3KFUF

Crystal structure of the transamidosome
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
453
structure length
447
Chain Sequence
MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGERRVRIKRLHLEEDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEILRRGEKVKQATMGFEEGSGKTYPMADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
total genus 111
structure length 447
sequence length 453
chains with identical sequence I
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kfuF02
2G5IB 2D6FC 1ZQ1C 3H0MB 2G5HB 2DF4B 3KFUF 2F2AB 2DQNB 3H0RB 3IP4B 4WJ3B 3H0LB 3AL0B
chains in the Genus database with same CATH superfamily
1WWUA 2W3RA 3ZDAA 4FE3A 4B9LA 2XY6A 3ONNA 1KKXA 2ES6A 3N97B 2AHOB 4DEZA 3QU9A 5K4LA 2KSOA 5J0SA 4BDPA 3QUTA 1N60A 4Y2PA 4IQTA 1QQ6A 4BWMA 2C22A 5J0OA 1JROA 2KZMA 2W3SA 4TQRA 1BPEA 9ICQA 2RLTA 2Y9UA 2ZXHA 4EENA 2DPIA 4F4YA 2KG5A 4AYBC 2E8NA 1N2XA 2KNJA 2ZIWA 1SIJA 1NZBA 1ZQRA 2EAPA 4DSEA 1NK8A 4UB3A 2K4IA 4P0QB 4B9MA 4LZGA 1DXSA 2JZBB 2M0NA 5ALYA 4YXMA 4KLGA 4RQ8A 4Y2SA 2YB4A 5DBCA 1ZQ1C 2V9WA 1JXLA 2F1IA 2LMRA 1S9FA 1UQVA 3MC1A 4C80A 2HHSA 2E1FA 4BJQA 3HP6A 4C4TA 2F3NA 5AI0A 8ICIA 2VA3A 3Q8RB 2WAQC 5EWFA 9ICFA 4AYBF 3V7LA 4BWJA 4UW9A 1PUZA 5KFZA 4MFAA 5KG0A 2I5HA 1SXEA 3SZ2A 3PX0A 3B0YA 1X9XA 1V9PA 4KLDA 1N63A 2FMSA 2EZXA 4FZNA 5KG7A 4G3IA 3JPSA 4GXJA 3RF9A 5ALFA 5JRTA 4QW9A 3ED5A 4O3OA 5BOLA 8ICAA 1Z4OA 4KLIA 3CYMA 5EWGA 1XSLA 1XNSA 4RQ3A 3SD7A 2W9BA 9ICAA 4Z6EA 4DLGA 1ZQTA 1ZQXA 1FEZA 2G0AA 5CB1A 4YMMA 1S0OA 1KQQA 5IINA 4O9MA 4QW8A 2HOIA 4ECTA 1ZRNA 5J2GA 2Y1IA 4YD2A 3KHHA 4QZIA 2BQUA 2JRZA 2JH1A 5AM2A 5CWRA 2FJ6A 7ICOA 1WCNA 3AU6A 4UB1A 1SZHA 3FAHA 5KFEA 1MQ2A 4E0DA 2K4EA 5AKLA 1NI3A 5DB6A 1IV8A 5KG4A 2FI1A 3QEBZ 3RTVA 3E0FA 2JEFA 2KVCA 2DKXA 3HILA 1BNPA 3V72A 2IHMA 3H40A 2BKEA 2KHVA 4J9PA 1PZNA 4TURA 2BZFA 4R63A 3TAQA 2ZUDA 4IQWA 3ZDBA 2ZIXA 2FDRA 4F5PA 1ZQOA 4YR2A 2VANA 3C2MA 3M6KA 3OHBA 1TKDA 3UMCA 4DQIA 1TK5A 1JALA 3TKAA 1S0NA 2F8LA 2FPKA 4KLSA 1B0XA 3M9NB 2F8KA 5KFTA 3ISCA 5KFIA 1AROP 1U49A 3TANA 3OHAA 8ICLA 1FIQA 4YMOA 3KZXA 1JUDA 1CRXA 4PPXA 4I2FA 1XO0A 4F50A 2MSNA 4MFFA 1WG8A 2HHWA 4C4SA 3WK5A 3F2BA 1NK7A 5AKKA 1HIWA 5KFNA 3F2DA 4I29A 1FFUA 2BDUA 3SMVA 3QU4A 2YX8A 1D9DA 3PX4A 1FO4A 3WK7A 5AKZA 5DG7A 3LK9A 3PW5A 2C2RA 2IOFA 1LV5A 2AGQA 3NASA 1B4FA 4NXZA 1Z00B 2P6UA 5KAIU 2JXJA 4OJLA 4BUGA 5F9NA 1D8LA 5AM3A 3ISBA 1TAUA 1PK3A 2W9CB 3JPNA 4ED1A 9ICKA 5G5GA 3LDAA 1URJA 2RDIA 3OSNA 5DQHA 4Y2JA 2BPFA 2G5HB 4GXKA 3QZ7A 1VLBA 5ALKA 3Q8QB 1N48A 1Z4NA 4PZOA 2XICA 4C8NA 1ZQZA 3NS1A 1ED1A 2XY7A 4EX6A 2ZIVA 3H0RB 2AU0A 1ZQSA 3HJEA 2QB1A 3V7KA 4NM1A 4O3SA 1U9LA 4M2YA 4F4ZA 4Z6DA 4EEKA 4F8RA 5HP4A 4YMNA 2KV2A 3QUBA 1A77A 4M6WA 1T7PA 2C2EA 4J9NA 3PR4A 4LZDA 4RUAA 5C0YA 2HCFA 4RPYA 3QNMA 2JEIA 1BPBA 4KLQA 2H3FA 4OCZA 1Z1BA 4OJPA 4OJOA 1XSNA 3GFKB 3AQFA 3KHLA 5EOZA 1EXNA 3T79A 2XCPA 5T14A 5HMMA 2FMPA 4U7CA 4US8A 4J9MA 4F72A 2DQNB 4XUSA 3RAXA 3M9MB 3MDCA 2HI0A 1TV9A 4KN7A 3C1ZA 5KFAA 3KKAC 3UMBA 1P7DA 2W8KA 7ICUA 4TUSA 4DL7A 2VIXA 3MR3A 5DLGA 2Y1JA 3H8SA 2E8PA 5ALGA 1Z3EB 1BPDA 2KEYA 3HKZC 8ICEA 3LVWA 3CRXA 4IRCA 2DKZA 3F5EA 2I9GA 2RDJA 4M9HA 1NK0A 4RPZA 1KW4A 2KICA 4I2BA 3ZD8A 2KP7A 1ZETA 5J0PA 2HVHA 4ECZA 3OJUA 4ECXA 2IOFK 3RH6A 5IIMA 4O3MA 2YMPA 1L3VA 4YXJA 1DOQA 3THVA 4F2RA 4K4GA 2BCQA 2E8MA 4NY8A 4QZGA 4O5EA 2H3IA 2KTQA 2DWQA 3D6JA 1RPLA 4B9TA 4KTQA 1RYRA 3PVXA 4PGYA 1S8OA 2MUTA 1IXRA 4DFPA 1S97A 2R8KA 9ICBA 1PK1A 2E8OA 2YTUA 1UT8A 9ICGA 5EE3A 3TACB 3EWAA 4YVZA 3F5AA 4EYHB 3G6YA 2EAOA 4UB5A 3BJYA 1KL9A 3ZDDA 5ALMA 4EZ6A 3OJSA 1ZJNA 2HBKA 2RQ5A 4EYIB 1MN8A 3PO5A 3SQIA 3M1YA 3V7JA 5KFQA 3AQEA 7ICSA 3RJFA 4F91B 4ECWA 2RP5A 2K8BB 2KHQA 7ICHA 5BPCA 2HDOA 5GTHU 3SEIA 1CEZA 5HMLA 3AN1A 2FPLA 2IBKA 2K89A 2GLEA 4UAZA 1RQNA 4QZ9A 5AKJA 3V6KA 5J0YA 5IIIA 4RQ4A 2W55A 2VJ4A 8ICTA 4PHEA 3QU5A 5AIBA 2Z7JA 4USAA 4DSLA 2OH2A 4ED8A 8ICWA 3NVVA 1ZQQA 2XGPA 4CGZA 9ICLA 8ICOA 1NZPA 3WKCA 4JWNA 2ZXIA 2JEGA 2VA8A 4PZNA 2DGZA 1NJZA 4M47A 2JR5A 1DK2A 1UHUA 4DS5A 4UAVA 1ZQNA 3C29A 1ZQGA 2OEHA 2ALZA 1HJPA 5CEHA 8ICGA 3B0XA 4UBBA 2I1QA 3WK9A 2W04A 2ZIXB 4O5CA 5DQIA 1S0MA 9ICOA 4YR0A 5IILA 2JEJA 3FYHA 1S5LU 4DS4A 4DSKA 1XO1A 3JPOA 4UB6U 2E1EA 3RRHA 5JTIA 4UAWA 2I6XA 3NUQA 4IR1A 1O03A 2D3DA 4C8LA 2JH7A 3OSPA 1WUDA 4ELTA 2QB0B 1TVAA 4CNQA 1KN5A 3SAFA 4RQ1A 1LB2B 3FC4A 3DEEA 3SAHA 4GXIA 1BPYA 1ZQKA 4MF8A 8ICNA 1J2NA 5AKIA 3AU2A 3T5HA 4DOBA 4I2GA 3C21A 3RB3A 4F4KA 4UASA 1ZQYA 4QZEA 1UA1A 5AK4A 2AXTU 4ELVA 1ZJMA 1CUKA 4ED6A 2YY6A 4NLBA 2R8GA 2MRLA 8ICQA 4ED0A 3QZ8A 4NM2A 1X2IA 2BCUA 2XO7A 5L1MA 1MQ3A 5BOMA 4RQ5A 3HW8A 1UPHA 5KT2A 4KX3A 2B0CA 4Q45A 2MAXA 5E79U 3SENA 7ICGA 4F2SA 1ZD2P 4KLTA 3CNHA 5ALRA 2BGWA 2BQ3A 2BCVA 1BGXT 2PI4A 4DQQA 1X9MA 3EUB2 5J2FA 2K4HA 2XC9A 7ICPA 4DFJA 2HBMA 4Y2XA 2NYVA 4RNNA 4QWEA 1X9SA 4P4MA 2HVIA 2A1AA 3D2QA 4RQMA 4TUPA 4RQ7A 2VA2A 3GV8B 2K4PA 3QX7A 2F77X 3RBDA 2LYAA 5A0LA 7ICLA 2BPGA 9ICXA 5DQGA 2BHNA 1L3SA 1JMSA 1X66A 4QWCA 3GIMA 2NRWA 5EWEA 2W43A 4CF3A 3QU7A 2LHTA 2EQYA 3MABA 9ICWA 1N5XA 2D8CA 3WK8A 1JIHA 4RUCA 3WK4A 4QZCA 4O5KA 2W8LA 5DBAA 2O6KA 3KFUF 3BQ1A 4FBTA 5L9XA 2MUTB 2QARB 2LM4A 2W54A 1F0MA 7ICKA 2EDUA 4OO1J 8ICKA 2FLNA 2JV3A 4ECYA 3MFHA 4YR3A 1KDHA 3ISDA 5DB9A 2ZJ5A 1OUQA 5HR7A 5AK5A 2PFPA 2RHFA 2IOHA 5KFPA 4RPXA 3K4GA 3ORYA 9ICMA 4MF2A 1NKBA 1T3NA 4KLLA 3F2CA 4Q8EA 5ALJA 2A19A 5KFCA 4JV2A 4KLJA 3JPQA 5AKXA 4P0PB 3GZFA 3E58A 3A0BU 5B5EU 5KNIA 1K5OA 9ICCA 4DSIA 3ZI4A 5KL8B 4UB2A 2KJ5A 2HHTA 3KD3A 4M6WB 1J97A 4KMOB 3VC8A 5AI6A 1MSWD 4A8EA 4BXOA 3N7SC 4ED3A 3H0LB 4OJ6A 5DKWA 3RJKA 5J0QA 2ZTCA 5IIJA 4I2AA 5EE1A 5DGAA 4HYKA 5KT7A 4CDGA 4F71A 2FLLA 3NTUA 2KIWA 9ICSA 4NJ8A 5DG9A 1C20A 4UARA 5H2FU 4JV1A 3AMZA 4KMUA 4O3NA 3QXGA 2A3VA 5CA7A 4I2JA 5EE0A 4YQWA 2DBYA 8ICRA 4PL2A 3H0MB 3IDWA 4I2EA 2ZIWB 3T5LA 4GLXA 1K1SA 1JRPA 1ZD5A 5HHHA 2EH9A 1S10A 7ICJA 1QQ7A 3G6XA 3RJHA 2ASJA 3UXNA 1L6NA 5CJ7A 5KT3A 1BNOA 9ICUA 4I2DA 7ICTA 4NL9C 1U48A 1B43A 4MHVA 4UB8U 1COKA 4MFCA 2LI6A 9ICTA 3BS5B 3I28A 3M7DA 9ICVA 2G08A 4DF4A 5J2JA 3RFAA 3RJEA 4FZLA 3EZ5A 4Q43A 3J81j 2J6TA 4YP3A 5IIOA 4F4XA 4F3OA 2EAMA 4UAYA 1ZD4A 2BCSA 4M9LA 5KFUA 2JZBA 5KFLA 4DL2A 1L5UA 4JB3A 3KHRA 4J9LA 1BVSA 1TE2A 1YZ6A 4YFKA 3LVVA 5AI9A 5KT6A 4F92B 4IRKA 1NK4A 4TUQA 4DLEA 1LKYB 1ZQLA 3RB0A 4IL6U 4C0ZA 1ZQPA 1COOA 5KL1B 4DFKA 3AL0B 4LVSA 2L5YA 4QZFA 3HKZF 1U4BA 1NKCA 3EPIA 4RQ2A 3F53A 1SL1A 1A0PA 2HHXA 4JUZA 4R64A 3S6JA 3PX6A 4J9RA 1RZTA 3K1ZA 4CE6A 4UBCA 4PGQA 4BXOB 4DFMA 2H3VA 1ZQDA 4Q8FA 4XQ8A 1K1QA 4F5QA 4R66A 1Z00A 3LWLA 5J2IA 2ZJ8A 2LKYA 4P2HA 2R8HA 4DOAA 4YN4A 3PW4A 5J29A 3M8RA 4DQRA 3IV6A 7ICRA 5KFGA 2NRZA 4DL6A 4R8UA 4CF5A 3DV9A 1WYGA 1RG6A 1L7NA 5HR6A 3NVYA 1QLNA 2DL0A 1BPZA 3H8JA 2G5IB 3FM9A 2BDPA 3PMNA 1QH9A 2HSZA 4J9KA 4NLCA 3Q8LA 1Z19A 9ICHA 3PSIA 1XC9A 2KE7A 5ALWA 3ETLA 3IP4B 2JMGA 2PXIA 3MBYA 5DDMA 3OPXA 5KFFA 3TADC 2F1JA 2GOLA 2BCRA 2K8CB 4QZBA 4DFDA 2H3ZA 3HT3A 5JUMA 4X5VA 2HMXA 1ZQHA 3BQTA 2ZTEA 3U26A 3BS7A 4DL3A 4Y2VA 4ZH4A 2JGAA 3V6HA 3MR5A 2ISPA 3I1YA 9ICEA 4DQSA 5KFDA 4Y2TA 5KFXA 3IG5A 4ICAA 3IN5A 3L4PA 3AEVA 3SI8A 1TAQA 1RQLA 1ZQBA 4HAIA 3JPPA 1IM4A 3IM1A 3MGIA 3SV3A 1ZQAA 5ALIA 1JX4A 1A6SA 2PFQA 1QQ5A 1QSSA 3BZKA 4Y2UA 1VDVA 1Q8KA 3NVWA 1ZQUA 4EBEA 2XGQA 4EBCA 4F5OA 2DPJA 5CR0A 4XA5A 3TFRA 4KX5A 4CCHA 3QEAZ 9ICIA 8ICMA 3OGUA 3JPRA 2UVUA 1D8BA 8ICSA 4GFJA 1U45A 3NVZA 3BDPA 4B6JA 3V6JA 2PI5A 4Q44A 2VKQA 3BZCA 3GDXA 2OHFA 2FMQA 3OTQA 2LYBA 2KIVA 4WJ3B 1Z1VA 5ALXA 3LWMA 3RR7A 2AQ4A 3B9JA 2WTFA 4IRDA 4US9A 1SXDA 1XWLA 5ALDA 5J8YC 7ICEA 3C2KA 1NNLA 5ALLA 4DL4A 4RU9A 1RYUA 2CPRA 3RBEA 3PSTA 4P0QA 4QIWC 2ZTDA 3HPOA 1L7MA 3SV4A 2IHNA 1JI7A 3A0HU 3RH4A 5DGBA 2Y0SC 3RB4A 3RJIA 3M8SA 3CW2C 2KOBA 2F2AB 5ALNA 2KJ9A 4JWMA 4NLZA 3MGHA 4CRXA 7ICQA 4GC7A 4ECQA 4J9OA 1L7OA 3RRGA 3N7RC 1DGJA 2PMZC 3ICXA 3L5KA 2YMMA 4KLFA 3H8MA 2ODGA 2HW3A 5KG5A 2OWOA 8ICXA 5KG3A 5J2HA 4ECUA 1ZQJA 3UM9A 5DDYA 2QKQA 2W03A 4DCCA 1HUZA 3M6ZA 3O0FA 1DRGA 5DBBA 4YD1A 3UXOA 5DB8A 2F44A 1SV0C 3GIJA 2BQRA 5J0TA 2WF8A 4O3PA 1XSPA 1RDFA 2QARA 5ALPA 4EZ9A 2G09A 1OXJA 3PW0A 2B21A 3TAPA 5DLFA 1TK0A 1UA0A 4Z6FA 7ICMA 5ALVA 2EZYA 2YMLA 4KLMA 2C2DA 1N62A 1SGGA 4I2CA 2NRVA 3DDHA 1DGSA 4QWBA 2R18A 3PW2A 3AM9A 4G9BA 4R65A 2LPEA 2C28A 2DFLA 4RQNA 1RYSA 3D2SA 4B9NA 5ALUA 1ZQIA 1S0VA 3QUCA 1NK9A 1ZOLA 4UB4A 3H4DA 2VJ5A 2P6RA 1FFVA 5CRXA 2LYHA 3H4BA 2F1HA 4CF4A 5KFJA 1C7YA 3PV8A 1D9FA 4B9VA 1BPXA 2R8JA 3PO4A 1T3QA 3QYPA 4OD0A 2ATLA 1ZD3A 3KTQA 5J0UA 2A1JA 5AIAA 2ZG6A 1NOMA 2KSOB 5KFOA 2KKPA 3WKDA 2NV3A 4QZAA 4KLEA 5KFWA 5KTQA 4KITB 5DG8A 1O08A 2M9NA 1NJYA 3MR2A 2WAQF 3GV7B 1N5WA 5AICA 4FS1A 2P66A 2IMWP 1YZ7A 5J0XA 2NRTA 1ZQEA 1T8EA 4UQGA 2ASDA 4M9JA 1ZXIA 3WKBA 2KZ3A 3HX0A 4P0PA 5AHXA 1KFSA 3QUQA 5ALOA 2KKVA 1UCVA 2H5XA 4FBUA 2RRDA 1ZRMA 2YQEA 1X40A 3T5KA 3IHQB 2KJ8A 4AP9A 5L1JA 1S77D 5AKYA 1Q3UA 7ICIA 2AH5A 8ICBA 4IC9A 2ZIUA 4J9QA 2GO7A 4QZDA 4UATA 2W9MA 4IS7A 1IG6A 4FFDA 4MEYA 3C28A 4QZHA 4NLNA 3PSFA 3UPQA 5G5HA 4DOCA 5AK6A 8ICZA 2OCEA 4C8KA 1Q46A 3PY8A 2ZIUB 1D8YA 5C5JA 5F9LA 2YMQA 2BPCA 2PFNA 1SV4A 2XIDA 3SYZA 4RQ6A 1SL0A 8ICPA 1X42A 2CN1A 1N61A 3NGDA 2AGOA 3PNCA 3UQ0A 2F76X 3KZIU 2PKEA 5EE9A 4PHAA 1RXWA 3PSPA 2FE9A 1VJ5A 5AM1A 4KN4A 5AI4A 2JHDA 3RAQA 3L3FX 2YB1A 3MDAA 9ICPA 2NRXA 1TAMA 3CP8A 5J2CA 1LKYA 2ZIVB 3TADA 1SZPA 1B22A 2J6SA 3D2NA 3C2LA 1H38A 3C23A 5TZVA 5HNKA 2ZUCA 3WKAA 4MEXA 2W11A 4J9SA 2W9CA 4PH5A 4Y2YA 2ISOA 3RH5A 5HHIA 3VCBA 8ICHA 9ICJA 3UMGA 2OM6A 3QU2A 2E5SA 1ZQMA 4FO6A 1OW5A 1HUOA 5L1IA 1LVHA 4PL1A 4ECRA 4EELA 1TK8A 5J2KA 5ALSA 2CXYA 1SKSA 8ICJA 4M9NA 4C7YA 1KSPA 2GWSA 5KT4A 3BS5A 2P35A 4DSFA 4ECVA 2ZJAA 3ZDCA 2WF5A 4DL5A 1NK6A 4QIWF 1KEJA 3KOOA 1HEKA 4DSJA 2Y0SF 3PW7A 2HHUA 5ALZA 1L7PA 3Q8MA 3BQ0A 2CRXA 1V38A 5D49A 5D46A 4RNMA 4M0AA 1SWWA 1SWVA 2Q0ZX 1L3UA 3GIIA 4ECSA 1SB3C 4KLHA 3I76A 1ZQFA 3SR6A 2IA6A 3Q8PB 4F5NA 1XS9D 4DWIA 3KBBA 4O0IA 3Q8SB 4Y2QA 3TARA 4M9GA 2XY5A 2H3QA 2WF6A 3ALRA 1X6IA 2UVVA 5J0RA 1UT5A 4GIBA 5AM4A 4R8UB 2DUYA 4RNOA 2W7PA 1ZQCA 3FDSA 1KRPA 3N7PD 2EANA 5TISU 1KLNA 4RZRA 2R8IA 1Q3VA 3ZD9A 4K4IA 4NWIA 2WF9A 3RJJA 5J8YA 4F5RA 4ZOHC 2KFNA 3GIKA 3JPTA 4O3RA 1N56A 4QNLA 1X9WA 2BR0A 2KMDA 3E2EA 4DF8A 3IG8A 1SKRA 1KFTA 1TFRA 3K1RB 2V4QA 1L8LA 2KZZA 4IQVA 3RB6A 3KHGA 7ICVA 5KG6A 9ICRA 4DQPA 5J2AA 2KFZA 2AGPA 8ICUA 2WFAA 3H7IA 3EYZA 1S76D 5AI8A 4OJ5A 4NL9A 1KBUA 5IIKA 2AQ0A 4KLUA 3H8WA 4IQUA 3C1YA 4C8OA 1JN3A 5CP2A 1QSLA 5ALQA 3WKEA 3PZPA 4RT3A 1ECWA 3UXPA 3WU2U 1YT3A 4O3QA 3NRZA 5AKGA 3BQ7A 3G6VA 2KK0A 3GV5B 2KN7A 1PK1B 2B6GA 5KT5A 1F5SA 5B66U 3HWTA 4QZ8A 4ED2A 1Y88A 2E3TA 2D6FC 4NLKA 1DK3A 1QTMA 1KFDA 4PJ0U 4DO9A 3C5GA 5KFSA 5ALEA 5AM0A 1NJXA 5D4BA 4ACOA 1PVPA 4YG2A 2UVWA 1F44A 1WWVA 3R9KA 3WK6A 2WF7A 2FLPA 4Z6CA 2PFOA 4BX9C 1MA7A 1JXEA 4RT2A 4RQ0A 1NJWA 2WHEA 2K8AA 4ELUA 3BQ2A 1CI4A 4XRHA 4NLGA 2HOQA 3PR5B 3N28A 4I27A 2KVSA 4EBDA 2MU2A 5AI5A 4C8MA 2QB0A 2N1RA 4P4OA 3EW9A 5GTIU 5KAFU 2MA1A 1AQ6A 4GC6A 3T5JA 2XI9A 1RXVA 1L8OA 5ALTA 2KD1A 4PGXA 8ICVA 4JV0A 1MC8A 3MFIA 2LBOA 2W9AA 5J2BA 3EPGA 1M6YA 4U6PA 1V85A 1GO3F 2YN4A 4F4WA 5KFKA 2XVTA 3T3FA 3RJGA 3TQ1A 5KFHA 3GQCA 2Q4TA 2G06A 2NO5A 2AJQA 2HBLA 2OYYA 3M9OB 3QE9Y 2ASLA 5AKHA 2LM1A 4FZMA 3IRUA 2ZUBA 1PVQA 5L1LA 2A1JB 3K75D 1SV0A 3ZDEA 2WB1C 4QWDA 2HHVA 4QJFB 4PHPA 1SKWA 2HOFA 1A76A 4EEYA 4QWAA 3NRWA 1QSYA 5KFBA 4M04A 3C5FA 2UVRA 5J0WA 4JK1A 4EX7A 5AM5A 8ICFA 2ESEA 1WCLA 3LYSA 2W9BB 4NV0A 3GU3A 1T94A 2G07A 1ZQWA 5J2EA 5KFMA 1XU4A 5J2DA 9ICNA 1ZYQA 4FS2A 8ICCA 4Y2RA 3TFSA 2W7OA 2HBJA 5KFVA 5ALHA 3HRDD 1U47A 4UAUA 4LJXA 4B9SA 2Y9TA 4C4RA 2WB1F 4ED7A 1V97A 3GILA 3AUOA 5L1KA 4I2HA 1SL2A 3RR8A 7ICFA 4F93B 3UQ2A 5DB7A 3MGVA 4J03A 5KG1A 5CHGA 5KG2A 2DF4B 4JMUA 5KFYA 2XCAA 1T4GA 4I28A 2OXOA 1PVRA 5JU5A 2J6UA 3TI0A 4PHDA 1J2MA 2PMZF 4C7ZA 4TQSA 2K60A 4K4HA 5AK3A 3Q8KA 1QCKA 2GH1A 2QLTA 4KLOA 4YCXA 5KFRA 3KKAA 4I2IA 4IR9A 1IIPA 1L3TA 3N4MB 2FPMA 1NK5A 5F3XB 2HHQA 1NKEA 3PMLA 1X6JA 8ICYA 2EZZA 4P4PA 4B9UA 2V4RA 1ZQVA 5FP0A 3SAGA 3ETRA 1RM6C 7ICNA 4BGDA 1KTQA 3MR6A 5AKEA 2NO4A
chains in the Genus database with same CATH topology
3LYSA 2H3VA 4PL2A 4ACOA 3D2NA 3H0MB 3CYMA 4NV0A 1XO0A 1PVPA 2ZIWB 2W7PA 3GU3A 1T94A 4FE3A 2HBKA 3T79A 5T14A 1XNSA 1F44A 3ONNA 3N7PD 2G07A 4U7CA 2LKYA 2DQNB 3DEEA 3F2BA 1Q3VA 2G0AA 3SQIA 4KX5A 4P0PA 4OO1J 1HIWA 3F2DA 4BX9C 1MA7A 2G09A 2KKVA 2W7OA 2HBJA 1L6NA 2BDUA 3AQEA 3SMVA 2K8AA 4NWIA 2YX8A 2RRDA 2HOIA 2RP5A 2K8BB 4NLBA 2KHQA 3VCBA 2MRLA 2HOQA 1D8BA 2OM6A 2KJ8A 1OUQA 2WB1F 5HR6A 2K89A 1DRGA 1P7DA 2JH1A 2E5SA 4GFJA 4QNLA 1Q3UA 5HR7A 2RHFA 4IC9A 2ZXHA 4OJLA 2N1RA 2ZIUA 2VKQA 1UPHA 2G5IB 3IG8A 2VIXA 4AYBC 1SZHA 4BUGA 4KX3A 2R18A 2K4EA 2LYBA 2VJ4A 4PL1A 4NLCA 1Z19A 2KNJA 4WJ3B 3M7DA 2KEYA 2ZIWA 3HKZC 3F2CA 2G08A 3LVWA 3C28A 2MA1A 3CRXA 2Z7JA 3PSIA 1NZBA 3PSFA 3D2SA 3MGVA 3F5EA 2OH2A 2K4IA 4P0QB 3IP4B 3RFAA 1URJA 2M0NA 2JMGA 4FZLA 3E0FA 3OPXA 4P0PB 2KVCA 2G5HB 2DF4B 2XI9A 2KICA 2GOLA 3GZFA 4JMUA 2YB4A 2K8CB 2OXOA 1PVRA 2KD1A 4OJ5A 4CGZA 1ZQ1C 2H3ZA 1KBUA 2KHVA 5KL8B 2KJ5A 2CPRA 2VJ5A 2ZXIA 2ZIUB 5CRXA 2HMXA 2XICA 4QIWF 2K4HA 2DGZA 3PSTA 4P0QA 4QIWC 2HBMA 2E1FA 2LBOA 3VC8A 4KMOB 3SAHA 4BJQA 2PMZF 1HEKA 4A8EA 2ZIXA 4U6PA 3PZPA 4O3MA 1ED1A 1ECWA 2XIDA 2Y0SF 3D2QA 3C29A 1GO3F 2Y0SC 1YT3A 2JGAA 2ZIVA 2XVTA 3N7SC 3H0RB 2GH1A 3H0LB 3LVVA 3M6KA 4OJ6A 2Q4TA 2F77X 2CN1A 2CRXA 2KOBA 2G06A 2F2AB 2H3IA 2KJ9A 2WAQC 2LYAA 2HBLA 1IIPA 2OYYA 2ZG6A 4AYBF 4C0ZA 5A0LA 3IG5A 3O0FA 2W04A 2ZIXB 4FZMA 4ICAA 2F76X 3IN5A 4CRXA 1PVQA 2KV2A 2F8LA 2KKPA 5KL1B 3AL0B 4CDGA 2WB1C 3N7RC 3PSPA 2NV3A 2PMZC 3ICXA 2E1EA 2KIWA 3HKZF 4QJFB 2JHDA 2HOFA 4FZNA 3NUQA 3L3FX 2D6FC 5C0YA 3SAGA 2YB1A 3RF9A 3NRWA 2JH7A 2LHTA 3F53A 1WUDA 1A0PA 1TAMA 2A3VA 3F5AA 2H3FA 3CP8A 1A6SA 1Z1BA 4OJPA 3KZXA 2WAQF 4OJOA 3SAFA 2H3QA 1CRXA 2W03A 3ALRA 3K1ZA 3M6ZA 3AQFA 2ZIVB 3KFUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5I B;  2D6F C;  1ZQ1 C;  3H0M B;  2G5H B;  2DF4 B;  3KFU F;  2F2A B;  2DQN B;  3H0R B;  3IP4 B;  4WJ3 B;  3H0L B;  3AL0 B; 
#chains in the Genus database with same CATH topology
 1WWU A;  2W3R A;  3ZDA A;  4FE3 A;  4B9L A;  2XY6 A;  3ONN A;  1KKX A;  2ES6 A;  3N97 B;  2AHO B;  4DEZ A;  3QU9 A;  5K4L A;  2KSO A;  5J0S A;  4BDP A;  3QUT A;  1N60 A;  4Y2P A;  4IQT A;  1QQ6 A;  4BWM A;  2C22 A;  5J0O A;  1JRO A;  2KZM A;  2W3S A;  4TQR A;  1BPE A;  9ICQ A;  2RLT A;  2Y9U A;  2ZXH A;  4EEN A;  2DPI A;  4F4Y A;  2KG5 A;  4AYB C;  2E8N A;  1N2X A;  2KNJ A;  2ZIW A;  1SIJ A;  1NZB A;  1ZQR A;  2EAP A;  4DSE A;  1NK8 A;  4UB3 A;  2K4I A;  4P0Q B;  4B9M A;  4LZG A;  1DXS A;  2JZB B;  2M0N A;  5ALY A;  4YXM A;  4KLG A;  4RQ8 A;  4Y2S A;  2YB4 A;  5DBC A;  1ZQ1 C;  2V9W A;  1JXL A;  2F1I A;  2LMR A;  1S9F A;  1UQV A;  3MC1 A;  4C80 A;  2HHS A;  2E1F A;  4BJQ A;  3HP6 A;  4C4T A;  2F3N A;  5AI0 A;  8ICI A;  2VA3 A;  3Q8R B;  2WAQ C;  5EWF A;  9ICF A;  4AYB F;  3V7L A;  4BWJ A;  4UW9 A;  1PUZ A;  5KFZ A;  4MFA A;  5KG0 A;  2I5H A;  1SXE A;  3SZ2 A;  3PX0 A;  3B0Y A;  1X9X A;  1V9P A;  4KLD A;  1N63 A;  2FMS A;  2EZX A;  4FZN A;  5KG7 A;  4G3I A;  3JPS A;  4GXJ A;  3RF9 A;  5ALF A;  5JRT A;  4QW9 A;  3ED5 A;  4O3O A;  5BOL A;  8ICA A;  1Z4O A;  4KLI A;  3CYM A;  5EWG A;  1XSL A;  1XNS A;  4RQ3 A;  3SD7 A;  2W9B A;  9ICA A;  4Z6E A;  4DLG A;  1ZQT A;  1ZQX A;  1FEZ A;  2G0A A;  5CB1 A;  4YMM A;  1S0O A;  1KQQ A;  5IIN A;  4O9M A;  4QW8 A;  2HOI A;  4ECT A;  1ZRN A;  5J2G A;  2Y1I A;  4YD2 A;  3KHH A;  4QZI A;  2BQU A;  2JRZ A;  2JH1 A;  5AM2 A;  5CWR A;  2FJ6 A;  7ICO A;  1WCN A;  3AU6 A;  4UB1 A;  1SZH A;  3FAH A;  5KFE A;  1MQ2 A;  4E0D A;  2K4E A;  5AKL A;  1NI3 A;  5DB6 A;  1IV8 A;  5KG4 A;  2FI1 A;  3QEB Z;  3RTV A;  3E0F A;  2JEF A;  2KVC A;  2DKX A;  3HIL A;  1BNP A;  3V72 A;  2IHM A;  3H40 A;  2BKE A;  2KHV A;  4J9P A;  1PZN A;  4TUR A;  2BZF A;  4R63 A;  3TAQ A;  2ZUD A;  4IQW A;  3ZDB A;  2ZIX A;  2FDR A;  4F5P A;  1ZQO A;  4YR2 A;  2VAN A;  3C2M A;  3M6K A;  3OHB A;  1TKD A;  3UMC A;  4DQI A;  1TK5 A;  1JAL A;  3TKA A;  1S0N A;  2F8L A;  2FPK A;  4KLS A;  1B0X A;  3M9N B;  2F8K A;  5KFT A;  3ISC A;  5KFI A;  1ARO P;  1U49 A;  3TAN A;  3OHA A;  8ICL A;  1FIQ A;  4YMO A;  3KZX A;  1JUD A;  1CRX A;  4PPX A;  4I2F A;  1XO0 A;  4F50 A;  2MSN A;  4MFF A;  1WG8 A;  2HHW A;  4C4S A;  3WK5 A;  3F2B A;  1NK7 A;  5AKK A;  1HIW A;  5KFN A;  3F2D A;  4I29 A;  1FFU A;  2BDU A;  3SMV A;  3QU4 A;  2YX8 A;  1D9D A;  3PX4 A;  1FO4 A;  3WK7 A;  5AKZ A;  5DG7 A;  3LK9 A;  3PW5 A;  2C2R A;  2IOF A;  1LV5 A;  2AGQ A;  3NAS A;  1B4F A;  4NXZ A;  1Z00 B;  2P6U A;  5KAI U;  2JXJ A;  4OJL A;  4BUG A;  5F9N A;  1D8L A;  5AM3 A;  3ISB A;  1TAU A;  1PK3 A;  2W9C B;  3JPN A;  4ED1 A;  9ICK A;  5G5G A;  3LDA A;  1URJ A;  2RDI A;  3OSN A;  5DQH A;  4Y2J A;  2BPF A;  2G5H B;  4GXK A;  3QZ7 A;  1VLB A;  5ALK A;  3Q8Q B;  1N48 A;  1Z4N A;  4PZO A;  2XIC A;  4C8N A;  1ZQZ A;  3NS1 A;  1ED1 A;  2XY7 A;  4EX6 A;  2ZIV A;  3H0R B;  2AU0 A;  1ZQS A;  3HJE A;  2QB1 A;  3V7K A;  4NM1 A;  4O3S A;  1U9L A;  4M2Y A;  4F4Z A;  4Z6D A;  4EEK A;  4F8R A;  5HP4 A;  4YMN A;  2KV2 A;  3QUB A;  1A77 A;  4M6W A;  1T7P A;  2C2E A;  4J9N A;  3PR4 A;  4LZD A;  4RUA A;  5C0Y A;  2HCF A;  4RPY A;  3QNM A;  2JEI A;  1BPB A;  4KLQ A;  2H3F A;  4OCZ A;  1Z1B A;  4OJP A;  4OJO A;  1XSN A;  3GFK B;  3AQF A;  3KHL A;  5EOZ A;  1EXN A;  3T79 A;  2XCP A;  5T14 A;  5HMM A;  2FMP A;  4U7C A;  4US8 A;  4J9M A;  4F72 A;  2DQN B;  4XUS A;  3RAX A;  3M9M B;  3MDC A;  2HI0 A;  1TV9 A;  4KN7 A;  3C1Z A;  5KFA A;  3KKA C;  3UMB A;  1P7D A;  2W8K A;  7ICU A;  4TUS A;  4DL7 A;  2VIX A;  3MR3 A;  5DLG A;  2Y1J A;  3H8S A;  2E8P A;  5ALG A;  1Z3E B;  1BPD A;  2KEY A;  3HKZ C;  8ICE A;  3LVW A;  3CRX A;  4IRC A;  2DKZ A;  3F5E A;  2I9G A;  2RDJ A;  4M9H A;  1NK0 A;  4RPZ A;  1KW4 A;  2KIC A;  4I2B A;  3ZD8 A;  2KP7 A;  1ZET A;  5J0P A;  2HVH A;  4ECZ A;  3OJU A;  4ECX A;  2IOF K;  3RH6 A;  5IIM A;  4O3M A;  2YMP A;  1L3V A;  4YXJ A;  1DOQ A;  3THV A;  4F2R A;  4K4G A;  2BCQ A;  2E8M A;  4NY8 A;  4QZG A;  4O5E A;  2H3I A;  2KTQ A;  2DWQ A;  3D6J A;  1RPL A;  4B9T A;  4KTQ A;  1RYR A;  3PVX A;  4PGY A;  1S8O A;  2MUT A;  1IXR A;  4DFP A;  1S97 A;  2R8K A;  9ICB A;  1PK1 A;  2E8O A;  2YTU A;  1UT8 A;  9ICG A;  5EE3 A;  3TAC B;  3EWA A;  4YVZ A;  3F5A A;  4EYH B;  3G6Y A;  2EAO A;  4UB5 A;  3BJY A;  1KL9 A;  3ZDD A;  5ALM A;  4EZ6 A;  3OJS A;  1ZJN A;  2HBK A;  2RQ5 A;  4EYI B;  1MN8 A;  3PO5 A;  3SQI A;  3M1Y A;  3V7J A;  5KFQ A;  3AQE A;  7ICS A;  3RJF A;  4F91 B;  4ECW A;  2RP5 A;  2K8B B;  2KHQ A;  7ICH A;  5BPC A;  2HDO A;  5GTH U;  3SEI A;  1CEZ A;  5HML A;  3AN1 A;  2FPL A;  2IBK A;  2K89 A;  2GLE A;  4UAZ A;  1RQN A;  4QZ9 A;  5AKJ A;  3V6K A;  5J0Y A;  5III A;  4RQ4 A;  2W55 A;  2VJ4 A;  8ICT A;  4PHE A;  3QU5 A;  5AIB A;  2Z7J A;  4USA A;  4DSL A;  2OH2 A;  4ED8 A;  8ICW A;  3NVV A;  1ZQQ A;  2XGP A;  4CGZ A;  9ICL A;  8ICO A;  1NZP A;  3WKC A;  4JWN A;  2ZXI A;  2JEG A;  2VA8 A;  4PZN A;  2DGZ A;  1NJZ A;  4M47 A;  2JR5 A;  1DK2 A;  1UHU A;  4DS5 A;  4UAV A;  1ZQN A;  3C29 A;  1ZQG A;  2OEH A;  2ALZ A;  1HJP A;  5CEH A;  8ICG A;  3B0X A;  4UBB A;  2I1Q A;  3WK9 A;  2W04 A;  2ZIX B;  4O5C A;  5DQI A;  1S0M A;  9ICO A;  4YR0 A;  5IIL A;  2JEJ A;  3FYH A;  1S5L U;  4DS4 A;  4DSK A;  1XO1 A;  3JPO A;  4UB6 U;  2E1E A;  3RRH A;  5JTI A;  4UAW A;  2I6X A;  3NUQ A;  4IR1 A;  1O03 A;  2D3D A;  4C8L A;  2JH7 A;  3OSP A;  1WUD A;  4ELT A;  2QB0 B;  1TVA A;  4CNQ A;  1KN5 A;  3SAF A;  4RQ1 A;  1LB2 B;  3FC4 A;  3DEE A;  3SAH A;  4GXI A;  1BPY A;  1ZQK A;  4MF8 A;  8ICN A;  1J2N A;  5AKI A;  3AU2 A;  3T5H A;  4DOB A;  4I2G A;  3C21 A;  3RB3 A;  4F4K A;  4UAS A;  1ZQY A;  4QZE A;  1UA1 A;  5AK4 A;  2AXT U;  4ELV A;  1ZJM A;  1CUK A;  4ED6 A;  2YY6 A;  4NLB A;  2R8G A;  2MRL A;  8ICQ A;  4ED0 A;  3QZ8 A;  4NM2 A;  1X2I A;  2BCU A;  2XO7 A;  5L1M A;  1MQ3 A;  5BOM A;  4RQ5 A;  3HW8 A;  1UPH A;  5KT2 A;  4KX3 A;  2B0C A;  4Q45 A;  2MAX A;  5E79 U;  3SEN A;  7ICG A;  4F2S A;  1ZD2 P;  4KLT A;  3CNH A;  5ALR A;  2BGW A;  2BQ3 A;  2BCV A;  1BGX T;  2PI4 A;  4DQQ A;  1X9M A;  3EUB 2;  5J2F A;  2K4H A;  2XC9 A;  7ICP A;  4DFJ A;  2HBM A;  4Y2X A;  2NYV A;  4RNN A;  4QWE A;  1X9S A;  4P4M A;  2HVI A;  2A1A A;  3D2Q A;  4RQM A;  4TUP A;  4RQ7 A;  2VA2 A;  3GV8 B;  2K4P A;  3QX7 A;  2F77 X;  3RBD A;  2LYA A;  5A0L A;  7ICL A;  2BPG A;  9ICX A;  5DQG A;  2BHN A;  1L3S A;  1JMS A;  1X66 A;  4QWC A;  3GIM A;  2NRW A;  5EWE A;  2W43 A;  4CF3 A;  3QU7 A;  2LHT A;  2EQY A;  3MAB A;  9ICW A;  1N5X A;  2D8C A;  3WK8 A;  1JIH A;  4RUC A;  3WK4 A;  4QZC A;  4O5K A;  2W8L A;  5DBA A;  2O6K A;  3KFU F;  3BQ1 A;  4FBT A;  5L9X A;  2MUT B;  2QAR B;  2LM4 A;  2W54 A;  1F0M A;  7ICK A;  2EDU A;  4OO1 J;  8ICK A;  2FLN A;  2JV3 A;  4ECY A;  3MFH A;  4YR3 A;  1KDH A;  3ISD A;  5DB9 A;  2ZJ5 A;  1OUQ A;  5HR7 A;  5AK5 A;  2PFP A;  2RHF A;  2IOH A;  5KFP A;  4RPX A;  3K4G A;  3ORY A;  9ICM A;  4MF2 A;  1NKB A;  1T3N A;  4KLL A;  3F2C A;  4Q8E A;  5ALJ A;  2A19 A;  5KFC A;  4JV2 A;  4KLJ A;  3JPQ A;  5AKX A;  4P0P B;  3GZF A;  3E58 A;  3A0B U;  5B5E U;  5KNI A;  1K5O A;  9ICC A;  4DSI A;  3ZI4 A;  5KL8 B;  4UB2 A;  2KJ5 A;  2HHT A;  3KD3 A;  4M6W B;  1J97 A;  4KMO B;  3VC8 A;  5AI6 A;  1MSW D;  4A8E A;  4BXO A;  3N7S C;  4ED3 A;  3H0L B;  4OJ6 A;  5DKW A;  3RJK A;  5J0Q A;  2ZTC A;  5IIJ A;  4I2A A;  5EE1 A;  5DGA A;  4HYK A;  5KT7 A;  4CDG A;  4F71 A;  2FLL A;  3NTU A;  2KIW A;  9ICS A;  4NJ8 A;  5DG9 A;  1C20 A;  4UAR A;  5H2F U;  4JV1 A;  3AMZ A;  4KMU A;  4O3N A;  3QXG A;  2A3V A;  5CA7 A;  4I2J A;  5EE0 A;  4YQW A;  2DBY A;  8ICR A;  4PL2 A;  3H0M B;  3IDW A;  4I2E A;  2ZIW B;  3T5L A;  4GLX A;  1K1S A;  1JRP A;  1ZD5 A;  5HHH A;  2EH9 A;  1S10 A;  7ICJ A;  1QQ7 A;  3G6X A;  3RJH A;  2ASJ A;  3UXN A;  1L6N A;  5CJ7 A;  5KT3 A;  1BNO A;  9ICU A;  4I2D A;  7ICT A;  4NL9 C;  1U48 A;  1B43 A;  4MHV A;  4UB8 U;  1COK A;  4MFC A;  2LI6 A;  9ICT A;  3BS5 B;  3I28 A;  3M7D A;  9ICV A;  2G08 A;  4DF4 A;  5J2J A;  3RFA A;  3RJE A;  4FZL A;  3EZ5 A;  4Q43 A;  3J81 j;  2J6T A;  4YP3 A;  5IIO A;  4F4X A;  4F3O A;  2EAM A;  4UAY A;  1ZD4 A;  2BCS A;  4M9L A;  5KFU A;  2JZB A;  5KFL A;  4DL2 A;  1L5U A;  4JB3 A;  3KHR A;  4J9L A;  1BVS A;  1TE2 A;  1YZ6 A;  4YFK A;  3LVV A;  5AI9 A;  5KT6 A;  4F92 B;  4IRK A;  1NK4 A;  4TUQ A;  4DLE A;  1LKY B;  1ZQL A;  3RB0 A;  4IL6 U;  4C0Z A;  1ZQP A;  1COO A;  5KL1 B;  4DFK A;  3AL0 B;  4LVS A;  2L5Y A;  4QZF A;  3HKZ F;  1U4B A;  1NKC A;  3EPI A;  4RQ2 A;  3F53 A;  1SL1 A;  1A0P A;  2HHX A;  4JUZ A;  4R64 A;  3S6J A;  3PX6 A;  4J9R A;  1RZT A;  3K1Z A;  4CE6 A;  4UBC A;  4PGQ A;  4BXO B;  4DFM A;  2H3V A;  1ZQD A;  4Q8F A;  4XQ8 A;  1K1Q A;  4F5Q A;  4R66 A;  1Z00 A;  3LWL A;  5J2I A;  2ZJ8 A;  2LKY A;  4P2H A;  2R8H A;  4DOA A;  4YN4 A;  3PW4 A;  5J29 A;  3M8R A;  4DQR A;  3IV6 A;  7ICR A;  5KFG A;  2NRZ A;  4DL6 A;  4R8U A;  4CF5 A;  3DV9 A;  1WYG A;  1RG6 A;  1L7N A;  5HR6 A;  3NVY A;  1QLN A;  2DL0 A;  1BPZ A;  3H8J A;  2G5I B;  3FM9 A;  2BDP A;  3PMN A;  1QH9 A;  2HSZ A;  4J9K A;  4NLC A;  3Q8L A;  1Z19 A;  9ICH A;  3PSI A;  1XC9 A;  2KE7 A;  5ALW A;  3ETL A;  3IP4 B;  2JMG A;  2PXI A;  3MBY A;  5DDM A;  3OPX A;  5KFF A;  3TAD C;  2F1J A;  2GOL A;  2BCR A;  2K8C B;  4QZB A;  4DFD A;  2H3Z A;  3HT3 A;  5JUM A;  4X5V A;  2HMX A;  1ZQH A;  3BQT A;  2ZTE A;  3U26 A;  3BS7 A;  4DL3 A;  4Y2V A;  4ZH4 A;  2JGA A;  3V6H A;  3MR5 A;  2ISP A;  3I1Y A;  9ICE A;  4DQS A;  5KFD A;  4Y2T A;  5KFX A;  3IG5 A;  4ICA A;  3IN5 A;  3L4P A;  3AEV A;  3SI8 A;  1TAQ A;  1RQL A;  1ZQB A;  4HAI A;  3JPP A;  1IM4 A;  3IM1 A;  3MGI A;  3SV3 A;  1ZQA A;  5ALI A;  1JX4 A;  1A6S A;  2PFQ A;  1QQ5 A;  1QSS A;  3BZK A;  4Y2U A;  1VDV A;  1Q8K A;  3NVW A;  1ZQU A;  4EBE A;  2XGQ A;  4EBC A;  4F5O A;  2DPJ A;  5CR0 A;  4XA5 A;  3TFR A;  4KX5 A;  4CCH A;  3QEA Z;  9ICI A;  8ICM A;  3OGU A;  3JPR A;  2UVU A;  1D8B A;  8ICS A;  4GFJ A;  1U45 A;  3NVZ A;  3BDP A;  4B6J A;  3V6J A;  2PI5 A;  4Q44 A;  2VKQ A;  3BZC A;  3GDX A;  2OHF A;  2FMQ A;  3OTQ A;  2LYB A;  2KIV A;  4WJ3 B;  1Z1V A;  5ALX A;  3LWM A;  3RR7 A;  2AQ4 A;  3B9J A;  2WTF A;  4IRD A;  4US9 A;  1SXD A;  1XWL A;  5ALD A;  5J8Y C;  7ICE A;  3C2K A;  1NNL A;  5ALL A;  4DL4 A;  4RU9 A;  1RYU A;  2CPR A;  3RBE A;  3PST A;  4P0Q A;  4QIW C;  2ZTD A;  3HPO A;  1L7M A;  3SV4 A;  2IHN A;  1JI7 A;  3A0H U;  3RH4 A;  5DGB A;  2Y0S C;  3RB4 A;  3RJI A;  3M8S A;  3CW2 C;  2KOB A;  2F2A B;  5ALN A;  2KJ9 A;  4JWM A;  4NLZ A;  3MGH A;  4CRX A;  7ICQ A;  4GC7 A;  4ECQ A;  4J9O A;  1L7O A;  3RRG A;  3N7R C;  1DGJ A;  2PMZ C;  3ICX A;  3L5K A;  2YMM A;  4KLF A;  3H8M A;  2ODG A;  2HW3 A;  5KG5 A;  2OWO A;  8ICX A;  5KG3 A;  5J2H A;  4ECU A;  1ZQJ A;  3UM9 A;  5DDY A;  2QKQ A;  2W03 A;  4DCC A;  1HUZ A;  3M6Z A;  3O0F A;  1DRG A;  5DBB A;  4YD1 A;  3UXO A;  5DB8 A;  2F44 A;  1SV0 C;  3GIJ A;  2BQR A;  5J0T A;  2WF8 A;  4O3P A;  1XSP A;  1RDF A;  2QAR A;  5ALP A;  4EZ9 A;  2G09 A;  1OXJ A;  3PW0 A;  2B21 A;  3TAP A;  5DLF A;  1TK0 A;  1UA0 A;  4Z6F A;  7ICM A;  5ALV A;  2EZY A;  2YML A;  4KLM A;  2C2D A;  1N62 A;  1SGG A;  4I2C A;  2NRV A;  3DDH A;  1DGS A;  4QWB A;  2R18 A;  3PW2 A;  3AM9 A;  4G9B A;  4R65 A;  2LPE A;  2C28 A;  2DFL A;  4RQN A;  1RYS A;  3D2S A;  4B9N A;  5ALU A;  1ZQI A;  1S0V A;  3QUC A;  1NK9 A;  1ZOL A;  4UB4 A;  3H4D A;  2VJ5 A;  2P6R A;  1FFV A;  5CRX A;  2LYH A;  3H4B A;  2F1H A;  4CF4 A;  5KFJ A;  1C7Y A;  3PV8 A;  1D9F A;  4B9V A;  1BPX A;  2R8J A;  3PO4 A;  1T3Q A;  3QYP A;  4OD0 A;  2ATL A;  1ZD3 A;  3KTQ A;  5J0U A;  2A1J A;  5AIA A;  2ZG6 A;  1NOM A;  2KSO B;  5KFO A;  2KKP A;  3WKD A;  2NV3 A;  4QZA A;  4KLE A;  5KFW A;  5KTQ A;  4KIT B;  5DG8 A;  1O08 A;  2M9N A;  1NJY A;  3MR2 A;  2WAQ F;  3GV7 B;  1N5W A;  5AIC A;  4FS1 A;  2P66 A;  2IMW P;  1YZ7 A;  5J0X A;  2NRT A;  1ZQE A;  1T8E A;  4UQG A;  2ASD A;  4M9J A;  1ZXI A;  3WKB A;  2KZ3 A;  3HX0 A;  4P0P A;  5AHX A;  1KFS A;  3QUQ A;  5ALO A;  2KKV A;  1UCV A;  2H5X A;  4FBU A;  2RRD A;  1ZRM A;  2YQE A;  1X40 A;  3T5K A;  3IHQ B;  2KJ8 A;  4AP9 A;  5L1J A;  1S77 D;  5AKY A;  1Q3U A;  7ICI A;  2AH5 A;  8ICB A;  4IC9 A;  2ZIU A;  4J9Q A;  2GO7 A;  4QZD A;  4UAT A;  2W9M A;  4IS7 A;  1IG6 A;  4FFD A;  4MEY A;  3C28 A;  4QZH A;  4NLN A;  3PSF A;  3UPQ A;  5G5H A;  4DOC A;  5AK6 A;  8ICZ A;  2OCE A;  4C8K A;  1Q46 A;  3PY8 A;  2ZIU B;  1D8Y A;  5C5J A;  5F9L A;  2YMQ A;  2BPC A;  2PFN A;  1SV4 A;  2XID A;  3SYZ A;  4RQ6 A;  1SL0 A;  8ICP A;  1X42 A;  2CN1 A;  1N61 A;  3NGD A;  2AGO A;  3PNC A;  3UQ0 A;  2F76 X;  3KZI U;  2PKE A;  5EE9 A;  4PHA A;  1RXW A;  3PSP A;  2FE9 A;  1VJ5 A;  5AM1 A;  4KN4 A;  5AI4 A;  2JHD A;  3RAQ A;  3L3F X;  2YB1 A;  3MDA A;  9ICP A;  2NRX A;  1TAM A;  3CP8 A;  5J2C A;  1LKY A;  2ZIV B;  3TAD A;  1SZP A;  1B22 A;  2J6S A;  3D2N A;  3C2L A;  1H38 A;  3C23 A;  5TZV A;  5HNK A;  2ZUC A;  3WKA A;  4MEX A;  2W11 A;  4J9S A;  2W9C A;  4PH5 A;  4Y2Y A;  2ISO A;  3RH5 A;  5HHI A;  3VCB A;  8ICH A;  9ICJ A;  3UMG A;  2OM6 A;  3QU2 A;  2E5S A;  1ZQM A;  4FO6 A;  1OW5 A;  1HUO A;  5L1I A;  1LVH A;  4PL1 A;  4ECR A;  4EEL A;  1TK8 A;  5J2K A;  5ALS A;  2CXY A;  1SKS A;  8ICJ A;  4M9N A;  4C7Y A;  1KSP A;  2GWS A;  5KT4 A;  3BS5 A;  2P35 A;  4DSF A;  4ECV A;  2ZJA A;  3ZDC A;  2WF5 A;  4DL5 A;  1NK6 A;  4QIW F;  1KEJ A;  3KOO A;  1HEK A;  4DSJ A;  2Y0S F;  3PW7 A;  2HHU A;  5ALZ A;  1L7P A;  3Q8M A;  3BQ0 A;  2CRX A;  1V38 A;  5D49 A;  5D46 A;  4RNM A;  4M0A A;  1SWW A;  1SWV A;  2Q0Z X;  1L3U A;  3GII A;  4ECS A;  1SB3 C;  4KLH A;  3I76 A;  1ZQF A;  3SR6 A;  2IA6 A;  3Q8P B;  4F5N A;  1XS9 D;  4DWI A;  3KBB A;  4O0I A;  3Q8S B;  4Y2Q A;  3TAR A;  4M9G A;  2XY5 A;  2H3Q A;  2WF6 A;  3ALR A;  1X6I A;  2UVV A;  5J0R A;  1UT5 A;  4GIB A;  5AM4 A;  4R8U B;  2DUY A;  4RNO A;  2W7P A;  1ZQC A;  3FDS A;  1KRP A;  3N7P D;  2EAN A;  5TIS U;  1KLN A;  4RZR A;  2R8I A;  1Q3V A;  3ZD9 A;  4K4I A;  4NWI A;  2WF9 A;  3RJJ A;  5J8Y A;  4F5R A;  4ZOH C;  2KFN A;  3GIK A;  3JPT A;  4O3R A;  1N56 A;  4QNL A;  1X9W A;  2BR0 A;  2KMD A;  3E2E A;  4DF8 A;  3IG8 A;  1SKR A;  1KFT A;  1TFR A;  3K1R B;  2V4Q A;  1L8L A;  2KZZ A;  4IQV A;  3RB6 A;  3KHG A;  7ICV A;  5KG6 A;  9ICR A;  4DQP A;  5J2A A;  2KFZ A;  2AGP A;  8ICU A;  2WFA A;  3H7I A;  3EYZ A;  1S76 D;  5AI8 A;  4OJ5 A;  4NL9 A;  1KBU A;  5IIK A;  2AQ0 A;  4KLU A;  3H8W A;  4IQU A;  3C1Y A;  4C8O A;  1JN3 A;  5CP2 A;  1QSL A;  5ALQ A;  3WKE A;  3PZP A;  4RT3 A;  1ECW A;  3UXP A;  3WU2 U;  1YT3 A;  4O3Q A;  3NRZ A;  5AKG A;  3BQ7 A;  3G6V A;  2KK0 A;  3GV5 B;  2KN7 A;  1PK1 B;  2B6G A;  5KT5 A;  1F5S A;  5B66 U;  3HWT A;  4QZ8 A;  4ED2 A;  1Y88 A;  2E3T A;  2D6F C;  4NLK A;  1DK3 A;  1QTM A;  1KFD A;  4PJ0 U;  4DO9 A;  3C5G A;  5KFS A;  5ALE A;  5AM0 A;  1NJX A;  5D4B A;  4ACO A;  1PVP A;  4YG2 A;  2UVW A;  1F44 A;  1WWV A;  3R9K A;  3WK6 A;  2WF7 A;  2FLP A;  4Z6C A;  2PFO A;  4BX9 C;  1MA7 A;  1JXE A;  4RT2 A;  4RQ0 A;  1NJW A;  2WHE A;  2K8A A;  4ELU A;  3BQ2 A;  1CI4 A;  4XRH A;  4NLG A;  2HOQ A;  3PR5 B;  3N28 A;  4I27 A;  2KVS A;  4EBD A;  2MU2 A;  5AI5 A;  4C8M A;  2QB0 A;  2N1R A;  4P4O A;  3EW9 A;  5GTI U;  5KAF U;  2MA1 A;  1AQ6 A;  4GC6 A;  3T5J A;  2XI9 A;  1RXV A;  1L8O A;  5ALT A;  2KD1 A;  4PGX A;  8ICV A;  4JV0 A;  1MC8 A;  3MFI A;  2LBO A;  2W9A A;  5J2B A;  3EPG A;  1M6Y A;  4U6P A;  1V85 A;  1GO3 F;  2YN4 A;  4F4W A;  5KFK A;  2XVT A;  3T3F A;  3RJG A;  3TQ1 A;  5KFH A;  3GQC A;  2Q4T A;  2G06 A;  2NO5 A;  2AJQ A;  2HBL A;  2OYY A;  3M9O B;  3QE9 Y;  2ASL A;  5AKH A;  2LM1 A;  4FZM A;  3IRU A;  2ZUB A;  1PVQ A;  5L1L A;  2A1J B;  3K75 D;  1SV0 A;  3ZDE A;  2WB1 C;  4QWD A;  2HHV A;  4QJF B;  4PHP A;  1SKW A;  2HOF A;  1A76 A;  4EEY A;  4QWA A;  3NRW A;  1QSY A;  5KFB A;  4M04 A;  3C5F A;  2UVR A;  5J0W A;  4JK1 A;  4EX7 A;  5AM5 A;  8ICF A;  2ESE A;  1WCL A;  3LYS A;  2W9B B;  4NV0 A;  3GU3 A;  1T94 A;  2G07 A;  1ZQW A;  5J2E A;  5KFM A;  1XU4 A;  5J2D A;  9ICN A;  1ZYQ A;  4FS2 A;  8ICC A;  4Y2R A;  3TFS A;  2W7O A;  2HBJ A;  5KFV A;  5ALH A;  3HRD D;  1U47 A;  4UAU A;  4LJX A;  4B9S A;  2Y9T A;  4C4R A;  2WB1 F;  4ED7 A;  1V97 A;  3GIL A;  3AUO A;  5L1K A;  4I2H A;  1SL2 A;  3RR8 A;  7ICF A;  4F93 B;  3UQ2 A;  5DB7 A;  3MGV A;  4J03 A;  5KG1 A;  5CHG A;  5KG2 A;  2DF4 B;  4JMU A;  5KFY A;  2XCA A;  1T4G A;  4I28 A;  2OXO A;  1PVR A;  5JU5 A;  2J6U A;  3TI0 A;  4PHD A;  1J2M A;  2PMZ F;  4C7Z A;  4TQS A;  2K60 A;  4K4H A;  5AK3 A;  3Q8K A;  1QCK A;  2GH1 A;  2QLT A;  4KLO A;  4YCX A;  5KFR A;  3KKA A;  4I2I A;  4IR9 A;  1IIP A;  1L3T A;  3N4M B;  2FPM A;  1NK5 A;  5F3X B;  2HHQ A;  1NKE A;  3PML A;  1X6J A;  8ICY A;  2EZZ A;  4P4P A;  4B9U A;  2V4R A;  1ZQV A;  5FP0 A;  3SAG A;  3ETR A;  1RM6 C;  7ICN A;  4BGD A;  1KTQ A;  3MR6 A;  5AKE A;  2NO4 A; 
#chains in the Genus database with same CATH homology
 3LYS A;  2H3V A;  4PL2 A;  4ACO A;  3D2N A;  3H0M B;  3CYM A;  4NV0 A;  1XO0 A;  1PVP A;  2ZIW B;  2W7P A;  3GU3 A;  1T94 A;  4FE3 A;  2HBK A;  3T79 A;  5T14 A;  1XNS A;  1F44 A;  3ONN A;  3N7P D;  2G07 A;  4U7C A;  2LKY A;  2DQN B;  3DEE A;  3F2B A;  1Q3V A;  2G0A A;  3SQI A;  4KX5 A;  4P0P A;  4OO1 J;  1HIW A;  3F2D A;  4BX9 C;  1MA7 A;  2G09 A;  2KKV A;  2W7O A;  2HBJ A;  1L6N A;  2BDU A;  3AQE A;  3SMV A;  2K8A A;  4NWI A;  2YX8 A;  2RRD A;  2HOI A;  2RP5 A;  2K8B B;  4NLB A;  2KHQ A;  3VCB A;  2MRL A;  2HOQ A;  1D8B A;  2OM6 A;  2KJ8 A;  1OUQ A;  2WB1 F;  5HR6 A;  2K89 A;  1DRG A;  1P7D A;  2JH1 A;  2E5S A;  4GFJ A;  4QNL A;  1Q3U A;  5HR7 A;  2RHF A;  4IC9 A;  2ZXH A;  4OJL A;  2N1R A;  2ZIU A;  2VKQ A;  1UPH A;  2G5I B;  3IG8 A;  2VIX A;  4AYB C;  1SZH A;  4BUG A;  4KX3 A;  2R18 A;  2K4E A;  2LYB A;  2VJ4 A;  4PL1 A;  4NLC A;  1Z19 A;  2KNJ A;  4WJ3 B;  3M7D A;  2KEY A;  2ZIW A;  3HKZ C;  3F2C A;  2G08 A;  3LVW A;  3C28 A;  2MA1 A;  3CRX A;  2Z7J A;  3PSI A;  1NZB A;  3PSF A;  3D2S A;  3MGV A;  3F5E A;  2OH2 A;  2K4I A;  4P0Q B;  3IP4 B;  3RFA A;  1URJ A;  2M0N A;  2JMG A;  4FZL A;  3E0F A;  3OPX A;  4P0P B;  2KVC A;  2G5H B;  2DF4 B;  2XI9 A;  2KIC A;  2GOL A;  3GZF A;  4JMU A;  2YB4 A;  2K8C B;  2OXO A;  1PVR A;  2KD1 A;  4OJ5 A;  4CGZ A;  1ZQ1 C;  2H3Z A;  1KBU A;  2KHV A;  5KL8 B;  2KJ5 A;  2CPR A;  2VJ5 A;  2ZXI A;  2ZIU B;  5CRX A;  2HMX A;  2XIC A;  4QIW F;  2K4H A;  2DGZ A;  3PST A;  4P0Q A;  4QIW C;  2HBM A;  2E1F A;  2LBO A;  3VC8 A;  4KMO B;  3SAH A;  4BJQ A;  2PMZ F;  1HEK A;  4A8E A;  2ZIX A;  4U6P A;  3PZP A;  4O3M A;  1ED1 A;  1ECW A;  2XID A;  2Y0S F;  3D2Q A;  3C29 A;  1GO3 F;  2Y0S C;  1YT3 A;  2JGA A;  2ZIV A;  2XVT A;  3N7S C;  3H0R B;  2GH1 A;  3H0L B;  3LVV A;  3M6K A;  4OJ6 A;  2Q4T A;  2F77 X;  2CN1 A;  2CRX A;  2KOB A;  2G06 A;  2F2A B;  2H3I A;  2KJ9 A;  2WAQ C;  2LYA A;  2HBL A;  1IIP A;  2OYY A;  2ZG6 A;  4AYB F;  4C0Z A;  5A0L A;  3IG5 A;  3O0F A;  2W04 A;  2ZIX B;  4FZM A;  4ICA A;  2F76 X;  3IN5 A;  4CRX A;  1PVQ A;  2KV2 A;  2F8L A;  2KKP A;  5KL1 B;  3AL0 B;  4CDG A;  2WB1 C;  3N7R C;  3PSP A;  2NV3 A;  2PMZ C;  3ICX A;  2E1E A;  2KIW A;  3HKZ F;  4QJF B;  2JHD A;  2HOF A;  4FZN A;  3NUQ A;  3L3F X;  2D6F C;  5C0Y A;  3SAG A;  2YB1 A;  3RF9 A;  3NRW A;  2JH7 A;  2LHT A;  3F53 A;  1WUD A;  1A0P A;  1TAM A;  2A3V A;  3F5A A;  2H3F A;  3CP8 A;  1A6S A;  1Z1B A;  4OJP A;  3KZX A;  2WAQ F;  4OJO A;  3SAF A;  2H3Q A;  1CRX A;  2W03 A;  3ALR A;  3K1Z A;  3M6Z A;  3AQF A;  2ZIV B;  3KFU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...