4UB8U

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport, photosynthesis
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 31
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub8U01
3KZIU 4PJ0U 4UB6U 4UB8U 5KAFU 1S5LU 5B5EU 5GTIU 3WU2U 3A0HU 5H2FU 2AXTU 4IL6U 5GTHU 5E79U 5TISU 3A0BU 2DUYA 5B66U 5KAIU
chains in the Genus database with same CATH superfamily
1KBUA 2F77X 2Y9TA 2AU0A 5KG6A 1ZQOA 2E8MA 1A0PA 2H3IA 3KZIU 1XSNA 4RZRA 5F3XB 9ICRA 2MU2A 4PHEA 4JK1A 2V4QA 4YP3A 2KFNA 1BGXT 3RAQA 4MHVA 2EDUA 4IQTA 2EQYA 1NOMA 4I2CA 3HW8A 4F5RA 3IHQB 5J2EA 4KX3A 2LPEA 4ECRA 3SZ2A 5KT6A 5KT4A 5AM3A 5KTQA 4ECTA 2F8LA 3UXNA 4PHPA 5DQGA 4DSEA 2E5SA 4OCZA 2UVUA 2ODGA 2MA1A 1B4FA 2HCFA 4ECWA 4F2RA 3FC4A 2NRVA 5J0QA 4M9LA 3IN5A 2KJ5A 1NKBA 3BZCA 3GZFA 5CA7A 2M9NA 4G3IA 2JEFA 4NWIA 2YMQA 3JPNA 4IC9A 2BDPA 2IA6A 2W9BA 5BOLA 1ZQXA 4OJ6A 2K89A 1S77D 9ICLA 1ZJNA 1PVQA 4ED0A 5J0RA 2Q0ZX 4P4OA 2IMWP 1ZXIA 3QU7A 3V7KA 2FMPA 4GC6A 4RQ2A 1NZPA 2K4EA 2XGPA 5D4BA 2BPGA 4IQUA 2F76X 3EYZA 2DFLA 2WF8A 2KNJA 7ICKA 5HMMA 2ATLA 3PW2A 4YD1A 3IG8A 3JPOA 8ICOA 1SV0C 1HJPA 1C7YA 4O5CA 2IBKA 3MBYA 9ICIA 4UAVA 4R8UA 3GFKB 4EBDA 2XCPA 4JUZA 5AIAA 3Q8SB 2KFZA 1L7NA 1JMSA 4YD2A 5IIIA 4UASA 1ZQRA 4IQVA 4UQGA 1ZQAA 1C20A 4UB8U 5EE1A 4NY8A 4Q43A 5JTIA 9ICJA 2MUTA 4EZ6A 2MRLA 3UQ0A 4ACOA 3I1YA 5AI8A 4Y2UA 4Z6CA 2VKQA 1TAMA 3NVVA 1QTMA 2IOFK 4YCXA 5KFGA 7ICPA 9ICNA 2XY5A 2YTUA 2H3QA 2YY6A 4I29A 4FO6A 3NASA 1WYGA 1V38A 1T3NA 4RQ8A 2J6TA 3E2EA 3Q8QB 2PFPA 4ECXA 1SIJA 2DUYA 2W3SA 1WG8A 4DL4A 1X42A 3EUB2 5J8YA 3WK5A 3OJUA 1TE2A 5AI9A 5DB6A 1COKA 8ICPA 9ICGA 2HW3A 1JUDA 3F2BA 5AKJA 4DSLA 4DSIA 2WF6A 1RG6A 4PHAA 1MQ2A 2FMQA 2HOIA 1JXEA 3EZ5A 4USAA 3RJFA 4R63A 1S76D 2JZBA 4KLMA 5KFSA 2ZXHA 1N56A 5AK6A 3BQ0A 4F5OA 3GIMA 4RQ5A 3AUOA 5J0OA 8ICZA 1L7MA 2FI1A 3RB4A 3PW0A 2ZTEA 5KFOA 2G5HB 4C4TA 1VJ5A 7ICEA 3RRHA 1DK3A 2VA8A 5AK5A 1X9XA 2QKQA 1N63A 3RRGA 5KT5A 5J2DA 1FFUA 2ZIVB 4R66A 4DL3A 3FM9A 2BDUA 3RR7A 3T79A 1KW4A 4TUQA 4RPXA 1T4GA 2W43A 4J9PA 4C4SA 4DFMA 5F9LA 3Q8KA 2KSOB 2DKZA 4US8A 3NRWA 4CE6A 3V72A 5IINA 4NXZA 3C1ZA 3WKBA 1RPLA 1ZQIA 1TAUA 5KFLA 1RYRA 1Z1BA 4K4GA 1VDVA 5FP0A 1L7PA 2RP5A 1L3VA 2ZUCA 4O3RA 4DL5A 3BZKA 2W54A 1X9MA 4ZOHC 5E79U 4GFJA 4NLBA 9ICOA 4QWDA 1QSLA 2AJQA 4DQIA 4EELA 4DF4A 1NK7A 4QZHA 4XUSA 3V6HA 4M04A 2HSZA 2EAMA 4I2HA 2OXOA 4IS7A 2C2RA 1BNPA 1S0NA 4F4ZA 1FO4A 3IP4B 5DLGA 1KFSA 1V85A 2R8JA 5KAIU 3KBBA 2L5YA 2ASLA 9ICVA 4YXJA 4UB5A 2Y0SC 5ALNA 1OXJA 2XO7A 1ZQJA 1S9FA 4MEYA 4F91B 2ASJA 5DG8A 2MUTB 5J2BA 3IRUA 9ICUA 1F5SA 1RZTA 4CF4A 2NYVA 1ZQBA 2P66A 4Y2PA 2BQRA 4GLXA 3HILA 3SR6A 3PSTA 1X6JA 4I28A 3M1YA 2H3FA 8ICLA 2PMZC 5C0YA 2GO7A 8ICVA 1X40A 5J2CA 2G5IB 3JPQA 3Q8PB 1TFRA 4UBBA 1MC8A 2VA2A 3IG5A 4DFKA 2GLEA 2BZFA 5KG0A 1DOQA 1NI3A 1U4BA 1ZRMA 3WK4A 4UB4A 3QYPA 3CW2C 1T7PA 4J9MA 1IV8A 3TI0A 1RXWA 4F71A 4NM2A 3PSFA 5HMLA 2BPCA 3F5EA 4QW9A 5TISU 1UPHA 4LZGA 2AGQA 4O5EA 2EZYA 3JPTA 4NJ8A 3IV6A 5BPCA 4P0PB 3F53A 3NGDA 2UVRA 4FS2A 5B5EU 2ZIUA 3WKDA 1Z00B 3RJHA 1A6SA 2AQ0A 4RQ6A 3K1RB 3DDHA 3F2DA 2MAXA 2CRXA 1NK9A 3H4BA 1Z1VA 7ICJA 3QNMA 1QQ5A 5AKEA 2KVSA 3ALRA 1S10A 4KLEA 4U6PA 2W7OA 3RAXA 3DEEA 2HHUA 3UMCA 5AHXA 1UA1A 1T94A 2QB1A 1ZD4A 3B0XA 2QARA 1SXEA 5L1KA 3BQ7A 2W3RA 2KKPA 1CI4A 1RM6C 4QWBA 3PX6A 5KFUA 4J9KA 4ED8A 3RBDA 3LDAA 3CYMA 3PO4A 4K4IA 3SD7A 2WAQC 1O08A 2KD1A 3H8MA 4AP9A 4KMOB 4ED3A 3GV8B 5DDYA 5ALZA 2NV3A 4DL2A 1QQ7A 4F5NA 9ICWA 5J2HA 5L9XA 5L1MA 1RQLA 4PPXA 4QZCA 1JALA 5CR0A 4P0PA 2ZIUB 3MGHA 3UXPA 1XSLA 2FLLA 4B9LA 1NK5A 3ZDAA 2P35A 3JPSA 5GTIU 1YT3A 2Q4TA 1D9FA 1JI7A 5KFKA 2FPKA 3ICXA 4DL7A 4YN4A 4PZNA 4NL9C 3PX4A 4I2EA 4ECVA 1TK5A 4PGYA 1JRPA 1KL9A 5KAFU 2F1JA 4M47A 2LM1A 9ICHA 3WK6A 2O6KA 2NO5A 3HPOA 2HDOA 2IOHA 1ZETA 2KVCA 1NZBA 2V9WA 2XGQA 4KN7A 3HKZF 5DQHA 2KOBA 3TARA 3G6XA 1NJWA 4F4XA 8ICTA 5DBCA 1P7DA 1ZQLA 2YN4A 4E0DA 2W11A 4Q44A 5B66U 2YQEA 1MQ3A 2CN1A 2JZBB 3H7IA 4DFDA 4F5PA 1ZQZA 1K5OA 4RU9A 3MC1A 2KMDA 1JXLA 2Y0SF 1BPZA 8ICAA 3UMBA 4QIWC 2W9CB 8ICWA 1Z4OA 3D2NA 2LBOA 4YMOA 3G6VA 4KTQA 1ZQPA 5DGAA 1XS9D 3TACB 4QZDA 8ICGA 4K4HA 5ALRA 2KIWA 5KG2A 8ICQA 2ZUBA 1J97A 1U9LA 7ICMA 8ICUA 7ICQA 2LYBA 4LJXA 2OH2A 2Y1JA 5ALKA 3U26A 3KFUF 5KFBA 3OHAA 2PI5A 3SAHA 3AL0B 2NRWA 5AI4A 9ICCA 4Y2VA 1DK2A 3OTQA 1QSYA 2LKYA 1BPYA 4I2BA 1KFDA 4YR3A 5IIOA 1WUDA 3NVYA 1FFVA 4TQSA 2KZ3A 3E58A 1ZQGA 4P4PA 1KQQA 5KG1A 1D8YA 1A77A 4KMUA 4PJ0U 1JIHA 4ECUA 5EOZA 5DB9A 2AGOA 3N4MB 4QZIA 4J9OA 4EYHB 1AQ6A 2K8CB 3TANA 4KLQA 3CP8A 2IOFA 4C8MA 1L5UA 4KLOA 4J9RA 4KX5A 4IR1A 1ZQKA 3J81j 5D46A 3UMGA 3C1YA 3IDWA 5KT2A 3AU2A 5DB7A 9ICSA 5ALXA 4ED2A 3GIJA 4U7CA 3L3FX 2B0CA 4RQ0A 3GDXA 4PGXA 3QU5A 3ZDDA 3WK9A 7ICOA 5ALSA 7ICGA 2B21A 2B6GA 3HRDD 3Q8RB 4B9SA 4KLIA 1V97A 1PK3A 3AM9A 1ZQWA 4JWMA 1NJYA 4RNMA 9ICAA 2NRXA 3ISCA 5J2GA 4CF5A 2AQ4A 2NRTA 4XQ8A 5ALFA 2XCAA 1S0VA 1KDHA 2PFOA 1SZHA 1L8LA 5DBBA 1HUOA 4M9JA 4UAWA 5KFAA 4A8EA 3EPGA 5J0YA 2G09A 3FYHA 1L3SA 1ZQTA 4C8OA 5ALGA 2W7PA 3I76A 5AKHA 2I6XA 2ESEA 2KTQA 5K4LA 3MR3A 5EWEA 1ZQNA 3BQTA 4GXKA 2I5HA 4PHDA 2E3TA 4DS4A 1V9PA 2HMXA 3PY8A 2JRZA 3RBEA 5CWRA 4O3QA 1TAQA 1LKYA 5DG9A 1XU4A 3ZDBA 4RNNA 3NRZA 2ZG6A 4TQRA 4I2AA 4LVSA 5D49A 2GOLA 1U45A 1T8EA 3RJJA 1B43A 1Z4NA 2PXIA 1WCLA 1L8OA 4CF3A 4B9UA 2W03A 2VJ5A 2EZZA 5BOMA 5KFNA 2DKXA 2WB1C 5J0UA 1WWVA 1N48A 2P6RA 4GC7A 4JMUA 3N7RC 3QU9A 4DL6A 2KK0A 4QZAA 1ZD5A 4ELUA 2HHQA 4F93B 1XNSA 2A1JB 3H0MB 2F44A 5AKIA 1SB3C 2HOQA 3K1ZA 3WKEA 2RDJA 4FBTA 1OW5A 1SWWA 3LVVA 1BVSA 4F92B 3O0FA 2C2EA 5J0WA 4F4KA 3PV8A 5J2JA 1ZQEA 3LWMA 2JXJA 2Y1IA 5KFQA 2WAQF 8ICSA 4EX7A 1NKCA 3ISDA 1B22A 3FDSA 3GIKA 2E8OA 4DS5A 3PW4A 2Z7JA 4DF8A 2QB0A 4TUPA 4RQ7A 2A1JA 1U49A 4KLJA 4C4RA 2LHTA 1NNLA 1Y88A 4MFAA 2K8BB 4F2SA 5KL1B 2BCQA 3WK7A 4EEKA 2UVVA 4QWCA 1XO1A 5J0TA 3UM9A 2YX8A 4M6WB 4JWNA 4KN4A 5AI0A 4RUCA 2XY6A 4RPYA 1RDFA 4ECYA 2DWQA 5KFDA 1KLNA 2OM6A 5IIMA 2BCRA 3Q8LA 2VJ4A 3OHBA 5EE0A 5AKYA 3KZXA 5KT7A 1SL0A 4Q8FA 5HR7A 1MN8A 1D9DA 4KLTA 9ICBA 2A19A 5J0XA 2WFAA 4KLGA 4RQ3A 3AN1A 3RH4A 3PSPA 2BPFA 1TK8A 4TUSA 2V4RA 3TADA 3M6ZA 4ELVA 2KICA 3T3FA 4GIBA 5ALDA 1CEZA 1DXSA 1XO0A 3AQFA 3ISBA 4M9GA 3OSPA 2OEHA 4P0QA 5CJ7A 2H3ZA 5KFIA 4DFJA 2IHNA 3PR4A 4NLZA 2HHWA 4ECZA 2G0AA 5TZVA 4F72A 2KJ8A 3K75D 1RXVA 1M6YA 1URJA 1KTQA 8ICMA 3KKAC 2YB1A 1TK0A 4UATA 4ZH4A 2PI4A 4I2IA 4BWJA 2EZXA 2DBYA 2KP7A 7ICNA 3NVWA 8ICHA 1O03A 4NLCA 4UB6U 1UQVA 3PX0A 2LMRA 3C2LA 2PKEA 5KFXA 3QUTA 1ZQFA 3ORYA 3QEAZ 1DRGA 1NK8A 4B9VA 5KFFA 5AM5A 1PK1A 4F3OA 2N1RA 2EH9A 4FZLA 7ICVA 4DO9A 5DKWA 4Y2JA 3PZPA 4BDPA 5ALLA 4C0ZA 4EBEA 4UAZA 4CCHA 2A1AA 2EANA 4J9SA 4DOAA 1H38A 4Z6DA 3MDCA 1OUQA 3F5AA 2HHXA 4EEYA 2HHSA 4EZ9A 3QXGA 3TFSA 2ZJ5A 4QZGA 5JRTA 2PMZF 5CHGA 4MEXA 3WKCA 4LZDA 4R8UB 1KEJA 4IL6U 1COOA 4PZOA 4P4MA 3BQ2A 1QQ6A 1D8BA 4B9MA 3MDAA 3RH5A 3DV9A 3SI8A 1SKWA 3BDPA 2DQNB 4X5VA 2QARB 3M9NB 2A3VA 4QJFB 1ECWA 4PH5A 3PVXA 5EE9A 2CPRA 5DDMA 8ICYA 2FE9A 2WTFA 1K1SA 1JROA 1X9WA 3WU2U 3NTUA 4OJPA 5KFHA 2E8PA 1XWLA 3BS5B 5IILA 4P2HA 5HNKA 2HBKA 4NV0A 3TADC 2KHVA 4YR0A 9ICTA 4BXOB 5AM4A 4NLNA 2DL0A 3JPRA 2K4IA 3KD3A 3VC8A 2HBLA 3OGUA 2K60A 4QNLA 4FS1A 2JGAA 1ZJMA 5AM0A 4F50A 2W9CA 1TVAA 3C2MA 4OJ5A 4QW8A 5ALMA 3PNCA 2JMGA 4IQWA 4C80A 4DQSA 3KKAA 5IIKA 1Q3UA 5ALVA 3V6KA 5HP4A 1QCKA 1MA7A 4YG2A 3BJYA 2YMPA 5AM2A 1F44A 1WCNA 4M9NA 5ALEA 4O3NA 4C8LA 2H5XA 4ED7A 4O5KA 1ZQHA 1QLNA 2G07A 4IRKA 5ALUA 3G6YA 3EW9A 1SV4A 3SAFA 3KHRA 2K8AA 4XRHA 2ISOA 4O3PA 3GIIA 5CEHA 3KHHA 1EXNA 3QZ7A 1BPBA 2G06A 4DLEA 4DSFA 4P0QB 4I2JA 3QUCA 2HBMA 1B0XA 2ZJ8A 1IG6A 2HVHA 1PVRA 4UB1A 1JX4A 5EE3A 4EBCA 4QZ9A 8ICIA 3RTVA 1XC9A 2K4PA 5KFEA 5AK4A 5ALJA 1IXRA 3WKAA 3RR8A 2W8KA 2LI6A 3GILA 4RQMA 1ZQVA 2M0NA 4KLLA 2CXYA 3H4DA 1XSPA 3KTQA 2R18A 4FE3A 8ICXA 4HAIA 3GQCA 2VANA 2OWOA 4Y2RA 2ZUDA 3PMNA 3HKZC 1SXDA 2HVIA 1UA0A 5ALWA 5KFVA 1X6IA 3MABA 2D3DA 3OSNA 8ICEA 4AYBF 4R65A 3QU4A 1ZRNA 4Z6FA 2FLPA 2ZIWA 3H8JA 2PFQA 2LM4A 5J0PA 3ED5A 5KFCA 5AI6A 3PW7A 4WJ3B 4EENA 2DPIA 4O3OA 3RB6A 2XICA 3SV4A 5T14A 1Z19A 5ALIA 2Y9UA 4J9LA 3OPXA 5J29A 1U48A 2BCSA 1K1QA 5ALYA 1ZOLA 1ZQSA 4RQ4A 2EAPA 1YZ7A 4UAYA 4NL9A 3M9OB 4PGQA 3EPIA 3H8SA 4QZ8A 3SV3A 1ZQCA 1SV0A 4JB3A 4J03A 3GU3A 4DQQA 1HIWA 3TAPA 4KLHA 4KLSA 4OJOA 4Y2TA 3RH6A 2DPJA 7ICIA 4IRDA 4O3MA 1ZD2P 4RNOA 4B9NA 2BQUA 2KV2A 3D6JA 2VIXA 4QZFA 3N97B 1VLBA 2BHNA 5AI5A 4B9TA 4UBCA 2J6UA 2GH1A 3A0HU 4BGDA 2JH7A 4DOBA 5C5JA 3C21A 2R8GA 1L7OA 3IM1A 3TKAA 3KHLA 1CRXA 2HBJA 4YXMA 9ICQA 1S97A 5KG5A 2K4HA 9ICXA 7ICLA 2IHMA 1N2XA 3LK9A 3HP6A 4JV0A 4NLGA 5KG7A 1X66A 3QUQA 5KFWA 4BX9C 2R8HA 2F1IA 1RYSA 4Y2QA 4M0AA 4MF8A 2P6UA 4DQPA 5ALTA 3QUBA 2D6FC 4FZNA 3NUQA 4I2FA 3C28A 3H0RB 2KJ9A 4FZMA 1CUKA 4ICAA 2JV3A 2F3NA 4FFDA 3MR2A 2YB4A 1A76A 3BS7A 4C7YA 1ZQUA 3THVA 3V6JA 4YQWA 1TKDA 3QEBZ 1FEZA 5HHHA 4GXJA 5KFPA 1Q8KA 3UPQA 4DSKA 5KL8B 4ECSA 2C22A 2VA3A 4DEZA 3C5GA 1IIPA 2RQ5A 1ZQQA 1KN5A 3MFIA 2JHDA 3WK8A 1L3TA 2KE7A 2G08A 3M7DA 2WF9A 2EAOA 3HT3A 3RJGA 5J2KA 3BQ1A 2JEIA 1Z3EB 4OJLA 4C8NA 1UT5A 3UXOA 2RRDA 3QE9Y 4UB3A 1N5WA 9ICMA 3I28A 2HOFA 2JEGA 3ZDEA 2ZTDA 2RDIA 5G5HA 3PMLA 3LYSA 1S5LU 5CB1A 3T5HA 4DSJA 4NLKA 2ZTCA 4Y2XA 4B6JA 1JN3A 3M9MB 4UARA 4KLDA 2QLTA 5AKKA 2KG5A 4C8KA 8ICFA 1ZYQA 3ETLA 1FIQA 1LB2B 1NJXA 1NK6A 3F2CA 3T5LA 3RJEA 2ZIVA 4J9QA 4FBUA 3D2SA 2F8KA 7ICHA 3MR5A 3RF9A 4XA5A 5EWGA 1PVPA 1HUZA 4KLUA 4F4YA 1UCVA 5AICA 3H40A 2WF5A 4C7ZA 5KNIA 5J8YC 1UT8A 2ZJAA 5H2FU 5KG3A 4CNQA 5JUMA 4DLGA 1N5XA 4F8RA 2LYHA 2C2DA 2R8KA 1S0MA 4MF2A 5J2IA 3GV7B 3B0YA 5L1JA 3SYZA 1Q3VA 5F9NA 3VCBA 3V7LA 3M8RA 4I2GA 8ICKA 5DBAA 4QWEA 1Z00A 3H0LB 3C29A 5AKXA 3SEIA 2KKVA 4BWMA 4F5QA 3PR5B 2AHOB 3KHGA 4ECQA 5KG4A 1NK4A 4OD0A 2DGZA 1KFTA 3ZI4A 2YMMA 2OHFA 3N7PD 2XVTA 2UVWA 4RQ1A 1TV9A 1J2MA 5AK3A 4R64A 3OJSA 1KRPA 5J2AA 3R9KA 4Q45A 4DCCA 3AMZA 1NKEA 1F0MA 1MSWD 5ALPA 2FPLA 5GTHU 4J9NA 1ZQ1C 3FAHA 4Y2SA 3GV5B 4Z6EA 1KSPA 1U47A 1T3QA 4OO1J 5KFZA 1LKYB 4PL2A 2RLTA 1PUZA 2BCVA 5DLFA 2OCEA 4ED6A 8ICRA 5AKLA 4O0IA 3N28A 5HR6A 3ZD8A 5KFTA 1SWVA 4EX6A 5L1IA 3PSIA 3D2QA 1BPEA 2PFNA 1RQNA 2DF4B 4DOCA 2WB1F 3RJIA 3RFAA 4EYIB 4YMMA 4UB2A 3C5FA 1J2NA 5KFYA 3E0FA 3TFRA 2BR0A 4MFFA 4AYBC 5A0LA 1SKRA 3V7JA 2FJ6A 4M2YA 3MGVA 3JPPA 5DB8A 2ISPA 5ALQA 2KN7A 3HJEA 9ICEA 1X9SA 1S0OA 5L1LA 3RJKA 1IM4A 1QH9A 3MFHA 3C2KA 2BQ3A 1L3UA 4QZEA 4GXIA 5KFRA 5ALOA 5CP2A 1ZD3A 4QZBA 3H8WA 4RUAA 4YVZA 5G5GA 2KZMA 9ICFA 2E1FA 1LVHA 4CDGA 5JU5A 2QB0B 4QWAA 2FMSA 3NS1A 3A0BU 4BUGA 2HHTA 1AROP 2JR5A 3S6JA 3ETRA 3CRXA 2ALZA 9ICKA 2JEJA 3MR6A 1N62A 3SAGA 1UHUA 3Q8MA 2KZZA 4MFCA 4DFPA 4KLFA 4G9BA 4QIWF 4US9A 1ZQDA 3UQ2A 2ZIXA 1N61A 5IIJA 4DQRA 7ICRA 5J2FA 2FDRA 2D8CA 2I1QA 1RYUA 5DGBA 2AH5A 3N7SC 1N60A 4PL1A 8ICNA 2XI9A 4IRCA 1PZNA 5DQIA 2AGPA 1DGJA 1S8OA 4M6WA 1BNOA 1SL1A 2OYYA 4YFKA 3L5KA 1LV5A 1X2IA 3K4GA 1BPDA 1L6NA 2MSNA 2XY7A 4ELTA 5AM1A 1HEKA 4RQNA 3ZD9A 2W04A 2R8IA 8ICJA 3NVZA 2WHEA 2NRZA 2ZXIA 2W55A 2J6SA 1SL2A 4Y2YA 2ASDA 4JV2A 2ZIWB 2BKEA 3RB0A 7ICSA 3HX0A 2W9BB 8ICBA 4CGZA 4HYKA 1YZ6A 2FLNA 2W9AA 2KIVA 2NO4A 4ED1A 3B9JA 4I27A 4I2DA 4JV1A 5AIBA 3KOOA 3PW5A 4DWIA 4IR9A 2XIDA 2W8LA 3HWTA 1NJZA 3ONNA 1SKSA 4UAUA 1KKXA 8ICCA 4M9HA 1ZQMA 5AKZA 4TURA 3AEVA 1ED1A 5KFJA 4Q8EA 4BXOA 1ZQYA 2HI0A 2KEYA 5CRXA 5J0SA 2FPMA 4BJQA 2WF7A 2JH1A 2F1HA 4CRXA 2YMLA 2KSOA 2BGWA 3RB3A 4O9MA 2ZIXB 2F2AB 1QSSA 3QU2A 2E8NA 3TQ1A 1Q46A 3QZ8A 7ICUA 2KHQA 5HHIA 1SZPA 1BPXA 7ICTA 5ALHA 1DGSA 3SMVA 2I9GA 3L4PA 4O3SA 7ICFA 3MGIA 4NM1A 1PK1B 2E1EA 1GO3F 2ES6A 2XC9A 2GWSA 5DG7A 2LYAA 2H3VA 3M8SA 3QX7A 4YMNA 4RPZA 4RT3A 3SQIA 2HHVA 4YR2A 3PO5A 3EWAA 5KFMA 9ICPA 3LVWA 2AXTU 3TAQA 3SENA 3AU6A 3ZDCA 3AQEA 1D8LA 3BS5A 2C28A 4UW9A 2BCUA 2RHFA 3C23A 4F4WA 3T5JA 5AKGA 4RT2A 1SGGA 5KT3A 5EWFA 1WWUA 2W9MA 4KITB 3M6KA 3CNHA 3LWLA 1NK0A 3T5KA
chains in the Genus database with same CATH topology
3KZIU 4PJ0U 4UB6U 4UB8U 5KAFU 1S5LU 5B5EU 5GTIU 3WU2U 3A0HU 5H2FU 2AXTU 4IL6U 5GTHU 5E79U 5TISU 3A0BU 2DUYA 5B66U 5KAIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI U;  4PJ0 U;  4UB6 U;  4UB8 U;  5KAF U;  1S5L U;  5B5E U;  5GTI U;  3WU2 U;  3A0H U;  5H2F U;  2AXT U;  4IL6 U;  5GTH U;  5E79 U;  5TIS U;  3A0B U;  2DUY A;  5B66 U;  5KAI U; 
#chains in the Genus database with same CATH topology
 1KBU A;  2F77 X;  2Y9T A;  2AU0 A;  5KG6 A;  1ZQO A;  2E8M A;  1A0P A;  2H3I A;  3KZI U;  1XSN A;  4RZR A;  5F3X B;  9ICR A;  2MU2 A;  4PHE A;  4JK1 A;  2V4Q A;  4YP3 A;  2KFN A;  1BGX T;  3RAQ A;  4MHV A;  2EDU A;  4IQT A;  2EQY A;  1NOM A;  4I2C A;  3HW8 A;  4F5R A;  3IHQ B;  5J2E A;  4KX3 A;  2LPE A;  4ECR A;  3SZ2 A;  5KT6 A;  5KT4 A;  5AM3 A;  5KTQ A;  4ECT A;  2F8L A;  3UXN A;  4PHP A;  5DQG A;  4DSE A;  2E5S A;  4OCZ A;  2UVU A;  2ODG A;  2MA1 A;  1B4F A;  2HCF A;  4ECW A;  4F2R A;  3FC4 A;  2NRV A;  5J0Q A;  4M9L A;  3IN5 A;  2KJ5 A;  1NKB A;  3BZC A;  3GZF A;  5CA7 A;  2M9N A;  4G3I A;  2JEF A;  4NWI A;  2YMQ A;  3JPN A;  4IC9 A;  2BDP A;  2IA6 A;  2W9B A;  5BOL A;  1ZQX A;  4OJ6 A;  2K89 A;  1S77 D;  9ICL A;  1ZJN A;  1PVQ A;  4ED0 A;  5J0R A;  2Q0Z X;  4P4O A;  2IMW P;  1ZXI A;  3QU7 A;  3V7K A;  2FMP A;  4GC6 A;  4RQ2 A;  1NZP A;  2K4E A;  2XGP A;  5D4B A;  2BPG A;  4IQU A;  2F76 X;  3EYZ A;  2DFL A;  2WF8 A;  2KNJ A;  7ICK A;  5HMM A;  2ATL A;  3PW2 A;  4YD1 A;  3IG8 A;  3JPO A;  8ICO A;  1SV0 C;  1HJP A;  1C7Y A;  4O5C A;  2IBK A;  3MBY A;  9ICI A;  4UAV A;  4R8U A;  3GFK B;  4EBD A;  2XCP A;  4JUZ A;  5AIA A;  3Q8S B;  2KFZ A;  1L7N A;  1JMS A;  4YD2 A;  5III A;  4UAS A;  1ZQR A;  4IQV A;  4UQG A;  1ZQA A;  1C20 A;  4UB8 U;  5EE1 A;  4NY8 A;  4Q43 A;  5JTI A;  9ICJ A;  2MUT A;  4EZ6 A;  2MRL A;  3UQ0 A;  4ACO A;  3I1Y A;  5AI8 A;  4Y2U A;  4Z6C A;  2VKQ A;  1TAM A;  3NVV A;  1QTM A;  2IOF K;  4YCX A;  5KFG A;  7ICP A;  9ICN A;  2XY5 A;  2YTU A;  2H3Q A;  2YY6 A;  4I29 A;  4FO6 A;  3NAS A;  1WYG A;  1V38 A;  1T3N A;  4RQ8 A;  2J6T A;  3E2E A;  3Q8Q B;  2PFP A;  4ECX A;  1SIJ A;  2DUY A;  2W3S A;  1WG8 A;  4DL4 A;  1X42 A;  3EUB 2;  5J8Y A;  3WK5 A;  3OJU A;  1TE2 A;  5AI9 A;  5DB6 A;  1COK A;  8ICP A;  9ICG A;  2HW3 A;  1JUD A;  3F2B A;  5AKJ A;  4DSL A;  4DSI A;  2WF6 A;  1RG6 A;  4PHA A;  1MQ2 A;  2FMQ A;  2HOI A;  1JXE A;  3EZ5 A;  4USA A;  3RJF A;  4R63 A;  1S76 D;  2JZB A;  4KLM A;  5KFS A;  2ZXH A;  1N56 A;  5AK6 A;  3BQ0 A;  4F5O A;  3GIM A;  4RQ5 A;  3AUO A;  5J0O A;  8ICZ A;  1L7M A;  2FI1 A;  3RB4 A;  3PW0 A;  2ZTE A;  5KFO A;  2G5H B;  4C4T A;  1VJ5 A;  7ICE A;  3RRH A;  1DK3 A;  2VA8 A;  5AK5 A;  1X9X A;  2QKQ A;  1N63 A;  3RRG A;  5KT5 A;  5J2D A;  1FFU A;  2ZIV B;  4R66 A;  4DL3 A;  3FM9 A;  2BDU A;  3RR7 A;  3T79 A;  1KW4 A;  4TUQ A;  4RPX A;  1T4G A;  2W43 A;  4J9P A;  4C4S A;  4DFM A;  5F9L A;  3Q8K A;  2KSO B;  2DKZ A;  4US8 A;  3NRW A;  4CE6 A;  3V72 A;  5IIN A;  4NXZ A;  3C1Z A;  3WKB A;  1RPL A;  1ZQI A;  1TAU A;  5KFL A;  1RYR A;  1Z1B A;  4K4G A;  1VDV A;  5FP0 A;  1L7P A;  2RP5 A;  1L3V A;  2ZUC A;  4O3R A;  4DL5 A;  3BZK A;  2W54 A;  1X9M A;  4ZOH C;  5E79 U;  4GFJ A;  4NLB A;  9ICO A;  4QWD A;  1QSL A;  2AJQ A;  4DQI A;  4EEL A;  4DF4 A;  1NK7 A;  4QZH A;  4XUS A;  3V6H A;  4M04 A;  2HSZ A;  2EAM A;  4I2H A;  2OXO A;  4IS7 A;  2C2R A;  1BNP A;  1S0N A;  4F4Z A;  1FO4 A;  3IP4 B;  5DLG A;  1KFS A;  1V85 A;  2R8J A;  5KAI U;  3KBB A;  2L5Y A;  2ASL A;  9ICV A;  4YXJ A;  4UB5 A;  2Y0S C;  5ALN A;  1OXJ A;  2XO7 A;  1ZQJ A;  1S9F A;  4MEY A;  4F91 B;  2ASJ A;  5DG8 A;  2MUT B;  5J2B A;  3IRU A;  9ICU A;  1F5S A;  1RZT A;  4CF4 A;  2NYV A;  1ZQB A;  2P66 A;  4Y2P A;  2BQR A;  4GLX A;  3HIL A;  3SR6 A;  3PST A;  1X6J A;  4I28 A;  3M1Y A;  2H3F A;  8ICL A;  2PMZ C;  5C0Y A;  2GO7 A;  8ICV A;  1X40 A;  5J2C A;  2G5I B;  3JPQ A;  3Q8P B;  1TFR A;  4UBB A;  1MC8 A;  2VA2 A;  3IG5 A;  4DFK A;  2GLE A;  2BZF A;  5KG0 A;  1DOQ A;  1NI3 A;  1U4B A;  1ZRM A;  3WK4 A;  4UB4 A;  3QYP A;  3CW2 C;  1T7P A;  4J9M A;  1IV8 A;  3TI0 A;  1RXW A;  4F71 A;  4NM2 A;  3PSF A;  5HML A;  2BPC A;  3F5E A;  4QW9 A;  5TIS U;  1UPH A;  4LZG A;  2AGQ A;  4O5E A;  2EZY A;  3JPT A;  4NJ8 A;  3IV6 A;  5BPC A;  4P0P B;  3F53 A;  3NGD A;  2UVR A;  4FS2 A;  5B5E U;  2ZIU A;  3WKD A;  1Z00 B;  3RJH A;  1A6S A;  2AQ0 A;  4RQ6 A;  3K1R B;  3DDH A;  3F2D A;  2MAX A;  2CRX A;  1NK9 A;  3H4B A;  1Z1V A;  7ICJ A;  3QNM A;  1QQ5 A;  5AKE A;  2KVS A;  3ALR A;  1S10 A;  4KLE A;  4U6P A;  2W7O A;  3RAX A;  3DEE A;  2HHU A;  3UMC A;  5AHX A;  1UA1 A;  1T94 A;  2QB1 A;  1ZD4 A;  3B0X A;  2QAR A;  1SXE A;  5L1K A;  3BQ7 A;  2W3R A;  2KKP A;  1CI4 A;  1RM6 C;  4QWB A;  3PX6 A;  5KFU A;  4J9K A;  4ED8 A;  3RBD A;  3LDA A;  3CYM A;  3PO4 A;  4K4I A;  3SD7 A;  2WAQ C;  1O08 A;  2KD1 A;  3H8M A;  4AP9 A;  4KMO B;  4ED3 A;  3GV8 B;  5DDY A;  5ALZ A;  2NV3 A;  4DL2 A;  1QQ7 A;  4F5N A;  9ICW A;  5J2H A;  5L9X A;  5L1M A;  1RQL A;  4PPX A;  4QZC A;  1JAL A;  5CR0 A;  4P0P A;  2ZIU B;  3MGH A;  3UXP A;  1XSL A;  2FLL A;  4B9L A;  1NK5 A;  3ZDA A;  2P35 A;  3JPS A;  5GTI U;  1YT3 A;  2Q4T A;  1D9F A;  1JI7 A;  5KFK A;  2FPK A;  3ICX A;  4DL7 A;  4YN4 A;  4PZN A;  4NL9 C;  3PX4 A;  4I2E A;  4ECV A;  1TK5 A;  4PGY A;  1JRP A;  1KL9 A;  5KAF U;  2F1J A;  4M47 A;  2LM1 A;  9ICH A;  3WK6 A;  2O6K A;  2NO5 A;  3HPO A;  2HDO A;  2IOH A;  1ZET A;  2KVC A;  1NZB A;  2V9W A;  2XGQ A;  4KN7 A;  3HKZ F;  5DQH A;  2KOB A;  3TAR A;  3G6X A;  1NJW A;  4F4X A;  8ICT A;  5DBC A;  1P7D A;  1ZQL A;  2YN4 A;  4E0D A;  2W11 A;  4Q44 A;  5B66 U;  2YQE A;  1MQ3 A;  2CN1 A;  2JZB B;  3H7I A;  4DFD A;  4F5P A;  1ZQZ A;  1K5O A;  4RU9 A;  3MC1 A;  2KMD A;  1JXL A;  2Y0S F;  1BPZ A;  8ICA A;  3UMB A;  4QIW C;  2W9C B;  8ICW A;  1Z4O A;  3D2N A;  2LBO A;  4YMO A;  3G6V A;  4KTQ A;  1ZQP A;  5DGA A;  1XS9 D;  3TAC B;  4QZD A;  8ICG A;  4K4H A;  5ALR A;  2KIW A;  5KG2 A;  8ICQ A;  2ZUB A;  1J97 A;  1U9L A;  7ICM A;  8ICU A;  7ICQ A;  2LYB A;  4LJX A;  2OH2 A;  2Y1J A;  5ALK A;  3U26 A;  3KFU F;  5KFB A;  3OHA A;  2PI5 A;  3SAH A;  3AL0 B;  2NRW A;  5AI4 A;  9ICC A;  4Y2V A;  1DK2 A;  3OTQ A;  1QSY A;  2LKY A;  1BPY A;  4I2B A;  1KFD A;  4YR3 A;  5IIO A;  1WUD A;  3NVY A;  1FFV A;  4TQS A;  2KZ3 A;  3E58 A;  1ZQG A;  4P4P A;  1KQQ A;  5KG1 A;  1D8Y A;  1A77 A;  4KMU A;  4PJ0 U;  1JIH A;  4ECU A;  5EOZ A;  5DB9 A;  2AGO A;  3N4M B;  4QZI A;  4J9O A;  4EYH B;  1AQ6 A;  2K8C B;  3TAN A;  4KLQ A;  3CP8 A;  2IOF A;  4C8M A;  1L5U A;  4KLO A;  4J9R A;  4KX5 A;  4IR1 A;  1ZQK A;  3J81 j;  5D46 A;  3UMG A;  3C1Y A;  3IDW A;  5KT2 A;  3AU2 A;  5DB7 A;  9ICS A;  5ALX A;  4ED2 A;  3GIJ A;  4U7C A;  3L3F X;  2B0C A;  4RQ0 A;  3GDX A;  4PGX A;  3QU5 A;  3ZDD A;  3WK9 A;  7ICO A;  5ALS A;  7ICG A;  2B21 A;  2B6G A;  3HRD D;  3Q8R B;  4B9S A;  4KLI A;  1V97 A;  1PK3 A;  3AM9 A;  1ZQW A;  4JWM A;  1NJY A;  4RNM A;  9ICA A;  2NRX A;  3ISC A;  5J2G A;  4CF5 A;  2AQ4 A;  2NRT A;  4XQ8 A;  5ALF A;  2XCA A;  1S0V A;  1KDH A;  2PFO A;  1SZH A;  1L8L A;  5DBB A;  1HUO A;  4M9J A;  4UAW A;  5KFA A;  4A8E A;  3EPG A;  5J0Y A;  2G09 A;  3FYH A;  1L3S A;  1ZQT A;  4C8O A;  5ALG A;  2W7P A;  3I76 A;  5AKH A;  2I6X A;  2ESE A;  2KTQ A;  5K4L A;  3MR3 A;  5EWE A;  1ZQN A;  3BQT A;  4GXK A;  2I5H A;  4PHD A;  2E3T A;  4DS4 A;  1V9P A;  2HMX A;  3PY8 A;  2JRZ A;  3RBE A;  5CWR A;  4O3Q A;  1TAQ A;  1LKY A;  5DG9 A;  1XU4 A;  3ZDB A;  4RNN A;  3NRZ A;  2ZG6 A;  4TQR A;  4I2A A;  4LVS A;  5D49 A;  2GOL A;  1U45 A;  1T8E A;  3RJJ A;  1B43 A;  1Z4N A;  2PXI A;  1WCL A;  1L8O A;  4CF3 A;  4B9U A;  2W03 A;  2VJ5 A;  2EZZ A;  5BOM A;  5KFN A;  2DKX A;  2WB1 C;  5J0U A;  1WWV A;  1N48 A;  2P6R A;  4GC7 A;  4JMU A;  3N7R C;  3QU9 A;  4DL6 A;  2KK0 A;  4QZA A;  1ZD5 A;  4ELU A;  2HHQ A;  4F93 B;  1XNS A;  2A1J B;  3H0M B;  2F44 A;  5AKI A;  1SB3 C;  2HOQ A;  3K1Z A;  3WKE A;  2RDJ A;  4FBT A;  1OW5 A;  1SWW A;  3LVV A;  1BVS A;  4F92 B;  3O0F A;  2C2E A;  5J0W A;  4F4K A;  3PV8 A;  5J2J A;  1ZQE A;  3LWM A;  2JXJ A;  2Y1I A;  5KFQ A;  2WAQ F;  8ICS A;  4EX7 A;  1NKC A;  3ISD A;  1B22 A;  3FDS A;  3GIK A;  2E8O A;  4DS5 A;  3PW4 A;  2Z7J A;  4DF8 A;  2QB0 A;  4TUP A;  4RQ7 A;  2A1J A;  1U49 A;  4KLJ A;  4C4R A;  2LHT A;  1NNL A;  1Y88 A;  4MFA A;  2K8B B;  4F2S A;  5KL1 B;  2BCQ A;  3WK7 A;  4EEK A;  2UVV A;  4QWC A;  1XO1 A;  5J0T A;  3UM9 A;  2YX8 A;  4M6W B;  4JWN A;  4KN4 A;  5AI0 A;  4RUC A;  2XY6 A;  4RPY A;  1RDF A;  4ECY A;  2DWQ A;  5KFD A;  1KLN A;  2OM6 A;  5IIM A;  2BCR A;  3Q8L A;  2VJ4 A;  3OHB A;  5EE0 A;  5AKY A;  3KZX A;  5KT7 A;  1SL0 A;  4Q8F A;  5HR7 A;  1MN8 A;  1D9D A;  4KLT A;  9ICB A;  2A19 A;  5J0X A;  2WFA A;  4KLG A;  4RQ3 A;  3AN1 A;  3RH4 A;  3PSP A;  2BPF A;  1TK8 A;  4TUS A;  2V4R A;  3TAD A;  3M6Z A;  4ELV A;  2KIC A;  3T3F A;  4GIB A;  5ALD A;  1CEZ A;  1DXS A;  1XO0 A;  3AQF A;  3ISB A;  4M9G A;  3OSP A;  2OEH A;  4P0Q A;  5CJ7 A;  2H3Z A;  5KFI A;  4DFJ A;  2IHN A;  3PR4 A;  4NLZ A;  2HHW A;  4ECZ A;  2G0A A;  5TZV A;  4F72 A;  2KJ8 A;  3K75 D;  1RXV A;  1M6Y A;  1URJ A;  1KTQ A;  8ICM A;  3KKA C;  2YB1 A;  1TK0 A;  4UAT A;  4ZH4 A;  2PI4 A;  4I2I A;  4BWJ A;  2EZX A;  2DBY A;  2KP7 A;  7ICN A;  3NVW A;  8ICH A;  1O03 A;  4NLC A;  4UB6 U;  1UQV A;  3PX0 A;  2LMR A;  3C2L A;  2PKE A;  5KFX A;  3QUT A;  1ZQF A;  3ORY A;  3QEA Z;  1DRG A;  1NK8 A;  4B9V A;  5KFF A;  5AM5 A;  1PK1 A;  4F3O A;  2N1R A;  2EH9 A;  4FZL A;  7ICV A;  4DO9 A;  5DKW A;  4Y2J A;  3PZP A;  4BDP A;  5ALL A;  4C0Z A;  4EBE A;  4UAZ A;  4CCH A;  2A1A A;  2EAN A;  4J9S A;  4DOA A;  1H38 A;  4Z6D A;  3MDC A;  1OUQ A;  3F5A A;  2HHX A;  4EEY A;  2HHS A;  4EZ9 A;  3QXG A;  3TFS A;  2ZJ5 A;  4QZG A;  5JRT A;  2PMZ F;  5CHG A;  4MEX A;  3WKC A;  4LZD A;  4R8U B;  1KEJ A;  4IL6 U;  1COO A;  4PZO A;  4P4M A;  3BQ2 A;  1QQ6 A;  1D8B A;  4B9M A;  3MDA A;  3RH5 A;  3DV9 A;  3SI8 A;  1SKW A;  3BDP A;  2DQN B;  4X5V A;  2QAR B;  3M9N B;  2A3V A;  4QJF B;  1ECW A;  4PH5 A;  3PVX A;  5EE9 A;  2CPR A;  5DDM A;  8ICY A;  2FE9 A;  2WTF A;  1K1S A;  1JRO A;  1X9W A;  3WU2 U;  3NTU A;  4OJP A;  5KFH A;  2E8P A;  1XWL A;  3BS5 B;  5IIL A;  4P2H A;  5HNK A;  2HBK A;  4NV0 A;  3TAD C;  2KHV A;  4YR0 A;  9ICT A;  4BXO B;  5AM4 A;  4NLN A;  2DL0 A;  3JPR A;  2K4I A;  3KD3 A;  3VC8 A;  2HBL A;  3OGU A;  2K60 A;  4QNL A;  4FS1 A;  2JGA A;  1ZJM A;  5AM0 A;  4F50 A;  2W9C A;  1TVA A;  3C2M A;  4OJ5 A;  4QW8 A;  5ALM A;  3PNC A;  2JMG A;  4IQW A;  4C80 A;  4DQS A;  3KKA A;  5IIK A;  1Q3U A;  5ALV A;  3V6K A;  5HP4 A;  1QCK A;  1MA7 A;  4YG2 A;  3BJY A;  2YMP A;  5AM2 A;  1F44 A;  1WCN A;  4M9N A;  5ALE A;  4O3N A;  4C8L A;  2H5X A;  4ED7 A;  4O5K A;  1ZQH A;  1QLN A;  2G07 A;  4IRK A;  5ALU A;  3G6Y A;  3EW9 A;  1SV4 A;  3SAF A;  3KHR A;  2K8A A;  4XRH A;  2ISO A;  4O3P A;  3GII A;  5CEH A;  3KHH A;  1EXN A;  3QZ7 A;  1BPB A;  2G06 A;  4DLE A;  4DSF A;  4P0Q B;  4I2J A;  3QUC A;  2HBM A;  1B0X A;  2ZJ8 A;  1IG6 A;  2HVH A;  1PVR A;  4UB1 A;  1JX4 A;  5EE3 A;  4EBC A;  4QZ9 A;  8ICI A;  3RTV A;  1XC9 A;  2K4P A;  5KFE A;  5AK4 A;  5ALJ A;  1IXR A;  3WKA A;  3RR8 A;  2W8K A;  2LI6 A;  3GIL A;  4RQM A;  1ZQV A;  2M0N A;  4KLL A;  2CXY A;  3H4D A;  1XSP A;  3KTQ A;  2R18 A;  4FE3 A;  8ICX A;  4HAI A;  3GQC A;  2VAN A;  2OWO A;  4Y2R A;  2ZUD A;  3PMN A;  3HKZ C;  1SXD A;  2HVI A;  1UA0 A;  5ALW A;  5KFV A;  1X6I A;  3MAB A;  2D3D A;  3OSN A;  8ICE A;  4AYB F;  4R65 A;  3QU4 A;  1ZRN A;  4Z6F A;  2FLP A;  2ZIW A;  3H8J A;  2PFQ A;  2LM4 A;  5J0P A;  3ED5 A;  5KFC A;  5AI6 A;  3PW7 A;  4WJ3 B;  4EEN A;  2DPI A;  4O3O A;  3RB6 A;  2XIC A;  3SV4 A;  5T14 A;  1Z19 A;  5ALI A;  2Y9U A;  4J9L A;  3OPX A;  5J29 A;  1U48 A;  2BCS A;  1K1Q A;  5ALY A;  1ZOL A;  1ZQS A;  4RQ4 A;  2EAP A;  1YZ7 A;  4UAY A;  4NL9 A;  3M9O B;  4PGQ A;  3EPI A;  3H8S A;  4QZ8 A;  3SV3 A;  1ZQC A;  1SV0 A;  4JB3 A;  4J03 A;  3GU3 A;  4DQQ A;  1HIW A;  3TAP A;  4KLH A;  4KLS A;  4OJO A;  4Y2T A;  3RH6 A;  2DPJ A;  7ICI A;  4IRD A;  4O3M A;  1ZD2 P;  4RNO A;  4B9N A;  2BQU A;  2KV2 A;  3D6J A;  2VIX A;  4QZF A;  3N97 B;  1VLB A;  2BHN A;  5AI5 A;  4B9T A;  4UBC A;  2J6U A;  2GH1 A;  3A0H U;  4BGD A;  2JH7 A;  4DOB A;  5C5J A;  3C21 A;  2R8G A;  1L7O A;  3IM1 A;  3TKA A;  3KHL A;  1CRX A;  2HBJ A;  4YXM A;  9ICQ A;  1S97 A;  5KG5 A;  2K4H A;  9ICX A;  7ICL A;  2IHM A;  1N2X A;  3LK9 A;  3HP6 A;  4JV0 A;  4NLG A;  5KG7 A;  1X66 A;  3QUQ A;  5KFW A;  4BX9 C;  2R8H A;  2F1I A;  1RYS A;  4Y2Q A;  4M0A A;  4MF8 A;  2P6U A;  4DQP A;  5ALT A;  3QUB A;  2D6F C;  4FZN A;  3NUQ A;  4I2F A;  3C28 A;  3H0R B;  2KJ9 A;  4FZM A;  1CUK A;  4ICA A;  2JV3 A;  2F3N A;  4FFD A;  3MR2 A;  2YB4 A;  1A76 A;  3BS7 A;  4C7Y A;  1ZQU A;  3THV A;  3V6J A;  4YQW A;  1TKD A;  3QEB Z;  1FEZ A;  5HHH A;  4GXJ A;  5KFP A;  1Q8K A;  3UPQ A;  4DSK A;  5KL8 B;  4ECS A;  2C22 A;  2VA3 A;  4DEZ A;  3C5G A;  1IIP A;  2RQ5 A;  1ZQQ A;  1KN5 A;  3MFI A;  2JHD A;  3WK8 A;  1L3T A;  2KE7 A;  2G08 A;  3M7D A;  2WF9 A;  2EAO A;  3HT3 A;  3RJG A;  5J2K A;  3BQ1 A;  2JEI A;  1Z3E B;  4OJL A;  4C8N A;  1UT5 A;  3UXO A;  2RRD A;  3QE9 Y;  4UB3 A;  1N5W A;  9ICM A;  3I28 A;  2HOF A;  2JEG A;  3ZDE A;  2ZTD A;  2RDI A;  5G5H A;  3PML A;  3LYS A;  1S5L U;  5CB1 A;  3T5H A;  4DSJ A;  4NLK A;  2ZTC A;  4Y2X A;  4B6J A;  1JN3 A;  3M9M B;  4UAR A;  4KLD A;  2QLT A;  5AKK A;  2KG5 A;  4C8K A;  8ICF A;  1ZYQ A;  3ETL A;  1FIQ A;  1LB2 B;  1NJX A;  1NK6 A;  3F2C A;  3T5L A;  3RJE A;  2ZIV A;  4J9Q A;  4FBU A;  3D2S A;  2F8K A;  7ICH A;  3MR5 A;  3RF9 A;  4XA5 A;  5EWG A;  1PVP A;  1HUZ A;  4KLU A;  4F4Y A;  1UCV A;  5AIC A;  3H40 A;  2WF5 A;  4C7Z A;  5KNI A;  5J8Y C;  1UT8 A;  2ZJA A;  5H2F U;  5KG3 A;  4CNQ A;  5JUM A;  4DLG A;  1N5X A;  4F8R A;  2LYH A;  2C2D A;  2R8K A;  1S0M A;  4MF2 A;  5J2I A;  3GV7 B;  3B0Y A;  5L1J A;  3SYZ A;  1Q3V A;  5F9N A;  3VCB A;  3V7L A;  3M8R A;  4I2G A;  8ICK A;  5DBA A;  4QWE A;  1Z00 A;  3H0L B;  3C29 A;  5AKX A;  3SEI A;  2KKV A;  4BWM A;  4F5Q A;  3PR5 B;  2AHO B;  3KHG A;  4ECQ A;  5KG4 A;  1NK4 A;  4OD0 A;  2DGZ A;  1KFT A;  3ZI4 A;  2YMM A;  2OHF A;  3N7P D;  2XVT A;  2UVW A;  4RQ1 A;  1TV9 A;  1J2M A;  5AK3 A;  4R64 A;  3OJS A;  1KRP A;  5J2A A;  3R9K A;  4Q45 A;  4DCC A;  3AMZ A;  1NKE A;  1F0M A;  1MSW D;  5ALP A;  2FPL A;  5GTH U;  4J9N A;  1ZQ1 C;  3FAH A;  4Y2S A;  3GV5 B;  4Z6E A;  1KSP A;  1U47 A;  1T3Q A;  4OO1 J;  5KFZ A;  1LKY B;  4PL2 A;  2RLT A;  1PUZ A;  2BCV A;  5DLF A;  2OCE A;  4ED6 A;  8ICR A;  5AKL A;  4O0I A;  3N28 A;  5HR6 A;  3ZD8 A;  5KFT A;  1SWV A;  4EX6 A;  5L1I A;  3PSI A;  3D2Q A;  1BPE A;  2PFN A;  1RQN A;  2DF4 B;  4DOC A;  2WB1 F;  3RJI A;  3RFA A;  4EYI B;  4YMM A;  4UB2 A;  3C5F A;  1J2N A;  5KFY A;  3E0F A;  3TFR A;  2BR0 A;  4MFF A;  4AYB C;  5A0L A;  1SKR A;  3V7J A;  2FJ6 A;  4M2Y A;  3MGV A;  3JPP A;  5DB8 A;  2ISP A;  5ALQ A;  2KN7 A;  3HJE A;  9ICE A;  1X9S A;  1S0O A;  5L1L A;  3RJK A;  1IM4 A;  1QH9 A;  3MFH A;  3C2K A;  2BQ3 A;  1L3U A;  4QZE A;  4GXI A;  5KFR A;  5ALO A;  5CP2 A;  1ZD3 A;  4QZB A;  3H8W A;  4RUA A;  4YVZ A;  5G5G A;  2KZM A;  9ICF A;  2E1F A;  1LVH A;  4CDG A;  5JU5 A;  2QB0 B;  4QWA A;  2FMS A;  3NS1 A;  3A0B U;  4BUG A;  2HHT A;  1ARO P;  2JR5 A;  3S6J A;  3ETR A;  3CRX A;  2ALZ A;  9ICK A;  2JEJ A;  3MR6 A;  1N62 A;  3SAG A;  1UHU A;  3Q8M A;  2KZZ A;  4MFC A;  4DFP A;  4KLF A;  4G9B A;  4QIW F;  4US9 A;  1ZQD A;  3UQ2 A;  2ZIX A;  1N61 A;  5IIJ A;  4DQR A;  7ICR A;  5J2F A;  2FDR A;  2D8C A;  2I1Q A;  1RYU A;  5DGB A;  2AH5 A;  3N7S C;  1N60 A;  4PL1 A;  8ICN A;  2XI9 A;  4IRC A;  1PZN A;  5DQI A;  2AGP A;  1DGJ A;  1S8O A;  4M6W A;  1BNO A;  1SL1 A;  2OYY A;  4YFK A;  3L5K A;  1LV5 A;  1X2I A;  3K4G A;  1BPD A;  1L6N A;  2MSN A;  2XY7 A;  4ELT A;  5AM1 A;  1HEK A;  4RQN A;  3ZD9 A;  2W04 A;  2R8I A;  8ICJ A;  3NVZ A;  2WHE A;  2NRZ A;  2ZXI A;  2W55 A;  2J6S A;  1SL2 A;  4Y2Y A;  2ASD A;  4JV2 A;  2ZIW B;  2BKE A;  3RB0 A;  7ICS A;  3HX0 A;  2W9B B;  8ICB A;  4CGZ A;  4HYK A;  1YZ6 A;  2FLN A;  2W9A A;  2KIV A;  2NO4 A;  4ED1 A;  3B9J A;  4I27 A;  4I2D A;  4JV1 A;  5AIB A;  3KOO A;  3PW5 A;  4DWI A;  4IR9 A;  2XID A;  2W8L A;  3HWT A;  1NJZ A;  3ONN A;  1SKS A;  4UAU A;  1KKX A;  8ICC A;  4M9H A;  1ZQM A;  5AKZ A;  4TUR A;  3AEV A;  1ED1 A;  5KFJ A;  4Q8E A;  4BXO A;  1ZQY A;  2HI0 A;  2KEY A;  5CRX A;  5J0S A;  2FPM A;  4BJQ A;  2WF7 A;  2JH1 A;  2F1H A;  4CRX A;  2YML A;  2KSO A;  2BGW A;  3RB3 A;  4O9M A;  2ZIX B;  2F2A B;  1QSS A;  3QU2 A;  2E8N A;  3TQ1 A;  1Q46 A;  3QZ8 A;  7ICU A;  2KHQ A;  5HHI A;  1SZP A;  1BPX A;  7ICT A;  5ALH A;  1DGS A;  3SMV A;  2I9G A;  3L4P A;  4O3S A;  7ICF A;  3MGI A;  4NM1 A;  1PK1 B;  2E1E A;  1GO3 F;  2ES6 A;  2XC9 A;  2GWS A;  5DG7 A;  2LYA A;  2H3V A;  3M8S A;  3QX7 A;  4YMN A;  4RPZ A;  4RT3 A;  3SQI A;  2HHV A;  4YR2 A;  3PO5 A;  3EWA A;  5KFM A;  9ICP A;  3LVW A;  2AXT U;  3TAQ A;  3SEN A;  3AU6 A;  3ZDC A;  3AQE A;  1D8L A;  3BS5 A;  2C28 A;  4UW9 A;  2BCU A;  2RHF A;  3C23 A;  4F4W A;  3T5J A;  5AKG A;  4RT2 A;  1SGG A;  5KT3 A;  5EWF A;  1WWU A;  2W9M A;  4KIT B;  3M6K A;  3CNH A;  3LWL A;  1NK0 A;  3T5K A; 
#chains in the Genus database with same CATH homology
 3KZI U;  4PJ0 U;  4UB6 U;  4UB8 U;  5KAF U;  1S5L U;  5B5E U;  5GTI U;  3WU2 U;  3A0H U;  5H2F U;  2AXT U;  4IL6 U;  5GTH U;  5E79 U;  5TIS U;  3A0B U;  2DUY A;  5B66 U;  5KAI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...