4IS7A

Crystal structure of the caskin2 sam domain tandem
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
GADAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-2
publication title Crystal Structure of the CASKIN2 SAM Domain Tandem
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 42
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A01
1KW4A 1DXSA 1UCVA 3IDWA 1SGGA 1JI7A 3SEIA 2E8NA 2LMRA 1LKYB 2K4PA 2DL0A 2EAPA 2F3NA 3BQ7A 2QKQA 1V38A 3KKAC 2Y9TA 4NL9A 2QB1A 3HILA 2QARB 3TACB 1X66A 4PZNA 3BS7A 3SENA 2JV3A 2EAOA 2KSOB 2KG5A 2KSOA 1LKYA 1OW5A 1PK1B 1RG6A 1B0XA 1X9XA 5F3XB 2EAMA 2LPEA 1OXJA 5J8YC 2DKZA 2Y9UA 2E8OA 1SXEA 1PK3A 5KNIA 4RQNA 1SV0C 2KE7A 1WWUA 1SXDA 2K60A 2QARA 4NJ8A 5JU5A 1B4FA 1X40A 1COKA 3TADC 3KKAA 2ESEA 4PZOA 3BS5B 4NL9C 2DKXA 2F8KA 5JTIA 1Z1VA 2YTUA 2KIVA 1PK1A 2D3DA 4IS7A 5JRTA 2E8MA 1UQVA 4RQMA 1F0MA 2FE9A 2GLEA 2QB0B 2QB0A 2F44A 4MHVA 1V85A 5J8YA 1SV4A 3K1RB 1WWVA 2EANA 2E8PA 2D8CA 3BS5A 1SV0A 5L1MA 2ES6A 2B6GA 2KMDA 3H8MA 2L5YA 3TADA
chains in the Genus database with same CATH superfamily
1JRPA 1KW4A 4J03A 2V9WA 4QJFB 3Q8SB 4B9NA 1UCVA 3C29A 1L8LA 4LZGA 1KL9A 3SAGA 4EBEA 3IHQB 2GWSA 2FI1A 4IQWA 4DFMA 4QZCA 2ASLA 2BCQA 2ZIWB 3GIIA 4AP9A 4J9RA 2LM1A 4YXJA 3AMZA 1XSPA 2FMSA 2BCRA 5AKKA 5BPCA 2G08A 2XY7A 3HPOA 4GFJA 5ALIA 5L1JA 2VA3A 4I2FA 3UM9A 1V9PA 2Y0SF 4HAIA 1MN8A 1T8EA 2PFOA 3PW7A 4EELA 3Q8QB 4UAVA 1XO1A 2Y9UA 1SZPA 4RQ6A 5KNIA 3SQIA 4UBBA 2ZG6A 1NJYA 8ICHA 2QARA 5AKLA 1S77D 3M9OB 2HHVA 3GFKB 1COKA 3QXGA 3OJUA 5AI4A 4DSJA 3AL0B 2AGPA 1TAMA 4IQVA 2DBYA 4AYBF 3I1YA 9ICRA 1NKEA 3WK5A 4DOBA 4R8UB 4KX3A 3I76A 3A0HU 1KBUA 5EE1A 3ETRA 3EUB2 1CUKA 1ZQYA 1Z19A 3BS5A 5F9NA 1ZQCA 4P4OA 5AHXA 3AM9A 2UVVA 4F5PA 1V97A 2P35A 2B6GA 2NRVA 3D2QA 3KZIU 5KT6A 1ZXIA 1JALA 2RDJA 4LZDA 3H8SA 5J0OA 3DDHA 4BJQA 3E2EA 3HJEA 1BPEA 1ZQZA 2LMRA 3C21A 2ODGA 4DFKA 4F72A 2C2DA 5DQHA 2CXYA 4I2HA 1L5UA 3V6JA 4CRXA 4P0PB 5AIAA 4BGDA 5D46A 4YR2A 2EZXA 1BNOA 2G09A 2OWOA 4OJ5A 4QZAA 4DFPA 4Z6FA 3FDSA 3FM9A 3WK4A 4I2GA 1L6NA 3WK7A 5AKEA 1L3UA 4IQTA 1Z00B 4J9LA 5B66U 1ZQ1C 1VLBA 2FLNA 1IM4A 1PK1B 5ALXA 1ZQTA 5AKZA 5ALNA 5HHHA 1PVRA 4PGQA 3OPXA 4PGYA 1PK3A 4DF4A 5AIBA 4FE3A 3N97B 2A1JB 2B21A 4P4PA 8ICQA 2VJ5A 1URJA 1ZRMA 4MF8A 2H3FA 3KKAA 2ESEA 3N7RC 3N7SC 1KKXA 1N2XA 1Z1BA 2DKXA 2PFNA 4DL5A 8ICBA 3NVVA 3HP6A 2YTUA 2W54A 4PHAA 4KX5A 4I2AA 1S0MA 1GO3F 3NUQA 5EE0A 4UAYA 5ALHA 2HSZA 5IIKA 2W8LA 3WKAA 2HHXA 2KICA 4MEXA 5C0YA 2P66A 3PY8A 5HMMA 4HYKA 1QTMA 9ICOA 1Z4NA 3D6JA 1X2IA 3PZPA 5KFNA 3F2DA 3EZ5A 3PR5B 3TAPA 3RR7A 2MUTB 3M8SA 2KOBA 4QZFA 1N61A 1S0VA 3OSPA 5E79U 2C28A 5BOLA 4RQ4A 2XY5A 5D4BA 3UQ0A 4DSLA 1ZETA 4YCXA 5KT7A 3Q8RB 4BXOB 5AK4A 1ZOLA 2BCSA 1KN5A 7ICVA 4NM2A 4Q45A 1RPLA 1BNPA 3HILA 2CPRA 4F91B 3PNCA 4PPXA 1ZD2P 3SENA 3WKBA 5K4LA 5J2EA 8ICIA 4Y2VA 1ZQJA 3BJYA 1S0OA 5AM0A 4DQRA 1LKYA 1OW5A 1ZJNA 3L5KA 4QWBA 1L7PA 4X5VA 1JMSA 4QW8A 2R8KA 1X42A 4RNNA 2KKVA 3SAHA 4R66A 4B9SA 3RTVA 3PMNA 5DG9A 1A77A 4QZBA 3KHHA 4M9LA 1NI3A 4KN4A 2ISPA 4P2HA 1D8YA 1PUZA 2W04A 4EBDA 4R63A 5J0PA 3K1ZA 2JMGA 2LYHA 2XGQA 4PL2A 3SD7A 9ICAA 3RBEA 2J6TA 4U7CA 2F77X 1T4GA 4R64A 4O5EA 2Y0SC 4M2YA 4B9MA 5DB7A 1WUDA 2E1FA 4J9KA 2KHQA 2W11A 4XRHA 4DSIA 4FZMA 4FZLA 2ZJAA 3SMVA 3M8RA 3KHLA 1OUQA 3D2NA 4C0ZA 4DFDA 2H3ZA 1FFVA 1YT3A 3E0FA 3PR4A 3FYHA 9ICNA 2R8GA 2RRDA 4EEKA 2C2RA 3V6KA 4ECSA 4AYBC 4O0IA 2FPLA 4C8MA 1J2NA 4J9QA 5KT5A 3KKAC 2W9CB 3C1YA 2G5HB 2CRXA 2ZTEA 3T5JA 3CNHA 3RFAA 5EWGA 1LVHA 2NO4A 5HR6A 3C2LA 8ICSA 1WCNA 1QSYA 4F4XA 4A8EA 2KHVA 2BQ3A 1JUDA 4Y2TA 1B22A 1X9XA 7ICHA 1KFTA 5KT2A 2DKZA 4CF3A 3B0XA 2HVIA 4TUSA 4PHDA 7ICUA 3QZ7A 1K1QA 3KHGA 1U4BA 5ALJA 4PZOA 5KFBA 3SR6A 4P0QB 5JTIA 2W43A 3JPTA 4PHEA 2HI0A 3LVVA 1SB3C 4YQWA 4O3OA 4I28A 1ZQQA 2VA8A 3OHBA 2MU2A 2FE9A 3IP4B 1S76D 4O3RA 1V85A 4M9HA 2HBJA 3F5EA 2KZMA 1D9FA 5ALSA 2E8PA 3V6HA 3H8JA 3NTUA 1C20A 2WAQF 5KL1B 2NYVA 3JPQA 2W55A 5ALEA 1NNLA 2HMXA 9ICJA 4UQGA 3BDPA 5J0SA 2ALZA 4J9NA 4B9VA 2MUTA 3AN1A 1XSNA 2HHWA 5J0RA 3GU3A 4ED0A 2XI9A 3MGIA 1ZQSA 2PI5A 4BXOA 4TQRA 3PW0A 5KFDA 3RJKA 2PFPA 2OHFA 4RQ8A 1Z4OA 1ZQKA 3RJEA 4IR1A 3BS7A 5AI9A 5ALKA 3QU7A 4MFCA 4GXJA 1NK6A 2EAOA 4QZDA 4UAWA 8ICWA 2BPGA 3VCBA 5AK5A 3H4DA 1D8BA 4JMUA 1ZD5A 2H3QA 5J2HA 1QSLA 2G07A 4YFKA 3QE9Y 1ZQGA 4ELVA 4EZ9A 3L3FX 1N56A 2IOHA 7ICGA 1RDFA 1QH9A 2PMZF 2AU0A 3GIJA 4O3NA 4ZH4A 3Q8PB 5KFTA 2ASJA 4PH5A 3SI8A 5IIJA 5AKJA 4UATA 2F1JA 3JPSA 2KJ8A 3PSFA 4OJPA 2E8MA 2ZUDA 3GILA 3JPNA 2KTQA 4DF8A 5KL8B 4C4SA 1N48A 3F2BA 2NRXA 4QZIA 1PVQA 2HW3A 3AEVA 3QEAZ 2KJ9A 1SV0A 1S5LU 3ZI4A 3BZCA 5FP0A 4U6PA 4KLOA 2HHUA 3GV8B 2M9NA 4OCZA 4XUSA 3IN5A 1Q3VA 1DOQA 4NY8A 5J2CA 1T94A 2E8NA 4CDGA 2KD1A 2ZUCA 2BR0A 2HVHA 5L1IA 4C4TA 1NZPA 2EAPA 3LYSA 1D8LA 4K4GA 2PI4A 4F2RA 1JN3A 3WKEA 5ALLA 5KFMA 3C2KA 2PFQA 4F2SA 5AKHA 2YQEA 4KLHA 3GIKA 4EX6A 1PVPA 5KFPA 2OH2A 2I5HA 2KK0A 3PSIA 3RB6A 1NOMA 2YMMA 4PL1A 7ICTA 9ICCA 1A76A 3RH5A 3GZFA 4IRDA 4ECUA 1U47A 1ZQNA 3NRWA 5G5HA 5IIOA 2BPFA 1ECWA 3MGVA 1VJ5A 7ICSA 2AQ0A 5EWFA 4UB4A 4DOCA 1UT8A 2VANA 3ZD9A 2JEIA 3IV6A 2K8BB 4DL7A 4JV2A 1DGSA 3OGUA 3NASA 1F0MA 3RR8A 2W7PA 3LK9A 5J8YA 3NVWA 4JWMA 4RPXA 5DGBA 4J9OA 4XA5A 4DEZA 1NJZA 1SL0A 1F5SA 2BCUA 3PO5A 2JH7A 3EW9A 5IILA 1KRPA 5KFHA 4Y2SA 1WYGA 3MC1A 3SEIA 4QZEA 2KV2A 9ICXA 5KAIU 1KQQA 4GC7A 1ZQFA 2VIXA 4Y2YA 2BDUA 5DKWA 1L7NA 1SKSA 5ALGA 4F4KA 4F50A 2XCAA 4WJ3B 3RH4A 1F44A 2ZIXB 5J2AA 1SWWA 1ZD3A 1XC9A 2KP7A 1L7OA 4MFFA 1X66A 4QWAA 2WAQC 5DBBA 3V72A 2K4IA 3IM1A 4USAA 1ZQUA 2FDRA 4FZNA 1YZ7A 4UB6U 5J0TA 3JPPA 4GXIA 1N63A 1P7DA 4NV0A 2FLLA 1RG6A 4QZGA 1CRXA 1C7YA 2P6RA 3T3FA 5DLGA 3ISBA 2UVWA 5CWRA 3R9KA 4Y2JA 4DCCA 5A0LA 1SV0C 4BDPA 3UXNA 1SXDA 2K60A 4GLXA 7ICJA 1BPDA 5AKIA 2LYAA 4DQPA 2EDUA 4O3SA 5KFUA 5KG4A 3HW8A 2AH5A 4C8LA 2CN1A 1S9FA 8ICJA 2W9BB 3RH6A 2EZYA 1ZQMA 4CGZA 1ED1A 3OSNA 4IRCA 1UQVA 2DPJA 3PW4A 1L8OA 4O3QA 1HUZA 4OJLA 5J0WA 1Q46A 4FS1A 1BVSA 9ICIA 4F5OA 2YN4A 3C23A 2D8CA 2XC9A 4O9MA 2DWQA 3JPOA 3IG8A 9ICMA 2W3SA 4NM1A 3OTQA 2LHTA 4M04A 4DSKA 2HCFA 4F92B 5KFLA 5GTHU 5J2GA 2HOFA 5KFRA 4DSFA 3H4BA 2PMZC 3HRDD 9ICUA 3AQFA 3MDCA 4NWIA 4RQ7A 1K1SA 3QU2A 8ICKA 1Y88A 2K4PA 5TZVA 1ZQAA 1UT5A 5AKXA 7ICLA 3H0RB 2EH9A 2DUYA 4Y2UA 8ICZA 5KTQA 1ZQDA 1IG6A 2Y9TA 1TK0A 4M6WB 2XO7A 3LDAA 1CI4A 4RT3A 4KN7A 1AQ6A 3T5KA 4F71A 1RQLA 4ED1A 2D6FC 4MEYA 2E3TA 5KFGA 3S6JA 1ZQVA 4DO9A 9ICFA 4BWMA 2KZ3A 5J8YC 1OXJA 9ICBA 3OHAA 2W9AA 2ZIWA 4RPYA 4ACOA 3PSTA 2JZBB 4CNQA 3EYZA 1WWUA 3JPRA 2ZXIA 3HKZF 3PSPA 4UB8U 1FFUA 3IG5A 2K4HA 5DBCA 2N1RA 2OEHA 4NL9C 5J2JA 4DS5A 2D3DA 3WKDA 5AKGA 5JRTA 2P6UA 4ECVA 5KFEA 3RRGA 1NK8A 4KTQA 1U48A 3I28A 4MHVA 4JB3A 3PX0A 2W8KA 3UXPA 4J9SA 1S97A 4RNOA 2UVUA 4C7YA 5L1MA 4C80A 3MABA 9ICVA 3AQEA 2YMPA 2Q0ZX 1RYUA 3H8MA 3THVA 1X9SA 2IOFA 2GO7A 1JROA 1ZRNA 5DG7A 4JUZA 4R8UA 5J2BA 4RQ5A 1SGGA 2BQRA 4KLMA 1L3VA 4I2IA 2RDIA 3C28A 2JEJA 3RB0A 4Y2RA 1ZJMA 2JEGA 1COOA 4US9A 3BQ0A 4KLFA 2OXOA 4M9GA 1ZD4A 3PX4A 3MR2A 3ZDDA 8ICXA 2BCVA 3QU4A 1NK4A 1UPHA 5KFYA 3UMGA 5KT4A 1TVAA 5HP4A 1NZBA 5IIIA 2G0AA 3MR3A 3GIMA 4I2JA 5KFZA 2ZIVB 1BPZA 4UAZA 4PZNA 2Q4TA 5G5GA 3AUOA 3V7JA 3N4MB 2NRTA 4ED7A 5EOZA 1X6JA 4TUQA 1X9WA 4YP3A 1NJWA 2E1EA 2FJ6A 2LPEA 4KMOB 4P0PA 3KZXA 1WG8A 2HOIA 7ICRA 3PO4A 4F5RA 2AJQA 2LI6A 7ICFA 1X40A 5KG6A 3TQ1A 5L9XA 4EX7A 4MFAA 3NS1A 1Z00A 2WF8A 3TFSA 1PK1A 3ISCA 2W9BA 4FBTA 4IS7A 2OYYA 2V4QA 2HHSA 1QSSA 2NRZA 4UB3A 4CCHA 4DLGA 3SYZA 8ICLA 3QUTA 4YN4A 3GDXA 2BHNA 2A1JA 5HHIA 2JXJA 5KG5A 3C2MA 2IMWP 2EANA 3RRHA 3RAXA 5CP2A 3HT3A 9ICSA 2K89A 2A1AA 2OM6A 4K4HA 2FMPA 4OO1J 3LVWA 2K8AA 4DQIA 4YMMA 4ECRA 5CHGA 4PGXA 5KFCA 4TQSA 2KJ5A 4Q43A 1UA1A 1T3NA 1JXLA 4Q8EA 2F1IA 2LBOA 3QEBZ 4DFJA 1O08A 3J81j 1RYSA 5J2IA 5KFJA 1JIHA 4IRKA 2QARB 2NO5A 3TACB 4FO6A 1Q8KA 2R8JA 3QZ8A 2IHNA 2JV3A 1RQNA 1NK7A 2KSOB 3G6VA 4P4MA 3SZ2A 5F3XB 3KHRA 5AI0A 5KAFU 2E5SA 4YXMA 3RF9A 3MR5A 5ALWA 3ETLA 3CYMA 2JZBA 1ZQPA 2KVSA 4BWJA 2GH1A 9ICWA 5ALOA 3TKAA 4RT2A 2BDPA 3BS5B 2OCEA 3MFHA 4I2DA 1IIPA 3V7LA 1Z3EB 4IL6U 4RUAA 8ICOA 1QQ7A 1SIJA 4B9UA 4YMOA 2J6UA 2XIDA 2VA2A 2I1QA 1EXNA 1ZQXA 2F1HA 2QB0B 4NLCA 2DPIA 3H0LB 1A6SA 2KVCA 1S8OA 2NV3A 1HEKA 3WU2U 2RHFA 3MBYA 2LM4A 4Z6EA 1SKWA 4QZ9A 2YMQA 2YX8A 3RJIA 2MRLA 3RB4A 2HBMA 5ALVA 3BQ7A 1RZTA 5F9LA 1DXSA 1J2MA 3HKZC 4K4IA 4OJ6A 5J0UA 4CF4A 3GQCA 4UB2A 2ISOA 5DG8A 2F76X 2HBKA 5EE3A 7ICKA 4C4RA 1J97A 1V38A 2C22A 3ZDEA 3AU2A 5KFWA 1FIQA 4QWCA 4ED6A 2EZZA 2DF4B 4ZOHC 5AM1A 4RQ3A 4QIWF 3RJGA 5J0XA 1S0NA 2ZIVA 4UW9A 8ICTA 5ALRA 3VC8A 3T5LA 3KFUF 2K8CB 2O6KA 4YR0A 5KFSA 3BZKA 3SV4A 5GTIU 2JGAA 4ED2A 1SXEA 4ED3A 4F93B 2W9CA 4XQ8A 5J2FA 2F2AB 3SV3A 4UB1A 1TKDA 1LV5A 7ICIA 2K4EA 3QUQA 4NJ8A 2B0CA 3NVYA 3M1YA 4ECWA 2KZZA 1KSPA 1FEZA 3M6ZA 2W03A 5KFFA 2KFNA 7ICEA 2VJ4A 2KN7A 7ICNA 3ZD8A 3RB3A 4KLJA 3MDAA 3RJJA 2YMLA 3KD3A 5KFAA 5CRXA 1Q3UA 3H0MB 2A3VA 3TARA 3CRXA 5DLFA 3V7KA 3D2SA 4P0QA 5T14A 4M47A 2DQNB 4NXZA 2BZFA 2ES6A 8ICYA 5CEHA 4TUPA 2UVRA 4C8KA 2XCPA 4Q8FA 3WKCA 5BOMA 2ZUBA 2WTFA 4LVSA 3F2CA 4M9JA 4ECTA 1RXWA 4MF2A 1LKYB 4QWDA 4NLNA 3EPIA 1XU4A 3ONNA 3QYPA 5ALZA 4QZ8A 2QKQA 3M6KA 5ALYA 2KIWA 9ICEA 4NL9A 2H3IA 3L4PA 4DQSA 3BQ1A 4M0AA 2R8HA 1RXVA 3UXOA 2PKEA 5J2KA 3KTQA 3CP8A 4ECQA 2R8IA 2LYBA 4UARA 3PW2A 1ZQRA 2KSOA 1DK2A 4NLBA 4QNLA 3B9JA 4KLUA 5ALFA 4BX9C 2V4RA 4RPZA 4UB5A 2DGZA 5B5EU 2BKEA 3OJSA 1ZQLA 4RUCA 5HR7A 1BPBA 2ZJ5A 8ICAA 4KLSA 1XO0A 3NVZA 5DBAA 1X9MA 5KFQA 2DFLA 3B0YA 4I2BA 1D9DA 9ICPA 4O3PA 2JEFA 3TAQA 4F3OA 5D49A 4YMNA 1L3TA 2IA6A 1H38A 2NRWA 2QB0A 5AK3A 1SL1A 1N62A 2H5XA 1L3SA 1WCLA 5DB8A 3H7IA 4RQ1A 8ICMA 1KEJA 2WB1C 4DWIA 4YR3A 4F8RA 1JX4A 1BGXT 1DK3A 4E0DA 2L5YA 1KDHA 2WF6A 4J9MA 1FO4A 1N60A 2ZJ8A 3ICXA 5DDYA 4ELUA 2G5IB 4G3IA 2W9MA 3FC4A 5L1LA 7ICMA 5C5JA 3TFRA 4PHPA 5ALPA 5AM3A 3PW5A 1XS9D 1UHUA 3UQ2A 3Q8MA 4DL3A 3FAHA 1X6IA 1HIWA 4TURA 4YG2A 3G6XA 9ICLA 4OJOA 4J9PA 4DLEA 2QB1A 4O3MA 4KLTA 5L1KA 2RLTA 4JV0A 1KTQA 3TI0A 4B6JA 3WK6A 1SWVA 3UMCA 2JR5A 4EBCA 3H40A 4PJ0U 4QWEA 5AM4A 2IOFK 4RQ0A 3RJHA 5ALTA 8ICCA 3K75D 4YD1A 3QUBA 3GV5B 4R65A 1LB2B 2KE7A 4ICAA 2HHTA 5JU5A 5JUMA 1B4FA 2WF7A 4Y2XA 5IIMA 4M9NA 5IINA 3LWMA 1TK8A 2FPMA 1U9LA 2W3RA 1RYRA 3NGDA 2KIVA 4RU9A 4NLGA 4RQMA 4QIWC 4CE6A 2BGWA 5DQIA 4EYIB 2KKPA 1BPXA 1B43A 2BPCA 2BQUA 2HDOA 2ZIUB 1RM6C 1SKRA 1YZ6A 2RQ5A 4BUGA 1DGJA 9ICHA 5TISU 2IBKA 1NK0A 5AKYA 3QNMA 4ED8A 2AGOA 4JV1A 5AM2A 4YD2A 1IV8A 3N7PD 4GC6A 7ICPA 1JXEA 1K5OA 7ICQA 3F53A 2HHQA 5EWEA 1QQ5A 2AHOB 4DS4A 1MQ3A 1QCKA 2FLPA 4KLLA 2Y1JA 3K4GA 1UA0A 8ICUA 4G9BA 5H2FU 3RJFA 2G06A 3ALRA 2EQYA 2XY6A 4I2CA 5EE9A 2ZXHA 5AI6A 4ECYA 1NJXA 4I27A 2ATLA 4KLIA 8ICVA 1XSLA 4F4YA 1QLNA 2A19A 2KG5A 2I9GA 4QZHA 4UASA 4UAUA 4KLEA 3PMLA 2EAMA 4O5KA 2JRZA 2W7OA 2M0NA 3RAQA 1ZQIA 2ZIXA 4RZRA 4EYHB 4JWNA 5KG0A 2WHEA 4O5CA 4IR9A 2WFAA 9ICTA 2FMQA 1MSWD 4EZ6A 1IXRA 2Z7JA 4KMUA 5CJ7A 5ALQA 5KG7A 2KFZA 3UPQA 1NK5A 1QQ6A 3ED5A 3MGHA 1WWVA 2YB1A 2FPKA 2C2EA 1CEZA 1T3QA 4CF5A 2XICA 2KMDA 3WK9A 4KLDA 4Y2QA 3TADA 3KBBA 1VDVA 2ASDA 1PZNA 2MA1A 3DEEA 4C7ZA 3IDWA 1AROP 1ZQOA 5DDMA 1KFDA 1XNSA 8ICEA 4IQUA 3C5FA 3TANA 4Q44A 3MFIA 1TK5A 5ALDA 3CW2C 3HX0A 4US8A 2F3NA 9ICKA 3C5GA 3NRZA 3IRUA 3QU9A 1M6YA 3GV7B 3BQ2A 5KG1A 4FFDA 3PVXA 7ICOA 5KG3A 2HOQA 4OD0A 2AGQA 4DL4A 2Y1IA 5DGAA 5DB9A 3AU6A 1B0XA 2VKQA 5J29A 1MC8A 3M9MB 2H3VA 4YVZA 4M6WA 4EENA 4FS2A 1U49A 2AQ4A 3ZDAA 2R18A 1TAQA 1TFRA 1XWLA 3EPGA 1KFSA 5DQGA 3UMBA 2ZTCA 4F4ZA 8ICFA 3BQTA 3Q8LA 1Z1VA 1SL2A 2WB1F 3M7DA 3ORYA 1N5WA 1NK9A 5KFIA 1NKCA 4GXKA 5J2DA 5ALUA 2GLEA 2KNJA 2LKYA 2GOLA 2F44A 3RBDA 5HNKA 2PXIA 1SV4A 4RQ2A 3Q8KA 2ZIUA 5CB1A 2XVTA 2MSNA 3LWLA 4C8OA 2JH1A 1U45A 1HJPA 4DOAA 1ZQBA 1ZQEA 3N28A 9ICQA 4ECZA 4F5QA 3E58A 4C8NA 5KG2A 4DL2A 2MAXA 5HMLA 5DB6A 1BPYA 1ZQWA 4GIBA 4Z6DA 2J6SA 2KEYA 1JI7A 3T5HA 8ICRA 3A0BU 3O0FA 2XGPA 2ZTDA 4DQQA 3PV8A 4IC9A 5AI8A 4Z6CA 4ECXA 4DSEA 3T79A 2DL0A 5KT3A 5AICA 2JHDA 4DL6A 4ELTA 3SAFA 1L7MA 1MQ2A 9ICGA 5KFXA 8ICPA 5KFVA 5J0YA 2YB4A 1ZYQA 1KLNA 5AI5A 1N5XA 3C1ZA 5ALMA 4KLQA 5AK6A 3ZDBA 2RP5A 4QW9A 3MR6A 3PX6A 4Y2PA 1HUOA 3KOOA 1A0PA 2WF5A 4KITB 3QX7A 8ICGA 4UBCA 5KFKA 2E8OA 4KLGA 1MA7A 4RQNA 5J0QA 2HBLA 3DV9A 1O03A 5KFOA 4FBUA 4JK1A 2IHMA 3H8WA 1SZHA 1T7PA 3TADC 4RNMA 3EWAA 1DRGA 3G6YA 5CR0A 2F8KA 1S10A 2I6XA 1TE2A 1NKBA 1ZQHA 2QLTA 3ZDCA 5CA7A 3ISDA 3WK8A 3QU5A 3HWTA 4B9LA 4F5NA 2F8LA 4I2EA 2AXTU 4I29A 4NLKA 2WF9A 4F4WA 5AM5A 1TV9A 3K1RB 4B9TA 4LJXA 3F5AA 3M9NB 8ICNA 1TAUA 3QUCA 4EEYA 3U26A 4NLZA 2YY6A
chains in the Genus database with same CATH topology
1KW4A 1DXSA 1UCVA 3IDWA 1SGGA 1JI7A 3SEIA 2E8NA 2LMRA 1LKYB 2K4PA 2DL0A 2EAPA 2F3NA 3BQ7A 2QKQA 1V38A 3KKAC 2Y9TA 4NL9A 2QB1A 3HILA 2QARB 3TACB 1X66A 4PZNA 3BS7A 3SENA 2JV3A 2EAOA 2KSOB 2KG5A 2KSOA 1LKYA 1OW5A 1PK1B 1RG6A 1B0XA 1X9XA 5F3XB 2EAMA 2LPEA 1OXJA 5J8YC 2DKZA 2Y9UA 2E8OA 1SXEA 1PK3A 5KNIA 4RQNA 1SV0C 2KE7A 1WWUA 1SXDA 2K60A 2QARA 4NJ8A 5JU5A 1B4FA 1X40A 1COKA 3TADC 3KKAA 2ESEA 4PZOA 3BS5B 4NL9C 2DKXA 2F8KA 5JTIA 1Z1VA 2YTUA 2KIVA 1PK1A 2D3DA 4IS7A 5JRTA 2E8MA 1UQVA 4RQMA 1F0MA 2FE9A 2GLEA 2QB0B 2QB0A 2F44A 4MHVA 1V85A 5J8YA 1SV4A 3K1RB 1WWVA 2EANA 2E8PA 2D8CA 3BS5A 1SV0A 5L1MA 2ES6A 2B6GA 2KMDA 3H8MA 2L5YA 3TADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KW4 A;  1DXS A;  1UCV A;  3IDW A;  1SGG A;  1JI7 A;  3SEI A;  2E8N A;  2LMR A;  1LKY B;  2K4P A;  2DL0 A;  2EAP A;  2F3N A;  3BQ7 A;  2QKQ A;  1V38 A;  3KKA C;  2Y9T A;  4NL9 A;  2QB1 A;  3HIL A;  2QAR B;  3TAC B;  1X66 A;  4PZN A;  3BS7 A;  3SEN A;  2JV3 A;  2EAO A;  2KSO B;  2KG5 A;  2KSO A;  1LKY A;  1OW5 A;  1PK1 B;  1RG6 A;  1B0X A;  1X9X A;  5F3X B;  2EAM A;  2LPE A;  1OXJ A;  5J8Y C;  2DKZ A;  2Y9U A;  2E8O A;  1SXE A;  1PK3 A;  5KNI A;  4RQN A;  1SV0 C;  2KE7 A;  1WWU A;  1SXD A;  2K60 A;  2QAR A;  4NJ8 A;  5JU5 A;  1B4F A;  1X40 A;  1COK A;  3TAD C;  3KKA A;  2ESE A;  4PZO A;  3BS5 B;  4NL9 C;  2DKX A;  2F8K A;  5JTI A;  1Z1V A;  2YTU A;  2KIV A;  1PK1 A;  2D3D A;  4IS7 A;  5JRT A;  2E8M A;  1UQV A;  4RQM A;  1F0M A;  2FE9 A;  2GLE A;  2QB0 B;  2QB0 A;  2F44 A;  4MHV A;  1V85 A;  5J8Y A;  1SV4 A;  3K1R B;  1WWV A;  2EAN A;  2E8P A;  2D8C A;  3BS5 A;  1SV0 A;  5L1M A;  2ES6 A;  2B6G A;  2KMD A;  3H8M A;  2L5Y A;  3TAD A; 
#chains in the Genus database with same CATH topology
 1JRP A;  1KW4 A;  4J03 A;  2V9W A;  4QJF B;  3Q8S B;  4B9N A;  1UCV A;  3C29 A;  1L8L A;  4LZG A;  1KL9 A;  3SAG A;  4EBE A;  3IHQ B;  2GWS A;  2FI1 A;  4IQW A;  4DFM A;  4QZC A;  2ASL A;  2BCQ A;  2ZIW B;  3GII A;  4AP9 A;  4J9R A;  2LM1 A;  4YXJ A;  3AMZ A;  1XSP A;  2FMS A;  2BCR A;  5AKK A;  5BPC A;  2G08 A;  2XY7 A;  3HPO A;  4GFJ A;  5ALI A;  5L1J A;  2VA3 A;  4I2F A;  3UM9 A;  1V9P A;  2Y0S F;  4HAI A;  1MN8 A;  1T8E A;  2PFO A;  3PW7 A;  4EEL A;  3Q8Q B;  4UAV A;  1XO1 A;  2Y9U A;  1SZP A;  4RQ6 A;  5KNI A;  3SQI A;  4UBB A;  2ZG6 A;  1NJY A;  8ICH A;  2QAR A;  5AKL A;  1S77 D;  3M9O B;  2HHV A;  3GFK B;  1COK A;  3QXG A;  3OJU A;  5AI4 A;  4DSJ A;  3AL0 B;  2AGP A;  1TAM A;  4IQV A;  2DBY A;  4AYB F;  3I1Y A;  9ICR A;  1NKE A;  3WK5 A;  4DOB A;  4R8U B;  4KX3 A;  3I76 A;  3A0H U;  1KBU A;  5EE1 A;  3ETR A;  3EUB 2;  1CUK A;  1ZQY A;  1Z19 A;  3BS5 A;  5F9N A;  1ZQC A;  4P4O A;  5AHX A;  3AM9 A;  2UVV A;  4F5P A;  1V97 A;  2P35 A;  2B6G A;  2NRV A;  3D2Q A;  3KZI U;  5KT6 A;  1ZXI A;  1JAL A;  2RDJ A;  4LZD A;  3H8S A;  5J0O A;  3DDH A;  4BJQ A;  3E2E A;  3HJE A;  1BPE A;  1ZQZ A;  2LMR A;  3C21 A;  2ODG A;  4DFK A;  4F72 A;  2C2D A;  5DQH A;  2CXY A;  4I2H A;  1L5U A;  3V6J A;  4CRX A;  4P0P B;  5AIA A;  4BGD A;  5D46 A;  4YR2 A;  2EZX A;  1BNO A;  2G09 A;  2OWO A;  4OJ5 A;  4QZA A;  4DFP A;  4Z6F A;  3FDS A;  3FM9 A;  3WK4 A;  4I2G A;  1L6N A;  3WK7 A;  5AKE A;  1L3U A;  4IQT A;  1Z00 B;  4J9L A;  5B66 U;  1ZQ1 C;  1VLB A;  2FLN A;  1IM4 A;  1PK1 B;  5ALX A;  1ZQT A;  5AKZ A;  5ALN A;  5HHH A;  1PVR A;  4PGQ A;  3OPX A;  4PGY A;  1PK3 A;  4DF4 A;  5AIB A;  4FE3 A;  3N97 B;  2A1J B;  2B21 A;  4P4P A;  8ICQ A;  2VJ5 A;  1URJ A;  1ZRM A;  4MF8 A;  2H3F A;  3KKA A;  2ESE A;  3N7R C;  3N7S C;  1KKX A;  1N2X A;  1Z1B A;  2DKX A;  2PFN A;  4DL5 A;  8ICB A;  3NVV A;  3HP6 A;  2YTU A;  2W54 A;  4PHA A;  4KX5 A;  4I2A A;  1S0M A;  1GO3 F;  3NUQ A;  5EE0 A;  4UAY A;  5ALH A;  2HSZ A;  5IIK A;  2W8L A;  3WKA A;  2HHX A;  2KIC A;  4MEX A;  5C0Y A;  2P66 A;  3PY8 A;  5HMM A;  4HYK A;  1QTM A;  9ICO A;  1Z4N A;  3D6J A;  1X2I A;  3PZP A;  5KFN A;  3F2D A;  3EZ5 A;  3PR5 B;  3TAP A;  3RR7 A;  2MUT B;  3M8S A;  2KOB A;  4QZF A;  1N61 A;  1S0V A;  3OSP A;  5E79 U;  2C28 A;  5BOL A;  4RQ4 A;  2XY5 A;  5D4B A;  3UQ0 A;  4DSL A;  1ZET A;  4YCX A;  5KT7 A;  3Q8R B;  4BXO B;  5AK4 A;  1ZOL A;  2BCS A;  1KN5 A;  7ICV A;  4NM2 A;  4Q45 A;  1RPL A;  1BNP A;  3HIL A;  2CPR A;  4F91 B;  3PNC A;  4PPX A;  1ZD2 P;  3SEN A;  3WKB A;  5K4L A;  5J2E A;  8ICI A;  4Y2V A;  1ZQJ A;  3BJY A;  1S0O A;  5AM0 A;  4DQR A;  1LKY A;  1OW5 A;  1ZJN A;  3L5K A;  4QWB A;  1L7P A;  4X5V A;  1JMS A;  4QW8 A;  2R8K A;  1X42 A;  4RNN A;  2KKV A;  3SAH A;  4R66 A;  4B9S A;  3RTV A;  3PMN A;  5DG9 A;  1A77 A;  4QZB A;  3KHH A;  4M9L A;  1NI3 A;  4KN4 A;  2ISP A;  4P2H A;  1D8Y A;  1PUZ A;  2W04 A;  4EBD A;  4R63 A;  5J0P A;  3K1Z A;  2JMG A;  2LYH A;  2XGQ A;  4PL2 A;  3SD7 A;  9ICA A;  3RBE A;  2J6T A;  4U7C A;  2F77 X;  1T4G A;  4R64 A;  4O5E A;  2Y0S C;  4M2Y A;  4B9M A;  5DB7 A;  1WUD A;  2E1F A;  4J9K A;  2KHQ A;  2W11 A;  4XRH A;  4DSI A;  4FZM A;  4FZL A;  2ZJA A;  3SMV A;  3M8R A;  3KHL A;  1OUQ A;  3D2N A;  4C0Z A;  4DFD A;  2H3Z A;  1FFV A;  1YT3 A;  3E0F A;  3PR4 A;  3FYH A;  9ICN A;  2R8G A;  2RRD A;  4EEK A;  2C2R A;  3V6K A;  4ECS A;  4AYB C;  4O0I A;  2FPL A;  4C8M A;  1J2N A;  4J9Q A;  5KT5 A;  3KKA C;  2W9C B;  3C1Y A;  2G5H B;  2CRX A;  2ZTE A;  3T5J A;  3CNH A;  3RFA A;  5EWG A;  1LVH A;  2NO4 A;  5HR6 A;  3C2L A;  8ICS A;  1WCN A;  1QSY A;  4F4X A;  4A8E A;  2KHV A;  2BQ3 A;  1JUD A;  4Y2T A;  1B22 A;  1X9X A;  7ICH A;  1KFT A;  5KT2 A;  2DKZ A;  4CF3 A;  3B0X A;  2HVI A;  4TUS A;  4PHD A;  7ICU A;  3QZ7 A;  1K1Q A;  3KHG A;  1U4B A;  5ALJ A;  4PZO A;  5KFB A;  3SR6 A;  4P0Q B;  5JTI A;  2W43 A;  3JPT A;  4PHE A;  2HI0 A;  3LVV A;  1SB3 C;  4YQW A;  4O3O A;  4I28 A;  1ZQQ A;  2VA8 A;  3OHB A;  2MU2 A;  2FE9 A;  3IP4 B;  1S76 D;  4O3R A;  1V85 A;  4M9H A;  2HBJ A;  3F5E A;  2KZM A;  1D9F A;  5ALS A;  2E8P A;  3V6H A;  3H8J A;  3NTU A;  1C20 A;  2WAQ F;  5KL1 B;  2NYV A;  3JPQ A;  2W55 A;  5ALE A;  1NNL A;  2HMX A;  9ICJ A;  4UQG A;  3BDP A;  5J0S A;  2ALZ A;  4J9N A;  4B9V A;  2MUT A;  3AN1 A;  1XSN A;  2HHW A;  5J0R A;  3GU3 A;  4ED0 A;  2XI9 A;  3MGI A;  1ZQS A;  2PI5 A;  4BXO A;  4TQR A;  3PW0 A;  5KFD A;  3RJK A;  2PFP A;  2OHF A;  4RQ8 A;  1Z4O A;  1ZQK A;  3RJE A;  4IR1 A;  3BS7 A;  5AI9 A;  5ALK A;  3QU7 A;  4MFC A;  4GXJ A;  1NK6 A;  2EAO A;  4QZD A;  4UAW A;  8ICW A;  2BPG A;  3VCB A;  5AK5 A;  3H4D A;  1D8B A;  4JMU A;  1ZD5 A;  2H3Q A;  5J2H A;  1QSL A;  2G07 A;  4YFK A;  3QE9 Y;  1ZQG A;  4ELV A;  4EZ9 A;  3L3F X;  1N56 A;  2IOH A;  7ICG A;  1RDF A;  1QH9 A;  2PMZ F;  2AU0 A;  3GIJ A;  4O3N A;  4ZH4 A;  3Q8P B;  5KFT A;  2ASJ A;  4PH5 A;  3SI8 A;  5IIJ A;  5AKJ A;  4UAT A;  2F1J A;  3JPS A;  2KJ8 A;  3PSF A;  4OJP A;  2E8M A;  2ZUD A;  3GIL A;  3JPN A;  2KTQ A;  4DF8 A;  5KL8 B;  4C4S A;  1N48 A;  3F2B A;  2NRX A;  4QZI A;  1PVQ A;  2HW3 A;  3AEV A;  3QEA Z;  2KJ9 A;  1SV0 A;  1S5L U;  3ZI4 A;  3BZC A;  5FP0 A;  4U6P A;  4KLO A;  2HHU A;  3GV8 B;  2M9N A;  4OCZ A;  4XUS A;  3IN5 A;  1Q3V A;  1DOQ A;  4NY8 A;  5J2C A;  1T94 A;  2E8N A;  4CDG A;  2KD1 A;  2ZUC A;  2BR0 A;  2HVH A;  5L1I A;  4C4T A;  1NZP A;  2EAP A;  3LYS A;  1D8L A;  4K4G A;  2PI4 A;  4F2R A;  1JN3 A;  3WKE A;  5ALL A;  5KFM A;  3C2K A;  2PFQ A;  4F2S A;  5AKH A;  2YQE A;  4KLH A;  3GIK A;  4EX6 A;  1PVP A;  5KFP A;  2OH2 A;  2I5H A;  2KK0 A;  3PSI A;  3RB6 A;  1NOM A;  2YMM A;  4PL1 A;  7ICT A;  9ICC A;  1A76 A;  3RH5 A;  3GZF A;  4IRD A;  4ECU A;  1U47 A;  1ZQN A;  3NRW A;  5G5H A;  5IIO A;  2BPF A;  1ECW A;  3MGV A;  1VJ5 A;  7ICS A;  2AQ0 A;  5EWF A;  4UB4 A;  4DOC A;  1UT8 A;  2VAN A;  3ZD9 A;  2JEI A;  3IV6 A;  2K8B B;  4DL7 A;  4JV2 A;  1DGS A;  3OGU A;  3NAS A;  1F0M A;  3RR8 A;  2W7P A;  3LK9 A;  5J8Y A;  3NVW A;  4JWM A;  4RPX A;  5DGB A;  4J9O A;  4XA5 A;  4DEZ A;  1NJZ A;  1SL0 A;  1F5S A;  2BCU A;  3PO5 A;  2JH7 A;  3EW9 A;  5IIL A;  1KRP A;  5KFH A;  4Y2S A;  1WYG A;  3MC1 A;  3SEI A;  4QZE A;  2KV2 A;  9ICX A;  5KAI U;  1KQQ A;  4GC7 A;  1ZQF A;  2VIX A;  4Y2Y A;  2BDU A;  5DKW A;  1L7N A;  1SKS A;  5ALG A;  4F4K A;  4F50 A;  2XCA A;  4WJ3 B;  3RH4 A;  1F44 A;  2ZIX B;  5J2A A;  1SWW A;  1ZD3 A;  1XC9 A;  2KP7 A;  1L7O A;  4MFF A;  1X66 A;  4QWA A;  2WAQ C;  5DBB A;  3V72 A;  2K4I A;  3IM1 A;  4USA A;  1ZQU A;  2FDR A;  4FZN A;  1YZ7 A;  4UB6 U;  5J0T A;  3JPP A;  4GXI A;  1N63 A;  1P7D A;  4NV0 A;  2FLL A;  1RG6 A;  4QZG A;  1CRX A;  1C7Y A;  2P6R A;  3T3F A;  5DLG A;  3ISB A;  2UVW A;  5CWR A;  3R9K A;  4Y2J A;  4DCC A;  5A0L A;  1SV0 C;  4BDP A;  3UXN A;  1SXD A;  2K60 A;  4GLX A;  7ICJ A;  1BPD A;  5AKI A;  2LYA A;  4DQP A;  2EDU A;  4O3S A;  5KFU A;  5KG4 A;  3HW8 A;  2AH5 A;  4C8L A;  2CN1 A;  1S9F A;  8ICJ A;  2W9B B;  3RH6 A;  2EZY A;  1ZQM A;  4CGZ A;  1ED1 A;  3OSN A;  4IRC A;  1UQV A;  2DPJ A;  3PW4 A;  1L8O A;  4O3Q A;  1HUZ A;  4OJL A;  5J0W A;  1Q46 A;  4FS1 A;  1BVS A;  9ICI A;  4F5O A;  2YN4 A;  3C23 A;  2D8C A;  2XC9 A;  4O9M A;  2DWQ A;  3JPO A;  3IG8 A;  9ICM A;  2W3S A;  4NM1 A;  3OTQ A;  2LHT A;  4M04 A;  4DSK A;  2HCF A;  4F92 B;  5KFL A;  5GTH U;  5J2G A;  2HOF A;  5KFR A;  4DSF A;  3H4B A;  2PMZ C;  3HRD D;  9ICU A;  3AQF A;  3MDC A;  4NWI A;  4RQ7 A;  1K1S A;  3QU2 A;  8ICK A;  1Y88 A;  2K4P A;  5TZV A;  1ZQA A;  1UT5 A;  5AKX A;  7ICL A;  3H0R B;  2EH9 A;  2DUY A;  4Y2U A;  8ICZ A;  5KTQ A;  1ZQD A;  1IG6 A;  2Y9T A;  1TK0 A;  4M6W B;  2XO7 A;  3LDA A;  1CI4 A;  4RT3 A;  4KN7 A;  1AQ6 A;  3T5K A;  4F71 A;  1RQL A;  4ED1 A;  2D6F C;  4MEY A;  2E3T A;  5KFG A;  3S6J A;  1ZQV A;  4DO9 A;  9ICF A;  4BWM A;  2KZ3 A;  5J8Y C;  1OXJ A;  9ICB A;  3OHA A;  2W9A A;  2ZIW A;  4RPY A;  4ACO A;  3PST A;  2JZB B;  4CNQ A;  3EYZ A;  1WWU A;  3JPR A;  2ZXI A;  3HKZ F;  3PSP A;  4UB8 U;  1FFU A;  3IG5 A;  2K4H A;  5DBC A;  2N1R A;  2OEH A;  4NL9 C;  5J2J A;  4DS5 A;  2D3D A;  3WKD A;  5AKG A;  5JRT A;  2P6U A;  4ECV A;  5KFE A;  3RRG A;  1NK8 A;  4KTQ A;  1U48 A;  3I28 A;  4MHV A;  4JB3 A;  3PX0 A;  2W8K A;  3UXP A;  4J9S A;  1S97 A;  4RNO A;  2UVU A;  4C7Y A;  5L1M A;  4C80 A;  3MAB A;  9ICV A;  3AQE A;  2YMP A;  2Q0Z X;  1RYU A;  3H8M A;  3THV A;  1X9S A;  2IOF A;  2GO7 A;  1JRO A;  1ZRN A;  5DG7 A;  4JUZ A;  4R8U A;  5J2B A;  4RQ5 A;  1SGG A;  2BQR A;  4KLM A;  1L3V A;  4I2I A;  2RDI A;  3C28 A;  2JEJ A;  3RB0 A;  4Y2R A;  1ZJM A;  2JEG A;  1COO A;  4US9 A;  3BQ0 A;  4KLF A;  2OXO A;  4M9G A;  1ZD4 A;  3PX4 A;  3MR2 A;  3ZDD A;  8ICX A;  2BCV A;  3QU4 A;  1NK4 A;  1UPH A;  5KFY A;  3UMG A;  5KT4 A;  1TVA A;  5HP4 A;  1NZB A;  5III A;  2G0A A;  3MR3 A;  3GIM A;  4I2J A;  5KFZ A;  2ZIV B;  1BPZ A;  4UAZ A;  4PZN A;  2Q4T A;  5G5G A;  3AUO A;  3V7J A;  3N4M B;  2NRT A;  4ED7 A;  5EOZ A;  1X6J A;  4TUQ A;  1X9W A;  4YP3 A;  1NJW A;  2E1E A;  2FJ6 A;  2LPE A;  4KMO B;  4P0P A;  3KZX A;  1WG8 A;  2HOI A;  7ICR A;  3PO4 A;  4F5R A;  2AJQ A;  2LI6 A;  7ICF A;  1X40 A;  5KG6 A;  3TQ1 A;  5L9X A;  4EX7 A;  4MFA A;  3NS1 A;  1Z00 A;  2WF8 A;  3TFS A;  1PK1 A;  3ISC A;  2W9B A;  4FBT A;  4IS7 A;  2OYY A;  2V4Q A;  2HHS A;  1QSS A;  2NRZ A;  4UB3 A;  4CCH A;  4DLG A;  3SYZ A;  8ICL A;  3QUT A;  4YN4 A;  3GDX A;  2BHN A;  2A1J A;  5HHI A;  2JXJ A;  5KG5 A;  3C2M A;  2IMW P;  2EAN A;  3RRH A;  3RAX A;  5CP2 A;  3HT3 A;  9ICS A;  2K89 A;  2A1A A;  2OM6 A;  4K4H A;  2FMP A;  4OO1 J;  3LVW A;  2K8A A;  4DQI A;  4YMM A;  4ECR A;  5CHG A;  4PGX A;  5KFC A;  4TQS A;  2KJ5 A;  4Q43 A;  1UA1 A;  1T3N A;  1JXL A;  4Q8E A;  2F1I A;  2LBO A;  3QEB Z;  4DFJ A;  1O08 A;  3J81 j;  1RYS A;  5J2I A;  5KFJ A;  1JIH A;  4IRK A;  2QAR B;  2NO5 A;  3TAC B;  4FO6 A;  1Q8K A;  2R8J A;  3QZ8 A;  2IHN A;  2JV3 A;  1RQN A;  1NK7 A;  2KSO B;  3G6V A;  4P4M A;  3SZ2 A;  5F3X B;  3KHR A;  5AI0 A;  5KAF U;  2E5S A;  4YXM A;  3RF9 A;  3MR5 A;  5ALW A;  3ETL A;  3CYM A;  2JZB A;  1ZQP A;  2KVS A;  4BWJ A;  2GH1 A;  9ICW A;  5ALO A;  3TKA A;  4RT2 A;  2BDP A;  3BS5 B;  2OCE A;  3MFH A;  4I2D A;  1IIP A;  3V7L A;  1Z3E B;  4IL6 U;  4RUA A;  8ICO A;  1QQ7 A;  1SIJ A;  4B9U A;  4YMO A;  2J6U A;  2XID A;  2VA2 A;  2I1Q A;  1EXN A;  1ZQX A;  2F1H A;  2QB0 B;  4NLC A;  2DPI A;  3H0L B;  1A6S A;  2KVC A;  1S8O A;  2NV3 A;  1HEK A;  3WU2 U;  2RHF A;  3MBY A;  2LM4 A;  4Z6E A;  1SKW A;  4QZ9 A;  2YMQ A;  2YX8 A;  3RJI A;  2MRL A;  3RB4 A;  2HBM A;  5ALV A;  3BQ7 A;  1RZT A;  5F9L A;  1DXS A;  1J2M A;  3HKZ C;  4K4I A;  4OJ6 A;  5J0U A;  4CF4 A;  3GQC A;  4UB2 A;  2ISO A;  5DG8 A;  2F76 X;  2HBK A;  5EE3 A;  7ICK A;  4C4R A;  1J97 A;  1V38 A;  2C22 A;  3ZDE A;  3AU2 A;  5KFW A;  1FIQ A;  4QWC A;  4ED6 A;  2EZZ A;  2DF4 B;  4ZOH C;  5AM1 A;  4RQ3 A;  4QIW F;  3RJG A;  5J0X A;  1S0N A;  2ZIV A;  4UW9 A;  8ICT A;  5ALR A;  3VC8 A;  3T5L A;  3KFU F;  2K8C B;  2O6K A;  4YR0 A;  5KFS A;  3BZK A;  3SV4 A;  5GTI U;  2JGA A;  4ED2 A;  1SXE A;  4ED3 A;  4F93 B;  2W9C A;  4XQ8 A;  5J2F A;  2F2A B;  3SV3 A;  4UB1 A;  1TKD A;  1LV5 A;  7ICI A;  2K4E A;  3QUQ A;  4NJ8 A;  2B0C A;  3NVY A;  3M1Y A;  4ECW A;  2KZZ A;  1KSP A;  1FEZ A;  3M6Z A;  2W03 A;  5KFF A;  2KFN A;  7ICE A;  2VJ4 A;  2KN7 A;  7ICN A;  3ZD8 A;  3RB3 A;  4KLJ A;  3MDA A;  3RJJ A;  2YML A;  3KD3 A;  5KFA A;  5CRX A;  1Q3U A;  3H0M B;  2A3V A;  3TAR A;  3CRX A;  5DLF A;  3V7K A;  3D2S A;  4P0Q A;  5T14 A;  4M47 A;  2DQN B;  4NXZ A;  2BZF A;  2ES6 A;  8ICY A;  5CEH A;  4TUP A;  2UVR A;  4C8K A;  2XCP A;  4Q8F A;  3WKC A;  5BOM A;  2ZUB A;  2WTF A;  4LVS A;  3F2C A;  4M9J A;  4ECT A;  1RXW A;  4MF2 A;  1LKY B;  4QWD A;  4NLN A;  3EPI A;  1XU4 A;  3ONN A;  3QYP A;  5ALZ A;  4QZ8 A;  2QKQ A;  3M6K A;  5ALY A;  2KIW A;  9ICE A;  4NL9 A;  2H3I A;  3L4P A;  4DQS A;  3BQ1 A;  4M0A A;  2R8H A;  1RXV A;  3UXO A;  2PKE A;  5J2K A;  3KTQ A;  3CP8 A;  4ECQ A;  2R8I A;  2LYB A;  4UAR A;  3PW2 A;  1ZQR A;  2KSO A;  1DK2 A;  4NLB A;  4QNL A;  3B9J A;  4KLU A;  5ALF A;  4BX9 C;  2V4R A;  4RPZ A;  4UB5 A;  2DGZ A;  5B5E U;  2BKE A;  3OJS A;  1ZQL A;  4RUC A;  5HR7 A;  1BPB A;  2ZJ5 A;  8ICA A;  4KLS A;  1XO0 A;  3NVZ A;  5DBA A;  1X9M A;  5KFQ A;  2DFL A;  3B0Y A;  4I2B A;  1D9D A;  9ICP A;  4O3P A;  2JEF A;  3TAQ A;  4F3O A;  5D49 A;  4YMN A;  1L3T A;  2IA6 A;  1H38 A;  2NRW A;  2QB0 A;  5AK3 A;  1SL1 A;  1N62 A;  2H5X A;  1L3S A;  1WCL A;  5DB8 A;  3H7I A;  4RQ1 A;  8ICM A;  1KEJ A;  2WB1 C;  4DWI A;  4YR3 A;  4F8R A;  1JX4 A;  1BGX T;  1DK3 A;  4E0D A;  2L5Y A;  1KDH A;  2WF6 A;  4J9M A;  1FO4 A;  1N60 A;  2ZJ8 A;  3ICX A;  5DDY A;  4ELU A;  2G5I B;  4G3I A;  2W9M A;  3FC4 A;  5L1L A;  7ICM A;  5C5J A;  3TFR A;  4PHP A;  5ALP A;  5AM3 A;  3PW5 A;  1XS9 D;  1UHU A;  3UQ2 A;  3Q8M A;  4DL3 A;  3FAH A;  1X6I A;  1HIW A;  4TUR A;  4YG2 A;  3G6X A;  9ICL A;  4OJO A;  4J9P A;  4DLE A;  2QB1 A;  4O3M A;  4KLT A;  5L1K A;  2RLT A;  4JV0 A;  1KTQ A;  3TI0 A;  4B6J A;  3WK6 A;  1SWV A;  3UMC A;  2JR5 A;  4EBC A;  3H40 A;  4PJ0 U;  4QWE A;  5AM4 A;  2IOF K;  4RQ0 A;  3RJH A;  5ALT A;  8ICC A;  3K75 D;  4YD1 A;  3QUB A;  3GV5 B;  4R65 A;  1LB2 B;  2KE7 A;  4ICA A;  2HHT A;  5JU5 A;  5JUM A;  1B4F A;  2WF7 A;  4Y2X A;  5IIM A;  4M9N A;  5IIN A;  3LWM A;  1TK8 A;  2FPM A;  1U9L A;  2W3R A;  1RYR A;  3NGD A;  2KIV A;  4RU9 A;  4NLG A;  4RQM A;  4QIW C;  4CE6 A;  2BGW A;  5DQI A;  4EYI B;  2KKP A;  1BPX A;  1B43 A;  2BPC A;  2BQU A;  2HDO A;  2ZIU B;  1RM6 C;  1SKR A;  1YZ6 A;  2RQ5 A;  4BUG A;  1DGJ A;  9ICH A;  5TIS U;  2IBK A;  1NK0 A;  5AKY A;  3QNM A;  4ED8 A;  2AGO A;  4JV1 A;  5AM2 A;  4YD2 A;  1IV8 A;  3N7P D;  4GC6 A;  7ICP A;  1JXE A;  1K5O A;  7ICQ A;  3F53 A;  2HHQ A;  5EWE A;  1QQ5 A;  2AHO B;  4DS4 A;  1MQ3 A;  1QCK A;  2FLP A;  4KLL A;  2Y1J A;  3K4G A;  1UA0 A;  8ICU A;  4G9B A;  5H2F U;  3RJF A;  2G06 A;  3ALR A;  2EQY A;  2XY6 A;  4I2C A;  5EE9 A;  2ZXH A;  5AI6 A;  4ECY A;  1NJX A;  4I27 A;  2ATL A;  4KLI A;  8ICV A;  1XSL A;  4F4Y A;  1QLN A;  2A19 A;  2KG5 A;  2I9G A;  4QZH A;  4UAS A;  4UAU A;  4KLE A;  3PML A;  2EAM A;  4O5K A;  2JRZ A;  2W7O A;  2M0N A;  3RAQ A;  1ZQI A;  2ZIX A;  4RZR A;  4EYH B;  4JWN A;  5KG0 A;  2WHE A;  4O5C A;  4IR9 A;  2WFA A;  9ICT A;  2FMQ A;  1MSW D;  4EZ6 A;  1IXR A;  2Z7J A;  4KMU A;  5CJ7 A;  5ALQ A;  5KG7 A;  2KFZ A;  3UPQ A;  1NK5 A;  1QQ6 A;  3ED5 A;  3MGH A;  1WWV A;  2YB1 A;  2FPK A;  2C2E A;  1CEZ A;  1T3Q A;  4CF5 A;  2XIC A;  2KMD A;  3WK9 A;  4KLD A;  4Y2Q A;  3TAD A;  3KBB A;  1VDV A;  2ASD A;  1PZN A;  2MA1 A;  3DEE A;  4C7Z A;  3IDW A;  1ARO P;  1ZQO A;  5DDM A;  1KFD A;  1XNS A;  8ICE A;  4IQU A;  3C5F A;  3TAN A;  4Q44 A;  3MFI A;  1TK5 A;  5ALD A;  3CW2 C;  3HX0 A;  4US8 A;  2F3N A;  9ICK A;  3C5G A;  3NRZ A;  3IRU A;  3QU9 A;  1M6Y A;  3GV7 B;  3BQ2 A;  5KG1 A;  4FFD A;  3PVX A;  7ICO A;  5KG3 A;  2HOQ A;  4OD0 A;  2AGQ A;  4DL4 A;  2Y1I A;  5DGA A;  5DB9 A;  3AU6 A;  1B0X A;  2VKQ A;  5J29 A;  1MC8 A;  3M9M B;  2H3V A;  4YVZ A;  4M6W A;  4EEN A;  4FS2 A;  1U49 A;  2AQ4 A;  3ZDA A;  2R18 A;  1TAQ A;  1TFR A;  1XWL A;  3EPG A;  1KFS A;  5DQG A;  3UMB A;  2ZTC A;  4F4Z A;  8ICF A;  3BQT A;  3Q8L A;  1Z1V A;  1SL2 A;  2WB1 F;  3M7D A;  3ORY A;  1N5W A;  1NK9 A;  5KFI A;  1NKC A;  4GXK A;  5J2D A;  5ALU A;  2GLE A;  2KNJ A;  2LKY A;  2GOL A;  2F44 A;  3RBD A;  5HNK A;  2PXI A;  1SV4 A;  4RQ2 A;  3Q8K A;  2ZIU A;  5CB1 A;  2XVT A;  2MSN A;  3LWL A;  4C8O A;  2JH1 A;  1U45 A;  1HJP A;  4DOA A;  1ZQB A;  1ZQE A;  3N28 A;  9ICQ A;  4ECZ A;  4F5Q A;  3E58 A;  4C8N A;  5KG2 A;  4DL2 A;  2MAX A;  5HML A;  5DB6 A;  1BPY A;  1ZQW A;  4GIB A;  4Z6D A;  2J6S A;  2KEY A;  1JI7 A;  3T5H A;  8ICR A;  3A0B U;  3O0F A;  2XGP A;  2ZTD A;  4DQQ A;  3PV8 A;  4IC9 A;  5AI8 A;  4Z6C A;  4ECX A;  4DSE A;  3T79 A;  2DL0 A;  5KT3 A;  5AIC A;  2JHD A;  4DL6 A;  4ELT A;  3SAF A;  1L7M A;  1MQ2 A;  9ICG A;  5KFX A;  8ICP A;  5KFV A;  5J0Y A;  2YB4 A;  1ZYQ A;  1KLN A;  5AI5 A;  1N5X A;  3C1Z A;  5ALM A;  4KLQ A;  5AK6 A;  3ZDB A;  2RP5 A;  4QW9 A;  3MR6 A;  3PX6 A;  4Y2P A;  1HUO A;  3KOO A;  1A0P A;  2WF5 A;  4KIT B;  3QX7 A;  8ICG A;  4UBC A;  5KFK A;  2E8O A;  4KLG A;  1MA7 A;  4RQN A;  5J0Q A;  2HBL A;  3DV9 A;  1O03 A;  5KFO A;  4FBU A;  4JK1 A;  2IHM A;  3H8W A;  1SZH A;  1T7P A;  3TAD C;  4RNM A;  3EWA A;  1DRG A;  3G6Y A;  5CR0 A;  2F8K A;  1S10 A;  2I6X A;  1TE2 A;  1NKB A;  1ZQH A;  2QLT A;  3ZDC A;  5CA7 A;  3ISD A;  3WK8 A;  3QU5 A;  3HWT A;  4B9L A;  4F5N A;  2F8L A;  4I2E A;  2AXT U;  4I29 A;  4NLK A;  2WF9 A;  4F4W A;  5AM5 A;  1TV9 A;  3K1R B;  4B9T A;  4LJX A;  3F5A A;  3M9N B;  8ICN A;  1TAU A;  3QUC A;  4EEY A;  3U26 A;  4NLZ A;  2YY6 A; 
#chains in the Genus database with same CATH homology
 1KW4 A;  1DXS A;  1UCV A;  3IDW A;  1SGG A;  1JI7 A;  3SEI A;  2E8N A;  2LMR A;  1LKY B;  2K4P A;  2DL0 A;  2EAP A;  2F3N A;  3BQ7 A;  2QKQ A;  1V38 A;  3KKA C;  2Y9T A;  4NL9 A;  2QB1 A;  3HIL A;  2QAR B;  3TAC B;  1X66 A;  4PZN A;  3BS7 A;  3SEN A;  2JV3 A;  2EAO A;  2KSO B;  2KG5 A;  2KSO A;  1LKY A;  1OW5 A;  1PK1 B;  1RG6 A;  1B0X A;  1X9X A;  5F3X B;  2EAM A;  2LPE A;  1OXJ A;  5J8Y C;  2DKZ A;  2Y9U A;  2E8O A;  1SXE A;  1PK3 A;  5KNI A;  4RQN A;  1SV0 C;  2KE7 A;  1WWU A;  1SXD A;  2K60 A;  2QAR A;  4NJ8 A;  5JU5 A;  1B4F A;  1X40 A;  1COK A;  3TAD C;  3KKA A;  2ESE A;  4PZO A;  3BS5 B;  4NL9 C;  2DKX A;  2F8K A;  5JTI A;  1Z1V A;  2YTU A;  2KIV A;  1PK1 A;  2D3D A;  4IS7 A;  5JRT A;  2E8M A;  1UQV A;  4RQM A;  1F0M A;  2FE9 A;  2GLE A;  2QB0 B;  2QB0 A;  2F44 A;  4MHV A;  1V85 A;  5J8Y A;  1SV4 A;  3K1R B;  1WWV A;  2EAN A;  2E8P A;  2D8C A;  3BS5 A;  1SV0 A;  5L1M A;  2ES6 A;  2B6G A;  2KMD A;  3H8M A;  2L5Y A;  3TAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...