4IS7A

Crystal structure of the caskin2 sam domain tandem
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
140
structure length
140
Chain Sequence
b'GADAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAELRRGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-2
publication title Crystal Structure of the CASKIN2 SAM Domain Tandem
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 42
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 4is7A01
1X9XA 1PK3A 1F0MA 5F3XB 1SV0A 2EAMA 2Y9UA 1JI7A 3TACB 2F3NA 1V38A 1Z1VA 2JV3A 1SV4A 2EAOA 3BS5A 1X40A 1PK1A 1SXEA 1WWUA 1OXJA 2KSOB 1X66A 2D3DA 2KMDA 2QB1A 3IDWA 4NJ8A 1V85A 2E8MA 3TADC 4NL9C 2EANA 2QKQA 2ESEA 3HILA 3KKAA 1OW5A 5JRTA 1DXSA 5KNIA 2E8PA 1UCVA 2KSOA 2E8NA 1B4FA 2K4PA 2DKZA 4RQNA 1B0XA 1SGGA 4RQMA 3H8MA 2Y9TA 1PK1B 4MHVA 2F8KA 1SV0C 4PZNA 1WWVA 3BS7A 4PZOA 2KIVA 2QARB 2KG5A 5L1MA 1SXDA 2QB0B 2K60A 1LKYB 2DKXA 3K1RB 5JTIA 1RG6A 2KE7A 3BS5B 5J8YC 2FE9A 5JU5A 3SENA 1COKA 3BQ7A 2F44A 3TADA 2B6GA 4NL9A 2QARA 4IS7A 2D8CA 2ES6A 2E8OA 2GLEA 3KKAC 2QB0A 2EAPA 1LKYA 3SEIA 2YTUA 2LPEA 2LMRA 2DL0A 1UQVA 2L5YA 5J8YA 1KW4A
chains in the Genus database with same CATH superfamily
3MC1A 1ZQNA 1NJWA 1ZQPA 4KTQA 3RJHA 4F4WA 5G5GA 8ICQA 3WU2U 2RDJA 4Q43A 4EZ9A 4KLTA 3SAGA 3ZDDA 3Q8LA 4MFFA 4PGQA 2JV3A 3QYPA 2PFQA 5J2AA 3D6JA 1TAQA 4B9SA 1KBUA 1ZQ1C 4F4KA 3C5GA 2FPMA 2J6UA 2KSOB 5AK4A 4F91B 5AI9A 2WHEA 2ZJ5A 9ICEA 2EZYA 2K8BB 4YCXA 2OYYA 2ZTCA 3OJSA 3RFAA 5GTIU 2XC9A 2ESEA 4QZCA 7ICMA 3AQEA 1OW5A 4PHPA 2DPJA 2E8PA 4XA5A 2KJ8A 5AKKA 4GXKA 3RRHA 3V6HA 5IIMA 4Z6FA 5CJ7A 8ICUA 9ICJA 2ASJA 1RYSA 4KLIA 4CF3A 3JPQA 4P0QB 2BCRA 3GU3A 3SAHA 5L1MA 4DOBA 2F77X 2KNJA 1NZBA 4UB8U 8ICRA 3V6KA 2OCEA 1ED1A 1XO0A 2YB1A 4R8UB 3KD3A 5KFTA 3C21A 2Q4TA 2KIWA 3QUTA 8ICWA 2W8KA 1NK9A 1DK2A 1V97A 5J0PA 4NM1A 3PR5B 4IQTA 2LMRA 3TQ1A 9ICWA 2BQUA 1OUQA 2F1IA 2Y0SF 3KZIU 8ICLA 4UAWA 3TAPA 1Q46A 8ICMA 2JZBA 2WAQC 2C2DA 1CUKA 1SWWA 4RQ6A 1TK0A 1JMSA 5KL8B 5EOZA 2DF4B 4RPZA 3LYSA 3QEAZ 2MAXA 2MUTA 1N48A 2PFNA 4KLDA 9ICCA 3WK8A 5KFBA 4M6WA 5J2IA 4FZMA 3D2SA 4TQSA 3WKEA 2EZZA 2F1JA 2NRTA 3H0MB 3GIJA 4AP9A 3M9OB 4IRCA 5HMLA 2B0CA 2ZJ8A 4QZFA 1DGSA 2HSZA 2W03A 4M9LA 3QZ8A 1NK4A 2YX8A 9ICRA 3BQ1A 4M47A 4UW9A 7ICVA 4I2EA 1KL9A 5B5EU 3AEVA 2KP7A 3G6YA 4ECWA 3BQ0A 3IM1A 5JRTA 2G08A 1JXEA 4A8EA 3TFSA 4Z6CA 3F53A 2W8LA 5ALEA 4RQ3A 1A0PA 3GZFA 4Z6EA 2M9NA 3BZCA 4GLXA 4BUGA 1L5UA 1N60A 3IP4B 1Q8KA 4RUAA 3G6VA 4RQ7A 3WK5A 4ED1A 1Z1BA 4NLBA 4OO1J 2W9MA 5KFFA 2FJ6A 1WYGA 4M9JA 2W11A 1QSLA 1B22A 1UA0A 4DQIA 1ZOLA 3F2CA 5E79U 1JX4A 2JXJA 3NVWA 1IM4A 5D4BA 3L3FX 5ALJA 3KHLA 4C4RA 2GO7A 3TADA 3PW5A 3RB6A 4QZEA 3N7PD 4B9VA 3JPNA 1HUZA 1BPBA 1SKRA 5KG0A 4DO9A 5DQIA 4I29A 1ZQYA 2ISPA 5DQGA 3H4DA 8ICGA 1SKSA 1MQ2A 2F8LA 4F3OA 4JK1A 2ZTDA 2HCFA 4ECUA 5KFJA 2UVWA 1CI4A 3UQ2A 1TKDA 1ZQIA 4F93B 4F72A 1DK3A 4MF8A 4Q45A 4G9BA 5ALYA 4GXJA 4R63A 8ICTA 3L4PA 4ZH4A 2FPLA 2Y1IA 8ICXA 2IMWP 3WK6A 5KFMA 2LBOA 3KHGA 2E8MA 1SIJA 1JALA 1S77D 5KFWA 3RB4A 9ICTA 4QNLA 4O3SA 5IIJA 4UASA 3AN1A 4JV0A 2IOFK 3RJEA 5J2HA 2YMMA 1JIHA 1RPLA 3AM9A 2KJ9A 2BDPA 3ONNA 3VC8A 1TFRA 2DKZA 5H2FU 2PKEA 3SQIA 4I2JA 2K89A 3RH5A 2PFOA 2VJ4A 2VA8A 1U48A 2IHNA 3GFKB 1BNOA 4Y2SA 1N5XA 4KLSA 4PL2A 1NKEA 1NK0A 2BQ3A 3PV8A 3KZXA 1SXDA 3O0FA 3M9MB 5JU5A 5KT4A 2FLPA 5EE3A 3SENA 2WF7A 1SB3C 8ICSA 4UAYA 1T3NA 3UMGA 4YR3A 1J2NA 2R8GA 4DFPA 4JV1A 4NWIA 4EEKA 4IL6U 2XIDA 2YY6A 3F5AA 4WJ3B 3GIKA 4C4SA 1KW4A 4Y2TA 3SD7A 5KG7A 3OJUA 1ECWA 1PVPA 3SZ2A 5KG4A 3UXPA 1V38A 4EX6A 1X6JA 2M0NA 1QQ5A 3RR7A 3H40A 3HPOA 2YMQA 5HNKA 4X5VA 2YN4A 4M9HA 2VKQA 3IDWA 4C8LA 3TADC 3UXNA 2RHFA 5AK6A 2OXOA 3PY8A 1P7DA 4B9MA 4UB1A 4R64A 4JWMA 2FPKA 1KLNA 3Q8SB 2J6TA 4UAVA 2BZFA 4FE3A 4IC9A 5DDMA 3M8RA 1ZQLA 1O03A 5ALKA 1AROP 3D2QA 1KFTA 4B9NA 3H8MA 4MFAA 3QUQA 5KFPA 3V72A 2P6UA 4E0DA 4DS5A 2MUTB 3RJIA 2BR0A 1TE2A 4DLEA 2ZUDA 2JMGA 3CNHA 3M6ZA 1NK6A 4NV0A 5JTIA 1C7YA 4XUSA 5ALXA 1RYUA 2W04A 1K1SA 5L1IA 4J9OA 4LVSA 2KVSA 1T4GA 1XWLA 1ZQUA 2QARA 4LJXA 4C8NA 3FDSA 2E8OA 1ZQKA 8ICCA 5DG9A 3EYZA 2WFAA 4PGXA 2ZXIA 8ICAA 1VDVA 4I2AA 4U7CA 3M8SA 5K4LA 4QWDA 4NY8A 1JROA 1M6YA 1D8LA 5AIAA 4DWIA 2DFLA 4FBUA 5J0UA 1ZQMA 2BPGA 1ZD2P 1PK1B 1QSYA 2I5HA 1L8LA 2KICA 3QE9Y 5CB1A 3UMCA 4IR9A 3ZDEA 4RPYA 1KFDA 1JUDA 4KX5A 1Z00A 2BQRA 1L3UA 3RAQA 2DWQA 3TFRA 2J6SA 5ALWA 2LYBA 3PO4A 4FS2A 1NJZA 1EXNA 2W43A 4DLGA 5KFCA 3K75D 2ZUBA 3PW4A 3J81j 7ICLA 1X66A 2QB1A 2R8HA 1ZJNA 3JPRA 1UA1A 4O3QA 4RQ5A 1MQ3A 4DL5A 5KTQA 3HILA 3L5KA 2H3ZA 2G5IB 4Q44A 2YQEA 5CA7A 9ICQA 4IQVA 4QW9A 1WCLA 4ICAA 4J9PA 1LVHA 3SV3A 1X9MA 5FP0A 4FZNA 4P4MA 4YD1A 3C28A 3NRZA 4QWCA 5G5HA 3TAQA 2F76X 4F71A 2HMXA 5EWFA 2HHWA 2ALZA 1U45A 2DGZA 7ICNA 5ALGA 4O0IA 3EWAA 4CE6A 4TUQA 3RJKA 1NI3A 4JMUA 3ZD9A 4CCHA 3MFIA 4C7ZA 1K1QA 5KFVA 5C0YA 1Q3VA 2L5YA 3NVYA 2W9AA 4M04A 1ZQCA 2BPCA 1S76D 5F9NA 1L8OA 2WF6A 3H8WA 5DDYA 4RT3A 3KFUF 1NK5A 4ED7A 5J0YA 2JHDA 3SV4A 4CF5A 2ATLA 2XY6A 4YFKA 5J0TA 4Y2YA 4LZDA 5D46A 1ZQGA 3BS5A 3ED5A 4RNMA 5J2DA 1Z19A 4C8MA 4KN4A 3ORYA 2BDUA 3RTVA 2EDUA 4QZIA 1SKWA 4ZOHC 1XSNA 3MABA 3C2MA 4K4GA 4XQ8A 2QKQA 2H3VA 2AH5A 4QZ8A 1H38A 3EW9A 4IQUA 5KAFU 3QU7A 4B9UA 2AXTU 3OSNA 2KEYA 3WKBA 4YR0A 5BOMA 1S0NA 3ETLA 3ETRA 4F4ZA 4G3IA 2ZIUA 3CP8A 2W9BB 2MRLA 1K5OA 1B0XA 4PH5A 3RH4A 7ICTA 9ICVA 3H0RB 3T5LA 1RM6C 1ZQBA 4DSKA 2R18A 2KHVA 1J2MA 2G09A 5J8YC 2P66A 4Y2UA 3QEBZ 3LVWA 3GIMA 1COKA 3BQ7A 3F2BA 5DG7A 1XNSA 1XU4A 4IRKA 5KG1A 4QZBA 5AM0A 4HYKA 4BWJA 4F8RA 7ICGA 5EE0A 1U49A 3JPSA 2R8JA 2BKEA 4RUCA 2A1AA 5B66U 1PZNA 2KKVA 3FYHA 5KT2A 1HIWA 1X9XA 2NV3A 1SV0A 3LWLA 4RT2A 2LYAA 4DL2A 3QZ7A 3T5KA 3C5FA 3RJGA 4EEYA 5AKGA 1SZHA 3PSFA 3ISDA 4NJ8A 1V85A 4ED6A 4I2HA 3RF9A 3C2KA 1LB2B 2I1QA 2DQNB 2EANA 3MR3A 1ZD4A 2KD1A 5ALIA 3H8JA 5DGAA 1NJXA 2H3IA 2ZIVB 4Y2RA 4F4XA 4FS1A 4KLQA 5HP4A 1HEKA 5KAIU 2F1HA 4P0PA 4K4HA 2R8KA 4P2HA 4R66A 9ICIA 3TARA 2EQYA 9ICPA 3MGIA 4RQMA 1BVSA 3RJJA 4U6PA 2MA1A 1ZQXA 4KLGA 1WWVA 4KX3A 4Y2XA 2HHSA 4PZOA 5ALRA 4QZ9A 4NXZA 5J2EA 1JRPA 5BOLA 7ICSA 3RB0A 2K60A 3T5HA 5ALTA 2KVCA 1NKBA 4NLCA 2E3TA 4BXOB 3C23A 2ZXHA 3ICXA 3PW0A 1MN8A 4QWAA 2ISOA 3IHQB 9ICUA 3NVVA 4YD2A 5TZVA 1KRPA 3PR4A 4DSLA 3GDXA 4RQ8A 1LKYA 2YTUA 4DSJA 4IR1A 4DQSA 2JGAA 3AMZA 4YMNA 1MA7A 1L3VA 4O3OA 1UT8A 4DFJA 4ED2A 4Q8EA 4EENA 3PMNA 8ICKA 2YMPA 2ZIWB 5A0LA 1KTQA 2KJ5A 2Y9UA 4YG2A 5AI4A 4KMUA 4M2YA 2Y0SC 4B6JA 3FAHA 4PL1A 5TISU 5AI6A 4QIWF 1SXEA 3JPPA 3NUQA 3MBYA 2JEFA 1L7MA 3ZDAA 1X6IA 1YZ7A 4FBTA 4I2FA 5CWRA 2Z7JA 1SL2A 2ZIXA 3GIIA 2WF8A 1NOMA 2FMQA 4ED0A 5ALSA 1SL1A 5KNIA 2JH7A 1PUZA 3UXOA 1IV8A 2E8NA 3QU4A 2KZZA 3ZI4A 4MHVA 1SV0C 8ICHA 3H7IA 7ICRA 4EZ6A 4QWEA 2HDOA 1XS9D 4O3RA 3ZD8A 4DOAA 4KLEA 4O3MA 3K1RB 3BS5B 4M9NA 2XY7A 2K4EA 4RNOA 3BQ2A 5J2BA 4DS4A 2RLTA 5HHHA 4J9QA 3AL0B 4BGDA 1Z4OA 1KDHA 1ZQFA 2IBKA 3T3FA 2QB0A 5KFIA 2VANA 2IHMA 5IIKA 4UBCA 4DL7A 5DBAA 4HAIA 5F9LA 5CRXA 3M7DA 2Q0ZX 4NLKA 2C2RA 2FLLA 3B0YA 9ICHA 4C0ZA 4I2CA 3PSTA 1WG8A 2W3RA 3VCBA 3HX0A 1YZ6A 1NKCA 1F0MA 2WF5A 2PI4A 1L6NA 5BPCA 2HBJA 3IG5A 1GO3F 4GXIA 5J0WA 3RBDA 2I6XA 2DUYA 1MC8A 3WK7A 4QIWC 3PVXA 5J2CA 2A1JA 5AKXA 2UVUA 2AU0A 2JEJA 2AJQA 4UARA 8ICNA 5AM3A 5IIIA 3HT3A 5KG6A 5KFDA 2OEHA 1Z3EB 3C2LA 4TUSA 4CDGA 3CRXA 5AM1A 3ZDCA 3PX0A 3MGHA 4IRDA 2R8IA 1JXLA 1WCNA 2KSOA 1HJPA 2V4RA 3PO5A 3LDAA 1B4FA 1QLNA 2MU2A 1D9DA 5KFZA 1QH9A 1N56A 1T94A 3OPXA 4GFJA 4F5OA 1N62A 2NRXA 1SZPA 3BS7A 3NTUA 5EE1A 4JUZA 5C5JA 4DQQA 2W55A 4DQPA 3KTQA 4ELVA 2HHTA 4EBEA 4P0QA 3WKCA 5KT5A 2JZBB 2BCQA 1ZQWA 2HI0A 5KG3A 2KOBA 2ES6A 1IIPA 3SAFA 1S10A 4F5RA 2A3VA 4R8UA 4M6WB 4M0AA 3NVZA 1ZJMA 5J0XA 4J9KA 1L3SA 1N5WA 4M9GA 1PK3A 2AGQA 1T8EA 4MEYA 1Q3UA 5F3XB 8ICIA 3Q8PB 5IILA 1FO4A 1IG6A 4JWNA 2F3NA 2D6FC 1ZRNA 3BJYA 1FFUA 1QCKA 8ICJA 3K1ZA 3IV6A 2CRXA 5ALQA 7ICHA 2KFZA 1RZTA 4Y2QA 7ICEA 3UMBA 5ALFA 5DG8A 4DSEA 1JN3A 5EWEA 4EELA 4PHAA 3DEEA 5KFAA 1KFSA 1XO1A 3S6JA 5DBBA 1ZQEA 2F8KA 2G07A 3UQ0A 3SI8A 3TI0A 3RBEA 3MR5A 3QXGA 3BZKA 4BWMA 4UBBA 3KOOA 4GC6A 2QLTA 5KFHA 3FM9A 4P4PA 4DCCA 4QJFB 3THVA 3WK4A 2KE7A 2RDIA 1U4BA 2YB4A 1Y88A 1UT5A 2C28A 2ASLA 4EBDA 4C80A 3NGDA 3U26A 4F5PA 2LYHA 5J2KA 1F44A 4EYHB 2NO4A 2GLEA 5KL1B 3V7LA 5CEHA 4CRXA 2LPEA 2HBMA 1ZYQA 4KN7A 4PHDA 3D2NA 2BCSA 9ICMA 4O5KA 4BX9C 2E5SA 4C4TA 1BPYA 2H3QA 4K4IA 4DF8A 3NASA 4RQ4A 4EYIB 5AKHA 1ZQRA 2XVTA 1RYRA 4EBCA 4DFMA 5KFNA 4US8A 1RXVA 4EX7A 4B9TA 4Q8FA 2EAMA 5KG5A 3TACB 5J0RA 3ZDBA 1CRXA 1U47A 1RDFA 1X40A 1TK8A 1FIQA 5KFOA 4KLUA 5ALZA 3HKZF 3EZ5A 2KMDA 2GH1A 4F5QA 9ICXA 1KSPA 4OJLA 3MR6A 1S5LU 3K4GA 7ICKA 2OWOA 7ICJA 4MEXA 3UM9A 3KKAA 4DFKA 1U9LA 1TV9A 5J2GA 2BCVA 4CNQA 2V4QA 2HHVA 2NRZA 2HVIA 1RXWA 5L1LA 5EWGA 3JPTA 7ICIA 1COOA 1FEZA 2WB1F 2W9CA 2Y9TA 2NO5A 3QX7A 3FC4A 5AKLA 4Z6DA 2KFNA 2GWSA 3Q8KA 5ALHA 5AKEA 3AQFA 4Y2PA 2N1RA 9ICGA 4RZRA 5DB7A 2EZXA 4ED8A 4OD0A 1BGXT 2C22A 2CN1A 4IQWA 4RQ1A 2KN7A 5ALOA 3ISCA 4UB6U 5AK3A 2AHOB 1T3QA 2F44A 4QW8A 4ELUA 2XGQA 4PGYA 8ICVA 4OJ6A 1ZQQA 2RQ5A 3V7KA 1X9WA 9ICLA 2KK0A 3OGUA 3Q8QB 1X2IA 3QUCA 2EH9A 3KHRA 1BNPA 5KFXA 2P35A 3CYMA 7ICFA 5JUMA 2IOFA 4DOCA 2XY5A 1KQQA 3Q8MA 2KZMA 3WKAA 4I2GA 2O6KA 2WF9A 4C7YA 5KFRA 4RQ2A 4KLHA 1A77A 1NNLA 2DPIA 8ICEA 3N7SC 1ZRMA 3E58A 4AYBF 3HKZC 5L1KA 2GOLA 1WWUA 2W54A 2WTFA 3IRUA 1OXJA 3F2DA 2W3SA 4QWBA 3RH6A 3Q8RB 1ZQJA 4FZLA 5CR0A 2OHFA 3HWTA 1S9FA 5KT7A 2NRWA 4JB3A 1DXSA 3QU2A 1AQ6A 1X42A 1UCVA 4DF4A 4YXMA 2Y1JA 2WB1C 5DB8A 4ED3A 2H5XA 2RP5A 3F5EA 4ECRA 4PZNA 3OHAA 1ZETA 2VA3A 1ZQDA 1ZQZA 2QARB 7ICPA 4ELTA 4KLMA 2AGOA 2HOIA 9ICSA 1NK8A 2HBKA 4RNNA 1DRGA 4O3PA 2AGPA 4JV2A 2LM1A 2BGWA 3PMLA 2D8CA 2HHQA 3KKAC 4UB2A 2XO7A 1N61A 1Z00B 5J2JA 1S0VA 4ECTA 4KLFA 2LHTA 4QZHA 2FLNA 1XSPA 2G0AA 2OM6A 4YR2A 3GQCA 3M9NB 4BDPA 1XSLA 4UB3A 5AICA 2F2AB 3QU9A 4ECSA 5L1JA 3SYZA 2HBLA 3MDCA 4YMMA 2E1EA 4QZAA 5D49A 1NJYA 1WUDA 5ALMA 5AKZA 1IXRA 2EAOA 4AYBC 1PK1A 4YN4A 5AM5A 3RB3A 1HUOA 4YMOA 2LKYA 1S8OA 1L7OA 4J9NA 4FO6A 1SL0A 3LVVA 5AHXA 4NM2A 4NLGA 4QZDA 1SWVA 3H0LB 2K8CB 4J9SA 4MFCA 4USAA 5J0OA 3PW2A 2ZTEA 2G5HB 4GC7A 5DLGA 1QQ7A 2XI9A 3B9JA 3PSPA 3QUBA 3KHHA 2UVRA 2CPRA 2XICA 3GILA 3SMVA 4F2RA 2PXIA 3RR8A 3C1YA 1X9SA 1QTMA 3I28A 5AI5A 1BPZA 4C8KA 2W7OA 2XCPA 8ICOA 4KLOA 5DB6A 5ALNA 4YP3A 3SR6A 5AKJA 5ALDA 2KHQA 3M1YA 4NL9A 2V9WA 3PX6A 5HHIA 1ZQVA 3GV5B 3IN5A 1TVAA 2JR5A 3H8SA 4YQWA 8ICPA 2W7PA 5J0SA 2BHNA 8ICBA 2JH1A 2ZJAA 3GV7B 3OHBA 3BQTA 1ZQOA 5DKWA 4CGZA 3DV9A 5IINA 9ICAA 7ICOA 4OJOA 1KEJA 2W9CB 3QNMA 4XRHA 3KBBA 3HRDD 4O5EA 3WK9A 1UHUA 1Z1VA 4ECQA 1SV4A 3EUB2 2MSNA 1NZPA 2FMPA 4OJ5A 4ECZA 5ALVA 4B9LA 1TAMA 2BCUA 2D3DA 1ZQAA 4I2IA 4J03A 1S0MA 4O5CA 2YMLA 2KZ3A 2ZIUB 5L9XA 4BJQA 2PMZF 5AKIA 3GV8B 2NRVA 4I2BA 1N63A 2LM4A 4NLZA 4RQ0A 3HJEA 4PJ0U 3E0FA 5KFYA 4QZGA 9ICKA 1QQ6A 1N2XA 3RJFA 2JEGA 1CEZA 4KLLA 1J97A 9ICNA 1YT3A 5KT3A 1ZQTA 3AU2A 2KG5A 3OSPA 2HHXA 1UPHA 4DQRA 2W9BA 2HW3A 2FE9A 3CW2C 9ICFA 1ZXIA 4P4OA 4OJPA 1NK7A 4DSIA 1A6SA 2JRZA 2OH2A 5ALUA 9ICOA 4DL6A 4YXJA 3NS1A 2VJ5A 4RU9A 3AUOA 2EAPA 3SEIA 4PPXA 5AIBA 2DL0A 1UQVA 5KFQA 2K8AA 4NLNA 3TKAA 5KFSA 2HOFA 4F2SA 5AKYA 1L3TA 1D8YA 5J29A 5AI0A 1MSWD 5T14A 2XGPA 3C1ZA 2RRDA 4C8OA 2ODGA 1LV5A 3C29A 3DDHA 5DBCA 1JI7A 1URJA 2ASDA 5KFKA 2FDRA 5KFUA 4UQGA 2C2EA 3ALRA 1L7NA 3MGVA 2VA2A 4F5NA 1TK5A 3IG8A 3JPOA 4ECXA 3R9KA 1D9FA 3LWMA 5KFGA 2VIXA 1TAUA 4P0PB 5DGBA 1ZD5A 4NL9C 1KN5A 5AI8A 5CP2A 5CHGA 3HP6A 4TQRA 5KT6A 2PMZC 4LZGA 4J9MA 3N28A 5HR6A 5DLFA 4DL4A 4J9RA 3A0BU 4PHEA 3EPIA 4FFDA 9ICBA 2K4PA 5DB9A 4OCZA 1PVQA 4UATA 1ZQHA 2ZIVA 4DEZA 5IIOA 1BPEA 2KIVA 4O9MA 5J0QA 3MFHA 1LKYB 2DKXA 4R65A 1FFVA 2CXYA 4Y2VA 5KFEA 3LK9A 2IOHA 1VJ5A 1V9PA 4TUPA 3PZPA 1KKXA 1B43A 4IS7A 3HW8A 3RRGA 4UB4A 2XCAA 3E2EA 1O08A 2BPFA 2NYVA 4F92B 5HR7A 4BXOA 1A76A 5J8YA 3H4BA 4I2DA 1DOQA 3PSIA 3PX4A 2KTQA 4ECVA 4CF4A 2ZG6A 4MF2A 3WKDA 2E1FA 3PNCA 2FI1A 1S0OA 4I27A 3TANA 4DFDA 1QSSA 2ZIXB 2B21A 3M6KA 3QU5A 3AU6A 2HVHA 5ALLA 1Z4NA 2ZIWA 1XC9A 1L7PA 5EE9A 2AQ0A 1RQLA 2K4HA 3MR2A 5KFLA 7ICQA 3V7JA 5GTHU 3B0XA 3BDPA 4KLJA 3RAXA 2A19A 4KITB 4TURA 3NRWA 2P6RA 4UAZA 2H3FA 3ISBA 4RPXA 2HHUA 1S97A 2PI5A 3I76A 2FMSA 5AM4A 5DQHA 1F5SA 4Y2JA 4UB5A 1BPDA 3G6XA 1BPXA 8ICZA 4J9LA 3T79A 4RQNA 1SGGA 5HMMA 2DBYA 5KG2A 4UAUA 2ZUCA 2AQ4A 2UVVA 4DL3A 2HOQA 3T5JA 1T7PA 5AM2A 4US9A 1RQNA 5J2FA 2QB0B 4I28A 1RG6A 4O3NA 3N4MB 8ICFA 3N97B 4ECYA 1ZD3A 3V6JA 4KMOB 4GIBA 3A0HU 3MDAA 3PW7A 1ZQSA 1DGJA 2B6GA 5AK5A 4DSFA 2KV2A 3I1YA 2LI6A 4F50A 2JEIA 1PVRA 3OTQA 2PFPA 8ICYA 4YVZA 2I9GA 5ALPA 3UPQA 2G06A 2K4IA 3EPGA 1VLBA 3N7RC 4ACOA 7ICUA 1D8BA 2KKPA 2IA6A 2WAQF 4F4YA 1C20A 2A1JB
chains in the Genus database with same CATH topology
1X9XA 1PK3A 1F0MA 5F3XB 1SV0A 2EAMA 2Y9UA 1JI7A 3TACB 2F3NA 1V38A 1Z1VA 2JV3A 1SV4A 2EAOA 3BS5A 1X40A 1PK1A 1SXEA 1WWUA 1OXJA 2KSOB 1X66A 2D3DA 2KMDA 2QB1A 3IDWA 4NJ8A 1V85A 2E8MA 3TADC 4NL9C 2EANA 2QKQA 2ESEA 3HILA 3KKAA 1OW5A 5JRTA 1DXSA 5KNIA 2E8PA 1UCVA 2KSOA 2E8NA 1B4FA 2K4PA 2DKZA 4RQNA 1B0XA 1SGGA 4RQMA 3H8MA 2Y9TA 1PK1B 4MHVA 2F8KA 1SV0C 4PZNA 1WWVA 3BS7A 4PZOA 2KIVA 2QARB 2KG5A 5L1MA 1SXDA 2QB0B 2K60A 1LKYB 2DKXA 3K1RB 5JTIA 1RG6A 2KE7A 3BS5B 5J8YC 2FE9A 5JU5A 3SENA 1COKA 3BQ7A 2F44A 3TADA 2B6GA 4NL9A 2QARA 4IS7A 2D8CA 2ES6A 2E8OA 2GLEA 3KKAC 2QB0A 2EAPA 1LKYA 3SEIA 2YTUA 2LPEA 2LMRA 2DL0A 1UQVA 2L5YA 5J8YA 1KW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9X A;  1PK3 A;  1F0M A;  5F3X B;  1SV0 A;  2EAM A;  2Y9U A;  1JI7 A;  3TAC B;  2F3N A;  1V38 A;  1Z1V A;  2JV3 A;  1SV4 A;  2EAO A;  3BS5 A;  1X40 A;  1PK1 A;  1SXE A;  1WWU A;  1OXJ A;  2KSO B;  1X66 A;  2D3D A;  2KMD A;  2QB1 A;  3IDW A;  4NJ8 A;  1V85 A;  2E8M A;  3TAD C;  4NL9 C;  2EAN A;  2QKQ A;  2ESE A;  3HIL A;  3KKA A;  1OW5 A;  5JRT A;  1DXS A;  5KNI A;  2E8P A;  1UCV A;  2KSO A;  2E8N A;  1B4F A;  2K4P A;  2DKZ A;  4RQN A;  1B0X A;  1SGG A;  4RQM A;  3H8M A;  2Y9T A;  1PK1 B;  4MHV A;  2F8K A;  1SV0 C;  4PZN A;  1WWV A;  3BS7 A;  4PZO A;  2KIV A;  2QAR B;  2KG5 A;  5L1M A;  1SXD A;  2QB0 B;  2K60 A;  1LKY B;  2DKX A;  3K1R B;  5JTI A;  1RG6 A;  2KE7 A;  3BS5 B;  5J8Y C;  2FE9 A;  5JU5 A;  3SEN A;  1COK A;  3BQ7 A;  2F44 A;  3TAD A;  2B6G A;  4NL9 A;  2QAR A;  4IS7 A;  2D8C A;  2ES6 A;  2E8O A;  2GLE A;  3KKA C;  2QB0 A;  2EAP A;  1LKY A;  3SEI A;  2YTU A;  2LPE A;  2LMR A;  2DL0 A;  1UQV A;  2L5Y A;  5J8Y A;  1KW4 A; 
#chains in the Genus database with same CATH topology
 3MC1 A;  1ZQN A;  1NJW A;  1ZQP A;  4KTQ A;  3RJH A;  4F4W A;  5G5G A;  8ICQ A;  3WU2 U;  2RDJ A;  4Q43 A;  4EZ9 A;  4KLT A;  3SAG A;  3ZDD A;  3Q8L A;  4MFF A;  4PGQ A;  2JV3 A;  3QYP A;  2PFQ A;  5J2A A;  3D6J A;  1TAQ A;  4B9S A;  1KBU A;  1ZQ1 C;  4F4K A;  3C5G A;  2FPM A;  2J6U A;  2KSO B;  5AK4 A;  4F91 B;  5AI9 A;  2WHE A;  2ZJ5 A;  9ICE A;  2EZY A;  2K8B B;  4YCX A;  2OYY A;  2ZTC A;  3OJS A;  3RFA A;  5GTI U;  2XC9 A;  2ESE A;  4QZC A;  7ICM A;  3AQE A;  1OW5 A;  4PHP A;  2DPJ A;  2E8P A;  4XA5 A;  2KJ8 A;  5AKK A;  4GXK A;  3RRH A;  3V6H A;  5IIM A;  4Z6F A;  5CJ7 A;  8ICU A;  9ICJ A;  2ASJ A;  1RYS A;  4KLI A;  4CF3 A;  3JPQ A;  4P0Q B;  2BCR A;  3GU3 A;  3SAH A;  5L1M A;  4DOB A;  2F77 X;  2KNJ A;  1NZB A;  4UB8 U;  8ICR A;  3V6K A;  2OCE A;  1ED1 A;  1XO0 A;  2YB1 A;  4R8U B;  3KD3 A;  5KFT A;  3C21 A;  2Q4T A;  2KIW A;  3QUT A;  8ICW A;  2W8K A;  1NK9 A;  1DK2 A;  1V97 A;  5J0P A;  4NM1 A;  3PR5 B;  4IQT A;  2LMR A;  3TQ1 A;  9ICW A;  2BQU A;  1OUQ A;  2F1I A;  2Y0S F;  3KZI U;  8ICL A;  4UAW A;  3TAP A;  1Q46 A;  8ICM A;  2JZB A;  2WAQ C;  2C2D A;  1CUK A;  1SWW A;  4RQ6 A;  1TK0 A;  1JMS A;  5KL8 B;  5EOZ A;  2DF4 B;  4RPZ A;  3LYS A;  3QEA Z;  2MAX A;  2MUT A;  1N48 A;  2PFN A;  4KLD A;  9ICC A;  3WK8 A;  5KFB A;  4M6W A;  5J2I A;  4FZM A;  3D2S A;  4TQS A;  3WKE A;  2EZZ A;  2F1J A;  2NRT A;  3H0M B;  3GIJ A;  4AP9 A;  3M9O B;  4IRC A;  5HML A;  2B0C A;  2ZJ8 A;  4QZF A;  1DGS A;  2HSZ A;  2W03 A;  4M9L A;  3QZ8 A;  1NK4 A;  2YX8 A;  9ICR A;  3BQ1 A;  4M47 A;  4UW9 A;  7ICV A;  4I2E A;  1KL9 A;  5B5E U;  3AEV A;  2KP7 A;  3G6Y A;  4ECW A;  3BQ0 A;  3IM1 A;  5JRT A;  2G08 A;  1JXE A;  4A8E A;  3TFS A;  4Z6C A;  3F53 A;  2W8L A;  5ALE A;  4RQ3 A;  1A0P A;  3GZF A;  4Z6E A;  2M9N A;  3BZC A;  4GLX A;  4BUG A;  1L5U A;  1N60 A;  3IP4 B;  1Q8K A;  4RUA A;  3G6V A;  4RQ7 A;  3WK5 A;  4ED1 A;  1Z1B A;  4NLB A;  4OO1 J;  2W9M A;  5KFF A;  2FJ6 A;  1WYG A;  4M9J A;  2W11 A;  1QSL A;  1B22 A;  1UA0 A;  4DQI A;  1ZOL A;  3F2C A;  5E79 U;  1JX4 A;  2JXJ A;  3NVW A;  1IM4 A;  5D4B A;  3L3F X;  5ALJ A;  3KHL A;  4C4R A;  2GO7 A;  3TAD A;  3PW5 A;  3RB6 A;  4QZE A;  3N7P D;  4B9V A;  3JPN A;  1HUZ A;  1BPB A;  1SKR A;  5KG0 A;  4DO9 A;  5DQI A;  4I29 A;  1ZQY A;  2ISP A;  5DQG A;  3H4D A;  8ICG A;  1SKS A;  1MQ2 A;  2F8L A;  4F3O A;  4JK1 A;  2ZTD A;  2HCF A;  4ECU A;  5KFJ A;  2UVW A;  1CI4 A;  3UQ2 A;  1TKD A;  1ZQI A;  4F93 B;  4F72 A;  1DK3 A;  4MF8 A;  4Q45 A;  4G9B A;  5ALY A;  4GXJ A;  4R63 A;  8ICT A;  3L4P A;  4ZH4 A;  2FPL A;  2Y1I A;  8ICX A;  2IMW P;  3WK6 A;  5KFM A;  2LBO A;  3KHG A;  2E8M A;  1SIJ A;  1JAL A;  1S77 D;  5KFW A;  3RB4 A;  9ICT A;  4QNL A;  4O3S A;  5IIJ A;  4UAS A;  3AN1 A;  4JV0 A;  2IOF K;  3RJE A;  5J2H A;  2YMM A;  1JIH A;  1RPL A;  3AM9 A;  2KJ9 A;  2BDP A;  3ONN A;  3VC8 A;  1TFR A;  2DKZ A;  5H2F U;  2PKE A;  3SQI A;  4I2J A;  2K89 A;  3RH5 A;  2PFO A;  2VJ4 A;  2VA8 A;  1U48 A;  2IHN A;  3GFK B;  1BNO A;  4Y2S A;  1N5X A;  4KLS A;  4PL2 A;  1NKE A;  1NK0 A;  2BQ3 A;  3PV8 A;  3KZX A;  1SXD A;  3O0F A;  3M9M B;  5JU5 A;  5KT4 A;  2FLP A;  5EE3 A;  3SEN A;  2WF7 A;  1SB3 C;  8ICS A;  4UAY A;  1T3N A;  3UMG A;  4YR3 A;  1J2N A;  2R8G A;  4DFP A;  4JV1 A;  4NWI A;  4EEK A;  4IL6 U;  2XID A;  2YY6 A;  3F5A A;  4WJ3 B;  3GIK A;  4C4S A;  1KW4 A;  4Y2T A;  3SD7 A;  5KG7 A;  3OJU A;  1ECW A;  1PVP A;  3SZ2 A;  5KG4 A;  3UXP A;  1V38 A;  4EX6 A;  1X6J A;  2M0N A;  1QQ5 A;  3RR7 A;  3H40 A;  3HPO A;  2YMQ A;  5HNK A;  4X5V A;  2YN4 A;  4M9H A;  2VKQ A;  3IDW A;  4C8L A;  3TAD C;  3UXN A;  2RHF A;  5AK6 A;  2OXO A;  3PY8 A;  1P7D A;  4B9M A;  4UB1 A;  4R64 A;  4JWM A;  2FPK A;  1KLN A;  3Q8S B;  2J6T A;  4UAV A;  2BZF A;  4FE3 A;  4IC9 A;  5DDM A;  3M8R A;  1ZQL A;  1O03 A;  5ALK A;  1ARO P;  3D2Q A;  1KFT A;  4B9N A;  3H8M A;  4MFA A;  3QUQ A;  5KFP A;  3V72 A;  2P6U A;  4E0D A;  4DS5 A;  2MUT B;  3RJI A;  2BR0 A;  1TE2 A;  4DLE A;  2ZUD A;  2JMG A;  3CNH A;  3M6Z A;  1NK6 A;  4NV0 A;  5JTI A;  1C7Y A;  4XUS A;  5ALX A;  1RYU A;  2W04 A;  1K1S A;  5L1I A;  4J9O A;  4LVS A;  2KVS A;  1T4G A;  1XWL A;  1ZQU A;  2QAR A;  4LJX A;  4C8N A;  3FDS A;  2E8O A;  1ZQK A;  8ICC A;  5DG9 A;  3EYZ A;  2WFA A;  4PGX A;  2ZXI A;  8ICA A;  1VDV A;  4I2A A;  4U7C A;  3M8S A;  5K4L A;  4QWD A;  4NY8 A;  1JRO A;  1M6Y A;  1D8L A;  5AIA A;  4DWI A;  2DFL A;  4FBU A;  5J0U A;  1ZQM A;  2BPG A;  1ZD2 P;  1PK1 B;  1QSY A;  2I5H A;  1L8L A;  2KIC A;  3QE9 Y;  5CB1 A;  3UMC A;  4IR9 A;  3ZDE A;  4RPY A;  1KFD A;  1JUD A;  4KX5 A;  1Z00 A;  2BQR A;  1L3U A;  3RAQ A;  2DWQ A;  3TFR A;  2J6S A;  5ALW A;  2LYB A;  3PO4 A;  4FS2 A;  1NJZ A;  1EXN A;  2W43 A;  4DLG A;  5KFC A;  3K75 D;  2ZUB A;  3PW4 A;  3J81 j;  7ICL A;  1X66 A;  2QB1 A;  2R8H A;  1ZJN A;  3JPR A;  1UA1 A;  4O3Q A;  4RQ5 A;  1MQ3 A;  4DL5 A;  5KTQ A;  3HIL A;  3L5K A;  2H3Z A;  2G5I B;  4Q44 A;  2YQE A;  5CA7 A;  9ICQ A;  4IQV A;  4QW9 A;  1WCL A;  4ICA A;  4J9P A;  1LVH A;  3SV3 A;  1X9M A;  5FP0 A;  4FZN A;  4P4M A;  4YD1 A;  3C28 A;  3NRZ A;  4QWC A;  5G5H A;  3TAQ A;  2F76 X;  4F71 A;  2HMX A;  5EWF A;  2HHW A;  2ALZ A;  1U45 A;  2DGZ A;  7ICN A;  5ALG A;  4O0I A;  3EWA A;  4CE6 A;  4TUQ A;  3RJK A;  1NI3 A;  4JMU A;  3ZD9 A;  4CCH A;  3MFI A;  4C7Z A;  1K1Q A;  5KFV A;  5C0Y A;  1Q3V A;  2L5Y A;  3NVY A;  2W9A A;  4M04 A;  1ZQC A;  2BPC A;  1S76 D;  5F9N A;  1L8O A;  2WF6 A;  3H8W A;  5DDY A;  4RT3 A;  3KFU F;  1NK5 A;  4ED7 A;  5J0Y A;  2JHD A;  3SV4 A;  4CF5 A;  2ATL A;  2XY6 A;  4YFK A;  5J0T A;  4Y2Y A;  4LZD A;  5D46 A;  1ZQG A;  3BS5 A;  3ED5 A;  4RNM A;  5J2D A;  1Z19 A;  4C8M A;  4KN4 A;  3ORY A;  2BDU A;  3RTV A;  2EDU A;  4QZI A;  1SKW A;  4ZOH C;  1XSN A;  3MAB A;  3C2M A;  4K4G A;  4XQ8 A;  2QKQ A;  2H3V A;  2AH5 A;  4QZ8 A;  1H38 A;  3EW9 A;  4IQU A;  5KAF U;  3QU7 A;  4B9U A;  2AXT U;  3OSN A;  2KEY A;  3WKB A;  4YR0 A;  5BOM A;  1S0N A;  3ETL A;  3ETR A;  4F4Z A;  4G3I A;  2ZIU A;  3CP8 A;  2W9B B;  2MRL A;  1K5O A;  1B0X A;  4PH5 A;  3RH4 A;  7ICT A;  9ICV A;  3H0R B;  3T5L A;  1RM6 C;  1ZQB A;  4DSK A;  2R18 A;  2KHV A;  1J2M A;  2G09 A;  5J8Y C;  2P66 A;  4Y2U A;  3QEB Z;  3LVW A;  3GIM A;  1COK A;  3BQ7 A;  3F2B A;  5DG7 A;  1XNS A;  1XU4 A;  4IRK A;  5KG1 A;  4QZB A;  5AM0 A;  4HYK A;  4BWJ A;  4F8R A;  7ICG A;  5EE0 A;  1U49 A;  3JPS A;  2R8J A;  2BKE A;  4RUC A;  2A1A A;  5B66 U;  1PZN A;  2KKV A;  3FYH A;  5KT2 A;  1HIW A;  1X9X A;  2NV3 A;  1SV0 A;  3LWL A;  4RT2 A;  2LYA A;  4DL2 A;  3QZ7 A;  3T5K A;  3C5F A;  3RJG A;  4EEY A;  5AKG A;  1SZH A;  3PSF A;  3ISD A;  4NJ8 A;  1V85 A;  4ED6 A;  4I2H A;  3RF9 A;  3C2K A;  1LB2 B;  2I1Q A;  2DQN B;  2EAN A;  3MR3 A;  1ZD4 A;  2KD1 A;  5ALI A;  3H8J A;  5DGA A;  1NJX A;  2H3I A;  2ZIV B;  4Y2R A;  4F4X A;  4FS1 A;  4KLQ A;  5HP4 A;  1HEK A;  5KAI U;  2F1H A;  4P0P A;  4K4H A;  2R8K A;  4P2H A;  4R66 A;  9ICI A;  3TAR A;  2EQY A;  9ICP A;  3MGI A;  4RQM A;  1BVS A;  3RJJ A;  4U6P A;  2MA1 A;  1ZQX A;  4KLG A;  1WWV A;  4KX3 A;  4Y2X A;  2HHS A;  4PZO A;  5ALR A;  4QZ9 A;  4NXZ A;  5J2E A;  1JRP A;  5BOL A;  7ICS A;  3RB0 A;  2K60 A;  3T5H A;  5ALT A;  2KVC A;  1NKB A;  4NLC A;  2E3T A;  4BXO B;  3C23 A;  2ZXH A;  3ICX A;  3PW0 A;  1MN8 A;  4QWA A;  2ISO A;  3IHQ B;  9ICU A;  3NVV A;  4YD2 A;  5TZV A;  1KRP A;  3PR4 A;  4DSL A;  3GDX A;  4RQ8 A;  1LKY A;  2YTU A;  4DSJ A;  4IR1 A;  4DQS A;  2JGA A;  3AMZ A;  4YMN A;  1MA7 A;  1L3V A;  4O3O A;  1UT8 A;  4DFJ A;  4ED2 A;  4Q8E A;  4EEN A;  3PMN A;  8ICK A;  2YMP A;  2ZIW B;  5A0L A;  1KTQ A;  2KJ5 A;  2Y9U A;  4YG2 A;  5AI4 A;  4KMU A;  4M2Y A;  2Y0S C;  4B6J A;  3FAH A;  4PL1 A;  5TIS U;  5AI6 A;  4QIW F;  1SXE A;  3JPP A;  3NUQ A;  3MBY A;  2JEF A;  1L7M A;  3ZDA A;  1X6I A;  1YZ7 A;  4FBT A;  4I2F A;  5CWR A;  2Z7J A;  1SL2 A;  2ZIX A;  3GII A;  2WF8 A;  1NOM A;  2FMQ A;  4ED0 A;  5ALS A;  1SL1 A;  5KNI A;  2JH7 A;  1PUZ A;  3UXO A;  1IV8 A;  2E8N A;  3QU4 A;  2KZZ A;  3ZI4 A;  4MHV A;  1SV0 C;  8ICH A;  3H7I A;  7ICR A;  4EZ6 A;  4QWE A;  2HDO A;  1XS9 D;  4O3R A;  3ZD8 A;  4DOA A;  4KLE A;  4O3M A;  3K1R B;  3BS5 B;  4M9N A;  2XY7 A;  2K4E A;  4RNO A;  3BQ2 A;  5J2B A;  4DS4 A;  2RLT A;  5HHH A;  4J9Q A;  3AL0 B;  4BGD A;  1Z4O A;  1KDH A;  1ZQF A;  2IBK A;  3T3F A;  2QB0 A;  5KFI A;  2VAN A;  2IHM A;  5IIK A;  4UBC A;  4DL7 A;  5DBA A;  4HAI A;  5F9L A;  5CRX A;  3M7D A;  2Q0Z X;  4NLK A;  2C2R A;  2FLL A;  3B0Y A;  9ICH A;  4C0Z A;  4I2C A;  3PST A;  1WG8 A;  2W3R A;  3VCB A;  3HX0 A;  1YZ6 A;  1NKC A;  1F0M A;  2WF5 A;  2PI4 A;  1L6N A;  5BPC A;  2HBJ A;  3IG5 A;  1GO3 F;  4GXI A;  5J0W A;  3RBD A;  2I6X A;  2DUY A;  1MC8 A;  3WK7 A;  4QIW C;  3PVX A;  5J2C A;  2A1J A;  5AKX A;  2UVU A;  2AU0 A;  2JEJ A;  2AJQ A;  4UAR A;  8ICN A;  5AM3 A;  5III A;  3HT3 A;  5KG6 A;  5KFD A;  2OEH A;  1Z3E B;  3C2L A;  4TUS A;  4CDG A;  3CRX A;  5AM1 A;  3ZDC A;  3PX0 A;  3MGH A;  4IRD A;  2R8I A;  1JXL A;  1WCN A;  2KSO A;  1HJP A;  2V4R A;  3PO5 A;  3LDA A;  1B4F A;  1QLN A;  2MU2 A;  1D9D A;  5KFZ A;  1QH9 A;  1N56 A;  1T94 A;  3OPX A;  4GFJ A;  4F5O A;  1N62 A;  2NRX A;  1SZP A;  3BS7 A;  3NTU A;  5EE1 A;  4JUZ A;  5C5J A;  4DQQ A;  2W55 A;  4DQP A;  3KTQ A;  4ELV A;  2HHT A;  4EBE A;  4P0Q A;  3WKC A;  5KT5 A;  2JZB B;  2BCQ A;  1ZQW A;  2HI0 A;  5KG3 A;  2KOB A;  2ES6 A;  1IIP A;  3SAF A;  1S10 A;  4F5R A;  2A3V A;  4R8U A;  4M6W B;  4M0A A;  3NVZ A;  1ZJM A;  5J0X A;  4J9K A;  1L3S A;  1N5W A;  4M9G A;  1PK3 A;  2AGQ A;  1T8E A;  4MEY A;  1Q3U A;  5F3X B;  8ICI A;  3Q8P B;  5IIL A;  1FO4 A;  1IG6 A;  4JWN A;  2F3N A;  2D6F C;  1ZRN A;  3BJY A;  1FFU A;  1QCK A;  8ICJ A;  3K1Z A;  3IV6 A;  2CRX A;  5ALQ A;  7ICH A;  2KFZ A;  1RZT A;  4Y2Q A;  7ICE A;  3UMB A;  5ALF A;  5DG8 A;  4DSE A;  1JN3 A;  5EWE A;  4EEL A;  4PHA A;  3DEE A;  5KFA A;  1KFS A;  1XO1 A;  3S6J A;  5DBB A;  1ZQE A;  2F8K A;  2G07 A;  3UQ0 A;  3SI8 A;  3TI0 A;  3RBE A;  3MR5 A;  3QXG A;  3BZK A;  4BWM A;  4UBB A;  3KOO A;  4GC6 A;  2QLT A;  5KFH A;  3FM9 A;  4P4P A;  4DCC A;  4QJF B;  3THV A;  3WK4 A;  2KE7 A;  2RDI A;  1U4B A;  2YB4 A;  1Y88 A;  1UT5 A;  2C28 A;  2ASL A;  4EBD A;  4C80 A;  3NGD A;  3U26 A;  4F5P A;  2LYH A;  5J2K A;  1F44 A;  4EYH B;  2NO4 A;  2GLE A;  5KL1 B;  3V7L A;  5CEH A;  4CRX A;  2LPE A;  2HBM A;  1ZYQ A;  4KN7 A;  4PHD A;  3D2N A;  2BCS A;  9ICM A;  4O5K A;  4BX9 C;  2E5S A;  4C4T A;  1BPY A;  2H3Q A;  4K4I A;  4DF8 A;  3NAS A;  4RQ4 A;  4EYI B;  5AKH A;  1ZQR A;  2XVT A;  1RYR A;  4EBC A;  4DFM A;  5KFN A;  4US8 A;  1RXV A;  4EX7 A;  4B9T A;  4Q8F A;  2EAM A;  5KG5 A;  3TAC B;  5J0R A;  3ZDB A;  1CRX A;  1U47 A;  1RDF A;  1X40 A;  1TK8 A;  1FIQ A;  5KFO A;  4KLU A;  5ALZ A;  3HKZ F;  3EZ5 A;  2KMD A;  2GH1 A;  4F5Q A;  9ICX A;  1KSP A;  4OJL A;  3MR6 A;  1S5L U;  3K4G A;  7ICK A;  2OWO A;  7ICJ A;  4MEX A;  3UM9 A;  3KKA A;  4DFK A;  1U9L A;  1TV9 A;  5J2G A;  2BCV A;  4CNQ A;  2V4Q A;  2HHV A;  2NRZ A;  2HVI A;  1RXW A;  5L1L A;  5EWG A;  3JPT A;  7ICI A;  1COO A;  1FEZ A;  2WB1 F;  2W9C A;  2Y9T A;  2NO5 A;  3QX7 A;  3FC4 A;  5AKL A;  4Z6D A;  2KFN A;  2GWS A;  3Q8K A;  5ALH A;  5AKE A;  3AQF A;  4Y2P A;  2N1R A;  9ICG A;  4RZR A;  5DB7 A;  2EZX A;  4ED8 A;  4OD0 A;  1BGX T;  2C22 A;  2CN1 A;  4IQW A;  4RQ1 A;  2KN7 A;  5ALO A;  3ISC A;  4UB6 U;  5AK3 A;  2AHO B;  1T3Q A;  2F44 A;  4QW8 A;  4ELU A;  2XGQ A;  4PGY A;  8ICV A;  4OJ6 A;  1ZQQ A;  2RQ5 A;  3V7K A;  1X9W A;  9ICL A;  2KK0 A;  3OGU A;  3Q8Q B;  1X2I A;  3QUC A;  2EH9 A;  3KHR A;  1BNP A;  5KFX A;  2P35 A;  3CYM A;  7ICF A;  5JUM A;  2IOF A;  4DOC A;  2XY5 A;  1KQQ A;  3Q8M A;  2KZM A;  3WKA A;  4I2G A;  2O6K A;  2WF9 A;  4C7Y A;  5KFR A;  4RQ2 A;  4KLH A;  1A77 A;  1NNL A;  2DPI A;  8ICE A;  3N7S C;  1ZRM A;  3E58 A;  4AYB F;  3HKZ C;  5L1K A;  2GOL A;  1WWU A;  2W54 A;  2WTF A;  3IRU A;  1OXJ A;  3F2D A;  2W3S A;  4QWB A;  3RH6 A;  3Q8R B;  1ZQJ A;  4FZL A;  5CR0 A;  2OHF A;  3HWT A;  1S9F A;  5KT7 A;  2NRW A;  4JB3 A;  1DXS A;  3QU2 A;  1AQ6 A;  1X42 A;  1UCV A;  4DF4 A;  4YXM A;  2Y1J A;  2WB1 C;  5DB8 A;  4ED3 A;  2H5X A;  2RP5 A;  3F5E A;  4ECR A;  4PZN A;  3OHA A;  1ZET A;  2VA3 A;  1ZQD A;  1ZQZ A;  2QAR B;  7ICP A;  4ELT A;  4KLM A;  2AGO A;  2HOI A;  9ICS A;  1NK8 A;  2HBK A;  4RNN A;  1DRG A;  4O3P A;  2AGP A;  4JV2 A;  2LM1 A;  2BGW A;  3PML A;  2D8C A;  2HHQ A;  3KKA C;  4UB2 A;  2XO7 A;  1N61 A;  1Z00 B;  5J2J A;  1S0V A;  4ECT A;  4KLF A;  2LHT A;  4QZH A;  2FLN A;  1XSP A;  2G0A A;  2OM6 A;  4YR2 A;  3GQC A;  3M9N B;  4BDP A;  1XSL A;  4UB3 A;  5AIC A;  2F2A B;  3QU9 A;  4ECS A;  5L1J A;  3SYZ A;  2HBL A;  3MDC A;  4YMM A;  2E1E A;  4QZA A;  5D49 A;  1NJY A;  1WUD A;  5ALM A;  5AKZ A;  1IXR A;  2EAO A;  4AYB C;  1PK1 A;  4YN4 A;  5AM5 A;  3RB3 A;  1HUO A;  4YMO A;  2LKY A;  1S8O A;  1L7O A;  4J9N A;  4FO6 A;  1SL0 A;  3LVV A;  5AHX A;  4NM2 A;  4NLG A;  4QZD A;  1SWV A;  3H0L B;  2K8C B;  4J9S A;  4MFC A;  4USA A;  5J0O A;  3PW2 A;  2ZTE A;  2G5H B;  4GC7 A;  5DLG A;  1QQ7 A;  2XI9 A;  3B9J A;  3PSP A;  3QUB A;  3KHH A;  2UVR A;  2CPR A;  2XIC A;  3GIL A;  3SMV A;  4F2R A;  2PXI A;  3RR8 A;  3C1Y A;  1X9S A;  1QTM A;  3I28 A;  5AI5 A;  1BPZ A;  4C8K A;  2W7O A;  2XCP A;  8ICO A;  4KLO A;  5DB6 A;  5ALN A;  4YP3 A;  3SR6 A;  5AKJ A;  5ALD A;  2KHQ A;  3M1Y A;  4NL9 A;  2V9W A;  3PX6 A;  5HHI A;  1ZQV A;  3GV5 B;  3IN5 A;  1TVA A;  2JR5 A;  3H8S A;  4YQW A;  8ICP A;  2W7P A;  5J0S A;  2BHN A;  8ICB A;  2JH1 A;  2ZJA A;  3GV7 B;  3OHB A;  3BQT A;  1ZQO A;  5DKW A;  4CGZ A;  3DV9 A;  5IIN A;  9ICA A;  7ICO A;  4OJO A;  1KEJ A;  2W9C B;  3QNM A;  4XRH A;  3KBB A;  3HRD D;  4O5E A;  3WK9 A;  1UHU A;  1Z1V A;  4ECQ A;  1SV4 A;  3EUB 2;  2MSN A;  1NZP A;  2FMP A;  4OJ5 A;  4ECZ A;  5ALV A;  4B9L A;  1TAM A;  2BCU A;  2D3D A;  1ZQA A;  4I2I A;  4J03 A;  1S0M A;  4O5C A;  2YML A;  2KZ3 A;  2ZIU B;  5L9X A;  4BJQ A;  2PMZ F;  5AKI A;  3GV8 B;  2NRV A;  4I2B A;  1N63 A;  2LM4 A;  4NLZ A;  4RQ0 A;  3HJE A;  4PJ0 U;  3E0F A;  5KFY A;  4QZG A;  9ICK A;  1QQ6 A;  1N2X A;  3RJF A;  2JEG A;  1CEZ A;  4KLL A;  1J97 A;  9ICN A;  1YT3 A;  5KT3 A;  1ZQT A;  3AU2 A;  2KG5 A;  3OSP A;  2HHX A;  1UPH A;  4DQR A;  2W9B A;  2HW3 A;  2FE9 A;  3CW2 C;  9ICF A;  1ZXI A;  4P4O A;  4OJP A;  1NK7 A;  4DSI A;  1A6S A;  2JRZ A;  2OH2 A;  5ALU A;  9ICO A;  4DL6 A;  4YXJ A;  3NS1 A;  2VJ5 A;  4RU9 A;  3AUO A;  2EAP A;  3SEI A;  4PPX A;  5AIB A;  2DL0 A;  1UQV A;  5KFQ A;  2K8A A;  4NLN A;  3TKA A;  5KFS A;  2HOF A;  4F2S A;  5AKY A;  1L3T A;  1D8Y A;  5J29 A;  5AI0 A;  1MSW D;  5T14 A;  2XGP A;  3C1Z A;  2RRD A;  4C8O A;  2ODG A;  1LV5 A;  3C29 A;  3DDH A;  5DBC A;  1JI7 A;  1URJ A;  2ASD A;  5KFK A;  2FDR A;  5KFU A;  4UQG A;  2C2E A;  3ALR A;  1L7N A;  3MGV A;  2VA2 A;  4F5N A;  1TK5 A;  3IG8 A;  3JPO A;  4ECX A;  3R9K A;  1D9F A;  3LWM A;  5KFG A;  2VIX A;  1TAU A;  4P0P B;  5DGB A;  1ZD5 A;  4NL9 C;  1KN5 A;  5AI8 A;  5CP2 A;  5CHG A;  3HP6 A;  4TQR A;  5KT6 A;  2PMZ C;  4LZG A;  4J9M A;  3N28 A;  5HR6 A;  5DLF A;  4DL4 A;  4J9R A;  3A0B U;  4PHE A;  3EPI A;  4FFD A;  9ICB A;  2K4P A;  5DB9 A;  4OCZ A;  1PVQ A;  4UAT A;  1ZQH A;  2ZIV A;  4DEZ A;  5IIO A;  1BPE A;  2KIV A;  4O9M A;  5J0Q A;  3MFH A;  1LKY B;  2DKX A;  4R65 A;  1FFV A;  2CXY A;  4Y2V A;  5KFE A;  3LK9 A;  2IOH A;  1VJ5 A;  1V9P A;  4TUP A;  3PZP A;  1KKX A;  1B43 A;  4IS7 A;  3HW8 A;  3RRG A;  4UB4 A;  2XCA A;  3E2E A;  1O08 A;  2BPF A;  2NYV A;  4F92 B;  5HR7 A;  4BXO A;  1A76 A;  5J8Y A;  3H4B A;  4I2D A;  1DOQ A;  3PSI A;  3PX4 A;  2KTQ A;  4ECV A;  4CF4 A;  2ZG6 A;  4MF2 A;  3WKD A;  2E1F A;  3PNC A;  2FI1 A;  1S0O A;  4I27 A;  3TAN A;  4DFD A;  1QSS A;  2ZIX B;  2B21 A;  3M6K A;  3QU5 A;  3AU6 A;  2HVH A;  5ALL A;  1Z4N A;  2ZIW A;  1XC9 A;  1L7P A;  5EE9 A;  2AQ0 A;  1RQL A;  2K4H A;  3MR2 A;  5KFL A;  7ICQ A;  3V7J A;  5GTH U;  3B0X A;  3BDP A;  4KLJ A;  3RAX A;  2A19 A;  4KIT B;  4TUR A;  3NRW A;  2P6R A;  4UAZ A;  2H3F A;  3ISB A;  4RPX A;  2HHU A;  1S97 A;  2PI5 A;  3I76 A;  2FMS A;  5AM4 A;  5DQH A;  1F5S A;  4Y2J A;  4UB5 A;  1BPD A;  3G6X A;  1BPX A;  8ICZ A;  4J9L A;  3T79 A;  4RQN A;  1SGG A;  5HMM A;  2DBY A;  5KG2 A;  4UAU A;  2ZUC A;  2AQ4 A;  2UVV A;  4DL3 A;  2HOQ A;  3T5J A;  1T7P A;  5AM2 A;  4US9 A;  1RQN A;  5J2F A;  2QB0 B;  4I28 A;  1RG6 A;  4O3N A;  3N4M B;  8ICF A;  3N97 B;  4ECY A;  1ZD3 A;  3V6J A;  4KMO B;  4GIB A;  3A0H U;  3MDA A;  3PW7 A;  1ZQS A;  1DGJ A;  2B6G A;  5AK5 A;  4DSF A;  2KV2 A;  3I1Y A;  2LI6 A;  4F50 A;  2JEI A;  1PVR A;  3OTQ A;  2PFP A;  8ICY A;  4YVZ A;  2I9G A;  5ALP A;  3UPQ A;  2G06 A;  2K4I A;  3EPG A;  1VLB A;  3N7R C;  4ACO A;  7ICU A;  1D8B A;  2KKP A;  2IA6 A;  2WAQ F;  4F4Y A;  1C20 A;  2A1J B; 
#chains in the Genus database with same CATH homology
 1X9X A;  1PK3 A;  1F0M A;  5F3X B;  1SV0 A;  2EAM A;  2Y9U A;  1JI7 A;  3TAC B;  2F3N A;  1V38 A;  1Z1V A;  2JV3 A;  1SV4 A;  2EAO A;  3BS5 A;  1X40 A;  1PK1 A;  1SXE A;  1WWU A;  1OXJ A;  2KSO B;  1X66 A;  2D3D A;  2KMD A;  2QB1 A;  3IDW A;  4NJ8 A;  1V85 A;  2E8M A;  3TAD C;  4NL9 C;  2EAN A;  2QKQ A;  2ESE A;  3HIL A;  3KKA A;  1OW5 A;  5JRT A;  1DXS A;  5KNI A;  2E8P A;  1UCV A;  2KSO A;  2E8N A;  1B4F A;  2K4P A;  2DKZ A;  4RQN A;  1B0X A;  1SGG A;  4RQM A;  3H8M A;  2Y9T A;  1PK1 B;  4MHV A;  2F8K A;  1SV0 C;  4PZN A;  1WWV A;  3BS7 A;  4PZO A;  2KIV A;  2QAR B;  2KG5 A;  5L1M A;  1SXD A;  2QB0 B;  2K60 A;  1LKY B;  2DKX A;  3K1R B;  5JTI A;  1RG6 A;  2KE7 A;  3BS5 B;  5J8Y C;  2FE9 A;  5JU5 A;  3SEN A;  1COK A;  3BQ7 A;  2F44 A;  3TAD A;  2B6G A;  4NL9 A;  2QAR A;  4IS7 A;  2D8C A;  2ES6 A;  2E8O A;  2GLE A;  3KKA C;  2QB0 A;  2EAP A;  1LKY A;  3SEI A;  2YTU A;  2LPE A;  2LMR A;  2DL0 A;  1UQV A;  2L5Y A;  5J8Y A;  1KW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...