A 1DXSA 2DKZA 1JI7A 3SEIA 1V38A 3BS7A 1B0XA 1PK3A 1RG6A 2D8CA 2KG5A 2EAOA 2JV3A 3BS5A 1WWUA 3BQ7A 5JRTA 2EAMA 2FE9A 2E8PA 1PK1B 2DKXA 2F44A 2L5YA 2B6GA 2YTUA 3TADC 3TACB 1X9XA 1X66A 1SXDA 1UQVA 1OXJA 1WWVA 4RQNA 4NJ8A 2EAPA 3KKAC 2F3NA 2ESEA 3HILA 5JU5A 1SGGA 1COKA 4NL9C 1F0MA 2GLEA 5J8YC 1SV0A 2KE7A 2QB1A 1UCVA 3TADA 2K4PA 5KNIA 2KIVA 1PK1A 3IDWA 3SENA 2E8OA 1OW5A 2ES6A 2KMDA 1LKYB 1V85A 1SXEA 2KSOB 4PZOA 4IS7A 1LKYA 2LMRA 2QKQA 1KW4A 2Y9TA 3BS5B 2KSOA 4PZNA 4RQMA 2EANA 5J8YA 2QARA 2LPEA 2D3DA 1Z1VA 2F8KA 2K60A 5JTIA 2QARB 4NL9A 2QB0A 3K1RB 3H8MA 1SV0C 3KKAA 2QB0B 2E8MA 2Y9UA 2E8NA 5F3XB
chains in the Genus database with same CATH superfamily
3UXPA 2ZG6A 2W8KA 2XVTA 2YQEA 2BZFA 1JI7A 4B6JA 4UB1A 1ZQCA 1SKRA 1T7PA 5KFRA 5DQGA 1V9PA 3CNHA 2IBKA 8ICHA 1NJZA 2M0NA 4TUSA 4M6WA 4PJ0U 4LVSA 2KVCA 4M6WB 5AI8A 8ICZA 4FE3A 2FI1A 5DB7A 3SI8A 4UASA 1ZQLA 3E0FA 2WAQF 3UQ0A 2LBOA 4Y2UA 4YFKA 4RQ2A 4Z6DA 4P0PA 4KN7A 2E5SA 4Y2VA 1XSPA 2HHXA 1QSLA 1KSPA 1JMSA 1HEKA 1L8OA 5AKJA 9ICNA 3GIKA 5ALDA 1NJWA 5JU5A 5BPCA 4I2AA 1NK6A 5L1LA 4G9BA 3MR6A 4F4XA 1UT5A 3RB6A 4I2JA 4C8OA 7ICOA 3MGIA 2KICA 1KKXA 4QIWF 1WG8A 4DFDA 5AIAA 3M9MB 2E8OA 5KT3A 2W43A 2W55A 4EBEA 2KMDA 3F2CA 1ZQOA 4YCXA 2Y9TA 5ALFA 1OUQA 3E2EA 1S0VA 3B0XA 2W54A 2Q4TA 1QTMA 5CB1A 5ALQA 3F2DA 2K4HA 9ICUA 1WCLA 4UATA 3BQ0A 1RYSA 2EQYA 1SWWA 5KFJA 2NRVA 4EX7A 3RAQA 4F2RA 3N7SC 2G09A 1N62A 8ICVA 2PI5A 8ICLA 5KFHA 3IV6A 3PO5A 2AHOB 3HRDD 5J2DA 2NRXA 2M9NA 1BPDA 2FLLA 2AH5A 1KRPA 5KFBA 4ECVA 1B0XA 3QZ7A 4U7CA 5EWFA 4YR3A 2ZIUA 3WK9A 2CPRA 1NNLA 1COOA 1ZQFA 4OO1J 1L7OA 5AKGA 2DKXA 2MRLA 3D2QA 1CI4A 5EE9A 4Q8FA 1LV5A 3JPQA 2D6FC 1QSYA 4DQSA 4OJ6A 2PFNA 2H3ZA 1MN8A 1Q3UA 2BDPA 3V6HA 2R18A 4ED6A 1U9LA 4IRDA 2KEYA 3N97B 3RJGA 8ICRA 3AM9A 9ICOA 4IQVA 3AMZA 2BCSA 3KBBA 7ICJA 5ALWA 4I2DA 3E58A 9ICXA 2DFLA 1C7YA 5CJ7A 4JUZA 4BJQA 1JRPA 2XGPA 2F77X 3H0LB 3PSIA 2BDUA 4IS7A 1S97A 1BPBA 4Y2TA 4F91B 1AROP 2XIDA 2QARA 3EWAA 5ALKA 4Q45A 2FLPA 5JTIA 3V6JA 4NL9A 2UVUA 2XCAA 4KLDA 1QLNA 3K4GA 5F3XB 3KZIU 3SYZA 1B4FA 5G5HA 3F2BA 5AKHA 4IRCA 4DSLA 4DFJA 4QZGA 2OEHA 2WF6A 4QZCA 5DG7A 1A77A 5ALEA 3BJYA 3NVYA 3TFSA 2MSNA 4DFKA 1XNSA 4DL7A 4DSEA 1WCNA 2A1JB 4RNMA 3LWLA 1WWUA 3QXGA 4YVZA 5J2GA 2HBMA 5ALTA 3UMCA 1PK1B 3ISCA 5EE0A 4QZ9A 4QZEA 2IA6A 5J29A 9ICRA 4DSKA 3RF9A 2MU2A 4KITB 5KL1B 7ICIA 2DUYA 8ICPA 2XC9A 2YTUA 4I29A 4IR1A 4CGZA 3TAPA 3H8WA 4KN4A 4O0IA 3PW2A 1X42A 5ALXA 5BOLA 4DSFA 1D8BA 4P2HA 4QWEA 2OM6A 4JWMA 3KZXA 2AGOA 1SZHA 2ESEA 1KFSA 1SGGA 1T4GA 4F71A 3T5JA 2ZIXA 3KD3A 3B9JA 4TURA 3SR6A 4ECUA 7ICPA 2A3VA 4UAVA 3NUQA 8ICJA 3PMNA 2NRTA 2YB4A 2R8GA 3FYHA 2YN4A 3M8RA 2HDOA 2YMLA 2KOBA 4CRXA 1SKSA 2IMWP 1ECWA 9ICFA 4KLMA 4MF8A 2ZTCA 1ZQBA 5AKEA 1L6NA 3M1YA 1RDFA 4KLQA 3WK7A 4F5NA 2ZIVA 1F5SA 5AI0A 4YQWA 5D49A 4FS1A 3I76A 1KL9A 2WF9A 4CE6A 3C2MA 1SV4A 4QZ8A 4YD1A 1DGJA 2WTFA 4NLCA 4R65A 3EYZA 2AJQA 2WFAA 3NASA 2PMZC 3F53A 4KLFA 4RZRA 2WF7A 4QZBA 3GIMA 1JIHA 3PX6A 3PX0A 1ZRMA 4QNLA 3BQ7A 3RBDA 2UVWA 2MUTB 4GLXA 2JEJA 5DB8A 4YN4A 2BPCA 5KG6A 2ASLA 2H3FA 2F44A 1MC8A 4F4WA 3WKDA 4DQQA 2BQRA 3HJEA 5CA7A 5DB9A 5AM2A 1X66A 3HKZC 1S8OA 1TFRA 1NJYA 3AU6A 4BDPA 2OWOA 4Q43A 4XA5A 5HP4A 2RDJA 1AQ6A 3EPGA 3HILA 3N7PD 4UAUA 1YZ7A 1XC9A 5KTQA 3NRWA 1NK5A 4FZLA 4OJLA 1UCVA 2HHWA 4Y2YA 2F1JA 2JRZA 3H8JA 1V97A 3FC4A 2DWQA 2PFPA 5CHGA 2AXTU 3OHBA 3QU5A 4UBBA 3ALRA 4BXOA 3BS5B 1KDHA 4F5RA 2GWSA 2MAXA 1ZRNA 1SL2A 3RRHA 1ZOLA 1TK0A 3BDPA 3H8MA 3OSPA 3PSPA 5KFMA 3H0RB 2Y9UA 1BPYA 3H4DA 5ALJA 1Q3VA 4O3SA 2EZZA 4RNOA 4Z6FA 2RQ5A 2G08A 4ICAA 4JV2A 5AI5A 3QX7A 3OTQA 4HAIA 1GO3F 2D8CA 1LB2B 2C2RA 1TK5A 5J2EA 1ZD4A 4KX3A 3GQCA 2WF8A 1U47A 1SZPA 3OHAA 3UMBA 1K1QA 2VA2A 3RJHA 3I1YA 4XRHA 5L9XA 3ISDA 1KQQA 7ICMA 1S0NA 4P0PB 2BQ3A 1NJXA 3KTQA 1BGXT 3SD7A 4P4PA 2O6KA 5C0YA 4Q8EA 3ZDCA 4C4SA 3EUB2 2RP5A 5DKWA 3HW8A 3ONNA 2G06A 5F9NA 5KFIA 5KFOA 3GV7B 5DBCA 3GILA 2KFNA 4F3OA 2W9BB 3NS1A 4NLBA 3JPNA 1K1SA 8ICTA 4UW9A 4OD0A 1JX4A 4ZH4A 2RHFA 2CRXA 2EZYA 1NKBA 4P4MA 2P66A 3V7KA 1RPLA 4RQ0A 3H4BA 5KFXA 2FLNA 9ICGA 2Y0SC 4GXKA 2KNJA 4DL4A 2KSOB 3HT3A 3TARA 3Q8SB 4TUPA 2XI9A 3ZD8A 2IOFK 5AKZA 3G6VA 4DFMA 5F9LA 2LPEA 9ICHA 4KMUA 3LDAA 4ELUA 2GOLA 5DG9A 5ALSA 1N63A 1Z3EB 2EH9A 3DDHA 8ICSA 5L1MA 4RPZA 2ISOA 2K4EA 2JEIA 5ALVA 4XQ8A 1ZETA 4Y2PA 4UB8U 2VKQA 4IQWA 1V38A 4MEXA 3HX0A 3BS7A 4J9OA 3MR3A 1WYGA 4KLOA 3WKBA 4Z6EA 5ALRA 1J2MA 3L4PA 1QH9A 1RXWA 1RYUA 2A1AA 3FAHA 4NY8A 1NZBA 4DQIA 2WAQC 3IRUA 4NLNA 2LHTA 4I2CA 5KT5A 3K1ZA 1N2XA 5J2KA 2DPJA 3MFIA 1ZQWA 2ZIWB 4KLGA 2W3SA 4MFCA 5DBBA 1FEZA 4UAWA 5BOMA 2NO4A 1ZD3A 4YP3A 2LYBA 4QWAA 3RJFA 4JV0A 1DK3A 3EZ5A 1NKCA 1TVAA 3DV9A 5KT6A 3M7DA 3CW2C 5KAIU 2LM1A 1A6SA 2J6TA 1Y88A 5ALYA 4ECZA 1DOQA 2G07A 1L3TA 3WKCA 1CRXA 5AK5A 3OGUA 4C8LA 3ZDEA 2HI0A 4PHEA 3N4MB 4CDGA 3QU2A 2HHQA 3C23A 1V85A 8ICIA 4QWCA 5J2JA 2W7PA 2VA3A 2VJ4A 1ZQHA 5J2HA 2YX8A 2KD1A 3V72A 3ZDBA 3EW9A 2JEFA 3AL0B 4BUGA 3ORYA 5IIJA 3UPQA 3K1RB 4ECWA 4DCCA 3TI0A 7ICTA 2QB0B 9ICTA 4DL3A 3UXOA 3QUTA 9ICVA 4C4RA 4J9PA 3LVVA 1DK2A 5HHHA 2FMQA 3SV4A 3BZKA 4UARA 2AGQA 2E3TA 4R8UB 2ATLA 2J6UA 1KFTA 1KTQA 3HKZF 5AKIA 5KFWA 5J2AA 4IC9A 9ICPA 7ICQA 3BS5A 3TAQA 4ECXA 2E8PA 2QLTA 1CEZA 2K8CB 4C4TA 4B9VA 2P35A 5KT2A 1Z00B 4RT2A 3UM9A 1QCKA 5KT4A 1ZQTA 4YR2A 4FO6A 2B6GA 4RQ5A 5CWRA 5D4BA 1P7DA 1NKEA 4KX5A 1WWVA 3GZFA 4YXJA 1PVPA 4Z6CA 3Q8QB 3OJSA 4UQGA 1S0OA 1UT8A 8ICQA 5DDYA 3MR5A 5J0UA 1JALA 5J8YC 2AQ4A 1ZQDA 4BX9C 4FFDA 2ZJ5A 2QB1A 4RQ4A 4K4HA 1IM4A 3PMLA 1RZTA 2JMGA 4RQ7A 1JROA 2XGQA 2KIVA 1IG6A 4M9HA 4ECSA 2V4RA 2XICA 1H38A 2KHVA 3AQEA 1Q8KA 4EEYA 2LMRA 4UBCA 4O5EA 4ED3A 4J9RA 5J8YA 4ED8A 1SV0C 4R63A 3UQ2A 5HNKA 3RB3A 5T14A 2KJ9A 3MDAA 1X40A 2ISPA 5DGBA 1NK0A 4K4IA 5AKKA 4GXJA 3ETLA 2Q0ZX 4J9LA 4F5OA 3H7IA 4JWNA 1XS9D 4M0AA 1N48A 2OH2A 2HBJA 3C2LA 4O3RA 2KJ8A 2HVHA 3M9NB 5KFYA 3HP6A 5J0OA 1KN5A 1T3NA 3PVXA 2FPKA 3FDSA 4WJ3B 2VA8A 3IHQB 3IG8A 3ETRA 1ZJMA 5KG2A 5ALHA 3QU9A 1SL0A 2W9MA 2OYYA 4PHDA 4TUQA 2G5IB 1FFVA 1T3QA 3M8SA 4RT3A 5KG3A 2DQNB 2G0AA 4LZGA 4I2BA 4BWMA 4F93B 2HHSA 3QU4A 2HCFA 1COKA 8ICEA 1U48A 2HHTA 3RJJA 4M47A 4QW9A 1KFDA 3WU2U 1Z19A 8ICYA 1FIQA 3RJKA 4OJ5A 4P4OA 4DOAA 1DRGA 1BNPA 1ZQAA 4F4ZA 5KNIA 8ICKA 4ZOHC 1KEJA 4CF4A 2YMPA 5EOZA 5K4LA 1KBUA 1HUOA 3RBEA 3RRGA 2R8IA 4LJXA 5ALZA 4PZOA 5KG4A 5DQIA 3RB0A 2E1FA 4KLTA 5DLFA 1BPEA 1L3SA 5C5JA 4PGXA 4F5PA 1S0MA 3SMVA 3EPIA 1WUDA 2HVIA 1UHUA 4I2IA 4NXZA 3D6JA 2DL0A 4I2GA 1ZJNA 3G6XA 3PR4A 5KFNA 4ED2A 3C1ZA 9ICEA 1F44A 5B66U 1B22A 3PW5A 3C5FA 3CP8A 2H3IA 1J2NA 2AQ0A 4MEYA 3T5KA 3PSTA 4ELVA 2W9BA 5J0QA 5CEHA 2XCPA 4YD2A 3ED5A 5KFTA 5GTHU 1O03A 2B21A 3MR2A 3QEBZ 8ICUA 2KZZA 5AI9A 4O5KA 3T5HA 1MQ3A 4C7ZA 2N1RA 2BCRA 3IN5A 2LKYA 2W3RA 4EYIB 9ICMA 5GTIU 4IQUA 4EZ6A 4KLLA 2BKEA 3PY8A 4GXIA 2W9CA 2AGPA 1XO0A 4DQPA 4DSJA 1ZQXA 3OPXA 2ZTEA 1S9FA 4CF3A 2R8KA 4BWJA 4F5QA 4RPYA 2XY5A 4DOBA 7ICNA 1ZQEA 4KLUA 4B9NA 2YMQA 5DLGA 4QZIA 3PX4A 1QQ6A 3BQ2A 2GLEA 3PZPA 9ICLA 1SV0A 1S10A 1JXEA 7ICFA 2HMXA 1NOMA 2W9AA 4EBCA 2DPIA 5J2FA 3KOOA 5ALUA 1PK1A 1L8LA 2NO5A 2W04A 8ICXA 3IP4B 2HOQA 3RFAA 2KFZA 3CRXA 4OCZA 2JHDA 1ED1A 4O9MA 4R66A 2BPFA 5L1IA 3V7LA 3FM9A 4JK1A 4F72A 1IIPA 5J0SA 7ICKA 8ICOA 2OHFA 2GO7A 4I2EA 4M2YA 3RH4A 7ICRA 3MBYA 3JPTA 2H3VA 5KG7A 4P0QA 5CRXA 2WHEA 3JPOA 2F1HA 5AI6A 4QZAA 4P0QB 3ZDAA 5E79U 4Y2JA 3C21A 5J0YA 5AHXA 5KFDA 5IIKA 3ISBA 3SAGA 3RH6A 2IHNA 4NLGA 3C29A 3NGDA 4I2HA 2BCUA 4O5CA 3C1YA 5ALLA 1UPHA 4QZHA 3OJUA 2KV2A 2FDRA 2GH1A 4DFPA 5B5EU 4KLIA 4ELTA 2JZBB 3PSFA 5DB6A 1Z4OA 5DG8A 3N28A 1K5OA 1JXLA 5EWGA 4OJOA 5J2CA 3IM1A 3GV8B 4RUAA 3SQIA 4EZ9A 3GV5B 4JV1A 5KFVA 2C2DA 3TQ1A 5TZVA 2ZJAA 4NJ8A 8ICBA 4UB5A 4LZDA 2OCEA 3PV8A 1ZQSA 1MA7A 5D46A 5KFQA 1X9MA 2ZIUB 3AQFA 3RR8A 4AP9A 4C80A 2CXYA 3Q8RB 2ES6A 3JPPA 5AK4A 8ICMA 4PZNA 4YR0A 3QUQA 1LVHA 4PHPA 1BNOA 3WK4A 4B9LA 5J2BA 5L1KA 3K75D 4KLHA 5KFLA 4J9NA 2ZUDA 4PHAA 5L1JA 1O08A 3M6KA 3RTVA 5AKXA 2C2EA 2NRWA 1ZQGA 4MHVA 1N56A 2BQUA 2P6UA 5J0RA 3MFHA 2EZXA 5EE3A 2JR5A 2ASDA 8ICCA 4O3QA 2ZIXB 4ED1A 4F92B 3TANA 4G3IA 1N61A 5KG1A 5AICA 2B0CA 1Z00A 3KHLA 4NLKA 1S77D 2BCVA 1X6IA 4EEKA 2KIWA 5ALNA 2HBLA 1SXDA 1UA1A 1QQ7A 1U45A 5KFPA 1C20A 1UQVA 1OXJA 3F5EA 2XY6A 2F76X 4EX6A 2HW3A 2FPLA 2HBKA 3SV3A 2H5XA 3UXNA 2JH7A 4U6PA 3R9KA 5HMLA 1NK9A 2KP7A 5J0WA 2A1JA 4DS4A 4US9A 5ALMA 2I6XA 2PXIA 1CUKA 2K4PA 4PL1A 2JH1A 3IDWA 4RQ3A 3T3FA 2KZ3A 5EE1A 1PUZA 4UB6U 5J0XA 4NLZA 1SXEA 1RYRA 4X5VA 1Z4NA 1NK7A 1LKYA 5AM0A 5KG5A 4IR9A 5AI4A 2Y0SF 1L7PA 4GC7A 1Q46A 4EBDA 3DEEA 2K89A 4O3MA 3N7RC 1PVQA 3VC8A 4B9MA 2ZUBA 4DWIA 3S6JA 5IIIA 4CF5A 4IRKA 2OXOA 2LI6A 3C5GA 1RQNA 2PMZF 3QUBA 4DOCA 3D2NA 4K4GA 4M9JA 4DLGA 5HR6A 1XSLA 4TQRA 4QWBA 1RXVA 1TAUA 3MABA 1HIWA 1XU4A 2BGWA 2G5HB 4M04A 1NZPA 2W11A 5ALGA 9ICQA 2FPMA 2EAMA 4J03A 4UB2A 3H40A 3WK8A 4KLEA 3RJIA 2ZJ8A 5H2FU 4PGYA 1JN3A 5AK3A 3U26A 2ZIVB 1ZD5A 4F50A 1PZNA 1ZQJA 3NRZA 3TACB 5AM3A 1X9SA 1D9DA 5ALPA 3A0BU 3M9OB 4PPXA 4OJPA 2IHMA 4M9GA 4RQNA 5G5GA 3KFUF 4ECQA 2HHUA 2LM4A 1TV9A 9ICWA 1T94A 1ZD2P 2V9WA 5DGAA 2XO7A 4YG2A 2ODGA 3MC1A 1IV8A 1SL1A 4MF2A 4C0ZA 2V4QA 4Q44A 2RRDA 4CCHA 2AU0A 1TAQA 7ICVA 1KW4A 7ICHA 1URJA 3GIJA 3F5AA 1ZQ1C 4YXMA 1J97A 1N60A 1ZQYA 4RU9A 1TAMA 5AKLA 4I27A 4GC6A 2QARB 3THVA 2A19A 5HHIA 4ECRA 5AKYA 2E8NA 5TISU 1L3UA 2K8AA 4O3NA 4I2FA 4C8NA 2HHVA 4KLJA 9ICKA 3MDCA 2Z7JA 2UVRA 4R8UA 2W03A 3QYPA 2EAOA 8ICFA 2LYHA 3MGHA 2R8JA 1ZQZA 2VJ5A 4NWIA 3QZ8A 5IIMA 3GIIA 4UB3A 3L3FX 4KLSA 3RR7A 4EELA 2I9GA 2HSZA 4UB4A 1X9XA 5KG0A 4FZMA 3C2KA 3KHGA 4M9NA 4B9SA 9ICJA 4NM2A 1L5UA 3WKEA 3WK6A 1N5XA 1S5LU 2PFOA 4J9SA 2F3NA 5IINA 3A0HU 4FS2A 2K4IA 5KFAA 2KJ5A 7ICSA 1M6YA 4B9UA 4MFAA 4USAA 5KAFU 3J81j 2MA1A 4DQRA 5JUMA 2BPGA 1IXRA 3PO4A 4JMUA 3SENA 4DLEA 3JPSA 2KTQA 1QSSA 5KFFA 5EWEA 2QKQA 2KVSA 4RNNA 4DL6A 1XO1A 1ZQQA 2J6SA 3ICXA 4GFJA 4EYHB 4F2SA 4ACOA 4Y2SA 3GDXA 3KKAA 5KFSA 4TQSA 5KL8B 2ZXIA 1SB3C 2VANA 2K8BB 2R8HA 3AEVA 3JPRA 9ICCA 4YMNA 3O0FA 2ZTDA 2IOFA 5A0LA 1RG6A 3RH5A 2KG5A 4QW8A 4FZNA 1SIJA 4RPXA 1A76A 5JRTA 4R64A 3V7JA 4B9TA 1RM6C 1ZYQA 2KZMA 2F2AB 2YMMA 1RQLA 1FO4A 5HMMA 3D2SA 2ASJA 3TFRA 1TKDA 1D9FA 3C28A 3T79A 3Q8KA 2JXJA 5ALIA 3KKAC 4A8EA 2CN1A 3L5KA 4NL9C 3B0YA 3ZD9A 3SAFA 1ZQKA 3PW0A 3QE9Y 5KFZA 3TADA 3NVZA 4MFFA 2H3QA 7ICUA 5KFKA 3WKAA 4FBUA 1HJPA 1L7NA 2HOIA 5DBAA 4CNQA 2ZIWA 5AM4A 1EXNA 4RQMA 3ZI4A 4AYBC 1XSNA 3TKAA 2JGAA 2C22A 3LWMA 2D3DA 1Z1BA 1UA0A 2KKVA 2K60A 3UMGA 1ZQPA 4ECYA 4NM1A 2YB1A 5J0TA 4QIWC 1BPZA 4DL5A 1VJ5A 3G6YA 4EENA 2E1EA 4ED7A 1VDVA 5AIBA 5KFCA 3WK5A 3SEIA 3VCBA 5IIOA 4J9MA 2WB1F 2I5HA 4NV0A 1ZQVA 1D8LA 2KK0A 3LYSA 4E0DA 2PFQA 2KHQA 3RB4A 1PK3A 4IQTA 4F4KA 1ZQRA 4DO9A 3NVVA 4C7YA 5KFUA 4C8MA 4IL6U 2NRZA 3KHHA 4DS5A 3GFKB 2RDIA 2P6RA 4I28A 4PH5A 2ZUCA 3RAXA 3RJEA 4C8KA 2Y1JA 3BQ1A 2L5YA 4O3OA 2PKEA 2I1QA 1DGSA 1PVRA 3QEAZ 3BZCA 3I28A 3AUOA 2BCQA 1T8EA 3HPOA 4M9LA 2RLTA 5J0PA 1ZXIA 3PW4A 1KLNA 3AU2A 8ICGA 7ICLA 2NYVA 1MSWD 2KE7A 1VLBA 5CP2A 3QNMA 2W7OA 2NV3A 1BVSA 4Y2XA 2EDUA 9ICBA 2WF5A 3PNCA 4KTQA 7ICEA 3Q8MA 2DGZA 5J2IA 2F1IA 4QWDA 4QZFA 1OW5A 4RUCA 1LKYB 1SKWA 4RQ8A 4UAYA 2C28A 1S76D 2KSOA 4RQ1A 2W9CB 2EANA 4O3PA 3M6ZA 3LK9A 2ALZA 3Q8LA 1Z1VA 2F8KA 5HR7A 2FJ6A 3LVWA 9ICSA 4KMOB 3CYMA 1U4BA 4FBTA 3SAHA 5CR0A 9ICAA 2E8MA 3NVWA 5AM5A 1U49A 2JEGA 5ALOA 4DEZA 1D8YA 2DF4B 1DXSA 1X2IA 5DQHA 2DKZA 3SZ2A 2IOHA 1SWVA 2LYAA 2WB1C 4J9KA 3OSNA 4PL2A 2BR0A 1XWLA 3NTUA 1B43A 4GIBA 1YZ6A 5FP0A 4ECTA 3H8SA 1ZQNA 1YT3A 2JV3A 4YMMA 2XY7A 5KFGA 2HOFA 2FE9A 1TK8A 4J9QA 5KFEA 3GU3A 2JZBA 2Y1IA 1NK4A 1ZQMA 2MUTA 4AYBF 5AK6A 2F8LA 1FFUA 1NI3A 3QUCA 3TADC 4DF4A 8ICAA 1QQ5A 1HUZA 5IILA 2DBYA 2YY6A 2ZXHA 2BHNA 3MGVA 2UVVA 2EAPA 1X9WA 4UAZA 4F4YA 1L3VA 5AM1A 4BGDA 4HYKA 4ED0A 3PW7A 4F8RA 2FMPA 1F0MA 3HWTA 2FMSA 2PI4A 4RQ6A 2KN7A 1NK8A 3PR5B 1TE2A 4DL2A 2VIXA 3BQTA 3AN1A 2KKPA 4YMOA 4DF8A 4DSIA 3QU7A 8ICNA 4US8A 8ICWA 3ZDDA 4XUSA 1ZQIA 1ZQUA 3H0MB 3Q8PB 1N5WA 7ICGA 3IG5A 4PGQA 3V6KA 4BXOB 9ICIA 3KHRA 1BPXA 1MQ2A 1L7MA 4QZDA 3T5LA 2W8LA 1A0PA 1JUDA 1X6JA 4JB3A 2QB0A 5KT7A 4Y2RA 4Y2QA 5DDMA 4QJFB
chains in the Genus database with same CATH topology
5L1MA 1B4FA 1SV4A 2DL0A 4MHVA 1X40A 1DXSA 2DKZA 1JI7A 3SEIA 1V38A 3BS7A 1B0XA 1PK3A 1RG6A 2D8CA 2KG5A 2EAOA 2JV3A 3BS5A 1WWUA 3BQ7A 5JRTA 2EAMA 2FE9A 2E8PA 1PK1B 2DKXA 2F44A 2L5YA 2B6GA 2YTUA 3TADC 3TACB 1X9XA 1X66A 1SXDA 1UQVA 1OXJA 1WWVA 4RQNA 4NJ8A 2EAPA 3KKAC 2F3NA 2ESEA 3HILA 5JU5A 1SGGA 1COKA 4NL9C 1F0MA 2GLEA 5J8YC 1SV0A 2KE7A 2QB1A 1UCVA 3TADA 2K4PA 5KNIA 2KIVA 1PK1A 3IDWA 3SENA 2E8OA 1OW5A 2ES6A 2KMDA 1LKYB 1V85A 1SXEA 2KSOB 4PZOA 4IS7A 1LKYA 2LMRA 2QKQA 1KW4A 2Y9TA 3BS5B 2KSOA 4PZNA 4RQMA 2EANA 5J8YA 2QARA 2LPEA 2D3DA 1Z1VA 2F8KA 2K60A 5JTIA 2QARB 4NL9A 2QB0A 3K1RB 3H8MA 1SV0C 3KKAA 2QB0B 2E8MA 2Y9UA 2E8NA 5F3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L1M A;  1B4F A;  1SV4 A;  2DL0 A;  4MHV A;  1X40 A;  1DXS A;  2DKZ A;  1JI7 A;  3SEI A;  1V38 A;  3BS7 A;  1B0X A;  1PK3 A;  1RG6 A;  2D8C A;  2KG5 A;  2EAO A;  2JV3 A;  3BS5 A;  1WWU A;  3BQ7 A;  5JRT A;  2EAM A;  2FE9 A;  2E8P A;  1PK1 B;  2DKX A;  2F44 A;  2L5Y A;  2B6G A;  2YTU A;  3TAD C;  3TAC B;  1X9X A;  1X66 A;  1SXD A;  1UQV A;  1OXJ A;  1WWV A;  4RQN A;  4NJ8 A;  2EAP A;  3KKA C;  2F3N A;  2ESE A;  3HIL A;  5JU5 A;  1SGG A;  1COK A;  4NL9 C;  1F0M A;  2GLE A;  5J8Y C;  1SV0 A;  2KE7 A;  2QB1 A;  1UCV A;  3TAD A;  2K4P A;  5KNI A;  2KIV A;  1PK1 A;  3IDW A;  3SEN A;  2E8O A;  1OW5 A;  2ES6 A;  2KMD A;  1LKY B;  1V85 A;  1SXE A;  2KSO B;  4PZO A;  4IS7 A;  1LKY A;  2LMR A;  2QKQ A;  1KW4 A;  2Y9T A;  3BS5 B;  2KSO A;  4PZN A;  4RQM A;  2EAN A;  5J8Y A;  2QAR A;  2LPE A;  2D3D A;  1Z1V A;  2F8K A;  2K60 A;  5JTI A;  2QAR B;  4NL9 A;  2QB0 A;  3K1R B;  3H8M A;  1SV0 C;  3KKA A;  2QB0 B;  2E8M A;  2Y9U A;  2E8N A;  5F3X B; 
#chains in the Genus database with same CATH topology
 3UXP A;  2ZG6 A;  2W8K A;  2XVT A;  2YQE A;  2BZF A;  1JI7 A;  4B6J A;  4UB1 A;  1ZQC A;  1SKR A;  1T7P A;  5KFR A;  5DQG A;  1V9P A;  3CNH A;  2IBK A;  8ICH A;  1NJZ A;  2M0N A;  4TUS A;  4M6W A;  4PJ0 U;  4LVS A;  2KVC A;  4M6W B;  5AI8 A;  8ICZ A;  4FE3 A;  2FI1 A;  5DB7 A;  3SI8 A;  4UAS A;  1ZQL A;  3E0F A;  2WAQ F;  3UQ0 A;  2LBO A;  4Y2U A;  4YFK A;  4RQ2 A;  4Z6D A;  4P0P A;  4KN7 A;  2E5S A;  4Y2V A;  1XSP A;  2HHX A;  1QSL A;  1KSP A;  1JMS A;  1HEK A;  1L8O A;  5AKJ A;  9ICN A;  3GIK A;  5ALD A;  1NJW A;  5JU5 A;  5BPC A;  4I2A A;  1NK6 A;  5L1L A;  4G9B A;  3MR6 A;  4F4X A;  1UT5 A;  3RB6 A;  4I2J A;  4C8O A;  7ICO A;  3MGI A;  2KIC A;  1KKX A;  4QIW F;  1WG8 A;  4DFD A;  5AIA A;  3M9M B;  2E8O A;  5KT3 A;  2W43 A;  2W55 A;  4EBE A;  2KMD A;  3F2C A;  1ZQO A;  4YCX A;  2Y9T A;  5ALF A;  1OUQ A;  3E2E A;  1S0V A;  3B0X A;  2W54 A;  2Q4T A;  1QTM A;  5CB1 A;  5ALQ A;  3F2D A;  2K4H A;  9ICU A;  1WCL A;  4UAT A;  3BQ0 A;  1RYS A;  2EQY A;  1SWW A;  5KFJ A;  2NRV A;  4EX7 A;  3RAQ A;  4F2R A;  3N7S C;  2G09 A;  1N62 A;  8ICV A;  2PI5 A;  8ICL A;  5KFH A;  3IV6 A;  3PO5 A;  2AHO B;  3HRD D;  5J2D A;  2NRX A;  2M9N A;  1BPD A;  2FLL A;  2AH5 A;  1KRP A;  5KFB A;  4ECV A;  1B0X A;  3QZ7 A;  4U7C A;  5EWF A;  4YR3 A;  2ZIU A;  3WK9 A;  2CPR A;  1NNL A;  1COO A;  1ZQF A;  4OO1 J;  1L7O A;  5AKG A;  2DKX A;  2MRL A;  3D2Q A;  1CI4 A;  5EE9 A;  4Q8F A;  1LV5 A;  3JPQ A;  2D6F C;  1QSY A;  4DQS A;  4OJ6 A;  2PFN A;  2H3Z A;  1MN8 A;  1Q3U A;  2BDP A;  3V6H A;  2R18 A;  4ED6 A;  1U9L A;  4IRD A;  2KEY A;  3N97 B;  3RJG A;  8ICR A;  3AM9 A;  9ICO A;  4IQV A;  3AMZ A;  2BCS A;  3KBB A;  7ICJ A;  5ALW A;  4I2D A;  3E58 A;  9ICX A;  2DFL A;  1C7Y A;  5CJ7 A;  4JUZ A;  4BJQ A;  1JRP A;  2XGP A;  2F77 X;  3H0L B;  3PSI A;  2BDU A;  4IS7 A;  1S97 A;  1BPB A;  4Y2T A;  4F91 B;  1ARO P;  2XID A;  2QAR A;  3EWA A;  5ALK A;  4Q45 A;  2FLP A;  5JTI A;  3V6J A;  4NL9 A;  2UVU A;  2XCA A;  4KLD A;  1QLN A;  3K4G A;  5F3X B;  3KZI U;  3SYZ A;  1B4F A;  5G5H A;  3F2B A;  5AKH A;  4IRC A;  4DSL A;  4DFJ A;  4QZG A;  2OEH A;  2WF6 A;  4QZC A;  5DG7 A;  1A77 A;  5ALE A;  3BJY A;  3NVY A;  3TFS A;  2MSN A;  4DFK A;  1XNS A;  4DL7 A;  4DSE A;  1WCN A;  2A1J B;  4RNM A;  3LWL A;  1WWU A;  3QXG A;  4YVZ A;  5J2G A;  2HBM A;  5ALT A;  3UMC A;  1PK1 B;  3ISC A;  5EE0 A;  4QZ9 A;  4QZE A;  2IA6 A;  5J29 A;  9ICR A;  4DSK A;  3RF9 A;  2MU2 A;  4KIT B;  5KL1 B;  7ICI A;  2DUY A;  8ICP A;  2XC9 A;  2YTU A;  4I29 A;  4IR1 A;  4CGZ A;  3TAP A;  3H8W A;  4KN4 A;  4O0I A;  3PW2 A;  1X42 A;  5ALX A;  5BOL A;  4DSF A;  1D8B A;  4P2H A;  4QWE A;  2OM6 A;  4JWM A;  3KZX A;  2AGO A;  1SZH A;  2ESE A;  1KFS A;  1SGG A;  1T4G A;  4F71 A;  3T5J A;  2ZIX A;  3KD3 A;  3B9J A;  4TUR A;  3SR6 A;  4ECU A;  7ICP A;  2A3V A;  4UAV A;  3NUQ A;  8ICJ A;  3PMN A;  2NRT A;  2YB4 A;  2R8G A;  3FYH A;  2YN4 A;  3M8R A;  2HDO A;  2YML A;  2KOB A;  4CRX A;  1SKS A;  2IMW P;  1ECW A;  9ICF A;  4KLM A;  4MF8 A;  2ZTC A;  1ZQB A;  5AKE A;  1L6N A;  3M1Y A;  1RDF A;  4KLQ A;  3WK7 A;  4F5N A;  2ZIV A;  1F5S A;  5AI0 A;  4YQW A;  5D49 A;  4FS1 A;  3I76 A;  1KL9 A;  2WF9 A;  4CE6 A;  3C2M A;  1SV4 A;  4QZ8 A;  4YD1 A;  1DGJ A;  2WTF A;  4NLC A;  4R65 A;  3EYZ A;  2AJQ A;  2WFA A;  3NAS A;  2PMZ C;  3F53 A;  4KLF A;  4RZR A;  2WF7 A;  4QZB A;  3GIM A;  1JIH A;  3PX6 A;  3PX0 A;  1ZRM A;  4QNL A;  3BQ7 A;  3RBD A;  2UVW A;  2MUT B;  4GLX A;  2JEJ A;  5DB8 A;  4YN4 A;  2BPC A;  5KG6 A;  2ASL A;  2H3F A;  2F44 A;  1MC8 A;  4F4W A;  3WKD A;  4DQQ A;  2BQR A;  3HJE A;  5CA7 A;  5DB9 A;  5AM2 A;  1X66 A;  3HKZ C;  1S8O A;  1TFR A;  1NJY A;  3AU6 A;  4BDP A;  2OWO A;  4Q43 A;  4XA5 A;  5HP4 A;  2RDJ A;  1AQ6 A;  3EPG A;  3HIL A;  3N7P D;  4UAU A;  1YZ7 A;  1XC9 A;  5KTQ A;  3NRW A;  1NK5 A;  4FZL A;  4OJL A;  1UCV A;  2HHW A;  4Y2Y A;  2F1J A;  2JRZ A;  3H8J A;  1V97 A;  3FC4 A;  2DWQ A;  2PFP A;  5CHG A;  2AXT U;  3OHB A;  3QU5 A;  4UBB A;  3ALR A;  4BXO A;  3BS5 B;  1KDH A;  4F5R A;  2GWS A;  2MAX A;  1ZRN A;  1SL2 A;  3RRH A;  1ZOL A;  1TK0 A;  3BDP A;  3H8M A;  3OSP A;  3PSP A;  5KFM A;  3H0R B;  2Y9U A;  1BPY A;  3H4D A;  5ALJ A;  1Q3V A;  4O3S A;  2EZZ A;  4RNO A;  4Z6F A;  2RQ5 A;  2G08 A;  4ICA A;  4JV2 A;  5AI5 A;  3QX7 A;  3OTQ A;  4HAI A;  1GO3 F;  2D8C A;  1LB2 B;  2C2R A;  1TK5 A;  5J2E A;  1ZD4 A;  4KX3 A;  3GQC A;  2WF8 A;  1U47 A;  1SZP A;  3OHA A;  3UMB A;  1K1Q A;  2VA2 A;  3RJH A;  3I1Y A;  4XRH A;  5L9X A;  3ISD A;  1KQQ A;  7ICM A;  1S0N A;  4P0P B;  2BQ3 A;  1NJX A;  3KTQ A;  1BGX T;  3SD7 A;  4P4P A;  2O6K A;  5C0Y A;  4Q8E A;  3ZDC A;  4C4S A;  3EUB 2;  2RP5 A;  5DKW A;  3HW8 A;  3ONN A;  2G06 A;  5F9N A;  5KFI A;  5KFO A;  3GV7 B;  5DBC A;  3GIL A;  2KFN A;  4F3O A;  2W9B B;  3NS1 A;  4NLB A;  3JPN A;  1K1S A;  8ICT A;  4UW9 A;  4OD0 A;  1JX4 A;  4ZH4 A;  2RHF A;  2CRX A;  2EZY A;  1NKB A;  4P4M A;  2P66 A;  3V7K A;  1RPL A;  4RQ0 A;  3H4B A;  5KFX A;  2FLN A;  9ICG A;  2Y0S C;  4GXK A;  2KNJ A;  4DL4 A;  2KSO B;  3HT3 A;  3TAR A;  3Q8S B;  4TUP A;  2XI9 A;  3ZD8 A;  2IOF K;  5AKZ A;  3G6V A;  4DFM A;  5F9L A;  2LPE A;  9ICH A;  4KMU A;  3LDA A;  4ELU A;  2GOL A;  5DG9 A;  5ALS A;  1N63 A;  1Z3E B;  2EH9 A;  3DDH A;  8ICS A;  5L1M A;  4RPZ A;  2ISO A;  2K4E A;  2JEI A;  5ALV A;  4XQ8 A;  1ZET A;  4Y2P A;  4UB8 U;  2VKQ A;  4IQW A;  1V38 A;  4MEX A;  3HX0 A;  3BS7 A;  4J9O A;  3MR3 A;  1WYG A;  4KLO A;  3WKB A;  4Z6E A;  5ALR A;  1J2M A;  3L4P A;  1QH9 A;  1RXW A;  1RYU A;  2A1A A;  3FAH A;  4NY8 A;  1NZB A;  4DQI A;  2WAQ C;  3IRU A;  4NLN A;  2LHT A;  4I2C A;  5KT5 A;  3K1Z A;  1N2X A;  5J2K A;  2DPJ A;  3MFI A;  1ZQW A;  2ZIW B;  4KLG A;  2W3S A;  4MFC A;  5DBB A;  1FEZ A;  4UAW A;  5BOM A;  2NO4 A;  1ZD3 A;  4YP3 A;  2LYB A;  4QWA A;  3RJF A;  4JV0 A;  1DK3 A;  3EZ5 A;  1NKC A;  1TVA A;  3DV9 A;  5KT6 A;  3M7D A;  3CW2 C;  5KAI U;  2LM1 A;  1A6S A;  2J6T A;  1Y88 A;  5ALY A;  4ECZ A;  1DOQ A;  2G07 A;  1L3T A;  3WKC A;  1CRX A;  5AK5 A;  3OGU A;  4C8L A;  3ZDE A;  2HI0 A;  4PHE A;  3N4M B;  4CDG A;  3QU2 A;  2HHQ A;  3C23 A;  1V85 A;  8ICI A;  4QWC A;  5J2J A;  2W7P A;  2VA3 A;  2VJ4 A;  1ZQH A;  5J2H A;  2YX8 A;  2KD1 A;  3V72 A;  3ZDB A;  3EW9 A;  2JEF A;  3AL0 B;  4BUG A;  3ORY A;  5IIJ A;  3UPQ A;  3K1R B;  4ECW A;  4DCC A;  3TI0 A;  7ICT A;  2QB0 B;  9ICT A;  4DL3 A;  3UXO A;  3QUT A;  9ICV A;  4C4R A;  4J9P A;  3LVV A;  1DK2 A;  5HHH A;  2FMQ A;  3SV4 A;  3BZK A;  4UAR A;  2AGQ A;  2E3T A;  4R8U B;  2ATL A;  2J6U A;  1KFT A;  1KTQ A;  3HKZ F;  5AKI A;  5KFW A;  5J2A A;  4IC9 A;  9ICP A;  7ICQ A;  3BS5 A;  3TAQ A;  4ECX A;  2E8P A;  2QLT A;  1CEZ A;  2K8C B;  4C4T A;  4B9V A;  2P35 A;  5KT2 A;  1Z00 B;  4RT2 A;  3UM9 A;  1QCK A;  5KT4 A;  1ZQT A;  4YR2 A;  4FO6 A;  2B6G A;  4RQ5 A;  5CWR A;  5D4B A;  1P7D A;  1NKE A;  4KX5 A;  1WWV A;  3GZF A;  4YXJ A;  1PVP A;  4Z6C A;  3Q8Q B;  3OJS A;  4UQG A;  1S0O A;  1UT8 A;  8ICQ A;  5DDY A;  3MR5 A;  5J0U A;  1JAL A;  5J8Y C;  2AQ4 A;  1ZQD A;  4BX9 C;  4FFD A;  2ZJ5 A;  2QB1 A;  4RQ4 A;  4K4H A;  1IM4 A;  3PML A;  1RZT A;  2JMG A;  4RQ7 A;  1JRO A;  2XGQ A;  2KIV A;  1IG6 A;  4M9H A;  4ECS A;  2V4R A;  2XIC A;  1H38 A;  2KHV A;  3AQE A;  1Q8K A;  4EEY A;  2LMR A;  4UBC A;  4O5E A;  4ED3 A;  4J9R A;  5J8Y A;  4ED8 A;  1SV0 C;  4R63 A;  3UQ2 A;  5HNK A;  3RB3 A;  5T14 A;  2KJ9 A;  3MDA A;  1X40 A;  2ISP A;  5DGB A;  1NK0 A;  4K4I A;  5AKK A;  4GXJ A;  3ETL A;  2Q0Z X;  4J9L A;  4F5O A;  3H7I A;  4JWN A;  1XS9 D;  4M0A A;  1N48 A;  2OH2 A;  2HBJ A;  3C2L A;  4O3R A;  2KJ8 A;  2HVH A;  3M9N B;  5KFY A;  3HP6 A;  5J0O A;  1KN5 A;  1T3N A;  3PVX A;  2FPK A;  3FDS A;  4WJ3 B;  2VA8 A;  3IHQ B;  3IG8 A;  3ETR A;  1ZJM A;  5KG2 A;  5ALH A;  3QU9 A;  1SL0 A;  2W9M A;  2OYY A;  4PHD A;  4TUQ A;  2G5I B;  1FFV A;  1T3Q A;  3M8S A;  4RT3 A;  5KG3 A;  2DQN B;  2G0A A;  4LZG A;  4I2B A;  4BWM A;  4F93 B;  2HHS A;  3QU4 A;  2HCF A;  1COK A;  8ICE A;  1U48 A;  2HHT A;  3RJJ A;  4M47 A;  4QW9 A;  1KFD A;  3WU2 U;  1Z19 A;  8ICY A;  1FIQ A;  3RJK A;  4OJ5 A;  4P4O A;  4DOA A;  1DRG A;  1BNP A;  1ZQA A;  4F4Z A;  5KNI A;  8ICK A;  4ZOH C;  1KEJ A;  4CF4 A;  2YMP A;  5EOZ A;  5K4L A;  1KBU A;  1HUO A;  3RBE A;  3RRG A;  2R8I A;  4LJX A;  5ALZ A;  4PZO A;  5KG4 A;  5DQI A;  3RB0 A;  2E1F A;  4KLT A;  5DLF A;  1BPE A;  1L3S A;  5C5J A;  4PGX A;  4F5P A;  1S0M A;  3SMV A;  3EPI A;  1WUD A;  2HVI A;  1UHU A;  4I2I A;  4NXZ A;  3D6J A;  2DL0 A;  4I2G A;  1ZJN A;  3G6X A;  3PR4 A;  5KFN A;  4ED2 A;  3C1Z A;  9ICE A;  1F44 A;  5B66 U;  1B22 A;  3PW5 A;  3C5F A;  3CP8 A;  2H3I A;  1J2N A;  2AQ0 A;  4MEY A;  3T5K A;  3PST A;  4ELV A;  2W9B A;  5J0Q A;  5CEH A;  2XCP A;  4YD2 A;  3ED5 A;  5KFT A;  5GTH U;  1O03 A;  2B21 A;  3MR2 A;  3QEB Z;  8ICU A;  2KZZ A;  5AI9 A;  4O5K A;  3T5H A;  1MQ3 A;  4C7Z A;  2N1R A;  2BCR A;  3IN5 A;  2LKY A;  2W3R A;  4EYI B;  9ICM A;  5GTI U;  4IQU A;  4EZ6 A;  4KLL A;  2BKE A;  3PY8 A;  4GXI A;  2W9C A;  2AGP A;  1XO0 A;  4DQP A;  4DSJ A;  1ZQX A;  3OPX A;  2ZTE A;  1S9F A;  4CF3 A;  2R8K A;  4BWJ A;  4F5Q A;  4RPY A;  2XY5 A;  4DOB A;  7ICN A;  1ZQE A;  4KLU A;  4B9N A;  2YMQ A;  5DLG A;  4QZI A;  3PX4 A;  1QQ6 A;  3BQ2 A;  2GLE A;  3PZP A;  9ICL A;  1SV0 A;  1S10 A;  1JXE A;  7ICF A;  2HMX A;  1NOM A;  2W9A A;  4EBC A;  2DPI A;  5J2F A;  3KOO A;  5ALU A;  1PK1 A;  1L8L A;  2NO5 A;  2W04 A;  8ICX A;  3IP4 B;  2HOQ A;  3RFA A;  2KFZ A;  3CRX A;  4OCZ A;  2JHD A;  1ED1 A;  4O9M A;  4R66 A;  2BPF A;  5L1I A;  3V7L A;  3FM9 A;  4JK1 A;  4F72 A;  1IIP A;  5J0S A;  7ICK A;  8ICO A;  2OHF A;  2GO7 A;  4I2E A;  4M2Y A;  3RH4 A;  7ICR A;  3MBY A;  3JPT A;  2H3V A;  5KG7 A;  4P0Q A;  5CRX A;  2WHE A;  3JPO A;  2F1H A;  5AI6 A;  4QZA A;  4P0Q B;  3ZDA A;  5E79 U;  4Y2J A;  3C21 A;  5J0Y A;  5AHX A;  5KFD A;  5IIK A;  3ISB A;  3SAG A;  3RH6 A;  2IHN A;  4NLG A;  3C29 A;  3NGD A;  4I2H A;  2BCU A;  4O5C A;  3C1Y A;  5ALL A;  1UPH A;  4QZH A;  3OJU A;  2KV2 A;  2FDR A;  2GH1 A;  4DFP A;  5B5E U;  4KLI A;  4ELT A;  2JZB B;  3PSF A;  5DB6 A;  1Z4O A;  5DG8 A;  3N28 A;  1K5O A;  1JXL A;  5EWG A;  4OJO A;  5J2C A;  3IM1 A;  3GV8 B;  4RUA A;  3SQI A;  4EZ9 A;  3GV5 B;  4JV1 A;  5KFV A;  2C2D A;  3TQ1 A;  5TZV A;  2ZJA A;  4NJ8 A;  8ICB A;  4UB5 A;  4LZD A;  2OCE A;  3PV8 A;  1ZQS A;  1MA7 A;  5D46 A;  5KFQ A;  1X9M A;  2ZIU B;  3AQF A;  3RR8 A;  4AP9 A;  4C80 A;  2CXY A;  3Q8R B;  2ES6 A;  3JPP A;  5AK4 A;  8ICM A;  4PZN A;  4YR0 A;  3QUQ A;  1LVH A;  4PHP A;  1BNO A;  3WK4 A;  4B9L A;  5J2B A;  5L1K A;  3K75 D;  4KLH A;  5KFL A;  4J9N A;  2ZUD A;  4PHA A;  5L1J A;  1O08 A;  3M6K A;  3RTV A;  5AKX A;  2C2E A;  2NRW A;  1ZQG A;  4MHV A;  1N56 A;  2BQU A;  2P6U A;  5J0R A;  3MFH A;  2EZX A;  5EE3 A;  2JR5 A;  2ASD A;  8ICC A;  4O3Q A;  2ZIX B;  4ED1 A;  4F92 B;  3TAN A;  4G3I A;  1N61 A;  5KG1 A;  5AIC A;  2B0C A;  1Z00 A;  3KHL A;  4NLK A;  1S77 D;  2BCV A;  1X6I A;  4EEK A;  2KIW A;  5ALN A;  2HBL A;  1SXD A;  1UA1 A;  1QQ7 A;  1U45 A;  5KFP A;  1C20 A;  1UQV A;  1OXJ A;  3F5E A;  2XY6 A;  2F76 X;  4EX6 A;  2HW3 A;  2FPL A;  2HBK A;  3SV3 A;  2H5X A;  3UXN A;  2JH7 A;  4U6P A;  3R9K A;  5HML A;  1NK9 A;  2KP7 A;  5J0W A;  2A1J A;  4DS4 A;  4US9 A;  5ALM A;  2I6X A;  2PXI A;  1CUK A;  2K4P A;  4PL1 A;  2JH1 A;  3IDW A;  4RQ3 A;  3T3F A;  2KZ3 A;  5EE1 A;  1PUZ A;  4UB6 U;  5J0X A;  4NLZ A;  1SXE A;  1RYR A;  4X5V A;  1Z4N A;  1NK7 A;  1LKY A;  5AM0 A;  5KG5 A;  4IR9 A;  5AI4 A;  2Y0S F;  1L7P A;  4GC7 A;  1Q46 A;  4EBD A;  3DEE A;  2K89 A;  4O3M A;  3N7R C;  1PVQ A;  3VC8 A;  4B9M A;  2ZUB A;  4DWI A;  3S6J A;  5III A;  4CF5 A;  4IRK A;  2OXO A;  2LI6 A;  3C5G A;  1RQN A;  2PMZ F;  3QUB A;  4DOC A;  3D2N A;  4K4G A;  4M9J A;  4DLG A;  5HR6 A;  1XSL A;  4TQR A;  4QWB A;  1RXV A;  1TAU A;  3MAB A;  1HIW A;  1XU4 A;  2BGW A;  2G5H B;  4M04 A;  1NZP A;  2W11 A;  5ALG A;  9ICQ A;  2FPM A;  2EAM A;  4J03 A;  4UB2 A;  3H40 A;  3WK8 A;  4KLE A;  3RJI A;  2ZJ8 A;  5H2F U;  4PGY A;  1JN3 A;  5AK3 A;  3U26 A;  2ZIV B;  1ZD5 A;  4F50 A;  1PZN A;  1ZQJ A;  3NRZ A;  3TAC B;  5AM3 A;  1X9S A;  1D9D A;  5ALP A;  3A0B U;  3M9O B;  4PPX A;  4OJP A;  2IHM A;  4M9G A;  4RQN A;  5G5G A;  3KFU F;  4ECQ A;  2HHU A;  2LM4 A;  1TV9 A;  9ICW A;  1T94 A;  1ZD2 P;  2V9W A;  5DGA A;  2XO7 A;  4YG2 A;  2ODG A;  3MC1 A;  1IV8 A;  1SL1 A;  4MF2 A;  4C0Z A;  2V4Q A;  4Q44 A;  2RRD A;  4CCH A;  2AU0 A;  1TAQ A;  7ICV A;  1KW4 A;  7ICH A;  1URJ A;  3GIJ A;  3F5A A;  1ZQ1 C;  4YXM A;  1J97 A;  1N60 A;  1ZQY A;  4RU9 A;  1TAM A;  5AKL A;  4I27 A;  4GC6 A;  2QAR B;  3THV A;  2A19 A;  5HHI A;  4ECR A;  5AKY A;  2E8N A;  5TIS U;  1L3U A;  2K8A A;  4O3N A;  4I2F A;  4C8N A;  2HHV A;  4KLJ A;  9ICK A;  3MDC A;  2Z7J A;  2UVR A;  4R8U A;  2W03 A;  3QYP A;  2EAO A;  8ICF A;  2LYH A;  3MGH A;  2R8J A;  1ZQZ A;  2VJ5 A;  4NWI A;  3QZ8 A;  5IIM A;  3GII A;  4UB3 A;  3L3F X;  4KLS A;  3RR7 A;  4EEL A;  2I9G A;  2HSZ A;  4UB4 A;  1X9X A;  5KG0 A;  4FZM A;  3C2K A;  3KHG A;  4M9N A;  4B9S A;  9ICJ A;  4NM2 A;  1L5U A;  3WKE A;  3WK6 A;  1N5X A;  1S5L U;  2PFO A;  4J9S A;  2F3N A;  5IIN A;  3A0H U;  4FS2 A;  2K4I A;  5KFA A;  2KJ5 A;  7ICS A;  1M6Y A;  4B9U A;  4MFA A;  4USA A;  5KAF U;  3J81 j;  2MA1 A;  4DQR A;  5JUM A;  2BPG A;  1IXR A;  3PO4 A;  4JMU A;  3SEN A;  4DLE A;  3JPS A;  2KTQ A;  1QSS A;  5KFF A;  5EWE A;  2QKQ A;  2KVS A;  4RNN A;  4DL6 A;  1XO1 A;  1ZQQ A;  2J6S A;  3ICX A;  4GFJ A;  4EYH B;  4F2S A;  4ACO A;  4Y2S A;  3GDX A;  3KKA A;  5KFS A;  4TQS A;  5KL8 B;  2ZXI A;  1SB3 C;  2VAN A;  2K8B B;  2R8H A;  3AEV A;  3JPR A;  9ICC A;  4YMN A;  3O0F A;  2ZTD A;  2IOF A;  5A0L A;  1RG6 A;  3RH5 A;  2KG5 A;  4QW8 A;  4FZN A;  1SIJ A;  4RPX A;  1A76 A;  5JRT A;  4R64 A;  3V7J A;  4B9T A;  1RM6 C;  1ZYQ A;  2KZM A;  2F2A B;  2YMM A;  1RQL A;  1FO4 A;  5HMM A;  3D2S A;  2ASJ A;  3TFR A;  1TKD A;  1D9F A;  3C28 A;  3T79 A;  3Q8K A;  2JXJ A;  5ALI A;  3KKA C;  4A8E A;  2CN1 A;  3L5K A;  4NL9 C;  3B0Y A;  3ZD9 A;  3SAF A;  1ZQK A;  3PW0 A;  3QE9 Y;  5KFZ A;  3TAD A;  3NVZ A;  4MFF A;  2H3Q A;  7ICU A;  5KFK A;  3WKA A;  4FBU A;  1HJP A;  1L7N A;  2HOI A;  5DBA A;  4CNQ A;  2ZIW A;  5AM4 A;  1EXN A;  4RQM A;  3ZI4 A;  4AYB C;  1XSN A;  3TKA A;  2JGA A;  2C22 A;  3LWM A;  2D3D A;  1Z1B A;  1UA0 A;  2KKV A;  2K60 A;  3UMG A;  1ZQP A;  4ECY A;  4NM1 A;  2YB1 A;  5J0T A;  4QIW C;  1BPZ A;  4DL5 A;  1VJ5 A;  3G6Y A;  4EEN A;  2E1E A;  4ED7 A;  1VDV A;  5AIB A;  5KFC A;  3WK5 A;  3SEI A;  3VCB A;  5IIO A;  4J9M A;  2WB1 F;  2I5H A;  4NV0 A;  1ZQV A;  1D8L A;  2KK0 A;  3LYS A;  4E0D A;  2PFQ A;  2KHQ A;  3RB4 A;  1PK3 A;  4IQT A;  4F4K A;  1ZQR A;  4DO9 A;  3NVV A;  4C7Y A;  5KFU A;  4C8M A;  4IL6 U;  2NRZ A;  3KHH A;  4DS5 A;  3GFK B;  2RDI A;  2P6R A;  4I28 A;  4PH5 A;  2ZUC A;  3RAX A;  3RJE A;  4C8K A;  2Y1J A;  3BQ1 A;  2L5Y A;  4O3O A;  2PKE A;  2I1Q A;  1DGS A;  1PVR A;  3QEA Z;  3BZC A;  3I28 A;  3AUO A;  2BCQ A;  1T8E A;  3HPO A;  4M9L A;  2RLT A;  5J0P A;  1ZXI A;  3PW4 A;  1KLN A;  3AU2 A;  8ICG A;  7ICL A;  2NYV A;  1MSW D;  2KE7 A;  1VLB A;  5CP2 A;  3QNM A;  2W7O A;  2NV3 A;  1BVS A;  4Y2X A;  2EDU A;  9ICB A;  2WF5 A;  3PNC A;  4KTQ A;  7ICE A;  3Q8M A;  2DGZ A;  5J2I A;  2F1I A;  4QWD A;  4QZF A;  1OW5 A;  4RUC A;  1LKY B;  1SKW A;  4RQ8 A;  4UAY A;  2C28 A;  1S76 D;  2KSO A;  4RQ1 A;  2W9C B;  2EAN A;  4O3P A;  3M6Z A;  3LK9 A;  2ALZ A;  3Q8L A;  1Z1V A;  2F8K A;  5HR7 A;  2FJ6 A;  3LVW A;  9ICS A;  4KMO B;  3CYM A;  1U4B A;  4FBT A;  3SAH A;  5CR0 A;  9ICA A;  2E8M A;  3NVW A;  5AM5 A;  1U49 A;  2JEG A;  5ALO A;  4DEZ A;  1D8Y A;  2DF4 B;  1DXS A;  1X2I A;  5DQH A;  2DKZ A;  3SZ2 A;  2IOH A;  1SWV A;  2LYA A;  2WB1 C;  4J9K A;  3OSN A;  4PL2 A;  2BR0 A;  1XWL A;  3NTU A;  1B43 A;  4GIB A;  1YZ6 A;  5FP0 A;  4ECT A;  3H8S A;  1ZQN A;  1YT3 A;  2JV3 A;  4YMM A;  2XY7 A;  5KFG A;  2HOF A;  2FE9 A;  1TK8 A;  4J9Q A;  5KFE A;  3GU3 A;  2JZB A;  2Y1I A;  1NK4 A;  1ZQM A;  2MUT A;  4AYB F;  5AK6 A;  2F8L A;  1FFU A;  1NI3 A;  3QUC A;  3TAD C;  4DF4 A;  8ICA A;  1QQ5 A;  1HUZ A;  5IIL A;  2DBY A;  2YY6 A;  2ZXH A;  2BHN A;  3MGV A;  2UVV A;  2EAP A;  1X9W A;  4UAZ A;  4F4Y A;  1L3V A;  5AM1 A;  4BGD A;  4HYK A;  4ED0 A;  3PW7 A;  4F8R A;  2FMP A;  1F0M A;  3HWT A;  2FMS A;  2PI4 A;  4RQ6 A;  2KN7 A;  1NK8 A;  3PR5 B;  1TE2 A;  4DL2 A;  2VIX A;  3BQT A;  3AN1 A;  2KKP A;  4YMO A;  4DF8 A;  4DSI A;  3QU7 A;  8ICN A;  4US8 A;  8ICW A;  3ZDD A;  4XUS A;  1ZQI A;  1ZQU A;  3H0M B;  3Q8P B;  1N5W A;  7ICG A;  3IG5 A;  4PGQ A;  3V6K A;  4BXO B;  9ICI A;  3KHR A;  1BPX A;  1MQ2 A;  1L7M A;  4QZD A;  3T5L A;  2W8L A;  1A0P A;  1JUD A;  1X6J A;  4JB3 A;  2QB0 A;  5KT7 A;  4Y2R A;  4Y2Q A;  5DDM A;  4QJF B; 
#chains in the Genus database with same CATH homology
 5L1M A;  1B4F A;  1SV4 A;  2DL0 A;  4MHV A;  1X40 A;  1DXS A;  2DKZ A;  1JI7 A;  3SEI A;  1V38 A;  3BS7 A;  1B0X A;  1PK3 A;  1RG6 A;  2D8C A;  2KG5 A;  2EAO A;  2JV3 A;  3BS5 A;  1WWU A;  3BQ7 A;  5JRT A;  2EAM A;  2FE9 A;  2E8P A;  1PK1 B;  2DKX A;  2F44 A;  2L5Y A;  2B6G A;  2YTU A;  3TAD C;  3TAC B;  1X9X A;  1X66 A;  1SXD A;  1UQV A;  1OXJ A;  1WWV A;  4RQN A;  4NJ8 A;  2EAP A;  3KKA C;  2F3N A;  2ESE A;  3HIL A;  5JU5 A;  1SGG A;  1COK A;  4NL9 C;  1F0M A;  2GLE A;  5J8Y C;  1SV0 A;  2KE7 A;  2QB1 A;  1UCV A;  3TAD A;  2K4P A;  5KNI A;  2KIV A;  1PK1 A;  3IDW A;  3SEN A;  2E8O A;  1OW5 A;  2ES6 A;  2KMD A;  1LKY B;  1V85 A;  1SXE A;  2KSO B;  4PZO A;  4IS7 A;  1LKY A;  2LMR A;  2QKQ A;  1KW4 A;  2Y9T A;  3BS5 B;  2KSO A;  4PZN A;  4RQM A;  2EAN A;  5J8Y A;  2QAR A;  2LPE A;  2D3D A;  1Z1V A;  2F8K A;  2K60 A;  5JTI A;  2QAR B;  4NL9 A;  2QB0 A;  3K1R B;  3H8M A;  1SV0 C;  3KKA A;  2QB0 B;  2E8M A;  2Y9U A;  2E8N A;  5F3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...