4ICAA

Crystal structure of a c-terminal truncated form of the matrix subunit (p15) of feline immunodeficiency virus (fiv)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
b'GNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p15
molecule tags Viral protein
source organism Feline immunodeficiency virus
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
total genus 42
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4icaA00
1A6SA 2JMGA 1HIWA 2K4EA 2H3IA 2H3FA 1HEKA 1TAMA 2N1RA 4ICAA 1UPHA 1ECWA 2H3QA 2NV3A 4IC9A 4JMUA 2LYAA 2GOLA 2K4IA 2LYBA 2K4HA 1L6NA 1ED1A 2H3VA 2H3ZA 2HMXA
chains in the Genus database with same CATH superfamily
1VDVA 2FPLA 1RM6C 5KT5A 4ECRA 1TV9A 4LZDA 3WKCA 1BVSA 4E0DA 1SXEA 2WB1F 4QZHA 2ZG6A 2ALZA 3C5GA 8ICVA 5L1LA 2BCSA 4NLZA 3Q8RB 2OWOA 4I2CA 3NVZA 2P35A 2UVWA 3MGHA 1TK5A 3E58A 2RDJA 3AU6A 4YG2A 5ALMA 9ICQA 2N1RA 5AKXA 5CRXA 4ICAA 5KG1A 3KFUF 1QQ7A 9ICHA 1WWVA 2ASLA 4ED7A 8ICHA 3RRHA 1KKXA 4FZMA 2C28A 1S77D 7ICPA 5D49A 3HP6A 1ZQDA 2W55A 4EBDA 4YMOA 5HR6A 4IL6U 2H3QA 5EE0A 2EAPA 3T5JA 1HUOA 1ZQPA 1V9PA 5TISU 1L6NA 3H8JA 2EZYA 2DL0A 3NGDA 1ZQXA 8ICWA 2K60A 3C2KA 1FEZA 3MR2A 1Z00A 1L3TA 1UHUA 5AKHA 5ALTA 5KFZA 4NLKA 9ICKA 2G07A 4FZLA 2FLPA 4Z6FA 4DWIA 5J0PA 1PK1B 1PUZA 2F1HA 2K8AA 2W03A 3C5FA 4F8RA 5JUMA 2A3VA 1KW4A 4OJ6A 4I2DA 2XY5A 3SZ2A 1ZJNA 5AM0A 2XVTA 3UM9A 2RHFA 4Q45A 1JALA 2YB4A 3QUCA 3I1YA 2J6SA 2JH1A 4J9QA 1Z19A 2ZIWB 4O3QA 2ZIWA 2YTUA 4F71A 3E0FA 1KFDA 2ZIVB 5J0OA 4DO9A 4M0AA 1YT3A 3JPNA 3AQFA 4MFCA 3JPPA 2NRTA 1N61A 1SWVA 2MSNA 4R66A 2V4QA 4FFDA 1X2IA 2HCFA 4C4RA 5AIBA 2KVSA 1S0NA 4F91B 4R8UA 5J2GA 8ICYA 5L1JA 4C8OA 1B4FA 4KTQA 4BXOB 4UAYA 1IXRA 4O3NA 8ICGA 2MA1A 1KL9A 2KP7A 5CR0A 4PZNA 4ELUA 1KQQA 3BJYA 5EWEA 8ICAA 2AQ4A 2HBKA 3WKAA 4UQGA 8ICCA 4F72A 2NRZA 1NKCA 5J2JA 3H7IA 4RQ4A 1T94A 4Z6CA 4QWCA 1QCKA 2K8BB 3IN5A 3RFAA 4PH5A 2B0CA 9ICXA 1UT8A 4K4IA 1L8OA 3Q8KA 2HVIA 4IS7A 1CRXA 5GTIU 2AH5A 2C2EA 4DF4A 5IILA 4DCCA 4KLHA 5JTIA 1SZHA 4UB5A 1BGXT 2PMZC 4OD0A 4DF8A 3PW2A 2P6UA 5ALFA 2LM1A 3IV6A 3ZDCA 5KT7A 3PZPA 2F2AB 9ICTA 3TADA 1DK2A 1KTQA 5KL1B 2YMMA 1DOQA 3A0HU 5KT3A 1HUZA 2MU2A 1B0XA 7ICSA 5HP4A 1BNOA 1RXVA 4P0PA 1KEJA 7ICTA 3PVXA 2Y0SF 5CB1A 4FS1A 1XSNA 2W8LA 4NY8A 1A6SA 2Q4TA 3V7JA 3BQ0A 1N5WA 2OXOA 2ISPA 2GH1A 4JV2A 5KFVA 2Y0SC 8ICSA 1PVRA 2OCEA 5EE3A 2LHTA 2E8OA 2BDUA 2NV3A 3C29A 2FMSA 5J2KA 3EYZA 3PR4A 3RTVA 4F5NA 2CRXA 2KOBA 4JK1A 4YXJA 5KT4A 3V7KA 5DG8A 4M9NA 3UPQA 4I2GA 1SV0A 2E5SA 2RDIA 3C1YA 3UXOA 2BCUA 1FFVA 2G0AA 2YMPA 2OYYA 3RB0A 2IHMA 2YMQA 3M9MB 1A0PA 5KG5A 3IDWA 5KFGA 4QZ9A 1ZOLA 2E1EA 2PKEA 1XS9D 4NV0A 5HMMA 2J6TA 4PGYA 3T5KA 1WCNA 2KEYA 4YN4A 1SL0A 4ED6A 3I76A 4KITB 1XNSA 4F5RA 4DFPA 1TE2A 3T5LA 3V6HA 1KBUA 3Q8LA 3JPRA 3I28A 1Z4OA 3UMGA 2ATLA 3AN1A 1MA7A 5DB7A 2IOFA 1ZQYA 2Y9UA 5AI4A 5EWGA 2QKQA 1BPDA 3F5AA 1DRGA 2R8JA 4U6PA 1L7PA 2JMGA 2ZIVA 4YVZA 2ZXHA 2F3NA 3PW7A 1MSWD 2XGQA 5DB6A 3KZXA 2K4IA 4GLXA 3RJJA 3H8WA 2DPJA 4C0ZA 4RT2A 9ICLA 3PSPA 3RAQA 1ZXIA 4YMNA 1SXDA 1SV4A 1WG8A 2W9CA 2KHVA 4C4SA 2DWQA 4DFMA 4YXMA 2LPEA 4IRKA 3F5EA 1S5LU 1IV8A 4PJ0U 3NS1A 2E8MA 4IQUA 5ALZA 2F1JA 2P66A 1ZQTA 3PO5A 1NZBA 5L1IA 2BCRA 5ALXA 4ED8A 4KLQA 9ICSA 3AEVA 3ZDEA 5AHXA 1L3SA 1UA0A 5J29A 3LK9A 2UVRA 3LVVA 1SB3C 1O08A 4DFDA 1F5SA 4DSKA 2H3IA 1S9FA 4YMMA 4OJLA 1RYUA 3SAGA 3AL0B 1D8BA 4CNQA 2RP5A 1NKEA 4QZIA 1KFSA 3BS5A 2MRLA 4GXJA 3BS5B 5KT2A 3MGIA 4F5PA 1NJWA 1QSLA 3H40A 4I2FA 5HHHA 1BPYA 5EE9A 5CWRA 3TAPA 5KFSA 1J97A 2YB1A 1BPXA 4ED2A 1ZQHA 5ALVA 1Q3VA 1SL2A 2BCQA 1ZQMA 3RH4A 1C20A 5J8YA 1Y88A 3PMNA 2LYBA 3BQTA 2WF5A 4QZGA 3HJEA 3V6KA 2ZUBA 4BJQA 4ACOA 3TADC 1JXEA 4P0PB 3RR8A 2KTQA 1X9MA 3B0YA 4CCHA 3JPOA 2IBKA 3D2NA 1TAQA 2GOLA 5KFUA 2FPKA 3RJIA 3KBBA 2YQEA 4P4PA 4P0QB 4RT3A 2C2RA 3WK5A 3PW5A 7ICMA 4RQ2A 2EANA 2BPGA 8ICZA 4TUPA 4YP3A 3QEAZ 3KD3A 1UQVA 5KFCA 2DKZA 9ICCA 1TAUA 2GLEA 3TAQA 4NL9C 3SMVA 8ICTA 3MDCA 3G6VA 3NVWA 3WKDA 1N48A 3TQ1A 1RG6A 5J0XA 3QUQA 2G5HB 3FDSA 3SD7A 4J9SA 2WF8A 1J2NA 4NLBA 4JWMA 3EZ5A 4KLGA 1B22A 4ELVA 2DUYA 2KE7A 1S0MA 5DLFA 1DGJA 1KRPA 2DGZA 2G08A 3MFIA 3ZDBA 1Z00B 2DKXA 2DQNB 2PFNA 2EH9A 5F3XB 3M1YA 8ICJA 2D3DA 4O3OA 2IMWP 5ALEA 4BX9C 2R8GA 1U49A 1IG6A 2KJ9A 2HBJA 8ICKA 3K75D 1QH9A 4NLNA 5CJ7A 1LV5A 4O5KA 3LVWA 3GIJA 1EXNA 2MUTB 4I28A 4RPZA 2BQUA 5KFAA 4B9NA 5AKIA 5AI8A 4RQ0A 5AK3A 1PVQA 4USAA 4QWDA 3L4PA 2R8IA 2G06A 2W11A 4KLIA 8ICOA 3VC8A 2ISOA 4QW8A 5ALYA 2UVVA 1SV0C 4Q8FA 1X9XA 2BQ3A 2KNJA 4J9RA 4UB2A 3T3FA 2JZBA 1UA1A 5DQIA 3KHRA 5KFKA 4RUAA 4ECTA 4MEYA 4F92B 1FIQA 4UAZA 3WKEA 1Z3EB 7ICUA 7ICRA 3KTQA 4MF2A 4M6WB 2HBLA 2C22A 4KLFA 4Y2SA 5ALOA 3ISCA 3NASA 2ZTCA 2Y9TA 1ZQEA 1JI7A 4QZCA 5KFBA 4RQ1A 4LZGA 2O6KA 4DSFA 1P7DA 5L1MA 2ZTEA 3M8RA 4JUZA 5ALPA 1OXJA 1SKRA 1ZQLA 1NK0A 3RJFA 4DS5A 1QSYA 4JB3A 1YZ6A 3C28A 1ECWA 4G3IA 4RZRA 3DDHA 3TFSA 5TZVA 4A8EA 3A0BU 1T4GA 5DDYA 1Q8KA 5CA7A 2YMLA 2HHWA 1N5XA 3UQ2A 4MHVA 1JX4A 3RJKA 3IM1A 5KL8B 3Q8MA 4CF5A 1JROA 4GC7A 2ZJAA 2HOIA 1ZQJA 5BPCA 1NOMA 3Q8SB 2YY6A 4F2SA 3RF9A 4Y2UA 4K4GA 2DF4B 1ZRNA 7ICHA 1S0OA 3DV9A 2ZXIA 3UXPA 2R8HA 3B0XA 4B9SA 4AYBC 2LKYA 3DEEA 1D8YA 2QB1A 4XUSA 4IQWA 4P0QA 2E8PA 8ICXA 3GU3A 4YR3A 1TKDA 4AP9A 4B9LA 4J9MA 4ZH4A 2EZXA 4NLGA 1MC8A 5FP0A 3LWMA 7ICJA 4UB8U 3GV8B 2FDRA 2W7OA 3OJSA 2E3TA 5AK6A 2IA6A 3ZI4A 1XU4A 3EPIA 7ICOA 3RB3A 3D6JA 4EX6A 4PHDA 4O5CA 4KX3A 1ZQUA 2BHNA 4CRXA 4C8KA 4QZBA 5DLGA 9ICGA 3SV4A 2FLNA 1CEZA 3MC1A 1SGGA 2BQRA 2LM4A 5HR7A 3V72A 5AI6A 5AM3A 1OW5A 3T79A 5ALUA 3OHAA 3KOOA 2XY6A 3JPTA 4PPXA 4U7CA 3SAFA 4ECWA 3GILA 4UAVA 1WWUA 2HSZA 2LYHA 3TANA 4QJFB 4NJ8A 2NRXA 3PSIA 4UAUA 5L1KA 2KV2A 1D9DA 4DFKA 2KIWA 3N7SC 3BS7A 3H8MA 1ZQRA 2OM6A 4F3OA 5C5JA 5AICA 2F76X 1Z1BA 2AXTU 1NJZA 4EELA 3BQ7A 3NVVA 5J2FA 3CW2C 2XC9A 3GV7B 5ALSA 5ALKA 2KFZA 4TQSA 2KD1A 5ALWA 4M9GA 3N4MB 4QIWC 1BPBA 2AU0A 4R64A 3PW4A 4DSJA 4BWJA 5AK5A 4F5QA 3PX0A 2I9GA 4NXZA 3LDAA 3QU5A 5KFJA 3GFKB 1T3QA 4WJ3B 3CYMA 2PI4A 3HKZC 5AK4A 5BOMA 2XI9A 2BCVA 5ALRA 4ELTA 4MEXA 3Q8PB 3EPGA 1XWLA 4NWIA 3QZ7A 1RYRA 1N56A 2J6UA 2NRVA 3ISDA 2F77X 1RXWA 4UARA 3UMBA 2HMXA 4P4MA 4P2HA 2KKVA 3QU9A 1S76D 1SKSA 4F4XA 1X6IA 4CE6A 5IIOA 3WU2U 3WK9A 1JRPA 5J0SA 3PX4A 4KLSA 2HHUA 4TURA 2XICA 1ZQVA 1ZQFA 1S10A 2EDUA 1K1SA 4RQ8A 3G6XA 4J9LA 3RBDA 1LVHA 4O3PA 5DBAA 4KMUA 2VJ4A 2ODGA 4KN4A 2ESEA 5CEHA 2V4RA 3RJGA 2FI1A 4J9NA 5ALQA 5DG7A 1NK7A 4KLTA 2KJ8A 4DQRA 5ALHA 4FBUA 4I29A 2PMZF 3QU2A 2QARA 1N62A 2W8KA 4IRCA 2QARB 2BPFA 1Z1VA 3MR5A 1ZQ1C 3ZD9A 3M9NB 3WK6A 1U45A 4F50A 5KG3A 4RQ7A 2H5XA 2WF9A 3HX0A 1SKWA 3HRDD 1RQNA 9ICNA 3MABA 5ALNA 3ZDAA 1VJ5A 9ICJA 3FAHA 4DL3A 1X66A 2XY7A 3GV5B 4JV0A 2BPCA 1UCVA 4DL6A 1N60A 5KFQA 1TVAA 3ETRA 3F53A 4NL9A 4BGDA 3PO4A 1S0VA 5J8YC 2A19A 2AHOB 2OHFA 4M9HA 2KZZA 1D8LA 4IQTA 5GTHU 2BDPA 4QNLA 4Q8EA 2UVUA 2EQYA 9ICIA 1XSPA 3NVYA 1FFUA 9ICRA 3Q8QB 1KLNA 5EWFA 5DQHA 2ZIUB 2HBMA 3QX7A 1QQ6A 1U4BA 2L5YA 4OO1J 4QZEA 4KLJA 1RZTA 2H3VA 4QZ8A 2HHVA 3HKZF 1V38A 4UB6U 5B5EU 3SYZA 9ICFA 4ED1A 4M6WA 4DLGA 4QWAA 3F2DA 2YX8A 5KFXA 3NTUA 4PL2A 3OGUA 4BWMA 1JIHA 3SEIA 2JEJA 3JPQA 3C1ZA 1IM4A 4C4TA 2ASDA 3WK4A 5J2DA 4O3MA 2VANA 1L3UA 3N28A 2DBYA 5D46A 1CI4A 5JU5A 2K4EA 5KFDA 4BDPA 5J0TA 9ICAA 9ICVA 4P4OA 2EAMA 3OJUA 2B6GA 4NM2A 4DL4A 5KFHA 3ONNA 2PXIA 4GXKA 1QQ5A 5J2EA 4I2AA 2OEHA 1PZNA 2ZJ8A 2W54A 4F2RA 4RNMA 5KFIA 4EZ6A 5A0LA 3ETLA 4KN7A 5BOLA 5DGAA 1TAMA 8ICMA 4FE3A 2KMDA 3M7DA 4EEKA 3GIMA 3MFHA 4F4KA 1LKYB 3RJEA 2JGAA 3RH6A 4KLMA 3H4DA 4ECZA 4CF3A 2W7PA 4UB4A 5KT6A 5J0RA 1L7OA 1ZQKA 1ZD4A 3HILA 5KFYA 4KLOA 3AU2A 2G5IB 2HVHA 2AGPA 1L8LA 3L3FX 1RPLA 4YR0A 1ZQAA 2KK0A 3N7PD 1NI3A 2W9BB 4YR2A 2Y1IA 2W9BA 4Y2TA 2JXJA 3V7LA 3MGVA 4FBTA 2AJQA 4PGXA 1UT5A 4F4YA 2BR0A 2KFNA 4IC9A 4QZFA 1S8OA 2WF7A 3AQEA 3MBYA 1V85A 2HHQA 4DOBA 3AUOA 4RNOA 1ZQZA 2Y1JA 3C21A 4CDGA 4ECVA 5F9LA 3OTQA 4YQWA 5DB9A 4O3SA 3TKAA 1SWWA 2FE9A 5AKJA 1K5OA 5AI0A 1QTMA 1BNPA 5G5GA 3BZKA 4B6JA 1L7MA 2C2DA 5AKYA 5KG2A 5KFLA 1COOA 4OJOA 3ZD8A 5ALIA 4Y2YA 1NZPA 4DQSA 1NK9A 2QB0B 4B9UA 1ED1A 1ZRMA 3TARA 1X42A 3RH5A 2FLLA 8ICNA 3M8SA 4KLEA 4YCXA 4RQNA 4Q44A 4DQPA 2KIVA 2FMPA 2NO4A 1Z4NA 2JEFA 2MAXA 2ZIXB 4JMUA 2LYAA 4ED0A 1PVPA 2YN4A 3HW8A 4YD2A 5AKKA 2W43A 4RQMA 3C23A 2IOFK 4Y2XA 3TFRA 2DFLA 3SQIA 5IIMA 4QW9A 2ZUCA 4EENA 3ISBA 8ICLA 3KZIU 4DOCA 4JV1A 1COKA 4I2IA 2GWSA 3H0RB 1JMSA 5J2HA 2KHQA 1DXSA 5DBBA 9ICOA 1NJXA 3KHHA 4QZDA 2PFOA 3WKBA 3RB4A 2RQ5A 1RDFA 2ZUDA 4KLUA 4OJ5A 1T7PA 1NKBA 2KN7A 2E1FA 3IRUA 5ALJA 4C8MA 3RR7A 1TK8A 9ICBA 3AM9A 2VA3A 4JWNA 4DOAA 1N63A 1RYSA 4GC6A 2JR5A 4KLDA 4UAWA 2Q0ZX 2ES6A 1Q46A 4R8UB 2BKEA 3PX6A 3UMCA 8ICPA 3QEBZ 3GIIA 2KJ5A 4GFJA 5J0QA 3LYSA 2EZZA 4FZNA 1MQ2A 1ZQQA 3PMLA 2JZBB 1XO1A 1KN5A 5KG7A 4GIBA 4UB1A 2ASJA 8ICFA 4PHEA 1OUQA 4EBEA 5KNIA 2WTFA 3GQCA 4CF4A 1KDHA 2JHDA 3BZCA 1URJA 2W3RA 4OCZA 3BQ1A 5J2IA 1HEKA 3E2EA 4F5OA 4ED3A 1X9WA 2VA8A 5B66U 4J9PA 5HMLA 5EOZA 4RPXA 3ED5A 4DS4A 2HOFA 2K8CB 7ICQA 1M6YA 5CHGA 1LKYA 4QWEA 1BPEA 2W3SA 1ZQNA 4EX7A 4GXIA 4RQ3A 4Y2VA 3NRZA 4ECYA 5KFPA 3LWLA 4IR9A 3WK8A 1Q3UA 2JH7A 5IIKA 1WCLA 1ZETA 3SV3A 3CP8A 2VJ5A 2QLTA 4I2JA 8ICQA 5IIJA 9ICMA 1ZQCA 4R65A 4UASA 5F9NA 7ICGA 5KFMA 3HT3A 2HDOA 4O0IA 7ICLA 4HAIA 2IHNA 3QUTA 4M2YA 3RBEA 3QYPA 5AIAA 2XCAA 5JRTA 4DEZA 4EZ9A 3QE9Y 2A1JB 2W9AA 5AKEA 4XQ8A 4ECSA 2VA2A 1U9LA 3L5KA 2NO5A 2ZIUA 4Z6DA 3N7RC 4C80A 3ORYA 5DB8A 1ZD5A 4RU9A 3N97B 4C8LA 5AM1A 2F1IA 2Z7JA 3RRGA 2LMRA 4KLLA 2VIXA 1JUDA 3U26A 2M9NA 5AM4A 2VKQA 3IHQB 3D2SA 5AM2A 9ICEA 3MR6A 4MF8A 1DGSA 4UBCA 2F8LA 1D9FA 3NUQA 2XGPA 1T3NA 5T14A 2NRWA 1JN3A 5DGBA 1AQ6A 1LB2B 1NK6A 2K4HA 1NK8A 4J9KA 3C2MA 1KFTA 2LBOA 2JV3A 4OJPA 5KFRA 5KTQA 4IR1A 5H2FU 4Y2PA 1H38A 3PSTA 8ICEA 2D6FC 4TUQA 3WK7A 5DDMA 4EYIB 5KFTA 2IOHA 4C8NA 2ZJ5A 5KFWA 3PR5B 1KSPA 3MDAA 2I5HA 1F0MA 1NK5A 2LI6A 1T8EA 1RQLA 2CN1A 3GDXA 4C7ZA 1QSSA 1ZD3A 2M0NA 4G9BA 4Y2RA 4Q43A 2BGWA 5AKGA 2WAQF 4DQQA 4ZOHC 9ICUA 8ICIA 1X40A 2RLTA 4M47A 3H0LB 4LVSA 2BZFA 4K4HA 5AM5A 7ICVA 3T5HA 3EW9A 1BPZA 4O9MA 4TUSA 8ICBA 3ALRA 5HNKA 2HOQA 3IG5A 2W04A 2KKPA 5D4BA 5HHIA 4MFAA 2ZIXA 5G5HA 3O0FA 2H3ZA 3ICXA 5DBCA 3QZ8A 2JEIA 1WUDA 5KFOA 4B9VA 4PZOA 2F8KA 4RUCA 1PK3A 3H8SA 4PGQA 3ZDDA 4XA5A 3MR3A 4UBBA 1V97A 2V9WA 2PI5A 5J0YA 5J2AA 2CPRA 3RB6A 4F4WA 4F93B 2I6XA 4UATA 5KAIU 2XO7A 1XO0A 4B9TA 1A77A 5KG6A 2WHEA 3QU7A 1O03A 3HWTA 2R18A 5KFEA 4QIWF 3PW0A 1F44A 5KG0A 3G6YA 3RAXA 4UB3A 3D2QA 2QB0A 5KG4A 5KFFA 3M6KA 1L3VA 1SL1A 1ZQIA 4YFKA 2CXYA 2JRZA 4RNNA 2K4PA 1X9SA 4DFJA 4DL5A 3PY8A 2I1QA 4DQIA 4CGZA 2AQ0A 4RQ6A 2WAQC 4YD1A 1X6JA 8ICRA 1ZJMA 3RJHA 4EYHB 4EBCA 2F44A 5DKWA 4BXOA 2W9CB 2KG5A 4US8A 2P6RA 2FPMA 4M04A 3EUB2 1XC9A 3K1ZA 2A1JA 2R8KA 3PV8A 4O5EA 1CUKA 3EWAA 4I27A 2D8CA 7ICNA 3KHGA 1U47A 3CNHA 4J03A 4DLEA 3KKAC 5AKZA 1NJYA 4QWBA 1MN8A 1MQ3A 3H0MB 2OH2A 1ZYQA 1ZQOA 4ECXA 5KAFU 5C0YA 2B21A 3KKAA 5DQGA 1B43A 4US9A 1ZQSA 3J81j 4I2HA 3SAHA 5AI9A 4BUGA 4QZAA 3FYHA 3K4GA 1XSLA 3NRWA 3OHBA 3UQ0A 4IQVA 2RRDA 4XRHA 1DK3A 1SZPA 3K1RB 5CP2A 2K89A 2KVCA 4I2BA 2KZ3A 2WF6A 7ICIA 2E8NA 4AYBF 4FS2A 4PHAA 5KFNA 2KSOB 3QU4A 4NM1A 3R9KA 4B9MA 2KSOA 2KZMA 1A76A 2WB1C 2ZTDA 5IIIA 7ICEA 5EE1A 5IINA 1N2XA 3M9OB 2H3FA 1U48A 1UPHA 1PK1A 3BQ2A 9ICPA 3GZFA 2AGQA 1ZQBA 5AI5A 4ECUA 1VLBA 2GO7A 3HPOA 5K4LA 4J9OA 1SIJA 7ICKA 3IP4B 1HJPA 3BDPA 2PFQA 9ICWA 1GO3F 3IG8A 3TACB 3FC4A 3VCBA 1TFRA 3OPXA 1AROP 2G09A 1WYGA 4DSIA 7ICFA 2HI0A 1ZQGA 3AMZA 4M9LA 3PSFA 4X5VA 2XIDA 2A1AA 1NK4A 1ZQWA 4M9JA 4C7YA 4RQ5A 4RPYA 5DG9A 1NNLA 4DL2A 2JEGA 2FJ6A 1L7NA 1HIWA 1FO4A 3FM9A 3SI8A 2HHXA 4Y2QA 4DSLA 4DL7A 1QLNA 2XCPA 4R63A 2HHSA 4PL1A 2KICA 4IRDA 4F4ZA 2WFAA 5ALGA 4PHPA 5L9XA 3OSPA 1IIPA 1JXLA 1YZ7A 5ALLA 5J0WA 3C2LA 8ICUA 4TQRA 4Z6EA 5ALDA 4ECQA 1K1QA 4KX5A 4KMOB 3CRXA 2HHTA 2HW3A 3SENA 2DPIA 3SR6A 4HYKA 4UW9A 4Y2JA 4O3RA 4DSEA 2AGOA 3QUBA 4I2EA 5J2BA 3QXGA 1TK0A 5J2CA 1J2MA 3V6JA 3S6JA 3KHLA 3JPSA 3M6ZA 4NLCA 1ZD2P 2NYVA 1S97A 3F2BA 3PNCA 3F2CA 3GIKA 2FMQA 4LJXA 3QNMA 3TI0A 5E79U 4MFFA 2EAOA 2PFPA 3H4BA 5AKLA 1C7YA 3UXNA 2W9MA 2MUTA 4EEYA 3B9JA 3OSNA 1L5UA 3THVA 5J0UA 4FO6A
chains in the Genus database with same CATH topology
1GO3F 2M0NA 3IG8A 4BX9C 3VCBA 3PSIA 2KEYA 2WAQC 2KV2A 3MGVA 3OPXA 1SZHA 3F2DA 2YX8A 2KJ9A 1CRXA 2HBJA 2WAQF 2G09A 4OJ5A 1XNSA 2KIWA 3N7SC 4PL2A 2PMZC 2XVTA 2YB1A 1KBUA 2E1FA 2RHFA 1Q3VA 2VJ4A 3H0LB 2OM6A 3LVWA 3PSFA 4IC9A 2F76X 2YB4A 3AQEA 1MA7A 2WB1F 5KL8B 2LYBA 1Z1BA 2XIDA 2ZG6A 2JH1A 1Z19A 3K1ZA 2ZIWB 2KJ8A 3PZPA 4CDGA 2HOIA 2F2AB 2PMZF 2ZIWA 3F5AA 1PVQA 4O3MA 4BJQA 4ACOA 3E0FA 3RF9A 1DRGA 3ALRA 2ZIVB 4U6PA 2KD1A 1YT3A 2HOQA 2JMGA 3AQFA 1HIWA 2DF4B 2ZIVA 5KL1B 4P0PB 3IG5A 2G06A 2ZIUA 1ZQ1C 2K4EA 3N7RC 2W04A 4QIWC 2KKPA 2ZXHA 2ZXIA 3VC8A 3H0MB 2N1RA 2OH2A 2KJ5A 4GFJA 3D2NA 4ICAA 4OJOA 5CRXA 4PL1A 3LYSA 2KICA 2ZIXA 3KZXA 3KFUF 2GOLA 2K4IA 4FZNA 1IIPA 2Z7JA 4AYBC 3ONNA 1ED1A 2LKYA 3DEEA 5C0YA 3O0FA 2VIXA 4P0QB 2KNJA 4P0PA 4WJ3B 2H3ZA 4C0ZA 3CYMA 3ICXA 4P0QA 4FZMA 2VKQA 3D2SA 3GU3A 3PSPA 4KMOB 2Y0SF 3HKZC 4KX5A 3CRXA 3SAHA 1A6SA 1OUQA 2XI9A 2F8LA 2Q4TA 4BUGA 1WUDA 3NUQA 5A0LA 3NRWA 2KHVA 2MA1A 2OXOA 2GH1A 2JHDA 2RRDA 1URJA 3F53A 5T14A 2W7OA 2Y0SC 1HEKA 1TAMA 1PVRA 5HR6A 2HBLA 2ZIXB 2H3QA 2LHTA 2BDUA 2NV3A 4FE3A 3M7DA 2K89A 4JMUA 3C29A 4NWIA 3SMVA 2KVCA 2LYAA 3F5EA 1PVPA 2KOBA 2CRXA 2CPRA 2K4HA 1L6NA 4AYBF 2HBKA 2HOFA 2K8CB 2JGAA 1NZBA 1XO0A 4QNLA 2G5HB 2F77X 3M6ZA 4NLCA 2W7PA 2HMXA 2LBOA 2E5SA 2WB1C 4NLBA 2R18A 1P7DA 4KX3A 2KKVA 4OJPA 4QIWF 3F2BA 3SQIA 1F44A 4CRXA 1T94A 3PSTA 2D6FC 3LVVA 3F2CA 1Q3UA 3D2QA 2JH7A 2G0AA 2H3IA 2K8BB 3IN5A 2OYYA 3H0RB 4OJLA 3SAGA 5HR7A 2G07A 2H3FA 3AL0B 1D8BA 3M6KA 1A0PA 1UPHA 1ECWA 2KHQA 2G5IB 2RP5A 2VJ5A 3CP8A 4FZLA 3C28A 3RFAA 3T79A 2ZIUB 3L3FX 2HBMA 2DGZA 3N7PD 2G08A 4OO1J 3GZFA 4A8EA 2MRLA 2K8AA 2CN1A 2H3VA 4U7CA 3SAFA 2DQNB 2W03A 2E1EA 3HKZF 3IP4B 2A3VA 4CGZA 4NV0A 4QJFB 4OJ6A 2XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6S A;  2JMG A;  1HIW A;  2K4E A;  2H3I A;  2H3F A;  1HEK A;  1TAM A;  2N1R A;  4ICA A;  1UPH A;  1ECW A;  2H3Q A;  2NV3 A;  4IC9 A;  4JMU A;  2LYA A;  2GOL A;  2K4I A;  2LYB A;  2K4H A;  1L6N A;  1ED1 A;  2H3V A;  2H3Z A;  2HMX A; 
#chains in the Genus database with same CATH topology
 1VDV A;  2FPL A;  1RM6 C;  5KT5 A;  4ECR A;  1TV9 A;  4LZD A;  3WKC A;  1BVS A;  4E0D A;  1SXE A;  2WB1 F;  4QZH A;  2ZG6 A;  2ALZ A;  3C5G A;  8ICV A;  5L1L A;  2BCS A;  4NLZ A;  3Q8R B;  2OWO A;  4I2C A;  3NVZ A;  2P35 A;  2UVW A;  3MGH A;  1TK5 A;  3E58 A;  2RDJ A;  3AU6 A;  4YG2 A;  5ALM A;  9ICQ A;  2N1R A;  5AKX A;  5CRX A;  4ICA A;  5KG1 A;  3KFU F;  1QQ7 A;  9ICH A;  1WWV A;  2ASL A;  4ED7 A;  8ICH A;  3RRH A;  1KKX A;  4FZM A;  2C28 A;  1S77 D;  7ICP A;  5D49 A;  3HP6 A;  1ZQD A;  2W55 A;  4EBD A;  4YMO A;  5HR6 A;  4IL6 U;  2H3Q A;  5EE0 A;  2EAP A;  3T5J A;  1HUO A;  1ZQP A;  1V9P A;  5TIS U;  1L6N A;  3H8J A;  2EZY A;  2DL0 A;  3NGD A;  1ZQX A;  8ICW A;  2K60 A;  3C2K A;  1FEZ A;  3MR2 A;  1Z00 A;  1L3T A;  1UHU A;  5AKH A;  5ALT A;  5KFZ A;  4NLK A;  9ICK A;  2G07 A;  4FZL A;  2FLP A;  4Z6F A;  4DWI A;  5J0P A;  1PK1 B;  1PUZ A;  2F1H A;  2K8A A;  2W03 A;  3C5F A;  4F8R A;  5JUM A;  2A3V A;  1KW4 A;  4OJ6 A;  4I2D A;  2XY5 A;  3SZ2 A;  1ZJN A;  5AM0 A;  2XVT A;  3UM9 A;  2RHF A;  4Q45 A;  1JAL A;  2YB4 A;  3QUC A;  3I1Y A;  2J6S A;  2JH1 A;  4J9Q A;  1Z19 A;  2ZIW B;  4O3Q A;  2ZIW A;  2YTU A;  4F71 A;  3E0F A;  1KFD A;  2ZIV B;  5J0O A;  4DO9 A;  4M0A A;  1YT3 A;  3JPN A;  3AQF A;  4MFC A;  3JPP A;  2NRT A;  1N61 A;  1SWV A;  2MSN A;  4R66 A;  2V4Q A;  4FFD A;  1X2I A;  2HCF A;  4C4R A;  5AIB A;  2KVS A;  1S0N A;  4F91 B;  4R8U A;  5J2G A;  8ICY A;  5L1J A;  4C8O A;  1B4F A;  4KTQ A;  4BXO B;  4UAY A;  1IXR A;  4O3N A;  8ICG A;  2MA1 A;  1KL9 A;  2KP7 A;  5CR0 A;  4PZN A;  4ELU A;  1KQQ A;  3BJY A;  5EWE A;  8ICA A;  2AQ4 A;  2HBK A;  3WKA A;  4UQG A;  8ICC A;  4F72 A;  2NRZ A;  1NKC A;  5J2J A;  3H7I A;  4RQ4 A;  1T94 A;  4Z6C A;  4QWC A;  1QCK A;  2K8B B;  3IN5 A;  3RFA A;  4PH5 A;  2B0C A;  9ICX A;  1UT8 A;  4K4I A;  1L8O A;  3Q8K A;  2HVI A;  4IS7 A;  1CRX A;  5GTI U;  2AH5 A;  2C2E A;  4DF4 A;  5IIL A;  4DCC A;  4KLH A;  5JTI A;  1SZH A;  4UB5 A;  1BGX T;  2PMZ C;  4OD0 A;  4DF8 A;  3PW2 A;  2P6U A;  5ALF A;  2LM1 A;  3IV6 A;  3ZDC A;  5KT7 A;  3PZP A;  2F2A B;  9ICT A;  3TAD A;  1DK2 A;  1KTQ A;  5KL1 B;  2YMM A;  1DOQ A;  3A0H U;  5KT3 A;  1HUZ A;  2MU2 A;  1B0X A;  7ICS A;  5HP4 A;  1BNO A;  1RXV A;  4P0P A;  1KEJ A;  7ICT A;  3PVX A;  2Y0S F;  5CB1 A;  4FS1 A;  1XSN A;  2W8L A;  4NY8 A;  1A6S A;  2Q4T A;  3V7J A;  3BQ0 A;  1N5W A;  2OXO A;  2ISP A;  2GH1 A;  4JV2 A;  5KFV A;  2Y0S C;  8ICS A;  1PVR A;  2OCE A;  5EE3 A;  2LHT A;  2E8O A;  2BDU A;  2NV3 A;  3C29 A;  2FMS A;  5J2K A;  3EYZ A;  3PR4 A;  3RTV A;  4F5N A;  2CRX A;  2KOB A;  4JK1 A;  4YXJ A;  5KT4 A;  3V7K A;  5DG8 A;  4M9N A;  3UPQ A;  4I2G A;  1SV0 A;  2E5S A;  2RDI A;  3C1Y A;  3UXO A;  2BCU A;  1FFV A;  2G0A A;  2YMP A;  2OYY A;  3RB0 A;  2IHM A;  2YMQ A;  3M9M B;  1A0P A;  5KG5 A;  3IDW A;  5KFG A;  4QZ9 A;  1ZOL A;  2E1E A;  2PKE A;  1XS9 D;  4NV0 A;  5HMM A;  2J6T A;  4PGY A;  3T5K A;  1WCN A;  2KEY A;  4YN4 A;  1SL0 A;  4ED6 A;  3I76 A;  4KIT B;  1XNS A;  4F5R A;  4DFP A;  1TE2 A;  3T5L A;  3V6H A;  1KBU A;  3Q8L A;  3JPR A;  3I28 A;  1Z4O A;  3UMG A;  2ATL A;  3AN1 A;  1MA7 A;  5DB7 A;  2IOF A;  1ZQY A;  2Y9U A;  5AI4 A;  5EWG A;  2QKQ A;  1BPD A;  3F5A A;  1DRG A;  2R8J A;  4U6P A;  1L7P A;  2JMG A;  2ZIV A;  4YVZ A;  2ZXH A;  2F3N A;  3PW7 A;  1MSW D;  2XGQ A;  5DB6 A;  3KZX A;  2K4I A;  4GLX A;  3RJJ A;  3H8W A;  2DPJ A;  4C0Z A;  4RT2 A;  9ICL A;  3PSP A;  3RAQ A;  1ZXI A;  4YMN A;  1SXD A;  1SV4 A;  1WG8 A;  2W9C A;  2KHV A;  4C4S A;  2DWQ A;  4DFM A;  4YXM A;  2LPE A;  4IRK A;  3F5E A;  1S5L U;  1IV8 A;  4PJ0 U;  3NS1 A;  2E8M A;  4IQU A;  5ALZ A;  2F1J A;  2P66 A;  1ZQT A;  3PO5 A;  1NZB A;  5L1I A;  2BCR A;  5ALX A;  4ED8 A;  4KLQ A;  9ICS A;  3AEV A;  3ZDE A;  5AHX A;  1L3S A;  1UA0 A;  5J29 A;  3LK9 A;  2UVR A;  3LVV A;  1SB3 C;  1O08 A;  4DFD A;  1F5S A;  4DSK A;  2H3I A;  1S9F A;  4YMM A;  4OJL A;  1RYU A;  3SAG A;  3AL0 B;  1D8B A;  4CNQ A;  2RP5 A;  1NKE A;  4QZI A;  1KFS A;  3BS5 A;  2MRL A;  4GXJ A;  3BS5 B;  5KT2 A;  3MGI A;  4F5P A;  1NJW A;  1QSL A;  3H40 A;  4I2F A;  5HHH A;  1BPY A;  5EE9 A;  5CWR A;  3TAP A;  5KFS A;  1J97 A;  2YB1 A;  1BPX A;  4ED2 A;  1ZQH A;  5ALV A;  1Q3V A;  1SL2 A;  2BCQ A;  1ZQM A;  3RH4 A;  1C20 A;  5J8Y A;  1Y88 A;  3PMN A;  2LYB A;  3BQT A;  2WF5 A;  4QZG A;  3HJE A;  3V6K A;  2ZUB A;  4BJQ A;  4ACO A;  3TAD C;  1JXE A;  4P0P B;  3RR8 A;  2KTQ A;  1X9M A;  3B0Y A;  4CCH A;  3JPO A;  2IBK A;  3D2N A;  1TAQ A;  2GOL A;  5KFU A;  2FPK A;  3RJI A;  3KBB A;  2YQE A;  4P4P A;  4P0Q B;  4RT3 A;  2C2R A;  3WK5 A;  3PW5 A;  7ICM A;  4RQ2 A;  2EAN A;  2BPG A;  8ICZ A;  4TUP A;  4YP3 A;  3QEA Z;  3KD3 A;  1UQV A;  5KFC A;  2DKZ A;  9ICC A;  1TAU A;  2GLE A;  3TAQ A;  4NL9 C;  3SMV A;  8ICT A;  3MDC A;  3G6V A;  3NVW A;  3WKD A;  1N48 A;  3TQ1 A;  1RG6 A;  5J0X A;  3QUQ A;  2G5H B;  3FDS A;  3SD7 A;  4J9S A;  2WF8 A;  1J2N A;  4NLB A;  4JWM A;  3EZ5 A;  4KLG A;  1B22 A;  4ELV A;  2DUY A;  2KE7 A;  1S0M A;  5DLF A;  1DGJ A;  1KRP A;  2DGZ A;  2G08 A;  3MFI A;  3ZDB A;  1Z00 B;  2DKX A;  2DQN B;  2PFN A;  2EH9 A;  5F3X B;  3M1Y A;  8ICJ A;  2D3D A;  4O3O A;  2IMW P;  5ALE A;  4BX9 C;  2R8G A;  1U49 A;  1IG6 A;  2KJ9 A;  2HBJ A;  8ICK A;  3K75 D;  1QH9 A;  4NLN A;  5CJ7 A;  1LV5 A;  4O5K A;  3LVW A;  3GIJ A;  1EXN A;  2MUT B;  4I28 A;  4RPZ A;  2BQU A;  5KFA A;  4B9N A;  5AKI A;  5AI8 A;  4RQ0 A;  5AK3 A;  1PVQ A;  4USA A;  4QWD A;  3L4P A;  2R8I A;  2G06 A;  2W11 A;  4KLI A;  8ICO A;  3VC8 A;  2ISO A;  4QW8 A;  5ALY A;  2UVV A;  1SV0 C;  4Q8F A;  1X9X A;  2BQ3 A;  2KNJ A;  4J9R A;  4UB2 A;  3T3F A;  2JZB A;  1UA1 A;  5DQI A;  3KHR A;  5KFK A;  4RUA A;  4ECT A;  4MEY A;  4F92 B;  1FIQ A;  4UAZ A;  3WKE A;  1Z3E B;  7ICU A;  7ICR A;  3KTQ A;  4MF2 A;  4M6W B;  2HBL A;  2C22 A;  4KLF A;  4Y2S A;  5ALO A;  3ISC A;  3NAS A;  2ZTC A;  2Y9T A;  1ZQE A;  1JI7 A;  4QZC A;  5KFB A;  4RQ1 A;  4LZG A;  2O6K A;  4DSF A;  1P7D A;  5L1M A;  2ZTE A;  3M8R A;  4JUZ A;  5ALP A;  1OXJ A;  1SKR A;  1ZQL A;  1NK0 A;  3RJF A;  4DS5 A;  1QSY A;  4JB3 A;  1YZ6 A;  3C28 A;  1ECW A;  4G3I A;  4RZR A;  3DDH A;  3TFS A;  5TZV A;  4A8E A;  3A0B U;  1T4G A;  5DDY A;  1Q8K A;  5CA7 A;  2YML A;  2HHW A;  1N5X A;  3UQ2 A;  4MHV A;  1JX4 A;  3RJK A;  3IM1 A;  5KL8 B;  3Q8M A;  4CF5 A;  1JRO A;  4GC7 A;  2ZJA A;  2HOI A;  1ZQJ A;  5BPC A;  1NOM A;  3Q8S B;  2YY6 A;  4F2S A;  3RF9 A;  4Y2U A;  4K4G A;  2DF4 B;  1ZRN A;  7ICH A;  1S0O A;  3DV9 A;  2ZXI A;  3UXP A;  2R8H A;  3B0X A;  4B9S A;  4AYB C;  2LKY A;  3DEE A;  1D8Y A;  2QB1 A;  4XUS A;  4IQW A;  4P0Q A;  2E8P A;  8ICX A;  3GU3 A;  4YR3 A;  1TKD A;  4AP9 A;  4B9L A;  4J9M A;  4ZH4 A;  2EZX A;  4NLG A;  1MC8 A;  5FP0 A;  3LWM A;  7ICJ A;  4UB8 U;  3GV8 B;  2FDR A;  2W7O A;  3OJS A;  2E3T A;  5AK6 A;  2IA6 A;  3ZI4 A;  1XU4 A;  3EPI A;  7ICO A;  3RB3 A;  3D6J A;  4EX6 A;  4PHD A;  4O5C A;  4KX3 A;  1ZQU A;  2BHN A;  4CRX A;  4C8K A;  4QZB A;  5DLG A;  9ICG A;  3SV4 A;  2FLN A;  1CEZ A;  3MC1 A;  1SGG A;  2BQR A;  2LM4 A;  5HR7 A;  3V72 A;  5AI6 A;  5AM3 A;  1OW5 A;  3T79 A;  5ALU A;  3OHA A;  3KOO A;  2XY6 A;  3JPT A;  4PPX A;  4U7C A;  3SAF A;  4ECW A;  3GIL A;  4UAV A;  1WWU A;  2HSZ A;  2LYH A;  3TAN A;  4QJF B;  4NJ8 A;  2NRX A;  3PSI A;  4UAU A;  5L1K A;  2KV2 A;  1D9D A;  4DFK A;  2KIW A;  3N7S C;  3BS7 A;  3H8M A;  1ZQR A;  2OM6 A;  4F3O A;  5C5J A;  5AIC A;  2F76 X;  1Z1B A;  2AXT U;  1NJZ A;  4EEL A;  3BQ7 A;  3NVV A;  5J2F A;  3CW2 C;  2XC9 A;  3GV7 B;  5ALS A;  5ALK A;  2KFZ A;  4TQS A;  2KD1 A;  5ALW A;  4M9G A;  3N4M B;  4QIW C;  1BPB A;  2AU0 A;  4R64 A;  3PW4 A;  4DSJ A;  4BWJ A;  5AK5 A;  4F5Q A;  3PX0 A;  2I9G A;  4NXZ A;  3LDA A;  3QU5 A;  5KFJ A;  3GFK B;  1T3Q A;  4WJ3 B;  3CYM A;  2PI4 A;  3HKZ C;  5AK4 A;  5BOM A;  2XI9 A;  2BCV A;  5ALR A;  4ELT A;  4MEX A;  3Q8P B;  3EPG A;  1XWL A;  4NWI A;  3QZ7 A;  1RYR A;  1N56 A;  2J6U A;  2NRV A;  3ISD A;  2F77 X;  1RXW A;  4UAR A;  3UMB A;  2HMX A;  4P4M A;  4P2H A;  2KKV A;  3QU9 A;  1S76 D;  1SKS A;  4F4X A;  1X6I A;  4CE6 A;  5IIO A;  3WU2 U;  3WK9 A;  1JRP A;  5J0S A;  3PX4 A;  4KLS A;  2HHU A;  4TUR A;  2XIC A;  1ZQV A;  1ZQF A;  1S10 A;  2EDU A;  1K1S A;  4RQ8 A;  3G6X A;  4J9L A;  3RBD A;  1LVH A;  4O3P A;  5DBA A;  4KMU A;  2VJ4 A;  2ODG A;  4KN4 A;  2ESE A;  5CEH A;  2V4R A;  3RJG A;  2FI1 A;  4J9N A;  5ALQ A;  5DG7 A;  1NK7 A;  4KLT A;  2KJ8 A;  4DQR A;  5ALH A;  4FBU A;  4I29 A;  2PMZ F;  3QU2 A;  2QAR A;  1N62 A;  2W8K A;  4IRC A;  2QAR B;  2BPF A;  1Z1V A;  3MR5 A;  1ZQ1 C;  3ZD9 A;  3M9N B;  3WK6 A;  1U45 A;  4F50 A;  5KG3 A;  4RQ7 A;  2H5X A;  2WF9 A;  3HX0 A;  1SKW A;  3HRD D;  1RQN A;  9ICN A;  3MAB A;  5ALN A;  3ZDA A;  1VJ5 A;  9ICJ A;  3FAH A;  4DL3 A;  1X66 A;  2XY7 A;  3GV5 B;  4JV0 A;  2BPC A;  1UCV A;  4DL6 A;  1N60 A;  5KFQ A;  1TVA A;  3ETR A;  3F53 A;  4NL9 A;  4BGD A;  3PO4 A;  1S0V A;  5J8Y C;  2A19 A;  2AHO B;  2OHF A;  4M9H A;  2KZZ A;  1D8L A;  4IQT A;  5GTH U;  2BDP A;  4QNL A;  4Q8E A;  2UVU A;  2EQY A;  9ICI A;  1XSP A;  3NVY A;  1FFU A;  9ICR A;  3Q8Q B;  1KLN A;  5EWF A;  5DQH A;  2ZIU B;  2HBM A;  3QX7 A;  1QQ6 A;  1U4B A;  2L5Y A;  4OO1 J;  4QZE A;  4KLJ A;  1RZT A;  2H3V A;  4QZ8 A;  2HHV A;  3HKZ F;  1V38 A;  4UB6 U;  5B5E U;  3SYZ A;  9ICF A;  4ED1 A;  4M6W A;  4DLG A;  4QWA A;  3F2D A;  2YX8 A;  5KFX A;  3NTU A;  4PL2 A;  3OGU A;  4BWM A;  1JIH A;  3SEI A;  2JEJ A;  3JPQ A;  3C1Z A;  1IM4 A;  4C4T A;  2ASD A;  3WK4 A;  5J2D A;  4O3M A;  2VAN A;  1L3U A;  3N28 A;  2DBY A;  5D46 A;  1CI4 A;  5JU5 A;  2K4E A;  5KFD A;  4BDP A;  5J0T A;  9ICA A;  9ICV A;  4P4O A;  2EAM A;  3OJU A;  2B6G A;  4NM2 A;  4DL4 A;  5KFH A;  3ONN A;  2PXI A;  4GXK A;  1QQ5 A;  5J2E A;  4I2A A;  2OEH A;  1PZN A;  2ZJ8 A;  2W54 A;  4F2R A;  4RNM A;  5KFI A;  4EZ6 A;  5A0L A;  3ETL A;  4KN7 A;  5BOL A;  5DGA A;  1TAM A;  8ICM A;  4FE3 A;  2KMD A;  3M7D A;  4EEK A;  3GIM A;  3MFH A;  4F4K A;  1LKY B;  3RJE A;  2JGA A;  3RH6 A;  4KLM A;  3H4D A;  4ECZ A;  4CF3 A;  2W7P A;  4UB4 A;  5KT6 A;  5J0R A;  1L7O A;  1ZQK A;  1ZD4 A;  3HIL A;  5KFY A;  4KLO A;  3AU2 A;  2G5I B;  2HVH A;  2AGP A;  1L8L A;  3L3F X;  1RPL A;  4YR0 A;  1ZQA A;  2KK0 A;  3N7P D;  1NI3 A;  2W9B B;  4YR2 A;  2Y1I A;  2W9B A;  4Y2T A;  2JXJ A;  3V7L A;  3MGV A;  4FBT A;  2AJQ A;  4PGX A;  1UT5 A;  4F4Y A;  2BR0 A;  2KFN A;  4IC9 A;  4QZF A;  1S8O A;  2WF7 A;  3AQE A;  3MBY A;  1V85 A;  2HHQ A;  4DOB A;  3AUO A;  4RNO A;  1ZQZ A;  2Y1J A;  3C21 A;  4CDG A;  4ECV A;  5F9L A;  3OTQ A;  4YQW A;  5DB9 A;  4O3S A;  3TKA A;  1SWW A;  2FE9 A;  5AKJ A;  1K5O A;  5AI0 A;  1QTM A;  1BNP A;  5G5G A;  3BZK A;  4B6J A;  1L7M A;  2C2D A;  5AKY A;  5KG2 A;  5KFL A;  1COO A;  4OJO A;  3ZD8 A;  5ALI A;  4Y2Y A;  1NZP A;  4DQS A;  1NK9 A;  2QB0 B;  4B9U A;  1ED1 A;  1ZRM A;  3TAR A;  1X42 A;  3RH5 A;  2FLL A;  8ICN A;  3M8S A;  4KLE A;  4YCX A;  4RQN A;  4Q44 A;  4DQP A;  2KIV A;  2FMP A;  2NO4 A;  1Z4N A;  2JEF A;  2MAX A;  2ZIX B;  4JMU A;  2LYA A;  4ED0 A;  1PVP A;  2YN4 A;  3HW8 A;  4YD2 A;  5AKK A;  2W43 A;  4RQM A;  3C23 A;  2IOF K;  4Y2X A;  3TFR A;  2DFL A;  3SQI A;  5IIM A;  4QW9 A;  2ZUC A;  4EEN A;  3ISB A;  8ICL A;  3KZI U;  4DOC A;  4JV1 A;  1COK A;  4I2I A;  2GWS A;  3H0R B;  1JMS A;  5J2H A;  2KHQ A;  1DXS A;  5DBB A;  9ICO A;  1NJX A;  3KHH A;  4QZD A;  2PFO A;  3WKB A;  3RB4 A;  2RQ5 A;  1RDF A;  2ZUD A;  4KLU A;  4OJ5 A;  1T7P A;  1NKB A;  2KN7 A;  2E1F A;  3IRU A;  5ALJ A;  4C8M A;  3RR7 A;  1TK8 A;  9ICB A;  3AM9 A;  2VA3 A;  4JWN A;  4DOA A;  1N63 A;  1RYS A;  4GC6 A;  2JR5 A;  4KLD A;  4UAW A;  2Q0Z X;  2ES6 A;  1Q46 A;  4R8U B;  2BKE A;  3PX6 A;  3UMC A;  8ICP A;  3QEB Z;  3GII A;  2KJ5 A;  4GFJ A;  5J0Q A;  3LYS A;  2EZZ A;  4FZN A;  1MQ2 A;  1ZQQ A;  3PML A;  2JZB B;  1XO1 A;  1KN5 A;  5KG7 A;  4GIB A;  4UB1 A;  2ASJ A;  8ICF A;  4PHE A;  1OUQ A;  4EBE A;  5KNI A;  2WTF A;  3GQC A;  4CF4 A;  1KDH A;  2JHD A;  3BZC A;  1URJ A;  2W3R A;  4OCZ A;  3BQ1 A;  5J2I A;  1HEK A;  3E2E A;  4F5O A;  4ED3 A;  1X9W A;  2VA8 A;  5B66 U;  4J9P A;  5HML A;  5EOZ A;  4RPX A;  3ED5 A;  4DS4 A;  2HOF A;  2K8C B;  7ICQ A;  1M6Y A;  5CHG A;  1LKY A;  4QWE A;  1BPE A;  2W3S A;  1ZQN A;  4EX7 A;  4GXI A;  4RQ3 A;  4Y2V A;  3NRZ A;  4ECY A;  5KFP A;  3LWL A;  4IR9 A;  3WK8 A;  1Q3U A;  2JH7 A;  5IIK A;  1WCL A;  1ZET A;  3SV3 A;  3CP8 A;  2VJ5 A;  2QLT A;  4I2J A;  8ICQ A;  5IIJ A;  9ICM A;  1ZQC A;  4R65 A;  4UAS A;  5F9N A;  7ICG A;  5KFM A;  3HT3 A;  2HDO A;  4O0I A;  7ICL A;  4HAI A;  2IHN A;  3QUT A;  4M2Y A;  3RBE A;  3QYP A;  5AIA A;  2XCA A;  5JRT A;  4DEZ A;  4EZ9 A;  3QE9 Y;  2A1J B;  2W9A A;  5AKE A;  4XQ8 A;  4ECS A;  2VA2 A;  1U9L A;  3L5K A;  2NO5 A;  2ZIU A;  4Z6D A;  3N7R C;  4C80 A;  3ORY A;  5DB8 A;  1ZD5 A;  4RU9 A;  3N97 B;  4C8L A;  5AM1 A;  2F1I A;  2Z7J A;  3RRG A;  2LMR A;  4KLL A;  2VIX A;  1JUD A;  3U26 A;  2M9N A;  5AM4 A;  2VKQ A;  3IHQ B;  3D2S A;  5AM2 A;  9ICE A;  3MR6 A;  4MF8 A;  1DGS A;  4UBC A;  2F8L A;  1D9F A;  3NUQ A;  2XGP A;  1T3N A;  5T14 A;  2NRW A;  1JN3 A;  5DGB A;  1AQ6 A;  1LB2 B;  1NK6 A;  2K4H A;  1NK8 A;  4J9K A;  3C2M A;  1KFT A;  2LBO A;  2JV3 A;  4OJP A;  5KFR A;  5KTQ A;  4IR1 A;  5H2F U;  4Y2P A;  1H38 A;  3PST A;  8ICE A;  2D6F C;  4TUQ A;  3WK7 A;  5DDM A;  4EYI B;  5KFT A;  2IOH A;  4C8N A;  2ZJ5 A;  5KFW A;  3PR5 B;  1KSP A;  3MDA A;  2I5H A;  1F0M A;  1NK5 A;  2LI6 A;  1T8E A;  1RQL A;  2CN1 A;  3GDX A;  4C7Z A;  1QSS A;  1ZD3 A;  2M0N A;  4G9B A;  4Y2R A;  4Q43 A;  2BGW A;  5AKG A;  2WAQ F;  4DQQ A;  4ZOH C;  9ICU A;  8ICI A;  1X40 A;  2RLT A;  4M47 A;  3H0L B;  4LVS A;  2BZF A;  4K4H A;  5AM5 A;  7ICV A;  3T5H A;  3EW9 A;  1BPZ A;  4O9M A;  4TUS A;  8ICB A;  3ALR A;  5HNK A;  2HOQ A;  3IG5 A;  2W04 A;  2KKP A;  5D4B A;  5HHI A;  4MFA A;  2ZIX A;  5G5H A;  3O0F A;  2H3Z A;  3ICX A;  5DBC A;  3QZ8 A;  2JEI A;  1WUD A;  5KFO A;  4B9V A;  4PZO A;  2F8K A;  4RUC A;  1PK3 A;  3H8S A;  4PGQ A;  3ZDD A;  4XA5 A;  3MR3 A;  4UBB A;  1V97 A;  2V9W A;  2PI5 A;  5J0Y A;  5J2A A;  2CPR A;  3RB6 A;  4F4W A;  4F93 B;  2I6X A;  4UAT A;  5KAI U;  2XO7 A;  1XO0 A;  4B9T A;  1A77 A;  5KG6 A;  2WHE A;  3QU7 A;  1O03 A;  3HWT A;  2R18 A;  5KFE A;  4QIW F;  3PW0 A;  1F44 A;  5KG0 A;  3G6Y A;  3RAX A;  4UB3 A;  3D2Q A;  2QB0 A;  5KG4 A;  5KFF A;  3M6K A;  1L3V A;  1SL1 A;  1ZQI A;  4YFK A;  2CXY A;  2JRZ A;  4RNN A;  2K4P A;  1X9S A;  4DFJ A;  4DL5 A;  3PY8 A;  2I1Q A;  4DQI A;  4CGZ A;  2AQ0 A;  4RQ6 A;  2WAQ C;  4YD1 A;  1X6J A;  8ICR A;  1ZJM A;  3RJH A;  4EYH B;  4EBC A;  2F44 A;  5DKW A;  4BXO A;  2W9C B;  2KG5 A;  4US8 A;  2P6R A;  2FPM A;  4M04 A;  3EUB 2;  1XC9 A;  3K1Z A;  2A1J A;  2R8K A;  3PV8 A;  4O5E A;  1CUK A;  3EWA A;  4I27 A;  2D8C A;  7ICN A;  3KHG A;  1U47 A;  3CNH A;  4J03 A;  4DLE A;  3KKA C;  5AKZ A;  1NJY A;  4QWB A;  1MN8 A;  1MQ3 A;  3H0M B;  2OH2 A;  1ZYQ A;  1ZQO A;  4ECX A;  5KAF U;  5C0Y A;  2B21 A;  3KKA A;  5DQG A;  1B43 A;  4US9 A;  1ZQS A;  3J81 j;  4I2H A;  3SAH A;  5AI9 A;  4BUG A;  4QZA A;  3FYH A;  3K4G A;  1XSL A;  3NRW A;  3OHB A;  3UQ0 A;  4IQV A;  2RRD A;  4XRH A;  1DK3 A;  1SZP A;  3K1R B;  5CP2 A;  2K89 A;  2KVC A;  4I2B A;  2KZ3 A;  2WF6 A;  7ICI A;  2E8N A;  4AYB F;  4FS2 A;  4PHA A;  5KFN A;  2KSO B;  3QU4 A;  4NM1 A;  3R9K A;  4B9M A;  2KSO A;  2KZM A;  1A76 A;  2WB1 C;  2ZTD A;  5III A;  7ICE A;  5EE1 A;  5IIN A;  1N2X A;  3M9O B;  2H3F A;  1U48 A;  1UPH A;  1PK1 A;  3BQ2 A;  9ICP A;  3GZF A;  2AGQ A;  1ZQB A;  5AI5 A;  4ECU A;  1VLB A;  2GO7 A;  3HPO A;  5K4L A;  4J9O A;  1SIJ A;  7ICK A;  3IP4 B;  1HJP A;  3BDP A;  2PFQ A;  9ICW A;  1GO3 F;  3IG8 A;  3TAC B;  3FC4 A;  3VCB A;  1TFR A;  3OPX A;  1ARO P;  2G09 A;  1WYG A;  4DSI A;  7ICF A;  2HI0 A;  1ZQG A;  3AMZ A;  4M9L A;  3PSF A;  4X5V A;  2XID A;  2A1A A;  1NK4 A;  1ZQW A;  4M9J A;  4C7Y A;  4RQ5 A;  4RPY A;  5DG9 A;  1NNL A;  4DL2 A;  2JEG A;  2FJ6 A;  1L7N A;  1HIW A;  1FO4 A;  3FM9 A;  3SI8 A;  2HHX A;  4Y2Q A;  4DSL A;  4DL7 A;  1QLN A;  2XCP A;  4R63 A;  2HHS A;  4PL1 A;  2KIC A;  4IRD A;  4F4Z A;  2WFA A;  5ALG A;  4PHP A;  5L9X A;  3OSP A;  1IIP A;  1JXL A;  1YZ7 A;  5ALL A;  5J0W A;  3C2L A;  8ICU A;  4TQR A;  4Z6E A;  5ALD A;  4ECQ A;  1K1Q A;  4KX5 A;  4KMO B;  3CRX A;  2HHT A;  2HW3 A;  3SEN A;  2DPI A;  3SR6 A;  4HYK A;  4UW9 A;  4Y2J A;  4O3R A;  4DSE A;  2AGO A;  3QUB A;  4I2E A;  5J2B A;  3QXG A;  1TK0 A;  5J2C A;  1J2M A;  3V6J A;  3S6J A;  3KHL A;  3JPS A;  3M6Z A;  4NLC A;  1ZD2 P;  2NYV A;  1S97 A;  3F2B A;  3PNC A;  3F2C A;  3GIK A;  2FMQ A;  4LJX A;  3QNM A;  3TI0 A;  5E79 U;  4MFF A;  2EAO A;  2PFP A;  3H4B A;  5AKL A;  1C7Y A;  3UXN A;  2W9M A;  2MUT A;  4EEY A;  3B9J A;  3OSN A;  1L5U A;  3THV A;  5J0U A;  4FO6 A; 
#chains in the Genus database with same CATH homology
 1GO3 F;  2M0N A;  3IG8 A;  4BX9 C;  3VCB A;  3PSI A;  2KEY A;  2WAQ C;  2KV2 A;  3MGV A;  3OPX A;  1SZH A;  3F2D A;  2YX8 A;  2KJ9 A;  1CRX A;  2HBJ A;  2WAQ F;  2G09 A;  4OJ5 A;  1XNS A;  2KIW A;  3N7S C;  4PL2 A;  2PMZ C;  2XVT A;  2YB1 A;  1KBU A;  2E1F A;  2RHF A;  1Q3V A;  2VJ4 A;  3H0L B;  2OM6 A;  3LVW A;  3PSF A;  4IC9 A;  2F76 X;  2YB4 A;  3AQE A;  1MA7 A;  2WB1 F;  5KL8 B;  2LYB A;  1Z1B A;  2XID A;  2ZG6 A;  2JH1 A;  1Z19 A;  3K1Z A;  2ZIW B;  2KJ8 A;  3PZP A;  4CDG A;  2HOI A;  2F2A B;  2PMZ F;  2ZIW A;  3F5A A;  1PVQ A;  4O3M A;  4BJQ A;  4ACO A;  3E0F A;  3RF9 A;  1DRG A;  3ALR A;  2ZIV B;  4U6P A;  2KD1 A;  1YT3 A;  2HOQ A;  2JMG A;  3AQF A;  1HIW A;  2DF4 B;  2ZIV A;  5KL1 B;  4P0P B;  3IG5 A;  2G06 A;  2ZIU A;  1ZQ1 C;  2K4E A;  3N7R C;  2W04 A;  4QIW C;  2KKP A;  2ZXH A;  2ZXI A;  3VC8 A;  3H0M B;  2N1R A;  2OH2 A;  2KJ5 A;  4GFJ A;  3D2N A;  4ICA A;  4OJO A;  5CRX A;  4PL1 A;  3LYS A;  2KIC A;  2ZIX A;  3KZX A;  3KFU F;  2GOL A;  2K4I A;  4FZN A;  1IIP A;  2Z7J A;  4AYB C;  3ONN A;  1ED1 A;  2LKY A;  3DEE A;  5C0Y A;  3O0F A;  2VIX A;  4P0Q B;  2KNJ A;  4P0P A;  4WJ3 B;  2H3Z A;  4C0Z A;  3CYM A;  3ICX A;  4P0Q A;  4FZM A;  2VKQ A;  3D2S A;  3GU3 A;  3PSP A;  4KMO B;  2Y0S F;  3HKZ C;  4KX5 A;  3CRX A;  3SAH A;  1A6S A;  1OUQ A;  2XI9 A;  2F8L A;  2Q4T A;  4BUG A;  1WUD A;  3NUQ A;  5A0L A;  3NRW A;  2KHV A;  2MA1 A;  2OXO A;  2GH1 A;  2JHD A;  2RRD A;  1URJ A;  3F53 A;  5T14 A;  2W7O A;  2Y0S C;  1HEK A;  1TAM A;  1PVR A;  5HR6 A;  2HBL A;  2ZIX B;  2H3Q A;  2LHT A;  2BDU A;  2NV3 A;  4FE3 A;  3M7D A;  2K89 A;  4JMU A;  3C29 A;  4NWI A;  3SMV A;  2KVC A;  2LYA A;  3F5E A;  1PVP A;  2KOB A;  2CRX A;  2CPR A;  2K4H A;  1L6N A;  4AYB F;  2HBK A;  2HOF A;  2K8C B;  2JGA A;  1NZB A;  1XO0 A;  4QNL A;  2G5H B;  2F77 X;  3M6Z A;  4NLC A;  2W7P A;  2HMX A;  2LBO A;  2E5S A;  2WB1 C;  4NLB A;  2R18 A;  1P7D A;  4KX3 A;  2KKV A;  4OJP A;  4QIW F;  3F2B A;  3SQI A;  1F44 A;  4CRX A;  1T94 A;  3PST A;  2D6F C;  3LVV A;  3F2C A;  1Q3U A;  3D2Q A;  2JH7 A;  2G0A A;  2H3I A;  2K8B B;  3IN5 A;  2OYY A;  3H0R B;  4OJL A;  3SAG A;  5HR7 A;  2G07 A;  2H3F A;  3AL0 B;  1D8B A;  3M6K A;  1A0P A;  1UPH A;  1ECW A;  2KHQ A;  2G5I B;  2RP5 A;  2VJ5 A;  3CP8 A;  4FZL A;  3C28 A;  3RFA A;  3T79 A;  2ZIU B;  3L3F X;  2HBM A;  2DGZ A;  3N7P D;  2G08 A;  4OO1 J;  3GZF A;  4A8E A;  2MRL A;  2K8A A;  2CN1 A;  2H3V A;  4U7C A;  3SAF A;  2DQN B;  2W03 A;  2E1E A;  3HKZ F;  3IP4 B;  2A3V A;  4CGZ A;  4NV0 A;  4QJF B;  4OJ6 A;  2XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...