4UB8U

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
total genus 31
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub8U01
4UB6U 5KAIU 4IL6U 1S5LU 4PJ0U 5GTHU 5B5EU 5TISU 5H2FU 4UB8U 3KZIU 5B66U 2AXTU 2DUYA 3WU2U 3A0BU 5KAFU 5E79U 5GTIU 3A0HU
chains in the Genus database with same CATH superfamily
1EXNA 1UT8A 3JPQA 1TK8A 4MFFA 3PV8A 8ICNA 1CRXA 4IQVA 2K4HA 1SXEA 4DL5A 4ECXA 3NASA 4US8A 1QLNA 4EZ6A 1SIJA 3OHAA 2XICA 2EH9A 2ZTEA 3O0FA 4WJ3B 1TAUA 2LM1A 4J9OA 2FLNA 4ACOA 5KNIA 3SYZA 3PX4A 2KKPA 2FMQA 5J0SA 3QE9Y 2AGPA 1NKBA 3MGVA 2W9CB 1PVPA 4DFDA 4M9GA 4RT3A 9ICBA 4I2DA 4FBTA 3RB6A 2GLEA 3PX6A 2FE9A 4OJPA 3QZ7A 1F44A 1L7NA 3RH6A 4ECUA 4X5VA 3EWAA 4FZLA 1N5WA 1TAMA 1X42A 3QUBA 3AL0B 2XY6A 3F5AA 4KLSA 2YX8A 1SV4A 2L5YA 2KSOB 5L9XA 3AQFA 1MSWD 2LYAA 2AQ4A 5CEHA 2OM6A 1SKWA 4UQGA 2AGQA 5ALXA 4RT2A 2V4RA 5IIJA 4PGXA 1RQNA 1MC8A 4ED2A 2W04A 9ICMA 2GO7A 2LM4A 3AU2A 4FBUA 4B9VA 4UW9A 1V38A 3VCBA 5DGAA 5BOMA 4BX9C 3VC8A 3AU6A 5DB7A 3C2LA 2N1RA 4EYHB 2BCRA 4UAWA 3IDWA 5AICA 5KT2A 4KITB 2DWQA 7ICRA 3V7KA 3AUOA 4Y2UA 5KFOA 2UVRA 4P0QB 1V9PA 2W8KA 3KBBA 3V6KA 1ZQAA 1J2NA 4J9MA 2JEJA 4M9JA 2DKXA 4ECSA 7ICQA 2HHXA 3E2EA 1CEZA 3TFRA 3RJJA 3IG5A 5DBBA 4IRKA 3TANA 5IIIA 5AIAA 3RR8A 5KFCA 2C2EA 2QKQA 5KFHA 3C29A 3SV3A 2QLTA 5KFZA 8ICQA 1UHUA 2PFNA 3ZI4A 2KMDA 3LVVA 2D3DA 2AXTU 3IM1A 3ICXA 8ICAA 5ALFA 2HBKA 2M9NA 2W03A 3KOOA 2KJ5A 1CI4A 4YR2A 1NK8A 3PZPA 2F1IA 1N2XA 3OSPA 3F2DA 1ZJMA 7ICFA 1N5XA 4C8LA 4DF8A 4YMOA 2PFOA 4O3SA 2H3IA 4NWIA 2KIWA 3SAHA 3Q8SB 5EE9A 4RQ7A 7ICNA 2ZIVB 4YD1A 5KG4A 1QSYA 2W8LA 9ICWA 1XS9D 2VKQA 1NK4A 1JX4A 4BWJA 4B9MA 1XSNA 2MRLA 2ZIWA 5KFSA 5J0RA 3RJFA 7ICOA 2NRXA 4RNNA 2QB1A 5J0QA 4EBEA 4BXOA 5JUMA 3SZ2A 2XY7A 1KRPA 1F5SA 3WU2U 3LK9A 3HRDD 1UT5A 3WKCA 8ICHA 1UQVA 1HIWA 4PHEA 4Q45A 1ZQVA 2KN7A 1PK1A 4C4RA 4DSEA 4PGYA 2I5HA 3QU5A 2JR5A 2E8MA 4UB8U 3EPGA 3PMNA 4EX7A 4XRHA 4JV2A 2KHQA 1L3SA 4YMNA 2Y0SC 2KKVA 3S6JA 4Z6EA 5KG7A 3DDHA 3UMBA 3WK6A 4P4MA 4B9LA 9ICEA 9ICHA 4KN4A 2ZIXA 1AQ6A 3KFUF 2ISPA 4YMMA 4EENA 1X66A 3PW0A 3V7JA 1ZD4A 4RUAA 3KHGA 2EQYA 5AKYA 5F9NA 4AP9A 1YT3A 2W54A 4DSIA 1T94A 2NO5A 3T5HA 2UVVA 9ICGA 5GTIU 4JUZA 5J8YA 4ED6A 8ICTA 4JV0A 4QZEA 2JGAA 2QB0B 2P6RA 4DS4A 2VJ4A 4QZ8A 1Q8KA 2PMZC 1TE2A 4ECZA 5AKEA 5AK3A 1HUZA 2K60A 3H0MB 3HJEA 3M8SA 1B22A 4JB3A 3UM9A 2G06A 1WG8A 4QZDA 3QUCA 2LBOA 1TK0A 1ZQFA 3RR7A 3UMCA 4MEXA 4TUPA 4U6PA 5KFTA 4F4YA 3EYZA 2W9BB 3H8JA 2R8GA 2KK0A 2W3RA 4RUCA 4F5NA 1A6SA 2GOLA 2MSNA 1DK2A 4QZCA 2ZUCA 2Q4TA 5J2IA 4KX5A 1O08A 1Z00A 3ORYA 2JEIA 1DRGA 4I27A 2F44A 5EE1A 5KAFU 1J2MA 3UQ0A 2JEGA 4FFDA 1COOA 4Y2JA 4F91B 3OPXA 1JRPA 4M9HA 1Q3VA 1TKDA 2FDRA 2LI6A 3GIIA 5DGBA 1ZQDA 4O3PA 3NVYA 1D9DA 2KJ9A 4BJQA 3M8RA 4UATA 1IM4A 8ICXA 1ZQEA 3TARA 2KHVA 1VDVA 4RQMA 4DCCA 2RLTA 8ICUA 5KG3A 4YVZA 1O03A 2Q0ZX 2NRZA 4I2JA 2IOHA 4QWEA 5ALZA 8ICWA 3HILA 2P66A 4I2IA 3MC1A 9ICAA 8ICOA 2LYBA 1TFRA 3Q8MA 4EBCA 4KX3A 3ZDAA 9ICFA 3BS7A 2W7PA 2LMRA 4OO1J 4UAVA 4JWNA 4QWBA 3G6XA 4F4ZA 4ED7A 1QQ6A 2KNJA 3N97B 4KLEA 3BQ2A 7ICLA 1XSPA 4M6WA 3AM9A 4B9SA 2B21A 1L3TA 3D2QA 3KHLA 2J6UA 1BPEA 4I2AA 1XC9A 2YMLA 3I1YA 4IL6U 4QW8A 1ZQTA 5KFYA 2FI1A 4PZNA 4YG2A 3M9MB 5ALMA 3M9OB 3SV4A 1Z4OA 1JROA 4RNOA 4M47A 2ZUBA 3PO5A 1F0MA 3ETRA 1X9SA 3QYPA 2BCQA 7ICSA 3MDCA 1KFDA 3EPIA 4RQNA 2IOFA 4KLUA 8ICEA 8ICGA 1ZQUA 1H38A 5KG0A 5KFRA 3PY8A 3PVXA 3UXPA 9ICVA 4BUGA 2XCPA 2DL0A 1XU4A 4IRCA 5J0PA 4YR0A 5G5HA 8ICVA 1T8EA 5ALTA 1RXWA 1OXJA 1UPHA 4F93B 1X9WA 1WWUA 1ZXIA 5KTQA 1TAQA 3H8MA 5KFNA 5J0WA 4K4IA 2PI4A 4NJ8A 5AK4A 5EE3A 1Q46A 4I2EA 5HHHA 2ODGA 1K1QA 3M1YA 5DKWA 1V97A 4M0AA 2RRDA 2HOFA 3BQ7A 1U9LA 1BNOA 1B4FA 5HHIA 2PMZF 1D8YA 1X2IA 3ZDEA 4AYBC 2E1EA 4XA5A 2KVSA 4C4SA 4QJFB 4RPXA 4RQ0A 2C2RA 3MR2A 4GLXA 4FO6A 4NLNA 4QWAA 2HBJA 2D8CA 2KP7A 1C20A 2EAOA 2BKEA 3H4BA 3A0HU 1BPXA 5L1MA 7ICUA 2ZJ5A 1TVAA 2DFLA 3N4MB 3K75D 1L3VA 4DSKA 4GXJA 1BVSA 4ED1A 1S0OA 2WAQC 2IBKA 2G07A 4Y2RA 3JPOA 1LB2B 1MN8A 5FP0A 5DQGA 3JPTA 4M04A 2R8IA 8ICIA 5ALDA 3IV6A 2G5IB 4ZH4A 4BXOB 1FIQA 4CGZA 5DDYA 1PK1B 5AM0A 3RAXA 5DB8A 4NLBA 5KFWA 1ZJNA 4B9NA 1SV0C 2FPMA 4OCZA 1UA0A 5J2HA 5CB1A 1CUKA 3QXGA 3KZXA 4P4PA 1NK6A 2ZG6A 5L1LA 1XO0A 3ZDDA 2E5SA 1N63A 5J2JA 1L7PA 2BZFA 1UCVA 1Z3EB 1FFVA 3IP4B 4KLFA 2ZIXB 1ECWA 2ES6A 1ZQKA 4FS1A 4J9NA 2Y9TA 2DKZA 2DQNB 5DG7A 3F2CA 3T5KA 1B43A 4OJOA 5EWGA 8ICRA 4Y2TA 3ISBA 3IHQB 2W11A 2E8NA 2H3VA 2WB1C 4EEYA 4YQWA 3HX0A 3ISDA 3FAHA 2G5HB 3JPRA 3LWLA 1VLBA 5ALYA 1ZQPA 1MA7A 1A0PA 1ZQRA 4IQTA 2O6KA 3BQTA 1ZD2P 1C7YA 3GV7B 1Z1VA 1TV9A 3LVWA 2MUTA 1AROP 4CF4A 2FJ6A 5KFVA 2KE7A 2GWSA 4GC6A 2E8PA 4CRXA 3AN1A 2F77X 2BQRA 4JV1A 2H3ZA 1VJ5A 1Z00B 2I1QA 4RZRA 1MQ2A 3QU7A 1KQQA 4MFAA 2BR0A 4KLHA 3UXOA 3C1YA 4DOBA 2NRVA 2CXYA 4KLJA 2JV3A 3LDAA 2HBMA 3D2SA 5J0UA 3CRXA 1XO1A 2JMGA 5HMMA 5BOLA 4ED8A 4UARA 1S76D 5J2FA 1IV8A 2E3TA 2J6SA 3AQEA 4DSFA 4C8MA 1B0XA 4GXIA 1ZD5A 2KTQA 5AK5A 3RFAA 1NZPA 2AH5A 1QCKA 3KKAC 3TI0A 5B5EU 2ASDA 3UQ2A 1P7DA 5KL8B 2XGPA 4DF4A 4UBCA 2BPGA 4TQSA 1ZOLA 3LWMA 4M2YA 3WK4A 4QZ9A 5ALVA 5KFXA 4NL9A 9ICCA 3GDXA 1RG6A 2DBYA 3MBYA 1SL2A 2F2AB 1BPZA 3WKDA 2VA2A 8ICBA 3RB4A 3TKAA 3CP8A 2KIVA 3PNCA 4M6WB 3K1ZA 5DG8A 4EZ9A 2K8CB 3ETLA 2HCFA 4C8NA 2DGZA 3GFKB 3KHRA 5ALEA 4B9UA 2YMPA 4ICAA 4ZOHC 3BS5A 4P0PA 1U49A 1SWWA 3JPPA 5ALSA 3ZDBA 3C5FA 4NLKA 5AM3A 4UAYA 5J0YA 1LKYA 4DLGA 2W3SA 4Z6FA 2RDJA 4IR9A 3Q8QB 3T79A 2BCSA 4BGDA 1Y88A 2F1JA 4EBDA 2DF4B 5KFDA 1QSSA 4UAZA 3E0FA 4I28A 3Q8RB 1K5OA 3QNMA 5JRTA 2XGQA 1HJPA 2WF6A 2AGOA 4FE3A 1BPYA 1KL9A 5DLGA 2G08A 2AHOB 4IQUA 1WCLA 4C0ZA 4ELVA 4UB6U 3BDPA 3WK7A 1N48A 5KFUA 1RYRA 1NOMA 2ZTDA 2PI5A 3BJYA 5KG1A 3TACB 4I2CA 2YB4A 4PHPA 1NK9A 2YB1A 1N62A 2WB1F 1U4BA 4TUSA 4F71A 3MR6A 1ZQOA 3TQ1A 3SR6A 5E79U 7ICVA 4J9RA 3EW9A 1T4GA 3MGHA 5ALGA 3H40A 4QZBA 3OTQA 1JALA 3GZFA 4QWDA 4MF8A 2V9WA 1U45A 4C8KA 5CR0A 4DQQA 5DB6A 2AU0A 4RQ5A 3HW8A 2EZXA 5KFGA 3TADC 3TAPA 2EDUA 4J03A 4PHDA 3GU3A 5KAIU 4UB3A 1L3UA 5A0LA 2ZUDA 2QARA 5AK6A 5AKHA 4EYIB 1RM6C 3RJKA 5AKLA 3ZD8A 3RRHA 2ASJA 2YQEA 3K4GA 4C7ZA 4UBBA 3D6JA 3ED5A 5AKKA 1M6YA 4I2FA 2KV2A 1MQ3A 1DOQA 4KMOB 2XY5A 2DUYA 2XC9A 3QZ8A 5KFIA 3NVZA 3ISCA 9ICIA 2K4IA 1JUDA 4QIWC 2I9GA 1IIPA 1XNSA 4NM2A 2JZBA 3QU4A 3TFSA 2FLLA 1IXRA 4O3QA 3OJSA 4ELTA 5IINA 2WTFA 4TQRA 4O5CA 5L1JA 2BHNA 1SZPA 3SQIA 5KL1B 4NXZA 2NV3A 3L4PA 4YCXA 4Y2SA 1KSPA 1OUQA 2C28A 1KKXA 4GC7A 5J2GA 2P35A 4UB5A 4ED3A 2NRWA 3HKZC 2PKEA 2UVWA 4DSJA 1D9FA 4Y2YA 7ICKA 5KT3A 1NZBA 1HEKA 2A1AA 4P4OA 4DQRA 1UA1A 4USAA 4C8OA 3GILA 2ZJ8A 2G0AA 2KZZA 5AKXA 2AJQA 2KVCA 2W9AA 4EELA 1U48A 1S9FA 1ZQBA 5IIOA 1JN3A 4O3RA 1S10A 4R65A 2CPRA 3NTUA 5C5JA 1L6NA 1N61A 4MHVA 4J9QA 4F5OA 3N7PD 2KICA 8ICLA 3MFIA 3H4DA 2BDUA 4BDPA 4J9KA 3H7IA 3M6ZA 2MUTB 3H8WA 5JU5A 2LYHA 7ICMA 4O5EA 9ICNA 3HP6A 2KEYA 1RYSA 1ZQQA 4DFMA 4R63A 5ALJA 1YZ6A 2UVUA 4PL1A 5KT4A 5AKJA 3I76A 3FC4A 1FFUA 5AI6A 2H5XA 2XCAA 4Q8FA 1TK5A 4JK1A 1NKEA 2R8KA 2B0CA 2Y0SF 2KD1A 4R66A 5DBCA 8ICYA 1SXDA 1RXVA 1PUZA 3GV8B 4KLLA 4RQ1A 4NV0A 2OHFA 2EAMA 5HNKA 5ALPA 4Y2QA 1SL0A 5AM5A 2H3QA 3MGIA 4O3OA 3B0YA 2JEFA 5T14A 1LVHA 5GTHU 3C2MA 3ONNA 1PZNA 1SGGA 4RQ6A 3M7DA 1RYUA 2LPEA 3BQ0A 2XIDA 2HBLA 1QTMA 3IG8A 5DBAA 2WHEA 4ECWA 5DQIA 3RJGA 4UB2A 2BCVA 3NUQA 2F3NA 3PW7A 4P2HA 1BPDA 4I2GA 3KHHA 3Q8PB 1JMSA 1NK7A 1N60A 2XO7A 1BNPA 4PH5A 3PR4A 2OYYA 3EUB2 4F5QA 3PSIA 2JRZA 9ICPA 4KN7A 1ZD3A 2OCEA 5ALRA 7ICHA 9ICRA 2JHDA 1ZQYA 5L1KA 3PW2A 2F8KA 3BS5B 4RPZA 3MR5A 3N28A 3C21A 2BQ3A 4P0PB 5TISU 2D6FC 3WK9A 4ELUA 2OXOA 7ICPA 1RPLA 4KLGA 4DQPA 3RF9A 2HOIA 1SV0A 2ZIWB 1WWVA 4QIWF 2BGWA 9ICUA 5J29A 5AI5A 3JPNA 1T3QA 1X9XA 4IQWA 1LKYB 1NKCA 2VANA 4IR1A 2K89A 3BQ1A 2I6XA 2ZIUA 4UB4A 1JIHA 1WYGA 2F1HA 3NGDA 2ESEA 4PZOA 4DQIA 4DEZA 2J6TA 4DSLA 1V85A 4QZFA 4KLDA 4NLZA 8ICFA 2IHNA 4CF5A 2C2DA 4FS2A 1RDFA 1ZQGA 3UXNA 9ICJA 8ICSA 2W7OA 1N56A 5ALQA 4KLOA 9ICKA 3HT3A 1RZTA 2EZYA 3Q8LA 4MFCA 1KDHA 2W55A 1U47A 3HKZF 4R8UA 4E0DA 1KEJA 2Y9UA 2HHQA 5F3XB 4NY8A 4DQSA 4KLTA 4MEYA 1D8LA 2WFAA 5ALKA 4DL3A 5AI4A 3M9NB 3RJHA 3N7RC 5AM4A 2PFPA 4BWMA 3CNHA 5J2CA 3T3FA 5AI9A 2HMXA 4YXMA 1L7OA 3FM9A 1NNLA 1ZRNA 4DL7A 5ALLA 3V6JA 5AM1A 5ALUA 4B9TA 1S97A 5KFAA 5J0OA 1NK0A 3NVWA 4KLIA 4DWIA 3PSPA 4DOCA 5KFLA 1RQLA 4CE6A 3GV5B 2WF8A 3PR5B 1BGXT 1FO4A 5J0TA 4RU9A 9ICSA 2ZXHA 4F2SA 1DXSA 2A1JA 4NM1A 4K4GA 2E1FA 5JTIA 4DO9A 4K4HA 4QZIA 9ICQA 4LZDA 2QARB 5EWEA 1ZQWA 4I29A 3EZ5A 3IRUA 5KFFA 3SAGA 2G09A 5AKIA 3RJEA 2ZXIA 2JH7A 3FDSA 5AKZA 1Z1BA 1T7PA 4RPYA 2P6UA 1K1SA 2NRTA 1ZQNA 1KTQA 3OJUA 4Q43A 4RNMA 2JZBB 3WKBA 2GH1A 4B6JA 1ZQMA 3SAFA 2V4QA 3KKAA 3B9JA 5KG2A 3SENA 4DFJA 3PSTA 2K8AA 4FZNA 4QWCA 2IOFK 2R8HA 4O3NA 2BPFA 4G9BA 2DPIA 3SEIA 2Y1IA 3C5GA 2FPLA 4CF3A 1COKA 1FEZA 1ZQJA 4JMUA 4RQ3A 4J9PA 4YR3A 2VA8A 5BPCA 1ZQXA 2OH2A 5EOZA 4YN4A 4OJ5A 4XQ8A 3GQCA 5IIMA 2HI0A 2ZTCA 8ICJA 2VJ5A 3OGUA 4AYBF 2EZZA 4Z6CA 4NLCA 4IS7A 4KMUA 5DG9A 1SZHA 1Z19A 3F5EA 1L7MA 3T5JA 3H0RB 3ALRA 5HMLA 1KN5A 1ZQSA 4OJ6A 5ALWA 4DLEA 1PK3A 1S5LU 2XI9A 3H0LB 5J2KA 5AHXA 8ICZA 4QZGA 3V7LA 1ZQCA 2YMMA 4Y2XA 5D49A 2WAQF 3F53A 2NO4A 3BZKA 5KG6A 1X6JA 4YFKA 2KJ8A 3QU9A 4YP3A 3WKEA 3PO4A 3PMLA 2XVTA 7ICGA 3H8SA 5L1IA 2W9MA 1S0NA 3L3FX 5KFKA 1SWVA 4KLQA 5TZVA 3WK5A 3L5KA 7ICEA 1KFSA 2KZ3A 4DL4A 3TAQA 3WK8A 1KBUA 3ZD9A 2IHMA 3B0XA 2R18A 4M9NA 4NL9C 2Z7JA 4Y2VA 4ECRA 2BCUA 9ICLA 2K4EA 1NJYA 5EE0A 1ZRMA 2YN4A 1LV5A 2MA1A 4RQ8A 3CYMA 1NJWA 4U7CA 3MFHA 1HUOA 3HPOA 2ALZA 3RBEA 3DEEA 2K8BB 2YTUA 4CNQA 5CHGA 5KFBA 3MDAA 4PL2A 4F5PA 5EWFA 2F76X 4EEKA 4F72A 5HR6A 2YMQA 4ED0A 2A19A 5IILA 2CN1A 5H2FU 1QQ5A 1IG6A 1JXEA 4UASA 3QUQA 3THVA 3RH5A 3TADA 4NLGA 2KG5A 1ZETA 4YD2A 5J2BA 8ICKA 4M9LA 3NVVA 2KOBA 3CW2C 4CDGA 1ZQLA 2FLPA 2ATLA 2BQUA 3KZIU 3R9KA 1J97A 7ICIA 2FPKA 5J2AA 4C7YA 1SL1A 1S77D 3QX7A 4DFKA 3PSFA 3DV9A 2R8JA 4J9SA 4Y2PA 3RJIA 1WUDA 2W9CA 1KLNA 4TUQA 5DQHA 5G5GA 1X40A 5KT7A 4C80A 2MU2A 1L8LA 4Z6DA 3RB0A 1KFTA 2LHTA 5KFMA 3M6KA 4LVSA 4Q44A 4KTQA 3N7SC 4F4KA 2ISOA 1SKRA 2ZJAA 4ECTA 1WCNA 3UMGA 1SKSA 3U26A 2RP5A 1T3NA 2HVIA 5F9LA 4ECVA 2KSOA 4PGQA 2ZIUB 4F4WA 4EX6A 3V6HA 4PJ0U 4F2RA 2FMSA 5J8YC 2H3FA 1NJXA 4O5KA 4OD0A 2Y1JA 3RRGA 4GFJA 3QU2A 5ALIA 3UPQA 4ECQA 1ZQ1C 1A77A 4QNLA 3QEBZ 4UAUA 7ICJA 4DL6A 4HYKA 3F2BA 1DGJA 3OHBA 1QSLA 3FYHA 2F8LA 1ZYQA 4O0IA 4ECYA 2VA3A 4R8UB 5KT5A 4DL2A 4O9MA 3C2KA 5ALOA 3QUTA 9ICOA 1S0VA 1NJZA 4F92B 4RQ4A 5KG5A 3K1RB 5AI0A 4P0QA 4JWMA 1BPBA 4LZGA 3SD7A 2WF7A 4YXJA 8ICMA 5CJ7A 3GIKA 2HHVA 4F3OA 5AI8A 2JH1A 4QZHA 3JPSA 1JXLA 8ICPA 5KFEA 9ICXA 5DDMA 3Q8KA 2KFNA 1SB3C 1S0MA 5AKGA 5D4BA 2HW3A 4US9A 2A1JB 4CCHA 5J2EA 1XSLA 2BDPA 2EAPA 5CRXA 3PW5A 3NS1A 3I28A 5AM2A 2PFQA 4QW9A 3RTVA 2OWOA 3KD3A 3RAQA 4Q8EA 2KZMA 2HHUA 5HR7A 2YY6A 1DGSA 2HHWA 2HOQA 4R64A 1NK5A 2RDIA 2HVHA 4LJXA 3OSNA 2ZIVA 5KFJA 5D46A 3V72A 2CRXA 4PHAA 1ED1A 3NRZA 2WF5A 1L5UA 3A0BU 4DFPA 2BPCA 2HDOA 1ZQIA 5KFQA 3QEAZ 3LYSA 2VIXA 3D2NA 3SMVA 2HSZA 1PVRA 2IMWP 2A3VA 5KT6A 4J9LA 5CA7A 5CWRA 4UB1A 2AQ0A 4FZMA 2NYVA 3C1ZA 5ALNA 1QH9A 5J2DA 1DK3A 4F50A 4F5RA 3RH4A 2HHTA 4XUSA 3NRWA 4RQ2A 2HHSA 1QQ7A 4DS5A 1ZQZA 5HP4A 1Q3UA 3AMZA 1JI7A 3HWTA 3GIJA 3T5LA 3RBDA 3C23A 1X9MA 5CP2A 5B66U 3GIMA 2WF9A 2EANA 2RHFA 2JXJA 1ZQHA 3IN5A 3E58A 3PX0A 1URJA 1PVQA 3C28A 4HAIA 3AEVA 3G6YA 1X6IA 3MR3A 4DOAA 2QB0A 5AIBA 1YZ7A 2RQ5A 4G3IA 1GO3F 2M0NA 4QZAA 5KFPA 1D8BA 2LKYA 4IC9A 4I2HA 1S8OA 3WKAA 2E8OA 4GIBA 2DPJA 5DLFA 4I2BA 2MAXA 4KLMA 2K4PA 4GXKA 1OW5A 5ALHA 9ICTA 4A8EA 4OJLA 2W9BA 1L8OA 1Z4NA 2OEHA 2C22A 4F8RA 2ASLA 4IRDA 1KW4A 5IIKA 4F4XA 1XWLA 2PXIA 7ICTA 1A76A 2KFZA 5J0XA 3J81j 4PPXA 3RB3A 4C4TA 4MF2A 5K4LA 4TURA 3SI8A 2W43A 2B6GA 3BZCA 3ZDCA 3KTQA 5DB9A 5C0YA 3MABA 3PW4A 8ICCA 1NI3A 3G6VA 2IA6A 2FMPA 4O3MA
chains in the Genus database with same CATH topology
4UB6U 5KAIU 4IL6U 1S5LU 4PJ0U 5GTHU 5B5EU 5TISU 5H2FU 4UB8U 3KZIU 5B66U 2AXTU 2DUYA 3WU2U 3A0BU 5KAFU 5E79U 5GTIU 3A0HU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 U;  5KAI U;  4IL6 U;  1S5L U;  4PJ0 U;  5GTH U;  5B5E U;  5TIS U;  5H2F U;  4UB8 U;  3KZI U;  5B66 U;  2AXT U;  2DUY A;  3WU2 U;  3A0B U;  5KAF U;  5E79 U;  5GTI U;  3A0H U; 
#chains in the Genus database with same CATH topology
 1EXN A;  1UT8 A;  3JPQ A;  1TK8 A;  4MFF A;  3PV8 A;  8ICN A;  1CRX A;  4IQV A;  2K4H A;  1SXE A;  4DL5 A;  4ECX A;  3NAS A;  4US8 A;  1QLN A;  4EZ6 A;  1SIJ A;  3OHA A;  2XIC A;  2EH9 A;  2ZTE A;  3O0F A;  4WJ3 B;  1TAU A;  2LM1 A;  4J9O A;  2FLN A;  4ACO A;  5KNI A;  3SYZ A;  3PX4 A;  2KKP A;  2FMQ A;  5J0S A;  3QE9 Y;  2AGP A;  1NKB A;  3MGV A;  2W9C B;  1PVP A;  4DFD A;  4M9G A;  4RT3 A;  9ICB A;  4I2D A;  4FBT A;  3RB6 A;  2GLE A;  3PX6 A;  2FE9 A;  4OJP A;  3QZ7 A;  1F44 A;  1L7N A;  3RH6 A;  4ECU A;  4X5V A;  3EWA A;  4FZL A;  1N5W A;  1TAM A;  1X42 A;  3QUB A;  3AL0 B;  2XY6 A;  3F5A A;  4KLS A;  2YX8 A;  1SV4 A;  2L5Y A;  2KSO B;  5L9X A;  3AQF A;  1MSW D;  2LYA A;  2AQ4 A;  5CEH A;  2OM6 A;  1SKW A;  4UQG A;  2AGQ A;  5ALX A;  4RT2 A;  2V4R A;  5IIJ A;  4PGX A;  1RQN A;  1MC8 A;  4ED2 A;  2W04 A;  9ICM A;  2GO7 A;  2LM4 A;  3AU2 A;  4FBU A;  4B9V A;  4UW9 A;  1V38 A;  3VCB A;  5DGA A;  5BOM A;  4BX9 C;  3VC8 A;  3AU6 A;  5DB7 A;  3C2L A;  2N1R A;  4EYH B;  2BCR A;  4UAW A;  3IDW A;  5AIC A;  5KT2 A;  4KIT B;  2DWQ A;  7ICR A;  3V7K A;  3AUO A;  4Y2U A;  5KFO A;  2UVR A;  4P0Q B;  1V9P A;  2W8K A;  3KBB A;  3V6K A;  1ZQA A;  1J2N A;  4J9M A;  2JEJ A;  4M9J A;  2DKX A;  4ECS A;  7ICQ A;  2HHX A;  3E2E A;  1CEZ A;  3TFR A;  3RJJ A;  3IG5 A;  5DBB A;  4IRK A;  3TAN A;  5III A;  5AIA A;  3RR8 A;  5KFC A;  2C2E A;  2QKQ A;  5KFH A;  3C29 A;  3SV3 A;  2QLT A;  5KFZ A;  8ICQ A;  1UHU A;  2PFN A;  3ZI4 A;  2KMD A;  3LVV A;  2D3D A;  2AXT U;  3IM1 A;  3ICX A;  8ICA A;  5ALF A;  2HBK A;  2M9N A;  2W03 A;  3KOO A;  2KJ5 A;  1CI4 A;  4YR2 A;  1NK8 A;  3PZP A;  2F1I A;  1N2X A;  3OSP A;  3F2D A;  1ZJM A;  7ICF A;  1N5X A;  4C8L A;  4DF8 A;  4YMO A;  2PFO A;  4O3S A;  2H3I A;  4NWI A;  2KIW A;  3SAH A;  3Q8S B;  5EE9 A;  4RQ7 A;  7ICN A;  2ZIV B;  4YD1 A;  5KG4 A;  1QSY A;  2W8L A;  9ICW A;  1XS9 D;  2VKQ A;  1NK4 A;  1JX4 A;  4BWJ A;  4B9M A;  1XSN A;  2MRL A;  2ZIW A;  5KFS A;  5J0R A;  3RJF A;  7ICO A;  2NRX A;  4RNN A;  2QB1 A;  5J0Q A;  4EBE A;  4BXO A;  5JUM A;  3SZ2 A;  2XY7 A;  1KRP A;  1F5S A;  3WU2 U;  3LK9 A;  3HRD D;  1UT5 A;  3WKC A;  8ICH A;  1UQV A;  1HIW A;  4PHE A;  4Q45 A;  1ZQV A;  2KN7 A;  1PK1 A;  4C4R A;  4DSE A;  4PGY A;  2I5H A;  3QU5 A;  2JR5 A;  2E8M A;  4UB8 U;  3EPG A;  3PMN A;  4EX7 A;  4XRH A;  4JV2 A;  2KHQ A;  1L3S A;  4YMN A;  2Y0S C;  2KKV A;  3S6J A;  4Z6E A;  5KG7 A;  3DDH A;  3UMB A;  3WK6 A;  4P4M A;  4B9L A;  9ICE A;  9ICH A;  4KN4 A;  2ZIX A;  1AQ6 A;  3KFU F;  2ISP A;  4YMM A;  4EEN A;  1X66 A;  3PW0 A;  3V7J A;  1ZD4 A;  4RUA A;  3KHG A;  2EQY A;  5AKY A;  5F9N A;  4AP9 A;  1YT3 A;  2W54 A;  4DSI A;  1T94 A;  2NO5 A;  3T5H A;  2UVV A;  9ICG A;  5GTI U;  4JUZ A;  5J8Y A;  4ED6 A;  8ICT A;  4JV0 A;  4QZE A;  2JGA A;  2QB0 B;  2P6R A;  4DS4 A;  2VJ4 A;  4QZ8 A;  1Q8K A;  2PMZ C;  1TE2 A;  4ECZ A;  5AKE A;  5AK3 A;  1HUZ A;  2K60 A;  3H0M B;  3HJE A;  3M8S A;  1B22 A;  4JB3 A;  3UM9 A;  2G06 A;  1WG8 A;  4QZD A;  3QUC A;  2LBO A;  1TK0 A;  1ZQF A;  3RR7 A;  3UMC A;  4MEX A;  4TUP A;  4U6P A;  5KFT A;  4F4Y A;  3EYZ A;  2W9B B;  3H8J A;  2R8G A;  2KK0 A;  2W3R A;  4RUC A;  4F5N A;  1A6S A;  2GOL A;  2MSN A;  1DK2 A;  4QZC A;  2ZUC A;  2Q4T A;  5J2I A;  4KX5 A;  1O08 A;  1Z00 A;  3ORY A;  2JEI A;  1DRG A;  4I27 A;  2F44 A;  5EE1 A;  5KAF U;  1J2M A;  3UQ0 A;  2JEG A;  4FFD A;  1COO A;  4Y2J A;  4F91 B;  3OPX A;  1JRP A;  4M9H A;  1Q3V A;  1TKD A;  2FDR A;  2LI6 A;  3GII A;  5DGB A;  1ZQD A;  4O3P A;  3NVY A;  1D9D A;  2KJ9 A;  4BJQ A;  3M8R A;  4UAT A;  1IM4 A;  8ICX A;  1ZQE A;  3TAR A;  2KHV A;  1VDV A;  4RQM A;  4DCC A;  2RLT A;  8ICU A;  5KG3 A;  4YVZ A;  1O03 A;  2Q0Z X;  2NRZ A;  4I2J A;  2IOH A;  4QWE A;  5ALZ A;  8ICW A;  3HIL A;  2P66 A;  4I2I A;  3MC1 A;  9ICA A;  8ICO A;  2LYB A;  1TFR A;  3Q8M A;  4EBC A;  4KX3 A;  3ZDA A;  9ICF A;  3BS7 A;  2W7P A;  2LMR A;  4OO1 J;  4UAV A;  4JWN A;  4QWB A;  3G6X A;  4F4Z A;  4ED7 A;  1QQ6 A;  2KNJ A;  3N97 B;  4KLE A;  3BQ2 A;  7ICL A;  1XSP A;  4M6W A;  3AM9 A;  4B9S A;  2B21 A;  1L3T A;  3D2Q A;  3KHL A;  2J6U A;  1BPE A;  4I2A A;  1XC9 A;  2YML A;  3I1Y A;  4IL6 U;  4QW8 A;  1ZQT A;  5KFY A;  2FI1 A;  4PZN A;  4YG2 A;  3M9M B;  5ALM A;  3M9O B;  3SV4 A;  1Z4O A;  1JRO A;  4RNO A;  4M47 A;  2ZUB A;  3PO5 A;  1F0M A;  3ETR A;  1X9S A;  3QYP A;  2BCQ A;  7ICS A;  3MDC A;  1KFD A;  3EPI A;  4RQN A;  2IOF A;  4KLU A;  8ICE A;  8ICG A;  1ZQU A;  1H38 A;  5KG0 A;  5KFR A;  3PY8 A;  3PVX A;  3UXP A;  9ICV A;  4BUG A;  2XCP A;  2DL0 A;  1XU4 A;  4IRC A;  5J0P A;  4YR0 A;  5G5H A;  8ICV A;  1T8E A;  5ALT A;  1RXW A;  1OXJ A;  1UPH A;  4F93 B;  1X9W A;  1WWU A;  1ZXI A;  5KTQ A;  1TAQ A;  3H8M A;  5KFN A;  5J0W A;  4K4I A;  2PI4 A;  4NJ8 A;  5AK4 A;  5EE3 A;  1Q46 A;  4I2E A;  5HHH A;  2ODG A;  1K1Q A;  3M1Y A;  5DKW A;  1V97 A;  4M0A A;  2RRD A;  2HOF A;  3BQ7 A;  1U9L A;  1BNO A;  1B4F A;  5HHI A;  2PMZ F;  1D8Y A;  1X2I A;  3ZDE A;  4AYB C;  2E1E A;  4XA5 A;  2KVS A;  4C4S A;  4QJF B;  4RPX A;  4RQ0 A;  2C2R A;  3MR2 A;  4GLX A;  4FO6 A;  4NLN A;  4QWA A;  2HBJ A;  2D8C A;  2KP7 A;  1C20 A;  2EAO A;  2BKE A;  3H4B A;  3A0H U;  1BPX A;  5L1M A;  7ICU A;  2ZJ5 A;  1TVA A;  2DFL A;  3N4M B;  3K75 D;  1L3V A;  4DSK A;  4GXJ A;  1BVS A;  4ED1 A;  1S0O A;  2WAQ C;  2IBK A;  2G07 A;  4Y2R A;  3JPO A;  1LB2 B;  1MN8 A;  5FP0 A;  5DQG A;  3JPT A;  4M04 A;  2R8I A;  8ICI A;  5ALD A;  3IV6 A;  2G5I B;  4ZH4 A;  4BXO B;  1FIQ A;  4CGZ A;  5DDY A;  1PK1 B;  5AM0 A;  3RAX A;  5DB8 A;  4NLB A;  5KFW A;  1ZJN A;  4B9N A;  1SV0 C;  2FPM A;  4OCZ A;  1UA0 A;  5J2H A;  5CB1 A;  1CUK A;  3QXG A;  3KZX A;  4P4P A;  1NK6 A;  2ZG6 A;  5L1L A;  1XO0 A;  3ZDD A;  2E5S A;  1N63 A;  5J2J A;  1L7P A;  2BZF A;  1UCV A;  1Z3E B;  1FFV A;  3IP4 B;  4KLF A;  2ZIX B;  1ECW A;  2ES6 A;  1ZQK A;  4FS1 A;  4J9N A;  2Y9T A;  2DKZ A;  2DQN B;  5DG7 A;  3F2C A;  3T5K A;  1B43 A;  4OJO A;  5EWG A;  8ICR A;  4Y2T A;  3ISB A;  3IHQ B;  2W11 A;  2E8N A;  2H3V A;  2WB1 C;  4EEY A;  4YQW A;  3HX0 A;  3ISD A;  3FAH A;  2G5H B;  3JPR A;  3LWL A;  1VLB A;  5ALY A;  1ZQP A;  1MA7 A;  1A0P A;  1ZQR A;  4IQT A;  2O6K A;  3BQT A;  1ZD2 P;  1C7Y A;  3GV7 B;  1Z1V A;  1TV9 A;  3LVW A;  2MUT A;  1ARO P;  4CF4 A;  2FJ6 A;  5KFV A;  2KE7 A;  2GWS A;  4GC6 A;  2E8P A;  4CRX A;  3AN1 A;  2F77 X;  2BQR A;  4JV1 A;  2H3Z A;  1VJ5 A;  1Z00 B;  2I1Q A;  4RZR A;  1MQ2 A;  3QU7 A;  1KQQ A;  4MFA A;  2BR0 A;  4KLH A;  3UXO A;  3C1Y A;  4DOB A;  2NRV A;  2CXY A;  4KLJ A;  2JV3 A;  3LDA A;  2HBM A;  3D2S A;  5J0U A;  3CRX A;  1XO1 A;  2JMG A;  5HMM A;  5BOL A;  4ED8 A;  4UAR A;  1S76 D;  5J2F A;  1IV8 A;  2E3T A;  2J6S A;  3AQE A;  4DSF A;  4C8M A;  1B0X A;  4GXI A;  1ZD5 A;  2KTQ A;  5AK5 A;  3RFA A;  1NZP A;  2AH5 A;  1QCK A;  3KKA C;  3TI0 A;  5B5E U;  2ASD A;  3UQ2 A;  1P7D A;  5KL8 B;  2XGP A;  4DF4 A;  4UBC A;  2BPG A;  4TQS A;  1ZOL A;  3LWM A;  4M2Y A;  3WK4 A;  4QZ9 A;  5ALV A;  5KFX A;  4NL9 A;  9ICC A;  3GDX A;  1RG6 A;  2DBY A;  3MBY A;  1SL2 A;  2F2A B;  1BPZ A;  3WKD A;  2VA2 A;  8ICB A;  3RB4 A;  3TKA A;  3CP8 A;  2KIV A;  3PNC A;  4M6W B;  3K1Z A;  5DG8 A;  4EZ9 A;  2K8C B;  3ETL A;  2HCF A;  4C8N A;  2DGZ A;  3GFK B;  3KHR A;  5ALE A;  4B9U A;  2YMP A;  4ICA A;  4ZOH C;  3BS5 A;  4P0P A;  1U49 A;  1SWW A;  3JPP A;  5ALS A;  3ZDB A;  3C5F A;  4NLK A;  5AM3 A;  4UAY A;  5J0Y A;  1LKY A;  4DLG A;  2W3S A;  4Z6F A;  2RDJ A;  4IR9 A;  3Q8Q B;  3T79 A;  2BCS A;  4BGD A;  1Y88 A;  2F1J A;  4EBD A;  2DF4 B;  5KFD A;  1QSS A;  4UAZ A;  3E0F A;  4I28 A;  3Q8R B;  1K5O A;  3QNM A;  5JRT A;  2XGQ A;  1HJP A;  2WF6 A;  2AGO A;  4FE3 A;  1BPY A;  1KL9 A;  5DLG A;  2G08 A;  2AHO B;  4IQU A;  1WCL A;  4C0Z A;  4ELV A;  4UB6 U;  3BDP A;  3WK7 A;  1N48 A;  5KFU A;  1RYR A;  1NOM A;  2ZTD A;  2PI5 A;  3BJY A;  5KG1 A;  3TAC B;  4I2C A;  2YB4 A;  4PHP A;  1NK9 A;  2YB1 A;  1N62 A;  2WB1 F;  1U4B A;  4TUS A;  4F71 A;  3MR6 A;  1ZQO A;  3TQ1 A;  3SR6 A;  5E79 U;  7ICV A;  4J9R A;  3EW9 A;  1T4G A;  3MGH A;  5ALG A;  3H40 A;  4QZB A;  3OTQ A;  1JAL A;  3GZF A;  4QWD A;  4MF8 A;  2V9W A;  1U45 A;  4C8K A;  5CR0 A;  4DQQ A;  5DB6 A;  2AU0 A;  4RQ5 A;  3HW8 A;  2EZX A;  5KFG A;  3TAD C;  3TAP A;  2EDU A;  4J03 A;  4PHD A;  3GU3 A;  5KAI U;  4UB3 A;  1L3U A;  5A0L A;  2ZUD A;  2QAR A;  5AK6 A;  5AKH A;  4EYI B;  1RM6 C;  3RJK A;  5AKL A;  3ZD8 A;  3RRH A;  2ASJ A;  2YQE A;  3K4G A;  4C7Z A;  4UBB A;  3D6J A;  3ED5 A;  5AKK A;  1M6Y A;  4I2F A;  2KV2 A;  1MQ3 A;  1DOQ A;  4KMO B;  2XY5 A;  2DUY A;  2XC9 A;  3QZ8 A;  5KFI A;  3NVZ A;  3ISC A;  9ICI A;  2K4I A;  1JUD A;  4QIW C;  2I9G A;  1IIP A;  1XNS A;  4NM2 A;  2JZB A;  3QU4 A;  3TFS A;  2FLL A;  1IXR A;  4O3Q A;  3OJS A;  4ELT A;  5IIN A;  2WTF A;  4TQR A;  4O5C A;  5L1J A;  2BHN A;  1SZP A;  3SQI A;  5KL1 B;  4NXZ A;  2NV3 A;  3L4P A;  4YCX A;  4Y2S A;  1KSP A;  1OUQ A;  2C28 A;  1KKX A;  4GC7 A;  5J2G A;  2P35 A;  4UB5 A;  4ED3 A;  2NRW A;  3HKZ C;  2PKE A;  2UVW A;  4DSJ A;  1D9F A;  4Y2Y A;  7ICK A;  5KT3 A;  1NZB A;  1HEK A;  2A1A A;  4P4O A;  4DQR A;  1UA1 A;  4USA A;  4C8O A;  3GIL A;  2ZJ8 A;  2G0A A;  2KZZ A;  5AKX A;  2AJQ A;  2KVC A;  2W9A A;  4EEL A;  1U48 A;  1S9F A;  1ZQB A;  5IIO A;  1JN3 A;  4O3R A;  1S10 A;  4R65 A;  2CPR A;  3NTU A;  5C5J A;  1L6N A;  1N61 A;  4MHV A;  4J9Q A;  4F5O A;  3N7P D;  2KIC A;  8ICL A;  3MFI A;  3H4D A;  2BDU A;  4BDP A;  4J9K A;  3H7I A;  3M6Z A;  2MUT B;  3H8W A;  5JU5 A;  2LYH A;  7ICM A;  4O5E A;  9ICN A;  3HP6 A;  2KEY A;  1RYS A;  1ZQQ A;  4DFM A;  4R63 A;  5ALJ A;  1YZ6 A;  2UVU A;  4PL1 A;  5KT4 A;  5AKJ A;  3I76 A;  3FC4 A;  1FFU A;  5AI6 A;  2H5X A;  2XCA A;  4Q8F A;  1TK5 A;  4JK1 A;  1NKE A;  2R8K A;  2B0C A;  2Y0S F;  2KD1 A;  4R66 A;  5DBC A;  8ICY A;  1SXD A;  1RXV A;  1PUZ A;  3GV8 B;  4KLL A;  4RQ1 A;  4NV0 A;  2OHF A;  2EAM A;  5HNK A;  5ALP A;  4Y2Q A;  1SL0 A;  5AM5 A;  2H3Q A;  3MGI A;  4O3O A;  3B0Y A;  2JEF A;  5T14 A;  1LVH A;  5GTH U;  3C2M A;  3ONN A;  1PZN A;  1SGG A;  4RQ6 A;  3M7D A;  1RYU A;  2LPE A;  3BQ0 A;  2XID A;  2HBL A;  1QTM A;  3IG8 A;  5DBA A;  2WHE A;  4ECW A;  5DQI A;  3RJG A;  4UB2 A;  2BCV A;  3NUQ A;  2F3N A;  3PW7 A;  4P2H A;  1BPD A;  4I2G A;  3KHH A;  3Q8P B;  1JMS A;  1NK7 A;  1N60 A;  2XO7 A;  1BNP A;  4PH5 A;  3PR4 A;  2OYY A;  3EUB 2;  4F5Q A;  3PSI A;  2JRZ A;  9ICP A;  4KN7 A;  1ZD3 A;  2OCE A;  5ALR A;  7ICH A;  9ICR A;  2JHD A;  1ZQY A;  5L1K A;  3PW2 A;  2F8K A;  3BS5 B;  4RPZ A;  3MR5 A;  3N28 A;  3C21 A;  2BQ3 A;  4P0P B;  5TIS U;  2D6F C;  3WK9 A;  4ELU A;  2OXO A;  7ICP A;  1RPL A;  4KLG A;  4DQP A;  3RF9 A;  2HOI A;  1SV0 A;  2ZIW B;  1WWV A;  4QIW F;  2BGW A;  9ICU A;  5J29 A;  5AI5 A;  3JPN A;  1T3Q A;  1X9X A;  4IQW A;  1LKY B;  1NKC A;  2VAN A;  4IR1 A;  2K89 A;  3BQ1 A;  2I6X A;  2ZIU A;  4UB4 A;  1JIH A;  1WYG A;  2F1H A;  3NGD A;  2ESE A;  4PZO A;  4DQI A;  4DEZ A;  2J6T A;  4DSL A;  1V85 A;  4QZF A;  4KLD A;  4NLZ A;  8ICF A;  2IHN A;  4CF5 A;  2C2D A;  4FS2 A;  1RDF A;  1ZQG A;  3UXN A;  9ICJ A;  8ICS A;  2W7O A;  1N56 A;  5ALQ A;  4KLO A;  9ICK A;  3HT3 A;  1RZT A;  2EZY A;  3Q8L A;  4MFC A;  1KDH A;  2W55 A;  1U47 A;  3HKZ F;  4R8U A;  4E0D A;  1KEJ A;  2Y9U A;  2HHQ A;  5F3X B;  4NY8 A;  4DQS A;  4KLT A;  4MEY A;  1D8L A;  2WFA A;  5ALK A;  4DL3 A;  5AI4 A;  3M9N B;  3RJH A;  3N7R C;  5AM4 A;  2PFP A;  4BWM A;  3CNH A;  5J2C A;  3T3F A;  5AI9 A;  2HMX A;  4YXM A;  1L7O A;  3FM9 A;  1NNL A;  1ZRN A;  4DL7 A;  5ALL A;  3V6J A;  5AM1 A;  5ALU A;  4B9T A;  1S97 A;  5KFA A;  5J0O A;  1NK0 A;  3NVW A;  4KLI A;  4DWI A;  3PSP A;  4DOC A;  5KFL A;  1RQL A;  4CE6 A;  3GV5 B;  2WF8 A;  3PR5 B;  1BGX T;  1FO4 A;  5J0T A;  4RU9 A;  9ICS A;  2ZXH A;  4F2S A;  1DXS A;  2A1J A;  4NM1 A;  4K4G A;  2E1F A;  5JTI A;  4DO9 A;  4K4H A;  4QZI A;  9ICQ A;  4LZD A;  2QAR B;  5EWE A;  1ZQW A;  4I29 A;  3EZ5 A;  3IRU A;  5KFF A;  3SAG A;  2G09 A;  5AKI A;  3RJE A;  2ZXI A;  2JH7 A;  3FDS A;  5AKZ A;  1Z1B A;  1T7P A;  4RPY A;  2P6U A;  1K1S A;  2NRT A;  1ZQN A;  1KTQ A;  3OJU A;  4Q43 A;  4RNM A;  2JZB B;  3WKB A;  2GH1 A;  4B6J A;  1ZQM A;  3SAF A;  2V4Q A;  3KKA A;  3B9J A;  5KG2 A;  3SEN A;  4DFJ A;  3PST A;  2K8A A;  4FZN A;  4QWC A;  2IOF K;  2R8H A;  4O3N A;  2BPF A;  4G9B A;  2DPI A;  3SEI A;  2Y1I A;  3C5G A;  2FPL A;  4CF3 A;  1COK A;  1FEZ A;  1ZQJ A;  4JMU A;  4RQ3 A;  4J9P A;  4YR3 A;  2VA8 A;  5BPC A;  1ZQX A;  2OH2 A;  5EOZ A;  4YN4 A;  4OJ5 A;  4XQ8 A;  3GQC A;  5IIM A;  2HI0 A;  2ZTC A;  8ICJ A;  2VJ5 A;  3OGU A;  4AYB F;  2EZZ A;  4Z6C A;  4NLC A;  4IS7 A;  4KMU A;  5DG9 A;  1SZH A;  1Z19 A;  3F5E A;  1L7M A;  3T5J A;  3H0R B;  3ALR A;  5HML A;  1KN5 A;  1ZQS A;  4OJ6 A;  5ALW A;  4DLE A;  1PK3 A;  1S5L U;  2XI9 A;  3H0L B;  5J2K A;  5AHX A;  8ICZ A;  4QZG A;  3V7L A;  1ZQC A;  2YMM A;  4Y2X A;  5D49 A;  2WAQ F;  3F53 A;  2NO4 A;  3BZK A;  5KG6 A;  1X6J A;  4YFK A;  2KJ8 A;  3QU9 A;  4YP3 A;  3WKE A;  3PO4 A;  3PML A;  2XVT A;  7ICG A;  3H8S A;  5L1I A;  2W9M A;  1S0N A;  3L3F X;  5KFK A;  1SWV A;  4KLQ A;  5TZV A;  3WK5 A;  3L5K A;  7ICE A;  1KFS A;  2KZ3 A;  4DL4 A;  3TAQ A;  3WK8 A;  1KBU A;  3ZD9 A;  2IHM A;  3B0X A;  2R18 A;  4M9N A;  4NL9 C;  2Z7J A;  4Y2V A;  4ECR A;  2BCU A;  9ICL A;  2K4E A;  1NJY A;  5EE0 A;  1ZRM A;  2YN4 A;  1LV5 A;  2MA1 A;  4RQ8 A;  3CYM A;  1NJW A;  4U7C A;  3MFH A;  1HUO A;  3HPO A;  2ALZ A;  3RBE A;  3DEE A;  2K8B B;  2YTU A;  4CNQ A;  5CHG A;  5KFB A;  3MDA A;  4PL2 A;  4F5P A;  5EWF A;  2F76 X;  4EEK A;  4F72 A;  5HR6 A;  2YMQ A;  4ED0 A;  2A19 A;  5IIL A;  2CN1 A;  5H2F U;  1QQ5 A;  1IG6 A;  1JXE A;  4UAS A;  3QUQ A;  3THV A;  3RH5 A;  3TAD A;  4NLG A;  2KG5 A;  1ZET A;  4YD2 A;  5J2B A;  8ICK A;  4M9L A;  3NVV A;  2KOB A;  3CW2 C;  4CDG A;  1ZQL A;  2FLP A;  2ATL A;  2BQU A;  3KZI U;  3R9K A;  1J97 A;  7ICI A;  2FPK A;  5J2A A;  4C7Y A;  1SL1 A;  1S77 D;  3QX7 A;  4DFK A;  3PSF A;  3DV9 A;  2R8J A;  4J9S A;  4Y2P A;  3RJI A;  1WUD A;  2W9C A;  1KLN A;  4TUQ A;  5DQH A;  5G5G A;  1X40 A;  5KT7 A;  4C80 A;  2MU2 A;  1L8L A;  4Z6D A;  3RB0 A;  1KFT A;  2LHT A;  5KFM A;  3M6K A;  4LVS A;  4Q44 A;  4KTQ A;  3N7S C;  4F4K A;  2ISO A;  1SKR A;  2ZJA A;  4ECT A;  1WCN A;  3UMG A;  1SKS A;  3U26 A;  2RP5 A;  1T3N A;  2HVI A;  5F9L A;  4ECV A;  2KSO A;  4PGQ A;  2ZIU B;  4F4W A;  4EX6 A;  3V6H A;  4PJ0 U;  4F2R A;  2FMS A;  5J8Y C;  2H3F A;  1NJX A;  4O5K A;  4OD0 A;  2Y1J A;  3RRG A;  4GFJ A;  3QU2 A;  5ALI A;  3UPQ A;  4ECQ A;  1ZQ1 C;  1A77 A;  4QNL A;  3QEB Z;  4UAU A;  7ICJ A;  4DL6 A;  4HYK A;  3F2B A;  1DGJ A;  3OHB A;  1QSL A;  3FYH A;  2F8L A;  1ZYQ A;  4O0I A;  4ECY A;  2VA3 A;  4R8U B;  5KT5 A;  4DL2 A;  4O9M A;  3C2K A;  5ALO A;  3QUT A;  9ICO A;  1S0V A;  1NJZ A;  4F92 B;  4RQ4 A;  5KG5 A;  3K1R B;  5AI0 A;  4P0Q A;  4JWM A;  1BPB A;  4LZG A;  3SD7 A;  2WF7 A;  4YXJ A;  8ICM A;  5CJ7 A;  3GIK A;  2HHV A;  4F3O A;  5AI8 A;  2JH1 A;  4QZH A;  3JPS A;  1JXL A;  8ICP A;  5KFE A;  9ICX A;  5DDM A;  3Q8K A;  2KFN A;  1SB3 C;  1S0M A;  5AKG A;  5D4B A;  2HW3 A;  4US9 A;  2A1J B;  4CCH A;  5J2E A;  1XSL A;  2BDP A;  2EAP A;  5CRX A;  3PW5 A;  3NS1 A;  3I28 A;  5AM2 A;  2PFQ A;  4QW9 A;  3RTV A;  2OWO A;  3KD3 A;  3RAQ A;  4Q8E A;  2KZM A;  2HHU A;  5HR7 A;  2YY6 A;  1DGS A;  2HHW A;  2HOQ A;  4R64 A;  1NK5 A;  2RDI A;  2HVH A;  4LJX A;  3OSN A;  2ZIV A;  5KFJ A;  5D46 A;  3V72 A;  2CRX A;  4PHA A;  1ED1 A;  3NRZ A;  2WF5 A;  1L5U A;  3A0B U;  4DFP A;  2BPC A;  2HDO A;  1ZQI A;  5KFQ A;  3QEA Z;  3LYS A;  2VIX A;  3D2N A;  3SMV A;  2HSZ A;  1PVR A;  2IMW P;  2A3V A;  5KT6 A;  4J9L A;  5CA7 A;  5CWR A;  4UB1 A;  2AQ0 A;  4FZM A;  2NYV A;  3C1Z A;  5ALN A;  1QH9 A;  5J2D A;  1DK3 A;  4F50 A;  4F5R A;  3RH4 A;  2HHT A;  4XUS A;  3NRW A;  4RQ2 A;  2HHS A;  1QQ7 A;  4DS5 A;  1ZQZ A;  5HP4 A;  1Q3U A;  3AMZ A;  1JI7 A;  3HWT A;  3GIJ A;  3T5L A;  3RBD A;  3C23 A;  1X9M A;  5CP2 A;  5B66 U;  3GIM A;  2WF9 A;  2EAN A;  2RHF A;  2JXJ A;  1ZQH A;  3IN5 A;  3E58 A;  3PX0 A;  1URJ A;  1PVQ A;  3C28 A;  4HAI A;  3AEV A;  3G6Y A;  1X6I A;  3MR3 A;  4DOA A;  2QB0 A;  5AIB A;  1YZ7 A;  2RQ5 A;  4G3I A;  1GO3 F;  2M0N A;  4QZA A;  5KFP A;  1D8B A;  2LKY A;  4IC9 A;  4I2H A;  1S8O A;  3WKA A;  2E8O A;  4GIB A;  2DPJ A;  5DLF A;  4I2B A;  2MAX A;  4KLM A;  2K4P A;  4GXK A;  1OW5 A;  5ALH A;  9ICT A;  4A8E A;  4OJL A;  2W9B A;  1L8O A;  1Z4N A;  2OEH A;  2C22 A;  4F8R A;  2ASL A;  4IRD A;  1KW4 A;  5IIK A;  4F4X A;  1XWL A;  2PXI A;  7ICT A;  1A76 A;  2KFZ A;  5J0X A;  3J81 j;  4PPX A;  3RB3 A;  4C4T A;  4MF2 A;  5K4L A;  4TUR A;  3SI8 A;  2W43 A;  2B6G A;  3BZC A;  3ZDC A;  3KTQ A;  5DB9 A;  5C0Y A;  3MAB A;  3PW4 A;  8ICC A;  1NI3 A;  3G6V A;  2IA6 A;  2FMP A;  4O3M A; 
#chains in the Genus database with same CATH homology
 4UB6 U;  5KAI U;  4IL6 U;  1S5L U;  4PJ0 U;  5GTH U;  5B5E U;  5TIS U;  5H2F U;  4UB8 U;  3KZI U;  5B66 U;  2AXT U;  2DUY A;  3WU2 U;  3A0B U;  5KAF U;  5E79 U;  5GTI U;  3A0H U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...