4ICAA

Crystal structure of a c-terminal truncated form of the matrix subunit (p15) of feline immunodeficiency virus (fiv)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
GNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Matrix protein p15
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
total genus 42
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4icaA00
2N1RA 4IC9A 2H3QA 2NV3A 1ECWA 1ED1A 1HEKA 4JMUA 4ICAA 2K4HA 1HIWA 1UPHA 2H3ZA 2H3VA 2HMXA 1A6SA 2K4IA 2K4EA 1TAMA 2H3IA 2JMGA 1L6NA 2LYAA 2H3FA 2GOLA 2LYBA
chains in the Genus database with same CATH superfamily
2H5XA 1T94A 4OJPA 1U4BA 3H8JA 4DWIA 4F8RA 2WFAA 4RNMA 1ZJMA 2JH7A 3QXGA 3LWMA 2OHFA 2PFNA 2KHQA 5KFPA 4GIBA 4F4XA 4CCHA 2G5IB 4KN7A 7ICTA 3WK6A 5EOZA 9ICRA 3OTQA 3GIMA 1PVRA 3QX7A 4QZCA 3WK9A 2E8PA 1SZPA 5KFIA 4UQGA 4E0DA 3PSFA 2EZXA 5AM4A 5L1JA 3VCBA 2EQYA 4J9PA 1RDFA 4DFKA 1F5SA 4RQ5A 3MABA 5KL8B 3MR6A 4F50A 2E8NA 2P35A 5EE3A 1Q3UA 2PI4A 4FO6A 2HBMA 4Q8EA 3C2MA 1ZXIA 5EE9A 1P7DA 2AXTU 5ALJA 5IILA 1IXRA 2A1JA 2FMSA 2KKVA 4EYHB 2C28A 3M6ZA 4FBTA 5EE1A 3CNHA 2R8GA 2HHQA 4F4WA 1T3NA 3WKEA 4FFDA 5KFXA 1DOQA 4KITB 4QW9A 2KP7A 4G3IA 4KLFA 1L3UA 3QU9A 1N2XA 2EAMA 5KFJA 4IRDA 2BKEA 2AGOA 2G08A 3MFHA 2IMWP 4M9GA 4YG2A 5AKZA 2KHVA 2G09A 2HHTA 2XCAA 3IM1A 4M0AA 4PZOA 2HOQA 5J0PA 2HVHA 1J2NA 1QSSA 4KX5A 2F3NA 3RJFA 1Z1BA 1TK5A 4HYKA 2ALZA 3GZFA 5KFAA 3KBBA 5KFOA 3JPPA 9ICKA 1Z1VA 3TANA 4PHPA 2ODGA 3MGIA 4DFPA 2E1FA 1BVSA 4M47A 8ICNA 1ZQVA 2KNJA 3R9KA 1XWLA 5KFKA 1XSNA 1TAQA 2KE7A 1KQQA 1PK1B 3H7IA 5ALGA 3CYMA 2WF8A 1TKDA 3RJJA 3ZDEA 3ZDAA 2W8LA 2JV3A 3OSNA 3RAQA 1QH9A 3FYHA 3SZ2A 5F9NA 1IG6A 2PFQA 2ZG6A 3G6XA 4DQSA 2BDUA 2B21A 1NJXA 8ICVA 2QB0B 1XSPA 2VANA 3E0FA 5J0TA 5J8YC 5AKGA 3WKDA 1UCVA 4CE6A 2LPEA 5AI4A 2WF6A 5CP2A 5G5HA 3C21A 7ICLA 2QKQA 3AU6A 1ZQAA 1NJZA 2KKPA 1L3SA 2BPCA 2JGAA 4Y2VA 1NJWA 8ICIA 4B9MA 2LM4A 1SWVA 4EX7A 1B22A 4NV0A 3IDWA 4KLLA 3GIIA 2CXYA 2XVTA 1RQNA 2DL0A 4O3MA 3RJGA 3OJSA 4U6PA 1QCKA 5AKEA 1ZD5A 3ETLA 1MSWD 4F93B 4ED1A 2MUTA 1LB2B 2VA3A 4I2FA 4UB2A 2V4RA 2KOBA 1U49A 5J2GA 4Q43A 1SV0C 5DB7A 5BOMA 3F2DA 3UXOA 4DSJA 4YR3A 4RNNA 4I2DA 5AK6A 5ALPA 2R8KA 3BQTA 5AI9A 5CEHA 3C5FA 2CRXA 3V7JA 1NKEA 3PO5A 4KLQA 3OHBA 3GV7B 3K75D 3BQ0A 1LKYA 1DXSA 4Y2RA 5ALVA 1RM6C 5H2FU 3BDPA 4ZH4A 4DFMA 1L3VA 5J0SA 3LK9A 4DL2A 1ZQCA 3HT3A 3MC1A 2Q4TA 3RJIA 2HHXA 1X66A 4ED2A 2BCSA 3C5GA 1ZOLA 1KW4A 4EBEA 4BJQA 3AM9A 3SQIA 3RRHA 2W9MA 4GXJA 1RXVA 1OW5A 1X6IA 1NZPA 4QZGA 1ZJNA 7ICNA 1XS9D 4ED3A 2RQ5A 5AI5A 4XA5A 4LZDA 4F2SA 3PSIA 3NVWA 4DSIA 4O9MA 9ICHA 4Z6FA 2CN1A 4FZNA 1IM4A 3D2QA 1XC9A 5AI0A 1NNLA 1ZQZA 1KRPA 4UB6U 5IIOA 4DSEA 4C8LA 2W9BA 1D8LA 5DBCA 3JPSA 3UQ2A 4DLEA 5J8YA 1NK8A 5KG2A 1UHUA 2ISOA 8ICJA 3T79A 4UB8U 4Q8FA 1K1QA 2KIWA 2VKQA 4USAA 2NRZA 1J2MA 3HJEA 4YFKA 4MFAA 2HHUA 4QIWF 2VIXA 5DB9A 1KSPA 1RXWA 4KLDA 1J97A 4PGYA 5KT5A 3PR4A 3H40A 1Z3EB 4OJLA 4EEKA 3HRDD 3MDCA 4JV1A 1IIPA 3AMZA 4KLTA 4YXJA 4PHEA 1S0OA 2ZIVA 3N97B 1NKCA 4P4MA 1BPZA 1U47A 3GQCA 3PY8A 9ICFA 2R8IA 4K4HA 2OEHA 7ICOA 1SV0A 5KFRA 4I2BA 4EENA 3PW7A 1D8BA 1X40A 1HUOA 4F71A 3GFKB 2EAPA 4ECXA 5HMMA 3F2BA 3O0FA 1VDVA 5KAIU 3KHRA 3RBDA 4LJXA 1Z4OA 2KIVA 2DQNB 4DF4A 4EEYA 4NLGA 1BGXT 2A1AA 2NV3A 2W8KA 3V7LA 4ECVA 5AKYA 5KTQA 3ED5A 4DOAA 2HSZA 3PW0A 4DCCA 5HR6A 4KTQA 4CNQA 7ICMA 3E2EA 2FLNA 1PVQA 3UMGA 2IHMA 2PFOA 1NZBA 2FE9A 2QB0A 1BPEA 9ICBA 5CWRA 1SZHA 4QZDA 5T14A 1HJPA 2DBYA 3AEVA 5AM0A 3L5KA 5KFWA 3LWLA 4US8A 4OCZA 5IIIA 4ECRA 1Y88A 2WTFA 5AM5A 2FMPA 2RDJA 4I2HA 3UXNA 8ICGA 1ZQOA 2I5HA 2HOIA 5AKJA 1ZQJA 4PPXA 2K8AA 4UAWA 4QW8A 5ALXA 2LBOA 1ZQ1C 3BQ2A 4F5QA 3RH5A 8ICHA 2ZJ8A 5HNKA 1MQ2A 1ZD4A 4C8KA 2M0NA 1SXDA 2BDPA 4YR0A 2J6TA 2R8JA 4Z6EA 4KMUA 4R66A 5KFNA 4RQ4A 4FBUA 3QEAZ 1O03A 3EUB2 2OXOA 1QQ6A 4DSKA 3PO4A 3CRXA 4R8UA 1CEZA 4RPXA 5KG7A 1ZQYA 2IA6A 2UVWA 1ZQDA 4TQSA 1TE2A 1XO1A 3UXPA 3SV4A 2WB1F 1T8EA 3NVVA 3FDSA 1SGGA 4BGDA 3OJUA 2VA2A 4QZFA 3T3FA 3WKBA 3NGDA 4F4YA 2ZUDA 1Z4NA 3J81j 1OXJA 2K8CB 4C80A 2UVRA 1NK9A 2FI1A 3TAPA 3DV9A 1X9XA 3SENA 4KMOB 4YMNA 2FPKA 4O3SA 4I2CA 1GO3F 3PNCA 8ICCA 5AI6A 3TADC 2W9AA 7ICPA 1CRXA 5GTHU 3PX0A 3NTUA 4KLIA 2B0CA 8ICRA 2HW3A 4RNOA 4YQWA 2ASJA 1NK5A 2BR0A 5AM1A 4M2YA 5AKXA 1C7YA 4FZLA 2KJ9A 4ED6A 3QNMA 4KLGA 1YT3A 4F91B 2KD1A 3Q8SB 4MF2A 3C2LA 2JEFA 4QZBA 1CI4A 1ZQKA 4O3RA 1LKYB 2EDUA 4UBBA 4YXMA 5D49A 3WK7A 4RQ0A 8ICMA 4RQ7A 5CRXA 9ICWA 1XSLA 1L7OA 2NRTA 2W11A 2FMQA 2RHFA 3RB4A 3ISCA 5DQGA 3LDAA 2YY6A 4DL3A 1FFVA 3M8SA 4PHAA 3EWAA 2JRZA 1ZRNA 3HKZC 5CA7A 4O5CA 4QJFB 5ALSA 1MA7A 2YQEA 4RU9A 3A0BU 2KG5A 3JPOA 3AU2A 5DQIA 4DS5A 4OJ5A 2ZTEA 2C2RA 2BCUA 3SV3A 9ICPA 5KG3A 2WF7A 3PR5B 4NL9C 7ICHA 3C1YA 3N7SC 4QZ8A 5ALEA 5ALDA 1K1SA 2W9BB 4GFJA 5ALRA 5DB8A 1ZQSA 3T5HA 4KLUA 4OO1J 5ALQA 2ZIXB 4KLEA 4I2GA 2FJ6A 2EAOA 5KG1A 3S6JA 4QWDA 2WB1C 1HIWA 3KFUF 4O5EA 2VA8A 5J0OA 1TAMA 4F92B 5KT7A 5KFHA 5EWEA 5ALNA 4ECTA 5L1MA 1JXLA 1N61A 4NWIA 1IV8A 3THVA 2RLTA 2RRDA 2Y9TA 2KZZA 1N5WA 4C0ZA 3AUOA 2ZIVB 4NM2A 2A3VA 4EX6A 4ECYA 3KHGA 3KKAC 3V72A 3UPQA 3ONNA 3QUTA 3D6JA 1YZ7A 3TADA 5KG0A 3H4BA 4IRKA 2AQ4A 4UB3A 5AM2A 3B0XA 2HOFA 2IOFA 5JRTA 3MBYA 1SKSA 3B0YA 2EZZA 9ICSA 2R18A 4BUGA 2AH5A 5G5GA 4CF3A 2ZXIA 4ED8A 3HPOA 1WWVA 2HMXA 3ISDA 2JR5A 1F0MA 3PX6A 3SMVA 1FFUA 1ZQXA 5A0LA 1JRPA 1V38A 1ZQNA 4IC9A 3ZDDA 5BOLA 3VC8A 3HW8A 3NVZA 4NLNA 1N62A 1B43A 1ZQUA 3M7DA 3C23A 5EWFA 3MR2A 4PGQA 3PZPA 4TURA 2HBLA 3F2CA 4Q45A 7ICKA 4Y2YA 1NOMA 3RTVA 4RZRA 1HEKA 1JROA 4G9BA 4O3OA 3GILA 2MA1A 1L3TA 1ZQEA 4C4TA 4QNLA 1Q8KA 1S77D 4KX3A 7ICRA 3QU7A 4EELA 1ZYQA 4B9NA 4DL5A 5KFUA 4NL9A 4QWCA 4LZGA 2A19A 2KJ8A 4NLBA 3GIJA 5AKHA 3EPIA 2CPRA 1MC8A 4DFJA 2HBJA 5HHHA 4ZOHC 3QZ8A 1TAUA 2I1QA 2K4IA 5KFYA 4M6WA 2BZFA 5ALHA 4TUSA 3A0HU 3Q8QB 2EZYA 4Y2SA 5KFGA 1UT5A 5B66U 9ICVA 3AQFA 1JXEA 4J9KA 5AK3A 4R8UB 8ICOA 4PL1A 2D8CA 3D2SA 3LVWA 4KLSA 4B6JA 2ZTCA 4QWAA 2E8MA 2XY6A 3KKAA 2HDOA 2KICA 2H3QA 5DB6A 3UQ0A 2HVIA 3NS1A 2BQRA 2W3RA 2NO5A 2ATLA 5KFEA 3ICXA 4DL4A 4DL6A 4AYBF 1WUDA 3IV6A 2O6KA 5AHXA 5KFTA 3BJYA 4M9HA 3ZI4A 4DSFA 4ECQA 4LVSA 3M8RA 5D46A 1B4FA 1QTMA 2YX8A 4US9A 2OCEA 3H8SA 4BWJA 5L1IA 2FPLA 4EZ6A 4RQ1A 4P0PA 2K4PA 8ICTA 4NY8A 2DF4B 5HHIA 1AROP 4J9LA 5JUMA 2C2EA 5HR7A 2F8LA 2DWQA 4B9UA 4CF4A 1BNPA 4NJ8A 1ZQWA 2V4QA 5J2BA 2DKXA 4RPZA 8ICXA 3IP4B 2HCFA 3BQ1A 1S9FA 3RBEA 1URJA 1WYGA 2LKYA 2ZIXA 4ECSA 1BPBA 3MGVA 5ALMA 2MRLA 1TFRA 4TUPA 3K1RB 2KN7A 1QQ7A 2PXIA 4Z6DA 2W43A 4QZHA 4XQ8A 3TFRA 2ZUBA 4UAVA 4CDGA 5J2CA 2L5YA 1D9FA 3RF9A 1KFDA 5AKKA 7ICQA 4C7YA 2BGWA 4FS2A 5KFSA 2VJ5A 2JXJA 3C29A 1QLNA 1N63A 2F77X 4BWMA 4DOCA 1SL0A 1ZQLA 5ALOA 5KT4A 1X2IA 3WK4A 2JH1A 1TVAA 1ZQRA 3QYPA 3WU2U 4EZ9A 5KNIA 4EBCA 3V7KA 8ICFA 8ICBA 4RQMA 4NLCA 4JB3A 5DDYA 2E1EA 1X9WA 3GIKA 3BS7A 3SI8A 7ICGA 2KFNA 3GU3A 5BPCA 4IR9A 5ALYA 1RZTA 5TISU 2JMGA 9ICXA 2QLTA 5IINA 3TAQA 2E3TA 4Y2XA 2GWSA 1Q46A 3V6JA 2D6FC 1NI3A 3KZXA 2JEGA 5CB1A 3SR6A 4C4RA 4MF8A 1MQ3A 9ICTA 2K4HA 1NK0A 4ED7A 4EYIB 4RPYA 4R63A 2GO7A 4Y2JA 4JWNA 4DOBA 3EPGA 2C2DA 4CF5A 2QB1A 2E8OA 1S0MA 2NYVA 1XNSA 2PKEA 5KAFU 5L1KA 2D3DA 2Y0SF 1RPLA 2G06A 4AYBC 3RH4A 1RYUA 3ALRA 3N7PD 4QZAA 1L7PA 2F44A 5KFZA 1BPDA 4IRCA 4RQ8A 4ECUA 5DGAA 1JN3A 7ICJA 3H4DA 5DKWA 1K5OA 3MR5A 3TARA 4YMMA 3PW2A 4YN4A 5J2HA 3V6HA 1WWUA 3LYSA 1ZETA 4YMOA 3RR8A 4GC7A 3PVXA 4I2JA 8ICWA 3HKZF 4KLJA 4ICAA 8ICPA 2J6UA 3JPTA 5KFCA 3D2NA 1XO0A 2AQ0A 4M9LA 2KVCA 3FAHA 3I28A 4JK1A 3ETRA 5HMLA 1X42A 4RQ6A 4MEXA 4GLXA 2UVVA 4PHDA 2XGPA 1JI7A 1ZQBA 4P0QA 4ELVA 4I2EA 2W04A 3H0RB 1SB3C 3IN5A 2YB4A 5EE0A 2R8HA 4K4GA 1DGSA 1LVHA 2JZBA 9ICIA 4YR2A 2B6GA 3RB6A 2MSNA 5DBBA 7ICUA 1S8OA 2HHSA 3PMNA 2WF9A 5DG8A 5E79U 3WKCA 1S0NA 1ZQGA 9ICMA 1FEZA 4UB4A 3Q8PB 2P6RA 5KFMA 2C22A 1BNOA 1V85A 3PSPA 2I6XA 1KL9A 1WG8A 1V9PA 2K60A 4DEZA 4PGXA 7ICFA 1VLBA 3FM9A 3TKAA 2GH1A 2F2AB 4FE3A 4IQUA 4M6WB 4B9VA 2W54A 3KOOA 3ZD9A 3RJKA 3T5KA 4P4PA 2PMZF 5AKIA 1SKRA 1D9DA 4NLZA 4R64A 7ICVA 4UATA 5DDMA 3M9MB 3AQEA 4FZMA 1KKXA 1YZ6A 4QZEA 1PK3A 2YN4A 2BQUA 1BPYA 5EWGA 2Y0SC 3OPXA 3I1YA 3KHLA 3SD7A 2YTUA 2YMQA 5ALTA 4UBCA 2KVSA 2YB1A 4O3PA 2DUYA 2W7PA 2XIDA 3Q8RB 1UA1A 4GXIA 3QU5A 4XRHA 4KN4A 3KZIU 4JMUA 3BQ7A 4F5NA 4O3QA 1TV9A 1A0PA 3WKAA 3QU2A 4MFFA 2NRWA 1N56A 1A76A 5C5JA 1BPXA 1F44A 2DPIA 2E5SA 1RQLA 2ASDA 9ICEA 4P0PB 5J2JA 4DQQA 4NLKA 2HHVA 5KFDA 5TZVA 1L5UA 4BXOA 2ZIUB 1KLNA 2NRXA 1WCNA 3DDHA 3HX0A 4UAYA 4Y2PA 1SV4A 3F53A 5IIJA 1UPHA 4F3OA 2Y1IA 4NXZA 5J0RA 3LVVA 3E58A 5DLGA 2ZXHA 1QSLA 3FC4A 5AKLA 5KT3A 4J9QA 3BZKA 3RB0A 2UVUA 4QZ9A 4DQIA 7ICIA 1CUKA 9ICNA 4M04A 2Y9UA 3RJHA 2FLLA 8ICQA 3QU4A 2KK0A 1RYRA 4I2AA 2JEIA 2H3VA 3Q8KA 3JPRA 5AM3A 4OJOA 4RUCA 1L8LA 4C8MA 1SWWA 8ICEA 5C0YA 1TK8A 4XUSA 4OJ6A 2PI5A 2M9NA 1OUQA 3QE9Y 4C4SA 4OD0A 4PJ0U 1COOA 3PW5A 4J03A 3NVYA 3AL0B 3T5JA 4P4OA 2BCQA 4DO9A 5ALKA 5HP4A 1U48A 5DG7A 3SEIA 1T3QA 4CRXA 3TQ1A 3EZ5A 5ALWA 1D8YA 4MHVA 2KMDA 4C8OA 1ZQMA 3IG8A 8ICSA 3SAFA 4DLGA 2XI9A 2PMZC 1NJYA 2BPFA 2NO4A 2IOHA 1JUDA 4PL2A 5ALUA 1S10A 1A6SA 1AQ6A 5JU5A 5DBAA 2XY7A 5CR0A 1QSYA 1RG6A 2LYBA 2AHOB 4UW9A 3C28A 2HI0A 2KFZA 4AP9A 1S5LU 2ZIWA 2F8KA 4GXKA 4ELTA 3KHHA 3NASA 2QARB 3N7RC 2KJ5A 1LV5A 4DF8A 4Y2UA 2N1RA 3Q8MA 4ED0A 8ICAA 4YCXA 2XC9A 4RT2A 3HWTA 3NUQA 4YD1A 3H0MB 4JWMA 4QWEA 3BS5B 2AU0A 4Q44A 4IQVA 4F5OA 2J6SA 3C1ZA 5KFFA 5J2EA 2FLPA 2KEYA 2ZJAA 1N5XA 1KFSA 5AI8A 4ECZA 2W9CA 3RR7A 5F3XB 3CW2C 2LHTA 4RT3A 3GDXA 2BQ3A 1KDHA 4FS1A 2V9WA 4MEYA 2IBKA 9ICOA 3B9JA 2F1HA 4PH5A 3G6VA 5FP0A 2XICA 3AN1A 5JTIA 1DK2A 3GV5B 2AGPA 3KTQA 4IS7A 4Y2TA 4X5VA 2H3FA 3TFSA 4UARA 1MN8A 2GLEA 4P0QB 3WK5A 3SAHA 1UT8A 3SYZA 1ZD3A 1SXEA 2DKZA 4Z6CA 2KTQA 1JMSA 3T5LA 2JEJA 4B9TA 3RJEA 4JV0A 1KEJA 1UQVA 2JZBB 3NRZA 2G0AA 1TK0A 2PFPA 5ALFA 2GOLA 1T7PA 5F9LA 1KN5A 1QQ5A 5DG9A 2XY5A 1DGJA 4I28A 4GC6A 3IG5A 2FDRA 3L3FX 5KL1B 9ICAA 4DSLA 4ECWA 9ICUA 4RQ2A 4YP3A 5CJ7A 3H8WA 3Q8LA 4C8NA 3QZ7A 4YD2A 2I9GA 5IIMA 2ISPA 1HUZA 4DQPA 2YMLA 2W55A 4EBDA 3JPQA 4ACOA 1Z00B 3OSPA 4QZIA 2JHDA 2YMPA 5D4BA 2OH2A 1COKA 4O3NA 2KSOB 1S97A 2WAQF 1X9SA 5K4LA 2ZIUA 5AK5A 3PW4A 4UB5A 3MDAA 5AIAA 4TUQA 1N48A 1SKWA 3SAGA 1NK6A 1PUZA 2LM1A 1Q3VA 1KFTA 1FIQA 1SIJA 2EANA 2RDIA 4KLOA 4PZNA 2FPMA 3U26A 2Q0ZX 3CP8A 2OYYA 9ICGA 3EW9A 5KFVA 3RFAA 3MFIA 3C2KA 5J0UA 3WK8A 4JV2A 2G07A 2HBKA 5AIBA 4TQRA 5KT2A 2LYAA 5CHGA 4UB1A 2BPGA 2MAXA 5KG6A 2AGQA 9ICQA 1L7MA 3MR3A 1O08A 5L1LA 4F72A 3M9OB 1NK4A 3ISBA 5L9XA 3L4PA 4MFCA 1A77A 2P6UA 4I2IA 1L7NA 1ZQQA 1M6YA 5ALIA 4RQNA 2DPJA 7ICEA 1ZQHA 3F5AA 1S76D 5J2DA 4F5RA 5KFLA 3RB3A 1ZQIA 4BXOB 4I29A 4P2HA 3EYZA 8ICYA 3N28A 5AK4A 3UM9A 2G5HB 2RP5A 1X6JA 2ZUCA 7ICSA 4KLHA 1NK7A 3QUQA 5DQHA 8ICUA 3HILA 4UAZA 3HP6A 1DRGA 4IQTA 4M9NA 2WHEA 9ICCA 5B5EU 3RRGA 2DGZA 2WF5A 2A1JB 4RUAA 1PZNA 4DQRA 2BCRA 2OWOA 2OM6A 3BZCA 4F5PA 3ZDBA 4Y2QA 4UASA 1PK1A 4DL7A 5ALLA 2H3ZA 3H0LB 2W03A 1SL1A 5J2FA 3ZDCA 3ORYA 1S0VA 8ICLA 2LI6A 1RYSA 2F76X 2QARA 4NM1A 2MU2A 2Z7JA 4K4IA 3G6YA 4F2RA 1H38A 5DLFA 1X9MA 3PMLA 1Z19A 1ZQTA 3K1ZA 4DS4A 1EXNA 4F4KA 2KV2A 3GV8B 5KFQA 2K4EA 3BS5A 2H3IA 4A8EA 1WCLA 3MGHA 2WAQC 5J0WA 5KT6A 4J9OA 1ZQFA 1ED1A 3IRUA 2XCPA 1L8OA 5ALZA 2ZJ5A 5J0XA 2W7OA 3PX4A 4BDPA 5DGBA 2ES6A 2BHNA 2K8BB 2NRVA 4IL6U 2YMMA 4R65A 5IIKA 4I27A 1ZQPA 4BX9C 1PVPA 2W3SA 2VJ4A 3OGUA 1XU4A 1ECWA 3NRWA 2ZIWB 4B9LA 8ICKA 4J9RA 1ZRMA 4J9MA 5J0QA 4IQWA 3V6KA 4DFDA 1KTQA 1U9LA 2EH9A 1N60A 2BCVA 5J2AA 2AJQA 4YVZA 4F4ZA 1FO4A 3JPNA 3RH6A 5KFBA 1SL2A 4QIWC 4QWBA 4KLMA 5J2IA 3F5EA 5KG4A 1UA0A 1KBUA 9ICJA 1DK3A 2F1IA 3UMCA 3QEBZ 3KD3A 2KZMA 1ZD2P 2W9CB 4HAIA 1L6NA 3H8MA 1NKBA 5KG5A 4O5KA 1V97A 2ESEA 4ELUA 3PV8A 2ASLA 2IOFK 2ZTDA 3M6KA 3OHAA 1VJ5A 2LYHA 5J0YA 3RAXA 5AICA 1B0XA 3TACB 1U45A 1Z00A 3DEEA 4O0IA 3N4MB 2HHWA 2IHNA 4UAUA 2KZ3A 3QUBA 4CGZA 3IHQB 4B9SA 2KSOA 2P66A 3ZD8A 8ICZA 2LMRA 3I76A 4M9JA 4RQ3A 1C20A 5J29A 2MUTB 3M9NB 3UMBA 5GTIU 2XO7A 2Y1JA 3QUCA 1JX4A 2F1JA 5J2KA 4J9SA 2DFLA 3PSTA 3K4GA 4JUZA 4J9NA 1JIHA 2XGQA 4C7ZA 1T4GA 4WJ3B 9ICLA 2K89A 3M1YA 3TI0A 4IR1A 1JALA 4U7CA
chains in the Genus database with same CATH topology
4O3MA 2ZIXB 1T94A 2HBLA 2YX8A 4OJPA 1PVPA 2VJ4A 3F2CA 4KMOB 4P0PA 1ECWA 4U6PA 3C28A 2D6FC 1HEKA 3NRWA 2G5HB 1GO3F 2JH7A 2RP5A 2ZIWB 3GZFA 2ZIUB 3KZXA 3IG5A 2KHQA 2MA1A 3L3FX 2K4HA 3T79A 5KL1B 1CRXA 2G5IB 2WB1C 1HIWA 2ZIWA 3F53A 1UPHA 2DF4B 3KFUF 2KIWA 1DRGA 2VKQA 2KOBA 5HR7A 4QNLA 2F8LA 1TAMA 2HOIA 3N7RC 1PVRA 3PSPA 4QIWF 4KX3A 2VIXA 2E1FA 3F2DA 2K8AA 3LVVA 4FZLA 2KJ9A 1XNSA 2KNJA 2KJ5A 2ZXHA 2Y0SF 2DGZA 3IP4B 4ACOA 2N1RA 1YT3A 2KD1A 2JHDA 2G06A 3PSFA 4AYBC 4OJLA 3ALRA 3N7PD 4NWIA 1ZQ1C 1URJA 2KJ8A 2OM6A 2RRDA 4NLBA 4QIWC 2OH2A 4P0PB 3NUQA 2LKYA 2ZIXA 4C0ZA 3VCBA 3H0MB 3MGVA 2CRXA 2ZIVB 3F5EA 2CPRA 2GH1A 1IIPA 2F2AB 4FE3A 2A3VA 2WAQF 1KBUA 2HBJA 2MRLA 3CYMA 2ZIVA 5KL8B 2ZIUA 2H3ZA 2H3VA 2K4IA 3ONNA 2M0NA 1Q3UA 3H0LB 5CRXA 2W03A 2HBMA 4OJOA 3SAGA 1L6NA 2KEYA 2PMZF 5C0YA 4CDGA 2F76X 1Q3VA 4OJ6A 3LYSA 3M6KA 1P7DA 2LHTA 2Z7JA 2HOFA 1OUQA 2Q4TA 3RF9A 3AQEA 2RHFA 1D8BA 4FZMA 2LBOA 2ZG6A 2OXOA 3AQFA 3DEEA 3HKZF 3CP8A 3AL0B 1Z19A 2KKVA 2VJ5A 2BDUA 2OYYA 3K1ZA 2R18A 4ICAA 4BUGA 3C29A 2Y0SC 4PL1A 2F77X 3OPXA 3RFAA 4BJQA 3M6ZA 2XICA 2ZXIA 3SQIA 3CRXA 3D2NA 1XO0A 2KV2A 4CGZA 3D2SA 2HMXA 2KVCA 3F2BA 4CRXA 3O0FA 3LVWA 2JH1A 2K4EA 2YB1A 2G07A 2H3IA 3E0FA 2HBKA 3HKZC 4A8EA 2W7PA 4QJFB 1MA7A 2LYAA 3SMVA 2XIDA 2WAQC 2H3FA 2DQNB 2WB1F 5A0LA 3IG8A 4P0QB 4IC9A 3SAHA 2KICA 2H3QA 2NV3A 3SAFA 4OJ5A 1ED1A 3VC8A 2XI9A 4P0QA 2W7OA 4JMUA 4NLCA 2W04A 2PMZC 3PSIA 3H0RB 1A0PA 2E1EA 2CN1A 2KKPA 5HR6A 4FZNA 1PVQA 3ICXA 2G08A 2K8BB 3D2QA 3N7SC 2JGAA 4PL2A 3IN5A 3PSTA 1A6SA 3GU3A 1WUDA 4AYBF 1NZBA 2K8CB 3M7DA 2KHVA 4GFJA 2G09A 2YB4A 1F44A 4WJ3B 2JMGA 4BX9C 2G0AA 4U7CA 2E5SA 4NV0A 4KX5A 1SZHA 2HOQA 2K89A 4OO1J 5T14A 2XVTA 3F5AA 2GOLA 2LYBA 1Z1BA 3PZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1R A;  4IC9 A;  2H3Q A;  2NV3 A;  1ECW A;  1ED1 A;  1HEK A;  4JMU A;  4ICA A;  2K4H A;  1HIW A;  1UPH A;  2H3Z A;  2H3V A;  2HMX A;  1A6S A;  2K4I A;  2K4E A;  1TAM A;  2H3I A;  2JMG A;  1L6N A;  2LYA A;  2H3F A;  2GOL A;  2LYB A; 
#chains in the Genus database with same CATH topology
 2H5X A;  1T94 A;  4OJP A;  1U4B A;  3H8J A;  4DWI A;  4F8R A;  2WFA A;  4RNM A;  1ZJM A;  2JH7 A;  3QXG A;  3LWM A;  2OHF A;  2PFN A;  2KHQ A;  5KFP A;  4GIB A;  4F4X A;  4CCH A;  2G5I B;  4KN7 A;  7ICT A;  3WK6 A;  5EOZ A;  9ICR A;  3OTQ A;  3GIM A;  1PVR A;  3QX7 A;  4QZC A;  3WK9 A;  2E8P A;  1SZP A;  5KFI A;  4UQG A;  4E0D A;  3PSF A;  2EZX A;  5AM4 A;  5L1J A;  3VCB A;  2EQY A;  4J9P A;  1RDF A;  4DFK A;  1F5S A;  4RQ5 A;  3MAB A;  5KL8 B;  3MR6 A;  4F50 A;  2E8N A;  2P35 A;  5EE3 A;  1Q3U A;  2PI4 A;  4FO6 A;  2HBM A;  4Q8E A;  3C2M A;  1ZXI A;  5EE9 A;  1P7D A;  2AXT U;  5ALJ A;  5IIL A;  1IXR A;  2A1J A;  2FMS A;  2KKV A;  4EYH B;  2C28 A;  3M6Z A;  4FBT A;  5EE1 A;  3CNH A;  2R8G A;  2HHQ A;  4F4W A;  1T3N A;  3WKE A;  4FFD A;  5KFX A;  1DOQ A;  4KIT B;  4QW9 A;  2KP7 A;  4G3I A;  4KLF A;  1L3U A;  3QU9 A;  1N2X A;  2EAM A;  5KFJ A;  4IRD A;  2BKE A;  2AGO A;  2G08 A;  3MFH A;  2IMW P;  4M9G A;  4YG2 A;  5AKZ A;  2KHV A;  2G09 A;  2HHT A;  2XCA A;  3IM1 A;  4M0A A;  4PZO A;  2HOQ A;  5J0P A;  2HVH A;  1J2N A;  1QSS A;  4KX5 A;  2F3N A;  3RJF A;  1Z1B A;  1TK5 A;  4HYK A;  2ALZ A;  3GZF A;  5KFA A;  3KBB A;  5KFO A;  3JPP A;  9ICK A;  1Z1V A;  3TAN A;  4PHP A;  2ODG A;  3MGI A;  4DFP A;  2E1F A;  1BVS A;  4M47 A;  8ICN A;  1ZQV A;  2KNJ A;  3R9K A;  1XWL A;  5KFK A;  1XSN A;  1TAQ A;  2KE7 A;  1KQQ A;  1PK1 B;  3H7I A;  5ALG A;  3CYM A;  2WF8 A;  1TKD A;  3RJJ A;  3ZDE A;  3ZDA A;  2W8L A;  2JV3 A;  3OSN A;  3RAQ A;  1QH9 A;  3FYH A;  3SZ2 A;  5F9N A;  1IG6 A;  2PFQ A;  2ZG6 A;  3G6X A;  4DQS A;  2BDU A;  2B21 A;  1NJX A;  8ICV A;  2QB0 B;  1XSP A;  2VAN A;  3E0F A;  5J0T A;  5J8Y C;  5AKG A;  3WKD A;  1UCV A;  4CE6 A;  2LPE A;  5AI4 A;  2WF6 A;  5CP2 A;  5G5H A;  3C21 A;  7ICL A;  2QKQ A;  3AU6 A;  1ZQA A;  1NJZ A;  2KKP A;  1L3S A;  2BPC A;  2JGA A;  4Y2V A;  1NJW A;  8ICI A;  4B9M A;  2LM4 A;  1SWV A;  4EX7 A;  1B22 A;  4NV0 A;  3IDW A;  4KLL A;  3GII A;  2CXY A;  2XVT A;  1RQN A;  2DL0 A;  4O3M A;  3RJG A;  3OJS A;  4U6P A;  1QCK A;  5AKE A;  1ZD5 A;  3ETL A;  1MSW D;  4F93 B;  4ED1 A;  2MUT A;  1LB2 B;  2VA3 A;  4I2F A;  4UB2 A;  2V4R A;  2KOB A;  1U49 A;  5J2G A;  4Q43 A;  1SV0 C;  5DB7 A;  5BOM A;  3F2D A;  3UXO A;  4DSJ A;  4YR3 A;  4RNN A;  4I2D A;  5AK6 A;  5ALP A;  2R8K A;  3BQT A;  5AI9 A;  5CEH A;  3C5F A;  2CRX A;  3V7J A;  1NKE A;  3PO5 A;  4KLQ A;  3OHB A;  3GV7 B;  3K75 D;  3BQ0 A;  1LKY A;  1DXS A;  4Y2R A;  5ALV A;  1RM6 C;  5H2F U;  3BDP A;  4ZH4 A;  4DFM A;  1L3V A;  5J0S A;  3LK9 A;  4DL2 A;  1ZQC A;  3HT3 A;  3MC1 A;  2Q4T A;  3RJI A;  2HHX A;  1X66 A;  4ED2 A;  2BCS A;  3C5G A;  1ZOL A;  1KW4 A;  4EBE A;  4BJQ A;  3AM9 A;  3SQI A;  3RRH A;  2W9M A;  4GXJ A;  1RXV A;  1OW5 A;  1X6I A;  1NZP A;  4QZG A;  1ZJN A;  7ICN A;  1XS9 D;  4ED3 A;  2RQ5 A;  5AI5 A;  4XA5 A;  4LZD A;  4F2S A;  3PSI A;  3NVW A;  4DSI A;  4O9M A;  9ICH A;  4Z6F A;  2CN1 A;  4FZN A;  1IM4 A;  3D2Q A;  1XC9 A;  5AI0 A;  1NNL A;  1ZQZ A;  1KRP A;  4UB6 U;  5IIO A;  4DSE A;  4C8L A;  2W9B A;  1D8L A;  5DBC A;  3JPS A;  3UQ2 A;  4DLE A;  5J8Y A;  1NK8 A;  5KG2 A;  1UHU A;  2ISO A;  8ICJ A;  3T79 A;  4UB8 U;  4Q8F A;  1K1Q A;  2KIW A;  2VKQ A;  4USA A;  2NRZ A;  1J2M A;  3HJE A;  4YFK A;  4MFA A;  2HHU A;  4QIW F;  2VIX A;  5DB9 A;  1KSP A;  1RXW A;  4KLD A;  1J97 A;  4PGY A;  5KT5 A;  3PR4 A;  3H40 A;  1Z3E B;  4OJL A;  4EEK A;  3HRD D;  3MDC A;  4JV1 A;  1IIP A;  3AMZ A;  4KLT A;  4YXJ A;  4PHE A;  1S0O A;  2ZIV A;  3N97 B;  1NKC A;  4P4M A;  1BPZ A;  1U47 A;  3GQC A;  3PY8 A;  9ICF A;  2R8I A;  4K4H A;  2OEH A;  7ICO A;  1SV0 A;  5KFR A;  4I2B A;  4EEN A;  3PW7 A;  1D8B A;  1X40 A;  1HUO A;  4F71 A;  3GFK B;  2EAP A;  4ECX A;  5HMM A;  3F2B A;  3O0F A;  1VDV A;  5KAI U;  3KHR A;  3RBD A;  4LJX A;  1Z4O A;  2KIV A;  2DQN B;  4DF4 A;  4EEY A;  4NLG A;  1BGX T;  2A1A A;  2NV3 A;  2W8K A;  3V7L A;  4ECV A;  5AKY A;  5KTQ A;  3ED5 A;  4DOA A;  2HSZ A;  3PW0 A;  4DCC A;  5HR6 A;  4KTQ A;  4CNQ A;  7ICM A;  3E2E A;  2FLN A;  1PVQ A;  3UMG A;  2IHM A;  2PFO A;  1NZB A;  2FE9 A;  2QB0 A;  1BPE A;  9ICB A;  5CWR A;  1SZH A;  4QZD A;  5T14 A;  1HJP A;  2DBY A;  3AEV A;  5AM0 A;  3L5K A;  5KFW A;  3LWL A;  4US8 A;  4OCZ A;  5III A;  4ECR A;  1Y88 A;  2WTF A;  5AM5 A;  2FMP A;  2RDJ A;  4I2H A;  3UXN A;  8ICG A;  1ZQO A;  2I5H A;  2HOI A;  5AKJ A;  1ZQJ A;  4PPX A;  2K8A A;  4UAW A;  4QW8 A;  5ALX A;  2LBO A;  1ZQ1 C;  3BQ2 A;  4F5Q A;  3RH5 A;  8ICH A;  2ZJ8 A;  5HNK A;  1MQ2 A;  1ZD4 A;  4C8K A;  2M0N A;  1SXD A;  2BDP A;  4YR0 A;  2J6T A;  2R8J A;  4Z6E A;  4KMU A;  4R66 A;  5KFN A;  4RQ4 A;  4FBU A;  3QEA Z;  1O03 A;  3EUB 2;  2OXO A;  1QQ6 A;  4DSK A;  3PO4 A;  3CRX A;  4R8U A;  1CEZ A;  4RPX A;  5KG7 A;  1ZQY A;  2IA6 A;  2UVW A;  1ZQD A;  4TQS A;  1TE2 A;  1XO1 A;  3UXP A;  3SV4 A;  2WB1 F;  1T8E A;  3NVV A;  3FDS A;  1SGG A;  4BGD A;  3OJU A;  2VA2 A;  4QZF A;  3T3F A;  3WKB A;  3NGD A;  4F4Y A;  2ZUD A;  1Z4N A;  3J81 j;  1OXJ A;  2K8C B;  4C80 A;  2UVR A;  1NK9 A;  2FI1 A;  3TAP A;  3DV9 A;  1X9X A;  3SEN A;  4KMO B;  4YMN A;  2FPK A;  4O3S A;  4I2C A;  1GO3 F;  3PNC A;  8ICC A;  5AI6 A;  3TAD C;  2W9A A;  7ICP A;  1CRX A;  5GTH U;  3PX0 A;  3NTU A;  4KLI A;  2B0C A;  8ICR A;  2HW3 A;  4RNO A;  4YQW A;  2ASJ A;  1NK5 A;  2BR0 A;  5AM1 A;  4M2Y A;  5AKX A;  1C7Y A;  4FZL A;  2KJ9 A;  4ED6 A;  3QNM A;  4KLG A;  1YT3 A;  4F91 B;  2KD1 A;  3Q8S B;  4MF2 A;  3C2L A;  2JEF A;  4QZB A;  1CI4 A;  1ZQK A;  4O3R A;  1LKY B;  2EDU A;  4UBB A;  4YXM A;  5D49 A;  3WK7 A;  4RQ0 A;  8ICM A;  4RQ7 A;  5CRX A;  9ICW A;  1XSL A;  1L7O A;  2NRT A;  2W11 A;  2FMQ A;  2RHF A;  3RB4 A;  3ISC A;  5DQG A;  3LDA A;  2YY6 A;  4DL3 A;  1FFV A;  3M8S A;  4PHA A;  3EWA A;  2JRZ A;  1ZRN A;  3HKZ C;  5CA7 A;  4O5C A;  4QJF B;  5ALS A;  1MA7 A;  2YQE A;  4RU9 A;  3A0B U;  2KG5 A;  3JPO A;  3AU2 A;  5DQI A;  4DS5 A;  4OJ5 A;  2ZTE A;  2C2R A;  2BCU A;  3SV3 A;  9ICP A;  5KG3 A;  2WF7 A;  3PR5 B;  4NL9 C;  7ICH A;  3C1Y A;  3N7S C;  4QZ8 A;  5ALE A;  5ALD A;  1K1S A;  2W9B B;  4GFJ A;  5ALR A;  5DB8 A;  1ZQS A;  3T5H A;  4KLU A;  4OO1 J;  5ALQ A;  2ZIX B;  4KLE A;  4I2G A;  2FJ6 A;  2EAO A;  5KG1 A;  3S6J A;  4QWD A;  2WB1 C;  1HIW A;  3KFU F;  4O5E A;  2VA8 A;  5J0O A;  1TAM A;  4F92 B;  5KT7 A;  5KFH A;  5EWE A;  5ALN A;  4ECT A;  5L1M A;  1JXL A;  1N61 A;  4NWI A;  1IV8 A;  3THV A;  2RLT A;  2RRD A;  2Y9T A;  2KZZ A;  1N5W A;  4C0Z A;  3AUO A;  2ZIV B;  4NM2 A;  2A3V A;  4EX6 A;  4ECY A;  3KHG A;  3KKA C;  3V72 A;  3UPQ A;  3ONN A;  3QUT A;  3D6J A;  1YZ7 A;  3TAD A;  5KG0 A;  3H4B A;  4IRK A;  2AQ4 A;  4UB3 A;  5AM2 A;  3B0X A;  2HOF A;  2IOF A;  5JRT A;  3MBY A;  1SKS A;  3B0Y A;  2EZZ A;  9ICS A;  2R18 A;  4BUG A;  2AH5 A;  5G5G A;  4CF3 A;  2ZXI A;  4ED8 A;  3HPO A;  1WWV A;  2HMX A;  3ISD A;  2JR5 A;  1F0M A;  3PX6 A;  3SMV A;  1FFU A;  1ZQX A;  5A0L A;  1JRP A;  1V38 A;  1ZQN A;  4IC9 A;  3ZDD A;  5BOL A;  3VC8 A;  3HW8 A;  3NVZ A;  4NLN A;  1N62 A;  1B43 A;  1ZQU A;  3M7D A;  3C23 A;  5EWF A;  3MR2 A;  4PGQ A;  3PZP A;  4TUR A;  2HBL A;  3F2C A;  4Q45 A;  7ICK A;  4Y2Y A;  1NOM A;  3RTV A;  4RZR A;  1HEK A;  1JRO A;  4G9B A;  4O3O A;  3GIL A;  2MA1 A;  1L3T A;  1ZQE A;  4C4T A;  4QNL A;  1Q8K A;  1S77 D;  4KX3 A;  7ICR A;  3QU7 A;  4EEL A;  1ZYQ A;  4B9N A;  4DL5 A;  5KFU A;  4NL9 A;  4QWC A;  4LZG A;  2A19 A;  2KJ8 A;  4NLB A;  3GIJ A;  5AKH A;  3EPI A;  2CPR A;  1MC8 A;  4DFJ A;  2HBJ A;  5HHH A;  4ZOH C;  3QZ8 A;  1TAU A;  2I1Q A;  2K4I A;  5KFY A;  4M6W A;  2BZF A;  5ALH A;  4TUS A;  3A0H U;  3Q8Q B;  2EZY A;  4Y2S A;  5KFG A;  1UT5 A;  5B66 U;  9ICV A;  3AQF A;  1JXE A;  4J9K A;  5AK3 A;  4R8U B;  8ICO A;  4PL1 A;  2D8C A;  3D2S A;  3LVW A;  4KLS A;  4B6J A;  2ZTC A;  4QWA A;  2E8M A;  2XY6 A;  3KKA A;  2HDO A;  2KIC A;  2H3Q A;  5DB6 A;  3UQ0 A;  2HVI A;  3NS1 A;  2BQR A;  2W3R A;  2NO5 A;  2ATL A;  5KFE A;  3ICX A;  4DL4 A;  4DL6 A;  4AYB F;  1WUD A;  3IV6 A;  2O6K A;  5AHX A;  5KFT A;  3BJY A;  4M9H A;  3ZI4 A;  4DSF A;  4ECQ A;  4LVS A;  3M8R A;  5D46 A;  1B4F A;  1QTM A;  2YX8 A;  4US9 A;  2OCE A;  3H8S A;  4BWJ A;  5L1I A;  2FPL A;  4EZ6 A;  4RQ1 A;  4P0P A;  2K4P A;  8ICT A;  4NY8 A;  2DF4 B;  5HHI A;  1ARO P;  4J9L A;  5JUM A;  2C2E A;  5HR7 A;  2F8L A;  2DWQ A;  4B9U A;  4CF4 A;  1BNP A;  4NJ8 A;  1ZQW A;  2V4Q A;  5J2B A;  2DKX A;  4RPZ A;  8ICX A;  3IP4 B;  2HCF A;  3BQ1 A;  1S9F A;  3RBE A;  1URJ A;  1WYG A;  2LKY A;  2ZIX A;  4ECS A;  1BPB A;  3MGV A;  5ALM A;  2MRL A;  1TFR A;  4TUP A;  3K1R B;  2KN7 A;  1QQ7 A;  2PXI A;  4Z6D A;  2W43 A;  4QZH A;  4XQ8 A;  3TFR A;  2ZUB A;  4UAV A;  4CDG A;  5J2C A;  2L5Y A;  1D9F A;  3RF9 A;  1KFD A;  5AKK A;  7ICQ A;  4C7Y A;  2BGW A;  4FS2 A;  5KFS A;  2VJ5 A;  2JXJ A;  3C29 A;  1QLN A;  1N63 A;  2F77 X;  4BWM A;  4DOC A;  1SL0 A;  1ZQL A;  5ALO A;  5KT4 A;  1X2I A;  3WK4 A;  2JH1 A;  1TVA A;  1ZQR A;  3QYP A;  3WU2 U;  4EZ9 A;  5KNI A;  4EBC A;  3V7K A;  8ICF A;  8ICB A;  4RQM A;  4NLC A;  4JB3 A;  5DDY A;  2E1E A;  1X9W A;  3GIK A;  3BS7 A;  3SI8 A;  7ICG A;  2KFN A;  3GU3 A;  5BPC A;  4IR9 A;  5ALY A;  1RZT A;  5TIS U;  2JMG A;  9ICX A;  2QLT A;  5IIN A;  3TAQ A;  2E3T A;  4Y2X A;  2GWS A;  1Q46 A;  3V6J A;  2D6F C;  1NI3 A;  3KZX A;  2JEG A;  5CB1 A;  3SR6 A;  4C4R A;  4MF8 A;  1MQ3 A;  9ICT A;  2K4H A;  1NK0 A;  4ED7 A;  4EYI B;  4RPY A;  4R63 A;  2GO7 A;  4Y2J A;  4JWN A;  4DOB A;  3EPG A;  2C2D A;  4CF5 A;  2QB1 A;  2E8O A;  1S0M A;  2NYV A;  1XNS A;  2PKE A;  5KAF U;  5L1K A;  2D3D A;  2Y0S F;  1RPL A;  2G06 A;  4AYB C;  3RH4 A;  1RYU A;  3ALR A;  3N7P D;  4QZA A;  1L7P A;  2F44 A;  5KFZ A;  1BPD A;  4IRC A;  4RQ8 A;  4ECU A;  5DGA A;  1JN3 A;  7ICJ A;  3H4D A;  5DKW A;  1K5O A;  3MR5 A;  3TAR A;  4YMM A;  3PW2 A;  4YN4 A;  5J2H A;  3V6H A;  1WWU A;  3LYS A;  1ZET A;  4YMO A;  3RR8 A;  4GC7 A;  3PVX A;  4I2J A;  8ICW A;  3HKZ F;  4KLJ A;  4ICA A;  8ICP A;  2J6U A;  3JPT A;  5KFC A;  3D2N A;  1XO0 A;  2AQ0 A;  4M9L A;  2KVC A;  3FAH A;  3I28 A;  4JK1 A;  3ETR A;  5HML A;  1X42 A;  4RQ6 A;  4MEX A;  4GLX A;  2UVV A;  4PHD A;  2XGP A;  1JI7 A;  1ZQB A;  4P0Q A;  4ELV A;  4I2E A;  2W04 A;  3H0R B;  1SB3 C;  3IN5 A;  2YB4 A;  5EE0 A;  2R8H A;  4K4G A;  1DGS A;  1LVH A;  2JZB A;  9ICI A;  4YR2 A;  2B6G A;  3RB6 A;  2MSN A;  5DBB A;  7ICU A;  1S8O A;  2HHS A;  3PMN A;  2WF9 A;  5DG8 A;  5E79 U;  3WKC A;  1S0N A;  1ZQG A;  9ICM A;  1FEZ A;  4UB4 A;  3Q8P B;  2P6R A;  5KFM A;  2C22 A;  1BNO A;  1V85 A;  3PSP A;  2I6X A;  1KL9 A;  1WG8 A;  1V9P A;  2K60 A;  4DEZ A;  4PGX A;  7ICF A;  1VLB A;  3FM9 A;  3TKA A;  2GH1 A;  2F2A B;  4FE3 A;  4IQU A;  4M6W B;  4B9V A;  2W54 A;  3KOO A;  3ZD9 A;  3RJK A;  3T5K A;  4P4P A;  2PMZ F;  5AKI A;  1SKR A;  1D9D A;  4NLZ A;  4R64 A;  7ICV A;  4UAT A;  5DDM A;  3M9M B;  3AQE A;  4FZM A;  1KKX A;  1YZ6 A;  4QZE A;  1PK3 A;  2YN4 A;  2BQU A;  1BPY A;  5EWG A;  2Y0S C;  3OPX A;  3I1Y A;  3KHL A;  3SD7 A;  2YTU A;  2YMQ A;  5ALT A;  4UBC A;  2KVS A;  2YB1 A;  4O3P A;  2DUY A;  2W7P A;  2XID A;  3Q8R B;  1UA1 A;  4GXI A;  3QU5 A;  4XRH A;  4KN4 A;  3KZI U;  4JMU A;  3BQ7 A;  4F5N A;  4O3Q A;  1TV9 A;  1A0P A;  3WKA A;  3QU2 A;  4MFF A;  2NRW A;  1N56 A;  1A76 A;  5C5J A;  1BPX A;  1F44 A;  2DPI A;  2E5S A;  1RQL A;  2ASD A;  9ICE A;  4P0P B;  5J2J A;  4DQQ A;  4NLK A;  2HHV A;  5KFD A;  5TZV A;  1L5U A;  4BXO A;  2ZIU B;  1KLN A;  2NRX A;  1WCN A;  3DDH A;  3HX0 A;  4UAY A;  4Y2P A;  1SV4 A;  3F53 A;  5IIJ A;  1UPH A;  4F3O A;  2Y1I A;  4NXZ A;  5J0R A;  3LVV A;  3E58 A;  5DLG A;  2ZXH A;  1QSL A;  3FC4 A;  5AKL A;  5KT3 A;  4J9Q A;  3BZK A;  3RB0 A;  2UVU A;  4QZ9 A;  4DQI A;  7ICI A;  1CUK A;  9ICN A;  4M04 A;  2Y9U A;  3RJH A;  2FLL A;  8ICQ A;  3QU4 A;  2KK0 A;  1RYR A;  4I2A A;  2JEI A;  2H3V A;  3Q8K A;  3JPR A;  5AM3 A;  4OJO A;  4RUC A;  1L8L A;  4C8M A;  1SWW A;  8ICE A;  5C0Y A;  1TK8 A;  4XUS A;  4OJ6 A;  2PI5 A;  2M9N A;  1OUQ A;  3QE9 Y;  4C4S A;  4OD0 A;  4PJ0 U;  1COO A;  3PW5 A;  4J03 A;  3NVY A;  3AL0 B;  3T5J A;  4P4O A;  2BCQ A;  4DO9 A;  5ALK A;  5HP4 A;  1U48 A;  5DG7 A;  3SEI A;  1T3Q A;  4CRX A;  3TQ1 A;  3EZ5 A;  5ALW A;  1D8Y A;  4MHV A;  2KMD A;  4C8O A;  1ZQM A;  3IG8 A;  8ICS A;  3SAF A;  4DLG A;  2XI9 A;  2PMZ C;  1NJY A;  2BPF A;  2NO4 A;  2IOH A;  1JUD A;  4PL2 A;  5ALU A;  1S10 A;  1A6S A;  1AQ6 A;  5JU5 A;  5DBA A;  2XY7 A;  5CR0 A;  1QSY A;  1RG6 A;  2LYB A;  2AHO B;  4UW9 A;  3C28 A;  2HI0 A;  2KFZ A;  4AP9 A;  1S5L U;  2ZIW A;  2F8K A;  4GXK A;  4ELT A;  3KHH A;  3NAS A;  2QAR B;  3N7R C;  2KJ5 A;  1LV5 A;  4DF8 A;  4Y2U A;  2N1R A;  3Q8M A;  4ED0 A;  8ICA A;  4YCX A;  2XC9 A;  4RT2 A;  3HWT A;  3NUQ A;  4YD1 A;  3H0M B;  4JWM A;  4QWE A;  3BS5 B;  2AU0 A;  4Q44 A;  4IQV A;  4F5O A;  2J6S A;  3C1Z A;  5KFF A;  5J2E A;  2FLP A;  2KEY A;  2ZJA A;  1N5X A;  1KFS A;  5AI8 A;  4ECZ A;  2W9C A;  3RR7 A;  5F3X B;  3CW2 C;  2LHT A;  4RT3 A;  3GDX A;  2BQ3 A;  1KDH A;  4FS1 A;  2V9W A;  4MEY A;  2IBK A;  9ICO A;  3B9J A;  2F1H A;  4PH5 A;  3G6V A;  5FP0 A;  2XIC A;  3AN1 A;  5JTI A;  1DK2 A;  3GV5 B;  2AGP A;  3KTQ A;  4IS7 A;  4Y2T A;  4X5V A;  2H3F A;  3TFS A;  4UAR A;  1MN8 A;  2GLE A;  4P0Q B;  3WK5 A;  3SAH A;  1UT8 A;  3SYZ A;  1ZD3 A;  1SXE A;  2DKZ A;  4Z6C A;  2KTQ A;  1JMS A;  3T5L A;  2JEJ A;  4B9T A;  3RJE A;  4JV0 A;  1KEJ A;  1UQV A;  2JZB B;  3NRZ A;  2G0A A;  1TK0 A;  2PFP A;  5ALF A;  2GOL A;  1T7P A;  5F9L A;  1KN5 A;  1QQ5 A;  5DG9 A;  2XY5 A;  1DGJ A;  4I28 A;  4GC6 A;  3IG5 A;  2FDR A;  3L3F X;  5KL1 B;  9ICA A;  4DSL A;  4ECW A;  9ICU A;  4RQ2 A;  4YP3 A;  5CJ7 A;  3H8W A;  3Q8L A;  4C8N A;  3QZ7 A;  4YD2 A;  2I9G A;  5IIM A;  2ISP A;  1HUZ A;  4DQP A;  2YML A;  2W55 A;  4EBD A;  3JPQ A;  4ACO A;  1Z00 B;  3OSP A;  4QZI A;  2JHD A;  2YMP A;  5D4B A;  2OH2 A;  1COK A;  4O3N A;  2KSO B;  1S97 A;  2WAQ F;  1X9S A;  5K4L A;  2ZIU A;  5AK5 A;  3PW4 A;  4UB5 A;  3MDA A;  5AIA A;  4TUQ A;  1N48 A;  1SKW A;  3SAG A;  1NK6 A;  1PUZ A;  2LM1 A;  1Q3V A;  1KFT A;  1FIQ A;  1SIJ A;  2EAN A;  2RDI A;  4KLO A;  4PZN A;  2FPM A;  3U26 A;  2Q0Z X;  3CP8 A;  2OYY A;  9ICG A;  3EW9 A;  5KFV A;  3RFA A;  3MFI A;  3C2K A;  5J0U A;  3WK8 A;  4JV2 A;  2G07 A;  2HBK A;  5AIB A;  4TQR A;  5KT2 A;  2LYA A;  5CHG A;  4UB1 A;  2BPG A;  2MAX A;  5KG6 A;  2AGQ A;  9ICQ A;  1L7M A;  3MR3 A;  1O08 A;  5L1L A;  4F72 A;  3M9O B;  1NK4 A;  3ISB A;  5L9X A;  3L4P A;  4MFC A;  1A77 A;  2P6U A;  4I2I A;  1L7N A;  1ZQQ A;  1M6Y A;  5ALI A;  4RQN A;  2DPJ A;  7ICE A;  1ZQH A;  3F5A A;  1S76 D;  5J2D A;  4F5R A;  5KFL A;  3RB3 A;  1ZQI A;  4BXO B;  4I29 A;  4P2H A;  3EYZ A;  8ICY A;  3N28 A;  5AK4 A;  3UM9 A;  2G5H B;  2RP5 A;  1X6J A;  2ZUC A;  7ICS A;  4KLH A;  1NK7 A;  3QUQ A;  5DQH A;  8ICU A;  3HIL A;  4UAZ A;  3HP6 A;  1DRG A;  4IQT A;  4M9N A;  2WHE A;  9ICC A;  5B5E U;  3RRG A;  2DGZ A;  2WF5 A;  2A1J B;  4RUA A;  1PZN A;  4DQR A;  2BCR A;  2OWO A;  2OM6 A;  3BZC A;  4F5P A;  3ZDB A;  4Y2Q A;  4UAS A;  1PK1 A;  4DL7 A;  5ALL A;  2H3Z A;  3H0L B;  2W03 A;  1SL1 A;  5J2F A;  3ZDC A;  3ORY A;  1S0V A;  8ICL A;  2LI6 A;  1RYS A;  2F76 X;  2QAR A;  4NM1 A;  2MU2 A;  2Z7J A;  4K4I A;  3G6Y A;  4F2R A;  1H38 A;  5DLF A;  1X9M A;  3PML A;  1Z19 A;  1ZQT A;  3K1Z A;  4DS4 A;  1EXN A;  4F4K A;  2KV2 A;  3GV8 B;  5KFQ A;  2K4E A;  3BS5 A;  2H3I A;  4A8E A;  1WCL A;  3MGH A;  2WAQ C;  5J0W A;  5KT6 A;  4J9O A;  1ZQF A;  1ED1 A;  3IRU A;  2XCP A;  1L8O A;  5ALZ A;  2ZJ5 A;  5J0X A;  2W7O A;  3PX4 A;  4BDP A;  5DGB A;  2ES6 A;  2BHN A;  2K8B B;  2NRV A;  4IL6 U;  2YMM A;  4R65 A;  5IIK A;  4I27 A;  1ZQP A;  4BX9 C;  1PVP A;  2W3S A;  2VJ4 A;  3OGU A;  1XU4 A;  1ECW A;  3NRW A;  2ZIW B;  4B9L A;  8ICK A;  4J9R A;  1ZRM A;  4J9M A;  5J0Q A;  4IQW A;  3V6K A;  4DFD A;  1KTQ A;  1U9L A;  2EH9 A;  1N60 A;  2BCV A;  5J2A A;  2AJQ A;  4YVZ A;  4F4Z A;  1FO4 A;  3JPN A;  3RH6 A;  5KFB A;  1SL2 A;  4QIW C;  4QWB A;  4KLM A;  5J2I A;  3F5E A;  5KG4 A;  1UA0 A;  1KBU A;  9ICJ A;  1DK3 A;  2F1I A;  3UMC A;  3QEB Z;  3KD3 A;  2KZM A;  1ZD2 P;  2W9C B;  4HAI A;  1L6N A;  3H8M A;  1NKB A;  5KG5 A;  4O5K A;  1V97 A;  2ESE A;  4ELU A;  3PV8 A;  2ASL A;  2IOF K;  2ZTD A;  3M6K A;  3OHA A;  1VJ5 A;  2LYH A;  5J0Y A;  3RAX A;  5AIC A;  1B0X A;  3TAC B;  1U45 A;  1Z00 A;  3DEE A;  4O0I A;  3N4M B;  2HHW A;  2IHN A;  4UAU A;  2KZ3 A;  3QUB A;  4CGZ A;  3IHQ B;  4B9S A;  2KSO A;  2P66 A;  3ZD8 A;  8ICZ A;  2LMR A;  3I76 A;  4M9J A;  4RQ3 A;  1C20 A;  5J29 A;  2MUT B;  3M9N B;  3UMB A;  5GTI U;  2XO7 A;  2Y1J A;  3QUC A;  1JX4 A;  2F1J A;  5J2K A;  4J9S A;  2DFL A;  3PST A;  3K4G A;  4JUZ A;  4J9N A;  1JIH A;  2XGQ A;  4C7Z A;  1T4G A;  4WJ3 B;  9ICL A;  2K89 A;  3M1Y A;  3TI0 A;  4IR1 A;  1JAL A;  4U7C A; 
#chains in the Genus database with same CATH homology
 4O3M A;  2ZIX B;  1T94 A;  2HBL A;  2YX8 A;  4OJP A;  1PVP A;  2VJ4 A;  3F2C A;  4KMO B;  4P0P A;  1ECW A;  4U6P A;  3C28 A;  2D6F C;  1HEK A;  3NRW A;  2G5H B;  1GO3 F;  2JH7 A;  2RP5 A;  2ZIW B;  3GZF A;  2ZIU B;  3KZX A;  3IG5 A;  2KHQ A;  2MA1 A;  3L3F X;  2K4H A;  3T79 A;  5KL1 B;  1CRX A;  2G5I B;  2WB1 C;  1HIW A;  2ZIW A;  3F53 A;  1UPH A;  2DF4 B;  3KFU F;  2KIW A;  1DRG A;  2VKQ A;  2KOB A;  5HR7 A;  4QNL A;  2F8L A;  1TAM A;  2HOI A;  3N7R C;  1PVR A;  3PSP A;  4QIW F;  4KX3 A;  2VIX A;  2E1F A;  3F2D A;  2K8A A;  3LVV A;  4FZL A;  2KJ9 A;  1XNS A;  2KNJ A;  2KJ5 A;  2ZXH A;  2Y0S F;  2DGZ A;  3IP4 B;  4ACO A;  2N1R A;  1YT3 A;  2KD1 A;  2JHD A;  2G06 A;  3PSF A;  4AYB C;  4OJL A;  3ALR A;  3N7P D;  4NWI A;  1ZQ1 C;  1URJ A;  2KJ8 A;  2OM6 A;  2RRD A;  4NLB A;  4QIW C;  2OH2 A;  4P0P B;  3NUQ A;  2LKY A;  2ZIX A;  4C0Z A;  3VCB A;  3H0M B;  3MGV A;  2CRX A;  2ZIV B;  3F5E A;  2CPR A;  2GH1 A;  1IIP A;  2F2A B;  4FE3 A;  2A3V A;  2WAQ F;  1KBU A;  2HBJ A;  2MRL A;  3CYM A;  2ZIV A;  5KL8 B;  2ZIU A;  2H3Z A;  2H3V A;  2K4I A;  3ONN A;  2M0N A;  1Q3U A;  3H0L B;  5CRX A;  2W03 A;  2HBM A;  4OJO A;  3SAG A;  1L6N A;  2KEY A;  2PMZ F;  5C0Y A;  4CDG A;  2F76 X;  1Q3V A;  4OJ6 A;  3LYS A;  3M6K A;  1P7D A;  2LHT A;  2Z7J A;  2HOF A;  1OUQ A;  2Q4T A;  3RF9 A;  3AQE A;  2RHF A;  1D8B A;  4FZM A;  2LBO A;  2ZG6 A;  2OXO A;  3AQF A;  3DEE A;  3HKZ F;  3CP8 A;  3AL0 B;  1Z19 A;  2KKV A;  2VJ5 A;  2BDU A;  2OYY A;  3K1Z A;  2R18 A;  4ICA A;  4BUG A;  3C29 A;  2Y0S C;  4PL1 A;  2F77 X;  3OPX A;  3RFA A;  4BJQ A;  3M6Z A;  2XIC A;  2ZXI A;  3SQI A;  3CRX A;  3D2N A;  1XO0 A;  2KV2 A;  4CGZ A;  3D2S A;  2HMX A;  2KVC A;  3F2B A;  4CRX A;  3O0F A;  3LVW A;  2JH1 A;  2K4E A;  2YB1 A;  2G07 A;  2H3I A;  3E0F A;  2HBK A;  3HKZ C;  4A8E A;  2W7P A;  4QJF B;  1MA7 A;  2LYA A;  3SMV A;  2XID A;  2WAQ C;  2H3F A;  2DQN B;  2WB1 F;  5A0L A;  3IG8 A;  4P0Q B;  4IC9 A;  3SAH A;  2KIC A;  2H3Q A;  2NV3 A;  3SAF A;  4OJ5 A;  1ED1 A;  3VC8 A;  2XI9 A;  4P0Q A;  2W7O A;  4JMU A;  4NLC A;  2W04 A;  2PMZ C;  3PSI A;  3H0R B;  1A0P A;  2E1E A;  2CN1 A;  2KKP A;  5HR6 A;  4FZN A;  1PVQ A;  3ICX A;  2G08 A;  2K8B B;  3D2Q A;  3N7S C;  2JGA A;  4PL2 A;  3IN5 A;  3PST A;  1A6S A;  3GU3 A;  1WUD A;  4AYB F;  1NZB A;  2K8C B;  3M7D A;  2KHV A;  4GFJ A;  2G09 A;  2YB4 A;  1F44 A;  4WJ3 B;  2JMG A;  4BX9 C;  2G0A A;  4U7C A;  2E5S A;  4NV0 A;  4KX5 A;  1SZH A;  2HOQ A;  2K89 A;  4OO1 J;  5T14 A;  2XVT A;  3F5A A;  2GOL A;  2LYB A;  1Z1B A;  3PZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...