3KFUF

Crystal structure of the transamidosome
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
453
structure length
447
Chain Sequence
MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGERRVRIKRLHLEEDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEILRRGEKVKQATMGFEEGSGKTYPMADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 111
structure length 447
sequence length 453
chains with identical sequence I
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kfuF02
4WJ3B 3H0RB 1ZQ1C 2G5HB 2DF4B 3IP4B 3AL0B 3KFUF 2DQNB 2D6FC 3H0MB 2F2AB 3H0LB 2G5IB
chains in the Genus database with same CATH superfamily
1U48A 4EX7A 5DB8A 4QZBA 4C4RA 4O5EA 7ICEA 5KFWA 1VJ5A 3MR5A 2ZIVB 4OD0A 5F3XB 4YXJA 3RB3A 2BCVA 5B5EU 5J2AA 3G6XA 2R18A 2P6RA 4YVZA 2ZTEA 3HKZF 2W03A 4RQ7A 2F3NA 5ALHA 5AK4A 4UAVA 4YN4A 2JH1A 4O0IA 4ED1A 4KLLA 3QYPA 3H4BA 3ETRA 2GLEA 5DKWA 4ECXA 4ICAA 2L5YA 1EXNA 2F1HA 2QKQA 7ICIA 5CP2A 5J2FA 3F2CA 4ECSA 4IR1A 3BQ1A 1NJZA 2AGPA 4E0DA 1ZQ1C 1N56A 1DK3A 2JMGA 3PW5A 2Y1IA 5AKZA 9ICVA 2J6SA 1V38A 4DLGA 9ICJA 4RQ3A 4ECQA 2ISOA 3V6HA 4ED2A 2AHOB 7ICRA 1Z00B 2BCUA 5B66U 2BQRA 4OJ5A 4F3OA 4QW9A 4F4XA 1PZNA 5TISU 2WAQF 4O3RA 4LZGA 9ICMA 3TI0A 3NUQA 4GXJA 4BUGA 3QEBZ 4QWCA 3TAQA 1JALA 2AQ0A 9ICHA 3ZI4A 4JMUA 1ZQOA 5KG6A 2JGAA 3MGIA 4I2BA 4I2EA 1ZD2P 1V85A 2DGZA 1S97A 1NK7A 1X42A 3NASA 1SKRA 4I2IA 2Y0SC 4C4SA 5J0OA 4B9MA 1Z4NA 3UMCA 1ZQJA 4DOAA 5AHXA 4DFDA 3GV8B 5EWFA 1RYUA 4O5KA 3PVXA 2LHTA 3EUB2 3U26A 1PK3A 5AK6A 1ZQKA 4Y2QA 3C2MA 3FM9A 2KEYA 2W43A 4PHAA 4ECYA 2I5HA 4YCXA 2DFLA 4CE6A 4ECUA 2MSNA 2DWQA 5KG2A 7ICSA 1VLBA 2JEJA 2UVRA 3L5KA 2E8MA 3QUQA 4KLTA 4ECWA 1ZQQA 2P66A 4ECZA 8ICBA 1SV4A 2H3ZA 3IG8A 2IHNA 1ZQTA 1KFSA 7ICVA 2BPCA 3GV7B 4GXIA 5KFRA 1S77D 2KKPA 5J2GA 1B43A 2G5HB 3NRWA 4DQPA 5DB7A 4OJOA 4PH5A 1HIWA 1F5SA 2I9GA 2RRDA 8ICVA 2RHFA 4RNMA 1JUDA 3BS5A 2YMLA 1QTMA 3FYHA 2Y9UA 1P7DA 2G07A 2ZIUA 3GIJA 2QARA 2GO7A 3QU2A 4Z6EA 2FPMA 5J2CA 4KMUA 4Y2UA 1DRGA 4TQSA 5AKKA 3RJJA 1VDVA 2XGQA 4EZ9A 2KJ9A 4EZ6A 4MF8A 2KFNA 9ICEA 3UM9A 4KLJA 4NLCA 3WKAA 4RQ2A 1ZQRA 1QCKA 5JUMA 1MN8A 4ED7A 7ICKA 4PPXA 5EE0A 3PW7A 2HW3A 4Z6DA 3AQFA 1ZD3A 1BPEA 2KZZA 8ICGA 3KHLA 2ZIXB 5DB6A 2W7OA 5DGBA 4P0PA 3OHAA 1HEKA 1S8OA 2KN7A 3PX4A 1ZQLA 1ZQFA 1K1QA 2LPEA 2A1JA 3H0RB 5ALZA 2BQUA 5GTIU 3V7LA 1L7OA 4C4TA 5J0TA 2G06A 2DQNB 1ZETA 4Q8FA 4C0ZA 2BCSA 2QB0B 4KN4A 4JB3A 1T3NA 9ICCA 4EEKA 1L7PA 4F5OA 8ICWA 5GTHU 4F5RA 1SV0C 2JRZA 3T5LA 5AI4A 4DS4A 1KSPA 4KLOA 2I1QA 4NLNA 4C8KA 3SENA 4P4PA 1L3UA 4DFPA 4YG2A 5KT4A 2XICA 3JPSA 5KFNA 3QUBA 4NY8A 3OGUA 2NO4A 3NVWA 4G9BA 2AU0A 2ZUCA 1S0NA 4QWBA 2OHFA 5J0PA 4YMNA 2NRVA 4P2HA 1SV0A 5KT5A 2D6FC 4DO9A 5DG8A 1CUKA 2HBKA 5AIBA 4C7YA 3TFRA 2AH5A 5IIIA 3OHBA 1ZQPA 1Q3VA 4RUCA 5AKYA 4CRXA 2W9CB 4Y2YA 3RJIA 2VIXA 3VC8A 5IILA 5KL8B 2B6GA 4QIWC 1MC8A 1HUZA 4KLQA 4QZAA 2JZBA 1N2XA 2IOFA 2W9BB 1X9SA 1WG8A 1XO1A 2M9NA 1C7YA 1KQQA 4O9MA 2G5IB 4TUPA 5HR7A 4ED6A 1NNLA 1X66A 1A77A 3T79A 3V6KA 4NLZA 4CF3A 3QZ8A 1RQLA 2W3SA 4CF5A 4J9MA 3UMGA 5L1LA 5AI5A 3UMBA 2PI4A 2BHNA 7ICUA 2KIWA 3KBBA 1BPZA 1O08A 3DDHA 4NM1A 3Q8KA 2V9WA 8ICRA 4AP9A 4A8EA 1FFVA 4YQWA 5ALNA 4JV2A 3H8JA 2ASJA 2K8AA 3T5KA 2V4RA 4O3OA 1C20A 1SL0A 2BDUA 2ZIVA 4IQVA 2K4EA 2YQEA 4OJPA 1Z4OA 2JXJA 2LYHA 4BXOA 1T3QA 4DL7A 1S0OA 1DK2A 2W9AA 9ICKA 4UB5A 1SXEA 1N63A 2N1RA 2WF7A 5KL1B 2R8HA 3ZDAA 5IIOA 3AM9A 3H0LB 5AI9A 1U49A 3FAHA 5AM4A 5FP0A 4KLGA 2W54A 1S5LU 4F71A 4RQ0A 4IR9A 3SD7A 1XC9A 1KFDA 2CPRA 2MUTB 1ZQUA 3RB0A 3NRZA 1NKCA 4RU9A 3NVZA 4DOCA 5IINA 3WK6A 1ZQEA 1COKA 5J0SA 5KFUA 4JV1A 1SZHA 1QQ6A 2J6TA 8ICIA 5DQGA 2W8KA 4ED8A 4KITB 5AM5A 8ICKA 2K8BB 4KLSA 5DG9A 2WF6A 3D2QA 2XO7A 4Z6FA 2PMZC 4U7CA 3K1RB 2OWOA 2ZTCA 4YMMA 3EYZA 4LZDA 2FI1A 3QE9Y 2PI5A 3WK7A 1ZQYA 2PFPA 3H4DA 1MQ2A 4QZ8A 1TFRA 2RQ5A 5H2FU 4B9VA 2DKXA 4KLUA 3RBDA 3AU6A 1ZOLA 2HHWA 2K8CB 5IIKA 1TK8A 1IG6A 8ICNA 3ISBA 9ICRA 1AQ6A 1DGJA 4UB2A 5KG5A 8ICXA 1V97A 4ECVA 2JEIA 4PZNA 1CEZA 2H5XA 1FO4A 7ICGA 3QNMA 4TUSA 3HX0A 4YXMA 4KLIA 3MR2A 1SXDA 5J2JA 1D9FA 1D8YA 1B4FA 4DQIA 3TFSA 2F77X 2VA8A 5KFTA 5KFJA 2LI6A 2ZUBA 1RXWA 3SQIA 1RXVA 2YB1A 2BQ3A 2CXYA 1ZQXA 4M2YA 3GV5B 3PY8A 4BJQA 4US8A 3IG5A 4O3QA 1X40A 2D3DA 3UXNA 4J9NA 3F2BA 3OPXA 3PO4A 4RQ5A 1KEJA 4J9RA 4QIWF 3FC4A 2KK0A 5KFDA 8ICTA 2NRWA 3N7SC 1YZ6A 1WCLA 4Y2XA 4EEYA 1OXJA 3D2NA 7ICMA 4B9TA 2E3TA 1V9PA 3V7KA 1QSSA 3G6YA 2CN1A 4IRKA 3WKCA 2PKEA 5J2KA 4NL9C 3M9OB 4EYHB 5KFSA 5T14A 3HJEA 4CGZA 1N61A 4US9A 3PO5A 3QX7A 3WK9A 1UHUA 2BPFA 2PFQA 2Y1JA 1LV5A 5AKJA 3V7JA 3NTUA 2ZIWB 1F44A 3WK4A 1TVAA 1JIHA 3OJUA 1YZ7A 4I2JA 7ICOA 1IXRA 4USAA 4CF4A 5ALMA 4KLEA 3ONNA 2EZXA 4NL9A 1NZBA 2YMQA 1TAUA 2LM1A 4DQRA 2G08A 5AI6A 1XU4A 4G3IA 2HMXA 2HHQA 3K75D 5DBAA 3GIIA 3SZ2A 5AI8A 1ZQDA 4NM2A 3R9KA 4QWEA 8ICLA 4R64A 5BOMA 4OJ6A 3NVYA 4GIBA 4Y2JA 3RJFA 3KOOA 3RJKA 1T4GA 3B9JA 1OW5A 2K4HA 2FPLA 2MAXA 2DF4B 3EPGA 2BCQA 1LKYA 3TACB 1KDHA 5G5HA 4DCCA 4RPXA 1Z1VA 2R8KA 4UW9A 1LB2B 4R8UB 2AJQA 1NKEA 3QU7A 4DF4A 4YD2A 2FE9A 1QLNA 4DWIA 4FS2A 2QB0A 3C2KA 3BJYA 3C5GA 1WYGA 3JPRA 5L1KA 5KFXA 2BKEA 1RYRA 2A19A 3KD3A 4CNQA 1N60A 1AROP 2FMPA 4IS7A 3T5JA 5KNIA 1RQNA 4J9SA 5J0YA 9ICGA 3WK5A 2P35A 2H3QA 2E1EA 2LBOA 4F72A 4M9GA 2Y9TA 2OYYA 2XCAA 4J9OA 3MGHA 4M6WB 5HHIA 4DSFA 2E8PA 2MA1A 3H40A 1UPHA 2KG5A 2NYVA 1QQ5A 3B0YA 3UXOA 4QZDA 1U4BA 3C21A 1L7MA 4KN7A 3Q8PB 5KFFA 1WWVA 4QWDA 1ZRNA 4F8RA 2RP5A 3HRDD 3TADC 1NKBA 4JK1A 4NLBA 2KSOB 1MQ3A 4QZEA 5AI0A 4RUAA 4I2GA 1JMSA 1NI3A 4RPYA 1TV9A 4F4YA 5HP4A 1N48A 2G0AA 4PHPA 3IHQB 3BQTA 5J0RA 4MEXA 3A0BU 2ES6A 2VJ4A 2HBLA 3IDWA 5F9NA 4UB8U 3AU2A 3DEEA 4K4IA 4DSLA 2BR0A 3TADA 3WKBA 2KP7A 3RTVA 1L7NA 1UT5A 3RAXA 2WB1F 3BZKA 5EWGA 9ICAA 1S9FA 2JV3A 1ECWA 3MBYA 3N4MB 2W9MA 2G09A 1JX4A 5DDYA 4K4HA 5HMLA 3M8RA 4EBDA 4XQ8A 2H3FA 2Z7JA 1L3VA 1SKWA 4PL2A 1BPXA 2JHDA 3L3FX 4CDGA 2OEHA 5KFIA 3HILA 1RG6A 5ALWA 1ZQIA 5D46A 3WK8A 3EPIA 4QZGA 3Q8MA 3GILA 5L1IA 5KFOA 2FMSA 4M9JA 3PX6A 1L5UA 1UT8A 2IOHA 1BNPA 2E8OA 5CB1A 5ALLA 3OJSA 2OXOA 5DLFA 2Q0ZX 4NLGA 3VCBA 2DL0A 3UPQA 4I28A 1D8LA 3HW8A 3ALRA 1UA1A 2XVTA 2HOFA 5F9LA 1KKXA 3Q8LA 1RM6C 4XA5A 5AKGA 1XS9D 4RT2A 1IV8A 2W04A 3IM1A 3TANA 4JUZA 1S0MA 2QLTA 3SMVA 1KLNA 4PGQA 8ICMA 1SWWA 3G6VA 1NJYA 4F91B 1SL1A 3M9NB 1ED1A 4TQRA 1CRXA 4XUSA 4PL1A 7ICPA 3MC1A 3BQ7A 3DV9A 1ZD5A 3F5AA 4RQNA 3CYMA 2BCRA 4M04A 1NK9A 1N5WA 4Y2TA 5J29A 4RQ8A 2HI0A 4KX3A 3ETLA 1ZQNA 3O0FA 1Z3EB 5EE1A 5HR6A 2FDRA 8ICPA 2IMWP 4GC7A 1ZQCA 3H8MA 1MSWD 5J0WA 2LMRA 3TAPA 5KFHA 4M9LA 1S76D 3KFUF 8ICZA 4KMOB 4DSKA 4YD1A 5DDMA 4J9LA 3HP6A 5D4BA 3M8SA 2WTFA 2LKYA 2RDJA 4IL6U 4UB4A 2XIDA 3RH4A 5CHGA 3M6ZA 5J2EA 2W7PA 2EANA 2Y0SF 5KFLA 5J2DA 2EAPA 1NK8A 3M7DA 4RQ1A 8ICUA 3C29A 3IP4B 3PX0A 2HCFA 2W55A 3CNHA 4OCZA 5KAIU 2DKZA 2KOBA 2CRXA 2VJ5A 4JWMA 5J2BA 4Z6CA 3AMZA 3PSTA 1D8BA 1PVRA 4DL6A 2YX8A 3QUCA 4F2SA 4UAUA 2YTUA 2Q4TA 3PV8A 3UXPA 4DFKA 2PXIA 2F1JA 4Q8EA 4KTQA 3ZDDA 1PK1A 2VANA 4GC6A 4GLXA 3MGVA 9ICLA 3EZ5A 5EWEA 2FJ6A 2VA2A 2ZUDA 3LWLA 3SEIA 3PW0A 3B0XA 1KFTA 5C0YA 2UVUA 1JXLA 4RQ6A 2ZTDA 3BQ0A 1SKSA 3J81j 4IQWA 1A0PA 2ATLA 3BS5B 4RZRA 3PMLA 3MR3A 5HNKA 2ZIWA 2ZIUB 3CP8A 3UQ0A 3GZFA 5KFPA 1OUQA 2A1AA 3HKZC 1ZXIA 4KLMA 3AN1A 5KG1A 2KTQA 2GWSA 1SL2A 1GO3F 1BPBA 8ICYA 2MU2A 4B6JA 5KG7A 3M6KA 1Q3UA 4PZOA 2EZZA 2H3VA 5EE9A 2BDPA 2BPGA 1XNSA 1KL9A 1Q46A 3WKDA 4IC9A 3MDAA 3BDPA 4M9NA 3T5HA 4KX5A 5CRXA 2EZYA 2PFNA 5ALKA 5ALTA 2HOQA 1WUDA 1KN5A 3C2LA 1UA0A 5KG0A 2UVWA 3ICXA 2HHSA 2D8CA 4YR3A 4UAZA 2B0CA 3SAGA 2NO5A 3KKAC 1SIJA 8ICFA 4IRDA 5KFYA 3RJGA 5CA7A 1Z00A 4Y2VA 7ICHA 4FBUA 2ZXHA 4KLFA 4UAWA 2FMQA 5KFMA 1QH9A 2BZFA 2A1JB 1JROA 4J03A 4I2FA 4DQQA 4M47A 2HHXA 4M9HA 1K5OA 3FDSA 3RR8A 4F4KA 2KJ5A 2C2EA 1M6YA 2KJ8A 1U45A 2KD1A 2ESEA 2GOLA 3KKAA 1X9MA 1PVQA 4K4GA 3ISCA 5ALDA 4QZFA 4ED0A 4TURA 2KVSA 2JEGA 1N5XA 3KHRA 4OO1J 3QU4A 3CW2C 4DL2A 3TARA 2O6KA 7ICLA 3LYSA 3C23A 4DQSA 4YR2A 1TE2A 1T94A 2WF5A 8ICJA 1ZQBA 1JRPA 2KV2A 1QSLA 2JEFA 3QXGA 2W11A 5AKXA 4FZLA 3N7PD 2ISPA 9ICOA 4DS5A 1KTQA 3GQCA 3SR6A 5ALGA 3RB4A 4Q43A 1URJA 4UBBA 4C8NA 4AYBC 4IQUA 4JV0A 4RQMA 5J2HA 3QUTA 1T8EA 2IA6A 4UB1A 5AM1A 4QZIA 1BPDA 5EE3A 4F4WA 1KW4A 4QZCA 2NRTA 2WF8A 1XWLA 3JPTA 2JZBB 2GH1A 3GFKB 5DBBA 3JPPA 5AKEA 3F2DA 3MABA 4NJ8A 2EAOA 4DOBA 4I2DA 3RR7A 3T3FA 3CRXA 4RNOA 2DBYA 5AK3A 3PW4A 3LVVA 5ALIA 9ICUA 5ALUA 1NK0A 4Y2RA 5AM3A 4YR0A 4DEZA 4B9UA 4QZ9A 4FS1A 9ICQA 4Q45A 2YMMA 4ZOHC 2KICA 1XO0A 3RAQA 2EAMA 2F1IA 2VKQA 3H0MB 3WKEA 2AGOA 3N97B 1NOMA 4HAIA 3AL0B 3LVWA 1RDFA 5AIAA 8ICOA 7ICFA 3THVA 3RH6A 1Z1BA 5KAFU 2C22A 2FLNA 4EBEA 3PW2A 4MFCA 4Y2SA 2R8IA 4Y2PA 9ICSA 4BXOB 4UARA 5KFZA 1J2NA 5L9XA 1RZTA 3L4PA 9ICPA 4KLHA 2FLLA 5ALRA 1SWVA 2XY6A 3OTQA 9ICXA 3KZXA 5JTIA 4JWNA 9ICIA 2ZIXA 2ODGA 5AM0A 2MRLA 1DOQA 1ZQWA 3IN5A 2UVVA 3NGDA 3GIMA 1RYSA 4O3PA 4WJ3B 1NJXA 2NV3A 5G5GA 2ZJ8A 3LK9A 4PJ0U 3JPNA 7ICNA 2W3RA 3PNCA 3UQ2A 3PR5B 4F50A 3OSNA 4KLDA 1COOA 1KRPA 1TAQA 4GFJA 1DXSA 1NK4A 1ZQZA 4RQ4A 2PMZF 2IOFK 3ZD9A 4DLEA 3RH5A 4F2RA 4MFFA 4MF2A 2ZJAA 4NWIA 3RRHA 2YMPA 2E1FA 1X6IA 1S0VA 3C28A 1KBUA 4RNNA 9ICWA 3F53A 2WFAA 4MHVA 2A3VA 3IV6A 2K60A 5DLGA 2ZG6A 4O3NA 2JR5A 4BGDA 2QB1A 1B22A 1ZQAA 5DB9A 4O3SA 1YT3A 3RFAA 2AXTU 1ZRMA 4GXKA 3TKAA 2W9CA 2KMDA 3MDCA 1NZPA 2ASLA 4P0QB 1TK5A 3C1ZA 9ICNA 5ALOA 5DBCA 8ICEA 1A6SA 3ORYA 5BOLA 4QNLA 4EYIB 4F5PA 5J0QA 2EQYA 2E5SA 4UATA 5KT2A 2HBJA 2AGQA 4J9PA 1BVSA 2W9BA 5KG4A 3SV4A 1L6NA 3N7RC 3HWTA 2KZ3A 2OCEA 3NS1A 5J0UA 4B9SA 2KIVA 4AYBF 3Q8QB 4YP3A 1ZQVA 1XSLA 1CI4A 4FZNA 2KNJA 5L1MA 1ZQHA 4I2CA 5KT7A 2HVHA 4FO6A 4P4MA 4ELVA 1NJWA 4QZHA 5ALQA 3EWAA 4MEYA 2HHUA 4C8OA 5KFAA 2HDOA 4O5CA 2B21A 3RJHA 4ZH4A 4O3MA 4DL4A 4RPZA 4FFDA 5AKHA 9ICFA 2BGWA 4NXZA 4PHDA 2IBKA 4DSIA 4YMOA 1B0XA 4DSJA 3Q8RB 2J6UA 4UASA 3RF9A 1WCNA 1MA7A 1FIQA 2JH7A 1N62A 3ISDA 3SYZA 2DPJA 4F93B 2VA3A 1L3TA 1F0MA 1ZJNA 9ICBA 3RBEA 3QU9A 1NK6A 2XI9A 1O03A 3IRUA 2ZJ5A 4M0AA 1L8OA 3PSPA 4LVSA 2K4IA 4C8MA 2LYBA 4FZMA 1J2MA 2DPIA 7ICQA 2KE7A 2MUTA 2ASDA 2C2RA 2YB4A 1LKYB 2AQ4A 4R63A 3H8WA 4TUQA 5HMMA 1TK0A 3OSPA 1TKDA 1ZQGA 2ZXIA 5L1JA 4F5QA 4BDPA 4LJXA 4B9LA 2HSZA 4EX6A 5DQHA 3I1YA 3H7IA 1RPLA 4RT3A 4B9NA 3QEAZ 1S10A 1XSPA 4UB3A 1JI7A 3K4GA 3RB6A 5BPCA 1Z19A 2I6XA 2HHTA 2H3IA 5KTQA 5J2IA 7ICTA 1QQ7A 4IQTA 5ALPA 4MFAA 5IIMA 1NK5A 1X6JA 4P4OA 1U9LA 4FE3A 2NRXA 8ICAA 4I29A 3E58A 4DF8A 4ECTA 2EDUA 1X9XA 3A0HU 3GDXA 2KHQA 3GU3A 5E79U 3C1YA 4C80A 8ICQA 1TAMA 4I2AA 3SAFA 1D9DA 3V6JA 5CR0A 3RRGA 3AUOA 4I2HA 8ICSA 5ALVA 5KT6A 3AQEA 1ZYQA 2LM4A 1SB3C 1HJPA 4PGXA 2K4PA 1BNOA 5TZVA 5IIJA 3SI8A 3JPQA 4UB6U 3E0FA 3PZPA 5JRTA 5C5JA 2M0NA 2C28A 3M1YA 4DL3A 4OJLA 5KFKA 1IM4A 5AK5A 5KFEA 1UCVA 4BX9C 4DFMA 4F5NA 4ELTA 1ZJMA 4QWAA 1UQVA 4R66A 3LWMA 4XRHA 2W8LA 3PSIA 3WU2U 2OM6A 3ZDEA 4FBTA 2F44A 2QARB 3KHGA 2XY7A 4J9KA 4R65A 5J8YC 5AKIA 4EENA 2F76X 1PVPA 5ALYA 1A76A 1FFUA 1SZPA 5HHHA 4C7ZA 2OH2A 3PSFA 1DGSA 5DGAA 2HOIA 4PHEA 2WF9A 3HPOA 1IIPA 2XGPA 4ECRA 2KKVA 4CCHA 1L8LA 3HT3A 1X9WA 5ALEA 1K1SA 3RJEA 3ZDCA 5ALXA 4C8LA 4DFJA 1LVHA 2F2AB 2KFZA 1QSYA 2E8NA 3BQ2A 5J8YA 5KFGA 2DUYA 2EH9A 4EBCA 5ALFA 2YN4A 2XC9A 4BWMA 3PMNA 4BWJA 4DL5A 1Y88A 2XY5A 2C2DA 3SV3A 5K4LA 3S6JA 1U47A 3QU5A 3KTQA 4R8UA 4P0PB 1ZQSA 2P6UA 4ACOA 3KHHA 5DG7A 2ALZA 1L3SA 2WAQC 3N28A 3MFHA 2PFOA 2FLPA 4J9QA 4UQGA 3LDAA 3ED5A 3I28A 3H8SA 2HBMA 1JXEA 3SAHA 4F4ZA 1T7PA 2V4QA 5AICA 1HUOA 4ED3A 2IHMA 2YY6A 5EOZA 4Q44A 1WWUA 3BS7A 5D49A 4YFKA 5A0LA 3I76A 1FEZA 4M6WA 5CWRA 3M9MB 4QW8A 2KZMA 3GIKA 1JN3A 2KHVA 3ZDBA 4NLKA 1H38A 4UBCA 3V72A 5KFQA 2LYAA 1ZD4A 2FPKA 4F92B 5JU5A 3AEVA 2F8LA 5KFVA 4HYKA 1PUZA 3MFIA 5AM2A 3D6JA 2KSOA 5ALSA 5KG3A 5ALJA 4P0QA 2RLTA 3EW9A 3KZIU 5KFCA 5CJ7A 3PR4A 3Q8SB 2R8JA 4U6PA 3QZ7A 4I27A 4EELA 4IRCA 3K1ZA 3NVVA 5J0XA 4X5VA 2RDIA 4UAYA 8ICCA 8ICHA 2HVIA 1ZQMA 3D2SA 2HHVA 2WHEA 4QJFB 2NRZA 3TQ1A 3F5EA 2WB1C 1SGGA 3JPOA 3C5FA 4PGYA 2F8KA 1PK1B 5AKLA 1BPYA 1J97A 1Q8KA 5CEHA 5KFBA 2R8GA 5DQIA 4NV0A 3E2EA 1X2IA 5KT3A 3ZD8A 3MR6A 1XSNA 4ELUA 4DSEA 3BZCA 2XCPA 1BGXT 2K89A 9ICTA 2KVCA 7ICJA
chains in the Genus database with same CATH topology
2VIXA 3VC8A 4FZLA 3N7PD 4OJLA 5KL8B 4QIWF 2G09A 1L6NA 4NLCA 3N7RC 3KFUF 2Y0SC 2ZXIA 1GO3F 3KZXA 4KMOB 4BX9C 4QIWC 2H3FA 4AYBF 2Z7JA 2ZIXA 1URJA 2ZIVB 3M6KA 1Q3UA 5A0LA 4FZNA 2CPRA 2H3VA 2MRLA 3N7SC 2KNJA 4PL2A 4AYBC 2JHDA 2LHTA 3D2NA 3L3FX 1XNSA 4CDGA 3PSIA 3IN5A 2LKYA 2CN1A 2OM6A 2R18A 4IC9A 2XIDA 4WJ3B 2KHVA 1SZHA 3HKZF 2W03A 2NV3A 3AQFA 3M6ZA 2KEYA 2W7PA 4KX5A 2G5IB 2K8BB 2LYAA 2Y0SF 5CRXA 2H3QA 2ZIXB 5T14A 2JH1A 2E1EA 4CGZA 3D2QA 2LBOA 2F76X 2W7OA 2PMZC 3T79A 4U7CA 2OYYA 1Z19A 1PVPA 2F8LA 3M7DA 4O3MA 4P0PA 2OH2A 3PSFA 2OXOA 2HOQA 1HEKA 3C29A 2HOIA 2GH1A 3IP4B 1WUDA 5HR7A 2MA1A 2H3IA 1UPHA 3VCBA 2ZIWB 3ICXA 1F44A 2KOBA 3H0RB 1IIPA 4P0QA 2G06A 2DQNB 2CRXA 4ICAA 2KKVA 2VJ5A 3SAGA 3F2DA 4GFJA 3PSTA 4C0ZA 2KIWA 3F2CA 2H3ZA 1D8BA 4U6PA 3IG8A 3ALRA 3RF9A 1PVRA 2YX8A 3ONNA 2F2AB 4FE3A 1MA7A 2XVTA 1NZBA 2PMZF 2JH7A 3CRXA 2K8CB 2RP5A 2HOFA 2G08A 1ZQ1C 3K1ZA 2Q4TA 4NLBA 2JMGA 2ZXHA 3LVVA 4A8EA 2HMXA 2KKPA 4NWIA 2E1FA 2G5HB 3NRWA 3C28A 1KBUA 4OJOA 3F53A 2K8AA 2W04A 2KJ5A 1HIWA 2A3VA 2RRDA 2KJ8A 3D2SA 3MGVA 2BDUA 2KHQA 2G0AA 2KD1A 3GU3A 4OJ6A 2ZIVA 2ZG6A 3SMVA 2K4EA 2XICA 4QJFB 2KICA 2VJ4A 2GOLA 2HBLA 1TAMA 4OJ5A 4OJPA 3F5EA 1XO0A 2WB1C 2RHFA 3SAFA 2WAQF 2VKQA 3H0MB 2K4HA 3DEEA 1PVQA 4P0PB 1ED1A 4ACOA 2XI9A 1P7DA 5C0YA 2F77X 2G07A 2WAQC 1YT3A 2ZIUA 3NUQA 2DF4B 4PL1A 3RFAA 1CRXA 3AQEA 3AL0B 4BUGA 3SQIA 2YB1A 3LVWA 4NV0A 3F5AA 3PSPA 3CYMA 4P0QB 4JMUA 2D6FC 2JGAA 1DRGA 1Z1BA 1A0PA 2K4IA 4OO1J 2HBKA 2LYBA 1A6SA 4BJQA 3LYSA 4FZMA 2N1RA 3IG5A 4QNLA 5KL1B 1T94A 4KX3A 2WB1F 3E0FA 3PZPA 2KJ9A 2ZIWA 3H0LB 2ZIUB 3CP8A 3O0FA 1Q3VA 2KV2A 2K89A 2E5SA 2HBMA 1ECWA 2M0NA 2YB4A 2DGZA 2KVCA 3GZFA 3OPXA 2HBJA 3F2BA 4CRXA 5HR6A 1OUQA 3SAHA 3HKZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ3 B;  3H0R B;  1ZQ1 C;  2G5H B;  2DF4 B;  3IP4 B;  3AL0 B;  3KFU F;  2DQN B;  2D6F C;  3H0M B;  2F2A B;  3H0L B;  2G5I B; 
#chains in the Genus database with same CATH topology
 1U48 A;  4EX7 A;  5DB8 A;  4QZB A;  4C4R A;  4O5E A;  7ICE A;  5KFW A;  1VJ5 A;  3MR5 A;  2ZIV B;  4OD0 A;  5F3X B;  4YXJ A;  3RB3 A;  2BCV A;  5B5E U;  5J2A A;  3G6X A;  2R18 A;  2P6R A;  4YVZ A;  2ZTE A;  3HKZ F;  2W03 A;  4RQ7 A;  2F3N A;  5ALH A;  5AK4 A;  4UAV A;  4YN4 A;  2JH1 A;  4O0I A;  4ED1 A;  4KLL A;  3QYP A;  3H4B A;  3ETR A;  2GLE A;  5DKW A;  4ECX A;  4ICA A;  2L5Y A;  1EXN A;  2F1H A;  2QKQ A;  7ICI A;  5CP2 A;  5J2F A;  3F2C A;  4ECS A;  4IR1 A;  3BQ1 A;  1NJZ A;  2AGP A;  4E0D A;  1ZQ1 C;  1N56 A;  1DK3 A;  2JMG A;  3PW5 A;  2Y1I A;  5AKZ A;  9ICV A;  2J6S A;  1V38 A;  4DLG A;  9ICJ A;  4RQ3 A;  4ECQ A;  2ISO A;  3V6H A;  4ED2 A;  2AHO B;  7ICR A;  1Z00 B;  2BCU A;  5B66 U;  2BQR A;  4OJ5 A;  4F3O A;  4QW9 A;  4F4X A;  1PZN A;  5TIS U;  2WAQ F;  4O3R A;  4LZG A;  9ICM A;  3TI0 A;  3NUQ A;  4GXJ A;  4BUG A;  3QEB Z;  4QWC A;  3TAQ A;  1JAL A;  2AQ0 A;  9ICH A;  3ZI4 A;  4JMU A;  1ZQO A;  5KG6 A;  2JGA A;  3MGI A;  4I2B A;  4I2E A;  1ZD2 P;  1V85 A;  2DGZ A;  1S97 A;  1NK7 A;  1X42 A;  3NAS A;  1SKR A;  4I2I A;  2Y0S C;  4C4S A;  5J0O A;  4B9M A;  1Z4N A;  3UMC A;  1ZQJ A;  4DOA A;  5AHX A;  4DFD A;  3GV8 B;  5EWF A;  1RYU A;  4O5K A;  3PVX A;  2LHT A;  3EUB 2;  3U26 A;  1PK3 A;  5AK6 A;  1ZQK A;  4Y2Q A;  3C2M A;  3FM9 A;  2KEY A;  2W43 A;  4PHA A;  4ECY A;  2I5H A;  4YCX A;  2DFL A;  4CE6 A;  4ECU A;  2MSN A;  2DWQ A;  5KG2 A;  7ICS A;  1VLB A;  2JEJ A;  2UVR A;  3L5K A;  2E8M A;  3QUQ A;  4KLT A;  4ECW A;  1ZQQ A;  2P66 A;  4ECZ A;  8ICB A;  1SV4 A;  2H3Z A;  3IG8 A;  2IHN A;  1ZQT A;  1KFS A;  7ICV A;  2BPC A;  3GV7 B;  4GXI A;  5KFR A;  1S77 D;  2KKP A;  5J2G A;  1B43 A;  2G5H B;  3NRW A;  4DQP A;  5DB7 A;  4OJO A;  4PH5 A;  1HIW A;  1F5S A;  2I9G A;  2RRD A;  8ICV A;  2RHF A;  4RNM A;  1JUD A;  3BS5 A;  2YML A;  1QTM A;  3FYH A;  2Y9U A;  1P7D A;  2G07 A;  2ZIU A;  3GIJ A;  2QAR A;  2GO7 A;  3QU2 A;  4Z6E A;  2FPM A;  5J2C A;  4KMU A;  4Y2U A;  1DRG A;  4TQS A;  5AKK A;  3RJJ A;  1VDV A;  2XGQ A;  4EZ9 A;  2KJ9 A;  4EZ6 A;  4MF8 A;  2KFN A;  9ICE A;  3UM9 A;  4KLJ A;  4NLC A;  3WKA A;  4RQ2 A;  1ZQR A;  1QCK A;  5JUM A;  1MN8 A;  4ED7 A;  7ICK A;  4PPX A;  5EE0 A;  3PW7 A;  2HW3 A;  4Z6D A;  3AQF A;  1ZD3 A;  1BPE A;  2KZZ A;  8ICG A;  3KHL A;  2ZIX B;  5DB6 A;  2W7O A;  5DGB A;  4P0P A;  3OHA A;  1HEK A;  1S8O A;  2KN7 A;  3PX4 A;  1ZQL A;  1ZQF A;  1K1Q A;  2LPE A;  2A1J A;  3H0R B;  5ALZ A;  2BQU A;  5GTI U;  3V7L A;  1L7O A;  4C4T A;  5J0T A;  2G06 A;  2DQN B;  1ZET A;  4Q8F A;  4C0Z A;  2BCS A;  2QB0 B;  4KN4 A;  4JB3 A;  1T3N A;  9ICC A;  4EEK A;  1L7P A;  4F5O A;  8ICW A;  5GTH U;  4F5R A;  1SV0 C;  2JRZ A;  3T5L A;  5AI4 A;  4DS4 A;  1KSP A;  4KLO A;  2I1Q A;  4NLN A;  4C8K A;  3SEN A;  4P4P A;  1L3U A;  4DFP A;  4YG2 A;  5KT4 A;  2XIC A;  3JPS A;  5KFN A;  3QUB A;  4NY8 A;  3OGU A;  2NO4 A;  3NVW A;  4G9B A;  2AU0 A;  2ZUC A;  1S0N A;  4QWB A;  2OHF A;  5J0P A;  4YMN A;  2NRV A;  4P2H A;  1SV0 A;  5KT5 A;  2D6F C;  4DO9 A;  5DG8 A;  1CUK A;  2HBK A;  5AIB A;  4C7Y A;  3TFR A;  2AH5 A;  5III A;  3OHB A;  1ZQP A;  1Q3V A;  4RUC A;  5AKY A;  4CRX A;  2W9C B;  4Y2Y A;  3RJI A;  2VIX A;  3VC8 A;  5IIL A;  5KL8 B;  2B6G A;  4QIW C;  1MC8 A;  1HUZ A;  4KLQ A;  4QZA A;  2JZB A;  1N2X A;  2IOF A;  2W9B B;  1X9S A;  1WG8 A;  1XO1 A;  2M9N A;  1C7Y A;  1KQQ A;  4O9M A;  2G5I B;  4TUP A;  5HR7 A;  4ED6 A;  1NNL A;  1X66 A;  1A77 A;  3T79 A;  3V6K A;  4NLZ A;  4CF3 A;  3QZ8 A;  1RQL A;  2W3S A;  4CF5 A;  4J9M A;  3UMG A;  5L1L A;  5AI5 A;  3UMB A;  2PI4 A;  2BHN A;  7ICU A;  2KIW A;  3KBB A;  1BPZ A;  1O08 A;  3DDH A;  4NM1 A;  3Q8K A;  2V9W A;  8ICR A;  4AP9 A;  4A8E A;  1FFV A;  4YQW A;  5ALN A;  4JV2 A;  3H8J A;  2ASJ A;  2K8A A;  3T5K A;  2V4R A;  4O3O A;  1C20 A;  1SL0 A;  2BDU A;  2ZIV A;  4IQV A;  2K4E A;  2YQE A;  4OJP A;  1Z4O A;  2JXJ A;  2LYH A;  4BXO A;  1T3Q A;  4DL7 A;  1S0O A;  1DK2 A;  2W9A A;  9ICK A;  4UB5 A;  1SXE A;  1N63 A;  2N1R A;  2WF7 A;  5KL1 B;  2R8H A;  3ZDA A;  5IIO A;  3AM9 A;  3H0L B;  5AI9 A;  1U49 A;  3FAH A;  5AM4 A;  5FP0 A;  4KLG A;  2W54 A;  1S5L U;  4F71 A;  4RQ0 A;  4IR9 A;  3SD7 A;  1XC9 A;  1KFD A;  2CPR A;  2MUT B;  1ZQU A;  3RB0 A;  3NRZ A;  1NKC A;  4RU9 A;  3NVZ A;  4DOC A;  5IIN A;  3WK6 A;  1ZQE A;  1COK A;  5J0S A;  5KFU A;  4JV1 A;  1SZH A;  1QQ6 A;  2J6T A;  8ICI A;  5DQG A;  2W8K A;  4ED8 A;  4KIT B;  5AM5 A;  8ICK A;  2K8B B;  4KLS A;  5DG9 A;  2WF6 A;  3D2Q A;  2XO7 A;  4Z6F A;  2PMZ C;  4U7C A;  3K1R B;  2OWO A;  2ZTC A;  4YMM A;  3EYZ A;  4LZD A;  2FI1 A;  3QE9 Y;  2PI5 A;  3WK7 A;  1ZQY A;  2PFP A;  3H4D A;  1MQ2 A;  4QZ8 A;  1TFR A;  2RQ5 A;  5H2F U;  4B9V A;  2DKX A;  4KLU A;  3RBD A;  3AU6 A;  1ZOL A;  2HHW A;  2K8C B;  5IIK A;  1TK8 A;  1IG6 A;  8ICN A;  3ISB A;  9ICR A;  1AQ6 A;  1DGJ A;  4UB2 A;  5KG5 A;  8ICX A;  1V97 A;  4ECV A;  2JEI A;  4PZN A;  1CEZ A;  2H5X A;  1FO4 A;  7ICG A;  3QNM A;  4TUS A;  3HX0 A;  4YXM A;  4KLI A;  3MR2 A;  1SXD A;  5J2J A;  1D9F A;  1D8Y A;  1B4F A;  4DQI A;  3TFS A;  2F77 X;  2VA8 A;  5KFT A;  5KFJ A;  2LI6 A;  2ZUB A;  1RXW A;  3SQI A;  1RXV A;  2YB1 A;  2BQ3 A;  2CXY A;  1ZQX A;  4M2Y A;  3GV5 B;  3PY8 A;  4BJQ A;  4US8 A;  3IG5 A;  4O3Q A;  1X40 A;  2D3D A;  3UXN A;  4J9N A;  3F2B A;  3OPX A;  3PO4 A;  4RQ5 A;  1KEJ A;  4J9R A;  4QIW F;  3FC4 A;  2KK0 A;  5KFD A;  8ICT A;  2NRW A;  3N7S C;  1YZ6 A;  1WCL A;  4Y2X A;  4EEY A;  1OXJ A;  3D2N A;  7ICM A;  4B9T A;  2E3T A;  1V9P A;  3V7K A;  1QSS A;  3G6Y A;  2CN1 A;  4IRK A;  3WKC A;  2PKE A;  5J2K A;  4NL9 C;  3M9O B;  4EYH B;  5KFS A;  5T14 A;  3HJE A;  4CGZ A;  1N61 A;  4US9 A;  3PO5 A;  3QX7 A;  3WK9 A;  1UHU A;  2BPF A;  2PFQ A;  2Y1J A;  1LV5 A;  5AKJ A;  3V7J A;  3NTU A;  2ZIW B;  1F44 A;  3WK4 A;  1TVA A;  1JIH A;  3OJU A;  1YZ7 A;  4I2J A;  7ICO A;  1IXR A;  4USA A;  4CF4 A;  5ALM A;  4KLE A;  3ONN A;  2EZX A;  4NL9 A;  1NZB A;  2YMQ A;  1TAU A;  2LM1 A;  4DQR A;  2G08 A;  5AI6 A;  1XU4 A;  4G3I A;  2HMX A;  2HHQ A;  3K75 D;  5DBA A;  3GII A;  3SZ2 A;  5AI8 A;  1ZQD A;  4NM2 A;  3R9K A;  4QWE A;  8ICL A;  4R64 A;  5BOM A;  4OJ6 A;  3NVY A;  4GIB A;  4Y2J A;  3RJF A;  3KOO A;  3RJK A;  1T4G A;  3B9J A;  1OW5 A;  2K4H A;  2FPL A;  2MAX A;  2DF4 B;  3EPG A;  2BCQ A;  1LKY A;  3TAC B;  1KDH A;  5G5H A;  4DCC A;  4RPX A;  1Z1V A;  2R8K A;  4UW9 A;  1LB2 B;  4R8U B;  2AJQ A;  1NKE A;  3QU7 A;  4DF4 A;  4YD2 A;  2FE9 A;  1QLN A;  4DWI A;  4FS2 A;  2QB0 A;  3C2K A;  3BJY A;  3C5G A;  1WYG A;  3JPR A;  5L1K A;  5KFX A;  2BKE A;  1RYR A;  2A19 A;  3KD3 A;  4CNQ A;  1N60 A;  1ARO P;  2FMP A;  4IS7 A;  3T5J A;  5KNI A;  1RQN A;  4J9S A;  5J0Y A;  9ICG A;  3WK5 A;  2P35 A;  2H3Q A;  2E1E A;  2LBO A;  4F72 A;  4M9G A;  2Y9T A;  2OYY A;  2XCA A;  4J9O A;  3MGH A;  4M6W B;  5HHI A;  4DSF A;  2E8P A;  2MA1 A;  3H40 A;  1UPH A;  2KG5 A;  2NYV A;  1QQ5 A;  3B0Y A;  3UXO A;  4QZD A;  1U4B A;  3C21 A;  1L7M A;  4KN7 A;  3Q8P B;  5KFF A;  1WWV A;  4QWD A;  1ZRN A;  4F8R A;  2RP5 A;  3HRD D;  3TAD C;  1NKB A;  4JK1 A;  4NLB A;  2KSO B;  1MQ3 A;  4QZE A;  5AI0 A;  4RUA A;  4I2G A;  1JMS A;  1NI3 A;  4RPY A;  1TV9 A;  4F4Y A;  5HP4 A;  1N48 A;  2G0A A;  4PHP A;  3IHQ B;  3BQT A;  5J0R A;  4MEX A;  3A0B U;  2ES6 A;  2VJ4 A;  2HBL A;  3IDW A;  5F9N A;  4UB8 U;  3AU2 A;  3DEE A;  4K4I A;  4DSL A;  2BR0 A;  3TAD A;  3WKB A;  2KP7 A;  3RTV A;  1L7N A;  1UT5 A;  3RAX A;  2WB1 F;  3BZK A;  5EWG A;  9ICA A;  1S9F A;  2JV3 A;  1ECW A;  3MBY A;  3N4M B;  2W9M A;  2G09 A;  1JX4 A;  5DDY A;  4K4H A;  5HML A;  3M8R A;  4EBD A;  4XQ8 A;  2H3F A;  2Z7J A;  1L3V A;  1SKW A;  4PL2 A;  1BPX A;  2JHD A;  3L3F X;  4CDG A;  2OEH A;  5KFI A;  3HIL A;  1RG6 A;  5ALW A;  1ZQI A;  5D46 A;  3WK8 A;  3EPI A;  4QZG A;  3Q8M A;  3GIL A;  5L1I A;  5KFO A;  2FMS A;  4M9J A;  3PX6 A;  1L5U A;  1UT8 A;  2IOH A;  1BNP A;  2E8O A;  5CB1 A;  5ALL A;  3OJS A;  2OXO A;  5DLF A;  2Q0Z X;  4NLG A;  3VCB A;  2DL0 A;  3UPQ A;  4I28 A;  1D8L A;  3HW8 A;  3ALR A;  1UA1 A;  2XVT A;  2HOF A;  5F9L A;  1KKX A;  3Q8L A;  1RM6 C;  4XA5 A;  5AKG A;  1XS9 D;  4RT2 A;  1IV8 A;  2W04 A;  3IM1 A;  3TAN A;  4JUZ A;  1S0M A;  2QLT A;  3SMV A;  1KLN A;  4PGQ A;  8ICM A;  1SWW A;  3G6V A;  1NJY A;  4F91 B;  1SL1 A;  3M9N B;  1ED1 A;  4TQR A;  1CRX A;  4XUS A;  4PL1 A;  7ICP A;  3MC1 A;  3BQ7 A;  3DV9 A;  1ZD5 A;  3F5A A;  4RQN A;  3CYM A;  2BCR A;  4M04 A;  1NK9 A;  1N5W A;  4Y2T A;  5J29 A;  4RQ8 A;  2HI0 A;  4KX3 A;  3ETL A;  1ZQN A;  3O0F A;  1Z3E B;  5EE1 A;  5HR6 A;  2FDR A;  8ICP A;  2IMW P;  4GC7 A;  1ZQC A;  3H8M A;  1MSW D;  5J0W A;  2LMR A;  3TAP A;  5KFH A;  4M9L A;  1S76 D;  3KFU F;  8ICZ A;  4KMO B;  4DSK A;  4YD1 A;  5DDM A;  4J9L A;  3HP6 A;  5D4B A;  3M8S A;  2WTF A;  2LKY A;  2RDJ A;  4IL6 U;  4UB4 A;  2XID A;  3RH4 A;  5CHG A;  3M6Z A;  5J2E A;  2W7P A;  2EAN A;  2Y0S F;  5KFL A;  5J2D A;  2EAP A;  1NK8 A;  3M7D A;  4RQ1 A;  8ICU A;  3C29 A;  3IP4 B;  3PX0 A;  2HCF A;  2W55 A;  3CNH A;  4OCZ A;  5KAI U;  2DKZ A;  2KOB A;  2CRX A;  2VJ5 A;  4JWM A;  5J2B A;  4Z6C A;  3AMZ A;  3PST A;  1D8B A;  1PVR A;  4DL6 A;  2YX8 A;  3QUC A;  4F2S A;  4UAU A;  2YTU A;  2Q4T A;  3PV8 A;  3UXP A;  4DFK A;  2PXI A;  2F1J A;  4Q8E A;  4KTQ A;  3ZDD A;  1PK1 A;  2VAN A;  4GC6 A;  4GLX A;  3MGV A;  9ICL A;  3EZ5 A;  5EWE A;  2FJ6 A;  2VA2 A;  2ZUD A;  3LWL A;  3SEI A;  3PW0 A;  3B0X A;  1KFT A;  5C0Y A;  2UVU A;  1JXL A;  4RQ6 A;  2ZTD A;  3BQ0 A;  1SKS A;  3J81 j;  4IQW A;  1A0P A;  2ATL A;  3BS5 B;  4RZR A;  3PML A;  3MR3 A;  5HNK A;  2ZIW A;  2ZIU B;  3CP8 A;  3UQ0 A;  3GZF A;  5KFP A;  1OUQ A;  2A1A A;  3HKZ C;  1ZXI A;  4KLM A;  3AN1 A;  5KG1 A;  2KTQ A;  2GWS A;  1SL2 A;  1GO3 F;  1BPB A;  8ICY A;  2MU2 A;  4B6J A;  5KG7 A;  3M6K A;  1Q3U A;  4PZO A;  2EZZ A;  2H3V A;  5EE9 A;  2BDP A;  2BPG A;  1XNS A;  1KL9 A;  1Q46 A;  3WKD A;  4IC9 A;  3MDA A;  3BDP A;  4M9N A;  3T5H A;  4KX5 A;  5CRX A;  2EZY A;  2PFN A;  5ALK A;  5ALT A;  2HOQ A;  1WUD A;  1KN5 A;  3C2L A;  1UA0 A;  5KG0 A;  2UVW A;  3ICX A;  2HHS A;  2D8C A;  4YR3 A;  4UAZ A;  2B0C A;  3SAG A;  2NO5 A;  3KKA C;  1SIJ A;  8ICF A;  4IRD A;  5KFY A;  3RJG A;  5CA7 A;  1Z00 A;  4Y2V A;  7ICH A;  4FBU A;  2ZXH A;  4KLF A;  4UAW A;  2FMQ A;  5KFM A;  1QH9 A;  2BZF A;  2A1J B;  1JRO A;  4J03 A;  4I2F A;  4DQQ A;  4M47 A;  2HHX A;  4M9H A;  1K5O A;  3FDS A;  3RR8 A;  4F4K A;  2KJ5 A;  2C2E A;  1M6Y A;  2KJ8 A;  1U45 A;  2KD1 A;  2ESE A;  2GOL A;  3KKA A;  1X9M A;  1PVQ A;  4K4G A;  3ISC A;  5ALD A;  4QZF A;  4ED0 A;  4TUR A;  2KVS A;  2JEG A;  1N5X A;  3KHR A;  4OO1 J;  3QU4 A;  3CW2 C;  4DL2 A;  3TAR A;  2O6K A;  7ICL A;  3LYS A;  3C23 A;  4DQS A;  4YR2 A;  1TE2 A;  1T94 A;  2WF5 A;  8ICJ A;  1ZQB A;  1JRP A;  2KV2 A;  1QSL A;  2JEF A;  3QXG A;  2W11 A;  5AKX A;  4FZL A;  3N7P D;  2ISP A;  9ICO A;  4DS5 A;  1KTQ A;  3GQC A;  3SR6 A;  5ALG A;  3RB4 A;  4Q43 A;  1URJ A;  4UBB A;  4C8N A;  4AYB C;  4IQU A;  4JV0 A;  4RQM A;  5J2H A;  3QUT A;  1T8E A;  2IA6 A;  4UB1 A;  5AM1 A;  4QZI A;  1BPD A;  5EE3 A;  4F4W A;  1KW4 A;  4QZC A;  2NRT A;  2WF8 A;  1XWL A;  3JPT A;  2JZB B;  2GH1 A;  3GFK B;  5DBB A;  3JPP A;  5AKE A;  3F2D A;  3MAB A;  4NJ8 A;  2EAO A;  4DOB A;  4I2D A;  3RR7 A;  3T3F A;  3CRX A;  4RNO A;  2DBY A;  5AK3 A;  3PW4 A;  3LVV A;  5ALI A;  9ICU A;  5ALU A;  1NK0 A;  4Y2R A;  5AM3 A;  4YR0 A;  4DEZ A;  4B9U A;  4QZ9 A;  4FS1 A;  9ICQ A;  4Q45 A;  2YMM A;  4ZOH C;  2KIC A;  1XO0 A;  3RAQ A;  2EAM A;  2F1I A;  2VKQ A;  3H0M B;  3WKE A;  2AGO A;  3N97 B;  1NOM A;  4HAI A;  3AL0 B;  3LVW A;  1RDF A;  5AIA A;  8ICO A;  7ICF A;  3THV A;  3RH6 A;  1Z1B A;  5KAF U;  2C22 A;  2FLN A;  4EBE A;  3PW2 A;  4MFC A;  4Y2S A;  2R8I A;  4Y2P A;  9ICS A;  4BXO B;  4UAR A;  5KFZ A;  1J2N A;  5L9X A;  1RZT A;  3L4P A;  9ICP A;  4KLH A;  2FLL A;  5ALR A;  1SWV A;  2XY6 A;  3OTQ A;  9ICX A;  3KZX A;  5JTI A;  4JWN A;  9ICI A;  2ZIX A;  2ODG A;  5AM0 A;  2MRL A;  1DOQ A;  1ZQW A;  3IN5 A;  2UVV A;  3NGD A;  3GIM A;  1RYS A;  4O3P A;  4WJ3 B;  1NJX A;  2NV3 A;  5G5G A;  2ZJ8 A;  3LK9 A;  4PJ0 U;  3JPN A;  7ICN A;  2W3R A;  3PNC A;  3UQ2 A;  3PR5 B;  4F50 A;  3OSN A;  4KLD A;  1COO A;  1KRP A;  1TAQ A;  4GFJ A;  1DXS A;  1NK4 A;  1ZQZ A;  4RQ4 A;  2PMZ F;  2IOF K;  3ZD9 A;  4DLE A;  3RH5 A;  4F2R A;  4MFF A;  4MF2 A;  2ZJA A;  4NWI A;  3RRH A;  2YMP A;  2E1F A;  1X6I A;  1S0V A;  3C28 A;  1KBU A;  4RNN A;  9ICW A;  3F53 A;  2WFA A;  4MHV A;  2A3V A;  3IV6 A;  2K60 A;  5DLG A;  2ZG6 A;  4O3N A;  2JR5 A;  4BGD A;  2QB1 A;  1B22 A;  1ZQA A;  5DB9 A;  4O3S A;  1YT3 A;  3RFA A;  2AXT U;  1ZRM A;  4GXK A;  3TKA A;  2W9C A;  2KMD A;  3MDC A;  1NZP A;  2ASL A;  4P0Q B;  1TK5 A;  3C1Z A;  9ICN A;  5ALO A;  5DBC A;  8ICE A;  1A6S A;  3ORY A;  5BOL A;  4QNL A;  4EYI B;  4F5P A;  5J0Q A;  2EQY A;  2E5S A;  4UAT A;  5KT2 A;  2HBJ A;  2AGQ A;  4J9P A;  1BVS A;  2W9B A;  5KG4 A;  3SV4 A;  1L6N A;  3N7R C;  3HWT A;  2KZ3 A;  2OCE A;  3NS1 A;  5J0U A;  4B9S A;  2KIV A;  4AYB F;  3Q8Q B;  4YP3 A;  1ZQV A;  1XSL A;  1CI4 A;  4FZN A;  2KNJ A;  5L1M A;  1ZQH A;  4I2C A;  5KT7 A;  2HVH A;  4FO6 A;  4P4M A;  4ELV A;  1NJW A;  4QZH A;  5ALQ A;  3EWA A;  4MEY A;  2HHU A;  4C8O A;  5KFA A;  2HDO A;  4O5C A;  2B21 A;  3RJH A;  4ZH4 A;  4O3M A;  4DL4 A;  4RPZ A;  4FFD A;  5AKH A;  9ICF A;  2BGW A;  4NXZ A;  4PHD A;  2IBK A;  4DSI A;  4YMO A;  1B0X A;  4DSJ A;  3Q8R B;  2J6U A;  4UAS A;  3RF9 A;  1WCN A;  1MA7 A;  1FIQ A;  2JH7 A;  1N62 A;  3ISD A;  3SYZ A;  2DPJ A;  4F93 B;  2VA3 A;  1L3T A;  1F0M A;  1ZJN A;  9ICB A;  3RBE A;  3QU9 A;  1NK6 A;  2XI9 A;  1O03 A;  3IRU A;  2ZJ5 A;  4M0A A;  1L8O A;  3PSP A;  4LVS A;  2K4I A;  4C8M A;  2LYB A;  4FZM A;  1J2M A;  2DPI A;  7ICQ A;  2KE7 A;  2MUT A;  2ASD A;  2C2R A;  2YB4 A;  1LKY B;  2AQ4 A;  4R63 A;  3H8W A;  4TUQ A;  5HMM A;  1TK0 A;  3OSP A;  1TKD A;  1ZQG A;  2ZXI A;  5L1J A;  4F5Q A;  4BDP A;  4LJX A;  4B9L A;  2HSZ A;  4EX6 A;  5DQH A;  3I1Y A;  3H7I A;  1RPL A;  4RT3 A;  4B9N A;  3QEA Z;  1S10 A;  1XSP A;  4UB3 A;  1JI7 A;  3K4G A;  3RB6 A;  5BPC A;  1Z19 A;  2I6X A;  2HHT A;  2H3I A;  5KTQ A;  5J2I A;  7ICT A;  1QQ7 A;  4IQT A;  5ALP A;  4MFA A;  5IIM A;  1NK5 A;  1X6J A;  4P4O A;  1U9L A;  4FE3 A;  2NRX A;  8ICA A;  4I29 A;  3E58 A;  4DF8 A;  4ECT A;  2EDU A;  1X9X A;  3A0H U;  3GDX A;  2KHQ A;  3GU3 A;  5E79 U;  3C1Y A;  4C80 A;  8ICQ A;  1TAM A;  4I2A A;  3SAF A;  1D9D A;  3V6J A;  5CR0 A;  3RRG A;  3AUO A;  4I2H A;  8ICS A;  5ALV A;  5KT6 A;  3AQE A;  1ZYQ A;  2LM4 A;  1SB3 C;  1HJP A;  4PGX A;  2K4P A;  1BNO A;  5TZV A;  5IIJ A;  3SI8 A;  3JPQ A;  4UB6 U;  3E0F A;  3PZP A;  5JRT A;  5C5J A;  2M0N A;  2C28 A;  3M1Y A;  4DL3 A;  4OJL A;  5KFK A;  1IM4 A;  5AK5 A;  5KFE A;  1UCV A;  4BX9 C;  4DFM A;  4F5N A;  4ELT A;  1ZJM A;  4QWA A;  1UQV A;  4R66 A;  3LWM A;  4XRH A;  2W8L A;  3PSI A;  3WU2 U;  2OM6 A;  3ZDE A;  4FBT A;  2F44 A;  2QAR B;  3KHG A;  2XY7 A;  4J9K A;  4R65 A;  5J8Y C;  5AKI A;  4EEN A;  2F76 X;  1PVP A;  5ALY A;  1A76 A;  1FFU A;  1SZP A;  5HHH A;  4C7Z A;  2OH2 A;  3PSF A;  1DGS A;  5DGA A;  2HOI A;  4PHE A;  2WF9 A;  3HPO A;  1IIP A;  2XGP A;  4ECR A;  2KKV A;  4CCH A;  1L8L A;  3HT3 A;  1X9W A;  5ALE A;  1K1S A;  3RJE A;  3ZDC A;  5ALX A;  4C8L A;  4DFJ A;  1LVH A;  2F2A B;  2KFZ A;  1QSY A;  2E8N A;  3BQ2 A;  5J8Y A;  5KFG A;  2DUY A;  2EH9 A;  4EBC A;  5ALF A;  2YN4 A;  2XC9 A;  4BWM A;  3PMN A;  4BWJ A;  4DL5 A;  1Y88 A;  2XY5 A;  2C2D A;  3SV3 A;  5K4L A;  3S6J A;  1U47 A;  3QU5 A;  3KTQ A;  4R8U A;  4P0P B;  1ZQS A;  2P6U A;  4ACO A;  3KHH A;  5DG7 A;  2ALZ A;  1L3S A;  2WAQ C;  3N28 A;  3MFH A;  2PFO A;  2FLP A;  4J9Q A;  4UQG A;  3LDA A;  3ED5 A;  3I28 A;  3H8S A;  2HBM A;  1JXE A;  3SAH A;  4F4Z A;  1T7P A;  2V4Q A;  5AIC A;  1HUO A;  4ED3 A;  2IHM A;  2YY6 A;  5EOZ A;  4Q44 A;  1WWU A;  3BS7 A;  5D49 A;  4YFK A;  5A0L A;  3I76 A;  1FEZ A;  4M6W A;  5CWR A;  3M9M B;  4QW8 A;  2KZM A;  3GIK A;  1JN3 A;  2KHV A;  3ZDB A;  4NLK A;  1H38 A;  4UBC A;  3V72 A;  5KFQ A;  2LYA A;  1ZD4 A;  2FPK A;  4F92 B;  5JU5 A;  3AEV A;  2F8L A;  5KFV A;  4HYK A;  1PUZ A;  3MFI A;  5AM2 A;  3D6J A;  2KSO A;  5ALS A;  5KG3 A;  5ALJ A;  4P0Q A;  2RLT A;  3EW9 A;  3KZI U;  5KFC A;  5CJ7 A;  3PR4 A;  3Q8S B;  2R8J A;  4U6P A;  3QZ7 A;  4I27 A;  4EEL A;  4IRC A;  3K1Z A;  3NVV A;  5J0X A;  4X5V A;  2RDI A;  4UAY A;  8ICC A;  8ICH A;  2HVI A;  1ZQM A;  3D2S A;  2HHV A;  2WHE A;  4QJF B;  2NRZ A;  3TQ1 A;  3F5E A;  2WB1 C;  1SGG A;  3JPO A;  3C5F A;  4PGY A;  2F8K A;  1PK1 B;  5AKL A;  1BPY A;  1J97 A;  1Q8K A;  5CEH A;  5KFB A;  2R8G A;  5DQI A;  4NV0 A;  3E2E A;  1X2I A;  5KT3 A;  3ZD8 A;  3MR6 A;  1XSN A;  4ELU A;  4DSE A;  3BZC A;  2XCP A;  1BGX T;  2K89 A;  9ICT A;  2KVC A;  7ICJ A; 
#chains in the Genus database with same CATH homology
 2VIX A;  3VC8 A;  4FZL A;  3N7P D;  4OJL A;  5KL8 B;  4QIW F;  2G09 A;  1L6N A;  4NLC A;  3N7R C;  3KFU F;  2Y0S C;  2ZXI A;  1GO3 F;  3KZX A;  4KMO B;  4BX9 C;  4QIW C;  2H3F A;  4AYB F;  2Z7J A;  2ZIX A;  1URJ A;  2ZIV B;  3M6K A;  1Q3U A;  5A0L A;  4FZN A;  2CPR A;  2H3V A;  2MRL A;  3N7S C;  2KNJ A;  4PL2 A;  4AYB C;  2JHD A;  2LHT A;  3D2N A;  3L3F X;  1XNS A;  4CDG A;  3PSI A;  3IN5 A;  2LKY A;  2CN1 A;  2OM6 A;  2R18 A;  4IC9 A;  2XID A;  4WJ3 B;  2KHV A;  1SZH A;  3HKZ F;  2W03 A;  2NV3 A;  3AQF A;  3M6Z A;  2KEY A;  2W7P A;  4KX5 A;  2G5I B;  2K8B B;  2LYA A;  2Y0S F;  5CRX A;  2H3Q A;  2ZIX B;  5T14 A;  2JH1 A;  2E1E A;  4CGZ A;  3D2Q A;  2LBO A;  2F76 X;  2W7O A;  2PMZ C;  3T79 A;  4U7C A;  2OYY A;  1Z19 A;  1PVP A;  2F8L A;  3M7D A;  4O3M A;  4P0P A;  2OH2 A;  3PSF A;  2OXO A;  2HOQ A;  1HEK A;  3C29 A;  2HOI A;  2GH1 A;  3IP4 B;  1WUD A;  5HR7 A;  2MA1 A;  2H3I A;  1UPH A;  3VCB A;  2ZIW B;  3ICX A;  1F44 A;  2KOB A;  3H0R B;  1IIP A;  4P0Q A;  2G06 A;  2DQN B;  2CRX A;  4ICA A;  2KKV A;  2VJ5 A;  3SAG A;  3F2D A;  4GFJ A;  3PST A;  4C0Z A;  2KIW A;  3F2C A;  2H3Z A;  1D8B A;  4U6P A;  3IG8 A;  3ALR A;  3RF9 A;  1PVR A;  2YX8 A;  3ONN A;  2F2A B;  4FE3 A;  1MA7 A;  2XVT A;  1NZB A;  2PMZ F;  2JH7 A;  3CRX A;  2K8C B;  2RP5 A;  2HOF A;  2G08 A;  1ZQ1 C;  3K1Z A;  2Q4T A;  4NLB A;  2JMG A;  2ZXH A;  3LVV A;  4A8E A;  2HMX A;  2KKP A;  4NWI A;  2E1F A;  2G5H B;  3NRW A;  3C28 A;  1KBU A;  4OJO A;  3F53 A;  2K8A A;  2W04 A;  2KJ5 A;  1HIW A;  2A3V A;  2RRD A;  2KJ8 A;  3D2S A;  3MGV A;  2BDU A;  2KHQ A;  2G0A A;  2KD1 A;  3GU3 A;  4OJ6 A;  2ZIV A;  2ZG6 A;  3SMV A;  2K4E A;  2XIC A;  4QJF B;  2KIC A;  2VJ4 A;  2GOL A;  2HBL A;  1TAM A;  4OJ5 A;  4OJP A;  3F5E A;  1XO0 A;  2WB1 C;  2RHF A;  3SAF A;  2WAQ F;  2VKQ A;  3H0M B;  2K4H A;  3DEE A;  1PVQ A;  4P0P B;  1ED1 A;  4ACO A;  2XI9 A;  1P7D A;  5C0Y A;  2F77 X;  2G07 A;  2WAQ C;  1YT3 A;  2ZIU A;  3NUQ A;  2DF4 B;  4PL1 A;  3RFA A;  1CRX A;  3AQE A;  3AL0 B;  4BUG A;  3SQI A;  2YB1 A;  3LVW A;  4NV0 A;  3F5A A;  3PSP A;  3CYM A;  4P0Q B;  4JMU A;  2D6F C;  2JGA A;  1DRG A;  1Z1B A;  1A0P A;  2K4I A;  4OO1 J;  2HBK A;  2LYB A;  1A6S A;  4BJQ A;  3LYS A;  4FZM A;  2N1R A;  3IG5 A;  4QNL A;  5KL1 B;  1T94 A;  4KX3 A;  2WB1 F;  3E0F A;  3PZP A;  2KJ9 A;  2ZIW A;  3H0L B;  2ZIU B;  3CP8 A;  3O0F A;  1Q3V A;  2KV2 A;  2K89 A;  2E5S A;  2HBM A;  1ECW A;  2M0N A;  2YB4 A;  2DGZ A;  2KVC A;  3GZF A;  3OPX A;  2HBJ A;  3F2B A;  4CRX A;  5HR6 A;  1OUQ A;  3SAH A;  3HKZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...