4UQGA

A new bio-isosteric base pair based on reversible bonding
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title "Post-it" type connected DNA created with a reversible covalent cross-link.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 214
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4uqgA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4uqgA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqgA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4uqgA01
4NXZA 4RPZA 4M3UA 1HNIA 1NJZA 4RW4A 4JV0A 3L2VA 4AHSA 1EXNA 3GV5B 4E1MA 1RDBA 2ASLA 2YNGA 8ICCA 2F8TA 4P2HA 5J0QA 5SWMA 8ICIA 3KHHA 4DTJA 2NRVA 5J2DA 3QZ8A 1BPZA 4CE9A 4E1NA 4E3SA 8ICUA 3OHAA 4Z4HA 4KFBA 2RKIA 3ZSQA 5KFSA 1ZQKA 4BWMA 4M9JA 5J2QA 1RDDA 4CGGA 2WTFA 4CEBA 3MAQA 4M04A 3ORYA 1QHTA 1HJRA 4LZGA 4JUZA 5IIMA 5DGBA 5KFBA 1S97A 2ISPA 1C1BA 5KFKA 4DTNA 4KI4A 4CK2A 1BCOA 5KFTA 3HWTA 1N6QA 4MFFA 2BPFA 1TKDA 2JLEA 3TFSA 5JUMA 1FKOA 5J0WA 5KFAA 2JEIA 1IKXA 4CHPA 3MABA 3LALA 4P4MA 4IKFA 1L3UA 9ICIA 2D5RA 2IAJA 2F1IA 4MEYA 7ICLA 2G8IA 3RB4A 4RU9A 1A5XA 2IDOA 3AA3A 4HUEA 9ICLA 3OYAA 1UWBA 1D5AA 1U4BA 3ZSVA 3LWMA 2BCQA 3QEWA 4DFMA 4F3TA 4O44A 3MGIA 4B8AB 2JZBA 1BHLA 3NE6A 4ECSA 3MDCA 3TAPA 5SZTA 4XUSA 1U04A 3WNGA 2BKEA 2X6NA 4YNQA 3AVKA 3LDSA 3S3OA 4FLXA 3DOKA 5J2MA 3AA5X 1NK0A 3OSPA 3FDSA 1FXXA 1C1CA 4OVLA 2PFNA 2GBZA 4R8UA 4F50A 4HUGA 3TI0A 4Z6FA 3IG1A 2Q0ZX 4YD2A 9ICMA 4KLTA 3GDXA 1TFRA 8ICOA 1Y97A 3JPRA 3UQ0A 5KFWA 1SL0A 1BIUA 4K8XA 1TL3A 2C2DA 1S1XA 4CF0A 8ICFA 4CJVA 3DRSA 1ZQRA 2PFOA 3WNEA 3FFIA 4NLZA 3RB3A 3OS1A 3LZJA 4QWCA 4N47A 1B43A 3VA0A 2W42A 9ICFA 2XCAA 3OYMA 1HQUA 3GV7B 4H4OA 5HMLA 4F2RA 4DSIA 4JS4A 2XY6A 2P1JA 3EPIA 4XIUA 2HVIA 9ICSA 2XY8A 4NLKA 3UXPA 1KFSA 3BQ2A 3C95A 4RNNA 4FZZA 3PO5A 1JLQA 3PNCA 4ED3A 2MUTB 1NJWA 2C22A 3K58A 3AVGA 7ICQA 1XU4A 3QLHA 4CHOA 4FJ9A 4RW9A 2LYHA 4CJFA 1ZBLA 7ICHA 2OPSA 3SQ1A 1UT5A 4PA1A 4ED7A 2Q3SA 4DTMA 3OYBA 3IRXA 4KLEA 3D45A 3V1RA 4QZ8A 2G8FA 5K14A 5E41A 4NLGA 3OHBA 4QZEA 2HHQA 5DDYA 4YD1A 4YFKA 4BXOA 3RJFA 1MU2A 5JS2A 3L2WA 3GQCA 5HMMA 4K4IA 1ZQVA 2PYJA 3RTVA 3TAEA 1VK0A 3P1GA 4XRHA 4KLMA 4YN4A 4QCLA 2W9CA 4KRFA 3O4NA 4CK3A 4MFAA 3EYZA 3RRHA 3ZT2A 4KHQA 3EZ5A 5KRTA 3RMDA 4FJ8A 4KHSA 1TKZA 3VQCA 8ICPA 5KFGA 1LWEA 3O3FA 3OJSA 2P5GA 3BQ1A 2BGGA 8ICLA 3LWLA 3CFRA 1RYSA 2KW4A 4RT3A 8ICYA 4DQIA 1RILA 3NF6A 4CJRA 5JS1A 3UQ2A 4RQ2A 3LP3A 4KREA 3VQ4A 4ECVA 2X78A 1N5YA 3JYTA 3MEGA 1X2IA 4I28A 1U48A 1RXWA 4M41A 2XRIA 3VQEA 5KG6A 4DL5A 4RQ8A 3TARA 3S3NA 4GXJA 5EU7A 5DBBA 3C5FA 3H4BA 2EX3A 2QXFA 2HHXA 1EP4A 1RTDA 4J2EA 4NCBA 1G15A 4MF8A 3PV8A 3V7KA 3RJIA 3A2FA 4KLHA 4O9MA 3Q8LA 3RMBA 1GOBA 4ZHRA 5DLGA 3NF7A 3T3FA 4CHQA 1RT3A 4E7KA 2F96A 3ISDA 2W8KA 2O4GA 2J6SA 1L3TA 4Z4GA 1SUQA 1WSIA 3TQ1A 5C25A 3RRGA 3ASMA 4OJRA 5L1LA 4EP4A 4FCYA 5HHHA 3SYZA 4B9LA 1BGXT 1D8YA 3L2UA 2KQ2A 3QEPA 3NF8A 2UVUA 3N97B 3L2RA 4FJGA 2RDJA 4KTWA 4BE0A 1ZBUA 1DOQA 1DTQA 1SZPA 4CF2A 5HRSA 4H4MA 3DLGA 1ZBFA 4JWMA 1BI4B 2FMPA 3H08A 4QZHA 5J2AA 3HM9A 2C2EA 3LPTA 5KFNA 8ICWA 7ICVA 3AVMA 4P4PA 3V1QA 4FBTA 3ISNC 3QNNA 4FJNA 1T4GA 3E2EA 2ATQA 2GWSA 4CF1A 4B9UA 3SPYA 2KFZA 5CHGA 7ICKA 4W5QA 4F5NA 1BPEA 1I39A 4KAZA 1JLCA 3NH1A 4KLOA 1RBVA 4M3YA 1ZQNA 3TFRA 3HK2A 4QZIA 5KG2A 3ZT0A 2VG5A 3EWAA 2IS3A 1IKWA 5HRPA 4QZFA 4YQWA 4F4XA 1Z00B 4RPXA 4DQRA 1T05A 2OPPA 4N76A 3H8WA 1ZQJA 4RW8A 4Y1CA 3LK9A 2BR0A 3HO1A 2B6AA 3C23A 1WAFA 1X9MA 4AHCA 1KLMA 2ZTDA 2WOMA 1TGOA 4ECYA 1TK5A 2ALZA 3LP2A 8ICXA 1VSMA 2OWOA 5L1JA 1K1SA 4UQGA 1JLFA 4UAWA 4M9GA 1SKRA 4KLSA 4HTUA 2R7YA 3IS9A 4B9SA 5J0TA 3OJUA 3MR6A 3B6PA 4YXMA 4PHEA 5KRSA 4CF9A 1WLJA 3VQBA 3HW8A 1ZQCA 4IRDA 3VA3A 1BPYA 1LAVA 1X1PA 5CZ2A 1MC8A 3NFAA 3PX0A 8ICRA 4EBEA 4IQUA 1W9HA 2B21A 3ZSYA 4KTQA 5KT4A 9ICRA 1LW0A 3QNOA 2ZQBA 1XSNA 4QW8A 4DSFA 3ZDCA 2HW3A 4JRPA 2AGQA 3FYHA 1KVBA 4HCCA 4QZGA 3AO4A 3MR2A 3HVTA 1YTAA 4M2YA 4CEAA 1EXQA 2W8LA 5HRNA 5J2NA 5KFDA 5KG5A 4AH9A 4E7JA 7ICEA 4IQTA 3V9UA 3O3HA 2I9GA 3VQPA 1SL2A 3AVBA 5IIKA 3V9WA 1TV9A 3LZIA 4QWAA 3OS0A 3ITHA 5HHIA 4FM0A 4ECUA 3QEXA 1Q9XA 3SUOA 4I2QA 1IO2A 1RXVA 3MBYA 1S1TA 4NM2A 1QE1A 4CJUA 3TAFA 4XQ8A 5DQGA 2YKMA 3RH5A 3C6TA 1ZQXA 4CGDA 1JXLA 3NGZA 4I27A 5F9NA 3ZSZA 1RBTA 4O0IA 1LV5A 3VQ9A 3QEAZ 1NKEA 4YR3A 3GILA 1UA0A 4CECA 4KLIA 4IR1A 3HP6A 2JEJA 4QZ9A 3QINA 3V9ZA 4CIGA 1BISA 4AHRA 3CFPA 4F5RA 4JV1A 4M9HA 4J9LA 4BACA 2A1RA 3EPGA 1HQEA 3KKRA 2DPIA 4C8MA 3AA4A 1QS4A 3RWUA 3RJEA 2BCUA 3K4GA 1F21A 1YTUA 3VQQA 2OYQA 1QLNA 5HRRA 1QSSA 3QEIA 3G6VA 4F92B 1ZQBA 3JPSA 5DK5A 1RT1A 3C2KA 2I1QA 2HMIA 1Z26A 2FLPA 4IQVA 1VRUA 2W9CB 4KLJA 3DYAA 4KB0A 2YHAA 3MXIA 1IXRA 1KEJA 1IKVA 4W5OA 1BI4A 2YNIA 3OS2A 1HMVA 1T8EA 4CHZA 1DGSA 1S9GA 2FPLA 2JEGA 3VN5A 2P66A 2ASJA 4O3PA 1D9FA 2FBVA 2VG6A 4RPYA 3K2PA 2NRWA 4ECWA 1ZQDA 1TK0A 1H38A 1NOZA 3DLBA 1KFDA 5HNKA 9ICQA 2G8KA 3MR3A 4J9NA 1LW2A 2BPGA 4J9PA 4Z4IA 1RTJA 2FPMA 2H5XA 1NK5A 3SUQA 4C8OA 3AO3A 3NBPA 4JLHA 5KT3A 2JGUA 4CJ4A 4FO6A 1HYSA 4BDYA 4AILC 3V7LA 3LDAA 3RMCA 2MUTA 4ZH4A 4BDPA 3RBDA 4DL4A 3KHGA 4FJHA 8ICTA 4CJKA 3PW7A 5CWRA 3HXMA 4KLGA 4NCGA 5IINA 2G8HA 2B5JA 4CEDA 4Z4EA 3AUOA 3QIOA 5FRMA 3RB0A 2FBXA 5CY4A 1SL1A 3IM1A 3K5NA 3S3MA 5KGWA 4ZTJA 3UPQA 1WSFA 4TUPA 3AV9A 4G3IA 1KFTA 4ELVA 2VWKA 3PMLA 2PFPA 3ZDAA 1VSJA 4NCAA 4DFPA 8ICSA 3DRPA 3K57A 3JPQA 2UVWA 4KN7A 4HHTA 3RH4A 1VSKA 1WCNA 1MQ2A 4TUQA 3C2MA 2Z1IA 3C6UA 2KTQA 2ZTEA 4QWEA 4FLUA 3MECA 3KLHA 7ICTA 3T5HA 8ICVA 5HLFA 4DL3A 4KLUA 2ZJ5A 4KMUA 1RT4A 2W9MA 2X6SA 4DTPA 3B0YA 4CCHA 3LAKA 3Q8QB 2IBKA 4YR2A 2J6TA 5J2FA 2YNHA 2NRZA 4F91B 4B08A 5I42A 3RR7A 2MAXA 5KT7A 4RQ7A 1UA1A 3N4MB 2F8SA 4O3SA 3PUFA 1J54A 3AVFA 3QERA 3U3YA 5KFPA 5KFLA 4CJQA 1NOYA 4J9MA 1CXUA 2PYLA 3HP9A 4FLYA 4UB1A 5KG7A 3ZDDA 3PVXA 5J2IA 4FJJA 1RTIA 2KZZA 4I2PA 1ZQUA 2AGPA 3ZDEA 4O55A 3GFKB 4ID1A 3PY8A 4OGEA 4Z0UA 4NM1A 1RT6A 1TL1A 4Q5VA 4Q0BA 1A5VA 8ICGA 1S1VA 3AVNA 3HPHA 3PR5B 2YNFA 2NRTA 4J9RA 1ZQSA 2VA3A 1WSHA 1WSJA 4KLLA 4ED8A 4EP5A 5J2KA 2O4IA 8ICQA 4DQPA 4EBDA 4F2SA 5KFJA 3LAMA 1ZQZA 4I2DA 4JK1A 1ZJMA 4FJ5A 4DU4A 2ZJ8A 3V6DA 5DG7A 1QQCA 4GVMA 4DQSA 5D49A 1BIZA 4DSKA 4J2BA 3ALYA 1A77A 4MFCA 1B9DA 2D0CA 9ICVA 3I0RA 3OVNA 5IIJA 4OKJA 2VG7A 3JPPA 3NTUA 2YHBA 4CFAA 2KFNA 3PW2A 3M9OB 4OLAA 3G6XA 2G8UA 4J9OA 2OZMA 5J2GA 4QZAA 1ITGA 4RQ4A 3KLFA 2ITGA 2KZ3A 5DGAA 1CZ9A 3OYKA 3AVJA 1T3NA 3Q8SB 3AVAA 4B9VA 3DLKA 4CJLA 1XSLA 5KI6A 4UB2A 2D0BA 1MSWD 4B3OA 4CJ3A 3HL8A 4GXKA 1EETA 3DRRA 4CGIA 5HROA 9ICAA 2BCSA 2VANA 1YVUA 2DFLA 1HPZA 2OA8A 5CR0A 1KRPA 4CF8A 4F3OA 3SI6A 8ICNA 3C94A 2FLLA 4BE1A 4I2JA 1TK8A 4NLNA 3AVIA 2HVHA 1ZQAA 2P5OA 2HHWA 1WNSA 4CFDA 1S6QA 1TV6A 1RBSA 7ICFA 1NK4A 2ATLA 1S6PA 4TQSA 2AQ0A 3DLHA 5EWEA 1ZBIA 3JPTA 1X9WA 2W9BB 3TWHA 1S76D 4YVZA 1N56A 2A1JB 3H4DA 4KLQA 3KLGA 4LD0A 2PZSA 1WSEA 4IDKA 4DFJA 1RT7A 4IRKA 5C5JA 5L1KA 1B92A 9ICOA 1LAWA 3V1OA 1NK6A 3QETA 3Q8MA 4MQ3A 2ISOA 4M47A 4FM2A 5FDLA 3M8RA 4CERA 3AO1A 4XA5A 9ICPA 2DFFA 7ICMA 4N41A 3CM5A 3V4IA 3IHQB 4EEYA 1KTQA 2OZSA 4ECRA 4O4GA 3ZD9A 9ICNA 4F93B 4CIFA 1JL2A 4FBUA 4QWBA 3M8QA 4TQRA 1QTMA 4C8NA 5KFVA 3MEEA 3EY1A 2Z1HA 2XGPA 4AHVA 1ASUA 2BGWA 2DTUA 4YP3A 3QESA 3ZSXA 5J1EA 3SJJA 2A1JA 4E89A 3GIJA 4JV2A 4OPKA 3KJVA 4DSEA 4CGFA 2HNDA 4I2CA 3K5MA 3V72A 3OYGA 4DOBA 2ZE2A 3T5JA 4TURA 1DLOA 3LP0A 4BWJA 1ZETA 4IG3A 5I3UA 2R8JA 1L3VA 7ICIA 4ECTA 3CFOA 1RBUA 3SQ4A 1QSLA 1ZQLA 1LWFA 4MFBA 4F5PA 4O0JA 4DG1A 3DI6A 2BANA 2E6MA 5FRNA 5KFOA 4B9TA 5DQHA 3SV3A 2Z1GA 2HHSA 2AGOA 2ETJA 3D0PA 4DL2A 4B8CA 4DTRA 5D4BA 1XC9A 3GIKA 3C2LA 3T1AA 1SKSA 5KFRA 3DLEA 4IQWA 7ICUA 4KV8A 1IKYA 5CYQA 4F4KA 1KVAA 4O5CA 9ICWA 2FC0A 3RJHA 2PXIA 2GUIA 4J2DA 8ICBA 4BDZA 3SV4A 1RBRA 2P6UA 1JXBA 1B22A 3K5OA 3GIMA 4DO9A 4F4YA 2BQUA 3ISCA 4RQ1A 4HCBA 5DMRA 3DLRA 2HHUA 4KPYA 3K5LA 9ICTA 3NH2A 2HNZA 3TABA 3KK2A 2JZBB 4DTXA 3KHRA 4Q44A 5KG1A 3VQ8A 4DEZA 3V9XA 1GOAA 5KFUA 3ZD8A 4FJLA 2F1HA 2B4JA 5D46A 3RB6A 3KK1A 4FZYA 3HX0A 8ICZA 4LSNA 3V81A 2ZUCA 4O3QA 4O3RA 2IOCA 4E7LA 1HYVA 2KN7A 2OPQA 4F5QA 3NH0A 4UBBA 4DSJA 3OSNA 9ICKA 4ECZA 4B9MA 4N5SA 1FK9A 1JX4A 1W0HA 4DL6A 1VSLA 4O5BA 1PZNA 3KLEA 3L3VA 1JL1A 4M3TA 4LZDA 5DBCA 3S9HA 3MEDA 3BJYA 3IAYA 2AQ4A 3H8JA 3VQ5A 4OPJA 5J2HA 4RUCA 5KG4A 1XS9D 4M6WA 4KLDA 3K59A 3KHLA 3E01A 1RCHA 4CESA 3BDPA 2QK9A 1U45A 3K75D 3KK3A 3JPOA 1VSHA 4R64A 4PQUA 1VSDA 1KCFA 1NKBA 3T19A 2C2RA 3LANA 4YFUA 1HUZA 3CM6A 3ZSRA 4YCXA 4FLTA 5C42A 1ZJNA 4F4ZA 4IG0A 1FKPA 3G10A 2V4QA 4J9SA 3B0XA 5J0XA 3OYNA 3MDAA 4KB1A 4IBNA 2BQ3A 4GC6A 1Q9YA 3MXJA 1RDCA 3AVHA 4FS1A 3HJFA 3OYHA 4DTOA 4G1QA 3V9SA 1RYRA 5KG0A 4DQQA 2DFEA 3QEBZ 1J5OA 3NCIA 4EYIB 3I0SA 5J2PA 3RAXA 1XO1A 3UXOA 2EHGA 4FW1A 9ICGA 1R0AA 2XO7A 1ZQIA 5IIOA 3PW0A 3V6JA 4B9NA 4Q8FA 5D3GA 9ICUA 1CXQA 4Z6DA 4CJTA 1ZQTA 1NKCA 1TAQA 3L2QA 2W9BA 3HSTB 3JSMA 3M9MB 4PY5A 3KLIA 4I7FA 1T03A 3C21A 1K1QA 4HVJA 2ZJAA 1TVRA 5IILA 1U47A 3GV8B 1AROP 1V9PA 3DM2A 3F9KA 2DFHA 4RT2A 4QZCA 1BPXA 3RJKA 3RR8A 2BPCA 5KFQA 3H7IA 7ICSA 3ZT3A 5CP2A 1HUOA 8ICAA 3ZSWA 4CK1A 3SCXA 4F5OA 4DS4A 4WE1A 5KFCA 5KTQA 2KZMA 4M9NA 2IMWP 1CEZA 5CYMA 4AHTA 4J9KA 4W5TA 1Z3EB 3AU6A 3OYJA 5J2CA 3C1ZA 5KG3A 4FJKA 3U3GA 3WNFA 1TAUA 4C8KA 3QE9Y 4I2BA 1ZYQA 3PW4A 2GV9A 4J2AA 3EW9A 4I9QA 4Z4CA 1SKWA 5CJ7A 3UIQA 1NK7A 4M3XA 9ICHA 3NF9A 4RNMA 4O5EA 4PGYA 1KLNA 5EWFA 5J29A 3B6OA 1ZQGA 3M8PA 1S0VA 2NRXA 4IFVA 4M3WA 1C0MA 3KIOA 4QZDA 3V7JA 1XHXA 4UB4A 1RT5A 4MF2A 4BE2A 5FROA 4JS5A 5KFMA 3CYMA 3NAEA 7ICPA 1VSFA 5KGXA 4RNOA 4FJ7A 1VSIA 3OYDA 2DPJA 3ULDA 2OPRA 5J2BA 4DF8A 3PX6A 2J6UA 4ZTFA 4FLWA 3H8SA 2YV0X 4UB3A 4O3OA 4PGXA 4FK2A 8ICHA 4CIEA 3RJJA 1X9SA 3Q8RB 2NUBA 3AU2A 4Z4FA 4FW2A 5DB9A 2HHTA 1S9EA 1KDHA 2R8GA 4FLZA 3TAGA 2BCRA 3NDKA 4CJ5A 4M42A 3GIIA 1UT8A 1COOA 4AHUA 4CFBA 1ZQMA 5BPCA 5J0UA 1XI1A 1ASWA 4BGDA 2BQRA 3ZT4A 5KFXA 5F9LA 5J2JA 4KHYA 1C0TA 4DMNA 1TKTA 2IHNA 4QAGA 2XHBA 3KKSA 3MXMA 5DG9A 5BOMA 1Z00A 4CJEA 5T7BA 3HPOA 4KTZA 2VA2A 3PO4A 1I3AA 3QIPA 1SV5A 5DLFA 7ICNA 1S9FA 4UB5A 2FBTA 2P51A 4OLBA 3OYEA 1HJPA 3VQ6A 2IA6A 4Y1DA 4EZ9A 2A1SA 4I9LA 4CEEA 1ZQHA 1A5WA 4PHAA 4UAZA 1KVCA 4CEZA 1HNVA 1WN7A 3SUPA 5BOLA 8ICEA 3V6KA 4M45A 4RQ5A 4IR9A 4IFYA 5KT2A 3VQAA 2RPIA 3OYFA 7ICGA 4ICLA 4CEFA 2RDIA 4I29A 4F4WA 1JN3A 1IG9A 4Q8EA 4C8LA 1RT2A 3U6FA 4GW6A 4Q45A 3CQ8A 1B9FA 4DF4A 3PMNA 3OYIA 1S1WA 3T5LA 3OGUA 2ZUBA 5HP1A 2QKBA 7ICJA 4NYNA 4HUFA 4KO0A 3MFHA 4RUAA 1REVA 2FMQA 2UVRA 2XGQA 4OKEA 1XWLA 9ICCA 4H8KA 3AVCA 9ICEA 2BHNA 3PW5A 4CJPA 5KT6A 2XY5A 4KLFA 4IRCA 5J0OA 2AU0A 4LH4A 2BCVA 1J9AA 3NGIA 5DB7A 3NGYA 4W5NA 4PHDA 3BGRA 4GXIA 4DSLA 4M0AA 1TKXA 1MQ3A 4ED1A 4DTSA 5C24A 1JMSA 2X74A 4ECXA 3MGHA 1CLQA 4KHNA 4EYHB 3AO5A 3SNNA 8ICKA 4CJSA 1JLEA 4CEQA 2ZUDA 3MR5A 2JEFA 4FLVA 1D8LA 4LY7A 2R8IA 4ED0A 1U9LA 1XSPA 3RJGA 4FJIA 2G8WA 1GOCA 3RAQA 3BQ0A 3AO2A 3CG7A 3BQTA 2ZTCA 4QW9A 2W9AA 2I5JA 2HB5A 2FBYA 3P5JA 4DLEA 9ICJA 5DQIA 2D0AA 8ICMA 1Q8IA 4RW7A 4TUSA 2PI4A 5EWGA 1CZBA 4E0DA 1HRHA 4RQ3A 9ICXA 3HVRA 4ECQA 4GC7A 4NYFA 1IM4A 4FJMA 4ED6A 4F8RA 4YG2A 4E19A 4CHNA 4YR0A 4Q43A 3TAMA 5DBAA 4KITB 3P83D 4ELTA 5CB1A 3V6HA 1ZQWA 1D9DA 2IHMA 1YT3A 3SQ0A 7ICRA 1S1UA 4O5KA 4YXJA 1S77D 2DY4A 2E6LA 4CGJA 4FK4A 4O3NA 1NOMA 3UXNA 3G6YA 2PFQA 1EKEA 4RQ0A 3L3UA 2C28A 3OYLA 4Z6CA 4I2IA 5L1IA 3ZDBA 3G0ZA 1BCMA 3MFIA 1RNHA 4LSLA 2AJQA 4RZRA 4GLXA 1NK9A 3VQ7A 7ICOA 5L9XA 4FXDA 3ZSOA 3HPGA 4EBCA 4W5RA 4FS2A 3OYCA 4I2FA 1UOCA 2VWJA 3VQDA 3M8SA 5DKWA 2IGIA 4PHPA 1ZQOA 3Q8PB 1RDAA 1J53A 2E4LA 5KFZA 1QSYA 1TVAA 4MEXA 4J9QA 4R5PA 4R66A 4P4OA 3SUNA 2F1JA 3ZCMA 2XY7A 4LVSA 5HP4A 3THVA 4E7HA 1L5UA 4YMMA 2XC9A 3JPNA 4HYKA 1ZBHA 4L8RB 2BDPA 5DB6A 3I8DA 2V9WA 4KN4A 2PI5A 5KFHA 4DOCA 1JXEA 2VA8A 3QO9A 2QKKA 4NY8A 2WONA 1LB2B 3PR4A 1S0MA 5CA7A 1ZQFA 2FLNA 4DS5A 4X5VA 2Y1JA 4FZXC 4DU1A 4N56A 3Q8KA 4K8ZA 1S0NA 1RPLA 1HYZA 1O1WA 1VSEA 4FYDA 1S5JA 4DLGA 2Y1IA 4PPXA 1LWCA 1ZQQA 2ASDA 4YMNA 4CHYA 3AA2A 2M9NA 2R8KA 2HHVA 4YMOA 5CZ1A 4QOZB 3RH6A 4I2HA 4R63A 1C6VA 1JIHA 5DDMA 5KT5A 4RW6A 4PWDA 4ED2A 4KHWA 4QWDA 1ASVA 5KFEA 1S10A 1U49A 4FVMA 4OGCA 4FM1A 4FJXA 3C1YA 4Z6EA 3F73A 1UAXA 4I2AA 5J0YA 3LP1A 4CFCA 2LSNA 5KFYA 2ZD1A 4ID5A 1CUKA 4M3RA 4EZ6A 3QZ7A 4CEOA 1BQNA 3HT3A 4PGQA 1ZQYA 2FMSA 3SQ2A 1ZQEA 3HYFA 5HBMA 1C1AA 1RZTA 1N48A 2P6RA 4DL7A 3TAQA 4JWNA 1C0UA 5TZVA 2R8HA 4ELUA 1JLAA 1XHZA 3KD1E 4R8UB 2YKNA 2PY5A 3ZT1A 3L8BA 3RMAA 3O3GA 3TR8A 2V4RA 5J0PA 1EX4A 3NGDA 1NK8A 1L3SA 3DOLA 1BQMA 1BPDA 9ICBA 4DOAA 2RF2A 2RN2A 3H40A 1KSPA 3ISBA 1NJXA 2IC3A 5KFIA 4GMJB 5J0RA 3RBEA 4R65A 1JLBA 1A76A 5DB8A 1WCLA 1JKHA 1S0OA 3PX4A 3LPUA 3KD5E 4M6WB 2XCPA 4DFKA 1BPBA 3KTQA 3M9NB 5KFFA 1BL3A 4OKKA 1T7PA 3OY9A 4PUOA 3C5GA 3SPZA 8ICJA 1K6YA 5J2EA 3SI8A 4KKOA 2Z1JA 2UVVA 4K4GA 4DTUA 2HNYA 3O4QA 4E7IA 4RQ6A 5J0SA 4UBCA 1Y88A 4KI6A 1DTTA 4LH5A 3QEVA 4UAYA 5DG8A 3WNHA 3ETLA 2FPKA 1ZQPA 1JLGA 1WSGA 3AVLA 4TSXA 4FK0A 3SZ2A 1Z25A 3DMJA 4CJWA 4M3ZA 3T5KA 1IH7A 2BE2A 4DU3A 3TANA 1NJYA 4BXOB 5IIIA 5EOZA 4RG8A 3NHGA 1C7YA 4QZBA 4CGHA 4DWIA 4PH5A 1WAJA 1VRTA 1BVSA 4M9LA 2G8VA 1RTHA 4I2EA 4KHUA 4K4HA 4JRQA 4I2GA
chains in the Genus database with same CATH superfamily
3BYPA 4RPZA 3HILA 2I6XA 2K7JA 4RW4A 3KZIU 4DV7F 5AKEA 1VK8A 4JV0A 2YX1A 2FJAB 3L2VA 4AHSA 4EENA 1T9UA 1UJ4A 2FYXA 2H3QA 2ASLA 2ZIXB 3MCOA 4OYBA 4IG0B 4DTJA 2NRVA 3LP0B 4E1NA 2ZWOA 1PAEX 8ICUA 3ZO7A 1Y7PA 4Z4HA 3EGNA 4CZMA 1FCAA 1VS3A 1RDDA 3OLBA 2WTFA 2B6GA 4RCHA 4CEBA 3ORYA 1QHTA 1X9XA 3OW2M 3WK9A 4HI2A 2WB1D 1HNVB 3GE1A 2KVCA 4OD0A 1X3NA 1O6XA 5IV4A 5KFKA 1VQ4S 4U9RA 4KI4A 3CI5A 3AOCA 5IM0B 1AUDA 4ILRA 4FXWA 1CULA 2A18A 2BPFA 1TKDA 4C7ZA 3QO9B 4HTLA 2JLEA 3TFSA 4KH0B 2MGZB 3W1YC 2MLXA 3M30B 1Z2LA 4IKFA 9ICIA 2D5RA 2HVDA 1ZTWA 1CPZA 2V50A 3H59A 1MN8A 3R5AA 5CAAA 4HUEA 9ICLA 1AB8A 4QZVB 1XNRJ 1U4BA 2ZIWB 3CCEN 3QPIA 4Y2UA 1HHTP 4ZS6A 2CIMA 3QEWA 2KJ9A 3MGIA 2QB1A 2RHKA 5CYMB 1BHLA 5HL7L 2AEJA 4C1NI 2V5HG 1CJVB 2N7YA 2GO8A 4YNQA 4EFHA 1HKBA 3D6FB 4FLXA 3DOKA 2DH9A 3CDEA 4H0PA 1KQGB 2NUUG 3HI9A 2GBZA 4NWIA 4I2PB 4GO5X 3IS9B 3G9CA 4H0TB 1FVQA 2YXLA 3M30A 2Q0ZX 4YD2A 1BC6A 1TYQB 4NI2B 4JI6F 1VQ8S 4I67A 4C97A 1I5OB 1TFRA 8ICOA 1Y97A 3G25A 3HKWA 4OX8A 1RQNA 3U7JA 1JCGA 1RT1B 2GQQA 2E5LK 1ZXIA 3MCPA 4NEYA 2C2DA 3IFRA 2M4MA 1F5CA 1ZQRA 3CCQN 1XNRF 4NLZA 3SMVA 1Q3UA 4N47A 3FZKA 3T69A 9ICFA 2Y0SC 3T1YF 5E3RA 5IT9O 4LFCK 1NG9A 4H4OA 3P31A 4XH1A 3W5YA 1NO8A 4F2RA 3NVWA 2Q4TA 1T9WA 2HF3A 4DSIA 4JS4A 4TLRA 3PIOL 2ZH9A 2W7PA 1IQTA 2K2PA 3G2XA 3BREA 1T9YA 3BQ2A 1TE2A 2ZXHA 3K9KA 3C95A 3VGTA 4RNNA 1NMEB 1X4GA 3I0RB 3C16B 3R7SB 3PNCA 4QR1A 1UVLA 3DN9A 1ZM4A 3FQLA 1LXNA 2C22A 1N5TA 4CTAB 3K58A 3PG9A 4FZNA 3MMJA 4C0BA 4CHOA 3LM2A 1S5LU 1FD8A 1N5QA 5A8RB 3CC2S 4ED7A 5I3PA 2XLIA 4CRXA 4A8FA 3OYBA 3D45A 2EDUA 3WKAA 1XK8A 4PPDA 5K14A 5E41A 3A13A 1LKYA 3BR9A 4QZEA 1Y5LB 3MWPA 3RJFA 2ESEA 1D0EA 2Y1LB 3GQCA 3D0IE 3OFFA 4K4IA 1ZQVA 1EQMA 5GAEU 3T6JA 4GNIA 3TAEA 3IG1B 3P1GA 4KLMA 3AJ2A 4QCLA 3X1LB 3O5BA 2QA4S 2R3VA 3EYZA 3CJQA 4LT6A 3KK1B 5KRTA 1X0PA 4KHSA 5HI7A 3HSGA 1UW9A 3M8ZA 1NZBA 4U67L 3O3FA 1A6SA 3CFRA 1RYSA 1GK8A 2KW4A 4RT3A 2G0AA 2ZH3A 8ICYA 4DQIA 1RILA 3IDHA 2BUPA 4RQ2A 4Y2AA 4JV5F 1SJ3P 4M95A 2X78A 2LP4A 1FA0A 4J7CA 5E79U 4Z94A 1X2IA 5AKJA 1U48A 4WKRA 1RXWA 1N34K 2XRIA 4JYAK 3VQEA 3TARA 2B6AB 1NHVA 3NAHA 4NCBA 2V7YA 4J2EA 4MF8A 3IRWP 1K73T 3V7KA 4O9MA 3Q8LA 2KLAA 2G2YA 3T3FA 5KAKA 4CHQA 4JK9A 2B43A 3THPA 3SCLE 2XNQA 1LKYB 3BO2A 3FFKB 1NHUA 1L3TA 3GJSB 4LRDA 1N33F 4WFBL 3NVYA 3I9V9 4USWA 4RW4B 2K06A 1SC3B 2E44A 5DM6Q 1RTJB 2XZWA 5M2PA 1IG8A 2DY1A 4EP4A 3CD7A 2FF6A 3MWTA 1NGEA 2EK1A 3SYZA 2FDNA 2QFIA 4JI2K 3QDKA 2VPYB 2O8DA 2GLEA 5HJYA 2HIQA 4QIWC 3L2RA 4U8VA 2IOFA 2LM1A 2JNJA 5LXRA 3D2FB 5GTHU 1DOQA 1DTQA 1SZPA 5HRSA 4H4MA 3F41A 1IUJA 4FWPA 4MFBB 1X31C 3CSKA 3V1QA 4FJNA 4DV4J 1SV0C 2KJ8A 3E2EA 2YKPA 3QMQA 3FR0A 1HWLA 1P8GA 3GG0A 4WU2A 4MO4A 2RB7A 2YQ0A 1FJGJ 3L5KA 1BPEA 1I39A 2WF8A 3CD6N 3S41A 1JLCA 2D3ZA 2WTUA 1FDAA 2GNKA 3DHXA 1RDFA 3FSIA 2ZEJA 2IS3A 1BLUA 4K5SA 2E7XA 1T05A 4JNEA 4OPAA 2KRBA 4XO0A 4LF9K 4WQ5C 3F2CA 2NXUA 2D9OA 4RW8A 3D6HB 3MM9B 2BR0A 5C25B 2BJ7A 2KH9A 3C23A 1WAFA 4FZVA 2J9EA 3EGVA 1X9MA 1RM6C 2CRLA 2YQEA 4B17A 4AHCA 3SBTA 2CJKA 3ZZPA 3NGUA 1Z1BA 1TK5A 2ALZA 4DBQA 5JMVA 1SV4A 3LP2A 4AXIA 1HR0F 5HMZA 2A1AA 1YJUA 1UFKA 1T3QA 2HS0A 3CRXA 5IC4B 4QPTA 1OH6A 4UAWA 1V4TA 1JLCB 5GMEA 3FZHA 2OGUA 5IWAK 2IA0A 3IS9A 5ETMA 4B9SA 4J90A 4ZK7M 1U2RA 5J0TA 4PHEA 3VGMA 4DOZA 2KT3A 4PKHA 4IO9L 3FCVA 1RT5B 3OA9A 2Y1RI 4IRDA 3VA3A 1DFDA 3PX0A 2PMHA 8ICRA 4OYPA 4CM2A 1W9HA 2MHNA 2B21A 4KRWA 4KTQA 9ICRA 4JKEA 5E26A 5A8KA 1HQ2A 2ZQBA 3M2RB 4QW8A 4K41A 4DSFA 3JB9k 4P2SA 2AGQA 3ETRA 2UZAA 4UZBA 2D3UA 3CPWR 1LK5A 5J2NA 1HI8A 4GIBA 1S6UA 3ULEB 7ICEA 3V9UA 3W9JA 1IJFB 4UASA 3VQPA 3ZTPA 3TYTA 4K25A 2DNRA 4NX9A 3LZIA 3ULHA 1PJ5A 3CCUN 2DISA 1N33J 4KIAA 2FQQB 2EH9A 2ITMA 4FM0A 4CZLA 2W2MP 2NLXA 3SUOA 4I2QA 1S1TA 2KHDA 1DURA 2JFKA 1B99A 1X9JA 5DQGA 5AK4A 4FDFA 4DV0J 1D8BA 4I27A 3I5BA 4ANDA 1LV5A 5FD1A 4QR0A 2KFYA 2ZXIA 3HVAA 1FFVA 2Y9TA 1S4FA 1JROA 4LF9J 4IR1A 3PYFA 4Y2SA 4QZ9A 1KBUA 3W62A 2KSOA 3N4PA 3BP8A 4F5RA 2UV8A 4M9HA 4AP9A 1HQEA 4X64J 4DZDA 1R7IA 3W63A 2QW9A 2DITA 3ET6A 4ZCMA 4HAIA 2HHHF 3K4GA 2H54B 2RDDA 5KAIU 1U8SA 2W4CA 1QSSA 2FJXA 3PIPQ 1NGCA 5DK5A 3C2KA 5JMNA 2PEBA 3QSIA 3SEOA 1VRUA 3IR5B 3WKBA 2YHAA 3MXIA 2P6SA 2W2PP 2MU2A 2HBYB 4W5OA 4KBIA 2KIWA 1HMVA 1DGSA 1M5KC 2FPLA 4DR6K 2JEGA 2P66A 1CVJA 1D9FA 3ZLJA 1ZQDA 5JVHQ 3KJFB 1KFDA 5HNKA 1OVYA 1VDHA 3SEIA 1B7FA 4J9PA 4Z4IA 1SUQB 1D9AA 4JI4F 1CC8A 4JI1J 3NBPA 4C2MA 2MLZA 4JLHA 2JGUA 3IWNC 1HYSA 3QB0A 1BHNA 4MK7A 2WFBA 2B51A 2CAJA 3OHRA 3RMCA 2MUTA 4ZH4A 1B64A 4KLGA 2JHEA 1K8KB 3AARA 2I7PA 3T1YK 1SC4B 2FVCA 1RT4B 1QE1B 4Y2KA 4CEDA 4KBOA 3CJ1A 2OEMA 3NCPA 4ZN1A 5FRMA 3PDNA 3GR1A 4QIFA 2WFAA 3NS7B 2UUCJ 3K5NA 1AA1B 4RW7B 1VDVA 1M90O 3VF4A 1KFTA 3ZDAA 4PXDA 2J9CA 4DFPA 1ZOTA 1F5SA 8ICSA 1Y5NB 3DRPA 2VF3A 1RQ0A 3OL9A 3K57A 4KN7A 1VSKA 4X4UA 1PSDA 3QRPA 1IXKA 4ATNA 2J7UA 3CNHA 1MA9B 5ADXH 2K8CB 1RWOB 1TFYA 4NRUA 3QXGA 2VONA 2UXDJ 5HLFA 4LFBJ 2ZJ5A 1NEEA 2P9UB 3I32A 2W9MA 2DR7A 1DAXA 1KL9A 2KT2A 2QMUB 4CCHA 1VQYA 3M1VB 3Q8QB 4UUWA 2HK2A 4YDUA 4B08A 3TPQA 5IXUA 1TR0A 5K9FA 2YJEA 5KT7A 4RQ7A 1E4GT 2HBMA 4O3SA 3U3YA 4CJQA 5CCMA 2FD2A 3GYXB 4DV2K 3R1HA 2QARA 2JH3A 4U7BA 1N63A 2XICA 1RG6A 4KV8B 1UFLA 5J1EB 2PGCA 2KZZA 3CO9A 2EFPA 3HZEA 1ZQUA 3MMAB 3F5EA 2AGPA 3ZDEA 3D5MA 4O55A 3H2LA 4Z0UA 4NLQA 1DBDA 2WC9A 4NMXA 4LIRA 4Q0BA 8ICGA 3AVNA 3HPHA 2NRTA 2XZTB 4AF1A 1WSHA 1C1CB 3CDUA 1S1XB 3CHWA 4ZIVA 1VQLN 3A1YG 2GVDB 3JSYA 3HDSA 1DY3A 3WU2U 4F2SA 5D0HA 4WJ3B 2AYEA 3MZIA 5FPEA 4I2DA 1B0XA 2WAQD 3K89A 4DU4A 3T1HF 3O80A 4FYXB 5GVQA 4LF6F 2VFUA 1REVB 3DOMA 1QQCA 4B1YB 1DTQB 4NZ6A 1H98A 1ITPA 4DQSA 4I6AA 4RJVA 1BIZA 4EI2A 5CYQB 3UKRA 3TUZC 4DSKA 4J2BA 1PJ6A 4FKXA 1U1MA 4NYPA 1YJWS 2M3DA 4H5NA 3D4JA 4MYTA 1K9MT 3CCSN 4ANEA 3OVNA 5IIJA 1Q3VA 4OKJA 3JPPA 1QY7A 2YHBA 3MECB 3IBWA 4X4RA 1JJ2R 2KO1A 3U9DA 4UARA 2GO9A 2WAQF 2D0PA 1ZZFA 4K50A 2V8HA 4OJPA 4J9OA 1NH7A 4DV3J 3U4LA 3J81O 1QH9A 5J2GA 4AQYK 4CNYA 2Q1LA 2ASMA 2JRZA 3A8YA 4A2AA 1CZ9A 1H2TZ 2ZWPA 4B9VA 2AF6A 3DLKA 4WZMA 2HLUA 1LOTB 1LWEB 2XMKA 2E66A 3TUJC 5KI6A 1PJ7A 2D0BA 4M5KA 4B3OA 4OZ5A 4BJQA 1FWLA 2ZBIA 2ZHAA 5A6WA 4GXKA 2KJVA 4NV0A 4RW6B 4LF5F 1XIQA 1L7MA 2FB0A 5D3GB 3PRBA 2BCSA 3MN5A 2DFLA 2J4RA 2OA8A 2KM8B 5DM7L 5CR0A 4B3SF 5ALXA 2WBMA 1QQ7A 3ISND 2VGMA 5E2QA 4JI0J 3D1HA 1ATRA 1VQ8N 2HZVA 3TX8A 3AGKA 8ICNA 3CJ5A 4Y2PA 2MJUA 3PYGA 5KL8B 4I2JA 4UW2A 3CMES 1X8DA 5IS2A 1QJHA 2HVHA 2JSXA 1ZQAA 2C3PA 5GMDA 5FJ4A 1S6QA 2IRUA 3CC2N 1RBSA 4QIWD 3QATA 5AQLA 4TQSA 3GFHA 3N7RC 2AQ0A 5AI8A 2UXCF 2Y0BB 4A8YA 2AEMA 4ZCKA 2FJWA 1ZBIA 4ZVSB 1N56A 2A1JB 2OI2A 3TP2A 3KLGA 2BJDA 3U8XA 2V63A 2PZSA 1V85A 1WSEA 1RT7A 4DV3K 1LAWA 1NH8A 3VGVA 3QICA 1N61A 3QETA 4WQ5A 4WFXA 2R7WA 4NCGB 2HFZA 2NQPA 4M47A 3N0VA 2HOFA 5F3TA 4FM2A 4FPIA 5FDLA 1NXIA 4TYAA 3O9SA 4CERA 1SIJA 4A8QA 1WELA 3HHKA 3EE8A 4KYZA 3V4IA 2Q31A 4ECRA 4M5NA 1NAQA 3MD1A 4IOAL 3KUEA 3P6YC 1NJIO 4PKGA 4A8MP 4A47A 4TQRA 2E5SA 2QWLA 4CZEA 3MEEA 4JI3J 1RAOA 5GINA 1ASUA 1IBMJ 4BRIA 1VJ5A 1UL3A 3IO1A 3CCZA 1PYSB 3SJJA 3H2VE 2A1JA 3G4SN 3W5XA 2WF5A 3VR1A 2KXFA 1AFJA 3OYGA 2I7NA 2HYIB 1TL1B 1NSAA 4IG3A 4I1TA 4F3MA 3AD7C 4P0PB 1GAOA 2UV8G 4EU0A 1M1KO 4NASA 4PEOA 1RBLA 3FZBA 4ZITA 4O0JA 5LY3A 4DG1A 4H0OA 2QA2A 4LUBA 2AXTU 2DGVA 5AE3A 5DQHA 4QIWF 2E7WA 1VQ6S 2XSJA 1SXEA 3HCXA 3D0PA 4DTRA 2ZUGA 4B3MJ 1EJ7L 4BY9C 5JLFA 4IQWA 3Q22A 2ZJRQ 2UUAF 3UMGA 2XWYA 5IT9Y 2I5JB 3AB4B 4K0KF 4WQ4C 2PXIA 2H5IB 3H5XA 4KGXB 1IJJA 3OXLA 3K8WA 1M0SA 4FPAA 2YH1A 3H0MB 4IS7A 1SBRA 1KN6A 2X51A 3GIMA 4DO9A 1S57A 3VMFB 4F4YA 3KOOA 1T9XA 2XYHB 1FE4A 3QRQA 3D54A 3N4WA 2WAQC 4DCCA 4KPYA 3NBPB 2QC3A 2FZGB 2A19A 3NH2A 4JKDA 1YJ7A 4DTXA 2Z0GA 1NPKA 2I6WA 5KG1A 4DEZA 1SB6A 3UM9A 1FO1A 2L48A 3ZD8A 2KHOA 4FJLA 2F1HA 5D46A 4B3RF 4IOXA 4FWRA 3VENA 4LSNA 2ZUCA 2LEPA 1FJGK 2IOCA 1WOQA 5JJBA 3T9NA 2OPQA 3UO0A 2W1BA 4ECZA 3BR8A 1FK9A 1JX4A 2VPXB 3K17A 4OI2A 4MYUA 5KL1B 1VSLA 2OXOA 2ILYA 2AA4A 4X64K 4WQ4A 3ZI4A 2ROPA 3LW5C 5F0WA 3L3VA 2MQNA 1IBMK 2RIJA 4Z2XA 2WB1C 3VQ5A 4C48A 4ZOHC 2WSCC 3FSYA 2H3FA 3IGVA 3SXLA 5KG4A 4KLDA 3KHLA 3MWBA 4GKJK 4DCOB 2KSOB 1U45A 4HHJA 3KK3A 3BV8A 3JPOA 3EZWA 2Q2RA 4C9DA 1WHVA 3MEGB 3GPAA 3M2UA 2C2RA 3LANA 3TO8A 3CM6A 2GWJA 4FLTA 1ZJNA 1XQIA 2BE7D 3PKMA 1Z4OA 3ENAA 1ZM2A 2AZ1A 3QT7A 2A42A 2V4QA 3B0XA 2YI1A 2WUSA 1F44A 4GC6A 1Q9YA 1RDCA 3AVHA 4FS1A 2N7CA 2UUAJ 2O5DA 4EIAA 1VQ6N 1QUPA 1YJWN 5CYJA 2A0FB 4CF5A 2ZBCA 4CI6A 2DFEA 4LF6K 4RPFA 1KR4A 3RAXA 2EHGA 2V2VA 1RWNB 1MMLA 1R0AA 2XO7A 3G87A 4J5OA 2H1YA 1KD1O 5D3GA 1YZ6A 4KHPK 4A8XA 1J2VA 3L2QA 2UYTA 3JSMA 4PY5A 3KLIA 2J7WA 1T03A 4K59A 3OQ2A 1FI4A 1DRGA 1XO0A 4PKDB 2M8HA 3GV8B 3KBBA 1NZPA 1V9PA 3OLAA 3G71N 1CS4B 3ZTRA 1BPXA 2MQQA 3IAS9 2FVSA 4DR4J 2BPCA 1I6JA 3ZT3A 3ZSWA 3UD5A 3SCXA 2P9SB 3GZ7A 5KTQA 1YBTA 1CEZA 2IMWP 3AU6A 4KH4A 3HJVA 3M6ZA 4DXLA 5KG3A 1GLBG 4C8KA 4BRGA 3GR0A 3HFZB 4IO8A 2K8GA 1SKWA 2XLKA 5CJ7A 4M3XA 1NK7A 3DDNA 3R9LA 5JLHA 3D6JA 5AKZA 1JLFB 1S0VA 3H0LB 3LGNA 3QAEA 4IFVA 4XTTA 4M3WA 2G2OA 5J2NB 4ILHA 4QZDA 3V7JA 1UPMB 4UB4A 1QVGR 2JV3A 5H9FJ 4D3HA 4TU9A 2H65B 5KFMA 2W54A 1YAGA 4JEPA 1NSKL 4BREA 1VSFA 2ZBQA 4AM7A 2E1AA 3ZYYX 2F8LA 4RNOA 4FJ7A 2G06A 2UXCK 3G82B 3IBCB 4QJFB 3R6LB 5ALUA 3FK4A 3RVCA 2J6UA 4DV6F 4DUYF 1SIWB 3AODA 4PGXA 4LF4F 5HAOA 2DPNA 1TUUA 2H3ZA 4Q2MA 3O1WA 1X9SA 3AU2A 4ZVUB 4LF8J 4P0QB 1YJVA 2ILZA 3I8BA 2EFVA 4WYLA 4BC4A 1Y3KA 1YITS 3IP4B 4EK2A 3E8OA 3W3SA 4I56A 3QX7A 3GIIA 4CO4A 2DQNB 5J0UA 5BPCA 1ASWA 3IMXA 2GUPA 5KFXA 2ZM6J 2VCPA 2DNLA 1WB9A 1TKTA 4ZCIA 3UCZP 2D74B 1SQEA 1RT7B 2QEXS 1YVNA 2PT0A 3M7VA 3EJMA 4W98A 1XNQJ 3R5CA 1BMQB 5M1QA 2KRRA 1NU4A 4CJEA 4H0YB 4KTZA 1SV5A 3TZWA 3BS5B 2F5GA 2P51A 5C24B 1HJPA 2F8MA 4OI1A 4OI0A 4LQ9A 2R2UA 3MK6A 3SDEA 2ZITA 2YB4A 3UW1A 5BOLA 2R18A 3WK5A 3V6KA 5BRHA 2QLTA 4DB3A 4YMEA 2HRYA 4GVBA 1DJ0A 1LFWA 1NDCA 2V52B 4M45A 3SD7A 4PZOA 3BGRB 4IFYA 5KT2A 1UVNA 4H4KA 1WOOA 4LF5J 1JN3A 4JD2B 4Q8EA 2YN4A 2F8EX 2KI2A 4WP9A 5RUBA 1P1TA 4KHRA 2E8AA 2HNDB 2NXJA 2N4DA 4QIEA 3T5LA 4X2BA 3FBFA 1N54B 2PN6A 3BSCA 5M2UA 4P0PA 1FE0A 3H8YA 4RUAA 2BM0A 3POTA 3MUMP 2UVRA 1U0HB 1NPRA 4OKEA 9ICCA 4RW8B 3AVCA 2C1EB 1P7DA 3MX2A 3T1YJ 3PW5A 1YJ9S 2XY5A 4KLFA 4IRCA 5J0OA 3H7HB 2AU0A 5DB7A 5M1OA 3JS6A 4DSLA 1TKXA 4ES3A 4DTSA 1L7PA 5GAGU 1JMSA 4G9BA 2CQ0A 2JH1A 3MGHA 4KHNA 3DXMA 3AO5A 2YWKA 2ZHOA 2KG0A 2I2YA 5LL6d 4JHDA 2H5EA 4DR7J 4HLBA 2JEFA 2EANA 1BNPA 1D8LA 4K8RA 3B78A 2R8IA 5ALJA 1SJFA 3CQXA 1U9LA 4B3TK 2B5JB 4JI1K 1OQ3A 4NXNJ 3TTDA 5HVGA 4ILMA 4R0EA 5C15A 1HHQA 3AO2A 3BQ0A 3CG7A 2ZJQL 4OJ6A 2ZFHA 1BWEA 1BWVA 2ZZNA 9ICJA 1IBMF 2D0AA 4ICAA 5EWGA 2M0GB 4QPXA 4RQ3A 1JNZB 3TZZA 4NLTA 4GC7A 4F0KA 3QQCD 4NYFA 4WK1A 2LVWA 4PUOB 1RZMA 4F8RA 1U8WA 2DBBA 3HT0A 3MF5A 2CNLB 3KUHA 1R0CB 1JALA 3P83D 1Q5YA 5BN8A 3V4IB 3I4PA 1Z1ZA 3V6HA 1YI2S 7ICRA 2HHHK 4O5KA 4YXJA 1N52B 2JLFA 2DY4A 2WF6A 2E6LA 4X4OA 4FK4A 2VFTA 5K8OA 3G6YA 2A3ZA 1RT3B 3L3UA 4BRLA 2DGZA 2CJAA 4M94A 4DKWA 4LSLA 5IOLA 5G4DA 1NK9A 1NDKA 1ULRA 3VQ7A 7ICOA 2IM1A 3THTA 1FJGF 3O9UA 1FRMA 3J81U 5H1SQ 1U1PA 3KK3B 4PHPA 1NGJA 2XMVA 2E4LA 4NXMK 2VYPA 2HQFA 4NXMJ 3TRGA 2J0QD 3MEDB 1GLLO 2XY7A 4LVSA 1S9EB 3E01B 1KLMB 4E7HA 1L5UA 3TTFA 3VCBA 1R0BG 4GKJF 4L8RB 5DB6A 1HNXK 1WHXA 2DBYA 3I8DA 1VHIA 1KC8O 3CMQA 1LW0B 4LBHA 4DOCA 2K4EA 1WI6A 3PJWA 2VA8A 2ZHBA 2QKKA 2EFQA 4FYWB 2DYAA 1FKOB 3NOCA 1OSCA 2Y1JA 1ZD5A 3KK7A 4N56A 1WKKA 5LOQA 2OTLN 4DV5J 1S0NA 4JP8A 3RFAA 4FYDA 1S5JA 2I5HA 1QQNA 1JJ2M 2KK0A 1NHKL 2NUHA 1HUXA 5HK4A 3CMAN 2RUGA 3EE9A 2M9NA 1RJJA 1C0TB 1WHYA 3DRSB 2E7VA 2HHVA 2AV5A 1BU6O 4ZOSA 3HHEA 1JIHA 2ZJPL 4KHWA 4QWDA 2R7TA 1CS4A 5KFEA 1U49A 2HQ3A 5AM0A 4P75A 1XJWB 3F73A 1UAXA 5EE0A 5ETLA 5IWAJ 1WC1A 4RNFA 2JL9A 1XMQK 2DIUA 3BYRA 4CDIA 2IOHA 3QU7A 2LQJA 2ZD1A 4ID5A 2KU7A 4GFJA 4JI5K 1S1WB 2G07A 4KGMA 3NKYA 2J8AA 2EFGA 2QXLA 3L7OA 3NXZA 3ZETB 4DHVA 1S6OA 3VEOA 1RZTA 1F0MA 4Y2TA 1N48A 2PFFB 2RQ5A 1VQ9S 4BC5A 3TAQA 2ZKTA 2DHHA 2RU9A 1OYEA 2R2TA 3CULA 4OX7A 2ZIXA 2PEHA 3KD1E 1YXQA 3FBCA 1RAEB 3L8BA 4M7YA 3CC4N 3LGMA 6FD1A 3IKMA 3HHDA 5HJXA 2HBZB 7AT1B 4X4PA 1BQMA 3THYA 4DR3F 5ITHA 4A48A 2OO4A 3ISBA 1NJXA 4ZLJA 3KLEB 3HSZA 5KFIA 4GMJB 3WEEA 2QJ3A 5AQKA 2BUNA 5DB8A 1WCLA 1S0OA 3TJAA 4Q2LA 4E1JA 3PIPL 3THWB 3MPUB 4DFKA 2IPOB 1Q82O 5ADXA 5AT1B 2HHPA 3DU6A 3KJNB 2KP7A 3LDLA 5MLCQ 2HQCA 4OJOA 1VRUB 2GEMA 3C5GA 2LDIA 2V51B 1K6YA 3MMCB 5ALRA 1LVHA 2Z1JA 4DR7F 4BC7A 4OV6A 2HNYA 3O4QA 5A2QY 4UBCA 3W2WB 3OR2B 4ZN3A 2KVQE 4MO5A 1S48A 5DG8A 3BF4A 4TSXA 3N79A 1VQ7S 2K3KA 3DMJA 1ESVA 2F7TA 3B4DA 2NZ4A 3FGVA 3DDHA 4DU3A 2FSJA 4RG8A 1NJYA 2P9IB 1YUWA 1VMBA 4QZBA 3PYDA 2ZC4A 4TXSA 4PH5A 2CZVC 1V9OA 1WAJA 4N8NA 4C11A 1VRTA 2VFRA 4M9LA 4ZP6A 1QZ5A 2ZE2B 3M4XA 1AW0A 4K4HA 4NXZA 2M70A 1HNIA 2XMJA 4BRFA 3Q2SC 1KOOA 4K4ZA 4DV4F 2O8FB 3O3LA 4MK8A 4F67A 3GV5B 2FE9A 2Y8YA 4K7QA 2Q0RA 2E8OA 2H51B 3FLCO 8ICIA 3EKSA 4CE9A 2G1DA 5BXIA 3B4MA 4DV7K 3RAMA 5ADZA 4KFBA 1FVSA 4M9JA 5J2QA 4CGGA 1VQKN 3CDAA 3MAQA 4Y0WA 2PE8A 3CIPA 1YG0A 4LZGA 1VK3A 5IIMA 3E1YA 3AOBA 2DRDA 5KFBA 3B9JA 1H6KX 4NL9C 1EHWA 1YSJA 2ISPA 2GAGC 2MZRA 1C1BA 2WHOA 4IUFA 2E1EA 4C4TA 4U7UD 2UUTA 1KVKA 3LO3A 4DTNA 4ZCLA 4K4SA 2Q97A 3Q7BA 1U0HA 3QT6A 1N6QA 5D78A 1ATNA 4PWDB 3HKZF 2KB2A 3VV2B 2RSQA 5JUMA 1FKOA 3CCES 4LR8A 1HX1A 2XS7A 2HWTA 5ALLA 2CPIA 3MABA 3LALA 5HMWA 1KQSR 1AT1B 4DV3F 3MM6A 2F1IA 2JHDA 2YKQA 4RU9A 1L6NA 4I6YA 4I2QB 2P9PA 2HBRB 1A5XA 1WTFA 3AA3A 2Y8WA 1XBWA 1N36K 4YY3F 3BZKA 3ZSVA 3LWMA 3H2UB 1J27A 1F60B 3QFPA 4R25A 1PUZA 2JZBA 4B8AB 2OPRB 4MKBA 3NOGA 4ECSA 3WKDA 3MDCA 3TAPA 3IG8A 1TV6B 2QYCA 4L76A 1VC5A 1U04A 2AKWB 1FWPA 2X6NA 3LM9A 3LDSA 3ATUA 5DO2A 1WF0A 4HKQA 2GV1A 3OSPA 3FDSA 4OVLA 2PFNA 4R8UA 2FVRA 3O8MA 3IR7B 3TI0A 3GCXP 4Z6FA 5T41A 3IG1A 3O0FA 4F3QA 3GDXA 5AZJA 2FI1A 4WFZA 1RT6B 2X1BA 2CQ1A 1FX2A 4PR6A 3KFUF 2QT7A 2K1RB 1DGJA 2B9WA 1S1XA 4B3TF 4CJVA 3D6TB 3DRSA 4DUZK 4H54A 4JI6K 2PFOA 2CJ9A 3WNEA 5G5GA 2DTJA 4O5FA 3LZJA 4PXBA 1A0PA 4QWCA 2BOPA 4WCEL 1R89A 4H03B 3VA0A 2W42A 2G09A 3OYMA 2AJ1A 4X66F 4M5LA 4KT0C 5HMLA 1JRPA 4FF3A 2XY6A 2ZC3A 2AJFE 5CQGA 2WSEC 4XIUA 2RT3A 5AM2A 9ICSA 4L3NA 3CJRA 3CF5Q 2XY8A 4NLKA 4MIAA 2FZCB 1T02A 1JLQA 4F4AA 1O5JA 1IBLJ 3OL7A 3AQOA 1CJTB 4PCQA 2MUTB 5EE3A 2H3VA 1BDGA 1X4CA 4FJ9A 4RW9A 5LJ3Y 2KKHA 4EMDA 4Y2IA 5KPTA 3LQVA 2DRAA 1EP4B 1WDTA 2LA6A 2NYVA 4Y28C 2OSRA 2OMLA 1F5AA 4DPOA 4KLEA 2HAIA 3GBTA 3V1RA 4QZ8A 2UUBF 2EAPA 1HWIA 3PCOB 3DMJB 3MN6A 1WWVA 2OUGA 3L2WA 1PC5A 1GMVA 2LU2A 5LL6Z 2A6AA 5HMMA 3J80O 2PYJA 2FZKB 4DUZJ 3CIMA 5JRTA 2W9CA 3I55S 4KRFA 3O4NA 4MFAA 1IBLF 2X1AA 3CCSS 3RRHA 4XPCA 4KHQA 3FCWA 2A10A 3DXKB 3RMDA 1TKZA 2H3IA 3VQTA 5A0YA 1RAJA 2JJ4D 1KAXA 2YKAA 1WDDA 4JI2F 3LWLA 1AZSB 5C0YA 3GB0A 3D2EB 1Q81T 3JSRA 2D3O1 2KYXA 1MWKA 3LP3A 2E8PA 4G6VB 3NNCA 1KN5A 1NM2A 4UY8T 1EQYA 1N5YA 2ZH4A 4WJBA 5C2GA 1RHQB 4RQ8A 4GXJA 4DJBA 2PKEA 1NBWA 3H4BA 1R8PA 2QXFA 5A8RA 1EP4A 2ZF5O 1C4AA 1YZ7A 5ALTA 4UUXA 4IDKB 3PV8A 2VKZG 1Q1KA 3KUGA 1YRXA 4O4GB 1WKLA 4X65J 1GOBA 3RMBA 1VRTB 4C11B 2YQ3A 1RISA 4ZVRB 2GHPA 2F96A 2RE2A 2O4GA 2J6SA 2HVZA 1P9QC 2RKIB 2CQIA 2IM3A 2PMWA 4K4XA 4OYAA 3GTYX 2VBXA 5BPMA 3VF2A 5C42B 3ASMA 5L1LA 4FCYA 4YS2A 4KE5A 5D4OA 4B9LA 1BGXT 1S12A 1WUDA 1YBUA 1VJQA 1U2CA 1R27B 4FF2A 3FC4A 4LSZB 3R97A 3NF8A 3WZ0A 4BR9A 4FJGA 2JC0A 4KTWA 1MA7A 4EAHD 1K8AT 2QL5B 5AJ3J 3DLGA 1ZBFA 2OCEA 2EAMA 1GO3F 5KFNA 8ICWA 7ICVA 4P4PA 3QNNA 1RDUA 4EUVA 4IOAQ 2XB2D 2ATQA 3KWIA 2COLA 5A0LA 2JH7A 1YVFA 1J5EK 2DKOB 5E84A 3OVBA 2XSJB 2HAFA 2IYGA 3MAAB 1QCKA 2IM0A 3MN9A 3SAGA 4W5QA 2XI9A 2R2SA 1SJQA 2ZH6A 1HNWF 1VQPS 3B8AX 1ZQNA 2IBOA 3HK2A 1E3MA 4QZIA 3ZT0A 2EW9A 2VG5A 2BTFA 3LDPA 4KSEB 1U1OA 3WIVA 5HRPA 4YQWA 2SXLA 3CCJS 2KG5A 4RPXA 2IM2A 5ETQA 4M1KA 2Y0SF 2QO3A 4N76A 3O9RA 4CWBA 1ZQJA 1H7XA 3DRPB 3LH2S 2H5JB 3I6PA 4OZ3A 2R7XA 4CI0B 5M1NA 1OH7A 1QQOA 4C4SA 1TMMA 2FHJD 2FDRA 1SWVA 3OPXA 2M5YA 4LIWA 4JI7K 2WOMA 1YQHA 4ECYA 5L38A 3M32B 4LF7F 1ZAWA 1H74A 5DM6L 4CZIA 3LPEA 5ALGA 2V8DA 3R5BA 2K8AA 4M5DA 4KLSA 1RWUA 4HTUA 1YBAA 3VWSA 4DV0K 5F41A 3OJUA 3B6PA 5KRSA 4CF9A 5B0AA 5GAHP 3BH6B 2G5HB 1GLCG 1LAVA 3EX7B 5AQSA 3D7SB 4AD6A 4IQUA 4DHYA 3ZSYA 3TR5A 3VTIA 2V69A 5LMUK 2P9LA 1XSNA 1JXVA 2W55A 3ZDCA 1KD1T 4B02A 4QZGA 1BQNB 3HVTA 3IFEA 3MC1A 4C1NK 3JSBA 5HRNA 3J7AP 3DU5A 2BW2A 3GJRB 4IQTA 4H4OB 2LECA 2E1MC 3OBYA 5KOWA 2HVEA 3AVBA 2L9WA 3U02A 3J7YU 3V9WA 3TEGA 2DXDA 1TV9A 4Y65A 2RS8A 3RYLA 1OVQA 4V19J 1VC0A 3THWA 3ITHA 1QVFM 2O8EA 4ECUA 3T79A 2RQKA 2WOMB 1JLEB 2LXUA 4TLQA 2O8CA 3IP0A 5E3AA 2ZOMA 4DR5K 4HWIA 3ZTQA 2F63A 1Q9XA 3IM8A 3PACA 2GW8A 4QIGA 3QGIA 3TAFA 2YKMA 5DDPC 3RH5A 2NXCA 4A8EA 1RBTA 3A0IX 4O0IA 2W11A 2NS1B 1UVMA 1UA0A 4EEKA 3HRGA 4CLTA 3VAIA 3UDLA 4KLIA 2JEJA 3SBGA 3V9ZA 4IYQA 4CIGA 3G86A 2KN4A 5DDRC 4J9UE 4J9LA 1HJOA 5GAGP 2Q1NA 4BACA 4Y00A 2OM6A 3GFYA 3KKRA 5CR4A 4WXOA 3SCIE 2H48B 3VGUA 5HSPA 5B09A 4ALZA 2CG8A 2IDLA 2ROGA 2OYQA 2CA9A 1DTTB 2LI6A 2WF7A 4K4YA 3TU5A 1Z26A 2Y9UA 4IQVA 2EFOA 1IR2A 2M88A 2W9CB 1UKUA 4KB0A 1SJRA 4PZVA 4RR5A 3UE2A 4CLFA 3VESA 1KEJA 5AM4A 1T8EA 3AM9A 2DY9A 1QZ6A 1OWXA 4USUA 2LCWA 1ZAXA 2ASJA 1NGHA 2H3GX 4RPYA 4OHWA 1TK0A 3C14A 1I94K 9ICQA 1PIEA 1VLBA 3MCNA 4CD3A 3MR3A 5HANA 1LW2A 1S7HA 2BPGA 4UAVA 3TNVA 1HW9A 4C8OA 3H5SA 1EIYB 4RQMA 1T3VA 1L8LA 2WK4A 2GWKA 5DDOC 4AILC 2MKHA 1DK3A 3GCWP 3LDAA 4QS9A 2QB0A 1TUYA 4BDPA 4FJHA 3KHGA 8ICTA 1HWKA 2OTJS 3PW7A 5CZXA 4NCGA 5AHXA 1HKAA 2R7OA 3SFGA 1X0FA 3MM9A 1RAIB 4Z4EA 1FRLA 4UW9A 2WBRA 4CD1A 1KWMA 4IJAA 1DT9A 3QIOA 2YX8A 4UTGA 1OXJA 3I87A 1VOMA 1H73A 4ZTJA 2XMWA 3K2YA 4JI8K 1WSFA 4CBWA 2BJ3A 3ZETA 2CQBA 3KHYA 3DRXA 4G3IA 4ELVA 1TELA 4CLSA 2PFPA 4EX6A 2LXIA 3QUCA 1XN9A 3M5RA 1M5PC 4HHTA 5FLXY 4MHVA 3MPVA 1WCNA 4TUQA 4YOVA 3HHLA 1S1UB 2V68A 2ZTEA 2JX2A 2KEYA 1WHWA 1ZRNA 3KDOA 7ICTA 4A8SA 4RLEA 4DL3A 4KX3A 1RT4A 2MZTA 3QJJA 2E29A 3B0YA 5GAHI 1X6IA 2IBKA 3D3CJ 2J6TA 1HIWA 5J2FA 1HYSB 2NRZA 1SC6A 1RU1A 2KXNB 1GMWD 1N5XA 2LBOA 1FWKA 2F8SA 3RU0A 2DT9A 5KFLA 4QYRA 3I56S 1WUAA 4J9MA 4M5GA 2W24A 3HP9A 4FLYA 5AIAA 1Q7YO 5DS7A 3VEYA 3BH7B 2RMLA 1E4FT 2K3IA 1TU0B 1TL4A 2GQCA 4OGEA 1CRXA 2NRHA 2YWEA 2MSSA 4NM1A 3TA2A 3FZMA 2HDOA 2N82B 5HLFB 2RF2B 3D2WA 2E8NA 6AT1B 1A5VA 1S8OA 1S1VA 4ETXA 2D1CA 3NUQA 1M6YA 1L7NA 4KLLA 3GMGA 3TA0A 5AQPA 3ZFVA 3OL8A 4C4RA 5J2KA 1V38A 5KFJA 4U96A 2QL9B 2F1FA 1SQFA 4V19X 1JJCB 1WD6A 3BBBA 1JLGB 4JK1A 1G99A 1Q53A 1MG7A 4JOUA 2YX4A 5DG7A 4EGLA 5D4LA 5AFUH 5F1XA 1S72N 1Y9OA 5D49A 4E98A 4OJLA 4FNIA 3CJ0A 3F53A 3DGPB 3VAMA 1A77A 2J9DA 3MMAA 3J7ZT 1B9DA 2QI2A 4DCJB 2KV2A 1X4EA 2CH5A 4IQMA 2F44A 4ISGA 9ICVA 3P38A 3VEWA 5AM1A 3IDWA 3QSYB 5CXTA 4JI4J 3NTUA 1JCEA 1B7YB 1ZOLA 3MDQA 2O01C 2LEAA 1LK7A 4CNZA 3DV9A 2G8UA 2L08A 2HMXA 4AFFA 2PFDA 3BSAA 1A7GE 2MQPA 2CN1A 2IJFA 3FNNA 1ITGA 5GAHU 3KLFA 3F56A 2HCFA 3AQPA 2DHGA 5DGAA 3ICLA 4BG9A 2Q43A 3SCKE 1T3NA 2VQEK 3Q8SB 1KKHA 1WEZA 5G0RB 2WW4A 4GV9A 7FDRA 1J5EF 2MPUA 1MSWD 3BGFA 4CJ3A 1X5PA 3JTPA 1Q46A 2Z30B 4X62J 1VR6A 2YQ1A 4CLWA 2WF9A 1K9MO 5CHIA 4Y2CA 4A2BA 3O5TB 1VIOA 5HROA 4CZKA 2BEFA 2WBNA 1CQMA 4IOBA 1HPZA 3QNWB 2OEJA 1K8KA 2ZJRL 3CCUS 4F3OA 2JLGA 2ZUAA 4MIBA 3DNCA 3C94A 5AXKA 2FLLA 4BE1A 1R59O 1TK8A 1YIJN 4NLNA 4AL7A 3QUQA 4KY3A 1H2UX 1WNSA 2A5XA 1TV6A 3CF5L 3VF6A 3FJ2A 2E2PA 1S6PA 1KAYA 4GY2B 1IN0A 5EWEA 2KT5A 3TWHA 3W65A 2F9TA 4KLQA 2ZIWA 4B3OB 3M2VB 3H25A 1WACA 5AZIA 5C5JA 2C3OA 5L1KA 3B82A 4P7TA 9ICOA 3GP9A 4CZJA 1NNEA 4KB7A 2HHHJ 3DGVA 2W7AA 1PK3A 2RQMA 3UI3A 3JSMB 3CJ7A 1NSQA 2KM8C 3NMUA 3J7A1 1RGVA 1PK1A 5I42B 5AQYA 1RWWB 4N41A 5LMUF 3SDEB 4EEYA 2FIUA 3ZD9A 4CIFA 1JL2A 3LVVA 3J80Y 4QWBA 3AY9A 1R6YA 1MN7A 4ER8A 4WK3A 3UR0A 2DTUA 4OZJA 2PFUA 4YP3A 5LM7E 4RUBA 5F2RA 3QESA 2KDOA 1E6YA 3ZSXA 4WIIA 2P2CB 4JV2A 4DV4K 5M1FA 2HNDA 2VG5B 5CCLA 4OZNA 4ZVEA 1TYQA 2YH0A 3V72A 4DOBA 4RNHA 1DLOA 5I3UA 3UWTA 5ALFA 2ASPA 1T6CA 4ECTA 1RBUA 4DR5F 1NGAA 1KNZA 2YPZA 2F9WA 3QJLA 3M8WA 4OLPA 3SK3A 1I94F 4GKKJ 4QYZJ 3E9LA 2DK2A 3L95X 3SFUA 3DI6A 2BANA 3ELHA 1WC0A 4H5WA 3G8QA 5FRNA 5KFOA 1MMDA 5HBMB 1OS5A 3ZZUA 2AGOA 3J8AA 1RCOB 4C80A 5D4BA 5MAOA 3GIKA 4WFAL 3C2LA 3T1AA 1C0UB 3DLEA 1IKYA 2B8QA 5CYQA 2E5GA 5JVGQ 4L3KA 1KVAA 4BRCA 2FC0A 3DXMB 3OTBA 2VICA 5CRXA 8ICBA 3AMZA 2P6UA 2W2OP 4E2FB 1B22A 2BQUA 3M6WA 2UUAK 4HCBA 3PYEA 1ZPWX 3D2NA 3VERA 4K0KK 2QARB 2DNNA 1J2MA 3K5LA 3FZLA 2PD1A 4TY8B 5BR8J 3AD9C 1M5VC 3SQGA 4IL6U 5AQOA 1T6DA 2J9DE 3UPFA 1U09A 1GOAA 3FM9A 2WVEA 1PILA 4NLWA 1ZBTA 1W2IA 3KG1A 4BLGA 2WVDA 3RB6A 3KK1A 4CW7B 1UETA 4FZYA 3MMBB 3RSEA 8ICZA 3V81A 4ZVPB 4O3QA 4O3RA 4I0WA 1FD2A 3B8HA 4E7LA 1HYVA 1WG1A 1CJVA 2YWWA 4HACB 4PG5A 3LYSA 9ICKA 4N5SA 1KVJA 4OL8A 1PZNA 1RBAA 3KLEA 4M3TA 5DBCA 4RWTA 2AQ4A 2P35A 4M5DB 2YX7A 3NS6A 2E5JA 2W3RA 2CNOB 4RUCA 1X5TA 1XS9D 4M6WA 1GLAG 1RTHB 3DJCA 4XEIA 4P10A 1RCHA 2DNPA 4CESA 1VRQC 5MLCV 1UEUA 4PQUA 1HBNB 1NKBA 4X66K 5AR0A 2AX1A 2KL8A 2WONB 4BR7A 1V5VA 2QL7B 2HQDA 2D3OR 3TTCA 4YCXA 3L9ZA 2FGOA 3UMCA 3J7Z5 3MM5B 1PVQA 3TA1A 3AN1A 3G10A 5A8WA 4J9SA 5KQ8A 4KB1A 4IBNA 2BQ3A 3MXJA 3G6EN 5AQGA 4KJIA 2ZGZA 2MQ8A 4DTOA 2AT1B 2JWNA 5KG0A 4DQQA 2EC2A 1PG5B 3NCIA 1HD0A 3DWLA 1XO1A 1K44A 9ICGA 1ZQIA 5IIOA 3CT9A 3PW0A 3V6JA 3QGGA 2BABA 5HROB 2BBEA 2D7SA 4CYUA 2HMIB 1TKXB 4CJTA 5FPDA 2HS3A 4BR0A 4ZP7A 1TAQA 2B9YA 3WBZA 4AQYJ 1EWQA 2W9BA 1RSCA 3HSTB 4PWUA 3M9MB 2IVPA 3BUZB 4IEEA 3C21A 5AI0A 1TVRA 3FBBA 1AROP 4HHUA 1NZAA 3DM2A 3FE1A 3F9KA 2LM4A 4Y0FA 3O6QA 2XEXA 4JI8J 2B56A 2EAOA 3H7IA 2FLOA 5KQDA 3SBMA 4H5RA 4F5OA 1KQSM 5KFCA 1AUSL 1LFPA 1V97A 4AHTA 4LFAJ 4W5TA 1FDBA 4BS2A 3QUTA 5J2CA 1TQLA 3ILOA 4QOTA 3U3GA 5A2QO 1RYUA 1SKUB 1GLFO 4I2BA 2B7CB 5CABA 1VIXA 3OR1A 2BYCA 3EW9A 1DQAA 3TX0A 2BKPA 3NF9A 2VJ5A 4RNMA 4IZ9A 3GSDA 2J76E 4IH6A 4P2XA 1KLNA 5J29A 1RADB 2CDRB 1WI8A 1JJHA 2NRXA 1C0MA 3DKDA 3KIOA 1XHXA 2XI3A 2BJ8A 2VGNA 2KKVA 2MQOA 5FROA 4JS5A 3DOKB 2OELA 2CQ3A 4KKOB 4TNOA 5KGXA 2AX0A 4LRCA 4QNLA 2QWRA 2QLFB 1RTDB 2DPJA 4CLLA 3ULDA 1J6ZA 5AXMA 3QU9A 4CH0S 3WK4A 3PX6A 2YMLA 4ZTFA 4WP8A 4FLWA 3H8SA 2HK3A 1RI7A 3DLKB 1Y5IB 8ICHA 2B9EA 2NZCA 1X60A 3IWLA 4IOCQ 3M3ZA 4P9SA 3RJJA 4XK8C 4I69A 5EE1A 2CPJA 5AQJA 3OBWA 2K89A 3I5CA 2UXDF 4FW2A 4M63C 2HHTA 1S9EA 1KDHA 3VAKA 4CJ5A 5E3CA 5KPZA 4PRFA 3BEGB 1COOA 3KG0A 4PL2A 1ZQMA 2FY8A 4PPZA 3L7PA 3CXCR 1KW4A 1SQGA 1FRKA 4AQYF 4KHYA 2EG2A 1C0TA 2BZFA 2VUGA 3O6WA 1B70B 4NA3A 4ZVTB 1UHUA 2YNGB 5C2DA 1HNWK 2YX6A 3MXMA 3ZZOA 4U95A 1Z00A 3D2QA 1YJTA 3HPOA 1I3AA 3QIPA 1HBUB 4USVA 5DLFA 5M2RA 3MOJB 7ICNA 1S9FA 1PAUB 2K60A 2P9NA 5H9EK 3ATVA 3R7NB 3LP1B 2AYMA 3VQ6A 2IA6A 1WOSA 4EZ9A 2PDAA 2A1SA 4CEEA 2MKYA 4NLVA 4UAZA 1KVCA 2ZNYA 1HNVA 1L3KA 4JKAA 3FGUA 3C7NB 4NYOA 2NO4A 2FC9A 4RQ5A 2E1ZA 4CEFA 2RDIA 4I29A 1ZD3A 4F4WA 3CC7S 4LFBK 3EKUA 1IG9A 2JFDA 2HBQB 4C8LA 1RT2A 1CQNA 3MOZA 5EX0A 5AKHA 3OYIA 1S1WA 5IT0A 1U2VB 4TY9A 2GHVC 3AH6A 3WHIA 5F3XB 3QNMA 3P4UB 3L4QA 4OYZA 1UCVA 3BM7A 4IKAA 2HMPA 4CT8A 9ICEA 4B3MK 3PEHA 4WTOB 2R4FA 2F65A 2ZH1A 1Z05A 4LH4A 2M7SA 4W5NA 4KHMA 3BGRA 2YJFA 3JTOA 3T41A 4GXIA 2LPEA 3OTQA 2KXHA 3GFZA 2DNGA 5C24A 1W7WA 2X74A 5GADU 3I56N 2DO0A 4EYHB 2LKYA 3C6UB 1F0XA 5HVFA 8ICKA 1FESA 1QAYA 2ZUDA 4DR6F 3MR5A 2GELA 3D67A 4USMA 2VIXA 3D66A 2AP6A 3N4QA 4V19S 3RJGA 3C15B 4OX6A 5L1MA 2G8WA 1GOCA 1NGDA 3R2DJ 1IG6A 3FVYA 3BQTA 3ZTOA 2NSCA 2I5JA 2P9GA 3BO4A 5M1KA 1PBAA 5DQIA 2IIHA 1CZAN 1Z4NA 4RW7A 2PI4A 1CZBA 3GL1A 4E0DA 3N6NA 3WT0A 2HFSA 4ECQA 4K0KJ 2BJEA 2CVIA 3OL6A 1KQKA 4HH0A 5T7LA 4YG2A 2G1HA 4Q43A 3AQFA 1GTEA 3TAMA 2OANA 5GMKa 1RGIA 2LYBA 3A5NC 3VZIA 2OAUA 2OSQA 5CB1A 2IHMA 1S1UA 2XULA 5FPNA 4YB5A 2WHEA 1G2EA 1ZM3A 3T6BA 3ADAC 2C28A 2VDHA 3OYLA 3KMQA 1NMNA 3BEXA 2AYBA 1RNHA 2A3VA 2KOBA 5D0RA 3ZZYA 2V4JA 4JKCA 3CCMN 3CC7N 4PXEA 3R1XA 3UN5A 4CBUA 4FXDA 3ZSOA 2ZZMA 1KS2A 3OYCA 5KOXA 1UOCA 2VWJA 1F3FA 1NGFA 2QA4G 3U1MA 2IGIA 3EVMA 3V6DB 1CG2A 1XERA 3CPWM 4FWSA 1J53A 1KQFB 5T7LB 1TKTB 1F9FA 4MEXA 4J9QA 4JI3F 4L73A 2GVDA 4P4OA 4QS7A 2Z4PA 3ZCMA 4CZGA 5ALDA 1VAZA 3KD3A 5HP4A 4DPUA 1DKGD 1ZBHA 1R43A 4HDGA 4B1WB 3FMBA 3K7RA 2PI5A 1KDNA 2IRXA 3FKBA 5E7OB 3H3OB 5HMYA 4NY8A 3MTKA 4QBUA 1ZQFA 2FLNA 3IUCA 3IN5A 4DS5A 1WC5A 3QGHA 1M1HA 4FZXC 4A62A 4NJ8A 4MAKA 2QTDA 1XMOJ 1HNXF 5ALPA 2Y1IA 4YMNA 3VETA 2GC8A 2GGPA 3BGUA 4CH7A 4G1QB 5H1SV 2DD8S 3MGVA 4F26A 4MLHA 4YMOA 2UP1A 2U1AA 4LFAF 1J2NA 1GQEA 1N34J 4JYAJ 2W25A 3TJ9A 5HL7Q 2MZJA 2BVZA 5EUHA 2MSNA 3C1YA 1V3RA 5HOOA 4DR3K 2QWOA 4I2AA 3HM8A 2DVIA 4IG3B 4ZJOA 2NREA 4F04B 4DR1K 3F44A 4BRHA 5AJ3F 5J0YA 4IQXA 4V1Ak 4CFCA 2LSNA 1T03B 4JI0K 4M3RA 1ZZNA 4EZ6A 4WIQA 2CWKA 2LXFA 3HT3A 1IBCB 1WG4A 2F77X 1UZDA 1X7VA 1BY9A 2FMSA 3H46O 3SQ2A 3S8SA 3HYFA 3TKAA 1UWAA 2P9KB 4NLCA 4H4MB 2F4VF 3NNHA 2YTUA 2ABYA 1C0UA 2J7KA 4JI5F 4C8ZA 2BZ2A 5TZVA 2CXEA 4JKGA 2I9SA 1JLAA 1QAJA 1PC4A 1N32J 2PA8D 4K2XA 4ZJQA 2YWFA 3RMAA 3WC0A 3CW2C 2MDAA 1NK8A 3DOLA 5LSLA 5E3PA 2AIRB 1BPDA 9ICBA 4DOAA 5K4LA 1KSPA 4FKYA 5SUHA 4M5IA 2X7IA 5J0RA 3TOQA 1QD1A 4R65A 1YGYA 4RQNA 3KLGB 1S9GB 4ZVHA 2DO4A 5FPMA 3PX4A 1EKSA 3CJSA 1CI4A 4GV3A 3M8QB 2A40A 1HLWA 1S6PB 3M9NB 1BL3A 2IIRA 4PUOA 3OY9A 1SCJB 4ZJLA 3P45B 4Y34A 1WWHA 5ELZA 4ZMMA 1HMVB 5J0SA 1N36J 1COKA 1Y88A 1DTTA 4NLRA 1XNQF 4LH5A 3QEVA 2CGKA 3ETLA 2HZCA 4LMZA 3DOLB 3CMEN 3BF3A 2F8KA 3NGKA 2OMOA 1TUVA 4M3ZA 1IH7A 3OTOJ 4BXOB 5IIIA 4JKGB 3WEEB 3H1QA 3M7DA 2LQ5A 3UKRB 1URNA 4URSA 3G71S 4KHPJ 4DR3J 3C6HA 3CIZA 3OFHA 4BRQA 3NS1A 1TMJA 4KHUA 1RWMB 5AK6A 1BQMB 1VQMN 2IFXA 1NJZA 3VEXA 3W64A 4DV1K 2NZTA 4OYWA 3D3BJ 2CADA 5DZ6A 3C19A 3R3TA 3C46A 4E1MA 1RDBA 3EEQA 1HBMB 8ICCA 1RWXB 4P2HA 5HO4A 1R8HA 3MM5A 3KHHA 5J2DA 4X4NA 4LF4K 5D4PA 4E3SA 2M9KA 1CJUA 2GJ2A 2MB0B 5KFSA 1ZQKA 4BWMA 1PYOB 1UWBB 4OX9K 2FTRA 4DUTA 3HHNB 4WTYA 2XS5A 3I76A 4JUZA 2BW7A 5DGBA 1Q7LB 1S97A 2CGJA 3P39A 2DNOA 3E9PA 2HEKA 2OJ3A 4YHHK 3MCAB 2EZZA 4WFAQ 2EK6A 1T0TV 4JB8B 4CZHA 4CK2A 4BRPA 1UQVA 3HWTA 2L3MA 3D2FA 2P9IA 5D6GA 2RP5A 2ASOA 2BH1A 3LPYA 4LSLB 3UR3C 3BPSP 5J0WA 5KFAA 2JEIA 2G0JA 2JRSA 1O8BA 1IKXA 5CH7B 3CETA 4A8WA 3T7ZA 5AKYA 1L3UA 5ETTA 5K8PA 2IAJA 4JI6J 4FN5A 7ICLA 3RB4A 4N77A 1KEKA 3ONNA 2ZIVA 1TL3B 4CO1A 5J1PA 2OHFA 2FJBB 2HURA 2VOPA 4DUZF 1UWBA 3QBWA 1OJ4A 4F0MA 3R8YA 2BCQA 4F3TA 4B3RJ 2J5AA 3NE6A 4QU6A 1BNOA 1Y0HA 4AL5A 1OKJA 2BJ1A 2BKEA 4YOXA 3S3OA 4CLYA 3O8WA 5J2MA 1ZBSA 3H0RB 1NK0A 4WBFA 3AA5X 1FXXA 1C1CA 2I0XA 3HZ6A 3M6GA 4KH5A 3AD8C 5AQQA 4WXWA 4CE6A 3SQIA 1OY6A 9ICMA 4KLTA 5AZIB 2G0CA 1GX6A 2QMXA 3UVJA 4CLZA 3R9PA 3QWPA 2IVOA 3JPRA 5KFWA 1NNDA 1SV5B 4DMZA 1KAZA 1SL0A 1BIUA 4K8XA 3Q23A 2MQMA 4US8A 2GS8A 4CF0A 8ICFA 3HLUA 4DR5J 3CJKB 5I3QA 1X4HA 2KIVA 1JWWA 3RB3A 5BREA 1DZ5A 2VC1A 2G08A 3Q89A 4K42A 1B43A 1O03A 1VGYA 4KPCA 3BQ7A 1HQUA 2YHYA 1E6VA 2JOQA 3J7YI 5J2MB 2P1JA 3PFEA 4AT1B 4DZ6A 3TZYA 4IXCA 2CUYA 4FWOA 3I1YA 1HPMA 3UXPA 5ALEA 3TSPA 4P0QA 4FZZA 4ED3A 1N0VC 2XZDB 4RBUA 3NCQA 4PG7A 1NJWA 3O4WA 3IAM9 3ULEA 7ICQA 1R3NA 2D3DA 1U1QA 2AJ2A 4CJFA 1ZBLA 1YJ9N 3OFGA 3I28A 1FRJA 4E8UA 2OPSA 2JVRA 6FDRA 1U25A 2WVFA 3TSUA 3SQ1A 3SMZA 2HFUA 1UT5A 3Q8YA 4HH1A 4PA1A 4YB6A 1APSA 2Q3SA 3EDRB 2W41A 1J5EJ 3GJTB 4DPTA 2ERRA 3R6MA 4NLGA 4LREA 3R8EA 3OHBA 3IWXA 3LTOA 2FVPA 4H0VB 5DDYA 4QQBA 2RILA 4YD1A 2O66A 4YFKA 4R0JA 1VQ4N 4BXOA 1MU2A 5JS2A 4PHTX 2PSZA 4BC2A 1YKWA 3M2RA 1NDLA 2BE9B 2E1YA 3RTVA 2QYGA 2MJNA 1VK0A 1LWCB 1JMTA 3DYAB 4LRAA 1SS6A 4CK3A 4RUHA 2I1RA 5BYRA 2F2AB 4Y2JA 4KHPF 3G4SS 2NXNA 8ICPA 2CZ4A 2GMLA 5HR6A 1RTIB 3PM9A 2IVNA 2P5GA 3GOIA 2F7VA 1A6LA 2NLWA 1OPIA 4Z7YA 2OPQB 2EWHA 3OR2A 5JS1A 2XTJP 2VG6B 1NRKA 1URRA 3UQ2A 4JI5J 3HSDA 2CZ9A 3EM1A 4KREA 3VQ4A 2Y3YA 5ETNA 2GX8A 4I28A 4DQ8A 4M41A 1FDDA 3KOAA 2A6OA 2LYVA 3QFWA 2P6TA 3S3NA 5EU7A 2FY1A 5DBBA 3NRZA 3C5FA 1HFEL 2EX3A 3G82A