1O03A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 77
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o03A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o03A01
2I34A 2IYEA 3OTQA 3W5BA 1U02A 2FI1A 3OCYA 1VJRA 1RKQA 4J2TA 3L8HA 4HYTA 2HHLA 3QU2A 5AKKA 5A3SA 1EK1A 1JUDA 4PNHA 4E88A 1QQ7A 5AK6A 3DDHA 2NO5A 4MUMA 5AI0A 3L1VA 5AM1A 4BX2A 4YIHA 4L6AA 3N5KA 4UMEA 4BNDA 3ET5A 1Z4NA 3WKDA 3FPBA 2WF9A 5AW9A 5AM0A 3OCWA 3R09A 5AVYA 5ALEA 4DCCA 3UMCA 3ZX5A 2C8LA 4OFZA 3WK9A 3ZUPA 3L8GA 2I33A 3QGMA 2G09A 2R8ZA 5ALMA 1YMQA 4ZEXA 3KDPA 4BNDB 3CZ4A 1ZS9A 3ESRA 1EK2A 1Y8AA 1LTQA 2PR7A 1Z4KA 4NFLA 3EPRA 2FUEA 4HGPA 2MU2A 3OCXA 5T41A 3OCUA 1TJ3A 5AW2A 1RC8A 1WR8A 4HAIA 1MH9A 2R8YA 3FPSA 2W11A 5ALZA 3L0BA 3WKAA 3ONNA 3AR6A 3WK8A 1KYTA 3A1EA 2C88A 1YNSA 2GO7A 1IWOA 3SHQA 1L8LA 5AM2A 2QYHA 4FYPA 4HGOA 2YMLA 3U7HB 2OYCA 3SD7A 2FPUA 4HGNA 5AVUA 5ALLA 2FPWA 2HX1A 3IB6A 2G06A 2P27A 3SMVA 2RB5A 1SWWA 4BX0A 2FUCA 1U7PA 1S8OA 4Y2QA 5AVQA 1LVHA 2B1RA 3RF6A 5AVWA 2HOQA 3W5AA 1QH9A 1T9ZA 2YMPA 2I7DA 3A3YA 2WF5A 1L7OA 2C9MA 5AVTA 5AI9A 1Z4JA 1NRWA 1YDFA 3QU9A 4UMVA 5IT4A 2Q5EA 2R8XA 2PKEA 4L6CA 3WKCA 1L7NA 5AIBA 2B0CA 3MC1A 3J7TA 4RETA 3QYPA 4UW9A 5AVZA 3EWIA 1TA0A 4GXTA 3UMGA 4EX7A 2GHQA 5ALHA 3U7EB 4F71A 5AKEA 2QLTA 3B8EA 3QXGA 4Y2JA 5E0OA 2AMYA 4EX6A 2ZBEA 3HLTA 2HDOA 2ZG6A 4EELA 3ESQA 3WKBA 4XE5A 4YCMA 1QQ6A 3NALA 3M1YA 2YMQA 3NANA 2HF7A 2DQSA 5AKYA 1RPZA 3ZU6A 3QX7A 3KBBA 4Y2TA 5AW0A 5AI4A 3BWVA 2IOFK 3U7FB 2Q4TA 3E84A 5IT0A 4EEKA 1NNLA 4Y3UA 5AKZA 2W43A 1RLTA 1Z5UA 4I9GA 2AUTA 3L0CA 2P11A 5ALNA 3SKYA 3L5KA 5AKXA 4UATA 2FPXA 3DV9A 3NRJA 4J03A 5AW1A 2CFSA 4UASA 3E81A 3L8FA 5AESA 1TJ4A 2IA5A 4CF3A 2IOFA 4DFDA 3KD3A 3PGVA 3QUTA 1Z4IA 3L7YA 5ALXA 3ZI4A 3ZWDA 4YGYA 4MWOA 5FP0A 2C4NA 1YJ5A 2P69A 5AW8A 1RKUA 3I6BA 2BDEA 3D6JA 1L8OA 4EENA 3AR5A 2AGVA 1Z88A 2G0AA 1U2SA 2ZOSA 4YCLA 5AKGA 3AR2A 5ALQA 3ET4A 3ZVLA 3HYCA 2GFHA 2RARA 5AI6A 1YS9A 4KX3A 4H1WA 2RAVA 4L57A 3NASA 3A1CA 4BBJA 5AIAA 1T5TA 2ZBGA 1J8DA 5AI8A 1SU4A 5ALRA 3NIWA 2WF7A 2C8KA 3MPOA 4OCZA 4O8CA 3EF1A 3FZQA 3MMZA 2HO4A 5AKLA 3NUQA 2OBBA 5A3RA 4UU0A 3QNMA 2YN4A 3DAOA 2I55A 5ALUA 5AK5A 5AKJA 4BEVA 4BEWA 2G07A 4JB3A 3WK6A 1N8NA 1K1EA 5AVRA 3M9LA 1Z4LA 5AKHA 4G63A 4Y2XA 3EF0A 1RLOA 4XQ0A 2BY4A 3B9BA 4UAUA 3QUCA 3I1YA 2JAUA 3W5DA 2ZXEA 1RDFA 3WK4A 3I28A 3L1UA 1FEZA 3E58A 4UU1A 5AW5A 1RMYA 2VKQA 4Y2RA 3KZXA 1TJ5A 3B9RA 2ZBDA 1AQ6A 4DWOA 2GHTA 1ZD3A 2JAWA 3BA6A 2B8EA 2AH5A 3OPXA 1O08A 4KX5A 1RQLA 4HGRA 2CN1A 3QU7A 3QU4A 2B30A 3N8GA 3AR9A 1WVIA 5AICA 5AK4A 4BX3A 4BKMA 4JDPA 4FFDA 1VFPA 5ALKA 2YBDA 2B82A 4CF4A 3FVVA 2YJ4A 4NAVA 3ED5A 1Z5GA 4YIKA 2HEGA 4Y2VA 2FPRA 2RBKA 4CE6A 3U19A 2MSNA 5ALDA 1J97A 1RQNA 1Z4PX 3ZTYA 4OHFA 4CNQA 3W5CA 2IOHA 4AS2A 1RMTA 5ALJA 4NABA 3AR8A 1RLMA 2I54A 3IRUA 1F5SA 3L0YA 2EARA 4I9FA 3MN1A 3SKXA 5AVVA 2G80A 4NV0A 5ALSA 5AKIA 2FEAA 3L8EA 3ZW7A 5JJBA 5AW6A 3ZWKA 5A3QA 1WPGA 3OCVA 1RMQA 3SF0A 2OA0A 2YJ5A 2FPSA 4ZEWA 3TLMA 5ALGA 2P9JA 5ALOA 1O03A 2YMMA 4HGQA 4B6JA 4UM5A 1WZCA 1ZD4A 1L6RA 4EZEA 3F9RA 5ALWA 4Y2SA 5AVSA 2PQ0A 3VAYA 2JAOA 5AM4A 3PGLA 5ALVA 3RFUA 5ALTA 1ZRMA 1Z4MA 3WKEA 4DW8A 2ODAA 4FE3A 2JGAA 5AW3A 1YV9A 3KOOA 1ZD5A 4C4RA 2X4DA 4AP9A 4ZEVA 4QQFA 5AW7A 4Y2PA 3SLRA 3IJ5A 4G9BA 2I6XA 2Q4RA 1U7OA 3FM9A 3WK7A 3QLEA 1CQZA 5ALPA 1QYIA 4C4SA 1SWVA 2O2XA 1X42A 2WF6A 3S6JA 3NAMA 1NF2A 5AM5A 4UM7A 4BYGA 1TE2A 3FGOA 3WGVA 5AK3A 2JARA 3I76A 4CF5A 4KYTA 3QUBA 1Z4QA 2WFAA 1VJ5A 4C4TA 4OD0A 1PW5A 2B8JA 2HI0A 4IG4A 3PDWA 1XPJA 3DNPA 1CR6A 4YH1A 2MU1A 3P96A 3U7GA 3U26A 3ZX4A 2YY6A 3QUQA 2G08A 3UMBA 4GIBA 2CFTA 2HF2A 2EATA 3CNHA 3ZTWA 3OCZA 5ALFA 5AM3A 1T5SA 3UM9A 3AR3A 2B1QA 4XPZA 3WGUA 4KNVA 3N28A 5ALYA 4KN8A 1N9KA 4F72A 2NO4A 2OM6A 4RESA 1ZJJA 3N07A 5AHXA 4UARA 4Y2YA 1Q92A 3ZVMA 2YJ6A 5AW4A 1S2OA 2NYVA 1XP5A 1RKVA 3AR4A 2R8EA 2W4MA 3PCTA 3GYGA 3K1ZA 4NWIA 5AVXA 2FDRA 1L7MA 2HCFA 1XVIA 4IFTA 3R9KA 3KC2A 4AS3A 1L7PA 2G1AA 1ZRNA 2WF8A 1QQ5A 3R4CA 3ZVNA 2GMWA 1RRCA 2HSZA 3N1UA 2WM8A 2WHEA 4QJBA 4UAVA 2ZBFA 4Y2UA 2CFRA 2YJ3A 3A1DA 2O9JA 2BDUA 2D2VA 1U2TA 4UMFA 5AI5A 2EAUA 4YCNA 1Z4OA 1ZOLA 5IS2A 1Q91A 3WK5A 3QU5A 1ZD2P 4KNWA 4UMDA 3AR7A 2YFYA 4XOUA 3U13A 3E8MA 5ALIA
chains in the Genus database with same CATH superfamily
4IQTA 4JA0A 4BL5A 3EIEA 4Z1MD 1JPJA 1T13A 3OCYA 1R0LA 8ICQA 1RIFA 3TO5A 4BB0A 1JI0A 3F53A 1F3OA 3BD8A 4TV8B 4V0NA 2NU9B 4I2HA 1R64A 5GY7A 4QUJA 1XAJA 5J2CA 1FTNA 4C7OA 1W88B 1NF9A 4Y6SA 3OZTA 3IQHX 4DBLE 3KAJA 1CVLA 4RLFA 3HMQA 4F9GA 4RQ1A 3O8RA 4P33A 1FSSA 1TOAA 1HG1A 3HVUA 1YA8A 3MXOA 4UDNA 4UCWA 3Q7PA 1GPNA 1DQZA 1YQWA 2QQGA 2W4QA 2A3NA 4PNHA 3KVNA 2LTAA 4IDBA 1H8HD 1X9WA 4DRZA 4O1IA 1E2HA 1EINA 2NO5A 1T24A 2BPOA 1U0NA 2GZRA 3IAUA 4OG2A 3UXPA 1MCZA 1ISJA 2EBHX 3HB7A 2FPPB 4Q3EA 1JHDA 2CHUA 5E0KB 1GA4A 5EP1A 1UPUA 5BQOA 3TSZA 3AY3A 5I5GA 3GLVA 1QYVA 2DJ5A 4M0CA 4C6RA 3IAM6 3D5EA 2PH3A 1YR1A 2MYPA 1IIPA 4P86A 2R8BA 2H1RA 4HQLA 3DL7A 2AJTA 2E5FA 3MJDA 3RFAA 1Z5OA 1QP0A 2XA1A 2KHVA 1X6JA 3WK9A 3IBFA 3OMXA 3P52A 7ICJA 1JHAA 2VDVE 4WBNB 4EI2A 2C29D 1P4RA 2H2WA 3NUGA 3P0HA 4IHQA 4JEHA 3CO5A 4LOIA 4B9LA 2O8BB 1TAMA 4TWIA 4MKRA 2X8LA 1NVBA 4C4PA 2KQUA 4PM4A 3ORYA 3P9SA 5ITWA 1BOFA 4A6EA 4EA9A 3R7WA 2OILA 2R6R1 3RYHB 1DQYA 3GJTA 3S2SA 3C1AA 1P45A 4A2WA 1CY4A 1VL8A 3WHLA 3OICA 4BP9A 5AW2A 3ZY5A 1GEGA 4DDWA 4HAIA 1DAHA 1OYWA 2R8YA 3FVTA 3SSMA 3V6LA 1L5KA 3A3KA 4C6SA 1Q19A 1LV8A 3WKAA 3PW2A 2PZBA 3LCRA 3TAPA 3L0DA 1AS3A 5KUTA 1VYTA 5CH8A 4G3IA 1G1AA 1RWBA 3T06B 1XZNA 4LWPA 2XZLA 1PVPA 1IWOA 3JW8A 1U9LA 4YMTA 9ICIA 1VPVA 2Q7XA 4QGHA 4ZT7A 1F20A 5KJ1A 1XO1A 2BWJA 2V98A 2GCNA 1ZN8A 1GPYA 2E3JA 2Y66A 3HE3A 4ZVRA 3UAZA 4AZTA 1ZNQO 4HQNA 5DHAA 4D46A 1N0HA 3NNNA 4FX5A 3H4MA 2LM4A 1L4UA 2PDAA 3JPRA 4BX0A 3DH0A 3CRXA 3U4HA 1I2MA 3BDAA 5DYGA 5BPCA 1Z00A 1C29B 1UMDA 4RHXA 4YC7A 4PR3A 4M22A 1Y5IA 2BP7B 1M5UA 4BWFB 1QP4A 2QVBA 4KP7A 1BDMA 2NZXA 4ZANA 4YT4A 4Y8VA 4ZHQB 1N5WA 2OGWA 4J4TA 5H0IA 2NUTA 7REQA 5EIHA 4WL0A 1P6QA 1IL0A 1T3LA 2HF8A 3PJDA 4QW8A 4X1OA 2BFEA 2QLFA 4DLTA 1SD2A 4F8EA 3EJ6A 4IDQA 2BGWA 3GRPA 5IVKA 3EG5A 5JYEA 1P18A 2J3LA 4B9EA 1MTOA 1QJCA 4HV4A 1HDCA 1QZUA 5HVNA 4UB1A 1MIOB 2Z2KA 2XXBA 4GGMX 4DOCA 3PFCA 3VU9A 1W36C 3VR5D 2B0CA 1X38A 1KEZA 3WGJA 1Z29A 3GF4A 4F50A 3UQZA 5AVZA 1XR3A 5F4BA 2C7OA 3ZCSA 3FETA 4RLHA 9ICXA 1SVNA 4GLJA 4HNAB 3MQFA 3WYDA 5DWVA 4F71A 2ZJ3A 2BGIA 4CM1A 4DT1A 3A25A 1AX9A 3GT7A 2ZWIA 3K0KA 2AMYA 2HHUA 4KR2A 4MRRA 4WJ3B 1XKXA 3D3KA 4M0UA 1T0IA 3DS8A 1OAOC 3HYRA 1UAGA 4XFJA 1PL0A 2ZUSA 3B9QA 4NF2A 3INYA 1T6NA 5ERGB 5BRJA 3QZ7A 3WWDA 4R4JA 4RTLA 3KJQA 1O6FA 3HB0A 4UBJA 3PPIA 4F96A 3OQ1A 4P2BA 4RVSA 5C3UA 1GARA 5B5SA 3M8RA 3K09C 5BN5A 2X0EA 3ZU6A 2VYVD 2WSYB 2H4JA 3LUJA 4RD3A 3S55A 3UJPA 5DTJA 4IICA 2IOFK 5MF6A 2BEWA 3PFKA 2EP5A 1J0DA 4RTQA 5IBCA 4AU1A 1ZC4A 3E84A 2X42A 4HK4A 4R9NA 1RZTA 3UMFA 2PFNA 4GSLA 4B4DA 1IUNA 3OUUA 2P9HA 4HFJA 5M34A 2XYGA 2P77A 1E3QA 2YR0A 4J0KA 2V6IA 2A86A 4NEGA 4CEIA 1PL7A 1R9NA 3A2MA 2DUMA 2OBFA 4M7WA 3PJFA 7ICKA 1NW5A 5FBKA 2Y2UA 3PXXA 2W0SA 3HUTA 1J8MF 3OZRA 1J4AA 2QENA 3PQ7A 3UFXA 3CZMA 3MIIA 1AIPA 1O8CA 1Z6QA 5FWAA 3TQQA 5AESA 2ZETA 3HHEA 4HMQA 5P8WA 3ZYZA 3ZHQA 2ZWOA 5E6SB 3UY4A 3ZXYA 3VNAA 1IUOA 4BZPA 1A77A 2QN9A 1JS1X 4YT8A 2PAFA 4GM0A 4EB6B 4DFPA 1J39A 5J2UA 3AHJA 1SBCA 4HN4B 4AS1A 3OSZA 3GXOA 4D45A 1VYHA 3C1OA 1R3UA 1X7WA 3GA0A 2HTFA 1V8PA 4G5QA 3UA3A 4UNSA 3C2KA 3SICE 2CWDA 1HE2A 3H2HA 5F35A 1Y1PA 3I5MA 1UXGA 4NEQA 5G0SA 1DBQA 4IOKA 2BDEA 3ACBA 3LXXA 4TMFA 3AR5A 4NCJA 5KTNA 1U2SA 3DHNA 2VNSA 3V48A 1M34A 4IDPA 4RBNA 2RKBA 2YQ5A 3TOCA 5E3JA 2FU5C 2V7EA 1V8OA 1PO7A 1TM1E 3EMBA 4U7WA 4K26A 4O2AB 3WLEA 1TKDA 1OTXA 2RB4A 4PZOA 3E9EA 3GBPA 3LHDA 3BOSA 4P7BA 2PSEA 1TVKB 2YWBA 4JQYA 4P38A 2IOQA 4HB4A 4OHMA 1FQWA 3S8YA 1I6WA 2ZB7A 4NL9C 3RJEA 3ROGA 3RLFA 9ICMA 1I4LD 5CCEA 3AO0B 5FLEX 1SBHA 1EFDN 1IB6A 2VWGA 1VECA 2FZLA 2VDKB 2ZIXB 1LRLA 3P9QA 1XEWY 3QF7A 3U48A 3TRFA 1MN6A 3VH1A 4BVAA 3SWWA 3K70C 5LQNA 1D0SA 5J8YA 2IXGA 3ST7A 4IMIB 5J0OA 4OY3A 1J7KA 3M9OB 1QFSA 4RE6A 3V2IA 4I0WB 3L06A 5EFOA 2XNDA 1F4VA 4TXNA 3IVRA 4FXPA 1FYDA 1J2EA 1FXWF 2GBLC 2P2GA 1TC1A 1ACJA 2FYTA 1BEUB 1WLSA 3R6TA 4IV0A 3VHXA 2I1LA 1LD3A 4AJPA 1QV9A 2UYQA 3VGPA 3B53X 2MSEB 1KI6B 2YL2A 3PGA1 4LZWA 1DWPA 6REQB 3PVSA 2OUIA 2OCBA 2OHOA 3P5BA 1NM5A 4UAUA 4Q1BA 3W79A 3W5DA 4FLFA 4DV3B 3C70A 1MNQA 1E4YA 2EFCB 2ZXEA 3FR7A 2WAXA 1DRGA 3RSGA 5TGZA 2GETA 3E58A 2VK4A 5DBOA 3LCMA 4I08A 3ZH2A 2IYRA 5MN4A 4Z0HO 4A8JA 2OEHA 4ZAGA 3SIPA 3V34A 4DMMA 1JMVA 3BH6A 1E2PA 1Z00B 3FF4A 5FUVA 2E8PA 5LQAA 9ICJA 4DWOA 4TWAA 2KS6A 1KQGA 4I2AA 3EZNA 2PFQA 1K1SA 3DFUA 2RQ5A 3M34A 3IEKA 4RL6A 1WY7A 2H3ZA 1WDKA 1U2EA 3CW8X 3FHJA 1G6OA 3KHRA 3MUNA 2WYVA 3LJKA 3P9NA 4JB0A 4C0HA 1RM5A 2N3ZA 3DMYA 2W2NA 4UD6A 4OGKA 1N92A 1A4UA 1HA3A 4XFDA 2F4NA 5BW5A 4CETA 5ICMA 4QASA 1X80B 4MO9A 3MMSA 2E6UX 2IKSA 5KL1B 2ZULA 3NS7A 5LZ7A 3WL8A 3RHFA 1BNPA 1E2DA 1T15A 1WVGA 5LZ8A 4DLXA 1ZJZA 3NBYC 2HZ7A 1VCIA 1GXSB 1JQJC 1T1SA 1QR6A 2BM8A 2WILA 1AKEA 1G8KA 7ICNA 3MWYW 3DJYA 1EWVA 1E1RD 3GMTA 1ZXBA 3JWJA 2AUNA 2HSEA 3PLNA 3UT5B 2Q0XA 3OE4A 5T6MA 4MGZR 4H6XA 4MI3A 1QU3A 4YCSA 1ZGJA 2UDPA 1H5QA 1Q11A 5F3XB 2UVPA 4N9QA 3SE0A 1LB2B 4W7SA 3U4DA 5IEJA 1WPQA 3COVA 3BZCA 4PPNA 3RRYA 2IOHA 3ZLTA 4KHZA 4MYHA 3EOZA 5EJIA 4BO0A 1W96A 2IYQA 4XIFA 4KLQA 4EY5A 1NMXA 2I2DA 2Z09A 3T5PA 1JSCA 1L4KA 1FRFS 4ND8B 3STWA 2ZVQX 3A6JA 1J5XA 5HDBB 4R6XA 2L69A 4C4ZA 4NV0A 5BXYA 5JC8A 4QZGA 5H83A 3GU3A 3TB4A 4E1AA 4IDOA 2QARB 2YBEA 1O95C 1DBVO 3AUAA 3ZTTA 1O6GA 1KMCA 2XMCA 2CMFA 1KWGA 3FDZA 4IUDS 4Q4JA 2X0JA 3RI3A 3KS9A 4OGFA 4M04A 4X24A 3UEOA 2PUDA 3A1FA 2A35A 3ESAA 1MC8A 2DBYA 4JJ7A 1DOHA 3HP1A 5DMXA 3E9QA 2KBFA 1COWD 5DF1A 3R7NA 3KZCA 4KK3A 1P6XA 1O03A 3WIDA 4DA9A 5J2EA 1IBSA 2C94A 2BJHA 5KINB 2ZI4A 4XGKA 2H8GA 2DUNA 4F6CA 1OU4A 2VJKA 3IHTA 4PPXA 4WD3A 4LF7B 5DBBA 1MZVA 1SG6A 3ZHCA 2AFIE 1NG1A 1EE9A 1TM3E 1BS9A 1DUSA 5ALWA 2PS3A 3CN9A 3AI1A 2AXPA 2IF0A 3FNHA 3LG2A 3WYBA 4OFBA 1S9HA 5CLFA 5ICEA 2DUJA 2WPNA 4YJFA 3RRGA 2XQKA 5KDLA 3T94A 3RRHA 4X7PA 1M5RA 3BDIA 2WJIA 5A0VA 4HNHA 1XSPA 1F0NA 2HDWA 2MTBA 3D0RA 4LECA 4UHJA 3FGZA 1WHSA 2G5IB 4LJ5A 1EBBA 3KHGA 3RABA 1DE0A 8ICIA 1Y9DA 3ZS8A 1DEXA 1IG6A 4ZDIA 3OF5A 4U7JA 5ADWA 3NKLA 3KOOA 4C4RA 4UE6A 4Y6PA 1E96A 3DL4A 2A9RA 2R751 2PWBA 3K9NA 4LVOA 1QV6A 1GPAA 2ZR9A 3GJXC 3IJ5A 3D0KA 3H5VA 1GVHA 3QKRA 2I6XA 4KGVA 3UV6A 5CK4A 1XF1A 2X41A 4LCEA 4OQPA 1CHNA 4UZSA 4CN9A 3OETA 3Q3JB 1MABA 2G28A 4KQFA 4Y9SA 1FFUA 1CQZA 4NYMR 5DX0A 1DIOB 1T0PA 2HHJA 2J0VA 4YRDA 5EIAA 4WN3A 3TJZA 4R8UB 2CBZA 3S8EA 4GLBA 1FFDA 3AU8A 1V5EA 2EKBA 5E6UB 1T9HA 3M49A 4DANA 1D6MA 3EZ5A 1Z6PA 4DSOA 3OQIB 4M3NA 1KL9A 5JUMA 1UZMA 1H94A 2V59A 3CNLA 2DH5A 3PD1A 4RTKA 4Y6OA 1NBEA 1FSPA 1JU9A 4LUCA 3P0RA 3FMVA 4KYTA 5DDYA 1REQB 2P7HA 2VT3A 4WOCA 1CY7A 4ESOA 4QZVA 5H02A 3OEYA 5J0UA 1FP7A 4I4LA 4JBNA 3V1UA 3O1IC 3QBEA 1TLLA 5C7YA 3DVLA 4IG4A 4WX2B 1BHQ1 3GP8A 3H6HA 3GZ4A 2AFHA 2J5RA 3VO9A 1E3DA 4LPSA 3NBXX 2CCKA 2Q3MA 1DBSA 2ZDGA 4FFWA 4EMSA 4KLLA 3ZDAA 1L1QA 3JQAB 2A94A 3ALRA 4IWNA 2HXYA 4LRWA 3U26A 5JLAA 4JP3A 4JJEA 2D1RA 3ZNQA 2C5GA 1VRCA 1IBMB 2JGJA 1DOZA 5JU6A 2K4MA 5LL6P 1OREA 2R9VA 1BWSA 4MAFA 2KHQA 3OX3A 1QGOA 4M0FA 2C2BA 2R8OA 3PHJA 5JU5A 1N6NA 1WUJS 4ALMA 2VN8A 1L3VA 4XPZA 1ORDA 2Q3HA 3O8NA 3SLKA 3BMOB 2JLXA 3MABA 4MVYA 2GF0A 3WRVA 4ZVVA 4DV2B 5CTAA 3MTIA 5ALYA 1S0OA 1GILA 1QB8A 1T2FA 1QJ4A 4R9SA 2GKSA 2OBXA 5E8RA 1TRHA 5HS6A 1X13A 2V3VA 1S10A 5DCLA 3TQIA 1U0OC 3DHVA 4LMRA 5BMVA 3T15A 4NMWA 3GFKB 5KYKA 2ZWAA 2H6EA 2NNLD 4Q47A 1HE1C 2I7VA 1U45A 5FRDA 3OP4A 3OQMA 2XX3A 3HJUA 3AZOA 3ZVMA 1K7SN 3AOGA 3PDHA 2XSZA 2H2HA 2X9LA 2G76A 1H85A 1RKBA 3JWEA 3T1OA 1S96A 1YS2X 2H5XA 3QVMA 4JLOA 4JROA 1ZNYA 4OHOA 4IFTA 1Z0JA 4GNRA 4DJAA 2GNAA 2AGPA 3E2PA 4CHGA 3W2FA 5ENVA 3D6FA 4TKMA 2R8HA 521PA 4UTPA 4N7MA 2R1TB 1UKEA 3B38A 3A0BU 2BELA 5T14A 2X1VA 4LDRA 4PSCA 4QEDA 2IP2A 5CVUA 3UH1A 2DHDA 1TPYA 2ZJ6A 5IJZA 5EWGA 2PGIA 4Y2UA 1DHTA 3B3FA 1MORA 3P9RA 1M8KA 4OK5A 2V9ZA 3IQZA 1BE0A 3A1DA 4WWHA 1I6KA 3W4JA 4ZMSA 5KOHB 3U6BA 4OV6B 3SKVA 5CVVA 4WLVA 4GH5A 2W8BB 3AF4A 2IH5A 5KFJA 1VPEA 3WK5A 4G26A 1CUYA 1BX1A 1PR0A 4KNWA 1CIVA 4EPWA 2AOUA 1DIRA 3DR5A 3CLRD 5CJ2A 1XD8A 3F3SA 2NU8B 3E8MA 1HH4A 1AQJA 3C5VA 3EUWA 4M38A 5BNWA 4AY2A 4JGGA 3U40A 4CTJA 3W5BA 1ORWA 2ES4A 1S77D 2Y0SF 1B16A 4H7JA 5ERXA 3FDZB 3TRDA 3VPBA 2LCFA 3BWBA 1EX9A 2CYAA 1AGYA 1LK5A 1KSFX 5GZ1A 1IHDA 3M4JA 1LPMA 3AUOA 1EP2B 1ODJA 1T10A 3DLBA 13PKA 2BUCA 2QAIA 1X6IA 3NO4A 3MJEA 3M81A 2KJQA 4J1TC 4RD4A 3VDXA 3FJOA 3VO2A 4NNPA 3GX1A 4C0ZA 2JIQA 3H5RA 2ODPA 1KA9H 4H18A 4EB0A 2X2OA 2Q2OA 3MT0A 4R01A 1M0EA 4I6JA 1G9XA 4EOGA 3QXXA 2M98A 4MMYB 5CJ7A 2DPYA 3CX8A 4L78A 3WWZA 1O58A 4O4IF 3C48A 3WG9A 3RJHA 3BM5A 3TQHA 4RJKA 1PZMA 1UBKS 3KR2A 1PFVA 2DT8A 5F1KA 3TNJA 1NK8A 1T43A 4FYHA 1JIQA 5BV1A 5BQXA 2OCYC 3L3BA 1MO3A 4IYRA 2CLIB 1Q21A 4GWLA 3EUB2 4V0LA 4TQRA 1LSSA 1RM0A 2ZJ1A 5IYZF 4CCHA 1V9PA 4IZIA 4CTNA 3SJCA 4ETWA 3CLRC 4Q1DA 2VQ3A 1IPHA 2PH1A 2WMOB 4NMMA 5BOSA 1NJGA 3IVMA 3U16A 3RT1A 2GJSA 3NOVA 1YRHA 1K7YA 1VGQA 2W2LD 1MN8A 2YXEA 3DUFA 2ZGVA 2KV2A 3DE1X 3VJLA 3EPRA 5KB3A 1D5WA 2VPQA 2UAGA 2WSSD 5DSXA 1FA9A 3OZAA 2E1FA 4JT9A 3DMHA 4M86A 3RC8A 2BR3A 5KI6A 1QRTA 2CLCX 2Q5IA 4Y1RA 1V1MB 4QPZA 5C5IA 2EHDA 4FWTA 5FBLB 3ONNA 5DTIA 1PBTA 3TIGA 1KZ9A 2Q2NA 3UG7A 1OXSC 3IC5A 4M1QA 4W8GA 1VL2A 4IGEA 2Y1JA 1TK8A 3SC2B 1TAUA 4JMLA 1HORA 5I5EA 3U7HB 2OYCA 1I4TD 2WJVA 3OIYA 4PZ9A 2RBGA 5KQSA 5J4KA 1FYWA 4O4JA 1RBQA 4RPGA 3HHPA 2VZ0A 2FVYA 4P35A 4QPCA 1W36B 1V6SA 3K9GA 1WUKS 1XE3A 4TVSA 4F5OA 3P2EA 1FUIA 4I3HA 2ZS8A 7AT1A 2L42A 1Y0BA 2QYOA 1IPEA 1NOIA 2CLDX 3I2IA 3K2BA 3OWOA 3QLVA 3CV3A 1F5NA 1W46A 4YACA 4M8IA 5A4KA 5TZVA 5D4BA 2XW6A 3NHPA 4RT2A 1UBNA 5CVTA 3ZWNA 1NMSA 1GITA 3AQEA 2VSFA 1XP8A 1XQ6A 2WD7B 2VBGA 3JQBA 3LT4A 4C1NA 1QH1A 4GZLA 2R6AA 5DVZA 3A14A 3BC1A 4HZIA 2F62A 5B64A 2ZTHA 1T6ZA 3AFIA 1N0IA 3I9KA 1J2YA 3NHSA 1Z4JA 5CTJA 5T4FA 2PGDA 2C82A 3R4VA 4WPGA 2V58A 4OJTA 3DE7X 5GWXA 4IMJB 4DREA 4AXBA 1XV5A 2BZSA 1SRQA 1DBPA 5KFDA 3T5KA 3W3AA 4BHTA 2PX6A 3M4ZA 5IRCD 1WSBA 4JS0A 1HE5A 2G9ZA 4QDTA 3WB0A 2CXTA 4F86A 3O4GA 1TCBA 4Q6BA 1PSDA 4GT1A 1HPLA 3VDQA 2QV0A 1W9MA 1L7QA 2KN7A 4IIBA 2FXVA 3PUJA 2GHQA 3WGYA 5B53A 4BNUA 4EMTA 4Z53A 5JJLA 3ZJ5A 4ZHSA 5KJCA 3T95A 1N2XA 3PUYA 4ZYTA 1XTPA 4M8LA 2AE2A 4GQBA 4NENB 1FSFA 2LDBA 2CUNA 4MUXA 3ZXUB 1D2AA 2NZUG 3NAQA 2AWOA 1GPMA 3K6JA 2WMNB 1B14A 4CWAA 4EYEA 4POOA 5JAZA 4GKKB 3JWGA 4C6TB 2W55A 2QN7A 4X6LA 5C52B 4Q15A 2CNWD 3PZBA 4Q66C 3ETHA 2AXQA 3VHQA 5F33A 1BS2A 1J24A 3LNTA 1I7LA 4LHYA 3TLKA 3FBGA 3WRYA 1U8CB 4FS1A 1UBOS 2Y0BA 4ZVNA 4A6XA 1CYEA 2A78A 4LX8A 4DMRA 2E2WA 5JSFA 1NWCA 3B1VA 3HN6A 1Z73A 2GJ4A 3PBKA 2OK7A 3R41A 3IN5A 4LCJA 2H07A 2GYVA 3E5MA 1B43A 1NK0A 1FXUA 3AQ4A 3LYUA 3NI2A 3NOOA 1QHGA 3OY7A 5LZ9A 2P7IA 4F1WA 4P3NA 3FPFA 4IRMA 3HJAA 1E9BA 5F2KA 2YWJA 1I3MA 1M3SA 3DF9A 5HZGA 1U4NA 2FMKA 1NRJB 4BN4A 4BP1A 1TM7E 3ISJA 5A9TA 3HM2A 1SULA 1FYFA 4OL9A 4QYMA 4MQUA 5ALNA 3INRA 2IUFA 1MGPA 5DM60 2NSYA 4CR7A 1OXTA 3VV3A 5J0XA 2OPBA 5JS1A 4AUEA 1PTJC 2RCYA 2O07A 5BWMA 3FD8A 8ICXA 1T0BA 2ZRMA 3WSWA 4FCTA 1V8ZA 2EW2A 4L07A 5LKAA 1E8MA 1LZKA 1N5XA 2NU7A 3EXIB 4CRWB 4KSYA 2VJDA 1SKQA 2YV5A 4PRKA 1N7GA 4R8UA 3DXFA 3MOGA 4R41A 4TGLA 4U6SA 1P1IA 4WV3A 1H0KA 2X2EA 4LZJA 4NE9A 4DMHA 4CQNA 2X9NA 2AW5A 1A5BB 3P2KA 4IDNA 1UMCA 2WNHA 1FVFA 4WE3A 3E0XA 4LY6A 3OOWA 4ZT2A 5L7WA 5IP5A 4M76B 5DB4A 5DB7A 2XADA 1A0PA 5FTLA 1L7AA 2QM7A 3ABIA 1TQ4A 3BIWA 1JQDA 1O54A 1NZDA 1P2GA 2P0YA 1LDGA 3OQJA 4JU9A 1PBNA 1HI9A 5IJ9A 1MFPA 3T5GA 3IE1A 5AW8A 5I7AA 4CG2A 5IXSA 1V9LA 2R6HA 1L8OA 3Q0EA 4HMOA 4KPFC 4MWSA 3F71A 4AJLA 2AGVA 4Y7DA 2ZOSA 5BUCA 1JF8A 4C0BA 3DM9B 1ZQYA 3P4XA 4N5DA 2X2PA 1F0YA 2AKAB 2WOOA 3F0TA 4MVJA 4OF4A 5AI6A 1MJGA 4TMKA 4R69A 4BRWA 4XQEA 1NAIA 2H2DA 2ERXA 5CK5A 3M6ZA 1JKIA 1U9ZA 2I1VB 1ETUA 1XVVA 5JHHB 5D3KA 3NIWA 3BAFA 1NRIA 3SVTA 1BZYA 4TXJA 1JAYA 4K5QA 5I9LA 1LKYB 4PFKA 1IOLA 5U4XA 1MTZA 4JLJA 1ZSVA 1RG6A 1USIA 1Z68A 4KEAA 3ZHOA 4F7WA 4O8CA 1QP7A 2CF6A 3KHSA 1KERA 5FWXA 5EZ6B 2JAQA 4JJIA 1LCIA 2IODA 1AKNA 2JGRA 4A10A 3CT4A 4QZEA 2XYQA 3OEED 3JQDA 4TX1A 3HCFA 5LZ4A 4HLQB 4X91A 3ITEA 3S3TA 4MQ6A 2FY8A 2IF2A 2WT9A 3WL5A 4DVGA 2VDNB 1P4JA 4TRNA 4L4SA 2NP6A 4L22A 3LFHA 5EL0A 3PQ2A 1E0JA 4P22A 3RT7A 1D2MA 3M8KA 5JRDS 2C42A 4W8OA 2KSOA 1QQBA 4RZUA 2ZYUX 1QTNA 4Q12A 4D8WA 1IN8A 1FP4B 1ZQCA 3RASA 1NUTA 1NHGA 4U6PA 8ICHA 4QUKA 5LR6A 3EPKA 1KVUA 3KKQA 2WA2A 1FQOA 3T1TA 1PGPA 2CKMA 3E22A 3JYOA 1Q12A 4TV8A 5GM2A 5FUXA 5JO0A 5LB2A 1ESZA 5I7EA 3JQPA 4XWTA 3W6OA 3RB0A 1NP3A 4LQDA 3RTCA 4DLSA 1GFIA 1CR4A 2CVQA 1QO7A 4REQA 1YL5A 2QNRA 1Z75A 2CCGA 4NJMB 3O8QA 3BA6A 1L4FA 5KFSA 1EK6A 1G8HA 4LHVA 2P2NA 1UXKA 3AMVA 3FFBA 4FMPA 1KZYC 9ICGA 3W1EA 2P68A 1HYEA 2FUNB 2VAWA 1WY5A 4ZI3A 2CN1A 2QMEA 2PTHA 4NZPA 5F2OA 4IGKA 5AOVA 5TF0A 4JYPA 3KEGA 1DKOA 4CQMD 4D3FA 2O7RA 4X8MA 5C37A 4C5CA 1BVRA 2IDKA 1UC9A 2NLOA 2PPLA 2YFHA 1GWNA 3SM3A 2E5WA 4Q9JA 4G8JA 2JJ1A 5K45A 3QZUA 2DQKA 2Y0SC 1S9DA 2IE8A 4M1KA 4CMEC 1XMOB 1Z5GA 4IKEA 1TMYA 4EZ9A 3G79A 5F23A 2IZZA 1N2CB 4QARA 1Q7EA 1WG8A 4W5JA 3P9CA 5ALDA 1NXTA 2YN0A 4IXWA 4EG3A 1L7DA 4KLAA 4WK4B 4M9SA 1ZG3A 3G0OA 1SUPA 4BFWA 4MI6A 2P5SA 3DWFA 4QGFA 1B42A 1LJUA 5KSPA 2BHSA 2RH9B 4OKNA 4B8YA 2IV2X 1WSDA 4CLXA 7ICIA 1FF9A 1REQA 4ZO9A 4ZD6A 2HHVA 3ESZA 3PTZA 4QUEA 4TLMB 4WIAA 2V4QA 4UAGA 2I54A 4KU4A 2BGJA 2EARA 1XTVA 2NOAA 1K4YA 1ZISA 5A5FA 3MN1A 3G2NA 3LCVB 3UK6A 5E6RA 5ALSA 5AKIA 4M7OA 1Y9ZA 4ZCMA 5LU9A 2XLBA 4QKQA 1QGUA 4RAOA 1SVSA 1X9GA 1BAPA 4P4LA 5JAMA 2A6PA 2PFPA 1FS5A 4M99A 5KYYA 3SS8A 4MIKA 3AY0A 1SFRA 1Q7BA 4AKSA 2UUAB 3NM4A 2EGUA 3F7MA 4HAZA 4TUYB 5LDGA 3JRWA 1U2GC 2EGGA 4EPTA 3HM9A 4OM7A 4R1TA 2A57A 1LRKA 2A9QA 4RAQA 9ICLA 2IUEA 4DDKA 4OH7A 3OZBA 4DMUB 2IS6A 1JQLB 5E2BA 2WHYA 3FCCA 1S5LU 4S2UA 1KF0A 2BEKA 3QPDA 4HD8A 5CXXA 4CM8B 4E03A 3JQFA 4O2BB 5A4AA 3MF4A 3MFIA 1WAMA 3CCBA 5EJ5A 2IJGX 3UMJA 1ZOPA 3IG5A 1VJGA 2EF1A 5I9TA 1VG0B 4ZOLA 4EW1A 2ZS7A 2ATEA 4G8BA 1CDEA 1ONBA 3GL9A 4TXHA 4BNZA 3ETDA 3W8EA 4XD7A 2F59A 5JUWA 5LQJA 3WIUA 2Q4EA 2FMSA 4IPTA 3T3EA 2VXOA 5A1TA 2TSYB 3CA8A 3G85A 2CV1A 2W6OA 1E2GA 2WUVA 3C3EA 4MVWA 3CX3A 1Z19A 2K8AA 1GGJA 4Q7KA 4U39A 1MXHA 3HSYA 7ICTA 5E9WA 3ZDXB 4CKCA 5IPFA 5LUBA 2CB9A 3PGLA 5TV2A 2O8VA 4M0AA 2K7ZA 2JPDA 4PYNA 2XVTA 2YV3A 4RPKA 3U37A 1JVNA 2ZJ0A 5IAOA 1CJTC 1Z08A 2K4IA 2E3TA 3HA5A 3I1IA 3JQEA 3E1SA 4OQNA 1Y6GA 1QPZA 2CFOA 4IXNA 5AOAA 4KDCA 3R23A 3RANA 5CXUA 4PZLA 2AD5A 1CEZA 2JGAA 4FBMA 8ABPA 1ZHOA 1QIJA 3CRVA 4PHCA 1J00A 4WCFA 5HFAA 4YXWA 3VU8A 3MHPA 3PEYA 4EKIA 5IUJC 4TYPA 1KSPA 4R2JA 4JMUA 4QYIB 1NXSA 1OJLA 2J3EA 3OQBA 3SNKA 4AO6A 5K8IA 3WAGA 3WTCA 1RHKA 5EWMB 2XAAA 1M1XB 3WK7A 1WW2A 5CEHA 3GFGA 3QLEA 5ARBA 2H16A 3QVKA 2W8BA 5LYJA 3FWKA 2BFCB 3IOBA 2RG7A 5IDXA 4QG7A 4MWGA 4XYBA 3CC8A 3O9ZA 2X8AA 1KKMA 3HJNA 1KRPA 4OOFA 1T2VA 3AONB 3VPDA 5JCOA 1CUZA 1UWCA 3CSDA 3SXPA 2CCJA 5T4HA 2HWKA 4D99A 2D74A 4LZLA 4DGQA 1JHVA 4LYGA 3TZBA 2ONJA 4KLIA 4R16A 3ISDA 1ZDMA 3JYPA 3FOAA 2ZU6A 8ICMA 2HK7A 4C3OB 4LV8B 3A11A 3F3YA 4I9UA 4LGMA 1AUXA 4AZ0A 3Q5GA 2D6FA 3G6VA 4ALNA 1NOKA 4F2RA 4IHJA 3Q4GA 3S44A 3MG9A 3FYUC 2OV8A 4KPGA 1VOTA 1X1CA 2Q6VA 1P1JA 2J45A 3CJTA 3C29A 1P9RA 4Y1EA 3SSOA 2WFZA 1BMQA 3WFIA 3PX4A 2P0EA 4X62B 5THQA 5EJFA 1JTEA 5KT6A 2AF4C 5F9MA 1EPUA 2YWXA 4RVNA 5A4JA 5F2EA 2ESEA 1P0QA 2D5BA 3WI7A 1AKTA 1XXHA 2AYZA 1J2NA 3DMFA 1U0LA 4DQ0A 5EIEA 1HYHA 2XDQB 4KLUA 3W5JA 1XEXA 4WEQA 1EGAA 5F5NA 2R66A 4R9VA 3TM5A 4EBEA 3R3VA 1G4UR 2YWGA 1TZMA 3Q15C 1ZFNA 1DTEA 2D5AA 3T3GA 1O96B 2GXAA 4GICA 3EA0A 5E4JA 4ZVSA 5KT4A 1KYVA 1RE1A 2GZ2A 3GZTB 3TADC 3T7RA 3HNRA 5ITVA 4UARA 1QG0A 5CVEA 1R5JA 2XMZA 3AF0A 4FR0A 2YV2A 4PO3X 1OXUA 5CLJA 1J56A 4KFCA 5KG7A 4EYSA 3WFJA 5TE9A 1U49A 1AZWA 1C9MA 3FB1A 5LMNB 3AT1A 4MEXA 4PX3A 4UFPA 2OMKA 5CYGA 5CA7A 2ZVDA 4NU8X 4QOHA 4BO9A 3W3AD 1N3YA 2AMLA 4WHMA 3L43A 3L82B 2DWCA 1EG2A 1AGNA 2WF8A 1QQ5A 3JYLA 3LYAA 1YNOA 4FEAA 4LNHA 5A6SA 3ZVNA 5DLDA 5KQGA 2FW6A 4OXKA 3F74A 4XSGA 5EXPA 1NZFA 2TYSB 3J81j 1MFZA 2X40A 1U8YA 3A9CA 3CO0S 4OXRA 4QJBA 3LUCA 1JFTA 2ZBFA 5JJCA 3L1JA 2JEOA 2EQ5A 3UJ9A 4BLPA 3VOSA 5DX1A 2XE7A 4A92A 1KEKA 1LI5A 4MVJD 1ZOLA 1NSFA 3M83A 4PG5A 1JXLA 3BXXA 5KMGA 2AI3A 1Y1KE 1T4MA 4PAGA 5BSGA 3OJLA 4OJOA 3DC2A 4UMDA 4DLPA 5JZSA 2BRUA 1YZNA 2CJFA 1ZNZA 5ALIA 4JSRA 3PC7A 5KOJB 1GTSA 1J2UA 2OAQ1 4GKVA 4HVTA 1VDZA 4GD3Q 3ICOA 1I5EA 3SZ3A 2H1LA 4H2DA 3U2QA 3V3KA 3WGOA 1EFCA 3ZWDA 4B0PA 2PXHA 4JT4A 4DFJA 4NCIA 2FV8A 4NS4A 4REMA 1T1RA 4BO5A 4O3SA 2O3UA 3K32A 4RM2A 1GCGA 1IEQA 4BVLA 1T1JA 3GG2A 1VI2A 4CM9D 4HXFB 3AHDA 1K92A 3CBGA 1SCUA 4QIWC 3R0XA 2JFHA 1QIEA 3I0ZA 4UJ3A 4PANA 4W9NA 2WPDA 1G59A 4RPLA 4EG7A 4IF4A 4YRNA 3VR4A 1I5OA 3GLUA 4MJ7A 1G4HA 1CUGA 4AUKA 4MQEB 1ZK3A 4N82A 2G7ZA 3GR6A 3LPAA 3MMPA 3TIXB 2ZM5A 3TDMA 1TRKA 3EZFA 2E4WA 3ONVA 1BXGA 4IMRA 4XX0A 4ZO6A 4YIHA 3TJMA 1IXYA 3QLUC 4CLEA 4I99A 1OFGA 1MA3A 2CFCA 2YS7A 4JJZA 3JR7A 2ZIVA 1NUQA 1XHFA 1UOQA 1CP2A 3FPBA 4PCUA 1KI1A 1CKEA 3L07A 1VRVA 4DMCA 3QEMB 1TAGA 4EW3A 4ZYVA 3ZZ0A 2ZM6B 4ZAWA 3L41A 3UVEA 1W19A 3ZHBA 4R7ZA 1E5LA 4RDXA 5GJWC 4AQYB 4AXXA 3WXMA 4R8SA 1ZK4A 4N18A 3LI2A 1IZ9A 2O2EA 4GP9A 4UJ5A 4BLQA 4AX4A 4M9GA 2JLYA 3OO0A 1JX6A 1MAUA 3ILYA 4JMPA 1TUIA 4IRCA 3O3MB 4BFLA 2EYUA 1E5QA 1MB3A 3O1HB 2QK4A 2BMEA 2MT9A 2XO7A 1SO8A 4RJ2A 2OHFA 1OGYA 2ZBVA 1X6VA 3MAAC 2HGSA 2QLMA 2VO1A 3HI6A 3P9IA 5EHXA 2C2EA 2R6ZA 1O4VA 5LYJF 3IKTA 1ULTA 1XSNA 3DDNA 3NV7A 1LXCA 4MIYA 4G0OA 1XVAA 1XNJA 1TK5A 2PIDA 2W7OA 4R31A 4B35A 3GIIA 4DR4B 2Y1LA 3RG2A 4XRHA 3GFFA 3RFXA 2XXAA 2QYHA 3DVSX 4RF2A 4EKGA 1QKKA 4HGOA 1SUSA 4QHYA 3VSCA 5JRZA 1FJGB 1U2PA 3U3XA 3QOFA 4UVEA 1M1UA 2EW1A 4OFWA 5DLEA 1KO7A 4HGNA 5JZMA 4CEHA 2P4EA 1JHYA 4UB3A 4EG4A 3WA6A 2DLNA 2VK1A 1JIXA 4TT3A 1GJRA 4LF8B 3E9RA 4F5RA 3RS2A 1ZQKA 3CTMA 1XJQA 3RQSA 1L8AA 1Q0TA 4YVZA 4ECRA 1Z6GA 1HV8A 3GOQA 4RA6B 3UJAA 3LSYA 1LA2A 2B1RA 1ZRHA 4FGWA 3FLMA 4DAOA 1J25A 2F43A 4TOIA 4C0QC 2Y0PA 4DLUA 2DFTA 3UUFA 3ZGNA 1MPXA 1DQPA 3U7IA 2Z5FA 1Z38A 3G7UA 4HDAA 1G20B 1OI2A 4ZVKA 3GPLA 3D5QA 4L28A 3IUQA 2D1FA 1N5RA 2REOA 4KLOA 1C4OA 3JCZA 4PSKA 4QUAA 1M2HA 3WJ2A 5LMCA 3GPBA 4RKEA 3EULA 1PCXA 2WWFA 1IN5A 3JVUA 4GOKA 4YRGA 3UUEA 4WESB 1XHLA 2XQGA 3NXKA 4C30A 2GXSA 1VLVA 4BKPA 2P9TA 4LDAA 3TLAA 5EZSA 8ICFA 2EX1A 2OR3A 1B0ZA 1P2FA 3J7TA 2ECPA 1UJ5A 2NQ8A 3BTVA 3QYPA 2Q5FA 3LHKA 4X54A 5ENDA 4GXTA 1NK9A 4H1VA 5TGDA 5U4QA 3V1NA 4F6RA 1Z2CA 2KP7A 5CWRA 1ZM4A 4Q4AB 4QC2A 5JQWA 3B82A 5LQUA 3DTVD 4NI5A 1MVOA 2KWIA 5AKEA 3ZDCA 2BM9A 1WB6A 1K0UA 1WX1A 2BZ0A 3VX4A 5WRFA 2EWVA 3HLTA 4WEOA 3PZPA 2P1RA 1FLNA 3NPAA 1XWFA 3P26A 5A62A 2X15A 3ND5A 4BFTA 4DUYB 1SD1A 3OOJA 4A0QA 3CEHA 2IRWA 4M8SA 4PICA 5JS2A 4HNGA 2B78A 3GY0A 3WKBA 3A4VA 1PN3A 2VSXA 4LJKA 4XA5A 1ZHFA 4C8OA 3NANA 1HSOA 4GX1A 4HVLA 4GMXA 1O5IA 4UNPA 2WW8A 5K9ZA 4XWKA 8ICVA 2WI8A 1WBBA 5BQPA 3L0PA 1GV1A 3AG6A 3OOHA 1GNSA 1YZGA 1XTUA 3ZDDA 4YXJA 1HXHA 1VSVA 5JPCA 4KLGA 4RKRA 3FOZA 4AKTA 4PWYA 2UZAA 4BAUA 3H2ZA 3ESYA 3P20A 3CNQS 1GZDA 4BZWA 1TTPB 3DT6A 4QXMA 1ZR2A 2H3IA 4KCGA 4TQAA 5THXA 4PN7A 1CUSA 1WZEA 1QUFA 2X8WA 1EVQA 2VXYA 3H87A 2BEVA 3JQGB 4IJKA 4IIUA 5H2FU 3BKWA 3QX8A 4N5HX 4PYKA 4UKDA 3UJNA 2WT8A 1DLIA 4KQHA 3SKYA 2HK8A 2IUUA 3GJ0A 4TS3A 4EA8A 1CF4A 2R48A 1I2ZA 4IHAA 4J6FA 3SZGA 1UAAA 1EQ2A 4CDMA 3LC7O 4DQPA 1P1KA 3NRJA 5T3UA 4JQSA 1QZZA 1HF3A 1QOZA 2NXNA 3JD3A 2ONCA 3I30X 4F9TA 4N8EA 2ZRFA 4YCAA 2XY7A 2HVIA 2R3SA 2ZDHA 2ZSUA 4KAJA 4E5VA 2FZKA 3L6BA 2IOYA 3DO8A 2UZIR 3ZLBA 5JT1A 4DV1B 3TTUA 4CQJA 4XYGA 1B8OA 3EVDA 3RYFB 5BVHB 5ADHA 2C4NA 5EWLA 2WLSA 4IX1A 1FDWA 2M1ZA 4IDAA 1GT6A 2UVVA 1YBHA 1UWLA 3PI6A 2K6GA 2AV6A 3EGCA 3VTFA 3EDMA 4EUKA 5DM4A 4M2YA 5BR1A 2NRVA 5LP6C 2DQYA 3WIVA 1BPEA 1RQPA 2AU0A 4REQB 4C8MA 3VNVA 3K05A 4B9NA 1G60A 2QSYA 5LNK6 4BVJA 1B4FA 4FDAA 4V0MA 3TZCA 4ALKA 4FDLA 1JFFA 4V39A 4B2YA 5KTSA 5HRUA 1ZQIA 2X9QA 4L1KA 3LYHA 5KFYA 1OPRA 4QZBA 2EU8A 4FEGA 5JV5A 3LWLA 3WQSB 2O0MA 4AKGA 5AHWA 3GFTA 4JYCA 1IY8A 4KZKA 3A6FA 1QZTA 3RFTA 4RJTA 3PHHA 4XUEA 2OBBA 3C1UA 1KEEB 1YU9A 3IDOA 3R3JA 3TMKA 2UZ4A 3MTJA 2UZ1B 2PZGA 4M6WA 2AXTU 1AVTA 1N2HA 1R2QA 3BJEA 4F1JA 4QTYA 3UJCA 4F4IA 4ZJUA 1Q6YA 3ADPA 3H8WA 2G3YA 4D5GA 5JSZA 4WKBA 4MSUA 1NXVA 1OAAA 4I4NA 2NWQA 2JJ2A 3ICWA 5A6VA 1WETA 1Y8RA 1H1TA 4NBTA 4MS1A 3SR6A 1NBWB 2QRPA 2YNMD 3T79A 2AD1A 5E7QA 2EQYA 3VPXA 1WV0A 5JXJA 1UT8A 3CUEF 3ILVA 4G65A 4H6VA 3AK4A 4RZQA 5CR0A 4YWHA 3UB3A 3VZBA 4BP8A 1YD7A 4WFJA 2I6FA 2C2GA 3RUCA 1SNYA 4ZMRA 3I62A 1QF9A 2YH2A 4PGFA 1OXMA 3JASA 4AJHA 3STTA 4HP8A 3VJRA 3G5AA 1LTKA 2ZIGA 5EYPB 1YT5A 2APJA 2J32A 3FUVA 2VSNA 4RKQA 3PQ3A 5JCXA 2ZUCA 4G1UC 2C7PA 2J67A 3HQ4O 5HR7A 4G5RA 5G2OA 1N3IA 4Y98A 4XIJA 1VXRA 2C92A 4CKEA 5JMTA 2NRTA 3HKBA 2Z1DA 4OX9Y 1B23P 1RQLA 1TAQA 5C7IO 2H9IA 3LBYA 2QLJA 3J80A 2IY7A 4PC1A 4RV9A 3ZBQA 5HCIA 3C28A 2MSKA 1GUYA 3IUYA 5EZQA 5JDIC 5I7FA 4RHYA 1ADBA 2E0IA 2ANBA 3QI2A 2WKRA 3TGLA 9ICPA 2V6GA 3EHDA 1JU4A 2J9YB 5AO9A 1N8SA 3MJFA 5EPEA 1DAFA 1ILWA 4YRJA 3WA7A 4X6YA 1ODFA 3WGQA 1SQ6A 3HB4X 5G1OA 1Z07A 2DR2A 3BS5B 4WLNA 3U19A 3W8RA 3CZCA 4OMCA 4X00A 1NPTO 1ODLA 2CDRA 3D3WA 4N0DA 1C7RA 2ZPUA 4QWCA 1UOEA 5IT9A 3G8YA 2JHFA 3L8YA 3DUFB 4ZHQF 4WXMA 3NJ8A 3WGGA 1HETA 1EIWA 1JIKA 5REQA 5EXEA 4O59O 2QV7A 3ZU5A 4YLYA 4HNVA 6REQA 1AD2A 4ITVA 3CRZA 5B3KA 1E3EA 3BHNA 2H1IA 2AJ8A 3BRWA 1T9AA 3S1AB 4LZPA 9ICRA 5FL7D 5LFAA 1E3JA 5AQ1A 3IRUA 4OATA 3THXA 2RGWA 3NGXA 2BI8A 1UXJA 1H2HA 1IQUA 1ZPDA 2JAPA 1JEOA 3KTDA 1OWLA 3NG1A 4TMYA 3KPJA 4BC0A 3PFNA 3TECE 2E48A 5EVJA 3ADBA 2WJGA 3O9MA 4U0JA 3K6RA 1U1IA 2KSQA 3LOUA 4UTZA 3HXQA 3OG9A 3NAZA 1CB0A 5LP6F 4BWGA 2HMVA 3A1TA 1GZUA 2D7DA 1WPGA 2ZT6A 4PWZA 5GVRA 5HF9A 4B74A 2OA0A 1ULBA 2UV8A 4O4JB 2PU7A 1YMUA 1E94E 1HYBA 1T4BA 2V5UA 2OMEA 1N2BA 3ZNOA 5I8PA 4ZT6A 4BMYA 4DJJA 3TGWA 5KVVA 4MGIR 1OV4A 2ERYA 3RR8A 1JEYA 3TE6A 4NZNA 2B7CA 4YP6A 1NVVR 5CMLA 1CY8A 4FVTA 3AF3A 3HJRA 2PLAA 4BN0A 3FNQA 4JBIA 1N2GA 3F4KA 3G1UA 1E9FA 1SB9A 3GHYA 2HREA 3AWIA 3F7TA 1TM2A 2GAIA 5DNWA 3WY9A 4BO1A 4C7MA 1AC5A 1GG9A 1N1DA 1HQCA 1N2CE 1YKSA 2R4QA 2WTBA 5EG5A 3R5TA 4D98A 4FR5A 5ADVA 3SFTA 5CFMA 4MV6A 1A0OA 4FIDA 2AVDA 1UJNA 4TL7A 1CLEA 1H2RS 3N8HA 4H15A 4OHVA 1O77A 1SV0A 3TQTA 4RNOA 5KWJA 1U0SY 5CT4A 4DCGA 4DZZA 2VH5R 3DXYA 4P93A 4MW0A 3HBLA 3CH5A 1SC9A 4Q03A 1TADA 1W25A 3LNCA 3KB1A 4QQNA 2VHJA 4G23A 5BNFA 1UP7A 5YASA 3WS7A 4C7XA 3JARB 1P2VA 4GDMA 5KQRA 4MWEA 4XGQA 5FXMA 2XRYA 1X3SA 2H2GA 2PK3A 4JI2B 1DL5A 2DEUA 3TOZA 9MHTA 1GFZA 3QBDA 3KQSA 2XLCA 3OJEA 1VE1A 3V3TA 4OXXA 1OZAA 3KLPX 2DVMA 5F1YA 4RPXA 1YAHA 3B1XA 3LUPA 4RK1A 1AS0A 3RAGA 3BH0A 2FPLA 1DPFA 4RK6A 2K2QB 5KJ6A 3HEAA 1EZ1A 3F78A 4CTMA 1X42A 4JBYA 3WC4A 3R76A 1H2BA 4TYNA 3UG6A 2KKVA 4LC0A 4DLYA 4WXRA 4CXMA 2ASJA 1Z17A 4EJ6A 2Z3WA 3AL2A 3IR6A 4NULA 4CI0B 5KREA 1AJEA 1E8NA 2HKIA 4KAFA 4ZK2A 1SK9A 1K7CA 3W34A 4ZYLA 5EE5B 2GK4A 3U1BA 2IE0A 1EESA 3DPSA 3JD4A 4GX5A 9ICWA 3R6DA 3A1NA 1SBTA 5EFZA 3LMKA 4P5DA 1MLDA 4X9XA 3VI4B 2HMXA 4JJ6A 5JVDB 1AV7A 1Y8RB 2EZUA 3B1KA 3KHUA 3CQ9A 4NPHA 4URFA 3V8QA 5ARCA 2N46A 1B3RA 4FZNA 4RSHA 1G21A 1H2ZA 1J6UA 2IEZA 2W2LA 3JQ9C 2C99A 1UBMS 4Y1RB 5H3CA 5IUKC 3EBLA 3TWOA 2NUTB 5LYYA 5C4MA 2DLCX 1RYMA 2QSZA 2ZAMA 3CUUA 2C9OA 1T8WA 2HA2A 4RFSA 1V85A 3ETRA 2F1OA 2KYRA 2P1ZA 3DP7A 1WOMA 3E9MA 3DGEC 4P2GA 3RC2A 3DOHA 3ZN2A 4EUEA 2EBWA 3R24A 4WOKA 3RLIA 4YRQA 3OTGA 3BBLA 2HXGA 2B1QA 4YJGA 1CI4A 3IDAA 1QIKA 2O1EA 3CF0A 2JHCA 4KNVA 1Z6YA 1M7BA 1PV1A 1VZ3A 3QPCA 4DS4A 1FXWA 3ASYA 5LJLA 1ZEJA 1GO3F 2OM6A 2NO4A 1YZFA 2AX3A 2CSUA 4HDCA 5HUQA 4MAAA 3CPHA 4IDFA 4AJ4A 5CXQA 3U44A 5TT0A 1EGQA 4U7CA 2F1HA 4K9RA 3WGLA 4JB2A 3PVCA 3KTFA 3MZ0A 4YA6A 2FW8A 5AW4A 2WJAA 3Q8QB 4TS4A 2VAMA 3KB2A 4BOYA 5B6JA 4ALJA 2RGCA 1BWPA 1FFXA 2WD7A 3F9IA 1BX3A 4CMGA 5JAHA 4A15A 3IV6A 2FR0A 3G0CA 4EA6A 1NTRA 1TVAA 2Z1MA 1LV5A 2WJPA 4B44A 1M6YA 4KO1S 2YWFA 5IAKA 1QOQB 2XYRA 3LKZA 4B45A 4ELTA 4JBWA 4QSMA 1YJ8A 2BAGA 4YN4A 4JASB 4QFMA 4N6OA 4BS9A 1WPXA 4GRAA 2YVQA 1KBUA 2XGMA 1KFSA 4HS9A 3ADCA 1DEHA 2V5AA 4N41A 1X8XA 4PQFA 5DI3A 1Q0RA 4UAVA 1I36A 1LNZA 1B4DA 2QUIA 1E3SA 1QYRA 2C1EA 4FS3A 1S3GA 3K0FB 3TX2A 2D2VA 4MKXA 5LSAA 2GJKA 2O54A 4JCCA 1RZVA 3N7SC 2I8LA 2H48A 4BU0A 1EMDA 4ECQA 5EWJB 1NQXA 2BKVA 2GD2A 4C6TA 1I4OA 3FNRA 1MB0A 2R6DA 1GQRA 5KFEA 1IM8A 4P5PA 1GM5A 1NBMA 3KJFA 3RWOA 3X1MA 4A4DA 1EGMB 5KFKA 2QTLA 4XD7D 3GDXA 3HRIA 4MUYA 4DNPA 1DRWA 4EG6A 5SYNA 2QW8A 5TPWA 4AIIA 5K0GA 2UVUA 2AQ0A 5HYVA 2W2OA 1PKXA 3SS7X 2F1JA 5IDQA 1JL3A 4XVQA 1EFRD 1TYCA 4JJAA 1I6LA 3PIRA 3FLBA 2A9PA 5I48A 3HT3A 2JRCA 5AKKA 1T36A 2QTRA 1D2GA 4F85A 1L5GB 3H05A 4I3GA 2ROQA 2HYDA 3U3ZA 4LPKA 3FFWA 2I8CA 2Y0CA 4D02A 1LWOA 2WT4A 3FPHA 1QQ7A 3TI7A 2MDTA 1A5TA 4P7KA 2Z57A 4XWOA 1OYYA 3AL0B 1X1TA 1X86B 2QN8A 1XMIA 2FTKE 2N47A 4MR8A 3WLPA 1CB7A 4G09A 4NOMA 4AKEA 4YREA 4HH1A 1UOPA 1M75A 3WBBA 1LJLA 4U2DA 1J9EA 2LR0A 4JFAA 1YZLA 4C4AA 2FWIA 4AULA 4AF6A 3GLQA 1YB7A 3ANMA 4L0MA 2YQEA 1UANA 1FZQA 4UB6U 5AM0A 3H8MA 1D2RA 1ZXXA 2XT6A 1R4ZA 2XITA 2ZYRA 1H93A 4JZKA 1QF7A 1WHSB 3BCUA 3DYBA 1IZZA 3B6IA 4RCYA 5DJ5A 3N76A 3ZUPA 1T29A 1VSTA 4PBRA 4QZDA 4YR0A 2H1SA 2VP0A 4FOOA 4PX2A 5K3EA 3G2LA 4I27A 2BMAA 3CF2A 1UFVA 3PP8A 1U8AA 3GAAA 4URWR 4CMKA 4EVQA 2C95A 1JDJA 4HDMB 2HPVA 2PR7A 2Q1TA 3E5HA 5I4BA 1JA9A 3MW8A 1JDUA 1SL1A 1PTKA 3Q8MA 2ZTVA 4HGPA 3USES 4CL3A 5M7EA 2I66A 1J5EB 2RHWA 2ZFUA 3QKTA 4N39A 3VA7A 4PN3A 2HK9A 3X1YA 1SXEA 3F73A 1UC8A 3WL7A 2R8RA 5J2DA 2YZGA 4TV9A 1SKAA 2R6FA 5E1MA 5EJ4A 2PU5A 3HPRA 3AR6A 5DTRA 1T0UA 3LQQA 1UMBA 1MT0A 5JNTA 3GUYA 2Z6VA 3LF2A 4N7RA 4PFSA 1FS4A 3WLLA 4M9ZA 3VYVA 3L6UA 5BSEA 1RZRD 1Z37A 3COYA 3GEIA 1LLCA 1SVWA 1JT2A 1YDMA 3QX9A 1N36B 3O5AA 1VMAA 4MI1A 4V0SA 4ZOAA 1HNZB 4DR3B 3OM0A 1E32A 1KP9A 2JGFA 3SF8A 1RRMA 2XVAA 5HM6A 1FCJA 2R8PA 3ER6A 4H1HA 5JBIA 3R7DA 3ZJUA 5AJZA 1AB6A 1PR2A 2FRXA 3TE7A 2R1ZA 5IDYA 2CUKA 4FE7A 1CD5A 1CJUC 2V9PA 1YK0A 4OBBA 2H2FA 3S2YA 4QPJC 1OQAA 4V1CB 3W5AA 3PW4A 4NNJA 1DG3A 4BC1A 1QDUA 2NM0A 2EXXA 3USCS 3W2HA 9LDBA 3HFJA 5MGNA 3T5MA 4BECA 1NN0A 5JFOA 2H3VA 3G6YA 2Z8ZA 3HR4A 5HJEA 3DBVO 1RHRA 3TANA 1SQ0A 3QU9A 1NJ6A 4FDUA 1N1EA 3R75A 3WIEA 1CERA 5E1DA 2EW8A 1U2QA 3T35A 2WSSA 5AJHA 5EZYF 4E11A 3TQFA 1BXRB 1K9VF 3N87A 4F5EA 4R1PA 2G70A 4MEAA 2X58A 3AUJB 3NHAA 3SZOA 2GDJA 4PQGA 3RARA 5U1PA 2GYWA 4CKWB 4E0BA 5J58A 1Z15A 3WMEA 1OI3A 5AH0A 1O97D 4F3RA 1WPRA 1YJQA 2D0DA 2JI7A 4MTLA 4NCKA 3BWCA 3VO1A 4B3JA 1G38A 3DDSA 4ZCTA 5EMKA 3EMDA 4PG6A 5A0LA 8ICPA 5COAA 5C4GB 3VKFA 3RBEA 2HDOA 4PQRA 1XZJA 3GA5A 1EGVB 3V7LA 1T6XA 3BN3A 5DLYA 2GPTA 1PZFA 3AJEA 5C80A 1TT5A 5DGHA 4ZAZA 1OSNA 1ZVJA 2AYXA 4FD2A 2YMQA 1XOIA 2IWRA 2HF7A 4BDTA 4C20A 1BFDA 2MMGA 1DB3A 1SVKA 3H2YA 4G1EB 4KO2S 4WNIA 2OC9A 4ZZIA 5JI3E 1MNAA 1JR4A 4UVGA 2WWIA 1TTTA 1PGNA 2QQ0A 3UWKA 3C3AA 2IY9A 1IWBB 4RJIA 3WBFA 5BQ3A 4IJ5A 4UD2A 3QW4B 4K86A 2Q4TA 1VIAA 2P4HX 3J7AC 4EEKA 3V1KA 2XDYA 3BQ1A 2H4HA 1Z0ZA 4KHPB 1OAOA 3AFGA 1U0EA 2P5UA 3BRWD 2Y8EA 3QXCA 5NULA 3WNVA 5JVDA 1SPBS 2C4TA 2WIDA 1K7FB 4OU5A 3O2JA 2Q45A 3PWSA 4WH0A 2Q9AA 3CR3C 1UBJS 4RT3A 2KMLA 3QVOA 3A4TA 4B4OA 3OOEA 4C2BA 3EZXA 5D5QA 4LJ9A 1UKZA 3OOSA 3QEJA 4ER0A 3C14C 1Y9AA 3P0EA 3NAGA 4YJ2A 4HXGA 4N6GA 1IC6A 3UWDA 3KUCA 4Z49A 3I37X 2AEMA 4LYYA 3LX5A 4AN1A 2ZR0A 5H70A 3RUFA 3DBHB 4HL6A 3UXHA 4MQBA 3MQ2A 3AEVA 5ALXA 3B5EA 1F2UA 2HO5A 3E0FA 2AXNA 3DKRA 5DFAA 2NZ8A 2ZREA 4LY0A 5KPJA 1ZJNA 3PRKE 3A2LA 3GFVA 4BFCA 4PSAA 2FFBA 1EE1A 1QE3A 4ZZ2A 5HKOA 4ZTZB 1S7GA 1EVLA 1R00A 1BU5A 4NBLA 2GEDA 3F6YA 4PPGA 4RM3A 4TLCA 2QRKA 4EENA 5EZ5A 2AN3A 2WM2A 1NKSA 4Z6DA 4K4IA 4D8VA 2CMDA 4NLBA 2YC4C 3L6OO 1QHNA 1Z7WA 3QA9A 5J0YA 3ET4A 4LXHA 3TCKA 2PZAA 3HYCA 2L82A 3ISTA 5FUWA 3CW2C 2G4VA 2WABA 3BD7A 1EBUA 4MULA 4I29A 2SKEA 1GQOA 2QTVB 2AFVA 2W6JA 3THSA 1ECLA 4CRXA 1DI0A 3RUAA 3DFIA 4I55A 2YJGA 4IGFA 4HQ0A 2B4RO 4JUAA 4XUDA 4A16A 1QHEA 4EFNA 3SQMA 4YPOA 3QRWA 1RWOA 3CFYA 4CT4B 4Z3KA 5JNWA 2C9DA 3HPOA 2PZMA 4MRSA 2Q8PA 3BB3A 3VHXB 3LWDA 3QX3A 1F6WA 3EF1A 4J90A 4TZ0A 1SCUB 4TS9A 4EZBA 3BZBA 4L5IA 2FWMX 4II3A 3BREA 5FYQA 4KR6A 1BCSA 1GN9A 5BW4A 3PX0A 2O2CA 3A3PA 4RNNA 3EVGA 4ZGBA 1N6OA 5KAMA 3PW0A 4MZXA 4G0NA 1HGXA 4XDHA 4P82A 8ICGA 1W48A 1B6TA 1ZK1A 2XHZA 5EWJA 1NFFA 5KFQA 2QXTA 3HCPA 4B3MB 2GHRA 5ISMA 3U4MA 4OGWA 3LVFO 1RLOA 3MJSA 3PEEA 1AK1A 4C29A 4LI3X 3B9BA 4PC7A 1HM5A 2KJ8A 4YMMA 1K8XB 2BUBA 4MHOA 2XJ9A 2QDKA 4ES6A 3QOXA 2D1QA 2Y9PB 3BXPA 1C20A 2AMFA 3DHEA 1Y7TA 2EKPA 1FYEA 2I3GA 3MS4A 4PHDA 1JMYA 3HL0A 3OWHA 4HAUA 1LBEA 3FBTA 4QRHA 2BGMA 3FX2A 5FJIA 5LBUA 4AN0A 1BH2A 1Q3VA 3IEVA 3O1JC 1KFTA 1HT1E 2ZKLA 4K9PA 3OPVA 3NVKI 2DB3A 3MILA 3BMOA 1MRSA 1VP3A 2XQIA 4M0LA 3EEOA 4TSKA 3D02A 2ZK7A 3HZRA 3N2YA 3DBIA 3L5OA 1SKUA 1FUYB 4KX5A 1P62B 1LPBB 3DG9A 4LTMA 4YYZA 1AQNA 4PIMA 3PCXA 1CJMA 1JLSA 3N8GA 4G8DA 5ED0A 2QPLA 2VRBA 3ZV3A 2F2AB 1BXGB 3PCRB 1KQFA 2Z6QA 4CFSA 4CIXA 4BKMA 1C9KA 1Q1NA 4D25A 2G6TA 5HJ5A 1K2WA 4J29A 4B6PA 1PZHA 3PGJA 1ZKDA 3EQ9A 3OESA 4P3YA 1Y5RA 4U6NA 1OH5A 1ZQMA 2X8JA 4YUZA 3DOIA 1OX4B 3KWJA 3OSNA 2J8ZA 3CRNA 4RNCA 5AVKA 3I58A 4OK6A 2HLDA 3TM4A 4ENVA 4RTPA 6AT1A 4H0CA 3PJRA 3NHUA 1RQNA 4B9MA 3JALA 3R5JA 4DRYA 3B36A 5HS4A 1XEXB 2Q6IA 3CU5A 4HB0A 3UYLA 4UOEA 1WD7A 4GM4A 2YHBA 2J6IA 1YZ6A 4YJDA 3HUUA 4S24A 3R44A 2Q0SA 2CY0A 3ECSA 4GNKA 3ZVRA 1ESEA 1M0WA 5B7GA 3SYZA 4HEA6 3AR8A 4QO8A 2IMWP 2I4OA 1RWWA 4DQQA 1NTOA 4HUQB 5FQNA 5JDCC 2NVUB 1AHPA 3KJZA 5C53B 4DM3A 5HOQA 4JWKA 2FEAA 1T9CA 2KBEA 5ESXA 3ZW7A 2YIDA 2RHBA 2PXXA 3GEPA 1PL8A 3ZE6A 3IQIX 2FQXA 5ERYA 2GN2A 2MUTB 1ZA2A 1PQUA 3GOHA 1ZQWA 5FR1A 3SF0A 3CR7A 1JX4A 1SQFA 1T0JB 2A1JB 3KYDB 1T8EA 4IIYA 4QYSA 4ZEWA 3RBXA 3FPJA 4CKZA 1FTSA 5ALOA 1H4TA 1WTCA 2OAGA 4KO3S 4Z4CA 4J9VA 2HU7A 3OEEA 1JKMA 4X41A 3VISA 4ECXA 4FGUA 4X8LA 2RI1A 4M36A 4OIMA 4EBFA 2A7QA 3WGHA 1E9SA 4NONA 3OCCA 1RHQA 3PW5A 4DL6A 1D8BA 4U00A 2IX3A 1S4MA 1TZJA 4Q3NA 5FPYA 5BMVF 3CISA 4JN6B 1G7RA 9ICBA 1L6RA 3DLHA 1PS0A 1JGTA 3ZKWA 1I13A 1L0BA 3GUVA 2ZE7A 4EMBA 1RHUA 3ENNA 4UVDA 4KMUA 1RI1A 3GUZA 1CUAA 3H4IA 4UNNA 2NU8A 1J22A 5DCWA 4QIHA 3L9WA 5TQ2B 5LOVB 1GGFA 4RGBA 1N4AA 4H7IA 3V4LA 4Q45A 1NJ8A 4RHUA 1MPTA 4ZVMA 2OZPA 2W3RA 1QHHB 1U8XX 1CXZA 1KMNA 2QLNA 4ZN6A 3RIHA 2CLOB 3ZNNA 2HV8A 2CHGA 3QKIA 3ZWMA 4JV0A 5JNLA 2IY8A 2I4TA 2WHQA 4LY9A 1GU0A 2QB0B 1JEQB 1CY6A 1UMDB 1XN1A 1E6KA 1ZD5A 2NUPA 1IHUA 4AP9A 4W8HA 4J8PA 1UQRA 5DDIP 1IM2A 3RSLA 3AEUB 3TAHA 4KLDA 4HH4A 4HDMA 3KETA 1CRWG 1QZ3A 3N86A 5K8JB 4K05A 1BPBA 5DCYA 4RTSA 3LGXA 1WDWB 3DOOA 2VPTA 4O2LA 3CVOA 3JD0A 3W6ZA 4MW2A 2G71A 3DCIA 3S99A 3WGTA 3AIMA 5IVDA 7MHTA 3C5HA 4Q00A 4WK0B 3L92A 4XQCA 5DISB 3X43A 3ZV7A 4F5ZA 3CPJB 2VTBA 3OMLA 3T38A 5LQRA 1GPKA 3S6JA 3D2CA 4ND2A 4QZ8A 2RGYA 3K6KA 1E1LA 4ML3A 5CT9A 3L6DA 5HA5A 2PX8A 4O2BA 1L8XA 3UKJA 1BEZA 1VQ1A 3LP6A 3C1TA 4XRRA 3TLZA 4ZTUB 4QZIA 1BPZA 1DDOA 3EF3A 3QMMA 5F77A 4BJ1A 1X7ZB 4FQ7A 5B2FA 3MRTA 2J5KA 4O4LF 1T5OA 3U0VA 1Z2DA 2A2ZA 2Y1XA 1N5MA 1X77A 3C3YA 1QIDA 4EQZA 4PRZA 4D4JA 2RJOA 1AK2A 3AV0B 1H6CA 3PDWA 2AJBA 1Q2UA 5JS8A 3EHEA 3A6LA 2RI0A 2ZTUA 3KKLA 5AJWA 3ZZMA 1HZZC 1DQNA 2GTIA 1CUXA 2JH9A 3NEAA 1NT4A 3E1KA 4B3XA 3O82A 2WDZA 1YB4A 4FZ3A 2Q2VA 2IW1A 4BV8A 2F8SA 2VJNA 2W71A 1G2QA 1XGKA 4E4TA 1ZAYA 2EATA 3KPWA 1PK7A 2B7LA 5D3MA 1E59A 1GKUB 4FWBA 1VMDA 3DT8A 2ZJ8A 4DB4A 8MHTA 5AM3A 3C43A 3EDQA 3M2PA 3ZD9A 3OFNA 1P72A 3ES9A 2A9OA 2YTZA 4FU0A 3W6NA 4RLQA 3SAHA 1BJKA 2G72A 1CQXA 2V7TA 4F38A 2HIMA 2P4UA 4DV5B 4DA6A 5TR9A 2GZSA 1YQDA 4PBSA 5E38A 4U1RA 1V25A 1ND6A 4KN8A 2D5IA 1STOA 3IJEB 2AUMA 2H65A 1ZJJA 3CLUC 3QHQA 1R7RA 1TF2A 5DP2A 1Y6FA 1PZXA 3JTMA 3H75A 4K6MA 4Q7MB 3ISVA 4YJ3A 5J5AA 4CIYA 7ICFA 1RXVA 1TMOA 3FZYA 3GG9A 5KVSA 1BCRA 3ZDRA 1YIAA 2PFGA 4TKZA 1R15A 2VUUA 4CMHA 2A8YA 3GEHA 4LKOA 2GN6A 5J1TB 2OV3A 3AR4A 1E6EA 4PX9A 4HAXA 4KR9A 1UM9B 5I7OA 5KHLB 4YRMA 5CA0B 4RACA 2DWPA 1A9RA 1L7PA 1KH2A 1MC4A 2G1AA 2PJUA 1ESNA 2Y1WA 3D8NA 4WADA 4A6PA 2VTVA 2EFJA 2GM4A 3RHZA 2ORYA 5FFMA 4QIWF 4KE7A 5C8YF 2GD1O 3NJ4A 1MV8A 4Y9UA 1YFJA 4G0YA 1R37A 1UKBA 5CYFA 4QGAA 4WSOA 3CGGA 2ZZMA 3RJKA 1Q0ZA 2R00C 4LRUA 4TYQA 2OO7A 3CUVA 1SCJA 2WG2A 4MLPA 1ISSA 1XFDA 3K7EA 1TFRA 3DE3X 4Y9RA 4PFQA 3ZU3A 3FYHA 1SZJG 1TF5A 2H8KA 2JI6A 3DLPX 2HCJB 1TTQB 5SZIA 3TF5A 1W88A 1V4NA 4L8FA 4D2IA 4JVMA 3BCHA 5IKMA 1CDZA 3TZHA 1NW7A 1XSEA 5HF5A 4DV7B 2F4VB 2EGHA 2YRXA 4FK8A 3JQ9A 1OVGA 1RQRA 2JA1A 2XIJA 4RABA 4TUYA 5FA5A 4E4RA 4M9QA 4WCVA 3C5WP 4YXWD 3N4MB 1V43A 3A28A 1MO6A 3NEYA 1VPTA 4MH0R 4CMEA 5E1OA 1RCTE 4LI0A 1YA6A 1EWQA 3HUFA 3GELA 5BPFA 2DR0A 1S7CA 4PLCA 3FDSA 3JPQA 2J4FA 1U99A 3OM9A 4BWYA 4Q3KA 2X4GA 3B48A 4YQEA 1XIVA 821PA 1GU1A 9ICTA 5D84A 4CKBB 1E1DA 4XI9A 4BTVA 5EE1A 3GVXA 2I6TA 4E88A 3RKUA 1KO8A 1A27A 5F9LA 3DDHA 1XRNA 2LKCA 1S3IA 3SNHA 3WNCA 5IJWA 4R83A 4URHA 2QBYB 1VE5A 3L1VA 4LWZA 4ND7A 3S5JA 1B26A 2BF7A 2AOTA 4QA9A 1GG8A 3ZBUA 1O9HA 5JD4A 2JJMA 2NVBA 3OT1B 3IT3A 1ZGGA 2DTXA 1OLOA 2WKWA 4S0ZA 2WF9A 2QTBA 3OCWA 3AP2A 5DGCA 5EIFA 2WQ6A 3KKAC 3H3JA 3OF2A 1DO8A 2IXTA 4R8RA 5IARA 5SV2A 4IS3A 1KI3A 2DWOA 3KQKA 1DCTA 4GEKA 1QVWA 1NKBA 4XKJA 4ZEXA 3UJ8A 2NUPB 2H4FA 3O2QB 2ZIVB 1UKCA 1HFWA 2WP8J 4KYIB 5K0EA 3O4RA 5DBIA 1EA5A 4J0DA 5IW8A 4BO2A 4JQZA 1D2NA 1K5HA 2BGRA 4JP5A 4RE5A 3VO8A 3PEFA 1RI4A 3KZNA 1CNMA 2I99A 3I8SA 4KAAA 5B1IA 3OCUA 5A9SB 1SIBE 2B9EA 2IX9A 5I4KA 3GMSA 2FDXA 4U2GA 3ZHXA 1VKRA 3BRCA 5KT7A 1RXUA 4BUCA 4NL4H 5BRAA 3BSWA 2JCGA 1PDVA 3TZ6A 4NOLA 2F90A 1DV2A 3SOPA 4DL7A 3HJEA 1XYGA 1ZICA 2E7ZA 3LX8A 2TECE 3ORFA 4YNBA 2K7FA 5E1BA 3PL5A 1JT9A 3TZQA 2KX7A 4NXNB 1CX9B 2C2WA 4KXNA 4OVKA 3DAGA 1ZQSA 1NRXA 4BO7A 1EDDA 1WQ1R 2FPWA 2G06A 2XA9A 4INOA 1UHUA 4M9HA 2BW0A 3CX4A 2WG1A 4FC6A 1I32A 4JYBA 7GPBA 2LUOA 5J8YC 5IVPA 1SXPA 1ZQHA 8ICAA 1E9VA 2BI7A 3TQ1A 2O2GA 3AVTA 1JTFA 1XPRA 1RZUA 2EIXA 4LGYA 3WZLA 5AHKA 4LTNA 5DKFA 4LJLA 3MOSA 4P5EA 3VX3A 3D6HA 5IM4F 4G37A 4HUQA 3QEMA 3VYRB 1ZMBA 3W7BA 2X3YA 2ZRQA 2BPCA 1GSOA 5ECGC 1A2KC 4OUDB 5AXDA 1ZR4A 3IUSA 3DP9A 3F47A 4DCNA 3A1VA 4QJ3A 5BNZA 5K0FA 4K1LA 4MK4A 1GL7A 2CXPA 3HWWA 4R3UC 5G1PA 5IKEA 2JV3A 3N8NA 1WULS 5EIXA 4D9CA 4L6CA 3D5TA 4QG3A 1OFTA 4L95C 4NENA 1DFIA 2C54A 3NVMB 1SKWA 1QHHA 2YUTA 3BQ7A 2YQ4A 3KTAA 4NPAA 3E53A 5JAOA 3OZIA 1UOOA 2JLWA 4OJ5A 2DPHA 3QF4A 2GZ1A 2JKZA 5AWFC 4XA8A 3AG5A 1JH8A 2FA9A 2N1BA 5EYPA 3LWBA 5TRTA 3EY9A 3NTXA 3NWEA 4DG9A 2XRMA 3FLAA 2VYND 1N25A 3JALB 1ZUHA 1A6SA 4Q37A 3SENA 1MW9X 2HQBA 5CG2A 4PCVA 3KT8A 3CX6A 2BCVA 3I6QA 2Z56A 3D1JA 5L9AA 1RNLA 4FNMA 2PE5A 2PV0A 4RPCA 2E4UA 2IS1A 1NW8A 1R0XA 1NC1A 2CVZA 4FYVA 4K7JA 1MBZA 3PQFA 5DH9A 2HIHA 1PEAA 1XLUA 2DECA 3LVBA 4NATA 3WYEA 3HRHA 4K28A 1OZFA 4XB1A 2NACA 3FVWA 2JGKA 1YK1A 4DUGD 1DAPA 3K72B 4V02A 1W34A 1K98A 1AK9A 4KOAA 1US8B 2ZIZA 3QFFA 3EGDA 2PBFA 1A95A 2CNWA 3WO0A 5KT3A 3CYFA 1Z5VA 2BSAA 1DAKA 1WSAA 1Y1SA 2HA7A 2MR6A 1H8EA 2QL5A 3E7DA 3EE6A 3T0FA 3ZYCA 1LFAA 4E5PA 3WR5A 3WRXA 4D9NA 3L8CA 3BGOS 4MW6A 4RZRA 2B92A 2C0PA 3PGXA 1W6UA 4DQVA 2IYSA 4M1EA 1P73A 1M10A 4IH4A 1NUHA 2XIQA 1TQ2A 3GN1A 2EG9A 1H2XA 1RLTA 5JCZA 1A97A 2EG5A 1QLJA 4O5EA 1ZQGA 3H2BA 1C0LA 5KZMB 5L53A 2HSGA 4D9FA 2H9YA 2H08A 4GQAA 1B2RA 1W52X 2C8VA 4RHCA 4Z8XA 2IZOA 5HQJA 2Q7OE 3I34X 1U3UA 3PLAE 1J8YF 5I47A 1E92A 3V2UA 3A4IA 4GOMD 1V11A 1Q84A 4UASA 1XZGA 2FSFA 2LKDA 2W7TA 2QUZA 4I8IA 4RXUA 4WBSA 3Q11A 5LU8A 1IMOA 4ZKDA 3ZY4A 3FAZA 1YVUA 1A98A 4F4KA 4CF3A 1LB1B 3OJWA 4LXIA 1S1MA 2HVHA 1C0PA 1H69A 5KFMA 1DWUA 5CA0F 3NM6B 4L15A 3RJGA 3FOEC 2OXOA 2EZ8A 1U9YA 3GEGA 5CAEB 1GNQA 3HI4A 2VNHA 2PPVA 2A1IA 1WP4A 3A05A 3H97A 1WCWA 3LBAA 5D8DA 1FFAA 4FGLA 3FKQA 5J40A 2JEGA 2YXBA 4Q4CA 4Q43A 2XA2A 2HRCA 1VHLA 4GC6A 1NXPA 1EX7A 3K0HA 2R68A 2D62A 1JMKC 4XX0B 5AJXA 1W2HA 1Q7CA 5CIWA 1XDWA 2PFOA 1HZZA 3AKEA 4HX9A 4UBLA 2Y1GA 4DLBA 4F06A 2W9XA 1DEKA 1PW7A 4AO8A 4R8KA 1QAQA 1P74A 1Z06A 4WAUA 4MJLA 2V0GA 1KP3A 2MCFA 5AIAA 3BFKA 4N0PA 2FRVA 2ZVJA 2JDIA 3NDBB 3A3OA 3PUZA 3QYJA 4KGDA 1QK3A 2WF7A 4RD1A 1N3LA 1XL1A 5DEOA 3SM9A 4BE7B 4D3XA 2C8KA 4KLNA 5KAPA 1LBIA 3TQSA 3ZBPA 2JI9A 1QSSA 5T4EA 3KZVA 1V5WA 3ZW9A 2VHXA 1XN4A 2E1RA 3P19A 5FCDA 4IF6A 1O2DA 3MMZA 5E3IA 4DT1B 2HJWA 3K0SA 3VC3A 1P7DA 1KMHA 3HKDB 2I03A 2ILVA 3ONWA 2YXPX 4J1SA 1M2EA 1UQTA 5H7XA 3DDCA 3ANSA 3N0RA 3KKMA 5FORA 3V46A 4ESEA 1GUAA 1HE4A 2DF8A 4OHPA 3CS3A 5E9QA 5EY5B 1Z22A 1T9DA 3G8AA 3Q9NA 1CRXA 2JLSA 3CUKA 5CBPA 1S8NA 1U1CA 4OYRA 2C3YA 1PT9A 1U8EA 1IXKA 2QRLA 3I52A 3W06A 4XQ0A 4DR5B