4UQGA

A new bio-isosteric base pair based on reversible bonding
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title "Post-it" type connected DNA created with a reversible covalent cross-link.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4uqgA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4uqgA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqgA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4uqgA01
1JLBA 4FJ5A 5CHGA 3N4MB 3ULDA 3N97B 4DG1A 4CIEA 2YNHA 1Z00B 3JPNA 5EWEA 2W9BA 4UAYA 3ZD8A 4CESA 3V9WA 4ZH4A 1SV5A 4KHYA 5BOMA 4BXOB 4I2PA 4NM1A 4E3SA 4DOBA 1G15A 5KFYA 3SPYA 1C0MA 3V1RA 3OYJA 1Q9XA 1S9FA 4O9MA 5C5JA 1RT3A 2Z1HA 4BDZA 3PY8A 3QEXA 1HQEA 4IQVA 1K6YA 4I29A 3S9HA 4M3TA 4JV2A 4RUAA 2J6UA 5J2IA 3LZJA 3U6FA 2MAXA 4J9QA 4EBDA 3VQQA 3H4DA 3HPHA 2RKIA 5D3GA 4KN4A 3AVJA 1JN3A 1WCLA 3LALA 2IS3A 5DQIA 3KK1A 2WTFA 1UAXA 4J9LA 4YXJA 4CIGA 2ISPA 1B43A 3RTVA 4CHZA 5DG9A 2DPIA 2JEGA 4ED7A 2YV0X 3C2MA 3DRRA 3EPIA 1JLCA 5HNKA 2A1JA 4CK3A 3T5KA 3AA3A 2IHNA 1BQMA 4Z4FA 4ECUA 4DSEA 1JLFA 4PGXA 2ASLA 5C24A 4QZFA 5J0YA 3TAPA 2JEFA 4I2HA 3ZD9A 1DTTA 2BQUA 4IKFA 3KTQA 1KTQA 4OKJA 4FYDA 3KIOA 3HVRA 4RQ8A 4OJRA 4YMOA 7ICNA 8ICNA 2ATQA 2BCUA 1UA1A 4ICLA 9ICBA 9ICEA 4O5EA 5CZ2A 5KFLA 3PW2A 4KLJA 1LAVA 9ICTA 3C6TA 4KPYA 4DU4A 5KFNA 5I3UA 1J5OA 4RPYA 4CJKA 3EY1A 1JX4A 1RT1A 4YP3A 3P83D 4Z4IA 1KSPA 4I2FA 1NJXA 4NCAA 2X6SA 5CB1A 4M04A 4RT2A 9ICUA 1VSKA 4CHPA 4RW4A 5HLFA 3QERA 3C2LA 1S9GA 1JLGA 5KFRA 2D0CA 4KI4A 5D49A 4UB4A 4ED2A 3L3VA 2XGQA 1RT6A 1SKWA 2ZUCA 4DL4A 2PFOA 4GXKA 4I7FA 1RTHA 2C2RA 1LWCA 1S1UA 4AILC 3V7KA 4KI6A 4YFKA 1RYRA 2HNYA 4CJLA 4F93B 4Q8EA 2UVRA 3ZT4A 3RJJA 2KQ2A 4ECTA 4TQRA 3HYFA 4W5NA 1C0TA 3OYKA 1SKRA 4NXZA 4AHSA 4FO6A 3C94A 1NJWA 4GLXA 7ICEA 1TV6A 5DB9A 3AVIA 4F4XA 3Q8RB 4I2GA 4KHWA 3LWMA 2LYHA 4MFCA 7ICGA 4KLUA 4J9KA 3MXIA 4PHAA 3B0XA 1IXRA 1IM4A 3HT3A 2YKMA 1ZQVA 2RN2A 1RTJA 3LANA 3QO9A 5JS1A 2FLLA 2UVUA 5SWMA 8ICXA 3AO5A 3UXPA 5DG8A 1TL1A 4IG3A 3Q8SB 3MR3A 2JZBA 2ZTCA 1ZQMA 1U47A 2BGWA 3F9KA 1RNHA 1KFDA 1Z26A 5J0XA 3VQAA 3DLBA 1IKVA 3MR2A 3SZ2A 4KLLA 4EEYA 4PPXA 1JKHA 1WSJA 4RNMA 5FDLA 1XWLA 4J2DA 2A1JB 3QEPA 3LP2A 3I8DA 1K1SA 3IAYA 4FJMA 3NFAA 3H8JA 1KRPA 3AO4A 5DBAA 1VK0A 3FYHA 4CF8A 4QZ9A 5HRPA 4YXMA 4QZBA 1NJZA 4FLWA 1GOAA 5DGBA 3MECA 4ZTJA 2AU0A 4N5SA 2F1JA 2KZMA 3DLHA 2Q3SA 1WNSA 2FPMA 1KVAA 3UQ2A 2VG5A 1EKEA 2BE2A 3HK2A 2VA3A 1RXVA 4JWMA 1JLEA 1DLOA 1QSYA 1U9LA 3V9UA 4Q45A 1TL3A 5J0SA 1MQ3A 8ICSA 4CJEA 4I2AA 5J2PA 4DSFA 4QW8A 3T19A 1BISA 3ZT1A 4TUSA 3KK2A 1ZQWA 4I2EA 3AVBA 2O4IA 7ICKA 1C1CA 4CJPA 4G3IA 3OHBA 3KD5E 4ED0A 4NYFA 3SPZA 2ASDA 3THVA 4Z4HA 1U45A 7ICRA 4CF1A 3RR8A 5J0OA 4ELTA 1IH7A 8ICZA 4DL2A 4MFAA 4ECXA 3BGRA 3EPGA 2BCRA 4M3YA 8ICWA 4Y1DA 1RDAA 4EBCA 3OYLA 5HHIA 1TK5A 4Q44A 8ICLA 5KT7A 4MF8A 4CEZA 1BPYA 2YNGA 2G8FA 4QCLA 1ZQLA 3OYAA 4DTOA 3QE9Y 2XO7A 5DKWA 4HHTA 3TAFA 1V9PA 4LSNA 4C8LA 5KG3A 4KREA 4W5RA 3D45A 3AU2A 3PMNA 1B92A 2G8KA 3C95A 4F4WA 3BQ0A 1GOCA 2Y1IA 4QZAA 5IIOA 2IOCA 2ETJA 5J2GA 2UVVA 1ZJNA 3ZSXA 4CEQA 2BR0A 5DLGA 3E2EA 3OGUA 2F8TA 3VQCA 2X78A 2HHWA 5DMRA 3G6VA 4DF8A 3JPPA 4IDKA 1KCFA 2ZQBA 3G6YA 4LZDA 3ZDCA 4NLNA 2FLNA 4UB1A 3L2RA 1J54A 1UA0A 3AO1A 4JV0A 1RT7A 3PX4A 4UBBA 1LV5A 4I28A 4R63A 4DOAA 2JZBB 3PVXA 4J9OA 1K1QA 4RW6A 2AJQA 4FLUA 1BGXT 3UXOA 3Q8QB 5TZVA 1BPXA 1Q9YA 4JV1A 3HPOA 3HP6A 2MUTA 4MFFA 1HMVA 1RBRA 5KFJA 4ELVA 3GIIA 2KFZA 5KRTA 2WOMA 5DK5A 5J0UA 4KRFA 4M0AA 1YTAA 5IIMA 4AHCA 3OYEA 9ICFA 3ITHA 5DBCA 3VQ5A 1HYZA 3RJEA 1TKTA 2W8KA 2OZSA 1ZBIA 4DOCA 4KTWA 2NUBA 4K4GA 4QWCA 4IQTA 3IS9A 3QEAZ 4CJFA 1N56A 4BDPA 5IIJA 3QINA 1RBVA 3HX0A 2ASJA 2W8LA 4CIFA 4DL7A 3VQ8A 4O5KA 3RBDA 1U49A 3GQCA 9ICQA 3V7LA 4BGDA 3NF7A 3RBEA 3H8SA 1RTIA 3AVNA 3AO3A 2W9CA 1NK9A 3MEDA 4I9LA 4MF2A 5DQHA 4F5PA 4HUFA 3KHLA 3O4QA 3QESA 2KZZA 3AVGA 3V9SA 2PYJA 4C8KA 5EOZA 1EP4A 4MEYA 4FJHA 3Q8MA 4KB1A 3RRGA 1VSIA 2PXIA 2JEJA 2RDJA 3LAMA 3H7IA 1VSJA 4OPJA 4IQWA 5DG7A 1RT5A 2DFFA 4OPKA 4EYIB 3O4NA 4QZGA 4ED1A 4K4IA 7ICUA 2EX3A 3SJJA 4NCBA 3EZ5A 4M9GA 3MBYA 3SI6A 4CJTA 2GWSA 1HUZA 2DPJA 1LB2B 2X74A 3M9OB 1W0HA 3L3UA 3MDAA 5DB7A 2Z1JA 4RQ2A 4RW7A 4OGEA 3HVTA 3ETLA 4NCGA 7ICIA 1CZ9A 4QWEA 2FBYA 4YG2A 5KG7A 4NM2A 3V6KA 4JRPA 4ED6A 4DFMA 8ICBA 4M3WA 3U3GA 3RRHA 4BE2A 1XS9D 1RT2A 3NF9A 5KG1A 4CF2A 4ED3A 5E41A 4PHEA 1SUQA 3SUOA 3ZSYA 1ZQIA 8ICHA 2B5JA 3TR8A 4IQUA 3ZSZA 1U04A 5J0WA 5CY4A 3RJHA 5J2HA 3AA5X 1XO1A 4LZGA 4DTUA 3L2QA 3HWTA 2PFPA 4FW2A 5F9NA 3OS2A 4F3TA 3SV3A 4KHSA 3MGHA 3HW8A 1ZQYA 3G6XA 1XI1A 4I2QA 2FPKA 5KT6A 2EHGA 3OYCA 1ZQKA 4Z6FA 9ICCA 3OYIA 1CXQA 2V4RA 4RUCA 4K8ZA 5DLFA 3KHGA 2XHBA 4KAZA 4FK4A 1VSMA 3PO4A 9ICOA 4FM1A 2FLPA 3IHQB 3AVMA 2FBVA 3RMCA 4Y1CA 3MAQA 2B6AA 3CM5A 3G0ZA 4DTJA 1KVBA 2ITGA 1T3NA 3QZ8A 4YR3A 3ISNC 4EZ6A 3AUOA 4O3SA 2YKNA 4XRHA 3LP1A 4ECZA 3GILA 2HNDA 3V4IA 2W9CB 3V6JA 2IAJA 4P4PA 3S3OA 4Z4EA 3DOLA 4KHQA 3NGZA 1I3AA 2RF2A 4DLEA 2P6RA 1WSEA 1S6QA 1YT3A 4DTNA 3ZSOA 4QZIA 3OYMA 4JWNA 2FBXA 4I2DA 4RQ0A 3TQ1A 3HPGA 4KLGA 4FJGA 1UT8A 4Z0UA 4GC6A 3OYFA 4KLSA 3PW5A 3MFIA 3RB4A 3ZT3A 3VQBA 5KFSA 4N41A 4FZXC 3QIOA 1L5UA 3NH0A 4KLMA 3CFPA 1VSFA 3ZDDA 4YD1A 4ECQA 1QTMA 4AHRA 3OVNA 3MR6A 2UVWA 8ICJA 4OKEA 1TK8A 3RMBA 2QK9A 5KFZA 3JPTA 2IBKA 4J9NA 4YMNA 4GMJB 3QEWA 3CFOA 4PGQA 2BCVA 3TWHA 2R8JA 4R66A 1ZQCA 3RJFA 1RDCA 3LP3A 4QZCA 4CJRA 4EYHB 3JYTA 4BE1A 1LW2A 4ECRA 4CFBA 4GC7A 1ZQAA 8ICOA 1REVA 9ICRA 9ICPA 4LSLA 1ZQJA 4AHVA 3K4GA 4TQSA 4KO0A 5L1IA 5KG0A 3KHRA 3RH4A 9ICAA 3A2FA 2HVIA 3ORYA 4CGHA 3KKSA 1XHZA 4FJ7A 2BQRA 4KV8A 1UWBA 5CP2A 1RTDA 4RNNA 2C28A 2DTUA 5HP4A 3PX0A 7ICQA 8ICCA 1TGOA 4O3RA 2E4LA 2M9NA 1NKEA 1B9FA 3V72A 2YHBA 1HNVA 5J2JA 2WONA 4KHUA 4FM0A 5HRSA 1T4GA 1T8EA 4PUOA 2ISOA 3K57A 4DFPA 4KLOA 1BPEA 3IM1A 3KLFA 5KFVA 4KTQA 3TAQA 1GOBA 7ICHA 4CCHA 1MC8A 5KG4A 5IIIA 4FW1A 1C6VA 4P4OA 2ZTDA 1ZQQA 2YHAA 3VN5A 4Z4GA 4KFBA 5KFBA 1FKOA 4TUPA 2HHQA 2W9BB 5J2BA 4CGDA 5JS2A 1J9AA 3SQ2A 3T1AA 5KFPA 3LPUA 3L8BA 4CEBA 3VQDA 4M47A 3EW9A 4KITB 3OSPA 3WNHA 1N48A 4E1NA 1DOQA 5J29A 2X6NA 2OPQA 3E01A 3RAQA 8ICRA 3OYHA 2IMWP 4CGIA 3H4BA 1S6PA 1JXBA 3TABA 1FKPA 2BCQA 4KLTA 3T5HA 4O3OA 5J2MA 2XCPA 1IKWA 4IFVA 4Q5VA 4DTRA 4KB0A 4KLHA 1ZQHA 3K5LA 3AVCA 4E0DA 4DSKA 4FLXA 1S77D 3IRXA 8ICEA 4O55A 2A1SA 2XCAA 4JK1A 1XC9A 1LAWA 4IR1A 2FMPA 1MU2A 4IRDA 2F1IA 8ICMA 1ZQEA 9ICLA 1EX4A 4QWBA 4J2EA 3BQ1A 5BPCA 1BI4A 4QWAA 1RZTA 4O3PA 8ICPA 1ZQUA 1TKZA 1VRTA 3VQ4A 3PW7A 4ELUA 1WAFA 3AA2A 2G8VA 3NDKA 7ICPA 4M42A 4ECWA 3P5JA 1CXUA 4YFUA 3CYMA 1JLAA 1BPZA 3WNEA 3DLEA 4RG8A 1RILA 1WSFA 4M45A 4F2SA 4DU1A 4RPXA 4KKOA 3U3YA 2P5OA 2W9AA 3UIQA 2C2EA 3KKRA 1B9DA 5DGAA 4LH4A 4CF9A 2HHTA 4M3RA 2OPRA 5HMLA 5J2CA 1X9MA 4RQ6A 7ICLA 3OYGA 3ZDEA 4DTSA 4CEOA 1KLMA 4YVZA 1LW0A 4YMMA 1ZQGA 4F4KA 1IKXA 2HMIA 5BOLA 3LAKA 4DMNA 1X9WA 1JXLA 3NAEA 3RR7A 2I9GA 3LDSA 2BCSA 1D8YA 1B22A 3Q8LA 1RDBA 3RWUA 4UB5A 3V7JA 4TUQA 2VG7A 4CJSA 5KGXA 3HL8A 4L8RB 4CFCA 5HBMA 5KT3A 4DQRA 1NK5A 5L1LA 1ZQFA 3NCIA 4AHTA 3SNNA 4PWDA 3M9NB 4RQ7A 4E7JA 5J2FA 2HNZA 4W5TA 1A76A 4FBTA 3AU6A 4IRCA 4UB3A 2IHMA 3I0SA 4QZDA 3SV4A 9ICSA 2D0AA 2PZSA 2HW3A 4O0JA 2VG6A 4YQWA 2R8KA 2OZMA 5L1JA 3C5FA 4LVSA 2NRWA 2B4JA 4RW9A 9ICWA 4E1MA 4DQIA 4J2AA 5KFKA 3V9XA 9ICVA 5EWFA 3AVAA 3DMJA 5DB8A 1BL3A 1W9HA 4LH5A 2HVHA 1BPBA 2YNFA 4HCBA 3SUQA 2DFHA 1Y88A 3JSMA 1UOCA 1QSLA 5CA7A 2ZJ5A 1C7YA 4F3OA 1S0VA 2AGPA 2IDOA 4I2JA 2FC0A 4CJVA 4BWJA 1IO2A 3CQ8A 3CG7A 7ICFA 1HYVA 4FJ8A 5JUMA 8ICAA 4M9LA 3MEEA 4TSXA 8ICYA 3UXNA 3ZDAA 2DFEA 4CJ5A 4K4HA 2BPGA 3M8RA 4HUGA 5DDMA 2R8GA 2ZD1A 4B08A 3NBPA 4PHDA 5SZTA 1A5XA 4CEDA 3NTUA 2P5GA 3KLIA 4Z6EA 7ICSA 1RT4A 1ASWA 4R64A 2BKEA 3C1ZA 2H5XA 4DL6A 2FMQA 1HRHA 1VRUA 5KFUA 2NRZA 3ISDA 3MDCA 3K59A 4O4GA 5KFFA 4BXOA 1ZBFA 2KTQA 3QEVA 3DRPA 4W5QA 3DRSA 2IA6A 4J9PA 5KI6A 1VSEA 3TARA 3TAGA 4FJ9A 4M41A 4O5BA 4F50A 4FJXA 4N47A 3DYAA 4B3OA 4F91B 5KFOA 2Z1GA 2XY6A 2BPFA 8ICTA 4O3QA 3BJYA 1VSLA 3VQ6A 3L2WA 4RW8A 2QKBA 4JS5A 3HP9A 4MEXA 4EP5A 4FJJA 3OYNA 5J2EA 4CEAA 1IKYA 1KFSA 3ISBA 2P1JA 4YR2A 4JRQA 1Z25A 1RDDA 3OY9A 4CGJA 2RDIA 4R8UA 3OSNA 1FK9A 3NGYA 1S1TA 4E7HA 3NGDA 3K5OA 3SQ1A 3KLEA 2OWOA 1BCMA 4DL5A 3KD1E 1L3SA 1RCHA 4DQPA 2G8IA 2B21A 4DSJA 3L2UA 2VWKA 5IINA 4R5PA 1WLJA 1UT5A 3AVLA 4O5CA 1S0OA 3OS1A 4Q0BA 3FDSA 5KFDA 3EYZA 4FS1A 3PW4A 1JLQA 3OS0A 4J2BA 3KK3A 7ICMA 2KZ3A 3C6UA 1JIHA 5I42A 1VSDA 3IG1A 4FLYA 3GFKB 4I27A 3K2PA 3NH1A 1TKXA 5KFQA 5KT5A 2P51A 3LPTA 3VQ7A 2D5RA 3TANA 3SQ0A 3MXJA 5KFIA 5J2QA 4FCYA 2P66A 1ASUA 7ICVA 3TI0A 4CE9A 1HQUA 4CFDA 5KFHA 4RQ1A 3MGIA 5HROA 4C8NA 4M3ZA 9ICHA 4CHQA 4E7LA 4HVJA 4M9JA 3Q8PB 4CF0A 4IRKA 1BIZA 5KFCA 3PW0A 3KLGA 2MUTB 1S1XA 5DB6A 1EETA 4DQSA 3HO1A 4NY8A 1BPDA 1C0UA 8ICQA 5KFMA 1D8LA 3C23A 4DWIA 1I39A 3T5LA 3M9MB 4KN7A 5DBBA 1DGSA 4ID5A 2ZJAA 1T7PA 2ZE2A 1WSIA 3DLGA 5DQGA 4OLBA 5KRSA 3OHAA 4KTZA 2J6SA 3GV5B 3K5MA 4PHPA 2KW4A 5IIKA 4WE1A 2HHSA 1L3TA 4FM2A 3BQTA 5T7BA 1NOZA 4M6WA 4DSLA 5KGWA 3GIKA 4XUSA 2PI4A 4YNQA 4ZTFA 4ECYA 4PQUA 1X9SA 3ASMA 4DSIA 2I1QA 1S1WA 4P2HA 1ASVA 1C1AA 3V9ZA 3O3FA 1JXEA 3DI6A 1U48A 3ZT2A 4CJUA 3LZIA 1KEJA 5J1EA 1NK0A 4F4ZA 2GBZA 5KFEA 4M9HA 4C8OA 3BQ2A 4N56A 2BANA 4B9TA 1JL1A 1XSPA 4DO9A 5HP1A 1A77A 4YR0A 2LSNA 1S0MA 4Q8FA 4NLKA 1WCNA 3OYBA 3EWAA 1O1WA 4I2IA 4QWDA 3NF8A 3H08A 1F21A 1TFRA 4F5QA 5L9XA 2VANA 4R8UB 1HPZA 1IG9A 4F5OA 4RPZA 1D9DA 1A5VA 3O3GA 1L3UA 4JS4A 5KG5A 5DDYA 1S97A 2FBTA 4M9NA 8ICVA 3OJUA 1L3VA 4LY7A 4FVMA 4O44A 5HMMA 4NLZA 2PYLA 5KG2A 4EBEA 1EXNA 1N5YA 2F8SA 3KHHA 1COOA 1BVSA 1S0NA 2D0BA 4YD2A 4CGFA 2F96A 2Q0ZX 1SKSA 4EP4A 4B9VA 3ZSWA 4E7KA 2V4QA 4F4YA 4CJQA 1TVAA 4BE0A 3ZSVA 1KLNA 3QEBZ 2V9WA 1WN7A 4E89A 2KN7A 4QAGA 1JMSA 3S3MA 2G8UA 1YTUA 3SUNA 3QLHA 4CHYA 3T5JA 2XY7A 2PI5A 4JUZA 1ZJMA 5J2DA 3L2VA 1ZQSA 1ITGA 4FLVA 1C1BA 1X1PA 4FJIA 1BHLA 2FPLA 5C42A 2ATLA 4DFJA 3HJFA 5J0RA 3V6HA 4I2CA 1LWFA 2JEIA 3C2KA 5J2NA 3RMAA 1TK0A 2W42A 4B9MA 8ICKA 1TKDA 4IBNA 1ZBUA 4FZZA 4IFYA 4PY5A 5CJ7A 2HHXA 4FK0A 3D0PA 2OPSA 5C25A 4M6WB 3QIPA 4O0IA 1S5JA 4M3UA 3M8PA 1CLQA 2JLEA 3C21A 3T3FA 3VA0A 4CHOA 4J9MA 3LWLA 1EXQA 3GV8B 4CGGA 9ICKA 4DLGA 5KTQA 2C2DA 3SI8A 1QS4A 4F8RA 3VA3A 1FXXA 1NOMA 4KLFA 3MABA 2PFNA 4KMUA 3MFHA 1YVUA 2R7YA 4GXIA 2R8IA 1AROP 2DY4A 3TAMA 5EU7A 1R0AA 2JGUA 4CFAA 3ZT0A 4OVLA 3GIMA 8ICIA 5IILA 5CR0A 1RPLA 2AQ4A 1WSHA 2RPIA 4G1QA 4CHNA 3ZCMA 9ICNA 4Z6DA 1TAQA 4DF4A 1D9FA 3CFRA 5L1KA 3V1QA 1U4BA 3V81A 4DTMA 4RU9A 3SCXA 4B9NA 1NKCA 3SQ4A 1N6QA 3P1GA 4FBUA 5FRMA 4RQ4A 3KLHA 4JLHA 1XU4A 3NF6A 1T05A 4QZHA 3JPSA 4HUEA 9ICXA 3JPRA 2W9MA 9ICMA 4FXDA 3K75D 4PH5A 2E6MA 4DFKA 3RJIA 4BACA 1TVRA 4O3NA 5KG6A 3V6DA 4ECSA 9ICGA 2XGPA 1ZYQA 5HHHA 4OGCA 3PO5A 4B9LA 7ICOA 2VA2A 4BWMA 5EWGA 3O3HA 4FZYA 4CEEA 4XA5A 1RBSA 5CWRA 2BPCA 2VA8A 1WAJA 4IR9A 2ALZA 1NOYA 1CEZA 1XHXA 2IGIA 4B9UA 1LWEA 4QW9A 1CUKA 2ZUBA 4UBCA 1S1VA 4ECVA 3RH6A 3PR5B 1TAUA 4FK2A 4CJ4A 3PMLA 3B0YA 5CYMA 2PFQA 1KVCA 4UB2A 2Z1IA 2ZJ8A 5FROA 4XQ8A 1NK6A 4RT3A 3UPQA 1ZQRA 1NJYA 3MEGA 5FRNA 2HHVA 4I2BA 4M2YA 3WNGA 4NYNA 2BGGA 4CERA 3RB3A 3ZSRA 1JL2A 1RYSA 7ICTA 2OYQA 5J2AA 1ZQZA 3M8SA 4J9RA 4X5VA 4UQGA 4RQ3A 1XSNA 5J0PA 5HRNA 3PR4A 4GVMA 4LD0A 3RJGA 3S3NA 1J53A 3PX6A 5D4BA 1H38A 5K14A 3DM2A 3AVFA 4FLTA 2OA8A 1BQNA 1HNIA 4ZHRA 4F92B 4H4MA 3LP0A 3WNFA 4OKKA 3PNCA 5KFGA 2R8HA 3H8WA 2C22A 4RNOA 5F9LA 4OLAA 2FMSA 2E6LA 9ICIA 3TFRA 4NLGA 3ISCA 4DS4A 1VSHA 8ICFA 1S76D 3AO2A 3RB6A 2AGQA 4UAWA 1ZQDA 5KT4A 2YNIA 3PUFA 4FS2A 3NGIA 1Q8IA 3QNOA 4AH9A 4H4OA 3K58A 4KLEA 4KLIA 4DEZA 4PGYA 2NRTA 1BIUA 2G8WA 2F1HA 1PZNA 2NRXA 4RZRA 3F73A 4H8KA 4F5NA 4Z4CA 1ZETA 4C8MA 3VQPA 1S10A 1QLNA 4GW6A 4E19A 3HXMA 4ID1A 1ZQNA 2XC9A 1BI4B 3FFIA 3I0RA 4HTUA 1S9EA 8ICGA 4GXJA 2BDPA 2ZTEA 3MR5A 3V1OA 4FJKA 1QE1A 1T03A 4F2RA 3SYZA 4CEFA 1ZQOA 4B8CA 4DL3A 1QQCA 2PY5A 1ZQTA 2I5JA 3UQ0A 4XIUA 1A5WA 2P6UA 1Z3EB 1SZPA 1WSGA 4CJWA 3GDXA 4EZ9A 3LDAA 5KFTA 3C1YA 4PA1A 3DLRA 4CECA 2HHUA 1X2IA 3RMDA 1XSLA 3Q8KA 4FJLA 2HB5A 2QKKA 5J0TA 1QHTA 5CYQA 4FJNA 3RH5A 1Z00A 2AQ0A 1RBTA 4P4MA 4BDYA 2J6TA 3NHGA 1ZQPA 4R65A 3AA4A 1RXWA 4TURA 4E7IA 3M8QA 4B8AB 3OJSA 3ZSQA 2XRIA 3AVHA 3TAEA 4I9QA 4HYKA 3HM9A 4DS5A 2ZUDA 5KFXA 3QETA 2KFNA 3TFSA 1BCOA 2QXFA 3SUPA 5CZ1A 4M3XA 1TV9A 1QSSA 3AV9A 1HJPA 8ICUA 4MFBA 5J0QA 1RBUA 4DTPA 4KHNA 4W5OA 4J9SA 1ZQBA 3AVKA 3NH2A 5KFAA 4N76A 1HJRA 4AHUA 2AGOA 3G10A 2OPPA 4F5RA 1SL1A 3H40A 4DQQA 3C5GA 4QZEA 4K8XA 4CK1A 3LK9A 3VQ9A 2G8HA 1Y97A 3NE6A 3HSTB 2VWJA 4IG0A 1CZBA 4KLQA 3B6OA 3ALYA 3RAXA 1KFTA 3MXMA 4QZ8A 2IC3A 1SL0A 1DTQA 3PV8A 1ZBHA 4HCCA 4DTXA 4Z6CA 5J2KA 1NK4A 3VQEA 4DU3A 2DFLA 1KDHA 3QEIA 2BQ3A 1D5AA 4YCXA 1NK8A 9ICJA 1HUOA 4B9SA 3DOKA 4FLZA 2A1RA 5D46A 3DLKA 4QOZB 3RB0A 4YN4A 1SL2A 3KJVA 2GV9A 2O4GA 3ZDBA 1HYSA 7ICJA 4CK2A 2Y1JA 3B6PA 1ZBLA 1NKBA 4CJ3A 2XY5A 3GIJA 4KLDA 3JPQA 1MSWD 4RQ5A 1MQ2A 4Q43A 3QZ7A 3K5NA 3RJKA 4UAZA 4ED8A 3JPOA 3BDPA 5HRRA 2BHNA 2GUIA 3GV7B 3OYDA 4MQ3A 1NK7A 3QNNA 5KFWA 3CM6A 5KT2A 1ZQXA 2XY8A 2NRVA
chains in the Genus database with same CATH superfamily
1FF2A 1NSAA 4WPAA 1SJRA 3SCKE 4AL6A 4CIEA 1RQ0A 2DRAA 1BDGA 5K8PA 1W2BR 3G9CA 5EWEA 1FRMA 1EZZB 4NYZA 4LVOP 1CQNA 3M6WA 5MAOA 4DZ6A 1VQ8S 2KIVA 3EJMA 1VQ6S 4ZVSB 1TE2A 1G15A 4JI0J 2NZCA 3T9NA 3OVBA 5C5JA 1RT3A 3DXMB 3ZETA 5F2RA 4L76A 4IQVA 3O44A 2L41A 4RW8B 2CQGA 4M3TA 2NSCA 4CE6A 2LI6A 3LZJA 2KDOA 2QMWA 3KKAA 3T1HF 3M2VB 3VQQA 4CO5A 1V3ZA 2MZTA 3D67A 2E9ZA 1W25A 4Y2IA 3KK1A 3TZZA 1SQKA 2V51B 5AM3A 1ZZFA 1CJUB 4CHZA 3VEOA 2YH1A 3VZHA 2YMQA 1NRKA 4GKJJ 4C6AA 2L9WA 2HFZA 2O66A 2B4OA 2A1JA 2HZCA 3SMZA 2XZTB 3KUHA 5HL7Q 4F26A 1QY7A 4I1TA 3AA3A 3GFZA 2WCXA 1BQMA 2GH1A 4Z4FA 2K06A 3ILOA 4PGXA 2ASLA 2VBWA 3BS5B 3MI7X 2E5IA 1QVGM 4LFCF 3WXMB 2FZKB 3FSXA 2BQUA 2ASOA 1Q82O 2KVIA 3QT7A 5JVGL 5EXWA 2ZH1A 4YMOA 8ICNA 1X5PA 4M95A 1UA1A 4DUZJ 9ICBA 9ICEA 1O13A 3X1LB 2MQNA 1U1NA 5KFLA 3PW2A 2HS4A 2GQ2A 1LAVA 9ICTA 3L9ZA 5KFNA 3IM9A 1YBAA 3IRUA 2HWHA 3KYLA 4CJKA 3RSEB 1ZOTA 4Z4IA 3VAIA 1C4CA 4NCAA 5ALHA 4HT7A 5D4LA 4M04A 3JSRA 2N7CA 1YRTA 1X4GA 1S7HA 5THWA 2W11A 3C2LA 3QERA 5KFRA 2D0CA 5D49A 3B8AX 2GVZB 3J81j 1RT6A 3LF0A 2AJ2A 2PFOA 2UUAK 1D8BA 4LF6F 4I7FA 3GE9A 4E98A 4PQUB 1SXLA 4K42A 5AQKA 2VONA 5F8LA 4KI6A 2NPFA 1HNZF 3I4PA 1RYRA 3E3XA 4CJLA 2NNWA 3AD9C 1HW9A 2UVRA 3L7OA 3M8YA 1KD1T 2HSTA 3IBPA 4LFBF 4ECTA 1SV5B 1IBMJ 2ZZNA 3MUVP 2XHWA 3C94A 2YQ3A 1TAMA 4GLXA 2KG1A 1MA7A 5DB9A 4DV7J 3Q8RB 2XI2A 4KHWA 4LF5J 4AQYK 1HQEB 1YJUA 2VPWB 3B0XA 1A7GE 2YKMA 1ZQVA 1DGJA 2QYGA 1RTJA 4DHVA 5SWMA 3G25A 1TL1A 1AXQA 2ZTCA 1U47A 2WB1F 1YKWA 2RKIB 5J0XA 2A2DA 3H25A 3KMSA 1COKA 4YOUA 2FGCA 5J8YA 3O1LA 3C28A 1WSJA 5GADI 1U1PA 4OHZA 1HW8A 3L4IA 1YXQA 3R5AA 3QEPA 4AUKA 2X1BA 2NXUA 4OYZA 1VK0A 4HHJA 1ZAXA 3K9KA 2LA4A 3QJLA 5HRPA 1YITN 4FLWA 4Y0FA 2QA4N 5DGBA 3H8YA 3TA1A 1A0OB 1WNSA 3CGIA 1YGYA 2DT9A 3MC1A 2VG5A 4AL7A 3HK2A 5AQMA 2FQQB 1RXVA 2VDHA 5F8NA 4Q45A 1XMOF 1TR0A 3K17A 3MM6B 8ICSA 4JKBA 3MN6A 4DSFA 3R5JB 5C2DA 1HNWJ 2WRMA 4CZIA 1ZQWA 1TL7B 2ZC4A 3C6TB 2O4IA 3W63A 4M5JA 5I3UB 3OHBA 1N5QA 3SPZA 5A8KA 5J0OA 2RHKA 2FC8A 4DL2A 1U2VA 4NLXA 4M3YA 3CQXA 3THYA 2PE8A 1UFWA 1RDAA 3CJBA 3OYLA 4ZOSA 1JLGB 2KXHA 4DV0J 2HGMA 5C25B 4ZPDA 3K0JA 3TSQA 2OSQA 1QJHA 3HOTA 3M8PB 3H2LA 2QARB 1PUZA 1ZD3A 5GAHU 2MKIA 2VIXA 4C11A 4LSNA 4C8LA 1I51B 2WBRA 3CRXA 1SQGA 4PKGA 2DO0A 3WEEA 1G3OA 4EGLA 1B0VA 1FESA 5HJYA 4F4WA 3J80U 2FXUA 4QZAA 3BM7A 1MWKA 2IOCA 5AQYA 4ZPBA 4CEQA 2R9LA 1L7NA 4OYOA 2BR0A 3NS6A 3PHEA 3TZXA 2K4PA 3E2EA 4J03A 2J5AA 2X78A 4UY8T 1FJCA 4DV1J 3DOMB 1RWWB 1JMTA 3ZDCA 2Q6CA 1WC4A 4AM6A 5BREA 4UB1A 4EAHD 2VFVA 2ZNYA 3L2RA 1J54A 2M52A 4NZ6A 3AO1A 2CVEA 4BRPA 1RT7A 1IBKF 5BYSA 5K8OA 2EFGA 3O6WA 2JZBB 2NO5A 2HQIA 1VQNN 4RW6A 1IKVB 5C10A 4MK9A 3I56N 2D9OA 3FZHA 3W66A 3DU6A 2KKVA 1JKHB 2WOMA 1WF1A 2ASPA 4ZN1A 4Y0WA 1YTAA 4JKDA 1CZAN 4AHCA 1VK3A 5DBCA 4C48A 1RWOB 2CJ9A 2F4VK 5AICA 3OTEA 4ES1A 4DOCA 3QT5A 3IP0A 4K4GA 4QWCA 2UUBK 4IQTA 1TP7A 3P5BP 3QEAZ 1N56A 4BDPA 3GJRB 3VGTA 3QINA 2DCUB 5F3TA 1R0BG 4JP8A 1JK9B 4A8FA 1HQ2A 2KU7A 4CIFA 2Q0RA 4F02A 4JKAA 2LYAA 5RUBA 4K4TA 2HBJA 4LRBA 4BGDA 5HI7A 3DC2A 1RTIA 3NY0A 3AVNA 3AO3A 3N79A 3CE8A 4I9LA 4OPHA 4MF2A 3I96A 5DQHA 4HUFA 3O4QA 2V7ZA 3R9PA 2L08A 5F1XA 4KT0C 1I94K 3MEGB 4KRWA 4FWLA 3A8IA 5CRXA 3HZ6A 2MQLA 1RAOA 1VQ9N 5EUHA 1Y7PA 2HFSA 2XI9A 2HRYA 4CT9A 1LWXA 4DUZF 4OPKA 4QZGA 4ED1A 4C97A 1GMWD 1RDFA 4OJ5A 5IV3A 3EZ5A 4CYUB 3MBYA 3FJ2A 4XH4A 2KJ8A 2WAQC 4OZ2A 2A41A 3M9OB 2FZGB 1DAXA 4CF3A 1CJVA 1SC1B 4CLSA 3GYXB 2FJDB 3HVTA 2V2ZA 3ETLA 4WP9A 4M5KA 3J7YI 7ICIA 4IYQA 3CCJS 3W65A 3N6MA 2FBYA 2MZQA 4YG2A 2C2KB 3V6KA 4JRPA 1G99A 4DFMA 4IDKB 8ICBA 1F2GA 3U3GA 1M90T 1XS9D 1F9HA 1HKCA 5AQSA 2KFYA 3HX9A 4H4OB 4ED3A 5E41A 1SUQA 5HSPA 4IH5A 4FYYB 3AJDA 5DETA 3S7RA 1VQ7N 1U04A 3H45C 1W7AA 4CZKA 2D3DA 4NXMJ 2VL1A 1IBLJ 3L2QA 3M6GA 3MCAB 1YVFA 4MKYA 3FFIB 3HWTA 2AIRB 4N8OA 1T03B 2EC0A 4F3TA 4LF5F 3KUEA 5LMUJ 2KH9A 1UQVA 2QA2A 3SJHA 3MGHA 3ITHB 3W2VA 5ALIA 1BHNA 2WBNA 5AIBA 1FE0A 4MK7A 1RWVB 3OYCA 1ZQKA 4Z6FA 1D8ZA 3OYIA 1B70B 4LF9J 2OFGX 4RUCA 3G8TA 2FLPA 3IHQB 3N6LA 4KE5A 1YK9A 4LR9A 4Y1CA 3MAQA 4X64K 2B6AA 3PYDA 3G0ZA 2FJAB 1U8WA 2GJFA 4GNIA 2XYHB 2ITGA 4DTJA 4OI2A 1PO6A 4H54A 4ZLPA 4ZP6A 3SMSA 3CMAN 3IA0A 5LJVA 3AUOA 2FE9A 4M8LA 3HHLB 3LP1A 5HMWA 1QAJA 4P4PA 2IRXA 5GINA 1KQKA 3CD6S 4DCJB 1GTHA 2IM3A 1WHWA 2F4FA 5ETRA 2X1FA 3HKZF 3IFRA 1WSEA 1RG6A 1AA1B 4DTNA 3ZSOA 3FZBA 2FBXA 3RBXA 1G2EA 1NDKA 4DR3J 3TQ1A 3HPGA 1Q3UA 2ZBCA 4Z0UA 3K5PA 3OYFA 2UZAA 3ZT3A 1HNWF 4N41A 5G0RB 4ETZA 4FZXC 3QIOA 1HR0K 4QU6A 4IJNA 4KLMA 3CDAA 3ZDDA 4YD1A 1HLWA 1DQ9A 3P4UB 5H1SV 3MR6A 2UVWA 2MMYA 1EKRA 3J80O 4J90A 8ICJA 5AQIA 4JI7J 1TYQB 1GQEA 1HBOB 1PILA 1Z1ZA 3RAMA 1G4CA 8ATCB 4C1NI 3DHXA 3THWB 1RWXB 1WI6A 4DV0F 1Q86O 3TWHA 4A62A 3RJFA 2XS7A 3J8AA 4QZCA 4CJRA 4EYHB 5J1NA 4ECRA 1ZXIA 2R7OA 4GC7A 3PJWA 4CFBA 2CQBA 2LA6A 4U96A 3WK9A 9ICPA 3TTCA 1ZQJA 2E1YA 1VHFA 1ZC6A 3GG1A 4WIIA 5JMVA 1WEXA 3RH4A 3QFWA 3THXB 2B5JB 3A2FA 1R0CB 1T02A 3CJKA 1SBRA 5FIIA 4KV8A 4PYDA 3E9OA 2OANA 1X9JA 1X4CA 2ZXHA 3D6HB 1GX5A 1DZ5A 5BRFA 2EBGA 4IH7A 3MCPA 4HL9A 4O3RA 3JSYA 3ZXWA 2DXEA 1EJ7L 1NKEA 5ALWA 4KGZB 5J2JA 4DR1J 4KHUA 5I9EB 5HRSA 4FM0A 5E5NA 3QRQA 4MMOA 3GJQB 2ISOA 2MXYA 4PUOA 1JRPA 1JNRB 4DFPA 2G08A 4I2QB 4FF1A 3GTYX 5T7LA 1BPEA 3IM1A 4WK3A 3CIPA 3TAQA 5GAEU 4BR2A 3A3PB 4MIAA 2BJ7A 2ZTDA 1Q81T 2AZ3A 2WAQD 2F63A 3SQ2A 2RNEA 3MZIA 3R3TA 5KFPA 4DCHA 1BXNA 2P9PA 3OTDA 2YKNB 3JS6A 3VQDA 4M47A 2H48B 4IOXA 3ENBA 1N48A 1IWAA 5EVZA 1X4EA 4XK8C 1DOQA 3KFWX 1RHRB 2OPQA 1QQMA 2F3NA 1XR5A 5BR8K 2UXCJ 3E01A 2Q6BA 4WCEL 1FD2A 2KXNB 1OY8A 3A3OB 3M8WA 2IMWP 1ZBSA 5B7WA 1JXBA 2BCQA 2F3JA 1N5SA 2DH9A 1IKWA 2CQ0A 4IFVA 3KK1B 3FRYA 1ZS6A 4QJVA 3Q0AA 4FPBA 3AVCA 2BOPA 3TACB 4UY85 4A8XA 4E0DA 4PG5A 3KNGA 4ILJA 4WFBQ 1F60B 2SXLA 8ICEA 2A1SA 1N4LA 4K5SA 3MHYA 1GLLO 3LL3A 2E1RA 3MMBA 4NWIA 4OYAA 4J37A 4KJIA 4J2EA 2JXJA 2OELA 2VODA 3LH2S 1BI4A 1RCXB 2BVZA 3HF5A 1RZMA 1CJTB 4BGAA 1FJGJ 3LDOA 2YHWA 4M94A 2KVSA 3R5BA 1ZQUA 1TZ0A 4ELUA 3AA2A 3NDKA 3EMTA 4CRXA 3BBFA 1CPZA 1UVJA 3Q22A 2VKRA 2PN6A 2R42A 1JLAA 2A0FB 3WNEA 3BBCA 3DLEA 5HVHA 3J81U 2JGAA 5L39A 2OI2A 3ZTQA 2X1GA 4KKOA 1D9AA 1UWBB 3UIQA 2LLZA 2C2EA 3KKRA 1RTZA 5B0CA 9RUBA 2IVPA 2KSOA 4EFAC 5HMLA 4BRDA 1RYUA 4CT8A 3NCQA 1HL6A 3JQKA 7ICLA 3N9UC 1X40A 2W1BA 4OYMA 3R1HA 3QU9A 2HEKA 1K9MT 2BJ1A 2KK0A 3M6VA 2ADCA 3LAKA 4DMNA 5AI8A 4I7FB 1E6YA 3NAEA 4IL6U 1DY3A 1E6VB 2YPYA 4ES3A 4X62J 2DISA 5M1KA 1RDBA 1IBLF 2HFUA 2NYHA 4UB5A 2LXIA 2VG7A 1Y00A 7AT1B 3F44A 4L8RB 5GMDA 1ZD4A 1J2NA 1CG2A 2COLA 3PM9A 5LMUF 4ZK7M 2EDUA 4NXNF 4ILMA 1YLXA 2X7IA 2UUCK 3M9NB 2F1FA 9ATCB 4RUBA 2DITA 3SBTA 4W5TA 2B3TB 2YKMB 1A76A 2I1RA 4IRCA 4UB3A 2QWRA 2IHMA 3PSPA 1RTJB 3NGSA 4WIQA 1WOSA 1NLKL 3E9PA 1NMEB 2PMHA 2CPDA 1S6PB 2GQQA 4MDBA 4YQWA 3R8YA 4K2JA 5DZ6A 2DTJA 3I8BA 2FJBB 2B4JA 3SDEB 4JI3F 1CJKA 4OV1A 1N36J 4OPAA 2MPUA 4DQIA 2QLWA 1P9YA 1XQIA 3I55N 2QWOA 4YOYA 4J2AA 2MKJA 4ES2A 4CM0A 3V9XA 3NRBA 3DMJA 1GLEG 4EIAA 2HVHA 1PJ5A 4RNHA 2DFHA 3N7SC 4K4ZA 3SEIA 5BN8A 4NYOA 4QJFB 1UOCA 1QSLA 1Z4NA 1Q3VA 2E1PA 5KPRA 4Y65A 1S0VA 2AGPA 2IDOA 4CJVA 1J5EJ 3G82A 3VF2A 4DR3F 4M9LA 2VG5B 4TSXA 8ICYA 3OPKA 3UXNA 4DV4J 5A8RA 1MWZA 1VRTB 3VGLA 4CZEA 5E3RA 2D0PA 4UARA 1KD1O 3ZZOA 1FRJA 1ZXOA 4HUGA 5DDMA 5DM6Q 5SZTA 3NTUA 4H0YB 2P5GA 2MZJA 3KLIA 2J9EA 1TUYA 1DKGD 2HWTA 2QYCA 2LU2A 2CDQA 3DGPB 1RU1A 1YJWS 2DR7A 4CO4A 4UZBA 3NXZA 4YEAA 5A8KB 2C2NA 1FD8A 4I6MA 3MDCA 4OYIA 4O4GA 4ED4A 2JJ4D 5E0OA 3G4SS 4MHVA 1U2VB 4FF4A 5ALPA 2IA6A 5KI6A 3D54A 4US8A 1JROA 1EQYA 1SKUB 2IBOA 1OSDA 5DM7Q 3DYAA 2XY6A 4O3QA 3GP9A 3L2WA 2DXFA 2V4JA 3J7ZT 1IWGA 1IKXB 4FJJA 4EP5A 4ANDA 2IOFK 3OYNA 3R3LA 1A6SA 5AM2A 5J2EA 3UN3A 4BRFA 4G6VB 4C11B 4LSNB 3MDQA 3ISBA 2XM3A 4YR2A 3CC2S 2XNRA 3WEEB 3OY9A 2RDIA 3OSNA 1FK9A 1S1TA 3QJJA 1YZ7A 4UTGA 3C19A 3NGDA 3NGUA 4Y6IA 3TX8A 2HKEA 3Q7CA 2E8OA 1NGFA 4HHUA 4DL5A 1RCHA 4XAKA 4DSJA 3L2UA 2VWKA 1X6IA 4BHQA 2ZJPQ 1YJNS 4IO9L 3H5YA 1WLJA 4O5CA 4I56A 3UNYA 4DR1F 1ZTTA 2YX8A 4DR6J 1RAGB 3OVSA 2K8GA 1VSDA 2HNZB 2ZOGA 3IG1A 2ZBRA 1YI2S 1TKXA 5KFQA 7FD1A 5IM0A 4ZVRB 2P51A 1RT7B 3LPTA 4NI2B 2D5RA 1TU0B 3MXJA 1ICEB 5J2QA 3Q86A 1CC8A 1HQUA 4QZVB 2DNKA 4RW6B 2ZM6J 1KN5A 2KICA 4HHHA 9ICHA 4FYWB 3R2CJ 4HVJA 1M1KT 3Q8PB 1W7WA 1OYDA 4CQ1A 3GYGA 3SK3A 4LIRA 4FOEA 1S1XA 4X66K 1OUQA 1TFYA 4DQSA 3HO1A 1PVPA 4USMA 2E1EA 2D69A 1B99A 1BPDA 8ICQA 5KFMA 1I39A 1XO0A 3J7YP 2MZRA 4MDAA 3TNVA 1DGSA 4TNOA 1VJQA 4ID5A 5ADZA 5HK4A 3OHAA 4FYXB 5AI0A 3K5MA 2VZ9A 4GKKJ 3MEEB 3L4QA 4OZ0A 3WIUA 4PHPA 2KW4A 4WE1A 3ZYYX 3FZLA 3BQTA 1Y4ZB 4M6WA 3GIKA 2YCHA 1CULB 5F3ZA 5AQWA 4YNQA 1EQ0A 2ZHBA 4BBYA 1VHIA 5B0BA 3D3BJ 3ASMA 4UY8O 1GLFO 3VERA 2XYPB 3ZNJ1 1UJ6A 2F44A 4ZPCA 1U48A 2QW9A 1VRUB 4GO7X 2FSNA 2YB4A 5GVQA 5EN1A 5J1EA 3UKRA 3AAQA 4H4KC 1OYEA 5KFEA 1S6OA 4M9HA 3DRSB 1U24A 1YAGA 3A1YG 2FF6A 4ISFA 1HWLA 3NRZA 4DUYJ 3LM2A 1A77A 3U1MA 4FE3A 3VENA 1WCNA 3MM8A 1XN9A 4L75A 3NF8A 2A6OA 3W62A 1WSRA 3SFGA 3FK4A 1YJVA 3FBEA 5C2FA 1D3WA 4C3LA 4UOFA 1HPZA 4F5OA 4RBVA 4RPZA 1CJVB 3NLCA 2W7AA 3BZCA 3HVTB 3KLEB 2WUSA 5LOQA 5KG5A 3HMJG 4AXIA 2ABYA 4XPEA 2P9KB 4HDGA 2ZOFA 1JLQB 3WX4A 3T1YJ 1IUJA 5HMMA 2FY1A 2M7SA 3F5EA 3EXCX 1EXNA 1N5YA 2QM1A 4FWOA 2RQ5A 1K44A 1S0NA 2V5HG 1NGAA 2D0BA 4WTOB 2WF6A 5C7PA 4X65K 4CGFA 2F96A 4X62F 3ZSWA 4IC9A 4E7KA 3ZZYA 4A8QA 4F4YA 4CJQA 3NG8A 1TVAA 2H3IA 4M5LA 1S4FA 5HROB 3BH6B 3D1OA 1KQQA 2HAIA 2ZH6A 3F53A 2W7OA 4QAGA 5D78A 4OYBA 4WFZA 1KVKA 4ERDA 3SUNA 4ZVQB 4CHYA 2O5DA 3WKBA 4H5VA 4EI2A 3L2VA 2NXJA 2IVYA 1SJ4P 1ITGA 2E2NA 4FLVA 2ZUAA 4CLWA 3W2VB 4FJIA 1PYTA 2BXJA 4LT6A 3QBCA 2GELA 2D3OR 2G9OA 3W8PA 1LWFA 5LSRA 1WACA 4DX7A 1OVYA 3W8GA 2EK1A 1XUPO 2DNLA 3D68A 8ICKA 4LIWA 4ZVPB 4PY5A 2J0XA 3DEEA 2HHXA 3D0PA 1N36F 2UXDF 3ZZPA 2B6AB 4GY2B 4M7YA 5IT4A 4MYUA 1T9WA 2LM1A 4JI2J 3PJXA 4JB8B 1CLQA 4YHHJ 3O5BA 3LP1B 3C8YA 1S1WB 1FVQA 4J9MA 3GV8B 4CGGA 3MM7B 4PZVA 4JI4J 4DLGA 5KTQA 1M90O 4LF4J 1NOMA 4KMUA 2DGSA 2R7YA 2XTJP 3W5YA 5AE2A 2DY4A 3VQTA 5EU7A 3H0LB 1H3DA 2JGUA 5GIOA 3IKMA 2ZJRL 3ZT0A 4OVLA 3QMQA 5IILA 3VZIA 3MWTA 4FWNA 1RPLA 5ITHA 4O4RA 2YWWA 4WXWA 2OUGA 4G1QA 3B78A 3TRGA 1R8BA 3TVKA 2JX2A 1TAQA 4DF4A 3LM9A 2Q43A 3QFHA 2YX7A 5L1KA 3V1QA 1U4BA 2Q4TA 4NZ0A 4B9NA 5LJ5Y 3DWLA 4ICAA 3ZX3A 4XTTA 3P1GA 3KLHA 4JLHA 3P39A 1QM9A 2GIRA 3NF6A 2DRBA 3JPSA 4HUEA 1M1GA 4K25A 4JAXA 9ICMA 4FXDA 4PH5A 5LL6Z 3RJIA 1QQOA 4BACA 2ZIUA 4EX7A 2H5JB 3CC4S 2F8HA 1Q8LA 2MQOA 3CCQS 3QFUA 4IOAQ 3OR2B 4O3MA 3O8MA 5HAOA 3LDNA 2UV8G 2K89A 3BS9A 2OHDA 1RBSA 1WAJA 2W43A 4Z37A 1NOYA 2IGIA 3W60A 4YMEA 2RRAA 3M05A 1V38A 2DNQA 2PMWA 1NPRA 2ZWOA 4LR7A 3NVMA 1FXRA 4UBCA 1S5LU 4ECVA 3PR5B 1TAUA 4CJ4A 3BZQA 4M5NA 1SWWA 1HBUA 3VGMA 4J8FA 2PFQA 4B1VA 3A5NC 4ZA1A 2VB6A 2NXEA 1KAXA 2A19A 3KMQA 3GJTB 1FWPA 3UPQA 1NJYA 3OLBA 2D3UA 2NCKL 2LEAA 5KPZA 5ELZA 5FRNA 2HHVA 3QU7A 1PC4A 3OFFA 4MN4C 3OW2R 3ZSRA 1T11A 4IFYB 3CCMS 1Z6RA 2JMGA 4FSVA 2OYQA 5J2AA 1ZQZA 3RBZA 1SV0A 2EZXA 3BSNA 2DR5A 3MGJA 4RQ3A 1XSNA 5J0PA 1H7WA 1VBXA 4PPDA 4LD0A 2P9PB 2B43A 3CF5L 3QGHA 5A2QY 4K4SA 5AQUA 1NMDA 3C0BA 5EGYA 3J7Z5 2OA8A 2AJ0A 1HFEL 3TA0A 3ZO7A 4AYBC 2DHGA 3FQKA 3PNCA 1U6ZA 2R8HA 2HVDA 4U95A 5F9LA 1R0AB 4IDHA 2RQ4A 4C0ZA 4K4VA 1IKWB 1FFSB 1VSHA 5AJ3K 4IFVB 3AO2A 2AGQA 2M9KA 1QUPA 2Y1LB 3SCLE 3M6KA 1BNPA 3K58A 2BM0A 4DEZA 3C3LA 3UNGC 2E8AA 5AQLA 3V81B 5AQVA 4Y2MA 2G8WA 1HWUA 2F1HA 1IIPA 2NRXA 4O8KA 1ZRMA 1HLUA 3WKEA 3CIMA 3MMBB 3FGUA 2PDAA 4Y2CA 1S10A 4Z94A 1B0TA 4E19A 1K5OA 3IWLA 1BI4B 3CXCM 3I0RA 4GXJA 3NASA 3MEKA 3EL2A 4BR9A 4DUYF 1VC6A 3SYZA 3QT8A 2U1AA 1Q81O 1ZQOA 3PKYA 2I5JA 4GVBB 3UQ0A 4G1PA 2P6UA 3CO9A 4JK9A 4OI6A 4PCQA 1XMQK 2CG8A 4KAIA 2WAQF 4CECA 1HHQA 2CPJA 4A57A 1X2IA 2OYYA 1XSLA 3FBBA 5IXUA 3Q8KA 4FO0A 2HB5A 4FJLA 1XK8A 1QHTA 5EE3A 1Z00A 1LWEB 4F72A 4KKOB 2OTLS 3SAGA 4R65A 2PSZA 4ZVOB 3D2QA 3AA4A 4ISEA 4TURA 4B8AB 2NUUG 3ZSQA 1WUDA 2R3VA 2KSOB 2XRIA 3H1QA 2YI1A 3T1YF 2CGLA 3TAEA 2E1CA 3CVKA 1PAEX 1WYGA 4NE9C 3I32A 4MO4A 1UFKA 1QQNA 3IN5A 2UUAJ 1BCOA 2QXFA 4OJGA 3U7JA 1L3KA 4M3XA 3H0RB 1QSSA 3AV9A 1WSVA 2KG5A 4J9SA 1Z4UA 3AVKA 1VJWA 3NH2A 1FXDA 2DCLA 5GMEA 4ZPVR 3OBWA 5KAIU 3F41A 1RWNB 3P31A 2VG7B 5KQ8A 2J7WA 5GAGU 2KM8B 2AGOA 2IJFA 2OPPA 1NCLA 1SL1A 1AW0A 4MKAA 4AQYJ 4K8XA 4CK1A 3VQ9A 1FDAA 4NZ7A 2VV5A 1CZBA 1RAAB 5AQHA 4YOVA 3HULA 1KFTA 4ZHRB 2EW9A 4H4MB 5AZJB 3MXMA 1SL0A 2A3ZA 1HIWA 4BVOA 4OJLA 3Q23A 4RTFD 4DU3A 2OJ3A 1HBMA 1OH8A 2HLTA 2WHEA 2OEMA 4FLZA 4UUWA 3DLKA 3HFZB 1YDLA 4JI2F 1MWMA 3RB0A 1SL2A 1CJKB 1KOHA 3KJVA 1U2FA 2BDUA 3ZDBA 4L3QA 2ROPA 5ALZA 4JI8K 4D3HA 4LC9B 3DMJB 2P9NA 3ENWA 3NS7B 2P35A 1NKBA 1I1GA 2XY5A 4JI4F 2AX0A 3JPQA 3OR1A 2Z2YB 2XLIA 4KGKA 4LF4F 4Q43A 3IUCA 4ILRA 4Q7AA 2OKQA 3NMUA 3OL9A 5ALJA 4ED8A 3JPOA 3CERA 1S9EB 3R27A 5HRRA 2V2QA 2POKA 2WK4A 2GUIA 4JI6K 1JJ2M 4MQ3A 2VH7A 1ZM4A 3CMEN 2DGXA 3QNNA 4ATNA 4QIGA 4H03B 4TYAA 2W4PA 3JAMU 3RVCA 2R7TA 1UEKA 2WC9A 1JLBA 2HBMA 3M2UA 3N4MB 3EZUA 4PG8A 1Q95G 3KLIB 4IOCL 2JVRA 4DG1A 4CZFA 5CYQB 1IV0A 3F2DA 3ZD8A 4O4GB 3M8QB 4AYBD 2DQNB 2CKWA 5KFYA 4GMKA 2FJ6A 3ILLA 1C0MA 3V1RA 3SPYA 5A0YB 2LKYA 1GT8A 2FIUA 1DRGA 3OYJA 1H73A 1O5JA 3PSTA 4HTLA 3EXYA 3KWMA 2PO4A 3PY8A 3DYAB 1X60A 2JHEA 3MCNA 4KY3A 1K6YA 4I29A 2HFNA 2V4JB 2J6UA 5AKZA 2RQCA 2QLXA 3NVYA 2V63A 3U6FA 2MAXA 4J9QA 3K8WA 4EBDA 5HR7A 1N34K 2FSJA 3VV2B 3GLJA 4GIBA 4KN4A 3AVJA 3G6ES 3LALA 2IS3A 3K9JA 3BO4A 3IBWA 3WQPA 3ET6A 3P38A 5IWAK 1B43A 3RTVA 1XQSC 2HFVA 3PRBA 2QT7A 4M5HA 1FNXH 3DRRA 4NLPA 3TPQA 4B3MK 4FKXA 4FPAA 5D4PA 3UB5A 3IWXA 5HNKA 5C2CA 3KJQB 4CK3A 3M6XA 1WOOA 4OLPA 2IC3B 2YBVA 3JS9A 1UTAA 2LHTA 1JLFA 1R3NA 2DIUA 2GW8A 3D6FB 5J0YA 3TAPA 2JEFA 1Q7LB 3IAM9 5K8MA 3P4IA 4U67L 2F7VA 2RILA 1FEZA 5J2QB 1KTQA 3MOJB 3HVRA 1S3XA 3HJVA 4RQ8A 3UN2A 2B6GA 2XB2D 1ZBTA 2N3LA 5B08A 2H3EB 2ATQA 4ICLA 5G5HA 1VK8A 5G4DA 4JK8A 2HWIA 3CJQA 3F2KA 4DU4A 5I3PA 2DB1A 1RHUB 2P9IA 5IT9Y 4OMFG 1JX4A 2F8KA 1RT1A 3D7EO 3T6JA 3J7ZO 2I7NA 4DU7A 2AJ1A 4ZLNA 5HMXA 4UQTA 3H5UA 2XZWA 3ZZZA 2FPHX 4ILGB 2VJVA 1LKYA 3EN9A 1VSKA 5HLFA 2QA4G 1S9GA 4WE1B 1FWLA 4UB4A 4C0OC 3HRDD 1ZM3A 4ED2A 5AZIA 2XGQA 2HBKA 1U8SA 2ZUCA 4MJKA 3NEKA 2O8BA 2C2RA 1LWCA 1WNEA 4AILC 1TFWA 3V7KA 4FWQA 3OXGA 1VC0A 1WOQA 3W64A 4F93B 3ZT4A 2YX6A 2QC3A 3HYFA 4W5NA 1C0TA 5J1EB 5ETQA 3UKRB 1Q78A 3HRGA 7ICEA 5B0GA 4CNZA 4HI2A 3NGKA 2ZH9A 1F6TA 1NGJA 4P52A 4KLUA 4J9KA 3UDLA 4PHAA 3DRXA 3MXIA 1KS2A 1OH7A 1GMWA 3R1XA 2XHCA 1IXRA 5F8JA 1M1KO 2EWHA 2RN2A 3LANA 1JJHA 4OHYA 3QO9A 3WXJA 1U1OA 4BR0A 5JS1A 1WI8A 2FLLA 1TELA 3UXPA 5DG8A 4IG3A 1LK5A 2LM4A 5ETVA 4ZVUB 4P2FA 3F9KA 3AQEA 3ULEB 1KFDA 3KJFB 2H1YA 1ZM9A 3DLBA 3MR2A 1HIYA 3FC9A 4KLLA 1H1VA 2EAOA 2N4CA 5BPMA 3MMAB 2BW2A 4RNMA 2HMPA 2V69A 3I8DA 4FJMA 2YQ1A 3AB4B 4FZMA 3GL1A 5A76A 1NDCA 2XO6A 4OL8A 3CQYA 2O8DA 1KONA 2JWKA 1Q46A 3VMFB 1T9TA 2DNYA 1DTTB 2KZMA 3MTJA 1KDNA 2Z2MA 4TU7A 2VGNA 4TLRA 3UMGA 1DLOA 2ZJQL 1HD1A 1TL3A 4H0OA 3O9SA 6AT1B 3TW0A 1MQ3A 4CJEA 4P10A 3EDQB 5J2PA 4PRFA 4J7CA 3TUJC 3ZT1A 3VALA 1A6LA 5AKIA 1QAYA 2UXBF 4G3IA 4H0PA 4NYFA 3AY0A 2K1RA 3THVA 4XDDA 2VBYA 4K8RA 4CF1A 3C66A 4PWUA 1LWFB 8ICZA 4ECXA 3UD4P 3EPGA 4HEA9 1PJ6A 4FPIA 5ALDA 5HHIA 2QA1A 4X64J 3C16A 1ZAWA 5A2QU 8ICLA 4NA3A 2FF3B 2JR5A 4GFJA 4HACA 1BPYA 4ZJLA 4OJ1A 2XNQA 3GG4A 3TA2A 1VOMA 4MIBA 5AM0A 3TAFA 1S1UB 1VS3A 2KV2A 2O8CB 4BRQA 3Q8UA 3ICXA 1YIJN 4JV5K 5KG3A 1YTYA 3AHPA 4JYAF 2OMLA 4W5RA 4PXBA 2HNYB 4BROA 2KHVA 3PMNA 3C95A 3F5AA 5HO4A 1RACB 2HZVA 5IV4A 5M1PA 3PYGA 1RAHB 3DDNA 2PFDA 1KNZA 5DLGA 1QVGR 1B7FA 4H5WA 4F3MA 2KD1A 3WK4A 3G6VA 4IFEA 3BR9A 3G6YA 4KIAA 4NLNA 2EFNA 5ETLA 4G1QB 1NSKL 1HR0J 2AYEA 5DJBA 2RP5A 4NA2A 1ATNA 4R63A 4DOAA 4J9OA 4ZPWR 2JLFA 4J9VA 1K1QA 5D0RA 2AJQA 1BGXT 1N33K 3WKCA 5TZVA 2W2NP 3HPOA 3L95X 3Q89A 2DNMA 5KFJA 3M5RA 3SXLA 1HKAA 5J0UA 1EO1A 1NSQA 3WU2U 5IIMA 1KBUA 5LXYA 4JI5K 2BTFA 4KYZA 3R6GB 1HYZA 2AYGA 1TKTA 4F0MA 3DJCA 2Q3PA 1YZ6A 3IS9A 4O0NA 5IS2A 4HKQA 5IIJA 1B4SA 4LFAF 2CJXB 2JH1A 3GSDA 1N88A 2I2YA 3SAFA 3H20A 2QXLA 4UB8U 4WU3A 1NGIA 1ZH5A 2GMLA 4NASA 4QS7A 2ASJA 3A5MC 2DBBA 2W8LA 1OJ4A 3VQ8A 1MROB 4O5KA 3RBDA 3CC7S 1U49A 9ICQA 3V7LA 4V1Ak 4FOIA 1HUXA 2NLWA 4HTIA 4KHRA 3U9DA 4C8YA 1C1CB 3H8SA 2W9CA 1NNLA 3MEDA 4JOUA 4JI1K 3NMAA 2ZGZA 4F5PA 2CQ4A 2UU9K 2PFFB 4W92B 1QCKA 4DKWA 3QESA 4BR7A 1KL9A 4C80A 4C8KA 3FGVA 1NGBA 5M2UA 4FJHA 1BWVA 2BJ3A 2BMBA 3HHLC 4KB1A 4JBCA 1VSIA 1BMQB 2RDJA 4WZQA 1LCUA 2AA4A 2Z2LA 5JVHQ 2M4MA 4QYZJ 3NP5A 2DFFA 4B3SJ 4EYIB 3HSJA 1FO1A 1XMBA 3SI6A 4GO5X 3GCXP 2QEXN 2DKXA 4RQMA 2DPJA 1KHVA 3V2UC 5CABA 1URNA 4RJVA 2BA9A 2IRYA 1RGVA 2HOFA 3IDHA 3L3UA 4J5OA 4LF8F 2Y1RI 5BR8J 3MDAA 1ROFA 3D1HA 2DKZA 4RQ2A 4RW7A 1VRQC 4CNQA 2HQDA 4OGEA 4FZLA 2LU1A 4ZS6A 1RBLA 1LKZA 1M5PC 5EY4A 1Z4OA 3R97A 3MM5B 1F2HA 4ED6A 4CZCA 4M3WA 3CO0P 2YVSA 5E3AA 4RBTA 3RRHA 3LA0A 4BE2A 3F9MA 5E3QA 2NXNA 1RT2A 3OL8A 4CF2A 5FD1A 4PHEA 2FHJD 2NYIA 2XMTA 3ZSYA 1ZQIA 3D2WA 2WTUA 4IQUA 3ZSZA 1X3NA 5J2HA 4LZGA 4WF9L 2H3GX 1ZPWX 1HMVB 3BN4A 4FW2A 2YX1A 5KPTA 1SI9A 2GO8A 3EEQA 5GADU 3ENQA 3SV3A 2AW0A 4KHSA 1WHYA 3HTVA 4ZJOA 3P3DA 3HW8A 3MF5A 3QUQA 3CJ1A 2FPKA 5KT6A 1WBBA 1UP1A 4RWWA 4OQJA 1OXJA 2RHFA 1CXQA 3W9IA 2KB2A 2V4RA 1WTBA 4WCEQ 2WSFC 3KHGA 3OVAA 4KAZA 2A1AA 2NYVA 2AHOB 2IPOB 2JH7A 3AVMA 4LFCK 3TX0A 3CM5A 2K8BB 1KVBA 1OY9A 2PA3A 2FJWA 1YX2A 2J76E 3ISNC 3UVJB 4EZ6A 3VEVA 3VEYA 1ZD5A 2ZGYA 4DPWA 1E3MA 3V4IA 3VHQA 5JJBA 1U7LA 3S6JA 3S3OA 1OH6A 2CJBA 1F9FA 4KHQA 1UPHA 4DPXA 1I3AA 4DLEA 2VWBA 1VQPN 1RDWX 1OSCA 4AE5A 3BKUA 4ED5A 4X4VA 3LDLA 5A2QO 1WDTA 3H6EA 2DGZA 3MXHP 5E26A 3DLJA 4KLGA 1UT8A 2VOPA 4GC6A 4EUVA 1NHVA 3RB4A 3MUMP 5KFSA 2QL7B 2MKSA 3G96A 2OPPB 4ILLA 3HT0A 4KX5A 5CE3A 2UUCJ 4OI1A 1VSFA 4ECQA 3VWSA 3LQVA 4CWBA 1N32K 1TK8A 2QK9A 1H2UX 1KQSR 4X4QA 1HNZK 3JPTA 4NCGB 5AQTA 4WK1A 2R7QA 1QZ5A 1HBMB 3D6TB 1S12A 3QEWA 4X64F 4V19J 3SQOP 5IT0A 2BCVA 1RKJA 2DVIA 1LFPA 2XMUA 2W6LA 5LSOA 4BE1A 3A0IX 1LW2A 2GWKA 2QLTA 1GXTA 4OYPA 2AX1A 3KJVB 5AR0A 5GTHU 2YXLA 2P9NB 3K4GA 2CZ9A 4KO0A 4WP8A 5KG0A 3ORYA 4CGHA 4OV6A 3KKSA 1DHMA 2D4WA 1G7CB 4FJ7A 3IBCB 3GOIA 1UVNA 2Z8QA 3PZPA 1RTDA 4WQ5C 3PX0A 3QJPA 8ICCA 4ETXA 1T9UA 2HHHF 1N63A 4O8UA 2NZTA 3V72A 2O8FA 2KYXA 4PR6A 1T4GA 3TUPA 2EVZA 1HR0F 4FYVB 1S8OA 1ATRA 4KLOA 4PXCA 4YB5A 1GOBA 1JLBB 3M2UB 1MC8A 4DG1B 4P4OA 4ALZA 1ZQQA 2Y8WA 1QD1A 1NGGA 2VFUA 4QQBA 2HHQA 2HFOA 2UYTA 3KBBA 5J2BA 4ZCMA 4CGDA 1NGHA 4EWTA 4DX5A 2ZIVA 3T1AA 3L8BA 2H4YB 1KC8T 3OSPA 5L38A 2D41A 2HNDB 1VBZA 3WNHA 2IAJB 2A3JA 1DEJA 2JNJA 3DOLB 4WBFA 3IBFB 1X0FA 2DPNA 2RF2B 2CQIA 3ETMA 2F9JA 1YJ9S 3RAQA 8ICRA 3I9ZA 2A5XA 3OYHA 1N8RT 1Q18A 5H2FU 3IMQJ 5ADXA 4G9BA 4XH5A 3TABA 1XNRJ 5A6WA 4F3QA 2DHSA 4DTRA 4KB0A 4KLHA 3CTRA 3CCSS 1S77D 3EM1A 5AKLA 3DRRB 3SENA 4OCZA 1VI7A 4B3RF 4O55A 2XCAA 2CNLB 4JK1A 1FRIA 4M7XA 2FMPA 1NBWA 4IRDA 2F1IA 2ZBQA 3NAIA 1EX4A 2AP6A 3BO3A 1P90A 3BQ1A 2N1RA 3B4DA 2HOEA 4A8SA 5LY3A 1RZTA 2G5IB 3BB5A 1F44A 2J7UA 1XNQF 3VQ4A 4B3SF 1EQMA 1WAFA 2G8VA 3U27A 4X66J 3FUYA 4ECWA 2NSBA 3C6HA 2BOAA 5FPMA 3CETA 3ISND 4I69A 4AYBF 3C65A 4A59A 1IBKK 1WSFA 2P9IB 4F2SA 4EX6A 4CBXA 2LBOA 4JK7A 2Y0SF 2YWFA 2ILZA 5KNIA 4LH4A 2PMZC 2HHTA 2CA9A 2A6MA 1LKYB 4X84A 5HLFB 4RQ6A 1S9GB 4IO9Q 1TUVA 2B4PA 1KLMA 5AZIB 2V8DA 4BC5A 3MD1A 4LR8A 5CEHA 2O8BB 1JXLA 2RH3A 1LWCB 1B3TA 4PAAA 4RNFA 2BCSA 1D8YA 4KFBB 4BX9C 1FKOB 4Y28C 4DR2K 4LBIA 1FDNA 5FLXY 3HL8A 5ETOA 4DQRA 3HHEA 1JNZB 5L1LA 3NCIA 4AHTA 3A3NB 4Q2LA 3OTBA 3R6LB 3NVKA 4FBTA 3AU6A 3CCVN 4DI6A 4QZDA 2E29A 3L3CA 3SV4A 3TR5A 3D7SB 3QO9B 3KOAA 2PZSA 4IG3B 3MK6A 2VG6A 3AQOA 3BO2A 2R8KA 2OZMA 5L1JA 2AKWB 3C5FA 2NRWA 9ICWA 5AQFA 2XICA 2P9UA 3RU0A 5EWFA 3WK8A 4DUZK 3AVAA 3IRXB 1W9HA 1MU2B 2FVSA 3SUQA 1EHWA 2CWKA 2CPFA 3KWGA 2WF7A 2PGCA 4CTAB 3FAHA 3CI5A 1OWXA 2FDNA 1C7YA 2ZDOA 4F3OA 4X65J 2O8DB 4USWA 8RUCA 2YQ0A 3I82A 4I2JA 2FC0A 3C7NB 5AXKA 4Y2QA 1XR7A 4CI0B 2E20A 1YRXA 4LRCA 3M1FA 3ZDAA 1UCVA 1TKZB 1UCNA 5IT9O 2CZ4A 4CJ5A 1DLOB 3H90A 1Z05A 2VPYB 3QNMA 2ZD1A 2R8GA 1VIOA 4PHDA 1A5XA 2JH3A 4HDHA 3KZIU 5AQZA 4Z6EA 3SFUA 7ICSA 3R2DJ 1RT4A 1UW9A 4W90B 4R64A 2BKEA 2GEMA 1S72N 2K1RB 1VQLN 3PEHA 3ONQA 1VQMS 1U02A 5IC4B 4OZLA 5KFUA 4BXOA 1ZBFA 3NCRA 2ZC3A 3DRPA 2A2CA 3SSQA 2EWSA 2OPRB 1KAYA 4P72A 4JKGA 4FJ9A 4ZP7A 3C16B 4M41A 3HSDA 4F50A 4FJXA 4F91B 2E7VA 2Z1GA 2BPFA 1SB3C 3ONNA 3AL0B 2HMIB 4JN4A 4P7VA 4M63C 2DD8S 5M1OA 3EX7B 1LNQA 3LTOA 1SZ2A 1RDDA 3L4BC 3A0HU 4R8UA 4E7HA 2GMJA 3OXFA 1R6VA 1BUPA 3U1LA 3PIPL 1VC5A 2M8DB 2Y0BB 4YDDB 1VQ5S 1L3SA 4DQPA 2B21A 1Q4RA 2RHQB 4R5PA 2ACYA 3AVLA 3L7PA 4A47A 3ID6A 3PW4A 3CJ3A 1PVQA 3KK3A 2R18A 2Q36A 2RAQA 4FLYA 3DLLL 3NH1A 1EIYB 3PSFA 1X66A 3H7HB 5KFIA 3AJ2A 2RUGA 5C15A 3MGIA 1GTEA 4CBUA 1H98A 4CF0A 4IRKA 1H72C 3PW0A 3HKWA 3KLGA 5DB6A 1OMSA 1SXEA 2G13A 1AZSA 4C4SA 2YNFB 3PJ9A 4PXEA 2H3FA 4DWIA 2J0WA 4KN7A 5DBBA 3JSMB 4EFHA 1VQOS 5AM5A 1TKTB 1T7PA 2YJFA 2QLBB 5DQGA 4AF1A 5KRSA 1GNKA 4HR2A 1XNRF 3A8YA 1SC6A 4KHPK 5IIKA 3D6MB 2XVTA 1L3TA 3AB2B 4M5MA 4FM2A 4C0HA 2ZJRQ 4DV0K 5T14A 2OTJN 4CH0S 5KGWA 3M2RA 2PI4A 3NBPB 4H4KA 1NPKA 3HD2A 4ECYA 3GZ7A 1IR0A 5HQ8A 2CVIA 4P2HA 1ASVA 2DH8A 1C1AA 3V9ZA 3OFHA 1TUGB 3O3FA 3B8HA 1JXEA 1H0HB 3FMWA 2YY6A 4FF2A 3CCLN 4ZCIA 3NVVA 1X9XA 4F4ZA 2ZHAA 5ETTA 1Q5YA 4O23A 3BQ2A 4OLOA 4USAA 4N56A 2BANA 3GSIA 4TU9A 5HP1A 4B3OB 1S0MA 3OYBA 1HHSA 3EWAA 1UWAA 5GAHP 4IS7A 3EICA 2FDRA 4TN2A 3QAEA 5EDWA 5B0FA 4MTPA 3K8VA 2K7JA 1UEUA 5EOYA 2J9DA 2OEHA 1PYSB 1L8OA 2IVFB 1IG9A 1A5VA 4RW7B 3OL6A 2E8NA 3ZEUA 1VLBA 5HMZA 3Q8YA 1HJOA 4JEPA 5DDYA 1S97A 1Y10A 3AJ1A 3OJUA 1L3VA 1V3RA 4Q0BB 5AJ3J 4FVMA 1N2XA 1MDUB 2HBZB 3ADAC 5ALGA 4O44A 4NLZA 2DWQA 5ALEA 5I42B 2F8SA 4KGMA 3THPA 1BVSA 3ZX0A 2DEJA 1BA0A 2YKOA 4YD2A 1DARA 1NZPA 2Q0ZX 4DR5F 4K41A 1T9VA 5ALSA 3ZSVA 1KLNA 4UB6U 2WW8A 5ALOA 4E89A 4DZDA 1J2VA 2OEKA 1QQ5A 3TZYA 4WZMA 3PACA 3S3MA 3T5JA 3ENOA 2DK2A 2PI5A 3H98A 4JUZA 1ZJMA 5J2DA 2GA7A 1Q7YT 1FO4A 1RA6A 1Y5IB 2CPXA 2JZ5A 4BGBA 5C42A 2ATLA 4DFJA 1S79A 2AV5A 3V6HA 3ATUA 3DLGB 2ZWHA 3C2KA 3QDKA 5J2NA 3RMAA 3GU3A 4ZDNA 1TK0A 4CZHA 4KH1B 4B9MA 1NSPA 1TKDA 4IBNA 1NI3A 1ZBUA 1RHJB 3SBMA 5CJ7A 2OPSA 3H2VE 2QMXA 3IG8A 4A46A 2CFXA 3QIPA 1S5JA 2LEPA 1WJ9A 3BGLA 3QIDA 4CO3A 3HI0A 1K47A 3V4IB 1EXQA 3LWLA 2VQFF 9ICKA 3TTDA 2IIHA 3FZMA 4RU2A 3DI6B 2C2DA 1PK1A 1QS4A 1DRZA 4X65F 1JI7A 4CLTA 1FXXA 4KLFA 5AXNA 3MABA 2FJXA 3NNHA 3QICA 1S6UA 3MM9A 2N82B 1AROP 5DDPC 2KKPA 4WWSA 2VFRA 3RW6A 3GIMA 8ICIA 3SIPB 1XNSA 4DFDA 5CR0A 1IV8A 1ZQ1C 2AQ4A 1NU0A 2GX8A 4F67A 4OIXA 2O8EA 2L3MA 2H5EA 1NH8A 2DNNA 4CHNA 4FXWA 1GH8A 4A8YA 3ZTRA 2JVOA 1HX1A 1PIEA 1UZHA 5ALQA 4RU9A 2JV3A 3TVZA 3VTHA 1NKCA 1CLFA 4P0QB 1CI4A 5EE1A 2WB4A 4A4JA 1T05A 1I6JA 4U8YA 5AKGA 3O9TA 1TVRA 3US5A 3E0FA 2XWYA 4K5RA 4DBQA 1RK8A 4M1KA 4IJAA 3M6UA 5LMUK 1LW2B 2ILYA 3VAJA 2MSSA 3TEHB 2BE9B 4NXNK 2UV8A 2XS2A 1Z2LA 4JI8J 4M5DA 1WD6A 3S8SA 4KO0B 1CEZA 2CAJA 4LSZB 1B0XA 4EHUA 3RRKA 5BR9A 3PFOA 4PL8A 5AFUA 4Y2TA 2P9LB 1S1VA 4FK2A 1RTDB 4JI6J 2C3UA 3AEVA 3D2FB 4IEEA 3QLHB 4HVZA 2RE2A 3B0YA 4JI3K 4P6QA 4NOHA 3VVUA 3JQMA 2BE7D 1S57A 2B56A 3CCUN 4UB2A 2Z1IA 2O8FB 2ZJ8A 3CP8A 2AMCB 2E1MC 3D28A 6FD1A 2HIYA 4PQAA 1SPBP 4I2BA 1N5VA 4M2YA 3E51A 3DN9A 3Q2TC 3VOVA 4KMOB 1A9NB 4ITSA 5DDRC 2I38A 4J9RA 4DR4F 4DR3K 5SUHA 1VGYA 4X5VA 2KO1A 3E9LA 5F0XA 3S3NA 3PX6A 5D4BA 1Q5VA 1UVMA 1H38A 5K14A 4FLTA 3K7RA 3QMLA 1BQNA 1X8DA 4Z2XA 1X5TA 4NA1A 1K8AT 3QRRA 4F92B 3KLVA 3IR6B 3WNFA 3TZWA 2PBDA 5EX5A 4A2BA 5KFGA 2NO4A 2RE1A 4RNOA 3EDRB 1Y5NB 3P45B 9ICIA 3TFRA 5TKYA 3ISCA 3T6BA 4DS4A 4MO5A 3VEXA 1S76D 3CJRA 1RAJA 5IWAJ 4UAWA 1ZQDA 3ENVA 2YNIA 1R31A 1X4DA 4B3MJ 1SC3B 2JFDA 3POTA 3CJ0A 2XG8A 2NRTA 1BIUA 4USHA 4IOCQ 4RZRA 5JU5A 4P0PA 2FJEB 3VGVA 4C8MA 4OYWA 2BW7A 4JI0F 2ZH7A 1Z19A 1SIJA 4BVPA 4HTUA 5CCMA 1V9OA 2WVCA 2CADA 4FJKA 2YKQA 2VYPA 1YF5L 2O1PA 1RAFB 3KG1A 3V6DB 1QQCA 2DNRA 2VFSA 5L46A 4U9RA 2OXOA 3LYSA 1A5WA 1RQNA 1NWKA 3ENAA 4CJWA 2MA1A 1FXLA 3C1YA 2WF8A 4PA1A 2MU2A 1WWVA 1KC8O 3J7A1 2CGJA 1NG9A 2P9GA 2HHUA 3GFXA 3RMDA 2DNHA 3OBIA 2QKKA 5J0TA 4FJNA 2KJ5A 4BRMA 3DV9A 1Y9OA 1VQ4N 4UUXA 1PJ7A 4GKJF 4NLVA 5CHCB 3GIRA 4GV9A 4Y00A 5AJ3F 3UW1A 5CYMB 1DQ8A 3W2WB 2X3DA 3IRWP 3UI3A 1TL4A 3G2XA 2OM6A 5L1MA 2KFNA 5GAEP 2L48A 4MFBA 8ICUA 5J0QA 1RBUA 5GMKa 4DTPA 4QOTA 3HBTA 1F5AA 4PHTX 4U67Q 2F65A 5BJRA 2BUPA 1ATSA 4N76A 2GZOA 1HJRA 1HNXK 2QB1A 3G10A 3H40A 3DM2B 4QZEA 1YITS 2J8SA 4AD6A 4K7QA 3FZFA 2QA4S 3UE5A 1NB2A 4KLQA 1U1QA 5AT1B 3B54A 3LPEA 3LP0B 4MIWA 3T41A 2A40A 1R7IA 1FNOA 1R8PA 4DTXA 4Z6CA 3GPAA 2FVPA 3BS5A 3VEZA 2K60A 1OO0B 2HQGA 3QGIA 4YCXA 3UCGA 4B3TJ 4B9SA 3DOKA 4OX9J 3TSUA 1MLAA 2CRLA 4EK2A 4YS2A 1FRHA 3IM8A 3GMGA 5CD4A 2OH2A 4URQU 3A13A 1IR1A 2P9UB 4E1JA 2O4GA 1HYSA 4Y2XA 1SAZA 3WT0A 1WKJA 2Y1JA 3B6PA 1ZBLA 4CZJA 2QWMA 4CJ3A 2E66A 4KLDA 1MSWD 2KHCA 1MQ2A 4X2BA 3FRZA 1IBMF 3RSEA 2EFQA 2C3OA 5CZXA 3SR6A 1FRKA 3CWJA 2HS0A 3PDNA 3H0MB 3RJKA 2QX0A 2VKZG 1HI0P 1VBYA 4DV7F 3BDPA 3DFEA 1O51A 1NGEA 2Q66A 4K2XA 4DX6A 2GVZA 2GIFA 1AFIA 2PD1A 2ZD1B 1V3SA 2XY8A 1QVFM 3UWTA 4FJ5A 5CHGA 3A4TA 2K3IA 1YHQN 3ULDA 3MPWA 2PIIA 2LQ9A 2YNHA 3UM9A 4IKAA 4DQ8A 3I33A 4WFNQ 3SSSA 1Y0HA 4ID8A 1BC6A 5AIAA 2YTCA 4ZH4A 5AK6A 1SV5A 3AA9A 2CRXA 1Q1KA 4BXOB 1T44A 4I2PA 4NM1A 1OPIA 4E3SA 2IOFA 2R7VA 1ULRA 4CGZA 4ZKAA 1Q9XA 1KQGB 1S9FA 4O9MA 1HI1A 4JKGB 5BPNA 2GFFA 3CCRN 4BDZA 2Z1HA 1XBWA 1BD6A 1O08A 3NOCA 4BC9A 2HURA 1M5HA 3ZTPA 3QEXA 1W26A 1HQEA 4FDFA 4JI8F 4JV2A 5FLXO 1VQNS 1NZAA 4Y2KA 4JV5J 2HBRB 3I56S 4C23A 4C98A 3MMCB 1NB7A 3HPHA 3P5TL 2RKIA 4NPOA 1DJ0A 3CDBA 5D3GA 1WHXA 5IC6B 1U1LA 5DQIA 3GCWP 2WTFA 1UAXA 1D0EA 4J9LA 1M5OC 2AWZA 2J0SD 3F5TA 1DXSA 4YXJA 4CIGA 2QN6B 2ZJQQ 2DPIA 2JEGA 2XWXA 3CXCR 2UXDK 4CIOA 2Z57B 4ED7A 3C2MA 1MG7A 4R5PB 2QFJA 5DM7L 1JLCA 3TYTA 4OO1J 5H9FK 3M8ZA 4FNIA 3KK3B 3WQTA 1LXJA 2OEJA 3MN5A 2HVZA 1DTQB 2E5LK 4ECUA 4DSEA 3IGVA 1Y3JA 5KOXA 5C24A 4QZFA 2GIQA 3FEYB 4I2HA 3ZD9A 5FP0A 4IKFA 3VCDA 3KTQA 2ZH3A 2YTUA 3CCWA 1N33J 4OJRA 2XMMA 2QTWA 5CYJA 1BOTO 3MM6A 1VQSA 1VAZA 5CZ2A 2QLJB 4KLJA 1P6TA 2D1CA 1TL7A 2BBEA 3C6TA 5IQQA 1PGZA 4ZVFA 5I3UA 2ZIWB 2NPIA 3AODA 4NEYA 2YB1A 3EY1A 1VJ5A 3ELHA 1VQ9S 2QWPA 2EC2A 1KSPA 2OP5A 4BJQA 1NJXA 3BEGB 5B0EA 5CB1A 4RPFA 2DR6A 2YKAA 4DV5J 4RT2A 4CHPA 3ED5A 3QUBA 4FXVA 4DV1F 4RW4A 1X3MA 1JLGA 4KI4A 3D2EA 4KGVB 3CCEN 4USUA 2MDAA 3L3VA 3BREA 1VQKN 3SEOA 2FI1A 2F8LA 4ZPTR 4B3MF 2NS1B 1XR6A 1NHUA 3M2RB 5J1PA 5GAGI 2E9TA 3RZAA 2O01C 3GU0A 1UMJA 1ACMB 2UU9J 1M6YA 2EFPA 1KR4A 3E58A 2OFHX 3R8EA 3RJJA 3VF6A 2GVDA 2KQ2A 4BCAA 2KYZA 4WTYA 5ALVA 4FO6A 2FZCB 4GVEA 2BACA 3VQSA 3P96A 1TV6A 3NVZA 3M30A 2M0NA 1BQXA 3TWZA 4F4XA 2FY8A 1RT3B 3ZETB 4OZJA 2EANA 3LWMA 3DOMA 5HP1B 2V94A 2G2OA 1IM4A 3EGVA 1VQ7S 1P1TA 4EU0A 2IVNA 4IO1A 3AO5A 3FM9A 2K4EA 1NDLA 2JZBA 4DB3A 3FMBA 3HDSA 1LOUA 1N52B 2BGWA 2L9NA 2YJEA 3VQAA 1IKVA 2XS5A 3SZ2A 4M5IA 5AE1A 3QT6A 1YJ7A 1JKHA 1RBAA 3FSYA 3G71N 1JJ2R 2A1JB 1TQLA 3OD2A 4O44B 4PEOA 3NFAA 3H8JA 1KRPA 5DBAA 3FYHA 4CF8A 4QZ9A 1BQMB 1EARA 2FHJA 3D0HE 2FC9A 1NJZA 3FR0A 2F8EX 4QR1A 1GOAA 2K2PA 3AA8A 4N5SA 3DLHA 2MEWA 3CMAS 3UQ2A 4NLUA 1EKEA 3MWBA 4JWMA 2M3DA 1QSYA 4KHMA 1U9LA 4LBHA 3V9UA 1KEKA 5J0SA 1MMLA 4I2AA 2HQCA 4QW8A 3KD3A 5L9NA 3N4PA 1BISA 1O8BA 4I2EA 3AVBA 7ICKA 1V5IB 4CJPA 2ASDA 3CDEA 3OA9A 3VPZA 7ICRA 3RR8A 1IH7A 2F2AB 5J2NB 3BGRA 2BCRA 4JKEA 8ICWA 3JQJA 1FJEB 4B3TF 4CO0A 4OX9F 1U09A 1AYEA 5HJXA 4LFCJ 1HD0A 1TK5A 4Q44A 5KT7A 4MF8A 4AXJA 2OPSB 2JDJA 1RT6B 4CEZA 2ZZMA 2YNGA 1M5SA 4L3NA 2G8FA 4AP9A 3QIPB 2FHOB 3OYAA 3QU5A 3QE9Y 4FNHA 2V50A 3FKBA 2VJ5A 1SC4B 3OTCA 4JHDA 5AE3A 1V9PA 3H5SA 4I68A 4BREA 4U8VA 4KREA 2ZH2A 3D45A 1FHTA 1SV0C 4NXMF 2D7SA 1PK1B 3I87A 2G8KA 1RCOB 5H1SQ