4UB8U

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 31
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub8U01
1S5LU 3KZIU 4UB6U 5E79U 3A0HU 5H2FU 2AXTU 4IL6U 4UB8U 5KAIU 2DUYA 4PJ0U 5B66U 5GTHU 5GTIU 3WU2U 5KAFU 3A0BU 5TISU 5B5EU
chains in the Genus database with same CATH superfamily
5F9LA 1WYGA 4DSKA 2G5HB 4OO1J 3OHBA 1JUDA 4ECTA 4OJ6A 4X5VA 4F4KA 1D8YA 2W3SA 3SAHA 3OHAA 2F1HA 3WKCA 4QJFB 2DL0A 3QUBA 5CJ7A 2ZIWA 1MQ2A 4G9BA 1X9MA 2LYHA 3BQTA 3D2NA 3RH5A 1OXJA 1N5XA 4QZAA 3F53A 3QE9Y 5B5EU 2PMZC 2F1IA 3B0YA 2KICA 4M0AA 3BS5A 5BPCA 3C23A 3NS1A 3HJEA 3RJKA 1JXLA 1IV8A 1PK3A 2WF7A 4DFMA 2QKQA 2HHSA 3KKAC 2Y1IA 4KLIA 1YT3A 3RJEA 3KHRA 4BXOB 2KV2A 4BGDA 1BPZA 4LZDA 1UQVA 4F72A 5J0YA 4JMUA 5F3XB 2AQ4A 3J81j 4RT3A 7ICUA 3UPQA 4USAA 2FI1A 1N63A 1PZNA 2W9BA 3I76A 1OW5A 4QWCA 3AM9A 2EAOA 4RUAA 5KTQA 3DV9A 1ZQWA 4LVSA 1UPHA 4R8UA 3GIMA 4RPYA 3CP8A 3ETLA 4M9LA 4JV1A 2HHUA 3K1RB 1ZQCA 8ICWA 1P7DA 3PSFA 1Z4NA 5ALXA 5J0SA 4UB6U 3SR6A 2IOHA 5ALWA 1KTQA 3F2BA 3PX0A 4ED0A 4IS7A 1TK5A 7ICVA 2FMSA 5KG6A 5KFNA 3MC1A 5ALJA 4KTQA 3ZDAA 4F50A 1FO4A 4KMOB 2DGZA 1N2XA 3T3FA 1NJYA 1S76D 2K60A 1X6IA 4RPZA 3PO5A 4O5CA 2YMMA 2NRTA 3Q8RB 2RDJA 1LB2B 9ICKA 2BCQA 5DB9A 2XVTA 2OEHA 2W7OA 2Y1JA 3V7LA 3AEVA 4QZIA 7ICQA 4ECRA 2UVRA 4F91B 2Y9UA 2OWOA 3EW9A 7ICGA 4M04A 2P35A 4C4TA 1XSNA 4IR1A 3TI0A 1S9FA 5DLGA 1Z00A 3GFKB 1T3NA 8ICNA 3I28A 3BZKA 4NWIA 2QARA 1MN8A 2KK0A 3CYMA 4I2FA 4PGXA 5J0OA 1ZRNA 2E8OA 2KJ8A 1T7PA 5HHIA 3LWLA 2XICA 5AI8A 4DQIA 4QZCA 8ICJA 4FE3A 3NVWA 4B9SA 2RRDA 5DBAA 4KLEA 5B66U 2EQYA 2H3FA 1ZD4A 1XO0A 1JIHA 5D46A 4US8A 4DQQA 4KLJA 4F8RA 2EZYA 2F44A 1ZXIA 2B6GA 1SV0C 3SENA 2YMPA 3F5AA 1JRPA 2W9BB 4UAYA 4EBCA 5KG1A 5ALOA 2AGPA 2MSNA 5KFGA 2VKQA 4F4YA 2DBYA 3BZCA 2PFOA 1WCLA 4IQWA 3C1YA 2I5HA 5AI9A 2FJ6A 4ECXA 1ZJMA 4J9LA 5C5JA 5KT7A 1ZQIA 2W9AA 8ICLA 4FBUA 3IN5A 3MR2A 2B0CA 3VC8A 2W9CA 3FC4A 4FFDA 5HHHA 3PMLA 8ICFA 4Y2VA 1IG6A 5KFQA 3NUQA 2QLTA 4GIBA 2WAQC 1ZQYA 4QZHA 4YP3A 2AU0A 1QSSA 4QIWF 4OCZA 1Q46A 2KVCA 5DDMA 3T5JA 2C2EA 2ZJ8A 4NLKA 1L7PA 2BCSA 5IIMA 1SWVA 9ICFA 5DDYA 2MAXA 8ICSA 1XS9D 4PJ0U 1Q3UA 5CP2A 5AM2A 2K8BB 2HI0A 5KL8B 5CRXA 3BDPA 4YD1A 4Y2SA 4I27A 2CPRA 3NVYA 1N61A 5DB7A 1S0MA 1NZPA 2QARB 2GO7A 5KFWA 5EOZA 4UBBA 1NZBA 4OD0A 3V6KA 1J2MA 2A3VA 1HEKA 1V85A 5DG9A 4JV2A 1KFDA 4UAVA 1AROP 1ZD2P 3GIIA 2JGAA 2H3IA 3ORYA 2BDUA 4NM1A 5D49A 2A1AA 4KLTA 1SKRA 4FS2A 4XRHA 2KFNA 8ICVA 4ED8A 5AM1A 1X9SA 5AKGA 1ZQRA 4TQRA 3AU6A 1BPEA 4DEZA 4F2RA 1F0MA 3SAFA 2FLNA 2JMGA 1UHUA 1U4BA 1RDFA 4DOBA 4PZNA 3WKBA 3KZXA 2YN4A 1H38A 5AK3A 3RJGA 1RXVA 4BXOA 4MFCA 1PVQA 3T79A 2KP7A 8ICIA 3QU5A 2KEYA 3H0RB 7ICTA 5AKJA 1O08A 5J2KA 5ALSA 5J0TA 4ECSA 5ALUA 2I6XA 2HCFA 3SI8A 3GIKA 4R64A 2K4IA 2BDPA 2EH9A 5A0LA 2W11A 4P4MA 5J8YC 1ZYQA 3ISBA 4NL9A 5ALQA 2EZZA 3V7JA 2FMQA 2PFPA 2DKZA 2E8NA 2ES6A 3PNCA 5KT5A 2I9GA 3R9KA 2W3RA 4UB1A 5J2EA 4EBDA 2K8CB 5JU5A 2HW3A 4PGYA 4UB4A 4PZOA 2FPMA 1QSYA 1FEZA 2C28A 1KKXA 1MSWD 4QW9A 1PK1B 3H0LB 2C2RA 4KLFA 3EZ5A 3HKZC 3C21A 5EE0A 2EZXA 4EYIB 2AJQA 3KBBA 2LBOA 4J9NA 2QB1A 4FZNA 4F4XA 4CDGA 4I2HA 3LVVA 4UBCA 5DGBA 3OPXA 5J2AA 5F9NA 4HYKA 5DQGA 3D2SA 4A8EA 3CW2C 2ATLA 2K4EA 3N7SC 4YXJA 3HILA 2E8MA 2EAMA 3K4GA 4DFKA 2KHQA 4KLLA 4CNQA 3UQ0A 4CCHA 4RPXA 3WK4A 4GXJA 4F92B 3A0BU 5KFLA 1JALA 5KFHA 4GC6A 2PFQA 4B6JA 3M8SA 4NLCA 1COOA 2IBKA 1KFSA 4Y2YA 3WK7A 1KN5A 4PL1A 2HSZA 4TUQA 5AM4A 1SB3C 2W04A 2FDRA 4DSLA 5EE3A 5DKWA 4ECQA 5DQIA 3SZ2A 2XGQA 2BPCA 4DS4A 2YB1A 1ZQMA 2G06A 2DPJA 5L1KA 1ZJNA 4R65A 3BQ1A 4F4ZA 2G5IB 2XCPA 4DSEA 4KMUA 3MABA 3MBYA 4I2GA 9ICJA 2W8KA 3FDSA 4C7YA 1ZQNA 3E0FA 5L9XA 3ZDEA 9ICGA 1FIQA 3QUCA 2UVWA 3IP4B 1NI3A 1L3SA 3BS7A 4UB2A 1NK4A 5EWFA 5TISU 8ICXA 3PR5B 1DK2A 1ZQFA 3TADA 3QNMA 1CUKA 2B21A 5C0YA 3JPTA 5KFUA 4B9VA 2JEGA 4RQ2A 3Q8SB 1K1QA 4F2SA 1L7MA 3L4PA 1TAUA 1NNLA 5L1MA 2BCVA 2OCEA 2ESEA 1D9DA 2BCRA 3ONNA 1NJZA 3RAQA 1F5SA 4ELUA 5KFRA 1RYSA 3NRWA 2NRVA 3N4MB 3MR6A 2JEIA 4YR3A 2AGQA 4C7ZA 4YR2A 2D8CA 3QU9A 2JRZA 3UMBA 3QEAZ 4EZ9A 4EELA 2FLLA 5ALMA 3SYZA 4QZDA 4US9A 3SV3A 7ICIA 4OJ5A 4TURA 3ED5A 1X9XA 7ICKA 3D2QA 4FO6A 5ALNA 5AKYA 9ICXA 2AQ0A 1KFTA 2CRXA 2XI9A 2WTFA 2XO7A 3EWAA 5ALFA 2WF8A 4QWDA 1SGGA 2GLEA 3QUTA 1HIWA 2K4PA 1S5LU 2W54A 8ICYA 4DSFA 4RT2A 4F5PA 3D6JA 4Q45A 4KLOA 4EYHB 5KFSA 2FPKA 3H8SA 3Q8PB 2W43A 5L1LA 2R8HA 4DL5A 2ZTEA 3QXGA 3Q8LA 4IRDA 5ALIA 1NKCA 2HBLA 3M9OB 3PR4A 4CRXA 3HPOA 4NV0A 3TADC 3ZDDA 3ICXA 2HBKA 1J97A 2KJ9A 5AKHA 2PKEA 4BWJA 1ZQBA 3KOOA 4XUSA 2QB0A 2ASJA 7ICPA 4KITB 2KNJA 4Y2XA 3RRHA 1RZTA 4M9HA 1MQ3A 4P0QB 2G07A 4QIWC 2XC9A 4UB3A 4QWAA 5AK5A 1D8BA 1SWWA 4DFPA 3WKDA 3LWMA 3H0MB 4UAUA 3N7PD 1PVPA 2ZIUA 2DWQA 1L8LA 2QB0B 5KFEA 2HHVA 4R66A 1O03A 2L5YA 1KLNA 2ZXIA 3QX7A 2N1RA 4RQ1A 7ICSA 3QU2A 2BGWA 4EX7A 2YB4A 4OJLA 1PVRA 4JWMA 2ZIVA 4PHEA 9ICOA 1D8LA 5E79U 5KG2A 4AYBC 8ICZA 3H7IA 2BZFA 1XNSA 1DGSA 2IHMA 3PV8A 1A76A 4CGZA 1X40A 9ICHA 1LVHA 5IILA 3V6HA 4DF4A 4RNNA 4J9OA 4ZH4A 5GTIU 2DQNB 4DF8A 5JTIA 4PGQA 4MF2A 4O3QA 3LYSA 5DB8A 1KW4A 4K4IA 3GU3A 3T5KA 4KN7A 2YX8A 1S10A 4NL9C 2H3VA 4QZFA 4ICAA 1XO1A 9ICSA 4KLUA 2M0NA 5K4LA 1KEJA 4DSIA 1BPBA 1A77A 5DG7A 4RUCA 2Y0SF 4RQMA 5AM3A 3M9NB 4M9NA 8ICKA 2NRZA 4Y2PA 4Y2UA 3L3FX 4M6WA 4OJOA 1NKEA 5AI0A 2D3DA 2NO4A 3QZ7A 4HAIA 3RJIA 5CWRA 3SD7A 5IIOA 9ICTA 3NVVA 1XSLA 2R8JA 5ALGA 5J0RA 1SL0A 2KG5A 4YN4A 2RP5A 5KL1B 8ICEA 4MFAA 4NLZA 4M2YA 1KL9A 3B9JA 4O3NA 5J2GA 4PHPA 3LK9A 3V6JA 2J6UA 1SKSA 4C8LA 5KG5A 4ECYA 2W9CB 2ZIUB 3C2KA 4ECZA 7ICHA 4RZRA 2E1EA 5HMMA 3MDCA 5J0WA 4IR9A 3MGVA 1QQ5A 3PX6A 3JPNA 5KT6A 1KDHA 3KD3A 4PHAA 4I2DA 5KFJA 4BX9C 4RNOA 3M9MB 1JI7A 2Y0SC 5AICA 1ZQPA 5ALYA 4RQNA 3ZDBA 5ALPA 3VCBA 2HVIA 4QZ9A 1S77D 4I2JA 4CF5A 3RRGA 3QU4A 5KFMA 1N60A 4UB5A 3GV7B 4Y2QA 2HOQA 1TAQA 3IM1A 5IINA 1TV9A 5ALEA 4DFDA 1IM4A 1RYUA 5ALDA 2F8KA 2ZUDA 2R8IA 1D9FA 2ODGA 3RTVA 2ISPA 2AGOA 1L3VA 4ECWA 2XIDA 4QW8A 4O5EA 4YMMA 4ACOA 3WK5A 4YMNA 4GXIA 3NASA 2V4RA 3F2CA 4IQUA 2JV3A 5J2BA 4YD2A 1XC9A 2VA8A 1J2NA 3RAXA 8ICUA 2KE7A 2ISOA 3NVZA 3GDXA 2YMQA 1MC8A 5AKZA 5KFFA 2PI4A 2PI5A 3KFUF 4QZ8A 1V9PA 1JROA 1TK0A 2DKXA 2F77X 4FS1A 1HJPA 3PZPA 3KHGA 2Z7JA 2P6UA 1WUDA 2D6FC 1LKYA 3TFSA 2VA3A 9ICCA 8ICBA 2Q0ZX 3BQ7A 3PVXA 2IMWP 2BKEA 1TFRA 2LYBA 4BJQA 4Z6CA 4EEYA 5KG0A 4J03A 2VIXA 5KFIA 4DFJA 4ED3A 1L3UA 4YFKA 4NLBA 2G09A 1NKBA 3H8JA 2F1JA 1OUQA 3K1ZA 4IRCA 3UXNA 1MA7A 5KT3A 3UXPA 4JWNA 1VJ5A 3UXOA 3TQ1A 2K8AA 4DL4A 4YXMA 3HRDD 3N7RC 1XU4A 4RQ6A 1YZ6A 2XCAA 8ICPA 4ED1A 2LPEA 3WKEA 2ZJAA 2J6SA 2JH7A 5HNKA 1CRXA 3N97B 2HDOA 3EPIA 3RFAA 4EX6A 3V72A 4K4GA 2CN1A 2LM4A 1V97A 5AHXA 5T14A 2GWSA 1K5OA 2MU2A 4DQRA 5CEHA 3MR3A 1RPLA 4RQ5A 4C8NA 5ALRA 1U45A 3GZFA 1JX4A 4M47A 5TZVA 2I1QA 3PW5A 7ICMA 4PHDA 3H4BA 4FZMA 3AL0B 4EBEA 3HX0A 3H4DA 5KFKA 5J2IA 9ICRA 2OYYA 1SL2A 3AQEA 3PW2A 1LKYB 1ZQQA 3MR5A 4ED7A 5KFVA 2V9WA 4UATA 1B43A 5J2JA 4RQ8A 3RH4A 2W03A 2H5XA 1V38A 5BOLA 2KKPA 1Q3VA 4O3RA 9ICPA 5AK4A 4I2BA 2HHXA 3BJYA 4C4SA 5IIJA 2R8GA 1X66A 2WF5A 2KOBA 4CF4A 3BQ2A 5D4BA 4Q44A 3IDWA 5G5GA 2VANA 3TAPA 1NJXA 4DCCA 5KT2A 2J6TA 1FFVA 5AIAA 4YCXA 2ASLA 1B4FA 4F5QA 4B9UA 2HVHA 2LHTA 2ZTDA 3WKAA 3MFIA 4I2AA 5KG3A 3QEBZ 3PSPA 2IOFA 5AKEA 2LKYA 1JN3A 4ZOHC 4NM2A 4R8UB 1TVAA 4DL2A 1UA0A 5ALHA 3M8RA 2BCUA 2BPGA 4NXZA 1Z4OA 2KKVA 3F5EA 3ZI4A 4J9SA 4K4HA 4PH5A 3E2EA 2FE9A 4P4OA 4FBTA 2LMRA 2G0AA 5J0QA 4YMOA 3IRUA 5DBBA 4QWEA 5CR0A 3RJHA 3T5HA 1Z1BA 2BPFA 1ED1A 5KT4A 2M9NA 5KFPA 1NK9A 2JR5A 4C8OA 4KN4A 3NGDA 4C8MA 3C28A 4KLHA 1PK1A 2FLPA 3SQIA 5ALLA 5CHGA 5HP4A 3LVWA 4J9KA 1L6NA 1EXNA 5KFZA 2LM1A 5ALVA 3HP6A 4RQ0A 5IIKA 3C2LA 3C2MA 3HWTA 5HR6A 7ICRA 3C5FA 3TKAA 4F5RA 3HKZF 1ZQZA 2JEFA 4DQSA 1VLBA 5AIBA 1X6JA 1ZQOA 1BGXT 4NLGA 4DLEA 5J0XA 4EEKA 4IC9A 2WHEA 4OJPA 2PMZF 1TE2A 4G3IA 2JZBB 4JUZA 2ZIXB 2KIWA 2BHNA 2R18A 2HMXA 9ICEA 3NTUA 3TANA 1VDVA 2EDUA 2ZXHA 4UARA 3M1YA 4QWBA 4B9NA 3PW4A 3SEIA 1COKA 4F3OA 4J9QA 2PXIA 3GQCA 4IQTA 1SV4A 4DL6A 5AK6A 3PW0A 1HUZA 5KFCA 4GC7A 3C5GA 4KLDA 2KJ5A 1F44A 3WK6A 1DRGA 1C20A 1B0XA 4GFJA 5EE9A 3MDAA 1ZQJA 3M6ZA 4O3MA 1L5UA 1ZQHA 3QZ8A 3AMZA 4F4WA 3RF9A 8ICTA 1A6SA 1ZQDA 1DGJA 2KZMA 2JXJA 4NY8A 2YQEA 4U6PA 2NYVA 3KKAA 1NK5A 4IQVA 7ICNA 1U48A 4J9PA 2DF4B 5GTHU 4ELTA 4QZGA 5J8YA 2WF6A 5L1IA 5KG4A 2KZ3A 1RG6A 3SMVA 2LYAA 3QU7A 3HT3A 1RM6C 2RHFA 1U9LA 9ICLA 3C29A 3OGUA 3LDAA 2A1JA 2IOFK 2YTUA 1L3TA 1FFUA 3TAQA 3KTQA 3GILA 2W8LA 2VJ4A 5JRTA 4UAWA 1KBUA 2KSOA 3Q8KA 4YQWA 3PMNA 2KD1A 2MUTA 2CXYA 4BDPA 4P2HA 3FYHA 8ICRA 1TK8A 2WF9A 1YZ7A 3QUQA 1HUOA 2OM6A 3MFHA 1UT5A 2BR0A 5KFOA 3IG5A 1X9WA 9ICWA 7ICFA 2F76X 4DO9A 3L5KA 5DB6A 3IHQB 4YR0A 1ZQGA 3T5LA 4DOAA 8ICCA 3RR8A 3O0FA 3UMCA 1RQLA 2RDIA 5J2DA 4DOCA 4DL7A 3DEEA 1T3QA 4M9GA 1WWVA 1SZPA 2AHOB 1L7NA 3PO4A 5J0UA 5AKKA 3Q8QB 1A0PA 3DDHA 4Y2RA 1PUZA 2MRLA 2WB1F 4ED2A 4C4RA 1Y88A 5AI6A 2Y9TA 5KAIU 1S0NA 1SIJA 2MA1A 2JHDA 1Z00B 2YY6A 1KQQA 5DQHA 1BVSA 1N5WA 2V4QA 1X42A 1ZQSA 2O6KA 4EZ6A 3RB3A 3WU2U 2HBMA 5KNIA 3OSPA 3RBDA 4I2IA 9ICVA 9ICUA 9ICQA 1B22A 1ZQUA 1ZQXA 3I1YA 2XY7A 4CF3A 4I2EA 4UAZA 1BNOA 9ICAA 1TAMA 5JUMA 2WAQF 1U49A 4RU9A 4O0IA 4DWIA 5BOMA 4M6WB 4O3PA 4P0PA 4AYBF 4Q8EA 1S0VA 1QQ7A 2OHFA 2OH2A 2BQRA 3M6KA 3M7DA 4M9JA 2RLTA 5KFAA 2KVSA 4MF8A 3A0HU 1S97A 2HOFA 3TARA 3EUB2 2KN7A 4ED6A 2E3TA 3ISCA 2FPLA 2NO5A 3OSNA 4MEXA 2KTQA 2WB1C 4GLXA 1SZHA 1BPDA 3U26A 4XQ8A 2OXOA 4MEYA 2K89A 3TFRA 4EENA 1QSLA 8ICAA 2H3ZA 4P4PA 1RYRA 2E8PA 2A19A 2ZTCA 4Z6EA 4Y2TA 4UW9A 4U7CA 8ICMA 4GXKA 5ALKA 1NK0A 2H3QA 1NK8A 8ICQA 4YVZA 1SXDA 3MGHA 2E1FA 1XSPA 2NRWA 2JH1A 3AN1A 5ALTA 4F5OA 3ZD9A 3KZIU 3JPSA 1ZQKA 3EYZA 3PSTA 4QZEA 2ZG6A 5KFDA 4XA5A 1N48A 5IIIA 1S8OA 4DS5A 2HHTA 5L1JA 4UB8U 4O3SA 1DOQA 1U47A 2DPIA 2PFNA 4RQ3A 2BQUA 4RNMA 1KRPA 1Q8KA 2W7PA 3HW8A 1T8EA 3G6VA 1C7YA 3IV6A 2KZZA 3TACB 4R63A 2ZIWB 2IA6A 4KLGA 4ELVA 1Z19A 4RQ4A 3K75D 4O5KA 4TUPA 4Z6FA 1T94A 4Z6DA 4P0QA 4BUGA 7ICLA 1ZQTA 4JK1A 4NJ8A 5CB1A 2KIVA 2JEJA 4KLSA 3RR7A 2KMDA 3C1ZA 2G08A 2YMLA 2P66A 2ZUBA 3N28A 3OJSA 4MFFA 2EANA 1CI4A 1SV0A 3OTQA 4IRKA 2Q4TA 2BQ3A 4CE6A 1L8OA 5AKXA 5AM0A 3IG8A 2VA2A 1ZOLA 1QCKA 2RQ5A 2ASDA 3PW7A 3ZD8A 3G6XA 5KFXA 2IHNA 1IXRA 1Z3EB 1KSPA 4C80A 3JPQA 5FP0A 5DLFA 4QZBA 2ZIVB 3ZDCA 4PPXA 2AXTU 3Q8MA 4NLNA 4FZLA 2A1JB 5KFBA 3SV4A 8ICGA 1S0OA 3EPGA 3PSIA 1NJWA 2HHQA 2DUYA 3BQ0A 1LV5A 4BWMA 4P0PB 4O9MA 1N62A 4LJXA 3WK8A 2W9MA 5DG8A 4TQSA 3RJJA 5KFYA 4I29A 9ICBA 1NK7A 2KFZA 3AQFA 2F3NA 4KX3A 1SKWA 5ALZA 2AH5A 4F5NA 1QH9A 1UA1A 2GH1A 2K4HA 2ZUCA 4DSJA 3MGIA 2JZBA 4E0DA 5AI4A 1WCNA 5EWEA 9ICNA 3RB4A 1XWLA 3ISDA 5HMLA 4PL2A 1ECWA 4B9MA 7ICJA 1M6YA 5KAFU 1ZD5A 2W55A 4Y2JA 5KFTA 2HHWA 4QNLA 3AUOA 3G6YA 2MUTB 3RH6A 3WK9A 2VJ5A 1ZETA 1JMSA 4F71A 3ETRA 1DXSA 3NRZA 4KLQA 4C8KA 4YG2A 2HBJA 1URJA 3GV8B 4AP9A 1TKDA 2ZJ5A 2ALZA 4RQ7A 3UMGA 3JPOA 1WWUA 2R8KA 5KG7A 5CA7A 1SXEA 1ZQ1C 5AI5A 4LZGA 8ICOA 3BS5B 4DQPA 3PX4A 1SL1A 1GO3F 1DK3A 2XGPA 4IL6U 3GV5B 1QLNA 1L7OA 4UASA 2FMPA 3GIJA 4JB3A 5HR7A 3E58A 1AQ6A 2C2DA 1ZQLA 5J2HA 9ICMA 2C22A 5H2FU 1NK6A 1ZQVA 5DGAA 1K1SA 1ZQAA 3KHHA 2UVUA 3SAGA 3FAHA 3UM9A 4JV0A 1QTMA 4Q43A 2NV3A 2HOIA 1ZQEA 4B9TA 2ZIXA 3S6JA 2WFAA 5J0PA 2GOLA 3CRXA 1ZRMA 2KSOB 3JPRA 5J2FA 1JXEA 1RQNA 4B9LA 1NOMA 2F8LA 1RXWA 1BPYA 1CEZA 2EAPA 3CNHA 5DBCA 5EE1A 2P6RA 3ALRA 4UQGA 4I28A 3B0XA 1ZD3A 3RBEA 3H8MA 4ECUA 1UT8A 3FM9A 4ECVA 3H40A 7ICEA 1WG8A 3AU2A 5G5HA 4MHVA 5J29A 3THVA 4Q8FA 2DFLA 3KHLA 4O3OA 5EWGA 3RB0A 4WJ3B 2NRXA 3F2DA 2XY6A 3UQ2A 2KHVA 1N56A 4J9MA 2E5SA 3PY8A 5J2CA 1BPXA 1X2IA 1BNPA 9ICIA 3QYPA 7ICOA 8ICHA 4DL3A 2LI6A 1UCVA 3OJUA 3H8WA 4KLMA 3JPPA 2F2AB 5AKLA 3RJFA 4KX5A 4F93B 4J9RA 2UVVA 5AM5A 3V7KA 3RB6A 1T4GA 4TUSA 2XY5A 4I2CA 4DLGA 4C0ZA 1QQ6A 1IIPA 1Z1VA 5AKIA
chains in the Genus database with same CATH topology
1S5LU 3KZIU 4UB6U 5E79U 3A0HU 5H2FU 2AXTU 4IL6U 4UB8U 5KAIU 2DUYA 4PJ0U 5B66U 5GTHU 5GTIU 3WU2U 5KAFU 3A0BU 5TISU 5B5EU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L U;  3KZI U;  4UB6 U;  5E79 U;  3A0H U;  5H2F U;  2AXT U;  4IL6 U;  4UB8 U;  5KAI U;  2DUY A;  4PJ0 U;  5B66 U;  5GTH U;  5GTI U;  3WU2 U;  5KAF U;  3A0B U;  5TIS U;  5B5E U; 
#chains in the Genus database with same CATH topology
 5F9L A;  1WYG A;  4DSK A;  2G5H B;  4OO1 J;  3OHB A;  1JUD A;  4ECT A;  4OJ6 A;  4X5V A;  4F4K A;  1D8Y A;  2W3S A;  3SAH A;  3OHA A;  2F1H A;  3WKC A;  4QJF B;  2DL0 A;  3QUB A;  5CJ7 A;  2ZIW A;  1MQ2 A;  4G9B A;  1X9M A;  2LYH A;  3BQT A;  3D2N A;  3RH5 A;  1OXJ A;  1N5X A;  4QZA A;  3F53 A;  3QE9 Y;  5B5E U;  2PMZ C;  2F1I A;  3B0Y A;  2KIC A;  4M0A A;  3BS5 A;  5BPC A;  3C23 A;  3NS1 A;  3HJE A;  3RJK A;  1JXL A;  1IV8 A;  1PK3 A;  2WF7 A;  4DFM A;  2QKQ A;  2HHS A;  3KKA C;  2Y1I A;  4KLI A;  1YT3 A;  3RJE A;  3KHR A;  4BXO B;  2KV2 A;  4BGD A;  1BPZ A;  4LZD A;  1UQV A;  4F72 A;  5J0Y A;  4JMU A;  5F3X B;  2AQ4 A;  3J81 j;  4RT3 A;  7ICU A;  3UPQ A;  4USA A;  2FI1 A;  1N63 A;  1PZN A;  2W9B A;  3I76 A;  1OW5 A;  4QWC A;  3AM9 A;  2EAO A;  4RUA A;  5KTQ A;  3DV9 A;  1ZQW A;  4LVS A;  1UPH A;  4R8U A;  3GIM A;  4RPY A;  3CP8 A;  3ETL A;  4M9L A;  4JV1 A;  2HHU A;  3K1R B;  1ZQC A;  8ICW A;  1P7D A;  3PSF A;  1Z4N A;  5ALX A;  5J0S A;  4UB6 U;  3SR6 A;  2IOH A;  5ALW A;  1KTQ A;  3F2B A;  3PX0 A;  4ED0 A;  4IS7 A;  1TK5 A;  7ICV A;  2FMS A;  5KG6 A;  5KFN A;  3MC1 A;  5ALJ A;  4KTQ A;  3ZDA A;  4F50 A;  1FO4 A;  4KMO B;  2DGZ A;  1N2X A;  3T3F A;  1NJY A;  1S76 D;  2K60 A;  1X6I A;  4RPZ A;  3PO5 A;  4O5C A;  2YMM A;  2NRT A;  3Q8R B;  2RDJ A;  1LB2 B;  9ICK A;  2BCQ A;  5DB9 A;  2XVT A;  2OEH A;  2W7O A;  2Y1J A;  3V7L A;  3AEV A;  4QZI A;  7ICQ A;  4ECR A;  2UVR A;  4F91 B;  2Y9U A;  2OWO A;  3EW9 A;  7ICG A;  4M04 A;  2P35 A;  4C4T A;  1XSN A;  4IR1 A;  3TI0 A;  1S9F A;  5DLG A;  1Z00 A;  3GFK B;  1T3N A;  8ICN A;  3I28 A;  3BZK A;  4NWI A;  2QAR A;  1MN8 A;  2KK0 A;  3CYM A;  4I2F A;  4PGX A;  5J0O A;  1ZRN A;  2E8O A;  2KJ8 A;  1T7P A;  5HHI A;  3LWL A;  2XIC A;  5AI8 A;  4DQI A;  4QZC A;  8ICJ A;  4FE3 A;  3NVW A;  4B9S A;  2RRD A;  5DBA A;  4KLE A;  5B66 U;  2EQY A;  2H3F A;  1ZD4 A;  1XO0 A;  1JIH A;  5D46 A;  4US8 A;  4DQQ A;  4KLJ A;  4F8R A;  2EZY A;  2F44 A;  1ZXI A;  2B6G A;  1SV0 C;  3SEN A;  2YMP A;  3F5A A;  1JRP A;  2W9B B;  4UAY A;  4EBC A;  5KG1 A;  5ALO A;  2AGP A;  2MSN A;  5KFG A;  2VKQ A;  4F4Y A;  2DBY A;  3BZC A;  2PFO A;  1WCL A;  4IQW A;  3C1Y A;  2I5H A;  5AI9 A;  2FJ6 A;  4ECX A;  1ZJM A;  4J9L A;  5C5J A;  5KT7 A;  1ZQI A;  2W9A A;  8ICL A;  4FBU A;  3IN5 A;  3MR2 A;  2B0C A;  3VC8 A;  2W9C A;  3FC4 A;  4FFD A;  5HHH A;  3PML A;  8ICF A;  4Y2V A;  1IG6 A;  5KFQ A;  3NUQ A;  2QLT A;  4GIB A;  2WAQ C;  1ZQY A;  4QZH A;  4YP3 A;  2AU0 A;  1QSS A;  4QIW F;  4OCZ A;  1Q46 A;  2KVC A;  5DDM A;  3T5J A;  2C2E A;  2ZJ8 A;  4NLK A;  1L7P A;  2BCS A;  5IIM A;  1SWV A;  9ICF A;  5DDY A;  2MAX A;  8ICS A;  1XS9 D;  4PJ0 U;  1Q3U A;  5CP2 A;  5AM2 A;  2K8B B;  2HI0 A;  5KL8 B;  5CRX A;  3BDP A;  4YD1 A;  4Y2S A;  4I27 A;  2CPR A;  3NVY A;  1N61 A;  5DB7 A;  1S0M A;  1NZP A;  2QAR B;  2GO7 A;  5KFW A;  5EOZ A;  4UBB A;  1NZB A;  4OD0 A;  3V6K A;  1J2M A;  2A3V A;  1HEK A;  1V85 A;  5DG9 A;  4JV2 A;  1KFD A;  4UAV A;  1ARO P;  1ZD2 P;  3GII A;  2JGA A;  2H3I A;  3ORY A;  2BDU A;  4NM1 A;  5D49 A;  2A1A A;  4KLT A;  1SKR A;  4FS2 A;  4XRH A;  2KFN A;  8ICV A;  4ED8 A;  5AM1 A;  1X9S A;  5AKG A;  1ZQR A;  4TQR A;  3AU6 A;  1BPE A;  4DEZ A;  4F2R A;  1F0M A;  3SAF A;  2FLN A;  2JMG A;  1UHU A;  1U4B A;  1RDF A;  4DOB A;  4PZN A;  3WKB A;  3KZX A;  2YN4 A;  1H38 A;  5AK3 A;  3RJG A;  1RXV A;  4BXO A;  4MFC A;  1PVQ A;  3T79 A;  2KP7 A;  8ICI A;  3QU5 A;  2KEY A;  3H0R B;  7ICT A;  5AKJ A;  1O08 A;  5J2K A;  5ALS A;  5J0T A;  4ECS A;  5ALU A;  2I6X A;  2HCF A;  3SI8 A;  3GIK A;  4R64 A;  2K4I A;  2BDP A;  2EH9 A;  5A0L A;  2W11 A;  4P4M A;  5J8Y C;  1ZYQ A;  3ISB A;  4NL9 A;  5ALQ A;  2EZZ A;  3V7J A;  2FMQ A;  2PFP A;  2DKZ A;  2E8N A;  2ES6 A;  3PNC A;  5KT5 A;  2I9G A;  3R9K A;  2W3R A;  4UB1 A;  5J2E A;  4EBD A;  2K8C B;  5JU5 A;  2HW3 A;  4PGY A;  4UB4 A;  4PZO A;  2FPM A;  1QSY A;  1FEZ A;  2C28 A;  1KKX A;  1MSW D;  4QW9 A;  1PK1 B;  3H0L B;  2C2R A;  4KLF A;  3EZ5 A;  3HKZ C;  3C21 A;  5EE0 A;  2EZX A;  4EYI B;  2AJQ A;  3KBB A;  2LBO A;  4J9N A;  2QB1 A;  4FZN A;  4F4X A;  4CDG A;  4I2H A;  3LVV A;  4UBC A;  5DGB A;  3OPX A;  5J2A A;  5F9N A;  4HYK A;  5DQG A;  3D2S A;  4A8E A;  3CW2 C;  2ATL A;  2K4E A;  3N7S C;  4YXJ A;  3HIL A;  2E8M A;  2EAM A;  3K4G A;  4DFK A;  2KHQ A;  4KLL A;  4CNQ A;  3UQ0 A;  4CCH A;  4RPX A;  3WK4 A;  4GXJ A;  4F92 B;  3A0B U;  5KFL A;  1JAL A;  5KFH A;  4GC6 A;  2PFQ A;  4B6J A;  3M8S A;  4NLC A;  1COO A;  2IBK A;  1KFS A;  4Y2Y A;  3WK7 A;  1KN5 A;  4PL1 A;  2HSZ A;  4TUQ A;  5AM4 A;  1SB3 C;  2W04 A;  2FDR A;  4DSL A;  5EE3 A;  5DKW A;  4ECQ A;  5DQI A;  3SZ2 A;  2XGQ A;  2BPC A;  4DS4 A;  2YB1 A;  1ZQM A;  2G06 A;  2DPJ A;  5L1K A;  1ZJN A;  4R65 A;  3BQ1 A;  4F4Z A;  2G5I B;  2XCP A;  4DSE A;  4KMU A;  3MAB A;  3MBY A;  4I2G A;  9ICJ A;  2W8K A;  3FDS A;  4C7Y A;  1ZQN A;  3E0F A;  5L9X A;  3ZDE A;  9ICG A;  1FIQ A;  3QUC A;  2UVW A;  3IP4 B;  1NI3 A;  1L3S A;  3BS7 A;  4UB2 A;  1NK4 A;  5EWF A;  5TIS U;  8ICX A;  3PR5 B;  1DK2 A;  1ZQF A;  3TAD A;  3QNM A;  1CUK A;  2B21 A;  5C0Y A;  3JPT A;  5KFU A;  4B9V A;  2JEG A;  4RQ2 A;  3Q8S B;  1K1Q A;  4F2S A;  1L7M A;  3L4P A;  1TAU A;  1NNL A;  5L1M A;  2BCV A;  2OCE A;  2ESE A;  1D9D A;  2BCR A;  3ONN A;  1NJZ A;  3RAQ A;  1F5S A;  4ELU A;  5KFR A;  1RYS A;  3NRW A;  2NRV A;  3N4M B;  3MR6 A;  2JEI A;  4YR3 A;  2AGQ A;  4C7Z A;  4YR2 A;  2D8C A;  3QU9 A;  2JRZ A;  3UMB A;  3QEA Z;  4EZ9 A;  4EEL A;  2FLL A;  5ALM A;  3SYZ A;  4QZD A;  4US9 A;  3SV3 A;  7ICI A;  4OJ5 A;  4TUR A;  3ED5 A;  1X9X A;  7ICK A;  3D2Q A;  4FO6 A;  5ALN A;  5AKY A;  9ICX A;  2AQ0 A;  1KFT A;  2CRX A;  2XI9 A;  2WTF A;  2XO7 A;  3EWA A;  5ALF A;  2WF8 A;  4QWD A;  1SGG A;  2GLE A;  3QUT A;  1HIW A;  2K4P A;  1S5L U;  2W54 A;  8ICY A;  4DSF A;  4RT2 A;  4F5P A;  3D6J A;  4Q45 A;  4KLO A;  4EYH B;  5KFS A;  2FPK A;  3H8S A;  3Q8P B;  2W43 A;  5L1L A;  2R8H A;  4DL5 A;  2ZTE A;  3QXG A;  3Q8L A;  4IRD A;  5ALI A;  1NKC A;  2HBL A;  3M9O B;  3PR4 A;  4CRX A;  3HPO A;  4NV0 A;  3TAD C;  3ZDD A;  3ICX A;  2HBK A;  1J97 A;  2KJ9 A;  5AKH A;  2PKE A;  4BWJ A;  1ZQB A;  3KOO A;  4XUS A;  2QB0 A;  2ASJ A;  7ICP A;  4KIT B;  2KNJ A;  4Y2X A;  3RRH A;  1RZT A;  4M9H A;  1MQ3 A;  4P0Q B;  2G07 A;  4QIW C;  2XC9 A;  4UB3 A;  4QWA A;  5AK5 A;  1D8B A;  1SWW A;  4DFP A;  3WKD A;  3LWM A;  3H0M B;  4UAU A;  3N7P D;  1PVP A;  2ZIU A;  2DWQ A;  1L8L A;  2QB0 B;  5KFE A;  2HHV A;  4R66 A;  1O03 A;  2L5Y A;  1KLN A;  2ZXI A;  3QX7 A;  2N1R A;  4RQ1 A;  7ICS A;  3QU2 A;  2BGW A;  4EX7 A;  2YB4 A;  4OJL A;  1PVR A;  4JWM A;  2ZIV A;  4PHE A;  9ICO A;  1D8L A;  5E79 U;  5KG2 A;  4AYB C;  8ICZ A;  3H7I A;  2BZF A;  1XNS A;  1DGS A;  2IHM A;  3PV8 A;  1A76 A;  4CGZ A;  1X40 A;  9ICH A;  1LVH A;  5IIL A;  3V6H A;  4DF4 A;  4RNN A;  4J9O A;  4ZH4 A;  5GTI U;  2DQN B;  4DF8 A;  5JTI A;  4PGQ A;  4MF2 A;  4O3Q A;  3LYS A;  5DB8 A;  1KW4 A;  4K4I A;  3GU3 A;  3T5K A;  4KN7 A;  2YX8 A;  1S10 A;  4NL9 C;  2H3V A;  4QZF A;  4ICA A;  1XO1 A;  9ICS A;  4KLU A;  2M0N A;  5K4L A;  1KEJ A;  4DSI A;  1BPB A;  1A77 A;  5DG7 A;  4RUC A;  2Y0S F;  4RQM A;  5AM3 A;  3M9N B;  4M9N A;  8ICK A;  2NRZ A;  4Y2P A;  4Y2U A;  3L3F X;  4M6W A;  4OJO A;  1NKE A;  5AI0 A;  2D3D A;  2NO4 A;  3QZ7 A;  4HAI A;  3RJI A;  5CWR A;  3SD7 A;  5IIO A;  9ICT A;  3NVV A;  1XSL A;  2R8J A;  5ALG A;  5J0R A;  1SL0 A;  2KG5 A;  4YN4 A;  2RP5 A;  5KL1 B;  8ICE A;  4MFA A;  4NLZ A;  4M2Y A;  1KL9 A;  3B9J A;  4O3N A;  5J2G A;  4PHP A;  3LK9 A;  3V6J A;  2J6U A;  1SKS A;  4C8L A;  5KG5 A;  4ECY A;  2W9C B;  2ZIU B;  3C2K A;  4ECZ A;  7ICH A;  4RZR A;  2E1E A;  5HMM A;  3MDC A;  5J0W A;  4IR9 A;  3MGV A;  1QQ5 A;  3PX6 A;  3JPN A;  5KT6 A;  1KDH A;  3KD3 A;  4PHA A;  4I2D A;  5KFJ A;  4BX9 C;  4RNO A;  3M9M B;  1JI7 A;  2Y0S C;  5AIC A;  1ZQP A;  5ALY A;  4RQN A;  3ZDB A;  5ALP A;  3VCB A;  2HVI A;  4QZ9 A;  1S77 D;  4I2J A;  4CF5 A;  3RRG A;  3QU4 A;  5KFM A;  1N60 A;  4UB5 A;  3GV7 B;  4Y2Q A;  2HOQ A;  1TAQ A;  3IM1 A;  5IIN A;  1TV9 A;  5ALE A;  4DFD A;  1IM4 A;  1RYU A;  5ALD A;  2F8K A;  2ZUD A;  2R8I A;  1D9F A;  2ODG A;  3RTV A;  2ISP A;  2AGO A;  1L3V A;  4ECW A;  2XID A;  4QW8 A;  4O5E A;  4YMM A;  4ACO A;  3WK5 A;  4YMN A;  4GXI A;  3NAS A;  2V4R A;  3F2C A;  4IQU A;  2JV3 A;  5J2B A;  4YD2 A;  1XC9 A;  2VA8 A;  1J2N A;  3RAX A;  8ICU A;  2KE7 A;  2ISO A;  3NVZ A;  3GDX A;  2YMQ A;  1MC8 A;  5AKZ A;  5KFF A;  2PI4 A;  2PI5 A;  3KFU F;  4QZ8 A;  1V9P A;  1JRO A;  1TK0 A;  2DKX A;  2F77 X;  4FS1 A;  1HJP A;  3PZP A;  3KHG A;  2Z7J A;  2P6U A;  1WUD A;  2D6F C;  1LKY A;  3TFS A;  2VA3 A;  9ICC A;  8ICB A;  2Q0Z X;  3BQ7 A;  3PVX A;  2IMW P;  2BKE A;  1TFR A;  2LYB A;  4BJQ A;  4Z6C A;  4EEY A;  5KG0 A;  4J03 A;  2VIX A;  5KFI A;  4DFJ A;  4ED3 A;  1L3U A;  4YFK A;  4NLB A;  2G09 A;  1NKB A;  3H8J A;  2F1J A;  1OUQ A;  3K1Z A;  4IRC A;  3UXN A;  1MA7 A;  5KT3 A;  3UXP A;  4JWN A;  1VJ5 A;  3UXO A;  3TQ1 A;  2K8A A;  4DL4 A;  4YXM A;  3HRD D;  3N7R C;  1XU4 A;  4RQ6 A;  1YZ6 A;  2XCA A;  8ICP A;  4ED1 A;  2LPE A;  3WKE A;  2ZJA A;  2J6S A;  2JH7 A;  5HNK A;  1CRX A;  3N97 B;  2HDO A;  3EPI A;  3RFA A;  4EX6 A;  3V72 A;  4K4G A;  2CN1 A;  2LM4 A;  1V97 A;  5AHX A;  5T14 A;  2GWS A;  1K5O A;  2MU2 A;  4DQR A;  5CEH A;  3MR3 A;  1RPL A;  4RQ5 A;  4C8N A;  5ALR A;  1U45 A;  3GZF A;  1JX4 A;  4M47 A;  5TZV A;  2I1Q A;  3PW5 A;  7ICM A;  4PHD A;  3H4B A;  4FZM A;  3AL0 B;  4EBE A;  3HX0 A;  3H4D A;  5KFK A;  5J2I A;  9ICR A;  2OYY A;  1SL2 A;  3AQE A;  3PW2 A;  1LKY B;  1ZQQ A;  3MR5 A;  4ED7 A;  5KFV A;  2V9W A;  4UAT A;  1B43 A;  5J2J A;  4RQ8 A;  3RH4 A;  2W03 A;  2H5X A;  1V38 A;  5BOL A;  2KKP A;  1Q3V A;  4O3R A;  9ICP A;  5AK4 A;  4I2B A;  2HHX A;  3BJY A;  4C4S A;  5IIJ A;  2R8G A;  1X66 A;  2WF5 A;  2KOB A;  4CF4 A;  3BQ2 A;  5D4B A;  4Q44 A;  3IDW A;  5G5G A;  2VAN A;  3TAP A;  1NJX A;  4DCC A;  5KT2 A;  2J6T A;  1FFV A;  5AIA A;  4YCX A;  2ASL A;  1B4F A;  4F5Q A;  4B9U A;  2HVH A;  2LHT A;  2ZTD A;  3WKA A;  3MFI A;  4I2A A;  5KG3 A;  3QEB Z;  3PSP A;  2IOF A;  5AKE A;  2LKY A;  1JN3 A;  4ZOH C;  4NM2 A;  4R8U B;  1TVA A;  4DL2 A;  1UA0 A;  5ALH A;  3M8R A;  2BCU A;  2BPG A;  4NXZ A;  1Z4O A;  2KKV A;  3F5E A;  3ZI4 A;  4J9S A;  4K4H A;  4PH5 A;  3E2E A;  2FE9 A;  4P4O A;  4FBT A;  2LMR A;  2G0A A;  5J0Q A;  4YMO A;  3IRU A;  5DBB A;  4QWE A;  5CR0 A;  3RJH A;  3T5H A;  1Z1B A;  2BPF A;  1ED1 A;  5KT4 A;  2M9N A;  5KFP A;  1NK9 A;  2JR5 A;  4C8O A;  4KN4 A;  3NGD A;  4C8M A;  3C28 A;  4KLH A;  1PK1 A;  2FLP A;  3SQI A;  5ALL A;  5CHG A;  5HP4 A;  3LVW A;  4J9K A;  1L6N A;  1EXN A;  5KFZ A;  2LM1 A;  5ALV A;  3HP6 A;  4RQ0 A;  5IIK A;  3C2L A;  3C2M A;  3HWT A;  5HR6 A;  7ICR A;  3C5F A;  3TKA A;  4F5R A;  3HKZ F;  1ZQZ A;  2JEF A;  4DQS A;  1VLB A;  5AIB A;  1X6J A;  1ZQO A;  1BGX T;  4NLG A;  4DLE A;  5J0X A;  4EEK A;  4IC9 A;  2WHE A;  4OJP A;  2PMZ F;  1TE2 A;  4G3I A;  2JZB B;  4JUZ A;  2ZIX B;  2KIW A;  2BHN A;  2R18 A;  2HMX A;  9ICE A;  3NTU A;  3TAN A;  1VDV A;  2EDU A;  2ZXH A;  4UAR A;  3M1Y A;  4QWB A;  4B9N A;  3PW4 A;  3SEI A;  1COK A;  4F3O A;  4J9Q A;  2PXI A;  3GQC A;  4IQT A;  1SV4 A;  4DL6 A;  5AK6 A;  3PW0 A;  1HUZ A;  5KFC A;  4GC7 A;  3C5G A;  4KLD A;  2KJ5 A;  1F44 A;  3WK6 A;  1DRG A;  1C20 A;  1B0X A;  4GFJ A;  5EE9 A;  3MDA A;  1ZQJ A;  3M6Z A;  4O3M A;  1L5U A;  1ZQH A;  3QZ8 A;  3AMZ A;  4F4W A;  3RF9 A;  8ICT A;  1A6S A;  1ZQD A;  1DGJ A;  2KZM A;  2JXJ A;  4NY8 A;  2YQE A;  4U6P A;  2NYV A;  3KKA A;  1NK5 A;  4IQV A;  7ICN A;  1U48 A;  4J9P A;  2DF4 B;  5GTH U;  4ELT A;  4QZG A;  5J8Y A;  2WF6 A;  5L1I A;  5KG4 A;  2KZ3 A;  1RG6 A;  3SMV A;  2LYA A;  3QU7 A;  3HT3 A;  1RM6 C;  2RHF A;  1U9L A;  9ICL A;  3C29 A;  3OGU A;  3LDA A;  2A1J A;  2IOF K;  2YTU A;  1L3T A;  1FFU A;  3TAQ A;  3KTQ A;  3GIL A;  2W8L A;  2VJ4 A;  5JRT A;  4UAW A;  1KBU A;  2KSO A;  3Q8K A;  4YQW A;  3PMN A;  2KD1 A;  2MUT A;  2CXY A;  4BDP A;  4P2H A;  3FYH A;  8ICR A;  1TK8 A;  2WF9 A;  1YZ7 A;  3QUQ A;  1HUO A;  2OM6 A;  3MFH A;  1UT5 A;  2BR0 A;  5KFO A;  3IG5 A;  1X9W A;  9ICW A;  7ICF A;  2F76 X;  4DO9 A;  3L5K A;  5DB6 A;  3IHQ B;  4YR0 A;  1ZQG A;  3T5L A;  4DOA A;  8ICC A;  3RR8 A;  3O0F A;  3UMC A;  1RQL A;  2RDI A;  5J2D A;  4DOC A;  4DL7 A;  3DEE A;  1T3Q A;  4M9G A;  1WWV A;  1SZP A;  2AHO B;  1L7N A;  3PO4 A;  5J0U A;  5AKK A;  3Q8Q B;  1A0P A;  3DDH A;  4Y2R A;  1PUZ A;  2MRL A;  2WB1 F;  4ED2 A;  4C4R A;  1Y88 A;  5AI6 A;  2Y9T A;  5KAI U;  1S0N A;  1SIJ A;  2MA1 A;  2JHD A;  1Z00 B;  2YY6 A;  1KQQ A;  5DQH A;  1BVS A;  1N5W A;  2V4Q A;  1X42 A;  1ZQS A;  2O6K A;  4EZ6 A;  3RB3 A;  3WU2 U;  2HBM A;  5KNI A;  3OSP A;  3RBD A;  4I2I A;  9ICV A;  9ICU A;  9ICQ A;  1B22 A;  1ZQU A;  1ZQX A;  3I1Y A;  2XY7 A;  4CF3 A;  4I2E A;  4UAZ A;  1BNO A;  9ICA A;  1TAM A;  5JUM A;  2WAQ F;  1U49 A;  4RU9 A;  4O0I A;  4DWI A;  5BOM A;  4M6W B;  4O3P A;  4P0P A;  4AYB F;  4Q8E A;  1S0V A;  1QQ7 A;  2OHF A;  2OH2 A;  2BQR A;  3M6K A;  3M7D A;  4M9J A;  2RLT A;  5KFA A;  2KVS A;  4MF8 A;  3A0H U;  1S97 A;  2HOF A;  3TAR A;  3EUB 2;  2KN7 A;  4ED6 A;  2E3T A;  3ISC A;  2FPL A;  2NO5 A;  3OSN A;  4MEX A;  2KTQ A;  2WB1 C;  4GLX A;  1SZH A;  1BPD A;  3U26 A;  4XQ8 A;  2OXO A;  4MEY A;  2K89 A;  3TFR A;  4EEN A;  1QSL A;  8ICA A;  2H3Z A;  4P4P A;  1RYR A;  2E8P A;  2A19 A;  2ZTC A;  4Z6E A;  4Y2T A;  4UW9 A;  4U7C A;  8ICM A;  4GXK A;  5ALK A;  1NK0 A;  2H3Q A;  1NK8 A;  8ICQ A;  4YVZ A;  1SXD A;  3MGH A;  2E1F A;  1XSP A;  2NRW A;  2JH1 A;  3AN1 A;  5ALT A;  4F5O A;  3ZD9 A;  3KZI U;  3JPS A;  1ZQK A;  3EYZ A;  3PST A;  4QZE A;  2ZG6 A;  5KFD A;  4XA5 A;  1N48 A;  5III A;  1S8O A;  4DS5 A;  2HHT A;  5L1J A;  4UB8 U;  4O3S A;  1DOQ A;  1U47 A;  2DPI A;  2PFN A;  4RQ3 A;  2BQU A;  4RNM A;  1KRP A;  1Q8K A;  2W7P A;  3HW8 A;  1T8E A;  3G6V A;  1C7Y A;  3IV6 A;  2KZZ A;  3TAC B;  4R63 A;  2ZIW B;  2IA6 A;  4KLG A;  4ELV A;  1Z19 A;  4RQ4 A;  3K75 D;  4O5K A;  4TUP A;  4Z6F A;  1T94 A;  4Z6D A;  4P0Q A;  4BUG A;  7ICL A;  1ZQT A;  4JK1 A;  4NJ8 A;  5CB1 A;  2KIV A;  2JEJ A;  4KLS A;  3RR7 A;  2KMD A;  3C1Z A;  2G08 A;  2YML A;  2P66 A;  2ZUB A;  3N28 A;  3OJS A;  4MFF A;  2EAN A;  1CI4 A;  1SV0 A;  3OTQ A;  4IRK A;  2Q4T A;  2BQ3 A;  4CE6 A;  1L8O A;  5AKX A;  5AM0 A;  3IG8 A;  2VA2 A;  1ZOL A;  1QCK A;  2RQ5 A;  2ASD A;  3PW7 A;  3ZD8 A;  3G6X A;  5KFX A;  2IHN A;  1IXR A;  1Z3E B;  1KSP A;  4C80 A;  3JPQ A;  5FP0 A;  5DLF A;  4QZB A;  2ZIV B;  3ZDC A;  4PPX A;  2AXT U;  3Q8M A;  4NLN A;  4FZL A;  2A1J B;  5KFB A;  3SV4 A;  8ICG A;  1S0O A;  3EPG A;  3PSI A;  1NJW A;  2HHQ A;  2DUY A;  3BQ0 A;  1LV5 A;  4BWM A;  4P0P B;  4O9M A;  1N62 A;  4LJX A;  3WK8 A;  2W9M A;  5DG8 A;  4TQS A;  3RJJ A;  5KFY A;  4I29 A;  9ICB A;  1NK7 A;  2KFZ A;  3AQF A;  2F3N A;  4KX3 A;  1SKW A;  5ALZ A;  2AH5 A;  4F5N A;  1QH9 A;  1UA1 A;  2GH1 A;  2K4H A;  2ZUC A;  4DSJ A;  3MGI A;  2JZB A;  4E0D A;  5AI4 A;  1WCN A;  5EWE A;  9ICN A;  3RB4 A;  1XWL A;  3ISD A;  5HML A;  4PL2 A;  1ECW A;  4B9M A;  7ICJ A;  1M6Y A;  5KAF U;  1ZD5 A;  2W55 A;  4Y2J A;  5KFT A;  2HHW A;  4QNL A;  3AUO A;  3G6Y A;  2MUT B;  3RH6 A;  3WK9 A;  2VJ5 A;  1ZET A;  1JMS A;  4F71 A;  3ETR A;  1DXS A;  3NRZ A;  4KLQ A;  4C8K A;  4YG2 A;  2HBJ A;  1URJ A;  3GV8 B;  4AP9 A;  1TKD A;  2ZJ5 A;  2ALZ A;  4RQ7 A;  3UMG A;  3JPO A;  1WWU A;  2R8K A;  5KG7 A;  5CA7 A;  1SXE A;  1ZQ1 C;  5AI5 A;  4LZG A;  8ICO A;  3BS5 B;  4DQP A;  3PX4 A;  1SL1 A;  1GO3 F;  1DK3 A;  2XGP A;  4IL6 U;  3GV5 B;  1QLN A;  1L7O A;  4UAS A;  2FMP A;  3GIJ A;  4JB3 A;  5HR7 A;  3E58 A;  1AQ6 A;  2C2D A;  1ZQL A;  5J2H A;  9ICM A;  2C22 A;  5H2F U;  1NK6 A;  1ZQV A;  5DGA A;  1K1S A;  1ZQA A;  3KHH A;  2UVU A;  3SAG A;  3FAH A;  3UM9 A;  4JV0 A;  1QTM A;  4Q43 A;  2NV3 A;  2HOI A;  1ZQE A;  4B9T A;  2ZIX A;  3S6J A;  2WFA A;  5J0P A;  2GOL A;  3CRX A;  1ZRM A;  2KSO B;  3JPR A;  5J2F A;  1JXE A;  1RQN A;  4B9L A;  1NOM A;  2F8L A;  1RXW A;  1BPY A;  1CEZ A;  2EAP A;  3CNH A;  5DBC A;  5EE1 A;  2P6R A;  3ALR A;  4UQG A;  4I28 A;  3B0X A;  1ZD3 A;  3RBE A;  3H8M A;  4ECU A;  1UT8 A;  3FM9 A;  4ECV A;  3H40 A;  7ICE A;  1WG8 A;  3AU2 A;  5G5H A;  4MHV A;  5J29 A;  3THV A;  4Q8F A;  2DFL A;  3KHL A;  4O3O A;  5EWG A;  3RB0 A;  4WJ3 B;  2NRX A;  3F2D A;  2XY6 A;  3UQ2 A;  2KHV A;  1N56 A;  4J9M A;  2E5S A;  3PY8 A;  5J2C A;  1BPX A;  1X2I A;  1BNP A;  9ICI A;  3QYP A;  7ICO A;  8ICH A;  4DL3 A;  2LI6 A;  1UCV A;  3OJU A;  3H8W A;  4KLM A;  3JPP A;  2F2A B;  5AKL A;  3RJF A;  4KX5 A;  4F93 B;  4J9R A;  2UVV A;  5AM5 A;  3V7K A;  3RB6 A;  1T4G A;  4TUS A;  2XY5 A;  4I2C A;  4DLG A;  4C0Z A;  1QQ6 A;  1IIP A;  1Z1V A;  5AKI A; 
#chains in the Genus database with same CATH homology
 1S5L U;  3KZI U;  4UB6 U;  5E79 U;  3A0H U;  5H2F U;  2AXT U;  4IL6 U;  4UB8 U;  5KAI U;  2DUY A;  4PJ0 U;  5B66 U;  5GTH U;  5GTI U;  3WU2 U;  5KAF U;  3A0B U;  5TIS U;  5B5E U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...