4UQGA

A new bio-isosteric base pair based on reversible bonding
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title "Post-it" type connected DNA created with a reversible covalent cross-link.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4uqgA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4uqgA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqgA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4uqgA01
3LDSA 2BPGA 3O4NA 4R8UB 4KLQA 2ZTDA 5E41A 3BQ0A 1CZBA 4FBTA 3M8PA 3U3GA 3H4BA 2Q3SA 3RMDA 4M41A 3V1QA 3SQ0A 4ZH4A 3K5LA 3L2QA 3HP9A 2G8KA 4UB3A 5DK5A 4PHDA 2YNFA 4B3OA 4LZDA 3PR4A 4IKFA 3PX4A 3RJIA 2GWSA 5KFRA 4M9HA 1ZQKA 4UBCA 2XGPA 8ICLA 1KDHA 1TL3A 4NLZA 1WSHA 1QE1A 4CJQA 3HWTA 1BGXT 1RYSA 8ICIA 4YR2A 2QXFA 1B9FA 4NCBA 2HHWA 3QNOA 2ASLA 4B9TA 2ZTCA 4QZEA 1C1CA 3AO2A 1XC9A 5KT7A 1JLGA 4KKOA 1AROP 1IKWA 4PHAA 1B9DA 3V1OA 4K4GA 3LP1A 3IHQB 4RQ1A 3DI6A 5DQHA 2OPPA 1EKEA 5KFSA 1NJZA 4FJXA 3IRXA 3VQEA 3ZSYA 8ICJA 3U3YA 4TQSA 4F5NA 4XUSA 4KHWA 3QE9Y 9ICOA 3T5LA 5J0PA 2OZSA 3B0XA 3K75D 1ZQGA 2X74A 1Q9XA 3QZ8A 2ZUDA 2VWJA 3OS2A 1WAFA 4AHCA 9ICJA 2W9MA 3OHBA 2KTQA 2LSNA 3C6UA 2YV0X 1RBSA 5HP1A 4O55A 1J54A 3KKSA 4DTOA 3ZT4A 4I2PA 4YN4A 1RT5A 4DQPA 1XU4A 3DRPA 5HMLA 3NF6A 1JLAA 1LV5A 4Q43A 3TABA 4FJJA 3DLGA 9ICRA 1N6QA 5J2IA 5DBAA 3KKRA 3V1RA 1ZQHA 4Q45A 2FPKA 1REVA 3QIOA 3DMJA 4OKEA 4TSXA 3CM5A 4QZBA 3NAEA 4ED6A 3SNNA 2XGQA 5HRSA 4RQ4A 3GFKB 1RTJA 1Z3EB 1RDBA 2OPQA 3GIMA 2FBTA 3KHGA 4DLEA 2BKEA 4KLIA 3UXOA 5CYMA 2WTFA 4RG8A 3LDAA 5BPCA 4FVMA 1UWBA 2QKKA 4M3XA 2FMPA 4YMNA 4M42A 2I1QA 5J1EA 1BI4A 4M3TA 3RR7A 4CGDA 4NYFA 3OYFA 4PPXA 5HP4A 4RPXA 2ETJA 2XC9A 4GVMA 1ZQEA 2VWKA 4F4XA 3I0RA 1ZQSA 4PA1A 3KLGA 3G0ZA 4CJUA 2ATQA 4O44A 1HNIA 4BDZA 5BOMA 3UQ0A 3NF8A 3ULDA 4PGYA 2YNGA 3AVNA 8ICUA 4BWJA 1TAQA 3H8SA 5KG0A 7ICLA 4JRPA 4G3IA 3VQDA 4H8KA 4YG2A 1CXQA 5FRNA 2KZMA 4DLGA 4E0DA 4ID5A 1C0MA 3ZDDA 4DTXA 3SQ4A 2UVVA 3DLBA 5CHGA 1BHLA 3H08A 3P83D 4Z0UA 2C28A 3U6FA 1KCFA 4DL2A 1L5UA 3C94A 2O4GA 4OJRA 4P4OA 4EYHB 1VRUA 3OS0A 7ICHA 4HCCA 3PX6A 3TAQA 3M8QA 5DQIA 1NKCA 4NYNA 2X6NA 2ZQBA 4Q5VA 4AHSA 3MGHA 2IA6A 5KFJA 4HUFA 3P1GA 3TI0A 3P5JA 4GXJA 3Q8KA 4Z6EA 1HQUA 1Q8IA 1JN3A 5KT3A 3Q8QB 1CZ9A 2HHSA 4J9RA 4KLUA 1XWLA 1T7PA 4FW1A 4CIEA 4KRFA 1DTTA 4YFKA 1S10A 4N47A 4OKJA 4QAGA 4ED1A 3LPTA 2BPCA 3RMAA 4JV1A 4J9KA 3CM6A 4PGQA 4F3TA 3T5HA 3ZT0A 3EPIA 3TAFA 4QZDA 4H4MA 5F9NA 3V6HA 1I3AA 4CK3A 2Z1HA 4QZCA 4RW9A 5J0XA 4F5QA 1S0NA 3F9KA 3L2WA 4CK1A 3EZ5A 5DGBA 4J9LA 1NKEA 3G6YA 3HK2A 1D9FA 4PHPA 4EBDA 1NK8A 2QK9A 3V7LA 1UT8A 3Q8RB 3ZSWA 3NGZA 2FPLA 5KRSA 4DS5A 3OHAA 3AA5X 3DOLA 2F8SA 3S9HA 3TWHA 7ICRA 3M9NB 2BQ3A 2IS3A 3VQ7A 3QEXA 2JGUA 4DO9A 4KLSA 4FLUA 1ZQJA 3NH2A 5K14A 5D49A 9ICXA 3CFPA 4NM2A 1VSEA 4KLTA 2BE2A 1HYVA 4KAZA 4OPJA 4YP3A 3HSTB 2UVRA 4XRHA 1TKTA 2JEGA 1ZQUA 4R66A 4CF8A 3TFRA 4KB0A 4CK2A 3KHRA 8ICKA 4GW6A 7ICIA 3SPZA 3PR5B 4J2BA 1ZQNA 4PHEA 3V6KA 4K8ZA 1BPDA 1JIHA 1WN7A 2KZZA 4AHUA 1D8YA 4HCBA 5KFEA 2QKBA 5HLFA 1ZQQA 3RB6A 4MFAA 1RT4A 1VRTA 3JPQA 4CF2A 3ZT2A 3OYAA 7ICTA 4ELTA 3OYNA 2ASJA 5KG2A 2KN7A 1D9DA 5C24A 4YR3A 4O4GA 2OPSA 4F4WA 2RKIA 1X2IA 3VQ8A 1IG9A 4DSEA 4GLXA 4I2DA 1T05A 3G6XA 5D46A 1YVUA 3C1ZA 2XY5A 3NBPA 1JKHA 3TAMA 4N5SA 4UQGA 3MDAA 2R8HA 5KGXA 4FYDA 1MQ3A 5J0UA 1ASVA 4CJRA 3TAPA 4NCAA 1ZQWA 4DF8A 4NY8A 2ZJ5A 4CHZA 4M6WA 4F4YA 4IQWA 1WSFA 4BDYA 2P6UA 2IHMA 4RNMA 1VSDA 2AGQA 2HNDA 5J2QA 3PW0A 5CB1A 3LK9A 3SYZA 3NGYA 4DTNA 3RBDA 2Y1IA 1BQNA 4OGEA 1WSGA 4C8LA 5J0RA 1VSFA 3QO9A 4KB1A 4DOBA 4MEXA 2OWOA 7ICOA 1HYZA 3LZIA 4KTWA 3V9SA 4DQRA 3PX0A 2FMQA 1QLNA 4FLTA 1KEJA 1ZBLA 2ZTEA 4ED2A 4RUAA 1S1UA 1IKXA 3K2PA 3UXPA 3ISBA 3LP0A 1L3UA 5J0SA 3RJGA 3DYAA 4N41A 2DY4A 5I42A 3MEGA 3JPPA 5EWFA 3KHLA 1C1AA 4CE9A 1Q9YA 3T5KA 3ZT3A 1X9SA 3KJVA 5L1KA 4CGJA 5KFDA 1UT5A 7ICKA 2R8GA 3H8JA 3IAYA 4EZ9A 3AVHA 1JLEA 1S6PA 5KFHA 2B21A 3VQBA 3ALYA 1XI1A 3AVAA 4DQQA 3NHGA 1KFDA 2V9WA 3O3HA 3KD1E 1BPZA 1A5XA 4KHYA 3RJHA 4UAYA 5KG6A 4QZHA 1SKRA 3OVNA 3JYTA 1ZQAA 1RTDA 2G8UA 4RQ5A 3PVXA 4B8AB 1NJYA 4I9QA 3BQ1A 3C21A 1ZQLA 3H7IA 1JX4A 4TUPA 3NDKA 1Y97A 2FBYA 3AA3A 2BR0A 1MSWD 3OYHA 4HUGA 4KLOA 4DTSA 1SL2A 1C0TA 1H38A 4FJGA 1KTQA 1J9AA 3S3OA 4UBBA 4W5QA 2HVIA 4KTQA 4CHYA 4CJ3A 2YKMA 4R5PA 4M3WA 2F1JA 2YNIA 8ICXA 4M9JA 4Z6CA 4IDKA 1GOAA 1CLQA 2P5GA 4LH5A 4ED3A 5JS2A 1Y88A 1JXBA 5I3UA 3SV4A 4PWDA 3BGRA 3LAMA 1ZBIA 2DFFA 1TAUA 2PYLA 4YXMA 3OYKA 3DOKA 3ZSXA 4YVZA 4BXOA 1TVRA 3LP3A 3T5JA 1BPBA 2HNZA 4F5OA 2A1JA 2FBXA 3DM2A 4BACA 3OYDA 3VQCA 3H40A 2HHUA 1JLBA 4ED7A 3NFAA 3UIQA 3D0PA 4K4HA 1IO2A 2YNHA 3QEBZ 2ASDA 4YFUA 1LW0A 4Z4HA 3HJFA 4YNQA 2ATLA 2NRZA 1A76A 5DBBA 4MFCA 1FK9A 4QZ9A 5CWRA 2BGWA 3RAQA 4C8NA 4P4MA 3THVA 1FKOA 3AVFA 9ICVA 2UVUA 4RQ0A 2H5XA 3ZSZA 4O5EA 4FK2A 4YMOA 5KFLA 1WSIA 3S3MA 2HHTA 4O3OA 3UXNA 3OJSA 8ICRA 4KLDA 1JLFA 4KLMA 4N76A 5IINA 1TKXA 3KLEA 1V9PA 1CUKA 1LAWA 2BQRA 3NE6A 1S9FA 3KTQA 3C2LA 3PMNA 4J9PA 3HVRA 3GDXA 4AHTA 3V6DA 4LSLA 1A5VA 3SUNA 3MEEA 5DMRA 4CERA 4KFBA 5J2PA 3H8WA 1YTAA 5KFKA 3HPGA 5HHHA 3PMLA 4ECXA 4FM2A 4QCLA 5KFYA 3AVGA 3O4QA 2ZJ8A 3UPQA 4LY7A 3HO1A 1BI4B 4DG1A 4F8RA 4B9SA 3QEAZ 3EW9A 4C8OA 4HUEA 3PO5A 3DRRA 3SZ2A 1S1XA 1WAJA 1TK5A 2PFPA 4JWNA 2D0CA 3KLHA 3T3FA 3GILA 4BE0A 4QZGA 1SV5A 3Q8PB 3T1AA 1BPYA 4C8KA 4CJTA 4W5RA 4IRCA 3HPOA 3G6VA 4FJMA 4IG0A 1ZQZA 5KT6A 3MBYA 4QZFA 4XQ8A 4M0AA 2RF2A 4KI6A 4PY5A 5J2HA 1U49A 4C8MA 2JZBA 1QSSA 2W42A 8ICFA 4FM0A 4BGDA 5D3GA 4RT3A 1ZJNA 3VQQA 4JS5A 2BCQA 1RXVA 1ZQPA 4EP4A 1RYRA 4IR9A 4UAZA 2UVWA 3WNHA 5KFBA 3OYEA 3C6TA 3RH6A 4ID1A 2IC3A 3AVBA 1XO1A 4O5KA 4ECWA 4RW8A 3AO4A 5J2MA 4I2AA 4E7KA 9ICUA 8ICAA 2D5RA 3V9UA 4O5CA 4CGIA 4L8RB 4CEOA 3MR5A 3EY1A 1LWCA 4IBNA 4J2AA 4YXJA 4F50A 1GOCA 4Q8EA 1JXLA 2ALZA 1N48A 1TK0A 3GQCA 4M3ZA 4NLNA 3QZ7A 2W8LA 2XY8A 3MXIA 1D5AA 1S76D 4IQVA 4E19A 3K57A 4CJSA 4I2EA 3TARA 2YHAA 4QW9A 4FXDA 3PUFA 3LWMA 1X9MA 1VK0A 4FJ9A 1VSLA 2R8KA 3L2RA 1HJRA 3RJEA 3AV9A 4FS2A 1I39A 3V81A 5D4BA 5DG7A 4CF9A 1HUZA 9ICBA 4ECSA 4Z4CA 1S1WA 5KG4A 1EX4A 1HMVA 4JRQA 4CECA 4ED0A 4KREA 4EP5A 3QEPA 5DB6A 4FLVA 2NRVA 3BJYA 3MEDA 4RQ7A 1U04A 4XIUA 4X5VA 2R8JA 3NH0A 1DOQA 3TANA 4CJWA 2W9CA 3DLEA 4KLGA 2FLLA 4Q8FA 4RUCA 5KFQA 3OSNA 4YD1A 4DSJA 2AU0A 3PY8A 1KLNA 5KT2A 3RH5A 1ZQFA 4KTZA 1NK7A 4QZAA 2V4RA 5KI6A 1HYSA 4PQUA 2XO7A 9ICTA 4ECQA 3AVJA 3MECA 3BQTA 5SZTA 4OLAA 4ELVA 5C42A 2NRTA 1HJPA 1TKDA 3RR8A 1CXUA 1UA1A 4ZHRA 1CEZA 4LVSA 9ICHA 4JV2A 3LALA 4R65A 1RZTA 5KFIA 3M9OB 4RW6A 8ICHA 3MR2A 3ZT1A 1IKVA 4RQ6A 3ISDA 5L1LA 3SUQA 1VSJA 4E89A 3EYZA 1QTMA 4ECVA 4K4IA 4J9SA 2B4JA 4O3RA 4CHQA 4E3SA 5J29A 4Z4EA 5J0OA 2FMSA 5T7BA 4CJPA 1U4BA 1YT3A 2E6LA 4I9LA 1TL1A 4LSNA 2Q0ZX 3T19A 4FO6A 5KFPA 1DGSA 4B9NA 3CYMA 3QINA 3ZD9A 2HHVA 1XSPA 2X78A 4I2JA 1SL0A 2XY7A 3QIPA 1PZNA 5J2KA 2AQ4A 4RNOA 4JWMA 9ICQA 1ASUA 3JPSA 4DQSA 3AVLA 1KLMA 1BL3A 3JPTA 1T8EA 4M9LA 4M6WB 1EXNA 1YTUA 4GMJB 2Y1JA 5CZ1A 4M47A 5CYQA 3IG1A 3SUPA 2DFHA 2NRXA 2BANA 4O3QA 5L1JA 3AVMA 3LANA 2IGIA 3I0SA 5EWEA 5DB7A 8ICEA 3SQ2A 4XA5A 3A2FA 2IMWP 1TGOA 4HYKA 2DTUA 9ICAA 5F9LA 4RW7A 5JUMA 1ZETA 3LZJA 1RDCA 1C6VA 3ZDEA 4RZRA 2KW4A 3S3NA 8ICSA 3ASMA 2G8IA 3KK2A 1T03A 3SQ1A 5KG5A 3MXMA 3RH4A 1ZQRA 4OVLA 1COOA 3KK1A 1RCHA 1FXXA 2HMIA 4UB5A 5TZVA 4OKKA 4W5NA 3MFIA 3HPHA 2PYJA 4DFMA 2W9BA 4LZGA 4KN4A 1TV9A 3KD5E 3QERA 1NK9A 4ZTFA 8ICYA 2C2EA 1RT6A 5DLGA 4FZYA 4Z4IA 4EYIB 3QETA 4IRKA 2IOCA 1WLJA 4JLHA 4CGHA 5EU7A 5JS1A 2BCUA 2PZSA 5J2GA 4KITB 1U47A 1S0VA 1JLQA 4HTUA 3RMBA 4KLEA 4B8CA 2HW3A 3OYGA 4F92B 4FW2A 5J2NA 2ZD1A 2RPIA 4CJEA 3HXMA 3OYBA 1VSKA 2VG7A 3OS1A 3B0YA 2AQ0A 2PFQA 5FDLA 3VQ4A 2PXIA 2PFNA 4IG3A 4J9OA 8ICZA 4FJHA 1NOYA 3JSMA 3HW8A 4MFBA 2JEFA 1ZBFA 1ZQBA 1W0HA 1NKBA 4F2SA 9ICKA 3HVTA 1B92A 2G8WA 3DRSA 3GV5B 4KPYA 4IRDA 5L9XA 1S5JA 4LH4A 3RJKA 4I7FA 5J0TA 2OYQA 3E2EA 3AU2A 2J6TA 4FJ8A 3L2UA 4CJ4A 3KIOA 4CFAA 4ECTA 3L3UA 4QZ8A 4CJFA 3DLRA 3MXJA 3VN5A 5J2CA 1A77A 4BXOB 1KRPA 4UB2A 4IQTA 2A1JB 3RJFA 5HBMA 1X1PA 3OSPA 1D8LA 5C5JA 3AUOA 4KHQA 3RRGA 3RAXA 1J53A 1DLOA 1ZQMA 4KLFA 4EBEA 4TQRA 3RB0A 1T3NA 3TAEA 8ICCA 3OJUA 4F4ZA 3NF7A 4CIFA 1HPZA 4HVJA 8ICQA 3ITHA 5FROA 2FPMA 3IM1A 1IKYA 4R64A 5IILA 5KG1A 1QQCA 1S77D 9ICNA 2D0AA 4DS4A 3SI6A 4F4KA 1BPEA 1RNHA 4OGCA 4Z4FA 1S0OA 1U45A 2F96A 4CFBA 1UOCA 4I2FA 2AGOA 1EP4A 1HUOA 4W5TA 7ICEA 4JV0A 2XRIA 2NRWA 3NH1A 3HYFA 3QLHA 3MAQA 4ED8A 3M8RA 9ICLA 3O3GA 3GV8B 1NOMA 9ICPA 1LWEA 4UAWA 3MR6A 4KO0A 5KFAA 3ISNC 1A5WA 2WOMA 2EHGA 4M9GA 2MUTA 4K8XA 5KFTA 1IH7A 3BDPA 4IFYA 2P6RA 3O3FA 3DLHA 1FKPA 2Z1GA 7ICSA 4O3SA 2KFZA 4GXKA 1F21A 2E6MA 4DOCA 1ZQDA 4FJNA 1BISA 1LWFA 4CFDA 1BQMA 4CEEA 4HHTA 3TFSA 1S1VA 3K5NA 5C25A 5HNKA 2G8VA 3KK3A 4AILC 3PV8A 2VA2A 4QWCA 4JUZA 2GV9A 4FBUA 7ICUA 4NM1A 5HHIA 3QEIA 4DEZA 5KT4A 3GIJA 3L8BA 3TR8A 1RBUA 3G10A 4ELUA 2KQ2A 2JZBB 4IFVA 4CEDA 5CP2A 3C95A 4RU9A 1NJXA 4ECUA 4Z6DA 5HRRA 4IR1A 1WNSA 3GV7B 3JPOA 1NK5A 4FJ5A 4FK4A 2B5JA 4N56A 3SCXA 4Y1CA 5KFWA 2AJQA 1TVAA 5KFZA 2ZJAA 4J9NA 1XSLA 3D45A 4DU3A 1BCOA 1NOZA 4KN7A 3HL8A 4FJ7A 9ICMA 1XHZA 4J2EA 2FC0A 3PW2A 3AVKA 4FK0A 4DTMA 1ZQYA 4M04A 1ZYQA 8ICTA 4Z6FA 3SI8A 4M2YA 3SJJA 2W9AA 1C1BA 4TUSA 1TK8A 3AO3A 1ZQXA 1L3TA 2Z1IA 4NXZA 4I2GA 1Z00A 4RQ3A 1T4GA 2I5JA 3B6PA 4RQ2A 4Z4GA 3OYLA 2J6SA 2PI4A 4OLBA 3L2VA 5IIJA 3V7KA 2P66A 3NGDA 8ICWA 4O3PA 3KLFA 3NF9A 1BPXA 7ICMA 2HB5A 1QSYA 1ZQTA 4CHOA 1RTHA 2ZUCA 4FLYA 4RNNA 4IQUA 3ZDCA 4R8UA 3F73A 4ECYA 3C5GA 4NLKA 1ZQCA 5IIIA 3ZCMA 4LD0A 3V6JA 4CHPA 4P2HA 3JPNA 4CEQA 4CJVA 5J0YA 4BE2A 4QWAA 2W9CB 1O1WA 4DTJA 4DL4A 4E7LA 3ISCA 5FRMA 4Q44A 2XY6A 9ICFA 4EEYA 4TURA 3HM9A 2BQUA 4F93B 4KLHA 5KFNA 4AH9A 3RJJA 4O9MA 3TQ1A 1RXWA 1MQ2A 3OY9A 1W9HA 3QEVA 5L1IA 1ZQIA 4M3UA 7ICFA 4CHNA 2A1RA 5J0WA 2FLNA 5DDYA 5IIMA 1EXQA 1NJWA 1R0AA 2EX3A 4E1NA 4J9MA 1J5OA 2I9GA 2C2RA 3UQ2A 3NTUA 2ISOA 1S97A 7ICGA 5DGAA 5KFUA 1VSMA 2GBZA 1BVSA 4B9MA 4FJIA 3M8SA 2LYHA 3AO1A 1NK6A 4FLZA 2O4IA 4QW8A 3N97B 1C0UA 4FJLA 4P4PA 5KFMA 3K5OA 3N4MB 3GIIA 4B9UA 1S1TA 3K5MA 4YCXA 1Z26A 2WONA 1DTQA 1RPLA 4CFCA 2P51A 5SWMA 3ZSOA 2GUIA 3OYMA 4DMNA 4AHRA 3RBEA 3GIKA 2P5OA 4ICLA 5DDMA 2HNYA 4TUQA 1JLCA 5DBCA 2YHBA 4DFJA 2X6SA 4I28A 3DLKA 4DOAA 3V4IA 5DLFA 2HHXA 1UAXA 4CF1A 4RPZA 8ICNA 4CIGA 3VQ5A 2BCRA 4MQ3A 1RDAA 3QNNA 4ZTJA 8ICPA 1UA0A 2BCSA 2BDPA 4RT2A 4DWIA 3NCIA 1L3SA 2B6AA 5BOLA 3E01A 2G8FA 4M3RA 1S6QA 3MR3A 4CF0A 4QWBA 1IXRA 1NK0A 1S9GA 3IS9A 4DL6A 2FBVA 3MFHA 3VA0A 3C23A 3EWAA 2D0BA 1TV6A 3CG7A 4MEYA 5CR0A 4EZ6A 3ZSQA 3Q8LA 5CZ2A 2J6UA 5CJ7A 4J9QA 5IIKA 1SL1A 1ITGA 3CQ8A 3TAGA 2OPRA 5KFGA 3C1YA 7ICNA 4O0IA 5KG3A 4W5OA 5J2JA 3VQAA 4MF2A 4Q0BA 4DL5A 3CFOA 3LWLA 8ICOA 1K6YA 2W9BB 1WSJA 2BGGA 4QWEA 4PUOA 2Z1JA 4RW4A 4EBCA 2R7YA 3RMCA 4F5RA 4DU1A 2G8HA 4MF8A 1WSEA 9ICCA 4DTPA 5EOZA 1RT2A 1B43A 1JMSA 5KGWA 1Z25A 2ITGA 8ICVA 4CESA 1ZJMA 1WCNA 3WNFA 2XCAA 3ZSRA 3PW4A 3WNEA 4CJ5A 3B6OA 4YMMA 5HRPA 4DSIA 9ICIA 1JL2A 4YR0A 4J2DA 1U9LA 4I27A 4KLJA 4R63A 4E7JA 4H4OA 5J0QA 3SPYA 4QOZB 5EWGA 4OPKA 1SZPA 3ETLA 3AVIA 1KVCA 3PO4A 4PH5A 3MGIA 2F1HA 2RDIA 2MAXA 4I2HA 4BDPA 2PY5A 1HQEA 2XHBA 3SUOA 4B9LA 4GXIA 3QEWA 1L3VA 1RTIA 2DFLA 3HP6A 2JLEA 3SV3A 4BE1A 1NK4A 1KFTA 3ORYA 3H4DA 4RQ8A 4CEZA 1RT3A 2OA8A 2C2DA 9ICEA 3PW5A 3AU6A 3LP2A 2KFNA 4NLGA 4YQWA 1VSIA 1BIZA 2XCPA 1ASWA 4F2RA 1JL1A 1XSNA 3V72A 4GC7A 5DQGA 2W8KA 1RBTA 3OYIA 3MABA 3LAKA 1VSHA 7ICQA 3JPRA 2E4LA 2IDOA 1G15A 3VQ6A 5KFCA 4DSLA 4I2CA 2VANA 3OYJA 3ZDBA 5KFXA 1QS4A 4DSFA 5KTQA 4CGGA 4DFKA 1KSPA 4CEBA 1KFSA 1BCMA 1ZBUA 8ICGA 4O5BA 3C2KA 3FDSA 4NCGA 5KFVA 4I2IA 7ICVA 1LB2B 2DFEA 4AHVA 3AO5A 5DB9A 3QESA 1S9EA 4DQIA 4CEAA 4WE1A 4JS4A 5CA7A 4CJLA 4O0JA 5KRTA 1SKSA 2BHNA 4DF4A 3CFRA 3L3VA 4M3YA 4QZIA 4Y1DA 4FM1A 4E1MA 1LW2A 4KHSA 9ICSA 1HRHA 2ZE2A 3AVCA 4FJKA 4DFPA 4F91B 1RILA 3ZDAA 3RTVA 4G1QA 4I2BA 1ZQOA 2P1JA 1GOBA 2KZ3A 4KHUA 4FLWA 4CCHA 5J2EA 3V7JA 4O3NA 4KI4A 3WNGA 3C2MA 4GC6A 2DPJA 2MUTB 1C7YA 4QWDA 4FLXA 2FLPA 2M9NA 1X9WA 4DU4A 2VA3A 4KHNA 4BWMA 2JEIA 2BPFA 3KLIA 3AA4A 3EPGA 3KHHA 4KLLA 1KVAA 2ZUBA 4I2QA 3VQ9A 4CJKA 3OYCA 3PNCA 1B22A 9ICGA 4PGXA 1HNVA 4B9VA 8ICMA 2F1IA 2R8IA 3M9MB 1RT1A 1N5YA 2ISPA 4M45A 5J2AA 3HX0A 4FS1A 1U48A 4UB4A 3RWUA 2IBKA 2NUBA 1JXEA 3K4GA 4M9NA 1MU2A 4CGFA 1WCLA 4ECZA 2RDJA 4I29A 5HMMA 2DPIA 3K58A 1TKZA 1S0MA 5J2DA 4KMUA 3VQPA 3BQ2A 4B08A 4E7IA 1ZQVA 5J2FA 4UB1A 5KFFA 1K1SA 1N56A 4FZXC 5DKWA 3VA3A 1XS9D 9ICWA 2AGPA 2JEJA 2PFOA 2IAJA 7ICPA 4DTRA 2V4QA 5KT5A 2VG6A 5HROA 4FZZA 5J2BA 2RN2A 4F3OA 2PI5A 2F8TA 1LAVA 1QHTA 1KVBA 2HHQA 5DB8A 2C22A 2A1SA 5KG7A 2HVHA 3V9ZA 3MDCA 3FFIA 3V9XA 2OZMA 1TFRA 3I8DA 5DG9A 4KV8A 2YKNA 3Q8MA 3RB3A 3HT3A 1XHXA 4DL3A 7ICJA 4ECRA 4E7HA 4DTUA 3PW7A 3LPUA 5DG8A 5KFOA 5IIOA 1IM4A 3ZD8A 1SUQA 2VG5A 4DSKA 3AA2A 4F5PA 3Q8SB 1Z00B 4FCYA 3FYHA 1RT7A 3RB4A 1RBRA 4JK1A 2VA8A 4CEFA 3V9WA 1RDDA 8ICBA 1BIUA 2BCVA 4DL7A 3K59A 1EETA 1ZBHA 3C5FA 3RRHA 1MC8A 3OGUA 4YD2A 4RPYA 5HRNA 1RBVA 3NGIA 1QSLA 1K1QA 3ZSVA 4MFFA 2IHNA 5CY4A 1SKWA
chains in the Genus database with same CATH superfamily
3P5TL 1YIJN 2XHCA 1WOOA 4KLQA 2X51A 2RDDA 3M8PA 4C1NK 1PYTA 4OPAA 3SQ0A 3B9JA 3O6QA 2HOEA 2KDOA 1TELA 5L8RC 2G8KA 4LZDA 3HHNB 3PX4A 1S6OA 4FWKA 4KB7A 3RJIA 1XMOJ 4M9HA 3SSQA 4UBCA 2DEJA 2I0XA 3H90A 8ICLA 2KL8A 2UXCF 1RYSA 2C3UA 2C2NA 3D6MB 4L74A 5HK4A 2ZH9A 4CF4A 4ZIVA 2ASLA 4QZEA 1C1CA 3PSIA 1X4FA 3UKRB 1PUZA 1FVSA 4BC2A 1AROP 1IKWA 2UU9J 1HWKA 4IDHA 1A6SA 1RHJB 4X4UA 1R0AB 3CGIA 2ZDPA 2KKHA 4NLWA 1R0BG 4LF6K 4RQ1A 5ALYA 4H0OA 1XK8A 4OD0A 4IQXA 3FQKA 4XPCA 3J80U 1VBYA 4OZLA 8ICJA 4TQSA 4F5NA 1WC0A 4KHWA 3QE9Y 4KIAA 1C0UB 2FHJA 4H4KC 3SMPA 1HWJA 2WF8A 4YOTA 3QFPA 3B0XA 1ZQGA 2DH7A 2B3TB 2WONB 4NJ8A 1WAFA 2QMWA 2A2DA 2FVQA 1NJIO 2BJ3A 2W9MA 2KTQA 5A8KB 3C6UA 1PVPA 4C0OC 2GTDA 2YV0X 3NXZA 3CJKB 4O55A 1J54A 1NLKL 1QDUB 1BWVA 4YN4A 1V5IB 4GMKA 3U02A 4ICLB 3KYLA 1IM6A 4FJJA 2WAQF 1NGAA 1JI7A 5BPNA 1FE4A 5J2IA 3V4IB 4WIIA 5DBAA 3KKRA 2PD1A 2E88A 3UI3A 3HTVA 1ZQHA 1ZOTA 4Q45A 3C16A 1F2HA 2FPKA 4AF1A 2MPUA 4DU8A 3O9UA 4OKEA 1DARA 1DQ8A 4QZBA 3NAEA 3E01B 3WKDA 1ZXOA 3GFKB 2FJBB 4IJAA 4JI5F 3MMCA 3MCSA 3VAJA 3RUBL 5AQKA 2FBTA 4DLEA 2BKEA 3A0IX 2B7CB 3FC4A 5CYMA 3I1YA 1TV6B 1W7WA 3O5TB 4RG8A 3SSRA 5KOWA 5BPCA 3D4JA 3ETMA 1EARA 3D6FB 1WB9A 3ENHA 2H4YB 2LQ5A 4NYFA 1DRZA 3OYFA 4PPXA 3P31A 4B3MJ 1ELOA 1Q53A 4DV2F 4RPXA 4NL9A 1OH8A 2VWKA 3T1YK 3WU2U 3CCQN 5AQNA 1OPIA 4X4SA 3G0ZA 1VQ6S 2D3ZA 2MU2A 3UQ0A 2CRLA 4XPEA 2QT7A 3TZZA 4OIXA 1OXJA 2YNGA 3P5BP 2FXUA 2E9TA 2DWQA 4JRPA 4G3IA 3VQDA 4IOBA 2EZXA 3BV8A 3OW2R 4H8KA 4DX8H 1CXQA 1PO6A 4FKYA 3T1HJ 4E0DA 2MHNA 4A5BA 2C2KB 3VEYA 2C28A 2BJDA 1KCFA 4F26A 3ILOA 2WB4A 4JKFA 2Z2YB 3WC0A 1COKA 3OS0A 3GG4A 4IFEA 2QARA 1NKCA 2X6NA 1YVFA 2ZQBA 4B3TF 3D1HA 1YSJA 3OFGA 4X65F 3QGIA 1TUUA 3P1GA 3ET6B 1IN0A 3HM8A 3ZYYX 4IZ9A 2RQKA 3IMXA 4AQYJ 3HFVA 5AI0A 5M1QA 1FI4A 2E8PA 1RWXB 4PCQA 4KRFA 4CIEA 1DTTA 1ATNA 1MNEA 5LMNJ 3MI7X 4UASA 4ED1A 1FRLA 1OPZA 2E1MC 2AJ4A 3KG4A 5EDWA 3D7EO 4I6AA 3T5HA 3ZT0A 1ZZFA 1VK3A 1XNQF 5F9NA 1I3AA 4CK3A 4GV6A 2KSOB 1HBOA 4RW9A 5G0RA 3K7RA 4JKCA 2AIRB 5EX0A 2KHVA 3OQ2A 4NCGB 4PHPA 2JVOA 2QK9A 1V3SA 2FPLA 5KRSA 4JI2K 1IBLJ 2VPZB 3CD0A 3BREA 3S9HA 1V4TA 3M9NB 3FJ2A 3VQ7A 4CYUB 3M8YA 5F8HA 4DO9A 4CI0B 2KT2A 3RW6A 2NPIA 1FJEB 1YJNS 3Q22A 4NM2A 2OKQA 2MQ8A 2GO7A 3UQSA 2DH9A 3O1BA 4JI0K 3GPAA 1TKTA 1IJJA 2QWQA 2RB7A 3A3OB 4G1QB 3W63A 4DR2K 2VYPA 1XMBA 1ZQUA 2KVSA 1X5TA 4CF8A 2ZWPA 1S22A 2CQ4A 2Z2MA 4JD2B 2YQ3A 4KB0A 4JI3J 3NGSA 4CK2A 2VFUA 1BUPA 5MLCQ 3GSIA 3NGKA 1BDGA 3SPZA 3PR5B 4PKIA 2NR0A 4MKAA 2ZIVA 1BPDA 1OO0B 1F44A 2KZZA 1D8YA 3D1OA 4G1IA 4NOHA 2HRTA 1KN5A 4CNZA 1ZQQA 4S0MA 3EXYA 3ZXWA 4GNIA 5E26A 4CF2A 4I2QB 3ZT2A 1LNQA 3H2LA 2LCWA 5HVFA 3H5YA 1HNVB 4J9VA 1VLYA 5KG2A 2KN7A 2Q1NA 2QFJA 1T9UA 3GJSB 3TUIC 2RRAA 3RJMB 1RT1B 1PC4A 4O4GA 1K0VA 2DR5A 3VPZA 2OPSA 4F4WA 2DGXA 3BY5A 4IO9L 3IBWA 3EZUA 3SJHA 3VQ8A 1IG9A 4DSEA 2SXLA 1K73T 2AZ1A 5CE3A 4USHA 2XY5A 4FYDA 2AMCB 1OS5A 4N5SA 2R8HA 5KGXA 3OVAA 3CDUA 2IVPA 1ASVA 4CJRA 1S7HA 4NCAA 1ZPWX 1PKUA 3N5FA 4F0HA 1AW0A 4M6WA 3CCRS 1VSDA 4A5AA 2E1RA 4LF2A 5J2QA 3AGRA 3NGYA 4CO5A 1U1OA 2HBKA 3PLAA 4DTNA 3RBDA 1FTCA 3HI0A 1BQNA 4OGEA 3QU4A 1I94J 2QW9A 1UPHA 3MK6A 3CC4N 3VVUA 1IWAA 4DOBA 3ONQA 2GIQA 3EZOA 3PX0A 4DI6A 4LFAJ 4QU7A 1M5SA 3H1VX 3FFIB 1D0EA 3HHEA 4BRIA 4BRKA 2HURA 2ZTEA 3CCJN 4BY9C 3FLCO 2R2SA 4B02A 4N41A 3F53A 1SUQB 2VG5B 4P75A 3TPQA 3F44A 2BZ2A 1S8OA 1Q9YA 2PSZA 3K8VA 4GO5X 1JMTA 3NNCA 3AD8C 3OPKA 4RR5A 2YVSA 4NWIA 3ZC4A 4CGJA 2AF6A 1QQ6A 3C14A 1JLEA 1QH9A 1MN9A 5BPMA 4IUFA 1S6PA 5KFHA 3VQBA 3ALYA 3MOJB 4MIAA 4DQ8A 2P8IA 3SIPB 3OTOK 3KK7A 3DDNA 2V9KA 3IRUA 5FPDA 4K5SA 4QZHA 2UXBF 3GFZA 1NGFA 2JFKA 3OVNA 3JYTA 2CQHA 4RQ5A 3PVXA 3CERA 5L46A 2OMOA 2YNFB 3SXLA 3H7IA 3TUPA 5AIAA 4ZK7M 4B9QA 1IWGA 3AA3A 2W7PA 2R7UA 4CZIA 3CIMA 1SL2A 3L6QA 3VEXA 1LK7A 1SXLA 5BR9A 2OO4A 2ZGYA 2HVIA 3HOTA 1URRA 4WK1A 3OA9A 4CJ3A 1D09B 4M3WA 1W97L 4TNOA 1TMJA 1S4FA 1Y10A 2YNIA 3CULA 1K0TA 2CPFA 3WK6A 1CLQA 1RACB 3TYTA 1H98A 4LH5A 5I3UA 5AKEA 3SV4A 4HACB 1W26A 2M5YA 3M6XA 2VJVA 3VEZA 2NQPA 2IMOA 2HG4A 1UQVA 4OZ5A 3BS5A 1ZBIA 1Q7YO 4BG9A 4DV4J 2PYLA 1Y00A 1H0HB 1Y5IB 1HNZJ 3CXCM 4BXOA 2MQOA 3VTIA 1VQNS 2A1JA 2DIVA 2XIDA 1EKSA 4NXMJ 3CD5A 3THYB 3H40A 3WK9A 1JLBA 3UIQA 4ANDA 1HHTP 3TSPA 4K4HA 3LPEA 4GKJK 1LW0A 2ATLA 1T3VA 1A76A 3B6BA 5ALLA 4L3KA 1RT5B 4ITSA 1GLJO 2AJ0A 1JLAB 4OLOA 1L3KA 4TN2A 1N33F 3AQOA 3MMAA 4X62K 3RAQA 3OXLA 1FKOA 4OI0A 4ZKAA 3CJ0A 4IS7A 1YGYA 1YRUA 1U1LA 1F5SA 4MJKA 2XNQA 1FW6A 2MLYA 1VFJA 3AOCA 1WTBA 1WG1A 3EGNA 4KLDA 3UPFA 4KLMA 2C3OA 3M2VA 1S57A 1TKXA 4QR2A 1V9PA 1CUKA 2IVOA 4UB8U 4YEAA 3CNHA 4NLUA 1X4AA 3C2LA 4ZVTB 1RTJB 2ZKUA 2CGJA 5U47A 1RQLA 2DXEA 4Y00A 3GDXA 3CF5L 3W9JA 2B9XA 5J2PA 5I3QA 1X4CA 1YTAA 5KFKA 3L7UA 4NPOA 4X4PA 4O4RA 3VEOA 1FT8A 1WF2A 4FM2A 2CRXA 2R2RA 2W2MP 1EQ0A 5J1EB 4DR4F 1Y64A 2EXUA 3MWBA 1MA7A 4C8OA 4F9OA 5GAGU 3SZ2A 3ZTQA 2OJ3A 2PFPA 4JWNA 1QAYA 3GILA 4BE0A 3FUYA 2A3ZA 4QZGA 3T1AA 1BPYA 4CJTA 4W5RA 4IRCA 4A8XA 4NLSA 4FWSA 1HNIB 3R5CA 4IXCA 3P8BB 4FJMA 1EQYA 1KQSR 3CJTA 5KT6A 3MBYA 2D69A 4WYLA 5C7PA 4XQ8A 3P6YC 1H6KX 4KI6A 1U49A 1UJ4A 4PKGA 4ID5B 3S6EA 1MN7A 4BGDA 3OFEA 4DV6J 4RT3A 2A41A 5ALGA 1XQSC 3VQQA 1FDBA 1KW4A 2XWYA 1FRKA 5B0FA 3W64A 1RXVA 4ERDA 3HHLD 4Y2YA 1UCNA 4IR9A 4A62A 2UVWA 5AQVA 3RH6A 4ID1A 4PKDB 2IC3A 5L9NA 4RW8A 3AVBA 2RT3A 3AO4A 3I28A 1EAYC 2ZJRQ 4OYXA 3M8QB 5BR8K 9ICUA 2HBQB 4MN4C 5FIIA 2D5RA 4O5CA 3W65A 3WC2A 2RE2A 3WK7A 3M2RA 1Q8LA 4DUZJ 4J2AA 3U9DA 4YXJA 2BX6A 2NYIA 2OUGA 1HQUB 1JXLA 2ALZA 1N48A 4Y2TA 4RNHA 2MDAA 1WF1A 1HL6A 3VZIA 3WEEA 2W8LA 5AQSA 1V3ZA 5J8YC 2H5JB 1S76D 2A18A 4E19A 4I2EA 3N6MA 2KHOA 3TARA 5B08A 3PUFA 1VSLA 3L2RA 1HJRA 1VJWA 5D78A 2EPIA 1YK9A 3D54A 3G8TA 3H45C 4ZVPB 1S1WA 4E1JA 4JV5J 2J9DA 4UB6U 4DB3A 3BYPA 4FLVA 2KIWA 5IV4A 3EDQB 1EZZB 3J7ZO 4OZ2A 3R3LA 5TKWA 3CCUN 2VONA 5HMWA 2Q43A 3NMUA 2W9CA 1A6LA 3DLEA 3IAS9 3DOLB 2O8DB 4IEIA 3UN5A 2HVEA 4NX9A 3PY8A 3I5CA 4KE5A 3CO0P 4KTZA 2V4RA 2BE2B 3BBCA 5KI6A 1FNXH 2XO7A 9ICTA 1N5SA 2CPHA 3BQTA 5SZTA 5AK5A 1RADB 1RU2A 1R8PA 4ELVA 4ZLPA 1HJPA 3F2BA 3OTQA 4LVSA 9ICHA 3BGUA 3NASA 3N7RC 3QRQA 4R65A 1NLVA 5KFIA 4RW6A 1B0XA 4H0XB 1X40A 3H42A 3GYGA 2HK3A 1CULB 2A6OA 3JSRA 3MR2A 3ZT1A 1F9FA 5L1LA 3PDNA 1HIWA 3LL3A 3U27A 4Z37A 1FIQA 2ZFHA 1O6XA 4ECVA 2R7VA 3C15B 1RT4B 3GCXP 1UVIA 4E3SA 3J7ZT 1HNXF 4EEKA 2ASMA 1YT3A 4B3RF 4CJPA 3JB9k 2LXIA 3BB5A 3O80A 1OW5A 4Z94A 4BR9A 5ALZA 3F0NA 1SZHA 1KN6A 2HHVA 3SR6A 1T05B 2VU5A 3TAMB 2XY7A 1Y11A 3BM7A 1Q81T 1UCVA 4LF5F 4JI8F 4EI2A 2AQ4A 5AQFA 3C7NA 3R9PA 1T8EA 2F1FA 3QAUA 3U1MA 1PSDA 2LEPA 1YTUA 1YF5L 5CZ1A 3RG6A 3EGWB 1KDNA 2QWMA 3IC1A 3VWSA 4Y2CA 3J80O 3IM8A 1ZAWA 3K5PA 2BANA 3AVMA 3N4QA 2IGIA 5EWEA 2DXFA 5DB7A 4YY3J 2EC0A 2F9TA 2DNZA 2W03A 3QO9B 1O0PA 4C11B 4CW7B 2IMWP 3OVSA 4YORA 5F9LA 5JUMA 1RAGB 1ZETA 4B1YB 2ZIXB 1S1UB 1IKXB 4YHHJ 2U2FA 3TVYA 3DYAB 4MYUA 2V8HA 2KYXA 8ICSA 5I42B 3ASMA 2G8IA 4ZCIA 3C6HA 4YB5A 3KK2A 4QPXA 5KG5A 2D9PA 3KJVB 4A46A 1RCHA 4UB5A 3CMEN 2PYJA 4Y2QA 4X64J 1OYDA 2VFSA 2GMHA 2VFVA 2F8KA 4ZTFA 2WW8A 8ICYA 1TZ0A 2E7VA 4B1UB 1Y3KA 4TXSA 4LF4F 4Z4IA 2Q0RA 2V50A 2E5HA 5JTIA 4JLHA 4CGHA 5EU7A 2W1BA 3DN9A 1YIJS 2PZSA 1U47A 1S0VA 1JLQA 4HTUA 4AYBF 4KLEA 1RYUA 2HW3A 2ZH1A 4ZVEA 1UW9A 5MAOA 2XZWA 4KAIA 2ZZNA 3HD1A 2FJ6A 4YB7A 3EZWA 2WBNA 4CLKA 2UUBK 4PXDA 4CJEA 3K2YA 1VSKA 5AZJB 3FZKA 5SUHA 2P9NA 3LGHA 3AB4B 2KHDA 1RISA 3JSMA 1V9OA 2ZOGA 1UHUA 1M5VC 1ZQBA 1W0HA 3JS6A 1HX1A 1NKBA 4F2SA 9ICKA 1ZD4A 2YKMB 1KD1T 1B92A 1SV0C 2ZOFA 5ETSA 4KPYA 4ICAA 2XYGB 1UVNA 1E6VB 4IDKB 2QA4N 5L9XA 1RGIA 3QJLA 2CNLB 3L2UA 4CJ4A 4U7CA 3DOMA 5KPTA 3FCHA 3MD1A 1KR4A 2IA0A 1GXLA 3KIOA 4CFAA 1R43A 4N77A 1XTZA 2WVDA 3GYNA 3BGRB 4USAA 3P3DA 1N4LA 4WFAQ 3NWGA 5J2CA 3LA0A 1N0UA 3T41A 2HVDA 4KC5A 2UXCJ 2BACA 2VIHA 1PIEA 2KHCA 5HBMA 4CT8A 2Q97A 3NWRA 3OSPA 1D8LA 2KP7A 2QLTA 3AUOA 1A0PA 4FOEA 3IWLA 3RRGA 4FWPA 3M2UA 4OMFG 3T1YF 2OELA 1A7GE 5AK6A 2VDIA 2LLZA 4EBEA 3TAEA 2R42A 1B4FA 3NF7A 2J8AA 4USIA 5LJWA 1J6ZA 3KMSA 5IILA 1K8AO 2D0AA 1T9YA 3WUHA 1BPEA 1L7OA 1DEJA 1S0OA 5IT9O 2M0GB 3BZKA 5A2QU 3PYFA 1CLFA 1IQTA 3PACA 3J7AP 2E1CA 3GU3A 2Z2LA 4HT7A 4JV0A 2XRIA 2FJDB 4CH7A 3M8RA 3ENWA 3F2KA 3V6DB 3ISNC 4LSLB 2EHGA 3Q83A 3Q86A 3MEEB 2FDNA 4IFYA 4KT0C 5AFUH 1N36K 1YRTA 3O3FA 3OXFA 1T9XA 4WXWA 2C2MB 3LOUA 1SC4B 4I68A 3DAWA 3NVKA 2UXDK 2LYAA 1VK8A 1PJ6A 3NRWA 2ERRA 3GIRA 1WHVA 3LF0A 1SH2A 3BN4A 4DOCA 2E6MA 4F7VA 1N32K 1ZQDA 2CJXB 1FX2A 4PYAA 2ACMA 1LWFA 3NS1A 4CFDA 5DM6Q 4HHTA 3CCQS 3QWUA 1S1VA 5JVHQ 3KK3A 2LXUA 1RB0A 1P1TA 4FBUA 2OTLS 1T95A 5HHIA 5HL7Q 1KC8O 3GIJA 4OJ1A 5LSOA 4FWNA 3CC2N 3JSBA 2ZDOA 3ALRA 3WKEA 5CP2A 3ZEUA 5F8JA 3C95A 5D3GB 3FC9A 1YX2A 4KHPF 1NJXA 4Z6DA 3G6EN 2RP5A 1TFYA 1WNSA 1NK5A 4FK4A 4Y1CA 4DV2J 4YS2A 4I67A 2AJQA 3C6AA 1TVAA 4J9NA 4CDIA 3QDKA 1U1QA 3D45A 4YB6A 3ISZA 2FC0A 4DTMA 2BEFA 4DR2F 4Z6FA 3J7A1 3CD7A 2ZH4A 1IG6A 2KH9A 4H5RA 1TK8A 1HBMA 1ZQXA 4NXZA 4I2GA 3QMLA 3QYPA 4FF4A 1ZQ1C 5A8RB 4WBFA 4H0TB 4Z4GA 2VKRA 4NO7A 5KAFU 1UPMB 3L2VA 2D41A 3EE9A 1BD6A 2CNKB 4X66F 4O3PA 4ZCLA 3FCVA 5AICA 3QSIA 3V81B 1K8KA 3RSEB 3TNVA 3EGVA 2R7XA 4C7QA 1VLOA 4DR1K 3MUMP 4ZOSA 4RNNA 3GE9A 4B3TJ 1QJHA 4ECYA 3QUQA 5JXSA 4X65J 3US5A 4NLKA 2VPXB 5B0CA 4CLZA 1K5OA 1RWMB 4LD0A 4BE2A 4NB4A 4QIWD 2CH6A 4R79A 2HQCA 9ICFA 4TURA 4ZVFA 1GO3F 3HM9A 5A0LA 4PQUB 3TA2A 2H51B 4F71A 5DO2A 3OY9A 2V7YA 1W9HA 3QEVA 3CJBA 1ZQIA 4M3UA 7ICFA 4P72A 4Z2XA 1PYOB 1YAGA 2MJNA 3CI5A 2UUAK 1Q46A 2PBDA 4NXNK 3M6KA 4E1NA 1JQGA 3H3NO 4J9MA 2HHHF 4M7XA 3EKUA 1UP1A 3PSPA 4OX9K 2GUPA 5F2RA 3MM8B 2QRRA 1ZOLA 2ISOA 1MN8A 2AP1A 3EICA 2Y0SC 4LT6A 4K4VA 3JQMA 3M32A 4Q2LA 4XH1A 1M90O 4TY8B 4B9UA 4TU8A 1N62A 4MT1A 1SC6A 1Z26A 4P2MA 2RVJA 3W61A 2A0FB 4CFCA 1JJ4A 2BTFA 4FWLA 4UW2A 3OYMA 4DMNA 5ADXA 2ZIUA 3A0HU 3RBEA 3GIKA 4OJGA 3OTCA 3KZIU 3OTOF 4TUQA 5FP0A 1KLMB 2YHBA 2X6SA 3CE8A 4I28A 3VVTA 4N8NA 3H7HB 2XSJB 1Z05A 2HHXA 1UAXA 4CF1A 8ICNA 2UV8A 3G8SA 4OL8A 3TJAA 2BCRA 3IG1B 2BCSA 2BDPA 1ECWA 3RGIA 5JMVA 4PYDA 1L3SA 2IRXA 2AJ1A 1RU1A 3CC4S 2DBYA 5M1OA 2G8FA 2Y9TA 4CF0A 2KRRA 2DHGA 1NXIA 2VC0A 1U0SA 4Q7AA 4RW7B 3VGMA 3EWAA 3B78A 3ATUA 5DM7Q 4L6V3 3CCJS 2YJEA 2KD1A 2QB1A 3TZWA 2J6UA 4KHMA 4ILLA 3UB5A 3JXOA 4H0YB 5CJ7A 4X2BA 3HX9A 4JI7F 5GTHU 5KG3A 5J2JA 3LWLA 2HMIB 3EKSA 2M8DB 3OUYB 2H65B 4X4NA 2W9BB 5TKYA 4PUOA 4RW4A 4DUYF 5IWAF 2X1GA 4J7CA 1RT6B 2WF9A 1CVJA 2YHXA 4AM6A 4NLXA 1Z25A 5EE0A 1ZJMA 3WNFA 4NLOA 2HIQA 3WNEA 4CJ5A 2GHPA 5EY4A 2YY6A 2ZD1B 1F6TA 5E33A 4TKTA 4DSIA 4BREA 1GLCG 2VG7B 1CJKB 1WUDA 1WG5A 5BR8J 4I27A 1B70B 5H9FK 3F2CA 1VQMN 2W2QP 1YJUA 3CPWM 5J0QA 3IR7B 3UN2A 4OPKA 2KJVA 1M5PC 5ALMA 3ATVA 3MGIA 2HLUA 2E8NA 4MDBA 5HMXA 2PY5A 1Q16B 3PNIA 3ILLA 3SUOA 3HVTB 1TYQA 4GV3A 3F2DA 3A1YG 2HF4A 1NK4A 4I7FB 4IO1A 1KFTA 5F8IA 3H4DA 4RQ8A 2W2OP 4YOEA 2F76X 1NU0A 2YCHA 1SGGA 2G07A 9ICEA 3PW5A 2KMDA 2R7QA 2P9UB 4DPYA 1BIZA 2XCPA 1ASWA 3L3CA 4NA3A 2HQFA 1RHMB 2LBOA 3QU2A 3PJWA 5ETTA 4MK7A 5K8PA 3FSYA 2W8KA 2E4LA 2B0GA 2VFTA 2VANA 2YMLA 2K8GA 1CC8A 1QS4A 4DSFA 2WAQD 1GTHA 4CGGA 4DFKA 1BCMA 3UD3P 1V4SA 4O5BA 4I2IA 5AQGA 4R0EA 3TR5A 5DB9A 1F0XA 4JB3A 1S9EA 4DQIA 4WE1A 4JMUA 1TUVA 4KBIA 1SWVA 1L8LA 2D0OA 5AJ3F 2DKXA 1SH3A 4ZVRB 1LKZA 3VAMA 4XK8C 3CCSN 4M3YA 5ADZA 3N0VA 4Y1DA 2MGZA 3WXIA 4U7UK 1HRHA 1IG8A 1SQFA 2RQCA 2LI6A 2KJ8A 1NHVA 3W8PA 1D1UA 1SS6A 1C2PA 3N7SC 3IR5B 2P1JA 1GMWA 3R2DJ 3QLHB 2V67A 4FLWA 5ALFA 5KPZA 2WOMB 4IOCQ 2D6FC 1Q5VA 2MUTB 4CDGA 2DPJA 4FLXA 1UZDA 1E6YA 3VHQA 3MCMA 4C8ZA 2VA3A 3M6VA 1WC3A 1Q8KA 3DXKA 4PXCA 1N33J 3OV7A 3QRRA 3AA4A 1YQHA 2E9RX 4CZFA 2KB2A 3KHHA 2ZUBA 3KZBA 3TA0A 1MMNA 1LFPA 4YB1P 5HANA 1ZA1B 2FZKB 1DFDA 3WK8A 1S72N 3LYSA 3EEQA 5J2AA 2JZ5A 3QFWA 5DRKA 3H1QA 4UB4A 3RWUA 2XI2A 2XS2A 1ZS6A 1JXEA 1MU2A 2C3MA 1WCLA 4CBUA 3CJ2A 3BO2A 2YI1A 1KKHA 4I29A 4DPOA 5ETQA 2GH1A 4UAVA 4ED5A 3CCZA 2F7VA 2DGOA 4B08A 3UM9A 1VIXA 4IFVB 3THPA 3UCGA 1X8DA 4C0ZA 1IV0A 3FRZA 1RWOB 4DR4J 4NWBA 5D0HA 2XMVA 5HROA 1Q95G 3IBPA 2M8HA 4F3OA 2B5JB 4UUWA 2XWXA 1QHTA 3HKZC 2B4UA 2LKYA 1XJWB 5IQQA 1A9NB 1EWQA 2R7WA 2KG5A 3V9ZA 2OZMA 4QU6A 3AB2B 3DRYA 4MKYA 3HT3A 1XHXA 4DL3A 4E7HA 1LOTB 4DTUA 4LF9K 5DG8A 4DSKA 3AA2A 3Q8SB 3FYHA 2DNMA 3O08A 4P7TA 2R2TA 3ID6A 4ZLNA 4JK1A 4B3SF 1M5OC 1NPRA 4CEFA 3K59A 2OSQA 2OLWA 1HR0K 1FO1A 1PJ5A 2QB0A 3RRHA 1HQ2A 5IQ6A 3TW0A 2CFXA 4MHVA 1QSLA 2Y1LB 2IHNA 4Y2MA 3LDSA 2BPGA 2MJUA 4R8UB 2H3FA 4LIRA 2ZTDA 2E20A 4RQMA 1IR0A 4C4WA 5FJ4A 3H4BA 1KOHA 2Q3SA 3VGTA 5ALIA 3ZTPA 4M41A 3CCUS 3L2QA 2BE9B 2B56A 2XNRA 5IV3A 3HP9A 2G5IB 4B3OA 4CTAB 1CS4A 3L09A 3MMJA 2P5VA 5KFRA 1TL7B 2OEHA 2XGPA 1BMQB 2DGTA 2NRHA 1WG8A 2A6MA 4NLZA 1QE1A 5D0GA 1HBUA 8ICIA 4YOXA 1AUDA 2VGMA 2APOA 3W2VA 3QNOA 4D3GA 4USWA 2HWHA 4URGA 1AFIA 3U1NA 1JLGA 4KKOA 4ID8A 3DXMB 1GLBG 4PHAA 1B9DA 3MPDA 4YN3B 2Q66A 4JYAK 5ALUA 2GV1A 3IHQB 1HBNB 3DI6A 5DQHA 2OPPA 3NCQA 1H2VZ 1HNWK 2XZDB 3IRXA 2RS2A 3ZSYA 3U3YA 3P96A 1ZM9A 1HPMA 3EO3A 3KNAA 4CLTA 1S1TB 3VGKA 2QA1A 2JSXA 3GJQB 2X74A 4RBTA 1Q9XA 3QZ8A 3BEXA 3LDOA 2VWJA 2HFNA 3D1QA 4AHCA 1GQEA 2YQ0A 4DCOB 1RHKB 2XMJA 4CLYA 3VGVA 3IG5A 4K0KF 2RD5C 5HP1A 5GIOA 4KX5A 2AJ2A 3KKSA 1ZD2P 3CEDA 3OFHA 2RHFA 5HN0A 1XU4A 2QSFA 5HMLA 3DRPA 3MDFA 4AM7A 4BR0A 4WCEQ 3BF1A 5ALNA 3C65A 4FP9A 3DLKB 4LSZB 1N6QA 1OH7A 4IWVA 1N5QA 3SFUA 4MDAA 3MCPA 4UQTA 5CR4A 3HVWA 1SJFA 4LF1A 4LBPA 3TZYA 3DMJA 1GAOA 3E8OA 1JK9B 4B3RJ 3CM5A 1YDLA 3SNNA 3OTEA 4XH4A 1LVHA 5HRSA 2IJNA 2V94A 4RQ4A 1S6QB 5F8GA 2CQ2A 3BO3A 1SQKA 1S79A 1PVQA 1S9GB 2OPQA 3GIMA 3IS9B 1VHFA 4JI6K 1VISA 4KLIA 3UXOA 3MGJA 2E9ZA 2Y8YA 3LDAA 4LF8F 3VENA 3R1XA 3R27A 4JI8J 1T9TA 4JKAA 2FMPA 4YMNA 2DNPA 5AXNA 4IH7A 3MDQA 4NLRA 5HP4A 1G6BA 5F0UA 2EAOA 3CMES 2IRUA 4CP5A 4WIQA 5ETLA 1ZQEA 4DR3J 4F4XA 2DNHA 4K4ZA 3I0RA 2XMAA 3KLGA 4PA1A 5I9EB 2K8CB 4CJUA 5A2QO 4O44A 2MKSA 5BOMA 3GONA 5AT1B 3ULDA 1RT2B 4PGYA 5H2FU 2YWEA 4CO1A 2FSNA 8ICUA 4M1KA 1NDKA 3A8JA 1VQ9N 3H8SA 7ICLA 2KZMA 3THWA 2CWXA 1C0MA 3ZDDA 2G0AA 2BM1A 2MKIA 4DTXA 4PRFA 2UUTA 2UVVA 3U7JA 2BW7A 1BHLA 4EU0A 3H08A 3I8BA 2ZM6K 1X5OA 3IRWP 3P83D 4Z0UA 4DL2A 2LM4A 3DKDA 4J9UE 4K4SA 3SAHA 2P9SA 2PFUA 3C94A 2O4GA 1VRUA 3A12A 4AXJA 4H4OB 5CZVA 2K89A 2WC9A 4AHSA 4FZLA 5LT5A 1HWUA 2HDOA 3W66A 3MPWA 2ZZTA 2LQJA 3GCWP 1T94A 3NEKA 5KT3A 4MIBA 4M5DB 2QA4S 1RTIB 1CZ9A 2HHSA 1V6HA 4J9RA 1KQGB 4LRBA 1FDDA 4OV6A 5ETNA 5CCMA 1U1KA 2ZHOA 2AP6A 1S10A 4EO8A 4OKJA 2FF6A 4G9BA 3LPTA 5K8MA 4H54A 1RAIB 5AI6A 3A8KA 2DNGA 4JV1A 4J9KA 4G1PA 4PGQA 4HAIA 3SDEB 4M94A 3PIOL 5LMUJ 4H4MA 3H2UB 2UXDF 2HZVA 2XSFA 1S0NA 2MMYA 4JI1F 2YWWA 2YHWA 1WI8A 2MRLA 3EZ5A 5DGBA 4TLQA 3HK2A 1O13A 2MXYA 5AM1A 3I9ZA 5A0YA 3Q8RB 1FWLA 4DS5A 3OHAA 2YWKA 3BSAA 3ICLA 3ENBA 3TWHA 2F8SA 1S3XA 7ICRA 2BQ3A 3K9KA 1BY9A 3ZNUA 4UT4A 2IOFK 4FLUA 3KD3A 1LW2B 3NH2A 2O3DA 5D49A 2AHOB 5K14A 1Q86O 1NG9A 4Y2VA 2ZWHA 2ZE2B 3B54A 1HYVA 4ZITA 4HLBA 3H98A 4DPTA 4XRHA 3MM5A 4NXNJ 3WQTA 2JEGA 1NH8A 2O01C 4KH6A 1GLAG 4V19S 3TFRA 3WX8A 1CG2A 2V0NA 4OX9J 4DJBA 1NNLA 3FEYB 5HSPA 1NI3A 8ICKA 4CNYA 3TSUA 2YH1A 5LSRA 1FA0A 3OBYA 1JIHA 5F3ZA 4OI6A 1WN7A 1X0FA 4BJQA 2ZH6A 1CZAN 4HCBA 3L0QA 1NB2A 5AQZA 1Q18A 3KLIB 4OYMA 1Q79A 5LOQA 7ICTA 5GAHP 4LUBA 4C0BA 4ELTA 3SCJE 2FB0A 2N1RA 4LFBK 3AL0B 4Z7CA 1N5YB 1NM1A 1B0PA 4U7BA 2W41A 2MQLA 2EFGA 3NBPA 5AI4A 1KVIA 1MG7A 4UQGA 3MDAA 2GVDB 5A8WA 4YDUC 2VQEK 2IVMA 4J90A 5MLCV 4KH5A 2ZH3A 1IBKF 3KWIA 4K59A 3MTKA 3O9QA 3QU9A 1HEKA 3TAPA 4CHZA 4I6MA 5AQOA 3CC2S 2DK2A 2J7KA 1WSFA 2IRYA 2P6UA 2DVIA 2VKQA 4RNMA 2Z4PA 2XQCA 3G6ES 4G65A 1EP4B 2O8FB 1WSGA 1LKYB 4C8LA 4N8OA 1BO5O 2CPIA 3AQEA 3H59A 5GAHI 3LZIA 3FZLA 4DQRA 5M1PA 1XMOK 3VC8A 3OW2M 4KPCA 2IOFA 2MQNA 1NHUA 2LEBA 1ZBLA 3HHDA 3UXPA 1O08A 3LP0A 1L3UA 4QIEA 4GVLA 3RJGA 4ILHA 1WKJA 5D6GA 3MEGA 1VC5A 2QEXN 1U6FA 2CVIA 2HAFA 2UU9K 3ZT3A 5AKKA 1RT7B 4KHPJ 7ICKA 4IO8A 2B51A 4O23A 3IAYA 1EETB 1D9AA 3HRGA 1XEZA 3R5GA 2O8CB 3SBMA 1BNPA 1IJFB 3AVAA 1YBTA 2J0SD 1X9XA 4B1ZA 1CJUA 1KFDA 4WTOB 3KD1E 3RJHA 4DN9A 5KG6A 3FQLA 4A8SA 3GOIA 3M8PB 1SKRA 4CO2A 4PQAA 1NSPA 4CLLA 2F4VF 2G8UA 1NJYA 5HJXA 3PEJA 3GG1A 4DV0F 3QBXA 5H9FJ 4P6QA 1GT8A 1JX4A 3GTYX 3NDKA 5AK3A 2CPJA 3FBFA 4OO1J 1X5PA 4ES1A 2BKPA 3RYLA 1MSWD 3D3BJ 3NAIA 4HUGA 1G2EA 1C0TA 1H38A 4OJHA 4X66J 1FWKA 1YJWN 4FJGA 3MMBA 2GAGC 1J9AA 1N2XA 2ATCB 1SJ1A 1C1CB 1AUSL 1VGYA 3C66A 2N7CA 1CRXA 1SCJB 1J5EJ 4R5PA 1IKWB 1IV8A 2Z30B 3K0JA 2BBEA 2IM1A 4FSVA 1ILYA 4Z6CA 2I6XA 2AEFA 1U1MA 2CPXA 2Z2ZA 5EX3A 1DHMA 2GQQA 1UPPA 3U4LA 3ZO7A 5JVGQ 2QC3A 1F60B 4UZCA 3OPXA 4YXMA 3DOKA 5HAOA 3ZSXA 2ZJRL 5T7LA 5KNIA 1TVRA 3T5JA 4F36A 1BPBA 3CW2C 2HNZA 4F5OA 5A6WA 2FBXA 4Y2KA 1DT9A 3WXLA 2RAQA 2BZFA 2HZCA 1ITPA 2HHUA 3ENQA 1Q3VA 2WF6A 3WXKA 1RAAB 2ZVSA 4B3MK 3C6UB 3ETRA 2ASDA 4YFUA 4YNQA 1NBEB 2GEMA 2NRZA 3R5JB 3KZXA 2OAUA 3MF5A 1FK9A 2VOOA 4QZ9A 2LMIA 2HHHJ 2WF7A 4OJOA 1CC7A 4HEA9 3M7VA 5ALVA 2IY5B 2ASPA 3T6JA 3RU0A 9ICVA 3G86A 4O5EA 3ULHA 5IFMA 4ZVOB 1VQ8N 2DY9A 2HHTA 3UXNA 2VWBA 3KJQB 8ICRA 3C16B 5IINA 1BQXA 2OTJN 4G6VB 2W54A 3T7ZA 3T1HK 1RAOA 3N6NA 4MO4A 2DBBA 3VESA 1WOSA 3PMNA 4J9PA 3HVRA 2H3EB 3MMCB 2I7PA 2QLWA 4AHTA 1A5VA 1KNZA 4DV7K 1UETA 4I6YA 5CYMB 3TU5A 4KFBA 2WBMA 2V63A 3QAEA 3HPGA 2BXJA 4BQLA 5HHHA 1WWHA 3PMLA 4M5KA 1B0VA 3R7SB 4QCLA 3SCKE 2FHOB 2E2QA 5KQ8A 2ZJ8A 3NRBA 5HI7A 3UPQA 2XTJP 3PYEA 4DG1A 4B9SA 3PO5A 2GNKA 4DCJB 4ZP8A 2VASA 4AQYK 4AYBD 3KLHA 3T3FA 3B4MA 2HF3A 5CD4H 3Q8PB 3G4SN 2GQCA 4MK8A 3VF6A 2F8LA 4M8LA 3G6VA 1FFVA 4WFXA 3VAFA 4IG0A 2YNGB 2XMKA 4C8YA 2PMWA 5D77A 3VR1A 3R9LA 3BGLA 2F77X 4PY5A 1NZAA 4C8MA 4BROA 2JZBA 1QSSA 4BRFA 2W42A 4BHQA 2C42A 2RILA 2JLFA 3L7OA 4JI7J 3M05A 4LJMA 4K8RA 1RYRA 2E1FA 1XO1A 3EVOA 1IBLK 1VQMS 1R6VA 2QARB 4DCHA 3CIPA 3KDNA 4CGIA 4OJ3A 4L8RB 4CEOA 1LWCA 5DZ7A 4EAHD 3MUVP 3W2WA 3IAM9 2HOQA 5B7WA 1EHWA 3GQCA 2RHQB 3QZ7A 2E5LF 1DTTB 4XDCA 3G9CA 4JI3K 2JNJA 4IQVA 1WYGA 3K57A 4CJSA 1O8BA 2YHAA 3U26A 2R8KA 4DV1K 1GLLO 4Y65A 5ADXH 9ICBA 1HBOB 4RW9B 4ECSA 2K4PA 4LR9A 1EX4A 1EO1A 4CECA 1WELA 3CDBA 5G0RB 3MEDA 2W3RA 2R8JA 4KQZA 1DOQA 4BRHA 3A8YA 3DDHA 4CJWA 2PMHA 5CQGA 4KLGA 2VUGA 3O3LA 1RABB 2F5GA 4FNIA 5FLXY 4DSJA 3CCSS 2EFPA 2GX8A 4FWOA 3J7YU 2BABA 1Z4NA 5CEHA 4CH0S 3CO9A 3MUTP 3P38A 1NK7A 4QZAA 3A13A 4A57A 2YY3A 1HYSA 1UVLA 1NMNA 4ECQA 4JKBA 2Z58B 4WFBQ 2R2UA 1TKTB 6FDRA 4E2FB 5CHIA 1UJ5A 4KX3A 3HHLA 1V85A 3RR8A 1UA1A 4ZHRA 1CXUA 3PKMA 4DKWA 1WUAA 3MM6A 1FJCA 5AE1A 2WSEC 1VQLN 2ZIVB 3M9OB 2JR5A 2Y0SF 4AE5A 3VCDA 2VF3A 2WVCA 3SUQA 4BG8A 3EUB2 4L73A 2QWPA 4BVPA 4OYPA 1VSJA 3MXHP 1EQMA 4LFAK 1ZPVA 2KKVA 1FRMA 5AJ3J 3K0SA 4J9SA 3V5RA 3PIPL 4EX7A 4WXOA 2H3VA 2EDUA 1F5BA 5BYRA 2ABYA 4I9LA 1VDHA 1TL1A 4O4GB 4LSNA 1WC5A 1S72S 2OPSB 1PAUB 4NL9C 2GIRA 3T19A 5KFPA 1N52B 1DGSA 3ZZYA 2DKZA 4B9NA 3GZFA 1HR0F 3GR0A 3ZLJA 2X78A 4YDUA 2P6TA 5D4LA 2RLTA 3SSSA 2CXEA 3QIPA 2E1AA 1Q4RA 2ASOA 4RNOA 4DQSA 2FSKA 3KUEA 3DXSX 3JPTA 2FD2A 3U1LA 2GCFA 4M6WB 1U2VA 1EXNA 2K3IA 4M63A 4QIGA 5CYQA 3SQOP 3OBIA 4M47A 4FPIA 4ANCA 2YTCA 1F2GA 5D4NA 5J2QB 4DPWA 2GIFA 4WFAL 3AJDA 1BQNB 4BQZA 5L1JA 1GK8A 3I0SA 2NS1B 4QPTA 3VERA 2WHEA 4MKVA 8ICEA 1JCFA 1KQSM 3EE8A 5BXIA 2FGOA 3FAHA 4HYKA 2DTUA 2KYZA 3QT5A 1VJQA 1XMQK 1CJTA 1XR6A 3H0MB 1C6VA 5L39A 2KK0A 4RZRA 1FWPA 4KH4A 3CJ1A 5AQLA 5L1MA 3HCXA 4WP9A 3KFWX 2HRYA 3MXMA 1ZQRA 1DXSA 1COOA 1KAZA 2CZVC 1X4BA 2BM0A 2L5YA 2KG1A 1VQ7N 3HPHA 4LZGA 3C14B 2DUYA 4KN4A 1JLEB 2EKYA 5GAEP 5AKIA 1HNWF 3KD5E 2P9CA 1S6PB 2DJWA 3J7YP 2A3VA 2H3GX 4EYIB 1WLJA 2F3JA 1QTNB 1RWKB 1X4GA 1XR5A 2IVYA 4DV4K 1VMBA 4P2FA 2PN6A 1HNZK 4CO0A 1FESA 2VOPA 3JYTB 4DX7A 1GXUA 5ALDA 3FGVA 4OZ1A 4NXMK 4PL1A 4FW2A 5J2NA 2VBWA 1CSJA 1X3NA 3CDWA 2XS5A 1JJ2R 1K47A 1M1KT 3PHTA 4LF7F 5ITHA 2LU2A 1WD6A 4CZHA 1M5HA 2CH5A 1MWKA 4FWRA 4DXLA 2E1PA 1NOYA 5DM6L 1X0PA 3KKAA 2QI2A 2JEFA 2FJXA 5AE2A 5JVHL 2EC2A 5E2QA 4B6JA 2WB1C 4U95A 4OZNA 4OJLA 5GAEI 1PAEX 2G8WA 2YNIB 3J7YI 5HL7L 2H3ZA 3GV5B 1KHWA 4PPDA 1YITN 1OIAA 2R3VA 1S5JA 2RQ4A 2JFDA 4Y28C 4FJ8A 1RE1B 5I3UB 3QMQA 1NGGA 2HFOA 2P9KA 1S48A 5D4OA 3L3UA 4QZ8A 1RAJA 2JGAA 3VQTA 3DLRA 3BS5B 3VN5A 4QOTA 2YX6A 1R31A 2BKNA 1A77A 4BXOB 2HSZA 4FYYB 2DNYA 4GKKF 2A1JB 1X1PA 4ZS6A 2RH3A 1U09A 1WBBA 2EWHA 1JLBB 3RAXA 1RWVB 2CG4A 1AQ6A 1DLOA 1J53A 2E1ZA 3CDAA 4KLFA 1LW0B 4TQRA 1T3NA 2RS8A 2H3IA 2GJIA 4UUXA 2X3DA 4CIFA 1HPZA 2OHFA 4HVJA 3MMAB 4NI2A 3ITHA 4FKXA 1X60A 1IKYA 4BCAA 1FKOB 3FGUA 1N34F 5KG1A 1R8AA 4K43A 2L41A 2DH8A 1BG3A 4F4KA 1BNOA 3VOVA 5B09A 5C2CA 4OGCA 3MD3A 4Z4FA 3M2VB 1U2CA 1TKXB 1R89A 3UR0A 1UOCA 1EP4A 2AGOA 3GWCA 4DV6K 1FFSB 1Z2LA 3H3OB 1SKUB 3NH1A 1FERA 5BPLA 3MAQA 3BS9A 2CPEA 4WQ4C 9ICLA 3MWPA 3G25A 1WORA 9ICPA 4O0NA 1I1GA 2JHEA 1K9MT 5KFAA 4M9GA 4EFAC 1GLEG 5J2PB 5KFTA 4BRLA 2P6RA 5G5HA 2HBZB 2X1BA 1FKPA 2HFSA 4FL9A 4DUZK 2KFZA 2CNNB 3EWGA 1BC6A 3VETA 2ILZA 3PYGA 4ILGB 2KO1A 3O6WA 4FJNA 2ZG6A 3D0HE 2IDEA 1BISA 5AFUA 1BQMA 1NB7A 4CEEA 2RRNA 2EFVA 2HBYB 2ZIWA 5C25A 4H03B 4AILC 1ZH5A 1SQEA 5D15A 3PV8A 2VA2A 4JUZA 2MY7A 3Q8VA 3FVYA 1AZSA 1YJTA 3HHKA 4DOZA 3DJCA 1VQ9S 5KT4A 3SCLE 4IOAL 3MGVA 4LF8J 3TR8A 1RBUA 3G10A 2FJEB 1DK3A 1CBKA 4JV5K 2EFOA 3VAKA 3H6EA 4ECUA 3HKZF 4IR1A 1VQ4N 2QA4G 4KY3A 2UV8G 1KP6A 2IC3B 4N56A 4RW8B 4FN5A 5EE3A 3BDEA 4KGZB 1E4FT 2CPRA 4QBUA 3J81O 1NOZA 3M2RB 4FZVA 2P9LA 1YTYA 4PL2A 4FK0A 1ZQYA 2IM3A 3C28A 4M04A 1ZYQA 3QNWB 1NDCA 3R3TA 3VTHA 2CQIA 1C1BA 1XUPO 4TUSA 1YKWA 4AL5A 5CCLA 1L3TA 2Z1IA 2NPFA 4RQ3A 2DT9A 3WEEB 5DDOC 3O8WA 1SV4A 2NO4A 3H5UA 4OLBA 1H2TZ 2CDQA 5IIJA 3V7KA 2XYHB 1ZM2A 4QR0A 3NMRA 3KLFA 2YWHA 3NF9A 4H5TA 2Y1RI 1TL5A 1QSYA 5ELZA 1VI7A 1ZQTA 1RTHA 3FEZA 2ZUCA 4FLYA 3S1TA 2RE1A 1S1WB 3PCOB 4DV3F 1JWWA 2AV5A 3ZNJ1 4FXVA 1SPBP 1GEHA 5DM7L 1ZQCA 2X7IA 2QL9B 1F5CA 3JPNA 1KVJA 2W9CB 4FF1A 3DLEB 2VQEF 3EN9A 3FBEA 4DL4A 2E66A 2XY6A 2NUHA 5AQYA 5HR6A 4EEYA 3D2EA 3W3DA 4GVBA 4CLSA 1WHXA 2BQUA 3ZZOA 2V8VA 3SBTA 5ALRA 4F93B 4GO7X 4KLHA 4OHVA 4O9MA 1RXWA 2QTDA 1MQ2A 4C9DA 1QQ5A 5EX5A 3CT9A 3HSGA 3CCWA 3PHEA 2V68A 3QJJA 4CHNA 2A1RA 4EELA 5E3QA 2JRSA 1JNZB 5DDYA 3PZPA 2YB1A 1WSRA 3ULEA 5AQXA 2EX3A 1J5OA 2NSCA 3QU5A 2E8AA 4YY3K 3QBCA 4RW6B 1XMOF 4CO3A 3UQ2A 3X1LB 2F8EX 5K5MA 2CVEA 2JL9A 4P0QA 4F02A 2H54B 1VC0A 4BRQA 7ICGA 5DGAA 3THXA 1NJIT 4FLZA 2EAMA 4HKQA 5M1KA 3KG0A 4YHHK 3N4MB 1LWXA 2V5HG 1T6DA 3K5MA 3G82A 4YUDA 4YCXA 4CLFA 3R5DA 1DTQA 2KVQE 2QO3A 3J81j 1RLDA 2P51A 4LBIA 3NVWA 3ZSOA 1U0HA 3Q7BA 3FZ2A 4NLPA 4UY8O 4X64K 4HHHA 4EIAA 2CQCA 2GA7A 2HNYA 4TVAB 1JLCA 3LM2A 5DBCA 1LFWA 3C7NB 2QJ3A 4DFJA 3QJPA 4A2AA 2FSJA 4LVOP 2A6AA 5E5NA 3KBBA 1C4CA 2W4CA 2RHKA 2W40A 4UATA 1VOMA 2OFHX 3VQ5A 4MQ3A 2Q31A 3QNNA 2FF3B 8ICPA 1UA0A 3FZBA 1Q82O 4YOVA 2BANB 5B8HA 4DWIA 2ZJPL 3JTOA 2B6AA 4DV7J 3A0BU 3DGVA 3NUQA 4M3RA 5F1XA 3MR3A 2GC8A 4DU7A 4QWBA 1IXRA 1NK0A 1LQ9A 1HJOA 1UVMA 1YZ7A 2FBVA 5ALKA 3MFHA 4UOGA 4EZ6A 3QGPA 1IBKJ 5B0EA 3SQGA 2VCPA 2ACYA 4CLWA 3HLUA 4K50A 4EO6A 2W2NP 1ITGA 3CQ8A 4YMEA 2OPRA 5KFGA 4HI1A 3KK2B 1T9VA 3C1YA 4A59A 1G1XA 2CJKA 1J27A 1NZBA 2MKKA 2DHHA 3RW7A 3KG1A 4MF2A 2M2BA 4DL5A 4Q0BA 3CFOA 3MCAB 2C3YA 2YKOA 8ICOA 2Y0BB 4DFDA 1K6YA 2XZTB 1NDLA 1O03A 1WSJA 4QWEA 2LQBA 4CZCA 3RMCA 1NAQA 4WZQA 1ZC6A 3KVGA 1IBCB 4FOIA 2G8HA 1JJHA 1GH8A 9ICCA 2EQYA 1TP7A 4DTPA 1RA7A 1JLQB 1Q82T 4IOCL 2K1RA 5KGWA 5F41A 2N7YA 2VB6A 2ITGA 2UXCK 3WIVA 1RWUA 2A42A 4CESA 1WCNA 1VQPN 1SAZA 3ZETA 2G0IA 3ZX3A 2AYEA 3B6OA 3I4HX 3S6JA 4OJPA 4DR6F 1JL2A 1IJEB 2Z56B 3MM7A 3D2FA 3O0FA 2XLKA 2P9NB 2XMMA 4KLJA 4ZPDA 4CGZA 3UDEA 3PM9A 4DV5F 1AYEA 2CZ4A 1YJWS 3JSMB 4M7YA 2FJVA 4QOZB 4PG8A 3AVIA 1KVCA 3PO4A 2DNNA 4U67Q 1HARA 2F1HA 4Y6IA 2OEMA 2V51B 3GMGA 4I2HA 3EM1A 2BH1A 3GSDA 3VCBA 4U8YA 1HQEA 2XHBA 4B9LA 4MAKA 4GXIA 1DJ0A 3QEWA 4A8EA 5IC4B 4C4RA 3HP6A 4RNFA 4MIWA 1TR0A 3DOMB 1RT3A 2OA8A 4YDDB 3EMTA 4DV0J 3LP2A 4DV1J 2KFNA 2FJWA 4NLGA 4YQWA 4DR7F 1ZAVA 4K4YA 3F5EA 1HW8A 4MLEA 1JL1A 1XSNA 1FNOA 3M6ZA 2FLOA 4JBCA 5HMZA 7FD1A 2KKPA 2W04A 3JPRA 4W90B 3FFKB 5HBMB 3VQ6A 5KFCA 1QM9A 1RZMA 3V4MA 3ZDBA 2NXCA 3BSCA 3CTRA 3S8SA 5KFXA 3CHWA 1RBAA 3M2UB 1KFSA 1ZBUA 4C4SA 1OJ4A 3OR2A 5LMNF 4PJ0U 3QESA 2NZCA 2VPWB 1KBRA 4CEAA 1ZXIA 5LY3A 2B8PA 4WU3A 2RQMA 1MWMA 5KRTA 1SKSA 3CFRA 4QZIA 5AI5A 1QUVA 2A5XA 4FM1A 3EGZA 2AT1B 2BJ9A 5DETA 4KHSA 5AR0A 1VQ8S 3I9V9 2B4VA 2RU9A 5E3CA 4OI1A 2EAPA 1P9YA 2OTJS 2V8GA 2HZAA 4C3LA 1ZQOA 2RJZA 3BPSP 4LFCF 2UYTA 3C46A 1GOBA 2KZ3A 3PIOQ 4WQ4A 4RQNA 4O3NA 5EOYA 3R8EA 2H48B 1KVKA 3BKTA 4GC6A 4DV2K 2FLPA 1X9WA 4IFYB 2ZBCA 1NGDA 4DU4A 4ZLJA 3EXCX 4BWMA 2JEIA 4B1VA 5GVQA 1IR2A 4CBXA 3VQ9A 3OYCA 3MEKA 5ALPA 4PGXA 4FWMA 2ZOMA 3NCRA 1U6BA 3RBXA 2IBOA 3M9MB 2YBVA 2Y9UA 1UFLA 2EG2A 2F9WA 1QQ7A 4USVA 3HX0A 4BR2A 4FS1A 1U48A 1LWFB 2WZ1A 3JSYA 3G4SS 1S1VB 2NUBA 3I56N 2QXLA 3KK3B 4M9NA 2OMLA 4CGFA 2EANA 4Y2UA 1DGKN 5ETMA 1DK2A 2NRRA 2EK6A 4C97A 1GTEA 4OI4A 5HMMA 1TKZA 1S0MA 2P6SA 3VQPA 4E7IA 2VODA 3IWNC 4B3TK 5KFFA 3CMQA 3ZEUB 5DKWA 4PXEA 1XS9D 3M1YA 1QAIA 4ENOA 4X65K 2IAJA 4DTRA 5LM7E 2VL1A 2VG6A 2DGVA 2RN2A 3D6HB 2PI5A 2E3TA 2K3KA 2RUGA 2F8TA 1LAVA 2WVBA 1ULRA 4EGLA 1XMQJ 2C22A 1ZM3A 3WIUA 1R8BA 3MDCA 4DPUA 1X6IA 3CD6N 4DR5J 4KV8A 2YKNA 3AGKA 2K4EA 3AMZA 4ECRA 3PW7A 4BC5A 4WU2A 4WCEL 5IIOA 3ZD8A 2V2KA 7FDRA 2B0CA 3SENA 1HBMB 5HO4A 3MM9A 1I94F 4FCYA 1WKKA 4WFYA 3VAHA 5BRFA 1ATRA 3A8EA 3RB4A 2DQNB 2VA8A 3HI9A 3MN9A 2BCVA 1ESVA 3OTBA 1ZBHA 4C48A 3E9LA 1I51B 1FVQA 2HI0A 2OXOA 1MC8A 4UOHA 1K8KB 3M8WA 5HRNA 4OX6A 1DQAA 3TVKA 2FZGB 3NGIA 4ZN3A 3F56A 3JS9A 1SJ4P 2ZNZA 4OYZA 2E7WA 2W24A 5E41A 4JKDA 1NPPA 4CF3A 1X31C 2L08A 3V1QA 2IPOB 4ZH4A 1RAFB 2GAHC 3UN3A 3NNHA 4UB3A 5DK5A 2DHSA 2FGCA 2IYIA 4IEEA 2E5LJ 4BRGA 3PR4A 4IKFA 2GWSA 4Y2XA 2KVIA 2A2CA 3TP2A 3NCPA 1KDHA 1TL3A 1RI7A 2KJ9A 1GMVA 1XNRF 3CCVN 4CJQA 5BRDA 1B9FA 4NCBA 3FR0A 2LHTA 1LEOA 4U9RA 2HHWA 4B9TA 3AO2A 1XC9A 5KT7A 2P9GA 1XN9A 4K4UA 3CCTA 1IBMF 3AY9A 5CRXA 2M9KA 2DNRA 2V2VA 2D1KA 5AI9A 1Q7YT 4LRCA 1VQLS 1JCGA 4URSA 4K4GA 5A6PA 3LP1A 4CZEA 4CZJA 2W6LA 1EKEA 5THWA 3IP4B 4EFHA 5KFSA 5ETKA 3R9KA 2NLWA 4FJXA 2ZF5O 4NLCA 4CZLA 3EE3A 2VFRA 2PEBA 2CQ0A 3T5LA 3M32B 3Q8YA 1KQFB 4HHJA 3KWMA 5J0PA 2OZSA 1NGHA 3O1WA 2D0PA 1C20A 3M6UA 3CPWR 2ZUDA 4PAAA 3OS2A 4KRWA 3D28A 2MSTA 5C0YA 3OHBA 2RIJA 2LSNA 1K44A 3FSIA 4OYIA 1RBSA 2KT3A 2ZIUB 2B9YA 1YJ9S 4I2PA 4JB8B 4DQPA 1Y4ZB 4OX8A 2G2ZA 4ISFA 4Q43A 3DLGA 3FSXA 3Q89A 2VICA 4DCCA 1HNZF 2GWKA 3EVWA 4NXMF 2GJFA 4LREA 3ZI4A 1RCXB 2FI1A 1REVA 3CJSA 2QX0A 1SQGA 4ZVUB 4D3HA 4TSXA 2AD9A 2D3OR 4R25A 4ZP9A 3AY0A 2B9WA 4ED6A 2XGQA 2W7AA 1Z3EB 1PBUA 5EUHA 4B1XB 3IA0A 3KMQA 3M1VA 3KHGA 4JI4J 3MAAA 1NPKA 3QT8A 2WTFA 1IKVB 2K4HA 2J0WA 2PFDA 4ZP6A 1N5TA 4FVMA 1PILA 1PGZA 4L76A 4LRAA 4M3XA 1B99A 1OH6A 3MOZA 2MLZA 1BI4A 4M3TA 5B0GA 1FJGJ 3CMAN 1OUQA 1VQ7S 4H0PA 4BRNA 4GVMA 4KGXB 4PUOB 4RW4B 1KWMA 3J80Y 2VGNA 1ZQSA 2OEKA 4AT1B 2VQFF 3ZTSA 4BDZA 2QIFA 2KLAA 4USMA 3NF8A 3I4PA 1MROA 3N28A 3L4PA 5JJBA 3AVNA 2GWJA 1WOPA 4BWJA 1TAQA 4YG2A 4OZ3A 3WKAA 4X4TA 5B0DA 3SQ4A 3CQXA 4AL7A 3JAMO 1NCLA 1B64A 3U6FA 1RKIA 1AB8A 1L5UA 4P4OA 4EYHB 1H73A 3D67A 7ICHA 3PX6A 3NKYA 5BJRA 3DEEA 4Q5VA 1BHNA 1FDAA 1DAXA 3MGHA 4IH6A 4BC4A 2IA6A 5KFJA 3K8WA 1QVGR 4GXJA 1QZ6A 3Q8KA 2VZ9A 4Z6EA 4FZMA 1YWXA 1JN3A 3ILJA 1TYQB 2X1FA 1YITS 5AQJA 2QYGA 3BR8A 1YJVA 5AK4A 1T7PA 4FW1A 4YFKA 4RBUA 3MAHA 4QAGA 2GGPA 3PYDA 2BPCA 3R1HA 3IWXA 3UW1A 2MKHA 1VR6A 4OPHA 3AODA 4BC7A 3WT0A 5BRHA 4F3TA 1QD1A 5EHHA 3EPIA 3TAFA 4QZDA 1BXNA 3V6HA 1YZ6A 1N33K 4FYWB 4C3KA 4FYXB 4YOYA 4OI2A 2BDUA 2MQMA 1NZPA 4CK1A 4C23A 4QZVB 1WC6A 3G6YA 2N3OA 3V7LA 4O8KA 2RRDA 3NVVA 1P7DA 1S9EB 3ZSWA 2CJYB 3NGZA 4WE1B 2Q2RA 1MMDA 2CWKA 2JGUA 3B8HA 4KLSA 5CXTA 2PKEA 4ZPWR 2MGZB 1ZQJA 3CFPA 2BUPA 4KLTA 1S5LU 2Q1LA 4OPJA 4YP3A