4ICAA

Crystal structure of a c-terminal truncated form of the matrix subunit (p15) of feline immunodeficiency virus (fiv)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
GNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
molecule keywords Matrix protein p15
total genus 42
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4icaA00
1HIWA 2H3QA 2N1RA 1A6SA 4IC9A 1ECWA 2H3IA 2H3FA 2LYAA 4ICAA 4JMUA 2HMXA 2H3VA 1UPHA 1TAMA 2H3ZA 2NV3A 2K4IA 2LYBA 2K4EA 2K4HA 1ED1A 1HEKA 1L6NA 2GOLA 2JMGA
chains in the Genus database with same CATH superfamily
1RPLA 4O5EA 2WF8A 2IOFK 7ICFA 9ICNA 3V6KA 5J0XA 3K75D 2UVWA 5KFQA 2V9WA 4TQRA 2PFNA 2HI0A 1JMSA 5KFCA 2KMDA 4RQ8A 2RDJA 4PHAA 4RNNA 4KLGA 2NRWA 3SAGA 2QB0A 1Z4NA 5KFKA 1NKEA 4KLFA 4Z6EA 5KFDA 2K60A 5G5GA 5AKYA 1U49A 4R8UB 1ZQYA 2F77X 3D2QA 1VDVA 5KFTA 4YG2A 2M0NA 3H0LB 5DB6A 3AEVA 3QZ7A 5D49A 3BQ2A 4M47A 4UAZA 1ED1A 5C0YA 1NI3A 3TARA 2H3QA 3PX6A 4UB4A 5J0WA 3BQ7A 5J29A 4NLZA 1IV8A 3N7RC 9ICLA 1PVQA 1D9DA 3WKBA 3M9OB 4R65A 4ED8A 5EOZA 5DBBA 3PSTA 4Q44A 4QZCA 1JX4A 3FYHA 4A8EA 4LZDA 8ICNA 7ICPA 4DLEA 5CEHA 4ED7A 4U7CA 2DGZA 1SKRA 1XU4A 4O5CA 2F1HA 4KLQA 3WKCA 1ZQLA 3BZCA 3IRUA 1PVRA 4QW9A 4DSFA 1SKSA 4DSLA 3OSNA 2XI9A 3M6ZA 4O9MA 3WK5A 4GLXA 3LK9A 4USAA 2W8KA 5ALVA 2QKQA 5GTIU 1NK0A 1MA7A 1LV5A 2WAQC 1TKDA 3HX0A 4I2BA 5KFGA 3PO4A 4C7YA 3N7PD 3WU2U 1X9SA 3PSFA 4C80A 5J2CA 1Q3VA 3ED5A 2FPKA 3F2DA 1X9MA 1DK3A 1J2MA 5ALWA 1ZRMA 5AM1A 2BCVA 1ZQZA 2ZUCA 3E0FA 1S5LU 4US8A 4C0ZA 4PL1A 5B5EU 2KFNA 1BPXA 2BPFA 4CGZA 3V7JA 1XC9A 4KLHA 3PR4A 4IQUA 3G6XA 4F4WA 1BGXT 5IILA 5KG4A 3ICXA 2HOFA 1D8BA 3OSPA 2V4RA 4RQ6A 3ZI4A 4F93B 1ZQEA 9ICPA 1SWVA 5ALOA 2W9BA 3RB4A 1TK5A 4NV0A 2ASDA 3BDPA 1SIJA 5JUMA 2C2DA 4FE3A 5DBAA 4MFFA 1N60A 2KG5A 4DEZA 1WYGA 4RQ2A 2RP5A 4YXMA 4FFDA 4E0DA 1VLBA 4ELTA 5TZVA 5ALZA 4MF8A 4UB1A 4UB2A 1YZ7A 3IG5A 2VKQA 3N7SC 1O08A 3F5AA 3TAQA 1V85A 2BQUA 3PV8A 2I5HA 1JXLA 5KG7A 2IHMA 5IINA 5ALKA 1S10A 4Q45A 1TVAA 3M8SA 2B6GA 3N97B 5AI0A 2XICA 1CEZA 1TK0A 3C5GA 2W04A 1L5UA 1N63A 2MAXA 2KV2A 2NO5A 2EANA 5EE9A 5ALXA 3NRZA 1N56A 1L3TA 2JEJA 1JUDA 4K4GA 1SXDA 4RPXA 4C4SA 3E2EA 2LBOA 3M6KA 2EH9A 5AM2A 4R66A 4F4YA 4ECZA 3IP4B 3MBYA 1B0XA 4F4KA 2WF6A 2W43A 1B4FA 1QQ7A 3MDAA 3E58A 9ICUA 1KKXA 4M9LA 2QLTA 1JALA 4KMUA 4F4XA 4IR9A 1KRPA 2AQ0A 2LYHA 8ICPA 2LPEA 3BJYA 5HNKA 1L8LA 4MEXA 2VA3A 3AM9A 4QZ9A 1NZPA 5AI6A 5L1MA 1DXSA 2P35A 4DLGA 2HW3A 3QUTA 4DL2A 1N5WA 2JGAA 2KP7A 2R18A 4F2RA 2EAPA 3H4BA 1A6SA 1ZQ1C 4I2EA 4YCXA 3ZD9A 4B6JA 3G6VA 3AQFA 1A76A 3MGVA 2A19A 3M8RA 3RAQA 3SAFA 4QWEA 4TUQA 3H7IA 3MGHA 1QCKA 3JPSA 4ECXA 4ELVA 3C1ZA 1S0OA 2W11A 5F9LA 2W8LA 2E3TA 2Y1IA 4KLSA 4B9UA 2F1JA 1KEJA 3RRGA 2AU0A 7ICQA 1V38A 3NUQA 1NNLA 3G6YA 5ALEA 4GC7A 4Q43A 1BPYA 4QWDA 2H3ZA 2VA8A 2KZ3A 3IM1A 3N28A 3UXPA 2C28A 4F8RA 5T14A 1S76D 3QU2A 3HKZC 1SGGA 3C2LA 7ICGA 2JRZA 1NK5A 4KN4A 1ZQVA 5L1KA 5D4BA 7ICIA 5KFSA 1FEZA 4EBCA 1T94A 3DEEA 4CF4A 2YY6A 4RT3A 2FMPA 3QYPA 1ZD4A 5KFIA 2ZJ5A 3RAXA 2BCSA 5AK3A 4F91B 1ZQRA 4IC9A 2KTQA 2JH1A 2CN1A 1BNOA 1Q8KA 8ICJA 5J2BA 4I2IA 3QX7A 3C5FA 2BGWA 3SAHA 4PJ0U 2E1EA 4DL3A 3NVVA 5J2DA 4EEYA 5J2FA 4O3SA 5BOMA 4NY8A 5DGAA 4PHEA 3H8JA 2P6RA 2ZUBA 4DSKA 4P2HA 3H8WA 2G07A 8ICFA 8ICAA 4DFDA 4DQQA 8ICRA 2AGQA 1BPEA 3O0FA 3RJJA 2DKXA 3SI8A 1WG8A 3QNMA 1IG6A 2UVVA 1XO0A 2W9MA 5AKGA 4DL6A 5B66U 3F2CA 2ZG6A 4QWBA 1T3QA 4KMOB 8ICVA 3V6JA 3LVVA 3EPIA 3BQ0A 4IQTA 1QSYA 1QLNA 1IIPA 1QSLA 4G9BA 9ICAA 4UBCA 1KDHA 4QZHA 1WCLA 4P0PA 3MR6A 3F5EA 2YX8A 1LVHA 4KX5A 2BKEA 5DKWA 4B9MA 1MN8A 3WKDA 2KIVA 4YP3A 2A1AA 1TE2A 2D8CA 3UXNA 5J2IA 2F8KA 3RJHA 3Q8KA 4RQ1A 4NXZA 4RNMA 5AK6A 4F5QA 4UW9A 3MR5A 2BDPA 1SKWA 3SZ2A 2ES6A 4IQVA 2NRZA 3I1YA 5AM3A 1D8LA 1Z1VA 4I2DA 2ISOA 1X6IA 4F2SA 4J9RA 1RXVA 2OWOA 1NJWA 4I2FA 4Z6DA 2ALZA 4G3IA 4F5RA 1TK8A 1DOQA 3HP6A 1C20A 1A0PA 9ICHA 3SQIA 4NWIA 4DFJA 1RDFA 4ICAA 1A77A 3GIMA 3TFRA 5E79U 4PGYA 4Z6FA 1L3VA 3Q8LA 4GXJA 3T79A 4M9HA 9ICXA 4O3QA 4KX3A 1SV0C 1TAUA 3M7DA 8ICGA 5J0SA 4F5OA 4F92B 3QU4A 4DFKA 1JROA 3ZDCA 4C7ZA 9ICQA 2MRLA 7ICMA 2KK0A 1ZQFA 2YQEA 7ICVA 2ZTCA 1C7YA 4ECTA 2CRXA 4IRDA 4ED0A 3RJKA 1HUOA 3OPXA 4MF2A 3C29A 4IQWA 2LM4A 4ECSA 4IRKA 5KT7A 1N5XA 3WKEA 2NYVA 4YFKA 4EZ9A 2BCUA 3F53A 8ICXA 5BPCA 5L1JA 2DPJA 2W3SA 3AU2A 2PI4A 2XGQA 3V7KA 2IBKA 4CCHA 4OO1J 1ZQUA 2LYBA 4NM2A 1S0NA 2E5SA 4ECUA 3RR8A 2W03A 3MDCA 4DQIA 4CE6A 2MU2A 2NRTA 1U45A 2ZIXA 1UT8A 2R8KA 3WK4A 3H0MB 3CRXA 1HJPA 4KLJA 2AH5A 2HSZA 4EX7A 5DG8A 4IL6U 3KZXA 5J2KA 2CXYA 4KLTA 3PMNA 9ICBA 1BVSA 3RH5A 2FMSA 4DOCA 2MA1A 4DFMA 1KL9A 3Q8SB 3AUOA 3JPRA 5DDYA 1S0VA 5AK5A 4KLDA 3SR6A 2JH7A 3HRDD 4Y2PA 3QEAZ 4B9VA 2KJ8A 2D6FC 3PW4A 5AM4A 3RJFA 1F44A 5HHHA 3OHAA 5GTHU 3MR2A 4DL5A 2DUYA 2E1FA 5ALJA 2JV3A 4J9MA 4RQ7A 1RYSA 2YMLA 1T4GA 4UARA 4GXKA 1NKCA 4QIWC 3TKAA 5HHIA 4BWJA 5KFHA 1ZQJA 9ICIA 1ZRNA 1TV9A 2FPLA 1QH9A 7ICHA 4KLEA 1L7PA 9ICKA 9ICOA 3KHHA 4ED3A 1U48A 3CP8A 1SWWA 3Q8MA 4RQ5A 4GXIA 4Y2YA 4YD2A 4RQ0A 3TADA 3DDHA 4JMUA 2JEFA 2G5HB 2JXJA 4YD1A 4PZOA 5J2JA 3J81j 5ALDA 1NOMA 2BCRA 3CNHA 2GLEA 3PW0A 4ECVA 2K8CB 4QZBA 9ICJA 3Q8PB 1XSLA 4B9NA 4CRXA 2G08A 1N2XA 3BQ1A 5CA7A 3GFKB 4B9TA 2BDUA 4Q8FA 3IHQB 2ZTDA 4JUZA 2KSOB 3OJUA 2J6TA 5ALYA 5D46A 1SL0A 3HW8A 3GV8B 4DL7A 2XO7A 3R9KA 4C8KA 9ICVA 1PK1A 4DSEA 2F76X 4KITB 3ALRA 2PFPA 2XGPA 3TAPA 4PL2A 4OJ5A 4QJFB 2XY7A 2I9GA 2AXTU 2JR5A 3ETLA 5J8YA 4EYHB 3H8MA 1FFUA 5AKHA 2K89A 3KHRA 3KTQA 3EUB2 2KSOA 9ICRA 5AIBA 4DQPA 4RZRA 3JPTA 5KG3A 2VA2A 3D2SA 5ALGA 1SZHA 5DLFA 4M9JA 3NRWA 5KG0A 1X6JA 4UQGA 4X5VA 2Y0SC 4UAVA 4BXOA 1SXEA 2R8JA 3BS7A 1NK7A 2HHVA 9ICGA 5CR0A 1F0MA 4CF5A 3CW2C 4C8LA 1Z3EB 3PW5A 3KHGA 3HILA 1ZQQA 2HHQA 4GFJA 5AKJA 4NJ8A 1ZQAA 3C23A 4ED2A 2L5YA 5J0YA 2YB1A 1L7MA 1ZD3A 3F2BA 3RBEA 3THVA 1HUZA 4GC6A 3B0YA 3EWAA 3KBBA 4M6WA 3V6HA 8ICZA 3NS1A 2XY5A 3JPNA 7ICTA 3VCBA 1MQ2A 1UT5A 2BHNA 4RNOA 4M9NA 5ALHA 3H0RB 2EZYA 2WF7A 5ALRA 7ICOA 4YN4A 1XO1A 2ASJA 3QU9A 3OGUA 3AL0B 1ZQKA 2ZTEA 4YXJA 3PSIA 2WFAA 2BZFA 4I2GA 2O6KA 2H3FA 2I6XA 2LYAA 4M9GA 4KLMA 1EXNA 5AI8A 1FIQA 1T8EA 7ICKA 1DGJA 1S9FA 4NM1A 5JTIA 4BGDA 1N62A 5KFUA 4MEYA 5J0QA 3H4DA 2ZJAA 3C2MA 5KNIA 1RXWA 4UAYA 8ICTA 2HBJA 4BX9C 2ZIUB 4YR2A 2LM1A 5CHGA 4ELUA 3RB0A 4EEKA 4KLUA 2YB4A 4O0IA 4C4TA 1CUKA 4QZIA 1ZJMA 4PGXA 2H3IA 3H40A 1XSNA 4HAIA 5J0UA 2HHUA 5AKIA 3MFHA 5AI5A 2W3RA 1HEKA 2OYYA 2M9NA 2P6UA 5L9XA 4UAWA 3QU5A 1ZJNA 3SV3A 1JI7A 1T7PA 2EAMA 2KN7A 3ZDEA 1IM4A 5KFWA 3UQ0A 1Y88A 3HT3A 4ACOA 8ICYA 1MC8A 2PMZC 1DRGA 2VJ5A 5EWEA 3IDWA 4DO9A 5KL8B 4HYKA 2KKVA 2Q4TA 3RF9A 9ICMA 3H8SA 1LKYB 1T3NA 1PK3A 3HJEA 2MSNA 1X9WA 8ICWA 7ICLA 2KNJA 5KFAA 2ODGA 3U26A 1TAMA 5DB9A 3MABA 5IIIA 4O3RA 2FJ6A 3T5KA 2CPRA 4F71A 4UAUA 1FO4A 2K8AA 2QB0B 4QZDA 1Q3UA 4RQNA 5F3XB 1VJ5A 4TUSA 5AI9A 5EWGA 3RB3A 1QSSA 3FM9A 5C5JA 1K1SA 2ASLA 2HHXA 5KT3A 2OHFA 2ISPA 3L4PA 3BZKA 4MFAA 4MFCA 4UB5A 3LWMA 4TQSA 2PXIA 2KZZA 1NKBA 2IOHA 2J6UA 4Y2TA 2WB1C 3ORYA 4NLCA 5KFFA 2Z7JA 5DQIA 1L7NA 2ZXIA 1NK4A 5ALIA 4J9KA 4F72A 5HR7A 5KT4A 1ZXIA 3WK6A 5JU5A 4I2AA 3GIIA 4P0QA 3C2KA 1WWVA 3K1ZA 3RR7A 1ZETA 3KKAC 3JPOA 2K4HA 4FBTA 1PZNA 2YN4A 2OXOA 4KLOA 5DQHA 4Q8EA 5AHXA 3KHLA 3PVXA 3LYSA 2ZIWA 2IMWP 1KFDA 4PH5A 4US9A 1YZ6A 5KFOA 1JRPA 4Z6CA 7ICEA 5KFMA 3PR5B 5AM5A 3A0BU 2LKYA 2HVIA 4KLIA 4Y2XA 3FAHA 2GH1A 1SL2A 4UB6U 4ED1A 3EZ5A 5ALUA 2C2RA 1DGSA 5FP0A 5KFRA 3WK7A 2FPMA 1UQVA 2EZXA 4Y2RA 1K1QA 1K5OA 1X2IA 1ZD5A 5AKLA 3MGIA 2BR0A 2JEGA 2PI5A 3PW7A 4I28A 1KLNA 1KFTA 2G5IB 4EELA 4DS5A 2RQ5A 5KTQA 3ISBA 2BPGA 1KN5A 4AYBF 3RJIA 3GIJA 4WJ3B 1ZQXA 5IIJA 2BPCA 5EWFA 3SYZA 2OCEA 3HWTA 1RQNA 4JV0A 2H3VA 3EW9A 4RUCA 3RBDA 1ZQPA 3T5HA 2RRDA 4OJOA 1X42A 4DCCA 5DQGA 2G06A 4QZAA 4YQWA 1Z4OA 2KIWA 3NGDA 5KT2A 3NASA 1D9FA 1U4BA 5KFJA 2JHDA 4AP9A 1COOA 4RU9A 4P0PB 5HP4A 4I2CA 5ALSA 4B9SA 3K4GA 4RT2A 1SL1A 2WF9A 2DFLA 1AQ6A 2E8OA 3GILA 2FLLA 2QARA 2UVUA 7ICNA 2C22A 3BS5B 5HMMA 2XCPA 4QW8A 4O3OA 3ZD8A 4QWAA 2ZUDA 3KD3A 2RDIA 3T5JA 4PHPA 2KOBA 5AKXA 5TISU 3PW2A 1XNSA 1SV4A 3ISCA 4M2YA 2JZBB 1V97A 4YMNA 1JIHA 2DQNB 4I2HA 2V4QA 2A3VA 4DFPA 5J2GA 4PPXA 2VIXA 4K4IA 4Y2VA 5CP2A 1UA0A 5KG6A 1JN3A 4NL9A 1KW4A 3SEIA 7ICUA 5AKKA 1H38A 2K4IA 1KSPA 1YT3A 4XRHA 5AM0A 1LB2B 4JK1A 4PZNA 4U6PA 3KOOA 4F5NA 3PO5A 5A0LA 1ZQBA 5EE1A 1O03A 2XIDA 4LVSA 3UQ2A 3K1RB 5IIOA 2PFOA 2QB1A 8ICCA 9ICWA 3FDSA 1QQ6A 4PGQA 4J9NA 4J9PA 3DV9A 5AICA 1HIWA 1ZQTA 4NL9C 4Y2UA 1N48A 2EDUA 1ZQDA 1Z1BA 3WK9A 2WB1F 1DK2A 4IR1A 3UMGA 2HHTA 4BDPA 2FLPA 1OXJA 1UPHA 2BQRA 1RG6A 4EYIB 1WWUA 1V9PA 3SV4A 1L8OA 4XQ8A 3A0HU 4FO6A 2W55A 8ICQA 4IRCA 4OCZA 1S8OA 5HR6A 2F44A 1BPZA 5CRXA 3Q8RB 3L5KA 2XY6A 3QE9Y 1IXRA 2HOQA 4UATA 4FZMA 3ZDAA 5DDMA 2PKEA 3AU6A 2F3NA 5KG5A 3GZFA 5DBCA 4OJLA 4DSIA 4FBUA 1OUQA 5KG1A 3EYZA 4O3NA 4P4PA 1XS9D 7ICRA 1SZPA 4QNLA 1ZOLA 3PZPA 1ZQCA 1KFSA 5J2AA 5IIKA 4ECWA 3NVWA 4J9OA 2KVCA 1S77D 1NK8A 5J0TA 1BNPA 5DGBA 4J9LA 4B9LA 2NRXA 4Y2SA 2KD1A 5JRTA 3OHBA 2R8GA 3I76A 4Y2QA 3RFAA 2KJ5A 3B9JA 8ICHA 3PX0A 4YVZA 3LDAA 5KAIU 5EE0A 3BQTA 3UMCA 1JXEA 4CF3A 4FS1A 3UMBA 2KJ9A 2BCQA 1NJYA 4DSJA 2Y1JA 4DQRA 3L3FX 2F8LA 9ICSA 1UCVA 1TAQA 3AQEA 2DBYA 1URJA 2YMQA 1XWLA 1Z00B 4QIWF 2Y9TA 3ZDDA 4J03A 1RZTA 4QZEA 2ESEA 1Z19A 1ZD2P 3UM9A 2DPIA 1B22A 5KT6A 4EX6A 3RJGA 2WHEA 5KFNA 1S97A 2WF5A 5KFXA 4BXOB 5IIMA 1ZQMA 2FMQA 2MUTA 5HMLA 5ALFA 2W54A 1L6NA 4UB3A 4IS7A 5KFPA 1COKA 5KFZA 4DOBA 4ECRA 4UB8U 1ZYQA 3OTQA 1NK6A 3SD7A 4JWNA 4R64A 5KAFU 4P4OA 2AJQA 4EBDA 3GV7B 4OJ6A 1CRXA 4ECQA 5H2FU 3ONNA 4FZNA 4F3OA 2E8NA 3VC8A 8ICLA 5ALMA 3LVWA 5DB8A 4RQ4A 4XA5A 4LJXA 5ALQA 1L3SA 4EBEA 5J0PA 4RQMA 7ICJA 4J9QA 2KHVA 3QU7A 2A1JB 4JB3A 3IG8A 3MC1A 1NJXA 1Q46A 1U9LA 2W7OA 5KFYA 3TADC 2W7PA 1J97A 3T3FA 5ALTA 2HHWA 8ICBA 2GWSA 2Y0SF 5KG2A 3N4MB 2KZMA 4OD0A 3TFSA 3C21A 2KHQA 3KKAA 2PMZF 4F5PA 2AQ4A 2IOFA 4MHVA 3QEBZ 1L7OA 3GQCA 1P7DA 1WUDA 4RUAA 3GV5B 2D3DA 3GU3A 2RHFA 2HMXA 5ALLA 3NVZA 2ZXHA 3OJSA 2DL0A 2R8IA 4JWMA 1ZQNA 1NK9A 2W9CB 3S6JA 1PUZA 8ICIA 1TFRA 1SV0A 5CWRA 4YR3A 1AROP 2FDRA 2ZIVA 2DWQA 4EZ6A 1M6YA 2KFZA 2OEHA 4NLBA 5DB7A 4NLNA 1ZQWA 4AYBC 2HBMA 3HPOA 2AGOA 3M9NB 5J0RA 3PX4A 8ICMA 3I28A 1NZBA 5CJ7A 2J6SA 3SENA 1PK1B 3C1YA 3IV6A 5AKEA 1D8YA 5KFEA 4CDGA 2FE9A 2VJ4A 4R8UA 2GO7A 4BWMA 1BPDA 2AGPA 5CB1A 2ZIXB 3RRHA 8ICOA 9ICFA 1SB3C 2NO4A 3T5LA 5F9NA 3B0XA 5AKZA 3JPQA 4YR0A 2ZJ8A 1RYUA 4C8MA 4O3MA 2FLNA 4P4MA 4QZGA 5DG7A 2HVHA 4C8NA 4M0AA 3ISDA 4PHDA 3LWLA 9ICCA 3QZ8A 4ED6A 5KT5A 4Y2JA 3MR3A 2R8HA 1OW5A 5KFBA 5J0OA 4TUPA 2HHSA 4I29A 1KBUA 1RQLA 2YMMA 2EQYA 2K4EA 2A1JA 3BS5A 3RH4A 3QUQA 2RLTA 5ALNA 3GDXA 1BPBA 2QARB 4O3PA 2NRVA 3D2NA 8ICKA 2ZIUA 3PY8A 2PFQA 3EPGA 4ZOHC 1L3UA 2JZBA 4UBBA 2NV3A 5L1LA 3QUCA 4UASA 3WKAA 2OH2A 4RPYA 4NLKA 2JMGA 3RH6A 4YMOA 5J8YC 3NVYA 2FI1A 4BJQA 4QZFA 3UPQA 3PNCA 1J2NA 4NLGA 1ECWA 2WTFA 1GO3F 3QUBA 2OM6A 3ZDBA 1UHUA 2WAQF 5G5HA 3KFUF 1CI4A 2W9AA 2KVSA 5AIAA 1ZQHA 2W9CA 1ZQIA 4GIBA 5L1IA 3NTUA 1XSPA 2E8PA 9ICTA 1U47A 4ECYA 4DS4A 4RQ3A 4C4RA 2N1RA 1LKYA 2HOIA 3RJEA 2YTUA 1RYRA 2ZIVB 3AN1A 2ATLA 2BQ3A 2KE7A 2LI6A 2K4PA 4I27A 1NJZA 2XCAA 2YMPA 2HDOA 4R63A 8ICSA 5EE3A 4DL4A 5J2EA 4F4ZA 3V7LA 3RTVA 2F2AB 2W9BB 4DWIA 2XC9A 1UA1A 2Q0ZX 2KEYA 3JPPA 2HBLA 5AI4A 8ICUA 1KQQA 1PVPA 2KKPA 1RM6C 1S0MA 2KICA 4RPZA 4DF8A 3Q8QB 5KFVA 4TURA 8ICEA 2I1QA 5BOLA 7ICSA 2B0CA 4DOAA 4K4HA 1X40A 5K4LA 3RB6A 3TANA 4KN7A 4P0QB 4BUGA 1X9XA 3TQ1A 1ZQSA 5KFLA 1F5SA 3M1YA 1B43A 5AK4A 2K8BB 1MSWD 3QXGA 4DF4A 4LZGA 5J2HA 3SMVA 1ZQOA 3V72A 9ICEA 2XVTA 2UVRA 4FZLA 3AMZA 3UXOA 3GIKA 2JEIA 2B21A 1QTMA 2G09A 2ZIWB 4ZH4A 1ZQGA 1MQ3A 5KL1B 4CNQA 2VANA 4YMMA 2C2EA 4QZ8A 1QQ5A 3HKZF 4F50A 3C28A 3CYMA 3TACB 3D6JA 2F1IA 4M04A 3PSPA 4OJPA 2P66A 3KZIU 2E8MA 2IA6A 1WCNA 3FC4A 5DLGA 2AHOB 4C8OA 4QWCA 1Z00A 5ALPA 3WK8A 3PMLA 1FFVA 4XUSA 2MUTB 4I2JA 2H5XA 4M6WB 2HBKA 2Y9UA 3ETRA 2GOLA 1X66A 3IN5A 2DKZA 2HCFA 2EAOA 2LMRA 1KTQA 2DF4B 2LHTA 4JV2A 3MFIA 4FS2A 4KTQA 4O5KA 4EENA 5DG9A 3M9MB 4J9SA 4DQSA 2IHNA 4KLLA 2EZZA 3TI0A 4JV1A 2G0AA 1N61A
chains in the Genus database with same CATH topology
4OJOA 2W03A 5T14A 2PMZF 3AQEA 2YB4A 1URJA 2KV2A 2G06A 4QIWF 2KIWA 2WB1C 3HKZC 3N7PD 2ZIXA 4NLCA 1Z1BA 2WB1F 3D2NA 2ZIUA 2Z7JA 1Z19A 4GFJA 2ZXIA 2K8CB 2H3IA 1WUDA 1P7DA 3H0MB 3CRXA 4P0QB 2JHDA 5HR7A 3PSFA 2LBOA 3GU3A 2RHFA 3KZXA 2HMXA 4P0PB 3M6KA 4BUGA 1Q3VA 4CRXA 1UPHA 2ZXHA 2G08A 4P0QA 3F2DA 2YB1A 1T94A 2NV3A 3DEEA 3IP4B 3K1ZA 3F2BA 2K4HA 2OH2A 2K8BB 1HEKA 2BDUA 2OXOA 2OYYA 1L6NA 2MA1A 2JMGA 3SAGA 3E0FA 4C0ZA 3LYSA 2ZIWA 5HR6A 4BJQA 2ZIVA 4PL1A 5CRXA 3SMVA 4IC9A 2XVTA 4FZLA 1A0PA 1ECWA 4CGZA 2HOQA 2JH1A 3L3FX 1GO3F 2OM6A 4FZMA 2CN1A 4NLBA 3SQIA 4NWIA 4ICAA 2JH7A 4AYBC 2G09A 2ZIWB 2WAQF 2F77X 2HBMA 3D2QA 3GZFA 4OJLA 2KJ8A 1OUQA 5KL1B 2M0NA 3KFUF 3H0LB 4ACOA 2LKYA 3VCBA 2PMZC 3T79A 3ICXA 3SAHA 2VJ5A 1NZBA 1DRGA 2HOFA 2D6FC 1D8BA 4KX3A 3HKZF 2F76X 2KOBA 3M7DA 5KL8B 3H0RB 4OJ6A 1F44A 2E1EA 2KKVA 3C28A 1ED1A 5C0YA 3CYMA 2Q4TA 2GH1A 4QNLA 3RF9A 1XNSA 1CRXA 3ALRA 4NV0A 2JGAA 3PSPA 4CDGA 3ONNA 4PL2A 4OJPA 2H3QA 3PZPA 2VJ4A 4FZNA 4OJ5A 4FE3A 2R18A 2DQNB 2N1RA 3AL0B 1A6SA 2MRLA 1ZQ1C 3VC8A 2A3VA 4QJFB 2HOIA 3PSIA 2E1FA 2VIXA 2G07A 3LVWA 2KVCA 3N7RC 1PVQA 2ZIVB 2H3FA 2KNJA 2LYAA 2ZIXB 3AQFA 2RP5A 4QIWC 3MGVA 2K89A 3SAFA 2KD1A 2CRXA 3PSTA 1TAMA 3O0FA 2K4IA 2KHVA 2G5IB 4A8EA 1YT3A 3RFAA 3OPXA 2KJ5A 3C29A 3IG8A 2HBKA 3IG5A 4O3MA 2VKQA 4U7CA 2DGZA 2GOLA 2CPRA 2W7OA 3N7SC 1HIWA 2W7PA 4U6PA 3D2SA 3F5AA 1SZHA 3IN5A 2K8AA 1XO0A 4AYBF 3CP8A 2F2AB 5A0LA 4WJ3B 1Q3UA 2XIDA 2DF4B 2LHTA 3NRWA 2Y0SF 3F2CA 2KEYA 2ZG6A 3F53A 1PVRA 4KMOB 2Y0SC 2XI9A 3LVVA 2HBLA 3NUQA 4JMUA 3M6ZA 1IIPA 2H3VA 2H3ZA 4OO1J 1PVPA 4P0PA 2G5HB 2XICA 2LYBA 1KBUA 2KJ9A 2HBJA 2KKPA 3F5EA 2E5SA 2YX8A 2K4EA 4KX5A 4BX9C 1MA7A 2W04A 2KICA 2WAQC 2ZIUB 2G0AA 2KHQA 2RRDA 2F8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HIW A;  2H3Q A;  2N1R A;  1A6S A;  4IC9 A;  1ECW A;  2H3I A;  2H3F A;  2LYA A;  4ICA A;  4JMU A;  2HMX A;  2H3V A;  1UPH A;  1TAM A;  2H3Z A;  2NV3 A;  2K4I A;  2LYB A;  2K4E A;  2K4H A;  1ED1 A;  1HEK A;  1L6N A;  2GOL A;  2JMG A; 
#chains in the Genus database with same CATH topology
 1RPL A;  4O5E A;  2WF8 A;  2IOF K;  7ICF A;  9ICN A;  3V6K A;  5J0X A;  3K75 D;  2UVW A;  5KFQ A;  2V9W A;  4TQR A;  2PFN A;  2HI0 A;  1JMS A;  5KFC A;  2KMD A;  4RQ8 A;  2RDJ A;  4PHA A;  4RNN A;  4KLG A;  2NRW A;  3SAG A;  2QB0 A;  1Z4N A;  5KFK A;  1NKE A;  4KLF A;  4Z6E A;  5KFD A;  2K60 A;  5G5G A;  5AKY A;  1U49 A;  4R8U B;  1ZQY A;  2F77 X;  3D2Q A;  1VDV A;  5KFT A;  4YG2 A;  2M0N A;  3H0L B;  5DB6 A;  3AEV A;  3QZ7 A;  5D49 A;  3BQ2 A;  4M47 A;  4UAZ A;  1ED1 A;  5C0Y A;  1NI3 A;  3TAR A;  2H3Q A;  3PX6 A;  4UB4 A;  5J0W A;  3BQ7 A;  5J29 A;  4NLZ A;  1IV8 A;  3N7R C;  9ICL A;  1PVQ A;  1D9D A;  3WKB A;  3M9O B;  4R65 A;  4ED8 A;  5EOZ A;  5DBB A;  3PST A;  4Q44 A;  4QZC A;  1JX4 A;  3FYH A;  4A8E A;  4LZD A;  8ICN A;  7ICP A;  4DLE A;  5CEH A;  4ED7 A;  4U7C A;  2DGZ A;  1SKR A;  1XU4 A;  4O5C A;  2F1H A;  4KLQ A;  3WKC A;  1ZQL A;  3BZC A;  3IRU A;  1PVR A;  4QW9 A;  4DSF A;  1SKS A;  4DSL A;  3OSN A;  2XI9 A;  3M6Z A;  4O9M A;  3WK5 A;  4GLX A;  3LK9 A;  4USA A;  2W8K A;  5ALV A;  2QKQ A;  5GTI U;  1NK0 A;  1MA7 A;  1LV5 A;  2WAQ C;  1TKD A;  3HX0 A;  4I2B A;  5KFG A;  3PO4 A;  4C7Y A;  3N7P D;  3WU2 U;  1X9S A;  3PSF A;  4C80 A;  5J2C A;  1Q3V A;  3ED5 A;  2FPK A;  3F2D A;  1X9M A;  1DK3 A;  1J2M A;  5ALW A;  1ZRM A;  5AM1 A;  2BCV A;  1ZQZ A;  2ZUC A;  3E0F A;  1S5L U;  4US8 A;  4C0Z A;  4PL1 A;  5B5E U;  2KFN A;  1BPX A;  2BPF A;  4CGZ A;  3V7J A;  1XC9 A;  4KLH A;  3PR4 A;  4IQU A;  3G6X A;  4F4W A;  1BGX T;  5IIL A;  5KG4 A;  3ICX A;  2HOF A;  1D8B A;  3OSP A;  2V4R A;  4RQ6 A;  3ZI4 A;  4F93 B;  1ZQE A;  9ICP A;  1SWV A;  5ALO A;  2W9B A;  3RB4 A;  1TK5 A;  4NV0 A;  2ASD A;  3BDP A;  1SIJ A;  5JUM A;  2C2D A;  4FE3 A;  5DBA A;  4MFF A;  1N60 A;  2KG5 A;  4DEZ A;  1WYG A;  4RQ2 A;  2RP5 A;  4YXM A;  4FFD A;  4E0D A;  1VLB A;  4ELT A;  5TZV A;  5ALZ A;  4MF8 A;  4UB1 A;  4UB2 A;  1YZ7 A;  3IG5 A;  2VKQ A;  3N7S C;  1O08 A;  3F5A A;  3TAQ A;  1V85 A;  2BQU A;  3PV8 A;  2I5H A;  1JXL A;  5KG7 A;  2IHM A;  5IIN A;  5ALK A;  1S10 A;  4Q45 A;  1TVA A;  3M8S A;  2B6G A;  3N97 B;  5AI0 A;  2XIC A;  1CEZ A;  1TK0 A;  3C5G A;  2W04 A;  1L5U A;  1N63 A;  2MAX A;  2KV2 A;  2NO5 A;  2EAN A;  5EE9 A;  5ALX A;  3NRZ A;  1N56 A;  1L3T A;  2JEJ A;  1JUD A;  4K4G A;  1SXD A;  4RPX A;  4C4S A;  3E2E A;  2LBO A;  3M6K A;  2EH9 A;  5AM2 A;  4R66 A;  4F4Y A;  4ECZ A;  3IP4 B;  3MBY A;  1B0X A;  4F4K A;  2WF6 A;  2W43 A;  1B4F A;  1QQ7 A;  3MDA A;  3E58 A;  9ICU A;  1KKX A;  4M9L A;  2QLT A;  1JAL A;  4KMU A;  4F4X A;  4IR9 A;  1KRP A;  2AQ0 A;  2LYH A;  8ICP A;  2LPE A;  3BJY A;  5HNK A;  1L8L A;  4MEX A;  2VA3 A;  3AM9 A;  4QZ9 A;  1NZP A;  5AI6 A;  5L1M A;  1DXS A;  2P35 A;  4DLG A;  2HW3 A;  3QUT A;  4DL2 A;  1N5W A;  2JGA A;  2KP7 A;  2R18 A;  4F2R A;  2EAP A;  3H4B A;  1A6S A;  1ZQ1 C;  4I2E A;  4YCX A;  3ZD9 A;  4B6J A;  3G6V A;  3AQF A;  1A76 A;  3MGV A;  2A19 A;  3M8R A;  3RAQ A;  3SAF A;  4QWE A;  4TUQ A;  3H7I A;  3MGH A;  1QCK A;  3JPS A;  4ECX A;  4ELV A;  3C1Z A;  1S0O A;  2W11 A;  5F9L A;  2W8L A;  2E3T A;  2Y1I A;  4KLS A;  4B9U A;  2F1J A;  1KEJ A;  3RRG A;  2AU0 A;  7ICQ A;  1V38 A;  3NUQ A;  1NNL A;  3G6Y A;  5ALE A;  4GC7 A;  4Q43 A;  1BPY A;  4QWD A;  2H3Z A;  2VA8 A;  2KZ3 A;  3IM1 A;  3N28 A;  3UXP A;  2C28 A;  4F8R A;  5T14 A;  1S76 D;  3QU2 A;  3HKZ C;  1SGG A;  3C2L A;  7ICG A;  2JRZ A;  1NK5 A;  4KN4 A;  1ZQV A;  5L1K A;  5D4B A;  7ICI A;  5KFS A;  1FEZ A;  4EBC A;  1T94 A;  3DEE A;  4CF4 A;  2YY6 A;  4RT3 A;  2FMP A;  3QYP A;  1ZD4 A;  5KFI A;  2ZJ5 A;  3RAX A;  2BCS A;  5AK3 A;  4F91 B;  1ZQR A;  4IC9 A;  2KTQ A;  2JH1 A;  2CN1 A;  1BNO A;  1Q8K A;  8ICJ A;  5J2B A;  4I2I A;  3QX7 A;  3C5F A;  2BGW A;  3SAH A;  4PJ0 U;  2E1E A;  4DL3 A;  3NVV A;  5J2D A;  4EEY A;  5J2F A;  4O3S A;  5BOM A;  4NY8 A;  5DGA A;  4PHE A;  3H8J A;  2P6R A;  2ZUB A;  4DSK A;  4P2H A;  3H8W A;  2G07 A;  8ICF A;  8ICA A;  4DFD A;  4DQQ A;  8ICR A;  2AGQ A;  1BPE A;  3O0F A;  3RJJ A;  2DKX A;  3SI8 A;  1WG8 A;  3QNM A;  1IG6 A;  2UVV A;  1XO0 A;  2W9M A;  5AKG A;  4DL6 A;  5B66 U;  3F2C A;  2ZG6 A;  4QWB A;  1T3Q A;  4KMO B;  8ICV A;  3V6J A;  3LVV A;  3EPI A;  3BQ0 A;  4IQT A;  1QSY A;  1QLN A;  1IIP A;  1QSL A;  4G9B A;  9ICA A;  4UBC A;  1KDH A;  4QZH A;  1WCL A;  4P0P A;  3MR6 A;  3F5E A;  2YX8 A;  1LVH A;  4KX5 A;  2BKE A;  5DKW A;  4B9M A;  1MN8 A;  3WKD A;  2KIV A;  4YP3 A;  2A1A A;  1TE2 A;  2D8C A;  3UXN A;  5J2I A;  2F8K A;  3RJH A;  3Q8K A;  4RQ1 A;  4NXZ A;  4RNM A;  5AK6 A;  4F5Q A;  4UW9 A;  3MR5 A;  2BDP A;  1SKW A;  3SZ2 A;  2ES6 A;  4IQV A;  2NRZ A;  3I1Y A;  5AM3 A;  1D8L A;  1Z1V A;  4I2D A;  2ISO A;  1X6I A;  4F2S A;  4J9R A;  1RXV A;  2OWO A;  1NJW A;  4I2F A;  4Z6D A;  2ALZ A;  4G3I A;  4F5R A;  1TK8 A;  1DOQ A;  3HP6 A;  1C20 A;  1A0P A;  9ICH A;  3SQI A;  4NWI A;  4DFJ A;  1RDF A;  4ICA A;  1A77 A;  3GIM A;  3TFR A;  5E79 U;  4PGY A;  4Z6F A;  1L3V A;  3Q8L A;  4GXJ A;  3T79 A;  4M9H A;  9ICX A;  4O3Q A;  4KX3 A;  1SV0 C;  1TAU A;  3M7D A;  8ICG A;  5J0S A;  4F5O A;  4F92 B;  3QU4 A;  4DFK A;  1JRO A;  3ZDC A;  4C7Z A;  9ICQ A;  2MRL A;  7ICM A;  2KK0 A;  1ZQF A;  2YQE A;  7ICV A;  2ZTC A;  1C7Y A;  4ECT A;  2CRX A;  4IRD A;  4ED0 A;  3RJK A;  1HUO A;  3OPX A;  4MF2 A;  3C29 A;  4IQW A;  2LM4 A;  4ECS A;  4IRK A;  5KT7 A;  1N5X A;  3WKE A;  2NYV A;  4YFK A;  4EZ9 A;  2BCU A;  3F53 A;  8ICX A;  5BPC A;  5L1J A;  2DPJ A;  2W3S A;  3AU2 A;  2PI4 A;  2XGQ A;  3V7K A;  2IBK A;  4CCH A;  4OO1 J;  1ZQU A;  2LYB A;  4NM2 A;  1S0N A;  2E5S A;  4ECU A;  3RR8 A;  2W03 A;  3MDC A;  4DQI A;  4CE6 A;  2MU2 A;  2NRT A;  1U45 A;  2ZIX A;  1UT8 A;  2R8K A;  3WK4 A;  3H0M B;  3CRX A;  1HJP A;  4KLJ A;  2AH5 A;  2HSZ A;  4EX7 A;  5DG8 A;  4IL6 U;  3KZX A;  5J2K A;  2CXY A;  4KLT A;  3PMN A;  9ICB A;  1BVS A;  3RH5 A;  2FMS A;  4DOC A;  2MA1 A;  4DFM A;  1KL9 A;  3Q8S B;  3AUO A;  3JPR A;  5DDY A;  1S0V A;  5AK5 A;  4KLD A;  3SR6 A;  2JH7 A;  3HRD D;  4Y2P A;  3QEA Z;  4B9V A;  2KJ8 A;  2D6F C;  3PW4 A;  5AM4 A;  3RJF A;  1F44 A;  5HHH A;  3OHA A;  5GTH U;  3MR2 A;  4DL5 A;  2DUY A;  2E1F A;  5ALJ A;  2JV3 A;  4J9M A;  4RQ7 A;  1RYS A;  2YML A;  1T4G A;  4UAR A;  4GXK A;  1NKC A;  4QIW C;  3TKA A;  5HHI A;  4BWJ A;  5KFH A;  1ZQJ A;  9ICI A;  1ZRN A;  1TV9 A;  2FPL A;  1QH9 A;  7ICH A;  4KLE A;  1L7P A;  9ICK A;  9ICO A;  3KHH A;  4ED3 A;  1U48 A;  3CP8 A;  1SWW A;  3Q8M A;  4RQ5 A;  4GXI A;  4Y2Y A;  4YD2 A;  4RQ0 A;  3TAD A;  3DDH A;  4JMU A;  2JEF A;  2G5H B;  2JXJ A;  4YD1 A;  4PZO A;  5J2J A;  3J81 j;  5ALD A;  1NOM A;  2BCR A;  3CNH A;  2GLE A;  3PW0 A;  4ECV A;  2K8C B;  4QZB A;  9ICJ A;  3Q8P B;  1XSL A;  4B9N A;  4CRX A;  2G08 A;  1N2X A;  3BQ1 A;  5CA7 A;  3GFK B;  4B9T A;  2BDU A;  4Q8F A;  3IHQ B;  2ZTD A;  4JUZ A;  2KSO B;  3OJU A;  2J6T A;  5ALY A;  5D46 A;  1SL0 A;  3HW8 A;  3GV8 B;  4DL7 A;  2XO7 A;  3R9K A;  4C8K A;  9ICV A;  1PK1 A;  4DSE A;  2F76 X;  4KIT B;  3ALR A;  2PFP A;  2XGP A;  3TAP A;  4PL2 A;  4OJ5 A;  4QJF B;  2XY7 A;  2I9G A;  2AXT U;  2JR5 A;  3ETL A;  5J8Y A;  4EYH B;  3H8M A;  1FFU A;  5AKH A;  2K89 A;  3KHR A;  3KTQ A;  3EUB 2;  2KSO A;  9ICR A;  5AIB A;  4DQP A;  4RZR A;  3JPT A;  5KG3 A;  2VA2 A;  3D2S A;  5ALG A;  1SZH A;  5DLF A;  4M9J A;  3NRW A;  5KG0 A;  1X6J A;  4UQG A;  4X5V A;  2Y0S C;  4UAV A;  4BXO A;  1SXE A;  2R8J A;  3BS7 A;  1NK7 A;  2HHV A;  9ICG A;  5CR0 A;  1F0M A;  4CF5 A;  3CW2 C;  4C8L A;  1Z3E B;  3PW5 A;  3KHG A;  3HIL A;  1ZQQ A;  2HHQ A;  4GFJ A;  5AKJ A;  4NJ8 A;  1ZQA A;  3C23 A;  4ED2 A;  2L5Y A;  5J0Y A;  2YB1 A;  1L7M A;  1ZD3 A;  3F2B A;  3RBE A;  3THV A;  1HUZ A;  4GC6 A;  3B0Y A;  3EWA A;  3KBB A;  4M6W A;  3V6H A;  8ICZ A;  3NS1 A;  2XY5 A;  3JPN A;  7ICT A;  3VCB A;  1MQ2 A;  1UT5 A;  2BHN A;  4RNO A;  4M9N A;  5ALH A;  3H0R B;  2EZY A;  2WF7 A;  5ALR A;  7ICO A;  4YN4 A;  1XO1 A;  2ASJ A;  3QU9 A;  3OGU A;  3AL0 B;  1ZQK A;  2ZTE A;  4YXJ A;  3PSI A;  2WFA A;  2BZF A;  4I2G A;  2O6K A;  2H3F A;  2I6X A;  2LYA A;  4M9G A;  4KLM A;  1EXN A;  5AI8 A;  1FIQ A;  1T8E A;  7ICK A;  1DGJ A;  1S9F A;  4NM1 A;  5JTI A;  4BGD A;  1N62 A;  5KFU A;  4MEY A;  5J0Q A;  3H4D A;  2ZJA A;  3C2M A;  5KNI A;  1RXW A;  4UAY A;  8ICT A;  2HBJ A;  4BX9 C;  2ZIU B;  4YR2 A;  2LM1 A;  5CHG A;  4ELU A;  3RB0 A;  4EEK A;  4KLU A;  2YB4 A;  4O0I A;  4C4T A;  1CUK A;  4QZI A;  1ZJM A;  4PGX A;  2H3I A;  3H40 A;  1XSN A;  4HAI A;  5J0U A;  2HHU A;  5AKI A;  3MFH A;  5AI5 A;  2W3R A;  1HEK A;  2OYY A;  2M9N A;  2P6U A;  5L9X A;  4UAW A;  3QU5 A;  1ZJN A;  3SV3 A;  1JI7 A;  1T7P A;  2EAM A;  2KN7 A;  3ZDE A;  1IM4 A;  5KFW A;  3UQ0 A;  1Y88 A;  3HT3 A;  4ACO A;  8ICY A;  1MC8 A;  2PMZ C;  1DRG A;  2VJ5 A;  5EWE A;  3IDW A;  4DO9 A;  5KL8 B;  4HYK A;  2KKV A;  2Q4T A;  3RF9 A;  9ICM A;  3H8S A;  1LKY B;  1T3N A;  1PK3 A;  3HJE A;  2MSN A;  1X9W A;  8ICW A;  7ICL A;  2KNJ A;  5KFA A;  2ODG A;  3U26 A;  1TAM A;  5DB9 A;  3MAB A;  5III A;  4O3R A;  2FJ6 A;  3T5K A;  2CPR A;  4F71 A;  4UAU A;  1FO4 A;  2K8A A;  2QB0 B;  4QZD A;  1Q3U A;  4RQN A;  5F3X B;  1VJ5 A;  4TUS A;  5AI9 A;  5EWG A;  3RB3 A;  1QSS A;  3FM9 A;  5C5J A;  1K1S A;  2ASL A;  2HHX A;  5KT3 A;  2OHF A;  2ISP A;  3L4P A;  3BZK A;  4MFA A;  4MFC A;  4UB5 A;  3LWM A;  4TQS A;  2PXI A;  2KZZ A;  1NKB A;  2IOH A;  2J6U A;  4Y2T A;  2WB1 C;  3ORY A;  4NLC A;  5KFF A;  2Z7J A;  5DQI A;  1L7N A;  2ZXI A;  1NK4 A;  5ALI A;  4J9K A;  4F72 A;  5HR7 A;  5KT4 A;  1ZXI A;  3WK6 A;  5JU5 A;  4I2A A;  3GII A;  4P0Q A;  3C2K A;  1WWV A;  3K1Z A;  3RR7 A;  1ZET A;  3KKA C;  3JPO A;  2K4H A;  4FBT A;  1PZN A;  2YN4 A;  2OXO A;  4KLO A;  5DQH A;  4Q8E A;  5AHX A;  3KHL A;  3PVX A;  3LYS A;  2ZIW A;  2IMW P;  1KFD A;  4PH5 A;  4US9 A;  1YZ6 A;  5KFO A;  1JRP A;  4Z6C A;  7ICE A;  5KFM A;  3PR5 B;  5AM5 A;  3A0B U;  2LKY A;  2HVI A;  4KLI A;  4Y2X A;  3FAH A;  2GH1 A;  1SL2 A;  4UB6 U;  4ED1 A;  3EZ5 A;  5ALU A;  2C2R A;  1DGS A;  5FP0 A;  5KFR A;  3WK7 A;  2FPM A;  1UQV A;  2EZX A;  4Y2R A;  1K1Q A;  1K5O A;  1X2I A;  1ZD5 A;  5AKL A;  3MGI A;  2BR0 A;  2JEG A;  2PI5 A;  3PW7 A;  4I28 A;  1KLN A;  1KFT A;  2G5I B;  4EEL A;  4DS5 A;  2RQ5 A;  5KTQ A;  3ISB A;  2BPG A;  1KN5 A;  4AYB F;  3RJI A;  3GIJ A;  4WJ3 B;  1ZQX A;  5IIJ A;  2BPC A;  5EWF A;  3SYZ A;  2OCE A;  3HWT A;  1RQN A;  4JV0 A;  2H3V A;  3EW9 A;  4RUC A;  3RBD A;  1ZQP A;  3T5H A;  2RRD A;  4OJO A;  1X42 A;  4DCC A;  5DQG A;  2G06 A;  4QZA A;  4YQW A;  1Z4O A;  2KIW A;  3NGD A;  5KT2 A;  3NAS A;  1D9F A;  1U4B A;  5KFJ A;  2JHD A;  4AP9 A;  1COO A;  4RU9 A;  4P0P B;  5HP4 A;  4I2C A;  5ALS A;  4B9S A;  3K4G A;  4RT2 A;  1SL1 A;  2WF9 A;  2DFL A;  1AQ6 A;  2E8O A;  3GIL A;  2FLL A;  2QAR A;  2UVU A;  7ICN A;  2C22 A;  3BS5 B;  5HMM A;  2XCP A;  4QW8 A;  4O3O A;  3ZD8 A;  4QWA A;  2ZUD A;  3KD3 A;  2RDI A;  3T5J A;  4PHP A;  2KOB A;  5AKX A;  5TIS U;  3PW2 A;  1XNS A;  1SV4 A;  3ISC A;  4M2Y A;  2JZB B;  1V97 A;  4YMN A;  1JIH A;  2DQN B;  4I2H A;  2V4Q A;  2A3V A;  4DFP A;  5J2G A;  4PPX A;  2VIX A;  4K4I A;  4Y2V A;  5CP2 A;  1UA0 A;  5KG6 A;  1JN3 A;  4NL9 A;  1KW4 A;  3SEI A;  7ICU A;  5AKK A;  1H38 A;  2K4I A;  1KSP A;  1YT3 A;  4XRH A;  5AM0 A;  1LB2 B;  4JK1 A;  4PZN A;  4U6P A;  3KOO A;  4F5N A;  3PO5 A;  5A0L A;  1ZQB A;  5EE1 A;  1O03 A;  2XID A;  4LVS A;  3UQ2 A;  3K1R B;  5IIO A;  2PFO A;  2QB1 A;  8ICC A;  9ICW A;  3FDS A;  1QQ6 A;  4PGQ A;  4J9N A;  4J9P A;  3DV9 A;  5AIC A;  1HIW A;  1ZQT A;  4NL9 C;  4Y2U A;  1N48 A;  2EDU A;  1ZQD A;  1Z1B A;  3WK9 A;  2WB1 F;  1DK2 A;  4IR1 A;  3UMG A;  2HHT A;  4BDP A;  2FLP A;  1OXJ A;  1UPH A;  2BQR A;  1RG6 A;  4EYI B;  1WWU A;  1V9P A;  3SV4 A;  1L8O A;  4XQ8 A;  3A0H U;  4FO6 A;  2W55 A;  8ICQ A;  4IRC A;  4OCZ A;  1S8O A;  5HR6 A;  2F44 A;  1BPZ A;  5CRX A;  3Q8R B;  3L5K A;  2XY6 A;  3QE9 Y;  1IXR A;  2HOQ A;  4UAT A;  4FZM A;  3ZDA A;  5DDM A;  2PKE A;  3AU6 A;  2F3N A;  5KG5 A;  3GZF A;  5DBC A;  4OJL A;  4DSI A;  4FBU A;  1OUQ A;  5KG1 A;  3EYZ A;  4O3N A;  4P4P A;  1XS9 D;  7ICR A;  1SZP A;  4QNL A;  1ZOL A;  3PZP A;  1ZQC A;  1KFS A;  5J2A A;  5IIK A;  4ECW A;  3NVW A;  4J9O A;  2KVC A;  1S77 D;  1NK8 A;  5J0T A;  1BNP A;  5DGB A;  4J9L A;  4B9L A;  2NRX A;  4Y2S A;  2KD1 A;  5JRT A;  3OHB A;  2R8G A;  3I76 A;  4Y2Q A;  3RFA A;  2KJ5 A;  3B9J A;  8ICH A;  3PX0 A;  4YVZ A;  3LDA A;  5KAI U;  5EE0 A;  3BQT A;  3UMC A;  1JXE A;  4CF3 A;  4FS1 A;  3UMB A;  2KJ9 A;  2BCQ A;  1NJY A;  4DSJ A;  2Y1J A;  4DQR A;  3L3F X;  2F8L A;  9ICS A;  1UCV A;  1TAQ A;  3AQE A;  2DBY A;  1URJ A;  2YMQ A;  1XWL A;  1Z00 B;  4QIW F;  2Y9T A;  3ZDD A;  4J03 A;  1RZT A;  4QZE A;  2ESE A;  1Z19 A;  1ZD2 P;  3UM9 A;  2DPI A;  1B22 A;  5KT6 A;  4EX6 A;  3RJG A;  2WHE A;  5KFN A;  1S97 A;  2WF5 A;  5KFX A;  4BXO B;  5IIM A;  1ZQM A;  2FMQ A;  2MUT A;  5HML A;  5ALF A;  2W54 A;  1L6N A;  4UB3 A;  4IS7 A;  5KFP A;  1COK A;  5KFZ A;  4DOB A;  4ECR A;  4UB8 U;  1ZYQ A;  3OTQ A;  1NK6 A;  3SD7 A;  4JWN A;  4R64 A;  5KAF U;  4P4O A;  2AJQ A;  4EBD A;  3GV7 B;  4OJ6 A;  1CRX A;  4ECQ A;  5H2F U;  3ONN A;  4FZN A;  4F3O A;  2E8N A;  3VC8 A;  8ICL A;  5ALM A;  3LVW A;  5DB8 A;  4RQ4 A;  4XA5 A;  4LJX A;  5ALQ A;  1L3S A;  4EBE A;  5J0P A;  4RQM A;  7ICJ A;  4J9Q A;  2KHV A;  3QU7 A;  2A1J B;  4JB3 A;  3IG8 A;  3MC1 A;  1NJX A;  1Q46 A;  1U9L A;  2W7O A;  5KFY A;  3TAD C;  2W7P A;  1J97 A;  3T3F A;  5ALT A;  2HHW A;  8ICB A;  2GWS A;  2Y0S F;  5KG2 A;  3N4M B;  2KZM A;  4OD0 A;  3TFS A;  3C21 A;  2KHQ A;  3KKA A;  2PMZ F;  4F5P A;  2AQ4 A;  2IOF A;  4MHV A;  3QEB Z;  1L7O A;  3GQC A;  1P7D A;  1WUD A;  4RUA A;  3GV5 B;  2D3D A;  3GU3 A;  2RHF A;  2HMX A;  5ALL A;  3NVZ A;  2ZXH A;  3OJS A;  2DL0 A;  2R8I A;  4JWM A;  1ZQN A;  1NK9 A;  2W9C B;  3S6J A;  1PUZ A;  8ICI A;  1TFR A;  1SV0 A;  5CWR A;  4YR3 A;  1ARO P;  2FDR A;  2ZIV A;  2DWQ A;  4EZ6 A;  1M6Y A;  2KFZ A;  2OEH A;  4NLB A;  5DB7 A;  4NLN A;  1ZQW A;  4AYB C;  2HBM A;  3HPO A;  2AGO A;  3M9N B;  5J0R A;  3PX4 A;  8ICM A;  3I28 A;  1NZB A;  5CJ7 A;  2J6S A;  3SEN A;  1PK1 B;  3C1Y A;  3IV6 A;  5AKE A;  1D8Y A;  5KFE A;  4CDG A;  2FE9 A;  2VJ4 A;  4R8U A;  2GO7 A;  4BWM A;  1BPD A;  2AGP A;  5CB1 A;  2ZIX B;  3RRH A;  8ICO A;  9ICF A;  1SB3 C;  2NO4 A;  3T5L A;  5F9N A;  3B0X A;  5AKZ A;  3JPQ A;  4YR0 A;  2ZJ8 A;  1RYU A;  4C8M A;  4O3M A;  2FLN A;  4P4M A;  4QZG A;  5DG7 A;  2HVH A;  4C8N A;  4M0A A;  3ISD A;  4PHD A;  3LWL A;  9ICC A;  3QZ8 A;  4ED6 A;  5KT5 A;  4Y2J A;  3MR3 A;  2R8H A;  1OW5 A;  5KFB A;  5J0O A;  4TUP A;  2HHS A;  4I29 A;  1KBU A;  1RQL A;  2YMM A;  2EQY A;  2K4E A;  2A1J A;  3BS5 A;  3RH4 A;  3QUQ A;  2RLT A;  5ALN A;  3GDX A;  1BPB A;  2QAR B;  4O3P A;  2NRV A;  3D2N A;  8ICK A;  2ZIU A;  3PY8 A;  2PFQ A;  3EPG A;  4ZOH C;  1L3U A;  2JZB A;  4UBB A;  2NV3 A;  5L1L A;  3QUC A;  4UAS A;  3WKA A;  2OH2 A;  4RPY A;  4NLK A;  2JMG A;  3RH6 A;  4YMO A;  5J8Y C;  3NVY A;  2FI1 A;  4BJQ A;  4QZF A;  3UPQ A;  3PNC A;  1J2N A;  4NLG A;  1ECW A;  2WTF A;  1GO3 F;  3QUB A;  2OM6 A;  3ZDB A;  1UHU A;  2WAQ F;  5G5H A;  3KFU F;  1CI4 A;  2W9A A;  2KVS A;  5AIA A;  1ZQH A;  2W9C A;  1ZQI A;  4GIB A;  5L1I A;  3NTU A;  1XSP A;  2E8P A;  9ICT A;  1U47 A;  4ECY A;  4DS4 A;  4RQ3 A;  4C4R A;  2N1R A;  1LKY A;  2HOI A;  3RJE A;  2YTU A;  1RYR A;  2ZIV B;  3AN1 A;  2ATL A;  2BQ3 A;  2KE7 A;  2LI6 A;  2K4P A;  4I27 A;  1NJZ A;  2XCA A;  2YMP A;  2HDO A;  4R63 A;  8ICS A;  5EE3 A;  4DL4 A;  5J2E A;  4F4Z A;  3V7L A;  3RTV A;  2F2A B;  2W9B B;  4DWI A;  2XC9 A;  1UA1 A;  2Q0Z X;  2KEY A;  3JPP A;  2HBL A;  5AI4 A;  8ICU A;  1KQQ A;  1PVP A;  2KKP A;  1RM6 C;  1S0M A;  2KIC A;  4RPZ A;  4DF8 A;  3Q8Q B;  5KFV A;  4TUR A;  8ICE A;  2I1Q A;  5BOL A;  7ICS A;  2B0C A;  4DOA A;  4K4H A;  1X40 A;  5K4L A;  3RB6 A;  3TAN A;  4KN7 A;  4P0Q B;  4BUG A;  1X9X A;  3TQ1 A;  1ZQS A;  5KFL A;  1F5S A;  3M1Y A;  1B43 A;  5AK4 A;  2K8B B;  1MSW D;  3QXG A;  4DF4 A;  4LZG A;  5J2H A;  3SMV A;  1ZQO A;  3V72 A;  9ICE A;  2XVT A;  2UVR A;  4FZL A;  3AMZ A;  3UXO A;  3GIK A;  2JEI A;  2B21 A;  1QTM A;  2G09 A;  2ZIW B;  4ZH4 A;  1ZQG A;  1MQ3 A;  5KL1 B;  4CNQ A;  2VAN A;  4YMM A;  2C2E A;  4QZ8 A;  1QQ5 A;  3HKZ F;  4F50 A;  3C28 A;  3CYM A;  3TAC B;  3D6J A;  2F1I A;  4M04 A;  3PSP A;  4OJP A;  2P66 A;  3KZI U;  2E8M A;  2IA6 A;  1WCN A;  3FC4 A;  5DLG A;  2AHO B;  4C8O A;  4QWC A;  1Z00 A;  5ALP A;  3WK8 A;  3PML A;  1FFV A;  4XUS A;  2MUT B;  4I2J A;  2H5X A;  4M6W B;  2HBK A;  2Y9U A;  3ETR A;  2GOL A;  1X66 A;  3IN5 A;  2DKZ A;  2HCF A;  2EAO A;  2LMR A;  1KTQ A;  2DF4 B;  2LHT A;  4JV2 A;  3MFI A;  4FS2 A;  4KTQ A;  4O5K A;  4EEN A;  5DG9 A;  3M9M B;  4J9S A;  4DQS A;  2IHN A;  4KLL A;  2EZZ A;  3TI0 A;  4JV1 A;  2G0A A;  1N61 A; 
#chains in the Genus database with same CATH homology
 4OJO A;  2W03 A;  5T14 A;  2PMZ F;  3AQE A;  2YB4 A;  1URJ A;  2KV2 A;  2G06 A;  4QIW F;  2KIW A;  2WB1 C;  3HKZ C;  3N7P D;  2ZIX A;  4NLC A;  1Z1B A;  2WB1 F;  3D2N A;  2ZIU A;  2Z7J A;  1Z19 A;  4GFJ A;  2ZXI A;  2K8C B;  2H3I A;  1WUD A;  1P7D A;  3H0M B;  3CRX A;  4P0Q B;  2JHD A;  5HR7 A;  3PSF A;  2LBO A;  3GU3 A;  2RHF A;  3KZX A;  2HMX A;  4P0P B;  3M6K A;  4BUG A;  1Q3V A;  4CRX A;  1UPH A;  2ZXH A;  2G08 A;  4P0Q A;  3F2D A;  2YB1 A;  1T94 A;  2NV3 A;  3DEE A;  3IP4 B;  3K1Z A;  3F2B A;  2K4H A;  2OH2 A;  2K8B B;  1HEK A;  2BDU A;  2OXO A;  2OYY A;  1L6N A;  2MA1 A;  2JMG A;  3SAG A;  3E0F A;  4C0Z A;  3LYS A;  2ZIW A;  5HR6 A;  4BJQ A;  2ZIV A;  4PL1 A;  5CRX A;  3SMV A;  4IC9 A;  2XVT A;  4FZL A;  1A0P A;  1ECW A;  4CGZ A;  2HOQ A;  2JH1 A;  3L3F X;  1GO3 F;  2OM6 A;  4FZM A;  2CN1 A;  4NLB A;  3SQI A;  4NWI A;  4ICA A;  2JH7 A;  4AYB C;  2G09 A;  2ZIW B;  2WAQ F;  2F77 X;  2HBM A;  3D2Q A;  3GZF A;  4OJL A;  2KJ8 A;  1OUQ A;  5KL1 B;  2M0N A;  3KFU F;  3H0L B;  4ACO A;  2LKY A;  3VCB A;  2PMZ C;  3T79 A;  3ICX A;  3SAH A;  2VJ5 A;  1NZB A;  1DRG A;  2HOF A;  2D6F C;  1D8B A;  4KX3 A;  3HKZ F;  2F76 X;  2KOB A;  3M7D A;  5KL8 B;  3H0R B;  4OJ6 A;  1F44 A;  2E1E A;  2KKV A;  3C28 A;  1ED1 A;  5C0Y A;  3CYM A;  2Q4T A;  2GH1 A;  4QNL A;  3RF9 A;  1XNS A;  1CRX A;  3ALR A;  4NV0 A;  2JGA A;  3PSP A;  4CDG A;  3ONN A;  4PL2 A;  4OJP A;  2H3Q A;  3PZP A;  2VJ4 A;  4FZN A;  4OJ5 A;  4FE3 A;  2R18 A;  2DQN B;  2N1R A;  3AL0 B;  1A6S A;  2MRL A;  1ZQ1 C;  3VC8 A;  2A3V A;  4QJF B;  2HOI A;  3PSI A;  2E1F A;  2VIX A;  2G07 A;  3LVW A;  2KVC A;  3N7R C;  1PVQ A;  2ZIV B;  2H3F A;  2KNJ A;  2LYA A;  2ZIX B;  3AQF A;  2RP5 A;  4QIW C;  3MGV A;  2K89 A;  3SAF A;  2KD1 A;  2CRX A;  3PST A;  1TAM A;  3O0F A;  2K4I A;  2KHV A;  2G5I B;  4A8E A;  1YT3 A;  3RFA A;  3OPX A;  2KJ5 A;  3C29 A;  3IG8 A;  2HBK A;  3IG5 A;  4O3M A;  2VKQ A;  4U7C A;  2DGZ A;  2GOL A;  2CPR A;  2W7O A;  3N7S C;  1HIW A;  2W7P A;  4U6P A;  3D2S A;  3F5A A;  1SZH A;  3IN5 A;  2K8A A;  1XO0 A;  4AYB F;  3CP8 A;  2F2A B;  5A0L A;  4WJ3 B;  1Q3U A;  2XID A;  2DF4 B;  2LHT A;  3NRW A;  2Y0S F;  3F2C A;  2KEY A;  2ZG6 A;  3F53 A;  1PVR A;  4KMO B;  2Y0S C;  2XI9 A;  3LVV A;  2HBL A;  3NUQ A;  4JMU A;  3M6Z A;  1IIP A;  2H3V A;  2H3Z A;  4OO1 J;  1PVP A;  4P0P A;  2G5H B;  2XIC A;  2LYB A;  1KBU A;  2KJ9 A;  2HBJ A;  2KKP A;  3F5E A;  2E5S A;  2YX8 A;  2K4E A;  4KX5 A;  4BX9 C;  1MA7 A;  2W04 A;  2KIC A;  2WAQ C;  2ZIU B;  2G0A A;  2KHQ A;  2RRD A;  2F8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...