1O03A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o03A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o03A01
3ZWDA 3ZI4A 3EWIA 4PNHA 3PDWA 4OCZA 2Q4TA 5AKHA 1ZJJA 4KX3A 3WGVA 3L1VA 5ALXA 2NYVA 4Y2SA 4YCMA 3QGMA 1LVHA 5ALHA 2GHTA 3EF1A 5AKIA 1U2TA 2HI0A 1AQ6A 4Y2XA 4XOUA 5IT0A 1L6RA 2RAVA 4L57A 4Y2PA 3ET4A 3ZX5A 2ZBDA 1Z88A 3ONNA 1TJ5A 3AR6A 3SKXA 1N9KA 4YH1A 4NFLA 1EK2A 1RLTA 2I7DA 3PGLA 5AW9A 4CF4A 3D6JA 4UMVA 4G9BA 2NO5A 4EX6A 3FPBA 1VJ5A 3DNPA 3A1DA 5AW8A 5AM5A 1TE2A 2PKEA 3AR8A 2R8EA 4H1WA 5AKKA 2ZXEA 3DDHA 3HLTA 3L8EA 2AH5A 1T9ZA 2G06A 5ALOA 3W5AA 2I6XA 2IOHA 2P11A 3AR5A 1MH9A 2FI1A 1WPGA 3W5DA 1Q92A 3R4CA 4MWOA 3GYGA 1Y8AA 2JARA 2OA0A 1QQ5A 5A3RA 1YS9A 1YDFA 3I76A 2G0AA 3R9KA 2ZOSA 3FGOA 1RDFA 4OHFA 1RKUA 3A1CA 1Q91A 4EEKA 1RMTA 3WK4A 2EARA 3R09A 3NALA 4UW9A 2HSZA 5AK3A 2VKQA 3WGUA 1VJRA 1F5SA 2ZBGA 4EX7A 2OM6A 3BWVA 5AKLA 1U7OA 2C8LA 1WR8A 2HHLA 5E0OA 2G08A 5AVTA 3U19A 2YMLA 4UMEA 4BNDB 2YJ3A 1Z5UA 3QUCA 3W5CA 3QNMA 4Y2QA 5AIAA 2HX1A 2BDEA 3EPRA 3KD3A 1RMYA 2B1RA 3SHQA 1Z4KA 5AW4A 2WFAA 2AGVA 3U7GA 3UMBA 3WK9A 5ALKA 2YMMA 2WF8A 2HEGA 1QQ6A 3NANA 3IB6A 2Q4RA 3N5KA 4KYTA 3E58A 3F9RA 3ZW7A 5AI9A 2FPRA 3OCZA 2JAOA 2BDUA 4YCLA 5AW2A 2GMWA 5AI4A 1Z4LA 3A3YA 4AS3A 2FPSA 2YN4A 4G63A 3DAOA 1Z5GA 2IOFK 5ALMA 2W4MA 4NAVA 4GIBA 2IYEA 2IOFA 4BX2A 4IFTA 2YJ5A 5ALEA 4BKMA 2WF5A 5AI6A 2C8KA 3ZVMA 3QUTA 4HGNA 4YIKA 4NABA 3ED5A 3PGVA 3ZU6A 4YGYA 1S8OA 1RQLA 4CF5A 3SKYA 4FE3A 3U26A 3ZTWA 3OCXA 4Y2VA 3WKCA 3E84A 2YMQA 5AM2A 3OPXA 4UMDA 2BY4A 4KN8A 3B9RA 3MMZA 1U2SA 3FZQA 3B8EA 2NO4A 3WK6A 2FUCA 2G09A 3ET5A 3W5BA 1YV9A 4HGPA 3L8GA 3N8GA 5AW1A 3L5KA 4XPZA 1ZD4A 2B8JA 3SD7A 3ESRA 3NUQA 4NWIA 3WK5A 3K1ZA 2CFSA 3N28A 5AW0A 4BBJA 3MC1A 5AW6A 2MSNA 2YFYA 3AR7A 2P9JA 3KDPA 1Z4IA 2GHQA 4C4RA 2C9MA 1ZRNA 1L7PA 5IT4A 3WK7A 2EATA 3KZXA 5ALYA 5ALZA 1YJ5A 2QYHA 4IG4A 3TLMA 3UMGA 4JDPA 2ZBEA 5ALPA 3KC2A 4HGOA 2MU2A 3QU7A 5AESA 2G80A 3NAMA 2C88A 3CZ4A 4J03A 1Z4NA 5AI8A 1TJ3A 4Y2YA 2GO7A 4CE6A 1J8DA 1XP5A 3IJ5A 2B82A 4BEVA 2B1QA 5ALTA 1ZD3A 5AKYA 3AR9A 3J7TA 4QQFA 3KBBA 3ZWKA 1EK1A 2JAUA 2W43A 3QU5A 1NF2A 2OYCA 2B30A 2YMPA 3OCUA 5AVUA 4XE5A 2G07A 1ZD2P 3U7EB 4UU1A 2FPWA 3U7FB 3NIWA 1T5TA 4BX3A 4L6AA 5AKEA 4EELA 3RFUA 4XQ0A 2EAUA 3N1UA 3QU4A 1WVIA 3QUBA 5AVVA 2WF9A 2WM8A 2FUEA 1CR6A 4BX0A 4UASA 5AK4A 4CF3A 5AVXA 3L8HA 5AKGA 4UMFA 1JUDA 4EENA 4JB3A 4YIHA 3QYPA 3CNHA 5AI5A 3I6BA 5AHXA 4C4SA 3I28A 4FFDA 2YJ6A 1L7OA 5ALQA 1YNSA 4Y2JA 1QYIA 3UM9A 5AK6A 4E88A 1SWWA 3FVVA 2I34A 4EZEA 3QU9A 2C4NA 4HYTA 2B8EA 3KOOA 2QLTA 4UAUA 5ALWA 5ALVA 1Z4PX 3NASA 4BEWA 3ZVNA 4UARA 5ALJA 1ZS9A 4DWOA 4Y2RA 4O8CA 2ZG6A 1RLOA 5JJBA 2WF7A 2YY6A 4I9GA 1NNLA 1SU4A 4YCNA 3IRUA 1Z4MA 1RMQA 2WHEA 3L0CA 3BA6A 4I9FA 2HCFA 3ESQA 3WKBA 3PCTA 4CNQA 2GFHA 4FYPA 1L7NA 5ALDA 3E8MA 4C4TA 3U7HB 5AM0A 3FM9A 1ZOLA 5AW7A 5AIBA 5AKZA 1U02A 5ALIA 4UM5A 1RRCA 1L8LA 5AVQA 5AVYA 2I54A 4DFDA 1Z4QA 3RF6A 2YJ4A 3EF0A 1L8OA 3L7YA 1T5SA 3OTQA 2MU1A 5AM4A 4J2TA 1U7PA 3L1UA 1CQZA 4HGQA 3MPOA 3WK8A 5ALNA 5AK5A 2JAWA 3ZTYA 5A3QA 4HGRA 1X42A 3E81A 5AKXA 1VFPA 3M1YA 4KNWA 2ODAA 2O9JA 1TJ4A 2D2VA 2X4DA 3B9BA 3SMVA 5ALRA 5ALUA 2RBKA 1TA0A 1FEZA 2CFRA 4DW8A 1S2OA 4KNVA 3S6JA 5AVZA 1RPZA 2O2XA 3QXGA 2FPUA 4UU0A 4MUMA 1WZCA 5AVRA 3QLEA 2OBBA 1QH9A 2ZBFA 2DQSA 5AI0A 4Y2UA 1PW5A 4AP9A 2WF6A 3AR2A 3ZUPA 2P69A 5ALSA 3OCWA 2R8XA 1KYTA 1O08A 1O03A 1ZRMA 4ZEWA 3OCVA 3P96A 1L7MA 4Y2TA 3L0YA 2YBDA 1LTQA 5AKJA 1Z4OA 4ZEXA 1NRWA 2PQ0A 3UMCA 4RESA 1J97A 2HDOA 2W11A 4QJBA 2Q5EA 1XPJA 1IWOA 1Z4JA 3ZX4A 2FEAA 5AICA 4F72A 1ZD5A 4UATA 5ALFA 3SLRA 2FDRA 2AMYA 4OFZA 1RKVA 2AUTA 2IA5A 2R8YA 2I55A 3SF0A 2FPXA 3WKAA 3DV9A 4UAVA 4Y3UA 3WKEA 3L0BA 5FP0A 5ALLA 3L8FA 4NV0A 3QX7A 3QU2A 4BYGA 3U13A 3NRJA 4L6CA 5ALGA 1YMQA 1XVIA 3M9LA 5T41A 1N8NA 4KX5A 2G1AA 2PR7A 2HOQA 5AM1A 2R8ZA 3N07A 5AVSA 5AVWA 2HO4A 3MN1A 3OCYA 1RQNA 4HAIA 5AW3A 3AR3A 2HF2A 3FPSA 2CFTA 3VAYA 3I1YA 2B0CA 4B6JA 3QUQA 3WKDA 2P27A 1SWVA 4F71A 4OD0A 1RC8A 4RETA 1RKQA 2CN1A 2RB5A 5A3SA 4AS2A 4UM7A 2JGAA 3ZVLA 3HYCA 4ZEVA 5AM3A 4BNDA 1K1EA 3AR4A 2I33A 4GXTA 5IS2A 3A1EA 5AW5A 1RLMA 2RARA 2HF7A 1QQ7A 4DCCA
chains in the Genus database with same CATH superfamily
2Y05A 3TNYA 3BDVA 2QVYX 3ETHA 1JLRA 2AOTB 2IS6A 3L18A 5D1HA 4W9NA 1H0HA 3VNAA 3HRIA 1NWHA 1XUOA 3L6BA 3O8LA 2YXBA 4MJXA 1UC8A 2ZRMA 1ZJMA 1N5RA 4I81A 3Q12A 4R3WA 1XRPA 5JSHA 3WGIA 3LG2A 3IOBA 2F1OA 4O5CA 5E4YA 1UP7A 1QVVA 1WPGA 2WA1A 3MPUA 4DPLA 2PLWA 4G0OA 4RTPA 1SVUA 5F7XA 1A8UA 4KACA 2FX5A 1H6AA 1Z22A 5AVOA 3AEQB 3DCNA 5E3HA 1TECE 4TS1A 1YS2X 4L8VA 3AMZA 3HY3A 3V2HA 3RJZA 3LBYA 2O5EA 1V16B 1JIVA 4RPYA 2XNKA 1RBMA 1WSWA 4ETNA 1YK0A 4YAKA 3OPMA 1Z2EA 1QQ6A 1XCMA 4EUSA 1K27A 3CRQA 4JVSB 1YR1A 2CFCA 5E1MA 1KHHA 3MR5A 1G20B 4JH0A 2C4KA 3EVGA 3AEUB 3DOFA 4FC7A 1KH3A 5T4EA 3SFVA 1IEVA 3PGVA 3HYLA 5DBFA 4GVPA 1WXQA 5T4HA 1X1TA 2BGWA 3TO5A 7ICJA 3OPXA 3UG7A 2XQFA 3IVRA 4QPJC 5TB5A 3DCIA 1N4DA 4P4UA 4MRSA 4U2EA 3OECA 2HSGA 4UVEA 2HXSA 2PKQO 5KYKA 1AHNA 2ISQA 4PWYA 2BEJA 1PT6A 2Q7XA 2A88A 5ALPA 1TMGE 5KT3A 5COQA 3BG5A 3LQRA 1X74A 3D64A 4P7KA 1OILA 3RS8A 2EEPA 1NQAO 4XIJA 1PL0A 4KLQA 1VPTA 3IP4B 5DQGA 3TBKA 1LK0A 1L7VC 1NUQA 4Q16A 2I7XA 4JJFA 3PQ4A 3U2QA 1J1IA 4ZOHC 2W6JA 3KPJA 3PE6A 1V85A 5L53A 3JASB 3MR3A 2B7CA 5KG3A 2PPVA 2QL6A 1ACJA 1IXRA 3HDVA 2DFTA 1EFRD 1JHXA 1XT6A 3V1NA 2D1YA 2PT6A 5BV0A 3S2ZA 4FYWA 5K0NA 2AN9A 2X2PA 3KFLA 2O3TA 2EYUA 3ZU4A 1QONA 3EFBA 3LDUA 3MWLA 2RSLA 1YJXA 1YH3A 3S0JA 1AKMA 4UB6U 1GYPA 1UFVA 5JARA 1IOVA 5K0CA 4TQUS 3PF9A 1KP9A 4YUXA 3A1UA 2OCPA 3EF0A 4GX0A 3T3PB 3RBXA 9ICQA 3ZYZA 1WXDA 1M75A 3S27A 5F35A 4K8RB 4L4ZA 4UVHA 4D4MA 2FWAA 3LQ2A 3ZK9A 2W5UA 1B93A 1R8XA 1SKAA 5F9NA 2I3BA 4LZOA 4GC7A 1HZJA 1ZA1A 1DJLA 1YZHA 2HHJA 2VPXA 1TZBA 4DQQA 2QTGA 2I1VB 3DUWA 1QOPB 5DPMA 1HL3A 1AK2A 3M9XA 4ZZ0A 2UVPB 3KR1A 5C1BA 5JAIA 3I8SA 2C7PA 5LKRA 4MWTA 1XVAA 4MW4A 2IA5A 4JT4A 4F6RB 2OG1A 3BWBA 4GG1A 1O1YA 1WDMA 1ZKMA 1BJTA 4WKBA 2FE1A 5E79U 3W9BA 4QXAA 4UHCA 3TJRA 4RE6A 3K9QO 16PKA 4BP1A 3FWNA 2VRWA 3EIEA 4DZRA 2V4QA 3R7WB 1CERA 1ML4A 3C3DA 1AUQA 4C8NA 2FSSA 3VR6D 4L95C 2P3QA 3G2JA 2J4CA 4S2EA 5JE8A 3DKPA 5LZ2A 2NSYA 5DGDA 3FYTA 3B1WA 4PLTA 1OHHA 5EXPA 3H2HA 3R0XA 1RJ9A 4RPGA 1DJNA 1NJYA 2HWYA 3QVMA 4MMZB 3LRTA 3W90A 4ZO8A 1P61B 5CWRA 2CLMB 2VP9A 5BT8A 5EJ8A 3VSEA 1JQ5A 3TWOA 1YS6A 5TJ9A 1Z2PX 3C98A 2OV8A 2ZRDA 5DP2A 2XO7A 2K4MA 1PZHA 2FQWA 1EESA 4BDTA 2J46A 3NDJA 1L8QA 4ZYWA 3TIVA 1TPZA 3D7KA 1R00A 2HWUA 5KG6A 1EHCA 2NO0A 4BN5A 3KP1A 1CB7A 4IXDA 1DGSA 3QOXA 4GI2A 4YJDA 4LY6A 4MJ7A 3PWKA 3IDFA 3T4UA 1TT5B 3HFSA 4RIEA 2VSOA 4UUQA 1P0CA 2HRDA 3T8YA 2P6NA 1TXGA 3FNRA 3JAKB 5DGBA 4B32A 3OCJA 2IXAA 8ICOA 4DV3B 2O0MA 3KXKA 2J85A 5TQVA 3REQB 1YV9A 3TQOA 2AKEA 3GEDA 3T4XA 4IIEA 4ZC1A 1E9SA 4FFNA 3FMGA 5BWOA 1N62A 2ALJA 2EW2A 1X7ZB 3SLGA 4X91A 1TAMA 3LUDA 5EWJB 3ELWA 2G9RA 3ILSA 3QH4A 2LIVA 1BXGA 1KSPA 1L5QA 3T7RA 3ZKAA 2JGDB 1R27A 3IMEA 4CEJA 2GN2A 1JXAA 1PVQA 5KNDA 4MINA 5LQCA 1URPA 3V7YA 1N2CE 7ICTA 3PSHA 4MWBA 1ZN9A 4N1AA 2W98A 3SE7A 2VYCA 1XHFA 2JKVA 4HATA 1SUAA 4URWR 1W0JD 5K0BA 3NT5A 4BTEA 4IDNA 3M6IA 1F8UA 4Q01A 4YJFA 4JI8B 3UTDA 3ZDRA 1RC1A 1JJFA 4JN6B 4JBIA 3ESQA 3WKBA 2VAVA 2Q5HA 4GW3A 2Q3DA 5BV1A 1FYVA 3CZPA 3DVAA 4JVLA 2EZTA 4UEQA 3LC0A 5BOMA 4YV0A 1S8AA 2PMKA 4C01A 1OC4A 4LSGA 1BHQ1 1H0RA 5E6UA 3LUPA 4MV0A 4HDSB 2VF2A 5TMEA 5K99A 3E81A 1XNHA 1P1IA 4XIGS 1HQCA 5CEHA 1VMKA 1C7EA 3MJSA 2V7XA 4I50A 1E7YA 1ZA2A 3SR4A 3GUVA 1E9DA 1D1QA 2WTFA 4ZVOA 2FPIA 1PK9A 2VEOA 1U9IC 3KYDB 5B1DA 2HMVA 3R76A 2W2QA 2KJ8A 5JPIA 1EQUA 1BZYA 1XI2A 4HC4A 4DIOA 2OESA 3GIDA 4GD3Q 3TGPA 1B0XA 5HX7A 1RWNA 2V7UA 2GR9A 4U7DA 4OJQA 1E6MA 2W54A 5BNZA 1T13A 4KMOA 2GHRA 4C0QC 2AI1A 4WZAB 3R75A 4O3FA 1Q0UA 1ZQXA 3ZIDA 3PLNA 4A91A 3FMIA 3WO1A 1YVEI 3CX7A 2O0HA 3OCYA 3C39A 1W73A 4YT8A 4HRAA 4OD0A 1SBQA 2OILA 3DWIA 2P8SA 4R1NA 2Q1TA 3QZUA 5THQA 2QG6A 3R7AA 4ED7A 1QRDA 4I50F 3LW7A 1U4OA 5JZOA 4G85A 4PNHA 3OI7A 1VHQA 1XAHA 3FSRA 5BUSA 4AJNA 2F6RA 2L5YA 3AKEA 4EPYA 3II6X 3VA7A 1JQKA 3L04A 1M2JA 4NFLA 3HZRA 4RF5A 4NYIQ 5DDMA 4QIWF 2J07A 1YZKA 3FMVA 3A1DA 1VCMA 4BGVA 2GPBA 1M0EA 1A76A 1KMMA 2FPGB 1IZ0A 4G97A 2OQIA 4GYWA 1Q19A 3FOEC 2ZJ5A 2CXTA 3ZXIA 3MGIA 2R2AA 1J0CA 2P6MA 4RANA 3M6VA 1V26A 1FFBA 1KVSA 3WGUA 2WZDA 1P72A 1GU7A 2ZRFA 1T9BA 1FDWA 2H00A 4N5DA 1MZVA 4MDHA 1MIOA 4OP2A 3QWHA 3GGOA 1N6KA 4KWIA 4H31A 2BMDA 2Z7JA 3P27A 5F21A 3VO2A 1E1MA 5EE0A 1G8GA 3OJLA 2QRUA 3EDRA 4MA4A 1JDTA 5BOSB 5U4QA 4BLVA 2ZSHA 5BWBA 2DBRA 4ENTA 5HM8A 1T5LA 1USWA 4DMHA 2ZJFA 3G6VA 2IV7A 1IZYA 5ELMA 1I3MA 2AQHA 4LFAB 2FRDC 3QE9Y 3MHTA 2FE4A 2B34A 3PR3A 4YR0A 2VOEA 1OFTA 4M6WB 1ONSA 3CO0S 5BN4A 3QKIA 5IAOA 4QJ5A 5LBTA 4RWZA 5LZ8A 1PDWA 4D99A 8ICAA 3ZHSA 4J7AA 1NI3A 3DLBA 4QIHA 4F4DA 3S1AB 3PHJA 3L43A 5TGTA 1EEHA 4NOLA 5GMOA 3T9CA 2XT6A 3M6WA 2BRUA 3L8HA 5EQFA 4TM7A 3PNQA 3T3DA 2A84A 2EGGA 2GPYA 5LXTB 4FFMA 4FDUA 1CX9B 1NXPA 1KO8A 3G0OA 2XITA 2J6TA 4F1KA 1IXSB 5DGXA 8OHMA 4LJLA 2CJPA 4RTNA 1Y82A 4IOKA 3M6UA 1WS6A 2BSAA 3D7NA 4I3FA 1Z17A 3TLAA 2FLWA 2I87A 3AU9A 3OX1A 4P7FA 5JXWA 3F3KA 4IRKA 3B6EA 1L3CA 3AHCA 3OEWA 3QEMB 4P0QA 4DFDA 1J9EA 1JG6A 5A0LA 5CA1B 1PNRA 1NN3A 3WNCA 4PZZA 4NLKA 4B87A 4GMKA 2A58A 4WLUA 4K6GA 2BTOA 2FPPB 3FWPA 3FNFA 3MABA 4QELA 2XAAA 4LWZA 4YJ3A 1ZM2A 4INJA 4M60A 3H86A 3RUHA 2QY6A 1E0AA 2PQMA 3RK4A 4H3SA 3EIHA 1AS2A 2FXVA 1O9HA 4CR7A 4YXWA 3HJCA 5A3VA 2P5SA 3DPSA 1ZGCA 2WKSA 3IBGA 4ZN6A 3AZPA 5GY7A 3INRA 2BKVA 5A6VA 5A6SA 1R0SA 1R16A 4A2WA 2LHTA 1CDEA 1OZHA 4YO7A 2VYVA 4YUYA 3UHPA 5LYYA 3DDOA 2V9PA 4ENUA 1BDIA 4DMMA 1KAGA 1H4TA 1HYGA 3R3VA 5FR2A 4NLGA 2QMUA 2R8YA 2BHTA 2W2TA 3D4IA 2PR2A 2XSZD 1D6MA 4JGBA 5JNTA 1G60A 2C2ZA 2VHJA 5B3AA 4F5NA 2G1AA 2R8ZA 1KP2A 4YCSA 4D8TA 3EG5A 4Y2GA 3AG5A 4LW8A 2G4CA 2GAOA 4YJ3F 3W79A 4DGSA 4DV7B 4ZOLA 4C14A 4FKZA 3WGVA 1DEXA 3PX4A 4I4NA 2V4MA 2JBAB 2R68A 4RM3A 3S1SA 5BVGA 1X14A 3QWAA 2XUHA 4CF4A 2A92A 1KYZA 3VVMA 4LYAA 5HRCA 5J63A 2PUEA 3DDHA 4PCVA 1GPMA 4EO9A 1YSCA 5MN4A 3D3NA 1NDQA 1NV8A 2JARA 3HG7A 2NVWA 3AETA 3QVUA 2RHDA 3UHOA 3GOHA 4K6MA 5HKAA 1NIPA 4UOZA 2Z1NA 5DB6A 4Z9YA 2BCSA 3ICPA 1P77A 3RHTA 5AKLA 3WB2A 4MPDA 4IJQA 3CXRA 3G2NA 4ENWA 1DJOA 2HCJB 2WWRA 3PQEA 1DKRA 3R7NA 3VR2D 4RD2A 1MB9A 4LHVA 3QPDA 1PL7A 3QPWA 4RA9A 3PMLA 2R00A 4MWGA 1QLWA 4D46A 1IG0A 2CD7A 1PR1A 2QKQA 4MWEA 5IEJA 4ZOLF 3D7SA 5LL6P 1HTTA 4UU7A 3VMFA 3WAKA 1EUCB 3H7AA 4B3BA 3ZW7A 5FOTA 1ZG3A 3TZHA 2X6RA 4PLCA 5LBIA 2Q8NA 4U02A 3UFBA 1AGRA 3O8RA 3TD9A 3CRMA 1C0IA 1UDRA 4HGNA 4YIKA 1J20A 3OMLA 1XMQB 2ORED 1HG1A 1NZFA 1GSIA 2YMQA 4AZWA 4FGJA 5J29A 5DWDA 2BUCA 1A9PA 4DG9A 5E2AA 1KKLA 5K3FA 4D4JA 1BCSA 3RYFB 1F0MA 4GEGA 4F3KA 5JJCA 4PL2A 1ZQHA 3BULA 2NTEA 1BWPA 4BJHB 3FTDA 1W7AA 3TSYA 4MAAA 1UDCA 5F9FA 1ZJ6A 2QX9A 1LQUA 3EG9A 4MTCA 4CR8A 2XOEA 1PV4A 1FFUA 3LKBA 4PYLA 1KIMA 3GPIA 3LYAA 5I9TA 4PYIA 3U9SA 4OOFA 4BFLA 5JAOA 4MVJP 4E32A 2NXNA 4L9WA 4NDZA 3BCHA 1FSSA 3CVWA 3ROEA 4KTTE 4G3XA 4U2DA 5A0VA 4F06A 2CLEB 1E2IA 5IC5A 3UT5B 5AI5A 3LYSA 2CZGA 2YJ6A 7ICEA 4L74A 1MABB 5KI6A 5KVAA 1JEEA 5LD2C 2CLCX 4YXFA 2W70A 3G8BA 2AS0A 1E0JA 1TZ2A 2ZG6A 1AKNA 5HF6A 1JQJC 5DBHX 5E4FA 1Z7BA 1Y3DE 1CTQA 3N7PD 4XSGA 3MTBA 4GS5A 5D46A 4BCDA 4AYXA 3HDGA 1GWNA 2Q0SA 3SF8A 1WXFA 1DELA 3W9SA 3B52X 4XQGA 1BHO1 3OZEA 4RIIA 2PUTA 2R4TA 1AKTA 3UAOA 4TKLA 2MU1A 5CUQA 5JECA 2H54A 4BNIA 1NF3A 1YL6A 1WEKA 2OUKA 4IR9A 4R1PA 3RGWS 1KOFA 1X1QA 1V1MA 3CZRA 2NV3A 4EKYA 2X4DA 5ALRA 4EJSC 1ZIDA 3GFSA 1RQ2A 5BVHA 3BWCA 5B5EU 1ZQJA 2HSJA 5TC4A 1KSFX 1CVLA 2Y0CA 3DXFA 4IS7A 4PSKA 2CW5A 4M04A 3I2JA 2ZDHA 4NLLA 5FBWB 5G1PA 2AE2A 3BUSA 3OCVA 4XASA 3EHEA 1K98A 1Z4OA 2PYIA 2L0XA 2WWWA 2GPAA 3MD9A 3KQQA 5EZQA 4ADSG 9ICCA 2IXTA 3RAEC 9ATCA 4RV5A 2UZ4A 4O0IA 2BFCB 3G9UA 1JKMA 1VLLA 3H8VA 2BPOA 5A62A 1BXRA 3F46A 1L7DA 1MRSA 3BMCB 4DVJA 3L84A 3EUFA 1RHQA 3QOYA 3CFYA 2A30A 1H2ZA 2AXNA 4NEHB 4J49A 2RK6A 5HHIA 3K3PA 4D4HA 1PJZA 4ZU1X 3LHDA 3QUAA 2W22A 3KQHA 1IDN1 1ZIPA 4Z7JA 1SL1A 1T8TA 2Q4TA 1VKNA 4KSBA 4BUZA 1GITA 4ZCTA 3HVHA 1NN0A 3PD0A 1ZQ1C 2ESEA 2WJZB 3HMKA 2X76A 1DC7A 2I8LA 2BDTA 4DJDC 1T9ZA 3J81j 2CL0X 2IOHA 2QARA 3RPEA 3TW6A 2FPMA 4DOCA 3MILA 3T4EA 3FVRA 3K75D 2XCOA 3OIDA 5F23A 4OK5A 1RHRA 1PVOA 5T14A 4LHWA 3FAHA 1CRXA 3C7AA 4AG3A 1M5RA 1RI1A 3SBDA 3ZCPA 5FI1B 2EYQA 1I36A 3FY4A 2YMLA 4OJKA 3C3AA 2IXGA 1NXOA 4WLNA 1U8ZA 1A9TA 2IPOA 1XTRA 3GZTB 5L3QB 4JT8A 2OPHA 821PA 3U7GA 3K31A 2HQSA 1JEDA 2G77B 2HM7A 4NBWA 3RCBA 1EK0A 4QRHA 3UJAA 4B75A 4YCLA 5L4SA 1JPUA 2A9RA 4FZVA 4MIKA 2ISPA 4XGQA 3I2HA 1G5QA 2ZT6A 2Z57A 3H9GA 2R8RA 2BW0A 2VA8A 3ZWAA 5IAAA 1OXJA 8ICGA 2HQRA 3NATA 4LBZA 4QULA 2JDID 4ZDWA 4BFUA 2W2XA 3RB8A 3L8DA 2IYUA 2AGPA 2W2OA 4EO4A 4C4RA 4A23A 5B3JC 2WZBA 5IT4A 3DAHA 1KYWA 1FTWA 4YRJA 1N1DA 2ZSJA 2XT9A 2HSDA 1WCWA 4XPIA 4C6SA 3GLHB 2C5SA 5AO9A 3EPHA 2MYUA 5IABA 4II3A 1A4XA 4B5LA 4FZ5A 1P6QA 1XXHE 3KB8A 4RZXA 2PS9A 1V35A 2DP4E 4WD3A 3UWOA 3LKDA 2W3SA 3ANNA 5C8ZA 1OXBB 5LDDC 4V2IA 4BZWA 2AOXA 5F51A 4YIHA 5E9QA 3I28A 1UM9B 4J07A 2VSYA 5E1OA 1QH0A 2F8LA 4JHXA 5DBCA 3HY6A 1G6HA 1U9CA 2MSDB 1I3NA 3L40A 3EEYA 1YR7A 5ESDA 4IXTA 5TPWB 1JG3A 4EF4A 2CYAA 2XHEA 5IVPA 1NW3A 3K9HA 1E61A 1M8PA 1E7QA 1C1DA 1RRCA 5DLFA 2W7PA 2J5QA 2BKXA 1NUHA 3EXG2 3OO1A 4M54A 1CQZA 4HGQA 2XJ9A 1R4NB 1B8NA 3O83A 4DPMA 1CS0B 1ZOOA 1WDTA 2QNIA 3CINA 4Q3NA 5L3ZA 2WPDD 4D0NA 4Q4JB 4FINA 1KI4A 4DSEA 1TCUA 4ALIA 1J0DA 3W2TA 4KUHA 1T15A 3DAFA 4DL2A 3QLEA 3I9NA 3F3SA 2OBBA 2QJTA 5JO9A 3U1TA 1A97A 1FFWA 2JLYA 3HO1A 3B8HA 4G01B 3UQYS 1WWKA 3AF5A 2RH9B 4RX1A 3PVCA 3FAZA 4NBSA 1PT8A 2HJWA 1AO0A 4DR1B 5C34B 4TLBA 5EE5B 2F1HA 3OA2A 2IP4A 2OC9A 4FDAA 2GZDA 2ZPUA 1GD1O 2Q27A 2OZVA 5HUJA 4Q1AA 1I2MA 4E5NA 3EXHA 4COKA 2H5EA 1OX6A 3L07A 4C4XA 4F9TA 4WK6A 1GUYA 3LK6A 3K0CA 4KGXA 2WJ4A 3EYAA 1ZLYA 4LVCA 3LY7A 3C14C 1EDEA 1QF9A 4FSXA 4WTOA 3GBSA 2ZSUA 1OWOA 5ECDA 2P65A 2C82A 3ROXA 3KHTA 3E0QA 2JJQA 5MFZA 2FG7C 3A4YA 3BL5A 5CBPB 1VTKA 1A50B 3DHVA 5AJVB 3U4QA 5TMDA 2A3NA 2H8KA 3OU6A 5K3EA 1LVHA 2GHTA 4BV2A 2YWXA 1JPVA 1X80A 4B3JA 1ZH0A 3I05A 3OSPA 3SXUB 5H68A 3VV3A 1ILEA 2EIHA 1K6XA 1T1GA 2V9ZA 4ZGBA 4A0RA 2JGMA 4ER5A 4X54A 5BMVA 3AIOA 1H69A 1OC2A 4PFKA 1APBA 1LSUA 4M46A 3V1LA 3RIYA 1KEWA 5ITWA 3JPSA 1HE4A 4GWLA 5DE3A 3F6YA 2ATIA 1F2UA 3I12A 1J09A 2W3RA 2YY7A 4HYYA 4RADA 4EEYA 2ZSEA 3G2LA 2QE6A 4S35A 1VE5A 4GECA 5HW0A 1SKYB 2EKPA 1R5BA 3TZLA 1KRWA 2QN3A 3ANMA 5NULA 4NE2A 3DE7X 1EFRA 2UVWA 5B6IA 4QO7A 3IIJA 1NJ8A 3H3FA 3PNMA 4Z9XA 4HAOA 4CKZA 2VN8A 2WYIA 4OUDA 4RKQA 1UK8A 4O5KA 4IQUA 4HQLA 3RJ5A 2IS2A 3D5TA 4A6DA 5INTA 2ZS9A 1PSWA 3DVLA 1ECBA 4QQNA 3KLMX 2XLCA 3W04A 5BMVF 1MT0A 4O2AF 5IVIA 3SZ2A 3B2NA 2JA1A 3O82A 1V0JA 1N0HA 4OYYA 2PMFA 2GHQA 4PFSA 4BHTA 2CLKB 3TXYA 3MJVA 3GLIE 4IDHA 4LZZA 3QVJA 3PGMA 1Z0KA 2QN8A 1T9CA 1JP7A 5BQPA 3OZIA 1FMCA 3T1YB 4Q1DA 4MLCA 3INYA 4BB6A 1RYZA 2BF7A 1P8JA 3G1TA 2G04A 5AKEA 4RK1A 4UDNA 1P19A 2IW3A 2IS4A 3REOA 3N7TA 4BX0A 4JJKA 4FHDA 5AVXA 1C2TA 2JJ2D 3I6BA 2JK1A 4WACA 1QC5A 5JDIC 2NPIA 4LRSB 4GP6A 3HKBB 1JR2A 2YASA 4O0LA 4DJFC 2PI4A 2V74B 3HDQA 1QS0A 5DGCA 3DSRA 2W2KA 2DFDA 2GPTA 1JQEA 4DWOA 4O5EA 2Z2JA 5HRAA 3LOUA 5A4DA 4W82A 5C3MA 1RMQA 4BMOB 4LYYA 3SEFA 3UENA 3OZWA 4OYHA 3GDFA 1C4KA 2GYUA 3VFDA 2ATLA 1YR9A 1RXUA 4JLBA 3TYXA 2VDWB 3WLOA 5KSPA 3GT4A 3VR6A 4LNHA 1I8TA 2ZI9A 4L0CA 3D7RA 2XUJA 4BJQA 2BTQA 1KI3A 4YV1A 2UVVA 3T3GA 1E94E 2AMJA 2DSTA 3BIWA 4E3ZA 1FXWA 2H0QA 4DMRA 1GRCA 3LK9A 3E9DA 4IFEA 5KTSA 5EGSA 2NACA 1MVNA 1JZTA 1MB3A 2XY5A 5IVHA 1YL5A 5G40A 3JYHA 2OC4A 2WB2A 4OB7A 4IQVA 4LTNA 4CMBA 5JNRA 2GEKA 2RFLA 1B0UA 4G5YA 1GADO 3KUXA 3N2IA 4UJ5A 5B36A 3HKCA 2A9FA 4JUCA 4IL6U 1IATA 3AP2A 3IELA 4I2FA 1ZONA 4B47A 1T1SA 3QX8A 3FROA 1BA3A 4FO6A 1XU7A 2P1ZA 2AB0A 1SXJC 4PIMA 5A1JA 1LNQA 2BN4A 5ER6A 1FFVA 4L15A 3FPJA 1M2VA 3K7EA 1VBNA 2VRNA 2M9NA 3UCEA 2IUFA 4AZTA 4BAUA 4LXQA 3PRKE 1AURA 3TRDA 3CEPB 4UNPA 3JPTA 5AQEA 5EPOA 4X1YA 3HRHA 2OB2A 3WHLA 3MS7A 2J7KA 1ZETA 5J23A 2QQFA 3KJZA 4F3NA 2WR8A 3R44A 4FMDF 2QSZA 3GGSA 4CG1A 4JJEA 1L5RA 1WTCA 1LDGA 1YOVA 1ZK4A 2C7OA 5AKIA 1OLOA 3PO4A 1E1DA 1UPCA 3IUNA 2RAVA 1I5OA 4OEHA 5ICCA 1IHXA 4JMUA 2DGZA 1YB4A 1GTSA 1C1XA 1TVAA 2CXYA 3B7PA 1S02A 4YFVA 3FUUA 2A9JA 1P9RA 4H1WA 4NV3A 3IVXA 4CM7A 3WZ2A 2FZCA 4QU5A 4G0VA 3DZGA 3HI4A 1J42A 4P4GA 1E3JA 1PNVA 2ANCA 8ABPA 5LWQA 5JHHB 4JJ4A 2C57A 5K4GA 4N54A 4MYCA 3JD0A 3SZGA 2OAQ1 3G1UA 4KI0A 3RVNA 3RS2A 4CM4B 4YXJA 4G5RA 3LJKA 1VGQA 4HHEA 3P2OA 2XWJI 1ADFA 3V1TC 2VQ3A 2I7TA 4LZAA 5AW4A 3KK0A 3ON5A 3O90A 5TGZA 3PQDA 4D97A 4DR2B 3D5EA 2C84A 2YXEA 3BM5A 3R3ZA 3DEAA 3BAFA 5GONB 3QFRA 1X2BA 4NBVA 2R8OA 3SC2B 2GCNA 3N6RA 5ALMA 3QSGA 4ND4A 1W0JA 2WDZA 4K9DA 4R8UA 2JBHA 1JLMA 3ED5A 1AO3A 1II9A 2C7VA 2PS1A 3WMRA 5D7BA 2B2XA 4PY2A 3M4JA 4B48A 4JDUA 4DS4A 3A6LA 3UXOA 3O0DA 3BD9A 3HKEB 2XZPA 3GCDA 4QATA 3DTYA 2VNHA 4LZGA 2OFPA 2Y0EA 2FR8C 2LNDA 5LMUB 4FMCF 5ESRA 4JROA 2HLHA 8MHTA 2HFKA 3ZOZA 4M9GA 3WYEA 1AJEA 3X2FA 4TWIA 4BE7B 5AESA 4LHYA 1JKFA 1Z4NA 2NSDA 2EP7A 3UOAB 3RS5A 1B41A 3L01A 2H4FA 5C8DA 3SSOA 1VI6A 2IPMA 3CUVA 4Z6KA 3C8HA 3D43A 1OBCA 3GBVA 1BXZA 4NCNA 1ZSNA 2YCBA 4PR3A 2G70A 1VIYA 1YL7A 5KVVA 3VNQA 4E5SA 2IZ1A 3TPZA 3VUEA 3AVYA 1D0SA 1W8DA 2NZVG 4P80A 5C5IA 4AJ9A 5KT4A 3CUUA 2VOJA 4W4TA 1C0KA 3I5UA 3DHWC 3C3CA 3BPSA 1UPBA 1Y9AA 4LC1A 2LRHA 2EBFX 4ENVA 1M1XB 4DSIA 5IWCA 2I3ZA 3QELB 1SGWA 4RWEA 3A2NA 3B9JA 5JISA 1TAQA 2AZTA 2OY0A 4YAEA 1P5ZB 2OXFA 4PL1A 1JE0A 1P6XA 2Z56A 3ICWA 2VBFA 3KQPA 2DQNB 5DB8A 3A11A 3BDPA 2YS7A 1UIRA 2FAXA 1SUDA 4RH0A 1RC0A 3AU2A 3ROPA 4WN9A 2O9JA 4F4UA 2CVOA 4I1VA 3U7QA 4G26A 3PDIB 4J9OA 4TYYA 2F3SA 5JD5A 5KHOC 4EVQA 1EFCA 5LU9A 2JXJA 3GUUA 4KXNA 2Q7OE 3NDBB 1AD2A 1PW5A 4PE5B 3QFFA 1V5IA 2J0SA 3WFJA 1PFQA 3P96A 2ZUSA 2D0DA 2MR5A 1L7BA 1N3BA 2ILTA 3O4JA 4J7UA 4RV9A 3LQYA 3OP1A 2WHYA 3DV0A 5H3LA 4B6FA 2A5JA 3PW5A 1PO7A 3EUAA 1ZK0A 1I7NA 1Q20A 4XSHA 3NHBA 2AVDA 5IAJA 4PRYA 1FSZA 4IUBS 2FJ0A 4J9PA 3O9VA 3RR7A 2XAUA 4QJ3A 3VYVA 1TFUA 3FWHA 4CMKA 1V4BA 4B6SA 2IZ5A 1ZXBA 4LGCA 3NEJA 3RVRA 4N0MA 3CLUC 3GNTA 4CV0A 1VG9B 1RQNA 2OV4A 4KFRA 1DBPA 1IULA 3ABRB 2HHWA 5CIYA 5C8YF 1SOVA 1QQ7A 3ZWDA 3ZHYA 2O8VA 4XWWA 2X41A 3F9CA 3WOHA 2QGFA 1ZWKA 4XZ3A 7ICOA 2KMLA 3GK3A 1NQUA 1QORA 3ES9A 4AK9A 4ESHA 2AGQA 2RAFA 4GPD1 4YQYA 4MRMB 1DX6A 1VBMA 2WEKA 3B6IA 1SM4A 2XICA 3BAZA 1WZNA 1PK3A 3MWYW 3PHHA 1WKCA 3UMYA 2PZBA 3R4CA 4QWEA 4W5JA 4AULA 2QY9A 4H1VA 2P6OA 3W77A 3Q8LA 1R37A 3O1IC 1SELA 7ICNA 5IDWA 1GTMA 1I9GA 1WG8A 2PL3A 4EFLA 4Z7QB 1U2QA 3LQKA 1O2DA 1MQ2A 2Y1FA 4RM2A 4U2GA 1TAGA 3ICEA 4EHBA 4WWHA 3SEQA 4ZPJA 1AKRA 1FQJA 1QRAA 3DWFA 3CF2A 3LD9A 4LWOA 1SVIA 3I64A 1HTWA 3WSTA 3NIGB 3USCS 5JD4A 3TF5A 4K0KB 4FP9A 1FUEA 4OKSA 4EMBA 3UJ9A 3R41A 2BPGA 3FN4A 4KITB 4MHSA 2ZJ0A 2CDAA 1XZJA 2R65A 3TIIA 4OK3A 5GGYA 1N2JA 3QQPA 2O8FB 4OXYA 3OP4A 1YF3A 1UKCA 3CW9A 1GQQA 3THXA 3BDIA 3WGZA 2FQYA 2OHJA 3O1HB 3I0MA 3E9RA 5CB6A 3DVRX 4HGPA 3TX6A 4GZ3A 5J5AA 2A4MA 5LLSA 3O8OB 4PRKA 2CNOA 3IJRA 4N03A 2FEKA 1GFWA 1KVTA 1GPWB 3KB2A 1J1ZA 4D4KA 4BBJA 5A7HA 3M8KA 2AD1A 5E7MA 1M1YA 2DFVA 4GL2A 3S44A 1YUMA 4KKVA 1Y7HA 4CRWB 3RNOA 4ZARA 4UDYX 4HTFB 3I83A 3BHIA 4LK2A 4ZI2A 4XUEA 3BF8A 2BLNA 2EAOA 1CF2O 4B6GA 1NM5C 1P9OA 2BGJA 3K6JA 4B2LA 1EWQA 3IAAA 4NAUA 5LJIA 3X1JA 2R6GA 5EOVA 3ACDA 3K20A 4ZVTA 4HVCA 3AH8A 1UXIA 2VF4X 3SC6A 3EGCA 3PXXA 4AKEA 4Q4AB 1KJ9A 3P45A 4EPRA 4A0SA 2XUKA 1MX3A 1NSFA 1IEWA 5CX1B 2Z9CA 2KVSA 3K9LA 1AKVA 1DPFA 4NDNE 4LV5B 2PHZA 4PC6A 4UTRA 2CV1A 2J6IA 2Q8PA 4DDTA 4X20B 1ABBA 1W19A 2XSZA 3BOSA 7ICRA 1GPLA 4UTNA 4QWAA 4NAHA 3DDUA 5L6LB 1NQWA 1QDLB 3ZK8A 1ZJYA 4RVCA 3GJ5A 3OU2A 2JAHA 4CNBA 4X45A 1YRHA 3P19A 3RUIA 2UUOA 3L1UA 3UV7A 3PIIA 1L9KA 4HFRA 2BR0A 1OFUA 4LPSA 1K06A 1HIWA 2MUTB 3Q0EA 1NONA 5B2EA 5AH0A 1EDBA 5CYOA 4C7BA 3I6QA 2J09A 2WHPA 2H2HA 4F2HA 3KXIA 1C3OA 1KOGA 1IB0A 5IMBA 4RD6A 2QLJA 1UEIA 3JQ8B 1MNAA 1V1RA 1AGXA 3NVMB 4D79A 3DMGA 4LFBB 4M0DA 1WP9A 521PA 1G1AA 2X22A 3QEAZ 5BWNA 3DVQX 3WLAA 3RF9A 1A5AB 3UJPA 5BN3B 1VE9A 1XHEA 4HSGA 1CFZA 1JVSA 1DEHA 4NZMA 4GF5A 4WXPA 3IS3A 4W63A 3B36A 5KQRA 2FQQA 1B8VA 3EZFA 5T7BA 4CTNA 2MJLA 3FIUA 3QHQA 5I45A 2OGZA 3L8FA 4QZAA 5BMOA 2F44A 5KYXA 1DGJA 1A8HA 3QBEA 3VR2A 1B15A 5BWMA 3TW8B 3OLVA 3PJDA 4FCTA 4MW1A 1HT3A 4RLQA 2OLJA 1Z3CA 4C8MA 3OJ0A 1LBTA 3S2SA 2M6KA 3CSUA 1Z26A 1OLSA 2OZPA 4XVHA 3FR8A 3GAMA 1JEOA 4LF6B 3TLEA 4ZO6A 2OCIA 5TQ2B 1FYEA 3WSWA 4FB4A 4F6LA 1D2RA 1DPGA 3P0EA 4ZYVA 2ZIVB 1Z8FA 2R66A 1ZVKA 4S0ZA 2BGGA 4FSDA 1HDIA 4HWTA 1T5BA 3K9CA 1CSEE 1D09A 2P41A 2H65A 3AJ8A 9ICRA 2VCYA 2Z6AA 4P2GA 3PQ2A 4MWOA 3WDKA 2P75A 2JAPA 4RPXA 4TMWA 3BJZA 2ZUVA 4H18A 3PNCA 1BXKA 3WE7A 2H4XA 3LVRE 3VC7A 3CONA 3FG9A 2C3PA 5A05A 5JQGA 1P4SA 2V9CA 3COWA 3U19A 5CB1A 4M3NA 3S2YA 1YJBA 3VGPA 1ZU5A 4Q1EA 5CFRA 2HBLA 4PPGA 5CM2Z 3VUFA 3ORSA 4GE3A 2A1JB 1YB2A 4I7EA 1BPBA 2WG1A 3A9CA 4YRBA 2HA6A 3LQQA 4K1XA 1BOOA 1FX0A 5A7FA 3BERA 2IOQA 3FLEA 4D0SA 1VL1A 1TLFA 2EKQA 5TS2A 4NL4H 3GVXA 3DUFB 2C4HA 4Z86A 1SKRA 5FV4A 4O5OA 3UOGA 4FUQA 1YZ6A 4FR0A 4NP6A 4MB0A 3N8GA 3NGXA 2ZJ2A 2A9VA 2J9YB 4K3UA 1NTRA 5EXEA 3GAZA 2NU8A 4IVQA 4LDAA 1X2IA 4OJMX 1GARA 5TQ0B 1L5OA 5EIFA 3AUXA 5LN1A 1HT2E 1WWUA 4PZOA 5JQGF 4H08A 2F4VB 3KJGA 1Z1BA 4TXHA 3V8PA 6GPBA 3LFUA 3C3EA 3MGHA 3W9YA 1QYDA 4TL9A 3UPDA 1D9DA 3D2LA 3VZSA 4U6PA 4XE5A 1IFXA 2AFIA 1D2CA 2W9MA 2HT1A 1U5AA 4YP1A 4G5OA 1G18A 3GRUA 3IV9A 1ISMA 1U5BA 1XGKA 3N0TA 5DHAA 2X9NA 3PJGA 1X9SA 3EQ6A 2H3FA 2JIBA 4L8WB 3RQSA 1NLUA 1OFHA 4UTPA 4RH1A 3A0HU 3ZHXA 3RB0A 2GYVA 3NVKI 5KU1A 4TZTA 2WJYA 4BJ1A 3TEFA 1EWRA 3AIMA 4WINA 4D9HA 2ZIUA 4BP8A 2GOYA 1T10A 3ZHRA 1FYFA 3ACBA 3BDAA 2HBJA 4D9GA 1JDBC 5JG7A 2A7XA 5AW7A 5JSUA 4U2KA 3N2EA 1U9JA 4OVKA 1B2RA 4I2EA 4IDPA 4ZDIA 4O4LF 3O4GA 4PPXA 4KNWA 5KU7A 1KRPA 4I19A 4DA7A 2G4VA 5DX8A 1ZEMA 1MA0A 4AX4A 5DFAA 2IYWA 3VBCA 3RRJA 1WLSA 4NFHA 4KQEA 3KQTA 5JRZA 1HETA 1Y5LA 1T2UA 4LQLA 4V3CA 1S2IA 2M6LA 1E0DA 2L69A 4G8DA 2HDOA 1FUIA 4X90A 4RGYA 4KAAA 3L2OB 3DDZX 2FSVA 2ZGVA 2PZMA 3NHJA 2OCLA 1WPXA 2HD4A 3Q3VA 4LDJA 3AMVA 4CLEA 1ZSVA 1L4NA 5EE3A 4OQFA 3A9VA 1Z34A 3DBLA 1UC5B 4HOYA 3HZZA 5EAIA 3KJQA 4PH5A 3DMNA 1DB3A 1UBFA 5FYDA 1K1QA 4ZTBA 4KQ6A 5JTIA 1Z6AA 1XTVA 3Q3GE 4DEYA 1WDLA 1RBYA 2VDJA 5LVAA 2I6SA 4DDKA 2QMYA 4S1WA 4P7GA 2ZRBA 1NNEA 3PDJA 3DQQA 2AG0A 3F5SA 1VRVA 7ICSA 3S5JA 3IAEA 3CNQS 4JCCA 4OAQA 4DF3A 2OENG 3AVWA 3JQEA 8ICRA 1S1CA 2AGOA 4MQEA 1A4UA 2JDIA 1O6ZA 4JBYA 4H15A 5A1TA 3VKHA 2GCOA 2JGFA 4LUCA 2H08A 3DL4A 3M7DA 3N2KB 3GROA 2H51A 4YCXA 4FYVA 3CISA 3ZCSA 4H7HA 4QQRA 1H8HD 1P31A 1SB8A 3LPCA 1K97A 4N5IX 5T3UA 1HYQA 2QB0B 3E7DA 3RBEA 2ZTSA 2E1FA 2IEZA 1S0NA 2NUTA 1JE1A 1MQ8B 1RSZA 2HYDA 2VP4A 4HDOB 3ABSB 4MW7A 3IKLA 4C3ZA 2X2OA 5M2QA 1THZA 1RBZA 1C0LA 1YU9A 3O6VA 3S81A 2ACKA 3WGQA 4ZAVA 3G0HA 1ZQUA 3MT0A 4BYMA 1V25A 2Z4SA 4GL4A 2A5LA 3K5IA 1Z6XA 1F38A 3TMAA 4JX8A 5D01A 2O8CA 5D49A 2IXBA 2JH9A 1NBEA 2W37A 1EX7A 1EM6A 2PUWA 2JANA 1XRSB 2Z43A 4RVSA 2W55A 4WW0A 3VC3A 2R1ZA 4I4CA 3IMCA 4LFCB 1CUWA 1CUKA 1XD9A 5K7SA 5DASA 4IX9A 2WRZA 4BO2A 3EZ9A 1RAAA 1T6YA 3AC0A 5G3YA 4BN0A 1JSXA 3IBSA 5D5HA 1SQ5A 4OQ4A 2X0JA 1XMPA 1SC9A 2WPDA 1L3BA 2MYTA 2GVDC 3DR3A 2WWVD 3VZPA 3F71A 3CYFA 3RVDA 2WAXA 5DISB 4LF9B 2PMEA 5DB4A 3X1YA 1EVEA 4R1UA 1T6XA 2IIPA 5AK6A 2ZUCA 5DRYA 1D6JA 2RJOA 1ZS9A 1R3DA 1HWYA 4NU5A 3U37A 2Y3IA 2WHEA 4ZTUB 2D8MA 4DL5A 1MNQA 2KP7A 3IUQA 4TTVA 1UK7A 3HCAA 4C4TA 4HZUA 3HJFA 3UGTA 1GL7A 5JXHA 3NONA 2H2WA 3D0RA 4N8DA 4F11A 2HOIA 4YV7A 2WVHA 3B1XA 1X6VA 2RGRA 4EH1A 4EHNA 3IP6A 3OZRA 1QLNA 3CW2C 3KTAB 2VA9A 1E8DA 1KZGB 5ARDA 3WJ2A 9MHTA 1H38A 3VOSA 2DULA 4NLNA 4HUQB 4AW9A 3EEQA 2WTAA 4HX5A 3J80A 1TVKA 3T0IA 3ROMA 3KQOA 1ACLA 3G9XA 4RK0A 3QHPA 4Y9SA 2JLWA 3S8EA 4E5UA 1MN8A 4DBLC 4H7DA 3UUFA 1XEWY 4ZVUA 2XGOA 1ECGA 2X5XA 4CKEB 3FZNA 5B3KA 3IERA 2PS3A 1KP3A 5HF8A 4I2DA 3KLNA 4ECEA 1LH0A 2AD5A 2C92A 5KS2A 3BFPA 4CDMA 3EZ6A 4J7CA 1ZITA 5LZ7A 4QFCA 2P9TA 2BPCA 1T5OA 1KXJA 1TNDA 4MQUA 4US0R 3AF4A 4QZCA 1XVIA 1ZD9A 4JD5A 3OPYB 4BZQA 1U0EA 1T8RA 5EKSA 2JEIA 1WMAA 2HMAA 1U3UA 1E2FA 1XLTA 4RVUA 3GEPA 4O33A 3I01A 5EQTA 1Z5PA 4RUAA 1QPGA 3GIWA 1XNRB 3TAPA 2PT9A 3SU8A 4V0MA 3PDWA 4CI9A 2E0IA 3RVOA 3ELDA 1ZUNB 4BASA 3IN5A 2OUIA 5DWVA 4Z6DA 1G20E 2G5TA 2YV1A 1ODKA 3S2UA 3ZI7A 3EVAA 3AF1A 2QXTA 4ZMSA 1TJ5A 1CUZA 3H4VA 2P77A 4XA8A 5L3SB 4YP5A 3KO8A 3D6JA 5IW8A 4HKTA 1GSHA 5EIHA 1SKBA 5DP1A 3O4VA 1IAQA 1T3SA 3RVPA 2P9YA 1C14A 4AJPA 4HXYA 2DQ4A 1W36B 3GCXA 4JL8A 1UMCA 4XYGA 3T1OA 4MS1B 1EVLA 1CCWA 1F5SA 1NLFA 1E1LA 5IHPA 2UVUA 1EUYA 1OA0A 4TURA 4FS2A 2DKFA 3F6EX 3L82B 4U63A 1US8B 4D25A 3A06A 3W5CA 1S3IA 1PG2A 2D3DA 1KMNA 2CVPA 4IDGA 1NQVA 5FL3A 2YDXA 4FGZA 4QASA 5LLTA 2JJ2A 5JAZA 4C5AA 5IN5A 4WOKA 1E3QA 2GN8A 3RS7A 2J9RA 1JI7A 2C4MA 3SY8A 3IP8A 1KQOA 1JAYA 3KG2A 4PX2A 4W5QA 1G3UA 1QM5A 2VHXA 3DZCA 8ATCA 3OURA 3BGSA 2W9BB 2HLDA 1XEXB 2UXCB 1FVOA 2O3SA 4HWKA 1Y4ZA 5IJAA 4BQSA 1LKZA 5JAPA 1K63A 5E3IA 1AKUA 3QFHA 2IUYA 3FWYA 5M3BA 3VYWA 4CF6A 1XZPA 2XQGA 1E32A 3DPUA 1XXLA 3TVYA 4JLMA 5KC9A 3CB4A 5LCXA 3ZE6A 4N7JA 4AP5A 4YP0A 1SEPA 1A71A 2SHKA 3JQFC 4RFSA 3T3FA 3CZ4A 1I7QB 4OMUA 1U8TA 2CNLA 5IN4A 4OXRA 3TRJA 3ERCA 4RSRA 1COZA 2O6KA 2G28A 2V7BA 5KNBH 1VPWA 3F90A 4QICA 4FC6A 4KW7A 3B5IA 2UUCB 2RBEA 4PO8A 1YBMA 1Q17A 3ZGVA 3H11B 1LZKA 2PLNA 3GGGA 2YVLA 1HK7A 1Z62A 3N2YA 2J0EA 3N2GA 3RU2A 1NP6A 3NWPA 4DDVA 4KN9S 2JH3A 2ODTX 3BMQA 4BJ3A 8ADHA 3MGVA 2P2LA 3G02A 5FI0B 5C31A 1PLKA 4EG5A 3HUEA 8ICBA 2LM1A 1ZCFA 5IJ9B 1A82A 1PZEA 4UEJA 4OIFA 4KSCA 4JZKA 4U9IS 1UBRS 1OYYA 1RYFA 4NC9A 3MUOA 3BH7A 4MITA 1BQ3A 2Z8YM 4EJ6A 2I78A 3A32A 5JU6A 2O2SA 1I3CA 3BBLA 2IHTA 2NV0A 4BVAA 3ZDEA 1W59A 3PTZA 2ZQZA 5IF3A 3ZW9A 1TUBB 1NPDA 1Q5PA 2W2NA 1DBWA 1U8EA 4MKGA 3M6AA 4OXXA 1B26A 2RE8A 1M6HA 2GLUA 2ZB7A 2C9BA 1KI2A 1BVHA 2X2FA 1MHPA 1TU3A 3FYUB 4MUIA 2W6QA 1Z00A 1ZN2A 5DCWA 2QNBA 5GM1A 1T6NA 4TT3D 5G4KA 2NV2B 2QTLA 2ZWIA 2FWBA 1D0VA 1V38A 5KPDA 3L3BA 4G81A 2MR6A 3SOPA 2G8NA 4UOQA 5AVSA 2G9UA 2VUIB 3UC5A 1SWVA 2BJVA 3ASYA 3TVTA 1KAOA 1KHTA 4R1SA 3U0VA 2KNJA 4GZ6A 2G7ZA 1NQOA 1Z0AA 4RC9A 3Q3IA 4IF4A 3RFXA 1SBNE 4JBXA 4LCEA 1Y0BA 4BRZA 2ZB2A 4MV1A 3Q1KA 2FZEA 2Q5IA 1QO7A 4Q9JA 4U4AA 4XR9A 2LDBA 3MLAA 1WULS 4DLPA 2QTZA 3Q5DA 1H6CA 4EB0A 5AW8A 1YMUA 2YKGA 4PAQA 3MTJA 1HEIA 2G36A 4P86A 4GI7A 2EV9A 1C1YA 2GZAA 4MR7A 1M2NA 2LYAA 3D6MA 1WUYA 4IVPA 1EJ2A 3L6DA 1QAOA 4MAFA 2HK7A 2VKQA 4KRGA 4DRXA 1Q1EA 2AG5A 3NAZA 2OO7A 1DBRA 2HLPA 3EDYA 2JGJA 2LBPA 3SIPA 3C8UA 4NJMA 5G5HA 2IHVA 5TV2A 5TEWA 3T1TA 4Y30A 2QU8A 1L4MA 3QXXA 5KVSA 4YQZA 3ZCUA 2CV0A 3FYHA 1QGUB 3OGUA 3PGJA 2BM0A 3TDKA 3VZQA 2YC2C 2RHOA 1VRWA 2ACWA 4M76B 4TROA 1RXCA 1ZGJA 1E66A 2GMWA 2GAAA 4GPTA 5JNVA 3PX2A 1RXEA 3I72A 3IAS1 4HEQA 2YRWA 2JW5A 4DCVA 1DINA 3R6WA 1S7GA 2C98A 3OCXA 2PUBA 3KVYA 3KKPA 3MJTA 5IFLA 2W8KA 3B3FA 2GJAA 3RRYA 4GRIA 1XCJA 2YWCA 4QUBA 1RWPA 3MWFA 2PX4A 2HW8A 1SIUA 4DSAA 1V8BA 1U8FO 1RG6A 1U2PA 4MDEA 3NIDB 4EMTA 4ERXA 8ICTA 2N1BA 1IJEA 4N3NA 3IULA 1IHPA 1EFVA 3V8QA 3B1ZA 4MCJA 4EZ9A 9ICAA 1ZJ4A 2P4QA 4PAMA 1QAQA 4X60A 1R0ZA 2OCKA 1PR0A 1OIWA 4WI1A 1HR0B 2I6UA 1X38A 3IUBA 2CXXA 1ORVA 2I66A 1XD2B 3IX7A 1V7CA 3EC1A 4BWGA 2QP9X 2GJ8A 3DCJA 4XDHA 3MUEA 3N86A 4WE3A 5TVKA 4ITRC 4XUSA 4TLMB 3PUXA 2WD9A 3LGXA 5KFXA 5HKOA 2JLSA 3K2BA 3C8ZA 1L5HB 3VHXA 2N3ZA 2Y9MB 2O8EA 5E9WA 2G5PA 3NORA 3OX4A 2XMBA 3Q2OA 1RP1A 4M8LA 4I3HA 3QFCA 4HR7A 1GQSA 5A5GA 1K89A 5EWGA 4LWQA 3PCTA 3ZWNA 4KPYA 3EJ6A 3TNLA 4AZSA 1R4AA 4Z0TA 1E7MA 4F2DA 1M6NA 3LL4A 4HQNA 2WV7A 3WBBA 4KFSA 3QZ7A 2O0JA 2Q5OA 3I53A 2ZEJA 4RYLA 4WZAE 1DAFA 4Z2YA 1TQ4A 4YY3B 1XZGA 2I67A 1KR2A 1IMJA 4MFFA 2WSLA 3PVZA 4AECA 3ZWQA 4LZJA 3EVFA 3LIPA 2JNWA 1ZC3A 2BFPA 4KPFC 3IDSA 1UK9A 2PCLA 4MWZA 3TI9A 2R25B 1ZGGA 2NX2A 3OCCA 2UVDA 3QM1A 4HVAA 1UQRA 4RENA 4LZDA 1E3IA 1MVLA 3GQBA 1HDEA 1SXJD 3GEBA 3INGA 4GOOD 3K92A 4K4HA 2I2CA 3Q7EA 4RU1A 1N9GA 4KK3A 1KETA 1OFVA 4IQ4A 4H4EA 4O2AA 4QJ4A 5K4AA 5U9CA 5B3LA 3KM0A 1MR3F 5HCUA 1J9ZA 1Z35A 4V1CB 4ZQHA 3RADC 2GXUA 1ESCA 2P7IA 4UBNA 1YQ9A 2IY9A 4CN9A 1G8SA 4B4DA 2LMRA 1MB4A 2H16A 4YMOA 1T24A 4BO3A 5BSEA 1WUDA 5DSZA 4FBMA 1A1VA 3PJRA 4J3NA 4RKWA 4EYKA 2HC9A 3ZUGA 2LGJA 4A0GA 3TAUA 4GC9A 4UBJA 1TA4A 4RYDA 3PHCA 2X3UA 3DZIA 5CIWA 3NH6A 3NIFB 1ISSA 3FUXA 4PG4A 1J8FA 5AW5A 1OU4A 5BOVA 5C9ZA 5K0FA 1EA7A 1IVNA 1I80A 4CMHA 5F1KA 8ICNA 2ZJ6A 3T5AA 1KH2A 3L0IB 4EGJA 2D59A 2I1WA 5KYUB 5KFCA 1AHIA 4E5MA 4KVZA 2ZANA 1QHHB 4J0FA 3WGGA 4UHFA 2QQEA 3GDWA 3CX4A 1WCLA 1DCKA 5FA8A 3IP9A 1I1HA 4XFKA 2FEMA 1SCAA 1MRZA 4UVIA 3RVSA 5AJXA 3NHFA 3BIXA 4P4SB 4GX1A 4N0EA 3I76A 2H4HA 5EHZA 3HBFA 3P9YA 1K3FA 2COUA 1Q77A 4NHOA 4EA6A 5KJFA 4GXIA 2P40A 1ORDA 5CCEA 1Z8HA 3FMFA 2JZCA 2UZ1A 4CL8A 3AP3A 4WFIA 1Q6ZA 1TUIA 2IYTA 1UDWA 1E7WA 2JFOA 1BFUA 4MIYA 3K09C 3NC1C 4BNWA 2ZYWX 4RQAA 1NVUQ 1GTJ1 1YAHA 1Y42X 4OV6B 4JXJA 4QXPA 3I09A 3TL6A 2A7QA 5MDHA 3DJFA 1MHTA 2QDKA 4HH1A 1NV9A 3ER8A 3Q7RA 3G5AA 3ECAA 2XRFA 2HLDD 1F4VA 4HJRA 4BV3A 4D98A 5KG5A 1SL0A 3RT9A 2IPLA 1VL0A 4YASA 2RGWA 2REOA 4EYIB 1Z08A 3JD1A 5JYEA 3Q8KA 1P3JA 5JCPA 3NPAA 4J2OA 5TNXA 1TLLA 2E8OA 2DERA 1U9IA 3DFKA 5BW8A 4RU9A 4J4TA 3KTOA 1V3TA 1KYYA 3BQ7A 2LYHA 3VOBA 1GKUB 8AT1A 1L7PA 3QLUC 5LQSA 4A8TA 2OK7A 3UMGA 1M5TA 1M6YA 1R64A 3SS8A 2QW0X 3HS3A 4WNIA 1XEFA 1IN5A 2GBLC 3CB2A 5KTRA 3ZE7A 3Q8SB 3BTUA 4BFZA 4RQ5A 4J9SA 5SY6A 4IKEA 2FCRA 5T57A 4TL7A 3AJEA 1JDPA 1UR5A 3TEJA 1B8UA 4MRRA 4LZLA 2RGDA 4KDCA 3TLBA 1JI0A 3WDLA 3IAXA 5B4VA 2PX3A 4L8FA 2J3EA 4FE4A 3MLBA 2LCQA 1WMFA 3V7FA 3X2SA 4US8A 4E51A 4C7VA 2J9XB 3FRIA 4V0SA 2JVJA 3EXIA 1XLUA 4YR7A 2PUAA 2GNPA 2W8ZA 3BTSA 4Z4CA 1BX1A 1TCAA 4C7OA 3U80A 5IIIA 2B4AA 4NCHA 1ODLA 2H31A 5JXJA 4S24A 4Q7MB 3P0HA 4HPXB 3U7HB 4XA5A 1Z3EB 4C4ZA 5EJ9A 2XBLA 1FDRA 2OWEA 3BS5A 4DIDA 4DR3B 1FFGA 2BFFA 3PCRB 1NW9B 4NU0A 5I7SA 4EDHA 3E3LA 3QVXA 4PGHA 2ZRJA 1E99A 3D8HA 1YACA 3R9XB 1WOYA 1G38A 4O9MA 1VL6A 4EAAA 3ZYCA 5AUQA 4AZ0A 2R4QA 3KEOA 4NNPA 4O2RA 4A8PA 3AF2A 3KNZA 2FW9A 1LK5A 5K3CA 2C94A 1G4HA 3DOHA 4OHYA 4G36A 1UWVA 2EVWX 3C4JA 4YALA 3SGLA 3CLUD 1H1LB 5HMMA 1E1NA 3K4HA 3EFOB 5KG0A 1V37A 1JYFA 3P9IA 4LGVA 1F12A 1AUXA 1HC7A 4V0NA 1UZAA 2ZR9A 3ZY5A 4M1YA 3AQ4A 5ALFA 4QO8A 4KIJA 3AL0B 1VIAA 1LQTA 2R97A 3LCVB 1VSUA 4DSKA 1CRZA 1EE1A 4AUKA 4TMFA 2PIDA 4KODA 2KG5A 1DT3A 3THWA 2FRDA 1E1RD 4UHJA 3EZGA 4TWAA 1VCIA 1NKTA 1TO2E 5DM4A 5KFGA 2YXLA 1L5FA 1OV6A 4GPZA 3DQZA 4AZ3A 4R4JA 1DFHA 4OG2A 4RNOA 1GGJA 3B5JA 5H59A 2KD1A 3ORRA 5HCNA 4GMGA 4JLVA 4RNNA 2KTQA 3RRXA 3ZY6A 4PG7A 1W93A 4TTRA 1T8WA 4U8GA 2VJKA 2DHDA 1N5DA 5EN4A 4N6OA 5JJIA 2WU3A 1RWWA 2DHQA 4F92B 1KGSA 5DRTA 3SZUA 4JEMA 5JNLA 2XWQA 3CWQA 1DC3A 1Q16A 2HPZA 4BV9A 5KOJB 3ABQB 1IMOA 3C5WP 5DTJA 2PRKA 1L1FA 3BJRA 3NGMA 1DJMA 3VISA 3FPHA 3OETA 3F6SA 2D5LA 2D0PB 2V65A 2XVAA 4P81A 3ZY3A 421PA 1ENYA 4U7TB 1B7GO 1JQAA 5LA6B 3WO0A 1JX6A 2ZTHA 4JLKA 1KK0A 1BCRA 4E03A 1E59A 1JI3A 2Y1LA 4MQFA 2IDJA 3D1JA 4CF7A 4XVQA 3LUCA 1E2GA 4MW9A 1LD3A 4AY4A 3OPNA 1Y37A 2H4JA 3C2LA 4GQAA 1PHRA 4JGIA 1QHIA 1JIQA 3FFWA 3PUYA 3SMQA 3OMWA 1EUZA 3WK6A 4MR8A 1E6UA 1ATZA 1KOLA 1REQB 4ECSA 4FQ8A 1K08A 1XNJA 5TEVA 2BCUA 3KDPA 3NVZA 1NJWA 3DBRA 1DXHA 3LI2A 1W6RA 4P98A 8ICSA 2BJHA 5C8YA 3LAWA 2GARA 5CTJA 3A3NA 3T3NA 3PUWA 1CQIA 2OTCA 3KR0A 2DUNA 3QKSB 1FP1D 4QDXA 3I3SR 2YICA 1R1DA 1WKVA 3Q10A 5ANRB 2BBSA 1LUAA 3CUKA 5CEJA 1WUKS 5D2CA 3VU0A 4C08A 5AVVA 1PJLA 3EH1A 4YAWA 4J0EA 1XAIA 4IGAA 4B4UA 4TUYB 2CB0A 5ULLA 2IPNA 1CXZA 1IPEA 4E46A 1C7JA 3H8MA 5A4AA 4REOA 3DHNA 1M2FA 5SZHB 5G1NA 4OQZA 3USES 2IYPA 2UZ0A 5K4HA 2WAQC 1I6MA 1YJAA 3HP6A 4JJ6A 3MIIA 2F17A 4TTTS 1FRFS 3IRUA 3COPA 2HZBA 4QZBA 4HEJA 3UW1A 4ZGGA 1JPJA 1K66A 2TMKA 4JLAA 5AM0A 3U1VA 2ISCA 3MJEA 1C3LA 2IEYA 4YFYA 5AVYA 1D2GA 1V8OA 2D1SA 4F5OA 2ZVJA 3OOEA 4X8OA 1GCGA 4JXZA 4TV8B 1QYVA 1ZIXA 3EXG1 1Z0SA 3QENA 5A3QA 4EZ6A 1JR3D 2DF4B 1KORA 2QBYB 3PC6A 2EW8A 2GWHA 4U7FA 1N2IA 2V3VA 3MFIA 2HPAA 4M9QA 1S2OA 1SXHA 4DUPA 4IDBA 1NUAA 1SZHA 2IKQA 3IIIA 1WD7A 3IDOA 1L8AA 2B25A 3K1AB 4TRJA 2IYVA 2BTEA 1UAAA 2HHVA 3BE8A 5KTYA 4M0CA 1KWGA 4Y2TA 3T1HB 2R1UA 4FJ1A 1KZ4A 1B1CA 5B6PA 1VKJA 1IN8A 4AFNA 5IM5A 1H8HA 1ZD5A 3EQ2A 3F1KA 1HY3A 2D8CA 2YUIA 3T52A 3ADCA 3MYRA 4CCSA 3SDSA 1XQ6A 4B71A 3PHBE 3WTBA 5IG2A 1C1HA 4ZA2A 1GV0A 4I2IA 3HJTA 1N8NA 1EWTA 3EVDA 3RU9A 4OLHA 1FMJA 1XZAA 1G19A 4BP9A 2XF8A 4AMZA 2ZWOA 2Q28A 4LIPD 4NCXA 2LDXA 3SZOA 1UOPA 4YUVA 4KXLA 1MT3A 1WETA 1V5EA 1S0UA 3EEOA 2ZYGA 1PBTA 4OHPA 1SCNE 4U2CA 2ZYAA 4R40A 4QOSA 5COAA 4DV1B 3UBTA 2WKWA 2CSXA 1M7GA 5I3ZA 4KGZA 3MVEA 4Q3KA 8ICFA 2FWRA 3EULA 5A3JA 4ARZB 1U11A 3W5DA 2GGSA 4LRXA 5DCLA 3GCZA 3R23A 4R64A 3KX2A 1LS6A 2IW1A 3VYSB 1IZ9A 3R09A 3NALA 1DOAA 1U0JA 3E9CA 3WRWA 1DVRA 2HHLA 1N2SA 4QODA 2QZSA 5K4LA 4KTVE 2HIMA 1D1TA 1CY7A 4KLCA 3Q15C 3AYXB 4XUDA 3D6TB 3GLHE 3OIYA 4G07A 1R6TA 3ANTA 4B9AA 3PFGA 5FPYA 2BCGY 2QW8A 4A5OA 4B9SA 3L0SA 3NTLA 4KO8A 3GFPA 4HADA 1U48A 2IZ6A 2O8DB 2YN4A 2AQ4A 1GCOA 2YWRA 4M47A 5KREA 1XJ0A 3D9QX 1P4HA 1HEYA 1X86B 1ZQYA 3CHYA 3EMVA 4EJSA 3L9WA 3H84A 1YC5A 3ROGA 1ZW6A 5LPNA 1C4XA 2VUHB 3I2FA 2EWWA 2P2GA 1I4TD 5BORA 4QT0A 2WJVA 2M2IA 1VBFA 3WK5A 1PK7A 1V4VA 3PT5A 5FKJA 1EZ4A 2OGSA 3MZ0A 2O2CA 4OFWA 4YJHB 3PD1A 3ZD9A 1VP9A 3QJ5A 2I4OA 2RKOA 3T5PA 4CTJA 1ZD3A 3AR9A 2P2CA 3RNLA 2B30A 3ILVA 5KYGA 5BNWA 2HNKA 5DTRA 2W8BA 1PV1A 4Q7QA 3QUBA 5HHHA 4TLAA 4DCTA 5LUAA 2GKOA 4JWNA 2QMHA 4PC2A 5KEIA 3AKYA 4FJ2A 2DG2A 1I2AA 1M8FA 1E4YA 1YT3A 1G3QA 1GGHA 1TIKA 5ADVA 3JZMA 3NEYA 4UBKA 4AN0A 2ALZA 4U6QA 3AEKB 1W4RA 1SN7A 4OP1A 2JRZA 5ALWA 4JVNA 3AQFA 3CLKA 5FWNA 4NENA 1E5QA 3E9QA 4C2AA 1RLOA 2Q3BA 3C2QA 1ZQ1A 1C0EA 1CF9A 3U6KA 3BEDA 2HBRA 5I7RA 4R9SA 4RHCA 2IGTA 5BW4A 1NP3A 2R8PA 4L6IA 3O73A 4AVYA 2VDPB 4XLZA 1WCNA 1TKBA 4GE0A 2XYRA 1PS0A 1PHPA 3EXFA 4CQMD 3ICQB 4X64B 4DAEA 2VR1A 2QT9A 3NYQA 4BDPA 1XF1A 1RAHA 3OY7A 2PUCA 3JYQA 3NPMA 1BS2A 4BQPA 2RBKA 2AQ8A 4ARVA 2VFAA 5AHRA 3QVOA 3S6JA 3RH4A 4RQ0A 1IG3A 3ONWA 5KKAA 3QYFA 4NJEA 2BR4A 1OPXA 1D04A 2EKBA 4BNUA 2WT4A 1POWA 2K5UA 1PD1A 2DAPA 2IDZA 2LP4Y 1WEHA 1HQYE 2CGEA 4A10A 2G6BA 3ILXA 2ORIA 1NZPA 1T3QA 3ILHA 4I1RA 5CBKA 4E4TA 5A9SB 4IRDA 1PR9A 2CMHA 2NZJA 5B7PA 1QGAA 4YN4A 4A8HA 2Z4TA 5KT6A 4DJTA 1E7RA 3LUBA 2OFXA 2ODWA 4HDQB 1HG0A 3DF9A 5BN5A 3UWKA 4AYBC 4NM2A 4U6SA 3UK0A 5HIJA 2FPOA 2HAEA 2OZLB 2DGDA 4MS3A 4YR9A 3NTXA 4P4NA 1GSOA 3F0TA 4O8ZA 1FYWA 3F5DA 3ZVRA 1YONA 2H4YA 3C6QA 3H5IA 4TSKA 1ENZA 1NUUA 3F2CA 4PTLA 5B3JA 1SKYE 1RYBA 1S6YA 2WNSA 5BWCA 1N2XA 4ITUA 1W5TA 1PK1B 1C3VA 3ZU3A 1DRKA 3HEBA 4CRXA 3GJRA 2GLXA 3SYLA 4DT1B 7ICFA 4DM3A 4FEYA 1NKSA 4OQXA 1XOIA 5FO1A 2C5HA 4OHBA 2QUIA 4Q05A 1OXMA 4GDMA 1X7XB 3FTFA 1ZU4A 1Y5IA 4CDGA 1JYSA 2ES6A 1BVRA 2YY5A 2FI1A 2PEYA 5ER9A 2E2WA 1M1NA 5DYTA 1LB2B 5DCUA 2ZTUA 2AX4A 4O4LA 2BMEA 1USUA 2UAGA 3DZBA 3BSFA 4HPJB 3MQFA 5KFHA 3QEJA 5E3JA 5FPQA 2XNJA 5A4IS 5KOHB 4FIDA 4RMJA 5IINA 2DX7A 2XKBA 2JLAA 5J4LA 3Q8RB 4NY8A 4RD3A 2F1IA 3QG5A 2M32A 2FWPA 5DN9A 2NU9A 4WBNB 4H60A 5HF5A 2H2GA 4MDFA 2EX1A 2PH7A 3P97A 1SXDA 2VUTA 2GERA 5K8LA 4B76A 4CLXA 5CCDA 4JHLA 5KYYA 2F55A 4Z4QA 1TCCA 4QZIA 3DT8A 4M86A 5CDFE 3W1VA 1BDJA 4H6XA 4ETMA 2WMDA 4UTVA 4F4IA 2AEFA 3RYIB 2L2QA 4CLOB 4B6QA 3KZ1E 5FUQA 3AI2A 3W7VA 4OLFA 2BC9A 1ZDMA 4A9AA 2NU7B 3KFVA 4UAYA 2G80A 7ICQA 3CQ9A 2I4MA 4BEVA 4A6EA 2JHCA 4QGBA 2JAUA 3L05A 1L3TA 4AJ4A 1I3KA 1Q7BA 5K3BA 3G8YA 4UC0A 1FNBA 4GKBA 3GLSA 4UMFA 3WTCA 1FP2A 3DTTA 5AHXA 3BXFA 1G5IA 4NNJA 4M9XA 3C3XA 1KS2A 2VTDA 1YJ8A 1HI9A 3SYNA 1TX4B 2LI6A 1UA1A 3NJRA 5FWXB 5BSWA 4TT3A 4WJKB 1DEKA 3ENVA 2ZB3A 3RC9A 4B3DA 3SVTA 3O95A 4PPQA 5ALDA 4F56A 3BRQA 5JSKA 2JD0A 3MCAA 5J2AA 3RHFA 4QZ9A 3PNPA 4HDNA 3DLHA 3UJHA 5F7OA 1SV0C 1BE6A 3W4KA 3FUTA 1EB9A 3K05A 4ZVPA 5GJWC 3LZ6A 2F1KA 4B3TB 1N5IA 4G4SP 3QF7A 4MVWA 2BFOA 2J9FA 3EJWA 5G1OA 2HDHA 3I2IA 4EGCB 3KZNA 3B9BA 3E6AA 5ALUA 2C8VA 2LR0A 2FB9A 1TA0A 3K0FA 4NK5A 4PX5A 1SCIA 4C5BA 1Z63A 5EMHA 1I10A 4R0NA 3H65A 5EYPB 1DEOA 3KLPX 2Q2WA 4MQ5A 2BONA 1NRWA 4BO4A 4HPWA 1J9GA 3HDTA 1SAYA 1NMZA 5IZCC 1EFKA 4DXHA 1O6BA 1LZLA 1WHTA 4I4TA 3QMWA 1TTQB 1T9AA 4O59O 4G65A 1NKVA 5KAIU 3PXDA 4IRCA 4DL9A 3OQ6A 3C3BA 2K4HA 3W1WA 2AXQA 3KSMA 3VAZA 4M88A 3HXOA 2VK4A 1C8KA 4PIPA 2CV2A 3AM1A 2XT0A 1I33A 5DLQC 1ISRA 3OFKA 3BRCA 3ITDA 4Z0NA 3T9EA 2NNWB 1ML3A 4HQFA 4L51A 2W83A 1K7YA 2IUSA 4RJIA 2AFHB 2Y0BA 1PWEA 1T9HA 3LPAA 1OQAA 1N61A 4WFKA 3A27A 3PL1A 2PL9A 3O74A 2CF6A 2D1FA 3D3QA 3ET4A 3AESA 1A9ZA 4G86A 3MJRA 3QF4A 4MUKA 3GFRA 7REQA 5REQB 3DEIA 4RD0A 4BMPB 4FFVA 1Z06A 2XE8A 3WL6A 1FLAA 2DPLA 2PFNA 1PU2A 1JSCA 2Y1WA 3DL2A 5JDIA 4LOAA 1ZOIA 5ITZA 3NTOA 1JSLA 4I4TF 4V39A 1SULA 1SUIA 4EIWA 1G5HA 1Q1GA 3TZQA 1J7KA 1QGDA 4K4GA 3AYZB 5KFJA 4AG5A 1EGVB 2IP2A 1X1BA 4HFMA 1IBLB 2MCFA 2RHHA 2XIQA 2E5LB 1OLXB 3QI7A 3N6XA 4OFBA 5HE9A 1W9HA 5J0WA 2ENWA 3MTEA 3KD3A 4G0YA 4RNMA 3ETGA 2AGVA 4DV4B 2CNNA 3RRBA 4AIIA 3B60A 2O4CA 4GKJB 4W5HA 5L4LA 1ESMA 2E55A 3QOWA 4OGLA 8ICQA 1BYIA 2A1TR 3SHTA 2A1UB 3KZCA 3R3WA 2CC2A 4YP3A 4B83A 5AW1A 4JQZA 3G7UA 2ZIGA 1RYYA 3K6KA 4G8JA 4NWIA 3D8UA 1NJZA 3WWOA 4BC1A 3AR7A 1PG0A 1QIIA 2JKZA 2YW2A 4CEIB 5C7IO 5KNCD 3Q9NA 3OQIB 1HDRA 1CF4A 1Q0SA 1USVA 1Z0FA 4PCUA 5CB4A 3IOYA 1TJ3A 5FFFA 4PGQA 5BQOA 3HI6A 4MCAA 5CP2A 2D2EA 1SXJA 1YQTA 2PM8A 4IILA 4UDOA 3GXOA 1XSPA 1AQYA 2XMRA 1PYGA 4AWXA 3RAQA 4EELA 4JQOA 3ASUA 1YO6A 1P2VA 5IP5A 2BKUA 4G1MB 5B7GA 1OH6A 4XLTA 3DM5A 1OXTA 3SAHA 2NQ8A 2Z1DA 2VDKB 1E3SA 4R5MA 4CLRB 3JPNA 3VZDA 4B0OA 4ECVA 4PONA 3CUEF 2IBSA 2HZ7A 2OCBA 1X7YA 2IYLD 5CYGA 2XGQA 1OZ0A 4FYXA 4DLWA 3WC4A 3OE1A 5SZIA 1OT3A 2FMIA 5BSHA 4MH0R 2Q9UA 3SK0A 1M67A 4IGFA 3W8NA 2AMLA 4PZ0A 4AO6A 3LPNA 5AIBA 1NK8A 4MROA 4ZKDA 1NQTA 3HP4A 1GAEO 4FKMA 3EA5A 3ONVA 4C07A 4L07A 2HRZA 5CB4F 2POQX 3WMFA 5I5EA 3WFIA 2DCMA 1SVWA 2O1WA 3A14A 2IYAA 2VTBA 4UDXX 2CNKA 5AT1A 4ZQCB 4M7PA 4AY5A 1P5RA 1X1DA 1O3YA 4DW8A 2ZUDA 2OEHA 2REXB 1QMGA 2XLBA 3K4QA 3Q87B 1DKQA 1HNNA 1QX3A 2BEWB 4QWDA 2KZ3A 4EHIA 3OOSA 4FGKA 1NNUA 3J81A 4A1OA 3E82A 1Z1VA 1FRVA 4EQ6A 2N9UA 5EG5A 5FWYB 1F6DA 3P2MA 3H19A 1U2DC 2G1KA 4BKRA 1R12A 1DSSG 1VFNA 4RK4A 3JAWB 2JFHA 3TUIC 4ARCA 1U98A 4KR9A 1JQDA 1NK5A 4HYKA 4ES6A 4KK4A 3OPVA 4QTXA 4ZCPA 2A5YB 1U2GC 1KRXA 3RJMA 2D06A 2Z6QA 2O3UA 4MIEA 2OCDA 3CKMA 5DNUA 3ACCA 2FR8A 3PNLA 3EPJA 2VBCA 2AKAB 4K26A 5KHLB 1QF6A 2WTXA 1XMVA 4BNDA 2GCIA 3VPXA 5FBRB 1GLGA 1GDTA 4ISCA 2ZSBA 2A59A 3JY6A 3E53A 3DOCA 5FUWA 1R0YA 2GLTA 3FYCA 3UA4A 4RPIA 5LP6C 1N2HA 3H2IA 5MFPA 3DLCA 4GR4A 4AUNA 3AFHA 1L3UA 2IZOA 2EHDA 1R6AA 2EHJA 1BD3A 1TK3A 4RXMA 3WHKA 5GZ3A 4PHTA 3PCXA 1GT91 2H1IA 2EJCA 5HIAA 8ICLA 1GZ3A 3JS5A 1YNOA 5LC1A 2HU7A 1IBKB 1QP4A 3THYB 1T6BY 4BO8A 2C78A 1CDOA 3TQHA 4ALLA 4Z0PA 3OEHD 5BUQA 3DKIA 4AG6A 3HO6A 3HBAA 4QOFA 1MFPA 3JD3A 2GI4A 2B1JA 4BIIA 3E2IA 1QVZA 1AM4D 5MHTA 2RLTA 4QLAA 2Z3VA 3F9RA 2UXBB 4GRAA 4E13A 3DT6A 2FPRA 2PJDA 4Q4HB 4HQ6A 3QKRA 1HT1E 3ESBA 3MJHA 4Y1GA 3I62A 2W4MA 4KRYA 2JHAA 4Y6SA 2I80A 5AFSA 3X1XA 2YXPX 2VF5X 2J6BA 4D5EA 1GLNA 4WVLA 3NRCA 1Z36A 2BI8A 3EY4A 1QH1A 3MMZA 2W90A 4NONA 4OBEA 1B8OA 3ONEA 1Y5NA 4JVOA 4KKXB 3W6PA 2GN0A 3W0LB 1B3RA 4A27A 4BVFA 4EG6A 5EJFA 2NT3A 1VJGA 2QL9A 5FNVA 3T0FA 3CU5A 2V7VA 4B0PA 3VOAA 1ZKDA 4GBGA 2WNIA 4HLDA 2G63A 1ZD2P 4ZZ1A 2XUPA 4GLXA 3WLRA 5LNK6 2FUEA 3H2ZA 1FMLA 3QEBZ 1CDDA 2BSQA 3A6DA 2HSWA 2JVKA 1NXTA 1JEQA 3ANSA 1RHUA 3LO8A 4ZIRA 3EZ7A 1H9BA 1TEVA 2DBVO 1XTIA 4QOGA 1E63A 3IE1A 4BZXA 4MX8A 1PZFA 1KPIA 4C0HA 4II7A 1JALA 3FDFA 4ARAA 1YRAA 1W75A 3OAAA 4F3RA 5BPFA 3PI7A 1E1RA 3MINA 1V2GA 4AAYA 3VC1A 3T94A 5L3VA 4O08A 1Z6TA 4RTSA 4AKTA 2IYSA 3Q8MA 2AN4A 5FNVF 5J43A 1FVXA 5HBRA 2F9LA 2HHQA 2A86A 2COKA 1WPRA 2NTVA 2RGAA 4E5YA 2KKVA 4TSFD 2WAQF 4OO3A 4BDSA 1L5YA 4DL7A 3OQOA 1A1SA 3BMNB 5H80A 2G0NA 1Z38A 4QM6A 2Y0PA 4ERNA 2ZWPA 4BQRA 2PMZC 1P0FA 5EMNA 3HNOA 1LPNA 4D57A 1G7RA 2J08A 1X8LA 2SNIE 5CR0A 4LNUB 3AHFA 1Z0ZA 2NUAB 1R6BX 4HD8A 1UH5A 2FLLA 3U4DA 1U28C 1ESZA 1ORIA 1SB9A 1AY0A 1T0UA 4WGGA 3EBLA 1K1SA 3L1JA 4CIWA 3PITA 4YLYA 5I7WA 1ZUD1 5IEBA 4DWJA 1P5FA 4GZLA 4DF8A 4Z6FA 2X15A 5T67A 4QLBA 5AUOB 3VKGA 5KFOA 1B14A 1UJ5A 3EGDB 5EESA 2KHQA 3IHLA 1HTBA 1JMVA 4A5SA 1O9BA 4GMXA 1CIPA 1KL7A 1NBHA 4URZR 4OJOA 3HVUA 4ZWNA 1NW8A 3AY6A 3V32A 2J67A 1EIWA 4WESA 4BLTA 4UPVA 2JLZA 1U6JA 2IHJA 3U3DA 1QIMA 3N8DA 3M6XA 5BV2P 3FDIA 1PT7A 4UVGA 2X8BA 2OLEA 1DFGA 1U2TA 3WMGA 1F06A 4JI3B 1U1DA 1ZQTA 3LS2A 2CHVA 1NM5A 1N1MA 2CXPA 3W05A 3UK7A 2ZXHA 2VF7A 2PDAA 3C6BA 5B55A 3NVAA 1DU4A 2NO5A