3DEEA

Crystal structure of a putative regulatory protein involved in transcription (ngo1945) from neisseria gonorrhoeae fa 1090 at 2.25 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the first representative of Pfam family PF09836 reveals a two-domain organization and suggests involvement in transcriptional regulation.
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Transcription
molecule keywords Putative regulatory protein
total genus 55
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09836 DUF2063 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3deeA02
1.10.150.690 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3deeA01
3DEEA
chains in the Genus database with same CATH superfamily
5KFDA 3CMEI 2AGQA 3UXOA 2WAFA 3ASNH 2I5UA 3MGHA 8ICKA 3SMVA 2M4KA 3V6JA 1D8BA 2V1DA 1TWCJ 3OYBA 4DO9A 2ZBKA 2GQQA 4QIWF 4J9KA 1FFVA 3AMZA 3UQ0A 2QCOA 4CO8A 3LSJA 3SR6A 5IILA 3CCUI 1MMDA 5CVVA 4KLHA 1T98A 3NS1A 4L18B 1YZ7A 2LDUA 3I59A 2E7WA 3SEIA 2E35A 4IQ4A 4FX0A 4F4YA 3SFZA 2MC3A 2M0MA 3CF2A 2LF8A 3HUGB 2BY1A 3FXOA 4M6XA 4RPXA 1R5GA 1QZZA 4L5EA 4MNUA 2PI0A 3BR5A 1HKTA 1HJPA 2VKQA 3LA7A 2O8KA 1KONA 3PW2A 2LD5A 4BBSJ 3K1RB 1YJWI 2BDPA 2YS9A 2STTA 4E0DA 2HDDA 1EJ9A 1O3RA 2DA7A 5DV5A 2EZHA 4XIDA 1LB2B 2IOFK 5F0HA 2IA2A 3CCLI 1NNLA 2ZXJA 3MVPA 4DF4A 2VQLA 3RIRA 4HDUA 2W3RA 2F4IA 3EUHA 3TO7A 3Q9SA 3H8SA 3HRDD 4PHDA 1D9FA 4M2YA 4HQMA 4KLLA 3OIPA 2KZGA 2KZMA 1B4AA 4PGQA 3RPUA 3S1NJ 2X6WA 2XDVA 1ACIA 3OYJA 2QZ8A 4TV7A 1ON2A 2P8TA 4KLJA 2Y1IA 1BA5A 2ICWG 2CW7A 4M3DA 3RYRA 4P9UA 4CCLA 3Q9VA 1QQIA 2ELKA 3QPTA 4PJ0U 1ZRFA 2NAZA 3FMSA 3GWZA 2AQFA 4MFDA 2LYBA 7ICNA 3BQZA 4MEYF 2LYAA 2IMWP 1GVJA 2DDAA 2M2EA 2FNAA 5B66U 5D46A 1SFEA 2W7OA 5F27A 1H89C 1IN8A 1ENHA 1DU0A 2OU2A 4QPOA 3JPRA 1A6SA 2Y9UA 1BW6A 5ALKA 2NVQJ 4RQ3A 4I98B 1FSHA 4MF2A 3DPTA 2R8IA 4J9NA 3NUQA 5KT2A 2KZZA 5CYVA 4RAYA 1MH4A 3ECOA 1Y6IA 3O6BB 3QYPA 5J0TA 2ZIXA 4PZOA 4ESFA 5D6EA 4Y2VA 1XCBA 1UAAA 3N7PD 2KHMA 1BR4A 4ZTJA 1NH3A 2ZXHA 5AKYA 2E5SA 1RG6A 4BYYA 2R3SA 2ZIWB 1IDZA 4F5OA 4CXFA 4UHTA 2WV0A 2H3QA 3TDUC 2ZMEB 3I4NJ 2EV6A 2M0NA 2CV0A 3GZNB 4C8LA 5D6FA 1S0OA 4CF3A 1WJ5A 1SFOJ 3EQLF 2JVGA 2WAQN 1SXEA 2XV4S 2VT3A 1J2MA 1KSPA 4ECRA 3UM9A 1WI9A 3REOA 3RI4A 2HVRA 1BOAA 1PP8F 3BG5A 4Q47A 5E17F 3ISCA 2LVSA 1SGGA 3A2KA 2PKEA 2VXDA 5KG4A 4TQSA 5EZGA 2DDBA 5J4VA 1B9MA 2AGPA 1U9LA 2H3VA 1QNTA 3Q0VA 3I64A 3GCMA 4RQ0A 3F53A 3BR1A 1Y0NA 2D2WA 1ERDA 1PK1A 2NO4A 3ML6A 5A2QK 4FZNA 5LEJA 1MJAA 3L2VA 3BTIA 3ZMDA 4A3BJ 4FE7A 4A3GJ 4BGDA 2DUYA 3NVWA 4FZLA 1A5JA 4YN4A 4FCYA 4F2RA 1ZG5A 5HODA 2R7RA 1CRXA 3E6DA 1FYMA 3D1NI 1W0UA 3MDAA 3M8JA 2MLKA 4XN3A 4ZC3A 1FBQA 3NEUA 1ZREA 4UY8I 2LG4A 2QLZA 2JA2A 4NDLA 3BZKA 3V7JA 2HDCA 4I76A 5IOYA 2N1RA 4ED3A 3QP5A 3LDAA 3HW8A 2W4SA 4HOBA 2F1JA 4KJZA 4DOCA 2NRAC 2G06A 1VQPI 4BDYA 2W00A 5HNKA 3ZR8X 2DBYA 3TQ1A 4Q43A 4OCZA 1U6GA 2BQ3A 1QGPA 5KFUA 5AHXA 5KT7A 4F91B 4OD0A 1MSFC 1LVHA 2ZTEA 1QA6A 5EG0A 4ECYA 4BXXJ 1I6XA 2F76X 1ZYRF 2Q0ZX 5CQEA 2P6UA 2PJRA 1V97A 4IC9A 5F9NA 3T3FA 3OV8A 5DD4A 4YD2A 1KU2A 2K4EA 2KSOA 1L7MA 1E3OC 1SXDA 3JRBA 1OCRH 9ICIA 3VDXA 1EF4A 3E6MA 1QBJA 1BW5A 2W9CA 2P6TA 2Z1DA 4G3IA 3GZ5A 3BTCA 3JREA 7ICJA 4Y7NJ 4KLSA 5CWRA 3ZMUA 1T33A 1TWFJ 2GIZA 5A0LA 3R0AA 1JROA 1MMGA 2W7PA 4Y4RA 2KFDA 4DQQA 4R66A 2K3FA 3N4MB 1MJ9A 4ON0A 3PW7A 1XO0A 3WTXC 5DD8A 1R1TA 1PP7U 4OJPA 4CRXA 4NNJA 3O0FA 2W9AA 2Y0SN 5F0CA 4BHPA 3I54A 4EQQA 3I9V2 4ESBA 3PSTA 2R7ZJ 4EM2A 1ZQCA 2BXYA 2ESHA 4YRVA 4XA5A 2DPIA 4BEHA 1TQPA 1JX4A 3G6EI 1IM4A 3AFHA 3P9KA 3KYLA 1Q8KA 2XGQA 5T14A 1S0NA 2DT5A 4M9SA 1N61A 2RGVA 2BW3B 2EV0A 5GTHC 2RRDA 1FEXA 3F8MA 3ALRA 1K78A 8ICSA 2WF5A 3DKXA 2HI0A 3E1SA 3SQNA 5ICEA 2HPMA 5J47A 3H40A 4XLNF 2EFNA 2VB6A 5M5YJ 3CMAI 4DFKA 2I9GA 1SVOA 2YN4A 2IGOA 4A5NA 2VI6A 3RRGA 2CG4A 2DMUA 1LJ9A 3GIJA 3V7SA 4KITB 1A36A 4JQFA 3LYSA 4NL9A 4PL1A 4AIJA 1BPYA 2F4MB 5AM0A 2X6YA 2DXIA 1TP4A 2H5XA 1Y8QB 4F72A 2QSFX 1IG7A 3ONQA 2IS2A 9ICMA 1Z1VA 4QW9A 4RLFA 2HQ5A 4NC8A 4LD5A 3JRHA 3HPGA 3WK4A 3ZDDA 3O3KA 4RM3A 2Q1ZB 2YR2A 4EGZA 1YRNB 2HBJA 3U9GA 5KG0A 2ZJAA 3KZXA 4Z6EA 1X2NA 3RQ4A 3K70D 3JRFA 2E8PA 2P7CB 3TFRA 5KFXA 3CCEI 5AI5A 9ICUA 2XF5A 2FMLA 3QPHA 3CDLA 3W6KB 1Z3YA 5FKKA 2XGPA 2R5ZB 3F8FA 1L7PA 2IA1A 3HKZF 3PMLA 1FX7A 2ZG6A 4MHVA 3ZDEA 1U48A 4OJLA 7ICKA 4JX5A 1ZLKA 2AQ4A 2CFXA 2E8OA 3PO2J 5CVJA 3PNCA 3KZYA 2CYYA 4GXJA 4ECTA 4XKWA 3WTWC 2W84A 1JJ8C 1AKHB 4UNOA 4PFOA 4QZGA 2GWSA 1WVRA 4CCKA 4DSLA 2JWTA 5F08A 3OYGA 5EE9A 4XLCA 1ZXIA 2DQLA 2FMSA 4XKCA 3V6KA 3V8JA 1CEZA 5LGUA 1L7OA 1D8YA 3ISPA 3C5FA 4NLCA 1SWVA 4R8HA 4B4CA 1QPMA 2CUJA 1OLTA 1DPRA 3OS2A 2YMQA 2HOFA 1S72I 9ANTA 4BDZA 4I27A 1WJBA 2F48A 2XAUA 4YR3A 1ETKA 4HSTA 1SL2A 5E3NA 2D1HA 3ZMZA 1T3QA 2COBA 4KA4A 3HKZA 2DA6A 4BWMA 1G4DA 1HW1A 1ZD3A 5FD6A 3DPUA 1HCRA 3MGVA 1P7DA 4OJOA 5J6XA 2CO5A 2VA8A 5TZVA 4DL5A 2ZJ2A 1S10A 4IRKA 1LDDA 5J0PA 1JKRC 3IC7A 4DFJA 3OMYA 2XC7A 5JUMA 3IV5A 2DLLA 1KQ9A 1ZQKA 3PNVA 1SWWA 5L1MA 4DZJA 5F04A 2H09A 5KFJA 1ODDA 1O08A 4J9MA 1COKA 3ABTA 1S97A 5EE1A 3WTTC 2BOLA 4B8XA 4U0YA 2MU2A 5J2CA 5L3FA 4B47A 3AKZA 3AL0C 2HHUA 4LG0A 1DOQA 2HVIA 3QRFF 4NBQA 2CQ7A 2TCTA 1BPZA 3HILA 3EUKL 3V42A 1JJ6C 2UUZA 4QZDA 3AU6A 3GFMA 3A01B 4ECZA 3NASA 1N5XA 2VC1A 4GC6A 4MFCA 2CH0A 2LYCA 5LHIA 5FKOA 1P4AA 4QZIA 2ZNYA 3G1MA 2OEHA 1WI3A 3T0YA 2EAMA 2LHTA 1XGNA 2IP2A 2O61A 1UG2A 4UUVA 1AROP 3HUGA 3KE2A 3DBHB 1STZA 2M8GX 3HHHA 5LHGA 3JPSA 4DFMA 2TDXA 4UAWA 3BG9A 4GDFA 2R8KA 5DLGA 2AO9A 2JRZA 1KU7A 3M7DA 1UHMA 3L2WA 3RJIA 2W85A 2JPCA 3WE3A 2KKOA 4PUSA 1SFKA 3WU0A 5KFKA 4HQEA 5J2DA 2PFPA 1LB2A 4RAGA 3RPUD 1AHDP 2AS5F 1RYSA 3J80Z 3RJGA 7ICGA 2A3VA 5BNGA 4G6QA 4Q5SF 3BDPA 5HR6A 1C20A 3BR3A 1LEAA 1MW7A 2R92J 3GUDA 2G08A 4C2TA 4EGYA 1MBKA 1N48A 2CUZA 3OL3A 1X9WA 1MQ3A 1Y1VJ 3E6BA 4RUCA 2VN2A 3ZXSA 1EH6A 2F6CA 2EB7A 5IP9J 5GADJ 1LNWA 1TWGJ 2VQGA 3KEOA 2K85A 3BR2A 4YIFA 5GPCA 4P5OA 2ZCWA 3HGGA 4MQ9F 2EZYA 5KFPA 3E0JB 2ZFWA 2RDPA 4LITA 2Z7JA 8ICUA 4XONA 7ICSA 3BG6A 5F1RA 2GLEA 2W7NA 4JYKA 5D5XB 4CZCA 3HSRA 5B66C 2WAEA 4IS7A 1B9NA 3I59B 5DEQA 2X4HA 3Q8MA 5ALIA 2EAOA 3O2PE 4GCVA 1UCRA 4G7OF 4XRSG 2EBIA 4F52A 1HF0A 1P7IA 4G6TB 2PMZC 2P81A 2ZO4A 2BKEA 2YMLA 4O3SA 2PMZN 2VA3A 4R8UB 2EFPA 2K9SA 2M4GA 1ZG3A 3FF5A 3G6XA 3EZ5A 3D2NA 4DLGA 2DK8A 2V4RA 3IUOA 2Q0OA 3Q0WA 1Q1VA 5KK1A 2WFAA 1H8AC 1F5SA 2F8KA 2LFBA 9ICAA 4D0PA 5H6RA 1Y88A 2W9MA 3L09A 1HKQA 5ILSA 4PH5A 4PHEA 4I2AA 4C2UA 1HDPA 1D1CA 1HSJA 3BY6A 3DKYA 4DYCA 2HW3A 5K5OA 3LVWA 2RQPA 4KMOB 4KT5C 1SV4A 2HHXA 5ALUA 2CW0F 3HKZC 2NVTJ 4IOAF 3Q8SB 3WTZA 5DGBA 2HU9A 3KLOA 1B59A 3SFIA 3L3FX 2X48A 2V9PA 1NK2P 2KG5A 2C2EA 2KPMA 1UG0A 2ZSHB 2KLOA 3ERMA 5DUKA 5HDGA 1JKOC 3OGUA 3DEUA 2DKZA 5EWEA 1V85A 3ONNA 5EWGA 4L9TA 3PO4A 3ZN1A 3IRQA 4UUSA 2EILH 2WC2A 2MRLA 4M3FA 1A0PA 1ZD4A 3JPQA 3M9OB 1ZETA 2BHZA 3SENA 4YEJA 3CCYA 5DTDA 3BZ6A 4YVZA 4IVNA 3FYHA 3VYUB 2VBZA 4DSFA 2F5VA 1VTNC 4AYBC 2KN7A 1B4FA 2JSPA 4FETA 4XOTA 4JBAA 4XRMA 1KTQA 3DU6A 2YB1A 5KFNA 5FRMA 1N78A 4Y2XA 1MBJA 4DF8A 5AI4A 4DJAA 3E7LA 4ECVA 2JV3A 3LSPA 4BQAA 1XWLA 4KLUA 5DG9A 3PO3J 2O0YA 5FLXZ 4IO9F 1S9FA 3BCAA 2EQRA 4A6EA 4EM1A 2E2IJ 1NOMA 3HL2A 1VQ4I 1V9PA 3RJFA 2RAEA 5CLSA 3T5KA 1NZPA 2DKXA 3MMYB 5AKEA 3GFKB 2PG4A 2QGUA 4MEYA 2CW8A 1T8EA 2GA2A 2X1CA 2FSWA 5KFMA 4I28A 4UARA 4UBBA 3HX0A 3SZGA 4RQNA 1R00A 2IGNA 1L8OA 4CUGA 4IRGA 4I2JA 1FJLA 2LRDA 3RTVA 2K86A 3V8KA 1HLVA 5DYMA 4DQSA 2QF7A 3JCUC 3AL0B 2RC4A 3CCJI 4ELVA 2RHFA 1HQCA 1YJ9I 2L5YA 2XHKA 2XKOA 2QQ8A 1G6NA 4C4TA 4CCNA 2YY6A 2XF6A 2K02A 1ZQRA 2R0QC 4KMUX 5EJCA 2Y30A 5ALTA 2DOFA 8ICCA 3T79A 3N4MA 4FBUA 2D6FC 5J8FA 3C23A 3GLLA 2DQRA 2XCAA 3E5QA 4IRCA 4O5VA 5J0YA 1W7PA 3M07A 2XSDC 4DYQA 2XY6A 2K4BA 5DCFA 1PJRA 3MKYB 3ZN0A 3WU2C 1TKDA 1T6SA 4IXAA 1BGXT 1VQ8I 2EAPA 1XX5A 2NNNA 3NWSA 3T8RA 1ZQBA 3GFLA 3GV8B 5D4RA 1YIJI 2P6RA 2OWOA 3COAC 2HI3A 1XU4A 4EENA 3EUHC 2IVMA 2YSRA 1WWXA 5E1WA 3F5EA 3H0MB 1X2MA 1BIAA 2QARA 4AIHA 2WTFA 3SDGA 5CPRB 1ZD2P 3DTEA 5JVTA 2KOBA 1L3TA 2RV8A 3WODF 1P2FA 1VQ7I 1SZPA 3C1DA 5ERIA 4MQVA 2FUG2 5KFFA 5CVUA 3HOZJ 1ZARA 3KD3A 1IV6A 2YB4A 2BEOA 2R18A 2O9LA 4M9HA 4XBFA 4RPZA 1FT9A 1SD5A 4HF1A 3K2AA 2Y0SA 4QZEA 3F8BA 2FE3A 4ECSA 2KMUA 4YG2A 4XQ8A 4QWAA 1XSPA 2LREA 1MIJA 4DYRA 2GIVA 4R63A 2KP6A 5AM2A 1BIBA 2YX7A 4NJ8A 3MR3A 2JN6A 5B3SH 3GZFA 9ICJA 5FP0A 3QE9Y 2HOTA 2W82A 2VBYA 5FO5A 3CW2C 2R7SA 4ELUA 2A1JA 4W1UA 3E0FA 4UB8U 1NK0A 1YG2A 4LG3A 1WSUA 5H2FC 1ONVA 1ZQWA 2Z2SB 4CCHA 3LSMA 1SVLA 1W36C 5AM1A 5E3LA 4CSWA 1A77A 1VNDA 3BQTA 2L7MP 3CJRB 3RB0A 4PJMA 2AQEA 1U49A 1ZQIA 3MDCA 3I4MJ 4UVBA 2OCCH 3GEZA 4ZH4A 3KKAA 3OIOA 4Z6DA 2FBKA 2MSYA 2IHMA 8ICFA 1I5ZA 2I8DA 5E3OA 1FLIA 2FU4A 1O3TA 1U5TC 2CRGA 1QRYA 2EV5A 5HLGA 4V2GA 5HVQC 5K7FA 1V55H 1R5HA 3WTYC 1WWUA 4O5EA 1Z6RA 3DF8A 3PMNA 1Q3VA 1ZQXA 3GX4X 5DGAA 2FEZA 2LMDA 3MZ8A 1E3PA 1TZLA 3HDDA 3PX4A 3H0LB 4NHJA 3QZ7A 3PM1A 3KBBA 3GXOA 3TDZC 1X6JA 3FKIJ 4LLGF 1RXVA 2VOPA 1WUDA 4BXOA 1HUOA 5G5GA 2HBMA 4O3MA 3DBRB 1J5YA 2A05A 4HZFA 1ZRDA 3GTGJ 4RQ8A 1HUZA 3PW4A 2NYVA 5KHDA 3TQNA 3LWFA 1S5LC 3IKVA 3VOEA 1ZQYA 4J9RA 4GLXA 2CWEA 3OYMA 4ENMA 5IT9Z 1UQVA 1J7KA 2W54A 5ALFA 2JK3A 3H9QA 4ASNA 1O4XA 5CKTA 3RJJA 2V9WA 5FJ8J 5DB9A 3WK7A 1Z7UA 1NK7A 1MNDA 7ICTA 1Z21A 9ICTA 3KP7A 1BR2A 3LSKA 4IRHA 3SZPA 4BBRJ 1YZ6A 5AIBA 2IPQX 1AKHA 2ISPA 1S0VA 4YXMA 2LBFB 1FIAA 2DA5A 3HKZN 1JTYA 2EIMH 2NS7A 2VJ5A 4DBQA 2HGCA 3WGHA 1S7OA 3JSPA 1SEUA 2CV1A 3M3YJ 2JMGA 2P5KA 2QB1A 4RNMA 2M9HA 2GLOA 2R4GA 4PK4A 4MEXF 5BOLA 2M1BA 1OYWA 2E1CA 4HNUA 1LDKB 3GFIA 3BR6A 5LD2C 4P1WA 4CYDA 2IHNA 2VJJA 2ASDA 2HMXA 2HBLA 1ZQTA 4F55A 4B9VA 3IHUA 1R36A 5HDKA 3DU5A 3C1YA 4MIMA 1H88C 3F2DA 1LDJA 2NVYJ 3G1OA 5FLXK 1CI4A 3Q8LA 3BQYA 1XS9D 2BHNA 1G59A 4G7HF 1UA1A 4KTQA 2R8HA 1UHWA 4CZZA 2G5HB 2ZIUA 4DFPA 5E1XA 3L2QA 3D2SA 4EM0B 1IDYA 2VOOA 2LY1A 3BOQA 1REPC 4JOMA 3E58A 3WHBA 2DA3A 2O8XA 4UAYA 4CA0A 1NJWA 4L9NA 4RDUA 1RESA 3N28A 2ME6A 3KEYA 4PGYA 3MABA 1RC9A 1J0RA 3C2BA 4CCMA 3DFGA 5DCMA 2WF7A 4UW9A 4O0IA 3I53A 1U8BA 8ICEA 2K9QA 2L01A 1S76D 2AHQA 2ZTDA 4EX7A 2W9BA 4A12A 4FO6A 4AC0A 3EYZA 1UT8A 1YW9A 3RZOJ 1ZQEA 3KZZA 4B9MA 3PY8A 1ZJMA 1L3SA 2XASA 2WA0A 1TV9A 1F44A 4EMSA 4FQGA 8ICXA 3GBGA 1R58A 2R7FA 3DLLF 3E5UA 4E7IA 1QZEA 3CLQA 2JXJA 2BQUA 1YLFA 3H1CA 2WY7Q 3RJPA 2Z5UA 4U7BA 1X6IA 5KAFU 2OAZA 3UMBA 3G6YA 2CN1A 3TGNA 5L1LA 4DL3A 1PYVA 3DTIA 4QJFB 8ICTA 4F5QA 4BQOA 5AM3A 3RRHA 2PJPA 3HGYA 1HA8A 2QKLB 2HHQA 2IRFG 1YI2I 2KFZA 1ZQQA 1RYRA 2XSJC 2HOQA 2XGXA 1GXPA 1WJFA 4DIQA 2ES6A 2L2OA 3EW9A 1S5LU 4XLPF 5AKKA 5EWFA 3EPGA 2M5WA 4JV1A 1QVUA 1JKQC 4DOAA 1PUEE 2MH9A 3H8JA 1V5GA 2XKPA 5EZHA 3ISBA 4LZGA 2ELJA 2K89A 3CCMI 3MCZA 3A0HU 5KFAA 4EX6A 3OHBA 4LZDA 1Q3UA 1U47A 4AUXA 2QBYB 1Z77A 3K69A 3J81j 4DS4A 4J9OA 1TQIA 2OA4A 4OWRB 1TC3C 1B6AA 4M6WA 1R23A 3IRUA 3D5RC 3V7KA 3CDHA 1PVEA 1Z4OA 3TMOA 1YYVA 2BY0A 2OQRA 2KDZA 1SKSA 1RPLA 4C8KA 3SQIA 5DBBA 4K4IA 4FX4A 2OYYA 2MW8A 4R65A 2NVXJ 4RQ7A 3ISDA 1ETWA 2YU3A 4J00A 1JI8A 4KN7A 4KLQA 3WK9A 4QZHA 1D1AA 2JZYA 1TWAJ 1OCCH 1UMQA 5J8YA 5KCMA 1ZQVA 1WCNA 1DRGA 2L4MA 3JAMZ 3K2ZA 1HW5A 2FLNA 8ICJA 3TKYA 3CRXA 2EJRA 9ICPA 3HIFA 1IJWC 3KZIU 1JN3A 5L1IA 2ODGA 3TW7A 3BZCA 1IIPA 4KLFA 2XAHA 1LKYB 3QZ8A 4JWMA 2VLAA 3JRGA 1P4WA 2RVCA 4L5IA 2X6XA 4RS8A 2X6OA 1XGMA 2VQHA 1ECWA 1W4MA 4P4OA 3F2BA 4PJLA 3KYCB 3ELKA 1AU7A 1PVRA 2XRLA 1IN7A 3AG3H 2DOEA 2Y0MA 3S3NA 3PJRA 4QWQA 9ICGA 4C8NA 5LFAA 1IGNA 3T1BA 3S14J 4HAIA 3HJEA 5ALWA 2F77X 3H35A 4ZDPA 2VPLA 4KIFA 1NTCA 4YMOA 4I2EA 8ICWA 8ICNA 4LB5A 3FX3A 2DPUA 2XCPA 2G09A 2ALZA 3KIOA 1ETVA 4LB6B 1XS9A 2L54A 2JT1A 3CUQB 4CICA 3QU9A 3PR5B 3WGGA 1G8XA 1VQ5I 3CESA 1NK3P 2WB1C 2XAQA 2CUFA 3OYHA 2HOAA 8ICMA 3I28A 2HKXA 5KG1A 2DFIA 3LSHA 2RN7A 5K5QA 2K4PA 5ALXA 3MFHA 4DQIA 4OAZA 4EJTA 5AI6A 1IRFA 4Q4ZF 1H9TA 4UVCA 4UAUA 3I3LA 1NK5A 2B6GA 2JEFA 1S29A 3KETA 1JE8A 2ZMEA 5BQTA 3MR2A 1ETOA 5DKWA 2HNHA 2BY2A 2PQ8A 4E7LA 3CTAA 3GO5A 4F4ZA 5ED4A 4WJ3B 4OO1J 2KRFA 4D7MA 2IS1A 2FA5A 3EETA 1CF7B 3Q3SA 2OTJI 4QZBA 1P6RA 3B0XA 3I58A 4QWEA 3Q8KA 1T38A 2BVLA 1EV7A 2E1EA 3WKEA 5AK3A 2B7EA 3F5AA 4F5PA 2W9BB 2BGWA 2W3SA 1GUUA 3OSNA 3V7CA 3OR1C 4ENKA 2E1OA 2Z3YA 5DBAA 5J2JA 1BI3A 2BCSA 3NVVA 4QWDA 5J1YA 2WF6A 5KL1B 2R5YA 3WU1B 3S16J 2ZIVB 2ZMEC 1RR7A 4C80A 4F4XA 3PSFA 3GTOJ 1HEKA 1X1AA 2KDOA 2CFOA 3S2WA 1D5YA 1ZQUA 2FJ6A 5BOXA 4Y2YA 1BPXA 1N2XA 4DQPA 5EGOB 3GTQJ 2IOFA 1Z1DA 3IH4A 1R4NB 2Y9TA 4M71A 3JPNA 3X2QH 1LQ1A 2FI1A 3M8SA 4NLKA 1R4MB 3BWGA 3H92A 4KLGA 2RP5A 1X9MA 8ICZA 4PGGA 1XDSA 4RGRA 4P9FA 3ZQ7A 2IEKA 2E1MB 4B9LA 3OS0A 2Y9YA 2W24A 1K4TA 3BCBA 1KU9A 1IC8A 3KHHA 2DQNB 4O3RA 5HMMA 8ICYA 2HDWA 4PJJA 3ECHA 2K9LA 5CJ7A 4BEHB 2VKDA 5HLHA 4DCCA 4IHTA 4PL2A 1LFPA 3ORYA 1R71A 3F21A 3TFSA 2FRHA 1DGSA 4II2A 5L1JA 5D4SA 2H94A 4HNVA 3PZPA 3QQAA 1N5WA 2K5CA 4M74A 2QB0B 1T39A 4N9HA 4M6WB 3LK9A 3RH4A 2PMZA 1BI2A 5J29A 4C3JJ 2EZXA 3BTJA 2XPWA 4GXOA 4PHPA 3PO5A 1MSWD 5TGTA 5IY5H 2EIKH 4A3DJ 2DK5A 1Y56A 3V8LA 1K7AA 3MN2A 1Z00B 2K8CB 4ACOA 2PFBA 4G8XA 1KDHA 4O5CA 5L9XA 2E60A 4DNCA 3J81K 4EBEA 9ICCA 5J0RA 1P9QC 3LAPA 2M8EA 1O3SA 1HW2A 2IOHA 1L8LA 1ZQGA 1FPQA 4PGHA 1TAQA 1NK9A 3HM5A 5IP7J 1IXRA 1V5EA 3D5LA 2EZKA 3VYRB 4JP0A 2GXAA 1A6IA 1DP3A 3TADA 1BJZA 1I1SA 2CQXA 2PLYA 4XLEA 3QAHA 4OJ6A 4BE2A 2XGDA 4AIDA 3BQ0A 2HZDA 1X42A 2EIJH 4KLEA 3JRIA 2JMWA 1Z6TA 4YIIA 3F22A 4IQJA 2HHSA 3BG3A 4MGRA 2M30A 4PCQA 5D5VB 1TNSA 2IGKA 2Y69H 4QLCU 3QNMA 2UV1A 3WE2A 1JXEA 3NRWA 1JUPA 5BOMA 4BY1J 3K1MA 3G6VA 2Y0SC 1WJDA 2PBIA 2FE9A 2D45A 4HG2A 3NQOA 1X3WB 3LNQA 3ERED 2I1QA 4IEJA 3SV4A 8ICHA 4I2CA 2P5VA 3A03A 4ZYHA 3IDWA 3N7SC 1O7LA 3SEQA 1MGTA 1FO4A 5EF6A 2EH9A 4KLOA 1DUXC 1FP1D 3PUBA 2PFNA 4NXZA 3JAMK 3CNHA 5H20A 4A2UA 5JLXA 4BHBA 3D2QA 1OUQA 1APLC 2LMRA 4PHAA 3A0HC 2MUTB 4IQWA 2JH1A 3BS7A 2OBPA 4A3IJ 3TEDA 1R5ID 8ICPA 5LLQA 4MFAA 3VODA 1J97A 4DGWB 2KVCA 3SXYA 3S3MA 3WU2U 1NKBA 1KN5A 5HS8A 5ICFA 5ICGA 1U8RA 3QOPA 5DB8A 3ZCOA 2HPIA 4EEFG 5AICA 4BS9A 3F3XA 5AKXA 4FS2A 4NLGA 1JRPA 4QTRA 1X1BA 5BPIA 9ICLA 3S15J 1CGPA 4KYWA 4A0XA 2ZIXB 2EWNA 3TACB 3DP7A 3FISA 5KFOA 5HOOA 4MTDA 1EH8A 1ZAOA 3C18A 3ABUA 2MD5A 1HDDC 2BCRA 3HWTA 1RXWA 1L0OC 1ULYA 3VCBA 4ZDLA 2HBKA 2QA4I 2V79A 3GLXA 1HOMA 5AIAA 3EDPA 1I3AA 1UFMA 2ZJQF 4Z6FA 3MR6A 3K4MA 2DF4B 2VJ4A 4TQRA 3GV5B 3QU2A 2DOAA 4G9YA 1SD6A 2L9RA 3VYTB 1VLBA 3WGIA 3G3ZA 4GFJA 3RKWA 5AK4A 3MAJA 2FX0A 1FOWA 3FBNB 3QPSA 3RCOA 4X5VA 4GYGA 4WX9A 3HOTA 3GVAA 5KTQA 1TT5B 2DT7B 2IA0A 3JSOA 5DQGA 5IIIA 1SL1A 3IN5A 2RDIA 2VODA 5DDYA 3W6VA 2ZSIB 4IRIA 2NVUB 4RQ5A 3FIWA 2ECCA 1A76A 2LNBA 1RQNA 3OS1A 4UBCA 4ED1A 1KKXA 4B44A 1E17A 2KIWA 3Q8PB 4A93J 1QTMA 4F2SA 4IOCF 2KQRA 3TAPA 1PVQA 4C7YA 3BS5A 5KFEA 4EJUA 1N63A 1X9XA 3CZ6A 2RDJA 1JHHA 3P9CA 1V4RA 2HQNA 4QIWC 1AQ6A 5AKZA 4XRHA 1ZQOA 1FOKA 4XORA 3PW5A 4RQMA 1VDVA 2J6TA 1IG6A 1JTXA 3QODA 1IF1A 4RQ6A 4KN4X 4HAMA 5EEGA 3RZDJ 1ZQ1C 2CQKA 4J9PA 1DGRM 1BL0A 1Z00A 1S8OA 2C22A 2OCEA 5KAIC 2W11A 1P4XA 4BXUA 3OYNA 2JH7A 3WTUC 4KFCA 1XD7A 3LWLA 4G6DA 4BH9A 3MZHA 2OXOA 4MF8A 2Y48A 1JUMA 2JR5A 2XIGA 1V5FA 4GO1A 5E8GA 2GZWA 3ZQIA 1C0WA 2M87A 1FTTA 2OHFA 4O9MA 1FSEA 2L3DA 3QX7A 4JWNA 1YX5A 4GC7A 3FAHA 2AXTC 2Q8KA 4YELA 4O3PA 1ZQSA 3C3WA 2BPGA 3ICXA 2E2JJ 2KIMA 1N77A 4DWIA 4R8UA 2VBXA 4DOZA 1ZQJA 4M9LA 1T08B 1F36A 4F7ZA 2LKPA 2MLGA 2ZC2A 5K1YA 3KCCA 5AI0A 4O3QA 8ICOA 4OINF 5KFLA 5KNLA 3UXNA 2BDUA 1SD4A 1YW8A 1I39A 2A69F 3KKAC 3H4BA 3RR8A 4P0PA 3C2GA 1ZQNA 1XSDA 3H36A 2UXXA 4D7NA 1LKYA 1UELB 1WHUA 4ICAA 4ECWA 2KTQA 3RKQA 5AK6A 2K40A 1ZR4A 3GU3A 5JVGF 5ALZA 1PUFB 1T56A 5B1AH 4XKVA 5GPAA 3HB9A 3SJMA 4A3FJ 4E7JA 5DLFA 3LSGA 1I50J 2KP7A 7ICFA 2ECBA 4U87A 1H38A 3IKTA 1D5VA 2JHDA 2KEYA 2YU9J 1JI7A 3KHLA 4HDVA 1NI3A 3SD7A 4QIWN 2H8RA 2XY5A 3TANA 2IBKA 2ETHA 4LJXA 1K78B 2MSNA 1FOYA 5K5RA 5AI8A 1YTYA 1VQOI 1JGGA 1T0FA 4OIPF 1S8NA 3K75D 4UB5A 1QU3A 3NVYA 3CD6I 2HVSA 1W5SA 5GAGJ 2ZUDA 3RB4A 3AG1H 1E2XA 3E5XA 3HPHA 1CUKA 4US8A 2MYSA 4XRFA 3TKAA 1ZQAA 1YO5C 1VQLI 2MAXA 2V4JC 6PAXA 3FM9A 1IN5A 4HYKA 5EE3A 4LLNA 4HF0A 4DBRA 2DT6A 3F2CA 2BQRA 1X19A 4IF4A 3P7NA 3M1YA 5J8CA 2R7DA 1NG6A 1GXQA 1XGOA 1Q46A 3CLOA 4IQVA 3IV6A 3MBYA 5BS6A 4L0YB 2VE9A 4CH7A 4WK8F 2FPMA 2BPCA 4L9JA 1M1EB 2XF7A 4PZNA 4US9A 3H3VK 9ICWA 4I2FA 3IP4B 4BQQA 2JPBA 1OW5A 4P4MA 3QEBZ 4YFKF 4JB3A 4J01A 2W43A 4IR1A 1MJBA 4RA2A 4Y52J 3LOCA 3N7RC 2L7FP 4ZOHC 4RZRA 4IZZA 5L1KA 4HLXA 3TP3A 3SZ2A 2BBYA 3EUB2 2P4WA 4MTEA 2LKXA 4LIVA 4C3IJ 4UAZA 2FLPA 2KRCA 7ICLA 1FYKA 4EZ9A 2LYHA 4I29A 5CRXA 2VC0A 1TK8A 4WF2A 5EEHA 5EE0A 3A02A 1VQKI 3ABKH 4HX8A 1ZRNA 3MR5A 4PGXA 1ORKA 2ASJA 2XICA 1WG8A 3GZ6A 1ZN2A 3PSPA 4IHXA 5EEAA 3MGIA 5GAEJ 4NB5A 5J2BA 3FWEA 4Y2QA 2KVSA 2A5WA 3FXJA 4M9ZA 4YFNF 5TJJA 4QZFA 1RETA 3C5GA 2BE5F 4DL6A 3VB2A 5HDNA 1MH3A 1M6YA 1VQ9I 2LBOA 5DB7A 2R93J 1QSSA 2ID3A 2OZUA 4IHVA 1ZOLA 1D0YA 4BWJA 2QSGX 1YQAA 3BJYA 4HX4A 2DU9A 5GP9A 2HWVA 2DI3A 1KFDA 1Z67A 1X1PA 3LL7A 1WJAA 2LOOA 3R60A 2ZJ5A 1Z4NA 2KE7A 1PVPA 3PVXA 5E18F 4LG0B 2QQ9A 3K4JA 2Z33A 4A3MJ 1J2XA 4WXCA 4E70A 3HHGA 4G7ZF 3NARA 2EANA 4ZYGA 4CF5A 5A2QZ 2ZTCA 4DQRA 4KIBA 3V4GA 2PFQA 4QW8A 1KYZA 3KPHA 2BPFA 1EH7A 4OU0A 4BU2A 1NKCA 4CCOA 3C29A 3A01A 3UKGA 1BNOA 3IL2A 1WPKA 3M6KA 2GOLA 4I2OA 2DFHA 3PFIA 3TO9A 3PSIA 1L5UA 4BUGA 1NHAA 2V6CA 2FLLA 2FQ4A 4R1HA 1KLNA 5ALGA 1YT3A 4RQ1A 3HP6A 4FZMA 5KT5A 3K1NA 1NK4A 4B43A 3UPQA 2A1JB 4I2BA 4YFXF 7ICQA 3FHNA 1OJLA 5J8YC 3RSNA 3DTKA 4MHGA 1N60A 2NS0A 4XUSA 2Y1JA 4Q8FA 2ESNA 3S1MJ 1IRZA 3BQ2A 1TAUA 2WHEA 3L9FA 1J09A 5CP2A 3GIMA 3FXUA 2FBIA 2P66A 1NKEA 4DEZA 1YFHA 2IGMA 5AK5A 2PMHA 2WBMA 2LI6A 4HRIA 1NZBA 4M9JA 1IAWA 1RKTA 3BJOA 2PEXA 3BR0A 5C0YA 4XM3A 3SV3A 2KZVA 2KZ3A 3EUAA 4ETSA 2K8AA 4JK1A 4A6DA 2JZBA 2Y31A 2W1OA 4QPQA 1D8JA 3ABLH 2UVVA 2VT2A 1GV5A 3BQ7A 2GXBA 2LTPA 4BJ5C 4XNFA 2GOMA 1L3LA 2V9VA 3LA3A 2RNJA 3PX0A 2M7BA 3VWBA 4EELA 3QP6A 3LSRA 3HOXJ 3AN1A 1D0XA 1IN4A 1B0XA 4B6JA 5AONA 3T5JA 2JTVA 5HNFA 1B1BA 4C7ZA 2CRXA 3AQFA 2A3SA 4B9NA 3BROA 1BBYA 1POGA 5B5EC 2RNGA 2OM6A 1U45A 3D5SC 1D3YA 4RAFA 1SFUA 2A61A 1R1UA 3G4SI 2WY8Q 1S9HA 4MFFA 2RQQA 1OCZH 1OMIA 4B3XA 2CU7A 1QVTA 1OCOH 2DTRA 3BG7A 3G73A 3DCFA 3J7AY 4AP9A 3AUOA 3U1KA 1RI7A 2KT0A 2Z99A 1SMTA 4ZYDA 1Z0XA 3RJHA 3E6CC 2IW5A 1V38A 9ICHA 4Z6YA 3J7AO 2V26A 3VSLA 5JFRA 4ABZA 2AH5A 5ALPA 1UJ8A 2E7XA 2OUMA 1T3NA 4A3JJ 1F0MA 1F1ZA 5LRRA 4CF4A 5M5XJ 4ESJA 4IHWA 1IW7F 1K79A 4HW0A 4Y2TA 2CMPA 2WADA 4HV6A 4BL0B 5JTIA 3JRCA 5J0UA 2W55A 3I55I 1OISA 4ED6A 1RR8C 3HXLA 2HYFA 3FXMA 4RGXA 5D8LB 3HTUA 5JR3A 5L3EA 5LHHA 2KKPA 2F5DA 5E8IA 4JX6A 1VFCA 3CYMA 4NLZA 2KJCA 3OWTA 2J6UA 4DL4A 3M9NB 2XPVA 1SZHA 2ZUBA 1XGSA 4HSRA 3AEVA 3RDIA 3HEFA 1FIQA 1XG1A 2PXIA 2CXYA 1ZQZA 5DDGA 3UXPA 3P5JA 3K0LA 4D1QA 5DB6A 5E20A 1KA8A 3DWLE 1SD7A 2GBYA 3KP3A 5LGNA 2L7ZA 4HLYA 3H9JA 1G3SA 1D1BA 5KFHA 1QQ6A 1Y39A 2XAGA 3CJTB 4XLHA 3HTSB 1TE2A 1UCVA 8ICLA 2Y75A 3NGDA 2FMQA 2ZJRF 2LY9A 4M9XA 3U21A 4GGGA 1ZH5A 4J19A 4E7HA 3J7YJ 5KT4A 3CUQC 4IQTA 3S2DJ 3KHGA 1MN8A 3QU3A 2GXGA 3SDBA 4QSHA 1HC8A 8ICGA 3WTVC 4LMYA 5IIOA 1U4BA 2X1DA 2WF9A 4C0ZA 2G0EA 2EZZA 4ECUA 2Q4TA 4E7ZA 2E5ZA 4AIKA 1KU3A 4M72A 4PZJA 1V54H 4F50A 4P96A 4RM2A 3CF5F 3HOYJ 3QU7A 2PN6A 1I1GA 5J0OA 1KFTA 4B9TA 3QU6A 5DBCA 2CUEA 3ZRGA 2LH9A 2EQYA 2EK5A 7ICMA 5CA7A 5CVIA 1KW4A 5KG7A 4HEA2 1Z05A 1LFBA 3RKXA 3PIOF 2HFHA 5F6FA 2D1VA 1G3WA 2DA1A 4BAYA 1UB9A 4U0WA 1LE8B 1FNNA 3QUQA 2QVOA 5IYDJ 3RJKA 2G7UA 4GRIA 1FTZA 3MC1A 5DG7A 4Q48A 3MKZA 1Z19A 3F9KA 2BZFA 2NOJB 3JR9A 1FP2A 1R7JA 5IT9K 2F1HA 5DM6F 1PUFA 3M7GA 1W7PB 4HF2A 5J1RA 1KZHA 3RYPA 3D0SA 3GTPJ 1TAMA 4XLAA 3EYYA 2PX9A 2TRTA 3OTQA 1LVKA 4F3OA 1TBXA 4M73A 2MGQA 4RU9A 1UHUA 2X1EA 2PJRB 3RJEA 2QM3A 4XLFA 4UB8C 4I01A 2NV3A 2WF8A 4XKBA 4TURA 2OQGA 3ESWB 1TTYA 5IIMA 4K4GA 8ICIA 4D5CA 5CR0A 3TAQA 2DPDA 1TNTA 4YG2F 2Y0SF 2DO7A 5L3DA 5IT3A 1LEBA 2G7HA 1O3QA 4CNQA 1U3EM 2L5QA 3S2HJ 2A6EF 2HKOA 4XMYA 3GV7B 4XQFA 2DMPA 4RAZA 3SEZA 3OYCA 2I6XA 2XIDA 3DDHA 4NM2A 2PFOA 3ZDAA 4C3HJ 2RKHA 4UASA 4GIBA 1QCKA 4C8OA 3FBIB 1PDNC 2NNYA 1B43A 4Q8EA 4OIRF 2Z9OA 5DUIA 2LK2A 2KKVA 1SFXA 3QUCA 2QYOA 5KVRA 2LKSA 2F2EA 2WAQF 5FFXA 4LLLA 5J0QA 3KP6A 1VZ0A 5IPAA 3VYSB 4RB0A 4RNOA 3RQIA 4TUPA 4DQ2A 5HP4A 2GH1A 4K4HA 2F1IA 4AYBA 3CCVI 1J75A 2QBYA 4X0GA 2VQCA 1HBXG 4I2GA 4OMYA 5ALEA 3KHRA 2YPRA 1TL8A 1D8KA 5C4XJ 4YMMA 3V6HA 4XL9A 2B9SA 3I71A 3L2RA 2UVRA 5D5UB 2B21A 2LR8A 4CYCA 1ZKGA 3PIPF 4M6VA 2JA8J 1DDNA 2LM1A 2R7QA 5J2GA 3BJ6A 5FD5A 3V72A 3RPQA 1BPDA 1ZGWA 2H3ZA 2VPRA 5DS9A 4BE1A 2E8NA 5KG6A 3VFZA 4YP3A 1VQNI 2MABA 1G2HA 3Q0UA 1OYIA 1L7NA 1T4GA 2YQEA 3SAHA 4O5KA 2F5FA 2W25A 4L9VA 3CO7C 1SV0C 1SL0A 2LPEA 2CV2A 2EFOA 2MFZA 3K4CA 2M34A 4MLOA 5CQGA 4C2MJ 1TW2A 3B6AA 2HVQA 2VL8A 4I99C 1BVSA 3I76A 4RT3A 1K61A 2FPLA 4UB2A 2ME0A 2OV7A 4B48A 3HT3A 1IXCA 2DFEA 2VBWA 2X9DA 3KP4A 2CGPA 3THVA 9ICSA 2FXAA 2ZIWA 1TK0A 4M47A 3I4PA 3OYKA 2B0LA 2G9WA 3ZMVA 4G94A 5IOZA 3OY9A 3P9IA 4RQ2A 2JA6J 1MBHA 2F5EA 1VI0A 2LSOA 5J4YA 3H0GJ 3LWMA 3HBLA 1A6QA 2KIUA 3NVZA 3HOWJ 5F64A 2JEIA 3M1CA 1ZD5A 4PJ0C 1Z91A 2JQ7A 4UB1A 1S7EA 3QYEA 3ZD9A 3EPIA 2YX4A 5L3BA 1YOVB 1RUOA 5HLIA 2HQRA 1GHCA 2BYVE 1UPHA 1RRJA 2JGAA 3SZTA 1VQ6I 1UHSA 1G3TA 3M9AA 1L3VA 3BDDA 1WQ2A 3LVVA 5ALJA 3A4CA 1W1WE 1OCTC 1XMXA 3ED5A 3BPXA 3U2RA 4P0QB 3KOOA 2JVHA 4EZ6A 3F72A 4I0BA 3K1ZA 2WTEA 1PK3A 4QZAA 2DFLA 4M3EA 3Q5FA 1RM6C 3SYTA 5DQHA 2A1AA 1YJNI 4I09A 4F8RA 1KFSA 5FRNA 1ETQA 1NK6A 4ELTA 2A07F 2MA3A 1W0TA 3L4PA 4JK1X 2E1MC 4KN7X 2EFWA 4M9NA 3NWTA 5B5EU 1L6NA 2I10A 2QB0A 1HKSA 3ZOBA 2DMNA 4OIOF 4QZ9A 4ZZLA 4UV9A 2XC9A 3ZQCA 5J2AA 1NJZA 2RLTA 3C2LA 2WWYA 2KJ9A 4Y3OA 2GAUA 4UV8A 2BHYA 4U6PA 2V1NA 5CEHA 2R8GA 2R7XA 2X85A 4I2IA 3BPVA 1BPBA 1ZGJA 1WYGA 2LM4A 4CCJA 4ZYEA 1P92A 4PSXA 4UATA 1TT0A 4F4WA 3GYHX 3OPXA 1ZHFA 5FKLA 2MC4A 1XSLA 2NRXA 3HOSA 2D3DA 3WKBA 4Q45A 4HYEA 3TW6A 4LJZF 1TFRA 2MG4A 2L4AA 3TBIA 4M3BA 4Z2YA 3C2HA 2DBBA 2PMUA 2QARB 2C6YA 3K7AJ 4DLEA 5E79U 2H3IA 3I56I 2DA4A 2QENA 5KFIA 5D4BA 3F6OA 7ICVA 2ID6A 3TARA 4KLTA 3RAXA 1WH7A 2MD0A 2XPUA 3ZPLA 2GO7A 9ICQA 2FNPA 1T0FC 1ITYA 1BI1A 5J2FA 3GDXA 5JHUA 3OSGA 2MH2A 1F43A 3GF2A 2UZKA 1FOXA 2KICA 4O6JA 5HS9A 1QO0D 3ZMTA 2BV6A 1U0JA 3N05A 3UNGC 1WCLA 2QKQA 5AI9A 2FBHA 3AU2A 7ICRA 2PMZF 5DQIA 3MEXA 3ZQFA 2G0AA 3PX6A 5J0XA 4KICA 4KX5A 4N4OB 2FDRA 5AM4A 1XDUA 3I5UA 5AM5A 2EPFA 4YQWA 5IIKA 1S7AA 3IM1A 3KLNA 2H1LA 2JUCA 2DCEA 4L0ZB 5HMLA 4BXFA 5LEKA 4M0AA 7ICIA 2DFFA 3DQVC 3HG9A 3K4GA 2KV2A 2A19A 3KEQA 4ANJA 4IJAA 2ZNZA 1ON1A 4EJWA 2P6SA 2P0WA 4WXDA 1LPQA 2VASA 1ZQFA 1T2KA 4B9SA 3HRTA 4UXNA 3ZQQA 1NJYA 3CJQB 2XGEA 3R61A 1X4OA 4H4KC 3FDSA 3QXGA 2O5RA 1ZQMA 2XVTA 3S3OA 3QUBA 3H8MA 2ASLA 2JZBB 4DOBA 2V7FA 4II3A 3F6VA 4G9BA 1BC8C 4EBCA 2ADUA 1BPEA 3LFKA 1KRPA 4C9YA 2LLKA 3M8FA 2ZUCA 5KT3A 1U2WA 4C8MA 3BTLA 3FMRA 2V6EA 4WCGA 3N97B 5C5JA 2BY3A 2DL0A 4YMNA 4P2HA 3GMEA 3NTUA 2KL4A 1C7YA 3B02A 2FMYA 3SHFA 4IHSA 2E1FA 3W3CA 2M45A 5J2EA 4O3NA 4ED8A 2HVHA 1U78A 3ZDBA 2W8LA 1MKMA 1RKWA 3S93A 2KJ8A 5GTIU 5KFWA 1Y1WJ 2P7VB 3BLYA 3FMQA 3GILA 4XR6A 2KHVA 1RYUA 1W5CC 2K3PA 3F8CA 5KFVA 1SAUA 4P0QA 3HRMA 3J81Z 2COMA 3CCRI 4A3CJ 3ASOH 3PQKA 1JT0A 2HXOA 1WKMA 3R0JA 1SANA 3M4OJ 4UB6U 4A69C 1I3QJ 3MQ0A 1USTA 5ALNA 2W57A 4IKFA 5DDMA 2VJIA 2DW4A 2J6SA 1XTAA 4P0PB 3ZQGA 1WZ2A 5J2IA 5EYRA 2F44A 1OCPA 5BPDA 3MWMA 1T94A 4FE4A 4KISA 4NWIA 3S8PA 4ECXA 4Y2PA 1O7FA 2XY7A 3A1YA 1ZQDA 4I0AA 4B09A 3H3ZA 4G12A 1QSYA 4JV0A 5KFCA 2NXNB 4QZCA 3OHAA 1Z3EB 3RH6A 2NRZA 2XVCA 4JUZA 3C7JA 5KG5A 2V1XA 1J2NA 1FBUA 1T95A 1WCMJ 2ZIUB 3KP2A 1IRGA 2Y9ZA 3T5LA 2EZIA 2AXTU 1MMNA 3ABMH 5G5HA 3IH3A 4Y2RA 2DJNA 5CVRA 4A0ZA 2E36A 2FQ3A 1AA7A 5J0WA 2PI4A 4D5FA 5L3GA 2H8WA 4L5JA 3R6SA 3HC7A 2D5VA 4DZPA 2AGOA 1LVAA 3CP8A 1VJ5A 2DODA 2QKMB 2M0CA 3WTSC 3LMMA 3OYLA 1FFUA 3RB6A 1IXRC 2JRMA 5LRSA 5EG0B 1BN5A 3OOUA 3G71I 5HHIA 2GM4A 4UB3A 4WWCA 2A68F 3OR2C 4YXJA 2BGCA 4IQUA 1Z7LA 3HSEA 4HV5A 1T7PA 2KSOB 9ICEA 2EFQA 2D8CA 3ZD8A 3MZYA 1GVDA 8ICVA 1HXDA 4Y15A 1LKXA 3HYIA 2XROA 4CHUA 2R7TA 2R7VA 2HXIA 1DGJA 4CE6A 1X1CA 4I6ZA 1BM9A 5C4JJ 1B8IB 2NO5A 5HLTA 5E79C 3VC8A 4B1RA 1X3UA 2EINH 2QUFA 3F8NA 5BMZA 3PV8A 1MMAA 1CQTA 2VIXA 3FK7A 4RB1A 4XICA 5BPCA 1LE8A 1E0EA 2ZJPF 5DM7F 2BCUA 9ICNA 3MFKA 1RZTA 1DK2A 2W03A 2Q2EB 5JHFA 2K4HA 4PSWA 9ICRA 2DN0A 1MC8A 1O57A 1ZK8A 2DTZA 3HRSA 4LIUA 5CHGA 1N56A 3J80K 1PZNA 4UB6C 4KDPA 5AKLA 2JSCA 4RUAA 2XGCA 1R9TJ 1IN6A 5M5WJ 4NLBA 3K4KA 1F4KA 1P7JA 2HEOA 4UB4A 3LSTA 4BNCA 3GIIA 2V9KA 1DK3A 3FM3A 4A3KJ 2O3FA 2OZ6A 1KQ8A 2M3AA 1FMWA 2VONA 2K4JA 2K9MA 2NOGA 3V7LA 2W8KA 2VE8A 2HZTA 2F5CA 5EDNA 2CS3A 3S1RJ 2I5HA 4BDPA 2HHWA 4MO7A 1Z9CA 1L3UA 1ETYA 5FKNA 5HHHA 1FIPA 1R6RA 2QSHX 1TQMA 3EWAA 2NS8A 1XMKA 2YUSA 1FYLA 5ILUA 5JRTA 3OJSA 1YX3A 3OL4A 2K9NA 3H3UA 4AM3A 1D0ZA 4UQGA 3W2VA 2EA2A 1U9OA 3K9TA 2VUMJ 3C28A 5F1JA 2H3FA 2OH2A 4LVSA 4F71A 2DA2A 1JGSA 4HNTA 1HSTA 5JI6A 3HOVJ 3ZI4A 2L02A 2IJLA 1JKPC 5J1UA 4Y13A 3FC4A 1OPCA 2EZLA 3LSIA 3AQEA 3WK6A 3QYBA 2A6TA 3WHCA 4BHCA 1B72B 1XO1A 1ZGAA 3QU4A 4KLMA 2XI9A 3QOEA 2KFNA 1H9GA 1VF9A 3HRUA 4NM1A 2ISZA 3M6ZA 5B1BH 2A6HF 4Y2SA 2YTUA 1QHHD 2HR3A 3GTJJ 1LV5A 2LP0A 1I27A 1GV2A 1A04A 3K70C 2EA4A 7ICUA 4XSZF 2OTLI 4JV2A 1H0MA 1OR7A 2G07A 1XSNA 3PL8A 3KX2A 2JJ7A 2VANA 3CUQA 4FISA 3VPRA 1RDFA 5ALRA 4U7CA 1USSA 1FWZA 2K7LA 3U1DA 2GA1A 4FBTA 4BXOB 2KJ5A 4RGUA 1FMVA 1ZTRA 3T5XA 1XC9A 3KYDB 1KQQA 2E8MA 3FKJA 2HDOA 1KYWA 3ULQB 1MDMA 1ED1A 4J9SA 4A8EA 2MBFA 3CMYA 5H6QA 2YMMA 1RPWA 2X0LA 4LFUA 1BC7C 4EEKA 4DL2A 3S17J 1QQ7A 3S32A 3WKAA 2UVUA 4U7DA 2DMQA 4I2HA 5ALQA 2ZKZA 4YR0A 5KL8B 4ZDOA 1ZJNA 5AKGA 1B22A 3F0CA 4ZZDA 3KP5A 5KFTA 1E3HA 2K4IA 2M7AA 2R7UA 5AKHA 4YCXA 3RBDA 4EV0A 1RUNA 4R64A 7ICPA 2FF4A 5L3CA 1TW3A 1CF7A 3M1EA 2WAQC 1MBEA 1FC3A 3BT9A 2VXZA 2HHTA 1U5TA 1TLHB 3ETRA 4D9JA 4DSEA 1BNPA 4P4PA 3OYAA 2F3NA 1XSXA 3GW2A 2EH3A 4IRDA 1WFXA 5E1ZB 5KFSA 5AIPA 3GTMJ 1WWVA 4ENJA 4IR9A 3TL4X 4XK4A 4YR2A 2XRNA 2OC6A 2E5NA 3KTQA 4YIRX 3U26A 1MQ2A 5HR7A 5AIQA 1MD0A 2ISOA 2KJBA 2LY2A 3BJAA 3LQQA 4X1EA 4A3LJ 2DMTA 2F8LA 2KNJA 4AYBF 4CGZA 1Y0UA 5FLMJ 2ISYA 3IRRA 4BE0A 1K6OA 2K8BB 4RQ4A 5EOZA 3O8GA 2WAQA 2NYXA 4N9IA 2QQBA 1EXNA 3HSFA 3DBLB 1YW7A 3I0TA 2ACJA 3RF9A 1FEZA 4YD1A 9ICOA 2O7OA 2V1UA 5AKJA 2HOSA 2L9SA 2KIFA 5HNHA 3OYDA 1ZQPA 4V2FA 5IINA 2AJQA 3MFIA 1NJXA 4N0BA 4BJTA 4ZJZA 4BACA 2Q2EA 5HS7A 3CC4I 3LAJA 5DCMB 4LGWA 3V7RA 2C2RA 1QZYA 4BJ6C 4TUQA 2ELHA 5KFGA 3RH5A 1YS6A 4OJ5A 2QQAA 3CQZJ 5K7HA 4AWXB 4OIQF 2EDUA 5KFYA 3NAUA 3NRZA 3IWZA 3JPOA 1WRJA 4UVAA 4AYBN 9ICFA 4HBLA 4MFEA 1IO2A 2HYGD 3PFYA 2GOXB 2KISA 1SKRA 4HX7A 3T8TA 4BJQA 1UA0A 1MBFA 3FK6A 3CO6C 4DFDA 3H0DA 2Z16A 2HYJA 5FB2A 3GQCA 2RREA 5J2KA 3RB3A 1SC7A 2IS6A 5K7ZA 1X9SA 1K4SA 3K4BA 2CQNA 3SAFA 1ZLJA 4KLDA 2OJED 4JMUA 3SAGA 2FD5A 2R7OA 1ZRCA 2FOWA 1OXJA 3EPZA 1YS7A 4RGSA 4B3AA 3IG8A 5ALHA 2J5PA 8ICRA 3E3VA 3VSKA 3K4LA 2KIVA 2KK0A 3GIKA 2E19A 4EYHB 1K1SA 2AU0A 2JRTA 2M9NA 4PPXA 3IHQB 5J0SA 2H27A 4NQWB 1Z1BA 4F93B 3N97A 1SV0A 2FMPA 3ZMSA 4BUPA 2QEXI 2KRHA 4P55A 3QEAZ 2ESEA 1JUSA 2K27A 1K5OA 4Q44A 1URJA 1XNSA 2HQAA 1OKRA 2BXZA 1YIOA 2E34A 3CDIA 5GTIC 1KL9A 4F92B 5F9LA 2VKEA 2CJJA 1GO3F 1OR7C 4E4HA 4EEYA 1DQUA 1LUJB 1DXSA 2O6GE 1ZQHA 4F4KA 4I02A 3TP0A 2OD5A 4RT2A 4DSJA 5C3EJ 3RR7A 4A5MA 4XOPA 1EA3A 3QYFA 3AG4H 1GDTA 3GTLJ 1I6HJ 4KN4A 2QWWA 4ZYAA 5KFRA 3DV8A 3PNTA 4I2DA 2C28A 3ZQLA 3SYZA 2CPRA 2HTSA 3LA2A 4NLNA 5ILVA 1S77D 4KT6A 4I7HA 1X2IA 8ICQA 4ENNA 2QLTA 3TOBA 1OFCX 4BKXA 5JU5A 5TISU 2O03A 4S05A 4KMUA 3FXQA 3E97A 3L00A 2VKVA 1X66A 1XB4A 2E71A 3DEEA 4S0HB 1LFUP 2DYSH 4KNYA 5KG3A 2NRTA 4FHTA 3IAM2 3M8RA 4V19K 1MMSA 3L5KA 2ZXIA 3LFUA 2FJ1A 4IL6U 4NUBA 4OOIA 1RQLA 3DLAA 5J3LA 1D9DA 4M9GA 4QWCA 3W6JB 4E7KA 2V4QA 1YHQI 1D8LA 1W7PD 3CP2A 4NL9C 1JUDA 4USAA 4BX9C 2E3TA 3WK5A 7ICEA 1COOA 3L2CA 3Q8RB 9ICXA 4ZTFA 4LK0F 3H5AA 4QNLA 2CSOA 2AXLA 3RKYA 2LBFA 1R49A 3H0RB 1NG7A 3C2KA 3ZDCA 4S04A 7ICOA 5FLVA 3OSFA 3WG7H 5KFZA 5E3MA 1IUYA 3A0BC 3H9GA 4DW6A 3IAS2 1XC5A 1A35A 4A3EJ 9ICVA 4RPYA 2X51A 2ATLA 5ICCA 4FT8A 3K10A 2BCQA 1R22A 3DEWA 4RBOA 2HTJA 4UAVA 4KLIA 3NRVA 4HA8A 1NK8A 4QZ8A 1SVMA 4RNNA 2JEJA 4F5NA 5KAIU 4EJOA 1UZCA 1ZRMA 1DGWY 1JT6A 3CCSI 4CDGA 2DWQA 3WK8A 4C4RA 2DGZA 3KFWX 4UUSB 4AVPA 3C1ZA 4EJVA 4JX4A 3PUFA 1WH5A 3EYIA 1ZQ3P 1GT0C 5M3MJ 2LKYA 5F3XB 2ZFUA 3RTRA 2HS5A 3G1LA 3OIQA 4IPAA 1B8IA 3JPTA 3ETLA 1JXLA 3H8WA 1IRXA 1G3YA 3BS5B 3CCQI 3JTHA 3AM9A 3FM5A 3HOUJ 1ZG1A 2UVWA 1XMAA 2L9VA 3L7WA 2E2HJ 3C21A 3BP8A 2IT0A 4KMFA 2FOKA 4F5RA 2A5YB 2AHOB 5KG2A 2XO7A 1W36D 3C2MA 3BQ1A 3PW0A 4BY7J 2MA1A 2HHVA 1SMYF 2ZIVA 4DL7A 5KT6A 3QPLA 5C44J 2G5IB 1W5TA 2WB1A 2F4OB 1MNMC 4NV0A 1F9NA 2OF7A 1IUFA 4NC6A 4AVZA 2HCFA 3Q8QB 3DPLC 1T8IA 1XSVA 3IH2A 2HSZA 1RIOH 2C2DA 2CQQA 3H5NA 4C30A 1X1DA 1N62A 5D5WB 2W9CB 3JRDA 4C4SA 4AU7A 2STWA 2DPJA 3L1PA 3R4KA 1RZ4A 2N8GA 5TISC 1OQYA 4AD9A 1JXSA 3DXJF 4GXKA 3UQ2A 4DSIA 2L9NA 3PR4A 2IA6A 1Z3XA 4GFBA 1QLNA 4RB3C 2IXSA 4PFPA 5H2FU 1IXSB 4BQNA 5CJ9A 1FBSA 1U9NA 3W2WA 5LGTA 5ALOA 2DAOA 4WXHA 2JEGA 3JW4A 3MKWB 5ALDA 4NY8A 2H6CA 5CB1A 1YITI 2J5OA 3GFJA 2IAIA 1EKEA 4RB2C 3DV9A 3OYEA 3UMCA 3T5HA 3RBEA 5LBQA 3CJNA 3MD2A 3F23A 3FXKA 1ZELA 1QPIA 3J7ZI 3UR3C 1JALA 1WJEA 2ZB9A 2L0KA 2H1KA 3ZQHA 2K60A 5AKIA 4ITVA 3JPPA 3OOPA 4KIGA 4X6AJ 1BOBA 2UXNA 3A0BU 2NRWA 4LK1F 4R79A 1QH9A 3HZJA 4OMZA 3AG2H 5D49A 1BI0A 4B9UA 2XB5A 2BVMA 2XAFA 5IYCJ 4XRSA 2F2AB 4M6YA 4N4NB 2HOIA 1SAXA 5FKMA 3VEPA 4FFDA 3K6GA 4RMNA 1DPUA 4FASD 2ZXWH 4NC7A 4Y2JA 1S3JA 4TUSA 3TI0A 3W2AA 2NRVA 4M04A 4M3GA 2E1NA 2RQ5A 2KD1A 1AOYA 3M9MB 4FE3A 2YX8A 3WKCA 1XN7A 3JRAA 3G2BA 2KIQA 2BCVA 5FGMA 3S6JA 2XUBA 3KFUF 1ZYQA 5FFZA 4KUMA 4LOCA 1GLNA 1AWCA 1QQ5A 1FZPB 4J9LA 1QSLA 3FXRA 2WB1F 5DG8A 1QHGA 3CMMA 4E6KG 2OPTA 3JTGA 3QUTA 3RAQA 2R5ZA 3ZP5A 4K2EA 2DYRH 2B0CA 1A31A 3D6JA 2R7WA 4J9QA 4ED7A 1KGSA 5K4LA 3OSPA 3OYIA 2WV1A 2BW3A 2W04A 2BZTA 3B73A 4CYCB 1SIJA 4MEXA 3GTKJ 2PI5A 1XPXA 5ALMA 1IV8A 2LF7A 5ALSA 4IL6C 2R8JA 4HPQA 2P5LC 2MUTA 1XCVA 2XAJA 3HPOA 1ETXA 1TVAA 5KFBA 1B72A 4H0EA 1Q1HA 3CC7I 3M8EA 5M3FJ 3S1QJ 1MBGA 2LC2A 1U5TB 1KBUA 1OYYA 5GAHJ 3ROUA 3CC2I 3L2UA 3IG5A 3TO6A 3TADC 5IP6A 2Y2ZA 1PUZA 5KNIA 3OJUA 4XSXF 3ZGKA 1SKWA 4DSKA 1O03A 2AQ0A 4A0YA 4XN0A 4EYIB 9ICKA 1SB3C 1HIWA 1K1QA 5IIJA 2JUGA 1S6LA 3UMGA 4YFKA 1BR1A 3O8HA 2IS4A 4EATA 3SI8A 1YRNA 3TOAA 3PQJA 3B9JA 4QWBA 2HOEA 5KFQA 4RLQA 3CUOA 4ED0A 1UT5A 8ICBA 1MZBA 1V3FA 5ALLA 4ECQA 2XB0X 3FHZA 3K4NA 1MDMB 1WJCA 5ALVA 4ED2A 2B63J 5J2HA 3IWFA 3WKDA 4DS5A 4EBDA 5JLWA 1DP7P 4FTHA 1DU6A 1TWHJ 2KMDA 4Z6CA 4PJNA 5IYBJ 3MKLA 3AAFA 1VQMI 2JA5J 3WG9A 3R9KA 1F5TA 1N25A 3B6CA 4O3OA 1YE9A 1Y8RB 3LQRA 1X40A 1S0MA 5D8KB 3BC8A 3E2EA 2DJIA 2VKHA 1WGXA 2KHQA 2O6KA 2ZJ8A 1ZR2A 8ICAA 4Y33A 2YMPA 3FZVA 2R5YB 4FS1A 4ZH4F 1J59A 4Y2UA 5KAFC 1JIHA 3DKWA 3KZIC 3QWLA 2P35A 3PNYA 3FDYA 1ZQLA 2GWRA 4PDKA 1MNEA 5F0FA 4Y17A 5EGOA 4J03A 5J40A 4E7SA 1K83J 1KEJA 3I1YA 1K6YA 1JMSA 5FROA 4F3QA 3RFAA 1N75A 4U88A 2W48A 4GXIA 1TK5A 2BR0A 2VA2A 3OYFA 2FPKA 4IHYA 9ICBA 2WB1N 1R1VA 1PK1B 3FXLA 2JA7J 2H6BA 1X58A 4W97A 5TRDA 4EVIA 3H4DA 4UUTA 4OAYA 4IX7A 1X3ZB 5GTHU 2UWMA 1MA7A 1RNLA 3K1PA 1JHFA 1FY7A 4U0VA 1MSEC 1J9IA 3QU5A 3H5RA 2IBDA 3H7IA 4KX3A 1X4PA 4GYIA 7ICHA 3B0YA 5ALYA 1BJAA 1KQ0A 4NQWA 2L7KA 1IZ1A
chains in the Genus database with same CATH topology
3E0FA 2WAFA 1T95A 4LG3A 2ZIUB 3SMVA 2M4KA 3N7RC 1MMNA 2Z2SB 3OYBA 4IZZA 3LSMA 1W36C 4QIWF 4CSWA 1AA7A 3CJRB 3HC7A 4LIVA 2AQEA 4PJMA 2KRCA 1MMDA 3CP8A 2QKMB 2I8DA 3LMMA 3OYLA 4IQ4A 2XICA 3OOUA 5HVQC 2M0MA 3CF2A 3HUGB 3PSPA 3OR2C 1Q3VA 1Z7LA 2VKQA 1KONA 1TZLA 2A5WA 3H0LB 2R7TA 2R7VA 1LKXA 1X1CA 5HLTA 1WUDA 2VQLA 3VC8A 2F4IA 2LBOA 1MMAA 2HBMA 4O3MA 3OIPA 1D0YA 2VIXA 2X6WA 5KHDA 2XDVA 1E0EA 3OYMA 3OYJA 3H9QA 5CKTA 3LL7A 2W03A 1WJAA 2LOOA 2Q2EB 4PSWA 5JHFA 2K4HA 1PVPA 2CW7A 1MNDA 4LIUA 4CCLA 3K4JA 1Z21A 3LSKA 1BR2A 2LBFB 4NLBA 3K4KA 2VJ5A 4DBQA 2AQFA 2HMXA 2LYBA 2V9KA 2JMGA 2CV1A 2LYAA 4BU2A 2W7OA 2M3AA 1FMWA 4CCOA 2R4GA 3C29A 2K9MA 4PK4A 3M6KA 4QPOA 2GOLA 1A6SA 2CS3A 4HNUA 1LDKB 3PSIA 5LD2C 4BUGA 3DPTA 4P1WA 3NUQA 1R6RA 2VJJA 2HBLA 1YT3A 4F55A 1Y6IA 2ZIXA 4FZMA 3DU5A 1YX3A 3OL4A 1UAAA 3F2DA 3N7PD 2KHMA 1BR4A 4ZTJA 4B43A 1D0ZA 2ZXHA 1G59A 2E5SA 3W2VA 2ZIWB 3FHNA 2G5HB 2ZIUA 3C28A 3L2QA 2H3FA 2OH2A 3RSNA 3D2SA 3DTKA 4HNTA 2H3QA 2LY1A 4JOMA 2M0NA 2CV0A 4CA0A 1WJ5A 3KEYA 3LSIA 1J09A 3AQEA 2JVGA 3QYBA 2A6TA 4CCMA 2XI9A 3QOEA 2HVRA 2IGMA 2WBMA 1NZBA 4HRIA 3M6ZA 5C0YA 3A2KA 2VXDA 4XM3A 1QHHD 2KZVA 3EUAA 2K8AA 1F44A 2WA0A 3K70C 2H3VA 3GBGA 2W1OA 4QPQA 4E7IA 3F53A 5CRXA 1ERDA 2G07A 2WY7Q 4U7BA 3PL8A 3KX2A 4BJ5C 4XNFA 2GOMA 4FZNA 2CN1A 1PYVA 3DTIA 3L2VA 4QJFB 4U7CA 4BGDA 2M7BA 4BQOA 3VWBA 4FZLA 2KJ5A 1FMVA 1HA8A 2QKLB 1D0XA 2R7RA 3FKJA 1CRXA 1ED1A 5HNFA 3M8JA 2CRXA 3AQFA 4A8EA 4XN3A 4ZC3A 2XSJC 2HOQA 2OM6A 2RNGA 2LG4A 1WJFA 2JA2A 3D5SC 4DIQA 2L2OA 2N1RA 3S32A 2W4SA 2WY8Q 1S9HA 5KL8B 1V5GA 2RQQA 4KJZA 4B3XA 4ZDOA 2ELJA 2G06A 2K89A 4BDYA 1Q3UA 2W00A 2M7AA 2R7UA 2K4IA 3BG7A 3ZR8X 3J7AY 4OWRB 2WAQC 3D5RC 2VXZA 4F91B 2V26A 3VSLA 3TMOA 4D9JA 2OUMA 3OYAA 3SQIA 2F76X 2OYYA 5CQEA 4IC9A 2PJRA 1WFXA 4J00A 1JI8A 1D1AA 2K4EA 3TL4X 5KCMA 1DRGA 2CMPA 2E5NA 2OC6A 2WADA 4BL0B 5HR7A 3CRXA 3VDXA 2LY2A 2F8LA 2Z1DA 3HXLA 4AYBF 2KNJA 2KKPA 4CGZA 2K8BB 4BE0A 5A0LA 3CYMA 1MMGA 1IIPA 3OWTA 2WAQA 2W7PA 4Y4RA 1SZHA 4HSRA 3RF9A 2VLAA 1XO0A 4OJPA 2X6XA 4CRXA 2L9SA 4NNJA 5HNHA 3OYDA 3O0FA 2VQHA 1ECWA 3I9V2 3F2BA 3PSTA 4PJLA 4BJTA 4YRVA 4ZJZA 4BACA 4D1QA 4BEHA 3DWLE 1PVRA 3AFHA 3KYLA 3S3NA 3H9JA 3PJRA 5T14A 4BJ6C 5LFAA 2BW3B 1D1BA 2F77X 2RRDA 4OJ5A 3ALRA 3H35A 4XLHA 4ZDPA 2VPLA 3DKXA 3E1SA 3U21A 2G09A 2HPMA 4E7HA 2VB6A 3PFYA 2GOXB 2IGOA 3SDBA 4BJQA 1G8XA 3CESA 2WB1C 2X1DA 3H0DA 4KITB 4C0ZA 2Z16A 4JQFA 2Q4TA 4E7ZA 3LYSA 3OYHA 2E5ZA 4PL1A 2RREA 2IS6A 3LSHA 2X6YA 3K4BA 2DXIA 3SAFA 4JMUA 3ONQA 4OAZA 2R7OA 4RM2A 2IS2A 3SAGA 3IG8A 3EPZA 4RLFA 3ZRGA 4NC8A 2LH9A 3HPGA 3I3LA 3VSKA 3K4LA 4RM3A 2Q1ZB 2HBJA 4HEA2 3KZXA 3K70D 3RQ4A 2HNHA 4NQWB 2XF5A 4F93B 4E7LA 1Z1BA 4BUPA 4GRIA 1Z19A 1Z3YA 2IS1A 3MKZA 2KRHA 4WJ3B 3F9KA 2NOJB 3HKZF 1URJA 2ZG6A 1XNSA 2HQAA 4OJLA 2BVLA 2E1EA 3F5AA 4F92B 1TAMA 4XLAA 4XKWA 1GO3F 1LVKA 1OR7C 4E4HA 4PFOA 4CCKA 2X1EA 1DQUA 3OR1C 2PJRB 3OYGA 4XLFA 4XLCA 2NV3A 4XKBA 4XKCA 5KL1B 4NLCA 2ZIVB 4XOPA 1EA3A 2CUJA 3PSFA 1OLTA 3QYFA 3OS2A 1X1AA 2KDOA 2CFOA 1HEKA 4BDZA 2Y0SF 1WJBA 2HOFA 2XAUA 4ZYAA 3PNTA 4HSTA 2L5QA 4XMYA 2CPRA 4XQFA 3HKZA 3OYCA 3SEZA 2RP5A 2XIDA 3DPUA 4KT6A 3MGVA 1P7DA 2E1MB 3OS0A 4OJOA 3BCBA 3FBIB 2DQNB 2HDWA 4PJJA 2K9LA 2KKVA 4BEHB 2VKDA 2WAQF 3OMYA 4PL2A 2XC7A 1LFPA 3DEEA 1VZ0A 3VYSB 3IAM2 2GH1A 3PNVA 4II2A 2ZXIA 3LFUA 4AYBA 4NUBA 4X0GA 3DLAA 2VQCA 3PZPA 4E7KA 2K5CA 2BOLA 2PMZA 3CP2A 4BX9C 3AKZA 4B47A 4XL9A 3AL0C 3L2RA 5TGTA 4ZTFA 3H5AA 4QNLA 3H0RB 4ACOA 1Y56A 2LBFA 3EUKL 1NG7A 2R7QA 2K8CB 3V42A 2H3ZA 2E60A 2UUZA 3H9GA 4BE1A 3IAS2 1P9QC 2X51A 2CH0A 2LYCA 2MABA 3K10A 3SAHA 1V5EA 3D5LA 1DP3A 3VYRB 2LHTA 2CV2A 4MLOA 2MFZA 3K4CA 5CQGA 4OJ6A 2HVQA 2VL8A 4XLEA 4BE2A 4P0PA 1DGWY 2HZDA 4CDGA 2OV7A 2DGZA 4B48A 3M7DA 3L2WA 4IQJA 2ZIWA 4PUSA 1SFKA 2IGKA 3OYKA 2LKYA 3OY9A 2ZFUA 2UV1A 3RTRA 3RPUD 3OIQA 3NRWA 1D8BA 1IRXA 2A3VA 2Y0SC 1WJDA 5HR6A 4HG2A 1MW7A 3M1CA 2G08A 4C2TA 2CUZA 3OL3A 1W36D 3N7SC 3QYEA 3SEQA 3ZXSA 2MA1A 2F6CA 2ZIVA 2JGAA 1UPHA 2VQGA 3PUBA 2G5IB 4P5OA 2WB1A 3E0JB 3D2QA 3LVVA 4LITA 4AVZA 2Z7JA 3A4CA 4XONA 4NV0A 3BG6A 3DPLC 1OUQA 2W7NA 3H5NA 4C30A 4CZCA 2JH1A 4P0QB 1X1DA 2WAEA 2JVHA 3K1ZA 4DGWB 2KVCA 4AU7A 3S3MA 3SYTA 4F52A 5FRNA 4G6TB 3ZCOA 2HPIA 2PMZC 4BS9A 2L9NA 1X1BA 1Z3XA 2M4GA 2E1MC 2IXSA 4PFPA 2ZIXB 3D2NA 3NWTA 3IUOA 4BQNA 1L6NA 5HOOA 3W2WA 3MKWB 2KJ9A 4Y3OA 3VCBA 4ZDLA 3OYEA 4U6PA 2V1NA 2HBKA 4C2UA 1D1CA 3DKYA 3MD2A 1ZELA 2R7XA 3UR3C 2X85A 1WJEA 3K4MA 2DF4B 2VJ4A 3LVWA 4ITVA 4CCJA 1BOBA 2DOAA 4PSXA 4KMOB 3VYTB 1TT0A 4R79A 3HKZC 3OPXA 4GFJA 2HU9A 2MC4A 3HOSA 2BVMA 2F2AB 3L3FX 4N4NB 3FBNB 2HOIA 3RCOA 2KPMA 1UG0A 2ZSHB 2KLOA 3K6GA 4RMNA 3HOTA 3TBIA 4FASD 2DT7B 3C2HA 4NC7A 3ONNA 3IN5A 3W2AA 2MRLA 1A0PA 2ZSIB 2H3IA 2KD1A 4FE3A 3OS1A 2YX8A 4YEJA 4B44A 2KIWA 3G2BA 2MD0A 2KQRA 1PVQA 3KFUF 3VYUB 1T0FC 2F5VA 1GLNA 4AYBC 2WB1F 3CZ6A 2JSPA 4FETA 1QHGA 3CMMA 4XOTA 4E6KG 2YB1A 3DU6A 4QIWC 5FRMA 1N78A 4XORA 2KICA 4DJAA 1U0JA 3N05A 3QODA 3UNGC 2R7WA 2PMZF 2G0AA 3OYIA 3BCAA 2BW3A 2W04A 4KX5A 3HL2A 4N4OB 1ZQ1C 1DGRM 3MMYB 2JH7A 3OYNA 2DCEA 4HPQA 4BXFA 2CW8A 2OXOA 2X1CA 3DQVC 3HG9A 2KV2A 1V5FA 3SZGA 2LC2A 4ANJA 1KBUA 3IG5A 2IGNA 2P0WA 3L2UA 2VASA 4CUGA 3ZQQA 2LRDA 1YX5A 3CJQB 4H4KC 1X4OA 4YELA 2O5RA 3ZGKA 2XVTA 3S3OA 3ICXA 4XN0A 3AL0B 1N77A 2V7FA 1HIWA 2RHFA 4II3A 2JUGA 4DOZA 1BR1A 2IS4A 4EATA 4CCNA 2XF6A 4C9YA 5KNLA 2BDUA 4RLQA 2V6EA 3C2GA 3T79A 3K4NA 1WJCA 1UELB 4ICAA 2D6FC 3GU3A 2KL4A 2E1FA 3W3CA 4PJNA 4XKVA 1PJRA 3MKYB 4E7JA 3LSGA 4OO1J 1YE9A 4U87A 3S93A 2KJ8A 3BC8A 3NWSA 2JHDA 2DJIA 2VKHA 3BLYA 2KEYA 2KHQA 4XR6A 4Y33A 2KHVA 2K3PA 3EUHC 1SAUA 4P0QA 3H0MB 3F5EA 3PNYA 3FDYA 5CPRB 1QU3A 1MNEA 3DTEA 2KOBA 2HVSA 4E7SA 4IKFA 3HPHA 1K6YA 2FUG2 2VJIA 5FROA 1N75A 2MYSA 4F3QA 3RFAA 4P0PB 2V4JC 2YB4A 2R18A 3OYFA 4DBRA 2DT6A 1T94A 3F2CA 2Y0SA 4KISA 1X19A 4NWIA 3S8PA 2KMUA 1NG6A 4OAYA 4IX7A 2LREA 2UWMA 1MA7A 3A1YA 2KP6A 4CH7A 2XF7A 3H5RA 4KX3A 1X4PA 3GZFA 3IP4B 4BQQA 2W82A 2R7SA 2L7KA 4J01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEE A; 
#chains in the Genus database with same CATH topology
 5KFD A;  3CME I;  2AGQ A;  3UXO A;  2WAF A;  3ASN H;  2I5U A;  3MGH A;  8ICK A;  3SMV A;  2M4K A;  3V6J A;  1D8B A;  2V1D A;  1TWC J;  3OYB A;  4DO9 A;  2ZBK A;  2GQQ A;  4QIW F;  4J9K A;  1FFV A;  3AMZ A;  3UQ0 A;  2QCO A;  4CO8 A;  3LSJ A;  3SR6 A;  5IIL A;  3CCU I;  1MMD A;  5CVV A;  4KLH A;  1T98 A;  3NS1 A;  4L18 B;  1YZ7 A;  2LDU A;  3I59 A;  2E7W A;  3SEI A;  2E35 A;  4IQ4 A;  4FX0 A;  4F4Y A;  3SFZ A;  2MC3 A;  2M0M A;  3CF2 A;  2LF8 A;  3HUG B;  2BY1 A;  3FXO A;  4M6X A;  4RPX A;  1R5G A;  1QZZ A;  4L5E A;  4MNU A;  2PI0 A;  3BR5 A;  1HKT A;  1HJP A;  2VKQ A;  3LA7 A;  2O8K A;  1KON A;  3PW2 A;  2LD5 A;  4BBS J;  3K1R B;  1YJW I;  2BDP A;  2YS9 A;  2STT A;  4E0D A;  2HDD A;  1EJ9 A;  1O3R A;  2DA7 A;  5DV5 A;  2EZH A;  4XID A;  1LB2 B;  2IOF K;  5F0H A;  2IA2 A;  3CCL I;  1NNL A;  2ZXJ A;  3MVP A;  4DF4 A;  2VQL A;  3RIR A;  4HDU A;  2W3R A;  2F4I A;  3EUH A;  3TO7 A;  3Q9S A;  3H8S A;  3HRD D;  4PHD A;  1D9F A;  4M2Y A;  4HQM A;  4KLL A;  3OIP A;  2KZG A;  2KZM A;  1B4A A;  4PGQ A;  3RPU A;  3S1N J;  2X6W A;  2XDV A;  1ACI A;  3OYJ A;  2QZ8 A;  4TV7 A;  1ON2 A;  2P8T A;  4KLJ A;  2Y1I A;  1BA5 A;  2ICW G;  2CW7 A;  4M3D A;  3RYR A;  4P9U A;  4CCL A;  3Q9V A;  1QQI A;  2ELK A;  3QPT A;  4PJ0 U;  1ZRF A;  2NAZ A;  3FMS A;  3GWZ A;  2AQF A;  4MFD A;  2LYB A;  7ICN A;  3BQZ A;  4MEY F;  2LYA A;  2IMW P;  1GVJ A;  2DDA A;  2M2E A;  2FNA A;  5B66 U;  5D46 A;  1SFE A;  2W7O A;  5F27 A;  1H89 C;  1IN8 A;  1ENH A;  1DU0 A;  2OU2 A;  4QPO A;  3JPR A;  1A6S A;  2Y9U A;  1BW6 A;  5ALK A;  2NVQ J;  4RQ3 A;  4I98 B;  1FSH A;  4MF2 A;  3DPT A;  2R8I A;  4J9N A;  3NUQ A;  5KT2 A;  2KZZ A;  5CYV A;  4RAY A;  1MH4 A;  3ECO A;  1Y6I A;  3O6B B;  3QYP A;  5J0T A;  2ZIX A;  4PZO A;  4ESF A;  5D6E A;  4Y2V A;  1XCB A;  1UAA A;  3N7P D;  2KHM A;  1BR4 A;  4ZTJ A;  1NH3 A;  2ZXH A;  5AKY A;  2E5S A;  1RG6 A;  4BYY A;  2R3S A;  2ZIW B;  1IDZ A;  4F5O A;  4CXF A;  4UHT A;  2WV0 A;  2H3Q A;  3TDU C;  2ZME B;  3I4N J;  2EV6 A;  2M0N A;  2CV0 A;  3GZN B;  4C8L A;  5D6F A;  1S0O A;  4CF3 A;  1WJ5 A;  1SFO J;  3EQL F;  2JVG A;  2WAQ N;  1SXE A;  2XV4 S;  2VT3 A;  1J2M A;  1KSP A;  4ECR A;  3UM9 A;  1WI9 A;  3REO A;  3RI4 A;  2HVR A;  1BOA A;  1PP8 F;  3BG5 A;  4Q47 A;  5E17 F;  3ISC A;  2LVS A;  1SGG A;  3A2K A;  2PKE A;  2VXD A;  5KG4 A;  4TQS A;  5EZG A;  2DDB A;  5J4V A;  1B9M A;  2AGP A;  1U9L A;  2H3V A;  1QNT A;  3Q0V A;  3I64 A;  3GCM A;  4RQ0 A;  3F53 A;  3BR1 A;  1Y0N A;  2D2W A;  1ERD A;  1PK1 A;  2NO4 A;  3ML6 A;  5A2Q K;  4FZN A;  5LEJ A;  1MJA A;  3L2V A;  3BTI A;  3ZMD A;  4A3B J;  4FE7 A;  4A3G J;  4BGD A;  2DUY A;  3NVW A;  4FZL A;  1A5J A;  4YN4 A;  4FCY A;  4F2R A;  1ZG5 A;  5HOD A;  2R7R A;  1CRX A;  3E6D A;  1FYM A;  3D1N I;  1W0U A;  3MDA A;  3M8J A;  2MLK A;  4XN3 A;  4ZC3 A;  1FBQ A;  3NEU A;  1ZRE A;  4UY8 I;  2LG4 A;  2QLZ A;  2JA2 A;  4NDL A;  3BZK A;  3V7J A;  2HDC A;  4I76 A;  5IOY A;  2N1R A;  4ED3 A;  3QP5 A;  3LDA A;  3HW8 A;  2W4S A;  4HOB A;  2F1J A;  4KJZ A;  4DOC A;  2NRA C;  2G06 A;  1VQP I;  4BDY A;  2W00 A;  5HNK A;  3ZR8 X;  2DBY A;  3TQ1 A;  4Q43 A;  4OCZ A;  1U6G A;  2BQ3 A;  1QGP A;  5KFU A;  5AHX A;  5KT7 A;  4F91 B;  4OD0 A;  1MSF C;  1LVH A;  2ZTE A;  1QA6 A;  5EG0 A;  4ECY A;  4BXX J;  1I6X A;  2F76 X;  1ZYR F;  2Q0Z X;  5CQE A;  2P6U A;  2PJR A;  1V97 A;  4IC9 A;  5F9N A;  3T3F A;  3OV8 A;  5DD4 A;  4YD2 A;  1KU2 A;  2K4E A;  2KSO A;  1L7M A;  1E3O C;  1SXD A;  3JRB A;  1OCR H;  9ICI A;  3VDX A;  1EF4 A;  3E6M A;  1QBJ A;  1BW5 A;  2W9C A;  2P6T A;  2Z1D A;  4G3I A;  3GZ5 A;  3BTC A;  3JRE A;  7ICJ A;  4Y7N J;  4KLS A;  5CWR A;  3ZMU A;  1T33 A;  1TWF J;  2GIZ A;  5A0L A;  3R0A A;  1JRO A;  1MMG A;  2W7P A;  4Y4R A;  2KFD A;  4DQQ A;  4R66 A;  2K3F A;  3N4M B;  1MJ9 A;  4ON0 A;  3PW7 A;  1XO0 A;  3WTX C;  5DD8 A;  1R1T A;  1PP7 U;  4OJP A;  4CRX A;  4NNJ A;  3O0F A;  2W9A A;  2Y0S N;  5F0C A;  4BHP A;  3I54 A;  4EQQ A;  3I9V 2;  4ESB A;  3PST A;  2R7Z J;  4EM2 A;  1ZQC A;  2BXY A;  2ESH A;  4YRV A;  4XA5 A;  2DPI A;  4BEH A;  1TQP A;  1JX4 A;  3G6E I;  1IM4 A;  3AFH A;  3P9K A;  3KYL A;  1Q8K A;  2XGQ A;  5T14 A;  1S0N A;  2DT5 A;  4M9S A;  1N61 A;  2RGV A;  2BW3 B;  2EV0 A;  5GTH C;  2RRD A;  1FEX A;  3F8M A;  3ALR A;  1K78 A;  8ICS A;  2WF5 A;  3DKX A;  2HI0 A;  3E1S A;  3SQN A;  5ICE A;  2HPM A;  5J47 A;  3H40 A;  4XLN F;  2EFN A;  2VB6 A;  5M5Y J;  3CMA I;  4DFK A;  2I9G A;  1SVO A;  2YN4 A;  2IGO A;  4A5N A;  2VI6 A;  3RRG A;  2CG4 A;  2DMU A;  1LJ9 A;  3GIJ A;  3V7S A;  4KIT B;  1A36 A;  4JQF A;  3LYS A;  4NL9 A;  4PL1 A;  4AIJ A;  1BPY A;  2F4M B;  5AM0 A;  2X6Y A;  2DXI A;  1TP4 A;  2H5X A;  1Y8Q B;  4F72 A;  2QSF X;  1IG7 A;  3ONQ A;  2IS2 A;  9ICM A;  1Z1V A;  4QW9 A;  4RLF A;  2HQ5 A;  4NC8 A;  4LD5 A;  3JRH A;  3HPG A;  3WK4 A;  3ZDD A;  3O3K A;  4RM3 A;  2Q1Z B;  2YR2 A;  4EGZ A;  1YRN B;  2HBJ A;  3U9G A;  5KG0 A;  2ZJA A;  3KZX A;  4Z6E A;  1X2N A;  3RQ4 A;  3K70 D;  3JRF A;  2E8P A;  2P7C B;  3TFR A;  5KFX A;  3CCE I;  5AI5 A;  9ICU A;  2XF5 A;  2FML A;  3QPH A;  3CDL A;  3W6K B;  1Z3Y A;  5FKK A;  2XGP A;  2R5Z B;  3F8F A;  1L7P A;  2IA1 A;  3HKZ F;  3PML A;  1FX7 A;  2ZG6 A;  4MHV A;  3ZDE A;  1U48 A;  4OJL A;  7ICK A;  4JX5 A;  1ZLK A;  2AQ4 A;  2CFX A;  2E8O A;  3PO2 J;  5CVJ A;  3PNC A;  3KZY A;  2CYY A;  4GXJ A;  4ECT A;  4XKW A;  3WTW C;  2W84 A;  1JJ8 C;  1AKH B;  4UNO A;  4PFO A;  4QZG A;  2GWS A;  1WVR A;  4CCK A;  4DSL A;  2JWT A;  5F08 A;  3OYG A;  5EE9 A;  4XLC A;  1ZXI A;  2DQL A;  2FMS A;  4XKC A;  3V6K A;  3V8J A;  1CEZ A;  5LGU A;  1L7O A;  1D8Y A;  3ISP A;  3C5F A;  4NLC A;  1SWV A;  4R8H A;  4B4C A;  1QPM A;  2CUJ A;  1OLT A;  1DPR A;  3OS2 A;  2YMQ A;  2HOF A;  1S72 I;  9ANT A;  4BDZ A;  4I27 A;  1WJB A;  2F48 A;  2XAU A;  4YR3 A;  1ETK A;  4HST A;  1SL2 A;  5E3N A;  2D1H A;  3ZMZ A;  1T3Q A;  2COB A;  4KA4 A;  3HKZ A;  2DA6 A;  4BWM A;  1G4D A;  1HW1 A;  1ZD3 A;  5FD6 A;  3DPU A;  1HCR A;  3MGV A;  1P7D A;  4OJO A;  5J6X A;  2CO5 A;  2VA8 A;  5TZV A;  4DL5 A;  2ZJ2 A;  1S10 A;  4IRK A;  1LDD A;  5J0P A;  1JKR C;  3IC7 A;  4DFJ A;  3OMY A;  2XC7 A;  5JUM A;  3IV5 A;  2DLL A;  1KQ9 A;  1ZQK A;  3PNV A;  1SWW A;  5L1M A;  4DZJ A;  5F04 A;  2H09 A;  5KFJ A;  1ODD A;  1O08 A;  4J9M A;  1COK A;  3ABT A;  1S97 A;  5EE1 A;  3WTT C;  2BOL A;  4B8X A;  4U0Y A;  2MU2 A;  5J2C A;  5L3F A;  4B47 A;  3AKZ A;  3AL0 C;  2HHU A;  4LG0 A;  1DOQ A;  2HVI A;  3QRF F;  4NBQ A;  2CQ7 A;  2TCT A;  1BPZ A;  3HIL A;  3EUK L;  3V42 A;  1JJ6 C;  2UUZ A;  4QZD A;  3AU6 A;  3GFM A;  3A01 B;  4ECZ A;  3NAS A;  1N5X A;  2VC1 A;  4GC6 A;  4MFC A;  2CH0 A;  2LYC A;  5LHI A;  5FKO A;  1P4A A;  4QZI A;  2ZNY A;  3G1M A;  2OEH A;  1WI3 A;  3T0Y A;  2EAM A;  2LHT A;  1XGN A;  2IP2 A;  2O61 A;  1UG2 A;  4UUV A;  1ARO P;  3HUG A;  3KE2 A;  3DBH B;  1STZ A;  2M8G X;  3HHH A;  5LHG A;  3JPS A;  4DFM A;  2TDX A;  4UAW A;  3BG9 A;  4GDF A;  2R8K A;  5DLG A;  2AO9 A;  2JRZ A;  1KU7 A;  3M7D A;  1UHM A;  3L2W A;  3RJI A;  2W85 A;  2JPC A;  3WE3 A;  2KKO A;  4PUS A;  1SFK A;  3WU0 A;  5KFK A;  4HQE A;  5J2D A;  2PFP A;  1LB2 A;  4RAG A;  3RPU D;  1AHD P;  2AS5 F;  1RYS A;  3J80 Z;  3RJG A;  7ICG A;  2A3V A;  5BNG A;  4G6Q A;  4Q5S F;  3BDP A;  5HR6 A;  1C20 A;  3BR3 A;  1LEA A;  1MW7 A;  2R92 J;  3GUD A;  2G08 A;  4C2T A;  4EGY A;  1MBK A;  1N48 A;  2CUZ A;  3OL3 A;  1X9W A;  1MQ3 A;  1Y1V J;  3E6B A;  4RUC A;  2VN2 A;  3ZXS A;  1EH6 A;  2F6C A;  2EB7 A;  5IP9 J;  5GAD J;  1LNW A;  1TWG J;  2VQG A;  3KEO A;  2K85 A;  3BR2 A;  4YIF A;  5GPC A;  4P5O A;  2ZCW A;  3HGG A;  4MQ9 F;  2EZY A;  5KFP A;  3E0J B;  2ZFW A;  2RDP A;  4LIT A;  2Z7J A;  8ICU A;  4XON A;  7ICS A;  3BG6 A;  5F1R A;  2GLE A;  2W7N A;  4JYK A;  5D5X B;  4CZC A;  3HSR A;  5B66 C;  2WAE A;  4IS7 A;  1B9N A;  3I59 B;  5DEQ A;  2X4H A;  3Q8M A;  5ALI A;  2EAO A;  3O2P E;  4GCV A;  1UCR A;  4G7O F;  4XRS G;  2EBI A;  4F52 A;  1HF0 A;  1P7I A;  4G6T B;  2PMZ C;  2P81 A;  2ZO4 A;  2BKE A;  2YML A;  4O3S A;  2PMZ N;  2VA3 A;  4R8U B;  2EFP A;  2K9S A;  2M4G A;  1ZG3 A;  3FF5 A;  3G6X A;  3EZ5 A;  3D2N A;  4DLG A;  2DK8 A;  2V4R A;  3IUO A;  2Q0O A;  3Q0W A;  1Q1V A;  5KK1 A;  2WFA A;  1H8A C;  1F5S A;  2F8K A;  2LFB A;  9ICA A;  4D0P A;  5H6R A;  1Y88 A;  2W9M A;  3L09 A;  1HKQ A;  5ILS A;  4PH5 A;  4PHE A;  4I2A A;  4C2U A;  1HDP A;  1D1C A;  1HSJ A;  3BY6 A;  3DKY A;  4DYC A;  2HW3 A;  5K5O A;  3LVW A;  2RQP A;  4KMO B;  4KT5 C;  1SV4 A;  2HHX A;  5ALU A;  2CW0 F;  3HKZ C;  2NVT J;  4IOA F;  3Q8S B;  3WTZ A;  5DGB A;  2HU9 A;  3KLO A;  1B59 A;  3SFI A;  3L3F X;  2X48 A;  2V9P A;  1NK2 P;  2KG5 A;  2C2E A;  2KPM A;  1UG0 A;  2ZSH B;  2KLO A;  3ERM A;  5DUK A;  5HDG A;  1JKO C;  3OGU A;  3DEU A;  2DKZ A;  5EWE A;  1V85 A;  3ONN A;  5EWG A;  4L9T A;  3PO4 A;  3ZN1 A;  3IRQ A;  4UUS A;  2EIL H;  2WC2 A;  2MRL A;  4M3F A;  1A0P A;  1ZD4 A;  3JPQ A;  3M9O B;  1ZET A;  2BHZ A;  3SEN A;  4YEJ A;  3CCY A;  5DTD A;  3BZ6 A;  4YVZ A;  4IVN A;  3FYH A;  3VYU B;  2VBZ A;  4DSF A;  2F5V A;  1VTN C;  4AYB C;  2KN7 A;  1B4F A;  2JSP A;  4FET A;  4XOT A;  4JBA A;  4XRM A;  1KTQ A;  3DU6 A;  2YB1 A;  5KFN A;  5FRM A;  1N78 A;  4Y2X A;  1MBJ A;  4DF8 A;  5AI4 A;  4DJA A;  3E7L A;  4ECV A;  2JV3 A;  3LSP A;  4BQA A;  1XWL A;  4KLU A;  5DG9 A;  3PO3 J;  2O0Y A;  5FLX Z;  4IO9 F;  1S9F A;  3BCA A;  2EQR A;  4A6E A;  4EM1 A;  2E2I J;  1NOM A;  3HL2 A;  1VQ4 I;  1V9P A;  3RJF A;  2RAE A;  5CLS A;  3T5K A;  1NZP A;  2DKX A;  3MMY B;  5AKE A;  3GFK B;  2PG4 A;  2QGU A;  4MEY A;  2CW8 A;  1T8E A;  2GA2 A;  2X1C A;  2FSW A;  5KFM A;  4I28 A;  4UAR A;  4UBB A;  3HX0 A;  3SZG A;  4RQN A;  1R00 A;  2IGN A;  1L8O A;  4CUG A;  4IRG A;  4I2J A;  1FJL A;  2LRD A;  3RTV A;  2K86 A;  3V8K A;  1HLV A;  5DYM A;  4DQS A;  2QF7 A;  3JCU C;  3AL0 B;  2RC4 A;  3CCJ I;  4ELV A;  2RHF A;  1HQC A;  1YJ9 I;  2L5Y A;  2XHK A;  2XKO A;  2QQ8 A;  1G6N A;  4C4T A;  4CCN A;  2YY6 A;  2XF6 A;  2K02 A;  1ZQR A;  2R0Q C;  4KMU X;  5EJC A;  2Y30 A;  5ALT A;  2DOF A;  8ICC A;  3T79 A;  3N4M A;  4FBU A;  2D6F C;  5J8F A;  3C23 A;  3GLL A;  2DQR A;  2XCA A;  3E5Q A;  4IRC A;  4O5V A;  5J0Y A;  1W7P A;  3M07 A;  2XSD C;  4DYQ A;  2XY6 A;  2K4B A;  5DCF A;  1PJR A;  3MKY B;  3ZN0 A;  3WU2 C;  1TKD A;  1T6S A;  4IXA A;  1BGX T;  1VQ8 I;  2EAP A;  1XX5 A;  2NNN A;  3NWS A;  3T8R A;  1ZQB A;  3GFL A;  3GV8 B;  5D4R A;  1YIJ I;  2P6R A;  2OWO A;  3COA C;  2HI3 A;  1XU4 A;  4EEN A;  3EUH C;  2IVM A;  2YSR A;  1WWX A;  5E1W A;  3F5E A;  3H0M B;  1X2M A;  1BIA A;  2QAR A;  4AIH A;  2WTF A;  3SDG A;  5CPR B;  1ZD2 P;  3DTE A;  5JVT A;  2KOB A;  1L3T A;  2RV8 A;  3WOD F;  1P2F A;  1VQ7 I;  1SZP A;  3C1D A;  5ERI A;  4MQV A;  2FUG 2;  5KFF A;  5CVU A;  3HOZ J;  1ZAR A;  3KD3 A;  1IV6 A;  2YB4 A;  2BEO A;  2R18 A;  2O9L A;  4M9H A;  4XBF A;  4RPZ A;  1FT9 A;  1SD5 A;  4HF1 A;  3K2A A;  2Y0S A;  4QZE A;  3F8B A;  2FE3 A;  4ECS A;  2KMU A;  4YG2 A;  4XQ8 A;  4QWA A;  1XSP A;  2LRE A;  1MIJ A;  4DYR A;  2GIV A;  4R63 A;  2KP6 A;  5AM2 A;  1BIB A;  2YX7 A;  4NJ8 A;  3MR3 A;  2JN6 A;  5B3S H;  3GZF A;  9ICJ A;  5FP0 A;  3QE9 Y;  2HOT A;  2W82 A;  2VBY A;  5FO5 A;  3CW2 C;  2R7S A;  4ELU A;  2A1J A;  4W1U A;  3E0F A;  4UB8 U;  1NK0 A;  1YG2 A;  4LG3 A;  1WSU A;  5H2F C;  1ONV A;  1ZQW A;  2Z2S B;  4CCH A;  3LSM A;  1SVL A;  1W36 C;  5AM1 A;  5E3L A;  4CSW A;  1A77 A;  1VND A;  3BQT A;  2L7M P;  3CJR B;  3RB0 A;  4PJM A;  2AQE A;  1U49 A;  1ZQI A;  3MDC A;  3I4M J;  4UVB A;  2OCC H;  3GEZ A;  4ZH4 A;  3KKA A;  3OIO A;  4Z6D A;  2FBK A;  2MSY A;  2IHM A;  8ICF A;  1I5Z A;  2I8D A;  5E3O A;  1FLI A;  2FU4 A;  1O3T A;  1U5T C;  2CRG A;  1QRY A;  2EV5 A;  5HLG A;  4V2G A;  5HVQ C;  5K7F A;  1V55 H;  1R5H A;  3WTY C;  1WWU A;  4O5E A;  1Z6R A;  3DF8 A;  3PMN A;  1Q3V A;  1ZQX A;  3GX4 X;  5DGA A;  2FEZ A;  2LMD A;  3MZ8 A;  1E3P A;  1TZL A;  3HDD A;  3PX4 A;  3H0L B;  4NHJ A;  3QZ7 A;  3PM1 A;  3KBB A;  3GXO A;  3TDZ C;  1X6J A;  3FKI J;  4LLG F;  1RXV A;  2VOP A;  1WUD A;  4BXO A;  1HUO A;  5G5G A;  2HBM A;  4O3M A;  3DBR B;  1J5Y A;  2A05 A;  4HZF A;  1ZRD A;  3GTG J;  4RQ8 A;  1HUZ A;  3PW4 A;  2NYV A;  5KHD A;  3TQN A;  3LWF A;  1S5L C;  3IKV A;  3VOE A;  1ZQY A;  4J9R A;  4GLX A;  2CWE A;  3OYM A;  4ENM A;  5IT9 Z;  1UQV A;  1J7K A;  2W54 A;  5ALF A;  2JK3 A;  3H9Q A;  4ASN A;  1O4X A;  5CKT A;  3RJJ A;  2V9W A;  5FJ8 J;  5DB9 A;  3WK7 A;  1Z7U A;  1NK7 A;  1MND A;  7ICT A;  1Z21 A;  9ICT A;  3KP7 A;  1BR2 A;  3LSK A;  4IRH A;  3SZP A;  4BBR J;  1YZ6 A;  5AIB A;  2IPQ X;  1AKH A;  2ISP A;  1S0V A;  4YXM A;  2LBF B;  1FIA A;  2DA5 A;  3HKZ N;  1JTY A;  2EIM H;  2NS7 A;  2VJ5 A;  4DBQ A;  2HGC A;  3WGH A;  1S7O A;  3JSP A;  1SEU A;  2CV1 A;  3M3Y J;  2JMG A;  2P5K A;  2QB1 A;  4RNM A;  2M9H A;  2GLO A;  2R4G A;  4PK4 A;  4MEX F;  5BOL A;  2M1B A;  1OYW A;  2E1C A;  4HNU A;  1LDK B;  3GFI A;  3BR6 A;  5LD2 C;  4P1W A;  4CYD A;  2IHN A;  2VJJ A;  2ASD A;  2HMX A;  2HBL A;  1ZQT A;  4F55 A;  4B9V A;  3IHU A;  1R36 A;  5HDK A;  3DU5 A;  3C1Y A;  4MIM A;  1H88 C;  3F2D A;  1LDJ A;  2NVY J;  3G1O A;  5FLX K;  1CI4 A;  3Q8L A;  3BQY A;  1XS9 D;  2BHN A;  1G59 A;  4G7H F;  1UA1 A;  4KTQ A;  2R8H A;  1UHW A;  4CZZ A;  2G5H B;  2ZIU A;  4DFP A;  5E1X A;  3L2Q A;  3D2S A;  4EM0 B;  1IDY A;  2VOO A;  2LY1 A;  3BOQ A;  1REP C;  4JOM A;  3E58 A;  3WHB A;  2DA3 A;  2O8X A;  4UAY A;  4CA0 A;  1NJW A;  4L9N A;  4RDU A;  1RES A;  3N28 A;  2ME6 A;  3KEY A;  4PGY A;  3MAB A;  1RC9 A;  1J0R A;  3C2B A;  4CCM A;  3DFG A;  5DCM A;  2WF7 A;  4UW9 A;  4O0I A;  3I53 A;  1U8B A;  8ICE A;  2K9Q A;  2L01 A;  1S76 D;  2AHQ A;  2ZTD A;  4EX7 A;  2W9B A;  4A12 A;  4FO6 A;  4AC0 A;  3EYZ A;  1UT8 A;  1YW9 A;  3RZO J;  1ZQE A;  3KZZ A;  4B9M A;  3PY8 A;  1ZJM A;  1L3S A;  2XAS A;  2WA0 A;  1TV9 A;  1F44 A;  4EMS A;  4FQG A;  8ICX A;  3GBG A;  1R58 A;  2R7F A;  3DLL F;  3E5U A;  4E7I A;  1QZE A;  3CLQ A;  2JXJ A;  2BQU A;  1YLF A;  3H1C A;  2WY7 Q;  3RJP A;  2Z5U A;  4U7B A;  1X6I A;  5KAF U;  2OAZ A;  3UMB A;  3G6Y A;  2CN1 A;  3TGN A;  5L1L A;  4DL3 A;  1PYV A;  3DTI A;  4QJF B;  8ICT A;  4F5Q A;  4BQO A;  5AM3 A;  3RRH A;  2PJP A;  3HGY A;  1HA8 A;  2QKL B;  2HHQ A;  2IRF G;  1YI2 I;  2KFZ A;  1ZQQ A;  1RYR A;  2XSJ C;  2HOQ A;  2XGX A;  1GXP A;  1WJF A;  4DIQ A;  2ES6 A;  2L2O A;  3EW9 A;  1S5L U;  4XLP F;  5AKK A;  5EWF A;  3EPG A;  2M5W A;  4JV1 A;  1QVU A;  1JKQ C;  4DOA A;  1PUE E;  2MH9 A;  3H8J A;  1V5G A;  2XKP A;  5EZH A;  3ISB A;  4LZG A;  2ELJ A;  2K89 A;  3CCM I;  3MCZ A;  3A0H U;  5KFA A;  4EX6 A;  3OHB A;  4LZD A;  1Q3U A;  1U47 A;  4AUX A;  2QBY B;  1Z77 A;  3K69 A;  3J81 j;  4DS4 A;  4J9O A;  1TQI A;  2OA4 A;  4OWR B;  1TC3 C;  1B6A A;  4M6W A;  1R23 A;  3IRU A;  3D5R C;  3V7K A;  3CDH A;  1PVE A;  1Z4O A;  3TMO A;  1YYV A;  2BY0 A;  2OQR A;  2KDZ A;  1SKS A;  1RPL A;  4C8K A;  3SQI A;  5DBB A;  4K4I A;  4FX4 A;  2OYY A;  2MW8 A;  4R65 A;  2NVX J;  4RQ7 A;  3ISD A;  1ETW A;  2YU3 A;  4J00 A;  1JI8 A;  4KN7 A;  4KLQ A;  3WK9 A;  4QZH A;  1D1A A;  2JZY A;  1TWA J;  1OCC H;  1UMQ A;  5J8Y A;  5KCM A;  1ZQV A;  1WCN A;  1DRG A;  2L4M A;  3JAM Z;  3K2Z A;  1HW5 A;  2FLN A;  8ICJ A;  3TKY A;  3CRX A;  2EJR A;  9ICP A;  3HIF A;  1IJW C;  3KZI U;  1JN3 A;  5L1I A;  2ODG A;  3TW7 A;  3BZC A;  1IIP A;  4KLF A;  2XAH A;  1LKY B;  3QZ8 A;  4JWM A;  2VLA A;  3JRG A;  1P4W A;  2RVC A;  4L5I A;  2X6X A;  4RS8 A;  2X6O A;  1XGM A;  2VQH A;  1ECW A;  1W4M A;  4P4O A;  3F2B A;  4PJL A;  3KYC B;  3ELK A;  1AU7 A;  1PVR A;  2XRL A;  1IN7 A;  3AG3 H;  2DOE A;  2Y0M A;  3S3N A;  3PJR A;  4QWQ A;  9ICG A;  4C8N A;  5LFA A;  1IGN A;  3T1B A;  3S14 J;  4HAI A;  3HJE A;  5ALW A;  2F77 X;  3H35 A;  4ZDP A;  2VPL A;  4KIF A;  1NTC A;  4YMO A;  4I2E A;  8ICW A;  8ICN A;  4LB5 A;  3FX3 A;  2DPU A;  2XCP A;  2G09 A;  2ALZ A;  3KIO A;  1ETV A;  4LB6 B;  1XS9 A;  2L54 A;  2JT1 A;  3CUQ B;  4CIC A;  3QU9 A;  3PR5 B;  3WGG A;  1G8X A;  1VQ5 I;  3CES A;  1NK3 P;  2WB1 C;  2XAQ A;  2CUF A;  3OYH A;  2HOA A;  8ICM A;  3I28 A;  2HKX A;  5KG1 A;  2DFI A;  3LSH A;  2RN7 A;  5K5Q A;  2K4P A;  5ALX A;  3MFH A;  4DQI A;  4OAZ A;  4EJT A;  5AI6 A;  1IRF A;  4Q4Z F;  1H9T A;  4UVC A;  4UAU A;  3I3L A;  1NK5 A;  2B6G A;  2JEF A;  1S29 A;  3KET A;  1JE8 A;  2ZME A;  5BQT A;  3MR2 A;  1ETO A;  5DKW A;  2HNH A;  2BY2 A;  2PQ8 A;  4E7L A;  3CTA A;  3GO5 A;  4F4Z A;  5ED4 A;  4WJ3 B;  4OO1 J;  2KRF A;  4D7M A;  2IS1 A;  2FA5 A;  3EET A;  1CF7 B;  3Q3S A;  2OTJ I;  4QZB A;  1P6R A;  3B0X A;  3I58 A;  4QWE A;  3Q8K A;  1T38 A;  2BVL A;  1EV7 A;  2E1E A;  3WKE A;  5AK3 A;  2B7E A;  3F5A A;  4F5P A;  2W9B B;  2BGW A;  2W3S A;  1GUU A;  3OSN A;  3V7C A;  3OR1 C;  4ENK A;  2E1O A;  2Z3Y A;  5DBA A;  5J2J A;  1BI3 A;  2BCS A;  3NVV A;  4QWD A;  5J1Y A;  2WF6 A;  5KL1 B;  2R5Y A;  3WU1 B;  3S16 J;  2ZIV B;  2ZME C;  1RR7 A;  4C80 A;  4F4X A;  3PSF A;  3GTO J;  1HEK A;  1X1A A;  2KDO A;  2CFO A;  3S2W A;  1D5Y A;  1ZQU A;  2FJ6 A;  5BOX A;  4Y2Y A;  1BPX A;  1N2X A;  4DQP A;  5EGO B;  3GTQ J;  2IOF A;  1Z1D A;  3IH4 A;  1R4N B;  2Y9T A;  4M71 A;  3JPN A;  3X2Q H;  1LQ1 A;  2FI1 A;  3M8S A;  4NLK A;  1R4M B;  3BWG A;  3H92 A;  4KLG A;  2RP5 A;  1X9M A;  8ICZ A;  4PGG A;  1XDS A;  4RGR A;  4P9F A;  3ZQ7 A;  2IEK A;  2E1M B;  4B9L A;  3OS0 A;  2Y9Y A;  2W24 A;  1K4T A;  3BCB A;  1KU9 A;  1IC8 A;  3KHH A;  2DQN B;  4O3R A;  5HMM A;  8ICY A;  2HDW A;  4PJJ A;  3ECH A;  2K9L A;  5CJ7 A;  4BEH B;  2VKD A;  5HLH A;  4DCC A;  4IHT A;  4PL2 A;  1LFP A;  3ORY A;  1R71 A;  3F21 A;  3TFS A;  2FRH A;  1DGS A;  4II2 A;  5L1J A;  5D4S A;  2H94 A;  4HNV A;  3PZP A;  3QQA A;  1N5W A;  2K5C A;  4M74 A;  2QB0 B;  1T39 A;  4N9H A;  4M6W B;  3LK9 A;  3RH4 A;  2PMZ A;  1BI2 A;  5J29 A;  4C3J J;  2EZX A;  3BTJ A;  2XPW A;  4GXO A;  4PHP A;  3PO5 A;  1MSW D;  5TGT A;  5IY5 H;  2EIK H;  4A3D J;  2DK5 A;  1Y56 A;  3V8L A;  1K7A A;  3MN2 A;  1Z00 B;  2K8C B;  4ACO A;  2PFB A;  4G8X A;  1KDH A;  4O5C A;  5L9X A;  2E60 A;  4DNC A;  3J81 K;  4EBE A;  9ICC A;  5J0R A;  1P9Q C;  3LAP A;  2M8E A;  1O3S A;  1HW2 A;  2IOH A;  1L8L A;  1ZQG A;  1FPQ A;  4PGH A;  1TAQ A;  1NK9 A;  3HM5 A;  5IP7 J;  1IXR A;  1V5E A;  3D5L A;  2EZK A;  3VYR B;  4JP0 A;  2GXA A;  1A6I A;  1DP3 A;  3TAD A;  1BJZ A;  1I1S A;  2CQX A;  2PLY A;  4XLE A;  3QAH A;  4OJ6 A;  4BE2 A;  2XGD A;  4AID A;  3BQ0 A;  2HZD A;  1X42 A;  2EIJ H;  4KLE A;  3JRI A;  2JMW A;  1Z6T A;  4YII A;  3F22 A;  4IQJ A;  2HHS A;  3BG3 A;  4MGR A;  2M30 A;  4PCQ A;  5D5V B;  1TNS A;  2IGK A;  2Y69 H;  4QLC U;  3QNM A;  2UV1 A;  3WE2 A;  1JXE A;  3NRW A;  1JUP A;  5BOM A;  4BY1 J;  3K1M A;  3G6V A;  2Y0S C;  1WJD A;  2PBI A;  2FE9 A;  2D45 A;  4HG2 A;  3NQO A;  1X3W B;  3LNQ A;  3ERE D;  2I1Q A;  4IEJ A;  3SV4 A;  8ICH A;  4I2C A;  2P5V A;  3A03 A;  4ZYH A;  3IDW A;  3N7S C;  1O7L A;  3SEQ A;  1MGT A;  1FO4 A;  5EF6 A;  2EH9 A;  4KLO A;  1DUX C;  1FP1 D;  3PUB A;  2PFN A;  4NXZ A;  3JAM K;  3CNH A;  5H20 A;  4A2U A;  5JLX A;  4BHB A;  3D2Q A;  1OUQ A;  1APL C;  2LMR A;  4PHA A;  3A0H C;  2MUT B;  4IQW A;  2JH1 A;  3BS7 A;  2OBP A;  4A3I J;  3TED A;  1R5I D;  8ICP A;  5LLQ A;  4MFA A;  3VOD A;  1J97 A;  4DGW B;  2KVC A;  3SXY A;  3S3M A;  3WU2 U;  1NKB A;  1KN5 A;  5HS8 A;  5ICF A;  5ICG A;  1U8R A;  3QOP A;  5DB8 A;  3ZCO A;  2HPI A;  4EEF G;  5AIC A;  4BS9 A;  3F3X A;  5AKX A;  4FS2 A;  4NLG A;  1JRP A;  4QTR A;  1X1B A;  5BPI A;  9ICL A;  3S15 J;  1CGP A;  4KYW A;  4A0X A;  2ZIX B;  2EWN A;  3TAC B;  3DP7 A;  3FIS A;  5KFO A;  5HOO A;  4MTD A;  1EH8 A;  1ZAO A;  3C18 A;  3ABU A;  2MD5 A;  1HDD C;  2BCR A;  3HWT A;  1RXW A;  1L0O C;  1ULY A;  3VCB A;  4ZDL A;  2HBK A;  2QA4 I;  2V79 A;  3GLX A;  1HOM A;  5AIA A;  3EDP A;  1I3A A;  1UFM A;  2ZJQ F;  4Z6F A;  3MR6 A;  3K4M A;  2DF4 B;  2VJ4 A;  4TQR A;  3GV5 B;  3QU2 A;  2DOA A;  4G9Y A;  1SD6 A;  2L9R A;  3VYT B;  1VLB A;  3WGI A;  3G3Z A;  4GFJ A;  3RKW A;  5AK4 A;  3MAJ A;  2FX0 A;  1FOW A;  3FBN B;  3QPS A;  3RCO A;  4X5V A;  4GYG A;  4WX9 A;  3HOT A;  3GVA A;  5KTQ A;  1TT5 B;  2DT7 B;  2IA0 A;  3JSO A;  5DQG A;  5III A;  1SL1 A;  3IN5 A;  2RDI A;  2VOD A;  5DDY A;  3W6V A;  2ZSI B;  4IRI A;  2NVU B;  4RQ5 A;  3FIW A;  2ECC A;  1A76 A;  2LNB A;  1RQN A;  3OS1 A;  4UBC A;  4ED1 A;  1KKX A;  4B44 A;  1E17 A;  2KIW A;  3Q8P B;  4A93 J;  1QTM A;  4F2S A;  4IOC F;  2KQR A;  3TAP A;  1PVQ A;  4C7Y A;  3BS5 A;  5KFE A;  4EJU A;  1N63 A;  1X9X A;  3CZ6 A;  2RDJ A;  1JHH A;  3P9C A;  1V4R A;  2HQN A;  4QIW C;  1AQ6 A;  5AKZ A;  4XRH A;  1ZQO A;  1FOK A;  4XOR A;  3PW5 A;  4RQM A;  1VDV A;  2J6T A;  1IG6 A;  1JTX A;  3QOD A;  1IF1 A;  4RQ6 A;  4KN4 X;  4HAM A;  5EEG A;  3RZD J;  1ZQ1 C;  2CQK A;  4J9P A;  1DGR M;  1BL0 A;  1Z00 A;  1S8O A;  2C22 A;  2OCE A;  5KAI C;  2W11 A;  1P4X A;  4BXU A;  3OYN A;  2JH7 A;  3WTU C;  4KFC A;  1XD7 A;  3LWL A;  4G6D A;  4BH9 A;  3MZH A;  2OXO A;  4MF8 A;  2Y48 A;  1JUM A;  2JR5 A;  2XIG A;  1V5F A;  4GO1 A;  5E8G A;  2GZW A;  3ZQI A;  1C0W A;  2M87 A;  1FTT A;  2OHF A;  4O9M A;  1FSE A;  2L3D A;  3QX7 A;  4JWN A;  1YX5 A;  4GC7 A;  3FAH A;  2AXT C;  2Q8K A;  4YEL A;  4O3P A;  1ZQS A;  3C3W A;  2BPG A;  3ICX A;  2E2J J;  2KIM A;  1N77 A;  4DWI A;  4R8U A;  2VBX A;  4DOZ A;  1ZQJ A;  4M9L A;  1T08 B;  1F36 A;  4F7Z A;  2LKP A;  2MLG A;  2ZC2 A;  5K1Y A;  3KCC A;  5AI0 A;  4O3Q A;  8ICO A;  4OIN F;  5KFL A;  5KNL A;  3UXN A;  2BDU A;  1SD4 A;  1YW8 A;  1I39 A;  2A69 F;  3KKA C;  3H4B A;  3RR8 A;  4P0P A;  3C2G A;  1ZQN A;  1XSD A;  3H36 A;  2UXX A;  4D7N A;  1LKY A;  1UEL B;  1WHU A;  4ICA A;  4ECW A;  2KTQ A;  3RKQ A;  5AK6 A;  2K40 A;  1ZR4 A;  3GU3 A;  5JVG F;  5ALZ A;  1PUF B;  1T56 A;  5B1A H;  4XKV A;  5GPA A;  3HB9 A;  3SJM A;  4A3F J;  4E7J A;  5DLF A;  3LSG A;  1I50 J;  2KP7 A;  7ICF A;  2ECB A;  4U87 A;  1H38 A;  3IKT A;  1D5V A;  2JHD A;  2KEY A;  2YU9 J;  1JI7 A;  3KHL A;  4HDV A;  1NI3 A;  3SD7 A;  4QIW N;  2H8R A;  2XY5 A;  3TAN A;  2IBK A;  2ETH A;  4LJX A;  1K78 B;  2MSN A;  1FOY A;  5K5R A;  5AI8 A;  1YTY A;  1VQO I;  1JGG A;  1T0F A;  4OIP F;  1S8N A;  3K75 D;  4UB5 A;  1QU3 A;  3NVY A;  3CD6 I;  2HVS A;  1W5S A;  5GAG J;  2ZUD A;  3RB4 A;  3AG1 H;  1E2X A;  3E5X A;  3HPH A;  1CUK A;  4US8 A;  2MYS A;  4XRF A;  3TKA A;  1ZQA A;  1YO5 C;  1VQL I;  2MAX A;  2V4J C;  6PAX A;  3FM9 A;  1IN5 A;  4HYK A;  5EE3 A;  4LLN A;  4HF0 A;  4DBR A;  2DT6 A;  3F2C A;  2BQR A;  1X19 A;  4IF4 A;  3P7N A;  3M1Y A;  5J8C A;  2R7D A;  1NG6 A;  1GXQ A;  1XGO A;  1Q46 A;  3CLO A;  4IQV A;  3IV6 A;  3MBY A;  5BS6 A;  4L0Y B;  2VE9 A;  4CH7 A;  4WK8 F;  2FPM A;  2BPC A;  4L9J A;  1M1E B;  2XF7 A;  4PZN A;  4US9 A;  3H3V K;  9ICW A;  4I2F A;  3IP4 B;  4BQQ A;  2JPB A;  1OW5 A;  4P4M A;  3QEB Z;  4YFK F;  4JB3 A;  4J01 A;  2W43 A;  4IR1 A;  1MJB A;  4RA2 A;  4Y52 J;  3LOC A;  3N7R C;  2L7F P;  4ZOH C;  4RZR A;  4IZZ A;  5L1K A;  4HLX A;  3TP3 A;  3SZ2 A;  2BBY A;  3EUB 2;  2P4W A;  4MTE A;  2LKX A;  4LIV A;  4C3I J;  4UAZ A;  2FLP A;  2KRC A;  7ICL A;  1FYK A;  4EZ9 A;  2LYH A;  4I29 A;  5CRX A;  2VC0 A;  1TK8 A;  4WF2 A;  5EEH A;  5EE0 A;  3A02 A;  1VQK I;  3ABK H;  4HX8 A;  1ZRN A;  3MR5 A;  4PGX A;  1ORK A;  2ASJ A;  2XIC A;  1WG8 A;  3GZ6 A;  1ZN2 A;  3PSP A;  4IHX A;  5EEA A;  3MGI A;  5GAE J;  4NB5 A;  5J2B A;  3FWE A;  4Y2Q A;  2KVS A;  2A5W A;  3FXJ A;  4M9Z A;  4YFN F;  5TJJ A;  4QZF A;  1RET A;  3C5G A;  2BE5 F;  4DL6 A;  3VB2 A;  5HDN A;  1MH3 A;  1M6Y A;  1VQ9 I;  2LBO A;  5DB7 A;  2R93 J;  1QSS A;  2ID3 A;  2OZU A;  4IHV A;  1ZOL A;  1D0Y A;  4BWJ A;  2QSG X;  1YQA A;  3BJY A;  4HX4 A;  2DU9 A;  5GP9 A;  2HWV A;  2DI3 A;  1KFD A;  1Z67 A;  1X1P A;  3LL7 A;  1WJA A;  2LOO A;  3R60 A;  2ZJ5 A;  1Z4N A;  2KE7 A;  1PVP A;  3PVX A;  5E18 F;  4LG0 B;  2QQ9 A;  3K4J A;  2Z33 A;  4A3M J;  1J2X A;  4WXC A;  4E70 A;  3HHG A;  4G7Z F;  3NAR A;  2EAN A;  4ZYG A;  4CF5 A;  5A2Q Z;  2ZTC A;  4DQR A;  4KIB A;  3V4G A;  2PFQ A;  4QW8 A;  1KYZ A;  3KPH A;  2BPF A;  1EH7 A;  4OU0 A;  4BU2 A;  1NKC A;  4CCO A;  3C29 A;  3A01 A;  3UKG A;  1BNO A;  3IL2 A;  1WPK A;  3M6K A;  2GOL A;  4I2O A;  2DFH A;  3PFI A;  3TO9 A;  3PSI A;  1L5U A;  4BUG A;  1NHA A;  2V6C A;  2FLL A;  2FQ4 A;  4R1H A;  1KLN A;  5ALG A;  1YT3 A;  4RQ1 A;  3HP6 A;  4FZM A;  5KT5 A;  3K1N A;  1NK4 A;  4B43 A;  3UPQ A;  2A1J B;  4I2B A;  4YFX F;  7ICQ A;  3FHN A;  1OJL A;  5J8Y C;  3RSN A;  3DTK A;  4MHG A;  1N60 A;  2NS0 A;  4XUS A;  2Y1J A;  4Q8F A;  2ESN A;  3S1M J;  1IRZ A;  3BQ2 A;  1TAU A;  2WHE A;  3L9F A;  1J09 A;  5CP2 A;  3GIM A;  3FXU A;  2FBI A;  2P66 A;  1NKE A;  4DEZ A;  1YFH A;  2IGM A;  5AK5 A;  2PMH A;  2WBM A;  2LI6 A;  4HRI A;  1NZB A;  4M9J A;  1IAW A;  1RKT A;  3BJO A;  2PEX A;  3BR0 A;  5C0Y A;  4XM3 A;  3SV3 A;  2KZV A;  2KZ3 A;  3EUA A;  4ETS A;  2K8A A;  4JK1 A;  4A6D A;  2JZB A;  2Y31 A;  2W1O A;  4QPQ A;  1D8J A;  3ABL H;  2UVV A;  2VT2 A;  1GV5 A;  3BQ7 A;  2GXB A;  2LTP A;  4BJ5 C;  4XNF A;  2GOM A;  1L3L A;  2V9V A;  3LA3 A;  2RNJ A;  3PX0 A;  2M7B A;  3VWB A;  4EEL A;  3QP6 A;  3LSR A;  3HOX J;  3AN1 A;  1D0X A;  1IN4 A;  1B0X A;  4B6J A;  5AON A;  3T5J A;  2JTV A;  5HNF A;  1B1B A;  4C7Z A;  2CRX A;  3AQF A;  2A3S A;  4B9N A;  3BRO A;  1BBY A;  1POG A;  5B5E C;  2RNG A;  2OM6 A;  1U45 A;  3D5S C;  1D3Y A;  4RAF A;  1SFU A;  2A61 A;  1R1U A;  3G4S I;  2WY8 Q;  1S9H A;  4MFF A;  2RQQ A;  1OCZ H;  1OMI A;  4B3X A;  2CU7 A;  1QVT A;  1OCO H;  2DTR A;  3BG7 A;  3G73 A;  3DCF A;  3J7A Y;  4AP9 A;  3AUO A;  3U1K A;  1RI7 A;  2KT0 A;  2Z99 A;  1SMT A;  4ZYD A;  1Z0X A;  3RJH A;  3E6C C;  2IW5 A;  1V38 A;  9ICH A;  4Z6Y A;  3J7A O;  2V26 A;  3VSL A;  5JFR A;  4ABZ A;  2AH5 A;  5ALP A;  1UJ8 A;  2E7X A;  2OUM A;  1T3N A;  4A3J J;  1F0M A;  1F1Z A;  5LRR A;  4CF4 A;  5M5X J;  4ESJ A;  4IHW A;  1IW7 F;  1K79 A;  4HW0 A;  4Y2T A;  2CMP A;  2WAD A;  4HV6 A;  4BL0 B;  5JTI A;  3JRC A;  5J0U A;  2W55 A;  3I55 I;  1OIS A;  4ED6 A;  1RR8 C;  3HXL A;  2HYF A;  3FXM A;  4RGX A;  5D8L B;  3HTU A;  5JR3 A;  5L3E A;  5LHH A;  2KKP A;  2F5D A;  5E8I A;  4JX6 A;  1VFC A;  3CYM A;  4NLZ A;  2KJC A;  3OWT A;  2J6U A;  4DL4 A;  3M9N B;  2XPV A;  1SZH A;  2ZUB A;  1XGS A;  4HSR A;  3AEV A;  3RDI A;  3HEF A;  1FIQ A;  1XG1 A;  2PXI A;  2CXY A;  1ZQZ A;  5DDG A;  3UXP A;  3P5J A;  3K0L A;  4D1Q A;  5DB6 A;  5E20 A;  1KA8 A;  3DWL E;  1SD7 A;  2GBY A;  3KP3 A;  5LGN A;  2L7Z A;  4HLY A;  3H9J A;  1G3S A;  1D1B A;  5KFH A;  1QQ6 A;  1Y39 A;  2XAG A;  3CJT B;  4XLH A;  3HTS B;  1TE2 A;  1UCV A;  8ICL A;  2Y75 A;  3NGD A;  2FMQ A;  2ZJR F;  2LY9 A;  4M9X A;  3U21 A;  4GGG A;  1ZH5 A;  4J19 A;  4E7H A;  3J7Y J;  5KT4 A;  3CUQ C;  4IQT A;  3S2D J;  3KHG A;  1MN8 A;  3QU3 A;  2GXG A;  3SDB A;  4QSH A;  1HC8 A;  8ICG A;  3WTV C;  4LMY A;  5IIO A;  1U4B A;  2X1D A;  2WF9 A;  4C0Z A;  2G0E A;  2EZZ A;  4ECU A;  2Q4T A;  4E7Z A;  2E5Z A;  4AIK A;  1KU3 A;  4M72 A;  4PZJ A;  1V54 H;  4F50 A;  4P96 A;  4RM2 A;  3CF5 F;  3HOY J;  3QU7 A;  2PN6 A;  1I1G A;  5J0O A;  1KFT A;  4B9T A;  3QU6 A;  5DBC A;  2CUE A;  3ZRG A;  2LH9 A;  2EQY A;  2EK5 A;  7ICM A;  5CA7 A;  5CVI A;  1KW4 A;  5KG7 A;  4HEA 2;  1Z05 A;  1LFB A;  3RKX A;  3PIO F;  2HFH A;  5F6F A;  2D1V A;  1G3W A;  2DA1 A;  4BAY A;  1UB9 A;  4U0W A;  1LE8 B;  1FNN A;  3QUQ A;  2QVO A;  5IYD J;  3RJK A;  2G7U A;  4GRI A;  1FTZ A;  3MC1 A;  5DG7 A;  4Q48 A;  3MKZ A;  1Z19 A;  3F9K A;  2BZF A;  2NOJ B;  3JR9 A;  1FP2 A;  1R7J A;  5IT9 K;  2F1H A;  5DM6 F;  1PUF A;  3M7G A;  1W7P B;  4HF2 A;  5J1R A;  1KZH A;  3RYP A;  3D0S A;  3GTP J;  1TAM A;  4XLA A;  3EYY A;  2PX9 A;  2TRT A;  3OTQ A;  1LVK A;  4F3O A;  1TBX A;  4M73 A;  2MGQ A;  4RU9 A;  1UHU A;  2X1E A;  2PJR B;  3RJE A;  2QM3 A;  4XLF A;  4UB8 C;  4I01 A;  2NV3 A;  2WF8 A;  4XKB A;  4TUR A;  2OQG A;  3ESW B;  1TTY A;  5IIM A;  4K4G A;  8ICI A;  4D5C A;  5CR0 A;  3TAQ A;  2DPD A;  1TNT A;  4YG2 F;  2Y0S F;  2DO7 A;  5L3D A;  5IT3 A;  1LEB A;  2G7H A;  1O3Q A;  4CNQ A;  1U3E M;  2L5Q A;  3S2H J;  2A6E F;  2HKO A;  4XMY A;  3GV7 B;  4XQF A;  2DMP A;  4RAZ A;  3SEZ A;  3OYC A;  2I6X A;  2XID A;  3DDH A;  4NM2 A;  2PFO A;  3ZDA A;  4C3H J;  2RKH A;  4UAS A;  4GIB A;  1QCK A;  4C8O A;  3FBI B;  1PDN C;  2NNY A;  1B43 A;  4Q8E A;  4OIR F;  2Z9O A;  5DUI A;  2LK2 A;  2KKV A;  1SFX A;  3QUC A;  2QYO A;  5KVR A;  2LKS A;  2F2E A;  2WAQ F;  5FFX A;  4LLL A;  5J0Q A;  3KP6 A;  1VZ0 A;  5IPA A;  3VYS B;  4RB0 A;  4RNO A;  3RQI A;  4TUP A;  4DQ2 A;  5HP4 A;  2GH1 A;  4K4H A;  2F1I A;  4AYB A;  3CCV I;  1J75 A;  2QBY A;  4X0G A;  2VQC A;  1HBX G;  4I2G A;  4OMY A;  5ALE A;  3KHR A;  2YPR A;  1TL8 A;  1D8K A;  5C4X J;  4YMM A;  3V6H A;  4XL9 A;  2B9S A;  3I71 A;  3L2R A;  2UVR A;  5D5U B;  2B21 A;  2LR8 A;  4CYC A;  1ZKG A;  3PIP F;  4M6V A;  2JA8 J;  1DDN A;  2LM1 A;  2R7Q A;  5J2G A;  3BJ6 A;  5FD5 A;  3V72 A;  3RPQ A;  1BPD A;  1ZGW A;  2H3Z A;  2VPR A;  5DS9 A;  4BE1 A;  2E8N A;  5KG6 A;  3VFZ A;  4YP3 A;  1VQN I;  2MAB A;  1G2H A;  3Q0U A;  1OYI A;  1L7N A;  1T4G A;  2YQE A;  3SAH A;  4O5K A;  2F5F A;  2W25 A;  4L9V A;  3CO7 C;  1SV0 C;  1SL0 A;  2LPE A;  2CV2 A;  2EFO A;  2MFZ A;  3K4C A;  2M34 A;  4MLO A;  5CQG A;  4C2M J;  1TW2 A;  3B6A A;  2HVQ A;  2VL8 A;  4I99 C;  1BVS A;  3I76 A;  4RT3 A;  1K61 A;  2FPL A;  4UB2 A;  2ME0 A;  2OV7 A;  4B48 A;  3HT3 A;  1IXC A;  2DFE A;  2VBW A;  2X9D A;  3KP4 A;  2CGP A;  3THV A;  9ICS A;  2FXA A;  2ZIW A;  1TK0 A;  4M47 A;  3I4P A;  3OYK A;  2B0L A;  2G9W A;  3ZMV A;  4G94 A;  5IOZ A;  3OY9 A;  3P9I A;  4RQ2 A;  2JA6 J;  1MBH A;  2F5E A;  1VI0 A;  2LSO A;  5J4Y A;  3H0G J;  3LWM A;  3HBL A;  1A6Q A;  2KIU A;  3NVZ A;  3HOW J;  5F64 A;  2JEI A;  3M1C A;  1ZD5 A;  4PJ0 C;  1Z91 A;  2JQ7 A;  4UB1 A;  1S7E A;  3QYE A;  3ZD9 A;  3EPI A;  2YX4 A;  5L3B A;  1YOV B;  1RUO A;  5HLI A;  2HQR A;  1GHC A;  2BYV E;  1UPH A;  1RRJ A;  2JGA A;  3SZT A;  1VQ6 I;  1UHS A;  1G3T A;  3M9A A;  1L3V A;  3BDD A;  1WQ2 A;  3LVV A;  5ALJ A;  3A4C A;  1W1W E;  1OCT C;  1XMX A;  3ED5 A;  3BPX A;  3U2R A;  4P0Q B;  3KOO A;  2JVH A;  4EZ6 A;  3F72 A;  4I0B A;  3K1Z A;  2WTE A;  1PK3 A;  4QZA A;  2DFL A;  4M3E A;  3Q5F A;  1RM6 C;  3SYT A;  5DQH A;  2A1A A;  1YJN I;  4I09 A;  4F8R A;  1KFS A;  5FRN A;  1ETQ A;  1NK6 A;  4ELT A;  2A07 F;  2MA3 A;  1W0T A;  3L4P A;  4JK1 X;  2E1M C;  4KN7 X;  2EFW A;  4M9N A;  3NWT A;  5B5E U;  1L6N A;  2I10 A;  2QB0 A;  1HKS A;  3ZOB A;  2DMN A;  4OIO F;  4QZ9 A;  4ZZL A;  4UV9 A;  2XC9 A;  3ZQC A;  5J2A A;  1NJZ A;  2RLT A;  3C2L A;  2WWY A;  2KJ9 A;  4Y3O A;  2GAU A;  4UV8 A;  2BHY A;  4U6P A;  2V1N A;  5CEH A;  2R8G A;  2R7X A;  2X85 A;  4I2I A;  3BPV A;  1BPB A;  1ZGJ A;  1WYG A;  2LM4 A;  4CCJ A;  4ZYE A;  1P92 A;  4PSX A;  4UAT A;  1TT0 A;  4F4W A;  3GYH X;  3OPX A;  1ZHF A;  5FKL A;  2MC4 A;  1XSL A;  2NRX A;  3HOS A;  2D3D A;  3WKB A;  4Q45 A;  4HYE A;  3TW6 A;  4LJZ F;  1TFR A;  2MG4 A;  2L4A A;  3TBI A;  4M3B A;  4Z2Y A;  3C2H A;  2DBB A;  2PMU A;  2QAR B;  2C6Y A;  3K7A J;  4DLE A;  5E79 U;  2H3I A;  3I56 I;  2DA4 A;  2QEN A;  5KFI A;  5D4B A;  3F6O A;  7ICV A;  2ID6 A;  3TAR A;  4KLT A;  3RAX A;  1WH7 A;  2MD0 A;  2XPU A;  3ZPL A;  2GO7 A;  9ICQ A;  2FNP A;  1T0F C;  1ITY A;  1BI1 A;  5J2F A;  3GDX A;  5JHU A;  3OSG A;  2MH2 A;  1F43 A;  3GF2 A;  2UZK A;  1FOX A;  2KIC A;  4O6J A;  5HS9 A;  1QO0 D;  3ZMT A;  2BV6 A;  1U0J A;  3N05 A;  3UNG C;  1WCL A;  2QKQ A;  5AI9 A;  2FBH A;  3AU2 A;  7ICR A;  2PMZ F;  5DQI A;  3MEX A;  3ZQF A;  2G0A A;  3PX6 A;  5J0X A;  4KIC A;  4KX5 A;  4N4O B;  2FDR A;  5AM4 A;  1XDU A;  3I5U A;  5AM5 A;  2EPF A;  4YQW A;  5IIK A;  1S7A A;  3IM1 A;  3KLN A;  2H1L A;  2JUC A;  2DCE A;  4L0Z B;  5HML A;  4BXF A;  5LEK A;  4M0A A;  7ICI A;  2DFF A;  3DQV C;  3HG9 A;  3K4G A;  2KV2 A;  2A19 A;  3KEQ A;  4ANJ A;  4IJA A;  2ZNZ A;  1ON1 A;  4EJW A;  2P6S A;  2P0W A;  4WXD A;  1LPQ A;  2VAS A;  1ZQF A;  1T2K A;  4B9S A;  3HRT A;  4UXN A;  3ZQQ A;  1NJY A;  3CJQ B;  2XGE A;  3R61 A;  1X4O A;  4H4K C;  3FDS A;  3QXG A;  2O5R A;  1ZQM A;  2XVT A;  3S3O A;  3QUB A;  3H8M A;  2ASL A;  2JZB B;  4DOB A;  2V7F A;  4II3 A;  3F6V A;  4G9B A;  1BC8 C;  4EBC A;  2ADU A;  1BPE A;  3LFK A;  1KRP A;  4C9Y A;  2LLK A;  3M8F A;  2ZUC A;  5KT3 A;  1U2W A;  4C8M A;  3BTL A;  3FMR A;  2V6E A;  4WCG A;  3N97 B;  5C5J A;  2BY3 A;  2DL0 A;  4YMN A;  4P2H A;  3GME A;  3NTU A;  2KL4 A;  1C7Y A;  3B02 A;  2FMY A;  3SHF A;  4IHS A;  2E1F A;  3W3C A;  2M45 A;  5J2E A;  4O3N A;  4ED8 A;  2HVH A;  1U78 A;  3ZDB A;  2W8L A;  1MKM A;  1RKW A;  3S93 A;  2KJ8 A;  5GTI U;  5KFW A;  1Y1W J;  2P7V B;  3BLY A;  3FMQ A;  3GIL A;  4XR6 A;  2KHV A;  1RYU A;  1W5C C;  2K3P A;  3F8C A;  5KFV A;  1SAU A;  4P0Q A;  3HRM A;  3J81 Z;  2COM A;  3CCR I;  4A3C J;  3ASO H;  3PQK A;  1JT0 A;  2HXO A;  1WKM A;  3R0J A;  1SAN A;  3M4O J;  4UB6 U;  4A69 C;  1I3Q J;  3MQ0 A;  1UST A;  5ALN A;  2W57 A;  4IKF A;  5DDM A;  2VJI A;  2DW4 A;  2J6S A;  1XTA A;  4P0P B;  3ZQG A;  1WZ2 A;  5J2I A;  5EYR A;  2F44 A;  1OCP A;  5BPD A;  3MWM A;  1T94 A;  4FE4 A;  4KIS A;  4NWI A;  3S8P A;  4ECX A;  4Y2P A;  1O7F A;  2XY7 A;  3A1Y A;  1ZQD A;  4I0A A;  4B09 A;  3H3Z A;  4G12 A;  1QSY A;  4JV0 A;  5KFC A;  2NXN B;  4QZC A;  3OHA A;  1Z3E B;  3RH6 A;  2NRZ A;  2XVC A;  4JUZ A;  3C7J A;  5KG5 A;  2V1X A;  1J2N A;  1FBU A;  1T95 A;  1WCM J;  2ZIU B;  3KP2 A;  1IRG A;  2Y9Z A;  3T5L A;  2EZI A;  2AXT U;  1MMN A;  3ABM H;  5G5H A;  3IH3 A;  4Y2R A;  2DJN A;  5CVR A;  4A0Z A;  2E36 A;  2FQ3 A;  1AA7 A;  5J0W A;  2PI4 A;  4D5F A;  5L3G A;  2H8W A;  4L5J A;  3R6S A;  3HC7 A;  2D5V A;  4DZP A;  2AGO A;  1LVA A;  3CP8 A;  1VJ5 A;  2DOD A;  2QKM B;  2M0C A;  3WTS C;  3LMM A;  3OYL A;  1FFU A;  3RB6 A;  1IXR C;  2JRM A;  5LRS A;  5EG0 B;  1BN5 A;  3OOU A;  3G71 I;  5HHI A;  2GM4 A;  4UB3 A;  4WWC A;  2A68 F;  3OR2 C;  4YXJ A;  2BGC A;  4IQU A;  1Z7L A;  3HSE A;  4HV5 A;  1T7P A;  2KSO B;  9ICE A;  2EFQ A;  2D8C A;  3ZD8 A;  3MZY A;  1GVD A;  8ICV A;  1HXD A;  4Y15 A;  1LKX A;  3HYI A;  2XRO A;  4CHU A;  2R7T A;  2R7V A;  2HXI A;  1DGJ A;  4CE6 A;  1X1C A;  4I6Z A;  1BM9 A;  5C4J J;  1B8I B;  2NO5 A;  5HLT A;  5E79 C;  3VC8 A;  4B1R A;  1X3U A;  2EIN H;  2QUF A;  3F8N A;  5BMZ A;  3PV8 A;  1MMA A;  1CQT A;  2VIX A;  3FK7 A;  4RB1 A;  4XIC A;  5BPC A;  1LE8 A;  1E0E A;  2ZJP F;  5DM7 F;  2BCU A;  9ICN A;  3MFK A;  1RZT A;  1DK2 A;  2W03 A;  2Q2E B;  5JHF A;  2K4H A;  4PSW A;  9ICR A;  2DN0 A;  1MC8 A;  1O57 A;  1ZK8 A;  2DTZ A;  3HRS A;  4LIU A;  5CHG A;  1N56 A;  3J80 K;  1PZN A;  4UB6 C;  4KDP A;  5AKL A;  2JSC A;  4RUA A;  2XGC A;  1R9T J;  1IN6 A;  5M5W J;  4NLB A;  3K4K A;  1F4K A;  1P7J A;  2HEO A;  4UB4 A;  3LST A;  4BNC A;  3GII A;  2V9K A;  1DK3 A;  3FM3 A;  4A3K J;  2O3F A;  2OZ6 A;  1KQ8 A;  2M3A A;  1FMW A;  2VON A;  2K4J A;  2K9M A;  2NOG A;  3V7L A;  2W8K A;  2VE8 A;  2HZT A;  2F5C A;  5EDN A;  2CS3 A;  3S1R J;  2I5H A;  4BDP A;  2HHW A;  4MO7 A;  1Z9C A;  1L3U A;  1ETY A;  5FKN A;  5HHH A;  1FIP A;  1R6R A;  2QSH X;  1TQM A;  3EWA A;  2NS8 A;  1XMK A;  2YUS A;  1FYL A;  5ILU A;  5JRT A;  3OJS A;  1YX3 A;  3OL4 A;  2K9N A;  3H3U A;  4AM3 A;  1D0Z A;  4UQG A;  3W2V A;  2EA2 A;  1U9O A;  3K9T A;  2VUM J;  3C28 A;  5F1J A;  2H3F A;  2OH2 A;  4LVS A;  4F71 A;  2DA2 A;  1JGS A;  4HNT A;  1HST A;  5JI6 A;  3HOV J;  3ZI4 A;  2L02 A;  2IJL A;  1JKP C;  5J1U A;  4Y13 A;  3FC4 A;  1OPC A;  2EZL A;  3LSI A;  3AQE A;  3WK6 A;  3QYB A;  2A6T A;  3WHC A;  4BHC A;  1B72 B;  1XO1 A;  1ZGA A;  3QU4 A;  4KLM A;  2XI9 A;  3QOE A;  2KFN A;  1H9G A;  1VF9 A;  3HRU A;  4NM1 A;  2ISZ A;  3M6Z A;  5B1B H;  2A6H F;  4Y2S A;  2YTU A;  1QHH D;  2HR3 A;  3GTJ J;  1LV5 A;  2LP0 A;  1I27 A;  1GV2 A;  1A04 A;  3K70 C;  2EA4 A;  7ICU A;  4XSZ F;  2OTL I;  4JV2 A;  1H0M A;  1OR7 A;  2G07 A;  1XSN A;  3PL8 A;  3KX2 A;  2JJ7 A;  2VAN A;  3CUQ A;  4FIS A;  3VPR A;  1RDF A;  5ALR A;  4U7C A;  1USS A;  1FWZ A;  2K7L A;  3U1D A;  2GA1 A;  4FBT A;  4BXO B;  2KJ5 A;  4RGU A;  1FMV A;  1ZTR A;  3T5X A;  1XC9 A;  3KYD B;  1KQQ A;  2E8M A;  3FKJ A;  2HDO A;  1KYW A;  3ULQ B;  1MDM A;  1ED1 A;  4J9S A;  4A8E A;  2MBF A;  3CMY A;  5H6Q A;  2YMM A;  1RPW A;  2X0L A;  4LFU A;  1BC7 C;  4EEK A;  4DL2 A;  3S17 J;  1QQ7 A;  3S32 A;  3WKA A;  2UVU A;  4U7D A;  2DMQ A;  4I2H A;  5ALQ A;  2ZKZ A;  4YR0 A;  5KL8 B;  4ZDO A;  1ZJN A;  5AKG A;  1B22 A;  3F0C A;  4ZZD A;  3KP5 A;  5KFT A;  1E3H A;  2K4I A;  2M7A A;  2R7U A;  5AKH A;  4YCX A;  3RBD A;  4EV0 A;  1RUN A;  4R64 A;  7ICP A;  2FF4 A;  5L3C A;  1TW3 A;  1CF7 A;  3M1E A;  2WAQ C;  1MBE A;  1FC3 A;  3BT9 A;  2VXZ A;  2HHT A;  1U5T A;  1TLH B;  3ETR A;  4D9J A;  4DSE A;  1BNP A;  4P4P A;  3OYA A;  2F3N A;  1XSX A;  3GW2 A;  2EH3 A;  4IRD A;  1WFX A;  5E1Z B;  5KFS A;  5AIP A;  3GTM J;  1WWV A;  4ENJ A;  4IR9 A;  3TL4 X;  4XK4 A;  4YR2 A;  2XRN A;  2OC6 A;  2E5N A;  3KTQ A;  4YIR X;  3U26 A;  1MQ2 A;  5HR7 A;  5AIQ A;  1MD0 A;  2ISO A;  2KJB A;  2LY2 A;  3BJA A;  3LQQ A;  4X1E A;  4A3L J;  2DMT A;  2F8L A;  2KNJ A;  4AYB F;  4CGZ A;  1Y0U A;  5FLM J;  2ISY A;  3IRR A;  4BE0 A;  1K6O A;  2K8B B;  4RQ4 A;  5EOZ A;  3O8G A;  2WAQ A;  2NYX A;  4N9I A;  2QQB A;  1EXN A;  3HSF A;  3DBL B;  1YW7 A;  3I0T A;  2ACJ A;  3RF9 A;  1FEZ A;  4YD1 A;  9ICO A;  2O7O A;  2V1U A;  5AKJ A;  2HOS A;  2L9S A;  2KIF A;  5HNH A;  3OYD A;  1ZQP A;  4V2F A;  5IIN A;  2AJQ A;  3MFI A;  1NJX A;  4N0B A;  4BJT A;  4ZJZ A;  4BAC A;  2Q2E A;  5HS7 A;  3CC4 I;  3LAJ A;  5DCM B;  4LGW A;  3V7R A;  2C2R A;  1QZY A;  4BJ6 C;  4TUQ A;  2ELH A;  5KFG A;  3RH5 A;  1YS6 A;  4OJ5 A;  2QQA A;  3CQZ J;  5K7H A;  4AWX B;  4OIQ F;  2EDU A;  5KFY A;  3NAU A;  3NRZ A;  3IWZ A;  3JPO A;  1WRJ A;  4UVA A;  4AYB N;  9ICF A;  4HBL A;  4MFE A;  1IO2 A;  2HYG D;  3PFY A;  2GOX B;  2KIS A;  1SKR A;  4HX7 A;  3T8T A;  4BJQ A;  1UA0 A;  1MBF A;  3FK6 A;  3CO6 C;  4DFD A;  3H0D A;  2Z16 A;  2HYJ A;  5FB2 A;  3GQC A;  2RRE A;  5J2K A;  3RB3 A;  1SC7 A;  2IS6 A;  5K7Z A;  1X9S A;  1K4S A;  3K4B A;  2CQN A;  3SAF A;  1ZLJ A;  4KLD A;  2OJE D;  4JMU A;  3SAG A;  2FD5 A;  2R7O A;  1ZRC A;  2FOW A;  1OXJ A;  3EPZ A;  1YS7 A;  4RGS A;  4B3A A;  3IG8 A;  5ALH A;  2J5P A;  8ICR A;  3E3V A;  3VSK A;  3K4L A;  2KIV A;  2KK0 A;  3GIK A;  2E19 A;  4EYH B;  1K1S A;  2AU0 A;  2JRT A;  2M9N A;  4PPX A;  3IHQ B;  5J0S A;  2H27 A;  4NQW B;  1Z1B A;  4F93 B;  3N97 A;  1SV0 A;  2FMP A;  3ZMS A;  4BUP A;  2QEX I;  2KRH A;  4P55 A;  3QEA Z;  2ESE A;  1JUS A;  2K27 A;  1K5O A;  4Q44 A;  1URJ A;  1XNS A;  2HQA A;  1OKR A;  2BXZ A;  1YIO A;  2E34 A;  3CDI A;  5GTI C;  1KL9 A;  4F92 B;  5F9L A;  2VKE A;  2CJJ A;  1GO3 F;  1OR7 C;  4E4H A;  4EEY A;  1DQU A;  1LUJ B;  1DXS A;  2O6G E;  1ZQH A;  4F4K A;  4I02 A;  3TP0 A;  2OD5 A;  4RT2 A;  4DSJ A;  5C3E J;  3RR7 A;  4A5M A;  4XOP A;  1EA3 A;  3QYF A;  3AG4 H;  1GDT A;  3GTL J;  1I6H J;  4KN4 A;  2QWW A;  4ZYA A;  5KFR A;  3DV8 A;  3PNT A;  4I2D A;  2C28 A;  3ZQL A;  3SYZ A;  2CPR A;  2HTS A;  3LA2 A;  4NLN A;  5ILV A;  1S77 D;  4KT6 A;  4I7H A;  1X2I A;  8ICQ A;  4ENN A;  2QLT A;  3TOB A;  1OFC X;  4BKX A;  5JU5 A;  5TIS U;  2O03 A;  4S05 A;  4KMU A;  3FXQ A;  3E97 A;  3L00 A;  2VKV A;  1X66 A;  1XB4 A;  2E71 A;  3DEE A;  4S0H B;  1LFU P;  2DYS H;  4KNY A;  5KG3 A;  2NRT A;  4FHT A;  3IAM 2;  3M8R A;  4V19 K;  1MMS A;  3L5K A;  2ZXI A;  3LFU A;  2FJ1 A;  4IL6 U;  4NUB A;  4OOI A;  1RQL A;  3DLA A;  5J3L A;  1D9D A;  4M9G A;  4QWC A;  3W6J B;  4E7K A;  2V4Q A;  1YHQ I;  1D8L A;  1W7P D;  3CP2 A;  4NL9 C;  1JUD A;  4USA A;  4BX9 C;  2E3T A;  3WK5 A;  7ICE A;  1COO A;  3L2C A;  3Q8R B;  9ICX A;  4ZTF A;  4LK0 F;  3H5A A;  4QNL A;  2CSO A;  2AXL A;  3RKY A;  2LBF A;  1R49 A;  3H0R B;  1NG7 A;  3C2K A;  3ZDC A;  4S04 A;  7ICO A;  5FLV A;  3OSF A;  3WG7 H;  5KFZ A;  5E3M A;  1IUY A;  3A0B C;  3H9G A;  4DW6 A;  3IAS 2;  1XC5 A;  1A35 A;  4A3E J;  9ICV A;  4RPY A;  2X51 A;  2ATL A;  5ICC A;  4FT8 A;  3K10 A;  2BCQ A;  1R22 A;  3DEW A;  4RBO A;  2HTJ A;  4UAV A;  4KLI A;  3NRV A;  4HA8 A;  1NK8 A;  4QZ8 A;  1SVM A;  4RNN A;  2JEJ A;  4F5N A;  5KAI U;  4EJO A;  1UZC A;  1ZRM A;  1DGW Y;  1JT6 A;  3CCS I;  4CDG A;  2DWQ A;  3WK8 A;  4C4R A;  2DGZ A;  3KFW X;  4UUS B;  4AVP A;  3C1Z A;  4EJV A;  4JX4 A;  3PUF A;  1WH5 A;  3EYI A;  1ZQ3 P;  1GT0 C;  5M3M J;  2LKY A;  5F3X B;  2ZFU A;  3RTR A;  2HS5 A;  3G1L A;  3OIQ A;  4IPA A;  1B8I A;  3JPT A;  3ETL A;  1JXL A;  3H8W A;  1IRX A;  1G3Y A;  3BS5 B;  3CCQ I;  3JTH A;  3AM9 A;  3FM5 A;  3HOU J;  1ZG1 A;  2UVW A;  1XMA A;  2L9V A;  3L7W A;  2E2H J;  3C21 A;  3BP8 A;  2IT0 A;  4KMF A;  2FOK A;  4F5R A;  2A5Y B;  2AHO B;  5KG2 A;  2XO7 A;  1W36 D;  3C2M A;  3BQ1 A;  3PW0 A;  4BY7 J;  2MA1 A;  2HHV A;  1SMY F;  2ZIV A;  4DL7 A;  5KT6 A;  3QPL A;  5C44 J;  2G5I B;  1W5T A;  2WB1 A;  2F4O B;  1MNM C;  4NV0 A;  1F9N A;  2OF7 A;  1IUF A;  4NC6 A;  4AVZ A;  2HCF A;  3Q8Q B;  3DPL C;  1T8I A;  1XSV A;  3IH2 A;  2HSZ A;  1RIO H;  2C2D A;  2CQQ A;  3H5N A;  4C30 A;  1X1D A;  1N62 A;  5D5W B;  2W9C B;  3JRD A;  4C4S A;  4AU7 A;  2STW A;  2DPJ A;  3L1P A;  3R4K A;  1RZ4 A;  2N8G A;  5TIS C;  1OQY A;  4AD9 A;  1JXS A;  3DXJ F;  4GXK A;  3UQ2 A;  4DSI A;  2L9N A;  3PR4 A;  2IA6 A;  1Z3X A;  4GFB A;  1QLN A;  4RB3 C;  2IXS A;  4PFP A;  5H2F U;  1IXS B;  4BQN A;  5CJ9 A;  1FBS A;  1U9N A;  3W2W A;  5LGT A;  5ALO A;  2DAO A;  4WXH A;  2JEG A;  3JW4 A;  3MKW B;  5ALD A;  4NY8 A;  2H6C A;  5CB1 A;  1YIT I;  2J5O A;  3GFJ A;  2IAI A;  1EKE A;  4RB2 C;  3DV9 A;  3OYE A;  3UMC A;  3T5H A;  3RBE A;  5LBQ A;  3CJN A;  3MD2 A;  3F23 A;  3FXK A;  1ZEL A;  1QPI A;  3J7Z I;  3UR3 C;  1JAL A;  1WJE A;  2ZB9 A;  2L0K A;  2H1K A;  3ZQH A;  2K60 A;  5AKI A;  4ITV A;  3JPP A;  3OOP A;  4KIG A;  4X6A J;  1BOB A;  2UXN A;  3A0B U;  2NRW A;  4LK1 F;  4R79 A;  1QH9 A;  3HZJ A;  4OMZ A;  3AG2 H;  5D49 A;  1BI0 A;  4B9U A;  2XB5 A;  2BVM A;  2XAF A;  5IYC J;  4XRS A;  2F2A B;  4M6Y A;  4N4N B;  2HOI A;  1SAX A;  5FKM A;  3VEP A;  4FFD A;  3K6G A;  4RMN A;  1DPU A;  4FAS D;  2ZXW H;  4NC7 A;  4Y2J A;  1S3J A;  4TUS A;  3TI0 A;  3W2A A;  2NRV A;  4M04 A;  4M3G A;  2E1N A;  2RQ5 A;  2KD1 A;  1AOY A;  3M9M B;  4FE3 A;  2YX8 A;  3WKC A;  1XN7 A;  3JRA A;  3G2B A;  2KIQ A;  2BCV A;  5FGM A;  3S6J A;  2XUB A;  3KFU F;  1ZYQ A;  5FFZ A;  4KUM A;  4LOC A;  1GLN A;  1AWC A;  1QQ5 A;  1FZP B;  4J9L A;  1QSL A;  3FXR A;  2WB1 F;  5DG8 A;  1QHG A;  3CMM A;  4E6K G;  2OPT A;  3JTG A;  3QUT A;  3RAQ A;  2R5Z A;  3ZP5 A;  4K2E A;  2DYR H;  2B0C A;  1A31 A;  3D6J A;  2R7W A;  4J9Q A;  4ED7 A;  1KGS A;  5K4L A;  3OSP A;  3OYI A;  2WV1 A;  2BW3 A;  2W04 A;  2BZT A;  3B73 A;  4CYC B;  1SIJ A;  4MEX A;  3GTK J;  2PI5 A;  1XPX A;  5ALM A;  1IV8 A;  2LF7 A;  5ALS A;  4IL6 C;  2R8J A;  4HPQ A;  2P5L C;  2MUT A;  1XCV A;  2XAJ A;  3HPO A;  1ETX A;  1TVA A;  5KFB A;  1B72 A;  4H0E A;  1Q1H A;  3CC7 I;  3M8E A;  5M3F J;  3S1Q J;  1MBG A;  2LC2 A;  1U5T B;  1KBU A;  1OYY A;  5GAH J;  3ROU A;  3CC2 I;  3L2U A;  3IG5 A;  3TO6 A;  3TAD C;  5IP6 A;  2Y2Z A;  1PUZ A;  5KNI A;  3OJU A;  4XSX F;  3ZGK A;  1SKW A;  4DSK A;  1O03 A;  2AQ0 A;  4A0Y A;  4XN0 A;  4EYI B;  9ICK A;  1SB3 C;  1HIW A;  1K1Q A;  5IIJ A;  2JUG A;  1S6L A;  3UMG A;  4YFK A;  1BR1 A;  3O8H A;  2IS4 A;  4EAT A;  3SI8 A;  1YRN A;  3TOA A;  3PQJ A;  3B9J A;  4QWB A;  2HOE A;  5KFQ A;  4RLQ A;  3CUO A;  4ED0 A;  1UT5 A;  8ICB A;  1MZB A;  1V3F A;  5ALL A;  4ECQ A;  2XB0 X;  3FHZ A;  3K4N A;  1MDM B;  1WJC A;  5ALV A;  4ED2 A;  2B63 J;  5J2H A;  3IWF A;  3WKD A;  4DS5 A;  4EBD A;  5JLW A;  1DP7 P;  4FTH A;  1DU6 A;  1TWH J;  2KMD A;  4Z6C A;  4PJN A;  5IYB J;  3MKL A;  3AAF A;  1VQM I;  2JA5 J;  3WG9 A;  3R9K A;  1F5T A;  1N25 A;  3B6C A;  4O3O A;  1YE9 A;  1Y8R B;  3LQR A;  1X40 A;  1S0M A;  5D8K B;  3BC8 A;  3E2E A;  2DJI A;  2VKH A;  1WGX A;  2KHQ A;  2O6K A;  2ZJ8 A;  1ZR2 A;  8ICA A;  4Y33 A;  2YMP A;  3FZV A;  2R5Y B;  4FS1 A;  4ZH4 F;  1J59 A;  4Y2U A;  5KAF C;  1JIH A;  3DKW A;  3KZI C;  3QWL A;  2P35 A;  3PNY A;  3FDY A;  1ZQL A;  2GWR A;  4PDK A;  1MNE A;  5F0F A;  4Y17 A;  5EGO A;  4J03 A;  5J40 A;  4E7S A;  1K83 J;  1KEJ A;  3I1Y A;  1K6Y A;  1JMS A;  5FRO A;  4F3Q A;  3RFA A;  1N75 A;  4U88 A;  2W48 A;  4GXI A;  1TK5 A;  2BR0 A;  2VA2 A;  3OYF A;  2FPK A;  4IHY A;  9ICB A;  2WB1 N;  1R1V A;  1PK1 B;  3FXL A;  2JA7 J;  2H6B A;  1X58 A;  4W97 A;  5TRD A;  4EVI A;  3H4D A;  4UUT A;  4OAY A;  4IX7 A;  1X3Z B;  5GTH U;  2UWM A;  1MA7 A;  1RNL A;  3K1P A;  1JHF A;  1FY7 A;  4U0V A;  1MSE C;  1J9I A;  3QU5 A;  3H5R A;  2IBD A;  3H7I A;  4KX3 A;  1X4P A;  4GYI A;  7ICH A;  3B0Y A;  5ALY A;  1BJA A;  1KQ0 A;  4NQW A;  2L7K A;  1IZ1 A; 
#chains in the Genus database with same CATH homology
 3E0F A;  2WAF A;  1T95 A;  4LG3 A;  2ZIU B;  3SMV A;  2M4K A;  3N7R C;  1MMN A;  2Z2S B;  3OYB A;  4IZZ A;  3LSM A;  1W36 C;  4QIW F;  4CSW A;  1AA7 A;  3CJR B;  3HC7 A;  4LIV A;  2AQE A;  4PJM A;  2KRC A;  1MMD A;  3CP8 A;  2QKM B;  2I8D A;  3LMM A;  3OYL A;  4IQ4 A;  2XIC A;  3OOU A;  5HVQ C;  2M0M A;  3CF2 A;  3HUG B;  3PSP A;  3OR2 C;  1Q3V A;  1Z7L A;  2VKQ A;  1KON A;  1TZL A;  2A5W A;  3H0L B;  2R7T A;  2R7V A;  1LKX A;  1X1C A;  5HLT A;  1WUD A;  2VQL A;  3VC8 A;  2F4I A;  2LBO A;  1MMA A;  2HBM A;  4O3M A;  3OIP A;  1D0Y A;  2VIX A;  2X6W A;  5KHD A;  2XDV A;  1E0E A;  3OYM A;  3OYJ A;  3H9Q A;  5CKT A;  3LL7 A;  2W03 A;  1WJA A;  2LOO A;  2Q2E B;  4PSW A;  5JHF A;  2K4H A;  1PVP A;  2CW7 A;  1MND A;  4LIU A;  4CCL A;  3K4J A;  1Z21 A;  3LSK A;  1BR2 A;  2LBF B;  4NLB A;  3K4K A;  2VJ5 A;  4DBQ A;  2AQF A;  2HMX A;  2LYB A;  2V9K A;  2JMG A;  2CV1 A;  2LYA A;  4BU2 A;  2W7O A;  2M3A A;  1FMW A;  4CCO A;  2R4G A;  3C29 A;  2K9M A;  4PK4 A;  3M6K A;  4QPO A;  2GOL A;  1A6S A;  2CS3 A;  4HNU A;  1LDK B;  3PSI A;  5LD2 C;  4BUG A;  3DPT A;  4P1W A;  3NUQ A;  1R6R A;  2VJJ A;  2HBL A;  1YT3 A;  4F55 A;  1Y6I A;  2ZIX A;  4FZM A;  3DU5 A;  1YX3 A;  3OL4 A;  1UAA A;  3F2D A;  3N7P D;  2KHM A;  1BR4 A;  4ZTJ A;  4B43 A;  1D0Z A;  2ZXH A;  1G59 A;  2E5S A;  3W2V A;  2ZIW B;  3FHN A;  2G5H B;  2ZIU A;  3C28 A;  3L2Q A;  2H3F A;  2OH2 A;  3RSN A;  3D2S A;  3DTK A;  4HNT A;  2H3Q A;  2LY1 A;  4JOM A;  2M0N A;  2CV0 A;  4CA0 A;  1WJ5 A;  3KEY A;  3LSI A;  1J09 A;  3AQE A;  2JVG A;  3QYB A;  2A6T A;  4CCM A;  2XI9 A;  3QOE A;  2HVR A;  2IGM A;  2WBM A;  1NZB A;  4HRI A;  3M6Z A;  5C0Y A;  3A2K A;  2VXD A;  4XM3 A;  1QHH D;  2KZV A;  3EUA A;  2K8A A;  1F44 A;  2WA0 A;  3K70 C;  2H3V A;  3GBG A;  2W1O A;  4QPQ A;  4E7I A;  3F53 A;  5CRX A;  1ERD A;  2G07 A;  2WY7 Q;  4U7B A;  3PL8 A;  3KX2 A;  4BJ5 C;  4XNF A;  2GOM A;  4FZN A;  2CN1 A;  1PYV A;  3DTI A;  3L2V A;  4QJF B;  4U7C A;  4BGD A;  2M7B A;  4BQO A;  3VWB A;  4FZL A;  2KJ5 A;  1FMV A;  1HA8 A;  2QKL B;  1D0X A;  2R7R A;  3FKJ A;  1CRX A;  1ED1 A;  5HNF A;  3M8J A;  2CRX A;  3AQF A;  4A8E A;  4XN3 A;  4ZC3 A;  2XSJ C;  2HOQ A;  2OM6 A;  2RNG A;  2LG4 A;  1WJF A;  2JA2 A;  3D5S C;  4DIQ A;  2L2O A;  2N1R A;  3S32 A;  2W4S A;  2WY8 Q;  1S9H A;  5KL8 B;  1V5G A;  2RQQ A;  4KJZ A;  4B3X A;  4ZDO A;  2ELJ A;  2G06 A;  2K89 A;  4BDY A;  1Q3U A;  2W00 A;  2M7A A;  2R7U A;  2K4I A;  3BG7 A;  3ZR8 X;  3J7A Y;  4OWR B;  2WAQ C;  3D5R C;  2VXZ A;  4F91 B;  2V26 A;  3VSL A;  3TMO A;  4D9J A;  2OUM A;  3OYA A;  3SQI A;  2F76 X;  2OYY A;  5CQE A;  4IC9 A;  2PJR A;  1WFX A;  4J00 A;  1JI8 A;  1D1A A;  2K4E A;  3TL4 X;  5KCM A;  1DRG A;  2CMP A;  2E5N A;  2OC6 A;  2WAD A;  4BL0 B;  5HR7 A;  3CRX A;  3VDX A;  2LY2 A;  2F8L A;  2Z1D A;  3HXL A;  4AYB F;  2KNJ A;  2KKP A;  4CGZ A;  2K8B B;  4BE0 A;  5A0L A;  3CYM A;  1MMG A;  1IIP A;  3OWT A;  2WAQ A;  2W7P A;  4Y4R A;  1SZH A;  4HSR A;  3RF9 A;  2VLA A;  1XO0 A;  4OJP A;  2X6X A;  4CRX A;  2L9S A;  4NNJ A;  5HNH A;  3OYD A;  3O0F A;  2VQH A;  1ECW A;  3I9V 2;  3F2B A;  3PST A;  4PJL A;  4BJT A;  4YRV A;  4ZJZ A;  4BAC A;  4D1Q A;  4BEH A;  3DWL E;  1PVR A;  3AFH A;  3KYL A;  3S3N A;  3H9J A;  3PJR A;  5T14 A;  4BJ6 C;  5LFA A;  2BW3 B;  1D1B A;  2F77 X;  2RRD A;  4OJ5 A;  3ALR A;  3H35 A;  4XLH A;  4ZDP A;  2VPL A;  3DKX A;  3E1S A;  3U21 A;  2G09 A;  2HPM A;  4E7H A;  2VB6 A;  3PFY A;  2GOX B;  2IGO A;  3SDB A;  4BJQ A;  1G8X A;  3CES A;  2WB1 C;  2X1D A;  3H0D A;  4KIT B;  4C0Z A;  2Z16 A;  4JQF A;  2Q4T A;  4E7Z A;  3LYS A;  3OYH A;  2E5Z A;  4PL1 A;  2RRE A;  2IS6 A;  3LSH A;  2X6Y A;  3K4B A;  2DXI A;  3SAF A;  4JMU A;  3ONQ A;  4OAZ A;  2R7O A;  4RM2 A;  2IS2 A;  3SAG A;  3IG8 A;  3EPZ A;  4RLF A;  3ZRG A;  4NC8 A;  2LH9 A;  3HPG A;  3I3L A;  3VSK A;  3K4L A;  4RM3 A;  2Q1Z B;  2HBJ A;  4HEA 2;  3KZX A;  3K70 D;  3RQ4 A;  2HNH A;  4NQW B;  2XF5 A;  4F93 B;  4E7L A;  1Z1B A;  4BUP A;  4GRI A;  1Z19 A;  1Z3Y A;  2IS1 A;  3MKZ A;  2KRH A;  4WJ3 B;  3F9K A;  2NOJ B;  3HKZ F;  1URJ A;  2ZG6 A;  1XNS A;  2HQA A;  4OJL A;  2BVL A;  2E1E A;  3F5A A;  4F92 B;  1TAM A;  4XLA A;  4XKW A;  1GO3 F;  1LVK A;  1OR7 C;  4E4H A;  4PFO A;  4CCK A;  2X1E A;  1DQU A;  3OR1 C;  2PJR B;  3OYG A;  4XLF A;  4XLC A;  2NV3 A;  4XKB A;  4XKC A;  5KL1 B;  4NLC A;  2ZIV B;  4XOP A;  1EA3 A;  2CUJ A;  3PSF A;  1OLT A;  3QYF A;  3OS2 A;  1X1A A;  2KDO A;  2CFO A;  1HEK A;  4BDZ A;  2Y0S F;  1WJB A;  2HOF A;  2XAU A;  4ZYA A;  3PNT A;  4HST A;  2L5Q A;  4XMY A;  2CPR A;  4XQF A;  3HKZ A;  3OYC A;  3SEZ A;  2RP5 A;  2XID A;  3DPU A;  4KT6 A;  3MGV A;  1P7D A;  2E1M B;  3OS0 A;  4OJO A;  3BCB A;  3FBI B;  2DQN B;  2HDW A;  4PJJ A;  2K9L A;  2KKV A;  4BEH B;  2VKD A;  2WAQ F;  3OMY A;  4PL2 A;  2XC7 A;  1LFP A;  3DEE A;  1VZ0 A;  3VYS B;  3IAM 2;  2GH1 A;  3PNV A;  4II2 A;  2ZXI A;  3LFU A;  4AYB A;  4NUB A;  4X0G A;  3DLA A;  2VQC A;  3PZP A;  4E7K A;  2K5C A;  2BOL A;  2PMZ A;  3CP2 A;  4BX9 C;  3AKZ A;  4B47 A;  4XL9 A;  3AL0 C;  3L2R A;  5TGT A;  4ZTF A;  3H5A A;  4QNL A;  3H0R B;  4ACO A;  1Y56 A;  2LBF A;  3EUK L;  1NG7 A;  2R7Q A;  2K8C B;  3V42 A;  2H3Z A;  2E60 A;  2UUZ A;  3H9G A;  4BE1 A;  3IAS 2;  1P9Q C;  2X51 A;  2CH0 A;  2LYC A;  2MAB A;  3K10 A;  3SAH A;  1V5E A;  3D5L A;  1DP3 A;  3VYR B;  2LHT A;  2CV2 A;  4MLO A;  2MFZ A;  3K4C A;  5CQG A;  4OJ6 A;  2HVQ A;  2VL8 A;  4XLE A;  4BE2 A;  4P0P A;  1DGW Y;  2HZD A;  4CDG A;  2OV7 A;  2DGZ A;  4B48 A;  3M7D A;  3L2W A;  4IQJ A;  2ZIW A;  4PUS A;  1SFK A;  2IGK A;  3OYK A;  2LKY A;  3OY9 A;  2ZFU A;  2UV1 A;  3RTR A;  3RPU D;  3OIQ A;  3NRW A;  1D8B A;  1IRX A;  2A3V A;  2Y0S C;  1WJD A;  5HR6 A;  4HG2 A;  1MW7 A;  3M1C A;  2G08 A;  4C2T A;  2CUZ A;  3OL3 A;  1W36 D;  3N7S C;  3QYE A;  3SEQ A;  3ZXS A;  2MA1 A;  2F6C A;  2ZIV A;  2JGA A;  1UPH A;  2VQG A;  3PUB A;  2G5I B;  4P5O A;  2WB1 A;  3E0J B;  3D2Q A;  3LVV A;  4LIT A;  4AVZ A;  2Z7J A;  3A4C A;  4XON A;  4NV0 A;  3BG6 A;  3DPL C;  1OUQ A;  2W7N A;  3H5N A;  4C30 A;  4CZC A;  2JH1 A;  4P0Q B;  1X1D A;  2WAE A;  2JVH A;  3K1Z A;  4DGW B;  2KVC A;  4AU7 A;  3S3M A;  3SYT A;  4F52 A;  5FRN A;  4G6T B;  3ZCO A;  2HPI A;  2PMZ C;  4BS9 A;  2L9N A;  1X1B A;  1Z3X A;  2M4G A;  2E1M C;  2IXS A;  4PFP A;  2ZIX B;  3D2N A;  3NWT A;  3IUO A;  4BQN A;  1L6N A;  5HOO A;  3W2W A;  3MKW B;  2KJ9 A;  4Y3O A;  3VCB A;  4ZDL A;  3OYE A;  4U6P A;  2V1N A;  2HBK A;  4C2U A;  1D1C A;  3DKY A;  3MD2 A;  1ZEL A;  2R7X A;  3UR3 C;  2X85 A;  1WJE A;  3K4M A;  2DF4 B;  2VJ4 A;  3LVW A;  4ITV A;  4CCJ A;  1BOB A;  2DOA A;  4PSX A;  4KMO B;  3VYT B;  1TT0 A;  4R79 A;  3HKZ C;  3OPX A;  4GFJ A;  2HU9 A;  2MC4 A;  3HOS A;  2BVM A;  2F2A B;  3L3F X;  4N4N B;  3FBN B;  2HOI A;  3RCO A;  2KPM A;  1UG0 A;  2ZSH B;  2KLO A;  3K6G A;  4RMN A;  3HOT A;  3TBI A;  4FAS D;  2DT7 B;  3C2H A;  4NC7 A;  3ONN A;  3IN5 A;  3W2A A;  2MRL A;  1A0P A;  2ZSI B;  2H3I A;  2KD1 A;  4FE3 A;  3OS1 A;  2YX8 A;  4YEJ A;  4B44 A;  2KIW A;  3G2B A;  2MD0 A;  2KQR A;  1PVQ A;  3KFU F;  3VYU B;  1T0F C;  2F5V A;  1GLN A;  4AYB C;  2WB1 F;  3CZ6 A;  2JSP A;  4FET A;  1QHG A;  3CMM A;  4XOT A;  4E6K G;  2YB1 A;  3DU6 A;  4QIW C;  5FRM A;  1N78 A;  4XOR A;  2KIC A;  4DJA A;  1U0J A;  3N05 A;  3QOD A;  3UNG C;  2R7W A;  2PMZ F;  2G0A A;  3OYI A;  3BCA A;  2BW3 A;  2W04 A;  4KX5 A;  3HL2 A;  4N4O B;  1ZQ1 C;  1DGR M;  3MMY B;  2JH7 A;  3OYN A;  2DCE A;  4HPQ A;  4BXF A;  2CW8 A;  2OXO A;  2X1C A;  3DQV C;  3HG9 A;  2KV2 A;  1V5F A;  3SZG A;  2LC2 A;  4ANJ A;  1KBU A;  3IG5 A;  2IGN A;  2P0W A;  3L2U A;  2VAS A;  4CUG A;  3ZQQ A;  2LRD A;  1YX5 A;  3CJQ B;  4H4K C;  1X4O A;  4YEL A;  2O5R A;  3ZGK A;  2XVT A;  3S3O A;  3ICX A;  4XN0 A;  3AL0 B;  1N77 A;  2V7F A;  1HIW A;  2RHF A;  4II3 A;  2JUG A;  4DOZ A;  1BR1 A;  2IS4 A;  4EAT A;  4CCN A;  2XF6 A;  4C9Y A;  5KNL A;  2BDU A;  4RLQ A;  2V6E A;  3C2G A;  3T79 A;  3K4N A;  1WJC A;  1UEL B;  4ICA A;  2D6F C;  3GU3 A;  2KL4 A;  2E1F A;  3W3C A;  4PJN A;  4XKV A;  1PJR A;  3MKY B;  4E7J A;  3LSG A;  4OO1 J;  1YE9 A;  4U87 A;  3S93 A;  2KJ8 A;  3BC8 A;  3NWS A;  2JHD A;  2DJI A;  2VKH A;  3BLY A;  2KEY A;  2KHQ A;  4XR6 A;  4Y33 A;  2KHV A;  2K3P A;  3EUH C;  1SAU A;  4P0Q A;  3H0M B;  3F5E A;  3PNY A;  3FDY A;  5CPR B;  1QU3 A;  1MNE A;  3DTE A;  2KOB A;  2HVS A;  4E7S A;  4IKF A;  3HPH A;  1K6Y A;  2FUG 2;  2VJI A;  5FRO A;  1N75 A;  2MYS A;  4F3Q A;  3RFA A;  4P0P B;  2V4J C;  2YB4 A;  2R18 A;  3OYF A;  4DBR A;  2DT6 A;  1T94 A;  3F2C A;  2Y0S A;  4KIS A;  1X19 A;  4NWI A;  3S8P A;  2KMU A;  1NG6 A;  4OAY A;  4IX7 A;  2LRE A;  2UWM A;  1MA7 A;  3A1Y A;  2KP6 A;  4CH7 A;  2XF7 A;  3H5R A;  4KX3 A;  1X4P A;  3GZF A;  3IP4 B;  4BQQ A;  2W82 A;  2R7S A;  2L7K A;  4J01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...