3DEEA

Crystal structure of a putative regulatory protein involved in transcription (ngo1945) from neisseria gonorrhoeae fa 1090 at 2.25 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative regulatory protein
publication title The structure of the first representative of Pfam family PF09836 reveals a two-domain organization and suggests involvement in transcriptional regulation.
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Transcription
total genus 55
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09836 DUF2063 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3deeA02
1.10.150.690 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3deeA01
3DEEA
chains in the Genus database with same CATH superfamily
4M9SA 3RR8A 3HILA 1WZ2A 4NWIA 2BPCA 3LSTA 2HDCA 2R5YA 1DU0A 4IHTA 1BPDA 2LPEA 3LFUA 2ASDA 5A2QK 3N28A 1IO2A 1ZRDA 3FKJA 4A3DJ 1E2XA 8ICGA 3MBYA 2VKQA 2KKOA 4RQMA 3FBNB 2BQRA 4IHXA 1BC8C 2R8JA 2QYOA 1ZJNA 5IOZA 1YS7A 3K4NA 2D2WA 4E70A 5H6RA 3C1YA 3IG8A 1ULYA 3QPLA 5IIOA 4G12A 3VPRA 1UQVA 4Y2PA 1S0VA 3EYYA 2ZJ5A 5HHIA 3M8EA 2ADUA 4IX7A 2LF8A 4M3EA 3PW4A 8ICPA 1T0FC 1NK6A 2K4JA 4IRGA 1TL8A 3H5NA 5K5RA 2RVCA 1OPCA 4XM3A 3QU7A 5ILSA 3CJTB 5J8YA 5J0YA 4ZYEA 1FLIA 3JRDA 2KFDA 4LITA 3OSGA 2GQQA 1RIOH 1YQAA 3IC7A 3OYHA 3CMAI 4JP0A 2XF5A 1PK1B 4OJ5A 3LFKA 3FK7A 3KP5A 2CG4A 2GOMA 4BQOA 5LHGA 3GX4X 1ZR2A 4XLNF 1FMVA 4O3MA 5IP6A 3SEQA 2ID6A 1C0WA 5KFFA 1YZ7A 5HR7A 5AKXA 2NRTA 3SV3A 2KJBA 7ICLA 1WUDA 3SAGA 1K4SA 1RYUA 1UCVA 3GCMA 1N61A 2DA2A 4BBRJ 4QWEA 5BQTA 1QBJA 2YPRA 3HKZF 4M3FA 3C29A 2OPTA 4TQRA 2VB6A 3J7AO 2XY7A 1KFDA 3I59A 3BQTA 2EZYA 4EM2A 4BJQA 5GTIU 5IP9J 2DKXA 1UHSA 3FK6A 4YR2A 1KFTA 2VKEA 1K78A 4UNOA 1RESA 2HI0A 1FWZA 3MKYB 3MR2A 3OL4A 3ZD8A 3FMQA 3V7SA 2FBHA 1FOYA 5D6FA 3ULQB 1WJDA 2YB1A 4IHVA 1UT8A 1COKA 2FQ3A 3ZOBA 4W97A 2VXZA 4O3OA 2VJIA 5KAIC 1EH7A 4B1RA 1ZQZA 9ICKA 2WADA 1U5TA 2OJED 3V4GA 4MO7A 2IA2A 4GLXA 2CFOA 1VQNI 4RGRA 2R7SA 2VXDA 4DYRA 2NO4A 2DO7A 1JX4A 3L2QA 1XGMA 4N4OB 2H3IA 4KFCA 4FETA 4XN0A 2LD5A 3ML6A 4DQPA 2HQNA 4P96A 3IWFA 4C2MJ 1W5CC 4DJAA 4KMFA 1PVQA 4JX4A 1FP1D 4I2IA 1TQIA 1I39A 4FQGA 3IP4B 3BY6A 1UG0A 5J2EA 4O5CA 4Q43A 6PAXA 2XVTA 4OIPF 3IH2A 2LKPA 4CCKA 4BYYA 3KYLA 2CWEA 5GAGJ 2EANA 3HZJA 3GTPJ 3KP6A 1E17A 2EA4A 2P81A 3QPSA 2HFHA 2OZUA 2MLGA 3RI4A 4IQJA 3NARA 1A35A 4LLNA 1R22A 2KL4A 1SWVA 4ICAA 5AM2A 3M6KA 5DGBA 1R1UA 3CCJI 2G06A 3RKQA 3K0LA 4GXKA 5L3GA 2O03A 5DD8A 2LC2A 4PJ0C 2E71A 5FB2A 3KOOA 4PHEA 4P0PA 1OCOH 3BQZA 4B48A 4E7HA 4ELTA 1XSXA 4U0WA 5AK4A 4KIGA 4Y15A 5FFZA 2VA8A 1Z3EB 3AG4H 4OJLA 3JPRA 5KFPA 1CRXA 5E1ZB 4DW6A 3M6ZA 1RYSA 1MNMC 5L1JA 5E18F 4HG2A 1CI4A 2KV2A 3ALRA 2V1UA 1ETKA 3HTSB 2ZCWA 3SZTA 3GTOJ 2EK5A 5L1LA 2DFEA 1QGPA 2DMTA 2E8NA 1FP2A 1K83J 2J5PA 5TGTA 2VQGA 1KN5A 1TQPA 3RJEA 4F3OA 4GYIA 3EUB2 3QU3A 3LMMA 1RI7A 3H8JA 2H6CA 1RKTA 3A0BU 3I5UA 3EUHC 2PI5A 4ZC3A 4YRVA 3BTCA 2EH3A 4M73A 4R8UA 2FLPA 4IRCA 3O6BB 3WU2C 1PP8F 5AKEA 4EBDA 4F2RA 1RZTA 5M3MJ 2E7XA 2BW3A 3MD2A 4HF0A 5AIQA 3ZP5A 4FX4A 4GC6A 2K27A 1U47A 4ENMA 2KZZA 2CW8A 2A05A 2MC4A 4F8RA 2M30A 4KDPA 5DDGA 3QE9Y 3H9QA 1F44A 4BAYA 5FRNA 2CU7A 2XC9A 3GV8B 3W6JB 1G4DA 2QKQA 4HF2A 4YELA 2UV1A 3ELKA 2DBYA 3L2UA 2XAFA 5J0UA 3H4BA 4II3A 2DF4B 2VKHA 1QRYA 1FIPA 1ZGWA 2E2JJ 2LBFA 5DBCA 5JTIA 3A1YA 5F08A 4Q4ZF 2W9AA 9ICNA 4PJLA 2ZSIB 5KFWA 1ETVA 4BUGA 1UA1A 1YW8A 2YUSA 1ZQJA 2QM3A 5DCFA 5L3CA 2JA5J 4O5VA 2KMUA 4YMNA 1D8YA 2VBZA 4EGZA 2BGWA 1ZQDA 1ORKA 3AG2H 4PL2A 3CCQI 4J00A 4I27A 5GADJ 3CNHA 2KKPA 3RFAA 2ZJ2A 1ZH5A 1WJFA 1WVRA 2ACJA 5AI6A 4PFPA 1HKQA 2V6EA 1KQ0A 1A76A 5ALDA 1D1BA 1MBJA 4ENJA 3K75D 4QWBA 2MGQA 1B22A 2OTJI 3GTMJ 1IZ1A 1HW1A 2E60A 3DTKA 2RRDA 3LWLA 1UELB 3G1MA 4DSJA 1B0XA 4PGHA 4A0XA 3ZQLA 2H6BA 3EETA 4F91B 5KT2A 4YD1A 1X4OA 4AU7A 2Z9OA 4K4HA 2WBMA 2LLKA 2FMPA 2H94A 3CTAA 1FT9A 1B8IB 3HOSA 1HUOA 5J0OA 2BHZA 2Z7JA 1MD0A 2BY0A 2QSFX 3SDBA 2ZJQF 2PQ8A 4DSLA 1Y39A 4M6WB 2YU9J 4C8LA 4I2GA 2FJ1A 2GWRA 4ECQA 1XSDA 5CR0A 5J0TA 2G5IB 3MCZA 3N7PD 5HMMA 5CB1A 5KFJA 4RQ2A 2AXLA 2P6TA 1X1AA 1PVPA 3F22A 4AUXA 2YMMA 4RUAA 2MSNA 2F44A 5KK1A 4EJWA 2O9LA 1X9WA 4DEZA 2VKDA 1VQPI 2KT0A 1YI2I 1LVHA 4DLEA 4CF5A 5DUKA 4JOMA 1L3UA 5KG4A 2JUGA 1IUFA 2JVGA 2C2DA 5M5YJ 4KYWA 1PP7U 3ABKH 3KHHA 1BW6A 4OMYA 1DK2A 4BXFA 3F2CA 2Q2EB 4MQ9F 2AHQA 5LRRA 4A69C 3JSPA 4BJ5C 2JA2A 4F55A 3BZCA 1JKQC 2A61A 3MKLA 3WGHA 2LYBA 2GO7A 3RQIA 3D6JA 3HOVJ 3WKAA 3ZMVA 3TACB 1P7JA 5JVTA 2HVIA 7ICNA 2O8XA 1Z21A 4RNOA 1X3ZB 4HW0A 2NS7A 3PM1A 2K9LA 2X85A 4QZ9A 1J09A 4UVAA 3RTRA 2B9SA 4YR0A 1Z7UA 4Y52J 3OYCA 4CDGA 1XSVA 3RR7A 1J5YA 4HPQA 3GVAA 4HV6A 4Y17A 3W2VA 5CVUA 2I8DA 1I6XA 2IXSA 2RC4A 2ZFWA 1E3OC 1S7AA 1S0NA 3HGGA 3CDIA 3CMMA 3JRHA 1WHUA 4BE0A 3QRFF 2LM1A 2FMLA 4R63A 2AJQA 2XGDA 1MMAA 2FPKA 3FXLA 1TWCJ 5D49A 1ZQXA 3X2QH 1X1DA 3KLNA 1A6QA 4A3LJ 4G9BA 3L2WA 4QZGA 3V7JA 1V85A 2G08A 1T08B 1USTA 2Y0MA 1L7NA 1X2NA 3TMOA 3V7CA 1K6OA 2GXBA 1P6RA 1OCRH 2I5HA 3NVWA 5EG0B 1D0ZA 1RZ4A 5CWRA 2HHVA 1NJZA 2V26A 2CQXA 3QUTA 1QLNA 4KUMA 1ACIA 3SHFA 4M3BA 4FZNA 3S3OA 3EWAA 2Z33A 1R1VA 2EA2A 4DNCA 1RUOA 1N5WA 5K7HA 3FDSA 2WAFA 1QQ6A 5AKKA 4DSFA 5J2IA 2XGEA 1Z1BA 1BW5A 3OV8A 3T1BA 1P92A 4AM3A 1SV0A 1NK9A 2IP2A 1P4AA 5IT9K 4YD2A 4DQSA 1J59A 3PO3J 5ED4A 2LM4A 4NC8A 2W9CB 3K4GA 1W36C 2OZ6A 3QUBA 3H1CA 2ME6A 2G9WA 3H9GA 1HF0A 2DOAA 2NRAC 1A77A 1RKWA 2X1DA 3J81Z 4FE7A 2HDOA 3PSTA 5J3LA 2DFHA 1NJWA 5HDGA 4DQIA 2GBYA 4XLEA 5AI5A 3K4LA 1FPQA 4A93J 1NK3P 4DFKA 8ICEA 2PFOA 1R6RA 4N4NB 4RAGA 4XKCA 2H1KA 1Q46A 4AYBN 1BVSA 2DMUA 5J8YC 2GH1A 2JRZA 3H0DA 2K9MA 1F36A 2V7FA 4N0BA 1S77D 4O5EA 1BJZA 3M7DA 4Y33A 4C8NA 2LYCA 5A0LA 5CVRA 3BPVA 3G6EI 4ABZA 2GWSA 3PO4A 3UXPA 4L18B 3DPLC 4A2UA 2W7PA 2R8HA 5KG3A 4QZ8A 2R18A 4I2AA 4UVBA 2WF6A 3KZXA 3GFJA 3LSHA 4DOZA 1N48A 1X9XA 2E8PA 3ZDCA 5K7FA 1MBGA 2EB7A 2LFBA 4UY8I 4F72A 3GIJA 3RJFA 1T7PA 3DU6A 3F5AA 1H8AC 1FTZA 4Z6CA 3KTQA 3HKZA 4Y2JA 1L5UA 2UXNA 3BTIA 5F04A 2DPDA 2X0LA 5J2KA 4JWMA 3ZMDA 4EQQA 1LUJB 1T2KA 1WH5A 1NG7A 1ECWA 1ZQ3P 3VWBA 1ZQOA 2A6EF 4DYQA 2HSZA 1OYWA 1Y0NA 2I1QA 5KFKA 1TW2A 2A1JB 4UB8C 1J2MA 1U49A 2DPJA 4D5CA 3VFZA 5D8LB 1I6HJ 5KAIU 2CQKA 3KYCB 2CSOA 1V5GA 5LGUA 3S8PA 1ZD5A 2ISYA 1Z9CA 4ZYDA 1U5TC 1ON1A 1NNLA 3KZIU 3IG5A 2IVMA 5AM3A 1Z4OA 5CYVA 4XRSG 5CJ7A 2LY1A 5KFNA 4E6KG 4KLSA 4L5JA 2H3VA 5HS9A 1ETOA 2WTEA 3OYGA 2CH0A 2W3SA 1EV7A 1BI3A 1F4KA 2CV1A 1USSA 2B0CA 4C3JJ 2DGZA 5H20A 5KG7A 4IOCF 3C21A 4TUQA 3CDLA 1BN5A 1HSTA 1FTTA 2FE9A 5JFRA 3L1PA 2EBIA 2OUMA 5HLHA 4BXOB 4I2EA 4F52A 2FI1A 5D5UB 2K40A 3IAS2 1Z6RA 1FEZA 4Y2VA 3ZQGA 8ICMA 3CCLI 4J01A 2M4GA 1Q1HA 1DU6A 2VASA 1B8IA 2HVRA 3CUQB 2A3VA 3ECHA 3F8BA 4KTQA 3H5RA 3RJPA 4M6WA 3F8CA 3IHUA 3ZQ7A 2BCSA 2M1BA 2GXAA 4PJ0U 5ALEA 3U2RA 2UVWA 4ECVA 1W7PA 2MSYA 3K70C 1ZXIA 1AU7A 3R9KA 2KFZA 4LLGF 3HOYJ 4BBSJ 4KN4X 2L3DA 4AVPA 5DM7F 3QP6A 2QB0B 5J2CA 2F5EA 2FF4A 4Y2RA 3RKXA 7ICGA 1YJWI 1U6GA 1G3YA 2AQ4A 2Y30A 2CQ7A 1N75A 2G5HB 2Q4TA 3HW8A 3QEBZ 2Y0SN 2N8GA 3CC4I 2QBYB 1PYVA 9ICBA 4BU2A 2CUZA 5HLIA 1OKRA 2F1JA 2FBKA 2BY3A 2KJCA 3QYFA 2HBKA 4DS5A 2OC6A 1S76D 2DYRH 2VC1A 5B1BH 5EGOB 1SIJA 2W9MA 4GFBA 8ICJA 2HYJA 2V1XA 3HGYA 2DI3A 3T5HA 3WU2U 2EPFA 3BG5A 3JRFA 5J1YA 2DFLA 2QGUA 2AU0A 3TBIA 3Q8QB 3W3CA 4M3DA 4IKFA 4XSXF 1N2XA 3BDDA 3TKYA 2DCEA 2IHMA 3M8RA 3GFLA 4BHCA 2R7OA 3QOEA 2XO7A 1Y8RB 3EQLF 2GLEA 2RDPA 2PJPA 1NKCA 3WTXC 4DOBA 2DA1A 4JQFA 1K1QA 2FJ6A 5ALTA 1Z6TA 1WJ5A 4CYCB 3CLQA 1ZQIA 2E5NA 4ESBA 3AG3H 4OIQF 3H0RB 2X6OA 2FQ4A 8ICTA 2MD0A 3HPGA 4F71A 1OLTA 1XGOA 1MDMA 1X19A 5AI8A 5J0PA 4TUSA 5L1KA 1NK0A 2P5VA 5FFXA 1MSWD 1LDJA 2ZJRF 3GIIA 1X66A 3OYAA 5J0QA 1BI1A 2IOFA 3TOAA 3GO5A 3V42A 4PHAA 4J9MA 3HUGA 5L1IA 3TO7A 3RBEA 5EG0A 4FASD 2MUTB 4RQ6A 4RNMA 1N25A 2RKHA 3PMLA 4L9VA 3H8SA 2ZUCA 5KFUA 4M9HA 2HW3A 5ERIA 3QZ7A 4B4CA 4CH7A 3H35A 3ROUA 3UNGC 4S05A 3BLYA 2VJ4A 2HOTA 4DWIA 2A3SA 2WF8A 2DTZA 2HVSA 3JR9A 1M6YA 1HW5A 1R4NB 3GMEA 4M3GA 2XKPA 4NDLA 2KE7A 1PUFB 2JA6J 4D5FA 1O03A 2EWNA 1MMGA 4XLPF 1ZKGA 2W9CA 3JTGA 1KYZA 2RN7A 8ICVA 5ALGA 2XDVA 1D0YA 3D5RC 3U1DA 2YTUA 5J2BA 4IL6C 3QNMA 2WTFA 2WB1C 8ICRA 1TP4A 1ZK8A 3UQ2A 3RJJA 3FHZA 5CKTA 3SDGA 2AH5A 2EZZA 4A12A 2ZKZA 3I28A 2JGAA 2LRDA 2W24A 2W85A 3G3ZA 1XSPA 3KP7A 2EINH 4PK4A 4AIKA 2H8RA 2XY6A 2HQRA 4M47A 3QYPA 3T79A 1ZLJA 2NVYJ 3HOZJ 3FX3A 2DYSH 4HLYA 3ABUA 4GCVA 3V7RA 1Z4NA 4GFJA 2R5YB 3OIOA 5F6FA 1HDPA 3AFHA 1ZYQA 4KLHA 3LWMA 1XS9D 1YX3A 4YCXA 5E79C 4BL0B 8ICQA 2LKSA 1TC3C 2WF5A 3HWTA 1LNWA 4M72A 5AK6A 2M7AA 2VQHA 2CFXA 1L3TA 3SQNA 4A3EJ 3MN2A 5CLSA 4XONA 3U26A 5IY5H 5FKOA 2NV3A 3C2KA 4HRIA 1D5VA 3C7JA 4NJ8A 4Z6EA 5LHHA 3KLOA 1UHWA 3PX6A 3OYLA 1U45A 1XX5A 2XRLA 3KHGA 3K4BA 3BG7A 5B5EC 4F7ZA 2ME0A 3CP8A 1UCRA 2GIZA 2NXNB 4UUSB 4YIIA 4DQ2A 3QU5A 3PMNA 4JK1A 2Y69H 2L54A 2A1JA 3CJRB 1ZQHA 3JRIA 3I3LA 1A04A 4QIWN 2O7OA 3I9V2 3S17J 4YMOA 5ALUA 3ZCOA 5LHIA 3TKAA 2W43A 1JALA 1K5OA 2GXGA 1LDDA 1ON2A 2BV6A 4O3RA 4U88A 2YY6A 3LAPA 3M1CA 1Z19A 2ZIXA 4IRHA 5E8GA 4EEKA 1FBUA 4XKVA 2TDXA 1YITI 5AKGA 4RPXA 1I3AA 3I4MJ 2XPUA 4YEJA 3BJ6A 3O2PE 3GZ5A 1AKHA 5GPAA 3BDPA 4F5NA 3KBBA 2B21A 2F4MB 1T3NA 1KGSA 4DZJA 2TCTA 3I59B 3E0JB 8ICLA 2EZLA 2K02A 3WK9A 4BXOA 2VUMJ 2PFPA 1MBKA 1B9NA 1YT3A 3IAM2 4NLNA 5ALIA 1FBSA 3QYBA 2VE9A 4G6QA 5KFSA 5EE9A 3W2AA 3L2RA 2CJJA 8ICBA 2XRNA 3CUQA 4RAZA 3F6VA 1N56A 2JRTA 5BS6A 4BHPA 3FXMA 3DKXA 4YFNF 4Y2UA 1YJ9I 2KIMA 5EYRA 3GTJJ 2R7VA 2EFPA 3E97A 4M9XA 4N9IA 4XOPA 4QWQA 3VSLA 3ZQFA 4BHBA 1PUZA 2C2EA 3S3MA 2CMPA 4K4GA 1O7LA 2BEOA 4JX6A 5LLQA 3LAJA 4ED1A 1SV0C 3PV8A 1JGSA 3BR3A 3S2WA 2QB0A 3K7AJ 4Z2YA 1NK4A 2ZTCA 2KICA 3ZRGA 2DW4A 1FOXA 1YLFA 5EEGA 3FF5A 2WB1F 3Q9SA 2KIVA 4A3IJ 2KVCA 3RJIA 1ZG3A 4O3SA 4LJZF 5F0CA 1BOBA 2FXAA 2M0MA 3QUQA 4ECUA 1ZQMA 2EH9A 2JN6A 2MH9A 1S8NA 1TK0A 3OIPA 3FXKA 3QP5A 3DBRB 4XLFA 5IYBJ 5EGOA 2M45A 3COAC 1W0TA 1JJ6C 4L0YB 5IIJA 1BI0A 2XUBA 1L3VA 4KLTA 1Y88A 7ICMA 3ZDDA 3ERMA 3RH4A 4UXNA 2DN0A 2ZBKA 1LQ1A 1ZQVA 4KICA 3J80Z 2RGVA 2H8WA 4V2FA 4PHPA 3OJSA 1ED1A 4XSZF 4DBQA 2IA1A 1BL0A 1F5SA 1JXSA 5D46A 4B9LA 3BJYA 5EE1A 1FOWA 2K5CA 1D1AA 2MA3A 3LQRA 3UQ0A 2HBMA 5KG0A 3H40A 4XQFA 4CYCA 4MEYA 3UXOA 1PZNA 4DL6A 2IGOA 4Y2YA 2RP5A 3NS1A 5K1YA 4UB8U 1B59A 4O0IA 5DD4A 3UXNA 2OCCH 4PSXA 3J81K 3IV5A 2D5VA 2V9KA 2CV2A 2XVCA 1VQOI 3DLAA 1SB3C 5LGNA 5ALRA 4PZNA 3SZ2A 8ICKA 4BQNA 1AQ6A 2MUTA 2ZJ8A 3HM5A 3FYHA 2EAOA 2P4WA 3GXOA 4WK8F 3AU6A 2E1OA 2BQ3A 2BW3B 1ZETA 2ASLA 3ZQIA 1FEXA 2HHUA 2GOXB 2EZHA 3E3VA 4F4KA 4YQWA 3V6KA 3VDXA 4EJTA 2JQ7A 3FISA 5HDNA 2DMPA 1QH9A 3ASNH 3HSFA 3RRGA 1G3TA 3N7SC 4LZDA 3C2HA 2VLAA 4P2HA 2L9VA 4W1UA 1VTNC 1S6LA 5ICGA 5E3NA 2FX0A 1S9FA 3LVWA 1GXQA 1SL2A 2BPFA 5CRXA 5JLXA 1OQYA 1APLC 2MLKA 4Y2TA 3DEWA 5GPCA 1I50J 3CJNA 5FKLA 3SXYA 4QW9A 3I71A 3V8LA 1V5EA 2DQRA 4I0AA 3ZQQA 2MU2A 4LZGA 5C3EJ 3ETLA 1LJ9A 1TWAJ 2KZ3A 4ON0A 1ZD3A 3F5EA 3HOXJ 3H36A 5FD5A 3CCUI 1XPXA 2E1EA 1ZLKA 2IEKA 1C20A 5AI4A 5ALJA 3N7RC 2RV8A 4X5VA 3Q8RB 4KA4A 2RNJA 4G7OF 1MJAA 2VANA 5E3OA 1X42A 1WI3A 2W8KA 1W1WE 3PUBA 5DB8A 1D3YA 3G71I 2E8OA 1DGWY 5KFAA 2WAQC 1FY7A 4P5OA 1ZD2P 1JT0A 1J7KA 1JTYA 1QVUA 2XPVA 2HR3A 5AONA 3HBLA 3T8TA 4ETSA 3I58A 4F93B 4WX9A 1HDDC 1ZRFA 4A3GJ 1SZPA 3CO7C 1TVAA 3OSFA 3GZFA 8ICZA 1QPMA 4ECXA 3F8MA 4P4OA 1PUEE 4DF4A 2HI3A 1TNTA 2KD1A 1V9PA 3S2DJ 2AQFA 4FHTA 4YFXF 1YHQI 2GIVA 2F77X 3ZDEA 4NM1A 4JYKA 2HOFA 4DFJA 3K9TA 5J6XA 4NBQA 1U48A 2EFQA 3M4OJ 3FC4A 2X6WA 2EV0A 1IIPA 3HRUA 5AKLA 4UUSA 3Q5FA 3H0GJ 2E1FA 3WK6A 4YIFA 3CYMA 3ZR8X 2VN2A 2K8AA 4AIDA 1JUDA 2DK8A 3VCBA 2NNYA 3FAHA 2PEXA 3LSPA 2JT1A 4B09A 2QEXI 1P4WA 3S1NJ 2HBLA 3MDCA 3VODA 3CRXA 1IN5A 3DPTA 4GRIA 2HOSA 4CZCA 2IJLA 5CP2A 5L3DA 2P5LC 4L5EA 4O3NA 2DT7B 2K9QA 1MGTA 2M4KA 3PJRA 5E1WA 3RB6A 2R5ZB 4ECWA 4XBFA 2LTPA 2AQ0A 4JB3A 2BE5F 3BZ6A 3NVZA 2BBYA 1KYWA 2ZB9A 3T5JA 4EV0A 2DT6A 2C2RA 1SKWA 4PFOA 2J6UA 2YU3A 5BOLA 3E6MA 2CGPA 9ICQA 1KU9A 1Q3VA 1QQ7A 5DV5A 3N97B 3TGNA 1ZQNA 4D7MA 4RPYA 1D9FA 2LSOA 4C8KA 1IG6A 2ISZA 2VE8A 3NWTA 2KHMA 9ICWA 1EH8A 3CESA 3FXOA 3HG9A 3A01A 1BPYA 1D8LA 2BOLA 2KQRA 3L2CA 1YZ6A 4ZYAA 1ZQTA 3C5FA 1TE2A 4WF2A 1IAWA 3WE3A 2FPLA 1R5HA 1R9TJ 3KZIC 1T4GA 4FE3A 4RB1A 2PXIA 2F8KA 1ZQKA 4IL6U 2EDUA 1TFRA 1AA7A 2DLLA 4AD9A 3CF2A 4Q48A 4BJTA 3D1NI 4BXXJ 3JTHA 1J75A 5EWGA 2QSGX 3GV7B 2A68F 2VBWA 2JH1A 2VQLA 2BPGA 4DL5A 4LK0F 2QA4I 3TI0A 1SKRA 4DSIA 4F5PA 3K2AA 1YS6A 2JSCA 2MH2A 5AM0A 4CCJA 1D0XA 4GGGA 1KQ8A 2PFBA 3U21A 2D3DA 3ETRA 3SAHA 3SD7A 2KJ5A 9ICEA 4N9HA 2OQRA 4CO8A 1EH6A 4MIMA 2WF9A 4HF1A 1L6NA 5CA7A 9ICOA 2JZYA 3JREA 1T38A 2HS5A 3VSKA 2KVSA 3MGIA 1QTMA 5E79U 4MF2A 1IXCA 2ZC2A 2WAQF 1JUSA 3EDPA 2RNGA 4U0VA 3HOTA 2H5XA 3SAFA 5KT4A 4UB2A 9ICJA 2KPMA 4RQ3A 4HQMA 3C2MA 1OUQA 3JPPA 2NAZA 3I4PA 1L3LA 2LMDA 2R8KA 2QLZA 2LBOA 3RBDA 2C6YA 1FX7A 3F9KA 2PX9A 5FO5A 1ODDA 4IEJA 2OWOA 2ELKA 2E5SA 5AKZA 3OYFA 1SWWA 2AGPA 2D1VA 3C2LA 3GZ6A 3GTGJ 5B5EU 1G3SA 3Q0VA 4KLJA 3QWLA 4KT5C 4E7SA 2KDZA 2FBIA 4XRMA 2R7RA 1NOMA 5LGTA 2E2HJ 1U3EM 2ZUDA 5AIBA 2X9DA 5BNGA 1NK7A 2FLNA 4P9UA 5D5VB 3J7YJ 3OYKA 2KN7A 4Q8FA 4L9JA 2XSDC 3QUCA 5J2FA 2DPIA 2DOEA 3ZMSA 4BDYA 2P7VB 1VQ8I 3TOBA 4XORA 2BVMA 2L9SA 4HYEA 3G4SI 2JA8J 3I54A 5J2GA 3QPHA 4NLGA 1CEZA 3OS1A 2DA3A 2NO5A 1S0OA 3M8JA 2Q1ZB 2JEGA 1LEAA 4J9QA 3RJGA 2JA7J 1N60A 2OTLI 2DODA 4ZH4A 1IRGA 4I2FA 2NOGA 2F4IA 3H3UA 5DCMB 3V8JA 5M3FJ 1MQ3A 1DPRA 4IQ4A 4QZFA 4ZTJA 1R00A 5TZVA 4RQ7A 3ZN1A 2DK5A 1X9MA 5DB7A 8ICNA 4ZDOA 4ED3A 2CRXA 2VA3A 2Z99A 4XMYA 1KQ9A 1TAQA 2W9BB 1FSEA 3CP2A 1L8OA 3RIRA 4S04A 2AO9A 3OSPA 3CUQC 5E20A 4TUPA 4PGYA 5J2JA 2P8TA 1XSNA 3K4KA 4GYGA 1ZGAA 3H0LB 2FUG2 4C30A 2LDUA 2XIDA 4EELA 2B6GA 3R61A 3RKWA 3WGIA 2K3PA 3EYIA 2LHTA 3AL0C 1STZA 4YG2A 4WWCA 2IRFG 1J9IA 4KX5A 4TQSA 3AQFA 2A5WA 3TEDA 5AKJA 3S16J 2PMUA 9ICLA 5F27A 2OA4A 2K3FA 3WTVC 4OJPA 3EZ5A 5KFHA 2WB1A 1IRZA 5FRMA 3F2BA 1I27A 2P35A 2E19A 3DU5A 3UMBA 4RT2A 1EJ9A 3DCFA 3C28A 4LK1F 2M87A 3QQAA 3TDZC 1W4MA 5C44J 4B9SA 4J9SA 7ICKA 2OCEA 3GFMA 5IYDJ 1XDSA 4FBUA 1P2FA 3OYNA 3FMRA 4EYIB 2FNPA 3OIQA 2ELJA 4P4PA 1MQ2A 1HUZA 2X6XA 1W7PB 3KKAA 1OMIA 4RUCA 2JVHA 3QOPA 2IS1A 2O6KA 4P0QA 3OJUA 3M9NB 1ZQEA 3W6KB 4XKBA 4IC9A 2LYAA 4DF8A 2BZFA 2MBFA 3ECOA 5AKYA 4I2OA 2Y0SA 5DLGA 4HOBA 4RQ8A 3HEFA 1EKEA 5IIKA 5JHUA 4X0GA 2CN1A 3BG6A 1TQMA 1TWHJ 5F64A 1QZYA 2VI6A 1F43A 5ALPA 1EXNA 5KG6A 1A31A 1LFPA 3TQ1A 1OFCX 3HRDD 2NOJB 2R5ZA 4M2YA 2D45A 1JN3A 3EUKL 1FJLA 1GUUA 3TW7A 3QZ8A 2IBDA 2HHSA 2HQAA 3ORYA 3W6VA 2R92J 1OYIA 4KISA 1WGXA 3PNTA 1SXEA 4I99C 1VQ9I 3UPQA 1DRGA 4IO9F 1NHAA 2FMSA 5CVVA 5KFZA 3IHQB 3N97A 1TKDA 4QJFB 1YG2A 3IRQA 1GHCA 4I29A 2CW7A 3FDYA 1E3HA 8ICUA 4HV5A 2CUJA 1PJRA 2V79A 1ZTRA 3L9FA 1K1SA 5J1RA 4J19A 2JPCA 1WJBA 2RDJA 1BNPA 2M8GX 4RZRA 1FC3A 2Y1JA 4P4MA 3ZGKA 4NNJA 3CCEI 5KFTA 3PW7A 3LQQA 3NRZA 2E1MB 5DBBA 5HP4A 5L3BA 3HTUA 1MSFC 4ENNA 3J80K 1B6AA 1SD7A 2YN4A 1LFUP 3H8MA 3IDWA 4KN4A 2F6CA 1W5SA 1XMAA 1MDMB 1HKSA 2JRMA 4Z6FA 3HYIA 3V72A 4DL2A 3RYPA 1ZOLA 1Y8QB 4PL1A 3PSFA 4UAVA 1KLNA 3GIMA 4FO6A 3UMCA 3RB3A 4D0PA 3WODF 2QARB 3NVVA 1RYRA 3HUGB 3IV6A 3O0FA 3RQ4A 2A6TA 5AICA 1HQCA 3BZKA 3OS2A 2W11A 2D1HA 4I2DA 1YYVA 2JR5A 4LFUA 1CF7B 1DGJA 2IA0A 5JLWA 3KPHA 4AWXB 1SZHA 4IR1A 1F5TA 1H38A 1IN6A 4IXAA 2HPMA 1IXSB 1WYGA 1MC8A 3NAUA 5JHFA 3T5XA 2W55A 1RC9A 1YX5A 2E8MA 5JU5A 3ZPLA 2M9HA 1NJXA 3A02A 1CGPA 3H4DA 1N78A 3TFRA 2W4SA 7ICRA 4Y13A 1LE8B 4ZJZA 1TT5B 4I2JA 4I02A 1R5GA 2KZGA 5EEAA 4KN7A 3A0HC 1HW2A 2UVRA 2QQ9A 2IA6A 4JV2A 2AXTC 4O3QA 1COOA 3CMEI 3G1LA 1TTYA 1EA3A 4RQ5A 3E1SA 3HP6A 1I1SA 3T3FA 3GTKJ 4I2BA 1YJNI 5FGMA 1KA8A 1UPHA 4QZBA 3D2SA 3SEIA 3LA7A 1B72B 2BDPA 4EATA 5J0RA 1PK3A 1DDNA 2KISA 2QSHX 2RQQA 2XF7A 4JX5A 5EEHA 1VQLI 4PGQA 4RM2A 4YVZA 3BPXA 4QWDA 1SD4A 5IIMA 3PNCA 1SVOA 4HLXA 3B9JA 1IDYA 4QZAA 3GV5B 2PFNA 3KFUF 2WA0A 2M5WA 1EF4A 2G7HA 3ISDA 3HPOA 2YQEA 2I5UA 5DCMA 5BPIA 2DMQA 2ZXHA 3C1DA 4MEYF 5HNFA 3MZHA 4DQRA 4C7ZA 1DGRM 3OHBA 3BT9A 4MFDA 3G2BA 2FDRA 4A3CJ 1VF9A 4EJOA 4MFEA 2ASJA 1X2IA 2FPMA 4RPZA 2QQAA 3SFZA 2WHEA 1Y1VJ 2JK3A 2K60A 5ALMA 5F9LA 1JRPA 3R4KA 4FBTA 2W9BA 1BGXT 3HHHA 3VEPA 4ACOA 1TNSA 1ZQSA 4CHUA 1SD5A 3DFGA 1RNLA 2F48A 4HSRA 3ZN0A 1XCVA 3Q8KA 2RREA 1KONA 1S7OA 2QCOA 2OM6A 1RQLA 3MDAA 3JRCA 2P5KA 4A3FJ 2IHNA 5HDKA 2XC7A 3WG7H 2ZIXB 4B9UA 5G5GA 3RRHA 5J29A 1FIAA 2PMZN 1R23A 3MQ0A 1VQKI 4E7ZA 4F5OA 4GDFA 1WFXA 3CCSI 1AKHB 4EJUA 3CW2C 2LMRA 3MABA 5DTDA 3DPUA 1KU2A 2HXIA 4U7CA 4CUGA 5JI6A 4BUPA 4CA0A 2EAPA 4NLBA 4HAIA 4AP9A 4B8XA 5B1AH 3OOPA 2OBPA 1Z91A 4F5QA 2W1OA 1XGNA 3ZXSA 1ZQUA 3RKYA 3TP3A 4PCQA 1LKYB 2LNBA 3QPTA 2DOFA 4ZTFA 2OYYA 3HX0A 3J7AY 4RB0A 4E7JA 3D2QA 5B66C 1Z00B 5AK3A 1KBUA 1MMSA 2V4QA 4EGYA 3BWGA 4NUBA 1NG6A 1T56A 2EZKA 4G6TB 2RQ5A 2M8EA 3SZPA 4JMUA 1XDUA 4BKXA 3MVPA 1LB2A 2L0KA 5DG8A 4NB5A 3JRBA 2B7EA 5EDNA 2KIUA 3IUOA 4M6XA 3AL0B 2ZIWA 3JAMZ 4A8EA 3BTLA 1FMWA 4DOAA 2BR0A 2WAQA 3FXUA 2GA2A 4LB6B 1VQMI 1O4XA 1N77A 3A4CA 4O6JA 2G7UA 1VI0A 3B6CA 3GILA 1TAUA 4RB2C 1PVEA 1RM6C 2V9VA 2AGOA 4BDPA 4I28A 3T5KA 2YB4A 2W3RA 4A6DA 1YRNA 5KFXA 4I6ZA 7ICJA 1BOAA 5KG2A 2OV7A 3QODA 3AKZA 1HXDA 4MFCA 1ZQCA 2DQNB 1U0JA 5D4SA 2R93J 3BG9A 4ECZA 2M9NA 4DSKA 1YTYA 3O8GA 4AYBC 2ZO4A 1GVDA 5KFQA 2AQEA 4U7BA 3EPGA 4OU0A 3ED5A 4LMYA 2F2EA 4ASNA 5ICFA 4BEHA 3LSIA 5HHHA 1POGA 5KFLA 3VYSB 2XROA 2HZTA 1X40A 2KJ9A 2OHFA 2QUFA 3AUOA 2P66A 3EUAA 3FWEA 3FZVA 3KP2A 1MJBA 4PJNA 5AIAA 4HQEA 4XQ8A 2LP0A 4KN7X 1QCKA 1WWXA 1U2WA 1RETA 1OXJA 4MQVA 3RDIA 5C4JJ 2UUZA 3GYHX 4B9TA 2DTRA 2HKOA 3VC8A 4B43A 1WJAA 2F5FA 3FMSA 3R0AA 4G7ZF 5FP0A 4FT8A 3R60A 3LSMA 5KFDA 4FISA 4XRHA 1U4BA 4CCNA 1UHMA 4FE4A 3TAQA 1L3SA 2QARA 4GIBA 3OSNA 4I7HA 4PH5A 3GUDA 4JBAA 2XGQA 4BY7J 3DV8A 3RYRA 3OY9A 2MG4A 2CYYA 3D0SA 5ALXA 3ZD9A 1QSLA 2R8IA 2ZJPF 5KG1A 4UAWA 3GU3A 4J9NA 1CF7A 1QQ5A 1YE9A 2KP6A 4RAYA 5L3EA 2IS6A 4KITB 4KMUA 5DB9A 3CLOA 3BR1A 3QAHA 3KE2A 4BJ6C 4XLAA 4G8XA 5DM6F 3SENA 4MLOA 5CQEA 5AI9A 1MW7A 5DG9A 4DLGA 1SVMA 4XLCA 2V9WA 1MBEA 4ZZDA 3BP8A 4HX8A 4AIHA 1NZBA 3S15J 2KSOB 1UZCA 5ICEA 1LE8A 5DKWA 1RUNA 5ALZA 3JPSA 3SJMA 5AIPA 2XV4S 2N1RA 2F5CA 3THVA 4HZFA 3K1RB 4QPOA 1OYYA 3C23A 3VYRB 4ZYHA 1I5ZA 1KKXA 1IRXA 4CZZA 3GLLA 2M0CA 3RSNA 9ICPA 1FSHA 2DA5A 4EBEA 3GLXA 2HVQA 2K9SA 2JEJA 1B1BA 2X48A 9ICTA 5ALOA 4J9KA 2V1NA 3MMYB 5T14A 2XAUA 1B72A 2VT3A 3Q9VA 1MN8A 1UG2A 3KKAC 3F2DA 5DG7A 2M2EA 1REPC 3QXGA 3Q8MA 1NK5A 3F53A 4KLEA 2YX7A 4HDUA 1AOYA 7ICPA 2QKLB 2Y0SC 1SVLA 1P9QC 4F50A 2YS9A 3OMYA 5J2AA 5KFGA 4M6YA 4WCGA 2ISOA 5IYCJ 1ZQYA 3FXJA 3K69A 4D7NA 1ZG5A 1G2HA 1D8KA 1U9OA 3N4MB 1JT6A 3BJOA 3I56I 1QZEA 1HJPA 2VJJA 3OPXA 4AYBF 5CVIA 3BQ7A 4YR3A 3KETA 1U8RA 2JH7A 2P6RA 3M8FA 2MYSA 4EVIA 1V3FA 1R49A 4BXUA 4XUSA 3PO5A 5ALLA 3M1YA 1JKPC 4IJAA 2W7OA 1XGSA 3RAQA 4M9NA 2FEZA 1L7PA 3V6JA 3R0JA 4XL9A 2XY5A 5B3SH 3JW4A 5E3LA 2BXYA 3LSRA 1DP3A 3OGUA 4DFPA 4C0ZA 2QVOA 4Q47A 4QTRA 1QPIA 2PJRB 1E0EA 1KQQA 2BVLA 2HCFA 3N05A 4ZH4F 4QZDA 3P9KA 2KIFA 3TADA 4Z6DA 3HKZN 3IWZA 2BDUA 4DFDA 2ECBA 1R1TA 5C5JA 4WJ3B 1ZHFA 3PFIA 4H4KC 1SV4A 1QSSA 4UATA 2F4OB 5KVRA 3BJAA 5TISC 4K4IA 3Q0UA 2E35A 2V4JC 3K2ZA 3WG9A 2DA7A 1OCPA 1OJLA 1LKYA 2HDDA 2B0LA 3P5JA 3PW0A 5EOZA 5IILA 1LKXA 2J5OA 1Z00A 1UMQA 1O3RA 5L1MA 2CRGA 3CJQB 2FU4A 2L9NA 3KIOA 4HNVA 5DGAA 1J2NA 2IW5A 5DUIA 5LBQA 1IG7A 2VC0A 1J2XA 1FIQA 3A01B 2Y48A 1Z3YA 1AWCA 1S8OA 3GZNB 4AIJA 2IMWP 7ICHA 3DKYA 2I9GA 3O3KA 3OL3A 3ZMZA 4YG2F 2ZIVB 3PZPA 1SL0A 2MFZA 3PQJA 1A6SA 4MFFA 1MBFA 1OCCH 5CQGA 3WHBA 1M1EB 2Y9YA 1XWLA 3NGDA 1Q1VA 1JXLA 4ED6A 1TW3A 2KEYA 4X1EA 3A0HU 3LVVA 4EM0B 4A3KJ 3SYZA 4XRSA 4CGZA 3C1ZA 3GEZA 3GDXA 9ICAA 1ZQFA 2DMNA 3E7LA 2AXTU 4UARA 4MEXA 4ELUA 3UR3C 5DBAA 2JUCA 3H8WA 4ED7A 2HKXA 3S1MJ 2IT0A 4IQVA 4NC6A 4B3AA 1OISA 4IHYA 2JXJA 3WK8A 4I01A 2NS0A 4BE2A 4ESJA 4RQ4A 1BIAA 4FX0A 4KMUX 3ZQHA 4DYCA 2HOIA 5TJJA 4LG3A 3BG3A 4CSWA 3C5GA 3S1QJ 4Q5SF 1VJ5A 1WG8A 2HOQA 9ICSA 1BR1A 4CNQA 4BDZA 4KLIA 1URJA 3ISCA 2VT2A 1SMTA 5FD6A 5GTHC 2Y0SF 2ZJAA 4O9MA 4GO1A 1XO1A 1ZRNA 1XMXA 2DKZA 5KFVA 4UW9A 5K4LA 2O6GE 4CCOA 3WGGA 2DQLA 3KEOA 4KLMA 5FJ8J 5KFIA 4B9VA 3SFIA 2M3AA 3QEAZ 3ZI4A 2OAZA 5HNKA 3M07A 2HEOA 5ALQA 4F4ZA 2JTVA 2M7BA 2QQ8A 2LREA 3C18A 1BR2A 2IGNA 1AHDP 4QIWC 3P7NA 5E17F 3C3WA 1ZQ1C 4OD0A 2X6YA 3HDDA 4DL4A 5KL8B 2DWQA 3H3VK 3F8FA 2R7QA 4H0EA 1ZG1A 2ZMEC 4NHJA 5LFAA 2NVXJ 4EYHB 3UM9A 3BR0A 1HCRA 2JMGA 3WKDA 3M8SA 1ZGJA 4R65A 2CQQA 4KIFA 4KT6A 3UMGA 4M9LA 1KDHA 4LOCA 1SFEA 5H2FC 3CO6C 4IPAA 4PZOA 4MFAA 3O8HA 1JE8A 4OIRF 4XN3A 1MH3A 3V8KA 3MFHA 1SFOJ 7ICOA 3CZ6A 3A2KA 2DUYA 2KSOA 3ONQA 5CVJA 3L5KA 2JMWA 3OWTA 3B0XA 3E5XA 3C2GA 2NYXA 1A5JA 3HC7A 1ZAOA 2Z3YA 1LDKB 2JJ7A 4R79A 3RZOJ 1LPQA 5B66U 3EYZA 3FKIJ 3PSPA 4F3QA 3M3YJ 5FKNA 2YMLA 5DQGA 3BQ2A 2ESEA 4CRXA 3AEVA 2HBJA 2W25A 4IQTA 2Z16A 1T39A 2L4AA 1G59A 1MBHA 2PN6A 2R7FA 3NRVA 3OR1C 3MZ8A 4FS1A 3WHCA 2P0WA 4DZPA 2BQUA 2HZDA 4IVNA 2JWTA 4UB4A 1BPZA 5FKMA 2ZSHB 4LLLA 4OJOA 4GXIA 2ISPA 5EE3A 5IP7J 4I2CA 1WJEA 3D5SC 4G9YA 4QLCU 4Q45A 2NRVA 3TL4X 2UZKA 4XRFA 3RF9A 4XK4A 4KJZA 2K8CB 1KU7A 5D4BA 9ANTA 4RS8A 4R66A 2GOLA 2EV6A 1JJ8C 1P7DA 1KZHA 4ZDLA 1H0MA 5ALHA 1SKSA 2MABA 1KEJA 1B43A 3N4MA 1JUMA 4Q44A 2HVHA 8ICOA 4TV7A 3RZDJ 1PDNC 1HBXG 2W7NA 3PIOF 1H89C 3H92A 3RPUD 1D1CA 1IDZA 1NZPA 1RG6A 3CQZJ 3HPHA 4J9RA 5EWEA 4A0YA 2BCQA 1RDFA 3PW2A 3PFYA 4L9NA 3ZQCA 1MIJA 3SEZA 4P0QB 1J97A 2C28A 2PLYA 3S1RJ 2W57A 3DBHB 3GBGA 2XPWA 4BE1A 2PJRA 3NTUA 3ISBA 4DO9A 5D5XB 2L7MP 3PY8A 3JAMK 2E34A 2AS5F 1UT5A 4PJMA 2WY7Q 1QQIA 2VOOA 2UVVA 8ICAA 2E1MC 2KIQA 2ZTEA 2QLTA 2OD5A 2LI6A 5ALNA 3BCBA 2BCRA 2DPUA 3Q8SB 2K7LA 3CDHA 3HT3A 4M9ZA 5J0XA 9ICCA 5EWFA 4CF3A 4QIWF 2KRCA 5K7ZA 1X3WB 2G09A 4BH9A 4MGRA 5BPDA 2ECCA 2KLOA 2K4PA 1KU3A 1MNEA 2HTJA 5LEJA 2STTA 2KJ8A 3F0CA 1ETXA 2R3SA 4BY1J 5KTQA 3CF5F 8ICSA 5L3FA 3RH6A 1V5FA 1RXVA 3M1EA 1MA7A 3SR6A 1VQ6I 3PW5A 3J81j 2X1EA 5CPRB 3I53A 2ZIVA 4BQAA 2WC2A 1RRJA 5ALKA 2BCVA 5BPCA 1VQ5I 1KTQA 1IXRA 4P55A 3DXJF 1SMYF 2WF7A 3PNVA 1B4AA 1OR7C 2WY8Q 2KHQA 2HHXA 3NASA 2RAEA 3DKWA 1V55H 1HLVA 1RXWA 2GAUA 2V4RA 4NQWB 2K8BB 3TO6A 4B9MA 1YOVB 4LIUA 1L8LA 4IOAF 4FCYA 1GV2A 5C4XJ 2Y9UA 2VA2A 3CUOA 1L7OA 2DAOA 5J0WA 2HPIA 2J6TA 1O3TA 4UV9A 2JZBB 2BYVE 3BROA 3H7IA 9ICUA 4BX9C 2I10A 3HRMA 3KD3A 2ZIUB 1TK5A 2K4BA 2XAQA 1MNDA 1JHHA 5F0HA 1ETYA 5F1JA 4ENKA 3NUQA 4BS9A 2Z2SB 2EIKH 3F3XA 2IBKA 4HA8A 1NKEA 1KL9A 2JSPA 4CCMA 1FFUA 4RT3A 8ICIA 2J6SA 4LB5A 2O5RA 5E1XA 4BQQA 3KFWX 3B6AA 5K5OA 3WK4A 2PFQA 3DTEA 1FFVA 1U9LA 3HRTA 3MAJA 1OCTC 3SI8A 2KK0A 3S3NA 1N62A 4DCCA 1S5LC 2BY1A 1MMNA 2KTQA 2HGCA 2CO5A 4EM1A 2FOKA 2OXOA 8ICCA 4F2SA 3OTQA 8ICFA 1NKBA 2Q0ZX 1BPBA 2GA1A 1UFMA 4HDVA 4NY8A 2STWA 3KCCA 4AYBA 2W82A 3IL2A 1HA8A 4C8MA 3F23A 4BWJA 2IS2A 2X4HA 3K6GA 1XTAA 2FMYA 4PSWA 4RDUA 1UA0A 1QSYA 1O3QA 2COMA 2XB0X 1BBYA 4G94A 4C3HJ 2O8KA 1V97A 9ICFA 3NWSA 5EJCA 2G07A 5IOYA 2E3TA 2IGMA 3CMYA 1ZRCA 3IKVA 5AKIA 2ZNYA 1T95A 3E6BA 1F9NA 2HOAA 1K6YA 1SAXA 2F1IA 4L0ZB 4OIOF 2R7ZJ 4UB5A 3IN5A 3K4MA 4NM2A 1NJYA 3QYEA 1QO0D 3TADC 1R71A 4DSEA 1XSLA 4G6DA 3PIPF 2ZG6A 5TISU 2UVUA 4DFMA 3BS5A 1T6SA 3SZGA 1K4TA 1SGGA 3SMVA 3V7LA 1S10A 3Q8LA 3D5LA 2LK2A 1DGSA 1RPWA 3HXLA 2R0QC 1JKOC 3RB4A 3NVYA 3WK7A 4XICA 3I76A 2PI4A 5FROA 1IUYA 1IN4A 2W84A 3H3ZA 4CXFA 1JKRC 3CC2I 3AQEA 3MGHA 3MR3A 2DJIA 4RLQA 4M9JA 3J7ZI 2ZMEB 3B02A 4A0ZA 3SQIA 4QSHA 3NQOA 4XOTA 3E5UA 4E4HA 3OOUA 2MC3A 2PMZA 1ZREA 3DV9A 4UQGA 1GO3F 5D4RA 4UUTA 4LVSA 1TZLA 3DEUA 1UHUA 2WV1A 1B4FA 5J4YA 5AHXA 3DBLB 3BC8A 4P1WA 1Z1VA 2EILH 2QF7A 1WCMJ 1SFUA 3RB0A 3GFIA 4X6AJ 2L9RA 1JROA 4U6PA 5DEQA 3JPNA 2D6FC 5HR6A 4OMZA 2L7KA 4EMSA 2QQBA 1VLBA 4DL7A 2KDOA 2DDAA 3GW2A 4HSTA 1D5YA 2HNHA 4J03A 3BQ1A 1JTXA 2ALZA 2A19A 3GQCA 3RCOA 5IPAA 1G6NA 4S0HB 3OYJA 4KIBA 1TV9A 9ICXA 4M9GA 2F5VA 3PVXA 4R64A 3DTIA 3R6SA 3WE2A 9ICHA 3GF2A 1QZZA 3EPIA 2ID3A 1YW7A 1FZPB 1LVAA 3RAXA 2QB1A 5CHGA 1LB2B 1SAUA 3U1KA 4Q8EA 7ICVA 4FZMA 5TRDA 1VFCA 8ICXA 1RQNA 2FRHA 1T98A 4UUVA 4Y2XA 1NK8A 5FLXZ 2G0AA 2ZIWB 5FLMJ 5KHDA 4IR9A 1ZN2A 1R7JA 3A03A 4II2A 4WXDA 5GTHU 5KFRA 3JPOA 3L2VA 5BOMA 2PBIA 3FM3A 5JRTA 1IC8A 3LYSA 7ICUA 2E36A 3PR5B 2H3FA 4DS4A 3T8RA 1I3QJ 1VDVA 2VIXA 3BR5A 1S97A 1YRNB 3ICXA 3LSJA 3E0FA 4Y2SA 5KL1B 1ZRMA 3HOUJ 3BTJA 5M5WJ 4FFDA 1MMDA 2XF6A 1P7IA 3I64A 3BR6A 5HS8A 4UASA 2F3NA 2NVTJ 3PX4A 1XN7A 3LOCA 1PK1A 1JMSA 4NXZA 4DBRA 4OJ6A 5HVQC 1ZQRA 2BHNA 1NK2P 4BEHB 2ELHA 4RNNA 2EV5A 2ZXJA 3JPTA 4ECSA 1QHHD 3I4NJ 1X3UA 1IW7F 1Y1WJ 4ZDPA 1C7YA 2VPRA 1U9NA 2L7FP 2D8CA 1WPKA 4ED8A 2L2OA 3ESWB 3JRGA 1T8EA 3PX0A 5H2FU 2F5DA 2DJNA 3OHAA 4WXCA 4KLGA 2DL0A 2R7UA 3C2BA 4HBLA 5ALFA 1S29A 1VQ7I 4NC7A 3EPZA 2FLLA 4M74A 1XS9A 2LR8A 1V38A 1FBQA 2LY9A 3L4PA 4B47A 2ZXIA 4PGXA 3K1PA 4KX3A 3TAPA 2ZNZA 4CE6A 3U9GA 4EX6A 5BMZA 1DOQA 5HS7A 4AVZA 2IS4A 3TARA 2L02A 2VBYA 2L7ZA 2XHKA 3BCAA 1P4XA 2FE3A 1Z7LA 3H5AA 4K2EA 4NQWA 1K7AA 2Q0OA 4OOIA 3K10A 2LKYA 5IIIA 2DT5A 3IRRA 1D8BA 3GWZA 2KOBA 9ICIA 2JZBA 4EEFG 2YSRA 4OCZA 2YMPA 3EW9A 2MAXA 4IQUA 4YFKA 7ICTA 2XAJA 4HX4A 4L5IA 1W36D 2RDIA 4G7HF 4KLFA 1S7EA 4RGXA 2RQPA 2ZIUA 1BNOA 2CS3A 4NL9A 4M04A 1Z1DA 2A6HF 4MTDA 2E1CA 3MR6A 5DDYA 2XCAA 5GAEJ 1Z0XA 5G5HA 4QZCA 5F9NA 4J9OA 3NRWA 5M5XJ 3RJHA 3KZYA 1Z67A 4QPQA 3ASOH 3E58A 4ED0A 1TK8A 3FXQA 2CV0A 2VPLA 1XC5A 3M7GA 3ABMH 4PGGA 2XAGA 4OO1J 1FO4A 4ECTA 2NS8A 3OYEA 2JEIA 3GTQJ 9ICVA 4PJJA 4MEXF 3I55I 1S0MA 2A07F 5KFYA 1JI7A 4M6VA 1CUKA 2YX8A 5F0FA 4EBCA 2KZMA 2JPBA 1DXSA 4IHWA 3I0TA 1YIOA 4C4TA 2XCPA 3WKEA 4IF4A 2DXIA 2MA1A 3CCRI 1SANA 3OYBA 4U0YA 1GDTA 4KMOB 3RJKA 2XIGA 4DL3A 3GTLJ 3T5LA 2H1LA 1BI2A 4IQWA 1HSJA 4HX7A 2LH9A 1Z77A 3M9OB 4B9NA 3DQVC 2ZTDA 1Y6IA 1OCZH 4NLCA 2EFNA 3DEEA 1JHFA 3LA3A 1O57A 3F72A 4QZIA 3Q3SA 3LSGA 4A6EA 4FS2A 4UB6C 2QZ8A 4UB3A 1MJ9A 3AM9A 1LV5A 2WAEA 2MD5A 3QU6A 1GXPA 1FYKA 3CC7I 1ZQPA 1WWUA 1ZQAA 3WU0A 3PR4A 4ELVA 3MZYA 2HU9A 7ICQA 3WU1B 4F4YA 4ECYA 5FLVA 4EJVA 5HLGA 1H9TA 3LSKA 4J9LA 4CCHA 1Y56A 2WWYA 4C80A 3VOEA 1BJAA 2EFOA 2DFIA 3NEUA 4BNCA 2UWMA 2IOHA 3G6XA 2P7CB 4YN4A 3FHNA 5J47A 1Y0UA 1H88C 4RM3A 1BA5A 4US9A 3Q8PB 3CCMI 1Z05A 5KNIA 2ZMEA 3L09A 3WKCA 1SL1A 4D9JA 4O5KA 2EIMH 1WKMA 5C0YA 7ICIA 4ANJA 2BHYA 2H09A 3MKWB 1DP7P 3TANA 2XGPA 5KFOA 5LEKA 3MFIA 4MTEA 2GLOA 4EENA 4M71A 1U78A 1H9GA 4XR6A 4MHGA 5ICCA 4YXJA 4PDKA 5EZGA 2IGKA 5KAFC 4IZZA 2H27A 1O08A 1T94A 4JV1A 3BS7A 2Q8KA 4A5NA 2QENA 1IXRC 4RAFA 4XIDA 1QU3A 3DWLE 3P9CA 4F5RA 2V6CA 4HYKA 1X1PA 1ZARA 3PNYA 5KT7A 2COBA 4UAUA 3WTSC 1FOKA 1NTCA 5JUMA 5A2QZ 3K70D 2OQGA 4B44A 3FM5A 3WTWC 1BPEA 1UJ8A 2KMDA 5ALWA 1WH7A 4IHSA 2RHFA 1R4MB 2VQCA 2X51A 1CQTA 2LVSA 4I2HA 5HNHA 2HTSA 4L9TA 2VONA 8ICWA 3ABLH 5KG5A 1ITYA 4ECRA 2KIWA 5J0SA 1ZQGA 5J8FA 1NH3A 2BKEA 2L5YA 3ZDAA 1XMKA 5KNLA 4RGUA 5J8CA 4QZEA 3SYTA 1S5LU 3L7WA 3WTTC 2XGXA 4A3MJ 3QU9A 3QX7A 3RPQA 2PI0A 2HXOA 5DB6A 3TW6A 2EZXA 5J40A 1GLNA 2E5ZA 2WB1N 1T3QA 4FZLA 5AKHA 4Y4RA 5HMLA 2VODA 1S72I 1LFBA 1SFXA 4C2TA 2CXYA 3OYDA 3WK5A 4JUZA 1MKMA 2AHOB 3IRUA 5AM4A 4I0BA 4U7DA 3HL2A 2R7TA 3V6HA 3E6DA 3F21A 4C8OA 1LVKA 1BC7C 1NI3A 2HYGD 3OYMA 1IGNA 2NVQJ 3K1MA 1A6IA 1ERDA 4BWMA 2Z1DA 3HRSA 4OAZA 1Q8KA 3MEXA 2W54A 4KNYA 4C4SA 2ZUBA 3E5QA 5DQHA 3P9IA 3AN1A 1TT0A 2M34A 2NRXA 5D5WB 4F4WA 4KLUA 1QNTA 1S3JA 5DYMA 4Y3OA 3JCUC 2NRWA 3AG1H 2PKEA 2BZTA 4V2GA 1V4RA 5HOOA 1YW9A 2A5YB 1O3SA 1DK3A 5KFCA 2Q2EA 5DQIA 3CD6I 2KKVA 1T0FA 2LKXA 4B6JA 3ABTA 4ESFA 1E3PA 2XKOA 5KCMA 2K4HA 3PL8A 3I1YA 1WSUA 8ICYA 1MSEC 4I09A 2F8LA 1R36A 2L01A 5D6EA 4V19K 3AU2A 1DQUA 2R7WA 2KP7A 2KRHA 1PVRA 1BR4A 1UB9A 1ZJMA 3MKZA 3VYUB 2BCUA 4U87A 2ZXWH 3HB9A 1ENHA 2H3QA 3BQYA 3TFSA 9ICRA 2F76X 4ZZLA 3G73A 3JSOA 2C22A 3ERED 9ICMA 5D8KB 1XO0A 4RB3C 3OR2C 3G1OA 2V9PA 2E7WA 3ISPA 4F92B 2L5QA 4ZYGA 4D1QA 3PO2J 4TURA 3RPUA 4UBCA 3KZZA 1B9MA 1WCLA 2PMZC 5ALYA 2ODGA 2XSJC 3QU4A 3TP0A 3JPQA 3KP3A 1TBXA 1F0MA 3TQNA 1S9HA 3WTYC 4YP3A 3Q0WA 4EZ9A 4MHVA 4IRKA 5GP9A 1OR7A 4UB1A 1Z3XA 4LD5A 2K9NA 3M9AA 2FOWA 1JGGA 3HHGA 1F1ZA 4C3IJ 4OINF 3VB2A 4E7IA 4ED2A 3S32A 1XCBA 5GTIC 5EE0A 2VOPA 2Y31A 3G6VA 4HNUA 1IM4A 4F4XA 5GAHJ 3IH3A 1W5TA 1XG1A 1ZELA 1TAMA 2W48A 2XICA 2BY2A 1SXDA 5H6QA 3TO9A 5JR3A 5HODA 4PHDA 4HEA2 1X1CA 1GT0C 4EZ6A 5J2DA 2Y9ZA 3HOWJ 1N5XA 3GIKA 2E1NA 1IN7A 2CQNA 5JVGF 4JWNA 3LL7A 1WCNA 3S14J 2LG4A 2PMHA 4MNUA 3JRAA 2DA6A 1SEUA 1QA6A 3KYDB 4DIQA 4LG0B 1HC8A 4NV0A 1VZ0A 4C2UA 2JHDA 5F1RA 2DA4A 2Y75A 5BOXA 1WI9A 3D2NA 1R5ID 4FTHA 3K1ZA 1J0RA 2R7XA 1ZYRF 3F6OA 2NRZA 1YO5C 1RPLA 4I76A 1FYLA 3F8NA 4CICA 5ALVA 2KFNA 2R7DA 4R1HA 1X6JA 3ZDBA 5IT3A 4BACA 1DPUA 1X4PA 4YIRX 5DLFA 3B73A 3GFKB 3K4JA 4PZJA 1QHGA 1XD7A 2Y2ZA 3H9JA 4QNLA 2UXXA 3E6CC 2P6SA 4Y7NJ 2NVUB 4RU9A 1ZQQA 1TWFJ 4KLDA 2OF7A 3IKTA 5AK5A 3H0MB 2CW0F 1K61A 2HDWA 1TLHB 1WWVA 1RR8C 2QKMB 1T8IA 4XLHA 1BIBA 1XU4A 4UVCA 2VBXA 3MR5A 3FM9A 1LEBA 4KLLA 4CYDA 5L9XA 2DBBA 1KFSA 1GV5A 2BGCA 3HSEA 3BR2A 4A5MA 3DLLF 3V7KA 2HHWA 4DQQA 2RLTA 5KFEA 2OH2A 1T33A 2YR2A 4OWRB 2CUEA 1L0OC 1FYMA 2O0YA 3KEYA 3AMZA 4QW8A 5KFMA 3BQ0A 1XNSA 4NLZA 4LGWA 5FLXK 1SFKA 4P9FA 3OYIA 2L4MA 4RGSA 2QWWA 2LF7A 4LIVA 1ZR4A 2VJ5A 2FD5A 3K1NA 2KG5A 4J9PA 1ZQLA 3EUHA 2EZIA 3LK9A 5HLTA 1YFHA 1X2MA 7ICSA 3K4CA 3KX2A 3A0BC 4C9YA 3KEQA 3ZMTA 1V54H 2Y1IA 3IH4A 4R8HA 3ZMUA 1X9SA 5ALSA 4A3JJ 4C4RA 4QZHA 4XNFA 2K4EA 3PUFA 3M9MB 1JUPA 5EF6A 2K85A 1KRPA 2G0EA 3E2EA 1W0UA 2PMZF 1X58A 2KHVA 4NL9C 2ICWG 1KW4A 1D9DA 9ICGA 5E8IA 2VL8A 4RA2A 4HNTA 4E7LA 1IV6A 4RQNA 4UAYA 3KHLA 1ZQBA 2XAHA 1L7MA 2W03A 2W04A 3B0YA 5KT5A 5E3MA 1XB4A 4RMNA 2XGCA 2FMQA 3L3FX 4GXJA 3AAFA 2ZFUA 3KP4A 3LNQA 3CCVI 1K78B 4Y2QA 2IPQX 1X6IA 2W8LA 1IV8A 2XI9A 1XC9A 4UV8A 2LY2A 2R4GA 2A69F 4RBOA 4HAMA 2ATLA 1TWGJ 3WKBA 4PUSA 1HIWA 4ITVA 4E7KA 2LOOA 1BM9A 3LA2A 2B63J 4DOCA 1U5TB 2KZVA 1JI8A 1O7FA 2H3ZA 4CF4A 2HMXA 2W00A 1OW5A 2AGQA 2WAQN 2ES6A 4YMMA 5ILVA 4UB6U 1ONVA 1RR7A 4QWCA 2O61A 5DS9A 4OAYA 1SC7A 4I98B 1IJWC 1VQ4I 3L00A 3FIWA 1A36A 1IRFA 1HOMA 5CJ9A 4Z6YA 3UKGA 2QBYA 1K79A 2LYHA 5IINA 2XB5A 2I6XA 7ICFA 4JV0A 2IAIA 4UAZA 3ONNA 3RH5A 2JEFA 2YX4A 1ZQWA 3REOA 1JIHA 4RLFA 2MRLA 2ETHA 1VNDA 1X1BA 1U8BA 4CCLA 2O3FA 2CUFA 2TRTA 4AC0A 3MC1A 3LWFA 4KLOA 5AM1A 2BXZA 4RQ0A 2HHTA 4LJXA 5J4VA 4KLQA 1G3WA 5FKKA 1G8XA 2K86A 2FSWA 4GXOA 1QVTA 8ICHA 2M0NA 4BGDA 1UAAA 2R8GA 4IS7A 3HJEA 5EZHA 4E0DA 5KT3A 2EQYA 2EIJH 2FNAA 1GVJA 1Q3UA 7ICEA 2OU2A 4P0PB 3QU2A 2V1DA 2PG4A 5J2HA 4DGWB 3TDUC 3PSIA 2P6UA 5K5QA 3DF8A 3HSRA 4MF8A 2JV3A 4EEYA 3BOQA 1ETWA 3S93A 1HKTA 5KAFU 3WTUC 2OEHA 4A3BJ 2GM4A 1AROP 3DDHA 2HWVA 2NYVA 5DDMA 3VYTB 4IRDA 3HKZC 4G3IA 3SV4A 5LD2C 3KHRA 1YIJI 2GZWA 2EFWA 1D8JA 3LDAA 4XA5A 4YXMA 5J1UA 2MW8A 3BS5B 1IN8A 3S2HJ 2YMQA 2HHQA 1FNNA 2VKVA 2EQRA 1W7PD 4M0AA 3PQKA 1ZD4A 4R8UB 1DUXC 2NNNA 5AM5A 2ESHA 1BPXA 3FBIB 2Z5UA 3T0YA 2IOFK 5IT9Z 4YFKF 2DU9A 5F3XB 1I1GA 3S6JA 1ETQA 1SD6A 2KNJA 2X1CA 5ILUA 3CCYA 4RQ1A 4QWAA 4GC7A 3MWMA 1WJCA 5LRSA 1WQ2A 2K89A 4EX7A 1KSPA 1HEKA 2K4IA 4B3XA 4US8A 2CPRA 4C7YA 4XKWA 2KRFA 2Y9TA 5KFBA 4ZOHC 3FXRA 4LG0A 2HQ5A 2EAMA 4UBBA 4USAA 2E2IJ 1R58A 4IRIA 1A0PA 2XASA 1IF1A 5KT6A 2WV0A 4UHTA 1MZBA 1PUFA 2F1HA 2WFAA 3RTVA 4NLKA 2HOEA 3HIFA 2LBFB 1N63A 3OS0A 5CEHA 4WXHA 3DP7A 2HYFA 4O3PA 3WTZA 4JK1X 1JXEA 5AI0A 2EJRA 4PPXA 2FA5A 2F2AB 2ESNA 3IM1A 1WRJA 3MFKA 2A1AA 3MGVA 3W2WA 2DDBA 3G6YA 2DFFA 1MH4A
chains in the Genus database with same CATH topology
2VQHA 4P1WA 3BC8A 4ACOA 4XONA 4NWIA 4U6PA 2D6FC 2NV3A 5HR6A 4HRIA 3LFUA 2L7KA 4HSRA 2RREA 1KONA 2OM6A 3OYLA 2KDOA 3FKJA 4HSTA 2ZIXB 3K4BA 2HNHA 2XC7A 3BG7A 2VKQA 3FBNB 3CP8A 3RCOA 3OYJA 4E7ZA 1WFXA 3K4NA 2F5VA 3CJRB 3IG8A 3I3LA 3DPUA 3DTIA 3I9V2 4U7CA 4CUGA 4BUPA 3ZCOA 4CA0A 4NLBA 1SAUA 4FZMA 4IX7A 2W1OA 3ZXSA 3M1CA 1T0FC 2G0AA 2ZIWB 2ZIXA 1Z19A 3H5NA 5KHDA 4ZTFA 4XKVA 2OYYA 4XM3A 4II2A 3J7AY 4E7JA 3D2QA 1KBUA 3L2VA 4YEJA 4LITA 4NUBA 1NG6A 3LYSA 4G6TB 3OYHA 2XF5A 4JMUA 2H3FA 4OJ5A 2GOMA 4BQOA 4O3MA 1FMVA 2VIXA 3E0JB 3IUOA 3ICXA 3SEQA 3E0FA 3AL0B 5KL1B 1YT3A 2ZIWA 3IAM2 4A8EA 1FMWA 1MMDA 2XF6A 5HR7A 2WAQA 3QYBA 1WUDA 3SAGA 1N77A 3W2AA 3A4CA 3L2RA 3HKZF 4DBRA 4OJ6A 2VB6A 5HVQC 3DKXA 2YB4A 1DRGA 4BEHB 4BJQA 1QHHD 2R7VA 2OV7A 3QODA 4XOPA 4ZDPA 3VSLA 3AKZA 4CGZA 2DQNB 1U0JA 3S3MA 2CMPA 2L2OA 3MKYB 3OL4A 2YB1A 4AYBC 1WJDA 2AQEA 2R7UA 4U7BA 2VXZA 3ZRGA 4NC7A 3EPZA 2KICA 2VJIA 2WB1F 2KVCA 4B47A 2WADA 4BEHA 2ZXIA 3LSIA 4KX3A 1BOBA 3VYSB 2CFOA 2M0MA 2R7SA 2KJ9A 4AVZA 2IS4A 2VXDA 3BCAA 5T14A 3EUAA 3L2QA 3H5AA 1Z7LA 3OIPA 4PJNA 4XLFA 2LKYA 4N4OB 2H3IA 3K10A 4FETA 4XN0A 1D8BA 2KOBA 4DJAA 1PVQA 2UUZA 3VC8A 4B43A 1WJAA 1W36D 3IP4B 1UG0A 2ZIUA 2XVTA 3LSMA 2CS3A 4CCKA 3KYLA 4CCNA 1ED1A 4DBQA 2K5CA 3NRWA 1D1AA 4IQJA 4QPQA 2HBMA 4ICAA 2KL4A 4XQFA 3OY9A 2CV0A 2VPLA 3M6KA 2G06A 4OO1J 3OYEA 2LC2A 3GU3A 4PJJA 1YE9A 2IGOA 2KP6A 4B48A 4E7HA 4P0PA 2IS6A 4KITB 2YX8A 2RP5A 4BJ6C 4XLAA 4OJLA 4MLOA 5CQEA 1CRXA 1MW7A 3M6ZA 4PSXA 4XLCA 2V9KA 2CV2A 3DLAA 2MA1A 4HG2A 2DXIA 2KV2A 1NZBA 4BQNA 3ALRA 3OYBA 4KMOB 2BW3B 2GOXB 5TGTA 2VQGA 2LH9A 3VDXA 3DQVC 3LMMA 1Y6IA 2N1RA 4NLCA 3DEEA 4QPOA 3N7SC 3VYRB 3C2HA 3EUHC 3LSGA 2VLAA 1IRXA 4ZC3A 4YRVA 2WAEA 3RSNA 3LVWA 5CRXA 2HVQA 2BW3A 3MD2A 2V1NA 3MMYB 2CW8A 2XAUA 2MC4A 3F2DA 1V5EA 2HU9A 3ZQQA 3H9QA 1F44A 5FRNA 3F5EA 3LSKA 2E1EA 1Y56A 3F53A 4YELA 2UV1A 2UWMA 3L2UA 3N7RC 2QKLB 3FHNA 4II3A 1P9QC 2VKHA 2DF4B 2Y0SC 3OMYA 2LBFA 3A1YA 4RM3A 4D9JA 3PUBA 4PJLA 2ZSIB 4BUGA 5C0YA 1DGWY 4ANJA 2WAQC 3MKWB 3OPXA 2VJJA 4P5OA 4AYBF 2JH7A 2KMUA 4F93B 2MYSA 4XR6A 2IGKA 4IZZA 1T94A 3GZFA 4PL2A 4J00A 2W7OA 1QU3A 3DWLE 2KKPA 4XL9A 3RFAA 3PNYA 2KD1A 1WJFA 2AQFA 1DP3A 4PFPA 2V6EA 2F77X 4C0ZA 2HOFA 1D1BA 3K70D 2PJRB 1E0EA 4B44A 2X6WA 1IIPA 2E1FA 2BVLA 2RRDA 2E60A 3DTKA 3N05A 1UELB 2RHFA 3CYMA 3ZR8X 2VQCA 2X51A 2K8AA 5HNHA 3VCBA 4F91B 2BDUA 1X4OA 4AU7A 4WJ3B 4H4KC 2WBMA 3HOSA 2HBLA 2V4JC 2KIWA 2Z7JA 3CRXA 3SDBA 3DPTA 4GRIA 1LKXA 4CZCA 5KNLA 3SYTA 3CJQB 2DT7B 2L9NA 2G5IB 3N7PD 2M4KA 3PJRA 1X1AA 1GLNA 2E5ZA 4FZLA 1PVPA 1Z3YA 4Y4RA 3DKYA 4C2TA 2DT6A 2VKDA 3OL3A 4PFOA 3OYDA 2ZIVB 2MFZA 3PZPA 1A6SA 4JOMA 1Q3VA 2JUGA 5CQGA 2JVGA 3HL2A 2R7TA 2KEYA 1LVKA 3NWTA 4BXFA 2KHMA 2Q2EB 3OYMA 3LVVA 3F2CA 3CESA 3HG9A 4BJ5C 2JA2A 4F55A 1ERDA 2LYBA 2BOLA 2KQRA 2Z1DA 4OAZA 4ZYAA 3UR3C 1TT0A 1Z21A 4FE3A 4Y3OA 2K9LA 2X85A 4BE2A 1J09A 3RTRA 3OYCA 5HOOA 1AA7A 4CDGA 4HPQA 3CF2A 3W2VA 4BJTA 2KKVA 2I8DA 2IXSA 2HOIA 4LG3A 4CSWA 5KCMA 2JH1A 2VQLA 3PL8A 2K4HA 3CMMA 4CCJA 1D0XA 4BE0A 2F8LA 2HOQA 1BR1A 3U21A 4BDZA 1PVRA 1DQUA 2R7WA 1URJA 2KRHA 3SAHA 1BR4A 2Y0SF 1MMAA 2KJ5A 3MKZA 3VYUB 4U87A 2H3QA 1L6NA 2F76X 1X1DA 3VSKA 4CCOA 3OR2C 3L2WA 4F92B 1XO0A 4D1QA 2G08A 2L5QA 3HOTA 2WAQF 2RNGA 3SAFA 2M3AA 3TMOA 2KPMA 2PMZC 1OUQA 1D0ZA 2XSJC 2M7BA 2V26A 2LREA 2LBOA 1BR2A 2IGNA 1S9HA 4QIWC 3F9KA 4FZNA 3S3OA 1ZQ1C 2X6YA 1Z3XA 2E5SA 5KL8B 3OYFA 2WAFA 2R7QA 4E7IA 1Z1BA 5LFAA 3S32A 2JMGA 4HNUA 4E7SA 2R7RA 1ZELA 1TAMA 2XICA 4KT6A 4NC8A 3OYKA 4HEA2 1X1CA 1W36C 4XN3A 3H9GA 3LL7A 2DOAA 3CZ6A 4BDYA 2X1DA 3A2KA 3ONQA 3PSTA 4XORA 2LG4A 2BVMA 2L9SA 3OWTA 3C2GA 4XLEA 3HC7A 3K4LA 4DIQA 1LDKB 4NV0A 3OS1A 4R79A 1VZ0A 3M8JA 2Q1ZB 4C2UA 4F3QA 2JHDA 3PSPA 3D2NA 1R6RA 4N4NB 3K1ZA 4XKCA 2HBJA 2R7XA 2Z16A 2GH1A 3H0DA 2K9MA 1G59A 2V7FA 2F4IA 4IQ4A 3M7DA 3OR1C 4Y33A 2LYCA 5A0LA 4ZTJA 2P0WA 4BACA 1X4PA 3DPLC 2HZDA 2W7PA 4ZDOA 2ZSHB 2CRXA 2R18A 4OJOA 3K4JA 3KZXA 3LSHA 4DOZA 1QHGA 1WJEA 3D5SC 3H9JA 4XMYA 4QNLA 3CP2A 3TL4X 3RF9A 3DU6A 3F5AA 3H0MB 4KJZA 2K8CB 3HKZA 2HDWA 3K4KA 2GOLA 3H0LB 2FUG2 4C30A 2XIDA 1P7DA 2QKMB 4XLHA 4ZDLA 1ECWA 1NG7A 2K3PA 3VWBA 3AL0C 2MABA 2LHTA 4KX5A 3AQFA 2OH2A 2A5WA 4OWRB 1XNSA 2W7NA 3KEYA 1V5GA 3RPUD 1D1CA 3S8PA 4OJPA 1SFKA 3HPHA 2WB1A 3OYIA 5FRMA 3F2BA 3PFYA 3IG5A 3DU5A 4LIVA 3SEZA 2VJ5A 4P0QB 3C28A 2LY1A 4E6KG 5HLTA 2H3VA 3GBGA 3K4CA 2PJRA 4BE1A 3OYGA 2CH0A 3KX2A 2DGZA 2CV1A 4C9YA 3OYNA 3OIQA 2ELJA 4PJMA 2WY7Q 2OUMA 2E1MC 2X6XA 4XNFA 4F52A 2K4EA 3IAS2 2JVHA 2IS1A 2PMZF 3BCBA 4J01A 4P0QA 2M4GA 2KHVA 2VASA 4XKBA 2HVRA 2LYAA 4HNTA 2VL8A 4IC9A 2A3VA 4E7LA 2KRCA 4QIWF 2Y0SA 2G09A 2W03A 3H5RA 2W04A 2KLOA 2KJ8A 1MNEA 4X0GA 2CN1A 3BG6A 4RMNA 1LFPA 3L3FX 1V5FA 2NOJB 2ZFUA 3K70C 3EUKL 1MA7A 2XI9A 2HQAA 2X1EA 5CPRB 2LY2A 2R4GA 2ZIVA 4KISA 3PNTA 4PUSA 1HIWA 4ITVA 4E7KA 1N75A 2G5HB 2LOOA 2Q4TA 2KZVA 1OR7C 1PYVA 2WY8Q 3PNVA 2CUZA 4BU2A 2CW7A 3FDYA 1JI8A 2KHQA 2H3ZA 2CUJA 1PJRA 2HMXA 2W00A 3QYFA 1WJBA 4NQWB 2HBKA 2K8BB 2OC6A 4LIUA 3ZGKA 4NNJA 4OAYA 2HPIA 2E1MB 4BX9C 3TBIA 3W3CA 4IKFA 2F6CA 2ZIUB 1MNDA 3ONNA 3NUQA 2DCEA 4PL1A 2MRLA 3PSFA 4BS9A 2R7OA 2Z2SB 3QOEA 4RLFA 1X1BA 4CCLA 2JSPA 4CCMA 3HUGB 4JQFA 2O5RA 4BQQA 1G8XA 1WJ5A 3RQ4A 2A6TA 3O0FA 3DTEA 2E5NA 2M0NA 4BGDA 3OS2A 1UAAA 3H0RB 3S3NA 2MD0A 3HPGA 1Q3UA 1MMNA 1SZHA 1OLTA 4P0PB 1X19A 2OXOA 2HPMA 4DGWB 3PSIA 5JHFA 3OYAA 1YX5A 3V42A 4AYBA 3S93A 2W82A 1N78A 1HA8A 4FASD 2W4SA 2IS2A 4ZJZA 3K6GA 3VYTB 3HKZC 4PSWA 5LD2C 4CH7A 3H35A 3UNGC 3NWSA 3BLYA 2VJ4A 2G07A 2IGMA 2HVSA 1T95A 3C29A 1K6YA 4CRXA 1EA3A 3IN5A 1MMGA 3K4MA 3E1SA 4QJFB 3FBIB 1UPHA 2XDVA 3D2SA 1D0YA 3D5RC 3QYEA 2KNJA 2X1CA 2WB1C 1WJCA 2K89A 4EATA 2ZG6A 1HEKA 2K4IA 5CKTA 3SZGA 4B3XA 3SMVA 2CPRA 4XKWA 2RQQA 2XF7A 3D5LA 2JGAA 3HXLA 2LRDA 4RM2A 4PK4A 1A0PA 5FROA 3T79A 3KFUF 2WA0A 3AQEA 4GFJA 2LBFB 3OS0A 2DJIA 4RLQA 3AFHA 5HNFA 2ZXHA 2F2AB 1YX3A 1DGRM 3SQIA 4XOTA 3G2BA 4E4HA 3OOUA 2PMZA 4BL0B 3MGVA 3W2WA 1GO3F 1TZLA 2M7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEE A; 
#chains in the Genus database with same CATH topology
 4M9S A;  3RR8 A;  3HIL A;  1WZ2 A;  4NWI A;  2BPC A;  3LST A;  2HDC A;  2R5Y A;  1DU0 A;  4IHT A;  1BPD A;  2LPE A;  3LFU A;  2ASD A;  5A2Q K;  3N28 A;  1IO2 A;  1ZRD A;  3FKJ A;  4A3D J;  1E2X A;  8ICG A;  3MBY A;  2VKQ A;  2KKO A;  4RQM A;  3FBN B;  2BQR A;  4IHX A;  1BC8 C;  2R8J A;  2QYO A;  1ZJN A;  5IOZ A;  1YS7 A;  3K4N A;  2D2W A;  4E70 A;  5H6R A;  3C1Y A;  3IG8 A;  1ULY A;  3QPL A;  5IIO A;  4G12 A;  3VPR A;  1UQV A;  4Y2P A;  1S0V A;  3EYY A;  2ZJ5 A;  5HHI A;  3M8E A;  2ADU A;  4IX7 A;  2LF8 A;  4M3E A;  3PW4 A;  8ICP A;  1T0F C;  1NK6 A;  2K4J A;  4IRG A;  1TL8 A;  3H5N A;  5K5R A;  2RVC A;  1OPC A;  4XM3 A;  3QU7 A;  5ILS A;  3CJT B;  5J8Y A;  5J0Y A;  4ZYE A;  1FLI A;  3JRD A;  2KFD A;  4LIT A;  3OSG A;  2GQQ A;  1RIO H;  1YQA A;  3IC7 A;  3OYH A;  3CMA I;  4JP0 A;  2XF5 A;  1PK1 B;  4OJ5 A;  3LFK A;  3FK7 A;  3KP5 A;  2CG4 A;  2GOM A;  4BQO A;  5LHG A;  3GX4 X;  1ZR2 A;  4XLN F;  1FMV A;  4O3M A;  5IP6 A;  3SEQ A;  2ID6 A;  1C0W A;  5KFF A;  1YZ7 A;  5HR7 A;  5AKX A;  2NRT A;  3SV3 A;  2KJB A;  7ICL A;  1WUD A;  3SAG A;  1K4S A;  1RYU A;  1UCV A;  3GCM A;  1N61 A;  2DA2 A;  4BBR J;  4QWE A;  5BQT A;  1QBJ A;  2YPR A;  3HKZ F;  4M3F A;  3C29 A;  2OPT A;  4TQR A;  2VB6 A;  3J7A O;  2XY7 A;  1KFD A;  3I59 A;  3BQT A;  2EZY A;  4EM2 A;  4BJQ A;  5GTI U;  5IP9 J;  2DKX A;  1UHS A;  3FK6 A;  4YR2 A;  1KFT A;  2VKE A;  1K78 A;  4UNO A;  1RES A;  2HI0 A;  1FWZ A;  3MKY B;  3MR2 A;  3OL4 A;  3ZD8 A;  3FMQ A;  3V7S A;  2FBH A;  1FOY A;  5D6F A;  3ULQ B;  1WJD A;  2YB1 A;  4IHV A;  1UT8 A;  1COK A;  2FQ3 A;  3ZOB A;  4W97 A;  2VXZ A;  4O3O A;  2VJI A;  5KAI C;  1EH7 A;  4B1R A;  1ZQZ A;  9ICK A;  2WAD A;  1U5T A;  2OJE D;  3V4G A;  4MO7 A;  2IA2 A;  4GLX A;  2CFO A;  1VQN I;  4RGR A;  2R7S A;  2VXD A;  4DYR A;  2NO4 A;  2DO7 A;  1JX4 A;  3L2Q A;  1XGM A;  4N4O B;  2H3I A;  4KFC A;  4FET A;  4XN0 A;  2LD5 A;  3ML6 A;  4DQP A;  2HQN A;  4P96 A;  3IWF A;  4C2M J;  1W5C C;  4DJA A;  4KMF A;  1PVQ A;  4JX4 A;  1FP1 D;  4I2I A;  1TQI A;  1I39 A;  4FQG A;  3IP4 B;  3BY6 A;  1UG0 A;  5J2E A;  4O5C A;  4Q43 A;  6PAX A;  2XVT A;  4OIP F;  3IH2 A;  2LKP A;  4CCK A;  4BYY A;  3KYL A;  2CWE A;  5GAG J;  2EAN A;  3HZJ A;  3GTP J;  3KP6 A;  1E17 A;  2EA4 A;  2P81 A;  3QPS A;  2HFH A;  2OZU A;  2MLG A;  3RI4 A;  4IQJ A;  3NAR A;  1A35 A;  4LLN A;  1R22 A;  2KL4 A;  1SWV A;  4ICA A;  5AM2 A;  3M6K A;  5DGB A;  1R1U A;  3CCJ I;  2G06 A;  3RKQ A;  3K0L A;  4GXK A;  5L3G A;  2O03 A;  5DD8 A;  2LC2 A;  4PJ0 C;  2E71 A;  5FB2 A;  3KOO A;  4PHE A;  4P0P A;  1OCO H;  3BQZ A;  4B48 A;  4E7H A;  4ELT A;  1XSX A;  4U0W A;  5AK4 A;  4KIG A;  4Y15 A;  5FFZ A;  2VA8 A;  1Z3E B;  3AG4 H;  4OJL A;  3JPR A;  5KFP A;  1CRX A;  5E1Z B;  4DW6 A;  3M6Z A;  1RYS A;  1MNM C;  5L1J A;  5E18 F;  4HG2 A;  1CI4 A;  2KV2 A;  3ALR A;  2V1U A;  1ETK A;  3HTS B;  2ZCW A;  3SZT A;  3GTO J;  2EK5 A;  5L1L A;  2DFE A;  1QGP A;  2DMT A;  2E8N A;  1FP2 A;  1K83 J;  2J5P A;  5TGT A;  2VQG A;  1KN5 A;  1TQP A;  3RJE A;  4F3O A;  4GYI A;  3EUB 2;  3QU3 A;  3LMM A;  1RI7 A;  3H8J A;  2H6C A;  1RKT A;  3A0B U;  3I5U A;  3EUH C;  2PI5 A;  4ZC3 A;  4YRV A;  3BTC A;  2EH3 A;  4M73 A;  4R8U A;  2FLP A;  4IRC A;  3O6B B;  3WU2 C;  1PP8 F;  5AKE A;  4EBD A;  4F2R A;  1RZT A;  5M3M J;  2E7X A;  2BW3 A;  3MD2 A;  4HF0 A;  5AIQ A;  3ZP5 A;  4FX4 A;  4GC6 A;  2K27 A;  1U47 A;  4ENM A;  2KZZ A;  2CW8 A;  2A05 A;  2MC4 A;  4F8R A;  2M30 A;  4KDP A;  5DDG A;  3QE9 Y;  3H9Q A;  1F44 A;  4BAY A;  5FRN A;  2CU7 A;  2XC9 A;  3GV8 B;  3W6J B;  1G4D A;  2QKQ A;  4HF2 A;  4YEL A;  2UV1 A;  3ELK A;  2DBY A;  3L2U A;  2XAF A;  5J0U A;  3H4B A;  4II3 A;  2DF4 B;  2VKH A;  1QRY A;  1FIP A;  1ZGW A;  2E2J J;  2LBF A;  5DBC A;  5JTI A;  3A1Y A;  5F08 A;  4Q4Z F;  2W9A A;  9ICN A;  4PJL A;  2ZSI B;  5KFW A;  1ETV A;  4BUG A;  1UA1 A;  1YW8 A;  2YUS A;  1ZQJ A;  2QM3 A;  5DCF A;  5L3C A;  2JA5 J;  4O5V A;  2KMU A;  4YMN A;  1D8Y A;  2VBZ A;  4EGZ A;  2BGW A;  1ZQD A;  1ORK A;  3AG2 H;  4PL2 A;  3CCQ I;  4J00 A;  4I27 A;  5GAD J;  3CNH A;  2KKP A;  3RFA A;  2ZJ2 A;  1ZH5 A;  1WJF A;  1WVR A;  2ACJ A;  5AI6 A;  4PFP A;  1HKQ A;  2V6E A;  1KQ0 A;  1A76 A;  5ALD A;  1D1B A;  1MBJ A;  4ENJ A;  3K75 D;  4QWB A;  2MGQ A;  1B22 A;  2OTJ I;  3GTM J;  1IZ1 A;  1HW1 A;  2E60 A;  3DTK A;  2RRD A;  3LWL A;  1UEL B;  3G1M A;  4DSJ A;  1B0X A;  4PGH A;  4A0X A;  3ZQL A;  2H6B A;  3EET A;  4F91 B;  5KT2 A;  4YD1 A;  1X4O A;  4AU7 A;  2Z9O A;  4K4H A;  2WBM A;  2LLK A;  2FMP A;  2H94 A;  3CTA A;  1FT9 A;  1B8I B;  3HOS A;  1HUO A;  5J0O A;  2BHZ A;  2Z7J A;  1MD0 A;  2BY0 A;  2QSF X;  3SDB A;  2ZJQ F;  2PQ8 A;  4DSL A;  1Y39 A;  4M6W B;  2YU9 J;  4C8L A;  4I2G A;  2FJ1 A;  2GWR A;  4ECQ A;  1XSD A;  5CR0 A;  5J0T A;  2G5I B;  3MCZ A;  3N7P D;  5HMM A;  5CB1 A;  5KFJ A;  4RQ2 A;  2AXL A;  2P6T A;  1X1A A;  1PVP A;  3F22 A;  4AUX A;  2YMM A;  4RUA A;  2MSN A;  2F44 A;  5KK1 A;  4EJW A;  2O9L A;  1X9W A;  4DEZ A;  2VKD A;  1VQP I;  2KT0 A;  1YI2 I;  1LVH A;  4DLE A;  4CF5 A;  5DUK A;  4JOM A;  1L3U A;  5KG4 A;  2JUG A;  1IUF A;  2JVG A;  2C2D A;  5M5Y J;  4KYW A;  1PP7 U;  3ABK H;  3KHH A;  1BW6 A;  4OMY A;  1DK2 A;  4BXF A;  3F2C A;  2Q2E B;  4MQ9 F;  2AHQ A;  5LRR A;  4A69 C;  3JSP A;  4BJ5 C;  2JA2 A;  4F55 A;  3BZC A;  1JKQ C;  2A61 A;  3MKL A;  3WGH A;  2LYB A;  2GO7 A;  3RQI A;  3D6J A;  3HOV J;  3WKA A;  3ZMV A;  3TAC B;  1P7J A;  5JVT A;  2HVI A;  7ICN A;  2O8X A;  1Z21 A;  4RNO A;  1X3Z B;  4HW0 A;  2NS7 A;  3PM1 A;  2K9L A;  2X85 A;  4QZ9 A;  1J09 A;  4UVA A;  3RTR A;  2B9S A;  4YR0 A;  1Z7U A;  4Y52 J;  3OYC A;  4CDG A;  1XSV A;  3RR7 A;  1J5Y A;  4HPQ A;  3GVA A;  4HV6 A;  4Y17 A;  3W2V A;  5CVU A;  2I8D A;  1I6X A;  2IXS A;  2RC4 A;  2ZFW A;  1E3O C;  1S7A A;  1S0N A;  3HGG A;  3CDI A;  3CMM A;  3JRH A;  1WHU A;  4BE0 A;  3QRF F;  2LM1 A;  2FML A;  4R63 A;  2AJQ A;  2XGD A;  1MMA A;  2FPK A;  3FXL A;  1TWC J;  5D49 A;  1ZQX A;  3X2Q H;  1X1D A;  3KLN A;  1A6Q A;  4A3L J;  4G9B A;  3L2W A;  4QZG A;  3V7J A;  1V85 A;  2G08 A;  1T08 B;  1UST A;  2Y0M A;  1L7N A;  1X2N A;  3TMO A;  3V7C A;  1K6O A;  2GXB A;  1P6R A;  1OCR H;  2I5H A;  3NVW A;  5EG0 B;  1D0Z A;  1RZ4 A;  5CWR A;  2HHV A;  1NJZ A;  2V26 A;  2CQX A;  3QUT A;  1QLN A;  4KUM A;  1ACI A;  3SHF A;  4M3B A;  4FZN A;  3S3O A;  3EWA A;  2Z33 A;  1R1V A;  2EA2 A;  4DNC A;  1RUO A;  1N5W A;  5K7H A;  3FDS A;  2WAF A;  1QQ6 A;  5AKK A;  4DSF A;  5J2I A;  2XGE A;  1Z1B A;  1BW5 A;  3OV8 A;  3T1B A;  1P92 A;  4AM3 A;  1SV0 A;  1NK9 A;  2IP2 A;  1P4A A;  5IT9 K;  4YD2 A;  4DQS A;  1J59 A;  3PO3 J;  5ED4 A;  2LM4 A;  4NC8 A;  2W9C B;  3K4G A;  1W36 C;  2OZ6 A;  3QUB A;  3H1C A;  2ME6 A;  2G9W A;  3H9G A;  1HF0 A;  2DOA A;  2NRA C;  1A77 A;  1RKW A;  2X1D A;  3J81 Z;  4FE7 A;  2HDO A;  3PST A;  5J3L A;  2DFH A;  1NJW A;  5HDG A;  4DQI A;  2GBY A;  4XLE A;  5AI5 A;  3K4L A;  1FPQ A;  4A93 J;  1NK3 P;  4DFK A;  8ICE A;  2PFO A;  1R6R A;  4N4N B;  4RAG A;  4XKC A;  2H1K A;  1Q46 A;  4AYB N;  1BVS A;  2DMU A;  5J8Y C;  2GH1 A;  2JRZ A;  3H0D A;  2K9M A;  1F36 A;  2V7F A;  4N0B A;  1S77 D;  4O5E A;  1BJZ A;  3M7D A;  4Y33 A;  4C8N A;  2LYC A;  5A0L A;  5CVR A;  3BPV A;  3G6E I;  4ABZ A;  2GWS A;  3PO4 A;  3UXP A;  4L18 B;  3DPL C;  4A2U A;  2W7P A;  2R8H A;  5KG3 A;  4QZ8 A;  2R18 A;  4I2A A;  4UVB A;  2WF6 A;  3KZX A;  3GFJ A;  3LSH A;  4DOZ A;  1N48 A;  1X9X A;  2E8P A;  3ZDC A;  5K7F A;  1MBG A;  2EB7 A;  2LFB A;  4UY8 I;  4F72 A;  3GIJ A;  3RJF A;  1T7P A;  3DU6 A;  3F5A A;  1H8A C;  1FTZ A;  4Z6C A;  3KTQ A;  3HKZ A;  4Y2J A;  1L5U A;  2UXN A;  3BTI A;  5F04 A;  2DPD A;  2X0L A;  5J2K A;  4JWM A;  3ZMD A;  4EQQ A;  1LUJ B;  1T2K A;  1WH5 A;  1NG7 A;  1ECW A;  1ZQ3 P;  3VWB A;  1ZQO A;  2A6E F;  4DYQ A;  2HSZ A;  1OYW A;  1Y0N A;  2I1Q A;  5KFK A;  1TW2 A;  2A1J B;  4UB8 C;  1J2M A;  1U49 A;  2DPJ A;  4D5C A;  3VFZ A;  5D8L B;  1I6H J;  5KAI U;  2CQK A;  3KYC B;  2CSO A;  1V5G A;  5LGU A;  3S8P A;  1ZD5 A;  2ISY A;  1Z9C A;  4ZYD A;  1U5T C;  1ON1 A;  1NNL A;  3KZI U;  3IG5 A;  2IVM A;  5AM3 A;  1Z4O A;  5CYV A;  4XRS G;  5CJ7 A;  2LY1 A;  5KFN A;  4E6K G;  4KLS A;  4L5J A;  2H3V A;  5HS9 A;  1ETO A;  2WTE A;  3OYG A;  2CH0 A;  2W3S A;  1EV7 A;  1BI3 A;  1F4K A;  2CV1 A;  1USS A;  2B0C A;  4C3J J;  2DGZ A;  5H20 A;  5KG7 A;  4IOC F;  3C21 A;  4TUQ A;  3CDL A;  1BN5 A;  1HST A;  1FTT A;  2FE9 A;  5JFR A;  3L1P A;  2EBI A;  2OUM A;  5HLH A;  4BXO B;  4I2E A;  4F52 A;  2FI1 A;  5D5U B;  2K40 A;  3IAS 2;  1Z6R A;  1FEZ A;  4Y2V A;  3ZQG A;  8ICM A;  3CCL I;  4J01 A;  2M4G A;  1Q1H A;  1DU6 A;  2VAS A;  1B8I A;  2HVR A;  3CUQ B;  2A3V A;  3ECH A;  3F8B A;  4KTQ A;  3H5R A;  3RJP A;  4M6W A;  3F8C A;  3IHU A;  3ZQ7 A;  2BCS A;  2M1B A;  2GXA A;  4PJ0 U;  5ALE A;  3U2R A;  2UVW A;  4ECV A;  1W7P A;  2MSY A;  3K70 C;  1ZXI A;  1AU7 A;  3R9K A;  2KFZ A;  4LLG F;  3HOY J;  4BBS J;  4KN4 X;  2L3D A;  4AVP A;  5DM7 F;  3QP6 A;  2QB0 B;  5J2C A;  2F5E A;  2FF4 A;  4Y2R A;  3RKX A;  7ICG A;  1YJW I;  1U6G A;  1G3Y A;  2AQ4 A;  2Y30 A;  2CQ7 A;  1N75 A;  2G5H B;  2Q4T A;  3HW8 A;  3QEB Z;  2Y0S N;  2N8G A;  3CC4 I;  2QBY B;  1PYV A;  9ICB A;  4BU2 A;  2CUZ A;  5HLI A;  1OKR A;  2F1J A;  2FBK A;  2BY3 A;  2KJC A;  3QYF A;  2HBK A;  4DS5 A;  2OC6 A;  1S76 D;  2DYR H;  2VC1 A;  5B1B H;  5EGO B;  1SIJ A;  2W9M A;  4GFB A;  8ICJ A;  2HYJ A;  2V1X A;  3HGY A;  2DI3 A;  3T5H A;  3WU2 U;  2EPF A;  3BG5 A;  3JRF A;  5J1Y A;  2DFL A;  2QGU A;  2AU0 A;  3TBI A;  3Q8Q B;  3W3C A;  4M3D A;  4IKF A;  4XSX F;  1N2X A;  3BDD A;  3TKY A;  2DCE A;  2IHM A;  3M8R A;  3GFL A;  4BHC A;  2R7O A;  3QOE A;  2XO7 A;  1Y8R B;  3EQL F;  2GLE A;  2RDP A;  2PJP A;  1NKC A;  3WTX C;  4DOB A;  2DA1 A;  4JQF A;  1K1Q A;  2FJ6 A;  5ALT A;  1Z6T A;  1WJ5 A;  4CYC B;  3CLQ A;  1ZQI A;  2E5N A;  4ESB A;  3AG3 H;  4OIQ F;  3H0R B;  2X6O A;  2FQ4 A;  8ICT A;  2MD0 A;  3HPG A;  4F71 A;  1OLT A;  1XGO A;  1MDM A;  1X19 A;  5AI8 A;  5J0P A;  4TUS A;  5L1K A;  1NK0 A;  2P5V A;  5FFX A;  1MSW D;  1LDJ A;  2ZJR F;  3GII A;  1X66 A;  3OYA A;  5J0Q A;  1BI1 A;  2IOF A;  3TOA A;  3GO5 A;  3V42 A;  4PHA A;  4J9M A;  3HUG A;  5L1I A;  3TO7 A;  3RBE A;  5EG0 A;  4FAS D;  2MUT B;  4RQ6 A;  4RNM A;  1N25 A;  2RKH A;  3PML A;  4L9V A;  3H8S A;  2ZUC A;  5KFU A;  4M9H A;  2HW3 A;  5ERI A;  3QZ7 A;  4B4C A;  4CH7 A;  3H35 A;  3ROU A;  3UNG C;  4S05 A;  3BLY A;  2VJ4 A;  2HOT A;  4DWI A;  2A3S A;  2WF8 A;  2DTZ A;  2HVS A;  3JR9 A;  1M6Y A;  1HW5 A;  1R4N B;  3GME A;  4M3G A;  2XKP A;  4NDL A;  2KE7 A;  1PUF B;  2JA6 J;  4D5F A;  1O03 A;  2EWN A;  1MMG A;  4XLP F;  1ZKG A;  2W9C A;  3JTG A;  1KYZ A;  2RN7 A;  8ICV A;  5ALG A;  2XDV A;  1D0Y A;  3D5R C;  3U1D A;  2YTU A;  5J2B A;  4IL6 C;  3QNM A;  2WTF A;  2WB1 C;  8ICR A;  1TP4 A;  1ZK8 A;  3UQ2 A;  3RJJ A;  3FHZ A;  5CKT A;  3SDG A;  2AH5 A;  2EZZ A;  4A12 A;  2ZKZ A;  3I28 A;  2JGA A;  2LRD A;  2W24 A;  2W85 A;  3G3Z A;  1XSP A;  3KP7 A;  2EIN H;  4PK4 A;  4AIK A;  2H8R A;  2XY6 A;  2HQR A;  4M47 A;  3QYP A;  3T79 A;  1ZLJ A;  2NVY J;  3HOZ J;  3FX3 A;  2DYS H;  4HLY A;  3ABU A;  4GCV A;  3V7R A;  1Z4N A;  4GFJ A;  2R5Y B;  3OIO A;  5F6F A;  1HDP A;  3AFH A;  1ZYQ A;  4KLH A;  3LWM A;  1XS9 D;  1YX3 A;  4YCX A;  5E79 C;  4BL0 B;  8ICQ A;  2LKS A;  1TC3 C;  2WF5 A;  3HWT A;  1LNW A;  4M72 A;  5AK6 A;  2M7A A;  2VQH A;  2CFX A;  1L3T A;  3SQN A;  4A3E J;  3MN2 A;  5CLS A;  4XON A;  3U26 A;  5IY5 H;  5FKO A;  2NV3 A;  3C2K A;  4HRI A;  1D5V A;  3C7J A;  4NJ8 A;  4Z6E A;  5LHH A;  3KLO A;  1UHW A;  3PX6 A;  3OYL A;  1U45 A;  1XX5 A;  2XRL A;  3KHG A;  3K4B A;  3BG7 A;  5B5E C;  4F7Z A;  2ME0 A;  3CP8 A;  1UCR A;  2GIZ A;  2NXN B;  4UUS B;  4YII A;  4DQ2 A;  3QU5 A;  3PMN A;  4JK1 A;  2Y69 H;  2L54 A;  2A1J A;  3CJR B;  1ZQH A;  3JRI A;  3I3L A;  1A04 A;  4QIW N;  2O7O A;  3I9V 2;  3S17 J;  4YMO A;  5ALU A;  3ZCO A;  5LHI A;  3TKA A;  2W43 A;  1JAL A;  1K5O A;  2GXG A;  1LDD A;  1ON2 A;  2BV6 A;  4O3R A;  4U88 A;  2YY6 A;  3LAP A;  3M1C A;  1Z19 A;  2ZIX A;  4IRH A;  5E8G A;  4EEK A;  1FBU A;  4XKV A;  2TDX A;  1YIT I;  5AKG A;  4RPX A;  1I3A A;  3I4M J;  2XPU A;  4YEJ A;  3BJ6 A;  3O2P E;  3GZ5 A;  1AKH A;  5GPA A;  3BDP A;  4F5N A;  3KBB A;  2B21 A;  2F4M B;  1T3N A;  1KGS A;  4DZJ A;  2TCT A;  3I59 B;  3E0J B;  8ICL A;  2EZL A;  2K02 A;  3WK9 A;  4BXO A;  2VUM J;  2PFP A;  1MBK A;  1B9N A;  1YT3 A;  3IAM 2;  4NLN A;  5ALI A;  1FBS A;  3QYB A;  2VE9 A;  4G6Q A;  5KFS A;  5EE9 A;  3W2A A;  3L2R A;  2CJJ A;  8ICB A;  2XRN A;  3CUQ A;  4RAZ A;  3F6V A;  1N56 A;  2JRT A;  5BS6 A;  4BHP A;  3FXM A;  3DKX A;  4YFN F;  4Y2U A;  1YJ9 I;  2KIM A;  5EYR A;  3GTJ J;  2R7V A;  2EFP A;  3E97 A;  4M9X A;  4N9I A;  4XOP A;  4QWQ A;  3VSL A;  3ZQF A;  4BHB A;  1PUZ A;  2C2E A;  3S3M A;  2CMP A;  4K4G A;  1O7L A;  2BEO A;  4JX6 A;  5LLQ A;  3LAJ A;  4ED1 A;  1SV0 C;  3PV8 A;  1JGS A;  3BR3 A;  3S2W A;  2QB0 A;  3K7A J;  4Z2Y A;  1NK4 A;  2ZTC A;  2KIC A;  3ZRG A;  2DW4 A;  1FOX A;  1YLF A;  5EEG A;  3FF5 A;  2WB1 F;  3Q9S A;  2KIV A;  4A3I J;  2KVC A;  3RJI A;  1ZG3 A;  4O3S A;  4LJZ F;  5F0C A;  1BOB A;  2FXA A;  2M0M A;  3QUQ A;  4ECU A;  1ZQM A;  2EH9 A;  2JN6 A;  2MH9 A;  1S8N A;  1TK0 A;  3OIP A;  3FXK A;  3QP5 A;  3DBR B;  4XLF A;  5IYB J;  5EGO A;  2M45 A;  3COA C;  1W0T A;  1JJ6 C;  4L0Y B;  5IIJ A;  1BI0 A;  2XUB A;  1L3V A;  4KLT A;  1Y88 A;  7ICM A;  3ZDD A;  3ERM A;  3RH4 A;  4UXN A;  2DN0 A;  2ZBK A;  1LQ1 A;  1ZQV A;  4KIC A;  3J80 Z;  2RGV A;  2H8W A;  4V2F A;  4PHP A;  3OJS A;  1ED1 A;  4XSZ F;  4DBQ A;  2IA1 A;  1BL0 A;  1F5S A;  1JXS A;  5D46 A;  4B9L A;  3BJY A;  5EE1 A;  1FOW A;  2K5C A;  1D1A A;  2MA3 A;  3LQR A;  3UQ0 A;  2HBM A;  5KG0 A;  3H40 A;  4XQF A;  4CYC A;  4MEY A;  3UXO A;  1PZN A;  4DL6 A;  2IGO A;  4Y2Y A;  2RP5 A;  3NS1 A;  5K1Y A;  4UB8 U;  1B59 A;  4O0I A;  5DD4 A;  3UXN A;  2OCC H;  4PSX A;  3J81 K;  3IV5 A;  2D5V A;  2V9K A;  2CV2 A;  2XVC A;  1VQO I;  3DLA A;  1SB3 C;  5LGN A;  5ALR A;  4PZN A;  3SZ2 A;  8ICK A;  4BQN A;  1AQ6 A;  2MUT A;  2ZJ8 A;  3HM5 A;  3FYH A;  2EAO A;  2P4W A;  3GXO A;  4WK8 F;  3AU6 A;  2E1O A;  2BQ3 A;  2BW3 B;  1ZET A;  2ASL A;  3ZQI A;  1FEX A;  2HHU A;  2GOX B;  2EZH A;  3E3V A;  4F4K A;  4YQW A;  3V6K A;  3VDX A;  4EJT A;  2JQ7 A;  3FIS A;  5HDN A;  2DMP A;  1QH9 A;  3ASN H;  3HSF A;  3RRG A;  1G3T A;  3N7S C;  4LZD A;  3C2H A;  2VLA A;  4P2H A;  2L9V A;  4W1U A;  1VTN C;  1S6L A;  5ICG A;  5E3N A;  2FX0 A;  1S9F A;  3LVW A;  1GXQ A;  1SL2 A;  2BPF A;  5CRX A;  5JLX A;  1OQY A;  1APL C;  2MLK A;  4Y2T A;  3DEW A;  5GPC A;  1I50 J;  3CJN A;  5FKL A;  3SXY A;  4QW9 A;  3I71 A;  3V8L A;  1V5E A;  2DQR A;  4I0A A;  3ZQQ A;  2MU2 A;  4LZG A;  5C3E J;  3ETL A;  1LJ9 A;  1TWA J;  2KZ3 A;  4ON0 A;  1ZD3 A;  3F5E A;  3HOX J;  3H36 A;  5FD5 A;  3CCU I;  1XPX A;  2E1E A;  1ZLK A;  2IEK A;  1C20 A;  5AI4 A;  5ALJ A;  3N7R C;  2RV8 A;  4X5V A;  3Q8R B;  4KA4 A;  2RNJ A;  4G7O F;  1MJA A;  2VAN A;  5E3O A;  1X42 A;  1WI3 A;  2W8K A;  1W1W E;  3PUB A;  5DB8 A;  1D3Y A;  3G71 I;  2E8O A;  1DGW Y;  5KFA A;  2WAQ C;  1FY7 A;  4P5O A;  1ZD2 P;  1JT0 A;  1J7K A;  1JTY A;  1QVU A;  2XPV A;  2HR3 A;  5AON A;  3HBL A;  3T8T A;  4ETS A;  3I58 A;  4F93 B;  4WX9 A;  1HDD C;  1ZRF A;  4A3G J;  1SZP A;  3CO7 C;  1TVA A;  3OSF A;  3GZF A;  8ICZ A;  1QPM A;  4ECX A;  3F8M A;  4P4O A;  1PUE E;  4DF4 A;  2HI3 A;  1TNT A;  2KD1 A;  1V9P A;  3S2D J;  2AQF A;  4FHT A;  4YFX F;  1YHQ I;  2GIV A;  2F77 X;  3ZDE A;  4NM1 A;  4JYK A;  2HOF A;  4DFJ A;  3K9T A;  5J6X A;  4NBQ A;  1U48 A;  2EFQ A;  3M4O J;  3FC4 A;  2X6W A;  2EV0 A;  1IIP A;  3HRU A;  5AKL A;  4UUS A;  3Q5F A;  3H0G J;  2E1F A;  3WK6 A;  4YIF A;  3CYM A;  3ZR8 X;  2VN2 A;  2K8A A;  4AID A;  1JUD A;  2DK8 A;  3VCB A;  2NNY A;  3FAH A;  2PEX A;  3LSP A;  2JT1 A;  4B09 A;  2QEX I;  1P4W A;  3S1N J;  2HBL A;  3MDC A;  3VOD A;  3CRX A;  1IN5 A;  3DPT A;  4GRI A;  2HOS A;  4CZC A;  2IJL A;  5CP2 A;  5L3D A;  2P5L C;  4L5E A;  4O3N A;  2DT7 B;  2K9Q A;  1MGT A;  2M4K A;  3PJR A;  5E1W A;  3RB6 A;  2R5Z B;  4ECW A;  4XBF A;  2LTP A;  2AQ0 A;  4JB3 A;  2BE5 F;  3BZ6 A;  3NVZ A;  2BBY A;  1KYW A;  2ZB9 A;  3T5J A;  4EV0 A;  2DT6 A;  2C2R A;  1SKW A;  4PFO A;  2J6U A;  2YU3 A;  5BOL A;  3E6M A;  2CGP A;  9ICQ A;  1KU9 A;  1Q3V A;  1QQ7 A;  5DV5 A;  3N97 B;  3TGN A;  1ZQN A;  4D7M A;  4RPY A;  1D9F A;  2LSO A;  4C8K A;  1IG6 A;  2ISZ A;  2VE8 A;  3NWT A;  2KHM A;  9ICW A;  1EH8 A;  3CES A;  3FXO A;  3HG9 A;  3A01 A;  1BPY A;  1D8L A;  2BOL A;  2KQR A;  3L2C A;  1YZ6 A;  4ZYA A;  1ZQT A;  3C5F A;  1TE2 A;  4WF2 A;  1IAW A;  3WE3 A;  2FPL A;  1R5H A;  1R9T J;  3KZI C;  1T4G A;  4FE3 A;  4RB1 A;  2PXI A;  2F8K A;  1ZQK A;  4IL6 U;  2EDU A;  1TFR A;  1AA7 A;  2DLL A;  4AD9 A;  3CF2 A;  4Q48 A;  4BJT A;  3D1N I;  4BXX J;  3JTH A;  1J75 A;  5EWG A;  2QSG X;  3GV7 B;  2A68 F;  2VBW A;  2JH1 A;  2VQL A;  2BPG A;  4DL5 A;  4LK0 F;  2QA4 I;  3TI0 A;  1SKR A;  4DSI A;  4F5P A;  3K2A A;  1YS6 A;  2JSC A;  2MH2 A;  5AM0 A;  4CCJ A;  1D0X A;  4GGG A;  1KQ8 A;  2PFB A;  3U21 A;  2D3D A;  3ETR A;  3SAH A;  3SD7 A;  2KJ5 A;  9ICE A;  4N9H A;  2OQR A;  4CO8 A;  1EH6 A;  4MIM A;  2WF9 A;  4HF1 A;  1L6N A;  5CA7 A;  9ICO A;  2JZY A;  3JRE A;  1T38 A;  2HS5 A;  3VSK A;  2KVS A;  3MGI A;  1QTM A;  5E79 U;  4MF2 A;  1IXC A;  2ZC2 A;  2WAQ F;  1JUS A;  3EDP A;  2RNG A;  4U0V A;  3HOT A;  2H5X A;  3SAF A;  5KT4 A;  4UB2 A;  9ICJ A;  2KPM A;  4RQ3 A;  4HQM A;  3C2M A;  1OUQ A;  3JPP A;  2NAZ A;  3I4P A;  1L3L A;  2LMD A;  2R8K A;  2QLZ A;  2LBO A;  3RBD A;  2C6Y A;  1FX7 A;  3F9K A;  2PX9 A;  5FO5 A;  1ODD A;  4IEJ A;  2OWO A;  2ELK A;  2E5S A;  5AKZ A;  3OYF A;  1SWW A;  2AGP A;  2D1V A;  3C2L A;  3GZ6 A;  3GTG J;  5B5E U;  1G3S A;  3Q0V A;  4KLJ A;  3QWL A;  4KT5 C;  4E7S A;  2KDZ A;  2FBI A;  4XRM A;  2R7R A;  1NOM A;  5LGT A;  2E2H J;  1U3E M;  2ZUD A;  5AIB A;  2X9D A;  5BNG A;  1NK7 A;  2FLN A;  4P9U A;  5D5V B;  3J7Y J;  3OYK A;  2KN7 A;  4Q8F A;  4L9J A;  2XSD C;  3QUC A;  5J2F A;  2DPI A;  2DOE A;  3ZMS A;  4BDY A;  2P7V B;  1VQ8 I;  3TOB A;  4XOR A;  2BVM A;  2L9S A;  4HYE A;  3G4S I;  2JA8 J;  3I54 A;  5J2G A;  3QPH A;  4NLG A;  1CEZ A;  3OS1 A;  2DA3 A;  2NO5 A;  1S0O A;  3M8J A;  2Q1Z B;  2JEG A;  1LEA A;  4J9Q A;  3RJG A;  2JA7 J;  1N60 A;  2OTL I;  2DOD A;  4ZH4 A;  1IRG A;  4I2F A;  2NOG A;  2F4I A;  3H3U A;  5DCM B;  3V8J A;  5M3F J;  1MQ3 A;  1DPR A;  4IQ4 A;  4QZF A;  4ZTJ A;  1R00 A;  5TZV A;  4RQ7 A;  3ZN1 A;  2DK5 A;  1X9M A;  5DB7 A;  8ICN A;  4ZDO A;  4ED3 A;  2CRX A;  2VA3 A;  2Z99 A;  4XMY A;  1KQ9 A;  1TAQ A;  2W9B B;  1FSE A;  3CP2 A;  1L8O A;  3RIR A;  4S04 A;  2AO9 A;  3OSP A;  3CUQ C;  5E20 A;  4TUP A;  4PGY A;  5J2J A;  2P8T A;  1XSN A;  3K4K A;  4GYG A;  1ZGA A;  3H0L B;  2FUG 2;  4C30 A;  2LDU A;  2XID A;  4EEL A;  2B6G A;  3R61 A;  3RKW A;  3WGI A;  2K3P A;  3EYI A;  2LHT A;  3AL0 C;  1STZ A;  4YG2 A;  4WWC A;  2IRF G;  1J9I A;  4KX5 A;  4TQS A;  3AQF A;  2A5W A;  3TED A;  5AKJ A;  3S16 J;  2PMU A;  9ICL A;  5F27 A;  2OA4 A;  2K3F A;  3WTV C;  4OJP A;  3EZ5 A;  5KFH A;  2WB1 A;  1IRZ A;  5FRM A;  3F2B A;  1I27 A;  2P35 A;  2E19 A;  3DU5 A;  3UMB A;  4RT2 A;  1EJ9 A;  3DCF A;  3C28 A;  4LK1 F;  2M87 A;  3QQA A;  3TDZ C;  1W4M A;  5C44 J;  4B9S A;  4J9S A;  7ICK A;  2OCE A;  3GFM A;  5IYD J;  1XDS A;  4FBU A;  1P2F A;  3OYN A;  3FMR A;  4EYI B;  2FNP A;  3OIQ A;  2ELJ A;  4P4P A;  1MQ2 A;  1HUZ A;  2X6X A;  1W7P B;  3KKA A;  1OMI A;  4RUC A;  2JVH A;  3QOP A;  2IS1 A;  2O6K A;  4P0Q A;  3OJU A;  3M9N B;  1ZQE A;  3W6K B;  4XKB A;  4IC9 A;  2LYA A;  4DF8 A;  2BZF A;  2MBF A;  3ECO A;  5AKY A;  4I2O A;  2Y0S A;  5DLG A;  4HOB A;  4RQ8 A;  3HEF A;  1EKE A;  5IIK A;  5JHU A;  4X0G A;  2CN1 A;  3BG6 A;  1TQM A;  1TWH J;  5F64 A;  1QZY A;  2VI6 A;  1F43 A;  5ALP A;  1EXN A;  5KG6 A;  1A31 A;  1LFP A;  3TQ1 A;  1OFC X;  3HRD D;  2NOJ B;  2R5Z A;  4M2Y A;  2D45 A;  1JN3 A;  3EUK L;  1FJL A;  1GUU A;  3TW7 A;  3QZ8 A;  2IBD A;  2HHS A;  2HQA A;  3ORY A;  3W6V A;  2R92 J;  1OYI A;  4KIS A;  1WGX A;  3PNT A;  1SXE A;  4I99 C;  1VQ9 I;  3UPQ A;  1DRG A;  4IO9 F;  1NHA A;  2FMS A;  5CVV A;  5KFZ A;  3IHQ B;  3N97 A;  1TKD A;  4QJF B;  1YG2 A;  3IRQ A;  1GHC A;  4I29 A;  2CW7 A;  3FDY A;  1E3H A;  8ICU A;  4HV5 A;  2CUJ A;  1PJR A;  2V79 A;  1ZTR A;  3L9F A;  1K1S A;  5J1R A;  4J19 A;  2JPC A;  1WJB A;  2RDJ A;  1BNP A;  2M8G X;  4RZR A;  1FC3 A;  2Y1J A;  4P4M A;  3ZGK A;  4NNJ A;  3CCE I;  5KFT A;  3PW7 A;  3LQQ A;  3NRZ A;  2E1M B;  5DBB A;  5HP4 A;  5L3B A;  3HTU A;  1MSF C;  4ENN A;  3J80 K;  1B6A A;  1SD7 A;  2YN4 A;  1LFU P;  3H8M A;  3IDW A;  4KN4 A;  2F6C A;  1W5S A;  1XMA A;  1MDM B;  1HKS A;  2JRM A;  4Z6F A;  3HYI A;  3V72 A;  4DL2 A;  3RYP A;  1ZOL A;  1Y8Q B;  4PL1 A;  3PSF A;  4UAV A;  1KLN A;  3GIM A;  4FO6 A;  3UMC A;  3RB3 A;  4D0P A;  3WOD F;  2QAR B;  3NVV A;  1RYR A;  3HUG B;  3IV6 A;  3O0F A;  3RQ4 A;  2A6T A;  5AIC A;  1HQC A;  3BZK A;  3OS2 A;  2W11 A;  2D1H A;  4I2D A;  1YYV A;  2JR5 A;  4LFU A;  1CF7 B;  1DGJ A;  2IA0 A;  5JLW A;  3KPH A;  4AWX B;  1SZH A;  4IR1 A;  1F5T A;  1H38 A;  1IN6 A;  4IXA A;  2HPM A;  1IXS B;  1WYG A;  1MC8 A;  3NAU A;  5JHF A;  3T5X A;  2W55 A;  1RC9 A;  1YX5 A;  2E8M A;  5JU5 A;  3ZPL A;  2M9H A;  1NJX A;  3A02 A;  1CGP A;  3H4D A;  1N78 A;  3TFR A;  2W4S A;  7ICR A;  4Y13 A;  1LE8 B;  4ZJZ A;  1TT5 B;  4I2J A;  4I02 A;  1R5G A;  2KZG A;  5EEA A;  4KN7 A;  3A0H C;  1HW2 A;  2UVR A;  2QQ9 A;  2IA6 A;  4JV2 A;  2AXT C;  4O3Q A;  1COO A;  3CME I;  3G1L A;  1TTY A;  1EA3 A;  4RQ5 A;  3E1S A;  3HP6 A;  1I1S A;  3T3F A;  3GTK J;  4I2B A;  1YJN I;  5FGM A;  1KA8 A;  1UPH A;  4QZB A;  3D2S A;  3SEI A;  3LA7 A;  1B72 B;  2BDP A;  4EAT A;  5J0R A;  1PK3 A;  1DDN A;  2KIS A;  2QSH X;  2RQQ A;  2XF7 A;  4JX5 A;  5EEH A;  1VQL I;  4PGQ A;  4RM2 A;  4YVZ A;  3BPX A;  4QWD A;  1SD4 A;  5IIM A;  3PNC A;  1SVO A;  4HLX A;  3B9J A;  1IDY A;  4QZA A;  3GV5 B;  2PFN A;  3KFU F;  2WA0 A;  2M5W A;  1EF4 A;  2G7H A;  3ISD A;  3HPO A;  2YQE A;  2I5U A;  5DCM A;  5BPI A;  2DMQ A;  2ZXH A;  3C1D A;  4MEY F;  5HNF A;  3MZH A;  4DQR A;  4C7Z A;  1DGR M;  3OHB A;  3BT9 A;  4MFD A;  3G2B A;  2FDR A;  4A3C J;  1VF9 A;  4EJO A;  4MFE A;  2ASJ A;  1X2I A;  2FPM A;  4RPZ A;  2QQA A;  3SFZ A;  2WHE A;  1Y1V J;  2JK3 A;  2K60 A;  5ALM A;  5F9L A;  1JRP A;  3R4K A;  4FBT A;  2W9B A;  1BGX T;  3HHH A;  3VEP A;  4ACO A;  1TNS A;  1ZQS A;  4CHU A;  1SD5 A;  3DFG A;  1RNL A;  2F48 A;  4HSR A;  3ZN0 A;  1XCV A;  3Q8K A;  2RRE A;  1KON A;  1S7O A;  2QCO A;  2OM6 A;  1RQL A;  3MDA A;  3JRC A;  2P5K A;  4A3F J;  2IHN A;  5HDK A;  2XC7 A;  3WG7 H;  2ZIX B;  4B9U A;  5G5G A;  3RRH A;  5J29 A;  1FIA A;  2PMZ N;  1R23 A;  3MQ0 A;  1VQK I;  4E7Z A;  4F5O A;  4GDF A;  1WFX A;  3CCS I;  1AKH B;  4EJU A;  3CW2 C;  2LMR A;  3MAB A;  5DTD A;  3DPU A;  1KU2 A;  2HXI A;  4U7C A;  4CUG A;  5JI6 A;  4BUP A;  4CA0 A;  2EAP A;  4NLB A;  4HAI A;  4AP9 A;  4B8X A;  5B1A H;  3OOP A;  2OBP A;  1Z91 A;  4F5Q A;  2W1O A;  1XGN A;  3ZXS A;  1ZQU A;  3RKY A;  3TP3 A;  4PCQ A;  1LKY B;  2LNB A;  3QPT A;  2DOF A;  4ZTF A;  2OYY A;  3HX0 A;  3J7A Y;  4RB0 A;  4E7J A;  3D2Q A;  5B66 C;  1Z00 B;  5AK3 A;  1KBU A;  1MMS A;  2V4Q A;  4EGY A;  3BWG A;  4NUB A;  1NG6 A;  1T56 A;  2EZK A;  4G6T B;  2RQ5 A;  2M8E A;  3SZP A;  4JMU A;  1XDU A;  4BKX A;  3MVP A;  1LB2 A;  2L0K A;  5DG8 A;  4NB5 A;  3JRB A;  2B7E A;  5EDN A;  2KIU A;  3IUO A;  4M6X A;  3AL0 B;  2ZIW A;  3JAM Z;  4A8E A;  3BTL A;  1FMW A;  4DOA A;  2BR0 A;  2WAQ A;  3FXU A;  2GA2 A;  4LB6 B;  1VQM I;  1O4X A;  1N77 A;  3A4C A;  4O6J A;  2G7U A;  1VI0 A;  3B6C A;  3GIL A;  1TAU A;  4RB2 C;  1PVE A;  1RM6 C;  2V9V A;  2AGO A;  4BDP A;  4I28 A;  3T5K A;  2YB4 A;  2W3R A;  4A6D A;  1YRN A;  5KFX A;  4I6Z A;  7ICJ A;  1BOA A;  5KG2 A;  2OV7 A;  3QOD A;  3AKZ A;  1HXD A;  4MFC A;  1ZQC A;  2DQN B;  1U0J A;  5D4S A;  2R93 J;  3BG9 A;  4ECZ A;  2M9N A;  4DSK A;  1YTY A;  3O8G A;  4AYB C;  2ZO4 A;  1GVD A;  5KFQ A;  2AQE A;  4U7B A;  3EPG A;  4OU0 A;  3ED5 A;  4LMY A;  2F2E A;  4ASN A;  5ICF A;  4BEH A;  3LSI A;  5HHH A;  1POG A;  5KFL A;  3VYS B;  2XRO A;  2HZT A;  1X40 A;  2KJ9 A;  2OHF A;  2QUF A;  3AUO A;  2P66 A;  3EUA A;  3FWE A;  3FZV A;  3KP2 A;  1MJB A;  4PJN A;  5AIA A;  4HQE A;  4XQ8 A;  2LP0 A;  4KN7 X;  1QCK A;  1WWX A;  1U2W A;  1RET A;  1OXJ A;  4MQV A;  3RDI A;  5C4J J;  2UUZ A;  3GYH X;  4B9T A;  2DTR A;  2HKO A;  3VC8 A;  4B43 A;  1WJA A;  2F5F A;  3FMS A;  3R0A A;  4G7Z F;  5FP0 A;  4FT8 A;  3R60 A;  3LSM A;  5KFD A;  4FIS A;  4XRH A;  1U4B A;  4CCN A;  1UHM A;  4FE4 A;  3TAQ A;  1L3S A;  2QAR A;  4GIB A;  3OSN A;  4I7H A;  4PH5 A;  3GUD A;  4JBA A;  2XGQ A;  4BY7 J;  3DV8 A;  3RYR A;  3OY9 A;  2MG4 A;  2CYY A;  3D0S A;  5ALX A;  3ZD9 A;  1QSL A;  2R8I A;  2ZJP F;  5KG1 A;  4UAW A;  3GU3 A;  4J9N A;  1CF7 A;  1QQ5 A;  1YE9 A;  2KP6 A;  4RAY A;  5L3E A;  2IS6 A;  4KIT B;  4KMU A;  5DB9 A;  3CLO A;  3BR1 A;  3QAH A;  3KE2 A;  4BJ6 C;  4XLA A;  4G8X A;  5DM6 F;  3SEN A;  4MLO A;  5CQE A;  5AI9 A;  1MW7 A;  5DG9 A;  4DLG A;  1SVM A;  4XLC A;  2V9W A;  1MBE A;  4ZZD A;  3BP8 A;  4HX8 A;  4AIH A;  1NZB A;  3S15 J;  2KSO B;  1UZC A;  5ICE A;  1LE8 A;  5DKW A;  1RUN A;  5ALZ A;  3JPS A;  3SJM A;  5AIP A;  2XV4 S;  2N1R A;  2F5C A;  3THV A;  4HZF A;  3K1R B;  4QPO A;  1OYY A;  3C23 A;  3VYR B;  4ZYH A;  1I5Z A;  1KKX A;  1IRX A;  4CZZ A;  3GLL A;  2M0C A;  3RSN A;  9ICP A;  1FSH A;  2DA5 A;  4EBE A;  3GLX A;  2HVQ A;  2K9S A;  2JEJ A;  1B1B A;  2X48 A;  9ICT A;  5ALO A;  4J9K A;  2V1N A;  3MMY B;  5T14 A;  2XAU A;  1B72 A;  2VT3 A;  3Q9V A;  1MN8 A;  1UG2 A;  3KKA C;  3F2D A;  5DG7 A;  2M2E A;  1REP C;  3QXG A;  3Q8M A;  1NK5 A;  3F53 A;  4KLE A;  2YX7 A;  4HDU A;  1AOY A;  7ICP A;  2QKL B;  2Y0S C;  1SVL A;  1P9Q C;  4F50 A;  2YS9 A;  3OMY A;  5J2A A;  5KFG A;  4M6Y A;  4WCG A;  2ISO A;  5IYC J;  1ZQY A;  3FXJ A;  3K69 A;  4D7N A;  1ZG5 A;  1G2H A;  1D8K A;  1U9O A;  3N4M B;  1JT6 A;  3BJO A;  3I56 I;  1QZE A;  1HJP A;  2VJJ A;  3OPX A;  4AYB F;  5CVI A;  3BQ7 A;  4YR3 A;  3KET A;  1U8R A;  2JH7 A;  2P6R A;  3M8F A;  2MYS A;  4EVI A;  1V3F A;  1R49 A;  4BXU A;  4XUS A;  3PO5 A;  5ALL A;  3M1Y A;  1JKP C;  4IJA A;  2W7O A;  1XGS A;  3RAQ A;  4M9N A;  2FEZ A;  1L7P A;  3V6J A;  3R0J A;  4XL9 A;  2XY5 A;  5B3S H;  3JW4 A;  5E3L A;  2BXY A;  3LSR A;  1DP3 A;  3OGU A;  4DFP A;  4C0Z A;  2QVO A;  4Q47 A;  4QTR A;  1QPI A;  2PJR B;  1E0E A;  1KQQ A;  2BVL A;  2HCF A;  3N05 A;  4ZH4 F;  4QZD A;  3P9K A;  2KIF A;  3TAD A;  4Z6D A;  3HKZ N;  3IWZ A;  2BDU A;  4DFD A;  2ECB A;  1R1T A;  5C5J A;  4WJ3 B;  1ZHF A;  3PFI A;  4H4K C;  1SV4 A;  1QSS A;  4UAT A;  2F4O B;  5KVR A;  3BJA A;  5TIS C;  4K4I A;  3Q0U A;  2E35 A;  2V4J C;  3K2Z A;  3WG9 A;  2DA7 A;  1OCP A;  1OJL A;  1LKY A;  2HDD A;  2B0L A;  3P5J A;  3PW0 A;  5EOZ A;  5IIL A;  1LKX A;  2J5O A;  1Z00 A;  1UMQ A;  1O3R A;  5L1M A;  2CRG A;  3CJQ B;  2FU4 A;  2L9N A;  3KIO A;  4HNV A;  5DGA A;  1J2N A;  2IW5 A;  5DUI A;  5LBQ A;  1IG7 A;  2VC0 A;  1J2X A;  1FIQ A;  3A01 B;  2Y48 A;  1Z3Y A;  1AWC A;  1S8O A;  3GZN B;  4AIJ A;  2IMW P;  7ICH A;  3DKY A;  2I9G A;  3O3K A;  3OL3 A;  3ZMZ A;  4YG2 F;  2ZIV B;  3PZP A;  1SL0 A;  2MFZ A;  3PQJ A;  1A6S A;  4MFF A;  1MBF A;  1OCC H;  5CQG A;  3WHB A;  1M1E B;  2Y9Y A;  1XWL A;  3NGD A;  1Q1V A;  1JXL A;  4ED6 A;  1TW3 A;  2KEY A;  4X1E A;  3A0H U;  3LVV A;  4EM0 B;  4A3K J;  3SYZ A;  4XRS A;  4CGZ A;  3C1Z A;  3GEZ A;  3GDX A;  9ICA A;  1ZQF A;  2DMN A;  3E7L A;  2AXT U;  4UAR A;  4MEX A;  4ELU A;  3UR3 C;  5DBA A;  2JUC A;  3H8W A;  4ED7 A;  2HKX A;  3S1M J;  2IT0 A;  4IQV A;  4NC6 A;  4B3A A;  1OIS A;  4IHY A;  2JXJ A;  3WK8 A;  4I01 A;  2NS0 A;  4BE2 A;  4ESJ A;  4RQ4 A;  1BIA A;  4FX0 A;  4KMU X;  3ZQH A;  4DYC A;  2HOI A;  5TJJ A;  4LG3 A;  3BG3 A;  4CSW A;  3C5G A;  3S1Q J;  4Q5S F;  1VJ5 A;  1WG8 A;  2HOQ A;  9ICS A;  1BR1 A;  4CNQ A;  4BDZ A;  4KLI A;  1URJ A;  3ISC A;  2VT2 A;  1SMT A;  5FD6 A;  5GTH C;  2Y0S F;  2ZJA A;  4O9M A;  4GO1 A;  1XO1 A;  1ZRN A;  1XMX A;  2DKZ A;  5KFV A;  4UW9 A;  5K4L A;  2O6G E;  4CCO A;  3WGG A;  2DQL A;  3KEO A;  4KLM A;  5FJ8 J;  5KFI A;  4B9V A;  3SFI A;  2M3A A;  3QEA Z;  3ZI4 A;  2OAZ A;  5HNK A;  3M07 A;  2HEO A;  5ALQ A;  4F4Z A;  2JTV A;  2M7B A;  2QQ8 A;  2LRE A;  3C18 A;  1BR2 A;  2IGN A;  1AHD P;  4QIW C;  3P7N A;  5E17 F;  3C3W A;  1ZQ1 C;  4OD0 A;  2X6Y A;  3HDD A;  4DL4 A;  5KL8 B;  2DWQ A;  3H3V K;  3F8F A;  2R7Q A;  4H0E A;  1ZG1 A;  2ZME C;  4NHJ A;  5LFA A;  2NVX J;  4EYH B;  3UM9 A;  3BR0 A;  1HCR A;  2JMG A;  3WKD A;  3M8S A;  1ZGJ A;  4R65 A;  2CQQ A;  4KIF A;  4KT6 A;  3UMG A;  4M9L A;  1KDH A;  4LOC A;  1SFE A;  5H2F C;  3CO6 C;  4IPA A;  4PZO A;  4MFA A;  3O8H A;  1JE8 A;  4OIR F;  4XN3 A;  1MH3 A;  3V8K A;  3MFH A;  1SFO J;  7ICO A;  3CZ6 A;  3A2K A;  2DUY A;  2KSO A;  3ONQ A;  5CVJ A;  3L5K A;  2JMW A;  3OWT A;  3B0X A;  3E5X A;  3C2G A;  2NYX A;  1A5J A;  3HC7 A;  1ZAO A;  2Z3Y A;  1LDK B;  2JJ7 A;  4R79 A;  3RZO J;  1LPQ A;  5B66 U;  3EYZ A;  3FKI J;  3PSP A;  4F3Q A;  3M3Y J;  5FKN A;  2YML A;  5DQG A;  3BQ2 A;  2ESE A;  4CRX A;  3AEV A;  2HBJ A;  2W25 A;  4IQT A;  2Z16 A;  1T39 A;  2L4A A;  1G59 A;  1MBH A;  2PN6 A;  2R7F A;  3NRV A;  3OR1 C;  3MZ8 A;  4FS1 A;  3WHC A;  2P0W A;  4DZP A;  2BQU A;  2HZD A;  4IVN A;  2JWT A;  4UB4 A;  1BPZ A;  5FKM A;  2ZSH B;  4LLL A;  4OJO A;  4GXI A;  2ISP A;  5EE3 A;  5IP7 J;  4I2C A;  1WJE A;  3D5S C;  4G9Y A;  4QLC U;  4Q45 A;  2NRV A;  3TL4 X;  2UZK A;  4XRF A;  3RF9 A;  4XK4 A;  4KJZ A;  2K8C B;  1KU7 A;  5D4B A;  9ANT A;  4RS8 A;  4R66 A;  2GOL A;  2EV6 A;  1JJ8 C;  1P7D A;  1KZH A;  4ZDL A;  1H0M A;  5ALH A;  1SKS A;  2MAB A;  1KEJ A;  1B43 A;  3N4M A;  1JUM A;  4Q44 A;  2HVH A;  8ICO A;  4TV7 A;  3RZD J;  1PDN C;  1HBX G;  2W7N A;  3PIO F;  1H89 C;  3H92 A;  3RPU D;  1D1C A;  1IDZ A;  1NZP A;  1RG6 A;  3CQZ J;  3HPH A;  4J9R A;  5EWE A;  4A0Y A;  2BCQ A;  1RDF A;  3PW2 A;  3PFY A;  4L9N A;  3ZQC A;  1MIJ A;  3SEZ A;  4P0Q B;  1J97 A;  2C28 A;  2PLY A;  3S1R J;  2W57 A;  3DBH B;  3GBG A;  2XPW A;  4BE1 A;  2PJR A;  3NTU A;  3ISB A;  4DO9 A;  5D5X B;  2L7M P;  3PY8 A;  3JAM K;  2E34 A;  2AS5 F;  1UT5 A;  4PJM A;  2WY7 Q;  1QQI A;  2VOO A;  2UVV A;  8ICA A;  2E1M C;  2KIQ A;  2ZTE A;  2QLT A;  2OD5 A;  2LI6 A;  5ALN A;  3BCB A;  2BCR A;  2DPU A;  3Q8S B;  2K7L A;  3CDH A;  3HT3 A;  4M9Z A;  5J0X A;  9ICC A;  5EWF A;  4CF3 A;  4QIW F;  2KRC A;  5K7Z A;  1X3W B;  2G09 A;  4BH9 A;  4MGR A;  5BPD A;  2ECC A;  2KLO A;  2K4P A;  1KU3 A;  1MNE A;  2HTJ A;  5LEJ A;  2STT A;  2KJ8 A;  3F0C A;  1ETX A;  2R3S A;  4BY1 J;  5KTQ A;  3CF5 F;  8ICS A;  5L3F A;  3RH6 A;  1V5F A;  1RXV A;  3M1E A;  1MA7 A;  3SR6 A;  1VQ6 I;  3PW5 A;  3J81 j;  2X1E A;  5CPR B;  3I53 A;  2ZIV A;  4BQA A;  2WC2 A;  1RRJ A;  5ALK A;  2BCV A;  5BPC A;  1VQ5 I;  1KTQ A;  1IXR A;  4P55 A;  3DXJ F;  1SMY F;  2WF7 A;  3PNV A;  1B4A A;  1OR7 C;  2WY8 Q;  2KHQ A;  2HHX A;  3NAS A;  2RAE A;  3DKW A;  1V55 H;  1HLV A;  1RXW A;  2GAU A;  2V4R A;  4NQW B;  2K8B B;  3TO6 A;  4B9M A;  1YOV B;  4LIU A;  1L8L A;  4IOA F;  4FCY A;  1GV2 A;  5C4X J;  2Y9U A;  2VA2 A;  3CUO A;  1L7O A;  2DAO A;  5J0W A;  2HPI A;  2J6T A;  1O3T A;  4UV9 A;  2JZB B;  2BYV E;  3BRO A;  3H7I A;  9ICU A;  4BX9 C;  2I10 A;  3HRM A;  3KD3 A;  2ZIU B;  1TK5 A;  2K4B A;  2XAQ A;  1MND A;  1JHH A;  5F0H A;  1ETY A;  5F1J A;  4ENK A;  3NUQ A;  4BS9 A;  2Z2S B;  2EIK H;  3F3X A;  2IBK A;  4HA8 A;  1NKE A;  1KL9 A;  2JSP A;  4CCM A;  1FFU A;  4RT3 A;  8ICI A;  2J6S A;  4LB5 A;  2O5R A;  5E1X A;  4BQQ A;  3KFW X;  3B6A A;  5K5O A;  3WK4 A;  2PFQ A;  3DTE A;  1FFV A;  1U9L A;  3HRT A;  3MAJ A;  1OCT C;  3SI8 A;  2KK0 A;  3S3N A;  1N62 A;  4DCC A;  1S5L C;  2BY1 A;  1MMN A;  2KTQ A;  2HGC A;  2CO5 A;  4EM1 A;  2FOK A;  2OXO A;  8ICC A;  4F2S A;  3OTQ A;  8ICF A;  1NKB A;  2Q0Z X;  1BPB A;  2GA1 A;  1UFM A;  4HDV A;  4NY8 A;  2STW A;  3KCC A;  4AYB A;  2W82 A;  3IL2 A;  1HA8 A;  4C8M A;  3F23 A;  4BWJ A;  2IS2 A;  2X4H A;  3K6G A;  1XTA A;  2FMY A;  4PSW A;  4RDU A;  1UA0 A;  1QSY A;  1O3Q A;  2COM A;  2XB0 X;  1BBY A;  4G94 A;  4C3H J;  2O8K A;  1V97 A;  9ICF A;  3NWS A;  5EJC A;  2G07 A;  5IOY A;  2E3T A;  2IGM A;  3CMY A;  1ZRC A;  3IKV A;  5AKI A;  2ZNY A;  1T95 A;  3E6B A;  1F9N A;  2HOA A;  1K6Y A;  1SAX A;  2F1I A;  4L0Z B;  4OIO F;  2R7Z J;  4UB5 A;  3IN5 A;  3K4M A;  4NM2 A;  1NJY A;  3QYE A;  1QO0 D;  3TAD C;  1R71 A;  4DSE A;  1XSL A;  4G6D A;  3PIP F;  2ZG6 A;  5TIS U;  2UVU A;  4DFM A;  3BS5 A;  1T6S A;  3SZG A;  1K4T A;  1SGG A;  3SMV A;  3V7L A;  1S10 A;  3Q8L A;  3D5L A;  2LK2 A;  1DGS A;  1RPW A;  3HXL A;  2R0Q C;  1JKO C;  3RB4 A;  3NVY A;  3WK7 A;  4XIC A;  3I76 A;  2PI4 A;  5FRO A;  1IUY A;  1IN4 A;  2W84 A;  3H3Z A;  4CXF A;  1JKR C;  3CC2 I;  3AQE A;  3MGH A;  3MR3 A;  2DJI A;  4RLQ A;  4M9J A;  3J7Z I;  2ZME B;  3B02 A;  4A0Z A;  3SQI A;  4QSH A;  3NQO A;  4XOT A;  3E5U A;  4E4H A;  3OOU A;  2MC3 A;  2PMZ A;  1ZRE A;  3DV9 A;  4UQG A;  1GO3 F;  5D4R A;  4UUT A;  4LVS A;  1TZL A;  3DEU A;  1UHU A;  2WV1 A;  1B4F A;  5J4Y A;  5AHX A;  3DBL B;  3BC8 A;  4P1W A;  1Z1V A;  2EIL H;  2QF7 A;  1WCM J;  1SFU A;  3RB0 A;  3GFI A;  4X6A J;  2L9R A;  1JRO A;  4U6P A;  5DEQ A;  3JPN A;  2D6F C;  5HR6 A;  4OMZ A;  2L7K A;  4EMS A;  2QQB A;  1VLB A;  4DL7 A;  2KDO A;  2DDA A;  3GW2 A;  4HST A;  1D5Y A;  2HNH A;  4J03 A;  3BQ1 A;  1JTX A;  2ALZ A;  2A19 A;  3GQC A;  3RCO A;  5IPA A;  1G6N A;  4S0H B;  3OYJ A;  4KIB A;  1TV9 A;  9ICX A;  4M9G A;  2F5V A;  3PVX A;  4R64 A;  3DTI A;  3R6S A;  3WE2 A;  9ICH A;  3GF2 A;  1QZZ A;  3EPI A;  2ID3 A;  1YW7 A;  1FZP B;  1LVA A;  3RAX A;  2QB1 A;  5CHG A;  1LB2 B;  1SAU A;  3U1K A;  4Q8E A;  7ICV A;  4FZM A;  5TRD A;  1VFC A;  8ICX A;  1RQN A;  2FRH A;  1T98 A;  4UUV A;  4Y2X A;  1NK8 A;  5FLX Z;  2G0A A;  2ZIW B;  5FLM J;  5KHD A;  4IR9 A;  1ZN2 A;  1R7J A;  3A03 A;  4II2 A;  4WXD A;  5GTH U;  5KFR A;  3JPO A;  3L2V A;  5BOM A;  2PBI A;  3FM3 A;  5JRT A;  1IC8 A;  3LYS A;  7ICU A;  2E36 A;  3PR5 B;  2H3F A;  4DS4 A;  3T8R A;  1I3Q J;  1VDV A;  2VIX A;  3BR5 A;  1S97 A;  1YRN B;  3ICX A;  3LSJ A;  3E0F A;  4Y2S A;  5KL1 B;  1ZRM A;  3HOU J;  3BTJ A;  5M5W J;  4FFD A;  1MMD A;  2XF6 A;  1P7I A;  3I64 A;  3BR6 A;  5HS8 A;  4UAS A;  2F3N A;  2NVT J;  3PX4 A;  1XN7 A;  3LOC A;  1PK1 A;  1JMS A;  4NXZ A;  4DBR A;  4OJ6 A;  5HVQ C;  1ZQR A;  2BHN A;  1NK2 P;  4BEH B;  2ELH A;  4RNN A;  2EV5 A;  2ZXJ A;  3JPT A;  4ECS A;  1QHH D;  3I4N J;  1X3U A;  1IW7 F;  1Y1W J;  4ZDP A;  1C7Y A;  2VPR A;  1U9N A;  2L7F P;  2D8C A;  1WPK A;  4ED8 A;  2L2O A;  3ESW B;  3JRG A;  1T8E A;  3PX0 A;  5H2F U;  2F5D A;  2DJN A;  3OHA A;  4WXC A;  4KLG A;  2DL0 A;  2R7U A;  3C2B A;  4HBL A;  5ALF A;  1S29 A;  1VQ7 I;  4NC7 A;  3EPZ A;  2FLL A;  4M74 A;  1XS9 A;  2LR8 A;  1V38 A;  1FBQ A;  2LY9 A;  3L4P A;  4B47 A;  2ZXI A;  4PGX A;  3K1P A;  4KX3 A;  3TAP A;  2ZNZ A;  4CE6 A;  3U9G A;  4EX6 A;  5BMZ A;  1DOQ A;  5HS7 A;  4AVZ A;  2IS4 A;  3TAR A;  2L02 A;  2VBY A;  2L7Z A;  2XHK A;  3BCA A;  1P4X A;  2FE3 A;  1Z7L A;  3H5A A;  4K2E A;  4NQW A;  1K7A A;  2Q0O A;  4OOI A;  3K10 A;  2LKY A;  5III A;  2DT5 A;  3IRR A;  1D8B A;  3GWZ A;  2KOB A;  9ICI A;  2JZB A;  4EEF G;  2YSR A;  4OCZ A;  2YMP A;  3EW9 A;  2MAX A;  4IQU A;  4YFK A;  7ICT A;  2XAJ A;  4HX4 A;  4L5I A;  1W36 D;  2RDI A;  4G7H F;  4KLF A;  1S7E A;  4RGX A;  2RQP A;  2ZIU A;  1BNO A;  2CS3 A;  4NL9 A;  4M04 A;  1Z1D A;  2A6H F;  4MTD A;  2E1C A;  3MR6 A;  5DDY A;  2XCA A;  5GAE J;  1Z0X A;  5G5H A;  4QZC A;  5F9N A;  4J9O A;  3NRW A;  5M5X J;  3RJH A;  3KZY A;  1Z67 A;  4QPQ A;  3ASO H;  3E58 A;  4ED0 A;  1TK8 A;  3FXQ A;  2CV0 A;  2VPL A;  1XC5 A;  3M7G A;  3ABM H;  4PGG A;  2XAG A;  4OO1 J;  1FO4 A;  4ECT A;  2NS8 A;  3OYE A;  2JEI A;  3GTQ J;  9ICV A;  4PJJ A;  4MEX F;  3I55 I;  1S0M A;  2A07 F;  5KFY A;  1JI7 A;  4M6V A;  1CUK A;  2YX8 A;  5F0F A;  4EBC A;  2KZM A;  2JPB A;  1DXS A;  4IHW A;  3I0T A;  1YIO A;  4C4T A;  2XCP A;  3WKE A;  4IF4 A;  2DXI A;  2MA1 A;  3CCR I;  1SAN A;  3OYB A;  4U0Y A;  1GDT A;  4KMO B;  3RJK A;  2XIG A;  4DL3 A;  3GTL J;  3T5L A;  2H1L A;  1BI2 A;  4IQW A;  1HSJ A;  4HX7 A;  2LH9 A;  1Z77 A;  3M9O B;  4B9N A;  3DQV C;  2ZTD A;  1Y6I A;  1OCZ H;  4NLC A;  2EFN A;  3DEE A;  1JHF A;  3LA3 A;  1O57 A;  3F72 A;  4QZI A;  3Q3S A;  3LSG A;  4A6E A;  4FS2 A;  4UB6 C;  2QZ8 A;  4UB3 A;  1MJ9 A;  3AM9 A;  1LV5 A;  2WAE A;  2MD5 A;  3QU6 A;  1GXP A;  1FYK A;  3CC7 I;  1ZQP A;  1WWU A;  1ZQA A;  3WU0 A;  3PR4 A;  4ELV A;  3MZY A;  2HU9 A;  7ICQ A;  3WU1 B;  4F4Y A;  4ECY A;  5FLV A;  4EJV A;  5HLG A;  1H9T A;  3LSK A;  4J9L A;  4CCH A;  1Y56 A;  2WWY A;  4C80 A;  3VOE A;  1BJA A;  2EFO A;  2DFI A;  3NEU A;  4BNC A;  2UWM A;  2IOH A;  3G6X A;  2P7C B;  4YN4 A;  3FHN A;  5J47 A;  1Y0U A;  1H88 C;  4RM3 A;  1BA5 A;  4US9 A;  3Q8P B;  3CCM I;  1Z05 A;  5KNI A;  2ZME A;  3L09 A;  3WKC A;  1SL1 A;  4D9J A;  4O5K A;  2EIM H;  1WKM A;  5C0Y A;  7ICI A;  4ANJ A;  2BHY A;  2H09 A;  3MKW B;  1DP7 P;  3TAN A;  2XGP A;  5KFO A;  5LEK A;  3MFI A;  4MTE A;  2GLO A;  4EEN A;  4M71 A;  1U78 A;  1H9G A;  4XR6 A;  4MHG A;  5ICC A;  4YXJ A;  4PDK A;  5EZG A;  2IGK A;  5KAF C;  4IZZ A;  2H27 A;  1O08 A;  1T94 A;  4JV1 A;  3BS7 A;  2Q8K A;  4A5N A;  2QEN A;  1IXR C;  4RAF A;  4XID A;  1QU3 A;  3DWL E;  3P9C A;  4F5R A;  2V6C A;  4HYK A;  1X1P A;  1ZAR A;  3PNY A;  5KT7 A;  2COB A;  4UAU A;  3WTS C;  1FOK A;  1NTC A;  5JUM A;  5A2Q Z;  3K70 D;  2OQG A;  4B44 A;  3FM5 A;  3WTW C;  1BPE A;  1UJ8 A;  2KMD A;  5ALW A;  1WH7 A;  4IHS A;  2RHF A;  1R4M B;  2VQC A;  2X51 A;  1CQT A;  2LVS A;  4I2H A;  5HNH A;  2HTS A;  4L9T A;  2VON A;  8ICW A;  3ABL H;  5KG5 A;  1ITY A;  4ECR A;  2KIW A;  5J0S A;  1ZQG A;  5J8F A;  1NH3 A;  2BKE A;  2L5Y A;  3ZDA A;  1XMK A;  5KNL A;  4RGU A;  5J8C A;  4QZE A;  3SYT A;  1S5L U;  3L7W A;  3WTT C;  2XGX A;  4A3M J;  3QU9 A;  3QX7 A;  3RPQ A;  2PI0 A;  2HXO A;  5DB6 A;  3TW6 A;  2EZX A;  5J40 A;  1GLN A;  2E5Z A;  2WB1 N;  1T3Q A;  4FZL A;  5AKH A;  4Y4R A;  5HML A;  2VOD A;  1S72 I;  1LFB A;  1SFX A;  4C2T A;  2CXY A;  3OYD A;  3WK5 A;  4JUZ A;  1MKM A;  2AHO B;  3IRU A;  5AM4 A;  4I0B A;  4U7D A;  3HL2 A;  2R7T A;  3V6H A;  3E6D A;  3F21 A;  4C8O A;  1LVK A;  1BC7 C;  1NI3 A;  2HYG D;  3OYM A;  1IGN A;  2NVQ J;  3K1M A;  1A6I A;  1ERD A;  4BWM A;  2Z1D A;  3HRS A;  4OAZ A;  1Q8K A;  3MEX A;  2W54 A;  4KNY A;  4C4S A;  2ZUB A;  3E5Q A;  5DQH A;  3P9I A;  3AN1 A;  1TT0 A;  2M34 A;  2NRX A;  5D5W B;  4F4W A;  4KLU A;  1QNT A;  1S3J A;  5DYM A;  4Y3O A;  3JCU C;  2NRW A;  3AG1 H;  2PKE A;  2BZT A;  4V2G A;  1V4R A;  5HOO A;  1YW9 A;  2A5Y B;  1O3S A;  1DK3 A;  5KFC A;  2Q2E A;  5DQI A;  3CD6 I;  2KKV A;  1T0F A;  2LKX A;  4B6J A;  3ABT A;  4ESF A;  1E3P A;  2XKO A;  5KCM A;  2K4H A;  3PL8 A;  3I1Y A;  1WSU A;  8ICY A;  1MSE C;  4I09 A;  2F8L A;  1R36 A;  2L01 A;  5D6E A;  4V19 K;  3AU2 A;  1DQU A;  2R7W A;  2KP7 A;  2KRH A;  1PVR A;  1BR4 A;  1UB9 A;  1ZJM A;  3MKZ A;  3VYU B;  2BCU A;  4U87 A;  2ZXW H;  3HB9 A;  1ENH A;  2H3Q A;  3BQY A;  3TFS A;  9ICR A;  2F76 X;  4ZZL A;  3G73 A;  3JSO A;  2C22 A;  3ERE D;  9ICM A;  5D8K B;  1XO0 A;  4RB3 C;  3OR2 C;  3G1O A;  2V9P A;  2E7W A;  3ISP A;  4F92 B;  2L5Q A;  4ZYG A;  4D1Q A;  3PO2 J;  4TUR A;  3RPU A;  4UBC A;  3KZZ A;  1B9M A;  1WCL A;  2PMZ C;  5ALY A;  2ODG A;  2XSJ C;  3QU4 A;  3TP0 A;  3JPQ A;  3KP3 A;  1TBX A;  1F0M A;  3TQN A;  1S9H A;  3WTY C;  4YP3 A;  3Q0W A;  4EZ9 A;  4MHV A;  4IRK A;  5GP9 A;  1OR7 A;  4UB1 A;  1Z3X A;  4LD5 A;  2K9N A;  3M9A A;  2FOW A;  1JGG A;  3HHG A;  1F1Z A;  4C3I J;  4OIN F;  3VB2 A;  4E7I A;  4ED2 A;  3S32 A;  1XCB A;  5GTI C;  5EE0 A;  2VOP A;  2Y31 A;  3G6V A;  4HNU A;  1IM4 A;  4F4X A;  5GAH J;  3IH3 A;  1W5T A;  1XG1 A;  1ZEL A;  1TAM A;  2W48 A;  2XIC A;  2BY2 A;  1SXD A;  5H6Q A;  3TO9 A;  5JR3 A;  5HOD A;  4PHD A;  4HEA 2;  1X1C A;  1GT0 C;  4EZ6 A;  5J2D A;  2Y9Z A;  3HOW J;  1N5X A;  3GIK A;  2E1N A;  1IN7 A;  2CQN A;  5JVG F;  4JWN A;  3LL7 A;  1WCN A;  3S14 J;  2LG4 A;  2PMH A;  4MNU A;  3JRA A;  2DA6 A;  1SEU A;  1QA6 A;  3KYD B;  4DIQ A;  4LG0 B;  1HC8 A;  4NV0 A;  1VZ0 A;  4C2U A;  2JHD A;  5F1R A;  2DA4 A;  2Y75 A;  5BOX A;  1WI9 A;  3D2N A;  1R5I D;  4FTH A;  3K1Z A;  1J0R A;  2R7X A;  1ZYR F;  3F6O A;  2NRZ A;  1YO5 C;  1RPL A;  4I76 A;  1FYL A;  3F8N A;  4CIC A;  5ALV A;  2KFN A;  2R7D A;  4R1H A;  1X6J A;  3ZDB A;  5IT3 A;  4BAC A;  1DPU A;  1X4P A;  4YIR X;  5DLF A;  3B73 A;  3GFK B;  3K4J A;  4PZJ A;  1QHG A;  1XD7 A;  2Y2Z A;  3H9J A;  4QNL A;  2UXX A;  3E6C C;  2P6S A;  4Y7N J;  2NVU B;  4RU9 A;  1ZQQ A;  1TWF J;  4KLD A;  2OF7 A;  3IKT A;  5AK5 A;  3H0M B;  2CW0 F;  1K61 A;  2HDW A;  1TLH B;  1WWV A;  1RR8 C;  2QKM B;  1T8I A;  4XLH A;  1BIB A;  1XU4 A;  4UVC A;  2VBX A;  3MR5 A;  3FM9 A;  1LEB A;  4KLL A;  4CYD A;  5L9X A;  2DBB A;  1KFS A;  1GV5 A;  2BGC A;  3HSE A;  3BR2 A;  4A5M A;  3DLL F;  3V7K A;  2HHW A;  4DQQ A;  2RLT A;  5KFE A;  2OH2 A;  1T33 A;  2YR2 A;  4OWR B;  2CUE A;  1L0O C;  1FYM A;  2O0Y A;  3KEY A;  3AMZ A;  4QW8 A;  5KFM A;  3BQ0 A;  1XNS A;  4NLZ A;  4LGW A;  5FLX K;  1SFK A;  4P9F A;  3OYI A;  2L4M A;  4RGS A;  2QWW A;  2LF7 A;  4LIV A;  1ZR4 A;  2VJ5 A;  2FD5 A;  3K1N A;  2KG5 A;  4J9P A;  1ZQL A;  3EUH A;  2EZI A;  3LK9 A;  5HLT A;  1YFH A;  1X2M A;  7ICS A;  3K4C A;  3KX2 A;  3A0B C;  4C9Y A;  3KEQ A;  3ZMT A;  1V54 H;  2Y1I A;  3IH4 A;  4R8H A;  3ZMU A;  1X9S A;  5ALS A;  4A3J J;  4C4R A;  4QZH A;  4XNF A;  2K4E A;  3PUF A;  3M9M B;  1JUP A;  5EF6 A;  2K85 A;  1KRP A;  2G0E A;  3E2E A;  1W0U A;  2PMZ F;  1X58 A;  2KHV A;  4NL9 C;  2ICW G;  1KW4 A;  1D9D A;  9ICG A;  5E8I A;  2VL8 A;  4RA2 A;  4HNT A;  4E7L A;  1IV6 A;  4RQN A;  4UAY A;  3KHL A;  1ZQB A;  2XAH A;  1L7M A;  2W03 A;  2W04 A;  3B0Y A;  5KT5 A;  5E3M A;  1XB4 A;  4RMN A;  2XGC A;  2FMQ A;  3L3F X;  4GXJ A;  3AAF A;  2ZFU A;  3KP4 A;  3LNQ A;  3CCV I;  1K78 B;  4Y2Q A;  2IPQ X;  1X6I A;  2W8L A;  1IV8 A;  2XI9 A;  1XC9 A;  4UV8 A;  2LY2 A;  2R4G A;  2A69 F;  4RBO A;  4HAM A;  2ATL A;  1TWG J;  3WKB A;  4PUS A;  1HIW A;  4ITV A;  4E7K A;  2LOO A;  1BM9 A;  3LA2 A;  2B63 J;  4DOC A;  1U5T B;  2KZV A;  1JI8 A;  1O7F A;  2H3Z A;  4CF4 A;  2HMX A;  2W00 A;  1OW5 A;  2AGQ A;  2WAQ N;  2ES6 A;  4YMM A;  5ILV A;  4UB6 U;  1ONV A;  1RR7 A;  4QWC A;  2O61 A;  5DS9 A;  4OAY A;  1SC7 A;  4I98 B;  1IJW C;  1VQ4 I;  3L00 A;  3FIW A;  1A36 A;  1IRF A;  1HOM A;  5CJ9 A;  4Z6Y A;  3UKG A;  2QBY A;  1K79 A;  2LYH A;  5IIN A;  2XB5 A;  2I6X A;  7ICF A;  4JV0 A;  2IAI A;  4UAZ A;  3ONN A;  3RH5 A;  2JEF A;  2YX4 A;  1ZQW A;  3REO A;  1JIH A;  4RLF A;  2MRL A;  2ETH A;  1VND A;  1X1B A;  1U8B A;  4CCL A;  2O3F A;  2CUF A;  2TRT A;  4AC0 A;  3MC1 A;  3LWF A;  4KLO A;  5AM1 A;  2BXZ A;  4RQ0 A;  2HHT A;  4LJX A;  5J4V A;  4KLQ A;  1G3W A;  5FKK A;  1G8X A;  2K86 A;  2FSW A;  4GXO A;  1QVT A;  8ICH A;  2M0N A;  4BGD A;  1UAA A;  2R8G A;  4IS7 A;  3HJE A;  5EZH A;  4E0D A;  5KT3 A;  2EQY A;  2EIJ H;  2FNA A;  1GVJ A;  1Q3U A;  7ICE A;  2OU2 A;  4P0P B;  3QU2 A;  2V1D A;  2PG4 A;  5J2H A;  4DGW B;  3TDU C;  3PSI A;  2P6U A;  5K5Q A;  3DF8 A;  3HSR A;  4MF8 A;  2JV3 A;  4EEY A;  3BOQ A;  1ETW A;  3S93 A;  1HKT A;  5KAF U;  3WTU C;  2OEH A;  4A3B J;  2GM4 A;  1ARO P;  3DDH A;  2HWV A;  2NYV A;  5DDM A;  3VYT B;  4IRD A;  3HKZ C;  4G3I A;  3SV4 A;  5LD2 C;  3KHR A;  1YIJ I;  2GZW A;  2EFW A;  1D8J A;  3LDA A;  4XA5 A;  4YXM A;  5J1U A;  2MW8 A;  3BS5 B;  1IN8 A;  3S2H J;  2YMQ A;  2HHQ A;  1FNN A;  2VKV A;  2EQR A;  1W7P D;  4M0A A;  3PQK A;  1ZD4 A;  4R8U B;  1DUX C;  2NNN A;  5AM5 A;  2ESH A;  1BPX A;  3FBI B;  2Z5U A;  3T0Y A;  2IOF K;  5IT9 Z;  4YFK F;  2DU9 A;  5F3X B;  1I1G A;  3S6J A;  1ETQ A;  1SD6 A;  2KNJ A;  2X1C A;  5ILU A;  3CCY A;  4RQ1 A;  4QWA A;  4GC7 A;  3MWM A;  1WJC A;  5LRS A;  1WQ2 A;  2K89 A;  4EX7 A;  1KSP A;  1HEK A;  2K4I A;  4B3X A;  4US8 A;  2CPR A;  4C7Y A;  4XKW A;  2KRF A;  2Y9T A;  5KFB A;  4ZOH C;  3FXR A;  4LG0 A;  2HQ5 A;  2EAM A;  4UBB A;  4USA A;  2E2I J;  1R58 A;  4IRI A;  1A0P A;  2XAS A;  1IF1 A;  5KT6 A;  2WV0 A;  4UHT A;  1MZB A;  1PUF A;  2F1H A;  2WFA A;  3RTV A;  4NLK A;  2HOE A;  3HIF A;  2LBF B;  1N63 A;  3OS0 A;  5CEH A;  4WXH A;  3DP7 A;  2HYF A;  4O3P A;  3WTZ A;  4JK1 X;  1JXE A;  5AI0 A;  2EJR A;  4PPX A;  2FA5 A;  2F2A B;  2ESN A;  3IM1 A;  1WRJ A;  3MFK A;  2A1A A;  3MGV A;  3W2W A;  2DDB A;  3G6Y A;  2DFF A;  1MH4 A; 
#chains in the Genus database with same CATH homology
 2VQH A;  4P1W A;  3BC8 A;  4ACO A;  4XON A;  4NWI A;  4U6P A;  2D6F C;  2NV3 A;  5HR6 A;  4HRI A;  3LFU A;  2L7K A;  4HSR A;  2RRE A;  1KON A;  2OM6 A;  3OYL A;  2KDO A;  3FKJ A;  4HST A;  2ZIX B;  3K4B A;  2HNH A;  2XC7 A;  3BG7 A;  2VKQ A;  3FBN B;  3CP8 A;  3RCO A;  3OYJ A;  4E7Z A;  1WFX A;  3K4N A;  2F5V A;  3CJR B;  3IG8 A;  3I3L A;  3DPU A;  3DTI A;  3I9V 2;  4U7C A;  4CUG A;  4BUP A;  3ZCO A;  4CA0 A;  4NLB A;  1SAU A;  4FZM A;  4IX7 A;  2W1O A;  3ZXS A;  3M1C A;  1T0F C;  2G0A A;  2ZIW B;  2ZIX A;  1Z19 A;  3H5N A;  5KHD A;  4ZTF A;  4XKV A;  2OYY A;  4XM3 A;  4II2 A;  3J7A Y;  4E7J A;  3D2Q A;  1KBU A;  3L2V A;  4YEJ A;  4LIT A;  4NUB A;  1NG6 A;  3LYS A;  4G6T B;  3OYH A;  2XF5 A;  4JMU A;  2H3F A;  4OJ5 A;  2GOM A;  4BQO A;  4O3M A;  1FMV A;  2VIX A;  3E0J B;  3IUO A;  3ICX A;  3SEQ A;  3E0F A;  3AL0 B;  5KL1 B;  1YT3 A;  2ZIW A;  3IAM 2;  4A8E A;  1FMW A;  1MMD A;  2XF6 A;  5HR7 A;  2WAQ A;  3QYB A;  1WUD A;  3SAG A;  1N77 A;  3W2A A;  3A4C A;  3L2R A;  3HKZ F;  4DBR A;  4OJ6 A;  2VB6 A;  5HVQ C;  3DKX A;  2YB4 A;  1DRG A;  4BEH B;  4BJQ A;  1QHH D;  2R7V A;  2OV7 A;  3QOD A;  4XOP A;  4ZDP A;  3VSL A;  3AKZ A;  4CGZ A;  2DQN B;  1U0J A;  3S3M A;  2CMP A;  2L2O A;  3MKY B;  3OL4 A;  2YB1 A;  4AYB C;  1WJD A;  2AQE A;  2R7U A;  4U7B A;  2VXZ A;  3ZRG A;  4NC7 A;  3EPZ A;  2KIC A;  2VJI A;  2WB1 F;  2KVC A;  4B47 A;  2WAD A;  4BEH A;  2ZXI A;  3LSI A;  4KX3 A;  1BOB A;  3VYS B;  2CFO A;  2M0M A;  2R7S A;  2KJ9 A;  4AVZ A;  2IS4 A;  2VXD A;  3BCA A;  5T14 A;  3EUA A;  3L2Q A;  3H5A A;  1Z7L A;  3OIP A;  4PJN A;  4XLF A;  2LKY A;  4N4O B;  2H3I A;  3K10 A;  4FET A;  4XN0 A;  1D8B A;  2KOB A;  4DJA A;  1PVQ A;  2UUZ A;  3VC8 A;  4B43 A;  1WJA A;  1W36 D;  3IP4 B;  1UG0 A;  2ZIU A;  2XVT A;  3LSM A;  2CS3 A;  4CCK A;  3KYL A;  4CCN A;  1ED1 A;  4DBQ A;  2K5C A;  3NRW A;  1D1A A;  4IQJ A;  4QPQ A;  2HBM A;  4ICA A;  2KL4 A;  4XQF A;  3OY9 A;  2CV0 A;  2VPL A;  3M6K A;  2G06 A;  4OO1 J;  3OYE A;  2LC2 A;  3GU3 A;  4PJJ A;  1YE9 A;  2IGO A;  2KP6 A;  4B48 A;  4E7H A;  4P0P A;  2IS6 A;  4KIT B;  2YX8 A;  2RP5 A;  4BJ6 C;  4XLA A;  4OJL A;  4MLO A;  5CQE A;  1CRX A;  1MW7 A;  3M6Z A;  4PSX A;  4XLC A;  2V9K A;  2CV2 A;  3DLA A;  2MA1 A;  4HG2 A;  2DXI A;  2KV2 A;  1NZB A;  4BQN A;  3ALR A;  3OYB A;  4KMO B;  2BW3 B;  2GOX B;  5TGT A;  2VQG A;  2LH9 A;  3VDX A;  3DQV C;  3LMM A;  1Y6I A;  2N1R A;  4NLC A;  3DEE A;  4QPO A;  3N7S C;  3VYR B;  3C2H A;  3EUH C;  3LSG A;  2VLA A;  1IRX A;  4ZC3 A;  4YRV A;  2WAE A;  3RSN A;  3LVW A;  5CRX A;  2HVQ A;  2BW3 A;  3MD2 A;  2V1N A;  3MMY B;  2CW8 A;  2XAU A;  2MC4 A;  3F2D A;  1V5E A;  2HU9 A;  3ZQQ A;  3H9Q A;  1F44 A;  5FRN A;  3F5E A;  3LSK A;  2E1E A;  1Y56 A;  3F53 A;  4YEL A;  2UV1 A;  2UWM A;  3L2U A;  3N7R C;  2QKL B;  3FHN A;  4II3 A;  1P9Q C;  2VKH A;  2DF4 B;  2Y0S C;  3OMY A;  2LBF A;  3A1Y A;  4RM3 A;  4D9J A;  3PUB A;  4PJL A;  2ZSI B;  4BUG A;  5C0Y A;  1DGW Y;  4ANJ A;  2WAQ C;  3MKW B;  3OPX A;  2VJJ A;  4P5O A;  4AYB F;  2JH7 A;  2KMU A;  4F93 B;  2MYS A;  4XR6 A;  2IGK A;  4IZZ A;  1T94 A;  3GZF A;  4PL2 A;  4J00 A;  2W7O A;  1QU3 A;  3DWL E;  2KKP A;  4XL9 A;  3RFA A;  3PNY A;  2KD1 A;  1WJF A;  2AQF A;  1DP3 A;  4PFP A;  2V6E A;  2F77 X;  4C0Z A;  2HOF A;  1D1B A;  3K70 D;  2PJR B;  1E0E A;  4B44 A;  2X6W A;  1IIP A;  2E1F A;  2BVL A;  2RRD A;  2E60 A;  3DTK A;  3N05 A;  1UEL B;  2RHF A;  3CYM A;  3ZR8 X;  2VQC A;  2X51 A;  2K8A A;  5HNH A;  3VCB A;  4F91 B;  2BDU A;  1X4O A;  4AU7 A;  4WJ3 B;  4H4K C;  2WBM A;  3HOS A;  2HBL A;  2V4J C;  2KIW A;  2Z7J A;  3CRX A;  3SDB A;  3DPT A;  4GRI A;  1LKX A;  4CZC A;  5KNL A;  3SYT A;  3CJQ B;  2DT7 B;  2L9N A;  2G5I B;  3N7P D;  2M4K A;  3PJR A;  1X1A A;  1GLN A;  2E5Z A;  4FZL A;  1PVP A;  1Z3Y A;  4Y4R A;  3DKY A;  4C2T A;  2DT6 A;  2VKD A;  3OL3 A;  4PFO A;  3OYD A;  2ZIV B;  2MFZ A;  3PZP A;  1A6S A;  4JOM A;  1Q3V A;  2JUG A;  5CQG A;  2JVG A;  3HL2 A;  2R7T A;  2KEY A;  1LVK A;  3NWT A;  4BXF A;  2KHM A;  2Q2E B;  3OYM A;  3LVV A;  3F2C A;  3CES A;  3HG9 A;  4BJ5 C;  2JA2 A;  4F55 A;  1ERD A;  2LYB A;  2BOL A;  2KQR A;  2Z1D A;  4OAZ A;  4ZYA A;  3UR3 C;  1TT0 A;  1Z21 A;  4FE3 A;  4Y3O A;  2K9L A;  2X85 A;  4BE2 A;  1J09 A;  3RTR A;  3OYC A;  5HOO A;  1AA7 A;  4CDG A;  4HPQ A;  3CF2 A;  3W2V A;  4BJT A;  2KKV A;  2I8D A;  2IXS A;  2HOI A;  4LG3 A;  4CSW A;  5KCM A;  2JH1 A;  2VQL A;  3PL8 A;  2K4H A;  3CMM A;  4CCJ A;  1D0X A;  4BE0 A;  2F8L A;  2HOQ A;  1BR1 A;  3U21 A;  4BDZ A;  1PVR A;  1DQU A;  2R7W A;  1URJ A;  2KRH A;  3SAH A;  1BR4 A;  2Y0S F;  1MMA A;  2KJ5 A;  3MKZ A;  3VYU B;  4U87 A;  2H3Q A;  1L6N A;  2F76 X;  1X1D A;  3VSK A;  4CCO A;  3OR2 C;  3L2W A;  4F92 B;  1XO0 A;  4D1Q A;  2G08 A;  2L5Q A;  3HOT A;  2WAQ F;  2RNG A;  3SAF A;  2M3A A;  3TMO A;  2KPM A;  2PMZ C;  1OUQ A;  1D0Z A;  2XSJ C;  2M7B A;  2V26 A;  2LRE A;  2LBO A;  1BR2 A;  2IGN A;  1S9H A;  4QIW C;  3F9K A;  4FZN A;  3S3O A;  1ZQ1 C;  2X6Y A;  1Z3X A;  2E5S A;  5KL8 B;  3OYF A;  2WAF A;  2R7Q A;  4E7I A;  1Z1B A;  5LFA A;  3S32 A;  2JMG A;  4HNU A;  4E7S A;  2R7R A;  1ZEL A;  1TAM A;  2XIC A;  4KT6 A;  4NC8 A;  3OYK A;  4HEA 2;  1X1C A;  1W36 C;  4XN3 A;  3H9G A;  3LL7 A;  2DOA A;  3CZ6 A;  4BDY A;  2X1D A;  3A2K A;  3ONQ A;  3PST A;  4XOR A;  2LG4 A;  2BVM A;  2L9S A;  3OWT A;  3C2G A;  4XLE A;  3HC7 A;  3K4L A;  4DIQ A;  1LDK B;  4NV0 A;  3OS1 A;  4R79 A;  1VZ0 A;  3M8J A;  2Q1Z B;  4C2U A;  4F3Q A;  2JHD A;  3PSP A;  3D2N A;  1R6R A;  4N4N B;  3K1Z A;  4XKC A;  2HBJ A;  2R7X A;  2Z16 A;  2GH1 A;  3H0D A;  2K9M A;  1G59 A;  2V7F A;  2F4I A;  4IQ4 A;  3M7D A;  3OR1 C;  4Y33 A;  2LYC A;  5A0L A;  4ZTJ A;  2P0W A;  4BAC A;  1X4P A;  3DPL C;  2HZD A;  2W7P A;  4ZDO A;  2ZSH B;  2CRX A;  2R18 A;  4OJO A;  3K4J A;  3KZX A;  3LSH A;  4DOZ A;  1QHG A;  1WJE A;  3D5S C;  3H9J A;  4XMY A;  4QNL A;  3CP2 A;  3TL4 X;  3RF9 A;  3DU6 A;  3F5A A;  3H0M B;  4KJZ A;  2K8C B;  3HKZ A;  2HDW A;  3K4K A;  2GOL A;  3H0L B;  2FUG 2;  4C30 A;  2XID A;  1P7D A;  2QKM B;  4XLH A;  4ZDL A;  1ECW A;  1NG7 A;  2K3P A;  3VWB A;  3AL0 C;  2MAB A;  2LHT A;  4KX5 A;  3AQF A;  2OH2 A;  2A5W A;  4OWR B;  1XNS A;  2W7N A;  3KEY A;  1V5G A;  3RPU D;  1D1C A;  3S8P A;  4OJP A;  1SFK A;  3HPH A;  2WB1 A;  3OYI A;  5FRM A;  3F2B A;  3PFY A;  3IG5 A;  3DU5 A;  4LIV A;  3SEZ A;  2VJ5 A;  4P0Q B;  3C28 A;  2LY1 A;  4E6K G;  5HLT A;  2H3V A;  3GBG A;  3K4C A;  2PJR A;  4BE1 A;  3OYG A;  2CH0 A;  3KX2 A;  2DGZ A;  2CV1 A;  4C9Y A;  3OYN A;  3OIQ A;  2ELJ A;  4PJM A;  2WY7 Q;  2OUM A;  2E1M C;  2X6X A;  4XNF A;  4F52 A;  2K4E A;  3IAS 2;  2JVH A;  2IS1 A;  2PMZ F;  3BCB A;  4J01 A;  4P0Q A;  2M4G A;  2KHV A;  2VAS A;  4XKB A;  2HVR A;  2LYA A;  4HNT A;  2VL8 A;  4IC9 A;  2A3V A;  4E7L A;  2KRC A;  4QIW F;  2Y0S A;  2G09 A;  2W03 A;  3H5R A;  2W04 A;  2KLO A;  2KJ8 A;  1MNE A;  4X0G A;  2CN1 A;  3BG6 A;  4RMN A;  1LFP A;  3L3F X;  1V5F A;  2NOJ B;  2ZFU A;  3K70 C;  3EUK L;  1MA7 A;  2XI9 A;  2HQA A;  2X1E A;  5CPR B;  2LY2 A;  2R4G A;  2ZIV A;  4KIS A;  3PNT A;  4PUS A;  1HIW A;  4ITV A;  4E7K A;  1N75 A;  2G5H B;  2LOO A;  2Q4T A;  2KZV A;  1OR7 C;  1PYV A;  2WY8 Q;  3PNV A;  2CUZ A;  4BU2 A;  2CW7 A;  3FDY A;  1JI8 A;  2KHQ A;  2H3Z A;  2CUJ A;  1PJR A;  2HMX A;  2W00 A;  3QYF A;  1WJB A;  4NQW B;  2HBK A;  2K8B B;  2OC6 A;  4LIU A;  3ZGK A;  4NNJ A;  4OAY A;  2HPI A;  2E1M B;  4BX9 C;  3TBI A;  3W3C A;  4IKF A;  2F6C A;  2ZIU B;  1MND A;  3ONN A;  3NUQ A;  2DCE A;  4PL1 A;  2MRL A;  3PSF A;  4BS9 A;  2R7O A;  2Z2S B;  3QOE A;  4RLF A;  1X1B A;  4CCL A;  2JSP A;  4CCM A;  3HUG B;  4JQF A;  2O5R A;  4BQQ A;  1G8X A;  1WJ5 A;  3RQ4 A;  2A6T A;  3O0F A;  3DTE A;  2E5N A;  2M0N A;  4BGD A;  3OS2 A;  1UAA A;  3H0R B;  3S3N A;  2MD0 A;  3HPG A;  1Q3U A;  1MMN A;  1SZH A;  1OLT A;  4P0P B;  1X19 A;  2OXO A;  2HPM A;  4DGW B;  3PSI A;  5JHF A;  3OYA A;  1YX5 A;  3V42 A;  4AYB A;  3S93 A;  2W82 A;  1N78 A;  1HA8 A;  4FAS D;  2W4S A;  2IS2 A;  4ZJZ A;  3K6G A;  3VYT B;  3HKZ C;  4PSW A;  5LD2 C;  4CH7 A;  3H35 A;  3UNG C;  3NWS A;  3BLY A;  2VJ4 A;  2G07 A;  2IGM A;  2HVS A;  1T95 A;  3C29 A;  1K6Y A;  4CRX A;  1EA3 A;  3IN5 A;  1MMG A;  3K4M A;  3E1S A;  4QJF B;  3FBI B;  1UPH A;  2XDV A;  3D2S A;  1D0Y A;  3D5R C;  3QYE A;  2KNJ A;  2X1C A;  2WB1 C;  1WJC A;  2K89 A;  4EAT A;  2ZG6 A;  1HEK A;  2K4I A;  5CKT A;  3SZG A;  4B3X A;  3SMV A;  2CPR A;  4XKW A;  2RQQ A;  2XF7 A;  3D5L A;  2JGA A;  3HXL A;  2LRD A;  4RM2 A;  4PK4 A;  1A0P A;  5FRO A;  3T79 A;  3KFU F;  2WA0 A;  3AQE A;  4GFJ A;  2LBF B;  3OS0 A;  2DJI A;  4RLQ A;  3AFH A;  5HNF A;  2ZXH A;  2F2A B;  1YX3 A;  1DGR M;  3SQI A;  4XOT A;  3G2B A;  4E4H A;  3OOU A;  2PMZ A;  4BL0 B;  3MGV A;  3W2W A;  1GO3 F;  1TZL A;  2M7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...