3DEEA

Crystal structure of a putative regulatory protein involved in transcription (ngo1945) from neisseria gonorrhoeae fa 1090 at 2.25 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
200
structure length
200
Chain Sequence
LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative regulatory protein
publication title The structure of the first representative of Pfam family PF09836 reveals a two-domain organization and suggests involvement in transcriptional regulation.
pubmed doi rcsb
source organism Neisseria gonorrhoeae fa 1090
total genus 55
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09836 DUF2063 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3deeA02
1.10.150.690 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3deeA01
3DEEA
chains in the Genus database with same CATH superfamily
1XD7A 9ICHA 3G6YA 3E5QA 3RQIA 2K5CA 3PFIA 2EDUA 3K9TA 2HHXA 1D0YA 5AKHA 2A19A 1FNNA 2BV6A 3U1KA 4DL3A 2BDUA 3C1YA 7ICKA 1EXNA 1YOVB 4HF0A 3AG3H 2KEYA 2YU9J 3WTXC 5C3EJ 3K4MA 2JRTA 2G5HB 1BIBA 3Q0UA 4JYKA 3L3FX 3SD7A 4HX8A 5KFRA 2BYVE 1YYVA 2EZHA 1E2XA 1W7PD 2D1VA 3CJTB 3DTEA 4DLEA 2MH2A 2KHMA 2VXZA 4B9NA 5E3LA 1ZQ3P 1BC8C 8ICMA 2LMDA 1RR8C 2KHVA 2MA3A 4MF8A 2AGPA 1BI0A 5E17F 1J7KA 1O7LA 3HUGB 1JI7A 5TISU 3LFKA 3CZ6A 2V26A 4HNTA 2LP0A 1XB4A 4I2OA 1Q3UA 4HYKA 4MQVA 5HODA 3CUQB 3RRHA 4FS1A 4ECYA 1BIAA 5J2CA 1KRPA 5CQEA 4GYGA 5H20A 2WAQF 2K7LA 4DL5A 7ICGA 5FD5A 1GV5A 1YW7A 2YX8A 5AKYA 3ASOH 4S0HB 4XNFA 4ITVA 4EGZA 1XSDA 1J09A 2XDVA 1G4DA 1TFRA 3FAHA 4YD1A 4F4YA 4DS5A 2W9CB 2WF8A 8ICHA 3C1DA 2KSOA 2XF7A 4UB6U 1U5TB 7ICSA 4LMYA 2LKSA 4XOTA 4G7HF 3N4MA 1ZR2A 5J0OA 3CESA 4OJOA 1MJ9A 2K9NA 3PO4A 1IN6A 1ZQDA 1E0EA 3SZTA 4PJJA 2QZ8A 1FYKA 1JHFA 1I50J 2HTJA 4A0YA 2LM1A 4PL2A 3CC4I 5IIJA 5CWRA 4PPXA 1XCVA 2LY9A 1K78B 1WI9A 2CMPA 2ISOA 3HOUJ 1POGA 4BQNA 4IR9A 3FXKA 2STWA 1FOKA 2YU3A 2RQPA 1AWCA 2ZMEC 3QRFF 3M6ZA 7ICEA 2UUZA 4RAFA 3IRQA 5KFLA 5EGOB 1YW8A 5J0PA 3QEAZ 1SFUA 5DBAA 5FGMA 4OIPF 1U45A 1JXLA 3DQVC 4DWIA 1KU7A 4DYRA 3D2QA 1LKYA 9ICKA 1OFCX 2M7BA 2K9MA 5J2HA 1D0ZA 1AOYA 4B9VA 4KLQA 4JBAA 1P7DA 3I28A 5ICCA 2OPTA 4ZJZA 2I5HA 3MQ0A 2PN6A 3MGVA 3KBBA 2E2JJ 3C2KA 3AAFA 3J7AY 2CUFA 1PP7U 4KISA 3UKGA 3H8MA 1W36D 2ZKZA 4XLAA 4GXJA 3PY8A 4BXOB 2IGNA 9ICJA 4MTEA 2JVHA 2OCEA 3K10A 3TW6A 4X6AJ 3WK7A 1TP4A 2EAOA 2DPIA 4L9NA 1KDHA 3CC7I 1E17A 3RKWA 2WADA 4GIBA 3WK6A 2TDXA 5D8LB 3C2HA 2WAEA 3PUBA 5J4VA 2CQQA 3S1RJ 3Q5FA 1USSA 3FMQA 4DJAA 4Q48A 5ALWA 4CF3A 2F77X 2XC7A 5HNHA 2DT5A 5LGUA 3VC8A 1ZELA 1K79A 1QPIA 1Z1VA 3QNMA 4F50A 5J2BA 2IA2A 2ZUBA 4FBTA 4AVZA 2VOOA 5ALRA 2W25A 3V4GA 4RQ2A 2EZYA 1ZJNA 4F2RA 3ZQQA 4YIRX 2VA3A 2QGUA 1ZR4A 3F23A 4XQFA 3QU7A 4ACOA 2R8KA 5KFMA 4M9HA 2BVLA 4OAYA 2KNJA 2LR8A 3PSPA 1BA5A 4EBDA 4QZIA 2E8NA 1S7EA 1JMSA 3IV6A 4TURA 2R7OA 4ZH4F 4PZOA 3IH4A 3W6JB 2KVSA 2DOAA 4HQEA 2Z9OA 1X1AA 5DBCA 1IIPA 2IJLA 2PQ8A 2W9AA 4LK1F 2ZIVB 3AG1H 3HGYA 1L3UA 3AL0C 4KLSA 2JZBB 2WHEA 4HAIA 1HW1A 1CF7A 1NZBA 4RQ5A 2OC6A 2IOFA 1YIJI 1X4PA 2LF8A 2L7FP 3E3VA 3WKDA 3SAGA 3S1NJ 2M1BA 7ICOA 3VEPA 1X58A 2V4RA 2YX4A 4KN7A 2E71A 1ZQXA 4B47A 2HHSA 3H8JA 1Z00B 3HJEA 4KLUA 5EEGA 2WTFA 5AM0A 2R7ZJ 2DI3A 2HDCA 3AKZA 2EH9A 3ORYA 2UVUA 3Q3SA 2BPCA 4CF4A 4I2EA 2WBMA 3MCZA 2RDIA 8ICJA 1JI8A 4IHWA 1BM9A 1X19A 1HOMA 4IRCA 3S1MJ 1BPZA 4IQTA 4W1UA 2ESNA 5AI0A 3PQJA 3E0FA 4JK1A 3R6SA 2QSGX 2JH7A 3U2RA 2L4AA 2L5YA 4RPYA 4RA2A 2MSYA 2ZTEA 2W57A 2V9KA 3BY6A 2R92J 2AXTC 2M9NA 5D4BA 1XGNA 5L1JA 3HC7A 1J0RA 2PFNA 5AIAA 4F4KA 5TRDA 2MH9A 3SI8A 3QU3A 1BL0A 3H0RB 1QZYA 2FI1A 5H2FU 3LSMA 3BQ1A 5HR7A 3VOEA 9ICMA 2WF7A 1NTCA 3BQYA 2FBIA 1SV0C 1L3TA 3FKJA 1XC9A 3HHGA 1TAQA 4LG0B 4XUSA 1H0MA 2C2DA 3NASA 3DFGA 8ICOA 3R0JA 4DL4A 2R93J 2YUSA 1U2WA 4B43A 1XMAA 2EWNA 1R4NB 2HXOA 2ZNYA 2M34A 2WAFA 5ED4A 3T5HA 3NVZA 3I59A 3I4MJ 3J7YJ 4D1QA 1W0UA 1XDSA 2L2OA 5HP4A 1FYMA 4I27A 1BC7C 2IMWP 1TK8A 2QSHX 1SVLA 2MBFA 4BXUA 5KFVA 3JPRA 2ZMEB 2QBYA 3UNGC 3H8SA 4NL9A 2VKDA 3WTSC 2LK2A 3BDDA 1G6NA 1X1DA 2FMYA 5LHGA 2DQRA 1BPXA 1D0XA 3SAFA 2W7OA 1PUZA 3A02A 1WJ5A 2FE3A 2D8CA 4U7CA 1PVEA 3BQ2A 5E8IA 1P4AA 4BJ6C 2OTJI 2PI4A 1O3QA 1IRGA 3LVVA 3HOXJ 4QZFA 2FX0A 2G07A 4NM2A 3MR2A 2H3FA 2HMXA 1RKWA 1O3RA 3ELKA 2COMA 2JH1A 4II2A 5KFBA 7ICNA 4Z2YA 4I2AA 4Y2SA 1R1VA 4IO9F 3K4CA 4D0PA 2Y9ZA 3KEOA 2W48A 4ZYDA 5J0YA 1N60A 3Q0WA 1G59A 4OCZA 4AP9A 2KK0A 2JUGA 3HILA 3KHLA 4L0ZB 2XKOA 5D8KB 1T7PA 5EZGA 3FXQA 1U4BA 4A5MA 4NLGA 4MFEA 4P0PA 4PGYA 4GGGA 1SL1A 3KX2A 4XORA 4MFCA 4GO1A 4WJ3B 3FIWA 1LB2A 4M3BA 1BOBA 2L54A 4B44A 1DOQA 4NXZA 1MBEA 2STTA 3IG5A 2ZIXB 4FHTA 4A6DA 4J9NA 1ZRCA 1VDVA 2NAZA 3OYDA 5FO5A 4J9MA 1FOYA 1LEAA 3H9QA 4KFCA 5KFNA 1ZQHA 1ZARA 4UAVA 3WTVC 4IC9A 2LH9A 5KFCA 4BACA 4I2HA 2PMZF 1MC8A 3U26A 3W2AA 3QPSA 3H1CA 4P4OA 3FM9A 4JX6A 1E3HA 4AD9A 5DKWA 2JN6A 4AWXB 3KZIU 4JUZA 2R5ZB 4F71A 2EZIA 3WKCA 1OUQA 2L7KA 2OF7A 3FC4A 4XM3A 3GCMA 2YMQA 4CA0A 1KL9A 2XGDA 3GFIA 2H09A 4PHDA 3Q8RB 3LQRA 5KL8B 4F5PA 3Q8MA 2J6UA 1MBKA 5DG7A 1R5ID 2R7XA 5LRSA 1LE8A 4PJ0U 2Y9YA 2HWVA 3EYIA 2HVIA 2EQYA 9ICUA 2HBKA 2ISYA 2KMUA 2QB0A 3WU1B 2KIUA 1X40A 1NJZA 4GC6A 4BQQA 5J1UA 1O03A 1VJ5A 4Z6DA 5FP0A 5IIKA 3LSRA 3E1SA 1QZZA 2M0CA 4PGGA 2ZJ2A 3M7GA 4I2DA 3CCUI 3BCBA 3HL2A 4I01A 5CLSA 3O6BB 4NB5A 1B72B 3L2CA 3F8MA 2VONA 5DGBA 2Y0SF 3G6XA 4J9PA 3C2GA 3RTRA 2R5YB 4AC0A 1W0TA 3KFWX 4RQ1A 3RJPA 1L0OC 3M8FA 4CH7A 4FCYA 3BS7A 3FBIB 4NLZA 3WU2C 2KIVA 3H9GA 1O08A 4P4MA 3RJEA 1TLHB 1ZLKA 2RLTA 4UB4A 4ECSA 3A01A 2ESHA 3HRUA 5DV5A 3NTUA 2IEKA 4ETSA 4IQWA 2NS0A 3DKYA 5AIPA 1ETWA 1HA8A 3PX0A 1T3NA 2IGMA 3QE9Y 3QU5A 1QVUA 5IOYA 5KFAA 3X2QH 3BP8A 4ZYEA 5H2FC 2H3VA 5ALMA 1MBFA 3EWAA 2O8XA 1ZTRA 2ME6A 1ZOLA 4BJQA 9ICPA 5TZVA 3K1ZA 1L8LA 1S0MA 3FM5A 3NEUA 4O3SA 3KD3A 2ZXWH 1H38A 2G08A 1XSLA 4E0DA 3ETLA 2VQCA 1BN5A 3K70D 2OAZA 2QWWA 3ZQ7A 5ILUA 8ICWA 1V97A 2M8GX 4OIOF 4AYBC 2FNAA 4LD5A 4G7OF 1X3UA 2X1CA 4PJNA 2FD5A 2Z99A 1HQCA 4FX4A 4A3EJ 4DFMA 2EV6A 4KMUX 1X9MA 1Q1VA 2Z33A 1MMGA 3LSKA 4RGSA 3BROA 2DFHA 5D49A 3ETRA 1NG6A 1OCRH 1X1BA 4I76A 4PGQA 3AG4H 5F1RA 3AU6A 2P5KA 2QARA 3GTLJ 5AKIA 4RQNA 3IH2A 1Y8QB 3J7ZI 2KTQA 3JSPA 2FSWA 3GF2A 3HDDA 4BUPA 2WA0A 1VQ8I 3MBYA 1EV7A 2QCOA 3RKYA 2HZTA 3GMEA 2FPKA 2LFBA 2NXNB 1ENHA 4A3MJ 3J81j 3GQCA 1QVTA 4X1EA 4X0GA 1M6YA 1A36A 4KIGA 2XROA 1LVAA 2IVMA 4YG2A 8ICBA 4F4XA 3RRGA 4ANJA 1LFPA 2M9HA 5F3XB 2OEHA 2DO7A 4A69C 2DYRH 5FKLA 4G6QA 3B73A 5A0LA 2JUCA 1JUPA 2VUMJ 4MEYF 4HDUA 2DPUA 3LQQA 1HW5A 2DODA 2X4HA 4BH9A 3PMNA 2ZFWA 2YX7A 8ICCA 4QWQA 3I55I 1DU6A 1QSYA 5HHIA 1MA7A 5ALLA 1QRYA 2F48A 3BCAA 1NOMA 1HBXG 2CV1A 4Y2JA 2OZ6A 3GEZA 4XRMA 2C2RA 2A6HF 2Y30A 5DLGA 4HV5A 3SDGA 1JE8A 3HXLA 1YRNA 3PNCA 3WKBA 3F8BA 1PVQA 5DD4A 3BG3A 1MN8A 2YS9A 2G7UA 1Z21A 2O6KA 4EBEA 2C22A 2Y31A 4DQIA 1T8EA 1Y1VJ 2RKHA 1ETOA 4AIJA 3N7RC 3NRZA 3TEDA 1FFVA 1D8YA 3KP2A 2A68F 2XGPA 1K83J 3WE3A 2E5SA 3A1YA 1J2NA 4M2YA 3H3ZA 1VI0A 2Q2EA 1WWXA 4CDGA 2X9DA 1PJRA 1UHMA 2O03A 3BQTA 1SANA 4LG3A 5ALPA 4XL9A 1TWCJ 5EG0B 5EE1A 4QZ8A 4LIUA 5DQHA 3MDAA 3OYHA 4M6VA 5KG0A 5H6QA 3EPIA 4O5VA 2NNNA 4DZPA 2IGOA 2Q0OA 4J00A 3GTKJ 3HSFA 2PJRA 1L3SA 2HI3A 4OWRB 4PJ0C 4I02A 1U9LA 2F4OB 4IQVA 4MFAA 3WK9A 3HZJA 7ICHA 1FOWA 2ETHA 2X1DA 2EIMH 5CVJA 1PYVA 3CCYA 2LBFA 2A6TA 3KP3A 2K85A 2R7WA 4J03A 2HVHA 2LOOA 3GTQJ 3KLOA 3NS1A 9ICLA 2DTRA 1FX7A 2QENA 4OINF 2NRAC 3E6MA 5AM5A 2LMRA 3BJAA 4EJOA 3KYDB 5CVRA 3OGUA 4B9UA 1G3SA 1B8IB 3PR5B 1SFEA 4NLCA 4HNUA 4Z6CA 2W9MA 8ICKA 1R6RA 1WGXA 1KTQA 1X6JA 1TW3A 2GAUA 2P5VA 1KW4A 1RNLA 4B3XA 1T4GA 2FLLA 3OMYA 3TAPA 4J9RA 2ZJPF 4MHGA 4MLOA 5EE3A 1JXSA 3MGHA 1TK5A 2FOKA 4DCCA 5LRRA 4PH5A 2ZJQF 2ZIWA 5BMZA 3CW2C 5IP7J 5M5YJ 3QU4A 2UVWA 3RJJA 1ZQEA 5AI5A 4LVSA 4IEJA 4U0WA 5IP6A 4PUSA 1H89C 2R7VA 1LUJB 4QZAA 2NVQJ 3DTIA 1YW9A 4QZBA 4UUVA 3B0XA 2WB1A 3D2NA 3CJRB 2K4HA 4XKVA 3UXPA 4IF4A 3VYTB 3WK4A 4L5JA 4UQGA 5J4YA 1B4FA 4W97A 2AQEA 4M9SA 2DJIA 2HS5A 2IT0A 9ICOA 1NK6A 3FZVA 4CICA 2FA5A 5GPCA 3H5RA 3GZ5A 2NVXJ 4HF1A 2E1FA 1DGWY 7ICVA 1RC9A 5CRXA 9ICBA 2HBMA 3PSIA 4CCJA 5JLXA 4KDPA 4UASA 3QP6A 2V4JC 4AU7A 5BOMA 1BI1A 2OZUA 3IHQB 1S3JA 1QHHD 2DBBA 2IOFK 4CRXA 1JJ8C 1KQ8A 2XY7A 5B1BH 1TW2A 1QCKA 1TNTA 3K1MA 2JGAA 2A1AA 1IV8A 1ZYRF 2KP6A 4OJ6A 1ZD4A 4KJZA 1GLNA 3ZN0A 3TI0A 4EEKA 4C3HJ 2OBPA 4O3PA 2PMZC 4LFUA 4DLGA 2HDDA 2J6TA 2MW8A 3KP5A 4E6KG 3NRWA 5F64A 4RLQA 4Q8EA 2VBXA 1Y6IA 4B9MA 3C3WA 2XAGA 3B02A 3MZHA 2E5NA 3CDIA 3SYTA 4E7LA 2MU2A 2MUTA 1V55H 3C29A 1OYYA 2ZXJA 2HOQA 3QUCA 1ACIA 1MBGA 3BDPA 5D6EA 4PHAA 3OIOA 1ODDA 3ISPA 3JPSA 1FTZA 3GFKB 2KFNA 2TCTA 3KEYA 5ALKA 1I6XA 2W3SA 4UARA 5AIQA 2JQ7A 1F1ZA 2NO4A 3TACB 5JLWA 1UT5A 3ZDDA 7ICIA 1QNTA 2EZKA 2AH5A 1P7JA 2XAUA 2PEXA 1UMQA 1HDDC 2GIZA 2ASJA 5IYDJ 2NRWA 3G3ZA 2R8HA 3BQ0A 2J5OA 2XVCA 1FT9A 3H36A 2Y0SC 2DWQA 4YVZA 1G8XA 2F5EA 2K4JA 2VKQA 4BL0B 4UVAA 2VBYA 4DBQA 5K5QA 5FRNA 3LSTA 1QGPA 2CFOA 2W7PA 2NS7A 1A35A 4DL2A 4NLNA 2YSRA 7ICTA 3RH4A 4IVNA 3QZ8A 3FMRA 5E79U 4ED6A 5JFRA 1X2NA 4XLFA 2ZXHA 2KDZA 2FQ3A 1S0OA 3BR1A 1AROP 4P96A 5KFUA 3RYRA 3IRRA 4RB2C 2H6BA 4UV9A 1MSWD 2RHFA 5AKLA 2NRXA 3CLOA 3HSEA 5F04A 4HDVA 2C28A 3WTYC 3GO5A 3CMYA 4TQSA 4E7IA 3WK8A 3EUHC 3ZCOA 2YN4A 1JKQC 3NARA 5B5EU 4OJLA 3CDLA 3K4LA 5DYMA 5L3EA 3BR2A 2KZ3A 3D5RC 3H7IA 2UVVA 1D1CA 5J8YC 3EUB2 2YMMA 2R3SA 2GXAA 3H35A 1SVMA 3G6VA 1D1BA 5KAIU 3L09A 4G12A 5J3LA 2KRFA 4M74A 4UVCA 4RB1A 1PZNA 2A69F 4IL6U 4BAYA 4C3JJ 4O3NA 3ZDBA 1S77D 4F72A 4Q45A 4F5NA 3CUQC 3K1PA 4IKFA 4P2HA 2VT2A 3GV8B 4P9FA 1O57A 4EBCA 2J5PA 3HTUA 5L1IA 4NY8A 3DV9A 2CRXA 2OUMA 5GTHC 3I4NJ 1ONVA 5JHFA 1UA0A 2WF5A 2KZGA 3HG9A 4D9JA 1ZLJA 1NKEA 1HCRA 1LKYB 4A3KJ 1Z7UA 1KEJA 4CUGA 1RESA 3CD6I 5J0QA 3BZ6A 1IRXA 2W43A 3GW2A 2EA2A 2C2EA 2PLYA 3MABA 2LG4A 3RB4A 2G7HA 1S0VA 4MTDA 3KPHA 3DLLF 4ZOHC 1I27A 4XLNF 2Z3YA 1WCNA 4A93J 1UCVA 7ICJA 5L3FA 2DLLA 1COOA 2JVGA 5FKMA 4EM0B 1JROA 5ALEA 2WAQN 5CJ9A 1Y8RB 5KFIA 3KHHA 2CS3A 5KNLA 2P6RA 1SC7A 2RN7A 2B63J 1S5LU 1U0JA 3PW2A 5CA7A 5J2EA 3F8FA 3ZQCA 1DPUA 2ECCA 3LA2A 4HPQA 2ELJA 3SXYA 2C6YA 2HOTA 3OIPA 5FFZA 1WRJA 3UPQA 4B9SA 2XPUA 1WHUA 2VBWA 3M8EA 3KETA 5KVRA 1U8BA 1APLC 2IA1A 2XICA 1SD4A 5DQGA 2WAQA 5KFWA 1OR7A 4H4KC 2K86A 3A0BC 2E2IJ 3MDCA 2BKEA 1WQ2A 3PM1A 4QWDA 2JA2A 3P9KA 1R00A 3CJQB 8ICXA 4YFXF 2R7UA 1H9GA 4M72A 3QPTA 5CQGA 4KIFA 1H9TA 1AKHB 3H4DA 1W4MA 3QPLA 4NC7A 2H94A 4XN0A 2JEGA 4JV0A 4KLHA 1ZREA 1AQ6A 2K4IA 2RQ5A 2ISZA 3OSNA 2KPMA 2BW3A 2IA0A 1DP7P 1UHWA 2GBYA 4LLLA 3PUFA 2W24A 3VYSB 4I99C 2BGWA 2EK5A 1HSJA 4G9YA 2DTZA 4FZNA 1XO0A 2M5WA 2VN2A 1SD6A 1XGOA 2O5RA 5KAFC 3L2VA 2VA8A 5BPCA 3RH5A 4IOCF 1CF7B 5J0XA 2ES6A 4DW6A 1D8KA 3BR5A 4M6WB 1CEZA 1ZQZA 5DDGA 3S2DJ 4UAUA 2W7NA 2K60A 3ZPLA 1NJYA 2ZSIB 3DP7A 2PG4A 1C20A 4U0VA 1J75A 3WKAA 4N0BA 5KG1A 2HU9A 2KFDA 1VQ6I 2H27A 2VLAA 2CWEA 4O5KA 5H6RA 2F2AB 4TUPA 4UVBA 2HCFA 2EAMA 5GTIU 2JTVA 4BXFA 1YG2A 3JRBA 3HOTA 1ED1A 3CYMA 3K1RB 1VZ0A 3HB9A 1FLIA 1PVPA 1OLTA 4R8HA 2Z2SB 1BNOA 3UM9A 1IF1A 1OW5A 1WZ2A 5KT7A 5JTIA 1UA1A 3ZQFA 5AI8A 1UG2A 3FXLA 1BVSA 3MC1A 1YO5C 2BPFA 5CJ7A 2L7ZA 1D1AA 1ECWA 2HQNA 4Q44A 4JV1A 1Z6TA 5E79C 4DGWB 1BW6A 2DDAA 3UR3C 1V38A 2CQ7A 2HPMA 4YMMA 2FBKA 3SHFA 2Q0ZX 1MQ2A 5E18F 2ATLA 4OU0A 4DSIA 1HUOA 7ICMA 3AU2A 5GAHJ 3B0YA 4B09A 1RQNA 5J1YA 4IHTA 4Y2TA 3BLYA 3U1DA 2VA2A 1B1BA 2KIFA 5EEAA 4RAGA 1H88C 2HVRA 4EELA 4RQ3A 3PW7A 5TJJA 2XGXA 2KOBA 5DS9A 2XF6A 5CYVA 2KFZA 2EH3A 2VASA 3D0SA 3H3UA 5ALIA 3KHRA 2W85A 5KAIC 4BS9A 2YB4A 4HLYA 3I59B 2XSJC 5KFXA 3PZPA 4U0YA 4UW9A 3CF2A 2HR3A 4QZGA 1S8OA 2HHVA 2NYVA 5ALXA 1XNSA 2DA4A 4DOBA 2KLOA 5D5UB 2OH2A 4M9ZA 2BY3A 4HNVA 2FE9A 5AKEA 1WWVA 1FY7A 1F4KA 5LHIA 1MMDA 2HHTA 3FX3A 5E1XA 4DSEA 4GDFA 3MZ8A 5BQTA 5ICEA 1TT5B 1Q8KA 1N63A 3QPHA 4HAMA 5LEKA 3GZFA 5ALDA 1MBJA 3G1LA 4EENA 1FZPB 1ZQ1C 1XGMA 1IUYA 3C18A 1FOXA 3FISA 3DDHA 5J0UA 4C3IJ 1NK4A 2QEXI 2NO5A 2DMQA 4KLIA 3T0YA 4FTHA 1CRXA 5KG4A 1RXWA 2FXAA 5IPAA 2V1DA 1QTMA 3ZDEA 1WFXA 2Z16A 2IW5A 3DEWA 2WV0A 3QUTA 1ON2A 4ZYGA 2BY2A 1T39A 1U78A 3D6JA 4KUMA 2ZFUA 1FSHA 5KTQA 3V8LA 4M6XA 4KA4A 2XGCA 1UELB 4NQWA 4UB8U 1BI3A 1YT3A 3KP7A 1ETYA 2DAOA 2RRDA 4TUQA 2EFPA 2VIXA 2FMPA 3G1OA 3OYIA 2L3DA 1JHHA 4F3QA 4XIDA 1W5SA 3I64A 1A04A 4LJXA 4I0BA 1O3TA 3THVA 1P9QC 3H0GJ 2LY2A 5ALQA 2JPBA 3MEXA 2VOPA 1Y1WJ 2VPLA 2E60A 2KHQA 2E7XA 4M47A 2DL0A 4ELUA 2YMLA 4Y4RA 4DIQA 3N7SC 5JRTA 5F6FA 3C2MA 1T95A 2W1OA 4ELVA 2QQAA 3PO3J 3HYIA 1N61A 1A6QA 3C7JA 4M3GA 3E7LA 1JRPA 3PW0A 3GTMJ 3DBLB 2LF7A 4YIIA 6PAXA 1GXPA 1L7NA 4MEXA 3KE2A 4N9IA 1TQPA 2QUFA 1TWFJ 3S2WA 3QU6A 3TP0A 4I2FA 1WPKA 3DKXA 2KDOA 3SZPA 2BHNA 1XU4A 4Y2UA 4IRDA 3VCBA 5KFOA 2RAEA 2A61A 5F0FA 4AVPA 5F1JA 3GYHX 5FLXK 5L1LA 2D2WA 4Y2PA 2E36A 2QB0B 4FFDA 2XCPA 2LKPA 3UXOA 4AYBF 4F5QA 1L3LA 1X9WA 5DEQA 4BXXJ 2FJ6A 4RT3A 4ENMA 3K7AJ 4UUSA 1NK9A 2ZIUA 3M4OJ 2LBOA 1CGPA 1NKCA 4PDKA 1BW5A 1DRGA 2MD5A 3TMOA 2ZTDA 1ZQKA 1P4WA 3S1QJ 8ICYA 4KTQA 1T2KA 4YCXA 1RM6C 2Z5UA 2DA3A 2LYAA 2N8GA 1YITI 4OMYA 1S29A 5CKTA 3ED5A 2CGPA 4YRVA 1Z3XA 5DBBA 4UAYA 3RZDJ 1KFSA 4EYIB 1X3ZB 3E2EA 2H1KA 4QNLA 1G3TA 1SWWA 3MFIA 4PCQA 4C30A 1G3YA 3FXRA 1F44A 5CPRB 2YMPA 2HDWA 2V9PA 4RMNA 2PMZN 1N48A 3ONQA 4JMUA 4DFJA 1ZQCA 3AG2H 1C0WA 4WWCA 1C7YA 1VTNC 2X1EA 2DFLA 3ECHA 1WVRA 3K2AA 2ZUCA 4J01A 9ICNA 3RJHA 3A0HU 1ZN2A 2DK8A 2CUZA 2B21A 2BPGA 1FIAA 4DQPA 5TISC 1URJA 9ICAA 2EFNA 5HDNA 4EATA 5IILA 3T5LA 4FQGA 3HOSA 4NDLA 5HLIA 1FEZA 5AKJA 1O3SA 4RGUA 3AUOA 2K8CB 4EYHB 3WE2A 5FLXZ 4HQMA 4BEHB 3F9KA 4QTRA 5CB1A 2DXIA 3HOVJ 2IS2A 4BQOA 3QYPA 1ZQYA 3IUOA 4F55A 2W82A 4P0QA 4RPXA 1WJEA 2M4GA 2Y0SN 1ZQMA 3GV5B 2PFPA 3BTIA 3H8WA 4CE6A 5IP9J 1ZQJA 4QJFB 1B22A 1T0FC 2EPFA 3BR3A 3P7NA 4UB6C 4CYCA 1N5XA 2OHFA 2EANA 3HKZC 2F3NA 4JWMA 1MNMC 2HKXA 3BR0A 5DCMB 1V5EA 4PGXA 1P2FA 4IPAA 4LGWA 1K7AA 2BY1A 2MG4A 4Z6YA 3IKTA 4I2JA 5KHDA 4R79A 4WF2A 2LDUA 3UMBA 5T14A 2XIGA 3ZRGA 2KRHA 3FHZA 2XO7A 1SKRA 4BDPA 2F8LA 3GZNB 2GA2A 4ED3A 2VT3A 3BR6A 8ICTA 2CN1A 1XSNA 1W1WE 5F27A 1L6NA 3M9NB 2CW0F 3FHNA 3H0LB 5G5GA 3CMAI 2BQ3A 4QWEA 2L02A 1R4MB 2VI6A 3MR6A 4DQQA 2XIDA 4DYCA 3RIRA 3TADA 1NK0A 3FXMA 4L9TA 2JA5J 4IHVA 4Y2VA 4QZDA 2KZZA 5EZHA 1UB9A 2X6WA 1X66A 2PI5A 3I76A 5G5HA 3F5AA 2VB6A 3EYYA 5FD6A 1J2MA 3ZI4A 1K6YA 3GIKA 3IG8A 4UB2A 4FASD 3T1BA 2XAFA 4A0ZA 1W36C 2DKZA 5AICA 3TARA 2DFIA 4M9GA 2E3TA 4G8XA 1N77A 4LZDA 4F4WA 4QIWF 5GPAA 2XC9A 2FDRA 1J5YA 1EF4A 3VODA 4FE3A 5EWFA 2NVUB 3ERMA 4XRSA 3S2HJ 5J0WA 3LSPA 3T3FA 1T38A 1HIWA 1WYGA 3EQLF 1S76D 2BR0A 1GDTA 3K4BA 1HEKA 2BDPA 1MH4A 4KT5C 5EEHA 3V8JA 4RT2A 1UHUA 2D3DA 5HOOA 4EZ6A 1REPC 1OJLA 2AJQA 3DKWA 2WV1A 2NNYA 2MGQA 4RU9A 4DF4A 2OQRA 2KIWA 2AQFA 2LBFB 4ECZA 3ASNH 4OIRF 3QAHA 1TWHJ 2F1JA 1KZHA 4BX9C 1HUZA 4KLJA 2K9QA 3I5UA 5DDYA 2W9CA 1MW7A 1BR1A 2R4GA 5CVIA 4R8UB 1IDYA 2K40A 4UV8A 1U5TA 2AXLA 4RGRA 3WU2U 4MFDA 4LB6B 1TAUA 1T56A 2JT1A 3WGHA 3PR4A 3ULQB 1RYUA 4Y17A 9ICWA 3Q8SB 5AKZA 2GM4A 1K78A 3QU2A 1OPCA 3IWFA 1YQAA 5K7HA 4WXCA 4MEYA 2ZJRF 3HRSA 3OYKA 2ZIWB 3JPTA 1P92A 1MDMB 2YB1A 5E20A 3ZGKA 1K1SA 1GO3F 1OCOH 4I7HA 2F5FA 4FETA 5EDNA 3S93A 4IX7A 2H8RA 2HOFA 3HPHA 3KZZA 2W11A 3DBRB 1T8IA 2LM4A 2IGKA 2PBIA 3V42A 1JUMA 4KYWA 3MFHA 5IIOA 3PNYA 3I0TA 4RM2A 3ZMVA 3S3NA 2YY6A 5JUMA 3I58A 5E3MA 2LKXA 4PJMA 1W7PB 3CCLI 4PFOA 4CCKA 2KKOA 2FNPA 1V3FA 1K4SA 3BZCA 2XASA 2VBZA 1QQ6A 2Q1ZB 3A0HC 1X3WB 1XX5A 3FDSA 5F08A 4ENKA 2DA5A 1ZAOA 9ICFA 1R36A 4XOPA 1Y0NA 3ALRA 4F3OA 2EA4A 2XUBA 3C2BA 4ZTJA 4UY8I 1MQ3A 7ICQA 4GRIA 4ECUA 2VKVA 4BXOA 2P8TA 2E1NA 3IDWA 1FBQA 3KKAC 1KYZA 4ELTA 5AK4A 4R66A 3OYAA 1JUSA 4RQ4A 2ISPA 1BI2A 3LA7A 3MAJA 2DOFA 3O2PE 3PL8A 1D8LA 1QQ5A 4ASNA 2JHDA 5D5WB 4NHJA 2HYFA 3JTGA 3HPGA 1TQMA 3PJRA 2HDOA 1IJWC 3ZMTA 4Y2YA 1Z4OA 2VJ4A 4HA8A 1R49A 3PSTA 5KFFA 4RNNA 3GIIA 2E19A 2HPIA 2ZJ5A 1R1UA 3AFHA 2JPCA 4XRSG 1W5CC 2EFQA 4I09A 3F6VA 1VQKI 4UXNA 3TGNA 2O6GE 1K1QA 3M8RA 3MGIA 2GWSA 1TTYA 2P7VB 2FMQA 3CO6C 4ZZLA 2M7AA 1IAWA 1VLBA 3ISCA 5AM4A 5J2IA 2HOEA 3LSJA 1XSXA 2BHZA 2NVYJ 4LOCA 1QQ7A 4UHTA 4XRFA 2WF9A 2M45A 3DPLC 3WHBA 3AN1A 2A3VA 2HOIA 5KG7A 3BS5B 2BE5F 3GLXA 3OR2C 3H0DA 2HQ5A 5DB7A 4FBUA 4O5EA 4XK4A 4CZZA 2OQGA 3HBLA 3K4GA 1MSEC 1IRZA 4PZJA 1IXRC 1WJBA 2XV4S 1KU9A 3Q9VA 5FB2A 3VB2A 2QYOA 2PMUA 1GV2A 3GTPJ 2AHOB 1IG6A 2IS1A 3HEFA 2DN0A 5B3SH 4MIMA 2HQAA 3NAUA 3RPQA 4PL1A 1SL2A 1T33A 2F2EA 5L3DA 2DQLA 3TO9A 2PKEA 3QU9A 1NKBA 1PUEE 4LB5A 3JRIA 1UQVA 2P4WA 1OISA 3HOZJ 1EKEA 3K1NA 3M9MB 1D8BA 4I2CA 2DUYA 4LZGA 2V79A 3F6OA 3IAM2 3NUQA 3SZ2A 2CQKA 4L9VA 4FE7A 2OU2A 3GBGA 4WXHA 2EZZA 2H3ZA 2DJNA 4ED7A 2OM6A 3RF9A 5CEHA 1XCBA 1J2XA 2CW8A 3WG7H 1BNPA 2F1IA 5HS7A 4PSWA 4K2EA 3ZOBA 1ZRDA 1OCPA 2IPQX 2CXYA 1F43A 9ICIA 1HC8A 1HKQA 4EEFG 3LNQA 3B9JA 2F6CA 4PK4A 3FBNB 4ECXA 2QQ9A 4KN4X 3SJMA 1IC8A 3F2DA 1KYWA 1I39A 1X4OA 5L9XA 5HHHA 4YIFA 1XS9A 4Y13A 1JGSA 4HRIA 4ZZDA 1PP8F 2H5XA 2MA1A 4QZ9A 3HT3A 4F8RA 1JTXA 5AM1A 1KFTA 1FP2A 1PUFA 4L5IA 1E3OC 8ICZA 2JV3A 4LG0A 3QYEA 3LL7A 5BOLA 4ED0A 3ROUA 4RLFA 4CSWA 1RZTA 2R8JA 3HTSB 5HMMA 2RNJA 3CF5F 1MZBA 4QW8A 1T6SA 3KZIC 1YLFA 2W9BA 1U6GA 1FMVA 3WTTC 1AHDP 1NJXA 1D8JA 4IRKA 4K4IA 4QWAA 1FIPA 4Z6EA 3UMGA 1LDKB 4C2UA 2PFOA 2ZTCA 1YS6A 3D5SC 2PFQA 3N97A 2DF4B 3GIJA 1BGXT 2LI6A 1ZK8A 2ZMEA 2JSPA 1FJLA 4I2GA 3DEUA 3W2WA 3A2KA 4I0AA 5AK6A 5DG8A 3PIOF 1OXJA 2Q8KA 2P6SA 2M3AA 4CGZA 1Z7LA 3JPNA 5E3NA 2GXGA 3G71I 5CVVA 3CDHA 4BHCA 5D5VB 2M0MA 1ZQOA 5LEJA 3GIMA 2EZLA 3MVPA 2ID3A 3SEQA 5GAEJ 4DS4A 2OJED 3P9CA 4CF5A 1LKXA 4M3EA 1DK2A 4YELA 5DB6A 5KCMA 4XLPF 2XF5A 5HLGA 2LYBA 5KFZA 4EX6A 4RB3C 1B4AA 4IQ4A 1MJAA 3MMYB 3Q0VA 1DQUA 3CJNA 4CZCA 2W03A 3EYZA 3LSIA 3FKIJ 3BC8A 4EX7A 2DMTA 2HW3A 2KJ9A 4HX4A 3QZ7A 3C5FA 2IS6A 2KD1A 5IIMA 1SIJA 3PNVA 2MABA 1OCZH 3OS0A 1PK1A 2R7DA 1OQYA 5DM6F 1R5GA 2BZTA 2EQRA 1MMNA 1ETQA 1VF9A 2WY7Q 3RZOJ 4HSRA 2ZJ8A 4QIWC 2AGQA 4JP0A 3COAC 2N1RA 1X1PA 4UAWA 2ZIXA 4J9QA 3WHCA 2YTUA 4HLXA 3JSOA 4ZTFA 1VFCA 3DCFA 3R0AA 3ZMDA 4GXKA 1LNWA 4AUXA 3F2CA 1DDNA 3M7DA 2CG4A 4Y15A 3RR7A 5TGTA 2KJ5A 2ZSHB 3H5AA 2DCEA 2VANA 4C0ZA 3UQ0A 4YFKF 4US8A 5KG5A 3ZQGA 2R5ZA 4M9XA 3BJOA 3W6KB 9ICSA 2JEFA 1EA3A 3V7SA 5K7ZA 3C21A 1KN5A 3S3MA 3HRMA 3CRXA 1XSPA 5DQIA 2LPEA 1G2HA 3V6HA 2EAPA 1L7MA 1SWVA 2HQRA 2FUG2 1NK8A 1JIHA 1QQIA 3BOQA 4IRGA 3GILA 2RQQA 1I3QJ 4OOIA 1L7PA 3IWZA 5ALVA 1JGGA 4YG2F 1TNSA 5DLFA 3H92A 1RPLA 4O3OA 5IY5H 4V2FA 3EDPA 4HEA2 2XY5A 5CR0A 3RPUD 4BY7J 4NBQA 5J29A 3ZN1A 1IXCA 2KJBA 2R5YA 5GAGJ 3HRDD 1LQ1A 2Y1IA 4KICA 3PMLA 1B6AA 3F53A 3F22A 2BQRA 5C4XJ 1DGJA 4EJUA 2NRTA 2LTPA 2K9LA 1ZQIA 1Z4NA 2ALZA 3MKWB 2L9RA 2Y0MA 4A5NA 1YJNI 4Y7NJ 1JT0A 2GQQA 2Z1DA 1XTAA 1F36A 1TWGJ 1U9NA 2PFBA 3GUDA 3M1CA 2E1CA 3KYLA 2BXYA 1ZKGA 4KT6A 5HLHA 2G09A 1G3WA 3IC7A 2LD5A 4C2TA 5LBQA 2GLOA 2O3FA 5D46A 2F8KA 1RI7A 3UMCA 1S6LA 4QLCU 1KQ0A 2VXDA 3GTGJ 4RQMA 3SR6A 5E8GA 7ICLA 1JKRC 2CV2A 1SV0A 4Y52J 2W00A 1VQLI 1R71A 4BKXA 4JX4A 4O6JA 4XMYA 2HOAA 1IW7F 2DYSH 3W3CA 4B3AA 3LFUA 5M5XJ 4A3FJ 2KP7A 4XN3A 4A3BJ 3K6GA 2ZBKA 4YD2A 4FE4A 3OS1A 4KITB 5DUIA 2KSOB 1HSTA 2F5VA 1ZG5A 3N4MB 5KFPA 8ICAA 4E7SA 3PV8A 2H3IA 4RGXA 5L1KA 1X1CA 3M1EA 2QLTA 5AM2A 2IAIA 4ED8A 2QF7A 3BTJA 1NI3A 3FYHA 4RBOA 1ZQWA 1WKMA 4EQQA 4KMUA 1S97A 1P4XA 2JEJA 2LVSA 4RAYA 5AM3A 4IHSA 4IZZA 4ZC3A 3JRGA 2KIQA 4NQWB 2P6UA 4RQ0A 4U87A 3SEZA 1S9HA 2CO5A 2HKOA 1XPXA 3ZR8X 2HGCA 5E1ZB 1V4RA 3NRVA 4NL9C 2RNGA 3L2UA 3LOCA 1ZH5A 4YMOA 4DFPA 2LY1A 2V9WA 5AI9A 3FXJA 3T8RA 1ZQRA 4R64A 1R9TJ 1XWLA 1TE2A 2K4BA 1HLVA 3ZMUA 4EVIA 4YMNA 3M3YJ 1ZQQA 3PO2J 4GFJA 3GLLA 4XKCA 4L5EA 2W04A 4RDUA 2M0NA 1XN7A 2DA2A 3T5XA 3E5UA 1F5TA 5L3BA 3OYGA 2WB1F 2ODGA 1QH9A 4DFKA 3D5LA 1N5WA 2AS5F 2MLGA 5C5JA 3NQOA 4Y2XA 3KYCB 1ZQNA 4IR1A 4YEJA 4F4ZA 4JV2A 1MKMA 3L9FA 1LJ9A 2I9GA 3VYRB 8ICLA 1D9FA 5HDKA 2DU9A 3H5NA 4B8XA 5D4RA 3FMSA 3TO7A 1HW2A 1A0PA 3F3XA 4HF2A 1B9MA 1FO4A 1NJWA 1WJFA 2EV5A 2GOMA 2M30A 3H0MB 1TV9A 2AGOA 5K1YA 4IOAF 4FO6A 3E58A 3RJKA 5EJCA 4S04A 4UUSB 3Q8LA 2QQBA 5EG0A 3F8CA 1JKPC 2YR2A 4GCVA 2YPRA 2Y9TA 1BPEA 2ZIUB 1UCRA 4XBFA 1B0XA 3BQ7A 3UXNA 1WI3A 4F5OA 3PIPF 3GX4X 5LD2C 2FQ4A 3SEIA 1XS9D 3HHHA 5KFJA 5GADJ 2VJIA 3K4JA 1KU3A 4YR2A 3SFZA 5DG9A 3VDXA 5HDGA 3CTAA 1RETA 4KLFA 4CCOA 2ME0A 1Q46A 2UVRA 1N62A 8ICGA 1WCMJ 2Y48A 5C4JJ 4XR6A 2B0LA 1LPQA 1KFDA 2JA7J 2XGEA 1V5FA 2X6XA 4CNQA 5J1RA 1FBSA 2UV1A 1ZGWA 3HKZF 4DL6A 4DQ2A 3F21A 3AM9A 4KN7X 1B8IA 2FLPA 2BGCA 1QHGA 1EH8A 1SZHA 3Q8PB 1KKXA 4RZRA 3V7KA 3ZMZA 1UHSA 4TV7A 2IS4A 2R7TA 2EB7A 3ONNA 3B6CA 1N25A 2XPWA 1Z1DA 3K69A 2E2HJ 2G06A 3ML6A 3RAQA 2JSCA 1SKWA 2PJPA 4TQRA 1XSVA 1MSFC 2VQHA 1QSLA 1RKTA 2WY8Q 3RKXA 3K4KA 2KVCA 1BR2A 5EF6A 3TL4X 3D1NI 3A03A 4JK1X 1R23A 2E1MB 3S17J 4Z6FA 1K5OA 2A6EF 4XONA 2O9LA 3BTCA 2CQNA 4IHXA 2KG5A 4PHPA 4ED1A 2MC3A 5L3GA 4O3QA 3TO6A 2K3PA 4L9JA 4BE1A 1Z67A 4AYBN 5F9NA 2R7RA 2QM3A 4KNYA 3J7AO 3D2SA 2HHUA 2JZYA 3QXGA 2X0LA 3GFJA 2HI0A 4Q8FA 4M6YA 1DGRM 3E5XA 4BUGA 2NRZA 3OHAA 4IQUA 1RPWA 3PVXA 5C0YA 2ACJA 4OD0A 3P9IA 3GFMA 3AQFA 1L3VA 3PNTA 2RC4A 4AYBA 4TUSA 2AQ4A 4JWNA 3AQEA 2F4IA 2A1JA 1QZEA 3KZXA 3M6KA 3ISBA 2KL4A 8ICEA 5B5EC 3OOPA 3E6CC 1RUOA 3K2ZA 4OMZA 5KG6A 5IIIA 1NG7A 4FISA 4HZFA 2DQNB 4R63A 4PZNA 4LJZF 3NWTA 4USAA 3RFAA 2OCCH 4XLHA 3JW4A 5AK5A 2PMHA 4QWBA 1SMTA 4QPOA 1U8RA 2G5IB 2FF4A 4IL6C 3EPZA 3S16J 2H1LA 2R7FA 5L3CA 1V5GA 2PX9A 4ZH4A 8ICRA 2RV8A 4H0EA 1JKOC 5KFTA 3V7LA 3UQ2A 5JVGF 5KFEA 4WX9A 5FLMJ 2KV2A 2XAHA 2E1OA 2QBYB 4C2MJ 4XQ8A 3S32A 3S15J 4QZEA 2WF6A 1YX5A 1OKRA 1GUUA 4BNCA 4KIBA 1FFUA 5EOZA 4CO8A 4US9A 4YP3A 3N7PD 2VE9A 3TW7A 3M8SA 2JJ7A 5J8CA 5BPDA 1NK5A 1J97A 4JOMA 4DOCA 5E3OA 2X6YA 3IAS2 5DDMA 1BPDA 3E6BA 2B6GA 1VQPI 4M3FA 2I8DA 3JPQA 3OOUA 3AMZA 1ZETA 3SMVA 2A05A 4J19A 3R60A 4NUBA 2FBHA 4Y2QA 2BOLA 1RRJA 1BPBA 2CV0A 2KJ8A 2RGVA 3L2WA 2OYYA 2P35A 4FZMA 2CJJA 3OYMA 1ZQSA 8ICSA 2NVTJ 1S5LC 2RP5A 1I5ZA 2Y69H 3U21A 3S8PA 3CMEI 3Q8QB 1FEXA 2E8MA 2JMGA 2NOJB 5ALGA 2V6CA 3ZD8A 1V9PA 2DKXA 4RB0A 2ADUA 5AIBA 4YQWA 1N2XA 4CHUA 3EW9A 2KMDA 4XSXF 4P0PB 4OO1J 1ZD3A 1MJBA 3RI4A 4O3MA 3O8HA 3OWTA 3JRAA 2AXTU 3RB0A 3O8GA 1CQTA 2QKQA 2OA4A 3I4PA 2JXJA 1KU2A 3BG6A 1LB2B 3G4SI 3QOPA 2NRVA 2VJJA 7ICRA 3SV4A 3CMMA 5J40A 1XMXA 4U7DA 1A77A 4P5OA 4M3DA 5DB8A 1P6RA 1ZGAA 2ZG6A 3OL4A 4V19K 4I6ZA 2IRFG 5ERIA 5J2JA 1SAUA 2VC1A 3KP4A 3HIFA 2BCQA 3OV8A 3IV5A 1RIOH 3ECOA 2CYYA 3C2LA 1U3EM 5AKXA 3HGGA 1TK0A 1SL0A 1KQQA 2F76X 3OTQA 1FSEA 2EBIA 5DM7F 3I54A 3TQNA 3T5JA 3GWZA 1DGSA 2V4QA 2XY6A 4HSTA 3EPGA 3V7JA 2DFEA 3TOBA 1S72I 2EILH 1LE8B 1IV6A 2Y9UA 1Z19A 4EGYA 4B48A 3U9GA 1WG8A 3CCRI 2CQXA 2OV7A 4QIWN 2HHQA 1DUXC 1BJZA 4QSHA 3ZQIA 4WCGA 3G6EI 5K4LA 3RJIA 3OR1C 5GTIC 2D45A 3VWBA 1E3PA 1ON1A 1RXVA 2D6FC 4RNMA 3LK9A 2XAJA 4A3JJ 4DSLA 5HLTA 1FBUA 3S3OA 1NNLA 2HBJA 5DD8A 2LYHA 3CP8A 1QLNA 3EUKL 2MFZA 1DXSA 1S0NA 5HS8A 3G1MA 5BPIA 4L0YB 2ZJAA 2RDJA 2LSOA 4NLBA 2L7MP 2VL8A 4AIKA 2JEIA 1ZD2P 1SB3C 3RYPA 3A01B 4QZHA 4F91B 3CQZJ 3JRCA 3RQ4A 2IHMA 3HOWJ 3R4KA 2DK5A 1IN5A 3BQZA 3QX7A 3HW8A 3OYEA 2R8IA 2XHKA 3T8TA 4ED2A 2WB1C 3DF8A 2P7CB 3R9KA 2WFAA 3M9AA 4DL7A 4M9LA 5A2QK 2D5VA 4NM1A 4K4GA 3WODF 1AKHA 3PFYA 1TVAA 4ESBA 2A07F 3MKZA 3JRFA 4QW9A 5ICGA 1IXSB 3T5KA 2FPLA 1MNDA 4RUCA 3SQNA 5J2DA 2KQRA 3V8KA 5K5RA 9ICRA 2BBYA 1ZQPA 2PMZA 1N75A 3LYSA 4DSFA 4RS8A 3VFZA 4D7NA 1ZG1A 4RQ6A 3GFLA 1T3QA 4O3RA 3IKVA 5J2KA 2GH1A 1LV5A 3RJFA 2EV0A 2NOGA 1LFUP 2QARB 4M6WA 2K02A 2NYXA 2P0WA 3MFKA 1X6IA 2ESEA 1TKDA 2A5WA 3TFRA 1KSPA 2IBDA 1YTYA 5IT9K 1LEBA 1UT8A 1Z3YA 3L5KA 1JX4A 5KNIA 3H9JA 1T08B 1WCLA 2F4MB 5EE9A 1HXDA 4EM2A 2P66A 4ESFA 2VQLA 2VPRA 4PFPA 4ECRA 1U47A 1UFMA 3BTLA 1VQ7I 1TL8A 4DFDA 1W5TA 1IUFA 2ZXIA 3GTOJ 2LHTA 5DTDA 4CCNA 3BPXA 1JXEA 2MLKA 3MWMA 1RQLA 3RCOA 4RQ7A 4NLKA 3WK5A 3KLNA 2JK3A 4C8NA 2Y0SA 4B9LA 5ALJA 3SQIA 4Q47A 2GLEA 1S7OA 1D3YA 9ICXA 4MGRA 3TP3A 3OYBA 4ABZA 3OYNA 2FLNA 2JRZA 3HX0A 3CCQI 2TRTA 4GFBA 5J47A 2NV3A 5KFKA 3JPOA 2ASDA 3BJ6A 3EETA 4UB8C 3DXJF 3M1YA 4C80A 2M8EA 3CCSI 1O7FA 1ZQLA 4PHEA 4BDZA 3HRTA 2W55A 2LKYA 3ZDCA 1YRNB 2I10A 2L9SA 5A2QZ 1VQNI 4A3DJ 5AI4A 3SFIA 4KLLA 3IRUA 4EZ9A 3G73A 1S10A 2AHQA 1QA6A 3LWMA 1Z77A 3EUHA 4BE0A 2L4MA 4EMSA 3L7WA 1PUFB 9ANTA 4XA5A 2HEOA 4U7BA 2AU0A 5HNFA 4ECTA 2K27A 2L9VA 4A3CJ 3LVWA 4ON0A 2GOXB 1MNEA 5J8YA 2HYJA 4UNOA 1MBHA 3RTVA 2DMNA 3K4NA 2Q2EB 1ZRFA 3GU3A 3HUGA 1XMKA 4MEXF 2W9BB 3ZP5A 4DF8A 3RBEA 1A6SA 2F5CA 4R1HA 4NWIA 4KMFA 4O0IA 4M73A 3CO7C 1J59A 2VODA 1RDFA 2A5YB 4KLTA 1S8NA 3CUQA 3N97B 1HKSA 5FKKA 2G0EA 2PJRB 3C5GA 3G2BA 2I6XA 2IA6A 3TKAA 3CUOA 2LYCA 3F8NA 5IT9Z 4ZDPA 1A5JA 3JPPA 3FDYA 1XGSA 2DW4A 4F93B 4IQJA 2R18A 1IDZA 4I28A 2DOEA 2L9NA 2ZUDA 4O9MA 3F72A 4Q5SF 4GYIA 2M2EA 1XC5A 1YJ9I 3KZYA 3A4CA 4BGDA 1OYWA 1I3AA 2RVCA 2ZC2A 4D7MA 4ICAA 4G9BA 2X48A 5FKNA 1IGNA 4MHVA 5KT4A 1TAMA 1MGTA 4IRIA 3MKLA 1RR7A 3ABTA 5ICFA 3O0FA 4G94A 2G9WA 1V54H 1L7OA 4NC6A 1FMWA 3TDUC 1NHAA 1QU3A 2UWMA 1SKSA 5IT3A 5LLQA 3F0CA 4HG2A 1DK3A 4AIDA 2KIMA 3WTWC 8ICVA 1IRFA 1WSUA 3DEEA 3RSNA 5DB9A 1I1SA 3S14J 1PK1B 3CCEI 4BWJA 4CCHA 3RPUA 4EEYA 3ICXA 1IO2A 9ICVA 2HTSA 2DFFA 3EZ5A 1BJAA 1QBJA 4F2SA 2QKLB 1JALA 3H4BA 5EGOA 3TDZC 2V1UA 4C8LA 4AM3A 3ISDA 4BHBA 4A3GJ 1YE9A 4MFFA 4F7ZA 5JR3A 4S05A 5IINA 3LMMA 1TWAJ 1DU0A 3LSHA 4EJTA 3LWLA 4F5RA 2K9SA 2WAQC 3DTKA 1OR7C 2W54A 1ERDA 1S9FA 1YJWI 2VC0A 3JR9A 3SV3A 3JAMK 3J80K 4LIVA 4BYYA 2NS8A 3I53A 1HF0A 5ALOA 2ZB9A 1ORKA 3QQAA 3N05A 1JJ6C 2EFOA 2BCRA 3CCMI 2EIJH 1Z9CA 4RM3A 5B1AH 3RAXA 1SD5A 3AL0B 1SXDA 2VJ5A 3JCUC 3HOYJ 5D4SA 1MH3A 2V1NA 2HBLA 1Z05A 2XI9A 3L00A 1YZ6A 2K89A 4X5VA 2V1XA 3OHBA 1Y39A 9ICEA 5F0CA 4Q4ZF 4D5CA 4J9KA 2ZO4A 3KFUF 5JVTA 3L1PA 1NZPA 2P6TA 1ZRNA 3VYUB 1YI2I 2A3SA 4JX5A 3MR5A 2MUTB 5M3FJ 4OJ5A 4ESJA 3CCJI 5IYBJ 2L01A 2R7QA 2WWYA 3JRHA 3WTZA 1IZ1A 4N9HA 2O61A 2FMSA 1NH3A 4YR3A 3QWLA 1K6OA 2LNBA 1Z3EB 2R7SA 3H40A 2G0AA 1VQMI 4KLDA 3J81K 2DDBA 4C8MA 1GHCA 3SYZA 1Q3VA 2PXIA 3HPOA 5LHHA 4B4CA 1ZQVA 5FJ8J 3BPVA 2ZIVA 5C44J 4G7ZF 4N4NB 2CUJA 2JZBA 5KT5A 2CU7A 1IG7A 2GOLA 1D5YA 2HHWA 3ZXSA 1EH7A 2QB1A 2EINH 2MRLA 5ALFA 3OYLA 3PX4A 2GZWA 2VKHA 3K0LA 1M1EB 4N4OB 2QA4I 1Z1BA 2K8AA 1ZQFA 4L18B 3DPUA 5J0SA 2ELKA 3JAMZ 5JHUA 3J80Z 2E35A 1Z00A 3OSFA 3BG7A 1QSSA 3W6VA 4AIHA 1XO1A 4KX3A 2LC2A 5J8FA 2DBYA 4BBSJ 5AI6A 3LAJA 4YFKA 1SD7A 8ICQA 2CFXA 4II3A 1IM4A 2QSFX 5KG3A 5FROA 1BR4A 2KICA 1ZQBA 1U9OA 1TT0A 4BEHA 5FRMA 3F5EA 1X2IA 4OAZA 3REOA 1FPQA 4LLGF 3FWEA 1R58A 1R7JA 1D5VA 2LREA 1P7IA 2PI0A 2FPMA 2Y75A 2QKMB 2RREA 3SENA 4UBCA 1HKTA 4BJ5C 2L5QA 1UZCA 4DQRA 4A6EA 1OCTC 5KT6A 3I1YA 2IXSA 1Y56A 4UUTA 2K4PA 5ALZA 5F9LA 1Z91A 5DCMA 1V85A 2QLZA 3WKEA 3GXOA 1SV4A 4PGHA 5KT3A 3C28A 3RB6A 4R65A 4MO7A 4XKWA 1R5HA 5ALNA 1SXEA 1UPHA 2H3QA 1ETXA 3V7RA 1EJ9A 2IHNA 4ENNA 4M04A 1SZPA 3OY9A 3KP6A 1KONA 3MN2A 3I71A 3J81Z 2E7WA 3BT9A 4E7KA 3TOAA 2OXOA 2XCAA 5F0HA 5LGTA 5ALHA 3OS2A 4DNCA 2R8GA 4I2BA 4WK8F 1CUKA 4M0AA 1Y88A 5KL1B 3BG9A 3WG9A 3MR3A 3OL3A 2OTLI 4D5FA 3NVWA 2E1EA 2HVSA 4DQSA 4BU2A 1HDPA 4PJLA 2JMWA 5FFXA 4EJVA 3AEVA 3NVYA 3PW4A 4YXMA 3EUAA 4EV0A 2UXNA 2EJRA 4XKBA 1ZGJA 1XDUA 2ZNZA 2RDPA 4XSZF 1GT0C 3RJGA 2FMLA 4EJWA 5AHXA 2O7OA 2KN7A 1NK7A 2GA1A 2B0CA 5KG2A 1JT6A 2CW7A 2JRMA 1OMIA 5BOXA 2EZXA 5ALTA 3ABLH 4G3IA 4C4RA 1VQ5I 4QZCA 3TFSA 2DPJA 1WJAA 4NNJA 2FJ1A 4G6DA 2DA7A 2I5UA 5D6FA 3ERED 5HNKA 3GZ6A 2B7EA 4UBBA 4DBRA 3E97A 5LFAA 1RUNA 7ICFA 3L4PA 9ICCA 2BW3B 2HSZA 1YS7A 3IL2A 3L2RA 4B1RA 1LDJA 2H6CA 2HVQA 2XPVA 4I98B 3H3VK 1N56A 4HBLA 4FS2A 9ICGA 3IN5A 1FTTA 2QVOA 3FXUA 3RKQA 2KRCA 4XLCA 5FKOA 2BCVA 5EYRA 2DA6A 3QUQA 4R8UA 3CP2A 3C1ZA 5EWEA 3Q8KA 9ICQA 2FEZA 2DMUA 2GXBA 3K70C 2F44A 4IJAA 3ZDAA 1ZQAA 2K8BB 4E7JA 3PSFA 3SZGA 5GTHU 5J2GA 4ZDOA 2HFHA 4DOAA 2K3FA 3OJSA 1U49A 4CYDA 2WB1N 1TC3C 4EM1A 1I1GA 2IBKA 2DGZA 5BS6A 2DT7B 3IP4B 4J9SA 1MDMA 1SMYF 1EH6A 2L0KA 3I9V2 2E34A 3IH3A 5IOZA 2VQGA 3S6JA 4YR0A 4P4PA 1RYSA 3ZQHA 2BY0A 1A76A 3I56I 4BHPA 1KA8A 5LGNA 5HR6A 3DLAA 5JI6A 3LSGA 3VSLA 1WWUA 2KISA 1W7PA 3QEBZ 1A31A 5AKKA 2XGQA 1X9SA 3E0JB 3FF5A 2JWTA 3BWGA 1MMSA 4FT8A 4O5CA 3WTUC 1ITYA 1Q1HA 1GXQA 1L8OA 1ZD5A 5ALYA 3FK6A 1LVKA 5J2FA 1RZ4A 2DA1A 4HYEA 2LRDA 4V2GA 4E4HA 5HS9A 3V7CA 2DT6A 3BG5A 1B72A 1NK2P 3TKYA 3MKYB 2UZKA 3A0BU 4BWMA 2ASLA 2F5DA 2X85A 1SAXA 2MD0A 2A1JB 3GDXA 4A3LJ 3ZD9A 8ICUA 4CCMA 1F9NA 4JB3A 5KFDA 5EWGA 1COKA 1Y0UA 4Y33A 2FRHA 2CH0A 3CC2I 1GVDA 1MMAA 5K5OA 4J9OA 4DSJA 1SEUA 4A8EA 3HKZN 4RAZA 2E8PA 1D9DA 4U6PA 4DOZA 4HX7A 4RNOA 2W84A 2E1MC 4E7HA 3OYFA 3QOEA 1LFBA 3O3KA 1X2MA 1SFOJ 4M9JA 2P5LC 3ABMH 4PSXA 1AU7A 4HV6A 2MC4A 3CCVI 2R0QC 1ETKA 2W8LA 4DO9A 1QPMA 8ICNA 1FP1D 5KAFU 4UB5A 1T0FA 3HKZA 3N28A 4DEZA 5KT2A 1PVRA 4HOBA 4GXIA 2E5ZA 2VE8A 4ZYAA 4C9YA 4A12A 3DV8A 3GV7B 3V6KA 5FLVA 5B66U 4E7ZA 2Z7JA 1WH5A 5IYCJ 3PQKA 4BQAA 4QWCA 4M71A 3ABKH 1HJPA 1F0MA 4YXJA 2CUEA 3GVAA 3GTJJ 2KKPA 5J2AA 1A6IA 5D5XB 2GWRA 3CLQA 2ECBA 3HWTA 5AK3A 4IHYA 3BS5A 4Q43A 2Q4TA 3OIQA 3FXOA 4BBRJ 4FZLA 4GXOA 5ILSA 2I1QA 1B43A 2Y1JA 1X42A 1MD0A 2XVTA 4OIQF 2KZMA 4WXDA 3KIOA 5DUKA 2J6SA 2O0YA 3OSGA 1N78A 3TAQA 2VKEA 2HNHA 2GO7A 2XB0X 4B6JA 8ICFA 1F5SA 2HOSA 3TANA 4Y3OA 4XICA 1UAAA 4UATA 2WTEA 2XRNA 3DBHB 2KT0A 4F92B 5CP2A 2P81A 4BY1J 5HVQC 4MF2A 7ICPA 2LLKA 1YX3A 5EE0A 4UB1A 2UXXA 1K4TA 3KHGA 4DYQA 4BDYA 1PK3A 3LWFA 4OJPA 4C4SA 3MD2A 2KKVA 4NJ8A 3B6AA 3LA3A 4ZDLA 2E8OA 4GC7A 1ZQTA 3RH6A 2MSNA 4KLGA 2XAQA 3TADC 3NWSA 1NK3P 2ELHA 5L1MA 2CPRA 2EIKH 3HM5A 1MIJA 5KFGA 1LVHA 1Z6RA 1SFKA 4ENJA 4P55A 4A3IJ 1FIQA 1X9XA 5DGAA 2OWOA 5CHGA 2X6OA 3ABUA 4P1WA 1AA7A 1YIOA 5BNGA 5J0TA 3RBDA 4MNUA 4KX5A 2IP2A 2BEOA 4Y2RA 1FC3A 3LDAA 3Q9SA 1JUDA 2ICWG 2D1HA 4FX0A 3OJUA 1ZG3A 2WC2A 3RDIA 1ZQUA 2KE7A 4F52A 3V72A 2KJCA 2BQUA 3VPRA 3WGIA 4XRHA 2ZCWA 1TBXA 1B59A 1UG0A 3OSPA 1ZQGA 2XRLA 4I29A 2EFWA 1DP3A 2HXIA 4I2IA 3ESWB 1RYRA 1IN7A 2Y2ZA 3QP5A 4CXFA 2JA6J 1T98A 2DPDA 5KFSA 4C7ZA 1VQ9I 9ICTA 4K4HA 1DPRA 2W4SA 1CI4A 5KFQA 3DU6A 1WUDA 2M87A 4KN4A 1ETVA 5KK1A 5K7FA 4YFNF 1T94A 2BCUA 1QO0D 4MQ9F 2X51A 2DMPA 2BCSA 3KTQA 4KLOA 1SVOA 3E6DA 2IOHA 5ALSA 1U5TC 5ALUA 3R61A 3M8JA 5J6XA 3KOOA 2OD5A 3NGDA 4C8KA 4IRHA 3SDBA 1Z0XA 1JTYA 1ZRMA 3NVVA 3ZQLA 4NV0A 2V9VA 3FK7A 5E1WA 2AO9A 3BZKA 4GLXA 2B9SA 1U48A 2K4EA 3QYBA 5JU5A 4IXAA 2GIVA 1WJCA 5AKGA 4ZYHA 2XSDC 1USTA 1ZJMA 3M07A 3OPXA 3QYFA 4C7YA 3PX6A 1ULYA 3V6JA 4RQ8A 4UAZA 4P9UA 3WGGA 1S7AA 4IS7A 2CRGA 2W8KA 2HZDA 3KCCA 3WU0A 4ECWA 1KBUA 5CVUA 4J9LA 4ECQA 2FOWA 4C8OA 3VSKA 4G6TB 1TQIA 2KZVA 3DPTA 3KEQA 4JQFA 2W3RA 2YQEA 1BPYA 3TBIA 4M9NA 1O4XA 3OYCA 4DSKA 2XKPA 4NC8A 3BJYA 1BBYA 1ZYQA 5AONA 1BOAA 4E70A 4UB3A 4KLEA 7ICUA 3JREA 4YN4A 3RR8A 1GVJA 2V7FA 4DZJA 1I6HJ 3F2BA 1L5UA 2V6EA 4KMOB 3TQ1A 3KKAA 3L2QA 5KFYA 4U88A 1ZHFA 1KQ9A 1UJ8A 2QQ8A 3W2VA 4BJTA 3OYJA 4A2UA 3LAPA 3ZMSA 1KLNA 2O8KA 2COBA 3I3LA 2XB5A 1ZXIA 3RB3A 4LLNA 3QUBA 3JTHA 2BHYA 3HSRA 3IM1A 3HP6A 1STZA 4LK0F 3JRDA 1FWZA 8ICPA 2ID6A 3DU5A 4XLEA 2MAXA 3M9OB 1YZ7A 4CCLA 1K61A 3PO5A 1JN3A 2AQ0A 5ILVA 3DWLE 3C23A 1J9IA 5M3MJ 4A0XA 4ECVA 5M5WJ 2M4KA 1WJDA 2BXZA 1LDDA 1VNDA 5B66C 1TZLA 1PDNC 5J0RA 1FYLA 4KLMA 4LITA 4P0QB 4BE2A 1OYIA 4HW0A 3SAHA 1YFHA 1OCCH 5DCFA 1VQ4I 5GP9A 3FM3A 1IN8A 4B9TA 2JA8J 3CNHA 4QPQA 4CYCB 4RPZA 1B9NA 3PW5A 3K75D 2JR5A 4RUAA 2FU4A 2BZFA 8ICIA 2CSOA 1KGSA 1SGGA 4C4TA 1WH7A 1VQOI 1IXRA 2H8WA 1SFXA 1IN4A 3IHUA 5HMLA 3T79A 3QODA 5KFHA 3P5JA 1R22A 1H8AC 1RG6A 3MZYA 1XG1A 2HYGD 2F1HA 2MYSA 1YHQI 1R1TA 2BVMA
chains in the Genus database with same CATH topology
4CCNA 3RCOA 2K5CA 2IS1A 2XAUA 2HQAA 2Y0SA 1D0YA 3SQIA 4PL1A 2BDUA 3OYBA 2KEYA 2G5HB 3OYNA 3K4MA 2Y0SC 3L3FX 1G8XA 2VKQA 4BL0B 2NV3A 4DBQA 1D8BA 3DTEA 5FRNA 2W7PA 2CFOA 2VXZA 2KHMA 3IAM2 3NUQA 3GBGA 4BDZA 2H3ZA 2LKYA 2KHVA 2OM6A 3RF9A 2L9SA 2CW8A 3HUGB 4XLFA 2ZXHA 4PSWA 3CZ6A 2V26A 4HNTA 1Q3UA 4BE0A 4U7BA 2RHFA 5HNFA 2F6CA 4PK4A 3FBNB 3LVWA 2GOXB 1MNEA 4E7IA 3EUHC 3ZCOA 5CQEA 3K4NA 3GU3A 2Q2EB 2WAQF 3F2DA 4OJLA 1X4OA 3K4LA 3D5RC 1A6SA 4NWIA 1D1CA 4HRIA 2YX8A 2MA1A 4XNFA 3H35A 4ITVA 1D1BA 1J09A 2XDVA 2PJRB 3QYEA 3G2BA 2XF7A 3LL7A 4RLFA 4CSWA 4XOTA 2LYCA 4ZDPA 3CESA 3FDYA 4IKFA 4F93B 4IQJA 2R18A 4OJOA 2L9NA 1E0EA 1FMVA 4PJJA 4PL2A 2CRXA 1LDKB 2OUMA 4C2UA 5JHFA 3D5SC 3A4CA 4BGDA 2DF4B 3HG9A 4D9JA 2CMPA 2JSPA 3W2WA 4BQNA 4CUGA 3A2KA 4ICAA 1IRXA 1TAMA 2M3AA 2LG4A 3M6ZA 1Z7LA 4CGZA 3O0FA 2UUZA 1FMWA 2M0MA 1QU3A 2UWMA 3SEQA 4HG2A 2JVGA 3DQVC 3D2QA 1LKXA 2CS3A 5KNLA 3DEEA 4YELA 3RSNA 2M7BA 2K9MA 5KCMA 2XF5A 1U0JA 1D0ZA 2LYBA 3ICXA 1P7DA 4IQ4A 3MMYB 4HPQA 2ELJA 4ZJZA 1DQUA 3OIPA 4CZCA 2QKLB 2W03A 3LSIA 3MGVA 3BC8A 2XICA 2KJ9A 3J7AY 2WAQA 4KISA 2IS6A 2KD1A 3PNVA 1YE9A 1W36D 4H4KC 4XLAA 2MABA 3OS0A 2IGNA 3LMMA 2JVHA 3LSHA 3K10A 2WAQC 2JA2A 3DTKA 1OR7C 3CJQB 1ERDA 1MMNA 2R7UA 2WY7Q 5CQGA 4HSRA 2WADA 4QIWC 4LIVA 2N1RA 3C2HA 2WAEA 3PUBA 4NC7A 4XN0A 4DJAA 2ZIXA 3N05A 2K4IA 2KPMA 2BW3A 4ZTFA 2F77X 2XC7A 5HNHA 3VC8A 4RM3A 1ZELA 3F2CA 3VYSB 3AL0B 3M7DA 2VJ5A 4FZNA 2HBLA 2XI9A 2V1NA 5TGTA 1XO0A 4AVZA 2KJ5A 2ZSHB 3H5AA 2DCEA 2O5RA 3ZQQA 3L2VA 2K89A 4ACOA 4XQFA 4C0ZA 2BVLA 4OAYA 2KNJA 3KFUF 1EA3A 3PSPA 2W7NA 3S3MA 3CRXA 2ZSIB 2R7OA 3VYUB 2DOAA 1X1AA 2FUG2 2HU9A 1IIPA 2VLAA 4OJ5A 2F2AB 2ZIVB 3AL0C 2R7QA 4BXFA 3CYMA 1ED1A 2RQQA 3HOTA 1NZBA 2OC6A 1VZ0A 1PVPA 1X4PA 1OLTA 2Z2SB 2R7SA 3SAGA 2G0AA 1Q3VA 4HEA2 3RPUD 2ZIVA 1D1AA 4B47A 1ECWA 4N4NB 2CUJA 4DGWB 3UR3C 2GOLA 3F53A 2HPMA 3ZXSA 3AKZA 2K9LA 2MRLA 3OYLA 3MKWB 2VKHA 2WBMA 2Z1DA 3M1CA 4N4OB 1JI8A 1Z1BA 1X19A 2K8AA 3KYLA 3BLYA 3DPUA 4KT6A 2HVRA 2G09A 3E0FA 2JH7A 2KOBA 3BG7A 2V9KA 4C2TA 4KX3A 2XF6A 2LC2A 2VASA 2VXDA 3HC7A 2CV2A 4BS9A 4II3A 2W00A 2YB4A 3H0RB 5HR7A 3LSMA 2XSJC 3PZPA 5FROA 1BR4A 2KICA 4BEHA 1TT0A 4XMYA 5FRMA 3F5EA 3CF2A 4OAZA 3W3CA 3LFUA 1XNSA 4XN3A 2KLOA 3FKJA 3K6GA 2OH2A 2LREA 3OS1A 4KITB 2F5VA 2QKMB 2RREA 1MMDA 4BJ5C 2L5QA 4E7SA 4B43A 2H3IA 2WAFA 1X1CA 2IXSA 1Y56A 4D1QA 2L2OA 3GZFA 1ZQ1C 3C28A 3UNGC 4XKWA 4IZZA 1UPHA 2H3QA 2VKDA 4ZC3A 1CRXA 3OY9A 1X1DA 4NQWB 1KONA 4U87A 4E7KA 2OXOA 3SEZA 1D0XA 1S9HA 3SAFA 2W7OA 1WFXA 1WJ5A 3ZR8X 2Z16A 3OS2A 4U7CA 2RNGA 4BJ6C 3L2UA 5KL1B 2LY1A 3OL3A 3LVVA 2E1EA 2HVSA 2G07A 4BU2A 4PJLA 2ZFUA 2H3FA 2HMXA 3EUAA 1UELB 2JH1A 1YT3A 4II2A 4GFJA 2RRDA 4XKCA 4XKBA 2VIXA 2W04A 2M0NA 3K4CA 3OYIA 4F3QA 3OYGA 2WB1F 1G59A 2JUGA 3D5LA 2CW7A 1P9QC 4P0PA 2LY2A 2VPLA 2E60A 2KHQA 3KX2A 1WJAA 4NNJA 4XORA 4Y4RA 4YEJA 4DIQA 3N7SC 4WJ3B 1T95A 2W1OA 1BOBA 4B44A 3VYRB 4DBRA 5LFAA 3H5NA 3IG5A 2ZIXB 1A0PA 2BW3B 1WJFA 3OYDA 2GOMA 3L2RA 3H0MB 3H9QA 2HVQA 3DKXA 2KDOA 2ZIUB 3IN5A 4IC9A 2LH9A 3VCBA 2KRCA 4XLCA 4BACA 2PMZF 3W2AA 5LD2C 3CP2A 2VJIA 3K4JA 4AYBF 3K70C 1OUQA 3VDXA 2L7KA 2K8BB 4E7JA 3PSFA 4XM3A 3SZGA 4ZDOA 4CA0A 4CCOA 5KL8B 2ZIUA 4XR6A 2R7XA 1V5FA 2X6XA 2LBOA 2UV1A 2DGZA 3HKZF 2DT7B 2HBKA 3IP4B 2KMUA 1QHGA 3I9V2 4BQQA 1DRGA 1SZHA 2VQGA 3TMOA 3E1SA 2IS4A 2R7TA 3ONNA 2LYAA 2G06A 3BCBA 3HL2A 5HR6A 3DLAA 3LSGA 5CKTA 3VSLA 2VQHA 2Y0SF 4YRVA 1Z3XA 3C2GA 3RTRA 2WY8Q 3K4KA 4QNLA 2KVCA 1BR2A 3E0JB 4CH7A 3FBIB 3TL4X 4C30A 1F44A 5CPRB 2E1MB 3H9GA 2HDWA 1LVKA 4RMNA 4XONA 2LRDA 4E4HA 3ONQA 4JMUA 2DT6A 2K3PA 3MKYB 3DKYA 4BE1A 2X85A 2X1EA 1HA8A 2MD0A 2IGMA 2R7RA 4J01A 3D2SA 4CCMA 2H3VA 2CUZA 4Y33A 1URJA 2CH0A 1MMAA 1DGRM 4BJQA 4BUGA 5C0YA 3K1ZA 4EATA 3AQFA 4A8EA 3PNTA 4U6PA 4DOZA 4AYBA 3HOSA 2G08A 2E1MC 2K8CB 3AQEA 4E7HA 2VQCA 2F4IA 3QOEA 3OYFA 3K70D 3KZXA 3M6KA 4BEHB 2KL4A 3F9KA 4PSXA 2DXIA 4AYBC 2MC4A 2IS2A 2X1CA 4PJNA 4BQOA 1NG7A 3IUOA 3HKZA 2W82A 4F55A 2DQNB 1MMGA 1WJEA 2M4GA 3LSKA 3NWTA 4XLHA 3RFAA 1PVRA 2E5ZA 4ZYAA 4C9YA 1NG6A 1X1BA 4QPOA 4QJFB 2G5IB 1T0FC 3EPZA 4E7ZA 2Z7JA 3HKZC 1V5GA 4BUPA 1V5EA 2WA0A 2KKPA 2KV2A 5KHDA 3S32A 4R79A 2Q4TA 3OIQA 1YX5A 4X0GA 5T14A 4FZLA 3ZRGA 2KRHA 3N7PD 2F8LA 2XVTA 4ANJA 1LFPA 1N78A 2CN1A 2HNHA 4JOMA 1L6NA 2X6YA 3IAS2 3FHNA 3H0LB 4Y3OA 1UAAA 5A0LA 2I8DA 3OOUA 4F92B 2XIDA 3SMVA 5HVQC 4NUBA 1YX3A 2BOLA 2OYYA 2KJ8A 2CV0A 4BDYA 3L2WA 4FZMA 4OJPA 3MD2A 2X6WA 2KKVA 4ZDLA 3OYMA 2RP5A 3F5AA 1MA7A 2VB6A 3BCAA 3NWSA 3S8PA 3U21A 2CV1A 1K6YA 2CPRA 3IG8A 2JMGA 2D6FC 2NOJB 4FASD 1SFKA 1W36C 3HXLA 4P0QA 4P0PB 4OO1J 1N77A 4P1WA 1AA7A 4QIWF 1PVQA 4O3MA 3OWTA 4KX5A 4FE3A 1Z21A 3BG6A 1HIWA 3N7RC 2VJJA 3K4BA 1HEKA 3CMMA 4F52A 2E5SA 5HOOA 3A1YA 4P5OA 1UG0A 4CDGA 1DP3A 2KIWA 1PJRA 2ZG6A 2AQFA 3OL4A 4LG3A 2LBFB 4XL9A 4LIUA 1SAUA 2W4SA 3OYHA 4BX9C 4J00A 3DU6A 2IGOA 1WUDA 1MW7A 1BR1A 2R4GA 2PJRA 1T94A 4OWRB 2X51A 2F76X 2X1DA 2R7WA 1PYVA 2LBFA 2A6TA 3M8JA 2LOOA 4HSTA 3SDBA 1Z19A 4NV0A 4B48A 3OYKA 2ZIWB 2K4EA 3QYBA 2YB1A 3ZGKA 1WJCA 2OV7A 1GO3F 4NLCA 4FETA 4HNUA 3OPXA 3QYFA 3S93A 4IX7A 1R6RA 3OR1C 3HPHA 3VWBA 2HOFA 4B3XA 2IGKA 3OMYA 3V42A 2HZDA 3PNYA 4MLOA 4RM2A 5HLTA 3S3NA 3S3OA 2HBJA 1KBUA 3CP8A 4PJMA 4PFOA 3VSKA 4G6TB 4CCKA 2KZVA 2MFZA 3DPTA 3EUKL 4JQFA 2ZIWA 3TBIA 3OYCA 4NC8A 4NLBA 2VL8A 4PUSA 2R7VA 2Q1ZB 3DTIA 2V7FA 3F2BA 4F91B 2WB1A 3D2NA 3RQ4A 3CJRB 2V6EA 2K4HA 4KMOB 4XOPA 4XKVA 3L2QA 3ALRA 3VYTB 4ZTJA 3W2VA 4BJTA 3OYJA 3OYEA 4GRIA 2AQEA 3I3LA 2DJIA 2WB1C 3H5RA 3OYAA 3PFYA 2E1FA 1DGWY 3DU5A 4XLEA 3MKZA 3PL8A 4CCLA 5CRXA 2HBMA 2JHDA 3PSIA 4CCJA 3DWLE 3HPGA 3PJRA 2V4JC 2VJ4A 4AU7A 1MNDA 3PSTA 2M4KA 1WJDA 1QHHD 4CRXA 2KQRA 1TZLA 2HPIA 3AFHA 2JGAA 2PMZA 1N75A 4LITA 3LYSA 4P0QB 4BE2A 2KP6A 4OJ6A 3SAHA 2GH1A 4KJZA 1GLNA 2M7AA 2PMZC 4QPQA 2P0WA 2A5WA 4E6KG 3NRWA 4RLQA 1Y6IA 2A3VA 1Z3YA 3DPLC 2E5NA 3H9JA 3SYTA 4E7LA 2HOIA 3OR2C 3H0DA 3C29A 3T79A 2HOQA 3QODA 2VQLA 4PFPA 1WJBA 2MYSA 2ZXIA 3KEYA 2BVMA 2LHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEE A; 
#chains in the Genus database with same CATH topology
 1XD7 A;  9ICH A;  3G6Y A;  3E5Q A;  3RQI A;  2K5C A;  3PFI A;  2EDU A;  3K9T A;  2HHX A;  1D0Y A;  5AKH A;  2A19 A;  1FNN A;  2BV6 A;  3U1K A;  4DL3 A;  2BDU A;  3C1Y A;  7ICK A;  1EXN A;  1YOV B;  4HF0 A;  3AG3 H;  2KEY A;  2YU9 J;  3WTX C;  5C3E J;  3K4M A;  2JRT A;  2G5H B;  1BIB A;  3Q0U A;  4JYK A;  3L3F X;  3SD7 A;  4HX8 A;  5KFR A;  2BYV E;  1YYV A;  2EZH A;  1E2X A;  1W7P D;  2D1V A;  3CJT B;  3DTE A;  4DLE A;  2MH2 A;  2KHM A;  2VXZ A;  4B9N A;  5E3L A;  1ZQ3 P;  1BC8 C;  8ICM A;  2LMD A;  1RR8 C;  2KHV A;  2MA3 A;  4MF8 A;  2AGP A;  1BI0 A;  5E17 F;  1J7K A;  1O7L A;  3HUG B;  1JI7 A;  5TIS U;  3LFK A;  3CZ6 A;  2V26 A;  4HNT A;  2LP0 A;  1XB4 A;  4I2O A;  1Q3U A;  4HYK A;  4MQV A;  5HOD A;  3CUQ B;  3RRH A;  4FS1 A;  4ECY A;  1BIA A;  5J2C A;  1KRP A;  5CQE A;  4GYG A;  5H20 A;  2WAQ F;  2K7L A;  4DL5 A;  7ICG A;  5FD5 A;  1GV5 A;  1YW7 A;  2YX8 A;  5AKY A;  3ASO H;  4S0H B;  4XNF A;  4ITV A;  4EGZ A;  1XSD A;  1J09 A;  2XDV A;  1G4D A;  1TFR A;  3FAH A;  4YD1 A;  4F4Y A;  4DS5 A;  2W9C B;  2WF8 A;  8ICH A;  3C1D A;  2KSO A;  2XF7 A;  4UB6 U;  1U5T B;  7ICS A;  4LMY A;  2LKS A;  4XOT A;  4G7H F;  3N4M A;  1ZR2 A;  5J0O A;  3CES A;  4OJO A;  1MJ9 A;  2K9N A;  3PO4 A;  1IN6 A;  1ZQD A;  1E0E A;  3SZT A;  4PJJ A;  2QZ8 A;  1FYK A;  1JHF A;  1I50 J;  2HTJ A;  4A0Y A;  2LM1 A;  4PL2 A;  3CC4 I;  5IIJ A;  5CWR A;  4PPX A;  1XCV A;  2LY9 A;  1K78 B;  1WI9 A;  2CMP A;  2ISO A;  3HOU J;  1POG A;  4BQN A;  4IR9 A;  3FXK A;  2STW A;  1FOK A;  2YU3 A;  2RQP A;  1AWC A;  2ZME C;  3QRF F;  3M6Z A;  7ICE A;  2UUZ A;  4RAF A;  3IRQ A;  5KFL A;  5EGO B;  1YW8 A;  5J0P A;  3QEA Z;  1SFU A;  5DBA A;  5FGM A;  4OIP F;  1U45 A;  1JXL A;  3DQV C;  4DWI A;  1KU7 A;  4DYR A;  3D2Q A;  1LKY A;  9ICK A;  1OFC X;  2M7B A;  2K9M A;  5J2H A;  1D0Z A;  1AOY A;  4B9V A;  4KLQ A;  4JBA A;  1P7D A;  3I28 A;  5ICC A;  2OPT A;  4ZJZ A;  2I5H A;  3MQ0 A;  2PN6 A;  3MGV A;  3KBB A;  2E2J J;  3C2K A;  3AAF A;  3J7A Y;  2CUF A;  1PP7 U;  4KIS A;  3UKG A;  3H8M A;  1W36 D;  2ZKZ A;  4XLA A;  4GXJ A;  3PY8 A;  4BXO B;  2IGN A;  9ICJ A;  4MTE A;  2JVH A;  2OCE A;  3K10 A;  3TW6 A;  4X6A J;  3WK7 A;  1TP4 A;  2EAO A;  2DPI A;  4L9N A;  1KDH A;  3CC7 I;  1E17 A;  3RKW A;  2WAD A;  4GIB A;  3WK6 A;  2TDX A;  5D8L B;  3C2H A;  2WAE A;  3PUB A;  5J4V A;  2CQQ A;  3S1R J;  3Q5F A;  1USS A;  3FMQ A;  4DJA A;  4Q48 A;  5ALW A;  4CF3 A;  2F77 X;  2XC7 A;  5HNH A;  2DT5 A;  5LGU A;  3VC8 A;  1ZEL A;  1K79 A;  1QPI A;  1Z1V A;  3QNM A;  4F50 A;  5J2B A;  2IA2 A;  2ZUB A;  4FBT A;  4AVZ A;  2VOO A;  5ALR A;  2W25 A;  3V4G A;  4RQ2 A;  2EZY A;  1ZJN A;  4F2R A;  3ZQQ A;  4YIR X;  2VA3 A;  2QGU A;  1ZR4 A;  3F23 A;  4XQF A;  3QU7 A;  4ACO A;  2R8K A;  5KFM A;  4M9H A;  2BVL A;  4OAY A;  2KNJ A;  2LR8 A;  3PSP A;  1BA5 A;  4EBD A;  4QZI A;  2E8N A;  1S7E A;  1JMS A;  3IV6 A;  4TUR A;  2R7O A;  4ZH4 F;  4PZO A;  3IH4 A;  3W6J B;  2KVS A;  2DOA A;  4HQE A;  2Z9O A;  1X1A A;  5DBC A;  1IIP A;  2IJL A;  2PQ8 A;  2W9A A;  4LK1 F;  2ZIV B;  3AG1 H;  3HGY A;  1L3U A;  3AL0 C;  4KLS A;  2JZB B;  2WHE A;  4HAI A;  1HW1 A;  1CF7 A;  1NZB A;  4RQ5 A;  2OC6 A;  2IOF A;  1YIJ I;  1X4P A;  2LF8 A;  2L7F P;  3E3V A;  3WKD A;  3SAG A;  3S1N J;  2M1B A;  7ICO A;  3VEP A;  1X58 A;  2V4R A;  2YX4 A;  4KN7 A;  2E71 A;  1ZQX A;  4B47 A;  2HHS A;  3H8J A;  1Z00 B;  3HJE A;  4KLU A;  5EEG A;  2WTF A;  5AM0 A;  2R7Z J;  2DI3 A;  2HDC A;  3AKZ A;  2EH9 A;  3ORY A;  2UVU A;  3Q3S A;  2BPC A;  4CF4 A;  4I2E A;  2WBM A;  3MCZ A;  2RDI A;  8ICJ A;  1JI8 A;  4IHW A;  1BM9 A;  1X19 A;  1HOM A;  4IRC A;  3S1M J;  1BPZ A;  4IQT A;  4W1U A;  2ESN A;  5AI0 A;  3PQJ A;  3E0F A;  4JK1 A;  3R6S A;  2QSG X;  2JH7 A;  3U2R A;  2L4A A;  2L5Y A;  4RPY A;  4RA2 A;  2MSY A;  2ZTE A;  2W57 A;  2V9K A;  3BY6 A;  2R92 J;  2AXT C;  2M9N A;  5D4B A;  1XGN A;  5L1J A;  3HC7 A;  1J0R A;  2PFN A;  5AIA A;  4F4K A;  5TRD A;  2MH9 A;  3SI8 A;  3QU3 A;  1BL0 A;  3H0R B;  1QZY A;  2FI1 A;  5H2F U;  3LSM A;  3BQ1 A;  5HR7 A;  3VOE A;  9ICM A;  2WF7 A;  1NTC A;  3BQY A;  2FBI A;  1SV0 C;  1L3T A;  3FKJ A;  1XC9 A;  3HHG A;  1TAQ A;  4LG0 B;  4XUS A;  1H0M A;  2C2D A;  3NAS A;  3DFG A;  8ICO A;  3R0J A;  4DL4 A;  2R93 J;  2YUS A;  1U2W A;  4B43 A;  1XMA A;  2EWN A;  1R4N B;  2HXO A;  2ZNY A;  2M34 A;  2WAF A;  5ED4 A;  3T5H A;  3NVZ A;  3I59 A;  3I4M J;  3J7Y J;  4D1Q A;  1W0U A;  1XDS A;  2L2O A;  5HP4 A;  1FYM A;  4I27 A;  1BC7 C;  2IMW P;  1TK8 A;  2QSH X;  1SVL A;  2MBF A;  4BXU A;  5KFV A;  3JPR A;  2ZME B;  2QBY A;  3UNG C;  3H8S A;  4NL9 A;  2VKD A;  3WTS C;  2LK2 A;  3BDD A;  1G6N A;  1X1D A;  2FMY A;  5LHG A;  2DQR A;  1BPX A;  1D0X A;  3SAF A;  2W7O A;  1PUZ A;  3A02 A;  1WJ5 A;  2FE3 A;  2D8C A;  4U7C A;  1PVE A;  3BQ2 A;  5E8I A;  1P4A A;  4BJ6 C;  2OTJ I;  2PI4 A;  1O3Q A;  1IRG A;  3LVV A;  3HOX J;  4QZF A;  2FX0 A;  2G07 A;  4NM2 A;  3MR2 A;  2H3F A;  2HMX A;  1RKW A;  1O3R A;  3ELK A;  2COM A;  2JH1 A;  4II2 A;  5KFB A;  7ICN A;  4Z2Y A;  4I2A A;  4Y2S A;  1R1V A;  4IO9 F;  3K4C A;  4D0P A;  2Y9Z A;  3KEO A;  2W48 A;  4ZYD A;  5J0Y A;  1N60 A;  3Q0W A;  1G59 A;  4OCZ A;  4AP9 A;  2KK0 A;  2JUG A;  3HIL A;  3KHL A;  4L0Z B;  2XKO A;  5D8K B;  1T7P A;  5EZG A;  3FXQ A;  1U4B A;  4A5M A;  4NLG A;  4MFE A;  4P0P A;  4PGY A;  4GGG A;  1SL1 A;  3KX2 A;  4XOR A;  4MFC A;  4GO1 A;  4WJ3 B;  3FIW A;  1LB2 A;  4M3B A;  1BOB A;  2L54 A;  4B44 A;  1DOQ A;  4NXZ A;  1MBE A;  2STT A;  3IG5 A;  2ZIX B;  4FHT A;  4A6D A;  4J9N A;  1ZRC A;  1VDV A;  2NAZ A;  3OYD A;  5FO5 A;  4J9M A;  1FOY A;  1LEA A;  3H9Q A;  4KFC A;  5KFN A;  1ZQH A;  1ZAR A;  4UAV A;  3WTV C;  4IC9 A;  2LH9 A;  5KFC A;  4BAC A;  4I2H A;  2PMZ F;  1MC8 A;  3U26 A;  3W2A A;  3QPS A;  3H1C A;  4P4O A;  3FM9 A;  4JX6 A;  1E3H A;  4AD9 A;  5DKW A;  2JN6 A;  4AWX B;  3KZI U;  4JUZ A;  2R5Z B;  4F71 A;  2EZI A;  3WKC A;  1OUQ A;  2L7K A;  2OF7 A;  3FC4 A;  4XM3 A;  3GCM A;  2YMQ A;  4CA0 A;  1KL9 A;  2XGD A;  3GFI A;  2H09 A;  4PHD A;  3Q8R B;  3LQR A;  5KL8 B;  4F5P A;  3Q8M A;  2J6U A;  1MBK A;  5DG7 A;  1R5I D;  2R7X A;  5LRS A;  1LE8 A;  4PJ0 U;  2Y9Y A;  2HWV A;  3EYI A;  2HVI A;  2EQY A;  9ICU A;  2HBK A;  2ISY A;  2KMU A;  2QB0 A;  3WU1 B;  2KIU A;  1X40 A;  1NJZ A;  4GC6 A;  4BQQ A;  5J1U A;  1O03 A;  1VJ5 A;  4Z6D A;  5FP0 A;  5IIK A;  3LSR A;  3E1S A;  1QZZ A;  2M0C A;  4PGG A;  2ZJ2 A;  3M7G A;  4I2D A;  3CCU I;  3BCB A;  3HL2 A;  4I01 A;  5CLS A;  3O6B B;  4NB5 A;  1B72 B;  3L2C A;  3F8M A;  2VON A;  5DGB A;  2Y0S F;  3G6X A;  4J9P A;  3C2G A;  3RTR A;  2R5Y B;  4AC0 A;  1W0T A;  3KFW X;  4RQ1 A;  3RJP A;  1L0O C;  3M8F A;  4CH7 A;  4FCY A;  3BS7 A;  3FBI B;  4NLZ A;  3WU2 C;  2KIV A;  3H9G A;  1O08 A;  4P4M A;  3RJE A;  1TLH B;  1ZLK A;  2RLT A;  4UB4 A;  4ECS A;  3A01 A;  2ESH A;  3HRU A;  5DV5 A;  3NTU A;  2IEK A;  4ETS A;  4IQW A;  2NS0 A;  3DKY A;  5AIP A;  1ETW A;  1HA8 A;  3PX0 A;  1T3N A;  2IGM A;  3QE9 Y;  3QU5 A;  1QVU A;  5IOY A;  5KFA A;  3X2Q H;  3BP8 A;  4ZYE A;  5H2F C;  2H3V A;  5ALM A;  1MBF A;  3EWA A;  2O8X A;  1ZTR A;  2ME6 A;  1ZOL A;  4BJQ A;  9ICP A;  5TZV A;  3K1Z A;  1L8L A;  1S0M A;  3FM5 A;  3NEU A;  4O3S A;  3KD3 A;  2ZXW H;  1H38 A;  2G08 A;  1XSL A;  4E0D A;  3ETL A;  2VQC A;  1BN5 A;  3K70 D;  2OAZ A;  2QWW A;  3ZQ7 A;  5ILU A;  8ICW A;  1V97 A;  2M8G X;  4OIO F;  4AYB C;  2FNA A;  4LD5 A;  4G7O F;  1X3U A;  2X1C A;  4PJN A;  2FD5 A;  2Z99 A;  1HQC A;  4FX4 A;  4A3E J;  4DFM A;  2EV6 A;  4KMU X;  1X9M A;  1Q1V A;  2Z33 A;  1MMG A;  3LSK A;  4RGS A;  3BRO A;  2DFH A;  5D49 A;  3ETR A;  1NG6 A;  1OCR H;  1X1B A;  4I76 A;  4PGQ A;  3AG4 H;  5F1R A;  3AU6 A;  2P5K A;  2QAR A;  3GTL J;  5AKI A;  4RQN A;  3IH2 A;  1Y8Q B;  3J7Z I;  2KTQ A;  3JSP A;  2FSW A;  3GF2 A;  3HDD A;  4BUP A;  2WA0 A;  1VQ8 I;  3MBY A;  1EV7 A;  2QCO A;  3RKY A;  2HZT A;  3GME A;  2FPK A;  2LFB A;  2NXN B;  1ENH A;  4A3M J;  3J81 j;  3GQC A;  1QVT A;  4X1E A;  4X0G A;  1M6Y A;  1A36 A;  4KIG A;  2XRO A;  1LVA A;  2IVM A;  4YG2 A;  8ICB A;  4F4X A;  3RRG A;  4ANJ A;  1LFP A;  2M9H A;  5F3X B;  2OEH A;  2DO7 A;  4A69 C;  2DYR H;  5FKL A;  4G6Q A;  3B73 A;  5A0L A;  2JUC A;  1JUP A;  2VUM J;  4MEY F;  4HDU A;  2DPU A;  3LQQ A;  1HW5 A;  2DOD A;  2X4H A;  4BH9 A;  3PMN A;  2ZFW A;  2YX7 A;  8ICC A;  4QWQ A;  3I55 I;  1DU6 A;  1QSY A;  5HHI A;  1MA7 A;  5ALL A;  1QRY A;  2F48 A;  3BCA A;  1NOM A;  1HBX G;  2CV1 A;  4Y2J A;  2OZ6 A;  3GEZ A;  4XRM A;  2C2R A;  2A6H F;  2Y30 A;  5DLG A;  4HV5 A;  3SDG A;  1JE8 A;  3HXL A;  1YRN A;  3PNC A;  3WKB A;  3F8B A;  1PVQ A;  5DD4 A;  3BG3 A;  1MN8 A;  2YS9 A;  2G7U A;  1Z21 A;  2O6K A;  4EBE A;  2C22 A;  2Y31 A;  4DQI A;  1T8E A;  1Y1V J;  2RKH A;  1ETO A;  4AIJ A;  3N7R C;  3NRZ A;  3TED A;  1FFV A;  1D8Y A;  3KP2 A;  2A68 F;  2XGP A;  1K83 J;  3WE3 A;  2E5S A;  3A1Y A;  1J2N A;  4M2Y A;  3H3Z A;  1VI0 A;  2Q2E A;  1WWX A;  4CDG A;  2X9D A;  1PJR A;  1UHM A;  2O03 A;  3BQT A;  1SAN A;  4LG3 A;  5ALP A;  4XL9 A;  1TWC J;  5EG0 B;  5EE1 A;  4QZ8 A;  4LIU A;  5DQH A;  3MDA A;  3OYH A;  4M6V A;  5KG0 A;  5H6Q A;  3EPI A;  4O5V A;  2NNN A;  4DZP A;  2IGO A;  2Q0O A;  4J00 A;  3GTK J;  3HSF A;  2PJR A;  1L3S A;  2HI3 A;  4OWR B;  4PJ0 C;  4I02 A;  1U9L A;  2F4O B;  4IQV A;  4MFA A;  3WK9 A;  3HZJ A;  7ICH A;  1FOW A;  2ETH A;  2X1D A;  2EIM H;  5CVJ A;  1PYV A;  3CCY A;  2LBF A;  2A6T A;  3KP3 A;  2K85 A;  2R7W A;  4J03 A;  2HVH A;  2LOO A;  3GTQ J;  3KLO A;  3NS1 A;  9ICL A;  2DTR A;  1FX7 A;  2QEN A;  4OIN F;  2NRA C;  3E6M A;  5AM5 A;  2LMR A;  3BJA A;  4EJO A;  3KYD B;  5CVR A;  3OGU A;  4B9U A;  1G3S A;  1B8I B;  3PR5 B;  1SFE A;  4NLC A;  4HNU A;  4Z6C A;  2W9M A;  8ICK A;  1R6R A;  1WGX A;  1KTQ A;  1X6J A;  1TW3 A;  2GAU A;  2P5V A;  1KW4 A;  1RNL A;  4B3X A;  1T4G A;  2FLL A;  3OMY A;  3TAP A;  4J9R A;  2ZJP F;  4MHG A;  4MLO A;  5EE3 A;  1JXS A;  3MGH A;  1TK5 A;  2FOK A;  4DCC A;  5LRR A;  4PH5 A;  2ZJQ F;  2ZIW A;  5BMZ A;  3CW2 C;  5IP7 J;  5M5Y J;  3QU4 A;  2UVW A;  3RJJ A;  1ZQE A;  5AI5 A;  4LVS A;  4IEJ A;  4U0W A;  5IP6 A;  4PUS A;  1H89 C;  2R7V A;  1LUJ B;  4QZA A;  2NVQ J;  3DTI A;  1YW9 A;  4QZB A;  4UUV A;  3B0X A;  2WB1 A;  3D2N A;  3CJR B;  2K4H A;  4XKV A;  3UXP A;  4IF4 A;  3VYT B;  3WK4 A;  4L5J A;  4UQG A;  5J4Y A;  1B4F A;  4W97 A;  2AQE A;  4M9S A;  2DJI A;  2HS5 A;  2IT0 A;  9ICO A;  1NK6 A;  3FZV A;  4CIC A;  2FA5 A;  5GPC A;  3H5R A;  3GZ5 A;  2NVX J;  4HF1 A;  2E1F A;  1DGW Y;  7ICV A;  1RC9 A;  5CRX A;  9ICB A;  2HBM A;  3PSI A;  4CCJ A;  5JLX A;  4KDP A;  4UAS A;  3QP6 A;  2V4J C;  4AU7 A;  5BOM A;  1BI1 A;  2OZU A;  3IHQ B;  1S3J A;  1QHH D;  2DBB A;  2IOF K;  4CRX A;  1JJ8 C;  1KQ8 A;  2XY7 A;  5B1B H;  1TW2 A;  1QCK A;  1TNT A;  3K1M A;  2JGA A;  2A1A A;  1IV8 A;  1ZYR F;  2KP6 A;  4OJ6 A;  1ZD4 A;  4KJZ A;  1GLN A;  3ZN0 A;  3TI0 A;  4EEK A;  4C3H J;  2OBP A;  4O3P A;  2PMZ C;  4LFU A;  4DLG A;  2HDD A;  2J6T A;  2MW8 A;  3KP5 A;  4E6K G;  3NRW A;  5F64 A;  4RLQ A;  4Q8E A;  2VBX A;  1Y6I A;  4B9M A;  3C3W A;  2XAG A;  3B02 A;  3MZH A;  2E5N A;  3CDI A;  3SYT A;  4E7L A;  2MU2 A;  2MUT A;  1V55 H;  3C29 A;  1OYY A;  2ZXJ A;  2HOQ A;  3QUC A;  1ACI A;  1MBG A;  3BDP A;  5D6E A;  4PHA A;  3OIO A;  1ODD A;  3ISP A;  3JPS A;  1FTZ A;  3GFK B;  2KFN A;  2TCT A;  3KEY A;  5ALK A;  1I6X A;  2W3S A;  4UAR A;  5AIQ A;  2JQ7 A;  1F1Z A;  2NO4 A;  3TAC B;  5JLW A;  1UT5 A;  3ZDD A;  7ICI A;  1QNT A;  2EZK A;  2AH5 A;  1P7J A;  2XAU A;  2PEX A;  1UMQ A;  1HDD C;  2GIZ A;  2ASJ A;  5IYD J;  2NRW A;  3G3Z A;  2R8H A;  3BQ0 A;  2J5O A;  2XVC A;  1FT9 A;  3H36 A;  2Y0S C;  2DWQ A;  4YVZ A;  1G8X A;  2F5E A;  2K4J A;  2VKQ A;  4BL0 B;  4UVA A;  2VBY A;  4DBQ A;  5K5Q A;  5FRN A;  3LST A;  1QGP A;  2CFO A;  2W7P A;  2NS7 A;  1A35 A;  4DL2 A;  4NLN A;  2YSR A;  7ICT A;  3RH4 A;  4IVN A;  3QZ8 A;  3FMR A;  5E79 U;  4ED6 A;  5JFR A;  1X2N A;  4XLF A;  2ZXH A;  2KDZ A;  2FQ3 A;  1S0O A;  3BR1 A;  1ARO P;  4P96 A;  5KFU A;  3RYR A;  3IRR A;  4RB2 C;  2H6B A;  4UV9 A;  1MSW D;  2RHF A;  5AKL A;  2NRX A;  3CLO A;  3HSE A;  5F04 A;  4HDV A;  2C28 A;  3WTY C;  3GO5 A;  3CMY A;  4TQS A;  4E7I A;  3WK8 A;  3EUH C;  3ZCO A;  2YN4 A;  1JKQ C;  3NAR A;  5B5E U;  4OJL A;  3CDL A;  3K4L A;  5DYM A;  5L3E A;  3BR2 A;  2KZ3 A;  3D5R C;  3H7I A;  2UVV A;  1D1C A;  5J8Y C;  3EUB 2;  2YMM A;  2R3S A;  2GXA A;  3H35 A;  1SVM A;  3G6V A;  1D1B A;  5KAI U;  3L09 A;  4G12 A;  5J3L A;  2KRF A;  4M74 A;  4UVC A;  4RB1 A;  1PZN A;  2A69 F;  4IL6 U;  4BAY A;  4C3J J;  4O3N A;  3ZDB A;  1S77 D;  4F72 A;  4Q45 A;  4F5N A;  3CUQ C;  3K1P A;  4IKF A;  4P2H A;  2VT2 A;  3GV8 B;  4P9F A;  1O57 A;  4EBC A;  2J5P A;  3HTU A;  5L1I A;  4NY8 A;  3DV9 A;  2CRX A;  2OUM A;  5GTH C;  3I4N J;  1ONV A;  5JHF A;  1UA0 A;  2WF5 A;  2KZG A;  3HG9 A;  4D9J A;  1ZLJ A;  1NKE A;  1HCR A;  1LKY B;  4A3K J;  1Z7U A;  1KEJ A;  4CUG A;  1RES A;  3CD6 I;  5J0Q A;  3BZ6 A;  1IRX A;  2W43 A;  3GW2 A;  2EA2 A;  2C2E A;  2PLY A;  3MAB A;  2LG4 A;  3RB4 A;  2G7H A;  1S0V A;  4MTD A;  3KPH A;  3DLL F;  4ZOH C;  1I27 A;  4XLN F;  2Z3Y A;  1WCN A;  4A93 J;  1UCV A;  7ICJ A;  5L3F A;  2DLL A;  1COO A;  2JVG A;  5FKM A;  4EM0 B;  1JRO A;  5ALE A;  2WAQ N;  5CJ9 A;  1Y8R B;  5KFI A;  3KHH A;  2CS3 A;  5KNL A;  2P6R A;  1SC7 A;  2RN7 A;  2B63 J;  1S5L U;  1U0J A;  3PW2 A;  5CA7 A;  5J2E A;  3F8F A;  3ZQC A;  1DPU A;  2ECC A;  3LA2 A;  4HPQ A;  2ELJ A;  3SXY A;  2C6Y A;  2HOT A;  3OIP A;  5FFZ A;  1WRJ A;  3UPQ A;  4B9S A;  2XPU A;  1WHU A;  2VBW A;  3M8E A;  3KET A;  5KVR A;  1U8B A;  1APL C;  2IA1 A;  2XIC A;  1SD4 A;  5DQG A;  2WAQ A;  5KFW A;  1OR7 A;  4H4K C;  2K86 A;  3A0B C;  2E2I J;  3MDC A;  2BKE A;  1WQ2 A;  3PM1 A;  4QWD A;  2JA2 A;  3P9K A;  1R00 A;  3CJQ B;  8ICX A;  4YFX F;  2R7U A;  1H9G A;  4M72 A;  3QPT A;  5CQG A;  4KIF A;  1H9T A;  1AKH B;  3H4D A;  1W4M A;  3QPL A;  4NC7 A;  2H94 A;  4XN0 A;  2JEG A;  4JV0 A;  4KLH A;  1ZRE A;  1AQ6 A;  2K4I A;  2RQ5 A;  2ISZ A;  3OSN A;  2KPM A;  2BW3 A;  2IA0 A;  1DP7 P;  1UHW A;  2GBY A;  4LLL A;  3PUF A;  2W24 A;  3VYS B;  4I99 C;  2BGW A;  2EK5 A;  1HSJ A;  4G9Y A;  2DTZ A;  4FZN A;  1XO0 A;  2M5W A;  2VN2 A;  1SD6 A;  1XGO A;  2O5R A;  5KAF C;  3L2V A;  2VA8 A;  5BPC A;  3RH5 A;  4IOC F;  1CF7 B;  5J0X A;  2ES6 A;  4DW6 A;  1D8K A;  3BR5 A;  4M6W B;  1CEZ A;  1ZQZ A;  5DDG A;  3S2D J;  4UAU A;  2W7N A;  2K60 A;  3ZPL A;  1NJY A;  2ZSI B;  3DP7 A;  2PG4 A;  1C20 A;  4U0V A;  1J75 A;  3WKA A;  4N0B A;  5KG1 A;  2HU9 A;  2KFD A;  1VQ6 I;  2H27 A;  2VLA A;  2CWE A;  4O5K A;  5H6R A;  2F2A B;  4TUP A;  4UVB A;  2HCF A;  2EAM A;  5GTI U;  2JTV A;  4BXF A;  1YG2 A;  3JRB A;  3HOT A;  1ED1 A;  3CYM A;  3K1R B;  1VZ0 A;  3HB9 A;  1FLI A;  1PVP A;  1OLT A;  4R8H A;  2Z2S B;  1BNO A;  3UM9 A;  1IF1 A;  1OW5 A;  1WZ2 A;  5KT7 A;  5JTI A;  1UA1 A;  3ZQF A;  5AI8 A;  1UG2 A;  3FXL A;  1BVS A;  3MC1 A;  1YO5 C;  2BPF A;  5CJ7 A;  2L7Z A;  1D1A A;  1ECW A;  2HQN A;  4Q44 A;  4JV1 A;  1Z6T A;  5E79 C;  4DGW B;  1BW6 A;  2DDA A;  3UR3 C;  1V38 A;  2CQ7 A;  2HPM A;  4YMM A;  2FBK A;  3SHF A;  2Q0Z X;  1MQ2 A;  5E18 F;  2ATL A;  4OU0 A;  4DSI A;  1HUO A;  7ICM A;  3AU2 A;  5GAH J;  3B0Y A;  4B09 A;  1RQN A;  5J1Y A;  4IHT A;  4Y2T A;  3BLY A;  3U1D A;  2VA2 A;  1B1B A;  2KIF A;  5EEA A;  4RAG A;  1H88 C;  2HVR A;  4EEL A;  4RQ3 A;  3PW7 A;  5TJJ A;  2XGX A;  2KOB A;  5DS9 A;  2XF6 A;  5CYV A;  2KFZ A;  2EH3 A;  2VAS A;  3D0S A;  3H3U A;  5ALI A;  3KHR A;  2W85 A;  5KAI C;  4BS9 A;  2YB4 A;  4HLY A;  3I59 B;  2XSJ C;  5KFX A;  3PZP A;  4U0Y A;  4UW9 A;  3CF2 A;  2HR3 A;  4QZG A;  1S8O A;  2HHV A;  2NYV A;  5ALX A;  1XNS A;  2DA4 A;  4DOB A;  2KLO A;  5D5U B;  2OH2 A;  4M9Z A;  2BY3 A;  4HNV A;  2FE9 A;  5AKE A;  1WWV A;  1FY7 A;  1F4K A;  5LHI A;  1MMD A;  2HHT A;  3FX3 A;  5E1X A;  4DSE A;  4GDF A;  3MZ8 A;  5BQT A;  5ICE A;  1TT5 B;  1Q8K A;  1N63 A;  3QPH A;  4HAM A;  5LEK A;  3GZF A;  5ALD A;  1MBJ A;  3G1L A;  4EEN A;  1FZP B;  1ZQ1 C;  1XGM A;  1IUY A;  3C18 A;  1FOX A;  3FIS A;  3DDH A;  5J0U A;  4C3I J;  1NK4 A;  2QEX I;  2NO5 A;  2DMQ A;  4KLI A;  3T0Y A;  4FTH A;  1CRX A;  5KG4 A;  1RXW A;  2FXA A;  5IPA A;  2V1D A;  1QTM A;  3ZDE A;  1WFX A;  2Z16 A;  2IW5 A;  3DEW A;  2WV0 A;  3QUT A;  1ON2 A;  4ZYG A;  2BY2 A;  1T39 A;  1U78 A;  3D6J A;  4KUM A;  2ZFU A;  1FSH A;  5KTQ A;  3V8L A;  4M6X A;  4KA4 A;  2XGC A;  1UEL B;  4NQW A;  4UB8 U;  1BI3 A;  1YT3 A;  3KP7 A;  1ETY A;  2DAO A;  2RRD A;  4TUQ A;  2EFP A;  2VIX A;  2FMP A;  3G1O A;  3OYI A;  2L3D A;  1JHH A;  4F3Q A;  4XID A;  1W5S A;  3I64 A;  1A04 A;  4LJX A;  4I0B A;  1O3T A;  3THV A;  1P9Q C;  3H0G J;  2LY2 A;  5ALQ A;  2JPB A;  3MEX A;  2VOP A;  1Y1W J;  2VPL A;  2E60 A;  2KHQ A;  2E7X A;  4M47 A;  2DL0 A;  4ELU A;  2YML A;  4Y4R A;  4DIQ A;  3N7S C;  5JRT A;  5F6F A;  3C2M A;  1T95 A;  2W1O A;  4ELV A;  2QQA A;  3PO3 J;  3HYI A;  1N61 A;  1A6Q A;  3C7J A;  4M3G A;  3E7L A;  1JRP A;  3PW0 A;  3GTM J;  3DBL B;  2LF7 A;  4YII A;  6PAX A;  1GXP A;  1L7N A;  4MEX A;  3KE2 A;  4N9I A;  1TQP A;  2QUF A;  1TWF J;  3S2W A;  3QU6 A;  3TP0 A;  4I2F A;  1WPK A;  3DKX A;  2KDO A;  3SZP A;  2BHN A;  1XU4 A;  4Y2U A;  4IRD A;  3VCB A;  5KFO A;  2RAE A;  2A61 A;  5F0F A;  4AVP A;  5F1J A;  3GYH X;  5FLX K;  5L1L A;  2D2W A;  4Y2P A;  2E36 A;  2QB0 B;  4FFD A;  2XCP A;  2LKP A;  3UXO A;  4AYB F;  4F5Q A;  1L3L A;  1X9W A;  5DEQ A;  4BXX J;  2FJ6 A;  4RT3 A;  4ENM A;  3K7A J;  4UUS A;  1NK9 A;  2ZIU A;  3M4O J;  2LBO A;  1CGP A;  1NKC A;  4PDK A;  1BW5 A;  1DRG A;  2MD5 A;  3TMO A;  2ZTD A;  1ZQK A;  1P4W A;  3S1Q J;  8ICY A;  4KTQ A;  1T2K A;  4YCX A;  1RM6 C;  2Z5U A;  2DA3 A;  2LYA A;  2N8G A;  1YIT I;  4OMY A;  1S29 A;  5CKT A;  3ED5 A;  2CGP A;  4YRV A;  1Z3X A;  5DBB A;  4UAY A;  3RZD J;  1KFS A;  4EYI B;  1X3Z B;  3E2E A;  2H1K A;  4QNL A;  1G3T A;  1SWW A;  3MFI A;  4PCQ A;  4C30 A;  1G3Y A;  3FXR A;  1F44 A;  5CPR B;  2YMP A;  2HDW A;  2V9P A;  4RMN A;  2PMZ N;  1N48 A;  3ONQ A;  4JMU A;  4DFJ A;  1ZQC A;  3AG2 H;  1C0W A;  4WWC A;  1C7Y A;  1VTN C;  2X1E A;  2DFL A;  3ECH A;  1WVR A;  3K2A A;  2ZUC A;  4J01 A;  9ICN A;  3RJH A;  3A0H U;  1ZN2 A;  2DK8 A;  2CUZ A;  2B21 A;  2BPG A;  1FIA A;  4DQP A;  5TIS C;  1URJ A;  9ICA A;  2EFN A;  5HDN A;  4EAT A;  5IIL A;  3T5L A;  4FQG A;  3HOS A;  4NDL A;  5HLI A;  1FEZ A;  5AKJ A;  1O3S A;  4RGU A;  3AUO A;  2K8C B;  4EYH B;  3WE2 A;  5FLX Z;  4HQM A;  4BEH B;  3F9K A;  4QTR A;  5CB1 A;  2DXI A;  3HOV J;  2IS2 A;  4BQO A;  3QYP A;  1ZQY A;  3IUO A;  4F55 A;  2W82 A;  4P0Q A;  4RPX A;  1WJE A;  2M4G A;  2Y0S N;  1ZQM A;  3GV5 B;  2PFP A;  3BTI A;  3H8W A;  4CE6 A;  5IP9 J;  1ZQJ A;  4QJF B;  1B22 A;  1T0F C;  2EPF A;  3BR3 A;  3P7N A;  4UB6 C;  4CYC A;  1N5X A;  2OHF A;  2EAN A;  3HKZ C;  2F3N A;  4JWM A;  1MNM C;  2HKX A;  3BR0 A;  5DCM B;  1V5E A;  4PGX A;  1P2F A;  4IPA A;  4LGW A;  1K7A A;  2BY1 A;  2MG4 A;  4Z6Y A;  3IKT A;  4I2J A;  5KHD A;  4R79 A;  4WF2 A;  2LDU A;  3UMB A;  5T14 A;  2XIG A;  3ZRG A;  2KRH A;  3FHZ A;  2XO7 A;  1SKR A;  4BDP A;  2F8L A;  3GZN B;  2GA2 A;  4ED3 A;  2VT3 A;  3BR6 A;  8ICT A;  2CN1 A;  1XSN A;  1W1W E;  5F27 A;  1L6N A;  3M9N B;  2CW0 F;  3FHN A;  3H0L B;  5G5G A;  3CMA I;  2BQ3 A;  4QWE A;  2L02 A;  1R4M B;  2VI6 A;  3MR6 A;  4DQQ A;  2XID A;  4DYC A;  3RIR A;  3TAD A;  1NK0 A;  3FXM A;  4L9T A;  2JA5 J;  4IHV A;  4Y2V A;  4QZD A;  2KZZ A;  5EZH A;  1UB9 A;  2X6W A;  1X66 A;  2PI5 A;  3I76 A;  5G5H A;  3F5A A;  2VB6 A;  3EYY A;  5FD6 A;  1J2M A;  3ZI4 A;  1K6Y A;  3GIK A;  3IG8 A;  4UB2 A;  4FAS D;  3T1B A;  2XAF A;  4A0Z A;  1W36 C;  2DKZ A;  5AIC A;  3TAR A;  2DFI A;  4M9G A;  2E3T A;  4G8X A;  1N77 A;  4LZD A;  4F4W A;  4QIW F;  5GPA A;  2XC9 A;  2FDR A;  1J5Y A;  1EF4 A;  3VOD A;  4FE3 A;  5EWF A;  2NVU B;  3ERM A;  4XRS A;  3S2H J;  5J0W A;  3LSP A;  3T3F A;  1T38 A;  1HIW A;  1WYG A;  3EQL F;  1S76 D;  2BR0 A;  1GDT A;  3K4B A;  1HEK A;  2BDP A;  1MH4 A;  4KT5 C;  5EEH A;  3V8J A;  4RT2 A;  1UHU A;  2D3D A;  5HOO A;  4EZ6 A;  1REP C;  1OJL A;  2AJQ A;  3DKW A;  2WV1 A;  2NNY A;  2MGQ A;  4RU9 A;  4DF4 A;  2OQR A;  2KIW A;  2AQF A;  2LBF B;  4ECZ A;  3ASN H;  4OIR F;  3QAH A;  1TWH J;  2F1J A;  1KZH A;  4BX9 C;  1HUZ A;  4KLJ A;  2K9Q A;  3I5U A;  5DDY A;  2W9C A;  1MW7 A;  1BR1 A;  2R4G A;  5CVI A;  4R8U B;  1IDY A;  2K40 A;  4UV8 A;  1U5T A;  2AXL A;  4RGR A;  3WU2 U;  4MFD A;  4LB6 B;  1TAU A;  1T56 A;  2JT1 A;  3WGH A;  3PR4 A;  3ULQ B;  1RYU A;  4Y17 A;  9ICW A;  3Q8S B;  5AKZ A;  2GM4 A;  1K78 A;  3QU2 A;  1OPC A;  3IWF A;  1YQA A;  5K7H A;  4WXC A;  4MEY A;  2ZJR F;  3HRS A;  3OYK A;  2ZIW B;  3JPT A;  1P92 A;  1MDM B;  2YB1 A;  5E20 A;  3ZGK A;  1K1S A;  1GO3 F;  1OCO H;  4I7H A;  2F5F A;  4FET A;  5EDN A;  3S93 A;  4IX7 A;  2H8R A;  2HOF A;  3HPH A;  3KZZ A;  2W11 A;  3DBR B;  1T8I A;  2LM4 A;  2IGK A;  2PBI A;  3V42 A;  1JUM A;  4KYW A;  3MFH A;  5IIO A;  3PNY A;  3I0T A;  4RM2 A;  3ZMV A;  3S3N A;  2YY6 A;  5JUM A;  3I58 A;  5E3M A;  2LKX A;  4PJM A;  1W7P B;  3CCL I;  4PFO A;  4CCK A;  2KKO A;  2FNP A;  1V3F A;  1K4S A;  3BZC A;  2XAS A;  2VBZ A;  1QQ6 A;  2Q1Z B;  3A0H C;  1X3W B;  1XX5 A;  3FDS A;  5F08 A;  4ENK A;  2DA5 A;  1ZAO A;  9ICF A;  1R36 A;  4XOP A;  1Y0N A;  3ALR A;  4F3O A;  2EA4 A;  2XUB A;  3C2B A;  4ZTJ A;  4UY8 I;  1MQ3 A;  7ICQ A;  4GRI A;  4ECU A;  2VKV A;  4BXO A;  2P8T A;  2E1N A;  3IDW A;  1FBQ A;  3KKA C;  1KYZ A;  4ELT A;  5AK4 A;  4R66 A;  3OYA A;  1JUS A;  4RQ4 A;  2ISP A;  1BI2 A;  3LA7 A;  3MAJ A;  2DOF A;  3O2P E;  3PL8 A;  1D8L A;  1QQ5 A;  4ASN A;  2JHD A;  5D5W B;  4NHJ A;  2HYF A;  3JTG A;  3HPG A;  1TQM A;  3PJR A;  2HDO A;  1IJW C;  3ZMT A;  4Y2Y A;  1Z4O A;  2VJ4 A;  4HA8 A;  1R49 A;  3PST A;  5KFF A;  4RNN A;  3GII A;  2E19 A;  2HPI A;  2ZJ5 A;  1R1U A;  3AFH A;  2JPC A;  4XRS G;  1W5C C;  2EFQ A;  4I09 A;  3F6V A;  1VQK I;  4UXN A;  3TGN A;  2O6G E;  1K1Q A;  3M8R A;  3MGI A;  2GWS A;  1TTY A;  2P7V B;  2FMQ A;  3CO6 C;  4ZZL A;  2M7A A;  1IAW A;  1VLB A;  3ISC A;  5AM4 A;  5J2I A;  2HOE A;  3LSJ A;  1XSX A;  2BHZ A;  2NVY J;  4LOC A;  1QQ7 A;  4UHT A;  4XRF A;  2WF9 A;  2M45 A;  3DPL C;  3WHB A;  3AN1 A;  2A3V A;  2HOI A;  5KG7 A;  3BS5 B;  2BE5 F;  3GLX A;  3OR2 C;  3H0D A;  2HQ5 A;  5DB7 A;  4FBU A;  4O5E A;  4XK4 A;  4CZZ A;  2OQG A;  3HBL A;  3K4G A;  1MSE C;  1IRZ A;  4PZJ A;  1IXR C;  1WJB A;  2XV4 S;  1KU9 A;  3Q9V A;  5FB2 A;  3VB2 A;  2QYO A;  2PMU A;  1GV2 A;  3GTP J;  2AHO B;  1IG6 A;  2IS1 A;  3HEF A;  2DN0 A;  5B3S H;  4MIM A;  2HQA A;  3NAU A;  3RPQ A;  4PL1 A;  1SL2 A;  1T33 A;  2F2E A;  5L3D A;  2DQL A;  3TO9 A;  2PKE A;  3QU9 A;  1NKB A;  1PUE E;  4LB5 A;  3JRI A;  1UQV A;  2P4W A;  1OIS A;  3HOZ J;  1EKE A;  3K1N A;  3M9M B;  1D8B A;  4I2C A;  2DUY A;  4LZG A;  2V79 A;  3F6O A;  3IAM 2;  3NUQ A;  3SZ2 A;  2CQK A;  4L9V A;  4FE7 A;  2OU2 A;  3GBG A;  4WXH A;  2EZZ A;  2H3Z A;  2DJN A;  4ED7 A;  2OM6 A;  3RF9 A;  5CEH A;  1XCB A;  1J2X A;  2CW8 A;  3WG7 H;  1BNP A;  2F1I A;  5HS7 A;  4PSW A;  4K2E A;  3ZOB A;  1ZRD A;  1OCP A;  2IPQ X;  2CXY A;  1F43 A;  9ICI A;  1HC8 A;  1HKQ A;  4EEF G;  3LNQ A;  3B9J A;  2F6C A;  4PK4 A;  3FBN B;  4ECX A;  2QQ9 A;  4KN4 X;  3SJM A;  1IC8 A;  3F2D A;  1KYW A;  1I39 A;  1X4O A;  5L9X A;  5HHH A;  4YIF A;  1XS9 A;  4Y13 A;  1JGS A;  4HRI A;  4ZZD A;  1PP8 F;  2H5X A;  2MA1 A;  4QZ9 A;  3HT3 A;  4F8R A;  1JTX A;  5AM1 A;  1KFT A;  1FP2 A;  1PUF A;  4L5I A;  1E3O C;  8ICZ A;  2JV3 A;  4LG0 A;  3QYE A;  3LL7 A;  5BOL A;  4ED0 A;  3ROU A;  4RLF A;  4CSW A;  1RZT A;  2R8J A;  3HTS B;  5HMM A;  2RNJ A;  3CF5 F;  1MZB A;  4QW8 A;  1T6S A;  3KZI C;  1YLF A;  2W9B A;  1U6G A;  1FMV A;  3WTT C;  1AHD P;  1NJX A;  1D8J A;  4IRK A;  4K4I A;  4QWA A;  1FIP A;  4Z6E A;  3UMG A;  1LDK B;  4C2U A;  2PFO A;  2ZTC A;  1YS6 A;  3D5S C;  2PFQ A;  3N97 A;  2DF4 B;  3GIJ A;  1BGX T;  2LI6 A;  1ZK8 A;  2ZME A;  2JSP A;  1FJL A;  4I2G A;  3DEU A;  3W2W A;  3A2K A;  4I0A A;  5AK6 A;  5DG8 A;  3PIO F;  1OXJ A;  2Q8K A;  2P6S A;  2M3A A;  4CGZ A;  1Z7L A;  3JPN A;  5E3N A;  2GXG A;  3G71 I;  5CVV A;  3CDH A;  4BHC A;  5D5V B;  2M0M A;  1ZQO A;  5LEJ A;  3GIM A;  2EZL A;  3MVP A;  2ID3 A;  3SEQ A;  5GAE J;  4DS4 A;  2OJE D;  3P9C A;  4CF5 A;  1LKX A;  4M3E A;  1DK2 A;  4YEL A;  5DB6 A;  5KCM A;  4XLP F;  2XF5 A;  5HLG A;  2LYB A;  5KFZ A;  4EX6 A;  4RB3 C;  1B4A A;  4IQ4 A;  1MJA A;  3MMY B;  3Q0V A;  1DQU A;  3CJN A;  4CZC A;  2W03 A;  3EYZ A;  3LSI A;  3FKI J;  3BC8 A;  4EX7 A;  2DMT A;  2HW3 A;  2KJ9 A;  4HX4 A;  3QZ7 A;  3C5F A;  2IS6 A;  2KD1 A;  5IIM A;  1SIJ A;  3PNV A;  2MAB A;  1OCZ H;  3OS0 A;  1PK1 A;  2R7D A;  1OQY A;  5DM6 F;  1R5G A;  2BZT A;  2EQR A;  1MMN A;  1ETQ A;  1VF9 A;  2WY7 Q;  3RZO J;  4HSR A;  2ZJ8 A;  4QIW C;  2AGQ A;  4JP0 A;  3COA C;  2N1R A;  1X1P A;  4UAW A;  2ZIX A;  4J9Q A;  3WHC A;  2YTU A;  4HLX A;  3JSO A;  4ZTF A;  1VFC A;  3DCF A;  3R0A A;  3ZMD A;  4GXK A;  1LNW A;  4AUX A;  3F2C A;  1DDN A;  3M7D A;  2CG4 A;  4Y15 A;  3RR7 A;  5TGT A;  2KJ5 A;  2ZSH B;  3H5A A;  2DCE A;  2VAN A;  4C0Z A;  3UQ0 A;  4YFK F;  4US8 A;  5KG5 A;  3ZQG A;  2R5Z A;  4M9X A;  3BJO A;  3W6K B;  9ICS A;  2JEF A;  1EA3 A;  3V7S A;  5K7Z A;  3C21 A;  1KN5 A;  3S3M A;  3HRM A;  3CRX A;  1XSP A;  5DQI A;  2LPE A;  1G2H A;  3V6H A;  2EAP A;  1L7M A;  1SWV A;  2HQR A;  2FUG 2;  1NK8 A;  1JIH A;  1QQI A;  3BOQ A;  4IRG A;  3GIL A;  2RQQ A;  1I3Q J;  4OOI A;  1L7P A;  3IWZ A;  5ALV A;  1JGG A;  4YG2 F;  1TNS A;  5DLF A;  3H92 A;  1RPL A;  4O3O A;  5IY5 H;  4V2F A;  3EDP A;  4HEA 2;  2XY5 A;  5CR0 A;  3RPU D;  4BY7 J;  4NBQ A;  5J29 A;  3ZN1 A;  1IXC A;  2KJB A;  2R5Y A;  5GAG J;  3HRD D;  1LQ1 A;  2Y1I A;  4KIC A;  3PML A;  1B6A A;  3F53 A;  3F22 A;  2BQR A;  5C4X J;  1DGJ A;  4EJU A;  2NRT A;  2LTP A;  2K9L A;  1ZQI A;  1Z4N A;  2ALZ A;  3MKW B;  2L9R A;  2Y0M A;  4A5N A;  1YJN I;  4Y7N J;  1JT0 A;  2GQQ A;  2Z1D A;  1XTA A;  1F36 A;  1TWG J;  1U9N A;  2PFB A;  3GUD A;  3M1C A;  2E1C A;  3KYL A;  2BXY A;  1ZKG A;  4KT6 A;  5HLH A;  2G09 A;  1G3W A;  3IC7 A;  2LD5 A;  4C2T A;  5LBQ A;  2GLO A;  2O3F A;  5D46 A;  2F8K A;  1RI7 A;  3UMC A;  1S6L A;  4QLC U;  1KQ0 A;  2VXD A;  3GTG J;  4RQM A;  3SR6 A;  5E8G A;  7ICL A;  1JKR C;  2CV2 A;  1SV0 A;  4Y52 J;  2W00 A;  1VQL I;  1R71 A;  4BKX A;  4JX4 A;  4O6J A;  4XMY A;  2HOA A;  1IW7 F;  2DYS H;  3W3C A;  4B3A A;  3LFU A;  5M5X J;  4A3F J;  2KP7 A;  4XN3 A;  4A3B J;  3K6G A;  2ZBK A;  4YD2 A;  4FE4 A;  3OS1 A;  4KIT B;  5DUI A;  2KSO B;  1HST A;  2F5V A;  1ZG5 A;  3N4M B;  5KFP A;  8ICA A;  4E7S A;  3PV8 A;  2H3I A;  4RGX A;  5L1K A;  1X1C A;  3M1E A;  2QLT A;  5AM2 A;  2IAI A;  4ED8 A;  2QF7 A;  3BTJ A;  1NI3 A;  3FYH A;  4RBO A;  1ZQW A;  1WKM A;  4EQQ A;  4KMU A;  1S97 A;  1P4X A;  2JEJ A;  2LVS A;  4RAY A;  5AM3 A;  4IHS A;  4IZZ A;  4ZC3 A;  3JRG A;  2KIQ A;  4NQW B;  2P6U A;  4RQ0 A;  4U87 A;  3SEZ A;  1S9H A;  2CO5 A;  2HKO A;  1XPX A;  3ZR8 X;  2HGC A;  5E1Z B;  1V4R A;  3NRV A;  4NL9 C;  2RNG A;  3L2U A;  3LOC A;  1ZH5 A;  4YMO A;  4DFP A;  2LY1 A;  2V9W A;  5AI9 A;  3FXJ A;  3T8R A;  1ZQR A;  4R64 A;  1R9T J;  1XWL A;  1TE2 A;  2K4B A;  1HLV A;  3ZMU A;  4EVI A;  4YMN A;  3M3Y J;  1ZQQ A;  3PO2 J;  4GFJ A;  3GLL A;  4XKC A;  4L5E A;  2W04 A;  4RDU A;  2M0N A;  1XN7 A;  2DA2 A;  3T5X A;  3E5U A;  1F5T A;  5L3B A;  3OYG A;  2WB1 F;  2ODG A;  1QH9 A;  4DFK A;  3D5L A;  1N5W A;  2AS5 F;  2MLG A;  5C5J A;  3NQO A;  4Y2X A;  3KYC B;  1ZQN A;  4IR1 A;  4YEJ A;  4F4Z A;  4JV2 A;  1MKM A;  3L9F A;  1LJ9 A;  2I9G A;  3VYR B;  8ICL A;  1D9F A;  5HDK A;  2DU9 A;  3H5N A;  4B8X A;  5D4R A;  3FMS A;  3TO7 A;  1HW2 A;  1A0P A;  3F3X A;  4HF2 A;  1B9M A;  1FO4 A;  1NJW A;  1WJF A;  2EV5 A;  2GOM A;  2M30 A;  3H0M B;  1TV9 A;  2AGO A;  5K1Y A;  4IOA F;  4FO6 A;  3E58 A;  3RJK A;  5EJC A;  4S04 A;  4UUS B;  3Q8L A;  2QQB A;  5EG0 A;  3F8C A;  1JKP C;  2YR2 A;  4GCV A;  2YPR A;  2Y9T A;  1BPE A;  2ZIU B;  1UCR A;  4XBF A;  1B0X A;  3BQ7 A;  3UXN A;  1WI3 A;  4F5O A;  3PIP F;  3GX4 X;  5LD2 C;  2FQ4 A;  3SEI A;  1XS9 D;  3HHH A;  5KFJ A;  5GAD J;  2VJI A;  3K4J A;  1KU3 A;  4YR2 A;  3SFZ A;  5DG9 A;  3VDX A;  5HDG A;  3CTA A;  1RET A;  4KLF A;  4CCO A;  2ME0 A;  1Q46 A;  2UVR A;  1N62 A;  8ICG A;  1WCM J;  2Y48 A;  5C4J J;  4XR6 A;  2B0L A;  1LPQ A;  1KFD A;  2JA7 J;  2XGE A;  1V5F A;  2X6X A;  4CNQ A;  5J1R A;  1FBS A;  2UV1 A;  1ZGW A;  3HKZ F;  4DL6 A;  4DQ2 A;  3F21 A;  3AM9 A;  4KN7 X;  1B8I A;  2FLP A;  2BGC A;  1QHG A;  1EH8 A;  1SZH A;  3Q8P B;  1KKX A;  4RZR A;  3V7K A;  3ZMZ A;  1UHS A;  4TV7 A;  2IS4 A;  2R7T A;  2EB7 A;  3ONN A;  3B6C A;  1N25 A;  2XPW A;  1Z1D A;  3K69 A;  2E2H J;  2G06 A;  3ML6 A;  3RAQ A;  2JSC A;  1SKW A;  2PJP A;  4TQR A;  1XSV A;  1MSF C;  2VQH A;  1QSL A;  1RKT A;  2WY8 Q;  3RKX A;  3K4K A;  2KVC A;  1BR2 A;  5EF6 A;  3TL4 X;  3D1N I;  3A03 A;  4JK1 X;  1R23 A;  2E1M B;  3S17 J;  4Z6F A;  1K5O A;  2A6E F;  4XON A;  2O9L A;  3BTC A;  2CQN A;  4IHX A;  2KG5 A;  4PHP A;  4ED1 A;  2MC3 A;  5L3G A;  4O3Q A;  3TO6 A;  2K3P A;  4L9J A;  4BE1 A;  1Z67 A;  4AYB N;  5F9N A;  2R7R A;  2QM3 A;  4KNY A;  3J7A O;  3D2S A;  2HHU A;  2JZY A;  3QXG A;  2X0L A;  3GFJ A;  2HI0 A;  4Q8F A;  4M6Y A;  1DGR M;  3E5X A;  4BUG A;  2NRZ A;  3OHA A;  4IQU A;  1RPW A;  3PVX A;  5C0Y A;  2ACJ A;  4OD0 A;  3P9I A;  3GFM A;  3AQF A;  1L3V A;  3PNT A;  2RC4 A;  4AYB A;  4TUS A;  2AQ4 A;  4JWN A;  3AQE A;  2F4I A;  2A1J A;  1QZE A;  3KZX A;  3M6K A;  3ISB A;  2KL4 A;  8ICE A;  5B5E C;  3OOP A;  3E6C C;  1RUO A;  3K2Z A;  4OMZ A;  5KG6 A;  5III A;  1NG7 A;  4FIS A;  4HZF A;  2DQN B;  4R63 A;  4PZN A;  4LJZ F;  3NWT A;  4USA A;  3RFA A;  2OCC H;  4XLH A;  3JW4 A;  5AK5 A;  2PMH A;  4QWB A;  1SMT A;  4QPO A;  1U8R A;  2G5I B;  2FF4 A;  4IL6 C;  3EPZ A;  3S16 J;  2H1L A;  2R7F A;  5L3C A;  1V5G A;  2PX9 A;  4ZH4 A;  8ICR A;  2RV8 A;  4H0E A;  1JKO C;  5KFT A;  3V7L A;  3UQ2 A;  5JVG F;  5KFE A;  4WX9 A;  5FLM J;  2KV2 A;  2XAH A;  2E1O A;  2QBY B;  4C2M J;  4XQ8 A;  3S32 A;  3S15 J;  4QZE A;  2WF6 A;  1YX5 A;  1OKR A;  1GUU A;  4BNC A;  4KIB A;  1FFU A;  5EOZ A;  4CO8 A;  4US9 A;  4YP3 A;  3N7P D;  2VE9 A;  3TW7 A;  3M8S A;  2JJ7 A;  5J8C A;  5BPD A;  1NK5 A;  1J97 A;  4JOM A;  4DOC A;  5E3O A;  2X6Y A;  3IAS 2;  5DDM A;  1BPD A;  3E6B A;  2B6G A;  1VQP I;  4M3F A;  2I8D A;  3JPQ A;  3OOU A;  3AMZ A;  1ZET A;  3SMV A;  2A05 A;  4J19 A;  3R60 A;  4NUB A;  2FBH A;  4Y2Q A;  2BOL A;  1RRJ A;  1BPB A;  2CV0 A;  2KJ8 A;  2RGV A;  3L2W A;  2OYY A;  2P35 A;  4FZM A;  2CJJ A;  3OYM A;  1ZQS A;  8ICS A;  2NVT J;  1S5L C;  2RP5 A;  1I5Z A;  2Y69 H;  3U21 A;  3S8P A;  3CME I;  3Q8Q B;  1FEX A;  2E8M A;  2JMG A;  2NOJ B;  5ALG A;  2V6C A;  3ZD8 A;  1V9P A;  2DKX A;  4RB0 A;  2ADU A;  5AIB A;  4YQW A;  1N2X A;  4CHU A;  3EW9 A;  2KMD A;  4XSX F;  4P0P B;  4OO1 J;  1ZD3 A;  1MJB A;  3RI4 A;  4O3M A;  3O8H A;  3OWT A;  3JRA A;  2AXT U;  3RB0 A;  3O8G A;  1CQT A;  2QKQ A;  2OA4 A;  3I4P A;  2JXJ A;  1KU2 A;  3BG6 A;  1LB2 B;  3G4S I;  3QOP A;  2NRV A;  2VJJ A;  7ICR A;  3SV4 A;  3CMM A;  5J40 A;  1XMX A;  4U7D A;  1A77 A;  4P5O A;  4M3D A;  5DB8 A;  1P6R A;  1ZGA A;  2ZG6 A;  3OL4 A;  4V19 K;  4I6Z A;  2IRF G;  5ERI A;  5J2J A;  1SAU A;  2VC1 A;  3KP4 A;  3HIF A;  2BCQ A;  3OV8 A;  3IV5 A;  1RIO H;  3ECO A;  2CYY A;  3C2L A;  1U3E M;  5AKX A;  3HGG A;  1TK0 A;  1SL0 A;  1KQQ A;  2F76 X;  3OTQ A;  1FSE A;  2EBI A;  5DM7 F;  3I54 A;  3TQN A;  3T5J A;  3GWZ A;  1DGS A;  2V4Q A;  2XY6 A;  4HST A;  3EPG A;  3V7J A;  2DFE A;  3TOB A;  1S72 I;  2EIL H;  1LE8 B;  1IV6 A;  2Y9U A;  1Z19 A;  4EGY A;  4B48 A;  3U9G A;  1WG8 A;  3CCR I;  2CQX A;  2OV7 A;  4QIW N;  2HHQ A;  1DUX C;  1BJZ A;  4QSH A;  3ZQI A;  4WCG A;  3G6E I;  5K4L A;  3RJI A;  3OR1 C;  5GTI C;  2D45 A;  3VWB A;  1E3P A;  1ON1 A;  1RXV A;  2D6F C;  4RNM A;  3LK9 A;  2XAJ A;  4A3J J;  4DSL A;  5HLT A;  1FBU A;  3S3O A;  1NNL A;  2HBJ A;  5DD8 A;  2LYH A;  3CP8 A;  1QLN A;  3EUK L;  2MFZ A;  1DXS A;  1S0N A;  5HS8 A;  3G1M A;  5BPI A;  4L0Y B;  2ZJA A;  2RDJ A;  2LSO A;  4NLB A;  2L7M P;  2VL8 A;  4AIK A;  2JEI A;  1ZD2 P;  1SB3 C;  3RYP A;  3A01 B;  4QZH A;  4F91 B;  3CQZ J;  3JRC A;  3RQ4 A;  2IHM A;  3HOW J;  3R4K A;  2DK5 A;  1IN5 A;  3BQZ A;  3QX7 A;  3HW8 A;  3OYE A;  2R8I A;  2XHK A;  3T8T A;  4ED2 A;  2WB1 C;  3DF8 A;  2P7C B;  3R9K A;  2WFA A;  3M9A A;  4DL7 A;  4M9L A;  5A2Q K;  2D5V A;  4NM1 A;  4K4G A;  3WOD F;  1AKH A;  3PFY A;  1TVA A;  4ESB A;  2A07 F;  3MKZ A;  3JRF A;  4QW9 A;  5ICG A;  1IXS B;  3T5K A;  2FPL A;  1MND A;  4RUC A;  3SQN A;  5J2D A;  2KQR A;  3V8K A;  5K5R A;  9ICR A;  2BBY A;  1ZQP A;  2PMZ A;  1N75 A;  3LYS A;  4DSF A;  4RS8 A;  3VFZ A;  4D7N A;  1ZG1 A;  4RQ6 A;  3GFL A;  1T3Q A;  4O3R A;  3IKV A;  5J2K A;  2GH1 A;  1LV5 A;  3RJF A;  2EV0 A;  2NOG A;  1LFU P;  2QAR B;  4M6W A;  2K02 A;  2NYX A;  2P0W A;  3MFK A;  1X6I A;  2ESE A;  1TKD A;  2A5W A;  3TFR A;  1KSP A;  2IBD A;  1YTY A;  5IT9 K;  1LEB A;  1UT8 A;  1Z3Y A;  3L5K A;  1JX4 A;  5KNI A;  3H9J A;  1T08 B;  1WCL A;  2F4M B;  5EE9 A;  1HXD A;  4EM2 A;  2P66 A;  4ESF A;  2VQL A;  2VPR A;  4PFP A;  4ECR A;  1U47 A;  1UFM A;  3BTL A;  1VQ7 I;  1TL8 A;  4DFD A;  1W5T A;  1IUF A;  2ZXI A;  3GTO J;  2LHT A;  5DTD A;  4CCN A;  3BPX A;  1JXE A;  2MLK A;  3MWM A;  1RQL A;  3RCO A;  4RQ7 A;  4NLK A;  3WK5 A;  3KLN A;  2JK3 A;  4C8N A;  2Y0S A;  4B9L A;  5ALJ A;  3SQI A;  4Q47 A;  2GLE A;  1S7O A;  1D3Y A;  9ICX A;  4MGR A;  3TP3 A;  3OYB A;  4ABZ A;  3OYN A;  2FLN A;  2JRZ A;  3HX0 A;  3CCQ I;  2TRT A;  4GFB A;  5J47 A;  2NV3 A;  5KFK A;  3JPO A;  2ASD A;  3BJ6 A;  3EET A;  4UB8 C;  3DXJ F;  3M1Y A;  4C80 A;  2M8E A;  3CCS I;  1O7F A;  1ZQL A;  4PHE A;  4BDZ A;  3HRT A;  2W55 A;  2LKY A;  3ZDC A;  1YRN B;  2I10 A;  2L9S A;  5A2Q Z;  1VQN I;  4A3D J;  5AI4 A;  3SFI A;  4KLL A;  3IRU A;  4EZ9 A;  3G73 A;  1S10 A;  2AHQ A;  1QA6 A;  3LWM A;  1Z77 A;  3EUH A;  4BE0 A;  2L4M A;  4EMS A;  3L7W A;  1PUF B;  9ANT A;  4XA5 A;  2HEO A;  4U7B A;  2AU0 A;  5HNF A;  4ECT A;  2K27 A;  2L9V A;  4A3C J;  3LVW A;  4ON0 A;  2GOX B;  1MNE A;  5J8Y A;  2HYJ A;  4UNO A;  1MBH A;  3RTV A;  2DMN A;  3K4N A;  2Q2E B;  1ZRF A;  3GU3 A;  3HUG A;  1XMK A;  4MEX F;  2W9B B;  3ZP5 A;  4DF8 A;  3RBE A;  1A6S A;  2F5C A;  4R1H A;  4NWI A;  4KMF A;  4O0I A;  4M73 A;  3CO7 C;  1J59 A;  2VOD A;  1RDF A;  2A5Y B;  4KLT A;  1S8N A;  3CUQ A;  3N97 B;  1HKS A;  5FKK A;  2G0E A;  2PJR B;  3C5G A;  3G2B A;  2I6X A;  2IA6 A;  3TKA A;  3CUO A;  2LYC A;  3F8N A;  5IT9 Z;  4ZDP A;  1A5J A;  3JPP A;  3FDY A;  1XGS A;  2DW4 A;  4F93 B;  4IQJ A;  2R18 A;  1IDZ A;  4I28 A;  2DOE A;  2L9N A;  2ZUD A;  4O9M A;  3F72 A;  4Q5S F;  4GYI A;  2M2E A;  1XC5 A;  1YJ9 I;  3KZY A;  3A4C A;  4BGD A;  1OYW A;  1I3A A;  2RVC A;  2ZC2 A;  4D7M A;  4ICA A;  4G9B A;  2X48 A;  5FKN A;  1IGN A;  4MHV A;  5KT4 A;  1TAM A;  1MGT A;  4IRI A;  3MKL A;  1RR7 A;  3ABT A;  5ICF A;  3O0F A;  4G94 A;  2G9W A;  1V54 H;  1L7O A;  4NC6 A;  1FMW A;  3TDU C;  1NHA A;  1QU3 A;  2UWM A;  1SKS A;  5IT3 A;  5LLQ A;  3F0C A;  4HG2 A;  1DK3 A;  4AID A;  2KIM A;  3WTW C;  8ICV A;  1IRF A;  1WSU A;  3DEE A;  3RSN A;  5DB9 A;  1I1S A;  3S14 J;  1PK1 B;  3CCE I;  4BWJ A;  4CCH A;  3RPU A;  4EEY A;  3ICX A;  1IO2 A;  9ICV A;  2HTS A;  2DFF A;  3EZ5 A;  1BJA A;  1QBJ A;  4F2S A;  2QKL B;  1JAL A;  3H4B A;  5EGO A;  3TDZ C;  2V1U A;  4C8L A;  4AM3 A;  3ISD A;  4BHB A;  4A3G J;  1YE9 A;  4MFF A;  4F7Z A;  5JR3 A;  4S05 A;  5IIN A;  3LMM A;  1TWA J;  1DU0 A;  3LSH A;  4EJT A;  3LWL A;  4F5R A;  2K9S A;  2WAQ C;  3DTK A;  1OR7 C;  2W54 A;  1ERD A;  1S9F A;  1YJW I;  2VC0 A;  3JR9 A;  3SV3 A;  3JAM K;  3J80 K;  4LIV A;  4BYY A;  2NS8 A;  3I53 A;  1HF0 A;  5ALO A;  2ZB9 A;  1ORK A;  3QQA A;  3N05 A;  1JJ6 C;  2EFO A;  2BCR A;  3CCM I;  2EIJ H;  1Z9C A;  4RM3 A;  5B1A H;  3RAX A;  1SD5 A;  3AL0 B;  1SXD A;  2VJ5 A;  3JCU C;  3HOY J;  5D4S A;  1MH3 A;  2V1N A;  2HBL A;  1Z05 A;  2XI9 A;  3L00 A;  1YZ6 A;  2K89 A;  4X5V A;  2V1X A;  3OHB A;  1Y39 A;  9ICE A;  5F0C A;  4Q4Z F;  4D5C A;  4J9K A;  2ZO4 A;  3KFU F;  5JVT A;  3L1P A;  1NZP A;  2P6T A;  1ZRN A;  3VYU B;  1YI2 I;  2A3S A;  4JX5 A;  3MR5 A;  2MUT B;  5M3F J;  4OJ5 A;  4ESJ A;  3CCJ I;  5IYB J;  2L01 A;  2R7Q A;  2WWY A;  3JRH A;  3WTZ A;  1IZ1 A;  4N9H A;  2O61 A;  2FMS A;  1NH3 A;  4YR3 A;  3QWL A;  1K6O A;  2LNB A;  1Z3E B;  2R7S A;  3H40 A;  2G0A A;  1VQM I;  4KLD A;  3J81 K;  2DDB A;  4C8M A;  1GHC A;  3SYZ A;  1Q3V A;  2PXI A;  3HPO A;  5LHH A;  4B4C A;  1ZQV A;  5FJ8 J;  3BPV A;  2ZIV A;  5C44 J;  4G7Z F;  4N4N B;  2CUJ A;  2JZB A;  5KT5 A;  2CU7 A;  1IG7 A;  2GOL A;  1D5Y A;  2HHW A;  3ZXS A;  1EH7 A;  2QB1 A;  2EIN H;  2MRL A;  5ALF A;  3OYL A;  3PX4 A;  2GZW A;  2VKH A;  3K0L A;  1M1E B;  4N4O B;  2QA4 I;  1Z1B A;  2K8A A;  1ZQF A;  4L18 B;  3DPU A;  5J0S A;  2ELK A;  3JAM Z;  5JHU A;  3J80 Z;  2E35 A;  1Z00 A;  3OSF A;  3BG7 A;  1QSS A;  3W6V A;  4AIH A;  1XO1 A;  4KX3 A;  2LC2 A;  5J8F A;  2DBY A;  4BBS J;  5AI6 A;  3LAJ A;  4YFK A;  1SD7 A;  8ICQ A;  2CFX A;  4II3 A;  1IM4 A;  2QSF X;  5KG3 A;  5FRO A;  1BR4 A;  2KIC A;  1ZQB A;  1U9O A;  1TT0 A;  4BEH A;  5FRM A;  3F5E A;  1X2I A;  4OAZ A;  3REO A;  1FPQ A;  4LLG F;  3FWE A;  1R58 A;  1R7J A;  1D5V A;  2LRE A;  1P7I A;  2PI0 A;  2FPM A;  2Y75 A;  2QKM B;  2RRE A;  3SEN A;  4UBC A;  1HKT A;  4BJ5 C;  2L5Q A;  1UZC A;  4DQR A;  4A6E A;  1OCT C;  5KT6 A;  3I1Y A;  2IXS A;  1Y56 A;  4UUT A;  2K4P A;  5ALZ A;  5F9L A;  1Z91 A;  5DCM A;  1V85 A;  2QLZ A;  3WKE A;  3GXO A;  1SV4 A;  4PGH A;  5KT3 A;  3C28 A;  3RB6 A;  4R65 A;  4MO7 A;  4XKW A;  1R5H A;  5ALN A;  1SXE A;  1UPH A;  2H3Q A;  1ETX A;  3V7R A;  1EJ9 A;  2IHN A;  4ENN A;  4M04 A;  1SZP A;  3OY9 A;  3KP6 A;  1KON A;  3MN2 A;  3I71 A;  3J81 Z;  2E7W A;  3BT9 A;  4E7K A;  3TOA A;  2OXO A;  2XCA A;  5F0H A;  5LGT A;  5ALH A;  3OS2 A;  4DNC A;  2R8G A;  4I2B A;  4WK8 F;  1CUK A;  4M0A A;  1Y88 A;  5KL1 B;  3BG9 A;  3WG9 A;  3MR3 A;  3OL3 A;  2OTL I;  4D5F A;  3NVW A;  2E1E A;  2HVS A;  4DQS A;  4BU2 A;  1HDP A;  4PJL A;  2JMW A;  5FFX A;  4EJV A;  3AEV A;  3NVY A;  3PW4 A;  4YXM A;  3EUA A;  4EV0 A;  2UXN A;  2EJR A;  4XKB A;  1ZGJ A;  1XDU A;  2ZNZ A;  2RDP A;  4XSZ F;  1GT0 C;  3RJG A;  2FML A;  4EJW A;  5AHX A;  2O7O A;  2KN7 A;  1NK7 A;  2GA1 A;  2B0C A;  5KG2 A;  1JT6 A;  2CW7 A;  2JRM A;  1OMI A;  5BOX A;  2EZX A;  5ALT A;  3ABL H;  4G3I A;  4C4R A;  1VQ5 I;  4QZC A;  3TFS A;  2DPJ A;  1WJA A;  4NNJ A;  2FJ1 A;  4G6D A;  2DA7 A;  2I5U A;  5D6F A;  3ERE D;  5HNK A;  3GZ6 A;  2B7E A;  4UBB A;  4DBR A;  3E97 A;  5LFA A;  1RUN A;  7ICF A;  3L4P A;  9ICC A;  2BW3 B;  2HSZ A;  1YS7 A;  3IL2 A;  3L2R A;  4B1R A;  1LDJ A;  2H6C A;  2HVQ A;  2XPV A;  4I98 B;  3H3V K;  1N56 A;  4HBL A;  4FS2 A;  9ICG A;  3IN5 A;  1FTT A;  2QVO A;  3FXU A;  3RKQ A;  2KRC A;  4XLC A;  5FKO A;  2BCV A;  5EYR A;  2DA6 A;  3QUQ A;  4R8U A;  3CP2 A;  3C1Z A;  5EWE A;  3Q8K A;  9ICQ A;  2FEZ A;  2DMU A;  2GXB A;  3K70 C;  2F44 A;  4IJA A;  3ZDA A;  1ZQA A;  2K8B B;  4E7J A;  3PSF A;  3SZG A;  5GTH U;  5J2G A;  4ZDO A;  2HFH A;  4DOA A;  2K3F A;  3OJS A;  1U49 A;  4CYD A;  2WB1 N;  1TC3 C;  4EM1 A;  1I1G A;  2IBK A;  2DGZ A;  5BS6 A;  2DT7 B;  3IP4 B;  4J9S A;  1MDM A;  1SMY F;  1EH6 A;  2L0K A;  3I9V 2;  2E34 A;  3IH3 A;  5IOZ A;  2VQG A;  3S6J A;  4YR0 A;  4P4P A;  1RYS A;  3ZQH A;  2BY0 A;  1A76 A;  3I56 I;  4BHP A;  1KA8 A;  5LGN A;  5HR6 A;  3DLA A;  5JI6 A;  3LSG A;  3VSL A;  1WWU A;  2KIS A;  1W7P A;  3QEB Z;  1A31 A;  5AKK A;  2XGQ A;  1X9S A;  3E0J B;  3FF5 A;  2JWT A;  3BWG A;  1MMS A;  4FT8 A;  4O5C A;  3WTU C;  1ITY A;  1Q1H A;  1GXQ A;  1L8O A;  1ZD5 A;  5ALY A;  3FK6 A;  1LVK A;  5J2F A;  1RZ4 A;  2DA1 A;  4HYE A;  2LRD A;  4V2G A;  4E4H A;  5HS9 A;  3V7C A;  2DT6 A;  3BG5 A;  1B72 A;  1NK2 P;  3TKY A;  3MKY B;  2UZK A;  3A0B U;  4BWM A;  2ASL A;  2F5D A;  2X85 A;  1SAX A;  2MD0 A;  2A1J B;  3GDX A;  4A3L J;  3ZD9 A;  8ICU A;  4CCM A;  1F9N A;  4JB3 A;  5KFD A;  5EWG A;  1COK A;  1Y0U A;  4Y33 A;  2FRH A;  2CH0 A;  3CC2 I;  1GVD A;  1MMA A;  5K5O A;  4J9O A;  4DSJ A;  1SEU A;  4A8E A;  3HKZ N;  4RAZ A;  2E8P A;  1D9D A;  4U6P A;  4DOZ A;  4HX7 A;  4RNO A;  2W84 A;  2E1M C;  4E7H A;  3OYF A;  3QOE A;  1LFB A;  3O3K A;  1X2M A;  1SFO J;  4M9J A;  2P5L C;  3ABM H;  4PSX A;  1AU7 A;  4HV6 A;  2MC4 A;  3CCV I;  2R0Q C;  1ETK A;  2W8L A;  4DO9 A;  1QPM A;  8ICN A;  1FP1 D;  5KAF U;  4UB5 A;  1T0F A;  3HKZ A;  3N28 A;  4DEZ A;  5KT2 A;  1PVR A;  4HOB A;  4GXI A;  2E5Z A;  2VE8 A;  4ZYA A;  4C9Y A;  4A12 A;  3DV8 A;  3GV7 B;  3V6K A;  5FLV A;  5B66 U;  4E7Z A;  2Z7J A;  1WH5 A;  5IYC J;  3PQK A;  4BQA A;  4QWC A;  4M71 A;  3ABK H;  1HJP A;  1F0M A;  4YXJ A;  2CUE A;  3GVA A;  3GTJ J;  2KKP A;  5J2A A;  1A6I A;  5D5X B;  2GWR A;  3CLQ A;  2ECB A;  3HWT A;  5AK3 A;  4IHY A;  3BS5 A;  4Q43 A;  2Q4T A;  3OIQ A;  3FXO A;  4BBR J;  4FZL A;  4GXO A;  5ILS A;  2I1Q A;  1B43 A;  2Y1J A;  1X42 A;  1MD0 A;  2XVT A;  4OIQ F;  2KZM A;  4WXD A;  3KIO A;  5DUK A;  2J6S A;  2O0Y A;  3OSG A;  1N78 A;  3TAQ A;  2VKE A;  2HNH A;  2GO7 A;  2XB0 X;  4B6J A;  8ICF A;  1F5S A;  2HOS A;  3TAN A;  4Y3O A;  4XIC A;  1UAA A;  4UAT A;  2WTE A;  2XRN A;  3DBH B;  2KT0 A;  4F92 B;  5CP2 A;  2P81 A;  4BY1 J;  5HVQ C;  4MF2 A;  7ICP A;  2LLK A;  1YX3 A;  5EE0 A;  4UB1 A;  2UXX A;  1K4T A;  3KHG A;  4DYQ A;  4BDY A;  1PK3 A;  3LWF A;  4OJP A;  4C4S A;  3MD2 A;  2KKV A;  4NJ8 A;  3B6A A;  3LA3 A;  4ZDL A;  2E8O A;  4GC7 A;  1ZQT A;  3RH6 A;  2MSN A;  4KLG A;  2XAQ A;  3TAD C;  3NWS A;  1NK3 P;  2ELH A;  5L1M A;  2CPR A;  2EIK H;  3HM5 A;  1MIJ A;  5KFG A;  1LVH A;  1Z6R A;  1SFK A;  4ENJ A;  4P55 A;  4A3I J;  1FIQ A;  1X9X A;  5DGA A;  2OWO A;  5CHG A;  2X6O A;  3ABU A;  4P1W A;  1AA7 A;  1YIO A;  5BNG A;  5J0T A;  3RBD A;  4MNU A;  4KX5 A;  2IP2 A;  2BEO A;  4Y2R A;  1FC3 A;  3LDA A;  3Q9S A;  1JUD A;  2ICW G;  2D1H A;  4FX0 A;  3OJU A;  1ZG3 A;  2WC2 A;  3RDI A;  1ZQU A;  2KE7 A;  4F52 A;  3V72 A;  2KJC A;  2BQU A;  3VPR A;  3WGI A;  4XRH A;  2ZCW A;  1TBX A;  1B59 A;  1UG0 A;  3OSP A;  1ZQG A;  2XRL A;  4I29 A;  2EFW A;  1DP3 A;  2HXI A;  4I2I A;  3ESW B;  1RYR A;  1IN7 A;  2Y2Z A;  3QP5 A;  4CXF A;  2JA6 J;  1T98 A;  2DPD A;  5KFS A;  4C7Z A;  1VQ9 I;  9ICT A;  4K4H A;  1DPR A;  2W4S A;  1CI4 A;  5KFQ A;  3DU6 A;  1WUD A;  2M87 A;  4KN4 A;  1ETV A;  5KK1 A;  5K7F A;  4YFN F;  1T94 A;  2BCU A;  1QO0 D;  4MQ9 F;  2X51 A;  2DMP A;  2BCS A;  3KTQ A;  4KLO A;  1SVO A;  3E6D A;  2IOH A;  5ALS A;  1U5T C;  5ALU A;  3R61 A;  3M8J A;  5J6X A;  3KOO A;  2OD5 A;  3NGD A;  4C8K A;  4IRH A;  3SDB A;  1Z0X A;  1JTY A;  1ZRM A;  3NVV A;  3ZQL A;  4NV0 A;  2V9V A;  3FK7 A;  5E1W A;  2AO9 A;  3BZK A;  4GLX A;  2B9S A;  1U48 A;  2K4E A;  3QYB A;  5JU5 A;  4IXA A;  2GIV A;  1WJC A;  5AKG A;  4ZYH A;  2XSD C;  1UST A;  1ZJM A;  3M07 A;  3OPX A;  3QYF A;  4C7Y A;  3PX6 A;  1ULY A;  3V6J A;  4RQ8 A;  4UAZ A;  4P9U A;  3WGG A;  1S7A A;  4IS7 A;  2CRG A;  2W8K A;  2HZD A;  3KCC A;  3WU0 A;  4ECW A;  1KBU A;  5CVU A;  4J9L A;  4ECQ A;  2FOW A;  4C8O A;  3VSK A;  4G6T B;  1TQI A;  2KZV A;  3DPT A;  3KEQ A;  4JQF A;  2W3R A;  2YQE A;  1BPY A;  3TBI A;  4M9N A;  1O4X A;  3OYC A;  4DSK A;  2XKP A;  4NC8 A;  3BJY A;  1BBY A;  1ZYQ A;  5AON A;  1BOA A;  4E70 A;  4UB3 A;  4KLE A;  7ICU A;  3JRE A;  4YN4 A;  3RR8 A;  1GVJ A;  2V7F A;  4DZJ A;  1I6H J;  3F2B A;  1L5U A;  2V6E A;  4KMO B;  3TQ1 A;  3KKA A;  3L2Q A;  5KFY A;  4U88 A;  1ZHF A;  1KQ9 A;  1UJ8 A;  2QQ8 A;  3W2V A;  4BJT A;  3OYJ A;  4A2U A;  3LAP A;  3ZMS A;  1KLN A;  2O8K A;  2COB A;  3I3L A;  2XB5 A;  1ZXI A;  3RB3 A;  4LLN A;  3QUB A;  3JTH A;  2BHY A;  3HSR A;  3IM1 A;  3HP6 A;  1STZ A;  4LK0 F;  3JRD A;  1FWZ A;  8ICP A;  2ID6 A;  3DU5 A;  4XLE A;  2MAX A;  3M9O B;  1YZ7 A;  4CCL A;  1K61 A;  3PO5 A;  1JN3 A;  2AQ0 A;  5ILV A;  3DWL E;  3C23 A;  1J9I A;  5M3M J;  4A0X A;  4ECV A;  5M5W J;  2M4K A;  1WJD A;  2BXZ A;  1LDD A;  1VND A;  5B66 C;  1TZL A;  1PDN C;  5J0R A;  1FYL A;  4KLM A;  4LIT A;  4P0Q B;  4BE2 A;  1OYI A;  4HW0 A;  3SAH A;  1YFH A;  1OCC H;  5DCF A;  1VQ4 I;  5GP9 A;  3FM3 A;  1IN8 A;  4B9T A;  2JA8 J;  3CNH A;  4QPQ A;  4CYC B;  4RPZ A;  1B9N A;  3PW5 A;  3K75 D;  2JR5 A;  4RUA A;  2FU4 A;  2BZF A;  8ICI A;  2CSO A;  1KGS A;  1SGG A;  4C4T A;  1WH7 A;  1VQO I;  1IXR A;  2H8W A;  1SFX A;  1IN4 A;  3IHU A;  5HML A;  3T79 A;  3QOD A;  5KFH A;  3P5J A;  1R22 A;  1H8A C;  1RG6 A;  3MZY A;  1XG1 A;  2HYG D;  2F1H A;  2MYS A;  1YHQ I;  1R1T A;  2BVM A; 
#chains in the Genus database with same CATH homology
 4CCN A;  3RCO A;  2K5C A;  2IS1 A;  2XAU A;  2HQA A;  2Y0S A;  1D0Y A;  3SQI A;  4PL1 A;  2BDU A;  3OYB A;  2KEY A;  2G5H B;  3OYN A;  3K4M A;  2Y0S C;  3L3F X;  1G8X A;  2VKQ A;  4BL0 B;  2NV3 A;  4DBQ A;  1D8B A;  3DTE A;  5FRN A;  2W7P A;  2CFO A;  2VXZ A;  2KHM A;  3IAM 2;  3NUQ A;  3GBG A;  4BDZ A;  2H3Z A;  2LKY A;  2KHV A;  2OM6 A;  3RF9 A;  2L9S A;  2CW8 A;  3HUG B;  4XLF A;  2ZXH A;  4PSW A;  3CZ6 A;  2V26 A;  4HNT A;  1Q3U A;  4BE0 A;  4U7B A;  2RHF A;  5HNF A;  2F6C A;  4PK4 A;  3FBN B;  3LVW A;  2GOX B;  1MNE A;  4E7I A;  3EUH C;  3ZCO A;  5CQE A;  3K4N A;  3GU3 A;  2Q2E B;  2WAQ F;  3F2D A;  4OJL A;  1X4O A;  3K4L A;  3D5R C;  1A6S A;  4NWI A;  1D1C A;  4HRI A;  2YX8 A;  2MA1 A;  4XNF A;  3H35 A;  4ITV A;  1D1B A;  1J09 A;  2XDV A;  2PJR B;  3QYE A;  3G2B A;  2XF7 A;  3LL7 A;  4RLF A;  4CSW A;  4XOT A;  2LYC A;  4ZDP A;  3CES A;  3FDY A;  4IKF A;  4F93 B;  4IQJ A;  2R18 A;  4OJO A;  2L9N A;  1E0E A;  1FMV A;  4PJJ A;  4PL2 A;  2CRX A;  1LDK B;  2OUM A;  4C2U A;  5JHF A;  3D5S C;  3A4C A;  4BGD A;  2DF4 B;  3HG9 A;  4D9J A;  2CMP A;  2JSP A;  3W2W A;  4BQN A;  4CUG A;  3A2K A;  4ICA A;  1IRX A;  1TAM A;  2M3A A;  2LG4 A;  3M6Z A;  1Z7L A;  4CGZ A;  3O0F A;  2UUZ A;  1FMW A;  2M0M A;  1QU3 A;  2UWM A;  3SEQ A;  4HG2 A;  2JVG A;  3DQV C;  3D2Q A;  1LKX A;  2CS3 A;  5KNL A;  3DEE A;  4YEL A;  3RSN A;  2M7B A;  2K9M A;  5KCM A;  2XF5 A;  1U0J A;  1D0Z A;  2LYB A;  3ICX A;  1P7D A;  4IQ4 A;  3MMY B;  4HPQ A;  2ELJ A;  4ZJZ A;  1DQU A;  3OIP A;  4CZC A;  2QKL B;  2W03 A;  3LSI A;  3MGV A;  3BC8 A;  2XIC A;  2KJ9 A;  3J7A Y;  2WAQ A;  4KIS A;  2IS6 A;  2KD1 A;  3PNV A;  1YE9 A;  1W36 D;  4H4K C;  4XLA A;  2MAB A;  3OS0 A;  2IGN A;  3LMM A;  2JVH A;  3LSH A;  3K10 A;  2WAQ C;  2JA2 A;  3DTK A;  1OR7 C;  3CJQ B;  1ERD A;  1MMN A;  2R7U A;  2WY7 Q;  5CQG A;  4HSR A;  2WAD A;  4QIW C;  4LIV A;  2N1R A;  3C2H A;  2WAE A;  3PUB A;  4NC7 A;  4XN0 A;  4DJA A;  2ZIX A;  3N05 A;  2K4I A;  2KPM A;  2BW3 A;  4ZTF A;  2F77 X;  2XC7 A;  5HNH A;  3VC8 A;  4RM3 A;  1ZEL A;  3F2C A;  3VYS B;  3AL0 B;  3M7D A;  2VJ5 A;  4FZN A;  2HBL A;  2XI9 A;  2V1N A;  5TGT A;  1XO0 A;  4AVZ A;  2KJ5 A;  2ZSH B;  3H5A A;  2DCE A;  2O5R A;  3ZQQ A;  3L2V A;  2K89 A;  4ACO A;  4XQF A;  4C0Z A;  2BVL A;  4OAY A;  2KNJ A;  3KFU F;  1EA3 A;  3PSP A;  2W7N A;  3S3M A;  3CRX A;  2ZSI B;  2R7O A;  3VYU B;  2DOA A;  1X1A A;  2FUG 2;  2HU9 A;  1IIP A;  2VLA A;  4OJ5 A;  2F2A B;  2ZIV B;  3AL0 C;  2R7Q A;  4BXF A;  3CYM A;  1ED1 A;  2RQQ A;  3HOT A;  1NZB A;  2OC6 A;  1VZ0 A;  1PVP A;  1X4P A;  1OLT A;  2Z2S B;  2R7S A;  3SAG A;  2G0A A;  1Q3V A;  4HEA 2;  3RPU D;  2ZIV A;  1D1A A;  4B47 A;  1ECW A;  4N4N B;  2CUJ A;  4DGW B;  3UR3 C;  2GOL A;  3F53 A;  2HPM A;  3ZXS A;  3AKZ A;  2K9L A;  2MRL A;  3OYL A;  3MKW B;  2VKH A;  2WBM A;  2Z1D A;  3M1C A;  4N4O B;  1JI8 A;  1Z1B A;  1X19 A;  2K8A A;  3KYL A;  3BLY A;  3DPU A;  4KT6 A;  2HVR A;  2G09 A;  3E0F A;  2JH7 A;  2KOB A;  3BG7 A;  2V9K A;  4C2T A;  4KX3 A;  2XF6 A;  2LC2 A;  2VAS A;  2VXD A;  3HC7 A;  2CV2 A;  4BS9 A;  4II3 A;  2W00 A;  2YB4 A;  3H0R B;  5HR7 A;  3LSM A;  2XSJ C;  3PZP A;  5FRO A;  1BR4 A;  2KIC A;  4BEH A;  1TT0 A;  4XMY A;  5FRM A;  3F5E A;  3CF2 A;  4OAZ A;  3W3C A;  3LFU A;  1XNS A;  4XN3 A;  2KLO A;  3FKJ A;  3K6G A;  2OH2 A;  2LRE A;  3OS1 A;  4KIT B;  2F5V A;  2QKM B;  2RRE A;  1MMD A;  4BJ5 C;  2L5Q A;  4E7S A;  4B43 A;  2H3I A;  2WAF A;  1X1C A;  2IXS A;  1Y56 A;  4D1Q A;  2L2O A;  3GZF A;  1ZQ1 C;  3C28 A;  3UNG C;  4XKW A;  4IZZ A;  1UPH A;  2H3Q A;  2VKD A;  4ZC3 A;  1CRX A;  3OY9 A;  1X1D A;  4NQW B;  1KON A;  4U87 A;  4E7K A;  2OXO A;  3SEZ A;  1D0X A;  1S9H A;  3SAF A;  2W7O A;  1WFX A;  1WJ5 A;  3ZR8 X;  2Z16 A;  3OS2 A;  4U7C A;  2RNG A;  4BJ6 C;  3L2U A;  5KL1 B;  2LY1 A;  3OL3 A;  3LVV A;  2E1E A;  2HVS A;  2G07 A;  4BU2 A;  4PJL A;  2ZFU A;  2H3F A;  2HMX A;  3EUA A;  1UEL B;  2JH1 A;  1YT3 A;  4II2 A;  4GFJ A;  2RRD A;  4XKC A;  4XKB A;  2VIX A;  2W04 A;  2M0N A;  3K4C A;  3OYI A;  4F3Q A;  3OYG A;  2WB1 F;  1G59 A;  2JUG A;  3D5L A;  2CW7 A;  1P9Q C;  4P0P A;  2LY2 A;  2VPL A;  2E60 A;  2KHQ A;  3KX2 A;  1WJA A;  4NNJ A;  4XOR A;  4Y4R A;  4YEJ A;  4DIQ A;  3N7S C;  4WJ3 B;  1T95 A;  2W1O A;  1BOB A;  4B44 A;  3VYR B;  4DBR A;  5LFA A;  3H5N A;  3IG5 A;  2ZIX B;  1A0P A;  2BW3 B;  1WJF A;  3OYD A;  2GOM A;  3L2R A;  3H0M B;  3H9Q A;  2HVQ A;  3DKX A;  2KDO A;  2ZIU B;  3IN5 A;  4IC9 A;  2LH9 A;  3VCB A;  2KRC A;  4XLC A;  4BAC A;  2PMZ F;  3W2A A;  5LD2 C;  3CP2 A;  2VJI A;  3K4J A;  4AYB F;  3K70 C;  1OUQ A;  3VDX A;  2L7K A;  2K8B B;  4E7J A;  3PSF A;  4XM3 A;  3SZG A;  4ZDO A;  4CA0 A;  4CCO A;  5KL8 B;  2ZIU A;  4XR6 A;  2R7X A;  1V5F A;  2X6X A;  2LBO A;  2UV1 A;  2DGZ A;  3HKZ F;  2DT7 B;  2HBK A;  3IP4 B;  2KMU A;  1QHG A;  3I9V 2;  4BQQ A;  1DRG A;  1SZH A;  2VQG A;  3TMO A;  3E1S A;  2IS4 A;  2R7T A;  3ONN A;  2LYA A;  2G06 A;  3BCB A;  3HL2 A;  5HR6 A;  3DLA A;  3LSG A;  5CKT A;  3VSL A;  2VQH A;  2Y0S F;  4YRV A;  1Z3X A;  3C2G A;  3RTR A;  2WY8 Q;  3K4K A;  4QNL A;  2KVC A;  1BR2 A;  3E0J B;  4CH7 A;  3FBI B;  3TL4 X;  4C30 A;  1F44 A;  5CPR B;  2E1M B;  3H9G A;  2HDW A;  1LVK A;  4RMN A;  4XON A;  2LRD A;  4E4H A;  3ONQ A;  4JMU A;  2DT6 A;  2K3P A;  3MKY B;  3DKY A;  4BE1 A;  2X85 A;  2X1E A;  1HA8 A;  2MD0 A;  2IGM A;  2R7R A;  4J01 A;  3D2S A;  4CCM A;  2H3V A;  2CUZ A;  4Y33 A;  1URJ A;  2CH0 A;  1MMA A;  1DGR M;  4BJQ A;  4BUG A;  5C0Y A;  3K1Z A;  4EAT A;  3AQF A;  4A8E A;  3PNT A;  4U6P A;  4DOZ A;  4AYB A;  3HOS A;  2G08 A;  2E1M C;  2K8C B;  3AQE A;  4E7H A;  2VQC A;  2F4I A;  3QOE A;  3OYF A;  3K70 D;  3KZX A;  3M6K A;  4BEH B;  2KL4 A;  3F9K A;  4PSX A;  2DXI A;  4AYB C;  2MC4 A;  2IS2 A;  2X1C A;  4PJN A;  4BQO A;  1NG7 A;  3IUO A;  3HKZ A;  2W82 A;  4F55 A;  2DQN B;  1MMG A;  1WJE A;  2M4G A;  3LSK A;  3NWT A;  4XLH A;  3RFA A;  1PVR A;  2E5Z A;  4ZYA A;  4C9Y A;  1NG6 A;  1X1B A;  4QPO A;  4QJF B;  2G5I B;  1T0F C;  3EPZ A;  4E7Z A;  2Z7J A;  3HKZ C;  1V5G A;  4BUP A;  1V5E A;  2WA0 A;  2KKP A;  2KV2 A;  5KHD A;  3S32 A;  4R79 A;  2Q4T A;  3OIQ A;  1YX5 A;  4X0G A;  5T14 A;  4FZL A;  3ZRG A;  2KRH A;  3N7P D;  2F8L A;  2XVT A;  4ANJ A;  1LFP A;  1N78 A;  2CN1 A;  2HNH A;  4JOM A;  1L6N A;  2X6Y A;  3IAS 2;  3FHN A;  3H0L B;  4Y3O A;  1UAA A;  5A0L A;  2I8D A;  3OOU A;  4F92 B;  2XID A;  3SMV A;  5HVQ C;  4NUB A;  1YX3 A;  2BOL A;  2OYY A;  2KJ8 A;  2CV0 A;  4BDY A;  3L2W A;  4FZM A;  4OJP A;  3MD2 A;  2X6W A;  2KKV A;  4ZDL A;  3OYM A;  2RP5 A;  3F5A A;  1MA7 A;  2VB6 A;  3BCA A;  3NWS A;  3S8P A;  3U21 A;  2CV1 A;  1K6Y A;  2CPR A;  3IG8 A;  2JMG A;  2D6F C;  2NOJ B;  4FAS D;  1SFK A;  1W36 C;  3HXL A;  4P0Q A;  4P0P B;  4OO1 J;  1N77 A;  4P1W A;  1AA7 A;  4QIW F;  1PVQ A;  4O3M A;  3OWT A;  4KX5 A;  4FE3 A;  1Z21 A;  3BG6 A;  1HIW A;  3N7R C;  2VJJ A;  3K4B A;  1HEK A;  3CMM A;  4F52 A;  2E5S A;  5HOO A;  3A1Y A;  4P5O A;  1UG0 A;  4CDG A;  1DP3 A;  2KIW A;  1PJR A;  2ZG6 A;  2AQF A;  3OL4 A;  4LG3 A;  2LBF B;  4XL9 A;  4LIU A;  1SAU A;  2W4S A;  3OYH A;  4BX9 C;  4J00 A;  3DU6 A;  2IGO A;  1WUD A;  1MW7 A;  1BR1 A;  2R4G A;  2PJR A;  1T94 A;  4OWR B;  2X51 A;  2F76 X;  2X1D A;  2R7W A;  1PYV A;  2LBF A;  2A6T A;  3M8J A;  2LOO A;  4HST A;  3SDB A;  1Z19 A;  4NV0 A;  4B48 A;  3OYK A;  2ZIW B;  2K4E A;  3QYB A;  2YB1 A;  3ZGK A;  1WJC A;  2OV7 A;  1GO3 F;  4NLC A;  4FET A;  4HNU A;  3OPX A;  3QYF A;  3S93 A;  4IX7 A;  1R6R A;  3OR1 C;  3HPH A;  3VWB A;  2HOF A;  4B3X A;  2IGK A;  3OMY A;  3V42 A;  2HZD A;  3PNY A;  4MLO A;  4RM2 A;  5HLT A;  3S3N A;  3S3O A;  2HBJ A;  1KBU A;  3CP8 A;  4PJM A;  4PFO A;  3VSK A;  4G6T B;  4CCK A;  2KZV A;  2MFZ A;  3DPT A;  3EUK L;  4JQF A;  2ZIW A;  3TBI A;  3OYC A;  4NC8 A;  4NLB A;  2VL8 A;  4PUS A;  2R7V A;  2Q1Z B;  3DTI A;  2V7F A;  3F2B A;  4F91 B;  2WB1 A;  3D2N A;  3RQ4 A;  3CJR B;  2V6E A;  2K4H A;  4KMO B;  4XOP A;  4XKV A;  3L2Q A;  3ALR A;  3VYT B;  4ZTJ A;  3W2V A;  4BJT A;  3OYJ A;  3OYE A;  4GRI A;  2AQE A;  3I3L A;  2DJI A;  2WB1 C;  3H5R A;  3OYA A;  3PFY A;  2E1F A;  1DGW Y;  3DU5 A;  4XLE A;  3MKZ A;  3PL8 A;  4CCL A;  5CRX A;  2HBM A;  2JHD A;  3PSI A;  4CCJ A;  3DWL E;  3HPG A;  3PJR A;  2V4J C;  2VJ4 A;  4AU7 A;  1MND A;  3PST A;  2M4K A;  1WJD A;  1QHH D;  4CRX A;  2KQR A;  1TZL A;  2HPI A;  3AFH A;  2JGA A;  2PMZ A;  1N75 A;  4LIT A;  3LYS A;  4P0Q B;  4BE2 A;  2KP6 A;  4OJ6 A;  3SAH A;  2GH1 A;  4KJZ A;  1GLN A;  2M7A A;  2PMZ C;  4QPQ A;  2P0W A;  2A5W A;  4E6K G;  3NRW A;  4RLQ A;  1Y6I A;  2A3V A;  1Z3Y A;  3DPL C;  2E5N A;  3H9J A;  3SYT A;  4E7L A;  2HOI A;  3OR2 C;  3H0D A;  3C29 A;  3T79 A;  2HOQ A;  3QOD A;  2VQL A;  4PFP A;  1WJB A;  2MYS A;  2ZXI A;  3KEY A;  2BVM A;  2LHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...