4CF3A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACAIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 85
structure length 224
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf3A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf3A01
2O2XA 1RKVA 3QU9A 1QQ5A 3FVVA 3MC1A 3OCUA 3QGMA 4BX2A 5AI8A 5AESA 4J03A 3QX7A 3U7GA 2FEAA 5ALQA 3S6JA 1ZD5A 4I9FA 1YV9A 2B30A 3WK9A 3R4CA 2I7DA 2OBBA 2WHEA 4UMFA 2FUEA 4EZEA 3ZVMA 1U02A 5AKZA 3NUQA 3ZX5A 1Q91A 5AW9A 5AVXA 5A3RA 2YMMA 3KOOA 2W4MA 1S8OA 3R9KA 4NABA 3HYCA 4Y2QA 5AM2A 4CF3A 1T9ZA 1ZS9A 3WGVA 2IOFA 4KX5A 4YCMA 3ONNA 5AI5A 2WF8A 5ALHA 4L6CA 4NAVA 2FPXA 4DW8A 5AVRA 4UU1A 3MPOA 5AKGA 5AM0A 5AK4A 5ALFA 1Z4IA 1SWWA 2WF6A 3DDHA 4IFTA 2PR7A 3OTQA 2AMYA 2ZOSA 2G06A 2X4DA 3N1UA 4HYTA 2BY4A 4ZEXA 2Q5EA 4MUMA 1Z4MA 4YIKA 3ET5A 4BEVA 4CF4A 2MU1A 1NF2A 5ALVA 2CN1A 3U26A 4BKMA 5AW4A 5AKXA 1Z4QA 2RBKA 3WK6A 4HGNA 3UMCA 1U7PA 3A1DA 2I34A 2R8YA 3FPBA 1YMQA 3DNPA 3FZQA 4YIHA 3EF1A 4C4TA 4IG4A 3L1UA 3U19A 3U13A 2D2VA 1PW5A 2NO4A 2FDRA 3D6JA 2P9JA 2C8KA 2EATA 3NALA 4I9GA 3SLRA 3B8EA 2B1QA 3L8HA 2G0AA 3L8EA 3NANA 3A1EA 2ODAA 1WZCA 5AW1A 3E84A 2MU2A 5AM4A 3QU5A 2YFYA 4H1WA 2GFHA 4KNVA 1S2OA 2HF2A 1Z88A 2I33A 4BYGA 1T5TA 4YCNA 5ALLA 3L0CA 3WKCA 3ESQA 2YJ6A 1K1EA 2FPRA 1XVIA 3QLEA 3L1VA 2JARA 4EEKA 3CNHA 1L6RA 5AK3A 2ZXEA 1ZRNA 4CF5A 5ALJA 3IB6A 1AQ6A 4MWOA 3E8MA 2YJ4A 4AP9A 2I6XA 3W5BA 3SKYA 3EWIA 5JJBA 1RKUA 4DFDA 3CZ4A 3EF0A 4PNHA 1WVIA 2AH5A 4HAIA 2HI0A 4KYTA 2OM6A 3WK4A 3I28A 3J7TA 4L57A 5AI6A 3PGLA 2C88A 4BX3A 2R8EA 2BDEA 5IT0A 3AR4A 1QQ7A 2P27A 2B8EA 3ZVLA 4FFDA 3P96A 3I76A 1TJ4A 3B9BA 1XP5A 3U7HB 3QNMA 5AW3A 3QXGA 2C4NA 1RLMA 2FPUA 4NFLA 1RRCA 2YMPA 5AVQA 3ZW7A 2YJ5A 4UATA 5AI0A 3MN1A 1VJRA 5AVZA 2G09A 5ALPA 4NV0A 1YDFA 4UARA 3OCVA 2MSNA 3SF0A 2HO4A 3KDPA 5AW7A 5AKYA 2AUTA 5ALGA 1RLTA 5AKIA 3ZWKA 1RQLA 3WK7A 3QUTA 3N07A 5AKJA 3ZI4A 1YNSA 2RAVA 1TE2A 2P69A 2HSZA 2B82A 5ALDA 2HDOA 3NASA 2HCFA 2HHLA 1U2SA 4UM7A 1ZJJA 4DCCA 2JGAA 1ZD2P 2FPWA 1Z4LA 5ALYA 4Y2UA 1N9KA 3FPSA 2FI1A 2YY6A 2RB5A 5FP0A 2IOHA 3KBBA 2ZBEA 3L8FA 5AI9A 3M9LA 2CFRA 3NAMA 2ZG6A 4EENA 5ALTA 1IWOA 1U2TA 4QQFA 5T41A 1TJ3A 4AS3A 3W5CA 3KD3A 3AR8A 4JB3A 4BX0A 4DWOA 2O9JA 1O08A 4ZEVA 2HX1A 2W11A 1N8NA 1X42A 1Z4NA 1L8LA 2Q4TA 2PKEA 2YMLA 4AS2A 3QUQA 3WK8A 3VAYA 4FE3A 3WGUA 5AVUA 1MH9A 3AR6A 1ZRMA 1RC8A 2NO5A 2WF9A 3QU4A 2CFTA 4QJBA 3UM9A 2IA5A 2HF7A 2WM8A 3ZU6A 2B1RA 4YH1A 4F71A 1XPJA 5AVWA 3ZTWA 3UMBA 3E81A 5ALUA 4XOUA 5ALZA 3W5AA 4UAVA 4Y3UA 2WF5A 5AKEA 1RDFA 5ALOA 5AM1A 2G08A 1ZD4A 1CQZA 3L0YA 5AKHA 5AW2A 4G9BA 4Y2PA 3AR2A 2YBDA 5AKLA 3WKBA 4F72A 1RMQA 4UMVA 4BBJA 3DAOA 3PGVA 1RLOA 3WKDA 4UMDA 5AVSA 2FUCA 3AR5A 1QQ6A 5AICA 3TLMA 1LVHA 4L6AA 4JDPA 3GYGA 3L7YA 4C4RA 2DQSA 2G1AA 1SWVA 3FGOA 4HGQA 5AW8A 1Q92A 5ALKA 3HLTA 3WK5A 2G80A 4Y2VA 4GXTA 5E0OA 1EK2A 4UMEA 2EARA 1Z4KA 4Y2XA 4XE5A 2OYCA 2ZBDA 4YGYA 3AR7A 2QLTA 2YN4A 3UMGA 1VJ5A 1ZD3A 1QYIA 2ZBFA 4O8CA 2PQ0A 3SMVA 3ZUPA 5AVTA 1CR6A 3ESRA 3I6BA 5IT4A 1RMTA 5AW5A 2R8XA 1Z4OA 4GIBA 4Y2SA 4HGPA 3SHQA 1YJ5A 4J2TA 1L7PA 3WKEA 3BA6A 2AGVA 2IOFK 5AK6A 2RARA 3F9RA 3BWVA 1ZOLA 5A3QA 4HGOA 1O03A 4BNDB 4CE6A 5AW6A 3N5KA 4XPZA 2GHQA 2WFAA 3ZX4A 2ZBGA 3AR9A 4UU0A 1KYTA 3L8GA 5ALNA 3R09A 1VFPA 2B8JA 4RESA 3QU2A 3ET4A 2GO7A 1T5SA 1Z4PX 3SKXA 3M1YA 1JUDA 3RF6A 2NYVA 5ALMA 1Z5UA 2B0CA 3KZXA 5AM3A 4XQ0A 3U7EB 1RQNA 2QYHA 5AIBA 3PDWA 5ALWA 3WKAA 3PCTA 4BEWA 2I55A 4Y2TA 1LTQA 4EX7A 4NWIA 2OA0A 4UAUA 4HGRA 2BDUA 2JAUA 3ZWDA 3W5DA 1Y8AA 2HEGA 3E58A 3ED5A 2IYEA 4CNQA 3OCYA 4C4SA 3NIWA 2C9MA 2C8LA 4UW9A 5AVYA 5AHXA 3KC2A 2R8ZA 1J97A 4KNWA 1SU4A 4BNDA 2GHTA 2JAOA 2CFSA 2HOQA 5ALSA 1F5SA 3QU7A 5AIAA 3QUBA 2FPSA 4Y2RA 1L7MA 2JAWA 3B9RA 1WPGA 5ALIA 1WR8A 3ZVNA 5IS2A 4B6JA 4Y2JA 4UM5A 1NRWA 3RFUA 3QUCA 5AI4A 2I54A 3MMZA 2VKQA 4EELA 3NRJA 4FYPA 5ALRA 4Y2YA 4ZEWA 4YCLA 3SD7A 2G07A 2YJ3A 1EK1A 1TA0A 4OFZA 1RKQA 3OCZA 1U7OA 3EPRA 3OPXA 3OCWA 3IJ5A 3DV9A 4E88A 4EX6A 4RETA 1J8DA 2Q4RA 2YMQA 1FEZA 1Z5GA 4UASA 4OD0A 3AR3A 3N28A 3A1CA 5AW0A 1L8OA 2EAUA 5AK5A 1L7NA 3FM9A 3U7FB 3L5KA 3I1YA 3IRUA 3ZTYA 3A3YA 3L0BA 1YS9A 5AKKA 3N8GA 5AVVA 5AM5A 3QYPA 1Z4JA 1NNLA 4KX3A 2P11A 3OCXA 4OCZA 3K1ZA 4OHFA 4G63A 5ALXA 1TJ5A 1L7OA 1RMYA 2W43A 2WF7A 2GMWA 1RPZA 1QH9A 5A3SA 5ALEA 4KN8A
chains in the Genus database with same CATH superfamily
3KPYA 1CJUC 1N57A 1H2FA 2RG7A 3VR4D 2O05A 4BPRA 5DSZA 5A4DA 2JLUA 2QRLA 2L17A 3QLVC 2E9SA 4D82A 2OXIA 3IH5A 1KGDA 3ZW9A 5JU6A 2V4QA 2C92A 4OHWA 2GD6A 3RBXA 4F91B 4R3UC 4EG8A 3BFXA 3FLMA 5FOVA 2B30A 3CLRC 4IEEA 3SEZA 1D3AA 3EC1A 4H7EA 4PIPA 2YIDA 1EXVA 5JNVA 3SDSA 3WIBA 3GLIB 3P5BA 4PC6A 2QTTA 1SIWA 2JIBA 3SYNA 5IBQA 1ENYA 5CXSA 3E3NA 4ID9A 1WZIA 3ROPA 1R0SA 3IKMB 1HKUA 1ZQXA 2DE0X 4U0KA 1M72A 3DAHA 2FF7A 1KRXA 2W4MA 1XOIA 2NVWA 4AUNA 3B89A 1HETA 1S8OA 3EDCA 4FC7A 3R3JA 4ZANA 2E48A 2BSQA 1PIWA 3SLKA 3SC2A 2ACVA 1EAMA 1Z3EB 3EZ2A 3NIDB 4G5HA 4MQBA 4A6EA 2QM8A 4YRGA 1EUQA 1CZKA 1ULHA 1W9MA 1SC1A 3GG9A 4CJXA 1D0SA 3AERA 4A26A 2QYOA 5DBHX 1FDUA 1KPGA 4QIWF 1LRJA 1NNI1 2XE4A 3GF4A 3T61A 2HSEA 1LPMA 3T7DA 4Q44A 3R0IA 1Y1QA 1T35A 2QNRA 4ZO4A 1U3VA 5CVDA 4JV2A 4RK1A 4MWTA 3UB3A 3W1EA 4ZHQA 1DCTA 4WKPA 2VPZA 4W1RA 1WP9A 1QQTA 2IV3A 4Q9AA 5BVHA 5L6MB 3KB8A 3WL4A 4BQPA 4AMBA 2XCRB 3GFFA 2GCOB 4QUGA 3QQ5A 4MRRA 4MYCA 2OYYA 1FVHA 1ZIXA 3T9FA 1KZYC 3W9SA 3WZMA 4AK9A 5EJ5A 2X4DA 2IELA 4GI7A 1KS2A 4C7XA 2KG5A 1XJQA 4DJEC 4EM6A 2ZWMA 5B37A 1EFRD 4AJKA 5CEJA 5KIAA 4W5TA 4YXJA 4AJPA 2JEIA 1OLSB 2X2EA 1U2PA 1TADA 1RQXA 3DQPA 3LHIA 2IK8A 4R5MA 3V7WA 2G9ZA 1L6IA 3LDFA 3RVBA 5JRZA 3E7DA 5DMXA 5IASA 3U9SA 1BDMA 1DXSA 3RUAA 3WRWA 3W7AA 3X43A 1GN9A 3BZWA 5IN5A 1T2FA 3ELDA 1K5PA 2D8CA 2BHTA 2PWYA 3CNEA 4J9OA 3UJAA 3PFNA 5IZCC 4KGVA 1YMQA 4JI1B 4YIHA 3A05A 2ADFA 5I7RA 1RJEA 3FYUA 5LA6A 3TSCA 5HKAA 1L9XA 3B3JA 4C7ZA 1KLNA 4IOKA 2OAEA 4M22A 5BMVB 4PQRA 4ZO8A 1O0SA 2WJ4A 3DUFA 4IIJB 4XB2A 5BR4A 4B35A 4NJMA 5HHTA 4RDIA 1RKXA 2RJ3A 5DSXA 5EZYB 2V6IA 5IXJA 5F9HA 4R9VA 5C7LO 3LC1O 3HXQA 4HSEA 3VO9A 2YFKA 3N7AA 3LBFA 1NPTO 4QARA 4F9TA 5LLTA 2P3QA 1S5PA 3LWNA 5FI0B 3ADBA 1AO3A 3JD4A 1HQKA 2FF5A 2QL9A 1U5BB 4I2JA 3HZRA 1PT7A 5J2KA 3ESAA 3RQSA 4CBVA 3EVGA 3SXPA 5HZKA 2KKVA 1GUAA 2A0XA 2EQ5A 2GFHA 3FPGA 1GV0A 4G07A 5GGYA 3LVFO 5T5QA 4ME6A 1JR3D 3HLKA 5ER9A 4BYGA 1JX4A 1W6UA 3E82A 3GRVA 5L3SA 6AT1A 1NR7A 4X97A 4J29A 3GA0A 3FPCA 1IN6A 1QYCA 1R64A 2I03A 4IHJA 1ACJA 2O2SA 3WL3A 2TRSB 2ZI9A 4G97A 2WSSA 5KX5A 1TECE 1U0JA 1M2OB 2BSAA 2YYAA 2SKDA 4G3IA 1YQDA 2NZYA 3M5DA 4KKVA 1QB7A 3VOSA 3MOIA 3SJCA 3GV5B 1V8OA 1U8UA 3KE8A 2JCBA 4UVIA 5JY6A 2CSXA 4P1ZA 1FZTA 4EWLA 3FSGA 4IHQA 4JJAA 3V3TA 3QITA 1IULA 2ATXA 5EFZA 3AQFA 4UE3S 4W6QA 3KJFA 3AEUA 4U2DA 3THOA 2E8MA 1Z8HA 1Q0PA 2Q1YA 2Y2VA 3OBBA 1EM6A 4J6FA 1TYEB 2PGAA 4RPGA 4WLOA 4R83A 2UDPA 2OCGA 3TLCA 1EFRA 1JI0A 1MO5A 3L0SA 3TZKA 4X5OA 5EIXA 4OV6B 3BE6A 3CRNA 2ATEA 2P91A 4N7BA 5REQB 1LX7A 2A67A 3ZE1B 4D9HA 2BFCB 3BGOS 3LQ2A 1VQ1A 4I19A 1FIQA 3EMVA 3WB2A 1Y5RA 1QCCA 2GVDC 1NYLA 2RGNA 3FWZA 3D3WA 2I4NA 3CZ4A 2F2AB 1S3FA 1UF9A 3IM1A 1RYRA 2EH9A 3JQ8A 3EXAA 3NAQA 4NSNA 5DN9A 4KYTA 4DPMA 5FLXA 2OCKA 3SC3A 3LS2A 2FMQA 3CYFA 4YWJA 1KYIA 1YIDA 2CHEA 2Q9AA 2Z2YA 1VHDA 3LK7A 3WGJA 3WYEA 3R9XA 3PJEA 4B87A 3T5GA 3NVAA 2AJBA 2E82A 2CVZA 2VJ5A 1II8A 2V5UA 3Q8PB 1N9ZA 5HS4A 3EZ6A 3U4AA 3IVXA 1JILA 4C43A 4BTEA 1JRPA 3A9UA 1M8FA 2AG0A 1DEXA 4BKPA 4FGZA 5KYKA 1QFMA 2A92A 3HGTA 1B3RA 3SEFA 1V9LA 2RP5A 4FNAA 4X9XA 2A84A 4Y6LA 4IJ5A 4PHEA 3EFHA 2WP0A 5J4YA 2F8MA 5G0VA 2HK9A 3M49A 1TU3A 1XSLA 1AHHA 3FHCB 3G5AA 3U1TA 6LDHA 3HB7A 3IHKA 2KVSA 4LVOA 5KVVA 1RRKA 1GPUA 3Q3JB 3FOFC 2KKPA 4TXMA 3NDBB 3BHIA 5AVQA 1M34E 3TQIA 2YYSA 5JMOA 3JWIA 4I5GA 3UJ6A 7MDHA 4NCAA 3A0BU 2ZANA 4PS1A 5IH3A 1X9XA 5DB4A 2K4HA 4MP6A 3GILA 4XGRA 3RHTA 3O03A 2MSNA 3EUB2 4ZVMA 4LZPA 5JS2A 4TQUS 1DX9A 4E22A 3BEDA 5SYMA 2WYWA 3LTNC 3HVUA 2GLXA 2BQUA 3O8DA 2RH9B 2DB3A 3LA6A 4R1PA 1NMEA 1SIBE 3CUSA 1G41A 4KVZA 3OSPA 2AT1A 1U3UA 3F5FA 4R1SA 3EW9A 4S04A 1E18A 3SJZA 1AKTA 3BOSA 1Z38A 1RYBA 3AVOA 2AOUA 3T5AA 2GESA 3ZHRA 1ECFA 1UPFA 1PR3A 1V8DA 3IBYA 4H7DA 1AG9A 3EEFA 4NBWA 3JQ8B 2B82A 2ODPA 2NVUA 4GOLD 4K4HA 2HXYA 3USES 2PLWA 3JQEA 4KLGA 3M6UA 1Q7GA 2XTJA 4M1KA 3V7KA 1RFLA 5DH9A 3GVIA 4DCUA 5JNSA 2FR0A 1U2SA 3HB5X 1Z0UA 5H5JA 4HMPA 1G21B 3BRSA 3Q1KA 4G0WA 5FBWB 3RYCA 1N32B 3V6MA 2R00C 3LP8A 3OOHA 2FFAA 3QXSA 1W5FA 3AZOA 3M7IA 5BOLA 4OH7A 3EPIA 3JR7A 4LY9A 3NETA 4F2HA 4MAMA 3EGOA 2HA7A 4OUDB 1MFZA 3TB4A 2F48A 1I3KA 3DZIA 1JQEA 1O96A 2I66A 3SEQA 1SFRA 4YFVA 2NRVA 4EENA 4NOKA 2IEDA 4RGQA 1D7OA 2A33A 2BI8A 2D1SA 2R5NA 3KV3O 4G1UC 5EXSA 3MJHA 4CCYB 1LDGA 1YJQA 4C22A 1WY7A 3CB2A 5JZVA 3W8EA 3AR8A 2ZSAA 4IXMA 1GYRA 1KA9H 1V35A 4TVOA 5CAEB 4ALMA 4EEXA 4DB2A 4IZIA 3CQ9A 4V3CA 2FLNA 3GG2A 3JQFC 4H7HA 2HX1A 2ONZA 5BVGB 2GPWA 3NEJA 2PLFA 3U4IA 4WZAA 4OXKA 1P80A 1NN5A 2NTNA 3N0WA 4RCZA 5TEWA 3BXHA 4DMCA 1L4KA 1JTVA 1IOVA 2YZMA 4QTUB 4ZDIA 4M9LA 2EF0A 2WM9B 3BMQB 4JHXA 2HM7A 3CCCA 1ECCA 1XQXA 5E7QA 2GKOA 4KLHA 1SRQA 2WM3A 1U1FA 2EZXA 1M1YB 3WSTA 3ZCVA 8ICIA 4R66A 4HP8A 4YMWA 4DQXA 3CF4A 2O8CB 5ILGA 2CFTA 4O8ZA 5BUSA 1XF9A 2X2PA 1Z00A 4CEJB 2QWXA 2VH2A 2ZS7A 3WC4A 2Q21A 1NRJB 3O94A 1JJBA 3OIFA 1KTVA 1IJEA 2HYDA 1WZEA 1R12A 1YZVA 3OI7A 4X24A 3H7IA 2OGWA 4CL2A 2PANA 2REXB 2JAXA 2XDQA 3SVTA 2CLOB 1RM5A 4KH1A 1NSYA 2WAQF 2G08A 4B3IA 4NK4A 4EVRA 5IKMA 5LQUA 1A9TA 1KI4A 4ALJA 4QPPA 1IZ0A 1C9YA 3W34A 5JXJA 3ZZ0A 4G9BA 1M5TA 1W59A 3DDSA 2ZROA 2OCYC 4KNYA 2IYRA 2KSOA 1DC6A 2XO7A 3C1ZA 2P6PA 3FPEA 3ELUA 3NC4A 1ONOA 4AC9A 5CDYA 2P79A 2Q5OA 2PL1A 3DAOA 4PHAA 1P18A 2X9GA 5IT5A 4LZJA 2XB2A 4FINA 1IQRA 1YCFA 1WWUA 2BDPA 1NR5A 2V7GA 4HYKA 1AKQA 1J2TA 1RHKA 2QRQA 3GYGA 3IPYA 5DLFA 4HH1A 1T8UA 2P8JA 4L0DA 1LJLA 4KDEA 3SV3A 1JNXX 1G2PA 5ALKA 1O9GA 2FRDA 1T0IA 3K8QA 3OX1A 5ECDA 1WX1A 3HDTA 1XMJA 3M82A 1L5VA 3RSOA 4MVJG 2R9VA 5IUNC 2JFWA 2HRBA 2LM4A 3OEEA 1HKHA 1ZGJA 2XUFA 5GM1A 5U4QA 3OIVA 4ED9A 1OBFO 4LVSA 1JG4A 1NOKA 4QULA 3ND8A 3G85A 2QLTA 4PU0A 2W6JD 3GQCA 2GEFA 2QRNA 3WGTA 3X2EA 5C51B 4O8CA 4O5EA 1CDOA 1MIOA 3B7GA 1PG0A 3MTIA 2H9YA 1IEQA 4XRHA 4I27A 2AG5A 5J2GA 4NL4H 3SSAA 1TYZA 1UK8A 2Q2VA 3OHPA 3VMMA 1JVBA 2IH2A 2AE1A 4K86A 3BH6A 3GBSA 3GUHA 4Z3DA 3OT1A 1AV6A 1VE7A 3OZXA 1W2GA 3BWVA 3JZAA 1SRRA 4P36A 4JKYA 2EW2A 1NP7A 1AUXA 5K3AA 2R5WA 4JEIA 4YJFB 1TIKA 1BVUA 3L79A 2ECQA 3ZX4A 4EI8A 2XZLA 4EG0A 4ZCTA 4FIDA 3AEKA 3A11A 1S0UA 2PRSA 3QE9Y 3R8FA 3V33A 2F43A 3PEYA 1T6NA 5EZYA 1IVSA 1O1YA 4XTCS 3T4EA 2RGRA 4YQEA 3E7PA 5CU7A 3TUZC 3TXXA 3W3AD 3ET4A 4DBLC 4M0FA 1UKZA 1DELA 1Z4PX 1DIOB 1M1ZA 1ZJZA 1E99A 3KKKA 5BMVA 2VK1A 1BS9A 1ULAA 3CR8A 2XUIA 1RYUA 4J9MA 1IAVA 1WCYA 1XV5A 1RWMA 3F6PA 3FWHA 3OFJA 4MVJI 1KU0A 3ZJUA 5DHQA 3UF0A 1UPCA 2ZTDA 5F1KA 3VU0A 4F56A 4LFBB 3HJCA 2I87A 2J33A 5KG2A 1GVHA 2XDAA 4FN5A 5EIAA 5K7SA 1O54A 1BSVA 2RG1A 3BWCA 3KWJA 4J0KA 3QMPA 1QMPA 3PYLA 1RYDA 3ZNPA 4DSOA 4FE7A 3AI1A 4F96A 1J0DA 2C8LA 2JIQA 2UXBB 1HK7A 2H1RA 3JZMA 1UBHS 4OFWA 4DADA 1SBYA 3RFTA 2Q2WA 5K6RA 4HDMA 2D4HA 3MAGA 4NC9A 2GYYA 2UVDA 1Z18A 1MB3A 1IOLA 2WJVA 3HB0A 2KS6A 1CDDA 3AY7A 3KK0A 4KNWA 4Z2YA 3OJFA 3KSRA 3ILSA 3RS0A 4BBPA 1Y3IA 2IHYA 4EI9A 2JAOA 4YPOA 4L8LA 2HBLA 3F7NA 3IUPA 5DM1A 4IVNA 3RT1A 1M6EX 1AMOA 4OXXA 1BYUA 4DIDA 5K2MA 2OG1A 2H5LA 3I4LA 4MJ3A 5ADWA 4JLDA 3VAAA 5HVNA 1NF9A 1E8MA 2MSEB 4ZPXA 2GX6A 3FMFA 4R1MA 5IJZA 3PRYA 2F7SA 3CLKA 5KQSA 3I2KA 1FFCA 5LDGA 4OMCA 4JASB 2DETA 5IS2A 1FUIA 1M0EA 3KAPA 3LYSA 5JG7A 1ZWKA 1IVNA 3OESA 4WZ6A 3BD9A 1YVUA 1DCKA 1LH0A 5J8YC 3FUVA 4AQ7A 9ICHA 2KIVA 1IL0A 2BLLA 2XR1A 5DTJA 4IQWA 4GNKA 4XLZA 2W6PA 1L5HA 1PG5A 3OPXA 1THTA 3ZWCA 3AEVA 4NPAA 5TGDA 4PHDA 3GH3A 3BHNA 4U1RA 2W54A 4YBRA 2JLCA 2BFAA 2HRRA 4P3OA 1KDVA 3ZGXA 3LVVA 1EFUA 2YXNA 3NIBA 4FCTA 3GZJA 2UZ3A 5CPBA 2X6RA 3MBOA 1MX3A 2YMQA 1AXGA 2J5BA 3F5DA 4K3VA 3TRFA 2CSUA 1I3CA 2B0JA 1KR2A 1V5WA 1CUXA 3LY9A 4KL8S 1USVA 4U7TB 3LUBA 1YZKA 4MPTA 2AQ8A 3CH5A 4K28A 2Y99A 4MWSA 1BN7A 5AXBA 4G09A 4Z4FA 3E7FA 1OE0A 3JQGB 4BQNA 1A2QA 2G40A 2C61A 4NYJQ 4PX5A 5IH7A 3M34A 3T5TA 4K9QA 5IZ4A 4KTVE 2QMZA 4MV0A 1QRSA 1KFBB 4HQOA 4OLHA 5F35A 5KFCA 2XTNA 3GB9A 1WVMA 3HKBB 4MVYA 1XSNA 5DOZA 4BUZA 4GXNA 4DA9A 4G5YA 4D9IA 5BYAA 4XA5A 4CEJA 1W5SA 1X1RA 2FP4A 1OIVA 2HRCA 3EUWA 4XCQA 4AMYA 3IP6A 4WTOA 3QYPA 3BFVA 1NOMA 4JLAA 3ZKAA 2DPLA 4LKOA 1G8KA 1TGYA 4RSMA 3JU3A 4L9WA 4LRTB 3IO3A 4K9NA 1DBWA 2WJPA 4M0AA 2XCQA 4ZMBA 4HZUA 5JAZA 9ICMA 2V97A 3LD9A 3ZCTA 5ALXA 1RAFA 4E31A 1M9NA 1ZOOA 3WWOA 5BUCA 2WWIA 1ISRA 2JIZD 3PUKA 1R5NA 2C2OA 1XEWY 2IOQA 2J3JA 2MMGA 3KHTA 1LLFA 2ES4A 3IFSA 1ONBA 3FVVA 3WQQA 5TQ2A 9ICAA 4M53A 1EXMA 1YZ3A 1SKSA 3LQ1A 3H0CA 3HYTA 1B74A 3CB4A 4GKKB 1NVVQ 1A9YA 4A7PA 3FDIA 1BXKA 4S2UA 3AEKB 1NWCA 1O5OA 1OBHA 2AG1A 1Z7YA 2BCQA 4QRIA 4F9EA 1NX9A 3U6BA 5GONF 3M6AA 1V25A 3G1TA 1GU7A 2VJNA 2RJOA 1GILA 4K3UA 3UB2A 4TS3A 1F0KA 5KYVA 1UKEA 2I8LA 4TYPA 3TRJA 4P0TA 1KQ3A 3UAYA 5HQ3A 4GT1A 3LDHA 1DG1G 4XVHA 5A3JA 1N2OA 1UMBA 3DTYA 3H3JA 2G4LA 3FYSA 3QX8A 1QPGA 1AK9A 2VSFA 3BHJA 5F3WB 4YXWD 3PENA 1SVOA 3DXZA 2FX5A 5KVQA 2EP8A 4CLRA 2Y9PB 3LBYA 5JARA 3JQQA 1QF6A 3FWYA 5K5EA 1XRQA 4IIEA 3JPNA 3GWGA 3ZLVA 4RFVA 2AJLI 4FEAA 4TT3D 1XZNA 1Y1RA 5LR6A 2GYVA 4CG2A 4MI9A 4Z4HA 2DPIA 5DYTA 5LXTB 1T5DX 3DE7X 4ZCIA 4YK7A 2GDJA 2YC4C 4MPRA 4JLSA 1VE1A 3QX9A 5IDVA 3SZGA 4D1YA 3RUEA 4EDHA 2Q6OA 5B6JA 3VGJA 1NK0A 1NKCA 2FFQA 4C21A 2F3SA 5AKGA 1ISJA 3X3HA 3K71B 2DEUA 1PVOA 4JI6B 3D54D 1RJWA 2AHOB 1KMQA 1YJCA 3K09C 1IONA 4K1XA 4PR0A 1N34B 1X9MA 1PR2A 2PR7A 3OTQA 2CYBA 1DJMA 5J1SB 3MF4A 1NT2A 3Q2IA 1C1DB 2H3EA 4TL9A 5KPDA 2CV1A 5G0SA 1WV1A 1C2TA 2Q6IA 4GYJA 3PV8A 1WOYA 2G9VA 4GMKA 4MUJA 2ORWA 4YIKA 1N8TA 1R3DA 4JSTA 5I4KA 3F4LA 1ARZA 4RMIA 4U7JA 4M1EA 1J0BA 1Z0JA 3LT4A 4DVGA 2E5FA 4NYIQ 2F17A 4TTTS 4GZLA 5AW4A 3AEZA 2OZKA 3VZDA 1SXDA 2VC2B 5DWQA 2LR0A 3FI0A 3T35A 1PEYA 3A1DA 1FDWA 1GDHA 3DGFC 2ORED 5DQIA 1IPHA 1UMDA 3L18A 4G67A 3WAGA 3Q87B 4DZZA 2X0RA 5LZ9A 3I3OA 1Y5IA 2K60A 1BFUA 2E1FA 1NPDA 1R15A 3EAFA 2J9GA 3GWZA 3L1UA 3M6MD 4L50A 4X60A 2FQ1A 4O0LA 4YCDA 4BGVA 1SB9A 1NTRA 4UPVA 4WOPA 5DGXA 1UDBA 5DZSA 4LOIA 3TD2A 1GL9B 3NM4A 1CE8B 3Q3VA 5J3JA 2FVYA 3NTQA 1VKJA 1SQSA 4EARA 3FYHA 1XO0A 3E7XA 5D4BA 1W5TA 2OGSA 3O4FA 4GLXA 2DPGA 1ZQBA 2XZDA 3OKCA 2A0UA 2H1IA 5BWOA 4N7JA 4UE2A 5JQGF 2WB2A 4NH0A 2O8EA 5SICE 2A3NA 3PTLA 2OHJA 3VSBA 3UOGA 3QU5A 3ORFA 4PZ0A 3LW8A 2DY0A 1L5QA 1G0OA 3RABA 4L22A 1E60A 5DM0A 3UUFA 2VCEA 3JQCA 2EEPA 2Z04A 3ECAA 3IPLA 4GH5A 3PR3A 4HUQA 5FPKA 3FOWA 5BYJA 3WIDA 2C5FA 5IVDA 3GP8A 3V8RA 1B2LA 1J2EA 3SIPA 4YAGA 4EF4A 3WG9A 1UC8A 3KHGA 1YE8A 3D7MA 1JG2A 5FJIA 3SPXA 3STWA 1UP7A 1NF3A 1Q7RA 3H1TA 3KUDA 4NV3A 4AT1A 2O8BA 4P4LA 3CF2A 1K6XA 4KOEC 1PN3A 2FRVA 3HPQA 1XR3A 1VMDA 3ZV7A 1GPKA 1H93A 1X3LA 3NJ4A 5JCOC 4X8OA 1ZQSA 3OHMA 4EYGA 1N63A 4LZZA 4RSHA 3I23A 3L1VA 3OFNA 4MVJF 1CZOA 1Z0DA 1N5WA 5G53C 4QOEA 1TRHA 2AFHB 1GZHB 2O6LA 3BGDA 3NAZA 4M1YA 5D01A 5J0TA 2TYSB 5E38A 3U3RA 1E8NA 4KN6A 3C7CB 4L7QA 2VF5X 5FNZA 1DSSG 1E0AA 3TN7A 1N1MA 4P3XA 3K9LA 1JEJA 1A9XB 2GDZA 1I01A 5KOJA 4D9BA 5AQ1A 2FMFA 4JXZA 1W49A 4BFUA 4YMGA 1B4FA 2R1ZA 2X9LA 4LBWA 4LV6A 3E53A 4MOWA 4R8KA 1GL7A 4PNHA 4U0JA 4J9KA 3V72A 5L7YA 3D81A 3PUVA 1JNYA 2YVLA 1AY0A 4CIXA 2HI0A 2Z1NA 2EBUA 3ABSB 1CNMA 2LKCA 1MA3A 1EUDB 1LNSA 2B1GA 2AVDA 3ZD9A 3VDRA 3BE8A 1RZTA 3N39C 4LNUA 1DWQA 4RA6B 3MJRA 4U5QA 1DPGA 3SN6A 1DKNA 1QVRA 2OVBA 3G8AA 3PGJA 2HD4A 4RSGA 1ZD8A 1KDYA 4UVGA 5HUHA 2X1HA 3EC7A 4UC0A 5U1PA 3G1WA 4RH3A 2B9VA 3ZVLA 4LYYA 2GOLA 1Y3HA 3UV3A 1L4GA 1HYGA 4G5GA 2JJ1D 3UT0A 3GCDA 4DXDA 1E98A 5KU7A 3NXKA 1TJ4A 1KI2A 2ONYA 4FNGA 1XP5A 5IBCA 1X1EA 5IZCA 4R8MA 5JOQA 4TKUB 3QXGA 1W9HA 2QM7A 1CE8A 1R4ZA 3JYOA 1CUHA 3P0EA 5C3MA 1NRIA 3OOEA 3W9UA 2XLCA 3I1JA 4ZU1X 3ZI0A 3EY4A 2J41A 2IH5A 1Q7EA 5TZVA 2H5IA 5FV7A 2IEYA 1CNFA 4K87A 4X5VA 4F4KA 1UXHA 1L4NA 2X3UA 3PXUA 4I1UA 1D2GA 3PR2B 4IXWA 3IXMA 4KGDA 2JH1A 2FEKA 1Z2EA 2VRWA 3DOFA 1YDFA 2WHPB 2WWGA 3HU1A 3K4PA 3T79A 3LT0A 4TUSA 4MW7A 4CT0A 2CW5A 4HFMA 5FO1A 2JK1A 2XSZA 2FX3A 2C5BA 3AFHA 3K6RA 3LL4A 3QUAA 4KQHA 1FVFA 4DQ0A 5KINB 3ISJA 1UQVA 3ONDA 4JQYA 2C7GA 1X66A 4U7HA 1KMHB 4JHLA 2AUTA 4A92A 4DA0A 3C7AA 5KYUA 4TUYB 1HYHA 2FQWA 3MD9A 2ASEA 5K0CA 1EFCA 2QN8A 3Q5DA 4DV6B 1FXWF 5LQCA 1ZNXA 3KQKA 4V0NA 3T41A 4J9SA 4A2QA 4ETNA 1DO0A 3B6IA 2B21A 1R0BA 4MB2A 5FUQA 3WV5A 4DYHA 2HMUA 1SG0A 5I9BA 3QLVA 2TSYB 3P26A 4DRXB 4HAOA 3O4GA 1VL8A 1Y5LA 4NCKA 2I2FA 3DO6A 4TSFD 3UUWA 1Z6AA 5I7HA 1ZD2P 3LGXA 5HJ7A 4M9HA 1M2FA 1IZYA 2FWIA 3C8HA 4LGMA 1QV7A 4PW0A 1NVWQ 2ECKA 3MWGA 5IDWA 5KG7A 3CSSA 3HDYA 4C0AC 1KEZA 2Z4RA 3UMRA 5B3JA 2FI1A 1CS0B 1QYXA 2RB5A 2CD7A 1ZBDA 4P3KA 1FNMA 4CKBA 3GEHA 2J9FA 3T1HB 4W5NA 2GF0A 2XUPA 2GZ1A 4YACA 4CL0A 3VHXB 4UUBA 1COOA 4R9RA 1NLFA 4G0NA 1J00A 4UFPA 5JADA 2Z8XA 3K70D 2NZWA 1PJBA 3O8OB 2ZG6A 4YJ3A 4RE6A 5IKXA 1DG9A 1FCJA 3JPTA 3E48A 5K0ZA 2PUEA 3KSMA 3GRUA 3HPRA 1Y7HA 5ED4A 2COEA 2ZCJA 4FBMA 5KI6A 2JLQA 2XHZA 2ZFUA 1YK1A 1QK5A 4MUYA 4Q1FA 4CM6A 2D7CA 4R64A 1VPVA 3UMFA 5HQ3B 3ZZ1A 3GUYA 4O5KA 3NHJA 4MKFA 4AX4A 1PT5A 3H2IA 3NU1A 3N6VA 4GOMD 2IWHA 2OPBA 2B6GA 5KTNA 5J2TF 1N8NA 1XNGA 5KJ1A 1AZSC 1N5JA 4LVUA 3PX2A 4US2R 1NLYA 4WPGA 4D4HA 2NSDA 2QV7A 3X0DA 1HT1E 1T2DA 3LKVA 1XQWA 1F4LA 2WSSD 2ZP1A 2ZTMA 4P81A 1DMSA 3RRHA 4NYIR 3AV3A 4JOBA 1YDWA 2CL5A 4H7JA 1ZRMA 2DKOA 2EYUA 3PNLA 1SUIA 1UDRA 3IOMA 1W93A 3PD7A 3W2TA 5DSTA 3UUGA 2B35A 4Y0VA 2IA5A 2XBLA 1VL6A 1V7QA 3BCUA 2VANA 1YBVA 2K7ZA 3ZE7A 5KAIU 2LZ0A 3ZU6A 2XCTB 4I81A 3WLIA 5KSOA 5CITA 3OX2A 1E3SA 5AVWA 2FPGB 4Y6OA 1WB4A 1ABBA 1Z0SA 1PJCA 3DXXA 5ALUA 4I4TA 3EXEB 3M9WA 4D45A 4RPZA 1A88A 2PUGA 3THVA 4YP1A 4UAVA 2AN1A 4QOGA 4IOMA 1X3SA 4B9LA 4KCGA 4IDCA 1YB2A 5CXUA 2Z1DA 4Y2PA 4HLQB 5JVDB 2E37A 4HFNA 2FK8A 2FZ4A 1L4HA 1D6NA 1TU0A 2FJPA 2C3UA 2J08A 3AIIA 1N6RA 3PGVA 4KMSA 1TT5A 2PYIA 3B85A 4L4XA 4U63A 1NK8A 2AJDA 3IKJA 5DI3B 5AWFC 2XMQA 2G9UA 1UOQA 5J5CA 1W36C 4LSMA 4G5OA 3TLMA 1A8SA 2YZGA 3DHYA 1ENOA 1SWVA 4F2DA 2XUQA 4NXZA 4DWIA 3AF1A 1Q92A 1GUFA 1Z9BA 3QWAA 1YVPA 1O6BA 1U99A 1UXKA 1BNCA 4A1OA 4AXBA 2QX8A 1CY1A 1IMOA 3Q1LA 4L15A 1NI4B 4IJ6A 4TMTA 3CLVA 3FR8A 5IILA 1G2QA 1QBKC 1A7KA 1XNJA 2Q3LA 2QN1A 3P2IA 4IS3A 5FR1A 3UGJA 1NNEA 3R24A 4ND6A 3U4HA 4CM3A 1VYVA 8ICMA 3MPUA 4WBNF 4ROSA 3B6ZA 2QRJA 2O14A 4QBHA 1FP4B 1R0XA 3CW9A 1YMUA 1Z39A 3GRCA 4QWDA 4Q4AB 1DBSA 4HK4A 4DF3A 4A6XA 2CXPA 4BP9A 2IU6A 1LKYA 2LCIA 1F20A 1S0OA 3SE7A 5C4IA 1KWKA 2PQ0A 2W42A 1J20A 2A3RA 2XOKD 4AJEA 3FUXA 2Z2ZA 4F85A 4FHGA 4F21A 2R8XA 3BJMA 4RY0A 4DLSA 3T3DA 5FAKA 1UCVA 5MGBA 2CKDA 3I04M 1D2AA 5JZOA 2GUGA 5KNBH 4QZGA 1NI4A 1RFGE 1W73A 4CDMA 4YR2A 3KZCA 3PFCA 4WDQA 5DHPA 2Z56A 3CF4G 3R0JA 5GWXA 5C1IA 4QOHA 4BNHA 4OU5A 2RHFA 2XD9A 1M0WA 4JELA 1BE6A 4TRJA 5FBZA 3S7TA 1WZ2A 2V8OA 4QICA 1AXRA 3DDOA 2HWYA 2IPLA 1ULSA 5AK0A 3EYZA 4FLMA 1N1EA 3GJYA 3KDSE 4KO2S 1M1NB 4DYDA 1Z5WA 5CPFA 5L9XA 2IEAA 3CH4B 5KWVA 3E9ZA 3EVTA 2X5NA 3KWFA 3R09A 1JPJA 3TLEA 5JZMA 2B8JA 4EF6A 3QVLA 5LB2A 4ABTA 3BYZA 3FTQA 1AUQA 4F4YA 4KEAA 4PPQA 5IU6A 3OKAA 5K99A 4YNBA 3FVRA 1DC5A 1S96A 1Z5UA 3EEYA 2XDQB 5AD1A 5B66U 2YWBA 3W8RA 1X8LA 4JC0A 1Y4UA 1AB5A 4JYZA 3G0GA 4NBSA 2DFKB 5MGNA 1RAIA 3LX4A 2YXPX 5D86A 5K4GA 5J23A 1NBAA 3JVVA 4YP5A 3E5RA 5EC8A 4WCDA 4ZVNA 5A3VA 1QP0A 5CUQA 1U9LA 1RXIA 3F4BA 2O8DB 1PBNA 3SQMA 5IDXA 1DV1A 3M4XA 1PEAA 5GQSA 1P1KA 1KBQA 3NIWA 3VJLA 1Q3VA 2JJ1A 1HORA 1A0PA 1SCDA 1TPYA 5JSKA 3UWOA 2F1RA 2PWZA 4KAFA 3L6OO 3TL6A 2OLKA 4R1LA 1P0FA 3UAWA 1JBEA 2JMGA 1RAHA 1YQTA 3OPYA 3VNRA 4ZFNA 4C7OA 4KQ6A 2R8ZA 2FLPA 2RGXA 3NHAA 4IMIB 2PL9A 1QYVA 4ZMRA 5EE1A 1GCGA 4MR8B 4BO1A 4JODA 4DDMA 1YJAA 4XWAA 3AVUA 4GPEA 1EDZA 3OT1B 4A4DA 2HLPA 4LJ8A 4GXIA 1E1QA 3QU7A 4UBOA 3TDKA 4TV9F 3TMKA 2M6RA 4F46A 1A8QA 2CL0X 3M70A 1E3JA 3BZCA 5EIHA 4Y2RA 3G6VA 2AEJA 2YDXA 1NN1A 2I2AA 5TEVA 4F50A 5EJ6A 1YC5A 2EW1A 4JENA 4ZCPA 4KO1S 2CYAA 2NQ8A 5E0KB 1KDZA 4J7XA 2E8OA 1RXCA 3GU3A 1ESNA 2X0EA 3O82A 2PLNA 1OY1A 5F21A 3ZDZB 4BNNA 1N3LA 1V3TA 5ARCA 3GFBA 4LZAA 4LHSA 5BV8A 3NRJA 3RM3A 5ITSA 1NWHA 1ZFNA 1QNLA 2XMRA 1EDEA 4MINA 4Z1OA 4OFZA 2XVXA 5CGQB 1BEEA 5CDGA 3EZNA 3K5PA 4NX2A 4OFXA 1JAIA 3WQHA 1G59A 3FF1A 3Q40A 4GR5A 1ZJMA 2ZRCA 5DWVA 3TADA 1PJ2A 3I32A 3DBLA 2P1RA 3MAAC 4ZK6A 5C8DA 3TAUA 4DLVA 3D0RA 3DV9A 2ZJ6A 2FEMA 2ZRKA 5FBRB 2C4KA 4W7IA 1J8DA 2GLUA 3U4DA 1DJLA 3T7SA 2NP6A 5KG1A 1OQAA 2DR3A 3BK2A 3K5HA 4LX8A 2F8LA 4MWDA 2DHCA 1UCFA 1NYRA 4X1YB 4IGEA 4MI6A 1BCSA 1QGDA 4M9RA 1A82A 2XGSA 3RS8A 3L1KA 1F6DA 1OXJA 1ZJ4A 2ZTHA 1UJNA 1UT6A 1L7DA 3GJ3A 3IRUA 3O0DA 2WDPA 2PSSA 3WS7A 4UTVA 4TUYA 2M2IA 3AL0C 5D51S 2X86A 1CUIA 4K8RB 3WFZA 2WWTA 3NYIA 2JHDA 1WIWA 2P8SA 1U2GC 2JHAA 4HWPA 1DXHA 2P3LA 4FWBA 4JBLA 4GEKA 4MWBA 3U7RA 4JT4A 1DS6A 4NHEA 4IH1A 3BE5A 3L5OA 2DR0A 4YHHB 4CIVA 5AT1A 1O8BA 4JN6B 4RPIA 4KX3A 4JJ4A 3VSDA 5H59A 5BQFA 3L2OB 1KEVA 1U6IA 1T3GA 3N5CA 5AMXA 1NJ5A 2WLTA 3Q8LA 3ANLA 4O4HA 1PDOA 5M5BA 2BFOA 2C4VA 1D9ZA 2Y0EA 2VBGA 2YJNA 1UXGA 2REBA 1CUYA 2JJ8A 4YRFA 3SBEA 3M81A 4MKHA 1C8KA 5LQDA 1ULTA 1LA2A 5J2IA 2H51A 3DVLA 3G2JA 1QVAA 3L02A 3QGMA 4UQGA 4KBGA 4XWGA 4X1YA 3UY4A 1ZD5A 1QO0A 2WIDA 3THXA 4JQCA 4D26A 2WPDA 2V7XA 3NGMA 3QPWA 5KNIA 2WG0A 4XWOA 1T9KA 3GLUA 3H13A 5KCMA 5A04A 3LUPA 3DWIA 4HF7A 4QGGA 4O4LA 1JQBA 2BCGY 2QLFA 2XCLA 2ZJ3A 2BEKA 3PPWA 1WUIS 2P0YA 1DIBA 3KKZA 3R3HA 4DGSA 5CB0A 2W6ZA 2A1UB 4MGZR 3ZGVA 4CKEA 2X0NA 1J5XA 4GSLA 4HQRA 5BSTA 1HFKA 4DTIA 3FJOA 3OSUA 3MD0A 1QCKA 2CVQA 1H2YA 3ID6C 1Q16A 1CY7A 2CWDA 4G1VA 5HS6A 4O02B 1CVIA 3P4XA 2ZDGA 1NW6A 2CZCA 3R9KA 3H7AA 4FQ7A 5B30A 1TJYA 2HRDA 4YP0A 5DE3A 5K3DA 1XVUA 2ZPAA 1Z2OX 3NDRA 5H3CA 1P77A 2CEAA 1Z7BA 2NADA 1ODCA 2Q3HA 4GI3A 3WGMA 1VL1A 1IB6A 1G17A 4AMGA 4IC9A 4DSJA 1MJFA 4BIMA 2ZSIA 3PV0A 1C20A 4XM0A 3TTTA 1DTSA 1XFDA 1I94B 3BJRA 3LF1A 1ZIYA 3IUNA 4WFKA 5B7PA 1HZZA 1QO7A 4X7MA 4UU1A 3E9RA 3UAVA 5AM0A 4JBYA 5EHNA 1CJKC 3WGKA 3R5JA 4MPJA 3W4IA 4D0GA 2PYDA 3VC2A 2H59A 1EE9A 1TQHA 2PKQP 4YEDA 2WUWE 3V2UA 3GZTB 4ITVA 4HYTA 2E2WA 2QMOA 2LM1A 7ICJA 1G8AA 4QU9A 1JAHA 1IN1A 5KSYA 1UFRA 1YS1X 1W96A 1QZTA 3PHJA 4Q3OA 1M74A 3DSRA 1AGYA 2VBCA 2CVHA 3EJWA 3N8HA 2Q9UA 2IS6A 4IAOA 4I8IA 4KFTA 1PJLA 1YRAA 4MW4A 5BW6B 5T8KA 5ALVA 1RJ9A 3L4SO 2Z8YM 3P32A 5EP2A 2VNSA 4URFA 4OHBA 1YB4A 1PUIA 2BCRA 2FZLA 3MBKA 1SBNE 2ABWA 1EVLA 2VP3A 3M3PA 4FJ0A 2ZUVA 2Q7DA 3FHJA 2ESEA 1D8YA 1Y1SA 1USUA 1P5JA 3AF3A 1OXBB 2IPOA 3GIWA 4C8LA 3GOQA 4F6RA 5IWAB 1PWZA 9ICQA 4TZ0A 1KVRA 2JCSA 4WK6A 4LDPA 3H4IA 5DM2A 5IM4F 4OSOA 4JYCA 4QZDA 4HLNA 4U8HA 2GEKA 3AH8A 4I5FA 3IEVA 1NX6A 1T1RA 3KL2A 1MAHA 7ICHA 3BS4A 5KKCA 1H8HD 4WZBB 1G7SA 1ZJWA 5KT7A 4JL6A 2NX2A 3SZLA 3U40A 3HCNA 1KSFX 1CJVC 4Z7QB 1JDUA 1WUDA 1CUVA 3ENVA 1XKXA 4YMOA 3MSXA 1DK2A 3RBEA 1EDOA 2NSLA 4YJHA 4D3XA 2DCUA 4BYMA 3KKPA 1B0XA 2XMDA 4ZQIA 5K03A 1BDJA 4J0IA 4NE2A 3MJFA 5EWMA 3OJSA 2V4ZA 4MI3A 5JISA 1QHFA 1CRPA 1Y34E 3Q0TA 1NVTA 1QLHA 3H1FA 3UPDA 3SJUA 4JX8A 3QK7A 4D9KA 1W36D 3TZCA 3CTPA 4UBBA 1UBGA 2KJ9A 3ST7A 3AU9A 2I7VA 1MNQA 4X20A 4NP6A 1FDVA 3EGVA 4ZICA 2WSMA 3VPAA 3ESXA 4J0FA 3L0PA 3P2JA 1Z45A 4HYQA 4OREX 2NTJA 5F64A 3DLTA 4F5EA 1QOPB 4YUXA 3L1JA 2CDAA 5IFLA 3ZJYA 1ZPDA 1U3CA 4BC1A 2KYRA 3C3DA 1QRAA 5IKPA 5JSUA 4CDNA 3BFPA 2A57A 2QJFA 3IEPA 1AHIA 2C2KA 3SVLA 1JKFA 3H8VA 3DTTA 1J9ZA 1O6CA 2J6IA 1FA9A 1PL8A 4GOOD 4GLFA 1S6YA 2H3IA 3COJA 3ON5A 3PGMA 4B80A 2VJKA 2DTEA 1FRZA 4EHDA 1JQ5A 1SCNE 1D8BA 4US1R 4WKGA 3OE7A 5IX8A 5KG5A 5KC9A 3TF5A 3MGHA 4JP8A 5DI3A 5G0UA 3V8QA 2W48A 2CVPA 3OOYA 4JA0A 5GZ1A 2EZZA 1U2ZA 3B5IA 3GNQA 4J94A 1CTQA 2OM6A 5DRYA 3FNQA 4C8NA 2O1SA 3GJXC 5FQNA 4JC8A 4H4EA 2VQSA 3FKQA 4OB6A 4XWTA 2YQ4A 5CVUA 6REQA 4UHCA 1ITZA 5JQWA 2GH1A 2AZTA 2KLHA 3CO5A 1U5BA 3P0JA 2IUYA 5FOXA 3SEAA 3A6GA 1QF7A 5EJMA 3WU2U 2C4MA 3VOBA 5KFNA 5JZ9A 1ULBA 4WXPA 5L8VA 2QZPA 2A1TS 2VG8A 5EHQA 5IEBA 2ZLBA 4BMYA 5JBNA 5K3SA 3GLTA 1QRUA 2HXGA 4KLTA 2IXTA 1N2ZA 1U28A 2BPOA 2KSQA 2H2WA 3U7HB 3QNMA 1TIPA 2WUEA 4JI3B 4KXNA 1HFEL 2BGTA 4JR0A 4AY5A 5IJ0B 1NDHA 2Q3MA 1W85B 2P7IA 4X45A 3SKVA 4OYYA 5JYDA 2JI9A 2B92A 4GM0A 4Z8XA 1Y8QA 3KHKA 2ZIVB 4L3OA 3C3JA 5AVZA 5LJIA 4MWGA 1SUPA 5KQPA 1T1IA 5KREA 1GSIA 1ZMOA 2RC6A 4QGAA 5JZBA 4UUOA 1JXAA 5IANA 4GZ5A 4IFBA 1O5IA 3KKQA 4BKRA 2O54A 4V0QA 4ZOQI 2FP4B 3T7JA 1KIAA 1M73E 1YR3A 3I73A 4LGCA 5IMBA 4U6PA 3M83A 4PAWA 2O19A 2P75A 5HCIA 4DG8A 5J29A 5DDMA 1R4MA 1E6WA 3ZV6A 3JALA 9ICOA 4GD3Q 5JYCA 3N2EA 3PDHA 1GEGA 4KXVA 5TVKA 3PBKA 4ZT5A 4DY4A 2WUVA 4F3CA 4AY2A 1L3UA 2AN4A 4P0PB 4MGHA 5DNDA 4B4UA 3IV7A 3C1TA 2HHLA 3PB3A 2H1SA 5HR7A 2DERA 3DUWA 3X1DA 4B0PA 4K6HA 4NFHA 3SOZA 3M6VA 3TOVA 4M7WA 3F5EA 4EDFA 1T3ZA 1U9CA 2GO1A 4EKNB 1EWKA 5A6SA 3LM8A 3GYBA 2Y0PA 3ZLUA 1M83A 2GJ9A 3GGCA 4OGKA 5KFOA 5LZ2A 4IQTA 1BVRA 3AVYA 1W4LA 5TE9A 3L7KA 1N5KA 3BULA 4E5DA 1OFIA 4JNCA 1I2BA 3KU4A 1Q0UA 3AHIA 3IESA 4RIIA 3GAMA 2W9CB 1L5NA 4C4XA 2GTIA 2H4HA 2OFOA 2YJTD 3F71A 2XNKA 4HYEA 3CG4A 4LC9A 4C4PA 1GT6A 5DG7A 4DFJA 1V5EA 3EPJA 1HO3A 3KELA 2Q8PA 5K1ZA 2CLIB 2O5RA 2FU5C 1RG6A 1B6GA 1EFKA 1T9GR 3G3EA 3OTHA 2RD2A 4W4TA 3G9UA 3C0KA 5CM2Z 3RTDA 2V9WA 3NT2A 1CEZA 4QOSA 2UYHA 2W6MA 3A3KA 1K0UA 2WZDA 4GQAA 4L8FA 4JSRA 4H0FA 3NYQA 3K75D 4J1TC 3LX5A 4TLMB 1CQJB 4K6GA 1E2PA 2VK4A 3N87A 2DR2A 3VAYA 1XTSA 3HWTA 3JQFA 1ZP6A 3G0BA 3DP7A 3GO4A 4OP2A 5TQ0B 1TFRA 2RAUA 1QHGA 3INYA 3DC2A 1H6CA 5COBA 4L4UA 3I5XA 2QDXA 2W9BB 1Y8QB 1ZHFA 2QAGC 1SVNA 5EOZA 3GFSA 2ZYTX 4TVKA 4KPUB 5M3BA 5ETJA 1XEWX 2EGUA 1A9PA 7ICTA 1J8YF 1E9AA 1IG0A 2BOVA 3CRQA 2XYQA 3DDWA 3H1EA 4NECA 4WNYA 4ZVLA 5EZSA 2A5FA 1FYFA 3HR4A 3F98A 2V4RA 2F2TA 4LHYA 4WGFA 4JV0A 2PMFA 2HIAA 1W87A 4P2BA 5JEDA 4NU0A 2C83A 3AIOA 3GJ7A 3RCBA 3STVA 2XYPA 2EAOA 1Y3BE 2ZSBA 3OIYA 5CK5A 1XDWA 4Y3UA 2WF5A 1TLFA 2SKEA 4A23A 1PQ4A 2PH5A 1IZZA 1X7WA 4ZVTA 2AI3A 2XQIA 4QZAA 2Z98A 4LNUB 4MX8A 4GMFA 3SI8A 1YQWA 2VYVA 5FPTA 2IZOA 3WKBA 1QKKA 1SOMA 1ZRHA 2YASA 3HZZA 5ILOA 2WC1A 2QTNA 1PZGA 4KN9S 1DAGA 1M1YE 3ROGA 4UM9D 4E0BA 2ZXIA 1R4AA 3F97A 5DBIA 3PNBA 3S99A 2FUG6 3D2BA 3DHVA 1CY4A 1FRQA 4MW5A 1J9GA 1H2EA 1NIJA 1XD8A 2GILA 1TCAA 4B6GA 3ZDCA 2ISCA 2YIVX 3FGOA 4RGVA 2PBZA 1VE5A 5D1NA 1CWUA 5JD3A 2Z43A 3HLTA 1ISPA 2ZYVX 1QHYA 3AUKA 1U49A 3MT9A 4C0ZA 1OB2A 4LYFA 3JPRA 3H1BA 3ZR4B 4UMEA 3F6CA 3QZ7A 3BIWA 4WESB 5LLDA 1GGKA 3U7JA 3WRXC 1GIAA 1DLIA 1FJHA 1SK8A 1XB2A 2EL7A 2RCNA 4AYBF 3LMKA 3OF5A 8ICLA 4MQLA 1QRTA 4ZVSA 4CCAA 2QTVB 1C8BA 2QTVA 2BRUA 1VJ5A 4KHZA 4A03A 1GARA 1XD9A 2JFQA 4I9HA 3E70C 4WINA 1WXEA 3VJRA 3MJSA 1U4NA 4KBFA 4F45A 3G2LA 2EVWX 4O63O 1SOUA 2XKAA 5DXJA 3VGPA 2QRKA 4H3SA 1LVGA 1QIJA 4J2TA 3EDOA 4ZYLA 1GLNA 1EVJA 4ED6A 4U9IS 3WKEA 1DC4A 2ODEA 1AZLA 1P1IA 5LSAA 4IZOA 1LI7A 3OHBA 4RNOA 3E5MA 3FSRA 5BPFA 3BTOA 4F2WA 5JWOA 4NLGA 4KJXA 8OHMA 5A5EA 2IITA 2XIJA 4CE6A 4RGBA 4RZSA 2IHJA 5A0TA 3CNBA 4RMHA 2O8VA 4DMHA 5KFZA 4EZ6A 3MGKA 2R18A 4DCSA 1J0EA 1V95A 3PPYA 4NATA 1K86A 4GZ6A 2C1ZA 4IV5A 1U6JA 3LQ4A 3RAPR 2G9NA 3AUAA 3CZAA 4QUJA 2QRVA 1RM6C 1JXOA 3NVZA 1UKAA 3FTFA 2RDJA 3ETDA 2AGQA 3HJTA 4LJLA 3Q6MA 3BBLA 4GX2A 3SIXA 4NJOA 1IBRA 1TTHA 2J07A 1GTL1 1HT2E 2KW5A 3MIZA 3AEQA 2FG6C 2EWWA 4HZUB 4X6LA 5CEHA 1NZDA 5EHGA 2GCNA 5TMPA 2NT3A 3U9LA 3UK7A 5CVTA 1M7GA 3PCTA 5FH9A 2I55A 5JNTA 3U4GA 1P8JA 3KJXA 4M2YA 5JH7F 1G1AA 3O4RA 5KEIA 1MGPA 3H17A 3I01M 1GTVA 1NC3A 3GMTA 4N4AA 4QHYA 3WWCA 3BS5A 3H2HA 3KR9A 4Y6QA 5I9MA 4QT4A 1MHTA 1TZCA 2FE1A 3DHWC 1W48A 1P2SA 4E5MA 4F6LA 1I5RA 2H4JA 3TVTA 3OZFA 3QVXA 5IC5A 1B0ZA 4JVOA 2VXBA 2VDVE 2NUAB 4BNDA 1X1SA 4WXMA 1P9OA 2AVNA 4DS4A 1QHNA 1VGRA 2HC9A 3S5UA 2HOQA 2YBEA 4F3KA 4KLSA 1RXVA 5C1DA 1SKUA 4IH4A 5JCZA 4HOYA 2IHZA 4K46A 2X14A 5BWBA 5BNWA 1BCRA 4BZZA 1Q0TA 4JOQA 3MUOA 4ZAVA 3RH6A 2PKQO 4N5LA 5G5GA 1EDBA 3D4OA 4XCVA 1YJXA 2JLRA 3KB1A 4RHCA 4HX9A 4QATA 4ASUD 4ZIRA 4DDWA 4DOCA 5ALIA 1KDTA 1AKNA 2W55A 1E6CA 4B5LA 1NU8A 3CE6A 4NKRA 3WMXA 5IM4A 3C3BA 3MMZA 9ICLA 1ND5A 4B45A 3NWOA 2PQ6A 3HWRA 3MLAA 5FIUA 4ZEWA 4B34A 3BCHA 3OPNA 1RLJA 5I8ZA 4E1AA 1S0VA 5F3XB 2PM8A 2QM0A 3NC1C 2QSJA 1MBZA 1RKQA 1TI7A 1Q77A 3E22B 3PQ8A 4GLJA 4M3NA 4C5BA 1Q0QA 7ICNA 5A71A 5FWNA 3NAGA 2XVZA 3O26A 4FOSA 4I6EA 3VO1A 5FOQA 1POXA 2YW2A 4RLHA 3ROZA 5BV0A 2EKPA 5J8YA 1NMXA 3N7RC 2G5IB 1YOVA 5E4JA 5KTPA 1N7GA 5DI9A 4GNRA 1THMA 4HNGA 2CHUA 2R8JA 4FZVA 4RETA 4W1PA 1FDTA 4AZSA 4I1PA 2LYBA 1H4VB 1EUCB 3HBAA 2D06A 4HDRA 4O4LB 4DCVA 3NHZA 4CM1A 5ES4B 5LQMA 3RS3A 1DXQA 4O6VA 3AR3A 3PNVA 1WQ1R 2Z7JA 1R6BX 3MUEA 1M1UA 2EAUA 1QDLB 3FMOB 3TFOA 4HFJA 3ZIAD 5BNZA 2ATCA 3MTBA 3QF4B 4JI7B 2BFMA 2R2AA 4DMMA 5KAMA 1D1PA 2ZWAA 3B5JA 1O94C 3ZTYA 1KFKB 2O2ZA 3WB0A 2JI7A 1GNLA 3ACDA 4OMUA 5CCBA 5LMNB 4ELTA 3LUJA 4DPLA 4MMXB 3B1XA 3A0RB 5CFZA 5EZ6B 4UXHA 4YT8A 4BCCA 5KB3A 1KAOA 2RGUA 2M32A 2OO3A 3EOBI 4L5AA 6PFKA 1J22A 5K3CA 1XC7A 4JY7A 4FHEA 3GY0A 3UH0A 1ZBQA 3JQRA 5CHEA 2ZIVA 3KTFA 2B5OA 1OD6A 3E1GA 3R6TA 3FZGA 2E4YA 3FNFA 5T6BA 2VS1A 1XRMA 2EFJA 2JGIA 3H9BA 3LCMA 4KO8A 1W85A 2C7BA 2GCEA 4PC3A 4TLDA 2G1KA 1ZXIA 4G5QA 1C5KA 2J67A 3L0OA 1X15A 1US8A 1MSWD 2HA4A 1U0HC 1GRVA 3JQGA 4YPVA 5J4KA 1OBOA 4K9DA 1S5LU 4RVGA 1BJTA 3H0EA 1IZ7A 4NMWA 2V7PA 3WK9A 2WJHA 3R20A 3R4CA 2V7QA 1W0KD 4I99A 1WD7A 4KIJA 4QGFA 5DDIP 8ICAA 3AMVA 5CP8A 5GMOA 3UJHA 3BWDD 3H4TA 4RVSA 1ABEA 1RC1A 1Q15A 1LS6A 3ONFA 4C0LA 1D2MA 3M6ZA 1S7GA 4LY6A 3BMNB 1UADA 1VM6A 4QDZA 3CRXA 4P32A 4IJQA 4AJ2A 2NPIA 2Y1EA 4BNVA 4D79A 1LLDA 5EJFA 3UJ9A 3DHEA 3GFKB 3QYFA 5A06A 1I0LA 3MDCA 3AU6A 2UU9B 4MGKR 3OIGA 5PNTA 3E5HA 3LECA 1OPXA 3A6EA 3FMVA 4NQZA 3TH5A 1SVUA 1TL7C 3T3FA 3WYCA 2WQ7A 4Y2QA 3LVBA 4BWYA 1FBNA 4JQOA 1EIWA 3LVRE 2G76A 4DREA 4INJA 3M3DA 1XDSA 3K1AA 3ONNA 2WR8A 3QQPA 5G3YA 4EB0A 3HCFA 1D5CA 3OZ7A 2SKCA 4R1TA 4UVEA 3IAUA 4Z7JA 2C94A 4AMZA 3Q6NA 3TD6A 4B6PA 1BO6A 1NBWB 1CCWA 2H2IA 1PF7E 4RZQA 3K9CA 1K08A 3OQPA 1CUUA 3H42B 4XSHA 4BQEA 3MWYW 4U7PB 3CMCO 5FWDA 5ALFA 4DLUA 4ES6A 4EG6A 1AKMA 2J32A 1GQQA 1LI4A 3CC8A 4GXRA 4OLJA 1EP2B 3ME5A 5TARA 4PS0A 3HR7A 4KB5A 3DF9A 1X6VA 2KHQA 3DM5A 3RYIA 1IOWA 1DKPA 4XB1A 3OQMA 2YJGA 2HBJA 1JH9A 1KOLA 4ZXPA 5D5HA 2Q5EA 1GZ5A 3GDFA 4G0OA 2V55B 3IULA 3W6UA 4JGGA 1OGIA 2PZKA 1XXLA 4R0MA 1P4HA 4N41A 5FFNA 1X80A 2PTGA 1UBCA 4DBVO 3U26A 1RM0A 4NL9A 1BHO1 1GPAA 2RB4A 4CV2A 4HRVA 4DFPA 1MQ8B 2XVMA 2H1FA 2OO7A 4CCSA 4XSVA 1PFQA 4POAA 2GQ0A 2WTMA 1C0IA 4XQGA 1U48A 4I50A 4LV8B 3JQ6A 1E0JA 3UJCA 4R05A 3PXBA 5HYVA 3LXRA 3VTZA 5CFNA 2IZ1A 3N97B 2H57A 3RUPA 4FFOA 1ZY2A 2NO4A 2NRXA 4X71A 1PT6A 2XMBA 2Q2OA 2WD7A 2Y6VA 3IVCA 2GOYA 5KL8B 1RI2A 4RMJA 4RKFA 5HQJA 4QE3A 1TQDA 3BTVA 1JDNA 2FPKA 2J0EA 4ZVQA 3MEQA 3OFVA 4QHSA 3L8HA 4BQFA 4EFDA 4DLWA 5GVRA 3N2NA 5I7EA 3EVAA 1K4MA 3P9PA 1WZCA 3DV2A 1WG8A 1KEUA 4EJ6A 1NQTA 1GA4A 4USAA 4L4SA 1JJIA 2VHJA 5KFTA 1IHPA 2YWEA 3TLGB 4BP3A 4YRSA 2H52A 3FUUA 3QKTA 3PDIB 2ZT8A 3R5FA 3SAFA 1V47A 4G26A 1SCUB 4KSYA 4YECA 4CUJA 4EYSA 4KAXA 3VSAA 4INPA 4JWMA 1L2TA 4X91A 3D64A 1RWKA 4K2HA 1D2EA 2J4DA 2P7HA 2OECA 5DXAA 3D5EA 4EG4A 3RUHA 4N5MA 3NLLA 3JRWA 2GXQA 4KLZA 5K2OA 1WUJS 1QQAA 1H4QA 3FCCA 3VNBA 121PA 3P2EA 3UXYA 5B7GA 1Z34A 2GBCA 5DASA 4J0GA 4EGCB 4MUNA 3G2NA 2VTBA 1RZVA 4HNSA 5FORA 2GNAA 3C21A 4WLUA 4YV1A 16PKA 1NVKA 4BLPA 1MJGA 2C54A 4YRTA 2TMGA 5DBAA 1UP4A 2K87A 4K7JA 4EBCA 2ZXEA 3SC4A 4Q7JB 3C4VA 4DG9A 4LC1A 5BN5B 1TA9A 2YZKA 1KZ1A 3E9MA 3FNGA 3EIXA 3PT5A 3L9XA 1Z5VA 1V2HE 4Q19A 1XT6A 3N70A 2I6XA 4K9LA 4L0CA 4ZDKA 2KZMA 3KQWA 1XNHA 2I22A 1RAGA 4ZI7F 4GWGA 3T34A 4X44A 2JDIA 4GC9A 9ICFA 3OE7D 1Q0RA 2CXQA 3MLBA 1KK2A 1P5ZB 3S40A 4EO9A 4I9NA 4O4LF 4BX9C 2DECA 3V4SA 1N77A 1R5JA 2I1QA 1SCQA 1JEDA 2I8CA 4M9XA 5AJYA 5LBTA 4BVBA 4PO3X 2W6OA 2J46A 3L49A 3FHTA 4WK2B 1ZOIA 2IKQA 1D6MA 1IK4A 1IE3A 2IXDA 5ER6A 1I14A 4LOJA 4A2WA 4PAGA 1PQPA 3UPTA 4BBAA 3LCVB 2GD1O 3F47A 5I8WA 2I2BA 2IODA 3QPAA 4Y7CA 3IUBA 3PC7A 3UNXA 5LIPA 3SC6A 1QYWA 4JV1A 2IWRA 1ZQ1A 2BFBA 5HSGA 3Q7QA 1RPTA 2WSIA 1CV2A 1JMYA 4DQRA 4OJOA 1Y6QA 1DAHA 2H3HA 4RF2A 3O8LA 1V45E 5DHTA 1DOHA 3NJRA 1S89A 1HPLA 1PNRA 3UFXB 2YUTA 3MN1A 4OIFA 4MW0A 1KQQA 1JIHA 3GIMA 2QI9C 3ANXA 4JIGA 2W2PA 4DL3A 2OKGA 4FDTA 5DT9A 4F86A 3U6KA 3RTGA 4GRAA 3J81A 2KOBA 1W36B 2LKDA 3LIPA 3EN0A 4WW0A 4CM9D 3HZOA 4J16A 3S81A 4FGUA 1LDBA 1XZJA 2WABA 1RLTA 5FNVA 2YFHA 2CV2A 3CN9A 1PR0A 4OAQA 3WBKA 3QF7A 1W2WB 1GSAA 2WG2A 4LHXA 1ZM9A 2Q45A 4WA7A 5EIFA 4B83A 4XYLA 2Q29A 4A0QA 1X2EA 1X86B 3G89A 4EUKA 3MOSA 1HL3A 2GS9A 5DM60 4V2IA 2A8YA 4IMRA 4Z86A 1X9IA 2E8NA 4XUSA 2CC2A 2XDWA 4ITRC 1RCUA 5GJVC 2GZAA 4XVQA 1RQ7A 2CLDX 1GP2A 3LGAA 5CJPA 4BECA 2NSHA 1GSOA 5DW3A 1SXPA 1P19A 1WSAA 1P2VA 4Q1AA 3V6LA 1NC1A 4TOIA 4GWKA 2XNDA 1OJLA 2GN8A 1WCLA 3SM9A 2OXOA 1G21A 4B3XA 2P9GA 3IPXA 4QZCA 5J9FA 4LXXA 3M9LA 4GVPA 4RT3A 3LA8A 2EC5A 3D1LA 4RWEA 3A37A 4N40A 4W5HA 4B71A 2LW7A 2VP2A 4QQFA 5T41A 2NVUB 3LPMA 4PV7A 3VTAA 2ANBA 1YE3A 2EJUA 3BWYA 1PFUA 3F7MA 3PUIA 3RRJA 3A7DA 1GPDG 4F9FA 3LX6A 3SGLA 1P72A 4FKZA 3OWHA 4W8OA 4XVRA 3T94A 1KVUA 2B37A 1O8CA 3A1UA 4IJVA 4MQUA 5E1OA 4EFMA 1I32A 1RI3A 3SIWA 1RR6A 3AXTA 3A7EA 1FDOA 5FNVB 3BQ7A 1WM1A 4U2CA 4QFMA 7AT1A 4Q4DA 4R1QA 4DWJA 2IUUA 2VIIA 1HMYA 3F74A 2BM9A 3RQIA 3QUQA 5C1OA 3TW6A 1TVKA 1GAWA 4J9LA 1OTHA 1YQ9A 1ATZA 4Q7KA 3FUWA 4GFJA 4FE3A 3LQQA 5IXYA 3FDXA 4CIBA 2VJQA 4JSYA 3LK9A 5AHRA 2IGBA 3JSAA 5BSRA 4NJMB 4ER5A 3MSCA 7ICSA 1IRXA 2P2CA 3DT6A 3ZZNA 3IAAA 3HA5A 3V4ZA 1I33A 3L0IB 3WGZA 4Q12A 4B6FA 3OQ6A 1U1EA 5EVCA 4LJXA 1D2RA 2KE5A 2BF7A 1YFZA 4HD8A 3DDNA 3BWXA 5D5QA 2JHGA 1T9BA 3LXMA 1RSZA 1Y8RB 2LIPA 2R8OA 3UQ2A 4BEJA 3CPHA 4ZZ2A 5HFAA 3RRBA 4ARZB 5F5LA 5IXSA 5AM1A 1I9CA 3GEIA 3ETRA 4O4JA 2IHNA 2L42A 1L5RA 2W98A 1KJ8A 1OFVA 2HHTA 2YWXA 4TV8B 5IK2A 1UEJA 5I48A 2VHUA 3K4QA 4F7DA 3I2HA 1XNQB 5KVAA 1ETUA 1BXGA 4QDJA 5JS8A 1OWOA 2ZCVA 1S10A 1XZCA 4GSKA 4PY2A 4UMDA 3QEAZ 2WOOA 2IL1A 1RIFA 1ZH4A 3N2YA 1X7YA 3R5HA 5KYTA 4ECEA 3DMFA 2G1AA 3BH7A 3MR2A 1KFSA 3OUTA 3DS8A 5K51A 4TXHA 4Q9JA 4JEMA 2R6FA 3AG5A 4DIFA 5BVHB 1H0RA 1WXIA 1PD1A 3KOXA 1C9EA 3DGEC 5D7BA 5H68A 2CE2X 5G1PA 1EK2A 1JJVA 5FOUA 1QHEA 4RK6A 4P80A 2XMCA 3S4YA 3HGQA 2QORA 1X13A 4U7CA 1Y0BA 3W2EA 3LI2A 3B6EA 4XE5A 2Y71A 3PFFA 4Q02A 1L1FA 3GROA 1ZJNA 3U7QA 3OCCA 1DWUA 1SD5A 2B2CA 4W1SA 4UEWA 5DV9A 1SKBA 3CEJA 3DOEA 3DTNA 1LLQA 4MHOA 4BP8A 1RMTA 2QN3A 1K9SA 2KHZA 3IURA 5BMOA 2ZTUA 5H4GA 1YR9A 2GN9A 4LF5B 2AGVA 1R18A 3I6MA 4XFDA 3C87A 5JFOA 4CIDA 5CHGA 2B4KA 3E4DA 3IJEB 4F4UA 3L7NA 1X1DA 5A3QA 1JDZA 1RLIA 1O03A 2O1EA 5HW0A 4D8VA 3DEHA 4ZV7A 4DGQA 2HHHB 2B4RO 5FFFA 1CUBA 1EZZA 5FFMA 4KR2A 3QOXA 4IIDA 1BTOA 5KDDA 3DB2A 1ZGBA 4KLCA 1T25A 4I1SA 2YOHA 4P3PA 1KJ9A 1G7TA 2A1TR 4HAVA 3OF2A 2R62A 4QO7A 1IQ0A 3U0BA 7ICGA 5KFRA 1J2YA 2PO7A 2WD7B 1KSGA 3UMSA 1FFHA 1EFPB 3PCRB 4JLBA 1C81A 2RHRA 1X7WB 1SHZA 1JROA 1UUFA 1PVPA 2F1OA 3GGDA 1TIBA 3HJGA 1IATA 3ZXSA 4QWCA 4AP5A 821PA 3I0NA 1MPTA 2G72A 3ZWNA 1VRWA 4I4TB 5AM3A 4C04A 5U9CA 2IDMA 4RL6A 4PLFA 1N36B 1JPVA 1Z2AA 2D3TA 1L7AA 4B3SB 2KJ5A 1RTKA 4ZWNA 2MR6A 2QW0X 3H86A 2PXAA 4ND1A 3ZGNA 2R5FA 3F7TA 1KP2A 3D7SA 4URYR 2Y76A 2I5PO 1T7PA 2BDUA 4HGRA 2AX4A 4BNXA 2WYOA 2Z6VA 3E58A 3DMHA 2IXFA 3WGNA 4ZYZA 1IUNA 1JG3A 1WVGA 1WW8A 3Q7SA 4UB1A 3P45A 4RH0A 1OLSA 4LFCB 5KFYA 2WT8A 1T3LA 4PLZA 2XB9A 4OQLA 1G8JA 1PO7A 1EVYA 4O25A 1SZJG 1WKCA 3CG0A 1HT3A 1PGQA 3UZUA 2X6QA 4TKMA 1JDJA 4TT3A 2E18A 3EOZA 3NKLA 2WQZA 2NV6A 1TYBE 1RYSA 2XRFA 5BYBA 4CT5A 3SQXA 4PIMA 2NYAA 4DC0A 1L3TA 3VQTA 5KYWA 5ALSA 7ICQA 3JQBC 1M7HA 4OO3A 1IMJA 1KEPA 3C6YA 1Z6PA 3KJEA 4FX2A 4E13A 1G20B 5FPYA 1J6UA 1N78A 1F1BA 1G3QA 1YMVA 2WE8A 4HX2A 3LIIA 3PW0A 2B61A 2SHKA 2WJIA 5C8VA 3VOAA 2W3RA 2AUMA 4XI9A 1E2QA 1QGZA 4P93A 2XRYA 3HWX1 1NRWA 2RH5A 1B93A 4PE5B 3UHOA 1JEYA 1JEYB 2M9NA 2JLWA 3RSHA 2HNAA 2DTXA 2ENWA 1J70A 4FYPA 4GOKA 4ZGGA 5J47A 2HAEA 3EMBA 1NKVA 3RTAA 3V2HA 1MW8X 5JPIA 1A9RA 3VR5A 4RJTA 4JLUA 2YNMD 4GLLA 2H3FA 5A6SB 2XB8A 3VR0A 1IDN1 4B8ZA 5L1JA 4GDMA 2PL5A 5A0FA 3KZVA 2CXXA 1U1DA 2OV2A 3T0FA 2XE6A 3WL5A 3WQRA 4LOLA 3IMFA 4YRPA 4DSEA 3DTVD 5KTQA 2LVBA 1CQIA 1A4RA 1VIDA 4YAWA 4AVYA 2HSWA 2BKXA 4FSDA 3DAGA 2R8PA 3PJRA 4EG3A 2ID7A 2PGIA 2VLBA 2HJGA 4YRAA 3MR5A 4YP9A 5DGBA 2PHZA 4N5HX 3STUA 3CGGA 4OKSA 3I52A 4ZJPA 5KTMA 4BB5A 1UJBA 1E69A 1PR4A 1RHUA 1QAQA 2TECE 3B60A 2OHGA 4HFRA 5F23A 1XX6A 4ARVA 3PLAE 2C59A 1J2UA 5KFJA 1QV6A 3IXLA 4EGSA 5KDOA 1BPEA 4E51A 3OEYA 2LCFA 2ZTCA 1PKXA 4A5SA 3IPCA 2I5HA 3L3FX 2X5XA 3FOBA 4GMXA 4JJIA 4G4GA 2R4TA 1HWYA 1T4CB 3NTUA 1TKBA 4Y1FA 1CUDA 1DAFA 3PQ7A 3DMYA 3I2JA 1NXSA 3N2KB 3NP7A 3C74A 4QJ4A 2IU0A 5FHRA 2GPTA 4PHCA 1COWA 2ZYUX 4MS3A 1TJ5A 4C7JA 2QIOA 3O4IA 3P9YA 1K4YA 4D2IA 2LRHA 4XW2A 5C3UA 3HKBA 2VWHA 5ALEA 3BK1A 4TTAA 3VO8A 4MMYB 1V43A 4FB4A 2DUWA 3CNQS 4TV9B 3GFPA 4BVAA 3GLFB 4BX2A 1RKBA 2B4TO 2EJBA 2IJGX 2H0QA 3NXSA 2YRFA 3SXUA 1JDSA 3HY6A 3PUJA 2KVCA 3N0VA 3MQ2A 1JWLA 2HMYB 3PE6A 3PW5A 3AB7A 4JC4A 3KFXA 1OB5A 5C8YF 1F0YA 4IY1A 4YAUA 4O9MA 1IHYA 2ZRJA 1MQSA 3T1NA 2W2LA 2J59A 5C5CA 1KC1A 1QAOA 4EZEA 3N58A 1X2IA 1ECGA 3V6KA 1PV1A 1U02A 4G4IA 2LCQA 1D8LA 1U0FA 2ASDA 2W2KB 3G6YA 4O4IF 3B6MA 3C98A 5LNK1 4B2LA 3LSYA 4LW8A 2Z5VA 2IBKA 3I1FA 4MDYA 3VPFA 3HUUA 2R1TA 1H4TA 1SB3C 4NABA 4OOEA 2Z4TA 3P9ZA 5AM2A 5CWRA 5JU5A 1FX0B 2VOJA 4DIMA 5EXTA 4K6CA 4NHOA 1Z3IX 1Y6JA 3R44A 1JHVA 1NW5A 3ZHVA 1D4AA 1OYYA 2J9FB 4LG1A 2CHQA 3H1GA 1VKNA 1FVOA 2FMKA 2WFMA 2HKIA 2NLOA 3H5VA 5D2CA 4JI8B 1TEHA 4WKBA 2B98A 8ABPA 1YFJA 1MRNA 2EFCB 3EIHA 4L16A 3TIXB 2V9CA 3X2FA 5DGIA 2QXYA 5HUQA 1YONA 4KGZA 5C52B 3Q8QB 4JYAB 2ACWA 4YRQA 2AI1A 3O8QB 2AK2A 2GZSA 3DCYA 1XTIA 3LO8A 2N1MA 1EFVB 4LK2A 5FB3A 4CHGA 1UBEA 3BD7A 2DJIA 5CT4A 1CHNA 3SZ2A 3D31A 2I6QA 1QU3A 4DE5A 1JN3A 4LJ9A 3RB6A 1JHAA 2P6MA 1KGSA 2PVPA 2QD2A 4GI1A 1OA1A 3LC2O 4OYHA 5ERGB 2IBMA 3PHHA 3AJAA 3VYRB 1OYVA 1ML3A 1GNVA 3KYBA 2QSYA 5DHRA 5DT2A 4LXUA 5AYVA 3KQLA 2HVIA 1J99A 1GT91 5B1SA 1R27A 1CP2A 2QT0A 1I36A 4JBWA 1ETHA 4G5XA 3DDUA 1T15A 4II3A 4Y6GB 2EKZA 4CIWA 1UR5A 4BKMA 2XWBF 1VMAA 4OQXA 5INTA 4IKEA 5JRJA 4KQ9A 4EHIA 1I6KA 3H11B 3QVSA 4FGJA 2ASLA 4KQXA 2IHMA 4PWZA 5L45A 4BY9E 2O8EB 3L6UA 2RSLA 4YI3A 3O3CA 2GZHA 1F6WA 1NBHA 4PRYA 1KF0A 2ZRDA 5G5HA 3DNPA 4I55A 4CTMA 5KNDD 2QEQA 3Q8WA 3ZK8A 4X94A 4IG4A 5LXTF 3U19A 1T8PA 1L5UA 2XIQA 4DV2B 2RKOA 1GPLA 2BGLA 1ZL0A 1MEEA 1QAMA 2F3TA 2D2FA 3HFGA 4H3KB 3D6JA 4MV5A 4U3JB 3SR0A 2G4VA 4QWEA 4IICA 3TQTA 1GO2A 5C8XA 1CF9A 4NBRA 5HE9A 4BX9A 1YBAA 1N2JA 3UQ0A 3LYLA 4YRJA 3HSKA 4CTNA 2G0AA 2J6SA 1MC8A 2VJ4A 2HHWA 3ETNA 2ODAA 3HADA 4TQAA 3UJBA 3K1RB 1ANKA 3PWKA 3R3YA 1NZBA 3PJGA 2I76A 2C2WA 5BSGA 5AW1A 3W4JA 1JLMA 3ODGA 4NEQA 2HPZA 1M2EA 3GDWA 1VHWA 1ELOA 2BZFA 2Q5LA 3I9MA 2L2QA 1J4AA 3L7BA 3REFA 5LZ4A 2QM3A 1XZMA 4JA2A 1DC8A 3FVTA 1O95D 2FLLA 2EFGA 4KNVA 4WZAB 2NGRA 2RHCA 1UBFA 1Z88A 1VOTA 2BFDA 4YALA 5CLQA 4B7XA 3EJ6A 1T36B 4DL6A 2GPYA 3UMJA 2JBHA 2PMBA 3BFKA 1L5KA 2V0NA 3LY5A 4B33A 3TLAA 4ENPA 2X2FA 1T3QA 1N6OA 3HA2A 4GPBA 5GGXA 4CKZA 3TECE 3GUUA 2FZKA 4QZ8A 3AOGA 3STXA 5M34A 3SFZA 3NS1A 3RR7A 2JVIA 2HZ7A 1MC1A 3T9EA 3T99A 2K4IA 5IDQA 3PGA1 3PXGA 1APBA 2J09A 2IS1A 1D9FA 3EA0A 5DLPA 3VR3A 2QTLA 1O0CA 3REQB 2PZFA 2XQGA 2JKVA 4EG7A 1RWPA 4EEKA 3CNHA 2XCPA 3BGSA 5E3JA 5K3EA 4LRYA 4ZD6A 3FLBA 3MGCA 5IINA 4CF5A 1TM5E 1YR7A 3KHSA 4J76A 3DFZA 1XMSA 4RHYA 5FDFA 4MWOA 1UAYA 1NVUQ 3JW8A 2YJ4A 3ZDFA 1M6HA 5FBHA 1YRYE 2BEWA 1VG0B 4NDAA 3VKGA 2Z2KA 4IQ8A 1ZQTA 1QFZA 2E5LB 3GJTA 1SZHA 1X7YB 2QY9A 3A4LA 4CV1A 1VKZA 1F0PA 1DO2A 5LDHA 3JPPA 1VHLA 3IO5A 2FAXA 5KMGB 4YJ2A 3O3NB 1YWGO 5JAUA 2E4XA 2JLAA 5GONA 3J7TA 2IUFA 3Q3IA 5FULA 4BL5A 1HE3A 1KYXA 1E1RA 1HL7A 1YZHA 2R8EA 4NM1A 2PZ8A 3DXYA 8ICJA 1QRRA 2QS9A 4KE6A 4AYTA 2X4LA 1PNOA 1Z0KA 3W06A 5TJ9A 4HH3C 1V2GA 2CY0A 4M8LA 3MWLA 4MKXA 2D5BA 4C7BA 4G5SA 5CX1B 3KM0A 5DCWA 3PNCA 4K81B 1WU7A 4Q7QA 1XXHE 1KOGA 2D1TA 2CXRA 3CEHA 1H2WA 4G2NA 4PYOA 5CURA 1BNPA 1BA2A 3TINA 4DQIA 3O21A 1XLWA 3IUYA 1EE2A 3RBVA 3C3AA 2BKVA 1AQIA 1EBBA 4L08A 2EJCA 1XLVA 4IUBS 4E7OA 1L1EA 4IJUA 5EKUA 1TVEA 3CE9A 3QYAA 5CA0A 1V0JA 1IPFA 4MV8A 4Q7MB 5GV8A 3RH5A 3UOAB 3U61B 4ZVUA 1Y7LA 3V80A 1C0PA 1HTTA 4J9PA 1TQ4A 3B7WA 4O4HB 3WMWA 3X2SA 2Z5GA 3O91A 3ELYA 2BFBB 2RIRA 3GD7A 3AP1A 3MINB 1K1QA 4R1UA 4JXKA 3VA7A 1XYVA 1T4MA 4BRUA 3MJVA 3CEMA 3WLJA 4C2UA 1UFKA 5H02A 4DDVA 3P9KA 4PZYA 3PITA 2ZSEA 2E6UX 5CG1A 4KXMA 5JUWA 5ALGA 5JJCA 4WDRA 1Z07A 4PWYA 2ZVDA 1L7VC 4YVFA 4ZKDA 3OTGA 3D3QA 2RGBA 3MOGA 2YJZA 3C70A 3QUTA 4O2BA 1NK9A 3ZI4A 3BXPA 3T9DA 5J0XA 1JZTA 1ZOPA 4RD4A 4G6ZA 3TLZA 4GOXA 1YA6A 3VC7A 5MHTA 2IW3A 1XWWA 1U7UA 2QW8A 2XRMA 3I39X 4QEDA 1KBOA 4ED3A 4YFKA 1U65A 2OXRA 4K1LA 1QIIA 1LJ8A 3GZFA 1UFVA 4KUGA 4XCXA 4L1KA 3P19A 1F17<