3KFUF

Crystal structure of the transamidosome
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
453
structure length
447
Chain Sequence
MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGERRVRIKRLHLEEDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEILRRGEKVKQATMGFEEGSGKTYPMADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase/rna
total genus 111
structure length 447
sequence length 453
chains with identical sequence I
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kfuF02
2G5HB 3H0RB 3KFUF 1ZQ1C 3IP4B 2D6FC 3AL0B 3H0LB 2G5IB 2F2AB 2DQNB 4WJ3B 2DF4B 3H0MB
chains in the Genus database with same CATH superfamily
2DGZA 4KTQA 4K4HA 2KHVA 2QARB 5KFZA 3Q8RB 2DKXA 2KTQA 4DSKA 1M6YA 1ZQCA 4F5OA 1N5XA 5AIAA 2KV2A 1ZQGA 2ASLA 2V4QA 3K75D 2VANA 2BCQA 8ICSA 3M6ZA 4LJXA 1QCKA 4ECYA 3N4MB 5CP2A 4UAUA 3PNCA 3SV3A 1UT8A 1MC8A 1Z1VA 4M9NA 4LVSA 3T5LA 1ZQXA 1RG6A 3S6JA 4DSIA 4QZFA 5KG3A 1U4BA 3AU6A 5AM3A 3HWTA 3JPOA 4U6PA 2E5SA 1SZHA 4F72A 1PVQA 3SAFA 2HW3A 3KOOA 1NK0A 1KBUA 4I2FA 4DL2A 4DWIA 4YR0A 3ZD8A 2KOBA 5DDYA 3UQ0A 1TK8A 2ASJA 2PXIA 5TZVA 1MQ3A 1S0VA 2FMQA 3BQ1A 1HIWA 2F8KA 5DB6A 1RYRA 4XQ8A 3UMCA 1Y88A 5CA7A 4BXOA 8ICNA 3T79A 1PZNA 4GFJA 3PO4A 2BPFA 3H7IA 4PL1A 4B9NA 2FDRA 4Z6FA 3F2DA 3L4PA 4B9TA 2HHWA 4FFDA 2FMSA 3H0LB 2CPRA 3FAHA 1X9WA 3OHBA 2WB1C 3F5AA 2XGPA 1S8OA 4Y2SA 1QQ6A 2HHQA 4M0AA 4F8RA 1JN3A 1ZETA 2DPIA 5KFVA 4QIWC 3ETRA 2KN7A 4F5QA 2HVIA 2FPMA 5J8YC 4C4SA 1X2IA 4QZEA 3QYPA 9ICPA 3H4DA 5ALDA 2XC9A 4GLXA 5B66U 2J6SA 4UAYA 4F3OA 5KFDA 5C0YA 2MUTA 4DSLA 1ZOLA 5KFHA 1X6IA 3D6JA 1HEKA 3PW2A 1NJXA 9ICOA 3GIIA 2FPLA 1ZQBA 4QJFB 4ZOHC 5ALLA 3NVYA 4RQ0A 2PMZC 4OJ6A 3NTUA 4ELTA 3NRZA 2FE9A 5DG9A 4UAZA 5DDMA 1BNPA 2NO5A 2KIVA 1L6NA 1ZQNA 4Y2VA 1JMSA 9ICNA 1ZQMA 8ICIA 4UAWA 2IOFK 4NV0A 1ZQEA 3V72A 8ICHA 1N60A 1NNLA 1TAQA 3QNMA 4FZLA 2H3ZA 9ICSA 3OJSA 3C2MA 3ZD9A 1TVAA 7ICVA 1XSPA 2K8AA 2FLPA 3WK4A 3AM9A 2KIWA 3HKZC 4R8UB 5ALOA 4RQ6A 3QU7A 2BPCA 2AQ0A 4NLKA 3F5EA 1QTMA 5HR7A 1Z3EB 2HBLA 3MFHA 3SMVA 4BGDA 2O6KA 4Y2QA 4ELUA 4M9HA 9ICQA 3RB6A 3SR6A 2RRDA 2L5YA 2HMXA 3T5HA 1ZD2P 3JPQA 3F2CA 2I1QA 1LKYA 3GFKB 2OM6A 4OCZA 3OJUA 4QWEA 1GO3F 1XU4A 4M9LA 2R8GA 4PL2A 3WKBA 5KT3A 5D49A 4UB3A 2E1FA 1A76A 5KTQA 3TANA 3OGUA 2Y9UA 2DF4B 3MABA 1L3UA 4Q8EA 4Q45A 2MA1A 4KLFA 2ZTEA 3UM9A 3CYMA 2LYHA 4EENA 5ALTA 9ICTA 2JH7A 4RPZA 4ECVA 3RR8A 4IQTA 5J2GA 5F3XB 1SL0A 5J0PA 4TQSA 3PSFA 3PX6A 3IP4B 5J2CA 1ZQSA 2OWOA 2WHEA 2KJ9A 5L1JA 2PFOA 2OCEA 4IQWA 1MSWD 4TURA 1PUZA 4ED0A 3SD7A 3G6VA 1PK3A 2EZYA 3ED5A 3TFRA 5DBAA 2UVWA 4BJQA 2NYVA 3H40A 1OUQA 2KJ8A 4CE6A 5CHGA 5D4BA 4LZDA 2ZJ8A 2B0CA 4QW9A 2ATLA 4KLGA 4OO1J 4I2EA 3RH4A 2FI1A 5AK4A 2NRTA 4Q8FA 3NVWA 5JU5A 4CGZA 4DQSA 1BVSA 3C1YA 4I2JA 2JEIA 1QQ7A 1FO4A 4C8NA 3RB3A 1IXRA 4RQ5A 5AKYA 2GH1A 1ZD3A 1KN5A 1MN8A 4J03A 4YCXA 8ICCA 3M8SA 1QSLA 1LB2B 2YY6A 3SAHA 5T14A 5HNKA 5AI5A 2ZG6A 2BKEA 2KZ3A 1L7PA 4O3QA 5ALNA 2K8BB 4DOCA 5CWRA 1ZD4A 2Y0SF 2HHSA 3BS5A 1ZQHA 3H8WA 2KHQA 3V7KA 2IMWP 5AKLA 2DBYA 3EPGA 2H3QA 2VA8A 3SENA 1NKCA 1ZRNA 4C4TA 1ECWA 2BCVA 1NKEA 1C20A 2NRWA 1ZQTA 5HMLA 4RT3A 8ICMA 3C2LA 2F3NA 4ECXA 4CCHA 2G5IB 2A1JA 2GLEA 2XY6A 2NV3A 3ZDEA 2E8NA 1ZQ1C 2I5HA 4WJ3B 3PW5A 1RQLA 2JZBA 1DK2A 3NRWA 1ZQLA 3H4BA 4PGYA 3M8RA 4US8A 4IRKA 5KFXA 7ICFA 8ICZA 3WU2U 4BDPA 1NI3A 5AKGA 4F71A 4QZHA 4P4PA 4M9JA 1ZQUA 5KFSA 4M2YA 5CJ7A 3G6XA 1PK1A 1U48A 1BPYA 1VDVA 1RQNA 2ZIUA 3LYSA 5KFWA 1JIHA 3JPRA 4ECSA 2B21A 2XICA 3PX4A 2FPKA 5ALJA 4YN4A 2P6UA 1X6JA 2DUYA 8ICBA 2ZTDA 3RJEA 1CEZA 8ICYA 5KNIA 3QX7A 5J0TA 2XCAA 2G06A 1S76D 5ALRA 9ICMA 1XSLA 4DEZA 4OJPA 2ZIVA 2BQUA 4Y2XA 5KG1A 1J2NA 1JI7A 3GZFA 2R8JA 4F2SA 5GTHU 4J9QA 3Q8PB 1B22A 4Q43A 5L1IA 2PFNA 4KLSA 4DSJA 9ICRA 3O0FA 3QUBA 3HP6A 5AKXA 1L8LA 2XY7A 1A77A 1ZD5A 2GO7A 4M04A 1RZTA 3D2SA 2XI9A 4P0PA 5J2IA 7ICQA 4O3NA 4DQQA 4Z6DA 1N56A 8ICXA 4YQWA 1UQVA 4YXJA 4J9PA 4MFFA 8ICGA 4R64A 1NK8A 2ASDA 4F5PA 4FZNA 2C2DA 4UW9A 1TFRA 3ZDAA 5KFUA 3BS5B 5KFQA 3F53A 9ICWA 2ES6A 2W7OA 1SWVA 5H2FU 1KL9A 4O3PA 8ICFA 5ALEA 1O08A 1JXEA 1ZQVA 4JB3A 2KFNA 2KJ5A 3BZKA 2MRLA 2A1AA 5KFRA 8ICAA 1X40A 5J0OA 3Q8QB 5DG8A 4EBDA 3TADA 3UXOA 3GIMA 3BS7A 5ALQA 2W9BB 7ICHA 4IQUA 4IQVA 2GWSA 2DPJA 4UAVA 1TAMA 5ALMA 1X66A 3TAPA 2EZXA 2P35A 3B0XA 4E0DA 5E79U 4GC7A 1RM6C 7ICPA 1TK5A 4B9MA 4NLCA 1PVRA 4I2AA 4P2HA 2KK0A 3MDCA 1ZQOA 4O5KA 2IOHA 3BJYA 3ZI4A 2Q4TA 3NASA 5IIKA 4BWJA 2BCSA 3HPOA 2W9CA 4DL5A 4MHVA 4R66A 8ICTA 5EE3A 1BPBA 3E0FA 3QU2A 3WKCA 2UVRA 2ZIUB 3PV8A 4O3OA 2K8CB 3MGHA 2HDOA 4JV1A 4DFJA 1ZQIA 1ZQDA 4JV0A 9ICIA 3N28A 5KG4A 3F2BA 1Z4NA 4YR3A 3PZPA 2EANA 4MF8A 1SIJA 3RFAA 9ICBA 4B9VA 5KT5A 4TUQA 3MDAA 5KAFU 4QZDA 3GU3A 1DXSA 4NWIA 4F2RA 1Z4OA 2KD1A 3D2QA 3EYZA 5KFIA 5DGBA 4Y2TA 4GC6A 2H3FA 1J2MA 4K4GA 5HHIA 1P7DA 3BQTA 1SXEA 7ICIA 4RNOA 3M7DA 3MFIA 4A8EA 1SV4A 1T3QA 3RJHA 2J6UA 1Z19A 1NK4A 3RB0A 3Q8MA 5J2EA 1K5OA 2ZXHA 4YMNA 1WUDA 4F93B 2KZMA 1ZQPA 2NRVA 3GV5B 1Z00B 3HX0A 1IG6A 3AEVA 4KLJA 2WF5A 2R8KA 4QZGA 3WK8A 3CP8A 2Y9TA 5EWGA 3RJFA 4F91B 4M6WA 4I28A 4DS4A 2JHDA 4CF4A 2KP7A 3ZDBA 4JWMA 1Q8KA 2W43A 2BPGA 1XNSA 5AKZA 5EWFA 4XUSA 4DQPA 1CUKA 3IM1A 2I6XA 4DLGA 5AKJA 2HBMA 1DOQA 5AM4A 4I2DA 4JV2A 4X5VA 4CNQA 4EX7A 4YVZA 1KQQA 3C23A 1S0MA 2HOQA 1VLBA 1COKA 2KEYA 3QE9Y 5KFJA 1SL1A 4RUAA 1KW4A 1L5UA 2BHNA 1DK3A 3HJEA 7ICEA 4AYBC 2WB1F 2YN4A 3OTQA 2C28A 4UATA 2JEJA 2CN1A 4XRHA 4B6JA 4QIWF 2WTFA 2CRXA 1N63A 3OPXA 2VA3A 2XGQA 3DDHA 8ICLA 3RBEA 4I2IA 4ECZA 4M9GA 2K89A 3PSIA 3AQFA 2G09A 1T94A 7ICLA 2KSOA 2ZXIA 1YZ7A 1DRGA 1URJA 1JALA 2W04A 3RB4A 2F76X 2J6TA 2YX8A 1LVHA 9ICFA 3JPSA 4F4KA 3ZDDA 2ZIXA 4F4WA 5J2KA 3QZ7A 4DSFA 4P0QA 1F5SA 1JUDA 2YMMA 4F4YA 2Z7JA 3TQ1A 1S97A 5HR6A 4ECQA 5FP0A 4EX6A 7ICGA 4C4RA 2F77X 5B5EU 3PW7A 3EWAA 4F50A 4RT2A 1TE2A 4YP3A 2F8LA 2PKEA 5KT6A 3HKZF 3QEBZ 4ED3A 3C28A 3KHRA 2E3TA 4UASA 2KVCA 1NOMA 2WF7A 3PW0A 5KT7A 3IG5A 4KLUA 5G5HA 5EE1A 4F92B 1PVPA 3KZXA 1S77D 4I2CA 2ZIWA 1SKWA 1WCNA 3SEIA 3AUOA 3C21A 1BPZA 3ICXA 2OYYA 4BX9C 1BPEA 2NRXA 4QNLA 2I9GA 1ZYQA 3PO5A 1ZJNA 3HRDD 1AROP 5KT2A 2EH9A 2JXJA 3BDPA 1CI4A 4BXOB 4M6WB 3JPTA 1UPHA 4OJLA 1K1QA 1D8LA 2KMDA 1S9FA 7ICOA 1V97A 1ZJMA 2PFPA 4XA5A 3TKAA 2LKYA 4EBEA 3WKEA 3GDXA 1ZQQA 4RQNA 2W8LA 4FE3A 1KDHA 3GV7B 5DG7A 4IR1A 1D8BA 2ISPA 1D9FA 4RQ2A 2NRZA 3KZIU 4DCCA 4I2BA 2QB0A 1X42A 1BGXT 5J8YA 1U45A 4EYHB 2OHFA 2ZUCA 1A6SA 5L1MA 5ALXA 2JMGA 3V7JA 5KFEA 2HOIA 4RPXA 3C5FA 5L1KA 1SKSA 5CB1A 2C22A 4KITB 4RU9A 2W03A 3BQ2A 4YFKA 4EBCA 2MUTB 3T5KA 3VC8A 1RYUA 1BNOA 4KLMA 4UB5A 3PSPA 3ISCA 2H3IA 3ALRA 5G5GA 2M9NA 3GIKA 1TV9A 2AJQA 4OD0A 2Y1JA 1XO1A 3UPQA 1WYGA 9ICHA 4DOAA 3KKAA 5IINA 9ICVA 4CRXA 4J9OA 5KG5A 2ZIXB 1NJYA 8ICOA 4KLIA 4UQGA 1EXNA 2AXTU 3BQ7A 5J2DA 1RPLA 1L8OA 9ICCA 2YMLA 5L1LA 3JPNA 5D46A 1Q3VA 2G07A 2F1HA 3N7PD 5J0XA 3PMNA 4EELA 3M6KA 1L7NA 4DS5A 4QZCA 2V9WA 5ALZA 3FDSA 2IHMA 1V9PA 4K4IA 1WWVA 3RRHA 5ALSA 3RJIA 5ALYA 2ZTCA 4YMOA 2W9MA 4KLHA 2V4RA 3Q8KA 2F1IA 2BR0A 8ICQA 3OSPA 2D6FC 3H8JA 1ZQYA 3RJJA 2RHFA 4PGXA 2VA2A 1UT5A 5AK3A 4NLGA 4MEYA 9ICKA 1LKYB 1V85A 4QZBA 3AN1A 2LYAA 1UA1A 4MEXA 3N7RC 3TADC 1KEJA 1IM4A 1WWUA 4UB4A 5AI4A 1NK7A 3PW4A 1FFUA 3SZ2A 5KG7A 4QWDA 3RRGA 3ISDA 3NVZA 4IL6U 4ICAA 4C7YA 4GXJA 4I2GA 4PHEA 5TISU 1D9DA 3I28A 2IA6A 4ELVA 2D8CA 4IC9A 5AK6A 1S0NA 5J2FA 2ZJ5A 2R8IA 2YQEA 4YD1A 3V7LA 4YXMA 5BOMA 4QW8A 1N2XA 2E8MA 2ZJAA 4DL7A 2BCUA 4DFPA 4KMOB 1N48A 4NL9A 2QARA 1CRXA 4QWAA 4PH5A 1DGJA 1ZRMA 3GQCA 2KE7A 4NLNA 3ETLA 7ICRA 2QB0B 4EYIB 4RQ8A 5CRXA 8ICVA 1X9MA 4UBBA 1AQ6A 1TK0A 4ACOA 1NZPA 2A19A 2K4IA 1FEZA 5KFLA 2VJ5A 1MQ2A 5DLFA 2AGOA 3MR2A 3L3FX 2KKPA 1ZQRA 1RXWA 5IIIA 1RYSA 4ED6A 2BDPA 4PJ0U 2BCRA 3EPIA 4Y2RA 2D3DA 3OHAA 1SGGA 5KL1B 4HYKA 3RH6A 1OW5A 4Q44A 2LMRA 5F9NA 2F44A 2W11A 2OEHA 1B43A 5ALIA 7ICJA 2LM1A 1B0XA 1SXDA 4TUPA 3PR5B 1RXVA 1FIQA 9ICUA 4ECUA 4DSEA 1YT3A 3A0HU 2MAXA 9ICLA 4J9NA 5KFCA 2WAQF 5AKEA 2LM4A 5J2HA 2PI5A 3HILA 4KX3A 4JUZA 2HOFA 1D8YA 2C2EA 1HUZA 4DF8A 2YB1A 4GXIA 2JV3A 4BWMA 3FM9A 3SI8A 4Y2PA 2A1JB 3H8MA 2XO7A 1HJPA 4OJOA 5ALGA 4FBUA 2HI0A 2FLNA 2JZBB 3RAXA 7ICMA 8ICWA 1NK5A 1J97A 4RNNA 4C8OA 1ED1A 4RPYA 2EZZA 3WK7A 2RP5A 1NKBA 2HVHA 3TACB 3K1ZA 4QWCA 5KG2A 5J2JA 1T3NA 5BOLA 2ALZA 1SKRA 5DKWA 4JWNA 2HHXA 4NY8A 4US9A 4C7ZA 2E1EA 2OH2A 1SWWA 1KSPA 3KHLA 1WCLA 2P6RA 2RLTA 1PK1B 5AIBA 3ONNA 1LV5A 4IRCA 9ICGA 2HSZA 5EWEA 4O3MA 4KLQA 4DFKA 4J9MA 3RAQA 4EZ6A 3J81j 3UXNA 4I2HA 4YMMA 5AI9A 5JTIA 1ZXIA 4OJ5A 4C8LA 3QUTA 4KLTA 1NK6A 3CRXA 4TUSA 4ECWA 1Z1BA 2KFZA 3WKAA 4ECRA 3M9OB 2W7PA 2N1RA 5AM2A 1ZQKA 1A0PA 5AKHA 1ZQZA 3U26A 2ZIVB 5EE9A 5KFTA 2IBKA 1SV0A 5AI8A 3A0BU 5JRTA 2DQNB 3PY8A 3OSNA 4DO9A 3PR4A 2W55A 3SYZA 1KRPA 4NM1A 9ICEA 3QXGA 2LPEA 4R8UA 2JH1A 1KFTA 2HBJA 3FYHA 5A0LA 4DFDA 2NO4A 3RJKA 3GV8B 2KG5A 4P0PB 4DF4A 4PZOA 1H38A 1QSYA 4J9LA 1SZPA 1YZ6A 4JK1A 2CXYA 3GILA 5J0WA 3IV6A 4NJ8A 4O3RA 2LI6A 4Y2JA 2YMQA 3SAGA 5HHHA 5EOZA 3K1RB 2KKVA 3RBDA 4UBCA 3HT3A 4KN7A 3G6YA 5AI0A 2YB4A 1TKDA 5F9LA 1RDFA 5KFMA 1NJZA 3SV4A 1SL2A 5KFYA 4O5CA 3IG8A 3KD3A 1L7MA 3QU9A 3MGVA 4CF3A 5ALPA 4Y2UA 4ECTA 2MU2A 2BDUA 2FLLA 3KTQA 5KAIU 2H3VA 3L5KA 4M47A 9ICXA 4GIBA 3N97B 2AQ4A 2KICA 3UMBA 3LWMA 3WK5A 5JUMA 5KFNA 4DQRA 5CEHA 5AM0A 3WK9A 4J9KA 4MF2A 2EDUA 4AYBF 2BGWA 4QWBA 3IDWA 2EAPA 5BPCA 2OXOA 3QU5A 4JMUA 2XCPA 4KX5A 3UMGA 1C7YA 4USAA 4GXKA 4F5NA 1U49A 5J2BA 2G5HB 5AKKA 3MR3A 4ED7A 1S5LU 2ODGA 3D2NA 4RZRA 3IHQB 2W9CB 2WFAA 4YG2A 2AU0A 2AGQA 3DEEA 2PMZF 4J9RA 4YD2A 5L9XA 3THVA 3PVXA 1COOA 2R8HA 1XS9D 3ISBA 3QZ8A 4B9LA 2FMPA 1TAUA 2WF8A 2P66A 3PSTA 2W8KA 3KKAC 4PPXA 2MSNA 3UXPA 3V6HA 3RJGA 1KLNA 4P4MA 1O03A 2W3RA 8ICJA 5AK5A 4EEYA 3H8SA 4FS2A 2ZUDA 5DQGA 5J0UA 5ALWA 5AKIA 3GIJA 4KLLA 1XO0A 2LBOA 4MFCA 3RR7A 3TI0A 2LHTA 3IRUA 4LZGA 2YTUA 2VKQA 2JRZA 2ZUBA 4YR2A 5DQIA 3AL0B 2AGPA 5KFOA 3LVVA 3RF9A 1T4GA 4NXZA 3HW8A 1VJ5A 3QU4A 2K4PA 2K4EA 3LDAA 3H0MB 4Z6CA 5KG0A 4C80A 1QH9A 4QZ9A 2A3VA 2LYBA 1N62A 4HAIA 5AICA 2HHUA 2UVUA 5HMMA 4RQ7A 1QLNA 2G0AA 5DBCA 7ICSA 5KFFA 2BZFA 4TQRA 4DOBA 3V6KA 1F0MA 2QB1A 4J9SA 1L3SA 1JROA 2ISOA 2M0NA 1N5WA 5K4LA 1KFSA 3KFUF 4Y2YA 2XIDA 5J0SA 4UB6U 4B9SA 4UB1A 1U47A 1U9LA 1S0OA 4NL9C 3R9KA 4R63A 2UVVA 4RQ3A 1B4FA 3C29A 4KN4A 4O0IA 3MR6A 5IIOA 5J0QA 2JEGA 3NS1A 3TARA 2F1JA 1HUOA 1V38A 3NVVA 4G3IA 5AI6A 1UA0A 5C5JA 5AM5A 1XWLA 1T7PA 2QKQA 4PGQA 5IILA 2KSOB 3C2KA 3BZCA 1KKXA 2R18A 3SQIA 4DL3A 2E8OA 4G9BA 1BPXA 4I27A 4IR9A 2Q0ZX 3EW9A 4NLZA 1ZQWA 2IHNA 4P0QB 3DV9A 1UCVA 4DL6A 9ICJA 1NJWA 4PHDA 2WF6A 4FZMA 4ED8A 2EQYA 1OXJA 1JXLA 2Y0SC 1UHUA 3KHGA 2WF9A 3CNHA 4F5RA 4UB8U 1JRPA 3H0RB 2G08A 5ALFA 2W3SA 3WKDA 5DB8A 1Q46A 5J29A 3Q8SB 4QZ8A 4F4ZA 4FBTA 3E58A 3QEAZ 1SB3C 3MR5A 2C2RA 2DWQA 4DFMA 5KFPA 2RDIA 4QZAA 1IV8A 4P4OA 2ZIWB 3B9JA 4RQMA 4MFAA 2QLTA 4KLEA 3B0YA 3LK9A 4PHAA 2RQ5A 5ALHA 3PMLA 1JX4A 5KT4A 1ZQAA 1NZBA 1WG8A 3AQEA 5J2AA 2BQ3A 5J0YA 4O5EA 2W9BA 1KFDA 4O3SA 2YMPA 3T5JA 4C8MA 5HP4A 2E8PA 5J0RA 7ICKA 4C8KA 3MC1A 3QUQA 3AU2A 5DLGA 3WK6A 5KFKA 2BQRA 1S10A 2JR5A 5DB7A 2FJ6A 8ICEA 5AHXA 5DB9A 4RQ1A 4RNMA 1F44A 2KZZA 1XC9A 3E2EA 2VIXA 4FS1A 3EUB2 4CDGA 5DBBA 3M1YA 4BUGA 3KBBA 2H5XA 9ICAA 3NUQA 4CF5A 3QUCA 3N7SC 3LWLA 3ZDCA 4R65A 2IOFA 2DL0A 8ICUA 3MBYA 3VCBA 3I1YA 3AMZA 2DFLA 1FFVA 1X9SA 4UARA 4FO6A 2XVTA 5GTIU 5DQHA 1DGSA 4ED1A 2PI4A 5IIMA 2JGAA 4O9MA 1SV0C 1ZQJA 4NLBA 4PZNA 1T8EA 4RUCA 5KG6A 1ZQFA 2EAMA 2K4HA 3FC4A 1NK9A 1BPDA 4ED2A 3TAQA 2HBKA 2KNJA 4RQ4A 2HHTA 3JPPA 1X9XA 4KMUA 7ICNA 1Z00A 1XSNA 4UB2A 5CR0A 3K4GA 4EZ9A 2HCFA 2W9AA 4NM2A 1L7OA 3I76A 3ORYA 1N61A 2PFQA 2K60A 8ICRA 1KTQA 3V6JA 2ESEA 4DL4A 2XY5A 2WAQC 1QQ5A 3TFSA 3LVWA 5KFBA 2VJ4A 3UQ2A 4Z6EA 3PX0A 4C0ZA 4U7CA 2Y1IA 2AHOB 4ZH4A 2DKZA 4KLOA 1MA7A 4DLEA 3Q8LA 4B9UA 4PHPA 4KLDA 3NGDA 5ALVA 3RTVA 3T3FA 5ALKA 2JEFA 3C1ZA 2B6GA 3IN5A 5IIJA 1IIPA 1L3TA 1L3VA 4QZIA 2AH5A 2EAOA 1K1SA 8ICPA 2GOLA 4I29A 3EZ5A 2W54A 5KFGA 5ALUA 2RDJA 5KL8B 1Q3UA 4DQIA 3C5GA 5AM1A 2KVSA 7ICTA 3BQ0A 2F2AB 2HHVA 7ICUA 1QSSA 3CW2C 3KHHA 3M9NB 5KFAA 3M9MB 3MGIA 4EEKA 4AP9A 5DGAA 5EE0A 4IRDA 8ICKA 3RH5A 4F4XA 4IS7A
chains in the Genus database with same CATH topology
2JGAA 2DGZA 2G5HB 2WAQF 1A6SA 2KHVA 5T14A 4NLBA 5HR6A 4ICAA 2JMGA 3H0LB 2CPRA 1TAMA 2DQNB 2ZG6A 2HOIA 3D2NA 3CP8A 2RRDA 2K4HA 2HMXA 2M0NA 2ZIWB 4IC9A 2K8BB 2F77X 4KX3A 2HOFA 3F2CA 2W03A 2JH1A 3KFUF 3DEEA 2JHDA 2HBKA 2PMZF 2WB1C 2YB1A 2XIDA 3F5AA 2OM6A 3VC8A 2KNJA 2HBJA 2KV2A 5A0LA 1GO3F 2G06A 2Y0SF 2F8LA 4PL2A 1XNSA 3PSPA 1NZBA 4P0PB 4NLCA 2KHQA 4OJPA 2H3IA 1PVRA 4QIWC 3ALRA 3AQEA 3HKZF 2H3QA 2ZIVA 2E1FA 3C28A 2Q4TA 2KVCA 4KMOB 2HBMA 3M6ZA 3GZFA 1CRXA 3IG5A 1PVPA 3KZXA 2DF4B 4OJOA 3PSTA 2MA1A 4CRXA 1ECWA 3CYMA 3SAGA 2ZIWA 3C29A 2WAQC 3O0FA 5C0YA 2ZIXB 3LVWA 2KKVA 2JH7A 2HOQA 1ED1A 2VJ4A 1HEKA 3E0FA 3D2SA 2ZIUB 5CRXA 2XI9A 2KEYA 3ICXA 2YB4A 2RP5A 4C0ZA 4QJFB 4U7CA 4P0PA 2K8CB 2G5IB 2OYYA 3K1ZA 4ACOA 4BX9C 3SMVA 1XO0A 3IG8A 2LBOA 3PSFA 1MA7A 2PMZC 2E5SA 4OJ6A 4QNLA 2WB1F 2K4IA 1SZHA 3IP4B 4AYBC 4U6PA 3MGVA 2NV3A 2VJ5A 1PVQA 1Q3VA 3F2BA 1F44A 2G07A 2LHTA 3N7PD 3SAFA 2KJ9A 3PZPA 2R18A 1ZQ1C 2CN1A 2E1EA 3L3FX 3M6KA 2BDUA 2VIXA 4QIWF 1KBUA 2KKPA 3RFAA 2CRXA 2OH2A 3SQIA 4FZNA 1L6NA 4WJ3B 1UPHA 4OJLA 2VKQA 3IN5A 1IIPA 4CDGA 3OPXA 4BUGA 3NRWA 3AL0B 2KOBA 2H3VA 3F53A 3LVVA 3GU3A 3ONNA 3RF9A 3NUQA 4NWIA 2W7OA 4P0QB 2GOLA 4NV0A 4BJQA 2KICA 2K89A 2KD1A 3D2QA 3N7SC 5KL1B 1OUQA 2KJ8A 4FZMA 5KL8B 1Q3UA 3PSIA 4O3MA 2LKYA 3AQFA 2H3FA 1HIWA 4OO1J 2G09A 1T94A 2D6FC 4FZLA 2KJ5A 2H3ZA 2F2AB 2Y0SC 2K4EA 2ZXIA 1URJA 2RHFA 1P7DA 1DRGA 3H0MB 2W04A 2K8AA 2F76X 2MRLA 3M7DA 4FE3A 4OJ5A 3VCBA 4CGZA 2YX8A 2KIWA 4A8EA 3HKZC 3T79A 3CRXA 4AYBF 1Z19A 3H0RB 2A3VA 1D8BA 4GFJA 2G08A 2LYAA 2LYBA 1Z1BA 3N7RC 2ZIXA 2W7PA 2OXOA 4PL1A 2ZXHA 4JMUA 2N1RA 2G0AA 1WUDA 3F5EA 4P0QA 1A0PA 2GH1A 2ZIUA 3LYSA 4KX5A 5HR7A 2XVTA 1YT3A 3F2DA 2XICA 2HBLA 2ZIVB 2Z7JA 3SAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5H B;  3H0R B;  3KFU F;  1ZQ1 C;  3IP4 B;  2D6F C;  3AL0 B;  3H0L B;  2G5I B;  2F2A B;  2DQN B;  4WJ3 B;  2DF4 B;  3H0M B; 
#chains in the Genus database with same CATH topology
 2DGZ A;  4KTQ A;  4K4H A;  2KHV A;  2QAR B;  5KFZ A;  3Q8R B;  2DKX A;  2KTQ A;  4DSK A;  1M6Y A;  1ZQC A;  4F5O A;  1N5X A;  5AIA A;  2KV2 A;  1ZQG A;  2ASL A;  2V4Q A;  3K75 D;  2VAN A;  2BCQ A;  8ICS A;  3M6Z A;  4LJX A;  1QCK A;  4ECY A;  3N4M B;  5CP2 A;  4UAU A;  3PNC A;  3SV3 A;  1UT8 A;  1MC8 A;  1Z1V A;  4M9N A;  4LVS A;  3T5L A;  1ZQX A;  1RG6 A;  3S6J A;  4DSI A;  4QZF A;  5KG3 A;  1U4B A;  3AU6 A;  5AM3 A;  3HWT A;  3JPO A;  4U6P A;  2E5S A;  1SZH A;  4F72 A;  1PVQ A;  3SAF A;  2HW3 A;  3KOO A;  1NK0 A;  1KBU A;  4I2F A;  4DL2 A;  4DWI A;  4YR0 A;  3ZD8 A;  2KOB A;  5DDY A;  3UQ0 A;  1TK8 A;  2ASJ A;  2PXI A;  5TZV A;  1MQ3 A;  1S0V A;  2FMQ A;  3BQ1 A;  1HIW A;  2F8K A;  5DB6 A;  1RYR A;  4XQ8 A;  3UMC A;  1Y88 A;  5CA7 A;  4BXO A;  8ICN A;  3T79 A;  1PZN A;  4GFJ A;  3PO4 A;  2BPF A;  3H7I A;  4PL1 A;  4B9N A;  2FDR A;  4Z6F A;  3F2D A;  3L4P A;  4B9T A;  2HHW A;  4FFD A;  2FMS A;  3H0L B;  2CPR A;  3FAH A;  1X9W A;  3OHB A;  2WB1 C;  3F5A A;  2XGP A;  1S8O A;  4Y2S A;  1QQ6 A;  2HHQ A;  4M0A A;  4F8R A;  1JN3 A;  1ZET A;  2DPI A;  5KFV A;  4QIW C;  3ETR A;  2KN7 A;  4F5Q A;  2HVI A;  2FPM A;  5J8Y C;  4C4S A;  1X2I A;  4QZE A;  3QYP A;  9ICP A;  3H4D A;  5ALD A;  2XC9 A;  4GLX A;  5B66 U;  2J6S A;  4UAY A;  4F3O A;  5KFD A;  5C0Y A;  2MUT A;  4DSL A;  1ZOL A;  5KFH A;  1X6I A;  3D6J A;  1HEK A;  3PW2 A;  1NJX A;  9ICO A;  3GII A;  2FPL A;  1ZQB A;  4QJF B;  4ZOH C;  5ALL A;  3NVY A;  4RQ0 A;  2PMZ C;  4OJ6 A;  3NTU A;  4ELT A;  3NRZ A;  2FE9 A;  5DG9 A;  4UAZ A;  5DDM A;  1BNP A;  2NO5 A;  2KIV A;  1L6N A;  1ZQN A;  4Y2V A;  1JMS A;  9ICN A;  1ZQM A;  8ICI A;  4UAW A;  2IOF K;  4NV0 A;  1ZQE A;  3V72 A;  8ICH A;  1N60 A;  1NNL A;  1TAQ A;  3QNM A;  4FZL A;  2H3Z A;  9ICS A;  3OJS A;  3C2M A;  3ZD9 A;  1TVA A;  7ICV A;  1XSP A;  2K8A A;  2FLP A;  3WK4 A;  3AM9 A;  2KIW A;  3HKZ C;  4R8U B;  5ALO A;  4RQ6 A;  3QU7 A;  2BPC A;  2AQ0 A;  4NLK A;  3F5E A;  1QTM A;  5HR7 A;  1Z3E B;  2HBL A;  3MFH A;  3SMV A;  4BGD A;  2O6K A;  4Y2Q A;  4ELU A;  4M9H A;  9ICQ A;  3RB6 A;  3SR6 A;  2RRD A;  2L5Y A;  2HMX A;  3T5H A;  1ZD2 P;  3JPQ A;  3F2C A;  2I1Q A;  1LKY A;  3GFK B;  2OM6 A;  4OCZ A;  3OJU A;  4QWE A;  1GO3 F;  1XU4 A;  4M9L A;  2R8G A;  4PL2 A;  3WKB A;  5KT3 A;  5D49 A;  4UB3 A;  2E1F A;  1A76 A;  5KTQ A;  3TAN A;  3OGU A;  2Y9U A;  2DF4 B;  3MAB A;  1L3U A;  4Q8E A;  4Q45 A;  2MA1 A;  4KLF A;  2ZTE A;  3UM9 A;  3CYM A;  2LYH A;  4EEN A;  5ALT A;  9ICT A;  2JH7 A;  4RPZ A;  4ECV A;  3RR8 A;  4IQT A;  5J2G A;  5F3X B;  1SL0 A;  5J0P A;  4TQS A;  3PSF A;  3PX6 A;  3IP4 B;  5J2C A;  1ZQS A;  2OWO A;  2WHE A;  2KJ9 A;  5L1J A;  2PFO A;  2OCE A;  4IQW A;  1MSW D;  4TUR A;  1PUZ A;  4ED0 A;  3SD7 A;  3G6V A;  1PK3 A;  2EZY A;  3ED5 A;  3TFR A;  5DBA A;  2UVW A;  4BJQ A;  2NYV A;  3H40 A;  1OUQ A;  2KJ8 A;  4CE6 A;  5CHG A;  5D4B A;  4LZD A;  2ZJ8 A;  2B0C A;  4QW9 A;  2ATL A;  4KLG A;  4OO1 J;  4I2E A;  3RH4 A;  2FI1 A;  5AK4 A;  2NRT A;  4Q8F A;  3NVW A;  5JU5 A;  4CGZ A;  4DQS A;  1BVS A;  3C1Y A;  4I2J A;  2JEI A;  1QQ7 A;  1FO4 A;  4C8N A;  3RB3 A;  1IXR A;  4RQ5 A;  5AKY A;  2GH1 A;  1ZD3 A;  1KN5 A;  1MN8 A;  4J03 A;  4YCX A;  8ICC A;  3M8S A;  1QSL A;  1LB2 B;  2YY6 A;  3SAH A;  5T14 A;  5HNK A;  5AI5 A;  2ZG6 A;  2BKE A;  2KZ3 A;  1L7P A;  4O3Q A;  5ALN A;  2K8B B;  4DOC A;  5CWR A;  1ZD4 A;  2Y0S F;  2HHS A;  3BS5 A;  1ZQH A;  3H8W A;  2KHQ A;  3V7K A;  2IMW P;  5AKL A;  2DBY A;  3EPG A;  2H3Q A;  2VA8 A;  3SEN A;  1NKC A;  1ZRN A;  4C4T A;  1ECW A;  2BCV A;  1NKE A;  1C20 A;  2NRW A;  1ZQT A;  5HML A;  4RT3 A;  8ICM A;  3C2L A;  2F3N A;  4ECX A;  4CCH A;  2G5I B;  2A1J A;  2GLE A;  2XY6 A;  2NV3 A;  3ZDE A;  2E8N A;  1ZQ1 C;  2I5H A;  4WJ3 B;  3PW5 A;  1RQL A;  2JZB A;  1DK2 A;  3NRW A;  1ZQL A;  3H4B A;  4PGY A;  3M8R A;  4US8 A;  4IRK A;  5KFX A;  7ICF A;  8ICZ A;  3WU2 U;  4BDP A;  1NI3 A;  5AKG A;  4F71 A;  4QZH A;  4P4P A;  4M9J A;  1ZQU A;  5KFS A;  4M2Y A;  5CJ7 A;  3G6X A;  1PK1 A;  1U48 A;  1BPY A;  1VDV A;  1RQN A;  2ZIU A;  3LYS A;  5KFW A;  1JIH A;  3JPR A;  4ECS A;  2B21 A;  2XIC A;  3PX4 A;  2FPK A;  5ALJ A;  4YN4 A;  2P6U A;  1X6J A;  2DUY A;  8ICB A;  2ZTD A;  3RJE A;  1CEZ A;  8ICY A;  5KNI A;  3QX7 A;  5J0T A;  2XCA A;  2G06 A;  1S76 D;  5ALR A;  9ICM A;  1XSL A;  4DEZ A;  4OJP A;  2ZIV A;  2BQU A;  4Y2X A;  5KG1 A;  1J2N A;  1JI7 A;  3GZF A;  2R8J A;  4F2S A;  5GTH U;  4J9Q A;  3Q8P B;  1B22 A;  4Q43 A;  5L1I A;  2PFN A;  4KLS A;  4DSJ A;  9ICR A;  3O0F A;  3QUB A;  3HP6 A;  5AKX A;  1L8L A;  2XY7 A;  1A77 A;  1ZD5 A;  2GO7 A;  4M04 A;  1RZT A;  3D2S A;  2XI9 A;  4P0P A;  5J2I A;  7ICQ A;  4O3N A;  4DQQ A;  4Z6D A;  1N56 A;  8ICX A;  4YQW A;  1UQV A;  4YXJ A;  4J9P A;  4MFF A;  8ICG A;  4R64 A;  1NK8 A;  2ASD A;  4F5P A;  4FZN A;  2C2D A;  4UW9 A;  1TFR A;  3ZDA A;  5KFU A;  3BS5 B;  5KFQ A;  3F53 A;  9ICW A;  2ES6 A;  2W7O A;  1SWV A;  5H2F U;  1KL9 A;  4O3P A;  8ICF A;  5ALE A;  1O08 A;  1JXE A;  1ZQV A;  4JB3 A;  2KFN A;  2KJ5 A;  3BZK A;  2MRL A;  2A1A A;  5KFR A;  8ICA A;  1X40 A;  5J0O A;  3Q8Q B;  5DG8 A;  4EBD A;  3TAD A;  3UXO A;  3GIM A;  3BS7 A;  5ALQ A;  2W9B B;  7ICH A;  4IQU A;  4IQV A;  2GWS A;  2DPJ A;  4UAV A;  1TAM A;  5ALM A;  1X66 A;  3TAP A;  2EZX A;  2P35 A;  3B0X A;  4E0D A;  5E79 U;  4GC7 A;  1RM6 C;  7ICP A;  1TK5 A;  4B9M A;  4NLC A;  1PVR A;  4I2A A;  4P2H A;  2KK0 A;  3MDC A;  1ZQO A;  4O5K A;  2IOH A;  3BJY A;  3ZI4 A;  2Q4T A;  3NAS A;  5IIK A;  4BWJ A;  2BCS A;  3HPO A;  2W9C A;  4DL5 A;  4MHV A;  4R66 A;  8ICT A;  5EE3 A;  1BPB A;  3E0F A;  3QU2 A;  3WKC A;  2UVR A;  2ZIU B;  3PV8 A;  4O3O A;  2K8C B;  3MGH A;  2HDO A;  4JV1 A;  4DFJ A;  1ZQI A;  1ZQD A;  4JV0 A;  9ICI A;  3N28 A;  5KG4 A;  3F2B A;  1Z4N A;  4YR3 A;  3PZP A;  2EAN A;  4MF8 A;  1SIJ A;  3RFA A;  9ICB A;  4B9V A;  5KT5 A;  4TUQ A;  3MDA A;  5KAF U;  4QZD A;  3GU3 A;  1DXS A;  4NWI A;  4F2R A;  1Z4O A;  2KD1 A;  3D2Q A;  3EYZ A;  5KFI A;  5DGB A;  4Y2T A;  4GC6 A;  2H3F A;  1J2M A;  4K4G A;  5HHI A;  1P7D A;  3BQT A;  1SXE A;  7ICI A;  4RNO A;  3M7D A;  3MFI A;  4A8E A;  1SV4 A;  1T3Q A;  3RJH A;  2J6U A;  1Z19 A;  1NK4 A;  3RB0 A;  3Q8M A;  5J2E A;  1K5O A;  2ZXH A;  4YMN A;  1WUD A;  4F93 B;  2KZM A;  1ZQP A;  2NRV A;  3GV5 B;  1Z00 B;  3HX0 A;  1IG6 A;  3AEV A;  4KLJ A;  2WF5 A;  2R8K A;  4QZG A;  3WK8 A;  3CP8 A;  2Y9T A;  5EWG A;  3RJF A;  4F91 B;  4M6W A;  4I28 A;  4DS4 A;  2JHD A;  4CF4 A;  2KP7 A;  3ZDB A;  4JWM A;  1Q8K A;  2W43 A;  2BPG A;  1XNS A;  5AKZ A;  5EWF A;  4XUS A;  4DQP A;  1CUK A;  3IM1 A;  2I6X A;  4DLG A;  5AKJ A;  2HBM A;  1DOQ A;  5AM4 A;  4I2D A;  4JV2 A;  4X5V A;  4CNQ A;  4EX7 A;  4YVZ A;  1KQQ A;  3C23 A;  1S0M A;  2HOQ A;  1VLB A;  1COK A;  2KEY A;  3QE9 Y;  5KFJ A;  1SL1 A;  4RUA A;  1KW4 A;  1L5U A;  2BHN A;  1DK3 A;  3HJE A;  7ICE A;  4AYB C;  2WB1 F;  2YN4 A;  3OTQ A;  2C28 A;  4UAT A;  2JEJ A;  2CN1 A;  4XRH A;  4B6J A;  4QIW F;  2WTF A;  2CRX A;  1N63 A;  3OPX A;  2VA3 A;  2XGQ A;  3DDH A;  8ICL A;  3RBE A;  4I2I A;  4ECZ A;  4M9G A;  2K89 A;  3PSI A;  3AQF A;  2G09 A;  1T94 A;  7ICL A;  2KSO A;  2ZXI A;  1YZ7 A;  1DRG A;  1URJ A;  1JAL A;  2W04 A;  3RB4 A;  2F76 X;  2J6T A;  2YX8 A;  1LVH A;  9ICF A;  3JPS A;  4F4K A;  3ZDD A;  2ZIX A;  4F4W A;  5J2K A;  3QZ7 A;  4DSF A;  4P0Q A;  1F5S A;  1JUD A;  2YMM A;  4F4Y A;  2Z7J A;  3TQ1 A;  1S97 A;  5HR6 A;  4ECQ A;  5FP0 A;  4EX6 A;  7ICG A;  4C4R A;  2F77 X;  5B5E U;  3PW7 A;  3EWA A;  4F50 A;  4RT2 A;  1TE2 A;  4YP3 A;  2F8L A;  2PKE A;  5KT6 A;  3HKZ F;  3QEB Z;  4ED3 A;  3C28 A;  3KHR A;  2E3T A;  4UAS A;  2KVC A;  1NOM A;  2WF7 A;  3PW0 A;  5KT7 A;  3IG5 A;  4KLU A;  5G5H A;  5EE1 A;  4F92 B;  1PVP A;  3KZX A;  1S77 D;  4I2C A;  2ZIW A;  1SKW A;  1WCN A;  3SEI A;  3AUO A;  3C21 A;  1BPZ A;  3ICX A;  2OYY A;  4BX9 C;  1BPE A;  2NRX A;  4QNL A;  2I9G A;  1ZYQ A;  3PO5 A;  1ZJN A;  3HRD D;  1ARO P;  5KT2 A;  2EH9 A;  2JXJ A;  3BDP A;  1CI4 A;  4BXO B;  4M6W B;  3JPT A;  1UPH A;  4OJL A;  1K1Q A;  1D8L A;  2KMD A;  1S9F A;  7ICO A;  1V97 A;  1ZJM A;  2PFP A;  4XA5 A;  3TKA A;  2LKY A;  4EBE A;  3WKE A;  3GDX A;  1ZQQ A;  4RQN A;  2W8L A;  4FE3 A;  1KDH A;  3GV7 B;  5DG7 A;  4IR1 A;  1D8B A;  2ISP A;  1D9F A;  4RQ2 A;  2NRZ A;  3KZI U;  4DCC A;  4I2B A;  2QB0 A;  1X42 A;  1BGX T;  5J8Y A;  1U45 A;  4EYH B;  2OHF A;  2ZUC A;  1A6S A;  5L1M A;  5ALX A;  2JMG A;  3V7J A;  5KFE A;  2HOI A;  4RPX A;  3C5F A;  5L1K A;  1SKS A;  5CB1 A;  2C22 A;  4KIT B;  4RU9 A;  2W03 A;  3BQ2 A;  4YFK A;  4EBC A;  2MUT B;  3T5K A;  3VC8 A;  1RYU A;  1BNO A;  4KLM A;  4UB5 A;  3PSP A;  3ISC A;  2H3I A;  3ALR A;  5G5G A;  2M9N A;  3GIK A;  1TV9 A;  2AJQ A;  4OD0 A;  2Y1J A;  1XO1 A;  3UPQ A;  1WYG A;  9ICH A;  4DOA A;  3KKA A;  5IIN A;  9ICV A;  4CRX A;  4J9O A;  5KG5 A;  2ZIX B;  1NJY A;  8ICO A;  4KLI A;  4UQG A;  1EXN A;  2AXT U;  3BQ7 A;  5J2D A;  1RPL A;  1L8O A;  9ICC A;  2YML A;  5L1L A;  3JPN A;  5D46 A;  1Q3V A;  2G07 A;  2F1H A;  3N7P D;  5J0X A;  3PMN A;  4EEL A;  3M6K A;  1L7N A;  4DS5 A;  4QZC A;  2V9W A;  5ALZ A;  3FDS A;  2IHM A;  1V9P A;  4K4I A;  1WWV A;  3RRH A;  5ALS A;  3RJI A;  5ALY A;  2ZTC A;  4YMO A;  2W9M A;  4KLH A;  2V4R A;  3Q8K A;  2F1I A;  2BR0 A;  8ICQ A;  3OSP A;  2D6F C;  3H8J A;  1ZQY A;  3RJJ A;  2RHF A;  4PGX A;  2VA2 A;  1UT5 A;  5AK3 A;  4NLG A;  4MEY A;  9ICK A;  1LKY B;  1V85 A;  4QZB A;  3AN1 A;  2LYA A;  1UA1 A;  4MEX A;  3N7R C;  3TAD C;  1KEJ A;  1IM4 A;  1WWU A;  4UB4 A;  5AI4 A;  1NK7 A;  3PW4 A;  1FFU A;  3SZ2 A;  5KG7 A;  4QWD A;  3RRG A;  3ISD A;  3NVZ A;  4IL6 U;  4ICA A;  4C7Y A;  4GXJ A;  4I2G A;  4PHE A;  5TIS U;  1D9D A;  3I28 A;  2IA6 A;  4ELV A;  2D8C A;  4IC9 A;  5AK6 A;  1S0N A;  5J2F A;  2ZJ5 A;  2R8I A;  2YQE A;  4YD1 A;  3V7L A;  4YXM A;  5BOM A;  4QW8 A;  1N2X A;  2E8M A;  2ZJA A;  4DL7 A;  2BCU A;  4DFP A;  4KMO B;  1N48 A;  4NL9 A;  2QAR A;  1CRX A;  4QWA A;  4PH5 A;  1DGJ A;  1ZRM A;  3GQC A;  2KE7 A;  4NLN A;  3ETL A;  7ICR A;  2QB0 B;  4EYI B;  4RQ8 A;  5CRX A;  8ICV A;  1X9M A;  4UBB A;  1AQ6 A;  1TK0 A;  4ACO A;  1NZP A;  2A19 A;  2K4I A;  1FEZ A;  5KFL A;  2VJ5 A;  1MQ2 A;  5DLF A;  2AGO A;  3MR2 A;  3L3F X;  2KKP A;  1ZQR A;  1RXW A;  5III A;  1RYS A;  4ED6 A;  2BDP A;  4PJ0 U;  2BCR A;  3EPI A;  4Y2R A;  2D3D A;  3OHA A;  1SGG A;  5KL1 B;  4HYK A;  3RH6 A;  1OW5 A;  4Q44 A;  2LMR A;  5F9N A;  2F44 A;  2W11 A;  2OEH A;  1B43 A;  5ALI A;  7ICJ A;  2LM1 A;  1B0X A;  1SXD A;  4TUP A;  3PR5 B;  1RXV A;  1FIQ A;  9ICU A;  4ECU A;  4DSE A;  1YT3 A;  3A0H U;  2MAX A;  9ICL A;  4J9N A;  5KFC A;  2WAQ F;  5AKE A;  2LM4 A;  5J2H A;  2PI5 A;  3HIL A;  4KX3 A;  4JUZ A;  2HOF A;  1D8Y A;  2C2E A;  1HUZ A;  4DF8 A;  2YB1 A;  4GXI A;  2JV3 A;  4BWM A;  3FM9 A;  3SI8 A;  4Y2P A;  2A1J B;  3H8M A;  2XO7 A;  1HJP A;  4OJO A;  5ALG A;  4FBU A;  2HI0 A;  2FLN A;  2JZB B;  3RAX A;  7ICM A;  8ICW A;  1NK5 A;  1J97 A;  4RNN A;  4C8O A;  1ED1 A;  4RPY A;  2EZZ A;  3WK7 A;  2RP5 A;  1NKB A;  2HVH A;  3TAC B;  3K1Z A;  4QWC A;  5KG2 A;  5J2J A;  1T3N A;  5BOL A;  2ALZ A;  1SKR A;  5DKW A;  4JWN A;  2HHX A;  4NY8 A;  4US9 A;  4C7Z A;  2E1E A;  2OH2 A;  1SWW A;  1KSP A;  3KHL A;  1WCL A;  2P6R A;  2RLT A;  1PK1 B;  5AIB A;  3ONN A;  1LV5 A;  4IRC A;  9ICG A;  2HSZ A;  5EWE A;  4O3M A;  4KLQ A;  4DFK A;  4J9M A;  3RAQ A;  4EZ6 A;  3J81 j;  3UXN A;  4I2H A;  4YMM A;  5AI9 A;  5JTI A;  1ZXI A;  4OJ5 A;  4C8L A;  3QUT A;  4KLT A;  1NK6 A;  3CRX A;  4TUS A;  4ECW A;  1Z1B A;  2KFZ A;  3WKA A;  4ECR A;  3M9O B;  2W7P A;  2N1R A;  5AM2 A;  1ZQK A;  1A0P A;  5AKH A;  1ZQZ A;  3U26 A;  2ZIV B;  5EE9 A;  5KFT A;  2IBK A;  1SV0 A;  5AI8 A;  3A0B U;  5JRT A;  2DQN B;  3PY8 A;  3OSN A;  4DO9 A;  3PR4 A;  2W55 A;  3SYZ A;  1KRP A;  4NM1 A;  9ICE A;  3QXG A;  2LPE A;  4R8U A;  2JH1 A;  1KFT A;  2HBJ A;  3FYH A;  5A0L A;  4DFD A;  2NO4 A;  3RJK A;  3GV8 B;  2KG5 A;  4P0P B;  4DF4 A;  4PZO A;  1H38 A;  1QSY A;  4J9L A;  1SZP A;  1YZ6 A;  4JK1 A;  2CXY A;  3GIL A;  5J0W A;  3IV6 A;  4NJ8 A;  4O3R A;  2LI6 A;  4Y2J A;  2YMQ A;  3SAG A;  5HHH A;  5EOZ A;  3K1R B;  2KKV A;  3RBD A;  4UBC A;  3HT3 A;  4KN7 A;  3G6Y A;  5AI0 A;  2YB4 A;  1TKD A;  5F9L A;  1RDF A;  5KFM A;  1NJZ A;  3SV4 A;  1SL2 A;  5KFY A;  4O5C A;  3IG8 A;  3KD3 A;  1L7M A;  3QU9 A;  3MGV A;  4CF3 A;  5ALP A;  4Y2U A;  4ECT A;  2MU2 A;  2BDU A;  2FLL A;  3KTQ A;  5KAI U;  2H3V A;  3L5K A;  4M47 A;  9ICX A;  4GIB A;  3N97 B;  2AQ4 A;  2KIC A;  3UMB A;  3LWM A;  3WK5 A;  5JUM A;  5KFN A;  4DQR A;  5CEH A;  5AM0 A;  3WK9 A;  4J9K A;  4MF2 A;  2EDU A;  4AYB F;  2BGW A;  4QWB A;  3IDW A;  2EAP A;  5BPC A;  2OXO A;  3QU5 A;  4JMU A;  2XCP A;  4KX5 A;  3UMG A;  1C7Y A;  4USA A;  4GXK A;  4F5N A;  1U49 A;  5J2B A;  2G5H B;  5AKK A;  3MR3 A;  4ED7 A;  1S5L U;  2ODG A;  3D2N A;  4RZR A;  3IHQ B;  2W9C B;  2WFA A;  4YG2 A;  2AU0 A;  2AGQ A;  3DEE A;  2PMZ F;  4J9R A;  4YD2 A;  5L9X A;  3THV A;  3PVX A;  1COO A;  2R8H A;  1XS9 D;  3ISB A;  3QZ8 A;  4B9L A;  2FMP A;  1TAU A;  2WF8 A;  2P66 A;  3PST A;  2W8K A;  3KKA C;  4PPX A;  2MSN A;  3UXP A;  3V6H A;  3RJG A;  1KLN A;  4P4M A;  1O03 A;  2W3R A;  8ICJ A;  5AK5 A;  4EEY A;  3H8S A;  4FS2 A;  2ZUD A;  5DQG A;  5J0U A;  5ALW A;  5AKI A;  3GIJ A;  4KLL A;  1XO0 A;  2LBO A;  4MFC A;  3RR7 A;  3TI0 A;  2LHT A;  3IRU A;  4LZG A;  2YTU A;  2VKQ A;  2JRZ A;  2ZUB A;  4YR2 A;  5DQI A;  3AL0 B;  2AGP A;  5KFO A;  3LVV A;  3RF9 A;  1T4G A;  4NXZ A;  3HW8 A;  1VJ5 A;  3QU4 A;  2K4P A;  2K4E A;  3LDA A;  3H0M B;  4Z6C A;  5KG0 A;  4C80 A;  1QH9 A;  4QZ9 A;  2A3V A;  2LYB A;  1N62 A;  4HAI A;  5AIC A;  2HHU A;  2UVU A;  5HMM A;  4RQ7 A;  1QLN A;  2G0A A;  5DBC A;  7ICS A;  5KFF A;  2BZF A;  4TQR A;  4DOB A;  3V6K A;  1F0M A;  2QB1 A;  4J9S A;  1L3S A;  1JRO A;  2ISO A;  2M0N A;  1N5W A;  5K4L A;  1KFS A;  3KFU F;  4Y2Y A;  2XID A;  5J0S A;  4UB6 U;  4B9S A;  4UB1 A;  1U47 A;  1U9L A;  1S0O A;  4NL9 C;  3R9K A;  4R63 A;  2UVV A;  4RQ3 A;  1B4F A;  3C29 A;  4KN4 A;  4O0I A;  3MR6 A;  5IIO A;  5J0Q A;  2JEG A;  3NS1 A;  3TAR A;  2F1J A;  1HUO A;  1V38 A;  3NVV A;  4G3I A;  5AI6 A;  1UA0 A;  5C5J A;  5AM5 A;  1XWL A;  1T7P A;  2QKQ A;  4PGQ A;  5IIL A;  2KSO B;  3C2K A;  3BZC A;  1KKX A;  2R18 A;  3SQI A;  4DL3 A;  2E8O A;  4G9B A;  1BPX A;  4I27 A;  4IR9 A;  2Q0Z X;  3EW9 A;  4NLZ A;  1ZQW A;  2IHN A;  4P0Q B;  3DV9 A;  1UCV A;  4DL6 A;  9ICJ A;  1NJW A;  4PHD A;  2WF6 A;  4FZM A;  4ED8 A;  2EQY A;  1OXJ A;  1JXL A;  2Y0S C;  1UHU A;  3KHG A;  2WF9 A;  3CNH A;  4F5R A;  4UB8 U;  1JRP A;  3H0R B;  2G08 A;  5ALF A;  2W3S A;  3WKD A;  5DB8 A;  1Q46 A;  5J29 A;  3Q8S B;  4QZ8 A;  4F4Z A;  4FBT A;  3E58 A;  3QEA Z;  1SB3 C;  3MR5 A;  2C2R A;  2DWQ A;  4DFM A;  5KFP A;  2RDI A;  4QZA A;  1IV8 A;  4P4O A;  2ZIW B;  3B9J A;  4RQM A;  4MFA A;  2QLT A;  4KLE A;  3B0Y A;  3LK9 A;  4PHA A;  2RQ5 A;  5ALH A;  3PML A;  1JX4 A;  5KT4 A;  1ZQA A;  1NZB A;  1WG8 A;  3AQE A;  5J2A A;  2BQ3 A;  5J0Y A;  4O5E A;  2W9B A;  1KFD A;  4O3S A;  2YMP A;  3T5J A;  4C8M A;  5HP4 A;  2E8P A;  5J0R A;  7ICK A;  4C8K A;  3MC1 A;  3QUQ A;  3AU2 A;  5DLG A;  3WK6 A;  5KFK A;  2BQR A;  1S10 A;  2JR5 A;  5DB7 A;  2FJ6 A;  8ICE A;  5AHX A;  5DB9 A;  4RQ1 A;  4RNM A;  1F44 A;  2KZZ A;  1XC9 A;  3E2E A;  2VIX A;  4FS1 A;  3EUB 2;  4CDG A;  5DBB A;  3M1Y A;  4BUG A;  3KBB A;  2H5X A;  9ICA A;  3NUQ A;  4CF5 A;  3QUC A;  3N7S C;  3LWL A;  3ZDC A;  4R65 A;  2IOF A;  2DL0 A;  8ICU A;  3MBY A;  3VCB A;  3I1Y A;  3AMZ A;  2DFL A;  1FFV A;  1X9S A;  4UAR A;  4FO6 A;  2XVT A;  5GTI U;  5DQH A;  1DGS A;  4ED1 A;  2PI4 A;  5IIM A;  2JGA A;  4O9M A;  1SV0 C;  1ZQJ A;  4NLB A;  4PZN A;  1T8E A;  4RUC A;  5KG6 A;  1ZQF A;  2EAM A;  2K4H A;  3FC4 A;  1NK9 A;  1BPD A;  4ED2 A;  3TAQ A;  2HBK A;  2KNJ A;  4RQ4 A;  2HHT A;  3JPP A;  1X9X A;  4KMU A;  7ICN A;  1Z00 A;  1XSN A;  4UB2 A;  5CR0 A;  3K4G A;  4EZ9 A;  2HCF A;  2W9A A;  4NM2 A;  1L7O A;  3I76 A;  3ORY A;  1N61 A;  2PFQ A;  2K60 A;  8ICR A;  1KTQ A;  3V6J A;  2ESE A;  4DL4 A;  2XY5 A;  2WAQ C;  1QQ5 A;  3TFS A;  3LVW A;  5KFB A;  2VJ4 A;  3UQ2 A;  4Z6E A;  3PX0 A;  4C0Z A;  4U7C A;  2Y1I A;  2AHO B;  4ZH4 A;  2DKZ A;  4KLO A;  1MA7 A;  4DLE A;  3Q8L A;  4B9U A;  4PHP A;  4KLD A;  3NGD A;  5ALV A;  3RTV A;  3T3F A;  5ALK A;  2JEF A;  3C1Z A;  2B6G A;  3IN5 A;  5IIJ A;  1IIP A;  1L3T A;  1L3V A;  4QZI A;  2AH5 A;  2EAO A;  1K1S A;  8ICP A;  2GOL A;  4I29 A;  3EZ5 A;  2W54 A;  5KFG A;  5ALU A;  2RDJ A;  5KL8 B;  1Q3U A;  4DQI A;  3C5G A;  5AM1 A;  2KVS A;  7ICT A;  3BQ0 A;  2F2A B;  2HHV A;  7ICU A;  1QSS A;  3CW2 C;  3KHH A;  3M9N B;  5KFA A;  3M9M B;  3MGI A;  4EEK A;  4AP9 A;  5DGA A;  5EE0 A;  4IRD A;  8ICK A;  3RH5 A;  4F4X A;  4IS7 A; 
#chains in the Genus database with same CATH homology
 2JGA A;  2DGZ A;  2G5H B;  2WAQ F;  1A6S A;  2KHV A;  5T14 A;  4NLB A;  5HR6 A;  4ICA A;  2JMG A;  3H0L B;  2CPR A;  1TAM A;  2DQN B;  2ZG6 A;  2HOI A;  3D2N A;  3CP8 A;  2RRD A;  2K4H A;  2HMX A;  2M0N A;  2ZIW B;  4IC9 A;  2K8B B;  2F77 X;  4KX3 A;  2HOF A;  3F2C A;  2W03 A;  2JH1 A;  3KFU F;  3DEE A;  2JHD A;  2HBK A;  2PMZ F;  2WB1 C;  2YB1 A;  2XID A;  3F5A A;  2OM6 A;  3VC8 A;  2KNJ A;  2HBJ A;  2KV2 A;  5A0L A;  1GO3 F;  2G06 A;  2Y0S F;  2F8L A;  4PL2 A;  1XNS A;  3PSP A;  1NZB A;  4P0P B;  4NLC A;  2KHQ A;  4OJP A;  2H3I A;  1PVR A;  4QIW C;  3ALR A;  3AQE A;  3HKZ F;  2H3Q A;  2ZIV A;  2E1F A;  3C28 A;  2Q4T A;  2KVC A;  4KMO B;  2HBM A;  3M6Z A;  3GZF A;  1CRX A;  3IG5 A;  1PVP A;  3KZX A;  2DF4 B;  4OJO A;  3PST A;  2MA1 A;  4CRX A;  1ECW A;  3CYM A;  3SAG A;  2ZIW A;  3C29 A;  2WAQ C;  3O0F A;  5C0Y A;  2ZIX B;  3LVW A;  2KKV A;  2JH7 A;  2HOQ A;  1ED1 A;  2VJ4 A;  1HEK A;  3E0F A;  3D2S A;  2ZIU B;  5CRX A;  2XI9 A;  2KEY A;  3ICX A;  2YB4 A;  2RP5 A;  4C0Z A;  4QJF B;  4U7C A;  4P0P A;  2K8C B;  2G5I B;  2OYY A;  3K1Z A;  4ACO A;  4BX9 C;  3SMV A;  1XO0 A;  3IG8 A;  2LBO A;  3PSF A;  1MA7 A;  2PMZ C;  2E5S A;  4OJ6 A;  4QNL A;  2WB1 F;  2K4I A;  1SZH A;  3IP4 B;  4AYB C;  4U6P A;  3MGV A;  2NV3 A;  2VJ5 A;  1PVQ A;  1Q3V A;  3F2B A;  1F44 A;  2G07 A;  2LHT A;  3N7P D;  3SAF A;  2KJ9 A;  3PZP A;  2R18 A;  1ZQ1 C;  2CN1 A;  2E1E A;  3L3F X;  3M6K A;  2BDU A;  2VIX A;  4QIW F;  1KBU A;  2KKP A;  3RFA A;  2CRX A;  2OH2 A;  3SQI A;  4FZN A;  1L6N A;  4WJ3 B;  1UPH A;  4OJL A;  2VKQ A;  3IN5 A;  1IIP A;  4CDG A;  3OPX A;  4BUG A;  3NRW A;  3AL0 B;  2KOB A;  2H3V A;  3F53 A;  3LVV A;  3GU3 A;  3ONN A;  3RF9 A;  3NUQ A;  4NWI A;  2W7O A;  4P0Q B;  2GOL A;  4NV0 A;  4BJQ A;  2KIC A;  2K89 A;  2KD1 A;  3D2Q A;  3N7S C;  5KL1 B;  1OUQ A;  2KJ8 A;  4FZM A;  5KL8 B;  1Q3U A;  3PSI A;  4O3M A;  2LKY A;  3AQF A;  2H3F A;  1HIW A;  4OO1 J;  2G09 A;  1T94 A;  2D6F C;  4FZL A;  2KJ5 A;  2H3Z A;  2F2A B;  2Y0S C;  2K4E A;  2ZXI A;  1URJ A;  2RHF A;  1P7D A;  1DRG A;  3H0M B;  2W04 A;  2K8A A;  2F76 X;  2MRL A;  3M7D A;  4FE3 A;  4OJ5 A;  3VCB A;  4CGZ A;  2YX8 A;  2KIW A;  4A8E A;  3HKZ C;  3T79 A;  3CRX A;  4AYB F;  1Z19 A;  3H0R B;  2A3V A;  1D8B A;  4GFJ A;  2G08 A;  2LYA A;  2LYB A;  1Z1B A;  3N7R C;  2ZIX A;  2W7P A;  2OXO A;  4PL1 A;  2ZXH A;  4JMU A;  2N1R A;  2G0A A;  1WUD A;  3F5E A;  4P0Q A;  1A0P A;  2GH1 A;  2ZIU A;  3LYS A;  4KX5 A;  5HR7 A;  2XVT A;  1YT3 A;  3F2D A;  2XIC A;  2HBL A;  2ZIV B;  2Z7J A;  3SAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...