4UQGA

A new bio-isosteric base pair based on reversible bonding
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
publication title "Post-it" type connected DNA created with a reversible covalent cross-link.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 214
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4uqgA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4uqgA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqgA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4uqgA01
3OYEA 4ELVA 3QETA 4XIUA 3TAMA 5DGBA 1NK6A 3TWHA 3RR8A 4DFMA 3IHQB 4F5OA 3QEAZ 4CF8A 3MEEA 3G6VA 4DTUA 3C5GA 2AQ0A 5KT2A 4QWBA 1RXWA 3ZDEA 1D9DA 4HHTA 3TFRA 2PI4A 4H4MA 3AVIA 1SL0A 3B0XA 4DTRA 4J9KA 3T5JA 3L3VA 1KFSA 4F5NA 4KN7A 4BXOA 1QHTA 2D5RA 2E6LA 4B9UA 9ICIA 5KFWA 3V9WA 5FDLA 3QEPA 3QZ8A 3AA4A 5KT7A 2ETJA 2VG5A 4MEYA 4NXZA 4F8RA 3JPNA 1NJZA 3VN5A 2FPKA 2HVIA 4KLIA 3RBDA 4KLQA 4FJGA 4QZEA 2KQ2A 4CFBA 2ATLA 5I3UA 3S3NA 5HMMA 3OJSA 4P4MA 3LWMA 1JLBA 3FFIA 4MFBA 1NOMA 2XRIA 2FLNA 1S1UA 1J9AA 4NLGA 3OJUA 4ED7A 3RJJA 2E6MA 3VQAA 1S1XA 3DRRA 4PH5A 4TUSA 1DLOA 3C2LA 4CGGA 4E7KA 3TAGA 1DTQA 3LP2A 3QINA 4NM2A 4YMNA 2C28A 4CHQA 4I9LA 4KLHA 5JS2A 3MDCA 5J2DA 3ALYA 1C1CA 1ZQVA 1RDCA 4IQTA 8ICQA 3PV8A 5KFVA 4I2FA 5KFZA 3RH4A 4BACA 4KLMA 5I42A 3AVHA 3RJGA 4PUOA 1X9WA 3DLEA 2Y1JA 1Z26A 2XGQA 5FRNA 3DLBA 4OGCA 1RDAA 3QESA 4KLJA 8ICBA 4CJSA 4RQ1A 3I0RA 2OYQA 3MGIA 3H8WA 4YD2A 2PYJA 1VSEA 4TUQA 4E1MA 4O0JA 4EYIB 1S76D 4IR9A 1KLNA 3RBEA 7ICHA 1K1SA 5DG7A 3ZDCA 4I2EA 1S6QA 2F1JA 1ZQIA 3OSNA 1SKWA 2BCQA 3AA3A 1L3VA 2EHGA 5J0QA 4RQ2A 1F21A 4FZZA 4ECSA 3D0PA 3RJFA 2DFFA 8ICJA 8ICTA 3KHHA 4MF2A 3PO4A 3RAQA 3QEBZ 4QAGA 3CG7A 4DTJA 1AROP 1J5OA 4DF4A 4Q45A 1EETA 5KT6A 5J0UA 2UVVA 3PY8A 5CYQA 1RT5A 2R7YA 2FC0A 4PQUA 3O3HA 3JPPA 2IC3A 4YCXA 3NBPA 4FJLA 1Z00A 3SQ1A 3BQ2A 3E2EA 5FROA 4OKEA 1NK0A 1S0OA 8ICHA 3MFHA 1ZQHA 5KG2A 1IKXA 4CK2A 1SZPA 3IRXA 3CYMA 5C42A 1RPLA 1S9EA 4B9VA 2OPSA 1K6YA 1MSWD 1VSDA 3AVAA 4KHUA 4M41A 1NOYA 3VQ8A 5KI6A 5HLFA 3N4MB 2C2RA 3RB6A 5DK5A 4CJFA 3KK2A 3G6XA 5D46A 4DFKA 3AVFA 2IBKA 8ICRA 5J2IA 1BPBA 2ZUCA 2AGPA 3LANA 4OPKA 1LWEA 4HVJA 1UT8A 1A5WA 4OLAA 1ZQDA 2XCPA 3NF8A 3O4QA 1MQ3A 4CHNA 2PI5A 3ISNC 4J9LA 5KFOA 3ZSQA 1WCLA 2JLEA 2ATQA 4OJRA 8ICMA 1TVAA 4ECWA 3F9KA 1ZQWA 3K5NA 4H8KA 4UAWA 3AO3A 4RT2A 4QOZB 1RT7A 3VQCA 4QZBA 3HXMA 3RWUA 3IG1A 1JLCA 2J6SA 3HX0A 2HNDA 1RZTA 5J2EA 4JWMA 2I5JA 4FW2A 1QTMA 4AHSA 3Q8LA 4JWNA 3V9UA 4PGXA 4UBBA 3VQQA 1WCNA 5HRPA 1FKPA 3EPGA 4KI6A 5HNKA 4CECA 2XCAA 3P5JA 1SKSA 4UB2A 4DEZA 2XY8A 4DSEA 4MEXA 4M2YA 4I2CA 3HJFA 3M9OB 2D0CA 4QWDA 3RH6A 5HBMA 5L1IA 2YKNA 3ZSXA 5F9LA 2IS3A 3L2RA 7ICVA 2KZZA 2FMSA 2BPGA 4ED0A 2YV0X 1BHLA 5DG9A 2C2EA 1I39A 3GV8B 1MU2A 1KLMA 1KCFA 1ZQMA 3CQ8A 4YVZA 1JKHA 5HRNA 1KTQA 1U9LA 3AO5A 5J2MA 2YHBA 4CJQA 1RDDA 4TUPA 3MEDA 4KTWA 7ICQA 4FJJA 3MXJA 4XRHA 1C1AA 1RT3A 9ICLA 1ZQZA 4I2GA 4LZGA 5KFYA 2DFLA 3HWTA 3DM2A 2C22A 4DSJA 4DTMA 2ZJ5A 3VQDA 3MR2A 5KGXA 5J2BA 3V6KA 3V7JA 5IIJA 4FM2A 4DFJA 3TFSA 3FYHA 1TAUA 3D45A 3HPGA 2WONA 4KKOA 4KO0A 3KKRA 4O3OA 1JL2A 9ICFA 2F8TA 4R8UA 2EX3A 2OWOA 3TARA 2J6UA 4RQ8A 3B6PA 3C1YA 4I2JA 2YNFA 3A2FA 4DSLA 4KLTA 4J9QA 2IA6A 1JMSA 4CGHA 3PR4A 5HROA 2HNZA 3NF9A 5CP2A 5KFCA 5KFAA 3SQ4A 3LALA 1B43A 9ICTA 2BHNA 1RT6A 4CGFA 3HP9A 4C8MA 4RQ4A 2VA8A 1N56A 3DMJA 4F5QA 4EBCA 2VA2A 3V9XA 4ECXA 1XO1A 3PX6A 1XI1A 1RBSA 4CIFA 5EWGA 2O4IA 1U4BA 4YXMA 4OLBA 9ICVA 3NF6A 3NF7A 7ICRA 4QW8A 5IIKA 4BE1A 1IG9A 3KHGA 3OS1A 2XHBA 2YKMA 4FW1A 3MXIA 3BQ1A 3Q8RB 4CIEA 4DQSA 3AVGA 5KFLA 3MEGA 1S9GA 2ZJ8A 4CK3A 1ASVA 4P4PA 4KB1A 1ZQPA 3BJYA 3ZT3A 1VRUA 3ASMA 4RQ3A 1C1BA 3SV4A 3Q8MA 4CHPA 4QZHA 3IM1A 3JSMA 1KRPA 4ELTA 3KKSA 1ASUA 4FM1A 1S0NA 1RTJA 5DBCA 4E1NA 1QQCA 1JLFA 4CK1A 4RT3A 4J9OA 7ICLA 1RNHA 2KTQA 4HTUA 4C8NA 1X9MA 4M3TA 1Z00B 2HHSA 4CHZA 2ZQBA 9ICPA 3NHGA 4KLLA 2RKIA 4KI4A 5KFRA 4O5EA 4XUSA 1YT3A 1CLQA 1L3TA 4KLUA 1HNVA 1O1WA 2ZTDA 3DI6A 3NFAA 2R8HA 4YFKA 3RAXA 4KHYA 3OHBA 4R65A 2R8GA 3H4BA 4DMNA 3L2QA 5BOMA 3OYNA 5HP4A 5DBAA 3O3GA 3KIOA 4RW8A 1IH7A 3C6TA 4YR0A 4Z6DA 2YHAA 5K14A 4ECZA 3EYZA 5KT5A 3DLHA 4LH5A 1WSFA 3EPIA 1RTHA 4K4GA 4KLDA 2VG6A 1S5JA 3RRHA 1I3AA 4ED8A 1ZETA 4CHYA 4FJXA 4HYKA 4KHQA 1WSIA 2J6TA 3L3UA 3HVRA 4F4ZA 4FLZA 1WSJA 1XSLA 3K57A 4ZHRA 1ZQBA 4O55A 4CJLA 3KLHA 2RPIA 3NH0A 9ICKA 4N56A 5KRSA 8ICZA 1WLJA 1IM4A 4M3YA 5FRMA 4EBDA 1XC9A 3AVMA 3K4GA 2ZTEA 4UB1A 4DSKA 4QWCA 4IR1A 3SI6A 3VQ4A 4RUAA 3M8RA 1NJXA 1T4GA 4FK4A 4BDPA 3CM6A 3Q8KA 2IDOA 2A1JA 3AU2A 3O3FA 1TFRA 2QKKA 4I2DA 4J2DA 4Q0BA 4IQVA 1SV5A 1TK0A 4DQRA 3QE9Y 3UQ2A 4JLHA 4NCGA 2IHNA 1J54A 4EZ6A 4DWIA 2H5XA 4DOCA 4ECQA 1QSLA 3HYFA 1C7YA 3KTQA 2P5GA 1RCHA 3OYDA 4ID1A 1TV6A 5HRSA 2VWJA 4ID5A 3KK3A 3KLIA 3V1QA 1HJRA 4TQRA 1HMVA 1QSYA 4M9NA 4ED1A 5KG6A 5KFNA 4PPXA 4BGDA 5KFKA 7ICJA 4M04A 4RNNA 4N5SA 3PW7A 3ZT0A 3UXPA 4CJ5A 1Q9YA 3RJIA 1EP4A 4M6WA 3F73A 1R0AA 3KD5E 1S1VA 1TL3A 3RJEA 4NYNA 2UVWA 1RTIA 1KSPA 9ICAA 2YNIA 4RPZA 2V4QA 1IO2A 5DQHA 1UT5A 1UWBA 4PHAA 1CZBA 1ZQOA 1TK5A 3C95A 3IS9A 3T5LA 1C6VA 4YP3A 4KTZA 4O9MA 4ECUA 3GIKA 2PFQA 1WAJA 1ZQLA 4CJPA 2F1HA 3TQ1A 2QXFA 4KB0A 4DU4A 3KJVA 4DL6A 3BQ0A 1Z25A 4O5KA 4FVMA 2BQRA 3QEVA 2IOCA 2BCVA 3BGRA 2I1QA 2F1IA 3T5KA 1B22A 3OHAA 1ZQJA 4NCAA 5CZ1A 4FS2A 2HHUA 2BGGA 3HM9A 5JS1A 3KHLA 3MDAA 3VA3A 2ZD1A 5J0SA 4DL2A 1W9HA 3V1RA 3ISBA 3C2KA 3V4IA 3L2WA 4UBCA 3RMAA 1ZQEA 5C5JA 4OVLA 3ZDAA 2OPRA 5HHIA 4RQ5A 9ICNA 4DL7A 1T8EA 4CGIA 4KHWA 3ISCA 2PYLA 3SCXA 1QSSA 2BPFA 1MQ2A 4DSFA 3CM5A 3TR8A 4FM0A 1TK8A 3C5FA 3L2VA 3SUQA 4R5PA 4DF8A 9ICWA 4I2PA 3ITHA 4AHUA 4M3XA 4K8XA 1CZ9A 2X78A 8ICAA 3JPOA 4M3RA 5D3GA 3TABA 2W9CA 3EWAA 2FBXA 5HRRA 1N5YA 4I2QA 3N97B 1JL1A 4YXJA 3QIPA 2G8UA 3NGDA 2LYHA 4J9PA 8ICCA 3MXMA 2UVRA 4I9QA 3P1GA 3LP0A 4FJMA 3TAFA 4DS4A 1VSKA 1BISA 3MBYA 1NK7A 4J9MA 3RRGA 4C8LA 1DTTA 5IILA 3TI0A 2B21A 3EW9A 1WNSA 4L8RB 1A77A 3Q8QB 2BGWA 3PMNA 2RDJA 2IGIA 3DYAA 1WSEA 3GQCA 3CFPA 1DOQA 4K4HA 4FO6A 5EWFA 9ICRA 5KG5A 4W5QA 4CF0A 5IIOA 4CEBA 2HHWA 4FLVA 2F8SA 2A1RA 4FLUA 4B9TA 3GIMA 4B9MA 3V72A 1XHXA 4ECYA 2ZUBA 4R66A 3T1AA 3QNNA 3LK9A 5DG8A 8ICUA 3NDKA 4DO9A 4Q5VA 4QWEA 2BCRA 4BE0A 3LZJA 2G8FA 4BDYA 1BQNA 3VQ5A 2HMIA 4BWJA 2JEFA 4IFVA 4WE1A 4FLXA 4RUCA 1JLAA 5J2GA 2PXIA 1NKCA 2ASDA 5DGAA 4E7JA 4IKFA 1RT4A 1KDHA 3ZCMA 3RJKA 1ZBLA 2X74A 2IAJA 3DLGA 4AHVA 7ICMA 1A5XA 1XWLA 3Q8SB 1YTAA 5EWEA 2JZBA 2BQ3A 3QEXA 4KLOA 4JRPA 4O3NA 1D8YA 1LB2B 3AVKA 5KFMA 3KHRA 1JXBA 2HW3A 4CCHA 5DLFA 1SL2A 4FJ8A 3H40A 2A1JB 2NRTA 4NM1A 4AILC 1LW2A 1XS9D 2X6SA 4CJUA 1WN7A 3MFIA 4UB3A 2W9BA 2IMWP 1VK0A 2DTUA 2DFHA 5KG1A 3RR7A 3TAPA 3AVJA 5J1EA 4CF1A 3OYMA 4GXIA 3SYZA 2QK9A 1KFDA 1ZBUA 4K8ZA 7ICTA 4M3ZA 3G10A 3Q8PB 3AV9A 1VSLA 4FJ5A 7ICPA 5D49A 4G1QA 1PZNA 4F91B 5KFIA 2M9NA 4CEAA 4ED2A 3VQ7A 2FPMA 1RYRA 4QZ9A 3MECA 1U48A 4TSXA 2RDIA 5KFUA 3SJJA 3HL8A 3JPQA 4FS1A 5TZVA 2O4GA 4F50A 5KFDA 2HVHA 4M47A 4BXOB 4CEEA 1ZQNA 3AVBA 2JEJA 2R8JA 3M8SA 3MGHA 9ICXA 3QEWA 2VANA 1HYZA 4F4WA 4AHTA 3U6FA 5J2HA 4F2RA 4EP5A 2AGQA 5E41A 2P5OA 1B92A 4DTSA 4YG2A 2DPIA 1X9SA 1ZQYA 3V6HA 5KT3A 4J2EA 1BPXA 1TAQA 4M6WB 8ICEA 3T3FA 1LV5A 4DOBA 3VA0A 4LZDA 1JLGA 3M9NB 2GWSA 2HHQA 4UAZA 8ICYA 3PR5B 2PFNA 5DB6A 4DQQA 1U45A 1U47A 2V9WA 4GC7A 1BCMA 1Y88A 4RPXA 4RG8A 4PGYA 3CFOA 4DG1A 1S0MA 3K58A 3ZT1A 3NGIA 4CJRA 4W5OA 2G8IA 4HCCA 4FBUA 3KK1A 1IKVA 3GIJA 4O3RA 4F3OA 5KFGA 1CXQA 8ICVA 3SPYA 1RBRA 5CA7A 1RBVA 4NLKA 3QNOA 4KPYA 4Y1DA 1N48A 5J2CA 4J2AA 4F4YA 4R64A 1ZQCA 5J2AA 3QO9A 7ICEA 2OZMA 3KLGA 8ICWA 4JV1A 3AU6A 1TKXA 5L9XA 4ZTFA 1HRHA 1COOA 1L5UA 4CJTA 2W9AA 1GOBA 2VA3A 3LWLA 5KTQA 1BL3A 3LDSA 2W9MA 1BGXT 5KFPA 1BIZA 9ICOA 4LY7A 2DFEA 5C25A 3LAKA 3RB0A 7ICNA 3QLHA 2FLPA 4FJKA 1ZQTA 1ZQAA 4YR3A 2OZSA 4YMMA 4CFCA 3L2UA 2Z1HA 3H7IA 3M8QA 2Z1JA 5SZTA 3K5MA 4CESA 2F96A 2B6AA 5L1JA 1Y97A 3OYKA 1V9PA 1RTDA 4I29A 4H4OA 4Z4HA 4ECTA 4RW7A 3PMLA 4BDZA 4IQWA 5J29A 4CF2A 3C1ZA 1U49A 4E0DA 8ICKA 9ICEA 2Q3SA 4FXDA 5KFSA 4F5PA 3QEIA 3G6YA 3M8PA 4J2BA 1NK9A 2W9CB 3NGZA 4Q44A 2JEGA 3HPHA 4O5BA 3UXOA 1EKEA 5CY4A 5KRTA 5SWMA 1Q8IA 4O0IA 1NKBA 4JK1A 4CEQA 4F93B 2FLLA 3OYBA 1X2IA 4JV2A 4ICLA 4DLEA 3UIQA 1ZQSA 4O4GA 1VSFA 4QW9A 3FDSA 4Z0UA 2YNGA 3G0ZA 3RTVA 4I28A 1TGOA 2G8WA 1REVA 1TVRA 4M9LA 3TANA 1SL1A 4N41A 3JPSA 5J2JA 4FZYA 4IBNA 9ICMA 2RN2A 3PX0A 4KLEA 1RYSA 4C8KA 2HNYA 2BCSA 3NH1A 4F5RA 3ZT4A 3U3GA 4RQ6A 1RDBA 1NJYA 3QERA 4DL4A 3B6OA 2XGPA 4NYFA 2ASLA 5DDMA 4RPYA 1HQEA 5DLGA 4PGQA 4GW6A 1BI4A 4X5VA 3WNEA 4PA1A 3PW2A 5KFXA 2JZBB 3HPOA 3OYJA 4KHSA 5IIMA 1A5VA 5CYMA 1BPZA 4DQIA 4F92B 1KVBA 2HHVA 3V1OA 4CE9A 4CJEA 5CB1A 2AGOA 4XQ8A 4HUFA 2ISOA 4MFAA 4KV8A 3JPTA 8ICGA 4FLYA 2W9BB 1H38A 1RBUA 2MAXA 2FMQA 1KVCA 4W5RA 4FBTA 4O44A 2B4JA 4DU1A 5KG0A 3K5OA 3LPUA 4Y1CA 4KITB 2XY6A 4GXKA 2P66A 2OPQA 1BVSA 4AH9A 1RILA 1Z3EB 4M3WA 1JLEA 5DDYA 4LSLA 1ZYQA 4ELUA 4E7LA 2HHTA 5EU7A 4CFAA 4JS4A 3IAYA 2E4LA 4M3UA 5CJ7A 4GC6A 3UXNA 3OVNA 2XY7A 4UB5A 3V7KA 3GV5B 4Q8FA 1GOAA 4RU9A 3C2MA 3PUFA 3KLFA 3PW4A 5J0RA 4Z6EA 1HYSA 1XU4A 4R63A 2KW4A 4BWMA 3ZD8A 7ICIA 4B3OA 1BPYA 4KHNA 4KLSA 3K75D 4EZ9A 8ICOA 3M9MB 2G8HA 4R8UB 1ZBHA 4PWDA 5J2NA 3T5HA 4HUGA 4OPJA 4JS5A 4YQWA 3WNHA 4RZRA 3NE6A 4Q8EA 4Z4EA 4CEFA 3V81A 4O3QA 8ICNA 3KLEA 4K4IA 1C0TA 1LAVA 4J9SA 4KFBA 2MUTA 4MF8A 5J2FA 5HP1A 1XHZA 5DKWA 4M9HA 3NGYA 2GUIA 4UB4A 3ISDA 3VQBA 3PNCA 4BE2A 3DOLA 5CZ2A 3ZSRA 3HK2A 2P6UA 4IQUA 3OYCA 3K5LA 1JX4A 4JV0A 3JPRA 5DB9A 4CFDA 3AA2A 5EOZA 4IRKA 1FK9A 3V6JA 4E19A 3DOKA 1EX4A 3NTUA 2JEIA 3OS2A 4MFCA 3PW0A 5KGWA 4Z4CA 4JRQA 7ICUA 3OYHA 3LPTA 4F4KA 1B9FA 5C24A 4QWAA 2Y1IA 3ZSYA 8ICXA 3SUOA 2G8VA 2DPJA 3MR5A 4B8CA 1HPZA 5DQGA 4GLXA 1BIUA 3S9HA 1FKOA 5DB8A 4FJ7A 3RH5A 2BQUA 1HJPA 4CIGA 9ICBA 2AQ4A 4I2AA 1TKTA 4B9NA 2B5JA 4CJ3A 1RT1A 3ZDBA 4QCLA 3OSPA 4DLGA 1K1QA 4DTOA 4Z4GA 2R8KA 2ZJAA 3C23A 4CJ4A 1VSIA 1ZQUA 5DMRA 1YVUA 4HUEA 4IFYA 3BQTA 1WAFA 3ZDDA 1CEZA 4KLGA 1TV9A 3AA5X 3AVLA 3DLKA 3LAMA 5DB7A 9ICCA 4DFPA 2G8KA 3UPQA 1CXUA 4ECVA 4AHCA 1MC8A 4YN4A 4OKKA 4CERA 2BR0A 1ZQFA 1RXVA 1D5AA 1JIHA 2ZUDA 2BDPA 3C21A 4M45A 1SUQA 1HYVA 2Z1GA 2ZTCA 3OGUA 4PHEA 1ASWA 4OGEA 5KG3A 2D0AA 4NCBA 2PZSA 5KG4A 5HMLA 3AO1A 2XO7A 2NRXA 4JUZA 1J53A 3SPZA 1TKDA 1LW0A 4P2HA 2I9GA 1DGSA 2BCUA 4RW6A 4CJVA 4FK2A 1ZQQA 2KFNA 2GV9A 4CJWA 4GMJB 4CHOA 2NRZA 4EP4A 4I2HA 3AVNA 2WOMA 4DL5A 5JUMA 1BPDA 3WNFA 4GXJA 3QZ7A 3ORYA 4IRDA 5IIIA 4RQ7A 4QZFA 5J0WA 5BPCA 4NLZA 4LD0A 4EYHB 4M42A 4CF9A 4G3IA 4KREA 1S6PA 3UQ0A 4DTNA 2PFOA 3TAQA 4UAYA 4QZCA 3CFRA 2ITGA 3NAEA 5DQIA 3OYAA 4YFUA 1ZQKA 3S3MA 1BI4B 4RNOA 4HCBA 4GVMA 4CEZA 3LDAA 4ED3A 4QZGA 9ICHA 1KVAA 4AHRA 1ZBFA 1KEJA 5KFEA 4RW4A 5KFHA 7ICFA 3ZSOA 3DRSA 3O4NA 2UVUA 9ICSA 4LVSA 3OY9A 1VRTA 4B8AB 3VQEA 2Q0ZX 3SZ2A 5F9NA 3VQ9A 3LP1A 3S3OA 1CUKA 2R8IA 4B08A 2JGUA 1IKWA 4J9RA 1IKYA 2BE2A 2FPLA 4LH4A 3K59A 3SV3A 1VSJA 3SQ0A 3LZIA 1SKRA 3P83D 5KG7A 4PY5A 5KFFA 4MQ3A 1ZQGA 3WNGA 4ED6A 2KZ3A 1LAWA 1S1WA 9ICGA 5IINA 4YD1A 2ISPA 3ULDA 2ASJA 4E7HA 4NLNA 4F2SA 5KFJA 1RBTA 5HHHA 1NOZA 2P51A 3NCIA 1T3NA 5T7BA 1JN3A 3HVTA 3T19A 1NK8A 1IXRA 3ZSWA 4E89A 2AU0A 3L8BA 5CWRA 3ZSZA 1LWCA 3PO5A 4FJ9A 3PX4A 7ICSA 4DU3A 1L3UA 4DQPA 1C0MA 2VWKA 1BCOA 3C6UA 4DOAA 4DTXA 8ICSA 2LSNA 3MAQA 3I0SA 1D9FA 2FMPA 7ICGA 4FJHA 4KN4A 3I8DA 4KRFA 4FJNA 5DBBA 3DLRA 1S9FA 4C8OA 4M9JA 3HO1A 7ICOA 3QIOA 1JXLA 1ZJMA 1G15A 2FBVA 3GIIA 2XY5A 2MUTB 5L1KA 2PY5A 4LSNA 2YNHA 1NK4A 3SI8A 3GV7B 1ZQRA 2OPPA 4I2BA 4KAZA 1FXXA 3GDXA 1S1TA 1HUOA 3OYIA 4W5TA 1YTUA 3E01A 3LP3A 4W5NA 3AVCA 4ZTJA 1UOCA 3JYTA 4TURA 4FK0A 4E3SA 4O3PA 2C2DA 1S77D 4F4XA 5J0PA 1U04A 2KZMA 4CEOA 3PVXA 2AJQA 1QS4A 4DL3A 1L3SA 4I27A 3SUPA 1VSMA 3SQ2A 1ITGA 4QZ8A 3TAEA 3H8SA 4KMUA 2ZE2A 2A1SA 1WSHA 4RNMA 5KFQA 1D8LA 3MABA 4IG0A 2KN7A 4N76A 3B0YA 1N6QA 1HUZA 2GBZA 5J0XA 2FBTA 4Z4IA 2BKEA 4DTPA 4DSIA 4Q43A 2ALZA 3GILA 1TKZA 1EXNA 1NJWA 1XSPA 3AO2A 3NH2A 2RF2A 4QZIA 5J2KA 9ICJA 1RT2A 2W8KA 1UA1A 2PFPA 1C0UA 3C94A 1BPEA 2Z1IA 4YR2A 5D4BA 1VSHA 4UQGA 4IRCA 3OYFA 3MR3A 3RMDA 5BOLA 3H8JA 4I2IA 1T05A 4NY8A 1HNIA 4FLTA 2VG7A 1QLNA 1ZQXA 4N47A 2XC9A 5CR0A 4FLWA 3HP6A 2HHXA 5J0OA 4B9LA 9ICUA 3AO4A 2D0BA 1UAXA 1X1PA 1WSGA 3V9SA 5KT4A 1ZBIA 1XSNA 4Z4FA 3EZ5A 2HB5A 1TL1A 4I7FA 3AUOA 2P1JA 8ICPA 4EBEA 3RB3A 3EY1A 4Z6CA 4P4OA 4MFFA 3V6DA 4M9GA 3SUNA 2V4RA 1KFTA 1HQUA 1Q9XA 3V9ZA 3RB4A 3OS0A 4PHPA 4F3TA 4KLFA 2OA8A 3RJHA 5L1LA 1BQMA 2X6NA 3ETLA 4Z6FA 5KFTA 5CHGA 5J0TA 4FCYA 5KFBA 4IDKA 2KFZA 2WTFA 5J0YA 1W0HA 4J9NA 9ICQA 7ICKA 3K2PA 4YNQA 4ZH4A 1S0VA 2BANA 3BDPA 3DRPA 3H08A 4CJKA 4XA5A 3HT3A 3OYLA 1LWFA 1GOCA 2DY4A 3VQ6A 3RMCA 2P6RA 3ZT2A 2NRWA 1A76A 4OKJA 4QZAA 2W8LA 4E7IA 4O5CA 1JLQA 4FJIA 3MR6A 4DS5A 1JXEA 4ECRA 4EEYA 2FBYA 3VQPA 4CEDA 4KTQA 3HW8A 3OYGA 3HSTB 4QZDA 4FZXC 4RW9A 2W42A 2QKBA 5J2PA 8ICIA 3V7LA 3ZD9A 3ZSVA 4O3SA 4YMOA 3KD1E 1S10A 4IG3A 3SNNA 1NKEA 1NK5A 4RQ0A 1QE1A 4CGJA 3H4DA 1B9DA 1UA0A 3U3YA 3THVA 1EXQA 1T03A 2IHMA 5J2QA 8ICFA 2NUBA 1T7PA 4CGDA 3RMBA 3GFKB 4TQSA 8ICLA 4PHDA 4M0AA 3PW5A 1ZJNA 2NRVA 1S97A 2BPCA 4FYDA 4B9SA
chains in the Genus database with same CATH superfamily
1S1WB 3QETA 3PXGa 3TAMA 3AD7C 2Y9TA 4YOYA 2FVQA 4CF8A 3G6VA 4DR4J 3PM9A 4DTUA 4WQ5A 2ADBA 2V2QA 4P10A 2EAMA 5K8NA 4YB1P 2EFGA 5AK4A 2XZWA 3HVTB 2PI4A 3GIRA 7AT1B 3B0XA 1VLOA 4DTRA 3L3VA 2M8DB 1Q79A 3DDHA 5GVQA 1LK5A 1OUQA 5LXYA 3V9WA 1FE4A 5FDLA 3QEPA 5HJXA 1HUXA 4WF9Q 3AA4A 3AD9C 2FUG9 1BOTO 1H73A 1WC4A 4NXZA 2GWJA 4C2MA 3U9ZA 2CIMA 1R59O 1IBMK 1Q78A 5HMZA 4TY8B 2FPKA 2AEFA 4KLIA 4FJGA 2ATLA 2DNGA 1PG5B 3CO9A 3S3NA 1LOUA 5BPMA 3NMAA 5FD1A 1IIPA 2W7OA 4P4MA 1KQQA 2KIWA 2YH0A 3QT8A 1SI9A 4MFBA 1FFGB 3DGVA 1U8SA 2XRIA 4DV2F 4HACB 1DARA 1YRUA 3NRWA 1WHWA 2PT0A 4ES1A 1X5TA 4ED7A 3HKZD 5AHXA 3S8SA 4TUSA 4M5GA 4PG7A 2BZFA 1RBAA 3ALYA 5JLFA 4NYZA 1RDCA 3BP8A 3IKMA 5D77A 1P8GA 4CF4A 3JS9A 4X4OA 2Y0BB 3PV8A 2Z58B 2JHDA 2VWBA 4P74A 5KFZA 3DCAA 3NVKA 3CULA 4DI6A 2ZE2B 5I42A 4JI7J 3D2EA 2HF4A 3CCSS 2KT3A 2XGQA 3OVBA 2ZH1A 2KB2A 2CQPA 4CLSA 2ADCA 4H5NA 2E7WA 3QESA 4KPCA 1ZS6A 3IBCB 4DZDA 5E5NA 2KDOA 3MGIA 1FA0A 1VS3A 4EYIB 1XQIA 4OZ5A 3F41A 3RBEA 5IT9U 2R2UA 1K1SA 4WKRA 1RHJB 1Q7YT 1HNZF 3W3SA 4USTA 1SKWA 3MTKA 3NKYA 1L3VA 2DYAA 2ZFHA 3D0PA 4YY3K 1CC7A 3O08A 4FE3A 3C15A 4ITSA 5JLHA 1QVGR 1SV0C 1XNRJ 4I1TA 1DQ9A 5ALLA 1IG6A 2XMMA 1DZ5A 3PY8A 2WB1F 3W2WA 3AARA 2E1FA 1RT5A 2HYIB 4PQUA 1R6VA 4OJ3A 3IO1A 2M3DA 3NBPA 2WSFC 2IJNA 3BQ2A 4I7FB 4OKEA 4A8QA 3KUEA 1NK0A 3M6VA 3OFGA 1TL7A 2O66A 3MFHA 1IKXA 5KG2A 4N7TA 4CK2A 1SZPA 3IRXA 3CMEN 1SBRA 3R2CJ 3CYMA 3W66A 4KB7A 1S9EA 2OPSA 2IVMA 1K6YA 2EK6A 1QQ5A 1VSDA 2WF9A 1FVQA 4ZKAA 3AVAA 2CJXB 3VQ8A 5KI6A 1EQ0A 2N7YA 3N4MB 5HLFA 4LIWA 3RB6A 1CQMA 1M6YA 3BBFA 3CJTA 4DFKA 3AVFA 2IBKA 1I94J 1SVDA 2ZUCA 2LP4A 1H98A 4WIIA 3LANA 3SSSA 4B3MF 4WQ5C 2NO4A 2E8NA 3DXKB 3F56A 3ETOA 4P0QB 1WCLA 3S7RA 1N33K 2XO6A 5A8RB 2MA1A 4H8KA 1X4GA 4RW9B 2Y0SF 1UEVA 1HIWA 1JLCA 4EIAA 2IRUA 3C8YA 2BJ9A 4FSVA 3HX0A 3OR2A 4JWMA 2I5JA 2V34A 4IG3B 3WK9A 4HT5A 1CBKA 2MSNA 1RBOB 3Q8LA 1BNPA 1QE1B 3EPGA 1F5AA 3BSAA 4FZMA 3OR1B 3J7Z5 4KR0B 3B54A 3P5JA 1AA1B 1T03B 3C28A 5J2QB 2IHR1 3BZCA 4DSEA 3ZYYX 3AT1B 4NZ0A 1RHRB 3P96A 2D0CA 4OHZA 4JBCA 1N34K 4V19X 5L1IA 4WFNL 1HBNA 3HSDA 5F9LA 2IS3A 7ICVA 5B7WA 4U8YA 2Q31A 2FMSA 2BPGA 4ED0A 4PAAA 1BHLA 5DG9A 3QNWB 3JAMY 2HK3A 4K4ZA 3NGKA 1KCFA 4YVZA 3DAWA 3F2CA 3KZXA 4QJFB 1FERA 1U9LA 1YF5L 4Y65A 3GJSB 1YKWA 5CD4H 4XRHA 3KLFB 1C1AA 3MXJA 4PHTX 2ZM6K 2YWGA 4GVLA 4X65K 2CH5A 3O1WA 4RNHA 1ZQZA 4LZGA 4BJQA 4QOTA 1NM1A 1VIXA 4DTMA 2QYCA 2DEJA 3VQDA 1OWXA 2A3ZA 2PDAA 5EHHA 2K4HA 2VYPA 1RDUA 4DFJA 1ZA2B 3V81B 3FYHA 3D45A 3G25A 3IGVA 2LQ9A 3QNMA 3C65A 2F8TA 4R8UA 4B1WB 5BR8J 4O3MA 5I3UB 2J6UA 4C7QA 3B6PA 4O23A 5CHCB 4HHJA 1H6KX 1FEZA 2RHQB 1HLWA 4BR4A 2AX0A 3D4JA 4WZMA 1JLBB 4KLTA 3PCOB 2QE5A 3UR3C 2MEWA 5HROA 2HNZA 1X40A 2AJ2A 2P9CA 1YBAA 3N79A 4BRCA 3NF9A 2EFVA 5CP2A 5KFCA 5A6WA 2N7CA 3LP2B 4ILGB 4RNFA 3LALA 4CWBA 2QARA 5BN9A 3QGHA 4US9A 2I5HA 4RQ4A 1FRJA 3CJ9A 3L6QA 4JP8A 4WP8A 1DGKN 1EZZB 1T9XA 3UNYA 3W9JA 2DHSA 1ITPA 2EFNA 1I5OB 1X4FA 4CO4A 1FF2A 1T02A 4PG4A 4BE1A 2YKMA 4FW1A 3MXIA 2GX8A 4QNLA 4WIQA 3O80A 2KVCA 4ISFA 3MEGA 4CK3A 1ASVA 3CD6S 4KB1A 1RADB 4C8YA 2AJ0A 3ZFVA 5L38A 5LXRA 1BUPA 1SC4B 4QZHA 3IM1A 3JSMA 3H46O 1YIJS 4CLLA 2QSFA 3I56S 4HR2A 3A4TA 4FM1A 1J5OB 3D66A 4N8OA 5CYQB 3AQEA 2VPWB 4RT3A 4J9OA 1RNHA 2KTQA 1ZD3A 4HTUA 4C8NA 1X9MA 1KOHA 3PSPA 3VMFB 4M3TA 4OCZA 4MK7A 2ZQBA 5IT9Y 4DCCA 3K5PA 3NHGA 3CCEN 3ZZ0A 2HOIA 3DLLL 3VQSA 1U1MA 3KKAA 5GAEP 1CLQA 1L3TA 3HZEA 5C42B 4ALZA 1NAQA 2LFVA 4DX8H 4F04B 1LVHA 2R18A 1MROA 2MZRA 4RJVA 3CW2C 2ZGYA 4BRPA 4R65A 3ENVA 2R8GA 3H4BA 2QL9B 4DMNA 4LQ9A 5DBAA 3QYYA 4ZCMA 3OVSA 1UWAA 3R8YA 4YR0A 5K14A 1HI1A 4BVOA 3B4MA 1ZM2A 4QR2A 4K4GA 4CH0S 3OBYA 4KLDA 2VG6A 4X62K 1KBUA 3GONA 4CHYA 1X3NA 4CM0A 2MQNA 5A8WA 4DV0K 4OZ1A 1F9EB 3HVRA 3K0SA 1ZPVA 4JI5J 3RUBL 1XSLA 4B3RF 3ZX3A 3CDWA 3K57A 1TUUA 1ZQBA 1MWKA 2RPIA 5AQQA 3A8JA 2IVYA 2VBZA 4IO9Q 1ACMB 1RWOB 4LQ3A 2FJAB 3SSRA 8ICZA 2GHPA 1WLJA 4M3YA 1KNZA 2EBEA 1XC9A 2HNDB 2HS0A 4UB1A 2YHWA 4QWCA 4ES2A 1W2BR 3VQ4A 1WWVA 1FKPB 4BDPA 2A1JA 2A42A 4OV1A 4AXIA 3KWGA 3CETA 4FXWA 2WC9A 2YVSA 1CJVA 4I2DA 1T94A 4U9RA 2ZOFA 1VQPS 3CDUA 2YKNB 4UAVA 3J7ZO 1PC4A 5AXLA 4KH5A 1AFIA 4JLHA 2VCPA 1HNXK 1F3VA 1CJTB 2IHNA 3DNCA 3PFEA 1J54A 1XMQJ 4JI8F 3MX5A 5L46A 1GLDG 1JNRB 3C7NB 1MWMA 1ZPWX 1JKHB 1F0MA 1RCHA 3OYDA 4ID1A 1TV6A 2BMBA 2CGLA 4ID5A 3KK3A 3KLIA 5IOLA 1FNXH 3KK7A 1HBMB 5LM7E 1HJRA 5AI6A 4WFXA 2XS2A 1S4FA 2CGJA 4AM6A 4CW7B 5M1PA 5HL7Q 3H90A 4OIXA 4PPXA 2FJXA 1WTFA 4FPRA 3I33A 3CC2S 3E8OA 1Q9YA 1F9FA 1MWQA 3WKCA 1QZ5A 4JN4A 2RUSA 4BREA 2NREA 2EEYA 3I9V9 3IWLA 2H51B 2ZIWA 9ICAA 1RKJA 3UKRA 1IO2A 1UT5A 3V2UC 4CTAA 4D3GA 1TK5A 3IS9A 3C95A 1Y7PA 2V7ZA 3MN9A 1LFPA 3T5LA 2BYCA 2OMLA 2RQKA 3HHEA 1EKRA 3PTWA 3VVTA 4YORA 3GIKA 1WAJA 1ZQLA 1RT6B 1RSCA 3NS6A 2P9KA 5JRTA 2W55A 4TU8A 3CF5L 1Z25A 1WWUA 4DU4A 4O5KA 3DMJB 5HATA 1DEJA 2HIQA 2XMTA 1B0PA 3KKAC 4IG0B 1HNXF 2Z57B 2DBBA 3HM9A 2PEHA 2WFBA 3H0PA 3VA3A 4X4UA 5J0SA 2ZJPL 4CYUB 1NMNA 1VHXA 3V4IA 3L2WA 3RMAA 2AH5A 3ZDAA 1RT2B 2DH8A 2W4PA 5HMYA 2K06A 9ICNA 1H72C 1C1BB 2VFUA 2BPFA 4DSFA 1I51B 5L9NA 1TK8A 2K4EA 3UD5A 3WK7A 3CCSN 4R5PA 2A41A 9ICWA 1GO3F 3KD3A 1G1XA 3MEKA 1UFWA 4CGZA 3JPOA 2QTWA 5HOOA 2LMIA 2W9CA 3TABA 2FBXA 3UD4P 3GYXB 3QIPA 4J9PA 3V6DB 1RLDA 4BC9A 2WF6A 2IVFB 4I9QA 3P1GA 4B3TF 4FJMA 4C8LA 3TI0A 1F2HA 3W2VB 4LF6F 2BGWA 4X2BA 2OEKA 4LF4J 1S8OA 2W6LA 3DYAA 4J90A 2IGIA 4X66F 3GQCA 2YQ0A 2JLGA 3CFPA 1DOQA 1VQYA 3NGTA 5EWFA 4U67Q 4W5QA 1RBLA 3ULEB 3DRPB 3E9OA 2GVDA 2Y9UA 4CEBA 2Q97A 3UKUB 4ECYA 2ZUBA 4LBPA 1JUDA 5JXSA 4R66A 2WB4A 2OI2A 1N61A 3TTCA 3LYSA 2UUCK 1VJWA 3WDOA 2BCRA 3RAMA 3LZJA 2SXLA 4YB6A 1DFDA 1WELA 4B1UB 2PN6A 4BDYA 4X64K 4ZHRB 1E6VA 2L9WA 3R97A 3US5A 3KLHB 4BWJA 3M8WA 3Q89A 1JLAA 2K3KA 1K8AO 2MYFA 4P72A 1KDHA 5AI0A 2ZIVA 4YOTA 5ALGA 4NASA 2X74A 2I6XA 1YWXA 2KD1A 3BR9A 7ICMA 3MAHA 1A5XA 3Q8SB 2P6SA 5I3QA 3SAFA 4A46A 1WDDA 3QEXA 4A61A 4FF1A 1D8YA 5LJ3Y 4C3KA 1SL2A 4EFAC 4FJ8A 3H40A 5I4MA 1TR0A 4NM1A 1WC6A 2CPHA 2OD4A 1N36F 1T6CA 3ZX0A 1ZZNA 1LW2A 1XS9D 2CYYA 3C6HA 3SIPB 2J4RA 3WXIA 1ZM3A 2WAQD 3MFIA 2NR0A 2DFHA 5KG1A 3RR7A 4F72A 4Q0BB 5J1EA 3OYMA 1NG9A 1KFDA 2QA4S 2OLWA 2ZH5A 3SCKE 3Q8PB 3VTIA 1VSLA 4FJ5A 1PZNA 3C66A 4F91B 1LKYA 4CEAA 4H4KA 4DV5J 3QYPA 2JWNA 4CIOA 2KXHA 1U48A 5KFUA 4BRIA 3HL8A 3PSTA 5LJVA 3M2UA 4GKJJ 1NB2A 5TZVA 3OTOK 1J5EK 4OFZA 5DM7Q 1X8DA 4DR7F 4EEKA 3NVWA 2QA4G 1IVZA 1G99A 4JKHA 4FWRA 4EX6A 1HYZA 4X4VA 4EP5A 2VG5B 1MWYA 3KOOA 2BE7D 1YRTA 5G5GA 2UUCF 1B92A 4YG2A 2DPIA 3TO8A 3BN7A 3LUYA 1ZQYA 3PDNA 1B99A 4HHHA 1BPXA 4X64F 1M5HA 1R0AB 3PYFA 2QX0A 2DF4B 3VA0A 1TL3B 3M9NB 8ICYA 3G87A 2FSKA 3FFIB 4K5SA 4CP5A 2G06A 2VHGA 4RPXA 2CNLB 1N5QA 2EAOA 4K50A 2YNIB 3K58A 2EZZA 3ZT1A 2MHEA 1O08A 3L3CA 1UWBB 3CJ8A 2DQNB 1IKVA 1Z2LA 4OX9F 2AW0A 4O3RA 4ZPWR 5F0UA 1CC8A 3MM8A 3MM7A 5CA7A 2FJEB 4NLKA 4I0WA 1VJQA 3QNOA 5AQRA 3QFHA 1Y10A 1T0TV 1AW0A 5J2CA 2MKKA 2AYGA 4J2AA 5DO2A 2Y9HA 4Y2AA 2AKWB 3DGPA 1RHUB 3AU6A 5BYRA 4K2JA 5L9XA 1WI8A 4KE5A 1COOA 1L5UA 4CJTA 2BW2A 3I0RB 2VA3A 1NH7A 3O6QA 4IH6A 4LFCJ 2LYBA 3IN5A 4ZPAA 1NGAA 1KBRA 3LAKA 4QR0A 1ZQTA 5IV3A 4C9DA 2W1BA 4X4QA 5ALSA 4CFCA 5EOYA 3H7IA 2WHEA 2EG2A 2YKQA 1E6YB 2H5JB 2EC0A 4CESA 2KO1A 4LJMA 2JVRA 1ZTWA 1RTDA 1N32K 4JYAK 1WC5A 3WIVA 3OL9A 4I2PB 4CF2A 3C1ZA 4E0DA 2WMMA 5AXMA 4Z94A 4KH1B 4JOUA 3QEIA 1O51A 2IMOA 1WOPA 2BJ1A 3ZTSA 1NK9A 3EDRB 4NA3A 4ZS6A 2EW9A 3HVAA 4CRXA 4HT7A 2B43A 2ZBCA 3LPEA 2MY8A 4O5BA 3UXOA 1EKEA 1BD6A 2J9CA 3LP0B 3CERA 5SWMA 4CLUA 1DTTB 1NKBA 4JK1A 3BF4A 3O1BA 3EZOA 3QIDA 3F2KA 4CEQA 4FWKA 2HFSA 1X2IA 2GO7A 5D6GA 3IM9A 3W63A 2I8EA 2QM1A 3I56N 3KK2B 4DX6A 1S6UA 2IBOA 4QW9A 3N5FA 4Z0UA 3NRBA 4I28A 2ZBQA 3VETA 5C2CA 1TGOA 2FZCB 2Y1LB 1X60A 4H4KC 4QYZK 8AT1B 4PZOA 3PKYA 3VALA 4ANEA 1RYSA 1V6HA 4J03A 4C8KA 2BCSA 4F5RA 4XO0A 3U3GA 4DR3K 4RQ6A 3QERA 3NS5A 4IFVB 1I6JA 2FYXA 3DXKA 3WX8A 2UXBK 2ASLA 3THYA 1Q4RA 3MMAB 1PUZA 2WK4A 2ZBRA 4X5VA 3WXLA 3CT9A 5BRDA 1JNZB 3P39A 5KFXA 2JZBB 3H5YA 3OYJA 3IG5A 2D69A 3KVGA 1N32F 1IXKA 4DQIA 5AFUA 4F92B 1KVBA 2HHVA 1YX2A 2RQ4A 1SQKA 2F40A 3MF5A 3CDEA 1CLFA 1NPRA 3SQGB 2H3GX 4LFBK 4HUFA 4MFAA 3BO2A 1YGYA 3JPTA 1RAHB 4OHYA 3CP8A 3EMTA 2N4CA 2FMQA 1ATSA 5C2GA 3NGRA 4L6V3 4DV7J 3RBXA 2WVCA 3TYTA 4LRCA 4JKGA 3LPUA 4Y1CA 2XY6A 4GXKA 2P66A 2NXCA 3AJ1A 2NUHA 3MECB 1WSRA 1N60A 4WFBQ 2C3OA 3W65A 4Z7CA 3HRGA 4ID8A 4YOXA 2VODA 1KC8T 1J2MA 4JS4A 2O3DA 3IAYA 2E4LA 1ATRA 2YMPA 2G09A 5CJ7A 4PG5A 4GC6A 2W40A 2XY7A 3DM2B 1VQ4S 3GP9A 1U09A 3KG0A 5AQOA 2XI2A 1VQPN 4Q8FA 4RU9A 4DR2K 3C2MA 3KLFA 5K5MA 4KKOB 3EUB2 4KO0B 2KSOA 1S57A 2H3VA 1HR0J 4KGMA 3T1YJ 1NGFA 1ZBHA 2DGZA 4DR3F 2DD8S 2G5HB 2J7KA 1FRLA 4QU7A 4ZVGA 1JLGB 3G8SA 2UXBF 2ZWPA 5M2RA 2J0SD 3V81A 8ICNA 3MCAB 1V5VA 2YMMA 2YX8A 4K4IA 4UY85 2DNQA 3W3DA 1NU4A 1ZM4A 2MUTA 4O8KA 4FZNA 3KK1B 4B1XB 1DY3A 3VGSA 4UB4A 3PNCA 4WXOA 3QRPA 4JI0J 3CC2N 5BPLA 3UMGA 3ENQA 3OYCA 1WB9A 5DB9A 3KBBA 5EOZA 3H20A 5ETLA 2E1PA 2XMKA 4TN2A 3NTUA 4NLYA 4DV4J 1K8KB 2Z2MA 4AF1A 2ROGA 4CF3A 3F53A 3GB0A 2Y1IA 1HPZA 2WVEA 1YI2N 3GYNA 1FKOA 1M90O 2LU2A 4USUA 1BG3A 3VEWA 4CIGA 4DUZK 9ICBA 3KJQB 1QUPA 4LR8A 4ANCA 2DL0A 3BF3A 4RBVA 2HZVA 2V8VA 3M8QB 2P9UB 3OSPA 4DTOA 5IWAK 2V8PA 1RTJB 3FZBA 4IKAA 1F6TA 1X4HA 2ZZTA 3BQTA 1G3OA 1AZSA 2L5YA 4ILRA 1CEZA 1JLFB 2CPFA 1TV9A 2JH7A 2XHCA 9ICCA 1VQSA 3UDLA 1CXUA 4YN4A 4CERA 1REGX 1FFVA 1RXVA 5LL6Z 2F44A 3CDBA 2RD5C 1TUVA 1YZ6A 3M1VA 3AY0A 2VKRA 5KAFU 4PHEA 1HIYA 2P8IA 3IAM9 2PZSA 2YJEA 5KG4A 5HL7L 3HSGA 3SPZA 3PIOQ 4AL6A 4M5DB 4PR6A 2ZG6A 2XMWA 4FK2A 3QU5A 2HS3A 4EP4A 2RMLA 3GBTA 2BJ3A 1BC6A 1GEHA 4OI6A 3AVNA 4DL5A 3S6JA 5JUMA 1HEKA 4Q2LA 4DBQA 2O8BA 4NMXA 4OJ6A 2OP5A 3MPWA 3CCJS 1JJ4A 1HBOB 3HHLD 3O4WA 4FXVA 5EXWA 3WKDA 5KNIA 1XC3A 1HQEB 2HLUA 4P7TA 4DR4F 3OYAA 1ZQKA 4DOZA 1BI4B 4UW2A 2KH9A 3AOCA 4C0HA 3LDAA 2EFPA 1KVAA 2BUPA 2JC0A 1IWAA 1V9OA 5CYMB 2GO8A 3CD5A 5D0RA 4C11B 4ED4A 5CABA 2QTDA 2DHHA 3BZQA 4KGKA 2Q0ZX 5F9NA 4AD6A 1HJOA 2JGUA 3NMUA 2JWKA 4U96A 2EFOA 3EZWA 1PJ7A 1F44A 2BE2A 3K59A 1F5SA 4ZCKA 1XNQJ 4MAKA 4ZLLA 4DR1J 4RWTA 5DM6L 4K4SA 4PY5A 5KG7A 3ENBA 1FWLA 4MQ3A 3MWTA 1K9MT 5GINA 2W03A 1YXQA 2IIRA 4Y0WA 4YOVA 9ICGA 2UUAJ 4GVBA 3WZ0A 3ULDA 2I2YA 1D1UA 4DUTA 4A2BA 2L3MA 4F2SA 1SJFA 4BCAA 2ZIUB 1GAOA 1G4CA 2Z2YB 4JI1J 3FZLA 3NRZA 2P2CB 3B8HA 2J8SA 3T19A 4FF3A 1NK8A 2HBJA 3G96A 1HNWK 3AEVA 3ZSZA 4B3OB 1HBMA 1K0VA 4ZPVR 3OHRA 3PO5A 7ICSA 2F1FA 4DQPA 4PWDB 5J2NB 8ICSA 2YTUA 1VLYA 3MAQA 4JI7F 7ICGA 1MW7A 4FJHA 3I96A 5BYSA 4KN4A 3I8DA 3THPA 5DBBA 2KYXA 2ROEA 4I56A 1D9AA 3KHYA 3QIOA 1FIQA 3W5YA 1ZJMA 3O9UA 2LI6A 4YN3B 4MK9A 2FBVA 4JK7A 4IO8A 3BGLA 4U67L 2G08A 1R8HA 1Z1BA 5K8MA 4NEZA 4LSNA 1U0SA 1QTNB 3SI8A 2RRDA 3C3LA 2PY5A 3Q22A 3GV7B 1ZQRA 4DN9A 1KHWA 3A8EA 1NWKA 3GDXA 1YQHA 4F26A 1DXSA 1KHVA 3VAJA 4W5TA 2V94A 1Z19A 4C0OC 1FDAA 3LP3A 1X4AA 1FCAA 4WYLA 3EXCX 3I32A 5IT0A 3TADA 1C4AA 1FK9B 3BGRB 1FW6A 1XNRF 4E3SA 4F4XA 5J0PA 3WT0A 2JH1A 3POTA 1UVLA 4CEOA 3PVXA 4OJOA 3L4PA 4NL9A 2YKAA 5IXUA 4JKCA 5AQXA 4I27A 1VSMA 1CRXA 4QZ8A 5CYJA 1NPKA 3MZIA 2A1SA 2GEMA 4RUBA 1D8LA 4IG0A 3GTYX 1YDLA 5G4DA 3EGVA 3B0YA 1BE4A 2JHEA 2FSNA 4JV5K 2E7XA 5ADZA 1BHNA 3NGUA 4DTPA 4A48A 9ATCB 3D6HB 2GX9A 4C4WA 1EXNA 1NJWA 1XSPA 1GNKA 2ZJQQ 5TKYA 5AM5A 4OI1A 3CWJA 4BC2A 1RT2A 1HNWF 3A12A 2H1YA 4UUWA 2DR9A 1P27B 3C94A 3ED5A 2Z1IA 4R25A 2BH1A 4JI3K 3S1TA 1I94F 3C2PA 1VSHA 2AX1A 4DHVA 3R6LB 4IRCA 4IFYB 3OYFA 2ZH2A 3MMCA 4NY8A 3D6FB 3FBBA 4FLTA 2VG7A 2CQIA 4DR6J 1QLNA 1ZQXA 2XC9A 1DKGD 3N28A 4KGZB 1Q81O 3HP6A 2XG8A 2ZDPA 2M4MA 2HBMA 4JKDA 3V9SA 1TFYA 5DM7L 5JVGQ 1ILYA 4Z4FA 1U25A 3D1OA 3ZLJA 3UCUP 3M6WA 2HB5A 1TL1A 4URQU 2N82B 2CJQA 4NRUA 4EO8A 2I38A 4Z6CA 3HMJG 3DXSX 3V6DA 3K8VA 2O01C 1KFTA 1H0HB 2HSTA 2OA8A 2VC1A 1OQ6A 1PVPA 4Z6FA 3W2VA 4FCYA 1T9UA 4USKA 2KFZA 3DN9A 4PL7A 4RWXA 1R8CA 3M6KA 2OMOA 1YAGA 2XICA 3K2PA 1B7YB 4ZH4A 2BANA 3BDPA 3FE1A 3DRPA 3R7SB 3H08A 4WWSA 1WC0A 1EB0A 4ZOSA 3M2RB 3CJKB 1BQNB 2U1AA 3VQ6A 3RMCA 3ILOA 3CC4N 1A76A 2GV1A 1Q5YA 4E8UA 2BUNA 2R7TA 1B64A 3EICA 3I6PA 4G1IA 3M1YA 1EKSA 1IBMJ 3G4SS 1RT4B 1PIEA 2XWXA 4CEDA 2DTJA 1YSJA 3OYGA 4USIA 3SQIA 3NS7B 2BDUA 3TVKA 2P9SA 3N0VA 5IFMA 2W42A 4KHPK 3U7JA 3NNAA 5J2PA 8ICIA 3ZD9A 3ZSVA 4Y2PA 5EDWA 2CQDA 3F5EA 4LF9K 2PFUA 3SNNA 1NKEA 3ALRA 4LF5K 3QFPA 3IR5B 4PKGA 1N5TA 3LP1B 5HQMA 4ZITA 4G1PA 1HL6A 1IKWB 1Q46A 2H4YB 5AI9A 5DETA 4CGDA 4AQYK 4K4TA 2OTJN 3GFKB 4PHDA 4M0AA 4Y2VA 3DHWC 5BR8F 5AKIA 2NRVA 5ALQA 5KPZA 3N4QA 2BPCA 5HQLA 4FYDA 4BR9A 4AL5A 3OYEA 3H7HB 2G0CA 5DGBA 4QPXA 3RR8A 5T7LB 4DFMA 5H1SQ 3TADC 4F5OA 2RB7A 2J9DE 4DPWA 3ILJA 4EFHA 1RXWA 3UN5A 2QG9B 4KYZA 7FD1A 3ONQA 4NL9C 3FEXB 2J8AA 1SL0A 4J9KA 1KFSA 4KN7A 1QHTA 2E6LA 3RF9A 3CDAA 3AOAA 1E3MA 4CQ1A 5KFWA 3AH6A 4YY3J 1HBUB 3GLJA 1K47A 3C6UB 4NO7A 1NSKL 3A0BU 1RWVB 3N4WA 2VG5A 4TLRA 4MEYA 4FOIA 1X0FA 3J7AN 4MIBA 4OZ2A 2CAJA 1O03A 4ZA1A 3TA2A 3RBDA 4KLQA 4DZ6A 4QZEA 2KQ2A 2NUUG 4DG1B 3HOTA 1PKUA 1KD1O 4KHPF 3OJSA 2DEIA 3VTHA 1VQ4N 2O67A 4Y34A 2V9KA 1UPHA 1T3OA 3FFIA 2OPPB 1NOMA 1Y3KA 4IOCQ 1J9AA 3OJUA 3N6NA 1OH7A 4MYUA 1S1XA 4TU9A 3C2LA 4CGGA 4P0PB 3TAGA 1PAUB 3NWRA 3QINA 4YMNA 1Z4UA 2JFKA 4Y2JA 3MDCA 1XERA 4MJKA 3MD1A 1C1CA 2G9OA 2JV3A 3DLJA 1WHVA 3O3LA 1UJ4A 2LXIA 3C14A 4F67A 3AVHA 3H2LA 3D3CJ 1X9WA 2KG0A 4IS7A 3QLHB 5FRNA 4WBFA 3FKBA 3DLBA 5CH7B 1RDAA 3SENA 3AB4B 1ZD5A 1N6QB 3UNGC 3I0RA 4K8RA 1N33J 3WKAA 4YD2A 4TUQA 2EPIA 1S76D 5F8NA 4NZ7A 1TKZB 4FFDA 5LT5A 3M8YA 3D2FA 1U1OA 4K0KK 4E1JA 2PD1A 4I2EA 4C4TA 3J7A1 1ZQIA 4RW7B 2E44A 3AA3A 2HFVA 4DU8A 4ECSA 3L0QA 3EVWA 1M1KT 3ISND 2KG5A 3MCNA 2CH6A 5M1KA 1XK8A 4QAGA 2CRXA 4DF4A 3F5TA 2MKYA 2ODGA 4WFBL 2VPYB 2QLJB 2UVVA 4JI5F 3BR8A 2D4WA 4JB3A 2D3UA 3O3HA 1N34J 2E5SA 3JPPA 4YCXA 1Q5VA 4CZFA 5LJWA 1Z00A 2AA4A 4JHDB 5FROA 2DBYA 3CCTA 4ZIWA 4MKYA 2D41A 2CJBA 3GG4A 2ZH8A 8ICHA 1PYTA 2UP1A 5AQFA 4P2MA 2FDRA 1EQYA 4PKHA 2VGNA 1K5OA 3IP4B 4MKBA 2OKQA 1MSWD 1G6BA 1S7HA 3QUCA 2EVZA 2NXJA 2V7YA 3H5SA 2KRBA 1TAMA 2ZM6J 3KK2A 5DK5A 4X65J 3P45B 2CNNB 4F4AA 3M30A 3L5KA 4WFZA 2AGPA 2KKPA 3CJCA 4CNZA 2E2QA 2ASMA 1VYAA 4I69A 1A5WA 1ZQDA 4Y28C 3BSOA 2HIYA 2XCPA 4JI4J 3NF8A 1XMQF 1RWKB 2VFSA 3H5UA 3ZSQA 4CZGA 4AP9A 2HG4A 4ECWA 1ZQWA 3K5NA 1RT7A 2KJ5A 1NM2A 1Y9OA 1HKCA 2F9TA 3HXMA 3RWUA 3IG1A 1AFJA 3MMAA 1QY7A 4WCEQ 3NOCA 3AL0B 3IGNA 5J2EA 2Y8WA 4ZP8A 1QVFM 1WG8A 3V9UA 1FESA 4PGXA 2NS1B 5HRPA 4RKUC 2YQ1A 5MLCV 3CCJN 5ALOA 2DCLA 2LBOA 1MMDA 2GVZA 2XY8A 2RILA 3RH6A 2FVSA 1GXTA 3FSIA 2C3MA 1S72N 2AJ4A 3ZSXA 3TAMB 4R0EA 4BBYA 2PA8D 2A1BA 4XPEA 3UO0A 4U8VA 1MU2A 1OPIA 1ZQMA 1AUDA 2LEPA 1GLCG 1YJNS 5F2RA 3ZX2A 5HRNA 3AO5A 5FJ4A 5J2MA 3BO4A 2NRRA 1RDDA 4TUPA 4KTWA 4DN0A 2VJUA 2MQ8A 3BS9A 4CI0B 5CAAA 2BOAA 1IR0A 5F3TA 4OYOA 1R6YA 5FDLB 5E33A 1O5JA 2DFLA 3DDIA 3DM2A 4I64A 3UMCA 2DIUA 5ALJA 3UN3A 5KGXA 3ZZRA 1U6ZA 3M6UA 2NXUA 3TFSA 4NOHA 5EE3A 3HPGA 3D9BA 2WONA 4KKOA 4KO0A 1L7OA 2MKHA 4RX6A 2HZCA 2K1RA 2OWOA 1KAYA 4YS2A 1FJ7A 3DC2A 2CPJA 3K7RA 3FR0A 3PIOL 1K8AT 3C1YA 3R3TA 3CCZA 4I2JA 5GAHU 5HP1B 2F76X 2YNFA 3A2FA 3VVUA 2G07A 4DSLA 3I9ZA 2ZH6A 5JICA 1NNLA 1UVIA 2JOQA 1NI3A 4MFBB 4PKIA 4H0XB 1OYEA 3M8ZA 2CQCA 1WUAA 3GE1A 3Q24A 2YKOA 1R89A 4Z2XA 2YB4A 2VOPA 2LM1A 1NSPA 5AM1A 3SMPA 3OXLA 4DV1K 2VJ4A 2W2OP 1B43A 9ICTA 5GAGU 1HARA 3MN7A 1PVQA 5CRXA 4FWSA 5M2UA 5JMNA 3OPXA 3O44A 1QQNA 2CJ9A 3CC7S 2D9OA 3R5GA 4X62J 5I42B 4DV0J 1K8KA 5B09A 2A18A 1U4BA 2HRUA 2W7PA 3OD2A 5FIIA 2JR5A 2FIUA 1OW5A 3QSYB 7ICRA 3NF7A 4XPCA 1TKTB 2D3OR 1CZAN 1FO4A 1N5VA 3OS1A 2B5JB 3R27A 1OH8A 3OPKA 3BQ1A 3Q8RB 4EO6A 4LF4F 2PGCA 3AVGA 3IMXA 5KFLA 2V0NA 2ZJ8A 4BC7A 4P4PA 5AI8A 2E5JA 1ZQPA 3ZT3A 1VRUA 2UUBK 4R79A 3T9NA 3UE5A 3SV4A 3Q8MA 3N7SC 2K4PA 4WU3A 2B3TB 2BE9B 4AYBC 3QFUA 1NBEB 3CJBA 4DUYK 4ELTA 3ZNJ1 4FYYB 2CRLA 1JJCB 3C15B 1ASUA 3CJ2A 1S0NA 1RTJA 1OY8A 4LC9B 3Q8VA 5JVHL 5DBCA 5C2FA 3W2WB 1KS2A 3EGWB 1UQVA 4E1NA 4M8LA 5AQVA 2K8AA 1RT5B 5IZHA 4PQUB 3IRWP 1JLFA 3OVAA 7ICLA 3EX7B 3FRYA 1VK3A 3NBPB 2XI9A 1C4CA 2NPFA 5ETPA 2RNEA 1HNXJ 4O5EA 3TZZA 2OANA 1IKXB 1ZAXA 3IRXB 2OEHA 3MMVA 2NNWA 1FRHA 1S9EB 2OPSB 3DI6A 2RQMA 4LF1A 5E3AA 5HLFB 2DGWA 4XK8C 3KMQA 1FKAF 3OYNA 5HP4A 3O3GA 4RW8A 3EYZA 1PO6A 1RTHA 1R27B 2ZBPA 3N4PA 5ELZA 4ED8A 2N4DA 1FRKA 1WSIA 2J6TA 4FKXA 3L3UA 1M5SA 2I1RA 1F0XA 3HHKA 3W9IA 4HH1A 4TVAB 1RGVA 1OS5A 4BC5A 1XUPO 1GTEA 3HULA 4OYXA 4GKJF 1CS4A 5JTIA 4ZK7M 3VOVA 2KI2A 9ICKA 3VZHA 1CQNA 4A2AA 3QGIA 5FRMA 2YWEA 3ELHA 4ZLPA 4HVZA 3OR2B 3AVMA 3BEGB 3K4GA 4BRMA 2MLZA 2I5JB 3MCOA 4IR1A 4A8EA 4C98A 1D8ZA 1XIQA 3TSQA 3Q8KA 2DB1A 1IKYB 4OD0A 5K9FA 4C11A 2ZVIA 3CJ4A 2QKKA 5HR7A 1U0HB 3HCXA 4J2DA 3I5AA 3CJ7A 4IQVA 1SV5A 1TK0A 5AM3A 1HBNB 4RBUA 1XR7A 3GG1A 4ATNA 2ZJQL 4NCGA 4CO3A 4EZ6A 2FGCA 5HR6A 4DWIA 3PRBA 2IVPA 2H5XA 4DOCA 2QI2A 3PEJA 3OL6A 5AM4A 3W5XA 3O8WA 1C7YA 3KTQA 2P5GA 4W90B 1IBKK 2A19A 3VEVA 1KQKA 4DX7A 1BWEA 1NPPA 1S79A 2DHXA 4Y2TA 3TTDA 1QSYA 2B9WA 1M5KC 2O8CA 2CG8A 4M9NA 5KAIU 4ED1A 5KG6A 3I31A 2CQ1A 1ZZFA 3KG4A 3VGTA 2Z30B 5KFNA 2H65B 4BGDA 2K3IA 5KFKA 5JVGL 7ICJA 1VQMN 3PW7A 2D3O1 2GIQA 3OTQA 5EN1A 3RJIA 1EP4A 2RUGA 1N2XA 4M6WA 3PYGA 5AXNA 4GKKK 4LFCF 2MKSA 3ILIA 2GQCA 4IJNA 1U8WA 1IBLK 4P9SA 1XMOK 2R9LA 3TSPA 4BRQA 1H2VZ 2W2MP 2YNHB 4DQ8A 1K73O 1H74A 4DB3A 3NWGA 2HSZA 2UVWA 1TL5A 4YOEA 3U1LA 1KSPA 4PPDA 3EGNA 5HROB 5L1MA 5ETOA 2DVIA 1RDFA 5DQHA 3KUGA 3JYTB 2DGSA 5ETSA 4YDDB 3H0RB 4ECUA 2PFQA 3N7RC 2ZJRQ 3TQ1A 2V50A 3P4IA 5ALEA 1NZPA 3KJVA 4DL6A 3BQ0A 5GMDA 2BQRA 3QEVA 2DO0A 2KYZA 2BCVA 3BGRA 2W2PP 3T5KA 5D78A 3X1LB 4Y2RA 5CCLA 1ZQJA 4F0HA 1SQFA 3QSIA 3TW0A 2ZD1A 2R7WA 1GLFO 2CZVC 1T9WA 2YKMB 3ET6B 3ISBA 2DNZA 2R7OA 3AY9A 1UPMB 2HVZA 1ZQEA 1ZBTA 3MEGB 2RHFA 4WFAQ 3BYPA 2KMDA 1ZOLA 2ITMA 1TMMA 4TKTA 4KHWA 2MKJA 3MK6A 3ISCA 4USVA 5AQWA 3SCXA 3D2NA 2FVRA 4JK8A 1MQ2A 3CM5A 3TR8A 1UP1A 5F8HA 2QWQA 4IH5A 3C5FA 3HFZB 1TUYA 3SUQA 2PFFB 4DF8A 1R0CB 4O4RA 4PCQA 1GX6A 3NNHA 4AHUA 4TNOA 4FP9A 1A0PA 4M3XA 1Q8LA 2DO4A 1U7LA 1IBLF 4M3RA 3R1XA 2AF6A 1N5YA 5HRRA 4I2QA 3N97B 4YXJA 4EU0A 4QS9A 8ICCA 5ALUA 3MUTP 3MXMA 2QEXS 2LECA 4ZPBA 1FRIA 3HKWA 3TAFA 3O8MA 1MNEA 4DS4A 1BISA 3DDNA 4D3HA 3FMWA 4A8SA 3WEEA 5DDQC 3K9KA 4JD2A 3KFWX 2OH2A 4BX9C 2MSSA 5LMNK 3OTOJ 1VCTA 1J5EJ 1MROB 1M5PC 1KQFB 2XZDB 1GLAG 1CI4A 3VWSA 2FHOB 2HHWA 4FNIA 3GIMA 3OTEA 5K14B 3U1MA 4ZLJA 4A62A 3O9RA 2VG6B 3T1AA 4DV7F 2XSFA 4IWVA 1ZA1B 8ICUA 2DH9A 4Q5VA 5A8WB 4DCPB 4BE0A 2P9IA 4Q2MA 1YJVA 3CJKA 4WFYA 5AQUA 4LF8K 2JGAA 1BQNA 1SJ4P 2YWKA 2WF7A 2ZWHA 3SMSA 3ILLA 3KNAA 3LW5C 3LVWA 5ALKA 5J2GA 1PC5A 3WXKA 2V2ZA 1RT4A 2AMCB 3ZCMA 3GZFA 3NLCA 5ADXA 1BWFO 4AHVA 1XWLA 5EWEA 1YTAA 5AQHA 2DHGA 2DXEA 2GMLA 3AVKA 3H3OB 4AYBF 5BN8A 2HW3A 1JI7A 2VU5A 1HW9A 4H0VB 4UATA 2A1JB 3IG8A 5AQPA 2XMAA 3OFHA 4DCJB 1HR0F 1RWMB 5ETMA 1RCOB 2HWIA 2X6SA 2AD9A 3PKMA 4CJUA 1WN7A 1VQKS 2IMWP 2DTUA 1JROA 3TAPA 4ZCLA 4R0JA 4MO5A 2IDEA 1ZBUA 1N8RO 7ICTA 2EQYA 5AT1B 3AV9A 5KOWA 7ICPA 4G1QA 2VKZG 3MEEB 1SC6A 1YBTA 3CUNA 4XH4A 2D3ZA 5AZJB 4QZ9A 1PILA 2RDIA 2HMPA 4CDIA 3SJJA 3TA1A 4LBIA 1Q16B 1TV6B 5B0FA 2O4GA 1RHMB 2G0IA 5T7LA 1QHAA 2I0XA 4USHA 4JI0F 4M47A 4ID5B 3KK3B 4BXOB 3KLIB 4CEEA 3VGMA 4QIWC 3DXMA 3QEWA 4F4WA 4ZVQB 3U6FA 3BUZB 2RVJA 4MT1A 4PABA 1FFWB 1N32J 4JYAJ 2HFZA 2OFHX 2Q43A 1P9YA 2P5OA 4DV4F 3BH7B 1X9SA 2ZWOA 5KT3A 2MPUA 1UCVA 2HBQB 2ZZMA 4JKBA 1LV5A 3D6JA 2HHQA 2PFNA 5MAOA 1W7AA 4OX6A 3RW6A 2F8KA 2V9WA 4OYBA 1RDRA 1Y88A 3NMRA 4DG1A 3H59A 1PGZA 2LU1A 3GMGA 4CH7A 4GV9A 3UKRB 4CJRA 4W5OA 2G8IA 4XDCA 4AXJA 2CPIA 2E8PA 2VQFK 4FBUA 3DJCA 1R8PA 3U02A 4CTAB 1H3DA 3GIJA 5D15A 2BBEA 1WG5A 8ICVA 2RH3A 3A5OC 2PFDA 2LEAA 3OW2R 4C3LA 2P9KB 2CADA 3CCVN 2DNOA 3QFWA 4R64A 2WVFA 1ZQCA 4DMZA 5J2AA 4P0PA 7ICEA 1TMJA 1NJIO 4JV1A 3UDCA 3DLEB 4QYZJ 4YOUA 2BXJA 3GYGA 1PYSB 3K8WA 4WCEL 2HS4A 3EUNA 4IOAL 5B0GA 3WXJA 2AYBA 2W9MA 1BGXT 3IDWA 5KFPA 9ICOA 2DFEA 3V4IB 5C25A 2Q36A 2UXBJ 3QLHA 2FLPA 3CIMA 1ZQAA 4YR3A 3IFEA 4F02A 2O6KA 1U02A 4JI1K 3SBGA 5SZTA 3K5MA 3CC7N 2ACMA 3BKTA 2ZH4A 2NPIA 2JDJA 2YX4A 4Z4HA 3ULHA 4RW7A 4R5PB 1T11A 1EETB 1TTHB 3JQJA 3QMQA 4BDZA 1PJ5A 5CXTA 1U2VA 4LFBJ 5J29A 1U49A 4LT6A 3IP0A 3LM2A 3A3NB 1SXDA 4H54A 4F5PA 1DGJA 4ZLNA 3D0HE 3M8PA 4E2FB 2W9CB 4CLFA 2LDYA 4EMDA 2ZXHA 2NSCA 4KH6A 3NGZA 1HPMA 4M5KA 4JI2J 4XDDA 2QWPA 3FAHA 2CVEA 2P5VA 1PJ6A 4O0IA 5ALYA 1M0SA 2FLLA 3OYBA 2CQ2A 3TNVA 3DYAB 4ICLA 4FDFA 3UIQA 1RZMA 4UY8T 4EENA 2GVDB 3FDSA 3NUQA 4NYOA 2CXEA 2VD3A 2K8BB 1HW8A 2E1MC 3R8EA 2CVIA 2OSQA 3UCZP 5F0WA 3FSXA 1TVRA 4DR2J 4M9LA 1I3OB 3Q0AA 3TANA 4ANDA 4N41A 1WBBA 1XNQF 3NVZA 1AYEA 4IBNA 2W6KA 1FX2A 4DR1F 2GW8A 3PX0A 4KLEA 4RL1A 1NGGA 2GAHC 2HNYA 2IYGA 3ZT4A 1E6VB 4FNHA 1RDBA 1NJYA 4DL4A 2XGPA 5H9FK 2KVIA 3OXFA 1JLAB 3VZIA 4F3MA 1BUXA 4RPYA 1RAFB 5DLGA 2HQGA 2FHMA 3AXKA 4JI1F 4NLBA 1VQ6S 5HMXA 1NBWA 3HPOA 2DGXA 4KHSA 4MYTA 2KV2A 2H4WB 5A8KB 3ZZYA 3V1OA 2LLZA 2ZJPQ 3CJSA 3MN5A 4PL8A 1LW2B 1C0GA 3WQTA 2XLJA 2C2NA 4KV8A 2KJVA 5J1EB 1Y64A 2JXJA 4W5RA 3NS1A 3OUYB 2DHAA 1VQNS 4Y2YA 1JMTA 2B7BB 2FHJA 1ULRA 3TKAA 3QT7A 4DU1A 1LKYB 4GMKA 1RA6A 3K5OA 2WF8A 3TX8A 3ENWA 2OPQA 5FLXO 1WTBA 4AH9A 2HGMA 3M2UB 4ZVOB 1RILA 4M3WA 2EXUA 2PMZC 2KXNB 4DUZJ 1ZYQA 2UXCK 4F71A 4BG9A 5ALVA 2HHTA 1Q7YO 1RT3B 3GR1A 1SB6A 2F8LA 4M3UA 3VCDA 2OHFA 2M52A 3UXNA 2X3DA 2F4FA 3K17A 3H0LB 4UB5A 3V7KA 3TJAA 1X9JA 3AB2B 2AIRB 4ETZA 5HO4A 5IWAJ 2DKOB 2YWHA 4Z6EA 1XU4A 1NRKA 2ZUAA 4BWMA 3ZD8A 3PRVA 2F3NA 2KW4A 2ZNYA 3K75D 4EZ9A 3MC1A 3MD3A 1FTRA 1FRMA 3EE9A 2K4IA 4ILHA 1X5PA 3VQTA 3IUCA 3TVZA 3WNHA 3NE6A 3NVYA 4NX9A 4Z4EA 4CEFA 2IOHA 1HKBA 4WJ3B 2B9EA 3TP2A 1IV0A 1RKIA 2KHCA 2Y1RI 1VQ7S 4L3QA 2XULA 1JCEA 4DKWA 1CJKA 4KFBA 3J80O 4ED5A 1IKVB 3HRDD 5HP1A 3ENAA 3NGYA 2GUIA 5E3PA 2YB1A 4BE2A 5AJ3K 3I28A 3J7AP 2VC0A 3MM8B 4NLWA 3C6AA 2BEFA 3F9MA 1C0FA 3ZSRA 3MM7B 3HK2A 4IQUA 2QL7B 1X7VA 3I4HX 1JX4A 3LH2S 3TR5A 3W62A 1WKKA 4CFDA 3MWBA 3RYLA 1TP7A 1PBAA 4DR6F 2M9KA 2DWQA 3DOKA 3QU7A 5AXKA 2B8PA 4MFCA 5KGWA 3DGPB 4CLTA 3OYHA 4B3SK 2MQLA 2KT5A 1JJ2R 4F4KA 3LGMA 4CNYA 4GVEA 2ASYA 5C24A 3P49B 2X1BA 3ZSYA 8ICXA 2DPJA 4B8CA 3GL1A 4GLXA 1X4BA 3QU2A 4FJ7A 2BQUA 4Y3CA 1HJPA 5AR0A 1RAIB 1NZAA 3IXQA 3PEHA 2RQ5A 2CQHA 4FYWB 2GUPA 5AIAA 1XTZA 3E3XA 1TKTA 2B5JA 4QIWF 2OGUA 5AKGA 3P31A 5K8OA 1BO5O 1NGHA 1SZHA 4Z4GA 2R8KA 3P3DA 3SMVA 1RTDB 3MX2A 4BRLA 4CJ4A 4K42A 3VC8A 1VSIA 4L3NA 1YVUA 3QBWA 3FSYA 4HUEA 2ZGZA 1R31A 1XR5A 1P90A 3LM9A 3VR1A 3AA5X 2ZDOA 3CIZA 4KRWA 4LBHA 1IBMF 1SAZA 3UPQA 3D5MA 4QPTA 1MC8A 4WKYA 4OKKA 2RKIB 4USMA 1ZQFA 1D5AA 3NCPA 1JIHA 2HFOA 3TUPA 4A8FA 4U7CA 3IBPA 5BXIA 1Q95G 3MCMA 4M45A 2FJWA 4UOCA 3R6MA 4JI6K 1UJ5A 4C4RA 5KG3A 2D0AA 4JUZA 2V51B 3O9TA 1QQ7A 3R1HA 3EVMA 1TKDA 3A8YA 2BCUA 2F8HA 4RW6A 3AM9A 1ZQQA 2IJFA 4GMJB 3WKEA 4CHOA 2NRZA 4ZVEA 1I1GA 2QA1A 2BRLA 3IDHA 1UW4A 3Q86A 4I2HA 1KKXA 3VGKA 4ZVPB 2WOMA 1HNWJ 1YJ9S 2QEXN 1RB0A 4QZFA 3I87A 4FF2A 3ZTPA 2C3UA 4BQZA 4M42A 4CF9A 2RE2A 5CR4A 3WX4A 2R2SA 4KREA 1S6PA 3UQ0A 1JRPA 1UAWA 3THYB 1MA7A 3A5LC 2QWMA 4KGXB 4HCBA 1NSQA 2ZJRL 2YXLA 4CEZA 2BABA 4QZGA 3SCLE 4F0MA 3LL3A 3CPEA 5ALPA 3D2SA 1KEJA 4XH5A 4IO1A 2EAPA 5KFHA 7ICFA 3ZSOA 4RBTA 5HQ8A 2UVUA 4LVSA 3QQCD 4YY3F 3ATVA 1VRTA 3UE2A 5ALWA 2WB1D 2P9PA 1S48A 1MWZA 3SZ2A 4Z37A 1R8BA 1IKYA 2F4VK 4H0OA 3SQ0A 2VH7A 1U0HA 5GADP 4WFAL 5KL8B 2IRYA 3L7UA 5HAOA 2XSJB 3JQMA 4JKGB 4C6AA 3PIPL 3G71S 4ED6A 2CQBA 4NLOA 1WG1A 1UFKA 3OA9A 4QIVA 2FD2A 4A59A 1IV8A 1B70B 2ISPA 2R7RA 2B4PA 4JV5J 5E84A 4U7UD 3E9PA 1JALA 3L7OA 1HMVB 2JH3A 5HHHA 5AQLA 2P51A 1Q3VA 3NCIA 2J5AA 3NASA 5AK5A 5A76A 4ZPCA 1CULA 1VQKN 1SQGA 4L76A 3L8BA 1O13A 1RWPB 4JI3J 1OKJA 1LWCA 3O6WA 4MMOA 2KSOB 4FJ9A 1WOOA 4CF5A 2G13A 2WVDA 1Q86T 1HWUA 4DU3A 4I6AA 3J7YU 2VWKA 3I8BA 2UXDK 1GMWD 4XTTA 1S1VB 2LSNA 3I0SA 1NNDA 4NRTA 1AQ6A 3CPWM 4FJNA 3DLRA 5LMUK 4JI4K 1QAYA 2Y0SD 5BRFA 4C0ZA 2FLOA 2K89A 3DRXA 1N33F 1G15A 2Q0RA 3GIIA 2MMYA 3W5ZA 4USJC 4ZVHA 2XY5A 2MUTB 4TXSA 2YNHA 1LK7A 2G1HA 3D3BJ 3AJ2A 4PXDA 1Q82T 4I2BA 4KAZA 5FPNA 3L3FX 1S1TA 1HUOA 4GO5X 1Q53A 3MMJA 4W5NA 8RUCA 1NDPA 3L7PA 3KKFA 2HQIA 3JYTA 4FK0A 1HWIA 2C2DA 3Q2SC 4MLHA 3H0MB 5M1OA 2V4JB 2KZMA 2LVWA 2AJQA 4BUGA 3O0FA 4HI2A 2V52B 4WP3A 4CO0A 1Y00A 1N34F 3SUPA 1M1HA 2DJWA 3SR6A 4DX5A 1AT1B 1ITGA 1T9TA 1NMDA 5AQZA 3SQ2A 1HPZB 5AM2A 1WI6A 2HVDA 2OFGX 5KFQA 5BR9A 1FKOB 1V5IB 4OZLA 2PMZF 2HBKA 2K7KA 3SXLA 2GBZA 5J0XA 2FBTA 4LF7K 2BKEA 4M5HA 3MM9A 2KM8C 3TPQA 2Q2RA 3H25A 2R7VA 3ET6A 5IM0B 2ZHOA 4RQMA 5A0LA 4KHPJ 2GLEA 5ALZA 3BN4A 4QZIA 2HVEA 5J2KA 2Q6BA 2ZM6F 1XBWA 1UA1A 2VPXB 4X65F 3OQ2A 3MHYA 1C0UA 1BPEA 4LF9J 4YR2A 5D4BA 2EBGA 2DNRA 3SFGA 2HEKA 3MR3A 3RMDA 5BOLA 5IC6B 1AZSB 4LF5J 3H8JA 1T05A 2W3SA 4JKFA 1HNIA 5D3GB 2C2MB 2KHQA 4JI4F 3WK4A 2P6TA 4BLGA 3PZPA 2HHXA 4AQYJ 2RAQA 2MGZB 1UAXA 4PYAA 1X1PA 2WSCC 2P9EA 2KEYA 4NXMK 1TYQB 1X42A 2A40A 4RO0A 4F36A 4MH8A 3M1VB 3U4LA 1WC3A 3RB3A 2E5LK 3EY1A 3M1FA 3FCVA 2UZAA 1ZQ1C 4KX5A 3F44A 1HWKA 3RB4A 3CCLS 2NZCA 4C8ZA 4PHPA 4KLFA 4CZHA 3RJHA 1BQMA 1X9XA 2LXFA 3QGGA 1WEZA 3BO3A 3PJ9A 2V2VA 5KFBA 4CNQA 4TYBA 2VJ5A 1OVYA 5J0YA 3G82A 4HTJA 1IM6A 4OI4A 2BKNA 3KOAA 7ICKA 4Y2XA 4YNQA 5CHIA 4CBWA 2HHHK 2DNLA 4XA5A 4M5NA 1RE1B 3HT3A 2O8BB 1NO8A 3TQEA 1YLXA 3G2XA 2DY4A 4DPYA 4KH0B 2HMIB 4O5CA 1JLQA 3CGIA 1S7IA 2F65A 3MR6A 3EE3A 4EEYA 1DT9A 3VQPA 2DKXA 4OJLA 5J8YA 2VQEK 4KTQA 2UU9K 1IBCB 2EZYA 3DLGB 4L73A 3J81O 2HF3A 1NDKA 4H0TB 2F3JA 3R5CA 2QKBA 1F5CA 3SCIE 1UMJA 4YMOA 1CG2A 1S10A 2BVZA 1GLEG 3I1YA 3V5RA 4BRNA 1SWWA 3VESA 2E9RX 1B9DA 1FWKA 1UA0A 2YKPA 4URGA 2ASPA 3KWIA 5EX0A 5F3ZA 5G5HA 2BE2B 1T7PA 3RMBA 3BKUA 1ZJNA 1S97A 4USWA 4B9SA 4I6MB 1VQ6N 1RWNB 1WJ9A 2CDQA 3ZETB 4ELVA 3BM7A 4XIUA 2CPEA 1NK6A 3E58A 3TWHA 4J7CA 2Q79A 4GVBB 4CZCA 4NXNK 3IHQB 3QEAZ 2MY7A 3MEEA 4NI2A 3C5GA 2AQ0A 5KT2A 1VDHA 1VFJA 5AZJA 2MQPA 2OJ3A 2IOFA 3ZDEA 5BJRA 3AAQA 2B9YA 5AKLA 3TFRA 4H4MA 4PWUA 4K0KJ 1MMLA 4B17A 3MUVP 4F5NA 2F5GA 4BXOA 1KVIA 2D5RA 4B9UA 9ICIA 1SJQA 5RUBA 4HTLA 1VQNN 1NLKL 5FLXU 5ETTA 5KT7A 1WACA 1S3XA 3KDNA 2NYIA 4X62F 1SKUB 1HKGA 4F8RA 1QUVA 4DV0F 1NJZA 4ILMA 4KT0C 4DCOB 2CJKA 4PL1A 3AFGA 4WTOB 1UEKA 3CJ1A 5HMMA 1UVNA 5AZIB 3D7EO 2A3JA 4FO0A 4LSNB 2DY1A 4EI2A 3RVCA 2KLAA 2WRMA 1F60B 4NLGA 3GJQB 3RJJA 2E6MA 3VQAA 2MHNA 5AQGA 3ZZTA 3DRRA 1RLCL 1WKJA 4E7KA 1DTQA 2C28A 4CHQA 4I9LA 4KLHA 1YK9A 5J2DA 3POTB 1ZQVA 1NGIA 3QJLA 8ICQA 1YJUA 3J80U 5KFVA 3G6ES 2XYHB 3OLBA 1VQ7N 4BACA 4EHUA 2AEMA 4KLMA 1X6JA 4PUOA 4NV0A 3DLEA 3BGUA 2FTRA 4FWOA 1NGDA 2XNQA 4OGCA 2A5XA 5ALIA 1IQTA 8ICBA 2FPHX 4RQ1A 1EWQA 3TUZC 4LRBA 2EWHA 3H8WA 1S59A 3VERA 2PYJA 1VSEA 4ZMMA 1FXRA 2E5IA 2AZ3A 4IR9A 4B1YB 7ICHA 3RRKA 1NHUA 3D2WA 5DG7A 3ZDCA 5F41A 2HCFA 3TUJC 5DM6Q 1S6QA 2FVPA 2F1JA 1Y0HA 1X0PA 2WF5A 2DGTA 5J0QA 4RQ2A 3R7NB 4H5WA 1M1GA 1RQ0A 4IXCA 3VAGA 3RJFA 3MMCB 8ICJA 2DFFA 8ICTA 2C2OB 3KHHA 1FJGK 2VG7B 3U26A 5J8YC 1P6TA 4CLZA 3RAQA 3QEBZ 4DTJA 1AROP 1L6NA 3B78A 3JTOA 3HKZC 2GHWA 2A2CA 1UVKA 4Q45A 1EETA 2NYVA 2H54B 1R43A 2XYGB 4CT9A 2FC0A 1PCAA 2IC3A 1TL1B 3SQ1A 3E2EA 1DBDA 4ZP9A 1TE2A 2ZNZA 1U2CA 3FZ2A 3L09A 1WUDA 1VQ9S 3RFAA 1NB7A 3DU5A 1SS6A 2EC2A 3CEDA 2Z0GA 2HHPA 4B9VA 1KL9A 4M41A 3UCGA 1NOYA 1REVB 3MOJB 4IL6U 2C2RA 3JTNA 3QAEA 3G6XA 4F0KA 5ALHA 2DNMA 2BANB 8ICRA 1LNQA 3S41A 1RHQB 3L4QA 2XB2D 3IAS9 1BPBA 3B4DA 4XAKA 2VDHA 4EHTA 2YTCA 4WZQA 1KQSM 2XIDA 3QU4A 3ZZUA 2HFNA 4OPKA 1FI4A 1LWEA 2JVOA 1UT8A 2JWLA 2GS8A 3O4QA 1MQ3A 4IC9A 5KAKA 2PI5A 1VDVA 2JLEA 1L7NA 3R9KA 4EUVA 2ATQA 4OJRA 8ICMA 3F9KA 2HWHA 4UAWA 3AO3A 5ALTA 4RT2A 1RXOB 1LEOA 3VQCA 2P9SB 4YHHK 5D4OA 5J2PB 2J6SA 4CBUA 2IYIA 2C3PA 1W25A 1Q8BA 2GAGC 1YJ9N 2QLFB 1E4FT 5EUHA 4BC3A 1A0OB 1QTMA 4AHSA 4JWNA 3VQQA 4NWIA 4KI6A 2DR6A 3D0GE <