1IXRA

Ruva-ruvb complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
135
structure length
135
Chain Sequence
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Holliday junction DNA helicase ruvA
publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
source organism Thermus thermophilus
total genus 29
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ixrA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ixrA01
4DV0L 1D8YA 4HJ7A 3M9MB 1XSLA 1HZBA 2JEIA 4UPAA 4QL5A 3TARA 2UVUA 5J0SA 1YNXA 2NZHA 1BPXA 2PI4A 5DQGA 2EXDA 2JA8H 3K81C 2QEXA 1VQDA 3RRHA 1NK9A 4EBDA 2ISPA 4ELTA 1ZQJA 8ICLA 4A76A 4LF4L 4O3QA 8ICYA 2VQFL 4K0KQ 1NK8A 3CPWA 1EYGA 4A3BH 2ZUCA 4XA5A 4LF6Q 4JI5L 4UB5A 4O3PA 3W5OA 1UA1A 3KF6B 5L1LA 3GIKA 2WAQG 4A3LG 1VQFA 1IBLQ 3CD6A 5DGBA 4DOAA 3DM3A 3TRZA 5LMUL 4X65L 4DK3C 5DB6A 3PMNA 2UUCL 5BPCA 1KD1C 5KFYA 1HNXQ 2AQ4A 4KLFA 4I2EA 4A3EG 1PFSA 5J0OA 1J5EL 1IL2A 1SFOH 4NB3A 2K75A 1HR0W 3BU2A 4J9RA 5C4XH 2F1HA 1X2IA 5KFEA 3RH6A 8ICEA 2PFOA 2FMQA 3IRBA 3PNCA 2HHTA 4JI2Q 2HT1A 1ZYQA 3PO3G 4RQ6A 1BPZA 4I2FA 2JZBA 3PUZA 5HHHA 1NJXA 1TXYA 1VQJA 3V7LA 4GXKA 4DSFA 9ICRA 4RNOA 4GS3A 4DSLA 1X54A 1XTDA 4JG2A 5IILA 4JV1A 2V4RA 3S1MH 3OYYA 4GKJL 1YHQA 2UUBL 5J2HA 1XMOL 4A3JG 4MFCA 3F2BA 1Q8KA 5FLMG 4LUVA 5C44G 1VQKA 4A3GH 1ZQKA 2XGQA 4DL2A 4UB1A 2BCQA 2IHMA 3ZDCA 1KXLA 2NRTA 2NVTH 2KN7A 1Y1WG 5EOZA 2LXKA 4X62L 5KFNA 3UDFA 3CCQA 5JUMA 1XO1A 4DR2L 1HNWL 1N32Q 4MFAA 4LF8Q 2BQRA 1Y1VG 9ICWA 4XIGS 1C9OA 7ICRA 4A3KH 5D49A 1EWIA 5ELOA 5IWAL 3K75D 1E22A 1PH6A 5DBCA 4K4GA 2ALZA 4F5NA 3EN2A 5IY0A 3CCVA 1IM4A 3HOXG 4LFAQ 2BPGA 2KHIA 4LFBL 1RZTA 1K0RA 4UB3A 1LM0A 3CPFA 3JPTA 3RR5A 4JI4Q 1UE6A 1BBUA 3AFQA 4HIKA 3IM1A 2R92G 4KLKA 4Z6FA 1S0OA 2D62A 3HOUG 4A3CH 3CMAA 4ELVA 5J2FA 3SYZA 2BA0A 3PO4A 4P74A 7ICPA 4OO1G 3PW0A 4F5RA 3CC7A 2KCMA 4KLOA 1X9SA 4UB2A 3M9OB 4KLHA 4YXMA 4O3RA 4J9KA 4F4WA 3H3VH 3QE9Y 1V43A 1ZQTA 2HHQA 4BA2I 5KT2A 2XGPA 1JX4A 3TFSA 7ICSA 2XCAA 4DS5A 3RB3A 4I27A 4KLUA 2OTLA 1NK4A 2EQSA 4BA1I 2K5NA 5IYCH 1PH8A 3TS2A 5L9XA 4BY1G 5IP7G 4J9OA 5BR8L 4ECSA 4RQ0A 4QWBA 8ICMA 1ZQMA 3KFUA 5KFXA 5DB9A 5HMLA 1TKDA 4DR6L 2VA8A 3C5GA 3PR4A 1V9PA 1ZQXA 5CP2A 2CWPA 2WB1E 2C28A 3Q8QB 1HNZL 2BA1A 4DUZL 5J0RA 4GOPB 4A4IA 4FO6A 3M4OH 7ICUA 3M85A 1ASYA 3TEHB 3J80i 5J29A 2N49A 4DV1Q 4NPSA 4GOPC 4OXPA 4LFCQ 3W1BA 2IHNA 4RUCA 3T5JA 4R4QA 3RB0A 3Q8MA 9ICTA 4DV4L 1RPLA 4PGQA 4TQRA 3KTQA 5L1JA 4BBSH 3GTPH 8ICOA 3K80C 5BOLA 1QUQA 2FLLA 4A3IH 2JA6H 2VUMH 3IHQB 3RR8A 4ECWA 2B63G 2WTFA 1A62A 2JA7G 1AE2A 3LDAA 4QZFA 1KRPA 1JIHA 4B3TQ 2IX0A 2UXBL 4BXXH 1GD7A 4IFDJ 3H0GH 7ICVA 5KFUA 2JJQA 4QJFA 3LK9A 2IBKA 4I2DA 2N3SA 5EAYA 5IP9H 4O5KA 3NTUA 3PW7A 4JI3Q 5DBBA 3TS0A 3T1YL 2GVBA 4DNIA 2I5MX 5KFSA 1XNRQ 1JJCB 2CKZB 4I29A 3C1YA 4EYHB 1HR0Q 1U48A 4J9SA 2EIFA 2AGPA 1GKHA 3FKIG 4JC0A 2QA4A 2NVYH 2WB1G 1S10A 4JI0Q 2HHSA 4M6WB 3T1HL 1LTLA 5C3EG 3KHGA 4ECZA 5M3MG 5KFVA 3KLWA 1I94Q 4F5QA 4K0KL 3ZD9A 1NMFA 2BKEA 2A1JA 1NE3A 4LF6L 1TWCH 1NJZA 4QWAA 3EBEA 3KJPA 1X3EA 9ICOA 1SKWA 3GIIA 3M7NA 4YQWA 1ZQFA 1WJJA 1Y14B 3DLLA 8ICPA 4DR3Q 4YD2A 4P71A 2JK8A 1HNXL 1U45A 2Q2IA 5DQIA 2PFPA 1ZJMA 3QEBZ 2R8KA 1UWVA 4TURA 4DL5A 1M1KC 4DF4A 4F8RA 1SRUA 1IXRA 2UUAQ 9ICVA 1Z00B 4I28A 4O3SA 5HP4A 1B8AA 4X6AH 5HHIA 3RBEA 1OTCA 2CCZA 1VQEA 4JI2L 2FXQA 2I5HA 4KLMA 2RDIA 2VA3A 1NJYA 3ZDEA 3F2DA 2AGQA 7ICFA 2HIVA 3SV3A 4JYAQ 4F92B 4OONA 4NLNA 2FPMA 8ICBA 3NBHB 2VL6A 3BQ2A 1LB2B 1ZQDA 2UU9Q 2J6UA 4O0IA 4PPXA 3H8SA 2BH8A 1VQ6A 9ICCA 4K4HA 3HOYH 4L5TA 3HOZG 2JA8G 3CCRA 4TUPA 4KI0A 1HUOA 4IR1A 2ISOA 5C5JA 4UAWA 1FGUA 4PG3A 5F9LA 5L1IA 5IIMA 4A3BG 4L5RC 1ZQVA 1KRTA 4GN4B 3MGIA 1KFTA 4PHAA 1N32L 5CWRA 5JJIA 4DR1Q 4LF8L 3UQ2A 3OJUA 5J2AA 3G6XA 1FVIA 2Q0ZX 3C5FA 4JOIA 4RUAA 3S2HH 1C7YA 4DV5Q 5J0UA 5J2JA 4JBMA 2J6TA 2YTXA 3MR5A 1JB7A 4LFAL 4BGDA 2KZ3A 7ICOA 1SL0A 3ISDA 5C4XG 2A19A 2NVXH 3TFRA 9ICAA 2R6GA 5IE8A 1YJWA 2R7ZG 1WCLA 3C2LA 4GN5A 4JI4L 1WCNA 4MF2A 2PFQA 4PZ7A 5CR0A 4RT3A 2CQOA 4NM2A 2OQKA 2PQAB 4R8UA 3KDFA 5EWGA 1K3RA 4B3MQ 1L0WA 1UEBA 1JXEA 3PY8A 9ICJA 4RNNA 8ICAA 3MR2A 2ZUBA 3RJKA 1Q7YC 5IIIA 3QZ7A 4J9LA 2VA2A 4ECXA 4QZEA 2HIXA 5M5WH 1NK6A 2ZJPA 4DOBA 3GDXA 3MGHA 4IOCA 5KG4A 4I2IA 3V6JA 2MNAA 1CKNB 3HT3A 4F3OA 3QEAZ 4ALPA 3OHBA 4XRHA 4A3GG 3HPOA 1BPBA 5J0QA 1ZQNA 2NRVA 4DAMA 2A1AA 3TI0A 4DUYQ 5D46A 1EIFA 4YVZA 1TFRA 1ZJNA 4DAYB 1JJGA 2MO0A 2ZM6Q 5C4JH 2LSSA 2DUDA 4A3MG 2HHXA 2F1JA 5TZVA 7ICQA 1VQAA 1XNQQ 4A3KG 5C0XG 4ED7A 2P66A 3GTQH 1YEZA 2AWNA 3RJGA 4Y7NH 1YHAA 1H38A 2DFLA 2R7DA 4R63A 4DQQA 3KF6A 4RQ4A 5J2KA 2JEBI 3Q8LA 5IIOA 1TK0A 1ZQAA 1Q82C 9ICLA 1KQSA 3NEMA 3MDCA 3J81i 1MIUA 1JJ2A 1TV9A 1S40A 4JWNA 3JAMc 4DV1L 5DQHA 4LFCL 2UXDQ 7ICMA 4Z6EA 2HHUA 2MFIA 3RR7A 1ZQUA 5CA7A 2GN5A 5KFRA 3BZKA 3L2PA 5DGAA 5HNKA 2BHNA 4KLIA 1YBYA 1U49A 4A3CG 2I9GA 5M3FG 2D0PA 1S3OA 2ASLA 4QZDA 1PH5A 3OW2A 4JV5Q 2NRWA 2C35B 1UE1A 3HKZE 4JI8L 2M9NA 1JN3A 4DL3A 3PGZA 4O2DA 3PO5A 3A74A 4B9UA 3C23A 1KL9A 1DGSA 4X5VA 5GAHC 4OX9Q 4B3TL 1NY4A 8ICJA 3E9IA 4KTQA 2PMZE 4M9NA 4KLJA 2ATWA 3M9BA 1KHIA 4JI3L 4DFJA 1TAQA 4HJ8A 5DDYA 4IQTA 1XMQQ 2BR0A 2F1IA 4RMFA 3F2CA 3RJIA 4LWCA 3C1ZA 3N4MB 1JE5A 3VDYA 4P4OA 1XNRL 2DPIA 4P72A 1VQOA 2XCPA 1PH7A 2OCEA 1HR0L 1N33Q 4TUSA 4F93B 3I4MG 3V6HA 3S1QH 1UE7A 4M04A 2AHOB 3LGJA 1B7YB 3GIJA 4JI0L 4F2RA 2WP8J 2ASJA 4RQ7A 2YYZA 2Y1IA 2IMWP 4WJ4A 1I94L 2CFMA 1AROP 3S14H 2HHVA 2QGQA 1TVAA 2ZJRA 4LF7Q 3GIMA 1ZQIA 4YY3Q 1ZQPA 4B3SQ 1DOQA 1NKEA 1ZQBA 2ZTDA 3HWTA 4F91B 4OWTB 1KEJA 3CW2C 5KG5A 1X6OA 3JC66 4JBWA 3RJEA 3S15H 1W3SA 5HY6A 1K8AC 4DSEA 2VANA 1ZQCA 4DR7Q 2IT1A 3BJYA 2BCSA 4BY7H 4IRCA 4DR3L 4DR5Q 3RAQA 4UAYA 4YR2A 8ICQA 4PZ6A 3S1RH 1X9NA 1XSPA 4NLGA 3HKZG 4LZDA 1G51A 2VUMG 2K5VA 4MZ9A 1EQRA 3RAXA 1XJVA 5H1SE 4GNXA 4MF8A 4M9HA 4YCXA 4DLGA 4O5EA 1Z9FA 5EWFA 4DK6C 4BXXG 2AJQA 1YHBA 3H0GG 2ASDA 4JI1Q 2UUAL 1U5KA 5IP9G 1PYBA 3NELA 3SI8A 1VQGA 3EPIA 2B29A 3TQYA 1L1OA 2KBNA 3BQTA 4JYAL 3N97B 1PH2A 4DV2Q 3G6EA 1ZQEA 4LNQA 4X64Q 4C8NA 3KHLA 1QZHA 1EIYB 3B6YA 2UU9L 4P4PA 1VQ9A 3RJHA 4JV0A 1YIJA 2JZBB 4KITB 2XTIA 1KFDA 3M8SA 3CXCA 2ZTEA 3V7JA 5KG2A 7ICTA 2UXCQ 1ZQGA 5IT9c 4M9GA 5DDMA 3H40A 2V4QA 3J81j 1I50H 3RTVA 1EUJA 2W9CA 4F5OA 1X3FA 4GOPA 4Q43A 5M5XH 1R9TH 3CC4A 2W9BB 3UE0A 5CB1A 4KN4A 3PVXA 4DV6Q 4QWCA 4BDPA 3CCJA 4DR1L 2C2DA 1IBMQ 1J6QA 4KN7A 1D8LA 4KHPQ 4UQGA 5KG7A 1P8LA 4DV5L 3RZOH 3CAMA 5GQOA 3U50C 4DF8A 1VS0A 3OSNA 3Q8RB 1BVSA 1N34Q 4A3DH 3Q8KA 1K1SA 1E1OA 5J3BA 3JPSA 4R4TA 3F8TA 4DEZA 3CCSA 5KT7A 2UVWA 3G6VA 3OJSA 3LWMA 4YHHQ 3M3YH 3RN5A 4F5PA 1IYJB 1RYSA 4GLVB 4JCVE 4B3ML 2ATLA 1RYRA 1L3UA 4UP9A 4QZAA 2KZZA 4A3EH 5KFGA 5J0PA 2VNUD 1HUZA 1S77D 3I4OA 2JEAI 3RJJA 4UP8A 1XWLA 2PNHA 4L5SA 1BKBA 2RHSB 8ICIA 2JEJA 3ZDBA 2K50A 5JEAJ 3RBDA 1BPEA 5DLGA 4IR9A 4JI6Q 1QZGA 3PW4A 4DUYL 3PO3H 2Y0SE 5IYBH 4ECQA 3EPGA 5DG9A 2R8JA 4DV0Q 4UAZA 5FJ8G 4M6WA 4QZ8A 1Z47A 1SLJA 3EIVA 2ZM6L 2K14A 4IPCA 1YI2A 9ICPA 3JPNA 2BCUA 1AH9A 3U4ZA 4QZHA 2BGWA 1FJGQ 1VQPA 3ETLA 3TREA 2UVVA 4J9MA 3W1GA 1Q81C 3A5UA 5KFKA 1XNQL 2HHWA 3GFKB 5C44H 4JBKA 3PUYA 3V7KA 2Z0SA 3H7IA 1OXTA 3S2DH 4DV7Q 4Q44A 3OHAA 2N8NA 7ICLA 4I2JA 1U0LA 1BPYA 2J6SA 3C2MA 3PR5B 5L1KA 4KLSA 8ICXA 4RU9A 4KMUA 1HZAA 4YD1A 3NGDA 3EZ5A 1WFQA 2H5XA 5J2CA 5KT6A 8ICUA 2UXDL 1T3NA 3K7AH 3EYZA 3RB4A 3HP6A 1Y1VH 2JA5H 1LV5A 4ECTA 4O9MA 4BWMA 1GM5A 5LMNW 4DQIA 4JV5L 2AGOA 3U4VA 3PF4A 4PHPA 4RQ5A 4ED1A 4YMNA 2W8LA 1ZQYA 4OX9L 1XPOA 3JPQA 3I4NH 1XU4A 8ICRA 4KHZA 4QW9A 2BPCA 2N78A 2R92H 1A63A 3HOUH 4MEYA 1XMQL 5KFWA 1ZQQA 9ICNA 4KLQA 1IBLL 3PUWA 1MSWD 2Y0SG 4P2HA 3JPRA 3UQ0A 1L3VA 4C8OA 4F4YA 3MR6A 4M47A 8ICGA 8ICNA 5DBAA 4F4KA 2ALYB 4JBJA 1E3PA 4FS1A 4I2CA 1N33L 2KCTA 2R93G 2F3IA 4J9PA 1D9FA 3PX4A 4IPDA 3UE1A 4IPHA 4BBRG 5HMMA 2E2JH 3BZCA 1X9WA 5EWEA 4C8LA 1NK7A 4KLDA 3CP0A 3PIPA 2B3GA 3KF8B 4MEXA 4Z6CA 1HH2P 4RQ1A 1UE5A 3ZD8A 5J2DA 4DSKA 2LXJA 4ED8A 9ICEA 3RN2A 3H8JA 1X65A 4R64A 4ED2A 3AU6A 4XTCS 4GN3B 4A93H 4LF7L 3T5HA 1N36Q 4YY3L 5J0TA 4YR0A 4B3SL 4QZBA 1D9DA 4G3IA 2BCRA 4B9NA 2ES2A 4B9TA 5JJLA 2PXIA 4DR2Q 2JQOA 3KYHC 4IOAA 1T7PA 4KLEA 3UXPA 4QIWE 4QGUA 2F52A 4P4MA 2C22A 4DL7A 3C2KA 2BCVA 4JWMA 4QWEA 4DR7L 1QSSA 4DR5L 1WI5A 3RLFA 1KDHA 5KT4A 2E2HH 5J2BA 2GVAA 9ICFA 8ICVA 3KOJA 4FDBA 3HOWH 2HVIA 1QTMA 4UB4A 1RIPA 1SN8A 2PQAA 2YTVA 3V72A 2DGYA 3M4QA 1IBKQ 1VQMA 4POGA 4P75A 4JI1L 4QY7A 2XY6A 1ZQLA 3G71A 2R7FA 9ICBA 2Q2UA 1BBWA 2F4VQ 3GTOH 4EYIB 4DV2L 3HFZB 9ICXA 1CKNA 4X64L 7ICKA 4DO9A 8ICTA 2HHHQ 2MUTA 2DPJA 1PH9A 5E7NA 3B0YA 5KFZA 3M4PA 3AU2A 1NMGA 2Q2TA 1U9LA 3J7A5 3A5ZB 4UP7A 4DL6A 4I2GA 2FMPA 2ZJQA 1TWGH 4IRDA 2UXCL 5IIKA 4AH6A 4LVSA 4PGXA 4B3RQ 5DLQE 3ER0A 2FLPA 2Z6KC 1Q1EA 2W9MA 2UVRA 1KLNA 4HJ5A 4PZ8A 4JI7Q 3GTKH 4DV6L 2I0QA 1MJEA 1SZPA 3RH4A 1S9FA 3RJFA 7ICJA 7ICEA 1IBML 2I5LX 5KFJA 4KHPL 3MFIA 8ICFA 3PV8A 1HZ9A 4BY7G 4Q8FA 4L5QA 3T5KA 1ZETA 2KFNA 1N34L 4ED3A 1NKBA 4ED0A 4DOCA 4KLLA 4F4XA 1NTGA 1PYSB 3PO2H 3I55A 1LYLA 2BQUA 3MDAA 4ECYA 4R65A 4YHHL 1ZQHA 4AIMA 4YFKA 2IHFA 5KFBA 1KIXA 5KG6A 1T8EA 2ZJ5A 3MEFA 3OTOQ 1VQ7A 4I2AA 1A8VA 1X56A 4R4OA 4EBCA 1B22A 4LF9Q 3GDEA 4BWJA 5DB8A 1X3GA 3GILA 3HW8A 3T5LA 1S0NA 4UBBA 1EOVA 3BJUA 4APVA 1OXUA 1KSPA 1AE3A 1PH4A 2RF4A 1ZQWA 3GTGH 4YCWA 3RH5A 3ORYA 2ZTCA 1Q12A 9ICSA 1MJCA 4NM1A 1NJIC 4O3NA 2ZJ8A 3JPOA 4JI6L 2PFNA 4NLKA 5LMNQ 1PHJA 3ULLA 4IFDG 2FPLA 5M5YH 4PHDA 4IJHA 3ULPA 4HYKA 4OO1I 3H15A 4GC6A 2W9AA 4F2SA 4R4IA 1QVCA 2ZUDA 4GLAC 3CMEA 1FJGL 4MNOA 4IQVA 1QSYA 5IYDH 2AU0A 1Q1BA 1EXNA 5D4BA 4J9QA 1E24A 3D0FA 4DV3Q 4RT2A 3T1HQ 3HOZH 4R1JA 2YV5A 1QLNA 3T3FA 4X66Q 4DQSA 4DV7L 8ICSA 3HX0A 5DG7A 3FHWA 3J80c 3GTJH 2AQ0A 4A3DG 4ELUA 1SE8A 1QSLA 5IYCG 3RLNA 4BXOB 3LWLA 2Q2HA 3NENA 1W2BA 4Y52H 4EZ6A 5IINA 1MKHA 3MXNB 5GAGC 3OGUA 1ASZA 4O0AA 3BQ0A 2B21A 4QZGA 5KFIA 2R8GA 1O7IA 1RL2A 2E5LQ 8ICZA 1KTQA 3HOVH 1SMXA 1VQ5A 2K52A 2V9WA 2R8IA 1VQ4A 1T9HA 5AJ3Q 3U58A 4NXMQ 2HQLA 3UDGA 3ISBA 4B9LA 1N8RC 1ZQSA 4QZCA 4YP3A 1CEZA 4FBTA 3PW2A 5KFFA 4CCHA 4LF5Q 5KG1A 4YWKA 4A3FH 4QW8A 2R7ZH 3FP9A 3UDXA 1UT5A 3UDIA 2MAXA 3UXOA 2FPKA 2AWOA 1BGXT 3ULJA 5KFLA 3GO5A 2XC9A 4GKKQ 5IYBG 4BBSG 3MR3A 4ME3A 3M9NB 4FS2A 4H02A 1X9MA 4A3IG 2C2RA 4LW1A 2JA6G 4QWDA 3PF5A 1NBWA 9ICGA 4DKAC 2BQ3A 3K8AA 2NN6G 1UT8A 4IQWA 3TAPA 5KT5A 3H8WA 1L3TA 2BDPA 4R4CA 4LZGA 4C8KA 1SROA 2WFWA 1D7QA 4ECVA 2W9BA 4F4ZA 1VQCA 2A8VA 2W8KA 1XPUA 1K83H 4HIDA 4XUSA 1N36L 3K0XA 1TWAH 3GQCA 4HJAA 4B9VA 1NK5A 4A3MH 3Q8SB 4O3OA 3TANA 2JA5G 1YITA 4F50A 1WCMH 1Z3EB 2KHJA 2ID0A 1L2FA 5F9NA 3PX6A 2IX1A 3D31A 1NK0A 9ICUA 3PCOB 1U47A 3E0EA 2ASBA 1IBKL 3PUVA 1H95A 4GC7A 1UA0A 4NLZA 4K4IA 3I4NG 5CJ7A 1SL1A 4PGYA 4QZ9A 1YJNA 1I5FA 2D0OA 4PMWA 2VQEQ 2E8GA 1CSQA 4RNMA 1MQ2A 4YCVA 4GNXB 4C8MA 1WOCA 2F4VL 5M3FH 1VQ8A 4DR4Q 4B9SA 4I2BA 1VQIA 4RPZA 2VY3A 4C3HH 2KTQA 4NXNQ 5BOMA 4RG1A 9ICQA 4XQ8A 4YCUA 2HHHL 1ZQRA 3TQ1A 2R8HA 1L1OB 3KHRA 5DLFA 9ICHA 1CKOA 1A0IA 4M2YA 3I56A 4GNXC 1X55A 1IZ6A 1S76D 3H4DA 5J0YA 4YMOA 1A76A 4Q45A 3G4SA 5J2IA 3JAMi 4JUZA 2XY5A 1XC9A 4M0AA 4DWIA 4GXIA 4WJ3M 4C3IH 4A3LH 5J0XA 2K4KA 2VW9A 1S97A 1L1OC 4MFFA 3RB6A 1L3SA 4B3RL 4A93G 1I6HH 2OTJA 3GTLH 1FL0A 4DPGA 1HJPA 1VCIA 4EBEA 4RQ3A 1CSPA 4JI7L 3I4MH 1TWFH 3CC2A 1GVPA 3PW5A 3H4BA 2JA9A 1K9MC 2W9CB 4TVAB 1KFSA 2NZOA 4GLXA 3I2ZA 2GWSA 3HOYG 5KFMA 4A75A 1VQHA 1M90C 1YJ9A 2XY7A 4UBCA 2L15A 4P73A 3PSIA 2JEGA 1VQNA 5DG8A 3ZDDA 3GTMH 2MQHA 4EX5A 4YG2A 3KHHA 4DSJA 2C2EA 2KFZA 4AQYQ 5K36G 4QQBX 3HOWG 3FYHA 4DS4A 4C3JH 5C0XJ 1N9WA 1OXVA 4ZH4A 1C0AA 4TUQA 3PUXA 2HW3A 1I3QH 1PVOA 4R66A 3OTOL 4EZ9A 4A3JH 1NKCA 1Y88A 2BH2A 9ICKA 1RXWA 3TAQA 5FLMH 3K4GA 2VS1A 4LF9L 4JI8Q 4UY8C 1YZ6A 4LF4Q 1OXSC 5KFDA 2VQFQ 1Y1WH 1MC8A 3EW9A 4PHEA 4JI5Q 4EQ5A 2VZAA 1TK5A 1S0VA 2HVHA 5KTQA 3S17H 3JPPA 2V1CC 3MABA 3RRGA 4TQSA 5FLXc 2FLNA 3L7ZC 1QVGA 5LMNL 1PZNA 5LMUQ 4ED6A 4X65Q 4HIOA 1XSNA 2UUCQ 3I7FA 4YWMA 2XGTA 5KFTA 1P16A 4I2HA 3HOXH 1J5EQ 1K1QA 1Z00A 5KFPA 2KENA 5KFQA 1TK8A 3STBC 4ECUA 5KFAA 3E2EA 2MO1A 3S24A 5J0WA 1TAUA 4E0DA 3GV5B 4KLGA 1QUQB 4M9JA 4NXZA 1A77A 4DV3L 1JMSA 4RPXA 8ICWA 4X66L 1JXLA 4YXJA 5J2GA 2XO7A 3J81c 1N56A 3ZJYC 1TWHH 1CKMA 8ICHA 3V6KA 3SGIA 4RZRA 1SKRA 2IHEA 7ICNA 4AYBE 3PO2G 2Y1JA 4J15A 2P6RA 7ICHA 3THVA 3CCUA 4O5CA 2OWOA 1RXVA 4KLTA 4OWXB 3S1NH 4GKJQ 1B43A 1WYDA 3OSPA 1SR3A 2UUBQ 8ICKA 5IIJA 3RZDH 3RNUA 1XMOQ 3F1ZA 2E5LL 5JJKA 5HGQA 1VQLA 2NVQH 5C0XI 2RDJA 3QZ8A 5DKWA 5AJ3L 1E1TA 4NXML 1PA6A 3AFPA 2KZMA 2PI2A 4B9MA 2AKWB 4OWWB 4BY1H 5IP7H 4X62Q 1XS9D 2RCNA 4LF5L 3SZ2A 5CHGA 4ECRA 3PV0A 4DQPA 4IO9A 3UXNA 1V1QA 3GV7B 4YWLA 1HNWQ 4C2MH 2FMSA 3WWVA 3B0XA 4Q8EA 4DL4A 2A1JB 4J9NA 3K7UC 5IWAQ 4GKKL 4IFDI 2I1QA 3PIOA 4DFKA 1VQBA 1K73C 2Z6KA 3HKSA 2BPFA 4Z6DA 3GV8B 5IYDG 4LFBQ 2JEFA 1G291 1T4GA 9ICIA 1GO3E 4FBUA 2K5HA 3H3VI 1OXXK 4HIMA 1COOA 4YN4A 4TQUS 7ICIA 3M8RA 2OQ0A 1ZQOA 3STBD 1NOMA 3AYHB 3CF5A 1Q86C 4YR3A 1BPDA 3ZDAA 3Q8DA 5FJ8H 4AYBG 2B63H 5ELNA 4DFPA 1PV4A 2JA7H 1KRSA 2LYHA 1Q46A 5GROA 4HJ9A 1JT8A 1L5UA 3E9HA 4IPGA 3ICEA 3HOVG 2NRXA 5J2EA 2AMCB 4POFA 1EQQA 1MQ3A 2YU9H 3L0OA 3EWAA 5KFOA 8ICCA 4IQUA 5GAEC 3MFHA 1E7ZA 1B70B 4IRKA 5BR8Q 4A3FG 2P6UA 2IA6A 4DR6Q 4RPYA 3AQQA 1S0MA 2NRZA 2VQEL 4DFMA 3FKIH 4YMMA 1LUZA 4NY8A 1HNZQ 5KG0A 3CQZH 1XPRA 3BQ1A 1N48A 4DUZQ 1QVFA 4DR4L 4IJLA 1KC8C 5C3EH 5M3MH 7ICGA 3G6YA 2JE6I 4NXNL 1K8GA 2RHQB 5KT3A 3S16H 4EEYA 4DSIA 3RLOA 4GXJA 4MTNA 3UPQA 3AUOA 3C21A 2NN6I 4RQ2A 3CCEA 2IY5B 1G6PA 4DQRA 3CCLA 5DB7A 3A0JA 4JK1A 4JV2A 1SL2A 3PX0A 2MUTB 2WAQE 1S72A 9ICMA 3KJOA 4DV4Q 1CUKA 3SV4A 4JOIC 4LUOA 2E2IH 4PH5A 1JMCA 4RQ8A 2PI5A 5JEAG 1ZQZA 3MBYA 3ERSX 1U4BA 3G48A 2R93H 3FDSA 4R8UB 4BBRH 5KFHA 3KDFB 3ISCA 1SKSA 4M9LA 1PH3A 2PI2E 2CWAA 2YTYA 3AEVA 4QZIA 1KAWA 3Q8PB 2UXBQ 3GD7A 1YVCA 5KFCA 4BXOA 1WCMG 1HZCA 3BDPA 3J7ZC 4DLEA 5GADC 1EFWA 5KG3A 3PMLA 3T1YQ 2ZJAA 1PH1A 4AQYL 4LUZA 3CCMA 1NJWA
chains in the Genus database with same CATH superfamily
1FNUA 3NXWA 1I4PA 4H0LC 1D8YA 4P2CB 4DV0L 1D8BA 4HJ7A 2QKQA 3M9MB 2WV6D 2A69D 1XSLA 3ND8A 2E74C 1HZBA 4V190 2JEIA 4UPAA 4QL5A 2L5YA 3TARA 3DEOA 2UVUA 5EE0A 5J0SA 1QNUA 3H0LB 1YNXA 2NZHA 1BPXA 2PI4A 1BNZA 1FNWA 2W3SA 5DQGA 2EXDA 2JA8H 4PJ0U 5F3XB 3TMEA 1O7LA 2XWBB 3K81C 3K59A 2QEXA 1VQDA 3MVVA 4C3HG 3BS1A 2EZXA 1IV8A 3RRHA 1NK9A 2IWHA 4EBDA 2ISPA 1G6ZA 4ELTA 2F4IA 3SHLA 1ZQJA 8ICLA 5JVG3 4A76A 4LF4L 3QU9A 4O3QA 8ICYA 1FD7D 1LTBD 2VQFL 4K0KQ 1NK8A 1CHPD 4A93B 4DF7A 3CPWA 3VR6A 1EYGA 4ZKBB 2DJFC 2F3VA 4A3BH 2ZUCA 4XA5A 4LF6Q 3P75A 4JI5L 3J7YW 4FZLA 4UB5A 1QE6A 2K8BB 4O3PA 3W5OA 1HFNA 1L0XB 1UA1A 4F8MA 3KF6B 4FO2A 5L1LA 1IYUA 3GIKA 3IN5A 1C48A 3OSOA 1CQVA 2WAQG 1GJXA 3QU5A 1MA7A 1JOOA 4Y2VA 1VQFA 2B2TC 3AU7A 4G57A 4ZRZA 3SE0A 1IBLQ 1RHPA 3DWPA 5G5GA 3CD6A 5DGBA 4DOAA 3DM3A 3HOYB 5LMUL 3TRZA 4X65L 4DK3C 2G0AA 5DB6A 3PMNA 1MBYA 3VR5A 1WTOA 1AP0A 2UUCL 1SXEA 5BPCA 1KD1C 5KFYA 1HNXQ 2AQ4A 4KLFA 1UNSA 4I2EA 3OMGA 4A3EG 1PFSA 5J0OA 2F3WA 1J5EL 1IL2A 5DEHA 2JHDA 5AHXA 3F5EA 3QUQA 1SFOH 3TN2A 2Y9TA 5AI4A 3D4WA 4NB3A 2K75A 1HR0W 1GUNA 1BBXC 3BU2A 4J9RA 5C4XH 3BS5B 4FXKC 3X3MA 2F1HA 1H9RA 4K14A 1X2IA 5KFEA 3RH6A 8ICEA 2PFOA 1P7DA 2FMQA 1LT4D 3IRBA 1F5SA 4CF4A 3SEBA 5B5EU 2LFNA 3TKAA 1EIGA 3PNCA 5AICA 2H3ZA 2HHTA 4JI2Q 1CI3M 3GTOB 3A7AB 2HT1A 2NZ1D 3S2HB 1ZYQA 3PO3G 4QCLA 4RQ6A 1KN5A 3PSTA 1BPZA 4I2FA 4AYBF 2JZBA 3PUZA 5HHHA 1NJXA 5HR7A 1TXYA 1VQJA 3V7LA 2AUKA 2C9OA 3LX0A 4GXKA 4DSFA 9ICRA 4RNOA 2NTTA 4GS3A 4DSLA 4CGZA 2XN9C 1X54A 1D2BA 1XTDA 4JG2A 4R8IA 5IILA 1RTOA 4JV1A 2V4RA 4BS9A 5FLXL 3OYYA 3S1MH 2NVXB 4GKJL 1YHQA 2CPRA 5EE3A 2UUBL 5J2HA 3I28A 1AN8A 1XMOL 1F0MA 4A3JG 4MFCA 1ZD3A 3F2BA 1Q8KA 5FLMG 4LUVA 5C44G 1VQKA 3IG5A 2DNEA 3V96A 1TWGB 4A3GH 1ZQKA 2XGQA 4DL2A 2FE9A 4UB1A 5ALGA 2BCQA 3QU7A 4Y2TA 2IHMA 3ZDCA 1KXLA 4UAIA 3T51B 3I1YA 2NRTA 2NVTH 2KN7A 1JC7A 1Y1WG 5EOZA 1EZ6A 2LXKA 4X62L 2JH7A 5KFNA 3UDFA 2EOTA 2B2VC 3IG8A 3CCQA 4OJPA 5AK5A 4QNLA 1DOKA 2OXOA 1XO1A 5JUMA 4DR2L 4OIKA 5M5WB 1HNWL 1N32Q 1JROA 5ALJA 4MFAA 1BF4A 4LF8Q 4CJ2C 4XT1B 2I46A 2F3NA 2BQRA 1Y1VG 3T53B 9ICWA 4XIGS 1AQ6A 5BN4A 1C9OA 7ICRA 4A3KH 2Z4HA 5C0XH 5D49A 1CZGA 1EWIA 2KHQA 5ELOA 1COKA 5IWAL 3DWQA 3BS7A 3GP7A 3K75D 1E22A 1HRJA 1PH6A 4NDXA 1HQMC 5DBCA 1DCZA 4K4GA 2ALZA 5J8YC 4F5NA 1T5EA 3EN2A 4U6PA 5IY0A 1IM4A 1RQNA 1SYBA 1VDVA 3ETRA 2EYJA 5ISRA 3HOXG 1SNCA 1Q8IA 2Y0SB 2DY8A 2BPGA 2KHIA 3A54A 3UMCA 4LFAQ 1QB5D 3A8IE 2KCNA 4LFBL 1RZTA 3P7JA 1GO3F 3PQIA 1K0RA 1JWSD 5KYIA 4UB3A 3P1HA 1LM0A 3CPFA 3JPTA 2W04A 3RR5A 4JI4Q 1UE6A 2KEYA 5I9PA 1BBUA 2K1BA 3AFQA 3IM1A 4DNRB 4HIKA 2B2YC 2R92G 4KLKA 2Y0SC 4Z6FA 1S0OA 2KP7A 2D62A 4G7HC 3HOUG 3CMAA 4A3CH 4ELVA 1VMPA 5J2FA 5AIAA 3SYZA 2BA0A 4IFDH 3PO4A 2P5ZX 3GTQB 4P74A 7ICPA 3S9WA 4OO1G 1BCPF 4Y7NB 3PW0A 2N88A 4F5RA 1MD2D 3CC7A 2KVMA 3I8ZA 2KCMA 4IN3A 4KLOA 2NUCA 1X9SA 4UB2A 3M9OB 4XDXA 4KLHA 1BNPA 3NWSA 4YXMA 4CDGA 1SNDA 3QOLA 4O3RA 4J9KA 3MC0B 2M2LA 5C6AA 2ZIWB 4F4WA 5AFWA 3H3VH 3ICXA 3NRWA 3QE9Y 5C0YA 1B9MA 1V43A 1ZQTA 1QNKA 2HHQA 2JXJA 2H3VA 4BA2I 5KT2A 2XGPA 1JX4A 2KMDA 3TFSA 1RODA 1SYCA 4ZAIA 7ICSA 2XCAA 4DS5A 1WTQA 2RKSA 4JPBW 3RB3A 1KDAA 4I27A 2F2AB 4KLUA 2HD3A 2OTLA 1NK4A 1FIQA 1I4RA 2EQSA 4BA1I 1U9RA 2K5NA 1S5CD 2G9HD 3DDHA 5IYCH 5M5YB 2XIWA 1PH8A 5CV4A 3TS2A 5L9XA 1CQFA 4BY1G 5IP7G 4J9OA 1QCKA 3WK9A 1F77A 3WDNA 5BR8L 1KAAA 4ECSA 3OPXA 4A8EA 4RQ0A 4QWBA 8ICMA 1SE3A 2K01A 1ZQMA 3KFUA 5KFXA 5DB9A 5HMLA 3KLRA 1TKDA 3N6RA 4DR6L 2VA8A 2KVCA 1S5BD 3LVVA 3C5GA 3PR4A 1V9PA 1ZQXA 5CP2A 2CWPA 4FVMA 2WB1E 2C28A 3Q8QB 2SOBA 1HNZL 2SNMA 3BG3A 1PTOH 5KEEA 2JR5A 2BA1A 4DUZL 5J0RA 4C7ZA 1XTCD 4GOPB 4A4IA 1L7MA 3A0BU 3NQTA 4FO6A 1RTNA 7ICUA 4MHEA 4ZCKA 3M85A 3M4OH 3GTJB 1ASYA 3KZIU 3TEHB 1Q90A 5AKHA 2KNJA 1RYUA 1PXUA 2HOFA 1WTRA 1X6IA 3ALRA 3J80i 2F03A 5J29A 2N49A 3VR3A 2E5SA 3SENA 4DV1Q 4NPSA 1IYVA 4GOPC 1ZD2P 4OXPA 4LFCQ 3W1BA 2IHNA 4RUCA 1JRPA 3T5JA 1GHKA 3U9SA 4R4QA 3S1QB 2J4XA 4US8A 5A2QL 4KN4C 4OJLA 2WAQF 1NZPA 1CHQD 3RB0A 3Q8MA 3UM9A 2K5WA 4FYDA 2EYPA 9ICTA 4DV4L 1RPLA 4PGQA 4KN7C 4TQRA 2YB1A 3KTQA 2SNSA 2EZYA 1W6JA 5L1JA 4BBSH 4KV6A 3GTPH 8ICOA 3K80C 1LTGD 1URJA 1CA5A 1B50A 1WWVA 5BOLA 1PK1A 3UMGA 1QUQA 2FLLA 2RSOA 5C4HA 2W7PA 4A3IH 4IZ8A 3ED5A 2JA6H 4IUVA 2VUMH 3IHQB 3RR8A 4ECWA 2B63G 3S14B 2WTFA 1A62A 1M6YA 2JA7G 1AE2A 3LDAA 2NN6H 4QZFA 1KRPA 2QDBA 1S5ED 1JIHA 5ALTA 3DEEA 3SAGA 2IX0A 4B3TQ 2UXBL 1ZXTA 5CBAE 4BXXH 1GD7A 3QUBA 1X66A 4IFDJ 2B2UC 3H0GH 7ICVA 2G5HB 5KFUA 2JJQA 2IJ0A 4QJFA 3LK9A 2IBKA 4I2DA 1JWMD 2N3SA 5EAYA 4CDFC 5IP9H 4ZKCB 4O5KA 4OD0A 3NTUA 3PW7A 4JI3Q 3S15B 1UUPA 2WF7A 5DBBA 3TS0A 2VB3X 2FMCA 1SYDA 3T1YL 3ND9A 1L7NA 1O03A 2GVBA 4DNIA 1MSGA 2QARB 2E2DC 1JORA 3DV9A 3E5SA 2I5MX 5KFSA 3W3AA 3S1RB 2EYLA 4Q5VA 1XNRQ 2EYMA 3KF8A 1O78A 2HI0A 1JJCB 2CKZB 4I29A 3C1YA 4EYHB 1HR0Q 1EY5A 4LAAA 3AMUA 4TSSA 1U48A 3E0JA 5E1FA 4J9SA 1YNJC 2KUMA 2EIFA 2AGPA 1GKHA 1NR2A 4WRDA 3FKIG 3T79A 3H94A 4JC0A 1PLFA 2RDGA 2QA4A 1N5WA 2F0NA 1S10A 2NVYH 2WB1G 4JI0Q 2HHSA 3LWUA 4K5VA 3UI2A 4DXFA 4M6WB 3T1HL 1LTLA 1KDCA 2KHSA 5HURA 5C3EG 1DJRD 3BZDB 4NW2A 4CKEA 3KHGA 4ECZA 5M3MG 5KFVA 2DGZA 5IOCA 1N63A 5ALFA 2BZFA 1ED1A 5HGTA 4DNTB 3KLWA 5B66U 1I94Q 5CV9A 5IGBA 4F5QA 2MP1A 5AI5A 4K0KL 3ZD9A 1U4MA 1STNA 3P20A 1BCPB 3NP8A 1NMFA 2BKEA 5GTIU 2E75C 2A1JA 1NE3A 4LF6L 1WTVA 2BDOA 1TWCH 1NJZA 4QWAA 3EBEA 1LABA 3KJPA 1X3EA 3FAHA 3SXHA 2Q8TA 9ICOA 2HDOA 1SKWA 1J2MA 4C1NK 3CYMA 3GIIA 1XNSA 3M7NA 4YQWA 4QB4A 1ZQFA 1WJJA 1BCPC 1WCMB 1Y14B 5KYLA 1H9SA 4Y2PA 3DLLA 2WF6A 8ICPA 2EPBA 2GA4B 4DR3Q 4YD2A 4P71A 2JK8A 5JU5A 3JAML 1HNXL 4S3SA 3KK7A 3CNHA 1U45A 2Q2IA 5AI9A 1L7PA 1NNLA 2E1FA 5DQIA 1EFID 2PFPA 1KABA 4RFBA 1ZJMA 3QEBZ 4NMZA 2R8KA 4KMUC 2FI1A 1UWVA 1L8LA 4TURA 4DL5A 1M1KC 4DF4A 4F71A 5M5XB 1WVLA 1R9TB 2HSZA 4F8RA 1SRUA 1IXRA 1K8OA 4I65A 2UUAQ 9ICVA 1Z00B 4I28A 2HDMA 5FP0A 2XIDA 4O3SA 4PQXA 3MC1A 5HP4A 1B8AA 5HHIA 3RBEA 4X6AH 3TP8A 1JOQA 1OTCA 2CCZA 1VQEA 4JI2L 4F7XA 2FXQA 1J9OA 2I5HA 4KLMA 2RDIA 2VXWA 2VA3A 1NJYA 1U4RA 1RG6A 3ZDEA 3F2DA 2AGQA 1HQRD 7ICFA 2HIVA 3SV3A 4JYAQ 4HSVA 1Q3UA 4F92B 2H4OA 2D8CA 2FPMA 4NLNA 1W6KA 4OONA 8ICBA 3NBHB 3RZOB 3J7AV 3KZXA 2O5IC 4H44C 2GOLA 2VL6A 2X6LA 3BQ2A 1LB2B 1LTID 2EVBA 4G4KA 1ZQDA 4HAEA 2UU9Q 5ALNA 2OXPA 3MXPA 5AM5A 2ZXPA 5C3XA 2FDRA 3QJYA 2J6UA 2HBLA 4KD4A 4O0IA 3SK5A 1OW5A 2YMLA 4N9PA 4PPXA 3H8SA 4NL9A 5AI8A 2BH8A 3LVWA 9ICCA 3NTIA 4UDUC 1VQ6A 1PRTB 3NVWA 1FO4A 2A3VA 4K4HA 1S5DD 1X9XA 4EENA 5EJWA 3HOYH 4L5TA 3HOZG 3BVZA 2JA8G 3CCRA 2WAQB 4TUPA 2RDHA 4KI0A 5M9OA 1TAMA 1L7OA 1HUOA 5E79U 4IR1A 2ISOA 1LT3D 3OIPA 5C5JA 1DRGA 4UAWA 1TS2A 1FGUA 1I6HB 3GTLB 4PG3A 5F9LA 4C4SA 3K1ZA 5L1IA 1CT1D 1PRTC 4A3EB 5IIMA 1M8AA 4A3BG 4HAIA 4FP5D 4L5RC 3C3LA 1ZQVA 1KRTA 2WAQC 2L12A 2MGSA 4GN4B 3MGIA 1KFTA 3MZ5A 1ICFB 4KTAA 1WTPA 4PHAA 5EKIA 1N32L 3BDLA 5CWRA 5JJIA 4DR1Q 4LF8L 3UQ2A 5F2DA 3OJUA 5J2AA 1I4HA 3G6XA 1FVIA 3R8BA 2O2LD 2O6KA 2MRLA 2Q0ZX 5ALMA 3C5FA 1EOTA 4JOIA 4DK1A 4RA8A 4QMGA 2EH9A 4RUAA 3S2HH 1SV4A 5JTIA 1C7YA 1UAPA 4DV5Q 5J0UA 1TS3A 2EANA 2PCFB 2E8OA 5J2JA 1F9RA 4C56C 2ZIVB 2J6TA 1KNAA 2YTXA 4JBMA 3MR5A 1JB7A 3PO3B 1PUZA 4LFAL 4BGDA 2X69A 1GXDC 2KZ3A 7ICOA 4DAVA 4F72A 3ISDA 1SL0A 5C4XG 2F0TA 2A19A 2NVXH 3TFRA 1ZQ1C 9ICAA 2R6GA 2L5TA 5IE8A 3M7DA 1YJWA 2E3TA 2R7ZG 1WCLA 3C2LA 2A68C 4GN5A 4JI4L 3TACB 1WCNA 4MF2A 1I3QB 2PFQA 2K03A 4PZ7A 5CR0A 2F76X 4RT3A 2ZG6A 2CQOA 3N7RC 5G5HA 4NM2A 2OQKA 4R8UA 2PQAB 4ZYSA 4P0PA 3KDFA 4A3JB 2CW0C 5C44B 5EWGA 4KX3A 1K3RA 2WF9A 4RGTA 2CHBD 1L0WA 1XWEA 1EYAA 3RFAA 1SV0A 1NZBA 1UEBA 3S2DB 1JXEA 3PY8A 1LV9A 9ICJA 3L9AX 4RNNA 1R4PB 4WORA 2XNAC 8ICAA 3MR2A 2ZUBA 3RJKA 1Q7YC 1RDPD 4RHSA 5IIIA 3QZ7A 4J9LA 2VA2A 4ECXA 4QZEA 2HIXA 5M5WH 1NK6A 1SMYC 2ZJPA 4DOBA 3GDXA 3MGHA 1K28A 4IOCA 4K8JA 5KG4A 4I2IA 3V6JA 2CH4A 2B8FA 1X6JA 2MNAA 3SAFA 1CKNB 1V1PA 3HT3A 2L0CA 4F3OA 1JB3A 3NTHA 3K7AB 4TRDA 3QEAZ 4US9A 1STAA 2NBFA 4ALPA 3OHBA 4XRHA 2B39A 4CNQA 1CM9A 3HPOA 1Y1VB 4A3GG 3QR8A 1BPBA 1HUMA 4WFN3 1ZRMA 5J0QA 1ZQNA 1JOKA 1RF2D 2NRVA 1UEAB 2A6HC 3C1FA 4DAMA 2A1AA 3TI0A 2IOFK 2F44A 4DUYQ 5D46A 5ALXA 4YVZA 3C28A 1EIFA 1TFRA 2GH1A 1ZJNA 3DXJC 4DAYB 1JJGA 2MO0A 5AKLA 3AM9A 3TP7A 2E8NA 2ZM6Q 4RCOA 4P0QA 5C4JH 3VC8A 4KJNA 3D2SA 4FF2A 4CRXA 2LSSA 2HOQA 2ICIA 2DUDA 5IT9L 4A3MG 2WB1F 2EAPA 1PRTD 1EY8A 2XWJB 3MA2B 2HHXA 5CC4A 2F1JA 2B2TA 5TZVA 4HMIA 7ICQA 2LMRA 1KNEA 1VQAA 1XNQQ 4A3KG 5C0XG 1EIHA 2H3IA 4ED7A 1WTHA 2P66A 3GTQH 1SZHA 1YEZA 2AWNA 3RJGA 2Z1CA 4Y7NH 2ODGA 2R92B 1PTOD 3QNMA 3F5AA 4CE6A 3HOUB 1YHAA 1H38A 2DFLA 2OF1A 4R63A 4DQQA 2R7DA 1A0PA 2KJ8A 3WKCA 4RQ4A 2BDNA 5J2KA 4C0ZA 3KF6A 3MXNA 5EPJA 2G9DA 2JEBI 1B2TA 3Q8LA 5IIOA 1TK0A 1ZQAA 4Y2UA 9ICLA 1Q82C 1KQSA 3NEMA 3MDCA 3J81i 4ZK9B 1MIUA 1JJ2A 1TV9A 1S40A 4JWNA 4B9WA 3JAMc 4DV1L 5DQHA 4LFCL 2QB1A 7ICMA 2NTSA 4Z6EA 2UXDQ 2MSNA 2WF8A 2HHUA 2EYHA 2MFIA 4R9WA 3RR7A 2E2JB 1ZQUA 5CA7A 2GN5A 5KFRA 2FJ2A 3S1NB 3BZKA 3L2PA 4FZMA 5HNKA 5DGAA 2D6FC 2DKZA 5FLXE 3RZDB 2G06A 2BHNA 3ONNA 3QWNA 4KLIA 1YBYA 1U49A 4ZUIA 4A3CG 3L4PA 2FINB 2I9GA 5M3FG 1EWCA 2D0PA 2NVQB 1S3OA 2ASLA 1OO9B 3BS5A 4KKSA 4QZDA 1PH5A 2A6EC 3OW2A 4JV5Q 2NRWA 2C35B 2LI6A 1UE1A 3HKZE 4JI8L 1ZOLA 2M9NA 1JN3A 4DL3A 2SEBD 3PGZA 4O2DA 3D6WA 1NSNS 4J8QA 1ONLA 3PO5A 3WKAA 3A74A 3TP5A 4B9UA 5J22A 3QU2A 1KL9A 3C23A 1DGSA 1TU2B 2QDLA 4BY1B 4X5VA 2KK0A 2EY6A 3H6MA 4RGOS 4IQZA 5GAHC 4OX9Q 5K5PA 4B3TL 1D1IA 1NY4A 4CHTB 2MJ8A 1SYFA 3K5OA 3IP4B 8ICJA 3E9IA 4LJXA 4K5WA 5CMDA 4KTQA 2M00A 5AM3A 4M9NA 2PMZE 3OWEB 1UQVA 1VF7A 4KLJA 4JK1C 1LKYB 3AQFA 1NCVA 4KY5A 2ATWA 3M9BA 1EY7A 1KHIA 3HGBA 3PSFA 4JI3L 4DFJA 1TAQA 3NUQA 3J81E 4HJ8A 5DDYA 4IQTA 1XMQQ 2BR0A 2F1IA 3F2CA 4RMFA 3RJIA 4KY6A 4LWCA 3C1ZA 3C2PA 3N4MB 1JE5A 3VDYA 4P4OA 2C5CA 2DPIA 1XNRL 4P72A 3D4DA 2XCPA 1IHZA 4QF4A 1VQOA 1PH7A 1STHA 2EXZA 2OCEA 2A6HD 2KCCA 2E2HB 2KIWA 1HR0L 4TUSA 4XQJA 1N33Q 4F93B 3HOWB 1HA6A 5K4LA 3I4MG 2F0KA 3V6HA 1L0YB 1UE7A 3S1QH 5ALRA 3SR6A 1F2YA 5IIFA 4MHVA 4M04A 2AHOB 3LGJA 1B7YB 3NWTA 3MGVA 3GIJA 1EWHA 1TY0A 4JI0L 4PMCA 4UAVA 4F2RA 2WP8J 5IGDA 4FXGC 2ASJA 4RQ7A 2YYZA 2ZXIA 4IURA 5EE9A 2Y1IA 2IMWP 4KX5A 2JV3A 5J8YA 3K58A 4WJ4A 3BVGA 3F53A 1LT5D 2CFMA 1I94L 1AROP 2ICEC 2ZIXB 3E0FA 1F9PA 2XRSD 3S14H 5FO8B 2HHVA 2QGQA 5CGKA 1TVAA 2ZJRA 5C5LA 4LF7Q 1S5LU 3GIMA 1ZQIA 3T16A 3ZI4A 4RHRA 4IUPA 4YY3Q 1ZQPA 1BDOA 2CQAA 1RM6C 4C3JG 4B3SQ 4Y2RA 2B63B 1DOQA 1NKEA 1ZQBA 1Z1BA 2ZTDA 3HWTA 2K4IA 4F91B 3NBIA 4OWTB 2B2YA 1KEJA 3CW2C 5KG5A 2KG5A 1X6OA 3JC66 4JBWA 3RJEA 3S15H 1W3SA 5HY6A 5LHY1 1K8AC 4DSEA 2VANA 1ZQCA 2F0PA 4DR7Q 2IT1A 3BJYA 2BCSA 2F0FA 4RGNA 4IRCA 1JCKB 5AIBA 3RAQA 4DR3L 4UAYA 4DR5Q 4YR2A 4UASA 8ICQA 2PZUA 4PZ6A 2W03A 3S1RH 3KD3A 1X9NA 2AQ1B 1XSPA 1B0XA 4NLGA 3HKZG 4LZDA 2YU9B 4OGQC 2RSNA 1G51A 4ID6A 2VUMG 1DD2A 2K5VA 1B1ZA 3EQLC 4MZ9A 1EQRA 3RAXA 2A6ED 1XJVA 5H1SE 4GNXA 4MF8A 4M9HA 4YCXA 4DLGA 4O5EA 1Z9FA 5ELFA 1SNQA 5EGTA 5EWFA 2A74C 4DK6C 4BXXG 2WINB 2AJQA 1YHBA 4Q0FA 3H0GG 2ASDA 4JI1Q 2UUAL 2OM6A 3KFUF 3GTKB 2MA1A 4IC9A 1U5KA 3FKIB 1EQVA 1PYBA 3A55A 3NELA 5IP9G 3SI8A 2HBJA 4ZOHC 1VQGA 2WB1B 2KKPA 2EDUA 3EPIA 4HTHA 2B29A 2PW7A 3TQYA 1I4XA 1L1OA 2KBNA 2DWQA 3AMZA 3BQTA 3A56A 4N8X1 3TZDA 5KL1B 5C3EB 2ZIWA 2F0HA 4JW0A 4JYAL 3N97B 1PH2A 4DV2Q 3BDCA 3S16B 3G6EA 1QCBD 1ZQEA 2IL8A 4X64Q 4C8NA 3KHLA 5EE1A 4EVOA 1QZHA 1EIYB 4LNQA 2ZIUB 3B6YA 1SGGA 2H1EA 1JI7A 1XX8A 2UU9L 2XI9A 2WB1C 3F2UA 4P4PA 2Z9HA 4LJZC 2B2WC 1VQ9A 2CVRA 3RJHA 4JV0A 2M0NA 3PZPA 4PMBA 5JJZA 5D3IB 1YIJA 3PO2B 5AKZA 2JZBB 4KITB 2XTIA 3WKEA 3L3OC 5G3LF 5HR6A 3FMCA 1KFDA 3M8SA 2GLEA 2G07A 3PMFA 3CXCA 1EZ8A 2HDLA 2ZTEA 3V7JA 5KG2A 7ICTA 2UXCQ 1ZQGA 5IT9c 4M9GA 4HCSA 3FM9A 5DDMA 2F0OA 3H40A 3O0FA 2V4QA 2WIIB 1CFMA 2E2IB 3J81j 3QB3A 1I50H 3Q23A 3RTVA 2HOIA 1EUJA 2W9CA 2KOLA 1RKNA 2ZXOA 4F5OA 2WKCA 3WOFA 3OTQA 3GU3A 1X3FA 3FPUB 4Q43A 5M5XH 4GOPA 4NV0A 1R9TH 3OPOA 3NRZA 2W9BB 1B44D 3CC4A 4JVZA 3IV6A 2F77X 3BDOA 3UE0A 4BWGB 5CB1A 1YT3A 4KN4A 3PVXA 4DV6Q 4QWCA 4BDPA 3BYYB 3CCJA 2C2DA 1TKWB 3IDWA 2XVSA 4HEDA 4RAUC 2FHTA 4DR1L 1J6QA 1IBMQ 4FF3A 1DK2A 3D6JA 3GTGB 4KN7A 1D8LA 3VA5A 4KHPQ 4UQGA 5KG7A 2AH5A 4OHJA 1P8LA 2F0JA 4DV5L 4B9XA 1VJ5A 2WHEA 3RZOH 1HFGA 3CAMA 5GQOA 3E58A 4DF8A 1VS0A 3U50C 3OSNA 4H7BA 1GOZA 3Q8RB 1BVSA 2RQXA 1N34Q 1A3VA 3Q8KA 2W3RA 4A3DH 1K1SA 3CRLC 2W7OA 1E1OA 1SB3C 4O1NA 3K1RB 5J3BA 3JPSA 4R4TA 4G7ZC 3F8TA 3K57A 3L3FX 4DEZA 3WU2U 2HQEA 3CCSA 1NNXA 5KT7A 2UVWA 3G6VA 1SXTA 1SIJA 2BCOA 2B2UA 3OJSA 3LWMA 4YHHQ 3M3YH 3RN5A 1UPHA 4F5PA 5I2YA 1IYJB 2CXYA 4AP9A 1RYSA 3C29A 4GLVB 4RCNA 3TDQA 4JCVE 2XVTA 1D5MC 3VYRA 2DQNB 2D3DA 3NASA 4B3ML 3HOZB 1SYEA 2ATLA 5E4WC 5AM1A 1RYRA 1L3UA 1X40A 4UP9A 5KNCA 3IRUA 2R3ZA 2M9VA 4USAA 3H8MA 2F8LA 3H0MB 4QZAA 2KZZA 4A3EH 5KFGA 5J0PA 4HR7B 1HUZA 2VNUD 1S77D 1YZ7A 3I4OA 3O13A 5DM73 2JEAI 3RJJA 5D14A 4UP8A 4CDEC 2O5JC 1XWLA 2PNHA 1K3BC 5GTHU 4L5SA 4AYBB 2KSOB 3MEHA 3VR4A 4EELA 1BKBA 2QARA 3R3OA 4UAUA 2MPMA 3A0HU 2RHSB 2K5DA 3Q24A 8ICIA 1LVHA 1I6VC 2JEJA 3ZDBA 1A3TA 2K50A 3NQIA 3RBDA 1BPEA 4IS7A 5JEAJ 3U9OA 4CDCC 5LL6S 4DK0A 5KNBA 1WG8A 5DLGA 5T1GA 1PFNA 2OEOA 1JE4A 2R18A 5L1MA 2JRZA 4IR9A 2KJ9A 4JI6Q 3HOVB 1QZGA 3PW4A 4DUYL 3OMCA 2Y0SE 2Q8IB 3PO3H 4AYBC 2QF7A 3ITPA 4ULLA 5IGGA 5IYBH 3HEJA 4ECQA 2BE5C 4K2KA 2RLTA 2B6GA 3EPGA 5DG9A 2R8JA 4DV0Q 4UAZA 5FJ8G 4M6WA 4QZ8A 1Z47A 4HSPA 5D3DA 1SLJA 4CF5A 5ELEA 3EIVA 3JAME 2ZM6L 2K14A 4HN7A 4IPCA 9ICPA 3JPNA 2BCUA 3PIP3 1YI2A 1BNOA 2VJ5A 3U4ZA 1AH9A 4QZHA 2BGWA 1FJGQ 4RKBA 5KRUA 1VQPA 5C4XB 4DR4L 3ETLA 1IW7C 3TREA 2K32A 4A3FB 1HEKA 2UVVA 2EE1A 2F1MA 2R7ZB 4J9MA 4NJ8A 3W1GA 1Q81C 3A5UA 2KHVA 5KFKA 3R2TA 3IAYA 1K0SA 1XNQL 3GFKB 2HHWA 1CI4A 1STYA 2KEEA 5C44H 4E6IA 4JBKA 3PUYA 3DEPA 2YTUA 3V7KA 2Z0SA 3H7IA 1OXTA 4I7ZC 5DNFA 1UHUA 5ELDA 3S2DH 4DV7Q 4Q44A 3OHAA 3I70A 1XXGA 3B9JA 5KGUA 2N8NA 7ICLA 2J0TD 4I2JA 1U0LA 1BPYA 2J6SA 3C2MA 3PR5B 1LACA 5L1KA 4KLSA 8ICXA 5ALUA 4KMUA 4RU9A 3Q6SA 1KQQA 1Q3VA 4YD1A 1HZAA 3VR2A 4DAPA 3NGDA 2PYKA 3EROA 3EZ5A 1QOHA 1WFQA 2ZXRA 2H5XA 1WUDA 5J2CA 5KT6A 3QIAA 8ICUA 3TBIB 2R61A 3QO2A 2UXDL 5ELCA 3DMUA 4UATA 1T3NA 3K7AH 3EYZA 3RB4A 2PZTA 2RVLA 5CV7A 3HP6A 1VF5C 1Y1VH 2JA5H 1LV5A 3QU4A 4ECTA 4O9MA 4NP5A 5DM63 1EU4A 1D6EC 4BWMA 1GM5A 5LMNW 4DQIA 3HKZF 4Y2YA 4JV5L 2AGOA 1TVXA 3N52A 1SWVA 5TISU 3U4VA 2OHFA 5EBDA 1K83B 2D9UA 1ZKOA 3PF4A 2EAOA 2NO5A 4PHPA 4J1MA 4RQ5A 4ED1A 3IKJA 4YMNA 2W8LA 5CYUA 1ZQYA 4OX9L 1XPOA 4FZNA 2NWGA 3QUTA 2JGAA 1HTLD 1TWAB 2KE7A 1PK1B 2PMZF 3JPQA 2EY5A 3I4NH 1XU4A 8ICRA 2FMMA 2WACA 3NBHA 4KHZA 4QW9A 4XXEA 2BPCA 4A3MB 2YN4A 2HBKA 1N2XA 2N78A 5I4DA 4WJ3B 2R92H 1A63A 1ESRA 3HOUH 4MEYA 1O08A 1SXDA 2QB0B 5KFWA 1DOLA 1ZQQA 3H0RB 4KLQA 9ICNA 1SE4A 2I07B 3MWYW 4A3KB 3KLSA 1IBLL 4L8JA 5CV8A 1WD0A 1H9JA 4PL2A 3PUWA 1MSWD 2Z7JA 2F0IA 2Y0SG 4P2HA 3JPRA 3UQ0A 1L3VA 4C8OA 4F4YA 3MR6A 4M47A 8ICGA 4QJFB 8ICNA 5DBAA 4F4KA 2ALYB 4JBJA 5EBCA 1E3PA 4FS1A 3T56B 4I2CA 2IPKD 1N33L 2KCTA 2R93G 2F3IA 4J9PA 1D9FA 3PX4A 2JSOA 3EUB2 4IPHA 2KA7A 4IPDA 5HMMA 3UE1A 4BBRG 2E2JH 3BZCA 2BE5D 1X9WA 5ALIA 5EWEA 4C8LA 2DY7A 1NK7A 1IKMA 2X6GA 4KLDA 3CP0A 3PIPA 1LT6D 5AI0A 2B3GA 2HCIA 3KF8B 4MEXA 3QUCA 1PDQA 1K5OA 4Z6CA 1HH2P 4RQ1A 1DXMA 1UE5A 1ILPA 5IGEA 3ZD8A 5J2DA 4PZOA 5KAIU 1IW7D 4DSKA 2YMQA 5M3FB 1FYCA 2LXJA 1II3A 4ED8A 9ICEA 3I91A 3RN2A 3H8JA 1X65A 3TADA 4R64A 4ED2A 3AU6A 4XTCS 4GN3B 5EPKA 5C4ZA 4A93H 3DWAA 4C3HB 3N7PD 4LF7L 4KKTA 4EX7A 3T5HA 1N36Q 4YY3L 5J0TA 2L4NA 3RUZA 4YR0A 2HUGA 4QZBA 1D9DA 4G3IA 4B3SL 2J7ZA 4JMUA 2BCRA 4B9NA 2ES2A 1EY6A 2L9HA 2W54A 4B9TA 1HXYD 5JJLA 2PXIA 4DR2Q 1B53A 2JQOA 3KYHC 2ZIVA 1RD9D 3HZXA 1PK3A 4IOAA 1T7PA 4KLEA 3UXPA 4QIWE 4QGUA 2F52A 4P4MA 3J80L 2C22A 1AW7A 4RQNA 4DL7A 3HRZC 3MTSA 2QCPX 3L5KA 3C2KA 2BCVA 4ZLTF 4JWMA 5JPMC 5E3FA 1H9MA 4QWEA 4DR7L 5D65A 2N1RA 1QSSA 1SNPA 4DR5L 1YNJD 5CEHA 2H3FA 1WI5A 1HHVA 2TSSA 4C3IB 3RLFA 3HJEA 1KDHA 5KT4A 2DNCA 1XMQL 5J2BA 2E2HH 2GVAA 9ICFA 8ICVA 1NUCA 3KOJA 4FDBA 5K36H 3HOWH 2HVIA 1QTMA 4UB4A 1RIPA 3FVQA 1SN8A 2PQAA 2YTVA 1H9SB 1IL8A 3ZYYX 1Q3LA 5NUCA 2I6XA 3GQBA 3WK8A 3V72A 2DGYA 3M4QA 1IBKQ 1VQMA 3A7LA 4POGA 1DXSA 1JQYD 3I4MB 1TWFB 4P75A 4JI1L 3EJIA 2LYAA 4QY7A 1AFPA 2F8KA 4L63B 4ME5A 2XY6A 1Z6HA 2K4EA 1ZQLA 2R7FA 3G71A 4Y2QA 9ICBA 5IT9E 1G2SA 2Q2UA 1BBWA 2F4VQ 1ET6A 3GTOH 3K0YA 2MHVA 4EYIB 4R8NA 2E76C 2HCFA 4G7OC 1U4PA 1PZKD 1V8QA 5EKLA 1B3AA 3HFZB 4U68A 4DV2L 1KKXA 9ICXA 1CKNA 4X64L 7ICKA 4GZYC 2F0VA 4KKUA 3GTMB 4DO9A 1I4QA 5E4XA 8ICTA 2HHHQ 2MUTA 1BCPD 4IUQA 5A0LA 2DPJA 5AKKA 1PH9A 3A8JE 5E7NA 3GZFA 2DL0A 3B0YA 5KFZA 2L1BA 4CGYB 3M4PA 3AU2A 3E6ZX 1NMGA 2XSCA 1STEA 4C3JB 2F0MA 5J39A 2Q2TA 4BY7H 4FF4A 1U9LA 1Y8OB 3J7A5 3RMHA 4OO1J 3A5ZB 4RH6A 1G2TA 4UP7A 4DL6A 4I2GA 2FMPA 3D8GA 3VYSA 1HA5A 3K5MA 2ZJQA 1TWGH 2KV2A 4IRDA 1PFBA 2UXCL 5IIKA 3EA6A 4AH6A 4LVSA 3GTPB 1G8ZD 4PGXA 4B3RQ 5DLQE 1E2VA 1MSHA 1BXTA 3ER0A 2FLPA 2Z6KC 3K5NA 1Q1EA 2W9MA 2YMPA 1KLNA 2UVRA 2PQEA 2VUMB 1LTTD 4HJ5A 4H13C 4PZ8A 1KTKA 4CKBA 4JI7Q 1Y1WB 2K4PA 3GTKH 1F44A 4K8IA 4DV6L 2I0QA 1MJEA 2VIXA 1SZPA 3RH4A 1S9FA 3RJFA 1VLBA 7ICJA 7ICEA 1IBML 2I5LX 4K2LA 4KHVA 3H0GB 1FNVA 5KFJA 3S17B 4KHPL 3MFIA 3V2TA 2EYFA 1S8OA 8ICFA 5LL6X 3NVYA 3AQEA 4MTKA 3PV8A 1HZ9A 3KOOA 4PZNA 2XRQD 2VJ4A 4BY7G 4Q8FA 4L5QA 3T5KA 1ZETA 1T5XD 2KFNA 3CCVA 3KBBA 1KLGD 2G09A 1N34L 4ED3A 2KVSA 1NKBA 4ED0A 4C4RA 4DOCA 1ICWA 4HMJA 1H9KA 2K8CB 1TQOA 4KLLA 4F4XA 1GUSA 3HOXB 2G5IB 5AK4A 1NTGA 1PYSB 2F0WA 1SSOA 3NTKA 2JH1A 3I55A 4Y2SA 3PO2H 1LYLA 2BQUA 3MDAA 4ECYA 3S6JA 4R65A 1L8OA 2LPEA 4QUFA 3LWEA 4YHHL 1ZQHA 5A35A 4AIMA 1C20A 4YFKA 1F2LA 2K60A 5KNIA 2IHFA 5KFBA 5IGFA 1KIXA 5KG6A 2D2CC 4J03A 5H2FU 1T8EA 2ZJ5A 1B4FA 4UB6U 3MEFA 4PNYA 3OTOQ 1VQ7A 5KAFU 3R2IA 2K89A 4I2AA 2DJGC 5COYA 4UW9A 1J2NA 3WK4A 5BN5A 1A8VA 1X56A 4R4OA 4EBCA 1B22A 4LF9Q 2ESEA 3FPPA 1TT2A 3GDEA 4BWJA 5DB8A 3GILA 1X3GA 2D5DA 5FK9C 2CN1A 3HW8A 3T5LA 2K04A 5ALSA 1S0NA 5T14A 1TWHB 3KKAC 1LKYA 1A2TA 4UBBA 1EOVA 2Z6BA 4P0PB 3BJUA 3D3RA 4APVA 1LTAD 1KSPA 1OXUA 1AE3A 1PH4A 2RF4A 1ZQWA 3HRDD 1TWCB 3GTGH 5C3WA 4NKLA 4YCWA 3RH5A 1NR4A 3V05A 3ORYA 4OJ6A 2BOSA 2ZTCA 1Q12A 2LS01 9ICSA 1MJCA 4NM1A 1KLUD 1SJHD 1NJIC 3N7SC 4O3NA 2ZJ8A 3JPOA 3NPPA 4NLBA 1CA6A 4JI6L 2PFNA 4NLKA 2Y0SF 5LMNQ 1V85A 1PHJA 3ULLA 2A68D 4IFDG 2FPLA 4UHVA 3WKDA 5M5YH 4PHDA 4IJHA 3ULPA 4HYKA 3T13A 2EQYA 1V1PB 4OO1I 1WYGA 3H15A 4GC6A 2W9AA 1GUTA 2QKIC 4F2SA 4EQPA 5CV6A 4R4IA 4XQNA 1QVCA 2ZUDA 2OT2A 2CW0D 4GLAC 3CMEA 2A73B 1ENCA 1FJGL 1OXJA 4MNOA 2PZWA 1BUVT 4IQVA 1QSYA 2QEJC 3NK9A 2AU0A 1Q1BA 2W11A 1EXNA 5C5MA 5IYDH 2FJ6A 5D4BA 4J9QA 4YIJA 3FEWX 2SDFA 2ZIXA 1SNOA 4DA2A 2DBYA 1E24A 3D0FA 3A8KE 4DV3Q 1XPRA 2RRDA 4RT2A 3T1HQ 3HOZH 2OEHA 4PL1A 4R1JA 4P0QB 2YV5A 1QLNA 3RF9A 3T3FA 1SYGA 4X66Q 4C2MB 4C80A 4DQSA 1U4LA 4ZUJA 1SMYD 4DV7L 8ICSA 3HX0A 5DG7A 3H09A 3K6OA 3FHWA 3J80c 3GTJH 2AQ0A 2P35A 2NV3A 3MFGA 4A3DG 4ELUA 4ICAA 1SE8A 4X3KA 1QSLA 1LTSD 2LY7A 1JR0D 4UARA 5IYCG 2G5DA 3RLNA 4BXOB 1QJOA 1BOSA 2AQ3B 1IG6A 4OIJA 2B2VA 3LWLA 2Q2HA 3NENA 1W2BA 4Y52H 4EZ6A 5IINA 1MKHA 3D4RA 3MXNB 5GAGC 3OGUA 2DUYA 4O0AA 5KIXA 1ASZA 3BQ0A 2B21A 5ALYA 4FFDA 3VA7A 2EJGC 4QZGA 5KFIA 2R8GA 1O7IA 2WF5A 2VKQA 1RL2A 2E5LQ 3WK5A 8ICZA 1KTQA 1GUOA 2NO4A 1SMXA 3G7LA 3HOVH 3BVMA 3I90A 1VQ5A 2K52A 2V9WA 2R8IA 1VQ4A 2IOFA 1T9HA 5JPNC 5AJ3Q 2AQ2B 3U58A 1R4QB 2HQLA 4FE3A 3UDGA 3ISBA 4NXMQ 2Q4TA 2KKVA 4B9LA 1N8RC 5JRTA 4CF3A 4QZCA 4YP3A 1ZQSA 4U673 3QG1A 1CEZA 2V4DA 4FBTA 3PW2A 2B2WA 5L37A 4UB8U 4EX6A 5KFFA 4CCHA 2KEDA 4LF5Q 5ALQA 5KG1A 1CK1A 4Y2XA 4YWKA 4A3FH 4QW8A 2R7ZH 2F0DA 3FP9A 2EY2A 3WK6A 3UDXA 4ABNA 1UT5A 1SE2A 3UDIA 2JA7B 3LNNA 2MAXA 1A15A 3UXOA 2FPKA 5AK3A 1ENFA 2AWOA 2ZIUA 1BGXT 3ULJA 5KFLA 1O7YA 2EYOA 3GO5A 1L6NA 5EQ0A 3SK4A 1JALA 1RDFA 2PKEA 2HCCA 2K6AA 3DM1A 2XC9A 4GKKQ 5IYBG 4BBSG 3MR3A 4ME3A 3M6KA 4CBVA 3NUCA 2N55A 4K6LA 3SEIA 3M9NB 4FS2A 3AB9A 2LHTA 4H02A 1X9MA 4A3IG 3I76A 2C2RA 4LW1A 4CKCA 1E2ZA 3E3XA 4QWDA 1FGBD 3PF5A 2JA6G 3I72A 1NBWA 9ICGA 4IALA 1M4VA 2BQ3A 4DKAC 3K8AA 3NSWA 2NN6G 1UT8A 3SR1A 4IQWA 3TAPA 2JXMB 5KT5A 3H8WA 1L3TA 2BDPA 2DN8A 4R4CA 5IGCA 1LTRD 4DCCA 4LZGA 1X3PA 2EJFC 4C8KA 1SROA 2WFWA 1D7QA 4BX9C 4DFAA 4ECVA 3CQZB 2W9BA 4F4ZA 4LMQD 1VQCA 2A8VA 2W8KA 1XPUA 1K83H 4HIDA 4C4TA 1EY0A 2JN4A 4IUTA 4XUSA 5M3MB 2OYYA 1N60A 3CRKC 5JEAH 1YNNC 3CRXA 1TIID 4RWSC 3BQ7A 1N36L 3SK8A 3K0XA 1TWAH 3NVZA 1SAPA 3GQCA 4HJAA 4B9VA 1NK5A 4X3UA 1CZWA 3U26A 4QIWF 5KL8B 4A3MH 3J81L 1BR9A 3OW7A 3Q8SB 4O3OA 3TANA 3OWFA 5KNDA 2JA5G 3IFDA 4EQNA 1EEFD 1YITA 3GTMH 4DFDA 1F2ZA 4LK1C 4F50A 4RQMA 5ALPA 1AZPA 1WCMH 1Z3EB 1B3QA 5A2QE 2KHJA 2ID0A 4ILWA 1L2FA 5F9NA 2LKVA 3IFTA 1PVRA 2RHFA 3AL0B 4ACOA 3PX6A 2IX1A 1K8MA 3D31A 3SDZA 1NK0A 9ICUA 4DGZA 2K7VA 3ONAB 3PCOB 1U47A 3E0EA 2YY6A 2ASBA 1IBKL 1QQ7A 3PUVA 1H95A 5C4JB 2R93B 1DK3A 2K33A 4GC7A 4BBRB 1UA0A 4NLZA 2LM1A 4K4IA 3I4NG 5CJ7A 1SL1A 4PGYA 3K5LA 5ALZA 4KJOA 4QZ9A 1V38A 4TKOB 1YJNA 1I5FA 2D0OA 4PMWA 2VQEQ 2E8GA 1CSQA 1EEID 4RNMA 4FXDA 1MQ2A 4YCVA 4GNXB 1JUDA 4C8MA 1WOCA 3R93A 5M3FH 2F4VL 1VQ8A 4DR4Q 2PNRC 2F0EA 2KSOA 5EPLA 4B9SA 4I2BA 1VQIA 5AKXA 4RPZA 2VY3A 4RGMA 1BO0A 4C3HH 2KTQA 4NXNQ 1Z4NA 5BOMA 4RG1A 9ICQA 5DAUA 3GV3A 3URYA 2K8AA 1VDZA 4KD3A 4XQ8A 4YCUA 4DU9A 2ZXHA 2HHHL 1ZQRA 3TQ1A 3NHHA 2R8HA 1L1OB 5BN3A 3KHRA 5DLFA 4RKLA 9ICHA 1CKOA 2IX3A 1A0IA 3C1EA 4M2YA 3I56A 4GNXC 1X55A 4XT3B 4I7AA 1IZ6A 1S76D 3H4DA 5J0YA 4YMOA 2F0QA 3HG9A 3X3NA 1A76A 2WFAA 1GHJA 2LM4A 4Q45A 3G4SA 5J2IA 3OHXC 2YQEA 2CH4W 1V1OA 3JAMi 4JUZA 2DF4B 2XY5A 1XC9A 4M0AA 5JVH3 4DWIA 4GXIA 2F0LA 4C3IH 4WJ3M 4A3LH 5J0XA 1MN8A 5AKYA 1S97A 1L1OC 2K4KA 4PV1C 4XYOA 2VW9A 3MXGA 2RBMA 3KLSX 4MFFA 1N61A 3RB6A 1L3SA 2JA8B 4B3RL 4A93G 5ALEA 1I6HH 1KBUA 2OTJA 3CU7A 3GTLH 4KY7A 1FL0A 4DPGA 3HILA 1HJPA 1FFUA 1F2MA 2RQ5A 1VCIA 5T1IA 4EBEA 4RQ3A 1DYQA 1CSPA 2DKXA 1TR5A 4JI7L 3I4MH 1TWFH 3CC2A 2ENBA 5IODA 1WD1A 3IL8A 1GVPA 3PW5A 3H4BA 1YNND 4A3BB 5CR3A 2JA9A 4EEKA 2W9CB 1K9MC 1ZXIA 4TVAB 1KFSA 2EZVA 2F0SA 1D1KA 1LO5D 2NZOA 2VB2X 4GLXA 4O42A 3I2ZA 3GV6A 2GWSA 1EYCA 2NB0A 5KFMA 2K28A 3HOYG 4A75A 1VQHA 4C7YA 4M1UB 4OJ5A 1YJ9A 2XY7A 1M90C 4UBCA 2L15A 4P73A 3PSIA 2JEGA 1VQNA 5DG8A 2EY1A 3ZDDA 4NLCA 1I4GA 2MQHA 4EX5A 4YG2A 3KHHA 4DSJA 2C2EA 2KFZA 4AQYQ 5K36G 2LYBA 4QQBX 3HOWG 4IL6U 3FYHA 3EFXD 1E2WA 2PO4A 4DS4A 3QX7A 1PVQA 5AK6A 1CTMA 4C3JH 1PRTF 5C0XJ 1HIWA 1N9WA 1OXVA 1WTWA 5ALLA 4ZH4A 1A6SA 1SFOB 1C0AA 5I6WA 3D2QA 4TUQA 2E8PA 1ZYRC 3PUXA 2HW3A 3SK6A 1Z7TA 1TY2A 2ES6A 2QILA 1I3QH 1PVOA 1NAPA 1PTOF 4R66A 3OTOL 4EZ9A 4A3JH 1PVPA 1NKCA 4OEMB 1Y88A 3FC4A 1Y8PB 9ICKA 2BH2A 1RXWA 3TAQA 5FLMH 1MGSA 3K4GA 4B6JA 2VS1A 2NYZD 4XQQA 1IKLA 4LF9L 4JI8Q 4UY8C 1SWWA 2EZZA 4FF1A 1YZ6A 2QLTA 1B4OA 1OXSC 4LF4Q 4OCZA 5KFDA 3KBGA 1X3QA 2VQFQ 1Y1WH 5JAVA 3VYTA 1MC8A 1HPCA 2QB0A 3EW9A 4PHEA 1PZID 1EY9A 3MHBA 3G6JB 4JI5Q 1N5XA 2W43A 4EQ5A 2VZAA 1TK5A 1S0VA 2HVHA 5KTQA 3S17H 3SMVA 3JPPA 5AKIA 2V1CC 2NYVA 4J6HA 3S1MB 1ZEQX 4QIWB 1DONA 2KQ3A 3MABA 3RRGA 4TQSA 2Q8RE 5FLXc 2FLNA 3PIO3 2JYOA 3J80E 3L7ZC 1QVGA 5AI6A 5LMNL 1PZNA 5LMUQ 4ED6A 3EVQA 4X65Q 4HIOA 1XSNA 4BY7B 2KICA 1ESFA 4A3GB 2UUCQ 3I7FA 3TP6A 4YWMA 2KD1A 2XGTA 5KFTA 1P16A 4I2HA 1G91A 4F87A 3HOXH 1J5EQ 1K1QA 1Z00A 2RCFA 4QIWC 5KFPA 5KFQA 2KENA 4MIUA 2NVTB 1XYIA 5AM4A 2E8MA 1TK8A 3STBC 4ECUA 5KFAA 1ML0D 2O4XA 5AKEA 3E2EA 2Y9UA 2MO1A 3I73A 5CV5A 5J0WA 1BQQT 1TAUA 2RA4A 3QXGA 3S24A 5FOBB 4E0DA 3GV5B 4KLGA 1QUQB 4M9JA 4NXZA 1A77A 2BDUA 4DV3L 1JMSA 3T4AC 1ZD5A 4RPXA 8ICWA 1RJTA 1S5FD 2PW5A 4X66L 2FFKB 1JXLA 3FDTA 4YXJA 5J2GA 2JMGA 2XO7A 3J81c 5FO7B 2MUYA 1N56A 3CHBD 4G9BA 3ZJYC 1TWHH 1SNMA 4JB3A 1AEXA 1CKMA 8ICHA 3V6KA 3SGIA 4RZRA 1JICA 2PPBC 5ELBA 2CRXA 4OO1H 1SKRA 1EQTA 2IHEA 4QUCA 4X3TA 1EL0A 7ICNA 4AYBE 2LKYA 1V97A 1TS4A 3DHQA 3PO2G 2RP5A 1C4QA 1TE2A 2Y1JA 4OELB 3TZUA 4J15A 1VMCA 2P6RA 7ICHA 1X32A 3THVA 3CCUA 4O5CA 2OWOA 1RXVA 1CRXA 4KLTA 3Q22A 4OWXB 4DXGA 3S1NH 4GKJQ 1B43A 1WYDA 3OSPA 1SR3A 2KECA 2Z8LA 2UUBQ 8ICKA 4K5XA 2HBMA 5IIJA 3VCBA 3RZDH 1SEBD 3MAQA 3RNUA 1XMOQ 3F1ZA 2E5LL 1WWUA 5JJKA 5HGQA 2Z4IA 1ZYRD 1VQLA 5ALHA 5AKJA 2RDJA 5C0XI 2NVQH 3QZ8A 3QYPA 5DKWA 1ZD4A 3I4LA 1E1TA 5AJ3L 4NXML 3NS1A 3NE5B 1QH9A 1PA6A 3AFPA 4N8FA 5ALWA 2KZMA 1I50B 2PI2A 4B9MA 5I6YA 2AKWB 4OWWB 4BY1H 4B08A 5IP7H 1Z1VA 1EU3A 2QW7A 1XS9D 4X62Q 2RCNA 1DZ1A 4LF5L 1QQ5A 3SZ2A 1KW4A 5ALDA 5CHGA 4ECRA 3PV0A 4GFJA 2LBOA 4DQPA 1EY4A 3WOEA 3UXNA 1V1QA 4KK7A 4IO9A 3GV7B 4YWLA 1HNWQ 3C46A 3LYSA 4C2MH 2B0CA 3M7GA 1WTXA 2FMSA 1STBA 4HCEA 3WWVA 5CRXA 3B0XA 4Q8EA 4DL4A 4MN3A 1PFMA 2A1JB 4J9NA 3K7UC 2H3QA 1E0BA 5IWAQ 4NWIA 4GKKL 2OH2A 4IFDI 2I1QA 3PIOA 4DFKA 2XICA 1EYDA 1VQBA 5I2XA 1K73C 3DUZA 2Z6KA 2YB4A 3HKSA 4M8AA 1J97A 4A3DB 2BPFA 4Z6DA 1ENAA 2EDGA 3HP3A 1DM0B 3H3VC 1QWYA 1FFVA 2G08A 2K4HA 3GV8B 1STGA 3W2DA 3MFYA 5IYDG 2W55A 4LFBQ 2F0GA 2JEFA 1G291 1T4GA 9ICIA 1GO3E 3D2NA 1SBBB 2IOHA 3M6ZA 4FBUA 2K5HA 1Z19A 1D5ZC 3H3VI 3M3YB 1OXXK 4FNFA 1PYWD 2YMMA 2KIVA 4F88A 4HIMA 1COOA 4Y2JA 4OJOA 4BUGA 4YN4A 4TQUS 7ICIA 1MI2A 1UCVA 3M8RA 2OQ0A 1ZQOA 2K05A 3STBD 1Y8NB 1NOMA 3SAHA 5G3LD 1PTOB 1J8IA 1T3QA 1SDFA 3AYHB 3VYUA 1ILQA 1NI3A 1S4ZA 3CF5A 3NVVA 1Q86C 4YR3A 1BPDA 5ALKA 1SJED 4GIBA 5TSSA 3M4OB 3ZDAA 3UMBA 3Q8DA 2GO7A 5FJ8H 4AYBG 1RQLA 1FR3A 4ODGA 5I9OA 4EQOA 2B63H 5ELNA 2MU2A 4DFPA 1PV4A 1DGJA 2JA7H 1KRSA 1Q46A 2LYHA 5GROA 4HJ9A 2K5QA 1PTOC 1TS5A 2B8GA 3CP8A 1JT8A 4O3MA 1KDBA 2HMXA 2AXTU 4EGVA 2JP1A 1L5UA 3QOJA 3FRPB 3E9HA 4IPGA 3ICEA 1X42A 3HOVG 2F0UA 3OOCA 4DAYA 1OUQA 4IUNA 5AM2A 3KBXA 3WKBA 2NRXA 4X3SA 5J2EA 2AMCB 4XYQA 4POFA 3OIQA 1EQQA 3KKAA 1MQ3A 2YU9H 2E1EA 3L0OA 3R9KA 2A69C 3TADC 3EWAA 4BBSB 5KFOA 8ICCA 4IQUA 5GAEC 1Y69U 3MFHA 1E7ZA 1N62A 3HKZB 5ALVA 1O80A 4A3IB 1B70B 4IRKA 1LLRD 5BR8Q 4A3FG 2JA6B 1B9NA 1D5XC 2P6UA 2IA6A 4KMOB 1JWUD 4DR6Q 5CBEE 4RPYA 3KUPA 4A3LG 3AQQA 1S0MA 2AUJD 2NRZA 4CJ0B 4DFMA 3FKIH 4YMMA 5AKGA 2VQEL 4NL9C 1ET9A 4NY8A 1LUZA 2KJXA 5KG0A 3SQIA 1HNZQ 3CQZH 3H91A 4OL7A 1GUWA 4DN4M 3RD4A 3SVMA 3BQ1A 1N48A 1QILA 4DUZQ 2PMZB 4WJWA 5FO9B 3TSSA 4IJLA 1QVFA 3HKZC 5C3EH 1KC8C 5EKKA 1HCZA 5M3MH 5J1ZA 1IIPA 7ICGA 3G6YA 2JE6I 1GUGA 4NXNL 2RHQB 1K8GA 5KT3A 3S16H 4EEYA 4DSIA 1F9SA 2ZT9C 3BYTB 2WKDA 3RLOA 4GXJA 4CJ1B 4MTNA 1QQ6A 4ZQ3A 1A2UA 3UPQA 3AUOA 1XO0A 1HTPA 3C21A 2PMZC 2NN6I 4RQ2A 2KOBA 3CCEA 2IY5B 1G6PA 4DQRA 2KJ5A 5CORA 3CCLA 5DB7A 1AZQA 3I3CA 1RCVD 3A0JA 4JK1A 4JV2A 1SL2A 1C8CA 2EJMA 3PX0A 1A3UA 2MUTB 2WAQE 2EAMA 1S72A 2JA5B 9ICMA 3N28A 3KJOA 2NVYB 1CUKA 3SV4A 4DV4Q 4CDDC 4JOIC 4LUOA 3Q0AA 5JOBA 2L55A 4N9TA 2E2IH 4PH5A 3HS0C 2LMCB 1JMCA 4RQ8A 3AN1A 2YX8A 2PI5A 2IW3A 1ZQZA 1F9QA 5JEAG 3MBYA 3ERSX 4C3IG 5AM0A 1PMRA 1U4BA 1HUNA 4V0BA 3G48A 2R93H 3FDSA 1FEZA 4R8UB 4BBRH 3M1YA 5KFHA 3KDFB 3ISCA 1SKSA 1MHWC 4M9LA 4IUUA 1PH3A 3D6CA 2PI2E 2CWAA 2YTYA 3AEVA 1ECWA