3DEEA

Crystal structure of a putative regulatory protein involved in transcription (ngo1945) from neisseria gonorrhoeae fa 1090 at 2.25 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the first representative of Pfam family PF09836 reveals a two-domain organization and suggests involvement in transcriptional regulation.
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Transcription
molecule keywords Putative regulatory protein
total genus 55
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09836 DUF2063 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3deeA02
1.10.150.690 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3deeA01
3DEEA
chains in the Genus database with same CATH superfamily
2E5SA 3QU5A 3QU9A 1Y0UA 1SZPA 3BR6A 4M9XA 2CXYA 1YITI 2CN1A 3RRHA 2DT5A 3E97A 3J81K 1T94A 1S0VA 1F5SA 4KISA 3TI0A 2ZFWA 2KZVA 4KT5C 1XSNA 2VA3A 5CVJA 2V6EA 4UUTA 5EE1A 4EGZA 3MGIA 2DGZA 2GM4A 4ED8A 2W84A 4E7HA 1N78A 3FBIB 2KVCA 3H3VK 2QWWA 2R7VA 1KLNA 3EETA 5KFRA 3QEBZ 2OAZA 4GXIA 2H94A 4CCOA 2YMLA 1KU2A 1QZYA 1KU7A 3HB9A 4PJ0C 3RPQA 3COAC 5ALDA 1BPYA 1FZPB 3J81Z 3RJIA 4M04A 1D9FA 5KG2A 5KT4A 1XSPA 1CRXA 1UB9A 2MA3A 3RQ4A 3OYIA 4AIKA 4IOAF 5AK3A 5KFOA 4U7CA 5K1YA 3JREA 1R71A 2ELJA 2KDOA 5B1BH 4DL5A 2HW3A 3FAHA 2XICA 3H8MA 4C2MJ 1DXSA 1X9XA 1UG0A 2YMMA 1SD6A 1EV7A 2FPMA 8ICYA 2E8NA 4Y2PA 4TURA 3ZMTA 1SFOJ 2LY1A 4U0WA 2IP2A 4UARA 2DPIA 4O3SA 3P5JA 4GO1A 4M3BA 4BNCA 9ANTA 2DTRA 2LNBA 4C30A 2R0QC 2M34A 2BY2A 1VQLI 2KVSA 3NRZA 1MMGA 4LG0A 1FY7A 2IS2A 5J2KA 2C28A 1MBHA 3CCSI 5KT7A 3DCFA 3K7AJ 3V7SA 3WK8A 1I50J 4RQNA 1RI7A 5BS6A 3K70C 2KRCA 2PFNA 2V9WA 3M7DA 5DDMA 2PI5A 4KLUA 4IQVA 2MC4A 4MEYF 1TNSA 1BGXT 4BKXA 1BOBA 1B1BA 3GLXA 4ECRA 4P0QA 5IP7J 1J97A 1U48A 1HW1A 3M8EA 2VB6A 4DO9A 2PFPA 2ACJA 5FLVA 3R61A 3JRIA 3HTSB 1Q3UA 1KU9A 3TO7A 2QGUA 5TJJA 4HEA2 2AGOA 1KRPA 3I1YA 1WJAA 1OXJA 3V7LA 4OMYA 5KFMA 1ZG5A 3GIJA 1O57A 4KMUA 1OYIA 4IF4A 1LVHA 1S7OA 1VQ5I 4FZNA 1D5YA 1U2WA 3RTRA 4C7YA 4TQRA 1UAAA 1KQQA 1YW7A 4CCKA 3RIRA 2JVGA 3V4GA 3W6KB 5F1RA 1ETOA 2MA1A 3ZQFA 3OTQA 3AU6A 2BCRA 3AM9A 3CYMA 2LH9A 4CRXA 1ZN2A 4ECZA 2EIJH 4HX7A 2LTPA 3J81j 1SAXA 2R92J 1MIJA 1QHGA 2OF7A 3IC7A 4EEFG 5JVGF 2H6CA 4DS5A 5ALJA 1B59A 4U6PA 2ISOA 3JPNA 3FM3A 5K7FA 3C2BA 4IKFA 1D8JA 1YZ7A 3RAQA 2FQ3A 2OJED 2ALZA 8ICUA 4CGZA 3AUOA 3L2UA 4FBUA 1UHMA 2WC2A 4IHXA 1IUFA 4XLCA 2BGWA 2PX9A 4ZOHC 2RNGA 3HL2A 4QSHA 4MQVA 3C1ZA 5J2DA 1TE2A 5KG4A 3HOWJ 4EELA 1ODDA 1ZG3A 3NWSA 2W04A 4PZOA 2UVUA 1GXPA 4WWCA 5ALGA 4RB0A 5GAGJ 5GADJ 3IV6A 2PG4A 2E5NA 4LG0B 3K1PA 4OIOF 3LFUA 4BXXJ 2DA1A 2COMA 5A2QK 1ZQAA 7ICGA 2GOXB 2BYVE 5AONA 1TQPA 4I2OA 2WF8A 1JT6A 5AI0A 5CWRA 3IN5A 1L6NA 2HTSA 4UHTA 2KKPA 4TUQA 4F50A 2DPJA 2W9BA 1QRYA 2O6GE 2ZXJA 4C8LA 2KICA 4ECVA 3QUBA 1YW8A 3AG2H 4Y2QA 1G3YA 4RT3A 2DU9A 4O3QA 1X6JA 5BOMA 2M87A 2X0LA 4JMUA 2HPIA 3JSPA 3PFIA 2NNYA 2X9DA 3TO9A 2KN7A 4DFMA 4NY8A 3V42A 2ZTEA 2RHFA 2IA6A 4Y33A 3DQVC 3UMCA 1N75A 2MGQA 4V2GA 1KDHA 4RAZA 3IH3A 1SWVA 3PUFA 3WK6A 1S72I 1Z3EB 4E7JA 4H0EA 4OAYA 4TUPA 2FLNA 2HZTA 1LFBA 5JHUA 1AQ6A 3KZYA 1Z4OA 2Z16A 1ZELA 4I0AA 5DEQA 3T1BA 1S77D 3DEWA 4ZDPA 2G0EA 4ENNA 5DKWA 4P4PA 3GFIA 1RYSA 2K4EA 2HOAA 5KAFU 2OBPA 2JR5A 4LJXA 3E6CC 4XLFA 2E8PA 5EG0B 2PFOA 3OYKA 1BPXA 3SYZA 1QGPA 2XF6A 5HDKA 4MTDA 3H8WA 1COKA 2BV6A 2G09A 3DEUA 3Q5FA 4OJPA 4W1UA 4CO8A 5KFZA 4RLQA 3PSIA 4YG2F 1YOVB 2E60A 2JA5J 4PGYA 2W25A 4LOCA 3QRFF 5GP9A 5IT9Z 2N1RA 3VCBA 3C2LA 4EJOA 2YR2A 2ODGA 2Z7JA 4A69C 4RQ0A 1MMNA 3SDBA 1U5TA 2HDWA 2K8CB 3RZOJ 3FKIJ 4KLJA 3WODF 3I4PA 2A69F 2R8GA 3PMNA 2JTVA 2DFIA 2ZJ2A 3ZMUA 3F21A 4YN4A 2A6HF 5AKIA 3KD3A 4RPYA 5AIAA 1OLTA 2E1MB 2EZLA 3FXLA 1JKOC 1BC8C 4UB3A 4EZ9A 3QQAA 1D8KA 2FX0A 2BVMA 1IRGA 3QUCA 2HNHA 5J2HA 1VI0A 1XSVA 4QLCU 2PJPA 1W36D 1D0ZA 2DYSH 4MQ9F 2EAPA 4GXOA 4G9YA 1TLHB 5ALQA 2LLKA 4RQ2A 4OJOA 3DBHB 3K10A 2DA2A 1MBJA 2CW8A 2MBFA 5L3FA 2P7VB 3IRQA 1BNOA 5KL1B 4XRHA 5KFCA 3PUBA 1X3WB 4B47A 3OYHA 1FO4A 4L9TA 1YX3A 2R5ZB 3GTLJ 2EJRA 7ICVA 2K8AA 4E7LA 5FLXK 5AM0A 4WX9A 5ALZA 3Q0WA 4IQWA 3LL7A 5LEJA 4FQGA 4NLCA 3PMLA 3Q8MA 2NAZA 5GAHJ 3DDHA 3OYLA 4U0VA 2MC3A 5CEHA 4WJ3B 2GA2A 3ZMVA 5DTDA 4PHEA 1E17A 3PO2J 1D1CA 3F22A 2FNPA 1HKSA 4QZIA 2MH2A 3KLNA 2QF7A 3GFMA 4C4TA 2HHWA 2Q2EA 4XUSA 5FO5A 3DFGA 2JEGA 1AKHA 1S8OA 5LLQA 5C3EJ 2K89A 1LKXA 2RDPA 3CF2A 2X6WA 1LPQA 2VONA 1OQYA 4PJJA 1K7AA 3A0HU 5EG0A 3N7RC 1J75A 2ECBA 2QYOA 5DM6F 2ZKZA 5IYBJ 1T38A 3Q0VA 3V8LA 1YT3A 5HR6A 4PGXA 2FNAA 2CUEA 3RYPA 2QM3A 1IAWA 3FXMA 4JYKA 2L2OA 2HOEA 4ACOA 1TK5A 3VOEA 2CUFA 1W36C 2L9SA 2P7CB 3BQ7A 4EZ6A 5ED4A 2VC1A 2VKHA 4M73A 3HRMA 3QU3A 5FGMA 1R49A 1ZD5A 2IOFA 1IV6A 2GIZA 1BOAA 2GBYA 2XUBA 1OW5A 1TFRA 3UMBA 1T39A 1HW5A 5FKLA 1RPLA 5BPDA 1NOMA 1F43A 3GTGJ 2K9NA 1V38A 1A0PA 4PGQA 1ZQEA 1ZRCA 2F2AB 4Y2YA 3FX3A 4M3DA 3OHAA 4ESFA 4AIHA 1PK1B 3E0FA 3OJUA 1J2MA 9ICCA 3EUHA 2PMUA 4Y3OA 2GLOA 2QSHX 4J9LA 1B4AA 2KDZA 2I5UA 5IPAA 4TV7A 4YFXF 3FXOA 1GVDA 1ZRDA 1K4TA 3BR1A 3Q3SA 2J6TA 5IILA 2H5XA 1FOXA 1ZQGA 1XX5A 4GFJA 2LRDA 4AYBA 4MFEA 2PMZF 2P35A 3CMYA 4IRCA 4HNVA 1Q3VA 4F92B 1EXNA 4BH9A 2FI1A 2A3VA 1NKCA 4L18B 3C29A 3SV4A 2WB1N 3AQEA 3UM9A 2Y69H 1VQOI 5F04A 1RIOH 3M4OJ 1SD4A 3PR4A 3RKYA 2YX4A 1FYKA 5L3GA 3ONNA 4FE3A 1USTA 4JX6A 5CYVA 1YE9A 1WSUA 2FBHA 3BTCA 1ZQ1C 1MBKA 2JHDA 4DSLA 1WJEA 3LSKA 3GZ5A 1UZCA 3REOA 4HLYA 3RJGA 4RBOA 4B9VA 3B0YA 4UVBA 4FX0A 2XF5A 3S3OA 1YG2A 1LE8B 1WWVA 4F8RA 3D6JA 5F9LA 4I27A 1K6OA 4DL6A 3DLAA 3CDLA 5DYMA 3BZ6A 4MTEA 3EDPA 5G5HA 3H4DA 2L9RA 1V5EA 4DYRA 4L9VA 2PLYA 1MW7A 3OV8A 2FE3A 3EPZA 4QIWC 5EZHA 1C7YA 8ICFA 3UQ2A 4LB6B 3L9FA 2BGCA 1TT5B 2R7SA 1WCLA 3N7SC 2EV5A 5DB9A 4F4KA 5IP9J 4DZJA 5KVRA 2KEYA 4TUSA 2W55A 4DSJA 4JV2A 1JHHA 3IUOA 4HX4A 1JMSA 3G1MA 2AHQA 2VE8A 5E18F 2G06A 2LM4A 4ZDOA 2ZB9A 4XLAA 2JK3A 3L2VA 7ICIA 2HHQA 1ZREA 2O0YA 2MUTA 5HMLA 5DG7A 2WB1C 3K1NA 3K4JA 4XKBA 3BQ0A 1O4XA 3IL2A 3GBGA 2K60A 4CSWA 2KP7A 2VA8A 4JP0A 4DZPA 1OR7C 3WKBA 2VASA 4CCJA 2B0CA 2YB4A 2ASDA 4BE0A 9ICGA 3SYTA 1YX5A 2E1CA 4D5CA 4QZHA 2DUYA 4MFFA 4L9JA 4HLXA 5DCMA 3PNTA 2LKXA 4NC8A 2NRVA 1U4BA 4Y17A 4ASNA 2VPLA 3KEYA 1DGJA 1B9NA 4OIQF 3F2BA 1W7PA 3KYLA 1PP7U 4HNTA 3QPHA 4M3FA 1U8BA 5D49A 1X9MA 3S3NA 1ZQOA 2YTUA 4J19A 1VTNC 3HSRA 2QKMB 1R9TJ 3DU5A 2A19A 5FD5A 5GAEJ 3OYCA 1QLNA 2RNJA 2WFAA 2ZTCA 5D5VB 4KLQA 1RPWA 1MJ9A 1MMSA 2K3PA 2BPCA 1LVKA 3L1PA 1CUKA 2WWYA 3BJOA 3W6VA 1RETA 2HOTA 3S1MJ 2MSNA 3NEUA 5AK4A 5KFSA 2XAHA 4QWBA 3OSNA 1ZQPA 1OCOH 2K9MA 4MHVA 2KK0A 2XAUA 3MKWB 1A04A 4IJAA 5E1XA 3TMOA 1HCRA 5M5YJ 4NHJA 4KMUX 1EF4A 4F2SA 5LGTA 2V26A 2M30A 1UG2A 3PNYA 1L0OC 5DUKA 3ZXSA 4ON0A 3TQNA 5FB2A 3S16J 3T5HA 4JV1A 4KLGA 2G9WA 3D0SA 3RJPA 2HOSA 3H0GJ 3LQQA 1PUFA 1DU6A 2MRLA 2QQ8A 1J9IA 4R79A 5KFEA 4J9MA 1QNTA 5J2IA 2JPCA 4ITVA 4II3A 1SKRA 9ICMA 9ICXA 1S5LU 3QWLA 1T7PA 9ICPA 1S76D 4UAUA 4RM3A 1LNWA 3ZDBA 1FX7A 5FD6A 3GZNB 5DGBA 4DQSA 5A0LA 3CUQC 2O3FA 2E2HJ 4DL7A 4B9SA 4ELUA 2DQNB 4YR0A 3RKWA 1D1BA 5IOYA 1YTYA 4XN0A 5DQGA 9ICVA 1BPZA 4O5VA 3WTUC 2HVSA 1S8NA 2CV1A 3QU2A 1ZQIA 3GILA 5J2JA 2Y0SA 4GYIA 2ZJPF 1LQ1A 2P0WA 1G3TA 1B0XA 5BOXA 1R7JA 1ZQQA 2R5ZA 4UV9A 5FKNA 4J03A 1R23A 1JX4A 4O5EA 4O5KA 4G94A 3OY9A 3D5RC 1AWCA 2L7KA 5KT6A 1N25A 3HG9A 2BEOA 3CMMA 3R60A 3DPLC 1X3ZB 1VQ7I 1YRNA 1M1EB 4QWDA 3HOYJ 1WRJA 3CC7I 3I53A 1XWLA 2ASLA 1X66A 2X48A 1YLFA 1IN4A 3H0DA 3KHRA 3RJFA 2BCSA 4IPAA 4UVCA 4GIBA 4HF1A 4O3MA 1QH9A 2L7MP 5JLXA 1H0MA 4YRVA 4Q8EA 1KL9A 3CCUI 2YN4A 5GTHC 1STZA 4LK1F 4HBLA 5JHFA 2XIDA 2JMWA 1ON2A 2M0CA 4A3MJ 4QZ9A 4MLOA 2EFPA 3CUQA 1F1ZA 2Q1ZB 3CCYA 3IAS2 5HS7A 1DQUA 5GTHU 3ZQCA 5LHHA 2JMGA 4P0PB 2Y31A 4BY7J 2AQ4A 2ZXWH 2XGPA 2QUFA 3HP6A 2BY1A 1E3HA 4HSTA 1Q1HA 2IA0A 1RQLA 4IX7A 3RFAA 3P9CA 3SZTA 5EDNA 1C20A 4FS1A 1W5SA 1XGNA 1PJRA 4IHYA 1MN8A 2GH1A 4ED6A 1H9TA 3D2SA 3QU6A 2M9NA 3S93A 1HC8A 4A3EJ 1BJAA 1VQKI 2NRZA 1LV5A 3NWTA 1QO0D 3F5AA 4Y2TA 4Y2XA 4GLXA 4KLHA 1Y56A 9ICAA 2KZGA 3DBRB 2HYGD 2ZTDA 1P4XA 1ZKGA 3DBLB 4RS8A 9ICIA 2HQNA 3I59B 2FA5A 2FMLA 4BEHB 2MYSA 2V9VA 3ECOA 4HQMA 1WI9A 4JBAA 3B0XA 4PL2A 4AP9A 3M7GA 4PHPA 1OUQA 2IW5A 3TFRA 4E7ZA 5CP2A 3WGGA 4ANJA 5KG6A 3WK9A 3CRXA 2FBIA 4LB5A 3TKYA 5LGUA 1LFPA 4I2JA 5JVTA 4Y2VA 2FEZA 1I1SA 5DCFA 4ELTA 5BPIA 3K70D 3CO7C 4J00A 3GTQJ 3ICXA 5AKHA 2R7QA 5H6RA 5B5EU 5DQHA 4IQJA 4ELVA 5KFPA 3H0LB 1T98A 3DPTA 1JROA 1T3NA 3V6JA 4KLIA 4EBEA 1D0XA 2RKHA 1HA8A 5ALKA 2M0MA 4G9BA 4D7MA 4BWMA 3ULQB 3IV5A 5KT5A 2VOPA 3RTVA 2O03A 5L3CA 1UA0A 1J2XA 2KISA 5DB6A 5CLSA 4MGRA 1QQIA 4MHGA 3ISCA 4R66A 2A05A 1Z7UA 3CJNA 1S29A 3HRSA 2X4HA 4MIMA 2VKQA 2FJ1A 1ZQXA 1QSYA 3DU6A 3F5EA 5L1KA 9ICBA 3K69A 2QCOA 4ENMA 3FF5A 2HXOA 1RESA 3KE2A 4C2TA 1MQ2A 3RQIA 3RZDJ 4U7BA 2LYCA 1R36A 2HR3A 5J40A 5KFHA 1RR7A 5KHDA 3HBLA 1K6YA 2E35A 3LAJA 2GXBA 3PX6A 1RYUA 3HRUA 1JHFA 2BCQA 2RQQA 4JX5A 1QZZA 4EQQA 5KFBA 1TWAJ 4OIRF 5IIJA 1JKRC 3RB6A 1EH6A 3AG1H 3O6BB 3RSNA 3JPOA 4AYBN 1MNDA 5FRNA 1IDZA 1LE8A 3QP6A 5B3SH 2AXTC 3CJTB 3HOSA 4G7HF 3WGIA 1MDMB 1T8EA 4F4YA 1BR1A 1Z1BA 7ICJA 3G1OA 2WV0A 2NRXA 4G3IA 5LEKA 4DYQA 3BQYA 2WADA 2K4PA 3Q0UA 2W03A 3THVA 1XCBA 4Y2UA 2YS9A 1BR4A 1FOWA 3R0JA 2ZIWA 3FIWA 2F4OB 1ZQCA 1HXDA 1RG6A 1JI8A 1X9WA 4LVSA 4BJQA 1BBYA 1U5TC 1DDNA 3C1YA 4RQ3A 3B9JA 2KFNA 3F3XA 4KIGA 3NQOA 1G3WA 2W1OA 3ZQQA 3S2WA 2OCCH 2V1DA 3PR5B 4QW9A 1RQNA 2X85A 2K8BB 2KIMA 4EGYA 3LSTA 1LFUP 4FO6A 2FPLA 1R1TA 2O6KA 1P6RA 2BKEA 1WZ2A 2KZ3A 4Z6CA 2F8LA 1PUEE 3SENA 1HDDC 2LYHA 4DCCA 1O08A 3D2NA 3AG4H 3BPXA 4A3KJ 2BBYA 3GZFA 1OCRH 2VBZA 4KA4A 1KA8A 4PFPA 3BG9A 3E6MA 3HRTA 3KEOA 5C44J 3OYDA 2CV2A 3SZPA 5HNHA 4XOPA 1FLIA 3H8JA 4EV0A 4MF2A 3N97A 4NM1A 3HHHA 8ICSA 3ZDAA 2DFHA 2FF4A 2KT0A 3ABMH 4GGGA 1Y88A 4CZZA 4QWCA 3LWFA 2E8OA 3A2KA 3QYBA 3F6VA 4PJNA 4YP3A 4FX4A 4B9TA 4BS9A 1Q8KA 3OSFA 3BP8A 3N28A 1BI3A 5T14A 4E0DA 3H3ZA 1X6IA 4FASD 1TQIA 4RAYA 3GTPJ 5TGTA 4JV0A 4PJLA 2I1QA 4ICAA 2JUGA 2VKDA 1JKQC 3NASA 1TWCJ 4U7DA 2EINH 3SI8A 4UBBA 3DP7A 3GUDA 8ICCA 3WHCA 4PPXA 1V5FA 3FKJA 1WWUA 5E1WA 3VSLA 2FJ6A 5KG0A 4GC7A 1T8IA 5D46A 2LF7A 5FKMA 4DYCA 1S9HA 1SKSA 3HKZF 3TW6A 1APLC 2GXAA 1COOA 2C2RA 2FLLA 2ESHA 2COBA 1PVQA 4XL9A 2XAGA 3OWTA 4Q5SF 2ZIUB 4CZCA 5DGAA 2CG4A 3ZMDA 3KKAC 3UMGA 4DL3A 1NK0A 1GV5A 4FCYA 3S8PA 1SVLA 1JUDA 2C2DA 2LOOA 1SV0A 2NYVA 5KFJA 5BMZA 7ICLA 1KN5A 5TISU 2GAUA 4HZFA 3LSPA 2EAOA 2BZFA 2A1JA 2OA4A 2HKXA 3ABLH 4IQUA 4K4IA 2HHSA 1LB2B 3NVYA 5DG9A 4AU7A 1ETXA 1FP1D 2DYRH 2MAXA 2Z33A 5L1LA 4RNNA 5EWFA 4W97A 4LGWA 3H0MB 7ICSA 2IOHA 2IEKA 3SAGA 1UHWA 1OKRA 2HHXA 1PDNC 1IN7A 2EFOA 3DTIA 4MFCA 2H3ZA 3FK7A 3G4SI 1U3EM 4JOMA 5D5XB 9ICOA 1PYVA 5E79U 3IRRA 1ZXIA 2VJ5A 2HCFA 3UXNA 4ED3A 1TQMA 2DFFA 1BVSA 3WTYC 1FYMA 2R5YB 1X1DA 4M47A 3GIMA 2OZ6A 8ICWA 2HDCA 1X58A 2FQ4A 1TL8A 2M3AA 1F5TA 3VWBA 1S10A 3H9JA 1IJWC 2EFWA 2TCTA 4M72A 3H7IA 1TTYA 2KRHA 4G8XA 4ZTJA 2DMPA 3ZQHA 4RAGA 1BN5A 4UB2A 3DEEA 2Q8KA 5J0PA 1X9SA 2PJRB 7ICOA 1IDYA 4BEHA 1F36A 3RAXA 3D2QA 3NRWA 3S2HJ 3SZ2A 2A5WA 2Z1DA 2DA6A 1QVTA 4NDLA 1YW9A 3HILA 4PJ0U 4HYKA 1P7DA 5IOZA 1Z05A 3QPTA 1GLNA 2VKEA 2F5FA 2LYBA 4IHWA 1MC8A 3HOXJ 3D5SC 3MDCA 3PNVA 3BR5A 1ZQLA 2Y0SN 2IHMA 1VQ6I 2VJIA 1SD7A 2GQQA 4XLEA 3ZN1A 1KQ0A 3WKEA 4A3CJ 2XPVA 4YR3A 4ETSA 3KHGA 1TC3C 1E2XA 2V4QA 3MC1A 3WTZA 1ZQJA 5AI6A 4ZYDA 5KFLA 3GFLA 2OZUA 3B02A 3KP2A 2YMQA 5CQGA 3S1RJ 2R8HA 2BPFA 4P0PA 1KQ9A 2FMSA 1FFUA 2JXJA 1J2NA 4BJTA 4LFUA 3KP3A 1MDMA 2BCUA 2ZJAA 1ZYRF 2XAQA 1IXSB 2X51A 4DW6A 3DTKA 2PQ8A 2QKQA 1YJ9I 1SZHA 2ZUCA 4RQ6A 1Z77A 2M4KA 5K5QA 2F4MB 2XGEA 1E3OC 1JRPA 2EIKH 3FXUA 2L54A 3KPHA 2QBYA 3WU1B 1D8BA 4DS4A 1RZ4A 2E1EA 5IIMA 3FISA 4UW9A 3H92A 4B3AA 4E70A 4MFAA 2UZKA 2LC2A 4ECXA 2W24A 4B9MA 4IVNA 4Y7NJ 2VIXA 5JR3A 1EA3A 3HOTA 1BNPA 4BBRJ 5HVQC 3UR3C 3JAMZ 3S32A 3ZN0A 5KAIC 4ZYGA 1SFKA 5D4SA 1URJA 4LD5A 1A5JA 4N9IA 2F77X 1K4SA 3T5LA 2HDOA 2HQAA 4AIJA 1YHQI 4PJMA 4L0YB 3L3FX 4O3PA 1NZPA 1KFDA 3HIFA 2MSYA 1OR7A 3LVWA 3K6GA 1SKWA 4A8EA 3BG5A 4NB5A 3WTSC 5IIIA 3KP5A 4ECSA 3JRFA 1XSXA 2E1NA 3IG5A 5J1UA 2F1HA 5AI8A 4ESJA 3PSFA 3CP2A 1YI2I 1K5OA 1S7AA 4FZLA 5J1RA 3HW8A 2KIQA 3GMEA 2HOFA 3SEQA 3EUAA 2AH5A 1PVPA 4ZZDA 5KAFC 1V3FA 1ZRNA 3TEDA 2QZ8A 4C3JJ 5L3DA 3T3FA 1OYYA 3LA2A 3H5RA 3L2CA 2X1DA 3RH5A 3CZ6A 3E0JB 2FRHA 4YFKF 3ERED 3LYSA 1X4PA 3I76A 3QEAZ 2K02A 2DMQA 3BPVA 2DO7A 3PL8A 2Q4TA 4K4HA 4XKWA 1S7EA 3K9TA 2CV0A 2MABA 1OJLA 1JE8A 5FLMJ 1DPUA 2RLTA 3WKAA 2AGQA 1IZ1A 2HQ5A 4DQQA 1NJYA 4LMYA 3NVWA 1V4RA 3L00A 3ZQIA 2JRMA 2PMZN 2KKVA 2FD5A 5AIPA 2YX7A 3G71I 4IS7A 1FIQA 2IBDA 2KQRA 3BDDA 3ED5A 3KOOA 3PSPA 2DT6A 4C7ZA 3RCOA 3ZDDA 2EV0A 3MFKA 2F3NA 2OHFA 4RB3C 2LMRA 5HP4A 3OHBA 2VQHA 5EJCA 5K5OA 3BR2A 4A6DA 4UUSB 1HLVA 1WG8A 2NV3A 1IXCA 1IG7A 2DPDA 2P6RA 1IRFA 1R4NB 3EUB2 4I2IA 1TWGJ 1XS9A 2P6SA 1VQPI 2PN6A 1QQ7A 2XB5A 1PVEA 3O8HA 4YIIA 3PIOF 2WF5A 3C23A 9ICRA 2KJ5A 5HHHA 1AKHB 4F4XA 2YSRA 2DOAA 4BU2A 3GCMA 3WE3A 2J5PA 1YJNI 3LSRA 1R1UA 1FSHA 1K1QA 1T6SA 1N2XA 4OOIA 3ELKA 4XRFA 2E1OA 3HXLA 3PVXA 1SD5A 3EYZA 8ICOA 4FFDA 3M9AA 4QTRA 3NUQA 4GXJA 3HWTA 2CJJA 5H20A 1BW5A 2F1IA 4O3NA 3CTAA 3FXKA 3WK4A 4P0QB 3QP5A 3H5NA 2NVQJ 3ALRA 4XM3A 1A6QA 2MLKA 4YG2A 4FBTA 4PHDA 2D3DA 2QLZA 4M71A 2L5QA 4FHTA 3CP8A 2LPEA 2C22A 1W5CC 2L4MA 2OD5A 7ICFA 2LVSA 2M4GA 2XF7A 4ZZLA 1B8IB 4CDGA 3K4GA 5ERIA 4ZYAA 3S14J 5TRDA 3OIQA 4BJ5C 3H4BA 1XNSA 4JK1A 3MN2A 3HPGA 2IMWP 2UUZA 5AKGA 1ZR2A 1DUXC 2IS1A 3ETLA 3HC7A 1ZGJA 1U0JA 2XKPA 2NVYJ 1PUFB 4I2HA 3AAFA 1SFXA 3MGHA 2GA1A 4Q8FA 4HNUA 2ZC2A 4E7KA 3H35A 3J7YJ 1P4WA 1ZD4A 4B44A 2KRFA 5LBQA 5ICGA 4M9JA 8ICMA 3S15J 3QOEA 5ALXA 3KHLA 2G7UA 2RN7A 2BZTA 4CYCB 2OM6A 4Q44A 4I2FA 3ONQA 5ALSA 2A61A 4DLGA 3PW2A 2OH2A 3PO4A 1ZQZA 1DPRA 4F3OA 1Z19A 8ICTA 4XQ8A 3CF5F 3IP4B 4NBQA 1LEAA 2MD0A 2O5RA 1Z00B 1BI1A 3C3WA 3LA3A 4KIBA 1NJZA 3RB0A 2VC0A 2JQ7A 4RNMA 1OCCH 4XA5A 5KNLA 3SHFA 3BCAA 2KHVA 3TOBA 2F5CA 3QYPA 3DTEA 2LM1A 3C5GA 1DGRM 2HWVA 2H8WA 1ZH5A 4XRSG 3JPRA 5M5XJ 5ALEA 4OINF 2V1XA 3DPUA 2G07A 1X1BA 2ISPA 3WTVC 4IOCF 2LMDA 4C4SA 5E3OA 2W11A 2Y0SC 2ZXIA 2K27A 1G6NA 1MH4A 4ENKA 2P81A 3IH4A 4KT6A 2HS5A 1L7MA 2JEFA 5HNKA 4ED2A 1GVJA 2WAQA 4R8HA 1VJ5A 2F44A 3KZXA 1X1CA 3ISDA 1RKWA 3RJHA 1P4AA 3OYAA 3C2GA 5KFFA 2ZMEC 2XGDA 3H9QA 4NLBA 2DFEA 5G5GA 4CF3A 2M1BA 4A0ZA 1UELB 4UAZA 4NQWB 5TISC 3WTXC 2XI9A 3SEZA 3NARA 1XSDA 1L5UA 3D1NI 3ROUA 2JN6A 4YELA 3BZCA 5HDGA 3CC2I 4EJTA 5J8FA 2PMZA 4I28A 5DS9A 1E0EA 2L9VA 1V5GA 1Z91A 2DMUA 1SXDA 2ZIWB 3IDWA 3HYIA 8ICPA 4KX3A 4BQQA 1FFVA 4RPXA 1AOYA 3GDXA 1USSA 1NJWA 4B6JA 1L3SA 9ICKA 2W82A 3O8GA 2LY2A 4C3HJ 1S6LA 1KEJA 3LWLA 1ZK8A 2L01A 7ICHA 1RZTA 2XROA 1KGSA 2XV4S 2VBXA 3GYHX 3S1QJ 4ABZA 3M8JA 1XN7A 3DXJF 5KFAA 3M8RA 3TFSA 2KZZA 2AS5F 2KOBA 1YFHA 4I0BA 2L9NA 1WI3A 3CDHA 3MKLA 5E8IA 5EF6A 4Y2RA 3RH6A 2KJCA 2JRZA 3NAUA 3RJJA 2WV1A 5M3MJ 3WE2A 2CUZA 1YQAA 3RH4A 2JH7A 3M8FA 2KE7A 4JWNA 4UB5A 3SAHA 1J09A 1P2FA 1UMQA 1ETVA 4YMMA 4BQOA 1H88C 2CQKA 2HXIA 5DV5A 4ZJZA 1SEUA 4DQRA 3AN1A 3GTOJ 4PHAA 3OGUA 4QW8A 4DSFA 2OWOA 5C4XJ 4IRGA 5IYCJ 4A3FJ 1JI7A 1N77A 4YMOA 4DSEA 2ISYA 2M8EA 1SB3C 1IIPA 1LKYA 5CVIA 3F0CA 1QA6A 1A35A 4X1EA 1RRJA 1TVAA 2ZFUA 3HM5A 3EQLF 3SFIA 5HS8A 2W48A 4KNYA 2B6GA 4XKVA 2GLEA 2FMPA 2Y1IA 2Q2EB 3E2EA 2WA0A 3DKYA 4DQPA 1BW6A 5BPCA 4HRIA 1Z3XA 1U78A 2XY5A 4GRIA 3SV3A 2EIMH 1D3YA 2X1EA 4HQEA 2WAQN 4UAWA 4XN3A 2OQRA 5KCMA 3FMSA 1ETKA 2LBFB 5KFGA 1B8IA 4NLNA 4AVPA 4LZDA 3N4MA 1KONA 3IHQB 5CJ7A 2NOJB 4J9QA 3O3KA 1WYGA 2M0NA 3AMZA 3ZDEA 2XO7A 4DQIA 1MZBA 1VQ4I 4EM0B 3UPQA 1O7FA 5ALNA 2M2EA 3IKTA 2AXLA 5IP6A 5LD2C 2AHOB 5J0OA 3TARA 4A93J 1A6SA 1W7PD 3HTUA 1PZNA 5EEGA 5B66U 3GEZA 2A5YB 2EFQA 4C2UA 3GLLA 1XPXA 2LKYA 3ZD8A 3GF2A 3QYEA 4A6EA 1O3QA 2IRFG 1KW4A 4OIPF 2DA5A 3ZCOA 1LUJB 4KJZA 5KFNA 4IL6C 1Q1VA 2R18A 2KV2A 2XAJA 3I4MJ 3AL0B 4Y52J 1IN8A 4UBCA 5HLGA 2W9AA 1UJ8A 2BHYA 1K78A 1N5XA 5J8YA 3M3YJ 1JKPC 3JRHA 1RR8C 1KQ8A 4KUMA 3OYFA 5FRMA 3PO3J 4G7OF 3R4KA 2Q0ZX 2W00A 4R63A 2W8LA 3HGYA 1I39A 2DI3A 4LLLA 3MKYB 1S5LC 2P6UA 2DA4A 2HHTA 3GFJA 3GVAA 4HAMA 3WTTC 4IRKA 4PCQA 4QNLA 4FE4A 2YY6A 1U49A 5HHIA 1LJ9A 4C8MA 1O7LA 2KFZA 2JEIA 5BOLA 1ZQFA 3J7AO 1N62A 2IS6A 1NKEA 1QVUA 1T56A 4U88A 1I5ZA 4C9YA 5DDYA 2ETHA 3BCBA 2DDBA 5HNFA 4F5PA 2F8KA 3BC8A 1L3VA 3LWMA 2NO4A 2F48A 4XSZF 1X40A 4EATA 1XDSA 3UQ0A 2WAQC 3I64A 1MSEC 4KLDA 1QQ6A 2WY8Q 2HSZA 4S04A 1L3LA 4BBSJ 1B72B 2QQBA 1MJBA 2GOMA 3MCZA 2ISZA 3MBYA 2BXYA 4WXDA 1F4KA 5FKKA 2HOQA 3OMYA 2GZWA 6PAXA 4A3JJ 2K85A 1Z0XA 5H6QA 3A01A 5CQEA 4IC9A 4K4GA 1RYRA 2F6CA 1MD0A 1TT0A 3HJEA 5IY5H 1SV4A 5KFQA 5C0YA 4AYBC 2KHMA 1IW7F 3HPOA 1EH8A 1ORKA 5J0WA 4CICA 4YD1A 5ILVA 1L3UA 5ALIA 2ES6A 8ICNA 4O0IA 2Q0OA 1XTAA 1ZETA 3QAHA 4BGDA 4IRHA 1CF7B 4F52A 2HBKA 4AUXA 2P8TA 1JN3A 3ZD9A 5IIOA 1AHDP 1ENHA 8ICLA 3JPPA 3FMQA 3CNHA 3BG3A 4LZGA 1I27A 5J1YA 1WJDA 4UNOA 2HMXA 4HAIA 4DGWB 1SWWA 2ZO4A 2K7LA 3KZZA 1YZ6A 5EWGA 1FBUA 3DV8A 4A0YA 3U2RA 2F5DA 5AM1A 1I3QJ 2E7WA 3C21A 2BDPA 1LKYB 5F3XB 4ED7A 4RUCA 1WJBA 2F2EA 4B9LA 4F2RA 1AA7A 1YIOA 3NVVA 3BTIA 2DOFA 5J29A 1T4GA 3Q8QB 3HOUJ 1ZQSA 3ABKH 3OYBA 5LHGA 4XK4A 2IOFK 3L5KA 2YUSA 3WKDA 4QJFB 5DBAA 4B9UA 3LNQA 4QZCA 4KLSA 4B43A 2CH0A 3EUHC 2XPWA 4BXOB 3ZP5A 5JU5A 4QZDA 3IWZA 4Y13A 2WAQF 4ED1A 3Q8KA 2RRDA 2RREA 5FFZA 2D8CA 5AKEA 4MF8A 2CPRA 2VXZA 3G3ZA 5LGNA 2K5CA 2MH9A 2QQ9A 4UASA 5H2FU 4BDPA 4M9NA 4EJWA 5IT9K 5J3LA 1KU3A 5GTIC 1ZGWA 4O3RA 2KJ8A 1W7PB 1F44A 1OFCX 2HYJA 1JGGA 3ESWB 5F0HA 2XCAA 3K0LA 1B9MA 2FOWA 4S0HB 4TQSA 9ICNA 8ICGA 4D9JA 1SAUA 4A12A 1WKMA 3HHGA 2KIFA 4CUGA 1GUUA 5BQTA 4XRMA 2EANA 1RKTA 2ZXHA 3M6KA 3ZPLA 4M9SA 2VQGA 4A3LJ 5ALRA 1LDJA 4JWMA 3MWMA 5D6FA 8ICVA 2Y2ZA 1UCVA 1ZRFA 1T08B 3KLOA 4FISA 4AD9A 4EMSA 4XIDA 1WGXA 3K4MA 4JQFA 3ETRA 9ICHA 4EENA 1MGTA 2V1NA 2H6BA 1W0TA 4D5FA 4YIRX 2R7OA 1OCZH 5DCMB 3I4NJ 5DG8A 5J0SA 3OSPA 2IBKA 1Z1DA 2ZJQF 3E58A 3RB3A 1NK3P 3LSMA 4OAZA 3PW0A 9ICFA 3MZ8A 3MZYA 5D6EA 1K1SA 2EZXA 3QZ8A 1D0YA 2R8KA 5DDGA 2K4IA 1FEZA 2CFOA 1X3UA 3SZGA 1XO0A 1G4DA 2ESEA 4A0XA 3BZKA 2YU3A 3KEQA 2B7EA 4D1QA 2QB0A 5ALVA 1ZRMA 2AGPA 3NTUA 2P5LC 2E7XA 3OYNA 3C2KA 2W7PA 2ME6A 4BHPA 1SC7A 2EPFA 2L3DA 4DFKA 5AKLA 1UA1A 2BW3A 2CU7A 3FWEA 4OJLA 2OXOA 5J4YA 2H3FA 1SVOA 3TAQA 5FKOA 2KPMA 3KKAA 3VODA 4UUSA 1WCNA 4RA2A 1XG1A 3QUQA 2STWA 4GDFA 2H3QA 1VZ0A 5JTIA 4FZMA 2IXSA 3FM9A 2DL0A 3KETA 5D5UB 3MR5A 4NXZA 2PFQA 2M9HA 1SFEA 2ZIUA 3KX2A 1K83J 2XY6A 3EYIA 9ICJA 1N5WA 4WF2A 5HLHA 3V8JA 2KHQA 1HKTA 2O8KA 1XD7A 2F1JA 3GTJJ 3QE9Y 4XBFA 2B0LA 3OOUA 3V7KA 4UB6U 1OCPA 1ZJMA 2UVVA 2WF7A 3RPUD 2WB1F 2D2WA 3GFKB 2NVUB 3GIKA 2G5IB 1CEZA 2NS7A 5H2FC 1A76A 1SMYF 4KLTA 1WVRA 3SFZA 4A3IJ 3M9MB 4KLMA 3UXPA 1HEKA 2DBBA 4ZYHA 1UQVA 2EAMA 2RDIA 1K61A 1SANA 2LP0A 3ZMZA 2JUCA 3LA7A 2NOGA 4IQ4A 4EX6A 5CPRB 9ICEA 4BUPA 7ICTA 3S3MA 3WK5A 2FMQA 4EYHB 2F4IA 1QU3A 1A77A 3DKWA 3H1CA 4YQWA 3JTGA 1HIWA 2A07F 1JXEA 4PH5A 3RYRA 5BNGA 4XICA 4L0ZB 3HDDA 4RQMA 5L1MA 4XOTA 3MKZA 4RU9A 4U87A 4XKCA 4KLFA 2QLTA 1YO5C 2CQNA 1G59A 4X5VA 4J9RA 3V6HA 1UT5A 2GWRA 1HUZA 3F23A 4Y2JA 3K1ZA 4UXNA 5E3MA 2TDXA 1QPIA 2VN2A 5EGOB 3RKQA 4DIQA 4ESBA 3BS5A 4HV5A 1NG7A 2VBYA 2LREA 1YRNB 2DBYA 4F5RA 3TP3A 4GXKA 3E5UA 1RM6C 1Y8RB 3ZQ7A 1IF1A 5CKTA 2FSWA 2VQCA 2HEOA 5J8CA 2X6OA 2Y75A 1NK7A 5HLTA 3ZR8X 5DD4A 4P5OA 2ATLA 4CYDA 3AU2A 1R6RA 3CC4I 2R3SA 3ABUA 4UAYA 3RR7A 2BXZA 5D4BA 2KJ9A 3PW7A 3IWFA 1ZTRA 1ZHFA 4LITA 1QSLA 2DOEA 4F71A 1TP4A 1ZQBA 2RAEA 3ZGKA 5KAIU 2Z3YA 1DOQA 2Y48A 1BL0A 3FDSA 4PK4A 1IV8A 5JUMA 3G1LA 4DJAA 1QSSA 4CCHA 1DU0A 5FJ8J 4UB4A 1MMAA 1KFSA 3BQ2A 2VBWA 4A3BJ 3CDIA 3OIOA 5KK1A 4G6TB 1FT9A 5AKZA 2DQRA 1O3RA 1WHUA 4KIFA 3IM1A 1HSJA 1JTYA 2W9CB 2W8KA 4N4OB 3VFZA 4LG3A 2DF4B 4IO9F 1MH3A 1PK3A 2V4RA 5J2CA 2ZUDA 1FBSA 4X6AJ 2L7ZA 2K4HA 4L5IA 2PXIA 1NG6A 2CUJA 2W7NA 1J59A 3NS1A 1BJZA 3MR3A 3OS0A 3RKXA 1SVMA 1IC8A 2R7DA 3SEIA 1R5HA 2G7HA 3G6VA 4C8KA 1A6IA 2JH1A 8ICEA 3WHBA 1X4OA 8ICKA 2HQRA 2XIGA 1H9GA 4NJ8A 3BY6A 4RGUA 3PX0A 2CW0F 3WGHA 1YS7A 4EM2A 4XNFA 4P9FA 5A2QZ 1XU4A 1I6HJ 2W9BB 4J9PA 3K4NA 2EZZA 3GW2A 3MMYB 3F8CA 3IRUA 1ZQRA 2JSCA 2H3VA 4EEYA 1C0WA 2IA1A 2CYYA 2QVOA 4IEJA 1ZOLA 4YCXA 2DMTA 2F5EA 4WCGA 2HI0A 2QA4I 3WKCA 3ZQGA 2IPQX 2NXNB 3S1NJ 5AHXA 3MFIA 1U9LA 3F2CA 4G12A 3LVVA 3AL0C 1BI0A 5CVUA 2P66A 3E5XA 2ZNYA 2H3IA 2R7ZJ 2LF8A 4ENJA 3L4PA 5L1JA 2HTJA 2MU2A 5KT2A 5HR7A 3BT9A 2JGAA 2UXXA 1HF0A 2HKOA 2LY9A 4R8UB 4UVAA 4WXHA 2KNJA 5B1AH 2Z9OA 1ZQMA 4QZAA 4XQFA 2W3RA 2ESNA 2JV3A 2D6FC 1JUPA 5ALYA 3KBBA 4DBRA 4D7NA 2ID3A 4CCNA 3OR2C 4Z6YA 2HBLA 3BQZA 4J01A 3EZ5A 3V7JA 3F2DA 1HKQA 2FXAA 3N05A 4M2YA 3T5KA 4NLKA 5AM3A 5AM2A 5J2GA 2D45A 2A3SA 1VLBA 4QPQA 4RQ4A 4Y4RA 1D8YA 4YIFA 2A1JB 4CNQA 3K4KA 2XDVA 4RGXA 4J9KA 1ZQNA 9ICTA 2XAFA 3CESA 5J2FA 1W5TA 4N0BA 3TDUC 3I9V2 3TO6A 3AQFA 5J2BA 4LIVA 1O3TA 2G5HB 1MMDA 3RR8A 8ICZA 1MJAA 2YU9J 4BQNA 1OISA 2KD1A 1T95A 4C8OA 1TAQA 2E3TA 3CO6C 5JFRA 1Y39A 5F64A 4NWIA 4I76A 4O5CA 8ICQA 9ICSA 1B43A 5CA7A 2CRXA 1FIPA 1OMIA 3P7NA 4PGGA 3GTKJ 2Y1JA 1ZARA 2BQRA 3F6OA 4I98B 1ZG1A 1BM9A 4I01A 4BX9C 4IR9A 3C2HA 3VYSB 4RB1A 1UPHA 4DFDA 4XR6A 4NLZA 9ICQA 1QCKA 4XONA 1NI3A 1UCRA 4AVZA 2Y9ZA 1U6GA 4KMFA 1PUZA 3ZI4A 5AKKA 4CE6A 4R8UA 2E1MC 4PGHA 3GIIA 2BOLA 3RB4A 1L7PA 4FTHA 4M3GA 3G6YA 4B9NA 3FMRA 4S05A 4YXMA 2RGVA 2KIWA 4ECWA 2LKSA 3WU0A 1J5YA 1R1VA 4AC0A 4I2BA 2QENA 5KFDA 4KN4X 1L3TA 5DQIA 7ICMA 1WH7A 4GYGA 3BDPA 1XC9A 1JXLA 3LDAA 3MFHA 1U9NA 3IH2A 2ECCA 2WY7Q 2PBIA 1R22A 1TZLA 3KP4A 1XDUA 2F5VA 3TP0A 4G7ZF 3UKGA 3JPTA 4OMZA 1FC3A 2DKZA 2R7TA 2XB0X 2VODA 2KG5A 3QX7A 5DLGA 2W7OA 3C1DA 1H38A 2QARB 1WCMJ 3E1SA 3F8MA 5KG5A 1V9PA 4C4RA 2K9QA 2XKOA 2IAIA 5HS9A 2E34A 2I5HA 3KFWX 3AKZA 4IZZA 2JZBB 1MQ3A 3PO5A 3UNGC 1X42A 1ZJNA 2ZSIB 3M1EA 4Z2YA 1N61A 3ISBA 4ECUA 1W1WE 3OYGA 3FXJA 1OCTC 3DWLE 1TBXA 2DJNA 1R00A 3MD2A 9ICLA 3HEFA 4EX7A 3NVZA 4RNOA 4US9A 3R9KA 4RM2A 3T0YA 3HOZJ 3WU2U 5F27A 2UV1A 2R7RA 4PSWA 3CLOA 4QZGA 1NK2P 2C6YA 1T0FC 2FOKA 2HZDA 2KP6A 1I6XA 2EILH 2L02A 2MD5A 3W3CA 1XMKA 4XLNF 4N9HA 2O61A 2EFNA 3QU4A 4RUAA 1Z00A 4JX4A 2EWNA 4BWJA 1SGGA 4KLEA 2W9CA 3G73A 5CR0A 4CCMA 3SR6A 3KFUF 2X1CA 3ERMA 5ICFA 3GX4X 4G6DA 2AXTU 2Y30A 3MR6A 3AFHA 2DT7B 3KYDB 2GXGA 1N60A 2HYFA 2UVWA 4WK8F 4I2DA 2WBMA 3HRDD 2VI6A 1IRXA 1POGA 4CYCA 2L0KA 1JIHA 7ICRA 1GT0C 4RGSA 3FBNB 3H3UA 3AEVA 1TAUA 2CQXA 2ELKA 2ZNZA 3KP7A 3MVPA 2JVHA 1CQTA 3BG7A 2PMHA 3OS1A 3BWGA 5LRSA 3I0TA 4I2CA 3KYCB 1RUNA 4PSXA 3HPHA 4BHCA 4F5OA 2K40A 1S3JA 2FDRA 2KJBA 3KCCA 4A3GJ 2R8IA 3PW4A 2GWSA 3ECHA 1Z3YA 3IKVA 1DK2A 2IGMA 5AKYA 4BYYA 2R4GA 3KTQA 3QNMA 2D1VA 1CF7A 1ZQYA 4P96A 4RAFA 2A6TA 4KLLA 5CB1A 3JRBA 3G6XA 2EZKA 2KSOB 2ME0A 2PMZC 1WJCA 5LRRA 2EH3A 2BVLA 1X1AA 2DDAA 4YFNF 2KMDA 1LDDA 4XRSA 1EH7A 2EA2A 3SD7A 4UB6C 4M9HA 3RDIA 1WUDA 2XVTA 3BLYA 4M3EA 5ALFA 3V6KA 1ZR4A 2ZIVB 1U5TB 4USAA 3FYHA 3ML6A 4CF4A 1ZYQA 9ICWA 4A2UA 3CCEI 2M5WA 2P5VA 4B3XA 8ICHA 2XRLA 1IN6A 2BQUA 1KYWA 3H5AA 1KTQA 2J6UA 1FTTA 3LMMA 5ALHA 2LI6A 3HUGB 4ZC3A 2B63J 5HMMA 1ACIA 2VJJA 3N97B 1X2MA 4I7HA 3H40A 2I6XA 3I54A 2ZJRF 3ORYA 4CH7A 4EVIA 1TWFJ 1W4MA 3KHHA 2PKEA 4ZDLA 1IO2A 4CXFA 2JWTA 3I5UA 4A5MA 2WF6A 3ZRGA 4NL9A 4M9ZA 5J0QA 3FXRA 1A36A 5ALOA 3Q8PB 3VC8A 2WAFA 3PX4A 3I28A 3E6BA 3C18A 2JSPA 2ICWG 4EJUA 4F5QA 2CSOA 3U21A 2CFXA 4RGRA 2EB7A 3ASNH 3H8SA 1IUYA 5KFIA 5L1IA 1TK8A 3J80K 4RDUA 1B72A 5KFYA 2OCEA 4KN7X 3PY8A 2LYAA 5KNIA 1JUSA 3SJMA 3GU3A 3I71A 2QBYB 4OJ5A 1MBEA 3Q9VA 5AICA 4KX5A 4UB8C 5F08A 1ZLKA 5D4RA 3W2WA 5FP0A 2Z99A 3C5FA 3ZDCA 5EEAA 2DKXA 3TL4X 1UHUA 2DFLA 5KL8B 1RC9A 4ZTFA 1F0MA 4HDVA 1S97A 1MNMC 4AIDA 1MBGA 4PZNA 4DOBA 1QTMA 2M8GX 1N48A 1BR2A 2HI3A 3PW5A 3LSHA 3K2AA 3MQ0A 5ILUA 1VDVA 2NRAC 3E6DA 3OOPA 1HQCA 4M6VA 2LD5A 4LLNA 1XGSA 1GDTA 4EYIB 7ICPA 1ZLJA 5DM7F 2QSFX 1BIAA 4F91B 3OYJA 3DF8A 3G2BA 4UV8A 3J7AY 4E6KG 2IVMA 3MDAA 5DLFA 2D1HA 3WK7A 1HW2A 2RDJA 2FPKA 2WTEA 2H8RA 2EZIA 3BJ6A 5J0UA 3JRDA 1UHSA 3H36A 1FJLA 2STTA 3F72A 4BXFA 2ZIXB 2BPGA 1Y1VJ 2VUMJ 3RJEA 1Y1WJ 4FE7A 1MSWD 2VANA 2HBJA 5KFUA 2K86A 1VF9A 2E2IJ 4DOCA 1PVRA 5E3NA 1TKDA 4QWQA 4QIWN 2JZBA 2YMPA 4OWRB 3HSFA 3ABTA 3IAM2 3WG7H 4AYBF 4BE1A 2KMUA 2HPMA 3NGDA 5J0TA 1GV2A 4P4MA 2VXDA 3PJRA 4F3QA 2F76X 4PL1A 3I58A 1V54H 1FNNA 4OCZA 1T3QA 4BUGA 7ICEA 2AQFA 2UWMA 2LBFA 3LSJA 1QQ5A 3M6ZA 4KYWA 1DRGA 2DJIA 1X19A 2VT3A 4A5NA 3GV8B 4P2HA 4BE2A 4E7IA 1DP3A 3CMEI 3I55I 1NK8A 4HA8A 2VKVA 3VSKA 2YPRA 5K7ZA 2FUG2 2Y9UA 1MNEA 2M7BA 1HBXG 5ALMA 3M9NB 3JRGA 8ICAA 1LEBA 3JRCA 3QZ7A 4QWEA 2VQLA 3LFKA 3SAFA 4R65A 3B73A 5AIBA 4KLOA 5EE3A 3BR3A 2BCVA 4NL9C 4KMOB 3L7WA 2VLAA 2ZBKA 3W2AA 1KFTA 5F1JA 3IG8A 3C7JA 1KSPA 2UVRA 4DL2A 2HGCA 1G8XA 3CUQB 2YX8A 2DMNA 3HKZA 1Y8QB 2RVCA 1Z6RA 3FK6A 4MO7A 1J0RA 4XSXF 3PIPF 3L2WA 3CLQA 4CF5A 2DN0A 4KDPA 2E36A 5J8YC 3CJRB 4UB8U 2HVRA 3OIPA 3R6SA 1RDFA 5B66C 1ZD2P 4ECQA 1SIJA 3OL4A 1HUOA 1FTZA 5FROA 4L9NA 2YQEA 1YIJI 1HDPA 2RQPA 3JCUC 1Z7LA 4F93B 3GZ6A 4YXJA 5AM4A 4RPZA 1NK6A 4O9MA 2XY7A 5AI4A 1ZGAA 2BHZA 5D8LB 4BJ6C 1IGNA 2E1FA 5ALWA 7ICKA 7ICUA 3LOCA 2DXIA 1ON1A 4I02A 3S6JA 4QWAA 3G6EI 1TNTA 3BR0A 1U8RA 1QBJA 4C80A 2KIUA 4UAVA 2BHNA 2I9GA 4P9UA 5CHGA 3VPRA 2VPRA 2OU2A 1Q46A 2QARA 1JXSA 1QHHD 5ICEA 1R5GA 1Z21A 2K9SA 4LIUA 2NRTA 3J7ZI 3VB2A 1Z1VA 2L4AA 2IJLA 2OQGA 2JZYA 3TKAA 4I2EA 5J0XA 3HUGA 3T8RA 1NK4A 2RQ5A 1D5VA 1HJPA 1H8AC 1MSFC 3SQIA 1TW3A 2R7UA 2AQEA 4GC6A 4N4NB 3RBEA 3F8BA 2Y9TA 3EPGA 1WJ5A 2JT1A 1J7KA 4M0AA 5LFAA 2ZJ5A 3GV5B 5AIQA 1UFMA 2IGKA 3K4BA 4HF2A 2G0AA 2ZIVA 3OR1C 2KKOA 4LJZF 4BQAA 3TQ1A 2JA8J 3CQZJ 1REPC 2CO5A 2NVTJ 1M6YA 4M9GA 4M6WB 4ED0A 3CMAI 1H89C 5TZVA 1VQ9I 5E1ZB 3BJYA 2O7OA 4R1HA 4HX8A 2V9PA 1VQNI 1QPMA 5DBBA 3ZOBA 8ICRA 4DBQA 5DUIA 2LK2A 3HX0A 3KZIC 1B22A 3U26A 4Q4ZF 2K3FA 2NS8A 2GIVA 5JI6A 4XORA 5AKJA 2AQ0A 5JRTA 4J9NA 2HHVA 4I6ZA 2ADUA 4G6QA 2HFHA 3QPLA 3TADA 5J0RA 3T5JA 1U45A 1SL0A 1SL1A 1VQMI 3KZIU 3FZVA 3HKZN 5E20A 7ICNA 3K1RB 5E8GA 4OJ6A 2TRTA 1L7OA 4H4KC 4UQGA 2XGCA 4ZH4F 3TOAA 4EBCA 2W54A 5J2EA 1RXVA 4RT2A 5D5WB 2Z2SB 3LSIA 3JRAA 2B9SA 1VQ8I 3PSTA 2CS3A 5IYDJ 4B4CA 5EE9A 2E2JJ 3RJKA 4PFOA 1FMVA 4M6YA 3HT3A 3VDXA 1I1GA 4DQ2A 2PI0A 4NV0A 5DB8A 4PUSA 1GO3F 3TW7A 1RNLA 3GWZA 3H9GA 1XMAA 2K9LA 4JK1X 5J47A 2HBMA 5ALLA 1FYLA 2GOLA 3QODA 1X2IA 3DLLF 2NS0A 1ZQVA 2CW7A 4PZJA 3RI4A 2DODA 2EH9A 3V8KA 3BJAA 2OTLI 4DF8A 2LKPA 2NRWA 4JB3A 4NC7A 4KFCA 3TAPA 3A1YA 2KIVA 2BY3A 1WQ2A 4KN4A 1CGPA 2ZIXA 1FEXA 3PNCA 1FWZA 1NHAA 4F7ZA 2EQRA 2LHTA 4UATA 2VE9A 2HOIA 3QOPA 1BPEA 2OUMA 3CCLI 3P9IA 4Z6DA 1G3SA 3K2ZA 1D8LA 3JSOA 4BACA 4RQ7A 1KYZA 5HLIA 2GO7A 4MEXA 1KZHA 4K2EA 3E7LA 4M74A 3L2QA 1JJ6C 1BPBA 2KFDA 4M6XA 4Q45A 1ZD3A 3PZPA 5GTIU 5K7HA 4LLGF 4A3DJ 2IA2A 2LSOA 2B21A 4U0YA 2Y0SF 4RQ8A 3JTHA 4HV6A 1E3PA 1NTCA 4Q48A 5FFXA 4EJVA 2MUTB 2QB0B 5KFWA 4OO1J 1Z6TA 2XASA 4BDZA 3MZHA 3RF9A 2JA2A 1ZQKA 4NC6A 1S0MA 2EA4A 1V85A 4J9SA 1BI2A 2HU9A 5HDNA 3OYMA 1ZQHA 4DSKA 2CWEA 2EDUA 4IHVA 5L3BA 4DFJA 3K1MA 3PQKA 2PEXA 1ZQ3P 1T0FA 4F4WA 1IG6A 1XCVA 4RB2C 3TADC 2BR0A 2HVQA 2CQQA 1Z67A 4DWIA 1GHCA 5AI5A 2DWQA 2FE9A 5LHIA 1MA7A 2QKLB 4AM3A 4F72A 3JPSA 3BQ1A 5EZGA 2WAEA 3IHUA 1X1PA 2HVIA 1ZQTA 3M1YA 4YVZA 2JA6J 2DW4A 5K4LA 1XMXA 4HSRA 2LBOA 4HYEA 3MR2A 4DSIA 3T79A 4O6JA 3I3LA 5J6XA 5HODA 3TANA 3LQRA 4GFBA 4DFPA 2WB1A 4CHUA 3BQTA 3HGGA 1ULYA 3MABA 1TWHJ 2R7XA 1S9FA 2A6EF 3TGNA 2HHUA 1YS6A 1B6AA 5GPCA 1JALA 2V79A 2BE5F 3QPSA 1BA5A 2NNNA 4FETA 5ALTA 1K79A 1EJ9A 3LSGA 3KIOA 4HOBA 3JR9A 3OSGA 1ZAOA 1ECWA 1WH5A 2PFBA 4YR2A 4V19K 1QZEA 1PK1A 3F9KA 4P55A 1DGSA 4QZEA 4I99C 2X6XA 1JT0A 5B5EC 2V7FA 4RMNA 2YB1A 4IHTA 2ZUBA 3HKZC 1XC5A 4NLGA 2XRNA 2K4BA 2Z5UA 4NQWA 2Y9YA 1NNLA 2E8MA 5KFVA 4C0ZA 3TBIA 3QUTA 1YYVA 3A0HC 4KICA 4E4HA 5L9XA 2O8XA 2LG4A 2ZMEB 4I29A 4I09A 5CRXA 3ASOH 3H0RB 2OTJI 2W3SA 2XPUA 4ZYEA 3CD6I 5IT3A 4IXAA 2VT2A 1IM4A 2RP5A 1FOYA 1WJFA 3Q8SB 3FXQA 4FS2A 1WPKA 3CW2C 2KSOA 3TACB 1TAMA 1W0UA 2XSDC 3K75D 4C8NA 1IXRA 2DCEA 2V9KA 4QIWF 1V55H 1U9OA 4WXCA 2V6CA 3U9GA 3F53A 4QPOA 4DF4A 3I59A 3B6AA 5L3EA 3HSEA 2W4SA 1LB2A 5E17F 2X6YA 1TV9A 4P1WA 2V4JC 2K4JA 1ZQWA 3OJSA 2BDUA 4M6WA 3LK9A 3EUKL 3E5QA 5DBCA 4KITB 3Q8RB 1F9NA 4FT8A 4JUZA 4UY8I 2E5ZA 4IRIA 2H1LA 4YEJA 3OL3A 2O9LA 1EKEA 2E19A 4XLHA 3V7RA 2CQ7A 5KG7A 3JPQA 4B8XA 4EEKA 1IN5A 2FBKA 4C3IJ 3MAJA 1V97A 5M3FJ 1D1AA 3BG6A 4QZFA 3FHZA 1X2NA 3GO5A 4X0GA 2EK5A 5J0YA 2KZMA 2XSJC 1BC7C 2DA7A 5CJ9A 5J4VA 2R5YA 1ED1A 3RPUA 3RRGA 2XC9A 1G2HA 4IR1A 1BIBA 3R0AA 5FLXZ 3SMVA 2FLPA 4EM1A 3S2DJ 3BS7A 1B4FA 5C4JJ 1NK5A 2LFBA 2R7FA 3A03A 4Y2SA 2PJRA 1AU7A 4J9OA 3U1KA 1WWXA 1T2KA 1FBQA 1FSEA 1ERDA 4HG2A 4P4OA 3N7PD 2EZHA 3V7CA 4MNUA 3C28A 4M9LA 3NRVA 2PI4A 1I3AA 3PQJA 5CVVA 2R93J 4NUBA 4IL6U 4NNJA 2RC4A 4MEYA 4B09A 2W57A 3Q9SA 7ICQA 2JPBA 2G08A 4KTQA 1SMTA 2KLOA 5KFKA 2I8DA 4UUVA 3QU7A 2DK5A 3CCJI 3FM5A 1AROP 5AI9A 2Y0MA 2MG4A 3WG9A 3C2MA 1HOMA 3LAPA 3OYEA 2L5YA 2NO5A 3MEXA 2QEXI 3M9OB 2ID6A 2JJ7A 2P5KA 4DOZA 3CCRI 2HDDA 3A0BC 1JTXA 1CI4A 4RLFA 1RXWA 4XLPF 2I10A 2V1UA 3EW9A 2ZCWA 3F8FA 1ONVA 5IINA 2DQLA 5EEHA 4DOAA 2W9MA 4L5EA 5GPAA 1Z9CA 4YMNA 5C5JA 4Y15A 3OPXA 1XS9D 4GCVA 4Z6FA 1FPQA 4BDYA 2XGXA 1DP7P 2EV6A 2E71A 3M1CA 3GTMJ 1Z4NA 1Y0NA 1LVAA 1S0NA 1L8LA 2EBIA 2M45A 2DA3A 2OPTA 1A31A 4DNCA 4DEZA 1ETYA 3WU2C 5KT3A 1P9QC 2LR8A 4BHBA 2OYYA 4IHSA 1O03A 4HDUA 2AO9A 1OPCA 1JJ8C 2CGPA 2WF9A 4YD2A 2DAOA 4D0PA 5IIKA 1JUMA 2ZSHB 1JGSA 4PDKA 3GQCA 4BAYA 9ICUA 8ICXA 3Q8LA 1SL2A 2WTFA 1TW2A 2N8GA 4BL0B 1P7JA 2P6TA 3CCQI 2DTZA 4ECYA 4B48A 1D9DA 8ICBA 1SFUA 2ASJA 2AJQA 2OC6A 2VA2A 4IRDA 1P92A 3O2PE 2D5VA 5KFTA 1LDKB 3FDYA 2C2EA 2R7WA 4I2GA 1N56A 4BXUA 2J6SA 4F4ZA 1R4MB 4MFDA 1DK3A 3GV7B 4KN7A 3MGVA 2H1KA 3QYFA 1NJXA 3JW4A 3V72A 3SQNA 2HVHA 3L2RA 1VFCA 3DV9A 3QXGA 3TDZC 5F0FA 2ZMEA 3SDGA 3EWAA 3D5LA 2KL4A 2MFZA 4AWXB 4E7SA 1FMWA 1PP8F 3ZMSA 2BW3B 3B6CA 5AKXA 2CRGA 3RBDA 3M07A 1ETWA 3CJQB 3EPIA 5AK5A 5JLWA 3VEPA 2IT0A 3HZJA 2BY0A 3K4LA 3W2VA 5KTQA 3I56I 1ITYA 4L5JA 3JAMK 2ZJ8A 5EE0A 5F0CA 3T8TA 1FIAA 4R64A 4LK0F 3N4MB 3EYYA 2AU0A 1RUOA 4Q43A 8ICIA 1Y6IA 3A01B 1YJWI 1NKBA 2MLGA 2EZYA 3VYUB 2DPUA 4F55A 5M5WJ 3K4CA 1TK0A 2A68F 3A4CA 3U1DA 3X2QH 4II2A 3J80Z 3BROA 4RQ1A 1SV0C 1HSTA 2NYXA 5AM5A 4HW0A 2LDUA 3A02A 5EYRA 5ICCA 3CCVI 4YFKA 5J2AA 4EBDA 1NZBA 4IQTA 2OEHA 3P9KA 1XSLA 3ISPA 5K5RA 1SXEA 3A0BU 2L7FP 1GXQA 4ECTA 4B1RA 2VOOA 3CUOA 1UT8A 2CMPA 4ZH4A 2MW8A 2XVCA 1NK9A 2KTQA 2H27A 1N63A 3E3VA 2OV7A 2FMYA 1VNDA 3PM1A 1DGWY 4OU0A 2ZG6A 4Z6EA 2XCPA 5F6FA 1ETQA 4RQ5A 1OYWA 4BY1J 5KG1A 3VYTB 1XGMA 3FC4A 4QZ8A 1NH3A 1S0OA 3SXYA 4US8A 3T5XA 2QQAA 2UXNA 2QSGX 1L7NA 2RV8A 2W43A 3GXOA 5KG3A 3BTJA 1R58A 1K78B 2M7AA 5E3LA 3PV8A 3KP6A 1KKXA 2VL8A 3O0FA 2JRTA 2XC7A 4DL4A 3L09A 1L8OA 3HOVJ 3FHNA 4O3OA 4QZBA 3ZQLA 1FP2A 4BXOA 5D8KB 5AK6A 4V2FA 5ALUA 4XMYA 2VJ4A 2XGQA 4F5NA 4DLEA 1ZQDA 3BOQA 1R5ID 2XHKA 2JA7J 1T33A 3M8SA 5EGOA 3BTLA 2A1AA 3BS5B 1XGOA 3UXOA 3VYRB 1XB4A 2W85A 1O3SA 4MEXF 3S17J 1WFXA 5CVRA 3F8NA 4UB1A 5HOOA 2J5OA 1MKMA 2BQ3A 2IHNA 8ICJA 2NVXJ 4Q47A 3AG3H 4OD0A 4CA0A 2IGNA 2IGOA 5DB7A 2H09A 2P4WA 3CCMI 1IRZA 5KFXA 4I2AA 2EQYA 2QB1A 5EWEA 5DD8A 1BPDA 5EOZA 1P7IA 1U47A 1IXRC 2DLLA 3PFYA 3OS2A 4RZRA 2JEJA 4HPQA 5F9NA 4NM2A 2DK8A 2IS4A 2WHEA 1ZQUA 1KBUA 4HF0A 2R8JA 1XO1A 5ILSA 5ALPA 1MBFA 4CCLA 5E79C 2FU4A 3WTWC 2ELHA 1FOKA 3W6JB 3DKXA
chains in the Genus database with same CATH topology
4ANJA 3CRXA 4F91B 3MKYB 2E5SA 3OYJA 3G2BA 1LFPA 3J7AY 4E6KG 2CN1A 3K70D 4J00A 1T94A 3ICXA 4QNLA 2R7QA 4KISA 4IQJA 2ZIXB 4BXFA 2KZVA 3H0LB 3DPTA 2V6EA 1D0XA 2HBJA 2IS6A 1HA8A 2M0MA 2DGZA 1PVRA 3BCBA 5HNFA 4E7HA 1N78A 3BC8A 3FBIB 4OWRB 2KVCA 2R7VA 3IAM2 4EATA 2WAQC 4AYBF 4BE1A 4CCOA 2KMUA 2HPMA 2VKQA 2VXDA 3PJRA 4F3QA 2F76X 2WY8Q 4PL1A 1CRXA 3DU6A 3RQ4A 2GOMA 3OYIA 2AQFA 2UWMA 2LBFA 3F5EA 3M6ZA 4BUGA 4U7CA 1DRGA 2DJIA 1X19A 2ELJA 2KDOA 4C2TA 4BE2A 4E7IA 2HOQA 2XICA 3OMYA 1DP3A 4U7BA 1UG0A 2LYCA 3VSKA 5CQEA 5KHDA 4IC9A 1K6YA 2FUG2 2LY1A 2F6CA 1TT0A 1MNEA 2M7BA 5C0YA 4AYBC 2KHMA 2VQLA 4C30A 2RQQA 3SAFA 1MMGA 2IS2A 3RSNA 4KMOB 2VLAA 1MNDA 3W2AA 5FRNA 3IG8A 4BGDA 3HOSA 2KRCA 3K70C 3M7DA 2YX8A 1G8XA 4F52A 2HBKA 1BR1A 2MC4A 3HKZA 1Z1BA 3L2WA 1BOBA 2W03A 2WADA 4P0QA 1WJDA 3CJRB 2HMXA 1BR4A 4DGWB 2HVRA 3OIPA 2ZIWA 2VB6A 1Q3UA 3OL4A 1JI8A 4BJQA 5FROA 1WJBA 4HEA2 1AA7A 2W1OA 1Z7LA 3ZQQA 1WJAA 4F93B 3OYBA 4QJFB 4BJ6C 2E1FA 2X85A 2K8BB 4B43A 2DXIA 2CH0A 3EUHC 2F8LA 4FZNA 2WAQF 3D2NA 2RRDA 3RTRA 2RREA 1UAAA 4CCKA 3GZFA 2JVGA 4PFPA 3OYDA 2CPRA 2VXZA 2CV2A 2K5CA 1QHHD 5HNHA 1Z21A 4XOPA 4LIUA 2MA1A 2KJ8A 1F44A 3CYMA 2LH9A 4CRXA 3A2KA 3QYBA 4PJNA 3SQIA 2R7UA 1QHGA 2AQEA 4N4NB 4BS9A 4D9JA 4U6PA 1WJ5A 1SAUA 5LFAA 5T14A 4CUGA 2IGKA 3K4BA 2ZXHA 2G0AA 4FASD 3OR1C 4IKFA 2ZIVA 3M6KA 5TGTA 4PJLA 2VQGA 4CGZA 3L2UA 4ICAA 2JUGA 2VKDA 4XLCA 2RNGA 3HL2A 3K4MA 4JQFA 1V5FA 3NWSA 2W04A 2V1NA 3FKJA 4DBQA 3VSLA 2R7OA 2E5NA 1S9HA 3HKZF 3LFUA 4XORA 3LSMA 4OAZA 2GOXB 1PVQA 1OUQA 4XL9A 3OWTA 2ZIUB 4CZCA 1D0YA 3IN5A 2K4IA 1L6NA 3S8PA 2CFOA 2KKPA 4OJ6A 2LOOA 3SZGA 1XO0A 4H4KC 4D1QA 2KICA 3OYNA 2Z2SB 3LSIA 3PSTA 4AU7A 2CS3A 2W7PA 4PFOA 1FMVA 2BW3A 3VDXA 4NV0A 4OJLA 4PUSA 1GO3F 2HPIA 2OXOA 3H0MB 2H3FA 4JMUA 3H9GA 2HBMA 2K9LA 3SAGA 2KPMA 3QODA 2GOLA 3V42A 2CW7A 3DTIA 2RHFA 4Y33A 3DQVC 2H3QA 1VZ0A 1N75A 2H3ZA 4FZMA 4JOMA 2IXSA 1PYVA 2VJ5A 4E7JA 4NC7A 4OAYA 2ZIUA 3A1YA 3KX2A 1X1DA 2ZIXA 2HOIA 2Z16A 1ZELA 2LHTA 2KHQA 3VWBA 2OUMA 2M3AA 4ZDPA 3H9JA 3OOUA 2KRHA 3RPUD 4ZTJA 2K4EA 2WB1F 4BACA 2G5IB 3DEEA 4XLFA 3L2QA 3OYKA 2PJRB 2XF6A 3PZPA 4BEHA 2G09A 1HEKA 3D2QA 3NRWA 4OJPA 2A5WA 4RLQA 2Z1DA 3PSIA 2E60A 2Y0SF 4IQ4A 1P7DA 2N1RA 5CPRB 3VCBA 4BUPA 3S3MA 2Z7JA 1GLNA 4OO1J 2LYBA 1MMNA 2F4IA 2HDWA 3SDBA 2JA2A 4BDZA 1QU3A 2K8CB 3RF9A 3D5SC 1HIWA 3PNVA 2HU9A 2VJIA 3OYMA 4XOTA 3MKZA 4XLEA 4U87A 4XKCA 1G59A 1OLTA 2E1MB 3K1ZA 2BVMA 2HVQA 2HNHA 4DIQA 5CQGA 4P0PA 1NG7A 1D0ZA 2LREA 1W36D 1MA7A 2QKLB 4OJOA 5CKTA 3K10A 4BJTA 2VQCA 2CW8A 5KL1B 2WAEA 5HLTA 3ZR8X 3PUBA 4B47A 3OYHA 3MGVA 4P5OA 1YX3A 2X51A 3DTKA 1R6RA 1SZHA 2K8AA 4HSRA 4E7LA 2LBOA 2M4KA 3T79A 2KJ9A 3LL7A 3I3LA 4NLCA 4LITA 1D8BA 2WB1A 2E1EA 3ZGKA 3OYLA 2R7XA 4WJ3B 4PK4A 2LC2A 1D1CA 4DJAA 2VIXA 1EA3A 3HOTA 1MMAA 5HVQC 3UR3C 3S32A 4G6TB 1SFKA 1URJA 2F77X 4FETA 4N4OB 3LSGA 4LG3A 1ECWA 2DF4B 2HQAA 2K89A 1LKXA 3CF2A 4PJMA 2X6WA 3L3FX 3F9KA 4PJJA 2K4HA 3N7RC 2X6XA 1NG6A 2CUJA 2V7FA 4RMNA 2W7NA 3K6GA 1YT3A 2YB1A 3OS0A 3LVWA 3HKZC 4A8EA 5HR6A 4ACOA 2L2OA 3IG5A 4C0ZA 3TBIA 2JH1A 1W36C 2L9SA 1X4OA 4E4HA 4FZLA 3PSFA 3CP2A 2LG4A 2VKHA 2HOFA 3SEQA 3EUAA 1PVPA 4XNFA 5CRXA 3K4NA 3H0RB 3H5RA 3MMYB 2X1DA 2RP5A 3CZ6A 3E0JB 3LYSA 1WJFA 2H3VA 1X4PA 1A0PA 2Q4TA 3PL8A 4XKWA 2CV0A 1TAMA 2F2AB 2MABA 2DCEA 2V9KA 4QIWF 3E0FA 3F53A 3F2CA 4QPOA 3LVVA 4Y3OA 2W4SA 3AL0C 2X6YA 2KKVA 2H3IA 4P1WA 2V4JC 3PSPA 2KQRA 2BDUA 3EUKL 2DT6A 4KITB 4GFJA 2LRDA 3RCOA 4AYBA 2JGAA 5HR7A 2PMZF 2E5ZA 2KNJA 2VQHA 4YEJA 3OL3A 4XQFA 2NV3A 2D6FC 1Q3VA 4F92B 4DBRA 4XLHA 4CCNA 3OR2C 2A3VA 2HBLA 3C29A 4J01A 3F2DA 3N05A 3AQEA 2KJ5A 2DOAA 1D1AA 3BG6A 4BU2A 4QPQA 4X0GA 4Y4RA 4FE3A 2XSJC 3K4KA 2XDVA 3ONNA 3HXLA 3CESA 1ED1A 1YE9A 3NUQA 3SMVA 1ZQ1C 2JHDA 3I9V2 3AQFA 4P0QB 1WJEA 3LSKA 4LIVA 1MMDA 2G5HB 4BQNA 3H5NA 2KD1A 1T95A 3ALRA 2PJRA 4XM3A 4NWIA 2XF5A 3S3OA 4HG2A 1ERDA 3N7PD 3C28A 2L5QA 2CRXA 3CP8A 2M4GA 2XF7A 3DLAA 4NUBA 4CDGA 4NNJA 4ZYAA 4BX9C 3OIQA 3C2HA 3VYSB 4BJ5C 1XNSA 1UPHA 2G08A 2KLOA 4XR6A 1V5EA 2I8DA 3HPGA 4XONA 2UUZA 1MW7A 4QIWC 3EPZA 4AVZA 2IS1A 3HC7A 1U0JA 2E1MC 2R7SA 3N7SC 2BOLA 3OYEA 4HNUA 4E7KA 3H35A 2KEYA 4DOZA 2KIWA 4B44A 4RLFA 3IUOA 3QOEA 2WY7Q 1TZLA 2F5VA 2OM6A 2G06A 3ONQA 4ZDOA 4XLAA 2R7TA 3L2VA 3OPXA 2W7OA 2OH2A 4BDYA 2WB1C 3K4JA 1Z19A 3E1SA 4XKBA 3IP4B 2MD0A 2O5RA 3M1CA 3GBGA 3AKZA 4CSWA 4IZZA 1OR7C 2VASA 3UNGC 4CCJA 2ZSIB 2YB4A 4BE0A 5KNLA 3BCAA 3SYTA 2KHVA 1P9QC 1YX5A 3OYGA 2OYYA 3DTEA 3DWLE 1DGRM 3MD2A 2ZSHB 3PNTA 2G07A 4NC8A 3DPUA 1X1BA 4RM2A 4BL0B 2VPLA 3KEYA 4B48A 3F2BA 2UV1A 2R7RA 4PSWA 3KYLA 4HNTA 2OC6A 2ZXIA 2Y0SC 3S3NA 1T0FC 1LDKB 3FDYA 2HZDA 2KP6A 4C9YA 3W3CA 2R7WA 4KT6A 2QKMB 3DU5A 3OYCA 3QYFA 2WAQA 3KZXA 2K3PA 1X1CA 4CCMA 3L2RA 1LVKA 3OYAA 2X1CA 3C2GA 3KFUF 3H9QA 4NLBA 3AFHA 2DT7B 3D5LA 2KL4A 2MFZA 2WBMA 1FMWA 4E7SA 1IRXA 1UELB 2BW3B 2K9MA 4NQWB 2XI9A 3SEZA 2XAUA 3FBNB 3TMOA 3MKWB 3CJQB 2JVHA 2V26A 3K4LA 4YELA 3BG7A 3W2VA 3OS1A 3PNYA 3ZXSA 2PMZA 1E0EA 4PSXA 3HPHA 1V5GA 2ZIWB 1Y6IA 4KX3A 4BQQA 1Z3YA 2MRLA 4R79A 3VYUB 2IGMA 4ITVA 4II3A 4F55A 2W82A 2R4GA 2LY2A 3K4CA 3A4CA 4RM3A 2A6TA 4II2A 3M8JA 5A0LA 2KOBA 2DQNB 2L9NA 1D1BA 4XN0A 2PMZC 1WJCA 2HVSA 1NZBA 2BVLA 1X1AA 2CV1A 2CUZA 2Y0SA 2P0WA 1WUDA 2XVTA 3BLYA 2CMPA 2JH7A 2ZIVB 3OY9A 3SAHA 1J09A 2OV7A 3D5RC 2L7KA 1DGWY 4BQOA 2ZG6A 3HG9A 4B3XA 3CMMA 3VYTB 3DPLC 4ZJZA 3H5AA 3LMMA 3HUGB 4ZC3A 1N77A 3H0DA 2VJJA 1IIPA 4CH7A 2M7AA 4O3MA 2ZFUA 2VL8A 3O0FA 4YRVA 2XC7A 4ZDLA 4XKVA 3FHNA 2Q2EB 2XIDA 5JHFA 2WA0A 3DKYA 3ZRGA 4HRIA 1Z3XA 4XMYA 2VJ4A 3VC8A 4GRIA 2WAFA 4MLOA 2Q1ZB 2X1EA 3IAS2 2JSPA 1DQUA 4XN3A 5KCMA 3U21A 2LBFB 2JMGA 4P0PB 1KONA 3VYRB 4HSTA 2LYAA 2NOJB 3GU3A 1WFXA 2M0NA 4OJ5A 4IX7A 3RFAA 4KX5A 5HOOA 5LD2C 3W2WA 1A6SA 2GH1A 1PJRA 3D2SA 3TL4X 4CA0A 2IGNA 2IGOA 3S93A 2LKYA 4C2UA 5KL8B 3QYEA 4ZTFA 3NWTA 3F5AA 1Y56A 3ZCOA 3OS2A 3PFYA 4KJZA 2R18A 1BR2A 4HPQA 2KV2A 3LSHA 2IS4A 3AL0B 4BEHB 1KBUA 2MYSA 4PL2A 4CCLA 3OYFA 5FRMA 2W00A 4E7ZA 3DKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEE A; 
#chains in the Genus database with same CATH topology
 2E5S A;  3QU5 A;  3QU9 A;  1Y0U A;  1SZP A;  3BR6 A;  4M9X A;  2CXY A;  1YIT I;  2CN1 A;  3RRH A;  2DT5 A;  3E97 A;  3J81 K;  1T94 A;  1S0V A;  1F5S A;  4KIS A;  3TI0 A;  2ZFW A;  2KZV A;  4KT5 C;  1XSN A;  2VA3 A;  5CVJ A;  2V6E A;  4UUT A;  5EE1 A;  4EGZ A;  3MGI A;  2DGZ A;  2GM4 A;  4ED8 A;  2W84 A;  4E7H A;  1N78 A;  3FBI B;  2KVC A;  3H3V K;  2QWW A;  2R7V A;  1KLN A;  3EET A;  5KFR A;  3QEB Z;  2OAZ A;  4GXI A;  2H94 A;  4CCO A;  2YML A;  1KU2 A;  1QZY A;  1KU7 A;  3HB9 A;  4PJ0 C;  3RPQ A;  3COA C;  5ALD A;  1BPY A;  1FZP B;  3J81 Z;  3RJI A;  4M04 A;  1D9F A;  5KG2 A;  5KT4 A;  1XSP A;  1CRX A;  1UB9 A;  2MA3 A;  3RQ4 A;  3OYI A;  4AIK A;  4IOA F;  5AK3 A;  5KFO A;  4U7C A;  5K1Y A;  3JRE A;  1R71 A;  2ELJ A;  2KDO A;  5B1B H;  4DL5 A;  2HW3 A;  3FAH A;  2XIC A;  3H8M A;  4C2M J;  1DXS A;  1X9X A;  1UG0 A;  2YMM A;  1SD6 A;  1EV7 A;  2FPM A;  8ICY A;  2E8N A;  4Y2P A;  4TUR A;  3ZMT A;  1SFO J;  2LY1 A;  4U0W A;  2IP2 A;  4UAR A;  2DPI A;  4O3S A;  3P5J A;  4GO1 A;  4M3B A;  4BNC A;  9ANT A;  2DTR A;  2LNB A;  4C30 A;  2R0Q C;  2M34 A;  2BY2 A;  1VQL I;  2KVS A;  3NRZ A;  1MMG A;  4LG0 A;  1FY7 A;  2IS2 A;  5J2K A;  2C28 A;  1MBH A;  3CCS I;  5KT7 A;  3DCF A;  3K7A J;  3V7S A;  3WK8 A;  1I50 J;  4RQN A;  1RI7 A;  5BS6 A;  3K70 C;  2KRC A;  2PFN A;  2V9W A;  3M7D A;  5DDM A;  2PI5 A;  4KLU A;  4IQV A;  2MC4 A;  4MEY F;  1TNS A;  1BGX T;  4BKX A;  1BOB A;  1B1B A;  3GLX A;  4ECR A;  4P0Q A;  5IP7 J;  1J97 A;  1U48 A;  1HW1 A;  3M8E A;  2VB6 A;  4DO9 A;  2PFP A;  2ACJ A;  5FLV A;  3R61 A;  3JRI A;  3HTS B;  1Q3U A;  1KU9 A;  3TO7 A;  2QGU A;  5TJJ A;  4HEA 2;  2AGO A;  1KRP A;  3I1Y A;  1WJA A;  1OXJ A;  3V7L A;  4OMY A;  5KFM A;  1ZG5 A;  3GIJ A;  1O57 A;  4KMU A;  1OYI A;  4IF4 A;  1LVH A;  1S7O A;  1VQ5 I;  4FZN A;  1D5Y A;  1U2W A;  3RTR A;  4C7Y A;  4TQR A;  1UAA A;  1KQQ A;  1YW7 A;  4CCK A;  3RIR A;  2JVG A;  3V4G A;  3W6K B;  5F1R A;  1ETO A;  2MA1 A;  3ZQF A;  3OTQ A;  3AU6 A;  2BCR A;  3AM9 A;  3CYM A;  2LH9 A;  4CRX A;  1ZN2 A;  4ECZ A;  2EIJ H;  4HX7 A;  2LTP A;  3J81 j;  1SAX A;  2R92 J;  1MIJ A;  1QHG A;  2OF7 A;  3IC7 A;  4EEF G;  5JVG F;  2H6C A;  4DS5 A;  5ALJ A;  1B59 A;  4U6P A;  2ISO A;  3JPN A;  3FM3 A;  5K7F A;  3C2B A;  4IKF A;  1D8J A;  1YZ7 A;  3RAQ A;  2FQ3 A;  2OJE D;  2ALZ A;  8ICU A;  4CGZ A;  3AUO A;  3L2U A;  4FBU A;  1UHM A;  2WC2 A;  4IHX A;  1IUF A;  4XLC A;  2BGW A;  2PX9 A;  4ZOH C;  2RNG A;  3HL2 A;  4QSH A;  4MQV A;  3C1Z A;  5J2D A;  1TE2 A;  5KG4 A;  3HOW J;  4EEL A;  1ODD A;  1ZG3 A;  3NWS A;  2W04 A;  4PZO A;  2UVU A;  1GXP A;  4WWC A;  5ALG A;  4RB0 A;  5GAG J;  5GAD J;  3IV6 A;  2PG4 A;  2E5N A;  4LG0 B;  3K1P A;  4OIO F;  3LFU A;  4BXX J;  2DA1 A;  2COM A;  5A2Q K;  1ZQA A;  7ICG A;  2GOX B;  2BYV E;  5AON A;  1TQP A;  4I2O A;  2WF8 A;  1JT6 A;  5AI0 A;  5CWR A;  3IN5 A;  1L6N A;  2HTS A;  4UHT A;  2KKP A;  4TUQ A;  4F50 A;  2DPJ A;  2W9B A;  1QRY A;  2O6G E;  2ZXJ A;  4C8L A;  2KIC A;  4ECV A;  3QUB A;  1YW8 A;  3AG2 H;  4Y2Q A;  1G3Y A;  4RT3 A;  2DU9 A;  4O3Q A;  1X6J A;  5BOM A;  2M87 A;  2X0L A;  4JMU A;  2HPI A;  3JSP A;  3PFI A;  2NNY A;  2X9D A;  3TO9 A;  2KN7 A;  4DFM A;  4NY8 A;  3V42 A;  2ZTE A;  2RHF A;  2IA6 A;  4Y33 A;  3DQV C;  3UMC A;  1N75 A;  2MGQ A;  4V2G A;  1KDH A;  4RAZ A;  3IH3 A;  1SWV A;  3PUF A;  3WK6 A;  1S72 I;  1Z3E B;  4E7J A;  4H0E A;  4OAY A;  4TUP A;  2FLN A;  2HZT A;  1LFB A;  5JHU A;  1AQ6 A;  3KZY A;  1Z4O A;  2Z16 A;  1ZEL A;  4I0A A;  5DEQ A;  3T1B A;  1S77 D;  3DEW A;  4ZDP A;  2G0E A;  4ENN A;  5DKW A;  4P4P A;  3GFI A;  1RYS A;  2K4E A;  2HOA A;  5KAF U;  2OBP A;  2JR5 A;  4LJX A;  3E6C C;  4XLF A;  2E8P A;  5EG0 B;  2PFO A;  3OYK A;  1BPX A;  3SYZ A;  1QGP A;  2XF6 A;  5HDK A;  4MTD A;  3H8W A;  1COK A;  2BV6 A;  2G09 A;  3DEU A;  3Q5F A;  4OJP A;  4W1U A;  4CO8 A;  5KFZ A;  4RLQ A;  3PSI A;  4YG2 F;  1YOV B;  2E60 A;  2JA5 J;  4PGY A;  2W25 A;  4LOC A;  3QRF F;  5GP9 A;  5IT9 Z;  2N1R A;  3VCB A;  3C2L A;  4EJO A;  2YR2 A;  2ODG A;  2Z7J A;  4A69 C;  4RQ0 A;  1MMN A;  3SDB A;  1U5T A;  2HDW A;  2K8C B;  3RZO J;  3FKI J;  4KLJ A;  3WOD F;  3I4P A;  2A69 F;  2R8G A;  3PMN A;  2JTV A;  2DFI A;  2ZJ2 A;  3ZMU A;  3F21 A;  4YN4 A;  2A6H F;  5AKI A;  3KD3 A;  4RPY A;  5AIA A;  1OLT A;  2E1M B;  2EZL A;  3FXL A;  1JKO C;  1BC8 C;  4UB3 A;  4EZ9 A;  3QQA A;  1D8K A;  2FX0 A;  2BVM A;  1IRG A;  3QUC A;  2HNH A;  5J2H A;  1VI0 A;  1XSV A;  4QLC U;  2PJP A;  1W36 D;  1D0Z A;  2DYS H;  4MQ9 F;  2EAP A;  4GXO A;  4G9Y A;  1TLH B;  5ALQ A;  2LLK A;  4RQ2 A;  4OJO A;  3DBH B;  3K10 A;  2DA2 A;  1MBJ A;  2CW8 A;  2MBF A;  5L3F A;  2P7V B;  3IRQ A;  1BNO A;  5KL1 B;  4XRH A;  5KFC A;  3PUB A;  1X3W B;  4B47 A;  3OYH A;  1FO4 A;  4L9T A;  1YX3 A;  2R5Z B;  3GTL J;  2EJR A;  7ICV A;  2K8A A;  4E7L A;  5FLX K;  5AM0 A;  4WX9 A;  5ALZ A;  3Q0W A;  4IQW A;  3LL7 A;  5LEJ A;  4FQG A;  4NLC A;  3PML A;  3Q8M A;  2NAZ A;  5GAH J;  3DDH A;  3OYL A;  4U0V A;  2MC3 A;  5CEH A;  4WJ3 B;  2GA2 A;  3ZMV A;  5DTD A;  4PHE A;  1E17 A;  3PO2 J;  1D1C A;  3F22 A;  2FNP A;  1HKS A;  4QZI A;  2MH2 A;  3KLN A;  2QF7 A;  3GFM A;  4C4T A;  2HHW A;  2Q2E A;  4XUS A;  5FO5 A;  3DFG A;  2JEG A;  1AKH A;  1S8O A;  5LLQ A;  5C3E J;  2K89 A;  1LKX A;  2RDP A;  3CF2 A;  2X6W A;  1LPQ A;  2VON A;  1OQY A;  4PJJ A;  1K7A A;  3A0H U;  5EG0 A;  3N7R C;  1J75 A;  2ECB A;  2QYO A;  5DM6 F;  2ZKZ A;  5IYB J;  1T38 A;  3Q0V A;  3V8L A;  1YT3 A;  5HR6 A;  4PGX A;  2FNA A;  2CUE A;  3RYP A;  2QM3 A;  1IAW A;  3FXM A;  4JYK A;  2L2O A;  2HOE A;  4ACO A;  1TK5 A;  3VOE A;  2CUF A;  1W36 C;  2L9S A;  2P7C B;  3BQ7 A;  4EZ6 A;  5ED4 A;  2VC1 A;  2VKH A;  4M73 A;  3HRM A;  3QU3 A;  5FGM A;  1R49 A;  1ZD5 A;  2IOF A;  1IV6 A;  2GIZ A;  1BOA A;  2GBY A;  2XUB A;  1OW5 A;  1TFR A;  3UMB A;  1T39 A;  1HW5 A;  5FKL A;  1RPL A;  5BPD A;  1NOM A;  1F43 A;  3GTG J;  2K9N A;  1V38 A;  1A0P A;  4PGQ A;  1ZQE A;  1ZRC A;  2F2A B;  4Y2Y A;  3FX3 A;  4M3D A;  3OHA A;  4ESF A;  4AIH A;  1PK1 B;  3E0F A;  3OJU A;  1J2M A;  9ICC A;  3EUH A;  2PMU A;  4Y3O A;  2GLO A;  2QSH X;  4J9L A;  1B4A A;  2KDZ A;  2I5U A;  5IPA A;  4TV7 A;  4YFX F;  3FXO A;  1GVD A;  1ZRD A;  1K4T A;  3BR1 A;  3Q3S A;  2J6T A;  5IIL A;  2H5X A;  1FOX A;  1ZQG A;  1XX5 A;  4GFJ A;  2LRD A;  4AYB A;  4MFE A;  2PMZ F;  2P35 A;  3CMY A;  4IRC A;  4HNV A;  1Q3V A;  4F92 B;  1EXN A;  4BH9 A;  2FI1 A;  2A3V A;  1NKC A;  4L18 B;  3C29 A;  3SV4 A;  2WB1 N;  3AQE A;  3UM9 A;  2Y69 H;  1VQO I;  5F04 A;  1RIO H;  3M4O J;  1SD4 A;  3PR4 A;  3RKY A;  2YX4 A;  1FYK A;  5L3G A;  3ONN A;  4FE3 A;  1UST A;  4JX6 A;  5CYV A;  1YE9 A;  1WSU A;  2FBH A;  3BTC A;  1ZQ1 C;  1MBK A;  2JHD A;  4DSL A;  1WJE A;  3LSK A;  3GZ5 A;  1UZC A;  3REO A;  4HLY A;  3RJG A;  4RBO A;  4B9V A;  3B0Y A;  4UVB A;  4FX0 A;  2XF5 A;  3S3O A;  1YG2 A;  1LE8 B;  1WWV A;  4F8R A;  3D6J A;  5F9L A;  4I27 A;  1K6O A;  4DL6 A;  3DLA A;  3CDL A;  5DYM A;  3BZ6 A;  4MTE A;  3EDP A;  5G5H A;  3H4D A;  2L9R A;  1V5E A;  4DYR A;  4L9V A;  2PLY A;  1MW7 A;  3OV8 A;  2FE3 A;  3EPZ A;  4QIW C;  5EZH A;  1C7Y A;  8ICF A;  3UQ2 A;  4LB6 B;  3L9F A;  2BGC A;  1TT5 B;  2R7S A;  1WCL A;  3N7S C;  2EV5 A;  5DB9 A;  4F4K A;  5IP9 J;  4DZJ A;  5KVR A;  2KEY A;  4TUS A;  2W55 A;  4DSJ A;  4JV2 A;  1JHH A;  3IUO A;  4HX4 A;  1JMS A;  3G1M A;  2AHQ A;  2VE8 A;  5E18 F;  2G06 A;  2LM4 A;  4ZDO A;  2ZB9 A;  4XLA A;  2JK3 A;  3L2V A;  7ICI A;  2HHQ A;  1ZRE A;  2O0Y A;  2MUT A;  5HML A;  5DG7 A;  2WB1 C;  3K1N A;  3K4J A;  4XKB A;  3BQ0 A;  1O4X A;  3IL2 A;  3GBG A;  2K60 A;  4CSW A;  2KP7 A;  2VA8 A;  4JP0 A;  4DZP A;  1OR7 C;  3WKB A;  2VAS A;  4CCJ A;  2B0C A;  2YB4 A;  2ASD A;  4BE0 A;  9ICG A;  3SYT A;  1YX5 A;  2E1C A;  4D5C A;  4QZH A;  2DUY A;  4MFF A;  4L9J A;  4HLX A;  5DCM A;  3PNT A;  2LKX A;  4NC8 A;  2NRV A;  1U4B A;  4Y17 A;  4ASN A;  2VPL A;  3KEY A;  1DGJ A;  1B9N A;  4OIQ F;  3F2B A;  1W7P A;  3KYL A;  1PP7 U;  4HNT A;  3QPH A;  4M3F A;  1U8B A;  5D49 A;  1X9M A;  3S3N A;  1ZQO A;  2YTU A;  4J19 A;  1VTN C;  3HSR A;  2QKM B;  1R9T J;  3DU5 A;  2A19 A;  5FD5 A;  5GAE J;  3OYC A;  1QLN A;  2RNJ A;  2WFA A;  2ZTC A;  5D5V B;  4KLQ A;  1RPW A;  1MJ9 A;  1MMS A;  2K3P A;  2BPC A;  1LVK A;  3L1P A;  1CUK A;  2WWY A;  3BJO A;  3W6V A;  1RET A;  2HOT A;  3S1M J;  2MSN A;  3NEU A;  5AK4 A;  5KFS A;  2XAH A;  4QWB A;  3OSN A;  1ZQP A;  1OCO H;  2K9M A;  4MHV A;  2KK0 A;  2XAU A;  3MKW B;  1A04 A;  4IJA A;  5E1X A;  3TMO A;  1HCR A;  5M5Y J;  4NHJ A;  4KMU X;  1EF4 A;  4F2S A;  5LGT A;  2V26 A;  2M30 A;  1UG2 A;  3PNY A;  1L0O C;  5DUK A;  3ZXS A;  4ON0 A;  3TQN A;  5FB2 A;  3S16 J;  3T5H A;  4JV1 A;  4KLG A;  2G9W A;  3D0S A;  3RJP A;  2HOS A;  3H0G J;  3LQQ A;  1PUF A;  1DU6 A;  2MRL A;  2QQ8 A;  1J9I A;  4R79 A;  5KFE A;  4J9M A;  1QNT A;  5J2I A;  2JPC A;  4ITV A;  4II3 A;  1SKR A;  9ICM A;  9ICX A;  1S5L U;  3QWL A;  1T7P A;  9ICP A;  1S76 D;  4UAU A;  4RM3 A;  1LNW A;  3ZDB A;  1FX7 A;  5FD6 A;  3GZN B;  5DGB A;  4DQS A;  5A0L A;  3CUQ C;  2O3F A;  2E2H J;  4DL7 A;  4B9S A;  4ELU A;  2DQN B;  4YR0 A;  3RKW A;  1D1B A;  5IOY A;  1YTY A;  4XN0 A;  5DQG A;  9ICV A;  1BPZ A;  4O5V A;  3WTU C;  2HVS A;  1S8N A;  2CV1 A;  3QU2 A;  1ZQI A;  3GIL A;  5J2J A;  2Y0S A;  4GYI A;  2ZJP F;  1LQ1 A;  2P0W A;  1G3T A;  1B0X A;  5BOX A;  1R7J A;  1ZQQ A;  2R5Z A;  4UV9 A;  5FKN A;  4J03 A;  1R23 A;  1JX4 A;  4O5E A;  4O5K A;  4G94 A;  3OY9 A;  3D5R C;  1AWC A;  2L7K A;  5KT6 A;  1N25 A;  3HG9 A;  2BEO A;  3CMM A;  3R60 A;  3DPL C;  1X3Z B;  1VQ7 I;  1YRN A;  1M1E B;  4QWD A;  3HOY J;  1WRJ A;  3CC7 I;  3I53 A;  1XWL A;  2ASL A;  1X66 A;  2X48 A;  1YLF A;  1IN4 A;  3H0D A;  3KHR A;  3RJF A;  2BCS A;  4IPA A;  4UVC A;  4GIB A;  4HF1 A;  4O3M A;  1QH9 A;  2L7M P;  5JLX A;  1H0M A;  4YRV A;  4Q8E A;  1KL9 A;  3CCU I;  2YN4 A;  5GTH C;  1STZ A;  4LK1 F;  4HBL A;  5JHF A;  2XID A;  2JMW A;  1ON2 A;  2M0C A;  4A3M J;  4QZ9 A;  4MLO A;  2EFP A;  3CUQ A;  1F1Z A;  2Q1Z B;  3CCY A;  3IAS 2;  5HS7 A;  1DQU A;  5GTH U;  3ZQC A;  5LHH A;  2JMG A;  4P0P B;  2Y31 A;  4BY7 J;  2AQ4 A;  2ZXW H;  2XGP A;  2QUF A;  3HP6 A;  2BY1 A;  1E3H A;  4HST A;  1Q1H A;  2IA0 A;  1RQL A;  4IX7 A;  3RFA A;  3P9C A;  3SZT A;  5EDN A;  1C20 A;  4FS1 A;  1W5S A;  1XGN A;  1PJR A;  4IHY A;  1MN8 A;  2GH1 A;  4ED6 A;  1H9T A;  3D2S A;  3QU6 A;  2M9N A;  3S93 A;  1HC8 A;  4A3E J;  1BJA A;  1VQK I;  2NRZ A;  1LV5 A;  3NWT A;  1QO0 D;  3F5A A;  4Y2T A;  4Y2X A;  4GLX A;  4KLH A;  1Y56 A;  9ICA A;  2KZG A;  3DBR B;  2HYG D;  2ZTD A;  1P4X A;  1ZKG A;  3DBL B;  4RS8 A;  9ICI A;  2HQN A;  3I59 B;  2FA5 A;  2FML A;  4BEH B;  2MYS A;  2V9V A;  3ECO A;  4HQM A;  1WI9 A;  4JBA A;  3B0X A;  4PL2 A;  4AP9 A;  3M7G A;  4PHP A;  1OUQ A;  2IW5 A;  3TFR A;  4E7Z A;  5CP2 A;  3WGG A;  4ANJ A;  5KG6 A;  3WK9 A;  3CRX A;  2FBI A;  4LB5 A;  3TKY A;  5LGU A;  1LFP A;  4I2J A;  5JVT A;  4Y2V A;  2FEZ A;  1I1S A;  5DCF A;  4ELT A;  5BPI A;  3K70 D;  3CO7 C;  4J00 A;  3GTQ J;  3ICX A;  5AKH A;  2R7Q A;  5H6R A;  5B5E U;  5DQH A;  4IQJ A;  4ELV A;  5KFP A;  3H0L B;  1T98 A;  3DPT A;  1JRO A;  1T3N A;  3V6J A;  4KLI A;  4EBE A;  1D0X A;  2RKH A;  1HA8 A;  5ALK A;  2M0M A;  4G9B A;  4D7M A;  4BWM A;  3ULQ B;  3IV5 A;  5KT5 A;  2VOP A;  3RTV A;  2O03 A;  5L3C A;  1UA0 A;  1J2X A;  2KIS A;  5DB6 A;  5CLS A;  4MGR A;  1QQI A;  4MHG A;  3ISC A;  4R66 A;  2A05 A;  1Z7U A;  3CJN A;  1S29 A;  3HRS A;  2X4H A;  4MIM A;  2VKQ A;  2FJ1 A;  1ZQX A;  1QSY A;  3DU6 A;  3F5E A;  5L1K A;  9ICB A;  3K69 A;  2QCO A;  4ENM A;  3FF5 A;  2HXO A;  1RES A;  3KE2 A;  4C2T A;  1MQ2 A;  3RQI A;  3RZD J;  4U7B A;  2LYC A;  1R36 A;  2HR3 A;  5J40 A;  5KFH A;  1RR7 A;  5KHD A;  3HBL A;  1K6Y A;  2E35 A;  3LAJ A;  2GXB A;  3PX6 A;  1RYU A;  3HRU A;  1JHF A;  2BCQ A;  2RQQ A;  4JX5 A;  1QZZ A;  4EQQ A;  5KFB A;  1TWA J;  4OIR F;  5IIJ A;  1JKR C;  3RB6 A;  1EH6 A;  3AG1 H;  3O6B B;  3RSN A;  3JPO A;  4AYB N;  1MND A;  5FRN A;  1IDZ A;  1LE8 A;  3QP6 A;  5B3S H;  2AXT C;  3CJT B;  3HOS A;  4G7H F;  3WGI A;  1MDM B;  1T8E A;  4F4Y A;  1BR1 A;  1Z1B A;  7ICJ A;  3G1O A;  2WV0 A;  2NRX A;  4G3I A;  5LEK A;  4DYQ A;  3BQY A;  2WAD A;  2K4P A;  3Q0U A;  2W03 A;  3THV A;  1XCB A;  4Y2U A;  2YS9 A;  1BR4 A;  1FOW A;  3R0J A;  2ZIW A;  3FIW A;  2F4O B;  1ZQC A;  1HXD A;  1RG6 A;  1JI8 A;  1X9W A;  4LVS A;  4BJQ A;  1BBY A;  1U5T C;  1DDN A;  3C1Y A;  4RQ3 A;  3B9J A;  2KFN A;  3F3X A;  4KIG A;  3NQO A;  1G3W A;  2W1O A;  3ZQQ A;  3S2W A;  2OCC H;  2V1D A;  3PR5 B;  4QW9 A;  1RQN A;  2X85 A;  2K8B B;  2KIM A;  4EGY A;  3LST A;  1LFU P;  4FO6 A;  2FPL A;  1R1T A;  2O6K A;  1P6R A;  2BKE A;  1WZ2 A;  2KZ3 A;  4Z6C A;  2F8L A;  1PUE E;  3SEN A;  1HDD C;  2LYH A;  4DCC A;  1O08 A;  3D2N A;  3AG4 H;  3BPX A;  4A3K J;  2BBY A;  3GZF A;  1OCR H;  2VBZ A;  4KA4 A;  1KA8 A;  4PFP A;  3BG9 A;  3E6M A;  3HRT A;  3KEO A;  5C44 J;  3OYD A;  2CV2 A;  3SZP A;  5HNH A;  4XOP A;  1FLI A;  3H8J A;  4EV0 A;  4MF2 A;  3N97 A;  4NM1 A;  3HHH A;  8ICS A;  3ZDA A;  2DFH A;  2FF4 A;  2KT0 A;  3ABM H;  4GGG A;  1Y88 A;  4CZZ A;  4QWC A;  3LWF A;  2E8O A;  3A2K A;  3QYB A;  3F6V A;  4PJN A;  4YP3 A;  4FX4 A;  4B9T A;  4BS9 A;  1Q8K A;  3OSF A;  3BP8 A;  3N28 A;  1BI3 A;  5T14 A;  4E0D A;  3H3Z A;  1X6I A;  4FAS D;  1TQI A;  4RAY A;  3GTP J;  5TGT A;  4JV0 A;  4PJL A;  2I1Q A;  4ICA A;  2JUG A;  2VKD A;  1JKQ C;  3NAS A;  1TWC J;  4U7D A;  2EIN H;  3SI8 A;  4UBB A;  3DP7 A;  3GUD A;  8ICC A;  3WHC A;  4PPX A;  1V5F A;  3FKJ A;  1WWU A;  5E1W A;  3VSL A;  2FJ6 A;  5KG0 A;  4GC7 A;  1T8I A;  5D46 A;  2LF7 A;  5FKM A;  4DYC A;  1S9H A;  1SKS A;  3HKZ F;  3TW6 A;  1APL C;  2GXA A;  1COO A;  2C2R A;  2FLL A;  2ESH A;  2COB A;  1PVQ A;  4XL9 A;  2XAG A;  3OWT A;  4Q5S F;  2ZIU B;  4CZC A;  5DGA A;  2CG4 A;  3ZMD A;  3KKA C;  3UMG A;  4DL3 A;  1NK0 A;  1GV5 A;  4FCY A;  3S8P A;  1SVL A;  1JUD A;  2C2D A;  2LOO A;  1SV0 A;  2NYV A;  5KFJ A;  5BMZ A;  7ICL A;  1KN5 A;  5TIS U;  2GAU A;  4HZF A;  3LSP A;  2EAO A;  2BZF A;  2A1J A;  2OA4 A;  2HKX A;  3ABL H;  4IQU A;  4K4I A;  2HHS A;  1LB2 B;  3NVY A;  5DG9 A;  4AU7 A;  1ETX A;  1FP1 D;  2DYR H;  2MAX A;  2Z33 A;  5L1L A;  4RNN A;  5EWF A;  4W97 A;  4LGW A;  3H0M B;  7ICS A;  2IOH A;  2IEK A;  3SAG A;  1UHW A;  1OKR A;  2HHX A;  1PDN C;  1IN7 A;  2EFO A;  3DTI A;  4MFC A;  2H3Z A;  3FK7 A;  3G4S I;  1U3E M;  4JOM A;  5D5X B;  9ICO A;  1PYV A;  5E79 U;  3IRR A;  1ZXI A;  2VJ5 A;  2HCF A;  3UXN A;  4ED3 A;  1TQM A;  2DFF A;  1BVS A;  3WTY C;  1FYM A;  2R5Y B;  1X1D A;  4M47 A;  3GIM A;  2OZ6 A;  8ICW A;  2HDC A;  1X58 A;  2FQ4 A;  1TL8 A;  2M3A A;  1F5T A;  3VWB A;  1S10 A;  3H9J A;  1IJW C;  2EFW A;  2TCT A;  4M72 A;  3H7I A;  1TTY A;  2KRH A;  4G8X A;  4ZTJ A;  2DMP A;  3ZQH A;  4RAG A;  1BN5 A;  4UB2 A;  3DEE A;  2Q8K A;  5J0P A;  1X9S A;  2PJR B;  7ICO A;  1IDY A;  4BEH A;  1F36 A;  3RAX A;  3D2Q A;  3NRW A;  3S2H J;  3SZ2 A;  2A5W A;  2Z1D A;  2DA6 A;  1QVT A;  4NDL A;  1YW9 A;  3HIL A;  4PJ0 U;  4HYK A;  1P7D A;  5IOZ A;  1Z05 A;  3QPT A;  1GLN A;  2VKE A;  2F5F A;  2LYB A;  4IHW A;  1MC8 A;  3HOX J;  3D5S C;  3MDC A;  3PNV A;  3BR5 A;  1ZQL A;  2Y0S N;  2IHM A;  1VQ6 I;  2VJI A;  1SD7 A;  2GQQ A;  4XLE A;  3ZN1 A;  1KQ0 A;  3WKE A;  4A3C J;  2XPV A;  4YR3 A;  4ETS A;  3KHG A;  1TC3 C;  1E2X A;  2V4Q A;  3MC1 A;  3WTZ A;  1ZQJ A;  5AI6 A;  4ZYD A;  5KFL A;  3GFL A;  2OZU A;  3B02 A;  3KP2 A;  2YMQ A;  5CQG A;  3S1R J;  2R8H A;  2BPF A;  4P0P A;  1KQ9 A;  2FMS A;  1FFU A;  2JXJ A;  1J2N A;  4BJT A;  4LFU A;  3KP3 A;  1MDM A;  2BCU A;  2ZJA A;  1ZYR F;  2XAQ A;  1IXS B;  2X51 A;  4DW6 A;  3DTK A;  2PQ8 A;  2QKQ A;  1YJ9 I;  1SZH A;  2ZUC A;  4RQ6 A;  1Z77 A;  2M4K A;  5K5Q A;  2F4M B;  2XGE A;  1E3O C;  1JRP A;  2EIK H;  3FXU A;  2L54 A;  3KPH A;  2QBY A;  3WU1 B;  1D8B A;  4DS4 A;  1RZ4 A;  2E1E A;  5IIM A;  3FIS A;  4UW9 A;  3H92 A;  4B3A A;  4E70 A;  4MFA A;  2UZK A;  2LC2 A;  4ECX A;  2W24 A;  4B9M A;  4IVN A;  4Y7N J;  2VIX A;  5JR3 A;  1EA3 A;  3HOT A;  1BNP A;  4BBR J;  5HVQ C;  3UR3 C;  3JAM Z;  3S32 A;  3ZN0 A;  5KAI C;  4ZYG A;  1SFK A;  5D4S A;  1URJ A;  4LD5 A;  1A5J A;  4N9I A;  2F77 X;  1K4S A;  3T5L A;  2HDO A;  2HQA A;  4AIJ A;  1YHQ I;  4PJM A;  4L0Y B;  3L3F X;  4O3P A;  1NZP A;  1KFD A;  3HIF A;  2MSY A;  1OR7 A;  3LVW A;  3K6G A;  1SKW A;  4A8E A;  3BG5 A;  4NB5 A;  3WTS C;  5III A;  3KP5 A;  4ECS A;  3JRF A;  1XSX A;  2E1N A;  3IG5 A;  5J1U A;  2F1H A;  5AI8 A;  4ESJ A;  3PSF A;  3CP2 A;  1YI2 I;  1K5O A;  1S7A A;  4FZL A;  5J1R A;  3HW8 A;  2KIQ A;  3GME A;  2HOF A;  3SEQ A;  3EUA A;  2AH5 A;  1PVP A;  4ZZD A;  5KAF C;  1V3F A;  1ZRN A;  3TED A;  2QZ8 A;  4C3J J;  5L3D A;  3T3F A;  1OYY A;  3LA2 A;  3H5R A;  3L2C A;  2X1D A;  3RH5 A;  3CZ6 A;  3E0J B;  2FRH A;  4YFK F;  3ERE D;  3LYS A;  1X4P A;  3I76 A;  3QEA Z;  2K02 A;  2DMQ A;  3BPV A;  2DO7 A;  3PL8 A;  2Q4T A;  4K4H A;  4XKW A;  1S7E A;  3K9T A;  2CV0 A;  2MAB A;  1OJL A;  1JE8 A;  5FLM J;  1DPU A;  2RLT A;  3WKA A;  2AGQ A;  1IZ1 A;  2HQ5 A;  4DQQ A;  1NJY A;  4LMY A;  3NVW A;  1V4R A;  3L00 A;  3ZQI A;  2JRM A;  2PMZ N;  2KKV A;  2FD5 A;  5AIP A;  2YX7 A;  3G71 I;  4IS7 A;  1FIQ A;  2IBD A;  2KQR A;  3BDD A;  3ED5 A;  3KOO A;  3PSP A;  2DT6 A;  4C7Z A;  3RCO A;  3ZDD A;  2EV0 A;  3MFK A;  2F3N A;  2OHF A;  4RB3 C;  2LMR A;  5HP4 A;  3OHB A;  2VQH A;  5EJC A;  5K5O A;  3BR2 A;  4A6D A;  4UUS B;  1HLV A;  1WG8 A;  2NV3 A;  1IXC A;  1IG7 A;  2DPD A;  2P6R A;  1IRF A;  1R4N B;  3EUB 2;  4I2I A;  1TWG J;  1XS9 A;  2P6S A;  1VQP I;  2PN6 A;  1QQ7 A;  2XB5 A;  1PVE A;  3O8H A;  4YII A;  3PIO F;  2WF5 A;  3C23 A;  9ICR A;  2KJ5 A;  5HHH A;  1AKH B;  4F4X A;  2YSR A;  2DOA A;  4BU2 A;  3GCM A;  3WE3 A;  2J5P A;  1YJN I;  3LSR A;  1R1U A;  1FSH A;  1K1Q A;  1T6S A;  1N2X A;  4OOI A;  3ELK A;  4XRF A;  2E1O A;  3HXL A;  3PVX A;  1SD5 A;  3EYZ A;  8ICO A;  4FFD A;  3M9A A;  4QTR A;  3NUQ A;  4GXJ A;  3HWT A;  2CJJ A;  5H20 A;  1BW5 A;  2F1I A;  4O3N A;  3CTA A;  3FXK A;  3WK4 A;  4P0Q B;  3QP5 A;  3H5N A;  2NVQ J;  3ALR A;  4XM3 A;  1A6Q A;  2MLK A;  4YG2 A;  4FBT A;  4PHD A;  2D3D A;  2QLZ A;  4M71 A;  2L5Q A;  4FHT A;  3CP8 A;  2LPE A;  2C22 A;  1W5C C;  2L4M A;  2OD5 A;  7ICF A;  2LVS A;  2M4G A;  2XF7 A;  4ZZL A;  1B8I B;  4CDG A;  3K4G A;  5ERI A;  4ZYA A;  3S14 J;  5TRD A;  3OIQ A;  4BJ5 C;  3H4B A;  1XNS A;  4JK1 A;  3MN2 A;  3HPG A;  2IMW P;  2UUZ A;  5AKG A;  1ZR2 A;  1DUX C;  2IS1 A;  3ETL A;  3HC7 A;  1ZGJ A;  1U0J A;  2XKP A;  2NVY J;  1PUF B;  4I2H A;  3AAF A;  1SFX A;  3MGH A;  2GA1 A;  4Q8F A;  4HNU A;  2ZC2 A;  4E7K A;  3H35 A;  3J7Y J;  1P4W A;  1ZD4 A;  4B44 A;  2KRF A;  5LBQ A;  5ICG A;  4M9J A;  8ICM A;  3S15 J;  3QOE A;  5ALX A;  3KHL A;  2G7U A;  2RN7 A;  2BZT A;  4CYC B;  2OM6 A;  4Q44 A;  4I2F A;  3ONQ A;  5ALS A;  2A61 A;  4DLG A;  3PW2 A;  2OH2 A;  3PO4 A;  1ZQZ A;  1DPR A;  4F3O A;  1Z19 A;  8ICT A;  4XQ8 A;  3CF5 F;  3IP4 B;  4NBQ A;  1LEA A;  2MD0 A;  2O5R A;  1Z00 B;  1BI1 A;  3C3W A;  3LA3 A;  4KIB A;  1NJZ A;  3RB0 A;  2VC0 A;  2JQ7 A;  4RNM A;  1OCC H;  4XA5 A;  5KNL A;  3SHF A;  3BCA A;  2KHV A;  3TOB A;  2F5C A;  3QYP A;  3DTE A;  2LM1 A;  3C5G A;  1DGR M;  2HWV A;  2H8W A;  1ZH5 A;  4XRS G;  3JPR A;  5M5X J;  5ALE A;  4OIN F;  2V1X A;  3DPU A;  2G07 A;  1X1B A;  2ISP A;  3WTV C;  4IOC F;  2LMD A;  4C4S A;  5E3O A;  2W11 A;  2Y0S C;  2ZXI A;  2K27 A;  1G6N A;  1MH4 A;  4ENK A;  2P81 A;  3IH4 A;  4KT6 A;  2HS5 A;  1L7M A;  2JEF A;  5HNK A;  4ED2 A;  1GVJ A;  2WAQ A;  4R8H A;  1VJ5 A;  2F44 A;  3KZX A;  1X1C A;  3ISD A;  1RKW A;  3RJH A;  1P4A A;  3OYA A;  3C2G A;  5KFF A;  2ZME C;  2XGD A;  3H9Q A;  4NLB A;  2DFE A;  5G5G A;  4CF3 A;  2M1B A;  4A0Z A;  1UEL B;  4UAZ A;  4NQW B;  5TIS C;  3WTX C;  2XI9 A;  3SEZ A;  3NAR A;  1XSD A;  1L5U A;  3D1N I;  3ROU A;  2JN6 A;  4YEL A;  3BZC A;  5HDG A;  3CC2 I;  4EJT A;  5J8F A;  2PMZ A;  4I28 A;  5DS9 A;  1E0E A;  2L9V A;  1V5G A;  1Z91 A;  2DMU A;  1SXD A;  2ZIW B;  3IDW A;  3HYI A;  8ICP A;  4KX3 A;  4BQQ A;  1FFV A;  4RPX A;  1AOY A;  3GDX A;  1USS A;  1NJW A;  4B6J A;  1L3S A;  9ICK A;  2W82 A;  3O8G A;  2LY2 A;  4C3H J;  1S6L A;  1KEJ A;  3LWL A;  1ZK8 A;  2L01 A;  7ICH A;  1RZT A;  2XRO A;  1KGS A;  2XV4 S;  2VBX A;  3GYH X;  3S1Q J;  4ABZ A;  3M8J A;  1XN7 A;  3DXJ F;  5KFA A;  3M8R A;  3TFS A;  2KZZ A;  2AS5 F;  2KOB A;  1YFH A;  4I0B A;  2L9N A;  1WI3 A;  3CDH A;  3MKL A;  5E8I A;  5EF6 A;  4Y2R A;  3RH6 A;  2KJC A;  2JRZ A;  3NAU A;  3RJJ A;  2WV1 A;  5M3M J;  3WE2 A;  2CUZ A;  1YQA A;  3RH4 A;  2JH7 A;  3M8F A;  2KE7 A;  4JWN A;  4UB5 A;  3SAH A;  1J09 A;  1P2F A;  1UMQ A;  1ETV A;  4YMM A;  4BQO A;  1H88 C;  2CQK A;  2HXI A;  5DV5 A;  4ZJZ A;  1SEU A;  4DQR A;  3AN1 A;  3GTO J;  4PHA A;  3OGU A;  4QW8 A;  4DSF A;  2OWO A;  5C4X J;  4IRG A;  5IYC J;  4A3F J;  1JI7 A;  1N77 A;  4YMO A;  4DSE A;  2ISY A;  2M8E A;  1SB3 C;  1IIP A;  1LKY A;  5CVI A;  3F0C A;  1QA6 A;  1A35 A;  4X1E A;  1RRJ A;  1TVA A;  2ZFU A;  3HM5 A;  3EQL F;  3SFI A;  5HS8 A;  2W48 A;  4KNY A;  2B6G A;  4XKV A;  2GLE A;  2FMP A;  2Y1I A;  2Q2E B;  3E2E A;  2WA0 A;  3DKY A;  4DQP A;  1BW6 A;  5BPC A;  4HRI A;  1Z3X A;  1U78 A;  2XY5 A;  4GRI A;  3SV3 A;  2EIM H;  1D3Y A;  2X1E A;  4HQE A;  2WAQ N;  4UAW A;  4XN3 A;  2OQR A;  5KCM A;  3FMS A;  1ETK A;  2LBF B;  5KFG A;  1B8I A;  4NLN A;  4AVP A;  4LZD A;  3N4M A;  1KON A;  3IHQ B;  5CJ7 A;  2NOJ B;  4J9Q A;  3O3K A;  1WYG A;  2M0N A;  3AMZ A;  3ZDE A;  2XO7 A;  4DQI A;  1MZB A;  1VQ4 I;  4EM0 B;  3UPQ A;  1O7F A;  5ALN A;  2M2E A;  3IKT A;  2AXL A;  5IP6 A;  5LD2 C;  2AHO B;  5J0O A;  3TAR A;  4A93 J;  1A6S A;  1W7P D;  3HTU A;  1PZN A;  5EEG A;  5B66 U;  3GEZ A;  2A5Y B;  2EFQ A;  4C2U A;  3GLL A;  1XPX A;  2LKY A;  3ZD8 A;  3GF2 A;  3QYE A;  4A6E A;  1O3Q A;  2IRF G;  1KW4 A;  4OIP F;  2DA5 A;  3ZCO A;  1LUJ B;  4KJZ A;  5KFN A;  4IL6 C;  1Q1V A;  2R18 A;  2KV2 A;  2XAJ A;  3I4M J;  3AL0 B;  4Y52 J;  1IN8 A;  4UBC A;  5HLG A;  2W9A A;  1UJ8 A;  2BHY A;  1K78 A;  1N5X A;  5J8Y A;  3M3Y J;  1JKP C;  3JRH A;  1RR8 C;  1KQ8 A;  4KUM A;  3OYF A;  5FRM A;  3PO3 J;  4G7O F;  3R4K A;  2Q0Z X;  2W00 A;  4R63 A;  2W8L A;  3HGY A;  1I39 A;  2DI3 A;  4LLL A;  3MKY B;  1S5L C;  2P6U A;  2DA4 A;  2HHT A;  3GFJ A;  3GVA A;  4HAM A;  3WTT C;  4IRK A;  4PCQ A;  4QNL A;  4FE4 A;  2YY6 A;  1U49 A;  5HHI A;  1LJ9 A;  4C8M A;  1O7L A;  2KFZ A;  2JEI A;  5BOL A;  1ZQF A;  3J7A O;  1N62 A;  2IS6 A;  1NKE A;  1QVU A;  1T56 A;  4U88 A;  1I5Z A;  4C9Y A;  5DDY A;  2ETH A;  3BCB A;  2DDB A;  5HNF A;  4F5P A;  2F8K A;  3BC8 A;  1L3V A;  3LWM A;  2NO4 A;  2F48 A;  4XSZ F;  1X40 A;  4EAT A;  1XDS A;  3UQ0 A;  2WAQ C;  3I64 A;  1MSE C;  4KLD A;  1QQ6 A;  2WY8 Q;  2HSZ A;  4S04 A;  1L3L A;  4BBS J;  1B72 B;  2QQB A;  1MJB A;  2GOM A;  3MCZ A;  2ISZ A;  3MBY A;  2BXY A;  4WXD A;  1F4K A;  5FKK A;  2HOQ A;  3OMY A;  2GZW A;  6PAX A;  4A3J J;  2K85 A;  1Z0X A;  5H6Q A;  3A01 A;  5CQE A;  4IC9 A;  4K4G A;  1RYR A;  2F6C A;  1MD0 A;  1TT0 A;  3HJE A;  5IY5 H;  1SV4 A;  5KFQ A;  5C0Y A;  4AYB C;  2KHM A;  1IW7 F;  3HPO A;  1EH8 A;  1ORK A;  5J0W A;  4CIC A;  4YD1 A;  5ILV A;  1L3U A;  5ALI A;  2ES6 A;  8ICN A;  4O0I A;  2Q0O A;  1XTA A;  1ZET A;  3QAH A;  4BGD A;  4IRH A;  1CF7 B;  4F52 A;  2HBK A;  4AUX A;  2P8T A;  1JN3 A;  3ZD9 A;  5IIO A;  1AHD P;  1ENH A;  8ICL A;  3JPP A;  3FMQ A;  3CNH A;  3BG3 A;  4LZG A;  1I27 A;  5J1Y A;  1WJD A;  4UNO A;  2HMX A;  4HAI A;  4DGW B;  1SWW A;  2ZO4 A;  2K7L A;  3KZZ A;  1YZ6 A;  5EWG A;  1FBU A;  3DV8 A;  4A0Y A;  3U2R A;  2F5D A;  5AM1 A;  1I3Q J;  2E7W A;  3C21 A;  2BDP A;  1LKY B;  5F3X B;  4ED7 A;  4RUC A;  1WJB A;  2F2E A;  4B9L A;  4F2R A;  1AA7 A;  1YIO A;  3NVV A;  3BTI A;  2DOF A;  5J29 A;  1T4G A;  3Q8Q B;  3HOU J;  1ZQS A;  3ABK H;  3OYB A;  5LHG A;  4XK4 A;  2IOF K;  3L5K A;  2YUS A;  3WKD A;  4QJF B;  5DBA A;  4B9U A;  3LNQ A;  4QZC A;  4KLS A;  4B43 A;  2CH0 A;  3EUH C;  2XPW A;  4BXO B;  3ZP5 A;  5JU5 A;  4QZD A;  3IWZ A;  4Y13 A;  2WAQ F;  4ED1 A;  3Q8K A;  2RRD A;  2RRE A;  5FFZ A;  2D8C A;  5AKE A;  4MF8 A;  2CPR A;  2VXZ A;  3G3Z A;  5LGN A;  2K5C A;  2MH9 A;  2QQ9 A;  4UAS A;  5H2F U;  4BDP A;  4M9N A;  4EJW A;  5IT9 K;  5J3L A;  1KU3 A;  5GTI C;  1ZGW A;  4O3R A;  2KJ8 A;  1W7P B;  1F44 A;  1OFC X;  2HYJ A;  1JGG A;  3ESW B;  5F0H A;  2XCA A;  3K0L A;  1B9M A;  2FOW A;  4S0H B;  4TQS A;  9ICN A;  8ICG A;  4D9J A;  1SAU A;  4A12 A;  1WKM A;  3HHG A;  2KIF A;  4CUG A;  1GUU A;  5BQT A;  4XRM A;  2EAN A;  1RKT A;  2ZXH A;  3M6K A;  3ZPL A;  4M9S A;  2VQG A;  4A3L J;  5ALR A;  1LDJ A;  4JWM A;  3MWM A;  5D6F A;  8ICV A;  2Y2Z A;  1UCV A;  1ZRF A;  1T08 B;  3KLO A;  4FIS A;  4AD9 A;  4EMS A;  4XID A;  1WGX A;  3K4M A;  4JQF A;  3ETR A;  9ICH A;  4EEN A;  1MGT A;  2V1N A;  2H6B A;  1W0T A;  4D5F A;  4YIR X;  2R7O A;  1OCZ H;  5DCM B;  3I4N J;  5DG8 A;  5J0S A;  3OSP A;  2IBK A;  1Z1D A;  2ZJQ F;  3E58 A;  3RB3 A;  1NK3 P;  3LSM A;  4OAZ A;  3PW0 A;  9ICF A;  3MZ8 A;  3MZY A;  5D6E A;  1K1S A;  2EZX A;  3QZ8 A;  1D0Y A;  2R8K A;  5DDG A;  2K4I A;  1FEZ A;  2CFO A;  1X3U A;  3SZG A;  1XO0 A;  1G4D A;  2ESE A;  4A0X A;  3BZK A;  2YU3 A;  3KEQ A;  2B7E A;  4D1Q A;  2QB0 A;  5ALV A;  1ZRM A;  2AGP A;  3NTU A;  2P5L C;  2E7X A;  3OYN A;  3C2K A;  2W7P A;  2ME6 A;  4BHP A;  1SC7 A;  2EPF A;  2L3D A;  4DFK A;  5AKL A;  1UA1 A;  2BW3 A;  2CU7 A;  3FWE A;  4OJL A;  2OXO A;  5J4Y A;  2H3F A;  1SVO A;  3TAQ A;  5FKO A;  2KPM A;  3KKA A;  3VOD A;  4UUS A;  1WCN A;  4RA2 A;  1XG1 A;  3QUQ A;  2STW A;  4GDF A;  2H3Q A;  1VZ0 A;  5JTI A;  4FZM A;  2IXS A;  3FM9 A;  2DL0 A;  3KET A;  5D5U B;  3MR5 A;  4NXZ A;  2PFQ A;  2M9H A;  1SFE A;  2ZIU A;  3KX2 A;  1K83 J;  2XY6 A;  3EYI A;  9ICJ A;  1N5W A;  4WF2 A;  5HLH A;  3V8J A;  2KHQ A;  1HKT A;  2O8K A;  1XD7 A;  2F1J A;  3GTJ J;  3QE9 Y;  4XBF A;  2B0L A;  3OOU A;  3V7K A;  4UB6 U;  1OCP A;  1ZJM A;  2UVV A;  2WF7 A;  3RPU D;  2WB1 F;  2D2W A;  3GFK B;  2NVU B;  3GIK A;  2G5I B;  1CEZ A;  2NS7 A;  5H2F C;  1A76 A;  1SMY F;  4KLT A;  1WVR A;  3SFZ A;  4A3I J;  3M9M B;  4KLM A;  3UXP A;  1HEK A;  2DBB A;  4ZYH A;  1UQV A;  2EAM A;  2RDI A;  1K61 A;  1SAN A;  2LP0 A;  3ZMZ A;  2JUC A;  3LA7 A;  2NOG A;  4IQ4 A;  4EX6 A;  5CPR B;  9ICE A;  4BUP A;  7ICT A;  3S3M A;  3WK5 A;  2FMQ A;  4EYH B;  2F4I A;  1QU3 A;  1A77 A;  3DKW A;  3H1C A;  4YQW A;  3JTG A;  1HIW A;  2A07 F;  1JXE A;  4PH5 A;  3RYR A;  5BNG A;  4XIC A;  4L0Z B;  3HDD A;  4RQM A;  5L1M A;  4XOT A;  3MKZ A;  4RU9 A;  4U87 A;  4XKC A;  4KLF A;  2QLT A;  1YO5 C;  2CQN A;  1G59 A;  4X5V A;  4J9R A;  3V6H A;  1UT5 A;  2GWR A;  1HUZ A;  3F23 A;  4Y2J A;  3K1Z A;  4UXN A;  5E3M A;  2TDX A;  1QPI A;  2VN2 A;  5EGO B;  3RKQ A;  4DIQ A;  4ESB A;  3BS5 A;  4HV5 A;  1NG7 A;  2VBY A;  2LRE A;  1YRN B;  2DBY A;  4F5R A;  3TP3 A;  4GXK A;  3E5U A;  1RM6 C;  1Y8R B;  3ZQ7 A;  1IF1 A;  5CKT A;  2FSW A;  2VQC A;  2HEO A;  5J8C A;  2X6O A;  2Y75 A;  1NK7 A;  5HLT A;  3ZR8 X;  5DD4 A;  4P5O A;  2ATL A;  4CYD A;  3AU2 A;  1R6R A;  3CC4 I;  2R3S A;  3ABU A;  4UAY A;  3RR7 A;  2BXZ A;  5D4B A;  2KJ9 A;  3PW7 A;  3IWF A;  1ZTR A;  1ZHF A;  4LIT A;  1QSL A;  2DOE A;  4F71 A;  1TP4 A;  1ZQB A;  2RAE A;  3ZGK A;  5KAI U;  2Z3Y A;  1DOQ A;  2Y48 A;  1BL0 A;  3FDS A;  4PK4 A;  1IV8 A;  5JUM A;  3G1L A;  4DJA A;  1QSS A;  4CCH A;  1DU0 A;  5FJ8 J;  4UB4 A;  1MMA A;  1KFS A;  3BQ2 A;  2VBW A;  4A3B J;  3CDI A;  3OIO A;  5KK1 A;  4G6T B;  1FT9 A;  5AKZ A;  2DQR A;  1O3R A;  1WHU A;  4KIF A;  3IM1 A;  1HSJ A;  1JTY A;  2W9C B;  2W8K A;  4N4O B;  3VFZ A;  4LG3 A;  2DF4 B;  4IO9 F;  1MH3 A;  1PK3 A;  2V4R A;  5J2C A;  2ZUD A;  1FBS A;  4X6A J;  2L7Z A;  2K4H A;  4L5I A;  2PXI A;  1NG6 A;  2CUJ A;  2W7N A;  1J59 A;  3NS1 A;  1BJZ A;  3MR3 A;  3OS0 A;  3RKX A;  1SVM A;  1IC8 A;  2R7D A;  3SEI A;  1R5H A;  2G7H A;  3G6V A;  4C8K A;  1A6I A;  2JH1 A;  8ICE A;  3WHB A;  1X4O A;  8ICK A;  2HQR A;  2XIG A;  1H9G A;  4NJ8 A;  3BY6 A;  4RGU A;  3PX0 A;  2CW0 F;  3WGH A;  1YS7 A;  4EM2 A;  4XNF A;  4P9F A;  5A2Q Z;  1XU4 A;  1I6H J;  2W9B B;  4J9P A;  3K4N A;  2EZZ A;  3GW2 A;  3MMY B;  3F8C A;  3IRU A;  1ZQR A;  2JSC A;  2H3V A;  4EEY A;  1C0W A;  2IA1 A;  2CYY A;  2QVO A;  4IEJ A;  1ZOL A;  4YCX A;  2DMT A;  2F5E A;  4WCG A;  2HI0 A;  2QA4 I;  3WKC A;  3ZQG A;  2IPQ X;  2NXN B;  3S1N J;  5AHX A;  3MFI A;  1U9L A;  3F2C A;  4G12 A;  3LVV A;  3AL0 C;  1BI0 A;  5CVU A;  2P66 A;  3E5X A;  2ZNY A;  2H3I A;  2R7Z J;  2LF8 A;  4ENJ A;  3L4P A;  5L1J A;  2HTJ A;  2MU2 A;  5KT2 A;  5HR7 A;  3BT9 A;  2JGA A;  2UXX A;  1HF0 A;  2HKO A;  2LY9 A;  4R8U B;  4UVA A;  4WXH A;  2KNJ A;  5B1A H;  2Z9O A;  1ZQM A;  4QZA A;  4XQF A;  2W3R A;  2ESN A;  2JV3 A;  2D6F C;  1JUP A;  5ALY A;  3KBB A;  4DBR A;  4D7N A;  2ID3 A;  4CCN A;  3OR2 C;  4Z6Y A;  2HBL A;  3BQZ A;  4J01 A;  3EZ5 A;  3V7J A;  3F2D A;  1HKQ A;  2FXA A;  3N05 A;  4M2Y A;  3T5K A;  4NLK A;  5AM3 A;  5AM2 A;  5J2G A;  2D45 A;  2A3S A;  1VLB A;  4QPQ A;  4RQ4 A;  4Y4R A;  1D8Y A;  4YIF A;  2A1J B;  4CNQ A;  3K4K A;  2XDV A;  4RGX A;  4J9K A;  1ZQN A;  9ICT A;  2XAF A;  3CES A;  5J2F A;  1W5T A;  4N0B A;  3TDU C;  3I9V 2;  3TO6 A;  3AQF A;  5J2B A;  4LIV A;  1O3T A;  2G5H B;  1MMD A;  3RR8 A;  8ICZ A;  1MJA A;  2YU9 J;  4BQN A;  1OIS A;  2KD1 A;  1T95 A;  4C8O A;  1TAQ A;  2E3T A;  3CO6 C;  5JFR A;  1Y39 A;  5F64 A;  4NWI A;  4I76 A;  4O5C A;  8ICQ A;  9ICS A;  1B43 A;  5CA7 A;  2CRX A;  1FIP A;  1OMI A;  3P7N A;  4PGG A;  3GTK J;  2Y1J A;  1ZAR A;  2BQR A;  3F6O A;  4I98 B;  1ZG1 A;  1BM9 A;  4I01 A;  4BX9 C;  4IR9 A;  3C2H A;  3VYS B;  4RB1 A;  1UPH A;  4DFD A;  4XR6 A;  4NLZ A;  9ICQ A;  1QCK A;  4XON A;  1NI3 A;  1UCR A;  4AVZ A;  2Y9Z A;  1U6G A;  4KMF A;  1PUZ A;  3ZI4 A;  5AKK A;  4CE6 A;  4R8U A;  2E1M C;  4PGH A;  3GII A;  2BOL A;  3RB4 A;  1L7P A;  4FTH A;  4M3G A;  3G6Y A;  4B9N A;  3FMR A;  4S05 A;  4YXM A;  2RGV A;  2KIW A;  4ECW A;  2LKS A;  3WU0 A;  1J5Y A;  1R1V A;  4AC0 A;  4I2B A;  2QEN A;  5KFD A;  4KN4 X;  1L3T A;  5DQI A;  7ICM A;  1WH7 A;  4GYG A;  3BDP A;  1XC9 A;  1JXL A;  3LDA A;  3MFH A;  1U9N A;  3IH2 A;  2ECC A;  2WY7 Q;  2PBI A;  1R22 A;  1TZL A;  3KP4 A;  1XDU A;  2F5V A;  3TP0 A;  4G7Z F;  3UKG A;  3JPT A;  4OMZ A;  1FC3 A;  2DKZ A;  2R7T A;  2XB0 X;  2VOD A;  2KG5 A;  3QX7 A;  5DLG A;  2W7O A;  3C1D A;  1H38 A;  2QAR B;  1WCM J;  3E1S A;  3F8M A;  5KG5 A;  1V9P A;  4C4R A;  2K9Q A;  2XKO A;  2IAI A;  5HS9 A;  2E34 A;  2I5H A;  3KFW X;  3AKZ A;  4IZZ A;  2JZB B;  1MQ3 A;  3PO5 A;  3UNG C;  1X42 A;  1ZJN A;  2ZSI B;  3M1E A;  4Z2Y A;  1N61 A;  3ISB A;  4ECU A;  1W1W E;  3OYG A;  3FXJ A;  1OCT C;  3DWL E;  1TBX A;  2DJN A;  1R00 A;  3MD2 A;  9ICL A;  3HEF A;  4EX7 A;  3NVZ A;  4RNO A;  4US9 A;  3R9K A;  4RM2 A;  3T0Y A;  3HOZ J;  3WU2 U;  5F27 A;  2UV1 A;  2R7R A;  4PSW A;  3CLO A;  4QZG A;  1NK2 P;  2C6Y A;  1T0F C;  2FOK A;  2HZD A;  2KP6 A;  1I6X A;  2EIL H;  2L02 A;  2MD5 A;  3W3C A;  1XMK A;  4XLN F;  4N9H A;  2O61 A;  2EFN A;  3QU4 A;  4RUA A;  1Z00 A;  4JX4 A;  2EWN A;  4BWJ A;  1SGG A;  4KLE A;  2W9C A;  3G73 A;  5CR0 A;  4CCM A;  3SR6 A;  3KFU F;  2X1C A;  3ERM A;  5ICF A;  3GX4 X;  4G6D A;  2AXT U;  2Y30 A;  3MR6 A;  3AFH A;  2DT7 B;  3KYD B;  2GXG A;  1N60 A;  2HYF A;  2UVW A;  4WK8 F;  4I2D A;  2WBM A;  3HRD D;  2VI6 A;  1IRX A;  1POG A;  4CYC A;  2L0K A;  1JIH A;  7ICR A;  1GT0 C;  4RGS A;  3FBN B;  3H3U A;  3AEV A;  1TAU A;  2CQX A;  2ELK A;  2ZNZ A;  3KP7 A;  3MVP A;  2JVH A;  1CQT A;  3BG7 A;  2PMH A;  3OS1 A;  3BWG A;  5LRS A;  3I0T A;  4I2C A;  3KYC B;  1RUN A;  4PSX A;  3HPH A;  4BHC A;  4F5O A;  2K40 A;  1S3J A;  2FDR A;  2KJB A;  3KCC A;  4A3G J;  2R8I A;  3PW4 A;  2GWS A;  3ECH A;  1Z3Y A;  3IKV A;  1DK2 A;  2IGM A;  5AKY A;  4BYY A;  2R4G A;  3KTQ A;  3QNM A;  2D1V A;  1CF7 A;  1ZQY A;  4P96 A;  4RAF A;  2A6T A;  4KLL A;  5CB1 A;  3JRB A;  3G6X A;  2EZK A;  2KSO B;  2ME0 A;  2PMZ C;  1WJC A;  5LRR A;  2EH3 A;  2BVL A;  1X1A A;  2DDA A;  4YFN F;  2KMD A;  1LDD A;  4XRS A;  1EH7 A;  2EA2 A;  3SD7 A;  4UB6 C;  4M9H A;  3RDI A;  1WUD A;  2XVT A;  3BLY A;  4M3E A;  5ALF A;  3V6K A;  1ZR4 A;  2ZIV B;  1U5T B;  4USA A;  3FYH A;  3ML6 A;  4CF4 A;  1ZYQ A;  9ICW A;  4A2U A;  3CCE I;  2M5W A;  2P5V A;  4B3X A;  8ICH A;  2XRL A;  1IN6 A;  2BQU A;  1KYW A;  3H5A A;  1KTQ A;  2J6U A;  1FTT A;  3LMM A;  5ALH A;  2LI6 A;  3HUG B;  4ZC3 A;  2B63 J;  5HMM A;  1ACI A;  2VJJ A;  3N97 B;  1X2M A;  4I7H A;  3H40 A;  2I6X A;  3I54 A;  2ZJR F;  3ORY A;  4CH7 A;  4EVI A;  1TWF J;  1W4M A;  3KHH A;  2PKE A;  4ZDL A;  1IO2 A;  4CXF A;  2JWT A;  3I5U A;  4A5M A;  2WF6 A;  3ZRG A;  4NL9 A;  4M9Z A;  5J0Q A;  3FXR A;  1A36 A;  5ALO A;  3Q8P B;  3VC8 A;  2WAF A;  3PX4 A;  3I28 A;  3E6B A;  3C18 A;  2JSP A;  2ICW G;  4EJU A;  4F5Q A;  2CSO A;  3U21 A;  2CFX A;  4RGR A;  2EB7 A;  3ASN H;  3H8S A;  1IUY A;  5KFI A;  5L1I A;  1TK8 A;  3J80 K;  4RDU A;  1B72 A;  5KFY A;  2OCE A;  4KN7 X;  3PY8 A;  2LYA A;  5KNI A;  1JUS A;  3SJM A;  3GU3 A;  3I71 A;  2QBY B;  4OJ5 A;  1MBE A;  3Q9V A;  5AIC A;  4KX5 A;  4UB8 C;  5F08 A;  1ZLK A;  5D4R A;  3W2W A;  5FP0 A;  2Z99 A;  3C5F A;  3ZDC A;  5EEA A;  2DKX A;  3TL4 X;  1UHU A;  2DFL A;  5KL8 B;  1RC9 A;  4ZTF A;  1F0M A;  4HDV A;  1S97 A;  1MNM C;  4AID A;  1MBG A;  4PZN A;  4DOB A;  1QTM A;  2M8G X;  1N48 A;  1BR2 A;  2HI3 A;  3PW5 A;  3LSH A;  3K2A A;  3MQ0 A;  5ILU A;  1VDV A;  2NRA C;  3E6D A;  3OOP A;  1HQC A;  4M6V A;  2LD5 A;  4LLN A;  1XGS A;  1GDT A;  4EYI B;  7ICP A;  1ZLJ A;  5DM7 F;  2QSF X;  1BIA A;  4F91 B;  3OYJ A;  3DF8 A;  3G2B A;  4UV8 A;  3J7A Y;  4E6K G;  2IVM A;  3MDA A;  5DLF A;  2D1H A;  3WK7 A;  1HW2 A;  2RDJ A;  2FPK A;  2WTE A;  2H8R A;  2EZI A;  3BJ6 A;  5J0U A;  3JRD A;  1UHS A;  3H36 A;  1FJL A;  2STT A;  3F72 A;  4BXF A;  2ZIX B;  2BPG A;  1Y1V J;  2VUM J;  3RJE A;  1Y1W J;  4FE7 A;  1MSW D;  2VAN A;  2HBJ A;  5KFU A;  2K86 A;  1VF9 A;  2E2I J;  4DOC A;  1PVR A;  5E3N A;  1TKD A;  4QWQ A;  4QIW N;  2JZB A;  2YMP A;  4OWR B;  3HSF A;  3ABT A;  3IAM 2;  3WG7 H;  4AYB F;  4BE1 A;  2KMU A;  2HPM A;  3NGD A;  5J0T A;  1GV2 A;  4P4M A;  2VXD A;  3PJR A;  4F3Q A;  2F76 X;  4PL1 A;  3I58 A;  1V54 H;  1FNN A;  4OCZ A;  1T3Q A;  4BUG A;  7ICE A;  2AQF A;  2UWM A;  2LBF A;  3LSJ A;  1QQ5 A;  3M6Z A;  4KYW A;  1DRG A;  2DJI A;  1X19 A;  2VT3 A;  4A5N A;  3GV8 B;  4P2H A;  4BE2 A;  4E7I A;  1DP3 A;  3CME I;  3I55 I;  1NK8 A;  4HA8 A;  2VKV A;  3VSK A;  2YPR A;  5K7Z A;  2FUG 2;  2Y9U A;  1MNE A;  2M7B A;  1HBX G;  5ALM A;  3M9N B;  3JRG A;  8ICA A;  1LEB A;  3JRC A;  3QZ7 A;  4QWE A;  2VQL A;  3LFK A;  3SAF A;  4R65 A;  3B73 A;  5AIB A;  4KLO A;  5EE3 A;  3BR3 A;  2BCV A;  4NL9 C;  4KMO B;  3L7W A;  2VLA A;  2ZBK A;  3W2A A;  1KFT A;  5F1J A;  3IG8 A;  3C7J A;  1KSP A;  2UVR A;  4DL2 A;  2HGC A;  1G8X A;  3CUQ B;  2YX8 A;  2DMN A;  3HKZ A;  1Y8Q B;  2RVC A;  1Z6R A;  3FK6 A;  4MO7 A;  1J0R A;  4XSX F;  3PIP F;  3L2W A;  3CLQ A;  4CF5 A;  2DN0 A;  4KDP A;  2E36 A;  5J8Y C;  3CJR B;  4UB8 U;  2HVR A;  3OIP A;  3R6S A;  1RDF A;  5B66 C;  1ZD2 P;  4ECQ A;  1SIJ A;  3OL4 A;  1HUO A;  1FTZ A;  5FRO A;  4L9N A;  2YQE A;  1YIJ I;  1HDP A;  2RQP A;  3JCU C;  1Z7L A;  4F93 B;  3GZ6 A;  4YXJ A;  5AM4 A;  4RPZ A;  1NK6 A;  4O9M A;  2XY7 A;  5AI4 A;  1ZGA A;  2BHZ A;  5D8L B;  4BJ6 C;  1IGN A;  2E1F A;  5ALW A;  7ICK A;  7ICU A;  3LOC A;  2DXI A;  1ON1 A;  4I02 A;  3S6J A;  4QWA A;  3G6E I;  1TNT A;  3BR0 A;  1U8R A;  1QBJ A;  4C80 A;  2KIU A;  4UAV A;  2BHN A;  2I9G A;  4P9U A;  5CHG A;  3VPR A;  2VPR A;  2OU2 A;  1Q46 A;  2QAR A;  1JXS A;  1QHH D;  5ICE A;  1R5G A;  1Z21 A;  2K9S A;  4LIU A;  2NRT A;  3J7Z I;  3VB2 A;  1Z1V A;  2L4A A;  2IJL A;  2OQG A;  2JZY A;  3TKA A;  4I2E A;  5J0X A;  3HUG A;  3T8R A;  1NK4 A;  2RQ5 A;  1D5V A;  1HJP A;  1H8A C;  1MSF C;  3SQI A;  1TW3 A;  2R7U A;  2AQE A;  4GC6 A;  4N4N B;  3RBE A;  3F8B A;  2Y9T A;  3EPG A;  1WJ5 A;  2JT1 A;  1J7K A;  4M0A A;  5LFA A;  2ZJ5 A;  3GV5 B;  5AIQ A;  1UFM A;  2IGK A;  3K4B A;  4HF2 A;  2G0A A;  2ZIV A;  3OR1 C;  2KKO A;  4LJZ F;  4BQA A;  3TQ1 A;  2JA8 J;  3CQZ J;  1REP C;  2CO5 A;  2NVT J;  1M6Y A;  4M9G A;  4M6W B;  4ED0 A;  3CMA I;  1H89 C;  5TZV A;  1VQ9 I;  5E1Z B;  3BJY A;  2O7O A;  4R1H A;  4HX8 A;  2V9P A;  1VQN I;  1QPM A;  5DBB A;  3ZOB A;  8ICR A;  4DBQ A;  5DUI A;  2LK2 A;  3HX0 A;  3KZI C;  1B22 A;  3U26 A;  4Q4Z F;  2K3F A;  2NS8 A;  2GIV A;  5JI6 A;  4XOR A;  5AKJ A;  2AQ0 A;  5JRT A;  4J9N A;  2HHV A;  4I6Z A;  2ADU A;  4G6Q A;  2HFH A;  3QPL A;  3TAD A;  5J0R A;  3T5J A;  1U45 A;  1SL0 A;  1SL1 A;  1VQM I;  3KZI U;  3FZV A;  3HKZ N;  5E20 A;  7ICN A;  3K1R B;  5E8G A;  4OJ6 A;  2TRT A;  1L7O A;  4H4K C;  4UQG A;  2XGC A;  4ZH4 F;  3TOA A;  4EBC A;  2W54 A;  5J2E A;  1RXV A;  4RT2 A;  5D5W B;  2Z2S B;  3LSI A;  3JRA A;  2B9S A;  1VQ8 I;  3PST A;  2CS3 A;  5IYD J;  4B4C A;  5EE9 A;  2E2J J;  3RJK A;  4PFO A;  1FMV A;  4M6Y A;  3HT3 A;  3VDX A;  1I1G A;  4DQ2 A;  2PI0 A;  4NV0 A;  5DB8 A;  4PUS A;  1GO3 F;  3TW7 A;  1RNL A;  3GWZ A;  3H9G A;  1XMA A;  2K9L A;  4JK1 X;  5J47 A;  2HBM A;  5ALL A;  1FYL A;  2GOL A;  3QOD A;  1X2I A;  3DLL F;  2NS0 A;  1ZQV A;  2CW7 A;  4PZJ A;  3RI4 A;  2DOD A;  2EH9 A;  3V8K A;  3BJA A;  2OTL I;  4DF8 A;  2LKP A;  2NRW A;  4JB3 A;  4NC7 A;  4KFC A;  3TAP A;  3A1Y A;  2KIV A;  2BY3 A;  1WQ2 A;  4KN4 A;  1CGP A;  2ZIX A;  1FEX A;  3PNC A;  1FWZ A;  1NHA A;  4F7Z A;  2EQR A;  2LHT A;  4UAT A;  2VE9 A;  2HOI A;  3QOP A;  1BPE A;  2OUM A;  3CCL I;  3P9I A;  4Z6D A;  1G3S A;  3K2Z A;  1D8L A;  3JSO A;  4BAC A;  4RQ7 A;  1KYZ A;  5HLI A;  2GO7 A;  4MEX A;  1KZH A;  4K2E A;  3E7L A;  4M74 A;  3L2Q A;  1JJ6 C;  1BPB A;  2KFD A;  4M6X A;  4Q45 A;  1ZD3 A;  3PZP A;  5GTI U;  5K7H A;  4LLG F;  4A3D J;  2IA2 A;  2LSO A;  2B21 A;  4U0Y A;  2Y0S F;  4RQ8 A;  3JTH A;  4HV6 A;  1E3P A;  1NTC A;  4Q48 A;  5FFX A;  4EJV A;  2MUT B;  2QB0 B;  5KFW A;  4OO1 J;  1Z6T A;  2XAS A;  4BDZ A;  3MZH A;  3RF9 A;  2JA2 A;  1ZQK A;  4NC6 A;  1S0M A;  2EA4 A;  1V85 A;  4J9S A;  1BI2 A;  2HU9 A;  5HDN A;  3OYM A;  1ZQH A;  4DSK A;  2CWE A;  2EDU A;  4IHV A;  5L3B A;  4DFJ A;  3K1M A;  3PQK A;  2PEX A;  1ZQ3 P;  1T0F A;  4F4W A;  1IG6 A;  1XCV A;  4RB2 C;  3TAD C;  2BR0 A;  2HVQ A;  2CQQ A;  1Z67 A;  4DWI A;  1GHC A;  5AI5 A;  2DWQ A;  2FE9 A;  5LHI A;  1MA7 A;  2QKL B;  4AM3 A;  4F72 A;  3JPS A;  3BQ1 A;  5EZG A;  2WAE A;  3IHU A;  1X1P A;  2HVI A;  1ZQT A;  3M1Y A;  4YVZ A;  2JA6 J;  2DW4 A;  5K4L A;  1XMX A;  4HSR A;  2LBO A;  4HYE A;  3MR2 A;  4DSI A;  3T79 A;  4O6J A;  3I3L A;  5J6X A;  5HOD A;  3TAN A;  3LQR A;  4GFB A;  4DFP A;  2WB1 A;  4CHU A;  3BQT A;  3HGG A;  1ULY A;  3MAB A;  1TWH J;  2R7X A;  1S9F A;  2A6E F;  3TGN A;  2HHU A;  1YS6 A;  1B6A A;  5GPC A;  1JAL A;  2V79 A;  2BE5 F;  3QPS A;  1BA5 A;  2NNN A;  4FET A;  5ALT A;  1K79 A;  1EJ9 A;  3LSG A;  3KIO A;  4HOB A;  3JR9 A;  3OSG A;  1ZAO A;  1ECW A;  1WH5 A;  2PFB A;  4YR2 A;  4V19 K;  1QZE A;  1PK1 A;  3F9K A;  4P55 A;  1DGS A;  4QZE A;  4I99 C;  2X6X A;  1JT0 A;  5B5E C;  2V7F A;  4RMN A;  2YB1 A;  4IHT A;  2ZUB A;  3HKZ C;  1XC5 A;  4NLG A;  2XRN A;  2K4B A;  2Z5U A;  4NQW A;  2Y9Y A;  1NNL A;  2E8M A;  5KFV A;  4C0Z A;  3TBI A;  3QUT A;  1YYV A;  3A0H C;  4KIC A;  4E4H A;  5L9X A;  2O8X A;  2LG4 A;  2ZME B;  4I29 A;  4I09 A;  5CRX A;  3ASO H;  3H0R B;  2OTJ I;  2W3S A;  2XPU A;  4ZYE A;  3CD6 I;  5IT3 A;  4IXA A;  2VT2 A;  1IM4 A;  2RP5 A;  1FOY A;  1WJF A;  3Q8S B;  3FXQ A;  4FS2 A;  1WPK A;  3CW2 C;  2KSO A;  3TAC B;  1TAM A;  1W0U A;  2XSD C;  3K75 D;  4C8N A;  1IXR A;  2DCE A;  2V9K A;  4QIW F;  1V55 H;  1U9O A;  4WXC A;  2V6C A;  3U9G A;  3F53 A;  4QPO A;  4DF4 A;  3I59 A;  3B6A A;  5L3E A;  3HSE A;  2W4S A;  1LB2 A;  5E17 F;  2X6Y A;  1TV9 A;  4P1W A;  2V4J C;  2K4J A;  1ZQW A;  3OJS A;  2BDU A;  4M6W A;  3LK9 A;  3EUK L;  3E5Q A;  5DBC A;  4KIT B;  3Q8R B;  1F9N A;  4FT8 A;  4JUZ A;  4UY8 I;  2E5Z A;  4IRI A;  2H1L A;  4YEJ A;  3OL3 A;  2O9L A;  1EKE A;  2E19 A;  4XLH A;  3V7R A;  2CQ7 A;  5KG7 A;  3JPQ A;  4B8X A;  4EEK A;  1IN5 A;  2FBK A;  4C3I J;  3MAJ A;  1V97 A;  5M3F J;  1D1A A;  3BG6 A;  4QZF A;  3FHZ A;  1X2N A;  3GO5 A;  4X0G A;  2EK5 A;  5J0Y A;  2KZM A;  2XSJ C;  1BC7 C;  2DA7 A;  5CJ9 A;  5J4V A;  2R5Y A;  1ED1 A;  3RPU A;  3RRG A;  2XC9 A;  1G2H A;  4IR1 A;  1BIB A;  3R0A A;  5FLX Z;  3SMV A;  2FLP A;  4EM1 A;  3S2D J;  3BS7 A;  1B4F A;  5C4J J;  1NK5 A;  2LFB A;  2R7F A;  3A03 A;  4Y2S A;  2PJR A;  1AU7 A;  4J9O A;  3U1K A;  1WWX A;  1T2K A;  1FBQ A;  1FSE A;  1ERD A;  4HG2 A;  4P4O A;  3N7P D;  2EZH A;  3V7C A;  4MNU A;  3C28 A;  4M9L A;  3NRV A;  2PI4 A;  1I3A A;  3PQJ A;  5CVV A;  2R93 J;  4NUB A;  4IL6 U;  4NNJ A;  2RC4 A;  4MEY A;  4B09 A;  2W57 A;  3Q9S A;  7ICQ A;  2JPB A;  2G08 A;  4KTQ A;  1SMT A;  2KLO A;  5KFK A;  2I8D A;  4UUV A;  3QU7 A;  2DK5 A;  3CCJ I;  3FM5 A;  1ARO P;  5AI9 A;  2Y0M A;  2MG4 A;  3WG9 A;  3C2M A;  1HOM A;  3LAP A;  3OYE A;  2L5Y A;  2NO5 A;  3MEX A;  2QEX I;  3M9O B;  2ID6 A;  2JJ7 A;  2P5K A;  4DOZ A;  3CCR I;  2HDD A;  3A0B C;  1JTX A;  1CI4 A;  4RLF A;  1RXW A;  4XLP F;  2I10 A;  2V1U A;  3EW9 A;  2ZCW A;  3F8F A;  1ONV A;  5IIN A;  2DQL A;  5EEH A;  4DOA A;  2W9M A;  4L5E A;  5GPA A;  1Z9C A;  4YMN A;  5C5J A;  4Y15 A;  3OPX A;  1XS9 D;  4GCV A;  4Z6F A;  1FPQ A;  4BDY A;  2XGX A;  1DP7 P;  2EV6 A;  2E71 A;  3M1C A;  3GTM J;  1Z4N A;  1Y0N A;  1LVA A;  1S0N A;  1L8L A;  2EBI A;  2M45 A;  2DA3 A;  2OPT A;  1A31 A;  4DNC A;  4DEZ A;  1ETY A;  3WU2 C;  5KT3 A;  1P9Q C;  2LR8 A;  4BHB A;  2OYY A;  4IHS A;  1O03 A;  4HDU A;  2AO9 A;  1OPC A;  1JJ8 C;  2CGP A;  2WF9 A;  4YD2 A;  2DAO A;  4D0P A;  5IIK A;  1JUM A;  2ZSH B;  1JGS A;  4PDK A;  3GQC A;  4BAY A;  9ICU A;  8ICX A;  3Q8L A;  1SL2 A;  2WTF A;  1TW2 A;  2N8G A;  4BL0 B;  1P7J A;  2P6T A;  3CCQ I;  2DTZ A;  4ECY A;  4B48 A;  1D9D A;  8ICB A;  1SFU A;  2ASJ A;  2AJQ A;  2OC6 A;  2VA2 A;  4IRD A;  1P92 A;  3O2P E;  2D5V A;  5KFT A;  1LDK B;  3FDY A;  2C2E A;  2R7W A;  4I2G A;  1N56 A;  4BXU A;  2J6S A;  4F4Z A;  1R4M B;  4MFD A;  1DK3 A;  3GV7 B;  4KN7 A;  3MGV A;  2H1K A;  3QYF A;  1NJX A;  3JW4 A;  3V72 A;  3SQN A;  2HVH A;  3L2R A;  1VFC A;  3DV9 A;  3QXG A;  3TDZ C;  5F0F A;  2ZME A;  3SDG A;  3EWA A;  3D5L A;  2KL4 A;  2MFZ A;  4AWX B;  4E7S A;  1FMW A;  1PP8 F;  3ZMS A;  2BW3 B;  3B6C A;  5AKX A;  2CRG A;  3RBD A;  3M07 A;  1ETW A;  3CJQ B;  3EPI A;  5AK5 A;  5JLW A;  3VEP A;  2IT0 A;  3HZJ A;  2BY0 A;  3K4L A;  3W2V A;  5KTQ A;  3I56 I;  1ITY A;  4L5J A;  3JAM K;  2ZJ8 A;  5EE0 A;  5F0C A;  3T8T A;  1FIA A;  4R64 A;  4LK0 F;  3N4M B;  3EYY A;  2AU0 A;  1RUO A;  4Q43 A;  8ICI A;  1Y6I A;  3A01 B;  1YJW I;  1NKB A;  2MLG A;  2EZY A;  3VYU B;  2DPU A;  4F55 A;  5M5W J;  3K4C A;  1TK0 A;  2A68 F;  3A4C A;  3U1D A;  3X2Q H;  4II2 A;  3J80 Z;  3BRO A;  4RQ1 A;  1SV0 C;  1HST A;  2NYX A;  5AM5 A;  4HW0 A;  2LDU A;  3A02 A;  5EYR A;  5ICC A;  3CCV I;  4YFK A;  5J2A A;  4EBD A;  1NZB A;  4IQT A;  2OEH A;  3P9K A;  1XSL A;  3ISP A;  5K5R A;  1SXE A;  3A0B U;  2L7F P;  1GXQ A;  4ECT A;  4B1R A;  2VOO A;  3CUO A;  1UT8 A;  2CMP A;  4ZH4 A;  2MW8 A;  2XVC A;  1NK9 A;  2KTQ A;  2H27 A;  1N63 A;  3E3V A;  2OV7 A;  2FMY A;  1VND A;  3PM1 A;  1DGW Y;  4OU0 A;  2ZG6 A;  4Z6E A;  2XCP A;  5F6F A;  1ETQ A;  4RQ5 A;  1OYW A;  4BY1 J;  5KG1 A;  3VYT B;  1XGM A;  3FC4 A;  4QZ8 A;  1NH3 A;  1S0O A;  3SXY A;  4US8 A;  3T5X A;  2QQA A;  2UXN A;  2QSG X;  1L7N A;  2RV8 A;  2W43 A;  3GXO A;  5KG3 A;  3BTJ A;  1R58 A;  1K78 B;  2M7A A;  5E3L A;  3PV8 A;  3KP6 A;  1KKX A;  2VL8 A;  3O0F A;  2JRT A;  2XC7 A;  4DL4 A;  3L09 A;  1L8O A;  3HOV J;  3FHN A;  4O3O A;  4QZB A;  3ZQL A;  1FP2 A;  4BXO A;  5D8K B;  5AK6 A;  4V2F A;  5ALU A;  4XMY A;  2VJ4 A;  2XGQ A;  4F5N A;  4DLE A;  1ZQD A;  3BOQ A;  1R5I D;  2XHK A;  2JA7 J;  1T33 A;  3M8S A;  5EGO A;  3BTL A;  2A1A A;  3BS5 B;  1XGO A;  3UXO A;  3VYR B;  1XB4 A;  2W85 A;  1O3S A;  4MEX F;  3S17 J;  1WFX A;  5CVR A;  3F8N A;  4UB1 A;  5HOO A;  2J5O A;  1MKM A;  2BQ3 A;  2IHN A;  8ICJ A;  2NVX J;  4Q47 A;  3AG3 H;  4OD0 A;  4CA0 A;  2IGN A;  2IGO A;  5DB7 A;  2H09 A;  2P4W A;  3CCM I;  1IRZ A;  5KFX A;  4I2A A;  2EQY A;  2QB1 A;  5EWE A;  5DD8 A;  1BPD A;  5EOZ A;  1P7I A;  1U47 A;  1IXR C;  2DLL A;  3PFY A;  3OS2 A;  4RZR A;  2JEJ A;  4HPQ A;  5F9N A;  4NM2 A;  2DK8 A;  2IS4 A;  2WHE A;  1ZQU A;  1KBU A;  4HF0 A;  2R8J A;  1XO1 A;  5ILS A;  5ALP A;  1MBF A;  4CCL A;  5E79 C;  2FU4 A;  3WTW C;  2ELH A;  1FOK A;  3W6J B;  3DKX A; 
#chains in the Genus database with same CATH homology
 4ANJ A;  3CRX A;  4F91 B;  3MKY B;  2E5S A;  3OYJ A;  3G2B A;  1LFP A;  3J7A Y;  4E6K G;  2CN1 A;  3K70 D;  4J00 A;  1T94 A;  3ICX A;  4QNL A;  2R7Q A;  4KIS A;  4IQJ A;  2ZIX B;  4BXF A;  2KZV A;  3H0L B;  3DPT A;  2V6E A;  1D0X A;  2HBJ A;  2IS6 A;  1HA8 A;  2M0M A;  2DGZ A;  1PVR A;  3BCB A;  5HNF A;  4E7H A;  1N78 A;  3BC8 A;  3FBI B;  4OWR B;  2KVC A;  2R7V A;  3IAM 2;  4EAT A;  2WAQ C;  4AYB F;  4BE1 A;  4CCO A;  2KMU A;  2HPM A;  2VKQ A;  2VXD A;  3PJR A;  4F3Q A;  2F76 X;  2WY8 Q;  4PL1 A;  1CRX A;  3DU6 A;  3RQ4 A;  2GOM A;  3OYI A;  2AQF A;  2UWM A;  2LBF A;  3F5E A;  3M6Z A;  4BUG A;  4U7C A;  1DRG A;  2DJI A;  1X19 A;  2ELJ A;  2KDO A;  4C2T A;  4BE2 A;  4E7I A;  2HOQ A;  2XIC A;  3OMY A;  1DP3 A;  4U7B A;  1UG0 A;  2LYC A;  3VSK A;  5CQE A;  5KHD A;  4IC9 A;  1K6Y A;  2FUG 2;  2LY1 A;  2F6C A;  1TT0 A;  1MNE A;  2M7B A;  5C0Y A;  4AYB C;  2KHM A;  2VQL A;  4C30 A;  2RQQ A;  3SAF A;  1MMG A;  2IS2 A;  3RSN A;  4KMO B;  2VLA A;  1MND A;  3W2A A;  5FRN A;  3IG8 A;  4BGD A;  3HOS A;  2KRC A;  3K70 C;  3M7D A;  2YX8 A;  1G8X A;  4F52 A;  2HBK A;  1BR1 A;  2MC4 A;  3HKZ A;  1Z1B A;  3L2W A;  1BOB A;  2W03 A;  2WAD A;  4P0Q A;  1WJD A;  3CJR B;  2HMX A;  1BR4 A;  4DGW B;  2HVR A;  3OIP A;  2ZIW A;  2VB6 A;  1Q3U A;  3OL4 A;  1JI8 A;  4BJQ A;  5FRO A;  1WJB A;  4HEA 2;  1AA7 A;  2W1O A;  1Z7L A;  3ZQQ A;  1WJA A;  4F93 B;  3OYB A;  4QJF B;  4BJ6 C;  2E1F A;  2X85 A;  2K8B B;  4B43 A;  2DXI A;  2CH0 A;  3EUH C;  2F8L A;  4FZN A;  2WAQ F;  3D2N A;  2RRD A;  3RTR A;  2RRE A;  1UAA A;  4CCK A;  3GZF A;  2JVG A;  4PFP A;  3OYD A;  2CPR A;  2VXZ A;  2CV2 A;  2K5C A;  1QHH D;  5HNH A;  1Z21 A;  4XOP A;  4LIU A;  2MA1 A;  2KJ8 A;  1F44 A;  3CYM A;  2LH9 A;  4CRX A;  3A2K A;  3QYB A;  4PJN A;  3SQI A;  2R7U A;  1QHG A;  2AQE A;  4N4N B;  4BS9 A;  4D9J A;  4U6P A;  1WJ5 A;  1SAU A;  5LFA A;  5T14 A;  4CUG A;  2IGK A;  3K4B A;  2ZXH A;  2G0A A;  4FAS D;  3OR1 C;  4IKF A;  2ZIV A;  3M6K A;  5TGT A;  4PJL A;  2VQG A;  4CGZ A;  3L2U A;  4ICA A;  2JUG A;  2VKD A;  4XLC A;  2RNG A;  3HL2 A;  3K4M A;  4JQF A;  1V5F A;  3NWS A;  2W04 A;  2V1N A;  3FKJ A;  4DBQ A;  3VSL A;  2R7O A;  2E5N A;  1S9H A;  3HKZ F;  3LFU A;  4XOR A;  3LSM A;  4OAZ A;  2GOX B;  1PVQ A;  1OUQ A;  4XL9 A;  3OWT A;  2ZIU B;  4CZC A;  1D0Y A;  3IN5 A;  2K4I A;  1L6N A;  3S8P A;  2CFO A;  2KKP A;  4OJ6 A;  2LOO A;  3SZG A;  1XO0 A;  4H4K C;  4D1Q A;  2KIC A;  3OYN A;  2Z2S B;  3LSI A;  3PST A;  4AU7 A;  2CS3 A;  2W7P A;  4PFO A;  1FMV A;  2BW3 A;  3VDX A;  4NV0 A;  4OJL A;  4PUS A;  1GO3 F;  2HPI A;  2OXO A;  3H0M B;  2H3F A;  4JMU A;  3H9G A;  2HBM A;  2K9L A;  3SAG A;  2KPM A;  3QOD A;  2GOL A;  3V42 A;  2CW7 A;  3DTI A;  2RHF A;  4Y33 A;  3DQV C;  2H3Q A;  1VZ0 A;  1N75 A;  2H3Z A;  4FZM A;  4JOM A;  2IXS A;  1PYV A;  2VJ5 A;  4E7J A;  4NC7 A;  4OAY A;  2ZIU A;  3A1Y A;  3KX2 A;  1X1D A;  2ZIX A;  2HOI A;  2Z16 A;  1ZEL A;  2LHT A;  2KHQ A;  3VWB A;  2OUM A;  2M3A A;  4ZDP A;  3H9J A;  3OOU A;  2KRH A;  3RPU D;  4ZTJ A;  2K4E A;  2WB1 F;  4BAC A;  2G5I B;  3DEE A;  4XLF A;  3L2Q A;  3OYK A;  2PJR B;  2XF6 A;  3PZP A;  4BEH A;  2G09 A;  1HEK A;  3D2Q A;  3NRW A;  4OJP A;  2A5W A;  4RLQ A;  2Z1D A;  3PSI A;  2E60 A;  2Y0S F;  4IQ4 A;  1P7D A;  2N1R A;  5CPR B;  3VCB A;  4BUP A;  3S3M A;  2Z7J A;  1GLN A;  4OO1 J;  2LYB A;  1MMN A;  2F4I A;  2HDW A;  3SDB A;  2JA2 A;  4BDZ A;  1QU3 A;  2K8C B;  3RF9 A;  3D5S C;  1HIW A;  3PNV A;  2HU9 A;  2VJI A;  3OYM A;  4XOT A;  3MKZ A;  4XLE A;  4U87 A;  4XKC A;  1G59 A;  1OLT A;  2E1M B;  3K1Z A;  2BVM A;  2HVQ A;  2HNH A;  4DIQ A;  5CQG A;  4P0P A;  1NG7 A;  1D0Z A;  2LRE A;  1W36 D;  1MA7 A;  2QKL B;  4OJO A;  5CKT A;  3K10 A;  4BJT A;  2VQC A;  2CW8 A;  5KL1 B;  2WAE A;  5HLT A;  3ZR8 X;  3PUB A;  4B47 A;  3OYH A;  3MGV A;  4P5O A;  1YX3 A;  2X51 A;  3DTK A;  1R6R A;  1SZH A;  2K8A A;  4HSR A;  4E7L A;  2LBO A;  2M4K A;  3T79 A;  2KJ9 A;  3LL7 A;  3I3L A;  4NLC A;  4LIT A;  1D8B A;  2WB1 A;  2E1E A;  3ZGK A;  3OYL A;  2R7X A;  4WJ3 B;  4PK4 A;  2LC2 A;  1D1C A;  4DJA A;  2VIX A;  1EA3 A;  3HOT A;  1MMA A;  5HVQ C;  3UR3 C;  3S32 A;  4G6T B;  1SFK A;  1URJ A;  2F77 X;  4FET A;  4N4O B;  3LSG A;  4LG3 A;  1ECW A;  2DF4 B;  2HQA A;  2K89 A;  1LKX A;  3CF2 A;  4PJM A;  2X6W A;  3L3F X;  3F9K A;  4PJJ A;  2K4H A;  3N7R C;  2X6X A;  1NG6 A;  2CUJ A;  2V7F A;  4RMN A;  2W7N A;  3K6G A;  1YT3 A;  2YB1 A;  3OS0 A;  3LVW A;  3HKZ C;  4A8E A;  5HR6 A;  4ACO A;  2L2O A;  3IG5 A;  4C0Z A;  3TBI A;  2JH1 A;  1W36 C;  2L9S A;  1X4O A;  4E4H A;  4FZL A;  3PSF A;  3CP2 A;  2LG4 A;  2VKH A;  2HOF A;  3SEQ A;  3EUA A;  1PVP A;  4XNF A;  5CRX A;  3K4N A;  3H0R B;  3H5R A;  3MMY B;  2X1D A;  2RP5 A;  3CZ6 A;  3E0J B;  3LYS A;  1WJF A;  2H3V A;  1X4P A;  1A0P A;  2Q4T A;  3PL8 A;  4XKW A;  2CV0 A;  1TAM A;  2F2A B;  2MAB A;  2DCE A;  2V9K A;  4QIW F;  3E0F A;  3F53 A;  3F2C A;  4QPO A;  3LVV A;  4Y3O A;  2W4S A;  3AL0 C;  2X6Y A;  2KKV A;  2H3I A;  4P1W A;  2V4J C;  3PSP A;  2KQR A;  2BDU A;  3EUK L;  2DT6 A;  4KIT B;  4GFJ A;  2LRD A;  3RCO A;  4AYB A;  2JGA A;  5HR7 A;  2PMZ F;  2E5Z A;  2KNJ A;  2VQH A;  4YEJ A;  3OL3 A;  4XQF A;  2NV3 A;  2D6F C;  1Q3V A;  4F92 B;  4DBR A;  4XLH A;  4CCN A;  3OR2 C;  2A3V A;  2HBL A;  3C29 A;  4J01 A;  3F2D A;  3N05 A;  3AQE A;  2KJ5 A;  2DOA A;  1D1A A;  3BG6 A;  4BU2 A;  4QPQ A;  4X0G A;  4Y4R A;  4FE3 A;  2XSJ C;  3K4K A;  2XDV A;  3ONN A;  3HXL A;  3CES A;  1ED1 A;  1YE9 A;  3NUQ A;  3SMV A;  1ZQ1 C;  2JHD A;  3I9V 2;  3AQF A;  4P0Q B;  1WJE A;  3LSK A;  4LIV A;  1MMD A;  2G5H B;  4BQN A;  3H5N A;  2KD1 A;  1T95 A;  3ALR A;  2PJR A;  4XM3 A;  4NWI A;  2XF5 A;  3S3O A;  4HG2 A;  1ERD A;  3N7P D;  3C28 A;  2L5Q A;  2CRX A;  3CP8 A;  2M4G A;  2XF7 A;  3DLA A;  4NUB A;  4CDG A;  4NNJ A;  4ZYA A;  4BX9 C;  3OIQ A;  3C2H A;  3VYS B;  4BJ5 C;  1XNS A;  1UPH A;  2G08 A;  2KLO A;  4XR6 A;  1V5E A;  2I8D A;  3HPG A;  4XON A;  2UUZ A;  1MW7 A;  4QIW C;  3EPZ A;  4AVZ A;  2IS1 A;  3HC7 A;  1U0J A;  2E1M C;  2R7S A;  3N7S C;  2BOL A;  3OYE A;  4HNU A;  4E7K A;  3H35 A;  2KEY A;  4DOZ A;  2KIW A;  4B44 A;  4RLF A;  3IUO A;  3QOE A;  2WY7 Q;  1TZL A;  2F5V A;  2OM6 A;  2G06 A;  3ONQ A;  4ZDO A;  4XLA A;  2R7T A;  3L2V A;  3OPX A;  2W7O A;  2OH2 A;  4BDY A;  2WB1 C;  3K4J A;  1Z19 A;  3E1S A;  4XKB A;  3IP4 B;  2MD0 A;  2O5R A;  3M1C A;  3GBG A;  3AKZ A;  4CSW A;  4IZZ A;  1OR7 C;  2VAS A;  3UNG C;  4CCJ A;  2ZSI B;  2YB4 A;  4BE0 A;  5KNL A;  3BCA A;  3SYT A;  2KHV A;  1P9Q C;  1YX5 A;  3OYG A;  2OYY A;  3DTE A;  3DWL E;  1DGR M;  3MD2 A;  2ZSH B;  3PNT A;  2G07 A;  4NC8 A;  3DPU A;  1X1B A;  4RM2 A;  4BL0 B;  2VPL A;  3KEY A;  4B48 A;  3F2B A;  2UV1 A;  2R7R A;  4PSW A;  3KYL A;  4HNT A;  2OC6 A;  2ZXI A;  2Y0S C;  3S3N A;  1T0F C;  1LDK B;  3FDY A;  2HZD A;  2KP6 A;  4C9Y A;  3W3C A;  2R7W A;  4KT6 A;  2QKM B;  3DU5 A;  3OYC A;  3QYF A;  2WAQ A;  3KZX A;  2K3P A;  1X1C A;  4CCM A;  3L2R A;  1LVK A;  3OYA A;  2X1C A;  3C2G A;  3KFU F;  3H9Q A;  4NLB A;  3AFH A;  2DT7 B;  3D5L A;  2KL4 A;  2MFZ A;  2WBM A;  1FMW A;  4E7S A;  1IRX A;  1UEL B;  2BW3 B;  2K9M A;  4NQW B;  2XI9 A;  3SEZ A;  2XAU A;  3FBN B;  3TMO A;  3MKW B;  3CJQ B;  2JVH A;  2V26 A;  3K4L A;  4YEL A;  3BG7 A;  3W2V A;  3OS1 A;  3PNY A;  3ZXS A;  2PMZ A;  1E0E A;  4PSX A;  3HPH A;  1V5G A;  2ZIW B;  1Y6I A;  4KX3 A;  4BQQ A;  1Z3Y A;  2MRL A;  4R79 A;  3VYU B;  2IGM A;  4ITV A;  4II3 A;  4F55 A;  2W82 A;  2R4G A;  2LY2 A;  3K4C A;  3A4C A;  4RM3 A;  2A6T A;  4II2 A;  3M8J A;  5A0L A;  2KOB A;  2DQN B;  2L9N A;  1D1B A;  4XN0 A;  2PMZ C;  1WJC A;  2HVS A;  1NZB A;  2BVL A;  1X1A A;  2CV1 A;  2CUZ A;  2Y0S A;  2P0W A;  1WUD A;  2XVT A;  3BLY A;  2CMP A;  2JH7 A;  2ZIV B;  3OY9 A;  3SAH A;  1J09 A;  2OV7 A;  3D5R C;  2L7K A;  1DGW Y;  4BQO A;  2ZG6 A;  3HG9 A;  4B3X A;  3CMM A;  3VYT B;  3DPL C;  4ZJZ A;  3H5A A;  3LMM A;  3HUG B;  4ZC3 A;  1N77 A;  3H0D A;  2VJJ A;  1IIP A;  4CH7 A;  2M7A A;  4O3M A;  2ZFU A;  2VL8 A;  3O0F A;  4YRV A;  2XC7 A;  4ZDL A;  4XKV A;  3FHN A;  2Q2E B;  2XID A;  5JHF A;  2WA0 A;  3DKY A;  3ZRG A;  4HRI A;  1Z3X A;  4XMY A;  2VJ4 A;  3VC8 A;  4GRI A;  2WAF A;  4MLO A;  2Q1Z B;  2X1E A;  3IAS 2;  2JSP A;  1DQU A;  4XN3 A;  5KCM A;  3U21 A;  2LBF B;  2JMG A;  4P0P B;  1KON A;  3VYR B;  4HST A;  2LYA A;  2NOJ B;  3GU3 A;  1WFX A;  2M0N A;  4OJ5 A;  4IX7 A;  3RFA A;  4KX5 A;  5HOO A;  5LD2 C;  3W2W A;  1A6S A;  2GH1 A;  1PJR A;  3D2S A;  3TL4 X;  4CA0 A;  2IGN A;  2IGO A;  3S93 A;  2LKY A;  4C2U A;  5KL8 B;  3QYE A;  4ZTF A;  3NWT A;  3F5A A;  1Y56 A;  3ZCO A;  3OS2 A;  3PFY A;  4KJZ A;  2R18 A;  1BR2 A;  4HPQ A;  2KV2 A;  3LSH A;  2IS4 A;  3AL0 B;  4BEH B;  1KBU A;  2MYS A;  4PL2 A;  4CCL A;  3OYF A;  5FRM A;  2W00 A;  4E7Z A;  3DKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...