4UQGA

A new bio-isosteric base pair based on reversible bonding
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title "Post-it" type connected DNA created with a reversible covalent cross-link.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4uqgA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4uqgA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqgA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4uqgA01
5J2HA 3AA2A 3C2LA 1RXWA 3KHHA 7ICEA 4CEOA 2DPJA 5KFBA 7ICOA 3OYLA 2P66A 4M6WB 1RBUA 3B6PA 2IMWP 4FLTA 3ZSQA 4Q44A 5J2CA 4CK2A 5J0XA 8ICSA 1RT4A 3KD5E 3G0ZA 3MECA 3AU2A 3B0YA 4IG3A 2JEJA 3HPGA 4UB1A 1RBSA 4KTQA 1WAFA 4RPXA 4EBEA 3IHQB 3PX0A 2PFQA 3LDAA 4YVZA 4J9KA 5CZ1A 3KHRA 2PFPA 4JK1A 3L3VA 2HMIA 2DPIA 3K5LA 1Q8IA 1PZNA 2R8KA 3RB6A 3QETA 2A1JA 3PW2A 3O4QA 5IIMA 3SV4A 9ICFA 5CP2A 4O5BA 3DOLA 5J2AA 2DFEA 2P6UA 2G8VA 1NOYA 1YTUA 3AO1A 3RAQA 3OVNA 5DBBA 1RDBA 9ICUA 3FDSA 4F4WA 5HMLA 5J2PA 5CY4A 3AVJA 3U3YA 1JL1A 5KFPA 1FKPA 4CEBA 4JLHA 4ECSA 3NF9A 4CEEA 4CJPA 3AA3A 4M47A 2ZTDA 1S6QA 2VWJA 3D0PA 5C42A 3LZJA 8ICOA 5DDMA 2F1JA 7ICMA 4ZTJA 1TAQA 1RT6A 2MUTB 4RT2A 2ASLA 3LALA 3TAFA 3JYTA 3GILA 3MDAA 4O5CA 5BOMA 1KRPA 4LZGA 4DTXA 5KFFA 4LSLA 3VQ7A 5KFTA 4CFBA 4KLSA 1VSLA 5IINA 1T05A 3ZSRA 2P6RA 4RNNA 1ZJMA 4B8AB 1RYSA 1BQNA 2V4RA 2KFZA 4CIFA 1T4GA 2NRXA 2NUBA 1FXXA 3RH5A 1L3SA 4PUOA 2ALZA 1SL1A 4O9MA 4P4OA 7ICKA 5DGBA 4KB0A 2ZJ5A 4EBCA 4AHVA 3ZSVA 3AA4A 2Z1JA 3QERA 2BQUA 2YNIA 4AHCA 4CGJA 2YHAA 4GXKA 4KHSA 4ED8A 4R8UB 1RT2A 3QLHA 2RN2A 3OYDA 3CFPA 3MR6A 1ZETA 3G6YA 4YD2A 3PNCA 4G3IA 1QE1A 4KPYA 5DDYA 3NGDA 1HUZA 2XY5A 1JXLA 7ICUA 3RBDA 1C0MA 5KFUA 3MGHA 3QIPA 4RPYA 2IAJA 4YNQA 1B43A 8ICJA 4CJ3A 5DB7A 1RNHA 4FK2A 5D49A 1IXRA 3E01A 9ICLA 3RMAA 5HHHA 2KZMA 2GUIA 4J9NA 3K58A 4ED1A 2Y1JA 3RJIA 5DQIA 1JLBA 1D8YA 3S3OA 3H4BA 1ZQEA 4RPZA 4RUAA 2P51A 4PGXA 3ISDA 1TAUA 4K4HA 4I2JA 3ALYA 4OKEA 1F21A 2HHSA 3OSPA 2RDIA 4F91B 4M41A 3GQCA 1YT3A 3Q8SB 3I0SA 1KFSA 5DKWA 1NK0A 2YNGA 1RBRA 1K1SA 2AGQA 4JWNA 3DYAA 5KT5A 4UB2A 4QAGA 4NXZA 7ICJA 3M8SA 1KEJA 3C1ZA 5KG5A 3LWMA 1SKWA 4JV0A 2PYLA 3TAEA 1S1WA 4HUFA 1RT3A 1S10A 4RU9A 4AHUA 3VA0A 5CWRA 3ORYA 3ZDDA 1BPEA 4E19A 2XO7A 3QEWA 4YG2A 1J53A 8ICKA 3GIMA 3AVNA 4ECUA 3P5JA 3SPZA 4I2IA 2IHMA 3NDKA 3MGIA 3QEIA 4ECRA 1SL0A 4KN7A 5KFJA 1RDAA 1ZQFA 3DRPA 4CF1A 3OYHA 3NTUA 3OYIA 1NKBA 4I2HA 9ICEA 3VQ5A 4Z4GA 2YNFA 1W0HA 3K5OA 4W5RA 4KLQA 1C6VA 4O3SA 4ECQA 2KFNA 3G6VA 4DF4A 3TAQA 3CG7A 5IILA 4RQ4A 4FJ8A 9ICRA 1KVCA 3SCXA 4F3TA 4DSLA 4FXDA 1RT7A 1XSLA 3KLGA 1AROP 2R8HA 3UQ0A 1TKTA 3SUOA 1NK8A 8ICPA 2AGOA 2KW4A 4F5PA 3JPNA 4MFCA 4PHAA 4W5TA 1VRTA 4IBNA 4YP3A 1UT5A 2PFOA 4QZFA 2D0AA 4I2AA 4B3OA 1JLEA 2B6AA 4UAYA 4RQ0A 4QZCA 1QHTA 3OJUA 1N56A 3SJJA 4CEQA 2YKNA 4MQ3A 4UB4A 3ZCMA 8ICVA 3AO2A 2UVVA 3OS0A 5J0YA 3ITHA 4CJWA 4GXJA 3FFIA 3GFKB 1WLJA 2BHNA 5K14A 4E3SA 5KT6A 3JPSA 5HLFA 4Q43A 1TKZA 1JLAA 1S0NA 1S1TA 3OYNA 3KLEA 1T03A 4YR3A 3JPQA 1JMSA 4Q8EA 3T3FA 2LYHA 4O5EA 3LZIA 3SZ2A 3NF6A 3QEAZ 4RW6A 3VN5A 4CJUA 4QZHA 4J2EA 5DB6A 2QKBA 4IRKA 3RWUA 3CM6A 1S9GA 3VA3A 1JKHA 4F3OA 1WNSA 1JN3A 4FJ7A 4MFFA 1BPBA 1S9FA 1LWEA 3HPHA 2FLLA 2HNZA 5J2FA 5CA7A 4DTNA 4XRHA 3V7JA 1RXVA 4CJQA 2HVHA 1TK5A 4LSNA 2XHBA 1XSNA 4Q0BA 8ICWA 4F5QA 4RQ3A 1L3VA 1WCNA 4FLZA 1L3TA 2DY4A 1RILA 3O3HA 4DS5A 1C1CA 4CECA 1ZQUA 2AGPA 3QIOA 1T8EA 4YD1A 5DGAA 1WSHA 5JS1A 4R66A 1TFRA 4KLHA 3OHAA 3NH2A 1ZQYA 5D46A 7ICPA 5HHIA 1S6PA 2BGWA 4BWJA 2W9BA 4E0DA 4ICLA 4ED2A 2UVRA 4B9NA 4NM2A 1BCOA 3VQ9A 4B9SA 2BCSA 9ICNA 3BQTA 4IG0A 1KLNA 5J0RA 3H08A 1XS9D 3G6XA 4FM0A 3HT3A 4F4KA 3C95A 2MAXA 1N6QA 4EEYA 4KLTA 4JS5A 5HNKA 3EYZA 4O0IA 2Y1IA 1A77A 4I28A 2QXFA 3SUPA 4C8LA 3ZT4A 4CF8A 3DRRA 3LP3A 4DMNA 4QZ8A 4W5NA 4YCXA 4X5VA 9ICKA 8ICAA 3SUNA 4P4MA 4UBCA 1ZQMA 3AVHA 5J2BA 4BE2A 1BI4A 2WONA 4WE1A 1U9LA 9ICHA 5KG7A 4I2BA 3CYMA 4LY7A 1NK9A 1H38A 3ZD9A 1TK8A 3TQ1A 1C1AA 1T7PA 4I2CA 4E7LA 4Z6DA 4YR0A 3BQ2A 4M04A 4E7KA 3RB4A 3TWHA 4I2EA 2JZBA 4DL3A 2BPFA 4FM1A 3MEGA 1RPLA 2ZUCA 3L2UA 4YN4A 1D9DA 7ICIA 3HX0A 4KHUA 4KHNA 3OS2A 4QZEA 3CFOA 4G1QA 4DTSA 2IOCA 2G8WA 4KI6A 4CHQA 4IKFA 1GOCA 8ICHA 4FCYA 3PX4A 2YKMA 3OYKA 1ZQRA 2FBTA 2W9AA 1I3AA 4RW7A 4JWMA 4TQSA 2KTQA 1R0AA 2BR0A 1S9EA 5F9NA 2IA6A 4I2PA 4M3TA 4ECTA 3P1GA 3TAGA 2W8KA 1VSKA 1SZPA 3LANA 3DI6A 3MXIA 5KFYA 4MEYA 2FMQA 3AV9A 1LB2B 5J0UA 2B4JA 4Z0UA 3OYMA 5SZTA 1U4BA 4CJEA 1HNVA 1EXNA 1BPZA 4DTPA 4OPJA 4M3UA 4QWCA 4H4MA 1ZQHA 4M9HA 1RDDA 1VRUA 4CEAA 1NJYA 4FLUA 3OYBA 5KG4A 3M8RA 4DTUA 4DU1A 5KG3A 3ZDAA 4ZTFA 3LP2A 4PH5A 1SUQA 1U47A 4UB5A 2ZJAA 1Z26A 9ICTA 3THVA 1A76A 3PW5A 3KK1A 8ICZA 4DSFA 4M42A 4HCCA 4FK0A 1MU2A 2C28A 4C8OA 1IO2A 4BDYA 2FMPA 1DLOA 2KQ2A 4IR1A 3RJFA 1ZBUA 5KFOA 2FLPA 2VANA 2P5GA 3KK2A 3B0XA 1S97A 5KG6A 2HHQA 1S5JA 1HYVA 3NCIA 3ISCA 1K1QA 5I3UA 2C2EA 9ICXA 8ICUA 1ASVA 4FS2A 4Z4IA 1RT5A 1ZQVA 2FBVA 2LSNA 3AO3A 9ICIA 1WSGA 1QSLA 4AHRA 2OPSA 3OSNA 3NBPA 3ZSYA 4CHOA 3RMBA 2V4QA 4UAZA 3V1QA 2YNHA 1HMVA 2HB5A 4EZ6A 1TV6A 2PI5A 1ZQLA 5J2KA 3MAQA 4CJFA 4RQ5A 4I27A 4N5SA 3V81A 1B9DA 1C1BA 1D8LA 4IR9A 3NE6A 2G8HA 1D5AA 1HYZA 1RDCA 3B6OA 4IQWA 2GWSA 1C0TA 1TL1A 4RZRA 5C25A 5KFHA 2NRVA 4PWDA 2JEFA 3T19A 4PPXA 2G8KA 1BPDA 5T7BA 4DSIA 1JX4A 4J2BA 4I2GA 2OA8A 3ZSXA 3HJFA 3ZDBA 1BGXT 3S3MA 3AUOA 4KTZA 1CZBA 3AA5X 1ASWA 3C94A 3HL8A 4CFDA 4ECWA 1MQ3A 5SWMA 3V1OA 4F2RA 3K4GA 3NH1A 5J2GA 4KRFA 4M9GA 2XCPA 3NH0A 3KD1E 4R64A 1WSJA 3OYCA 3GV5B 8ICMA 3DOKA 4C8NA 9ICMA 4DFJA 4FJ9A 5J0OA 3AVCA 1B9FA 3PY8A 3NGIA 2RPIA 1N5YA 4DTJA 5DK5A 4FO6A 3DRSA 4KN4A 3FYHA 3QEBZ 5J0SA 4JV1A 2HNDA 3ZT1A 3SQ1A 3QNNA 1X9SA 4CGDA 2VA3A 3KKSA 1LV5A 2W42A 1JXBA 1RT1A 1X9MA 5KFDA 7ICVA 1C7YA 4B9VA 4CJTA 1MSWD 2XC9A 4EYIB 4CF0A 2IHNA 4CESA 4Z6CA 3LDSA 1UA1A 5J0TA 4M3RA 2XGQA 4F5OA 4F4XA 1HJRA 4KLUA 1JLFA 3N4MB 2ISOA 3TR8A 1HQUA 5DQGA 4OPKA 4Y1DA 1EETA 4Q8FA 4QW9A 4DL7A 2UVUA 4KTWA 4J2DA 2J6UA 3UPQA 1ZJNA 4QWEA 1VSIA 1WCLA 4ELVA 1ZBFA 2C2RA 2PYJA 3C6TA 4F50A 1S1XA 1XU4A 3C5GA 2WTFA 9ICOA 3HVTA 4F93B 4RW9A 3DLHA 4KLMA 1CUKA 4I7FA 3ZT0A 4CGIA 4DG1A 3D45A 4FM2A 4GMJB 3VQBA 3SI6A 3C21A 1L5UA 1IKVA 3F73A 5CB1A 2HNYA 1UWBA 1SKSA 4TUPA 3OJSA 2ITGA 2GV9A 4KMUA 1HJPA 3OHBA 2Z1IA 3NAEA 4F92B 1HPZA 4DL5A 4I2QA 3DLGA 4RQ6A 3T5KA 1BHLA 3PO5A 4CF9A 1NK5A 4CJRA 4NYFA 4TURA 1EXQA 1RBVA 1YTAA 2EX3A 4KLLA 5DG9A 1KDHA 4KITB 2RF2A 4CK1A 3DLEA 4J9QA 4HHTA 4RNMA 3PR4A 5KFWA 5F9LA 4KLIA 4B9TA 4M45A 5KFGA 4FJKA 1JLCA 4MEXA 1JLQA 4DU4A 4QZIA 5KTQA 4FLWA 3TANA 5HRPA 1MQ2A 1T3NA 3UQ2A 4KLDA 5J1EA 1KVAA 4DFPA 2XCAA 5KFQA 3RTVA 3BQ0A 3C2KA 4TSXA 7ICNA 1LWFA 5KFZA 9ICGA 4NCBA 1V9PA 5KFSA 4QWDA 3VQEA 2D5RA 1HUOA 3ASMA 3IG1A 4AH9A 4CEFA 1S0OA 4FJHA 4CJ5A 1WAJA 4YXJA 3JSMA 3AO5A 4RUCA 3RAXA 3MBYA 3RMCA 5CYMA 1VSJA 1XHZA 2B5JA 4YMMA 3AU6A 9ICSA 4L8RB 3AVMA 3I0RA 2P5OA 2BGGA 3ISBA 4DTRA 3LPTA 3V7LA 4AILC 5KT4A 4Z6EA 3H8SA 3RR7A 3KLIA 4DOCA 3M9NB 4LH4A 3L2VA 5EWEA 3GV7B 3ETLA 3M8QA 4Z4CA 3ZSWA 2FPMA 1QLNA 1HNIA 3QZ8A 2BCUA 1VSFA 2EHGA 3WNEA 3NFAA 3TAPA 4GC6A 1RTHA 1IG9A 8ICLA 2VWKA 5HP4A 3K2PA 4OJRA 2M9NA 5IIIA 4HTUA 2KN7A 3Q8PB 1JIHA 2A1RA 1ITGA 4FJXA 3L2RA 4TUSA 2ZJ8A 2BANA 4C8KA 1SV5A 1Y88A 3SUQA 5KFKA 3PX6A 1BISA 2DFHA 1ZQNA 8ICQA 1GOBA 1KLMA 5L1JA 3CQ8A 1BL3A 1Q9YA 8ICRA 2ASJA 1TVAA 3ZT3A 2JLEA 2ATLA 1KCFA 5EWGA 2W9BB 3L8BA 3OGUA 1RYRA 3M9MB 2GBZA 3MFHA 1BPYA 3RJGA 4CIGA 1RTDA 4F4ZA 4QWBA 3HM9A 4OKJA 3RB3A 5KFLA 5KFMA 2R7YA 1KVBA 4BGDA 1BIUA 4EP4A 3OYEA 3EPGA 2X78A 2F8SA 5CYQA 4JV2A 3AVIA 1ZQWA 4E1NA 5KI6A 4YR2A 1Z3EB 2ASDA 2BCRA 4CJSA 1CXUA 4FW1A 3GV8B 4IRCA 5J2MA 4DL2A 4J2AA 5KFEA 1VSMA 4J9PA 3VQQA 3PR5B 3GIKA 2VA8A 1KFDA 2RDJA 3PO4A 4UB3A 4FVMA 4KO0A 3M9OB 3WNFA 5J2IA 1I39A 3MR5A 4PGYA 5J0PA 3HP6A 1BI4B 4EYHB 4DEZA 3QNOA 1JL2A 1ASUA 4ED6A 5KRSA 3V9UA 1NKEA 4I2DA 2X6SA 4HUEA 9ICCA 3SI8A 4NYNA 3I8DA 4CJVA 5L9XA 4F5NA 3MR3A 4E7IA 1NKCA 2IGIA 3SV3A 1ZQCA 5FRMA 1IKYA 2JZBB 3BGRA 4GVMA 7ICHA 1IKWA 4YMOA 4OGCA 5KG0A 4TUQA 3ZDEA 1LWCA 8ICBA 5CHGA 4KHQA 4DQPA 1J54A 4QZDA 5TZVA 2W9CA 4M9NA 1Z25A 3RJEA 1C0UA 7ICGA 5IIOA 4XQ8A 3SQ2A 5HRSA 3V7KA 4R5PA 1ZQQA 1TKXA 4IFYA 3VQ8A 8ICCA 4XIUA 3UIQA 4FLVA 2PXIA 1XO1A 4DQQA 4DL4A 4FJGA 3DLKA 4JRPA 3C1YA 3OYAA 2JEIA 2OZMA 3ULDA 4H8KA 4B9MA 2R8GA 3LPUA 2ZD1A 4O0JA 4LVSA 2G8FA 4BE0A 1QS4A 3T5LA 2D0CA 4CJ4A 3T5JA 3ISNC 3IS9A 2R8IA 4JS4A 3V6HA 4KFBA 2JEGA 4BXOA 3AVFA 1KSPA 2HHTA 3HP9A 1REVA 4O3RA 2DFLA 1NK4A 8ICTA 1U04A 5J0WA 8ICEA 1G15A 2ZUBA 8ICIA 3RMDA 1SL2A 5D3GA 4DS4A 4IQTA 1CEZA 5BOLA 5DB8A 3RBEA 3QINA 3ZSZA 1Y97A 4O3OA 4M3WA 1LAWA 2RKIA 4N76A 3T1AA 2YHBA 3RH6A 3KLFA 3AVGA 3K59A 2IBKA 5EWFA 3PMLA 2O4GA 4ED0A 3KKRA 4J9OA 5DQHA 9ICJA 3P83D 1CXQA 3HVRA 1ZQGA 4R63A 4UBBA 4HCBA 1NOMA 3QE9Y 4CERA 3SYZA 4RW4A 2NRWA 4CHZA 4O55A 3CM5A 4IRDA 5HP1A 2H5XA 3JPRA 3L2QA 1ZQPA 3HSTB 1QSSA 4PHDA 4LD0A 1LW2A 3C2MA 3OYGA 4NCGA 3RR8A 1RTJA 4YXMA 4CEDA 3DMJA 7ICSA 3HO1A 3H4DA 4CEZA 3JPTA 4CGHA 1ZQXA 3GIIA 3HYFA 4EBDA 1VSDA 2I5JA 4OLBA 4CF2A 4OGEA 1HYSA 3OYJA 4N47A 1ZBHA 1RTIA 8ICFA 2AJQA 9ICQA 3TI0A 1IH7A 4BACA 1A5XA 1X9WA 5KG1A 3T5HA 2BE2A 4FS1A 3K57A 1SKRA 4KHWA 5DMRA 3NGYA 4FW2A 3H7IA 3PVXA 4N56A 1O1WA 1ZQZA 5KT3A 1S0VA 2W9MA 1J5OA 4TQRA 2A1JB 3TFSA 3L2WA 4DWIA 3U3GA 2Z1GA 9ICPA 2I1QA 3CFRA 4MFAA 2WOMA 5HMMA 4Z4FA 3U6FA 1B92A 3SNNA 3DLBA 4P4PA 4FZYA 4IQVA 2F1HA 4M9LA 2ZQBA 4F8RA 5HROA 3KIOA 5HRNA 1WSFA 1NK7A 1NOZA 3AVKA 3LK9A 3TAMA 3AVLA 4QCLA 4XA5A 1U45A 1TK0A 1NJZA 4CJLA 1D9FA 9ICBA 4ECXA 1TV9A 3A2FA 4FJIA 4QW8A 4PA1A 4YQWA 4ED3A 4PY5A 4M6WA 4QZ9A 4OVLA 4EP5A 4F4YA 1RCHA 1J9AA 1XC9A 1S76D 3MEDA 7ICFA 3NF7A 4AHTA 4FJMA 3PUFA 2D0BA 2FBYA 4PHEA 2AQ4A 4I9QA 1S1UA 4Z4HA 2KZZA 2QKKA 4KREA 4GW6A 3MFIA 5KT7A 4B9UA 4DLGA 4P2HA 4CGGA 4RQ1A 1Z00B 2C22A 1YVUA 4HYKA 4RQ7A 3RJHA 5CR0A 1U49A 5KFIA 4FZZA 2HHVA 4FBTA 1ZQBA 4PHPA 4KLFA 2F96A 3O3GA 2ZTCA 3OYFA 3UXNA 5J2QA 2B21A 3HWTA 2NRTA 5KRTA 1UAXA 1UT8A 1TVRA 4UQGA 2R8JA 8ICGA 3S9HA 4PQUA 4LZDA 3KK3A 2ISPA 3KTQA 2ZE2A 4MFBA 4BE1A 2ATQA 3MEEA 5CJ7A 3NHGA 1S1VA 3G10A 2YV0X 4CGFA 8ICNA 3HXMA 4I9LA 1COOA 5DBCA 4KAZA 4O5KA 3V9WA 2X74A 4NLGA 4NCAA 4NM1A 2MUTA 3WNGA 4B8CA 4ZHRA 1BPXA 3MR2A 4AHSA 2HVIA 3NF8A 1Z00A 4ED7A 4RG8A 3BDPA 4ZH4A 4I29A 4M3XA 5J2JA 5DLFA 1ZQKA 3M8PA 3Q8KA 4J9LA 2E4LA 5KGXA 4K8XA 3F9KA 1LW0A 1DGSA 4FK4A 4DF8A 4CHPA 3PV8A 2BCVA 3VQ6A 1Q9XA 3DLRA 3V9XA 3TABA 1VSHA 1ZQJA 2BPGA 4O4GA 1UA0A 4YFKA 4ECZA 4BWMA 3BQ1A 4GLXA 2J6TA 4Z6FA 3WNHA 4R8UA 5KFNA 5JS2A 3V9SA 1X1PA 3C6UA 5KFCA 4JRQA 1BIZA 3RRHA 4EZ9A 2XY6A 7ICLA 2AU0A 4QZBA 5I42A 4M2YA 2IC3A 3V1RA 3PW4A 4DTMA 2PY5A 1DTTA 4W5OA 3V6DA 4CJKA 7ICTA 4KB1A 4CIEA 2OPPA 1ZQOA 9ICWA 3KHLA 2HHUA 3K5MA 2G8IA 5FRNA 3QO9A 4O44A 4FYDA 3MXMA 4CFCA 4FJ5A 3K75D 2J6SA 3ZDCA 4DSKA 4XUSA 2X6NA 1TGOA 3RJJA 3LP0A 2Q0ZX 4RT3A 4K4GA 9ICVA 3GDXA 3KLHA 3QZ7A 5CZ2A 1K6YA 2QK9A 4PGQA 3IAYA 2HHWA 4DOBA 2PZSA 1N48A 2O4IA 5J29A 1WSEA 4MF8A 2OPRA 4W5QA 5DBAA 4Z4EA 4FZXC 2Z1HA 1TL3A 4OLAA 2JGUA 1L3UA 3KJVA 3IM1A 4Y1CA 1FK9A 5KGWA 4ID5A 2DFFA 1ZQDA 3VQPA 3O4NA 4E7HA 4ELTA 5E41A 4HVJA 1NJXA 2XY8A 1U48A 1CZ9A 4QZAA 3H40A 2IS3A 4M9JA 5FDLA 1JLGA 3V72A 4ECVA 4R65A 2VG6A 4CCHA 4Q5VA 3QEPA 3JPPA 4UAWA 2BDPA 4FJLA 2BPCA 3AVAA 4NY8A 4J9SA 4GXIA 1HQEA 3OS1A 3EPIA 4FBUA 4DO9A 4K4IA 3Q8LA 4M3YA 1IKXA 1A5WA 3RH4A 1CLQA 4NLNA 1KTQA 3BJYA 4DQSA 3LAMA 4OKKA 5KFAA 3EZ5A 2G8UA 4M0AA 2I9GA 4FLYA 4DOAA 1X2IA 4E7JA 1ZYQA 3V6JA 3TARA 1VK0A 3HK2A 1W9HA 2W9CB 1NK6A 1ZQSA 2VG7A 3C5FA 4KLEA 3H8WA 2V9WA 5DG8A 1JXEA 4NLKA 8ICYA 3PW7A 2C2DA 3KHGA 1LAVA 4QZGA 4QWAA 5BPCA 2OYQA 4KI4A 5HRRA 2P1JA 5IIJA 4FJNA 2BCQA 3ZD8A 5J2DA 1GOAA 5JUMA 2XY7A 4GC7A 4DL6A 4F2SA 3QEVA 2OZSA 1ZBIA 1EKEA 1ZQIA 2ZUDA 4RQ8A 4I2FA 4CFAA 3SQ0A 1HRHA 5J0QA 4DQRA 5C5JA 4BXOB 2ZTEA 3MDCA 2KZ3A 5KG2A 5C24A 1XSPA 5DLGA 2F8TA 3IRXA 1S0MA 3VQAA 1RBTA 1FKOA 1DTQA 4DTOA 5KFRA 2FPKA 2FLNA 1ZQAA 4RW8A 2VG5A 5HBMA 3Q8QB 3ZSOA 3V4IA 4CE9A 3QESA 2OWOA 3VQ4A 4CK3A 4JUZA 1B22A 4O3QA 4ELUA 4FJJA 3V9ZA 2A1SA 3MABA 3GIJA 3TFRA 5EU7A 1XWLA 3QEXA 3UXPA 5L1IA 4IDKA 4DFKA 1ZQTA 3SQ4A 3S3NA 4ECYA 3VQDA 4KKOA 4DFMA 4HUGA 3NGZA 4YMNA 1TKDA 3ZT2A 3Q8RB 1KFTA 4B9LA 4CHNA 4F5RA 2XRIA 5KFXA 2ETJA 4O3PA 2OPQA 3O3FA 4RQ2A 3AVBA 3LAKA 4KLGA 1WSIA 4ID1A 3VQCA 5L1LA 3K5NA 4DSEA 4FLXA 4DQIA 2UVWA 8ICXA 7ICQA 3H8JA 4O3NA 3LP1A 4RNOA 3EW9A 3UXOA 4E89A 1A5VA 5L1KA 4M3ZA 5FROA 5KT2A 3EY1A 5J2EA 5EOZA 2NRZA 1DOQA 3E2EA 4DLEA 4NLZA 4C8MA 1QSYA 3DM2A 9ICAA 2BKEA 2HW3A 2IDOA 2E6MA 3HW8A 2PFNA 4J9RA 3L3UA 4CHYA 2FC0A 4LH5A 1IM4A 3HPOA 2E6LA 1BCMA 2Q3SA 4KLJA 4DU3A 3OY9A 4QOZB 5IIKA 3SPYA 3JPOA 2XGPA 3RB0A 2HHXA 1VSEA 2FBXA 1NJWA 4H4OA 2VA2A 2PI4A 3C23A 1BQMA 3PMNA 1WN7A 4J9MA 4N41A 3AO4A 5DG7A 3N97B 2BQ3A 2AQ0A 5D4BA 5J2NA 4KLOA 1XHXA 4YFUA 2FMSA 4BDPA 4MF2A 1QTMA 2FPLA 2W8LA 2BQRA 1EX4A 4BDZA 3EWAA 1BVSA 1QQCA 3RJKA 1RZTA 4IQUA 5KFVA 3V6KA 7ICRA 4IFVA 4KHYA 4KV8A 2DTUA 4Q45A 4B08A 5DB9A 3MXJA 1MC8A 3RRGA 1EP4A 1XI1A 4E1MA 1ZBLA 4K8ZA 1UOCA 1S77D 4DSJA 2F1IA 3Q8MA 3LWLA 3PW0A
chains in the Genus database with same CATH superfamily
3HD2A 2MZQA 4M94A 4IO9L 1RLCL 4CEOA 4RWXA 2ZOGA 2WF5A 2DPJA 5EE1A 2MY7A 3M32B 4WFXA 3WKDA 2IJFA 5C15A 1YBTA 1M5OC 3I96A 2G4BA 3UN5A 4MO5A 2MZJA 4M6WB 3CMQA 1RBUA 3CJKA 4H0PA 2QRRA 3NKYA 4TY9A 3UCGA 2M8DB 1MNEA 3NXZA 1EQYA 8ICSA 4CM0A 1NSKL 2KFYA 3G0ZA 4U7BA 4ILLA 4W98A 1E6VB 4IG3A 2X3GA 4UARA 4USJC 4NL9A 3T69A 1H0HB 2PFQA 3D6RA 2KD1A 1WWHA 4S0MA 3HHLD 3WIUA 1L8OA 2L08A 4QYZJ 1QQOA 1WC3A 4J9KA 3R7SB 2GQQA 2O6KA 3KHRA 5CZ1A 5BN9A 5BPMA 2OGUA 3L3VA 1PZNA 3M2VA 2R8KA 1URNA 3S8SA 1Q7YO 2A1JA 3GCWP 1DZ5A 4O5BA 1SJFA 5J2AA 2W1BA 3W3DA 4OV6A 1OH5A 2ZOMA 1P8GA 2P6UA 2G8VA 1VQ7S 1UPPA 2GZOA 3HLUA 2QMXA 5KL8B 1IVZA 1HA1A 1RDBA 2XZTB 2QFJA 5HMLA 2BH1A 1RABB 4NJ8A 3ENQA 1WHYA 3AVJA 2ZE2B 4CEBA 4KRWA 1L7NA 4JLHA 1RISA 4FPAA 1J27A 2IOFA 1N88A 4CBUA 4NYPA 2VUGA 3VF2A 3PHTA 3G25A 2O8EA 2B4VA 7ICMA 4HI1A 4ZTJA 3TAFA 1WUDA 3GILA 5HR6A 4O5CA 3ET6B 3N6LA 3FZFA 5KFFA 2N3OA 1U24A 4Y2YA 2GWKA 5KFTA 5HANA 1PVRA 2AW0A 4G9BA 4DR7K 1T05A 3TJAA 2XLJA 3L6QA 1GMUA 2IRYA 4ES2A 5AQXA 2V4RA 2KFZA 2X51A 4JNEA 2LEBA 2XLKA 3BV8A 2K8GA 3QU2A 4BC4A 3WKBA 1L6NA 5IOLA 4BR2A 4O9MA 1IJFB 3RAMA 5LOQA 2ZJ5A 4O4GB 1VLYA 1FHTA 3ZSVA 3AA4A 3HULA 3PEHA 2A10A 4ED8A 1F3FA 1LOTB 3GU0A 5BREA 1WC5A 3C6UB 2O5DA 2JH3A 2MHNA 3CFPA 2CUYA 2IC3B 3MUMP 3PNCA 4KBIA 1WG5A 4ZCIA 3V6DB 5D4NA 1ATRA 3POTA 3RBDA 4FSVA 2PMZD 3CMAS 3MGHA 4RPYA 2Z8QA 2UXCK 4DCPB 5ETOA 1IXRA 2M5YA 3GJRB 3MI7X 2VIHA 5HHHA 4B3SK 4JV5K 4J9NA 1CJUA 2QXLA 4ED1A 2Y1JA 2Q79A 3CIMA 3VAMA 5ALVA 3KJQB 1NI3A 5DQIA 3EGWB 4Z37A 2UU9F 1D8YA 4IKAA 3H4BA 3LP0B 3T1YJ 1IIPA 2XS7A 2P51A 1QHAA 2O8BA 2N82B 4OKEA 3ENOA 2RDIA 4UAVA 3VMFB 3GQCA 1YT3A 4A2BA 3Q8SB 3I0SA 1KFSA 5H2FU 2XWYA 2YB1A 1NK0A 5CHCB 3N6MA 3D9BA 1FTCA 2DGUA 3VTIA 3DJCA 5ALMA 4CE6A 3KZIU 5KG5A 4OJ6A 3CDBA 4ID5B 1FWPA 2XBPA 3R3TA 4A8MP 3FEYB 3VA0A 3ORYA 2UU9J 5AQZA 5FDLB 3VF4A 2H3IA 2XI3A 4KHRA 2VG6B 3SPZA 1HD1A 1CQMA 2RE2A 3ONNA 2IJNA 3MGIA 4MK9A 1SL0A 4KN7A 3VGUA 3J80O 1UEVA 5MAOA 3NTUA 1NKBA 1F5CA 1HQEB 4ACOA 9ICEA 3UDLA 1SJ4P 1PJ7A 3K5OA 2M8HA 2GAGC 3WKCA 2PMHA 2ZNYA 1P9YA 4C1NK 4ECQA 2ZEJA 3J7AP 1JI7A 2QL7B 1A0PA 2ZVSA 4FJ8A 3UDCA 4EI2A 1YJTA 1KVCA 1X66A 1HIYA 3U9ZA 1HI8A 4OV1A 4FXDA 3D68A 1X60A 3H20A 1XSLA 2ZH7A 2MQ8A 2VG7B 1JJHA 2ZWHA 1R59O 1TKTA 1NK8A 2JNJA 8ICPA 9ATCB 4WQ4A 2F4VK 2O8CA 3DHXA 3KFWX 3MGVA 4P7TA 4LQ9A 2KT3A 1VRTA 4YP3A 4KHPK 1UT5A 3PXGa 1JCEA 2HBMA 4UAYA 1QHTA 3THTA 1R6YA 2YKNA 5A0LA 4UB4A 3ZCMA 2CPJA 1TUVA 1YIJS 5BR9A 5J0YA 2V9KA 1KOHA 2R7UA 1PILA 4OX8A 2BW7A 4U8YA 3KOAA 1WLJA 5K14A 4L72B 3JPSA 4ZPTR 3ZO7A 5AE2A 1TKZA 1S0NA 3BDEA 1JJCB 3H0RB 4NLPA 3SZ2A 3NF6A 3QEAZ 5B0AA 1KNZA 2MKJA 2E88A 2QKBA 3C29A 5HBMB 2HRYA 3V4IB 3MXHP 2CZ4A 1JN3A 3HKWA 1F60B 5AZIA 2BE7D 3J81Y 1VQLN 4CZIA 1N5SA 4ILJA 3C19A 1HKBA 1VQ8S 5JXSA 4DTNA 4ZPBA 4DUYK 1ZC6A 3V7JA 4E98A 2UXBF 4PZVA 2AYBA 4JKEA 1L3TA 3TA1A 4J9UE 1U6FA 1C1CA 2OPQB 3PFOA 1ZQUA 2AGPA 3BBCA 4AM7A 4YD1A 3MURP 2UUBF 2HS0A 2WVCA 4B3RJ 3F5EA 4O8KA 1ZQYA 2JRSA 3BZQA 3LP1B 1HNXK 2I6WA 2CG4A 2MQLA 3AAWB 3ZZOA 5HHIA 4NX9A 4OI0A 3ILJA 4KGZB 1KL9A 3QBCA 1UZHA 2P9LB 2MKHA 4BWJA 3KD3A 3NRBA 1ED1A 4ED2A 4P72A 3DM2B 3JAMU 4NM2A 4IFEA 2APOA 2Q2RA 2HLUA 3UQSA 2QWLA 2BCSA 1DK2A 2UXBJ 2J9EA 4K4XA 2CA9A 3FZKA 2A41A 3H5SA 4JKDA 1FFSB 2VV5A 4KLTA 2IPOB 4G1QB 4NA3A 5CR4A 3AT1B 3EYZA 2Y1IA 1PKUA 1BQMB 1A77A 4IQXA 1VC5A 2UUBJ 5IWAK 4QR2A 3ZT4A 4DMNA 1YJVA 4ZPVR 1NH8A 3IBPA 5J2NB 3Q2TC 4ISFA 4W5NA 4CZJA 3NASA 3ZLJA 4A5BA 1GO3F 2E5GA 4RW7B 3N7SC 1ZQMA 5E5NA 3AVHA 1BI4A 4CLWA 1X4HA 2AJ1A 5KG7A 3CYMA 2D69A 2NYIA 2O1PA 3ZD9A 4I1TA 4KV8B 3VEYA 2C3PA 1X8DA 2BW2A 3QGPA 4Z6DA 4E7KA 1HFEL 2UV8G 1YHQN 3R2DJ 3TWHA 1BWVA 4DUZK 1RPLA 1S57A 2R18A 4YN4A 1D9DA 3D3CJ 3MC1A 3UD4P 3BGFA 1H2TZ 3DEEA 3LP2B 1VHXA 3HX9A 4KHNA 1JQGA 3FNNA 1EB0A 4CHQA 1RWKB 2OFHX 3KK7A 4BRCA 3CJKB 3VENA 4B3TK 2YKMA 1ZQRA 2W9AA 1I3AA 2KTQA 1RWVB 3P45B 4NZ7A 2FSKA 4LIRA 3EX7B 4I2PA 2IA6A 4IG3B 4NB4A 4PZNA 3GFYA 2DHGA 5AIBA 1MWYA 4GFJA 2QWNA 2KVSA 1WHXA 4RUBA 2A1AA 3MXIA 5KFYA 1RFQA 1NBEB 1XK8A 2B4JA 2V69A 1N4LA 5F3XB 4ZVOB 1TMMA 1BPZA 1NGJA 1UP1A 5LMUF 4M3UA 3SSQA 3ZEUB 3M2VB 4FLUA 3B6BA 4UQTA 3OYBA 4JK8A 5D77A 3M8RA 1RACB 4DU1A 1VQ5N 3VEVA 5AIAA 5KG3A 3ZDAA 1U09A 4PH5A 1U47A 4UB5A 2IIRA 2IOHA 5CCLA 4F04B 3UM9A 1Y0HA 3I33A 4DSFA 2HWTA 1VC0A 3M30A 4CH7A 1RQNA 5DDRC 2R2TA 4LF5K 4LR9A 5AK6A 2IRXA 3NVMA 3A8KA 5KFOA 3QMQA 1JUDA 2O8DA 4TY8A 4DPWA 1OH8A 1S97A 2HHQA 2UXDK 2O8EB 5LMUJ 2VQFF 1RQLA 3MZIA 4M5IA 3ISCA 3T1HJ 1FEHA 1C4CA 5I3UA 2CGLA 4PEOA 8ICUA 1XERA 4BROA 1JJ2M 1UW9A 2E3TA 4ZVUB 4JKCA 1S48A 2OO4A 2LSNA 1TL7A 5GAEU 2KRBA 9ICIA 4AHRA 1SWWA 1X4CA 3KZXA 2ZM6K 2YNHA 2HB5A 3J7YP 1X4AA 4DPXA 3BP8A 4JI2F 2Y1RI 4AM6A 1XNRF 3C15A 3MAQA 4K5SA 4RQ5A 5L8RC 1X9JA 3D2EA 5EDWA 2JVRA 2VQFJ 5B66U 1C1BA 1X4EA 2RT3A 3FSYA 5GAGI 2P9PA 3AOCA 4C7QA 2G8HA 1D5AA 2MSSA 4ZDNA 1U1OA 4TVAB 3O9QA 3B6OA 4IQWA 2C42A 4QS7A 1ZAWA 2NRVA 3ADAC 4PWDA 3T19A 2G8KA 3R5CA 2PEBA 3J81O 4I2GA 2OA8A 1TP7A 3HJFA 2DIUA 3ZDBA 4JI7F 2FC9A 1WI8A 3B9JA 1ASWA 3POTB 5SWMA 2KG0A 4JI2J 1FJGF 1RAHB 5J2GA 1NG9A 4M9GA 1Q1KA 4NXMK 1XNRJ 4RJVA 4WFYA 3GV5B 1FE4A 1IBCB 2NYHA 3VGVA 5J0OA 3O5BA 2EFGA 4YDXA 1CJUB 2RPIA 3CCRS 3NS1A 4DZDA 5H9EK 4DTJA 1FO1A 5DK5A 4FO6A 4KN4A 5J0SA 1U1NA 1WC0A 5AKXA 1AB8A 2DKOB 5AXMA 2Z7JA 2SXLA 5KFDA 2KP7A 1VQ9N 1Z2LA 4B9VA 4XO0A 4JI7J 3I0SB 4EYIB 5JRTA 1UA1A 1FJGJ 4WYLA 4U96A 1AYEA 2EH9A 1HJRA 2OIHA 3PTWA 3N4MB 2E9RX 3TR8A 4YY3F 3EICA 2HIQA 5ADXH 2IDLA 2UVUA 2J6UA 3F2DA 4ES1A 1ZJNA 1Z1ZA 3M2UA 1M1HA 2DNLA 4NXNJ 2DTJA 1ZBFA 3L4BC 1PYSB 4V19J 4RPFA 5J1EB 3QYPA 1BU6O 4O23A 2FVRA 4I64A 4DFDA 4F93B 1OKJA 3SSRA 3DLHA 1U26A 4CGIA 4FM2A 2UUCK 5B09A 4GMJB 3VQBA 2HRTA 1VJWA 5A8RA 4CNYA 1MMLA 5CB1A 1JRPA 1UWBA 1SKSA 4UY8O 3MMJA 2QL5B 4HHHA 2ITGA 3VV2B 3FBEA 4KMUA 4QS9A 2Z1IA 4CP5A 4P73A 4DL5A 3O80A 3J7YU 3QPIA 2GC8A 4C0HA 3T5KA 4PRFA 3SQGA 1NK5A 3JSMB 4CJRA 4BR7A 3ALRA 4NYFA 3IFRA 3IDWA 1YZ6A 2HQIA 1U8WA 1YTAA 4KLLA 3OL6A 2KHCA 4HKQA 4GKJJ 3PR4A 2ZOFA 4NEYA 5HVHA 2I7PA 4B9TA 4H0XB 4YOWA 1NUEA 5AFUA 1YJRA 2O8CB 2XLIA 5E7OB 3A1YG 2J9DA 4QZIA 5AJ3K 2XYPB 2DH8A 5L1MA 1VRTB 5B0DA 2GHPA 4KLDA 4LQ3A 1HQ2A 1U1KA 3HVWA 1M5VC 2LMRA 3BREA 2XCAA 2OCEA 3SAHA 2IVFB 1H74A 1B99A 2MLZA 2YKNB 4B3MF 5AQRA 4NCBA 2C2OB 1X42A 4QWDA 1VYAA 3X3UA 3AQEA 3FZLA 3IG1A 5K14B 1S0OA 4FJHA 5DZ6A 2MQOA 2DGZA 2V8VA 1FXRA 3RAXA 5AM3A 4X4QA 1TKZB 4PCQA 1FRKA 2ZC4A 5CYMA 1XMQF 1N33F 1TR0A 2FJ6A 2BGGA 3ISBA 3P8BB 1MDUB 3OQ2A 4AILC 2EBEA 4Z6EA 1Q7YT 1LNQA 4HTJA 1VMBA 3E9OA 3M9NB 3BN7A 2P9UA 2WUSA 4B3MJ 3CNHA 5HVGA 5AZIB 5H1SV 3TTDA 3N28A 4K4TA 2B9XA 1ZM2A 3WNEA 2XMKA 1Z05A 3TAPA 4DHVA 1IG9A 1R43A 2WSCC 4J37A 3E0FA 4FVCA 4JI4F 3JSRA 2JV3A 4HTUA 4FYVB 3W0LA 4DV1F 1CPZA 1FNXH 4MH8A 4LRFA 4LUBA 4TUSA 1C1CB 4Y6IA 1IQTA 3ELHA 1Y88A 3BSAA 5KFKA 5KAIU 3CPEA 3NOCA 2LXFA 3CQ8A 5L1JA 1RBAA 3E51A 5A76A 2FVSA 4LF8K 2POKA 1HI0P 1BC6A 4P2MA 5AK4A 4YDDB 2P2CB 2DB1A 3RF9A 2CPYA 5GMDA 4YB1P 2JFKA 2ACYA 4K2JA 2X7IA 2ROGA 3G71N 1QD1A 4JI4J 5AQJA 1RTDA 1V3ZA 3HFVA 3S41A 2GS8A 4QWBA 3HM9A 1ATNA 3RB3A 2DHAA 1XTZA 4YORA 2ZIUA 4DV1J 2R7YA 2ZBPA 4BGDA 1KVBA 4DOZA 2X78A 2HFZA 4JV2A 2RHKA 3O9RA 2Z2MA 2QEXS 3AVIA 4YR2A 5AQSA 1OH7A 5F8GA 1TTHB 2W41A 1CXUA 4FW1A 4IRCA 1WTBA 5TKYA 3UKUA 3VQQA 5GIPA 4BC2A 1BOTO 4UB3A 4KO0A 4L6V3 4ZVEA 5J2IA 2AEFA 1XNQF 1S59A 3WX4A 5J0PA 4QPXA 3CJ5A 1BI4B 1RBLA 2Q97A 4EYHB 3CDEA 3K8VA 1JL2A 1PGZA 1BXNA 4C4WA 2ASYA 1ASUA 5LM7E 3V9UA 2X6SA 4HUEA 4TU7A 9ICCA 5AXKA 5A0YA 4F5NA 3NVYA 3AN1A 4E7IA 1NKCA 3TADC 1B7FA 1IKYA 1WKLA 3BGRA 7ICHA 4F0KA 4YMOA 5KG0A 4X2BA 1OSDA 5CHGA 3F5AA 3VESA 3MM8A 3GPAA 1LVHA 4KPCA 1SH3A 1KHVA 1VQ7N 1C0UA 1WHWA 7ICGA 4I6AA 5DZ7A 3P39A 2CH6A 5HRSA 3V7KA 5AICA 1EARA 5HQLA 3HZGA 4LBIA 2B0GA 5LSLA 2YKMB 1YJ9S 3UR0A 4BRMA 3LPYA 4DQQA 1FW6A 4FJGA 3DLKA 2JEIA 3ENWA 3JTNA 4I2PB 3W65A 4DJBA 2H5JB 2R8GA 2ZD1A 3FZBA 4F0MA 2VU5A 2R7VA 2D0CA 4CJ4A 4LJXA 4PG4A 3TSUA 3Q89A 2R8IA 1KS2A 1IV0A 3V6HA 2JEGA 5EE0A 2EC0A 2YMMA 4XPCA 1YJ7A 2MPUA 3QJPA 2AV5A 4NOHA 1NK4A 3IG8A 1NGCA 8ICEA 3VVUA 3QX7A 2N1RA 3VC8A 4JI1K 1CEZA 4B9QA 5BOLA 3RBEA 2A2DA 1Y97A 4O3OA 4CRXA 4C3MA 2E1FA 2IBOA 3EVOA 5ALQA 3QJLA 4M3WA 1LAWA 3FSXA 2RB7A 4JEPA 3M30B 4KJIA 3F2KA 1L7MA 4BX9C 4LFCF 2IBKA 5EWFA 2O66A 3KKRA 1HWIA 3E8OA 5ALSA 1JNZB 1WJ9A 2O8DB 4L76A 5AI4A 1CXQA 4TY8B 4R63A 4QZVB 3NMRA 4HCBA 2CPFA 2KYZA 2A3VA 3QE9Y 3KOOA 4CERA 5I3UB 4FYWB 2NRWA 3OR1A 1MWQA 3CM5A 2AZ3A 4JI0K 3N0VA 2AHOB 3HSTB 1QSSA 4PHDA 1TL7B 3QGHA 2XO6A 2VQEF 3CMAN 2RJZA 4KC5A 7ICSA 4FZVA 3J80U 3JPTA 2K4IA 4LFCJ 4KH4A 4DR3K 2YNHB 4WFAQ 4OLBA 1MWKA 3C15B 2I1RA 1ZBHA 3I5BA 3D2EB 3TI0A 3OUYA 1IH7A 1FKAF 3FUYA 1D09B 3TZZA 2P9PB 1X9WA 4EHTA 3CC2N 5KG1A 3T5HA 3W5ZA 4FS1A 5AM2A 1SKRA 5DMRA 3BF1A 3OHRA 4OX6A 4FW2A 3QRPA 2ZGYA 4N56A 4H5WA 4CNQA 4PWDB 3TFSA 2E1YA 1RAEB 2VQEJ 3L2WA 3U3GA 1H1VA 4PL1A 2MSTA 2YBVA 4JI3F 2FSJA 3CFRA 4FKXA 1GNKA 4MFAA 4J8FA 3KWGA 2MTLA 3AL0B 2OANA 3AHPA 3UNYA 1W97L 5K9FA 2VPWB 1B92A 3SNNA 2ESEA 4M9LA 3F41A 2NRHA 4F8RA 1VBKA 1XMOF 1WSFA 1NOZA 7FDRA 3WK8A 4OZ5A 1EZZB 2KN4A 4CWBA 4XA5A 2C2NA 4URGA 1WYGA 2B9WA 1O0PA 4X4SA 3VAJA 2VC1A 3A2FA 4QW8A 3WK5A 4WU3A 3EO3A 4ED3A 5DJBA 3W5XA 2F1FA 5E3PA 4OHWA 4KSEB 1WSVA 2F5GA 4FZMA 3Q7BA 2VASA 4EP5A 4F4YA 2FUG9 3CJ8A 1J9AA 1S76D 1Q5VA 3MEDA 4ISGA 2LU1A 1XMOJ 4ZLNA 4Q2MA 3LDLA 4O0NA 4RUHA 2D0BA 2VJUA 2FBYA 2CPRA 4I9QA 3M2UB 5AR0A 1S1UA 1HKCA 3JSBA 3H3OB 2P5VA 4QIGA 1JB0C 4P2HA 3IA0A 1GT8A 1A9NB 2ALYB 2EZZA 4JI8J 1ZAVA 3RJHA 2ZH5A 5KFIA 4CO3A 1ZQBA 5A8RB 2XMVA 1UWBB 5BXIA 3OYFA 1VBXA 1UAXA 3ICLA 4XPEA 2PMWA 2DH9A 1S79A 2Y8YA 5AKGA 2R8JA 4HH1A 1ZRMA 4NASA 3SQGB 8ICGA 5LXYA 1RJJA 1ZXOA 1UL3A 3D1QA 5GTIU 4BE1A 1GLCG 2CYYA 3W9IA 3CF5Q 2Q6CA 4CQ1A 5GAHP 1S1VA 1P8ZA 1YTYA 3G10A 3NEKA 3HXMA 1WF2A 5DBCA 3HHKA 1L7PA 3TJ8A 3DXKA 5JVHQ 4NCAA 4DPOA 3VAGA 2MUTA 4OJLA 1J6ZA 2Y3YA 4X4NA 4QU6A 2BE9B 2FDNA 3IWNC 5F3TA 1NLKL 1V5VA 1VQ8N 2OI2A 1Z00A 1BG3A 3N5BA 4ED7A 1NGBA 2HOQA 4RG8A 6FDRA 3BDPA 3G8TA 5G5HA 1FCAA 4M3XA 5DLFA 2GIFA 5E2QA 3WXLA 1FRJA 3BH7B 1RLDA 5KL1B 1PC4A 3IG1B 2V7ZA 2A3ZA 2DL0A 2UUTA 2BCVA 2EAPA 2XMJA 3M6ZA 1JK9B 4CT9A 4DX8H 4F72A 1V6HA 3QT7A 3CCZA 2JWKA 2XULA 2ADCA 1ZOTA 3PJXA 1RADB 5CYMB 3W64A 2DBBA 1UA0A 2G2ZA 2WVBA 2XNQA 1UFKA 4JI5F 4Z6FA 2NO5A 4DR1F 2GX8A 2P9UB 3R2CJ 3ZI4A 2JSXA 3EJMA 5DDPC 5I42A 4M2YA 2W11A 1PVQA 3V1RA 2E1RA 2XB2D 2W01A 1KDNA 2QA4N 4HT5A 5D0RA 2OPPA 3Q8YA 2UP1A 1S12A 2KHVA 3CD5A 5HMWA 5FRNA 2OSQA 3ILIA 3N01A 1NNEA 3IRUA 2W55A 2J6SA 2HMPA 4DSKA 2E1ZA 3MGJA 4C7ZA 3EUB2 5HQMA 2I7NA 2E1AA 3QWUA 4EO8A 2FY8A 4JI5J 2Q0ZX 4DR1J 1JNRB 1F6TA 5CZ2A 3IAYA 3SBGA 1IQZA 2PZSA 2JH7A 3UDVA 4QIEA 2MMYA 1FXDA 2CWXA 2L9NA 3WC0A 2K89A 5MLCQ 3CDWA 4R79A 1RTDB 3EE9A 3KJVA 1O51A 2YKQA 4P10A 2WHEA 3DAWA 1FK9A 5KGWA 2RVJA 2ZIUB 5GAHU 4MDAA 2DFFA 1B0XA 3S7RA 3VQPA 3C3LA 3CJAA 1LXJA 3VGTA 3FMBA 4LF9F 1PG5B 2KOBA 4DCJB 2XY8A 3CF5L 3AY9A 2B4OA 4M9JA 1KKHA 4L3NA 3D5MA 4M7YA 3UKUB 3IP0A 1KQSR 3QEPA 2VFTA 1FRMA 4WZQA 4KO0B 5HAOA 4WFBL 3P5TL 1R0CB 2V2KA 4JB8B 1PSDA 3FE1A 4DV7K 3OBIA 1EWRA 1WI6A 3CCLS 3R5JB 3R7BB 3X1LB 3A8YA 3JQMA 4DV2F 4Z94A 3OS1A 4FBUA 4DO9A 4H5VA 3K8WA 3BZCA 3MD1A 3Q7CA 5A0YB 4OKKA 3EZ5A 1V3RA 2R3VA 2G8UA 1IKYB 2XWXA 5EVZA 1N63A 2DCLA 1SKUB 3BGRB 4LF6F 4GV9A 4DV4K 4JHDA 4X66K 4E7JA 4K2XA 5LJVA 1N36J 2A6MA 4BQLA 3HK2A 1DTQB 3CO9A 1ZQSA 1C0UB 4WF9L 5AI6A 4BVPA 4KMOB 2C2DA 1LAVA 3SIPB 4L75A 1H2VZ 5LSOA 1FESA 3AMZA 2GJIA 5BPCA 1OVQA 2OYQA 3IDHA 2B8PA 5IIJA 4F4AA 3NNCA 2BCQA 4DV2J 1X4DA 1GOAA 3DLKB 2EXUA 4DPYA 3J81U 4DL6A 3VF6A 5C0YA 4WJBA 4OLOA 2OZSA 4IEEA 4A5AA 5F8NA 2ZD1B 3SQ0A 3O6WA 1SI9A 5J0QA 2JVOA 4YUDA 4LF6J 2E2QA 5C5JA 2X1FA 1ZTTA 1AQ6A 2BBEA 2DQNB 3IM8A 3MDCA 2ROPA 2HBQB 1RHRB 3TADA 3IKMA 4EAHD 3IRXA 2O01C 5MLCV 3VQAA 2KM8C 2A1BA 1RBTA 1UW4A 2E5SA 1ACMB 5KFRA 3D7EO 2FPKA 4F3MA 3G82A 3U1MA 2FLNA 1ZQAA 3H90A 5J1NA 3AB4B 4Q7AA 4QJVA 4WTYA 5DM7L 3H42A 3QESA 1OY6A 1NM1A 4C8YA 4CK3A 4ELUA 3MABA 1X0FA 3QEXA 3CVKA 3CI5A 2HFNA 2YVSA 1G6BA 4IDKA 4TN2A 1DGKN 3GE1A 1ZBTA 3SQ4A 3S3NA 4NRUA 2MZ1A 2ZWOA 3JS6A 5CABA 3Q8RB 2W7OA 2M0GB 2BM1A 4IWVA 4Y2CA 4JKHA 4LF1A 3OR1B 1HKGA 4O3PA 3BBFA 1CULB 5K5MA 3O3FA 3PDNA 4KLGA 4IUFA 3K5NA 1T3VA 4DSEA 4FLXA 4DQIA 2DHSA 3H8JA 1HJOA 2H3GX 5L1KA 5AE3A 4OHXA 1Q8BA 5FROA 5KAKA 3W3SA 3A8IA 3SBTA 5D4OA 3CCRN 4NLZA 9ICAA 4C4RA 2BKEA 2HW3A 1IN0A 2KB2A 2E6MA 3R1XA 2GUPA 2W3SA 1D9AA 2GMJA 3Q8VA 3SCIE 1PK1A 4M5MA 4QOZB 3W60A 3MN6A 2IYIA 1MA7A 2ZBQA 4LF4F 3C23A 1IM6A 2NPIA 3LGNA 4N41A 3UMBA 1F9HA 2YX7A 5ALPA 2QTWA 4KLOA 2M70A 2F3JA 3NVKA 5ETPA 2GVDA 2OTJS 1M1GA 4Y2KA 1BVSA 4IO1A 1GLJO 4P6QA 4NV0A 2HAIA 4WTOB 1MA9B 4UOCA 3PKMA 4FXVA 4Y2AA 2DKZA 5DB9A 3RRGA 2EKYA 4ENOA 1I94J 3ICXA 1EP4A 5LMNF 4UF4A 3A13A 5BN8A 5L38A 4BY9C 4CZCA 3OFHA 3Q8MA 4NLXA 2ZIXA 4LF4J 3AA2A 4WKRA 4A61A 2HVZA 2XEXA 2WAQD 7ICEA 3GYGA 1IBMK 3OTOK 1ECWA 3CDUA 2OEJA 3D0GE 4WU2A 1YVNA 2YN4A 3OYLA 2CKWA 2GQ2A 3W9JA 2FXUA 1UJ4A 4YDUA 4A8QA 5GADU 5ALWA 1JROA 1K5OA 1RDWX 3B6PA 4OI2A 3ZSQA 3MWBA 1HW8A 4B1UB 1N32F 3MEDB 4OJGA 4FWOA 2ZNZA 2GHWA 2V2QA 3HFKA 1KBRA 1JJ4A 3HPGA 4UB1A 2W2PP 1RBSA 5LMNJ 2E2OA 1VJQA 4KTQA 3QGGA 4RPXA 4EBEA 5AK5A 3PX0A 2ZIWA 1S1UB 2DGTA 3OL8A 3FK4A 2HQCA 2DRAA 3WK7A 2P8IA 1B0PA 2HBJA 2PFPA 3GONA 5IV3A 3F53A 1Q8IA 3RB6A 4IC9A 4ZVPB 3PW2A 5IIMA 3SV4A 9ICFA 2LEAA 3G2XA 4BR0A 3H45C 2A19A 1NOYA 1YTUA 3OVNA 4KH1B 5KPRA 3CXCR 2JLGA 1N32J 3A0IX 3VGKA 3FDSA 3QSYB 3H1QA 5AQGA 4LBHA 4I4BA 3OVSA 4PUOB 4GY2B 1QQMA 5CY4A 1NB7A 1JL1A 4DL0C 3MPWA 5KFPA 1FKPA 2BKOA 4ZLLA 2G08A 4CEEA 1S1VB 3AA3A 2VJVA 1DURA 3US5A 2ZTDA 3V4MA 2WFAA 3D0PA 4OIXA 5T7LA 4BRNA 4GRSA 2A5XA 3VEWA 3DXKB 4USMA 5CCMA 1RT6A 2MUTB 2QO3A 3JYTA 2DXDA 5AM1A 3EN9A 1FFGB 3DXMA 4CFBA 4WXWA 2WRMA 2JC0A 3QNMA 3TX0A 1QAJA 2IDEA 2P6RA 1ZJMA 3D6MB 5E3QA 4Y65A 1T02A 2RSQA 4ZPAA 1GXTA 3CJ7A 4B1WB 3O9TA 3FC4A 1T44A 2B3TB 2ZJPQ 1SL1A 3E3XA 3UNGC 4GIBA 1M5PC 2CPDA 3QERA 3CC7S 3O6QA 2Z1JA 2B7BB 2GIQA 2CH5A 3ETRA 4GXKA 2J0WA 1I6JA 1Y7PA 5ALTA 1HNWK 4F7VA 4NE9C 2OKQA 2DNHA 4OD0A 2LVWA 3DXSX 4WP8A 3DGPA 4LFBK 3TKAA 4EENA 1BD6A 4YD2A 3B78A 3CUNA 2DRBA 4G3IA 1C2PA 3MMCA 1CRXA 4C0BA 2VHGA 3NGDA 2DY9A 5ADZA 3KMSA 2WK4A 7ICUA 4A48A 2OPPB 2LQBA 2QEXN 4MYUA 2W6KA 4PKDB 5DB7A 1G3OA 1R6VA 1BMQB 5D49A 2JC1A 9ICLA 3RMAA 1OYDA 2VFUA 2KZMA 4N77A 2QSFA 3UE5A 3K58A 4MKBA 3RJIA 1X5TA 2ZKTA 3S3OA 4RUAA 2R7SA 3MUVP 3IP4B 2FZKB 1TAUA 5M1QA 1PC5A 4I2JA 3FCWA 1F21A 3MOZA 2VGNA 3MN9A 3OSPA 3FBFA 1OMSA 3H2VE 2VKRA 1WBBA 2AYGA 2HI0A 5DKWA 1AUDA 2YCHA 1K1SA 2AGQA 4JWNA 3DYAA 5KT5A 4UB2A 1X5SA 4NXZA 4NZ0A 2NREA 1FK9B 2GTDA 2PYLA 4NLYA 4K59A 3TAEA 1S1WA 9RUBA 1SZHA 4DR5K 1RT3A 3VERA 4RU9A 4AHUA 2LQ5A 2IJRA 2HBLA 2ZIVA 1JCFA 2A6OA 3NP5A 4Y00A 1ZS6A 3C14A 1DARA 3GTYX 1J53A 8ICKA 3GIMA 2DGXA 2WC9A 3AVNA 3T1YK 4KIAA 4PR6A 2DPNA 2IHMA 1UFLA 3QEIA 3K1RB 1RDAA 3DRPA 4NLVA 1I1GA 4QBUA 2ZG6A 5ADXA 1FO4A 5HL7Q 4Z4GA 2M9KA 2AIRB 1HBMA 4O3SA 3UW1A 2KFNA 2V8DA 1LFPA 3CG7A 3CPWM 5IILA 2CN1A 9ICRA 3D2SA 1GQEA 1ZRNA 3MCOA 4JHDB 3EM1A 4LVOP 1YLXA 5AZJB 2QLBB 2U2FA 2MB0B 2G0AA 5AI8A 3J7AN 2HSTA 1AROP 3J7YI 2ZJPL 2R8HA 1UZDA 3CCES 3D3BJ 2VDHA 4DR4J 3LL3A 3SQOP 2WVEA 2AGOA 5AQPA 1M5KC 4DR2F 4F5PA 4MFCA 4W5TA 4MAKA 4PG6A 1QVFM 2VOPA 4OZ2A 2Q1NA 4IBNA 1F3VA 4TLQA 4W4MA 4C48A 2PFOA 2K8BB 4QZFA 2DNOA 2B6AA 5BYQA 3AA9A 1UCVA 8ICVA 5M1KA 3NRZA 3AO2A 4JKBA 1DQ8A 3HHDA 4M5DA 4UB6U 3HKZF 1YBAA 3ITHA 2AMCB 2KJWA 4NL5A 3U7JA 3FFIA 4ZJLA 3GFKB 2BHNA 2QSWA 1HHQA 4LMZA 5KT6A 1BHNA 2H5IB 2K3IA 3G6EN 4I6YA 3SEOA 1JLAA 1T03A 3JPQA 1JMSA 2LPEA 4Q8EA 3FGVA 4O5EA 4ZVSB 4DR2J 4HDHA 4K50A 1HBUA 4DR6F 1J97A 1Z4NA 2A42A 4PABA 4MIWA 3G82B 1RAAB 2FVCA 1VQKS 4IRKA 2FGCA 4JMUA 1WNSA 5G0RA 4MFFA 3QMLA 1LWEA 2FLLA 3T9ZA 2HNZA 5ELZA 1K8AO 4ES3A 1HWUA 4IDKB 2PFUA 4CJQA 1XSNA 2WCXA 1GMWD 2Z58B 4MIBA 4FLZA 3SCKE 5F0WA 3O3HA 2HBYB 2VFRA 3MWTA 2MQPA 1WSHA 2YX6A 2V51B 1R8BA 1XMBA 1K44A 3OHAA 3NH2A 4LJMA 2W2MP 4AP9A 5J8YC 1X4BA 3R7NB 1S6PA 2BGWA 3J8AA 2BJ8A 3VQTA 3ILOA 4JI6J 1NMEB 1FA0A 5HL7L 3N4WA 2LI6A 1YKWA 1P27B 2VDIA 3H08A 4FM0A 3G6XA 1PK1B 2XYHB 2RRAA 3SAGA 2MXYA 4WFZA 2HBZB 2LEPA 1BLUA 1N6QA 4WIQA 4EEYA 3BO2A 4AQYF 4I28A 1NNLA 4C8LA 1JWWA 4A2AA 1F9EB 4OJPA 4CF8A 4YCXA 4B3RK 4X5VA 9ICKA 2CQ4A 2GVDB 3WEEA 1CJTA 3BF4A 4NPOA 4DI6A 4UBCA 4A59A 4DV0F 2ERRA 5J2BA 4BE2A 4TLRA 2L9WA 2WONA 3DI6B 4WE1A 1U9LA 2WF6A 2BJ1A 3UWTA 1NK9A 1H38A 2BKPA 3ATUA 1C1AA 4I2CA 3NCRA 4EMDA 1EP4B 4YR0A 3I4PA 2QW9A 2UXBK 3RB4A 5RUBA 4PXCA 4DL3A 2ZXIA 2MQNA 4QIWD 2ZUCA 4DN9A 3P4UB 2AD9A 3ZZZA 4AQYJ 1UHUA 3W5YA 4OI3A 4DU7A 5BR8F 3HX0A 4MK8A 5DETA 2UUBK 3OS2A 3CFOA 3P6YC 1F2HA 5HR7A 2JGAA 4K4UA 2G8WA 2BJ7A 3M4XA 4DV0J 4XH4A 1GTEA 4FCYA 3KKFA 4PWUA 4OCZA 2HRUA 2ASOA 4KGXB 4TQSA 2CNLB 2BR0A 3DC2A 2QTDA 1B4SA 3LANA 2LP4A 1IR2A 3LVWA 3B82A 2I5HA 1Q81O 2KJ9A 2FMQA 2N4CA 1C0FA 1LB2B 2ZIWB 3OYMA 1U4BA 3MM9A 3H25A 4KX3A 1ZM4A 4CJEA 1GMVA 3MOJB 2CXEA 5BR8J 1RT5B 4H4MA 4M9HA 5ALKA 5ALZA 2DXEA 3I1YA 2F76X 3PYFA 4DTUA 4KGVB 3GSDA 4LVNP 2CGKA 2XMTA 4ZTFA 2ZJAA 1Y10A 1TV6B 4BC9A 1Z26A 9ICTA 4CTAB 1A76A 2LU2A 3CJ4A 4DR7F 1MU2A 2C28A 2RMLA 4X64F 5HSPA 1IO2A 4BDYA 1DLOA 2KQ2A 1FKPB 4OJ3A 1SQKA 2OFGX 3RJFA 2J8SA 4PPZA 2FLPA 1DHMA 3EWGA 2IY5B 3G4SN 3DV9A 1ZD2P 2P5GA 3KK2A 5T7LB 5CXTA 5FP0A 2QLTA 2Y0SC 5ALUA 3TSQA 2DJWA 2OEMA 4DKWA 1HYVA 3SDEA 3NCIA 1MN9A 1RT6B 3I32A 3A4TA 4M5HA 3OLAA 3JYTB 1FJ7A 2H3QA 4PAAA 5M1FA 2C1EB 4MMOA 4KH0B 3UE2A 2NS1B 3DXMB 2MLXA 1ZQVA 3SMZA 2FBVA 1IJJA 3ZTRA 2LYBA 4M63C 3TR5A 2OPSA 4DR7J 3RMBA 2V4QA 4X64J 1WNEA 4BRPA 1HMVA 4KGKA 5BRHA 7AT1B 2WB1D 2L48A 1OUQA 4P75A 1ZQLA 5J2KA 2DH7A 2G07A 2LQ8A 2XNRA 4N5SA 3V81A 5ALEA 1B9DA 3MDFA 4A8WA 2LQJA 4Y2JA 3CJTA 2E44A 2UXCF 3QIDA 3U4LA 5E84A 1PJ6A 3KDOA 3T1HK 2VYPA 1SQFA 4WP9A 3CD0A 2GWSA 4I56A 1C0TA 4JV5F 1TL1A 1APSA 3UN2A 5KFHA 2NSBA 2EG2A 4KHMA 8AT1B 4PPXA 3DGPB 1BPDA 4DSIA 3SR6A 4J2BA 1ATSA 2DGWA 1T9XA 3ZSXA 3S01A 4TU8A 1BGXT 3WBZA 1CZBA 3AA5X 3C94A 4CFDA 1FEZA 2BTFA 3K4GA 2FZCB 3NH1A 4KRFA 1S72S 3NH0A 3GYNA 2AJ4A 3DOKA 3AVCA 1K9MT 3PY8A 4WYWA 3I31A 4X65F 2VQFK 1N5YA 2UXCJ 4X62K 4FYXB 5B5EU 5AQQA 2A40A 1SWVA 3R9KA 3DRSA 4Y3CA 4JV1A 1U02A 4JV5J 3SQ1A 4DX5A 3CCLN 2W4CA 3NL0A 3KNGA 2DD8S 5JLHA 4Y2SA 1WKKA 4CGDA 3QUBA 3LM2A 3MPYA 2W42A 3THYB 1F44A 1RT1A 1WUUA 5K8PA 5LSRA 2Z2LA 3TVKA 1V4TA 4CJTA 5E3CA 4TYAA 1NGHA 1VJ5A 2AJFE 2Y0SD 2RQMA 2I38A 1E3MA 3R3LA 2IHNA 4Z6CA 3DYAB 3LDSA 4LREA 2OEHA 4PKHA 4JI2K 3OL7A 1U2VA 4KLUA 2M52A 5DQGA 4OPKA 1S1WB 2KXHA 4ILHA 1RT3B 4X65J 3TP2A 4DL7A 4J2DA 1MLAA 4K7QA 4QR1A 3I28A 4KYZA 3C14B 2QWPA 3WIVA 3C6TA 4F50A 1XU4A 3C5GA 9ICOA 5AQOA 2DR9A 3HVTA 4DV6F 5AM0A 3CJQA 3NLCA 4RW9A 1CUKA 4DG1A 3D45A 3DRPB 2H3ZA 3W1YC 2F4VF 1T9UA 1WF1A 4NMXA 3N7RC 4JI7K 3K1ZA 3OTQA 3AJDA 2GV9A 2XVTA 1HPZA 1HBMB 1V9OA 3AJ2A 2PFDA 4ZOSA 1FJGK 1Q8KA 4I0WA 1BHLA 3OVBA 3PO5A 2HBRB 2AP6A 5FIIA 1X40A 1RBVA 2EX3A 4A57A 4IOXA 5IV4A 4USIA 2EAOA 4QIFA 2DNQA 4CK1A 2FGOA 3DLEA 3UKRA 3KG4A 4OYWA 3TEHB 2MKKA 3AEVA 4NXNK 5KFGA 4DV6J 1KQKA 2F63A 1B70B 3VAKA 3DRXA 2CJXB 1N8RT 3TANA 4EUVA 3UQ2A 2F4VJ 1HNIB 1KVAA 2D1KA 2VL1A 3HF5A 2YY3A 1PBAA 2PMZF 4CGZA 3RTVA 2E7VA 2FJWA 3BQ0A 4TSXA 5KFZA 1AZSA 4ID8A 5EY4A 4M5DB 4FF3A 1V9PA 4DQ8A 2FI1A 4FYYB 5KFSA 2CIMA 3ITHB 2GVZA 1GAOA 3THPA 3FFIB 2RHQB 3D67A 4AH9A 4WWSA 4CEFA 3CB4A 2RP5A 2EW9A 1TZ0A 3JSYA 4CJ5A 3CCMS 4EK2A 6AT1B 4OJOA 4GKJK 4JB3A 4P2XA 3GIRA 1JLAB 4DUYF 3RMCA 1T03B 2Z4PA 2DGVA 3PIOQ 1TAMA 1NPKA 2LDYA 1OS5A 3MM6A 1KAXA 1HBUB 3I0RA 3AVMA 1UQVA 3H8SA 3FQKA 4WQ5C 2BUNA 4LH4A 3O1BA 5G0RB 2DITA 1HNXF 1D8ZA 5HMXA 1KP6A 1UKUA 2EHGA 2HNZB 1YF5L 3C28A 4ZPCA 2J9CA 1YSJA 1PVPA 4TYBA 1HLWA 8ICLA 2G2YA 1OIAA 2VWKA 5ALFA 3R8YA 2M9NA 3U8XA 4G1IA 3QUCA 4FWRA 4D3HA 4DUYJ 5J2MB 5D4PA 3DOMA 4FJXA 2K7JA 4IO8A 2ZJ8A 2BANA 4C8KA 2OTJN 2EZXA 1Z4UA 4LR7A 3PX6A 1BISA 4UOGA 1Y3KA 5AQUA 2KG5A 1CZAN 3MF5A 3KXDA 4CT8A 1GOBA 1EX8A 1JMTA 1KQQA 1Q9YA 1TVAA 4A8SA 3UD5A 1H3DA 2G0IA 2EFOA 5GIOA 5IWAF 1S6PB 3B8AX 1KCFA 3MCSA 2KM8B 1N34F 1HNXJ 1EKSA 1SAZA 3OGUA 3UMGA 2R7RA 2RDDA 3ZZ0A 1NM2A 3WXKA 2F3NA 4PKGA 4QJFB 1BPYA 2ZITA 1VQMS 3RJGA 1WD6A 2P9NA 1KW4A 2DGOA 1FRLA 2H5EA 5KFLA 4JOUA 4PWWA 4ZCMA 1BDGA 2F8SA 4EP4A 2EQYA 3EPGA 4U6PA 5CYQA 4IEIA 1N6QB 1E6YA 4E1NA 2FY1A 3ZTSA 4MN4C 1Z3EB 2BCRA 1N5XA 5FD1A 2P6TA 1U0HA 5GAHI 1VSMA 3GP9A 1ROFA 3WEEB 1CJTB 2RDJA 3PO4A 1SIJA 3BGLA 3BQ7A 3WNFA 1EWQA 3OTEA 3MR5A 3ZZPA 1N34J 4PGYA 2IOFK 4DEZA 2WONB 4DU8A 4WE1B 4ETZA 3QNOA 3AQPA 3AA8A 1ULRA 3K9KA 1FXLA 4ED6A 4JBCA 1NKEA 4NZ6A 2XMWA 2CRLA 4DPTA 5J8YA 4NYNA 4IO9Q 1Q86O 1PAEX 2NV3A 4AUKA 3MR3A 4WIIA 3SV3A 1ZQCA 2BVZA 4FZLA 2ZJQQ 4GVMA 2IVYA 4X84A 2C3MA 3ZDEA 1LWCA 2YI1A 3LW5C 5TZVA 2W9CA 3W62A 3RJEA 5FLXY 4C6AA 2E8OA 5IIOA 4XQ8A 4ZOHC 1ZM9A 1F0XA 2FD2A 3PIOL 3SQ2A 4NWBA 2K4HA 3SEIA 4O3MA 4J7CA 1RQ0A 2A6AA 2Q0RA 4DUTA 2KNJA 8ICCA 2WBRA 3N9UC 1O8BA 1XO1A 1QTNB 3BSOA 1COKA 4CLKA 2HG4A 4H8KA 2D41A 2GHVC 4O0JA 4C1NI 4BE0A 2BJEA 2XM3A 3TYTA 1MROA 3O9SA 2H9ZA 4LF5F 3MM9B 3JTPA 4BXOA 3AVFA 2DNZA 3CCJS 2HHTA 4H4MB 4O3RA 5K4LA 4I6MA 3AD9C 2YTUA 3GG0A 2UXDF 4OYMA 2PT0A 5IT9Y 1G15A 2ZUBA 2PFFB 3P3DA 1HNZK 3N5FA 4DS4A 4IQTA 2Q66A 2E7WA 3TNVA 4PG8A 1XQSC 3H0PA 3QAEA 4DHYA 2RKIA 4NA2A 2GWJA 4DXLA 2YX4A 3T1AA 1WEYA 4M7XA 3KLFA 1MU2B 1Q53A 1DLOB 2IM0A 1NGEA 1NH7A 2ZH8A 3CC7N 4ED0A 3CJSA 2BDUA 1ZD4A 4RQMA 2BJDA 3QICA 3KK2B 2ZM6F 1ZQGA 4HL9A 4XK8C 1YJWS 3IR5B 1NOMA 3GG1A 4ZVHA 1ZA1B 2RQ5A 1OW5A 2R2RA 1NZAA 4CLSA 2G9OA 4MTPA 1KOOA 4RW4A 2YWFA 3I8BA 4JK9A 3PSIA 2H5XA 3JPRA 1ZQPA 4C97A 2E20A 3VR1A 3OYGA 3M6WA 3P38A 4NCGA 1T3OA 3M7VA 1RTJA 4YXMA 1VQNS 3PJ9A 2OPSB 3IAS9 3HO1A 3E9LA 3H4DA 2JX2A 1ZQXA 3N7PD 1HMVB 3QUQA 1R27B 2I5JA 4WKYA 1HYSA 4EX7A 3OYJA 2HS4A 3GFZA 3R5BA 3GG4A 2ZM6J 4NO7A 1C20A 3GL1A 4OL8A 4BACA 4NXMF 3KJFB 4UASA 1RM6C 2QLXA 2JR5A 1FDDA 4KHWA 4XTTA 2ZJQL 1C0TB 1TL1B 2WB4A 2B4PA 2PIIA 1O1WA 1S0VA 2E8MA 2W9MA 3EZOA 4TQRA 3AODA 3J7Z5 3TVZA 1J5EK 5IT0A 1WDDA 1URRA 3SFUA 2PE8A 2WOMA 4BR4A 2FHMA 3FBBA 2KK0A 3TZXA 3AB2B 1K0TA 4MLEA 3U6FA 2V68A 2W4DA 4FZYA 3OT9A 2PKEA 2F1HA 5AQNA 4M63A 5HROA 1K8AT 5HRNA 3DOKB 4BQZA 4ZITA 4NXMJ 4FWKA 1N5YB 5IXUA 3WU2U 4UW9A 3AVLA 1WEZA 4QCLA 5F2RA 1UTAA 2RHFA 4BGBA 5H9EJ 2OMLA 1VK3A 2KU7A 1S4EA 3QFWA 2OM6A 4RU2A 1TVRB 3BGUA 3RW7A 4B6JA 4CD1A 2A2CA 2MSNA 4ZVFA 2UUCF 1TE2A 3BUZB 4OVLA 1YWXA 3ZX3A 1RCHA 4ALZA 1U2VB 7ICFA 2B9YA 4AHTA 3CCEN 5T14A 5GADI 2LECA 3PUFA 4IJAA 2DYAA 3Q23A 3OFFA 3NS7B 1RBOB 3BEXA 2KKVA 1QDUB 2QKKA 3C6TB 3MFIA 5KT7A 4B9UA 4DLGA 4TNOA 5AI0A 3HVTB 2RD5C 1AXQA 4RW9B 2WW8A 4DG1B 4HYKA 4RQ7A 5CR0A 3J7A1 2XHWA 2K8AA 1G99A 3PRVA 3HBTA 4H03B 2RRDA 5AJ3F 2UUCJ 4DZ6A 4ILMA 4A62A 1TL4A 2HVEA 5AK3A 2KO1A 1LWXA 1UT8A 1YI2S 1HPZB 2E5LK 3RG6A 2OD4A 3KK3A 3KTQA 4MFBA 4E8UA 3O1LA 1WKJA 5CJ7A 1SQEA 2VICA 3OPXA 3UKRB 8ICNA 2AJ0A 4I9LA 4ED4A 1RGVA 2K1RA 5DO2A 4I6WA 1VQKN 3VEZA 4O5KA 3CJRA 3V9WA 1YVFA 4P9SA 4OZ3A 2P9GA 4NM1A 3GJQB 3D66A 1H7WA 4KE5A 1BPXA 4JI8K 2HVIA 3NF8A 5AJ3J 5E33A 3C0BA 1T3QA 2PBDA 2PA8D 3WQUA 1AZSB 3ZC4A 1YRXA 3NCPA 3M8PA 2HCFA 2GVZB 4QQBA 5GMKa 1U2FA 2PSZA 3F9KA 1KQGB 4PHTX 3PV8A 1RG6A 1SIZA 1NGAA 4FNIA 5IZHA 1CS4A 3V9XA 4F36A 1Q81T 1WG8A 1N52B 3R9PA 2QWRA 5IT9O 2BPGA 2UYTA 3LUYA 3MM6B 2KVQE 4MKAA 2BEFA 3I0RB 1U6BA 2J6TA 4PL8A 3KG0A 4USTA 1X4GA 3QYYA 4R8UA 5D0EA 4JRQA 1BIZA 3RRHA 4EZ9A 3D54A 1UAWA 4LF8F 1DTTA 3MD3A 2KL8A 4KX5A 3TJ9A 3BB5A 3F0NA 3JS9A 4QYRA 3QU4A 3SMVA 3ZZTA 2VBYA 2HHUA 3QJJA 3OFGA 4O44A 4RLEA 3DOMB 3K75D 4UZCA 3UPFA 2BANB 4OI6A 4AL6A 4EFHA 1PUZA 1S5ZA 4LRDA 9ICVA 2OP5A 3KLHA 4UATA 1K6YA 2QK9A 1JCGA 5ALNA 2GJ2A 4Y2PA 1EJ7L 2HS3A 4NLDA 3CQYA 4DOBA 2YMQA 3I5CA 2K3KA 1UJ5A 4MF8A 2OPRA 4Z4EA 2FDRA 2LA6A 4FZXC 1TL3A 3ZTPA 1IWGA 2ZHOA 4WQ5A 3NAHA 4OX9K 5DS7A 2P9NB 4WJ3B 4CO4A 3IM1A 4DV5K 1UVMA 2FHJA 3D2QA 4YB6A 2CQPA 2QN6B 5CYQB 3D6FB 3B54A 2QE5A 5E41A 1E6YB 4F02A 4WCEQ 2PC6A 4QZAA 4CZEA 2X1GA 1U0HB 4ECVA 4R65A 4CLLA 4CCHA 3SLCA 1ZPVA 3M6GA 1VHIA 2RS2A 3AVAA 1J2MA 3ZZUA 4IOBA 5EXWA 2BZ2A 3Q8LA 1IKXA 2F8LA 3TTCA 1CLQA 1IBLF 1KTQA 3WQTA 2KV2A 4DQSA 3DHWC 4OQJA 4BHQA 2WBMA 4DB3A 1FFWB 3MCMA 2WHOA 3EEQA 1LWCB 3QDKA 1VQYA 2Y9UA 1ZYQA 1RAFB 2V5HG 2C2ZB 2W9CB 3CEDA 3IG5A 2V9WA 5DG8A 3TSPA 1JXEA 2QA2A 3PW7A 2E66A 3KHGA 2V50A 5AQVA 1BY9A 4WBFA 2IM3A 1ZQ1C 1CG2A 2RLTA 3ZD8A 2CDQA 5J2DA 1UETA 1GLDG 4JI1F 1IBLJ 3DXBA 4GC7A 3VETA 2IM1A 4YB5A 4A8FA 3OXLA 3FZHA 2ZUDA 1B7YB 4CFAA 3HJVA 3NVVA 1MROB 3CIPA 2GMHA 4DQRA 3ZZYA 3O0FA 4BXOB 3UMCA 1N36K 3OBYA 5AQYA 2YX1A 1S8OA 4I6MB 5DLGA 4BUGA 4GNIA 1S0MA 1M5HA 2CPHA 4A46A 3ENAA 2K2PA 1DGJA 2VG5A 1WOOA 2KYXA 1PYOB 3A12A 4DV2K 2E8AA 3DLJA 4CLZA 1I5OB 3MHYA 1Z1VA 3KLFB 3HHNB 4ZP7A 5H9FK 4FJJA 3LTOA 1WEXA 2NQPA 1DAXA 2DXFA 2Q3PA 1BA1A 4DFKA 2RUSA 3CTRA 4DX6A 5F41A 4LF6K 4DR3F 3VQDA 4H4OB 2YH0A 3NGZA 1JALA 4YMNA 2W25A 1QM9A 1DY3A 1SJQA 3UI3A 4RW4B 1LFWA 1H72C 2ETJA 1SS6A 3AVBA 4P0QA 5SUHA 3VQCA 5L1LA 2HQFA 2KHOA 5GAEP 4NLUA 4EELA 4WCEL 8ICXA 2W03A 2ZH6A 4O3NA 4NCGB 3UXOA 3DDHA 1RTJB 1RAIB 4RR5A 1S72N 1A5VA 1HEKA 2CJBA 4G1PA 1W2BM 4DBQA 1BA0A 1DOQA 2VGMA 2I5JB 3UCUP 5C2GA 1RKJA 4DR3J 4OJ5A 5JVGQ 3K0SA 1IM4A 1HBOA 3HPOA 1BCMA 2Q3SA 1Y5IB 4KLJA 4CO0A 5A8WA 3OY9A 1EIYB 2GAHC 2XGPA 4IXCA 3PM9A 2F8EX 2VA2A 1YX2A 1WN7A 4J9MA 5DG7A 3K5PA 2QI2A 2BQ3A 2AQ0A 3VCDA 2NSCA 1T0TV 2KG1A 1XHXA 4YFUA 4KY3A 3DDIA 3O44A 4YHHK 1RA7A 2BQRA 4KB7A 2IVNA 4BDZA 4L3KA 3HSCA 2WOMB 3HJEA 1QH9A 1RZTA 1MW7A 3GZFA 1L8LA 1V38A 4IFVA 4KHYA 2VPXB 1U1LA 1HPMA 3FAHA 5HROB 3MXJA 3O5TB 1MC8A 7FD1A 4Y28C 1XI1A 1SC3B 4NLWA 2NNWA 1CJVA 3KZBA 4CLPA 4WK3A 3H98A 4MT1A 1YRTA 3R9LA 4CH1A 5AKYA 1UOCA 8ICOA 2A1JB 3PW0A 2WTUA 3C2LA 1RXWA 5KQ8A 2EFNA 5AM5A 2K4PA 1UFWA 4LRBA 2DY1A 5KFBA 4FDFA 2P66A 1S6OA 2MLYA 3L95X 4FLTA 1PCAA 3AQFA 4EU0A 4FN5A 5J0XA 2EG1A 5AQTA 4NYOA 4A47A 2W2OP 2MGZA 5AQHA 3KD5E 3MECA 3OLBA 1E4FT 2JEJA 1RWUA 2RIJA 1WBDA 4OHZA 1I94K 2HWHA 5GMEA 4Z7CA 5LJWA 2CQ1A 1NNDA 3CNQP 4YVZA 3T79A 4ZJOA 2BM0A 3MPDA 3AM9A 2HMIA 2IRUA 4CDIA 1T05B 1NPRA 2X1AA 5CQGA 2BZFA 3BH6B 1IG6A 3R1LA 3TPQA 3DOLA 2ZHBA 3IRWP 2GV1A 2XI9A 3AO1A 3WT0A 3M32A 9ICUA 1KD1T 2HK2A 2Q31A 3CCMN 1TUYA 3FM9A 2FPHX 3ENVA 2ASMA 2AYMA 5HATA 3U3YA 2UUWA 3KK3B 4J5OA 4URQU 4MFBB 1RK8A 4UUXA 2BKNA 5LMNK 1Q86T 3NF9A 3LPEA 2HWIA 3TVYA 4CH0S 3CP8A 1HWJA 2K1RB 1B4FA 5C42A 3CMES 3LZJA 5DDMA 2JL9A 2F1JA 3MTKA 3HVAA 1TAQA 5JVGL 1EQ0A 4RT2A 2KICA 1RHJB 2F2AB 3MDAA 1DXSA 5BOMA 4LZGA 3HCXA 2Z0GA 3VQ7A 5AKKA 4KLSA 1D4XA 2E1CA 2KVIA 5IINA 2RU3A 3BF3A 3ZSRA 4B1XB 4RNNA 4USHA 4RL1A 4B8AB 4TXSA 1N32K 3CQXA 1RYSA 3HKZC 1BQNA 4CIFA 3M8PB 4LR8A 3CO0P 1T4GA 1FWLA 3I5AA 2DR5A 4YB7A 3CHWA 1R8CA 5BYRA 2Z2YB 2V4JA 1FXXA 3RH5A 1CS4B 2ALZA 2E5IA 7ICKA 5DGBA 4KB0A 2ZZNA 2O8BB 3D6HB 3T6BA 2YNIA 2XS5A 4AHCA 4CGJA 3D0HE 2NLXA 4NLQA 2FSNA 4KHSA 3PJWA 3GSIA 2YWWA 4R8UB 1RT2A 4M95A 1YDLA 3OYDA 5E79U 1QQNA 1VQMN 3AFGA 1ZETA 5E3RA 3MM5A 4LF7K 1WOPA 2XMAA 1DTTB 4KPYA 4BCAA 5DDYA 3KBBA 1HUZA 2XY5A 1A6SA 2KT2A 1NSQA 4CI0B 3LGMA 1C0MA 3QIPA 2IAJA 4YNQA 5J1PA 4OX7A 4CJ3A 4GO5X 1VISA 1RNHA 4O44B 1W7AA 4Q2LA 3VAFA 1FNMA 2QV6A 1N0UA 1JLBA 3J81j 1ZQEA 3OFEA 3ISDA 3KLHB 3M7DA 2CXYA 3W66A 4K4HA 3I82A 3THWA 1T6DA 3NS5A 2HHSA 1F0MA 4WP3A 3NRWA 3CRXA 3ZNJ1 4F91B 3WXMB 1QAIA 4M41A 2OPRB 2ABYA 1WC6A 3SJHA 3O1WA 4YY3J 1TL3B 2G2OA 3H2LA 1RBRA 3HILA 2I0XA 2V67A 2M3DA 2E1EA 1Y5NB 4DV7F 7ICJA 3M8SA 1JXVA 1SKWA 1BO5O 3EGZA 3IMQJ 4HUFA 1TKTB 1NXIA 4KR0B 5CWRA 4IOAQ 3ZDDA 1BPEA 4E19A 2XO7A 3CJCA 3QEWA 4YG2A 4DV4F 4G6VB 1S99A 4X66F 2D4WA 4ECUA 4NLBA 4GV6A 3NDKA 2WMMA 2CNNB 2KLAA 2CAJA 5KFJA 1ZQFA 4H5TA 4CF1A 3OYHA 1BNPA 4I2HA 4ICAA 4L3QA 1HHSA 3IGNA 1IKXB 3W2WA 2ZDPA 4KLQA 2MEWA