4CF3A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACAIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 85
structure length 224
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf3A01
3FM9A 2YY6A 2C8LA 3L8EA 1RKQA 4Y2PA 3SLRA 2W11A 2B8JA 1WVIA 3QGMA 3MC1A 5ALOA 3OCVA 3PGLA 5A3QA 5AKLA 4O8CA 3L8FA 1Z4PX 3ZX4A 5ALUA 3U7EB 4CF5A 5AVRA 1QQ6A 2VKQA 4KX3A 5FP0A 1AQ6A 1T5TA 3FZQA 1KYTA 4KNWA 1K1EA 5AK3A 3ESQA 2OM6A 4RESA 1LTQA 3VAYA 2IOHA 2WHEA 2PR7A 2GO7A 2NO4A 1RQLA 1RMYA 4J2TA 5AIAA 2ZXEA 3WKAA 3U7GA 2R8XA 3L8GA 4XQ0A 2C88A 3NUQA 2YJ5A 4PNHA 3ZWDA 2HSZA 2C9MA 3NRJA 2ODAA 1ZD5A 3N07A 3L0YA 2P9JA 3FPBA 3D6JA 2R8EA 3WKBA 5AIBA 3SHQA 2CFTA 1Z5GA 4Y2QA 1N8NA 2YMMA 3M9LA 3A1EA 5AVXA 3W5BA 4Y2RA 4YIHA 4L6AA 1U2TA 5AM0A 4IG4A 1LVHA 4UAVA 3AR9A 1L7OA 2JAWA 4KYTA 2FPXA 5ALHA 3U7FB 3OCWA 5AK4A 2AUTA 4Y2UA 5A3RA 3WK4A 3WK6A 3OCUA 3OCXA 5AVZA 3MN1A 3WKEA 4UM7A 4CNQA 4CF3A 2PKEA 1Z4LA 4UMEA 2I55A 2ZBDA 5IT4A 1Z4IA 5T41A 2O2XA 2OYCA 2G07A 3AR5A 5ALXA 2O9JA 3WK8A 2WFAA 5A3SA 4Y2SA 1RMTA 4NV0A 2I33A 3NAMA 3I1YA 3BA6A 4B6JA 1ZD4A 5ALTA 4MUMA 2P11A 2G08A 3F9RA 4YCNA 4HGQA 4C4RA 1T9ZA 3AR2A 3ONNA 3WKCA 4BX2A 3QX7A 3ESRA 2WF6A 4MWOA 4AS3A 4E88A 1YNSA 1O03A 4HGPA 1YMQA 3MPOA 5ALRA 3L1VA 3S6JA 3BWVA 3QXGA 2I34A 4Y3UA 1YS9A 4OFZA 3U19A 1FEZA 3QLEA 1MH9A 1XP5A 4FE3A 3SMVA 2NO5A 1T5SA 3QUCA 4HAIA 4OHFA 4GIBA 3ET5A 4BNDA 5AVSA 1U2SA 5ALLA 5AK5A 5AM5A 3FPSA 3ZI4A 2FPSA 5ALQA 3RF6A 5AKKA 4XE5A 2AGVA 5AW3A 2Q4RA 3QUBA 3AR6A 4HGNA 4EX7A 3IB6A 3ZW7A 2AH5A 2FPUA 4J03A 5AI8A 3U26A 1X42A 1VJ5A 3IRUA 2FPRA 4FYPA 3R09A 1J8DA 3FVVA 3L8HA 3E8MA 5ALJA 5E0OA 3AR7A 4ZEWA 1JUDA 2I6XA 1NF2A 1Z4MA 1ZOLA 3N8GA 4EENA 4QQFA 5AVUA 3KZXA 2X4DA 3A1CA 1L7PA 3J7TA 2MU2A 1Y8AA 3SKXA 5AVQA 3AR3A 4UU0A 1RLTA 4KN8A 2R8YA 3ZVNA 4CF4A 2QYHA 2JAUA 3SF0A 3SKYA 3ZTWA 1O08A 3UMBA 4C4TA 1Q92A 3CNHA 2YMPA 4FFDA 2I54A 2BDUA 2WM8A 4Y2YA 3R9KA 4L6CA 2D2VA 2G0AA 3M1YA 2JAOA 1YJ5A 2FUEA 5ALZA 3ZUPA 1F5SA 4DWOA 5IS2A 2C8KA 2B30A 2GMWA 5AW0A 3KOOA 2FPWA 5AK6A 3IJ5A 3PGVA 2FDRA 2B82A 5AW1A 1Z4NA 3KD3A 4XOUA 4H1WA 2GFHA 1RC8A 2Q5EA 3ED5A 4DW8A 4DFDA 3N1UA 3DAOA 4XPZA 3RFUA 2CN1A 2HHLA 1J97A 2HDOA 1TJ4A 1TJ5A 4UMFA 3A1DA 4G9BA 2YMLA 2WF8A 1ZJJA 3EF0A 2W4MA 1QQ5A 1N9KA 2HOQA 2EARA 3SD7A 4UMVA 4GXTA 3W5CA 4CE6A 4C4SA 2YJ6A 3UM9A 2G06A 5AKIA 3NANA 3ET4A 5AM4A 3E84A 3CZ4A 1QYIA 2CFSA 4BEWA 1S8OA 3EPRA 5AKGA 2DQSA 3QYPA 2B8EA 4Y2XA 3UMGA 1RLOA 4HYTA 5ALDA 2IOFA 3QU9A 1RDFA 3HLTA 3PCTA 4AS2A 4BX3A 2I7DA 3ZVMA 5AKEA 4RETA 5ALVA 1RKUA 1RLMA 1Q91A 1Z4KA 5AICA 4BKMA 1ZD2P 5AW6A 2FI1A 1NRWA 2BDEA 1VJRA 1IWOA 3NASA 1QQ7A 2YN4A 4UAUA 3HYCA 3WGVA 2WF5A 2JGAA 3QUQA 4YCMA 5ALEA 3KBBA 2EAUA 4I9FA 5ALSA 4UU1A 2B1QA 2RARA 3OCZA 4IFTA 5AW7A 2IA5A 2G09A 5AKJA 4EEKA 4BYGA 1TJ3A 1EK2A 4UATA 1L8OA 1L8LA 5ALNA 4Y2JA 5AVYA 2YBDA 3U7HB 2ZG6A 4OCZA 2ZOSA 5AESA 2YMQA 3AR4A 3WK5A 3EF1A 5AKZA 4KNVA 3QU7A 3OCYA 5ALFA 4HGOA 1WZCA 4OD0A 1CR6A 4UMDA 5AM2A 2G80A 3E58A 3I6BA 4G63A 4UM5A 1RRCA 4JDPA 4BEVA 3UMCA 3ZU6A 5AW8A 1U02A 3WK7A 1WR8A 4Y2VA 1SWWA 5AVTA 4KX5A 4ZEXA 2BY4A 5AVVA 3TLMA 3QU2A 1PW5A 3I76A 5AI9A 2EATA 1RPZA 1Z5UA 5AI0A 3WKDA 1RMQA 5ALYA 5AI6A 1SU4A 2Q4TA 2P27A 2R8ZA 2CFRA 3R4CA 2ZBGA 2FEAA 2HCFA 3WGUA 3QU5A 1Z4OA 3ZX5A 4BX0A 2QLTA 4ZEVA 4JB3A 4EZEA 4L57A 3WK9A 3MMZA 2RB5A 3ZTYA 1WPGA 5ALMA 2W43A 3L7YA 3I28A 2HF2A 4UASA 4BNDB 3GYGA 4NFLA 2MU1A 3DV9A 2FUCA 1S2OA 3DNPA 3A3YA 1L7MA 4Y2TA 5AKYA 2PQ0A 1U7PA 4EX6A 3B9RA 3L5KA 3L1UA 1ZRMA 2HX1A 4NWIA 1ZS9A 2RBKA 3FGOA 5AKXA 2ZBFA 4BBJA 3PDWA 3P96A 2RAVA 1L6RA 1CQZA 3KC2A 3L0CA 2GHQA 3DDHA 3QNMA 1VFPA 2B1RA 2OA0A 3ZWKA 1L7NA 4YCLA 1QH9A 5IT0A 4DCCA 1SWVA 1U7OA 1Z88A 2AMYA 4F72A 4UARA 3L0BA 3NALA 3U13A 2NYVA 3ZVLA 3QUTA 5ALWA 4I9GA 2WF7A 1ZD3A 1Z4QA 3W5DA 2B0CA 3W5AA 5AW5A 4YIKA 5AHXA 2P69A 2HF7A 3QU4A 1RQNA 4YGYA 2YJ4A 1EK1A 4NAVA 2HI0A 2HEGA 5AKHA 1TE2A 1Z4JA 4UW9A 4EELA 1YDFA 2ZBEA 3AR8A 1YV9A 2YFYA 3KDPA 4YH1A 5AW2A 5JJBA 3NIWA 2YJ3A 3OPXA 2IOFK 4QJBA 3EWIA 3N28A 2HO4A 5AM3A 2JARA 4HGRA 5AVWA 5AI5A 5AW4A 1TA0A 5AW9A 3K1ZA 5ALKA 2GHTA 5ALIA 1XVIA 2MSNA 1ZRNA 2OBBA 5ALGA 3B9BA 5AI4A 5AM1A 3E81A 1NNLA 2WF9A 2G1AA 4NABA 1XPJA 3B8EA 3OTQA 1RKVA 3N5KA 4AP9A 2IYEA 5ALPA 4F71A 2C4NA
chains in the Genus database with same CATH superfamily
5IP5A 1CR1A 3HB4X 3ZY4A 2RE8A 1IH8A 1TGVA 1B23P 2QMQA 1V9SA 5JMPA 1O77A 3CINA 1GPYA 4M1MA 3EXHC 3MD9A 4RACA 5DNEA 1OFHA 1O87A 5GGYA 4EG6A 1N5KA 4HH1A 4UHHA 2AYZA 4EL0A 1YZKA 2ZAOA 4GSYA 4IDGA 5A4MS 1E4VA 4RLFA 4LPSA 2KP7A 1ZQ9A 2WMYA 4MRRA 1ZMBA 2O3TA 2UUOA 3VR2D 3DCYA 3H04A 3U39A 4UDNA 1F48A 3RBEA 3B3QA 5EJ4A 4JI8B 3PWKA 1WEKA 1P72A 3IXLA 1LGYA 3TKLA 5KFJA 4B9EA 2RHCA 2XUDA 2Y1FA 1H9CA 4WOJA 1H2FA 4WFQA 3ZJ5A 4DDHA 3U80A 5KYGA 4RTLA 1WKCA 3LF2A 1M8JA 2Q6TA 3NCHA 6NULA 4FUTA 3CT6A 5IIMA 1ODFA 3CEPB 3IO5A 2NO4A 1VG8A 2GR9A 2WYVA 1B8PA 2OAP1 2P9FA 3LT5A 4Q37A 4DA7A 4CKCB 4KLOA 5TARA 1P0MA 2C94A 1EH5A 1Q22A 3U44B 7ICIA 3EMBA 4NDZA 3ACDA 4MB0A 1OXTA 3LQRA 2PJDA 1Y3DE 4UE3S 5FI3A 4PVDA 3AGPA 4OI1A 3AEUB 5E6SB 2ZJ8A 1QSGA 3RQSA 4F4HA 2HLDA 4GEGA 4QX6A 5P21A 4B7CA 1KQGA 2GHRA 5H83A 2D59A 3GRVA 3SZMA 2JHGA 2Z2JA 4GXRA 4LJ7A 1DKQA 3E5RA 2QOEA 4WOKA 1JG2A 1RZRD 4ZQFA 5B7NA 4Q8EA 4QTZA 1LA2A 4DKXA 5AR1A 2R7LA 1K7SN 4ZAXA 3IG8A 2HRCA 4MR7A 2FMHA 4DXDA 5HFJA 5KWJA 2XYQA 3ZNNA 5BSTA 4DCGA 1KOGA 4PL1A 4FOSA 3FIUA 4AQ7A 4KDRA 2W4IA 4JWMA 1J9EA 1US8A 4F85A 3UMRA 3ZHSA 1K4YA 5DG7A 1FX0B 1YOVA 2DE0X 3UXOA 3BILA 2OHXA 3TB6A 1XZAA 2WT9A 4BRSA 4H18A 2CVOA 2GNPA 2NP6A 1F1BA 2VDRB 4OXRA 5EA2A 1PVDA 2ZJZA 2VNHA 4IGEA 2JL1A 3WIOA 5A3RA 3WK6A 1I7PA 1BQEA 1S02A 4ZO9A 3TLGB 3GIDA 4HEA6 3CA8A 2WT4A 1E77A 3HB7A 3OCXA 2HHVA 4BNXA 2CSXA 3BJMA 4PLVA 3H0MB 2HLHA 2JJ2A 3LXXA 4D4LA 1ED1A 3ND6A 4D4JA 5KTPA 3NBMA 3B6EA 2ZYWX 2FLNA 1Z4LA 2ACEA 4KQJA 3RSFA 1M1ZA 2YNMA 3KZCA 2RGGA 2E1EA 3TR6A 1QRTA 1P5RA 2WVJA 1MG5A 2MSDB 4MGYR 2I9KA 3CPHA 2BKUA 4NR0A 3KUCA 4YQEA 5J40A 1VHWA 3PC8C 2P2SA 3EPIA 4FUQA 1FIQA 2F8MA 3AR5A 3QHAA 4S1TA 5M3BA 4B5KA 2LDBA 3LECA 1R0BA 1YJAA 1Z45A 4L0DA 3UJDA 3E3LA 2PKQP 1FXUA 1IDOA 5I5GA 4KR0A 3BSWA 4NS4A 3PVCA 4TSFA 1AMNA 2W8BA 2QA5A 5EWJB 1B26A 4BVGA 3KK0A 1UFRA 2PBFA 4PSVA 1T9ZA 1IVNA 5THKA 1BDBA 1GG8A 2BM8A 1TC2A 4HMPA 3BS7A 4X92A 1N4AA 3L3BA 3VYSB 4CDMA 4RH3A 7ICNA 3MJRA 8GPBA 3QXGA 4P4LA 3RUHA 1U9IC 4BN4A 3ZH2A 1S4MA 4FPXA 4KPUA 3L7OA 1DX4A 2HEIA 2ZSAA 3AEXA 1K7FB 1UBJS 3EGVA 1XP5A 3OBBA 2QMZA 5EIOA 4P4GA 2Q3LA 4GRDA 4YXWA 4IJMA 1PK1B 2BFDA 3LZCA 3ZV4A 3QUCA 2AOWA 1YFLA 4AYBF 1JHUA 4KREA 2CT8A 3L9WA 4IOJA 1J2UA 1TZJA 2I6SA 3NDIA 4MEAA 4CDRA 2H6EA 3SENA 4M7RA 4RL4A 5FWYB 3SBDA 4B32A 3BK1A 5F7XA 3UAXA 1RWNA 3T3EA 1QO0A 3Q2KA 3E4DA 4I28A 2F1OA 2VJMA 4V0LA 4OFXA 3K2QA 4LCJA 3TQRA 2XR1A 3LLVA 5T14A 1ZMRA 2WUEA 3A6KA 3D6FA 4JJKA 4R1UA 3X0DA 5L3SA 4JKYA 1P1RA 2B6GA 8ICQA 3T4EA 3W78A 2FWBA 1FOEB 5ESRA 3SQDA 4MO9A 3RYIA 1IHUA 3G2JA 1XMQB 1SNYA 1T94A 1BO6A 1MBZA 2JD2A 2XGGA 4NSNA 5A0FA 1XLWA 5M29A 1DLIA 1IWPB 1EDEA 1XTPA 2ZRBA 1A7KA 3RS9A 2PEYA 3CF2A 1JE1A 3CKKA 4JP2A 3F9CA 4MAMA 4OQQA 4PU0A 3ZI7A 1TPZA 3L2OB 1YIDA 5JMWA 3HU3A 1DV1A 1IEXA 2W2KA 2V3CC 3QMPA 4QYIA 2AIRA 3QUSA 2OBNA 1KSFX 5DTJA 2VTBB 3KKZA 1RXEA 3P1JA 4J9PA 4DOAA 4YR3A 4C5BA 5EOZA 5TT1A 4NYMQ 4HVLA 4UUNA 2VT3A 2AJ8A 2EKQA 2ZPUA 4DA4A 4N18A 5HW0A 4TLMB 1ZQWA 1S5LU 4EJ0A 1V95A 3FHTA 4XVCA 1DX9A 2AHOA 2VRWA 3RABA 3ZWPA 5ETJA 3PRKE 1Z74A 3NEJA 4LVOA 3ECSA 2JV3A 3Q88A 4PGFA 4CYMA 3SC4A 1OVMA 3Q9NA 3VV2A 3NBKA 3R3VA 4L3WA 4QUAA 4CU2A 5BMVF 2WFMA 1ANKA 1IBCA 4PLYA 5FBLB 1GCOA 3G2MA 3GNLA 4LC1A 5IX8A 3ZQJA 5JCOC 2CE2X 2G5IB 2IXEA 1ZJ4A 2ZREA 2DH5A 5DLQC 3FBGA 5FBWB 3VZBA 5DV9A 1O08A 3UMBA 5CIWA 2O5RA 1GLGA 2WU0A 4OQDA 4CM8B 3O4IA 1NHGA 2ZIGA 4II2A 5KFYA 1SPXA 1VJCA 2E1FA 2PL1A 4N40A 5EJAA 3R8FA 4JJ8A 3KKAC 4OJ6A 2VI5A 4M0KA 4EYIB 3HCAA 1N2SA 4TKUA 5KFRA 3KL2A 5T57A 4TMXA 1P39A 1JLKA 1C0IA 2C4MA 1FBNA 3HPQA 5JSHA 3B5IA 3IB3A 5ER6A 2Q3HA 1XLTC 4FOTA 5GADl 4GLFA 4BO2A 1Z7EA 4NYIR 3LWDA 1T5OA 4UB2A 1E5TA 4U39A 1RI4A 2IP4A 5JFGA 2ZR9A 2HHSA 1IATA 2X9LA 2PE5A 3P4XA 3IQXA 5EP2A 1WDLA 1K6IA 1UCFA 4DZZA 3OPYA 5CT8A 3ED5A 3O8DA 4CMGA 2JS7A 1IN7A 3DAOA 5KG2A 4IICA 4U9HS 3RNOA 4A2WA 4ESHA 2HDOA 1COKA 3KR2A 3NEAA 5D46A 1WNTA 2Q41A 5JQGB 3R9IA 1P4GA 2GRUA 2FCAA 3UYLA 1K08A 3DPSA 3PFHA 3CZCA 4CKXA 1OBOA 1ZPDA 1COOA 5BYKA 4XM1A 2NVUA 5FL3A 4YJ3F 2A86A 2WA2A 1I80A 3F74A 3BQNB 3SJBA 4M53A 1TZMA 3HADA 3K20A 4KQWA 1PS0A 1A4IA 1Z0FA 3HBNA 4LXUA 3FOBA 3AILA 4MDHA 3SQNA 3QKRA 2UZ0A 2X0RA 3FNRA 1QLNA 1OI3A 3OE7D 7REQB 3G9TA 3KYBA 4NK4A 1AA6A 4I2BA 2NXWA 1VMKA 1WW2A 4JQSA 3NBXX 3H1EA 4MQBA 5EPOA 3RD5A 5JYCA 5HZKA 3RR7A 3HWTA 4B82A 2P4HX 2OFWA 4B4VA 1DVRA 2C03A 2I2WA 3USZA 4DARA 4L3OA 4L4YA 1IHYA 2K8CB 4WXEA 3SSOA 1IJFA 1QZZA 4S1PA 4WESB 2WTNA 1ZGBA 2GOLA 2HH9A 3IBTA 2VXCA 3HVUA 5CNJA 4R98A 4Z0HO 3SYMA 3OA0A 3VPGA 1GNLA 1T8UA 2INGX 4LQDA 3ENQA 4PWYA 3UTDA 3R5KA 5ALDA 3TBHA 1ZQZA 1NSFA 4ALNA 3MJTA 2OSBA 3ELBA 2O2CA 2ZIXA 1FNDA 1PFVA 4K1LA 4M8KA 4BE9A 4BVBA 2PT5A 5AXCA 1XXHB 3HLTA 3QIVA 1YB5A 5EP1A 5LQDA 1EUDB 3EA5A 3C5WP 1F2UB 5DGAA 1MRNA 1I2DA 2V7UA 2ZYHA 3NHKA 4W7IA 1DBQA 3EVNA 4WOBA 3JW8A 4X90A 1U0TA 2CLLB 1RLMA 3RARA 4FZMA 1ADGA 2A9RA 4EARA 5I7VA 2WJPA 1IAVA 3GRAA 3L4EA 4R7TA 1S76D 2FI1A 5GONB 3NBYC 1HOTA 3MM4A 4QDXA 1GNQA 1VJRA 2XOKA 1KETA 4OQMA 4N0MA 5K01A 4KHPB 2WAQF 1FRZA 5I7HA 3A1SA 1GKIA 1GGKA 5EIFA 4KE7A 3DV2A 3AHIA 2OWEA 3AFIA 3EIHA 1KVUA 4BFCA 4EG7A 4S1VA 3TTTA 2BGLA 3B1ZA 2HNKA 2MRLA 4LQLA 4M87A 3VR6H 1R10A 1AXRA 3IQGX 2IA5A 3ZE1B 2CXYA 3ANNA 2TRSB 4LTNA 3ZV3A 2R6JA 1FP4B 5BSFA 3HQ4O 2IYTA 3H4BA 2I5PO 5BP7A 4DV5B 1EK2A 4NICA 4ACBA 3KZ1E 5K0CA 4KPYA 4AJPA 4JHLA 1XWFA 5ALNA 1SZCA 1PP4A 1YKGA 4FMDF 1EXVA 4W82A 3IL2A 1AKYA 2ZOSA 1NW7A 1XNHA 3EVGA 2CEKA 4JJIA 3DE5X 4TS9A 1P2SA 1YBHA 1UBTS 2C3MA 2I6TA 2W03A 2ZPTX 3G9XA 3KQWA 4C8LA 1OC4A 2QUZA 4CQJA 4MINA 1RXSA 5A6SB 5ES3A 5HBGA 1AO0A 2AR0A 2BEKA 2X7JA 4CLRA 2H9YA 1W85B 1GPAA 2R5FA 3C85A 4O4IF 3NFYA 1V11A 4B9VA 1OGYA 2IYRA 3DMGA 1UPXA 1BKYA 2GN8A 3FHJA 4CGZA 2A1JB 3BF8A 4QW8A 2X2EA 3BMOB 2H85A 2YQEA 1FRVA 1UOEA 5K0FA 4D4IA 1KS9A 2QRVB 3I0ZA 4BVLA 1Z33A 4BJ3A 5I5EA 4MGZR 3I37X 3AKCA 1AUXA 1GA1A 2Q1WA 1QHHA 3EXG1 3H0CA 1TM7E 2R1VA 2W48A 4UZSA 1EVJA 1FUIA 1TQHA 1ZK3A 4QWEA 3C45A 4PXAA 4RKEA 1CUHA 3RDPA 3EXFA 4I4TA 4B4KA 3O3NB 3Q6IA 2J3DA 1NQWA 2R62A 1DKNA 3S3TA 4J1NA 2H4ZA 1UBRS 1H93A 4NCNA 2CC2A 5K20A 1JEAA 1E2JA 2HGSA 3M9WA 1J7JA 3LIIA 3QYAA 4JJ4A 3A2KA 4HO1X 2GM4A 2Z2KA 3JQAA 4PYMA 4II7A 2JA2A 1LLUA 3TEMA 1ZH4A 3SEFA 2JLWA 1B41A 2CJFA 2QD5A 3DA8A 1KY4A 4P82A 1ZMOA 3E5NA 3LF1A 4C7OB 4JB3A 3VZPA 4NPCA 1FRFS 4EZEA 1PGQA 3FMPB 3HP6A 3A4NA 5JMOA 3PUXA 4LRYA 5E0KB 1NBOA 1LPMA 4O4HF 4F97A 4QRDA 1GU7A 1US8B 4IXMA 4D3SA 3C21A 4IUBS 3V1LA 2BJVA 2I6QA 4ZT3A 1YMVA 2SECE 1QGED 4J7XA 4Q7LA 2NSHA 5D5QA 5LB2A 3AFHA 1QIMA 4ZOCA 1K98A 4DT1A 4J7CA 4I6GA 4L8GA 1PW7A 1SXJC 4TXLA 4WBXC 5G53C 3T5GA 4V1CA 4PC7A 4DLTA 5KU1A 2ZM6B 4RGVA 5JSKA 1QVAA 4MR8A 1GUBA 2PUEA 4LKOA 1XF1A 4JQYA 1R4NA 2LYHA 2GERA 3SZ3A 3GUCA 1DJLA 1GT91 1ZI6A 5C4MA 3DXFA 3T34A 1QFXA 2JFZA 3DPIA 1BKDR 3SJAA 1G64A 4EKNB 4F21A 2QVGA 2O06A 3UUGA 1S8FA 4FJ2A 3K9LA 3N2IA 3PA6A 4KO4S 4L73A 1E7QA 1LNQA 4Y30A 1Q0PA 3R44A 3RU3A 3TMKA 8ICTA 4D2IA 1PF7E 2A78A 2YXLA 1DJOA 1B1CA 2C7PA 4B1FA 2IXBA 4GLXA 1GTL1 2B7LA 3PT5A 3FWKA 4KMRA 5JUMA 3OX3A 1T5BA 3FTFA 4QM6A 5ITSA 4ICAA 3ADPA 4R8MA 4QBKA 3B1VA 1Z0IA 1KI6B 1NSTA 2P2CA 4C6SA 3FYDA 3P9NA 3KB2A 2KM1A 1X7ZA 2IPMA 1RJFA 3W0LB 3M1AA 5DM1A 1ZQQA 1F0KA 3ROMA 2YFQA 1I9GA 5IT9A 3NS7A 5I9SA 1QJ4A 3FCCA 2F8KA 2CXSA 4Q47A 4DL2A 2R25B 1OE0A 1KOLA 4ZYLA 2FH5B 2V1XA 3LC0A 4RZ3A 2BFDB 3COWA 1U8ZA 3JQRA 2F8TA 1DMSA 4N5IX 2QLFA 4W99A 3TQHA 2XB2A 2O8DA 1UDAA 2XUQA 5EMJA 1MO3A 1DT5A 4YGYA 5LIPA 3AQ4A 2CXOA 5GM1A 2ENWA 4R3UC 1B8NA 9ICMA 1CNEA 4NULA 1Z0KA 3OQVA 3VU9B 5EP4A 4XR9A 1WUJS 1Z4JA 2XDAA 1UMDB 4RTKA 2EFJA 3E22A 4WINA 2UYHA 3IUNA 2I78A 1G21A 3A1FA 1TVMA 4W5QA 3LUHA 1UAAA 5KAMA 4BNUA 3PX3A 3AL0B 4DAOA 1CR4A 5K3EA 1FXWA 1DXSA 3E0XA 5INTA 1P5JA 5AI5A 1E6EA 2QN2A 3FROA 1XP8A 3K73O 4UQOA 2HW8A 4P5DA 3WGNA 5ALKA 3Q72A 4MWCA 4QUJA 4N8DA 2FPOA 1E20A 4C30A 4D9GA 3I9LA 4EVSA 4DUGD 2D1YA 2YYSA 3DS8A 4ZYTA 3F97A 2C83A 1YAJA 4DFJA 2POCA 3HYNA 4FLEA 4I50A 4XYMA 4G5YA 4CMEC 3NDRA 1E9RA 1JKMA 5KAPA 1LLFA 1QRDA 1XJCA 2YVUA 3FDJA 5CM8B 1SHTX 3EVBA 2AQKA 3OA2A 1BDIA 1E1RA 8ICKA 1ZXLA 3O75A 3S2ZA 5KFKA 5B5SA 3J81A 1HG1A 3L41A 3F6RA 4LSGA 3VNUA 3A9RA 4U7CA 3A06A 1D2HA 2I0FA 2PWAA 1EFRA 2ZWIA 3DOEA 3Q0EA 1NKBA 3HHPA 4MVJE 2DUUA 2FRXA 5A3QA 1PT6A 1YQXA 5BNTA 2XE8A 2P75A 2AHOB 4GI2A 4LHZA 2KIWA 3E2EA 5A5FA 4D5EA 1ZUD1 2G7MC 5KYNA 4L75A 1V48A 5KYXA 3A6ZA 1JYSA 3NRWA 1U28C 1F0MA 3C7KA 1G1MA 2FN3A 4RQUA 4DMKA 3J7AC 3U3ZA 1M8FA 1UWLA 1Z5ZA 3ZKWA 4JI6B 4C8OA 3CLUC 3EA4A 3GJ3A 3A6HA 4B3SB 4KNWA 3BTVA 3ESQA 2CF6A 4GBJA 4OJQA 4CODB 1WULS 4RESA 1OWMA 5CA0F 2XI4A 4OQ4A 1U0HC 2DHDA 3KQTA 2UVUA 4QUDA 3LFUA 1GTZA 3L8YA 4P58A 1TL7C 1L4EA 2WYHA 4RMNA 1E0KA 3DD5A 3WKAA 4P83A 2OO3A 2Q8NA 2IP1A 1EE2A 2C5AA 5G5GA 1VMDA 2BSAA 2JJ8A 2VPPA 3EQZA 3NCTA 3ZWBA 3W5DA 4N9QA 4I6EA 4QIHA 2C4HA 3ZWDA 3NRCA 1EMDA 2PS9A 3ZXYA 4AZVA 4IDNA 4DMCA 4M1QA 4AL4A 5HUHA 3GP5A 3WBFA 3GT7A 1JBKA 4MV9A 3PHIA 3D6JA 1CZOA 4B85A 2LTAA 2I3GA 1W88A 5EQTA 3IE1A 2GUGA 4A8JC 2H2AA 3LSTA 2WKWA 3OZDA 2I80A 2QM7A 3D7MA 3V48A 4BNMA 1ZQXA 2HYDA 2NYRA 2YXDA 1FLNA 2NO9A 3C8DA 1JZTA 1HZZA 1U0SY 3DG9A 3LCCA 5E9JA 5FHRA 3SE7A 5AVXA 5GINE 1XRPA 4IHJB 3HABA 3HYSA 2EKLA 2VEDA 1FMCA 1E1DA 2YS6A 3HYRA 3K8QA 2ADFA 4U02A 5DTQA 4E0BA 5CAEA 4FQ5A 4BXOA 3O4VA 2FPXA 1YUMA 4B3HA 5A62A 1SQGA 1I0IA 3Q10A 1IUOA 5BR1A 1V3QE 5DPMA 3RRYA 3SR4A 1NFFA 4RT2A 3H7IA 3ZS9A 4BQSA 1HR0B 4ARSA 4FOOA 1GZ6A 1ZH2A 2PKCA 1W30A 3ROKA 5BO5A 4DBZA 4F6RA 4I2AA 1G9SA 1FY2A 3NGLA 2C57A 4B7ZA 1N2BA 1QHNA 2I62A 4MO2A 4F2PA 2NGRA 2X0JA 1IJBA 1GZ4A 2BEUB 2XUKA 3MN1A 4UM7A 1SVOA 4U8HA 4E4RA 1D04A 2VAVA 1Q3VA 3CUKA 3DAGA 1A4RA 1NIJA 2GCGA 4Z3OA 1ISFA 1JFLA 1JXOA 1Z2EA 4ND3A 3Q7EA 1AS2A 4OQYA 1EDDA 4XYGA 3UXHA 2VJBA 4ECEA 5DP1A 4LJYA 1UEJA 2FFRA 3BAZA 4WUVA 3PIRA 3FETA 4O29A 3LYUA 5DGHA 1JKFA 1KY2A 2P6RA 1IK4A 1VLBA 4Y2SA 1L6IA 1P2GA 1XK6A 2J5KA 5CJJA 4YAWA 4EW1A 1YZ6A 5L95A 8AT1A 1NXXA 3DYIA 1HTWA 3GT0A 1NONA 1XVAA 5DKWA 2AJBA 1DL5A 4JITA 3BFKA 4Q7EA 4ND8B 4XWGA 3CZ9A 5DT2A 4P84A 5GM2A 4BX2A 3ICPA 4RUKA 3MOSA 3PW0A 1G17A 1FDIA 4URFA 5DN6A 2ACVA 3C1YA 3MPOA 3THVA 3EYWA 5LU8A 3KEMA 3E05A 2A9PA 4RAOA 4Y3UA 1Q14A 3VJKA 3GRUA 5JAZA 4B6SA 4PLCA 2YY7A 4TLDA 4IUYA 1XQ9A 3SMVA 4ZQCB 2KSQA 3SVZA 4RTOA 1SCJA 3MDAA 3LA8A 2VNIA 4GIBA 2UKDA 3M6XA 4OHFA 2JLSA 4G4SO 5SYNA 3V9AA 4OHWA 2G88A 2ZT7A 3QYJA 4J9QA 4GKAA 3RHFA 3J81k 3LIPA 4DNXA 1T15A 3RJEA 1ODSA 6YASA 5I7RA 3O8RA 3GYBA 3BKWA 1RYHA 1TIKA 2ORED 1A9SA 1NWCA 4MRPA 2TS1A 4O2AA 1Y4UA 4JBXA 3MB5A 5FNVB 3TRFA 1L7QA 4ZZ3A 4C6RA 4G9EA 3HFRA 2J6TA 1I13A 1ZSYA 3KQOA 5FFNA 3AEVA 4H35A 4B5LA 2BFEB 3P5SA 4E5NA 2B2XA 5BNZA 1H2ZA 2WNIA 4QBIA 1QYWA 4KLZA 4F91B 1WWKA 2YJZA 5A5EA 4YHHB 3CGWA 3MOGA 2A6PA 4O2RA 4X20B 3SU8A 4EVRA 16PKA 3PGMA 3IAHA 3IPAA 2NSYA 3U26A 2J6CA 3KSDO 4RM3A 5JH7F 3C4JA 2CLSA 3WOHA 3OEYA 3U4HA 1BWPA 3IC5A 2JI4A 4G65A 3G89A 2VYNA 2FETA 1ZHHA 1ENYA 2QP9X 3T6KA 4UBCA 2HW3A 2FZCA 3SDBA 3TPFA 5DQHA 1OGJA 2WSSA 2JLXA 3ISJA 4JI3B 4Z4GA 2D1RA 3G7NA 3FWNA 2AFHE 4PO8A 4PZUA 2I6XA 3PVZA 2BH9A 1O8BA 2DRIA 4XLTA 4PPGA 3QHQA 4AW9A 4YMGA 5LYJF 4V0KA 3JVIA 4MIYA 1KYZA 4RKRA 4EVQA 4KRGA 4QLBA 3NIFB 1WUDA 4CWAA 3TQQA 1VKHA 2HMSA 1ZEMA 3D4PA 3I5AA 4NX2A 2GILA 4OYLA 2DPYA 3ZDXB 5CLFA 3GLRA 2BCRA 3FN4A 4BVEA 5KO2A 4HB4A 1DSSG 2I2CA 3PQ7A 1Z2CA 3LQ2A 5BN5B 5TB5A 4XCVA 4GRIA 4E14A 4K26A 4X63A 2JGRA 2OZEA 2RJ3A 3AR3A 1GUAA 2IU4A 1YBVA 2J85A 3N0WA 2D3TA 1ZCJA 4LHYA 3DHNA 1IXZA 3ZGLA 4M0AA 4ZP1A 4M0DA 1H23A 4TUYA 3QTLA 4YRKA 5AUOB 3NTQA 4RK5A 1FZTA 3SKYA 2JCBA 2QVZX 3MS4A 3FMVA 1VCHA 3Q15C 4C4OA 1N92A 1L3SA 4CG2A 5IJ0B 4HXYA 1AV7A 5EWEA 5JO0A 3EOBI 3MWDA 5BN4B 3EASA 4P32A 3AL3A 2G0AA 4N5LA 5DHFA 2PSFA 5CGQB 2CXRA 2P65A 1IK6A 3H5WA 4RXUA 1ORWA 2ID4A 2V6GA 2YW9A 3HDTA 1SKSA 5L1IA 5IS2A 3UJ8A 1P9RA 2JLQA 2XGPA 5FB3A 5B3JC 2NU7A 2AXNA 2WD9A 3H1PA 4TV8F 1C8LA 1SU7A 5DLYA 3ZY3A 1CE8B 2ID7A 1U8UA 3OVMA 3K70D 2OO5A 3UAOA 4ZQGA 5T4HA 1T1EA 3LP5A 4O5AA 3BWDD 4XVHA 1NJ6A 4LECA 3AVTA 3RVQA 4HHEA 5F5LA 2VVTA 4MB2A 5BPFA 1QH8B 4R0MA 2ID8A 2ZJ7A 3DHVA 1DTSA 1NT2A 4QOGA 4ZHQF 5C7LO 4DFMA 3MT7A 3T9DA 1BDHA 3K7EA 1U3UA 2Z4TA 4OVKA 5E7MA 5LQSA 4ER5A 3JQCA 4JV2A 5EERA 1YRHA 4YMHA 1QG0A 4B9SA 4EHIA 3F46A 1VHJA 1RHKA 3KTDA 5TQ2B 1QHEA 1Q77A 2PUTA 2IFTA 4ZVQA 1IY2A 1RPJA 3GUZA 4RPGA 3KYDA 4KLEA 4NHOA 1GTRA 1IG6A 2XMSA 4A23A 3KJQA 4Y6QA 1IAQA 4IRCA 4G85A 4QNMA 4RZRA 3K0KA 5FI0B 3VZDA 4FNOA 2IIVA 5BMVA 2IWRA 5C3MA 3QQ5A 1VBKA 5CDGA 2EF0A 3VBEA 2O54A 2GCNA 2L42A 2UZ4A 2WSIA 1ULBA 3UM9A 1KI6A 3PEEA 3RYHB 4O1IA 3PQEA 1UWCA 1B00A 1MF7A 3ZIAD 4K8RB 1PL8A 3TADA 1OXXK 1Y3FE 1FQJA 2AMJA 2DQSA 5H02A 3K3PA 1MIHA 2P7HA 1U8XX 1MLDA 4LK3A 2ZIUA 1NNSA 1PGPA 1R64A 1T2CA 2VHYA 3PGJA 2ZT5A 4FR5A 4C5CA 4F4DA 4JOBA 4HNUA 3EPKA 1XZDA 1N75A 2E6KA 2PL3A 1V5GA 2JKZA 3EG5A 3A58B 3NHSA 5CJPA 5G0TA 4PG7A 2DHRA 5C5EA 3ZZMA 2V7PA 1KY3A 3GNQA 4Q4JB 1A2OA 4GRAA 1L5SA 2JH3A 2ISOA 1HEUA 5MDHA 2ZIWA 4JLUA 2WSSD 2AWOA 1QC5A 4RELA 1Q91A 4KTTE 3WP0A 4I29A 2QD4A 1OLXA 1NVXQ 3P9KA 4ADSG 3S40A 1APBA 1O0CA 3DD1A 2PSJA 1ZQJA 2P3LA 3O3MB 4NCAA 1ECLA 2QUKA 3AIIA 3FG9A 4XI9A 1G9TA 2O8NA 1V47A 1NN1A 2C99A 3HRIA 1X7GA 2BHTA 4MV1A 3W2TA 1T8TA 4MF8A 2BZGA 4UXHA 4EGJA 5KSOA 3HYCA 3L77A 1P9NA 1T3LA 3EQ9A 2H63A 3OT1B 4CJXA 1L4BA 3GJRA 5TMEA 5TVKA 3QE0A 1PR1A 3B3FA 3NKVA 1Y6RA 3PF9A 3IKTA 3B60A 4DV2B 4NY8A 4ZI3A 2PI4A 2PH3A 4CM3A 4QU8A 4AK9A 1YDGA 1U48A 3GFBA 1NLMA 4C43A 2NRXA 4KPFC 1GO3F 4EYQA 2FE9A 1SBCA 4HAOA 3ETRA 2BF7A 5IAEA 4U8GA 2CD9A 2GPWA 2ZG6A 2AKYA 5B4UA 1B0AA 1FDTA 4G0PA 5TPZD 3WI7A 9ICBA 1YZ3A 8ICBA 1Z26A 2VOJA 3MEQA 3DV0B 3WX0A 3EFOB 3HBJA 4PAOA 1N1MA 2CBXA 3B2NA 5JH7A 4KO1S 4LWQA 4ABTA 1SKMA 3QU7A 1NULA 1YMUA 2C98A 4JBNA 1C9DB 1E98A 2ZYSA 4ZAVA 4DLZA 1DXQA 3KSBC 1JMSA 1O97C 2D5IA 1CUEA 1QCYA 3WAGA 2Y2VA 4Y6LA 3N58A 4P4OA 3PWTA 4ZVVA 3M6KA 2MDTA 3U81A 2A7QA 2XW6A 4QA9A 4XWTA 3EVDA 4CQMD 2I5HA 4IFEA 2VHUA 2H52A 4DM4A 1VE1A 5CA1F 3EY9A 3W2IA 1T8YA 2Y6UA 2YWCA 2W2MA 2A1UA 3BPSA 1I1NA 2VTVA 1QXSA 1M0SA 1NLYA 4NNJA 4WOCA 2ZUFA 3G2NA 4L9RA 2WYOA 3TLMA 1TM5E 1GL6A 3KTQA 1PW5A 3QXJA 2ZRPA 4GXNA 2BHRA 3AB7A 4QZFA 5CVVA 3IA2A 1LDNA 2AEJA 3CPJB 2OV3A 1RWKA 2V7QA 2W4QA 4IXTA 3VC3A 1M66A 2G28A 1V7QA 2Q4TA 1TFUA 2B36A 2CFRA 3BCHA 4HFNA 2EQAA 4NH4A 3PW4A 4G5XA 4MMYB 2G9VA 1EEHA 2GM5A 4MKIA 3TCKA 621PA 1ODTC 3E8SA 1PLKA 1GSAA 4FGZA 4Y6PA 1AQIA 1NJSA 4RF5A 3H9BA 4Q0MA 2VANA 1GTG1 2RGNC 1OBVA 2HK8A 1N7HA 4JUAA 3OJSA 4A0GA 1TKAA 3I3SR 4M0FA 3P9RA 3VDQA 2DPHA 3TVTA 3GX1A 2C58A 3IKLA 4XARA 3GUVA 3PJFA 1SD5A 1RRMA 3O03A 3QPUA 4JCOA 3KHGA 1WPGA 2J7PD 3OKFA 3PSAA 2ODNA 2W43A 1VI5A 2XE7A 5CAEB 2OQ2A 4GL4A 5A2GA 5KWEA 1TTTA 2X0KA 4TS4A 3KT0A 2JDID 2XVZA 1CDOA 3MJVA 1XCLA 1YI8A 5L1LA 1LV5A 1PD0A 2FFJA 1Y37A 2KE7A 3VNAA 4O02B 1YR2A 5LU9A 2Q3FA 3EC1A 2XX3A 3T3GA 4G0VA 1GPMA 4K4IA 4F5QA 1W1WA 3DCNA 1Z6AA 4KXMA 4Q3AA 4WKPA 1EWYA 3CWZA 4Y2TA 3WOVA 4JXXA 1M5UA 3DVLA 2H0AA 3WDLA 1NPYA 3BHMA 3L5KA 4D92A 5LWHA 2AF4C 1WF6A 2O2DA 1Z0DA 2RHMA 3RS3A 4ALLA 4YCSA 3E7FA 4ZOBA 3OQ1A 5F5XA 1ZVJA 4AECA 1XQVA 1KO7A 2R11A 3LQ4A 1ZDMA 1KIMA 1RXCA 4HTAA 5ADHA 5A71A 2WSYB 4I55A 1SZJG 2AXEA 4IQ0A 3AQIA 2Q0SA 3QFTA 1HE8B 3UK0A 1QH1B 2B1RA 3EOZA 1GAXA 1Q1AA 3GJ0A 3NP7A 5KYYA 5BUQA 4JLKA 4RVDA 3A1TA 4MGKR 2OGSA 2FYTA 2L5YA 3AERB 1NVMB 1QGDA 1SUFA 4URUR 1C9EA 3N3BC 3L82B 1UK9A 2QIPA 5L9AA 1AHPA 3HJGA 3TWOA 2X8LA 2RDMA 1NVUQ 4B3XA 3E3OA 4DZRA 1Y8ZA 4YXJA 13PKA 1CF9A 3AEKA 4F50A 3I9V6 4QYTA 5KOHB 5J2UF 1NJ5A 1AUOA 1VLHA 2BFNA 2FFAA 3QMWA 4ISBA 5CK4A 3I0NA 4P3YA 1I30A 1KEVA 3CUYA 1KDPA 2V6IA 2PZEA 3M6AA 3G02A 4QQRA 3I2IA 4TMKA 3ELYA 4E31A 3R0IA 5JAPA 4ZOQI 3R2JA 2CCJA 1FFSA 3R6LA 1WXDA 3DOCA 4GG1A 4BNYA 1K4KA 3FDIA 3OQJA 3IHTA 2WWGA 1BS1A 4UBBA 2VRCA 2AQIA 2D5AA 3O3OB 4YQWA 4LDRA 7MHTA 3KDPA 4FYIA 4YRSA 2FOXA 2Q6IA 2B0JA 1P75A 2XQGA 3C5EA 4K2AA 2D7JA 2QVCA 5FNVA 1NP6A 5LA6F 1UZMA 4RU9A 4ELVA 1Z1VA 3LY9A 3UA3A 4F6LA 3KSUA 3ROZA 2UUCB 3Q8LA 3M6FA 2O48X 4EM6A 1BU8A 1PT9A 5EMHA 3RYCA 4E5DA 1Z5VA 3IO3A 1T43A 3VGJA 5LFAA 1HEYA 3HB5X 4AMYA 4I9HA 3GLQA 3I9FA 4TUSA 1R2QA 2OHIA 3D64A 1XVIA 5H9VA 1ML3A 2AJCA 2XZTA 3OEHA 5ALGA 2P3OA 1PFKA 4ASUD 3OHPA 3AP1A 1NNLA 5HRUA 2LKYA 2HBMA 3C6XA 4MMXB 3TRDA 2GBPA 5DM4A 3PE6A 4N5NA 2PPLA 3T52A 2PXIA 5JSZB 4XSGA 2RSLA 3ODPA 3KXDA 1G16A 4K9PA 1G6KA 1ESZA 2KS6A 2GZAA 3UHJA 5JXJA 1E7SA 3FM9A 1P9OA 2H9AA 2YCBA 4JYZA 4B9MA 1L7BA 1GKYA 2YV5A 4X1YA 2QMHA 2A5YB 3TJMA 4RTNA 1D2RA 4D8XA 1LJUA 4OY3A 2GWRA 4FSDA 1Y48E 2SKDA 4H1TA 4V0OA 4YO8A 2P5YA 4KLDA 5J5CA 3GPDG 3WQQA 1MB2A 5H70A 4H6WA 3ZX4A 1KI3A 3JXEA 1SKUA 5CT4A 4MVJP 5KG5A 2BIFA 2XZDA 3FBWA 5K2MA 5TGDA 1GN9A 4PSKA 2Q6VA 2N0SA 1JH9A 1QQ6A 1PLJA 4E1VA 4MP6A 2CNKA 3NHZA 4OREX 2JZCA 1MHPA 5ERGB 2PU7A 3KJNA 3PHGA 2J32A 3VH1A 3P9PA 3F7TA 2D1FA 2VJOA 1NXTA 2FA9A 4YP9A 5TISU 1IEVA 1Y4DE 4HQ0A 3WIDA 3RJJA 1W4ZA 2IW1A 3OWOA 5A04A 1CQIB 1W9MA 3GLIB 2OY0A 1UM8A 2ES4A 4NPHA 2JBWA 2O6KA 4IH1A 1Z6TA 2R8XA 3EGXB 1H8ED 4LZJA 3RR8A 3KTAA 3ONEA 1F0PA 4IW3B 4MQFA 4R2WA 2X19A 2C5SA 4DMGA 4H60A 5KTRA 4PYQA 4NCXA 1J1ZA 2G1PA 5HE8A 4D43A 2P6NA 4PO3X 3OICA 1UBNA 3X1DA 4AC9A 2B20A 2O2SA 5G3YA 1JLMA 4JR1A 4REOA 4QDTA 2XBMA 2VNJA 3CUTA 5MFZA 4C0ZA 1VA4A 1CE8A 3RVJA 3HA3A 8OHMA 4BRZA 1SC9A 4KKVA 4B7XA 3AI2A 4XUSA 2W58A 1W75A 3RJMA 4CI0B 3O9MA 5EMMA 1QMGA 4M8IA 4S35A 1B8OA 1T1SA 2C9ZA 3AGQA 3CRMA 2ZGVA 3OY7A 4ROSA 5DI3B 2IEBA 3ESCA 3ZDAA 3V1UA 4L6AA 4KO2S 3DFUA 4QUHA 1TAQA 3UH0A 4RPIA 2WBLC 2X3UA 2PVCA 5J9FA 1UMBA 2ODQA 3IILA 4O4JF 2N46A 5DMXA 4M0UA 1T0BA 5IVPA 4D45A 1HFEL 1C0LA 1F60A 3F7OA 3IR6A 4ALJA 4DDMA 1W47A 1BGVA 3MGIA 4WLVA 4DR2B 2XBUA 3OZSA 3UWKA 4KXXA 3F90A 2QZPA 4PGHA 5IINA 1GTVA 2EDUA 4L08A 4IUCS 4UCXA 3IEKA 4RVHA 4Y1RA 4OHOA 5H3LA 3SN6A 2PV7A 4JVLA 4XIFA 4AVYA 2EFEB 1UFOA 3C6BA 3EQ8A 1P4RA 3P0IA 4TKZA 3V33A 1S96A 3ZJVA 3VYTB 3SSMA 4O3RA 2D4AA 7YASA 4TTIA 3HEMA 4G3XA 5JPDA 4QVGA 4CNQA 1T34A 1XQXA 2B25A 3WLFA 4KCGA 5DM70 1E3DA 5D8DA 1OBFO 1H6CA 2FZGA 4OXKA 3V3TA 3U3MA 3NBQA 4Q4AA 2A4KA 3JATB 4IGAA 4UCFA 3NONA 1XD2B 1I4LD 3D4OA 3TLCA 1H38A 1N2EA 4KEAA 2XLBA 4PX2A 2H2HA 3OZVA 3UMSA 9ICTA 4AJ1A 2R60A 1XZ8A 4PV7A 3I1YA 5EUQB 2K7ZA 2X7HA 3GGGA 4ZOLA 3E35A 3U3DA 3NNDA 2HMWA 2MHCA 2O3JA 4R69A 4RO0A 3EDOA 2HJWA 3PXDA 1CHNA 1XNJA 4FEYA 1T9BA 4E88A 2HVHA 1GSHA 1YB6A 3AEUA 3VR4H 2XTZA 3S6JA 4B6RA 4BU0A 2XNSA 2I34A 3W9YA 5DHTA 2MT9A 2PPVA 3PR2B 1FEZA 4PAMA 4OP1A 5KMGA 4RK0A 1G55A 4NI5A 3WGKA 1BHQ1 3K8OE 4I4CA 2AOTA 2QKYA 5EXTA 3WTBA 3DE7X 2QL6A 4W1QA 4A73A 3KHKA 2OPBA 4RDXA 4NM1A 1KJNA 4FOPA 4RGQA 2OWOA 3UK1A 2OCBA 3DBHA 5ALLA 1M33A 1A2KC 3BX1A 2WQ7A 4GE3A 5K3CA 3LBIA 3IYLW 4F1KA 3WQHA 4F9FA 4AY6A 1FFAA 4HH3C 3A6JA 1WKVA 3RF6A 1PCXA 2NT3A 4OEHA 4KSBA 2I9GA 3F8WA 4M1SA 4DMHA 5IK2D 4TQSA 1S3SA 1OREA 4FNAA 1SMKA 2WZBA 3EG9A 5AW3A 1W9HA 4GQIA 4ENVA 2JH1A 3PC4A 4MK4A 1RM3A 2JGJA 1H69A 2MSKA 3C7AA 3MTBA 4JN6B 2ZXHA 2DFLA 3SHOA 4G0QA 1YDMA 1UDBA 2OB2A 1SL0A 4QZIA 1N61A 3OF2A 2C78A 2PGIA 3QVUA 1QYCA 4JR0A 4MV8A 1BPZA 5ECWA 4J0IA 3IN5A 1JBQA 4XCQA 4QPZA 1JIUA 4NMXB 2ZR8A 4MKRA 1G2OA 1G5TA 3CBQA 1NE7A 4LRTB 1E7MA 1PR9A 3GGDA 4BCBA 4P0QA 5EQJB 2W54A 3X43A 5JUWA 1ZXBA 3I5UA 3UJCA 2OGZA 2R00C 4HWOA 5E0OA 1NVVQ 3B36A 3S99A 4KACA 1SXDA 3GAAA 2Q2QA 4EHBA 1RCFA 3VR2A 4HVCA 1WOMA 3I0MA 3P2EA 5FI5A 4BNLA 3H3JA 3MABA 3PW7A 1ZOLA 3OLYA 5CB4B 2JXJA 2A1UB 4I1VA 5JO9A 1YT3A 5D3QA 1E6KA 2FP4B 5TMBA 3SX4A 2B69A 2HOIA 4B74A 4Z4CA 3QWBA 3L01A 5HJEA 1KNQA 2NACA 1CY8A 5E6UB 1LWOA 2JEOA 2BMVA 4ZTUB 4CF6A 4ZH4A 1EJ0A 4LFCB 3ZZ1A 2PZGA 1P7DA 3LRXA 3SVLA 5IH3A 4A10A 3NOOA 4RU1A 1XL0A 1TVCA 4QYXA 2LPEA 3RTVA 2R8YA 4Y9DA 3UEOA 5D3ZA 3JQ9C 2PRIA 3G1UA 4LOAA 2M1ZA 2QJOA 4NEGA 1KFBB 3TLZA 2BHLA 3ZTWA 4OP3A 4O2BF 4WKBA 4V2UA 3EIUA 5TPWA 4O2AF 2BI7A 4L50A 1JG1A 5FWYA 1JAYA 1YCGA 3O6VA 4R8RA 3IDZA 1JIHA 2HNBA 2D2VA 2ZDQA 1QGYA 4UBLA 1F8GA 5EOVA 5F4ZA 3I9KA 4YRZA 2K4IA 3NTUA 2OBXA 3PDHA 1ACJA 4GXKA 2HA0A 2NU6B 4O3MA 5D1NA 4MQEA 1KZGB 1GUYA 4M86A 3S55A 4KXFB 1FZQA 3F1KA 2QG6A 1EJ6A 3A28A 4B3TB 4AZSA 3V7JA 2CXQA 1WY5A 1Y7TA 4KXYA 4M8SA 2HXGA 1YKFA 4J6FA 5G4KA 3WMXA 3ITEA 3T5KA 3VSAA 2CYCA 4YI5A 5HDQA 1E2KA 1TEVA 3ID6C 4M9HA 1IZ0A 3FTCA 1HKUA 3OTWA 4GSLA 5IRCD 3RSGA 2W2LD 2EYUA 2QTGA 2O0JA 2W6IA 7ICUA 2CN1A 1DEXA 2XTJA 4GI3A 3KYCB 2O8BB 2R68A 1E92A 5FI1B 2W42A 1Y6GA 1X7HA 3AI1A 2HA7A 3CH5A 4XASA 4X7RA 3LSYA 2VTBA 1E9SA 1XK7A 3P0HA 4UNPA 1WU7A 3TXXA 2PRSA 4ZJPA 1V1MB 4R3NA 1AHHA 1ZJJA 3OQ6A 4L5JA 4TWIA 4YUAA 4CCAA 5HR7A 4EZBA 5BNIA 1GR0A 2J87A 4K3UA 5K05A 5E2BA 4HVAA 2YHIA 3MTAA 1SO8A 2WWRA 1BVHA 3TTSA 1YOBA 5JD6A 3D0QA 1ISMA 3H2ZA 1MQ8B 3WLPA 2PH7A 2NZWA 3AERA 1J1UA 3OECA 2G06A 2HREA 4LN1A 1V9CA 1T3GA 2VWPA 1FSGA 4IJWA 5AM4A 2DLCX 4RIHA 1P4SA 5FOXA 4LF6B 3KSZO 2IYUA 3W1VA 3A2MA 3WGOA 4IX9A 3EGEA 4EGFA 4DV6B 4HQ6A 3HSSA 4EF4A 1G5PA 3OEWA 3ETJA 4C8MA 1U4SA 1QKKA 1KY5A 3WHPA 3L4JA 2B8EA 3HK2A 4XUEA 2XXJA 5G4KB 2D2FA 3F3YA 4MVJF 4EUKA 3PR4A 1CD5A 3TK1A 5IBQA 1AQYA 2DUMA 4TLEA 4PZLA 1ZEJA 3H0EA 4GXJA 1K89A 1T1RA 4LXHA 2CNWA 2JEIA 4LC9A 1U2ZA 3GI1A 5KDOA 1ZAKA 4P22A 1J0XO 4IQ4A 2GXQA 1A50B 1FP1D 2JLAA 2PFNA 3EZGA 4FWIB 1SBTA 5JVDA 4KRYA 2CE7A 3FOEC 4LQCA 1FFUA 3KIPA 3ODGA 1PDVA 1ZD2P 1XCMA 4UNSA 4YAOA 4FFOA 2X9VA 4CEJA 3RYCB 4KH0A 5IZ4A 3L79A 3SHWA 3EZ9A 3K9HA 2PSHA 5JJ5A 4HYEA 1KWKA 3NLLA 3BXEA 3UHPA 1PWEA 1HUZA 5J2CA 1H2WA 3JPPA 2B4AA 3T38A 4P5EA 1IBMB 1ZIPA 3N2KA 2EX0A 2O05A 3MRSA 3W8FA 2BKAA 1JQJC 5DGIA 2QT9A 3F7MA 5BQ5A 8ICOA 3I2GA 4FBMA 5MGBA 5BMOA 1UJMA 3C3EA 1ONPA 2WSLA 2G09A 4RY8A 2GLTA 5REQA 3W3ZB 4LYGA 5DBEX 4EEKA 4BP3A 1LDBA 1O95C 4CMCA 1SG0A 2NVUB 5FBZA 1XB2A 2XCUA 2ZAGA 4UUMA 3E9MA 3JQBC 4OK3A 1AZLA 1HPLA 4F5ZA 3VHRA 1SRQA 4E0DA 4X54A 4R05A 1ULTA 1YRQA 1Z7BA 1J8VA 2VKTA 3CSUA 2G82A 3W79A 1XPOA 4MV6A 3V8BA 5EL0A 4LJRA 5DN9A 1TK2A 2BKLA 2R6ZA 3BTUA 1NC3A 1P17A 2C4KA 3NNSA 4HOYA 3RYFA 3WQBA 5E3HA 1DG9A 4HGOA 5IPFA 4DMFA 5KYWB 4PYJA 4NE2A 5AM2A 4D9HA 3OX4A 5LUAA 1ICEA 1MMFB 2NZVG 2O2IA 1TT5A 1XAHA 3Q0TA 3GIKA 1A71A 1PBNA 4WNAB 4GP9A 4YFYA 4WY8A 2R96A 4QICA 4NC9A 4XWKA 3WO1A 5JCXA 4FVTA 1JV2B 2PUBA 4IIJF 1VGVA 4LMPA 4MYSA 5ECYA 1U02A 2I67A 5IBRA 4GP7A 1MNAA 2KI5A 221PA 1EVKA 1DTEA 4TL9A 2CDBA 1RZTA 1D2EA 3B9PA 1T2VA 1N2GA 3CTMA 2DKFA 3K2BA 1E89A 1AB6A 2M0NA 1Z2AA 2XYPA 3JD4A 2I03A 2HWUA 1MXHA 4DTCA 4X8OA 3AHDA 5IVDA 1WCXA 2YV3A 3CUEF 1AQLA 2H7XA 3Q1LA 3WKDA 2VF8A 1C0PA 3KHLA 1KMMA 3DEEA 1G0OA 2UYYA 4GZ6A 2BOVA 1NR5A 4I4NA 4LRWA 3N53A 2H5IA 4UAGA 4HAWA 4YDSA 2X5XA 3A4VA 3RTAA 1MDBA 4AB1A 4J49A 3UV6A 3DTNA 3OFVA 5KFCA 2H1LA 1OB2A 3M9NB 1T3HA 1HM5A 1HGXA 5MN5A 1T36A 3ZN2A 2M6RA 3ZY2A 3RS2A 4KBYA 3AL0C 3RSHA 4CN9A 4M7PA 4EGCB 3FZYA 3LBFA 2AQHA 3ENWA 4HZGA 5SY9A 5AD1A 1K7YA 1KKUA 3NHMA 1UMBB 3T54A 3L7YA 3P52A 2BD0A 5J5VA 4F5RA 1TIPA 1R4MA 2QY9A 1SVIA 1IUKA 4U2DA 1DK2A 1I8TA 1TX4B 2ZTCA 3IAM1 2PHZA 4K0RA 1Z0ZA 3RFAA 3LXMA 1NW8A 5EEHA 3PUVA 2ISSD 4IXWA 1NW5A 4INJA 1DAOA 3SI8A 1L7MA 4POOA 1V9PA 4BVJA 1WPXA 1ZQCA 1NW3A 3NIBA 6Q21A 4BMSA 3SDSA 2B5OA 3OP1A 4UB5A 3A3NA 1W4CA 3MQFA 4O0LA 3BAFA 1N0IA 1XTRA 3M1IA 3FFXA 2XY6A 3K09C 4CLRB 2A0YA 1XFDA 2JIZD 2GCPA 3OKAA 1TMGE 5KL1B 1V11B 5K0LA 3E7XA 1PZGA 2FFQA 4YCJA 3WRXA 2C2YA 2QXYA 1U0OC 3KR9A 3P96A 4OB8A 3T4XA 1L6RA 2NAFA 2BGWA 2GHQA 3P9YA 1TCUA 1U2PA 3IUJA 1HXHA 3AEQB 3C3JA 3GRRA 3LHSA 2HU5A 1D7OA 1KBUA 1N0UA 1ULAA 2C2XA 3A9UA 3C6YA 3F4BA 4PJ0U 1ZQDA 1IZ7A 1KAQA 2QNBA 5FUVA 5LJIA 1PT5A 4PR0A 1DQSA 4FXOA 4GWLA 1P80A 4PN3A 1E3SA 1AUQA 4RZXA 2JFNA 1NN5A 1RWVA 1TQ8A 2YFKA 4LDNA 3TIFA 5JALA 4M0PA 2QYSA 1STOA 3D5QA 2G36A 2PRJA 1PZEA 5K7SA 3INRA 3M9OB 3BIJA 2WR8A 2VSYA 1EP9A 3OWXA 4M0MA 2B0CA 3JYPA 3MBIA 1KJIA 2VQ6A 5AW5A 4DMRA 2BQ3A 4NENA 2IQIA 3ZHBA 4EP1A 3SC6A 1JG3A 5SZJA 3ZW9A 1TZBA 3QU4A 2VF5X 3SOZA 4O5KA 1BYUA 1I4DD 1YQQA 4GHWA 2HI0A 1XHLA 1L8XA 1XKQA 2IU0A 3RFCA 4ACAA 4BO0A 1CF2O 1BMTA 3AVWA 1UOQA 4B81A 5JD4A 1D6NA 4HEQA 4YH1A 3JCZA 1TT7A 2J3KA 5T6MA 3WLEA 3NAGA 3LWMA 1AU9A 4R6WA 3VPBA 3HG7A 1LH0A 3THSA 2OHVA 1TAUA 1O4WA 2CUZA 1QF7A 2QR3A 2V7XA 2Y0EA 4G5QA 4Y2GA 4HGRA 3T5DA 4A5OA 2VJ4A 4KQXA 4MKHA 3VR0A 1SIJA 2IRWA 4PQEA 2W9AA 3FF1A 1HI9A 1X1SA 4WKOA 2EKPA 4OQPA 4UDYX 1A8QA 2VSFA 2GDZA 1SELA 1UKCA 1Z47A 1ZXXA 5GTDA 3QFHA 4LEIA 3M4JA 2Z30A 3FLEA 3GFSA 4XIJA 3PNQA 2ZR7A 3RHSA 4R8VA 2HU8A 5B1EA 2GRAA 5AM1A 3Q3IA 5ENVA 3VTZA 4D02A 2Y9MB 2AEFA 2C2ZA 4MEBA 2QLBA 1DBPA 4DL7A 1EXMA 2XWQA 3TKAA 3UK2A 2Z8ZA 5KHOC 3FTEA 2BEWA 2WD8A 4LVSA 2DG2A 1G0NA 4ARVA 2F77X 2J3MA 3MR5A 2E5LB 3F5AA 4RABA 1RKQA 1YR6A 3D4NA 4JA2A 3FPAA 1KYXA 1W6RA 2QRQA 3L49A 3MC1A 1S3IA 4C0QC 3P19A 3T7TA 2GZRA 4HUQA 3ETNA 2BM9A 2DCUA 2I8AA 4FMPA 4LDAA 2FWPA 1ADBA 3D31A 2WJYA 3OU7A 4OJKA 4RH0A 1DLJA 3ZZUA 2PNFA 5AVJA 1ZQOA 2HK6A 3T79A 1ZUNB 4FYKA 4CFSA 5HZMA 5M5BA 1CHDA 1PHRA 1O9GA 1XZJA 1SXJE 1XUOA 1M2GA 2ZIAA 5KT4A 1K3FA 2IX9A 3ACCA 1OT5A 4XWYA 4BLSA 3Q0IA 4QT4A 3VAYA 1KMNA 2JRZA 1IV8A 4L51A 1IY1A 2IEZA 4MV4A 1DEKA 2WHEA 4YJFA 1GLVA 1RIIA 4K8OA 5DEOA 3BRQA 3WHLA 1OSNA 2YTZA 3OUTA 3K70C 3JWGA 1LW7A 7ICLA 2VDKB 3JTEA 4MWZA 1HO3A 5D00A 2FG5A 5BSKA 3EBPA 1FXSA 2YJ5A 3T1HB 2ZLBA 5EXXA 5LZ8A 4CI9A 3UV3A 4W7HA 4TTPA 3EIEA 2JATA 1ZL0A 1PR6A 1PSWA 4BBZA 2BR4A 4XA5A 4D0GA 1C7RA 4YX9A 1RWQA 1UFVA 2C8VA 4E51A 1TF7A 4LNUA 3E3NA 3ZLBA 3IHQB 2YQ5A 4J1SA 4H7EA 1OHHD 1P61B 1QIGA 1PKXA 1RYYA 2P7IA 2ZVQX 3BMCB 5EYPA 3L06A 3LUJA 2HU7A 4HB0A 4XEHA 4D57A 4XDGA 3GMIA 1DG3A 4ARCA 3GK3A 2XMZA 2UXBB 3UJ3X 5J0XA 1NRIA 4RZHA 4I50B 1F06A 3S2SA 3BQ7A 1NW6A 1PSZA 1WB9A 3RFFA 4IXNA 1I94B 1ISGA 3SJZA 2EZ4A 2WHYA 5AT1A 1I01A 5EINA 5FUXA 2NOAA 3TUJC 1QP7A 2G04A 5HGJA 2W7TA 4PY2A 1SC6A 2PBRA 2ZBQA 5A6SA 1A27A 2ZUEA 4UQGA 3PR1A 4TGLA 4ZVRA 2C4VA 4M8NE 2JASA 5EXPA 2XGJA 1GZVA 5KSYA 4NARA 2R2AA 5FTJA 2IUEA 1EXNA 1UJBA 2E1RA 4UJ5A 2RI0A 3PUWA 4F8EA 4W8HA 2VQEB 5EMNA 3DM5A 3KDSE 1KSJA 3A36A 4F8RA 3CJQA 4URVR 1N6PA 4L76A 2YXEA 4R2XA 4YRNA 3EARA 3I6IA 3JSXA 4PXSA 4UXIA 3S1AB 3VVMA 1TJYA 4ENWA 3PT9A 4XVQA 3QEOA 1L1EA 1L5HA 3CYFA 4BO5A 4OSPA 4LOIA 3UJAA 1OZHA 3VPHA 1GVHA 5P8WA 1IOWA 1DQPA 4ZQIA 1L5FA 3VFDA 2Y9UA 1AXGA 2GPJA 2WJ6A 1M83A 1U0JA 4P3PA 1G8AA 1Z3EB 1CUJA 5CYFA 4YRQA 5FUWA 1VL1A 2I22A 2J3EA 3MCTA 1G6HA 4KLAA 4ME6A 4YQZA 5KOJB 1B15A 4ONEA 4B6JA 2PV0A 5HS4A 1TGYA 4G1EB 1XMSA 4PZOA 3EC7A 3CZMA 3QWIA 1M2KA 4K6HA 3HEAA 2ZSHA 4NOLA 1K5OA 2QM3A 3BDVA 3TZQA 3ESRA 4G09A 3C23A 3WZ2A 3CLHA 4RVGA 5DYTA 1V5IA 4HGPA 1YQWA 1XEWY 1GU1A 1DEOA 3L0OA 1VMEA 4LYYA 5KFSA 5C5DA 5JNRA 5MN6A 1PLLA 2K6GA 5B58T 4YMTA 2C2OA 3BJZA 3MGVA 1TPYA 4ENQA 5D7BA 4JV1A 3H6KA 4UKDA 1C9NA 4JLWA 3K5IA 4MUHA 1N2IA 2VAMA 3OPYI 4AMGA 4BNDA 1ZQPA 2BCJQ 4R65A 5J47A 2VJKA 1YONA 1SHLA 1TVKA 1Z3IX 4Z4EA 3F71A 1TA9A 3EZ2A 4J1QA 1CNMA 1TKDA 3FUCA 3GLFA 4AWAA 1P7YA 1QQAA 1J2YA 3K9BA 3DDNA 1N48A 3OE1A 1JLSA 4DQRA 1N2XA 5J0OA 1JFFA 1P2FA 4QXAA 3SCZA 5BXQC 5SZHB 4YR9A 3ICEA 5EJ5A 4ZT6A 2VBIA 3EPGA 3UANA 5KBYA 2VO1A 3RE1A 1TEZA 1E4EB 1I6LA 5EKDA 1ULHA 3VVLA 1DKLA 3WHKA 3CN9A 1DARA 1FYFA 2XE4A 3DZGA 2Q5FA 1N25A 2X7XA 3IQWA 2WJHA 4X97A 2H1IA 1YB7A 2JHFA 1V2GA 3DM9B 4JJZA 1DELA 1ZNZA 2GHIA 5THXA 4OI2A 4LX8A 1N78A 2FPUA 3II6X 4X95A 821PA 3RBAA 2IBSA 4GMDA 4IV5A 4DPLA 4D3ZA 2DKXA 1ZJYA 3GLSA 2FE4A 1A77A 4UM9D 1A2QA 2AVDA 2DUYA 3E3MA 3RYFB 2F62A 4JELA 3R09A 3GBPA 5CDFE 1JAIA 5DWQA 2XXBA 4WX2B 4L16A 2JZNA 2VNAA 1PVQA 1ZM9A 3HS3A 4BPBA 2D74A 2AG8A 1L5QA 1DO0A 1GQ2A 1YTUA 1T24A 1KBOA 4BUCA 2RDIA 1ZQSA 3QKTA 4MV7A 3N2EA 1Z2OX 3IAUA 2JFPA 4NG5A 1R8YA 2J3IA 1NBEA 1RS0A 2LP4Y 4DCVA 2XCIA 3DAFA 2GDJA 1X40A 5UKDA 3ZBUA 2Z2ZA 2HPVA 1E3WA 4K28A 5DO9A 4CIBA 1TTHA 4PVCA 4WD3A 3BBPA 3B20A 4BWGA 4R1TA 3TAXA 4BNJA 4MCHA 1E9VA 3TFSA 4J9KA 1P2TA 1LDEA 1N2OA 1T3SA 1EBBA 3HDJA 4DLKA 3LY7A 4M1EA 1RLTA 2PZLA 2CXUA 3CEHA 4KRFA 4G0ZA 5H9WA 4JSRA 4JLAA 1ZVVA 1GDDA 3T9CA 4CFZA 1KC3A 2YH2A 3CUVA 2RGYA 6LDHA 3QLUC 5KYVA 5K8VA 1D03A 2YINC 4IKEA 1OHHA 2GPAA 2JW5A 1ST3A 2QZ4A 2ZTUA 5GV7A 1CZHA 2RH4A 1E2EA 1X7YA 2G7ZA 4KDEA 2VPWA 3FPCA 4GW3A 3F6CA 2Y0CA 4GZ3A 2HQOA 3HT3A 4OJYA 3VR6A 1L1QA 3QNWA 1KI1A 1NE2A 1DBIA 3I83A 1FDUA 3NTOA 5LP6B 1A8SA 1OVGA 2NUAB 4C78A 1JEDA 1LSOA 1KEUA 3EGCA 2D00A 5JC1A 5BSEA 3W5JA 3K4QA 5M34A 3IVXA 2HBJA 2BV3A 2PI5A 5AK6A 2H8KA 5DULA 5K8UA 4FDAA 1OZ0A 3KRTA 3C1ZA 3ZEAA 4WCFB 1AQJA 1Y3BE 5KFZA 2B82A 1ZO8A 1ODKA 4XOUA 3CONA 4E32A 3SE0A 2KE5A 3F2CA 4RMJA 2N9UA 4PCLA 1TCBA 5ECDA 5EJ6A 3ZOZA 3N1UA 4MCAA 2B4YA 3CIFA 1PDOA 2FUG6 2IDZA 2Q5OA 3L6UA 3OD1A 3NETA 4X3CA 1RYUA 4LBZA 4FNMA 1AH2A 3WV4A 3GP8A 4R9UC 5LBIA 3V6LA 4ER0A 1DRVA 4EY6A 2PVSA 4TYYA 2YMLA 2HMUA 1RRFA 5K3SA 1FFCA 1TYAE 4QBHA 1ZGJA 4GEKA 5DX8A 3OJOA 4BMVA 2R4UA 3UPQA 8ICIA 1Y3AA 2W4MA 3V1YA 4JWNA 1KVRA 3RIXA 1DGQA 4QJ3A 1DDOA 1MT3A 4QIWF 4IS2A 5LBTA 1CS4C 3I9V1 3DZFA 1GKLA 3ICOA 1SKWA 3JRWA 2FJ6A 5KFTA 4LYHA 3GLVA 2O2JA 5BW4A 4GYWA 4B6GA 3PNCA 3E0FA 2CL6X 2QORA 3LK9A 3HKEA 1A76A 3RU9A 1E4YA 1ETHA 2PGLA 4FQ8A 1B43A 2VBFA 4P53A 3WWDA 4L9WA 3U56A 4AYWA 1BS2A 3C4QA 2GK3A 4OQFA 1M9NA 3QYPA 2G63A 4V3BA 2OXFA 3D81A 5DB9A 4PC6A 5JNWA 5KX5F 1WNFA 3C3BA 4DCOA 2ZETA 3I30X 3RKRA 1RYEA 2HK7A 3H84A 1H8HD 1NQUA 3TINA 4CIXA 4HQKA 4O3PA 1GYQA 1Q0RA 1ZXIA 5A0LA 1PYDA 3R7AA 1T4CA 4R1PA 5CH8A 3RFVA 3C98A 2LYBA 1NNUA 2KSOB 4CLXA 2C00A 3NHPA 4NU5A 4ENUA 4IHJA 3T5JA 5FUMA 2OO5C 3W7AA 2HIAA 5JXHA 2GCOA 3V6KA 1Z4KA 4FCWA 1RHQA 1WCWA 2NNWB 1DRUA 1NTOA 3CKLA 2FMPA 4X44A 3ZE9A 2IY9A 3DKVA 3QE9Y 2EFYA 3QBEA 5B55A 4KBGA 1R6AA 2FU5C 2QM8A 2REBA 3H5TA 2P2LA 1IUPA 4ND6A 5CDHA 2Q07A 3RVDA 2BGGA 3ZGOA 1I32A 2DYKA 2Y05A 2V03A 3KETA 4FS3A 2LNDA 2B9EA 3UXEA 3E5MA 1PDWA 1GCAA 4RE6A 1UBUS 5NULA 4M1ZA 4EGSA 3V8QA 2IV3A 2I76A 4YR0A 2GD6A 3GDFA 1U2GC 4KLCA 1BD3A 3BDAA 1ND6A 2RFLA 2RHOA 2W6JA 3NYRA 3CPSA 1CUXA 5CD9A 2W9BB 1UKEA 4AJKA 4UATA 2ZRNA 2W2NA 4FGKA 5FF9A 3AF0A 4KE6A 3SM3A 3TTXA 1L1RA 1GL7A 3D4BA 2NTYC 2ZJYA 1QKIA 4IMRA 3T3NA 10MHA 3AI3A 2ZZMA 4PZPA 1XO1A 1NJ2A 1OW3B 2JHAA 2ENUA 3R0ZA 4NBRA 1XTTA 1BCSB 3WISA 5AESA 5BMVB 5KTTA 2XXAA 2J6BA 3EIXA 3RC2A 4RC9A 4WBNA 4LW8A 5A4FS 3A6GA 4K9RA 3IUMA 4NESA 1C7JA 2FKNA 4B48A 2PUGA 1NK8A 1UEIA 2FX2A 1ML4A 1S97A 3GFTA 3DKPA 3OCYA 4Q5IA 4G1MB 3FOWA 4DJJA 3JD0A 3A1WA 4ZJZA 2WAAA 8ICWA 3IHKA 5B3AA 3TDKA 1HYQA 2P9BA 3T3IA 5KSWB 3V7LA 3E58A 3QF7A 3EGDB 3WJAA 4D44A 1Z63A 3T5MA 3INYA 4YAGA 1EFCA 1QB7A 1XSPA 2Z58A 5HWSA 3LO5A 2DBQA 3VDMA 3ZU6A 1NPDA 4A92A 4E1BA 2CMKA 1JB1A 5JANA 2WIDA 3TG2A 2XUIA 4CTOA 1QIFA 3I6MA 4YJDA 4BS9A 1TTQB 4D99A 4U6PA 1BXZA 3V00A 2WSBA 4D1YA 3UPUA 4JXJA 3RSQA 1Z5UA 3IR7A 2ZXUA 2EOAA 2FX3A 1H2BA 2P2YA 3RADC 4C1BA 1AOXA 1TU0A 3UENA 3KQYA 4KH1A 3WL4A 5IKEA 1SHUX 3KKOA 4O2AB 3HV2A 4UZFA 4ZVMA 1OJ7A 1RU3A 2JFYA 2NQ8A 1KYWA 3N05A 2RGEA 3AIKA 4ED9A 1ZN9A 3K4HA 4K9LA 1DB3A 4YV7A 2WMNB 4F4ZA 5EFZA 4J9MA 4GM0A 1KU0A 1G8HA 4CMHA 1L5YA 2OEHA 1YHZA 1NA5A 4I2DA 4EBCA 4KMOA 4OU5A 4PFQA 2C0QA 1KH3A 3ZUGA 4YUWA 1NQOA 2R8OA 3OOYA 2RB5A 3P9QA 2JCVA 1PNTA 3NTXA 3KOWA 1SN7A 2CVQA 1R3UA 3KEFA 4ZVKA 2WVAA 1PJBA 4ECRA 1C7YA 5DRYA 3OQNA 4YRAA 1ZVQA 3C7DB 4UASA 3HBFA 3VTAA 4AIRA 5ELXA 3R3SA 2DTDA 4N8EA 5EPEA 1M74A 3ELWA 3AVVA 3LPLA 3GBSA 2QGFA 4NNOA 4EDFA 1J2MA 2ONCA 5DBHX 3OSPA 1AN0A 2ACWA 5C18A 1U49A 5FWXA 3OUUA 1F4PA 3MGBA 4YV0A 1L3BA 3DGFC 2PFPA 2ZRJA 1RPTA 1FP6A 1R0LA 3DMDA 2QVBA 3S1AA 1NM5A 4RT3A 4QZAA 1QX4A 1MB3A 4CGYA 4D9NA 4EYSA 3FGOA 3ONFA 3FVQA 1Z18A 4N5DA 1COWD 2G25A 2EZUA 3W04A 3PXCX 4PG4A 3JQPA 1Y6QA 1E79A 4Z9FA 2KZZA 3PHLA 4UVGA 2WKQA 2ZYVX 1O96A 1PJAA 3U3JA 8ICCA 4I2IA 2KFNA 4CZ2A 3KNZA 3G59A 4QLAA 5EWLA 1MHTA 4IVPA 2GEDA 2V9CA 3FRIA 5F33A 5IKOA 2Z8XA 2WUDA 3VJRA 2OA0A 4ECYA 1UMCA 2PKRA 3V2GA 3N8KA 4E2YA 4KJXA 1T6NA 3MT9A 4FD3A 1KK0A 1MZPA 4HH4A 4CUJA 4JIGA 4US0R 3USCS 1II0A 2J1LA 2VOEA 1Q0LA 4LI0A 1HE3A 4OLHA 5D87A 3AUTA 4FB4A 3LUBA 1W581 4UTNA 3H6GA 1ZIXA 2AF3C 3FTPA 1UC8A 3NAQA 3IQIX 3ZVLA 4W4TA 2GESA 5FUQA 1NBME 2QTZA 3G0GA 4YMLA 3AKDA 1FYWA 3O94A 4I9GA 2C20A 3RREA 3IERA 2WF7A 2R7MA 2ZTMA 5FOSA 2GEJA 2H7VA 1C9JA 3HKDB 1DOAA 4KFTA 5G41A 3RJTA 4YHBA 5LIRA 3K71B 3B13B 1IIRA 1YF3A 1VKNA 1OH8A 2CWWA 1N60A 3S29A 2EZ8A 1HYBA 4OG2A 4YLEA 3LYAA 1YS4A 2ZUCA 4BNFA 4UUPA 5C8DA 1WE2A 2YJ4A 1G8GA 4FT4A 2HHAA 4OGFA 2EFHB 3WR5A 4AJ2A 1YDFA 3SHFA 1XTUA 4TKVB 1CF4A 3P2IA 5CFNA 2FUG1 4JI1B 3JYLA 2IA6A 3OEEA 1FUEA 2OYRA 1OXKB 1WZNA 4GC9A 3VA7A 4DPMA 4PCVA 4OL0A 3C3XA 4LXIA 5SV2A 1QP4A 5E79U 4B2LA 2N3ZA 2R8KA 1E6UA 1QANA 3U48A 4Y9RA 2I1VB 3WNQA 4DA8A 2FWMX 1ZC4A 4EZIA 3BT7A 3OZIA 3QSGA 1E7YA 2B8NA 3PUJA 4FLFA 1B42A 2CL0X 3AJAA 1VE5A 2AXPA 4B80A 3STXA 5CIQA 5B2EA 3MTDA 1C4WA 2JZOA 4CT5A 3OTQA 1DEHA 2PX0A 4M46A 1AKUA 1YC2A 3AQFA 4R1LA 1LK7A 2HJRA 3IIMA 4Q7KA 4BO6A 5CA1A 2OTCA 1NN0A 5KFFA 2R0QC 4CUKA 3MWEA 5CWRA 4FI3C 4R63A 1LPPA 1W5AA 1I2BA 1U8CB 5A2QA 5TS3A 2XVXA 1Y1PA 4DIBA 3CP8A 1Q1BA 2BFAA 1OYYA 1A5TA 1A8PA 3RRHA 4GGMX 1YH3A 2PRZA 1PEDA 4KXLA 1YCHA 4G4GA 3LVWA 3NX4A 3G85A 4HSGA 2XBLA 1CI4A 4FFRA 5F9NA 1T10A 4NMHA 4DE5A 5AVRA 3REFA 1C4KA 1SCKA 2VP3A 1POXA 4RZIA 2DWCA 3FI0A 3UFXB 2JD1A 2P2GA 2X6RA 3AEKB 4I14A 4OTZA 2FWRA 5EJIA 4MHTA 1NK0A 2B1JA 1WMFA 3M6WA 4FT2A 3IDAA 4KWCA 1YZHA 4XFDA 4PIPA 5JPIA 4DY6A 4TN5A 2QB5A 2WK1A 3IUPA 3AT1A 3TLBA 2ATCA 2E4YA 4FCVA 4QO8A 4UUBA 3V1MA 2QTFA 1WX1A 1TQDA 2LI6A 3WYGA 2C0CA 1XZQA 2CLIB 4S05A 5JRDS 1U7HA 2ST1A 4MHVA 2O23A 2YZ7A 2PT7A 2UVWA 3ZNOA 5B30A 1ONNA 4YT4A 3TL3A 2O8BA 1G59A 2ODAA 4USAA 3OT1A 4J9UE 1VHTA 3IUBA 3L4KA 2P9JA 3MMPA 3K35A 3ENZA 4BFZA 1JIQA 5CT9A 3TTVA 5L4NA 4C7ZA 3PNYA 2CB0A 4ZIRA 4YUVA 2H1HA 2XD9A 4AFNA 1XTQA 1N8NA 2FK8A 4MYUA 2YMMA 1OFIA 3ONWA 3FGNA 4CM9D 3IJRA 4XGIA 4J8PA 3KQKA 3VYVA 1T1GA 1TB4A 1IXKA 1PQYA 3G82C 4WZAA 2ODEA 3UWOA 3D4LA 2X0IA 2J5XA 1JIIA 3GR6A 4BQQA 5AUNB 4Z86A 4KLTA 3W5BA 2O6HA 3GEGA 5DLGA 5H2FU 2YVKA 2AJLI 3E15A 2IPLA 3DB1A 5HJ2A 3Q8MA 2IBMA 2VLIA 5D7NA 5FBKA 1LC0A 3UMFA 4BWVA 2AD5A 4OA5A 1V8OA 1XDGA 3RKUA 1QRRA 4Q3NA 5G1OA 1AJEA 2RH8A 3QEMB 5EPUA 2NSLA 3DDCA 5FX2A 2WWTA 2G8NA 2AUTA 2ZSJA 2P5UA 5DNUA 1DIBA 2FMQA 2JFXA 3PI6A 5F52A 4Q45A 1UDXA 2RHLA 5TNXA 1L8QA 5DIFA 2W6MA 4YRLA 3WS7A 1H94A 4CUZA 3V8MA 4ARAA 1QCKA 3TD9A 5K6TA 1M2JA 4LHSA 5J8YC 3TIIA 2RIRA 3LVRE 4G26A 3N97B 3F98A 3TE7A 2R4TA 2W8BB 3FUUA 3LLUA 1LW6E 1Q11A 1ZQMA 2QRHA 5BYBA 3RJGA 1UL1X 3RB4A 2H3ZA 2EG9A 2ZBDA 1YCDA 3SC2B 4M0CA 3WLLA 4HUJA 5EIBC 5I7FA 1G8KA 1S1CA 2OYCA 5I48A 2OYSA 2GS9A 1QIEA 2QZZA 3ECAA 3CX3A 1N6LA 3UA4A 1IPEA 5I9IA 3EDYA 2GETA 5A3SA 3PXAA 1O5TA 1UJCA 4G5GA 1MTOA 4AF6A 1ISHA 1E66A 3BA6A 2DPMA 1SC1A 4LE0A 2RP5A 4LGMA 2G08A 4X84A 5FA6A 1FQWA 2CF5A 4P7GA 3TSOA 1XFAA 3L7BA 7GPBA 2JF0A 4EY5A 5L7YA 5CDSA 1JDZA 3WO0A 1RM0A 1R16A 2HRQA 4GX5A 3ZWVA 4EECA 3ZYZA 1Y9EA 4EK9A 3TACB 5EHZA 1VGQA 5BOSA 1L3UA 2XVTA 1RJGA 1QIHA 3BB3A 2Q1SA 3FLBA 3K4PA 5J2JA 3H9JA 4OHCA 2FVXA 1PUIA 4HWPA 1ZQFA 1NN3A 2E7ZA 2G0TA 3QEBZ 5KG6A 3FCYA 1IXYA 2BTEA 1V85A 1JR3D 4YD2A 5JDCC 1Z12A 3E2PA 4FYWA 3GUYA 5A5VA 1IIBA 5C1PA 1SZPA 1YU9A 2HL6A 4YAKA 2ZSDA 2GZMA 4H4DA 4I8IA 1TCVA 5BSHA 1W52X 4PSUA 2O8FB 1HF3A 2ROQA 4AURA 4YRDA 4F2DA 1DS6A 1LUAA 4NDNE 1O97D 4NS1A 2C7RA 1ESDA 3AOEC 3MMNA 3NOQA 1YU6A 3VKFA 1M1NB 2ZYTX 3T5CA 1R6DA 3AR6A 4Q82A 2O2ZA 2P4SA 4OXNA 2H1VA 4BWJA 4NRDA 3I72A 3ZW7A 1ECBA 2DEUA 4QELA 1Y5IA 4Z6DA 1NF9A 5T3YA 3WC4A 3CVUA 3M6LA 2OECA 5B5EU 3BHNA 3ZXXA 2HOFA 3IRUA 1LBEA 1RCUA 2GTHA 3REGA 4ZGWA 4BQRA 1LC3A 5K0TA 5L3SB 2J0QA 1VPTA 5A7GA 5IW8A 3I73A 1MXFA 1E3EA 3SQOA 1TA4A 1Y42X 3UG7A 1E96A 1F1JA 3EUAA 3HCBA 5CX1B 3ALRA 4RNOA 3V7YA 3VSCA 5IM4F 5C4IA 3JATA 4HN9A 4DDVA 1GL9B 5IAOA 3GIWA 5IC4A 3KB8A 3D6HA 2QQ5A 1ODIA 3SQIA 4TWRA 2CPRA 1R50A 3AB3A 3T4UA 4HG2A 2V55B 4INOA 2PRKA 4MQ6A 3ZXUB 4CM5A 4DSEA 3QV1A 1Y8CA 2EFDB 3TARA 2Z6UA 1TIBA 5AMXA 2NZYA 2FOLA 1UKZA 2WM9B 4MARA 5KFUA 5EKTA 5AH0A 5HF5A 4RY9A 5IDXA 4C29A 2D0OB 1E2DA 3B6ZA 4NP6A 3R7WB 4DEXA 2NZUG 1DRJA 3K5PA 4CQLA 1H4QA 2BPOA 3J7TA 3OESA 4IO1A 1RHMA 2AL7A 1Q57A 1THMA 1VDMA 3IHWA 1F3OA 1WD7A 4MLPA 4QWCA 1XROA 1QVRA 2ZBUA 4FDVA 5KFWA 4M76B 4UB4A 5KFBA 2QYHA 2IUFA 3WSWA 3PLAE 9ICSA 2JH9A 2EKZA 3BQ9A 3LK6A 2EIHA 1SVWA 1W73A 2I54A 2BDUA 2YCLA 1D1TA 1UKBA 3OEED 3T5BA 3P9ZA 3HWWA 1XTBA 2HMAA 2VDJA 1YJ5A 2PLNA 1KNXA 1F5SA 3EBLA 3L7IA 2NRZA 4IFBA 3AM4A 2ZJ3A 4Y1GA 4C6TA 1GG5A 5E2AA 1I5OA 3VH4A 3MDCA 4NFYA 1URJA 3UAYA 1PK9A 2GMWA 3KOOA 4D0N<