4CF3A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACAIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 85
structure length 224
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf3A01
4Y2PA 1Z4PX 5E0OA 1RPZA 3U13A 3K1ZA 1Z4NA 3W5DA 4BEWA 1SWVA 2YFYA 5ALLA 1U7OA 3EF0A 5AW7A 3B9RA 5AVRA 3NIWA 1RLMA 2RARA 5ALVA 1EK1A 5ALFA 4Y2SA 3ZWKA 2WHEA 2WFAA 5AK6A 1Z4IA 4KNVA 2FPXA 4BKMA 3ET4A 1L7PA 5ALRA 1EK2A 4DW8A 2IOFK 1QQ6A 3ONNA 4OCZA 3RF6A 4KNWA 2B1RA 2MU2A 3HLTA 3OPXA 4XPZA 5AVQA 5AW0A 5JJBA 1RMQA 3QNMA 2C8LA 4KX3A 2WF7A 3W5BA 5ALSA 3R09A 1VJ5A 4Y2TA 3NUQA 5ALZA 2FUEA 3WGVA 3L5KA 5A3RA 3KBBA 3NALA 4KN8A 2HEGA 2HCFA 2BDEA 2ZXEA 1Z4OA 5AI4A 2B8JA 2HDOA 1PW5A 2HO4A 1L7MA 2JARA 3GYGA 4UMDA 2HF2A 2Q5EA 3L8FA 5ALKA 3J7TA 2NO5A 1RMYA 3WK7A 4EX6A 3OTQA 4BNDA 1QYIA 3ZVNA 2G0AA 2ZBDA 4YCMA 5AVVA 5AVSA 4AS2A 1L8LA 4O8CA 3WKDA 3BA6A 4RETA 2FPRA 3ZTWA 4YCNA 2I7DA 3A1CA 2CFRA 4NFLA 2G07A 2G1AA 4Y2VA 5AKGA 2ZG6A 3VAYA 4ZEWA 5AVXA 2FI1A 3QU5A 3E81A 4AS3A 4FFDA 1WZCA 1L8OA 5IT0A 2MSNA 5ALQA 1Z4LA 3NRJA 1VJRA 1KYTA 2HI0A 3PGVA 5AM2A 3DNPA 3ZVMA 3PCTA 2ZBGA 4XQ0A 2B0CA 4PNHA 3FM9A 1YS9A 3BWVA 3WK5A 5AK5A 1XP5A 2R8ZA 4G9BA 4H1WA 4HGPA 1J97A 4YIKA 3EF1A 2RAVA 3ZI4A 2FEAA 4UMVA 2BDUA 1Z4JA 2W4MA 2OM6A 2B30A 1TJ5A 5ALGA 2FPSA 1RKVA 4BX3A 4HYTA 2JAOA 4CF3A 2GFHA 1SU4A 5AI9A 3W5AA 1RKQA 2FPWA 2C4NA 2RB5A 3N8GA 4NV0A 1Z5UA 3KOOA 2WF5A 2CFSA 2GHTA 5AVWA 2AGVA 5A3SA 2D2VA 3IJ5A 5AW5A 4BEVA 3QU2A 5AVZA 4IG4A 2NYVA 1ZD3A 3NAMA 3OCZA 1K1EA 3WGUA 3N5KA 4EZEA 3WK8A 4NWIA 3E8MA 3WK4A 2IOFA 1XPJA 3I6BA 3L7YA 4UU0A 5AKYA 3WK9A 2EAUA 4CNQA 3ESQA 1YJ5A 1RLTA 3A1DA 3L0BA 4L6CA 3WKEA 3M1YA 4ZEVA 3OCXA 1TJ4A 3U7FB 4BYGA 2P9JA 1CQZA 2C8KA 4IFTA 1U2TA 4C4TA 4UMFA 1Z4QA 2RBKA 4UU1A 2BY4A 4ZEXA 4Y2JA 3QUBA 2WF9A 3N1UA 2IYEA 1ZRNA 1FEZA 1TE2A 2WF6A 5AKLA 2YN4A 5ALMA 2HX1A 3NANA 5AM0A 5AW6A 3MMZA 4JDPA 2HF7A 1U02A 2NO4A 5AK3A 3AR5A 4OHFA 4JB3A 4XE5A 1N8NA 3U7HB 2JAWA 2YMPA 3QUQA 1O03A 3ZWDA 1WVIA 1RQNA 2YMQA 5ALUA 2IOHA 3KD3A 1S8OA 3DDHA 1Z4MA 3AR3A 4YCLA 3AR8A 4MUMA 3I28A 2R8EA 3SLRA 3SMVA 3AR6A 4L57A 3OCWA 2QYHA 2R8XA 3L1VA 4UASA 1Q92A 4C4RA 2X4DA 1VFPA 5AKZA 2YJ6A 4J03A 3KDPA 5AW8A 4HGRA 2YMMA 4Y3UA 2W11A 3SHQA 3SKYA 3L8EA 4UAUA 3B9BA 5AI6A 2R8YA 3UMCA 5AM4A 3ESRA 1YV9A 2VKQA 5AKJA 5ALIA 2YMLA 4EEKA 3WKAA 3NASA 2YY6A 2ZBFA 3OCUA 3QGMA 3FVVA 1TJ3A 1ZRMA 5AHXA 5AKIA 4RESA 2O9JA 5AVTA 2P11A 5IS2A 5AICA 3HYCA 4I9GA 5A3QA 3E58A 2B82A 1Q91A 3L0YA 3WK6A 3A3YA 4UATA 2YJ4A 3KC2A 3L0CA 2ODAA 3F9RA 5AKXA 3WKBA 2QLTA 1RQLA 1LVHA 3B8EA 4DWOA 2B8EA 5ALNA 2PR7A 4CF4A 5AKHA 5AIAA 3P96A 4NAVA 3ZU6A 3AR9A 2PKEA 3E84A 3OCVA 3KZXA 2I55A 3ED5A 4G63A 4Y2QA 4HGQA 3S6JA 3N28A 4QJBA 3AR2A 5IT4A 1ZD5A 2AUTA 4BX2A 2FDRA 4DFDA 3AR4A 1T5TA 3SKXA 5AM3A 1L7OA 4UM5A 2AH5A 2GMWA 3QLEA 1X42A 1RLOA 1JUDA 1T9ZA 2DQSA 2YJ5A 4KX5A 1U7PA 2GHQA 4L6AA 5ALPA 4B6JA 2JGAA 4GIBA 2AMYA 2B1QA 3FPBA 5FP0A 4CF5A 1U2SA 3QYPA 4EELA 4KYTA 1YMQA 2YBDA 3TLMA 2ZOSA 1ZD2P 4UARA 1TA0A 3QU4A 3M9LA 4FE3A 4C4SA 3UMGA 4GXTA 4OFZA 3ZTYA 5AKEA 3U19A 4F72A 1WPGA 2G80A 3CNHA 3DV9A 2ZBEA 4YGYA 4UMEA 2C88A 2HHLA 4EENA 2G06A 5ALOA 3MN1A 4F71A 5AW4A 2JAUA 4UAVA 1Z4KA 5ALXA 3MPOA 5ALHA 1AQ6A 4Y2YA 3QU7A 1QQ7A 2GO7A 5AM5A 2P69A 5AM1A 2G09A 2HSZA 4FYPA 2I54A 1WR8A 4BBJA 1QQ5A 2I34A 1QH9A 3R9KA 4HGOA 3PGLA 5ALDA 3IRUA 2I6XA 2WF8A 5T41A 4HGNA 4QQFA 2EARA 1NRWA 3L1UA 4BNDB 3PDWA 4YH1A 5AKKA 2IA5A 3L8HA 4Y2XA 3ET5A 4XOUA 4E88A 2W43A 3U7EB 1RRCA 2PQ0A 3ZUPA 3A1EA 3U26A 5AESA 2G08A 3QU9A 5AW3A 3SF0A 4Y2RA 4AP9A 5ALWA 3FGOA 3EWIA 3N07A 5AW1A 3AR7A 1J8DA 3SD7A 3L8GA 1NF2A 1RMTA 3I1YA 5AK4A 4UW9A 1NNLA 5ALEA 2WM8A 5AW9A 3WKCA 1IWOA 5ALYA 5AVUA 2CN1A 4DCCA 3UM9A 2OBBA 2P27A 5AI0A 2HOQA 3U7GA 1LTQA 3IB6A 1RDFA 1F5SA 1Z5GA 1MH9A 2C9MA 1Y8AA 1T5SA 3QXGA 3MC1A 3QUTA 1SWWA 4EX7A 4YIHA 3FZQA 4MWOA 2Q4TA 2FPUA 1ZS9A 4BX0A 3CZ4A 2O2XA 4NABA 3EPRA 2I33A 4I9FA 5AW2A 3ZX5A 1XVIA 3OCYA 5AIBA 4OD0A 2MU1A 1RKUA 1Z88A 2YJ3A 3D6JA 4Y2UA 3QX7A 2FUCA 2OA0A 2EATA 1ZOLA 1ZJJA 4HAIA 5ALTA 3ZX4A 1N9KA 5AI8A 2CFTA 2Q4RA 1YDFA 5ALJA 3FPSA 3ZVLA 5AVYA 3UMBA 1CR6A 4J2TA 1YNSA 3RFUA 1L7NA 2OYCA 3W5CA 5AI5A 3QUCA 1L6RA 3ZW7A 3DAOA 1RC8A 1S2OA 1O08A 3R4CA 3I76A 4CE6A 1ZD4A 4UM7A
chains in the Genus database with same CATH superfamily
4FDMA 5IANA 3HRKA 2Z8YA 3EEQA 2BOVA 4Y67A 2NSHA 4MUFA 5EINA 4E1AA 4XR4A 1X7HA 4BO1A 4YT4A 1NBEA 3QOFA 2W98A 4YMVA 3NX4A 3RC2A 4DADA 1T3TA 1SN7A 5GAJA 2WJAA 1M2VB 4E3ZA 3B9RA 3WLTA 2IL1A 1QGOA 3IAS6 1CUKA 3TRHA 1WMBA 4KYVA 5LSAA 4ZT3A 1DEAA 2KJ9A 5GV8A 4Y2SA 1PJLA 5EJ8A 1OH7A 3EVZA 1T9AA 3G8BA 3JYOA 4BFWA 1JQDA 2B8WA 3NS7A 1VPLA 4ZU1X 4BV2A 4CFZA 4O08A 1JEQA 3DTVD 4HDKB 2H1LA 5B4TA 2HQSA 3BILA 5FWYB 5BVGB 5C1DA 5DQGA 3DOUA 3LUKA 4GKBA 4DF3A 4RV4A 2A88A 4TXNA 5LPNA 1NW9B 2HJ9A 4RPXA 1RG6A 1ISHA 1JG3A 2VPIA 1V26A 4D9CA 2CZGA 4MW1A 3HLTA 4NLLA 2OZLB 4MUJA 3CLSD 2Q3MA 1US8B 2WPDD 3IR7A 4PFQA 2NW6A 1L5KA 3SFVA 5KFRA 3IYLW 3TKYA 4DA0A 2TECE 3C1OA 3CRRA 3F2DA 3OO0A 1DFIA 4TLEA 4O4IA 2VI5A 1RHUA 3IV9A 3FOCA 2YDYA 3ZD6A 3VDNB 5J2UF 2H51A 4BE9A 4EY8A 1W36B 1NVXQ 2EZZA 1T2CA 1RYUA 1JMYA 3QJGA 4HH3C 1AUVA 1H6BA 3R5FA 5EMMA 1FQKA 1QWSA 3EFOA 4RFSA 3PMLA 4UEJA 4ZVLA 4UAGA 4O4JA 3TNJA 4B2IA 4Q4AB 4ETWA 1HDRA 2VT7A 4HYEA 4REQA 1TAQA 1BE0A 2IF2A 4IV0A 5F7XA 1SBNE 1PEAA 2O0MA 3LQFA 4AP6A 4B3JA 1BNCA 4C06A 1UPBA 3WYFA 3L7MA 1MORA 3GROA 3VSCA 4PNZA 3U6BA 2WD8A 3K70C 1LVGA 5AVVA 4Y6QA 3B1KA 3V1UA 5C53B 1E9EA 3KE8A 4R2XA 3BA6A 1M6HA 3R6LA 3HVIA 5P21A 3ZIAD 4C5CA 1B8UA 3NBUA 4BQRA 3UT6A 3GFPA 5DNWA 1C8VB 3BGSA 3CO0S 1XQVA 1HYBA 3QU5A 1SCUB 2B83A 1YJXA 3CZ9A 3EG9B 3L0DA 1K1QA 1RPNA 4HUQA 4Y6SA 1FC0A 3RS3A 3EE6A 4WK0B 1MQSA 4AP5A 2J0SA 4TLCA 3KPYA 2P6RA 2GD1O 5EUBA 4FN5A 2KLBA 2XDWA 3EMVA 1V48A 3A6PC 3GNLA 1CUFA 4N8EA 3Q3GE 4J9RA 4FMDF 3AVTA 4AG6A 3K6SB 4R8LA 2C2KA 3P52A 1XD2B 4TM7A 3ZVMA 3EFEA 4IX1A 1A9PA 4WI1A 2B0CA 4XTCS 4GEGA 5TJ9A 2D2IA 4EHBA 1S9DA 1TJYA 1QKJA 3IQWA 4XGQA 5CTAA 3UAGA 4QJIA 1CDZA 1OXTA 4DR5B 1ADGA 4S1OA 2GBCA 1T3QA 4RA6B 2V3WA 4A5SA 2KG5A 1Y3IA 4F5EA 2JIZD 2XUFA 1RCTE 4TV9A 1IBKB 2FW1A 1VJTA 4DNOA 1FMFA 3G0HA 3OM1A 3UXHA 4EIWA 4R64A 1JKJA 1WXGA 2DTXA 3M4XA 3BK7A 3VOTA 1MX3A 2JI6A 2PTGA 1ZMRA 5HIJA 2C8JA 1VHDA 2AK3A 5D1HA 1I30A 4ZRNA 5KTYA 1KY4A 1ZXLA 3RYTC 3K0CA 3CEPB 1SKRA 2ECKA 2W2PA 2D1QA 5FBRB 2GCPA 2OCIA 1F14A 2ZAYA 4Q8EA 2FMPA 1MP0A 3N3AC 4DWWA 2AHOA 3T06B 3VU9A 1KZ9A 2BV3A 3F7OA 2ZXHA 3K70D 3KKAA 4NJMB 1RLIA 1SB8A 4F4JA 2PD4A 3BF7A 4KLCA 3VJMA 4BEVA 3OUTA 4F7WA 2RH5A 5JI2E 4KEAA 3TQHA 4IG4A 2D7DA 1QO0D 3UUFA 5LQUA 1JVNA 3BXHA 1GUZA 4EPYA 1S1CA 3GRZA 3QG5A 4M22A 2WTBA 3U16A 2H0AA 2W4IA 3HYNA 3V1YA 4CL2A 1XUOA 1KJJA 4BVEA 2O8FA 1E1YA 2P9YA 3DP9A 2ES6A 3KJQA 1NQAO 1W87A 1ZIPA 2I66A 5FBQB 4A10A 4CNQA 1NVKA 1SXHA 2P9GA 3CW8X 3H84A 4JVNA 3EVEA 1LNQA 3GELA 3LO5A 1LBTA 4GMFA 9ICRA 2ZJ0A 3KKNA 4OHUA 2IXDA 2Y6VA 3ICPA 5EQJB 3UYLA 4ED8A 3ENWA 3Q8LA 4E4YA 1EMDA 1WB4A 3ORRA 1HF3A 2EFEB 1PYGA 2PU7A 3BPSA 3G17A 4IIEA 1N92A 1JAXA 3LHIA 4IR7A 5FPQA 2IYWA 3WLLA 5HUJA 3EUAA 1U2TA 2HW8A 3LPAA 4FCTA 1N2BA 2YIVX 3SZUA 3KXPA 1TDJA 2VQ3A 4JQSA 3TB6A 3VYVA 3ME5A 2EFJA 2PLFA 4KGZA 4NEHB 2G8LA 4QWBA 1S8NA 2AJLI 4FZLA 2FE4A 4H3VA 5HZMA 1QP4A 4GX0A 4WIAA 2RBEA 3D3EA 1J2YA 1WL8A 1ZH2A 2Q6VA 1FNMA 3IUYA 5DNVA 4FC6A 1O57A 5IHPA 3SCZA 3CZCA 4L28A 4R8KA 3HKCA 5L3VA 3RSOA 4RD4A 3HJEA 2QTNA 3F6YA 4IOLA 1HETA 4OK3A 4OHPA 4AMGA 4UQLA 2OCBA 4JA2A 2QARB 1W4AA 4LX0A 2IYZA 2QLJA 4R1SA 2WOJA 1Z3CA 2WWFA 2K7ZA 3MUNA 4GVPA 4OTZA 3VXKA 1A9SA 1A9TA 2FWRA 4Q44A 2C59A 3LYUA 3CLRD 4NLKA 3CUYA 3CNNA 4W99A 4D43A 2I4OA 3ZZ0A 2BTQB 4DT1B 2GEUA 4LSGA 3PSFA 1ISGA 3VOSA 3HKDB 4UVEA 4B6GA 1W49A 2D2FA 3O0DA 1E2UA 2HDNB 2XLBA 5TMEA 1QPGA 1RXCA 4I5EA 1FFGA 3B3JA 1O0CA 3GEHA 3OX4A 3OMWA 1QK5A 2GPYA 5MDHA 1T94A 1T0HB 1VM6A 2FSSA 1NPTO 1G7RA 3L5OA 5A04A 5C3MA 4BNMA 2VZLA 4QLBA 2D74A 1P9OA 3O74A 3OIYA 4HLNA 4NMLA 4X64B 2HRZA 2XOKD 3R0IA 1WWUA 4B5LA 1ILEA 1Q7BA 3R8FA 1YA4A 3DUFB 2DUWA 1SPXA 5BN5B 1TD1A 4DOAA 4QTZA 1MB9A 2POQX 3W5VA 3IB3A 2P4SA 3AVXA 5HSGA 4G5YA 1OCEA 4MW6A 4FUTA 1IXRC 2X4DA 1VIMA 3UICA 5AKZA 1JH8A 2P9FA 3KSMA 1C8LA 1BE8A 3LGXA 3N5CA 4YMWA 4C22A 5LFAA 4UB2A 4EQ6A 4LZGA 1KFCB 2FMIA 4TUPA 3BFPA 5JSZA 3TMKA 1M34B 3FC4A 2YY7A 4MV8A 4IVNA 5CDFA 1MABA 3DAPA 4UAUA 3OG9A 3PDCA 2HHAA 1QO0A 2RI0A 3ZKWA 2OFXA 5T8KA 2JMGA 4ISBA 5JCPA 1PR0A 3U7RA 4EEKA 4HLDA 1D7AA 3DKKA 4DCUA 4R8MA 2GLEA 4EGQA 4JB0A 1T25A 3A25A 4TXLA 5IIIA 3W8DA 3OEEA 1F60A 2ATXA 4Q9IA 5DM1A 3LCMA 3FWNA 1J0CA 4Q7MB 2PLRA 3QF4A 5KNDD 3I01A 1KORA 5LZ7A 1T1SA 4WE3A 1Z06A 1C7EA 1UANA 2Z2XA 2AZTA 4NCIA 4BX8A 3C3YA 5ESXA 2XD4A 2D59A 2ZTEA 4H2DA 4PPFA 2WC1A 3KCNA 4WBXC 2XI4A 5F4ZA 4UATA 2YJ4A 3ZHVA 4UFPA 4PS0A 1RYNA 2FPOA 2XYVA 2G1KA 3IILA 5F5LA 2QZ4A 4G0XA 4QRDA 5IDWA 1JMVA 1YXMA 3VO1A 3TH5A 1T0BA 4NBLA 1WP9A 2Z6UA 1BOOA 1PUJA 1QHSA 1MEEA 3H99A 3SXJA 3BEOA 1T2NA 2X5XA 2VDWB 4E4RA 3UPTA 4KB5A 3V9PA 3J7AC 4PQYA 2YIJA 3D4NA 4LJ9A 4EHNA 1CY1A 2PKEA 2FRXA 3HGTA 4KBYA 2QM3A 1K9SA 4EJMA 2IYVA 4PGMA 3F6BX 1B3BA 4P93A 4B8WA 2I55A 1GD1O 4IIUA 2BM1A 3FPLA 4OEHA 4OU4A 4RJLA 2Q9CA 3AV3A 4ZGBA 4EMTA 2XGPA 2Q5QA 4MV0A 4FZVA 1HUZA 1TVKA 2GBIA 2WZDA 2FLNA 3IV7A 5BN4B 1Z1BA 4BX2A 3M1LA 1NFQA 5J2IA 3AR4A 3EDOA 2DETA 2I7TA 2WZCA 1WV0A 2JRCA 4KAJA 4S0ZA 3K75D 4NDNE 1D5CA 3KVRA 3ZXUB 4Z7JA 1T6ZA 1E3TA 2AJCA 3O73A 4KX5A 2J5XA 2PX4A 3SVZA 5I7RA 1ED1A 3BQNB 5DTMA 2ZPTX 1GSIA 1Z38A 4YJFB 4ZCLA 1LBIA 3SGLA 4UB8U 2ZI6A 4BJQA 2F7SA 3P0RA 2YOGA 4RK7A 5FA5A 5HG0A 1WNFA 4QHTA 4ALKA 3PDUA 1UM8A 1WG8A 2IZ1A 5F4BA 2ZE8A 1T4GA 2NADA 3MEQA 4V0KA 5FI3A 4LZDA 3DKIA 5G4KB 3WSTA 4DLXA 1HT1E 3MCTA 1A04A 3IHLA 5KFWA 1RQ2A 4PZPA 4EELA 3JPNA 5K3AA 1PI3A 2VTKA 2X9QA 2Q46A 3ZWMA 3BZUA 1JEYA 5J2KA 1MB2A 1QF7A 1SPBS 2AJBA 2PGIA 3G7NA 4RLFA 3WAKA 4ER6A 4C03A 8ICVA 4QJ4A 5JPDA 3GRKA 4MKHA 2PZLA 1QTNA 2FEOA 4PQEA 1HE2A 2JVKA 4UC0A 1NJSA 3GIJA 2EHJA 4FOPA 2WHPA 3I5AA 4X41A 3UTDA 1BXRA 3PSIA 3ZLBA 4CLHA 1X1QA 3M4ZA 4F8JA 4FJ1A 2BKEA 1I94B 2QUHA 3HW8A 3R4VA 1GWNA 4RL4A 4CM4A 1K8ZB 1IOZA 5EFZA 2W9CA 1WMAA 2OO7A 4ZGGA 1U2RA 2IBMA 3BXGA 3OQ6A 2B1JA 5L95A 3JALA 3QPUA 2O2JA 3BB1A 1SCKA 5T3YA 4YV2A 3L1HA 4AJ2A 4HNRA 1WSBA 1ZGCA 3EJ6A 1HRKA 3VHQA 2WB1C 5KDLA 3G8CA 1PFVA 1MO6A 4JL6A 3DDNA 3SYKA 3P1JA 1ZQUA 5AM1A 2PA3A 3LECA 3PUIA 4X62B 3M9WA 3H4IA 2QY9A 4R2JA 2O8CB 1WR8A 4WJZA 3IHWA 1MHPA 3FF4A 4AJEA 3SQIA 1EB9A 1VC2A 1ZEMA 2OP1A 3EGDB 3QYJA 5EXEA 4TMWA 5LP6B 1JSRA 3H5LA 4JBGA 4LE2A 4YONB 1TMKA 3A4IA 5HWSA 1MB3A 2L5YA 3FYUA 2QXYA 1USKA 4EA8A 1H6CA 2WDZA 3PDJA 3U0VA 3UWOA 4CRWB 1WMEA 1X6JA 4G01B 5EZYA 1TFRA 4EUKA 3KJHA 1AKVA 4JL5A 4AKIA 5KOHA 1M2HA 2VDPB 4LGCA 2IA5A 1JPVA 2J7PA 3IQEA 1ZGAA 1PDVA 1QIJA 3DVSX 8ICGA 2VHEA 4LWOA 5HGXA 2JBAA 1QKIA 3ETGA 3OIFA 2FX3A 4JB2A 3SQXA 1D4OA 1RI2A 1E3WB 4ZYLA 5BSGA 1H8ED 3VR6D 2GZRA 3T5DA 5DIZA 4ALLA 5F23A 3NNSA 5JSZB 3UGJA 2WK1A 2WTAA 3CNBA 3NYRA 2Z7JA 1G21A 4IZOA 3L79A 3N8IA 1T5HX 2ATVA 2M1XA 4R31A 5CBKA 4L50A 4URXR 3VYTB 2JIQA 3HY6A 3OFND 1QYRA 4HQKA 1NASA 5AQ1A 2G40A 3UT5A 5L45A 2G76A 2QR3A 3O94A 3KQVA 1NF2A 2J59A 2I2AA 4O5AA 1T5LA 4PLCA 4EW3A 5L7TA 2V9ZA 4IEEA 3U4GA 4P1ZA 1P7DA 1NYRA 5CDUA 1K0FA 4M1ZA 2AOWA 1L5QA 4AJHA 3E0FA 4TSFD 4HKTA 4YAKA 3O8QB 2PUVA 1KI6A 1PFWA 1W5TA 2F3PA 1JWAB 2ZRGA 3LDHA 5AW9A 1SQ6A 4DQDA 1I7QB 4II7A 4TM8A 2H11A 2E8OA 1YB4A 4YGXB 2E1FA 4OJPA 1BE6A 3RG8A 1N36B 4XWYA 4S3MA 2Q50A 3UG7A 4AY4A 4DMMA 1Z2DA 1KXJA 3ER8A 3G1TA 3Q9SA 4FHDA 4XDYA 4MF8A 2R2AA 3MS4A 4ZQBA 3RI3A 1N2EA 4I29A 1DPFA 1PW7A 5IEJA 5EIXA 1AKTA 4BMCA 4D7AA 2R60A 2ZSBA 5FLEX 3U3MA 5MN4A 1C7JA 3MLBA 4YIHA 1C7IA 1R10A 2O7SA 3PGKA 1I13A 4BO7A 1AUPA 1H05A 3KNZA 5CB0A 1B76A 1Q3VA 2ZE5A 2B4AA 4MWEA 5FO1A 3W1WA 4D4IA 5A6VA 4XA8A 1ZS9A 1HNZB 1PVPA 4M4SA 1O94C 4F4WA 13PKA 2F62A 3S1SA 5TSDA 3IL2A 3NV7A 4OQLA 1HORA 3PKJA 3DKPA 1LF5A 1MJNA 4YD1A 1U7XA 2JH3A 4OD0A 3IIKA 3FNIA 4DM7A 2V4ZA 2JEOA 4UUNA 2ZAMA 4ARBA 3WDLA 1Q46A 1GSAA 2BVNA 3COWA 4GT1A 2YIMA 3B0XA 1S76D 2WJJA 4FDTA 4K6MA 5NLLA 1HNNA 1KO7A 3TX2A 4A03A 3KVYA 3W3ZB 4TSFA 1T3GA 1YVDA 4DRYA 2GAFA 1B15A 2FXVA 3CLTC 4NX2A 5DLYA 3NORA 4MB0A 5CBPA 5C0YA 2XXJA 5K8UA 4NE9A 3TYXA 5A9SB 1QG6A 2BI7A 1I33A 3ANYB 3S1LA 3M6XA 3RPEA 1DPGA 5K3FB 1TMGE 4J2TA 3RSCA 2R1UA 4Q1DA 4NAUA 3AJ8A 3EMKA 3GVHA 2V1UA 1E4YA 3SAFA 2MYUA 3U5ZB 1SVMA 4F2SA 2YXDA 3Q12A 4IILA 3ZU4A 3EBOA 1BHO1 2AZDA 2QTVB 5EOVA 1VRCA 4HEHA 4CMAA 1NUUA 4B9SA 1HEKA 2QM0A 1YIAA 1GAJA 1PQ4A 2VHYA 1ONPA 4RABA 3HO6A 3VR4H 4UM7A 5JWRA 4ZAVA 1IC6A 1J8FA 3DA8A 1XRRA 2ASEA 3D7KA 4ND5A 3GLTA 4I81A 1OFTA 4ZN6A 1L4UA 4KXVA 3IC5A 2GCOA 4ND2A 5E2AA 3ITKA 4AICA 4DLLA 2MT9A 4AMYA 4YV1A 3SQWA 3LIPA 1N3YA 1TTQB 1U8ZA 2G71A 3E7DA 1SUAA 3WQSB 2VXOA 5AW7A 4DJFC 4DG8A 1JKMA 4D4MA 1EK1A 1CERA 4CODB 3M81A 2G77B 1JSZA 2QLFA 5JV5A 4G3IA 3FH0A 4RQ7A 4RVCA 1MDBA 1GVHA 2BPGA 3NYIA 5FR1A 4ELVA 1E18A 1IEXA 4OLJA 2ECOA 4IIDA 4URWR 2Y77A 3O4RA 1RZVA 1CHNA 1GHTA 3IMFA 3NUGA 3P7MA 4Q7EA 3GIWA 5IULC 4RTNA 1CS0A 1OR8A 3O9MA 4WCFB 1IY8A 1G20E 1PWHA 2GAIA 3ODPA 3HS3A 1VG1A 2IOFK 4A0RA 1CI4A 2WPDA 1GPDG 3BWDD 3PC2A 5HF5A 2PX0A 4GLBA 1WSDA 2FW0A 1CHDA 1SIJA 1JIQA 2B1RA 2XT6A 3T7EA 4F8YA 1EWYA 2ZB3A 1BRMA 5E8JA 4M2YA 4P4MA 3LA6A 5COAA 4NR0A 1LFDB 1E1DA 3MGKA 3Q9UA 5B53A 1I5RA 2BLLA 2WIGA 3LC7O 5SYMA 4M83A 1UJNA 4PHHA 3V42A 3QWAA 2ODTX 5BNIA 1K06A 4LYHA 5DISB 3R44A 2P67A 2ACVA 3KBBA 1X3LA 2AGQA 1GUBA 4RWEA 4X00A 5L3ZA 1BVUA 5A3RA 4EK9A 4KN8A 4MQFB 2HEGA 3IEXA 2BDEA 5JANA 1J0AA 4TTRA 3ESXA 3ROZA 4BV3A 4CDNA 1DTEA 3OC0A 1Q83A 4KO1S 5KCMA 5DYWA 2FW7A 2JARA 2ZRMA 4KMMA 1ZQOA 4LFCB 1MC8A 3BORA 3BKWA 3DR5A 3GLGE 1CETA 4YXWD 3INNA 5TMBA 3AWDA 4UM9D 1P2TA 2H4JA 1YZTA 1U1DA 3JR7A 2R48A 3A58B 2IEGA 1P4RA 3KOXA 3O1JC 3WYBA 3M6ZA 2J3DA 1QCCA 2XPCA 4QZHA 3TG8A 4M38A 2J0UA 3WKDA 1XPUA 3FVWA 3SEQA 4DOCA 4C4YA 4YCNA 3ASYA 4ZU3A 2W8BA 3KKAC 1ZQRA 4CLOB 2CFRA 3SDBA 3KB2A 4HLUA 3LV8A 4R65A 3U3RA 4OHVA 2ZI4A 2G1AA 2J5QA 1VMDA 8GPBA 5IAAA 3UUGA 4HX2A 2FI1A 1N6KA 3WXMA 4C1BA 3O8OA 3DZDA 1PFQA 4E33A 3W6ZA 4K9PA 1M2NA 5A2GA 1PUXA 1Q3UA 1HEIA 1U80A 2X23A 3HNRA 3P0JA 2OCGA 1KRWA 2MA1A 2PU5A 2XBUA 4NU5A 1C7RA 1V1RA 2FPPB 3M6UA 4YJKA 5IXJA 3GNTA 4QWWA 1KVSA 1XEXB 2YZKA 2JGNA 1JDNA 1RW4A 3BDPA 2PMDA 4DQRA 2EQ5A 2P6OA 5HHTA 3DBLB 2HKIA 1J24A 1EYZA 4HJRA 4KVAA 5K3CA 3LWMA 1Z0DA 3PQDA 2E18A 4YT2A 5J2GA 3JR3A 2QDXA 3H97A 4IIJA 3LTNC 4M54A 4XWWA 3UVEA 2R8ZA 3FHJA 2GYUA 2OCXA 2PO7A 4WK2B 4GMDA 3RBZA 4YDQA 5E6SB 5BV0A 4UZFA 1CJMA 1IDN1 4ALIA 3OD5A 4H3HB 2BUAA 5GTDA 2GPJA 2IUYA 2CHUA 4EHIA 1ZITA 2D6FC 5TEWA 4S05A 1G3MA 1M72A 3FWPA 3HZHA 3N59A 4TUSA 1PL8A 4YJGB 3H5NA 4GO1A 4P32A 4EFLA 3UWMA 3RJHA 1WV1A 3W4IA 1AKQA 2O14A 3GXOA 3KLOA 1A96A 2IU4A 4A8PA 5DYGA 2CXQA 4MR9A 5A6SA 4QWEA 2IIBA 3U44B 3PTZA 2VOEA 3OZVA 2DBRA 3ZHZA 4EYOA 5IFLA 4PGXA 2J46A 1FJHA 3BMQA 2A2ZA 3C5WP 4DR3B 2K4MA 2D1YA 5FFMA 5AVZA 2BONA 3AESB 2H0QA 1R0ZA 3HVJA 2NYVA 2ZWIA 3GUUA 5J4HA 4C3OB 1ESCA 5E9JA 3N5KA 1ORIA 1V6AA 3KV1A 3WWOA 1PJCA 2ZJ3A 5IM4F 4OL0A 3IIJA 4KLEA 2OFPA 3L7YA 1WF6A 4ZHQF 2O5EA 4GECA 3LOQA 4S2UA 2O8BB 1E9VA 1ZH8A 4Z8XA 1GR0A 5HILA 4MITA 5IKMA 4YCXA 3SEIA 3RIEA 1A4IA 4YY3B 2ZM5A 4E2YA 4KQ2A 3DDWA 5BUQA 1OU0A 5BPHA 2CVQA 3PC3A 1Q7TA 3VCBA 1J5PA 1E4EA 3MG9A 1ADCA 3HVHA 2X2EA 3FX2A 5BN3B 3IAXA 2VPXA 4QZFA 2EAPA 1T29A 5GINE 2O1WA 3ZW9A 2Y1KA 2ZRJA 3DM5A 4UMFA 5PGMA 3FWYA 4YRNA 1VCNA 2P4QA 3GFRA 3NQ41 1R3DA 4G1FA 1V11B 5CA1A 3GLKA 4AQYB 2XXAB 3BRCA 4ZEXA 5J2UA 1XXLA 4QVGA 5FOSA 1EE1A 2BFPA 1DOAA 3HUTA 3JAKA 4M1SA 4CM4B 4XGRA 2DKXA 3IT3A 4US1R 1XOIA 2J08A 1JTEA 5GWXA 1MW8X 2JHFA 2QF7A 4NBWA 4JI5B 1XRJA 1JAYA 2OQRA 3OPYB 2NRXA 4DR2B 3EVAA 4Y6RA 4LYFA 2BH2A 2XMSA 3AR5A 4K6CA 1FFWA 3QM1A 4C21A 2GI4A 1QPBA 1SG6A 1MJHA 1R4MB 3DTYA 2JGMA 1TQHA 2I65A 1TI7A 4P4SB 4R1UA 3C3WA 5E4YA 5FTNA 3TPFA 3I9JA 3WV5A 5IJ0A 1YQTA 3IHTA 1GGEA 4LZZA 4Z9FA 3QVGB 1L4FA 3PNLA 3MBOA 4NICA 3Q0EA 2F1OA 1SOUA 5M29A 1E99A 1UZNA 3OOEA 5TR9A 3PY8A 1YSCA 3E9CA 3QFTA 1R0WA 5IYZA 3I28A 4ZT7A 1UC5B 5ULLA 2W55A 3ABRB 4R1QA 2ZIXB 2VNKA 4KQGA 5CDSA 2ZLBA 3QZ8A 2OCYC 4H7FA 3QE3A 5E3JA 5J2TF 1YZNA 3ND6A 2W2LD 5I7VA 2Y1WA 2OBXA 3DAFA 1W85A 4KLUA 9ICHA 3P19A 2GYVA 3E22B 4GGMX 4OUKX 2AUMA 1JFFB 2XQFA 4OH1A 1G8JA 2WWVD 2P9BA 1A5AB 2ZVJA 4XVCA 2GR9A 4C08A 3E2MA 1QSSA 2FPIA 4HAXA 4A6XA 5LDDC 2YWEA 4PRYA 1FW6A 3L6UA 4W7IA 3CG0A 1FUYB 1U2QA 2QZ9A 4D3FA 4O2BB 3M4YA 3RB3A 3K6KA 4GP6A 4DIOA 4C05A 3FYHA 5FI1B 1L1QA 2C96A 2E4XA 2Q6LA 3FLMA 3QPBA 4K26A 4NH0A 3Q3CA 3L8EA 2OE2A 2VJCA 2GRUA 2VP5A 1M1NA 4WLUA 5EHNA 3ZHQA 2BM0A 4F85A 4WL0A 5AM4A 1YJCA 1EG7A 4M87A 5C1IA 4ETMA 3JQ9C 2JR5A 2R0QC 3R6DA 1DXSA 3TQRA 1QH1B 3T34A 4UE3S 1GPBA 1TJ3A 3C6MA 5YASA 1QGUA 5FOXA 1PWYE 4LV8B 1ANKA 2E3JA 2L82A 1WCIB 2O7QA 5JALA 3OPVA 4BDPA 5AVTA 4CVNA 2IV2X 3EG9A 3RJEA 5IS2A 3ZDCA 1UFOA 1GQSA 3FPGA 3I37X 4I9GA 1V96A 2RGGA 1UF9A 1YO6A 1LB2B 2R84A 2VDNB 1JXEA 5HE8A 4JEMA 4PRZA 2V4RA 1ZOIA 3M1IA 4TMZA 5CLQA 5DPMA 4U6SA 4RIEA 3M49A 3L1JA 4BNGA 1ORTA 3ZV7A 2NXJA 3JQ8B 4RQAA 3SQOA 4QZ8A 1VPVA 4MV3A 3VI3B 2E0IA 2JIZA 5P8WA 2PSFA 1XQXA 3OA0A 4PG6A 5B64A 1VKHA 4B74A 3ZQ6A 2H4HA 1XZMA 3IT2A 4HATA 3R3JA 1L6NA 4FGLA 2BISA 2O4UX 1YRAA 3AUXA 1TKBA 3I1JA 1FFBA 2HQOA 3JTEA 3BB4A 3X2SA 1NW6A 2QVLA 3UJPA 1DO0A 1HQKA 4NJEA 3WL6A 3F46A 3NTVA 4DXAA 2HHXA 3EQZA 1E2GA 4ZOLF 2Z4SA 3OQ1A 4OLAA 4YXJA 2PANA 2OEHA 2AR0A 2XO7A 4HL6A 3ED5A 1Y7PA 4MVXA 4QICA 5KINB 3D8HA 2OQ2A 4RADA 2E8NA 4W7HA 2KS6A 2ZM6B 2QMYA 4XIIA 5FORA 4ND3A 3VPGA 1G6HA 5EKSA 1J20A 2IZ0A 1ZD5A 3BS7A 2QM7A 3QEOA 1N4DA 5EJMA 1EUQA 1DX6A 3R2JA 2QAGC 1L5FA 2FDRA 3HR7A 3OUUA 3PD1A 3VI4B 2NTYC 3EVFA 4WBNF 4IIBA 5E1MA 4FJ2A 4EECA 2F1JA 1YUMA 4FCCA 1ML4A 2IDMA 1FRFS 3HLKA 4UM5A 3ZIAA 5JRJA 1X42A 1FLAA 5DI3A 4EYIB 1PL0A 4DCOA 1BCSB 1M1ZA 1S0OA 1IBSA 2NZVG 3IDQA 4DLRA 4M9SA 1EUYA 1GN8A 2R6DA 4OQDA 2CHEA 4NLCA 2C3MA 4RQ0A 2RSLA 4IXMA 2Z04A 3BJEA 4FFVA 1QH8B 4F84A 3SM3A 3OF2A 3GBVA 4GIBA 3K0AB 1F38A 3KHSA 4QUBA 2AMYA 1KKMA 5JDCC 4ZZ1A 2CLKB 1KDTA 1I4LD 2BGUA 3DE0X 3BQ0A 9ICPA 1QLWA 3JYQA 3OJXA 3PPVA 3PYMA 4GVXA 2I4NA 4OFXA 5A03A 1LRJA 3TOZA 5I7UA 1FFXA 4LK2A 2EH9A 3RSZA 3V48A 2SBTA 4H7EA 5DLGA 4L9AA 1AZWA 3VPSA 1K9VF 2GPSA 1UODA 4RGQA 4U02A 3G0OA 1V35A 3QELA 2FA9A 1P7VA 3WWYA 5BN1A 3U19A 1P7CA 4O3NA 3G85A 5FTJA 3RS0A 4M7RA 2CL5A 1E32A 1QORA 3MIZA 3K9WA 1M0WA 3LRXA 4Y6PA 2HHQA 4LGVA 4UMEA 1AS3A 3T99A 4C0AC 1VBNA 4UAZA 1U2ZA 5IKEA 1E1NA 5JQGB 2HY7A 2AKAB 4QATA 5AW4A 5FNVF 1DO8A 1Z4KA 2CWWA 3BE4A 3PSAA 1PK1B 2IBTA 4J3NA 4A3SA 4Y2YA 2VF8A 5C35A 2BKAA 2OT3B 1D6JA 1R3UA 2Z5LA 3B5IA 1S6YA 1V7QA 4UD2A 1EJBA 2LMRA 3HKCB 3WZMA 2WVGA 4D8WA 3EXIB 3E9MA 4UB4A 2V7EA 1XDUA 3OQVA 4P35A 4UZSA 1NL3A 4L07A 2XCSB 2HFJA 5J2FA 4GC7A 1E8MA 2FMHA 2ZVQX 3B9QA 5E9AA 1IPEA 2E4YA 5H5JA 3SX0A 1KH2A 1KQOA 3ZHSA 4F8EA 4BMDA 7ICTA 1PKXA 1OTYA 3KKPA 4YN3A 3ZHTA 3WMGA 2HCTA 1J99A 3V97A 2WA1A 2VKTA 2YV1A 4W1SA 5AW0A 1UBNA 2DH6A 5DOVA 2L0XA 4EI2A 3ZNQA 4G0VA 2MMGA 2H63A 2PFSA 2PRZA 2PVPA 4E5NA 5FL7A 4YMOA 3EPKA 4LOKA 4C2AA 2X19A 4YUVA 1ZH0A 4E88A 3O0FA 3KZNA 4RDHA 1A9OA 2C22A 4EGSA 3PUWA 4RHFA 1V1JA 2Y27A 1CD5A 5JY6A 2GK3A 3DZCA 3OVMA 3GGSA 3QU9A 5KFLA 5EWFA 1W0KA 1AGRA 1B0ZA 1ISSA 1L5ZA 4IY1A 2Y1FA 4D02A 3L3BA 2FJ6A 2O2YA 4CIAA 3B12A 3L1IA 2W7TA 1JQEA 1Z47A 2X9VA 3DH0A 4KR2A 4K46A 3PX0A 3RASA 1E6KA 4C88A 3UB4A 3K2EA 3SBOA 2H29A 4DQUA 2FNAA 2IMWP 1N6OA 4J1TA 2C1EA 3TN7A 2XBLA 2HREA 2JKZA 2VANA 3FBGA 1R0SA 5E3IA 4RQ5A 3QEAZ 3WGKA 2LI6A 1ADBA 1DUVG 1EVKA 1VP3A 2H2WA 3CF2A 4MEBA 4MR8B 1EG2A 2VWHA 4RPZA 1JDZA 2PKCA 1NK5A 4QAJA 1C1XA 3U7GA 1F2UA 2EQYA 1Z2NX 2FTKE 2QSJA 3DHEA 3JPYA 3IVAA 1H66A 1X0XA 4F6RA 1PQUA 4RSRA 2Z6AA 4IXTA 2XRFA 1UQTA 3ICXA 4OGLA 3AP1A 4NOMA 1Q1ZA 3OE7D 4IJQA 4HDRB 4GYKA 1FMJA 2Q07A 3T5PA 1RI3A 2FG6C 3WYEA 2IX3A 1FP1D 4AFNA 2I4TA 1YR2A 5I7OA 1BVHA 3VH3A 2J67A 4BDSA 4C6TA 4GP9A 3UAXA 5C5IA 3CF6R 3ZWCA 3K0SA 1N33B 1Y7TA 5KNBA 2RAUA 4CXMA 2XT0A 2XZDA 1GYQA 3U62A 2V55B 5AW2A 1QJ4A 1U0JA 1M54A 2R6ZA 2OG2A 2I67A 3FUUA 3MF4A 3SSAA 5REQA 8ICRA 3TAPA 5K2MA 2EDCA 4X66B 1E2EA 2FMFA 1PEDA 1PR3A 3MYYA 4EVQA 1M66A 4KUGA 2EATA 3VH4A 5ADVA 5IJZA 4WZZA 5BSEA 3TZBA 4RT2A 1TC1A 1Y89A 3DQPA 3N86A 1TEXA 3RV3A 4NU6A 2R6R1 3T5MA 3B36A 1FRQA 1PX0A 3NHSA 2A1UA 1H5UA 3PQ6A 2ICAA 2YCLA 4AN4A 2X22A 4DLAA 5LD2B 4OUDB 4JLBA 5HM8A 1NVGA 4H18A 3EGVA 4IIYA 2RAFA 3UANA 3GEEA 3RFUA 2WM9B 1N2JA 2OYCA 3FA2A 5AI5A 4YR3A 2GYYA 1Q0ZA 1TT5A 2CKMA 2IXFA 3TCKA 4BRZA 4C4AA 4US2R 1OH6A 3OZWA 1O08A 2O6HA 4YP5A 1QX4A 3CP8A 1KQGA 1V5WA 4AZVA 4XVRA 2ZITA 2G0TA 1E6UA 2R8PA 3BUSA 4EFNA 4YXFA 4DQVA 2F8SA 1Z4PX 1D9FA 1CYDA 4DY6A 1N3BA 3AUFA 3VV2A 1P9WA 5D3MA 2XSZA 2LIVA 2NUBA 4FBTA 3FJ1A 1EXVA 1SL0A 4B9LA 1JZTA 1D8TA 1DJQA 4US0R 1QTMA 3PLRA 1FTGA 1ZMTA 2NNLD 5ESDA 3V6MA 1RQXA 4R63A 5G4KA 4TUQA 3ZZMA 2V9PA 3QITA 3QHPA 4FLMA 2RD2A 5AVJA 4CDRA 1XMOB 2AFIB 4N0EA 3IJEB 2WFAA 4HLUC 5K6AC 1W47A 1FJ2A 3FWHA 3FHCB 2UVDA 1PJ4A 3LUAA 3BSYA 4MV4A 3WIEA 3ZHRA 1CQIA 3IUPA 4NHEA 5JYDA 1LW6E 1T8YA 3WYNA 3PPYA 3DWEX 3D8TA 2P3LA 4K81B 5FB3A 3RF6A 1JHOA 2IX9A 4IFBA 5TISU 5IPFA 1Z74A 3R9XB 1NPDA 1X7YA 1DL5A 3ZHXA 4CFYA 5LWHA 4ZI2A 3S55A 1Y6FA 4I5FA 2W9CB 1SU6A 1MN8A 3UW3A 5AFSA 2IEIA 3HFSA 4IBOA 1RAEA 1TUEA 2G1UA 2IUSA 3VNSA 1S2MA 1BVRA 2JATA 3W1EA 3H1BA 4DB2A 1QP7A 1X94A 2FUEA 4WN9B 3PEFA 3RREA 5KYVA 3RT7A 2W9BB 4IQWA 1UKCA 1ULBA 3E82A 3KYCA 1IHYA 2WSYB 4MK4A 4OPMA 3A8TA 2W04A 3W5UA 2W3RA 5JH7A 4D9FA 1IH8A 2XNDA 3GJXC 4WN3A 3CPJB 4NJ8A 1QLNA 1K98A 1U2GA 2QUAA 3IAEA 4PAQA 4WY8A 2IU6A 2IXAA 3HCFA 1UZAA 4DDUA 3G2QA 2ZT7A 4C0HA 4JXJA 1P7WA 4ZGWA 1E1QA 2AMFA 2QRLA 2OZPA 5LP6A 2FMXA 1KSFX 2X0RA 1EINA 3BA1A 2NO5A 1YBVA 1X92A 1Z0AA 2B4RO 2GRJA 2HCRA 1SKQA 4UVIA 2NUAB 2QRHA 1WU7A 3K05A 1DVRA 1K3UB 1BMTA 3HJAA 4A0HA 1SKAA 1XTTA 4A5OA 3L9XA 7ICEA 4IPTA 3VR2D 4W8HA 2BHRA 1ZMXA 5FX2A 3ZTWA 3G9UA 5KVQA 1A9ZA 2BEWB 3A1CA 2OD7A 4LDZA 3P20A 5H2FU 3NBKA 5G1NA 4RVDA 3VHLB 1U6IA 2EKBA 4TWAA 4KRFA 1VI2A 2RHLA 3ENQA 4NC9A 4H08A 1P3DA 1E9FA 1QFMA 4FLEA 1L3BA 3T7AA 3G6VA 1PL7A 3KT0A 2MSEB 3TM5A 5CCXA 1DAHA 1DEKA 3I3OA 5DFAA 2RGDA 4ZYYA 3JARA 5TB5A 4JVSB 1GT6A 3G0BA 2O50A 1XRQA 3HFRA 5KYUB 5BSHA 4R9VA 2G6TA 2JD0A 3RVDA 1KZ6A 5MHTA 5FRDA 1DT3A 3NTRA 3SC4A 2JB9A 4CI9A 3PLAE 1ZYUA 3N2ZB 4DTIA 4QOIA 1ADFA 1QV9A 1YS9A 2QRVB 2FQ1A 3A6EA 4CT4B 4D99A 3DF7A 5IIKA 4EEYA 2O57A 2Y1LA 3G3EA 1MOPA 4FGKA 4P7JA 1T9KA 3HP1A 1THMA 3EQ6A 2AXQA 2HBYA 2VQ6A 3E9ZA 4FEYA 4QULA 2G9NA 1SXGA 2GKSA 3R7LA 3URKA 4LVSA 1CUWA 3IHKA 3LHFA 5CEFA 1WXWA 2BFWA 2YRWA 3CT4A 3HI6A 2ORIA 3UJHA 3CYMA 2QB0A 3I2HA 1ZIDA 2HHTA 4NEGA 3J81A 1TRKA 4UUPA 5E7MA 1KPGA 2CF5A 4FD3A 4DPKA 4YRSA 1G3QA 1D0VA 2BEJA 2OOSA 2B8NA 2B99A 4EKIA 2IYPA 1R7RA 2HBZA 2C2YA 1UBUS 2GZHA 5ES3A 5TJHA 3UK6A 1LC0A 1IN5A 4DQ0A 4E5YA 1HLPA 2RB5A 2ZS7A 4KTQA 3IKJA 1Y5IA 4LZOA 3KOOA 4QBGB 3UZUA 1JJ7A 4LPKA 3SHVA 3U3DA 4DCMA 5J0XA 4UAWA 3PI7A 5F12A 1XN1A 5A3SA 1NI3A 1XDBA 1NI4A 1WEKA 3EFHA 3CUEF 4YFVA 1ZOOA 3EHDA 5KU7A 3H2BA 4NPAA 2GFQA 1WTCA 4P5DA 1OYYA 3BCSA 3NM6B 3P0FA 5G2OA 1NBWB 4BIMA 6ADHA 2F3SA 3N2LA 3NCHA 5ERGB 4GC9A 3PW5A 1K5HA 2P91A 5DRTA 5IN5A 3UH1A 1OI4A 5BUSA 1AMUA 2BGIA 1OIWA 3GCXA 2YTUA 2PQMA 1AXGA 2NQ2C 4OQFA 5T4EA 4G41A 1NDHA 1YJAA 5KKAA 3O4JA 1UPHA 5JI3E 3RB4A 4CQMA 1I2MA 3LCRA 4MLDA 5A4JA 5EHGA 4ZYZA 3WIDA 1D4AA 2GXAA 1VL6A 2QL6A 2R87A 1TYZA 1LLUA 3ROKA 2PMKA 3Q4GA 1T43A 4JD5A 2YNMA 4C3VA 2AQHA 4C3ZA 4PLWA 4WJKB 2UVQA 4PG8A 1EXDA 5DQHA 5LZ8A 1FEZA 2VCYA 5IT9A 2WF6A 4XXHA 2F8KA 2ZDGA 2NRTA 2QORA 1YRLA 2GCOB 3LUBA 1FX1A 2JVJA 1T4DA 2L69A 1PGPA 1ISPA 1E2QA 1BPXA 1FLDA 1OBHA 2R18A 3ONDA 4I1UA 2QVCA 4JDPA 3LIIA 4KMOB 2JHCA 3DPIA 4ENWA 1EFPB 1K1SA 3QXSA 5LQNA 4BJ6A 1F7UA 3MWFA 2X9NA 5LNK1 1QK3A 2W2OA 3LTEA 1IL0A 2GPNA 4M49A 5CRIA 1YZHA 3EPLA 1RQNA 1C7FA 1JHMA 3EC7A 4RH3A 1F0PA 3ITDA 2H52A 1W8DA 4MS3B 1URJA 1A5BB 4BX9C 3CURA 5BRAA 1R18A 1QGED 3M4JA 3I23A 5C1OA 4JSYA 1GOTA 4JQCA 4HBZA 4G0UA 4YV7A 3HYRA 3CG4A 2FZ4A 2HTEA 5D01A 4B0PA 1UPCA 2ZKIA 4Z1OA 1Z2PX 3O1HB 3DULA 5JD3A 1WHSA 1EA5A 4KQHA 3WLSA 4QDUA 2XQIA 4BFLA 2YASA 1N2GA 2R8XA 3KUKA 3LD9A 1Y4UA 4N4AA 4JP8A 5HJEA 1UP6A 4X3CA 3K94A 3N7PD 5CNMA 4ZOHC 4LRUA 2G1JA 2BMJA 3C21A 4O3QA 1U1CA 2VDUE 1XTQA 3IUBA 3NOVA 5JZBA 2CC2A 3JALB 1L4EA 3ABZA 3TTUA 2I5HA 4X91A 3SNKA 1JB9A 5L3SA 2PWYA 3M70A 4ENRA 2O2EA 2GQ0A 4P22A 1Y9DA 2QN6A 3EN0A 3G8DA 3PZBA 4MYTA 4GWKA 5J1TB 1QRAA 1N5JA 4X92A 4EHFA 2XBMA 3D8BA 3HA5A 3CZAA 5KFYA 1SVIA 4UBBA 1HIWA 2RQ5A 2FMQA 1FMLA 4Y3UA 3UC9A 1EFHA 1H4VB 2BZ0A 3LUFA 1Z73A 1VSBA 4TQAA 3SKYA 2QQ0A 4HZUA 1W581 2ISQA 2K87A 3KIPA 4MDEA 3EOBI 3IQIX 5FWXA 1J2JA 3THXB 4L7QA 3DQZA 4MKRA 4W6QA 1N9ZA 3ZHYA 1ZVQA 2ECPA 1IQRA 2IYYA 2Q29A 2VXCA 3LSYA 3TK1A 3EZ5A 1Q14A 3EEOA 4OI0A 4CJXA 3B1XA 1OPXA 1PTJC 3QSGA 1VMAA 1Q74A 1WPXA 3NP7A 4NONA 5J4VA 2DLCX 2P11A 1NOMA 4K4HA 2AHOB 5HR7A 1GXSB 3CZRA 3IDFA 4YFKA 2JEYA 3MCVA 4G89A 4INOA 2O0HA 4ZCMA 2XITA 1ENZA 1PJTA 1VPDA 1X7GA 1AS2A 2ONYA 2WM3A 3LL7A 4UQOA 4OHZA 2EWMA 3KC2A 1EGHA 3KQHA 1CP3A 3H5AA 4EZ9A 2Y0CA 2B61A 8ICXA 4DQQA 4FC7A 4JA0A 1IZ7A 1RQLA 1XTZA 1B41A 5F9MA 3KSZO 3UK1A 1CJUC 1EHYA 4KK3A 5EIWA 1Y9ZA 2F1RA 2H3HA 2YHIB 4XX1A 2G82A 3NU1A 4UULA 4AVYA 2BGWA 2N3ZA 3LWZA 3AT1A 1UMDB 3WNQA 3ZE1B 1CEZA 3E70C 4ZK2A 1XHEA 3DHNA 4ZC1A 1H94A 1U5BA 1QLHA 2OEPA 3DDZX 3H2HA 3KO8A 4IM7A 4FOOA 4JENA 4I3HA 3T3FA 5K8IA 2NZWA 3IE1A 4NULA 4OO1J 4I8XA 4BJ3A 3EY4A 1N57A 3GEPA 3V46A 2HJRA 2OY0A 3SPXA 3I5YA 3E3NA 3IQFA 4BJ1A 2ZE6A 3LPMA 1YOVB 5AXAA 1SVOA 4NYJQ 1C8KA 2N1BA 1F8FA 3GLSA 4RQ6A 3LZCA 4CT0A 4QGFA 3VVLA 3K72B 3PA6A 1J1ZA 2PX6A 3HUEA 4RVSA 3KEQA 2BFEA 4JYMA 5KNBD 2Y1IA 4FINA 4F5DA 1VYUA 4JBLA 5IJXA 4U7WA 4ZCSA 3F1LA 4ZPXA 3NVYA 1MOSA 1E7MA 3VR3A 3UC5A 5HOQA 1ABBA 1K6XA 1SHZA 4K9KA 2DF4B 2Y3IA 2ESEA 2FG5A 3ID6C 3NHMA 4ZDWA 3DONA 3MW8A 3KXLA 1QC5B 4TL6A 1M2VA 5H7XA 3P9XA 3SS9X 4HN2A 3RB8A 3JQAD 2FLKA 4GRIA 4LHWA 4FFWA 3VM6A 4JI2B 1NLYA 3F8TA 5GIOE 1H6DA 1KHHA 3X1YA 1FMTA 3TAHA 1IVNA 1L3CA 3BWXA 3V4VB 3E1GA 2G72A 4XM0A 2F3NA 1MAHA 4KWHA 1BH6A 3MQFA 4L8FA 4LBWA 4WTOA 2CZQA 1R2QA 4OJYA 2Q4BA 1AJEA 2H8GA 3ZWXA 1GRRA 5A9SA 4JHLA 1PDWA 4FKZA 1RI4A 2KD1A 5DKWA 2VJKA 2Z56A 2BGRA 2ZDHA 3OHAA 3RAPR 1Z0KA 5FWNA 5CA1B 4BRUA 2RH4A 3KOZA 3NGLA 3T3HA 4MHTA 4GDFA 1DI0A 4ML3A 3IDWA 2IW1A 1JHVA 1ZNXA 3EA4A 5TS3A 4GKJB 2B1GA 4DRZA 3M6FA 1TJNA 4J1TC 2R7AA 3LMKA 5EHIA 2YN0A 3C4JA 3EIOA 4DPLA 4I2IA 3OZIA 1LW7A 3GQBB 1Q57A 3JCZA 4LTMA 4ZAZA 1AQLA 1OMOA 1UBEA 2OENG 3TQQA 2F67A 2Q9UA 1P4JA 1L3IA 2B36A 3DD1A 1CR1A 2FFHA 3PITA 5BW4A 3KZVA 1S97A 3D43A 4RTLA 2Q3CA 9ICTA 2HSZA 3EZGA 4CTOA 2HF9A 4FONA 1E3MA 1AQJA 2X41A 2SNIE 4Z0HO 4QHYA 4Q4AA 1SZPA 4UQGA 2RGNA 1ZK1A 2I4MA 1STOA 2GAOA 3CZMA 3MJFA 1VIYA 1GCOA 2W6CX 2HLNA 2ZJ7A 5H3HA 1RVDA 3IKMB 3LK7A 1H9CA 2JF0A 2NLOA 2NO1A 2NP6A 4OGWA 1Q0HA 4LJLA 4WASA 4QWDA 2WKQA 1CZLA 5DIFA 1DFGA 3I0ZA 3DZIA 2C0PA 2PQ0A 3ZUPA 4F5OA 1J6UA 3AYXB 4X8OA 1OGYA 1G42A 2WJIA 2IS6A 3AQEA 5JC1A 1UJBA 3PVSA 4UFOA 3RABA 3LWBA 3ZCXA 9LDBA 2ENUA 3NEAA 4RZ3A 1OXMA 3MJSA 2VQEB 5EJIA 4PGQA 2X2OA 5TQVA 4H4CA 1C3VA 2AU0A 4Y1EA 4NYIQ 4M2LA 4QSHA 4KMUA 3U81A 4AJLA 4EYKA 3IQXA 2C9BA 1NLZA 2JPDA 3BBPA 2K4IA 1S0UA 1LI5A 3HSYA 4LJ4A 2V7QA 3IUQA 2NZJA 1L1EA 3TCNA 1S9HA 3G0DA 4I99A 1NBMA 4L8YA 1MHTA 3K0FA 5BXQC 3B9JA 1NP7A 3K7EA 3ADKA 1MA3A 1WOYA 2JLBA 3KZ1E 3DLAA 4KQWA 4RL6A 4RPCA 3PRJA 3RFTA 3RHFA 3VUEA 4OXYA 3NWOA 1YE8A 1YZ6A 1C3LA 1E63A 4CV3A 3JD2A 1KMCA 3O84A 8ICLA 3L0IB 1EWQA 3F4BA 3GDHA 1JQ3A 4M9HA 1LF0A 5TE9A 2D00A 3JYPA 5E2IA 1MT0A 2PN1A 4WUTA 4KOEC 3WMRA 4D9BA 3GT4A 4ZVOA 3OTOB 1T5OA 4C14A 1ZCFA 5L3QB 1X9GA 3ZI7A 1SXEA 3LYHA 4GOKA 5HFAA 3EY9A 4EW1A 1SOAA 1AGYA 2NOAA 4R05A 4YUZA 2ZIAA 2EP7A 4MWOA 2RGCA 2REQB 2A3VA 3GLIB 4UEKA 3OF3A 4RX1A 1XMQB 2PBLA 2FPUA 4N7JA 1UXOA 2VRBA 4O5KA 1ZY2A 4L0DA 5CDYA 4NIMA 4UZEA 4N54A 3A6ZA 2WT8A 5EJAA 2BMWA 1JA0A 3R3ZA 4E12A 3ZQ4A 4WKPA 2XE4A 5AIBA 1RKUA 3II6X 3DYBA 2YJ3A 3O95A 4KDCA 1V9LA 1ODSA 2DKZA 2CWDA 4JWKA 3QBJA 4RHXA 4PBTA 3G8AA 3O2SB 4PIPA 1SUIA 1NMYA 1SBHA 3UXNA 5L9AA 2O8FB 4EF6A 3C2LA 1EFDN 2DECA 4DREA 2HU7A 3SE7A 4TLBA 2VDQB 3ZY6A 1PAUA 2ZKLA 1FP4B 1GPWB 3M2TA 3W7VA 1VDZA 1SBCA 5KYGA 3OQIB 4G0YA 4XCVA 2WG0A 3NIGB 1NVFA 2JFYA 3UMBA 2RHMA 3KOUA 1FO4A 3V2GA 1THZA 1DEHA 3CX3A 2N75A 4RVOA 3VYWA 4AECA 2XCIA 5FUQA 4MW2A 5CH3A 3RS5A 4RU9A 2Q1SA 1CF2O 4LDJA 1E7YA 2FX5A 3F5SA 3Q3JB 4DXDA 1G64A 4Q12A 1W73A 1WX1A 2YWHA 4ZODA 1K7EB 1XSEA 2DJIA 3I76A 3HDGA 4NOJA 4NF2A 2ILVA 3ZR4B 4EY3A 1G21E 3BH7A 1FY2A 1H1TA 4QUHA 2ZPUA 2Z2KA 2VBGA 3HKBB 2I76A 2Q4EA 5DO9A 4N8DA 5B6JA 3IXLA 4FR5A 5HKKD 3K0CC 3MSXA 1MIOA 3T52A 1SWVA 5CM9C 5LP6C 5IN4A 2QAGB 3BMQB 1DK2A 2IODA 3LP6A 1PJQA 5EWEA 1NNSA 3LF1A 2AB0A 3FHLA 4Q01A 1ECBA 1JG1A 1ETUA 5FUYA 4D8VA 2AF4C 2JHGA 4RYLA 3SZ2A 4HDOB 1WVMA 2HRDA 3H9BA 4II3A 4B84A 1C4WA 1RWKA 4DM4A 1XQWA 2ON6A 1GTSA 1JIJA 4TMVA 1ZIXA 3L7CA 3TLJA 3LXRA 2B3TA 4IH4A 4LYJA 4F56A 1HY3A 4MKIA 4QA9A 5EJFA 3QOYA 4RAQA 2I4LA 3QG1A 5T57A 2JJ1D 3SYZA 1VSUA 4D4KA 4GW3A 5HKAA 1VGVA 4I5DA 2D1FA 5I7FA 5C4MA 3MQ2A 1A98A 2HC9A 3QEBZ 5ILOA 5DCLA 1WUJS 4TLDA 2BFBA 3Q3EA 2D06A 2G0NA 4PLHA 5ECWA 1S2DA 3EAGA 5FTWA 1ZQTA 4MFCA 4US9A 2ERCA 2F59A 4HQ0A 2LCQA 4A92A 3LQYA 1J25A 2JD1A 3O75A 4P7KA 4KIFA 2DKFA 4N48A 1U63A 5I45A 1TF7A 1DRJA 1KFKB 3JYLA 4RGYA 4BV9A 1KAEA 4YPOA 3RVBA 2PUCA 1GPAA 3PV0A 3C3MA 4MKGA 1W7AA 4RQ4A 1QDEA 2JIMA 2FP4A 1KAQA 4YMSA 4TTSA 2GJKA 1DQSA 3ROQA 3ESBA 3R3WA 5ALKA 1NAIA 1NQOA 3EXEA 3WK7A 4BNDA 5GONF 4KDRA 4NI5A 4FI3C 1IXKA 1ODKA 4R7GA 2HMWA 3D5EA 3MJTA 4XM2A 4JYPA 1H2HA 1G8KA 3GCGA 5JVDB 3TIIA 4Q15A 1PYDA 3V6KA 2MR6A 1ZM4A 3GAZA 4FSXA 1GPKA 1J06A 4IDQA 2JIOA 2GASA 3K96A 4UCQA 4BNXA 4OJTA 3QKWA 3AJAA 2WHRA 4HN9A 3R0QA 4IEFB 1WBJB 5DT9A 4KLHA 1YRWA 3TI7A 4BLTA 1SIBE 1V97A 2FMSA 1ND5A 1XHFA 4GU5A 4JBWA 4MVJP 5G3ZA 3PHGA 3B6JA 4U0JA 4B71A 4CYMA 4O1IA 5IT0A 3KZKA 4BGEA 4RJTA 2ZJ5A 3PVCA 2MWMA 2WYWA 4WA7A 4CRXA 1B14A 3H6GA 4G9EA 3CRVA 4J9SA 2GOLA 2IYRA 3LP8A 2XGSA 3NTOA 4KIWA 5C9ZA 4W1QA 1KYTA 2P5SA 1A1VA 1RABA 2AYYA 2BPCA 1AU9A 1XVAA 1X1RA 2VHJA 2Z8ZA 1EBBA 2DYKA 1F44A 5A9TA 4N9QA 1T5BA 1XTSA 3IUEA 4JLNA 5HA5A 3SQNA 1Q1EA 5CFOA 1WCV1 2H3EA 4LTDA 4DC0A 5LOVA 2K4HA 2FUKA 7ADHA 1E5TA 3ECSA 3JQFA 4V0NA 3D7MA 2LP4Y 1U8EA 5JT1A 3KWFA 4J3JA 4N1AA 2XRZA 1GNVA 1Y4DE 1ONNA 2XCUA 4F9TA 3C98A 4HAZA 1TPZA 5KHAA 5U4QA 1L9XA 1WW8A 2JL1A 4Z3KA 3G0CA 2X4LA 1FU4A 1XDSA 3EB9A 1MAWA 2Y9MB 3KHTA 4OLHA 8ICYA 4N3CA 1QONA 2WB4A 4EVRA 4PYLA 4UHDA 3KHRA 2GFHA 1KR2A 1QF6A 2X4GA 2IS4A 1BYIA 3OZDA 3RRYA 3BTSA 1JLSA 4NE2A 1GEEA 5ARBA 3CVYA 1NZDA 1IG0A 1QRTA 1SIOA 1OBCA 1JIIA 5SY6A 3O3NB 4X54A 3FJOA 2AXNA 4JN6B 1PSWA 2JDIA 4H4DA 2QKQA 2AGVA 4N82A 4HTFA 2OLEA 4PAMA 4PGHA 5A7GA 1DADA 3IBSA 3IIMA 1KVQA 2WSIA 3LX8A 4UUBA 3TSAA 1RM6C 1O7JA 1BFUA 3LDFA 4TYMA 2A6PA 1JW9B 3ZS9A 5EE1A 1G1MA 1XK7A 1D2AA 2PL5A 3C6ZA 3DV2A 2P2GA 4AMVA 4DLPA 2UYCA 2P0YA 2VZEA 1M10A 1DBIA 1TTHA 2X4IA 3EW7A 1D6SA 2I87A 5EXDA 4E51A 2Z2IA 4P2HA 2O05A 1E20A 1M8GA 4F4FA 3CH6A 4JDUA 3AP2A 3T1NA 3PYLA 2WJPA 3GXBA 4BNFA 1JEYB 2C5AA 1IMJA 2W8ZA 4A8JC 2P4HX 2A94A 2HIGA 4RHCA 5LXTA 2PJRA 4NJEB 3GH3A 1X1DA 4DV5B 4DYHA 3LNTA 4OG2A 3AY6A 4F5QA 2FSFA 4AXXA 2EIHA 4U0KA 3MJDA 2FSHA 3NATA 1TT5B 1OASA 4Q3BA 3LGSA 2TSYB 1AA6A 4KV7A 1WXIA 1KL7A 1XNQB 3SMQA 2HMAA 4G8CA 9ICBA 4Z4FA 3OZAA 2WF9A 1OFVA 4BNJA 1U0FA 3KJGA 3RTBA 1X13A 2FK7A 1VLJA 4PYMA 2XQGA 4ZOBA 1QHYA 4CTMA 2RGBA 1FDSA 3KUDA 4BCCA 5FNVA 4IRDA 3TZLA 4BECA 4GWGA 4PGYA 1R4AA 2X5NA 2VTVA 1TX4B 3K6JA 3Q3IA 4JB3A 2H2FA 3JQAA 3L7LA 4G5FA 4I4LA 4LBYA 1D2GA 4X61A 5DHAA 3FPHA 3F78A 5JNWA 4KWTA 5LOVF 3UXPA 5JCZA 3QKSB 4ZVNA 2PPLA 4UB5A 1LBEA 4NPHA 5K8CA 3TMAA 3F98A 4YACA 2QD1A 4TROA 1I3KA 2X8JA 4LCJA 1AGNA 1P4GA 1N1MA 2G6BA 1JZSA 1N5IA 3PFHA 3VNBA 1X7ZB 5JSUA 1S8OA 4ARZA 2VJMA 1HYGA 2J0UB 3DKRA 1MJFA 1ZMBA 4MP8A 4Y2GA 5EZYB 1ZR4A 1M2FA 4ECZA 2PA0A 2PSHA 3JAWA 2JZCA 1UOEA 4EATA 1X8XA 2QTFA 1AE1A 8LDHA 3MGGA 3T61A 3VC3A 4ZI5A 3LY9A 4TZ0A 2M32A 4QIWF 5J2CA 1AQYA 1GEGA 1LNZA 2IQIA 2WSBA 3PF8A 5F3RA 5TNXA 3UO8B 1P8JA 3ETEA 1FTQA 1I14A 1HE8B 1D0SA 5KWVA 3CLTD 4TYPA 4LXQA 4DRXA 4C8KA 4YK7A 4D0LB 4BGUA 4Z3OA 2IPLA 4NK5A 3RAQA 2BBTA 2M1ZA 3N4MB 3MRTA 1PR2A 2JCSA 4E5UA 1E4OA 1YR6A 2DUYA 3RF7A 3TSCA 4X6LA 1LC3A 1IN6A 3WZLA 4DIBA 4PE5B 2E4ZA 4HNVA 4L6IA 4DMRA 4XQ9A 1CY8A 3WICA 1HFKA 3G2HA 3GEIA 5EJEA 3NP9A 5K8TA 5J0RA 3GN2A 1KOFA 4BNUA 2PT5A 1JP7A 3GGGA 4NV1A 1G2QA 1FNDA 3ZE2B 4BO3A 2WJHA 1WDTA 2DBVO 2B0JA 3NFYA 1HUQA 3RUAA 5DW3A 2W3SA 1CZRA 1JXQA 1XYVA 1QG0A 2VK1A 2PCJA 2YQZA 3GRFA 4CMGA 1ZAYA 4R6WA 4GBMA 2HWWA 2R8YA 3LUPA 1EHCA 2AVNA 4HXEB 2VRCD 1VECA 4R1TA 4DCJA 3IG8A 1LPOA 2WEKA 3QGMA 3QMWA 1QYDA 1LZLA 3SSNA 2JFPA 4DLTA 2PWPA 3E2PA 5DNCA 3FTQA 1YH3A 3TOCA 2PQ6A 1LKZA 3AQ4A 1TKAA 3EZXA 4LCBA 4V38A 2Y0PA 5IWCA 2BP7A 5A3QA 1JFTA 2B82A 4JBXA 1HTWA 2R1ZA 1Y5MA 3NBMA 5JG7A 2UVPB 4MI6A 2JEIA 1DRKA 3BMOA 1PHPA 3C5VA 2P9EA 2MCFA 3REQB 4BIIA 1ZL2A 3U4QA 3ANNA 2F76X 3HCWA 4V3CA 3OPNA 4TSKA 5JSKA 4QWMA 3X0DA 4CQLA 1QTRA 5KWEA 2VHTA 5THXA 2ZZNA 2OWEA 3HHPA 2KZMA 3RTAA 1LSUA 1P39A 1EFCA 1R4NB 2H2DA 4YCAA 3BD6A 3TI0A 1PN3A 4L0MA 3KM0A 3KQMA 3UFXB 4TL9A 3UUEA 2A7QA 5F51A 3SBXA 3P96A 4FM9A 4AJ9A 1HSOA 4G0WA 4Q37A 3HEAA 5EXSA 5B58T 3RV4A 4DILA 1N2ZA 3MJ4A 1CRQA 3I5XA 3FKSA 1HTBA 1NK4A 4V2IA 5BY2A 1AO0A 1KTVA 3VNUA 4NY8A 1UBSB 2X8WA 1IB6A 3A6HA 4UHEA 3R7SA 4FDUA 2KEYA 3UATA 4QZGA 1FTNA 2HBKA 1I9GA 2HAEA 3D6VA 3RKUA 3ZNPA 1QTIA 2ZK7A 2C99A 1PV2A 5BV7A 1DWPA 3QRWA 3MGAA 1SHLA 2ZPAA 3KOWA 2A5FA 1CPYA 3FUVA 2I78A 1YS7A 5BURA 4LRYA 1KK3A 1OX5A 1DAPA 1SKUA 2RGYA 2W93A 3DXFA 3QLUC 4OHBA 2M6LA 3RE1A 3SQLA 3FROA 4KTTE 1VMEA 5U9CA 3HKEB 4C7KA 4PM4A 5G1PA 4HT3B 2KNJA 2AH5A 1IXSB 1XZQA 2B2CA 2KJ5A 1QZUA 2LKDA 5DGXA 4F3NA 2HRQA 2M9MA 1GL7A 2I99A 3OTIA 1UXKA 4UOEA 4ZTUB 3T3PB 1P9RA 1ZVVA 5KDOA 3OLZA 1J42A 3FDXA 1EK0A 1YGPA 2CMKA 5KSYA 4W9MC 5CX1B 2REXB 2HTFA 5REQB 3WNBA 1T2AA 4YCJA 5J2HA 3AI3A 2QDKA 4L0CA 5M3BA 4ATNA 3HXTA 4AO8A 1QAMA 1QVAA 4WKGA 2I2FA 5EWMA 4GOND 1ZJMA 1P1HA 3UWPA 4LJ5A 5HR6A 2CK3A 1K7CA 2VSXA 2XGMA 3A4MA 3GLUA 1BD3A 3Q41A 4MYHA 4UFNA 3RUDA 4JLDA 4ED9A 4GXTA 4J0EA 3S2UA 6CHYA 2AMJA 2IKSA 2ZBRA 1JVSA 1UEIA 3PUYA 1ZI8A 1V16B 2UUCB 3PCXA 5AKEA 1X87A 2IYUA 5EPOA 1KO8A 2ATLA 2P65A 3BHIA 3VU3A 2VNIA 2QNBA 1X86B 3RW9A 1S2NA 4E2ZA 1CU1A 5F1YA 4X0EA 5B30A 4CKZA 4C3UA 3PE6A 4M21A 1FP2A 4G36A 4YMGA 4ELTA 2AKYA 4FFBB 3DZHA 4LKOA 3ONFA 4WERA 4LSWA 2OCLA 3AETB 4MTCA 4MICA 4E5KA 4QRIA 1J8QA 2OBNA 4KSBA 8AT1A 5JAIA 3FDZA 1S4MA 3PL1A 4CEIB 3MPOA 2PXXA 3T6KA 1DIOB 3QU7A 2FEXA 1T0PA 1ZQSA 2XIDA 2FN9A 4C07A 1QO9A 3CVWA 6GPBA 5AM5A 2KBEA 4J1NA 4E6EA 1NYTA 1OXBB 4DTCA 4FYPA 4J75A 3N75A 4RGVA 4C87A 3WMEA 4MW0A 1YZFA 1VCMA 4JEHA 1D04A 1C30B 1EX9A 3R9KA 4JLVA 1T34A 2Q8QA 3A6JA 3EGOA 2O19A 3FBWA 3V4ZA 4B4WA 4DKJA 1B2RA 2ZAGA 2AFIA 2ODEA 3DL4A 3H3XA 1IN8A 1HYEA 3I6YA 3PE4A 4H1TA 4HGNA 4NYMR 4J7CA 4PBSA 5FBVB 1NRWA 4G56A 3T9CA 2V7WA 2KJQA 2O0JA 1Z2OX 3I6ZA 3LH5A 3RK0A 4RMHA 1KK2A 2BRUC 3U40A 5EL0A 4AJJA 1DG3A 4LN1A 4XOUA 1QGUB 3U4IA 3MFIA 1T2DA 1X7WB 2QB1A 2A9OA 5KFJA 2H1WA 2QVGA 2ZATA 3IMEA 4IOJA 3SYTA 4UOZA 4J7UA 1I8TA 2Y4NA 3L6RA 1J9ZA 3MQ4A 1ATZA 3KKZA 1IUOA 1ZQKA 9ICVA 5SYAA 4JV0A 3EWIA 3PRHA 3UQYS 2OV6A 3H6HA 3N07A 4LVUA 4ZTBA 2OV3A 4RS3A 4BEJA 4E5MA 1OUQA 3C1UA 4IXNA 3UWKA 3RB0A 2QD3A 3HBMA 4QJ3A 2Y67A 2G9RA 3N2KA 3MFQA 5A71A 5A02A 1TM7E 1Q15A 2X13A 5AK4A 2WU4A 1VSTA 3QUAA 1Q3KA 3T9AA 4BKOA 5KUTA 2O8EB 3H4BA 3RH5A 5J2DA 5LQKA 4LWPA 3VU0A 2NMVA 4DKXA 1ULSA 2I6SA 1EUDB 1GKYA 5FFFA 1HKHA 1YI8A 4EUHA 1IWOA 3MR2A 1DIRA 2VJNA 3CLHA 4RVNA 3WWZA 4QPPA 1MCZA 1X2IA 2JFWA 4A8HA 1O95C 4C5BA 1SULA 3NKVA 4HOYA 221PA 2V0CA 4RK4A 2LNDA 3H5VA 1CIVA 4R1OA 4Y8VA 2QYSA 1BRTA 5I7AA 3U37A 1EX1A 1VBMA 1VGQA 5B37A 4MMZB 4UHCA 5DSTA 2C9MA 2CZCA 1ZNZA 4Q3OA 4F3CA 1KK0A 3QVJA 2R1TB 2X7HA 2K8CB 1GCGA 4I4IA 1TKRA 5EIEA 1LBHA 1ACLA 4MI3A 2OXFA 4GI5A 3SX2A 2Z9BA 2BBWA 5MN6A 3JQRA 3KPWA 3WYGA 3A10A 3OZRA 5J2TB 5IDVA 5CJJA 2PX2A 1I7DA 4CIXA 4BXOB 2ONKA 4WACA 3ZX5A 3FHTA 3T9BA 4FUQA 4F50A 1KI9A 1NKSA 2YJZA 1YZGA 3HEMA 4HR7A 5KYUA 5JYCA 1GTZA 1CUJA 3ESYA 2BFAA 4B9UA 4AI6A 1EE2A 1Z2AA 3FTDA 3L4SO 4QXAA 3ER6A 3GLVA 1C41A 2ZJ6A 4JX9A 5DK6A 4ZYTA 3B2QA 2R8OA 3JATB 5DTRA 2CDNA 1YHNA 4BLVA 3RHTA 1JKIA 2PEYA 3AOGA 3OP1A 5ILQA 5L3RA 1WY7A 1TUIA 1EVLA 1YDFA 2O06A 3DT8A 3MYRA 3ZXYA 5CVTA 2RHWA 3C3CA 2I3AA 3ZD7A 4DJTA 1P5HA 1V45E 1VI6A 4KN9S 2QJOA 3SJ7A 1KDZA 4UTXA 2VQSA 4UUOA 5D7NA 4JQOA 4RZQA 2ASJA 1L5HA 3C97A 5EJ2A 1N5MA 4OQXA 3M9NB 1AV7A 3GDFA 5CFNA 3KQKA 2ZUVA 7MHTA 3D0KA 3L2OB 4I08A 4ZFNA 1JA1A 4AMZA 3R6WA 1YL6A 3N39C 2H4YA 1V11A 4WECA 2D6FA 2XXAA 1L7BA 4BC1A 2P8JA 1AH2A 8ICIA 4EHJA 2A58A 2YTZA 4NXZA 5B2ZA 3GWGA 2RKWA 5K0BA 3MLEA 3MWKA 5EZ6B 4BB6A 2JLRA 5I4CA 2VZ8A 2XY7A 5DN6A 3AU2A 3K1ZA 4A4DA 4NZNA 1XSLA 4XWKA 3ZBUA 1GQFA 1A71A 1XCGB 3FSGD 4KCGA 3GIMA 5JJLA 7ICSA 5KFIA 4GZ3A 4HFJA 4DUZB 1Y37A 1NI4B 4PSDA 1R6TA 3ZWBA 1GFZA 1N8KA 2QQ5A 1T36A 3E3LA 5EOZA 2HPAA 5A0TA 5AXBA 2BGLA 3SC3A 3BJIC 4TS1A 2BHNA 1GPH1 4EL5A 5C8ZA 2H1VA 4NU0A 2ZJ1A 1R4MA 4CKYA 2E21A 3G2KA 4J9NA 1FFEA 1ARZA 4P4SA 2DBZA 3DTTA 2P9ZA 2QVBA 2CMHA 3H8WA 3V7NA 3KT6A 2HBRA 2V7QD 1DIAA 2SCUB 4IV8A 4MW7A 1UM9A 1ZK4A 3RSHA 3D3QA 3RKSA 2XMCA 2HQ1A 4EUEA 4OCZA 2IHKA 2VNSA 4KXQA 2VPZA 2R68A 4KPUA 3UGTA 5AVQA 3RYCA 2XD9A 3QFCA 4O2AA 3DB2A 5CNJA 2C8LA 3GRYA 5L7WA 1O97D 4P4TA 1VJ5A 2QE6A 3QMMA 4AAYA 4CKEB 2R9VA 1FLVA 2GETA 3LVBA 4KQ6A 1G9TA 2ISPA 5DNUA 1K7XB 3I2GA 4DSIA 5I01A 3NALA 1ESEA 3EIQA 4IS2A 2IEYA 3EZ6A 3ZJ4A 1JN0A 2HFKA 3QMPA 3AYZB 1Q11A 2HA4A 4KRYA 4MA4A 5J40A 1GG8A 4L2IB 4LY9A 2FPIB 4A15A 1OROA 2WIFA 5I5GA 2JNWA 1EFPA 1L4HA 3ADPA 3HGMA 3N0XA 5CLHA 4E30A 1KLNA 2Q2QA 3PEEA 1DXHA 1E98A 4Q43A 2OO5C 2C9DA 3CF4A 4GBED 4J29A 3BSSA 4NU8X 3PD0A 5FPPA 1XEFA 2GD6A 4RY8A 4UPDA 4OJ5A 1WY5A 4RJKA 4BJ5A 4E2FA 5HX7A 1DC7A 3LE8A 3ZVNA 4JVLA 4AU1A 2ASVA 3E5MA 2X86A 3H42B 1QSLA 4MQ4A 4B82A 4BGIA 3KD2A 3IX7A 4AS2A 4CL3A 4X97A 4D46A 1ECWA 3B1WA 1Q50A 4CZ2A 1C4OA 3TDKA 2CDBA 1IJBA 3UUWA 5EP1A 4NFLA 3BAZA 4RQ8A 3RAJA 4DR4B 2VA2A 4AN1A 1ZQZA 1J23A 1HE3A 1JHZA 1T5DX 3LO8A 2ZG6A 4DA7A 5BQFA 5BR4A 3SVLA 1KIMA 3NEYA 3AY3A 3FYTA 5TARA 3BMXA 3U7IA 3UTCA 1AO3A 2JIPA 5IKXA 1SXPA 2ODQA 4ZA2A 4QWCA 3P2MA 1X3SA 4J94A 4C8MA 3HRIA 4PVDA 3V4FA 5IDQA 1FSPA 1NM5A 2AWOA 4IWNA 3FJYA 2BGNA 2BWJA 3MOIA 1JLKA 1UC9A 2CNDA 4QOJA 4B9TA 2JAXA 2D5IA 2HK7A 3DWGA 4IHAA 4A8JA 4E5VA 3C7TA 1OILA 5KVVA 4BO4A 5JS1A 1V5FA 2DHEA 4G85A 2P2SA 1FX0B 3Q40A 3V8VA 1SR8A 1KZ4A 3MUEA 3AFGA 4V02A 1ECJA 1DINA 2HNBA 1OZAA 5SZKB 2G7ZA 2UUPA 2FR8A 1L7XA 1N7HA 1ZH4A 4OBEA 5TQ2A 3VPAA 2C4TA 4XCXA 4Y9SA 3RUFA 2RAVA 4JJ8A 1L2TA 5E4FA 3ZXXA 4Y1RA 5FWXB 2X2PA 3JVDA 1SVUA 1FNBA 4HHEA 3TZEA 3ZKAA 4EMBA 1WDWB 4F3OA 4GPIB 2PI4A 4JYBA 1Z0JA 2ZUUA 2BQ3A 1DNPA 3C16C 5EXXA 4F5RA 1C9KA 4PWYA 3OT4A 4COKA 5KIAA 4R9NA 1ST3A 1IOLA 5J0WA 2XTAA 3OD1A 3INTA 5AI9A 3JQ9A 3ABOB 3PPWA 3L4PA 4IHJA 2Z1NA 4P83A 4REOA 4B8ZA 2ZUEA 1V71A 4S1NA 4BNVA 4KR7A 1PS0A 1PT6A 2XHZA 4X90A 1ZQNA 1D8BA 2DUJA 4LTNA 1SGWA 2A35A 3SJAA 5E7IA 1GA1A 4D8XA 3KTDA 3D3WA 3ZH2A 5C5JA 1QZXA 4TKZA 2Y68A 2H4XA 2ZRCA 3E35A 1VE1A 4HJXA 3GUZA 1MXHA 1LPSA 5IM5A 6NULA 3CU5A 3WISA 1BWRA 1U94A 1XPJA 2F4NA 3DMRA 3PUVA 1U7HA 4J9PA 2VYND 3CKLA 3UKOA 4B1FA 1JFVA 3TRDA 1SNYA 2UYHA 4Z9YA 4Q3NA 1R9GA 1C1HA 2IVFA 4QUEA 2YZ2A 1Z83A 3W8FA 3UPUA 1JR3E 4BWMA 3OTWA 2Q3EA 4QNRA 1B4DA 1T8PA 2J3KA 1H38A 2PD3A 2AC2A 4KXUA 3OU7A 3R3HA 2VNAA 2WPNA 1S5PA 4FS1A 2C5HA 4UVDA 1UA1A 4RNDB 4DL7A 4RUAA 2GZ2A 4HMPA 3PK0A 5DHRA 4I2AA 5LMZA 1VG0B 2E1RA 5I9BA 1M1YA 1LNSA 1FVXA 2WKRA 3BL8A 1UAYA 2OFFA 3OQNA 3ZZNA 4HB0A 4UUMA 3S44A 1P9NA 1XSPA 1Q2UA 1FU7A 2JFZA 5AKLA 1UIRA 2ZAIA 1QBGA 3AEZA 2W9BA 1EGQA 4MDYA 1KMHA 1HEYA 5EJ6A 1D9XA 1LV5A 4HDMA 2B35A 1NJZA 2A5LA 5AK3A 1N2IA 2XUZA 4D5EA 2GTIA 1PFKA 1NJYA 1H2WA 1P5JA 3ETDA 3P2EA 4ZREA 3TJRA 4ZJZA 3IO3A 1HZZA 1PQPA 4B76A 2ZCJA 3K5HA 2JAWA 4WT7A 1NLFA 1HTTA 2YMPA 1I1QB 1KH1A 2Q1TA 3A4LA 4G3XA 3RBDA 4BQIA 5F7ZA 1NJFA 2G04A 3FNGA 3RK4A 1R0BA 4KREA 3ZI0A 1X80B 2J6BA 2QZJA 2C00A 2V4MA 4W5JA 2JFHA 1B16A 2VJLA 1LH0A 3PXGA 3BOSA 2BYTA 1LQ2A 2E8MA 3AR8A 3LCVB 3OIWA 3EXFB 4TYQA 4KI7A 4ZZ3A 2DKNA 4IV5A 3LT1A 3V55A 4ZI7F 4JZYA 4DY4A 4EJSB 1NVVR 1X7XB 2R1VB 2R00C 3MBYA 3MILA 1V4NA 1SQFA 3GZTB 4LYGA 3WLPA 3KHHA 4JUAA 4AN0A 2F3UA 1Q7RA 2YVQA 5KVCA 4Z3DA 3THWB 1PR5A 1W4BA 4O5CA 2RAPA 1NK9A 3G02A 3KR0A 5IASA 4RK0A 4UREA 5CVDA 3JPSA 1ULHA 2RBGA 4NLNA 2X1LA 4WPGA 5COQA 3RQSA 5KTRA 2JGDB 4EKGA 5KFVA 3BAFA 1PS8A 3MGH<