3DEEA

Crystal structure of a putative regulatory protein involved in transcription (ngo1945) from neisseria gonorrhoeae fa 1090 at 2.25 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
b'LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative regulatory protein
publication title The structure of the first representative of Pfam family PF09836 reveals a two-domain organization and suggests involvement in transcriptional regulation.
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
molecule tags Transcription
total genus 55
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09836 DUF2063 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3deeA02
1.10.150.690 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3deeA01
3DEEA
chains in the Genus database with same CATH superfamily
3RAXA 1GDTA 2ZO4A 2KHVA 2YMMA 4TV7A 4ESJA 3UXNA 1RYRA 5AI6A 4XL9A 3DLLF 3JAMZ 2HVRA 4FFDA 5GADJ 3ETLA 4QZEA 4EJOA 2CW7A 1MKMA 2QQ8A 1LDKB 5ALQA 3RJKA 1SAUA 4M9HA 8ICCA 3TGNA 4AIHA 4Y2TA 4UVAA 4E7KA 3QP6A 8ICXA 5J0QA 5GPAA 4NJ8A 4G12A 3H8MA 3FZVA 1G3WA 2XB0X 2CV0A 2EAMA 4NXZA 4RA2A 1S0NA 5IOZA 2OH2A 5DV5A 2HYFA 3NARA 2P6RA 3UM9A 4BHBA 3CMYA 3WK4A 1Q3VA 3DV8A 3OYNA 4GDFA 2H6BA 1JIHA 2ELKA 4B9TA 3RJEA 1K4TA 3NGDA 3N97B 1NZPA 2CV1A 2R4GA 5CQGA 2VBWA 2DA5A 4NY8A 1KFSA 4P4OA 3ZRGA 1N25A 1FC3A 4DGWB 2KDZA 4P0QA 4A5NA 1TWHJ 2B63J 1HXDA 2R7DA 3RKQA 2OV7A 2W84A 2K4PA 3AQFA 3C23A 5AM3A 2PFOA 3HOYJ 4J03A 4IRCA 4CYCA 4WWCA 2XB5A 4II2A 5FGMA 8ICPA 3PR4A 2HCFA 1SMYF 1Y8RB 1QZEA 3BPVA 1QO0D 3S93A 3BS7A 1DGWY 3VB2A 4DSIA 4YN4A 4RS8A 4A3LJ 4KT5C 2EINH 1SFUA 5L3GA 2EZLA 2OPTA 2UWMA 1IUYA 2G5HB 1J9IA 2V1UA 4NL9C 3ZMDA 2W9BA 4DFKA 2OYYA 3A0BC 3VEPA 2CQQA 4NDLA 2A3SA 1KA8A 2HBMA 2XRNA 5L9XA 1U49A 2BY2A 2CW8A 5FLXZ 2XCPA 3QZ8A 3TW6A 4NLKA 1COKA 2BEOA 6PAXA 4KDPA 4RAYA 1N78A 3DPLC 4R8HA 1FOWA 3T0YA 3E6DA 4I76A 4PFPA 1OCZH 2WF7A 1UCVA 1Q1HA 2WAEA 2UV1A 1VQKI 5ALDA 3IAS2 4JK1X 4KLOA 1S10A 8ICEA 1UPHA 2EV6A 3E7LA 2PMZN 1XD7A 2DDAA 3VPRA 5IT9Z 2NRXA 2ZJ8A 5J0UA 5F6FA 1JTXA 2P4WA 2HI3A 2WA0A 3BROA 1B8IA 3UXPA 2K4JA 2GAUA 3N4MB 3LYSA 1ZQFA 5DGBA 2RRDA 5FJ8J 4U87A 5M5YJ 1PVEA 4D0PA 1RR8C 2DGZA 4PHDA 1LEAA 2Z9OA 4NLCA 4H4KC 1SMTA 4P5OA 3U1KA 4AD9A 3MR5A 3BJOA 5CRXA 4HNTA 4U0VA 1D8LA 4KN4X 3P9KA 4C8KA 4F72A 2W57A 3Q0VA 4DF8A 2PFBA 3ESWB 3ASNH 4YRVA 4I2CA 4F7ZA 2HVQA 2VKVA 1D5VA 2JPBA 3BG3A 5KL1B 4L9TA 1OYWA 2DMTA 2X0LA 5L3EA 4CO8A 2IGKA 4KLUA 5F27A 2YTUA 5DLGA 1ZQMA 1FYMA 5IYBJ 1K61A 4C8OA 3K4BA 2VXZA 2LKPA 1G3SA 3IUOA 4N4NB 4BACA 4UW9A 3PL8A 2BCQA 1F0MA 1ITYA 3K69A 1W0UA 4DQRA 3GIJA 2JR5A 4XOPA 2W43A 2LI6A 3QODA 1ZXIA 3KZIU 4QW8A 1B59A 3BLYA 3V7JA 1T2KA 5CP2A 3UMBA 1FZPB 1MSFC 1STZA 4UVCA 4BWMA 4DL3A 4UAUA 1ZQDA 2OBPA 2COMA 1IXSB 3D0SA 1X9WA 2CQKA 3RQIA 1ETOA 5KT3A 1PJRA 3PW4A 4N9IA 1U45A 1LKXA 5FFXA 5DM7F 4Y2UA 5J29A 5FKMA 4MNUA 1U5TB 2DT6A 4IHYA 2X6YA 3ABLH 3GIMA 4R79A 3HKZA 1JT6A 4YIFA 3HTUA 3RB0A 1ZQZA 3OYEA 3DPUA 4BDZA 3H8WA 2BDUA 7ICIA 4M9LA 2W1OA 3BJAA 4CZCA 5M5WJ 1V97A 3FM3A 1E17A 9ICNA 4TQSA 2XUBA 4OJLA 1FOKA 1RXWA 4O3NA 2JMGA 2FX0A 1G3TA 3HOSA 2YU3A 3KEOA 1V5GA 1JUDA 4I0BA 4ENNA 3LAPA 2FMPA 3TBIA 3V8LA 4CCLA 2O9LA 1SANA 2Y0SC 3ONNA 7ICVA 4D9JA 2WB1N 2VKEA 1DP3A 4C30A 2V4JC 1DRGA 1VQ9I 3BDPA 1XNSA 3TKAA 1N75A 3ABUA 5H2FU 4IHVA 2VB6A 1WJAA 1O57A 4U0WA 1TQMA 3CCEI 5F9NA 3IM1A 1UG0A 1JMSA 3EPIA 2BHZA 2P7CB 2X9DA 2NRVA 2JUCA 4QZCA 3UQ0A 1U4BA 5JFRA 3KLNA 4DOBA 1TVAA 1P6RA 2WY8Q 3FKIJ 4ABZA 2X48A 3CQZJ 3PO2J 4Q44A 2UVRA 1OCOH 2AHQA 2J6UA 2HHWA 2HXIA 4F50A 3WKBA 3A1YA 3FC4A 3CLQA 3UNGC 5L1KA 1B72A 2KP6A 4QIWC 2YY6A 3MKWB 1K1SA 4HNVA 3DFGA 4CGZA 2VE8A 1ZQJA 1ZTRA 3AM9A 2BY1A 5AI0A 3OOUA 3OYFA 4KNYA 2IOFK 5K7ZA 4AC0A 3CCLI 1FTZA 3RPUA 3BTJA 3JRHA 3KZXA 4XSXF 3E1SA 1YJNI 1BPXA 1TW2A 5L3CA 2EQYA 2J5PA 3JSPA 1SD7A 2QBYA 2W7PA 4OIRF 3P5JA 9ICRA 2A1JB 4ECSA 1MDMA 4I2AA 2LG4A 3QPTA 1SXEA 2A1AA 3N7SC 3DF8A 4B43A 3SEZA 3JRFA 2CJJA 2LH9A 4DNCA 1QPIA 4BY1J 5CVRA 5DD8A 3QP5A 4AIDA 3IHQB 1RG6A 1X2MA 3OS0A 1YZ6A 4HPQA 3EYYA 3FBNB 2ES6A 1PVPA 2BVLA 1B1BA 1WJEA 2M30A 4MIMA 5KG6A 1SB3C 5LHGA 4RQ7A 2A19A 3UMGA 2MA3A 4RT2A 1ON1A 1JHHA 1Z00A 2KT0A 5F1RA 5KT6A 5E8GA 3ZXSA 2XICA 1KU3A 4JX4A 2H1KA 5FRMA 2B7EA 2K5CA 1LFPA 3WTUC 5HR7A 3LSPA 2DXIA 4RQ4A 1S6LA 3I4MJ 2K89A 1YW8A 3TO9A 1S7AA 1BIBA 4IZZA 4IOAF 1XTAA 2HSZA 4UB6U 1QTMA 4DSEA 1H89C 5FKOA 3ABTA 1NJXA 2HHVA 5EG0A 4KA4A 4P55A 3AUOA 3HJEA 4ZDPA 1WCLA 4FHTA 2ZIUB 3C18A 4M6YA 4YIIA 4A93J 9ICHA 1OCPA 1R1UA 4U7DA 1S76D 1TTYA 4PGQA 2L7ZA 1YG2A 2OC6A 2E5NA 2JZYA 1IRXA 2BW3A 2E35A 3F21A 1DDNA 4XSZF 3RZDJ 1SZPA 2NS7A 2Q8KA 2HOQA 4TQRA 3ZDDA 2DTZA 4ZTJA 2ZFWA 4JV0A 3NVVA 3QYFA 2PI0A 2K8CB 4KLDA 4P1WA 2M4GA 3HL2A 1VLBA 4MHGA 2F5DA 4PGYA 1OR7C 4A5MA 3IN5A 3JSOA 1QSLA 1Y0UA 3EWAA 1WKMA 4A2UA 4K4GA 5J2DA 1LKYB 1JKRC 4ZZDA 5KFEA 4GO1A 4WXCA 4RGRA 1R4NB 1PZNA 1I1SA 5BPDA 1S7OA 2E19A 5HS7A 1FMWA 4KLJA 2K3FA 2P6SA 1U6GA 1AROP 1NOMA 2WBMA 1JKQC 3ML6A 1IN8A 5J1UA 2YQEA 2IA2A 3WG9A 1ZQ3P 1LJ9A 3EUAA 5LGUA 2IRFG 4Y2XA 4ED0A 1T56A 2JRMA 5KFTA 3ZR8X 1KQQA 3T5JA 4EM1A 3THVA 2HOSA 4DBRA 3K70D 1WCNA 2V6CA 3QOEA 4M3EA 4ZYDA 4NUBA 2HHQA 2M87A 5IIJA 5L3DA 4EJWA 2BQRA 1NJZA 3Q8QB 2ESHA 3F72A 2XDVA 2OU2A 1NK2P 2LFBA 3MKZA 4F55A 4QPOA 3VSLA 2ZMEC 5KG4A 2JA5J 1KDHA 4B3XA 3DKXA 5EGOB 2ZJ2A 5AI4A 3C2GA 4ENJA 5BOMA 2DQNB 4AYBN 2XSDC 3PNYA 3J80Z 2VLAA 2PI5A 1DK2A 3OPXA 3CZ6A 5KG3A 2V7FA 1V9PA 4FE3A 3KFWX 4YELA 5AM1A 4I99C 3HHHA 3EQLF 4BXFA 1L8OA 2K60A 1LPQA 2WTEA 5ED4A 2EFOA 4YMNA 5KG7A 3S1MJ 1X4PA 9ICEA 4I01A 3HSEA 1ZETA 4M6WA 2JGAA 1ZRNA 3H0MB 3M1EA 4HV5A 2F2AB 4IQTA 4KMOB 2LYAA 4R64A 4F5RA 1A76A 3RF9A 3SQNA 4YMOA 1FEXA 4LK1F 2DPUA 4ZH4F 2LMDA 2KSOA 2CXYA 4F91B 1HUOA 4MFFA 1E3PA 3M1CA 5H20A 2DJIA 1XO1A 4CF5A 2I6XA 4QZFA 7ICNA 4DBQA 2FPKA 1BW6A 1XX5A 3ORYA 3A03A 2DPDA 3HYIA 4UVBA 3IG5A 1L7PA 2XPVA 2A05A 5J8CA 1R1VA 4CA0A 1ZQVA 3BQ1A 3G2BA 3RIRA 3PO5A 5ICFA 4BNCA 3H5RA 2MSNA 2FA5A 1D5YA 2Z3YA 4RGUA 3TQNA 2E2JJ 3WK9A 4C8MA 5FFZA 3SZ2A 1IUFA 3CJTB 3GYHX 4HLXA 1WFXA 4ECVA 4ICAA 2BPGA 1NK0A 1ZLJA 4DEZA 4RMNA 3F3XA 2Z33A 3S16J 5ALZA 3PY8A 4BY7J 2PN6A 1YIJI 5IYDJ 4DQSA 5LBQA 2F1JA 2ECCA 3TQ1A 2RDIA 3RJJA 1BPDA 4IXAA 4XOTA 2E1CA 2IS6A 3OMYA 2GXGA 3FXQA 1X9SA 2HW3A 5A0LA 3N97A 4BXXJ 4ECYA 3TO7A 1OISA 2WAQF 1K6YA 1G59A 2PMZA 5HLIA 1CF7B 1JI7A 1LQ1A 2F77X 3KP3A 4LG0B 5KFWA 4GXOA 5AK6A 1U9OA 2DDBA 3H5AA 3QPLA 4UHTA 2KV2A 2FMLA 1E3HA 2DBBA 4HQEA 1HBXG 3E6CC 1MSEC 2JA8J 2VQLA 4ZOHC 2BCVA 2JN6A 4G7ZF 2DFLA 3RB4A 2XY6A 3FXKA 3QUTA 2ZXWH 2RGVA 3BQ7A 4I28A 4MQ9F 3GDXA 3BOQA 2R7SA 2IHNA 5DB9A 4QW9A 1VF9A 1RC9A 4IHXA 4IS7A 5ALTA 8ICBA 2RN7A 2YMLA 4KLGA 4BJQA 4O5KA 3CCUI 2C2DA 4PDKA 2HBJA 4A0YA 4ECUA 2AQ0A 4RNOA 2LKYA 8ICJA 9ICVA 3NASA 4OD0A 1T95A 3M9OB 1MZBA 2AS5F 3UPQA 4NHJA 3CCRI 3B9JA 2DT7B 5KFLA 3QYEA 3V7RA 5IPAA 2KZGA 5KFAA 4CRXA 2Y69H 3OTQA 1OR7A 5KL8B 2K8AA 3NUQA 4XUSA 5KFPA 3OYDA 2F5CA 1AHDP 5G5GA 5F04A 5ICEA 2NNNA 4IR1A 2CRGA 3Q8KA 4M9XA 4FX4A 2ZCWA 2D45A 5DBAA 4DS5A 2E7XA 3SFZA 3A01B 3NVZA 4DZJA 3H9GA 4PHAA 4D5CA 2Y75A 5DUKA 5EEGA 5DDGA 1KYZA 1DXSA 3N4MA 2CFXA 5ICCA 3H0RB 3BQ2A 3ASOH 3ED5A 5AM4A 3E6MA 3K4NA 5ICGA 2I5HA 3E5XA 3KP4A 1R00A 1ENHA 2Z2SB 1EF4A 1Z7LA 2Y9ZA 1QQ5A 1T3NA 4Q8FA 1JJ6C 1JUPA 2BV6A 3B02A 2CQXA 8ICKA 1LVAA 4QWCA 5AHXA 3SZTA 4I2OA 3MBYA 3C7JA 1POGA 2HZTA 2QEXI 4FCYA 2CGPA 1NK4A 4P9FA 4CH7A 1QQ7A 4XN0A 1A04A 3I4PA 5J3LA 1YIOA 5L3FA 2JSCA 2XROA 4J9OA 1OKRA 1PYVA 2IP2A 5KVRA 2R8JA 5AKXA 3M7DA 3LSMA 3QU9A 1D1AA 2ID6A 4ZJZA 2LD5A 1GV5A 1NJWA 4EEKA 1ETYA 1HIWA 1ZN2A 1XDSA 4RLQA 3JPTA 2NS0A 5DTDA 4FT8A 2FJ6A 4HZFA 1HDPA 3T5LA 2BQ3A 1V3FA 4IEJA 1L3SA 3RI4A 7ICKA 9ICPA 1XGNA 2RQPA 4CSWA 2BYVE 4HF1A 2EK5A 1HA8A 3V7KA 1MQ3A 1MSWD 2LNBA 3HSFA 2EV5A 3IH2A 3C21A 1Z1BA 2BY3A 1MJBA 3NQOA 2F4MB 4L9VA 1L0OC 1COOA 3PFYA 4ECQA 5JU5A 5J2IA 3BR6A 4O3MA 1KU9A 2ZJRF 1TAQA 2P7VB 4DYCA 4KISA 3ISDA 1ZQPA 4BE1A 3KHGA 4LLNA 3V42A 3GV8B 3IDWA 4E70A 3K4MA 1AKHB 1O7LA 2L9NA 3N05A 5JVTA 2MC4A 2JJ7A 2X85A 4UV8A 3HEFA 5KFIA 2GM4A 3RKYA 3FWEA 2EBIA 5C0YA 4C9YA 1RPLA 1BNPA 5ALIA 2FRHA 3K9TA 1UB9A 2AQFA 1GLNA 1XG1A 1RQNA 8ICFA 2Y48A 2W7NA 7ICPA 4M9ZA 4MTEA 2HQRA 3KIOA 4ETSA 3VWBA 4RNNA 1YS6A 2E8OA 3CP8A 1EH8A 5AKHA 5ALRA 3C2KA 3CJRB 2FLPA 1U0JA 7ICEA 4B9UA 2OTJI 3GZ6A 5AICA 5FP0A 2M5WA 4BQQA 1ACIA 5CHGA 3OJUA 3MKLA 4IRKA 4KLQA 1TAMA 1KTQA 3K1MA 3E3VA 2NNYA 4JX5A 4KFCA 3IRRA 3V6JA 2VA8A 3BDDA 4V2FA 1R23A 3WK5A 2E1MB 2VPLA 5B5EU 4DOCA 5J0XA 5J2EA 1IN4A 2YSRA 3HGYA 1I3AA 3I64A 5F0FA 2KN7A 1UA0A 2UVVA 3PO4A 2QLZA 2ME6A 2MH2A 1T3QA 3CYMA 8ICSA 4JMUA 2GXAA 2KQRA 2M0CA 5ALGA 3HW8A 3L1PA 2C2EA 4PL1A 3ERED 1JXSA 2KKOA 3H3UA 3I54A 4ED8A 1C20A 5J2FA 3WGGA 3HP6A 4RQ0A 5J2CA 3HIFA 4J9NA 1SD6A 3KYCB 1G6NA 3VOEA 3Q3SA 4C4TA 4RPZA 3IRUA 1MMGA 1SWWA 3K4JA 1TWGJ 1GV2A 1MH3A 1KONA 3QWLA 3COAC 2W04A 4EVIA 2RLTA 5DB8A 3SZPA 3G6VA 4RLFA 2KK0A 4ED6A 3RJPA 2A1JA 7ICQA 1O3QA 5JLWA 3WG7H 1FOYA 3M07A 1OJLA 1BC8C 2KP7A 1ZQGA 4O0IA 1O03A 3N7RC 4FASD 5E8IA 2VQCA 2HPIA 3V6HA 5M3FJ 7ICFA 3JPPA 3PUBA 3FHNA 4KICA 3F22A 3IHUA 2QVOA 2V6EA 3NAUA 2F1IA 4TURA 1FBQA 1GVDA 2Q0OA 3CP2A 3PSTA 5J40A 4FX0A 5EDNA 4BE2A 2D1HA 4MTDA 4XLPF 2VOOA 5BPIA 1TQPA 2HZDA 3RYPA 2JQ7A 3TAPA 1RXVA 2OQRA 3CCVI 2L4AA 2ADUA 1PUFB 3H92A 3QQAA 1E0EA 1AQ6A 1UT8A 3MR3A 1L6NA 2CYYA 3R9KA 3RSNA 3DDHA 3JRGA 2FLLA 3HPHA 2G08A 1R4MB 3A0BU 5JTIA 3IL2A 3S14J 3GTLJ 1B43A 7ICLA 5EWGA 1KEJA 3F2CA 2VA2A 2E36A 3FAHA 5HNFA 1IM4A 4ED7A 1UMQA 2FXAA 2KFDA 3MEXA 2CWEA 2DMPA 2ZIUA 4D7NA 4NWIA 5DDMA 3Q9SA 4M71A 1R9TJ 2LBOA 1RRJA 3KOOA 3ISPA 1WJCA 5FKLA 4F4YA 1CGPA 1T94A 2E3TA 1X9XA 3RB6A 1JJ8C 4PJ0C 1S0MA 9ICQA 4PUSA 3VSKA 1SL1A 2XV4S 3CF2A 3J81Z 3H36A 2G7UA 1BI1A 1MNMC 1TC3C 4HBLA 1B0XA 2QM3A 2BPFA 1W0TA 1X9MA 1ZQSA 2KMUA 3WKCA 1VQ7I 2HQNA 1XSPA 2A5WA 4AVPA 2EFWA 1JX4A 2HKOA 3HGGA 4Y2RA 2V26A 2JMWA 2KHMA 2A6TA 3PM1A 3BS5A 3BTLA 1LKYA 5AKJA 5C4XJ 5DB6A 3GEZA 3Q8LA 2B6GA 4RQ2A 3QU7A 5KFXA 3VFZA 1ZQWA 2WV0A 4L9JA 2IS2A 2H3ZA 3PSIA 2O03A 1K79A 1MD0A 4XM3A 1MIJA 2VT2A 5C44J 1MJ9A 2RQQA 5D5WB 3GFJA 4XLCA 1FBSA 3F53A 1RNLA 4HYEA 4CE6A 1A31A 2R5YB 5J0TA 2LF8A 3ETRA 2KNJA 2HVIA 1RYUA 1ZG3A 1ZRDA 2DW4A 3OYMA 1XC9A 3CESA 8ICYA 1D3YA 1M1EB 2R7RA 1QNTA 4GXJA 1D8BA 5GAGJ 5F64A 4HDVA 1ZQYA 3RJFA 2H8RA 3W2WA 4XORA 2VC1A 2P66A 1S0VA 1FSEA 5J2JA 1IN6A 2L5QA 3GTQJ 2ZTDA 4KTQA 3KFUF 3CJNA 4G6QA 4IRGA 4BGDA 3PNCA 3VYSB 3PSFA 3HDDA 3C5FA 5EGOA 1ZQTA 8ICRA 4M9SA 1R58A 3H7IA 5E79U 3H40A 3NVWA 1JI8A 1A6QA 3B0XA 1XSNA 2A6EF 4LD5A 3TKYA 2FBHA 2ODGA 2XC7A 3TFSA 4DL5A 2P6UA 4B9NA 5LFAA 1FTTA 3PX0A 2BBYA 3FMQA 1PUZA 2OCCH 2CUZA 2JUGA 4ECZA 5CVJA 1T6SA 2JA7J 2V4QA 4DSJA 4Y2SA 3U9GA 1I6XA 3EUKL 4O3QA 1I39A 4YFKA 1TLHB 5JHUA 5L3BA 4BHCA 4MEXF 2JZBB 3HKZC 3H4BA 3BQZA 1TNTA 5LRRA 2KEYA 4IX7A 1VQLI 2F3NA 3ELKA 1U9LA 2W24A 4TUSA 2IBDA 3PQJA 4ED3A 4FO6A 1XS9D 5M3MJ 2EIKH 4KN7X 4ANJA 3OS2A 2WTFA 1OYYA 1CQTA 2DMUA 3SHFA 9ANTA 3MAJA 4C80A 3QU2A 3BZKA 4MF8A 1GXPA 5EYRA 3BQYA 5L1IA 2F5EA 8ICHA 1P4WA 5GTIC 5TISU 3U1DA 2KIVA 3S3MA 2A68F 5DG7A 2DAOA 4XRMA 2EH9A 4QZHA 5FD5A 2GOLA 3PZPA 1X2IA 4FS1A 3F8BA 1T7PA 3J7AY 3EUHA 2HNHA 3PNTA 4BQAA 2FQ3A 2DK8A 3H8JA 3KHLA 4J9QA 1MQ2A 1AWCA 5ALKA 1HW5A 2HVHA 3WU2C 4L9NA 3V8KA 4RPXA 5L1JA 3RDIA 3H0LB 1BPZA 4M04A 3M8SA 4GYIA 1TT0A 4PZJA 1YW7A 4DIQA 4DSLA 3DQVC 4IL6C 3W6JB 3WGIA 1H0MA 4Y2QA 2UVWA 5JR3A 2AXTU 2KE7A 2QQBA 3J7ZI 2F2EA 1U3EM 5KFUA 5DBBA 1LEBA 3KKAC 2JEJA 2E1MC 3ERMA 4LG0A 3WKAA 2WAQN 5CKTA 1ZQEA 2QSHX 4HEA2 4RAZA 5A2QZ 4GGGA 2HBKA 1XSLA 4NC7A 3MFHA 1EV7A 1RZTA 4JUZA 4EATA 1LUJB 1O3TA 5D4SA 3RZOJ 9ICTA 2K86A 4O5VA 1NK8A 2H6CA 5E1WA 2FSWA 2EZXA 1F1ZA 2NO4A 1TZLA 5ALNA 4JK1A 1FLIA 4OMYA 1LV5A 2GH1A 1REPC 1QQIA 2BCRA 2TCTA 3E2EA 2JT1A 2W3RA 2K3PA 4F3QA 2KKVA 2WHEA 4G94A 4XKBA 3FDSA 2PMUA 2Y31A 2W9CB 2BXYA 3BTCA 4RM2A 4Y3OA 5FD6A 3K1RB 2HHTA 1KQ0A 3H3ZA 4X1EA 5ILUA 1ZRMA 3GX4X 2DL0A 4XNFA 3MGHA 2C22A 2NV3A 2MFZA 3E58A 3I56I 2KISA 3LAJA 4F5QA 4D7MA 3TL4X 4R66A 2CUFA 4KN4A 4G7HF 3LVVA 2XGCA 3BG7A 4M6VA 2O8KA 3M9NB 1HSTA 1ZD2P 5LGNA 3MMYB 3K1PA 3LVWA 3A01A 4US8A 1KL9A 5KAFU 1BJAA 5C5JA 1FYKA 3S3OA 1XPXA 4KLFA 4OJPA 1D9DA 4KJZA 5HLGA 3K1NA 4A3KJ 3IV5A 2DJNA 4UAZA 4A3GJ 4EZ9A 1BPEA 2QB1A 2GWRA 2LKSA 3QE9Y 1F36A 2EIJH 2KZVA 4PFOA 2IGNA 3T5XA 1JHFA 2V9KA 4BUPA 2XGXA 5ALOA 3SI8A 1Y8QB 1SKWA 2VASA 3PVXA 4P4MA 1MA7A 3L2WA 3L2QA 3KE2A 1TKDA 3WK8A 2O5RA 3TO6A 3BQ0A 2ZJPF 2QA4I 1X6JA 1A0PA 1FOXA 1Z67A 4JV2A 2STTA 2ESNA 1ZG5A 4BS9A 3UR3C 3HRTA 1T08B 1BL0A 4KIBA 3R4KA 1UZCA 1J2MA 3BWGA 5DUIA 5ALYA 4J9SA 2ZTEA 2XHKA 4DL7A 1B22A 2M34A 3OYAA 2HHUA 3T8TA 2L02A 3VYUB 3QYPA 4RQ1A 2NRWA 3C28A 2WF9A 1FPQA 2BXZA 4RNMA 2Y1JA 1NK7A 3WHCA 2V1XA 3J81j 1D0ZA 4XRHA 3D6JA 5DQIA 1ETQA 4I29A 1SFKA 2FMYA 1Y56A 1CUKA 2KD1A 3F9KA 1RETA 2EZYA 3QAHA 7ICMA 3O8HA 5HHHA 5KFVA 2Y9TA 2X4HA 4HOBA 4DCCA 2G7HA 2W8LA 1ZQBA 1ZQHA 4K4HA 9ICBA 2Y2ZA 1FP2A 3SQIA 4DSKA 3OIQA 2OZUA 2DK5A 1NKEA 1X3WB 3ZMTA 5D6EA 4DLGA 2W03A 2K9SA 4TUPA 2J6SA 2K4HA 5C3EJ 2JA6J 3V7CA 5KK1A 3GV5B 4WXHA 5IIKA 1AKHA 3SFIA 1SFOJ 4A3EJ 2PKEA 4UB2A 3RTRA 1UT5A 2IJLA 5DD4A 3RR7A 2EFNA 3E5UA 5TRDA 2VQHA 3L2CA 2QQAA 4A3JJ 1X19A 2C2RA 2R8GA 5J1YA 3GZ5A 2PLYA 1OPCA 1NK9A 8ICZA 1T33A 1HOMA 2W11A 4BJTA 1ZH5A 2PJPA 8ICQA 2ALZA 4GYGA 2Y0MA 4XLHA 1A6IA 2LYBA 4ZC3A 2BR0A 4A3MJ 4EM2A 4A3BJ 4J9RA 1BI3A 3B73A 1N61A 3AG4H 1RESA 1QCKA 3F8MA 4ECXA 4CCOA 2VKHA 1L7OA 2DUYA 2GLOA 2XF6A 5J1RA 3OR2C 4QZIA 4DYQA 3F6VA 1RM6C 1JKPC 3KKAA 2UXXA 4IRIA 3OY9A 1IN5A 4XRSA 3S15J 4WJ3B 5KAIU 1VJ5A 2VQGA 4CF3A 1TWCJ 2EV0A 3HSRA 4OMZA 1SIJA 3MCZA 1JT0A 2CUJA 2ZBKA 3LOCA 2IS4A 5E17F 4LIUA 1V54H 3L09A 4LG3A 4MGRA 3GTJJ 2WAFA 3I0TA 5FKKA 3S2HJ 4Y2VA 3FK6A 5CQEA 2DT5A 3FYHA 4GC6A 1X2NA 1FWZA 2X6WA 3WE2A 3U26A 4PGGA 1SD5A 3RH4A 3RAQA 2V9VA 5K7FA 1U9NA 2K40A 2D8CA 5AK3A 4KYWA 2KRHA 4EENA 2XAFA 1R7JA 1D8KA 3CDHA 1X1AA 4MFEA 1VFCA 5JUMA 5J0WA 2VUMJ 1KQ8A 5C4JJ 2NOGA 5AONA 3TOBA 4UAWA 4DOAA 4NLGA 2ZKZA 1WI3A 1YJWI 1JUMA 3F0CA 1IZ1A 2H3FA 1ZQKA 3I59B 2DPIA 3JW4A 1MMDA 1ZRFA 2ZG6A 7ICUA 1BR1A 2X1EA 2LPEA 3ZN0A 5HODA 2PMZC 2LLKA 5E3MA 2RP5A 4RB0A 1V55H 4LFUA 3Q5FA 3B0YA 3IV6A 2LHTA 4Q45A 2E8MA 3M6KA 4MEYF 2DA4A 4FETA 2FUG2 5LHHA 1X3UA 3HUGB 1TBXA 1UJ8A 1W5SA 2ELHA 5H6QA 3OYCA 1PUFA 2F76X 4EQQA 1W7PD 4YQWA 2DOEA 2HTJA 4RDUA 2F5FA 2IT0A 4MFAA 1DPUA 4ELUA 1EKEA 4W1UA 4WX9A 2GBYA 2M9HA 2LY1A 1NJYA 4M9NA 1QSSA 2HDOA 3H1CA 1XSXA 2W9AA 4B9SA 1P92A 4ELTA 4Z2YA 2YX8A 2ZIWB 2WWYA 4KLEA 2HYJA 5J2AA 4I2GA 3I3LA 5AM2A 4XKWA 4FE7A 4HDUA 4RQ5A 1U47A 3HM5A 5EF6A 1LB2A 5KFMA 3GFMA 3WTWC 3K4GA 4ZYHA 2DPJA 5EWEA 4BDYA 4YG2A 2F44A 4CXFA 2VONA 5AIPA 8ICMA 5DG9A 3MN2A 1QSYA 2NVUB 1FO4A 1TK5A 4E0DA 2PFNA 1D8JA 3FXMA 3HTSB 2JHDA 3I5UA 1IG7A 2DKZA 3DTEA 2MAXA 3GFIA 3CCYA 2X51A 2LF7A 4Q8EA 2HEOA 2P8TA 4B8XA 4B3AA 3JTGA 4RT3A 1YO5C 5HLTA 3RH5A 5K4LA 2R7WA 1V85A 3ICXA 7ICGA 2E8NA 2ATLA 2KRFA 1J2XA 4A0XA 2NRTA 2YX7A 3WGHA 3M9MB 4LJZF 1EJ9A 2A5YB 5HNHA 4UB3A 2B21A 5HP4A 4HX8A 1FIPA 1X40A 4QWQA 4PZOA 2R8HA 3Q9VA 3FKJA 4HYKA 3AG1H 1ZELA 5D4RA 3KP2A 3BG9A 3KZIC 4BXUA 5AI9A 2R5YA 3A0HU 4WCGA 2RC4A 1WUDA 2L5YA 4ZH4A 2BQUA 4I2HA 1O7FA 2KICA 2MU2A 3TW7A 4KX3A 2ECBA 3R0JA 3CUQB 1DGRM 9ICCA 2MW8A 4JYKA 1UAAA 3BCBA 3GMEA 2FNPA 1CI4A 4NLZA 2XKOA 2I10A 3OYJA 9ICXA 1WRJA 3DEEA 2A6HF 1SD4A 4C7YA 1DP7P 2ICWG 1WCMJ 1ZR2A 4DF4A 5H6RA 4HV6A 3G4SI 1T38A 2WB1C 4I6ZA 3HPGA 3RCOA 4O9MA 1NKBA 3KP6A 3ZQ7A 1LE8A 2ISOA 1S5LU 5J0YA 3I9V2 2DYSH 4A3DJ 1ON2A 2XF5A 4LLGF 3ZQQA 3OYHA 3MQ0A 2DFIA 2ESEA 8ICTA 5GTHU 1S77D 4M2YA 2GOMA 4HW0A 1SVOA 3ZQLA 2YU9J 1MC8A 1YS7A 4BDPA 3RYRA 4ESBA 1JKOC 3CD6I 1V5FA 3PJRA 2FDRA 4EJUA 1ETWA 2IOFA 3SEIA 1OUQA 1MBGA 1YTYA 1X6IA 2BZFA 1Y1WJ 4C7ZA 1U5TC 4Q47A 4LVSA 4MFDA 1BR4A 1TE2A 3RJHA 4O3PA 2X1DA 1KRPA 4II3A 2JZBA 1G3YA 5J4YA 3GIIA 4BH9A 2MSYA 4I98B 5CR0A 3PMLA 5DCMB 3SYZA 4EEYA 5H2FC 2KIMA 3H0GJ 3LSHA 4L5IA 3NEUA 1W5TA 9ICWA 2LREA 1WYGA 4IHSA 3HOUJ 1H38A 3CDIA 3K70C 1QZYA 9ICLA 4CCMA 3GZNB 2P5KA 3CC7I 2UVUA 3V7LA 2CUEA 4OAYA 2Y0SF 2Q1ZB 4BXOB 1RZ4A 3DKYA 2O61A 1QU3A 2OHFA 3QU4A 4LIVA 2CQNA 4I0AA 4EBEA 4I09A 1R5HA 3GTKJ 5LGTA 5KNLA 2R5ZB 4MLOA 4QWBA 3G6XA 2AGQA 2KLOA 5D5UB 4YXJA 8ICGA 4F4XA 2XCAA 3WTXC 5HVQC 5K1YA 4I2IA 2V9PA 1D0YA 3CTAA 4OOIA 1KSPA 2ZUCA 1MBKA 5KG0A 2KIWA 4KX5A 1FSHA 1XSDA 2BZTA 1X1CA 4F2RA 3F23A 2L01A 3C2BA 5AKEA 1HKTA 4QIWF 3Q8MA 3NS1A 2L9SA 4P2HA 5FO5A 2VE9A 5IOYA 5J2HA 4ECTA 1TW3A 2E5SA 2M2EA 2FF4A 2OM6A 3Q8PB 2KIQA 3AEVA 4KLHA 4WK8F 2IHMA 1F9NA 2VL8A 3GTGJ 2HFHA 1D1BA 1YX3A 1H9GA 4A3FJ 8ICLA 5CJ9A 4EV0A 3MR2A 2GIVA 3O3KA 3S1QJ 4R1HA 2NAZA 2OWOA 1HC8A 3DU5A 2ASLA 2C28A 4BQNA 3SAHA 5KFZA 1HQCA 3T8RA 5B66U 3J7YJ 5CVIA 3F5EA 1J97A 4YXMA 5AKLA 1CEZA 1VQOI 2JXJA 3HOZJ 3RKXA 3PX4A 1IO2A 2JEGA 1OFCX 1VQPI 4A8EA 2RKHA 5HDKA 1X1PA 2V1DA 3HRMA 3OOPA 3GIKA 3SDBA 3OYKA 5K7HA 5AKGA 4UB6C 4BWJA 1BOBA 4RB2C 1FX7A 3WHBA 5J0SA 2KJBA 2QLTA 4Y13A 1QGPA 4QWEA 3PW7A 2IBKA 1H9TA 2HXOA 2F8LA 4OIQF 3D2NA 2D2WA 2ZC2A 2KJ9A 1D8YA 3PV8A 4J00A 1HDDC 2W54A 5J47A 3DXJF 3F5AA 1ZJMA 2K8BB 3R6SA 1ZARA 2FPMA 2JRZA 3FXLA 5CLSA 3M1YA 2W55A 2O6GE 1WH7A 2KTQA 3TP3A 1K78B 3PQKA 2K02A 3JRAA 3H3VK 2G06A 3V6KA 3RJGA 1N77A 1VQNI 3IWFA 4U7BA 1WPKA 2IW5A 3S1RJ 1YT3A 2GQQA 3OL4A 3B6AA 2A69F 4JOMA 2HDDA 2H3QA 3H35A 2AH5A 1A35A 4CDGA 3ISBA 4RQNA 3I53A 1S0OA 1HUZA 5TJJA 4YD2A 2F4OB 1BA5A 4NM2A 3FXJA 3AKZA 4P96A 2NRZA 1DPRA 5FLVA 3E5QA 5ALMA 2CSOA 1HCRA 4JWNA 2QYOA 1BJZA 3E97A 4C4RA 1MNEA 5LHIA 4FBUA 1SV0A 3D5SC 4IQJA 3DCFA 3MZYA 2DLLA 9ICOA 4F2SA 3G6EI 5ALHA 2FEZA 1P2FA 3L00A 4CHUA 2WB1A 2HOAA 2IAIA 4ZDLA 4B9VA 2LSOA 3IH4A 3L2VA 4XMYA 1RUNA 1ULYA 3A02A 1SVLA 4RQ8A 2HR3A 5DBCA 4AYBC 3EZ5A 2CPRA 4BBRJ 2W00A 3SXYA 4UAVA 2IOHA 5J0OA 4AUXA 3SV4A 4CCHA 4OINF 3FDYA 1H8AC 2QWWA 2CQ7A 5JLXA 3WK7A 1P4XA 2E71A 5D49A 4M74A 2FU4A 1A77A 2WV1A 3G3ZA 3OYBA 2QQ9A 1U5TA 2EDUA 1K7AA 2CV2A 4IQWA 1BBYA 3LSJA 3OYGA 1MNDA 2OUMA 1F5TA 1ED1A 3C1YA 3L5KA 4DZPA 1SVMA 5EWFA 3ZDCA 1IN7A 1SXDA 9ICSA 2R0QC 8ICWA 1X42A 1KGSA 2CO5A 1L3LA 3LDAA 2R7XA 9ICKA 3QNMA 3GVAA 1IRFA 2E1EA 3OJSA 4ZYEA 4NQWB 4HNUA 4RGXA 1S7EA 1V4RA 4XKCA 3BP8A 1IGNA 1T4GA 3FM9A 5AI5A 3EW9A 3JPOA 1SEUA 3L2RA 1SC7A 2VXDA 2BCSA 2M7BA 4E7SA 3PIPF 4EGZA 4O6JA 5D46A 5HNKA 1QZZA 1WVRA 2IXSA 3FK7A 4BL0B 5DKWA 2K9MA 1Z19A 2E60A 3CMEI 2DO7A 1K1QA 3KHRA 4XR6A 1ONVA 2FE9A 2Y1IA 1PK1B 1VDVA 2V79A 3MFIA 2BY0A 2HOTA 4Z6CA 3ZP5A 2M8EA 4Z6YA 2LDUA 3S2WA 2KHQA 4I2FA 1RI7A 3BR1A 1BC7C 4AIKA 2VANA 4IC9A 7ICTA 3D5LA 4XIDA 3I4NJ 2UXNA 5LEJA 3AU6A 3M8JA 3ECHA 5J0RA 3ZCOA 2TDXA 4GXKA 2VKDA 3BPXA 4DW6A 1X1DA 2UZKA 1GHCA 1ZAOA 4LZDA 1Y88A 5ALJA 4QZGA 5D5VB 2FMSA 2MC3A 1EXNA 1Z1VA 1X58A 1JUSA 2O3FA 4WXDA 2Z1DA 1WWVA 5KNIA 4MF2A 4QWAA 1YITI 5CB1A 5FRNA 1MJAA 2F4IA 2VPRA 5AKYA 2R7ZJ 2EIMH 1U48A 1P7DA 4OCZA 4RAGA 3O2PE 3PW2A 1QPMA 7ICOA 2MLKA 1BN5A 4M3FA 4X6AJ 2F1HA 2F8KA 2YB4A 1IXRA 1DUXC 2IMWP 4ZZLA 1L8LA 3OYIA 3C2LA 5IY5H 2R7TA 1YJ9I 3M8FA 2PMHA 4CYDA 2R7QA 2FI1A 2MRLA 3HG9A 1LVKA 2EFQA 2PEXA 4JP0A 1NI3A 1WI9A 2L7MP 2PBIA 2IS1A 2Y9YA 4QZDA 1UHUA 4FBTA 1N2XA 2DFFA 3G1OA 3HRDD 3EUHC 2KFZA 3K10A 4PHEA 2MUTB 4OO1J 3DBRB 3ZOBA 1DU6A 2HOEA 3WK6A 1ZQLA 1Z4NA 2LY2A 5D4BA 2AGPA 1DK3A 5K5QA 1IW7F 4EELA 1L3UA 1R1TA 1AOYA 4LZGA 1MN8A 2N8GA 2R7OA 3I59A 3GW2A 2HKXA 4TUQA 4B6JA 2LP0A 2NXNB 3AQEA 3Q0WA 1RKTA 2JVGA 4EM0B 3KEYA 4P0PA 3QZ7A 1UQVA 5ALSA 4M0AA 3PMNA 2LBFB 4ZTFA 5LD2C 1ERDA 1U8BA 3QXGA 1Z0XA 3ZN1A 3BZ6A 4A6EA 1VQMI 3VCBA 5KFKA 4DL4A 1JGGA 2FBIA 3HUGA 2VBXA 4XLNF 3HOVJ 1YZ7A 2X6XA 1ODDA 1R5GA 1XDUA 2P6TA 3IH3A 4UQGA 3SV3A 4DQ2A 3BR2A 2IA0A 1I3QJ 1W5CC 1OYIA 2X1CA 2VJ4A 4MFCA 2M45A 4DFJA 3OR1C 1Z77A 4LMYA 5HOOA 3GFLA 5FROA 4OIOF 1NK6A 1ZGJA 5K5RA 5AKIA 5HDNA 1Z91A 3DU6A 2ZIWA 3KYDB 3RR8A 4B1RA 3GU3A 4CF4A 1K6OA 1YI2I 1V5EA 5HMMA 3ZQGA 3HHGA 1OQYA 5JHFA 2Z5UA 1BNOA 2ISPA 3LFKA 1JE8A 3ZDEA 2GO7A 4AYBA 3VODA 3LSRA 1QBJA 5FLMJ 3FXUA 2ISZA 4F93B 3ZPLA 4MO7A 4BEHB 1HKSA 2KJ8A 3GLXA 1FYLA 4FS2A 4UUVA 2JK3A 3FXOA 2VBYA 4A12A 2H3IA 3ZQHA 2K4IA 2XC9A 4Q48A 1SL0A 4L0ZB 2VIXA 1VNDA 3BT9A 2E8PA 3C3WA 3D2SA 1ECWA 4RAFA 3AL0B 3S2DJ 4O3RA 2TRTA 4GCVA 4JBAA 2E5ZA 2GZWA 2G9WA 4B9LA 4KITB 1FT9A 1SFXA 2PJRB 2G07A 3V72A 2PFQA 2AGOA 4XRSG 4CUGA 1TP4A 1KKXA 5AIBA 1JXEA 3CRXA 1MMSA 3IAM2 3OV8A 1DGSA 2RVCA 1S8OA 4D5FA 4RZRA 3PFIA 5DM6F 1L5UA 4YIRX 3RB3A 4HF2A 2HQAA 5KFBA 4I2EA 1HJPA 4BAYA 8ICIA 5ERIA 2HU9A 4KMUX 4MEXA 3JAMK 3OSGA 4FE4A 3H8SA 5LEKA 1S29A 1LNWA 2H94A 2XI9A 1ZR4A 2FQ4A 5DGAA 4ZYGA 2L3DA 4ECWA 4B48A 1VI0A 3QPSA 1ZQQA 2K9NA 3WU0A 2DU9A 1MBEA 5KG2A 2HVSA 1B9NA 4BYYA 3FXRA 3SAFA 2BGCA 2OQGA 4S0HB 4DOZA 3E6BA 5J0PA 1LVHA 5LLQA 2EQRA 2QCOA 2XGEA 1W4MA 4PZNA 1NZBA 1N5WA 2HYGD 1ZD5A 3AAFA 2KOBA 4J9PA 2F5VA 2CH0A 3ROUA 2JH7A 2KKPA 2P35A 4UATA 1OCRH 4Q43A 4NLBA 3L2UA 3KHHA 2QKMB 3H4DA 1YRNB 3O0FA 4KN7A 4RQMA 4HSTA 3DBHB 4RPYA 4CCKA 4G9BA 3RH6A 4C3HJ 3S3NA 4DSFA 2M7AA 2NVQJ 2CRXA 1GT0C 1RR7A 2QGUA 5CYVA 1XGOA 4IHWA 3ZD9A 5EE9A 2EA4A 4F8RA 2W85A 2K27A 5DCMA 2I9GA 1XCVA 2G09A 4XONA 4EGYA 1FEZA 4PCQA 3RPUD 1IG6A 1J09A 5AKKA 2CN1A 2F6CA 4K4IA 3PUFA 4XLAA 3ULQB 5FLXK 2DQRA 1BPYA 5KT7A 5JI6A 2K9QA 4NLNA 1TWFJ 3HPOA 2HHXA 3DWLE 3LQQA 1GVJA 4U0YA 4KLTA 2DODA 4YR2A 2HBLA 1Z3EB 1Z4OA 2ASJA 1L3TA 5BOLA 5ALVA 1QQ6A 2W7OA 2QUFA 1E3OC 2Y0SN 3DV9A 3RFAA 4FTHA 3K7AJ 1R71A 2R5ZA 2B9SA 1OLTA 5B1BH 2K4EA 4F4ZA 2RV8A 3GBGA 3T1BA 3FM5A 1BIAA 5EE3A 5J8YC 1B6AA 3IP4B 2GXBA 2CG4A 5IT9K 4UARA 2IGMA 1Q8KA 3TANA 1SZHA 2L9VA 1CF7A 1ZYQA 4R8UB 1K5OA 2Q2EB 2XY7A 2W82A 2WY7Q 1A6SA 4YFKF 1N48A 5ILVA 8ICAA 4ASNA 4IHTA 4UB8C 2Q0ZX 3FF5A 1RQLA 1QH9A 7ICJA 1ZQ1C 3CNHA 4QIWN 4KT6A 5KTQA 3D5RC 2YMPA 1S8NA 2OEHA 2QZ8A 1FJLA 3DP7A 5AM5A 2O8XA 2KIFA 4DQQA 1TWAJ 4OIPF 2LRDA 4Q5SF 1D1CA 3KZYA 4LGWA 2LMRA 2ZIVB 3A2KA 2IPQX 4K2EA 4J9KA 3RJIA 1ETVA 3TDUC 4UUSB 2NS8A 3GQCA 2O7OA 3VYRB 5DDYA 5AM0A 2KJ5A 5D6FA 1IV8A 4I2DA 3VYTB 1ZQXA 2RNJA 3CMMA 1TAUA 3JPRA 4OAZA 2G5IB 4ON0A 4DFDA 1IDZA 2JSPA 2IEKA 4PJMA 1UG2A 2MH9A 2W48A 3G1MA 3LA3A 2ZXJA 3ZQFA 2EJRA 3HX0A 3RPQA 3V7SA 2HDWA 4GC7A 5ALWA 2EWNA 2Y30A 1I27A 2WC2A 3M9AA 3BZCA 2JEFA 4PJJA 3HBLA 2EA2A 5DCFA 3S1NJ 2ZTCA 4EZ6A 2XAHA 1O08A 2EB7A 4AU7A 1XMXA 2XVTA 3K2ZA 3JCUC 3FBIB 1SAXA 3M3YJ 3EUB2 2M0MA 2VJIA 1SFEA 1HF0A 3CCMI 3P9CA 1BOAA 2YS9A 4QSHA 3DTKA 1W7PB 1XGSA 3DKWA 1X66A 1YYVA 3PO3J 1NK3P 1NG7A 4GRIA 1P7IA 1K78A 3HILA 1N62A 3MC1A 4OU0A 1TL8A 4OJ5A 2K85A 1VQ4I 3GWZA 1I5ZA 1IV6A 3UXOA 3H5NA 4L18B 4M3DA 4PSWA 1BGXT 2LTPA 1U2WA 3LSIA 3W3CA 1T8IA 1PDNC 1RIOH 5DQHA 3KETA 4GFBA 1BR2A 2BHYA 1WGXA 3MVPA 3X2QH 1VQ5I 1ZQUA 4KLLA 2ISYA 3W6VA 2J6TA 1N63A 4UXNA 1SKRA 4J01A 3KTQA 1IXCA 3OWTA 1PUEE 2AO9A 5IIIA 4M72A 2VT3A 1IC8A 5J2GA 4USAA 5CVVA 4QPQA 3H0DA 4FZMA 4DL6A 3SAGA 3RBEA 2DA6A 2ZMEB 2LC2A 4PSXA 4A6DA 3I76A 4CCNA 2DFHA 4S05A 2H09A 4C4SA 2AHOB 4RU9A 2PI4A 1EA3A 5KFRA 3KLOA 2L7FP 1JTYA 5ALXA 1UFMA 1WQ2A 3K75D 2EAOA 2HDCA 2R92J 2GIZA 1L7NA 8ICUA 3CCQI 3EYZA 2R8KA 2YPRA 3R0AA 1L7MA 2QKQA 1MH4A 4AP9A 3OHAA 2UUZA 4E7ZA 3WTVC 2KIUA 7ICHA 1DQUA 3OIOA 5TGTA 4HRIA 4KLIA 9ICIA 3AU2A 3DEUA 1EH7A 3GF2A 3LSKA 4XBFA 1IJWC 3AL0C 5IINA 2XSJC 2I8DA 3LA7A 4JWMA 3V4GA 1RKWA 2K9LA 1NH3A 5E79C 1WJ5A 4LB5A 5E3NA 4B47A 1OCTC 4XK4A 2HTSA 4NQWA 1IRGA 2GA2A 5E1ZB 2P0WA 1R36A 1J5YA 3OGUA 1J2NA 9ICAA 1Q1VA 5JVGF 1WG8A 2BHNA 5HDGA 3OL3A 2ZXIA 2BVMA 2JWTA 2YR2A 2HPMA 2E2IJ 2I1QA 5KG5A 5CJ7A 1B4AA 1NK5A 1WJBA 2IA1A 3BCAA 1O3RA 4J9MA 1E2XA 4S04A 3HT3A 3MZHA 5EE1A 3KCCA 4PK4A 1PK1A 3PW0A 3DBLB 4B09A 4L0YB 1XMKA 3FMRA 4ENKA 1R5ID 2XO7A 4DQPA 3CJQB 2VOPA 5J8YA 4M9GA 3OSPA 1T0FC 5BS6A 4ECRA 1AU7A 2DWQA 4EYHB 5KHDA 3NTUA 3NVYA 2BKEA 5KT2A 4BXOA 4DS4A 3AFHA 3M7GA 3SD7A 4JB3A 4C2TA 4NC8A 2CFOA 3KYLA 5D5XB 2LM1A 3HKZF 2KL4A 5TISC 1R6RA 1XC5A 3JR9A 1BI0A 3O8GA 2D6FC 4F4WA 2KFNA 2O6KA 5HS9A 1KBUA 4IF4A 4KLSA 5KT4A 4Y2PA 2WAQC 5EZGA 1T39A 3LNQA 3LMMA 4LB6B 4G6DA 1TT5B 1ZQNA 4BKXA 3NWTA 2CW0F 4MEYA 5KFQA 1XS9A 1YHQI 3C1ZA 1TQIA 3TMOA 1CRXA 4FISA 2XPWA 4OWRB 5EEHA 5KCMA 3EPGA 1KZHA 3EYIA 2HHSA 5KFSA 3S8PA 2AXTC 3KEQA 4E7IA 3IRQA 4M6XA 5TZVA 5BPCA 3RTVA 1VQ6I 4NL9A 1KU7A 5M5XJ 4J19A 2VKQA 4PPXA 2MUTA 3I1YA 2GWSA 1JALA 4G8XA 4IRDA 2FOWA 2YN4A 2QARB 3P7NA 1PVQA 1OW5A 1ZJNA 2EFPA 3C2HA 1J7KA 2XAGA 3F8FA 1K4SA 2KZZA 1ZRCA 4LITA 4A3CJ 4PGXA 4U88A 3M6ZA 4E7LA 1VQ8I 1MBFA 2KVCA 4QTRA 3U21A 4C8LA 4ITVA 3ALRA 2XAQA 4DLEA 4DFPA 2R18A 1P4AA 2JTVA 4UASA 5KFHA 2LBFA 4F71A 3FMSA 1YOVB 4HQMA 4BX9C 4P0PB 1Z1DA 4ZYAA 4XQFA 1MGTA 1ZREA 4G3IA 8ICOA 9ICJA 4BQOA 1F4KA 1A5JA 5AI8A 5J4VA 3S6JA 2ME0A 3CO6C 3I55I 3BR5A 1IRZA 4IPAA 4EBDA 2DA1A 4HAIA 3SEQA 5GP9A 3R60A 3ZQCA 1Y39A 1FIQA 3U2RA 1XWLA 1ZGWA 2FOKA 4RQ3A 3HOTA 3T5HA 1YLFA 2JA2A 4IKFA 3MGVA 4GXIA 2FPLA 1A36A 3HB9A 2QB0B 3M8RA 5KAFC 3BJYA 3VC8A 4DO9A 2ZJQF 2H27A 5KFFA 4QLCU 3GO5A 4CNQA 2CS3A 5IP6A 3J80K 3WU1B 2CMPA 2KRCA 2OCEA 4LJXA 2KMDA 2DQLA 4EX6A 3QOPA 2WFAA 4YEJA 4C3JJ 2E34A 2CU7A 2LY9A 4HLYA 4BEHA 4Z6EA 5HMLA 1B4FA 2PXIA 5D8KB 4HA8A 5KG1A 5ALEA 5L1MA 3RRHA 3PSPA 1TV9A 4ELVA 2V9WA 1Z6RA 3K4LA 3JRCA 4ACOA 2ZSIB 4NBQA 3BS5B 4I7HA 3VDXA 2RREA 3EPZA 2ZNYA 1FY7A 4P4PA 1ETKA 2MD0A 5ILSA 2K7LA 3LA2A 4C0ZA 4UB1A 2PJRA 3ZQIA 3MGIA 3ZDAA 1KYWA 2H1LA 3WTZA 3OHBA 1ZHFA 4M3BA 1IAWA 3GCMA 2NOJB 4UNOA 4IOCF 9ICGA 1ZLKA 3GTPJ 2Z99A 2ZIXB 3Q8RB 4GIBA 4UB5A 4HX7A 5CVUA 4MHVA 2Z7JA 2DA7A 1SV0C 2YMQA 4QZ9A 3QRFF 1I50J 2XF7A 2VODA 2PG4A 4YG2F 3RQ4A 4UY8I 3IKTA 3K2AA 4AM3A 1WWXA 1XGMA 2RAEA 2KZMA 5JRTA 3S32A 2IA6A 3MZ8A 3ECOA 2W4SA 4LK0F 1KW4A 3DPTA 4BJ6C 2IVMA 3GZFA 4F3OA 3KBBA 2WF8A 3N28A 1Q46A 3BJ6A 2ZXHA 1ZOLA 3BTIA 1FNNA 4UB4A 1S9FA 3GFKB 3PX6A 5DB7A 2XRLA 1T0FA 2Y0SA 2RNGA 2R8IA 5KT5A 4Y52J 4Y15A 3LFUA 2NVXJ 3T5KA 2KVSA 1Y1VJ 2J5OA 1B9MA 2LM4A 1G4DA 3HOWJ 1T8EA 3TOAA 1JXLA 3KP5A 4F4KA 4O5CA 2FJ1A 2RDPA 1ZKGA 3TDZC 4BHPA 1YRNA 5B1AH 3OYLA 1FFVA 2M1BA 3K4CA 4F5PA 3IG8A 2WAQA 2XASA 3K1ZA 4ZDOA 4YFNF 5E3OA 4BE0A 4EEFG 1IIPA 2EAPA 4MQVA 4IJAA 3Q8SB 4YFXF 2LR8A 2XPUA 1Z21A 5EOZA 3DTIA 5L1LA 5CEHA 3HC7A 4KIFA 1MBHA 2RQ5A 1VTNC 1Z05A 1SL2A 4RBOA 2LK2A 1NTCA 1TNSA 2M9NA 5E18F 2A3VA 4RB3C 3T3FA 4E6KG 1L3VA 1K83J 3CF5F 2XIGA 2P5VA 5AK4A 2XAJA 3RRGA 5IP9J 4QZBA 5CWRA 4Y7NJ 2OXOA 3WODF 2EILH 4E4HA 5GAHJ 3SENA 2E1NA 1QVUA 1JGSA 1USSA 2OAZA 4G6TB 5KAIC 3MDAA 1KFDA 1WZ2A 5FKNA 3SDGA 2OJED 4NV0A 2EZKA 1HEKA 2DA3A 3KD3A 1ZQOA 3HOXJ 4IO9F 5EJCA 3L4PA 2JEIA 2B0CA 2KJCA 1WH5A 2ZFUA 4BBSJ 4YR3A 1V38A 2ZUBA 1OXJA 4I02A 2FLNA 3OIPA 1UHWA 4V19K 1JROA 4P0QB 2ID3A 4R8UA 5KFGA 3HRSA 1BW5A 2Q2EA 1KLNA 3M8EA 3GXOA 1HW1A 4CYCB 1Z9CA 5KFOA 4O3SA 4U6PA 1XN7A 1IXRC 2QF7A 3LK9A 2D3DA 3MDCA 3ABMH 3AG3H 1OMIA 4AVZA 3R61A 2NVTJ 3AN1A 3JREA 1J75A 3HZJA 2EZIA 4LOCA 4RB1A 4UBCA 3ZDBA 3CW2C 2DFEA 3FIWA 2LKXA 4GFJA 4IQVA 2XVCA 4CZZA 1YW9A 2W8KA 2W9BB 9ICFA 1PP8F 4HX4A 3CCSI 2V4RA 2ZIVA 3DEWA 4N9HA 1W1WE 1O4XA 3A4CA 4N0BA 5AKZA 3IKVA 2L54A 2L7KA 1NHAA 4UUSA 2XGPA 2XIDA 2O0YA 3T79A 2M0NA 4HAMA 1LDJA 2W9CA 1XCBA 1IDYA 4V2GA 3JTHA 5KFNA 3EETA 1J59A 3OSNA 5IILA 3SMVA 3AG2H 3W2AA 4NM1A 5DQGA 4DJAA 1KQ9A 2AQ4A 2M4KA 4HG2A 2OA4A 3MWMA 3E0JB 5BOXA 2PMZF 1HSJA 1DU0A 3WKDA 2ZJ5A 4XRFA 3OSFA 3BC8A 3JRIA 8ICVA 3I58A 4DWIA 2ZNZA 2W9MA 3O6BB 1B8IB 4PHPA 2X6OA 4DYRA 2KG5A 5DS9A 2AJQA 4BU2A 2XAUA 4NB5A 2FE3A 2E1FA 3NRZA 3QUBA 1QA6A 2BCUA 5IIMA 2N1RA 1Z7UA 2L9RA 3IWZA 4KIGA 4BJ5C 1W7PA 1LFUP 4DL2A 9ICMA 5IP7J 2BPCA 7ICRA 3HXLA 2DA2A 3JPSA 5CPRB 4C8NA 1T98A 4PJ0U 4RUCA 2W25A 1S72I 1UHSA 2NO5A 1NKCA 4RM3A 4YR0A 3LSTA 4NNJA 2HGCA 5DEQA 4KMFA 4L5EA 2Y9UA 2H8WA 4QZAA 1HW2A 2Z16A 2MLGA 3RBDA 4Y4RA 2MYSA 3ZMZA 4IRHA 1Z6TA 4M47A 2STWA 3J7AO 1N56A 1J0RA 3C5GA 2COBA 5F1JA 4J9LA 3C2MA 5J6XA 4F52A 4JX6A 7ICSA 1ZQIA 2GLEA 1O3SA 2R7VA 1FFUA 1LFBA 1I1GA 5AIQA 5FB2A 3P9IA 2BGWA 2ZMEA 4A69C 1QLNA 3E0FA 3NWSA 3CDLA 3KPHA 3SYTA 1D9FA 4G7OF 4FQGA 1SWVA 2FNAA 3TEDA 1VZ0A 1Y6IA 2I5UA 3A0HC 1XSVA 3L9FA 4Y17A 3SZGA 1RDFA 2ASDA 1ZGAA 3CO7C 2KDOA 2QKLB 5KFYA 4NC6A 1ZG1A 2BDPA 2F48A 3TAQA 2EZHA 2DTRA 1X3ZB 3WTSC 4EBCA 1WJFA 1F43A 2VN2A 5BMZA 4Q4ZF 2DBYA 2NYVA 2MG4A 4OJOA 1C0WA 4ED2A 5BQTA 1ZYRF 4B4CA 2LYCA 2RHFA 3FISA 4JV1A 2ZB9A 2D1VA 5DG8A 1XO0A 3ABKH 1IF1A 4QNLA 3QPHA 3WKEA 5CA7A 4U7CA 3TADC 1S5LC 3KX2A 4UUTA 1BVSA 1QVTA 3QUQA 1GUUA 2DMQA 2LVSA 1APLC 1N60A 3F2BA 5GTHC 1UA1A 3W6KB 2OD5A 2GOXB 3CUQC 2ACJA 2JV3A 5HLHA 1BPBA 2QSGX 5LRSA 4XQ8A 4WF2A 2FMQA 1UHMA 1XMAA 2NRAC 1QHGA 4EMSA 4A3IJ 2WF5A 1ZQCA 1YX5A 1X4OA 1BI2A 3MD2A 2GA1A 5D8LB 4UBBA 2WB1F 2AXLA 1RUOA 2JVHA 1JN3A 4O3OA 4D1QA 1HLVA 3N7PD 1DOQA 4IR9A 3JRDA 1N5XA 1P7JA 4YVZA 5DLFA 2KZ3A 2HOIA 1X1BA 3M4OJ 3NRVA 3I28A 5B3SH 2VA3A 1KU2A 2JPCA 1ZD4A 4F5NA 1SKSA 3TI0A 2HQ5A 2NVYJ 1WSUA 3QEAZ 4X0GA 1S97A 2RDJA 3BR3A 1XB4A 5HHIA 3MFKA 2P81A 5BNGA 3F2DA 3H9JA 4EX7A 1YE9A 4CICA 5F0CA 3ZGKA 3Q0UA 1I6HJ 5HR6A 3CLOA 4PGHA 5EZHA 2DI3A 3HRUA 1B72B 1SGGA 5GTIU 4Z6DA 3TACB 3G6YA 3ISCA 3G73A 4R63A 1QHHD 1ZK8A 1D0XA 2E1OA 3FX3A 3HKZN 1P9QC 3BR0A 3MKYB 2W3SA 3JPQA 4B9MA 5EEAA 3UMCA 3C1DA 3GILA 4XA5A 1W36D 3LSGA 3QEBZ 1C7YA 1MBJA 4BUGA 3WU2U 2HS5A 2VC0A 4X5VA 3TARA 2DOAA 5DYMA 2QBYB 4IQUA 3B6CA 4UV9A 3D2QA 3EDPA 2QENA 2VBZA 2HWVA 4G9YA 2DOFA 3K0LA 1MDMB 4EJTA 4IL6U 5F08A 2V1NA 2NYXA 3K4KA 2R93J 2P5LC 2HMXA 4PH5A 2PQ8A 4P9UA 2HI0A 3D1NI 4DFMA 3K6GA 2B0LA 2PX9A 2YUSA 3J81K 2MD5A 3ONQA 1M6YA 3ZD8A 3BQTA 3ZMVA 4B44A 4N4OB 3REOA 3IC7A 4IVNA 4XN3A 2D5VA 4Y33A 1ORKA 3AMZA 2A61A 4AWXB 2QARA 4UB8U 2PFPA 2BE5F 3LL7A 2DF4B 4PL2A 1Z00B 2DN0A 5B66C 2EZZA 4XKVA 1LDDA 3QYBA 1ZQAA 4PJLA 4F92B 4QZ8A 5E1XA 4OJ6A 5E3LA 4RGSA 5KFJA 4EYIB 4M9JA 4US9A 1S3JA 5HS8A 2AU0A 3TP0A 4Z6FA 5ALLA 1PVRA 4HF0A 2L4MA 2XKPA 2M3AA 4PJNA 1ETXA 3CMAI 1RYSA 2VI6A 5EG0B 4XLFA 4H0EA 2OTLI 4C2UA 1DGJA 2M8GX 1PK3A 2R3SA 4XLEA 3QU3A 4Y2YA 4R65A 4I27A 2OF7A 1AA7A 1EH6A 1OCCH 3WTTC 1MMNA 2OZ6A 3DLAA 1G8XA 4AIJA 3NRWA 3GV7B 1R22A 3CC2I 4E7HA 3QU6A 2ZSHB 2AQEA 4C2MJ 1W36C 2MBFA 3G71I 1KN5A 1TFRA 4Y2JA 3ZI4A 1YQAA 2BW3B 3BY6A 5J2BA 3GLLA 2JRTA 5ALFA 2QB0A 2XY5A 5J8FA 1G2HA 4A0ZA 3CC4I 1LB2B 2R7UA 1WJDA 3L7WA 2G0AA 2EANA 3LQRA 3V8JA 3PNVA 5J2KA 2DMNA 3KP7A 2ZJAA 5IT3A 3BG5A 4I2JA 1FP1D 3CUOA 3QX7A 5E20A 4DQIA 3PIOF 5F3XB 3QU5A 1XU4A 1R49A 4YP3A 4KLMA 2FD5A 2LOOA 3LWMA 3LWLA 1F44A 3QUCA 3FHZA 2G0EA 4YD1A 3ZMSA 5KFCA 2A07F 3C29A 2HOFA 4E7JA 4ESFA 5IIOA 3G1LA 4IQ4A 2EH3A 3ZMUA 5K5OA 1BM9A 3BG6A 4C3IJ 4FZNA 2XGDA 2E2HJ 3H9QA 4KMUA 2R7FA 1MMAA 1UCRA 4W97A 4ED1A 5KFDA 3TADA 5F9LA 1TK8A 4CCJA 1RPWA 3WTYC 2VJJA 3GTMJ 2LYHA 2ZUDA 5AK5A 4RUAA 4FZLA 1ZQRA 3JRBA 2DYRH 1PP7U 1S9HA 2ELJA 3CUQA 3OS1A 2KPMA 1WWUA 3HWTA 1UELB 3UKGA 2ZIXA 2Q4TA 1U8RA 4GLXA 3TFRA 5EE0A 3SJMA 1JRPA 2H3VA 3L3FX 1FBUA 3JPNA 2C6YA 3I71A 2VJ5A 2WF6A 2JH1A 4UAYA 1Z3XA 1HKQA 3F8CA 1SV4A 1ZD3A 1Z3YA 5ALPA 3CCJI 4QWDA 2L2OA 3S17J 2MA1A 4F5OA 1QRYA 5IYCJ 4AYBF 1TK0A 1GO3F 4RQ6A 2FBKA 4ENMA 2K4BA 3PW5A 2DKXA 1NNLA 1URJA 1KFTA 4O5EA 4KUMA 2DCEA 3MR6A 2ETHA 5F0HA 4M73A 3F6OA 1F5SA 8ICNA 1GXQA 1MW7A 2L0KA 4M3GA 1LE8B 3PR5B 1Q3UA 1YFHA 4M6WB 3F8NA 3SR6A 2MABA 1USTA 3UQ2A 1H88C 2MGQA 3GTOJ 2KSOB 4EJVA 2H5XA 5G5HA 2WADA 4JQFA 1Y0NA 4YCXA 3WE3A 4I2BA 5A2QK 2BOLA 1U78A 3KZZA 3MABA 2E7WA 2EPFA 5T14A 5ALUA 9ICUA 2XGQA 2IGOA 2QSFX 3LWFA 1NG6A 5GAEJ 4HSRA 4YMMA 2YB1A 3W2VA 1FMVA 3RKWA 1WHUA 4L5JA 3GUDA 4LLLA 5B5EC 5AIAA 1FIAA 4XICA 2YX4A 4QJFB 5GPCA
chains in the Genus database with same CATH topology
3AFHA 4CCMA 2KHVA 4C2TA 4NC8A 2CFOA 3KYLA 3HKZF 4XL9A 2KL4A 4OAYA 1R6RA 2HVRA 2Q1ZB 2E1MB 2VPLA 2Y0SF 3DKYA 1QU3A 2CW7A 1LDKB 4LIVA 1KBUA 1SAUA 2WAQC 4E7KA 3CYMA 3LMMA 5KNLA 4JMUA 4MLOA 2KQRA 2KLOA 4PL1A 3NWTA 2CV0A 2OH2A 5HVQC 1D0YA 3TMOA 1Q3VA 1CRXA 3OYNA 4OWRB 5KCMA 2KIWA 4KX5A 1MMGA 2CV1A 2R4GA 3K4JA 5CQGA 1KONA 1X1CA 3S8PA 2W04A 4E7IA 4QIWF 3ZRGA 4DGWB 4RLFA 2L9SA 4P0QA 2E5SA 2OV7A 2OM6A 3AQFA 2VKQA 4II2A 2VL8A 1D1BA 1YX3A 3N7RC 4FASD 2VQCA 2HPIA 3S93A 1PVQA 3PUBA 3FHNA 1DGWY 3C2HA 2V6EA 3CP2A 4LITA 3DU5A 3PSTA 4BE2A 3M6ZA 4E7LA 4BQNA 2UWMA 2G5HB 3SAHA 2D6FC 2HZDA 2KVCA 2OYYA 3F5EA 3U21A 2HBMA 4ITVA 3ALRA 1E0EA 2R18A 2CW8A 1L6NA 4A8EA 2LBFA 4BX9C 3RSNA 4ZYAA 4XQFA 1N78A 3SDBA 3OYKA 4P0PB 3DPLC 4BQOA 3HPHA 2G08A 1BOBA 4PFPA 2F8LA 2WAEA 3F2CA 2UV1A 3SEQA 3D2NA 5HNFA 3IAS2 2KJ9A 4J00A 2ZIUA 1UPHA 3F5AA 3HOTA 2K8BB 2LBOA 2JA2A 4IKFA 3MGVA 2WA0A 1WJCA 3VC8A 3LYSA 2RRDA 1T94A 2CS3A 4U87A 2G06A 2CMPA 2KRCA 4U7BA 1N77A 1YT3A 4PUSA 3VSKA 2DGZA 3OL4A 3CF2A 4NLCA 4H4KC 4JOMA 4YEJA 4P5OA 3H35A 2H3QA 4CDGA 5CRXA 4HNTA 4BEHA 2KMUA 2A5WA 4YRVA 3AKZA 2V26A 3PSPA 2HVQA 5KL1B 2KHMA 2A6TA 1MNEA 3K4LA 4ACOA 3D5SC 2IGKA 4IQJA 2ZSIB 3VDXA 3EPZA 2RREA 3K4BA 2IS2A 2MD0A 2VXZA 2WB1A 2H3ZA 3PSIA 4ZDLA 3IUOA 3L2VA 4C0ZA 4XMYA 4N4NB 2PJRA 4BACA 4XM3A 4AYBC 3PL8A 2CPRA 4NWIA 2RQQA 2W00A 4XLCA 3F53A 2NOJB 4XOPA 2KNJA 2ZIXB 3QODA 3FDYA 3BLYA 2Z7JA 3OYMA 2XF7A 3CESA 3RQ4A 3OYBA 2R7RA 1D8BA 2CV2A 3OYGA 1ED1A 1MNDA 2OUMA 3S32A 3W2WA 1PJRA 2W4SA 4XORA 1LKXA 3DPTA 2L5QA 4BJ6C 3KFUF 2DT6A 3GZFA 4BGDA 2X6YA 3VYSB 2ZXHA 4R79A 3PSFA 2R7XA 3HKZA 2E1EA 4NQWB 2Y0SA 2RNGA 4XKCA 4HNUA 3OYEA 3DPUA 4BDZA 1JI8A 2BDUA 3LFUA 2W1OA 4CZCA 3L2RA 2VXDA 2XC7A 2M7BA 4E7SA 5LFAA 4OJLA 2IXSA 4BL0B 2JMGA 2CUZA 2K9MA 1Z19A 2JUGA 3HOSA 2E60A 3OYLA 1V5GA 3K4CA 4XR6A 2WAQA 3EUKL 3IG8A 3TBIA 4ZDOA 3HKZC 4CCLA 4BE0A 1IIPA 3K1ZA 2Y0SC 3ONNA 2KHQA 4D9JA 1Z21A 3DTIA 1DP3A 2KEYA 4IX7A 4C30A 2V4JC 1DRGA 3HC7A 4IC9A 1N75A 3D5LA 1XNSA 2VB6A 1WJAA 3M8JA 1UG0A 4ANJA 3ZCOA 3OS2A 2VKDA 2A3VA 1X1DA 2WY8Q 4E6KG 2Z1DA 3S3MA 5FRNA 2F4IA 3A1YA 3UNGC 2GOLA 4E4HA 2OXOA 3PZPA 2KP6A 4QIWC 1P7DA 3MKWB 4G6TB 3J7AY 4CGZA 2HNHA 3PNTA 4NV0A 1HEKA 2YB4A 3OOUA 3OYFA 3OYIA 3H0LB 3KZXA 2R7TA 3E1SA 1TT0A 2ZFUA 2R7QA 2MRLA 3HG9A 4DIQA 3DQVC 2W7PA 1LVKA 3OIPA 4P0QB 2IS1A 2LG4A 3EUHC 3N7SC 4B43A 3K10A 4OO1J 4U6PA 2E1MC 3SEZA 2LH9A 5CKTA 4HEA2 2LY2A 4AVZA 2HBKA 3OS0A 4NC7A 4HPQA 3FBNB 4EATA 1PVPA 2BVLA 2R7OA 1WJEA 4GFJA 2ZIVA 3AQEA 3A4CA 1TZLA 2JVGA 2L7KA 3T79A 3KEYA 2XIDA 3ZXSA 2GH1A 2M0NA 2XICA 2LBFB 4ZTFA 5LD2C 5FRMA 1ERDA 2K5CA 1LFPA 3VCBA 2K3PA 5HR7A 4F3QA 2DXIA 2KKVA 3W2AA 3SMVA 4XKBA 4DJAA 2K89A 2X6XA 2M4KA 4RM2A 4Y3OA 4IZZA 4HG2A 3E0JB 2X1CA 4XNFA 2PMZF 2VJ4A 3OR1C 2MFZA 4ZDPA 2NV3A 3BC8A 5HOOA 2ZIUB 5FROA 3TL4X 2ZIWA 3DU6A 3LVVA 3BG7A 4BU2A 3GU3A 2XAUA 2E1FA 1V5EA 3MMYB 2OC6A 3LVWA 2E5NA 2N1RA 4BJ5C 1IRXA 5JHFA 2BW3A 3S3OA 4OJPA 3HXLA 4KJZA 4AYBA 5CPRB 2HOQA 4ZTJA 3QYFA 4F93B 2K8CB 4BEHB 4P1WA 2KJ8A 2M4GA 2KZVA 4PFOA 2IGNA 4RM3A 2V9KA 3HL2A 4BUPA 4NNJA 1OR7C 3IN5A 2VASA 1MA7A 2K4IA 3L2WA 3L2QA 2H3IA 2Z16A 2O5RA 2VIXA 4Y4RA 2MYSA 3D2SA 1A0PA 1ECWA 3AL0B 1FMWA 2E5ZA 4F52A 4KITB 2PJRB 2G07A 4BS9A 2WBMA 3UR3C 4CUGA 2R7VA 3CRXA 3EUAA 3IAM2 3E0FA 3ZR8X 3NWSA 3SYTA 3OYAA 3VYUB 3C28A 1Y6IA 1VZ0A 2HQAA 3SZGA 4DBRA 3K70D 2HU9A 3QOEA 2KDOA 2QKLB 1D0ZA 4NUBA 2XI9A 1SFKA 1Y56A 2XDVA 1WJFA 2KD1A 3F9KA 4B48A 3MKZA 4OJOA 4F55A 4QPOA 3VSLA 2RHFA 2LYCA 4B3XA 2HVSA 1XO0A 3DKXA 4QNLA 3SAFA 4U7CA 3C2GA 3SQIA 3OIQA 3KX2A 4DOZA 3PNYA 2VLAA 2DQNB 3OPXA 3CZ6A 2V7FA 4FE3A 4YELA 2W03A 3F2BA 1NZBA 2K4HA 4BXFA 2KOBA 2F5VA 2GOXB 2CH0A 2JH7A 2KKPA 1X4PA 4NLBA 3L2UA 3RTRA 2QKMB 3O0FA 1QHGA 2JGAA 4HSTA 3H0MB 2VQHA 1YX5A 1X4OA 3MD2A 4CCKA 2F2AB 4KMOB 2LYAA 2WB1F 3RF9A 1X19A 2JVHA 3S3NA 2M7AA 4F91B 4D1QA 3N7PD 4BJTA 2CRXA 3M1CA 2DJIA 4XLHA 2LYBA 2HOIA 1X1BA 4ZC3A 4DBQA 2G09A 4X0GA 4XONA 3IG5A 3RPUD 2VKHA 4CCOA 1J09A 3F2DA 2XF6A 3H9JA 2F6CA 2CN1A 4CA0A 1YE9A 3OR2C 3ZGKA 3G2BA 4XLAA 3H5RA 5HR6A 3DWLE 1WFXA 2HBLA 4ICAA 3OY9A 1QHHD 1D0XA 3MKYB 2W7OA 1P9QC 3RFAA 4WJ3B 2VQGA 4RMNA 1OLTA 3LSGA 1W36D 2K4EA 3GBGA 2CUJA 2IS4A 4BUGA 4LIUA 4LG3A 3IP4B 2WAFA 2DOAA 2IGMA 4XOTA 2IS6A 3OMYA 5CQEA 1SZHA 3D2QA 5A0LA 2X6WA 2Q2EB 2W82A 2WY7Q 2V1NA 2WAQF 3K4KA 1K6YA 1G59A 2HMXA 2PMZA 1A6SA 2F77X 3K6GA 2KRHA 3ONQA 2KV2A 3H5AA 1X1AA 1ZQ1C 4KT6A 3D5RC 4B44A 4N4OB 2VQLA 4XN3A 2H3FA 4Y33A 2LRDA 1MMDA 1D1CA 2ZG6A 1BR1A 3LL7A 3A2KA 2X1EA 2DF4B 2ZIVB 4PL2A 2R7SA 2PMZC 2RP5A 4XKVA 3VYRB 3QYBA 2LHTA 4PJLA 2KJ5A 3M6KA 4BJQA 4FETA 2FUG2 4F92B 2HBJA 4OJ6A 3VYTB 3CMMA 3HUGB 3OYCA 2LKYA 2F76X 4OAZA 2G5IB 1T95A 2JSPA 1PVRA 4PJMA 2DT7B 4P0PA 2M3AA 4PJNA 3QYEA 4CRXA 4XLFA 2LY1A 4C2UA 2HDWA 4XLEA 1AA7A 4PJJA 2K8AA 3NUQA 5KL8B 3OYDA 1MMNA 3DLAA 2YX8A 1G8XA 2ZIWB 4AU7A 3NRWA 2XVTA 3I3LA 4E7HA 4XKWA 3FBIB 2ZSHB 2AQEA 1W36C 2M0MA 2VJIA 3H9GA 3DTKA 2BW3B 4BDYA 1NG7A 4GRIA 3H0RB 2R7UA 1WJDA 2G0AA 4OJ5A 3K4NA 3PNVA 2JHDA 3DTEA 3H5NA 4PSWA 3LSIA 3W3CA 2X51A 2Z2SB 2LOOA 1Z7LA 5HLTA 1F44A 2R7WA 3ICXA 1BR2A 3C29A 2HOFA 4E7JA 4IQ4A 4J01A 3OWTA 4FZNA 3BG6A 4CH7A 3H9QA 4XN0A 5HNHA 4QPQA 1MMAA 3H0DA 4FZMA 1PYVA 3SAGA 2LC2A 4PSXA 4CCJA 3FKJA 4CCNA 2VJJA 3LSMA 3M7DA 1ZELA 4FZLA 1D1AA 4ZJZA 1EA3A 1S9HA 2ELJA 3OS1A 2KPMA 1HIWA 1WUDA 1UELB 2ZIXA 2Q4TA 4RLQA 2KICA 3L3FX 2H3VA 4KX3A 1DGRM 2VJ5A 2JH1A 1Z3XA 2UUZA 3BCBA 4CSWA 4E7ZA 1UAAA 1HA8A 1DQUA 1Z3YA 5TGTA 4HRIA 2L2OA 3OYJA 2MA1A 4AYBF 3DEEA 1Z1BA 1GO3F 3LSKA 3AL0C 2XSJC 3PFYA 2I8DA 2WB1C 3HPGA 3RCOA 2K9LA 1URJA 4KISA 4O3MA 4BE1A 1WJ5A 2DCEA 3I9V2 4B47A 3V42A 2XF5A 3ZQQA 3OYHA 1MW7A 3K4MA 2P0WA 2L9NA 3N05A 2GOMA 2MC4A 1Q3UA 2X85A 2MABA 1V5FA 3OL3A 2ZXIA 2BVMA 4C9YA 3PJRA 5C0YA 1OUQA 2HPMA 2AQFA 2WADA 1BR4A 1GLNA 4JQFA 1WJBA 3BCAA 2BOLA 2W7NA 2X1DA 5T14A 4II3A 4PK4A 3VWBA 2IGOA 3CP8A 1NG6A 3CJRB 1U0JA 4HSRA 2YB1A 3CJQB 3W2VA 1FMVA 3LSHA 4BQQA 1T0FC 2LREA 1TAMA 5KHDA 4QJFB 3K70C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEE A; 
#chains in the Genus database with same CATH topology
 3RAX A;  1GDT A;  2ZO4 A;  2KHV A;  2YMM A;  4TV7 A;  4ESJ A;  3UXN A;  1RYR A;  5AI6 A;  4XL9 A;  3DLL F;  3JAM Z;  2HVR A;  4FFD A;  5GAD J;  3ETL A;  4QZE A;  4EJO A;  2CW7 A;  1MKM A;  2QQ8 A;  1LDK B;  5ALQ A;  3RJK A;  1SAU A;  4M9H A;  8ICC A;  3TGN A;  4AIH A;  4Y2T A;  4UVA A;  4E7K A;  3QP6 A;  8ICX A;  5J0Q A;  5GPA A;  4NJ8 A;  4G12 A;  3H8M A;  3FZV A;  1G3W A;  2XB0 X;  2CV0 A;  2EAM A;  4NXZ A;  4RA2 A;  1S0N A;  5IOZ A;  2OH2 A;  5DV5 A;  2HYF A;  3NAR A;  2P6R A;  3UM9 A;  4BHB A;  3CMY A;  3WK4 A;  1Q3V A;  3DV8 A;  3OYN A;  4GDF A;  2H6B A;  1JIH A;  2ELK A;  4B9T A;  3RJE A;  1K4T A;  3NGD A;  3N97 B;  1NZP A;  2CV1 A;  2R4G A;  5CQG A;  2VBW A;  2DA5 A;  4NY8 A;  1KFS A;  4P4O A;  3ZRG A;  1N25 A;  1FC3 A;  4DGW B;  2KDZ A;  4P0Q A;  4A5N A;  1TWH J;  2B63 J;  1HXD A;  2R7D A;  3RKQ A;  2OV7 A;  2W84 A;  2K4P A;  3AQF A;  3C23 A;  5AM3 A;  2PFO A;  3HOY J;  4J03 A;  4IRC A;  4CYC A;  4WWC A;  2XB5 A;  4II2 A;  5FGM A;  8ICP A;  3PR4 A;  2HCF A;  1SMY F;  1Y8R B;  1QZE A;  3BPV A;  1QO0 D;  3S93 A;  3BS7 A;  1DGW Y;  3VB2 A;  4DSI A;  4YN4 A;  4RS8 A;  4A3L J;  4KT5 C;  2EIN H;  1SFU A;  5L3G A;  2EZL A;  2OPT A;  2UWM A;  1IUY A;  2G5H B;  1J9I A;  2V1U A;  4NL9 C;  3ZMD A;  2W9B A;  4DFK A;  2OYY A;  3A0B C;  3VEP A;  2CQQ A;  4NDL A;  2A3S A;  1KA8 A;  2HBM A;  2XRN A;  5L9X A;  1U49 A;  2BY2 A;  2CW8 A;  5FLX Z;  2XCP A;  3QZ8 A;  3TW6 A;  4NLK A;  1COK A;  2BEO A;  6PAX A;  4KDP A;  4RAY A;  1N78 A;  3DPL C;  4R8H A;  1FOW A;  3T0Y A;  3E6D A;  4I76 A;  4PFP A;  1OCZ H;  2WF7 A;  1UCV A;  1Q1H A;  2WAE A;  2UV1 A;  1VQK I;  5ALD A;  3IAS 2;  4JK1 X;  4KLO A;  1S10 A;  8ICE A;  1UPH A;  2EV6 A;  3E7L A;  2PMZ N;  1XD7 A;  2DDA A;  3VPR A;  5IT9 Z;  2NRX A;  2ZJ8 A;  5J0U A;  5F6F A;  1JTX A;  2P4W A;  2HI3 A;  2WA0 A;  3BRO A;  1B8I A;  3UXP A;  2K4J A;  2GAU A;  3N4M B;  3LYS A;  1ZQF A;  5DGB A;  2RRD A;  5FJ8 J;  4U87 A;  5M5Y J;  1PVE A;  4D0P A;  1RR8 C;  2DGZ A;  4PHD A;  1LEA A;  2Z9O A;  4NLC A;  4H4K C;  1SMT A;  4P5O A;  3U1K A;  4AD9 A;  3MR5 A;  3BJO A;  5CRX A;  4HNT A;  4U0V A;  1D8L A;  4KN4 X;  3P9K A;  4C8K A;  4F72 A;  2W57 A;  3Q0V A;  4DF8 A;  2PFB A;  3ESW B;  3ASN H;  4YRV A;  4I2C A;  4F7Z A;  2HVQ A;  2VKV A;  1D5V A;  2JPB A;  3BG3 A;  5KL1 B;  4L9T A;  1OYW A;  2DMT A;  2X0L A;  5L3E A;  4CO8 A;  2IGK A;  4KLU A;  5F27 A;  2YTU A;  5DLG A;  1ZQM A;  1FYM A;  5IYB J;  1K61 A;  4C8O A;  3K4B A;  2VXZ A;  2LKP A;  1G3S A;  3IUO A;  4N4N B;  4BAC A;  4UW9 A;  3PL8 A;  2BCQ A;  1F0M A;  1ITY A;  3K69 A;  1W0U A;  4DQR A;  3GIJ A;  2JR5 A;  4XOP A;  2W43 A;  2LI6 A;  3QOD A;  1ZXI A;  3KZI U;  4QW8 A;  1B59 A;  3BLY A;  3V7J A;  1T2K A;  5CP2 A;  3UMB A;  1FZP B;  1MSF C;  1STZ A;  4UVC A;  4BWM A;  4DL3 A;  4UAU A;  1ZQD A;  2OBP A;  2COM A;  1IXS B;  3D0S A;  1X9W A;  2CQK A;  3RQI A;  1ETO A;  5KT3 A;  1PJR A;  3PW4 A;  4N9I A;  1U45 A;  1LKX A;  5FFX A;  5DM7 F;  4Y2U A;  5J29 A;  5FKM A;  4MNU A;  1U5T B;  2DT6 A;  4IHY A;  2X6Y A;  3ABL H;  3GIM A;  4R79 A;  3HKZ A;  1JT6 A;  4YIF A;  3HTU A;  3RB0 A;  1ZQZ A;  3OYE A;  3DPU A;  4BDZ A;  3H8W A;  2BDU A;  7ICI A;  4M9L A;  2W1O A;  3BJA A;  4CZC A;  5M5W J;  1V97 A;  3FM3 A;  1E17 A;  9ICN A;  4TQS A;  2XUB A;  4OJL A;  1FOK A;  1RXW A;  4O3N A;  2JMG A;  2FX0 A;  1G3T A;  3HOS A;  2YU3 A;  3KEO A;  1V5G A;  1JUD A;  4I0B A;  4ENN A;  3LAP A;  2FMP A;  3TBI A;  3V8L A;  4CCL A;  2O9L A;  1SAN A;  2Y0S C;  3ONN A;  7ICV A;  4D9J A;  2WB1 N;  2VKE A;  1DP3 A;  4C30 A;  2V4J C;  1DRG A;  1VQ9 I;  3BDP A;  1XNS A;  3TKA A;  1N75 A;  3ABU A;  5H2F U;  4IHV A;  2VB6 A;  1WJA A;  1O57 A;  4U0W A;  1TQM A;  3CCE I;  5F9N A;  3IM1 A;  1UG0 A;  1JMS A;  3EPI A;  2BHZ A;  2P7C B;  2X9D A;  2NRV A;  2JUC A;  4QZC A;  3UQ0 A;  1U4B A;  5JFR A;  3KLN A;  4DOB A;  1TVA A;  1P6R A;  2WY8 Q;  3FKI J;  4ABZ A;  2X48 A;  3CQZ J;  3PO2 J;  4Q44 A;  2UVR A;  1OCO H;  2AHQ A;  2J6U A;  2HHW A;  2HXI A;  4F50 A;  3WKB A;  3A1Y A;  3FC4 A;  3CLQ A;  3UNG C;  5L1K A;  1B72 A;  2KP6 A;  4QIW C;  2YY6 A;  3MKW B;  1K1S A;  4HNV A;  3DFG A;  4CGZ A;  2VE8 A;  1ZQJ A;  1ZTR A;  3AM9 A;  2BY1 A;  5AI0 A;  3OOU A;  3OYF A;  4KNY A;  2IOF K;  5K7Z A;  4AC0 A;  3CCL I;  1FTZ A;  3RPU A;  3BTJ A;  3JRH A;  3KZX A;  4XSX F;  3E1S A;  1YJN I;  1BPX A;  1TW2 A;  5L3C A;  2EQY A;  2J5P A;  3JSP A;  1SD7 A;  2QBY A;  2W7P A;  4OIR F;  3P5J A;  9ICR A;  2A1J B;  4ECS A;  1MDM A;  4I2A A;  2LG4 A;  3QPT A;  1SXE A;  2A1A A;  3N7S C;  3DF8 A;  4B43 A;  3SEZ A;  3JRF A;  2CJJ A;  2LH9 A;  4DNC A;  1QPI A;  4BY1 J;  5CVR A;  5DD8 A;  3QP5 A;  4AID A;  3IHQ B;  1RG6 A;  1X2M A;  3OS0 A;  1YZ6 A;  4HPQ A;  3EYY A;  3FBN B;  2ES6 A;  1PVP A;  2BVL A;  1B1B A;  1WJE A;  2M30 A;  4MIM A;  5KG6 A;  1SB3 C;  5LHG A;  4RQ7 A;  2A19 A;  3UMG A;  2MA3 A;  4RT2 A;  1ON1 A;  1JHH A;  1Z00 A;  2KT0 A;  5F1R A;  5KT6 A;  5E8G A;  3ZXS A;  2XIC A;  1KU3 A;  4JX4 A;  2H1K A;  5FRM A;  2B7E A;  2K5C A;  1LFP A;  3WTU C;  5HR7 A;  3LSP A;  2DXI A;  4RQ4 A;  1S6L A;  3I4M J;  2K89 A;  1YW8 A;  3TO9 A;  1S7A A;  1BIB A;  4IZZ A;  4IOA F;  1XTA A;  2HSZ A;  4UB6 U;  1QTM A;  4DSE A;  1H89 C;  5FKO A;  3ABT A;  1NJX A;  2HHV A;  5EG0 A;  4KA4 A;  4P55 A;  3AUO A;  3HJE A;  4ZDP A;  1WCL A;  4FHT A;  2ZIU B;  3C18 A;  4M6Y A;  4YII A;  4A93 J;  9ICH A;  1OCP A;  1R1U A;  4U7D A;  1S76 D;  1TTY A;  4PGQ A;  2L7Z A;  1YG2 A;  2OC6 A;  2E5N A;  2JZY A;  1IRX A;  2BW3 A;  2E35 A;  3F21 A;  1DDN A;  4XSZ F;  3RZD J;  1SZP A;  2NS7 A;  2Q8K A;  2HOQ A;  4TQR A;  3ZDD A;  2DTZ A;  4ZTJ A;  2ZFW A;  4JV0 A;  3NVV A;  3QYF A;  2PI0 A;  2K8C B;  4KLD A;  4P1W A;  2M4G A;  3HL2 A;  1VLB A;  4MHG A;  2F5D A;  4PGY A;  1OR7 C;  4A5M A;  3IN5 A;  3JSO A;  1QSL A;  1Y0U A;  3EWA A;  1WKM A;  4A2U A;  4K4G A;  5J2D A;  1LKY B;  1JKR C;  4ZZD A;  5KFE A;  4GO1 A;  4WXC A;  4RGR A;  1R4N B;  1PZN A;  1I1S A;  5BPD A;  1S7O A;  2E19 A;  5HS7 A;  1FMW A;  4KLJ A;  2K3F A;  2P6S A;  1U6G A;  1ARO P;  1NOM A;  2WBM A;  1JKQ C;  3ML6 A;  1IN8 A;  5J1U A;  2YQE A;  2IA2 A;  3WG9 A;  1ZQ3 P;  1LJ9 A;  3EUA A;  5LGU A;  2IRF G;  4Y2X A;  4ED0 A;  1T56 A;  2JRM A;  5KFT A;  3ZR8 X;  1KQQ A;  3T5J A;  4EM1 A;  3THV A;  2HOS A;  4DBR A;  3K70 D;  1WCN A;  2V6C A;  3QOE A;  4M3E A;  4ZYD A;  4NUB A;  2HHQ A;  2M87 A;  5IIJ A;  5L3D A;  4EJW A;  2BQR A;  1NJZ A;  3Q8Q B;  2ESH A;  3F72 A;  2XDV A;  2OU2 A;  1NK2 P;  2LFB A;  3MKZ A;  4F55 A;  4QPO A;  3VSL A;  2ZME C;  5KG4 A;  2JA5 J;  1KDH A;  4B3X A;  3DKX A;  5EGO B;  2ZJ2 A;  5AI4 A;  3C2G A;  4ENJ A;  5BOM A;  2DQN B;  4AYB N;  2XSD C;  3PNY A;  3J80 Z;  2VLA A;  2PI5 A;  1DK2 A;  3OPX A;  3CZ6 A;  5KG3 A;  2V7F A;  1V9P A;  4FE3 A;  3KFW X;  4YEL A;  5AM1 A;  4I99 C;  3HHH A;  3EQL F;  4BXF A;  1L8O A;  2K60 A;  1LPQ A;  2WTE A;  5ED4 A;  2EFO A;  4YMN A;  5KG7 A;  3S1M J;  1X4P A;  9ICE A;  4I01 A;  3HSE A;  1ZET A;  4M6W A;  2JGA A;  1ZRN A;  3H0M B;  3M1E A;  4HV5 A;  2F2A B;  4IQT A;  4KMO B;  2LYA A;  4R64 A;  4F5R A;  1A76 A;  3RF9 A;  3SQN A;  4YMO A;  1FEX A;  4LK1 F;  2DPU A;  4ZH4 F;  2LMD A;  2KSO A;  2CXY A;  4F91 B;  1HUO A;  4MFF A;  1E3P A;  3M1C A;  5H20 A;  2DJI A;  1XO1 A;  4CF5 A;  2I6X A;  4QZF A;  7ICN A;  4DBQ A;  2FPK A;  1BW6 A;  1XX5 A;  3ORY A;  3A03 A;  2DPD A;  3HYI A;  4UVB A;  3IG5 A;  1L7P A;  2XPV A;  2A05 A;  5J8C A;  1R1V A;  4CA0 A;  1ZQV A;  3BQ1 A;  3G2B A;  3RIR A;  3PO5 A;  5ICF A;  4BNC A;  3H5R A;  2MSN A;  2FA5 A;  1D5Y A;  2Z3Y A;  4RGU A;  3TQN A;  2E2J J;  3WK9 A;  4C8M A;  5FFZ A;  3SZ2 A;  1IUF A;  3CJT B;  3GYH X;  4HLX A;  1WFX A;  4ECV A;  4ICA A;  2BPG A;  1NK0 A;  1ZLJ A;  4DEZ A;  4RMN A;  3F3X A;  2Z33 A;  3S16 J;  5ALZ A;  3PY8 A;  4BY7 J;  2PN6 A;  1YIJ I;  5IYD J;  4DQS A;  5LBQ A;  2F1J A;  2ECC A;  3TQ1 A;  2RDI A;  3RJJ A;  1BPD A;  4IXA A;  4XOT A;  2E1C A;  2IS6 A;  3OMY A;  2GXG A;  3FXQ A;  1X9S A;  2HW3 A;  5A0L A;  3N97 A;  4BXX J;  4ECY A;  3TO7 A;  1OIS A;  2WAQ F;  1K6Y A;  1G59 A;  2PMZ A;  5HLI A;  1CF7 B;  1JI7 A;  1LQ1 A;  2F77 X;  3KP3 A;  4LG0 B;  5KFW A;  4GXO A;  5AK6 A;  1U9O A;  2DDB A;  3H5A A;  3QPL A;  4UHT A;  2KV2 A;  2FML A;  1E3H A;  2DBB A;  4HQE A;  1HBX G;  3E6C C;  1MSE C;  2JA8 J;  2VQL A;  4ZOH C;  2BCV A;  2JN6 A;  4G7Z F;  2DFL A;  3RB4 A;  2XY6 A;  3FXK A;  3QUT A;  2ZXW H;  2RGV A;  3BQ7 A;  4I28 A;  4MQ9 F;  3GDX A;  3BOQ A;  2R7S A;  2IHN A;  5DB9 A;  4QW9 A;  1VF9 A;  1RC9 A;  4IHX A;  4IS7 A;  5ALT A;  8ICB A;  2RN7 A;  2YML A;  4KLG A;  4BJQ A;  4O5K A;  3CCU I;  2C2D A;  4PDK A;  2HBJ A;  4A0Y A;  4ECU A;  2AQ0 A;  4RNO A;  2LKY A;  8ICJ A;  9ICV A;  3NAS A;  4OD0 A;  1T95 A;  3M9O B;  1MZB A;  2AS5 F;  3UPQ A;  4NHJ A;  3CCR I;  3B9J A;  2DT7 B;  5KFL A;  3QYE A;  3V7R A;  5IPA A;  2KZG A;  5KFA A;  4CRX A;  2Y69 H;  3OTQ A;  1OR7 A;  5KL8 B;  2K8A A;  3NUQ A;  4XUS A;  5KFP A;  3OYD A;  2F5C A;  1AHD P;  5G5G A;  5F04 A;  5ICE A;  2NNN A;  4IR1 A;  2CRG A;  3Q8K A;  4M9X A;  4FX4 A;  2ZCW A;  2D45 A;  5DBA A;  4DS5 A;  2E7X A;  3SFZ A;  3A01 B;  3NVZ A;  4DZJ A;  3H9G A;  4PHA A;  4D5C A;  2Y75 A;  5DUK A;  5EEG A;  5DDG A;  1KYZ A;  1DXS A;  3N4M A;  2CFX A;  5ICC A;  3H0R B;  3BQ2 A;  3ASO H;  3ED5 A;  5AM4 A;  3E6M A;  3K4N A;  5ICG A;  2I5H A;  3E5X A;  3KP4 A;  1R00 A;  1ENH A;  2Z2S B;  1EF4 A;  1Z7L A;  2Y9Z A;  1QQ5 A;  1T3N A;  4Q8F A;  1JJ6 C;  1JUP A;  2BV6 A;  3B02 A;  2CQX A;  8ICK A;  1LVA A;  4QWC A;  5AHX A;  3SZT A;  4I2O A;  3MBY A;  3C7J A;  1POG A;  2HZT A;  2QEX I;  4FCY A;  2CGP A;  1NK4 A;  4P9F A;  4CH7 A;  1QQ7 A;  4XN0 A;  1A04 A;  3I4P A;  5J3L A;  1YIO A;  5L3F A;  2JSC A;  2XRO A;  4J9O A;  1OKR A;  1PYV A;  2IP2 A;  5KVR A;  2R8J A;  5AKX A;  3M7D A;  3LSM A;  3QU9 A;  1D1A A;  2ID6 A;  4ZJZ A;  2LD5 A;  1GV5 A;  1NJW A;  4EEK A;  1ETY A;  1HIW A;  1ZN2 A;  1XDS A;  4RLQ A;  3JPT A;  2NS0 A;  5DTD A;  4FT8 A;  2FJ6 A;  4HZF A;  1HDP A;  3T5L A;  2BQ3 A;  1V3F A;  4IEJ A;  1L3S A;  3RI4 A;  7ICK A;  9ICP A;  1XGN A;  2RQP A;  4CSW A;  2BYV E;  4HF1 A;  2EK5 A;  1HA8 A;  3V7K A;  1MQ3 A;  1MSW D;  2LNB A;  3HSF A;  2EV5 A;  3IH2 A;  3C21 A;  1Z1B A;  2BY3 A;  1MJB A;  3NQO A;  2F4M B;  4L9V A;  1L0O C;  1COO A;  3PFY A;  4ECQ A;  5JU5 A;  5J2I A;  3BR6 A;  4O3M A;  1KU9 A;  2ZJR F;  1TAQ A;  2P7V B;  4DYC A;  4KIS A;  3ISD A;  1ZQP A;  4BE1 A;  3KHG A;  4LLN A;  3V42 A;  3GV8 B;  3IDW A;  4E70 A;  3K4M A;  1AKH B;  1O7L A;  2L9N A;  3N05 A;  5JVT A;  2MC4 A;  2JJ7 A;  2X85 A;  4UV8 A;  3HEF A;  5KFI A;  2GM4 A;  3RKY A;  3FWE A;  2EBI A;  5C0Y A;  4C9Y A;  1RPL A;  1BNP A;  5ALI A;  2FRH A;  3K9T A;  1UB9 A;  2AQF A;  1GLN A;  1XG1 A;  1RQN A;  8ICF A;  2Y48 A;  2W7N A;  7ICP A;  4M9Z A;  4MTE A;  2HQR A;  3KIO A;  4ETS A;  3VWB A;  4RNN A;  1YS6 A;  2E8O A;  3CP8 A;  1EH8 A;  5AKH A;  5ALR A;  3C2K A;  3CJR B;  2FLP A;  1U0J A;  7ICE A;  4B9U A;  2OTJ I;  3GZ6 A;  5AIC A;  5FP0 A;  2M5W A;  4BQQ A;  1ACI A;  5CHG A;  3OJU A;  3MKL A;  4IRK A;  4KLQ A;  1TAM A;  1KTQ A;  3K1M A;  3E3V A;  2NNY A;  4JX5 A;  4KFC A;  3IRR A;  3V6J A;  2VA8 A;  3BDD A;  4V2F A;  1R23 A;  3WK5 A;  2E1M B;  2VPL A;  5B5E U;  4DOC A;  5J0X A;  5J2E A;  1IN4 A;  2YSR A;  3HGY A;  1I3A A;  3I64 A;  5F0F A;  2KN7 A;  1UA0 A;  2UVV A;  3PO4 A;  2QLZ A;  2ME6 A;  2MH2 A;  1T3Q A;  3CYM A;  8ICS A;  4JMU A;  2GXA A;  2KQR A;  2M0C A;  5ALG A;  3HW8 A;  3L1P A;  2C2E A;  4PL1 A;  3ERE D;  1JXS A;  2KKO A;  3H3U A;  3I54 A;  4ED8 A;  1C20 A;  5J2F A;  3WGG A;  3HP6 A;  4RQ0 A;  5J2C A;  3HIF A;  4J9N A;  1SD6 A;  3KYC B;  1G6N A;  3VOE A;  3Q3S A;  4C4T A;  4RPZ A;  3IRU A;  1MMG A;  1SWW A;  3K4J A;  1TWG J;  1GV2 A;  1MH3 A;  1KON A;  3QWL A;  3COA C;  2W04 A;  4EVI A;  2RLT A;  5DB8 A;  3SZP A;  3G6V A;  4RLF A;  2KK0 A;  4ED6 A;  3RJP A;  2A1J A;  7ICQ A;  1O3Q A;  5JLW A;  3WG7 H;  1FOY A;  3M07 A;  1OJL A;  1BC8 C;  2KP7 A;  1ZQG A;  4O0I A;  1O03 A;  3N7R C;  4FAS D;  5E8I A;  2VQC A;  2HPI A;  3V6H A;  5M3F J;  7ICF A;  3JPP A;  3PUB A;  3FHN A;  4KIC A;  3F22 A;  3IHU A;  2QVO A;  2V6E A;  3NAU A;  2F1I A;  4TUR A;  1FBQ A;  1GVD A;  2Q0O A;  3CP2 A;  3PST A;  5J40 A;  4FX0 A;  5EDN A;  4BE2 A;  2D1H A;  4MTD A;  4XLP F;  2VOO A;  5BPI A;  1TQP A;  2HZD A;  3RYP A;  2JQ7 A;  3TAP A;  1RXV A;  2OQR A;  3CCV I;  2L4A A;  2ADU A;  1PUF B;  3H92 A;  3QQA A;  1E0E A;  1AQ6 A;  1UT8 A;  3MR3 A;  1L6N A;  2CYY A;  3R9K A;  3RSN A;  3DDH A;  3JRG A;  2FLL A;  3HPH A;  2G08 A;  1R4M B;  3A0B U;  5JTI A;  3IL2 A;  3S14 J;  3GTL J;  1B43 A;  7ICL A;  5EWG A;  1KEJ A;  3F2C A;  2VA2 A;  2E36 A;  3FAH A;  5HNF A;  1IM4 A;  4ED7 A;  1UMQ A;  2FXA A;  2KFD A;  3MEX A;  2CWE A;  2DMP A;  2ZIU A;  4D7N A;  4NWI A;  5DDM A;  3Q9S A;  4M71 A;  1R9T J;  2LBO A;  1RRJ A;  3KOO A;  3ISP A;  1WJC A;  5FKL A;  4F4Y A;  1CGP A;  1T94 A;  2E3T A;  1X9X A;  3RB6 A;  1JJ8 C;  4PJ0 C;  1S0M A;  9ICQ A;  4PUS A;  3VSK A;  1SL1 A;  2XV4 S;  3CF2 A;  3J81 Z;  3H36 A;  2G7U A;  1BI1 A;  1MNM C;  1TC3 C;  4HBL A;  1B0X A;  2QM3 A;  2BPF A;  1W0T A;  1X9M A;  1ZQS A;  2KMU A;  3WKC A;  1VQ7 I;  2HQN A;  1XSP A;  2A5W A;  4AVP A;  2EFW A;  1JX4 A;  2HKO A;  3HGG A;  4Y2R A;  2V26 A;  2JMW A;  2KHM A;  2A6T A;  3PM1 A;  3BS5 A;  3BTL A;  1LKY A;  5AKJ A;  5C4X J;  5DB6 A;  3GEZ A;  3Q8L A;  2B6G A;  4RQ2 A;  3QU7 A;  5KFX A;  3VFZ A;  1ZQW A;  2WV0 A;  4L9J A;  2IS2 A;  2H3Z A;  3PSI A;  2O03 A;  1K79 A;  1MD0 A;  4XM3 A;  1MIJ A;  2VT2 A;  5C44 J;  1MJ9 A;  2RQQ A;  5D5W B;  3GFJ A;  4XLC A;  1FBS A;  3F53 A;  1RNL A;  4HYE A;  4CE6 A;  1A31 A;  2R5Y B;  5J0T A;  2LF8 A;  3ETR A;  2KNJ A;  2HVI A;  1RYU A;  1ZG3 A;  1ZRD A;  2DW4 A;  3OYM A;  1XC9 A;  3CES A;  8ICY A;  1D3Y A;  1M1E B;  2R7R A;  1QNT A;  4GXJ A;  1D8B A;  5GAG J;  5F64 A;  4HDV A;  1ZQY A;  3RJF A;  2H8R A;  3W2W A;  4XOR A;  2VC1 A;  2P66 A;  1S0V A;  1FSE A;  5J2J A;  1IN6 A;  2L5Q A;  3GTQ J;  2ZTD A;  4KTQ A;  3KFU F;  3CJN A;  4G6Q A;  4IRG A;  4BGD A;  3PNC A;  3VYS B;  3PSF A;  3HDD A;  3C5F A;  5EGO A;  1ZQT A;  8ICR A;  4M9S A;  1R58 A;  3H7I A;  5E79 U;  3H40 A;  3NVW A;  1JI8 A;  1A6Q A;  3B0X A;  1XSN A;  2A6E F;  4LD5 A;  3TKY A;  2FBH A;  2ODG A;  2XC7 A;  3TFS A;  4DL5 A;  2P6U A;  4B9N A;  5LFA A;  1FTT A;  3PX0 A;  2BBY A;  3FMQ A;  1PUZ A;  2OCC H;  2CUZ A;  2JUG A;  4ECZ A;  5CVJ A;  1T6S A;  2JA7 J;  2V4Q A;  4DSJ A;  4Y2S A;  3U9G A;  1I6X A;  3EUK L;  4O3Q A;  1I39 A;  4YFK A;  1TLH B;  5JHU A;  5L3B A;  4BHC A;  4MEX F;  2JZB B;  3HKZ C;  3H4B A;  3BQZ A;  1TNT A;  5LRR A;  2KEY A;  4IX7 A;  1VQL I;  2F3N A;  3ELK A;  1U9L A;  2W24 A;  4TUS A;  2IBD A;  3PQJ A;  4ED3 A;  4FO6 A;  1XS9 D;  5M3M J;  2EIK H;  4KN7 X;  4ANJ A;  3OS2 A;  2WTF A;  1OYY A;  1CQT A;  2DMU A;  3SHF A;  9ANT A;  3MAJ A;  4C80 A;  3QU2 A;  3BZK A;  4MF8 A;  1GXP A;  5EYR A;  3BQY A;  5L1I A;  2F5E A;  8ICH A;  1P4W A;  5GTI C;  5TIS U;  3U1D A;  2KIV A;  3S3M A;  2A68 F;  5DG7 A;  2DAO A;  4XRM A;  2EH9 A;  4QZH A;  5FD5 A;  2GOL A;  3PZP A;  1X2I A;  4FS1 A;  3F8B A;  1T7P A;  3J7A Y;  3EUH A;  2HNH A;  3PNT A;  4BQA A;  2FQ3 A;  2DK8 A;  3H8J A;  3KHL A;  4J9Q A;  1MQ2 A;  1AWC A;  5ALK A;  1HW5 A;  2HVH A;  3WU2 C;  4L9N A;  3V8K A;  4RPX A;  5L1J A;  3RDI A;  3H0L B;  1BPZ A;  4M04 A;  3M8S A;  4GYI A;  1TT0 A;  4PZJ A;  1YW7 A;  4DIQ A;  4DSL A;  3DQV C;  4IL6 C;  3W6J B;  3WGI A;  1H0M A;  4Y2Q A;  2UVW A;  5JR3 A;  2AXT U;  2KE7 A;  2QQB A;  3J7Z I;  2F2E A;  1U3E M;  5KFU A;  5DBB A;  1LEB A;  3KKA C;  2JEJ A;  2E1M C;  3ERM A;  4LG0 A;  3WKA A;  2WAQ N;  5CKT A;  1ZQE A;  2QSH X;  4HEA 2;  4RAZ A;  5A2Q Z;  4GGG A;  2HBK A;  1XSL A;  4NC7 A;  3MFH A;  1EV7 A;  1RZT A;  4JUZ A;  4EAT A;  1LUJ B;  1O3T A;  5D4S A;  3RZO J;  9ICT A;  2K86 A;  4O5V A;  1NK8 A;  2H6C A;  5E1W A;  2FSW A;  2EZX A;  1F1Z A;  2NO4 A;  1TZL A;  5ALN A;  4JK1 A;  1FLI A;  4OMY A;  1LV5 A;  2GH1 A;  1REP C;  1QQI A;  2BCR A;  2TCT A;  3E2E A;  2JT1 A;  2W3R A;  2K3P A;  4F3Q A;  2KKV A;  2WHE A;  4G94 A;  4XKB A;  3FDS A;  2PMU A;  2Y31 A;  2W9C B;  2BXY A;  3BTC A;  4RM2 A;  4Y3O A;  5FD6 A;  3K1R B;  2HHT A;  1KQ0 A;  3H3Z A;  4X1E A;  5ILU A;  1ZRM A;  3GX4 X;  2DL0 A;  4XNF A;  3MGH A;  2C22 A;  2NV3 A;  2MFZ A;  3E58 A;  3I56 I;  2KIS A;  3LAJ A;  4F5Q A;  4D7M A;  3TL4 X;  4R66 A;  2CUF A;  4KN4 A;  4G7H F;  3LVV A;  2XGC A;  3BG7 A;  4M6V A;  2O8K A;  3M9N B;  1HST A;  1ZD2 P;  5LGN A;  3MMY B;  3K1P A;  3LVW A;  3A01 A;  4US8 A;  1KL9 A;  5KAF U;  1BJA A;  5C5J A;  1FYK A;  3S3O A;  1XPX A;  4KLF A;  4OJP A;  1D9D A;  4KJZ A;  5HLG A;  3K1N A;  4A3K J;  3IV5 A;  2DJN A;  4UAZ A;  4A3G J;  4EZ9 A;  1BPE A;  2QB1 A;  2GWR A;  2LKS A;  3QE9 Y;  1F36 A;  2EIJ H;  2KZV A;  4PFO A;  2IGN A;  3T5X A;  1JHF A;  2V9K A;  4BUP A;  2XGX A;  5ALO A;  3SI8 A;  1Y8Q B;  1SKW A;  2VAS A;  3PVX A;  4P4M A;  1MA7 A;  3L2W A;  3L2Q A;  3KE2 A;  1TKD A;  3WK8 A;  2O5R A;  3TO6 A;  3BQ0 A;  2ZJP F;  2QA4 I;  1X6J A;  1A0P A;  1FOX A;  1Z67 A;  4JV2 A;  2STT A;  2ESN A;  1ZG5 A;  4BS9 A;  3UR3 C;  3HRT A;  1T08 B;  1BL0 A;  4KIB A;  3R4K A;  1UZC A;  1J2M A;  3BWG A;  5DUI A;  5ALY A;  4J9S A;  2ZTE A;  2XHK A;  4DL7 A;  1B22 A;  2M34 A;  3OYA A;  2HHU A;  3T8T A;  2L02 A;  3VYU B;  3QYP A;  4RQ1 A;  2NRW A;  3C28 A;  2WF9 A;  1FPQ A;  2BXZ A;  4RNM A;  2Y1J A;  1NK7 A;  3WHC A;  2V1X A;  3J81 j;  1D0Z A;  4XRH A;  3D6J A;  5DQI A;  1ETQ A;  4I29 A;  1SFK A;  2FMY A;  1Y56 A;  1CUK A;  2KD1 A;  3F9K A;  1RET A;  2EZY A;  3QAH A;  7ICM A;  3O8H A;  5HHH A;  5KFV A;  2Y9T A;  2X4H A;  4HOB A;  4DCC A;  2G7H A;  2W8L A;  1ZQB A;  1ZQH A;  4K4H A;  9ICB A;  2Y2Z A;  1FP2 A;  3SQI A;  4DSK A;  3OIQ A;  2OZU A;  2DK5 A;  1NKE A;  1X3W B;  3ZMT A;  5D6E A;  4DLG A;  2W03 A;  2K9S A;  4TUP A;  2J6S A;  2K4H A;  5C3E J;  2JA6 J;  3V7C A;  5KK1 A;  3GV5 B;  4WXH A;  5IIK A;  1AKH A;  3SFI A;  1SFO J;  4A3E J;  2PKE A;  4UB2 A;  3RTR A;  1UT5 A;  2IJL A;  5DD4 A;  3RR7 A;  2EFN A;  3E5U A;  5TRD A;  2VQH A;  3L2C A;  2QQA A;  4A3J J;  1X19 A;  2C2R A;  2R8G A;  5J1Y A;  3GZ5 A;  2PLY A;  1OPC A;  1NK9 A;  8ICZ A;  1T33 A;  1HOM A;  2W11 A;  4BJT A;  1ZH5 A;  2PJP A;  8ICQ A;  2ALZ A;  4GYG A;  2Y0M A;  4XLH A;  1A6I A;  2LYB A;  4ZC3 A;  2BR0 A;  4A3M J;  4EM2 A;  4A3B J;  4J9R A;  1BI3 A;  3B73 A;  1N61 A;  3AG4 H;  1RES A;  1QCK A;  3F8M A;  4ECX A;  4CCO A;  2VKH A;  1L7O A;  2DUY A;  2GLO A;  2XF6 A;  5J1R A;  3OR2 C;  4QZI A;  4DYQ A;  3F6V A;  1RM6 C;  1JKP C;  3KKA A;  2UXX A;  4IRI A;  3OY9 A;  1IN5 A;  4XRS A;  3S15 J;  4WJ3 B;  5KAI U;  1VJ5 A;  2VQG A;  4CF3 A;  1TWC J;  2EV0 A;  3HSR A;  4OMZ A;  1SIJ A;  3MCZ A;  1JT0 A;  2CUJ A;  2ZBK A;  3LOC A;  2IS4 A;  5E17 F;  4LIU A;  1V54 H;  3L09 A;  4LG3 A;  4MGR A;  3GTJ J;  2WAF A;  3I0T A;  5FKK A;  3S2H J;  4Y2V A;  3FK6 A;  5CQE A;  2DT5 A;  3FYH A;  4GC6 A;  1X2N A;  1FWZ A;  2X6W A;  3WE2 A;  3U26 A;  4PGG A;  1SD5 A;  3RH4 A;  3RAQ A;  2V9V A;  5K7F A;  1U9N A;  2K40 A;  2D8C A;  5AK3 A;  4KYW A;  2KRH A;  4EEN A;  2XAF A;  1R7J A;  1D8K A;  3CDH A;  1X1A A;  4MFE A;  1VFC A;  5JUM A;  5J0W A;  2VUM J;  1KQ8 A;  5C4J J;  2NOG A;  5AON A;  3TOB A;  4UAW A;  4DOA A;  4NLG A;  2ZKZ A;  1WI3 A;  1YJW I;  1JUM A;  3F0C A;  1IZ1 A;  2H3F A;  1ZQK A;  3I59 B;  2DPI A;  3JW4 A;  1MMD A;  1ZRF A;  2ZG6 A;  7ICU A;  1BR1 A;  2X1E A;  2LPE A;  3ZN0 A;  5HOD A;  2PMZ C;  2LLK A;  5E3M A;  2RP5 A;  4RB0 A;  1V55 H;  4LFU A;  3Q5F A;  3B0Y A;  3IV6 A;  2LHT A;  4Q45 A;  2E8M A;  3M6K A;  4MEY F;  2DA4 A;  4FET A;  2FUG 2;  5LHH A;  1X3U A;  3HUG B;  1TBX A;  1UJ8 A;  1W5S A;  2ELH A;  5H6Q A;  3OYC A;  1PUF A;  2F76 X;  4EQQ A;  1W7P D;  4YQW A;  2DOE A;  2HTJ A;  4RDU A;  2F5F A;  2IT0 A;  4MFA A;  1DPU A;  4ELU A;  1EKE A;  4W1U A;  4WX9 A;  2GBY A;  2M9H A;  2LY1 A;  1NJY A;  4M9N A;  1QSS A;  2HDO A;  3H1C A;  1XSX A;  2W9A A;  4B9S A;  1P92 A;  4ELT A;  4Z2Y A;  2YX8 A;  2ZIW B;  2WWY A;  4KLE A;  2HYJ A;  5J2A A;  4I2G A;  3I3L A;  5AM2 A;  4XKW A;  4FE7 A;  4HDU A;  4RQ5 A;  1U47 A;  3HM5 A;  5EF6 A;  1LB2 A;  5KFM A;  3GFM A;  3WTW C;  3K4G A;  4ZYH A;  2DPJ A;  5EWE A;  4BDY A;  4YG2 A;  2F44 A;  4CXF A;  2VON A;  5AIP A;  8ICM A;  5DG9 A;  3MN2 A;  1QSY A;  2NVU B;  1FO4 A;  1TK5 A;  4E0D A;  2PFN A;  1D8J A;  3FXM A;  3HTS B;  2JHD A;  3I5U A;  1IG7 A;  2DKZ A;  3DTE A;  2MAX A;  3GFI A;  3CCY A;  2X51 A;  2LF7 A;  4Q8E A;  2HEO A;  2P8T A;  4B8X A;  4B3A A;  3JTG A;  4RT3 A;  1YO5 C;  5HLT A;  3RH5 A;  5K4L A;  2R7W A;  1V85 A;  3ICX A;  7ICG A;  2E8N A;  2ATL A;  2KRF A;  1J2X A;  4A0X A;  2NRT A;  2YX7 A;  3WGH A;  3M9M B;  4LJZ F;  1EJ9 A;  2A5Y B;  5HNH A;  4UB3 A;  2B21 A;  5HP4 A;  4HX8 A;  1FIP A;  1X40 A;  4QWQ A;  4PZO A;  2R8H A;  3Q9V A;  3FKJ A;  4HYK A;  3AG1 H;  1ZEL A;  5D4R A;  3KP2 A;  3BG9 A;  3KZI C;  4BXU A;  5AI9 A;  2R5Y A;  3A0H U;  4WCG A;  2RC4 A;  1WUD A;  2L5Y A;  4ZH4 A;  2BQU A;  4I2H A;  1O7F A;  2KIC A;  2MU2 A;  3TW7 A;  4KX3 A;  2ECB A;  3R0J A;  3CUQ B;  1DGR M;  9ICC A;  2MW8 A;  4JYK A;  1UAA A;  3BCB A;  3GME A;  2FNP A;  1CI4 A;  4NLZ A;  2XKO A;  2I10 A;  3OYJ A;  9ICX A;  1WRJ A;  3DEE A;  2A6H F;  1SD4 A;  4C7Y A;  1DP7 P;  2ICW G;  1WCM J;  1ZR2 A;  4DF4 A;  5H6R A;  4HV6 A;  3G4S I;  1T38 A;  2WB1 C;  4I6Z A;  3HPG A;  3RCO A;  4O9M A;  1NKB A;  3KP6 A;  3ZQ7 A;  1LE8 A;  2ISO A;  1S5L U;  5J0Y A;  3I9V 2;  2DYS H;  4A3D J;  1ON2 A;  2XF5 A;  4LLG F;  3ZQQ A;  3OYH A;  3MQ0 A;  2DFI A;  2ESE A;  8ICT A;  5GTH U;  1S77 D;  4M2Y A;  2GOM A;  4HW0 A;  1SVO A;  3ZQL A;  2YU9 J;  1MC8 A;  1YS7 A;  4BDP A;  3RYR A;  4ESB A;  1JKO C;  3CD6 I;  1V5F A;  3PJR A;  2FDR A;  4EJU A;  1ETW A;  2IOF A;  3SEI A;  1OUQ A;  1MBG A;  1YTY A;  1X6I A;  2BZF A;  1Y1W J;  4C7Z A;  1U5T C;  4Q47 A;  4LVS A;  4MFD A;  1BR4 A;  1TE2 A;  3RJH A;  4O3P A;  2X1D A;  1KRP A;  4II3 A;  2JZB A;  1G3Y A;  5J4Y A;  3GII A;  4BH9 A;  2MSY A;  4I98 B;  5CR0 A;  3PML A;  5DCM B;  3SYZ A;  4EEY A;  5H2F C;  2KIM A;  3H0G J;  3LSH A;  4L5I A;  3NEU A;  1W5T A;  9ICW A;  2LRE A;  1WYG A;  4IHS A;  3HOU J;  1H38 A;  3CDI A;  3K70 C;  1QZY A;  9ICL A;  4CCM A;  3GZN B;  2P5K A;  3CC7 I;  2UVU A;  3V7L A;  2CUE A;  4OAY A;  2Y0S F;  2Q1Z B;  4BXO B;  1RZ4 A;  3DKY A;  2O61 A;  1QU3 A;  2OHF A;  3QU4 A;  4LIV A;  2CQN A;  4I0A A;  4EBE A;  4I09 A;  1R5H A;  3GTK J;  5LGT A;  5KNL A;  2R5Z B;  4MLO A;  4QWB A;  3G6X A;  2AGQ A;  2KLO A;  5D5U B;  4YXJ A;  8ICG A;  4F4X A;  2XCA A;  3WTX C;  5HVQ C;  5K1Y A;  4I2I A;  2V9P A;  1D0Y A;  3CTA A;  4OOI A;  1KSP A;  2ZUC A;  1MBK A;  5KG0 A;  2KIW A;  4KX5 A;  1FSH A;  1XSD A;  2BZT A;  1X1C A;  4F2R A;  3F23 A;  2L01 A;  3C2B A;  5AKE A;  1HKT A;  4QIW F;  3Q8M A;  3NS1 A;  2L9S A;  4P2H A;  5FO5 A;  2VE9 A;  5IOY A;  5J2H A;  4ECT A;  1TW3 A;  2E5S A;  2M2E A;  2FF4 A;  2OM6 A;  3Q8P B;  2KIQ A;  3AEV A;  4KLH A;  4WK8 F;  2IHM A;  1F9N A;  2VL8 A;  3GTG J;  2HFH A;  1D1B A;  1YX3 A;  1H9G A;  4A3F J;  8ICL A;  5CJ9 A;  4EV0 A;  3MR2 A;  2GIV A;  3O3K A;  3S1Q J;  4R1H A;  2NAZ A;  2OWO A;  1HC8 A;  3DU5 A;  2ASL A;  2C28 A;  4BQN A;  3SAH A;  5KFZ A;  1HQC A;  3T8R A;  5B66 U;  3J7Y J;  5CVI A;  3F5E A;  1J97 A;  4YXM A;  5AKL A;  1CEZ A;  1VQO I;  2JXJ A;  3HOZ J;  3RKX A;  3PX4 A;  1IO2 A;  2JEG A;  1OFC X;  1VQP I;  4A8E A;  2RKH A;  5HDK A;  1X1P A;  2V1D A;  3HRM A;  3OOP A;  3GIK A;  3SDB A;  3OYK A;  5K7H A;  5AKG A;  4UB6 C;  4BWJ A;  1BOB A;  4RB2 C;  1FX7 A;  3WHB A;  5J0S A;  2KJB A;  2QLT A;  4Y13 A;  1QGP A;  4QWE A;  3PW7 A;  2IBK A;  1H9T A;  2HXO A;  2F8L A;  4OIQ F;  3D2N A;  2D2W A;  2ZC2 A;  2KJ9 A;  1D8Y A;  3PV8 A;  4J00 A;  1HDD C;  2W54 A;  5J47 A;  3DXJ F;  3F5A A;  1ZJM A;  2K8B B;  3R6S A;  1ZAR A;  2FPM A;  2JRZ A;  3FXL A;  5CLS A;  3M1Y A;  2W55 A;  2O6G E;  1WH7 A;  2KTQ A;  3TP3 A;  1K78 B;  3PQK A;  2K02 A;  3JRA A;  3H3V K;  2G06 A;  3V6K A;  3RJG A;  1N77 A;  1VQN I;  3IWF A;  4U7B A;  1WPK A;  2IW5 A;  3S1R J;  1YT3 A;  2GQQ A;  3OL4 A;  3B6A A;  2A69 F;  4JOM A;  2HDD A;  2H3Q A;  3H35 A;  2AH5 A;  1A35 A;  4CDG A;  3ISB A;  4RQN A;  3I53 A;  1S0O A;  1HUZ A;  5TJJ A;  4YD2 A;  2F4O B;  1BA5 A;  4NM2 A;  3FXJ A;  3AKZ A;  4P96 A;  2NRZ A;  1DPR A;  5FLV A;  3E5Q A;  5ALM A;  2CSO A;  1HCR A;  4JWN A;  2QYO A;  1BJZ A;  3E97 A;  4C4R A;  1MNE A;  5LHI A;  4FBU A;  1SV0 A;  3D5S C;  4IQJ A;  3DCF A;  3MZY A;  2DLL A;  9ICO A;  4F2S A;  3G6E I;  5ALH A;  2FEZ A;  1P2F A;  3L00 A;  4CHU A;  2WB1 A;  2HOA A;  2IAI A;  4ZDL A;  4B9V A;  2LSO A;  3IH4 A;  3L2V A;  4XMY A;  1RUN A;  1ULY A;  3A02 A;  1SVL A;  4RQ8 A;  2HR3 A;  5DBC A;  4AYB C;  3EZ5 A;  2CPR A;  4BBR J;  2W00 A;  3SXY A;  4UAV A;  2IOH A;  5J0O A;  4AUX A;  3SV4 A;  4CCH A;  4OIN F;  3FDY A;  1H8A C;  2QWW A;  2CQ7 A;  5JLX A;  3WK7 A;  1P4X A;  2E71 A;  5D49 A;  4M74 A;  2FU4 A;  1A77 A;  2WV1 A;  3G3Z A;  3OYB A;  2QQ9 A;  1U5T A;  2EDU A;  1K7A A;  2CV2 A;  4IQW A;  1BBY A;  3LSJ A;  3OYG A;  1MND A;  2OUM A;  1F5T A;  1ED1 A;  3C1Y A;  3L5K A;  4DZP A;  1SVM A;  5EWF A;  3ZDC A;  1IN7 A;  1SXD A;  9ICS A;  2R0Q C;  8ICW A;  1X42 A;  1KGS A;  2CO5 A;  1L3L A;  3LDA A;  2R7X A;  9ICK A;  3QNM A;  3GVA A;  1IRF A;  2E1E A;  3OJS A;  4ZYE A;  4NQW B;  4HNU A;  4RGX A;  1S7E A;  1V4R A;  4XKC A;  3BP8 A;  1IGN A;  1T4G A;  3FM9 A;  5AI5 A;  3EW9 A;  3JPO A;  1SEU A;  3L2R A;  1SC7 A;  2VXD A;  2BCS A;  2M7B A;  4E7S A;  3PIP F;  4EGZ A;  4O6J A;  5D46 A;  5HNK A;  1QZZ A;  1WVR A;  2IXS A;  3FK7 A;  4BL0 B;  5DKW A;  2K9M A;  1Z19 A;  2E60 A;  3CME I;  2DO7 A;  1K1Q A;  3KHR A;  4XR6 A;  1ONV A;  2FE9 A;  2Y1I A;  1PK1 B;  1VDV A;  2V79 A;  3MFI A;  2BY0 A;  2HOT A;  4Z6C A;  3ZP5 A;  2M8E A;  4Z6Y A;  2LDU A;  3S2W A;  2KHQ A;  4I2F A;  1RI7 A;  3BR1 A;  1BC7 C;  4AIK A;  2VAN A;  4IC9 A;  7ICT A;  3D5L A;  4XID A;  3I4N J;  2UXN A;  5LEJ A;  3AU6 A;  3M8J A;  3ECH A;  5J0R A;  3ZCO A;  2TDX A;  4GXK A;  2VKD A;  3BPX A;  4DW6 A;  1X1D A;  2UZK A;  1GHC A;  1ZAO A;  4LZD A;  1Y88 A;  5ALJ A;  4QZG A;  5D5V B;  2FMS A;  2MC3 A;  1EXN A;  1Z1V A;  1X58 A;  1JUS A;  2O3F A;  4WXD A;  2Z1D A;  1WWV A;  5KNI A;  4MF2 A;  4QWA A;  1YIT I;  5CB1 A;  5FRN A;  1MJA A;  2F4I A;  2VPR A;  5AKY A;  2R7Z J;  2EIM H;  1U48 A;  1P7D A;  4OCZ A;  4RAG A;  3O2P E;  3PW2 A;  1QPM A;  7ICO A;  2MLK A;  1BN5 A;  4M3F A;  4X6A J;  2F1H A;  2F8K A;  2YB4 A;  1IXR A;  1DUX C;  2IMW P;  4ZZL A;  1L8L A;  3OYI A;  3C2L A;  5IY5 H;  2R7T A;  1YJ9 I;  3M8F A;  2PMH A;  4CYD A;  2R7Q A;  2FI1 A;  2MRL A;  3HG9 A;  1LVK A;  2EFQ A;  2PEX A;  4JP0 A;  1NI3 A;  1WI9 A;  2L7M P;  2PBI A;  2IS1 A;  2Y9Y A;  4QZD A;  1UHU A;  4FBT A;  1N2X A;  2DFF A;  3G1O A;  3HRD D;  3EUH C;  2KFZ A;  3K10 A;  4PHE A;  2MUT B;  4OO1 J;  3DBR B;  3ZOB A;  1DU6 A;  2HOE A;  3WK6 A;  1ZQL A;  1Z4N A;  2LY2 A;  5D4B A;  2AGP A;  1DK3 A;  5K5Q A;  1IW7 F;  4EEL A;  1L3U A;  1R1T A;  1AOY A;  4LZG A;  1MN8 A;  2N8G A;  2R7O A;  3I59 A;  3GW2 A;  2HKX A;  4TUQ A;  4B6J A;  2LP0 A;  2NXN B;  3AQE A;  3Q0W A;  1RKT A;  2JVG A;  4EM0 B;  3KEY A;  4P0P A;  3QZ7 A;  1UQV A;  5ALS A;  4M0A A;  3PMN A;  2LBF B;  4ZTF A;  5LD2 C;  1ERD A;  1U8B A;  3QXG A;  1Z0X A;  3ZN1 A;  3BZ6 A;  4A6E A;  1VQM I;  3VCB A;  5KFK A;  4DL4 A;  1JGG A;  2FBI A;  3HUG A;  2VBX A;  4XLN F;  3HOV J;  1YZ7 A;  2X6X A;  1ODD A;  1R5G A;  1XDU A;  2P6T A;  3IH3 A;  4UQG A;  3SV3 A;  4DQ2 A;  3BR2 A;  2IA0 A;  1I3Q J;  1W5C C;  1OYI A;  2X1C A;  2VJ4 A;  4MFC A;  2M45 A;  4DFJ A;  3OR1 C;  1Z77 A;  4LMY A;  5HOO A;  3GFL A;  5FRO A;  4OIO F;  1NK6 A;  1ZGJ A;  5K5R A;  5AKI A;  5HDN A;  1Z91 A;  3DU6 A;  2ZIW A;  3KYD B;  3RR8 A;  4B1R A;  3GU3 A;  4CF4 A;  1K6O A;  1YI2 I;  1V5E A;  5HMM A;  3ZQG A;  3HHG A;  1OQY A;  5JHF A;  2Z5U A;  1BNO A;  2ISP A;  3LFK A;  1JE8 A;  3ZDE A;  2GO7 A;  4AYB A;  3VOD A;  3LSR A;  1QBJ A;  5FLM J;  3FXU A;  2ISZ A;  4F93 B;  3ZPL A;  4MO7 A;  4BEH B;  1HKS A;  2KJ8 A;  3GLX A;  1FYL A;  4FS2 A;  4UUV A;  2JK3 A;  3FXO A;  2VBY A;  4A12 A;  2H3I A;  3ZQH A;  2K4I A;  2XC9 A;  4Q48 A;  1SL0 A;  4L0Z B;  2VIX A;  1VND A;  3BT9 A;  2E8P A;  3C3W A;  3D2S A;  1ECW A;  4RAF A;  3AL0 B;  3S2D J;  4O3R A;  2TRT A;  4GCV A;  4JBA A;  2E5Z A;  2GZW A;  2G9W A;  4B9L A;  4KIT B;  1FT9 A;  1SFX A;  2PJR B;  2G07 A;  3V72 A;  2PFQ A;  2AGO A;  4XRS G;  4CUG A;  1TP4 A;  1KKX A;  5AIB A;  1JXE A;  3CRX A;  1MMS A;  3IAM 2;  3OV8 A;  1DGS A;  2RVC A;  1S8O A;  4D5F A;  4RZR A;  3PFI A;  5DM6 F;  1L5U A;  4YIR X;  3RB3 A;  4HF2 A;  2HQA A;  5KFB A;  4I2E A;  1HJP A;  4BAY A;  8ICI A;  5ERI A;  2HU9 A;  4KMU X;  4MEX A;  3JAM K;  3OSG A;  4FE4 A;  3H8S A;  5LEK A;  1S29 A;  1LNW A;  2H94 A;  2XI9 A;  1ZR4 A;  2FQ4 A;  5DGA A;  4ZYG A;  2L3D A;  4ECW A;  4B48 A;  1VI0 A;  3QPS A;  1ZQQ A;  2K9N A;  3WU0 A;  2DU9 A;  1MBE A;  5KG2 A;  2HVS A;  1B9N A;  4BYY A;  3FXR A;  3SAF A;  2BGC A;  2OQG A;  4S0H B;  4DOZ A;  3E6B A;  5J0P A;  1LVH A;  5LLQ A;  2EQR A;  2QCO A;  2XGE A;  1W4M A;  4PZN A;  1NZB A;  1N5W A;  2HYG D;  1ZD5 A;  3AAF A;  2KOB A;  4J9P A;  2F5V A;  2CH0 A;  3ROU A;  2JH7 A;  2KKP A;  2P35 A;  4UAT A;  1OCR H;  4Q43 A;  4NLB A;  3L2U A;  3KHH A;  2QKM B;  3H4D A;  1YRN B;  3O0F A;  4KN7 A;  4RQM A;  4HST A;  3DBH B;  4RPY A;  4CCK A;  4G9B A;  3RH6 A;  4C3H J;  3S3N A;  4DSF A;  2M7A A;  2NVQ J;  2CRX A;  1GT0 C;  1RR7 A;  2QGU A;  5CYV A;  1XGO A;  4IHW A;  3ZD9 A;  5EE9 A;  2EA4 A;  4F8R A;  2W85 A;  2K27 A;  5DCM A;  2I9G A;  1XCV A;  2G09 A;  4XON A;  4EGY A;  1FEZ A;  4PCQ A;  3RPU D;  1IG6 A;  1J09 A;  5AKK A;  2CN1 A;  2F6C A;  4K4I A;  3PUF A;  4XLA A;  3ULQ B;  5FLX K;  2DQR A;  1BPY A;  5KT7 A;  5JI6 A;  2K9Q A;  4NLN A;  1TWF J;  3HPO A;  2HHX A;  3DWL E;  3LQQ A;  1GVJ A;  4U0Y A;  4KLT A;  2DOD A;  4YR2 A;  2HBL A;  1Z3E B;  1Z4O A;  2ASJ A;  1L3T A;  5BOL A;  5ALV A;  1QQ6 A;  2W7O A;  2QUF A;  1E3O C;  2Y0S N;  3DV9 A;  3RFA A;  4FTH A;  3K7A J;  1R71 A;  2R5Z A;  2B9S A;  1OLT A;  5B1B H;  2K4E A;  4F4Z A;  2RV8 A;  3GBG A;  3T1B A;  3FM5 A;  1BIA A;  5EE3 A;  5J8Y C;  1B6A A;  3IP4 B;  2GXB A;  2CG4 A;  5IT9 K;  4UAR A;  2IGM A;  1Q8K A;  3TAN A;  1SZH A;  2L9V A;  1CF7 A;  1ZYQ A;  4R8U B;  1K5O A;  2Q2E B;  2XY7 A;  2W82 A;  2WY7 Q;  1A6S A;  4YFK F;  1N48 A;  5ILV A;  8ICA A;  4ASN A;  4IHT A;  4UB8 C;  2Q0Z X;  3FF5 A;  1RQL A;  1QH9 A;  7ICJ A;  1ZQ1 C;  3CNH A;  4QIW N;  4KT6 A;  5KTQ A;  3D5R C;  2YMP A;  1S8N A;  2OEH A;  2QZ8 A;  1FJL A;  3DP7 A;  5AM5 A;  2O8X A;  2KIF A;  4DQQ A;  1TWA J;  4OIP F;  2LRD A;  4Q5S F;  1D1C A;  3KZY A;  4LGW A;  2LMR A;  2ZIV B;  3A2K A;  2IPQ X;  4K2E A;  4J9K A;  3RJI A;  1ETV A;  3TDU C;  4UUS B;  2NS8 A;  3GQC A;  2O7O A;  3VYR B;  5DDY A;  5AM0 A;  2KJ5 A;  5D6F A;  1IV8 A;  4I2D A;  3VYT B;  1ZQX A;  2RNJ A;  3CMM A;  1TAU A;  3JPR A;  4OAZ A;  2G5I B;  4ON0 A;  4DFD A;  1IDZ A;  2JSP A;  2IEK A;  4PJM A;  1UG2 A;  2MH9 A;  2W48 A;  3G1M A;  3LA3 A;  2ZXJ A;  3ZQF A;  2EJR A;  3HX0 A;  3RPQ A;  3V7S A;  2HDW A;  4GC7 A;  5ALW A;  2EWN A;  2Y30 A;  1I27 A;  2WC2 A;  3M9A A;  3BZC A;  2JEF A;  4PJJ A;  3HBL A;  2EA2 A;  5DCF A;  3S1N J;  2ZTC A;  4EZ6 A;  2XAH A;  1O08 A;  2EB7 A;  4AU7 A;  1XMX A;  2XVT A;  3K2Z A;  3JCU C;  3FBI B;  1SAX A;  3M3Y J;  3EUB 2;  2M0M A;  2VJI A;  1SFE A;  1HF0 A;  3CCM I;  3P9C A;  1BOA A;  2YS9 A;  4QSH A;  3DTK A;  1W7P B;  1XGS A;  3DKW A;  1X66 A;  1YYV A;  3PO3 J;  1NK3 P;  1NG7 A;  4GRI A;  1P7I A;  1K78 A;  3HIL A;  1N62 A;  3MC1 A;  4OU0 A;  1TL8 A;  4OJ5 A;  2K85 A;  1VQ4 I;  3GWZ A;  1I5Z A;  1IV6 A;  3UXO A;  3H5N A;  4L18 B;  4M3D A;  4PSW A;  1BGX T;  2LTP A;  1U2W A;  3LSI A;  3W3C A;  1T8I A;  1PDN C;  1RIO H;  5DQH A;  3KET A;  4GFB A;  1BR2 A;  2BHY A;  1WGX A;  3MVP A;  3X2Q H;  1VQ5 I;  1ZQU A;  4KLL A;  2ISY A;  3W6V A;  2J6T A;  1N63 A;  4UXN A;  1SKR A;  4J01 A;  3KTQ A;  1IXC A;  3OWT A;  1PUE E;  2AO9 A;  5III A;  4M72 A;  2VT3 A;  1IC8 A;  5J2G A;  4USA A;  5CVV A;  4QPQ A;  3H0D A;  4FZM A;  4DL6 A;  3SAG A;  3RBE A;  2DA6 A;  2ZME B;  2LC2 A;  4PSX A;  4A6D A;  3I76 A;  4CCN A;  2DFH A;  4S05 A;  2H09 A;  4C4S A;  2AHO B;  4RU9 A;  2PI4 A;  1EA3 A;  5KFR A;  3KLO A;  2L7F P;  1JTY A;  5ALX A;  1UFM A;  1WQ2 A;  3K75 D;  2EAO A;  2HDC A;  2R92 J;  2GIZ A;  1L7N A;  8ICU A;  3CCQ I;  3EYZ A;  2R8K A;  2YPR A;  3R0A A;  1L7M A;  2QKQ A;  1MH4 A;  4AP9 A;  3OHA A;  2UUZ A;  4E7Z A;  3WTV C;  2KIU A;  7ICH A;  1DQU A;  3OIO A;  5TGT A;  4HRI A;  4KLI A;  9ICI A;  3AU2 A;  3DEU A;  1EH7 A;  3GF2 A;  3LSK A;  4XBF A;  1IJW C;  3AL0 C;  5IIN A;  2XSJ C;  2I8D A;  3LA7 A;  4JWM A;  3V4G A;  1RKW A;  2K9L A;  1NH3 A;  5E79 C;  1WJ5 A;  4LB5 A;  5E3N A;  4B47 A;  1OCT C;  4XK4 A;  2HTS A;  4NQW A;  1IRG A;  2GA2 A;  5E1Z B;  2P0W A;  1R36 A;  1J5Y A;  3OGU A;  1J2N A;  9ICA A;  1Q1V A;  5JVG F;  1WG8 A;  2BHN A;  5HDG A;  3OL3 A;  2ZXI A;  2BVM A;  2JWT A;  2YR2 A;  2HPM A;  2E2I J;  2I1Q A;  5KG5 A;  5CJ7 A;  1B4A A;  1NK5 A;  1WJB A;  2IA1 A;  3BCA A;  1O3R A;  4J9M A;  1E2X A;  4S04 A;  3HT3 A;  3MZH A;  5EE1 A;  3KCC A;  4PK4 A;  1PK1 A;  3PW0 A;  3DBL B;  4B09 A;  4L0Y B;  1XMK A;  3FMR A;  4ENK A;  1R5I D;  2XO7 A;  4DQP A;  3CJQ B;  2VOP A;  5J8Y A;  4M9G A;  3OSP A;  1T0F C;  5BS6 A;  4ECR A;  1AU7 A;  2DWQ A;  4EYH B;  5KHD A;  3NTU A;  3NVY A;  2BKE A;  5KT2 A;  4BXO A;  4DS4 A;  3AFH A;  3M7G A;  3SD7 A;  4JB3 A;  4C2T A;  4NC8 A;  2CFO A;  3KYL A;  5D5X B;  2LM1 A;  3HKZ F;  2KL4 A;  5TIS C;  1R6R A;  1XC5 A;  3JR9 A;  1BI0 A;  3O8G A;  2D6F C;  4F4W A;  2KFN A;  2O6K A;  5HS9 A;  1KBU A;  4IF4 A;  4KLS A;  5KT4 A;  4Y2P A;  2WAQ C;  5EZG A;  1T39 A;  3LNQ A;  3LMM A;  4LB6 B;  4G6D A;  1TT5 B;  1ZQN A;  4BKX A;  3NWT A;  2CW0 F;  4MEY A;  5KFQ A;  1XS9 A;  1YHQ I;  3C1Z A;  1TQI A;  3TMO A;  1CRX A;  4FIS A;  2XPW A;  4OWR B;  5EEH A;  5KCM A;  3EPG A;  1KZH A;  3EYI A;  2HHS A;  5KFS A;  3S8P A;  2AXT C;  3KEQ A;  4E7I A;  3IRQ A;  4M6X A;  5TZV A;  5BPC A;  3RTV A;  1VQ6 I;  4NL9 A;  1KU7 A;  5M5X J;  4J19 A;  2VKQ A;  4PPX A;  2MUT A;  3I1Y A;  2GWS A;  1JAL A;  4G8X A;  4IRD A;  2FOW A;  2YN4 A;  2QAR B;  3P7N A;  1PVQ A;  1OW5 A;  1ZJN A;  2EFP A;  3C2H A;  1J7K A;  2XAG A;  3F8F A;  1K4S A;  2KZZ A;  1ZRC A;  4LIT A;  4A3C J;  4PGX A;  4U88 A;  3M6Z A;  4E7L A;  1VQ8 I;  1MBF A;  2KVC A;  4QTR A;  3U21 A;  4C8L A;  4ITV A;  3ALR A;  2XAQ A;  4DLE A;  4DFP A;  2R18 A;  1P4A A;  2JTV A;  4UAS A;  5KFH A;  2LBF A;  4F71 A;  3FMS A;  1YOV B;  4HQM A;  4BX9 C;  4P0P B;  1Z1D A;  4ZYA A;  4XQF A;  1MGT A;  1ZRE A;  4G3I A;  8ICO A;  9ICJ A;  4BQO A;  1F4K A;  1A5J A;  5AI8 A;  5J4V A;  3S6J A;  2ME0 A;  3CO6 C;  3I55 I;  3BR5 A;  1IRZ A;  4IPA A;  4EBD A;  2DA1 A;  4HAI A;  3SEQ A;  5GP9 A;  3R60 A;  3ZQC A;  1Y39 A;  1FIQ A;  3U2R A;  1XWL A;  1ZGW A;  2FOK A;  4RQ3 A;  3HOT A;  3T5H A;  1YLF A;  2JA2 A;  4IKF A;  3MGV A;  4GXI A;  2FPL A;  1A36 A;  3HB9 A;  2QB0 B;  3M8R A;  5KAF C;  3BJY A;  3VC8 A;  4DO9 A;  2ZJQ F;  2H27 A;  5KFF A;  4QLC U;  3GO5 A;  4CNQ A;  2CS3 A;  5IP6 A;  3J80 K;  3WU1 B;  2CMP A;  2KRC A;  2OCE A;  4LJX A;  2KMD A;  2DQL A;  4EX6 A;  3QOP A;  2WFA A;  4YEJ A;  4C3J J;  2E34 A;  2CU7 A;  2LY9 A;  4HLY A;  4BEH A;  4Z6E A;  5HML A;  1B4F A;  2PXI A;  5D8K B;  4HA8 A;  5KG1 A;  5ALE A;  5L1M A;  3RRH A;  3PSP A;  1TV9 A;  4ELV A;  2V9W A;  1Z6R A;  3K4L A;  3JRC A;  4ACO A;  2ZSI B;  4NBQ A;  3BS5 B;  4I7H A;  3VDX A;  2RRE A;  3EPZ A;  2ZNY A;  1FY7 A;  4P4P A;  1ETK A;  2MD0 A;  5ILS A;  2K7L A;  3LA2 A;  4C0Z A;  4UB1 A;  2PJR A;  3ZQI A;  3MGI A;  3ZDA A;  1KYW A;  2H1L A;  3WTZ A;  3OHB A;  1ZHF A;  4M3B A;  1IAW A;  3GCM A;  2NOJ B;  4UNO A;  4IOC F;  9ICG A;  1ZLK A;  3GTP J;  2Z99 A;  2ZIX B;  3Q8R B;  4GIB A;  4UB5 A;  4HX7 A;  5CVU A;  4MHV A;  2Z7J A;  2DA7 A;  1SV0 C;  2YMQ A;  4QZ9 A;  3QRF F;  1I50 J;  2XF7 A;  2VOD A;  2PG4 A;  4YG2 F;  3RQ4 A;  4UY8 I;  3IKT A;  3K2A A;  4AM3 A;  1WWX A;  1XGM A;  2RAE A;  2KZM A;  5JRT A;  3S32 A;  2IA6 A;  3MZ8 A;  3ECO A;  2W4S A;  4LK0 F;  1KW4 A;  3DPT A;  4BJ6 C;  2IVM A;  3GZF A;  4F3O A;  3KBB A;  2WF8 A;  3N28 A;  1Q46 A;  3BJ6 A;  2ZXH A;  1ZOL A;  3BTI A;  1FNN A;  4UB4 A;  1S9F A;  3GFK B;  3PX6 A;  5DB7 A;  2XRL A;  1T0F A;  2Y0S A;  2RNG A;  2R8I A;  5KT5 A;  4Y52 J;  4Y15 A;  3LFU A;  2NVX J;  3T5K A;  2KVS A;  1Y1V J;  2J5O A;  1B9M A;  2LM4 A;  1G4D A;  3HOW J;  1T8E A;  3TOA A;  1JXL A;  3KP5 A;  4F4K A;  4O5C A;  2FJ1 A;  2RDP A;  1ZKG A;  3TDZ C;  4BHP A;  1YRN A;  5B1A H;  3OYL A;  1FFV A;  2M1B A;  3K4C A;  4F5P A;  3IG8 A;  2WAQ A;  2XAS A;  3K1Z A;  4ZDO A;  4YFN F;  5E3O A;  4BE0 A;  4EEF G;  1IIP A;  2EAP A;  4MQV A;  4IJA A;  3Q8S B;  4YFX F;  2LR8 A;  2XPU A;  1Z21 A;  5EOZ A;  3DTI A;  5L1L A;  5CEH A;  3HC7 A;  4KIF A;  1MBH A;  2RQ5 A;  1VTN C;  1Z05 A;  1SL2 A;  4RBO A;  2LK2 A;  1NTC A;  1TNS A;  2M9N A;  5E18 F;  2A3V A;  4RB3 C;  3T3F A;  4E6K G;  1L3V A;  1K83 J;  3CF5 F;  2XIG A;  2P5V A;  5AK4 A;  2XAJ A;  3RRG A;  5IP9 J;  4QZB A;  5CWR A;  4Y7N J;  2OXO A;  3WOD F;  2EIL H;  4E4H A;  5GAH J;  3SEN A;  2E1N A;  1QVU A;  1JGS A;  1USS A;  2OAZ A;  4G6T B;  5KAI C;  3MDA A;  1KFD A;  1WZ2 A;  5FKN A;  3SDG A;  2OJE D;  4NV0 A;  2EZK A;  1HEK A;  2DA3 A;  3KD3 A;  1ZQO A;  3HOX J;  4IO9 F;  5EJC A;  3L4P A;  2JEI A;  2B0C A;  2KJC A;  1WH5 A;  2ZFU A;  4BBS J;  4YR3 A;  1V38 A;  2ZUB A;  1OXJ A;  4I02 A;  2FLN A;  3OIP A;  1UHW A;  4V19 K;  1JRO A;  4P0Q B;  2ID3 A;  4R8U A;  5KFG A;  3HRS A;  1BW5 A;  2Q2E A;  1KLN A;  3M8E A;  3GXO A;  1HW1 A;  4CYC B;  1Z9C A;  5KFO A;  4O3S A;  4U6P A;  1XN7 A;  1IXR C;  2QF7 A;  3LK9 A;  2D3D A;  3MDC A;  3ABM H;  3AG3 H;  1OMI A;  4AVZ A;  3R61 A;  2NVT J;  3AN1 A;  3JRE A;  1J75 A;  3HZJ A;  2EZI A;  4LOC A;  4RB1 A;  4UBC A;  3ZDB A;  3CW2 C;  2DFE A;  3FIW A;  2LKX A;  4GFJ A;  4IQV A;  2XVC A;  4CZZ A;  1YW9 A;  2W8K A;  2W9B B;  9ICF A;  1PP8 F;  4HX4 A;  3CCS I;  2V4R A;  2ZIV A;  3DEW A;  4N9H A;  1W1W E;  1O4X A;  3A4C A;  4N0B A;  5AKZ A;  3IKV A;  2L54 A;  2L7K A;  1NHA A;  4UUS A;  2XGP A;  2XID A;  2O0Y A;  3T79 A;  2M0N A;  4HAM A;  1LDJ A;  2W9C A;  1XCB A;  1IDY A;  4V2G A;  3JTH A;  5KFN A;  3EET A;  1J59 A;  3OSN A;  5IIL A;  3SMV A;  3AG2 H;  3W2A A;  4NM1 A;  5DQG A;  4DJA A;  1KQ9 A;  2AQ4 A;  2M4K A;  4HG2 A;  2OA4 A;  3MWM A;  3E0J B;  5BOX A;  2PMZ F;  1HSJ A;  1DU0 A;  3WKD A;  2ZJ5 A;  4XRF A;  3OSF A;  3BC8 A;  3JRI A;  8ICV A;  3I58 A;  4DWI A;  2ZNZ A;  2W9M A;  3O6B B;  1B8I B;  4PHP A;  2X6O A;  4DYR A;  2KG5 A;  5DS9 A;  2AJQ A;  4BU2 A;  2XAU A;  4NB5 A;  2FE3 A;  2E1F A;  3NRZ A;  3QUB A;  1QA6 A;  2BCU A;  5IIM A;  2N1R A;  1Z7U A;  2L9R A;  3IWZ A;  4KIG A;  4BJ5 C;  1W7P A;  1LFU P;  4DL2 A;  9ICM A;  5IP7 J;  2BPC A;  7ICR A;  3HXL A;  2DA2 A;  3JPS A;  5CPR B;  4C8N A;  1T98 A;  4PJ0 U;  4RUC A;  2W25 A;  1S72 I;  1UHS A;  2NO5 A;  1NKC A;  4RM3 A;  4YR0 A;  3LST A;  4NNJ A;  2HGC A;  5DEQ A;  4KMF A;  4L5E A;  2Y9U A;  2H8W A;  4QZA A;  1HW2 A;  2Z16 A;  2MLG A;  3RBD A;  4Y4R A;  2MYS A;  3ZMZ A;  4IRH A;  1Z6T A;  4M47 A;  2STW A;  3J7A O;  1N56 A;  1J0R A;  3C5G A;  2COB A;  5F1J A;  4J9L A;  3C2M A;  5J6X A;  4F52 A;  4JX6 A;  7ICS A;  1ZQI A;  2GLE A;  1O3S A;  2R7V A;  1FFU A;  1LFB A;  1I1G A;  5AIQ A;  5FB2 A;  3P9I A;  2BGW A;  2ZME A;  4A69 C;  1QLN A;  3E0F A;  3NWS A;  3CDL A;  3KPH A;  3SYT A;  1D9F A;  4G7O F;  4FQG A;  1SWV A;  2FNA A;  3TED A;  1VZ0 A;  1Y6I A;  2I5U A;  3A0H C;  1XSV A;  3L9F A;  4Y17 A;  3SZG A;  1RDF A;  2ASD A;  1ZGA A;  3CO7 C;  2KDO A;  2QKL B;  5KFY A;  4NC6 A;  1ZG1 A;  2BDP A;  2F48 A;  3TAQ A;  2EZH A;  2DTR A;  1X3Z B;  3WTS C;  4EBC A;  1WJF A;  1F43 A;  2VN2 A;  5BMZ A;  4Q4Z F;  2DBY A;  2NYV A;  2MG4 A;  4OJO A;  1C0W A;  4ED2 A;  5BQT A;  1ZYR F;  4B4C A;  2LYC A;  2RHF A;  3FIS A;  4JV1 A;  2ZB9 A;  2D1V A;  5DG8 A;  1XO0 A;  3ABK H;  1IF1 A;  4QNL A;  3QPH A;  3WKE A;  5CA7 A;  4U7C A;  3TAD C;  1S5L C;  3KX2 A;  4UUT A;  1BVS A;  1QVT A;  3QUQ A;  1GUU A;  2DMQ A;  2LVS A;  1APL C;  1N60 A;  3F2B A;  5GTH C;  1UA1 A;  3W6K B;  2OD5 A;  2GOX B;  3CUQ C;  2ACJ A;  2JV3 A;  5HLH A;  1BPB A;  2QSG X;  5LRS A;  4XQ8 A;  4WF2 A;  2FMQ A;  1UHM A;  1XMA A;  2NRA C;  1QHG A;  4EMS A;  4A3I J;  2WF5 A;  1ZQC A;  1YX5 A;  1X4O A;  1BI2 A;  3MD2 A;  2GA1 A;  5D8L B;  4UBB A;  2WB1 F;  2AXL A;  1RUO A;  2JVH A;  1JN3 A;  4O3O A;  4D1Q A;  1HLV A;  3N7P D;  1DOQ A;  4IR9 A;  3JRD A;  1N5X A;  1P7J A;  4YVZ A;  5DLF A;  2KZ3 A;  2HOI A;  1X1B A;  3M4O J;  3NRV A;  3I28 A;  5B3S H;  2VA3 A;  1KU2 A;  2JPC A;  1ZD4 A;  4F5N A;  1SKS A;  3TI0 A;  2HQ5 A;  2NVY J;  1WSU A;  3QEA Z;  4X0G A;  1S97 A;  2RDJ A;  3BR3 A;  1XB4 A;  5HHI A;  3MFK A;  2P81 A;  5BNG A;  3F2D A;  3H9J A;  4EX7 A;  1YE9 A;  4CIC A;  5F0C A;  3ZGK A;  3Q0U A;  1I6H J;  5HR6 A;  3CLO A;  4PGH A;  5EZH A;  2DI3 A;  3HRU A;  1B72 B;  1SGG A;  5GTI U;  4Z6D A;  3TAC B;  3G6Y A;  3ISC A;  3G73 A;  4R63 A;  1QHH D;  1ZK8 A;  1D0X A;  2E1O A;  3FX3 A;  3HKZ N;  1P9Q C;  3BR0 A;  3MKY B;  2W3S A;  3JPQ A;  4B9M A;  5EEA A;  3UMC A;  3C1D A;  3GIL A;  4XA5 A;  1W36 D;  3LSG A;  3QEB Z;  1C7Y A;  1MBJ A;  4BUG A;  3WU2 U;  2HS5 A;  2VC0 A;  4X5V A;  3TAR A;  2DOA A;  5DYM A;  2QBY B;  4IQU A;  3B6C A;  4UV9 A;  3D2Q A;  3EDP A;  2QEN A;  2VBZ A;  2HWV A;  4G9Y A;  2DOF A;  3K0L A;  1MDM B;  4EJT A;  4IL6 U;  5F08 A;  2V1N A;  2NYX A;  3K4K A;  2R93 J;  2P5L C;  2HMX A;  4PH5 A;  2PQ8 A;  4P9U A;  2HI0 A;  3D1N I;  4DFM A;  3K6G A;  2B0L A;  2PX9 A;  2YUS A;  3J81 K;  2MD5 A;  3ONQ A;  1M6Y A;  3ZD8 A;  3BQT A;  3ZMV A;  4B44 A;  4N4O B;  3REO A;  3IC7 A;  4IVN A;  4XN3 A;  2D5V A;  4Y33 A;  1ORK A;  3AMZ A;  2A61 A;  4AWX B;  2QAR A;  4UB8 U;  2PFP A;  2BE5 F;  3LL7 A;  2DF4 B;  4PL2 A;  1Z00 B;  2DN0 A;  5B66 C;  2EZZ A;  4XKV A;  1LDD A;  3QYB A;  1ZQA A;  4PJL A;  4F92 B;  4QZ8 A;  5E1X A;  4OJ6 A;  5E3L A;  4RGS A;  5KFJ A;  4EYI B;  4M9J A;  4US9 A;  1S3J A;  5HS8 A;  2AU0 A;  3TP0 A;  4Z6F A;  5ALL A;  1PVR A;  4HF0 A;  2L4M A;  2XKP A;  2M3A A;  4PJN A;  1ETX A;  3CMA I;  1RYS A;  2VI6 A;  5EG0 B;  4XLF A;  4H0E A;  2OTL I;  4C2U A;  1DGJ A;  2M8G X;  1PK3 A;  2R3S A;  4XLE A;  3QU3 A;  4Y2Y A;  4R65 A;  4I27 A;  2OF7 A;  1AA7 A;  1EH6 A;  1OCC H;  3WTT C;  1MMN A;  2OZ6 A;  3DLA A;  1G8X A;  4AIJ A;  3NRW A;  3GV7 B;  1R22 A;  3CC2 I;  4E7H A;  3QU6 A;  2ZSH B;  2AQE A;  4C2M J;  1W36 C;  2MBF A;  3G71 I;  1KN5 A;  1TFR A;  4Y2J A;  3ZI4 A;  1YQA A;  2BW3 B;  3BY6 A;  5J2B A;  3GLL A;  2JRT A;  5ALF A;  2QB0 A;  2XY5 A;  5J8F A;  1G2H A;  4A0Z A;  3CC4 I;  1LB2 B;  2R7U A;  1WJD A;  3L7W A;  2G0A A;  2EAN A;  3LQR A;  3V8J A;  3PNV A;  5J2K A;  2DMN A;  3KP7 A;  2ZJA A;  5IT3 A;  3BG5 A;  4I2J A;  1FP1 D;  3CUO A;  3QX7 A;  5E20 A;  4DQI A;  3PIO F;  5F3X B;  3QU5 A;  1XU4 A;  1R49 A;  4YP3 A;  4KLM A;  2FD5 A;  2LOO A;  3LWM A;  3LWL A;  1F44 A;  3QUC A;  3FHZ A;  2G0E A;  4YD1 A;  3ZMS A;  5KFC A;  2A07 F;  3C29 A;  2HOF A;  4E7J A;  4ESF A;  5IIO A;  3G1L A;  4IQ4 A;  2EH3 A;  3ZMU A;  5K5O A;  1BM9 A;  3BG6 A;  4C3I J;  4FZN A;  2XGD A;  2E2H J;  3H9Q A;  4KMU A;  2R7F A;  1MMA A;  1UCR A;  4W97 A;  4ED1 A;  5KFD A;  3TAD A;  5F9L A;  1TK8 A;  4CCJ A;  1RPW A;  3WTY C;  2VJJ A;  3GTM J;  2LYH A;  2ZUD A;  5AK5 A;  4RUA A;  4FZL A;  1ZQR A;  3JRB A;  2DYR H;  1PP7 U;  1S9H A;  2ELJ A;  3CUQ A;  3OS1 A;  2KPM A;  1WWU A;  3HWT A;  1UEL B;  3UKG A;  2ZIX A;  2Q4T A;  1U8R A;  4GLX A;  3TFR A;  5EE0 A;  3SJM A;  1JRP A;  2H3V A;  3L3F X;  1FBU A;  3JPN A;  2C6Y A;  3I71 A;  2VJ5 A;  2WF6 A;  2JH1 A;  4UAY A;  1Z3X A;  1HKQ A;  3F8C A;  1SV4 A;  1ZD3 A;  1Z3Y A;  5ALP A;  3CCJ I;  4QWD A;  2L2O A;  3S17 J;  2MA1 A;  4F5O A;  1QRY A;  5IYC J;  4AYB F;  1TK0 A;  1GO3 F;  4RQ6 A;  2FBK A;  4ENM A;  2K4B A;  3PW5 A;  2DKX A;  1NNL A;  1URJ A;  1KFT A;  4O5E A;  4KUM A;  2DCE A;  3MR6 A;  2ETH A;  5F0H A;  4M73 A;  3F6O A;  1F5S A;  8ICN A;  1GXQ A;  1MW7 A;  2L0K A;  4M3G A;  1LE8 B;  3PR5 B;  1Q3U A;  1YFH A;  4M6W B;  3F8N A;  3SR6 A;  2MAB A;  1UST A;  3UQ2 A;  1H88 C;  2MGQ A;  3GTO J;  2KSO B;  4EJV A;  2H5X A;  5G5H A;  2WAD A;  4JQF A;  1Y0N A;  4YCX A;  3WE3 A;  4I2B A;  5A2Q K;  2BOL A;  1U78 A;  3KZZ A;  3MAB A;  2E7W A;  2EPF A;  5T14 A;  5ALU A;  9ICU A;  2XGQ A;  2IGO A;  2QSF X;  3LWF A;  1NG6 A;  5GAE J;  4HSR A;  4YMM A;  2YB1 A;  3W2V A;  1FMV A;  3RKW A;  1WHU A;  4L5J A;  3GUD A;  4LLL A;  5B5E C;  5AIA A;  1FIA A;  4XIC A;  2YX4 A;  4QJF B;  5GPC A; 
#chains in the Genus database with same CATH homology
 3AFH A;  4CCM A;  2KHV A;  4C2T A;  4NC8 A;  2CFO A;  3KYL A;  3HKZ F;  4XL9 A;  2KL4 A;  4OAY A;  1R6R A;  2HVR A;  2Q1Z B;  2E1M B;  2VPL A;  2Y0S F;  3DKY A;  1QU3 A;  2CW7 A;  1LDK B;  4LIV A;  1KBU A;  1SAU A;  2WAQ C;  4E7K A;  3CYM A;  3LMM A;  5KNL A;  4JMU A;  4MLO A;  2KQR A;  2KLO A;  4PL1 A;  3NWT A;  2CV0 A;  2OH2 A;  5HVQ C;  1D0Y A;  3TMO A;  1Q3V A;  1CRX A;  3OYN A;  4OWR B;  5KCM A;  2KIW A;  4KX5 A;  1MMG A;  2CV1 A;  2R4G A;  3K4J A;  5CQG A;  1KON A;  1X1C A;  3S8P A;  2W04 A;  4E7I A;  4QIW F;  3ZRG A;  4DGW B;  4RLF A;  2L9S A;  4P0Q A;  2E5S A;  2OV7 A;  2OM6 A;  3AQF A;  2VKQ A;  4II2 A;  2VL8 A;  1D1B A;  1YX3 A;  3N7R C;  4FAS D;  2VQC A;  2HPI A;  3S93 A;  1PVQ A;  3PUB A;  3FHN A;  1DGW Y;  3C2H A;  2V6E A;  3CP2 A;  4LIT A;  3DU5 A;  3PST A;  4BE2 A;  3M6Z A;  4E7L A;  4BQN A;  2UWM A;  2G5H B;  3SAH A;  2D6F C;  2HZD A;  2KVC A;  2OYY A;  3F5E A;  3U21 A;  2HBM A;  4ITV A;  3ALR A;  1E0E A;  2R18 A;  2CW8 A;  1L6N A;  4A8E A;  2LBF A;  4BX9 C;  3RSN A;  4ZYA A;  4XQF A;  1N78 A;  3SDB A;  3OYK A;  4P0P B;  3DPL C;  4BQO A;  3HPH A;  2G08 A;  1BOB A;  4PFP A;  2F8L A;  2WAE A;  3F2C A;  2UV1 A;  3SEQ A;  3D2N A;  5HNF A;  3IAS 2;  2KJ9 A;  4J00 A;  2ZIU A;  1UPH A;  3F5A A;  3HOT A;  2K8B B;  2LBO A;  2JA2 A;  4IKF A;  3MGV A;  2WA0 A;  1WJC A;  3VC8 A;  3LYS A;  2RRD A;  1T94 A;  2CS3 A;  4U87 A;  2G06 A;  2CMP A;  2KRC A;  4U7B A;  1N77 A;  1YT3 A;  4PUS A;  3VSK A;  2DGZ A;  3OL4 A;  3CF2 A;  4NLC A;  4H4K C;  4JOM A;  4YEJ A;  4P5O A;  3H35 A;  2H3Q A;  4CDG A;  5CRX A;  4HNT A;  4BEH A;  2KMU A;  2A5W A;  4YRV A;  3AKZ A;  2V26 A;  3PSP A;  2HVQ A;  5KL1 B;  2KHM A;  2A6T A;  1MNE A;  3K4L A;  4ACO A;  3D5S C;  2IGK A;  4IQJ A;  2ZSI B;  3VDX A;  3EPZ A;  2RRE A;  3K4B A;  2IS2 A;  2MD0 A;  2VXZ A;  2WB1 A;  2H3Z A;  3PSI A;  4ZDL A;  3IUO A;  3L2V A;  4C0Z A;  4XMY A;  4N4N B;  2PJR A;  4BAC A;  4XM3 A;  4AYB C;  3PL8 A;  2CPR A;  4NWI A;  2RQQ A;  2W00 A;  4XLC A;  3F53 A;  2NOJ B;  4XOP A;  2KNJ A;  2ZIX B;  3QOD A;  3FDY A;  3BLY A;  2Z7J A;  3OYM A;  2XF7 A;  3CES A;  3RQ4 A;  3OYB A;  2R7R A;  1D8B A;  2CV2 A;  3OYG A;  1ED1 A;  1MND A;  2OUM A;  3S32 A;  3W2W A;  1PJR A;  2W4S A;  4XOR A;  1LKX A;  3DPT A;  2L5Q A;  4BJ6 C;  3KFU F;  2DT6 A;  3GZF A;  4BGD A;  2X6Y A;  3VYS B;  2ZXH A;  4R79 A;  3PSF A;  2R7X A;  3HKZ A;  2E1E A;  4NQW B;  2Y0S A;  2RNG A;  4XKC A;  4HNU A;  3OYE A;  3DPU A;  4BDZ A;  1JI8 A;  2BDU A;  3LFU A;  2W1O A;  4CZC A;  3L2R A;  2VXD A;  2XC7 A;  2M7B A;  4E7S A;  5LFA A;  4OJL A;  2IXS A;  4BL0 B;  2JMG A;  2CUZ A;  2K9M A;  1Z19 A;  2JUG A;  3HOS A;  2E60 A;  3OYL A;  1V5G A;  3K4C A;  4XR6 A;  2WAQ A;  3EUK L;  3IG8 A;  3TBI A;  4ZDO A;  3HKZ C;  4CCL A;  4BE0 A;  1IIP A;  3K1Z A;  2Y0S C;  3ONN A;  2KHQ A;  4D9J A;  1Z21 A;  3DTI A;  1DP3 A;  2KEY A;  4IX7 A;  4C30 A;  2V4J C;  1DRG A;  3HC7 A;  4IC9 A;  1N75 A;  3D5L A;  1XNS A;  2VB6 A;  1WJA A;  3M8J A;  1UG0 A;  4ANJ A;  3ZCO A;  3OS2 A;  2VKD A;  2A3V A;  1X1D A;  2WY8 Q;  4E6K G;  2Z1D A;  3S3M A;  5FRN A;  2F4I A;  3A1Y A;  3UNG C;  2GOL A;  4E4H A;  2OXO A;  3PZP A;  2KP6 A;  4QIW C;  1P7D A;  3MKW B;  4G6T B;  3J7A Y;  4CGZ A;  2HNH A;  3PNT A;  4NV0 A;  1HEK A;  2YB4 A;  3OOU A;  3OYF A;  3OYI A;  3H0L B;  3KZX A;  2R7T A;  3E1S A;  1TT0 A;  2ZFU A;  2R7Q A;  2MRL A;  3HG9 A;  4DIQ A;  3DQV C;  2W7P A;  1LVK A;  3OIP A;  4P0Q B;  2IS1 A;  2LG4 A;  3EUH C;  3N7S C;  4B43 A;  3K10 A;  4OO1 J;  4U6P A;  2E1M C;  3SEZ A;  2LH9 A;  5CKT A;  4HEA 2;  2LY2 A;  4AVZ A;  2HBK A;  3OS0 A;  4NC7 A;  4HPQ A;  3FBN B;  4EAT A;  1PVP A;  2BVL A;  2R7O A;  1WJE A;  4GFJ A;  2ZIV A;  3AQE A;  3A4C A;  1TZL A;  2JVG A;  2L7K A;  3T79 A;  3KEY A;  2XID A;  3ZXS A;  2GH1 A;  2M0N A;  2XIC A;  2LBF B;  4ZTF A;  5LD2 C;  5FRM A;  1ERD A;  2K5C A;  1LFP A;  3VCB A;  2K3P A;  5HR7 A;  4F3Q A;  2DXI A;  2KKV A;  3W2A A;  3SMV A;  4XKB A;  4DJA A;  2K89 A;  2X6X A;  2M4K A;  4RM2 A;  4Y3O A;  4IZZ A;  4HG2 A;  3E0J B;  2X1C A;  4XNF A;  2PMZ F;  2VJ4 A;  3OR1 C;  2MFZ A;  4ZDP A;  2NV3 A;  3BC8 A;  5HOO A;  2ZIU B;  5FRO A;  3TL4 X;  2ZIW A;  3DU6 A;  3LVV A;  3BG7 A;  4BU2 A;  3GU3 A;  2XAU A;  2E1F A;  1V5E A;  3MMY B;  2OC6 A;  3LVW A;  2E5N A;  2N1R A;  4BJ5 C;  1IRX A;  5JHF A;  2BW3 A;  3S3O A;  4OJP A;  3HXL A;  4KJZ A;  4AYB A;  5CPR B;  2HOQ A;  4ZTJ A;  3QYF A;  4F93 B;  2K8C B;  4BEH B;  4P1W A;  2KJ8 A;  2M4G A;  2KZV A;  4PFO A;  2IGN A;  4RM3 A;  2V9K A;  3HL2 A;  4BUP A;  4NNJ A;  1OR7 C;  3IN5 A;  2VAS A;  1MA7 A;  2K4I A;  3L2W A;  3L2Q A;  2H3I A;  2Z16 A;  2O5R A;  2VIX A;  4Y4R A;  2MYS A;  3D2S A;  1A0P A;  1ECW A;  3AL0 B;  1FMW A;  2E5Z A;  4F52 A;  4KIT B;  2PJR B;  2G07 A;  4BS9 A;  2WBM A;  3UR3 C;  4CUG A;  2R7V A;  3CRX A;  3EUA A;  3IAM 2;  3E0F A;  3ZR8 X;  3NWS A;  3SYT A;  3OYA A;  3VYU B;  3C28 A;  1Y6I A;  1VZ0 A;  2HQA A;  3SZG A;  4DBR A;  3K70 D;  2HU9 A;  3QOE A;  2KDO A;  2QKL B;  1D0Z A;  4NUB A;  2XI9 A;  1SFK A;  1Y56 A;  2XDV A;  1WJF A;  2KD1 A;  3F9K A;  4B48 A;  3MKZ A;  4OJO A;  4F55 A;  4QPO A;  3VSL A;  2RHF A;  2LYC A;  4B3X A;  2HVS A;  1XO0 A;  3DKX A;  4QNL A;  3SAF A;  4U7C A;  3C2G A;  3SQI A;  3OIQ A;  3KX2 A;  4DOZ A;  3PNY A;  2VLA A;  2DQN B;  3OPX A;  3CZ6 A;  2V7F A;  4FE3 A;  4YEL A;  2W03 A;  3F2B A;  1NZB A;  2K4H A;  4BXF A;  2KOB A;  2F5V A;  2GOX B;  2CH0 A;  2JH7 A;  2KKP A;  1X4P A;  4NLB A;  3L2U A;  3RTR A;  2QKM B;  3O0F A;  1QHG A;  2JGA A;  4HST A;  3H0M B;  2VQH A;  1YX5 A;  1X4O A;  3MD2 A;  4CCK A;  2F2A B;  4KMO B;  2LYA A;  2WB1 F;  3RF9 A;  1X19 A;  2JVH A;  3S3N A;  2M7A A;  4F91 B;  4D1Q A;  3N7P D;  4BJT A;  2CRX A;  3M1C A;  2DJI A;  4XLH A;  2LYB A;  2HOI A;  1X1B A;  4ZC3 A;  4DBQ A;  2G09 A;  4X0G A;  4XON A;  3IG5 A;  3RPU D;  2VKH A;  4CCO A;  1J09 A;  3F2D A;  2XF6 A;  3H9J A;  2F6C A;  2CN1 A;  4CA0 A;  1YE9 A;  3OR2 C;  3ZGK A;  3G2B A;  4XLA A;  3H5R A;  5HR6 A;  3DWL E;  1WFX A;  2HBL A;  4ICA A;  3OY9 A;  1QHH D;  1D0X A;  3MKY B;  2W7O A;  1P9Q C;  3RFA A;  4WJ3 B;  2VQG A;  4RMN A;  1OLT A;  3LSG A;  1W36 D;  2K4E A;  3GBG A;  2CUJ A;  2IS4 A;  4BUG A;  4LIU A;  4LG3 A;  3IP4 B;  2WAF A;  2DOA A;  2IGM A;  4XOT A;  2IS6 A;  3OMY A;  5CQE A;  1SZH A;  3D2Q A;  5A0L A;  2X6W A;  2Q2E B;  2W82 A;  2WY7 Q;  2V1N A;  2WAQ F;  3K4K A;  1K6Y A;  1G59 A;  2HMX A;  2PMZ A;  1A6S A;  2F77 X;  3K6G A;  2KRH A;  3ONQ A;  2KV2 A;  3H5A A;  1X1A A;  1ZQ1 C;  4KT6 A;  3D5R C;  4B44 A;  4N4O B;  2VQL A;  4XN3 A;  2H3F A;  4Y33 A;  2LRD A;  1MMD A;  1D1C A;  2ZG6 A;  1BR1 A;  3LL7 A;  3A2K A;  2X1E A;  2DF4 B;  2ZIV B;  4PL2 A;  2R7S A;  2PMZ C;  2RP5 A;  4XKV A;  3VYR B;  3QYB A;  2LHT A;  4PJL A;  2KJ5 A;  3M6K A;  4BJQ A;  4FET A;  2FUG 2;  4F92 B;  2HBJ A;  4OJ6 A;  3VYT B;  3CMM A;  3HUG B;  3OYC A;  2LKY A;  2F76 X;  4OAZ A;  2G5I B;  1T95 A;  2JSP A;  1PVR A;  4PJM A;  2DT7 B;  4P0P A;  2M3A A;  4PJN A;  3QYE A;  4CRX A;  4XLF A;  2LY1 A;  4C2U A;  2HDW A;  4XLE A;  1AA7 A;  4PJJ A;  2K8A A;  3NUQ A;  5KL8 B;  3OYD A;  1MMN A;  3DLA A;  2YX8 A;  1G8X A;  2ZIW B;  4AU7 A;  3NRW A;  2XVT A;  3I3L A;  4E7H A;  4XKW A;  3FBI B;  2ZSH B;  2AQE A;  1W36 C;  2M0M A;  2VJI A;  3H9G A;  3DTK A;  2BW3 B;  4BDY A;  1NG7 A;  4GRI A;  3H0R B;  2R7U A;  1WJD A;  2G0A A;  4OJ5 A;  3K4N A;  3PNV A;  2JHD A;  3DTE A;  3H5N A;  4PSW A;  3LSI A;  3W3C A;  2X51 A;  2Z2S B;  2LOO A;  1Z7L A;  5HLT A;  1F44 A;  2R7W A;  3ICX A;  1BR2 A;  3C29 A;  2HOF A;  4E7J A;  4IQ4 A;  4J01 A;  3OWT A;  4FZN A;  3BG6 A;  4CH7 A;  3H9Q A;  4XN0 A;  5HNH A;  4QPQ A;  1MMA A;  3H0D A;  4FZM A;  1PYV A;  3SAG A;  2LC2 A;  4PSX A;  4CCJ A;  3FKJ A;  4CCN A;  2VJJ A;  3LSM A;  3M7D A;  1ZEL A;  4FZL A;  1D1A A;  4ZJZ A;  1EA3 A;  1S9H A;  2ELJ A;  3OS1 A;  2KPM A;  1HIW A;  1WUD A;  1UEL B;  2ZIX A;  2Q4T A;  4RLQ A;  2KIC A;  3L3F X;  2H3V A;  4KX3 A;  1DGR M;  2VJ5 A;  2JH1 A;  1Z3X A;  2UUZ A;  3BCB A;  4CSW A;  4E7Z A;  1UAA A;  1HA8 A;  1DQU A;  1Z3Y A;  5TGT A;  4HRI A;  2L2O A;  3OYJ A;  2MA1 A;  4AYB F;  3DEE A;  1Z1B A;  1GO3 F;  3LSK A;  3AL0 C;  2XSJ C;  3PFY A;  2I8D A;  2WB1 C;  3HPG A;  3RCO A;  2K9L A;  1URJ A;  4KIS A;  4O3M A;  4BE1 A;  1WJ5 A;  2DCE A;  3I9V 2;  4B47 A;  3V42 A;  2XF5 A;  3ZQQ A;  3OYH A;  1MW7 A;  3K4M A;  2P0W A;  2L9N A;  3N05 A;  2GOM A;  2MC4 A;  1Q3U A;  2X85 A;  2MAB A;  1V5F A;  3OL3 A;  2ZXI A;  2BVM A;  4C9Y A;  3PJR A;  5C0Y A;  1OUQ A;  2HPM A;  2AQF A;  2WAD A;  1BR4 A;  1GLN A;  4JQF A;  1WJB A;  3BCA A;  2BOL A;  2W7N A;  2X1D A;  5T14 A;  4II3 A;  4PK4 A;  3VWB A;  2IGO A;  3CP8 A;  1NG6 A;  3CJR B;  1U0J A;  4HSR A;  2YB1 A;  3CJQ B;  3W2V A;  1FMV A;  3LSH A;  4BQQ A;  1T0F C;  2LRE A;  1TAM A;  5KHD A;  4QJF B;  3K70 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...