4ICAA

Crystal structure of a c-terminal truncated form of the matrix subunit (p15) of feline immunodeficiency virus (fiv)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
GNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p15
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 42
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4icaA00
2HMXA 4ICAA 4IC9A 2H3QA 2JMGA 4JMUA 2K4IA 2LYBA 1TAMA 1ECWA 2GOLA 1HEKA 1L6NA 2H3FA 1A6SA 1UPHA 2H3ZA 2K4HA 2LYAA 1HIWA 2N1RA 2H3IA 2K4EA 1ED1A 2NV3A 2H3VA
chains in the Genus database with same CATH superfamily
5KAIU 1D9FA 7ICOA 5KFVA 5KG2A 5DDMA 1ZQJA 1SGGA 2XVTA 3RF9A 1RM6C 3Q8SB 4B9TA 5ALMA 3KTQA 4F4ZA 2G07A 1Q3VA 1PK1B 4R8UA 2VKQA 5EE3A 4F91B 4PZNA 2ZXIA 1MQ3A 1X42A 4UASA 5IINA 3LDAA 3JPOA 1S97A 4EEKA 4F92B 3SQIA 2DKXA 3AU6A 5CP2A 2J6UA 5ALUA 1ZQTA 8ICUA 4Z6EA 2KN7A 1SXDA 4RPYA 1KDHA 8ICAA 2LI6A 2EQYA 1SKRA 1NKEA 3EYZA 4I2GA 2XI9A 4DLEA 5KFJA 5J0TA 3G6YA 3Q8KA 5J0YA 5HR7A 3TADA 4I2BA 5K4LA 1F44A 2IHMA 2LMRA 2OHFA 4K4IA 1NK8A 5DDYA 1ZQLA 3PO4A 5KT4A 5DLFA 4MEYA 1PVRA 4Y2PA 5AK3A 4NLNA 1IM4A 4UB8U 5HHIA 4DFPA 4RQ1A 2ISOA 3CW2C 9ICAA 4NJ8A 4OJ6A 2PXIA 2XY7A 3CYMA 1S8OA 5KG0A 3KHRA 1AQ6A 5KFTA 5DGAA 2R8HA 1MA7A 4Y2UA 4EZ6A 2AGOA 2KMDA 4NLCA 5ALSA 1O08A 2WF6A 4C8NA 3H7IA 2NO4A 5AM0A 3PW0A 3QZ7A 3UMBA 7ICRA 2GH1A 4G9BA 4B9SA 2HW3A 4R65A 1ZRNA 2O6KA 3OPXA 1LKYB 4KX3A 3RJIA 4HYKA 3MBYA 2EH9A 7ICFA 2WF7A 2VA2A 1X6JA 1FO4A 4Y2JA 1KL9A 1UPHA 5DKWA 3RJKA 1CUKA 4I2CA 1YZ6A 1BPZA 2LM4A 4DFDA 4P4MA 2ASJA 8ICKA 3QNMA 4QWDA 4P2HA 2NYVA 1B43A 4JV0A 4US9A 4OJ5A 3KZIU 1NKCA 3C21A 1S9FA 1YZ7A 4E0DA 4RQ6A 3EPIA 1S10A 4YN4A 3PMNA 5CRXA 3K4GA 1JI7A 5AKHA 3BS7A 3UXOA 5ALFA 4FS1A 4KLEA 4ACOA 2KV2A 2KOBA 1CEZA 1ZQAA 3C29A 4PHDA 3D2SA 4IQUA 4Y2XA 3UPQA 5ALZA 3NUQA 4ED0A 2RRDA 5AK6A 4Y2QA 4ECSA 4KLJA 2PFQA 5AKGA 4F5QA 3QUTA 2G09A 3AQEA 2BPCA 4M6WA 2MUTB 4QZ9A 3QUCA 2K8CB 2JMGA 2F1JA 4UAUA 4ECXA 5KT3A 5ALTA 2VA8A 1TE2A 2W04A 1WWVA 2B6GA 1L6NA 3M7DA 3RAQA 4M04A 4XUSA 1MQ2A 2KNJA 1UA1A 1TK5A 2ZTCA 2H5XA 1D8BA 1YT3A 5DB7A 2KK0A 4O3MA 2C2RA 3EZ5A 4UARA 2IOHA 2WAQF 5ALLA 2AU0A 1V38A 2K4IA 1ZQWA 1JROA 3GIIA 5KFGA 4R63A 3GIKA 1Z3EB 4J9RA 5IIIA 2IA6A 2H3FA 9ICRA 2I9GA 2ES6A 2NRVA 4PL2A 2KZ3A 1TKDA 5J2FA 3PVXA 3HRDD 3PR5B 2M9NA 4DF8A 3HWTA 5ALRA 8ICSA 1NZPA 4EEYA 1JXLA 4DFMA 2E1EA 4NLBA 3UXPA 3SZ2A 4C4SA 1ZQNA 1T7PA 3RJGA 4DL3A 8ICQA 3PX6A 5KTQA 4MFFA 4F2RA 4DQPA 2J6SA 4BUGA 1COKA 4C4RA 4KLMA 3M9MB 5HMMA 1RXWA 3EWAA 3TADC 9ICCA 3RAXA 1FIQA 1N60A 2R8JA 1ZQVA 4ECVA 2XY6A 3TACB 5KFMA 2QB0A 9ICWA 2KEYA 8ICLA 2FPMA 3WK7A 2AQ0A 2G5HB 4J9PA 4DSFA 4DL5A 4UB3A 2ZUCA 4QZEA 5KG1A 4A8EA 1ZQSA 1QTMA 4KLOA 5AKJA 3HT3A 3QE9Y 2ESEA 4DF4A 2K4HA 4O3RA 4DFKA 1ZJMA 7ICLA 3SMVA 4QIWC 3HX0A 4PJ0U 4NV0A 4Z6FA 1NK6A 3MABA 4Y2YA 4FFDA 1EXNA 2FPKA 3RH5A 5GTIU 4PH5A 3UMGA 3TARA 5KNIA 8ICOA 1T94A 2IOFK 3PW7A 1X9SA 2EAOA 3MR6A 3IN5A 1JIHA 3MGHA 4DL2A 3UQ0A 4UW9A 1AROP 3ZDAA 1Z00A 5KG7A 4JV2A 4BWMA 3QX7A 3JPPA 5KFPA 1TV9A 4DOAA 1IXRA 3ED5A 4P0PB 3THVA 4NXZA 1TAMA 2ASDA 2HBLA 3V7KA 2KG5A 4BDPA 1RPLA 4J9KA 2W7OA 3PR4A 4DLGA 2HHQA 4DWIA 4C4TA 2V9WA 3NVVA 3GDXA 8ICMA 2KP7A 2ASLA 2HHWA 3N97B 3SYZA 3C1ZA 4YR3A 1XWLA 7ICGA 1NKBA 2NRZA 2VIXA 2N1RA 5IIJA 2HHSA 1HUOA 2AGPA 1SKWA 1HJPA 3VC8A 1N56A 8ICYA 2Z7JA 4DSIA 1Z4NA 2WAQC 5KFAA 1Q8KA 3PW5A 5D46A 3ZD8A 4PHEA 4O5CA 2YMMA 3RFAA 4UB1A 1S0MA 1NK0A 4UAZA 5EE1A 2VJ5A 1S0OA 3V6KA 4ELTA 1KEJA 2K4EA 1U45A 2BPFA 5EWEA 3HKZF 4Z6DA 5AM5A 2W7PA 2YN4A 2I1QA 2IBKA 3NRWA 5KFWA 3T5LA 1NNLA 1QQ6A 1H38A 1KW4A 2RP5A 2G08A 3IRUA 3RBEA 2ZIVA 2W9CB 3GIMA 1SZHA 4DOCA 3OJUA 1XO1A 5KFFA 3B0YA 4ZOHC 1N63A 2C2EA 3QUBA 4QZIA 4I2JA 2BQ3A 1A0PA 5IIMA 3WK4A 5AK5A 4RQMA 3R9KA 1JN3A 9ICLA 4EELA 2YQEA 5J2EA 5J2DA 2W9BA 3FAHA 5KFZA 4ELVA 5L1LA 2CRXA 4YR0A 3PW4A 3C2KA 2A1AA 3EPGA 3NS1A 5DQHA 2D3DA 4YMMA 3D6JA 1Z1BA 3MR2A 2KZZA 5HNKA 2UVRA 3ZD9A 5CWRA 9ICGA 1N2XA 2A1JA 3SI8A 4CCHA 4RQ4A 1VDVA 5KFOA 2Q0ZX 3AU2A 4BXOA 4I2DA 4M9GA 5KFUA 3ZDBA 3RB6A 7ICUA 3IV6A 3PSIA 3V72A 2OWOA 4EX6A 4QZCA 2AQ4A 2IMWP 4Q8EA 2DUYA 4B9NA 4ZH4A 4QWAA 7ICEA 3CNHA 1URJA 1HUZA 4QWBA 4GXKA 1IIPA 4QZGA 4J9NA 1ZQQA 2W54A 4TURA 2W3SA 2OM6A 5AI6A 9ICNA 1JALA 1PK3A 3DDHA 4RQ7A 1DRGA 9ICMA 4C7ZA 4KLUA 3AEVA 2ZIXA 5GTHU 3C23A 1ZQGA 1XSPA 1BNPA 4IRDA 1DOQA 5IIKA 3Q8RB 1ZJNA 1Z4OA 4JV1A 1J2NA 2ALZA 1C7YA 4FZMA 3H4DA 4YXJA 5AK4A 2ZJ8A 2BCSA 2HSZA 2VJ4A 4DQRA 4O3PA 3RR7A 2D8CA 2V4QA 2DPIA 5T14A 4JMUA 3PV8A 4NY8A 4YMNA 5AICA 3QU4A 4B9VA 3PY8A 4DQQA 3H4BA 8ICZA 2CN1A 1GO3F 1SV0A 1RZTA 1NJZA 1ZD2P 4PGQA 1RQLA 2OEHA 2G06A 5DG9A 3L4PA 4J9MA 4KLQA 3HKZC 2KFZA 1XO0A 2I6XA 2KSOA 4RUAA 4O3SA 3MC1A 2R18A 4MF2A 2XCPA 1SWVA 2PMZF 3RB0A 2F8LA 5AI5A 1XSLA 5KL1B 3HILA 5KFBA 4EX7A 5HR6A 9ICIA 2KKPA 1KFTA 2AXTU 4ED1A 2JZBA 4KMUA 5J0PA 7ICMA 4DL7A 2MA1A 3GFKB 4QJFB 5DQIA 2L5YA 4B9MA 4IRKA 1BPDA 3KKAA 2HCFA 5KG6A 2W3RA 4GLXA 1DXSA 3C2LA 5B5EU 3BS5B 2HI0A 1L7OA 2BDUA 2HBJA 4IR1A 3QU5A 2OXOA 4M9NA 2KHVA 2E3TA 3EW9A 2HOIA 3ZDCA 5DG8A 3KHLA 2RDIA 3HW8A 3MDAA 4YP3A 2YB1A 3NGDA 5BOMA 1UHUA 4Q43A 5ALGA 1DGJA 4QIWF 3LK9A 2E8PA 5L1KA 2ZIUA 2Y0SC 3MR5A 4MFCA 1SKSA 2AHOB 2KIVA 2WTFA 4B9LA 2K8BB 1TFRA 4GIBA 3CP8A 3M6KA 4MEXA 2W8LA 2KICA 5AM4A 3HP6A 8ICIA 2ZG6A 2UVWA 3PSFA 4DCCA 1ZQDA 5DB8A 1ZQMA 4KN4A 2FLPA 1XS9D 2QLTA 2P66A 5KL8B 5DGBA 8ICBA 1RQNA 3G6XA 4CRXA 1F0MA 4ED8A 4M9HA 4OD0A 4DOBA 1HIWA 5ALWA 5J2AA 2AGQA 1BPYA 1K5OA 4CGZA 4ELUA 2NO5A 4DSLA 1DK3A 3QEAZ 1Z19A 3SAFA 3H8SA 3A0BU 2BKEA 2QARB 4F72A 1SL1A 1XC9A 4P0QB 4KLSA 2MAXA 1VJ5A 3OHBA 4M9JA 3PO5A 1ZD4A 4F5OA 7ICVA 2RQ5A 4FBUA 3SR6A 5G5HA 5J8YA 1MC8A 3SV4A 4M0AA 5J0XA 4YCXA 3OSPA 2H3VA 4O9MA 2ZJ5A 4J9QA 4IC9A 5AKIA 3NRZA 4YD1A 3OTQA 4ED2A 4ECRA 5J2HA 3WK9A 4EENA 1ZQRA 3QZ8A 2FE9A 3Q8PB 4KLTA 4I2HA 3SV3A 5ALDA 5KFQA 4GC7A 3GV8B 3PSTA 8ICJA 9ICVA 4AYBF 1X66A 1QSYA 3TAPA 2KHQA 1BPEA 3AM9A 1S76D 5J2CA 2MU2A 4YQWA 1A6SA 1RXVA 4F4WA 4JWNA 2PMZC 3NASA 5KFCA 2LYAA 3RTVA 2HBMA 3WKBA 5IIOA 5FP0A 1MN8A 2HMXA 5F3XB 2W03A 2ZIWA 1N62A 1SV0C 2BGWA 2MSNA 3BQ2A 4LZDA 5J2GA 3PMLA 2QKQA 5E79U 4J9LA 4CF3A 5J2KA 9ICXA 2K89A 1JUDA 2W11A 2BDPA 2Q4TA 5DBCA 3SAGA 1NK7A 2YY6A 5CEHA 4LJXA 5J0OA 2GWSA 2PFOA 4RZRA 5L1IA 4R8UB 1OW5A 5IILA 3B9JA 5DBAA 4RQ0A 3RH4A 4XRHA 2BCQA 1OUQA 4J9OA 2F1HA 4UAVA 1F5SA 1RYSA 4F2SA 5KT5A 4ECZA 2EZXA 3EUB2 3IM1A 1PK1A 1DK2A 2W55A 3K1ZA 2KE7A 4PHPA 5KT2A 3KD3A 2K8AA 4K4HA 4MHVA 3OJSA 4I2FA 5C0YA 8ICWA 5EE0A 3C2MA 3JPQA 5DG7A 2BZFA 7ICNA 1NJWA 1ZQHA 4LZGA 4F93B 5DB6A 4FE3A 3M1YA 3PZPA 3JPTA 4I27A 8ICNA 3F2DA 4TUQA 3UQ2A 5JRTA 3CRXA 3MFIA 3BDPA 4QNLA 4RQNA 4RNOA 3C1YA 2K4PA 2BQRA 4F4YA 1ZQ1C 1ZQKA 1IV8A 1QLNA 1ZQBA 8ICTA 4C7YA 3GV5B 4R66A 1WCNA 4GXIA 1ZXIA 2C22A 4UBCA 1IG6A 5AI9A 3ALRA 1ZQIA 1TK8A 3H8JA 4C8OA 4O5EA 3LWMA 1U9LA 1XSNA 1D9DA 3WK5A 5KFIA 3IG5A 4QZHA 3N7PD 1UT5A 3PX0A 3SAHA 4QW8A 2H3ZA 3AQFA 1KSPA 2P6RA 1COOA 4U7CA 1ZD3A 2EZYA 4ECQA 5DLGA 1OXJA 2DF4B 2V4RA 5EWGA 3RR8A 1ZOLA 9ICFA 2QB1A 4RNNA 3F53A 4C8LA 1VLBA 3AL0B 2EAPA 3QU2A 2Y9UA 2HDOA 4QWCA 2P6UA 1LKYA 1JMSA 3LWLA 2KVCA 3KOOA 3PNCA 4FZNA 4RU9A 4CE6A 4AYBC 3RB3A 5AKEA 2PFPA 1KN5A 5J8YC 2LHTA 1PVPA 3T5KA 1QH9A 2ATLA 3LYSA 5J2BA 5AKXA 2A3VA 4I29A 4IR9A 4CNQA 3M9NB 1KFDA 3MR3A 1V9PA 1NJXA 4OCZA 5KFXA 3T5JA 4IQWA 3RBDA 3ONNA 4KLGA 2WF8A 4US8A 1V97A 4YVZA 4Q45A 2YTUA 1X9WA 1FFUA 3GILA 3I1YA 1CRXA 4UQGA 2DKZA 3TKAA 3F5EA 1QQ5A 4M6WB 2DGZA 5J2IA 3N7RC 4EBDA 3DV9A 2W9AA 4F4XA 9ICJA 3T79A 5KFYA 1Y88A 3N7SC 5KFNA 1K1SA 1ZQYA 2JEIA 2LYBA 4RQ2A 1CI4A 3GQCA 2WFAA 1SIJA 2MUTA 1XNSA 8ICPA 3KFUF 4NM1A 5F9LA 1B22A 1DGSA 5AKZA 4I2EA 3PX4A 9ICHA 4ED7A 2F3NA 2JH7A 8ICRA 4O3QA 5DQGA 1JXEA 3TAQA 4NLGA 4RQ5A 5ALNA 3ICXA 1ZQCA 2Y0SF 5J0QA 1KBUA 3HPOA 5L1MA 3N4MB 4BJQA 2FDRA 3IDWA 3K1RB 1ZQOA 2EAMA 4FBTA 2AH5A 3RB4A 4KLDA 2D6FC 3ORYA 2E5SA 3WK8A 2Y1IA 4RNMA 5ALOA 4OJLA 4MFAA 5EE9A 2ZJAA 3OSNA 2KVSA 4J9SA 2HHXA 1D8YA 3I76A 4EZ9A 1ZD5A 3RJHA 2ZUDA 5AKKA 3DEEA 3WKAA 1SL0A 3H8MA 4C80A 1X6IA 3TQ1A 3KHGA 3V7LA 4TQRA 5D4BA 1N61A 3UM9A 2R8KA 2XCAA 4R64A 1K1QA 2YMQA 2RDJA 2LPEA 4DQIA 5JU5A 2NRWA 2QB0B 2OH2A 3M8RA 5J0WA 5KAFU 4JK1A 4DQSA 3V7JA 9ICOA 4Q44A 3MGVA 5J0SA 4F5RA 4G3IA 4KLIA 2HHTA 1MSWD 4EBEA 1UA0A 3RRGA 2FPLA 5HMLA 2B21A 1L7NA 3GIJA 1U4BA 1ZQFA 2YMLA 2XY5A 1PVQA 1LVHA 2P35A 4DSEA 1KLNA 3AN1A 3NVZA 2FI1A 3BQ0A 2PFNA 3BZCA 4U6PA 2DWQA 2KD1A 5F9NA 3H0RB 3FC4A 1B0XA 1L3UA 2WF9A 2CXYA 4DO9A 3H40A 3Q8LA 2BCVA 5ALVA 9ICBA 2ZTEA 2HVIA 1NJYA 4JWMA 3V6JA 7ICKA 1LV5A 1UQVA 5JTIA 1JRPA 1Z00B 2ZXHA 3M6ZA 4Y2RA 4C0ZA 4ECUA 4TQSA 4RPZA 1JX4A 3T3FA 2E8OA 3QU7A 4QW9A 3GZFA 4PGXA 1M6YA 4F5NA 1NK4A 5ALKA 4DS4A 1U48A 5G5GA 1RDFA 2R8GA 4DSKA 4MF8A 2UVVA 5KG5A 4P0PA 1ZETA 4F5PA 4F3OA 2ISPA 2XGPA 1P7DA 1L8OA 1C20A 3TANA 4M47A 4PZOA 2ZUBA 5J0UA 2E8MA 2BQUA 5KFDA 3B0XA 3IP4B 7ICIA 4F4KA 5AM2A 3TFSA 2FLNA 4C8MA 1T3QA 4CF4A 3FYHA 1TK0A 2W43A 3WU2U 4NM2A 2JHDA 3AMZA 8ICVA 4I28A 3I28A 5ALPA 5A0LA 1ECWA 4B6JA 8ICFA 4KMOB 3RJJA 3J81j 2PI4A 5KG3A 5ALHA 4KN7A 1PZNA 1X9MA 2ODGA 2HOQA 1UT8A 4YFKA 4Y2TA 4DFJA 4ICAA 3WKDA 2J6TA 7ICSA 3E0FA 1T8EA 7ICJA 5CA7A 4DSJA 3IG8A 2DQNB 5ALJA 5EWFA 2KJ8A 2YB4A 4GC6A 4FZLA 4UATA 2BR0A 5AI4A 3BQ1A 2W9MA 2ZIVB 1A77A 2EZZA 4JUZA 3Q8QB 1X2IA 3QU9A 3ETRA 1Z1VA 4TUPA 8ICXA 5KT7A 5L9XA 3MGIA 9ICKA 4FO6A 1BNOA 4CDGA 5KFHA 3F2BA 5DBBA 2RLTA 1Q3UA 1L3VA 2E1FA 2LM1A 2DFLA 3AUOA 1KQQA 2YX8A 1WUDA 1S77D 2W9CA 2VA3A 2KJ9A 5ALEA 5KFRA 2JRZA 4YR2A 3QYPA 3SEIA 3H0LB 2I5HA 3VCBA 4USAA 9ICEA 3LVVA 5JUMA 2W9BB 5KT6A 3ISCA 1ED1A 4ED6A 4P4OA 3C5GA 4M9LA 2F8KA 5EOZA 3QUQA 9ICSA 1SWWA 3FDSA 4OJPA 4BGDA 2Y9TA 1U47A 5AIAA 3ZDDA 3WKEA 3JPSA 7ICQA 3D2NA 3NVYA 4DL4A 4F50A 4Y2SA 2A1JB 2EANA 2F44A 1ZYQA 4DEZA 4GXJA 4EYHB 4NLZA 3E2EA 2C28A 4BXOB 2KIWA 2ZTDA 2KKVA 1X40A 4O3OA 1L8LA 3BZKA 1HEKA 4P4PA 1TAUA 9ICQA 8ICEA 2B0CA 2K60A 3G6VA 4IL6U 2XGQA 4K4GA 1L7MA 5J29A 2H3IA 3T5HA 4ED3A 1QCKA 2FJ6A 1RYUA 3UMCA 1QSLA 3U26A 1RG6A 2KJ5A 3KZXA 1SB3C 2AJQA 2YMPA 5H2FU 1RYRA 5ALIA 3MDCA 4B9UA 4OJOA 4CF5A 2JEFA 2ZIXB 4NL9A 8ICCA 5AIBA 2JXJA 1NOMA 5CHGA 1NZBA 5AHXA 5AKLA 2G0AA 1KTQA 5KFKA 1TVAA 4PHAA 2JGAA 4QWEA 3SD7A 1N5XA 3RJEA 3MFHA 4KLFA 8ICGA 2E8NA 5BPCA 2HHUA 4IRCA 1Q46A 4QZAA 2BCRA 1UCVA 1V85A 4JB3A 1SL2A 2MRLA 3KKAC 2OYYA 3BQ7A 2Y1JA 3WKCA 2HHVA 1LB2B 4OO1J 2XIDA 3HJEA 1N48A 3JPNA 4PPXA 3ZDEA 2HBKA 5AM1A 4BX9C 2VANA 4YG2A 1KKXA 3H8WA 4UBBA 3O0FA 5ALXA 4J03A 3A0HU 3V6HA 4RUCA 3H0MB 2KSOB 1U49A 4EBCA 4X5VA 3NVWA 1PUZA 5TZVA 4FS2A 4YXMA 2JR5A 1FFVA 5C5JA 5J0RA 2GOLA 2F77X 1NI3A 1FEZA 4IQVA 4QZFA 3C5FA 1BPBA 3FM9A 1L5UA 1ZQUA 1A76A 1QQ7A 4YMOA 4Z6CA 9ICPA 2JZBB 3S6JA 3TFRA 5L1JA 4KLLA 1B4FA 2WB1F 3GV7B 2JEGA 1SXEA 4KITB 2KFNA 4QZ8A 4YD2A 2DPJA 2IOFA 3L5KA 5AKYA 1L3TA 5KFSA 2GO7A 3F2CA 3N28A 2A19A 2OCEA 7ICPA 2XICA 4O5KA 1XU4A 3BS5A 2NRTA 2W8KA 4LVSA 1ZRMA 1T3NA 3KBBA 3Q8MA 1L7PA 4XQ8A 1S5LU 2ZIUB 3OGUA 3D2QA 4UB5A 5ALYA 4UB2A 1N5WA 2JEJA 4F8RA 3UXNA 3BJYA 4KTQA 5KFLA 4UAYA 3ETLA 2FMPA 9ICTA 7ICHA 4DL6A 3NTUA 2PI5A 5AI0A 4HAIA 1T4GA 5KG4A 3ZI4A 2KZMA 1J97A 3C28A 2RHFA 2NV3A 4Y2VA 4O3NA 2LKYA 5CJ7A 4UB6U 3OHAA 4KLHA 4M2YA 4O0IA 4BWJA 3M9OB 1SV4A 1ZQPA 3WK6A 3LVWA 1ZQEA 2LYHA 1BVSA 1WCLA 2NRXA 2FMSA 2JV3A 1D8LA 3ISBA 4TUSA 4IQTA 2BCUA 2G5IB 3IHQB 4AP9A 4EYIB 5ALQA 2UVUA 2F2AB 3SENA 4QZBA 2DL0A 2WHEA 4RQ3A 1WYGA 2KTQA 1BGXT 5AI8A 4DS5A 2CPRA 2F1IA 2QARA 4P0QA 4UB4A 2XO7A 4F71A 3F5AA 3M8SA 1QSSA 4XA5A 2R8IA 5AM3A 4C8KA 1ZQXA 4NL9C 2H3QA 1TAQA 4NWIA 3PSPA 4RQ8A 5KFEA 2FMQA 3ISDA 2WF5A 3RH6A 2JH1A 2PKEA 1KRPA 5CR0A 2EDUA 2GLEA 3QEBZ 5CB1A 4PL1A 5HHHA 2FLLA 1S0VA 4ECYA 2DBYA 5DB9A 4I2AA 3K75D 1SZPA 1O03A 2HVHA 4I2IA 1BPXA 3TI0A 5TISU 2IHNA 5HP4A 3L3FX 4Q8FA 4GFJA 3KHHA 2C2DA 3RRHA 1X9XA 4NLKA 2F76X 4PGYA 1WG8A 3PW2A 4RPXA 4QZDA 4RT2A 4ECWA 2BHNA 2ZIWB 2BPGA 2LBOA 4KX5A 1KFSA 9ICUA 4WJ3B 4RT3A 1S0NA 3RJFA 1J2MA 4ECTA 4UAWA 5BOLA 3BQTA 2WB1C 3E58A 5J2JA 7ICTA 2XC9A 3QXGA 1L3SA 1WWUA 1NK9A 1ZQZA 2M0NA 5D49A 5B66U 1NK5A 2HOFA 3GU3A 8ICHA 3JPRA 4IS7A
chains in the Genus database with same CATH topology
4O3MA 3HKZF 1Z19A 2WAQF 3SAFA 3PSIA 4ICAA 3OPXA 2WB1F 2G5IB 2KKPA 3ICXA 5HR6A 2Y0SF 2XVTA 4KX3A 3RF9A 2K4IA 2W7PA 3E0FA 2KJ5A 3F53A 1KBUA 2F2AB 1T94A 3KZXA 4P0QB 3AL0B 3IG8A 2DQNB 2G07A 3NRWA 1Q3VA 2KJ8A 2MA1A 2YB4A 4BJQA 1URJA 2VKQA 4QJFB 2H3FA 4FZLA 1OUQA 1IIPA 2ZXIA 1UPHA 3IN5A 4OJOA 4PL2A 2CPRA 2ZIXB 2ZIVB 2ZXHA 4P0QA 2D6FC 3M6ZA 2E5SA 2OM6A 3SQIA 4C0ZA 2KVCA 3K1ZA 3F2CA 2BDUA 4OJLA 3F5AA 1NZBA 2K8AA 4CDGA 2RP5A 1DRGA 4FZNA 3F2BA 2H3VA 2G0AA 2G08A 2HBJA 2XICA 5C0YA 4OJ5A 2ZIXA 2ZIVA 4IC9A 4AYBC 2JGAA 2OXOA 2H3QA 1Q3UA 2E1FA 4NWIA 2LHTA 3GZFA 3PSPA 1SZHA 1PVPA 4P0PB 2KHVA 1TAMA 3DEEA 2JH1A 2YX8A 2HOIA 2E1EA 4NLBA 1WUDA 3LYSA 2A3VA 5CRXA 2KJ9A 2HBLA 2XI9A 4PL1A 4FE3A 3H0LB 3PZPA 4P0PA 3F2DA 2ZIUB 4FZMA 1A0PA 3VCBA 5HR7A 2YB1A 3LVVA 3D2QA 3CRXA 2VJ4A 4QIWF 4BUGA 1P7DA 1ED1A 2W7OA 1F44A 3PSTA 4ACOA 2MRLA 2OYYA 4QNLA 4NV0A 4AYBF 2ZIUA 3ONNA 5T14A 2KHQA 3L3FX 2Y0SC 2KV2A 4GFJA 4JMUA 4OO1J 2KOBA 2XIDA 2OH2A 3C29A 1ZQ1C 2CRXA 2K8BB 2HBKA 4OJPA 3IP4B 2F76X 3CP8A 4BX9C 1CRXA 1PVRA 3D2SA 1A6SA 3M6KA 2CN1A 1GO3F 2ZIWB 3NUQA 3F5EA 2PMZC 3D2NA 4KX5A 2RRDA 2DGZA 3O0FA 2LBOA 2LYAA 2KICA 4WJ3B 2VIXA 2N1RA 1Z1BA 3MGVA 3C28A 2HBMA 2KEYA 2ZG6A 3PSFA 3N7RC 2G09A 2G06A 3AQEA 2RHFA 2NV3A 3VC8A 2HMXA 3H0MB 2JHDA 2G5HB 2W03A 2Z7JA 2ZIWA 3ALRA 2WAQC 2LKYA 3HKZC 4OJ6A 3T79A 2WB1C 3N7SC 2K8CB 2JMGA 3CYMA 2LYBA 1XO0A 2KIWA 4A8EA 5A0LA 1ECWA 2KKVA 2GOLA 2F77X 2W04A 3IG5A 3RFAA 5KL8B 1HEKA 4KMOB 1PVQA 3N7PD 1MA7A 2R18A 3M7DA 3SAHA 1L6NA 2K89A 1XNSA 4CRXA 2Q4TA 2H3ZA 3AQFA 3KFUF 4NLCA 3SAGA 2K4HA 2PMZF 3LVWA 2VJ5A 2F8LA 2KNJA 1HIWA 2M0NA 1D8BA 3SMVA 4U7CA 2H3IA 2JH7A 4U6PA 2K4EA 2KD1A 2HOQA 5KL1B 3GU3A 4QIWC 1YT3A 2HOFA 4CGZA 3H0RB 2DF4B 2GH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMX A;  4ICA A;  4IC9 A;  2H3Q A;  2JMG A;  4JMU A;  2K4I A;  2LYB A;  1TAM A;  1ECW A;  2GOL A;  1HEK A;  1L6N A;  2H3F A;  1A6S A;  1UPH A;  2H3Z A;  2K4H A;  2LYA A;  1HIW A;  2N1R A;  2H3I A;  2K4E A;  1ED1 A;  2NV3 A;  2H3V A; 
#chains in the Genus database with same CATH topology
 5KAI U;  1D9F A;  7ICO A;  5KFV A;  5KG2 A;  5DDM A;  1ZQJ A;  1SGG A;  2XVT A;  3RF9 A;  1RM6 C;  3Q8S B;  4B9T A;  5ALM A;  3KTQ A;  4F4Z A;  2G07 A;  1Q3V A;  1PK1 B;  4R8U A;  2VKQ A;  5EE3 A;  4F91 B;  4PZN A;  2ZXI A;  1MQ3 A;  1X42 A;  4UAS A;  5IIN A;  3LDA A;  3JPO A;  1S97 A;  4EEK A;  4F92 B;  3SQI A;  2DKX A;  3AU6 A;  5CP2 A;  2J6U A;  5ALU A;  1ZQT A;  8ICU A;  4Z6E A;  2KN7 A;  1SXD A;  4RPY A;  1KDH A;  8ICA A;  2LI6 A;  2EQY A;  1SKR A;  1NKE A;  3EYZ A;  4I2G A;  2XI9 A;  4DLE A;  5KFJ A;  5J0T A;  3G6Y A;  3Q8K A;  5J0Y A;  5HR7 A;  3TAD A;  4I2B A;  5K4L A;  1F44 A;  2IHM A;  2LMR A;  2OHF A;  4K4I A;  1NK8 A;  5DDY A;  1ZQL A;  3PO4 A;  5KT4 A;  5DLF A;  4MEY A;  1PVR A;  4Y2P A;  5AK3 A;  4NLN A;  1IM4 A;  4UB8 U;  5HHI A;  4DFP A;  4RQ1 A;  2ISO A;  3CW2 C;  9ICA A;  4NJ8 A;  4OJ6 A;  2PXI A;  2XY7 A;  3CYM A;  1S8O A;  5KG0 A;  3KHR A;  1AQ6 A;  5KFT A;  5DGA A;  2R8H A;  1MA7 A;  4Y2U A;  4EZ6 A;  2AGO A;  2KMD A;  4NLC A;  5ALS A;  1O08 A;  2WF6 A;  4C8N A;  3H7I A;  2NO4 A;  5AM0 A;  3PW0 A;  3QZ7 A;  3UMB A;  7ICR A;  2GH1 A;  4G9B A;  4B9S A;  2HW3 A;  4R65 A;  1ZRN A;  2O6K A;  3OPX A;  1LKY B;  4KX3 A;  3RJI A;  4HYK A;  3MBY A;  2EH9 A;  7ICF A;  2WF7 A;  2VA2 A;  1X6J A;  1FO4 A;  4Y2J A;  1KL9 A;  1UPH A;  5DKW A;  3RJK A;  1CUK A;  4I2C A;  1YZ6 A;  1BPZ A;  2LM4 A;  4DFD A;  4P4M A;  2ASJ A;  8ICK A;  3QNM A;  4QWD A;  4P2H A;  2NYV A;  1B43 A;  4JV0 A;  4US9 A;  4OJ5 A;  3KZI U;  1NKC A;  3C21 A;  1S9F A;  1YZ7 A;  4E0D A;  4RQ6 A;  3EPI A;  1S10 A;  4YN4 A;  3PMN A;  5CRX A;  3K4G A;  1JI7 A;  5AKH A;  3BS7 A;  3UXO A;  5ALF A;  4FS1 A;  4KLE A;  4ACO A;  2KV2 A;  2KOB A;  1CEZ A;  1ZQA A;  3C29 A;  4PHD A;  3D2S A;  4IQU A;  4Y2X A;  3UPQ A;  5ALZ A;  3NUQ A;  4ED0 A;  2RRD A;  5AK6 A;  4Y2Q A;  4ECS A;  4KLJ A;  2PFQ A;  5AKG A;  4F5Q A;  3QUT A;  2G09 A;  3AQE A;  2BPC A;  4M6W A;  2MUT B;  4QZ9 A;  3QUC A;  2K8C B;  2JMG A;  2F1J A;  4UAU A;  4ECX A;  5KT3 A;  5ALT A;  2VA8 A;  1TE2 A;  2W04 A;  1WWV A;  2B6G A;  1L6N A;  3M7D A;  3RAQ A;  4M04 A;  4XUS A;  1MQ2 A;  2KNJ A;  1UA1 A;  1TK5 A;  2ZTC A;  2H5X A;  1D8B A;  1YT3 A;  5DB7 A;  2KK0 A;  4O3M A;  2C2R A;  3EZ5 A;  4UAR A;  2IOH A;  2WAQ F;  5ALL A;  2AU0 A;  1V38 A;  2K4I A;  1ZQW A;  1JRO A;  3GII A;  5KFG A;  4R63 A;  3GIK A;  1Z3E B;  4J9R A;  5III A;  2IA6 A;  2H3F A;  9ICR A;  2I9G A;  2ES6 A;  2NRV A;  4PL2 A;  2KZ3 A;  1TKD A;  5J2F A;  3PVX A;  3HRD D;  3PR5 B;  2M9N A;  4DF8 A;  3HWT A;  5ALR A;  8ICS A;  1NZP A;  4EEY A;  1JXL A;  4DFM A;  2E1E A;  4NLB A;  3UXP A;  3SZ2 A;  4C4S A;  1ZQN A;  1T7P A;  3RJG A;  4DL3 A;  8ICQ A;  3PX6 A;  5KTQ A;  4MFF A;  4F2R A;  4DQP A;  2J6S A;  4BUG A;  1COK A;  4C4R A;  4KLM A;  3M9M B;  5HMM A;  1RXW A;  3EWA A;  3TAD C;  9ICC A;  3RAX A;  1FIQ A;  1N60 A;  2R8J A;  1ZQV A;  4ECV A;  2XY6 A;  3TAC B;  5KFM A;  2QB0 A;  9ICW A;  2KEY A;  8ICL A;  2FPM A;  3WK7 A;  2AQ0 A;  2G5H B;  4J9P A;  4DSF A;  4DL5 A;  4UB3 A;  2ZUC A;  4QZE A;  5KG1 A;  4A8E A;  1ZQS A;  1QTM A;  4KLO A;  5AKJ A;  3HT3 A;  3QE9 Y;  2ESE A;  4DF4 A;  2K4H A;  4O3R A;  4DFK A;  1ZJM A;  7ICL A;  3SMV A;  4QIW C;  3HX0 A;  4PJ0 U;  4NV0 A;  4Z6F A;  1NK6 A;  3MAB A;  4Y2Y A;  4FFD A;  1EXN A;  2FPK A;  3RH5 A;  5GTI U;  4PH5 A;  3UMG A;  3TAR A;  5KNI A;  8ICO A;  1T94 A;  2IOF K;  3PW7 A;  1X9S A;  2EAO A;  3MR6 A;  3IN5 A;  1JIH A;  3MGH A;  4DL2 A;  3UQ0 A;  4UW9 A;  1ARO P;  3ZDA A;  1Z00 A;  5KG7 A;  4JV2 A;  4BWM A;  3QX7 A;  3JPP A;  5KFP A;  1TV9 A;  4DOA A;  1IXR A;  3ED5 A;  4P0P B;  3THV A;  4NXZ A;  1TAM A;  2ASD A;  2HBL A;  3V7K A;  2KG5 A;  4BDP A;  1RPL A;  4J9K A;  2W7O A;  3PR4 A;  4DLG A;  2HHQ A;  4DWI A;  4C4T A;  2V9W A;  3NVV A;  3GDX A;  8ICM A;  2KP7 A;  2ASL A;  2HHW A;  3N97 B;  3SYZ A;  3C1Z A;  4YR3 A;  1XWL A;  7ICG A;  1NKB A;  2NRZ A;  2VIX A;  2N1R A;  5IIJ A;  2HHS A;  1HUO A;  2AGP A;  1SKW A;  1HJP A;  3VC8 A;  1N56 A;  8ICY A;  2Z7J A;  4DSI A;  1Z4N A;  2WAQ C;  5KFA A;  1Q8K A;  3PW5 A;  5D46 A;  3ZD8 A;  4PHE A;  4O5C A;  2YMM A;  3RFA A;  4UB1 A;  1S0M A;  1NK0 A;  4UAZ A;  5EE1 A;  2VJ5 A;  1S0O A;  3V6K A;  4ELT A;  1KEJ A;  2K4E A;  1U45 A;  2BPF A;  5EWE A;  3HKZ F;  4Z6D A;  5AM5 A;  2W7P A;  2YN4 A;  2I1Q A;  2IBK A;  3NRW A;  5KFW A;  3T5L A;  1NNL A;  1QQ6 A;  1H38 A;  1KW4 A;  2RP5 A;  2G08 A;  3IRU A;  3RBE A;  2ZIV A;  2W9C B;  3GIM A;  1SZH A;  4DOC A;  3OJU A;  1XO1 A;  5KFF A;  3B0Y A;  4ZOH C;  1N63 A;  2C2E A;  3QUB A;  4QZI A;  4I2J A;  2BQ3 A;  1A0P A;  5IIM A;  3WK4 A;  5AK5 A;  4RQM A;  3R9K A;  1JN3 A;  9ICL A;  4EEL A;  2YQE A;  5J2E A;  5J2D A;  2W9B A;  3FAH A;  5KFZ A;  4ELV A;  5L1L A;  2CRX A;  4YR0 A;  3PW4 A;  3C2K A;  2A1A A;  3EPG A;  3NS1 A;  5DQH A;  2D3D A;  4YMM A;  3D6J A;  1Z1B A;  3MR2 A;  2KZZ A;  5HNK A;  2UVR A;  3ZD9 A;  5CWR A;  9ICG A;  1N2X A;  2A1J A;  3SI8 A;  4CCH A;  4RQ4 A;  1VDV A;  5KFO A;  2Q0Z X;  3AU2 A;  4BXO A;  4I2D A;  4M9G A;  5KFU A;  3ZDB A;  3RB6 A;  7ICU A;  3IV6 A;  3PSI A;  3V72 A;  2OWO A;  4EX6 A;  4QZC A;  2AQ4 A;  2IMW P;  4Q8E A;  2DUY A;  4B9N A;  4ZH4 A;  4QWA A;  7ICE A;  3CNH A;  1URJ A;  1HUZ A;  4QWB A;  4GXK A;  1IIP A;  4QZG A;  4J9N A;  1ZQQ A;  2W54 A;  4TUR A;  2W3S A;  2OM6 A;  5AI6 A;  9ICN A;  1JAL A;  1PK3 A;  3DDH A;  4RQ7 A;  1DRG A;  9ICM A;  4C7Z A;  4KLU A;  3AEV A;  2ZIX A;  5GTH U;  3C23 A;  1ZQG A;  1XSP A;  1BNP A;  4IRD A;  1DOQ A;  5IIK A;  3Q8R B;  1ZJN A;  1Z4O A;  4JV1 A;  1J2N A;  2ALZ A;  1C7Y A;  4FZM A;  3H4D A;  4YXJ A;  5AK4 A;  2ZJ8 A;  2BCS A;  2HSZ A;  2VJ4 A;  4DQR A;  4O3P A;  3RR7 A;  2D8C A;  2V4Q A;  2DPI A;  5T14 A;  4JMU A;  3PV8 A;  4NY8 A;  4YMN A;  5AIC A;  3QU4 A;  4B9V A;  3PY8 A;  4DQQ A;  3H4B A;  8ICZ A;  2CN1 A;  1GO3 F;  1SV0 A;  1RZT A;  1NJZ A;  1ZD2 P;  4PGQ A;  1RQL A;  2OEH A;  2G06 A;  5DG9 A;  3L4P A;  4J9M A;  4KLQ A;  3HKZ C;  2KFZ A;  1XO0 A;  2I6X A;  2KSO A;  4RUA A;  4O3S A;  3MC1 A;  2R18 A;  4MF2 A;  2XCP A;  1SWV A;  2PMZ F;  3RB0 A;  2F8L A;  5AI5 A;  1XSL A;  5KL1 B;  3HIL A;  5KFB A;  4EX7 A;  5HR6 A;  9ICI A;  2KKP A;  1KFT A;  2AXT U;  4ED1 A;  2JZB A;  4KMU A;  5J0P A;  7ICM A;  4DL7 A;  2MA1 A;  3GFK B;  4QJF B;  5DQI A;  2L5Y A;  4B9M A;  4IRK A;  1BPD A;  3KKA A;  2HCF A;  5KG6 A;  2W3R A;  4GLX A;  1DXS A;  3C2L A;  5B5E U;  3BS5 B;  2HI0 A;  1L7O A;  2BDU A;  2HBJ A;  4IR1 A;  3QU5 A;  2OXO A;  4M9N A;  2KHV A;  2E3T A;  3EW9 A;  2HOI A;  3ZDC A;  5DG8 A;  3KHL A;  2RDI A;  3HW8 A;  3MDA A;  4YP3 A;  2YB1 A;  3NGD A;  5BOM A;  1UHU A;  4Q43 A;  5ALG A;  1DGJ A;  4QIW F;  3LK9 A;  2E8P A;  5L1K A;  2ZIU A;  2Y0S C;  3MR5 A;  4MFC A;  1SKS A;  2AHO B;  2KIV A;  2WTF A;  4B9L A;  2K8B B;  1TFR A;  4GIB A;  3CP8 A;  3M6K A;  4MEX A;  2W8L A;  2KIC A;  5AM4 A;  3HP6 A;  8ICI A;  2ZG6 A;  2UVW A;  3PSF A;  4DCC A;  1ZQD A;  5DB8 A;  1ZQM A;  4KN4 A;  2FLP A;  1XS9 D;  2QLT A;  2P66 A;  5KL8 B;  5DGB A;  8ICB A;  1RQN A;  3G6X A;  4CRX A;  1F0M A;  4ED8 A;  4M9H A;  4OD0 A;  4DOB A;  1HIW A;  5ALW A;  5J2A A;  2AGQ A;  1BPY A;  1K5O A;  4CGZ A;  4ELU A;  2NO5 A;  4DSL A;  1DK3 A;  3QEA Z;  1Z19 A;  3SAF A;  3H8S A;  3A0B U;  2BKE A;  2QAR B;  4F72 A;  1SL1 A;  1XC9 A;  4P0Q B;  4KLS A;  2MAX A;  1VJ5 A;  3OHB A;  4M9J A;  3PO5 A;  1ZD4 A;  4F5O A;  7ICV A;  2RQ5 A;  4FBU A;  3SR6 A;  5G5H A;  5J8Y A;  1MC8 A;  3SV4 A;  4M0A A;  5J0X A;  4YCX A;  3OSP A;  2H3V A;  4O9M A;  2ZJ5 A;  4J9Q A;  4IC9 A;  5AKI A;  3NRZ A;  4YD1 A;  3OTQ A;  4ED2 A;  4ECR A;  5J2H A;  3WK9 A;  4EEN A;  1ZQR A;  3QZ8 A;  2FE9 A;  3Q8P B;  4KLT A;  4I2H A;  3SV3 A;  5ALD A;  5KFQ A;  4GC7 A;  3GV8 B;  3PST A;  8ICJ A;  9ICV A;  4AYB F;  1X66 A;  1QSY A;  3TAP A;  2KHQ A;  1BPE A;  3AM9 A;  1S76 D;  5J2C A;  2MU2 A;  4YQW A;  1A6S A;  1RXV A;  4F4W A;  4JWN A;  2PMZ C;  3NAS A;  5KFC A;  2LYA A;  3RTV A;  2HBM A;  3WKB A;  5IIO A;  5FP0 A;  1MN8 A;  2HMX A;  5F3X B;  2W03 A;  2ZIW A;  1N62 A;  1SV0 C;  2BGW A;  2MSN A;  3BQ2 A;  4LZD A;  5J2G A;  3PML A;  2QKQ A;  5E79 U;  4J9L A;  4CF3 A;  5J2K A;  9ICX A;  2K89 A;  1JUD A;  2W11 A;  2BDP A;  2Q4T A;  5DBC A;  3SAG A;  1NK7 A;  2YY6 A;  5CEH A;  4LJX A;  5J0O A;  2GWS A;  2PFO A;  4RZR A;  5L1I A;  4R8U B;  1OW5 A;  5IIL A;  3B9J A;  5DBA A;  4RQ0 A;  3RH4 A;  4XRH A;  2BCQ A;  1OUQ A;  4J9O A;  2F1H A;  4UAV A;  1F5S A;  1RYS A;  4F2S A;  5KT5 A;  4ECZ A;  2EZX A;  3EUB 2;  3IM1 A;  1PK1 A;  1DK2 A;  2W55 A;  3K1Z A;  2KE7 A;  4PHP A;  5KT2 A;  3KD3 A;  2K8A A;  4K4H A;  4MHV A;  3OJS A;  4I2F A;  5C0Y A;  8ICW A;  5EE0 A;  3C2M A;  3JPQ A;  5DG7 A;  2BZF A;  7ICN A;  1NJW A;  1ZQH A;  4LZG A;  4F93 B;  5DB6 A;  4FE3 A;  3M1Y A;  3PZP A;  3JPT A;  4I27 A;  8ICN A;  3F2D A;  4TUQ A;  3UQ2 A;  5JRT A;  3CRX A;  3MFI A;  3BDP A;  4QNL A;  4RQN A;  4RNO A;  3C1Y A;  2K4P A;  2BQR A;  4F4Y A;  1ZQ1 C;  1ZQK A;  1IV8 A;  1QLN A;  1ZQB A;  8ICT A;  4C7Y A;  3GV5 B;  4R66 A;  1WCN A;  4GXI A;  1ZXI A;  2C22 A;  4UBC A;  1IG6 A;  5AI9 A;  3ALR A;  1ZQI A;  1TK8 A;  3H8J A;  4C8O A;  4O5E A;  3LWM A;  1U9L A;  1XSN A;  1D9D A;  3WK5 A;  5KFI A;  3IG5 A;  4QZH A;  3N7P D;  1UT5 A;  3PX0 A;  3SAH A;  4QW8 A;  2H3Z A;  3AQF A;  1KSP A;  2P6R A;  1COO A;  4U7C A;  1ZD3 A;  2EZY A;  4ECQ A;  5DLG A;  1OXJ A;  2DF4 B;  2V4R A;  5EWG A;  3RR8 A;  1ZOL A;  9ICF A;  2QB1 A;  4RNN A;  3F53 A;  4C8L A;  1VLB A;  3AL0 B;  2EAP A;  3QU2 A;  2Y9U A;  2HDO A;  4QWC A;  2P6U A;  1LKY A;  1JMS A;  3LWL A;  2KVC A;  3KOO A;  3PNC A;  4FZN A;  4RU9 A;  4CE6 A;  4AYB C;  3RB3 A;  5AKE A;  2PFP A;  1KN5 A;  5J8Y C;  2LHT A;  1PVP A;  3T5K A;  1QH9 A;  2ATL A;  3LYS A;  5J2B A;  5AKX A;  2A3V A;  4I29 A;  4IR9 A;  4CNQ A;  3M9N B;  1KFD A;  3MR3 A;  1V9P A;  1NJX A;  4OCZ A;  5KFX A;  3T5J A;  4IQW A;  3RBD A;  3ONN A;  4KLG A;  2WF8 A;  4US8 A;  1V97 A;  4YVZ A;  4Q45 A;  2YTU A;  1X9W A;  1FFU A;  3GIL A;  3I1Y A;  1CRX A;  4UQG A;  2DKZ A;  3TKA A;  3F5E A;  1QQ5 A;  4M6W B;  2DGZ A;  5J2I A;  3N7R C;  4EBD A;  3DV9 A;  2W9A A;  4F4X A;  9ICJ A;  3T79 A;  5KFY A;  1Y88 A;  3N7S C;  5KFN A;  1K1S A;  1ZQY A;  2JEI A;  2LYB A;  4RQ2 A;  1CI4 A;  3GQC A;  2WFA A;  1SIJ A;  2MUT A;  1XNS A;  8ICP A;  3KFU F;  4NM1 A;  5F9L A;  1B22 A;  1DGS A;  5AKZ A;  4I2E A;  3PX4 A;  9ICH A;  4ED7 A;  2F3N A;  2JH7 A;  8ICR A;  4O3Q A;  5DQG A;  1JXE A;  3TAQ A;  4NLG A;  4RQ5 A;  5ALN A;  3ICX A;  1ZQC A;  2Y0S F;  5J0Q A;  1KBU A;  3HPO A;  5L1M A;  3N4M B;  4BJQ A;  2FDR A;  3IDW A;  3K1R B;  1ZQO A;  2EAM A;  4FBT A;  2AH5 A;  3RB4 A;  4KLD A;  2D6F C;  3ORY A;  2E5S A;  3WK8 A;  2Y1I A;  4RNM A;  5ALO A;  4OJL A;  4MFA A;  5EE9 A;  2ZJA A;  3OSN A;  2KVS A;  4J9S A;  2HHX A;  1D8Y A;  3I76 A;  4EZ9 A;  1ZD5 A;  3RJH A;  2ZUD A;  5AKK A;  3DEE A;  3WKA A;  1SL0 A;  3H8M A;  4C80 A;  1X6I A;  3TQ1 A;  3KHG A;  3V7L A;  4TQR A;  5D4B A;  1N61 A;  3UM9 A;  2R8K A;  2XCA A;  4R64 A;  1K1Q A;  2YMQ A;  2RDJ A;  2LPE A;  4DQI A;  5JU5 A;  2NRW A;  2QB0 B;  2OH2 A;  3M8R A;  5J0W A;  5KAF U;  4JK1 A;  4DQS A;  3V7J A;  9ICO A;  4Q44 A;  3MGV A;  5J0S A;  4F5R A;  4G3I A;  4KLI A;  2HHT A;  1MSW D;  4EBE A;  1UA0 A;  3RRG A;  2FPL A;  5HML A;  2B21 A;  1L7N A;  3GIJ A;  1U4B A;  1ZQF A;  2YML A;  2XY5 A;  1PVQ A;  1LVH A;  2P35 A;  4DSE A;  1KLN A;  3AN1 A;  3NVZ A;  2FI1 A;  3BQ0 A;  2PFN A;  3BZC A;  4U6P A;  2DWQ A;  2KD1 A;  5F9N A;  3H0R B;  3FC4 A;  1B0X A;  1L3U A;  2WF9 A;  2CXY A;  4DO9 A;  3H40 A;  3Q8L A;  2BCV A;  5ALV A;  9ICB A;  2ZTE A;  2HVI A;  1NJY A;  4JWM A;  3V6J A;  7ICK A;  1LV5 A;  1UQV A;  5JTI A;  1JRP A;  1Z00 B;  2ZXH A;  3M6Z A;  4Y2R A;  4C0Z A;  4ECU A;  4TQS A;  4RPZ A;  1JX4 A;  3T3F A;  2E8O A;  3QU7 A;  4QW9 A;  3GZF A;  4PGX A;  1M6Y A;  4F5N A;  1NK4 A;  5ALK A;  4DS4 A;  1U48 A;  5G5G A;  1RDF A;  2R8G A;  4DSK A;  4MF8 A;  2UVV A;  5KG5 A;  4P0P A;  1ZET A;  4F5P A;  4F3O A;  2ISP A;  2XGP A;  1P7D A;  1L8O A;  1C20 A;  3TAN A;  4M47 A;  4PZO A;  2ZUB A;  5J0U A;  2E8M A;  2BQU A;  5KFD A;  3B0X A;  3IP4 B;  7ICI A;  4F4K A;  5AM2 A;  3TFS A;  2FLN A;  4C8M A;  1T3Q A;  4CF4 A;  3FYH A;  1TK0 A;  2W43 A;  3WU2 U;  4NM2 A;  2JHD A;  3AMZ A;  8ICV A;  4I28 A;  3I28 A;  5ALP A;  5A0L A;  1ECW A;  4B6J A;  8ICF A;  4KMO B;  3RJJ A;  3J81 j;  2PI4 A;  5KG3 A;  5ALH A;  4KN7 A;  1PZN A;  1X9M A;  2ODG A;  2HOQ A;  1UT8 A;  4YFK A;  4Y2T A;  4DFJ A;  4ICA A;  3WKD A;  2J6T A;  7ICS A;  3E0F A;  1T8E A;  7ICJ A;  5CA7 A;  4DSJ A;  3IG8 A;  2DQN B;  5ALJ A;  5EWF A;  2KJ8 A;  2YB4 A;  4GC6 A;  4FZL A;  4UAT A;  2BR0 A;  5AI4 A;  3BQ1 A;  2W9M A;  2ZIV B;  1A77 A;  2EZZ A;  4JUZ A;  3Q8Q B;  1X2I A;  3QU9 A;  3ETR A;  1Z1V A;  4TUP A;  8ICX A;  5KT7 A;  5L9X A;  3MGI A;  9ICK A;  4FO6 A;  1BNO A;  4CDG A;  5KFH A;  3F2B A;  5DBB A;  2RLT A;  1Q3U A;  1L3V A;  2E1F A;  2LM1 A;  2DFL A;  3AUO A;  1KQQ A;  2YX8 A;  1WUD A;  1S77 D;  2W9C A;  2VA3 A;  2KJ9 A;  5ALE A;  5KFR A;  2JRZ A;  4YR2 A;  3QYP A;  3SEI A;  3H0L B;  2I5H A;  3VCB A;  4USA A;  9ICE A;  3LVV A;  5JUM A;  2W9B B;  5KT6 A;  3ISC A;  1ED1 A;  4ED6 A;  4P4O A;  3C5G A;  4M9L A;  2F8K A;  5EOZ A;  3QUQ A;  9ICS A;  1SWW A;  3FDS A;  4OJP A;  4BGD A;  2Y9T A;  1U47 A;  5AIA A;  3ZDD A;  3WKE A;  3JPS A;  7ICQ A;  3D2N A;  3NVY A;  4DL4 A;  4F50 A;  4Y2S A;  2A1J B;  2EAN A;  2F44 A;  1ZYQ A;  4DEZ A;  4GXJ A;  4EYH B;  4NLZ A;  3E2E A;  2C28 A;  4BXO B;  2KIW A;  2ZTD A;  2KKV A;  1X40 A;  4O3O A;  1L8L A;  3BZK A;  1HEK A;  4P4P A;  1TAU A;  9ICQ A;  8ICE A;  2B0C A;  2K60 A;  3G6V A;  4IL6 U;  2XGQ A;  4K4G A;  1L7M A;  5J29 A;  2H3I A;  3T5H A;  4ED3 A;  1QCK A;  2FJ6 A;  1RYU A;  3UMC A;  1QSL A;  3U26 A;  1RG6 A;  2KJ5 A;  3KZX A;  1SB3 C;  2AJQ A;  2YMP A;  5H2F U;  1RYR A;  5ALI A;  3MDC A;  4B9U A;  4OJO A;  4CF5 A;  2JEF A;  2ZIX B;  4NL9 A;  8ICC A;  5AIB A;  2JXJ A;  1NOM A;  5CHG A;  1NZB A;  5AHX A;  5AKL A;  2G0A A;  1KTQ A;  5KFK A;  1TVA A;  4PHA A;  2JGA A;  4QWE A;  3SD7 A;  1N5X A;  3RJE A;  3MFH A;  4KLF A;  8ICG A;  2E8N A;  5BPC A;  2HHU A;  4IRC A;  1Q46 A;  4QZA A;  2BCR A;  1UCV A;  1V85 A;  4JB3 A;  1SL2 A;  2MRL A;  3KKA C;  2OYY A;  3BQ7 A;  2Y1J A;  3WKC A;  2HHV A;  1LB2 B;  4OO1 J;  2XID A;  3HJE A;  1N48 A;  3JPN A;  4PPX A;  3ZDE A;  2HBK A;  5AM1 A;  4BX9 C;  2VAN A;  4YG2 A;  1KKX A;  3H8W A;  4UBB A;  3O0F A;  5ALX A;  4J03 A;  3A0H U;  3V6H A;  4RUC A;  3H0M B;  2KSO B;  1U49 A;  4EBC A;  4X5V A;  3NVW A;  1PUZ A;  5TZV A;  4FS2 A;  4YXM A;  2JR5 A;  1FFV A;  5C5J A;  5J0R A;  2GOL A;  2F77 X;  1NI3 A;  1FEZ A;  4IQV A;  4QZF A;  3C5F A;  1BPB A;  3FM9 A;  1L5U A;  1ZQU A;  1A76 A;  1QQ7 A;  4YMO A;  4Z6C A;  9ICP A;  2JZB B;  3S6J A;  3TFR A;  5L1J A;  4KLL A;  1B4F A;  2WB1 F;  3GV7 B;  2JEG A;  1SXE A;  4KIT B;  2KFN A;  4QZ8 A;  4YD2 A;  2DPJ A;  2IOF A;  3L5K A;  5AKY A;  1L3T A;  5KFS A;  2GO7 A;  3F2C A;  3N28 A;  2A19 A;  2OCE A;  7ICP A;  2XIC A;  4O5K A;  1XU4 A;  3BS5 A;  2NRT A;  2W8K A;  4LVS A;  1ZRM A;  1T3N A;  3KBB A;  3Q8M A;  1L7P A;  4XQ8 A;  1S5L U;  2ZIU B;  3OGU A;  3D2Q A;  4UB5 A;  5ALY A;  4UB2 A;  1N5W A;  2JEJ A;  4F8R A;  3UXN A;  3BJY A;  4KTQ A;  5KFL A;  4UAY A;  3ETL A;  2FMP A;  9ICT A;  7ICH A;  4DL6 A;  3NTU A;  2PI5 A;  5AI0 A;  4HAI A;  1T4G A;  5KG4 A;  3ZI4 A;  2KZM A;  1J97 A;  3C28 A;  2RHF A;  2NV3 A;  4Y2V A;  4O3N A;  2LKY A;  5CJ7 A;  4UB6 U;  3OHA A;  4KLH A;  4M2Y A;  4O0I A;  4BWJ A;  3M9O B;  1SV4 A;  1ZQP A;  3WK6 A;  3LVW A;  1ZQE A;  2LYH A;  1BVS A;  1WCL A;  2NRX A;  2FMS A;  2JV3 A;  1D8L A;  3ISB A;  4TUS A;  4IQT A;  2BCU A;  2G5I B;  3IHQ B;  4AP9 A;  4EYI B;  5ALQ A;  2UVU A;  2F2A B;  3SEN A;  4QZB A;  2DL0 A;  2WHE A;  4RQ3 A;  1WYG A;  2KTQ A;  1BGX T;  5AI8 A;  4DS5 A;  2CPR A;  2F1I A;  2QAR A;  4P0Q A;  4UB4 A;  2XO7 A;  4F71 A;  3F5A A;  3M8S A;  1QSS A;  4XA5 A;  2R8I A;  5AM3 A;  4C8K A;  1ZQX A;  4NL9 C;  2H3Q A;  1TAQ A;  4NWI A;  3PSP A;  4RQ8 A;  5KFE A;  2FMQ A;  3ISD A;  2WF5 A;  3RH6 A;  2JH1 A;  2PKE A;  1KRP A;  5CR0 A;  2EDU A;  2GLE A;  3QEB Z;  5CB1 A;  4PL1 A;  5HHH A;  2FLL A;  1S0V A;  4ECY A;  2DBY A;  5DB9 A;  4I2A A;  3K75 D;  1SZP A;  1O03 A;  2HVH A;  4I2I A;  1BPX A;  3TI0 A;  5TIS U;  2IHN A;  5HP4 A;  3L3F X;  4Q8F A;  4GFJ A;  3KHH A;  2C2D A;  3RRH A;  1X9X A;  4NLK A;  2F76 X;  4PGY A;  1WG8 A;  3PW2 A;  4RPX A;  4QZD A;  4RT2 A;  4ECW A;  2BHN A;  2ZIW B;  2BPG A;  2LBO A;  4KX5 A;  1KFS A;  9ICU A;  4WJ3 B;  4RT3 A;  1S0N A;  3RJF A;  1J2M A;  4ECT A;  4UAW A;  5BOL A;  3BQT A;  2WB1 C;  3E58 A;  5J2J A;  7ICT A;  2XC9 A;  3QXG A;  1L3S A;  1WWU A;  1NK9 A;  1ZQZ A;  2M0N A;  5D49 A;  5B66 U;  1NK5 A;  2HOF A;  3GU3 A;  8ICH A;  3JPR A;  4IS7 A; 
#chains in the Genus database with same CATH homology
 4O3M A;  3HKZ F;  1Z19 A;  2WAQ F;  3SAF A;  3PSI A;  4ICA A;  3OPX A;  2WB1 F;  2G5I B;  2KKP A;  3ICX A;  5HR6 A;  2Y0S F;  2XVT A;  4KX3 A;  3RF9 A;  2K4I A;  2W7P A;  3E0F A;  2KJ5 A;  3F53 A;  1KBU A;  2F2A B;  1T94 A;  3KZX A;  4P0Q B;  3AL0 B;  3IG8 A;  2DQN B;  2G07 A;  3NRW A;  1Q3V A;  2KJ8 A;  2MA1 A;  2YB4 A;  4BJQ A;  1URJ A;  2VKQ A;  4QJF B;  2H3F A;  4FZL A;  1OUQ A;  1IIP A;  2ZXI A;  1UPH A;  3IN5 A;  4OJO A;  4PL2 A;  2CPR A;  2ZIX B;  2ZIV B;  2ZXH A;  4P0Q A;  2D6F C;  3M6Z A;  2E5S A;  2OM6 A;  3SQI A;  4C0Z A;  2KVC A;  3K1Z A;  3F2C A;  2BDU A;  4OJL A;  3F5A A;  1NZB A;  2K8A A;  4CDG A;  2RP5 A;  1DRG A;  4FZN A;  3F2B A;  2H3V A;  2G0A A;  2G08 A;  2HBJ A;  2XIC A;  5C0Y A;  4OJ5 A;  2ZIX A;  2ZIV A;  4IC9 A;  4AYB C;  2JGA A;  2OXO A;  2H3Q A;  1Q3U A;  2E1F A;  4NWI A;  2LHT A;  3GZF A;  3PSP A;  1SZH A;  1PVP A;  4P0P B;  2KHV A;  1TAM A;  3DEE A;  2JH1 A;  2YX8 A;  2HOI A;  2E1E A;  4NLB A;  1WUD A;  3LYS A;  2A3V A;  5CRX A;  2KJ9 A;  2HBL A;  2XI9 A;  4PL1 A;  4FE3 A;  3H0L B;  3PZP A;  4P0P A;  3F2D A;  2ZIU B;  4FZM A;  1A0P A;  3VCB A;  5HR7 A;  2YB1 A;  3LVV A;  3D2Q A;  3CRX A;  2VJ4 A;  4QIW F;  4BUG A;  1P7D A;  1ED1 A;  2W7O A;  1F44 A;  3PST A;  4ACO A;  2MRL A;  2OYY A;  4QNL A;  4NV0 A;  4AYB F;  2ZIU A;  3ONN A;  5T14 A;  2KHQ A;  3L3F X;  2Y0S C;  2KV2 A;  4GFJ A;  4JMU A;  4OO1 J;  2KOB A;  2XID A;  2OH2 A;  3C29 A;  1ZQ1 C;  2CRX A;  2K8B B;  2HBK A;  4OJP A;  3IP4 B;  2F76 X;  3CP8 A;  4BX9 C;  1CRX A;  1PVR A;  3D2S A;  1A6S A;  3M6K A;  2CN1 A;  1GO3 F;  2ZIW B;  3NUQ A;  3F5E A;  2PMZ C;  3D2N A;  4KX5 A;  2RRD A;  2DGZ A;  3O0F A;  2LBO A;  2LYA A;  2KIC A;  4WJ3 B;  2VIX A;  2N1R A;  1Z1B A;  3MGV A;  3C28 A;  2HBM A;  2KEY A;  2ZG6 A;  3PSF A;  3N7R C;  2G09 A;  2G06 A;  3AQE A;  2RHF A;  2NV3 A;  3VC8 A;  2HMX A;  3H0M B;  2JHD A;  2G5H B;  2W03 A;  2Z7J A;  2ZIW A;  3ALR A;  2WAQ C;  2LKY A;  3HKZ C;  4OJ6 A;  3T79 A;  2WB1 C;  3N7S C;  2K8C B;  2JMG A;  3CYM A;  2LYB A;  1XO0 A;  2KIW A;  4A8E A;  5A0L A;  1ECW A;  2KKV A;  2GOL A;  2F77 X;  2W04 A;  3IG5 A;  3RFA A;  5KL8 B;  1HEK A;  4KMO B;  1PVQ A;  3N7P D;  1MA7 A;  2R18 A;  3M7D A;  3SAH A;  1L6N A;  2K89 A;  1XNS A;  4CRX A;  2Q4T A;  2H3Z A;  3AQF A;  3KFU F;  4NLC A;  3SAG A;  2K4H A;  2PMZ F;  3LVW A;  2VJ5 A;  2F8L A;  2KNJ A;  1HIW A;  2M0N A;  1D8B A;  3SMV A;  4U7C A;  2H3I A;  2JH7 A;  4U6P A;  2K4E A;  2KD1 A;  2HOQ A;  5KL1 B;  3GU3 A;  4QIW C;  1YT3 A;  2HOF A;  4CGZ A;  3H0R B;  2DF4 B;  2GH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...