4CF3A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACAIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
total genus 85
structure length 224
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf3A01
2ZBDA 3I28A 2I54A 1LVHA 1RMQA 2WF7A 4F71A 3OPXA 3UMBA 3ESQA 2P27A 5AW7A 5AW0A 3QUQA 3UMCA 3DDHA 1Z4JA 5ALWA 5AW4A 2YJ4A 3DAOA 3L0CA 3KD3A 1Z4KA 1QQ5A 3NASA 3DV9A 3WK9A 2DQSA 2GHQA 3AR5A 3BA6A 3EWIA 2WF5A 2FPUA 4Y2YA 5ALOA 3NALA 2MU1A 1T9ZA 3U7GA 5AKKA 3QUCA 4EENA 3OCYA 5AKYA 2B1QA 2I6XA 3L7YA 5AKGA 1TJ4A 2JAUA 1SWVA 1YJ5A 5ALVA 1TE2A 4XE5A 4C4TA 4EZEA 3U26A 3L5KA 5AKLA 2HCFA 1ZJJA 3KBBA 3WK7A 1L7NA 4FFDA 3ONNA 1U2TA 3IJ5A 3S6JA 4CF3A 2GMWA 1Z4OA 1RLTA 4EELA 5AI5A 2YBDA 1TJ3A 1CQZA 4BKMA 5ALUA 3EF0A 5AVSA 1EK2A 4KYTA 2WM8A 4BEVA 3KC2A 2FPSA 3B9RA 5ALEA 1WPGA 1ZS9A 3L0YA 4FYPA 3U19A 3NIWA 5ALDA 3FPBA 4ZEVA 4UU0A 3VAYA 3PGVA 1KYTA 1NNLA 5AKEA 1TJ5A 2P11A 5AICA 2ZBFA 4BNDA 5AW5A 4XQ0A 3QXGA 1YNSA 3N07A 2YJ6A 4OHFA 5ALRA 1XVIA 2R8YA 4BX0A 2NO5A 1T5TA 2Q4TA 2B1RA 2RAVA 5A3SA 3ZTWA 2FPWA 5AKIA 3CZ4A 3SMVA 5AI0A 5AW8A 2Q5EA 1ZD2P 3SD7A 2FPXA 3L8GA 2GFHA 5AVTA 4UMDA 1YDFA 5AVWA 3ED5A 3OTQA 3WKAA 4YCLA 2ZBEA 4RESA 1RKUA 5A3RA 3P96A 3ZUPA 3D6JA 1L6RA 4AS2A 2R8XA 2OBBA 3SKYA 2CFRA 3N5KA 2WF8A 3TLMA 2G06A 2C8LA 4KX3A 3SHQA 2FI1A 3QX7A 4EX7A 4CF4A 2PQ0A 3KDPA 5AI9A 5ALJA 1LTQA 2HDOA 4I9GA 4HYTA 2HOQA 1QQ6A 5ALIA 3OCVA 3PDWA 2G0AA 2AUTA 2BDEA 4B6JA 3FM9A 1K1EA 4I9FA 1O08A 2BDUA 4NWIA 4UU1A 1S8OA 1EK1A 2G09A 2ZG6A 5AI6A 2C88A 1ZRNA 4DFDA 3QU2A 3QU9A 4OCZA 3KOOA 1N9KA 2PR7A 4KNWA 2I34A 3M1YA 3SF0A 5AW2A 4CE6A 3QYPA 1ZD4A 2HF2A 5AKZA 1RMTA 3ZVLA 5AM0A 2YY6A 4Y2RA 5JJBA 2YMPA 2R8ZA 4NABA 5AK6A 5T41A 2JAOA 4EX6A 3UMGA 1Z4PX 4Y2PA 2EAUA 3L1UA 2MU2A 1SWWA 3W5BA 4Y2JA 3W5CA 1CR6A 3MN1A 3A3YA 4HGNA 1VJ5A 2WF9A 2JAWA 3AR4A 5AIAA 4UMVA 4CF5A 1RC8A 3W5AA 2W43A 4YCNA 5AM1A 5AM5A 4DCCA 5AW9A 3WK8A 3PGLA 1IWOA 5AKHA 2W11A 2I55A 4H1WA 1RRCA 3SKXA 3WGVA 3IRUA 2ZXEA 3QLEA 5ALLA 4L6AA 4NAVA 1L7PA 3AR7A 4IG4A 3M9LA 2WFAA 3WKBA 3QU7A 4QJBA 4E88A 2C9MA 1Z5UA 5AI4A 3B9BA 2WHEA 2CFSA 3E8MA 1SU4A 2QLTA 1RQNA 2PKEA 5AW3A 3L8EA 1WR8A 2W4MA 2VKQA 1RKVA 3A1EA 2YJ5A 2GHTA 1X42A 2RARA 3ZW7A 1Z4LA 2EARA 3SLRA 3I1YA 3E81A 4Y2SA 5AM4A 2BY4A 2NO4A 2I7DA 4JB3A 3PCTA 4J2TA 3FZQA 1XP5A 2GO7A 4GXTA 2G07A 2I33A 4UATA 4XOUA 5AVQA 5IS2A 1Z4IA 2AH5A 1J8DA 1J97A 3QNMA 2HX1A 1Q92A 3ZWDA 4L57A 1L7MA 4EEKA 2D2VA 4Y2VA 2ZOSA 1O03A 2FDRA 1QH9A 2YJ3A 4HGPA 4XPZA 3ZVMA 3OCUA 1U2SA 3FGOA 2MSNA 2HI0A 5ALGA 3AR3A 4J03A 3ZWKA 4BBJA 3E84A 2G1AA 2B0CA 5ALZA 3ZX5A 3A1DA 4PNHA 4HAIA 4F72A 5AVYA 4UMFA 2Q4RA 3E58A 2HSZA 5ALNA 3ZU6A 5ALFA 4IFTA 1WZCA 2QYHA 1U7OA 3I6BA 3DNPA 3NUQA 1YV9A 3BWVA 1L7OA 1TA0A 3R4CA 2IA5A 3WKCA 2G08A 3W5DA 4DW8A 4BX2A 3OCWA 4Y2UA 2IOFA 4UASA 5AIBA 3NANA 3GYGA 4KX5A 2OYCA 3QGMA 4OD0A 2OA0A 5ALYA 3MPOA 4MWOA 2B82A 3MMZA 4ZEWA 5ALTA 3WK5A 3K1ZA 4C4SA 2HO4A 4NFLA 4HGOA 1Z4QA 2C4NA 4C4RA 2HHLA 2FUCA 3J7TA 2YN4A 1ZD3A 1ZRMA 5AVVA 1RLMA 1RMYA 1U7PA 2YMQA 3EPRA 2C8KA 3OCXA 2R8EA 3HYCA 3WK6A 3R9KA 3N8GA 2CFTA 3L8HA 5AVRA 2O9JA 4HGQA 2JGAA 5FP0A 1T5SA 3QU5A 4QQFA 1N8NA 3ZVNA 5IT0A 4YGYA 3ET5A 1Q91A 3U13A 1L8LA 1F5SA 5AK3A 2HF7A 4Y2QA 4FE3A 3NAMA 1RKQA 5AKXA 2P9JA 5ALPA 3R09A 4OFZA 3QUTA 5ALKA 3WKDA 5AK4A 3N1UA 3AR9A 2IOFK 1MH9A 3ET4A 4YIHA 4Y3UA 4NV0A 3FPSA 3AR6A 3L0BA 4DWOA 3QUBA 2HEGA 2RB5A 1RQLA 1FEZA 1Z4MA 3N28A 5AESA 1WVIA 3WGUA 2NYVA 2EATA 4BNDB 1ZOLA 4G9BA 3EF1A 1YMQA 4YCMA 1Z4NA 3FVVA 1Y8AA 2CN1A 1S2OA 4AS3A 4ZEXA 4UAUA 3A1CA 3I76A 4Y2XA 4UW9A 4JDPA 2YMMA 2AGVA 1VFPA 3ZTYA 3U7FB 1NF2A 4BEWA 1U02A 4YIKA 2B8EA 5AM2A 5AVXA 3F9RA 3AR2A 3B8EA 4UAVA 1RDFA 1QQ7A 1Z88A 2YFYA 1YS9A 2ZBGA 5AVZA 4BYGA 3WK4A 2B30A 3L1VA 5A3QA 2G80A 4MUMA 2YMLA 2B8JA 5ALMA 3AR8A 5AKJA 3MC1A 2FEAA 4YH1A 5AVUA 5AM3A 4UM7A 5AW1A 5E0OA 1L8OA 2IOHA 3ESRA 3QU4A 5AI8A 3HLTA 3U7EB 4BX3A 3UM9A 4CNQA 4G63A 5IT4A 4UARA 5AK5A 3WKEA 2WF6A 3ZX4A 2IYEA 1RPZA 1PW5A 2FPRA 5AW6A 5ALSA 1VJRA 1XPJA 4O8CA 3CNHA 3OCZA 2P69A 3U7HB 1QYIA 3L8FA 4AP9A 3RF6A 4HGRA 4UMEA 3KZXA 4RETA 4Y2TA 4UM5A 2JARA 4GIBA 4L6CA 2RBKA 5ALQA 1RLOA 4KN8A 5ALHA 1Z5GA 2FUEA 3IB6A 5ALXA 1NRWA 1JUDA 3ZI4A 3RFUA 3NRJA 2OM6A 2X4DA 1ZD5A 2ODAA 2O2XA 1AQ6A 5AHXA 2AMYA 4KNVA
chains in the Genus database with same CATH superfamily
1KIMA 2GUGA 2MTBA 4TYQA 1X0XA 3TLGA 1YU6A 5MHTA 4LYDA 4HDKB 4IDEA 1KPHA 5EP3A 4HEJA 3WYFA 4LJAA 3EASA 2XDQA 2G70A 5AKLA 5DP2A 4DCMA 1OGYA 1Z7EA 1IYZA 4PFSA 2X0FA 2E2WA 2J6SA 1D3AA 1ECGA 2V97A 1OI7A 1JPNA 3H3FA 2E9SA 2L0XA 1G5PA 3LWBA 4YQEA 1ADFA 1ZH8A 4QATA 2XGPA 1LLQA 1R66A 1MB4A 3OX3A 3OICA 2JF0A 3NXSA 3H3XA 1ZUNB 1CIVA 1V9PA 2YJ6A 3SQWA 3A4MA 5DIFA 3ROGA 3CSSA 1EQ2A 1N0WA 1Z15A 3BTUA 3N6VA 3UB2A 5AVWA 1ZITA 2ZBEA 3BQNB 4RZ2A 5MDHA 2F1OA 5B7NA 1RWWA 2C8LA 2Q8QA 3HSSA 4DR6B 4JAVC 5I8PA 1QHHA 5HKLA 2HCJB 4X00A 2NUAA 2XIQA 4JXZA 3NOQA 4B6JA 4Q9AA 2F76X 4PONA 5EJAA 2AC4A 2H08A 1TOAA 3F5MA 3VOSA 5TS3A 3GZJA 4H18A 1A7UA 3J7AC 2QRMA 2W9BA 1W5FA 1E2KA 4F45A 3HUDA 1K68A 5HJ5A 4I2BA 3BGWA 3CYMA 1YVEI 3V32A 3HKBB 2D4AA 2EX0A 2QBYA 4QJBA 1E7MA 3ZY5A 1PQ4A 3TVTA 1EPUA 2DFNA 2V7TA 5KYUB 3L79A 1QH1B 4CPDA 4BWJA 3HJTA 1TQDA 2C57A 2ESRA 3PDHA 1ZXXA 2QM0A 5IKOA 2WJPA 1CKEA 3DB1A 3KL4A 1PSWA 3DG9A 4PC2A 3K8OE 4IIFA 5EZ6B 3V1NA 3B0YA 1SC1A 1WS6A 1U5BA 4K9MA 2KSOB 3DGEC 1U28A 1N78A 3HTXA 1XALA 4U7PB 1BQ4A 1LDBA 1I3NA 1NJ2A 3I6BA 3IP3A 5TMDA 1U31A 2YWJA 4KHZA 1DELA 2M2IA 2R2GA 3HKDA 1PW7A 4D4JA 3SQXA 3IOCA 1CR1A 2W55A 2NNWB 3V4FA 2FSVC 1KRXA 5D2CA 4LS3A 2QRHA 3O2SB 2ANCA 2YN4A 3WGJA 4ZYYA 2CUKA 4PTZA 3GNSA 1ULSA 4AI6A 4UNPA 4ZI5A 4RPJA 1UJ4A 3HYCA 1JLLA 1TTTA 4GPZA 1DP4A 2G76A 3FYDA 2ZYVX 4GGPA 4O4JF 3AVYA 2J0SA 1Z6TA 3IAHA 4ZAZA 2V5AA 2F2AB 2FJUA 5DG9A 2G6BA 2GCPA 2FSGA 2PLFA 1PV2A 3KEGA 1QP0A 4MWSA 1FEZA 4L4ZA 4JUIA 1SOMA 1MIHA 1TVKB 1Z4NA 4DILA 2VH1A 4UAUA 2LCFA 4HZUA 4BGIA 3ZHZA 1IQ0A 1O6FA 3F7OA 3C8MA 4B2LA 1ZIDA 1N2BA 4U9HS 4OXNA 5H02A 1UJ6A 1KC3A 3H97A 5AKJA 4N82A 2H4WA 5G5HA 4EEYA 4D92A 2HFKA 2DQNB 5EKSA 1YI8A 1M2HA 1NQXA 5BNWA 1EA7A 2CW5A 3NBAA 2GBCA 4TGLA 4FW8A 1E6MA 4CT4B 2JPDA 3NGXA 4KZPA 1P4AA 2BEUB 1GDDA 1X1AA 2IQ5A 2GVZC 4D9HA 1Z0KA 4QIWC 5SYMA 5GPBA 4ETMA 5DN9A 2QXYA 2QB0B 1OH5A 1XMIA 4CF6A 5ALOA 4KODA 4KWEA 1TJ4A 4NL9C 4DCNA 4RD3A 1P5FA 1DTEA 1OV6A 3EGIA 4Z9XA 4JLOA 4WY5A 1QCYA 1E3TA 5IJXA 2H51A 1I5OA 3LTNC 5C32A 1L7NA 1I6WA 3NAGA 2PA3A 2YIDA 3BCRA 3OQPA 3HBFA 4NLZA 4CLEA 1KSPA 3GD7A 1VIYA 3IQDB 1WP9A 3D2CA 4L5AA 4G23A 2DR2A 1HYEA 1NYRA 1QHGA 3IP4B 4HAWA 5KG3A 3C24A 2DRIA 1YDFA 1BN6A 2AOTB 5KQLA 1E18A 3LBHA 2Y0SC 1QVZA 4YUYA 4RVOA 2GCOA 4FEYA 2F43B 1Z22A 1NDHA 4KLOA 4Y18A 2O8VA 4KKXB 2CFOA 3ZXYA 2XMSA 4HRVA 3H2HA 2DFKB 1WO8A 5JTTA 2FFRA 3NAZA 1MG0A 5CNIA 3HL4A 3JWEA 1LQUA 4RZUA 4UBCA 5KT3A 3DZ8A 2GHRA 4V2UA 1Y82A 4JODA 4G36A 4HNRA 1J0EA 4MKXA 3HV0A 5DW3A 1W2GA 3KFUF 1KFKB 2CJXA 2XI9A 4ZC8A 1DOQA 2JHCA 2H0AA 5IIMA 4EY5A 5BQOA 3ORHA 2KJ8A 1CEXA 1QP8A 4DNQA 2AC7A 1P6XA 8AT1A 1U4SA 4JQZA 3THOA 2XLBA 3NHYA 1FQJA 3AYZB 2EAMA 2HBZA 4LDAA 1MGOA 3KYBA 4QECA 2I9PA 3NBMA 4MV7A 1SC3A 2GHTA 1P8JA 1JXLA 3RYCA 3B1VA 2B21A 2PJUA 4J1SA 3E81A 5HCUA 2NPIA 3B6KA 5LC1A 2GGSA 5LUAA 2HY7A 4XLLA 4OJNA 4KR9A 3HJEA 1PVDA 2CHUA 4DJDC 3LYUA 4QLOA 4YXWA 4MFCA 2O3UA 5BV8A 2XODA 5IVPA 4YAOA 1QTRA 1T1EA 2OQRA 1GN8A 1GSAA 3TFOA 3WKCA 5HGJA 5DTMA 4OM7A 4HUQA 1QLHA 2PX3A 1CYDA 1CCWA 4LZPA 3D1JA 4YN3A 4MJ7A 2C9CA 3EHDA 4FZRA 3SOPA 3ZZMA 2Q5QA 2F3NA 1UFKA 5I9TA 3U1VA 3I9FA 3V8RA 5T64A 1G5HA 4ZCMA 3GAZA 4NYJR 2NO6A 2ZT7A 3KQNA 3IT2A 3CF6R 2XUIA 3IBFA 3II6X 1TPYA 4DSUA 2IHMA 4EG8A 4JJKA 1QX4A 1W49A 4B3TB 3P26A 3OTWA 4LK2A 1A95A 3TIVA 5KVVA 3UPQA 5B57C 1GLGA 4V0ME 4HDMA 2YL2A 4YJ3F 1ZQTA 1E8NA 1XRNA 2C4HA 2FPGA 1VM6A 3LQKA 3K4GA 1CUVA 1R0BA 5DMXA 3Q6NA 1RYYA 3OU7A 3Q9NA 1W88A 4O5CA 4R9UC 3T7EA 1FSSA 2NV3A 4PLWA 1X7ZB 2HRCA 1LSSA 1OT5A 4FNOA 3RM3A 5AW1A 1Q14A 3KVRA 1DBWA 1N5LA 3ZVKA 4GBGA 4QEZA 1ZI6A 3OA2A 1RG6A 3K8ZA 4K4IA 2IYEA 2CDCA 2QLFA 2ZR7A 3JYNA 1EDBA 4GP7A 3S40A 4NZZA 2HMXA 4RQ2A 4O4LF 3WLFA 2I0FA 5EIWA 4LBYA 2VP5A 1CRLA 1YIAA 3DOIA 4BV8A 2FMKA 3PSTA 1ECWA 3DFUA 3TQIA 2GM5A 2QTGA 2PMEA 3ZI4A 3BBPA 4DUGA 2QKYA 4LXUA 4DJFC 1PGQA 3Q5GA 1S0OA 2VP3A 2UYGA 4M3NA 3BA1A 3A6FA 5AKYA 1ORIA 3KXPA 3Q3VA 2E49A 3QF4B 3DWIA 4HEHA 2UXCB 1E94E 3BJZA 4QU0A 3RADC 3V7UA 1PT6A 3EUB2 1DMRA 4FXPA 2XZLA 1GL9B 3WRXC 7ICGA 5A2QA 3KAKA 4RNOA 3LDGA 1U2PA 3HI6A 2V9WA 2OGTA 3PW5A 4D96A 4PYQA 4ZT2A 4LX8A 1Q16A 3N05A 3BPSA 1UP6A 5CW2A 4QW9A 7ABPA 2EFJA 1PT8A 2BDTA 1F7VA 3GLGB 2OCLA 1PK1A 4F4FA 1CVRA 3AEQA 2JEIA 2ZYGA 5CLJA 2W6NA 4QGSA 1FUIA 4UAWA 1YQXA 4FTWA 2QZJA 1JE1A 5G2OA 3SKYA 3WOVA 3QVWA 4J6EA 4WAUA 2GK7A 3QX7A 4HZIA 4G5YA 1E9EA 1S5LU 2H18A 1QG4A 3C6MA 4M8LA 1M2KA 4EI9A 3EB9A 3SNHA 2FWAA 3IEVA 3WHLA 1ZD4A 2DT5A 4BO2A 2I1VB 1VSTA 3CZMA 4W6QA 4IGKA 2ZJ6A 4L1KA 6PFKA 4X3CA 1ZL2A 1CZOA 1JEYA 1BQ3A 1KSHA 1YR2A 3GDGA 2OYRA 2AXQA 1C3JA 5CB4A 3FWHA 3ZXUB 2MIIA 4EYEA 1MO2A 3RG2A 4TT3A 4KV7A 1ZVQA 3Q6IA 4H1WA 1Z0ZA 1XZKA 4S0XA 4J90A 2ALJA 4B35A 1I94B 3VPSA 4BNUA 3DMHA 1CX9B 1VCNA 3RTDA 1XQ6A 2IHUA 1CZNA 5F1OA 2O2ZA 4OQPA 2C3MA 4D9IA 1L1RA 3EQZA 3P4XA 2A9KA 5CH5A 5KG0A 2HIHA 1C9NA 2FP4A 2VDQB 3JZMA 2WVGA 4LHVA 3AF4A 3UH0A 3FZQA 3DEJA 5HG0A 4RK6A 4JLAA 4C4OA 3G6WA 1CQWA 1IRXA 1K8XB 3O2QB 2ZXFA 4C5BA 4DTIA 2JLSA 1X7XA 4DC9A 3ICCA 3G0OA 4R8RA 3C3BA 4ZQEA 2HB6A 1TZJA 2H57A 1NI5A 4UZEA 1ZNYA 3EXIB 4WXYB 1ADGA 4MVJE 4YLYA 2MMCA 3EPHA 5FWYA 2C4TA 3U4GA 3I52A 9ATCA 2YZ2A 5KX5A 2JGNA 3IPRA 4UASA 4KFTA 4LF5B 4EFNA 2QP3A 4MOWA 5CK5A 4WH0A 4RKRA 2XTJA 5DLDA 3TPZA 1RE1A 3HWRA 2YYSA 4C3ZA 4XVCA 1M73E 1Z6PA 2NTEA 2L18A 1WVGA 3ZHOA 5BSEA 3B3QA 2VDKB 3WXBA 5DZSA 2R48A 3RASA 3WZ2A 3B13B 2KLBA 1W87A 4TQ9A 1KYZA 1XDZA 3B51X 1FIUA 4IIXA 3IX7A 4DLPA 5J0SA 3AHCA 2BMWA 4RK5A 2LPMA 5DVZA 2FEKA 3E3NA 4L5IA 3BICA 1H2AS 4IMRA 4EGFA 1FTYA 4AS3A 2A5JA 1EG2A 4PLFA 3RNOA 1XJCA 2VH5R 4R64A 3MYRA 2GBFA 2AYZA 2XY7A 4EMBA 4I27A 4JI4B 3E82A 1F20A 5IKPA 5JU6A 2BI4A 5CA0F 4YCAA 3A6GA 4YRIA 2PD6A 2LZ0A 5KYGA 3FFXA 5T7BA 1V4VA 1YQWA 4KMSA 3DE3X 3EVCA 1IM4A 4KLQA 4KXXA 4QNRA 1VECA 4C88A 2IHTA 2VS1A 821PA 4ZU1X 4B83A 4QZHA 3NWEA 1EVIA 1X7DA 3VOBA 4PYKA 5JU5A 4WWHA 3K0AB 3KR2A 4DEVA 2PDAA 4KNVA 1TT7A 1GFIA 1U6KA 4KK4A 3RFCA 2ZWAA 2I66A 4LF6B 2NRTA 5G53C 4PTLA 1Z8NA 5AHWA 4DAOA 3R3UA 1JHYA 3MCWA 2XWSA 4PSDA 2JAUA 3MAJA 4BP8A 2W9MA 4A8JB 1SKYB 5ITWA 1NXXA 1WHTB 3VPGA 1AUOA 4MLPA 1NXVA 1SUPA 2QX6A 4IAOA 1YFZA 4PLGA 1GO3F 3GD5A 4JU8A 1U1FA 2QPOA 2OFOA 4OL9A 1QVRA 1DSSG 4WN9B 4AQYB 5AO9A 3Q1LA 1EGHA 3FKQA 4PIMA 5CP2A 2UVUA 3FKSD 2C4VA 1SL1A 4TL6A 4M76B 3DHNA 3T7IA 1W5EA 2O14A 2BE7A 3WL7A 3SMVA 2R79A 1P7DA 1G5QA 1PGNA 5BPCA 2LD4A 2J0QA 4ZT6A 1HETA 3ITNA 3GEEA 4Q8FA 3B2EA 2Q2OA 4DSAA 1EP3B 5BV7A 1V47A 2QMHA 3K0EA 5CTJA 4CWAA 4KX3A 3JQPA 5E1BA 4K88A 3J81j 4OPMA 3ICVA 2BFCB 1KIAA 1IN1A 3TD9A 4EA7A 3HYTA 3OX2A 4XX0A 2POCA 1ZIPA 4EVRA 3G85A 5KCMA 2G09A 2YZNA 2IH2A 2DXIA 2WYIA 1Y7LA 4KMOA 2IU4A 2P2CA 1LK5A 4YRTA 4HPXB 2OYSA 1D9ZA 3EJWA 3D7NA 1JIIA 4AC9A 1YKFA 2Q21A 5LSAA 3TAUA 4DQIA 3S68A 4M0PA 2A3RA 4G4JA 1ONOA 5LJLA 2ZYUX 3PRYA 4BDPA 3IKMB 1XCGB 1K75A 4DQPA 4OY3A 3OQ6A 5HRUA 2PS3A 3NOVA 2Z0MA 4TURA 5F5NA 1XMPA 1GTRA 3HLYA 4R8UB 4LJ5A 1KFSA 5JS1A 4XLZA 2R44A 3JARB 3LC1O 4HRXA 1Q5PA 2PKRA 2OZLA 3Q3IA 4FR2A 3R3YA 4Q3KA 2GZ1A 2PKCA 1G8KA 4DKXA 2W9CB 3EG9B 4KWTA 1T3ZA 1BS2A 4GXKA 1V5EA 1NE2A 3STTA 5IM4A 2FFQA 3E0XA 2R6ZA 3EXEA 3PDUA 4P36A 4UFNA 1FP4A 2K2QB 3DAFA 4YT2A 3PKJA 3L9WA 1XTRA 2XT0A 2WUEA 4RQ8A 2QWXA 4YJHB 2BZ1A 4PG5A 1XCBA 4US8A 1XZNA 1LI5A 3Q7SA 1V38A 1M6EX 4KL8S 2FX2A 3AEZA 3ZGLA 4YFKA 3OLVA 1F60A 2DU8A 4TYNA 3KOUA 2HJGA 1NUQA 5C1BA 1YR8A 2HU2A 1J2MA 2FUCA 5KKAA 4RUKA 5ABPA 4IIGA 2QK4A 5FULA 2R5NA 3K5HA 4Q45A 4N3AA 1V7ZA 2WSSD 1TUIA 1EGQA 5FLXA 3T1HB 3IG8A 1OYWA 1QKKA 1BWRA 3KTDA 2HSGA 3JALB 5KVQA 4GI2A 1RHQA 3V8MA 4H1VA 1E4VA 3CPJB 4KAFA 4C7ZA 3GLQA 3DBLA 3UMJA 1JJBA 1SCUA 4I4TA 3DZGA 4FONA 1XOIA 5AM2A 1DTSA 3B52X 2KSQA 3FZGA 4CMGA 4RL6A 2FZVA 1EXNA 2VYQA 8ATCA 5JSKA 4E12A 2DLDA 3MLEA 2C2KA 1EWKA 1NUUA 5AVUA 2DKXA 3COSA 2C4WA 2H3QA 1UMCA 8ICZA 3G88A 3JAWB 4KE7A 4CI0B 3K4PA 4JKYA 5DI9A 1RPZA 3I04A 1M74A 2H8GA 3TW8A 3FG9A 1OZFA 1SCBA 3C74A 2J4FA 3S2FA 4MQBA 4BDSA 4OXYA 4GYYA 3MLAA 2CCJA 4RGVA 3E15A 1NULA 4UBOA 1N2ZA 2C5LA 3IMGA 3R6LA 4MKIA 2IEDA 1NBIA 4CNBA 2NUTB 5F7OA 3GGDA 3TAHA 5KSWB 3RVLA 4LDRA 2FWIA 4UOEA 1Z6AA 4U8HA 2GQ0A 1SPBS 1XG5A 4XSGA 3TTWA 3EW7A 1CBUA 3RFTA 1V1MA 2EIXA 5I3ZA 2O8EB 1KR5A 4M9CA 4KYTA 4DBVO 4WRRA 5AUPB 1E5TA 4GP9A 1KYWA 2Y1CA 2QVBA 3A28A 3R5XA 2BM8A 2H6EA 2PBFA 1FDRA 1XTVA 1PJLA 2JIMA 2NSHA 3FDIA 1NAIA 4QUEA 3UUEA 4BNZA 5EN4A 1OI2A 4ELVA 1V45E 4YCLA 1DCTA 4FZMA 1NMQA 5JANA 3FOEC 2O1SA 4J0FA 5DV9A 4LXHA 1E98A 4JKOA 5A7HA 4J4BA 2J9GA 5J43A 9ICUA 5IVHA 1FK8A 3ITKA 4DIUA 4OX9B 3ASZA 2YXBA 1G6KA 3PYLA 1KQOA 5E7IA 4DFDA 1ORRA 1Y7PA 3LGXA 1P1BA 4B3RB 3WYNA 1TM2A 4RU1A 5K0LA 4O59O 2J07A 2JS7A 4KK3A 5KYVA 3TPFA 5DHQA 3KQMA 3PEWA 2KI5A 3UHFA 3VKUA 1KU0A 1XNHA 1KZYC 3V00A 3B7PA 3LQYA 2WJ4A 1DQSA 3I2FA 2CXSA 5TLSA 1KK0A 1OILA 3NIFB 5AW3A 2JFZA 4X90A 1WR8A 2AW3A 5BWCA 4J6FA 3I39X 4IF4A 5HZMA 1FA9A 3LK7A 1OX4A 2ZBVA 4UAYA 3PF9A 1H2HA 2NZUG 3N3BC 1P2TA 2AH5A 4Z9YA 1TQ4A 5KFXA 2V3WA 3I04M 3UW3A 2MAXA 2FDCA 3DXXA 5E0KB 1JIXA 3WMGA 1I4EB 1KQPA 2XTAA 4CF7A 3TQFA 4Q7JB 4XGIA 4KV9A 3LF1A 4JL8A 1K63A 1HEYA 3RTGA 1HZZC 4AJLA 2XX3A 5KFGA 2JHFA 5ESXA 2PA0A 4RO0A 1GG5A 2WPNA 3RFAA 5KJ6A 3NC1C 4E4YA 3F46A 4RHTA 4OREX 2XVMA 1YB4A 3C8UA 1S8FA 4WKGA 1ZQWA 4NTZA 2KX7A 3Q5EA 5JWHA 2JIZD 4YEDA 2D2FA 4C3VA 1JQLB 3ZV6A 1P18A 1LLFA 2G88A 3GEBA 3KTOA 3IEKA 3SIXA 4IDHA 3KPVA 4HH3C 5IM5A 3CF2A 2FJ0A 1JU3A 3ZWQA 3H9QA 4K6OA 1N4AA 5G0TA 3PC3A 5BOMA 1YJXA 4U7JA 2YWFA 2W3RA 5IANA 1MZVA 3LZCA 4OYHA 1SD5A 3RSQA 2J85A 2HV9A 4DFPA 2X0EA 3CW2C 4I66A 2B8WA 1T3SA 4FLEA 2JI7A 3M89A 5E6RB 5LP6C 1UJNA 4YQZA 4X1KA 4TMTA 4I5EA 1UMBA 1KKMA 1ZWKA 1LTKA 4YP1A 1H6BA 1KNXA 5EUCA 3NBXX 1K98A 5K0NA 2VI5A 3P45A 1IM5A 3RAEC 2ZRLA 5JC8A 3QFCA 3BMNA 4TLEA 3EOZA 1O97C 2A67A 1VL8A 1KI8A 1FUEA 3W4JA 5JH7B 1ST3A 4CYMA 4FP9A 1U0JA 2C29D 1X19A 2CNNA 2I2CA 1MQ8B 2CGEA 3I1FA 2XT6A 2ZI5A 1N8TA 4ASUA 2H2AA 2W5UA 3IT0A 4ALJA 3ESQA 3LT2A 2FK7A 2XOKD 3DAOA 2VRWA 5LA6B 1T2VA 2FPUA 1RD4A 4S35A 3OHSX 4HOYA 1UDWA 3VR5D 3FA2A 3L6EA 1H1TA 2H54A 2Q0XA 4Y9DA 3QE0A 3OWHA 5EWLA 2LMRA 4JB8A 1T3GA 5LP1A 5EQDA 3MXOA 5JWOA 4IDGA 1R9JA 4J0CA 1E7RA 4BQRA 1VHDA 1IULA 1RM5A 3RC9A 3DFFA 1XVVA 2HO5A 5DX0A 5C0YA 4D8UA 1FXSA 4W6ZA 2Y67A 3JQAB 1UR5A 3FCYA 5IXJA 4PHGA 3QEBZ 2I71A 1QRSA 2H5LA 1DOAA 5LDHA 4Z1MA 4JJ8A 5JMPA 2WIJA 1Y63A 1XRLA 4F5ZA 4PPGA 2ORED 1TL7C 3F53A 3LX8A 4JV2A 4XI9A 4R9NA 2H9AA 3QE2A 3SS8A 2AD5A 3T7KA 2OGSA 3VMFA 4DANA 2V6FA 4IIYA 3GBPA 3DQPA 2B9VA 4FLMA 2HNBA 1XQXA 5J23A 1Y5RA 2DHEA 4FX5A 3LKZA 2PMDA 2FQQA 1EXMA 2YY6A 2H1IA 3LVBA 3FWKA 4WESB 2FZ5A 1KOFA 4Z2YA 4A26A 2BELA 2XWPA 2RGDA 3QE9Y 1VKRA 3AONB 3B2NA 3E70C 5JI3E 3OZVA 5A6SB 4F7DA 1ZLYA 2QTLA 1XL1A 4YQYA 4U7TB 5JY6A 4DEZA 2GF9A 3GCDA 3N2GA 3RH4A 3LC2O 4MI1A 3RR8A 4H77A 2UZ3A 2P0EA 4ILEA 5LYYA 1Z25A 3BTVA 4M37A 1NFQA 2JLUA 3PY8A 5CR0A 3ZW8A 1Z0UA 4J2TA 3EN0A 3QTLA 1RJWA 2RHTA 1CUIA 1PFUA 5CYOA 3A05A 2FDRA 3R9XA 1HKHA 4MINA 3GRRA 4J03A 4C03A 1OLUB 4HVTA 4F72A 1VHTA 3K96A 3T52A 3E58A 4XKJA 1WNTA 2PXHA 4X95A 1QRUA 1L4YA 5LOVA 3B8HA 3KV3O 1WXDA 1PJSA 4RPZA 2NRXA 4UAZA 1CQXA 1UINA 2FVYA 3WMFA 1OW5A 3USCS 1C30B 5L1MA 3R3HA 3TZBA 3MUNA 1J21A 2OBMA 4KIJA 3SY8A 1S0UA 3ITDA 1K4KA 4LI3X 2LCIA 2ZZNA 5DG7A 3TLKA 3TX2A 3WL6A 2EZYA 2X3YA 2X15A 2KVSA 3PUWA 4N76A 4B82A 4ZEXA 1TW3A 3CR7A 3RG8A 4DYVA 3MFHA 5EJ7A 2RHGB 2FPMA 2ZZKA 4G5SA 3U2QA 1C9JA 2V3VA 1M10A 4OLBA 3WK4A 2YUIA 3LBFA 3RF9A 3W6ZA 2QUJA 3KKEA 5AOAA 3OMXA 3ZWYA 3AF2A 1DOHA 4UUMA 2KFZA 3C4VA 3FUUA 3DBRA 4HD8A 4KVAA 3QLTA 3HJNA 2QSJA 3NHAA 4M9LA 1PL8A 2QX9A 4QDZA 2WF6A 3HA2A 5JJ5A 2D00A 3K1YA 3ELDA 2OB1A 1UODA 4DG9A 4ED1A 2Y6VA 3OWOA 3MWYW 3RSCA 4W5TA 3I9V6 1PUZA 3QPWA 5DRYA 2QVLA 3X2FA 4CDRA 3W9BA 1RXCA 1KKXA 4B09A 4GW3A 3T99A 4P3YA 3NT4A 1N2XA 5KEIA 2PU5A 5DHSA 1RXVA 4KIUA 3OSNA 3NOOA 5JHHB 2EBWA 4RLQA 4RJTA 3VHQA 3UG7A 5J2FA 1SBZA 8LDHA 2XY4A 2Y4NA 3AIOA 3AUTA 2ZAMA 3P2YA 1LBIA 1KLNA 2C95A 4YLEA 1NMZA 1JJIA 4K0RA 4GUDA 2FH5B 4KLDA 1GZUA 2CK3A 1Y5IA 2NNLD 2VT3A 4L73A 5JMOA 4XWWA 3IELA 1JFFA 1EE9A 4NHOA 4A10A 3ORRA 3DMNA 4HV4A 2EFYA 2WE7A 4WFJA 3F7TA 1W94A 1HT0A 4IJKA 4W63A 4CEIA 4HMPA 3L4EA 4RKQA 3DV2A 3KHKA 1JHRA 1G2OA 4KAXA 3F96A 1LQ2A 1XD8A 3VSDA 4UEWA 1OBFO 1PQYA 3E5RA 4JR1A 1KI9A 3PNSA 5BPFA 1K89A 1E3QA 3FZNA 4HUTA 2G63A 1KDPA 3OMWA 4KWHA 3TZCA 3VC2A 4AZ0B 1KBZA 2D62A 4CF4A 4DDVA 5DB8A 4ZEOA 2IS6A 4A92A 5TS2A 4MW5A 3VU1A 2P4HX 3PFIA 1YT5A 4HNAA 4OCZA 1S0NA 2OHVA 2RHDA 1RMTA 2CT8A 1IG0A 5L40A 1DJLA 2LKCA 3NRCA 3BZKA 2QN7A 3ZYCA 4P0TA 1SG0A 3RSGA 1LK0A 2PSHA 1J56A 4RTNA 1W5TA 2QQFA 2WQZA 2ES4A 4QGFA 1GPJA 5K01A 4FHDA 5DCWA 2H7YA 1G1AA 3RS2A 4YY3B 5J47A 3QLEA 3O2NA 4WXHA 1WV0A 1P8AA 3EOAI 3VC1A 1ZOPA 4BJQA 2PGXA 1C9YA 4Z4CA 5DKFA 1T0PA 3SF8B 1JZQA 2JATA 1RRGA 5CMLA 3AEKA 1T91A 3OZSA 3VTFA 5DCYA 3RUHA 3NYQA 2J6UA 1Q2XA 5JOQA 5AJZA 3R3VA 3LXUX 4KQ6A 1VI2A 3MJVA 3PNKA 5A7FA 2BHNA 1KF0A 5JQGF 3I0ZA 1GQRA 2XXAA 2PTHA 4O5OA 4DLXA 3VSBA 4ZPJA 3GZNB 2XWQA 4JV5B 4I2EA 1AUPA 1E3EA 5K0CA 1WB6A 2CJFA 2TYSB 3SVTA 4GLFA 1ZUIA 3EDYA 4KXUA 1G20A 16PKA 1XRQA 3OSUA 2WW8A 5JNSA 4JNKA 3MMZA 4MO9A 8ADHA 1L5GB 5G4KA 2WUDA 3HJCA 4IDAA 4UREA 5DBEX 4NY8A 4FMCB 1JDBC 3B9JA 5JRTA 3BGVA 4ER7A 4CG1A 2IEGA 3M9XA 4ZHQF 3CB4A 3FSRA 4HGQA 2GKOA 4RIHA 1DV2A 5DXAA 3JD0A 2PU7A 2D8MA 2P9JA 4K8RB 1TCVA 3PNYA 3THYA 4DLRA 2OFWA 2AFHA 2IS4A 4J9UE 1E79D 3E9MA 1GAQA 1UKEA 2E55A 2V7GA 2VL7A 2YNMD 4U6SA 2FMHA 2OV1A 2H3VA 1VHLA 1OLSB 2C92A 3R5KA 4F4YA 3VBCA 4MUIA 1M1YE 3PXEA 2R62A 2B30A 3VTAA 3RSHA 3VYUB 5A3QA 1SA0B 1CHNA 1QYCA 4LHXA 1N62A 1XQYA 3KZVA 2HRDA 2HCRA 4C4PA 2VZ9A 4NLCA 3CHYA 3GNTA 1GG9A 4IV8A 1P0QA 4AKIA 1IJKA 1K1SA 3GROA 4NAHA 5E3HA 5E2AA 1XZMA 2IH5A 3TZLA 5J2HA 4JBLA 3KZNA 2P6UA 4X8MA 1B2LA 1XNQB 1GSOA 3U56A 1VOTA 4XYLA 3NS7A 4LXGA 1H2RS 3RE1A 4RK0A 4E30A 2WF7A 3U4MA 2YKGA 3ZU4A 2ZULA 3I2HA 3HR8A 1EJ2A 1OUQA 3REOA 4LVSA 4JBWA 1EM8B 1GZSA 1W1WA 4N5HX 3PT5A 2HCBA 1TU3A 3V7NA 4ARBA 2WA2A 1CY7A 1ILWA 9ICEA 2YHAA 4QLBA 5DM4A 5CA7A 1NBHA 2NX2A 4N6NA 1D2CA 3B1WA 5ICEA 4TT8A 4JR0A 4CKEB 2GYUA 5EA2A 2I7VA 1CUYA 5EVCA 5JD5A 5D84A 5CRIA 4EHKA 3ACCA 5SY9A 3UFBA 5H59A 1II8B 3TFRA 3NVMB 2VHEA 4I5GA 4IS2A 5AICA 1AE1A 4DY6A 3KCNA 3TNDA 2XMRA 1E2IA 4DR3B 4AVYA 3U9TA 2DBVO 4GEKA 3UWKA 2EZTA 2P9YA 3MVEA 3U31A 4RESA 4E5NA 4RXUA 3RTEA 3ZN2A 3IG5A 3L05A 3T3PB 2A4KA 3B6JA 2QJFA 3OE7D 1J39A 3O8OB 3DBIA 2V7XA 1HG0A 3KOWA 4KN6A 1NZFA 1I7DA 3UGKA 4BIIA 2VNHA 1DWUA 1A96A 2BDEA 2VP4A 1BCSB 1IH8A 1G8MA 5KSOA 4EZ9A 2D13A 2ZIWB 4C4ZA 2FKAA 5JJBA 4PZDA 4YRFA 1FMTA 1I36A 1JR3D 2XIDA 1E1QD 4EHJA 3AMVA 2A88A 1YBMA 2OLEA 4M46A 4HFMA 4CQMB 2WIAA 3O9VA 5AJYA 1PIWA 2ID8A 5F78A 3G6YA 3GR6A 3FFWA 1L6IA 4U2BA 1NJ5A 2P6MA 2ZSUA 2DCUA 1RRKA 2P9CA 5IN5A 4D99A 3U37A 3C70A 1LQTA 4A2PA 1QFZA 1E4OA 3MJRA 3RREA 5LQAA 4LV6A 1WAMA 4IH1A 4DR4B 2G8NA 4UCFA 3U4QA 4J9KA 3LHFA 4K5QA 3I6QA 1KP2A 3EFOA 2J3JA 1CD5A 5JCPA 2NO1A 4CU2A 2VBGA 4JUFA 4Z4QA 1GXSA 4HB0A 3WY9A 3ENQA 2OEHA 2ZIAA 4EKNB 3ORSA 4AF8A 5EHZA 4QZDA 1UBEA 4J0DA 4L3WA 4OQLA 2JFGA 3NP9A 2RKOA 2JKYA 5D5PA 5CX1A 5CIQA 1EFRD 3SJAA 1P2SA 3J7TA 5DGBA 2PGLA 1FUUA 4V0KA 2PO5A 3A4NA 5C0OE 5IINA 1ZSNA 4ZRMA 5JPIA 4Q3NA 4LFAB 3EX7C 1NWCA 1NK4A 3TINA 2JLWA 3FDJA 3VDQA 4O0LA 5BN5B 3NDPA 4WBNB 3ZH9B 3BF8A 4Y6PA 3QV2A 1R15A 3OF3A 3HWTA 4MEXA 2JGEA 1DC6A 4YCSA 4GPEA 2V1UA 2JLVA 4BEWA 4HATA 3U4IA 1IUOA 2GSDA 5CFOA 1KOJA 3WRYC 2WM2A 1B8UA 1M2VB 2K8BB 4CQNA 2RQ5A 1OVMA 3GJ0A 1GZ7A 2IXGA 4XQEA 2ZDHA 1K7YA 2FXIA 4WQMA 5J2UF 4KOEC 2P1DA 3UV6A 3R75A 3WFJA 2OV2A 4UTXA 3VI4B 3M5WA 3BJIC 2OORA 3IQGX 3QXHA 2QSZA 1SXIA 3RJIA 4FZNA 4MPPA 4BV9A 4W8HA 3U7HB 1IAVA 4GR4A 2W6CX 4GIBA 3BHMA 3ZUGA 1LI7A 5BY2A 2NG1A 4ZD6A 4Q4AA 5L45A 3BORA 3D8BA 2FMSA 2J45A 4H0FA 1FXUA 1S2LA 3DL7A 2C28A 3SV3A 4F91B 5DYIA 1X7YA 1M6NA 3HP1A 1NBMD 2A7QA 4NBSA 4BNIA 1A4UA 5A4AA 1B3RA 5ALWA 1YZ7A 3L0CA 5C8YA 4DS3A 1A5AB 3E5HA 2GPSA 1AC5A 4JWKA 3KYDA 1VL6A 5D49A 3ZD8A 4FJ2A 5H0IA 4CETA 2AG5A 1VBFA 3GUUA 1GU0A 3E9RA 2VPQA 1AKMA 5A0VA 4OFBA 2Y3IA 3HB0A 1BXRA 4DWWA 4BC1A 2AQ8A 4O2AA 2LI6A 4U5XA 3O83A 3PXCX 3QQ5A 4WMLA 3IAS6 1OGIA 4J1NA 5FFNA 3WGNA 5CEJA 4UCQA 3K6SB 3N75A 4UU0A 1VSQA 3V8QA 5I7HA 3DVAB 1I0LA 3H9CA 2J9FA 2NQ2C 1XN1A 3BCHA 3OFND 1NWHA 3EA4A 1DDOA 4E11A 1KKUA 2D74A 1ZWLA 1UMDA 1Z35A 5DK6A 3RD5A 1FUYB 2XMDA 2WKQA 3SKVA 3AU6A 4UB3A 2B61A 5CWRA 1LRLA 1JHMA 2WYUA 3DGFC 2XNKA 1T43A 2ZUUA 4TZ6A 3IEPA 2PR7A 3SF0A 2YXLA 5LBIA 1XLTA 5BSRA 2HUPA 2X5KO 4LMAA 1MIOA 4DSEA 3SEZA 4EJFA 3H2SA 4DJJA 4QICA 2XKAA 2QN3A 2P4EA 1U47A 3PENA 2RKWA 2OO5C 2WJ3A 4BLUA 2W6JA 3T3IA 2DH6A 5LIRA 1RRCA 3UGTA 4D6YA 3TKLA 2FR1A 1L6NA 3M6XA 3J80A 3BH0A 4XPIA 4C8OA 2RB4A 1GL3A 3OKCA 5BXYA 4YMLA 1AKTA 1NYQA 1WNFA 4EJ0A 1VE1A 2HIMA 1Z47A 1TCCA 1U9JA 2ZTEA 1Z38A 5K3FA 5TEWA 3ZHRA 5EJEA 2PRSA 5E1DA 4MYSA 1FFDA 3EPIA 3V1YA 3WMEA 4XOUA 3DEAA 1J97A 7ICUA 1H5QA 4HDSA 2C78A 4ECXA 1J9GA 4LTDA 3AI1A 4QA9A 2I1QA 4B73A 3WLLA 3QVSA 3HM9A 1UZNA 3ISBA 1Q0PA 5LLTA 4CHGA 2Y0BA 3TUJC 2MYTA 2YWDA 3U44A 1CB0A 3VKVA 5FPYA 4MUEA 2DUYA 2BHRA 2Z30A 3INYA 4HL6A 4O1HA 4B17A 1KDOA 5KOYA 3OJ0A 1JVSA 4W5OA 1NW6A 3LWZA 3O1LA 3HN6A 3UAXA 5KTOA 2AZ4A 2VJPA 5H82A 5A7GA 4CLOA 3GLUA 3A0BU 1X9IA 3MJ4A 2PS0A 2IHYA 1VXRA 3A4TA 4WBXC 1G63A 2AKEA 3UK2A 3RUEA 2QPTA 5LQDA 5KFVA 4MR9B 4JBXA 2JHAA 1YVUA 4A4DA 5A4MS 2O50A 5JCJD 4M6WA 1JU9A 3PG5A 3PGA1 1TCAA 1JI0A 3AR6A 3QUBA 3N87A 2RB5A 4NKRA 1QORA 2C9BA 3ETLA 3EIHA 2NSLA 3SJBA 2XBMA 3PRJA 4MJLA 2NVUA 4B7UA 3LLSA 4Q66C 4IGIA 1A2OA 5SYAA 4CLXA 1TYAE 4JA2A 1WQ3A 2XCSB 1C1HA 3T1VA 2J3IA 4CCHA 4OA8A 5I7WA 1E4EA 5BSTA 4M8IA 1XTQA 1NV9A 5E0OA 3KDAA 4Q1EA 4E13A 1L7AA 3DE2X 1YQUA 1LLUA 5F64A 5AK5A 4LFBB 1PI3A 3G49A 5TC4A 4TKMA 3OTHA 4WECA 1EB8A 2FLWA 5EIEA 3ZW9A 2B25A 4KH0A 4RKYA 1DG3A 4ROTA 4Z9BA 2ZUSA 3RAQA 5KG5A 3WLSA 1MNQA 4IHKA 5L9XA 5IC6A 3QKSA 1SGWA 1IE3A 1KFEB 3CF0A 2MSWA 4OXRA 2Q1SA 2QD3A 3KYCA 2ODAA 3L7NA 4LNUB 2R5FA 2FQ1A 1TMGE 2O3RA 3VVMA 4ZV7A 3L49A 4FGLA 1U8FO 2IDJA 4RACA 4DAEA 2XE8A 4W7SA 2GZHA 3C5HA 3O9ZA 1JKXA 2IXFA 2AUMA 3HY3A 5AKKA 1Q22A 3PVSA 1JR4A 4CQLB 4L9RA 2WHQA 4MVCA 2PJRA 3MMXA 1J25A 2O2EA 1USIA 2TECE 3G7NA 1EAYA 1DHTA 3HWX1 4P7JA 4WCFC 3DV0A 4B1FA 2Q2WA 3TSYA 2CXOA 1WRBA 1H2EA 1ZW6A 1V1RA 1WYGA 2E37A 3HI4A 1N92A 4WLOA 1SNYA 4KFSA 4XQ0A 4LHSA 3RB3A 3P9PA 1HI9A 4QBGB 1BMQA 4YRZA 4PHCA 3DO6A 1NN0A 4JCCA 4KP7A 5GWXA 1Y8ZA 4TUQA 3BGSA 4RY0A 4Y6LA 2WMOB 1YQTA 2V6MA 1N5OX 3AEXA 1BDJA 1INLA 5GADl 3SHQA 4C1BA 5CLIA 3QIVA 2FE1A 1U5CA 4N01A 3MMNA 1G5RA 1C7FA 3GLFB 2VN8A 2E8MA 2H2GA 4QT0A 2WKPA 3FOCA 3ZWPA 1E7YA 2C5SA 1QIJA 1U4NA 5JNUA 3G5LA 2WKRA 3HDVA 3H87A 1SKBA 2A35A 1B1AA 1E32A 2Q9AA 4XLTA 5JJIA 2IS2A 1MAUA 2BCQA 5I7SA 4MGEA 5I4CA 1LC0A 3NEYA 3FGPA 5BR1A 4LPSA 2Z4RA 1NY6A 3WNCA 1PNVA 2UVVA 2WU0A 1NI4A 4FR0A 1A8UA 1W9HA 1XRMA 4DSLA 4DIBA 1H3FA 2F9FA 4CVNA 1RJ9A 1V85A 5IYZF 2GD0A 1T5OA 3O84A 3S7TA 3LLUA 2RC6A 2GEKA 4K6KA 2Q3LA 2HBMA 3D6HA 5D4BA 2G5IB 3FPKA 1Q7EA 1TCBA 3KLNA 4OIMA 4KN4A 3PL5A 4UD6A 1F8UA 4CR8A 3BWDD 1UBUS 1KI7A 5H1YA 5L7TA 4KO2S 5E9QA 5HKBA 3KKQA 8ICAA 1XHLA 3I72A 4PRLA 1H65A 1FX1A 4NCNA 4DWVA 5TQ0B 2AOUB 4L4XA 4A6EA 5FOUA 3LJKA 1LBQA 4ZCRA 3GFTA 1DO8A 5EP4A 1E2UA 3KQTA 2K7FA 3UMMA 3LKDA 3WLJA 3CUEF 2WLSA 2GDJA 3AESA 3RPEA 1XNGA 3N7AA 1RZVA 1NNEA 2C2YA 4R1SA 1PGJA 3ZNQA 3MQ4A 2ZYSA 1O6CA 4K87A 3EF3A 1CNMA 3QJYA 1KFJB 1QK3A 2OPBA 4RCYA 2YVLA 4DPMA 3SQMA 1P74A 4QIHA 2VIIA 5JDIA 4FE3A 1PGOA 3S70A 2ANBA 1OWOA 5JAOA 3LUBA 1ONSA 3L4SO 4IG9A 4P4GA 2GZSA 5IC4A 4B46A 1BXGA 3ONVA 3T1OA 3JQ7B 4JWTA 1KY5A 3I5YA 4IS3A 3QMMA 2XLCA 3VCBA 3S3TA 1RVV1 2AKAB 3OZRA 4PSVA 4H16A 1C7IA 2DH5A 4PYOA 2Z6VA 4TTQA 3NRZA 1WBJB 2QW1A 3DLIA 1TMYA 1QHYA 2JI4A 4Q18A 4MA0A 1M6YA 1CUBA 2R1TA 4RWEA 1KZ1A 2WD7B 2J8ZA 4IILA 2VDRB 2R2AA 3LXMA 3QZUA 5CVCA 3JQ9A 1MC5A 3PL1A 1OH8A 1E5DA 1V26A 4DCOA 1OIWA 4UTOA 5KFYA 3OURA 2W6IA 2CMGA 2Q3JA 1CP3A 1IBMB 3L9XA 3AU8A 3V4OA 3RU3A 1QRAA 1TCUA 1Q0HA 5CD9A 1A97A 5JZBA 2X0IA 4BY9E 3JQAD 2LW7A 4PU0A 5CH3A 4XA8A 1V8OA 3OC6A 5DQHA 4GDFA 5B66U 2QP4A 2PUHA 2LR0A 2WHPA 1PQWA 5COQA 1XD2B 3FSGA 4AJPA 2O8CA 1RMQA 1DE0A 4ZI7F 3HB9A 2FFAA 2JIOA 4LRXA 2Q6OA 1GIAA 3CLHA 3Q9UA 2PZMA 1I3LA 2PFQA 1EA5A 5CR9A 3HZHA 4B9LA 3GRKA 5EZYA 4Z49A 3SP1A 4EW1A 3I05A 4M36A 3U5TA 5FBZA 4FDUA 3C5GA 3N0WA 5DT2A 1O5IA 2M0NA 2B4AA 1DO2A 1GCGA 1UJMA 4AJOA 1YA8A 2ZS8A 1YR1A 2J3KA 3EJ6A 3G1TA 3O4HA 1RAIA 1DCFA 1CQIB 2JAQA 2F1IA 4TLMB 3EEOA 3GLIA 2GN4A 3OQMA 1SUIA 1YE5A 3TUZC 3O95A 4RVHA 4K03A 3EQ9A 2Q3CA 3PGVA 4MR8A 1B93A 3KPYA 3RYTC 1GNQA 4IDPA 3QMPA 5EJ2A 2F90A 2Q5EA 1W7AA 1ISRA 1MKYA 3GWGA 2EBUA 1P7PA 5DWDA 3RHZA 3UMVA 4GC6A 1VDMA 1GZVA 4QFBA 3EYAA 4EYHB 2AFIB 4NDAA 2VNKA 1HEKA 4HQOA 1ZN9A 3C7CB 2F8MA 4YAJA 1GUYA 3K0BA 2VPWA 4ZCIA 2BPGA 3EGDA 1U04A 5EE5B 2Q3FA 1JEEA 1QNLA 1OA1A 2VT2A 1P77A 4PX9A 5E95A 4CFZA 2PLRA 2IKSA 4FYXA 5GJWC 1R9MA 5FV4A 1VE9A 2FETA 1L5KA 1S3IA 2A14A 2P4SA 1A4RA 4OHZA 4WY8A 4WZAB 3NNNA 4J9LA 1SHKA 5HF8A 1KK2A 1GAWA 1YI1A 1NJYA 3LS2A 3COJA 3WKBA 4PBRA 1V35A 3GP5A 4GECA 4RUCA 2JEYA 4MWTA 2CZCA 3K0CA 5D85A 5B53A 4EYIB 3WYCA 1ZQPA 1CRQA 3AJ8A 2ZQ5A 1D8TA 1DG1G 4ZJZA 1TZBA 4ZZIA 4Z6FA 4D0GA 2PFGA 1PYGA 3LIPA 1F2DA 2P2SA 1C1DB 1Q6YA 3I3SR 2DWUA 3P27A 1N9GA 2IT1A 4EA9A 2CB9A 1TUBA 4MQLA 2WAQC 1HFEL 1LD3A 4EY7A 5HDQA 3C3AA 5K05A 5KNBH 2MSNA 5KYYB 1NMYA 4J1TA 3D4NA 5KNCD 3K0SA 2FRDA 1AQNA 1T3LA 3B5JA 4CEHA 3PCRB 1RRPA 3ZU6A 4ZVQA 4DL4A 2ZR8A 2NU9B 3PA8A 1DAIA 2VQ6A 4H3KB 1IG6A 3CT4A 2HA3A 1RZRD 4EYQA 3B6EA 4ZHSA 2W6PA 3F1LA 1Z36A 1FYDA 2IOFA 3FNHA 4KX5A 3FPGA 2QT0A 3L7JA 3DCYA 3EDRA 1R5JA 2IUTA 4OP1A 4GBED 4WUVA 3D2NA 2Z2JA 5AOCA 3AJEA 4DLZA 3Q7IA 4C0ZA 4UAJA 3A4YA 1J8QA 1YB6A 5KT6A 4BASA 4BQPA 4LZWA 3WLPA 3I9JA 3OIUA 4LOJA 1G16A 3EVGA 1B7GO 5LDGA 3LIIA 1MMFB 2UUAB 3LPCA 3FVVA 4CCSA 2VKTA 2VJCA 3A7DA 4LMPA 1KVUA 2O8BA 5SZIA 4QVGA 2VLIA 3IKJA 3M1AA 1KFTA 2BR0A 3IQXA 1QYRA 3NTLA 1YZHA 3NXKA 2P67A 3EDOA 2BFOA 2GLTA 2DBYA 1A2BA 1RR6A 1ZCJA 4B3DA 1BE6A 1DRGA 5FLYA 4RFSA 3ZYZA 3R7WB 1G3UA 1EVQA 3BMOB 5IWAB 2UUBB 2EERA 1KAGA 4FEAA 4A8HA 3L4KA 4G07A 3VPAA 3R23A 4H2DA 4BQQA 1OWNA 4A6XA 1GUFA 1SVUA 8ICHA 1VB3A 4FFOA 2ZITA 4JA0A 3V8PA 4P5PA 4NC9A 5J0TA 1R0LA 2YRWA 5LIPA 5DLPA 5AW7A 4FFRA 2PKXA 4BQFA 1I1NA 3GG9A 3S7ZA 4QIWF 1DBQA 2OPHA 1E9AA 1ZO8A 1DXYA 3AF3A 3WHKA 2KICA 4XE5A 4RIEA 3V1UA 1JEQB 2FPIA 5CEEA 5KNDH 1V6SA 1ZM9A 3CG4A 3FH0A 4WD3A 1QGOA 3JPPA 3ADBA 4JWMA 4RIGA 5KFPA 4MEAA 4BVBA 4RKWA 1FFSA 5KOJA 2YW9A 3K3PA 3V7FA 2FEOA 2HLNA 5KFDA 3V9AA 4II2A 3VAYA 4I14A 3ZDQA 4F96A 1Z75A 3M6KA 3O8RA 4D3ZA 1GRQA 3QVTA 1BD4A 2D2EA 2B92A 3OF5A 2VOEA 5EWJA 2O3TA 2HMAA 4L2IB 1F48A 3RU2A 4AECA 4ENSA 3TR0A 2B4KA 3RAXA 1CUSA 2Z83A 3UXNA 2XUDA 2WAMA 2VA8A 8ICLA 3BHNA 1URPA 1WUHS 2Y0SF 1DX9A 2XQGA 3N2LA 1N0IA 3TSCA 3GXOA 4LV8B 2ZSJA 2Y71A 4UXJA 4DE5A 3LTEA 3TRKA 2MA1A 2Z9CA 2GF2A 1HEUA 3FGZA 3QH4A 5LQNA 5T41A 2PPVA 1RIFA 1WD5A 3WIOA 2FOLA 4QYWA 3OOWA 3GN2A 2XYHA 2YRXA 3ZY6A 1AH2A 1JWAB 3BMCA 2O2DA 4KLMA 4QM7A 2WWIA 3WYGA 3SXUB 2P91A 4GH5A 1B8VA 4XTCS 3Q8KA 3KEQA 2XADA 3CLUC 1XXHB 1X38A 3ADPA 4NPCA 2ZXEA 3CURA 2BCEA 1R10A 1NE7A 2WT9A 1HE5A 2B4QA 3Q8QB 3ZDCA 3WQRA 4J9VA 3ZD9A 2VK8A 3FFAA 3SZUA 3PGXA 3HJHA 4A0RA 1RC1A 3QHPA 3B7WA 1DEXA 3PUZA 3G6VA 4HAUA 1YFKA 3BVPA 1T0UA 1L7VC 1SBTA 2BFDA 4R84A 4FS1A 1OJ7A 2I7XA 2OCEA 1XDUA 1YS7A 1WE2A 4MV5A 4C2UA 4FDTA 1ZCBA 3DSRA 4JBNA 2BM1A 5J9FA 1A5ZA 2ATEA 5M29A 3GFPA 1AZSC 1R4NB 2ZAYA 4PLPA 2ZPTX 3GVIA 3ZCUA 2AG8A 4F1WA 3P4YA 4I0WB 4LVOA 3IHTA 3IAEA 4MYCA 4F5QA 2ZJOA 1CZUA 3D2AA 1E7QA 1J4AA 4E94A 4CQJA 3VNSA 2WILA 5F4ZA 2H5XA 1WWVA 3BKXA 4FFBB 1XZAA 2ODEA 4U8GA 2EFDB 3JQBC 4OQXA 3KUXA 1NJ8A 5BOSA 1U7WA 3KSRA 5FP0A 3WWZA 3M7IA 5LPNA 2DT8A 4MUJA 3PRKE 3PMLA 2CXYA 3O3OB 3WWPA 2FW8A 2WJZB 1E6KA 3EGWA 4GXIA 4DWIA 5BV2P 4BFXA 1QO0A 1K7EB 5FA6A 3CYFA 3BRWD 2Q3BA 2JBHA 2J9XB 2OHOA 4C80A 1E5LA 2OWEA 2O1EA 5I8WA 3NGLA 3MIIA 3L2OB 4NEGA 2ETXA 5IT9A 3I9V1 4N39A 2OMEA 4V1CB 4RDXA 2REQB 4A2WA 4MYDA 2IS1A 1FFCA 5EWGA 4ZMBA 5F3XB 5A0LA 4IIBA 1NTOA 1U8EA 3KLBA 1YASA 1T1JA 2JKVA 1I7QB 4E5SA 2BEVB 1WKCA 1IVNA 3RCBA 2BIFA 2WJJA 4OVKA 3AUYA 4O3PA 3CISA 4FGZA 4RMJA 4F3TA 1N6NA 3SR3A 4JVSB 2G36A 5F12A 1O3YA 2WG0A 2I3DA 1OR8A 4G67A 5JBIA 3LCCA 4ESEA 2D7CA 5J63A 3L7DA 1TKCA 2YNMC 3UWPA 3ZIDA 4IUDS 2HWXA 4UBMA 3HVKA 3FRIA 2DB3A 3AFGA 3JQQA 4YWJA 5FPQA 5FCDA 1VCIA 2HRRA 1XO0A 3D4IA 4YD1A 5E8RA 3KPJA 5DFAA 2FPPB 4D3SA 3GO4A 1AQUA 3IE1A 1DXHA 1PX2A 1SJ9A 4PV7A 2X5JO 3AOGA 3EPGA 3BIWA 2OQIA 4YRSA 4NU0A 3IC5A 5SY4A 5L3SB 1JMKC 3E3OA 4OI4A 4YRRA 2IMWP 3ZLVA 4UCXA 2VVTA 1QE3A 4CQMD 5EUBA 3KAPA 4GPAA 1KS2A 3KELA 2A9QA 2LBOA 1W5BA 1YA4A 5GIOE 4RE6A 1JTVA 5BPHA 4P4LA 3RQIA 1C4XA 2OB2A 4JJZA 3MS7A 3A1FA 2SKEA 4EO9A 2GO1A 2DPHA 5B12A 4RU9A 4MS4B 4O08A 4HXFB 4KH1A 4JIMA 3GIIA 2HFJA 4WZ6A 4P53A 4G4GA 1NI3A 2VAPA 1QVWA 4IQFA 2GKSA 3E7WA 3QU9A 4ZRDA 3KK0A 4LXQA 4EI2A 4TV9B 1O1YA 3V7WA 4W8OA 1FXWA 1ZQGA 2WNHA 5F9HA 3PQEA 4DWJA 2PM8A 5H80A 1YZLA 2BYTA 1M33A 1YSCA 1U9IA 1U3FA 3QBVA 1C9EA 3EEFA 2LUOA 1FSZA 3L0DA 2VF5X 5JO9A 3FGNA 4XB2A 2IDMA 2DPJA 1NOMA 4WT7A 3RQSA 5JNVA 4RFVA 4XX1A 3CGGA 1MENA 7YASA 3LRXA 3C6QA 1TAGA 3A9VA 2R00A 3TTSA 1GTL1 2C5GA 3E8MA 4OOEA 4MIOA 2YDXA 2O6LA 4V1CI 1Y9ZA 3IQWA 4KXVA 3NUZA 2Z1DA 4OO3A 3DVQX 5AVQA 3HYLA 3THXA 5TNXA 4I7EA 1E3WA 2CHFA 4ZOLF 1AHIA 1OFGA 4BZPA 1F2UB 4A03A 4FQ5A 2UVPA 1N4DA 3BGDA 4LSMA 4RA6A 4PZLA 1A9SA 2Q5CA 1WZCA 4JLMA 3HXTA 3OPVA 4EZ6A 3MCAA 3FUVA 1Y4AE 1DIAA 5J59A 4URHA 1XWFA 2GOLA 4M0AA 1RXUA 2ZE6A 2ZPAA 3ZCTA 1FLDA 1YCGA 1Y1LA 4DZZA 2AV6A 2QAIA 3U4CA 1MEEA 3BK1A 3AH8A 2GPJA 4DUPA 3ZNPA 3S2EA 2RC5A 2GAAA 2WM3A 1G20E 3OA0A 2BJHA 3SYNA 2E4WA 5JALA 2AR9A 4WK2B 3QU5A 1N2SA 1N8NA 5HIIA 2PUBA 1KY3A 2BGGA 4FE4A 4XIFA 1FS4A 4J3FA 4GL2A 4CMEC 3QEMB 4KIFA 3M7DA 3LMKA 5KFNA 2WJ6A 3VKWA 3WA6A 1JBKA 2E8NA 4J0GA 1OPXA 4RSMA 2ASJA 1XEXA 4BFVA 2YHBA 4TUYB 5B1HA 4AG5A 5CTAA 3TQCA 3B60A 4FILA 1V43A 3CLUD 1R6TA 5FADA 3ZCSA 5EHQA 4LNAA 4PGMA 4NBLA 4NMXB 1CJVC 4OHKA 3Q98A 1O54A 3H5OA 4BUCA 4B8WA 3WLIA 3HSYA 4CMKA 3TZHA 2D6FC 1GV1A 1XCLA 2I87A 4L16A 2EW8A 4P5DA 3H2ZA 3UXMA 4IHJF 1P0IA 4YMNA 3PWTA 4NY1A 5E2IA 3HH8A 4HNGA 1H2YA 4L0CA 1S2DA 3H8WA 5B1SA 3WBBA 3ZCVA 2UYHA 1IN4A 1SOUA 1ZICA 2R6HA 4RTLA 1E1KA 2N9UA 2HMVA 3JYQA 4ARAA 2PZFA 4A8JC 1BX3A 3O74A 3ACBA 1Z63A 2ZR9A 2BMVA 5DBFA 3TMYA 1D2MA 2YVKA 4OK3A 1T8YA 3CLRD 4MYTA 1NVDA 3R76A 5I9LA 2XKJE 2UZ1A 1SIJA 3LNTA 2EEPA 2VDLB 2RGRA 2Q5IA 1J2RA 3IXLA 3WAGA 1OI3A 3D8SA 4M1TA 1BE8A 1C8KA 4HJRA 2IODA 4MIYA 3NV9A 4ZYTA 3L06A 2M6KA 3DO8A 3L40A 1H8EA 1GITA 5TPWA 1DWQA 3PV8A 5EJ8A 1GM5A 2GPBA 4FC6A 3OE1A 1L6RA 3NBYC 3ZBQA 1VG0B 2PYZA 3WXMA 2BHLA 1DJMA 4CFSA 1NC1A 1LTQA 2YVAA 3KU4A 1NJXA 1JT9A 4OXXA 1PKEA 1F9EA 3AM1A 3NT5A 2RI1A 1F17A 2I34A 1UP4A 1O8CA 3A06A 3R3XA 2PWAA 4KJXA 2DERA 2Q28A 2BR3A 4YR9A 2JH3A 3BQ9A 1DT3A 1I30A 3ZE0B 3HKEA 2X8WA 4K3VA 5DH9A 5TQ2B 4UHDA 2G1PA 1I2CA 4LV5B 4REQB 4ZAYA 2B6GA 4N8EA 3AU2A 1ZQIA 3H5VA 1YB2A 2Q0SA 1RLUA 3H16A 2HA0A 3WJ1A 2GWRA 5KNBA 4YHHB 4GOXA 4TKUA 5F3RA 2QUHA 4LJ4A 1ZQKA 3FI0A 3RGGA 4CIDA 3DM9B 2WUFA 3JZAA 2GNOA 5EXEA 2KJQA 3DE7X 4OO1J 2CXXA 4RIIA 3SLRA 4V2IA 1X7HA 4I55B 4W9NC 4KQEA 3AOEC 5K51A 3RJ9A 4BFWA 5BN4A 1RAHA 4FBMA 4ME6A 5CA0A 3ZWMA 2AI3A 5K20A 1F2TB 3INTA 5K99A 3O4RA 1JAIA 3PI7A 3BWVA 5HHHA 3NWOA 1FRNA 3QXSA 1KEWA 2FX3A 5DLFA 3BTOA 2HYDA 3ND6A 4I3HA 1EQUA 5GZ6A 4OQQA 5KFQA 3EODA 1AGNA 2AJ8A 1JA1A 4YRDA 3U0BA 4C4SA 3IV7A 3T12A 4RGBA 4BZWA 1Z17A 1KJ8A 3O9MA 4XWKA 3N2KA 3MTGA 2H52A 1TGVA 2H1FA 5K0FA 3D5TA 2XRFA 1F5SA 2PYIA 4GYJA 4PG4A 2ZDGA 3JV7A 1YI0A 3PF8A 1PT5A 2FE4A 2NPFA 3K2QA 3FPJA 4BBZA 3FYUB 1C1YA 2CVPA 4JD5A 3B82A 1D2NA 3CCCA 4D02A 4G1CA 2PBRA 5BMVB 2GEBA 3ZY3A 1BVSA 2QRVA 3RVSA 3Q8MA 1KO4A 4LA4A 1NM5A 1NW5A 2ADMA 2XQVA 1ST2A 3RVDA 1DK3A 1XCPA 3JYOA 4YDHB 1NVEA 1COWA 1NBEA 4IRUB 1HQCA 5NULA 4KWIA 4I46A 4ZQIA 1COOA 4YDQA 4J3NA 3H0KA 4BLTA 1QCDA 3KZKA 3JPTA 4GVLA 3K9NA 2J7PD 5DX8A 4UMEA 1XZHA 4Y2TA 4R2LA 1X86B 5KNDA 2Y9UA 1ADYA 4KPGA 2EXXA 3AHJA 4IZIA 1F5NA 2X4DA 3DVLA 1NUTA 4TTJA 3MCUA 1FP2A 1YR9A 2WOOA 1RWNA 4KVFA 4C89A 2A9FA 2F3QA 3QVVA 3IAS1 5LXTB 2SCUA 4EPWA 3KP1A 1XDGA 3ZGNA 3A9TA 3MGGA 3H05A 1TLLA 5FNVA 4AY6A 1K27A 2C4UA 2DQ4A 4C0WA 2FV8A 4G3IA 3PO5A 3ROZA 4B0PA 4AMVA 1FL9A 1Q2UA 2C5BA 1U94A 4NJ8A 5ALEA 2VSNA 3FCSB 2EG5A 2VDOB 1H0KA 3HDHA 3TM4A 1CR4A 3V1TC 3BQ2A 4EL5A 1X2IA 5LU8A 4TM8A 3ANNA 5B3JA 5DASA 2RBEA 4X24A 2F1RA 3GEHA 5JD6A 3AY7A 4E7OA 1G60A 1WLYA 2QIOA 1K0FA 3E0QA 2G4VA 2FLNA 3DVSX 1M7HA 5KYNA 3ND7A 5J58A 1YOBA 2GYVA 3KJEA 5BSUA 4RKEA 2JRZA 5KMGB 2J87A 2BM9A 1WWUA 4C6HA 2LE0A 1GL6A 1TFUA 3B5EA 3I09A 4OKNA 4RS4A 1GGFA 1QBGA 3PHJA 4NJOA 4YMVA 4G09A 1IY0A 2EKPA 2DG2A 1E2NA 1WZIA 5AM0A 1BMFD 3RTAA 2XXJA 3SX0A 5CLFA 2W8KA 4AMZA 1BEEA 4F9TA 4EUKA 4DA8A 4TXHA 1JDNA 4LRUA 3M6UA 5E9JA 3AR4A 3N0VA 4LY9A 3WQQA 3CF4G 1QM5A 3K31A 5HJ2A 1N56A 2GJAA 3WLEA 5J8YA 4FB4A 3WGVA 5IDVA 4MW6A 3IT3A 2HA6A 3LLMA 1D2GA 3HVJA 3CLVA 5I7OA 2EQAA 4HX5A 3L8YA 5KJEA 4EAAA 1XELA 3EARA 3W5VA 1PK3A 3BIJA 1IOWA 1U1EA 5K6AA 4YD2A 2W4MA 4HLUA 4B76A 3SPXA 1U8CB 2H8KA 3HXMA 1THGA 4O2BA 2I80A 3PIIA 1KH2A 1ZH0A 1P4HA 4L57A 5TIIA 1QFXA 3TKYA 5TJ9A 2VRCD 4TZTA 1ZAKA 3WL4A 2JHGA 2HEIA 1M7BA 2AK3A 3FHLA 4B8ZA 4YBRA 4CKCB 1PE0A 3IAXA 3D64A 3CR3C 5ADVA 2EQYA 3OAAA 4G0UA 1ZSYA 1IB0A 5JISA 4G8CA 1RADA 2L19A 3SQLA 5BW8A 3OQBA 4AICA 4KN7A 4Q03A 4TRNA 5DBHX 3OTOB 4HX2A 3C3YA 3TCKA 4C5CA 3FCAA 2FWBA 4IEIA 1XQ1A 3W8RA 3GGPA 5FOTA 3FNEA 1E92A 1UBFA 5L3QA 4YXMA 2NUPB 5IDQA 2O9JA 2PXAA 4C87A 1NYLA 3KKMA 1KDZA 2F48A 2GPYA 3RS5A 4C6SA 4RTOA 1L5YA 2G17A 3DLAA 2A1TR 5CGQB 2I1LA 2C07A 3WSTA 1H22A 4W5JA 2O59A 1H0HA 2AL7A 1CS0A 4TWBA 1L5ZA 2GXQA 1V9CA 4BBAA 4D80A 4NCHA 1I3KA 4DM4A 3DJYA 3LYSA 2JBWA 2Z9BA 4AJ2A 2ASLA 1VZ2A 2F8SA 4B9TA 5AVXA 1DRKA 1ZSVA 1UBLS 2GM3A 3Q7EA 4KGXA 4ALLA 2F8TA 3SENA 2AN4A 2O54A 4ECZA 4LJ9A 2A33A 5LP6F 1ZQHA 4DV3B 5E7QA 1WMBA 1E1YA 4IQVA 3BD6A 1D6SA 2IFTA 1Z12A 2C98A 2WG1A 5ARDA 1PDOA 2BFBB 5CP8A 1LU9A 4LXYA 1EDZA 2HMTA 3H5RA 4LDPA 1Z7YA 4KN8A 3VYVA 4DLSA 5BT9A 2V4ZA 2OD9A 4G0MA 5GM1A 4WKOA 5BUQA 5T4BA 1QZTA 4Q3DA 3C1OA 3MA0A 3KSDO 3PQ4A 2LXNA 2CHQA 4K9OA 2NAPA 2CNOA 3QLUA 2B1QA 2KTQA 1CFJA 8ICTA 1SBIA 3Q41A 1FRQA 1EWTA 4AZTA 3FF4A 1KZ9A 1XTUA 4V0OA 5SICE 4ND8A 1MBZA 4BKQA 3I2KA 3P2JA 5U4QA 1K6JA 5JT1A 2NV0A 4EHDA 3M6FA 1SC6A 1KBQA 1BS9A 1YKGA 1N75A 2J0UA 1PEKE 2O6KA 2QM3A 3E23A 4E1AA 3TRFA 9ICSA 4DV2B 3ZKWB 5CBPA 2I3GA 2VF2A 5FAKA 3FOWA 1AHHA 2J5RA 4JXJA 3M4YA 3ZJ5A 5BYJA 5JVDF 2ZTMA 1G6Q1 2W2VA 5H81A 1AKYA 2FMXA 3BX1A 1UPAA 4P4TA 1TF5A 3DEHA 1SCDA 1PJ3A 1Q1AA 2QZSA 1BA3A 2XA1A 1JW9B 5K6TA 1UOEA 3N7RC 1C8BA 4KW7A 1DK2A 1HDCA 4G4SO 1D4FA 2G5PA 1J20A 4YJ2B 4MKFA 1XHFA 1KJQA 1Z3IX 3NVKI 1Z2CA 2AUTA 4DVJA 4PWZA 2R7MA 4B33A 5G1OA 2CXUA 2XJ4A 3FUCA 5KG4A 1UJCA 1XTKA 4G01B 4FFPA 2OKGA 4UVIA 2W22A 2VDVE 1VE3A 3UN1A 2NV6A 4WNIA 4EF5A 3MS2A 4TYPA 2UZ4A 1PJRA 3OT5A 4I5IA 5JPCA 2JAWA 5CB1A 3TVYA 3PQ6A 4YXJA 1ZESA 1Q77A 3EXHB 3GZ4A 4PLZA 4MF8A 1Q0LA 4QPJC 5ALLA 2BCSA 1EVYA 1BSVA 2IYSA 1S96A 3KT3A 4NR0A 1QC5B 2XSZA 1E99A 1YGPA 2W9XA 4IXMA 3WAJA 5JDCC 4KR0A 1QKJA 3A1EA 4Q19A 1YMUA 2EF1A 4IBOA 2NMVA 2W3SA 4UC0A 5L1KA 1EU1A 2C84A 2OBXA 1J8VA 6AT1A 2UZ0A 3LBAA 3Q2OA 3QKUA 1TUEA 1WSWA 3AN1A 3KHSA 2IY8A 2H4YA 5JRDS 4J8PA 5MN5A 3VR3D 3NTXA 3L02A 2OSVA 4OGFA 4H08A 3JQ8A 2P9HA 3G5AA 2XVAA 1AZWA 2J3QA 3OBBA 3PE4A 2QTVB 2PWYA 5C5IA 1KP3A 3OI7A 1AS0A 4IUYA 5EIOA 1W0KA 3H5TA 1SB8A 3F0TA 3BJYA 4ZA2A 4I3GA 2VNIA 2H29A 4EECA 4NOJA 4QARA 3Q0TA 4UBBA 4K9PA 1VPDA 3FMPB 1FPQA 4TN5A 4JL5A 1US8A 4GBJA 4KQ2A 4IJWA 4QZEA 1SVIA 2FWNA 2XY5A 3DC7A 3ETGA 2BLLA 1I4LD 3CINA 5JYCA 4C0HA 3D3KA 3P19A 4BX9C 3RFFA 4Q4HB 3ANXA 3KXLA 2ZJ0A 3EPPA 5J0OA 3I23A 3K9HA 3NYRA 3PLRA 2OFFA 5J29A 2B94A 1PJ4A 3AVQA 2A5DA 2JANA 3O3CA 1Q3HA 2AKYA 4B6RA 1WXWA 3AR2A 1NBAA 3EAQA 3ZE9A 4GPIB 4BYGA 1WCIA 4L0MA 1WMFA 3A32A 3VTKA 3AQIA 5EQTA 5FTJA 2WYWA 1UPTA 1M5TA 1M54A 5F2OA 3ILXA 4MWEA 3TDMA 4R0VA 1E1CA 3FUTA 1VJRA 5DBBA 1XZLA 3F3YA 3P71T 5DDMA 2OBLA 4ZTZB 4WFIA 2R84A 4Q9IA 2AQ0A 3TFQA 3KZ1E 2Q3HA 5DEIA 5CM2Z 5FBQB 3KSZO 1UP7A 2CL7X 4BXOA 2D8CA 4M7OA 4HG2A 3MR2A 4JDUA 1FIQA 4O0IA 1ZPDA 3HDYA 2RHBA 2IBTA 4X41A 2HLDA 3SIWA 4D9GA 3KD3A 1NDUA 4PC7A 4A27A 4DSKA 3T41A 5JNLA 3NKFA 2IH4A 5A3JA 1JKMA 2H7CA 4BGUA 1QHXA 4MV6A 2GH1A 2JRLA 4AYTA 4I5FA 1RC0A 2NZVG 2PX6A 3I9NA 2NPOA 5A1TA 4B3SB 4OBBA 3D7KA 1A71A 4TZKA 2X76A 5DXFA 4M1ZA 4RWZA 3GUYA 2VUUA 1UPHA 5DDYA 4DQQA 2O0MA 4YJFB 7ICJA 4D3FA 3ROTA 1QG6A 3QP9A 1IY9A 2NXNA 4MJXA 4G65A 2FAXA 4NENB 5BYBA 1CIPA 4Q1BA 3QI2A 1NVGA 1K0UA 1QH0A 3GLIE 5D3MA 4FMBB 4P0PA 1JKFA 1W85B 1GCAA 1U9YA 1BDHA 9ICPA 2FPKA 4I4CA 2DWOA 3HDQA 3R24A 4TQRA 5JAMA 1NNUA 3O92A 4CDGA 1HBJA 3GZFA 4BMCA 4BVKA 3IAUA 4ISBA 3AY0A 2H31A 3GUHA 2V55B 4HQLA 2HJSA 3M1LA 5REQA 2YHIA 4HQKA 1P72A 2HF2A 3MWDB 2AFVA 1O7JA 2JAOA 4IOJA 3W2TA 3LSTA 1GSIA 1VPLA 1GZ5A 1T6XA 3MQFA 2GWSA 2BTQA 3Q88A 4UHHA 2EDUA 2CC2A 5HMLA 2ZB7A 4C21A 1NLUA 2BFEA 3P52A 2OTCA 4NCXA 3LYAA 4XQCA 3GRYA 1OFUX 5KSYA 1RKBA 4X54A 3TEMA 1VE7A 3RANA 4QDUA 3T15A 3QBEA 3VPDA 4MQEB 5GQSA 2BKLA 3M3HA 1WZ2A 4QASA 5HK8A 1Z2OX 3KVVA 3D6UA 3AC0A 1QH8B 4DV1B 2JGRA 6GPBA 5B1IA 3X2EA 4QU8A 2UUPA 1G9XA 3CSUA 1LFDB 1FTSA 3AI7A 1SQ6A 3PNMA 4EPRA 1WW2A 2E1RA 1ZM7A 4QRDA 5EHGA 5HKKD 2WTXA 2CLEB 3A9WA 4BATA 1SZPA 1UAGA 2WMYA 3ZC3A 1OJLA 1U7ZA 1IPEA 3PX4A 4K9KA 3OZXA 3WGGA 3F3MA 2W42A 1ZM4A 5ALFA 3HW8A 2EDAA 2QLJA 3L7CA 4DADA 1KW4A 1EDEA 4AZVA 2WFLA 2Y27A 3O03A 1H69A 2FQWA 3VH3A 3CH5A 4MCAA 1GPMA 3L43A 4AQ7A 3EBLA 4F5NA 3GELA 3BJEA 1U6JA 3DTNA 1T2UA 1ZD3A 4HQNA 3RYHB 5IUKC 3KB2A 4MX8A 3C3DA 3QKWA 3KQYA 1IB6A 3CNLA 4F4KA 1PF7E 4IF6A 3JY6A 4M47A 2HK8A 3FOZA 3MWFA 3OPQA 5D00A 3KR0A 4QDTA 4ED9A 5HNKA 5LZ8A 2R25B 3D5EA 2AE2A 1WEKA 2K89A 1OFIA 2WICA 3T4EA 2A9OA 2XDAA 4BNDB 3VR0A 1MJHA 2E18A 4FMDB 4Y2XA 4LZDA 4KQCA 4LCJA 1Y9AA 2B8EA 1CK4A 1U3DA 4DMGA 1O94D 5A9SB 5FF9A 2ZUWA 4WOKA 4E2YA 4O02B 1XMVA 5JJCA 4P2HA 4D3DA 2DGDA 1CZLA 1I7SB 2IOHA 2IDKA 3IAM6 3K9CA 5FI3A 4LQ4A 2GXAA 2FLKA 4DF8A 2R8KA 4PZCA 5KFCA 1U1CA 4ZZ0A 3SS9X 2HBQA 3QOXA 1DAOA 1HA3A 2DECA 4EG5A 3GBVA 4DMLA 3RVNA 1ZD8A 3H9UA 4DLVA 2ISPA 3P9KA 4R1TA 4V3BA 4QGHA 5ITZB 1MB0A 3DEKA 3OEEA 2A8YA 1OXUA 1C8LA 1LLCA 5KT2A 4NFHA 2YJ4A 2H1VA 4CR6A 2I4IA 9ICKA 3EGEA 3PUKA 3JQDA 1AXEA 1JU4A 2I6XA 2W4QA 3KVYA 3EIXA 1A8HA 4N0PA 2CNDA 2ZXUA 1MGPA 5K45A 1J09A 3KTAB 1K88A 2FW0A 3F2IA 4KO4S 4F1JA 2XA9A 4O8ZA 4E2ZA 2O1WA 4YX9A 1E3MA 2H00A 3E22A 4MVJI 7ICMA 3JPYA 3A6PC 4JJAA 3LF2A 3UVEA 1NRXA 1IXRC 1WPGA 3JASA 4FYPA 1QYVA 5CIYA 2QT9A 2D3TA 3SCZA 2E21A 3CO0S 4M1EA 1L5HB 3JATB 5ED0A 3Q72A 4DVGA 2HU7A 4ZGBA 4KKVA 3FNIA 5B7QA 1K9SA 2C82A 3NJ4A 4LXTA 2VAMA 1NZBA 2W03A 5HTKA 1LUAA 3ED5A 3PJRA 1YUBA 5FA5A 2WQ7A 3L3BA 2C7QA 2W37A 2WF8A 1YB1A 3WI7A 1ND5A 4P8RA 5CD1A 2ODWA 5G3ZA 1FS5A 4YAKA 5CB8A 5CDFA 3B3FA 1J9EA 5CH8A 1YVPA 2IEBA 4K9SA 2CLOB 3KO8A 4U5QA 1QVVA 4CE6A 1O95C 3TCXB 4NABA 3HN2A 5HS6A 5LYJB 1N1GA 1KXJA 2C42A 3RRHA 1QE5A 4CKBA 5JROA 3CCFA 4UQLA 2VK1A 3DTVB 3DQQA 2W2LA 2PRKA 4N3GA 2NU6B 4QTYA 4ECUA 1D8YA 4D25A 1HTWA 1KMNA 3K09A 3TL6A 1Z2NX 1N1EA 1XCOA 2QTFA 4F7WA 4N9WA 3DE6X 1U3GA 3M5DA 4NG5A 1CRPA 2RIPA 4EZBA 5EE0A 4CTKA 2E1PA 1WPXA 2C9DA 1NN5A 2CMDA 3NORA 3G2NA 4J7CA 2HBRA 3C14C 3RJMA 4C7VA 1G291 4NX2A 3UQ2A 2VQ3A 5K3BA 3VHRA 2GNPA 1P39A 2I99A 2KZ3A 4A82A 4U6PA 4UDOA 4JEHA 3UT0A 2WIFA 5KHLB 1KFDA 3TQOA 3EDCA 1N5IA 1OMOA 2BONA 4KAJA 1NPYA 4CM8B 1PNQA 2B0CA 4EG0A 4B8YA 3ISVA 5T5QA 2VZEA 1MPXA 4YRMA 1HDIA 3A1NA 2FOXA 2Z6UA 9ICJA 3USZA 3PQDA 3F73A 4ETIA 1VPEA 3NHKA 2ZRIA 421PA 5FUMA 4ECWA 1QZXA 1HE2A 1WB9A 1I1QB 3VAZA 3TTXA 3MHTA 4HC4A 4QBIA 3ZIUA 5K8JB 2ZBUA 3DPUA 2A84A 3NDIA 2GAFA 5JQWA 3EH1A 7ICKA 3VPXA 4MLZA 3AVTA 3KHUA 1SAYA 3IUSA 4P4OA 2C8KA 4R0NA 5EJGA 3BQTA 4HCJA 5EJ9A 2V6IA 1SXQA 4B2IA 3GJ5A 4MPJA 4PYRA 4R8LA 4P83A 1G3MA 3PMNA 1XZIA 4I50F 1ZQJA 4ZVUA 1A77A 3MGHA 5J2TB 2IE8A 3RRBA 4ZKDA 2J9RA 4LRTB 3UK6A 3UQYS 3B1FA 3T35A 4V0QA 4MA4A 1XJWA 4IIUA 3H4IA 5DYWA 3ANYB 2ISSD 5D46A 1AQYA 5C7LO 3M4ZA 1MR3F 2EJTA 4JI0B 4RTRA 3LDUA 3R0JA 4JK3A 3S27A 4URYR 1CUDA 2KOBA 3TIXB 3OX4A 1LDMA 5EJFA 1DEAA 5GOZA 4ZPXA 3R5TA 3H42B 1L5LA 4F4ZA 2GSWA 1P80A 4ZH4A 5LU9A