4UB8U

Native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 31
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 4ub8U01
3A0BU 2AXTU 1S5LU 4PJ0U 5B5EU 5TISU 4IL6U 4UB8U 3WU2U 5KAIU 5E79U 3A0HU 5B66U 5GTHU 5KAFU 5GTIU 2DUYA 3KZIU 4UB6U 5H2FU
chains in the Genus database with same CATH superfamily
2EANA 1ZQPA 1Q8KA 4IR9A 2EZYA 2KHVA 2W54A 5HMMA 2JRZA 2BHNA 2HDOA 4PHEA 1B22A 1YZ6A 4F72A 2W8LA 1D8YA 1XSNA 5ALNA 2IOFA 3G6VA 4OO1J 2MUTB 3M9OB 3KZIU 1WUDA 8ICCA 5ALTA 1B0XA 3E0FA 4BUGA 3QU7A 4CGZA 2EZZA 1MA7A 2RQ5A 4J9PA 2AQ4A 4KLUA 2PFNA 4UB3A 1S8OA 3RB3A 2DWQA 3M7DA 3MFIA 4C7YA 2ASDA 5AK5A 1T3NA 1N61A 1WCLA 1X6IA 4ACOA 3C5GA 1SKRA 2YMLA 4RUCA 4UAWA 1BPBA 5AKGA 1Z3EB 4DQQA 2JV3A 1UA0A 4I29A 2W9BA 3LYSA 2QB1A 3SR6A 1NK9A 1T4GA 3SI8A 4M6WB 4EYIB 4UW9A 4RT2A 2KSOB 5IIOA 3GIMA 3RJEA 5J2JA 3AN1A 2QARA 1WWVA 5CEHA 5J0XA 1PZNA 1KBUA 1V97A 1N48A 1ZETA 1TK0A 2FLLA 4M47A 1N5XA 4Y2JA 4QWEA 3HKZF 3M8RA 4Z6DA 1S97A 3QEAZ 1T94A 4IRKA 3WKAA 5L1JA 8ICNA 2ASLA 5AK4A 5AM3A 2DPIA 5KG0A 3HPOA 2MRLA 3UMBA 4OJOA 4R8UA 3QYPA 5KT3A 3H0LB 4C4RA 3RJKA 4C4SA 3WK4A 1F44A 5E79U 4KLMA 3SQIA 4C7ZA 3C23A 1LVHA 2ZJ5A 3PO4A 1NK8A 4IQTA 2ZTEA 2H3ZA 3C29A 3RRHA 3AL0B 1SXEA 2VKQA 3H4BA 3AUOA 3RFAA 5J2GA 4PJ0U 3HJEA 1NJZA 3N7PD 2ZTDA 1TAUA 2O6KA 2Q0ZX 1NK6A 5JU5A 4F50A 1CEZA 2F44A 3PX0A 4DFJA 4PH5A 1NK5A 4ICAA 3B0YA 4I2IA 3PVXA 4TQSA 4PGXA 3PMNA 8ICUA 3BQ7A 2W03A 5J0QA 4UB4A 2N1RA 3LVVA 1KRPA 4C8NA 4JB3A 3ORYA 3GZFA 4ECVA 3BS7A 1T7PA 9ICOA 2UVWA 1COKA 3JPSA 3TI0A 4ED2A 2WB1F 2KZZA 3C1YA 5EWGA 1QQ5A 4DL3A 2PKEA 4KLHA 1SV0C 2F8LA 4ECZA 4BDPA 2CN1A 4C8KA 1SXDA 1SZPA 4EYHB 2A19A 4ELVA 2OH2A 4RQ5A 3ED5A 3IV6A 3ZDBA 4QIWF 4EBCA 3TFRA 4USAA 1SL1A 7ICVA 3ALRA 4AYBF 4DSIA 5KFGA 2NRXA 3QU2A 4RZRA 9ICRA 4B9VA 1X9WA 3PW0A 3TADC 2WF6A 2HOQA 4F5RA 4IR1A 2BDUA 3N4MB 1TE2A 1L7NA 4F4WA 4JV0A 3ZDEA 3OPXA 4UB5A 8ICMA 4IQUA 3WU2U 3IRUA 2RLTA 9ICWA 5EE3A 3OHBA 7ICHA 2RP5A 4O3SA 2CRXA 2ZUCA 2P6UA 3M1YA 3SAGA 2BQ3A 4O3RA 5CP2A 4B9LA 8ICGA 2UVRA 4P0PA 2E8PA 2LI6A 2KN7A 3JPOA 2KZ3A 4DL6A 3RBEA 1SL2A 1J2MA 5ALUA 9ICUA 2A1JA 1WCNA 1U45A 2KHQA 2W3SA 4PGQA 4J9MA 4QZIA 4QZBA 4RQ8A 1NZPA 3EYZA 2DFLA 1ZQIA 3GU3A 4BWJA 5AI8A 3LWMA 2F76X 4NM1A 3TANA 4QZDA 2AJQA 4ECQA 8ICPA 4C4TA 3E58A 1VLBA 2M0NA 3GIKA 3Q8LA 4EELA 1PVPA 4P4PA 4M9NA 4IQWA 4C0ZA 2IMWP 4US8A 4ED3A 5J0SA 3IG5A 3UXNA 4DLGA 1M6YA 4F2SA 1NK7A 3MBYA 2R8HA 5DG9A 2XICA 2KP7A 2C28A 3PO5A 2HI0A 4NWIA 1ZQHA 5J2AA 1LKYB 3QX7A 1TKDA 1SWVA 3QU9A 1HUOA 3WK6A 9ICIA 5KNIA 3T5JA 4DFMA 2ZIUA 5DQHA 2F1HA 5AI6A 1Q46A 2H5XA 1NJWA 5A0LA 3MDAA 5KFZA 5KFAA 3M6KA 4KTQA 1UA1A 1ZQXA 3QU4A 3K1ZA 2GH1A 9ICCA 2WF5A 4RQ0A 5CB1A 1VDVA 3RH6A 2HHSA 1QQ7A 1L7PA 5ALIA 1X40A 1ZJNA 1PK3A 7ICKA 3FC4A 4F5QA 3EWAA 2HOFA 2FE9A 2AHOB 5DB8A 5DLGA 2NO4A 1ZQMA 4CCHA 4YD2A 4O5EA 2VJ5A 5AKLA 1K1SA 2W9CB 1JIHA 2W7PA 5KFIA 1C20A 2UVVA 3PX4A 4DOCA 1AQ6A 2PMZC 4BX9C 2KTQA 8ICVA 4O9MA 4R64A 2HBMA 3RF9A 5ALWA 2RDIA 4ED7A 5F9LA 2J6UA 2ZIWA 4NLNA 4R63A 2ZXIA 1UHUA 1Z00A 7ICFA 7ICUA 4KLEA 4PL2A 1NZBA 1K1QA 4TURA 5KFOA 1XC9A 3SEIA 5BOLA 1N60A 3N7RC 2W11A 4M9HA 4QZHA 1S10A 1JMSA 2H3FA 4KLJA 5AHXA 5ALDA 1S0MA 3LWLA 1IXRA 3B9JA 4KLGA 3NTUA 4GXKA 1WG8A 1PK1B 3LVWA 4DSLA 1SB3C 3PW4A 1Z4OA 3CP8A 2KD1A 3LDAA 4XQ8A 2OM6A 8ICSA 4F5OA 1QH9A 5KFBA 1L3UA 2FLNA 2ZUDA 3RH5A 3K75D 3JPRA 3OGUA 5GTIU 1S0OA 1XS9D 4F5PA 5IIMA 5ALEA 3S6JA 2DKZA 2FLPA 4KLQA 3RJHA 5J2HA 2KVCA 2L5YA 4KLSA 2XIDA 2CPRA 5AKZA 1S0VA 4RPZA 3F5AA 1JXEA 4DL2A 2I6XA 2BPFA 1ZXIA 4B9UA 4KX3A 1NK0A 4DL7A 4PZOA 2Y9UA 2WAQC 2AQ0A 1X2IA 3IDWA 2JEIA 1VJ5A 1D8BA 1N63A 1ZQGA 1J97A 3SD7A 5AKKA 3UXOA 1D8LA 3QUTA 2W55A 4O3QA 3TARA 3KD3A 4NV0A 5ALJA 3C2KA 1ECWA 3RB0A 4O0IA 5L1IA 2XY5A 1ZQLA 5DG7A 3CRXA 3SYZA 4M6WA 4DOBA 1TAMA 2H3IA 4LZDA 2KSOA 1H38A 3L3FX 2K8AA 1U47A 2AGPA 2EH9A 3ETRA 3C28A 4BXOA 4QW8A 1S0NA 2BQRA 3RJGA 3C5FA 4NM2A 5ALZA 2ZIXA 4ELTA 1JALA 2IBKA 4U6PA 2DKXA 2FPMA 3MGHA 2DQNB 2WHEA 5G5HA 5J0YA 3JPQA 1FFVA 4QZCA 1X66A 4RPYA 2WTFA 2Y0SF 5L1LA 3IM1A 3ISBA 1RM6C 5GTHU 5K4LA 2BKEA 3SAFA 5KFCA 2WF8A 3RRGA 2K60A 4F91B 1QCKA 4MFCA 4F4KA 3KZXA 4M9GA 5C0YA 2FJ6A 3V6JA 5D4BA 3H4DA 2ZIVA 3T5LA 2C22A 2IHMA 1KKXA 3ZD8A 2QB0A 5KFDA 5AICA 5KG1A 1IM4A 2PFQA 4CRXA 1GO3F 8ICXA 4GC6A 2KFNA 4KX5A 2BCUA 1MSWD 1NOMA 4IRDA 1KFTA 5CR0A 4O3NA 1X9SA 4F4YA 1ZQYA 9ICNA 3BQTA 2JEJA 1DXSA 3D2SA 4QJFB 5J2CA 4UASA 4P4OA 1TAQA 2XY6A 3UQ2A 3JPTA 3VCBA 2R8IA 2YB4A 2BQUA 3GDXA 2KFZA 3H8WA 5FP0A 5KL8B 4DEZA 3JPNA 3OTQA 2NYVA 3RR8A 3AU6A 1JN3A 5ALOA 4NL9A 2YMMA 2E3TA 5EE0A 4ED6A 3V6KA 3PSFA 1MQ2A 2EAMA 4K4GA 2RHFA 4RQNA 2VA8A 4DWIA 3U26A 1LB2B 7ICGA 1SKWA 1OXJA 9ICJA 1NKBA 2W7OA 1SZHA 2HHTA 9ICXA 2LBOA 3IG8A 3T3FA 4YMNA 2WFAA 1X9MA 2BPGA 7ICLA 1L8LA 4PHDA 2NO5A 3C21A 5JUMA 3CW2C 2VANA 5KAIU 3TFSA 5CRXA 1ZQOA 4XA5A 2W9MA 3TACB 3HT3A 3KKAA 1B4FA 9ICPA 3KHGA 4I2BA 4JV2A 3DV9A 1RXVA 5DLFA 1ZD5A 4J9LA 4DSJA 3RBDA 2KZMA 4BGDA 2MSNA 3AQFA 1KW4A 4C80A 2F77X 2G5HB 5AI0A 2A3VA 4KN7A 5IINA 4Y2UA 2KMDA 3CYMA 3PR4A 2HOIA 4F71A 3RB4A 5AIAA 2K4HA 1HUZA 2MU2A 4HAIA 3UXPA 4ECSA 2KJ9A 1A76A 3A0BU 2RDJA 1XO1A 4UQGA 4Z6EA 3NS1A 3PV8A 1Z1BA 4RPXA 5F3XB 5HR6A 2LMRA 4DQPA 8ICLA 3F2BA 4Z6FA 2JEFA 1PUZA 4UAVA 1QTMA 5L1MA 1X42A 3ZDDA 2QLTA 3LK9A 1QLNA 4KMOB 1LV5A 4UAUA 2W9BB 2RRDA 2XY7A 2KVSA 4TQRA 5HR7A 1F0MA 2PXIA 4F2RA 2GOLA 3UMCA 4UB8U 4I28A 4J9SA 5ALRA 2F1JA 1IV8A 2QARB 5ALMA 3IN5A 4EEYA 3RR7A 4LJXA 3BZCA 1JRPA 5CHGA 2XCAA 1BPDA 2E5SA 4F3OA 2AXTU 5HMLA 5KT4A 5ALLA 1UPHA 1KTQA 2YTUA 3QUBA 1ZQQA 3OHAA 3QEBZ 3BQ0A 1S77D 4YR0A 5B66U 4DSKA 4FZLA 7ICMA 2AH5A 2OWOA 5DGBA 4R8UB 5CA7A 3C2LA 1LKYA 5J0OA 2JEGA 1D9FA 4PL1A 2B6GA 1L7OA 3H8JA 1Q3VA 5CWRA 4I2HA 4ED8A 9ICBA 8ICJA 3QE9Y 1ZQUA 3QZ7A 4P4MA 5DKWA 3PSPA 1FEZA 2KICA 2ZTCA 5ALHA 3TAQA 2P35A 4QWBA 5KFKA 4AP9A 3SV3A 2J6SA 5ALQA 4DFKA 2HMXA 5BOMA 3SV4A 4IRCA 2ODGA 1ZOLA 1NI3A 3WK8A 2BCSA 5J0TA 5KFYA 4YXJA 5L9XA 1SV0A 3DEEA 4UATA 4DS4A 4HYKA 1F5SA 5KFFA 3PNCA 4PPXA 4QZEA 4MEXA 4IS7A 4P0QA 2Q4TA 4FBUA 5KG6A 3GV8B 4I2FA 8ICAA 4FE3A 5KG7A 4I2CA 2EQYA 2OEHA 3ZD9A 4CE6A 3AQEA 2DPJA 5KT2A 4C8OA 5KFHA 4BJQA 4GIBA 4RQ6A 4DF4A 2Z7JA 4DQRA 2WF7A 3TAPA 4UBCA 7ICPA 3TADA 2YX8A 3E2EA 2MA1A 4MF2A 1DGJA 2HSZA 4KN4A 4DLEA 4M2YA 5J8YC 5KG3A 1BNPA 4C8LA 3IHQB 1JROA 3V72A 4O5CA 7ICOA 4KLFA 1V9PA 1ZRMA 3I1YA 2D8CA 3HKZC 2YN4A 2MAXA 2ISPA 4WJ3B 9ICHA 4KLDA 1BPZA 2LM1A 3EW9A 3SENA 1PK1A 2F3NA 2ASJA 4UARA 3FYHA 1WWUA 1BPXA 4NLBA 3G6XA 1ZQFA 1JX4A 4IL6U 4O3OA 3D2QA 2YB1A 1BVSA 3WKEA 5HNKA 5DB6A 1XSLA 3PZPA 1Z19A 1RG6A 4M9JA 4YVZA 4Y2YA 3BJYA 4ECWA 3EPGA 5EE9A 3WKBA 3EZ5A 2FPLA 5J2BA 3KHLA 2DL0A 2EAOA 1RYRA 5KFLA 5DBAA 3RTVA 3AU2A 1EXNA 1J2NA 3TKAA 1JUDA 4EBEA 5KFRA 1O03A 2E8MA 1ZQWA 4Y2SA 4FZMA 3N97B 5CJ7A 1N2XA 5KTQA 1RZTA 3AMZA 4P0PB 2F2AB 4DQIA 4FS2A 5KFVA 9ICFA 5AI4A 2D6FC 5ALFA 4QZ8A 4O5KA 1ZD4A 2FI1A 2A1JB 1AROP 4O3MA 4M04A 5ALXA 5KAFU 5EWEA 2WB1C 3WK9A 4JUZA 3J81j 3L5KA 2G0AA 1ZQAA 1UT8A 4ECXA 1X9XA 1Y88A 2HHWA 2EZXA 4TUSA 4PHPA 2C2EA 2JHDA 4YXMA 3ETLA 2PFOA 4I27A 3ISDA 2JH7A 4Z6CA 4MHVA 4JV1A 2D3DA 4OJPA 5KT5A 3NRWA 4QIWC 5G5GA 3OSNA 2DF4B 2VA3A 4MFAA 4AYBC 2G5IB 9ICTA 3QNMA 4NLGA 2KIVA 2NRVA 1ZD2P 4DOAA 4K4IA 2M9NA 4XRHA 3KBBA 1FIQA 4EBDA 4J9OA 4FBTA 5KG4A 2KJ8A 8ICYA 3T5KA 2Y1JA 3ONNA 4LZGA 2KOBA 8ICQA 2G06A 2MUTA 2BZFA 2P6RA 5KFNA 3B0XA 5TZVA 1A77A 4RNNA 3RJIA 8ICTA 2FDRA 1RQNA 4RQ4A 4JMUA 1FO4A 4UB1A 1KFDA 1PVRA 1T8EA 1S9FA 2OCEA 4KLTA 5HHIA 1CI4A 1T3QA 2LPEA 4YR3A 2KG5A 4OJ5A 1QQ6A 1U9LA 4M9LA 4R66A 4I2DA 1HJPA 4J9RA 4ECUA 4RQMA 1XNSA 3N28A 2LYBA 2PFPA 4UAYA 3PSTA 9ICMA 2NRWA 2C2DA 1Q3UA 1OUQA 4F93B 3M6ZA 3I28A 1ZQRA 3H0RB 2I9GA 3BZKA 4Y2TA 3GIIA 2ZXHA 1WYGA 3GFKB 4KITB 5IILA 5HHHA 4TUQA 2E1EA 2YMQA 3BS5B 5ALGA 2JZBB 1Z00B 5AM4A 1U4BA 4KLOA 1KDHA 2HBLA 1DOQA 1ZQBA 2AGQA 3NASA 1QSYA 4YMMA 1MN8A 5DBBA 3MGVA 4Y2VA 3KHRA 4GFJA 3UPQA 3MABA 4F4XA 1NNLA 3OJSA 3C2MA 5KFEA 1KLNA 8ICOA 4GXJA 3GIJA 3MGIA 2EDUA 3MR2A 4RUAA 5AI5A 3V7LA 5J2DA 2HBJA 4NLCA 4EZ9A 3QXGA 4DQSA 1RYUA 2KEYA 2AU0A 4F8RA 3ZI4A 4NL9C 4PHAA 1JI7A 1RYSA 2I5HA 2V4QA 3Q8MA 4QZAA 3JPPA 2W8KA 3A0HU 5DDYA 1BPYA 3EUB2 3G6YA 4ED0A 5J0UA 7ICRA 4B9NA 1UT5A 2YMPA 2E8NA 3MDCA 3M9MB 4ECYA 2AGOA 8ICWA 7ICEA 1KN5A 1L3VA 2H3QA 1S5LU 2IHNA 5TISU 2VJ4A 2VA2A 1IG6A 3V7KA 2W9AA 2C2RA 2R8GA 3F2CA 3KKAC 3QUQA 1TVAA 2YQEA 4BWMA 4Q8EA 1ZQDA 2K4EA 5KFJA 4Q8FA 3H0MB 2J6TA 3Q8RB 3H8MA 1URJA 5AM0A 3CNHA 1ED1A 2ATLA 4OJLA 3PW7A 2KJ5A 3AM9A 2XI9A 3MC1A 3OSPA 2DUYA 2ES6A 4RU9A 4BXOB 2JR5A 2P66A 3PY8A 3THVA 3H8SA 2KE7A 3UMGA 3NVVA 5AKIA 5DQIA 2ZIXB 4CNQA 4RNMA 1U48A 1ZQJA 5J2EA 5AKXA 4YFKA 1L3TA 5J2KA 2KKPA 3BQ1A 7ICQA 5EOZA 4DCCA 3SMVA 3I76A 2LYAA 5H2FU 5DB9A 5AKYA 7ICJA 3Q8KA 4QWCA 2HBKA 3MR3A 2K8BB 4JK1A 5JTIA 3WKDA 3T5HA 2Y9TA 3H40A 4Q44A 1V38A 5AK3A 5AM1A 1MQ3A 1ZQSA 2H3VA 3NVYA 4RQ1A 2XGQA 4R65A 1DRGA 2FMPA 2F8KA 4Y2PA 2LM4A 2ZIVB 4YG2A 1UQVA 2K89A 2QB0B 1OW5A 3SZ2A 1L5UA 3UQ0A 2HHQA 2KK0A 1KL9A 3WK5A 2LHTA 3OJUA 4NLKA 4J9NA 4CDGA 4Y2XA 4I2GA 3PR5B 2QKQA 2W43A 2G07A 4J03A 1NKEA 1RQLA 4QZ9A 2HHXA 4UB6U 2B0CA 4DSEA 4YCXA 1L8OA 2PMZF 3F53A 4DS5A 8ICKA 5IIKA 2PI4A 4I2JA 3BDPA 1XU4A 4QNLA 1ZQZA 1SKSA 8ICFA 3L4PA 3D6JA 4O3PA 4RT3A 2K8CB 3KHHA 4UBBA 5AKJA 4KLIA 4G3IA 1KEJA 4A8EA 4ELUA 1L6NA 3KFUF 7ICTA 2R8KA 4EX6A 4F4ZA 3PW2A 1SWWA 4GLXA 3NRZA 4NXZA 2HVHA 2BDPA 1YZ7A 1Z1VA 5EWFA 4Y2RA 2HVIA 2GLEA 1DK3A 2IOHA 5KFSA 3RAXA 2BCQA 1BNOA 4GC7A 3FDSA 4NJ8A 5DDMA 1ZRNA 3WKCA 2IOFK 8ICHA 4KLLA 1S76D 5AM2A 1BGXT 2ESEA 4B9TA 1TK8A 1SV4A 4FFDA 2ZJ8A 1A0PA 3NGDA 5KFXA 3ISCA 2HW3A 2Y0SC 5BPCA 4DFDA 2K4PA 4DO9A 1HEKA 3QZ8A 4ZH4A 3O0FA 1JXLA 2KIWA 2E1FA 8ICEA 9ICGA 1RPLA 1ZQVA 4XUSA 4UB2A 3RJJA 3GQCA 9ICLA 1B43A 4GXIA 3GV7B 4YQWA 1ZQEA 5EE1A 3NUQA 7ICNA 5AM5A 1L7MA 3ICXA 5J0PA 9ICKA 1DGSA 3F2DA 4F92B 3IP4B 3BQ2A 3QU5A 2UVUA 1MC8A 2NV3A 4YD1A 2NRZA 2W9CA 1FFUA 3Q8SB 1Z4NA 5ALPA 5KFUA 4QWAA 2WAQF 3VC8A 2BCVA 4P2HA 4QZGA 3UM9A 2YY6A 3T79A 3F5EA 3ZDCA 4X5VA 3V7JA 2EAPA 1XO0A 4CF3A 2F1IA 5T14A 1UCVA 3GILA 2GO7A 2A1AA 2XC9A 1V85A 4NY8A 5J2FA 3Q8QB 1L3SA 1ZQCA 4DSFA 3V6HA 4EEKA 4NLZA 5DBCA 5DQGA 1QSSA 5J0RA 2I1QA 1CUKA 2G09A 4DFPA 2LYHA 4B6JA 9ICAA 4I2EA 4IC9A 4FO6A 1NJXA 1N5WA 4US9A 4TUPA 2BGWA 5D49A 1D9DA 3M9NB 4B9MA 5KFWA 2ZJAA 2DGZA 3FAHA 3MFHA 5ALVA 4RQ3A 1QSLA 2FMSA 2G08A 3Q8PB 5KG5A 2BPCA 2JGAA 1KFSA 5D46A 4MF8A 3MR6A 4J9KA 4QW9A 5KFTA 5AKEA 3WK7A 4QZFA 1ZQKA 5J0WA 1N56A 2E8OA 1XSPA 1KSPA 2R8JA 1NK4A 9ICVA 2XO7A 1ZYQA 1XWLA 3C1ZA 5JRTA 2WF9A 3HRDD 1YT3A 1NJYA 2FMQA 2HCFA 5AKHA 2PI5A 4ECRA 4DL5A 1SGGA 5J8YA 2ISOA 5ALYA 3EPIA 4ED1A 4DF8A 5DGAA 2B21A 8ICIA 5B5EU 5HP4A 4YN4A 2LKYA 2Y1IA 4OD0A 7ICIA 1COOA 4CF5A 4P0QB 5ALSA 3HW8A 4PZNA 8ICBA 4Q45A 1BPEA 2KKVA 5DG8A 3RAQA 1ZQTA 5ALKA 5KFQA 4EX7A 1SIJA 9ICEA 1KQQA 3BS5A 1N62A 2JZBA 4E0DA 1ZQ1C 2KNJA 2JH1A 4KMUA 2V9WA 2W3RA 5C5JA 9ICQA 4DL4A 4Q43A 1SL0A 1TV9A 1A6SA 7ICSA 2CXYA 2XCPA 3HWTA 2K4IA 4F5NA 3RJFA 1K5OA 1O08A 5KG2A 2R18A 3RB6A 1IIPA 2JXJA 2XVTA 3K1RB 4Y2QA 2ZIUB 1X6JA 3R9KA 3MR5A 4EZ6A 5F9NA 3SAHA 2NRTA 4YMOA 4FZNA 2HHVA 5IIIA 4ECTA 5AIBA 4K4HA 2V4RA 1PVQA 5J2IA 1TFRA 3NVWA 1RDFA 2W04A 4RQ7A 3H7IA 5KT7A 1C7YA 3PX6A 5KFMA 2OXOA 4EENA 1NKCA 4MEYA 3FM9A 4UAZA 4YR2A 4OCZA 3NVZA 2JMGA 3AEVA 4LVSA 4OJ6A 4JWMA 4RNOA 5KFPA 4IQVA 3HP6A 1DK2A 2FPKA 3RH4A 5AK6A 5KT6A 2ALZA 2BR0A 1RXWA 5L1KA 8ICRA 3PW5A 4CF4A 4G9BA 3TQ1A 4M0AA 4FS1A 4B9SA 1ZD3A 2DBYA 4ZOHC 2ZIWB 2GWSA 3ZDAA 3KOOA 5DB7A 4JWNA 5IIJA 1ZJMA 2ZG6A 4U7CA 5KL1B 3HILA 1HIWA 4YP3A 4PGYA 1CRXA 4C8MA 2VIXA 2HHUA 3QUCA 3D2NA 2OHFA 3HX0A 4MFFA 2XGPA 3PSIA 1ZQNA 4QWDA 3K4GA 2IA6A 2KV2A 3GV5B 1P7DA 3M8SA 5J29A 2ZUBA 3PMLA 3DDHA 2OYYA 8ICZA 1TK5A 2BCRA 1U49A 9ICSA 4RQ2A 4I2AA 4J9QA 5AI9A 3KTQA 3N7SC
chains in the Genus database with same CATH topology
3A0BU 2AXTU 1S5LU 4PJ0U 5B5EU 5TISU 4IL6U 4UB8U 3WU2U 5KAIU 5E79U 3A0HU 5B66U 5GTHU 5KAFU 5GTIU 2DUYA 3KZIU 4UB6U 5H2FU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B U;  2AXT U;  1S5L U;  4PJ0 U;  5B5E U;  5TIS U;  4IL6 U;  4UB8 U;  3WU2 U;  5KAI U;  5E79 U;  3A0H U;  5B66 U;  5GTH U;  5KAF U;  5GTI U;  2DUY A;  3KZI U;  4UB6 U;  5H2F U; 
#chains in the Genus database with same CATH topology
 2EAN A;  1ZQP A;  1Q8K A;  4IR9 A;  2EZY A;  2KHV A;  2W54 A;  5HMM A;  2JRZ A;  2BHN A;  2HDO A;  4PHE A;  1B22 A;  1YZ6 A;  4F72 A;  2W8L A;  1D8Y A;  1XSN A;  5ALN A;  2IOF A;  3G6V A;  4OO1 J;  2MUT B;  3M9O B;  3KZI U;  1WUD A;  8ICC A;  5ALT A;  1B0X A;  3E0F A;  4BUG A;  3QU7 A;  4CGZ A;  2EZZ A;  1MA7 A;  2RQ5 A;  4J9P A;  2AQ4 A;  4KLU A;  2PFN A;  4UB3 A;  1S8O A;  3RB3 A;  2DWQ A;  3M7D A;  3MFI A;  4C7Y A;  2ASD A;  5AK5 A;  1T3N A;  1N61 A;  1WCL A;  1X6I A;  4ACO A;  3C5G A;  1SKR A;  2YML A;  4RUC A;  4UAW A;  1BPB A;  5AKG A;  1Z3E B;  4DQQ A;  2JV3 A;  1UA0 A;  4I29 A;  2W9B A;  3LYS A;  2QB1 A;  3SR6 A;  1NK9 A;  1T4G A;  3SI8 A;  4M6W B;  4EYI B;  4UW9 A;  4RT2 A;  2KSO B;  5IIO A;  3GIM A;  3RJE A;  5J2J A;  3AN1 A;  2QAR A;  1WWV A;  5CEH A;  5J0X A;  1PZN A;  1KBU A;  1V97 A;  1N48 A;  1ZET A;  1TK0 A;  2FLL A;  4M47 A;  1N5X A;  4Y2J A;  4QWE A;  3HKZ F;  3M8R A;  4Z6D A;  1S97 A;  3QEA Z;  1T94 A;  4IRK A;  3WKA A;  5L1J A;  8ICN A;  2ASL A;  5AK4 A;  5AM3 A;  2DPI A;  5KG0 A;  3HPO A;  2MRL A;  3UMB A;  4OJO A;  4R8U A;  3QYP A;  5KT3 A;  3H0L B;  4C4R A;  3RJK A;  4C4S A;  3WK4 A;  1F44 A;  5E79 U;  4KLM A;  3SQI A;  4C7Z A;  3C23 A;  1LVH A;  2ZJ5 A;  3PO4 A;  1NK8 A;  4IQT A;  2ZTE A;  2H3Z A;  3C29 A;  3RRH A;  3AL0 B;  1SXE A;  2VKQ A;  3H4B A;  3AUO A;  3RFA A;  5J2G A;  4PJ0 U;  3HJE A;  1NJZ A;  3N7P D;  2ZTD A;  1TAU A;  2O6K A;  2Q0Z X;  1NK6 A;  5JU5 A;  4F50 A;  1CEZ A;  2F44 A;  3PX0 A;  4DFJ A;  4PH5 A;  1NK5 A;  4ICA A;  3B0Y A;  4I2I A;  3PVX A;  4TQS A;  4PGX A;  3PMN A;  8ICU A;  3BQ7 A;  2W03 A;  5J0Q A;  4UB4 A;  2N1R A;  3LVV A;  1KRP A;  4C8N A;  4JB3 A;  3ORY A;  3GZF A;  4ECV A;  3BS7 A;  1T7P A;  9ICO A;  2UVW A;  1COK A;  3JPS A;  3TI0 A;  4ED2 A;  2WB1 F;  2KZZ A;  3C1Y A;  5EWG A;  1QQ5 A;  4DL3 A;  2PKE A;  4KLH A;  1SV0 C;  2F8L A;  4ECZ A;  4BDP A;  2CN1 A;  4C8K A;  1SXD A;  1SZP A;  4EYH B;  2A19 A;  4ELV A;  2OH2 A;  4RQ5 A;  3ED5 A;  3IV6 A;  3ZDB A;  4QIW F;  4EBC A;  3TFR A;  4USA A;  1SL1 A;  7ICV A;  3ALR A;  4AYB F;  4DSI A;  5KFG A;  2NRX A;  3QU2 A;  4RZR A;  9ICR A;  4B9V A;  1X9W A;  3PW0 A;  3TAD C;  2WF6 A;  2HOQ A;  4F5R A;  4IR1 A;  2BDU A;  3N4M B;  1TE2 A;  1L7N A;  4F4W A;  4JV0 A;  3ZDE A;  3OPX A;  4UB5 A;  8ICM A;  4IQU A;  3WU2 U;  3IRU A;  2RLT A;  9ICW A;  5EE3 A;  3OHB A;  7ICH A;  2RP5 A;  4O3S A;  2CRX A;  2ZUC A;  2P6U A;  3M1Y A;  3SAG A;  2BQ3 A;  4O3R A;  5CP2 A;  4B9L A;  8ICG A;  2UVR A;  4P0P A;  2E8P A;  2LI6 A;  2KN7 A;  3JPO A;  2KZ3 A;  4DL6 A;  3RBE A;  1SL2 A;  1J2M A;  5ALU A;  9ICU A;  2A1J A;  1WCN A;  1U45 A;  2KHQ A;  2W3S A;  4PGQ A;  4J9M A;  4QZI A;  4QZB A;  4RQ8 A;  1NZP A;  3EYZ A;  2DFL A;  1ZQI A;  3GU3 A;  4BWJ A;  5AI8 A;  3LWM A;  2F76 X;  4NM1 A;  3TAN A;  4QZD A;  2AJQ A;  4ECQ A;  8ICP A;  4C4T A;  3E58 A;  1VLB A;  2M0N A;  3GIK A;  3Q8L A;  4EEL A;  1PVP A;  4P4P A;  4M9N A;  4IQW A;  4C0Z A;  2IMW P;  4US8 A;  4ED3 A;  5J0S A;  3IG5 A;  3UXN A;  4DLG A;  1M6Y A;  4F2S A;  1NK7 A;  3MBY A;  2R8H A;  5DG9 A;  2XIC A;  2KP7 A;  2C28 A;  3PO5 A;  2HI0 A;  4NWI A;  1ZQH A;  5J2A A;  1LKY B;  3QX7 A;  1TKD A;  1SWV A;  3QU9 A;  1HUO A;  3WK6 A;  9ICI A;  5KNI A;  3T5J A;  4DFM A;  2ZIU A;  5DQH A;  2F1H A;  5AI6 A;  1Q46 A;  2H5X A;  1NJW A;  5A0L A;  3MDA A;  5KFZ A;  5KFA A;  3M6K A;  4KTQ A;  1UA1 A;  1ZQX A;  3QU4 A;  3K1Z A;  2GH1 A;  9ICC A;  2WF5 A;  4RQ0 A;  5CB1 A;  1VDV A;  3RH6 A;  2HHS A;  1QQ7 A;  1L7P A;  5ALI A;  1X40 A;  1ZJN A;  1PK3 A;  7ICK A;  3FC4 A;  4F5Q A;  3EWA A;  2HOF A;  2FE9 A;  2AHO B;  5DB8 A;  5DLG A;  2NO4 A;  1ZQM A;  4CCH A;  4YD2 A;  4O5E A;  2VJ5 A;  5AKL A;  1K1S A;  2W9C B;  1JIH A;  2W7P A;  5KFI A;  1C20 A;  2UVV A;  3PX4 A;  4DOC A;  1AQ6 A;  2PMZ C;  4BX9 C;  2KTQ A;  8ICV A;  4O9M A;  4R64 A;  2HBM A;  3RF9 A;  5ALW A;  2RDI A;  4ED7 A;  5F9L A;  2J6U A;  2ZIW A;  4NLN A;  4R63 A;  2ZXI A;  1UHU A;  1Z00 A;  7ICF A;  7ICU A;  4KLE A;  4PL2 A;  1NZB A;  1K1Q A;  4TUR A;  5KFO A;  1XC9 A;  3SEI A;  5BOL A;  1N60 A;  3N7R C;  2W11 A;  4M9H A;  4QZH A;  1S10 A;  1JMS A;  2H3F A;  4KLJ A;  5AHX A;  5ALD A;  1S0M A;  3LWL A;  1IXR A;  3B9J A;  4KLG A;  3NTU A;  4GXK A;  1WG8 A;  1PK1 B;  3LVW A;  4DSL A;  1SB3 C;  3PW4 A;  1Z4O A;  3CP8 A;  2KD1 A;  3LDA A;  4XQ8 A;  2OM6 A;  8ICS A;  4F5O A;  1QH9 A;  5KFB A;  1L3U A;  2FLN A;  2ZUD A;  3RH5 A;  3K75 D;  3JPR A;  3OGU A;  5GTI U;  1S0O A;  1XS9 D;  4F5P A;  5IIM A;  5ALE A;  3S6J A;  2DKZ A;  2FLP A;  4KLQ A;  3RJH A;  5J2H A;  2KVC A;  2L5Y A;  4KLS A;  2XID A;  2CPR A;  5AKZ A;  1S0V A;  4RPZ A;  3F5A A;  1JXE A;  4DL2 A;  2I6X A;  2BPF A;  1ZXI A;  4B9U A;  4KX3 A;  1NK0 A;  4DL7 A;  4PZO A;  2Y9U A;  2WAQ C;  2AQ0 A;  1X2I A;  3IDW A;  2JEI A;  1VJ5 A;  1D8B A;  1N63 A;  1ZQG A;  1J97 A;  3SD7 A;  5AKK A;  3UXO A;  1D8L A;  3QUT A;  2W55 A;  4O3Q A;  3TAR A;  3KD3 A;  4NV0 A;  5ALJ A;  3C2K A;  1ECW A;  3RB0 A;  4O0I A;  5L1I A;  2XY5 A;  1ZQL A;  5DG7 A;  3CRX A;  3SYZ A;  4M6W A;  4DOB A;  1TAM A;  2H3I A;  4LZD A;  2KSO A;  1H38 A;  3L3F X;  2K8A A;  1U47 A;  2AGP A;  2EH9 A;  3ETR A;  3C28 A;  4BXO A;  4QW8 A;  1S0N A;  2BQR A;  3RJG A;  3C5F A;  4NM2 A;  5ALZ A;  2ZIX A;  4ELT A;  1JAL A;  2IBK A;  4U6P A;  2DKX A;  2FPM A;  3MGH A;  2DQN B;  2WHE A;  5G5H A;  5J0Y A;  3JPQ A;  1FFV A;  4QZC A;  1X66 A;  4RPY A;  2WTF A;  2Y0S F;  5L1L A;  3IM1 A;  3ISB A;  1RM6 C;  5GTH U;  5K4L A;  2BKE A;  3SAF A;  5KFC A;  2WF8 A;  3RRG A;  2K60 A;  4F91 B;  1QCK A;  4MFC A;  4F4K A;  3KZX A;  4M9G A;  5C0Y A;  2FJ6 A;  3V6J A;  5D4B A;  3H4D A;  2ZIV A;  3T5L A;  2C22 A;  2IHM A;  1KKX A;  3ZD8 A;  2QB0 A;  5KFD A;  5AIC A;  5KG1 A;  1IM4 A;  2PFQ A;  4CRX A;  1GO3 F;  8ICX A;  4GC6 A;  2KFN A;  4KX5 A;  2BCU A;  1MSW D;  1NOM A;  4IRD A;  1KFT A;  5CR0 A;  4O3N A;  1X9S A;  4F4Y A;  1ZQY A;  9ICN A;  3BQT A;  2JEJ A;  1DXS A;  3D2S A;  4QJF B;  5J2C A;  4UAS A;  4P4O A;  1TAQ A;  2XY6 A;  3UQ2 A;  3JPT A;  3VCB A;  2R8I A;  2YB4 A;  2BQU A;  3GDX A;  2KFZ A;  3H8W A;  5FP0 A;  5KL8 B;  4DEZ A;  3JPN A;  3OTQ A;  2NYV A;  3RR8 A;  3AU6 A;  1JN3 A;  5ALO A;  4NL9 A;  2YMM A;  2E3T A;  5EE0 A;  4ED6 A;  3V6K A;  3PSF A;  1MQ2 A;  2EAM A;  4K4G A;  2RHF A;  4RQN A;  2VA8 A;  4DWI A;  3U26 A;  1LB2 B;  7ICG A;  1SKW A;  1OXJ A;  9ICJ A;  1NKB A;  2W7O A;  1SZH A;  2HHT A;  9ICX A;  2LBO A;  3IG8 A;  3T3F A;  4YMN A;  2WFA A;  1X9M A;  2BPG A;  7ICL A;  1L8L A;  4PHD A;  2NO5 A;  3C21 A;  5JUM A;  3CW2 C;  2VAN A;  5KAI U;  3TFS A;  5CRX A;  1ZQO A;  4XA5 A;  2W9M A;  3TAC B;  3HT3 A;  3KKA A;  1B4F A;  9ICP A;  3KHG A;  4I2B A;  4JV2 A;  3DV9 A;  1RXV A;  5DLF A;  1ZD5 A;  4J9L A;  4DSJ A;  3RBD A;  2KZM A;  4BGD A;  2MSN A;  3AQF A;  1KW4 A;  4C80 A;  2F77 X;  2G5H B;  5AI0 A;  2A3V A;  4KN7 A;  5IIN A;  4Y2U A;  2KMD A;  3CYM A;  3PR4 A;  2HOI A;  4F71 A;  3RB4 A;  5AIA A;  2K4H A;  1HUZ A;  2MU2 A;  4HAI A;  3UXP A;  4ECS A;  2KJ9 A;  1A76 A;  3A0B U;  2RDJ A;  1XO1 A;  4UQG A;  4Z6E A;  3NS1 A;  3PV8 A;  1Z1B A;  4RPX A;  5F3X B;  5HR6 A;  2LMR A;  4DQP A;  8ICL A;  3F2B A;  4Z6F A;  2JEF A;  1PUZ A;  4UAV A;  1QTM A;  5L1M A;  1X42 A;  3ZDD A;  2QLT A;  3LK9 A;  1QLN A;  4KMO B;  1LV5 A;  4UAU A;  2W9B B;  2RRD A;  2XY7 A;  2KVS A;  4TQR A;  5HR7 A;  1F0M A;  2PXI A;  4F2R A;  2GOL A;  3UMC A;  4UB8 U;  4I28 A;  4J9S A;  5ALR A;  2F1J A;  1IV8 A;  2QAR B;  5ALM A;  3IN5 A;  4EEY A;  3RR7 A;  4LJX A;  3BZC A;  1JRP A;  5CHG A;  2XCA A;  1BPD A;  2E5S A;  4F3O A;  2AXT U;  5HML A;  5KT4 A;  5ALL A;  1UPH A;  1KTQ A;  2YTU A;  3QUB A;  1ZQQ A;  3OHA A;  3QEB Z;  3BQ0 A;  1S77 D;  4YR0 A;  5B66 U;  4DSK A;  4FZL A;  7ICM A;  2AH5 A;  2OWO A;  5DGB A;  4R8U B;  5CA7 A;  3C2L A;  1LKY A;  5J0O A;  2JEG A;  1D9F A;  4PL1 A;  2B6G A;  1L7O A;  3H8J A;  1Q3V A;  5CWR A;  4I2H A;  4ED8 A;  9ICB A;  8ICJ A;  3QE9 Y;  1ZQU A;  3QZ7 A;  4P4M A;  5DKW A;  3PSP A;  1FEZ A;  2KIC A;  2ZTC A;  5ALH A;  3TAQ A;  2P35 A;  4QWB A;  5KFK A;  4AP9 A;  3SV3 A;  2J6S A;  5ALQ A;  4DFK A;  2HMX A;  5BOM A;  3SV4 A;  4IRC A;  2ODG A;  1ZOL A;  1NI3 A;  3WK8 A;  2BCS A;  5J0T A;  5KFY A;  4YXJ A;  5L9X A;  1SV0 A;  3DEE A;  4UAT A;  4DS4 A;  4HYK A;  1F5S A;  5KFF A;  3PNC A;  4PPX A;  4QZE A;  4MEX A;  4IS7 A;  4P0Q A;  2Q4T A;  4FBU A;  5KG6 A;  3GV8 B;  4I2F A;  8ICA A;  4FE3 A;  5KG7 A;  4I2C A;  2EQY A;  2OEH A;  3ZD9 A;  4CE6 A;  3AQE A;  2DPJ A;  5KT2 A;  4C8O A;  5KFH A;  4BJQ A;  4GIB A;  4RQ6 A;  4DF4 A;  2Z7J A;  4DQR A;  2WF7 A;  3TAP A;  4UBC A;  7ICP A;  3TAD A;  2YX8 A;  3E2E A;  2MA1 A;  4MF2 A;  1DGJ A;  2HSZ A;  4KN4 A;  4DLE A;  4M2Y A;  5J8Y C;  5KG3 A;  1BNP A;  4C8L A;  3IHQ B;  1JRO A;  3V72 A;  4O5C A;  7ICO A;  4KLF A;  1V9P A;  1ZRM A;  3I1Y A;  2D8C A;  3HKZ C;  2YN4 A;  2MAX A;  2ISP A;  4WJ3 B;  9ICH A;  4KLD A;  1BPZ A;  2LM1 A;  3EW9 A;  3SEN A;  1PK1 A;  2F3N A;  2ASJ A;  4UAR A;  3FYH A;  1WWU A;  1BPX A;  4NLB A;  3G6X A;  1ZQF A;  1JX4 A;  4IL6 U;  4O3O A;  3D2Q A;  2YB1 A;  1BVS A;  3WKE A;  5HNK A;  5DB6 A;  1XSL A;  3PZP A;  1Z19 A;  1RG6 A;  4M9J A;  4YVZ A;  4Y2Y A;  3BJY A;  4ECW A;  3EPG A;  5EE9 A;  3WKB A;  3EZ5 A;  2FPL A;  5J2B A;  3KHL A;  2DL0 A;  2EAO A;  1RYR A;  5KFL A;  5DBA A;  3RTV A;  3AU2 A;  1EXN A;  1J2N A;  3TKA A;  1JUD A;  4EBE A;  5KFR A;  1O03 A;  2E8M A;  1ZQW A;  4Y2S A;  4FZM A;  3N97 B;  5CJ7 A;  1N2X A;  5KTQ A;  1RZT A;  3AMZ A;  4P0P B;  2F2A B;  4DQI A;  4FS2 A;  5KFV A;  9ICF A;  5AI4 A;  2D6F C;  5ALF A;  4QZ8 A;  4O5K A;  1ZD4 A;  2FI1 A;  2A1J B;  1ARO P;  4O3M A;  4M04 A;  5ALX A;  5KAF U;  5EWE A;  2WB1 C;  3WK9 A;  4JUZ A;  3J81 j;  3L5K A;  2G0A A;  1ZQA A;  1UT8 A;  4ECX A;  1X9X A;  1Y88 A;  2HHW A;  2EZX A;  4TUS A;  4PHP A;  2C2E A;  2JHD A;  4YXM A;  3ETL A;  2PFO A;  4I27 A;  3ISD A;  2JH7 A;  4Z6C A;  4MHV A;  4JV1 A;  2D3D A;  4OJP A;  5KT5 A;  3NRW A;  4QIW C;  5G5G A;  3OSN A;  2DF4 B;  2VA3 A;  4MFA A;  4AYB C;  2G5I B;  9ICT A;  3QNM A;  4NLG A;  2KIV A;  2NRV A;  1ZD2 P;  4DOA A;  4K4I A;  2M9N A;  4XRH A;  3KBB A;  1FIQ A;  4EBD A;  4J9O A;  4FBT A;  5KG4 A;  2KJ8 A;  8ICY A;  3T5K A;  2Y1J A;  3ONN A;  4LZG A;  2KOB A;  8ICQ A;  2G06 A;  2MUT A;  2BZF A;  2P6R A;  5KFN A;  3B0X A;  5TZV A;  1A77 A;  4RNN A;  3RJI A;  8ICT A;  2FDR A;  1RQN A;  4RQ4 A;  4JMU A;  1FO4 A;  4UB1 A;  1KFD A;  1PVR A;  1T8E A;  1S9F A;  2OCE A;  4KLT A;  5HHI A;  1CI4 A;  1T3Q A;  2LPE A;  4YR3 A;  2KG5 A;  4OJ5 A;  1QQ6 A;  1U9L A;  4M9L A;  4R66 A;  4I2D A;  1HJP A;  4J9R A;  4ECU A;  4RQM A;  1XNS A;  3N28 A;  2LYB A;  2PFP A;  4UAY A;  3PST A;  9ICM A;  2NRW A;  2C2D A;  1Q3U A;  1OUQ A;  4F93 B;  3M6Z A;  3I28 A;  1ZQR A;  3H0R B;  2I9G A;  3BZK A;  4Y2T A;  3GII A;  2ZXH A;  1WYG A;  3GFK B;  4KIT B;  5IIL A;  5HHH A;  4TUQ A;  2E1E A;  2YMQ A;  3BS5 B;  5ALG A;  2JZB B;  1Z00 B;  5AM4 A;  1U4B A;  4KLO A;  1KDH A;  2HBL A;  1DOQ A;  1ZQB A;  2AGQ A;  3NAS A;  1QSY A;  4YMM A;  1MN8 A;  5DBB A;  3MGV A;  4Y2V A;  3KHR A;  4GFJ A;  3UPQ A;  3MAB A;  4F4X A;  1NNL A;  3OJS A;  3C2M A;  5KFE A;  1KLN A;  8ICO A;  4GXJ A;  3GIJ A;  3MGI A;  2EDU A;  3MR2 A;  4RUA A;  5AI5 A;  3V7L A;  5J2D A;  2HBJ A;  4NLC A;  4EZ9 A;  3QXG A;  4DQS A;  1RYU A;  2KEY A;  2AU0 A;  4F8R A;  3ZI4 A;  4NL9 C;  4PHA A;  1JI7 A;  1RYS A;  2I5H A;  2V4Q A;  3Q8M A;  4QZA A;  3JPP A;  2W8K A;  3A0H U;  5DDY A;  1BPY A;  3EUB 2;  3G6Y A;  4ED0 A;  5J0U A;  7ICR A;  4B9N A;  1UT5 A;  2YMP A;  2E8N A;  3MDC A;  3M9M B;  4ECY A;  2AGO A;  8ICW A;  7ICE A;  1KN5 A;  1L3V A;  2H3Q A;  1S5L U;  2IHN A;  5TIS U;  2VJ4 A;  2VA2 A;  1IG6 A;  3V7K A;  2W9A A;  2C2R A;  2R8G A;  3F2C A;  3KKA C;  3QUQ A;  1TVA A;  2YQE A;  4BWM A;  4Q8E A;  1ZQD A;  2K4E A;  5KFJ A;  4Q8F A;  3H0M B;  2J6T A;  3Q8R B;  3H8M A;  1URJ A;  5AM0 A;  3CNH A;  1ED1 A;  2ATL A;  4OJL A;  3PW7 A;  2KJ5 A;  3AM9 A;  2XI9 A;  3MC1 A;  3OSP A;  2DUY A;  2ES6 A;  4RU9 A;  4BXO B;  2JR5 A;  2P66 A;  3PY8 A;  3THV A;  3H8S A;  2KE7 A;  3UMG A;  3NVV A;  5AKI A;  5DQI A;  2ZIX B;  4CNQ A;  4RNM A;  1U48 A;  1ZQJ A;  5J2E A;  5AKX A;  4YFK A;  1L3T A;  5J2K A;  2KKP A;  3BQ1 A;  7ICQ A;  5EOZ A;  4DCC A;  3SMV A;  3I76 A;  2LYA A;  5H2F U;  5DB9 A;  5AKY A;  7ICJ A;  3Q8K A;  4QWC A;  2HBK A;  3MR3 A;  2K8B B;  4JK1 A;  5JTI A;  3WKD A;  3T5H A;  2Y9T A;  3H40 A;  4Q44 A;  1V38 A;  5AK3 A;  5AM1 A;  1MQ3 A;  1ZQS A;  2H3V A;  3NVY A;  4RQ1 A;  2XGQ A;  4R65 A;  1DRG A;  2FMP A;  2F8K A;  4Y2P A;  2LM4 A;  2ZIV B;  4YG2 A;  1UQV A;  2K89 A;  2QB0 B;  1OW5 A;  3SZ2 A;  1L5U A;  3UQ0 A;  2HHQ A;  2KK0 A;  1KL9 A;  3WK5 A;  2LHT A;  3OJU A;  4NLK A;  4J9N A;  4CDG A;  4Y2X A;  4I2G A;  3PR5 B;  2QKQ A;  2W43 A;  2G07 A;  4J03 A;  1NKE A;  1RQL A;  4QZ9 A;  2HHX A;  4UB6 U;  2B0C A;  4DSE A;  4YCX A;  1L8O A;  2PMZ F;  3F53 A;  4DS5 A;  8ICK A;  5IIK A;  2PI4 A;  4I2J A;  3BDP A;  1XU4 A;  4QNL A;  1ZQZ A;  1SKS A;  8ICF A;  3L4P A;  3D6J A;  4O3P A;  4RT3 A;  2K8C B;  3KHH A;  4UBB A;  5AKJ A;  4KLI A;  4G3I A;  1KEJ A;  4A8E A;  4ELU A;  1L6N A;  3KFU F;  7ICT A;  2R8K A;  4EX6 A;  4F4Z A;  3PW2 A;  1SWW A;  4GLX A;  3NRZ A;  4NXZ A;  2HVH A;  2BDP A;  1YZ7 A;  1Z1V A;  5EWF A;  4Y2R A;  2HVI A;  2GLE A;  1DK3 A;  2IOH A;  5KFS A;  3RAX A;  2BCQ A;  1BNO A;  4GC7 A;  3FDS A;  4NJ8 A;  5DDM A;  1ZRN A;  3WKC A;  2IOF K;  8ICH A;  4KLL A;  1S76 D;  5AM2 A;  1BGX T;  2ESE A;  4B9T A;  1TK8 A;  1SV4 A;  4FFD A;  2ZJ8 A;  1A0P A;  3NGD A;  5KFX A;  3ISC A;  2HW3 A;  2Y0S C;  5BPC A;  4DFD A;  2K4P A;  4DO9 A;  1HEK A;  3QZ8 A;  4ZH4 A;  3O0F A;  1JXL A;  2KIW A;  2E1F A;  8ICE A;  9ICG A;  1RPL A;  1ZQV A;  4XUS A;  4UB2 A;  3RJJ A;  3GQC A;  9ICL A;  1B43 A;  4GXI A;  3GV7 B;  4YQW A;  1ZQE A;  5EE1 A;  3NUQ A;  7ICN A;  5AM5 A;  1L7M A;  3ICX A;  5J0P A;  9ICK A;  1DGS A;  3F2D A;  4F92 B;  3IP4 B;  3BQ2 A;  3QU5 A;  2UVU A;  1MC8 A;  2NV3 A;  4YD1 A;  2NRZ A;  2W9C A;  1FFU A;  3Q8S B;  1Z4N A;  5ALP A;  5KFU A;  4QWA A;  2WAQ F;  3VC8 A;  2BCV A;  4P2H A;  4QZG A;  3UM9 A;  2YY6 A;  3T79 A;  3F5E A;  3ZDC A;  4X5V A;  3V7J A;  2EAP A;  1XO0 A;  4CF3 A;  2F1I A;  5T14 A;  1UCV A;  3GIL A;  2GO7 A;  2A1A A;  2XC9 A;  1V85 A;  4NY8 A;  5J2F A;  3Q8Q B;  1L3S A;  1ZQC A;  4DSF A;  3V6H A;  4EEK A;  4NLZ A;  5DBC A;  5DQG A;  1QSS A;  5J0R A;  2I1Q A;  1CUK A;  2G09 A;  4DFP A;  2LYH A;  4B6J A;  9ICA A;  4I2E A;  4IC9 A;  4FO6 A;  1NJX A;  1N5W A;  4US9 A;  4TUP A;  2BGW A;  5D49 A;  1D9D A;  3M9N B;  4B9M A;  5KFW A;  2ZJA A;  2DGZ A;  3FAH A;  3MFH A;  5ALV A;  4RQ3 A;  1QSL A;  2FMS A;  2G08 A;  3Q8P B;  5KG5 A;  2BPC A;  2JGA A;  1KFS A;  5D46 A;  4MF8 A;  3MR6 A;  4J9K A;  4QW9 A;  5KFT A;  5AKE A;  3WK7 A;  4QZF A;  1ZQK A;  5J0W A;  1N56 A;  2E8O A;  1XSP A;  1KSP A;  2R8J A;  1NK4 A;  9ICV A;  2XO7 A;  1ZYQ A;  1XWL A;  3C1Z A;  5JRT A;  2WF9 A;  3HRD D;  1YT3 A;  1NJY A;  2FMQ A;  2HCF A;  5AKH A;  2PI5 A;  4ECR A;  4DL5 A;  1SGG A;  5J8Y A;  2ISO A;  5ALY A;  3EPI A;  4ED1 A;  4DF8 A;  5DGA A;  2B21 A;  8ICI A;  5B5E U;  5HP4 A;  4YN4 A;  2LKY A;  2Y1I A;  4OD0 A;  7ICI A;  1COO A;  4CF5 A;  4P0Q B;  5ALS A;  3HW8 A;  4PZN A;  8ICB A;  4Q45 A;  1BPE A;  2KKV A;  5DG8 A;  3RAQ A;  1ZQT A;  5ALK A;  5KFQ A;  4EX7 A;  1SIJ A;  9ICE A;  1KQQ A;  3BS5 A;  1N62 A;  2JZB A;  4E0D A;  1ZQ1 C;  2KNJ A;  2JH1 A;  4KMU A;  2V9W A;  2W3R A;  5C5J A;  9ICQ A;  4DL4 A;  4Q43 A;  1SL0 A;  1TV9 A;  1A6S A;  7ICS A;  2CXY A;  2XCP A;  3HWT A;  2K4I A;  4F5N A;  3RJF A;  1K5O A;  1O08 A;  5KG2 A;  2R18 A;  3RB6 A;  1IIP A;  2JXJ A;  2XVT A;  3K1R B;  4Y2Q A;  2ZIU B;  1X6J A;  3R9K A;  3MR5 A;  4EZ6 A;  5F9N A;  3SAH A;  2NRT A;  4YMO A;  4FZN A;  2HHV A;  5III A;  4ECT A;  5AIB A;  4K4H A;  2V4R A;  1PVQ A;  5J2I A;  1TFR A;  3NVW A;  1RDF A;  2W04 A;  4RQ7 A;  3H7I A;  5KT7 A;  1C7Y A;  3PX6 A;  5KFM A;  2OXO A;  4EEN A;  1NKC A;  4MEY A;  3FM9 A;  4UAZ A;  4YR2 A;  4OCZ A;  3NVZ A;  2JMG A;  3AEV A;  4LVS A;  4OJ6 A;  4JWM A;  4RNO A;  5KFP A;  4IQV A;  3HP6 A;  1DK2 A;  2FPK A;  3RH4 A;  5AK6 A;  5KT6 A;  2ALZ A;  2BR0 A;  1RXW A;  5L1K A;  8ICR A;  3PW5 A;  4CF4 A;  4G9B A;  3TQ1 A;  4M0A A;  4FS1 A;  4B9S A;  1ZD3 A;  2DBY A;  4ZOH C;  2ZIW B;  2GWS A;  3ZDA A;  3KOO A;  5DB7 A;  4JWN A;  5IIJ A;  1ZJM A;  2ZG6 A;  4U7C A;  5KL1 B;  3HIL A;  1HIW A;  4YP3 A;  4PGY A;  1CRX A;  4C8M A;  2VIX A;  2HHU A;  3QUC A;  3D2N A;  2OHF A;  3HX0 A;  4MFF A;  2XGP A;  3PSI A;  1ZQN A;  4QWD A;  3K4G A;  2IA6 A;  2KV2 A;  3GV5 B;  1P7D A;  3M8S A;  5J29 A;  2ZUB A;  3PML A;  3DDH A;  2OYY A;  8ICZ A;  1TK5 A;  2BCR A;  1U49 A;  9ICS A;  4RQ2 A;  4I2A A;  4J9Q A;  5AI9 A;  3KTQ A;  3N7S C; 
#chains in the Genus database with same CATH homology
 3A0B U;  2AXT U;  1S5L U;  4PJ0 U;  5B5E U;  5TIS U;  4IL6 U;  4UB8 U;  3WU2 U;  5KAI U;  5E79 U;  3A0H U;  5B66 U;  5GTH U;  5KAF U;  5GTI U;  2DUY A;  3KZI U;  4UB6 U;  5H2F U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...