1O03A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 77
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o03A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o03A01
4CNQA 3F9RA 2WM8A 2FI1A 3J7TA 4IFTA 5ALRA 3QUBA 4NFLA 2G07A 4RESA 1AQ6A 3OCVA 4DW8A 4YGYA 4YCNA 3L5KA 2ZBGA 1RKUA 3CNHA 2B1RA 5AW0A 3ZTWA 2ZG6A 3BWVA 3MC1A 3NIWA 2YMPA 3SD7A 4XPZA 1VJ5A 3WKAA 2CFTA 1WR8A 2W4MA 4FFDA 1TA0A 1Q91A 2HSZA 5AICA 1RKQA 3SLRA 3E8MA 4J2TA 3P96A 4GIBA 4AP9A 3WKEA 3FZQA 4KYTA 1ZD3A 5AW8A 4BX0A 2EATA 3SF0A 5AKXA 4OHFA 2NO4A 2HOQA 2I7DA 1WVIA 5IT0A 4C4RA 2JAOA 3ZTYA 2Q4RA 1CR6A 5IS2A 1RMYA 4B6JA 3NANA 4C4SA 1XP5A 2D2VA 4L6AA 4UMFA 2I55A 3WK4A 3L0YA 2JAWA 4UMDA 4Y3UA 1Z5GA 1SU4A 3U19A 2WFAA 1JUDA 5JJBA 4Y2UA 4KNVA 4MUMA 3E81A 3AR8A 5AKKA 4HAIA 5T41A 3NUQA 2YY6A 3U7FB 2JARA 1ZS9A 2HCFA 1RLTA 5ALVA 5AM3A 1YS9A 1Z4JA 2AH5A 2WF5A 3IB6A 1Z4KA 4FE3A 2FPSA 3VAYA 1SWVA 3WGVA 2Q4TA 3QU2A 4FYPA 4AS3A 4Y2QA 5AKGA 3WK6A 3N07A 2G0AA 1ZD2P 3I1YA 2C88A 1N9KA 2OA0A 1YV9A 4BEWA 3PCTA 2B82A 2NYVA 3ZX5A 2WF6A 2OBBA 4CF5A 5AVQA 3L7YA 3GYGA 3W5AA 3QUQA 5AM2A 4E88A 5AHXA 3CZ4A 5AIBA 5AKIA 1MH9A 3U7HB 4BNDA 2BY4A 2IA5A 5AVZA 3ET4A 4JDPA 1U2SA 2ODAA 3I76A 5ALOA 1SWWA 4UW9A 5ALPA 1T9ZA 4HYTA 3QNMA 3AR4A 2G09A 4DFDA 3A1CA 5E0OA 3L1UA 3S6JA 2GMWA 2P9JA 3OPXA 5ALMA 3WK7A 1XVIA 2OM6A 2YJ4A 1ZD4A 3ONNA 4HGOA 4XOUA 1L7MA 3A1DA 3FPBA 2C8LA 4H1WA 5ALNA 4YIHA 3QYPA 4UAVA 3A3YA 4XQ0A 5AW4A 4ZEWA 2HO4A 4UASA 3RFUA 2YBDA 4XE5A 2I54A 1NRWA 1Y8AA 2B8JA 4UU1A 1N8NA 4EZEA 3QUTA 2B1QA 1ZRMA 1WZCA 1U2TA 5ALWA 5ALQA 1L7PA 2PR7A 1EK1A 5AI9A 5ALYA 3ZX4A 5AKEA 2QYHA 5AVYA 4BYGA 2P69A 4Y2SA 2JAUA 3QUCA 1K1EA 3W5DA 3L8GA 4CF3A 2EARA 3E84A 1EK2A 3MN1A 3ZU6A 3QU5A 2ZXEA 3AR3A 2W11A 3NAMA 1PW5A 2ZBDA 2HI0A 3N8GA 4Y2VA 1IWOA 2FPXA 1J8DA 1CQZA 1ZJJA 3ZWKA 2CN1A 4DWOA 2P27A 4NABA 2CFRA 2ZBFA 4EX6A 1Z4NA 2RARA 2AUTA 2AGVA 5AM5A 2IYEA 1Z5UA 3ZWDA 3WK8A 3QXGA 2YN4A 4YH1A 5AVRA 4OFZA 3B9RA 3HLTA 3PGVA 4UAUA 5ALEA 4I9FA 3WGUA 1LVHA 1S2OA 5A3SA 2B30A 2FEAA 1NF2A 5AW7A 4UMEA 3I28A 3UMGA 3FM9A 2FPUA 3QU9A 5AESA 4KNWA 1Z4MA 3M1YA 1ZRNA 5ALZA 2R8YA 1L6RA 5AKHA 5AKZA 5FP0A 2C4NA 2FPWA 2G08A 3L8EA 1RLOA 1VFPA 1Z4IA 5ALXA 1TJ5A 3KDPA 2BDUA 4G63A 3PGLA 1S8OA 5AVVA 5AI8A 5AVUA 3WK5A 2G1AA 3FGOA 4UU0A 5AK6A 2WF8A 4NV0A 3OTQA 4Y2YA 4GXTA 4KN8A 5ALKA 3U7EB 1QQ5A 3R4CA 4NWIA 3N28A 2G80A 5ALIA 5AI0A 2O9JA 1QQ6A 4YCMA 1TJ3A 1VJRA 3N5KA 2WF7A 1RMTA 4J03A 1Q92A 5ALUA 2DQSA 1O08A 1Z4OA 3I6BA 5AI5A 1RPZA 4Y2JA 1TJ4A 3KC2A 5AIAA 2IOFK 1LTQA 3SKXA 2EAUA 4KX5A 3W5CA 5AW3A 2FPRA 5AI4A 4C4TA 2IOFA 4F71A 2WF9A 3DAOA 2X4DA 3K1ZA 1J97A 2B0CA 4O8CA 1U7OA 4NAVA 2B8EA 3AR2A 4DCCA 3HYCA 3TLMA 5ALGA 3U26A 4HGQA 2HEGA 3NALA 3EF1A 1X42A 2AMYA 2W43A 3DV9A 3ED5A 2O2XA 4EEKA 2QLTA 2I6XA 5AVXA 3AR7A 4JB3A 3KD3A 2HF2A 2YJ3A 4Y2RA 3WKBA 3OCXA 3ET5A 2YJ6A 4G9BA 3ZUPA 1RDFA 2GHQA 2GO7A 1U7PA 3UMCA 3L8HA 5AI6A 1Z4PX 1Z88A 2HX1A 4EENA 3OCUA 2NO5A 2ZBEA 4L57A 4UMVA 4ZEXA 2JGAA 3KBBA 3AR5A 3B9BA 3KZXA 3WKCA 3ZVLA 3AR9A 5AW9A 1L7NA 1T5TA 3FVVA 1QQ7A 2YJ5A 4RETA 2RBKA 1F5SA 3PDWA 5ALSA 3QGMA 1RKVA 2I34A 1L8OA 4QQFA 3UM9A 5ALHA 3R09A 4HGRA 4BX2A 3OCWA 2WHEA 3OCYA 2IOHA 3MMZA 1O03A 3SMVA 3N1UA 5AKLA 3QLEA 3EWIA 4IG4A 1YMQA 1FEZA 5AM4A 1QH9A 2PQ0A 3E58A 2BDEA 4BX3A 1KYTA 2HF7A 2OYCA 2YMQA 3M9LA 4BBJA 3ESQA 2RB5A 3SKYA 5AVWA 1YDFA 4UARA 1ZOLA 3U7GA 4Y2TA 1ZD5A 4OD0A 2P11A 3RF6A 2C8KA 5ALJA 4ZEVA 3ZVNA 3MPOA 4AS2A 5AW1A 5AW2A 2YFYA 1L8LA 3ZW7A 3EF0A 5AKJA 4UM7A 4HGNA 5A3RA 2HHLA 2PKEA 4UATA 1YJ5A 1XPJA 3L0BA 5ALLA 2MU1A 3NRJA 4MWOA 2Q5EA 3ESRA 1QYIA 4Y2XA 1RC8A 4OCZA 2GFHA 3NASA 1U02A 1Z4LA 3L0CA 4KX3A 5AK3A 3B8EA 1T5SA 5IT4A 4EX7A 4YCLA 1L7OA 5AK4A 4HGPA 3QU4A 4L6CA 1WPGA 4I9GA 3R9KA 5AM0A 5AM1A 5AW6A 2HDOA 5AW5A 1RLMA 1RQLA 2CFSA 2GHTA 1RRCA 4BNDB 2R8XA 4BEVA 2C9MA 3L1VA 3W5BA 2FUEA 3IRUA 2R8EA 3DDHA 2MU2A 1YNSA 4EELA 2YMLA 3QU7A 3WK9A 3D6JA 5AVTA 2G06A 3EPRA 4UM5A 1RQNA 3ZVMA 3KOOA 3WKDA 4CF4A 3IJ5A 1RMQA 5ALDA 4BKMA 3DNPA 3AR6A 4QJBA 5ALFA 4PNHA 5AK5A 5AVSA 2I33A 3L8FA 5A3QA 3ZI4A 2R8ZA 3BA6A 3A1EA 5AKYA 2VKQA 1TE2A 5ALTA 4F72A 2YMMA 2ZOSA 2FUCA 2MSNA 4Y2PA 4CE6A 3FPSA 2RAVA 3OCZA 1NNLA 3U13A 3SHQA 2FDRA 4YIKA 3QX7A 3UMBA 1Z4QA
chains in the Genus database with same CATH superfamily
2KN7A 1UXJA 3J7TA 4CODB 4HDRB 2FR0A 4ZCQA 4ZYUA 5DE3A 2GSWA 1ADGA 4LC9A 3PHHA 3I2KA 2MHCA 4JHLA 3GIJA 4EM6A 4YJ2A 4XXHA 1PFWA 2CL6X 2OWDA 4R9NA 3BH7A 3T5BA 3I1JA 4JN6B 2NP7A 3EIWA 9LDTA 3A6GA 3VKUA 3F5AA 2IMWP 3OEEA 3ANMA 1P5JA 4C4RA 1RWWA 2VN8A 4G8JA 1WV1A 3OTHA 3FRJA 3L8ZA 4CMJA 1MEEA 3KRTA 3F5FA 2HQBA 4ZVRA 3F6PA 1K7YA 1G4UR 3GLKA 1P4SA 3EZFA 4ESEA 3EEQA 3KKEA 5IYZA 3IE2A 1XRQA 4COKA 1P3Y1 4M7PA 1DJNA 4MKIA 5EJ4A 1GO2A 2WM3A 3R8XA 2O1XA 3L7YA 3MMNA 3SCZA 4TTQA 3TFWA 4YDQA 1M2JA 3SEQA 2J6SA 4D98A 1RS0A 9ICHA 1FRVA 4XRHA 2H9YA 3SSOA 4YVZA 1WMFA 2F1HA 1YE8A 4HVLA 3G2LA 3UG7A 3FCXA 3KLMX 3V34A 5C1DA 2L42A 5L9AA 1KF0A 4BVGA 4KR6A 5F3DA 1CB0A 1Z2EA 1W0JA 1GGMA 4FBMA 4L4YA 4IILA 3ODPA 2ONKA 2WOOA 4NYMR 5CFRA 4BXOA 4F3YA 2PO7A 2A9JA 4B6QA 3ZBQA 2VNIA 4GKBA 5KDOA 2YL2A 5DB9A 4US1R 1E8MA 1ODSA 2VQSA 1A7UA 1E1MA 1Q0HA 3CVYA 3H13A 1ZIDA 3PXAA 3I04M 4KXMA 4NDZA 4FHFA 1THMA 1BX1A 5K45A 2GRJA 4Q7MB 5F1YA 2AJQA 1MXFA 2YN4A 1LV5A 5I9MA 3B9RA 3JYHA 1ZQSA 1M1YE 3NXSA 5A62A 5FR1A 1UBHS 1YI8A 2H17A 3LC0A 3QQ5A 1E1QA 3C6KA 2N46A 1COWA 1C4OA 2OCIA 2EFDB 2FW9A 3OM0A 2FWNA 3L8DA 1UDAA 5FQOA 2OLKA 1ECCA 1NT4A 4O4JB 1SURA 5ERYA 1XEAA 2EX0A 1QKIA 4QUDA 2D1YA 3N58A 4D9IA 3FVQA 3NNSA 2NU8B 4DLYA 3NC4A 2BW0A 5F5XA 1BFKA 3KOMA 3ZGNA 3K4HA 1PLJA 1H9BA 2ZRFA 3ET5A 5IIKA 1YJXA 1NBHA 4IDNA 2Z8YA 2CPRA 4L5AA 3ESAA 2CXTA 3PUJA 1X9IA 5ITZB 1H6DA 3E2EA 3AJ9A 3AR9A 3SPXA 1JAZA 1TF2A 5LMZA 1GVNB 1ZSVA 1AUPA 3RAEC 1E60A 3FETA 1GUBA 4XTCS 1RWOA 5CLGA 4MV8A 5JO9A 1DJOA 1KEPA 4KR0A 4RTOA 3EMDA 1G0NA 4EUKA 4F9TA 5TMEA 3RUFA 4AG5A 3NCHA 8ICQA 2RI1A 3P9PA 4J4HA 5K6TA 1JG1A 3KFVA 1R4AA 3HNOA 2QSYA 3OT1A 1KO4A 3DH0A 4JGGA 1N6RA 5DN6A 4AXBA 5IINA 1J42A 3DDZX 4KMRA 4N1AA 4HNHA 4IIFA 4JC4A 4JXKA 4P9NA 4EYGA 3BCRA 4JT8A 2GDZA 1QWSA 3DDHA 4RZSA 1W36D 2V5AA 3TFRA 1VKOA 2J0EA 3ZIAD 3ND8A 5KQLA 4ENVA 1YGYA 3O8BA 4J1SA 1WDWB 2ANCA 4R2JA 1GL3A 2VF5X 1Y6GA 4R1OA 4RUKA 1R6TA 4DS3A 4DL7A 1NNLA 3FDSA 3INYA 2R6CA 5BV8A 3K1YA 2JFBA 3JPNA 3ZWVA 1ST3A 3BFKA 3C3KA 4BVFA 3TPCA 1VIVA 4HLQB 3BWVA 2PX5A 1NDQA 4MW1A 3D4BA 4AICA 2G1KA 4QZDA 1MEJA 1J25A 4DE5A 3COVA 5CBPA 4GXJA 3KG2A 3E8MA 4Q66C 2VP9A 4NPHA 4BVHA 3U9SA 5DTRA 5CDYA 1QVAA 4D97A 4G86A 1U1IA 5LWHA 2BKEA 3KU1A 4OI0A 4JXXA 1UMBA 2YQEA 4MWEA 1YOVA 3LYSA 2UZAA 2FJ0A 1GYRA 3E81A 2B69A 4HPJB 5HS6A 1P73A 2EZTA 3W7BA 2HCFA 3CY6A 2E7ZA 1ZITA 2CLMB 4LDPA 4LF7B 3MTDA 4PYMA 4Y2QA 4B45A 3RK1A 4HFNA 3LM8A 2Q0ZX 1TF7A 3QFFA 4AC9A 1N7HA 3EFOB 4Y6GB 4NU5A 3Q3JB 1C7FA 4MLCA 2IEAA 1UODA 3QXHA 2HRBA 1L3IA 2AWNA 4G09A 1HDEA 3DDCA 1L7QA 3NZEA 3EEBA 1FXWF 3UANA 1MT3A 1SC3A 1D6SA 5JAIA 4FR5A 2H7VA 5DQGA 2D8AA 3I2IA 4WKPA 2BM8A 2KQUA 1U94A 4HMPA 1T1SA 3LUFA 2YYYA 1Y8AA 4DCPA 1QO0D 4LJKA 2PR7A 2QMHA 3CSSA 2C5FA 1SB9A 2CXQA 3G9QA 5JFTA 1I10A 3AXTA 1N61A 3LY7A 3O95A 3U3OA 1SKRA 5JYDA 5NLLA 1LK7A 3ZKAA 2HYIC 4OH7A 2O7QA 1IPFA 2AFIA 4PG4A 1NW4A 3PEEA 1DC5A 2HCRA 1DK2A 4NENA 2XNHA 1NNI1 5JVDF 2VQFB 2QVBA 2RGDA 3TIVA 1GTRA 5LUBA 4FLFA 4LJAA 1LK5A 2QN8A 2F3QA 3L0OA 6NULA 3TSYA 2GPTA 1NNUA 1N2CA 4E51A 3ITEA 2JGEA 3V1MA 2YV5A 1ZP6A 5EHNA 3DEAA 2NWQA 5H9WA 1QQ5A 2H48A 4TL6A 3K1TA 4UTPA 1ODIA 4DV3B 2FCAA 4K8OA 3TPFA 4JWKA 1XUOA 2ZPAA 1KMNA 3KVNA 2LDXA 5CEEA 1P2SA 1JQJC 4AP5A 2VDJA 2W2KB 1KQFA 2FQYA 3PUHA 4HH4A 1RI5A 3OJXA 2C29D 5IDVA 2ZETA 2XMRA 2FEXA 1E9FA 1TNDA 4FX2A 2FUKA 2EEPA 3GY0A 4C7ZA 3E9EA 1QQTA 1TKDA 5EOZA 3O31A 1TJPB 4LF5B 1EBBA 3LDGA 2VHCA 4QW8A 1PWEA 3D8RA 5IFKA 4PVDA 5KWEA 5ICMA 4TZ6A 1IM5A 4P34A 2F76X 3ZBTA 4W5JA 1QGUB 1WCNA 2NIPA 1CW2B 1OV6A 5FTNA 2GCPA 4AS2A 3SIWA 2IA6A 5LB4A 2IHUA 2X9GA 5JBIA 1NC1A 1FX1A 5LQDA 3IUJA 1CS0B 1FRZA 4HH3C 3DBRB 1NZBA 3OFVA 4C21A 3D8UA 1X2BA 1OLSB 4ED2A 2QN3A 3F73A 3WL3A 4W4TA 3TOSA 1NR1A 4ND8A 4PCAA 4RKEA 5JQWA 5A04A 4RMGA 3LWMA 1T6ZA 3R7LA 2R8XA 2OY0A 3CF4G 1ABEA 4XSHA 2P2YA 4RA6B 5GOTA 2FWJA 5FI0B 2XUIA 3E1SA 4BO6A 1R4MB 2ZM5A 2LDBA 2HGSA 1IXSB 1DZ3A 4DLZA 4CEJA 1GN9A 4I50B 1KW4A 2CVFA 3EE6A 4EB6B 3VVBA 4M98A 2E87A 4U9HS 3LPLA 4FTWA 4Y2PA 3WRXC 5IIMA 4YRKA 4I1UA 3ZD8A 2VXBA 4JJKA 1H9AA 4UVGA 1FUUA 2IBMA 3L5KA 3KQKA 2OSVA 3L3BA 4Q7EA 1W29A 4EGAA 1K8QA 2LR0A 2C0PA 3PXUA 3QXSA 2I76A 4FFDA 4Z3OA 4TV9B 1R9MA 1Q7TA 3REQB 1YVEI 1DO0A 1QGED 4EMUA 4OLHA 1PDVA 1JEAA 4NE9A 1AH2A 3ILSA 1HFWA 4Y9TA 5TQ0B 1U80A 1NQVA 2MAXA 1CR6A 3H75A 1XZGA 4Q9NA 2GEJA 5G1PA 2QMYA 4Z6CA 4Y3UA 5IXSA 2ASEA 3EG9A 1AURA 2G72A 3BERA 1AM4D 3OZXA 4FYYA 1P6XA 2JASA 1ZEMA 1BWRA 4CQMB 3NDIA 4R7TA 4PSVA 3F49S 4E5DA 3W8NA 2DFVA 3ZN2A 3HU1A 4ECWA 2ZDQA 2JFPA 5DMHA 2GZAA 2BV3A 3AUSA 2BM0A 3LOQA 4KH1A 4Q6BA 4GSKA 4EGJA 4DQRA 3MDAA 2QTVB 3AVQA 3VJKA 1IU9A 2CKDA 1H22A 2JFZA 3ZV7A 4Z1MD 1WYGA 1ZXXA 4YJHA 3MWYW 1MHPA 2J7PD 4J2OA 1QPZA 3W6ZA 3HNPA 4A5SA 4ZU3A 4Z7JA 2O5VA 5BSHA 2LGJA 4WX2B 1HDIA 4KQFA 4M1WA 3HFSA 5FLXA 2ZUWA 2RDIA 2V7QD 1POWA 1C7RA 2HZ7A 2OO7A 3D59A 2C42A 1NRJB 3HWWA 4C5CA 2XCLA 4BLTA 3L41A 2EARA 2FW8A 3SHTA 3I9JA 4EL5A 4EPTA 1TGVA 4BFLA 1JKFA 4NABA 3X1KA 3PE3A 3Q5EA 3UXHA 4W9MC 3HG7A 4P82A 2F55A 1BMTA 2IVZA 2PXCA 5J2TA 1FB5A 4EMSA 1U11A 4H7DA 3QKSB 1FLVA 2OGTA 3PO4A 3CONA 5JSFA 3LSYA 5HHTA 3P5SA 3SI8A 2JRCA 1JHZA 1TJNA 1U4SA 4J16A 5KDDA 4DL2A 3CINA 2CSXA 2K87A 2HBRA 1II8B 1UZAA 1ZGCA 3T0IA 4B7UA 3BGOS 3V7KA 1RU3A 2ABWA 3JQQA 1C1DB 5IT5A 1P5FA 3FPCA 1JDPA 5EL0A 4MWZA 1M10A 2I66A 4PU0A 1NVEA 2JJ8A 4ZCRA 1AQYA 1W5FA 4WH0A 1AX9A 2JCGA 5L53A 4FYKA 2BHLA 2IUTA 3D0OA 3GQVA 5KVVA 3WBKA 2E8MA 4EENA 3RHSA 2Q3HA 2UUCB 1RYSA 4YUYA 4EA7A 1J2NA 3O26A 4BIMA 3AR5A 2XBUA 3KHRA 3UK0A 3ZOKA 1EE2A 4ARZB 2X2FA 3V32A 3UM9A 4EUNA 2WU0A 2PAAA 4BTVA 1JILA 2H1WA 1O95D 4AZ3A 3DMRA 1BH6A 2QW8A 4DS4A 3GRPA 3RJ5A 1CUGA 1K9VF 2VXOA 3A4MA 2XB6A 1BN6A 4PZDA 3IHQB 3OPNA 5FWXA 3WAGA 1ZQGA 3GDGA 5AVWA 4NP6A 1JSXA 1E7RA 3RROA 1F2UA 2QTTA 2O23A 2G4CA 2PKEA 4IL6U 3CRMA 3H8VA 2B25A 1RE1A 2VUIB 1NXWA 3UA3A 3NRWA 4UVDA 4F2HA 2A4KA 4OSPA 3MJFA 5J3JA 1LV8A 2N1RA 2JIDA 2BMFA 4J0QA 1E77A 1YOBA 5IKXA 5EEHA 4F2WA 2O3UA 2RGUA 3SR3A 4BWJA 4CKXA 4DWJA 1PGPA 2HBKA 4QDKA 4TN1A 1XXHE 2X2EA 1PG5A 1FSZA 5ENVA 2OCYC 4UQOA 2FG5A 5DBHX 1GYPA 4PIPA 2CXXA 3EOZA 1SVNA 3LVQE 4J8PA 2X8JB 1I1QB 4RMNA 1U2GA 2EP7A 3SHQA 3SF8A 4OQQA 5F9NA 2NADA 1SB8A 2OM2A 5I7AA 4LHVA 1KZ6A 4MRMB 4KG7A 4RQ7A 1Q74A 2E8PA 3FOAA 3QEMA 4JV2A 4NJEB 3K0CC 3SFTA 3U4QA 4MCJA 1ZINA 1NP7A 4K40A 5THQA 4D0GA 3VC2A 4CMKA 4KMSA 1NUSA 3F6RA 4GP6A 2G9VA 1BW9B 5KS2A 1SGGA 2UVPA 4LOJA 5J2AA 4I3GA 3HVJA 4P86A 4M89A 1GPWB 1IRIA 3A9SA 3P52A 2XDYA 5ER9A 2RDJA 3DB1A 3H1GA 1T1JA 4TLDA 1MGOA 2WMNB 3EFBA 1ZD2P 4DTIA 4EKEA 2NYVA 1D9DA 2RGEA 2DR3A 4J6EA 3SP1A 4D57A 3NAGA 1PSZA 4F5PA 3SM9A 2I78A 5FOXA 2BY4A 2DR2A 2QLLA 3O74A 3O4HA 5DHSA 1D5WA 4HADA 2CW5A 1HPLA 1MPXA 4OJNA 2IT1A 2ODNA 4D4MA 1B23P 1CULC 5EVJA 3G0CA 1TI7A 5J0YA 4K4GA 4MP6A 2DHCA 4I2JA 4Q9LA 3FHTA 3WK7A 1MNAA 4IMIB 4H7FA 1JMYA 1PZMA 2BFCA 1Q12A 2H0QA 2Z2YA 3NOOA 1N8NA 7ICFA 3OZ7A 3SYKA 1ZC4A 3AWDA 4UBOA 5I8WA 1HM5A 1M6VB 1YR1A 3RB0A 2QTCA 2CNDA 4X20B 2VT3A 3KYCA 2YWRA 2C9DA 1P29A 1O89A 2O8FB 1FUYB 5E38A 3HA5A 1Q3UA 3E9DA 3INNA 4PTLA 2Z6AA 4GO1A 1NK5A 3LBIA 3OP4A 3AESA 4H31A 2OCAA 3IVCA 1XIVA 1C0KA 3VQTA 4XB2A 2XMSA 2G5HB 4HDNB 3PGVA 1J0XO 4I4CA 4JJIA 4MUHA 4E2YA 1ONBA 1O77A 4KXLA 3OAAD 2K7ZA 1V1MB 3CNEA 1N48A 2IYVA 1TAHA 3SQXA 4C6SA 4J9MA 4MVXA 1AO0A 3AF0A 4KO4S 3QLVA 5BUSA 4NU0A 5DTMA 4AJPA 4M55A 4ZOBA 2HRRA 5BOVA 4R54A 3KE9A 1PV2A 3DBLB 5M04A 1EX7A 2BDPA 4MW4A 2B7BA 4Q3EA 5FHRA 4F6LA 3RQSA 5LD2C 3KJFA 4AL4A 4D99A 5J43A 4I8IA 4DF8A 4XM2A 1EZZA 1EX1A 5REQA 1LX7A 3EIHA 2AG5A 5EWLB 4MVJF 4P4MA 3JY6A 1SQ6A 4RNNA 1PV1A 2O19A 4U0KA 3E70C 2Q0XA 2Z5FA 3MCAA 4UMVA 4FFWA 4GW3A 1Y8RA 5DIZA 5LA6B 5K4LA 5NULA 2CCGA 2ZI4A 1QH1B 3FVVA 4R31A 5A3VA 2DWCA 3RU3A 2GYWA 121PA 1XD2B 4Z7OB 3RNOA 5BW6B 2IH2A 1K3TA 221PA 1JN0A 2BDEA 4JP3A 2WZCA 3M0EA 3G9ZA 3QJYA 2WA2A 4YP1A 1JR6A 2WD7A 2B78A 4CR6A 1WE2A 3IBSA 5F9LA 1KI4A 1Y88A 2NV6A 3TLYA 5TGDA 3EF0A 5EWEA 4Y6RA 1A9TA 3FTNA 1OYYA 1E3MA 1H0HA 2BTEA 3K8ZA 2WA1A 3C8HA 1P31A 3EXHB 3BREA 2KJ5A 5AVKA 1ZICA 4XVHA 1EFLA 4BJQA 1PSWA 4F4IA 5HXAA 3S28A 4ZDWA 4C7YA 5K09A 2QYSA 3C3DA 4PPNA 5AVTA 1RZTA 3G8CA 1MCZA 4M60A 2WFLB 1BFUA 2BGNA 5CYOA 1M1YB 1GFWA 1XTIA 1WCXA 2C4UA 3OOJA 4YAGA 1FDUA 1LBIA 4B7ZA 3K94A 2V7VA 5ALTA 2P2SA 3ETJA 2GYVA 2IPOA 4Z7QB 2BBSA 5H2FU 4CE6A 1J2RA 3S5UA 2NNWB 5LL6P 2VDWB 1JEQB 4NNOA 3JVDA 4YR0A 1VI2A 1EFDN 3EODA 4F4ZA 3RS8A 4KMOA 5HFJA 3OWXA 1YIAA 1LS1A 3CFYA 3GN1A 4OAOA 2K8AA 4JJFA 1O96B 3DV0A 2J0QA 2HPVA 4JUZA 4AJNA 4HYYA 3K2BA 1K6JA 4NQZA 8ICBA 3C2KA 5GZ6A 5B12A 3Q40A 1E96A 5HDQA 1CJSA 1B0ZA 2QORA 5HR5A 3G6VA 4UMFA 4YQZA 9ABPA 1JEDA 4V38A 1MA3A 4U7GA 2REXB 3SYNA 3OURA 1R37A 3CGWA 3JQ8B 3ZIAA 4Z2AA 2O1WA 1N5WA 1QP7A 3NHAA 2ATXA 3NC1C 5TB5A 2Z1DA 4TYNA 1UBKS 2FYTA 3H2GA 4BQPA 3AL0C 2BCRA 2R8JA 1V9SA 5CR0A 1OZFA 3RRZA 3ZKWB 4TXNA 1A1SA 3W5AA 3CLUC 1PHRA 5IJ9A 4A6DA 2A5JA 3B52X 3KL2A 4DF4A 2HNAA 4MWDA 3MFIA 1TCAA 2B34A 2F1KA 2D54A 1B0AA 1GUAA 3U40A 4JV0A 4CRWB 4HYTA 2FVXA 1Z36A 2WHRA 1HT3A 3PC8C 4DN6A 1ZQFA 3VZPA 2H3IA 1KZ4A 1LF0A 3PQ2A 2FMFA 4KXVA 1W88A 5G4KA 1E9VA 3GOHA 3HR8A 4ZQHA 3TUJC 1ZFNA 1V45E 5YASA 2B61A 1T0HB 4BLPA 3I4CA 4E2XA 3H3FA 4MUFA 1KSPA 3D64A 3Q1LA 4DIUA 3FCSB 4EWLA 2ZIUA 2J3KA 1XHFA 4K9QA 4KPGA 1UPTA 2WTMA 3KLBA 3HK2A 4KACA 2YCBA 4IV8A 4YQEA 1UDXA 2G36A 3AT1A 3IVAA 2EG9A 4QGAA 2F43B 3ZHCA 1YRWA 2Q3CA 1XYYA 3EGVA 4YPOA 2XZPA 4MMXB 3ON5A 5I8ZA 5ALKA 2GZDA 5CA0A 3OM9A 5JNTA 4JUIA 5JI3E 4N6NA 1L5YA 4LAFA 5ADWA 1ZA1A 4MF8A 3KSUA 2A0WA 3AM9A 4DSFA 4D0NA 1CPYA 4C22A 2FA9A 4EMBA 3BIJA 3GJZA 2I99A 4DJJA 5KT4A 4HFMA 1NZPA 1HKHA 4UOZA 3AR2A 4ARUA 2FG7C 4LC1A 1NP6A 2C2RA 3PLNA 3UC5A 1KVRA 2QGFA 3GCXA 2GM4A 2FJUA 3ZLUA 1HFKA 4NM2A 3EOBI 1P7DA 2YXBA 2AJDA 1XWWA 1E5LA 4I5IA 3Q0IA 3O90A 3GQBA 3PO5A 3VNQA 2KMLA 5LN1A 3MSCA 2ENWA 2CDCA 1DIBA 1H2YA 1Z0ZA 5LZ4A 1FYFA 5IKOA 3BMQA 1O03A 1CQIB 3N1UA 3EWIA 2F3SA 4IZ6A 3A7DA 3JAWA 1I5OA 4IO0A 4UARA 1JIUA 4TKMA 4NDAA 2ARKA 4E31A 3LE8A 1SXJC 5EJ2A 2JH9A 3NCTA 3RR7A 2ZPTX 1WMAA 5EMHA 2QENA 4A4DA 1G98A 1R0WA 4MR8B 2QRJA 1E9BA 2YTZA 3R7FA 4A3SA 4FWIB 3RF9A 4U2CA 4K4HA 2R1ZA 1L4NA 2XKBA 4B31A 4TTTS 1RYHA 2J41A 2PVSA 3EFEA 2ECKA 4R1NA 3TN7A 2A1TS 2Y05A 4OO3A 3NUZA 2FN4A 4PHEA 3KOZA 1SCQA 3A4LA 4FI3C 2IX3A 1R0YA 3X2EA 2R8ZA 3BA6A 1YS2X 2IXFA 5KFXA 3BE5A 3UJ6A 1E1NA 2P91A 1DQYA 2BONA 4KAJA 2V6GA 2VDQB 1AQ6A 3B8HA 2PUCA 5J2BA 1DAEA 1L1EA 5AW0A 3WOHA 3TL3A 1QGDA 2FN7A 3EIOA 4RDHA 3EARA 1BWPA 1S8AA 4I9NA 4Y0AA 5KQGA 1UDRA 3O4GA 2PXXA 2HXYA 1MAHA 3LUHA 3PRKE 5B7PA 1OXBB 4B1FA 1BTOA 5IXJA 1NG1A 5P21A 5B1DA 4HY3A 1B4DA 3AMVA 5D01A 3TI9A 4CV0A 3QIVA 1Y63A 3THXA 3HYNA 1ABFA 4B09A 1P62B 2CV1A 2R6ZA 3IIIA 2Q0SA 3N87A 2AX4A 4LK2A 1W93A 2LI6A 1PG0A 1UOEA 1O2DA 2V6FA 4QYMA 2Y1GA 2D7CA 3UFXB 4DR5B 2JRZA 4DA7A 4K6HA 3QV1A 2WAXA 1BD3A 1QV9A 1UP6A 1PAUA 1QYRA 1MH9A 2NAFA 1I0ZA 4O4HB 4MMZB 1Q11A 1VG0B 2EERA 2Y67A 3FAKA 3D2BA 4LZZA 3PW0A 5CU7A 4KLZA 4MULA 3V4ZA 2FKAA 4MP3A 2WV9A 4U9IS 3GOQA 2UDPA 1E1DA 4M53A 4D0LB 4MUBA 4MZXA 2HO4A 5JAQA 1K9SA 1ISPA 3RYTC 1HBJA 5AJWA 1SZPA 5E9JA 3MM4A 2E2WA 4PH5A 4RIHA 1S9HA 1H4VB 1EE9A 5LB2A 1EK1A 4ENUA 5P8WA 5EZYB 3AP2A 3K7EA 2B1JA 4HDQB 4PAGA 5KYYA 1M0TA 1AKMA 1K8RA 2CE7A 4ZIRA 4ZPXA 2FEPA 4UBBA 2QYTA 2A92A 1M2VA 3QNWA 2A9FA 2IOQA 4FHGA 4MIYA 4YCJA 3PB3A 5AVJA 3FJYA 1TTQB 3S1AB 2DWPA 2ZJBA 3GA0A 3F0TA 2V6JA 4KIFA 2VHQA 4Z1MA 4F7WA 2FAXA 1EDBA 1T2VA 1O8BA 1ZUIA 2J09A 2J7PA 1Y8QA 3MYRA 3A1UA 5DBBA 4IWNA 3VAZA 2BFEA 2VLBA 1U8CB 2ATIA 1NJ8A 1KZYC 1KI6A 1K06A 4BO1A 3L02A 2OCBA 3RKSA 9ICXA 2V7QA 2RBGA 3MTQA 5G5HA 3IN5A 1Y9AA 3ILYA 1BXGA 1ULSA 4IXWA 3U61B 1PUZA 3DG9A 4G4JA 5EHGA 1KJJA 2OCEA 1AA6A 1U6JA 2XKJE 2ERCA 1D2MA 1YQWA 4UPVA 2WF9A 4NULA 2GHRA 3TDKA 4Q1CA 4F3CA 5DBAA 4KE8A 2Z56A 1WCWA 1HYGA 3N0VA 2H54A 3RJGA 1OROA 2DHRA 3DT8A 2GZ1A 2C7QA 1TTPB 2JGAA 1M72A 1NQAO 3EMBA 4ZOQI 1NBEA 4P38A 2W7OA 5KT2A 4KI0A 4GWLA 1SG6A 1DWPA 3EC7A 1NW5A 1QE3A 4MJ3A 4O2LA 1CUYA 3PXEA 5TEVA 3GEIA 4DKJA 1O57A 1JKXA 5EXSA 1VE7A 2NLOA 4ER7A 4DFJA 1RQXA 1LW6E 2CXPA 1ND6A 4JI6B 2WLSA 5C34B 5JCOA 4G23A 4J9VA 5CAEB 1QYIA 5JIBA 5MGNA 2IITA 1D8TA 3K9FC 4K6KA 2EW8A 3E82A 4TXLA 5FL7D 3WFIA 4PPXA 3HKDA 2ONZA 4MYDA 4QQNA 4TSRA 2ASJA 4ZP1A 1JN3A 1ZX1A 2P1RA 3SS7X 4F5OA 3I9V6 2BL4A 5FNVA 4EEYA 3LECA 3OT5A 2ZBVA 4D3DA 2FR8A 1JXLA 3WYCA 1O95A 4D4GA 5FRDA 4KN9S 2PD6A 1JHVA 5TZVA 2CXUA 4PAOA 5LQAA 3Q72A 1HG1A 3VPGA 2BR4A 4FS8A 2EKQA 4MRSA 1ZQPA 4DMKA 4F5NA 2XQGA 3MC1A 1GGNA 3EY9A 4ITVA 4BGEA 1JG3A 2JFWA 4G3IA 3NYRA 4UJ3A 5FBLB 2ZIVB 1MP0A 4BO4A 1SVLA 4GLLA 4L85A 4I9UA 3U3RA 4BDTA 3ESBA 1MAWA 3PVCA 2XO7A 1YJ8A 4YRDA 3CCCA 2OB1A 4S1TA 2R751 5HYVA 2ZRGA 3KQUA 3SX4A 3KM0A 2VP4A 5CVCA 1AB5A 2DGZA 3KHHA 1X3LA 4ZD6A 4TYYA 1D8AA 3OUUA 2QAIA 3PI6A 3NGDA 4W8OA 3TI0A 1Y1TA 1D3AA 2BGKA 1MH1A 5CFNA 4DQPA 3D31A 3A2NA 4OFBA 1XZEA 1J2UA 4FJ0A 4DANA 2OA0A 5TQ2A 3AI3A 3DFMA 1TEXA 3GT3A 4F56A 5BQFA 1DC8A 2ET6A 5ILOA 3LY5A 5K8CA 2QHXA 2NSDA 2OLJA 3NEAA 1GEGA 5TC4A 1OB2A 4JJ6A 1WCYA 4UW9A 4Z3DA 4PNEA 3H4VA 3EVCA 3MWLA 3H0MB 4JIGA 4KQWA 3PV8A 2F8KA 1QTQA 3WIOA 2X23A 5K03A 1RXWA 1Q6ZA 4LWOA 3UAYA 1K4YA 1ZG3A 3HU2A 4QJFB 1QWOA 4M54A 4R8UA 2E4YA 3N2GA 2WU3A 1QRSA 4MVCA 5C4MA 1XXHB 3V7UA 5H83A 2X0NA 5DM0A 3UXNA 4BWMA 3QU5A 3T9FA 2D7DA 1O0BA 2XT0A 1TFUA 2AIRA 8ADHA 2GPBA 1ZZGA 2QRUA 4ZHQA 3RS9A 1USUA 1EDEA 3LO5A 5ADHA 2XEDA 5C7OO 4HUQA 4OFZA 3GUHA 3R75A 1XTPA 1RVV1 3PWSA 1X7WA 2J0UA 1BS1A 2PFOA 3LWBA 4BVKA 1FFYA 2PH5A 1G60A 3NDPA 3OJ0A 4URHA 3Q7IA 3HZRA 2MMGA 2NYRA 3UB2A 2TMKA 3KAKA 2QTZA 3H3JA 3H9EO 4LXTA 2UXBB 1DWOA 2DWUA 2RHTA 2ZVPX 2C9OA 4HFJA 1BOOA 4J49A 2RHCA 1G5HA 3LXMA 5C46F 1M1NA 4K9MA 3G2OA 2ON6A 4ELTA 1SC1A 3NMUF 4ZI7F 4LS3A 4EK9A 4ND1A 4BBZA 4V3BA 3EBOA 1II9A 2ADOA 2VF4X 2A2ZA 1OI7A 4FQ8A 3MCVA 4MR9B 5F2KA 5KWIA 4YJ3A 1QR2A 1FS5A 3U56A 4M36A 4FFVA 1PL0A 2XD4A 3EF1A 3DUFA 2W43A 1T8PA 4OQNA 1HT0A 1GITA 4EW6A 2W4QA 4AFNA 4AYTA 1ATZA 2ZJAA 1OAAA 4LHEA 3MIZA 2R00A 4FNGA 5KFPA 3GEMA 3W6PA 4D9NA 4Z4FA 4OQEA 5IAGA 2FQ1A 3OAAA 3W6UA 4YQFA 4AN4A 1ZW1A 4BU1A 1KSFX 5CNKA 5JZVA 3BQ2A 5B53A 2OZKA 3AJEA 2H11A 1XCJA 3SV3A 3QLEA 1QRDA 1U7ZA 1KP3A 3FTCA 2ZIEA 4BAUA 5KTNA 4TMTA 4W8HA 1UJ4A 1QFXA 4TUYB 3TTYA 2OZEA 4JODA 9ICGA 5EE5B 1OLOA 4OOEA 3RVNA 2W6PA 4CG3A 4WQMA 3RK4A 1DBSA 4D8UA 2GKGA 5FUVA 1T2UA 1V85A 1Z39A 1S3IA 4HGPA 1W30A 4RLQA 2HDOA 1BKDR 3HVHA 3IEKA 1SD1A 4MNTA 3UV3A 5KYWB 3QU7A 1RIFA 3HCRA 2YZKA 4H6WA 5F12A 3C3WA 2W8BB 3MOSA 4Z6FA 1OSNA 2JHDA 1SL1A 4V1CA 3QP9A 5CVTA 4F12A 1A1VA 3FFBA 5E8JA 1AOXA 3VOBA 5KKAA 7ICMA 4GZ3A 1SVMA 3BB4A 4LJ4A 1ZXIA 2FLWA 1Z45A 4EFMA 3BFXA 1KYIA 2JGDB 4FM9A 1T2CA 3AEYA 4RF5A 4WNAB 2GBPA 2FN9A 2OHFA 3LVWA 2VK1A 4N5LA 5SICE 1GV0A 2GF2A 1M8FA 1AUOA 5DNYB 3U31A 4ENSA 4RA9A 3I83A 2VJLA 3P26A 3G6WA 2QG4A 4EHKA 2PFNA 1WVIA 2C7OA 4KR3A 2YYZA 4IQ4A 5KFUA 4B40A 2QD4A 1NK4A 1STOA 2P35A 1HYQA 5ED0A 4F85A 2AXNA 1A4RA 4EO4A 3AR8A 4C6TB 2AJLI 1Z8DA 5J2IA 2DLCX 4F46A 2V7UA 1C3EA 4US8A 4LF6B 2N1MA 3DXFA 4F92B 3IV6A 2VQ6A 1TM7E 1F1JA 2WAMA 4IZIA 1SRRA 3CKLA 2CL5A 4FC7A 4OI2A 4GI2A 4PYKA 2VJOA 3I76A 2AHOB 4YFYA 3ZDEA 3ZS9A 5FOUA 4DFDA 1YZTA 2OQIA 3E9CA 2AF4C 1QF9A 2CVZA 2PI4A 4W1QA 4Y7CA 1P4HA 4ECTA 3RRHA 3PQ5A 1ORTA 3KVVA 3UWOA 2WUWE 3RRFA 3D3JA 4GVLA 4EABA 3VPXA 3WL6A 3P9QA 3UA4A 4LVSA 2PD4A 3RG8A 2E8OA 1CJBA 4XW2A 3ZU6A 4P4UA 2W6MA 4WXMA 1C30B 5IEJA 2O8VA 4BNZA 1WEKA 4ED0A 4C7OA 1S77D 4H1TA 5BR4A 2AC7A 2E4ZA 1QSGA 5CRIA 1ULAA 4YP0A 2TMDA 2RK6A 2IS2A 5D51S 1BEEA 2P0EA 3N8NA 5L7YA 4G4SP 3MJHA 4GM0A 3TAQA 4KPFC 3LLMA 5AI8A 5EMKA 3BRWD 2PRJA 5DLGA 1IY1A 3ZD7A 7ICVA 2AJCA 4WCFB 5ANRB 4EBEA 1U8YA 1I13A 1WPQA 1LZLA 2OORA 4J43A 4V0OA 1IZ8A 1QRTA 1UK7A 4Q3KA 4ER0A 1Y6JA 2PXIA 1WWUA 3O5AA 4I29A 3BDIA 1NI4B 3Q8WA 821PA 1PEAA 4S35A 2WJGA 1K5HA 4O8CA 3VKVA 1SR8A 3JQCA 3N2LA 1K2VN 3B3FA 4EHIA 4ZCIA 1XFDA 2YWFA 4UCQA 4J94A 1W44A 4KIWA 3CEHA 2ZVJA 4GYWA 4OHUA 3HYLA 3E0XA 1WVMA 1QRRA 4INOA 1KEUA 3I3SR 1P60A 4BFUA 3HO8A 4PCLA 2W8ZA 4MW2A 1IXRA 2Q2OA 5KDLA 3GLGA 2K89A 3ENZA 4UU8A 1JHYA 3WV5A 4Y6QA 2CNKA 2EBUA 3R7WB 2XVTA 1MZVA 2ZJZA 3DMTC 4EF5A 4V2IA 1WAMA 3MUFA 5ES3A 2CXOA 2Q1XA 2MINA 3DMHA 4I4TA 1RG6A 3KEQA 3D4LA 4P8RA 2P11A 3KP1A 2R1VA 1VSVA 5BOMA 1GPMA 3ZW7A 2ZJ1A 1K97A 3BTSA 4YCAA 4JY7A 4F84A 4XFKA 4A91A 1UBEA 3CKMA 4O4LB 3X0DA 1X7ZB 1FFAA 2R6HA 2HDWA 1Z3CA 3IC5A 1G20B 4M0LA 4L6CA 2O52A 3RIMA 1IB6A 3B6MA 1CFJA 3H6GA 2ZYDA 2Q5LA 1ZQEA 1Y6FA 1N77A 5JJIA 1WUYA 2XGGA 2FX5A 1KAEA 1QTIA 4RPZA 3A8TA 3JQGA 4YI5A 4U3JA 2V7BA 2JJYA 1X7XB 2I33A 1R6DA 1NVFA 2YMMA 2R8GA 4ECQA 3TZCA 2XNKA 2QPLA 5BN5A 5F1PA 2B6GA 4CM6A 1X66A 3QLUC 1ONOA 4OOFA 2EEZA 1B3BA 3NGXA 2NSLA 4XFDA 1NWHA 3HGQA 4I55F 2X5XA 1YDMA 1XZKA 1OTHA 2BUAA 5BNFA 4ZAXA 2G77B 3GLTA 1CUWA 4AD8A 2I3DA 1RKQA 1T4CA 5TMBA 3DGFC 4EB0A 3GN2A 1BA2A 2WZBA 4OQ4A 3PSTA 5AJZA 5I5GA 1AS3A 4E12A 4U7DA 2O3QA 3KQYA 1I7DA 1NSFA 4FCWA 1I30A 1KXJA 4Q1DA 4Q3BA 4MVWA 4GXQA 4L9WA 2WMYA 1XQXA 5IWAB 4UHJA 2G9QA 5KFRA 1S5PA 4IHAA 2CZCA 3TECE 4CM4B 2FPSA 2XXBA 1LUAA 1L4BA 2ZR0A 3PENA 4GQIA 2WTBA 5J4YA 1Y3BE 4GI1A 1HE8B 2QNRA 3DZCA 4JI8B 1M2OA 3GMDA 4E4TA 2CMKA 1IBCA 1CNMA 1X8XA 1E0JA 2V59A 4OJTA 2PFQA 2IHVA 1ID8A 3N05A 2VH2A 4QNRA 3SX2A 3MRTA 2J9YB 3UATA 1GU7A 2YQZA 2DPMA 3DLCA 4QC2A 5CVDA 4NCXA 3K32A 1GXSB 3GYBA 4EO9A 1MABB 2AVDA 4EQ6B 5EMJA 2R6R1 4ZEWA 5I8PA 1GGJA 4PGMA 4QXMA 4Q9HA 3F46A 3A70A 3EIQA 4XDYA 5JANA 4QIHA 3PRJA 2V0GA 2QM3A 3NNDA 1KTVA 3VR4D 4ZALA 1EWRA 2NSYA 1B26A 1I4WA 3GK3A 4Y2VA 4KUGA 1G6Q1 4HHEA 2VHEA 2AGVA 3KNZA 4RD6A 1OCEA 2QRMA 1DG9A 3I9NA 2CLOB 2P3QA 5J4VA 4LVOA 2FEAA 2ATEA 5CVEA 5TPZD 3T6KA 4UEWA 3BG5A 3N2NA 3DEKA 1JEYA 2XTZA 1VBMA 5B1IA 2I8AA 1T5LA 2O4CA 4GOMD 3ICOA 5JZ9A 3W5SA 5JJ5A 3IE1A 3SS8A 3TSOA 5BV7A 1RJDA 4FS2A 3SBDA 3EVBA 4WLVA 5CPFA 4A2CA 4TTVA 3M3HA 1G17A 5DTJA 1RMTA 2XQIA 1UFOA 4NEHB 2AG0A 4P36A 3G2IA 3EISA 3D1JA 2AZ4A 3UHOA 1I1NA 4P4TA 1E1CB 4D6PA 2JZBB 4YY3B 3GHHA 4XLLA 1RIIA 4QZIA 1IN1A 1PRYA 4MVJM 2AE2A 5ED4A 4HWKA 5JT1A 4EEKA 3M49A 3RRJA 1FTWA 3KSMA 2ZUEA 1LU9A 2SICE 3OCXA 1ONSA 1VPTA 3K9QO 4DPLA 1XRSB 2O07A 4EG0A 1D2HA 4D02A 1CIJA 4MEXA 2FE4A 7ICNA 3RV3A 4AYBC 2I34A 1E5QA 3AUTA 4QECA 4REMA 1QFYA 5D3MB 2ZKLA 4K6FA 5FH9A 4GQAA 1ZM7A 3R3ZA 3M9OB 3MMZA 4UEJA 4ZFNA 2Y9UA 4ZO4A 4J9QA 1UKEA 5KOHA 4YECA 1I32A 1CUUA 3EGDB 3EK2A 2ZATA 1GD1O 1I2DA 3TZBA 3D4OA 2CHQA 5ALJA 1P7VA 2F3RA 4IF4A 3K0KA 4ZVNA 2JMGA 2ODQA 2QRNA 3Q2KA 1D6MA 3CHYA 2H2DA 3ESRA 3ZLBA 1HZZA 1LBTA 2I2CA 4F4FA 2AOUB 1H0SA 1GU0A 1KO8A 4U2BA 3JPSA 1C7QA 3VPFA 4PYOA 3PNKA 4OTZA 1HTBA 1GRQA 1G291 4YBZA 3LVBA 4IIUA 3W90A 2JGRA 3IIJA 3VO1A 4DG5A 4PCVA 4OQYA 3V1NA 4GS5A 4DM7A 5JS8A 1N1GA 1GADO 3INRA 2GZRA 4H6XA 4BC1A 4X8OA 5FKJA 3A36A 3IULA 3D5TA 2FG6C 4RK1A 1UKYA 3T7TA 1LPNA 4KSCA 4NL9A 4BQSA 4C30A 3IP7A 1R6XA 1X8KA 3E22A 5IUKC 4O4JF 2CLKB 3AG5A 1FLDA 1N60A 5KFAA 3GRRA 3FSEA 4Q1EA 5BV2P 2F64A 3O2JA 1AZWA 2BTQB 1CUSA 4O9MA 1KRPA 4K46A 2G5PA 4MROA 4Y6SA 2I6UA 2OKCA 2VA3A 5HFNA 3W5HA 1C80A 1PL7A 2EH9A 1M66A 4KQJA 5IT0A 4M9UA 4M8IA 1QU3A 4LSZA 1ZNQO 2CMDA 1QX3A 3D7SA 3BWXA 3Q5GA 2V7TA 5FL7A 5F1OA 1YBVA 1TA4A 2C2WA 4G67A 1UFKA 2HJHA 5HJ7A 1U8AA 2IYNA 3U39A 8ICOA 1NJYA 1PK1B 4U9UA 3SM3A 4IDOA 3R8CA 1SMKA 2R7KA 2HMWA 2C0QA 2AR7A 4R2KA 4MLDA 1OT3A 1Z7EA 2OL4A 1WU7A 1PEKE 1TVKB 1ZN8A 5TS2A 4LQ4A 1XZJA 5EIAA 4BNJA 5JALA 4J7XA 4G4GA 2Z3WA 4AJEA 3V6MA 3L0ZA 4YRFA 3KKAC 3B7PA 1CEZA 1XKXA 5A9SB 2J3JA 1NKBA 1A7JA 2G6BA 4DQQA 1AF7A 4XX0A 3S6JA 1B6GA 4ZYXA 2VJCA 2FGKA 3SBXA 1WW8A 1MFPA 4XPIB 4L8GA 3T5KA 3ZCQA 4WSOA 4X24A 4QE3A 2YBDA 3MRSA 5IZCA 1A5SB 4UAYA 2E4AA 2QX9A 3TXAA 1JLSA 3BSYA 3TW4A 2CSUA 3KALA 1SHUX 1KY5A 2Q2NA 1W48A 4TT8A 2WWTA 2RHMA 5B4UA 3TR5A 4G0NA 2V8OA 2R6DA 3OSUA 4B8YA 1AY0A 5KMGA 4NJMA 5JV5A 4TQAA 1J0AA 3IP5A 1MVOA 5TVKA 1JDBB 4LXUA 3NM6B 4ZO9A 1CVIA 3EF3A 3HDTA 2CVOA 4WW0A 5TF0A 4GPIB 4YAUA 3UAWA 4L5JA 3TQFA 5EPOA 3PR4A 3EUAA 9ICVA 2PMCA 4Q12A 1G8KA 1RLOA 5ICGA 1S2GA 2EIXA 1MC5A 1Y1SA 2P7IA 2JANA 5DK4A 2OGUA 5DM70 3RR2A 1TU0A 3AO0B 2H85A 3WMXA 1WY5A 3VYUB 4RL6A 2NSJA 4UOQA 4WOCA 1ZLYA 3A4TA 3WJ7A 3NWEA 2JV3A 3EYZA 1RPZA 3A4YA 2Z5VA 1GSHA 5F76A 2DF8A 3BE4A 1OREA 4YMMA 3N8KA 1E0DA 1LC0A 1L5VA 3BWCA 2AX3A 4QXOA 4TYQA 2X5NA 1N3IA 3ZZ0A 4UHHA 4YMTA 3QX8A 2X0KA 4IJQA 1ZUNB 2GHQA 4ZEXA 1DJPA 4C05A 2YVQA 3AJ8A 3KYJB 2ZI7A 3O8CA 2J9ZB 5CBKA 2I2FA 3SWWA 3MLAA 4JCCA 2BE9A 4H4CA 4AWBA 1NJFA 1RTTA 5I4BA 3P5BA 1GL7A 4RYDA 3JQ6A 1AK2A 1YZFA 3WQQA 1KARA 4GU5A 5ESRA 3MR2A 4CI0B 4UPEA 4H1HA 2WVAA 5KFNA 3PWZA 4EBFA 1V38A 3FYUA 4NEGA 4IDQA 4X6YA 1VI5A 5LZ2A 5KFOA 2Q21A 1YKGA 3EZ9A 2W2TA 3PMLA 3D6NB 1E2NA 4OGKA 5C8DA 3K4QA 521PA 2AN3A 2ORYA 1N6OA 4H3SA 5LBTA 1SD2A 1TU4A 3S4YA 4IRDA 3LBHA 4KN5A 1PR5A 1F3LA 3H5NA 5A2QA 2FP4A 2Q1WA 5AK4A 5JDIA 2J87A 3OPYB 5KFWA 4I4IA 3NS1A 1RLMA 4ECRA 4ECEA 5AK0A 2HJRA 2H2HA 3VAAA 4AWAA 3OLCX 3H05A 2R4TA 2VRBA 2OYRA 5I9NA 1QQAA 2G76A 5DLEA 4CV2A 1J1ZA 4UXJA 5FPQA 3FROA 3L8FA 1J23A 1YCHA 3CW8X 3TTXA 1TJYA 3A1EA 4DSTA 3A0BU 2ZOSA 3QMWA 4L08A 4Q4JA 4RPCA 5EQJB 1GQQA 2SECE 4X3OA 3AQEA 1U0NA 3ADOA 4B74A 3TFOA 2AMFA 3HWX1 2VDUE 1YACA 3QE2A 1KTQA 2QRLA 3WC4A 4DW8A 4KW7A 3SBOA 4DOMA 2PR2A 4YT4A 4XGQA 2GEUA 4MEYA 1QBKC 2HSZA 2DYKA 1XROA 4L0QA 1GNPA 3K9LA 2YJNA 3M83A 5L1IA 3HA2A 2GM3A 1H4QA 4RF4A 1IIPA 3R20A 2WNIA 2FF7A 4M87A 1MHTA 1HTTA 6REQB 4DQUA 1GNSA 4FYPA 3FX2A 5L1LA 2WIKA 2Z9DA 4DSIA 2IYRA 1NXTA 1S0UA 3UJHA 3OE1A 4Y1EA 3RHFA 1OA0A 4BLRA 2R7NA 1X19A 4CV3A 3L4BA 7ICUA 4KUEA 1ESZA 1NE7A 2RGNA 5BW4A 4M1SA 5T8KC 3VISA 1LX6A 3N6VA 1EUCA 2ACVA 2L5YA 4HDOB 4Y9DA 3C1ZA 3WIBA 4O0IA 4NCIA 1S4QA 1Z0JA 3AF4A 4LXIA 4C87A 3TR0A 3W79A 3NTVA 4R8LA 1ZOIA 4I50F 2GF0A 4BYGA 3KJNA 4LDQA 5CFZA 4YMNA 2YIMA 5HTOA 4LDNA 3TZEA 4CIVA 2ZXEA 3AR3A 2PJZA 1PDWA 1W76A 3LWDA 2M2IA 2SBTA 4L16A 3I72A 3NRCA 3NVDA 4HNSA 1SPBS 2CFRA 5H16A 1KP9A 1ACLA 4GKVA 4NH0A 1NJXA 2VTDA 4EUHA 1Y5NA 4TV9F 1ZIYA 4RXMA 1Z6AA 2UVDA 4Z9AA 3BILA 1QTNA 5ITWA 1Q0SA 3EVGA 1QMPA 5IIJA 2FPWA 4KPEC 4MA4A 2I7XA 2IP2A 4BVJA 4W5HA 4UTNA 4MW0A 3EXG1 2OV3A 4PGHA 2G1AA 2NAPA 5KYTA 3R5TA 5D7NA 4E5MA 5KNLA 2E4WA 1EKXA 4RK0A 3FUXA 3EAFA 1K2WA 5ESXA 3BSSA 1JJFA 3FKQA 5KFIA 4IVRA 4KBYA 2CJFA 4ZT3A 1M1ZA 5LKRA 1NLFA 2WAQF 3ECSA 3R76A 1V35A 2GFQA 1GSIA 2DBYA 1XA3A 1P7CA 1Y42X 3HCOA 1CQXA 5CM9C 1EUDB 1UOQA 3KFLA 4JLOA 4BMVA 2G5CA 1NVBA 1MQ3A 4BV2A 4B85A 2PFKA 4RPIA 2QTHA 4XWKA 1PK7A 2GRUA 3DFFA 3E7WA 1QM5A 5ALSA 3NORA 3ONEA 3WY9A 3GRUA 2ACWA 4IIBA 5KNCH 4L27A 1NKSA 4HB2A 1GCIA 3R09A 3X43A 1FXSA 1ZQUA 4MI3A 1Z7GA 2NQ2C 1XG5A 1N0HA 1NUAA 4I36A 2YWBA 3BRWA 1X38A 3GPIA 1T29A 2NTNA 3CT4A 4K9SA 3SN6A 1L5UA 5IM4A 2DB3A 4CHTA 2JH3A 2OUIA 3TLZA 1AQIA 1XMIA 2R6AA 3TFSA 3LKDA 5DBIA 1XV5A 2O7NA 5BR7A 4C80A 3G6YA 1S9FA 1XVUA 2B99A 2Z58A 5H4GA 1OFUA 4JLVA 1IZ7A 3HB0A 3SFVA 3RS5A 3R40A 3QVKA 3A9RA 4F5QA 3IMGA 2WZDA 1R18A 4J9PA 1FW8A 3ABRB 2RAPA 2BKVA 2PZEA 2PGDA 1RXIA 3NPAA 3X3HA 1RBYA 2EZZA 3O0TA 1GPLA 5HM8A 4YLGA 3HUDA 4H7HA 3C1TA 4DSKA 2FZVA 4KHZA 3MTBA 1T4DA 2B0JA 4D79A 5J2HA 1CTQA 3EH1A 3QMVA 1D6JA 3TLJA 4G0ZA 4D4HA 1U1GA 1EZ4A 2K7FA 1KMQA 3NG1A 2ECOA 4FZRA 5FBKA 3ZDYB 4H3VA 2R60A 2PRYA 4AU1A 1W1UA 4CR8A 5IDYA 1HA3A 2KFZA 3B13B 2XGQA 2ZJ7A 3O3CA 3TSZA 2QDKA 3M5DA 4EY4A 2OXRA 3SS9X 1AS0A 2ZULA 1GKKA 2WSSD 4FFBB 1CR0A 4BX0A 2WM2A 1XDUA 1BNOA 4LHZA 4TL8A 2QROA 2A3VA 5DI3A 5AUQA 1WXHA 4HLUC 3COWA 5DDIP 1IWPB 1G20E 2V4RA 1F4VA 3V7LA 4B83A 3TQ1A 4DDHA 3LRXA 3GRZA 4CT4B 4JZYA 4CN8A 2QJFA 4UE6A 1BPYA 3G5LA 4WLEA 4JL8A 2OV2A 4NI5A 2I6GA 1R5OA 1UM9B 4DIBA 1CY4A 4UNPA 1YV9A 3NT5A 5LQSA 2WF6A 4HLNA 1NJGA 1TYCA 3RSOA 4JC0A 1VMEA 5JRTA 3I09A 4MINA 4WFQA 5TT1A 4RTJA 3MINB 3TCNA 2QRVA 4RZXA 3UT5B 4DUZB 1K68A 5C80A 2IS6A 5E1OA 5GM2A 3RRGA 4L07A 2RE8A 2A19A 3RAFC 2FPLA 4BB0A 1W73A 4FLEA 1WCIA 4MKHA 1WDKA 2VBCA 4QWWA 2EQYA 2H5LA 1V48A 3DKKA 1WV0A 1H2WA 4AJ1A 1Z2NX 2PT7A 5MN4A 1XTTA 3MUNA 4BPRA 4U6QA 1Z5ZA 1WZCA 4HEA6 4HJRA 2W9CA 1WLYA 2C2BA 1RYNA 2JAUA 1SH7A 1L5GB 4ON9A 1NHGA 2DKNA 2HQRA 4K9RA 4FS1A 1OWNA 4G0OA 3H1BA 3GVXA 3HXLA 2YCLA 1ZGAA 2H2AA 2ZUBA 3G2PA 4IQUA 4L9RA 3W2EA 2IYEA 2GRAA 4KWCA 3IVXA 5FPTA 5JSZA 5I7VA 5FBRB 1Q1NA 1MOQA 4O59O 4WD3A 1PT8A 4QG7A 3I28A 2XWBF 1LDNA 3A3KA 3W04A 5GTHU 2OD7A 4D81A 1KFCB 1RYFA 4XDHA 3OLVA 1K8ZB 3PX0A 1B6TA 2VBIA 1L9XA 3NEYA 1QGZA 1H1TA 2AFHE 2D1TA 5C2JB 4RD3A 2HBQA 3M4ZA 1DOZA 5A0VA 1RADA 3MBKA 4KFCA 4W5QA 1QH8A 3VKHA 3NAQA 4FNMA 3LK6A 3K5IA 4PYJA 2ZWOA 4NPAA 5IW8A 5B7NA 1UHUA 2Y3IA 1AHIA 4V0MA 3VTFA 3DZGA 1NVKA 3VR4A 3EMKA 4JEHA 3MB5A 4I7EA 1FU8A 1IMJA 3UJCA 4DAOA 1UKCA 2BN4A 5TLSA 3BVPA 3KXIA 1EG2A 2AQ8A 2RH9B 3ORFA 1NY6A 3SJ7A 4DC0A 3ZYZA 4QGFA 4CTNA 4P81A 2HIMA 2FSFA 3IIMA 5TPZA 3FKSD 5DFAA 4X64B 1ID1A 1ZA2A 4Q19A 3AHEA 3OCYA 5A6SA 1P3JA 1NOKA 3NBQA 4XAQA 5BNTA 2NZ8A 2W9BB 1ZCBA 1E5TA 3F7TA 4ROTA 4AP6A 3EPGA 1DHTA 1C8KA 2C8KA 1UC5B 1PG2A 1XF9A 1YNOA 5H59A 2X5JO 4AJOA 3UMVA 3NT4A 2H3VA 1T9KA 1XDSA 4OA8A 2YV1A 5KVAA 3BSFA 4AW9A 4IHJA 5IT4A 4JYPA 5CA7A 3L4KA 1KMMA 4PHHA 1P7PA 5J8YC 1D07A 2QTFA 3EZ6A 1DEOA 2JLCA 1LKZA 4TXHA 1IXKA 4P80A 4NU8X 3GPBA 4ECSA 4F5YA 7GPBA 2J9FA 2QAGA 1P1CA 4GYKA 2G06A 3F78A 2IEYA 2WHXA 1UBMS 3ISDA 4YAOA 1WZEA 3OJCA 2ZRNA 1GL9B 5A7FA 3B70A 5IN4A 3JQPA 1Z63A 2YB4A 5E1DA 4N5MA 5C8YB 1NK6A 3K05A 4A8HA 3LFUA 3OM1A 4E11A 4OI4A 2HPHA 3HCNA 1YJQA 2R62A 1T8UA 1MUUA 1T5BA 5J4LA 4PPYA 1LDGA 2PT5A 2WQ6A 4MS1B 1V4VA 5K3DA 2C92A 7ICRA 1GPNA 2IPAB 9ICEA 1S5LU 3TJMA 5EKXA 4ELUA 4UUBA 4F5DA 5JASA 5LA6F 4KBFA 4X54A 1J9EA 4JWTA 4A8JA 1BROA 2VZEA 1MPTA 3T5LA 1NVAA 4QDOA 4UM8B 3X1YA 3L0YA 2ALZA 1YZNA 4ZVTA 4KNVA 3U3ZA 4XTRA 3EGOA 4MHOA 3FNQA 2OGWA 5GJWC 2R8PA 5B3JA 5EJIA 2NT4A 4R65A 4BZQA 2YX1A 3L4PA 1YRAA 3CRNA 4RTKA 4XR9A 2VUTA 1OTYA 1SCAA 1PZXA 4IX9A 1BX0A 2O0LA 4LJ7A 3WMEA 1F0MA 2A1TR 2X8AA 4U2KA 5GZ3A 4TT3D 2OAEA 4YUAA 2E5WA 1NV9A 1ZUD1 3N39C 4WV3A 1PWXA 5D8DA 4R8MA 1IBRA 4WKCA 3SYMA 1KNXA 3MHTA 3MTJA 5JSYA 3ZCPA 3FPBA 4RLHA 3CBGA 2LTAA 5TQJA 1RJFA 1EGAA 3Q98A 1NBWB 3M6XA 4UB8U 2GCGA 1JSLA 5JNRA 1CLUA 1P0QA 2ZUVA 3MGHA 3KTAB 2NN3C 1M7GA 3E3AA 5ALYA 4TLMB 2JLXA 2Y0BA 1M74A 2AMJA 4A1FA 3WMWA 1UK9A 5IKMA 2N3ZA 1L6NA 4E32A 5JJLA 1ZJJA 1NYQA 2HK8A 4H3KB 4FFLA 1WU8A 4B5KA 3UWSA 1JVNA 1N9ZA 3BN3A 1CF2O 1B0XA 3AJAA 5KG0A 3ZWYA 4ZOHC 5H02A 2CXHA 3QMMA 3HBFA 2A67A 1GTVA 5KFEA 1E9DA 5A3SA 2BZSA 2OMEA 2FPUA 2XA9A 4N65A 4F7DA 3H5OA 1FYEA 4KODA 4GX5A 1HUOA 1VG9B 1COZA 2BPGA 3GLSA 2VP6A 2Q8NA 4LRTB 2Z2KA 2C8JA 4ZDIA 3BFJA 3ZW8A 1BJRE 3TG8A 3KYDA 1CDZA 2ZRCA 1XCLA 3ZQUA 2VTBB 5KUTA 2EAUA 4YP5A 3V6KA 1XRJA 1SXEA 3UK6A 1NSYA 1XU4A 1OASA 1WS6A 3UWKA 3U5ZB 4E09A 3PGA1 5BN4A 4H0FA 4OIFA 3BX1A 4LE2A 3PHJA 5HQ3A 5JDCC 3ZWCA 2PGXA 3WXBA 2XTJA 3IUEA 4FKMA 2JFQA 2QL7A 1SCUA 3FBTA 3K2EA 3B9BA 1U2EA 4N12A 3BJMA 1FJ2A 3OC6A 3VVCA 3O6VA 3TKLA 2UKDA 5LDHA 3UJAA 4DHEA 1EVZA 2EZXA 1X1RA 4O5CA 2QAJA 4L95C 3F8SA 3LDUA 1MIOB 3BXFA 3MERA 1RAGA 1MQ8B 3RB4A 4G36A 3GPDG 2GNOA 3G9TA 1DOAA 4G0YA 4ECUA 2CBXA 3PFIA 4ZMBA 2M6RA 1JAXA 1GNTA 4Y30A 2QSJA 1EJ2A 1U8XX 2P1DA 4UBCA 1V39A 1N57A 4M1QA 1FU7A 3MWJA 4JQCA 1FDWA 1RI3A 3C39A 4FT2A 1U90A 4IVPA 4LOIA 1Z34A 1IUPA 3E15A 4MX8A 4UVEA 4M7RA 1LQ2A 1CZUA 4DT1B 4O2AA 3OIUA 4KRYA 3TSWA 4YG2A 1GCOA 5DCLA 3ID6C 5E6UB 2OOSA 1OH6A 4FXPA 1IHUA 3FAHA 3DD5A 1QYCA 1CE8A 4EJSB 4MWBA 1Y3DE 3O3NB 2ORVA 3QW2A 4NVRA 1Y98A 4P7FA 4DCJA 1SY7A 5HF6A 1KDTA 3FE2A 1UC8A 1W581 2A14A 3G0IA 2YHSA 4XPZA 2O5EA 5B64A 3JTEA 4RQ3A 2H4YA 2ZYGA 2CLIB 1AK1A 5ECYA 2O0KA 1R6BX 5DNEA 7ICHA 1SU6A 5CJPA 1VG1A 1BWSA 2FOIA 4XZ3A 2AOWA 2ZSAA 1LPBB 5K4GA 1CR1A 4C1BA 4DYHA 1U5BB 3NBYC 2AEFA 4S24A 9MHTA 4PBSA 3WNVA 4BZXA 3U7QA 1DQPA 4QXAA 2EHDA 3GBVA 1AXEA 1T3SA 4AXXA 2NU9A 2W54A 3ZEAA 3UICA 1SK8A 1RAFA 5JTIA 1NN0A 1F9AA 2V7PA 5BWMA 2XGOA 1XZBA 4F4XA 2ODAA 5JWHA 1WM1A 5C32A 1FFXA 4PXAA 2OBXA 4LNUA 3WNCA 1JFRA 1VBKA 2YXPX 3P2IA 5H3HA 2IF0A 3ZLJA 4Z6EA 4QWBA 2YICA 1JVBA 2RK3A 1JTFA 2UVWA 3F6EX 4HLCA 1LWOA 4R2MA 3VHRA 1ZM3A 3PX4A 3RTGA 3GILA 2KZZA 3MSXA 2IJGX 4PSUA 3JX9A 5CJ7A 2HHXA 1LJUA 4MS4A 1A8PA 4A8EA 1DHRA 3BRCA 2OCLA 4P32A 1Q95A 1PZHA 2P77A 1PJCA 2FVYA 1ZQ1C 1QBGA 5J2GA 2P27A 2JHAA 5T64A 5DM1A 3LBYA 4EX6A 5ERXA 2EBHX 3FIUA 2N47A 4YH1A 5JS6A 4DL9A 1VA4A 4UM9B 2BGTA 1F20A 4GP7A 4R6WA 2PQMA 2WT9A 3EUEA 1NQXA 2ZTCA 3HT3A 1XSLA 4DUPA 1K7XB 2JVKA 2EAPA 3WK5A 1V16A 3KJEA 4GT1A 3CWCA 1V3QE 3QVUA 3RBVA 4A16A 5TGZA 1R16A 1U2ZA 3PX2A 1J00A 1ZVJA 1XCGB 5IJAA 4RNDB 2AFRA 5DDMA 4DSUA 2AL7A 3P2EA 2A9VA 2AOXA 2JR5A 3QVMA 3ZE0B 1GWNA 3ZQJA 3CYFA 1CY2A 3EVAA 2LYAA 4XIYA 5C81A 2VG8A 3NTQA 3OQIA 2JB9A 1KFSA 3ACBA 5MHTA 1UEXC 3HU5A 1TA9A 1WTAA 2E4XA 1E6EA 1T5OA 3SU8A 2HMVA 4KPUB 4O4HF 1WF3A 1DSSG 4OP2A 2XCTB 2PN1A 2GCOA 1C3XA 3DKIA 4WLFA 5THKA 3FI0A 3TR6A 3MLBA 2X5OA 5FEMA 5B3LA 2FPKA 1L7BA 3DOCA 5TSDA 1T25A 3DBOB 1FYXA 1G8YA 2BP7B 3NBUA 4C5AA 1PQ4A 4K9NA 3T5TA 2AU0A 3RE1A 4KQKA 1ESEA 4B17A 1QFJA 1BKSB 4MWGA 4JJEA 2FWPA 4DCOA 4ZCTA 4IR9A 5C7IO 1SV0C 5EZYF 4Q00A 2X2OA 4P0QA 2VRWA 5IIIA 1X7HA 3KZMA 4Y6LA 4A7PA 1IM4A 3B3QA 3BYZA 4F2PA 1BS9A 1JRPA 2AQIA 3G3EA 3GLFA 1NSTA 3N97B 4CJXA 1FFWA 3CRQA 3TQOA 1G8SA 1CUAA 3IJPA 2APJA 1XNJA 4KWEA 1TKRA 1N6IA 2X40A 2DM6A 5AW6A 5EFOA 3UTCA 2WR8A 4QDJA 3ESXA 4BPBA 4OXXA 1CX9B 2BE7A 1WHTA 3LO8A 2N1BA 4MYHA 3ASZA 4JVOA 3KPVA 3PXGA 3M6VA 3KEGA 1V96A 2DUJA 2YOFA 2BFMA 4J7CA 3SQOA 2OYSA 2GQ0A 1J09A 1VIMA 4ER5A 3ELUA 3KZCA 4URFA 4N41A 4XWYA 3PI7A 2WWWA 1JMKC 3OIFA 5DP2A 2NXEA 4TSKA 1T0IA 4PGAA 3VDMA 5IG2A 3QEAZ 2X4IA 4M2YA 4BE9A 1M2FA 1OXTA 1A9XB 5FHQA 1CRLA 1F2TA 4LKOA 3QSYA 2Q1SA 3FMIA 1JDSA 2P6PA 4R1TA 5LP6A 4MUYA 3QVLA 3LVRE 2NO4A 5CYGA 1GLVA 2PKCA 1QHXA 5DW3A 3PU6A 1OW3B 2RIRA 2YN2A 3DWEX 5DHFA 1W96A 2POCA 4UBKA 2G4VA 3CS3A 1N33B 4IAOA 1GNLA 4QZ9A 3UJ9A 1IUNA 1RXEA 1B8NA 3PZRA 1R88A 1CEYA 1WTCA 1E61A 1KWKA 5FPHA 3GZFA 2QBYA 2QUBA 3IAS6 2HA7A 3TUZC 4EI8A 2H0AA 2IQ5A 1PNQA 3L6DA 2B35A 5LDDC 1LKYA 1DIGA 3AVVA 4B3MB 5EYPA 7ICGA 3NM5A 3PE6A 2VEDA 3SY8A 3O73A 4KLQA 5J2EA 1FP4B 2J59A 1D6NA 1HC7A 1X40A 4MR7B 3FTEA 5I51A 4BIIA 3FPKA 4BN4A 4P5EA 4EA8A 1SKAA 1CF4A 1DARA 4NJOA 2DERA 4B71A 3SQMA 1SHTX 2BI4A 2WSSA 3HMKA 2Q3BA 1J8MF 3QYFA 1E3LA 2JZOA 3ZC3A 4QJ4A 3RFUA 1O94C 3GJ4A 1ZMOA 3COJA 4EPXA 1FC0A 7MHTA 4LTNA 3UPTA 2H52A 1ZRMA 3N6RA 3PFFA 4GE0A 2C94A 4B84A 2JIQA 3KR1A 1YR9A 4P22A 1EK2A 1W5BA 3BJIC 4E1VA 4YB8A 5JD3A 2V5VA 1YXMA 3O1LA 1SA0A 3WLMA 1YB4A 4QUGA 1PX0A 1JI3A 4CCSA 4EVSA 1XDGA 4NOJA 1SM4A 2GEBA 4M76B 3F3SA 4R9VA 2J33A 3L7IA 5FUQA 1F0PA 4WZAA 4HBGA 4G0MA 1ZSYA 1MTOA 1OYWA 2HQSA 3MHPA 3FVTA 5I7SA 4UAUA 4EGSA 4TM7A 5CHGA 3U44B 3P0RA 5TR9A 3HEMA 3AHHA 3QU9A 5AESA 3LHDA 2GK6A 5J0TA 4PVCA 1L5SA 4XWAA 3WLSA 1ADCA 1E4EB 3J7AC 1YZUA 3AVOA 3HRHA 2BCUA 1E1KA 3M7IA 1OC4A 1M8KA 4GRIA 3CH6A 3O8RA 4EEZA 3ONWA 1W85B 1U2RA 4CW7A 1LI7A 1PNVA 3JQEA 2NUTB 1Y9DA 1KC1A 3S68A 3PXDA 3E35A 3EIFA 1M2KA 7MDHA 1WD7A 2ZS7A 4LRSB 2B0CA 1Q84A 1DRGA 2DU8A 4DLBA 1EEXB 2VCHA 5SYMA 3QHPA 4ALNA 3AM1A 1F8FA 3PRYA 2DQKA 4X85A 4G8DA 4AS1A 3FPGA 2NXNA 1DPGA 3DCNA 1WUIS 3IR7A 5KYNA 4RETA 4V3CA 2BGUA 4AJHA 4HWRA 4ZK2A 1BPXA 3WLQA 4P4LA 1QU2A 2PLAA 3T95A 4B4OA 3BZBA 4JLDA 4YEDA 4E3WA 4OP3A 2KBEA 4KLLA 1A97A 3ZHZA 3K70C 2GN0A 2ZR8A 5T4FA 2QW1A 3FNHA 3P32A 1IHDA 2VQ3A 2ONYA 3KS9A 1MJFA 4UM7A 5H4HA 4KXXA 2H16A 1W8IA 4KTVE 1L8XA 1NF8A 3W9UA 5B2FA 4C7BA 4DDKA 3PPIA 4KOEC 4AQ7A 3ROPA 3G7SA 3QA9A 3A0HU 4IS3A 5DNDA 1E3IA 1MQSA 1DQSA 2EGUA 3D2CA 2IYXA 1AN9A 4QUBA 4RF2A 4G5HA 4Q44A 3WSVA 1SVOA 3PSHA 1ODTC 4W82A 5E6SA 3FKSA 5E7MA 2VJBA 2ZBQA 2FRDC 3H86A 5C18A 4OQMA 2AFHB 4ZMSA 3U13A 3R7NA 2BBOA 3UJDA 4B3HA 4DOCA 3RC3A 5L3QB 5UKDA 4UE2A 3M6KA 2D4HA 3MWDB 4N4AA 3KT8A 1IXZA 3AINA 4I6GA 3K2IA 3DLBA 4CKZA 4DR7B 1DIHA 1QSSA 4GG1A 1PD1A 1JL3A 1NV8A 2R7AA 1C29B 4DCGA 4N6GA 4O33A 5BURA 3K1AA 3E9QA 3UJBA 4RS3A 5COQA 3NQ41 4ZAGA 1U81A 4X7BA 3IOMA 1A8SA 16PKA 3LBFA 1G8GA 5DI9A 1B7GO 3STWA 4K6GA 1PLKA 1FNMA 1Y9JA 4IZHA 4E4RA 5JJBA 3ASYA 3ZHQA 3B0XA 5B7QA 3KOUA 4M38A 1T5HX 2R68A 4Q21A 5JTUA 3WK6A 3KJGA 3LQ4A 2PXAA 3LZDA 2H07A 4TUYF 4TMXA 1GUDA 3ENWA 2O8DB 3AEUB 3HCAA 3ZU5A 2XJ4A 5FLYA 1N8TA 3KIPA 3TLGB 4FR2A 2H1RA 4LDJA 2R8OA 7REQB 5IF3A 1YCDA 3FPFA 4XDZA 4DUGD 1RWVA 5LQKA 2E21A 3GZJA 4DXAA 3GAMA 4GI3A 2QXUA 3F4LA 4YYZA 3PQDA 3B2EA 3QRWA 2HL6A 1LB2B 1BX3A 3QPAA 4FJ2A 3MK31 2I4NA 3Q8QB 1M0SA 3F1LA 3OQ1A 4R2XA 4UASA 4XE5A 1TKBA 4EJ6A 2Q5QA 3U4MA 4EZEA 1V6CA 2Q5OA 3CW2C 1EHYA 1V7CA 4FQ7A 4G01B 1NBOA 2PUJA 4RS4A 2XA1A 3OSZA 4HNVA 2JK0A 4LJ9A 4NL4H 1VTKA 1AJEA 1RJ9B 3HJEA 4EZ9A 4CTJA 1XZCA 1RLJA 2WIBA 1H2EA 2KP7A 1NG9A 1CQZA 2GWSA 3FTPA 3HJAA 1MAVA 4U4AA 3LUDA 1J4AA 5J0XA 3PR1A 1F17A 2VJMA 4C88A 4CNBA 4HNAB 1PFGA 4TT3A 2E89A 2Z6UA 3OP1A 3WGIA 3TIIA 3EPKA 1Q6YA 4ZREA 2NVUB 3FOFC 1JSRA 2IW3A 1TYEB 3L8EA 4B6RA 3TMAA 3BB1A 2HSWA 2FLNA 3QMPA 3EQ2A 3CWZA 4NWIA 3QEJA 4BJHB 3H17A 3T8YA 5AI0A 3LUCA 1E0AA 1DIAA 5DP1A 1Y3CE 2P79A 3WIDA 4EECA 8ICGA 1V7QA 1L1RA 3BMXA 2FLLA 2SCUB 2NUAA 4PLHA 3NBFA 3CNNA 5CLJA 3CLTD 1HE3A 5DTIA 3MAAC 2ZSJA 3AVPA 1FS4A 3A3PA 2AWOA 3ZNOA 3O4VA 1FS6A 2VP5A 2BWJA 1UBRS 1OWPA 3K6JA 4N3CA 4CI9A 2ZWAA 6ABPA 4JMLA 4C0KA 1KY2A 2E0IA 2DTEA 3G5MA 2JFYA 5JAMA 3LA6A 2BCSA 1KFKB 3GWZA 2BQUA 4EHNA 3U9TA 1EK6A 2FFJA 1JQLB 2NUPA 4N5NA 2PSDA 3EXHC 2JCSA 2YWDA 1NPDA 4ZA2A 5A06A 4NLKA 1ICEA 3DKVA 4DLWA 3D9QX 3HW8A 3KPJA 1PBNA 3K20A 3NHYA 3TAUA 2Z43A 2WLTA 3FCCA 3A4VA 4B4WA 2XKKA 4OKIA 2X3FA 4REQB 4P4SA 4RF3A 4RFVA 3LXRA 4F4DA 1B74A 4KZPA 3PDUA 3MT8A 4JYAB 1HRDA 5BMVA 2CFSA 2CNNA 3ASVA 1VJCA 2RIPA 4P5PA 2F90A 4DMLA 3CLSC 3D6JA 4WLOA 4KR9A 2ZCUA 1XEXA 8ICSA 5LP1A 4LVNA 4BMSA 1SVIA 2O54A 1YTUA 3SOPA 4I14A 1MFZA 3NKFA 4E22A 3JZFA 2RAVA 1K1QA 2WWVD 3GFGA 3WO0A 4R01A 5BWNA 3T1QA 3RH4A 4BQFA 1E64A 4RIIA 5KYXB 2HJGA 1AA9A 1X9XA 5E9QA 2BUBA 3QEKA 2W4MA 1PS8A 1HETA 3LW8A 1G1MA 2WU4A 2A9RA 5TARA 3GRCA 1QDUA 3GLVA 4CM9D 4BGUA 4B2YA 1CY6A 2W0MA 5BOLA 3H99A 4O25A 5JBQA 5JYCA 4CGYA 3FF1A 4X41A 1N9GA 3I30X 1YF3A 1CRWG 3JALA 4XVUA 1PU2A 1KQPA 2BEVA 4RK6A 4CMGA 1RQPA 1RYZA 4LJRA 4R83A 4PL1A 4NK5A 4GKJB 2YVAA 2H1CA 1KK3A 2GBGA 3KXPA 1XWFA 2R7LA 4KLAA 1CWUA 3K6KA 1PR9A 5CXUA 1SQ5A 4BS9A 5JQGA 5DBCA 1ZU4A 4Z9XA 4I1IA 4I81A 4HVTA 3PC2A 3ZDAA 2PWYA 1VB5A 2TECE 4P7KA 4JUDX 4R1UA 3BZWA 5DNUA 3FDJA 2BMJA 4O4LF 3NYIA 3CLKA 4X94A 2JBAA 4FWBA 4M0DA 1IN7A 4RSHA 2NRVA 2ZAGA 3IRVA 5A5VA 4RHFA 2EGGA 1QGYA 3SSNA 3MW8A 4LZNA 1JHXA 1T0UA 4FD2A 3BDVA 3LP8A 1GN8A 1QHHB 2RMKA 1QCDA 4MGYR 4K4IA 3TH5A 2NUBA 3OX2A 4HKTA 4KIJA 4DR6B 4EYHB 3NYQA 2HI0A 1K86A 2XY4A 3HJHA 3R6TA 2ZJ8A 1IWOA 2BEKA 2V03A 3CXRA 3BIFA 3FDXA 1J5PA 4LXYA 4PO3X 2QM8A 3DTYA 1X14A 5KPJA 4LIPD 4F6RA 2A1JA 3KQOA 2H57A 1A0PA 3PNBA 1KSHA 4QWAA 4I9FA 3N5CA 5TEWA 4HV4A 1NAIA 5KYKA 5D86A 3GEPA 5FT9A 4XRGA 1EBUA 3ESZA 4ZTBA 5FP0A 4RTRA 1QK3A 4NE7A 3IBFA 3DAFA 3FBWA 1KSGA 5LM3A 1S4MA 2QTLA 2R8IA 3KEFA 4BLUA 4XYMA 1OR8A 3JQAA 3A10A 4ARIA 3EXIA 3V8BA 2GUGA 3DV2A 2O2SA 4ZQEA 5K3FA 5AI4A 4LWZA 4Z1OA 4C0ZA 1PGQA 3EZ7A 1G5FA 1XPRA 4FX5A 3L0SA 3T3IA 5IILA 1KFDA 2WJVA 1B1CA 5IANA 4DBZA 4AY3A 4CFSA 2AXPA 3PP8A 1KOLA 4X0EA 2HOIA 1LBQA 1D1TA 2PTGA 5ERGB 4JFAA 1A9YA 4YGXB 4NMHA 5FYDA 4C0XA 2Z98A 1FX0B 4ISBA 4LBWA 3R7SA 4B46A 1Y82A 2O4UX 4YCBA 1EVJA 1DBQA 1YDFA 3ZGYA 4P92A 4WN3A 4OA5A 1PEYA 3AP3A 4ZVVA 2I2DA 3GV7B 4J0JA 4F8RA 1SL0A 1QV6A 3PDHA 3HXPA 2IUUA 4ZMRA 3SZUA 1P4JA 3OZAA 3W1VA 1NKTA 2BHNA 2ISOA 1GUYA 3UOGA 4QHTA 2P67A 3AFIA 2JLUA 1FSFA 3PFWO 2ZWIA 4PHFA 3V80A 1NU8A 2QD3A 1DK3A 4R41A 4J0KA 2C9MA 4B9NA 3VA7A 4TMVA 1JLHA 4F1KA 4Z4EA 1CZOA 5CDHA 1N0UA 1EGHA 1QO7A 1Z26A 3WLHA 4TKUA 3TTSA 4PRKA 3C87A 2W6QA 2IEDA 2LCIA 2CK3D 1YQXA 1Z74A 2Q9BA 5J5CA 1EU1A 3X2SA 3DE3X 5EA2A 1E6WA 1UBSB 3FLAA 4ZOLB 2CRXA 3SC6A 2HA2A 4HDKA 1MO3A 1CQJA 1G2OA 2QOEA 4RVUA 1Q17A 1OGJA 4P83A 2XADA 3SLRA 2ZANA 3DB2A 1FMCA 1AKQA 3WOVA 4UAJA 4MUNA 1Q1BA 5KJ1A 1H3FA 4DCVA 5K6RA 1P1FA 1QVVA 4HT3B 2C2XA 3VFDA 1FFSA 1QAQA 1R74A 2H06A 3IOYA 2OQ2A 1PVVA 3KUCA 3VTAA 2JI4A 3C6ZA 4U00A 1NW7A 4L3VA 4BHTA 5KNBD 2XYRA 3NBZC 1G6KA 1SU4A 4EQZA 1LLCA 2NPIA 3SZMA 3Q41A 2O2GA 5FUXA 2VRNA 2BGMA 1Z4JA 5CIQA 3HB5X 1N5JA 1FUKA 5A4KA 3ZY5A 1VL5A 5CA1A 3L0IB 1PJRA 3ZYCA 4EW3A 1YAJA 3G0BA 5BOSA 4F2SA 1S76D 3F90A 3KV1A 4TRMA 2D3TA 4JK3A 3D81A 4RVOA 3BXOA 4TQGA 3OX4A 2WWHA 4HRVA 3ILXA 2H63A