3DEEA

Crystal structure of a putative regulatory protein involved in transcription (ngo1945) from neisseria gonorrhoeae fa 1090 at 2.25 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the first representative of Pfam family PF09836 reveals a two-domain organization and suggests involvement in transcriptional regulation.
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Transcription
molecule keywords Putative regulatory protein
total genus 55
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09836 DUF2063 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3deeA02
1.10.150.690 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3deeA01
3DEEA
chains in the Genus database with same CATH superfamily
1Q1VA 5IILA 3JPPA 4FZLA 3FXKA 2PFQA 3G2BA 4KJZA 1IUFA 3F9KA 4UUTA 2OEHA 1B0XA 1VQ7I 3AQFA 3CNHA 4BHBA 4XUSA 2HBJA 2W8KA 4CSWA 1F9NA 4G8XA 5G5HA 1JMSA 5KG0A 2FD5A 1BI0A 3M9AA 1R5ID 4J9OA 4PJ0U 5BQTA 2BGCA 3DP7A 2K40A 3SFIA 2R7VA 2JZBA 2ADUA 1WCLA 3HGGA 2QB0A 4F92B 5DEQA 1Z3EB 3ZMVA 9ICWA 2XDVA 1VQOI 2Y31A 2K7LA 4CGZA 1YW7A 3FXLA 5AI5A 4RAYA 2IRFG 4Q47A 3BS5B 1NKEA 2GQQA 2F76X 2JGAA 3Q0VA 3ROUA 3G71I 4I6ZA 1PDNC 1QGPA 4J9QA 2KJBA 5HDKA 4Q45A 2Y0SC 4P9FA 5EGOA 2VA3A 5GADJ 4DL6A 9ICAA 2EPFA 5KFRA 4HNVA 5DB6A 4DQPA 7ICJA 4NLNA 3TARA 2Y1JA 1J75A 5L3BA 4RU9A 1DPUA 4BDPA 4Y3OA 5KFXA 5B1AH 2VXZA 2DQNB 3ZP5A 5EE1A 2V1DA 4P0QB 5EEHA 1E3PA 1HQCA 3Q3SA 1JHHA 3RJPA 5ICEA 4GGGA 2WTFA 2A6TA 3P9KA 5ALYA 3X2QH 1SD4A 5DDYA 2RQPA 1A6SA 2JRMA 4RT2A 1N5WA 4ECUA 4LG3A 4OWRB 3RH4A 2DK5A 3FBNB 4NUBA 1COOA 2DA7A 2XVCA 4CO8A 4YIRX 1PVPA 3NEUA 5F0FA 2OZ6A 2NS8A 3L2VA 1LKXA 4XLHA 2B9SA 1RDFA 5GAGJ 1X66A 4QW8A 2W9AA 5AM1A 5D4BA 2EZZA 2Z5UA 2R8KA 4EVIA 2JSPA 3O8HA 1V5GA 3BJAA 4X1EA 2EZXA 3H0LB 1ETVA 1XDUA 2DFIA 3PNCA 4MHGA 4KLQA 2IVMA 1YFHA 5K4LA 2K4PA 3VFZA 1P9QC 2VBXA 4TUSA 2LBFA 4CE6A 5K1YA 1ZQXA 2W57A 1KU7A 4UAUA 4EENA 2VC0A 2FF4A 5D5XB 2F44A 2WF5A 5KNLA 1L7NA 1PP7U 4N4NB 1R58A 3KP2A 5F3XB 9ICXA 3JRHA 2DOEA 3AG2H 3D2QA 5DTDA 3ZMDA 4J9LA 4DFPA 1XMKA 4NLGA 2DLLA 2QQBA 2ESNA 3BJ6A 4BYYA 5L9XA 2OTJI 2ICWG 1LUJB 3BQZA 1KEJA 2G0EA 1UMQA 3K1NA 3DV8A 2ZXJA 4IEJA 1PK1A 5FD5A 5AKJA 4YXMA 3QP5A 2JH7A 2BQUA 3Q9VA 8ICMA 2W3SA 2KIQA 1MSEC 3CLOA 4XKVA 1AU7A 1NKBA 4CDGA 1TNSA 4I2GA 4Y7NJ 2M1BA 4I02A 3NRZA 2B7EA 2NS7A 1EF4A 2FOWA 3FM5A 1OYWA 3A2KA 5DCFA 1WJCA 3SFZA 3OYKA 2H3QA 2VC1A 1QSYA 3MMYB 9ANTA 2MUTA 5B3SH 4NV0A 3HP6A 2KP7A 3S2WA 1UCVA 1FJLA 2KRHA 4ED0A 2X6XA 2CMPA 1D8LA 3V6HA 3GBGA 1S7OA 4CYDA 4II3A 4XOPA 1KFDA 1SB3C 1KKXA 2E60A 2BXZA 1EXNA 3R60A 1TTYA 1U9OA 3GFJA 1JJ8C 2V9WA 3IV5A 2FUG2 1XGNA 4GIBA 1Z19A 2UV1A 4J00A 4MFCA 4YRVA 5EJCA 1VQ6I 4OO1J 4HSTA 4DQ2A 4BS9A 1CF7A 2X48A 3WGGA 1OYIA 1HW5A 2KMUA 5EEAA 2ISOA 4BKXA 4WXDA 3PUBA 1SXDA 4ECQA 5HMMA 2FMSA 2V4QA 4G94A 3GTQJ 3LSKA 4QTRA 1SKWA 3VSKA 2XGPA 3F8NA 2Q2EA 2BY0A 2VJ4A 4KIGA 4G9BA 2R5ZA 1UJ8A 3E5QA 4UY8I 3M1CA 4C8MA 4Y13A 2ID6A 3OSFA 2H6BA 1KU2A 1LE8B 4A2UA 2FMLA 3S3MA 3DF8A 4BQAA 2FE9A 2K9QA 1H88C 4YEJA 4I28A 5HDNA 1TL8A 3VODA 1T39A 4L18B 1GT0C 1MMNA 1URJA 2QARB 3KZXA 4PGHA 1D1CA 1AWCA 2K8CB 5KFSA 3OYFA 3MDCA 2Z1DA 2VN2A 2O03A 3A01B 1V3FA 3CO6C 3WTZA 1G4DA 1OQYA 4M6XA 5GP9A 3OWTA 1CF7B 2GLOA 4FZMA 3UXNA 2BVMA 4CXFA 3HM5A 1TLHB 2DTZA 4OOIA 5M5XJ 2VLAA 2H27A 2JA5J 2AXTU 2H5XA 5M3FJ 4LVSA 3TW7A 5ALQA 3FDSA 2Z3YA 3VYTB 4DIQA 1CUKA 1SVMA 5LBQA 1X19A 2HYFA 3J7AO 4C80A 4MF8A 2IJLA 1UFMA 1LPQA 1UCRA 1T0FC 1HCRA 2HOSA 2CUFA 3PSPA 1H38A 1YX3A 1B4AA 3MABA 1S10A 2HZDA 3K70C 2W43A 2HHTA 4PK4A 3B0XA 2HVHA 3S1MJ 4G6QA 4PJNA 1B43A 8ICWA 2OYYA 5JLXA 4B09A 2L5YA 5DG7A 3CMYA 5AK5A 5D5WB 2KVCA 3BJYA 1XSLA 4V2FA 2XB5A 1IO2A 2RDPA 5KG6A 2X51A 5KFHA 2FQ4A 3BJOA 3IH3A 2X85A 3QP6A 5KG4A 3L4PA 2HHVA 1ETXA 1IRGA 2G5HB 5DQGA 4P4MA 2DWQA 1A5JA 2V7FA 2PMZA 4NL9A 2QB0B 3TFRA 4I29A 1Z4NA 5C4JJ 1IC8A 4LZDA 4YFKF 4C0ZA 3M9OB 2BCQA 1JUPA 5FGMA 4PH5A 4A3DJ 2UZKA 2FMPA 1JGSA 1FIPA 3RYRA 2D1VA 1USSA 3KP5A 1FT9A 3T5KA 2MSNA 2ASLA 2D6FC 1RI7A 2BV6A 3ABTA 1A31A 2C6YA 2H3VA 1JIHA 2IGNA 2A05A 5D6FA 2XGDA 2R7DA 3CCRI 2FMQA 3BPVA 4BXOB 1SAUA 2WA0A 1KFSA 2GOXB 1XMAA 4YQWA 3BQ2A 3K70D 2A6EF 2F5VA 3KHGA 3JAMK 3WK7A 2RN7A 2UUZA 2ZUBA 5K7HA 3ZDEA 4L5JA 4M72A 3FHZA 2G09A 3QU7A 5K7FA 3GDXA 5D8LB 2ATLA 2CQ7A 4AVPA 1VQ4I 3M3YJ 3H9GA 2HOFA 1X4OA 2H3ZA 4HX8A 3QYBA 4YFNF 3LFKA 1CI4A 3ABUA 1ZJNA 1P2FA 4XN3A 3ABKH 3FXJA 3PM1A 5M5WJ 4BWMA 3M8EA 4B9NA 4BE0A 3N7RC 4XONA 3LSMA 2CU7A 2DAOA 5H6QA 3BG5A 2VB6A 2H3FA 4B48A 3SQIA 3IP4B 4ECXA 3OYDA 1RYRA 1MMDA 2K4HA 5K5QA 5KFPA 4F4YA 1RR7A 2KRFA 2WTEA 4CZCA 2KZMA 3NASA 4HDVA 1U49A 2A1JA 3J81K 3I1YA 3KOOA 2ZIVA 3PFIA 3RDIA 4O3NA 1SC7A 5F0HA 4AIHA 3QNMA 5H2FU 4A5NA 1LNWA 3BS7A 1YLFA 1PVEA 3L2CA 3LMMA 5DV5A 1RIOH 4KLHA 2QKLB 3SJMA 4DO9A 3O6BB 1TKDA 4GXIA 1RZTA 3K1MA 4NY8A 4GCVA 4I2BA 2RHFA 4RQ5A 3OPXA 2XAJA 2K27A 2DL0A 5KFJA 2VQHA 3FM9A 3QE9Y 8ICVA 5AKGA 3GTKJ 2E34A 3S3NA 2GA2A 3BTCA 1YW8A 2LI6A 3QUBA 5ALNA 2W00A 1ZELA 3DEWA 4CA0A 5KG7A 4ECZA 1XS9D 3WE2A 2JA6J 3I4MJ 2W82A 4EBDA 4XR6A 1HC8A 3OIOA 1O3TA 2Y9UA 3KCCA 3S14J 4HAIA 3GEZA 1SZHA 8ICOA 1T95A 2V4RA 5KT7A 3WKCA 2HOEA 2QVOA 5L1IA 4NLKA 3JRCA 2E5SA 5KG5A 1WJEA 3CP2A 3AKZA 1EH7A 1F5TA 4F5QA 5FROA 5DBBA 1CEZA 3CUQB 2GM4A 1DRGA 1OPCA 3MKYB 3PVXA 4RAZA 3LFUA 4DW6A 2EINH 5LHIA 1ULYA 2JVGA 5KFLA 3MEXA 5HS8A 1Y39A 1X6IA 4UASA 3TO7A 3V42A 4JBAA 1TFRA 1Q3VA 5GPCA 3RKXA 2EFPA 2NYXA 3BR2A 3SDBA 4KIFA 5CB1A 1TK8A 3OYBA 4BU2A 5BPIA 4PUSA 3SXYA 2JA8J 1J97A 3EPGA 1ZGWA 4BQNA 2AQFA 2OQGA 4KMFA 3HOXJ 3RJHA 3ECOA 2KOBA 4CF4A 3A02A 3M4OJ 3DPUA 2R4GA 3R0JA 4GLXA 2QBYA 4K4IA 4JB3A 2VA8A 4Q4ZF 2FPLA 5HS9A 4IQVA 5F64A 1ECWA 4BJTA 4MFEA 3BLYA 1ZR2A 2HFHA 4IQTA 1TW3A 4DQSA 1BOAA 3BDDA 2WF7A 1R4NB 3RSNA 3E1SA 3MR6A 2GH1A 3LAPA 5TJJA 3SQNA 2OWOA 2OHFA 4IR1A 4HNTA 3D1NI 2GWSA 1UQVA 3WU2U 4LLGF 2KZ3A 3D5RC 3JRDA 5J8YA 3U9GA 4EEFG 3WKBA 4GXJA 1Z7LA 1X2IA 3PL8A 7ICTA 1IN4A 3L7WA 1RUNA 1SVLA 3K7AJ 4MQ9F 3WODF 3EZ5A 1UG0A 1SV0A 1V54H 3BR3A 4BXUA 3D2NA 3JPNA 4JV0A 2VUMJ 1S77D 3PW2A 1D8BA 5FKMA 4A93J 2G5IB 3GZ5A 3CMMA 2WAFA 3KZZA 4RQ2A 1QLNA 2D45A 2KISA 7ICGA 3IWFA 1L8LA 2BVLA 3PSTA 2DW4A 3FF5A 1SZPA 1MJ9A 2IGOA 5KVRA 5LD2C 4M6WA 3C3WA 1PJRA 2G9WA 3FAHA 3PUFA 3CCEI 2KSOB 3H1CA 5KK1A 4PGQA 4PZNA 2ELJA 3LWMA 3TAPA 4Y2JA 2XC7A 5D46A 5HOOA 3FIWA 2XY7A 2O3FA 4AYBC 4G3IA 3GZ6A 3A0BU 3EDPA 4G7OF 3IUOA 3RJFA 2F4OB 4ZYGA 3UQ0A 4C3IJ 3ZD9A 1X58A 3KLNA 3ETLA 5DGBA 2K3FA 4IJAA 2I5UA 3QOPA 1PYVA 1J7KA 2NAZA 2E35A 1VDVA 2DGZA 3ZGKA 3U21A 2YMQA 2DKZA 4JV1A 5IP6A 4B9MA 2XI9A 3JREA 5ALOA 3TL4X 4LK0F 4A69C 4AUXA 2W7NA 1DGJA 1X1BA 4QZHA 4M9GA 2QLTA 4RB0A 2PFNA 4M6WB 2IGMA 2QSHX 3EW9A 2KIMA 4NXZA 1OW5A 3W2VA 1Z4OA 1S72I 8ICBA 1MBJA 2LSOA 1HW2A 5DG9A 1E0EA 3TQ1A 4BWJA 1PVRA 3ZN1A 3SEQA 5J0PA 3UKGA 3ZQ7A 4U7DA 3BCBA 2YB1A 2ASDA 1I50J 2J5OA 4EJOA 5G5GA 2W7PA 1YI2I 2EQYA 2W9CA 2JT1A 2DA4A 5IINA 1MQ2A 2EZYA 5B66U 1SD5A 1KDHA 1D9DA 1FSEA 2A6HF 1TZLA 1ZQOA 2K4IA 2O8KA 1VQMI 4P55A 4G7ZF 4IRIA 3CJTB 2ETHA 2XCAA 1QZZA 2DT5A 1N62A 1IXSB 2B63J 3GLLA 2KVSA 3ZQGA 4BQOA 3KYCB 4M9SA 5LGUA 3IV6A 3QPHA 5TZVA 1TBXA 2CS3A 2D5VA 2Z9OA 8ICGA 2YTUA 1UA1A 5AM2A 2A61A 3ZD8A 5J0OA 3F2BA 1L3SA 1LFBA 4PHAA 1QCKA 1PVQA 2AGQA 2NVYJ 4KLMA 4KLUA 3A0HU 3F0CA 3MKWB 3L2QA 1E3OC 3MKZA 4GO1A 4EJUA 2W03A 5ALSA 8ICLA 2HOIA 3E5UA 2TDXA 4F50A 2V1XA 1OYYA 2ZJQF 5CVJA 1JKRC 3F22A 5KT3A 3BTIA 5FLVA 1OXJA 4Y2QA 1D8YA 3U1KA 3A03A 4Y4RA 4BUGA 2KHQA 3G6VA 4RGUA 1KN5A 5KT4A 1DK3A 3WTWC 2BEOA 3SDGA 3IC7A 4UAVA 1LFPA 1J2XA 2W9BB 3BOQA 2DA3A 4PGYA 3PX4A 2VJIA 3TI0A 4HOBA 1W7PB 4IOCF 3RBEA 2DODA 4EZ6A 3CCJI 1ZQ3P 3FXQA 2FE3A 5DUIA 3KIOA 2VBZA 5HP4A 4IQUA 1QVTA 1Z9CA 4NC7A 4HNUA 1AOYA 4US8A 4KTQA 2VQGA 2W25A 1WI9A 1IRXA 2NOGA 4FISA 4RB2C 1O3RA 3KEOA 4ZTJA 5J8CA 2BZFA 4IZZA 1GLNA 4A3GJ 2HW3A 9ICCA 3G3ZA 2IAIA 2R92J 4IPAA 3EPZA 1HKSA 4NM2A 3HHHA 2HS5A 2HSZA 2KHVA 4QIWF 5E8GA 3E6CC 1LEBA 1U6GA 2Q0ZX 4XLPF 4R8UB 5FKOA 3HOWJ 3RB3A 3SD7A 4DSFA 1L0OC 1ZQQA 3CTAA 2VKQA 3LL7A 5EYRA 1RKWA 7ICPA 1BI2A 1IRFA 2HWVA 3EUHC 1OKRA 2IP2A 2OV7A 4A5MA 4LIUA 4QPQA 2EDUA 3VC8A 3H4BA 1MJBA 3ERED 5L1LA 1ZRMA 1QSSA 3PNVA 3CJRB 2QENA 1B8IB 4OMYA 1HOMA 1K1SA 2Z33A 3RJJA 4BNCA 2CUZA 2A68F 4E7LA 1WZ2A 2O7OA 2KIVA 5J2KA 3ZMZA 4HV5A 5CQEA 1OCCH 1FEXA 4Z2YA 1LFUP 2NOJB 3OTQA 2JMGA 4ACOA 2VQCA 2GIVA 2NNYA 3CD6I 1T3QA 4ZJZA 4KDPA 3IAS2 2BXYA 2YU9J 6PAXA 3T79A 2IHMA 2PMHA 4I7HA 3PIOF 3TAQA 1W5TA 2VKHA 1P7JA 2LM1A 4HYKA 4F52A 1NK3P 1MMGA 3ALRA 3LYSA 1ZJMA 4KLTA 1MZBA 4LG0A 3IKVA 4U0VA 4OINF 5IT3A 3HTSB 3GILA 2O8XA 1MW7A 2F5CA 3D0SA 3VEPA 5ALKA 4ZH4A 3BZ6A 3FMRA 1X9WA 3MWMA 5ALJA 5L3CA 2PG4A 4JX4A 1ETWA 2LRDA 4RBOA 4ZYDA 1DP7P 2EAMA 2RDIA 2ZG6A 4UB8C 4PL2A 5KFDA 1XNSA 1BNPA 3GTJJ 3H0MB 2RP5A 4X5VA 3RB6A 9ICOA 4V2GA 4EJWA 2JEIA 4OMZA 3GO5A 1O08A 5IT9Z 4Y2TA 4RQ7A 2EQRA 2XAFA 1OMIA 2GA1A 3CF2A 5CKTA 3HL2A 2JRZA 1JKPC 1FMVA 1WJAA 1SFEA 3BR5A 3OOUA 2F5DA 1A04A 4ETSA 4TQSA 4DS5A 1O3QA 4A3EJ 1CQTA 2X4HA 8ICCA 3GYHX 1QU3A 1MNMC 4PFOA 5KG1A 3V7KA 4DBQA 7ICEA 4QPOA 1DPRA 4UV9A 3LSTA 4HX4A 5GTIC 5BOLA 5ILVA 3GLXA 1S29A 4A3BJ 2K5CA 3PO3J 3IWZA 2MRLA 3KEYA 3HSRA 4QSHA 3G4SI 3QODA 3BZKA 2QB1A 3SV3A 3QEAZ 4YR2A 5F1RA 1T3NA 1BI1A 2IW5A 4C30A 1T38A 3P5JA 2EAPA 2ZJ8A 3OJUA 1R4MB 2H1LA 2G08A 2V9VA 3DEUA 2HR3A 2KL4A 1VJ5A 1S7EA 3QZ8A 2FNPA 1FP1D 5C3EJ 4YN4A 3LDAA 4I76A 2GXBA 1NH3A 4UB4A 4WK8F 3HOVJ 3V72A 4PDKA 5F1JA 2XRLA 1G3YA 1YT3A 1WHUA 1MGTA 3DKXA 4L0ZB 4LK1F 2W8LA 1ZREA 2CXYA 3PNYA 1Y0NA 8ICSA 4JUZA 4BQQA 3PX6A 1XB4A 2HKXA 2HTJA 4I98B 3I9V2 5FB2A 1TAUA 3OHAA 2E2JJ 4B9UA 1X4PA 2GLEA 3L2UA 5F08A 2PJRA 7ICVA 3N7PD 4A3IJ 2F1JA 3I4PA 3PR5B 2RQQA 2KKVA 3BG3A 2F3NA 2ELHA 5IIOA 1IDZA 4L9NA 3PW5A 3SZGA 1HW1A 1JN3A 3JRIA 8ICJA 1R36A 4C3HJ 3FHNA 2C22A 2ELKA 4PJLA 3BQ7A 3SEZA 3Q8RB 1BR2A 2PBIA 5LGNA 2O6GE 1DGSA 4Q5SF 4DQRA 3I59B 1AROP 3TADC 1KL9A 4C8OA 4O3QA 1XO0A 3HKZF 4ED2A 4RB3C 3RTRA 1I27A 3CESA 3WU1B 4ESBA 2KZVA 3Q0WA 5EEGA 2DPDA 1ZQUA 2JZBB 5HLGA 1S5LC 3VWBA 3QUCA 5CLSA 4MIMA 2BW3A 5FFXA 2HDDA 4QZFA 1NJZA 4BUPA 2L02A 2F8KA 1HIWA 3MKLA 2BCSA 1BA5A 1EV7A 3CYMA 4XLNF 2PFPA 4HZFA 2X6OA 3AEVA 3AM9A 4J9MA 1RXWA 3WK6A 2FJ1A 4II2A 3LWFA 2IA2A 2HPMA 1TV9A 1LV5A 4JK1X 3S15J 4ZYHA 1P4XA 2HU9A 3K2ZA 4LG0B 3VPRA 4GC6A 4DOAA 1ZK8A 4F72A 4ZZDA 4BXXJ 4UBBA 5AIAA 1HDPA 2TRTA 3ZCOA 3CF5F 4KMUA 3CCQI 4NC8A 3DDHA 1X1AA 3CRXA 9ICNA 2F48A 2H6CA 3ZI4A 2MAXA 4QWBA 4I2AA 3KKAA 1LKYB 3GFKB 2DA5A 2YY6A 4BXFA 1EA3A 1VQ5I 1S8OA 3OYNA 4UW9A 5DYMA 3JPOA 5A0LA 2ALZA 3UNGC 2R7UA 1ZYQA 3QPSA 1KQ9A 2RNGA 3HRUA 2BPCA 1GVDA 5AI6A 3M8RA 1ZG1A 3OYAA 1M6YA 2HHWA 2PMZN 4U0WA 5GAEJ 2ZJPF 4FX4A 1U8RA 5IYDJ 3IG5A 2ECBA 2KN7A 5L1JA 3VYRB 2DU9A 4DCCA 4WX9A 3LSIA 2X1CA 3WTXC 2HVIA 3MZ8A 5FLXZ 1TW2A 2LTPA 2XPWA 5JI6A 3UXPA 1IGNA 5J0UA 5IYCJ 2NVXJ 4M74A 1K4SA 3H5AA 3L2WA 4FS2A 3QRFF 1SEUA 3T5HA 1LB2A 2VODA 3KFUF 1C0WA 5GPAA 4R66A 1MBGA 4NNJA 4QWQA 3CCLI 3WKDA 1Q3UA 1VQ8I 1H9TA 4RGXA 3F3XA 4BAYA 3F8MA 2ME6A 2W04A 1TQMA 2DMUA 3EUAA 3TADA 2EJRA 4XRFA 1FYKA 2BGWA 1T2KA 4M3DA 2H94A 5D5VB 4XIDA 1FFVA 1W0TA 4RT3A 2A1JB 1BM9A 2MD0A 2LY9A 1GUUA 3BR1A 4L9VA 2BZTA 5HMLA 3DCFA 2R7OA 1Q1HA 2W9MA 1TT5B 2ECCA 4P2HA 3DBLB 1KQ8A 1IXRA 4OIOF 3AG1H 3AAFA 3KX2A 2DQRA 1BNOA 3LVWA 1FWZA 2XAUA 3HOYJ 2K85A 3LA7A 1AQ6A 2XAGA 2ZMEB 3GV7B 1QHHD 2XVTA 1UA0A 1ZRNA 2BDUA 1XX5A 2YS9A 4ECSA 4DJAA 3S2HJ 1SMTA 1J09A 4L0YB 5IIJA 3EUB2 1UAAA 2FBIA 2IS6A 3VCBA 3RJIA 1QSLA 5KFCA 3PJRA 3JTHA 5DQIA 2DA2A 2KFDA 2UVWA 2R7QA 2P0WA 1ZQWA 4P0PA 1KONA 3V8JA 1MMSA 1HSTA 5FO5A 2QA4I 1ZQNA 1Z05A 2V26A 2VPRA 1B4FA 4Z6DA 2R8HA 1A6QA 1Z91A 2YB4A 3TFSA 2HOAA 3ZMSA 5FRMA 1Q46A 3AG3H 1MIJA 2CJJA 3BR0A 2CQKA 3CUQC 3H0GJ 5J1YA 3GX4X 1DOQA 1U8BA 4IR9A 2XKPA 4NC6A 2ZSHB 5AKZA 3W6VA 2COMA 3FXRA 2VT2A 2EA2A 4HBLA 4JV2A 2E8NA 2AO9A 1WSUA 1I6HJ 4F4XA 5E3LA 3Q8LA 2GOMA 1ZLJA 1HLVA 3KZYA 4P1WA 4A6EA 4YFKA 2IMWP 3KEQA 4F3QA 3WKEA 4Q48A 2CW8A 3RIRA 2YU3A 2ESHA 1XSXA 4ENNA 2WB1C 1X1PA 4TUQA 4IHSA 1V9PA 1G59A 9ICUA 2WB1N 1LDDA 2H8WA 2P5KA 2AXLA 5HODA 3L5KA 1W5CC 3F8FA 3NARA 3QWLA 2ISZA 2UVUA 5AK3A 3K1RB 1WPKA 1Y8RB 4B6JA 3GFMA 1F1ZA 3IRQA 4XN0A 3WG9A 1NTCA 2X6YA 5ICCA 4RUCA 3HOZJ 1BR1A 1ZQFA 1KSPA 2W84A 1WI3A 1D8KA 4A0ZA 4O6JA 1D5YA 4ZDOA 2M4KA 2IOFK 2R18A 2YUSA 1RQNA 1IDYA 5H2FC 1ZD5A 2J6SA 4MEYF 3GW2A 1WUDA 4F71A 4ED7A 2VT3A 4NM1A 5J1RA 1MSWD 1MBHA 2VXDA 2GWRA 2IA1A 2UVRA 1Q8KA 1K5OA 2LF8A 3ZMTA 3I64A 3PQJA 3FK6A 2MSYA 4HV6A 3ZPLA 1ZXIA 1HXDA 4OJLA 3IG8A 4Y2XA 9ICRA 1XU4A 4XL9A 3EYYA 4ABZA 1YQAA 1FX7A 3CP8A 1O3SA 2CW0F 4M9HA 2GIZA 2LK2A 2FBHA 2OBPA 3GF2A 4JX5A 4IHYA 1FIQA 3PV8A 2B6GA 2FLNA 1UHSA 1YYVA 2BW3B 3CMEI 2IGKA 3IM1A 1ZD3A 2CN1A 1YTYA 4DBRA 2M8GX 2V6CA 1Y1WJ 1PZNA 1BPBA 7ICMA 3H5RA 4F93B 2FA5A 2I10A 2L9SA 3I59A 4PZJA 2E1NA 3IL2A 5JVGF 1JXSA 3RB0A 5JVTA 2B21A 2KJ5A 3H8WA 5ALEA 3FXUA 1ZQZA 3WHBA 4I2FA 4MNUA 4E7JA 1QQ7A 1I1GA 1RM6C 4XKWA 5IT9K 1DP3A 2ZUCA 4BX9C 2YSRA 1MNDA 1X1DA 3S1RJ 5C4XJ 5J2FA 2EK5A 2EV5A 3NVYA 4NWIA 4XQ8A 1MA7A 1NK9A 3H3ZA 2ZIXB 1NJYA 2K4EA 2K3PA 4Y15A 4QZDA 3J7ZI 4PJMA 2X1EA 1YJNI 2LLKA 1LKYA 3QU2A 5ALMA 4QZGA 4HX7A 4RPZA 3LNQA 1R1UA 3SYZA 2P7VB 1PUFB 2ZMEC 3Q0UA 1T94A 5K5OA 2ZXWH 3N4MA 4MQVA 1PK3A 2WFAA 5J2DA 3W6JB 3TKYA 4OJ5A 2WADA 5CP2A 3G1OA 5KFVA 3OYJA 4UVCA 3ISDA 2LY2A 2KEYA 3J80Z 2E2IJ 1IRZA 4I2JA 3C2HA 4JX6A 1WRJA 4ENJA 3HOSA 2BQ3A 5B1BH 3GZNB 5KCMA 3GXOA 5E79U 1XSDA 4HLYA 2VKVA 1N60A 4OCZA 1FOYA 3WU2C 5ALVA 3MGHA 3OSPA 1ZQSA 3PO5A 2R5YB 3QEBZ 1LQ1A 4EJTA 3BG6A 3TO6A 5ED4A 2XAQA 3ICXA 2JSCA 4F2SA 4MGRA 3HKZN 2MW8A 1SD6A 5KFEA 1E3HA 4AIDA 4QIWN 2HVQA 5D4RA 2HXOA 4L5IA 2JN6A 2OD5A 3DBHB 2LREA 5FKLA 1UPHA 4EELA 1R5HA 5LEJA 3PY8A 2KTQA 3OSNA 3KKAC 5E1WA 1H0MA 3ONQA 2RVCA 3AFHA 1ONVA 2DBBA 4NBQA 1JXEA 4UAZA 4QW9A 3BQ0A 4ED6A 3ED5A 3RF9A 3CCYA 4YCXA 2DI3A 1ERDA 4Z6YA 3QU3A 2RV8A 2NO4A 2IA0A 4DF4A 4M47A 3FXMA 3H9QA 1P92A 1A6IA 2RC4A 5H20A 3JPTA 2IEKA 3HOUJ 4JQFA 3WK4A 3PQKA 5KT2A 3OY9A 5HLHA 2NRZA 2FQ3A 4EGZA 4RM2A 2KZGA 3S17J 3R6SA 2AHOB 1SL1A 2HVSA 3GV8B 3ZDDA 3CO7C 1RKTA 2QQ8A 2E1CA 2LYCA 5BNGA 4ENMA 2W1OA 2PKEA 3G1MA 3F8CA 5LHHA 1MBKA 8ICHA 1FOKA 1SV0C 4EJVA 4DZPA 5HR7A 5ALIA 5CVIA 3MD2A 3L2RA 1QPMA 3DBRB 3TOBA 1RG6A 2P66A 2W3RA 1ZETA 1NK4A 2QYOA 4ANJA 4CICA 2LD5A 4XBFA 5KFGA 4C8LA 2MFZA 2KG5A 5DD4A 1G3WA 3OYEA 3AN1A 9ICSA 2IPQX 3TQNA 4EMSA 3HRDD 1IIPA 3BQYA 3NRWA 2DFLA 3FKIJ 5BMZA 1QBJA 1UT5A 4MEYA 4RB1A 5ALTA 2OCCH 4RQMA 5AKXA 4BE2A 3MBYA 2YMMA 2JJ7A 4FASD 2VONA 3UXOA 5F9NA 4EM2A 4IKFA 4YP3A 3OIQA 3B73A 2HDCA 1MKMA 1GDTA 5EG0B 9ICLA 2MC3A 2J5PA 4ELTA 2LKXA 1FIAA 2F8LA 4JK1A 2HQNA 8ICIA 1X2MA 1J59A 3E0FA 5AIPA 3IRUA 3WK9A 1K78A 4ECYA 3GIKA 1H9GA 2HHUA 2DFHA 2HGCA 2WAQF 2PJRB 3NS1A 4F4WA 1X9XA 1IXRC 2A69F 1VQKI 1ZRFA 2D8CA 4QZAA 3HB9A 2Y9TA 2E1EA 1G3TA 2F6CA 4KIBA 2QGUA 2WWYA 4YVZA 3CDLA 1EKEA 2JR5A 2JA2A 4KNYA 1KYWA 2IS4A 3Q8QB 2Q0OA 2R3SA 5IP9J 4ZC3A 3TP3A 2EV0A 2KSOA 1VF9A 2IXSA 1S0MA 3CQZJ 1LJ9A 2M0CA 4KT5C 3G73A 5KFKA 4LITA 4XRSA 2A5WA 5DBAA 1ZGAA 4HQMA 2ZJRF 3K0LA 2QKMB 4XSZF 2KKOA 1Z3XA 2XV4S 1TWGJ 4HAMA 2BHNA 1WH7A 1L7OA 1XSNA 9ICFA 4Y52J 3OR2C 1IN8A 4YELA 5FRNA 5B5EU 5KFAA 3K75D 3ZQFA 5CEHA 1BN5A 3PMLA 2KZZA 3ZXSA 1U45A 3KP4A 2CUEA 5AI0A 1D0YA 4ECVA 1ZQJA 4I27A 3ULQB 3V7CA 1I5ZA 2AGPA 1R1TA 3JCUC 3B6CA 4TURA 1MNEA 1RZ4A 5FD6A 2GXGA 3LK9A 4FETA 4AD9A 4AYBA 1ZG5A 2HOTA 3V6JA 1MBFA 1RPWA 3GTMJ 4AP9A 1WCNA 5KAIC 2KKPA 4IX7A 1UHUA 3RH5A 4DSKA 4QNLA 1ZQPA 1N5XA 3F2DA 4J9NA 4KMOB 1FOWA 4XKBA 1AHDP 1D3YA 7ICNA 4PGGA 3P9CA 4D7MA 3WHCA 2OF7A 3EETA 2VBWA 3S93A 2M5WA 3RBDA 2PI5A 1NOMA 3E3VA 3BT9A 2WAEA 1I1SA 1Z6RA 3L1PA 2LMDA 2A5YB 2B0CA 4Y2YA 2EZLA 2P6RA 3SYTA 4DSIA 3MDAA 1KBUA 8ICUA 3OYHA 1Y0UA 2WHEA 4JOMA 3HBLA 4MEXA 2QWWA 1K7AA 4P0QA 2FBKA 3SAHA 5J0SA 2FSWA 2L7KA 2M0MA 1B1BA 1IAWA 1TAQA 2P8TA 3E97A 4UQGA 3ZDBA 1TQIA 1ZARA 2AQ0A 3N97B 2JUCA 4KLLA 1ACIA 4FT8A 5IOZA 2BYVE 4N9IA 1WGXA 3A4CA 3CUQA 4HYEA 3O3KA 3IKTA 4GC7A 1WKMA 1YO5C 1NNLA 2DOAA 4DEZA 5ALLA 1CGPA 4KN7X 2PMUA 1O4XA 2M4GA 4QZIA 5JHUA 3I28A 4MFFA 1ORKA 8ICNA 1NK5A 2GOLA 3AQEA 2V1NA 4KLOA 1FTZA 2CV0A 2PI4A 2O5RA 1BJAA 1ETOA 1N75A 2CGPA 4V19K 2RGVA 4KA4A 3F5EA 5KG3A 1N2XA 2M7AA 3ABLH 5K5RA 3SAGA 1NK8A 3WE3A 2QARA 5T14A 3C1DA 4ECTA 5JFRA 5FLXK 4F5RA 3G6EI 2GBYA 1Z7UA 4ZH4F 4DNCA 1T6SA 3OOPA 3CCSI 5K7ZA 1A76A 2DA1A 3I54A 1X9MA 3QUTA 3SHFA 3QYEA 2W55A 1X3WB 1X6JA 3QU5A 1ZQGA 3KTQA 3HTUA 4DSJA 4F7ZA 2E8OA 1K6YA 3RZDJ 3HSEA 1QZYA 1ITYA 4BDYA 5HNKA 4OIPF 4O5VA 2FJ6A 4B8XA 1F44A 4KLGA 3E5XA 2OAZA 4MEXF 2K8AA 1L3UA 1X1CA 2YQEA 3JW4A 1WCMJ 3EYIA 3KPHA 3UR3C 4YMOA 2KT0A 4FQGA 2LFBA 4KN4A 1NHAA 3GIIA 4ICAA 5KFUA 2K9LA 3ZMUA 1TK0A 2LY1A 2L4MA 2OJED 4HW0A 4YMNA 3KLOA 1FNNA 2DN0A 3ZQCA 4F5NA 1FBQA 3ISCA 2YPRA 3HKZA 3TGNA 4CYCB 4I2IA 5J2HA 1FC3A 1L8OA 4U87A 5AONA 3MZHA 1X40A 2UXXA 4EV0A 4FE3A 1HJPA 1U5TC 2MU2A 4TV7A 1WJ5A 3BR6A 2L9VA 2EAOA 4OJ6A 3MFKA 4NDLA 4HRIA 1NJXA 3BS5A 1DGWY 5DGAA 7ICHA 3NWTA 1ZD2P 1DK2A 2EZHA 3G1LA 1MMAA 4RQ3A 1IXCA 2W4SA 4X0GA 3MAJA 3C28A 4O3RA 2A1AA 4PCQA 2M8EA 1H8AC 3VYUB 1FFUA 1WYGA 2XY5A 4TQRA 2PX9A 4E7HA 2V6EA 3I5UA 4UUSB 2HHSA 3RQ4A 2R5ZB 4FE7A 2JQ7A 1BPXA 4C7YA 1VQLI 2VL8A 1SL0A 3WG7H 2JXJA 4WF2A 4UXNA 4IRGA 2IOHA 4AU7A 5M3MJ 5HNFA 1S9FA 1TK5A 2M7BA 3EUHA 4XORA 2XB0X 3JAMZ 2I5HA 3SAFA 3KYDB 5D4SA 4K4HA 5CJ7A 2XPVA 2I1QA 1JI8A 2HQRA 4UV8A 1XCVA 2EIKH 4RS8A 2LMRA 1IW7F 2O0YA 3H3VK 2QKQA 8ICRA 3MZYA 5ICGA 4CYCA 1Y88A 1WFXA 4W97A 4UVAA 4WWCA 4J9PA 1R22A 3TDZC 4PL1A 4XLEA 1ZG3A 4PFPA 4G12A 4E7ZA 4RAGA 4UAYA 4PHDA 4GXOA 3L9FA 3WTUC 5J2AA 1MJAA 5B5EC 2VOOA 1U4BA 4IS7A 1XD7A 2CG4A 1XN7A 2UXNA 4ZDPA 1YG2A 4DYRA 2JEJA 2P35A 4Y2PA 1G3SA 4B4CA 4UARA 3PO2J 2W9CB 5D6EA 4ITVA 3NQOA 3M8JA 1FMWA 1MSFC 5GTHC 3I71A 3COAC 2CFXA 4XNFA 2DOFA 5ICFA 1RR8C 1JKOC 3JR9A 5GTHU 4B9LA 4AYBN 3GIMA 4IRDA 4KN7A 1SL2A 2O61A 4Q8EA 1STZA 3B0YA 1PUZA 4DGWB 5HHIA 7ICSA 3C2KA 5J0XA 4RUAA 3KZIU 1BR4A 3G6XA 1ETKA 5KFTA 3J7YJ 4NHJA 1ZN2A 1Z0XA 5ALXA 4M0AA 4Q44A 2HVRA 4C8NA 3ASNH 2M30A 1B22A 1ZOLA 3AUOA 4BJQA 1U5TA 2CQQA 3HPGA 4KLSA 3Q8KA 3TW6A 5TISC 2DJIA 5DB8A 1HUOA 2CPRA 9ICPA 2LKSA 1IN6A 3OIPA 4PSWA 1W36D 4K2EA 2HBKA 1UELB 3F72A 4M9ZA 2KK0A 1ZR4A 3E6MA 1S97A 5EF6A 2Y2ZA 1XWLA 2VJ5A 3GMEA 4RNMA 3CJNA 4DSLA 1QQIA 2CH0A 1BJZA 3I0TA 3B6AA 3PW0A 4KLFA 3TOAA 2MUTB 1YZ7A 4IL6U 3IDWA 3E6DA 1YHQI 4LZGA 2EB7A 1Z67A 2E19A 2Y9YA 5CVVA 4S05A 3WTSC 3OJSA 2RREA 2WAQC 2LKYA 3VB2A 1DUXC 4UNOA 4KISA 4O3MA 2EZIA 2WAQN 1ZGJA 1YJ9I 2KFNA 1S8NA 2EV6A 1YIOA 2WB1F 3FISA 2O6KA 1ODDA 2XGEA 2QZ8A 4W1UA 4BGDA 4I2DA 4DOCA 4UBCA 4F8RA 4MF2A 5AIQA 4XA5A 1J0RA 3CJQB 2XGQA 1XG1A 2KLOA 5HDGA 2PXIA 2R7XA 3F5AA 1FBSA 2Y0SA 1ZQDA 4I0BA 4CF5A 3MFHA 2EFWA 4FFDA 2AXTC 1TAMA 9ICTA 4EEYA 3GCMA 2DXIA 4NJ8A 1S6LA 4DOZA 2E2HJ 2K60A 3ONNA 2PMZF 2P4WA 1S7AA 3RTVA 5DDMA 4EEKA 1XGMA 3FMSA 4QZBA 3ML6A 1D1AA 4EZ9A 4ECWA 2R7ZJ 4YD2A 1T56A 2VASA 5C5JA 9ICBA 3PFYA 5FP0A 2WY7Q 1G2HA 1GV2A 3MC1A 1TT0A 3ZOBA 4KFCA 3QPLA 3M9NB 4P0PB 4DLEA 1RPLA 3FXOA 1EH8A 1OR7A 1BPEA 3C29A 9ICIA 4I2OA 2M9NA 1MH3A 2KIUA 3H7IA 1T8EA 2COBA 4HF2A 2HOQA 4CCOA 2CQNA 1AKHA 3W2AA 2JHDA 2E8MA 2PMZC 4UUVA 4NL9C 3RRHA 4MFDA 1SMYF 3N4MB 2NRXA 1OJLA 5EZGA 3H8SA 5LGTA 3I4NJ 2BOLA 1ON1A 1EH6A 5IPAA 2DKXA 3W3CA 3FKJA 5J0RA 2WF6A 5AI8A 4HSRA 2FNAA 3HOTA 3DKWA 1NZPA 5M5YJ 1SAXA 4UB1A 2Y1IA 2M45A 4O9MA 9ICHA 5CWRA 1B6AA 3QZ7A 3C2BA 3DQVC 3QXGA 5KFOA 2K9NA 2KRCA 4OAYA 2ZFUA 3V7SA 2BBYA 3Q5FA 2CRGA 2BY2A 5H6RA 4LLLA 2KP6A 5J40A 1SFUA 5DBCA 3GQCA 5GTIU 4D1QA 1B59A 2XF5A 5EWGA 3G6YA 4AVZA 4EQQA 3HPOA 3S8PA 5B66C 4KX3A 1T08B 2RNJA 5LHGA 1IG7A 1D0ZA 3BQTA 5KFBA 2RDJA 3GFLA 4IF4A 2F5EA 1XC9A 3V8KA 4I2HA 3K4GA 3PW7A 1DDNA 2E7XA 1K78B 2ZIWB 3E58A 5L3FA 1LVAA 5JTIA 3CCMI 1GVJA 1FYLA 5TRDA 3M7GA 3V7LA 5ALPA 2VQLA 3GVAA 2EFQA 1HKTA 2KIWA 3PMNA 1XMXA 2Q4TA 1L3VA 2VPLA 2V4JC 1U78A 2Q8KA 2Y69H 5CVRA 1QPIA 4J03A 5J0QA 4WXHA 3RQIA 3S1NJ 1IN7A 4U6PA 2XIDA 4L5EA 1ZD4A 2R93J 3KD3A 2EIMH 3HRSA 4RNOA 3TO9A 2EFOA 3TP0A 3WGHA 4EM0B 4A3LJ 1SFXA 2FXAA 5AKLA 5AKYA 1GXQA 4GRIA 3C5FA 3MVPA 4IHXA 8ICQA 1W7PA 3LVVA 1W5SA 8ICEA 4Q8FA 3Q8PB 4KMUX 2Q1ZB 1WJBA 3I55I 4RGRA 4B3AA 4L9JA 2RAEA 2Y0SF 1ZQTA 2DFEA 3OV8A 4A3JJ 1VQNI 2YMLA 1ZLKA 5DB7A 4WXCA 4QWDA 3DPLC 3ESWB 1OCRH 2HPIA 2KPMA 1L3LA 1FBUA 5HLIA 3C23A 2C2DA 3TKAA 2OXOA 3F2CA 1MH4A 2MH2A 2HKOA 2VKDA 3IH4A 5ERIA 2ZIWA 2CQXA 1NG6A 3GTLJ 2VJJA 5ILSA 1IM4A 3AU2A 1RC9A 4FCYA 1JT0A 4R65A 2XUBA 1YE9A 5F27A 4IVNA 4QLCU 7ICRA 3V4GA 2F77X 1X3ZB 4ELUA 3ABMH 4M2YA 2CSOA 3L3FX 1FOXA 5J3LA 2XPUA 2AHQA 1ZTRA 4R64A 3HRMA 2RKHA 3PSFA 4O3OA 5KL8B 5DS9A 5EZHA 2WC2A 3T8TA 2AH5A 5ALFA 4JP0A 4DQQA 4EX7A 1VI0A 1JXLA 3ASOH 4F3OA 3KBBA 2D2WA 2NVUB 3CC4I 1JI7A 3KP7A 1UB9A 1U9NA 3LSPA 4BEHA 3F6OA 3D5SC 2G7UA 1BI3A 4M3EA 5E1XA 2P6UA 1K83J 1U2WA 4PZOA 4JWMA 7ICIA 1OISA 2VKEA 3KP3A 1USTA 2QSGX 4BXOA 1ZQIA 2KMDA 4CZZA 5J8FA 3HZJA 1T7PA 2MLKA 1EJ9A 3M6ZA 7ICKA 2DPUA 4DFDA 5J2BA 5DCMB 3T5XA 2HYGD 3TMOA 2ZBKA 3LQQA 1V97A 3U26A 2I9GA 4AM3A 4X6AJ 4IRCA 5IP7J 1WWVA 2C2RA 1FP2A 4XMYA 1BBYA 3K69A 3P9IA 4XRMA 1YITI 2L2OA 1H89C 1JROA 1ON2A 2G07A 1NKCA 4QWEA 1U3EM 3H8MA 3R0AA 4KX5A 4CNQA 4DYCA 4XRHA 4B44A 2L3DA 4HPQA 1YS6A 5C44J 4DSEA 5EE9A 5LEKA 1DQUA 1IUYA 3C21A 3NWSA 2WV1A 5DKWA 4O5KA 4XLFA 4RDUA 2E36A 4HF1A 5EDNA 4M3FA 1P7IA 4C7ZA 1JE8A 3I58A 2M3AA 2FPMA 3GFIA 2L0KA 1SANA 3S32A 1QH9A 3VOEA 4F4KA 5F04A 4D0PA 2KQRA 1J2MA 4UB6U 3RFAA 2ACJA 2L9NA 4XRSG 1UHMA 3FX3A 2V1UA 4RQNA 4RGSA 1LDJA 1YS7A 1ED1A 5ALZA 3MR5A 2DPIA 3IHQB 3N05A 3CDIA 1N48A 3I3LA 5J47A 3HSFA 5LLQA 5BOXA 2O9LA 5EWFA 2K86A 2K4JA 2H1KA 5FKNA 4KLIA 4DFJA 1OR7C 2ZTDA 2JEFA 3H9JA 1SVOA 3C18A 3CLQA 4QZ8A 1P4WA 5KNIA 3RAQA 3BDPA 1Y1VJ 4GFBA 2W7OA 1B8IA 1K6OA 3WK5A 3KZIC 2R8JA 2XROA 5E17F 4WJ3B 4IHTA 4OAZA 3K1ZA 4I09A 3EYZA 1SD7A 1T98A 3Q8MA 1QRYA 8ICXA 2JRTA 1QA6A 1Z77A 4B1RA 2E1MB 2KHMA 2V9KA 4CCKA 4UB8U 5ALRA 4NQWB 3S3OA 3S6JA 2JA7J 3K4JA 1AKHB 2R7SA 2FEZA 4EATA 2BY1A 2WAQA 4O3PA 3K1PA 2KDOA 4B43A 3FWEA 3GTOJ 1KGSA 3H35A 2OM6A 2BCVA 4IQWA 2X1DA 5A2QZ 4GXKA 2DDAA 5IY5H 2EILH 3DFGA 2JPCA 1YX5A 2ZXHA 4NLCA 2IHNA 1PUFA 5J8YC 5L1KA 2MYSA 1P7DA 2NRVA 2ME0A 3PO4A 1IN5A 2LG4A 1M1EB 1T4GA 2NRTA 3PW4A 2LBFB 3SZPA 2OQRA 2R7FA 2ZO4A 2P5LC 4GDFA 1RETA 2X0LA 5AICA 2ZMEA 3B02A 4E70A 1A35A 2OH2A 1XO1A 5KHDA 3ZN0A 3VDXA 3F8BA 2ZXIA 3LA3A 1SGGA 2HMXA 4RQ8A 4QZEA 3MR3A 3JTGA 2CYYA 3M7DA 2K9SA 2YR2A 4LJZF 4RLQA 3CW2C 4A3MJ 3OS2A 2ZJAA 2M2EA 2ZNYA 5E18F 9ICKA 1U48A 4Y17A 4RPXA 1JTXA 4B47A 4HF0A 1D8JA 1Z00A 1D1BA 3M1YA 3OYGA 1SXEA 4RPYA 2TCTA 2EH9A 2ESEA 2FLLA 4KLDA 4BJ5C 3N97A 1WG8A 2PFBA 3HGYA 3M07A 2W85A 1UT8A 1XCBA 1XTAA 4IHWA 4BE1A 1J2NA 2OTLI 2ZTCA 3FDYA 1QQ6A 1X42A 3F23A 1N63A 2R7RA 4U7BA 5AM5A 3L00A 3BTJA 2HTSA 3RCOA 2P7CB 3SV4A 3BZCA 3HDDA 2OU2A 3AL0B 1QTMA 2MC4A 3RJGA 4M9JA 4JMUA 1S9HA 5J2CA 5LRSA 1BIBA 3GTGJ 1JTYA 1E17A 4ED8A 3P7NA 2LHTA 2XKOA 3S2DJ 3LSHA 2E1FA 4F5OA 1ZHFA 2P5VA 2ZC2A 2BHZA 4ZZLA 5L3DA 3HT3A 2STTA 5ALHA 3AU6A 2K8BB 1G6NA 4C4TA 1MN8A 3MGIA 5JLWA 5EE0A 3ZDAA 1TWFJ 2C2EA 2IT0A 3VSLA 1ZKGA 2LOOA 4M6VA 3OL3A 4BDZA 3ZQLA 4YIFA 1XPXA 1A36A 3T0YA 2A3VA 3HILA 2C28A 2BPFA 3KETA 3SZTA 3BP8A 4RLFA 4QWAA 1Z1BA 1DXSA 1C7YA 4LFUA 1U9LA 1E2XA 4H0EA 1OCTC 1BPZA 1K61A 5J6XA 1HF0A 1TE2A 5KFQA 1WVRA 3UMBA 2I8DA 3AMZA 5IIKA 2K02A 3R61A 1KW4A 4YG2A 4LB6B 1R1VA 3JSPA 2LNBA 4LD5A 9ICVA 2M9HA 3QPTA 5TGTA 1UG2A 1K1QA 4UHTA 2J6TA 3H4DA 5EE3A 1HDDC 5KFFA 4DQIA 1JHFA 3M6KA 1COKA 4J9KA 3C2LA 4C4RA 1JT6A 1RYUA 1N56A 4E7IA 3ZR8X 3RPUA 2E5ZA 1YIJI 3O8GA 4Y2RA 1XGSA 2KNJA 1FO4A 5EWEA 2QCOA 2L4AA 3NTUA 5KFWA 3C5GA 2EBIA 2XSDC 4DYQA 1C20A 8ICPA 2LP0A 4ZYAA 2MBFA 3K6GA 3I56I 1F0MA 3RKYA 4PHEA 1HEKA 2PQ8A 2MD5A 3EUKL 4C2MJ 2GAUA 2BE5F 5AI4A 4DL2A 2HCFA 4XICA 3LWLA 4IQJA 1JUDA 1RESA 1D5VA 4UB3A 4LIVA 3TANA 2ID3A 4S04A 1DU6A 1S5LU 2R7WA 2F1HA 2DMPA 3RRGA 4R8UA 4RMNA 4CRXA 3HJEA 1FSHA 2DBYA 2HQAA 1OCZH 1ZRDA 1NK0A 3LSRA 1HUZA 2AJQA 4UUSA 1N77A 2CV2A 4AC0A 4A8EA 4R8HA 4B9VA 3KE2A 3HC7A 3LSGA 4KICA 2EZKA 4RZRA 3GV5B 4DS4A 3K4LA 1I39A 4B9TA 2OUMA 3K4BA 5CA7A 2KFZA 3HIFA 3S16J 4A12A 5E3MA 2KIFA 4BEHB 4P4PA 4UAWA 3RPUD 5FLMJ 3NVWA 4OJPA 7ICQA 4XSXF 1LB2B 2J6UA 3T5JA 3FYHA 4M04A 1BPDA 1X9SA 1I6XA 3A0HC 4XOTA 1KU3A 4MLOA 1FYMA 4O3SA 5DD8A 3CCUI 3JRBA 2ODGA 3H5NA 4GFJA 3T5LA 2EWNA 4A3KJ 2NNNA 5LFAA 4DL5A 4EYHB 3BC8A 2KICA 3J81j 1XSVA 1Z3YA 3NVZA 3A0BC 4KUMA 3HRTA 5ALDA 4E0DA 2LKPA 2ZIUB 1TP4A 4CCLA 2XF6A 3B9JA 9ICMA 2CFOA 3GTPJ 1F4KA 2STWA 2IBDA 1GHCA 3OSGA 1ZQEA 3K4KA 1N78A 1Z21A 2PLYA 4ON0A 3ERMA 1QHGA 5KG2A 4J9SA 3D2SA 1Y6IA 5J0YA 4E7SA 4GYIA 1VNDA 2R0QC 4RM3A 2L7ZA 5TISU 3AL0C 4ELVA 2QQAA 4N4OB 2XRNA 4E6KG 1B9NA 1R23A 4GYGA 2NO5A 1L6NA 1HSJA 3H36A 1I3QJ 3H0DA 5AM0A 3IAM2 4D7NA 4US9A 3WGIA 1V55H 2HZTA 3NGDA 2FOKA 3PIPF 2HYJA 4NQWA 5E1ZB 2MA1A 3H0RB 1OUQA 8ICAA 4IL6C 4IXAA 4LB5A 2YN4A 1OFCX 3IN5A 3PZPA 3A1YA 9ICGA 5KAIU 3C1ZA 1NK7A 5KT6A 1X2NA 3DTEA 5KFZA 2W54A 3C2GA 3NUQA 4IRKA 3BTLA 2ZSIB 2QEXI 1U0JA 2CWEA 3MCZA 1I3AA 2VE9A 1RRJA 1R7JA 3GWZA 2HEOA 4OJOA 3WKAA 3HW8A 3V6KA 1S0OA 4I99C 1ZQHA 5J4YA 2ISYA 1V38A 4DFMA 2DTRA 4KYWA 2VA2A 3DEEA 4UB5A 2R7TA 4R79A 5J29A 1YOVB 2VOPA 3SMVA 2BY3A 2EANA 4KT6A 2XIGA 1ETQA 2FPKA 3LAJA 2L9RA 5DM7F 3UM9A 5A2QK 2DDBA 4IRHA 1NZBA 8ICFA 1KQQA 9ICQA 2IA6A 3CDHA 5CJ9A 2YX7A 2AU0A 2AQEA 1WWUA 3RR7A 3MN2A 1FY7A 2XGCA 4CCNA 2MA3A 1VZ0A 1YRNB 1OCPA 1TWAJ 4FX0A 4XQFA 4G9YA 2NV3A 5F0CA 3BCAA 4EM1A 2VIXA 5DDGA 3HKZC 4USAA 5KL1B 4YIIA 5CVUA 3R9KA 1JUMA 3DU6A 3OL4A 4IO9F 4NLBA 1L3TA 4C3JJ 3RI4A 2GZWA 2CW7A 3CMAI 3JPSA 5AKEA 4RQ1A 1N25A 1RUOA 4FHTA 3K4NA 2DT7B 4IQ4A 3TEDA 1JX4A 3UQ2A 2JMWA 4FO6A 1B72B 3JRFA 1REPC 2LR8A 1WWXA 1T8IA 2LBOA 3TDUC 2KJ8A 3KHHA 3M8FA 1O7FA 3V7RA 1U47A 1RYSA 1WJFA 3ISPA 5JHFA 4KITB 3IH2A 1JUSA 1YRNA 5ALGA 9ICEA 4O5EA 1TWCJ 5AIBA 2PFOA 4C8KA 4UVBA 2E1OA 2B0LA 2QM3A 3DPTA 3HHGA 1SKRA 1AA7A 5DG8A 1ZQKA 5IYBJ 1KU9A 2DYRH 2F4IA 4CH7A 4YR3A 7ICLA 3HEFA 3O2PE 4C9YA 5HVQC 3V8LA 2Y30A 4J9RA 4BY1J 2X9DA 3SEIA 4I2EA 2BKEA 1KA8A 2DQLA 1LE8A 2PJPA 2D3DA 3KHLA 2JV3A 1IF1A 2Y48A 3RPQA 1B72A 2XASA 3MQ0A 4EBEA 1HKQA 5BPDA 1R9TJ 1V4RA 3OMYA 5J4VA 1FEZA 3H40A 4DFKA 2Y0SN 4RA2A 2OPTA 2DF4B 5D5UB 4IC9A 3GUDA 4K4GA 4S0HB 3ELKA 3WTTC 1R5GA 4I01A 4UB2A 4M9NA 2UWMA 1NJWA 4JWNA 2G06A 4O5CA 1Z6TA 4C2TA 2LPEA 1KYZA 1MD0A 2A19A 4HEA2 3FC4A 1P4AA 2BDPA 5E3NA 3RKWA 1OCOH 2JK3A 3U2RA 4YFXF 5J1UA 2GO7A 5ALUA 2HDWA 3MGVA 3M1EA 3ISBA 4RNNA 2ES6A 1MDMB 1V5EA 2MABA 2K9MA 2E71A 3RAXA 3NAUA 1QZEA 4G6DA 2R8GA 4ESFA 5DUKA 5KAFU 2LYHA 2DYSH 4ECRA 7ICFA 4XM3A 1XS9A 4RAFA 2F2EA 4RQ6A 2JPBA 1BC8C 1JRPA 1UZCA 4JYKA 4FS1A 4EYIB 1Z1DA 3WU0A 1BPYA 8ICYA 4WCGA 3THVA 3DKYA 4M9XA 2DFFA 4B3XA 4LLNA 1YW9A 4DWIA 5KFNA 1BIAA 1L7MA 4C4SA 3QAHA 2HHXA 1R71A 2Z2SB 4J01A 3JPRA 4LOCA 3BROA 1T0FA 2H8RA 4AYBF 1TVAA 4PPXA 3WK8A 1X3UA 5BOMA 2P81A 2AGOA 1W4MA 4Y2VA 5E8IA 1PP8F 2FLPA 4P96A 2HXIA 2EFNA 2Y75A 3WTYC 1QO0D 3KFWX 1F43A 1QVUA 4NLZA 2JTVA 1V85A 1KRPA 4A3FJ 1V5FA 1Y56A 2LYBA 5KT5A 5C0YA 1NK2P 1KTQA 4Y2SA 3OYCA 2F4MB 4BL0B 3TBIA 2XF7A 1ZYRF 2JUGA 2PN6A 1APLC 4AIJA 2BCRA 3K10A 3RJKA 3HWTA 4N9HA 3A01A 1HA8A 4G7HF 5DLFA 1KZHA 2Q2EB 3MFIA 3QU9A 4ZTFA 2VE8A 2ZCWA 1NI3A 2KE7A 4O0IA 2LC2A 3GZFA 3KP6A 2YMPA 1O57A 1BW6A 2FRHA 4OIRF 4OU0A 4CCMA 4A0YA 1Y8QB 2DMTA 2W9BA 5JU5A 1BW5A 2ZKZA 2HI3A 4MHVA 1KLNA 1D9FA 2CV1A 2EA4A 3JRAA 1XDSA 1O7LA 2VBYA 4M9LA 1SWVA 4BBSJ 3RR8A 3VYSB 3QYPA 1O03A 5FFZA 1IJWC 5L3GA 3H3UA 4Y2UA 1VQPI 1MC8A 5GAHJ 1K79A 3SENA 3IHUA 2XSJC 1BOBA 3OYMA 3N28A 4BBRJ 4DL7A 4QZ9A 3RB4A 2ZIVB 3RKQA 1FTTA 3ZQIA 2WB1A 1KQ0A 2G7HA 2IS2A 2ZTEA 2DT6A 3NRVA 4CHUA 2ZIUA 4DOBA 1W1WE 1RXVA 4ED3A 4B9SA 3JSOA 3LSJA 1SFKA 2L01A 2M87A 4UATA 2CO5A 1JALA 3NVVA 5J2GA 4PJJA 1Z1VA 1NG7A 2FX0A 2DK8A 5CQGA 2WY8Q 4CUGA 1LVHA 5E3OA 1ZQVA 2M0NA 4YR0A 3OGUA 3T8RA 2XY6A 1L5UA 5CRXA 2DMQA 3JRGA 2JVHA 2ZUDA 4YXJA 5D49A 1POGA 5EGOB 4HLXA 2R8IA 3L09A 5L1MA 3T3FA 1CRXA 3RYPA 2CUJA 2UVVA 1K4TA 1KFTA 4OD0A 3ZRGA 3WTVC 2FI1A 5IIIA 3MR2A 2BPGA 1RNLA 2HBMA 3W6KB 3ORYA 2E7WA 3HG9A 4Z6EA 4ASNA 1W36C 1R00A 1PK1B 2DUYA 4Z6FA 1XSPA 2PEXA 4M71A 2K89A 2JWTA 1ZRCA 3SZ2A 5D8KB 3OS1A 4N0BA 3OR1C 4BHPA 1VQ9I 2XGXA 2BHYA 4BHCA 3I53A 2LF7A 4KLJA 2NRAC 2ISPA 5DCMA 1ZAOA 4M6YA 1GO3F 1P6RA 2H09A 2MGQA 3K4CA 3U1DA 4F2RA 2R5YA 2EIJH 5HNHA 3SR6A 1BC7C 4F5PA 2XC9A 5AKIA 1S3JA 3CZ6A 3K4MA 1DU0A 4F55A 4QWCA 2OC6A 2N1RA 3EQLF 2QLZA 1DGRM 2HDOA 4R1HA 3T1BA 3BWGA 2N8GA 4LMYA 4FTHA 2LYAA 3M9MB 3J7AY 8ICTA 2NVQJ 5AKHA 3OS0A 1LEAA 2HNHA 5ALWA 4QIWC 3PNTA 5AM4A 1TC3C 2RRDA 3F21A 4OIQF 2HI0A 1IG6A 2K4BA 2L7MP 2A3SA 2MG4A 3DU5A 3QYFA 1BGXT 2NXNB 4PSXA 3PSIA 2IS1A 2L7FP 2RQ5A 2OA4A 4D5CA 1MQ3A 3F53A 5HS7A 2LM4A 3EWAA 3E7LA 3UMGA 2KV2A 2DJNA 3GU3A 7ICUA 3K9TA 4ENKA 3CUOA 4KN4X 2E1MC 5AK6A 4PGXA 3JPQA 1TQPA 2ZJ5A 4IOAF 2DPJA 4UB6C 4LGWA 4RQ4A 7ICOA 1WQ2A 4EBCA 3CC2I 5L3EA 5AKKA 1QNTA 5JUMA 5KFYA 4L9TA 2F2AB 1ZQCA 2V79A 1T33A 4P9UA 5KAFC 3D5LA 3LQRA 1VLBA 5J0WA 3Q9SA 4DZJA 3OYIA 4YMMA 2KJCA 5IIMA 4A0XA 4F4ZA 3HUGB 3GIJA 5HR6A 2ASJA 3W2WA 5F6FA 3UMCA 3Q8SB 2W11A 1XGOA 5HHHA 1G8XA 1JJ6C 5DQHA 3OYLA 2Y0MA 4C2UA 4YD1A 3RH6A 1YJWI 1ZQLA 4P5OA 2FU4A 2A07F 3CC7I 4XKCA 1IZ1A 2MLGA 2QUFA 5HLTA 2WF9A 5KFIA 1ZQ1C 2JH1A 1PUEE 3UPQA 4FBUA 1FPQA 2DA6A 1S0VA 4ED1A 3BPXA 3DWLE 2H3IA 2ZJ2A 3HPHA 1HBXG 2NVTJ 3C2MA 1MBEA 3DLLF 5AHXA 1ENHA 1A0PA 4KLEA 3J81Z 3SI8A 2LVSA 1B9MA 3E0JB 1JGGA 4FBTA 3DV9A 4DL4A 4QZCA 4ZDLA 2CRXA 3N7SC 4F91B 1J5YA 4BH9A 2QBYB 1J9IA 5DM6F 2E3TA 3LA2A 2F1IA 2XICA 3H8JA 5J0TA 1SFOJ 5KFMA 1MDMA 1WH5A 4XK4A 3RJEA 5FKKA 1SKSA 4CCJA 5BS6A 4Q43A 4QJFB 2WV0A 2DCEA 3QQAA 1LVKA 1IV8A 2D1HA 2LDUA 5E79C 5EG0A 3C1YA 3D6JA 3PX0A 4FZNA 3H92A 3ETRA 1BL0A 3O0FA 3HUGA 1NK6A 2VI6A 5DLGA 1GV5A 1ETYA 2KJ9A 3F6VA 3CCVI 8ICKA 4MTEA 5CHGA 3E6BA 2BQRA 1D0XA 2OZUA 3QU6A 5KTQA 3FK7A 2X6WA 2G0AA 1R6RA 2BCUA 2YX4A 4PHPA 4I2CA 1YZ6A 3EPIA 3J80K 3KYLA 1UHWA 2W48A 3M8SA 4XLCA 3R4KA 2F5FA 2L54A 4IHVA 1F5SA 4M73A 2P6TA 2ZFWA 4D9JA 2AQ4A 3HXLA 1JKQC 4U0YA 2WF8A 2HHQA 4AWXB 2E5NA 2QSFX 5FJ8J 3TACB 1LDKB 2FDRA 1TNTA 3HYIA 1FZPB 3PR4A 1VTNC 4MO7A 3QX7A 1WJDA 5J2JA 5DB9A 3LOCA 3ECHA 2XHKA 3V7JA 4HDUA 4BJ6C 2AS5F 4A3CJ 5CR0A 2ZNZA 3ZQHA 4AIKA 3QUQA 2Z16A 5JRTA 3DXJF 2XAHA 4I0AA 3REOA 2W24A 1RQLA 3HX0A 1W7PD 3QU4A 4DLGA 2IBKA 2V9PA 4PJ0C 2VANA 2LH9A 2RLTA 3E2EA 3FMQA 2P6SA 3FBIB 3BG9A 4MTDA 9ICJA 2JZYA 3OHBA 1Z00B 1ZQMA 4CCHA 2M34A 4ZYEA 4J19A 4Z6CA 5J2IA 1SIJA 5BPCA 5AM3A 2DMNA 5E20A 5F9LA 1ZQRA 2NYVA 1OLTA 3DLAA 5AK4A 8ICZA 1XC5A 4U88A 4DF8A 5EOZA 1QQ5A 3DTKA 4EX6A 2XO7A 3QOEA 2PI0A 4BY7J 2WBMA 4HG2A 1W0UA 1R49A 4CF3A 2ZB9A 3RZOJ 4RQ0A 2L5QA 2QF7A 3BG7A 4ESJA 4YG2F 4H4KC 1A77A 4ZOHC 1U5TB 3AG4H 3DTIA 4NB5A 2XCPA 5JR3A 3FM3A 2NS0A 3K2AA 2KDZA 2E8PA 2KD1A 5J2EA 4G6TB 2Z7JA 4Y33A 2MH9A 2IOFA 2I6XA 4E7KA 3S1QJ 1ZH5A 3C7JA 2OCEA 1GXPA 1SV4A 5IOYA 4LJXA 4E4HA 4EGYA 2QQ9A 2YX8A 2FMYA 3BQ1A 4A6DA 3I76A 1ZQAA 1N61A 1ZQYA 4M3BA 5CYVA 4U7CA 4R63A 3IRRA 5ILUA 4M3GA 5LRRA 2HBLA 2ZIXA 5AI9A 1S76D 1VFCA 1L7PA 2GXAA 2Y9ZA 2NRWA 1ZQBA 2JEGA 1TWHJ 4FE4A 1IV6A 4MFAA 1FLIA 3FZVA 4XLAA 4HA8A 4BACA 3KHRA 4TUPA 2Z99A 3BY6A 1SWWA 2BR0A 1S0NA 3ZQQA 2DO7A 1F36A 4P4OA 3ZDCA 4DL3A 2HQ5A 5CPRB 2EH3A 1BVSA 4HQEA 4D5FA
chains in the Genus database with same CATH topology
5CQEA 1KBUA 3OYHA 1HEKA 4FZLA 2NOJB 4JOMA 3EUKL 2JMGA 4ACOA 2VQCA 3G2BA 4P0QA 3SAHA 4KJZA 2L7KA 2M0MA 3F9KA 4ZJZA 4IQJA 3IAS2 3T79A 4LIVA 2VKHA 3AQFA 2R7WA 4F52A 3ALRA 1MMGA 3LYSA 4RMNA 4CRXA 2HBJA 4CSWA 3A4CA 2HQAA 1MW7A 2DOAA 2R7VA 2M4GA 1N77A 2CV2A 4A8EA 3LSGA 3HC7A 4F92B 2LRDA 2ZG6A 3K4LA 1XNSA 2OUMA 3K4BA 2GOLA 2XDVA 3H0MB 2RP5A 2V1NA 3AQEA 4CGZA 2CV0A 4BEHB 2O5RA 3RPUD 4OJPA 1N75A 5CKTA 3F5EA 3CF2A 3HL2A 2M7AA 3SAGA 1FMVA 1WJAA 5T14A 3OOUA 2F76X 4XOTA 2JGAA 4MLOA 1QU3A 4PFOA 2Y0SC 4DBQA 4QPOA 3H5NA 4GFJA 5LFAA 3QYEA 3BC8A 2KICA 2K5CA 1Z3YA 2MRLA 1K6YA 3KEYA 3QODA 4Y3OA 4P0QB 2VXZA 4CCLA 2DQNB 2XF6A 4BDYA 4C30A 2ZIUB 2CFOA 1F44A 2G08A 2K8AA 2A6TA 2KL4A 1X1CA 3K4KA 1N78A 1Z21A 1A6SA 3UR3C 1QHGA 3D2SA 1Y6IA 4LG3A 4OWRB 4E7SA 3FBNB 4NUBA 4ICAA 2K9LA 1PVPA 4RM3A 1YT3A 3DKXA 2LY1A 3AL0C 4N4OB 3L2VA 1LKXA 4XLHA 3PNYA 4E6KG 4BQQA 1L6NA 3HKZA 3H0DA 3IAM2 3I9V2 2JSPA 1X4PA 1V5GA 4U87A 3L2UA 2PJRA 3H0LB 3H0RB 3N7PD 2MA1A 4FE3A 1OUQA 1WJ5A 4OJ6A 3IN5A 2RQQA 3PZPA 3A1YA 2KKVA 4HRIA 1DGWY 3NWTA 3SZGA 1P9QC 3DTEA 1MMAA 2LBFA 3C2GA 2W4SA 4X0GA 3NUQA 2ZSIB 3FHNA 1U0JA 4PJLA 3C28A 3SEZA 4OJOA 1BR2A 3VYUB 5KNLA 4E7HA 4N4NB 2V6EA 3DEEA 3HKZF 1XO0A 3RTRA 3D2QA 3CESA 2R7TA 2KZVA 3RQ4A 4R79A 3SMVA 2VL8A 3VWBA 4KT6A 2BW3A 4BUPA 4AU7A 5HNFA 1HIWA 1NZBA 2M7BA 4XORA 3CYMA 2JH7A 3SAFA 2AQEA 4XKVA 4CDGA 4II2A 4CCNA 1JI8A 1VZ0A 2HPMA 4XQFA 2NV3A 3BCAA 3A2KA 2VIXA 2H3QA 1WJCA 3HKZC 1WFXA 2HU9A 3OYKA 5KL1B 3DU6A 3MMYB 3OL4A 4XLEA 4NLBA 4PFPA 4NV0A 4E7ZA 4PL1A 3ZCOA 2CW7A 2KRHA 4NC8A 3CRXA 1X1AA 2X6XA 2CMPA 1PVRA 3GBGA 4II3A 4XOPA 3K4NA 2DT7B 2E60A 4IQ4A 4ZDPA 4BXFA 1EA3A 3OYNA 4ITVA 2LBOA 3UNGC 3M8JA 1FMWA 2FUG2 2R7UA 2KJ8A 5A0LA 2RNGA 2UV1A 4J00A 1Z19A 4YRVA 4OO1J 4XNFA 4HSTA 1WJFA 4BS9A 3OYAA 5JHFA 2KMUA 4KITB 3IG5A 3PUBA 3VYRB 3LSIA 4DGWB 2X1CA 3LSKA 3DPTA 3VSKA 2VJ4A 1AA7A 1BR4A 2F4IA 4CH7A 3M1CA 2HVRA 4C9YA 5HVQC 3H5AA 3L2WA 3S3MA 4BJQA 3HPGA 4YEJA 3KFUF 1URJA 2DJIA 3KZXA 1MMNA 2CPRA 3OIPA 4PSWA 3OMYA 1D1CA 4NNJA 1W36D 1UELB 3OYFA 2HBKA 2Z1DA 2K8CB 1Q3UA 2VJ5A 3OWTA 4FZMA 2DF4B 2CH0A 2BVMA 4IC9A 2VLAA 2W04A 3EUAA 2UWMA 4DIQA 3VYTB 2G06A 1X19A 2RREA 4C2TA 2WAQC 2LKYA 4HEA2 1T0FC 4KISA 4O3MA 2MD0A 3PSPA 2HDWA 3MGVA 1YX3A 2WB1F 1V5EA 2MABA 2HZDA 2K9MA 2R7OA 4BGDA 4PK4A 3K70C 3CJQB 4XM3A 3KX2A 4PJNA 2OYYA 3LVWA 2KLOA 2XAUA 2R7XA 3F5AA 2Y0SA 3DKYA 2KVCA 4B3XA 1TAMA 2DXIA 2X51A 1QHHD 4DOZA 2XVTA 2BDUA 2Z2SB 4J01A 2PMZF 3ONNA 2X85A 4AYBF 4DJAA 2G5HB 1D1AA 1J09A 2V7FA 2PMZA 2VASA 1UAAA 3PFYA 2IS6A 3VCBA 4C0ZA 3PJRA 2WY7Q 2R7QA 2P0WA 4P0PA 1KONA 2D6FC 1TT0A 4P0PB 2V26A 2H3VA 1V5FA 1Y56A 2LYBA 2IGNA 2YB4A 5C0YA 3C29A 3OYCA 1SAUA 4BL0B 2WA0A 3TBIA 2XF7A 5FRMA 2GOXB 2JUGA 4CCOA 2HOQA 2JHDA 3K10A 3W2AA 2PMZC 3K70D 1HA8A 2F5VA 2ZSHB 2Q2EB 2UUZA 2BOLA 4ZTFA 2G09A 3W3CA 3FKJA 2LC2A 4HSRA 2GOMA 3GZFA 4P1WA 3HOTA 3H9GA 4F3QA 1X4OA 2HOFA 4CCMA 2H3ZA 2CW8A 3QYBA 3DQVC 2WB1C 2KRCA 4OAYA 4XN3A 2ZFUA 1G59A 2CV1A 2KP6A 4BE0A 3N7RC 4XONA 3LSMA 4D1QA 2XF5A 3VYSB 2VB6A 4AVZA 4B48A 2H3FA 3IP4B 3SQIA 3OYDA 3S8PA 4KX3A 1MMDA 2K4HA 1D0ZA 3OYMA 2XSJC 1BOBA 4XN0A 4CZCA 2X6YA 2ZIVB 2WB1A 2IS2A 1BR1A 2DT6A 2ZIUA 2ZIVA 2ZIWB 1SFKA 2M4KA 4ZDOA 2R18A 4PJJA 1NG7A 3LMMA 5CQGA 2QKLB 2WY8Q 4CUGA 1WUDA 2M0NA 2VQLA 2VXDA 2KIWA 2Q4TA 5CRXA 2JVHA 2VPLA 2RHFA 3OPXA 2V4JC 2VQHA 4OJLA 3IG8A 1CRXA 2CUJA 4XL9A 3S3NA 3ZRGA 4U6PA 3CP8A 2HBMA 2W00A 1ZELA 4CA0A 2XIDA 3HG9A 1W36C 2W82A 4XR6A 2K89A 1SZHA 2BW3B 1T95A 2IGKA 4GRIA 3OS1A 3OR1C 2CN1A 2E5SA 4DBRA 3LVVA 1WJEA 3CP2A 3AKZA 2Q1ZB 3H5RA 1WJBA 5FROA 2L9SA 4F93B 1GO3F 2Y0SF 3K4CA 1DRGA 2KJ5A 5HNHA 3MKYB 3LFUA 3CZ6A 3DPLC 3K4MA 2HPIA 4E7JA 2JVGA 2KPMA 4XKWA 4F55A 1DP3A 4BX9C 2OC6A 2N1RA 1MNDA 2OXOA 1X1DA 3V42A 1DGRM 3F2CA 1Q3VA 2VKDA 2LYAA 2ZIWA 1MA7A 4NWIA 3J7AY 3SDBA 1NG6A 3OS0A 2VJJA 2HNHA 2K4EA 2K3PA 3OYBA 3PNTA 4BU2A 2ZIXB 4QIWC 4PUSA 2RRDA 4PJMA 2X1EA 4BQNA 2AQFA 3QYFA 3DU5A 1YE9A 2KOBA 4PSXA 3PSIA 2IS1A 3DPUA 2R4GA 2F77X 1T94A 3L3FX 3F53A 1ECWA 2KV2A 4BJTA 3GU3A 3PSFA 5KL8B 4OJ5A 3BLYA 2WADA 2E1MC 3OYJA 2LY2A 2KEYA 3RSNA 3E1SA 2GH1A 3C2HA 3HOSA 4BEHA 4HNTA 2F2AB 5KCMA 3D5SC 3D5LA 3D5RC 3OYIA 1Z7LA 3PL8A 3HUGB 3M6ZA 5HR6A 3W2WA 3BG6A 1UG0A 3ICXA 3TMOA 1G8XA 3D2NA 3OYLA 4C2UA 4XMYA 4PL2A 1D8BA 2HVQA 2L2OA 4P5OA 1UPHA 2G07A 2LREA 3CMMA 2G5IB 2WAFA 4XKCA 4KX5A 5HLTA 4B44A 1ZQ1C 2JH1A 4HPQA 3ONQA 1DQUA 3DWLE 3AFHA 2BVLA 3NWSA 2H3IA 3PSTA 3HPHA 2IGOA 5LD2C 4XLFA 3RF9A 1PJRA 1A0PA 1ERDA 2M3AA 2ELJA 3E0JB 3S32A 3H9QA 2XC7A 5HOOA 2CRXA 4ZDLA 4JQFA 3N7SC 2KQRA 4F91B 4AYBC 3RFAA 3IUOA 2L9NA 3OY9A 4RM2A 1ED1A 2XICA 2HVSA 3N05A 3I3LA 1PYVA 2LYCA 2DGZA 3ZGKA 3U21A 1OR7C 4CCJA 3H9JA 4QJFB 2W1OA 2XI9A 2DCEA 3TL4X 1LVKA 2W7NA 1X1BA 4FZNA 2W7OA 5HR7A 3O0FA 2IGMA 3MD2A 4WJ3B 3L2RA 3W2VA 2KJ9A 4OAZA 3K1ZA 1D0XA 4ANJA 1E0EA 4CCKA 2E1MB 2KHMA 2MFZA 1R6RA 2V9KA 2X6WA 4NQWB 3SEQA 3S3OA 2G0AA 3K4JA 2R7SA 3OYEA 4EATA 2WAQA 3KYLA 4XLCA 3BCBA 2KDOA 4B43A 1IIPA 2YB1A 3NRWA 3H35A 2OM6A 2W7PA 2X1DA 4D9JA 3HXLA 4BE2A 1YX5A 2ZXHA 2E5NA 4NLCA 4FASD 1LDKB 2MYSA 1P7DA 4IKFA 2LG4A 3OIQA 1TZLA 1WJDA 2LBFB 2K4IA 4BJ6C 2F8LA 2OH2A 5KHDA 3E0FA 3VDXA 2HMXA 2ZXIA 4BQOA 2Z16A 2WAQF 3M7DA 4RLQA 2PJRB 3OS2A 2CS3A 2LH9A 4B47A 2E1EA 2F6CA 1D1BA 3FBIB 3OYGA 3F2BA 1PVQA 4BJ5C 2JA2A 3MKWB 3L2QA 2IS4A 3MKZA 4BE1A 4ZC3A 2W03A 2HOIA 3FDYA 1OLTA 2IXSA 3DLAA 2R7RA 4U7BA 3RCOA 4LITA 3AL0B 2A5WA 3DTKA 2MC4A 3QOEA 4Y4RA 2QKMB 4BUGA 2KHQA 1S9HA 1Z3XA 2WBMA 4HG2A 4JMUA 2LHTA 3LSHA 2E1FA 2L5QA 3BG7A 3OR2C 4H4KC 1LFPA 4YELA 5FRNA 3DTIA 2VJIA 2K8BB 3ZXSA 2KD1A 4G6TB 2Z7JA 1D0YA 3VSLA 4Y33A 2LOOA 4NC7A 4HNUA 2VQGA 3OL3A 4BDZA 4E7KA 1IRXA 2A3VA 1MNEA 4ZTJA 4RLFA 1GLNA 4IZZA 1Z1BA 4FETA 4AYBA 4E4HA 2YX8A 3EPZA 2I8DA 2KHVA 4QIWF 2KKPA 4IX7A 4U7CA 4QNLA 2ZIXA 2HBLA 3F2DA 4KMOB 5TGTA 4XKBA 2VKQA 3LL7A 3M6KA 4XLAA 3EUHC 4BACA 2OV7A 4LIUA 4QPQA 4E7IA 3S93A 3VC8A 3ZR8X 2E5ZA 3PNVA 3CJRB 2KNJA 3ZQQA 2CUZA 4E7LA 2WAEA 5CPRB 4ZYAA 3K6GA 3SYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEE A; 
#chains in the Genus database with same CATH topology
 1Q1V A;  5IIL A;  3JPP A;  4FZL A;  3FXK A;  2PFQ A;  3G2B A;  4KJZ A;  1IUF A;  3F9K A;  4UUT A;  2OEH A;  1B0X A;  1VQ7 I;  3AQF A;  3CNH A;  4BHB A;  4XUS A;  2HBJ A;  2W8K A;  4CSW A;  1F9N A;  4G8X A;  5G5H A;  1JMS A;  5KG0 A;  2FD5 A;  1BI0 A;  3M9A A;  1R5I D;  4J9O A;  4PJ0 U;  5BQT A;  2BGC A;  3DP7 A;  2K40 A;  3SFI A;  2R7V A;  2JZB A;  2ADU A;  1WCL A;  3HGG A;  2QB0 A;  4F92 B;  5DEQ A;  1Z3E B;  3ZMV A;  9ICW A;  2XDV A;  1VQO I;  2Y31 A;  2K7L A;  4CGZ A;  1YW7 A;  3FXL A;  5AI5 A;  4RAY A;  2IRF G;  4Q47 A;  3BS5 B;  1NKE A;  2GQQ A;  2F76 X;  2JGA A;  3Q0V A;  3ROU A;  3G71 I;  4I6Z A;  1PDN C;  1QGP A;  4J9Q A;  2KJB A;  5HDK A;  4Q45 A;  2Y0S C;  4P9F A;  5EGO A;  2VA3 A;  5GAD J;  4DL6 A;  9ICA A;  2EPF A;  5KFR A;  4HNV A;  5DB6 A;  4DQP A;  7ICJ A;  4NLN A;  3TAR A;  2Y1J A;  1J75 A;  5L3B A;  4RU9 A;  1DPU A;  4BDP A;  4Y3O A;  5KFX A;  5B1A H;  2VXZ A;  2DQN B;  3ZP5 A;  5EE1 A;  2V1D A;  4P0Q B;  5EEH A;  1E3P A;  1HQC A;  3Q3S A;  1JHH A;  3RJP A;  5ICE A;  4GGG A;  2WTF A;  2A6T A;  3P9K A;  5ALY A;  3X2Q H;  1SD4 A;  5DDY A;  2RQP A;  1A6S A;  2JRM A;  4RT2 A;  1N5W A;  4ECU A;  4LG3 A;  4OWR B;  3RH4 A;  2DK5 A;  3FBN B;  4NUB A;  1COO A;  2DA7 A;  2XVC A;  4CO8 A;  4YIR X;  1PVP A;  3NEU A;  5F0F A;  2OZ6 A;  2NS8 A;  3L2V A;  1LKX A;  4XLH A;  2B9S A;  1RDF A;  5GAG J;  1X66 A;  4QW8 A;  2W9A A;  5AM1 A;  5D4B A;  2EZZ A;  2Z5U A;  2R8K A;  4EVI A;  2JSP A;  3O8H A;  1V5G A;  3BJA A;  4X1E A;  2EZX A;  3H0L B;  1ETV A;  1XDU A;  2DFI A;  3PNC A;  4MHG A;  4KLQ A;  2IVM A;  1YFH A;  5K4L A;  2K4P A;  3VFZ A;  1P9Q C;  2VBX A;  4TUS A;  2LBF A;  4CE6 A;  5K1Y A;  1ZQX A;  2W57 A;  1KU7 A;  4UAU A;  4EEN A;  2VC0 A;  2FF4 A;  5D5X B;  2F44 A;  2WF5 A;  5KNL A;  1L7N A;  1PP7 U;  4N4N B;  1R58 A;  3KP2 A;  5F3X B;  9ICX A;  3JRH A;  2DOE A;  3AG2 H;  3D2Q A;  5DTD A;  3ZMD A;  4J9L A;  4DFP A;  1XMK A;  4NLG A;  2DLL A;  2QQB A;  2ESN A;  3BJ6 A;  4BYY A;  5L9X A;  2OTJ I;  2ICW G;  1LUJ B;  3BQZ A;  1KEJ A;  2G0E A;  1UMQ A;  3K1N A;  3DV8 A;  2ZXJ A;  4IEJ A;  1PK1 A;  5FD5 A;  5AKJ A;  4YXM A;  3QP5 A;  2JH7 A;  2BQU A;  3Q9V A;  8ICM A;  2W3S A;  2KIQ A;  1MSE C;  3CLO A;  4XKV A;  1AU7 A;  1NKB A;  4CDG A;  1TNS A;  4I2G A;  4Y7N J;  2M1B A;  4I02 A;  3NRZ A;  2B7E A;  2NS7 A;  1EF4 A;  2FOW A;  3FM5 A;  1OYW A;  3A2K A;  5DCF A;  1WJC A;  3SFZ A;  3OYK A;  2H3Q A;  2VC1 A;  1QSY A;  3MMY B;  9ANT A;  2MUT A;  5B3S H;  4NV0 A;  3HP6 A;  2KP7 A;  3S2W A;  1UCV A;  1FJL A;  2KRH A;  4ED0 A;  2X6X A;  2CMP A;  1D8L A;  3V6H A;  3GBG A;  1S7O A;  4CYD A;  4II3 A;  4XOP A;  1KFD A;  1SB3 C;  1KKX A;  2E60 A;  2BXZ A;  1EXN A;  3R60 A;  1TTY A;  1U9O A;  3GFJ A;  1JJ8 C;  2V9W A;  3IV5 A;  2FUG 2;  1XGN A;  4GIB A;  1Z19 A;  2UV1 A;  4J00 A;  4MFC A;  4YRV A;  5EJC A;  1VQ6 I;  4OO1 J;  4HST A;  4DQ2 A;  4BS9 A;  1CF7 A;  2X48 A;  3WGG A;  1OYI A;  1HW5 A;  2KMU A;  5EEA A;  2ISO A;  4BKX A;  4WXD A;  3PUB A;  1SXD A;  4ECQ A;  5HMM A;  2FMS A;  2V4Q A;  4G94 A;  3GTQ J;  3LSK A;  4QTR A;  1SKW A;  3VSK A;  2XGP A;  3F8N A;  2Q2E A;  2BY0 A;  2VJ4 A;  4KIG A;  4G9B A;  2R5Z A;  1UJ8 A;  3E5Q A;  4UY8 I;  3M1C A;  4C8M A;  4Y13 A;  2ID6 A;  3OSF A;  2H6B A;  1KU2 A;  1LE8 B;  4A2U A;  2FML A;  3S3M A;  3DF8 A;  4BQA A;  2FE9 A;  2K9Q A;  1H88 C;  4YEJ A;  4I28 A;  5HDN A;  1TL8 A;  3VOD A;  1T39 A;  4L18 B;  1GT0 C;  1MMN A;  1URJ A;  2QAR B;  3KZX A;  4PGH A;  1D1C A;  1AWC A;  2K8C B;  5KFS A;  3OYF A;  3MDC A;  2Z1D A;  2VN2 A;  2O03 A;  3A01 B;  1V3F A;  3CO6 C;  3WTZ A;  1G4D A;  1OQY A;  4M6X A;  5GP9 A;  3OWT A;  1CF7 B;  2GLO A;  4FZM A;  3UXN A;  2BVM A;  4CXF A;  3HM5 A;  1TLH B;  2DTZ A;  4OOI A;  5M5X J;  2VLA A;  2H27 A;  2JA5 J;  2AXT U;  2H5X A;  5M3F J;  4LVS A;  3TW7 A;  5ALQ A;  3FDS A;  2Z3Y A;  3VYT B;  4DIQ A;  1CUK A;  1SVM A;  5LBQ A;  1X19 A;  2HYF A;  3J7A O;  4C80 A;  4MF8 A;  2IJL A;  1UFM A;  1LPQ A;  1UCR A;  1T0F C;  1HCR A;  2HOS A;  2CUF A;  3PSP A;  1H38 A;  1YX3 A;  1B4A A;  3MAB A;  1S10 A;  2HZD A;  3K70 C;  2W43 A;  2HHT A;  4PK4 A;  3B0X A;  2HVH A;  3S1M J;  4G6Q A;  4PJN A;  1B43 A;  8ICW A;  2OYY A;  5JLX A;  4B09 A;  2L5Y A;  5DG7 A;  3CMY A;  5AK5 A;  5D5W B;  2KVC A;  3BJY A;  1XSL A;  4V2F A;  2XB5 A;  1IO2 A;  2RDP A;  5KG6 A;  2X51 A;  5KFH A;  2FQ4 A;  3BJO A;  3IH3 A;  2X85 A;  3QP6 A;  5KG4 A;  3L4P A;  2HHV A;  1ETX A;  1IRG A;  2G5H B;  5DQG A;  4P4M A;  2DWQ A;  1A5J A;  2V7F A;  2PMZ A;  4NL9 A;  2QB0 B;  3TFR A;  4I29 A;  1Z4N A;  5C4J J;  1IC8 A;  4LZD A;  4YFK F;  4C0Z A;  3M9O B;  2BCQ A;  1JUP A;  5FGM A;  4PH5 A;  4A3D J;  2UZK A;  2FMP A;  1JGS A;  1FIP A;  3RYR A;  2D1V A;  1USS A;  3KP5 A;  1FT9 A;  3T5K A;  2MSN A;  2ASL A;  2D6F C;  1RI7 A;  2BV6 A;  3ABT A;  1A31 A;  2C6Y A;  2H3V A;  1JIH A;  2IGN A;  2A05 A;  5D6F A;  2XGD A;  2R7D A;  3CCR I;  2FMQ A;  3BPV A;  4BXO B;  1SAU A;  2WA0 A;  1KFS A;  2GOX B;  1XMA A;  4YQW A;  3BQ2 A;  3K70 D;  2A6E F;  2F5V A;  3KHG A;  3JAM K;  3WK7 A;  2RN7 A;  2UUZ A;  2ZUB A;  5K7H A;  3ZDE A;  4L5J A;  4M72 A;  3FHZ A;  2G09 A;  3QU7 A;  5K7F A;  3GDX A;  5D8L B;  2ATL A;  2CQ7 A;  4AVP A;  1VQ4 I;  3M3Y J;  3H9G A;  2HOF A;  1X4O A;  2H3Z A;  4HX8 A;  3QYB A;  4YFN F;  3LFK A;  1CI4 A;  3ABU A;  1ZJN A;  1P2F A;  4XN3 A;  3ABK H;  3FXJ A;  3PM1 A;  5M5W J;  4BWM A;  3M8E A;  4B9N A;  4BE0 A;  3N7R C;  4XON A;  3LSM A;  2CU7 A;  2DAO A;  5H6Q A;  3BG5 A;  2VB6 A;  2H3F A;  4B48 A;  3SQI A;  3IP4 B;  4ECX A;  3OYD A;  1RYR A;  1MMD A;  2K4H A;  5K5Q A;  5KFP A;  4F4Y A;  1RR7 A;  2KRF A;  2WTE A;  4CZC A;  2KZM A;  3NAS A;  4HDV A;  1U49 A;  2A1J A;  3J81 K;  3I1Y A;  3KOO A;  2ZIV A;  3PFI A;  3RDI A;  4O3N A;  1SC7 A;  5F0H A;  4AIH A;  3QNM A;  5H2F U;  4A5N A;  1LNW A;  3BS7 A;  1YLF A;  1PVE A;  3L2C A;  3LMM A;  5DV5 A;  1RIO H;  4KLH A;  2QKL B;  3SJM A;  4DO9 A;  3O6B B;  1TKD A;  4GXI A;  1RZT A;  3K1M A;  4NY8 A;  4GCV A;  4I2B A;  2RHF A;  4RQ5 A;  3OPX A;  2XAJ A;  2K27 A;  2DL0 A;  5KFJ A;  2VQH A;  3FM9 A;  3QE9 Y;  8ICV A;  5AKG A;  3GTK J;  2E34 A;  3S3N A;  2GA2 A;  3BTC A;  1YW8 A;  2LI6 A;  3QUB A;  5ALN A;  2W00 A;  1ZEL A;  3DEW A;  4CA0 A;  5KG7 A;  4ECZ A;  1XS9 D;  3WE2 A;  2JA6 J;  3I4M J;  2W82 A;  4EBD A;  4XR6 A;  1HC8 A;  3OIO A;  1O3T A;  2Y9U A;  3KCC A;  3S14 J;  4HAI A;  3GEZ A;  1SZH A;  8ICO A;  1T95 A;  2V4R A;  5KT7 A;  3WKC A;  2HOE A;  2QVO A;  5L1I A;  4NLK A;  3JRC A;  2E5S A;  5KG5 A;  1WJE A;  3CP2 A;  3AKZ A;  1EH7 A;  1F5T A;  4F5Q A;  5FRO A;  5DBB A;  1CEZ A;  3CUQ B;  2GM4 A;  1DRG A;  1OPC A;  3MKY B;  3PVX A;  4RAZ A;  3LFU A;  4DW6 A;  2EIN H;  5LHI A;  1ULY A;  2JVG A;  5KFL A;  3MEX A;  5HS8 A;  1Y39 A;  1X6I A;  4UAS A;  3TO7 A;  3V42 A;  4JBA A;  1TFR A;  1Q3V A;  5GPC A;  3RKX A;  2EFP A;  2NYX A;  3BR2 A;  3SDB A;  4KIF A;  5CB1 A;  1TK8 A;  3OYB A;  4BU2 A;  5BPI A;  4PUS A;  3SXY A;  2JA8 J;  1J97 A;  3EPG A;  1ZGW A;  4BQN A;  2AQF A;  2OQG A;  4KMF A;  3HOX J;  3RJH A;  3ECO A;  2KOB A;  4CF4 A;  3A02 A;  3M4O J;  3DPU A;  2R4G A;  3R0J A;  4GLX A;  2QBY A;  4K4I A;  4JB3 A;  2VA8 A;  4Q4Z F;  2FPL A;  5HS9 A;  4IQV A;  5F64 A;  1ECW A;  4BJT A;  4MFE A;  3BLY A;  1ZR2 A;  2HFH A;  4IQT A;  1TW3 A;  4DQS A;  1BOA A;  3BDD A;  2WF7 A;  1R4N B;  3RSN A;  3E1S A;  3MR6 A;  2GH1 A;  3LAP A;  5TJJ A;  3SQN A;  2OWO A;  2OHF A;  4IR1 A;  4HNT A;  3D1N I;  2GWS A;  1UQV A;  3WU2 U;  4LLG F;  2KZ3 A;  3D5R C;  3JRD A;  5J8Y A;  3U9G A;  4EEF G;  3WKB A;  4GXJ A;  1Z7L A;  1X2I A;  3PL8 A;  7ICT A;  1IN4 A;  3L7W A;  1RUN A;  1SVL A;  3K7A J;  4MQ9 F;  3WOD F;  3EZ5 A;  1UG0 A;  1SV0 A;  1V54 H;  3BR3 A;  4BXU A;  3D2N A;  3JPN A;  4JV0 A;  2VUM J;  1S77 D;  3PW2 A;  1D8B A;  5FKM A;  4A93 J;  2G5I B;  3GZ5 A;  3CMM A;  2WAF A;  3KZZ A;  4RQ2 A;  1QLN A;  2D45 A;  2KIS A;  7ICG A;  3IWF A;  1L8L A;  2BVL A;  3PST A;  2DW4 A;  3FF5 A;  1SZP A;  1MJ9 A;  2IGO A;  5KVR A;  5LD2 C;  4M6W A;  3C3W A;  1PJR A;  2G9W A;  3FAH A;  3PUF A;  3CCE I;  2KSO B;  3H1C A;  5KK1 A;  4PGQ A;  4PZN A;  2ELJ A;  3LWM A;  3TAP A;  4Y2J A;  2XC7 A;  5D46 A;  5HOO A;  3FIW A;  2XY7 A;  2O3F A;  4AYB C;  4G3I A;  3GZ6 A;  3A0B U;  3EDP A;  4G7O F;  3IUO A;  3RJF A;  2F4O B;  4ZYG A;  3UQ0 A;  4C3I J;  3ZD9 A;  1X58 A;  3KLN A;  3ETL A;  5DGB A;  2K3F A;  4IJA A;  2I5U A;  3QOP A;  1PYV A;  1J7K A;  2NAZ A;  2E35 A;  1VDV A;  2DGZ A;  3ZGK A;  3U21 A;  2YMQ A;  2DKZ A;  4JV1 A;  5IP6 A;  4B9M A;  2XI9 A;  3JRE A;  5ALO A;  3TL4 X;  4LK0 F;  4A69 C;  4AUX A;  2W7N A;  1DGJ A;  1X1B A;  4QZH A;  4M9G A;  2QLT A;  4RB0 A;  2PFN A;  4M6W B;  2IGM A;  2QSH X;  3EW9 A;  2KIM A;  4NXZ A;  1OW5 A;  3W2V A;  1Z4O A;  1S72 I;  8ICB A;  1MBJ A;  2LSO A;  1HW2 A;  5DG9 A;  1E0E A;  3TQ1 A;  4BWJ A;  1PVR A;  3ZN1 A;  3SEQ A;  5J0P A;  3UKG A;  3ZQ7 A;  4U7D A;  3BCB A;  2YB1 A;  2ASD A;  1I50 J;  2J5O A;  4EJO A;  5G5G A;  2W7P A;  1YI2 I;  2EQY A;  2W9C A;  2JT1 A;  2DA4 A;  5IIN A;  1MQ2 A;  2EZY A;  5B66 U;  1SD5 A;  1KDH A;  1D9D A;  1FSE A;  2A6H F;  1TZL A;  1ZQO A;  2K4I A;  2O8K A;  1VQM I;  4P55 A;  4G7Z F;  4IRI A;  3CJT B;  2ETH A;  2XCA A;  1QZZ A;  2DT5 A;  1N62 A;  1IXS B;  2B63 J;  3GLL A;  2KVS A;  3ZQG A;  4BQO A;  3KYC B;  4M9S A;  5LGU A;  3IV6 A;  3QPH A;  5TZV A;  1TBX A;  2CS3 A;  2D5V A;  2Z9O A;  8ICG A;  2YTU A;  1UA1 A;  5AM2 A;  2A61 A;  3ZD8 A;  5J0O A;  3F2B A;  1L3S A;  1LFB A;  4PHA A;  1QCK A;  1PVQ A;  2AGQ A;  2NVY J;  4KLM A;  4KLU A;  3A0H U;  3F0C A;  3MKW B;  3L2Q A;  1E3O C;  3MKZ A;  4GO1 A;  4EJU A;  2W03 A;  5ALS A;  8ICL A;  2HOI A;  3E5U A;  2TDX A;  4F50 A;  2V1X A;  1OYY A;  2ZJQ F;  5CVJ A;  1JKR C;  3F22 A;  5KT3 A;  3BTI A;  5FLV A;  1OXJ A;  4Y2Q A;  1D8Y A;  3U1K A;  3A03 A;  4Y4R A;  4BUG A;  2KHQ A;  3G6V A;  4RGU A;  1KN5 A;  5KT4 A;  1DK3 A;  3WTW C;  2BEO A;  3SDG A;  3IC7 A;  4UAV A;  1LFP A;  1J2X A;  2W9B B;  3BOQ A;  2DA3 A;  4PGY A;  3PX4 A;  2VJI A;  3TI0 A;  4HOB A;  1W7P B;  4IOC F;  3RBE A;  2DOD A;  4EZ6 A;  3CCJ I;  1ZQ3 P;  3FXQ A;  2FE3 A;  5DUI A;  3KIO A;  2VBZ A;  5HP4 A;  4IQU A;  1QVT A;  1Z9C A;  4NC7 A;  4HNU A;  1AOY A;  4US8 A;  4KTQ A;  2VQG A;  2W25 A;  1WI9 A;  1IRX A;  2NOG A;  4FIS A;  4RB2 C;  1O3R A;  3KEO A;  4ZTJ A;  5J8C A;  2BZF A;  4IZZ A;  1GLN A;  4A3G J;  2HW3 A;  9ICC A;  3G3Z A;  2IAI A;  2R92 J;  4IPA A;  3EPZ A;  1HKS A;  4NM2 A;  3HHH A;  2HS5 A;  2HSZ A;  2KHV A;  4QIW F;  5E8G A;  3E6C C;  1LEB A;  1U6G A;  2Q0Z X;  4XLP F;  4R8U B;  5FKO A;  3HOW J;  3RB3 A;  3SD7 A;  4DSF A;  1L0O C;  1ZQQ A;  3CTA A;  2VKQ A;  3LL7 A;  5EYR A;  1RKW A;  7ICP A;  1BI2 A;  1IRF A;  2HWV A;  3EUH C;  1OKR A;  2IP2 A;  2OV7 A;  4A5M A;  4LIU A;  4QPQ A;  2EDU A;  3VC8 A;  3H4B A;  1MJB A;  3ERE D;  5L1L A;  1ZRM A;  1QSS A;  3PNV A;  3CJR B;  2QEN A;  1B8I B;  4OMY A;  1HOM A;  1K1S A;  2Z33 A;  3RJJ A;  4BNC A;  2CUZ A;  2A68 F;  4E7L A;  1WZ2 A;  2O7O A;  2KIV A;  5J2K A;  3ZMZ A;  4HV5 A;  5CQE A;  1OCC H;  1FEX A;  4Z2Y A;  1LFU P;  2NOJ B;  3OTQ A;  2JMG A;  4ACO A;  2VQC A;  2GIV A;  2NNY A;  3CD6 I;  1T3Q A;  4ZJZ A;  4KDP A;  3IAS 2;  2BXY A;  2YU9 J;  6PAX A;  3T79 A;  2IHM A;  2PMH A;  4I7H A;  3PIO F;  3TAQ A;  1W5T A;  2VKH A;  1P7J A;  2LM1 A;  4HYK A;  4F52 A;  1NK3 P;  1MMG A;  3ALR A;  3LYS A;  1ZJM A;  4KLT A;  1MZB A;  4LG0 A;  3IKV A;  4U0V A;  4OIN F;  5IT3 A;  3HTS B;  3GIL A;  2O8X A;  1MW7 A;  2F5C A;  3D0S A;  3VEP A;  5ALK A;  4ZH4 A;  3BZ6 A;  3FMR A;  1X9W A;  3MWM A;  5ALJ A;  5L3C A;  2PG4 A;  4JX4 A;  1ETW A;  2LRD A;  4RBO A;  4ZYD A;  1DP7 P;  2EAM A;  2RDI A;  2ZG6 A;  4UB8 C;  4PL2 A;  5KFD A;  1XNS A;  1BNP A;  3GTJ J;  3H0M B;  2RP5 A;  4X5V A;  3RB6 A;  9ICO A;  4V2G A;  4EJW A;  2JEI A;  4OMZ A;  3GO5 A;  1O08 A;  5IT9 Z;  4Y2T A;  4RQ7 A;  2EQR A;  2XAF A;  1OMI A;  2GA1 A;  3CF2 A;  5CKT A;  3HL2 A;  2JRZ A;  1JKP C;  1FMV A;  1WJA A;  1SFE A;  3BR5 A;  3OOU A;  2F5D A;  1A04 A;  4ETS A;  4TQS A;  4DS5 A;  1O3Q A;  4A3E J;  1CQT A;  2X4H A;  8ICC A;  3GYH X;  1QU3 A;  1MNM C;  4PFO A;  5KG1 A;  3V7K A;  4DBQ A;  7ICE A;  4QPO A;  1DPR A;  4UV9 A;  3LST A;  4HX4 A;  5GTI C;  5BOL A;  5ILV A;  3GLX A;  1S29 A;  4A3B J;  2K5C A;  3PO3 J;  3IWZ A;  2MRL A;  3KEY A;  3HSR A;  4QSH A;  3G4S I;  3QOD A;  3BZK A;  2QB1 A;  3SV3 A;  3QEA Z;  4YR2 A;  5F1R A;  1T3N A;  1BI1 A;  2IW5 A;  4C30 A;  1T38 A;  3P5J A;  2EAP A;  2ZJ8 A;  3OJU A;  1R4M B;  2H1L A;  2G08 A;  2V9V A;  3DEU A;  2HR3 A;  2KL4 A;  1VJ5 A;  1S7E A;  3QZ8 A;  2FNP A;  1FP1 D;  5C3E J;  4YN4 A;  3LDA A;  4I76 A;  2GXB A;  1NH3 A;  4UB4 A;  4WK8 F;  3HOV J;  3V72 A;  4PDK A;  5F1J A;  2XRL A;  1G3Y A;  1YT3 A;  1WHU A;  1MGT A;  3DKX A;  4L0Z B;  4LK1 F;  2W8L A;  1ZRE A;  2CXY A;  3PNY A;  1Y0N A;  8ICS A;  4JUZ A;  4BQQ A;  3PX6 A;  1XB4 A;  2HKX A;  2HTJ A;  4I98 B;  3I9V 2;  5FB2 A;  1TAU A;  3OHA A;  2E2J J;  4B9U A;  1X4P A;  2GLE A;  3L2U A;  5F08 A;  2PJR A;  7ICV A;  3N7P D;  4A3I J;  2F1J A;  3I4P A;  3PR5 B;  2RQQ A;  2KKV A;  3BG3 A;  2F3N A;  2ELH A;  5IIO A;  1IDZ A;  4L9N A;  3PW5 A;  3SZG A;  1HW1 A;  1JN3 A;  3JRI A;  8ICJ A;  1R36 A;  4C3H J;  3FHN A;  2C22 A;  2ELK A;  4PJL A;  3BQ7 A;  3SEZ A;  3Q8R B;  1BR2 A;  2PBI A;  5LGN A;  2O6G E;  1DGS A;  4Q5S F;  4DQR A;  3I59 B;  1ARO P;  3TAD C;  1KL9 A;  4C8O A;  4O3Q A;  1XO0 A;  3HKZ F;  4ED2 A;  4RB3 C;  3RTR A;  1I27 A;  3CES A;  3WU1 B;  4ESB A;  2KZV A;  3Q0W A;  5EEG A;  2DPD A;  1ZQU A;  2JZB B;  5HLG A;  1S5L C;  3VWB A;  3QUC A;  5CLS A;  4MIM A;  2BW3 A;  5FFX A;  2HDD A;  4QZF A;  1NJZ A;  4BUP A;  2L02 A;  2F8K A;  1HIW A;  3MKL A;  2BCS A;  1BA5 A;  1EV7 A;  3CYM A;  4XLN F;  2PFP A;  4HZF A;  2X6O A;  3AEV A;  3AM9 A;  4J9M A;  1RXW A;  3WK6 A;  2FJ1 A;  4II2 A;  3LWF A;  2IA2 A;  2HPM A;  1TV9 A;  1LV5 A;  4JK1 X;  3S15 J;  4ZYH A;  1P4X A;  2HU9 A;  3K2Z A;  4LG0 B;  3VPR A;  4GC6 A;  4DOA A;  1ZK8 A;  4F72 A;  4ZZD A;  4BXX J;  4UBB A;  5AIA A;  1HDP A;  2TRT A;  3ZCO A;  3CF5 F;  4KMU A;  3CCQ I;  4NC8 A;  3DDH A;  1X1A A;  3CRX A;  9ICN A;  2F48 A;  2H6C A;  3ZI4 A;  2MAX A;  4QWB A;  4I2A A;  3KKA A;  1LKY B;  3GFK B;  2DA5 A;  2YY6 A;  4BXF A;  1EA3 A;  1VQ5 I;  1S8O A;  3OYN A;  4UW9 A;  5DYM A;  3JPO A;  5A0L A;  2ALZ A;  3UNG C;  2R7U A;  1ZYQ A;  3QPS A;  1KQ9 A;  2RNG A;  3HRU A;  2BPC A;  1GVD A;  5AI6 A;  3M8R A;  1ZG1 A;  3OYA A;  1M6Y A;  2HHW A;  2PMZ N;  4U0W A;  5GAE J;  2ZJP F;  4FX4 A;  1U8R A;  5IYD J;  3IG5 A;  2ECB A;  2KN7 A;  5L1J A;  3VYR B;  2DU9 A;  4DCC A;  4WX9 A;  3LSI A;  2X1C A;  3WTX C;  2HVI A;  3MZ8 A;  5FLX Z;  1TW2 A;  2LTP A;  2XPW A;  5JI6 A;  3UXP A;  1IGN A;  5J0U A;  5IYC J;  2NVX J;  4M74 A;  1K4S A;  3H5A A;  3L2W A;  4FS2 A;  3QRF F;  1SEU A;  3T5H A;  1LB2 A;  2VOD A;  3KFU F;  1C0W A;  5GPA A;  4R66 A;  1MBG A;  4NNJ A;  4QWQ A;  3CCL I;  3WKD A;  1Q3U A;  1VQ8 I;  1H9T A;  4RGX A;  3F3X A;  4BAY A;  3F8M A;  2ME6 A;  2W04 A;  1TQM A;  2DMU A;  3EUA A;  3TAD A;  2EJR A;  4XRF A;  1FYK A;  2BGW A;  1T2K A;  4M3D A;  2H94 A;  5D5V B;  4XID A;  1FFV A;  1W0T A;  4RT3 A;  2A1J B;  1BM9 A;  2MD0 A;  2LY9 A;  1GUU A;  3BR1 A;  4L9V A;  2BZT A;  5HML A;  3DCF A;  2R7O A;  1Q1H A;  2W9M A;  1TT5 B;  2ECC A;  4P2H A;  3DBL B;  1KQ8 A;  1IXR A;  4OIO F;  3AG1 H;  3AAF A;  3KX2 A;  2DQR A;  1BNO A;  3LVW A;  1FWZ A;  2XAU A;  3HOY J;  2K85 A;  3LA7 A;  1AQ6 A;  2XAG A;  2ZME B;  3GV7 B;  1QHH D;  2XVT A;  1UA0 A;  1ZRN A;  2BDU A;  1XX5 A;  2YS9 A;  4ECS A;  4DJA A;  3S2H J;  1SMT A;  1J09 A;  4L0Y B;  5IIJ A;  3EUB 2;  1UAA A;  2FBI A;  2IS6 A;  3VCB A;  3RJI A;  1QSL A;  5KFC A;  3PJR A;  3JTH A;  5DQI A;  2DA2 A;  2KFD A;  2UVW A;  2R7Q A;  2P0W A;  1ZQW A;  4P0P A;  1KON A;  3V8J A;  1MMS A;  1HST A;  5FO5 A;  2QA4 I;  1ZQN A;  1Z05 A;  2V26 A;  2VPR A;  1B4F A;  4Z6D A;  2R8H A;  1A6Q A;  1Z91 A;  2YB4 A;  3TFS A;  2HOA A;  3ZMS A;  5FRM A;  1Q46 A;  3AG3 H;  1MIJ A;  2CJJ A;  3BR0 A;  2CQK A;  3CUQ C;  3H0G J;  5J1Y A;  3GX4 X;  1DOQ A;  1U8B A;  4IR9 A;  2XKP A;  4NC6 A;  2ZSH B;  5AKZ A;  3W6V A;  2COM A;  3FXR A;  2VT2 A;  2EA2 A;  4HBL A;  4JV2 A;  2E8N A;  2AO9 A;  1WSU A;  1I6H J;  4F4X A;  5E3L A;  3Q8L A;  2GOM A;  1ZLJ A;  1HLV A;  3KZY A;  4P1W A;  4A6E A;  4YFK A;  2IMW P;  3KEQ A;  4F3Q A;  3WKE A;  4Q48 A;  2CW8 A;  3RIR A;  2YU3 A;  2ESH A;  1XSX A;  4ENN A;  2WB1 C;  1X1P A;  4TUQ A;  4IHS A;  1V9P A;  1G59 A;  9ICU A;  2WB1 N;  1LDD A;  2H8W A;  2P5K A;  2AXL A;  5HOD A;  3L5K A;  1W5C C;  3F8F A;  3NAR A;  3QWL A;  2ISZ A;  2UVU A;  5AK3 A;  3K1R B;  1WPK A;  1Y8R B;  4B6J A;  3GFM A;  1F1Z A;  3IRQ A;  4XN0 A;  3WG9 A;  1NTC A;  2X6Y A;  5ICC A;  4RUC A;  3HOZ J;  1BR1 A;  1ZQF A;  1KSP A;  2W84 A;  1WI3 A;  1D8K A;  4A0Z A;  4O6J A;  1D5Y A;  4ZDO A;  2M4K A;  2IOF K;  2R18 A;  2YUS A;  1RQN A;  1IDY A;  5H2F C;  1ZD5 A;  2J6S A;  4MEY F;  3GW2 A;  1WUD A;  4F71 A;  4ED7 A;  2VT3 A;  4NM1 A;  5J1R A;  1MSW D;  1MBH A;  2VXD A;  2GWR A;  2IA1 A;  2UVR A;  1Q8K A;  1K5O A;  2LF8 A;  3ZMT A;  3I64 A;  3PQJ A;  3FK6 A;  2MSY A;  4HV6 A;  3ZPL A;  1ZXI A;  1HXD A;  4OJL A;  3IG8 A;  4Y2X A;  9ICR A;  1XU4 A;  4XL9 A;  3EYY A;  4ABZ A;  1YQA A;  1FX7 A;  3CP8 A;  1O3S A;  2CW0 F;  4M9H A;  2GIZ A;  2LK2 A;  2FBH A;  2OBP A;  3GF2 A;  4JX5 A;  4IHY A;  1FIQ A;  3PV8 A;  2B6G A;  2FLN A;  1UHS A;  1YYV A;  2BW3 B;  3CME I;  2IGK A;  3IM1 A;  1ZD3 A;  2CN1 A;  1YTY A;  4DBR A;  2M8G X;  2V6C A;  1Y1W J;  1PZN A;  1BPB A;  7ICM A;  3H5R A;  4F93 B;  2FA5 A;  2I10 A;  2L9S A;  3I59 A;  4PZJ A;  2E1N A;  3IL2 A;  5JVG F;  1JXS A;  3RB0 A;  5JVT A;  2B21 A;  2KJ5 A;  3H8W A;  5ALE A;  3FXU A;  1ZQZ A;  3WHB A;  4I2F A;  4MNU A;  4E7J A;  1QQ7 A;  1I1G A;  1RM6 C;  4XKW A;  5IT9 K;  1DP3 A;  2ZUC A;  4BX9 C;  2YSR A;  1MND A;  1X1D A;  3S1R J;  5C4X J;  5J2F A;  2EK5 A;  2EV5 A;  3NVY A;  4NWI A;  4XQ8 A;  1MA7 A;  1NK9 A;  3H3Z A;  2ZIX B;  1NJY A;  2K4E A;  2K3P A;  4Y15 A;  4QZD A;  3J7Z I;  4PJM A;  2X1E A;  1YJN I;  2LLK A;  1LKY A;  3QU2 A;  5ALM A;  4QZG A;  4HX7 A;  4RPZ A;  3LNQ A;  1R1U A;  3SYZ A;  2P7V B;  1PUF B;  2ZME C;  3Q0U A;  1T94 A;  5K5O A;  2ZXW H;  3N4M A;  4MQV A;  1PK3 A;  2WFA A;  5J2D A;  3W6J B;  3TKY A;  4OJ5 A;  2WAD A;  5CP2 A;  3G1O A;  5KFV A;  3OYJ A;  4UVC A;  3ISD A;  2LY2 A;  2KEY A;  3J80 Z;  2E2I J;  1IRZ A;  4I2J A;  3C2H A;  4JX6 A;  1WRJ A;  4ENJ A;  3HOS A;  2BQ3 A;  5B1B H;  3GZN B;  5KCM A;  3GXO A;  5E79 U;  1XSD A;  4HLY A;  2VKV A;  1N60 A;  4OCZ A;  1FOY A;  3WU2 C;  5ALV A;  3MGH A;  3OSP A;  1ZQS A;  3PO5 A;  2R5Y B;  3QEB Z;  1LQ1 A;  4EJT A;  3BG6 A;  3TO6 A;  5ED4 A;  2XAQ A;  3ICX A;  2JSC A;  4F2S A;  4MGR A;  3HKZ N;  2MW8 A;  1SD6 A;  5KFE A;  1E3H A;  4AID A;  4QIW N;  2HVQ A;  5D4R A;  2HXO A;  4L5I A;  2JN6 A;  2OD5 A;  3DBH B;  2LRE A;  5FKL A;  1UPH A;  4EEL A;  1R5H A;  5LEJ A;  3PY8 A;  2KTQ A;  3OSN A;  3KKA C;  5E1W A;  1H0M A;  3ONQ A;  2RVC A;  3AFH A;  1ONV A;  2DBB A;  4NBQ A;  1JXE A;  4UAZ A;  4QW9 A;  3BQ0 A;  4ED6 A;  3ED5 A;  3RF9 A;  3CCY A;  4YCX A;  2DI3 A;  1ERD A;  4Z6Y A;  3QU3 A;  2RV8 A;  2NO4 A;  2IA0 A;  4DF4 A;  4M47 A;  3FXM A;  3H9Q A;  1P92 A;  1A6I A;  2RC4 A;  5H20 A;  3JPT A;  2IEK A;  3HOU J;  4JQF A;  3WK4 A;  3PQK A;  5KT2 A;  3OY9 A;  5HLH A;  2NRZ A;  2FQ3 A;  4EGZ A;  4RM2 A;  2KZG A;  3S17 J;  3R6S A;  2AHO B;  1SL1 A;  2HVS A;  3GV8 B;  3ZDD A;  3CO7 C;  1RKT A;  2QQ8 A;  2E1C A;  2LYC A;  5BNG A;  4ENM A;  2W1O A;  2PKE A;  3G1M A;  3F8C A;  5LHH A;  1MBK A;  8ICH A;  1FOK A;  1SV0 C;  4EJV A;  4DZP A;  5HR7 A;  5ALI A;  5CVI A;  3MD2 A;  3L2R A;  1QPM A;  3DBR B;  3TOB A;  1RG6 A;  2P66 A;  2W3R A;  1ZET A;  1NK4 A;  2QYO A;  4ANJ A;  4CIC A;  2LD5 A;  4XBF A;  5KFG A;  4C8L A;  2MFZ A;  2KG5 A;  5DD4 A;  1G3W A;  3OYE A;  3AN1 A;  9ICS A;  2IPQ X;  3TQN A;  4EMS A;  3HRD D;  1IIP A;  3BQY A;  3NRW A;  2DFL A;  3FKI J;  5BMZ A;  1QBJ A;  1UT5 A;  4MEY A;  4RB1 A;  5ALT A;  2OCC H;  4RQM A;  5AKX A;  4BE2 A;  3MBY A;  2YMM A;  2JJ7 A;  4FAS D;  2VON A;  3UXO A;  5F9N A;  4EM2 A;  4IKF A;  4YP3 A;  3OIQ A;  3B73 A;  2HDC A;  1MKM A;  1GDT A;  5EG0 B;  9ICL A;  2MC3 A;  2J5P A;  4ELT A;  2LKX A;  1FIA A;  2F8L A;  4JK1 A;  2HQN A;  8ICI A;  1X2M A;  1J59 A;  3E0F A;  5AIP A;  3IRU A;  3WK9 A;  1K78 A;  4ECY A;  3GIK A;  1H9G A;  2HHU A;  2DFH A;  2HGC A;  2WAQ F;  2PJR B;  3NS1 A;  4F4W A;  1X9X A;  1IXR C;  2A69 F;  1VQK I;  1ZRF A;  2D8C A;  4QZA A;  3HB9 A;  2Y9T A;  2E1E A;  1G3T A;  2F6C A;  4KIB A;  2QGU A;  2WWY A;  4YVZ A;  3CDL A;  1EKE A;  2JR5 A;  2JA2 A;  4KNY A;  1KYW A;  2IS4 A;  3Q8Q B;  2Q0O A;  2R3S A;  5IP9 J;  4ZC3 A;  3TP3 A;  2EV0 A;  2KSO A;  1VF9 A;  2IXS A;  1S0M A;  3CQZ J;  1LJ9 A;  2M0C A;  4KT5 C;  3G73 A;  5KFK A;  4LIT A;  4XRS A;  2A5W A;  5DBA A;  1ZGA A;  4HQM A;  2ZJR F;  3K0L A;  2QKM B;  4XSZ F;  2KKO A;  1Z3X A;  2XV4 S;  1TWG J;  4HAM A;  2BHN A;  1WH7 A;  1L7O A;  1XSN A;  9ICF A;  4Y52 J;  3OR2 C;  1IN8 A;  4YEL A;  5FRN A;  5B5E U;  5KFA A;  3K75 D;  3ZQF A;  5CEH A;  1BN5 A;  3PML A;  2KZZ A;  3ZXS A;  1U45 A;  3KP4 A;  2CUE A;  5AI0 A;  1D0Y A;  4ECV A;  1ZQJ A;  4I27 A;  3ULQ B;  3V7C A;  1I5Z A;  2AGP A;  1R1T A;  3JCU C;  3B6C A;  4TUR A;  1MNE A;  1RZ4 A;  5FD6 A;  2GXG A;  3LK9 A;  4FET A;  4AD9 A;  4AYB A;  1ZG5 A;  2HOT A;  3V6J A;  1MBF A;  1RPW A;  3GTM J;  4AP9 A;  1WCN A;  5KAI C;  2KKP A;  4IX7 A;  1UHU A;  3RH5 A;  4DSK A;  4QNL A;  1ZQP A;  1N5X A;  3F2D A;  4J9N A;  4KMO B;  1FOW A;  4XKB A;  1AHD P;  1D3Y A;  7ICN A;  4PGG A;  3P9C A;  4D7M A;  3WHC A;  2OF7 A;  3EET A;  2VBW A;  3S93 A;  2M5W A;  3RBD A;  2PI5 A;  1NOM A;  3E3V A;  3BT9 A;  2WAE A;  1I1S A;  1Z6R A;  3L1P A;  2LMD A;  2A5Y B;  2B0C A;  4Y2Y A;  2EZL A;  2P6R A;  3SYT A;  4DSI A;  3MDA A;  1KBU A;  8ICU A;  3OYH A;  1Y0U A;  2WHE A;  4JOM A;  3HBL A;  4MEX A;  2QWW A;  1K7A A;  4P0Q A;  2FBK A;  3SAH A;  5J0S A;  2FSW A;  2L7K A;  2M0M A;  1B1B A;  1IAW A;  1TAQ A;  2P8T A;  3E97 A;  4UQG A;  3ZDB A;  1TQI A;  1ZAR A;  2AQ0 A;  3N97 B;  2JUC A;  4KLL A;  1ACI A;  4FT8 A;  5IOZ A;  2BYV E;  4N9I A;  1WGX A;  3A4C A;  3CUQ A;  4HYE A;  3O3K A;  3IKT A;  4GC7 A;  1WKM A;  1YO5 C;  1NNL A;  2DOA A;  4DEZ A;  5ALL A;  1CGP A;  4KN7 X;  2PMU A;  1O4X A;  2M4G A;  4QZI A;  5JHU A;  3I28 A;  4MFF A;  1ORK A;  8ICN A;  1NK5 A;  2GOL A;  3AQE A;  2V1N A;  4KLO A;  1FTZ A;  2CV0 A;  2PI4 A;  2O5R A;  1BJA A;  1ETO A;  1N75 A;  2CGP A;  4V19 K;  2RGV A;  4KA4 A;  3F5E A;  5KG3 A;  1N2X A;  2M7A A;  3ABL H;  5K5R A;  3SAG A;  1NK8 A;  3WE3 A;  2QAR A;  5T14 A;  3C1D A;  4ECT A;  5JFR A;  5FLX K;  4F5R A;  3G6E I;  2GBY A;  1Z7U A;  4ZH4 F;  4DNC A;  1T6S A;  3OOP A;  3CCS I;  5K7Z A;  1A76 A;  2DA1 A;  3I54 A;  1X9M A;  3QUT A;  3SHF A;  3QYE A;  2W55 A;  1X3W B;  1X6J A;  3QU5 A;  1ZQG A;  3KTQ A;  3HTU A;  4DSJ A;  4F7Z A;  2E8O A;  1K6Y A;  3RZD J;  3HSE A;  1QZY A;  1ITY A;  4BDY A;  5HNK A;  4OIP F;  4O5V A;  2FJ6 A;  4B8X A;  1F44 A;  4KLG A;  3E5X A;  2OAZ A;  4MEX F;  2K8A A;  1L3U A;  1X1C A;  2YQE A;  3JW4 A;  1WCM J;  3EYI A;  3KPH A;  3UR3 C;  4YMO A;  2KT0 A;  4FQG A;  2LFB A;  4KN4 A;  1NHA A;  3GII A;  4ICA A;  5KFU A;  2K9L A;  3ZMU A;  1TK0 A;  2LY1 A;  2L4M A;  2OJE D;  4HW0 A;  4YMN A;  3KLO A;  1FNN A;  2DN0 A;  3ZQC A;  4F5N A;  1FBQ A;  3ISC A;  2YPR A;  3HKZ A;  3TGN A;  4CYC B;  4I2I A;  5J2H A;  1FC3 A;  1L8O A;  4U87 A;  5AON A;  3MZH A;  1X40 A;  2UXX A;  4EV0 A;  4FE3 A;  1HJP A;  1U5T C;  2MU2 A;  4TV7 A;  1WJ5 A;  3BR6 A;  2L9V A;  2EAO A;  4OJ6 A;  3MFK A;  4NDL A;  4HRI A;  1NJX A;  3BS5 A;  1DGW Y;  5DGA A;  7ICH A;  3NWT A;  1ZD2 P;  1DK2 A;  2EZH A;  3G1L A;  1MMA A;  4RQ3 A;  1IXC A;  2W4S A;  4X0G A;  3MAJ A;  3C28 A;  4O3R A;  2A1A A;  4PCQ A;  2M8E A;  1H8A C;  3VYU B;  1FFU A;  1WYG A;  2XY5 A;  4TQR A;  2PX9 A;  4E7H A;  2V6E A;  3I5U A;  4UUS B;  2HHS A;  3RQ4 A;  2R5Z B;  4FE7 A;  2JQ7 A;  1BPX A;  4C7Y A;  1VQL I;  2VL8 A;  1SL0 A;  3WG7 H;  2JXJ A;  4WF2 A;  4UXN A;  4IRG A;  2IOH A;  4AU7 A;  5M3M J;  5HNF A;  1S9F A;  1TK5 A;  2M7B A;  3EUH A;  4XOR A;  2XB0 X;  3JAM Z;  2I5H A;  3SAF A;  3KYD B;  5D4S A;  4K4H A;  5CJ7 A;  2XPV A;  2I1Q A;  1JI8 A;  2HQR A;  4UV8 A;  1XCV A;  2EIK H;  4RS8 A;  2LMR A;  1IW7 F;  2O0Y A;  3H3V K;  2QKQ A;  8ICR A;  3MZY A;  5ICG A;  4CYC A;  1Y88 A;  1WFX A;  4W97 A;  4UVA A;  4WWC A;  4J9P A;  1R22 A;  3TDZ C;  4PL1 A;  4XLE A;  1ZG3 A;  4PFP A;  4G12 A;  4E7Z A;  4RAG A;  4UAY A;  4PHD A;  4GXO A;  3L9F A;  3WTU C;  5J2A A;  1MJA A;  5B5E C;  2VOO A;  1U4B A;  4IS7 A;  1XD7 A;  2CG4 A;  1XN7 A;  2UXN A;  4ZDP A;  1YG2 A;  4DYR A;  2JEJ A;  2P35 A;  4Y2P A;  1G3S A;  4B4C A;  4UAR A;  3PO2 J;  2W9C B;  5D6E A;  4ITV A;  3NQO A;  3M8J A;  1FMW A;  1MSF C;  5GTH C;  3I71 A;  3COA C;  2CFX A;  4XNF A;  2DOF A;  5ICF A;  1RR8 C;  1JKO C;  3JR9 A;  5GTH U;  4B9L A;  4AYB N;  3GIM A;  4IRD A;  4KN7 A;  1SL2 A;  2O61 A;  4Q8E A;  1STZ A;  3B0Y A;  1PUZ A;  4DGW B;  5HHI A;  7ICS A;  3C2K A;  5J0X A;  4RUA A;  3KZI U;  1BR4 A;  3G6X A;  1ETK A;  5KFT A;  3J7Y J;  4NHJ A;  1ZN2 A;  1Z0X A;  5ALX A;  4M0A A;  4Q44 A;  2HVR A;  4C8N A;  3ASN H;  2M30 A;  1B22 A;  1ZOL A;  3AUO A;  4BJQ A;  1U5T A;  2CQQ A;  3HPG A;  4KLS A;  3Q8K A;  3TW6 A;  5TIS C;  2DJI A;  5DB8 A;  1HUO A;  2CPR A;  9ICP A;  2LKS A;  1IN6 A;  3OIP A;  4PSW A;  1W36 D;  4K2E A;  2HBK A;  1UEL B;  3F72 A;  4M9Z A;  2KK0 A;  1ZR4 A;  3E6M A;  1S97 A;  5EF6 A;  2Y2Z A;  1XWL A;  2VJ5 A;  3GME A;  4RNM A;  3CJN A;  4DSL A;  1QQI A;  2CH0 A;  1BJZ A;  3I0T A;  3B6A A;  3PW0 A;  4KLF A;  3TOA A;  2MUT B;  1YZ7 A;  4IL6 U;  3IDW A;  3E6D A;  1YHQ I;  4LZG A;  2EB7 A;  1Z67 A;  2E19 A;  2Y9Y A;  5CVV A;  4S05 A;  3WTS C;  3OJS A;  2RRE A;  2WAQ C;  2LKY A;  3VB2 A;  1DUX C;  4UNO A;  4KIS A;  4O3M A;  2EZI A;  2WAQ N;  1ZGJ A;  1YJ9 I;  2KFN A;  1S8N A;  2EV6 A;  1YIO A;  2WB1 F;  3FIS A;  2O6K A;  1ODD A;  2XGE A;  2QZ8 A;  4W1U A;  4BGD A;  4I2D A;  4DOC A;  4UBC A;  4F8R A;  4MF2 A;  5AIQ A;  4XA5 A;  1J0R A;  3CJQ B;  2XGQ A;  1XG1 A;  2KLO A;  5HDG A;  2PXI A;  2R7X A;  3F5A A;  1FBS A;  2Y0S A;  1ZQD A;  4I0B A;  4CF5 A;  3MFH A;  2EFW A;  4FFD A;  2AXT C;  1TAM A;  9ICT A;  4EEY A;  3GCM A;  2DXI A;  4NJ8 A;  1S6L A;  4DOZ A;  2E2H J;  2K60 A;  3ONN A;  2PMZ F;  2P4W A;  1S7A A;  3RTV A;  5DDM A;  4EEK A;  1XGM A;  3FMS A;  4QZB A;  3ML6 A;  1D1A A;  4EZ9 A;  4ECW A;  2R7Z J;  4YD2 A;  1T56 A;  2VAS A;  5C5J A;  9ICB A;  3PFY A;  5FP0 A;  2WY7 Q;  1G2H A;  1GV2 A;  3MC1 A;  1TT0 A;  3ZOB A;  4KFC A;  3QPL A;  3M9N B;  4P0P B;  4DLE A;  1RPL A;  3FXO A;  1EH8 A;  1OR7 A;  1BPE A;  3C29 A;  9ICI A;  4I2O A;  2M9N A;  1MH3 A;  2KIU A;  3H7I A;  1T8E A;  2COB A;  4HF2 A;  2HOQ A;  4CCO A;  2CQN A;  1AKH A;  3W2A A;  2JHD A;  2E8M A;  2PMZ C;  4UUV A;  4NL9 C;  3RRH A;  4MFD A;  1SMY F;  3N4M B;  2NRX A;  1OJL A;  5EZG A;  3H8S A;  5LGT A;  3I4N J;  2BOL A;  1ON1 A;  1EH6 A;  5IPA A;  2DKX A;  3W3C A;  3FKJ A;  5J0R A;  2WF6 A;  5AI8 A;  4HSR A;  2FNA A;  3HOT A;  3DKW A;  1NZP A;  5M5Y J;  1SAX A;  4UB1 A;  2Y1I A;  2M45 A;  4O9M A;  9ICH A;  5CWR A;  1B6A A;  3QZ7 A;  3C2B A;  3DQV C;  3QXG A;  5KFO A;  2K9N A;  2KRC A;  4OAY A;  2ZFU A;  3V7S A;  2BBY A;  3Q5F A;  2CRG A;  2BY2 A;  5H6R A;  4LLL A;  2KP6 A;  5J40 A;  1SFU A;  5DBC A;  3GQC A;  5GTI U;  4D1Q A;  1B59 A;  2XF5 A;  5EWG A;  3G6Y A;  4AVZ A;  4EQQ A;  3HPO A;  3S8P A;  5B66 C;  4KX3 A;  1T08 B;  2RNJ A;  5LHG A;  1IG7 A;  1D0Z A;  3BQT A;  5KFB A;  2RDJ A;  3GFL A;  4IF4 A;  2F5E A;  1XC9 A;  3V8K A;  4I2H A;  3K4G A;  3PW7 A;  1DDN A;  2E7X A;  1K78 B;  2ZIW B;  3E58 A;  5L3F A;  1LVA A;  5JTI A;  3CCM I;  1GVJ A;  1FYL A;  5TRD A;  3M7G A;  3V7L A;  5ALP A;  2VQL A;  3GVA A;  2EFQ A;  1HKT A;  2KIW A;  3PMN A;  1XMX A;  2Q4T A;  1L3V A;  2VPL A;  2V4J C;  1U78 A;  2Q8K A;  2Y69 H;  5CVR A;  1QPI A;  4J03 A;  5J0Q A;  4WXH A;  3RQI A;  3S1N J;  1IN7 A;  4U6P A;  2XID A;  4L5E A;  1ZD4 A;  2R93 J;  3KD3 A;  2EIM H;  3HRS A;  4RNO A;  3TO9 A;  2EFO A;  3TP0 A;  3WGH A;  4EM0 B;  4A3L J;  1SFX A;  2FXA A;  5AKL A;  5AKY A;  1GXQ A;  4GRI A;  3C5F A;  3MVP A;  4IHX A;  8ICQ A;  1W7P A;  3LVV A;  1W5S A;  8ICE A;  4Q8F A;  3Q8P B;  4KMU X;  2Q1Z B;  1WJB A;  3I55 I;  4RGR A;  4B3A A;  4L9J A;  2RAE A;  2Y0S F;  1ZQT A;  2DFE A;  3OV8 A;  4A3J J;  1VQN I;  2YML A;  1ZLK A;  5DB7 A;  4WXC A;  4QWD A;  3DPL C;  3ESW B;  1OCR H;  2HPI A;  2KPM A;  1L3L A;  1FBU A;  5HLI A;  3C23 A;  2C2D A;  3TKA A;  2OXO A;  3F2C A;  1MH4 A;  2MH2 A;  2HKO A;  2VKD A;  3IH4 A;  5ERI A;  2ZIW A;  2CQX A;  1NG6 A;  3GTL J;  2VJJ A;  5ILS A;  1IM4 A;  3AU2 A;  1RC9 A;  4FCY A;  1JT0 A;  4R65 A;  2XUB A;  1YE9 A;  5F27 A;  4IVN A;  4QLC U;  7ICR A;  3V4G A;  2F77 X;  1X3Z B;  4ELU A;  3ABM H;  4M2Y A;  2CSO A;  3L3F X;  1FOX A;  5J3L A;  2XPU A;  2AHQ A;  1ZTR A;  4R64 A;  3HRM A;  2RKH A;  3PSF A;  4O3O A;  5KL8 B;  5DS9 A;  5EZH A;  2WC2 A;  3T8T A;  2AH5 A;  5ALF A;  4JP0 A;  4DQQ A;  4EX7 A;  1VI0 A;  1JXL A;  3ASO H;  4F3O A;  3KBB A;  2D2W A;  2NVU B;  3CC4 I;  1JI7 A;  3KP7 A;  1UB9 A;  1U9N A;  3LSP A;  4BEH A;  3F6O A;  3D5S C;  2G7U A;  1BI3 A;  4M3E A;  5E1X A;  2P6U A;  1K83 J;  1U2W A;  4PZO A;  4JWM A;  7ICI A;  1OIS A;  2VKE A;  3KP3 A;  1UST A;  2QSG X;  4BXO A;  1ZQI A;  2KMD A;  4CZZ A;  5J8F A;  3HZJ A;  1T7P A;  2MLK A;  1EJ9 A;  3M6Z A;  7ICK A;  2DPU A;  4DFD A;  5J2B A;  5DCM B;  3T5X A;  2HYG D;  3TMO A;  2ZBK A;  3LQQ A;  1V97 A;  3U26 A;  2I9G A;  4AM3 A;  4X6A J;  4IRC A;  5IP7 J;  1WWV A;  2C2R A;  1FP2 A;  4XMY A;  1BBY A;  3K69 A;  3P9I A;  4XRM A;  1YIT I;  2L2O A;  1H89 C;  1JRO A;  1ON2 A;  2G07 A;  1NKC A;  4QWE A;  1U3E M;  3H8M A;  3R0A A;  4KX5 A;  4CNQ A;  4DYC A;  4XRH A;  4B44 A;  2L3D A;  4HPQ A;  1YS6 A;  5C44 J;  4DSE A;  5EE9 A;  5LEK A;  1DQU A;  1IUY A;  3C21 A;  3NWS A;  2WV1 A;  5DKW A;  4O5K A;  4XLF A;  4RDU A;  2E36 A;  4HF1 A;  5EDN A;  4M3F A;  1P7I A;  4C7Z A;  1JE8 A;  3I58 A;  2M3A A;  2FPM A;  3GFI A;  2L0K A;  1SAN A;  3S32 A;  1QH9 A;  3VOE A;  4F4K A;  5F04 A;  4D0P A;  2KQR A;  1J2M A;  4UB6 U;  3RFA A;  2ACJ A;  2L9N A;  4XRS G;  1UHM A;  3FX3 A;  2V1U A;  4RQN A;  4RGS A;  1LDJ A;  1YS7 A;  1ED1 A;  5ALZ A;  3MR5 A;  2DPI A;  3IHQ B;  3N05 A;  3CDI A;  1N48 A;  3I3L A;  5J47 A;  3HSF A;  5LLQ A;  5BOX A;  2O9L A;  5EWF A;  2K86 A;  2K4J A;  2H1K A;  5FKN A;  4KLI A;  4DFJ A;  1OR7 C;  2ZTD A;  2JEF A;  3H9J A;  1SVO A;  3C18 A;  3CLQ A;  4QZ8 A;  1P4W A;  5KNI A;  3RAQ A;  3BDP A;  1Y1V J;  4GFB A;  2W7O A;  1B8I A;  1K6O A;  3WK5 A;  3KZI C;  2R8J A;  2XRO A;  5E17 F;  4WJ3 B;  4IHT A;  4OAZ A;  3K1Z A;  4I09 A;  3EYZ A;  1SD7 A;  1T98 A;  3Q8M A;  1QRY A;  8ICX A;  2JRT A;  1QA6 A;  1Z77 A;  4B1R A;  2E1M B;  2KHM A;  2V9K A;  4CCK A;  4UB8 U;  5ALR A;  4NQW B;  3S3O A;  3S6J A;  2JA7 J;  3K4J A;  1AKH B;  2R7S A;  2FEZ A;  4EAT A;  2BY1 A;  2WAQ A;  4O3P A;  3K1P A;  2KDO A;  4B43 A;  3FWE A;  3GTO J;  1KGS A;  3H35 A;  2OM6 A;  2BCV A;  4IQW A;  2X1D A;  5A2Q Z;  4GXK A;  2DDA A;  5IY5 H;  2EIL H;  3DFG A;  2JPC A;  1YX5 A;  2ZXH A;  4NLC A;  2IHN A;  1PUF A;  5J8Y C;  5L1K A;  2MYS A;  1P7D A;  2NRV A;  2ME0 A;  3PO4 A;  1IN5 A;  2LG4 A;  1M1E B;  1T4G A;  2NRT A;  3PW4 A;  2LBF B;  3SZP A;  2OQR A;  2R7F A;  2ZO4 A;  2P5L C;  4GDF A;  1RET A;  2X0L A;  5AIC A;  2ZME A;  3B02 A;  4E70 A;  1A35 A;  2OH2 A;  1XO1 A;  5KHD A;  3ZN0 A;  3VDX A;  3F8B A;  2ZXI A;  3LA3 A;  1SGG A;  2HMX A;  4RQ8 A;  4QZE A;  3MR3 A;  3JTG A;  2CYY A;  3M7D A;  2K9S A;  2YR2 A;  4LJZ F;  4RLQ A;  3CW2 C;  4A3M J;  3OS2 A;  2ZJA A;  2M2E A;  2ZNY A;  5E18 F;  9ICK A;  1U48 A;  4Y17 A;  4RPX A;  1JTX A;  4B47 A;  4HF0 A;  1D8J A;  1Z00 A;  1D1B A;  3M1Y A;  3OYG A;  1SXE A;  4RPY A;  2TCT A;  2EH9 A;  2ESE A;  2FLL A;  4KLD A;  4BJ5 C;  3N97 A;  1WG8 A;  2PFB A;  3HGY A;  3M07 A;  2W85 A;  1UT8 A;  1XCB A;  1XTA A;  4IHW A;  4BE1 A;  1J2N A;  2OTL I;  2ZTC A;  3FDY A;  1QQ6 A;  1X42 A;  3F23 A;  1N63 A;  2R7R A;  4U7B A;  5AM5 A;  3L00 A;  3BTJ A;  2HTS A;  3RCO A;  2P7C B;  3SV4 A;  3BZC A;  3HDD A;  2OU2 A;  3AL0 B;  1QTM A;  2MC4 A;  3RJG A;  4M9J A;  4JMU A;  1S9H A;  5J2C A;  5LRS A;  1BIB A;  3GTG J;  1JTY A;  1E17 A;  4ED8 A;  3P7N A;  2LHT A;  2XKO A;  3S2D J;  3LSH A;  2E1F A;  4F5O A;  1ZHF A;  2P5V A;  2ZC2 A;  2BHZ A;  4ZZL A;  5L3D A;  3HT3 A;  2STT A;  5ALH A;  3AU6 A;  2K8B B;  1G6N A;  4C4T A;  1MN8 A;  3MGI A;  5JLW A;  5EE0 A;  3ZDA A;  1TWF J;  2C2E A;  2IT0 A;  3VSL A;  1ZKG A;  2LOO A;  4M6V A;  3OL3 A;  4BDZ A;  3ZQL A;  4YIF A;  1XPX A;  1A36 A;  3T0Y A;  2A3V A;  3HIL A;  2C28 A;  2BPF A;  3KET A;  3SZT A;  3BP8 A;  4RLF A;  4QWA A;  1Z1B A;  1DXS A;  1C7Y A;  4LFU A;  1U9L A;  1E2X A;  4H0E A;  1OCT C;  1BPZ A;  1K61 A;  5J6X A;  1HF0 A;  1TE2 A;  5KFQ A;  1WVR A;  3UMB A;  2I8D A;  3AMZ A;  5IIK A;  2K02 A;  3R61 A;  1KW4 A;  4YG2 A;  4LB6 B;  1R1V A;  3JSP A;  2LNB A;  4LD5 A;  9ICV A;  2M9H A;  3QPT A;  5TGT A;  1UG2 A;  1K1Q A;  4UHT A;  2J6T A;  3H4D A;  5EE3 A;  1HDD C;  5KFF A;  4DQI A;  1JHF A;  3M6K A;  1COK A;  4J9K A;  3C2L A;  4C4R A;  1JT6 A;  1RYU A;  1N56 A;  4E7I A;  3ZR8 X;  3RPU A;  2E5Z A;  1YIJ I;  3O8G A;  4Y2R A;  1XGS A;  2KNJ A;  1FO4 A;  5EWE A;  2QCO A;  2L4A A;  3NTU A;  5KFW A;  3C5G A;  2EBI A;  2XSD C;  4DYQ A;  1C20 A;  8ICP A;  2LP0 A;  4ZYA A;  2MBF A;  3K6G A;  3I56 I;  1F0M A;  3RKY A;  4PHE A;  1HEK A;  2PQ8 A;  2MD5 A;  3EUK L;  4C2M J;  2GAU A;  2BE5 F;  5AI4 A;  4DL2 A;  2HCF A;  4XIC A;  3LWL A;  4IQJ A;  1JUD A;  1RES A;  1D5V A;  4UB3 A;  4LIV A;  3TAN A;  2ID3 A;  4S04 A;  1DU6 A;  1S5L U;  2R7W A;  2F1H A;  2DMP A;  3RRG A;  4R8U A;  4RMN A;  4CRX A;  3HJE A;  1FSH A;  2DBY A;  2HQA A;  1OCZ H;  1ZRD A;  1NK0 A;  3LSR A;  1HUZ A;  2AJQ A;  4UUS A;  1N77 A;  2CV2 A;  4AC0 A;  4A8E A;  4R8H A;  4B9V A;  3KE2 A;  3HC7 A;  3LSG A;  4KIC A;  2EZK A;  4RZR A;  3GV5 B;  4DS4 A;  3K4L A;  1I39 A;  4B9T A;  2OUM A;  3K4B A;  5CA7 A;  2KFZ A;  3HIF A;  3S16 J;  4A12 A;  5E3M A;  2KIF A;  4BEH B;  4P4P A;  4UAW A;  3RPU D;  5FLM J;  3NVW A;  4OJP A;  7ICQ A;  4XSX F;  1LB2 B;  2J6U A;  3T5J A;  3FYH A;  4M04 A;  1BPD A;  1X9S A;  1I6X A;  3A0H C;  4XOT A;  1KU3 A;  4MLO A;  1FYM A;  4O3S A;  5DD8 A;  3CCU I;  3JRB A;  2ODG A;  3H5N A;  4GFJ A;  3T5L A;  2EWN A;  4A3K J;  2NNN A;  5LFA A;  4DL5 A;  4EYH B;  3BC8 A;  2KIC A;  3J81 j;  1XSV A;  1Z3Y A;  3NVZ A;  3A0B C;  4KUM A;  3HRT A;  5ALD A;  4E0D A;  2LKP A;  2ZIU B;  1TP4 A;  4CCL A;  2XF6 A;  3B9J A;  9ICM A;  2CFO A;  3GTP J;  1F4K A;  2STW A;  2IBD A;  1GHC A;  3OSG A;  1ZQE A;  3K4K A;  1N78 A;  1Z21 A;  2PLY A;  4ON0 A;  3ERM A;  1QHG A;  5KG2 A;  4J9S A;  3D2S A;  1Y6I A;  5J0Y A;  4E7S A;  4GYI A;  1VND A;  2R0Q C;  4RM3 A;  2L7Z A;  5TIS U;  3AL0 C;  4ELV A;  2QQA A;  4N4O B;  2XRN A;  4E6K G;  1B9N A;  1R23 A;  4GYG A;  2NO5 A;  1L6N A;  1HSJ A;  3H36 A;  1I3Q J;  3H0D A;  5AM0 A;  3IAM 2;  4D7N A;  4US9 A;  3WGI A;  1V55 H;  2HZT A;  3NGD A;  2FOK A;  3PIP F;  2HYJ A;  4NQW A;  5E1Z B;  2MA1 A;  3H0R B;  1OUQ A;  8ICA A;  4IL6 C;  4IXA A;  4LB5 A;  2YN4 A;  1OFC X;  3IN5 A;  3PZP A;  3A1Y A;  9ICG A;  5KAI U;  3C1Z A;  1NK7 A;  5KT6 A;  1X2N A;  3DTE A;  5KFZ A;  2W54 A;  3C2G A;  3NUQ A;  4IRK A;  3BTL A;  2ZSI B;  2QEX I;  1U0J A;  2CWE A;  3MCZ A;  1I3A A;  2VE9 A;  1RRJ A;  1R7J A;  3GWZ A;  2HEO A;  4OJO A;  3WKA A;  3HW8 A;  3V6K A;  1S0O A;  4I99 C;  1ZQH A;  5J4Y A;  2ISY A;  1V38 A;  4DFM A;  2DTR A;  4KYW A;  2VA2 A;  3DEE A;  4UB5 A;  2R7T A;  4R79 A;  5J29 A;  1YOV B;  2VOP A;  3SMV A;  2BY3 A;  2EAN A;  4KT6 A;  2XIG A;  1ETQ A;  2FPK A;  3LAJ A;  2L9R A;  5DM7 F;  3UM9 A;  5A2Q K;  2DDB A;  4IRH A;  1NZB A;  8ICF A;  1KQQ A;  9ICQ A;  2IA6 A;  3CDH A;  5CJ9 A;  2YX7 A;  2AU0 A;  2AQE A;  1WWU A;  3RR7 A;  3MN2 A;  1FY7 A;  2XGC A;  4CCN A;  2MA3 A;  1VZ0 A;  1YRN B;  1OCP A;  1TWA J;  4FX0 A;  4XQF A;  4G9Y A;  2NV3 A;  5F0C A;  3BCA A;  4EM1 A;  2VIX A;  5DDG A;  3HKZ C;  4USA A;  5KL1 B;  4YII A;  5CVU A;  3R9K A;  1JUM A;  3DU6 A;  3OL4 A;  4IO9 F;  4NLB A;  1L3T A;  4C3J J;  3RI4 A;  2GZW A;  2CW7 A;  3CMA I;  3JPS A;  5AKE A;  4RQ1 A;  1N25 A;  1RUO A;  4FHT A;  3K4N A;  2DT7 B;  4IQ4 A;  3TED A;  1JX4 A;  3UQ2 A;  2JMW A;  4FO6 A;  1B72 B;  3JRF A;  1REP C;  2LR8 A;  1WWX A;  1T8I A;  2LBO A;  3TDU C;  2KJ8 A;  3KHH A;  3M8F A;  1O7F A;  3V7R A;  1U47 A;  1RYS A;  1WJF A;  3ISP A;  5JHF A;  4KIT B;  3IH2 A;  1JUS A;  1YRN A;  5ALG A;  9ICE A;  4O5E A;  1TWC J;  5AIB A;  2PFO A;  4C8K A;  4UVB A;  2E1O A;  2B0L A;  2QM3 A;  3DPT A;  3HHG A;  1SKR A;  1AA7 A;  5DG8 A;  1ZQK A;  5IYB J;  1KU9 A;  2DYR H;  2F4I A;  4CH7 A;  4YR3 A;  7ICL A;  3HEF A;  3O2P E;  4C9Y A;  5HVQ C;  3V8L A;  2Y30 A;  4J9R A;  4BY1 J;  2X9D A;  3SEI A;  4I2E A;  2BKE A;  1KA8 A;  2DQL A;  1LE8 A;  2PJP A;  2D3D A;  3KHL A;  2JV3 A;  1IF1 A;  2Y48 A;  3RPQ A;  1B72 A;  2XAS A;  3MQ0 A;  4EBE A;  1HKQ A;  5BPD A;  1R9T J;  1V4R A;  3OMY A;  5J4V A;  1FEZ A;  3H40 A;  4DFK A;  2Y0S N;  4RA2 A;  2OPT A;  2DF4 B;  5D5U B;  4IC9 A;  3GUD A;  4K4G A;  4S0H B;  3ELK A;  3WTT C;  1R5G A;  4I01 A;  4UB2 A;  4M9N A;  2UWM A;  1NJW A;  4JWN A;  2G06 A;  4O5C A;  1Z6T A;  4C2T A;  2LPE A;  1KYZ A;  1MD0 A;  2A19 A;  4HEA 2;  3FC4 A;  1P4A A;  2BDP A;  5E3N A;  3RKW A;  1OCO H;  2JK3 A;  3U2R A;  4YFX F;  5J1U A;  2GO7 A;  5ALU A;  2HDW A;  3MGV A;  3M1E A;  3ISB A;  4RNN A;  2ES6 A;  1MDM B;  1V5E A;  2MAB A;  2K9M A;  2E71 A;  3RAX A;  3NAU A;  1QZE A;  4G6D A;  2R8G A;  4ESF A;  5DUK A;  5KAF U;  2LYH A;  2DYS H;  4ECR A;  7ICF A;  4XM3 A;  1XS9 A;  4RAF A;  2F2E A;  4RQ6 A;  2JPB A;  1BC8 C;  1JRP A;  1UZC A;  4JYK A;  4FS1 A;  4EYI B;  1Z1D A;  3WU0 A;  1BPY A;  8ICY A;  4WCG A;  3THV A;  3DKY A;  4M9X A;  2DFF A;  4B3X A;  4LLN A;  1YW9 A;  4DWI A;  5KFN A;  1BIA A;  1L7M A;  4C4S A;  3QAH A;  2HHX A;  1R71 A;  2Z2S B;  4J01 A;  3JPR A;  4LOC A;  3BRO A;  1T0F A;  2H8R A;  4AYB F;  1TVA A;  4PPX A;  3WK8 A;  1X3U A;  5BOM A;  2P81 A;  2AGO A;  1W4M A;  4Y2V A;  5E8I A;  1PP8 F;  2FLP A;  4P96 A;  2HXI A;  2EFN A;  2Y75 A;  3WTY C;  1QO0 D;  3KFW X;  1F43 A;  1QVU A;  4NLZ A;  2JTV A;  1V85 A;  1KRP A;  4A3F J;  1V5F A;  1Y56 A;  2LYB A;  5KT5 A;  5C0Y A;  1NK2 P;  1KTQ A;  4Y2S A;  3OYC A;  2F4M B;  4BL0 B;  3TBI A;  2XF7 A;  1ZYR F;  2JUG A;  2PN6 A;  1APL C;  4AIJ A;  2BCR A;  3K10 A;  3RJK A;  3HWT A;  4N9H A;  3A01 A;  1HA8 A;  4G7H F;  5DLF A;  1KZH A;  2Q2E B;  3MFI A;  3QU9 A;  4ZTF A;  2VE8 A;  2ZCW A;  1NI3 A;  2KE7 A;  4O0I A;  2LC2 A;  3GZF A;  3KP6 A;  2YMP A;  1O57 A;  1BW6 A;  2FRH A;  4OIR F;  4OU0 A;  4CCM A;  4A0Y A;  1Y8Q B;  2DMT A;  2W9B A;  5JU5 A;  1BW5 A;  2ZKZ A;  2HI3 A;  4MHV A;  1KLN A;  1D9F A;  2CV1 A;  2EA4 A;  3JRA A;  1XDS A;  1O7L A;  2VBY A;  4M9L A;  1SWV A;  4BBS J;  3RR8 A;  3VYS B;  3QYP A;  1O03 A;  5FFZ A;  1IJW C;  5L3G A;  3H3U A;  4Y2U A;  1VQP I;  1MC8 A;  5GAH J;  1K79 A;  3SEN A;  3IHU A;  2XSJ C;  1BOB A;  3OYM A;  3N28 A;  4BBR J;  4DL7 A;  4QZ9 A;  3RB4 A;  2ZIV B;  3RKQ A;  1FTT A;  3ZQI A;  2WB1 A;  1KQ0 A;  2G7H A;  2IS2 A;  2ZTE A;  2DT6 A;  3NRV A;  4CHU A;  2ZIU A;  4DOB A;  1W1W E;  1RXV A;  4ED3 A;  4B9S A;  3JSO A;  3LSJ A;  1SFK A;  2L01 A;  2M87 A;  4UAT A;  2CO5 A;  1JAL A;  3NVV A;  5J2G A;  4PJJ A;  1Z1V A;  1NG7 A;  2FX0 A;  2DK8 A;  5CQG A;  2WY8 Q;  4CUG A;  1LVH A;  5E3O A;  1ZQV A;  2M0N A;  4YR0 A;  3OGU A;  3T8R A;  2XY6 A;  1L5U A;  5CRX A;  2DMQ A;  3JRG A;  2JVH A;  2ZUD A;  4YXJ A;  5D49 A;  1POG A;  5EGO B;  4HLX A;  2R8I A;  3L09 A;  5L1M A;  3T3F A;  1CRX A;  3RYP A;  2CUJ A;  2UVV A;  1K4T A;  1KFT A;  4OD0 A;  3ZRG A;  3WTV C;  2FI1 A;  5III A;  3MR2 A;  2BPG A;  1RNL A;  2HBM A;  3W6K B;  3ORY A;  2E7W A;  3HG9 A;  4Z6E A;  4ASN A;  1W36 C;  1R00 A;  1PK1 B;  2DUY A;  4Z6F A;  1XSP A;  2PEX A;  4M71 A;  2K89 A;  2JWT A;  1ZRC A;  3SZ2 A;  5D8K B;  3OS1 A;  4N0B A;  3OR1 C;  4BHP A;  1VQ9 I;  2XGX A;  2BHY A;  4BHC A;  3I53 A;  2LF7 A;  4KLJ A;  2NRA C;  2ISP A;  5DCM A;  1ZAO A;  4M6Y A;  1GO3 F;  1P6R A;  2H09 A;  2MGQ A;  3K4C A;  3U1D A;  4F2R A;  2R5Y A;  2EIJ H;  5HNH A;  3SR6 A;  1BC7 C;  4F5P A;  2XC9 A;  5AKI A;  1S3J A;  3CZ6 A;  3K4M A;  1DU0 A;  4F55 A;  4QWC A;  2OC6 A;  2N1R A;  3EQL F;  2QLZ A;  1DGR M;  2HDO A;  4R1H A;  3T1B A;  3BWG A;  2N8G A;  4LMY A;  4FTH A;  2LYA A;  3M9M B;  3J7A Y;  8ICT A;  2NVQ J;  5AKH A;  3OS0 A;  1LEA A;  2HNH A;  5ALW A;  4QIW C;  3PNT A;  5AM4 A;  1TC3 C;  2RRD A;  3F21 A;  4OIQ F;  2HI0 A;  1IG6 A;  2K4B A;  2L7M P;  2A3S A;  2MG4 A;  3DU5 A;  3QYF A;  1BGX T;  2NXN B;  4PSX A;  3PSI A;  2IS1 A;  2L7F P;  2RQ5 A;  2OA4 A;  4D5C A;  1MQ3 A;  3F53 A;  5HS7 A;  2LM4 A;  3EWA A;  3E7L A;  3UMG A;  2KV2 A;  2DJN A;  3GU3 A;  7ICU A;  3K9T A;  4ENK A;  3CUO A;  4KN4 X;  2E1M C;  5AK6 A;  4PGX A;  3JPQ A;  1TQP A;  2ZJ5 A;  4IOA F;  2DPJ A;  4UB6 C;  4LGW A;  4RQ4 A;  7ICO A;  1WQ2 A;  4EBC A;  3CC2 I;  5L3E A;  5AKK A;  1QNT A;  5JUM A;  5KFY A;  4L9T A;  2F2A B;  1ZQC A;  2V79 A;  1T33 A;  4P9U A;  5KAF C;  3D5L A;  3LQR A;  1VLB A;  5J0W A;  3Q9S A;  4DZJ A;  3OYI A;  4YMM A;  2KJC A;  5IIM A;  4A0X A;  4F4Z A;  3HUG B;  3GIJ A;  5HR6 A;  2ASJ A;  3W2W A;  5F6F A;  3UMC A;  3Q8S B;  2W11 A;  1XGO A;  5HHH A;  1G8X A;  1JJ6 C;  5DQH A;  3OYL A;  2Y0M A;  4C2U A;  4YD1 A;  3RH6 A;  1YJW I;  1ZQL A;  4P5O A;  2FU4 A;  2A07 F;  3CC7 I;  4XKC A;  1IZ1 A;  2MLG A;  2QUF A;  5HLT A;  2WF9 A;  5KFI A;  1ZQ1 C;  2JH1 A;  1PUE E;  3UPQ A;  4FBU A;  1FPQ A;  2DA6 A;  1S0V A;  4ED1 A;  3BPX A;  3DWL E;  2H3I A;  2ZJ2 A;  3HPH A;  1HBX G;  2NVT J;  3C2M A;  1MBE A;  3DLL F;  5AHX A;  1ENH A;  1A0P A;  4KLE A;  3J81 Z;  3SI8 A;  2LVS A;  1B9M A;  3E0J B;  1JGG A;  4FBT A;  3DV9 A;  4DL4 A;  4QZC A;  4ZDL A;  2CRX A;  3N7S C;  4F91 B;  1J5Y A;  4BH9 A;  2QBY B;  1J9I A;  5DM6 F;  2E3T A;  3LA2 A;  2F1I A;  2XIC A;  3H8J A;  5J0T A;  1SFO J;  5KFM A;  1MDM A;  1WH5 A;  4XK4 A;  3RJE A;  5FKK A;  1SKS A;  4CCJ A;  5BS6 A;  4Q43 A;  4QJF B;  2WV0 A;  2DCE A;  3QQA A;  1LVK A;  1IV8 A;  2D1H A;  2LDU A;  5E79 C;  5EG0 A;  3C1Y A;  3D6J A;  3PX0 A;  4FZN A;  3H92 A;  3ETR A;  1BL0 A;  3O0F A;  3HUG A;  1NK6 A;  2VI6 A;  5DLG A;  1GV5 A;  1ETY A;  2KJ9 A;  3F6V A;  3CCV I;  8ICK A;  4MTE A;  5CHG A;  3E6B A;  2BQR A;  1D0X A;  2OZU A;  3QU6 A;  5KTQ A;  3FK7 A;  2X6W A;  2G0A A;  1R6R A;  2BCU A;  2YX4 A;  4PHP A;  4I2C A;  1YZ6 A;  3EPI A;  3J80 K;  3KYL A;  1UHW A;  2W48 A;  3M8S A;  4XLC A;  3R4K A;  2F5F A;  2L54 A;  4IHV A;  1F5S A;  4M73 A;  2P6T A;  2ZFW A;  4D9J A;  2AQ4 A;  3HXL A;  1JKQ C;  4U0Y A;  2WF8 A;  2HHQ A;  4AWX B;  2E5N A;  2QSF X;  5FJ8 J;  3TAC B;  1LDK B;  2FDR A;  1TNT A;  3HYI A;  1FZP B;  3PR4 A;  1VTN C;  4MO7 A;  3QX7 A;  1WJD A;  5J2J A;  5DB9 A;  3LOC A;  3ECH A;  2XHK A;  3V7J A;  4HDU A;  4BJ6 C;  2AS5 F;  4A3C J;  5CR0 A;  2ZNZ A;  3ZQH A;  4AIK A;  3QUQ A;  2Z16 A;  5JRT A;  3DXJ F;  2XAH A;  4I0A A;  3REO A;  2W24 A;  1RQL A;  3HX0 A;  1W7P D;  3QU4 A;  4DLG A;  2IBK A;  2V9P A;  4PJ0 C;  2VAN A;  2LH9 A;  2RLT A;  3E2E A;  3FMQ A;  2P6S A;  3FBI B;  3BG9 A;  4MTD A;  9ICJ A;  2JZY A;  3OHB A;  1Z00 B;  1ZQM A;  4CCH A;  2M34 A;  4ZYE A;  4J19 A;  4Z6C A;  5J2I A;  1SIJ A;  5BPC A;  5AM3 A;  2DMN A;  5E20 A;  5F9L A;  1ZQR A;  2NYV A;  1OLT A;  3DLA A;  5AK4 A;  8ICZ A;  1XC5 A;  4U88 A;  4DF8 A;  5EOZ A;  1QQ5 A;  3DTK A;  4EX6 A;  2XO7 A;  3QOE A;  2PI0 A;  4BY7 J;  2WBM A;  4HG2 A;  1W0U A;  1R49 A;  4CF3 A;  2ZB9 A;  3RZO J;  4RQ0 A;  2L5Q A;  2QF7 A;  3BG7 A;  4ESJ A;  4YG2 F;  4H4K C;  1A77 A;  4ZOH C;  1U5T B;  3AG4 H;  3DTI A;  4NB5 A;  2XCP A;  5JR3 A;  3FM3 A;  2NS0 A;  3K2A A;  2KDZ A;  2E8P A;  2KD1 A;  5J2E A;  4G6T B;  2Z7J A;  4Y33 A;  2MH9 A;  2IOF A;  2I6X A;  4E7K A;  3S1Q J;  1ZH5 A;  3C7J A;  2OCE A;  1GXP A;  1SV4 A;  5IOY A;  4LJX A;  4E4H A;  4EGY A;  2QQ9 A;  2YX8 A;  2FMY A;  3BQ1 A;  4A6D A;  3I76 A;  1ZQA A;  1N61 A;  1ZQY A;  4M3B A;  5CYV A;  4U7C A;  4R63 A;  3IRR A;  5ILU A;  4M3G A;  5LRR A;  2HBL A;  2ZIX A;  5AI9 A;  1S76 D;  1VFC A;  1L7P A;  2GXA A;  2Y9Z A;  2NRW A;  1ZQB A;  2JEG A;  1TWH J;  4FE4 A;  1IV6 A;  4MFA A;  1FLI A;  3FZV A;  4XLA A;  4HA8 A;  4BAC A;  3KHR A;  4TUP A;  2Z99 A;  3BY6 A;  1SWW A;  2BR0 A;  1S0N A;  3ZQQ A;  2DO7 A;  1F36 A;  4P4O A;  3ZDC A;  4DL3 A;  2HQ5 A;  5CPR B;  2EH3 A;  1BVS A;  4HQE A;  4D5F A; 
#chains in the Genus database with same CATH homology
 5CQE A;  1KBU A;  3OYH A;  1HEK A;  4FZL A;  2NOJ B;  4JOM A;  3EUK L;  2JMG A;  4ACO A;  2VQC A;  3G2B A;  4P0Q A;  3SAH A;  4KJZ A;  2L7K A;  2M0M A;  3F9K A;  4ZJZ A;  4IQJ A;  3IAS 2;  3T79 A;  4LIV A;  2VKH A;  3AQF A;  2R7W A;  4F52 A;  3ALR A;  1MMG A;  3LYS A;  4RMN A;  4CRX A;  2HBJ A;  4CSW A;  3A4C A;  2HQA A;  1MW7 A;  2DOA A;  2R7V A;  2M4G A;  1N77 A;  2CV2 A;  4A8E A;  3LSG A;  3HC7 A;  4F92 B;  2LRD A;  2ZG6 A;  3K4L A;  1XNS A;  2OUM A;  3K4B A;  2GOL A;  2XDV A;  3H0M B;  2RP5 A;  2V1N A;  3AQE A;  4CGZ A;  2CV0 A;  4BEH B;  2O5R A;  3RPU D;  4OJP A;  1N75 A;  5CKT A;  3F5E A;  3CF2 A;  3HL2 A;  2M7A A;  3SAG A;  1FMV A;  1WJA A;  5T14 A;  3OOU A;  2F76 X;  4XOT A;  2JGA A;  4MLO A;  1QU3 A;  4PFO A;  2Y0S C;  4DBQ A;  4QPO A;  3H5N A;  4GFJ A;  5LFA A;  3QYE A;  3BC8 A;  2KIC A;  2K5C A;  1Z3Y A;  2MRL A;  1K6Y A;  3KEY A;  3QOD A;  4Y3O A;  4P0Q B;  2VXZ A;  4CCL A;  2DQN B;  2XF6 A;  4BDY A;  4C30 A;  2ZIU B;  2CFO A;  1F44 A;  2G08 A;  2K8A A;  2A6T A;  2KL4 A;  1X1C A;  3K4K A;  1N78 A;  1Z21 A;  1A6S A;  3UR3 C;  1QHG A;  3D2S A;  1Y6I A;  4LG3 A;  4OWR B;  4E7S A;  3FBN B;  4NUB A;  4ICA A;  2K9L A;  1PVP A;  4RM3 A;  1YT3 A;  3DKX A;  2LY1 A;  3AL0 C;  4N4O B;  3L2V A;  1LKX A;  4XLH A;  3PNY A;  4E6K G;  4BQQ A;  1L6N A;  3HKZ A;  3H0D A;  3IAM 2;  3I9V 2;  2JSP A;  1X4P A;  1V5G A;  4U87 A;  3L2U A;  2PJR A;  3H0L B;  3H0R B;  3N7P D;  2MA1 A;  4FE3 A;  1OUQ A;  1WJ5 A;  4OJ6 A;  3IN5 A;  2RQQ A;  3PZP A;  3A1Y A;  2KKV A;  4HRI A;  1DGW Y;  3NWT A;  3SZG A;  1P9Q C;  3DTE A;  1MMA A;  2LBF A;  3C2G A;  2W4S A;  4X0G A;  3NUQ A;  2ZSI B;  3FHN A;  1U0J A;  4PJL A;  3C28 A;  3SEZ A;  4OJO A;  1BR2 A;  3VYU B;  5KNL A;  4E7H A;  4N4N B;  2V6E A;  3DEE A;  3HKZ F;  1XO0 A;  3RTR A;  3D2Q A;  3CES A;  2R7T A;  2KZV A;  3RQ4 A;  4R79 A;  3SMV A;  2VL8 A;  3VWB A;  4KT6 A;  2BW3 A;  4BUP A;  4AU7 A;  5HNF A;  1HIW A;  1NZB A;  2M7B A;  4XOR A;  3CYM A;  2JH7 A;  3SAF A;  2AQE A;  4XKV A;  4CDG A;  4II2 A;  4CCN A;  1JI8 A;  1VZ0 A;  2HPM A;  4XQF A;  2NV3 A;  3BCA A;  3A2K A;  2VIX A;  2H3Q A;  1WJC A;  3HKZ C;  1WFX A;  2HU9 A;  3OYK A;  5KL1 B;  3DU6 A;  3MMY B;  3OL4 A;  4XLE A;  4NLB A;  4PFP A;  4NV0 A;  4E7Z A;  4PL1 A;  3ZCO A;  2CW7 A;  2KRH A;  4NC8 A;  3CRX A;  1X1A A;  2X6X A;  2CMP A;  1PVR A;  3GBG A;  4II3 A;  4XOP A;  3K4N A;  2DT7 B;  2E60 A;  4IQ4 A;  4ZDP A;  4BXF A;  1EA3 A;  3OYN A;  4ITV A;  2LBO A;  3UNG C;  3M8J A;  1FMW A;  2FUG 2;  2R7U A;  2KJ8 A;  5A0L A;  2RNG A;  2UV1 A;  4J00 A;  1Z19 A;  4YRV A;  4OO1 J;  4XNF A;  4HST A;  1WJF A;  4BS9 A;  3OYA A;  5JHF A;  2KMU A;  4KIT B;  3IG5 A;  3PUB A;  3VYR B;  3LSI A;  4DGW B;  2X1C A;  3LSK A;  3DPT A;  3VSK A;  2VJ4 A;  1AA7 A;  1BR4 A;  2F4I A;  4CH7 A;  3M1C A;  2HVR A;  4C9Y A;  5HVQ C;  3H5A A;  3L2W A;  3S3M A;  4BJQ A;  3HPG A;  4YEJ A;  3KFU F;  1URJ A;  2DJI A;  3KZX A;  1MMN A;  2CPR A;  3OIP A;  4PSW A;  3OMY A;  1D1C A;  4NNJ A;  1W36 D;  1UEL B;  3OYF A;  2HBK A;  2Z1D A;  2K8C B;  1Q3U A;  2VJ5 A;  3OWT A;  4FZM A;  2DF4 B;  2CH0 A;  2BVM A;  4IC9 A;  2VLA A;  2W04 A;  3EUA A;  2UWM A;  4DIQ A;  3VYT B;  2G06 A;  1X19 A;  2RRE A;  4C2T A;  2WAQ C;  2LKY A;  4HEA 2;  1T0F C;  4KIS A;  4O3M A;  2MD0 A;  3PSP A;  2HDW A;  3MGV A;  1YX3 A;  2WB1 F;  1V5E A;  2MAB A;  2HZD A;  2K9M A;  2R7O A;  4BGD A;  4PK4 A;  3K70 C;  3CJQ B;  4XM3 A;  3KX2 A;  4PJN A;  2OYY A;  3LVW A;  2KLO A;  2XAU A;  2R7X A;  3F5A A;  2Y0S A;  3DKY A;  2KVC A;  4B3X A;  1TAM A;  2DXI A;  2X51 A;  1QHH D;  4DOZ A;  2XVT A;  2BDU A;  2Z2S B;  4J01 A;  2PMZ F;  3ONN A;  2X85 A;  4AYB F;  4DJA A;  2G5H B;  1D1A A;  1J09 A;  2V7F A;  2PMZ A;  2VAS A;  1UAA A;  3PFY A;  2IS6 A;  3VCB A;  4C0Z A;  3PJR A;  2WY7 Q;  2R7Q A;  2P0W A;  4P0P A;  1KON A;  2D6F C;  1TT0 A;  4P0P B;  2V26 A;  2H3V A;  1V5F A;  1Y56 A;  2LYB A;  2IGN A;  2YB4 A;  5C0Y A;  3C29 A;  3OYC A;  1SAU A;  4BL0 B;  2WA0 A;  3TBI A;  2XF7 A;  5FRM A;  2GOX B;  2JUG A;  4CCO A;  2HOQ A;  2JHD A;  3K10 A;  3W2A A;  2PMZ C;  3K70 D;  1HA8 A;  2F5V A;  2ZSH B;  2Q2E B;  2UUZ A;  2BOL A;  4ZTF A;  2G09 A;  3W3C A;  3FKJ A;  2LC2 A;  4HSR A;  2GOM A;  3GZF A;  4P1W A;  3HOT A;  3H9G A;  4F3Q A;  1X4O A;  2HOF A;  4CCM A;  2H3Z A;  2CW8 A;  3QYB A;  3DQV C;  2WB1 C;  2KRC A;  4OAY A;  4XN3 A;  2ZFU A;  1G59 A;  2CV1 A;  2KP6 A;  4BE0 A;  3N7R C;  4XON A;  3LSM A;  4D1Q A;  2XF5 A;  3VYS B;  2VB6 A;  4AVZ A;  4B48 A;  2H3F A;  3IP4 B;  3SQI A;  3OYD A;  3S8P A;  4KX3 A;  1MMD A;  2K4H A;  1D0Z A;  3OYM A;  2XSJ C;  1BOB A;  4XN0 A;  4CZC A;  2X6Y A;  2ZIV B;  2WB1 A;  2IS2 A;  1BR1 A;  2DT6 A;  2ZIU A;  2ZIV A;  2ZIW B;  1SFK A;  2M4K A;  4ZDO A;  2R18 A;  4PJJ A;  1NG7 A;  3LMM A;  5CQG A;  2QKL B;  2WY8 Q;  4CUG A;  1WUD A;  2M0N A;  2VQL A;  2VXD A;  2KIW A;  2Q4T A;  5CRX A;  2JVH A;  2VPL A;  2RHF A;  3OPX A;  2V4J C;  2VQH A;  4OJL A;  3IG8 A;  1CRX A;  2CUJ A;  4XL9 A;  3S3N A;  3ZRG A;  4U6P A;  3CP8 A;  2HBM A;  2W00 A;  1ZEL A;  4CA0 A;  2XID A;  3HG9 A;  1W36 C;  2W82 A;  4XR6 A;  2K89 A;  1SZH A;  2BW3 B;  1T95 A;  2IGK A;  4GRI A;  3OS1 A;  3OR1 C;  2CN1 A;  2E5S A;  4DBR A;  3LVV A;  1WJE A;  3CP2 A;  3AKZ A;  2Q1Z B;  3H5R A;  1WJB A;  5FRO A;  2L9S A;  4F93 B;  1GO3 F;  2Y0S F;  3K4C A;  1DRG A;  2KJ5 A;  5HNH A;  3MKY B;  3LFU A;  3CZ6 A;  3DPL C;  3K4M A;  2HPI A;  4E7J A;  2JVG A;  2KPM A;  4XKW A;  4F55 A;  1DP3 A;  4BX9 C;  2OC6 A;  2N1R A;  1MND A;  2OXO A;  1X1D A;  3V42 A;  1DGR M;  3F2C A;  1Q3V A;  2VKD A;  2LYA A;  2ZIW A;  1MA7 A;  4NWI A;  3J7A Y;  3SDB A;  1NG6 A;  3OS0 A;  2VJJ A;  2HNH A;  2K4E A;  2K3P A;  3OYB A;  3PNT A;  4BU2 A;  2ZIX B;  4QIW C;  4PUS A;  2RRD A;  4PJM A;  2X1E A;  4BQN A;  2AQF A;  3QYF A;  3DU5 A;  1YE9 A;  2KOB A;  4PSX A;  3PSI A;  2IS1 A;  3DPU A;  2R4G A;  2F77 X;  1T94 A;  3L3F X;  3F53 A;  1ECW A;  2KV2 A;  4BJT A;  3GU3 A;  3PSF A;  5KL8 B;  4OJ5 A;  3BLY A;  2WAD A;  2E1M C;  3OYJ A;  2LY2 A;  2KEY A;  3RSN A;  3E1S A;  2GH1 A;  3C2H A;  3HOS A;  4BEH A;  4HNT A;  2F2A B;  5KCM A;  3D5S C;  3D5L A;  3D5R C;  3OYI A;  1Z7L A;  3PL8 A;  3HUG B;  3M6Z A;  5HR6 A;  3W2W A;  3BG6 A;  1UG0 A;  3ICX A;  3TMO A;  1G8X A;  3D2N A;  3OYL A;  4C2U A;  4XMY A;  4PL2 A;  1D8B A;  2HVQ A;  2L2O A;  4P5O A;  1UPH A;  2G07 A;  2LRE A;  3CMM A;  2G5I B;  2WAF A;  4XKC A;  4KX5 A;  5HLT A;  4B44 A;  1ZQ1 C;  2JH1 A;  4HPQ A;  3ONQ A;  1DQU A;  3DWL E;  3AFH A;  2BVL A;  3NWS A;  2H3I A;  3PST A;  3HPH A;  2IGO A;  5LD2 C;  4XLF A;  3RF9 A;  1PJR A;  1A0P A;  1ERD A;  2M3A A;  2ELJ A;  3E0J B;  3S32 A;  3H9Q A;  2XC7 A;  5HOO A;  2CRX A;  4ZDL A;  4JQF A;  3N7S C;  2KQR A;  4F91 B;  4AYB C;  3RFA A;  3IUO A;  2L9N A;  3OY9 A;  4RM2 A;  1ED1 A;  2XIC A;  2HVS A;  3N05 A;  3I3L A;  1PYV A;  2LYC A;  2DGZ A;  3ZGK A;  3U21 A;  1OR7 C;  4CCJ A;  3H9J A;  4QJF B;  2W1O A;  2XI9 A;  2DCE A;  3TL4 X;  1LVK A;  2W7N A;  1X1B A;  4FZN A;  2W7O A;  5HR7 A;  3O0F A;  2IGM A;  3MD2 A;  4WJ3 B;  3L2R A;  3W2V A;  2KJ9 A;  4OAZ A;  3K1Z A;  1D0X A;  4ANJ A;  1E0E A;  4CCK A;  2E1M B;  2KHM A;  2MFZ A;  1R6R A;  2V9K A;  2X6W A;  4NQW B;  3SEQ A;  3S3O A;  2G0A A;  3K4J A;  2R7S A;  3OYE A;  4EAT A;  2WAQ A;  3KYL A;  4XLC A;  3BCB A;  2KDO A;  4B43 A;  1IIP A;  2YB1 A;  3NRW A;  3H35 A;  2OM6 A;  2W7P A;  2X1D A;  4D9J A;  3HXL A;  4BE2 A;  1YX5 A;  2ZXH A;  2E5N A;  4NLC A;  4FAS D;  1LDK B;  2MYS A;  1P7D A;  4IKF A;  2LG4 A;  3OIQ A;  1TZL A;  1WJD A;  2LBF B;  2K4I A;  4BJ6 C;  2F8L A;  2OH2 A;  5KHD A;  3E0F A;  3VDX A;  2HMX A;  2ZXI A;  4BQO A;  2Z16 A;  2WAQ F;  3M7D A;  4RLQ A;  2PJR B;  3OS2 A;  2CS3 A;  2LH9 A;  4B47 A;  2E1E A;  2F6C A;  1D1B A;  3FBI B;  3OYG A;  3F2B A;  1PVQ A;  4BJ5 C;  2JA2 A;  3MKW B;  3L2Q A;  2IS4 A;  3MKZ A;  4BE1 A;  4ZC3 A;  2W03 A;  2HOI A;  3FDY A;  1OLT A;  2IXS A;  3DLA A;  2R7R A;  4U7B A;  3RCO A;  4LIT A;  3AL0 B;  2A5W A;  3DTK A;  2MC4 A;  3QOE A;  4Y4R A;  2QKM B;  4BUG A;  2KHQ A;  1S9H A;  1Z3X A;  2WBM A;  4HG2 A;  4JMU A;  2LHT A;  3LSH A;  2E1F A;  2L5Q A;  3BG7 A;  3OR2 C;  4H4K C;  1LFP A;  4YEL A;  5FRN A;  3DTI A;  2VJI A;  2K8B B;  3ZXS A;  2KD1 A;  4G6T B;  2Z7J A;  1D0Y A;  3VSL A;  4Y33 A;  2LOO A;  4NC7 A;  4HNU A;  2VQG A;  3OL3 A;  4BDZ A;  4E7K A;  1IRX A;  2A3V A;  1MNE A;  4ZTJ A;  4RLF A;  1GLN A;  4IZZ A;  1Z1B A;  4FET A;  4AYB A;  4E4H A;  2YX8 A;  3EPZ A;  2I8D A;  2KHV A;  4QIW F;  2KKP A;  4IX7 A;  4U7C A;  4QNL A;  2ZIX A;  2HBL A;  3F2D A;  4KMO B;  5TGT A;  4XKB A;  2VKQ A;  3LL7 A;  3M6K A;  4XLA A;  3EUH C;  4BAC A;  2OV7 A;  4LIU A;  4QPQ A;  4E7I A;  3S93 A;  3VC8 A;  3ZR8 X;  2E5Z A;  3PNV A;  3CJR B;  2KNJ A;  3ZQQ A;  2CUZ A;  4E7L A;  2WAE A;  5CPR B;  4ZYA A;  3K6G A;  3SYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...