4ICAA

Crystal structure of a c-terminal truncated form of the matrix subunit (p15) of feline immunodeficiency virus (fiv)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
GNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
molecule keywords Matrix protein p15
total genus 42
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4icaA00
2H3QA 2GOLA 2N1RA 2H3IA 2LYBA 2NV3A 2H3VA 2H3ZA 1ED1A 2K4EA 2LYAA 1HIWA 1TAMA 1A6SA 4ICAA 4IC9A 2K4IA 1UPHA 1L6NA 4JMUA 2K4HA 2JMGA 2H3FA 1ECWA 1HEKA 2HMXA
chains in the Genus database with same CATH superfamily
3FAHA 1RPLA 2YMMA 4EYHB 4PGXA 2HVIA 2I6XA 5J8YC 1U47A 5TISU 1JXEA 3AQFA 4OO1J 2LBOA 4US8A 3KTQA 1ZD4A 1ZQQA 3F5EA 1NK4A 2H3QA 1RXVA 3UMBA 1MN8A 4BWMA 3Q8RB 2LM1A 4XUSA 2RLTA 1D8YA 2EZXA 2XY5A 2AGPA 2EAPA 3NS1A 5J0TA 3SQIA 2DQNB 2E8MA 2ZXHA 1F44A 4ECQA 5AK4A 3E58A 2JH7A 2XY6A 3OHBA 3QU5A 2JHDA 1XSNA 3H40A 2CRXA 1N2XA 1L3SA 2KFNA 5KG6A 1CI4A 2D8CA 5CHGA 3RH5A 1PZNA 1D8LA 4B9TA 5HP4A 1Z1VA 3QYPA 4KX5A 4KLIA 4CDGA 2NRZA 3Q8SB 4ED7A 5ALDA 1WCLA 3OPXA 2DFLA 4B9UA 2WAQC 1MC8A 4PJ0U 4TUPA 1QSSA 3JPSA 1TK8A 1Q46A 1N62A 1GO3F 2KE7A 1N48A 2JXJA 2BCRA 4KLEA 5AKEA 3QZ7A 9ICOA 3FYHA 1NJWA 4RQ0A 2P6RA 3TARA 2KNJA 4O5KA 4DS4A 2PMZC 4KLMA 5JRTA 1KQQA 3NVWA 3QX7A 4OJPA 2KK0A 3QXGA 1T8EA 4IR1A 5AI5A 3KKAC 2W9BB 8ICSA 5IILA 1TVAA 1K1QA 2KD1A 4DFJA 2MUTA 4FZLA 2E8NA 5AM2A 2BCVA 7ICMA 4OJOA 4DLEA 1H38A 2NRVA 3F2BA 2H3FA 1RXWA 1VDVA 1LVHA 4BGDA 3RR8A 5JUMA 5H2FU 3PW5A 3BQ7A 3V6KA 4M6WB 4M2YA 1ZQFA 4M9JA 4RQ6A 3MFHA 2BQ3A 2UVRA 1PVPA 1BPXA 3Q8KA 4QWCA 4R65A 1KL9A 1TFRA 1QCKA 4DSEA 2Y9UA 3HJEA 8ICJA 4QIWC 3WKAA 3TFRA 5ALGA 2WTFA 4NLGA 2RDIA 4DQQA 2D6FC 2E3TA 3CNHA 1NZBA 8ICHA 3F2CA 4DL6A 1QQ7A 4USAA 3B0YA 1X9MA 4PHEA 5J0RA 2LI6A 5J0PA 5BOLA 2KVCA 4RQ7A 5DQGA 3SV3A 4QZDA 4YXMA 1F0MA 2AQ0A 5TZVA 4F5NA 2HW3A 4DSLA 5ALSA 4ECZA 4WJ3B 4PHDA 5ALJA 5J2FA 2BPGA 2OM6A 3RB4A 3SZ2A 1ZJNA 4UB8U 4Z6DA 1Z19A 4DO9A 3SAFA 4DQIA 5FP0A 4FFDA 4UB3A 2HHUA 1XSPA 4F4YA 3PSIA 1ED1A 4UAWA 2DPIA 4F2RA 1ZQUA 2G06A 4B9SA 4UB4A 3L4PA 2BCUA 2DGZA 2PFPA 9ICCA 4UBBA 3SAGA 1SWWA 1QSLA 2ZJ8A 1XO0A 3EUB2 5J2DA 5KFPA 4KLTA 5IINA 2F8LA 4I29A 4Z6FA 3EYZA 3MABA 5KFUA 1JX4A 2F8KA 3JPQA 5J2IA 4DSFA 1COOA 5HNKA 5F9LA 1X40A 2OYYA 3F53A 5AM4A 1A77A 4QZ8A 1S5LU 1X9WA 2P66A 1SL2A 3M6KA 4C80A 1NI3A 4RT3A 1M6YA 4P2HA 1Q8KA 2GWSA 3QEBZ 2LPEA 1SKWA 5KFTA 4PPXA 2WB1F 4C8NA 3D2SA 3MR6A 2Y0SC 4R64A 1N56A 4GIBA 3THVA 3WK9A 5KFVA 2W9BA 8ICAA 2ZIVB 4Y2QA 4B9NA 8ICCA 5ALMA 3N7RC 5HR7A 5IIOA 7ICPA 3PX6A 5KFRA 4IRDA 1ZQDA 4Y2YA 4DL3A 7ICIA 2Y1JA 2Z7JA 4FZMA 3JPPA 4UB2A 1L3TA 2YB1A 1XS9D 5AKGA 4NLKA 5J0YA 1WCNA 3RAQA 2FJ6A 2QARB 3WK5A 4ED6A 5KT4A 3BQ2A 2ZXIA 3H4DA 1BPBA 3V6JA 2IOHA 1V9PA 7ICTA 2ZJ5A 3V7KA 4I2CA 1DGSA 4NL9C 3RJEA 1JI7A 5DBCA 2JEFA 1NK0A 4J9MA 2E1EA 4JUZA 4CE6A 4AYBC 1T7PA 2IHNA 3EZ5A 5IIKA 2XIDA 1X66A 3JPRA 3GIMA 2QB0A 1KRPA 1L7OA 3NVZA 4I2AA 3CRXA 5J2EA 4YQWA 5ALQA 4C8LA 5ALWA 2J6UA 3M6ZA 5EE9A 3G6XA 8ICLA 2BQRA 3S6JA 2PFQA 4OJ6A 5AK6A 4M9HA 5KT2A 5J0UA 5CA7A 4DL4A 2C2DA 1S76D 3TAPA 2HBJA 5GTIU 4I2DA 3PW2A 4KLUA 1JN3A 4RNMA 4QWBA 3Q8MA 3I28A 1KBUA 3IM1A 2ZIWB 4I2FA 3RJKA 2AXTU 2ASDA 3IP4B 3UQ0A 2BPFA 4Y2PA 4QWDA 4O3SA 1RG6A 2OH2A 4UAUA 8ICNA 4UAZA 2A1JB 4J9SA 2ZUDA 4NL9A 1U49A 2FLPA 2WHEA 1Z1BA 4QZGA 2ISOA 2H3VA 3K1RB 4QZCA 5ALXA 3I76A 3KHLA 2E8PA 1NZPA 3QEAZ 1L3UA 1MA7A 3C1YA 4GC6A 3ZDCA 1L7MA 1SGGA 1UPHA 1KKXA 4Q45A 1ZQPA 3AU2A 3AL0B 1ZQWA 2KIWA 4ZH4A 4RQ1A 4GXJA 2KMDA 4RUCA 2E5SA 4M47A 1FEZA 5KFKA 2ZJAA 1HIWA 3PR4A 3H8WA 1XO1A 1SZHA 3AN1A 4LZGA 3OGUA 2JEGA 4KLOA 2K4IA 3ZDAA 1UT5A 5KFNA 3C21A 4C8OA 1UA1A 8ICKA 2KEYA 1QQ5A 1TK0A 1UHUA 3RBEA 4IS7A 5J0XA 3H0LB 5AM1A 9ICPA 4M9GA 2BGWA 4QIWF 3PX0A 3ALRA 4NXZA 3WK4A 2I9GA 5CR0A 1T4GA 3QZ8A 5CEHA 1YT3A 3GV8B 4JV0A 5ALVA 2PMZF 3NRZA 3SR6A 4C8KA 2C22A 3IG5A 3GZFA 4Y2XA 2K8BB 4ELTA 5GTHU 2ZIUB 4F50A 4BX9C 3GILA 1ZQKA 3T5KA 4RQMA 4F5OA 3QE9Y 4KLQA 2WB1C 2GLEA 2KICA 2YMLA 3RF9A 2W3SA 1BPZA 2JV3A 3FC4A 2YMQA 2N1RA 3ZI4A 1ZQSA 4F2SA 3HP6A 2AQ4A 4ELVA 3MC1A 9ICLA 4I2GA 3SENA 2KVSA 1F5SA 4F91B 2M0NA 5EWEA 4ZOHC 3RH4A 1ZQMA 3QU9A 5KAIU 4PH5A 7ICLA 5AKXA 2KP7A 1PK3A 1KFSA 4C4TA 4NY8A 4DQSA 3PY8A 2H3ZA 5AKIA 5DG7A 3NVYA 5ALRA 4JB3A 4CGZA 5DB8A 3PMLA 4O3RA 5KFMA 3M8RA 3QUQA 4DFMA 2ODGA 2HMXA 9ICUA 4O3MA 2HDOA 4RQ2A 3RTVA 2HBLA 2P35A 3PZPA 4PZNA 4MF2A 1ZD2P 2A1JA 3HRDD 4Z6CA 1WUDA 2V4RA 3LVWA 3MGVA 2KSOA 1Y88A 3RJHA 5KFYA 4QZBA 2BCQA 2FPLA 1HUOA 9ICRA 2KSOB 4Y2RA 1DK2A 3EWAA 1ZQJA 2V9WA 1IV8A 4QWAA 3RAXA 3G6YA 4I2JA 1ZOLA 2O6KA 1URJA 4LVSA 4MEXA 4DL2A 4GFJA 4ECYA 3QNMA 5J29A 4ECVA 2K4EA 3MR3A 4M04A 1KN5A 3C28A 3N4MB 8ICOA 3SEIA 2FE9A 1KTQA 4JMUA 4M0AA 3HX0A 9ICGA 1LB2B 4KTQA 2JEIA 1JRPA 3MDAA 2DKXA 3T5LA 2XGQA 2YN4A 3T79A 2KOBA 5IIIA 3DV9A 1S0VA 3KBBA 4NWIA 2KKVA 2GH1A 4P0PA 1B43A 2PKEA 3C2KA 4IQVA 3HILA 1KLNA 2IOFK 8ICRA 4B9VA 3Q8LA 1NKEA 7ICHA 5EE1A 4DSIA 2AHOB 3HT3A 1ZXIA 4QJFB 4C4SA 5ALYA 2FLLA 2MU2A 4KMOB 4O0IA 1A6SA 1YZ6A 2J6TA 5KT6A 2NRTA 1UA0A 1U45A 4NLZA 4HAIA 1SKRA 3VC8A 3WK6A 1MQ3A 4TQRA 4DF4A 1SWVA 4C7YA 5DG8A 3UXOA 4RQNA 1DRGA 1QQ6A 2C2RA 4NM1A 2LMRA 4FBTA 1V97A 5AIBA 5DB7A 4RPZA 2W7OA 3GFKB 3OJSA 4GXKA 5J0OA 1ZQCA 3M9OB 4DEZA 4BWJA 5G5GA 4UASA 4DOCA 3AM9A 3IRUA 3M1YA 3T3FA 4U7CA 5KG0A 1SL1A 2F2AB 3LDAA 5D49A 1AQ6A 2DUYA 5KT5A 3SYZA 5E79U 4ICAA 4YN4A 3CP8A 4DCCA 4DSJA 2RQ5A 2FMQA 4EZ9A 2F1HA 1IG6A 4R63A 5KFEA 1BPEA 1JMSA 1PVQA 8ICIA 3ZDEA 1COKA 3H8SA 2BDUA 1Q3VA 1TE2A 4YXJA 2NYVA 3WKEA 5KG4A 3RJIA 1NK7A 4F4KA 2F77X 5J8YA 2H3IA 3BJYA 3BQTA 2RDJA 2XICA 4F4XA 9ICBA 7ICKA 4F92B 2W04A 4O5CA 4XQ8A 4FBUA 3PW4A 4J9NA 3BDPA 2H5XA 5IIJA 1DXSA 4OJLA 2F3NA 3DDHA 3KHGA 5DG9A 4X5VA 4QZIA 1Z00A 4YMNA 4BDPA 3BQ0A 1NK6A 2YTUA 4RPYA 1BVSA 1L7NA 1S97A 2ESEA 3C2LA 3SAHA 5AI9A 4J9PA 1SKSA 4UQGA 1BPDA 2ZG6A 2G5HB 5KFHA 2ASJA 1ZQNA 5G5HA 4QZHA 2K8CB 3KHRA 2KZ3A 3D2QA 5AICA 2RHFA 4TUSA 1A76A 5KG7A 2XCAA 1KDHA 3TQ1A 5KFGA 3AEVA 3QUBA 2B0CA 4RQ3A 5CWRA 4M6WA 2IMWP 4UAYA 5C5JA 4RQ5A 2C28A 4DQRA 4IRCA 4YFKA 5B66U 4YVZA 2K89A 2Y1IA 4NLBA 2HVHA 5AM3A 4EYIB 2UVWA 5AI6A 1ZD3A 5AKLA 3N28A 1ZRMA 1N63A 2QLTA 1JUDA 2YMPA 3TFSA 2HHSA 2FPMA 4PZOA 4BUGA 1Z4OA 4DF8A 4IR9A 2YY6A 3GIJA 8ICWA 2Y0SF 2LYAA 5AKHA 1D9FA 9ICWA 4JV1A 3ETLA 3M9NB 3ETRA 1FIQA 3QU7A 1NJXA 4B9MA 4P0QB 2VA3A 1ZQEA 1ZQRA 2DWQA 3F5AA 4DFDA 5KFSA 5CJ7A 8ICPA 3D6JA 2HOFA 4KLSA 4JWNA 3L5KA 2ZTDA 3ONNA 2IBKA 1X6IA 3ISDA 4RT2A 5DKWA 1FO4A 4HYKA 2ZIWA 1U48A 9ICFA 5ALUA 5KFZA 2WF5A 5JTIA 4GLXA 1ZQYA 2W8LA 1TK5A 3U26A 2XO7A 2R18A 5AM0A 5L9XA 7ICRA 2ALZA 2W9CB 2Y9TA 4ECSA 3OHAA 4Q44A 1NJYA 5D4BA 5KFFA 4DQPA 4KLFA 7ICVA 1SXDA 3PO5A 1L8OA 5KFXA 5IIMA 5KFQA 4F3OA 1D8BA 1S77D 1LKYA 3C23A 9ICHA 1QTMA 1J2MA 3DEEA 2CPRA 2HBKA 1ZQBA 5DGBA 3ZD8A 2KV2A 1FFUA 2M9NA 1MSWD 1SB3C 3UMGA 3H8MA 5AKYA 3J81j 1QLNA 2W55A 2JR5A 1S8OA 2WF7A 3K75D 4K4IA 3MGIA 5AIAA 4UAVA 5J0QA 3GQCA 5ALLA 5DBAA 3PSTA 3WK8A 3RB0A 3B0XA 1L8LA 2A19A 3A0HU 3PVXA 3UXNA 3RJJA 2FPKA 5KFOA 2LM4A 3JPOA 5KFBA 5EWGA 2L5YA 1JALA 2HHTA 2OXOA 3T5JA 4UB5A 3TACB 5KFIA 2CN1A 2FDRA 3R9KA 2ZTEA 3HPOA 3I1YA 2RRDA 4I2BA 3GV5B 4PGYA 2HBMA 4KLDA 3LVVA 1CEZA 3G6VA 2G08A 4YD2A 4BXOA 4ECRA 3IN5A 4QZ9A 2ZIUA 1C7YA 2HHVA 1NKBA 1Q3UA 5F3XB 2ISPA 3KKAA 2EH9A 3N7PD 4F5PA 2NO4A 2UVVA 2JMGA 2EAMA 1SZPA 5EWFA 4J9RA 1N5WA 3C5FA 3AQEA 2KFZA 1UT8A 1ZQLA 2A1AA 4P0QA 2F1JA 8ICBA 5ALFA 1L5UA 2W03A 3QUTA 3L3FX 3AUOA 2KIVA 3ICXA 3PW0A 4IC9A 2KN7A 4YMOA 4OCZA 7ICOA 2BZFA 1BNOA 3MGHA 1DK3A 5DDYA 3WKDA 3BQ1A 2HI0A 4RQ4A 8ICMA 3C29A 4C0ZA 1RZTA 3MDCA 2R8JA 8ICUA 2OEHA 3BS7A 4UARA 4XA5A 1ZQIA 2IA6A 3QU4A 2PI5A 3V72A 9ICTA 5J2GA 2QB0B 8ICYA 4RUAA 9ICSA 2KHQA 4PL1A 5F9NA 1T3QA 2W8KA 5HHHA 4DL7A 1XWLA 2JRZA 4ECWA 1PUZA 2J6SA 3PO4A 4J9QA 2DKZA 3RJGA 3E0FA 1OW5A 3BS5B 3RFAA 3PNCA 1DGJA 2ES6A 2AU0A 1N61A 4I2HA 1NJZA 1DOQA 1ZQGA 1UQVA 2FMSA 3KHHA 2Q0ZX 4QWEA 5HMLA 5AKJA 4RZRA 3LYSA 4DSKA 4KN4A 2HCFA 4JV2A 4XRHA 3PW7A 2AH5A 7ICQA 2UVUA 5DB9A 2QKQA 3RB3A 4I2EA 2JZBA 1OXJA 2F1IA 4P0PB 3UXPA 4KMUA 4J9OA 1TAMA 2ZIXB 3BZKA 9ICAA 3OSNA 2IOFA 4IRKA 3NUQA 3NVVA 4TUQA 2ZTCA 2NO5A 2DBYA 3WKBA 4Y2JA 3E2EA 4Z6EA 3PR5B 3GV7B 2G0AA 5EE3A 1SV0C 2MSNA 1S0OA 2VJ5A 2LKYA 1TKDA 4O3NA 1J97A 5DLGA 5KT3A 5KG3A 4ED2A 3TADC 4F4WA 4IL6U 4KLHA 4US9A 4FE3A 2RP5A 4Y2TA 3A0BU 4ECTA 2Q4TA 1BPYA 3D2NA 5J2HA 2IHMA 3OSPA 2WF8A 2KJ5A 3CW2C 1RDFA 4UATA 2K4PA 2KJ9A 2EQYA 5KL8B 5ALPA 1ZQOA 5ALNA 5AI8A 4B6JA 1SL0A 4KLJA 2I5HA 2I1QA 1RYUA 2BKEA 4DOAA 2NRWA 4MFFA 3H7IA 1IIPA 1S10A 7ICSA 4MEYA 3H0MB 4PGQA 4C4RA 3C2MA 4NJ8A 2HSZA 3GIIA 2KTQA 3Q8QB 1U9LA 4UB1A 1JXLA 3NRWA 4EENA 1L3VA 4DS5A 1ZQAA 2G07A 2WAQF 5KG2A 2W9CA 2ZUCA 3ZD9A 1X2IA 3PV8A 5DGAA 2C2EA 1IM4A 2MRLA 4P4PA 1SV4A 2KHVA 3RB6A 5KNIA 3IHQB 3ED5A 1WWUA 3ISBA 1ZQ1C 4MFAA 1QSYA 4AYBF 5ALKA 3RR7A 4ELUA 1ZJMA 1OUQA 1LKYB 3LWMA 1ZD5A 5AKKA 4QZAA 2BDPA 3EPIA 2HHQA 5K4LA 4EX7A 4IQTA 8ICFA 5KG5A 5L1LA 2GO7A 5HHIA 7ICNA 9ICXA 2G09A 3N97B 1LV5A 4DFPA 2WF6A 2EDUA 5ALOA 4U6PA 4EZ6A 5AM5A 4ED8A 3M9MB 2EZZA 4J03A 3Q8PB 2KKPA 3TI0A 4RNNA 4RU9A 1O08A 1T94A 5J2AA 5BPCA 5KG1A 4I27A 1KFDA 1CRXA 2K60A 3SV4A 4J9KA 3ISCA 3SD7A 2LYHA 1AROP 1RYSA 1UCVA 1B0XA 3ORYA 1TV9A 3QU2A 1NK8A 1WG8A 4F93B 2PFNA 2WFAA 4EBCA 3PX4A 2KZZA 4DOBA 1WYGA 5EE0A 9ICMA 3ZDDA 4Q8FA 4QW9A 5L1IA 5DDMA 3GIKA 9ICIA 5T14A 4OD0A 2XCPA 5KFLA 4UB6U 8ICZA 4UW9A 3TKAA 1TAUA 1IXRA 2W9AA 2BCSA 3QUCA 2K4HA 5ALTA 2BR0A 3KZXA 2W7PA 1X9SA 4M9NA 2XI9A 3AMZA 5ALIA 4DL5A 1L7PA 1KEJA 1NNLA 2WF9A 2PI4A 1YZ7A 4EELA 3F2DA 5HR6A 2KZMA 4P4OA 4YCXA 1J2NA 4DFKA 8ICGA 2KG5A 4G3IA 4KLLA 3AU6A 4O5EA 1C20A 2KJ8A 5J2JA 1QH9A 2P6UA 3WK7A 1ZRNA 1ZQTA 1ZQVA 5AK5A 4F72A 5J2KA 5D46A 2YX8A 4YD1A 1XC9A 5KFDA 3RRGA 1A0PA 8ICEA 4UBCA 3HKZF 5KFWA 3LWLA 5DQHA 4F4ZA 1ZQHA 5J0SA 1RYRA 3EPGA 4GC7A 2QB1A 2HHXA 2W3RA 2DPJA 4Q43A 5KFAA 2BQUA 1S9FA 1T3NA 1RQLA 3B9JA 3SMVA 2NV3A 2W43A 5L1JA 1JIHA 2CXYA 9ICEA 1PK1B 1BGXT 2BPCA 2AGOA 4F5QA 3RJFA 1NOMA 8ICVA 3BZCA 3N7SC 5CB1A 1PK1A 1VJ5A 1Z00B 4KN7A 4I28A 7ICUA 4JWMA 1NK5A 5L1MA 3GU3A 2GOLA 3KD3A 5AKZA 1WWVA 2DL0A 3K1ZA 4E0DA 2VA8A 1ZQZA 9ICVA 5KFJA 3TAQA 4RPXA 3IDWA 3NGDA 4CF3A 5HMMA 3HWTA 1ECWA 4F71A 4Y2VA 4OJ5A 4CF4A 4B9LA 3UMCA 3IV6A 1ZQXA 3HW8A 4F5RA 3MFIA 1NK9A 1K5OA 1JROA 2JZBB 1S0MA 5DLFA 2XVTA 4MFCA 5BOMA 2NRXA 3VCBA 4EX6A 4JK1A 4BXOB 2R8KA 4O3QA 5AK3A 2LYBA 3KFUF 2K8AA 1KFTA 4ED0A 5L1KA 5AHXA 5KAFU 2OHFA 4EEKA 2YQEA 4C8MA 4I2IA 1HJPA 2VJ4A 3K4GA 4DLGA 3ZDBA 2EANA 1TAQA 5CRXA 2PFOA 7ICFA 3HKZC 4P4MA 1X42A 4R8UB 2JEJA 1S0NA 2MUTB 4M9LA 4AP9A 2D3DA 2F44A 1BNPA 2HOQA 3PSFA 4G9BA 5DBBA 3O0FA 3OTQA 1X9XA 1VLBA 1K1SA 2DF4B 3PMNA 4A8EA 4NLCA 4QZEA 4TQSA 2V4QA 4PHPA 1Z3EB 2ATLA 4O9MA 2A3VA 2FMPA 9ICNA 1KSPA 1SXEA 1X6JA 2LHTA 3WKCA 8ICQA 2ASLA 1RQNA 2QARA 1XSLA 4K4HA 4Y2SA 3JPTA 3WU2U 2FLNA 1HEKA 2VIXA 5DQIA 1ZYQA 1MQ2A 4NV0A 4QZFA 2VKQA 1PVRA 1Z4NA 3H0RB 4CCHA 1NKCA 4O3OA 4C7ZA 4TURA 4MF8A 8ICXA 1O03A 4QW8A 3KZIU 4LZDA 4CNQA 3TANA 4YG2A 1V85A 4KLGA 2BHNA 4QNLA 3SI8A 1D9DA 1SIJA 4FO6A 5JU5A 4NM2A 3NASA 5A0LA 4KITB 2HOIA 9ICQA 4BJQA 4YP3A 2OCEA 2FI1A 3M7DA 3MR5A 1U4BA 9ICKA 3T5HA 1EXNA 1B4FA 2MA1A 4K4GA 1N60A 3CYMA 4FS2A 3BS5A 4FS1A 2XC9A 2VANA 2R8HA 4ACOA 5DB6A 3H4BA 3IG8A 3EW9A 5J0WA 5KT7A 2B6GA 4ED1A 7ICJA 2XY7A 4Q8EA 1XU4A 1B22A 2YB4A 4R66A 2HHWA 1V38A 5ALEA 4CF5A 3KOOA 5KTQA 1N5XA 5KFCA 4F8RA 3UM9A 2ZIXA 3MR2A 2E8OA 2ZUBA 3UQ2A 5CP2A 2PXIA 2F76X 3PSPA 2JGAA 3H8JA 2OWOA 2EAOA 1ZETA 3C5GA 4DWIA 3LK9A 3RBDA 2VA2A 1KW4A 3OJUA 3FM9A 1P7DA 3C1ZA 2R8IA 4ECXA 1FFVA 4EBDA 9ICJA 8ICTA 3TADA 1XNSA 4GXIA 3RH6A 4IQUA 4CRXA 4NLNA 4PHAA 4EEYA 3UPQA 5J2BA 4EBEA 4ED3A 3V6HA 4RQ8A 4YR3A 3GDXA 4R8UA 5KL1B 3V7JA 2ZIVA 4FZNA 2XGPA 4YMMA 2E1FA 2W54A 3NTUA 3JPNA 1L6NA 4PL2A 2MAXA 2AGQA 2B21A 4YR0A 1HUZA 4Y2UA 4IQWA 7ICEA 3M8SA 2JH1A 4RNOA 2W11A 5AI0A 3MBYA 5B5EU 1CUKA 1RM6C 4ECUA 2W9MA 5J2CA 5EOZA 7ICGA 5C0YA 2R8GA 2AJQA 4LJXA 4J9LA 3FDSA 3RRHA 4MHVA 4O3PA 4YR2A 4KX3A 5AI4A 3V7LA 2G5IB 5ALZA 5ALHA 2EZYA 1SV0A
chains in the Genus database with same CATH topology
4ACOA 1T94A 2RP5A 5CRXA 2ZXIA 1Z19A 3HKZC 2Q4TA 3IG8A 3D2NA 2KNJA 3SAFA 2KJ5A 3F5AA 2PMZC 2OXOA 1CRXA 2E5SA 4QJFB 2KHQA 4PL1A 3SMVA 2KJ9A 2NV3A 2H3ZA 2HOFA 3PSIA 5KL8B 4OJPA 1ED1A 2CN1A 4KMOB 1HIWA 2E1EA 3AQFA 1A6SA 4OO1J 1SZHA 2LBOA 4AYBC 2G06A 4CGZA 2KD1A 3KFUF 2HOQA 2RRDA 2YB4A 3ONNA 3PSFA 4FZLA 3O0FA 2K4IA 2XIDA 4OJLA 3SAHA 2HBMA 3VC8A 3LVVA 4OJOA 2DGZA 3N7SC 2G08A 2KEYA 3SAGA 2DF4B 3F5EA 3F2BA 2HMXA 2H3FA 4A8EA 2ZIWA 1XO0A 2ZG6A 4O3MA 3E0FA 2G5HB 4NLCA 3IN5A 1IIPA 3GU3A 2H3QA 3H0LB 2HBLA 2F8LA 2GOLA 2ZIUA 3PZPA 1DRGA 3H0MB 2ZIXA 3CRXA 2R18A 2K8CB 3K1ZA 3RFAA 2A3VA 1WUDA 2F76X 3D2QA 3M6ZA 2LHTA 3PSPA 2JGAA 2RHFA 4QIWF 3LVWA 1Q3UA 2OYYA 3F53A 5T14A 3ALRA 4OJ6A 3MGVA 3N7PD 1PVPA 2W7OA 3SQIA 2DQNB 3NRWA 2ZXHA 1F44A 2G07A 2WAQF 2K4HA 2JH7A 2JMGA 3LYSA 1P7DA 4QIWC 1YT3A 1ECWA 2JHDA 1HEKA 3M6KA 2HBJA 3KZXA 2PMZF 2VIXA 4NV0A 2W7PA 4OJ5A 2CRXA 3AQEA 2XI9A 2VKQA 1URJA 1PVRA 2MRLA 4U7CA 1XNSA 2D6FC 3IG5A 4P0QA 3GZFA 3H0RB 4CRXA 1KBUA 4GFJA 2F2AB 2WB1F 2ZIWB 3F2CA 2K8BB 2W03A 1NZBA 2KHVA 3D2SA 1D8BA 2K89A 3L3FX 2Y0SC 3F2DA 4P0PB 2K4EA 2ZIUB 4NLBA 4BX9C 5HR6A 1ZQ1C 1TAMA 2ZIXB 3ICXA 4ICAA 5KL1B 3IP4B 4AYBF 3CP8A 4IC9A 2ZIVA 4FZNA 3C28A 1OUQA 3DEEA 2E1FA 2CPRA 4KX5A 2HBKA 2XVTA 1L6NA 2KVCA 4CDGA 3NUQA 1PVQA 4JMUA 2KV2A 4PL2A 2ZIVB 2WB1C 2OH2A 2BDUA 1Q3VA 2KICA 3OPXA 3N7RC 3VCBA 2KJ8A 3RF9A 4BUGA 2WAQC 4QNLA 5HR7A 2JH1A 2F77X 2N1RA 2H3IA 3C29A 4C0ZA 5A0LA 1Z1BA 2HOIA 2YX8A 4BJQA 2XICA 2Z7JA 2LYBA 2G0AA 2H3VA 4FZMA 1A0PA 2G09A 2Y0SF 2K8AA 1GO3F 3T79A 2LYAA 2W04A 2KOBA 5C0YA 2YB1A 3HKZF 1MA7A 3M7DA 4NWIA 2KKVA 4U6PA 4WJ3B 2GH1A 2VJ5A 2VJ4A 1UPHA 2LKYA 2MA1A 4P0PA 2OM6A 2M0NA 3CYMA 4KX3A 3PSTA 2KKPA 3AL0B 2G5IB 4FE3A 4P0QB 2KIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3Q A;  2GOL A;  2N1R A;  2H3I A;  2LYB A;  2NV3 A;  2H3V A;  2H3Z A;  1ED1 A;  2K4E A;  2LYA A;  1HIW A;  1TAM A;  1A6S A;  4ICA A;  4IC9 A;  2K4I A;  1UPH A;  1L6N A;  4JMU A;  2K4H A;  2JMG A;  2H3F A;  1ECW A;  1HEK A;  2HMX A; 
#chains in the Genus database with same CATH topology
 3FAH A;  1RPL A;  2YMM A;  4EYH B;  4PGX A;  2HVI A;  2I6X A;  5J8Y C;  1U47 A;  5TIS U;  1JXE A;  3AQF A;  4OO1 J;  2LBO A;  4US8 A;  3KTQ A;  1ZD4 A;  1ZQQ A;  3F5E A;  1NK4 A;  2H3Q A;  1RXV A;  3UMB A;  1MN8 A;  4BWM A;  3Q8R B;  2LM1 A;  4XUS A;  2RLT A;  1D8Y A;  2EZX A;  2XY5 A;  2AGP A;  2EAP A;  3NS1 A;  5J0T A;  3SQI A;  2DQN B;  2E8M A;  2ZXH A;  1F44 A;  4ECQ A;  5AK4 A;  3E58 A;  2JH7 A;  2XY6 A;  3OHB A;  3QU5 A;  2JHD A;  1XSN A;  3H40 A;  2CRX A;  1N2X A;  1L3S A;  2KFN A;  5KG6 A;  1CI4 A;  2D8C A;  5CHG A;  3RH5 A;  1PZN A;  1D8L A;  4B9T A;  5HP4 A;  1Z1V A;  3QYP A;  4KX5 A;  4KLI A;  4CDG A;  2NRZ A;  3Q8S B;  4ED7 A;  5ALD A;  1WCL A;  3OPX A;  2DFL A;  4B9U A;  2WAQ C;  1MC8 A;  4PJ0 U;  4TUP A;  1QSS A;  3JPS A;  1TK8 A;  1Q46 A;  1N62 A;  1GO3 F;  2KE7 A;  1N48 A;  2JXJ A;  2BCR A;  4KLE A;  5AKE A;  3QZ7 A;  9ICO A;  3FYH A;  1NJW A;  4RQ0 A;  2P6R A;  3TAR A;  2KNJ A;  4O5K A;  4DS4 A;  2PMZ C;  4KLM A;  5JRT A;  1KQQ A;  3NVW A;  3QX7 A;  4OJP A;  2KK0 A;  3QXG A;  1T8E A;  4IR1 A;  5AI5 A;  3KKA C;  2W9B B;  8ICS A;  5IIL A;  1TVA A;  1K1Q A;  2KD1 A;  4DFJ A;  2MUT A;  4FZL A;  2E8N A;  5AM2 A;  2BCV A;  7ICM A;  4OJO A;  4DLE A;  1H38 A;  2NRV A;  3F2B A;  2H3F A;  1RXW A;  1VDV A;  1LVH A;  4BGD A;  3RR8 A;  5JUM A;  5H2F U;  3PW5 A;  3BQ7 A;  3V6K A;  4M6W B;  4M2Y A;  1ZQF A;  4M9J A;  4RQ6 A;  3MFH A;  2BQ3 A;  2UVR A;  1PVP A;  1BPX A;  3Q8K A;  4QWC A;  4R65 A;  1KL9 A;  1TFR A;  1QCK A;  4DSE A;  2Y9U A;  3HJE A;  8ICJ A;  4QIW C;  3WKA A;  3TFR A;  5ALG A;  2WTF A;  4NLG A;  2RDI A;  4DQQ A;  2D6F C;  2E3T A;  3CNH A;  1NZB A;  8ICH A;  3F2C A;  4DL6 A;  1QQ7 A;  4USA A;  3B0Y A;  1X9M A;  4PHE A;  5J0R A;  2LI6 A;  5J0P A;  5BOL A;  2KVC A;  4RQ7 A;  5DQG A;  3SV3 A;  4QZD A;  4YXM A;  1F0M A;  2AQ0 A;  5TZV A;  4F5N A;  2HW3 A;  4DSL A;  5ALS A;  4ECZ A;  4WJ3 B;  4PHD A;  5ALJ A;  5J2F A;  2BPG A;  2OM6 A;  3RB4 A;  3SZ2 A;  1ZJN A;  4UB8 U;  4Z6D A;  1Z19 A;  4DO9 A;  3SAF A;  4DQI A;  5FP0 A;  4FFD A;  4UB3 A;  2HHU A;  1XSP A;  4F4Y A;  3PSI A;  1ED1 A;  4UAW A;  2DPI A;  4F2R A;  1ZQU A;  2G06 A;  4B9S A;  4UB4 A;  3L4P A;  2BCU A;  2DGZ A;  2PFP A;  9ICC A;  4UBB A;  3SAG A;  1SWW A;  1QSL A;  2ZJ8 A;  1XO0 A;  3EUB 2;  5J2D A;  5KFP A;  4KLT A;  5IIN A;  2F8L A;  4I29 A;  4Z6F A;  3EYZ A;  3MAB A;  5KFU A;  1JX4 A;  2F8K A;  3JPQ A;  5J2I A;  4DSF A;  1COO A;  5HNK A;  5F9L A;  1X40 A;  2OYY A;  3F53 A;  5AM4 A;  1A77 A;  4QZ8 A;  1S5L U;  1X9W A;  2P66 A;  1SL2 A;  3M6K A;  4C80 A;  1NI3 A;  4RT3 A;  1M6Y A;  4P2H A;  1Q8K A;  2GWS A;  3QEB Z;  2LPE A;  1SKW A;  5KFT A;  4PPX A;  2WB1 F;  4C8N A;  3D2S A;  3MR6 A;  2Y0S C;  4R64 A;  1N56 A;  4GIB A;  3THV A;  3WK9 A;  5KFV A;  2W9B A;  8ICA A;  2ZIV B;  4Y2Q A;  4B9N A;  8ICC A;  5ALM A;  3N7R C;  5HR7 A;  5IIO A;  7ICP A;  3PX6 A;  5KFR A;  4IRD A;  1ZQD A;  4Y2Y A;  4DL3 A;  7ICI A;  2Y1J A;  2Z7J A;  4FZM A;  3JPP A;  4UB2 A;  1L3T A;  2YB1 A;  1XS9 D;  5AKG A;  4NLK A;  5J0Y A;  1WCN A;  3RAQ A;  2FJ6 A;  2QAR B;  3WK5 A;  4ED6 A;  5KT4 A;  3BQ2 A;  2ZXI A;  3H4D A;  1BPB A;  3V6J A;  2IOH A;  1V9P A;  7ICT A;  2ZJ5 A;  3V7K A;  4I2C A;  1DGS A;  4NL9 C;  3RJE A;  1JI7 A;  5DBC A;  2JEF A;  1NK0 A;  4J9M A;  2E1E A;  4JUZ A;  4CE6 A;  4AYB C;  1T7P A;  2IHN A;  3EZ5 A;  5IIK A;  2XID A;  1X66 A;  3JPR A;  3GIM A;  2QB0 A;  1KRP A;  1L7O A;  3NVZ A;  4I2A A;  3CRX A;  5J2E A;  4YQW A;  5ALQ A;  4C8L A;  5ALW A;  2J6U A;  3M6Z A;  5EE9 A;  3G6X A;  8ICL A;  2BQR A;  3S6J A;  2PFQ A;  4OJ6 A;  5AK6 A;  4M9H A;  5KT2 A;  5J0U A;  5CA7 A;  4DL4 A;  2C2D A;  1S76 D;  3TAP A;  2HBJ A;  5GTI U;  4I2D A;  3PW2 A;  4KLU A;  1JN3 A;  4RNM A;  4QWB A;  3Q8M A;  3I28 A;  1KBU A;  3IM1 A;  2ZIW B;  4I2F A;  3RJK A;  2AXT U;  2ASD A;  3IP4 B;  3UQ0 A;  2BPF A;  4Y2P A;  4QWD A;  4O3S A;  1RG6 A;  2OH2 A;  4UAU A;  8ICN A;  4UAZ A;  2A1J B;  4J9S A;  2ZUD A;  4NL9 A;  1U49 A;  2FLP A;  2WHE A;  1Z1B A;  4QZG A;  2ISO A;  2H3V A;  3K1R B;  4QZC A;  5ALX A;  3I76 A;  3KHL A;  2E8P A;  1NZP A;  3QEA Z;  1L3U A;  1MA7 A;  3C1Y A;  4GC6 A;  3ZDC A;  1L7M A;  1SGG A;  1UPH A;  1KKX A;  4Q45 A;  1ZQP A;  3AU2 A;  3AL0 B;  1ZQW A;  2KIW A;  4ZH4 A;  4RQ1 A;  4GXJ A;  2KMD A;  4RUC A;  2E5S A;  4M47 A;  1FEZ A;  5KFK A;  2ZJA A;  1HIW A;  3PR4 A;  3H8W A;  1XO1 A;  1SZH A;  3AN1 A;  4LZG A;  3OGU A;  2JEG A;  4KLO A;  2K4I A;  3ZDA A;  1UT5 A;  5KFN A;  3C21 A;  4C8O A;  1UA1 A;  8ICK A;  2KEY A;  1QQ5 A;  1TK0 A;  1UHU A;  3RBE A;  4IS7 A;  5J0X A;  3H0L B;  5AM1 A;  9ICP A;  4M9G A;  2BGW A;  4QIW F;  3PX0 A;  3ALR A;  4NXZ A;  3WK4 A;  2I9G A;  5CR0 A;  1T4G A;  3QZ8 A;  5CEH A;  1YT3 A;  3GV8 B;  4JV0 A;  5ALV A;  2PMZ F;  3NRZ A;  3SR6 A;  4C8K A;  2C22 A;  3IG5 A;  3GZF A;  4Y2X A;  2K8B B;  4ELT A;  5GTH U;  2ZIU B;  4F50 A;  4BX9 C;  3GIL A;  1ZQK A;  3T5K A;  4RQM A;  4F5O A;  3QE9 Y;  4KLQ A;  2WB1 C;  2GLE A;  2KIC A;  2YML A;  3RF9 A;  2W3S A;  1BPZ A;  2JV3 A;  3FC4 A;  2YMQ A;  2N1R A;  3ZI4 A;  1ZQS A;  4F2S A;  3HP6 A;  2AQ4 A;  4ELV A;  3MC1 A;  9ICL A;  4I2G A;  3SEN A;  2KVS A;  1F5S A;  4F91 B;  2M0N A;  5EWE A;  4ZOH C;  3RH4 A;  1ZQM A;  3QU9 A;  5KAI U;  4PH5 A;  7ICL A;  5AKX A;  2KP7 A;  1PK3 A;  1KFS A;  4C4T A;  4NY8 A;  4DQS A;  3PY8 A;  2H3Z A;  5AKI A;  5DG7 A;  3NVY A;  5ALR A;  4JB3 A;  4CGZ A;  5DB8 A;  3PML A;  4O3R A;  5KFM A;  3M8R A;  3QUQ A;  4DFM A;  2ODG A;  2HMX A;  9ICU A;  4O3M A;  2HDO A;  4RQ2 A;  3RTV A;  2HBL A;  2P35 A;  3PZP A;  4PZN A;  4MF2 A;  1ZD2 P;  2A1J A;  3HRD D;  4Z6C A;  1WUD A;  2V4R A;  3LVW A;  3MGV A;  2KSO A;  1Y88 A;  3RJH A;  5KFY A;  4QZB A;  2BCQ A;  2FPL A;  1HUO A;  9ICR A;  2KSO B;  4Y2R A;  1DK2 A;  3EWA A;  1ZQJ A;  2V9W A;  1IV8 A;  4QWA A;  3RAX A;  3G6Y A;  4I2J A;  1ZOL A;  2O6K A;  1URJ A;  4LVS A;  4MEX A;  4DL2 A;  4GFJ A;  4ECY A;  3QNM A;  5J29 A;  4ECV A;  2K4E A;  3MR3 A;  4M04 A;  1KN5 A;  3C28 A;  3N4M B;  8ICO A;  3SEI A;  2FE9 A;  1KTQ A;  4JMU A;  4M0A A;  3HX0 A;  9ICG A;  1LB2 B;  4KTQ A;  2JEI A;  1JRP A;  3MDA A;  2DKX A;  3T5L A;  2XGQ A;  2YN4 A;  3T79 A;  2KOB A;  5III A;  3DV9 A;  1S0V A;  3KBB A;  4NWI A;  2KKV A;  2GH1 A;  4P0P A;  1B43 A;  2PKE A;  3C2K A;  4IQV A;  3HIL A;  1KLN A;  2IOF K;  8ICR A;  4B9V A;  3Q8L A;  1NKE A;  7ICH A;  5EE1 A;  4DSI A;  2AHO B;  3HT3 A;  1ZXI A;  4QJF B;  4C4S A;  5ALY A;  2FLL A;  2MU2 A;  4KMO B;  4O0I A;  1A6S A;  1YZ6 A;  2J6T A;  5KT6 A;  2NRT A;  1UA0 A;  1U45 A;  4NLZ A;  4HAI A;  1SKR A;  3VC8 A;  3WK6 A;  1MQ3 A;  4TQR A;  4DF4 A;  1SWV A;  4C7Y A;  5DG8 A;  3UXO A;  4RQN A;  1DRG A;  1QQ6 A;  2C2R A;  4NM1 A;  2LMR A;  4FBT A;  1V97 A;  5AIB A;  5DB7 A;  4RPZ A;  2W7O A;  3GFK B;  3OJS A;  4GXK A;  5J0O A;  1ZQC A;  3M9O B;  4DEZ A;  4BWJ A;  5G5G A;  4UAS A;  4DOC A;  3AM9 A;  3IRU A;  3M1Y A;  3T3F A;  4U7C A;  5KG0 A;  1SL1 A;  2F2A B;  3LDA A;  5D49 A;  1AQ6 A;  2DUY A;  5KT5 A;  3SYZ A;  5E79 U;  4ICA A;  4YN4 A;  3CP8 A;  4DCC A;  4DSJ A;  2RQ5 A;  2FMQ A;  4EZ9 A;  2F1H A;  1IG6 A;  4R63 A;  5KFE A;  1BPE A;  1JMS A;  1PVQ A;  8ICI A;  3ZDE A;  1COK A;  3H8S A;  2BDU A;  1Q3V A;  1TE2 A;  4YXJ A;  2NYV A;  3WKE A;  5KG4 A;  3RJI A;  1NK7 A;  4F4K A;  2F77 X;  5J8Y A;  2H3I A;  3BJY A;  3BQT A;  2RDJ A;  2XIC A;  4F4X A;  9ICB A;  7ICK A;  4F92 B;  2W04 A;  4O5C A;  4XQ8 A;  4FBU A;  3PW4 A;  4J9N A;  3BDP A;  2H5X A;  5IIJ A;  1DXS A;  4OJL A;  2F3N A;  3DDH A;  3KHG A;  5DG9 A;  4X5V A;  4QZI A;  1Z00 A;  4YMN A;  4BDP A;  3BQ0 A;  1NK6 A;  2YTU A;  4RPY A;  1BVS A;  1L7N A;  1S97 A;  2ESE A;  3C2L A;  3SAH A;  5AI9 A;  4J9P A;  1SKS A;  4UQG A;  1BPD A;  2ZG6 A;  2G5H B;  5KFH A;  2ASJ A;  1ZQN A;  5G5H A;  4QZH A;  2K8C B;  3KHR A;  2KZ3 A;  3D2Q A;  5AIC A;  2RHF A;  4TUS A;  1A76 A;  5KG7 A;  2XCA A;  1KDH A;  3TQ1 A;  5KFG A;  3AEV A;  3QUB A;  2B0C A;  4RQ3 A;  5CWR A;  4M6W A;  2IMW P;  4UAY A;  5C5J A;  4RQ5 A;  2C28 A;  4DQR A;  4IRC A;  4YFK A;  5B66 U;  4YVZ A;  2K89 A;  2Y1I A;  4NLB A;  2HVH A;  5AM3 A;  4EYI B;  2UVW A;  5AI6 A;  1ZD3 A;  5AKL A;  3N28 A;  1ZRM A;  1N63 A;  2QLT A;  1JUD A;  2YMP A;  3TFS A;  2HHS A;  2FPM A;  4PZO A;  4BUG A;  1Z4O A;  4DF8 A;  4IR9 A;  2YY6 A;  3GIJ A;  8ICW A;  2Y0S F;  2LYA A;  5AKH A;  1D9F A;  9ICW A;  4JV1 A;  3ETL A;  3M9N B;  3ETR A;  1FIQ A;  3QU7 A;  1NJX A;  4B9M A;  4P0Q B;  2VA3 A;  1ZQE A;  1ZQR A;  2DWQ A;  3F5A A;  4DFD A;  5KFS A;  5CJ7 A;  8ICP A;  3D6J A;  2HOF A;  4KLS A;  4JWN A;  3L5K A;  2ZTD A;  3ONN A;  2IBK A;  1X6I A;  3ISD A;  4RT2 A;  5DKW A;  1FO4 A;  4HYK A;  2ZIW A;  1U48 A;  9ICF A;  5ALU A;  5KFZ A;  2WF5 A;  5JTI A;  4GLX A;  1ZQY A;  2W8L A;  1TK5 A;  3U26 A;  2XO7 A;  2R18 A;  5AM0 A;  5L9X A;  7ICR A;  2ALZ A;  2W9C B;  2Y9T A;  4ECS A;  3OHA A;  4Q44 A;  1NJY A;  5D4B A;  5KFF A;  4DQP A;  4KLF A;  7ICV A;  1SXD A;  3PO5 A;  1L8O A;  5KFX A;  5IIM A;  5KFQ A;  4F3O A;  1D8B A;  1S77 D;  1LKY A;  3C23 A;  9ICH A;  1QTM A;  1J2M A;  3DEE A;  2CPR A;  2HBK A;  1ZQB A;  5DGB A;  3ZD8 A;  2KV2 A;  1FFU A;  2M9N A;  1MSW D;  1SB3 C;  3UMG A;  3H8M A;  5AKY A;  3J81 j;  1QLN A;  2W55 A;  2JR5 A;  1S8O A;  2WF7 A;  3K75 D;  4K4I A;  3MGI A;  5AIA A;  4UAV A;  5J0Q A;  3GQC A;  5ALL A;  5DBA A;  3PST A;  3WK8 A;  3RB0 A;  3B0X A;  1L8L A;  2A19 A;  3A0H U;  3PVX A;  3UXN A;  3RJJ A;  2FPK A;  5KFO A;  2LM4 A;  3JPO A;  5KFB A;  5EWG A;  2L5Y A;  1JAL A;  2HHT A;  2OXO A;  3T5J A;  4UB5 A;  3TAC B;  5KFI A;  2CN1 A;  2FDR A;  3R9K A;  2ZTE A;  3HPO A;  3I1Y A;  2RRD A;  4I2B A;  3GV5 B;  4PGY A;  2HBM A;  4KLD A;  3LVV A;  1CEZ A;  3G6V A;  2G08 A;  4YD2 A;  4BXO A;  4ECR A;  3IN5 A;  4QZ9 A;  2ZIU A;  1C7Y A;  2HHV A;  1NKB A;  1Q3U A;  5F3X B;  2ISP A;  3KKA A;  2EH9 A;  3N7P D;  4F5P A;  2NO4 A;  2UVV A;  2JMG A;  2EAM A;  1SZP A;  5EWF A;  4J9R A;  1N5W A;  3C5F A;  3AQE A;  2KFZ A;  1UT8 A;  1ZQL A;  2A1A A;  4P0Q A;  2F1J A;  8ICB A;  5ALF A;  1L5U A;  2W03 A;  3QUT A;  3L3F X;  3AUO A;  2KIV A;  3ICX A;  3PW0 A;  4IC9 A;  2KN7 A;  4YMO A;  4OCZ A;  7ICO A;  2BZF A;  1BNO A;  3MGH A;  1DK3 A;  5DDY A;  3WKD A;  3BQ1 A;  2HI0 A;  4RQ4 A;  8ICM A;  3C29 A;  4C0Z A;  1RZT A;  3MDC A;  2R8J A;  8ICU A;  2OEH A;  3BS7 A;  4UAR A;  4XA5 A;  1ZQI A;  2IA6 A;  3QU4 A;  2PI5 A;  3V72 A;  9ICT A;  5J2G A;  2QB0 B;  8ICY A;  4RUA A;  9ICS A;  2KHQ A;  4PL1 A;  5F9N A;  1T3Q A;  2W8K A;  5HHH A;  4DL7 A;  1XWL A;  2JRZ A;  4ECW A;  1PUZ A;  2J6S A;  3PO4 A;  4J9Q A;  2DKZ A;  3RJG A;  3E0F A;  1OW5 A;  3BS5 B;  3RFA A;  3PNC A;  1DGJ A;  2ES6 A;  2AU0 A;  1N61 A;  4I2H A;  1NJZ A;  1DOQ A;  1ZQG A;  1UQV A;  2FMS A;  3KHH A;  2Q0Z X;  4QWE A;  5HML A;  5AKJ A;  4RZR A;  3LYS A;  4DSK A;  4KN4 A;  2HCF A;  4JV2 A;  4XRH A;  3PW7 A;  2AH5 A;  7ICQ A;  2UVU A;  5DB9 A;  2QKQ A;  3RB3 A;  4I2E A;  2JZB A;  1OXJ A;  2F1I A;  4P0P B;  3UXP A;  4KMU A;  4J9O A;  1TAM A;  2ZIX B;  3BZK A;  9ICA A;  3OSN A;  2IOF A;  4IRK A;  3NUQ A;  3NVV A;  4TUQ A;  2ZTC A;  2NO5 A;  2DBY A;  3WKB A;  4Y2J A;  3E2E A;  4Z6E A;  3PR5 B;  3GV7 B;  2G0A A;  5EE3 A;  1SV0 C;  2MSN A;  1S0O A;  2VJ5 A;  2LKY A;  1TKD A;  4O3N A;  1J97 A;  5DLG A;  5KT3 A;  5KG3 A;  4ED2 A;  3TAD C;  4F4W A;  4IL6 U;  4KLH A;  4US9 A;  4FE3 A;  2RP5 A;  4Y2T A;  3A0B U;  4ECT A;  2Q4T A;  1BPY A;  3D2N A;  5J2H A;  2IHM A;  3OSP A;  2WF8 A;  2KJ5 A;  3CW2 C;  1RDF A;  4UAT A;  2K4P A;  2KJ9 A;  2EQY A;  5KL8 B;  5ALP A;  1ZQO A;  5ALN A;  5AI8 A;  4B6J A;  1SL0 A;  4KLJ A;  2I5H A;  2I1Q A;  1RYU A;  2BKE A;  4DOA A;  2NRW A;  4MFF A;  3H7I A;  1IIP A;  1S10 A;  7ICS A;  4MEY A;  3H0M B;  4PGQ A;  4C4R A;  3C2M A;  4NJ8 A;  2HSZ A;  3GII A;  2KTQ A;  3Q8Q B;  1U9L A;  4UB1 A;  1JXL A;  3NRW A;  4EEN A;  1L3V A;  4DS5 A;  1ZQA A;  2G07 A;  2WAQ F;  5KG2 A;  2W9C A;  2ZUC A;  3ZD9 A;  1X2I A;  3PV8 A;  5DGA A;  2C2E A;  1IM4 A;  2MRL A;  4P4P A;  1SV4 A;  2KHV A;  3RB6 A;  5KNI A;  3IHQ B;  3ED5 A;  1WWU A;  3ISB A;  1ZQ1 C;  4MFA A;  1QSY A;  4AYB F;  5ALK A;  3RR7 A;  4ELU A;  1ZJM A;  1OUQ A;  1LKY B;  3LWM A;  1ZD5 A;  5AKK A;  4QZA A;  2BDP A;  3EPI A;  2HHQ A;  5K4L A;  4EX7 A;  4IQT A;  8ICF A;  5KG5 A;  5L1L A;  2GO7 A;  5HHI A;  7ICN A;  9ICX A;  2G09 A;  3N97 B;  1LV5 A;  4DFP A;  2WF6 A;  2EDU A;  5ALO A;  4U6P A;  4EZ6 A;  5AM5 A;  4ED8 A;  3M9M B;  2EZZ A;  4J03 A;  3Q8P B;  2KKP A;  3TI0 A;  4RNN A;  4RU9 A;  1O08 A;  1T94 A;  5J2A A;  5BPC A;  5KG1 A;  4I27 A;  1KFD A;  1CRX A;  2K60 A;  3SV4 A;  4J9K A;  3ISC A;  3SD7 A;  2LYH A;  1ARO P;  1RYS A;  1UCV A;  1B0X A;  3ORY A;  1TV9 A;  3QU2 A;  1NK8 A;  1WG8 A;  4F93 B;  2PFN A;  2WFA A;  4EBC A;  3PX4 A;  2KZZ A;  4DOB A;  1WYG A;  5EE0 A;  9ICM A;  3ZDD A;  4Q8F A;  4QW9 A;  5L1I A;  5DDM A;  3GIK A;  9ICI A;  5T14 A;  4OD0 A;  2XCP A;  5KFL A;  4UB6 U;  8ICZ A;  4UW9 A;  3TKA A;  1TAU A;  1IXR A;  2W9A A;  2BCS A;  3QUC A;  2K4H A;  5ALT A;  2BR0 A;  3KZX A;  2W7P A;  1X9S A;  4M9N A;  2XI9 A;  3AMZ A;  5ALI A;  4DL5 A;  1L7P A;  1KEJ A;  1NNL A;  2WF9 A;  2PI4 A;  1YZ7 A;  4EEL A;  3F2D A;  5HR6 A;  2KZM A;  4P4O A;  4YCX A;  1J2N A;  4DFK A;  8ICG A;  2KG5 A;  4G3I A;  4KLL A;  3AU6 A;  4O5E A;  1C20 A;  2KJ8 A;  5J2J A;  1QH9 A;  2P6U A;  3WK7 A;  1ZRN A;  1ZQT A;  1ZQV A;  5AK5 A;  4F72 A;  5J2K A;  5D46 A;  2YX8 A;  4YD1 A;  1XC9 A;  5KFD A;  3RRG A;  1A0P A;  8ICE A;  4UBC A;  3HKZ F;  5KFW A;  3LWL A;  5DQH A;  4F4Z A;  1ZQH A;  5J0S A;  1RYR A;  3EPG A;  4GC7 A;  2QB1 A;  2HHX A;  2W3R A;  2DPJ A;  4Q43 A;  5KFA A;  2BQU A;  1S9F A;  1T3N A;  1RQL A;  3B9J A;  3SMV A;  2NV3 A;  2W43 A;  5L1J A;  1JIH A;  2CXY A;  9ICE A;  1PK1 B;  1BGX T;  2BPC A;  2AGO A;  4F5Q A;  3RJF A;  1NOM A;  8ICV A;  3BZC A;  3N7S C;  5CB1 A;  1PK1 A;  1VJ5 A;  1Z00 B;  4KN7 A;  4I28 A;  7ICU A;  4JWM A;  1NK5 A;  5L1M A;  3GU3 A;  2GOL A;  3KD3 A;  5AKZ A;  1WWV A;  2DL0 A;  3K1Z A;  4E0D A;  2VA8 A;  1ZQZ A;  9ICV A;  5KFJ A;  3TAQ A;  4RPX A;  3IDW A;  3NGD A;  4CF3 A;  5HMM A;  3HWT A;  1ECW A;  4F71 A;  4Y2V A;  4OJ5 A;  4CF4 A;  4B9L A;  3UMC A;  3IV6 A;  1ZQX A;  3HW8 A;  4F5R A;  3MFI A;  1NK9 A;  1K5O A;  1JRO A;  2JZB B;  1S0M A;  5DLF A;  2XVT A;  4MFC A;  5BOM A;  2NRX A;  3VCB A;  4EX6 A;  4JK1 A;  4BXO B;  2R8K A;  4O3Q A;  5AK3 A;  2LYB A;  3KFU F;  2K8A A;  1KFT A;  4ED0 A;  5L1K A;  5AHX A;  5KAF U;  2OHF A;  4EEK A;  2YQE A;  4C8M A;  4I2I A;  1HJP A;  2VJ4 A;  3K4G A;  4DLG A;  3ZDB A;  2EAN A;  1TAQ A;  5CRX A;  2PFO A;  7ICF A;  3HKZ C;  4P4M A;  1X42 A;  4R8U B;  2JEJ A;  1S0N A;  2MUT B;  4M9L A;  4AP9 A;  2D3D A;  2F44 A;  1BNP A;  2HOQ A;  3PSF A;  4G9B A;  5DBB A;  3O0F A;  3OTQ A;  1X9X A;  1VLB A;  1K1S A;  2DF4 B;  3PMN A;  4A8E A;  4NLC A;  4QZE A;  4TQS A;  2V4Q A;  4PHP A;  1Z3E B;  2ATL A;  4O9M A;  2A3V A;  2FMP A;  9ICN A;  1KSP A;  1SXE A;  1X6J A;  2LHT A;  3WKC A;  8ICQ A;  2ASL A;  1RQN A;  2QAR A;  1XSL A;  4K4H A;  4Y2S A;  3JPT A;  3WU2 U;  2FLN A;  1HEK A;  2VIX A;  5DQI A;  1ZYQ A;  1MQ2 A;  4NV0 A;  4QZF A;  2VKQ A;  1PVR A;  1Z4N A;  3H0R B;  4CCH A;  1NKC A;  4O3O A;  4C7Z A;  4TUR A;  4MF8 A;  8ICX A;  1O03 A;  4QW8 A;  3KZI U;  4LZD A;  4CNQ A;  3TAN A;  4YG2 A;  1V85 A;  4KLG A;  2BHN A;  4QNL A;  3SI8 A;  1D9D A;  1SIJ A;  4FO6 A;  5JU5 A;  4NM2 A;  3NAS A;  5A0L A;  4KIT B;  2HOI A;  9ICQ A;  4BJQ A;  4YP3 A;  2OCE A;  2FI1 A;  3M7D A;  3MR5 A;  1U4B A;  9ICK A;  3T5H A;  1EXN A;  1B4F A;  2MA1 A;  4K4G A;  1N60 A;  3CYM A;  4FS2 A;  3BS5 A;  4FS1 A;  2XC9 A;  2VAN A;  2R8H A;  4ACO A;  5DB6 A;  3H4B A;  3IG8 A;  3EW9 A;  5J0W A;  5KT7 A;  2B6G A;  4ED1 A;  7ICJ A;  2XY7 A;  4Q8E A;  1XU4 A;  1B22 A;  2YB4 A;  4R66 A;  2HHW A;  1V38 A;  5ALE A;  4CF5 A;  3KOO A;  5KTQ A;  1N5X A;  5KFC A;  4F8R A;  3UM9 A;  2ZIX A;  3MR2 A;  2E8O A;  2ZUB A;  3UQ2 A;  5CP2 A;  2PXI A;  2F76 X;  3PSP A;  2JGA A;  3H8J A;  2OWO A;  2EAO A;  1ZET A;  3C5G A;  4DWI A;  3LK9 A;  3RBD A;  2VA2 A;  1KW4 A;  3OJU A;  3FM9 A;  1P7D A;  3C1Z A;  2R8I A;  4ECX A;  1FFV A;  4EBD A;  9ICJ A;  8ICT A;  3TAD A;  1XNS A;  4GXI A;  3RH6 A;  4IQU A;  4CRX A;  4NLN A;  4PHA A;  4EEY A;  3UPQ A;  5J2B A;  4EBE A;  4ED3 A;  3V6H A;  4RQ8 A;  4YR3 A;  3GDX A;  4R8U A;  5KL1 B;  3V7J A;  2ZIV A;  4FZN A;  2XGP A;  4YMM A;  2E1F A;  2W54 A;  3NTU A;  3JPN A;  1L6N A;  4PL2 A;  2MAX A;  2AGQ A;  2B21 A;  4YR0 A;  1HUZ A;  4Y2U A;  4IQW A;  7ICE A;  3M8S A;  2JH1 A;  4RNO A;  2W11 A;  5AI0 A;  3MBY A;  5B5E U;  1CUK A;  1RM6 C;  4ECU A;  2W9M A;  5J2C A;  5EOZ A;  7ICG A;  5C0Y A;  2R8G A;  2AJQ A;  4LJX A;  4J9L A;  3FDS A;  3RRH A;  4MHV A;  4O3P A;  4YR2 A;  4KX3 A;  5AI4 A;  3V7L A;  2G5I B;  5ALZ A;  5ALH A;  2EZY A;  1SV0 A; 
#chains in the Genus database with same CATH homology
 4ACO A;  1T94 A;  2RP5 A;  5CRX A;  2ZXI A;  1Z19 A;  3HKZ C;  2Q4T A;  3IG8 A;  3D2N A;  2KNJ A;  3SAF A;  2KJ5 A;  3F5A A;  2PMZ C;  2OXO A;  1CRX A;  2E5S A;  4QJF B;  2KHQ A;  4PL1 A;  3SMV A;  2KJ9 A;  2NV3 A;  2H3Z A;  2HOF A;  3PSI A;  5KL8 B;  4OJP A;  1ED1 A;  2CN1 A;  4KMO B;  1HIW A;  2E1E A;  3AQF A;  1A6S A;  4OO1 J;  1SZH A;  2LBO A;  4AYB C;  2G06 A;  4CGZ A;  2KD1 A;  3KFU F;  2HOQ A;  2RRD A;  2YB4 A;  3ONN A;  3PSF A;  4FZL A;  3O0F A;  2K4I A;  2XID A;  4OJL A;  3SAH A;  2HBM A;  3VC8 A;  3LVV A;  4OJO A;  2DGZ A;  3N7S C;  2G08 A;  2KEY A;  3SAG A;  2DF4 B;  3F5E A;  3F2B A;  2HMX A;  2H3F A;  4A8E A;  2ZIW A;  1XO0 A;  2ZG6 A;  4O3M A;  3E0F A;  2G5H B;  4NLC A;  3IN5 A;  1IIP A;  3GU3 A;  2H3Q A;  3H0L B;  2HBL A;  2F8L A;  2GOL A;  2ZIU A;  3PZP A;  1DRG A;  3H0M B;  2ZIX A;  3CRX A;  2R18 A;  2K8C B;  3K1Z A;  3RFA A;  2A3V A;  1WUD A;  2F76 X;  3D2Q A;  3M6Z A;  2LHT A;  3PSP A;  2JGA A;  2RHF A;  4QIW F;  3LVW A;  1Q3U A;  2OYY A;  3F53 A;  5T14 A;  3ALR A;  4OJ6 A;  3MGV A;  3N7P D;  1PVP A;  2W7O A;  3SQI A;  2DQN B;  3NRW A;  2ZXH A;  1F44 A;  2G07 A;  2WAQ F;  2K4H A;  2JH7 A;  2JMG A;  3LYS A;  1P7D A;  4QIW C;  1YT3 A;  1ECW A;  2JHD A;  1HEK A;  3M6K A;  2HBJ A;  3KZX A;  2PMZ F;  2VIX A;  4NV0 A;  2W7P A;  4OJ5 A;  2CRX A;  3AQE A;  2XI9 A;  2VKQ A;  1URJ A;  1PVR A;  2MRL A;  4U7C A;  1XNS A;  2D6F C;  3IG5 A;  4P0Q A;  3GZF A;  3H0R B;  4CRX A;  1KBU A;  4GFJ A;  2F2A B;  2WB1 F;  2ZIW B;  3F2C A;  2K8B B;  2W03 A;  1NZB A;  2KHV A;  3D2S A;  1D8B A;  2K89 A;  3L3F X;  2Y0S C;  3F2D A;  4P0P B;  2K4E A;  2ZIU B;  4NLB A;  4BX9 C;  5HR6 A;  1ZQ1 C;  1TAM A;  2ZIX B;  3ICX A;  4ICA A;  5KL1 B;  3IP4 B;  4AYB F;  3CP8 A;  4IC9 A;  2ZIV A;  4FZN A;  3C28 A;  1OUQ A;  3DEE A;  2E1F A;  2CPR A;  4KX5 A;  2HBK A;  2XVT A;  1L6N A;  2KVC A;  4CDG A;  3NUQ A;  1PVQ A;  4JMU A;  2KV2 A;  4PL2 A;  2ZIV B;  2WB1 C;  2OH2 A;  2BDU A;  1Q3V A;  2KIC A;  3OPX A;  3N7R C;  3VCB A;  2KJ8 A;  3RF9 A;  4BUG A;  2WAQ C;  4QNL A;  5HR7 A;  2JH1 A;  2F77 X;  2N1R A;  2H3I A;  3C29 A;  4C0Z A;  5A0L A;  1Z1B A;  2HOI A;  2YX8 A;  4BJQ A;  2XIC A;  2Z7J A;  2LYB A;  2G0A A;  2H3V A;  4FZM A;  1A0P A;  2G09 A;  2Y0S F;  2K8A A;  1GO3 F;  3T79 A;  2LYA A;  2W04 A;  2KOB A;  5C0Y A;  2YB1 A;  3HKZ F;  1MA7 A;  3M7D A;  4NWI A;  2KKV A;  4U6P A;  4WJ3 B;  2GH1 A;  2VJ5 A;  2VJ4 A;  1UPH A;  2LKY A;  2MA1 A;  4P0P A;  2OM6 A;  2M0N A;  3CYM A;  4KX3 A;  3PST A;  2KKP A;  3AL0 B;  2G5I B;  4FE3 A;  4P0Q B;  2KIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...