4CF3A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACAIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 85
structure length 224
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf3A01
4FYPA 5AI6A 3R4CA 2JGAA 2I55A 2YMPA 3EPRA 4F72A 3AR4A 3QU9A 2FPXA 3OCVA 5AVQA 3WKBA 1S8OA 5ALFA 5AI4A 4BX3A 1F5SA 3KOOA 4UMFA 4Y2XA 4Y2UA 4G9BA 1RMTA 1YJ5A 4C4RA 4J2TA 3ZX4A 1T5TA 3OTQA 2D2VA 2O2XA 3AR8A 4NAVA 2ZOSA 5AVSA 3DNPA 3WKDA 2HI0A 3NANA 3IB6A 3N28A 3IRUA 4J03A 3ONNA 3ZVMA 4UW9A 1RLTA 5AKIA 1QYIA 2G09A 4UMDA 3QU5A 1ZS9A 3B9RA 2G1AA 5AM3A 3F9RA 4BNDA 5AKHA 2EARA 3ESRA 3WGUA 5AM1A 3U26A 3PCTA 1ZOLA 3WK6A 2WF9A 3N07A 5A3SA 2FPRA 1N8NA 2FPSA 2FPWA 3ZWKA 3U7HB 2EATA 5AKZA 3U7GA 2CFTA 2ZG6A 3SD7A 4DWOA 5ALKA 3U7EB 3E8MA 1S2OA 3W5BA 3UM9A 3ZI4A 3A1DA 5ALEA 4G63A 2IYEA 3QU2A 3NRJA 1X42A 5AVRA 4Y3UA 4HGRA 5AW7A 1EK1A 2ZBGA 2RAVA 1KYTA 4UM5A 2AMYA 3FPSA 5ALZA 4GIBA 3RF6A 3UMBA 5AICA 3DAOA 4NFLA 2AH5A 2YMMA 2YJ6A 3WKAA 4EX7A 3L0CA 3OCXA 1K1EA 3UMGA 3ED5A 3PGVA 3B8EA 4YGYA 5AVXA 1WVIA 2WF5A 2B1QA 2MU2A 1ZD3A 2YN4A 4Y2YA 2CFRA 4EZEA 1RKQA 3WKCA 4UMVA 5AI5A 5AKYA 2R8XA 5AW4A 2HDOA 2FUCA 3KBBA 1QQ5A 2W43A 2FUEA 3J7TA 1Z4NA 4AP9A 3BWVA 4XPZA 3MMZA 2ZBEA 1Z5GA 3QYPA 2EAUA 3UMCA 3SHQA 3W5CA 2GHQA 4YCMA 1LTQA 3MC1A 3N8GA 4KNWA 1ZD4A 3QUTA 5ALSA 2P9JA 5AM5A 1Z4KA 5AKKA 2JAWA 4EENA 4OCZA 2IOFA 3HLTA 1T5SA 3U13A 2YMLA 1EK2A 2PQ0A 3A1EA 5ALLA 5IT0A 1Z4MA 1Z4QA 1TJ3A 4C4TA 3OCZA 3E84A 2JARA 2HF2A 1WPGA 3L8HA 3A1CA 3L8FA 2IOFK 3R09A 3ZUPA 2FI1A 5ALHA 2WF7A 5A3RA 2VKQA 1ZJJA 4UU1A 5AW8A 2OM6A 2O9JA 1T9ZA 3NUQA 4MUMA 5ALNA 1Z4LA 2ZXEA 1RQLA 4BX0A 2B1RA 5ALGA 4XQ0A 4AS2A 2HHLA 4KNVA 2NO4A 4F71A 2MU1A 1O03A 5ALOA 2YY6A 1TJ4A 3PGLA 3ZU6A 3EF0A 3WK7A 3I1YA 4CF3A 4Y2JA 3L1VA 1CR6A 4IG4A 5AM4A 3NALA 4BEVA 5AVZA 4KN8A 3DV9A 2RARA 2QYHA 1U02A 3QXGA 3WK8A 1RKVA 4OD0A 4Y2TA 2OYCA 5ALJA 3SLRA 1RLMA 1Z4OA 3I6BA 4QJBA 3OCUA 2HSZA 3FGOA 4BBJA 5AHXA 3L7YA 5E0OA 1L6RA 3BA6A 1YMQA 3KZXA 3ZVNA 2ZBDA 4HGOA 2YJ3A 5AKGA 2YMQA 3QGMA 2ODAA 1L8OA 5AKJA 3ET4A 3N5KA 1XP5A 5AK3A 2YJ4A 4BYGA 5ALVA 4UAUA 5A3QA 5AM2A 2B0CA 1J97A 1ZD5A 5IS2A 2R8YA 1L7MA 3W5AA 3KD3A 4Y2SA 5ALPA 1YNSA 1Z4PX 3NASA 4CE6A 3VAYA 3ZX5A 2I7DA 5T41A 2C8KA 1YV9A 3MPOA 1L8LA 2AUTA 1L7PA 5AW3A 1L7NA 3OCWA 1RMQA 3L5KA 3AR9A 4HGPA 4NABA 4UATA 1VJ5A 1NNLA 3AR5A 4HGQA 5JJBA 2FPUA 2ZBFA 2JAUA 1FEZA 3AR7A 3QLEA 2C9MA 2B82A 4FE3A 3EF1A 4H1WA 3SKXA 4C4SA 5ALIA 4RETA 1RMYA 1Y8AA 3NAMA 4ZEXA 4YCLA 1ZD2P 5ALMA 4HYTA 4YCNA 5AW2A 4PNHA 2HEGA 3IJ5A 2R8ZA 3OPXA 3WGVA 1JUDA 4BEWA 2HCFA 1IWOA 2G80A 3L8GA 5AW5A 4EEKA 5IT4A 4UU0A 3FPBA 2P27A 1YS9A 4XE5A 4E88A 2Q4TA 1U2SA 1PW5A 1VFPA 3U19A 3E81A 3NIWA 3ZTYA 4I9FA 4JDPA 4CF5A 3ZTWA 2C8LA 3L0YA 3R9KA 1J8DA 4XOUA 5AVTA 1Q91A 3EWIA 4OFZA 2G0AA 3OCYA 5AI0A 4BNDB 1RPZA 5AM0A 1U2TA 4CF4A 4L6CA 4B6JA 1CQZA 4UASA 3I76A 1RRCA 2C4NA 2HO4A 3QX7A 3SF0A 2OA0A 4RESA 5AW0A 3QU7A 3N1UA 4GXTA 3KDPA 2GHTA 3E58A 4IFTA 1U7OA 5AW9A 3P96A 1QH9A 5ALQA 1YDFA 2JAOA 1WR8A 5ALWA 3ZW7A 3L8EA 1TA0A 4UAVA 1TE2A 3FM9A 4Y2QA 2G07A 2PR7A 3HYCA 4HGNA 3TLMA 5AKXA 5AI8A 4FFDA 2P11A 2AGVA 3MN1A 4NWIA 4JB3A 4YH1A 1QQ6A 1Z88A 3PDWA 1NF2A 2W4MA 3FVVA 1RQNA 1SU4A 2GMWA 1XVIA 4DFDA 4O8CA 4CNQA 4UMEA 2RB5A 3FZQA 3KC2A 3SMVA 2G06A 3AR6A 3ESQA 4EX6A 5AVUA 4EELA 1SWWA 2HOQA 4BX2A 1XPJA 2I33A 3QUCA 2HF7A 4Y2VA 4ZEWA 2C88A 5AIAA 3I28A 3WK4A 2WF6A 5ALXA 1WZCA 5AK5A 3ET5A 1MH9A 2BDEA 2Q5EA 3L1UA 4UARA 4KX3A 5AK6A 2I34A 4ZEVA 5AKEA 5AVWA 4Y2PA 3L0BA 1O08A 2QLTA 2NYVA 2BDUA 3M1YA 3WKEA 3GYGA 3QU4A 4KX5A 2X4DA 5AW6A 2FEAA 4BKMA 2FDRA 2IOHA 3S6JA 5ALUA 4HAIA 1RKUA 4DCCA 2B8EA 3WK5A 1TJ5A 4KYTA 2R8EA 3RFUA 2I6XA 1Z5UA 1ZRMA 3U7FB 2YJ5A 2GO7A 5AW1A 2W11A 2CN1A 4MWOA 2B8JA 3K1ZA 4UM7A 4L57A 2OBBA 5ALRA 3B9BA 4L6AA 2I54A 1Z4JA 1SWVA 2P69A 5AVVA 2WFAA 3QUQA 2GFHA 1Z4IA 5AVYA 2BY4A 2MSNA 3M9LA 4DW8A 3QNMA 1QQ7A 1N9KA 4AS3A 1LVHA 4YIHA 3AR2A 5AIBA 1L7OA 5FP0A 2NO5A 5AI9A 2WM8A 3ZWDA 2Q4RA 1Q92A 5AK4A 3W5DA 3CZ4A 5ALYA 3SKYA 3A3YA 2IA5A 2WF8A 4OHFA 3AR3A 4NV0A 4YIKA 1ZRNA 3QUBA 1NRWA 2B30A 1RLOA 4QQFA 4I9GA 2PKEA 5AKLA 2G08A 1AQ6A 1VJRA 2CFSA 2DQSA 3D6JA 5ALDA 5ALTA 4Y2RA 1U7PA 2YFYA 2YBDA 3ZVLA 3WK9A 2RBKA 3DDHA 2HX1A 1RDFA 3CNHA 5AESA 1RC8A 2WHEA
chains in the Genus database with same CATH superfamily
3IQHX 1RHMA 1DZ3A 5JNVA 3FSRA 4DCJA 2GZDA 3F5QA 4Q02A 4JNKA 1M3SA 5BRNA 4RD3A 4DWVA 1CUDA 3DVLA 3O3OB 1YJ5A 2NUAA 3OU7A 4ECUA 2NU9A 1YZKA 4XJSA 4DMCA 4MFCA 3OT5A 4I7EA 3HSKA 4B35A 1EXMA 2O2SA 3OFKA 5B6PA 1ZZGA 1RRPA 1RLTA 3CHYA 1X7ZB 3PGA1 3PSPA 3R5SA 3WLEA 3C7AA 1SHUX 1SCAA 4G4JA 3LU1A 1XRLA 2UYCA 2WF9A 3A25A 4OP2A 3KFLA 4HFMA 3VTFA 2NXJA 4QZDA 3PYLA 1ZU5A 1WDWB 3GRYA 3KKOA 5FUBA 2YHAA 1OZGA 4GIBA 1XCLA 2WT8A 4TWIA 1D4FA 3MGBA 1MAAA 3O4GA 2IWHA 4DWJA 3A4VA 3FR8A 1OT3A 3DTNA 2ZE5A 3BJYA 1OZ0A 5IU6A 2O14A 4TV8F 4BMYA 5BSHA 4WBNF 5DWVA 2PRJA 3QE0A 4K7JA 3ZDXB 3W3AA 4UM9B 1KYIA 4MLZA 2ZRFA 1DELA 5IAKA 2FW0A 2EZTA 4UNNA 1PFUA 4Y0AA 4E5NA 1F1BA 1X9WA 4MUHA 3IA2A 3FOAA 1ACMA 3M4NA 4TVOA 2WDPA 4QXQA 4D8WA 4B8ZA 2E4VA 3T35A 5JR3A 1X1CA 3KWLA 4I5GA 1ZH2A 1JLLA 2ODBA 4R2IA 2HU5A 3GGJA 1OLSA 5ES3A 3KLNA 1S0VA 2GHRA 5C81A 2DLDA 2ONJA 2QYOA 3JPNA 4KMSA 3ZDZB 3TIGA 5KNBA 1N61A 3VTKA 4JKIA 2KMDA 1TMOA 5CLJA 3F73A 5JVDF 2HQSA 4OD0A 3IQEA 4BE4A 4GL2A 2A8YA 1JPVA 3P0RA 4G0ZA 2WE8A 3GJSA 3U3KA 1OGIA 1Z74A 1X80A 2W6QA 4UAUA 4IS7A 4GX2A 4YDHB 4YCXA 3KEQA 2XT9A 3I9NA 1WUIS 2WA1A 4WADA 4OBBA 2YVLA 2Y9UA 3FTEA 1O5OA 1ZCBA 3BS4A 4YV2A 4ER5A 4PQFA 1XMXA 1J0BA 3S2IA 1QGUA 1VJ5A 4AAYA 5F9MA 3OUZA 5KT4A 4QGSA 1XAHA 3WQBA 1UOEA 4L9RA 4JP1A 1T5HX 2FVYA 3HH8A 2QD3A 2VR1A 1WS6A 2N9UA 4MKZA 3FPBA 1N60A 1FNCA 1YS9A 4IVRA 1I2ZA 1ZHHA 3HKEA 3QOXA 4I2JA 3I01M 5EIFA 4L9SA 4UTVA 1AKNA 1W6UA 2C92A 3MD9A 4I3FA 3AHIA 2KP7A 2ERYA 2WT9A 1LBTA 5DIFA 3JQEA 1SD5A 4YJ3F 5C1IA 4Q8EA 1EX1A 3DZJA 1QKKA 1U2TA 1HORA 4FSHA 3KXKA 4QT0A 3D9QX 1Z6XA 1U8YA 5ERYA 3DMGA 3LFHA 2H2DA 1FMTA 1BGWA 2WZQA 2X9VA 4OB8A 1GILA 3QF4A 4MEYA 3F6EX 4WFJA 1FVHA 7REQA 4FFOA 1PR0A 3STVA 1D2RA 2H1VA 2WU8A 4MR9A 4HAOA 4DGSA 4JB3A 3TLGB 1Z88A 2G6BA 1M8KA 2Z9CA 1TC2A 4QQ8A 3KC2A 5JPDA 3WIDA 1E3WB 2H2WA 1US8A 3WNDA 2JK1A 2R18A 1OILA 5CPBA 1ZIYA 3RABA 1DAEA 4ENQA 1SXPA 4BZQA 1AF4A 2NV6A 3G88A 1JT9A 5T64A 1HTTA 1X8XA 1QGYA 4CLOB 1BCRB 1PLKA 3FLAA 4UFPA 2H9AA 4IC9A 4L8YA 1JEQA 2LKCA 5JH7A 1I4WA 1VSQA 2BM0A 1AV6A 3UJ8A 3CLSC 3B9QA 2JCBA 3KWFA 4C43A 2WTFA 3ENNA 3MOIA 2HSWA 2PUCA 4NV0A 1WVMA 4MWGA 3O5AA 1OOEA 1I1OA 4S1VA 3C3YA 5LQUA 1SBIA 1PWHA 1VYHA 4RPCA 4JBYA 3GY0A 1SCQA 4YR0A 1IBLB 2PN1A 3L1JA 3IPXA 4JB8A 3ZGXA 3IKLA 4BGEA 5M5BA 3BTUA 4RS4A 1UDRA 3ASYA 2P9ZA 3PEUA 2P3SA 2CF6A 3WKDA 2NYUA 4OJTA 1RXIA 3IRUA 1VLZA 5G3ZA 4LKOA 3AF3A 4NAHA 2CFCA 4WZZA 1PQUA 3PNKA 3U1TA 3BS7A 4C0ZA 1NKCA 3QSGA 1VKHA 4DEXA 3ZXXA 2DKFA 1V5EA 5F3DA 4F97A 3IDQA 7YASA 1I5OA 3TBHA 1SXEA 3H9JA 3R5HA 1M7GA 1R0WA 2VO1A 4KSYA 4B9SA 5HBRA 4DJ5X 1WF6A 1PUJA 4FYMA 4YMMA 1TM3E 3THXB 3TQHA 4AG5A 4XSHA 3LYHA 4YAEA 5TPWB 1DKUA 4WZ6A 2ZVJA 5AVXA 3FDJA 3GLFA 3W6UA 3BSYA 4KQMA 2V1UA 4NZYA 2H7CA 4WLOA 2XGOA 1YR6A 4Q03A 2GCEA 2DBRA 4UREA 1E7YA 3N7PD 3FMPB 1VZ3A 3HKBB 4PCAA 3BSFA 2Q50A 1J2JA 2VJMA 2LWIA 2H59A 2D8CA 2CNDA 4WOKA 2VNHA 3KYCA 2RDJA 3STXA 1SXJE 4XGQA 3DTYA 5HJ7A 3OF3A 5DBOA 1ZI6A 1V8PA 2PJRA 1ECCA 3CRNA 1PJTA 2VRCA 3H4BA 1RBZA 1L9XA 1JQLB 2VSQA 4RZHA 4DM3A 4DWWA 4ZTUB 3ZKWA 1Y4ZA 3CNLA 5ELLA 1Z4LA 3C1OA 3WIUA 1BAPA 4TQAA 2VUHB 4ESHA 1L4NA 3PGLA 3SNKA 2A1TS 3FOCA 2W6IA 2IE8A 3RIMA 2OXEA 3I45A 3GRAA 5H02A 3UUFA 2CCJA 1GSAA 2N1BA 4M9GA 4JKYA 2IUSA 1CETA 2C84A 4A6XA 3R0ZA 4G5QA 3PDHA 3WO1A 3CWZA 3X1WA 5IKEA 4CIVA 4FFMA 2NYRA 1ZD5A 4MYDA 1ONNA 4CG2A 4L74A 2XI9A 3QKWA 1LDYA 2GZ1A 1U65A 1AKMA 3NLLA 4RPLA 3GFTA 2CKMA 2RP5A 5E7JA 1YS1X 5KEIA 3E1SA 2FZ4A 3TO5A 5AW5A 4ZI2A 5J1TB 5HUHA 1PSDA 3PQ7A 2E18A 1GVHA 4QYSA 3RS7A 2X13A 5KG2A 2C1EA 4NHEA 5KSPA 4C9BA 4JLWA 4HQ0A 2Y9PB 5DSXA 3L0YA 2CDCA 1ECFA 3CEAA 4LVOA 2FW8A 3KDAA 2KZZA 4PPQA 3ISDA 5SYNA 1SEPA 1TM7E 2ASLA 4Y6GB 4QM7A 3E58A 2FSHA 1E1KA 2PEZA 3UHJA 3V6KA 1FQWA 2V98A 4HGNA 3KZCA 5AKXA 1T7PA 3O47A 2IU3A 3GP3A 4TMTA 5G1OA 3AVTA 3QMVA 5BYKA 1X66A 2JDID 5I9LA 2Q6LA 4C06A 2COUA 4PLTA 3MJ4A 4XUEA 1EVLA 4XVHA 2JH9A 1OXVA 3ROXA 2TECE 3NETA 4W5HA 4I8XA 3EIFA 3QX9A 1Z38A 4RTOA 2XYGA 1XYVA 3TZCA 2PV7A 4LMPA 3AESA 1NVTA 2W6ID 1TQ6A 4X8OA 3RPEA 4Z86A 2ZJ5A 2XOXA 4KVGA 3UA4A 4UHKA 4O4IA 1J8YF 3GCWA 1KFEB 1XDUA 2EDCA 4OB7A 2DHEA 2PBFA 1L5HB 2UDPA 3W9UA 1JJFA 3RNOA 2QF7A 3GFOA 1UBJS 3Q3EA 4CG0A 4QNLA 4ZCPA 1C9KA 4FGWA 5B30A 1C2TA 2ZB4A 2DETA 4IQVA 1RDFA 2H48A 3IMFA 4FS8A 4X41A 4GEKA 3DT9A 1SIOA 4CM6A 1DAHA 3VHQA 4FC7A 4E5PA 1ZGZA 4FMDF 2EAPA 4PGYA 5H4HA 2P5UA 1ZWLA 1MJHA 2B9EA 3F1LA 1GUDA 5DCLA 3AY3A 2Y76A 4EGQA 1NG1A 3PJDA 2RHWA 4YEDA 4PYLA 2PFKA 1U1CA 2NO9A 2ZRBA 1UWVA 1X9MA 1PL7A 3F4LA 1RD4A 3NVZA 1VG1A 4ETIA 4DB4A 1E2EA 3OI7A 3HHPA 2AVDA 4G63A 3H0EA 3NHFA 5BT9A 4UM5A 1OWNA 2E2WA 3U3DA 2ZT7A 3UT0A 3GLGE 3NJ4A 4KQFA 4RJ2A 4FBGA 3LRTA 2YRWA 4F4UA 2VAMA 2ORED 4UZEA 3D2QA 4YJFA 5EE5B 2F1IA 3SYRA 3VVCA 4UMVA 3INTA 2W2XA 5AI5A 1LPAB 1VDMA 3KBBA 4JL6A 1EH5A 3LD9A 3T0IA 3SHQA 2XR1A 5HR6A 1FCJA 4PLFA 4F11A 2UVUA 2I6QA 2PX3A 2WAOA 3ZD7A 4NONA 1G7TA 3WL8A 3BAZA 5M3BA 3NEJA 2VWPA 3SFZA 2AD1A 4JD5A 1NDUA 1NF9A 3G0GA 4CR7A 2BFEA 3JAKB 4MYUA 1YJ8A 5HF6A 4EZIA 2K60A 3DKPA 4OUDB 4QUHA 3V3KA 3QOYA 2C7OA 4TQGA 2NXCA 3JPRA 2VBIA 1F2UB 3PC8C 2Y05A 1IXZA 4F3NA 3PR3A 4F38A 2HBZA 4LDZA 5KT2A 1TKCA 2IELA 4EY6A 1P29A 5ULLA 1A8HA 4N4AA 3EWNA 3G2IA 1FFXA 1RSZA 4A8JA 3MTAA 3KQHA 3F9CA 4EZBA 4Y98A 1QF7A 3A36A 1VCHA 3FX2A 1QZTA 3ZX5A 1TD9A 4W5TA 1PT9A 1FXSA 3V1UA 4NBNA 2E5LB 1M0SA 3AP1A 3OLCX 3KJXA 1GQSA 2UAGA 1O96A 2PUAA 4LSWA 3LHKA 1KAGA 4DM7A 2JZBA 4UDXX 4MNTA 4EKDA 4EY5A 2UKDA 4DA8A 2H9IA 3EULA 3UPUA 4KLJA 3JYOA 1T8UA 1RNLA 5EE3A 4JXJA 4EA6A 1KZGB 2WWXA 9ICGA 4XRHA 1MIOA 2CBXA 2A67A 3KXLA 1UM8A 3E82A 3EEBA 3AFNA 1KJ9A 1Y3DE 4WZBA 1MB0A 5LA6F 2R8BA 4BYMA 3OM8A 1LRLA 4LWZA 2DAPA 4TLLB 3TQRA 2B94A 4FR0A 5LYJF 1RKXA 1M5TA 4DQQA 2HUPA 4R71A 4AKIA 4RFLA 2C61A 1L4EA 4M3NA 2AGPA 3VNSA 2ODNA 2ZSJA 3P2OA 2GETA 1TTTA 4A3SA 4X1YB 3FZQA 4Q7MB 4IQ8A 5AVUA 2DQYA 2YTZA 1CF4A 2VCYA 5FD8A 4BQQA 4MVJI 4CKEA 3A37A 1KFKB 5I9TA 4GXRA 4GNRA 1QF9A 2I8CA 4MWCA 4R1TA 1IHDA 3WGGA 4QUBA 1UH5A 3O74A 3FF1A 4HVAA 5JS6A 1RG6A 1P1IA 1Y3BE 2F2TA 2GYWA 1SEVA 2XIDA 1FJ2A 3AHJA 3HR8A 5J5AA 9ICNA 3VV2A 3GLTA 3AINA 2XBUA 2PH5A 1GCUA 3LRXA 2VH2A 1UXHA 4ND7A 3JD1A 1V25A 4OXXA 1DLJA 3AEUA 4N5HX 4XCVA 3Q9SA 3HXLA 4C0SA 3CZ5A 4MB0A 3A05A 3F5SA 4E07A 1EJ6A 2XYHA 1U90A 4U7GA 1GL9B 5KYXB 2Z95A 3O82A 5A1TA 2R79A 1MOSA 3H2YA 5G0VA 2Q6KA 2IEAA 3ILVA 4Z9FA 4EGJA 1RC8A 2BCRA 1P0FA 2BUBA 1KE1A 3ULKA 2YMPA 9ICLA 4B9EA 2NTNA 1LVGA 1VE9A 4F72A 3F8WA 4RV5A 3OQIB 2VP6A 1EX9A 4R2XA 3USES 3VC3A 3PNMA 5BN3A 1DB3A 4G89A 2X6RA 3P1JA 2AJDA 1AGPA 4PLYA 4KLAA 2PLFA 1BJKA 2PLNA 3AVUA 3WK6A 3F7OA 4NCNA 3K70C 3VZQA 2V5VA 5CW1A 1CUAA 3NOQA 3U7GA 2AN3A 4K2HA 4D9GA 3ZXUB 3F2VA 1G5QA 2QTVA 5CFLA 2KFZA 4KR7A 1V5FA 3G6WA 3O8LA 4C0BA 3Q98A 3UGKA 1RQRA 4FJ0A 4DREA 2FMFA 3EBPA 1J0EA 2FP4B 2A2ZA 2BFFB 4J29A 3IVCA 3U5ZB 2EZ8A 1EGQA 4LXHA 1BCSA 2RGGA 9ICMA 5K3EA 4MW4A 4FHDA 5JJLA 1ZN2A 3FPKA 3TOVA 3GA7A 3IEKA 3DEZA 3EMKA 3H7IA 4BB6A 3P9RA 1UKEA 3D6VA 3QUTA 2FMQA 4MGHA 3CS3A 2CEKA 4OCZA 5EHZA 1RWXA 2J4CA 1ESZA 3QPWA 3VV3A 3HEMA 2JARA 4K6HA 1RXSA 4I2VA 2WW8A 4UAZA 5DFAA 2F59A 1ONPA 2CV1A 4L50A 1PTJA 4OO3A 1XTZA 5G5GA 4BX0A 4F3YA 1JHDA 4PG5A 4XUGB 3OLQA 4N76A 3BIOA 2BEUA 4ZP1A 3PFWO 4H1HA 2HPVA 1V4BA 4CL2A 4RNOA 3VQTA 1S2IA 2XZTA 3SAGA 3G85A 2E1EA 2FWBA 1GPJA 5FPTA 3HVJA 2P2SA 1NE2A 1VYTA 4NL4H 4GVPA 4DAOA 3R23A 5JYBA 3AEQB 3V3TA 3PFNA 5EESA 5TARA 3BF7A 1AUPA 3VU3A 1S10A 1KZ6A 4F2GA 2P5TB 3GEEA 3SLKA 2FW7A 2NO6A 3NYWA 5A06A 1MNAA 2E3JA 1FFCA 4UATA 1YUNA 3RSLA 3HJUA 5ALIA 2JGIA 3O3NB 1JIHA 3DWEX 3SG0A 1CRWG 1ICEA 1Z06A 1OZHA 5DGIA 4A03A 3D4LA 2VSXA 3DT6A 4CMIA 1E58A 2NRTA 1JU9A 3DEYX 3RFCA 3PW7A 1H3EA 4CL3A 4CEJB 3RIEA 4X1IA 2F43A 1QRDA 2V3VA 1XB2A 4PHEA 1DC4A 3BGSA 4EGAA 5HRAA 4PE5B 4TOIA 1Z08A 1ZH0A 5EQDA 2GCNA 4F4KA 4LXYA 4IIDA 1JLKA 1U7OA 5IZCA 3AHGA 4LS3A 4Z6KA 4TYPA 4IV0A 2B8TA 8ICXA 1U4SA 1OTYA 4OSEA 1MPTA 2QRJA 2WU3A 3SC4A 1GOTA 1QHFA 5F2KA 3CWCA 1C9YA 3O7WA 4HDNB 2X2EA 4LK2A 4EB6B 4FT2A 3PHJA 2BI7A 8ICBA 4M86A 2WUWE 2JZCA 2FDRA 3NC4A 2LYAA 1WF3A 4U7PB 2ZR9A 2FWAA 2QLNA 3I0NA 3PRYA 1EM8A 3OT1B 1OBVA 2A5YB 3CNQS 2VNSA 4ZGGA 3TBFA 3ZR4B 4J3JA 2MSNA 2IZOA 4HPJB 3G8YA 4A6EA 1ZEJA 5CXQA 4PFKA 1ZQFA 4JJAA 2OT3B 2FLPA 2KV2A 5HG0A 4ELVA 2XA9A 3LBIA 4MCIA 4F21A 4H9GA 1STOA 1OC4A 2BN4A 4YLGA 5K0BA 4HRAA 4ZQFA 1U9CA 3EPRA 1H1TA 4W5RA 3NIFB 3CIOA 1QUEA 2VJAA 4XGIA 1IYZA 3AC0A 3R3YA 4G1VA 3PEVA 3OZFA 1GUYA 4XD7A 1I3CA 3WU2U 1EP9A 4JITA 4GRDA 3FKSD 4S0XA 1XLWA 2IPLA 1CQXA 3ZNNA 2HJRA 4IWNA 4UTZA 1IJEA 4FS2A 1E1LA 3VH4A 3ANXA 4DQRA 2MHCA 1CUEA 1UZLA 3GIWA 3W5SA 2P4UA 3TUZC 4Z9BA 1C14A 5EUMA 3QZ7A 3MWEB 1GEEA 4KYUA 3LWDA 4PWYA 4OQZA 3KTDA 2X14A 1IQ0A 3OY2A 5BN5A 1DGJA 1LKZA 4G5RA 1SVNA 1HRKA 5K8LA 5BMVA 1LV7A 4R1LA 5EKTA 5NLLA 3UTDA 5ICGA 3UMGA 1E3LA 3QK7A 3VZCA 5ED4A 1F60A 3TAHA 5LMZA 3GARA 3VKUA 3C14C 1KJQA 3H97A 4ROSA 3KT0A 1LRKA 3NOXA 4PLPA 2BTOA 4D9CA 3SYMA 2FJUA 5LKAA 2WA2A 4G5GA 4RJJA 1XDBA 4L08A 4ZYWA 3IQDB 1UMBA 1T1EA 1USUA 4UHHA 3GG2A 3KVRA 4HWPA 1CPYA 3IAM1 1JA9A 2VYFA 4XYGA 1N1EA 4GHWA 3O8NA 1W75A 1TM4E 2GPWA 4FMCB 1KMQA 5JZVA 4MVYA 3EIXA 3WWEA 1PJQA 1H8EA 3ICQB 4R2LA 4LJ6A 2O2GA 2C97A 3OTIA 4JK3A 2GPBA 3I32A 4J94A 2Y92A 5J4HA 2AI1A 4KN8A 1QTMA 1GZ3A 2VI5A 5FA6A 5GMOA 3I92A 1K6EA 2NACA 5B5EU 2QJRA 5KNDA 3SEQA 1J5EB 2GEUA 4B6GA 3T5CA 4BNUA 4C2AA 4XD7D 4JOSA 1ISGA 2OVBA 2XBMA 1OHHA 2ZM6B 5KTSA 4LFAB 3NVWA 4HLCA 4EHFA 3QVVA 3PC2A 2CLCX 2A94A 4BNHA 1DO8A 3N2LA 3COYA 4EG4A 3NAMA 1RZUA 3L02A 1FNDA 3HABA 4BNNA 3CLVA 4I1SA 4NAUA 5AMXA 4H31A 2CVPA 4WINA 4ITRC 3CW8X 3L5OA 3HO6A 3D3NA 1JA1A 1TYCA 4B8WA 1GGEA 3P9QA 4F4HA 1P9NA 3NIWA 2CL0X 3AY7A 4J7UA 4N54A 4PZLA 2W03A 4Q01A 4YAWA 1KZ4A 4TLMB 2Y1XA 3BC1A 1E1MA 1ATIA 3SK0A 4DO9A 4IGAA 4FUQA 2HADA 1FJGB 3E7XA 2CYCA 1BGVA 1L5QA 2UUCB 5ALQA 3W8FA 4TLBA 2HMYB 3IERA 1IWBB 1PL0A 3TD6A 5DEOA 5BQ5A 5J0TA 4D79A 3M2TA 4MZXA 3LUHA 1CUBA 2J59A 3HWX1 4F3KA 5K0LA 2KZ3A 3EVDA 2A0YA 2I33A 3JR3A 3ZDBA 2C59A 4D3YA 1L7VC 4RQ4A 1MEJA 3EGXB 4WFKA 2NVWA 5AOCA 4Q16A 1KAOA 2X15A 4FUTA 1YB2A 4ESOA 4DFPA 3KHSA 5FO1A 1WUYA 3TW6A 4WTOA 2GRJA 5F1PA 4ZTZB 1DT3A 1RKUA 4BO3A 1F8YA 2PD3A 3EGDB 1E2LA 4LNAA 3EOBI 5UKDA 2PZBA 3COWA 3ZE9A 5CIYA 5I5EA 3EQ9A 5IIJA 1DARA 2F44A 1T8TA 1YA8A 4RZXA 3PNOA 4DIOA 3DF9A 1Q6YA 1R6UA 3LVVA 1XRRA 2XDQA 2R1TB 3OX2A 1T1IA 1N7GA 4NLBA 4M6WA 1PZNA 4TZ0A 4E51A 4IDNA 3AR4A 1HYBA 3FMGA 1HWYA 4KK3A 4MRVA 4IZOA 1Q3TA 1BHO1 2PA0A 5JH7F 1OC2A 1MO4A 1CNMA 3K3PA 3SEAA 3QJYA 1EWQA 4OTZA 4ZN6A 1UBTS 4KU4A 1PT8A 1JU3A 4G8JA 4O3FA 4CMCA 3OSNA 3H99A 3ITDA 4CUZA 5IXJA 2C03A 5IM4A 4C14A 1LTKA 2AE2A 2J09A 1IG6A 3A4MA 4CIBA 4TUYA 3FDIA 4O25A 3ZCSA 5E6SB 4I55F 2HWUA 3ME5A 3EIQA 1MQ2A 4QXRA 1MGPA 1JHMA 1GO2A 1G60A 2ORYA 2GT1A 5ANRB 3C5FA 3HUDA 2G40A 1NW9B 4NG5A 4DCNA 2EVWX 4Y6LA 2OAGA 3L0CA 1WBJB 1MB4A 5EMHA 4ZT7A 3BGWA 3RAEC 5I7UA 2JRZA 1SH7A 3NHLA 4N8DA 1SKYB 2Y99A 2NSYA 3NVMB 2QKQA 3QZ8A 3RS4A 5BWOA 2ZS8A 1D4AA 1B23P 2W7TA 2GO1A 3TSCA 8ICRA 1OLUB 2J08A 5FR1A 4Q3BA 4PZAA 2CNWD 5DGAA 3VO1A 3LQ1A 2C7BA 3RFXA 1RLJA 1ZL0A 2NPOA 4GKJB 1M2JA 3JASB 3QFHA 1DGSA 2FY8A 4YDQA 3OKFA 2MYTA 2FCAA 4B3SB 3OQBA 1WPGA 4H4DA 4K6MA 4X20A 1HQDA 4CXMA 2PQ2A 2GZ3A 4ZOAA 1P7WA 2NN3C 1U47A 3IUYA 3EXIB 2YXPX 2QT1A 1P1KA 1Z0UA 5FTNA 3DBHA 4H7DA 3HZZA 1XIVA 4F4YA 1L5MA 1WYGA 1A7AA 3QW4B 4RCZA 4CJXA 1SUWA 3DZGA 3FH0A 1NNEA 5HNKA 1UQTA 1V4NA 4FFWA 1P7CA 1CLEA 2RGXA 5BSWA 4LYDA 2BEWB 5BO5A 3QEBZ 4I2IA 1VLLA 5CNIA 3KFUF 1FDVA 4NC9A 1IHOA 3COVA 3RF7A 1TCAA 3PW5A 3HDGA 2FZGA 2CVOA 3CXUA 1P4AA 3IEPA 3ZS8A 2L19A 4RVOA 3AR9A 3MJTA 1Q84A 3IP3A 3REGA 1PD0A 2GZMA 5BVGB 5JJBA 4GL4A 2UZ1B 2P2CA 1BEEA 3AXTA 2IYXA 3M5PA 2AMLA 4DLAA 4Z6CA 3ORFA 2KJ9A 1H85A 4I5IA 3NEAA 1E89A 3SLGA 1IIRA 3SS8A 1CY8A 3LUGA 1UM9A 3B2NA 1Y88A 1H9CA 4L07A 2H3EA 4KR3A 1N5RA 2GAJA 1GU7A 3C5HA 1XVTA 4AJ1A 1BPZA 3UK1A 3ZDFA 2C5SA 4AF8A 4TUSA 4UULA 1K7XB 1WPRA 4OKSA 1VHJA 1EXWA 4Z4IA 4DC0A 1GPAA 2BCGY 1QZUA 1T2DA 2P9CA 3AWIA 3FSJX 3KT3A 5LBUA 2M98A 1I94B 4F4XA 4EJ2A 4ABYA 1YR9A 3TNYA 2OV1A 4UTOA 1APBA 4EG7A 4J91A 3TGWA 5EIHA 2H1HA 1EINA 2VP2A 5BSMA 1MX9A 4FFBA 1Y3HA 8OHMA 1XJ5A 4GG1A 3QVSA 3UH0A 3LFTA 1MOZA 3S7TA 2QIOA 1TZMA 4EMUA 3DDWA 2AFVA 3ZC3A 2CN1A 1N5OX 3PA8A 5BOSB 3NTRA 5C8YB 1VCNA 4BP9A 3ETDA 1E8NA 1F6WA 5HRCA 3M9LA 3FBWA 3SZLA 1JROA 3VPFA 4FHEA 5D49A 1MJGA 3RIXA 4O4JA 1L7OA 3KPUA 3J80A 2EC5A 4JI5B 1EBFA 3TANA 3FFAA 5I45A 1R12A 1WQ1R 8ATCA 4LHEA 3UAZA 1D8BA 3AB8A 1E0KA 3A11A 2ZIGA 3K15A 2A92A 3LHFA 4JLPA 5M29A 1NY5A 1HFEL 2H4FA 4D45A 3EF3A 2ZIWA 5DNCA 3PPWA 2F3RA 4PZ0A 1X1QA 3TRKA 3B1JA 1KO4A 1EA5A 4O4IF 4EYKA 2QAJA 4U7FA 3RB3A 4DLBA 1D5WA 1ELOA 2C5AA 4IX1A 4E5KA 4A7PA 3EMVA 2WQZA 1H23A 3ZBTA 2IW1A 4N40A 4YBRA 1SPBS 5DK4A 3NONA 1VDVA 3U26A 5B7QA 3HV0A 1FFUA 1FQKA 4RH0A 3QKUA 3ZYZA 3AKZA 2QT0A 1Y9JA 4KO1S 1WXWA 3NHMA 1TUEA 3OZ7A 4QAJA 1ZJWA 4DEZA 4M1QA 4B9NA 1U5BB 1DP4A 4GXQA 3SIRA 4YAKA 2IV2X 8GPBA 1JG3A 1CHNA 2I6SA 3VOAA 1NQUA 2JCSA 1IM5A 3FZYA 1JSRA 2CDAA 1BKDR 4G3IA 2XA2A 2YVAA 4QQRA 3ZLJA 3TGPA 3LC2O 1E2KA 3DCYA 3ETLA 2QN6A 4DUGD 3EPGA 3N97B 1ZXLA 3JYLA 3WISA 4K9KA 4EHBA 4AT1A 1IUKA 1FYEA 4ARCA 4B8YA 2EKLA 3RQIA 4X00A 4YLEA 5AVJA 4N41A 1I4DD 3KYJB 4KV7A 4YT2A 3PXUA 1CEZA 1JR6A 5JWOA 2OSVA 2OPBA 1RI2A 2HRCA 1N63A 1DRWA 3WVNA 1RWQA 5JAOA 2DLCX 1CB7A 2D0PB 2WVHA 2B6HA 2H92A 4BNKA 4MUMA 2X1VA 1YE3A 1C8BA 3I5MA 1YA6A 3IJEB 1S89A 621PA 4ZQIA 2GPNA 5GV7A 4F4JA 4ND3A 4BWYA 1XBTA 4N1AA 4KSBA 1BTOA 4J3NA 4G6ZA 2HF8A 3KWMA 3TIIA 3ICXA 1DSSG 2KICA 4ED3A 1UKZA 3QGMA 1R74A 1EWYA 3HCNA 3MS2A 4O5CA 4MPPA 1XNRB 3F6SA 1JHXA 1XZCA 2I7DA 3PQ8A 4TSFA 4EA9A 4KRFA 3UAOA 3GIDA 2XXJA 2IBKA 4R51A 3OFSA 5H83A 1ZK1A 2RDIA 4H1WA 3VH3A 3MOGA 5E9WA 2XB9A 1XJQA 5DDYA 1FDOA 1KLNA 1XZQA 7GPBA 3W9SA 4IS3A 2G63A 4N3NA 5JCXA 2GNAA 4NJ8A 4DRXB 5LMCA 2WNSA 4AD8A 1AUXA 3RKRA 1CVLA 1Q22A 1GPNA 4NLZA 4JJKA 2BPCA 3AGPA 1HT3A 5EQJB 4U0JA 3VCBA 2CUZA 1JBEA 4HZIA 3QX7A 2JGKA 3A6FA 3UGQA 2A5DA 3HCFA 4F04A 4P2GA 4MO2A 3WRYA 5C8VA 2JFNA 3GT7A 1F48A 1ABFA 1P1HA 4XEUA 4LI0A 3H1GA 1OPRA 2VL7A 1F12A 1RQNA 3MWGA 2FW1A 4AJKA 5FNZA 4TKZA 4YECA 5BR7A 4JBNA 4UARA 4RDXA 3H2ZA 3F2IA 1BS2A 4IRCA 3OIWA 1TEZA 1BIFA 4YREA 1EDZA 1QRUA 2ACVA 2YJ5A 1D1QA 3LA6A 2WKWA 3PYMA 5HBGA 2X8BA 1KL7A 2FW9A 5FUMA 3OQNA 4J9UE 4FFRA 4QHSA 4B87A 2W48A 2AUNA 3EVNA 1JP7A 2XBLA 1JBKA 3T1OA 1PZMA 2VJ5A 2WF8A 4GOND 5F3XB 3ZGZA 2QM7A 5IANA 4P35A 2A14A 1JIXA 3TTXA 1SOAA 4TSFD 1RIFA 5F7OA 5KFZA 3LCJA 2OC9A 4FEGA 1W5SA 1KH3A 4G1EB 2JGLA 4MQEA 4W6QA 5CA0A 1NBIA 1RKBA 2IEDA 2I9KA 5DU2A 3E2IA 2QB0B 1CUGA 2NO7A 2Y6UA 3ZD6A 4I9UA 3RJTA 5IZ4A 4J2OA 5T4HA 3LUKA 4C4OA 1Q0PA 1UBGA 2VXCA 4JJZA 3TKYA 4K46A 1Y3AA 1DMSA 5KJCA 2WWYA 1L4FA 2ZPTX 2FUKA 1VJ1A 3JY6A 4UVIA 1P2GA 2XWJI 3OD5A 3JQBC 2QTCA 2O5RA 1G7SA 4I99A 3WNBA 4A5SA 3FR7A 5IBRA 2GTIA 4F2SA 3ITNA 2B1JA 1INLA 2J0QA 3OT4A 3CZRA 2EIXA 1JEJA 2AW5A 5ILOA 1SJ9A 4G0OA 4UJ5A 1TUBB 2IT1A 3OCXA 3KETA 3GFSA 4K6CA 4F8YA 4W5JA 1AHHA 3MXOA 4X7PA 4HZUB 2GRUA 2Z8ZA 2BTEA 2AFIA 1DAOA 1S3IA 3TMKA 2VHQA 4P4TA 4BGVA 2BMAA 4B3CA 5JADA 2QZPA 3WGLA 2I1WA 3KTQA 4C88A 4JOQA 2A19A 1FRQA 2ZFUA 1ZMRA 3F5AA 3ZWNA 3GFBA 4R2WA 4GX1A 4AX8A 3A1CA 4ZCMA 3EAFA 1XZBA 1ZQMA 1UP4A 2Z83A 2PAAA 2QM3A 4NE9A 3FETA 3D3WB 1YHZA 2VT2A 3W1VA 2F17A 3WMXA 2ZETA 4QW8A 3JQGA 4KQ2A 1QGZA 2IYPA 1GDHA 2ALJA 3SKVA 4LYHA 4AZ3A 3AV3A 4BV3A 4DXDA 3DV9A 2CEAA 4DBLE 3AIMA 3UVEA 1TUGA 3I6BA 5KOJA 1UBNA 3BG5A 4FYHA 4CFYA 4P3KA 3UBMA 2Z2IA 2V7GA 4UM9D 3KL4A 5KFNA 4HNAB 1DKOA 4NOMA 4KJXA 3EAGA 1TKRA 1G2OA 1RYYA 4ZYZA 3BQTA 1V2GA 3CURA 2FWPA 2WM2A 4YJ2F 4B74A 4K1LA 3M6UA 3HJAA 3PQCA 1W1IA 4C0HA 3EQ8A 4ZU3A 5CBKA 3ZV4A 2CLHB 3W2IA 3ZDCA 2IZ5A 2HGSA 2CWDA 4MVXA 1E9FA 3TAQA 4L4SA 3PR1A 3BMOA 4G4IA 2W9CA 3TZHA 4HLUC 2IU4A 5TB5A 4HK4A 1NN3A 4GOJA 3UAXA 4KZPA 1DAIA 3KG2A 4JELA 5KHOC 4NL9A 1YO6A 3BDVA 3PNYA 1FFWA 4I55A 2BGGA 2AK2A 1EHYA 2EV9A 4DA9A 3F3KA 2QR2A 2PS1A 1G7RA 1A9OA 1JZSA 1E1QA 1CIJA 1SCIA 5C3MA 5HFAA 4EI9A 3BPSA 2HH9A 2FN4A 2HHAA 3I34X 3OM9A 1R10A 3L7OA 2E85A 1S97A 3KV1A 4QNNA 2HREA 3PHLA 1T5OA 2XUGA 5EJGA 4YH1A 3ZZ0A 1KI8A 5KNDH 2B69A 5HOEA 4LF5B 2A1TR 3BJZA 4GLOA 3BFXA 3LZCA 5HFJA 3TJMA 2GN2A 4LJAA 1CS0A 3QXCA 1G20A 2XKBA 1VLJA 4KJZA 2Y68A 1MHPA 3RROA 1PJ3A 3T15A 2XF2A 3C85A 3ZU4A 2QRNA 2FZEA 1G7CA 5FI1B 1LU9A 3S28A 3GJZA 1Q1GA 4C0WA 4HR7A 2A9VA 5F33A 3W5DA 1GQOA 2G04A 1BC5A 1YVEI 3U31A 1P72A 3THXA 2H65A 3AR3A 4ED0A 3EXHC 5TPWA 4LHYA 5JEEA 3OF5A 3VNUA 5K3FA 4LF4B 4B4DA 4GH5A 4QPZA 4KRXA 1H2WA 3FZNA 4Q1FA 3WV4A 3O26A 4RQ5A 4S1WA 3E35A 5F9HA 2WYVA 2CMKA 3T0GA 3GJTA 4OH7A 2OHIA 2JDIA 1NBEA 3RUDA 5E6UA 5F78A 1YDEA 4IVQA 3HKCB 2PT7A 1V45E 3OVMA 3SU8A 4RPYA 4PYNA 2P9EA 4FQ5A 4J0GA 2C77A 5J2UA 4DABA 4DJJA 2M1XA 2NRZA 1N8NA 4P4OA 1MTOA 3E2MA 4PG4A 1Y3CE 3L46A 2PFPA 3FW1A 1E1QD 4HMOA 1ZSVA 1ZH6A 4LYYA 3I1IA 3UM9A 4W6ZA 2PKRA 2BDPA 3WIBA 4E14A 1C2YA 2QMYA 3Q8LA 5H7XA 5LC1A 3NP9A 3MYYA 5EXEA 4H7IA 3C74A 4P7JA 3L6DA 3BXPA 2XCQA 3RVNA 1DWOA 5G0TA 3B8EA 1E1CB 3G8AA 1XRMA 1GCAA 4WNAB 3PD7A 1NNUA 1UPBA 4D4IA 2HDOA 2A4MA 2EERA 3LL4A 4OIMA 3Q3HA 1UKCA 4EF4A 2ZYHA 2QM0A 1V9PA 2K2WA 4BX9A 3WSTA 1AROP 1H1LB 1MHTA 1B3BA 4O63O 3QPDA 3H17A 3DGEC 3EXHB 2YIJA 1P74A 4LV6A 4IIBA 1R9MA 3TZEA 1NXTA 2HMUA 5M04A 1P1BA 1RYNA 1SBYA 2VTBB 5EJEA 3MDCA 4V03A 1AMUA 5AOAA 5BMVF 1B2RA 3E7WA 3AUAA 2H3VA 3H5TA 3MQ4A 2BT4A 2JKZA 3BUSA 2OD7A 3V2UA 3G5MA 2WP0A 2CE2X 3WLMA 5LQRA 4LZGA 1AG9A 2CPRA 1OI2A 1NOJA 3PXAA 2DBQA 4C6TB 1PZGA 2CXNA 4E1AA 1N0UA 4WCVA 3OPQA 3CLSD 1SC3A 1R5NA 4QDUA 1EB9A 1N6PA 1DNPA 3T5GA 1JJBA 4PZNA 3ELDA 3LT5A 3LQYA 2Z5LA 4G0YA 5DE3A 5IS2A 2C98A 1Y5MA 2JAHA 3F53A 3H9CA 2FWIA 3KSBC 2A9PA 3TQQA 2VAXA 4EUEA 2W7PA 3JPWA 2N0SA 4LRQA 2C9MA 3KOMA 3TYXA 3HYTA 5DRYA 4O0IA 2A0KA 5HHTA 2ZSFA 1NZPA 3OPXA 3VNVA 1JSXA 2PVSA 4S12A 2NUTA 3GDFA 2W2KA 1IN6A 3H1BA 4Q4HA 5F76A 1HMPA 4I1RA 4DR2B 2Q6VA 3WLQA 5CMLA 1F8UA 4INOA 3KHUA 4FBTA 1DJNA 1THMA 1V26A 3DE0X 4BN5A 4G0PA 2O1SA 1AUOA 1NM5A 4F5OA 3QI2A 4OP1A 1P6XA 3RLFA 4P33A 3M49A 3IESA 2ZIZA 3ENVA 4Y18A 5LQJA 3W2GA 4V24A 1R50A 3IPYA 5YASA 5JV5A 3M3PA 3AZPA 1Q17A 3BWBA 9ICSA 2QR3A 4X71A 3MR5A 3WLTA 4GKAA 3DKVA 4RS3A 3QVLA 1QHIA 1CVIA 1Q14A 4Q0MA 3MHTA 2W6PA 3KU4A 2QLLA 3QOFA 1SY7A 3R0JA 3FF4A 5C37A 2FEXA 2AC4A 4F9TA 3OOEA 1YQWA 5FDFA 4RUKA 1IJFA 3U4HA 3HUUA 4GPBA 1Z47A 4TL7A 4ZYVA 3DPIA 3R3SA 1W5AA 3NTXA 2Z4TA 2V6MA 1USWA 3MAJA 2FJ0A 4QWBA 1QQ7A 4AS3A 2F1JA 2JLYA 2JJMA 4AWAA 2UYYA 5E1OA 4MV4A 2R11A 2VATA 3NYIA 1U28C 2Z8YA 1SC1A 2DX7A 1ZGJA 4XB1A 5LUBA 4RCVA 5DVZA 2O3SA 1W85B 4EFMA 3L7CA 2V9ZA 4EVQA 3WK9A 4YR2A 1QHGA 1ZG3A 1HNZB 4IFEA 2MTBA 2PHZA 4GOLD 4DFJA 1XRNA 1CEYA 1JQ5A 3DT8A 2J6HA 5FLEX 2WIDA 3FBGA 4C5BA 2EFDB 3QYFA 4BFLA 1GG8A 3HZOA 1NJ8A 4D25A 1T13A 4FYWA 3SV4A 1Y1LA 2V7BA 1CKEA 2LI6A 3CJQA 3OZBA 2DP4E 5KJ1A 3B3QA 1BG6A 3A2KA 1U94A 1D9ZA 1D3AA 1I9CA 2OWDA 5FOUA 1MVOA 1XWLA 1F2UA 1A9YA 1X14A 1QM5A 1QIFA 4B09A 4M8IA 1Q0ZA 4DQPA 1CQWA 3SSOA 2VK8A 2DHDA 2QX7A 4G2TA 3U48A 1WNTA 1XA4A 3BCUA 2M6RA 2ECPA 1OBOA 3PNCA 4P4LA 1JLRA 5IM4F 2P2ZA 3SNHA 3B82A 4DRZA 3GVIA 4N39A 3G5UA 4TUYF 3J7TA 3BWVA 2BEKA 2COKA 3IAUA 4ODIA 1VL5A 2FLNA 5HHIA 4C22A 3RAPR 3EZXA 5JNWA 5B2EA 3SYZA 3HLTA 3C39A 2E5SA 2BMEA 4DL4A 1QFZA 5BR4A 1VDZA 4M7WA 3RJ5A 4Q4JB 1V8DA 2APJA 4TWAA 4WX2B 2PYDA 4JVMA 4HAXA 3RU3A 5IWCA 1A4UA 1KVTA 4QLBA 2JFWA 2G88A 1PVVA 2PBZA 4CIXA 1ZQPA 3CG4A 3L7BA 3Q15C 1QH1B 1B1AA 1ZA1A 1G5PA 1K7CA 2H1RA 1H0SA 3DO6A 5L1LA 1EDBA 5E9JA 2DR0A 3RK4A 4MWSA 4ZZ0A 4E5MA 1R5OA 3TCKA 1YACA 1NYRA 2DY0A 5FI3A 5A5EA 4DLGA 3N7SC 3W8NA 4BYGA 2I2BA 3WMWA 3KD3A 2VRWA 5T41A 1H2EA 1P5ZB 2ZCJA 4LCJA 3B89A 4CPDA 1JGTA 2REQB 1RFLA 1OWPA 1D7AA 2IPMA 3FDZB 3UV3A 2IYTA 2QAGC 1W5BA 1R0BA 1Y6FA 4C7OA 2YNMC 1J39A 4B6FA 4BIMA 4QYIB 1M6HA 3AOGA 3R3HA 3B70A 3RM3A 4H7PA 1WRBA 1D5CA 2W6CX 2D13A 3JWEA 1UOOA 1E7QA 3OJXA 3E22A 2CF5A 3AVWA 4I2DA 2QI9C 3CEPB 5E4JA 4CV1A 1YMUA 5KWVA 3FJ1A 5A5FA 3RVBA 2WUGA 3O84A 1CJBA 1J0XO 3IAFA 4UZFA 3T7RA 5JQGB 1M54A 5KYXA 2FG6C 4IQWA 2QN9A 4JA2A 1WR8A 4TTTS 2XRMA 3WYGA 2IV3A 3IVXA 2Q46A 3LYUA 1OKKD 4TWBA 4X94A 4C0LA 4ZOLB 4KK4A 1J8FA 2V4ZA 1OBCA 3ESQA 1XEAA 4M98A 1CB0A 3ZHTA 1TMYA 4NTZA 3IHQB 2NP6A 2ID8A 1U9IC 3GU3A 3MRXA 4PX9A 5EZ6B 2KPOA 2ZIVB 4F6CA 3KQMA 1ZJ6A 2PJZA 5ITZA 3ZVKA 3ROQA 1E5LA 3AW9A 2BHNA 2EJCA 3G0OA 1NTOA 1LH0A 4JWTA 1VSTA 5BUQA 4XWWA 2QAGB 3V8EA 1B93A 5EP3A 3EQ2A 3L2OB 3CQ9A 3I9JA 4KQHA 3HNPA 1MTZA 4R68A 2UVPB 4NIMA 3N74A 2AXPA 2PFNA 2OCLA 4QWEA 3H7AA 3V4LA 1IN1A 1ZRNA 2W9AA 2J4FA 1P0IA 1XQXA 4EUFA 2BFFA 2OHXA 4BNYA 5ELMA 3AI7A 2H5XA 3JQ6A 3PFFA 3WB2A 4UTRA 2ADFA 1VP3A 4DF3A 5TEVA 4IF4A 1PW7A 1IXKA 4P0QB 1CD5A 2AXNA 4E4RA 2QN8A 2AJQA 5KYUA 3GRUA 1K6MA 4K2AA 4L28A 3Q4GA 1JIKA 3DKKA 3TI9A 4CM5A 4O4JF 3UC9A 3L4SO 5AVSA 5LU8A 3TKLA 4YJ2A 1MA7A 2J3KA 3WLHA 2KQUA 4BKOA 4M1YA 3RU9A 3C43A 2WHXA 2CNKA 1OA0A 5E4TA 2R96A 2WYHA 3ESZA 2MOKA 3L8CA 3BTOA 4UXJA 3GEGA 3GRFA 2CVHA 2JXJA 3FDFA 3JWIA 4JI7B 1CF9A 1ZH4A 3K70B 4HS9A 2JANA 1AV7A 4L8FA 5L6MB 3I3OA 3FB4A 2XJ9A 5KG7A 1PWZA 3K05A 4ZAZA 1LSOA 3OETA 4AKTA 3JVUA 4EX7A 3OQ1A 4QOSA 1SL2A 1TCVA 3CSSA 5FL7A 2XMDA 1PJ8A 5DO9A 3U3RA 3TNLA 5EHQA 1IBMB 2QL5A 3FD8A 5EP1A 3JD2A 4LZDA 5B3AA 4AULA 1PWXA 4RMNA 4O5EA 4IOJA 4GMXA 1X74A 4RO0A 4F50A 3NW9A 4F2HA 4PBRA 3FKSA 3CRVA 4IF6A 1LW7A 4KLSA 1H4QA 1NI5A 1U4NA 5CDFA 1FYWA 2E4ZA 5DM1A 1A1SA 5J0UA 4J0HA 3A9SA 4X3OA 2JRLA 4RJLA 2VDKB 8ICNA 1T6ZA 5F1KA 1Y7HA 3RR2A 2ID9A 3HB4X 1MEOA 2V74B 5JU5A 5JCOA 1JRPA 5ALGA 2EQ5A 3OX3A 1LB2B 4MRMB 1R66A 5BWNA 3GRZA 1TT5A 3ZU6A 3REFA 3ECAA 3EF0A 2FX5A 2BFBA 4PN7A 2ZANA 4YROA 1I33A 3JQ9A 4D1YA 4LYJA 4GZMA 2AQ0A 1XLUA 1N56A 1G3RA 2I7TA 1UMDA 3KL2A 3IILA 4CEIA 1IXRA 4G81A 5CVTA 2VOJA 5GIPE 2WYIA 3WDLA 3QWFA 2XKAA 4ECYA 2WSLA 1WEHA 2XMZA 1UBHS 2A6PA 2E6UX 3SR6A 1WUTA 4YT8A 4MKHA 3AIKA 1NNLA 1U0NA 3BWYA 2V9WA 1T2FA 3AUYA 4AVYA 4YP6A 3LS2A 4CIWA 1ZD2P 3LQ2A 2OCEA 4JI0B 1HYEA 4MGZR 3VISA 4RVDA 5SY4A 1N1GA 3J7AC 4MQ6A 3OT1A 4DARA 5T8KC 2DM6A 4JT8A 2I1QA 4DHEA 3PNBA 2O8BB 4NU5A 5CFPA 1QUFA 5FL7D 1C9JA 4QDXA 1I6LA 1NKTA 2FGJA 4G1CA 4O4HB 4PSUA 2A9FA 3C23A 1PFKA 2UU9B 3K0KA 2RMKA 2J45A 3PUYA 1F2DA 2O2JA 2VA9A 3AJEA 5HZHA 4S2EA 3THRA 3TOCA 4WLEA 3RYCB 2WIKA 2C5LA 9MHTA 5J59A 4F5YA 4YD2A 1EWTA 1XVIA 4PYKA 5D4BA 4Z4GA 2VT3A 2WDZA 3WB1A 1V97A 1ZQAA 5KQGA 2ZWAA 2WM3A 2C88A 1P9OA 5JE8A 1TK3A 2ZJ1A 3C4JA 4R83A 1QBGA 1R2QA 1Z2NX 1F17A 1BS1A 1DIBA 3VUEA 3WHLA 1UWLA 4WKCA 1HNXB 2PGIA 1PYDA 1KO1A 3O4JA 3HXPA 3OZEA 4BPRA 1LZKA 3T99A 4HRXA 1LLFA 2GEBA 3RARA 1KKMA 3GOHA 1KY4A 2J8ZA 1MLDA 2WJVA 5KWJA 2E21A 3MBYA 4IIXA 5L4SA 2IYNA 1QVRA 1DIHA 2F55A 3BFPA 3NHJA 1UT8A 4CKWB 2QLMA 4I9GA 5H80A 5AKLA 1XI2A 4YCJA 3MW8A 3F49S 3WOHA 4NLLA 4A0GA 3HK2A 8ICLA 4QELA 4PHDA 4LG1A 4QJIA 2PBLA 1FJHA 2NZ8A 3H05A 4BNJA 1C3XA 4A4DA 4B9MA 3KJIA 2XB2A 4FN5A 5FTJA 2JGFA 1PJSA 4ZPJA 3DMRA 3IV7A 3DE4X 4L78A 3E53A 2Z43A 2V3WA 3MWYW 5K6AA 2X4GA 4YRBA 5C0YA 2DGDA 3PL5A 4H18A 2QPAA 2C2ZA 3CONA 3MCWA 5KWSA 4D4JA 4BNDA 5AKHA 2FAXA 1JKMA 4BLTA 2M6SA 4JFAA 3VKVA 2JVIA 5CA0F 3R5XA 2KWIA 3Q7IA 1WEKA 5DBHX 3JVVA 5IUKC 3FTQA 4OHVA 5JNUA 5B3JC 3HJTA 4MFFA 3P0IA 7ICSA 1GPWB 2IYAA 4BB5A 5DK6A 2P6RA 2P3LA 2R44A 2Q4DA 4R63A 4C7KA 2VHCA 1DK3A 1WZEA 4WK0B 4ZC1A 4TXJA 4DL2A 1D0VA 2Z5VA 2BGMA 3CB2A 3ADDA 3GV8B 1OB5A 1NW8A 2GJ4A 4HGYA 1BE0A 1VRWA 3MCUA 1CJVC 5I01A 5DGCA 5JSKA 3C15C 3DDUA 5I9IA 3TCXB 2JAWA 3M33A 4YAFA 5E3HA 1MU0A 4XB6B 1UBMS 3C3EA 1L4BA 4WJKB 5ARDA 1V6CA 5IIOA 2HGZA 1PE0A 4UVEA 1SIJA 4W8HA 4RW0A 3ILYA 4WK4B 4FHFA 1U81A 3FHLA 1A71A 1C3VA 4IQTA 4S35A 5TY0A 2ZYGA 1ZJJA 2IHNA 1GGNA 1RPTA 1BN6A 3AQIA 2CLDX 2JI7A 3PS9A 4G5OA 5EMLA 2H17A 1E0AA 2X2PA 3T3DA 3MT0A 1SMKA 1KFJB 1L5ZA 5AQEA 2QD5A 3QPUA 1VKOA 1F8XA 2V0CA 1JDBC 1OGJA 2PT9A 4ZAXA 3IIKA 4BP3A 4K9RA 2YCLA 2J3MA 3U4AA 4J9RA 4NNJA 3IM1A 4KLDA 2CNWA 2AMVA 5T4BA 2I3GA 3IQFA 4CN8A 3M82A 3OEWA 3WGNA 4HGPA 4OQQA 2XHEA 4WY8A 2AEMA 3RRBA 1LKYB 3W77A 2F48A 2FPUA 3FWZA 2B3TA 5D5HA 2GPYA 5J2IA 2IU6A 4LECA 3EGXA 4IDAA 4NFSA 1V9CA 4AZ0A 5CR9A 3FFWA 5I7FA 1T0IA 5GM1A 3UF0A 1R6TA 3HEAA 1M72A 2KLHA 3EGDA 3D3KA 2FSIA 3AILA 4B32A 3RW9A 4NPAA 3D8TA 1T8EA 4AJ4A 3A9RA 2C7GA 4K28A 1KRWA 4WXMA 2WAAA 2XB6A 4WN3A 4IH9A 4EI8A 3S1AA 3H4DA 1ADGA 2HEIA 2B61A 2HK6A 2R1TA 1DV1A 1MF7A 2Z9BA 2Q4EA 4CGZA 1HKUA 1DBVO 4WXPA 4ASUA 2JEYA 2I8LA 2WWFA 4XQ9A 4NMXB 1R0KA 3KKAA 2G5TA 4OYLA 1U49A 1TZ2A 2PO7A 3NNDA 1M83A 3G0DA 1XVVA 4EELA 2SKCA 4P5DA 5I8PA 4YWHA 5CCXA 3UMSA 5KC8A 2W0MA 2HF7A 2Y2VA 9LDTA 4IDOA 4KQJA 3HJNA 3EVEA 1JDBB 1A2OA 3UJAA 5LQSA 1T43A 1H6AA 5EE9A 3LGSA 4YQWA 4WIAA 2GBIA 1P0PA 4YN3A 4S1NA 4HPWA 3DUFB 2CHGA 1JYFA 2I54A 4E0BA 3TRFA 2J5RA 3ZHCA 2DVMA 1N2CB 2NO5A 4KIGA 2OG2A 3VHLB 3KRTA 2OHFA 1M66A 2KSQA 2JGDB 3GFGA 3OZUA 3LW8A 4R2KA 3VC8A 4FYJA 4OQEA 3OWHA 3P9PA 4XJXA 1P7VA 4OPMA 3AUXA 2IDJA 4JWNA 5JRZA 2HCJB 2YS6A 2Q9CA 3QVGB 4M36A 3Q8XB 1JBQA 4TLAA 5C46F 2CMGA 3C98A 5KPDA 4BX3A 1XNSA 3AO0B 4QIWF 3N0VA 3TTTA 2YH2A 5CFRA 3B20A 3PK0A 4FW9A 1Z26A 3KBOA 2P0EA 3A6EA 2HI0A 1HJPA 4MUYA 1WCIB 1PNOA 1YQXA 4RZIA 4DQKA 2XUPA 2ADMA 3W8DA 3R5TA 1SBZA 2VBFA 1ADJA 3PQ3A 1GG2A 4P54A 3KZ1E 3ROKA 1K7YA 1RYUA 3WLFA 3LUJA 3W5BA 3FNFA 2W8ZA 3L04A 5CEEA 4FE4A 2WK1A 5AHRA 4NCHA 4WT7A 5J47A 3SQOA 4ASUD 5AICA 4IRDA 3W78A 2HOIA 3I52A 9ICBA 1QYDA 1U3UA 1TQ8A 2FN8A 5KFEA 4AY5A 3VU0A 4D9JA 3S8YA 4Y7DA 4BC1A 2NPIA 3GMTA 1T34A 3E1KA 2ZATA 2BEWA 2JKYA 1GNVA 1S8NA 1P5JA 4JQZA 3O1LA 2D74A 5J2UF 3WLNA 3DHNA 4BUZA 1FLDA 2O50A 1L8XA 4EY7A 3N2YA 2XRYA 3FTFA 4BFSA 4JN6B 1MR3F 3RYIA 3CLKA 1R0CA 4JNCA 1MO2A 3WTBA 3HWRA 1M9NA 1Z4KA 1VHTA 1HI9A 4N9QA 4AN0A 2NU7B 1QQTA 4K9OA 4XCQA 2M9MA 4RULA 2AOTA 1EE1A 3JAWB 4UE2A 3OUTA 1WCWA 4X90A 2XXBA 2OEHA 4ZJZA 1V43A 4EG0A 3VU1A 5ILGA 1YBHA 1B0AA 3N6RA 4GI2A 3T7CA 5JATA 1UEIA 1F5NA 1C3LA 1S7CA 4R1UA 4GRIA 2BELA 3L8ZA 3AGQA 2YY6A 2IE0A 3RG8A 1JI7A 3L1VA 4KYVA 3LA8A 3KUKA 1BQ3A 4KO2S 4E0DA 1K8YB 1G4AE 3AF1A 2Y1WA 5KYYA 5AK3A 3MEQA 1T4CB 5I7OA 4ZVOA 3PDIB 4DUGA 5IN5A 2YZNA 3GIKA 3A1SA 4L8LA 3W2HA 1Z4PX 4QJ5A 2DE0X 1A50B 4YFYA 1TPZA 3V1NA 1KEEB 3H8VA 1R37A 1HURA 2DFPA 1PZHA 4GYKA 3HXOA 3SZRA 721PA 2FFQA 3MAAC 3OX1A 3DC7A 5JNTA 4G37A 1REQB 4FJ1A 2Q1YA 4CG3A 4RQMA 1N9GA 5TS2A 2DL0A 2P27A 4IMRA 2Q3MA 5K8TA 1KJZA 3HU5A 2FA9A 2CJWB 1EU1A 2E89A 4LRWA 5DBGA 4ZCLA 2BCQA 2MR6A 1GR1A 5DSTA 2DFTA 4DCVA 4K5QA 2I6TA 2F1HA 4LHZA 3RUEA 4XVRA 2AKEA 2KD1A 2IXEA 3V00A 5HIAA 1VMDA 3W6NA 2E8NA 3I9FA 2RHHA 4Z9YA 5JMTA 2R65A 1W25A 1PYGA 1J49A 2JGMA 3CF4G 5L45A 1GNSA 3C41J 1YZLA 3QUAA 4WXRA 2VN8A 2PXAA 4ZQEA 1XU4A 4QKQA 5CEJA 1XL1A 3NHPA 3HXQA 4WQMA 1L5WA 5BWLA 2JLXA 4IKEA 4C89A 3RSSA 3IOMA 1HC7A 2QMEA 1S0UA 3GGDA 1Z29A 5LB4A 3PXCX 4MW0A 2ZRMA 4F5RA 1EPUA 1RCUA 5SYAA 3UCFA 1QG0A 2CDNA 1OA1A 2X9QA 2F9FA 3VTAA 1HKHA 3NWPA 1E4VA 2DWPA 3WX0A 2W3RA 4QO8A 2C2OA 4PZCA 2A1JA 2ZTEA 1U5BA 1LUAA 4FS1A 2IWRA 4ITUA 1HYGA 4GZ6A 4LMRA 2JIPA 3N76A 3A1VA 3QWAA 4GQBA 3KZOA 5BORA 4LAFA 1I51A 1UPCA 1SKQA 1WV0A 5J4VA 4EVIA 1IZ7A 5BRJA 5HPYB 4UHJA 2WHEA 3FYUA 2QD2A 3NGXA 2X8AA 2IODA 3ZWPA 8ICGA 3WGYA 4B6RA 1WZNA 5K0NA 5HZGA 4JODA 3QVTA 9ICKA 3II6X 4C20A 4YXFA 2VYND 4OA8A 4YTEA 5GZ6A 3SVTA 1NSYA 1C0LA 1HH4A 1V5GA 3DBRA 3F6RA 2I71A 2FPWA 4J0CA 1CUXA 2RJ3A 3AP2A 1GKUB 2HA0A 3QYAA 1QOPB 2VNAA 2N47A 1AF7A 2V54A 5G41A 5FUQA 1G8HA 1NWCA 3PSTA 1W34A 3X1DA 3DHWC 2KHVA 4LSGA 1V8OA 2RHTA 3WZLA 2W9MA 2GBLC 2POCA 1U9JA 1ZESA 4A10A 3VNBA 1H93A 2Z3ZA 3OPYA 4F6LA 5L1MA 4CKZA 3OU2A 1FOEB 2YC4C 2ZYWX 3ADBA 4WBSA 4KNWA 1JG4A 6REQA 1W4AA 2OZEA 1PNRA 4BQRA 2P77A 2NMVA 2JK0A 4DQUA 3ZYCA 3F8TA 3MWLA 4JI6B 1ZR4A 1GQFA 4RPKA 4MVJA 3K71B 1U4BA 2FDCA 2ZJ6A 1Z0JA 1Y6RA 1XO1A 2GLTA 5HGXA 1QH0A 3EIEA 4OX9Y 3QFCA 1WD7A 4RQBA 1QR6A 1W2HA 3H5OA 4L3OA 2ZSIA 4DCGA 3H2JA 4GWLA 1ZXBA 1T10A 1LC0A 2MU1A 2DUYA 4PGQA 4N3GA 3C1UA 2G4LA 4PVCA 2VQSA 5TVKA 3QXGA 2AG8A 1WUHS 1DIAA 2QTNA 1MO6A 4QTTB 2QQEA 1UP7A 1BDBA 1CP3A 4OQNA 2Q8PA 3CZAA 2GN6A 2HSDA 4JH0A 4PYMA 1JSZA 4L2IB 2EOAA 3V6MA 2MSDB 2NX2A 1X7ZA 2O8EB 2X3UA 2ZJYA 5TVGA 3AEXA 1QK5A 1XKXA 1P3DA 1JS1X 5AR1A 1CDOA 3OE5A 5LZ5A 1N5XA 2C94A 3UTCA 4WERA 3TZQA 3N7RC 4I2EA 2WHQA 1W1UA 2RGUA 4F60A 4Z9XA 2ZROA 4UHEA 3OE7A 4INJA 2ZU0C 1EZ1A 3L0PA 5CH3A 2YZGA 5FBRB 4OLBA 1ZXIA 1GCGA 4Z4EA 3IHKA 1NR1A 3SBXA 1K3FA 3IO3A 3K0CC 3EDCA 1EG7A 3K5IA 1KSFX 3H2BA 2JJ8A 3UPDA 4V2IA 4HG2A 4O3QA 3U4GA 4NEHB 1RRCA 4Q9DA 4EWLA 2YWJA 1ZQWA 1MOQA 3FUWA 1VKNA 1E3DA 3IVAA 4GBGA 4LY0A 4ROTA 2UYQA 3IHLA 3L8EA 5TLSA 3F4KA 3QJGA 1K5HA 1O58A 3TAPA 2ESRA 2VBGA 4FCWA 4MVJD 5DGTA 5JD5A 2BLNA 1DMRA 1TKAA 4JI3B 2BSQA 5IAAA 3ABSB 5CLFA 3QI7A 2PK3A 4NZZA 2EAOA 1QIEA 3INNA 1QHHB 3UMVA 3RFUA 2VNIA 1VXRA 2I4RA 1CRQA 1VRCA 1SK9A 2H7YA 2VJKA 5EXTA 2PGNA 3OHMA 4E5DA 2JFXA 2R8JA 1EFPB 4IKOA 5C32A 3DO5A 3SR4A 1BRMA 7ABPA 3GVCA 5KC9A 1TUBA 1EAYA 3G68A 3E3NA 4MULA 2YQZA 3E61A 1U7PA 3IDZA 1RWVA 1W4RA 4B73A 4IO1A 1CDEA 1ULUA 2Y67A 3RJJA 4ARSA 3H5NA 1PJAA 2PKXA 2VXOA 3OE7D 3GGSA 1YQEA 3K2IA 3HN7A 3P5SA 5EQTA 4DA0A 4NQZA 4UUOA 1M75A 1JQEA 4E15A 2YWGA 3GBSA 3ZJ4A 1NW5A 2OV6A 4Q7QA 4EYGA 4EY8A 2KIWA 1RIIA 3A6HA 1ZJZA 5EJ6A 2HTEA 3DSRA 1Q7TA 2HV9A 5AKZA 2IDKA 5CDSA 3B3AA 3GQBB 4BJ5A 5AOBA 4KMMA 1R4NB 1UKYA 2FF5A 2WTBA 4E4TA 1PK8A 3SOZA 3TLGA 1RJFA 3ZCQA 3C97A 2B1QA 3BWCA 4C8OA 3KDSE 3WHIA 1E3WA 3LJKA 5EPUA 5DNAA 3PD1A 2QYSA 5KFJA 4QDZA 1U11A 1BU8A 1YVDA 2OGSA 1X9IA 2ZEJA 3HHEA 3U0BA 2ZVPX 5DM70 3W7AA 1QHNA 2Y2UA 3WDMA 4X9XA 4KG7A 4CLOA 1BCRA 3VYSB 5AM5A 1TEXA 3IE0A 4CMAA 4ETNA 3WQHA 2X8WA 2NTEA 1YFJA 1T25A 4LXIA 4C4TA 2E8MA 3PUIA 4HNHA 4CKCB 4QUDA 1BJTA 1W2WB 1IPHA 3G02A 5CT6A 2PTGA 2IX3A 2WV9A 1T5DX 3O83A 3Q87B 3NUQA 1KL9A 3IN5A 4HXGA 1Q7GA 2DWCA 3D31A 2B4RO 1G19A 1J0CA 1YZNA 1O6BA 2F77X 5KVVA 3MGHA 2IQIA 3V8NA 2H3ZA 3DXZA 1PQWA 2JL1A 1XC7A 1V6AA 4B3BA 4G9EA 5J5VA 2Q21A 4XWOA 5BN1A 4V1CB 4H6VA 4RD6A 2FZVA 3BAFA 1JDUA 4FBUA 4G0UA 3TW4A 1M2FA 4EO4A 4TRRA 3M0EA 3I9LA 4OFBA 5EJIA 4C7XA 3MJVA 2XA1A 5IIIA 2JAUA 1W94A 5AJHA 3Q8PB 2Q5OA 5JIBA 3VJLA 2BD0A 4HYTA 3GBVA 3NHKA 4KLLA 2QVCA 4H7FA 2Z2XA 3CVUA 1ZRSA 1TV9A 1PDVA 2B36A 1E2PA 3CC8A 4RH1A 2GCPA 2OXCA 4O5KA 4US2R 1HT1E 5D6NA 2K4PA 3IHTA 3ROMA 3ZHVA 4YRKA 1RRKA 1G3MA 3PEFA 1JAHA 3C5EA 4DPMA 4OVKA 1ULAA 3R76A 3TX2A 2HDWA 1PS8A 4DLNA 4LWQA 4REQB 5KG3A 3ZH9B 2VC2B 4O33A 1QH8B 3REOA 4NATA 3HKBA 3QFTA 1HTWA 2QTMA 1UC4B 3EC2A 3HR7A 1QS0B 2O19A 3RSFA 1OX4B 3WO0A 4Q3KA 5EWJB 2E49A 2OO3A 2B25A 3ZU3A 1XCMA 1I2MA 4DFDA 3BSSA 1IEQA 2XD9A 1SVWA 4PLCA 4WUVA 1WSBA 3HDQA 4QUAA 1FNMA 5DV9A 1V7CA 2ZULA 1GPH1 3U3OA 3I2IA 1N5IA 4QPDA 3L7DA 5EHNA 3EPJA 4MW1A 2IW3A 1E6WA 2QVGA 3I0ZA 3UKDA 1IHXA 3C3DA 3I9V1 3I9OA 3MR3A 1KYZA 4GXIA 4LPKA 3S2SA 3ETNA 4TX1A 1JG2A 1KNQA 5AIBA 3NG1A 4A2QA 2LZ0A 3UWPA 1MAWA 2AUMA 2FNAA 3WLRA 4BU1A 4B2LA 4P92A 4UB5A 2YXBA 2V6GA 1Y9ZA 5CBPB 1T0PA 4QGFA 4TM7A 2RK4A 5EJ7A 1J5XA 1E1CA 1HFJA 2H00A 2WSMA 4PRKA 2VPXA 4MCHA 3V34A 3BWEA 1NI4B 4Z1MA 4IOKA 3O31A 1SD2A 4KVZA 1P61B 1DIGA 1C3JA 2OGTA 4WKGA 2DBVO 4X5VA 2I6GA 3BB4A 1UK6A 1JFVA 5CK5A 5JWRA 4POOA 4HQLA 1QMPA 1RACA 2I78A 1M1UA 5KKCA 4H3HB 2WZBA 3OPNA 3ER6A 2OK8A 5I7EA 1HE8B 1Q1NA 4ZDJA 1ANKA 5T6MA 4YMWA 1O7JA 1R88A 5E2IA 4XCXA 1MJGM 1WNFA 2AX4A 2OOSA 4NV3A 3R0IA 2ZITA 4BZWA 1K6XA 1P3JA 4URUR 4C6TA 4L4UA 4JC8A 2GR9A 2X58A 3O38A 1FFDA 3B60A 4FDUA 3QE9Y 4Q6WA 3F7NA 4RK7A 3SQLA 2AB0A 3C1AA 2MYUA 5JJ5A 1IUNA 3ED5A 3OZAA 2HBLA 4WJ3B 1HE3A 3USCS 3TOXA 1GXSB 3JRWA 3ORQA 1FY2A 1RPNA 1ZHFA 4RIIA 4FMCF 3MLAA 3L3BA 1P0CA 4V2UA 2EGHA 2B5OA 4WZAE 3SC2B 2OCXA 4D2IA 2UXBB 3DQPA 2EJTA 4QQNA 4RNCA 3U13A 4H27A 2WLTA 3E05A 1XT6A 2O23A 4TT8A 3OCZA 1L5HA 1JU4A 3LUBA 1EVZA 3MIIA 4N8EA 1RM4A 3UHOA 4NZNA 1KWGA 3IEMA 3ZWCA 5HJ2A 3UGJA 4IMPA 4KXWA 2XUIA 4YUVA 1VPTA 2IPNA 3NHUA 3U2QA 2PYZA 4ERXA 3O2JA 4Z1MD 1R6VA 4JI8B 1QQAA 3IUBA 2KK0A 1GSHA 3QXXA 4D3XA 3E9NA 5P8WA 2AU0A 3ZGVA 3HP1A 2HHUA 4QSMA 2BM8A 4NYJQ 4EPTA 4E94A 4FZ5A 5AKJA 1RI4A 3CVJA 2RBGA 2PV0A 3C6XA 3SIWA 4HEHA 1A98A 2KHZA 2JI8A 4P38A 1Q2XA 5LJLA 2O7SA 4FILA 4N01A 1KNXA 3P71T 2PO5A 1D03A 1DAGA 1A2QA 2EWVA 1EX6A 1XMQB 4RHYA 5DLYA 2JH1A 1B15A 1MVLA 4BEWA 5KWEA 1JXAA 3SDBA 3F5FA 3F1KA 1E7RA 3BGIA 1MXHA 4HH3C 2JFUA 4P36A 4Q93A 2GEDA 4YB8A 5LLTA 1XU9A 3UOWA 1KVSA 4X61A 4ZXPA 1OIVA 3UH1A 3PB3A 4NXMB 4ZCIA 4PC2A 2GD1O 1GYRA 2B4QA 1W85A 3VZPA 1KOFA 4E7PA 1BEZA 3GJ5A 1M2NA 2HZBA 4HS4A 1WLYA 2FPMA 2P11A 3PDJA 5EMJA 4O3OA 4NV1A 4JXZA 5DNUA 4MHVA 1JR3E 5DJ5A 3JAKA 4IGIA 1QO0D 4OUDA 4EBCA 5K4AA 1SM4A 2E4YA 5D5QA 5IJAA 4BP8A 2FB9A 5JMWA 4NZ9A 1C0PA 4HTFB 1ZM4A 4MVJM 1E3TA 3G2KA 4OKIA 4KXVA 4YP9A 4AY4A 3IP9A 4ZOHC 1TOAA 2W7OA 1S1MA 5KB3A 2P6PA 1BH2A 2R8IA 3BT7A 2GA9A 4CHGA 2X5JO 9ICRA 3KPWA 3UG6A 5LQCA 3NTLA 4XDGA 5AI9A 1QYVA 3KEFA 3DE1X 2XGSA 4AUMA 2B30A 2K4HA 5PGMA 5JDIC 2G08A 4NLKA 1FX0B 2DQSA 3JV7A 4KLZA 4RV9A 1LV5A 3NZEA 1C3OB 3M9OB 3NBMA 1ZQGA 3JQPA 1NJ1A 4DTCA 2YQ4A 1N6OA 1NRJB 4FX2A 3RJ9A 1WG8A 4WD3A 4IX9A 3WXBA 1OKKA 1U4OA 2GJAA 2P6MA 2GN1A 2NTJA 2DPXA 5DLEA 4O2RA 1TYZA 4Z6EA 4FXOA 3WL5A 2ECFA 1NURA 2XC9A 2JGNA 5I8ZA 1J20A 1SG9A 1Y48E 1CUFA 5KQMA 1XAIA 4KDEA 1K92A 2HCTA 2B1IA 3DZHA 3MUFA 2G17A 1QSLA 5BWCA 4IDPA 1IZ8A 1K75A 5F64A 1QP8A 1ZQHA 3RC7A 2XT0A 3RB4A 1ECGA 4RMGA 3UZUA 4KO8A 3PGKA 4UUQA 2X7HA 7ICJA 2RAFA 1QV7A 4U7TB 3WB9A 3GLIB 3PKJA 2AN4A 3PC8A 1ZVJA 1NUTA 2QENA 4X1YA 2QVYX 4LK3A 3D1VA 1ZIOA 5A0VA 5FPPA 4K9NA 1DRUA 4QC2A 1WV1A 1BQEA 4DB2A 3CA8A 2CHQA 5A05A 5LJIA 4XIJA 3DE7X 4ER0A 2JFZA 3BULA 1TVMA 1B16A 2REQA 2V55B 1CIPA 4IIVA 8ICSA 4BRUA 4MUNA 3UCXA 1ZDMA 3FDZA 4I2AA 2C7QA 3QTTA 1C20A 1DUIA 1JLSA 3LVWA 3GIJA 2F3SA 2OAP1 3OCCA 2XUZA 4E46A 3PF8A 4XDHA 4QYIA 5B64A 5FLKA 5JUWA 3LX8A 3AVVA 4R5HA 1DT5A 2PSEA 3SM3A 2JGJA 3IPAA 4X92A 3B38A 1Q7BA 1QVAA 3DAPA 2UYGA 1QIGA 2I91A 1V8ZA 4W1QA 5AW8A 4BY9E 1U80A 2IEBA 4ED7A 3M3DA 4IJUA 2NO4A 5FNVB 1DQZA 4MRNA 4ER6A 3QXJA 4JA0A 3DD5A 4A26A 1YULA 3ZE1B 1QO9A 4X3CA 5JQGA 2H0RA 2ZW9A 3EXG1 3OQIA 3HR4A 1V38A 1KEUA 3TFOA 3ZVNA 1QB7A 1VBNA 2WU4A 1Y81A 4YRSA 1EXNA 4E1VA 5DP1A 1D2MA 2ONYA 3EZ2A 4G67A 2QZ9A 3OJWA 4ZOLA 3H4MA 3ISTA 1XTPA 1WY7A 1ECPA 4WOPA 4NYJR 4ZDKA 2RLTA 2XJ4A 1Y4DE 5FI5A 2JLBA 3NTQA 3HL4A 3HN2A 2RK3A 4OGWA 5EAIA 3Q2OA 2C4KA 8ADHA 4HOYA 1MX5A 3PQEA 1TM5E 3R6LA 1FPMA 4JR2A 4XH9B 3O9VA 1EGVB 1Q7RA 4Q6BA 1G8AA 4MVJH 4U2CA 4OJOA 2FP4A 2J07A 6Q21A 1BVSA 3G5LA 5F1OA 1DUVG 1H4TA 2ATXA 4B40A 3PXGA 4NS1A 3JQCA 4H3SA 2FYTA 5EUBA 1GZ4A 1W0CA 4ZO7A 1JI3A 3BD7A 3O8QB 1BPYA 4RANA 4UOQA 4PPXA 2GERA 4N5IX 4M49A 2GLUA 4MLCA 3RBXA 4IXTA 1P9RA 4HDSB 4DJAA 3S2FA 4TMWA 1OFUA 1IHYA 4F86A 5CXSA 1R6BX 3FVVA 5C8YF 4KUEA 4WMLA 3JS5A 4QUGA 1NP6A 3PX3A 3TDKA 3V4FA 5LM3A 1PT5A 4XSGA 4ESVA 5AKEA 2KVCA 3PPXA 3BMNB 3UWMA 1MN8A 1RHUA 3DYIA 1LS1A 4NBLA 3RJZA 2PWPA 2JRCA 1VXOA 3BXHA 3FHJA 1YAHA 4AROA 4MCJA 3PUVA 1F14A 3Q2IA 4RF3A 1GTG1 1DCFA 4F5EA 3AEQA 3BRWD 3BVPA 1TTHA 4HXEB 4UUAA 3MF4A 4BX8A 4M04A 2HJVA 3LUFA 3TINA 3ZZTA 3RTBA 4I2CA 2GF2A 1E61A 2GARA 4FGZA 1QMGA 4KFCA 2WSSD 3T3MB 5EWLB 4XUDA 1Y9AA 4HWGA 4CMEC 1ODFA 3W34A 2GQ0A 1E2BA 5AFSA 1Q7EA 4HO1X 3KUXA 1OMOA 3QEMB 1XA0A 5LCXA 3OJEA 4D8TA 5HIMA 3D43A 4EG5A 4QU9A 4CEJA 3KR0A 1UDWA 1S5LU 3RRHA 1D2EA 2PSFA 3WJ1A 3AM1A 3RQSA 4H4CA 2H85A 3ESRA 2GD0A 4QODA 3O4IA 3IBYA 2YRFA 3RHZA 1Z12A 1AQIA 2V6FA 3PG5A 1LJLA 3IP7A 1P1CA 2Z2JA 3FBTA 2QGFA 1EJ0A 3V80A 4P7BA 3Q7EA 5DCUA 1Z0DA 2ZGVA 1BYIA 4L85A 3ETEA 3MJRA 1NRXA 3WBBA 2ZRAA 2EBFX 3X44A 3E2PA 3FPCA 1ECLA 3CLHA 4HDNA 4M1ZA 1VCMA 2C9DA 3V97A 4JEMA 4EZEA 1S0OA 4EB6A 4P83A 4E32A 1JDPA 1XTSA 3DEKA 1OXSC 5CVDA 4Y9RA 3PZPA 1X9HA 3VR2A 1QF6A 1WM1A 1P5HA 4AYWA 1PGPA 3S0JA 1IN8A 3KALA 3TE7A 1UODA 1U6KA 3PUHA 1E79D 2RK6A 5GM2A 1Z6PA 1X13A 2MRLA 3KB8A 2X8JB 2NOAA 4N12A 5ELXA 2Z1DA 1XMIA 3AJ9A 3K70D 3JWJA 1U0JA 4LJRA 2CJXA 1XYGA 2VP3A 4DOCA 1LLUA 2GH1A 1WXQA 4FLMA 3RB0A 4V1CI 2NO1A 1G59A 4KXNA 5FOTA 1MB3A 4AY3A 2WAQF 5B66U 1U1FA 3NTVA 1T0JB 4LC1A 3O4VA 3RK1A 3R6DA 1SIWA 3MTBA 4IG9A 3RKSA 1LTHR 5K1ZA 1RFGE 2QN1A 2R8OA 4MVJF 1W19A 2ODAA 2ZI5A 5LBTA 4A16A 2OECA 3RYCA 3VDQA 2V03A 1NBME 2IZZA 1QSGA 1H65A 5B7PA 2QM8A 2X0KA 1XQ9A 4ZK6A 4RU1A 1TC1A 4Q05A 3MPOA 4ERNA 2D1QA 4N0EA 6LDHA 3N6VA 4YMOA 2BQRA 4RTPA 1MD9A 1URPA 1QNLA 4F6RB 1HEYA 3ZDYB 3MWEA 4BGUA 3IQXA 1MQ3A 5JZOA 1OD6A 3UJ6A