4UQGA

A new bio-isosteric base pair based on reversible bonding
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title "Post-it" type connected DNA created with a reversible covalent cross-link.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 214
structure length 579
sequence length 579
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4uqgA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4uqgA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqgA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4uqgA01
2YKNA 5CP2A 5KI6A 1HRHA 5IIIA 3DOLA 5DB9A 3ZDDA 5K14A 1RNHA 3K58A 3TAQA 4RQ8A 5KFRA 4JUZA 4FXDA 5J0UA 2DFHA 2OYQA 4CHYA 1VSEA 4O44A 5DG7A 4O5EA 3VQ8A 4I2IA 8ICUA 2C22A 1HYZA 2YNIA 4CJFA 1KSPA 2BANA 4J9RA 1J53A 2PYLA 3HJFA 2IGIA 4KFBA 3WNEA 2BQRA 9ICNA 3QZ8A 2ZD1A 4FVMA 3MR2A 7ICTA 3LANA 3JSMA 4FJIA 3SV3A 1SL0A 2Z1JA 5J2NA 1T4GA 4M3XA 1BL3A 3L3UA 2BQ3A 1FKPA 1IKXA 4Z6FA 3OSPA 3C94A 1WSEA 2MUTA 1Z00A 4FJHA 3OSNA 1S1UA 3TR8A 8ICBA 2GUIA 5J2FA 3T5JA 5CYQA 4OJRA 4O3SA 5DLFA 4M6WB 3VQ9A 4ECWA 4JWMA 4Z6DA 4M41A 1BPYA 7ICKA 1FKOA 2V4RA 3LK9A 4DFJA 8ICLA 1SKRA 3RB4A 1ZQMA 4JV0A 4OGCA 3ORYA 5KT6A 7ICNA 3RR7A 5DB6A 4NCAA 4E7IA 5KFEA 3NFAA 3BQTA 3AVAA 1WSFA 3NF7A 5SZTA 4F5RA 4KB0A 3RMCA 4R8UB 1BCMA 4W5QA 5DBBA 1XU4A 1ZQIA 1LWEA 4RNOA 4ECXA 2FBXA 8ICEA 4M3YA 5KFFA 8ICTA 3FYHA 4B9VA 2P6RA 1JXEA 3O4QA 2MUTB 4J9QA 2W9BB 4J9MA 3N97B 4YR0A 2IAJA 1T8EA 2F1IA 2BCUA 2E4LA 4DU4A 1O1WA 4RG8A 3QEBZ 3AO5A 3RAXA 4X5VA 3RRGA 1B9DA 4CJ5A 2Z1IA 4TQSA 3JPQA 2FLNA 4K4GA 4J2DA 3PW2A 2YV0X 3ISDA 2XO7A 4QOZB 5C25A 1J9AA 3SUNA 2ZUDA 5CWRA 3TWHA 3DRSA 3LP0A 2ZE2A 3OHAA 2A1JB 2ZUBA 4MFBA 1NJYA 3RMDA 3KK2A 2JZBB 1JLAA 3NH2A 5KFNA 1G15A 5J0WA 9ICFA 4ED6A 4Y1DA 9ICEA 5TZVA 2Z1HA 1TK0A 1R0AA 1J54A 3KHGA 3OYMA 1F21A 4FJNA 3K5MA 1SKWA 3H4BA 1H38A 2UVUA 4KLEA 4NCGA 5DDMA 1Q9XA 1RBVA 1AROP 1WN7A 1DLOA 1A76A 1S76D 2NRXA 3SQ2A 3QNNA 1KFSA 1SZPA 4R5PA 3ZT4A 2G8VA 1I3AA 4OLBA 3RMBA 4KO0A 4HUEA 3IS9A 3GIIA 3KLGA 2VANA 3ZSWA 1REVA 3KLHA 4KI4A 4DWIA 4YN4A 1VSLA 3AVCA 5DKWA 3S3MA 3DLHA 5KFJA 2W8KA 7ICHA 4IFVA 3SI8A 4WE1A 4W5OA 4GXIA 1ZQXA 4FZYA 3AVGA 3CFOA 3CFRA 3NBPA 1KVCA 3HP6A 2BCSA 1GOBA 1ZQGA 2RDIA 3HSTB 3OYEA 3MDAA 1ZYQA 1U04A 5HMLA 1ZQCA 3TQ1A 1VSJA 2BKEA 3V7JA 2XGQA 1A5VA 1RILA 5DLGA 2JZBA 1LW2A 2PI5A 8ICOA 4Q5VA 2J6TA 3PY8A 4IQWA 5CA7A 1S77D 2LSNA 3C1ZA 2I9GA 3L2WA 3C5GA 3BDPA 2QXFA 5FRNA 3UXOA 3AA4A 4CHNA 4DU3A 5J0QA 1QE1A 4GMJB 4CFDA 3ISCA 4QZAA 4J9PA 4F3OA 1NOYA 4CEQA 4I9LA 7ICOA 3C95A 3HWTA 1JN3A 1ZQAA 3KHHA 1NJXA 4R64A 4RPYA 3HK2A 1NK7A 4DTPA 4FLTA 2UVRA 4CEFA 3AUOA 1GOAA 9ICWA 1XSLA 1DTTA 4IQVA 3QZ7A 4KLTA 2HHUA 4HCCA 2FLLA 5DBCA 4ZTFA 3DLBA 1XI1A 2KN7A 1JMSA 1JLFA 4ED0A 3PUFA 3PR5B 4DFKA 1TGOA 4I2AA 1XWLA 1L5UA 3UXNA 4ECQA 8ICSA 4E7KA 1DTQA 4F4ZA 2PFOA 4ID5A 3AVHA 4NY8A 5KFBA 5J0TA 4YXMA 4MFCA 3LP1A 2O4IA 4KLHA 5DGBA 3DMJA 3OYGA 2NRZA 3DM2A 4NYFA 1QLNA 4CJ3A 3BQ2A 3ZT3A 5IINA 1U4BA 3PO4A 4DQIA 4TUQA 1EXNA 4TQRA 1NK4A 4FJ5A 4E0DA 1U45A 1TVRA 4QW8A 3O4NA 1IKWA 1ZQYA 5DGAA 1S1TA 3VQ6A 3PX6A 1NKBA 1BIZA 5CHGA 5F9NA 3AVJA 1XC9A 3VQQA 1S1VA 1UAXA 2YKMA 5J2DA 3B6OA 1B92A 4Q8EA 2IMWP 1Z25A 4DL2A 1TL3A 2OPRA 7ICFA 3NAEA 4QCLA 1BGXT 8ICRA 5EWFA 2DTUA 4QZBA 2XC9A 3SYZA 3DLRA 1S97A 4DTJA 1S0OA 3NF8A 2P5OA 3HPGA 3WNFA 1KFTA 4FCYA 3OYJA 4DQPA 2B4JA 5KFLA 3M8PA 3C2LA 1RBSA 1RTHA 4DMNA 4UB5A 3LAMA 3V4IA 1ZQTA 4EBCA 8ICJA 3V9ZA 2VG6A 8ICFA 4CJRA 4E19A 4YG2A 8ICXA 5DK5A 4ECSA 8ICWA 1C1AA 4FK4A 3Q8QB 1CXQA 3SI6A 4EZ6A 2IS3A 3RR8A 1U49A 1K1QA 5D49A 5DQGA 2OZSA 2BCRA 4CEDA 2I1QA 3V1OA 5C24A 4FJ7A 1NK8A 5KG0A 3PV8A 4C8OA 3LZIA 3K57A 4GC7A 3G6XA 7ICSA 3RWUA 4R66A 3PNCA 3OGUA 4F2RA 1DOQA 4RQ2A 4QWBA 5KT7A 1C6VA 1JLEA 2R8KA 2R8JA 1HQUA 3ASMA 3MDCA 4QWAA 7ICQA 3TFSA 4R65A 4BACA 4UAYA 4QZIA 5BPCA 1X1PA 2BCQA 4O3RA 4DO9A 4B08A 3TABA 5JS2A 1Z00B 2W8LA 4YVZA 3C21A 3BJYA 5D46A 1RBUA 4CF2A 1HPZA 2A1JA 4TSXA 4ECTA 5D4BA 3AV9A 2P66A 1TV9A 3GV7B 2PFPA 4M3TA 1BI4B 2LYHA 3MEGA 1PZNA 3AVFA 3VQEA 3TAEA 3ZCMA 4F5NA 5J2AA 4C8KA 1TKDA 4F5PA 4I2HA 1ZQHA 3EYZA 4ECZA 5HMMA 4KLGA 2IBKA 4ED1A 4QWEA 4NM1A 4XA5A 1CLQA 3ZSOA 3MABA 1SL2A 4C8MA 4KLFA 5HHHA 4CJEA 2HNDA 1FXXA 3QEPA 3EW9A 3MR3A 1ZQKA 4I27A 9ICXA 1RT3A 2W9CA 2KQ2A 2ZTDA 5IIOA 3NF9A 4RW6A 4R8UA 2OPPA 4PHEA 2PYJA 3B0YA 3UQ2A 2I5JA 3C5FA 4F92B 4GVMA 4EZ9A 3NE6A 3EZ5A 1BQNA 3Q8PB 2P6UA 4FZZA 5DG8A 2HHXA 3V9UA 3NCIA 3QEVA 3TAPA 4W5TA 2XY5A 3MFIA 4NXZA 2Y1IA 2BDPA 4GC6A 1UA0A 2D0BA 4M04A 4GLXA 7ICJA 4W5NA 4OPJA 5KFIA 2ATQA 4RUCA 5CY4A 3IHQB 3VQCA 2HHQA 4JRQA 1C0UA 4IG3A 4UQGA 3RH5A 4RPXA 3Q8RB 4O0JA 3S9HA 4PA1A 8ICNA 7ICMA 3NF6A 5J2CA 3RJJA 4I2DA 3V6JA 3VQPA 5IIJA 5HRSA 2ZTEA 1IM4A 2IOCA 3PW4A 3KKRA 1TAQA 1JX4A 3V6KA 4E7HA 4EBEA 1ZQEA 4MEXA 3T19A 1XSNA 4NLNA 4KHWA 1VK0A 1S1XA 1UA1A 3GDXA 4M9JA 4AHSA 4XQ8A 4RU9A 3H40A 2QK9A 3QINA 4DL6A 3ZDEA 4DQQA 1SUQA 3LP3A 4I9QA 2UVVA 3OYAA 2G8WA 1IKYA 1BHLA 1VRUA 4GW6A 4CGHA 2FPLA 3PW5A 1X9WA 5KGWA 2C2RA 3I0RA 5IILA 3JYTA 5HHIA 2KFZA 1JLQA 1S9EA 3LPTA 3ZSXA 5KFCA 4IRDA 4DOCA 3ETLA 4KTQA 3GQCA 4OKKA 3TANA 4CFBA 8ICCA 3L2VA 3G6VA 4IQUA 1U48A 1KTQA 4AHUA 1U47A 2R7YA 5KG4A 4FM0A 1RYSA 1FK9A 4CEEA 2VA3A 5KRTA 4M42A 3RJEA 9ICBA 5C5JA 4MQ3A 3DRRA 3KD1E 3I8DA 1ASWA 4F50A 9ICLA 4RQ7A 4QZ9A 4FJ8A 2WOMA 4AH9A 4KHNA 1A77A 2DPIA 1CZBA 3HT3A 5KFUA 9ICGA 3ISBA 5IIMA 1WAJA 2D5RA 4K8XA 3V9WA 3LWLA 4HHTA 2OWOA 4LVSA 4PPXA 5L1LA 2XGPA 4B9TA 2J6SA 3U3YA 3RBEA 5HLFA 3HVTA 3C23A 2IHMA 4F91B 4J9KA 4Q8FA 4AHTA 4DOAA 2DPJA 1D9DA 1RDDA 2JEIA 7ICPA 5HRPA 4B8AB 4JWNA 2OZMA 3PMNA 5DQHA 1NK5A 3G6YA 3M9MB 4HYKA 3VQ4A 3P5JA 4TUSA 4JS4A 4CECA 7ICIA 1T7PA 4IBNA 4AHRA 2G8IA 5J0YA 4CHPA 4YD2A 2AGQA 4EP4A 4RNNA 1S0MA 3QEXA 1RBRA 1W9HA 2AGOA 4NLZA 3EPGA 3K59A 4DU1A 4FJGA 3E2EA 4EP5A 4C8NA 2NRTA 2OA8A 4Z4FA 4PGQA 3HXMA 4DFMA 3OYBA 3ISNC 3UQ0A 9ICVA 4O4GA 5CJ7A 1RT4A 4KLSA 4DTRA 3TFRA 3Q8LA 1X2IA 4J9SA 5L9XA 2YNFA 1HQEA 4RNMA 4PY5A 3DYAA 4FS1A 3RJHA 4AILC 4DTOA 3NDKA 1ASVA 3AA5X 3KLIA 3AVNA 1ZBLA 4RT2A 4JK1A 2YHAA 4CJLA 1QHTA 5DMRA 5HBMA 9ICQA 3OYHA 1BCOA 5HP1A 4B9SA 5EU7A 5L1IA 3MGIA 3AVKA 4CGIA 1V9PA 4B9NA 4I2PA 9ICJA 1LWCA 3RAQA 4Q43A 4ED2A 3OYIA 2J6UA 4O0IA 1VSDA 2FC0A 4F5QA 4H4OA 1ZQOA 1RTIA 1ZQQA 1B9FA 1ITGA 1MSWD 7ICVA 3P1GA 3K4GA 5KFYA 2PFNA 3RJKA 5KFTA 3RB0A 4Z4GA 1VSHA 4O3NA 2AJQA 4M3UA 4I2EA 4OKEA 4AHCA 3AO2A 1JLGA 3QO9A 3M9OB 1S6PA 3BGRA 3BQ0A 1ZQRA 1IXRA 4QWDA 4PHAA 2DFFA 1T05A 1NJWA 3JPSA 3EY1A 1RT1A 5J2IA 4Z4CA 2HNYA 2FBVA 4FK2A 4CIGA 3LAKA 3HM9A 4CEOA 4DTXA 4DTUA 4P2HA 4M0AA 1QSYA 3RJGA 9ICOA 1Q9YA 1KLNA 4RQ6A 3CFPA 5KFKA 3LZJA 4ED8A 4DLEA 4JV1A 3AA2A 4I7FA 1BPDA 2F8SA 3VQDA 5FDLA 4KPYA 9ICAA 4F5OA 3SZ2A 1B22A 4FJJA 2BGGA 3QNOA 3F9KA 3O3FA 1KLMA 3PX4A 1ZQPA 9ICUA 4IRCA 1Q8IA 5KT2A 4CK2A 4RQ5A 1S0VA 3ZT2A 4FLYA 1IKVA 3S3OA 1GOCA 1ZQJA 5KG3A 4DF8A 5JS1A 2JEFA 1ZQVA 1RT2A 3KTQA 4YXJA 4R63A 1WSHA 4KLMA 1ZBFA 3V72A 3OYCA 3OVNA 2AQ0A 3RBDA 4YMMA 2HHTA 2RPIA 1UWBA 2XY7A 2VG7A 3AA3A 2PXIA 2PFQA 4DTMA 3HL8A 4HUGA 4KMUA 4IQTA 4UB4A 4F2SA 3LP2A 5FROA 4RPZA 3ZD9A 3QEIA 5KFHA 2AQ4A 1KDHA 4I2QA 3VA0A 4F93B 4P4OA 5KFAA 1K1SA 3AO3A 1S5JA 2BPGA 5KT4A 1U9LA 4BXOA 3Q8SB 4FW2A 2GBZA 4CGJA 1L3TA 1BPXA 3KD5E 1RPLA 1BPEA 1TK8A 3TAFA 3LDAA 3H8SA 3NGDA 3TI0A 3DLGA 4J9LA 3KLEA 3OHBA 1QSLA 2V4QA 1HYSA 3EWAA 3ZDAA 3MFHA 4YD1A 3RTVA 4MFAA 1EX4A 4TUPA 3Q8MA 4CGDA 3AVLA 3PW7A 4DEZA 1KCFA 2A1RA 4W5RA 1XO1A 4MF8A 4GXJA 4NCBA 4DL4A 4B9LA 1N48A 4FBTA 1QTMA 4LH5A 3HYFA 4CJVA 3VA3A 2M9NA 3IRXA 1EKEA 1RDCA 4M2YA 3OS0A 1TL1A 3ZSRA 3T3FA 1TVAA 4P4MA 5J1EA 2KZ3A 2WONA 4J9OA 4UAZA 2C28A 4CK3A 1ZBIA 5KFQA 4CJPA 4QAGA 1ZQDA 4LY7A 5EOZA 3AU2A 2ZJAA 4QZCA 4RW4A 4M9HA 3GIMA 2E6MA 1N5YA 5C42A 4E1MA 2R8GA 1C0TA 3QERA 4Z6CA 4I2JA 2NRVA 3A2FA 4KHSA 3VN5A 5KG6A 9ICCA 4ELUA 2BGWA 1C1BA 2X78A 2D0AA 1RXVA 5J2EA 4CIFA 4DOBA 1Y88A 4N5SA 1ZBUA 3KHRA 3KKSA 4O9MA 3QEAZ 1S9GA 4DFPA 1T3NA 4UAWA 1ZETA 4CE9A 1WSGA 1NJZA 4B8CA 1B43A 2FMSA 2PZSA 1A5WA 1ZQWA 4KKOA 3WNGA 5KFXA 1VRTA 1WCNA 2ASLA 1RYRA 4NLKA 4CGGA 1S0NA 3L2RA 4CHQA 3ALYA 1WSJA 1IG9A 3O3HA 4BE1A 4M3WA 1RXWA 4YNQA 3BQ1A 1N6QA 1C1CA 8ICMA 4DTSA 4KV8A 2ETJA 2W9MA 4H4MA 9ICMA 4KRFA 1WCLA 1BPBA 2V9WA 4KHYA 5DB8A 2W9AA 3C2MA 1JLCA 4XRHA 4KTWA 1TK5A 1SV5A 5DB7A 4I29A 1RDBA 3OYLA 7ICRA 3CG7A 2BQUA 1LAVA 2G8FA 1RCHA 5KFDA 4LSNA 2QKKA 3DI6A 1ZJNA 1HYVA 5KFVA 3RH6A 3OY9A 1NK6A 1UT5A 3EPIA 5KG5A 4KHUA 4CEBA 2AU0A 2OPQA 4MFFA 3HPHA 5KTQA 5KT3A 1T03A 4RW7A 3KLFA 2YNHA 1XS9D 2RN2A 2NUBA 3QIOA 3RJIA 4H8KA 4LD0A 4GXKA 4KN4A 1CZ9A 4M9GA 5HRNA 4IDKA 5J0PA 4QZGA 2X6SA 4KN7A 3LDSA 3MEDA 3QIPA 3PX0A 9ICTA 4KITB 2E6LA 4CESA 4HTUA 2C2EA 1ZQFA 4FLZA 2JEGA 1IH7A 4CF9A 4BWMA 3B0XA 4FW1A 2FBTA 2D0CA 5SWMA 2ALZA 1SL1A 4DL3A 3V6DA 4YR2A 2MAXA 4BWJA 2W9CB 1HMVA 4DL7A 4RW9A 4O3QA 4YQWA 1CXUA 5BOMA 3H08A 4F4YA 4BDYA 2DFLA 3RH4A 4AHVA 4QZEA 4EYIB 2XCPA 1XHXA 3V9XA 3IM1A 2ZJ8A 5J0RA 4Z4HA 3HX0A 4I2CA 4TURA 4Z4EA 2GV9A 2EX3A 4KI6A 4FJ9A 1CUKA 3GV5B 1LAWA 2BE2A 4EEYA 3QEWA 4CK1A 4CHZA 2VA2A 1EETA 3QETA 2WTFA 4K4IA 3NH1A 2GWSA 3GFKB 3MR5A 2ISPA 4CJSA 2KZMA 5KGXA 4OPKA 3T1AA 1S6QA 2C2DA 2ISOA 4BXOB 4O5BA 4E3SA 4LSLA 1NOZA 1JL1A 3RJFA 4E7JA 5I42A 1JIHA 3TARA 2G8KA 1VSFA 1S9FA 4PHPA 4DF4A 3KJVA 2B6AA 5HNKA 2VWJA 3MXJA 4B9UA 3MR6A 1TKXA 4FM2A 4BE2A 2BPCA 1JXLA 4KLIA 3JPRA 3AVIA 3HPOA 4Q44A 3TAMA 2KTQA 5J0SA 4QZFA 3MGHA 1Z26A 4LZDA 4ELVA 9ICPA 4RW8A 3KK3A 2Q3SA 4OKJA 4Q45A 4PUOA 4L8RB 5KFPA 4J9NA 4ICLA 3SUOA 4FLVA 4E7LA 1WAFA 1RZTA 5T7BA 3VQ7A 3M8RA 2BR0A 2W9BA 4Z6EA 5J2GA 1BIUA 4NLGA 3KK1A 2W42A 3RB6A 3ZSZA 4FZXC 5EWEA 4ECYA 1W0HA 2VG5A 5BOLA 3FDSA 4K8ZA 1NKCA 3VQ5A 4RUAA 3ZSQA 1QQCA 5KFZA 1J5OA 4I2FA 1TFRA 4NM2A 3K2PA 3RB3A 1D9FA 1RTJA 2OPSA 3WNHA 4M45A 4BDZA 4BE0A 2XCAA 1HJRA 8ICGA 5J29A 3GIKA 3K5NA 3S3NA 3HVRA 3B6PA 1TKZA 3V7LA 1MQ2A 3H4DA 2ZUCA 3V9SA 4FM1A 1ZQBA 1DGSA 4I2GA 3AO4A 4CJTA 8ICAA 2ZTCA 2IHNA 4FS2A 2FBYA 1D5AA 2YHBA 2YNGA 5KG7A 1A5XA 2O4GA 3DRPA 4FLXA 4YFKA 3HP9A 2RDJA 1VSKA 3MEEA 4JLHA 1CEZA 2HNZA 1D8LA 1RT7A 5KFOA 4KHQA 3RMAA 5KFMA 2Z1GA 3E01A 2XY8A 2FMPA 5EWGA 5DG9A 5KFSA 1KEJA 2X6NA 3ZT1A 3GILA 2HHWA 2HMIA 1WNSA 4PGYA 3UPQA 4JV2A 3D45A 1Z3EB 4OVLA 4G3IA 4O3PA 4F4XA 1K6YA 3SUPA 3NTUA 3L3VA 4ZHRA 4F4KA 3SNNA 3O3GA 5E41A 4DL5A 8ICIA 3JPTA 4CJWA 3AVMA 4ZH4A 1NOMA 4F8RA 5CZ1A 5J2JA 2JEJA 4CHOA 1L3SA 4BDPA 4N56A 4O5KA 4CJQA 3SQ4A 3T5LA 4YP3A 5HROA 1UT8A 4N47A 1L3VA 8ICZA 1LWFA 4CIEA 4KLLA 1TV6A 3CM6A 3AVBA 3NGIA 2F1JA 3HO1A 2HW3A 4QZHA 3KIOA 3V6HA 3U6FA 3G0ZA 4ECVA 3GIJA 2X74A 4RQ3A 3THVA 3IAYA 1YVUA 3QLHA 2RKIA 2XRIA 3ZDBA 5KFGA 2HVHA 1Y97A 4Z0UA 2HHVA 4CF0A 8ICHA 1D8YA 2UVWA 3AU6A 4JRPA 2F96A 3PMLA 3SQ1A 2XHBA 4FJXA 2BCVA 2A1SA 1S1WA 4F3TA 8ICQA 5KRSA 3H7IA 4J2AA 4O5CA 3M9NB 4UBBA 4ID1A 3JPPA 4KREA 2FMQA 1QS4A 4DSKA 2H5XA 4DSEA 4YMOA 4EYHB 2G8HA 4FJKA 3CM5A 2DFEA 4M9LA 1JL2A 4O55A 4FJMA 2HVIA 5CYMA 4IKFA 2PI4A 4M9NA 3T5KA 1ZQNA 4KLJA 1X9MA 4G1QA 3QESA 2RF2A 1LV5A 1N56A 4MF2A 3KHLA 1RBTA 1WLJA 2F8TA 4CEZA 2JGUA 2P51A 4K4HA 1RTDA 3IG1A 1BPZA 3TAGA 5KT5A 4OGEA 3OYNA 2Q0ZX 3FFIA 5J0XA 4CFCA 3NGZA 4DSLA 1LB2B 1VSIA 2P5GA 3PR4A 4KTZA 3OJUA 1ZQSA 4ED3A 5J2PA 1SKSA 5D3GA 4PHDA 3K5LA 4FYDA 3RRHA 4M6WA 4ED7A 1TKTA 1MU2A 1XHZA 1HJPA 3ULDA 1ASUA 4PWDA 3PVXA 4LH4A 2G8UA 7ICLA 3C1YA 4RT3A 4YFUA 9ICKA 3K75D 4Q0BA 1YTUA 1KFDA 4DQSA 5J0OA 3MXIA 5CB1A 3MBYA 5I3UA 9ICRA 4QZ8A 4KLDA 1KVBA 2BPFA 4FK0A 2KW4A 4DG1A 4E89A 2F1HA 2HB5A 2ATLA 3V1RA 5IIKA 4M3RA 4XUSA 1EXQA 4IR9A 1YT3A 3CQ8A 3SV4A 4N41A 3V1QA 3SQ0A 2IC3A 3V81A 4N76A 1BI4A 1MQ3A 9ICSA 9ICHA 1BISA 3L2UA 2R8IA 3SPZA 3PW0A 2HHSA 4IFYA 2B5JA 3JPNA 5J2HA 8ICVA 3VQBA 4DS4A 4ZTJA 5F9LA 3I0SA 4Z4IA 3MAQA 1XSPA 1HNIA 1NKEA 3NGYA 4M47A 3C6TA 3M8SA 3GV8B 4IG0A 5J2KA 7ICEA 3G10A 2IA6A 1L3UA 3N4MB 4FO6A 4BGDA 3QE9Y 4KLOA 5J2QA 4RZRA 4CGFA 8ICYA 4CCHA 1JXBA 5KG2A 4JS5A 3H8WA 3ITHA 3F73A 1RT6A 1C0MA 1NK0A 3LWMA 4PH5A 3PO5A 4CEAA 3OJSA 1HNVA 4PQUA 4CERA 4DSIA 4DSJA 4ECRA 4C8LA 3MXMA 3OYDA 2QKBA 3C6UA 2IDOA 1ZBHA 4EBDA 4RQ0A 4ECUA 1TAUA 4UBCA 3T5HA 4FLUA 4CF1A 4UB3A 9ICIA 3L8BA 8ICKA 4UB2A 1RT5A 2ZQBA 1COOA 4KB1A 3K5OA 4I28A 3SUQA 3JPOA 1X9SA 4O3OA 1HUOA 1EP4A 1RDAA 5DQIA 3ZSYA 1JKHA 2ASJA 4IR1A 4DQRA 1LW0A 4ELTA 4CFAA 5FRMA 5L1JA 4J2EA 1ZQUA 3DOKA 1KVAA 3CYMA 2Y1JA 5DBAA 5J2MA 5J2BA 4NYNA 3HW8A 3OS2A 3UIQA 4DLGA 4YR3A 2R8HA 4YMNA 3DLKA 4KLQA 2BHNA 1ZQZA 3ZDCA 1WSIA 3LALA 3L2QA 5CZ2A 2NRWA 7ICGA 4B9MA 2EHGA 4M3ZA 1YTAA 2DY4A 2JLEA 1I39A 3ZD8A 5KFWA 2PY5A 4B3OA 5KG1A 4DSFA 4FLWA 2B21A 2XY6A 3OYFA 4Y1CA 4E1NA 4YCXA 4FBUA 4QWCA 2FPMA 5CR0A 3SCXA 5L1KA 2FLPA 4IRKA 5HP4A 4FJLA 4HUFA 1UOCA 3Q8KA 3ZSVA 3P83D 1BQMA 4P4PA 3V7KA 4CJ4A 3SPYA 3OS1A 1C7YA 4HVJA 4DTNA 3U3GA 4QZDA 4MEYA 4DS5A 2VA8A 2P1JA 3D0PA 1JLBA 3LPUA 4OLAA 1HUZA 4HCBA 5JUMA 2KFNA 4KAZA 3H8JA 1VSMA 1BVSA 4RQ4A 3C2KA 3NH0A 4KLUA 3OYKA 3UXPA 1MC8A 1ZQLA 3ZT0A 1KRPA 4LZGA 3VQAA 3AO1A 4UB1A 2FPKA 4F4WA 1QSSA 2KZZA 3NHGA 2VWKA 1ZJMA 4J2BA 5HRRA 4RQ1A 2ITGA 7ICUA 4CF8A 4I2BA 3DLEA 4PGXA 3MECA 4CJKA 4CJUA 1NK9A 4QW9A 1IO2A 8ICPA 2ZJ5A 1S10A 3M8QA 4XIUA 2AGPA 5DDYA 3SJJA 2ASDA
chains in the Genus database with same CATH superfamily
2HPUA 1WI8A 4CZKA 2WHOA 3JYTB 5AFUA 3OVSA 1R8PA 5KI6A 5K8OA 4UAVA 4PAAA 5LMNF 3D7EO 4CQ1A 2RLTA 5DG7A 4O5EA 2OEHA 1HKBA 5FPNA 8ICUA 2C22A 3DLKB 4H0PA 1L7MA 1B7YB 2HOEA 2F8HA 1SC3B 1YVNA 5C7PA 4JI4J 2GTDA 1SV0A 4F0KA 2KOBA 5H9EK 2LEBA 4ZCMA 3MI7X 3CIPA 2FGOA 3C65A 3LANA 1N36F 4BRQA 5BR8J 2Z1JA 1CJKA 4NLTA 2CQ3A 2J7WA 3L3UA 3CW2C 4TXSA 3CPWM 3ZZPA 3C94A 4KH5A 1VQON 2A10A 4C4WA 4FJHA 1QHAA 8ICBA 1COKA 1LWEB 1RWKB 1B7FA 1OY8A 3W2VB 3NS6A 4LF4J 4ECWA 4WFAL 4JWMA 1RAAB 2C1EB 5IM0A 5BR8F 3P39A 2D7SA 2W3RA 5F3ZA 2FHJA 4KT0C 4U7UD 1FJGK 4HTJA 3JSBA 3OTOJ 3O1BA 3MN9A 2CWXA 4DUZF 2XM3A 4DFJA 1U1RA 2DNNA 3VGLA 3GCXP 1ZQMA 4W92B 2CPXA 4OGCA 5G5GA 3ORYA 3D1OA 1WB9A 1YGYA 5DB6A 4BC9A 2CIMA 4OI4A 4MK9A 3NFAA 3BQTA 1U2CA 3O0FA 1DXSA 1SI9A 5AJ3F 2HBYB 2YMQA 3CDBA 3O9UA 4F5RA 2FXUA 2NXUA 1SB3C 1RT1B 4R8UB 1U02A 4B9VA 4LBPA 2R7OA 3QFHA 2QI2A 4J9QA 5AJ3J 3WKAA 4B9QA 4YR0A 4O0NA 1IWAA 4DFDA 1T8EA 2BCUA 4DU4A 4UAUA 1O1WA 4JD2B 2D6FC 4RG8A 1RBOB 3QEBZ 3RAXA 4X5VA 2Q0RA 1FX2A 3TX0A 3VF6A 4HEA9 3ZX0A 4TQSA 3GG4A 2YV0X 2XO7A 1M90T 1PJ5A 4ERDA 4QOZB 4RQMA 1B64A 2R7VA 4KIAA 2LU1A 3O9TA 4F67A 2ZE2A 4MFBA 3RMDA 2ZM6J 1NI3A 5D15A 4PWWA 1IIPA 4ETXA 3VPZA 5J0WA 3M30A 9ICEA 5TZVA 5HP1B 3Q8VA 3OYMA 1F21A 1D4XA 1NPPA 2JX2A 1SKWA 2PMZD 2HZAA 1NM2A 4KLEA 3CDUA 4NCGA 5DDMA 4BC3A 1RBVA 5CYQB 2V63A 2IYGA 4ZIWA 1UVNA 3D6RA 4Y0WA 2KVIA 2M5YA 3PM9A 5HN0A 1I3AA 4ES1A 2K06A 3FBBA 3DRSB 2ZKUA 4HUEA 3PHTA 4EX7A 2YQEA 4YY3J 1SCJB 4ILLA 3MPWA 1PBUA 4NLDA 3GU3A 1HBMB 3AVCA 1T0TV 1N32K 4OJLA 4UQTA 3DLHA 5KFJA 2ZH2A 4J37A 7ICHA 1BHNA 4IFVA 3H46O 4MHVA 1Q95G 3VR1A 3MM6A 1JKHB 1M5OC 4DPWA 3CFOA 2KHDA 3KXDA 2ZOFA 2MEWA 3BO3A 2AKWB 4NLOA 2EVZA 3HSTB 4JKDA 1MU2B 3JTOA 3MDAA 1U04A 3UDLA 1W7AA 3TQ1A 3VEYA 4OYOA 1UTAA 5AQYA 1YITN 4AM6A 2CRXA 4H5TA 4FL9A 3F9MA 1A5VA 2A42A 4L72B 1RILA 2PGCA 1HNXK 3O5TB 4WYLA 2O1PA 2A3VA 1EWQA 1RCOB 1BY9A 2Z2LA 3BDEA 2QXFA 3UXOA 3OFGA 2B0CA 1RXOB 3AA4A 1HWIA 2YKAA 1D8BA 2GQQA 3IWLA 4CFDA 3PHEA 1K5OA 3HX9A 2GS8A 5A6WA 4JI2K 3BEGB 2YMLA 5AKEA 3C19A 4QPXA 4CZGA 2C2KB 4I9LA 3O8MA 4CRXA 3HWTA 1TVRB 3KHHA 1NJXA 5IXUA 4B3OB 4LMZA 3IUCA 4FLTA 4FNHA 2Y8YA 1GOAA 5EOYA 4C6AA 3H2VE 3W9IA 2XWYA 2M7SA 1T11A 4FFDA 3TZZA 2I6WA 2FLLA 3MM9B 1HD1A 2O8DB 3C3LA 4CZHA 1R27B 4UF4A 1KL9A 2Y0SD 3KMQA 1XWLA 3UXNA 1DTQA 4C1NK 4F4ZA 2BDUA 5B0CA 2NYIA 2R2RA 3ELHA 4NY8A 2JHEA 2O4IA 5M2PA 3M2RB 2B7BB 3AGRA 1QLNA 1C2PA 4JMUA 3OT9A 5IINA 2IRUA 4TUQA 2I1RA 1GX5A 4F04B 1NK4A 4B3SF 3IWXA 4N77A 5L38A 5ADZA 3W3DA 1N52B 1K8AO 3N9UC 2ZGYA 4QW8A 2GJ2A 3MK6A 1O51A 2NYHA 5ALOA 2A1BA 3CJ4A 3PX6A 4BRGA 2XI2A 1S1VA 1UAXA 2OYYA 4H4KC 5B0BA 1VK3A 3B6OA 3BN7A 1B92A 1Q82T 4KHRA 2UXBK 3I31A 7ICFA 2OD6A 4CE6A 2AJFE 4QIFA 4UTGA 1NGHA 2AEJA 3SYZA 3DLRA 3S1TA 3IV6A 1TUGB 2LM4A 4TY8B 3HPGA 2P5OA 4GKJF 4H0YB 3OYJA 4DQPA 3KUHA 2A19A 1Y5LB 1X0PA 2BANB 3PDNA 5JICA 3M8PA 4O3MA 3LAMA 5GADU 4FYWB 2E1ZA 1ZQTA 8ICJA 1QAYA 8ICFA 2KJ9A 2IOFA 2EFNA 3HT0A 4ECSA 2L3MA 8ICWA 1VQ4N 1C1AA 1N0UA 1FO1A 4IJNA 3Q8QB 3CJ0A 5CAAA 2IS3A 5A6PA 3WKEA 1FD8A 1U49A 2D1CA 5D49A 5DQGA 3CDEA 3CJTA 2ZH5A 5BJRA 1E3MA 4LF9K 1QCKA 4NYOA 3CIZA 4KB7A 4C8OA 1YJNS 3QLHB 3ONNA 3ITHB 3PNCA 4F2RA 3I9ZA 4HH1A 3WK6A 4BGBA 1XJWB 3LVWA 2QEXS 3AOBA 1D8ZA 4R65A 3Q23A 3SEOA 1VQPS 2G2OA 1TV6B 1ZM9A 2M88A 3H1QA 4BQLA 4L74A 5BPCA 2L9NA 4KC5A 4CO4A 1S49A 2DGWA 4B08A 3TABA 4FOIA 2W8LA 1M5KC 3GR1A 2KG1A 3C21A 3MPDA 4OLOA 2MKCA 1UFLA 3GU0A 1VK8A 2AH5A 2A1JA 4ECTA 3AV9A 4B3RJ 4LR7A 2P66A 1TV9A 1RHKB 5CHCB 2H1YA 2LYHA 1IUJA 3VQEA 2ZM6F 3CCVS 5M1QA 4NL9C 1IJEB 4JYAJ 3BBFA 4ECZA 3MCOA 2N82B 1P8ZA 4NM1A 1JLFB 1UCNA 4JD2A 3MABA 2XSJB 4OX7A 1WKJA 1FF2A 3QEPA 1MMDA 3A5NC 1NB2A 3MR3A 3HZ6A 4ES3A 3W0LA 4I27A 1MG7A 3RUBL 4OJOA 1RT3A 5AM2A 2ZTDA 2E1RA 2CNKB 2F2AB 1N5QA 2OCEA 1PO6A 3EM1A 1IBMF 2PEBA 4YDUC 3H25A 4P52A 2OPPA 5A76A 1VQ5N 5E5NA 2I5JA 2FC9A 4F92B 4BUGA 1ULRA 3Q8PB 2R2UA 3CCMS 5DG8A 2FSKA 3CCTA 3NNCA 1X5OA 4W5TA 2HSTA 4GC6A 1UA0A 1FW6A 1JJCB 3UO0A 3T79A 5A8KB 5GAHP 2ATQA 4RUCA 1LW0B 1SC6A 3PIOQ 5I3QA 1U1KA 2CJ9A 4NPOA 2WSFC 1C0UA 2BJ8A 3DLJA 4G1QB 2WUSA 3M5RA 2ZZMA 3SQGB 3HHKA 2R7RA 4O0JA 2EFOA 4CIOA 2KICA 2DRDA 3DHXA 1D3WA 4JOUA 3T1HJ 3P3DA 2IOCA 4TY8A 3KG0A 2EAPA 2D69A 1JX4A 3V6KA 3MPVA 1T9TA 3BKUA 2D3O1 4NLNA 4KHWA 1N8RT 2M2BA 1VC5A 2CVEA 1N5TA 1R89A 4A8QA 2I7PA 3MAAA 5BPMA 4KO0B 4RU9A 3H40A 2W3SA 2QK9A 1A9NB 1C1CB 2L08A 4DL6A 3PNIA 3OR2B 2QKQA 2PE8A 5F0UA 4I9QA 1VQPN 3R6GB 2G8WA 2A1AA 3A4TA 1Z4UA 2EFPA 1BHLA 2YX8A 2DB1A 4PKGA 3UI3A 2FPLA 4C7ZA 3MEEB 3PW5A 1HBNB 3QGIA 5KGWA 2QIFA 3F5TA 2Y9HA 1KHWA 5IILA 2C2OB 3DM2B 4Y2XA 2HS0A 1RYUA 1LQ9A 4DV1K 2DF4B 3OXFA 3LPTA 1NHKL 5C10A 4DOCA 3ETLA 4KTQA 1IBLJ 2MZTA 4EFAC 2VJUA 2K89A 3L7OA 2F7VA 1S72S 1VDHA 4CZJA 4BY9C 2LQ9A 3G6VA 4IQUA 3J81Y 3MECB 4U67Q 3E1YA 1KTQA 3R1LA 4XAKA 4AHUA 2KHOA 1RM6C 2QB0A 4WKYA 1IBKJ 2R7YA 4FM0A 1O08A 2DXEA 4FSVA 5KRTA 4M42A 3TA1A 3QSIA 4LVNP 3I8DA 5KOWA 4J90A 1YRXA 2HGMA 4GKKF 3WXMB 2QWLA 2CZ4A 1WOQA 3U02A 4P71A 2OUGA 5A8RA 4IFEA 4AH9A 5AI6A 4KHNA 1O0PA 2K2PA 4A4JA 4NXMJ 4YB6A 2AMCB 4W4MA 1Q86T 2DGZA 4WCEQ 4K41A 4HHTA 5K4LA 1NNDA 5L1LA 2H3GX 5AQOA 3P5TL 2O6KA 4Y2AA 3J7YU 4AL6A 5HLFA 3EKUA 3HVTA 3C23A 4CDIA 4J9KA 5F0XA 1RDDA 1D9DA 5IT0A 2FD2A 2LMIA 1RWVB 5AQFA 3PMNA 2KN4A 1NK5A 4AT1B 2GLEA 4P0QB 3VQ4A 4JS4A 4TUSA 4HH0A 2EC2A 4CLYA 1T7PA 2RDDA 4IBNA 2YTUA 3TRGA 2BKPA 1WG4A 1KD1O 5GVQA 1BWVA 1S0MA 1HA1A 1W9HA 2F5GA 3EPGA 2WRMA 4DU1A 2FY8A 5DZ6A 3NCQA 4GNIA 4FJGA 4LRAA 1VOMA 4EP5A 2OA8A 3DOMB 2WCXA 3OYBA 4KR0B 3N01A 1UP1A 4X65K 1RT4A 2D9PA 3LP2B 3HHNB 1T44A 1FTCA 3OPXA 4CO5A 5DS7A 1BQMB 2UU9F 1UPHA 1PYSB 1CJUA 4DV2F 3GCWP 5CE3A 4FS1A 2W11A 3ZETA 1ZXOA 2DBYA 1GFWB 3FC4A 1ZC6A 1FD2A 3N28A 3AVNA 4U67L 3GFZA 1AZSA 2JLGA 2V8GA 1YBAA 3QGGA 3H8MA 4JK1A 4CJLA 2JOQA 1QHTA 5HBMA 4BGAA 3AQOA 2ASYA 3RYLA 4FXVA 2W41A 1R8BA 3H0RB 1XNQJ 2WW4A 1M1KO 3FEYB 5FPDA 3PYDA 2DNQA 1FO4A 4LF7K 1V9PA 3RAQA 2HBKA 2DCUB 4CI6A 4HTLA 1VSDA 4F5QA 4JKCA 1ZQOA 2WFBA 4ISEA 1ITGA 1UZHA 1MSWD 2CQDA 7ICVA 4KSEB 2FI1A 2M3DA 4M1KA 1U1LA 4OV6A 3UKUA 3ZETB 1JLCB 5BRDA 1BO5O 1FRKA 4QBUA 2OO4A 4KBOA 2NRRA 4MO5A 4A47A 3NKYA 3CUNA 2A2DA 3QBWA 4ILHA 2UXDF 1W26A 1UVIA 4RW9B 2GOLA 4DOZA 1QAXA 4RW4B 2OFGX 2MQOA 5D4PA 1FXRA 4LFCJ 2HZCA 3MM8A 2QSFA 4UUXA 4LFAJ 2GV1A 2VYPA 4WWSA 2ROEA 3HM9A 4DTXA 4IEEA 4IH5A 3DDIA 2DEIA 1Q3VA 2MQLA 2JH7A 3QBCA 2NCKL 3B4MA 1Q9YA 2DHGA 3L7UA 2NREA 2HS4A 2E1CA 1KLNA 2HMIB 2IOHA 1Q3UA 4NZ0A 4PWDB 4FE3A 3P4IA 1V3SA 2E20A 2BGGA 4D3GA 3CC4S 3F9KA 1KLMA 2VGNA 1ZQPA 2MYFA 4B3TK 4A48A 1ZD2P 9ICUA 4XPEA 4WQ4C 2DWQA 3QIDA 5KT2A 4CK2A 4RQ5A 2PD1A 4FLYA 5F3XB 1PYOB 4LSNB 3E66A 3FZBA 3R1HA 1NMDA 2IM3A 3KZBA 4MLHA 1S9GB 2WB1C 5JS1A 2JEFA 2EFVA 3CCES 2CQCA 2WB4A 1N4LA 5E3PA 1LOUA 3M4XA 3VWSA 3IP4B 1EZZB 3PYGA 1C4AA 1ZBFA 3V72A 3OYCA 2AQ0A 4OPAA 4YMMA 2HHTA 2OHDA 4ZVUB 4L76A 4DUYF 2ALYB 3DYAB 4F26A 2YQ3A 2OHFA 4MDBA 5C0YA 3T1YF 1BUXA 3DKDA 2BZFA 4YOVA 4UB4A 2HHHJ 2CJBA 2EZXA 7AT1B 2CH5A 4I2QA 3VA0A 4E1JA 4F93B 2CZ9A 3QATA 2G13A 2MA1A 3AO3A 4H54A 3N7SC 1Q16B 1AUDA 1KC8T 5CHIA 2GBZA 1L3TA 3VZHA 3EUB2 3NASA 5AE3A 1NWKA 1NUEA 3KD5E 4USTA 1IBMK 5HATA 3TAFA 3NGDA 3TI0A 2EK1A 3DLGA 2OSRA 2KSOA 3OHBA 5AZJB 3UVJA 2EAOA 2V4QA 3ZDAA 2GMLA 2UUBF 4YD1A 4KGKA 3QX7A 4GIBA 5B08A 5HO4A 1REGX 2JWLA 4DR4J 2ZUAA 1CC7A 3AJ2A 3ET6B 3CJAA 3CEDA 1MW7A 1UJ5A 1DT9A 2OPSB 4DEZA 1KCFA 1Q8LA 3PXGa 4IO9L 4BC4A 5FP0A 3N6LA 4DL4A 4ZVTB 4LREA 4FBTA 1QTMA 1U0HA 5ETQA 2M9NA 3MMAB 1TL1A 4F3QA 3DEEA 2BACA 2HEKA 5IQQA 1TVAA 2BJ1A 1RSCA 3H45C 2KG5A 5J1EA 4J9OA 1PK1A 1X4DA 4RWXA 1A6LA 3C14B 2UUTA 4QAGA 4NO7A 3H5YA 3TUZC 4ZHRB 4M9HA 3DGPB 5F8IA 2E9RX 3CCEN 2E6MA 3VAFA 4TVAB 3RJMB 2HHHF 2AF6A 1XEZA 4E1MA 2R8GA 3QERA 4IH7A 4K0KJ 1J6ZA 3OW2M 2NLWA 1VC6A 1KQSR 4CM0A 2NRVA 2ZIXB 2UUCJ 2A41A 5ETOA 3VN5A 5KG6A 2BGWA 4NMXA 2P2CB 2OXOA 4IJAA 4CIFA 5EE9A 1BU6O 1I51B 3IR5B 3I5BA 3KKSA 1WC0A 4O9MA 2K3IA 3I56N 4DFPA 1T3NA 4UAWA 5JXSA 2V2ZA 2V69A 3QPIA 1AT1B 4CE9A 2LBOA 1ESVA 2G4BA 1I1GA 4OYPA 1B43A 1M6YA 1A5WA 1RYRA 2XSFA 1T3VA 1S0NA 3L2RA 4WFYA 3ALYA 3HI9A 1F1BB 3M8YA 3MHYA 3WXLA 2XI3A 1KBUA 3GZ7A 2KRRA 4M3WA 4U96A 3BQ1A 4FWSA 1WD6A 3R5CA 4K2JA 4DTSA 4CYUB 3DAWA 2HBRB 2OAUA 3QUQA 2VB6A 2EC0A 1UAWA 4KHYA 3CC4N 1JLCA 3QGPA 3UKUB 3F0NA 2VUGA 1HNZJ 4Z7CA 5DM7Q 5AKXA 4P2SA 2V5HG 3PTWA 2BQUA 2JRZA 4WYBA 1B0XA 3AJDA 3ZZRA 5KFDA 1UJ4A 4LSNA 2QKKA 2FE9A 1ZJNA 1M1GA 5AM5A 4OZ2A 3OY9A 1UT5A 2VFTA 4KHUA 2GMHA 4K43A 1PG5B 1SVDA 4CEBA 2HRYA 4C0OC 4JYAF 4MFFA 2FZKB 1M5VC 1RUSA 1HWUA 2LMRA 5KT3A 2ODGA 4RW7A 3KLFA 3PG9A 2YNHA 1SJ4P 4Z7YA 4KX3A 2ZOGA 2KNJA 1A6SA 4D3HA 1CZ9A 4CLKA 3FEZA 5HRNA 2UZAA 3PZPA 5RUBA 4LJMA 1GLLO 3JXOA 1FRXA 3OXGA 3ISND 4HTUA 1ZQFA 2J76E 1IH7A 4FW1A 1WELA 4EO8A 1GMWD 4FWMA 3R5BA 1UVKA 1SL1A 2NYVA 3V6DA 3G25A 5GAHI 4DV4J 1K9MT 3EZWA 3M7VA 4DL7A 4O3QA 1F5CA 1S6UA 3H08A 4JB8B 2V8DA 1UETA 3RH4A 4AHVA 4FWLA 1W2BR 5U47A 2XSJA 3V9XA 4X65F 1FK9B 2ZJ8A 1TL4A 1IWGA 4Z4HA 1N36J 4TURA 3A5LC 3QFUA 3IA0A 2QWQA 2EX3A 3NG8A 2F65A 3A8EA 4FJ9A 3FZLA 4A8EA 2EEYA 4L3NA 3RAMA 1TP7A 3QMQA 1EETA 4K4IA 5J1EB 3GL1A 2GWSA 4DV7J 1F5BA 4CJSA 2KKZA 4DHYA 4E3SA 5M1NA 5AKHA 1FT8A 2WF5A 3U9ZA 1ZZFA 5I42A 1AZSB 3TARA 1VQ4S 1GK8A 4OYBA 4PHPA 4ZPWR 1FWLA 1JJHA 4FZMA 2D8CA 2FY1A 1IM6A 3GTYX 1TKXA 1JXLA 4KLIA 3G4SN 4BQZA 2VD3A 3W2WB 1X5PA 2MJUA 3MGHA 3MD3A 4ELVA 1S59A 3K1RB 4OKJA 4Q45A 4PUOA 4CNQA 2APOA 3V5RA 4E7LA 1WAFA 4OV1A 3FMWA 2K8GA 3N6NA 5T7BA 4HDGA 4NASA 4JBCA 4NLGA 2Q6CA 2COLA 3UD4P 2QA4S 3AAWB 4I2QB 4RW8B 5BOLA 2YHWA 1RHMB 5D0HA 4YB7A 1NSQA 6FD1A 4UB6U 4BBYA 3ZSQA 5KFZA 2QL5B 3E58A 1HD0A 4QIWF 3K2PA 4CDGA 3TWZA 1D9FA 3WNHA 4M45A 2J9DE 4BDZA 2OP5A 3KJVB 4J5OA 3SXLA 5J29A 3K5NA 2H4WB 2LECA 3B6PA 3ETOA 1TKZA 1MQ2A 2UUBK 5IT9O 1ZQBA 3L5KA 4I64A 1VJWA 2YPZA 3AO4A 2MLYA 4IDHA 4JI5K 1XNQF 1WUDA 2E44A 4FLXA 1X9XA 4F4AA 3NVZA 4YFKA 4HHUA 2VJVA 2DITA 1D8LA 3MMCA 3R6LB 4KHQA 1UQVA 2LFVA 5KFMA 2NNWA 3SQGA 2FMPA 3KHYA 4I7FB 1CC8A 2O8BB 4PHTX 1LK7A 3UPQA 3IO1A 3D45A 5LXYA 2XBPA 5AQLA 5B66U 3W9HA 4G3IA 4O3PA 3SUPA 5AI0A 1D9AA 3L3VA 1K73O 1NH8A 4GVLA 5LL6Z 4RR5A 4CVNE 2R18A 2KDOA 3C15A 4QR2A 3MUTP 2CQIA 3JPTA 3C14A 1H2VZ 4LF2A 1V38A 1VLOA 5CZ1A 1E6VA 2DRBA 4CHOA 2O8EB 1L3SA 3AHPA 4WPAA 4CJQA 1T9WA 1HBOA 4RX6A 4YP3A 2JH3A 2KYXA 5ALPA 4A8WA 3NL0A 1L3VA 8ICZA 4CIEA 3G6EN 1TV6A 1K0TA 3HRDD 3CM6A 4K5RA 4TLQA 3HO1A 1KW4A 2XICA 4EK2A 3MR7A 3V6HA 3GIJA 3MMJA 4OZ0A 4UZBA 3VV2B 2X74A 2KHQA 2RQ4A 3M1FA 4ICAA 1NM1A 1LXNA 5ALMA 1ZTTA 3ZDBA 1GEHA 2HRTA 5LMNK 2J4RA 4A57A 2KL8A 2EWSA 4JI8K 5AKZA 4Y2KA 2NSBA 4DV6K 3K5PA 8ICQA 3K2YA 2ZXHA 2UUAK 3JPPA 3TADC 2FMQA 1HNWF 3HFZB 4JI3K 1H7WA 4EYHB 2G8HA 1P1LA 1BA1A 3CCMN 5AKYA 4M9LA 1FDNA 1YSJA 2O8FB 2PI4A 2ZIVA 1O13A 1ZQNA 1SXEA 4KLJA 3CF5L 1X9MA 1S79A 1RHUB 2RF2A 1NZPA 1I94K 2MKYA 4CEZA 3U8XA 4B02A 4K4HA 2VIHA 1NCLA 2HI0A 2V8HA 2PT0A 5AZIB 4ZCKA 1UWAA 2VQFF 1EQYA 5HVGA 5HLFB 3SJHA 2YI1A 1F9FA 4OZLA 4XO0A 2P5GA 1VSIA 4KTZA 3OJUA 1U7LA 3HSZA 2R9LA 1ZQSA 2HVZA 4ED3A 3VHQA 1VDVA 4WQ5C 3W2VA 1MU2A 1XHZA 4LQ9A 2G8UA 7ICLA 4YFUA 4LSZB 1C4CA 4P73A 1R31A 5J0OA 3MXIA 5I3UA 1QUPA 2VICA 9ICRA 4KJIA 5AKGA 2VF3A 2BPFA 2CWKA 2FF3B 4CO3A 3UPFA 4Y2SA 2EH9A 2JHDA 4DG1A 4BRKA 4E89A 2Z2YB 2HBJA 3V1RA 3FZMA 2DR9A 3P45B 1EXQA 1UEVA 3EUNA 2GCFA 1YT3A 2VFVA 3SV4A 1RLDA 2IC3A 9ICSA 1TU0B 3DDNA 4A8KA 2F4VJ 4CLPA 3SCKE 2R8IA 3SPZA 5AIAA 1Z2ZA 4DR2K 5J2HA 1Q79A 1T9XA 3CULA 3VQBA 4ZTJA 3I0SA 5AI9A 1C20A 3M8SA 3GV8B 1YWXA 3HBTA 1JUDA 2JJ4D 1C0UB 3P96A 3CCWA 1VQNS 5FLXU 1BOTO 1UFKA 3OUYA 3ETMA 1HR0K 1K44A 2IA6A 4FO6A 5J2QA 3VETA 5F8MA 1HEKA 1ZBTA 3FE1A 2LQJA 3ITHA 5AQVA 4ZK7M 2HHPA 1RAHB 2ILZA 4DPTA 4X4VA 2QG9B 4AUKA 2O8CB 4PH5A 3AY9A 4HACB 3OJSA 4ZLLA 4EELA 1HNVA 4ZIVA 4DSJA 5TKWA 3OYDA 3C6UA 1ZBHA 1N62A 3R5GA 4CF1A 4UB3A 1N2XA 3LH2S 5FPMA 3G4SS 2BUNA 3PCOB 4UB2A 4NA2A 2D41A 4AQYK 4KB1A 4I28A 2W4CA 1U1NA 1JCGA 2CXEA 4TU9A 1G6BA 4NWBA 3CD6S 2ASJA 1LXJA 2LXFA 4ELTA 3KMSA 1WC1A 2MJNA 4KY3A 4E8UA 1ZZNA 1NH7A 2Y1JA 3CCJS 2K7KA 3CIMA 4ZCIA 2YHYA 3LGMA 4DLGA 3E51A 4XEIA 3MGVA 2U2FA 5IV3A 2VOOA 3OQ2A 2BHNA 1M1HA 3P5BP 2DY1A 1Q81O 3ZDCA 1WSIA 4FKYA 1PAUB 3S7RA 2NRWA 7ICGA 1NGAA 2OPPB 5HMYA 1B4SA 4X62F 4DR6K 3TPQA 1P90A 4IC9A 5KFWA 2PY5A 4EFHA 4B3OA 5KG1A 4FLWA 5AE2A 5GADI 4JI2F 2FPMA 5T7LB 2P35A 4IRKA 2FDRA 3QUCA 4DV5J 3TJ8A 3M2RA 3KFWX 3Q8KA 2YNFB 3H8YA 1ROFA 3T1YJ 1TMJA 1HNXF 1O03A 1EJ7L 4B3RF 4DV2J 4RNFA 5AZIA 4QZDA 4F0MA 1KHVA 2P1JA 4ATNA 4RPFA 3LPUA 1HUZA 4KFBB 2QTDA 2LM1A 4JK8A 2PO4A 1BVSA 5E84A 2R4FA 3QRPA 3EVWA 2HZVA 2HF4A 1MWYA 1KRPA 4WU3A 3FLCO 3OTCA 3CWJA 3AO1A 1X6JA 2E3TA 2AYBA 3OR1A 2RJZA 3KNAA 2VWKA 4JV5K 3C6UB 5HRRA 4K4WA 2QA4N 3C66A 1LKYA 4DI6A 2DGUA 4CF8A 4I2BA 3GSIA 3O1WA 4WXWA 4DQ8A 4YB1P 4JI6K 1NZBA 1HYSB 2H3ZA 2CQPA 1IO2A 4BRCA 2AP6A 2O67A 4FXWA 4R5PB 3JAMU 3ZX2A 3HFVA 2ASDA 2DBBA 3CF5Q 4O5FA 4H0XB 2ZH8A 1HRHA 3CP8A 2KM8B 2QLFB 5K14A 5DB9A 3ZDDA 3K58A 1U1PA 1RNHA 5KFRA 4JUZA 1GMUA 2DFHA 2FJDB 1SPBP 2OYQA 4CHYA 1JLAB 3GJTB 4MFBB 1J53A 1R8CA 3HJFA 2IGIA 5GAEU 1HPMA 1DARA 2W6KA 3DXSX 1X4HA 2CPJA 3QZ8A 3CXCM 1NGCA 1YZ7A 3IR6B 2ABYA 4DV6F 3D0HE 3MTJA 1SJRA 1QTNB 2DNGA 4FJIA 1SL0A 3W66A 2BQ3A 2AZ3A 4Z6FA 4I67A 3GMGA 3NCRA 2HOIA 1RCXB 4F9OA 1IKVB 2MUTA 4Y00A 5AQRA 3C28A 2IRYA 1S1UA 1R3NA 3WX8A 2GUIA 2P9IA 4QIWD 3T5JA 2MSTA 4OJRA 1LCUA 3FMBA 3P31A 5DLFA 3VENA 3WIVA 2HK3A 4P0QA 5JLHA 4NWIA 5IC6B 4M41A 1FKOA 2YQ0A 3AA9A 1IBKK 1KONA 2VFSA 4PQUB 1VJ5A 2P9KB 4KH6A 3BF4A 3ZZYA 2IDEA 2C3PA 8ICLA 1SKRA 4DCOB 4JV0A 1RHJB 3B82A 2ERRA 4NCAA 3IRWP 4E7IA 5KFEA 2HFUA 5FD1A 1WSFA 3U1LA 2D3UA 3NF7A 2XEXA 1SH2A 4Z37A 3MM8B 3D1QA 1ZQIA 3ENWA 1LWEA 2VG5B 2FBXA 4M3YA 8ICTA 1CG2A 2V2QA 2CADA 4RJVA 2HSZA 5EE3A 2RQCA 5ETNA 2QMUB 4LIRA 1DQ9A 2E4LA 1PK3A 4PL1A 3TVKA 5A8KA 1WWUA 5JLFA 1B9DA 3QBXA 4MH8A 1HNVB 1F6TA 2FLNA 3M8QB 2Z1IA 2UU9J 3ZLJA 3PW2A 5C25A 2K4HA 3M2VA 4MYTA 2LQ5A 1J9AA 3BR9A 3LGNA 5HK4A 3TWHA 3DRSA 2A1JB 2ZUBA 4HI1A 4DX6A 5LM7E 1JLAA 4ES2A 4WFNL 3NH2A 5CYJA 5EE1A 4NLYA 9ICFA 2AT1B 2B4UA 2VODA 4ED6A 5F2RA 2Z1HA 1R0AA 1JNRB 4DV0F 4FJNA 9RUBA 2DXDA 4CLSA 3K5MA 5ALSA 1ZOLA 4A62A 4X62K 2UVUA 3OPKA 1Q9XA 3F2BA 1WN7A 4U7BA 1L7PA 3FBCA 3ENBA 2BX6A 2NRXA 1W97L 5IFMA 2BE7D 3ZTOA 2ZHBA 1EETB 4R5PA 3H98A 3ZT4A 4UUWA 4PG5A 5ALHA 4KO0A 1P9QC 1P6TA 1XMBA 3UDVA 2VANA 1GXLA 1REVA 4JHDB 1RT4B 3HHEA 3ICXA 1N54B 3H20A 4KI4A 2QV6A 4FZVA 1VSLA 3S3MA 1NGBA 5H1SV 1VR6A 1N63A 2W8KA 2G0AA 3SI8A 3CI5A 1S12A 1WOOA 5K20B 2NXNA 2MZJA 5B8HA 2NXEA 3CERA 2GQCA 5AK5A 4MKBA 1L3KA 1F3VA 2JFKA 2FUG9 2RDIA 3RGIA 1HMVB 4DX7A 3OYEA 3BF3A 1ZYQA 4LVOP 5HMLA 1ZQCA 1IJJA 4ZVOB 2CJAA 1WC4A 1JLBB 2IM0A 1UPMB 4K4YA 5DLGA 2JZBA 1LW2A 8ICOA 2DIUA 1Q78A 4IQWA 5CA7A 1S77D 2I0XA 2DKZA 2I9GA 3L2WA 5CD4A 5EX5A 4CHNA 4CM2A 5J0QA 1QE1A 4GMJB 2K3KA 3ISCA 4X2BA 4QZAA 4DV1F 3TP2A 1KAYA 1RB0A 3HHLA 3DOKB 1NGFA 1Y9OA 3LGHA 1PVRA 5B0DA 1NDPA 2XMKA 7ICOA 4QIEA 2V7YA 1JN3A 1Q81T 1ZQAA 4JKBA 4M63A 3NXZA 5M1OA 1NK7A 1CJTB 4DB3A 2RNEA 3AUOA 3C6TB 2IM1A 3GLJA 1DTTA 2VG6B 4YOTA 3QZ7A 4KLTA 2G2ZA 3RFAA 3NP5A 4HCCA 5BRHA 3CJKA 4I6AA 4OJ5A 3J7ZT 3HHLC 2KN7A 2XZDB 2VONA 4ED0A 1WF2A 3PUFA 3BO4A 1UEUA 3A8IA 8RUCA 1TGOA 2VPXB 4KMOB 5DM7L 1RHRB 4E7KA 2HFOA 4Y2RA 1ZXIA 3CMES 4R79A 4ID5A 5EDWA 2B9YA 5KFBA 2MPUA 5J0TA 4YXMA 3R2DJ 3WKCA 4KLHA 3AA8A 3R7NB 3DU5A 5KL1B 2GO9A 2DY9A 5DGBA 3M1YA 2XMAA 1T3QA 3CO0P 4CJ3A 3ZT3A 3ENAA 4K42A 1ZA1B 4USUA 4NL5A 2IVNA 1U4BA 3PO4A 4DQIA 5IT9Y 5H9FK 1Y0HA 4A8FA 4OX8A 4TQRA 1JJ4A 3M6XA 4AP9A 2MKSA 2ZJRL 3FSXA 1H0HB 5ALZA 1OSCA 2XO6A 1VBXA 3DRPB 1URRA 4GKKJ 4JKHA 1IKWA 1ZQYA 5DGAA 3CCRS 1VQ8N 4WFXA 1NKBA 1OYEA 5CHGA 1MN8A 5J2DA 3D66A 2J8SA 4F02A 3LP1B 2VQFK 4Q8EA 2IMWP 5E3CA 4U8YA 1TL3A 5E26A 4QCLA 2IVYA 1BGXT 8ICRA 3J81O 4QZBA 2XC9A 4DTJA 3NF8A 2MHNA 1KFTA 2BA9A 1PAEX 4FCYA 4ACOA 4KPCA 2A6OA 3N7RC 3NCPA 2KV2A 2XIDA 1RBSA 1SS6A 2HDOA 1RTHA 4UB5A 3WZ0A 1HNIB 1YJVA 2UXCK 5MLCQ 2VG6A 1XERA 4E19A 3CJCA 3D0IE 4IFYB 1F0MA 5I3PA 2UUAF 4C98A 4M5JA 1FKPB 4X4RA 4IH6A 1BLUA 2C3YA 4C2MA 3TTCA 1B99A 3I28A 1TUYA 1QQ6A 2MKJA 2RU3A 4DUZJ 3WK4A 1C0FA 2BCRA 2EANA 4CEDA 4M8LA 2NO4A 4FJ7A 1NK8A 4BVPA 2FB0A 5BN8A 3K57A 4GC7A 7ICSA 2NLXA 2ZH3A 2XMWA 1LK5A 1FJGF 3NRZA 4WFZA 4RQ2A 2QARB 3H0LB 5KT7A 2R8KA 1HQUA 2BW7A 1NGGA 2G06A 1OQ3A 3TFSA 4NCGB 4BACA 4UAYA 4JV5F 3KVGA 4OYZA 2GX9A 1LWFB 3D6FB 4RUBA 2CZVC 2RQMA 4DO9A 4U7UK 4NLXA 1Z00B 4YVZA 3MN5A 3QDKA 3BJYA 5D46A 3H2UB 2LQ8A 1HPZA 2B3TB 4TSXA 3OV7A 3CJ9A 4A8SA 3F53A 2GHVC 2BMBA 3L4PA 4XPCA 3VMFB 4IFVB 3MCNA 3PKYA 3AVFA 3TAEA 3ZCMA 4F5NA 3KUEA 4M5NA 1TKDA 1HBMA 2DHSA 1ZQHA 1FI4A 1YG0A 4ED1A 4NL9A 3ZSOA 2QA4G 4KLFA 2YX7A 4K0KF 1WJ9A 2F9DA 1FDDA 1ZA2B 4KQZA 2KEYA 4C8ZA 5C2CA 1FXXA 2ZIUA 3EW9A 1ZQKA 4ZOSA 9ICXA 2W9CA 4P72A 5IIOA 4RW6A 4HAIA 1NO8A 4K5SA 1IR2A 4OJHA 3UQ2A 2AD9A 2ZDPA 1ZAXA 3C5FA 3IMXA 4WF9L 3PIPQ 4EZ9A 3EZ5A 5JTIA 4QYRA 3E9PA 1H2UX 4B3MF 2F7TA 2FJ6A 5E7OB 4GKJJ 2HHXA 5AXLA 3FBEA 1IV8A 2XQCA 2HK2A 3QEVA 3FFIB 2VQEJ 2GHWA 4GVEA 2BDPA 2GNKA 3QJJA 3TSUA 2D0BA 2HRUA 4C1NI 1W25A 5FDLB 5FLXY 5KFIA 4OI2A 4B3MJ 5CY4A 1WG1A 2WSCC 5GADP 2QSWA 3RBXA 2IAJB 3EDQB 1VQKN 2GVZA 4PZNA 4PXCA 2KU7A 5C2FA 4DUYK 3RH5A 3SDEA 4RPXA 4PG8A 2RUGA 2KXHA 4ZVPB 8ICNA 1UHUA 7ICMA 3NF6A 3NLCA 3LDOA 4LFBF 5J2CA 3O9QA 3VQPA 1Q86O 5HRSA 2ZTEA 2DT9A 1N33K 3IFRA 4PPZA 4EHTA 4HWIA 4EBEA 1H3DA 1PJ6A 4TN2A 4MEXA 3T19A 2LP4A 3A3PB 1U0HB 2ZHAA 3D6TB 1TL3B 5ALJA 3N4WA 4CYUA 2WF7A 3OTDA 3B54A 3QINA 2Y0BB 5AKJA 2CQBA 3QNMA 1NPKA 2EFGA 3ET6A 4KHPK 2UVVA 5FPEA 3OYAA 3FZHA 2E1MC 2RH3A 1VRUA 3WBZA 2YJEA 5DDPC 3DN9A 4BRNA 1M1KT 2M0GB 2L9WA 1X9WA 1VQ7S 1SB6A 5M1FA 4YB5A 2P9IB 1N5WA 3JYTA 3UN5A 4AL7A 5HOOA 4QNLA 4P10A 3DDKA 4J91A 1RK8A 2OD4A 4AYBF 4YUDA 3EEQA 3MZIA 2QX0A 3ZC4A 2J5AA 3GQCA 3HRGA 2M4MA 4OKKA 1HI8A 2B9EA 2ZWHA 2A0FB 1DTQB 4CRJA 1MMNA 1ZPVA 3EGVA 5HAOA 5E3RA 5LMUF 3MCPA 1FK9A 1I3OB 4GMKA 4CEEA 1FE4A 3T6JA 2ADBA 5C5JA 2CVIA 1PYTA 5ADXA 3M8WA 2HFSA 4OX9J 3KD1E 4URQU 1ASWA 1PIEA 2W24A 3KYLA 4RQ7A 4ER8A 2LDIA 1TZ0A 3MMBA 1RFQA 4LC9B 4QOTA 5JRTA 1PVPA 4O4RA 1NJIO 2GW8A 2QZ8A 4BR0A 3O9RA 4CO0A 5KFUA 2YNGB 5IIMA 3L3FX 1OSDA 2NXCA 2RAQA 3V9WA 1EO1A 4LVSA 4PPXA 1WG8A 2R7WA 3Q8YA 2XGPA 4IKAA 2J6SA 3U3YA 3RBEA 2GUPA 1CULB 3VALA 2HS3A 4Q8FA 3VZIA 4DOAA 5ALVA 2ZC4A 2YKOA 5MAOA 1X4GA 5HRPA 1C1BB 7FDRA 2H4YB 2Q0UA 4B1VA 2OZMA 2Z4PA 5AQXA 2XYPB 5DDOC 4HYKA 1WWHA 4CECA 4KH1B 3TEGA 4AHRA 2G8IA 5HJYA 1HBUB 1FJEB 4RNNA 2Z56B 4TU7A 3OD2A 3PJ9A 3KZXA 1RBRA 4I0WA 2AGOA 3AOAA 3CJRA 3T6BA 4A5AA 3W5XA 3E2EA 4HT5A 2NRTA 4K4SA 3SMZA 2WONB 4GVBA 4DUTA 3Q22A 3ISNC 3OLAA 5AQIA 3L4BC 4N8OA 2OMOA 3FR0A 1Z1VA 5CJ7A 1NSAA 2XB2D 3QO9B 4RBVA 2KVCA 4KLSA 3VEVA 3TFRA 1OYDA 3Q8LA 3TR5A 5L9XA 2R2TA 5IT4A 3FRYA 3HSJA 4PY5A 3DYAA 3SK3A 5JU5A 1QUVA 3MM5A 3NMRA 1ATSA 5AQWA 3MX2A 3NDKA 4OYAA 3KLIA 4B1WB 2KKVA 1ZBLA 2WBMA 1TKTB 2Q1LA 1RI7A 1GLFO 2YHAA 3GE9A 3R3LA 5DMRA 3AD8C 4KKOB 4DCJB 9ICQA 2AYEA 1RKJA 3OYHA 1KC8O 1I5OB 5HP1A 1Q46A 1J2MA 1QY7A 3AVKA 1OO0B 4HDHA 3TA2A 4Q43A 1T95A 2K8AA 1QQ5A 1ZQ1C 1VQ5S 5AKIA 1FFGB 1HX1A 1RTIA 1SQKA 1ZQQA 1NZ8A 5B7WA 4OYIA 3P1GA 3K4GA 3RB0A 2HAFA 4Z4GA 2Y0SC 2EG1A 3CGIA 2A18A 4Y65A 4LF6J 1UL3A 1VBZA 3AO2A 1WBDA 2RF2B 3LUYA 3QO9A 5KAKA 1U24A 2VDHA 1K73T 3BGRA 3BQ0A 1ZQRA 3FZKA 1K8KB 4QWDA 4RWTA 2DFFA 4JI1F 1RWNB 3OHRA 1X3NA 5EX0A 3I9V9 3EY1A 3ZI4A 4UZCA 3N0VA 4DR7J 5C2DA 3P4UB 4H5RA 2EWHA 3QAUA 2HNYA 2FBVA 1Q5VA 4CIGA 3HSGA 1KQKA 5J1PA 1T6DA 2MSNA 3M6KA 2AV5A 1VLYA 4BC7A 4IUFA 3B8AX 3CC7S 1GXTA 4X4SA 4ED8A 1PKUA 2IVFB 4I7FA 2CPYA 1NDCA 4XK8C 3DXMA 3FSIA 1K47A 1PJ7A 2UUAJ 3SZ2A 3R2CJ 4FJJA 4RCHA 5BPLA 2ZJQQ 1ZRMA 1B0TA 5LL6d 2HWHA 1LFPA 1ZM2A 2PFUA 2ZUGA 3DGPA 1XNRK 1MA9B 3CQYA 3KK1B 3BS7A 3S3OA 1ZQJA 1YBUA 1JJ2M 1E6VB 2CQ2A 1PUZA 1SC1B 5G4DA 4PG6A 3M3ZA 1X4BA 1S6PB 3RBDA 1UWBA 2HFNA 2JC1A 2XY7A 3LF0A 4ZITA 4FYYB 4AD6A 3SQIA 4X4QA 4IQTA 3LP2A 4Y2CA 4JI0J 4FYVB 1KDHA 3QYYA 4P4OA 1RTIB 3EICA 1K1SA 4JKGA 4BG8A 1S5JA 2W7OA 2NXJA 4DR7F 4WFNQ 3DOLB 5KT4A 1VC0A 2QC3A 4BXOA 3CMAS 4NRUA 3CCSS 4FW2A 4CGJA 1EKSA 2IVMA 1TK8A 1VLBA 3H8SA 2P9SB 3KLEA 3EWGA 4X4PA 4MT1A 3AM9A 3TSPA 4BCAA 2OKQA 2YMPA 2I5HA 1X31C 2AX0A 1HYSA 2YBVA 4MFAA 1EX4A 3FQKA 3Q8MA 3VGSA 5GAEP 4CGDA 3QT7A 3QAEA 1OVQA 3VEZA 3PW7A 2A1RA 3VGUA 5F0WA 4LF8J 2NRHA 4WZQA 4LH5A 2L41A 4B1ZA 4PCQA 2KXNB 3F5EA 4M2YA 1VQOS 3NMAA 1HBOB 1DZ5A 2HGNA 3KK7A 2E8OA 4CWBA 1ZBIA 2DGXA 3D2FA 3M32B 3MGJA 1W2IA 4I6MA 1O6XA 4X64F 1X8DA 1JWWA 3CSKA 5IWAJ 3H5UA 1N5YA 2VBYA 5ALKA 4I2JA 2AJ0A 4JKAA 2ZC3A 3IWNC 2JZ5A 3FQLA 4ELUA 2X78A 5T7LA 1VQKS 1RXVA 2JSXA 1VQNN 5J2EA 2I6XA 3NS1A 4UOCA 1S57A 1OY6A 1HFEL 3HVTB 3QEAZ 3UVJB 4O8UA 4A8YA 4AXJA 3ID8A 1L8OA 4RBTA 1X0FA 1OUQA 5ETMA 2J7KA 1WSGA 3NAIA 3CJ3A 2G2YA 5ALYA 4KKOA 3UDCA 2A3ZA 5KFXA 1VRTA 3V2UC 1SQGA 2ASLA 4CGGA 4USKA 5EXWA 4CHQA 4YHHJ 2YCHA 2CNNB 5LSLA 4BE1A 4LF9F 4CTAA 1GLAG 1N6QA 4KV8A 1S3XA 4H4MA 9ICMA 1M5SA 3LDPA 2J0XA 2V9WA 2E2OA 3C2MA 4NLBA 2XS2A 1SJFA 3TQEA 3QNWB 3KKAC 4NEYA 3FM9A 1RDBA 7ICRA 3LYSA 5IWAF 2G8FA 3TOQA 1T94A 1JMTA 4HHJA 2ZJPQ 3RH6A 2CKWA 1CBKA 3BZKA 5AICA 2PEHA 1TTHB 4IG3B 3ZTRA 2AU0A 3RW6A 2YPYA 4DJBA 2Y8WA 4IDKB 2PBDA 3ATUA 4QZVB 5KTQA 4DCPB 1T02A 5GIPA 1N88A 5F8GA 3RJIA 2ASOA 3D2QA 4LD0A 1OJ4A 2KT5A 4Y2VA 4M9GA 3K8VA 1HJOA 1V4TA 3D2EA 3W8PA 3QIPA 3DLGB 1DEJA 4I2PB 3SQOP 4KITB 4J7CA 4ZLNA 2HBLA 3WEEA 2JEGA 4EEKA 2IFXA 4UT4A 4BWMA 4CF9A 3B0XA 3GE1A 4J8FA 5E33A 1DQ8A 2DIVA 3O08A 2MAXA 4LFBK 3AD9C 2FSJA 3ISZA 1HMVA 2ZVIA 3MWTA 4RW9A 4YQWA 2MHEA 2WVFA 2PN6A 4F4YA 1RTHB 2DFLA 3CCUS 4EYIB 3AQFA 2XG8A 4C0HA 2XCPA 1SGGA 4PKHA 4H4MB 1YF5L 5J0RA 3HX0A 1UWBB 4EWTA 4WP9A 1OWXA 5L8RC 4UY85 1IBCB 1CUKA 3GV5B 1WC5A 3P49B 2DD8S 5AQTA 3J7YI 3W9JA 4EEYA 1BA0A 1DURA 4HI2A 3ENHA 1S1VB 2HLUA 4Y34A 2HOFA 4NXNK 3GFKB 2V4JA 3ED5A 3MR5A 4A59A 2HMPA 2KZMA 5KGXA 3T1AA 3WXKA 4NEZA 4BXOB 1U25A 4O5BA 1IVZA 3SAFA 2I9SA 1NOZA 1JL1A 4MN4C 4E7JA 2OM6A 3Q8UA 4DF4A 3AARA 4DR2F 5HNKA 2JDJA 4JI7K 4ZVHA 3JS9A 3MR6A 3FGUA 1Q18A 4BE2A 4LF5K 4RW7B 1MDUB 3QUBA 2FVSA 2I8EA 2PFFB 3HPOA 4BG9A 2KTQA 3WK7A 3U4LA 3KZIU 2J8AA 1YIJS 3UMBA 2GHPA 5IS2A 1Z26A 4LZDA 3VQTA 3W61A 5A8WA 9ICPA 1H98A 3KK3A 2XULA 2Q3SA 2NZ4A 3AB2B 3UR0A 3JQMA 1T9VA 1OH7A 2ZBQA 1KBRA 4J9NA 1AFIA 1R6VA 3CNQP 2X3GA 3VQSA 2WBRA 2BR0A 1IR0A 2EK6A 1BIUA 4I4BA 3ZSZA 3L7PA 1NAQA 3SDEB 4M7XA 3R6MA 1KN6A 4GV9A 4LF8F 2R2SA 1J5OA 3E9OA 3PJWA 1HQUB 3H2LA 4JI4K 4ZVEA 3GFXA 3RB3A 4NI2B 4DR3J 3CJQA 2OPSA 2E8MA 1MA7A 2XCAA 4X64K 3S6EA 3V7LA 3LDNA 3V9SA 2E2QA 1CI4A 1QZ6A 2DNHA 4ENOA 4Y6IA 3DHWC 4USVA 2IHNA 4ISGA 2ZZNA 3OBWA 4IOCL 3EGWB 2FBYA 5HI7A 4CBXA 2O4GA 4ZPAA 4K4UA 5K5MA 3HP9A 2RDJA 1Q1KA 1VSKA 3UR3C 3R5AA 2W2QP 3ENVA 2A5XA 3ENOA 5KFOA 1YTYA 3FGVA 4WJBA 4JI0F 2XY8A 5DG9A 5KFSA 2E7VA 4QIVA 2ZWPA 2H3EB 3CCQN 2Z57B 1SZ2A 1CRXA 1YJ9S 5CEHA 1K6YA 1YVFA 1RKIA 3AQEA 4JI8J 2C2ZB 2GWKA 5IQ6A 4H4OB 3HKZC 2AIRB 5C12A 1VBKA 4F8RA 2DH9A 2F44A 3UE2A 1VJQA 1LWCB 1GO3F 3PFEA 1SXDA 4O5KA 3T5LA 2IM2A 2KIWA 4N47A 1LWFA 2NZTA 5AJ3K 1GTHA 3O1LA 3NGIA 4H4KA 1B70B 2MQNA 2HW3A 3PEJA 4QZHA 3U6FA 3D2SA 3TUJC 2JRSA 5AQQA 1LKZA 3FVYA 1XMOJ 4RQ3A 3MXHP 3H3OB 4OJ3A 4USIA 3H42A 5DJBA 2XRIA 1Y97A 4Z0UA 2IIHA 2X1FA 1TL7A 5AQHA 4CF0A 3I5CA 1CULA 5C25B 4JRPA 1ELOA 2HF3A 4NXMK 3SQ1A 2XHBA 1F0XA 4KRWA 5GAGI 4UBBA 4DPUA 4ID1A 2B43A 3OBYA 1QS4A 4FWPA 4G9ZA 5AK3A 2EXUA 1GLBG 1KOHA 2DQNB 2G08A 4DN0A 4WF9Q 2DFEA 2DGOA 1RWXB 3LW5C 3Q86A 2BXJA 4MK8A 1X5SA 3QB0A 2XLIA 4NX9A 2JL9A 3OLBA 1N56A 4V19S 1WLJA 2P51A 4JN4A 5ALEA 2DRAA 3K1ZA 1BPZA 5KT5A 2ZBPA 4OGEA 4OX9F 3CCVN 2W03A 2AWZA 2F8MA 2HLTA 4ZVSB 1DHMA 5I4MA 4PXDA 3GYNA 3GJQB 4K2XA 4BLGA 2FVPA 1YITS 4ZPDA 2AYGA 2KSOB 3R5DA 4F7VA 1URNA 4DR2J 5J2PA 1NLKL 2WAQD 2BOAA 3RRHA 5D4NA 2MQQA 5AE1A 1SC4B 4ED7A 5B0AA 1TKTA 5HQ8A 3PVXA 3C1YA 9ICKA 3MF5A 1KFDA 4DQSA 2KKPA 5CB1A 4CT8A 4ZP7A 5J1NA 3J81j 2MU2A 3ZNUA 1DQAA 3W5ZA 4PG4A 4FK0A 1Q7LB 1P27B 3CETA 4K4VA 2ATLA 2MQPA 5J2MB 4IR9A 3K0SA 2VASA 3WU2U 2PA8D 1U1OA 4N41A 3V1QA 3O4WA 5A2QY 2ZH9A 2RVJA 2D1KA 4I56A 1EIYB 2M70A 3JPNA 4LBHA 5ETKA 3VAMA 3A8YA 4Y2JA 4NMLA 1IKWB 1DTTB 4M47A 4OJPA 5J2KA 3G8TA 3J7A1 1JROA 1Y64A 3G10A 1AB8A 4YOEA 2DEJA 1L3UA 2C3MA 4QPTA 1YJ9N 1JALA 5AM4A 3ZXWA 2DKOB 3KLFB 7FD1A 3H8WA 2ZM6K 2C3UA 1RT6A 4C3LA 4KH4A 3OVBA 1HHQA 2A40A 4NRTA 5M2RA 3OL8A 4CEAA 3HKZF 3MPYA 4PQUA 4CERA 4ZJOA 2UP1A 1V9OA 4OD0A 5GAEI 2KKHA 2X1GA 3GONA 5AM3A 4DR5J 4ECUA 2V52B 2BBEA 9ICIA 2XMJA 3A12A 1M5PC 3D4JA 2LDYA 5M1KA 3U1MA 2KXFA 5T41A 2MKKA 3BYPA 1RQ0A 3DMJB 4O3OA 1VQLN 1EP4A 2VDIA 5DQIA 1RDAA 4IR1A 2J0SD 2CXYA 4CFAA 2BJ9A 5LMUJ 1N6QB 4OLPA 4KE5A 5L1JA 3Q0AA 1KEKA 4J2EA 1ZQUA 3DOKA 3JTNA 3CTRA 5J2MA 3E0FA 3M1VA 1RAGB 3C16B 1Z2LA 2FJBB 1HKCA 3HILA 1ZQZA 1S9EB 3KJNB 3I6PA 4WXOA 3WX4A 4AFFA 1RACB 2H9ZA 2LXIA 4B9MA 1DLOB 2EHGA 3T7ZA 4KX5A 4ZKAA 1H7XA 4A8MP 1MNEA 3ZD8A 2B0GA 1GXUA 1G4CA 4IYQA 2OTLS 2XY6A 4E1NA 4FBUA 5CR0A 1WHXA 3DXKB 1SUQB 3OL9A 2FLPA 5HP4A 1ILYA 2HQIA 2V2VA 3TJAA 4HUFA 1Q8BA 3I55N 1Q82O 4M5GA 4WIQA 2X1BA 4V1Ak 5ALTA 4WE1B 4JI7F 3D2WA 1GLJO 3SPYA 1C7YA 4HVJA 4BX9C 2UXDJ 1GMWA 1CS4B 1RDUA 3OL6A 1U2VA 3LA0A 4WKRA 1YQHA 1HARA 2VA8A 3D0PA 1JLBA 5ALGA 2E29A 1Y11A 4NB4A 1U6FA 3QICA 2KFNA 1U2FA 2FF6A 2PC6A 2CDQA 1P7DA 3M6GA 2FJEB 1VSMA 4CZIA 1JNZB 2YB1A 2P6SA 2UXCF 2O8FA 2YMMA 2WF6A 5AXKA 1LWXA 3G82A 4KHPF 1PC4A 1ZQLA 3ZT0A 3LL3A 4LZGA 4WFBL 4A46A 4C3KA 1XR5A 1NGDA 1QJHA 5KAFU 4L75A 2KZZA 2QL9B 1ZJMA 2MTLA 4J2BA 3ONQA 3CJ8A 3LQVA 4RQ1A 2CJQA 3K89A 3MECA 1JJ2R 3CJ5A 2Q43A 2ZE2B 3IMQJ 1MWQA 2P9LA 3WIUA 3HFKA 5L39A 3A1YG 1YI2S 2HIQA 3JSYA 4XIUA 5DDYA 1LKYB 4DR6J 2JLFA 4WP8A 3J7AN 4QIWC 2B51A 1S5LU 5IIIA 1VQSA 2OH2A 1YZ6A 2E8PA 5HQLA 3TAQA 4RQ8A 5HMWA 4FXDA 4DN9A 4F72A 1S1UB 2KIVA 1DY3A 1VSEA 4O44A 2CPDA 1S7HA 1HYZA 2YNIA 2FYXA 4CJ7A 2WB1F 5FJ4A 4RTFD 1HHSA 3TU5A 2OTJN 3CQXA 4PEOA 4I68A 4K4XA 4FVMA 3MR2A 2Y3YA 3JSMA 3SV3A 2E5LF 3VOVA 4TYBA 5J2NA 4M3XA 4S0MA 1O5JA 2F8KA 1TFWA 2KB2A 3ULEA 1Z00A 3D5MA 3OSNA 1FVQA 2QMXA 2Z8QA 3O3LA 3CC7N 1KQFB 5AM0A 5J2FA 4O3SA 1RDRA 3UFCX 3THXB 4JV5J 1X3MA 2E7XA 4WYWA 1XNRF 3CPEA 4YOUA 1R0CB 4LBIA 4Z6DA 7ICKA 5ALUA 2WSEC 1DRGA 1V6HA 2DO0A 3LK9A 2LKZA 3GDQA 2D3OR 3W5YA 4DDFA 3RB4A 5J2NB 3ZFVA 2K1RA 3RR7A 5HL7L 2YH0A 1JRPA 1OH6A 1LW2B 1SJQA 4BJQA 3AVAA 5KNIA 1V5IB 1B0PA 3CJSA 5ALFA 3J81U 3RBZA 5SZTA 3MTKA 2QWNA 3RMCA 1BCMA 5DBBA 3BO2A 8AT1B 2PMZC 4DR1J 1APSA 4ECXA 8ICEA 5KFFA 2GO8A 2P6RA 3O4QA 1Y5IB 4NLCA 3BPSP 1G99A 2W9BB 3N97B 2GZOA 5GMEA 1TUWA 2F1IA 1NGIA 1FHTA 3FKBA 2IJFA 2GX8A 1BWFO 2BKOA 2IRXA 4H03B 4CJ5A 3KJQB 3WQPA 1R7IA 1SJ3P 3ISDA 2RHQB 1KVKA 3QWPA 3SUNA 2ZUDA 5CWRA 3LP0A 3OHAA 1RAOA 1QM9A 1NJYA 3KK2A 5ALDA 2EKYA 4ANEA 2ZVSA 2V6AA 3KLVA 4CF5A 3KHGA 4U8VA 4JI3F 4NZ7A 5KAIU 3I0RB 2QMWA 5LJ3Y 2OEJA 1W2BM 1BDGA 1H38A 2X3DA 2YWKA 4DV3F 2RP5A 3BP8A 3GJRB 2P9CA 3Q7BA 5D0EA 1DLOA 2ZHOA 1A76A 4ILGB 1BUPA 3UN2A 2NUUG 3SQ2A 2W54A 3A8JA 1SZPA 3IBFB 4US8A 2G8VA 1CLFA 3RMBA 2PIIA 2YVSA 1YJWS 1UKUA 3WK5A 3IS9A 4NYPA 4ZPBA 2C2MB 4V19J 2LEAA 3ZSWA 4FOEA 3DC2A 5AQSA 3KLHA 2DHHA 4DWIA 4YN4A 4FP9A 3UKRA 1IN0A 2R3VA 5ETPA 3UDEA 1UEKA 5BR8K 4WE1A 2UXBF 1CPZA 4DL0C 3DV9A 2E7WA 4FZYA 3AVGA 4A8XA 2LEPA 1Z19A 2W55A 3CFRA 1KVCA 4IOXA 2BCSA 3DXKA 4CF4A 1BMQB 4QU7A 1OMSA 2XYGB 1YDLA 4ZOHC 5L9NA 2W2OP 1L7NA 2BOPA 3EE9A 1SV0C 2BKEA 3V7JA 2XGQA 4WQ4A 1ZBSA 1J5EJ 1ZH5A 4PJ0U 5BYQA 1FJGJ 4EUVA 2CGJA 1XIQA 2BABA 3QIPB 3OTEA 1IG6A 2D0OA 5AQGA 3PY8A 4KGMA 2VH7A 2LSNA 3KOOA 5THWA 3BY5A 3C1ZA 3BDPA 5FRNA 3UM9A 2Z2ZA 3GWCA 3G8QA 2MY7A 1NOYA 2G1HA 3BGLA 4NI2A 4X62J 4PKDB 3C95A 5F1XA 1V85A 1T03B 2BM1A 1TAMA 3UWTA 1FFSB 3SENA 3QRRA 3EZUA 3HK2A 3W65A 4GV3A 1FNOA 1XSLA