4UB8U

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 31
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub8U01
3A0HU 5KAFU 3WU2U 3KZIU 1S5LU 4UB8U 5GTIU 5KAIU 4PJ0U 5E79U 5GTHU 4UB6U 5H2FU 5TISU 5B66U 4IL6U 2DUYA 2AXTU 5B5EU 3A0BU
chains in the Genus database with same CATH superfamily
4Q43A 4QWDA 2G08A 2KHQA 1RYSA 7ICFA 3RRGA 4Y2RA 2G0AA 5C0YA 5F9NA 3RJIA 9ICOA 4EEYA 1NZPA 2AGQA 1IM4A 4QJFB 4O3NA 9ICRA 4F91B 2NRZA 2BZFA 1X6JA 4FZLA 7ICPA 4DSJA 2F8LA 1MSWD 4Z6CA 4P4PA 3QU7A 3KZXA 2ZJ5A 3WK7A 4O5CA 1WUDA 4PH5A 1ZQRA 4GXIA 2YTUA 3RFAA 5J0WA 9ICEA 5J8YA 1RXWA 1RQNA 5AI9A 2AJQA 1OUQA 2Z7JA 4RQ6A 1B4FA 5AKJA 4FO6A 3GIKA 5J0PA 1MQ2A 4JWMA 5DQHA 5KFSA 1KFTA 3H7IA 2KP7A 5BPCA 4DL2A 2ZXIA 3JPQA 5EWGA 3RJJA 1NK6A 5AKYA 1ZQUA 5KFDA 2M0NA 4J9QA 2BPCA 3H8JA 2KMDA 3GFKB 1O08A 3PO5A 2KK0A 2XCPA 1ZQAA 2LHTA 4HAIA 1RQLA 3J81j 1NZBA 4USAA 1SXDA 1XSLA 4Q8FA 4NJ8A 1SKSA 9ICXA 1L6NA 2I5HA 2KIVA 3RAQA 5KG1A 4KN7A 4KLTA 1JUDA 3VCBA 3ETLA 3MR5A 8ICPA 1SB3C 2ATLA 2K8BB 4M9LA 2W3SA 4Y2TA 8ICVA 1KQQA 5DGAA 2ZIUA 2R8GA 4B9TA 3BS7A 3H8WA 4Y2SA 2OEHA 4NM2A 2FPLA 4C8MA 3C1ZA 1P7DA 1X42A 5ALLA 3QYPA 4KLIA 2DGZA 2I1QA 1B43A 3RJEA 3GIIA 4C8NA 3M7DA 4M6WB 3ISDA 1WYGA 1U9LA 5ALUA 3WKAA 7ICKA 4YP3A 4RQ4A 2HHVA 5CRXA 1L7PA 1N2XA 2OWOA 2ES6A 4Z6FA 2HBJA 1ZQTA 4NLKA 7ICIA 1QH9A 2P66A 5CR0A 1ZQKA 4BWMA 2XY6A 2UVVA 1A76A 5DLGA 2Y9TA 1JX4A 2P6UA 2KJ9A 1PVRA 1M6YA 2G09A 3V6JA 3QXGA 4Y2UA 7ICNA 2W55A 3Q8MA 2OM6A 3BQ7A 3GIJA 2IMWP 3NVZA 4CNQA 3NVVA 1TK5A 1HUZA 2KHVA 4MEYA 2HOFA 3BS5A 3PMLA 1V9PA 2K8CB 3UXPA 3AEVA 1KLNA 7ICVA 2DPIA 1N48A 3K1RB 3EPIA 3Q8LA 4UBBA 2PKEA 3FC4A 3BQ0A 3PW5A 2KVSA 3KOOA 8ICOA 2PXIA 3RJFA 5AKKA 4ED1A 4ZOHC 1JN3A 5CJ7A 3OPXA 1KRPA 1QLNA 1ZQWA 5KAIU 2JZBB 3RH5A 1L8OA 1URJA 3T3FA 1X40A 2C28A 3KFUF 3SV4A 2DUYA 4JUZA 3SENA 4I2BA 3F2DA 4UATA 1ZOLA 1D9DA 5AM0A 1X9SA 2RP5A 1J2MA 2HHXA 4J9NA 4PZOA 1Z1BA 1XSNA 4DSEA 4EBCA 1ZD5A 4KLDA 3OTQA 2W8LA 3GU3A 5KFCA 2BQUA 3OJSA 3QUTA 3TACB 2Y1IA 1QSSA 3PX0A 3JPRA 2LMRA 8ICKA 1Q8KA 2HW3A 2RQ5A 3V72A 9ICLA 5KT5A 1XO0A 4YR3A 3PO4A 2FPKA 1TAMA 3M8RA 1SXEA 4ED0A 3AU2A 5HR6A 2HI0A 4JV1A 5AKXA 3HKZC 3B9JA 2JEJA 4UASA 3DV9A 2AU0A 1S77D 2KTQA 1ZQIA 5EWEA 2VA8A 4ELVA 5DG7A 3T5HA 1X6IA 1X66A 4KITB 4J9LA 5TZVA 3F2CA 4YR2A 3C29A 4AYBF 1DGSA 5ALHA 2ZUBA 4DS4A 3EZ5A 5L1IA 4BUGA 5KT6A 5B5EU 1Z00A 2UVRA 1XNSA 4TURA 4GC6A 4ECTA 3CYMA 7ICJA 2ASDA 2PFOA 4DQRA 8ICNA 1ZQLA 1V97A 2BKEA 3H0LB 4FE3A 2QARA 3NTUA 3UXNA 2ZIUB 1HIWA 1KEJA 9ICQA 1UQVA 5DBBA 4DOCA 4ED3A 5KG3A 3THVA 2RLTA 1NK9A 1O03A 2NO4A 3MR3A 3UMCA 3ZDCA 4OCZA 4DO9A 1ZQOA 4E0DA 2GH1A 4KMOB 1D9FA 4I29A 4F8RA 3Q8KA 4M2YA 3E2EA 4I2FA 2W54A 1T4GA 2ZG6A 1NK8A 4NLBA 3Q8SB 5J2BA 1N61A 2ZTEA 3BZKA 4UB4A 4RPYA 3M9MB 5KT2A 4M9JA 4IC9A 3QNMA 2GOLA 2HVHA 5AKZA 5KG2A 2F3NA 5KG7A 4YXMA 1BPXA 2PFPA 1VLBA 3RBDA 4NWIA 2E8PA 2C2RA 4DSFA 3RJGA 1Z4OA 5J2EA 3UMGA 1SWVA 3ZDBA 2W9BA 1NNLA 1PVQA 3BS5B 1EXNA 2EZYA 3AM9A 4EX7A 1JIHA 5FP0A 4I28A 4QZGA 3L5KA 4XUSA 4Y2JA 9ICCA 1COKA 3WKDA 4KLGA 1BPZA 5HP4A 1KW4A 4DLEA 8ICTA 8ICXA 5D46A 2ZXHA 2QKQA 4OJ6A 5A0LA 2YMLA 5IINA 1J2NA 4DS5A 3ZDEA 3TAPA 4J03A 4RT3A 2XGPA 2WF9A 3RB0A 3FAHA 4NLCA 4R66A 4M0AA 4IL6U 1ZJMA 4XA5A 2MU2A 3PW4A 3M9OB 3KD3A 2ISPA 1TAQA 4CCHA 1BNPA 3QX7A 3KHLA 3RJKA 4B9NA 5KFWA 3Q8RB 4RQNA 4RQMA 2PI5A 3QEBZ 2HBMA 5J2DA 3D2NA 1S0MA 2C22A 3HPOA 4FS2A 1QCKA 5IIMA 4BXOA 1X2IA 3SEIA 3MBYA 2KICA 2QB1A 1QSLA 4F4YA 4C8LA 2FMPA 2YB1A 2ZIWA 4NL9C 1XS9D 5JTIA 2G5IB 3GV8B 1VJ5A 1N62A 4TUSA 1TKDA 5J0RA 1JXEA 3SD7A 4DL3A 5KFAA 2IA6A 4PHDA 2RDJA 5ALIA 3PR4A 1Z00B 3PSPA 3IN5A 4ACOA 5L1MA 3M9NB 1U49A 2F1IA 1H38A 4J9PA 2QARB 3PNCA 3GZFA 2AXTU 5DB6A 1SV0C 1C20A 5KAFU 2ZJAA 4I2AA 3D2SA 8ICYA 2HHUA 4I2GA 4RNOA 2ZIXA 5J8YC 1U47A 4EZ9A 4DQPA 3TADC 1S0NA 2VA2A 1ZQCA 5KFGA 2XY7A 3PSIA 1BPBA 1SL0A 4EYHB 1MQ3A 4QZIA 5KFQA 5ALNA 3QZ8A 4Q8EA 4UB8U 2OXOA 2H3FA 1JXLA 1QQ5A 2KOBA 1F5SA 4NL9A 5ALDA 4CGZA 1LKYA 3HILA 1KDHA 4JK1A 3RAXA 1LB2B 3BJYA 1HEKA 4QWCA 3QU9A 4BX9C 2W9BB 2D6FC 2WFAA 4F4WA 5DB8A 3MGHA 5ALXA 4P0QB 1S10A 4IR1A 3TQ1A 2VKQA 4US8A 2NRVA 5KFZA 1DK2A 1SV0A 1C7YA 4QZFA 2IBKA 4RQ0A 4EZ6A 3G6VA 4UB5A 9ICKA 3VC8A 4J9RA 2UVUA 1PUZA 3HJEA 2KG5A 3JPNA 2DL0A 4FZMA 2KZMA 3EYZA 4M9NA 5J29A 4QIWC 2F8KA 4OO1J 1Z3EB 4B9LA 3TADA 2GWSA 4FFDA 1Q3UA 4ED2A 2R18A 9ICHA 3JPOA 3N7PD 1RYRA 2Y9UA 2W7OA 4RQ7A 2OH2A 1F44A 2W9AA 1JROA 2YMPA 1OW5A 5TISU 4CDGA 3KHHA 3U26A 3QU2A 1B22A 2RRDA 4C8KA 2KZZA 2WB1C 2W9MA 2DKXA 3M6KA 2EH9A 3UPQA 3JPPA 3ISBA 1Z1VA 5GTHU 3HW8A 3Q8QB 5ALYA 2FDRA 3C23A 2P6RA 1WWVA 4PGXA 5AI6A 2HHTA 2IOFK 3T79A 1T94A 1MC8A 4LJXA 1SZPA 3F5EA 2LBOA 7ICRA 3G6XA 8ICSA 2ZIWB 4O3OA 2F76X 2HDOA 1ZQPA 2JH7A 5JUMA 2BHNA 2JXJA 3IHQB 2NRWA 3KBBA 4MFFA 4PPXA 2R8IA 2VA3A 3LVVA 1UHUA 2HBKA 5AKGA 3SAGA 3A0HU 1ZQHA 3PX4A 3TANA 2W9CB 5AIAA 3WK8A 2WAQC 3IV6A 5G5HA 4KLQA 4LVSA 2IOHA 5JU5A 5ALSA 3CRXA 4QZDA 3LDAA 9ICVA 3QZ7A 1ZYQA 4IQUA 1ZJNA 1TV9A 7ICLA 2D3DA 2ZJ8A 1BPDA 2ZIXB 4FZNA 2HOQA 1F0MA 3MR6A 1BPEA 2ASLA 4KX3A 2H5XA 1S0VA 2Q0ZX 4OD0A 1A0PA 1L7OA 5CHGA 2HCFA 5DB7A 3Q8PB 3D2QA 3RBEA 8ICBA 4F4KA 3ISCA 1Q3VA 1L3SA 2PMZC 2FLPA 4P4MA 1HUOA 5L1LA 5KFEA 7ICHA 4OJ5A 4R8UA 4P4OA 2ASJA 3KHGA 5KFMA 4K4GA 3PSFA 4C80A 4G9BA 4Z6DA 4B9SA 5AICA 5T14A 5DG8A 4EENA 1RZTA 2YY6A 1Z4NA 2E8MA 1LKYB 2YMQA 5J2KA 1S9FA 1UCVA 3GILA 4RQ2A 2O6KA 1UT8A 3CW2C 8ICUA 1SWWA 4QWAA 3AUOA 3MC1A 5DBAA 1FIQA 1RXVA 2XVTA 4KLHA 5AM2A 1SKWA 2BCVA 2Y1JA 4QW8A 1U45A 4PHPA 2H3VA 2FMSA 3AMZA 5ALKA 4RNNA 1ZQ1C 2MAXA 2ISOA 2I6XA 3LYSA 3AQEA 3KZIU 3N7RC 5J0XA 2EQYA 5EE0A 5ALPA 2WF8A 4ECQA 2K4PA 2E1EA 4ECRA 4U6PA 3T5JA 1KTQA 4KLLA 4Y2XA 3BQTA 2DWQA 3JPTA 2JEGA 4PGQA 3QE9Y 2JMGA 3QUBA 1XSPA 4K4IA 8ICRA 2E5SA 3K75D 3TKAA 3QU4A 4UQGA 1TE2A 5BOMA 4F5PA 1NKBA 2WHEA 1ZRMA 1T7PA 2J6SA 1IG6A 5AK4A 3QU5A 4PJ0U 4O3PA 4RU9A 2LYHA 3DDHA 4F92B 4MFAA 3R9KA 3PW0A 1SV4A 3PW7A 1N5XA 3UM9A 4O5KA 3M1YA 3I28A 2Y0SF 1RM6C 3UMBA 1RYUA 1ZETA 3CNHA 5ALVA 4QZEA 5KFKA 3CP8A 2ZTCA 3C2LA 3UXOA 2R8HA 3ZI4A 2LYBA 4OJPA 5ALOA 1BGXT 1DXSA 5KG5A 1SKRA 1D8YA 2UVWA 5EE9A 3C1YA 3EW9A 1JMSA 3MGIA 1NJZA 4FBUA 2EZZA 3B0YA 2DPJA 4OJOA 2LYAA 1NKEA 2E8OA 2PFQA 2WTFA 2F1HA 4YR0A 4C7YA 1U48A 1UPHA 5HR7A 3AN1A 2JV3A 2VIXA 1KFDA 5L1JA 3TAQA 4DQQA 1RPLA 9ICWA 4HYKA 3MFHA 4DSLA 3PSTA 4QZ9A 3BDPA 3OJUA 4EBEA 4BGDA 5J2AA 4NLNA 4F72A 3NGDA 1TAUA 4R63A 1COOA 2FI1A 4JV0A 5J2CA 2CPRA 3RH4A 3BQ1A 5KG6A 3RB6A 3NVWA 1V38A 2JH1A 4XRHA 4YD2A 4UAYA 1X9MA 3WKEA 4O0IA 3NRWA 2H3QA 3C28A 3RJHA 2K4IA 5L1KA 4IR9A 1VDVA 3OHBA 3H8MA 3GIMA 4KX5A 5AKLA 4R8UB 4XQ8A 3SQIA 2FLNA 3RF9A 3TI0A 2BCSA 7ICGA 1HJPA 4IQTA 2F2AB 4ZH4A 5KFNA 4K4HA 3F5AA 3TFSA 4M47A 2MRLA 5HHHA 2FE9A 4DLGA 9ICGA 1CI4A 5AK6A 5DKWA 3GDXA 2RDIA 4RPZA 5KFPA 1NJXA 2N1RA 3MR2A 5ALMA 5CB1A 1L7NA 5AKEA 2E8NA 5J0UA 3EUB2 1K1SA 5AK5A 2G06A 2XIDA 1SIJA 4AP9A 4DOAA 2IHMA 4YMOA 2V4RA 8ICGA 1LVHA 2ESEA 5IIJA 5KL8B 4C7ZA 2ZIVA 2OHFA 1N63A 4MF2A 4KLEA 4F5OA 3IRUA 1WCLA 4ELUA 2KFNA 8ICMA 4DF8A 2YB4A 4LZDA 1FFUA 3WKBA 5IIKA 2JRZA 4C4RA 2PI4A 3DEEA 3EWAA 1FEZA 4F5QA 4DQSA 5KT4A 1TFRA 4PL2A 5G5GA 4DF4A 2KNJA 4F4XA 4EX6A 3OGUA 2XCAA 3TFRA 4KLJA 3ICXA 2KKVA 3AQFA 3O0FA 4B6JA 5KFVA 2XO7A 3PVXA 2A1JA 3NS1A 4UW9A 7ICOA 3SR6A 5KFYA 1KN5A 2YX8A 3NASA 2W3RA 5KT7A 4RZRA 5EE3A 3WK9A 1NKCA 1S5LU 3MDCA 1T3QA 4ELTA 2NV3A 2OCEA 4UB6U 5KFTA 4QZ8A 3I1YA 4PZNA 3I76A 3T5LA 2MUTA 4FBTA 5F9LA 4QZHA 4AYBC 1FO4A 7ICTA 2OYYA 3G6YA 3QEAZ 4QNLA 9ICTA 3OSPA 2A3VA 1S76D 8ICAA 5KNIA 2KJ5A 3E58A 2Q4TA 3IM1A 1N60A 9ICMA 1V85A 4I2IA 8ICHA 1DOQA 2AQ0A 4O3QA 4F71A 2JGAA 3H4DA 1XC9A 2KV2A 2AHOB 9ICUA 1S8OA 4EELA 3KKAC 3LWLA 1UA1A 4BDPA 4QW9A 2A1AA 3LWMA 1DK3A 2EDUA 2ZTDA 3N7SC 2NO5A 2LI6A 5KTQA 4I2HA 2BPGA 4NY8A 4PHAA 2W11A 1KL9A 1CRXA 4MHVA 2V9WA 3PMNA 1NK0A 3ZD8A 1L3UA 2B21A 1ED1A 4ECUA 3OSNA 4P0PA 3BZCA 5ALQA 3WU2U 1Z19A 2KVCA 2YN4A 2K4EA 8ICJA 1L7MA 5GTIU 1ZQQA 5AM4A 4I2EA 3WK6A 2KZ3A 4TUQA 2JEIA 5F3XB 5J0TA 3RH6A 3RR7A 4QZCA 5AHXA 5K4LA 4FS1A 5ALRA 4F5RA 4O3SA 4PHEA 4R65A 1IIPA 2JHDA 4O3RA 2K60A 4KLUA 4J9KA 2CN1A 4UAZA 1ZXIA 3QUCA 9ICSA 2JEFA 3KKAA 5D49A 4DEZA 3ALRA 9ICNA 4RQ5A 3RB4A 4C4TA 3SYZA 4UB3A 3F2BA 1BVSA 1TVAA 2R8JA 4M04A 4CRXA 4QWEA 3PY8A 1JI7A 2BCRA 2EANA 4YVZA 3RB3A 3HKZF 5CP2A 2ZIVB 2HHQA 1UA0A 5KG0A 9ICFA 4GXJA 2RHFA 4Q44A 2DFLA 2K8AA 4KLSA 5AI5A 1PVPA 1SL2A 1A77A 3L3FX 3C5FA 4M9GA 3K4GA 3NRZA 4GC7A 2KEYA 3WKCA 1WCNA 2LM4A 4X5VA 2B0CA 4BXOB 5HNKA 2FLLA 4ECXA 2GLEA 2C2EA 1ZQBA 3SAFA 2EAOA 2AH5A 2A1JB 4RQ3A 3GV7B 4IRCA 8ICQA 4YFKA 3N97B 3MABA 5DQGA 4YXJA 1IV8A 2K89A 1ZQNA 3IDWA 4KLMA 5CEHA 2G07A 3ETRA 2ODGA 2MUTB 4RNMA 2GO7A 4UAWA 2HOIA 2W43A 1ZQZA 2BDUA 5AK3A 4I2DA 5C5JA 4ECSA 2JR5A 4Z6EA 4KN4A 4C8OA 1QQ7A 4Y2PA 4RUCA 2BPFA 4YQWA 1NJWA 4O9MA 4BWJA 4DCCA 2W8KA 1ZQEA 4DOBA 2BR0A 2VANA 4DFMA 2KJ8A 2KKPA 3T5KA 5ALGA 1RDFA 4TQSA 4F50A 5EOZA 4F3OA 1ZQGA 4IQVA 3C2MA 2XC9A 2ZUCA 4DL4A 2PFNA 5EWFA 1ZQDA 5KFUA 1QSYA 7ICQA 3FDSA 4DL6A 2XY5A 3F53A 9ICAA 8ICFA 4UARA 4YMNA 4DSIA 4J9OA 1BNOA 4NV0A 9ICBA 5DQIA 3C21A 8ICWA 2ZUDA 1S0OA 2NRXA 4P0PB 1T3NA 1LV5A 2DQNB 3HRDD 1PK1A 1AROP 4RPXA 1A6SA 2F1JA 2BDPA 5AKIA 2IOFA 5HMMA 4RT2A 5AIBA 2V4QA 5J0YA 1QQ6A 2AGPA 1JRPA 3WK4A 5KL1B 5KFRA 1NK4A 4ECWA 2M9NA 3MDAA 1YZ6A 3IP4B 3H8SA 2EAPA 3NUQA 2P35A 2B6GA 3PR5B 4Y2VA 2XICA 3B0XA 4CE6A 4F4ZA 1GO3F 5ALJA 5KFFA 4IRDA 4YN4A 2MSNA 4ECVA 3JPSA 3HP6A 2A19A 5BOLA 3V7JA 4WJ3B 3ORYA 5J2JA 5J2GA 3RTVA 3PV8A 5D4BA 1CUKA 5AM5A 5AI0A 1L5UA 1XU4A 2HSZA 4DFDA 2W03A 4TUPA 5ALWA 1KSPA 4KLOA 4MEXA 1CEZA 1KFSA 2KIWA 3BQ2A 4GXKA 5J2IA 1ZQMA 4NLZA 3GV5B 4J9MA 5EE1A 3A0BU 2QB0A 9ICJA 2HHWA 4U7CA 2H3IA 4OJLA 4DFKA 1L3TA 1ZD3A 2XI9A 3RR8A 4NLGA 2QLTA 8ICIA 3H4BA 4MFCA 5ALEA 2I9GA 2W7PA 3GQCA 2F44A 5KT3A 5KFLA 4Y2QA 2KN7A 3KHRA 4Q45A 3C2KA 1RG6A 2WF5A 1J97A 1JALA 3D6JA 5J0SA 2VJ5A 2KFZA 2ALZA 3SV3A 2CXYA 5L9XA 2EAMA 2KE7A 4GLXA 1SL1A 4LZGA 1N5WA 4B9VA 8ICEA 4IRKA 4UAVA 2KSOA 1X9WA 3OHAA 1ZRNA 2BQ3A 5HHIA 3UQ2A 1K1QA 4RUAA 4I27A 5AM3A 4I2CA 4DWIA 2AQ4A 4NM1A 4YG2A 1ZQXA 2L5YA 3E0FA 1U4BA 5IIIA 1TK8A 5ALFA 4I2JA 4EBDA 4J9SA 5CWRA 2F77X 4DFJA 1B0XA 1IXRA 2HHSA 1NK5A 2BCQA 5KG4A 1ECWA 1ZQYA 4IQWA 1N56A 1UT5A 3V7LA 5KFBA 1XO1A 3KTQA 3NVYA 4CF5A 1S97A 4Y2YA 1OXJA 5JRTA 3H0RB 2KD1A 2H3ZA 3K1ZA 2R8KA 5KFXA 4MF8A 4YCXA 4DL7A 9ICPA 5E79U 4F2RA 3SI8A 5H2FU 4R64A 4NXZA 4PGYA 2VJ4A 2FPMA 2LKYA 1K5OA 2D8CA 5AI4A 1Q46A 4PL1A 5ALTA 1YT3A 4F2SA 5IILA 3ONNA 5DDYA 1T8EA 5DDMA 5ALZA 1PK1B 4P0QA 2DBYA 3H40A 3ZDAA 3PW2A 1WWUA 4GFJA 3IG5A 2MA1A 3PX6A 4G3IA 4QIWF 4JMUA 1D8LA 3LVWA 1ZD2P 2K4HA 2J6UA 1SGGA 5J0QA 1YZ7A 1NJYA 3PZPA 4CF3A 2FMQA 3RRHA 5J2FA 3H0MB 4O3MA 9ICIA 3V7KA 2NRTA 4KTQA 1SZHA 8ICCA 4EEKA 1ZQSA 3MGVA 4ED6A 1ZD4A 2BQRA 4UAUA 3C5GA 4IS7A 2WB1F 2DF4B 4F5NA 2NYVA 4F93B 3L4PA 3MFIA 3AL0B 2QB0B 4JV2A 7ICEA 2HVIA 4UB1A 2DKZA 3FYHA 1NK7A 3UQ0A 5KFOA 7ICMA 2EZXA 1FFVA 1DRGA 5DBCA 3HWTA 1ZQVA 3QUQA 1DGJA 4QZBA 3M8SA 4ICAA 3AU6A 4CF4A 5AI8A 2C2DA 2W04A 4RQ1A 1MA7A 3SZ2A 4RQ8A 2XGQA 4P2HA 2HBLA 3ZD9A 3TARA 7ICSA 4C0ZA 2YQEA 1PZNA 4YD1A 1QTMA 2LM1A 4BJQA 2WAQF 5HMLA 3SAHA 5DLFA 3N4MB 1X9XA 4B9MA 5CA7A 2Y0SC 1KBUA 2E1FA 4M6WA 4DQIA 3V6KA 1Y88A 5AM1A 1L8LA 2E3TA 2BGWA 2G5HB 1KKXA 4C4SA 3S6JA 4ECZA 5DGBA 1AQ6A 4GIBA 4B9UA 3V6HA 2KSOB 5KFJA 2W9CA 8ICLA 4ECYA 1BPYA 3ZDDA 4QZAA 4YMMA 2BCUA 4KLFA 3WK5A 1MN8A 3FM9A 3IG8A 2HMXA 1XWLA 2YMMA 5KFIA 3LK9A 4JB3A 3ED5A 2CRXA 1WG8A 1NI3A 4JWNA 5KFHA 2LPEA 4UBCA 2PMZF 3N28A 1NOMA 5J2HA 5B66U 1PK3A 4A8EA 4TQRA 1TK0A 4EYIB 1L3VA 3M6ZA 4DL5A 5DB9A 4KMUA 4ED8A 4UB2A 2IHNA 5IIOA 4DFPA 4O5EA 3SMVA 8ICZA 4QWBA 4US9A 5DG9A 1ZQJA 2J6TA 3EPGA 5AKHA 4M9HA 2WF6A 4DSKA 5J0OA 2WF7A 3HT3A 2AGOA 7ICUA 3HX0A 1D8BA 2FJ6A 1ZQFA 2JZBA 4ED7A
chains in the Genus database with same CATH topology
3A0HU 5KAFU 3WU2U 3KZIU 1S5LU 4UB8U 5GTIU 5KAIU 4PJ0U 5E79U 5GTHU 4UB6U 5H2FU 5TISU 5B66U 4IL6U 2DUYA 2AXTU 5B5EU 3A0BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  5KAF U;  3WU2 U;  3KZI U;  1S5L U;  4UB8 U;  5GTI U;  5KAI U;  4PJ0 U;  5E79 U;  5GTH U;  4UB6 U;  5H2F U;  5TIS U;  5B66 U;  4IL6 U;  2DUY A;  2AXT U;  5B5E U;  3A0B U; 
#chains in the Genus database with same CATH topology
 4Q43 A;  4QWD A;  2G08 A;  2KHQ A;  1RYS A;  7ICF A;  3RRG A;  4Y2R A;  2G0A A;  5C0Y A;  5F9N A;  3RJI A;  9ICO A;  4EEY A;  1NZP A;  2AGQ A;  1IM4 A;  4QJF B;  4O3N A;  9ICR A;  4F91 B;  2NRZ A;  2BZF A;  1X6J A;  4FZL A;  7ICP A;  4DSJ A;  2F8L A;  1MSW D;  4Z6C A;  4P4P A;  3QU7 A;  3KZX A;  2ZJ5 A;  3WK7 A;  4O5C A;  1WUD A;  4PH5 A;  1ZQR A;  4GXI A;  2YTU A;  3RFA A;  5J0W A;  9ICE A;  5J8Y A;  1RXW A;  1RQN A;  5AI9 A;  2AJQ A;  1OUQ A;  2Z7J A;  4RQ6 A;  1B4F A;  5AKJ A;  4FO6 A;  3GIK A;  5J0P A;  1MQ2 A;  4JWM A;  5DQH A;  5KFS A;  1KFT A;  3H7I A;  2KP7 A;  5BPC A;  4DL2 A;  2ZXI A;  3JPQ A;  5EWG A;  3RJJ A;  1NK6 A;  5AKY A;  1ZQU A;  5KFD A;  2M0N A;  4J9Q A;  2BPC A;  3H8J A;  2KMD A;  3GFK B;  1O08 A;  3PO5 A;  2KK0 A;  2XCP A;  1ZQA A;  2LHT A;  4HAI A;  1RQL A;  3J81 j;  1NZB A;  4USA A;  1SXD A;  1XSL A;  4Q8F A;  4NJ8 A;  1SKS A;  9ICX A;  1L6N A;  2I5H A;  2KIV A;  3RAQ A;  5KG1 A;  4KN7 A;  4KLT A;  1JUD A;  3VCB A;  3ETL A;  3MR5 A;  8ICP A;  1SB3 C;  2ATL A;  2K8B B;  4M9L A;  2W3S A;  4Y2T A;  8ICV A;  1KQQ A;  5DGA A;  2ZIU A;  2R8G A;  4B9T A;  3BS7 A;  3H8W A;  4Y2S A;  2OEH A;  4NM2 A;  2FPL A;  4C8M A;  3C1Z A;  1P7D A;  1X42 A;  5ALL A;  3QYP A;  4KLI A;  2DGZ A;  2I1Q A;  1B43 A;  3RJE A;  3GII A;  4C8N A;  3M7D A;  4M6W B;  3ISD A;  1WYG A;  1U9L A;  5ALU A;  3WKA A;  7ICK A;  4YP3 A;  4RQ4 A;  2HHV A;  5CRX A;  1L7P A;  1N2X A;  2OWO A;  2ES6 A;  4Z6F A;  2HBJ A;  1ZQT A;  4NLK A;  7ICI A;  1QH9 A;  2P66 A;  5CR0 A;  1ZQK A;  4BWM A;  2XY6 A;  2UVV A;  1A76 A;  5DLG A;  2Y9T A;  1JX4 A;  2P6U A;  2KJ9 A;  1PVR A;  1M6Y A;  2G09 A;  3V6J A;  3QXG A;  4Y2U A;  7ICN A;  2W55 A;  3Q8M A;  2OM6 A;  3BQ7 A;  3GIJ A;  2IMW P;  3NVZ A;  4CNQ A;  3NVV A;  1TK5 A;  1HUZ A;  2KHV A;  4MEY A;  2HOF A;  3BS5 A;  3PML A;  1V9P A;  2K8C B;  3UXP A;  3AEV A;  1KLN A;  7ICV A;  2DPI A;  1N48 A;  3K1R B;  3EPI A;  3Q8L A;  4UBB A;  2PKE A;  3FC4 A;  3BQ0 A;  3PW5 A;  2KVS A;  3KOO A;  8ICO A;  2PXI A;  3RJF A;  5AKK A;  4ED1 A;  4ZOH C;  1JN3 A;  5CJ7 A;  3OPX A;  1KRP A;  1QLN A;  1ZQW A;  5KAI U;  2JZB B;  3RH5 A;  1L8O A;  1URJ A;  3T3F A;  1X40 A;  2C28 A;  3KFU F;  3SV4 A;  2DUY A;  4JUZ A;  3SEN A;  4I2B A;  3F2D A;  4UAT A;  1ZOL A;  1D9D A;  5AM0 A;  1X9S A;  2RP5 A;  1J2M A;  2HHX A;  4J9N A;  4PZO A;  1Z1B A;  1XSN A;  4DSE A;  4EBC A;  1ZD5 A;  4KLD A;  3OTQ A;  2W8L A;  3GU3 A;  5KFC A;  2BQU A;  3OJS A;  3QUT A;  3TAC B;  2Y1I A;  1QSS A;  3PX0 A;  3JPR A;  2LMR A;  8ICK A;  1Q8K A;  2HW3 A;  2RQ5 A;  3V72 A;  9ICL A;  5KT5 A;  1XO0 A;  4YR3 A;  3PO4 A;  2FPK A;  1TAM A;  3M8R A;  1SXE A;  4ED0 A;  3AU2 A;  5HR6 A;  2HI0 A;  4JV1 A;  5AKX A;  3HKZ C;  3B9J A;  2JEJ A;  4UAS A;  3DV9 A;  2AU0 A;  1S77 D;  2KTQ A;  1ZQI A;  5EWE A;  2VA8 A;  4ELV A;  5DG7 A;  3T5H A;  1X6I A;  1X66 A;  4KIT B;  4J9L A;  5TZV A;  3F2C A;  4YR2 A;  3C29 A;  4AYB F;  1DGS A;  5ALH A;  2ZUB A;  4DS4 A;  3EZ5 A;  5L1I A;  4BUG A;  5KT6 A;  5B5E U;  1Z00 A;  2UVR A;  1XNS A;  4TUR A;  4GC6 A;  4ECT A;  3CYM A;  7ICJ A;  2ASD A;  2PFO A;  4DQR A;  8ICN A;  1ZQL A;  1V97 A;  2BKE A;  3H0L B;  4FE3 A;  2QAR A;  3NTU A;  3UXN A;  2ZIU B;  1HIW A;  1KEJ A;  9ICQ A;  1UQV A;  5DBB A;  4DOC A;  4ED3 A;  5KG3 A;  3THV A;  2RLT A;  1NK9 A;  1O03 A;  2NO4 A;  3MR3 A;  3UMC A;  3ZDC A;  4OCZ A;  4DO9 A;  1ZQO A;  4E0D A;  2GH1 A;  4KMO B;  1D9F A;  4I29 A;  4F8R A;  3Q8K A;  4M2Y A;  3E2E A;  4I2F A;  2W54 A;  1T4G A;  2ZG6 A;  1NK8 A;  4NLB A;  3Q8S B;  5J2B A;  1N61 A;  2ZTE A;  3BZK A;  4UB4 A;  4RPY A;  3M9M B;  5KT2 A;  4M9J A;  4IC9 A;  3QNM A;  2GOL A;  2HVH A;  5AKZ A;  5KG2 A;  2F3N A;  5KG7 A;  4YXM A;  1BPX A;  2PFP A;  1VLB A;  3RBD A;  4NWI A;  2E8P A;  2C2R A;  4DSF A;  3RJG A;  1Z4O A;  5J2E A;  3UMG A;  1SWV A;  3ZDB A;  2W9B A;  1NNL A;  1PVQ A;  3BS5 B;  1EXN A;  2EZY A;  3AM9 A;  4EX7 A;  1JIH A;  5FP0 A;  4I28 A;  4QZG A;  3L5K A;  4XUS A;  4Y2J A;  9ICC A;  1COK A;  3WKD A;  4KLG A;  1BPZ A;  5HP4 A;  1KW4 A;  4DLE A;  8ICT A;  8ICX A;  5D46 A;  2ZXH A;  2QKQ A;  4OJ6 A;  5A0L A;  2YML A;  5IIN A;  1J2N A;  4DS5 A;  3ZDE A;  3TAP A;  4J03 A;  4RT3 A;  2XGP A;  2WF9 A;  3RB0 A;  3FAH A;  4NLC A;  4R66 A;  4M0A A;  4IL6 U;  1ZJM A;  4XA5 A;  2MU2 A;  3PW4 A;  3M9O B;  3KD3 A;  2ISP A;  1TAQ A;  4CCH A;  1BNP A;  3QX7 A;  3KHL A;  3RJK A;  4B9N A;  5KFW A;  3Q8R B;  4RQN A;  4RQM A;  2PI5 A;  3QEB Z;  2HBM A;  5J2D A;  3D2N A;  1S0M A;  2C22 A;  3HPO A;  4FS2 A;  1QCK A;  5IIM A;  4BXO A;  1X2I A;  3SEI A;  3MBY A;  2KIC A;  2QB1 A;  1QSL A;  4F4Y A;  4C8L A;  2FMP A;  2YB1 A;  2ZIW A;  4NL9 C;  1XS9 D;  5JTI A;  2G5I B;  3GV8 B;  1VJ5 A;  1N62 A;  4TUS A;  1TKD A;  5J0R A;  1JXE A;  3SD7 A;  4DL3 A;  5KFA A;  2IA6 A;  4PHD A;  2RDJ A;  5ALI A;  3PR4 A;  1Z00 B;  3PSP A;  3IN5 A;  4ACO A;  5L1M A;  3M9N B;  1U49 A;  2F1I A;  1H38 A;  4J9P A;  2QAR B;  3PNC A;  3GZF A;  2AXT U;  5DB6 A;  1SV0 C;  1C20 A;  5KAF U;  2ZJA A;  4I2A A;  3D2S A;  8ICY A;  2HHU A;  4I2G A;  4RNO A;  2ZIX A;  5J8Y C;  1U47 A;  4EZ9 A;  4DQP A;  3TAD C;  1S0N A;  2VA2 A;  1ZQC A;  5KFG A;  2XY7 A;  3PSI A;  1BPB A;  1SL0 A;  4EYH B;  1MQ3 A;  4QZI A;  5KFQ A;  5ALN A;  3QZ8 A;  4Q8E A;  4UB8 U;  2OXO A;  2H3F A;  1JXL A;  1QQ5 A;  2KOB A;  1F5S A;  4NL9 A;  5ALD A;  4CGZ A;  1LKY A;  3HIL A;  1KDH A;  4JK1 A;  3RAX A;  1LB2 B;  3BJY A;  1HEK A;  4QWC A;  3QU9 A;  4BX9 C;  2W9B B;  2D6F C;  2WFA A;  4F4W A;  5DB8 A;  3MGH A;  5ALX A;  4P0Q B;  1S10 A;  4IR1 A;  3TQ1 A;  2VKQ A;  4US8 A;  2NRV A;  5KFZ A;  1DK2 A;  1SV0 A;  1C7Y A;  4QZF A;  2IBK A;  4RQ0 A;  4EZ6 A;  3G6V A;  4UB5 A;  9ICK A;  3VC8 A;  4J9R A;  2UVU A;  1PUZ A;  3HJE A;  2KG5 A;  3JPN A;  2DL0 A;  4FZM A;  2KZM A;  3EYZ A;  4M9N A;  5J29 A;  4QIW C;  2F8K A;  4OO1 J;  1Z3E B;  4B9L A;  3TAD A;  2GWS A;  4FFD A;  1Q3U A;  4ED2 A;  2R18 A;  9ICH A;  3JPO A;  3N7P D;  1RYR A;  2Y9U A;  2W7O A;  4RQ7 A;  2OH2 A;  1F44 A;  2W9A A;  1JRO A;  2YMP A;  1OW5 A;  5TIS U;  4CDG A;  3KHH A;  3U26 A;  3QU2 A;  1B22 A;  2RRD A;  4C8K A;  2KZZ A;  2WB1 C;  2W9M A;  2DKX A;  3M6K A;  2EH9 A;  3UPQ A;  3JPP A;  3ISB A;  1Z1V A;  5GTH U;  3HW8 A;  3Q8Q B;  5ALY A;  2FDR A;  3C23 A;  2P6R A;  1WWV A;  4PGX A;  5AI6 A;  2HHT A;  2IOF K;  3T79 A;  1T94 A;  1MC8 A;  4LJX A;  1SZP A;  3F5E A;  2LBO A;  7ICR A;  3G6X A;  8ICS A;  2ZIW B;  4O3O A;  2F76 X;  2HDO A;  1ZQP A;  2JH7 A;  5JUM A;  2BHN A;  2JXJ A;  3IHQ B;  2NRW A;  3KBB A;  4MFF A;  4PPX A;  2R8I A;  2VA3 A;  3LVV A;  1UHU A;  2HBK A;  5AKG A;  3SAG A;  3A0H U;  1ZQH A;  3PX4 A;  3TAN A;  2W9C B;  5AIA A;  3WK8 A;  2WAQ C;  3IV6 A;  5G5H A;  4KLQ A;  4LVS A;  2IOH A;  5JU5 A;  5ALS A;  3CRX A;  4QZD A;  3LDA A;  9ICV A;  3QZ7 A;  1ZYQ A;  4IQU A;  1ZJN A;  1TV9 A;  7ICL A;  2D3D A;  2ZJ8 A;  1BPD A;  2ZIX B;  4FZN A;  2HOQ A;  1F0M A;  3MR6 A;  1BPE A;  2ASL A;  4KX3 A;  2H5X A;  1S0V A;  2Q0Z X;  4OD0 A;  1A0P A;  1L7O A;  5CHG A;  2HCF A;  5DB7 A;  3Q8P B;  3D2Q A;  3RBE A;  8ICB A;  4F4K A;  3ISC A;  1Q3V A;  1L3S A;  2PMZ C;  2FLP A;  4P4M A;  1HUO A;  5L1L A;  5KFE A;  7ICH A;  4OJ5 A;  4R8U A;  4P4O A;  2ASJ A;  3KHG A;  5KFM A;  4K4G A;  3PSF A;  4C80 A;  4G9B A;  4Z6D A;  4B9S A;  5AIC A;  5T14 A;  5DG8 A;  4EEN A;  1RZT A;  2YY6 A;  1Z4N A;  2E8M A;  1LKY B;  2YMQ A;  5J2K A;  1S9F A;  1UCV A;  3GIL A;  4RQ2 A;  2O6K A;  1UT8 A;  3CW2 C;  8ICU A;  1SWW A;  4QWA A;  3AUO A;  3MC1 A;  5DBA A;  1FIQ A;  1RXV A;  2XVT A;  4KLH A;  5AM2 A;  1SKW A;  2BCV A;  2Y1J A;  4QW8 A;  1U45 A;  4PHP A;  2H3V A;  2FMS A;  3AMZ A;  5ALK A;  4RNN A;  1ZQ1 C;  2MAX A;  2ISO A;  2I6X A;  3LYS A;  3AQE A;  3KZI U;  3N7R C;  5J0X A;  2EQY A;  5EE0 A;  5ALP A;  2WF8 A;  4ECQ A;  2K4P A;  2E1E A;  4ECR A;  4U6P A;  3T5J A;  1KTQ A;  4KLL A;  4Y2X A;  3BQT A;  2DWQ A;  3JPT A;  2JEG A;  4PGQ A;  3QE9 Y;  2JMG A;  3QUB A;  1XSP A;  4K4I A;  8ICR A;  2E5S A;  3K75 D;  3TKA A;  3QU4 A;  4UQG A;  1TE2 A;  5BOM A;  4F5P A;  1NKB A;  2WHE A;  1ZRM A;  1T7P A;  2J6S A;  1IG6 A;  5AK4 A;  3QU5 A;  4PJ0 U;  4O3P A;  4RU9 A;  2LYH A;  3DDH A;  4F92 B;  4MFA A;  3R9K A;  3PW0 A;  1SV4 A;  3PW7 A;  1N5X A;  3UM9 A;  4O5K A;  3M1Y A;  3I28 A;  2Y0S F;  1RM6 C;  3UMB A;  1RYU A;  1ZET A;  3CNH A;  5ALV A;  4QZE A;  5KFK A;  3CP8 A;  2ZTC A;  3C2L A;  3UXO A;  2R8H A;  3ZI4 A;  2LYB A;  4OJP A;  5ALO A;  1BGX T;  1DXS A;  5KG5 A;  1SKR A;  1D8Y A;  2UVW A;  5EE9 A;  3C1Y A;  3EW9 A;  1JMS A;  3MGI A;  1NJZ A;  4FBU A;  2EZZ A;  3B0Y A;  2DPJ A;  4OJO A;  2LYA A;  1NKE A;  2E8O A;  2PFQ A;  2WTF A;  2F1H A;  4YR0 A;  4C7Y A;  1U48 A;  1UPH A;  5HR7 A;  3AN1 A;  2JV3 A;  2VIX A;  1KFD A;  5L1J A;  3TAQ A;  4DQQ A;  1RPL A;  9ICW A;  4HYK A;  3MFH A;  4DSL A;  3PST A;  4QZ9 A;  3BDP A;  3OJU A;  4EBE A;  4BGD A;  5J2A A;  4NLN A;  4F72 A;  3NGD A;  1TAU A;  4R63 A;  1COO A;  2FI1 A;  4JV0 A;  5J2C A;  2CPR A;  3RH4 A;  3BQ1 A;  5KG6 A;  3RB6 A;  3NVW A;  1V38 A;  2JH1 A;  4XRH A;  4YD2 A;  4UAY A;  1X9M A;  3WKE A;  4O0I A;  3NRW A;  2H3Q A;  3C28 A;  3RJH A;  2K4I A;  5L1K A;  4IR9 A;  1VDV A;  3OHB A;  3H8M A;  3GIM A;  4KX5 A;  5AKL A;  4R8U B;  4XQ8 A;  3SQI A;  2FLN A;  3RF9 A;  3TI0 A;  2BCS A;  7ICG A;  1HJP A;  4IQT A;  2F2A B;  4ZH4 A;  5KFN A;  4K4H A;  3F5A A;  3TFS A;  4M47 A;  2MRL A;  5HHH A;  2FE9 A;  4DLG A;  9ICG A;  1CI4 A;  5AK6 A;  5DKW A;  3GDX A;  2RDI A;  4RPZ A;  5KFP A;  1NJX A;  2N1R A;  3MR2 A;  5ALM A;  5CB1 A;  1L7N A;  5AKE A;  2E8N A;  5J0U A;  3EUB 2;  1K1S A;  5AK5 A;  2G06 A;  2XID A;  1SIJ A;  4AP9 A;  4DOA A;  2IHM A;  4YMO A;  2V4R A;  8ICG A;  1LVH A;  2ESE A;  5IIJ A;  5KL8 B;  4C7Z A;  2ZIV A;  2OHF A;  1N63 A;  4MF2 A;  4KLE A;  4F5O A;  3IRU A;  1WCL A;  4ELU A;  2KFN A;  8ICM A;  4DF8 A;  2YB4 A;  4LZD A;  1FFU A;  3WKB A;  5IIK A;  2JRZ A;  4C4R A;  2PI4 A;  3DEE A;  3EWA A;  1FEZ A;  4F5Q A;  4DQS A;  5KT4 A;  1TFR A;  4PL2 A;  5G5G A;  4DF4 A;  2KNJ A;  4F4X A;  4EX6 A;  3OGU A;  2XCA A;  3TFR A;  4KLJ A;  3ICX A;  2KKV A;  3AQF A;  3O0F A;  4B6J A;  5KFV A;  2XO7 A;  3PVX A;  2A1J A;  3NS1 A;  4UW9 A;  7ICO A;  3SR6 A;  5KFY A;  1KN5 A;  2YX8 A;  3NAS A;  2W3R A;  5KT7 A;  4RZR A;  5EE3 A;  3WK9 A;  1NKC A;  1S5L U;  3MDC A;  1T3Q A;  4ELT A;  2NV3 A;  2OCE A;  4UB6 U;  5KFT A;  4QZ8 A;  3I1Y A;  4PZN A;  3I76 A;  3T5L A;  2MUT A;  4FBT A;  5F9L A;  4QZH A;  4AYB C;  1FO4 A;  7ICT A;  2OYY A;  3G6Y A;  3QEA Z;  4QNL A;  9ICT A;  3OSP A;  2A3V A;  1S76 D;  8ICA A;  5KNI A;  2KJ5 A;  3E58 A;  2Q4T A;  3IM1 A;  1N60 A;  9ICM A;  1V85 A;  4I2I A;  8ICH A;  1DOQ A;  2AQ0 A;  4O3Q A;  4F71 A;  2JGA A;  3H4D A;  1XC9 A;  2KV2 A;  2AHO B;  9ICU A;  1S8O A;  4EEL A;  3KKA C;  3LWL A;  1UA1 A;  4BDP A;  4QW9 A;  2A1A A;  3LWM A;  1DK3 A;  2EDU A;  2ZTD A;  3N7S C;  2NO5 A;  2LI6 A;  5KTQ A;  4I2H A;  2BPG A;  4NY8 A;  4PHA A;  2W11 A;  1KL9 A;  1CRX A;  4MHV A;  2V9W A;  3PMN A;  1NK0 A;  3ZD8 A;  1L3U A;  2B21 A;  1ED1 A;  4ECU A;  3OSN A;  4P0P A;  3BZC A;  5ALQ A;  3WU2 U;  1Z19 A;  2KVC A;  2YN4 A;  2K4E A;  8ICJ A;  1L7M A;  5GTI U;  1ZQQ A;  5AM4 A;  4I2E A;  3WK6 A;  2KZ3 A;  4TUQ A;  2JEI A;  5F3X B;  5J0T A;  3RH6 A;  3RR7 A;  4QZC A;  5AHX A;  5K4L A;  4FS1 A;  5ALR A;  4F5R A;  4O3S A;  4PHE A;  4R65 A;  1IIP A;  2JHD A;  4O3R A;  2K60 A;  4KLU A;  4J9K A;  2CN1 A;  4UAZ A;  1ZXI A;  3QUC A;  9ICS A;  2JEF A;  3KKA A;  5D49 A;  4DEZ A;  3ALR A;  9ICN A;  4RQ5 A;  3RB4 A;  4C4T A;  3SYZ A;  4UB3 A;  3F2B A;  1BVS A;  1TVA A;  2R8J A;  4M04 A;  4CRX A;  4QWE A;  3PY8 A;  1JI7 A;  2BCR A;  2EAN A;  4YVZ A;  3RB3 A;  3HKZ F;  5CP2 A;  2ZIV B;  2HHQ A;  1UA0 A;  5KG0 A;  9ICF A;  4GXJ A;  2RHF A;  4Q44 A;  2DFL A;  2K8A A;  4KLS A;  5AI5 A;  1PVP A;  1SL2 A;  1A77 A;  3L3F X;  3C5F A;  4M9G A;  3K4G A;  3NRZ A;  4GC7 A;  2KEY A;  3WKC A;  1WCN A;  2LM4 A;  4X5V A;  2B0C A;  4BXO B;  5HNK A;  2FLL A;  4ECX A;  2GLE A;  2C2E A;  1ZQB A;  3SAF A;  2EAO A;  2AH5 A;  2A1J B;  4RQ3 A;  3GV7 B;  4IRC A;  8ICQ A;  4YFK A;  3N97 B;  3MAB A;  5DQG A;  4YXJ A;  1IV8 A;  2K89 A;  1ZQN A;  3IDW A;  4KLM A;  5CEH A;  2G07 A;  3ETR A;  2ODG A;  2MUT B;  4RNM A;  2GO7 A;  4UAW A;  2HOI A;  2W43 A;  1ZQZ A;  2BDU A;  5AK3 A;  4I2D A;  5C5J A;  4ECS A;  2JR5 A;  4Z6E A;  4KN4 A;  4C8O A;  1QQ7 A;  4Y2P A;  4RUC A;  2BPF A;  4YQW A;  1NJW A;  4O9M A;  4BWJ A;  4DCC A;  2W8K A;  1ZQE A;  4DOB A;  2BR0 A;  2VAN A;  4DFM A;  2KJ8 A;  2KKP A;  3T5K A;  5ALG A;  1RDF A;  4TQS A;  4F50 A;  5EOZ A;  4F3O A;  1ZQG A;  4IQV A;  3C2M A;  2XC9 A;  2ZUC A;  4DL4 A;  2PFN A;  5EWF A;  1ZQD A;  5KFU A;  1QSY A;  7ICQ A;  3FDS A;  4DL6 A;  2XY5 A;  3F53 A;  9ICA A;  8ICF A;  4UAR A;  4YMN A;  4DSI A;  4J9O A;  1BNO A;  4NV0 A;  9ICB A;  5DQI A;  3C21 A;  8ICW A;  2ZUD A;  1S0O A;  2NRX A;  4P0P B;  1T3N A;  1LV5 A;  2DQN B;  3HRD D;  1PK1 A;  1ARO P;  4RPX A;  1A6S A;  2F1J A;  2BDP A;  5AKI A;  2IOF A;  5HMM A;  4RT2 A;  5AIB A;  2V4Q A;  5J0Y A;  1QQ6 A;  2AGP A;  1JRP A;  3WK4 A;  5KL1 B;  5KFR A;  1NK4 A;  4ECW A;  2M9N A;  3MDA A;  1YZ6 A;  3IP4 B;  3H8S A;  2EAP A;  3NUQ A;  2P35 A;  2B6G A;  3PR5 B;  4Y2V A;  2XIC A;  3B0X A;  4CE6 A;  4F4Z A;  1GO3 F;  5ALJ A;  5KFF A;  4IRD A;  4YN4 A;  2MSN A;  4ECV A;  3JPS A;  3HP6 A;  2A19 A;  5BOL A;  3V7J A;  4WJ3 B;  3ORY A;  5J2J A;  5J2G A;  3RTV A;  3PV8 A;  5D4B A;  1CUK A;  5AM5 A;  5AI0 A;  1L5U A;  1XU4 A;  2HSZ A;  4DFD A;  2W03 A;  4TUP A;  5ALW A;  1KSP A;  4KLO A;  4MEX A;  1CEZ A;  1KFS A;  2KIW A;  3BQ2 A;  4GXK A;  5J2I A;  1ZQM A;  4NLZ A;  3GV5 B;  4J9M A;  5EE1 A;  3A0B U;  2QB0 A;  9ICJ A;  2HHW A;  4U7C A;  2H3I A;  4OJL A;  4DFK A;  1L3T A;  1ZD3 A;  2XI9 A;  3RR8 A;  4NLG A;  2QLT A;  8ICI A;  3H4B A;  4MFC A;  5ALE A;  2I9G A;  2W7P A;  3GQC A;  2F44 A;  5KT3 A;  5KFL A;  4Y2Q A;  2KN7 A;  3KHR A;  4Q45 A;  3C2K A;  1RG6 A;  2WF5 A;  1J97 A;  1JAL A;  3D6J A;  5J0S A;  2VJ5 A;  2KFZ A;  2ALZ A;  3SV3 A;  2CXY A;  5L9X A;  2EAM A;  2KE7 A;  4GLX A;  1SL1 A;  4LZG A;  1N5W A;  4B9V A;  8ICE A;  4IRK A;  4UAV A;  2KSO A;  1X9W A;  3OHA A;  1ZRN A;  2BQ3 A;  5HHI A;  3UQ2 A;  1K1Q A;  4RUA A;  4I27 A;  5AM3 A;  4I2C A;  4DWI A;  2AQ4 A;  4NM1 A;  4YG2 A;  1ZQX A;  2L5Y A;  3E0F A;  1U4B A;  5III A;  1TK8 A;  5ALF A;  4I2J A;  4EBD A;  4J9S A;  5CWR A;  2F77 X;  4DFJ A;  1B0X A;  1IXR A;  2HHS A;  1NK5 A;  2BCQ A;  5KG4 A;  1ECW A;  1ZQY A;  4IQW A;  1N56 A;  1UT5 A;  3V7L A;  5KFB A;  1XO1 A;  3KTQ A;  3NVY A;  4CF5 A;  1S97 A;  4Y2Y A;  1OXJ A;  5JRT A;  3H0R B;  2KD1 A;  2H3Z A;  3K1Z A;  2R8K A;  5KFX A;  4MF8 A;  4YCX A;  4DL7 A;  9ICP A;  5E79 U;  4F2R A;  3SI8 A;  5H2F U;  4R64 A;  4NXZ A;  4PGY A;  2VJ4 A;  2FPM A;  2LKY A;  1K5O A;  2D8C A;  5AI4 A;  1Q46 A;  4PL1 A;  5ALT A;  1YT3 A;  4F2S A;  5IIL A;  3ONN A;  5DDY A;  1T8E A;  5DDM A;  5ALZ A;  1PK1 B;  4P0Q A;  2DBY A;  3H40 A;  3ZDA A;  3PW2 A;  1WWU A;  4GFJ A;  3IG5 A;  2MA1 A;  3PX6 A;  4G3I A;  4QIW F;  4JMU A;  1D8L A;  3LVW A;  1ZD2 P;  2K4H A;  2J6U A;  1SGG A;  5J0Q A;  1YZ7 A;  1NJY A;  3PZP A;  4CF3 A;  2FMQ A;  3RRH A;  5J2F A;  3H0M B;  4O3M A;  9ICI A;  3V7K A;  2NRT A;  4KTQ A;  1SZH A;  8ICC A;  4EEK A;  1ZQS A;  3MGV A;  4ED6 A;  1ZD4 A;  2BQR A;  4UAU A;  3C5G A;  4IS7 A;  2WB1 F;  2DF4 B;  4F5N A;  2NYV A;  4F93 B;  3L4P A;  3MFI A;  3AL0 B;  2QB0 B;  4JV2 A;  7ICE A;  2HVI A;  4UB1 A;  2DKZ A;  3FYH A;  1NK7 A;  3UQ0 A;  5KFO A;  7ICM A;  2EZX A;  1FFV A;  1DRG A;  5DBC A;  3HWT A;  1ZQV A;  3QUQ A;  1DGJ A;  4QZB A;  3M8S A;  4ICA A;  3AU6 A;  4CF4 A;  5AI8 A;  2C2D A;  2W04 A;  4RQ1 A;  1MA7 A;  3SZ2 A;  4RQ8 A;  2XGQ A;  4P2H A;  2HBL A;  3ZD9 A;  3TAR A;  7ICS A;  4C0Z A;  2YQE A;  1PZN A;  4YD1 A;  1QTM A;  2LM1 A;  4BJQ A;  2WAQ F;  5HML A;  3SAH A;  5DLF A;  3N4M B;  1X9X A;  4B9M A;  5CA7 A;  2Y0S C;  1KBU A;  2E1F A;  4M6W A;  4DQI A;  3V6K A;  1Y88 A;  5AM1 A;  1L8L A;  2E3T A;  2BGW A;  2G5H B;  1KKX A;  4C4S A;  3S6J A;  4ECZ A;  5DGB A;  1AQ6 A;  4GIB A;  4B9U A;  3V6H A;  2KSO B;  5KFJ A;  2W9C A;  8ICL A;  4ECY A;  1BPY A;  3ZDD A;  4QZA A;  4YMM A;  2BCU A;  4KLF A;  3WK5 A;  1MN8 A;  3FM9 A;  3IG8 A;  2HMX A;  1XWL A;  2YMM A;  5KFI A;  3LK9 A;  4JB3 A;  3ED5 A;  2CRX A;  1WG8 A;  1NI3 A;  4JWN A;  5KFH A;  2LPE A;  4UBC A;  2PMZ F;  3N28 A;  1NOM A;  5J2H A;  5B66 U;  1PK3 A;  4A8E A;  4TQR A;  1TK0 A;  4EYI B;  1L3V A;  3M6Z A;  4DL5 A;  5DB9 A;  4KMU A;  4ED8 A;  4UB2 A;  2IHN A;  5IIO A;  4DFP A;  4O5E A;  3SMV A;  8ICZ A;  4QWB A;  4US9 A;  5DG9 A;  1ZQJ A;  2J6T A;  3EPG A;  5AKH A;  4M9H A;  2WF6 A;  4DSK A;  5J0O A;  2WF7 A;  3HT3 A;  2AGO A;  7ICU A;  3HX0 A;  1D8B A;  2FJ6 A;  1ZQF A;  2JZB A;  4ED7 A; 
#chains in the Genus database with same CATH homology
 3A0H U;  5KAF U;  3WU2 U;  3KZI U;  1S5L U;  4UB8 U;  5GTI U;  5KAI U;  4PJ0 U;  5E79 U;  5GTH U;  4UB6 U;  5H2F U;  5TIS U;  5B66 U;  4IL6 U;  2DUY A;  2AXT U;  5B5E U;  3A0B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...