1O03A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o03A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o03A01
2JARA 4L6AA 3QU7A 3QU5A 1RLOA 4Y2SA 1L7MA 1RKVA 3TLMA 4UU1A 3UMCA 5AM4A 1U2SA 4Y2XA 1RPZA 1F5SA 3E81A 1AQ6A 5AESA 3ZW7A 3WKAA 2GHQA 5AVUA 2BDEA 3UMBA 3AR4A 1RQLA 2WFAA 3RF6A 1L7OA 2I54A 4DW8A 4DCCA 1Z5GA 5IS2A 1RRCA 2MU2A 4UMEA 4EX6A 4BYGA 2R8XA 2W11A 3WGUA 4ZEXA 3KBBA 4ZEVA 1RMQA 4Y2TA 2ZG6A 2RAVA 4YCMA 4F72A 3E8MA 3WK7A 1Z5UA 3AR2A 1TE2A 3QU4A 2NYVA 3NALA 1QH9A 4EENA 5AVZA 3OCWA 1Z4LA 3L8EA 1U7PA 1L7PA 2R8YA 2IA5A 3ED5A 4UMVA 2BDUA 3FM9A 2PR7A 3U13A 1KYTA 1XVIA 3SD7A 1WR8A 2PQ0A 1N8NA 5AVWA 1ZRNA 3UMGA 3N8GA 1RMTA 3ONNA 1Q91A 2RARA 3QU2A 3WK8A 2WF7A 3U7FB 2HI0A 1J8DA 4XQ0A 3IJ5A 3OCXA 4EEKA 4L6CA 1YS9A 3WGVA 5AI5A 2CFRA 3L1VA 2P69A 3OCZA 4ZEWA 3ZVLA 2C8LA 1N9KA 3CZ4A 3I6BA 2NO5A 1T5SA 3J7TA 3ESQA 4BNDB 3KD3A 5AKEA 1Q92A 2HF7A 2JAOA 3ZX5A 3IRUA 2I33A 4KX5A 2QYHA 4CF3A 2WF5A 3OPXA 1RC8A 1T9ZA 3DNPA 1QQ5A 3WKEA 3ZTYA 3A3YA 5AICA 3MPOA 3RFUA 5AM5A 2GHTA 5AI4A 4GXTA 1WZCA 4CF4A 4IG4A 3HLTA 5AKYA 4YH1A 1YV9A 2YMQA 1NF2A 4KNWA 5AW5A 5ALTA 4KN8A 3U19A 1SWWA 3ZUPA 5AK3A 3WKDA 1TJ5A 1Z4NA 2RBKA 5ALEA 5AM3A 3ZWKA 5AK4A 1LVHA 2G09A 3AR3A 5AW2A 3W5AA 3L0YA 1ZD3A 1TJ3A 4EELA 4AP9A 2P27A 2FPRA 2AMYA 3D6JA 5AW3A 3E84A 1J97A 4Y2PA 4UASA 2EATA 3I28A 2HSZA 4BNDA 3IB6A 2W43A 5ALMA 4AS2A 2C4NA 2FPWA 3OCVA 3PGVA 2P9JA 5ALWA 1Z88A 3ZVNA 2AGVA 3FZQA 2GMWA 5AIBA 4RESA 3S6JA 5ALIA 5AW0A 2HEGA 4HGPA 1ZJJA 3B9BA 2YY6A 3KZXA 3F9RA 4XE5A 3NIWA 5ALVA 5AKJA 2G1AA 3ZVMA 2G06A 5AKIA 4G9BA 2HOQA 3ET5A 3OCYA 4EZEA 2ZBGA 2AUTA 3L1UA 2I6XA 4CE6A 4FE3A 5AKLA 5ALFA 4KYTA 3ZWDA 5AIAA 5AVSA 5AKGA 2W4MA 4Y3UA 4FYPA 4HYTA 1QQ7A 1JUDA 1Z4JA 1O08A 3QUCA 5AVXA 3VAYA 5ALRA 1Z4OA 1EK2A 2Q4RA 3QX7A 3KC2A 5AKKA 5AW9A 4CNQA 2CN1A 4FFDA 2P11A 3QUBA 1ZD5A 3SHQA 4Y2YA 2YJ5A 4HGNA 1NNLA 3M9LA 3NAMA 4Y2QA 2B8JA 4UU0A 2FPUA 2FDRA 4JB3A 5AK6A 1Z4MA 2B1QA 4E88A 3QYPA 3QUQA 5ALKA 4DFDA 3WK6A 1U2TA 4AS3A 3KDPA 3U7HB 2CFTA 2G0AA 2MU1A 2HO4A 4HGOA 1VFPA 5ALGA 4NABA 4I9FA 4B6JA 1O03A 1Z4QA 4PNHA 2WF6A 3ZX4A 4BX2A 5AK5A 2YBDA 5IT0A 2D2VA 2YN4A 2HCFA 1K1EA 1FEZA 4GIBA 4BBJA 2OBBA 4UM5A 3ZU6A 2WF8A 1XP5A 5AW8A 5AI9A 1YJ5A 2B8EA 5AI6A 3N5KA 3AR6A 5A3SA 5AVRA 3QU9A 4OD0A 3B8EA 4XOUA 3L0CA 3AR9A 4UAUA 3BWVA 2C8KA 1EK1A 1T5TA 5ALJA 1RQNA 1L7NA 1YMQA 2G07A 1ZS9A 2PKEA 2EAUA 4C4SA 3W5BA 5A3RA 2ZBDA 5AI8A 3FVVA 2C88A 2JAUA 3P96A 3PGLA 1ZOLA 4J2TA 1YNSA 3QNMA 2MSNA 2ZXEA 3NASA 4YIKA 5AKXA 5FP0A 3M1YA 2O9JA 3N07A 3MC1A 3U26A 5ALHA 1S2OA 4NV0A 1RLTA 1U7OA 2IOFK 3SLRA 2YMMA 1Y8AA 4OCZA 4C4TA 3DAOA 1XPJA 4Y2RA 4JDPA 1RMYA 1X42A 2FI1A 1QYIA 3UM9A 5ALLA 3WK5A 2GO7A 3E58A 3L8FA 1NRWA 3ZI4A 2X4DA 3W5DA 4EX7A 4J03A 1SU4A 4G63A 4UW9A 4RETA 5E0OA 1ZRMA 2YFYA 4XPZA 5AVYA 4O8CA 3QXGA 1RKUA 2ZBEA 4HGRA 5JJBA 3QLEA 3BA6A 2BY4A 2GFHA 3PDWA 3FPBA 1QQ6A 5AVVA 3WKBA 2WHEA 5AVTA 1RKQA 2B82A 4NFLA 3I76A 3U7EB 3PCTA 3CNHA 4BX0A 3OTQA 5ALUA 1TJ4A 4YGYA 3A1DA 3ZTWA 1VJ5A 4F71A 2YMLA 4UATA 3OCUA 2HX1A 1L8LA 2FUCA 3MMZA 3WK4A 1WPGA 3SMVA 2DQSA 3HYCA 2Q4TA 2OM6A 3SF0A 3AR7A 5AW7A 5ALPA 1WVIA 2IOHA 1ZD2P 2YMPA 1VJRA 4UAVA 4NAVA 3A1CA 4BKMA 3FPSA 5IT4A 4KX3A 2VKQA 1Z4KA 3U7GA 4Y2UA 3ET4A 4MWOA 1IWOA 3N28A 3W5CA 2I55A 4HAIA 5ALDA 2AH5A 3NRJA 1PW5A 2EARA 2IOFA 3DV9A 3K1ZA 4UMFA 2WF9A 2R8ZA 4BEWA 3N1UA 5AKZA 5AW4A 4DWOA 3DDHA 4OHFA 5AM0A 3NANA 1L8OA 2HF2A 3SKYA 5AKHA 2FPSA 1CR6A 4L57A 3EWIA 2NO4A 5ALQA 4C4RA 5A3QA 4Y2VA 4Y2JA 2G80A 2OA0A 2JGAA 2YJ6A 1LTQA 3QGMA 4YCLA 1L6RA 5AVQA 3NUQA 5ALYA 1RLMA 1MH9A 5AHXA 1SWVA 5AW1A 5ALZA 4BEVA 3EF1A 4I9GA 3AR5A 3AR8A 2O2XA 1S8OA 5ALNA 3B9RA 5AM2A 4UARA 4QQFA 4QJBA 2OYCA 5AW6A 5ALXA 2FEAA 4YIHA 3L5KA 2ZOSA 1YDFA 4KNVA 1Z4PX 2IYEA 4CF5A 3L8HA 3GYGA 1ZD4A 3WK9A 3L0BA 5AI0A 3QUTA 3ESRA 4NWIA 5T41A 2G08A 3EF0A 3WKCA 4YCNA 1U02A 4IFTA 2HHLA 4UMDA 4H1WA 2I34A 2FPXA 2CFSA 3MN1A 1TA0A 3FGOA 3I1YA 1CQZA 2JAWA 2WM8A 3EPRA 2C9MA 4MUMA 3R4CA 1Z4IA 3SKXA 4HGQA 3R9KA 3R09A 4UM7A 2YJ4A 2B30A 3L8GA 2ODAA 1RDFA 4OFZA 2QLTA 3KOOA 2R8EA 4BX3A 5ALSA 2RB5A 2YJ3A 2ZBFA 2B0CA 2HDOA 2FUEA 5ALOA 2Q5EA 5AM1A 3A1EA 3L7YA 2I7DA 2B1RA
chains in the Genus database with same CATH superfamily
1BYIA 3E7PA 4FDMA 2YZMA 5K0JA 4CEJA 3HB9A 3W4IA 3ROGA 2QTRA 2QLJA 5LU9A 5GZ3A 4LHZA 3PSAA 5DN6A 4FSHA 4GLBA 5DK6A 4ZEXA 3TLCA 3MT7A 4ZEVA 2ZTUA 3L0IB 4KBFA 1NUAA 1A9RA 1I6MA 4MW5A 3C3CA 3VHRA 5C8YB 3IULA 3K2QA 4LJ6A 4DQKA 3PQ5A 3U13A 1T8WA 3MINA 5AXCA 2E4ZA 4ZQBA 5I01A 4RQ3A 2JZBA 3V3KA 5EMHA 3STYA 3HCBA 5H3CA 4LOLA 3ORHA 3I39X 2EAPA 3VRHA 3U3KA 2G7ZA 4GDFA 5TSDA 3CZMA 5FBHA 4IIHA 4BZXA 3T7AA 5JY1A 3HACA 2PSEA 1JQDA 3QWIA 3FBWA 2I6FA 2REQB 3ROEA 4UFOA 5C1BA 1S7GA 1MJGA 4CIYA 2WJZB 4O4HF 3REQB 2QPAA 2YZ2A 3FOBA 3OA0A 3LLUA 5IPFA 4YJHA 1Z2NX 1UZNA 2RHLA 1I33A 3A6ZA 2GK3A 4IDQA 2EZ8A 3MTIA 4WKOA 3AM4A 4OPMA 4DC0A 4QA9A 2DQZA 1PJRA 2HH9A 3MGHA 3ASZA 4URFA 5BV7A 5CM8B 1NVAA 1Z4JA 4BNIA 3R5KA 2W2LA 5AVXA 2KWIA 4RC9A 5K9ZA 3E9MA 2B25A 1IG0A 3WO0A 1UPCA 5C3MA 4NARA 4MKXA 2W98A 4CMEC 2R5WA 4E0BA 4IWNA 4PYNA 1CDZA 5KFKA 2PMKA 1F0NA 4HGZA 3V97A 3W78A 3OPNA 4EOGA 1Q84A 4PCVA 4ZV9A 2GDJA 2IYUA 2G0TA 3JQ9A 5J0UA 1IYZA 5MHTA 5AI6A 5L4NA 1R6DA 1GTVA 4P3XA 2E21A 2AN1A 2OSVA 5E9JA 4W8OA 1ZBQA 1YZ7A 4B4WA 2FUNB 4YIKA 1YHYA 4IRMA 1V45E 4H08A 4U2CA 4RJ2A 3HJTA 1GGKA 3Q0TA 4M1ZA 3LY5A 4N82A 1H69A 3FAKA 1U3UA 3L18A 1OASA 1N7HA 3GGSA 1MN6A 1FNCA 1QV6A 2AHOA 3FMFA 4H3VA 4G09A 3A36A 2EFEB 2GN4A 5ECYA 3IVXA 2DJIA 5A6VA 1W0KA 3O9VA 4RGBA 2Q4OA 1ZD2P 7ICOA 4Q9AA 2YXLA 3H83A 3JY6A 1Q0LA 3HO8A 4U2GA 1BIFA 5HF6A 1JSRA 1KYXA 4KUGA 2NW6A 2AQ0A 3R8XA 3OTHA 1VA4A 3QOYA 1TZCA 4WN9B 4XUGB 3T7CA 3RAPR 4MQ6A 2ZAOA 1BDJA 4NZOA 2WPDD 4NMHA 4DRYA 2Q99A 3UMJA 2VUTA 5F2OA 4WCVA 5AVQA 1C7QA 4X5OA 3TZLA 3Q8XB 2EBUA 3O38A 3RSOA 3VZCA 3UOAB 5CFNA 4U7PB 1ZH2A 5EE5B 2QARB 1T8UA 2NZ2A 4DSEA 2J6SA 8ICRA 1RYUA 3AEKA 2ZOSA 1D1PA 5FWAA 2W2TA 2XYHA 1J2NA 1BCSB 5C52B 1GU0A 5A9SA 1XYVA 4J7AA 2VLBA 4MVJP 4P4MA 3L77A 2O05A 2VQ3A 2C7QA 4KN4A 5L3ZA 2IU3A 4Q01A 1AD2A 2C97A 2G4VA 3BZKA 5BORA 4UXJA 4CM9A 1DZ3A 5IC6A 1UMBB 1E3TA 1P7VA 2G9ZA 5I9SA 4LSGA 1EFVB 1E9BA 2CE2X 4ONEA 2Y0BA 1XHFA 4XM1A 4Z8XA 2XUFA 3M9XA 821PA 3OT4A 1KI1A 2EG9A 4IDAA 1RLJA 3RVBA 2OV2A 4RAQA 5A4AA 4FZ5A 2UZ0A 2VRNA 3ONVA 3FX2A 1EXDA 1CYEA 2FR1A 2CUKA 2C1ZA 2ZEJA 5EAIA 2P3LA 4IIUA 2R7NA 1P73A 3WGLA 5A4IS 2VNHA 2DPGA 1TUIA 8ADHA 5EIFA 2P91A 3KJGA 2Q9BA 2IELA 2FJ0A 3Q6NA 2Z09A 4YUAA 2Q4BA 3DGFC 4YMOA 3IKMB 4NZ9A 3EK2A 3L1HA 5JE8A 2WMDA 4BLTA 3A7EA 3HJUA 5CCEA 4J0IA 2ZRBA 3PNCA 3V4LA 4QDTA 1K4MA 3EPHA 3OIYA 1FFAA 2YUTA 1AZWA 2P9BA 2VP3A 3L0YA 4BOYA 4NKRA 3PQDA 4YJGA 3NHYA 1PS8A 1GARA 3OKCA 4NBSA 4GR9A 2HD4A 8ICOA 5FBQB 5ERGB 3FFBA 4IUDS 5DHQA 3D4OA 4BWYA 3RH6A 2V7PA 3H5IA 1E79D 9ICKA 2VYCA 1OKKA 3QNWA 2V74B 1XJ0A 2O2IA 1ODSA 5BSUA 3C74A 4CKEA 5EP3A 1ZGCA 1T5LA 3HJGA 1U3TA 3W5SA 1Y6RA 3QZ7A 1S10A 2GAOA 3Q9LA 4FYPA 1FP2A 1MIOA 4O4IB 1WA5A 1NUUA 1Q44A 2KP7A 1I4TD 3KT6A 3RTDA 4YP0A 4B79A 3ZJYA 2AFIE 1W5FA 3Q88A 1D9ZA 4CHTA 4K9QA 4G5OA 3F96A 2Z43A 4KXLA 4TVBA 1GLVA 4L75A 3SEFA 4BFLA 2Q46A 4HX9A 4A36A 4JLOA 2FSGA 1CUVA 3GH3A 1FSPA 4IDPA 1YBMA 5F9FA 4PPNA 3KFVA 4Z2AA 1PV1A 1XT6A 1T5TA 1A9YA 3M4YA 4YVZA 2ZJBA 2E87A 2V1UA 5L9XA 2Q5JA 3EDMA 4X1YB 4D2IA 3R0ZA 4AN0A 1F8XA 1IOWA 2Y9PB 3R6GA 1RADA 4GXIA 4OXXA 3IUYA 4DG9A 5FWXB 4E2FA 4FJ0A 3PFFA 4IQ8A 2Q29A 2XDQB 1VSQA 1L9KA 5CCBA 4Z4EA 4X54A 1BHJA 3O3CA 4K86A 4DWVA 1S6YA 3E7DA 4LX0A 3LWLA 2WSBA 4BKPA 2ERCA 4FYXA 4DLNA 1L4KA 1SBHA 4RGVA 1TJ4A 2GJ4A 4CG3A 1RPTA 2J32A 3AVWA 2PYZA 2DQSA 4ZGWA 1S3SA 1GFZA 3GRFA 4YPOA 3A1CA 3WTCA 1H2HA 2QTBA 2XUIA 3PHIA 4LDAA 4RV5A 3CRVA 2J48A 2BEKA 2AGQA 1GRRA 2Z95A 3EEQA 4X45A 2XVAA 3NRWA 4OHFA 4TXMA 1GYPA 4NZMA 1U8FO 3TADA 1PWZA 1H65A 2DJ5A 4BLRA 9MHTA 2FZWA 2XGOA 2DUNA 4U9UA 1T0IA 3NIBA 1XDUA 5KYUA 2PS3A 2CYCA 2NVUB 5EJ4A 1C20A 3CN9A 4EDFA 2NV0A 2O2GA 5L1JA 4IZ6A 1YQ9A 2F2AB 3T5JA 2IV3A 1OFUX 5GJWC 1JQKA 2O6KA 3V72A 3B12A 1L1FA 5E4FA 3TMAA 3KZNA 4OUDB 3QE0A 2Z9DA 1WWUA 1WUDA 3HJFA 3MJCA 3SC2B 5CFQA 3RWBA 4Z2YA 4BWVA 2AWOA 1IN6A 2ODAA 1NUTA 4DABA 1OGYA 2PANA 2HHVA 4RH3A 3GIDA 1B23P 4WK0B 3FJ1A 3OFJA 1QO7A 1NTRA 5DOVA 3CNQS 3AONB 3C3MA 3M33A 3FSJX 1U4SA 5EQJB 5E1MA 2J87A 4XCVA 2OMKA 1GA1A 4MKHA 3NTXA 4P0TA 3SNKA 5KBYA 4OHVA 2KD1A 3VH4A 2WYOA 4HB3A 4LOAA 3ZGOA 4IQWA 4IUCS 4E6EA 4Q8FA 3TQFA 1AGNA 3BBLA 3FJOA 3MOGA 3PGMA 2A59A 1W30A 1GQOA 3LUCA 3WNCA 4USAA 3KL2A 5LA6B 4DBLC 3SBDA 3ZDFA 1JDJA 3NIGB 2ODGA 3AKCA 2IKSA 4ZMBA 2KM1A 4J1QA 3ZZ0A 3OPQA 1TMKA 3C3AA 1IN4A 3AWDA 3ZCSA 2ZRNA 2E37A 1EK5A 2BKVA 5DM60 3T34A 2YX8A 1OUQA 3KOWA 3ZXUB 1I4WA 1ZCFA 4C7JA 1HURA 3FAZA 1ZD3A 1ULAA 4HRYA 1ZHOA 4LYHA 3B1YA 2OXRA 4L27A 1VBKA 3ZD6A 3QFCA 1FDOA 5DLYA 5C51B 1FXWA 2M6RA 5DTIA 5ALWA 2OCXA 5FWYB 1H5QA 1QB7A 4OYRA 4NG4A 3AERB 2PGNA 3RS2A 1SRRA 4QRIA 3RS3A 4YRSA 4I9UA 3TW0A 2QN1A 3KXPA 5MFZA 4JP2A 3N70A 3PD7A 2R6R1 1TT5B 4G5YA 5B3JC 2Y2VA 5K3BA 2Q2NA 2XCRB 1UPUA 1SVNA 4DRZA 1B1CA 1PNVA 9ICNA 3GRZA 3ILSA 4QE3A 4G4SO 2XSZA 4QDKA 4YLGA 1UMDB 4PHHA 1O8BA 2AXNA 8OHMA 2TRSB 3DV0A 2CVFA 1CWUA 2B5WA 1I2BA 1Q3UA 4KN6A 2QUBA 2IXAA 3P5BA 3S7TA 1KZGB 4BLVA 3GFGA 1AKYA 1F60A 4PLCA 1D9XA 4KXWA 3IQEA 2CZCA 5KAIU 1G5FA 4ME6A 4XIFA 3P4UA 1M73E 3AF1A 4OHUA 3AR9A 2JAQA 8ICHA 2O8DB 2O2CA 3SQLA 3OC0A 2H2DA 3VTFA 3LC1O 4NBTA 2QVYX 3KFXA 4GZ3A 2ZIAA 1T9DA 3HCNA 4OBEA 3C6BA 2FMHA 2J5KA 3ODGA 1WKCA 2RI0A 1KARA 1QS0A 1RQXA 5CA7A 4WIAA 1WXXA 1N5WA 3VV3A 3CZQA 5KPDA 1XZHA 1U4BA 4O5AA 5ICGA 3DL7A 4KXNA 3ZHCA 4B9TA 2CJPA 2Z56A 2XMGA 3B7WA 4EG3A 4PL1A 3U56A 2OT3B 1TKCA 1RCFA 2J6BA 3QKRA 1X9XA 2J9GA 5ADVA 3OICA 2HMTA 4WVFA 4ENTA 3K32A 1MO3A 2FSIA 1XZAA 2FEOA 2JLUA 2VIXA 4ZOCA 4MLDA 5D3MB 2X5OA 1T2DA 1AURA 2EYUA 2R8ZA 1THMA 5EIXA 2HHJA 4MVWA 4MLPA 4NLNA 4DWOA 4V1CB 1BVUA 5KQMA 1ORIA 3FUWA 1E9DA 1NZPA 5ALQA 1C9JA 1X9WA 4YROA 2H7YA 3D4BA 1J00A 2ZZMA 4DV7B 5SV2A 4RMJA 4YUZA 3P9RA 5BUCA 4I2FA 4V0MA 3ELUA 4I2EA 1HMPA 2I2FA 3TINA 4KLTA 2QG6A 2XWSA 3OFND 4QDUA 3LXMA 2H51A 2LW7A 2GBPA 4NONA 4CU5A 2JLZA 1NT2A 3U3JA 1T3HA 5A05A 5T4BA 2GTPA 4AF8A 4Q4CA 3K35A 4EZ6A 4JK3A 3Q3IA 1D6MA 3ESRA 3X43A 1N33B 4X97A 1GY8A 5M34A 2AQHA 4KLGA 1G5QA 9ICRA 1NIJA 4KQWA 2ISOA 1T0JB 4DKXA 1TIPA 5FUMA 2VYVD 4Q5IA 4TTTS 3TLMA 1GN8A 4TURA 2JNWA 1GFIA 1DELA 1Y7PA 4FCCA 3JQAA 3KHKA 2BISA 4YI5A 1MHPA 1IU9A 4OHXA 5GOZA 1YZNA 1RAAA 4ZARA 2D2IA 4NBRA 5FEMA 2I7TA 3OOJA 3T4UA 4DLWA 4E7OA 3SC4A 2Y0SC 4E5UA 2FA9A 4CN8A 4LBWA 1O77A 5KVCA 2EIXA 3PK0A 1NJ8A 4M88A 3GFBA 5DGXA 1SCQA 3PDUA 2XCTB 2LPMA 3QW4B 4L4ZA 3CUSA 3C8MA 3HGMA 3VPDA 4J0CA 2HHTA 2AE2A 4Q12A 3DOCA 1JKMA 1S4MA 1FNNA 4DJDC 1GAJA 4PPFA 2NU9A 4C7VA 1ILEA 4GXTA 2JW5A 1NN3A 5JQWA 3FMGA 1J23A 1M54A 4KNWA 2W3SA 3NT4A 3HB7A 3HCEA 5L7TA 4IJWA 1BEUB 4WZAA 1QMPA 4LE0A 3CF2A 3UVEA 1PT6A 4EAAA 1ZXBA 2JIZA 1GGJA 3JQEA 1SIOA 4QQ8A 4ZT4A 4C0JA 3FUUA 2NADA 1YQTA 2GPAA 3SEZA 2GRUA 5F7JA 3SJBA 5BSMA 4GX0A 1XR3A 1A3CA 3MS2A 1SXJB 4MDEA 4ZICA 3A9SA 1DOHA 3GLFE 3NTUA 4ND3A 3RTEA 1EUDB 3OLXA 5C2JB 3ZHBA 4ZT2A 3SYZA 1ZOIA 5DTMA 2KE5A 3BJMA 2YFKA 1EQ2A 1KDZA 2D0IA 4PLGA 1O08A 2PTHA 3KSDO 2HREA 3FR7A 4IHQA 4Y7DA 2VHEA 3OTWA 3B1XA 1WUYA 4F3TA 3O26A 1ONOA 2JGNA 1E7YA 2G1PA 2W6JD 4PNHA 1D5CA 3PUJA 2GHRA 1E77A 3OU2A 3F1KA 5BVHB 3UUGA 1FTYA 3HCRA 5DM1A 3OQNA 2C22A 4P2BA 5FUYA 2FZEA 4V02A 2QN8A 4UAUA 4MGKR 1LI5A 2BLLA 3VZQA 1C0IA 1II8A 2XA2A 4EGJA 1CY2A 3FW1A 1DBQA 2PRZA 1ZDMA 3KYJB 2XW6A 3GX1A 1L4LA 1IJKA 1EK0A 3IDFA 4LJKA 1RMYA 2P66A 1XTJA 3U7RA 3RNLA 1K5PA 4DG8A 3F4KA 3L79A 4L9RA 4UB8U 3VKHA 2GN8A 3BYZA 4RHFA 1SG9A 3PQ3A 3HPQA 5AOAA 2XQKA 3PY8A 6REQB 3KL4A 1NDQA 4UUNA 1ODIA 4FZMA 3T79A 2NTJA 3FPBA 4DA0A 2UXCB 4CEIB 3FUCA 2GNAA 2BZSA 1DRVA 2AKAB 3D2QA 1W94A 1CVLA 4RIHA 3MUNA 1ZGAA 3PE3A 4HB4A 1T0HB 2HCBA 3A9WA 4ZREA 5EP4A 1NXVA 4EA7A 5DB9A 4Z1OA 4KAAA 4CM4A 3FAHA 5K8CA 4D9EA 2KN7A 3QBTA 3IUSA 1EK6A 5BMVF 2KHZA 3C5CA 3RPEA 3NO4A 2YWCA 2P5YA 5I6DA 2PN1A 1A4RA 1NW5A 4OTZA 1CIJA 5B36A 4IIJA 5TS2A 1HDCA 3NBZC 2GEUA 5HK8A 4DUYB 1HNXB 1YS2X 4CGYA 2B7CA 4NQRA 1G2IA 1RC0A 1AKEA 1AV6A 4Z9FA 3O4RA 1OAOA 5DB4A 3U17A 5DGIA 1V7PC 3L1IA 2KJ9A 4AZSA 4TLAA 4QUJA 1T8YA 4J94A 3RHFA 1UBTS 4OLHA 1JEYB 4JY7A 4W5QA 4H7PA 5AJTA 1HZJA 3JR7A 4HDKB 5DBIA 3B9PA 2YXEA 4ER0A 4QXQA 1Z4IA 3PRHA 3KLMX 1DK2A 1Z75A 2IXTA 2VAWA 2EDCA 2VIIA 3DZCA 5IJZA 4BJ5A 4LNAA 5K6TA 4L6AA 3IVGA 3CB2A 4ITUA 4YB8A 3RVOA 4EYSA 4BS9A 3W8NA 1XDGA 1YS7A 1X9GA 1QSYA 3U61B 5DOZA 2XGJA 4R2LA 3N8NA 3CX8A 1KH2A 2PSHA 2AVNA 4I2GA 3QH4A 4BEBA 4DN6A 3P20A 1IV8A 1ECPA 1N8NA 4HBGA 4O4LB 4PYOA 4J3JA 3WK8A 3OZVA 4B3FX 4J6EA 2ZSUA 2FSVC 4LY3A 4QTYA 4H0CA 3L3BA 4YDQA 3H1AA 2QGFA 2BEWA 3GJZA 5BYKA 1ULHA 3KM0A 3RJJA 1CB7A 4FTWA 3NRZA 4Q7QA 2BFCA 1RC8A 4WK6A 2P7HA 1XU4A 4TLCA 4F3KA 4R05A 1RWXA 3A27A 3D6VA 2RGEA 3B1VA 5KSYA 5DBBA 3SXUA 2ZIVA 4Y9TA 1BU8A 1F9AA 1AXGA 1A9TA 4CUJA 3C2LA 1ZUHA 4GXRA 4AI6A 5F2KA 3VVCA 1P19A 4ALMA 4ER5A 2PBRA 4A2WA 4R1NA 4EITA 3STXA 3FVTA 2O23A 4JNKA 4NLLA 4U2KA 4FNMA 4GMKA 5CIQA 1E7SA 4Z0TA 2QJOA 1AC5A 1R7RA 2A30A 3RU3A 1DCTA 1R4NA 2O20A 5KFOA 4FHFA 1BH6A 2BCJQ 5JIBA 3KIPA 3G3EA 3QITA 3U9LA 5TISU 1CB0A 1YQGA 3EZYA 1NKEA 3EYWA 1MQSA 1YR7A 3HJNA 4AMUA 2OYYA 4RA9A 2C3YA 3VNAA 2JXJA 2VQEB 3ZZMA 1Q15A 3T9AA 4TYNA 4MPRA 1LSJA 2X0IA 2MYTA 3C5HA 1K7EB 2HIGA 4I2NA 1SUPA 1UOQA 4MVXA 3T7TA 1Q3VA 2RHFA 3F6BX 4X1OA 2F59A 4KFRA 1MJ5A 2IHNA 5F78A 1DUIA 4D9GA 4EJ6A 4OJ6A 4K03A 4BFVA 2BZ1A 3DTVA 4AG5A 3PDIB 3FTDA 1SCDA 1ND5A 5FPKA 2QV7A 1TZKA 3SEQA 1S9FA 2FR8A 3BORA 4KQIA 2YWFA 5FWNA 1EGMB 2PWBA 3TZBA 2IYQA 1Y3CE 5LZ4A 2ZSKA 2O52A 4PGQA 5F9LA 4P2HA 2IPNA 3FPAA 1X6IA 4LXTA 4D99A 7ICKA 2HU7A 2AI3A 5JZVA 2W6IA 4NCHA 4PH5A 4J16C 5ALUA 1K3UB 2K8AA 2W58A 2GR9A 2CVHA 5K4GA 4ZOHC 5J59A 1KJNA 1E3QA 3FCSB 1S8AA 1KQFA 2GAAA 5IT4A 2ACKA 3WLIA 1QGYA 5FO0A 5JWRA 2CMDA 4UCWA 1HDOA 3Q7SA 4TUPA 2I65A 3UXHA 3W2HA 3VU3A 1KSFX 1QK4A 1OU4A 3FCXA 4ILEA 3ZHSA 1D9FA 4ZDWA 1YNOA 3WBKA 3AFHA 3OIGA 4G36A 2VDWB 3UH0A 3JZIA 1LKYB 1JG2A 2JIQA 5D6NA 1CQXA 4FT4A 3ZZUA 1NR7A 4OK5A 3F74A 3GO4A 4FVTA 3ONEA 5ALXA 1WLYA 3I32A 2GUWA 4D74A 4DSIA 3QLVA 1XV5A 1RTKA 1D8BA 4RTLA 4D96A 5J2EA 2OXOA 4JI8B 1QBKC 4YCCA 4TL8A 5BOVA 2QD4A 3NWOA 4QZCA 4YMTA 5JAUA 3ROQA 2I34A 1YQQA 3Q7IA 2JZNA 1Y1QA 4KQXA 1TVEA 1VG9B 3T7IA 4K9MA 2C9DA 2OORC 4PSUA 5DB7A 5KPJA 1C3LA 3G0GA 4BNYA 1JR3E 1O96B 3CURA 1GL7A 5AESA 3O0DA 4FFMA 1P5JA 1J20A 2OCEA 4DCCA 4S1NA 2ZJ8A 1E0AA 3KHUA 2YTZA 4CQNA 3KPYA 2R1VA 1VKJA 1YIDA 5JVDA 4OF4A 1ESZA 4ZVLA 1P45A 4A8PA 3BFXA 4YDHB 6AT1A 3JD3A 1U2EA 4FW8A 4RJJA 4R2HA 2IU0A 5I7HA 3PD0A 4GH5A 3VR5H 1JW9B 5AI5A 4DJFC 2HTFA 3RH0A 4RQTA 2V7TA 3IS3A 4RJLA 3GDFA 2ZPUA 4KAJA 5KQPA 3FJYA 1BXZA 2Y0PA 1RYFA 2ECQA 4A0RA 3ESBA 2P9TA 3T4PA 3HP1A 3JWHA 1ESCA 1ZMRA 1PTKA 4B3HA 1T3NA 4RVHA 4BMOB 2X9LA 4R0MA 4REMA 4KRYA 5KNBA 2GGSA 3WRYC 1CNEA 5MN5A 4DV2B 2P0AA 1P33A 3GEHA 1LVHA 4FGSA 4GP7A 4XRHA 4B4DA 4QYIA 5GTHU 3DE7X 2HLDA 2Q6LA 4DA4A 1VLHA 2IYOA 4X60A 2O5RA 3E27A 1UADA 4YRCA 4IXNA 5FH9A 5B58C 4AXBA 4MQEA 1XMQB 1TEZA 3BUSA 3F9RA 5KTNA 4MV9A 1DIBA 5CFOA 1SC4A 4TKZA 1LRLA 2QD1A 4K9KA 3LUBA 2FF7A 4L74A 5DX0A 1YCDA 4DM7A 2COKA 3K9GA 1H1TA 1MO2A 3UXOA 5CLIA 3ZWDA 4V03A 4KIGA 2GDZA 1E89A 1KAGA 4ECVA 1LQTA 4OSPA 1JPVA 3LL4A 3TQ1A 4UU0A 4YS6A 2WJGA 1WRBA 5ADWA 4JWMA 3SQIA 2BEUB 4XGNA 4QTXA 1JX4A 3TD6A 1GO3F 2HO5A 2Z83A 4FGLA 4KI0A 4AYXA 4DLZA 2CB0A 1N32B 3LYHA 4R2WA 1E8MA 1KMHA 1R5JA 3HWSA 1HQCA 3O3OB 1NW8A 2FW8A 3BTVA 1ZUNA 1ND6A 1YMQA 1QGOA 2GNPA 1VE1A 1Y34E 3O95A 3JAWA 1JQJC 3NPAA 4GQAA 3DWEX 1OLSB 1CTQA 1FDUA 1FP1D 1Q0SA 3BMNB 3AILA 1M83A 1EFCA 1DOQA 2P1DA 3NV7A 4PO9A 3V3TA 1O57A 2YTUA 5KWEA 3QXGA 2E89A 1PR4A 1R0XA 3D3EA 5J8YA 3HXLA 2C4MA 1KU6A 3BA6A 2RGRA 4UU7A 1CULC 1PN3A 4HH4A 2IS2A 3R7SA 1Z56C 3ROZA 1RI5A 1GL3A 3G79A 3LC2O 5TXGA 1RXVA 2D1YA 1X1CA 4PZ0A 2C1XA 1X0XA 2ZUVA 3U48A 1O0BA 2GT1A 4FFBA 3O3NB 1WVIA 4L73A 1TRHA 2JVJA 3K73O 3ZDQA 1NC1A 1O6BA 1FNDA 4QXMA 1EWQA 3PVZA 1S5LU 4MPJA 4M47A 3RFVA 4RK5A 4HEA6 4J0EA 4KLEA 2Q21A 3CT4A 3PHHA 4EKYA 3S8YA 1SKBA 1SKAA 5H9WA 3RBXA 3CLKA 3WXMA 5AM2A 2H4FA 3Q9UA 3I12A 1V5EA 2C58A 2ZWVA 4ECEA 1YJAA 1C4OA 3KOYA 2C4KA 3VHXA 4ANFA 3C5EA 4ZVUA 4RQ0A 5CB4A 4DIBA 4HR7A 4BPRA 3NV9A 3EIHA 2GO1A 5CTJA 3RUFA 1W19A 2A0WA 3EVDA 1JAHA 1IQUA 5B1HA 4LVNA 1NVKA 2F1RA 3A14A 1AKQA 1QTQA 2GVNA 4AD8A 1J2EA 3SXPA 4I55F 1RPZA 1BRTA 4F93B 1ZX1A 3FUTA 2WFAA 3MM4A 2AF3C 1N0HA 4XD7A 1PT8A 3NHPA 4UCXA 3WLRA 1FFBA 4INOA 4C8KA 1XL0A 4LEIA 5KUTA 2NTYC 3ZWMA 2YY7A 3LAWA 3VKWA 4CMBA 3ZQKA 3M9NB 4B82A 3UMGA 2CSUA 4HQ0A 1JQBA 4IJQA 3C16C 1XTZA 2UKDA 3W8RA 4CM1A 1HT2E 3RI3A 4DFMA 1VECA 2GJSA 3ZVLA 4ELVA 3EXIB 3P0JA 4LYDA 2HSGA 3QUSA 5IMSA 4CKYA 3BQNB 4BQFA 1DKNA 1SPXA 4FMPA 3D6MA 3LPNA 3HLTA 4RANA 4U2DA 4YPVA 1TAMA 1J9ZA 3INYA 4ZVMA 3RC8A 2GM3A 2EFGA 1EJBA 3VNVA 4JI5B 3WWYA 1JHQA 1YJBA 1XN4A 1T6ZA 5F1PA 2QRNA 4F1JA 3OT1B 4RIIA 2FPWA 4Q24A 1C1DA 5LZ5A 3DB2A 2HJSA 2XCLA 3UPQA 4OX9Y 1DAGA 2CF6A 2H11A 3S5JA 2O8EA 2H1IA 2P5SA 2FEWB 2EZ4A 2C5EA 5AIAA 9ICJA 3FHCB 3QUCA 5ANRB 4HDRB 2OD2A 4UEOA 3KYDA 4PQRA 1E5LA 1Y3FE 2NAFA 2NPFA 2Q62A 2CLCX 3BIOA 1C7ZA 1GV1A 3KHGA 1DC4A 1UPFA 1G9TA 1SC3A 4QUGA 3IOBA 2IPXA 5DYWA 3P71T 2QZPA 2K89A 4QZ8A 3NBUA 5AI9A 1ADJA 4WFKA 1COWA 3N5KA 3IAM6 4BFZA 1M6VB 5DCYA 3B8EA 1XTTA 2CK3D 1GOTA 2NTNA 1B76A 3EOBI 1JXAA 1LDYA 3NVKI 5FO1A 3C3YA 4ECXA 2ZWPA 2JCSA 2DMRA 1M5RA 4OJPA 1UINA 2VF2A 1UFRA 4YBZA 4YQWA 2V9CA 3PXBA 3RRHA 1XELA 1QP7A 3DLTA 3WGMA 2YWEA 3EXEA 1YVUA 5K3DA 3UM9A 4PGXA 1SG0A 1ADBA 1JALA 4KR9A 3H5TA 4NH0A 1DEXA 3NEAA 2IMWP 4NJEB 4PXSA 1A8SA 4JLNA 1IJEA 5EIEA 2PWYA 3L82B 4RVGA 5B3LA 5HZKA 3TUJC 5L3QA 1H2AS 2ATLA 1ZG3A 3B3GA 3KUUA 4ZOQI 1HR0B 4Q4AB 3R9XA 2G5CA 1P0MA 2P2SA 1V3VA 2DR2A 4DNOA 4ZQEA 2BGJA 2VBGA 3SF0A 2E5LB 221PA 4I5DA 2J6CA 4QOHA 4FBMA 3UPTA 3E22A 3L2OB 3LDFA 3OKFA 5KFPA 4KQCA 1TCUA 3BEDA 1P5HA 2NSDA 2NU6A 2LWIA 2ZUFA 1L7XA 1SM4A 3R5XA 4GOJA 1C9YA 3T5AA 2QB0A 1C3OB 2QL5A 4RTOA 1NKTA 2E3TA 1ZQJA 3QGMA 3F9CA 3WU2U 4YAFA 1VB3A 3IQHX 4QIWC 4GGMX 4MCHA 4YMLA 4B9AA 1J5EB 4DJEC 4AP6A 1K9SA 3LNCA 3INNA 1IH8A 1AROP 4DIUA 2FPOA 1DIAA 3DHYA 4U2EA 5JPCA 4FJ1A 3C23A 2IEZA 3HLKA 1WCWA 1T7PA 5KFLA 3TQQA 1GCUA 3UMFA 1RP7A 2F4NA 3SE0A 3O8CA 3VI4B 4F3RA 2Z0MA 3AVQA 4IDHA 1XL1A 3L8GA 2AN4A 1AT1A 3LH5A 2WT8A 2OLKA 2OECA 4KW7A 2J6TA 4DLKA 5KOJA 4QBTA 1LRKA 4JNCA 3U3RA 4R66A 4GVXA 3LT4A 2QRGA 3TOXA 2YV4A 3KLOA 1DEOA 5DWQA 1XWLA 2J5QA 4IR7A 1PL8A 4ZQIA 3QWAA 1QZ3A 2P65A 4EH1A 2OK8A 1TB4A 2VOJA 4DZZA 1MJHA 2AXTU 3R5FA 1UT8A 1SPBS 2PO7A 3BIWA 2QZSA 5C5JA 2GCOA 1W48A 1ZESA 7AT1A 2R8RA 2ID7A 3FLEA 2Q3CA 2Q3MA 3R3SA 7ICTA 2OQRA 3BWXA 3FDSA 3B52X 1XTQA 3RAEC 2NO5A 1QLJA 4ZALA 4H0FA 3V6KA 2UXBB 4FO6A 5TVKA 2Y76A 5LQRA 4BKOA 5LOVA 1XPUA 1RYZA 3CVWA 2O8CB 3H9BA 3L0OA 3KZIU 4XYEA 4WZBA 3TR6A 5ENDA 1EX7A 4W8GA 9ICFA 3AR3A 5LUAA 4ZPJA 4GMFA 1SNYA 2E1FA 1KFBB 4WNCA 4A0GA 4F4KA 2VDMB 5FA6A 1MEJA 3WB0A 5AW0A 2XH8A 3GFKB 2QTLA 3RFFA 3ROPA 1KO8A 1NBAA 3NIWA 5T64A 4I4NA 2JB9A 3A0RB 2JFOA 3PV0A 4EABA 2EERA 4QYTA 2II6A 4G26A 3TW8B 4WASA 1GV0A 3LHFA 3ETRA 4MA5A 1SV4A 3B60A 3UYLA 4ZRNA 1YKFA 4NV1A 2O2ZA 1OWNA 3AHCA 1H0HA 4YRNA 5FNVB 4IS7A 5TC4A 4TV8A 4TTIA 4GF5A 4B2LA 5BRJA 4FYWA 2OUIA 1G59A 1E96A 2GZHA 5IUJC 5JDCA 3PFIA 5HKLA 1X9MA 4CFYA 4MJ7A 2XO7A 3E18A 4EP1A 3LCMA 1BDHA 4QM6A 2BKXA 5DYIA 3C2KA 1DXOA 4FCWA 2ZAIA 3HDJA 5FAKA 1L7NA 1L4NA 4I4TA 3B5JA 1R00A 2XMQA 1C80A 5ARDA 1F9EA 1FW6A 3P45A 4KLJA 1KDTA 3A9VA 4OLAA 4YT2A 2VPTA 2F43B 3T12A 4JROA 4G2NA 3O82A 4JITA 1OIXA 1OA0A 1RZRA 1LSSA 4TKMA 3I34X 2ZROA 1US8B 1N3LA 3U6BA 2FZ5A 4YT8A 3U44A 1SU4A 2J09A 2XJ9A 3PWKA 4D45A 3OOWA 4E3ZA 3U3OA 4AKTA 3KU4A 2XEXA 4N12A 1KW4A 4RPIA 4HUTA 4IQ0A 6LDHA 2QMHA 3WJ1A 3JWIA 2H00A 3PXCX 1IOVA 4Q4HA 5JPIA 1KVTA 2PGIA 1WBDA 4CRXA 3HUEA 1T5DX 1N2CE 4NS4A 1JQEA 5JD6A 1MAHA 1JKJA 1M2VA 1LRJA 3EW9A 1YCFA 4ZJYA 3ISCA 1WF6A 1ZWLA 2R6GA 4BO5A 1R16A 1HYHA 3IRVA 1M8JA 2V6MA 4YDRA 1N2IA 2AC2A 3MIIA 1FFVA 3NHUA 3RIYA 1YK0A 1TUGA 3R7DA 4GYYA 1IZ9A 1D03A 4JGIA 3AB8A 1HZZC 1FDVA 1CS4C 4V39A 5JS6A 2QZ9A 4RLQA 1LUAA 1GADO 5CH5A 1T25A 2P77A 5EZYA 1CS0B 5E2BA 3UFXA 3ZW9A 4JMLA 2JAHA 4DV4B 1NQ5A 5KIAA 2KBFA 4DYVA 2WE7A 2HU5A 3CKKA 1QH8B 3FPLA 3OZWA 4IV0A 3DE4X 3MN1A 3BG5A 2ZPTX 4AJ1A 2BI4A 3AEUA 1QUFA 1Y9AA 3RUEA 4XIIA 3KZ1E 5K2MA 1GA6A 2I0FA 2XUOA 1K92A 3IDQA 4F3OA 4YJ2B 2N46A 3RS8A 1X8JA 4Y2GA 5AVUA 1MO4A 1JG3A 3DE6X 1L5KA 4YR3A 1L7OA 3TAXA 1FL9A 1QP8A 5JMTA 1ZICA 5FTJA 3L4KA 3PX6A 1U9JA 3PZPA 1X9HA 3JZFA 3T9BA 1WE2A 3BSFA 1ISSA 1RWNA 8ICNA 4OK6A 3FFXA 1X13A 2YNMD 5JZOA 1F8UA 3NONA 1N8KA 4OOFA 3HKZC 1JPUA 5J5VA 4BNDB 2G6BA 4KXYA 2QYHA 3G0DA 5DQGA 2XWBF 1IM8A 1W1WA 5B1YA 1G5RA 2WTAA 1XCPA 4MVYA 1WZCA 3E4DA 2IZ0A 3IPLA 2DSTA 5HJ5A 1RYEA 1GCIA 4HZGA 3ASVA 1UBLS 2GARA 1ZJMA 3T41A 4AJLA 2ZSJA 2BUBA 4HWOA 1VG0B 5ES3A 1ODTC 1PTJA 2VK4A 3TIVA 4DE5A 5CMLA 3HEAA 1WV0A 3MJRA 5T7BA 1X2IA 2R5FA 1WNFA 2BGGA 2I9PA 4MUEA 4US2R 5K0FA 1WG8A 1ZJJA 3KKNA 4TL6A 4UNRA 2G1AA 1JSZA 1H22A 1ZD9A 2ERYA 2QN2A 1B0UA 1GA4A 4LNUA 2MR5A 3L1UA 3VBEA 3T35A 4RY8A 2A7QA 4ZXPA 5BRAA 4D3YA 3IYLW 1Y5RA 2X0EA 5IIKA 2FSSA 2A3NA 2PFGA 1S3FA 3MB5A 3NVVA 1DKOA 3NTVA 4P6VF 5HKKD 3MJ4A 1KYVA 1BHSA 2ZYAA 4KFSA 2MU1A 5BO5A 2DEUA 3PNYA 3VU9A 1HORA 4WCFB 4EPWA 4K46A 4ZQGA 2C28A 1XZDA 1JSLA 4I6JA 4L95C 1XRSB 2XUPA 4GU5A 1S2GA 2BBSA 3OE5A 1HI9A 1T8SA 1K7YA 4LQCA 4DC1A 4PBSA 3ZWXA 3WSTA 3HVHA 5J5AA 4QBFA 4C8LA 3RAFC 1SKMA 1ID8A 2MUTA 5CA0A 1L3UA 2JCGA 2PUBA 1LXCA 4XX0A 4W5RA 3JQBC 3E58A 3FKJA 2QRMA 4P3YA 3D2LA 2OG1A 1H8ED 1DEHA 2O5CA 1ZQEA 1NW4A 1J5XA 1XXHB 1L5RA 2HUPA 3DG9A 1U81A 3WKBA 2CZGA 4YO7A 1N62A 3GLQA 3ZJ4A 3EHDA 2JZOA 1HKUA 1YZKA 2WSSA 4D9JA 2YMLA 4G4GA 1ZGGA 4M76B 2RHCA 1H2EA 2GK7A 3W3ZB 4RQ7A 1YUBA 1RJEA 3C8HA 3ZK9A 4L02A 5J2DA 1TFRA 3G1TA 2B9EA 5JJLA 1E1YA 4U9IS 5JJIA 5JOQA 2K5UA 4RMIA 3N1UA 5B7PA 1EG7A 3ZCTA 2Q4EA 5LDHA 1DPGA 4MJ3A 7REQB 3UEOA 2XB4A 1W7AA 2PUGA 1ZM7A 4LTMA 4Y1EA 3ZXYA 3ZV5A 1V25A 3B1ZA 5LM3A 2WSIA 1OROA 1A1SA 4E4YA 5IUNC 1GLNA 4KO3S 1S97A 5JNVA 3WLHA 3RRXA 1LQUA 3GAZA 2UV8A 3OE7D 4EAQA 1I2ZA 1REQA 1G2OA 4P5DA 5ED4A 4XIYA 3UENA 5FTLA 2QRKA 3L5KA 2KE7A 4YJDA 1QG2A 1LNSA 1TO2E 3VO9A 3V2UA 2KJ5A 3NR2A 3HBNA 4XGRA 1XJ5A 5JAOA 2BGKA 2I2AA 1WU8A 2Q6KA 4ER6A 1TTPB 1T2CA 1GPKA 4GXQA 4CV2A 2PL3A 3WHIA 3VR6H 1OREA 4MVJI 4FEAA 2VTVA 2AK3A 2YWHA 2A35A 5EIOA 8ICXA 1OOEA 3V9PA 1MQ9A 5IXSA 3L8MA 3TQHA 3L7MA 1L3TA 2JFPA 3M1LA 1NVTA 3O93A 2HDWA 2FEMA 5CG2A 5JRZA 2UYYA 4IGEA 4YCMA 1H2ZA 1PZEA 3AN1A 1F2UB 2G5PA 4RZHA 3WLSA 1VBMA 4JWKA 4S24A 3MJFA 2IODA 1GL6A 2I6TA 4GBGA 3WQBA 1R6AA 3N7PD 3WLPA 2CNOA 3GLHB 2KVCA 2PZKA 3AJAA 3ZX5A 5LYJF 1FW8A 5K8VA 4ZJPA 4M9SA 4B32A 5L8VA 5TQVA 3AHDA 5JVDF 3ML1A 1U2GC 4YUXA 4UD2A 4CR7A 4PFKA 4FB5A 4UPEA 1QHHA 3NRCA 1ZM3A 3JQQA 3LYUA 3K0SA 2PZJA 1DRWA 2ST1A 3NW9A 3IIIA 5L3SA 1JYEA 3SDBA 5J2TB 3RWOA 4MF2A 3JWGA 1GN9A 2HK9A 3ANSA 3W79A 2PKXA 1XFDA 5GPBA 5HQ3B 3S6JA 4K6FA 3N0TA 3WLMA 4LWQA 3F5MA 1TKAA 3UJBA 1H3EA 5J4YA 1BMTA 1C41A 2IF2A 2QXYA 2CXPA 1IDN1 1JE0A 2XKJE 4MUHA 2XQIA 3X1DA 1V8PA 1I6WA 2Q9AA 1HFKA 1JHAA 1QZTA 3F5SA 1CUAA 2C99A 1NATA 2PS0A 4IHAA 3HXMA 3PFGA 1T9GS 2Q5FA 2X7JA 4IIEA 2E85A 4QZIA 2ZT5A 3IVMA 4HGNA 3UCXA 3GJSA 2B8TA 1IWPB 3UMVA 3UTCA 2FPKA 2ZQ5A 2WOOA 2I2XB 1K6EA 4UB4A 2UZ3A 2WF8A 3R7WB 1TZBA 2QWXA 3C4JA 3C6KA 1NHGA 1RXCA 2M6KA 4FDTA 2HU8A 4MGHA 2FQXA 3LXXA 2ZYVX 1UBEA 5B7GA 2C5FA 3EGOA 1E1CB 3N2LA 2Y1LA 3QPBA 4U8GA 1MC1A 1V37A 3HJAA 1T8RA 2R8BA 3ALRA 3IOCA 4GD3Q 1QTRA 3DMPA 1Q16A 5IG2A 2FUG1 1TC1A 3AVYA 5A4FS 3I30X 2OD7A 1ZQNA 4C22A 3CSUA 5KNCA 3OE4A 2N47A 1Z29A 2JMGA 2G25A 1PFVA 4BKQA 2EGUA 1LX7A 3I83A 4UJ5A 4FR2A 4MS3B 2ZJ1A 4H1HA 3CEAA 3SS9X 3BVPA 1NK6A 4PO3X 3E9CA 2Z9BA 1BFUA 4US8A 2GVDC 1R5OA 3O8NA 1IB6A 2VHQA 2J3EA 4Y67A 2XQVA 4MVJG 4ZEMA 4PYJA 4WW0A 4KWIA 4ZAFA 3ABZA 4I2DA 3BKWA 4LUCA 3EF3A 4W5JA 2CYBA 4IHJF 3TZCA 3A06A 2WBLC 4OUKX 2PUFA 3OF2A 2IRWA 4J1NA 4IEIA 4XR9A 5BYJA 4L8FA 2VTBB 1ZBDA 1Q5PA 3S1SA 3S2IA 1PZMA 2ZYGA 3PNSA 2G80A 4H31A 1TMOA 1TF5A 2PNJA 5DNWA 4A73A 1E2IA 2FETA 1KIAA 3X1WA 1MVNA 4MS4B 1YZGA 3PVCA 5JYCA 1M6WA 3VX3A 2H1CA 1F51E 3L06A 3RC1A 2PRSA 4H35A 2WHPA 1ZQTA 2NV2B 1R8XA 4MVJF 1JEJA 1BVYF 1JKFA 3HUDA 2KK0A 4ASUD 5FV4A 2PT7A 4NL9A 3LL7A 5TPWB 3MFHA 2ZB3A 3JVIA 1NASA 4BO4A 4P33A 4M1YA 4E11A 3F3SA 3IN5A 2G36A 4I6EA 3I09A 4UM7A 4ZCTA 2X4GA 5C53B 3K6SB 3QSYA 1XTVA 2FYTA 3PGVA 5EXTA 1XIVA 5H4HA 2VK8A 4LQ4A 1QVAA 4HI0E 3INRA 3HZOA 5CFPA 2JJYA 4KPYA 4LDJA 2YNMC 1N5DA 4UHCA 4FE7A 3AKEA 2FWBA 2ODNA 1XLVA 3L49A 4A6DA 1ZITA 2SECE 2XXAB 3OA2A 2DF8A 7MDHA 2B69A 2QR3A 1S0NA 1LPBB 3HC7A 1FTSA 4OHPA 5LN1A 1G21A 4RL6A 2F77X 1T8TA 4GBED 1XPRA 3G13A 1CLUA 1A8UA 3RJZA 3QVKA 3OCXA 4HLNA 2J3JA 4TRMA 1KSHA 5FL7A 2OM2A 1CJBA 3BXFA 5AOVA 4NZYA 1HLFA 4O2BB 4HN9A 2P3SA 4RZXA 3CLTD 3OCCA 4WY2A 5KCZA 2Q2OA 3JR3A 2FP3A 1U1FA 3PA6A 4MO2A 1ZL0A 2L5YA 3H8JA 1QOZA 1NG1A 2O57A 3JD2A 4YRQA 4RTMA 3AU6A 3I04M 2DWOA 4DCMA 4UQLA 1H42A 3T9FA 4EELA 3WR5A 1T2VA 4AZ0A 2HSWA 3AIIA 3DC2A 8ICCA 3QJ5A 1XRMA 5KNDA 2VHTA 2ZIFA 2QI9C 1RYMA 1VDVA 3FZQA 5JCJD 3TLGB 1R88A 3IP9A 4YMMA 1FX1A 3B48A 4RPZA 3JQCA 2FQ1A 3BRSA 1XCGB 4CLOA 5ALVA 2X1HA 3NHZA 4WJKB 4TTVA 3ET5A 1P2SA 4CMAA 3P2EA 2YXPX 5HRUA 2VPQA 4Z6KA 1MF7A 1IMJA 3I61A 3UUEA 1AZLA 4JJ4A 3T1NA 3PUVA 5FL3A 2J30A 3URKA 5F2EA 4MW2A 4R7TA 2JVKA 3HB4X 2IW3A 1X3SA 3WIVA 2ODPA 4XDZA 4BFXA 2YDYA 2GFIA 4E15A 4EBFA 1T9GR 3K9QO 1YQUA 4EY4A 4JWNA 1OFHA 1Y5NA 3ES9A 3EGDB 4ARCA 3FYDA 1OILA 1CP3A 4LTDA 3HL0A 3VNSA 4JA0A 3FNRA 1QLWA 3SYTA 1EIZA 2ZBDA 3BL8A 5AHRA 3TW4A 3V2GA 3A8TA 5A9TA 1T2UA 3HE3A 1B4DA 2O9JA 1E1LA 4M0LA 3GDXA 1AKWA 4MWCA 4DQIA 3S0JA 5JI2E 5CPFA 4CKWB 1N7JA 3ICCA 3WS7A 4DV3B 2PX6A 1QZXA 3HYSA 3A4YA 3L43A 2EJUA 1CUZA 3ZY3A 3Q9SA 3IBYA 4QULA 2Z98A 2EQYA 2JGLA 4MWBA 1T3TA 3IUMA 3GOHA 3PQ7A 2AT1A 2F44A 4PIVA 2PLNA 4ZZ1A 1P61B 2C82A 4DCPA 2NRZA 4Q16A 3RBZA 2YOGA 2QSUA 4RD2A 1V96A 3VU8A 3OTGA 5F9HA 1IJBA 2XYVA 3KHTA 3BFJA 1W5SA 2C42A 4PYKA 5CGZA 3N28A 3NJ4A 1ZJZA 3DUFA 2VNAA 5ECWA 2NO7A 3SM9A 1A27A 3ZVKA 2QE6A 5IC4A 4BUJA 4YO8A 1XTKA 3SX4A 2UYGA 3WLJA 3PPYA 4CMEA 4F84A 2OHGA 1Z26A 4B3MB 4AP5A 5CD9A 4UTRA 2XMCA 6PFKA 3RIXA 5C8VA 1UK8A 5BSTA 4EFMA 5IANA 3I9JA 2O2XA 3EGXB 5LBIA 5P8WA 4EGFA 4BGDA 1WXFA 3UA4A 4QJBA 4PICA 5CDYA 5AW6A 3MJDA 1MOQA 5KT3A 5MDHA 1BROA 2W7OA 2VZ0A 5EIBD 4RNMA 3EZ9A 1DHTA 5IT5A 2YWDA 2YJTD 4IF4A 4KO4S 1TK8A 3ZJTA 5CHEA 2X8JB 1GVHA 4YXWA 1Y6QA 3R6LA 1KJZA 2Q8NA 4EPRA 5C35A 5IHXA 1MCZA 4BVBA 2PMZC 4MW1A 3INGA 2JARA 4GYKA 1Z1VA 5LMUB 3PW4A 2O7SA 4P92A 1W34A 2QX4A 3SZGA 3NH9A 2GYYA 2KFZA 5TT0A 1RZVA 2CDRA 4HWRA 3T8YA 3B5IA 5IM4A 2GD0A 4F60A 4QGBA 2J0UB 2R48A 2P7IA 2WE8A 1ULUA 4XPIB 1C50A 1WABA 1U0HC 1CEQA 3VDMA 1AN9A 2VH1A 2E8MA 2DZDA 2C4WA 3IM1A 2NM0A 4RW0A 1LZKA 1JLLA 2D5IA 3PX0A 5SYAA 3L7IA 4KK3A 4JI6B 2Z4SA 4G6ZA 2ISCA 2IY7A 3A1FA 1VHQA 4JENA 4I2AA 1N7GA 1PE0A 9ABPA 4UVHA 1J2YA 2ZGVA 3GA7A 3OC6A 4IJMA 3E4CA 3BQ9A 2JS7A 3DXZA 2YMQA 121PA 3UBMA 2PX4A 4PLHA 1DL5A 1U31A 3FPHA 2UYHA 1BNCA 5AK4A 1APBA 2IYFA 2UUOA 1FUUA 1B41A 1PS0A 4EW6A 1B3RA 1ZNQO 3UHAA 3U31A 3DO6A 4KFTA 3NC4A 2YHIA 4QLBA 5FTWA 1RPNA 1Z8FA 2FSFA 3UWSA 1D2GA 1P29A 4BO8A 4KKXB 4LPKA 5DBFA 4BNTA 3D6NB 3EEFA 3PFCA 4JLAA 4EW2A 5LOVF 3C0KA 3VR2D 1K1SA 4O3RA 4C0ZA 3R3VA 2CUTA 3KYCB 4EG4A 2D1FA 3AOEC 4ZI7A 4KG7A 5I7AA 4MEAA 4FR0A 4ZPXA 3E48A 1QV9A 3UCEA 4IOKA 3SFVA 2V98A 2Y2UA 1KRPA 2P11A 4DY4A 1XUOA 4DV1B 3K2IA 3TK1A 2LTAA 1FPMA 3HB1A 4FR5A 4Q05A 4YT5A 3D8RA 3CEMA 3MMNA 4Z9BA 3RVSA 1ZCBA 1Z25A 1YT5A 4BP3A 1LU9A 1T5IA 2C3UA 3CC8A 4YCAA 4EG5A 1WMSA 2DLDA 4DKJA 3Q8KA 3SS7X 4C8MA 2P6OA 5CJPA 5AW8A 1Q1AA 3FWNA 1EVZA 2WUEA 3G2HA 3CZCA 3QU9A 4DCUA 3QHAA 1E3JA 4IMPA 3VXKA 4DT1A 4WCFC 3TSAA 2XE6A 1NP7A 3ZOZA 3TUZC 3QNMA 5AKXA 1WHSB 1U3DA 1QAMA 2Z7JA 5IU6A 3QWFA 1KA9H 4U6NA 2Y71A 2XYQA 1RHKA 2GCIA 4H1VA 3L40A 1TM5E 3DCIA 4FGKA 5JS2A 4UOZA 4UB2A 5HOEA 5B2ZA 3VZRA 4BNHA 1P7PA 2IZ5A 1XLTC 3EA4A 1FLAA 4G07A 4K6HA 2L18A 2CEAA 3CNBA 3QEAZ 2AOWA 4GVLA 3KNZA 3N7SC 3QKSB 2CHFA 1T4CA 4HFNA 5E6SB 2KBEA 5EXPA 4JA2A 3PRJA 4AJHA 1D8YA 2RCYA 4M7OA 1MO5A 2JLVA 4IPTA 5FB3A 3CY6A 2QRJA 1IZ7A 1ZMXA 1JWLA 2R11A 4CM5A 1DINA 2D74A 2G9UA 3FB4A 4WBSA 1XAHA 1A9OA 2AZTA 3L7LA 4CV3A 4QZHA 3CHYA 4TRRA 1FSGA 3CX6A 3KKAA 1W35A 2ZI3A 3LRPA 3R6TA 3O90A 4JR1A 2R66A 1XF9A 4TTSA 5D46A 1JI7A 4ZZIA 2BPOA 3WAJA 2GXAA 3JQGB 4HADA 3GIMA 3OWHA 5G0VA 4YIHA 1ZW1A 2O8NA 5JSZB 4QBKA 1NPTO 3T9EA 4DQXA 5DYYA 4PQFA 3BCHA 1YAHA 3HU3A 4Q9HA 3LPAA 4JZKA 3GZTB 5K0BA 5FA8A 3GG9A 3DZIA 5EJ7A 1M2GA 1MEEA 4JUFA 3W6NA 1P9OA 4KYIB 2JAWA 3G1WA 1M2NA 5CB6A 1NYLA 4EKDA 4L9AA 4DSLA 2IBKA 3G02A 1JQLB 4D3FA 2K87A 5EZYF 4OB8A 3ELWA 4MKIA 1V8FA 4ZCIA 1FX0A 2V5UA 3QWHA 3KFLA 2F8KA 3KEMA 2O48X 1ECGA 1R6XA 2EKQA 2ZIZA 4EBDA 4IOMA 4X93A 4DXHA 1ZQUA 2R6DA 2Q6OA 1QGED 5C3UA 2DQ4A 2XY5A 3CLTC 3M2TA 1FU4A 1KAOA 2Q3FA 2J3DA 1JEQB 4M9GA 1W75A 4KXXA 2CUNA 1E3WB 1ZQZA 1A5BB 1G63A 3L7JA 3PC7A 4B43A 3BX1A 3DVSX 1BA3A 1MA7A 4RNNA 3IIMA 1AXRA 3AJDA 4O4JB 2A9PA 2KZ3A 1T5SA 4Y6RA 4Y0AA 1O7JA 2X0DA 1W0CA 3F78A 1XALA 1IK4A 2VH2A 4HAZA 3BKXA 3M49A 4EWLA 4KN8A 2WVAA 4YNBA 1AH2A 1OHHA 1JDTA 1PX2A 5ICMA 4F11A 3ZWPA 4IQFA 1VYUA 4FHZA 1KETA 4NY8A 4ARUA 4CM8A 4HKTA 3PXAA 3FZGA 4NBNA 5EPEA 1ZOSA 5CNIA 4ZCQA 2WD7B 4DOBA 1EFPA 1Q2UA 2REOA 1XCOA 4RSHA 4EYHB 5CEFA 1XJQA 1ULSA 2JHAA 2WMOB 3OOHA 2BP7B 4K4GA 1URJA 2BCQA 1D2RA 1Z18A 1MP0A 3GUZA 2C2BA 5LNK6 5J0RA 5HCUA 4GL2A 4GNKA 4UREA 3M6KA 4EARA 2N9UA 4K28A 1NX6A 1QH1A 4FYMA 3LGAA 1XMXA 1ZNWA 4OLFA 1Y3DE 2HDNB 2PSJA 3ROMA 1GJRA 4LTNA 3IBTA 2L17A 2XOKD 4P7KA 3WZ2A 3Q6IA 1EFHA 4HDAA 2CFTA 3QEMB 2GLXA 3SYKA 2R751 2JJ1A 1PGOA 1PKXA 1GCAA 2GSWA 3K9BA 1ZJNA 4NQZA 1HV8A 3GARA 4ECAA 1RLUA 4AMGA 3GBVA 3CPSA 3R3UA 2P62A 3MRVA 3HWRA 7ICIA 4EKNB 2Z08A 4F4ZA 1SFRA 3F0TA 1CR1A 1YKSA 3VR3A 1J33A 4IFBA 4TTPA 3TDMA 3QXHA 4OMFG 4KV9A 1Z83A 4IIBA 1CC1S 2IIVA 4WOBA 2QMQA 3IPXA 4G5FA 5AXAA 2CPRA 5HZMA 4NL4H 3UICA 4DR3B 1K0FA 3CF6R 2YQEA 3FF1A 1JPNA 2PPLA 3DE1X 4QTZA 2FV8A 2FW6A 5CW1A 2BR4A 1V6AA 3N7RC 4RDXA 1P81A 2Z8ZA 1S0MA 2AA3A 4XCQA 1BWRA 3G1UA 3LT5A 4LRSB 4KSCA 4RU9A 1EVLA 5KX5B 4IXTA 1Z74A 4MIOA 5CA0F 4J9RA 4P31A 2A5LA 3U4QB 2A88A 2EOAA 2PVCA 2HHCA 3GLTA 3W8FA 1POXA 5B3JA 1BN6A 2QTFA 2F6RA 3EYZA 1TK2A 5ARBA 4GXKA 4C0AC 3EWIA 2FMIA 3DBRA 3GLUA 5EIBC 3GJRA 4KXMA 1KI9A 3LX4A 3BN3A 3L7BA 3OQIB 4CIVA 3NOOA 1AVTA 2ZU6A 5LZ2A 1IIPA 1QF7A 3NUQA 4H7DA 4I50A 4U63A 1ZZEA 4FU0A 1RAEA 3HRKA 1MJFA 5LPNA 4RHEA 2IYAA 1U9IA 4OX9B 1YVEI 3QPAA 2FEAA 2PZFA 1E2NA 3GMTA 3ISBA 4RJKA 1SQ0A 1Z4PX 2IYEA 3C8DA 3V4PB 1O6CA 4H1WA 2HJ9A 3W6OA 3LHSA 3HKEA 1N6NA 3TQRA 1NZDA 3TKYA 1EDBA 3ASUA 1OA1A 3TRFA 1X7XA 4YP7A 1W5EA 2IH5A 1YH3A 3SC3A 4B9NA 4Y2XA 1UM9B 3C2QA 1C29B 1NXWA 2P41A 4HDNB 3K5WA 1ZSVA 3UAGA 4MRAA 3AVTA 2MU2A 3AUYA 4YTEA 1SAYA 2HJGA 4RSRA 4RCZA 4UTXA 1CY1A 2YRWA 2X42A 1SCBA 3KQQA 3B6MA 1FXWF 3OCWA 4XJVA 2HSDA 5CVVA 2IXGA 4HJRA 7ICEA 3AETA 1PK7A 5JSYA 4R1QA 2VDJA 4N3BA 3HKCB 4WXPA 1PG5A 3ITKA 2A0XA 1K89A 5KINB 1PO7A 3C3WA 4PXYA 2GPSA 4P4SA 1N36B 3TTTA 1KYQA 1H4TA 3RIGA 1GSAA 3DYVA 3BM5A 1LK5A 1DSSG 5CH3A 2C2MA 4CEHA 4KPUA 2WYIA 1DJMA 1QK3A 5ALEA 1E69A 2M6SA 3B53X 2JFGA 3IJPA 1LLFA 4GR5A 2JI8A 4E08A 1X1DA 2NZXA 3HPOA 5EMKA 1A7JA 2LP4Y 1U1CA 3OCVA 4WPGA 4O33A 4HAUA 3AB7A 4HK4A 4KLRA 5IVIA 4EI8A 1LV8A 4XQEA 3ZVMA 2IH2A 3MTAA 3W6PA 3ZQ4A 2H4WA 4AJEA 4MB2A 5BMOA 1ZKMA 4MI6A 4A8JC 2OHFA 4TQGA 2OVFA 3C3EA 3EWAA 4REQB 1M2OA 5EYPA 1VLVA 4BATA 1R8QA 2HXYA 2FN9A 1RRKA 3MK31 4WRRA 2RG1A 4HHEA 1BOFA 1J1ZA 2DUMA 3V7FA 4YMGA 5DGHA 1RRFA 1G7SA 1HOXA 2VXYA 5DV9A 3OIUA 2XNJA 2ZWOA 3NDRA 1S3GA 4XTRA 1U0FA 3DXFA 3ZX4A 1W5TA 3PNMA 4FC7A 2WB4A 4ZAGA 3T99A 2Z6AA 1P72A 3A0BU 2GA9A 1ZQ9A 4MUFA 1RQNA 1EDDA 5C8YA 2HJWA 3OIDA 1O87A 4E7PA 1G4AE 4C2TA 4QUEA 4E5KA 3GRKA 3GLIB 1VDZA 1DX9A 1FMCA 4ACBA 3L6BA 2HWKA 2HQRA 4JIGA 1QYIA 3GEPA 3OQMA 2JGJA 2BBWA 3JQFC 5I8WA 1PR1A 3EOZA 4ACAA 3H4TA 5BVGB 1TFUA 5K99A 4EPYA 1FNMA 1WKBA 4D0GA 2O2SA 3ER6A 4HLUA 3UJ6A 4TTRA 3UAWA 4TROA 3M9MB 1SULA 1X6VA 4DV6B 2SNIE 3FDZB 4CN9A 4BMNA 3L6OO 3WK4A 2QE7D 2O07A 3REQA 2WU1A 1QYRA 3M6LA 5T4HA 5ALPA 2AOVA 4JASB 4GX2A 4RKWA 2XNDD 4DL9A 2JLCA 3KKPA 1A97A 2ZQYA 3CWQA 3A3OA 2PL9A 3KT3A 3U4GA 3M8RA 4R65A 4ICIA 4FGZA 1JFLA 4EHIA 1JIIA 3AY0A 3PE4A 2FNAA 1BDIA 3BHJA 3UZUA 3VC1A 5G1OA 4NBKA 2XHEA 3RB6A 2MDTA 3QJGA 4KRXA 3LD9A 3K20A 3QELB 1V5IA 4Q19A 3QMPA 5E1OA 3DVRX 1GTG1 2PFPA 4BHTA 1C7YA 3NGLA 4OQMA 4UULA 4JELA 3A1SA 4KNVA 3ZK7A 5GIOE 1XA0A 1CRLA 4JBLA 3ZTTA 1CHDA 3Q40A 2VDRB 4IFTA 3AZQA 2IBSA 1P1FA 3VDRA 2EJBA 1Z07A 4QX6A 4V0NA 2R8EA 3RABA 2ZE6A 3C3BA 3UJCA 1Q12A 3WI7A 4P35A 1XSNA 2XC9A 1ZN9A 5BV1A 2ZTMA 1JPJA 3K5PA 2MMGA 4HVTA 1NSYA 3BBPA 1SBCA 3E0XA 1ELOA 4PX3A 1WVGA 4RHYA 4CM7A 2HHQA 3PUZA 3C3DA 4ZMRA 1VGQA 4UBNA 4GC9A 4B4VA 4D3SA 4RQBA 3B1KA 1N9GB 1VPVA 2P9FA 4ESHA 3CRQA 5EQFA 4GPBA 4LZNA 4EI9A 3BHNA 2C4TA 4N1AA 1YL6A 2HSJA 2IP4A 1H66A 3NOXA 2FMSA 2RK6A 2V5AA 2HF7A 4MRSA 3IRUA 4KOEC 3O4FA 3MCVA 3I5YA 2O7RA 4KE6A 3HJHA 2NUPA 4FI3F 3HVJA 1MSWD 2XD4A 3Q7PA 1KTIA 4LJYA 5AKYA 5IIJA 4EY7A 5EMNA 3L6DA 5ALTA 3IT2A 2IPAB 2H1OA 2IEYA 3Q7RA 2E1RA 1IWBB 1AGXA 3C7DB 5H68A 3IAS1 3EIEA 1JAZA 4F46A 4RQ4A 2IU6A 1XA3A 3BAFA 3C8ZA 4QC2A 1PP4A 2QARA 3JAKA 3D8HA 4K9NA 5GM2A 2UYQA 1PVQA 1E58A 5JD3A 1B22A 3QFHA 3PSHA 3SYLA 2P5UA 5AJUA 3PNQA 3BS5B 3IQFA 2HCTA 3BQMB 4TSRA 2RLTA 3BMQA 4JC4A 1N61A 1J8VA 4FSXA 4LYFA 3AF6A 4I1YA 3ZNPA 3EIOA 5GTDA 2ZRJA 1W93A 3KO8A 3UN1A 4I19A 4I2HA 5HEKA 4QODA 1UMBA 1KQPA 1JA1A 3GROA 1EFVA 3DKVA 4XI9A 2ZIUB 1VBFA 3EGVA 3L0SA 5DTJA 3DQQA 3GT7A 3RYFB 2RI1A 4ZZ2A 5EC8A 1FEZA 1EA7A 3LQ4A 1GGVA 4HO1X 1ZZGA 2XYPA 3VBCA 1X7WA 2HC9A 2XUKA 2XUGA 4XOUA 1G20E 3BWVA 1EWTA 2IXBA 2P2GA 3R75A 1XTSA 2CD9A 4MDHA 2R6FA 3IL2A 3OJSA 1KQQA 2L0XA 5GADl 1SOWA 3HX0A 1N6PA 1R3UA 1AHIA 1V1RB 4CL3A 1A04A 1TAGA 4H7KA 2BW0A 1D0IA 1L5LA 2WB1F 1HE8B 1M10A 2H0RA 1YR1A 3RVMA 1ZQSA 1TNDA 1ZMTA 2X1VA 5KJ1A 3PWZA 4IIJF 5TZVA 1UOPA 4Y9DA 1IBCA 1OXJA 2P2DA 3P9CA 3DAYA 2AJBA 2B82A 5A3JA 1W2GA 2QAGA 4YAGA 5A0VA 2CWWA 1HA3A 2PT6A 1Z7BA 1V16A 4MV7A 2VAVA 2G8NA 1YRWA 1SKQA 4Z9XA 3RNOA 1CR2A 3NEJA 1VJ0A 1YJCA 5EEHA 2P1RA 2B1IA 4G01B 5EIHA 2ZSEA 3A11A 1MT3A 4M9RA 3KB6A 1CR6A 4OG2A 1UKYA 1YU9A 4NATA 1EP9A 3LG2A 2O2EA 1OTYA 1RM6C 4O4IA 1D7AA 2RRDA 2WJ4A 1G6HA 1NJZA 3EXG1 4GL4A 5JNWA 2C0PA 5K3AA 1ZGZA 1IY9A 1A2BA 2PGLA 3SK0A 1MAUA 3VOAA 4NY1A 1R37A 2W0SA 3CZ5A 1PHPA 4O2AB 1EG2A 2FLVA 4L50A 2HWWA 1KEVA 3LY9A 3OPMA 5ARCA 2WW8A 1UZUA 1AQYA 1JDUA 1K63A 3X2SA 4D4LA 4OP1A 2DG2A 2KSQA 3DF9A 4B40A 5B3AA 2O5VA 2C95A 4X1YA 2DB3A 5EHIA 3DC7A 2UVQA 2GESA 3TPFA 1FFXB 3WB2A 1FPQA 5FWXA 2NZVG 4Z7OB 1TYBE 3GJ7A 5LLTA 4B87A 4LXIA 2GCPA 3IKVA 2OKGA 1RAIA 1K7CA 4TT3D 2VTEA 3E5RA 2IF0A 4F72A 8ICWA 2BMJA 2GBLC 4OHRA 3TEJA 5BNWA 2GD6A 1TCVA 1GRCA 4B3TB 8ATCA 4D92A 3W2GA 1ZRNA 1S4QA 3N4MB 1H0RA 1L3VA 4V0RA 2EGGA 3FWHA 3LWZA 4HDOB 1MUUA 1Z0JA 4QXPA 1I01A 5IM4F 4BJHB 2OCKA 3SEIA 3EPPA 3A37A 5AOCA 3GLGE 8GPBA 3KEFA 2ONZA 3AW9A 3CBGA 1P80A 3HH8A 4CIAA 3BE4A 3R7LA 4PX9A 4RJTA 3INTA 3QW2A 1MU0A 4FILA 3GRVA 3NT5A 1ZNYA 4WLNA 1QYXA 2FPRA 2WY2D 4UQOA 2APJA 2HT6A 4JLBA 1COKA 2V03A 1TRKA 3C6QA 1SCJA 2PWPA 3OHMA 2NVUA 1LS1A 3IDZA 3G6XA 4IJUA 3ZN2A 3FRJA 2ZRHA 1VXRA 3PUYA 3FNEA 3IT3A 3L1KA 4DFPA 4RADA 3W8DA 1Z8DA 2GPBA 3E9YA 2QRZA 3GMSA 3LCCA 3K1RB 4QWDA 1QG4A 4OUDA 4LY9A 5GVSA 4BKRA 1D2NA 4PTYA 1X1SA 3QX7A 1YHZA 1QCYA 1BRMA 2QNBA 4CR8A 1G9XA 5DGCA 1Z4MA 1W36B 1ISPA 2JV3A 1WXWA 3LK9A 4S0XA 1KOGA 5B3KA 1U45A 5DWDA 2HCFA 1ZVMA 4J3FA 4ZI7F 3LOPA 2Z8YM 5FXMA 3JRNA 1Y5LA 2A86A 2EBFX 3NUZA 2QX7A 4Z9AA 5IZCC 1IY0A 3T95A 4NC9A 4DQDA 5BT9A 2WAMA 4C0LA 4ABTA 1UP6A 1MNQA 2JZCA 5BV0A 1LDNA 5J63A 3AQFA 3ZWWA 2Z6UA 4BVEA 2PZLA 1W85B 1WXHA 3FTFA 1NOMA 3G6KA 3RKUA 1TADA 1RE0A 4UHEA 3WWPA 1N34B 3HI4A 3MW8A 2FP4B 3G9XA 4YQYA 4Q1BA 4DL2A 1K8YB 1XZMA 4JSYA 3GYBA 2H29A 2JH1A 1NLZA 4GPZA 1Y1LA 1YL5A 4ED6A 4Q45A 1K7FB 4YRDA 4FOTA 1VHWA 2X0FA 1O94D 3PCTA 2XV1A 5CFZA 5ICCA 3F6RA 2BQ3A 1WETA 3CU5A 3QIVA 2Y1IA 2BZ0A 3OCUA 3H99A 1WWVA 1KNXA 3AUUA 4BNJA 5KFDA 5FWYA 4N65A 4KZPA 3AERA 2ZS8A 4Z4HA 2I55A 3CUYA 2BJHA 2SKDA 2DERA 3DMTA 2LGJA 5CNKA 1CUYA 1TT5A 1HT3A 2A58A 4DMKA 4HDQB 3HVUA 3WC4A 4WKGA 1Z2PX 3IJRA 3I9V6 1FMJA 2NWQA 2JANA 1I3LA 4C4RA 2ZI6A 3RASA 1QPBA 3K92A 1JJFA 1UMDA 3DL2A 3AB3A 2PX2A 1E4OA 4EMTA 3BJIC 4I9GA 3IAFA 4BQNA 2IZ6A 1J39A 5KCMA 4IXDA 1PL7A 1Z22A 1FS4A 1WPQA 3C43A 2NPIA 3FMIA 1YAJA 1BNOA 3Q85A 2XA9A 3ZS8A 1GVNB 3FE2A 4IIGA 4IJ6A 2O8DA 3NHBA 2YWGA 5DDIP 2WM8A 2KSOB 2POQX 1Z6TA 3GRCA 4MUMA 5EVCA 4QEZA 5KG3A 3WGHA 1TAUA 1RRGA 1KDVA 3EZ6A 5KSWB 1WQ3A 3Q8WA 4K0RA 4QU8A 4OKNA 2J3HA 4MRMA 3OEHA 2VA9A 3MLBA 3DXXA 1ISMA 3IH5A 4BYGA 4V0OA 2YC2C 4ZVKA 4KZKA 1W0JA 2XCOA 2BELA 4MIEA 1EESA 2IUEA 2WIKA 4OQDA 5BUSA 2LKDA 5M3BA 1UMCB 2AE1A 4FCTA 4B3GA 2A67A 2BDUA 4N7BA 3HYNA 3TLZA 2JCXA 1C9NA 3HXTA 1ZIOA 3OP1A 2GH1A 4UTZA 3AQEA 2YIMA 3MUFA 3H2KA 2GHIA 2Z3ZA 3U37A 3UHJA 2EP7A 2Z4RA 5D3MA 4PNPA 2PKYX 5CXUA 1UHUA 3NYIA 1U0OC 2WOJA 4V1CA 4B0OA 5BW4A 2JBAB 4OEHA 2X5KO 2RIPA 4YREA 3LYSA 4DLTA 4YRIA 1Z3EB 2JEFA 5JUMA 1V38A 1XHEA 3D6JA 4ER3A 3GVHA 1W4CA 4LOJA 2WV7A 4JQZA 1Y1TA 5GONB 3HM9A 3SZLA 1X92A 1X14A 4NYMR 5FLEX 1BZYA 1V3TA 3WQHA 3PEEA 3HJCA 4P84A 1KMIY 3THYB 1EXMA 5G0SA 3GAAA 3TJMA 4V0SA 3PCXA 4F4UA 5FBRB 4DA7A 5CNJA 1M0WA 4B9LA 5BPCA 5T57A 4RAOA 2B78A 4H7IA 1I10A 3LKZA 4UXHA 5EY5B 2D59A 3IUPA 4DL6A 1VJ1A 1JEAA 4AG6A 4D79A 2XUDA 3GK3A 1NNLA 2VPPA 5IBPA 4OXKA 2AN5A 4QAQA 4L9WA 3IG8A 3U7HB 2FN4A 1U1GA 5J1SB 1O03A 3KJZA 1EE9A 4QICA 4J1TC 2WKQA 2FG7C 4RA6B 2DFDA 5GIPE 3DLCA 3AR6A 1CJSA 1PFYA 1USKA 1EK1A 4DMUB 1AU9A 1IM2A 1PJBA 4F2HA 7GPBA 1NP6A 4F4FA 3QSGA 3N0VA 3VPFA 1X7GA 3CIOA 3WMWA 1OV4A 3CPJB 1K98A 7ICFA 3WMEA 1W36D 5EL0A 2AXEA 5FWDA 3UGTA 4HVCA 1P0CA 2VT3A 4YP9A 5KJ6A 4LWZA 1B6GA 2HADA 1XC9A 2Q2VA 4KWTA 4ZT5A 3RR2A 1SQFA 3C48A 3LU1A 4ZI2A 1UQRA 1OI7A 4EUNA 1YULA 3ZUGA 4JI7B 1M74A 1PLJA 4HLCA 3S44A 4E51A 4AIRA 2FX5A 4KFUA 3PHJA 4WEQA 4RZIA 4XVHA 2F2TA 3D54D 1N60A 3N76A 2NP6A 3BWCA 1KRXA 2RGDA 4F9TA 3SDZA 2FE4A 3HN6A 2RMKA 2AJQA 2RBEA 3RK1A 2WNHA 3ZGYA 2HR1A 1KO7A 8ICEA 2VJPA 3HTXA 1IG6A 4PBTA 1SXJA 2H16A 5CB4F 2H1SA 2WU4A 3LC0A 2BM0A 4BWJA 1QVWA 4B7CA 5EUBA 1YFJA 1ECCA 2FPGB 3CV3A 5G0WA 5IP5A 5AKHA 3GWGA 2CL7X 1OXKB 4JBYA 5BR1A 3D3KA 3RC2A 2ABWA 3PSIA 4TWZA 4TMYA 1HG0A 4L4RA 1FRNA 3NZEA 4X44A 5I4KA 3TNJA 2BUAA 4PU0A 4CIWA 3CH5A 4OFWA 5M5BA 1A0PA 2FMKA 5I7UA 1SHLA 4DSJA 3S2SA 2YKGA 5K6RA 1TJYA 3GJYA 2WFZA 3L7OA 3D0QA 1JYSA 1VL0A 4R8KA 2CT8A 1LSOA 3L0BA 1NE7A 3GY0A 2VCHA 3M0EA 5H83A 3I2IA 4JJ8A 2VHXA 2VHYA 1VC2A 3I52A 5KEIA 2SCUB 4DG5A 2B6GA 4GMGA 3W7AA 4A8JB 4BX3A 3QIAA 5E7MA 5EE3A 1SA0B 2W6CX 1IPHA 3KSRA 1FRQA 4PCAA 4JCCA 4TLMB 2H0QA 1CJUC 1GZSA 3QVOA 3KTDA 4MWEA 4ZOEA 1IBSA 4EF4A 3PIIA 1F5NA 2X0JA 4HXFB 6REQA 4OGFA 4J7UA 4K6OA 2R3SA 3WK7A 3AY3A 2WKWA 4L4YA 4EL5A 4CEIA 1I3MA 4CG0A 4ED1A 1NWHA 5FOXA 2HMSA 1NK4A 2Q3EA 3HB0A 3SD7A 3SR4A 5B2FA 1K6MA 3KR2A 1J8DA 1Q0TA 4BVAA 2F64A 1ZK2A 5ES4B 5T4EA 1Z68A 5L9AA 5F4BA 2RB4A 2I33A 2ZRLA 1ZFNA 1ZGJA 2CC2A 3ICOA 3H2JA 3O8QB 1XZCA 5AM5A 4IDFA 4DIEA 4EKEA 2B5VA 3GU3A 3KQWA 5IKOA 2XVTA 3GF4A 3W1EA 4IOLA 1VL8A 4JJKA 4BKUA 1KIFA 3T3GA 1E2QA 4MHOA 5FADA 4C8NA 5CR9A 3VR4H 5JU6A 2PZBA 1RXWA 4CMJA 4C0QC 1RM3A 5KFVA 4CV1A 4IKEA 1S1CA 5DKFA 4L0DA 3VOTA 3OSNA 2V6IA 3GVCA 5REQA 2E5FA 1QHYA 1ZRSA 4HDKA 4P80A 3I92A 5FR1A 1BKDR 1HXHA 2CKMA 4CNQA 1PGJA 1G4HA 2OC4A 4LZJA 1A9PA 1VRVA 1JT2A 4RD0A 4AK9A 4XVRA 3H97A 4A2QA 4ZGGA 4C4YA 1CHNA 3OEED 1OAKA 4BN0A 1UQTA 1L7BA 2V96A 5G2OA 2WD8A 1AV7A 1A8QA 4AECA 2HBMA 5IT0A 1U28C 1LBSA 3DULA 4S1PA 1K1EA 3V7WA 4YMVA 4DLUA 1VL5A 5TRTA 3R7AA 2LYBA 3ONDA 5ALJA 3N2GB 2AUNA 3FWPA 1QSGA 1TCBA 4MP6A 2LIVA 1YC2A 1G8YA 4PC7A 3S1AA 1RYSA 4AY3A 1AF4A 3VJKA 1N5OX 4M1KA 3DHVA 2VA2A 3K16A 2W2XA 4RUKA 8ICLA 3T7KA 2OFPA 2R6JA 4TLLB 4OHBA 1O94C 3ZD7A 2A9KA 4E5MA 1IZYA 3MQFA 3VYVA 3MUEA 1P4HA 4LYEA 4XWWA 4F50A 3EXG2 2DPHA 2A0UA 1NZJA 1V11B 3HDGA 1EGQA 1YDHA 1KDRA 3FCUB 3MT8A 3BD7A 4XWKA 3VGPA 2ODQA 4UHDA 4DTCA 4C6HA 1X1BA 2VJMA 3FF4A 4HT3B 1Q50A 4Y1FA 4KQ9A 1SUAA 3LPLA 3ZWNA 1AS0A 3ZTWA 3IE0A 4JYBA 1SBZA 1L7DA 1OGJA 1OXTA 4O5CA 2QD5A 1OXVA 2ZITA 1RXSA 4RQ2A 1W96A 4JJEA 5U1PA 1RP1A 1X7ZB 4FQ8A 3T1YB 2XT6A 4PSCA 4I28A 3RODA 5AUQA 1TUEA 3GG2A 3LF2A 3KWMA 4KI7A 2VYFA 3OO0A 4EUFA 4CFZA 1MH1A 4RPKA 4LFBB 5JNLA