1IXRA

Ruva-ruvb complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
135
structure length
135
Chain Sequence
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction DNA helicase ruvA
publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 29
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ixrA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ixrA01
3STBD 5KTQA 3V6JA 4QWBA 4LFBL 3RJKA 1MSWD 3PW4A 4DSKA 3U58A 3RBEA 3C1ZA 4ECQA 4EX5A 3GIKA 4LFBQ 1XTDA 3MBYA 5DB7A 3GIJA 2VS1A 3S1MH 2K14A 2R8IA 4OO1I 1B8AA 4KMUA 4POGA 1TWHH 2UUBQ 4IPGA 4M9JA 5J0WA 1J5EL 3KOJA 2R8GA 9ICAA 2K5HA 1T8EA 4MFFA 8ICAA 2HQLA 4JI7L 3CCRA 3J81j 4Q43A 4C8LA 4K4HA 1N56A 3KDFB 2HHWA 7ICJA 4JI7Q 4LF5L 4UBBA 4IFDJ 3Q8QB 2BDPA 3A74A 3ISBA 2VY3A 4LUOA 1MIUA 4ECTA 3ZDDA 3PR5B 4G3IA 4QIWE 1SLJA 2BQUA 3HOWG 5J0SA 3G6EA 5DQIA 4IOAA 3H4BA 2HHHL 4JI2L 1TAQA 4QZFA 1KHIA 3CP0A 3CPWA 4DUYL 4J9NA 2GN5A 3S24A 2HHHQ 5DG8A 4X5VA 2JA7G 4JI2Q 1RIPA 3KYHC 4OXPA 4R1JA 5J0RA 4PGQA 2BGWA 2IX0A 3C23A 4J9QA 1U49A 4A3FH 3GTJH 4ECSA 4F5RA 1L1OA 3JPPA 4QWDA 2QGQA 4PZ7A 1XMQL 5KG4A 2R93G 2W9BB 3RJIA 3PO2H 4M6WA 8ICQA 4DAYB 4QY7A 1R9TH 4EBCA 2W9CA 4A3BH 1EUJA 5CHGA 2FPLA 4A76A 1SMXA 1WCMG 1EIFA 1JXLA 2JA5H 5KFCA 1UEBA 5JUMA 2ATLA 1XMOL 3TEHB 4F5PA 4ECUA 1B43A 2KCMA 2AGQA 2HHQA 9ICOA 1NK6A 2AWNA 1ZQVA 1XMOQ 3OJSA 2F4VQ 4YD2A 5IIKA 4A3EG 4DR2L 4DR3L 3HOUG 4JCVE 4Y52H 3PUYA 4KHPL 2MUTB 2YTYA 1PZNA 4DR3Q 3Q8DA 4YXMA 4O3QA 2C35B 2ZJRA 3S15H 1X56A 8ICGA 4O3RA 1UE6A 1XWLA 5M3MH 1ZQBA 2JZBA 5FLMG 5KFMA 3HOVG 4IRDA 4J9OA 4NB3A 3G6VA 2HVHA 4A3CH 4P4OA 7ICPA 5DBBA 2BKEA 1U48A 4KLLA 1LTLA 2BCQA 4J9SA 4DL2A 3C5GA 4DQRA 2MO1A 2MQHA 4EYHB 1BPEA 2KTQA 1V43A 2VZAA 4RPZA 4HJ5A 4DV0L 3PIPA 2R8KA 4XA5A 1TK5A 3GTKH 2WAQE 4GKKL 1PFSA 2PNHA 3PUVA 5FJ8H 4DV0Q 2LSSA 1KSPA 4KHZA 4DLGA 4Z6FA 1TWGH 3K4GA 1WCMH 4OWXB 2C22A 4I2DA 2C28A 1QVCA 5KFVA 4F2RA 2AHOB 2YTXA 1D8LA 1HUZA 5JEAG 3UDGA 4P74A 1Z9FA 3BQTA 2B63G 4LFAQ 4PMWA 2ASBA 4A3GG 1M1KC 3PW7A 4A3EH 4PZ8A 2I0QA 4Z6EA 3OSPA 2V1CC 5JJLA 4DFMA 1HZAA 1TXYA 3PMLA 1I94L 3AUOA 3B6YA 2IT1A 1MC8A 1ZQFA 4LF4Q 7ICSA 4YVZA 5BR8Q 2YU9H 2UXBL 4ECRA 1K73C 1I94Q 4LF8L 5M5XH 1VQLA 5KFDA 2JA9A 2A1AA 4JBKA 3RJJA 4IQTA 1BPYA 1NKCA 3BQ2A 1JX4A 3OHAA 3STBC 5KFZA 4DSJA 5DB9A 3CMEA 4IRCA 4UY8C 2QA4A 1YIJA 4HIMA 2Q2IA 5DLGA 1TAUA 1ZQIA 5KFPA 4ELUA 5IIIA 4ALPA 3RJFA 4J9RA 4C8NA 3CXCA 3CMAA 1U0LA 3D31A 3M9BA 3Q8MA 1GKHA 1PH6A 5DBCA 1N32Q 3HOZG 3PUWA 1ZQJA 1JN3A 4FBUA 2HIXA 4IFDG 2I5HA 4A3MG 3W5OA 4LF7L 1TV9A 5J2JA 3WWVA 3SGIA 2D0PA 1S97A 4LF7Q 4DV5Q 1NJWA 3W1GA 5HMLA 3MR3A 2DUDA 3KF8B 2PXIA 3SV4A 3RH6A 5LMNL 2VNUD 5K36G 3GFKB 2I9GA 1C7YA 2ZM6Q 3UQ2A 1KL9A 1U5KA 9ICWA 2UVWA 1KAWA 2B63H 4RMFA 2WTFA 1HNWL 4DWIA 2VL6A 3RJHA 1K9MC 4A3LG 5J0TA 1HNWQ 3LWLA 3BQ1A 3OTOL 2HW3A 2UXCQ 2BH8A 2DFLA 2NN6G 1PA6A 3PO5A 2Y0SE 4MTNA 4M9NA 3PW0A 1LV5A 5IIOA 4YMMA 1VQDA 5C3EG 2ZUCA 3ISDA 4O3OA 2BQ3A 5IYCG 1OXUA 2RHQB 2E5LL 1VQ4A 2IBKA 3I4NH 2OCEA 1M90C 4JOIC 5KT2A 4FS1A 2D0OA 3HOXG 2J6UA 2KFNA 2E2IH 1A76A 5KT5A 3HW8A 4ED6A 4MFCA 4PHPA 4I2JA 5ELNA 3I55A 2ISPA 2D62A 3PO3G 1L3SA 4ELTA 4R66A 2V4RA 1XNRL 5J0XA 3HOYG 3F2BA 1CKOA 2HHUA 4KLSA 1L2FA 3V7KA 1XNRQ 3KLWA 3HOZH 4JYAL 4I2CA 4DQSA 2PQAB 5KT4A 1G291 2RF4A 1NK8A 4A3MH 5DB8A 5LMUL 4FBTA 3KF6B 5EWGA 1WCNA 2N8NA 5JJKA 3FP9A 7ICOA 2XGQA 2UVVA 3U50C 4HJAA 4X65L 2EQSA 2Z6KC 2FMSA 4KLOA 1L0WA 4DSLA 1YNXA 2ZJPA 4X65Q 1VQ8A 1D9FA 1S0NA 3UXPA 1GM5A 4P71A 4JV1A 2Q2UA 4A3LH 3RAQA 4GLAC 4XQ8A 2PI2E 1K8GA 3I56A 2BH2A 3CW2C 1YEZA 2P6UA 1KIXA 3PNCA 1N33Q 1VQ6A 3C2MA 5DG9A 3GTOH 4XUSA 3H40A 5GQOA 4M04A 5KFKA 1H38A 3EW9A 3F8TA 3HOXH 3OGUA 1E1TA 1TKDA 2K52A 3RLFA 3MGIA 3UDXA 4X66L 3V7JA 3PVXA 8ICUA 1A8VA 1B22A 3MXNB 1Z3EB 4X66Q 3TRZA 2C2DA 3PW5A 4O3SA 4HYKA 3QEBZ 1G6PA 4FO6A 2A19A 4BXOA 1A63A 3HP6A 4A4IA 3M3YH 3RR7A 3SI8A 1NMFA 3MABA 4DV7Q 4YR0A 1ZQUA 4P75A 4M9LA 2WFWA 2RHSB 5KFEA 4P73A 3N4MB 1NE3A 1SROA 4R8UB 4NLKA 3C2LA 4IPHA 2HT1A 5DLQE 4DR7Q 2NVYH 4RQ2A 4JWNA 1YHQA 1OXVA 1VQEA 4C8OA 2JA8H 2BPGA 1L1OB 2XY6A 1N36L 3K7AH 5IP7G 4YQWA 4I2AA 1T4GA 2B3GA 1ZQEA 2VW9A 2W9AA 3HWTA 1TWFH 4RQ4A 2F52A 1K1QA 4M6WB 4F4YA 4KLUA 5HY6A 9ICJA 2FPMA 4NXNL 1KLNA 1LYLA 2W9CB 2Q2TA 3M4OH 3S16H 2OTJA 2IMWP 4M9HA 1KXLA 4NXNQ 4DR6Q 1Q8KA 5J2KA 1ZETA 4TVAB 4GS3A 4IQWA 4IR1A 4A3DG 4B9SA 8ICNA 3UDFA 1PH1A 1WYDA 4RUCA 4ED0A 2IX1A 4OX9L 3Q8SB 1KFTA 4KLQA 4GXIA 2XY7A 4QWCA 3H15A 1RPLA 2BCSA 4PGXA 5J0QA 4KLDA 3RR5A 3BJUA 4DV6L 1ZQHA 1I5FA 2JZBB 3F2CA 2MO0A 4IOCA 3B0XA 2R8HA 2K5VA 4HJ8A 5EWEA 1S0OA 4Q45A 4IRKA 4DV6Q 1NJXA 1OXTA 3J7A5 4RQ8A 1RXWA 3SV3A 1CKNA 2ZJ5A 4Q44A 3JPTA 1KRPA 2R92G 4DO9A 3BDPA 2XTIA 3H8SA 4RT2A 5DGBA 4DUZL 4KI0A 5BOLA 4R4QA 3GTLH 3KHRA 1KDHA 4DAMA 2AJQA 5DG7A 2P6RA 3K7UC 2KBNA 1TVAA 5J2GA 4BY1H 3M85A 4DUZQ 5KG7A 3CQZH 4P4MA 1S0MA 2PFNA 3GV7B 4QZAA 4JI4L 5J0OA 4PH5A 1UA1A 2EXDA 5GAGC 1TK8A 2YYZA 5FLXc 1E24A 4EYIB 3E9HA 4BBSG 3AYHB 2YTVA 3BZKA 3U4ZA 2RCNA 1XPOA 3RTVA 3D0FA 2W8LA 2V4QA 2GWSA 4PPXA 1J5EQ 5L1JA 3TS0A 3NELA 2OQ0A 4ECZA 2F1JA 3L0OA 4YCVA 1X55A 4RNNA 3J81c 4LF5Q 1VQ9A 1NK5A 3TREA 3HPOA 4MNOA 3PF4A 1EQQA 2BQRA 1UA0A 3H3VH 5DDMA 1Z00B 3I4OA 3M9NB 4BXXG 1X9SA 1VQGA 1OXXK 3DM3A 4DPGA 4GN4B 3QE9Y 3RZDH 1HZ9A 3G71A 3GIMA 3GO5A 4DL4A 3I4MG 4DUYQ 4DR5L 4OWTB 3KHHA 3GDXA 2IHMA 4R65A 1X3EA 4DR5Q 4J15A 4JK1A 3S2HH 4JI1L 4BWJA 7ICVA 4GLVB 5DBAA 3Q8KA 2N3SA 4PG3A 3LDAA 4JI1Q 3JPNA 1CKMA 4QQBX 1XMQQ 3VDYA 4EZ6A 5HHHA 4A3KG 3S14H 2HHSA 1PH8A 4Q8EA 1ZQQA 5KFGA 4UB1A 1YJNA 2LYHA 1UE5A 4JOIA 3PX4A 1CUKA 3ER0A 7ICEA 3MDCA 1A62A 3V6HA 1ZQPA 8ICSA 1JB7A 3K80C 1KRTA 4GKJL 4IQVA 1W3SA 1QSYA 1QUQB 1HJPA 3CCQA 3RZOH 5E7NA 3IM1A 4B3RL 3RB4A 3M8SA 2MFIA 5J2FA 5KFXA 2AMCB 1XC9A 2BA0A 8ICTA 2NRXA 1ZQTA 1JXEA 2Q0ZX 1XNQL 4GKJQ 4DR2Q 4JV0A 2OTLA 4UB3A 1QZHA 5KFIA 3HOWH 4B3RQ 1ZQWA 3MR5A 3G6XA 1XNQQ 4KHPQ 4TURA 2A1JA 2NZHA 4BBRG 2DPJA 1VQOA 1E1OA 4UB2A 8ICIA 2CWPA 3GV5B 4I28A 4GNXC 2JA7H 2NVXH 2HHXA 1PYBA 2XGPA 4JBJA 4GLXA 1X9NA 1PH3A 7ICLA 2Z6KA 2Y1IA 4KLKA 2BR0A 1JMSA 1T7PA 3FKIG 1ZQZA 3QZ7A 5LMNW 5CB1A 1HNZL 3F2DA 2AU0A 1ASZA 4F50A 1HR0W 4YXJA 1EFWA 4X64L 2R93H 4PZ6A 8ICFA 5IILA 5JJIA 2DGYA 4XRHA 2F3IA 4TQUS 4X64Q 4DL6A 2AQ0A 4JI0L 4BDPA 4A3KH 4GKKQ 5M3FG 4LW1A 4RNOA 3A5UA 5HP4A 7ICKA 4JI0Q 4NXML 4AH6A 4UBCA 1JT8A 3TQYA 3PV8A 4GN3B 4QW9A 4NXMQ 4GOPC 3BU2A 2GVBA 5J2BA 2GVAA 8ICWA 2QEXA 4RQ1A 4QZIA 3Q8PB 3ORYA 1XS9D 5C44G 1GO3E 2M9NA 1JIHA 3HOUH 4UB4A 2PMZE 4MEYA 4BGDA 4TUSA 1KC8C 2LXKA 3PW2A 4B3SL 1Q12A 1N8RC 4AQYL 2I1QA 4IPDA 4DV3L 4JI5L 1B7YB 2UXBQ 2R7ZG 4ELVA 5FLMH 4LF8Q 3HOVH 5DB6A 4QZDA 4DV3Q 4JI5Q 2KHJA 4LWCA 2VQEL 2HHVA 3CCEA 4IO9A 4ED3A 4JV5L 1ZQOA 3HKZG 1AROP 4AYBG 4M9GA 3ZDCA 4QWEA 1S10A 2VQEQ 2W9MA 4ECWA 4JV5Q 1OTCA 5GROA 2PI4A 1MQ2A 1VQIA 1MJEA 1L5UA 4DQQA 4YCXA 3ZDBA 5DQGA 2R7DA 3KJOA 4NXZA 8ICRA 8ICYA 4F8RA 9ICSA 4NLNA 3ULLA 3RB0A 2ZJQA 5M3FH 4ED1A 4DV4L 1FJGL 3RB6A 3H3VI 5KG0A 3ZD8A 4QZ8A 4OO1G 2UU9L 5J2EA 4RUAA 3AEVA 2W9BA 7ICMA 5J2CA 2L15A 3PSIA 5C5JA 4B9MA 3RLNA 2UU9Q 2XCPA 1HR0L 1N9WA 3RRHA 3ZJYC 2CKZB 5LMNQ 3PR4A 3RR8A 4UP7A 4A3GH 5CJ7A 2XGTA 1RYRA 3PY8A 3ETLA 1Y1VG 4ED2A 5IY0A 4A3JG 3GD7A 3FYHA 1QZGA 3V72A 1BPZA 1K0RA 1EWIA 3MEFA 2Q2HA 4EBEA 1PH4A 3QZ8A 5GAEC 3OTOQ 4O3PA 8ICOA 2XCAA 1ZYQA 4C3JH 2R7ZH 3V6KA 4DFPA 4UP9A 1T3NA 3M7NA 4BA2I 5J0YA 4J9KA 2E5LQ 4C2MH 2ZTEA 1VQPA 4DV2L 5F9LA 1VQJA 5KFJA 2MUTA 3PIOA 4DNIA 5C0XI 2HIVA 7ICIA 4BA1I 1S3OA 1YJWA 4YWLA 1NJIC 2DPIA 3EZ5A 4GXJA 2BHNA 4DOBA 3AU2A 5KFQA 3GTGH 1VQMA 1KQSA 3PUZA 3PO4A 4BWMA 2FMPA 4KLIA 4KLGA 4ED7A 1N34L 1ZQKA 3GTQH 4O2DA 1I6HH 3RBDA 1B70B 1KTQA 4JYAQ 2ZUBA 1N34Q 3E9IA 1X9WA 5LMUQ 5C0XJ 2XO7A 5IWAL 3A5ZB 3ICEA 3J81i 4JI8L 4DF4A 2UVRA 1EQRA 2VA2A 1K3RA 5IWAQ 3PX6A 2FLNA 3I7FA 2FLLA 1S77D 1BVSA 3SZ2A 4JI8Q 1SL2A 1TWAH 3H7IA 3LGJA 3NBHB 5IP9G 4RPXA 1PH5A 1Y1VH 3RB3A 5KFAA 1NBWA 4DK6C 4A3JH 1Q82C 4JI6L 5C4XG 3CCUA 5D46A 1BPXA 4F5OA 4YY3L 3UE0A 4JBWA 2AWOA 1QLNA 8ICLA 4JI6Q 3LWMA 4J9LA 4YY3Q 2JEBI 4PGYA 5C3EH 5IYCH 4YCWA 4BY7G 4A3IG 1E7ZA 3L7ZC 4UPAA 1TFRA 1UT5A 1YHAA 4RNMA 1IZ6A 2CQOA 2IHNA 3MFIA 1EIYB 1NJYA 3IRBA 1X2IA 4I2BA 3MGHA 1HZCA 1UE7A 3LK9A 1YJ9A 4X6AH 3PO3H 2HVIA 5KT6A 4O0AA 8ICBA 1DOQA 5J2AA 1DGSA 5KT3A 4J9PA 9ICGA 8ICVA 4TQRA 3HOYH 3UPQA 2KFZA 4R4TA 2JEJA 5KFOA 4YWMA 2XC9A 4B9NA 4JG2A 4DR4L 4LVSA 2JEFA 4YWKA 4F5QA 4ED8A 3H0GG 4LUZA 4L5TA 4O0IA 3JPRA 3FHWA 5KFLA 2ALYB 3PUXA 4DFJA 1XU4A 1KEJA 4M2YA 1PH2A 1N36Q 3M9MB 5IP9H 2KCTA 3ULPA 1U47A 1S76D 5KG3A 4I2HA 1D8YA 1ZQCA 3ZDAA 5C4XH 1PVOA 4I2GA 1AE2A 2WB1G 5IYBG 5KFTA 1WJJA 3Q8LA 5IYDG 1UE1A 4YR2A 5L1LA 4RQ5A 5D4BA 3ISCA 7ICUA 4BY7H 4O5EA 4A3IH 2VA3A 5CR0A 3HFZB 4GNXA 4YG2A 3F1ZA 4UB5A 3CC2A 4P72A 1ASYA 4MEXA 3C5FA 5BPCA 4IR9A 5J2HA 2JQOA 2R6GA 9ICUA 4GC7A 2R7FA 2VANA 5M5WH 1BGXT 4LUVA 3KJPA 4QGUA 4I27A 4O5KA 2XY5A 2JJQA 5KG6A 2IHEA 4RPYA 4LF6L 4OX9Q 4ME3A 3EPIA 4QZCA 4DKAC 4B3TL 1IYJB 4LFCL 3E0EA 1VQAA 4NLZA 2AGPA 2JEAI 3J7ZC 4QZGA 3ERSX 4B3TQ 2VQFL 3GTMH 4H02A 4JI3L 2NRTA 1L3UA 4OONA 3T5LA 3UDIA 2VQFQ 4JI3Q 4NY8A 3UQ0A 4GOPA 2OQKA 4C8MA 1SE8A 5IP7H 4DQIA 1Z47A 5KFFA 1VQNA 1HUOA 9ICVA 1C9OA 3M8RA 3KF6A 3PV0A 3TARA 1MQ3A 4HIDA 3S1RH 2KHIA 4X62L 4EEYA 4F4WA 1T9HA 4K4GA 3L2PA 4JI4Q 4A3FG 3JAMc 4DQPA 3EPGA 1CEZA 4X62Q 8ICEA 5IYDH 4B9UA 1VQFA 4KLFA 2NRZA 4UQGA 3OSNA 1D9DA 4QZBA 3CPFA 4UP8A 2ZUDA 4AIMA 4A3DH 4NPSA 4IFDI 4KN7A 3GV8B 8ICXA 1IM4A 3N97B 3PO2G 2A8VA 4PHDA 2EIFA 4NM1A 5DLFA 4A3BG 2P66A 2YV5A 2UUBL 4B9VA 1FGUA 4UAWA 1IXRA 1GVPA 4NM2A 4Z6DA 4JUZA 1U45A 2JA5G 5C0XG 1D7QA 3RJEA 2LXJA 1ZJNA 3C1YA 4YMNA 3TANA 1SKWA 5TZVA 2ASDA 1NTGA 1ZQRA 1O7IA 4DR1L 2JK8A 4GC6A 4KLTA 2CCZA 2NN6I 3IHQB 2HHTA 4DR1Q 4O5CA 2I5MX 3EIVA 2PFPA 3RH4A 4EQ5A 2ATWA 1AE3A 5KFUA 4QJFA 2BPCA 3G48A 4DOAA 4YP3A 2R92H 3MR2A 5DQHA 1NJZA 1YVCA 4ECYA 5KFBA 1IBKL 1HNXL 5CP2A 1YHBA 5M3MG 1Y1WG 5ELOA 9ICHA 1IBKQ 1HNXQ 2JA6G 3S2DH 4IJLA 7ICNA 5AJ3L 1Q81C 8ICHA 2J6SA 9ICKA 1P16A 3OW2A 3T1HL 4YD1A 3J80c 4ECVA 1JJCB 4HIKA 2C2EA 1JE5A 5AJ3Q 4R8UA 4A3CG 3M4QA 1XJVA 3HT3A 3T1HQ 3RAXA 4A75A 4BBSH 1ZQNA 5KFWA 4Z6CA 2V9WA 1XPUA 4DSEA 4JV2A 1ZQDA 1FL0A 2E2JH 1ZQMA 2B29A 1Q1BA 5GAHC 1ZQXA 4DV1L 1BKBA 4IPCA 1SRUA 2N78A 4MFAA 5FJ8G 5J0PA 3FDSA 2W8KA 1TWCH 3M4PA 1LUZA 3T5KA 3CCVA 4DV1Q 2WB1E 4KLHA 2R8JA 2Y0SG 2BCUA 2PFOA 4O3NA 1Q86C 3RN5A 3I2ZA 1QVGA 2PFQA 1SFOH 4MF2A 1PV4A 1NOMA 4QZ9A 1PH9A 2F4VL 4RQ0A 4B3ML 9ICFA 4RG1A 1W2BA 4BXXH 4B9LA 4R63A 4DLEA 1A0IA 5KFNA 4C8KA 4B3MQ 5DKWA 1XSLA 3PF5A 1J6QA 1Q1EA 4XTCS 3I4MH 4PHEA 3CCJA 2ID0A 2AGOA 7ICTA 4F91B 3K8AA 4LNQA 1KRSA 3CD6A 3RN2A 3RNUA 3S1NH 4XIGS 1Y1WH 9ICBA 1G51A 4DL7A 1X6OA 2JA6H 1OXSC 1RYSA 1QVFA 1CSPA 2UUCL 4PHAA 5KG5A 1HNZQ 3GILA 2ZTCA 1TK0A 4R4OA 4RQ3A 4R64A 2UUCQ 3JC66 4F5NA 2E2HH 2UXDL 1MJCA 2B21A 5F9NA 9ICIA 1U9LA 8ICZA 4KN4A 2UXDQ 5DDYA 1ZQGA 4LZDA 1Y88A 7ICFA 9ICCA 1ZQYA 7ICRA 4KITB 4DFKA 1BPBA 1S0VA 1C0AA 1X65A 1JJ2A 1KFDA 1SZPA 3CC4A 3GIIA 2FXQA 8ICJA 1X54A 1K8AC 9ICQA 3G4SA 2BPFA 5KFSA 9ICRA 3GTPH 1CSQA 1Y14B 4QZEA 1NK0A 1I3QH 1YI2A 2NVTH 1NK4A 3GDEA 4I2FA 4LFAL 3C2KA 5J3BA 1PHJA 4EZ9A 4M47A 3CF5A 4YCUA 3KDFA 1S9FA 1EYGA 4B3SQ 2FPKA 4QW8A 4L5RC 1XSNA 4BBRH 1RXVA 4QL5A 4AQYQ 5J0UA 3CAMA 5IIJA 2AQ4A 4LF4L 5BR8L 1VQBA 4K4IA 5IINA 1COOA 1P8LA 1A77A 3KHGA 2AKWB 4J9MA 7ICGA 8ICCA 1XSPA 3FKIH 4WJ4A 1VQHA 2VUMG 1Z00A 3B0YA 3PCOB 3I4NG 4HIOA 1VQCA 4EBDA 1RL2A 4LF9L 3T1YL 4BXOB 3KHLA 4LF9Q 4MZ9A 1S40A 2I5LX 3T1YQ 3EYZA 3ZD9A 4HJ7A 5H1SE 1E22A 4KLJA 3ZDEA 4DEZA 4QWAA 5HNKA 5HGQA 1N32L 5M5YH 4DV4Q 1FJGQ 5L1IA 1HZBA 3UXOA 5J2DA 5EAYA 3SYZA 5KFRA 3PGZA 3TAQA 2IHFA 3V7LA 4DV5L 5C4JH 4DOCA 1SKRA 5C44H 3OHBA 4M0AA 1HR0Q 5GADC 1EOVA 1QSLA 5J29A 3AU6A 2ZM6L 1VQ5A 5EOZA 4O9MA 4QZHA 1JMCA 4RU9A 9ICXA 2RDIA 2C2RA 3RH5A 1L1OC 3MR6A 1SKSA 1WOCA 4CCHA 1XPRA 2UXCL 3TFRA 4GNXB 3BZCA 3RJGA 4JWMA 1YBYA 4P4PA 1SL1A 1QUQA 4F4XA 4ZH4A 4DSFA 5BOMA 5D49A 1BBUA 4YR3A 2KZZA 2ZTDA 2VA8A 4A93G 1ZQLA 4LZGA 4DV2Q 3JAMi 2VUMH 4F4KA 1JJGA 3BQ0A 4F93B 3JPSA 2ISOA 1X3FA 1YITA 4RZRA 2PI5A 3RRGA 2F1HA 1NK9A 3TQ1A 2K5NA 4DSIA 3TS2A 2IA6A 4GXKA 4KLMA 3CCLA 5KG1A 1CKNB 3NGDA 1SR3A 4K0KL 2BCRA 8ICPA 4R4IA 5KFYA 1PH7A 2PI2A 1LM0A 3H8JA 1FVIA 4GOPB 2BCVA 4K0KQ 4MF8A 5HMMA 3K81C 1X9MA 1AH9A 3MDAA 3T5HA 4IJHA 3HKSA 1V9PA 2ASJA 2ALZA 3ULJA 3CCMA 3G6YA 5KG2A 3JPQA 1NY4A 3OYYA 1LB2B 4DS4A 4B9TA 3TI0A 4DL3A 4HJ9A 1L3TA 7ICQA 2JA8G 1K83H 3CCSA 3H4DA 4WJ3M 9ICEA 3KFUA 3JPOA 4DF8A 1L3VA 9ICTA 1KD1C 2NZOA 2BA1A 4ECXA 3PMNA 3Q8RB 3EBEA 2JE6I 4RQ6A 1WI5A 1NKBA 8ICMA 1H95A 4DS5A 4YHHL 1WFQA 9ICLA 2RDJA 3AFQA 1N33L 5CWRA 3HX0A 5EWFA 1VQ7A 1MKHA 3J80i 4A93H 2KENA 2NRVA 1GD7A 3K0XA 4YHHQ 3M9OB 4L5QA 2K50A 1XO1A 4C3HH 2ZJAA 3KTQA 3T3FA 4F2SA 4C3IH 1Q7YC 5J2IA 3QEAZ 1E3PA 1RZTA 4UAZA 4I2EA 1VS0A 3S17H 3EN2A 4JC0A 5KFHA 2WP8J 3NTUA 1VQKA 2CFMA 5IE8A 3PX0A 2MAXA 3A0JA 4FDBA 1YZ6A 4GN5A 3CC7A 4AYBE 3HKZE 4TUQA 3RLOA 4APVA 2F1IA 2K4KA 4DR4Q 1NKEA 4TQSA 1I50H 3OJUA 4DV7L 5L9XA 1QSSA 2ZJ8A 5HHIA 5IT9c 5IIMA 4Y7NH 4JBMA 2J6TA 4IQUA 4L5SA 2ASLA 5L1KA 2NRWA 1K1SA 1BPDA 4KTQA 3MFHA 3EWAA 4DR7L 1IBML 4RT3A 2UUAL 3NENA 4F3OA 1IBMQ 1NK7A 2UUAQ 2Z0SA 2JEIA 4NLGA 1SL0A 3NEMA 4BY1G 3TFSA 3K75D 3H8WA 4YMOA 4I2IA 1ZQAA 4DR6L 1S72A 1EXNA 2MNAA 5KT7A 1IL2A 9ICMA 2KZMA 3BJYA 1N48A 8ICKA 1VCIA 3DLLA 3T5JA 2K75A 4F4ZA 1NMGA 3C21A 3AFPA 3S1QH 2N49A 4DK3C 4YFKA 2JEGA 2OWOA 2A1JB 2KN7A 4LF6Q 3UE1A 4UAYA 1SN8A 2ES2A 3GQCA 1ZQSA 4LFCQ 9ICNA 3H0GH 3E2EA 1Q46A 4YN4A 2Y1JA 2H5XA 4KLEA 1U4BA 4R4CA 2IY5B 4P2HA 1UWVA 4FS2A 9ICPA 2KZ3A 4F92B 5JEAJ 1WCLA 4TUPA 2E8GA 2PQAA 4POFA 4OWWB 3W1BA 2WAQG 1BBWA 2FMQA 4E0DA 4DL5A 2CWAA 3TAPA 1IBLL 1PYSB 1KFSA 3THVA 7ICHA 5DGAA 3U4VA 1ZJMA 1UT8A 5IYBH 4RQ7A 4I29A 1HH2P 1IBLQ 1QTMA 3AQQA 1X3GA 2FLPA 3UXNA 2UVUA 4Q8FA 5CA7A 1V1QA 2NVQH
chains in the Genus database with same CATH superfamily
1SYCA 3STBD 1HUNA 5KTQA 1F9SA 1HXYD 2WKDA 3V6JA 4QWBA 1PTOC 4LFBL 5JPMC 3RJKA 3NVZA 1MSWD 5EE9A 3PW4A 2GO7A 4DSKA 3VA7A 3NBHA 3U58A 3RBEA 3C1ZA 4ECQA 4EX5A 3GIKA 4LFBQ 5ALLA 1XTDA 2BDNA 3MBYA 5JPNC 5DB7A 3GIJA 1Z6HA 3OWEB 3KBXA 2VS1A 1WVLA 2K14A 2EY1A 3S1MH 4ODGA 2R8IA 4OO1I 2NO5A 1B8AA 1IYVA 1MD2D 4KMUA 5KNDA 5JTIA 1ED1A 4POGA 1TWHH 5FO8B 2UUBQ 1VLBA 4IPGA 4M9JA 5J0WA 1B53A 2GA4B 3KOJA 1J5EL 1CFMA 1CQVA 2R8GA 9ICAA 2K5HA 1T8EA 4MFFA 8ICAA 1C4QA 2HQLA 4JI7L 4HSPA 3CCRA 3N7PD 3J81j 4Q43A 4C8LA 4K4HA 5B66U 1N56A 1UCVA 2HHWA 2DNEA 3KDFB 1J2NA 1X40A 3MTSA 3NPPA 3I4MB 2SOBA 7ICJA 5E1FA 4NMZA 3SDZA 4UB8U 5FO9B 4JI7Q 4LF5L 3BG3A 2KSOA 3KKAA 4UBBA 2FMCA 5IGBA 4IFDJ 4DFDA 3Q8QB 2ESEA 3NTHA 4DA2A 1Y1WB 3S1NB 2BDPA 3A74A 5FLXL 2HI0A 3ISBA 2W03A 2VY3A 4LUOA 2ZIUB 3VR3A 2HDOA 1MIUA 2JA6B 4ECTA 3SAHA 3A56A 1C48A 3ZDDA 3PR5B 2A69C 4G3IA 2B2VC 2R3ZA 4QIWE 4OO1J 1SLJA 4Y2VA 5A2QL 2BQUA 4M1UB 3HOWG 5J0SA 3WU2U 1FNUA 2RQ5A 3G6EA 4Y2RA 5DQIA 4IOAA 3H4BA 2HHHL 2RDFA 4JI2L 2O5IC 1TAQA 3QU9A 3M7GA 2IJ0A 1KDCA 1L0XB 4QZFA 4OIKA 1KHIA 2YB1A 3CP0A 2GOLA 3CPWA 3BDCA 4DUYL 4J9NA 3KFUF 2GN5A 2I46A 3S24A 2HHHQ 5DG8A 4X5VA 2JA7G 4JI2Q 1ICWA 1LTTD 3MXPA 1RIPA 1D1KA 3T53B 5AM1A 3KYHC 4OXPA 4R1JA 2DBYA 2F0SA 5J0RA 4PGQA 2BGWA 2IX0A 3J81L 3C23A 3I1YA 4J9QA 1U49A 4UB6U 4A3FH 1PK1A 1ENCA 2F0UA 2B8FA 3GTJH 4V190 1ECWA 4ECSA 1B9NA 4HEDA 4F5RA 2FE9A 1L1OA 4KK7A 3JPPA 2WV6D 3SR1A 4QWDA 2QGQA 1NI3A 3X3MA 2ZIXB 4PZ7A 1XMQL 5KG4A 3GTPB 3L5KA 1O7ZA 2BOSA 2Z6BA 2R93G 2W9BB 5ALRA 3RJIA 2C5CA 3PO2H 1F9RA 5FP0A 2KOBA 4M6WA 2NVTB 5KL1B 8ICQA 1F9PA 1DONA 4DAYB 4QY7A 1R9TH 2LYAA 3TDQA 4EBCA 2W9CA 4A3BH 2J4XA 1EUJA 5KAIU 5CHGA 1STYA 1A2UA 2D6FC 3D3RA 4BBRB 1Y8NB 2FPLA 1SMYD 4NV0A 4A76A 1SMXA 1WCMG 1EIFA 5EBCA 1JXLA 2JA5H 1TVXA 1ESRA 5C0XH 5KFCA 1UEBA 5JUMA 4V0BA 3BZDB 1S8OA 2ATLA 4H44C 1XMOL 4QF4A 3TEHB 4F5PA 4ECUA 4F71A 1B43A 5T14A 2KCMA 2AGQA 4P0PA 2HHQA 9ICOA 1NK6A 2AWNA 2QF7A 5JRTA 1ZQVA 5E79U 1XMOQ 3OJSA 2EDGA 3MC0B 3FKIB 2F4VQ 4YD2A 5IIKA 4A3EG 4DR2L 3WK6A 3H09A 4DR3L 3HOUG 4JCVE 4EVOA 4Y52H 2LKVA 3PUYA 1BCPC 4KHPL 2MUTB 2YTYA 1PZNA 4RKLA 4DR3Q 3Q8DA 4RHSA 4YXMA 4O3QA 2C35B 2ZJRA 1L7PA 1WG8A 3S15H 1X56A 2PO4A 4KY6A 4DFAA 8ICGA 4OD0A 5ALJA 4O3RA 1UE6A 1B3AA 1XWLA 2EYOA 3M6KA 1MA7A 5M3MH 1ZQBA 2JZBA 5DEHA 5GTHU 1URJA 2Y9UA 5ALHA 3C1FA 5FLMG 1BXTA 1ENAA 5KFMA 3D6JA 2HBLA 3SQIA 3HOVG 1U4RA 2IW3A 4IRDA 2NTSA 4J9OA 3KLSX 5M5YB 4NB3A 2JH1A 3T79A 3G6VA 3MXUA 2HVHA 4CGZA 4K8IA 4A3CH 4P4OA 1BCPF 7ICPA 1V1PA 5J39A 5DBBA 2BKEA 1U48A 4KLLA 2VXWA 1LTLA 2BCQA 1SE3A 4J9SA 4DL2A 4DAVA 3C5GA 2F0NA 5C4JB 4U7CA 4DQRA 4CKCA 2MO1A 2MQHA 3EROA 5C44B 4EYHB 1BPEA 2KTQA 4BS9A 1V43A 2VZAA 4RPZA 4HJ5A 4DV0L 2EDUA 3PIPA 2R8KA 5ALVA 4XA5A 1TK5A 3GTKH 2WAQE 4GKKL 2HD3A 2QARB 1PFSA 1HA6A 3TP5A 1GUWA 2PNHA 4IFDI 1RM6C 5ALDA 3PUVA 3FAHA 2LSSA 5FJ8H 4DV0Q 2QCPX 1KSPA 2A6HC 4KHZA 1ZRNA 1PFBA 1Z1BA 1NUCA 2KG5A 4DLGA 4ID6A 3V05A 4Z6FA 2CHBD 2A5HA 3VC8A 4US8A 1TWGH 3K4GA 2M9VA 1WCMH 2WACA 4OWXB 1JOQA 4XYOA 2DQNB 2C22A 4I2DA 2C28A 2QILA 1QVCA 3FPPA 2XWBB 5KFVA 2JXMB 2F0VA 4F2RA 4OCZA 2AHOB 2YTXA 3DWPA 1D8LA 4C7YA 1HUZA 5JEAG 3UDGA 4IUUA 3AB9A 4P74A 1Z9FA 3P1HA 3BQTA 3HKZB 4AYBB 4LFAQ 3IFDA 4PMWA 2B63G 5I4DA 2ASBA 2A6EC 3Q0AA 4A3GG 2CW0D 1WWUA 5CC4A 4BUGA 4LJXA 5G3LD 2E1EA 1Z4NA 1M1KC 2VUMB 3OPOA 3PW7A 1FNVA 2RDGA 4PZ8A 4A3EH 5IOCA 2I0QA 4Z6EA 3OSPA 2V1CC 5JJLA 4DFMA 1QE6A 1HZAA 1SNDA 1TXYA 3PMLA 1I94L 4USAA 5JAVA 1EQTA 3AUOA 3B6YA 4DN4M 2IT1A 5ALSA 1MC8A 2K5WA 1ZQFA 2QKIC 4LF4Q 7ICSA 4YVZA 5BR8Q 2YU9H 2UXBL 5J22A 4ECRA 1K73C 1I94Q 5FKAC 4LF8L 1IKMA 5M5XH 3LWEA 1VQLA 5KFDA 2JA9A 3LVVA 2A1AA 4C3JG 4CBVA 4JBKA 3RJJA 1N2XA 2F0OA 2SEBD 4IQTA 1BPYA 2WIIB 1NKCA 2HBMA 1B3QA 3BQ2A 1JX4A 3OHAA 3STBC 5KFZA 2G06A 3CYMA 1J97A 3H91A 4FF2A 4DSJA 4P0QA 5EPLA 1B2TA 5DB9A 3CMEA 1SV4A 5AI4A 4IRCA 4UY8C 1S4ZA 2QA4A 4ZUJA 3KKAC 1YIJA 3EFXD 4HIMA 2Q2IA 5HURA 5DLGA 3PMFA 1TAUA 1G2SA 3FVQA 4WJWA 1ZQIA 2L12A 5KFPA 3PSFA 2FHTA 4ELUA 3NRWA 3I3CA 5IIIA 2NUCA 4ALPA 5KGUA 3RJFA 3UMCA 4J9RA 1AEXA 4RFBA 2F0WA 4C8NA 5M9OA 3CXCA 3CMAA 1U0LA 3D31A 4ULLA 4G4KA 1GUSA 3L3OC 3M9BA 3Q8MA 1GKHA 1PH6A 4G7HC 5DBCA 5DNFA 1EY6A 1N32Q 1JOOA 2CH4A 3HOZG 3PUWA 1ZQJA 1JN3A 4FBUA 4CGYB 2KIWA 2HIXA 1TS2A 1PLFA 2I5HA 1K83B 4EGVA 3W5OA 4A3MG 4LF7L 4IFDG 1TV9A 3CNHA 5J2JA 3WWVA 1SV0A 1XNSA 1VMCA 1YZ7A 3SGIA 3SD7A 1ZQ1C 2D0PA 1S97A 4LF7Q 4DV5Q 1NJWA 3W1GA 5KRUA 4R9WA 1LKYB 5HMLA 3MR3A 3K59A 2DUDA 3KF8B 2PXIA 3OW7A 3SV4A 3RH6A 3TKAA 5LMNL 3QOJA 1O80A 3IAYA 2VNUD 5K36G 3GFKB 2I9GA 1C7YA 1DOLA 4KY7A 3UQ2A 2ZM6Q 1KL9A 1U5KA 2NO4A 5AK5A 9ICWA 2UVWA 1D6EC 1KAWA 3MA2B 2PZTA 4A93B 2B63H 4RMFA 2WTFA 1HNWL 3UI2A 3SAFA 1X42A 3BS5A 1SDFA 2E74C 3X3NA 4C3HB 4DWIA 1C8CA 2VL6A 3RJHA 2WF9A 3ND9A 1K9MC 1N60A 4A3LG 1PMRA 4C3IB 5J0TA 1VF5C 4IS7A 4PZOA 4OJOA 1HNWQ 3LWLA 1LT6D 3BQ1A 3OTOL 3QU7A 2HW3A 2F0FA 2UXCQ 2BH8A 2DFLA 2NN6G 1PA6A 3PO5A 2Y0SE 3IP4B 4MTNA 5D3IB 1IYUA 3GV3A 3J7AV 1EZ6A 1MI2A 1SNMA 4M9NA 3PW0A 1LV5A 3S17B 1OXJA 2XIDA 4YMMA 1SGGA 2YQEA 5IIOA 1VQDA 1YNND 2ZUCA 3ISDA 4O3OA 2BQ3A 1N5WA 4KY5A 2KMDA 5IYCG 1OXUA 3H0RB 1H9RA 2QKQA 2RHQB 1ZXIA 1STBA 3FDTA 4O42A 5IGDA 4G9BA 1PFMA 1VQ4A 2E5LL 3AMUA 2IBKA 3I4NH 2OCEA 1M90C 3KK7A 5HR6A 4JOIC 5KT2A 4FS1A 1GHKA 2G09A 4H13C 2D0OA 2K32A 3HOXG 2J6UA 2KFNA 2E2IH 1A76A 1I50B 1EU3A 2IWHA 5KT5A 3MXGA 3HW8A 4ED6A 3AL0B 4MFCA 4Y7NB 4PHPA 4I2JA 2F76X 5ELNA 2AUJD 2ISPA 2ZXOA 3I55A 2D62A 1K0SA 3PO3G 4C1NI 4DAPA 2K4IA 1L3SA 4ELTA 4R66A 2EYJA 2V4RA 1SMYC 1HQMC 4KX5A 1XNRL 1U4PA 2KD1A 1EFID 2D9UA 1TIID 3NK9A 5J0XA 4MIUA 4LK1C 3HOYG 3F2BA 1CKOA 2HHUA 4KLSA 1BQQT 1L2FA 2F03A 3V7KA 1XNRQ 1S5DD 3KD3A 3KLWA 3HOZH 4JYAL 5DAUA 1JWUD 2KIVA 4DQSA 4I2CA 5KT4A 1G291 1JCKB 2PQAB 1NK8A 2RF4A 4A3MH 4ACOA 5DB8A 5LMUL 2DN8A 3KBGA 4FBTA 3KF6B 5EWGA 5CV7A 1WCNA 3AQFA 2N8NA 4F87A 2IOFK 5JJKA 2KOLA 1DOMA 1JWSD 1FFVA 7ICOA 2XGQA 3FP9A 3ALRA 3HS0C 4RCOA 3KUPA 4B6JA 4KMOB 2KKVA 2UVVA 3U50C 5LL6X 4HJAA 4X65L 2EQSA 1RG6A 2FMSA 4KLOA 2Z6KC 2M0NA 4DSLA 1YNXA 1L0WA 1KAAA 4CF4A 2WAQF 2ZJPA 3Q22A 4X65Q 1GUOA 5KNCA 1VQ8A 1D9FA 4PL1A 5I6YA 4ZQ3A 3R2IA 1S0NA 4X3KA 3UM9A 1Q90A 3UXPA 1GM5A 2PMZC 3S1QB 4P71A 4JV1A 4B9WA 4UAUA 5KIXA 1N61A 3GTLH 2Q2UA 4A3LH 3RAQA 4GLAC 4XQ8A 4C4TA 2PI2E 4Y2XA 2B2VA 3I56A 3CW2C 1K8GA 3E0FA 1YEZA 2BH2A 2P6UA 4ZOHC 2NN6H 1KIXA 2EJFC 5EBDA 5AKGA 2MU2A 3PNCA 2KEDA 2RBMA 4KKTA 1KLGD 1N33Q 3C2MA 1VQ6A 5DG9A 5KYLA 3DUZA 3RFAA 2R61A 3F2UA 3GTOH 4CJ1B 4XUSA 3H40A 1EYCA 1GO3F 5GQOA 4M04A 3DEPA 5KFKA 1H38A 3EW9A 3H0GB 5DM63 4CKEA 1GHJA 3F8TA 2PMZF 5EE3A 3HOXH 5JOBA 3OGUA 1E1TA 1TKDA 2W3SA 2L55A 4F7XA 2XVTA 2K52A 4Q0FA 4UDUC 3RLFA 3MGIA 3UDXA 2ZT9C 4X66L 3V7JA 4DCCA 4IUVA 3A55A 4C1NK 2EJMA 1L8OA 3U26A 3PVXA 1ZRMA 8ICUA 1A8VA 1B22A 3MXNB 2RKSA 1UQVA 3D2NA 1Z3EB 4QJFB 4X66Q 3TRZA 2C2DA 3PW5A 3F53A 2DY7A 4O3SA 2GLEA 4HYKA 1PFNA 5ALQA 3QEBZ 3J80E 1G6PA 2A19A 4FO6A 2LHTA 4BXOA 1A63A 3HP6A 4IQZA 4A4IA 3M3YH 2YN4A 3RR7A 3SI8A 1NMFA 1RQLA 3MABA 1Z7TA 2HBKA 1FGBD 1UEAB 4DV7Q 4YR0A 1CHQD 3EQLC 1ZQUA 4P75A 2E1FA 1ILPA 1O03A 1CQFA 4M9LA 1G91A 4S3SA 1IG6A 2WFWA 2MA1A 2RHSB 4BY1B 5KFEA 4P73A 3N4MB 1NE3A 1SROA 3M4YA 1SE2A 4C56C 3KLSA 4R8UB 4NLKA 3C2LA 4IPHA 2HT1A 5DLQE 3DEEA 4DR7Q 2NVYH 4RQ2A 4JWNA 1YHQA 1OXVA 1VQEA 2VB2X 4C8OA 1K28A 2JA8H 2BPGA 3R8BA 1L1OB 2XY6A 1N36L 3K7AH 2I6XA 1H9SA 5IP7G 3S1MB 4YQWA 4I2AA 1T4GA 3QU5A 2H3VA 3ETRA 2B3GA 1ZQEA 2DGZA 1RF2D 5AKIA 1LT4D 2VW9A 2OF1A 2W9AA 1TWHB 2E8OA 3HWTA 1TWFH 4RQ4A 2F2AB 2F52A 1PVPA 3KZIU 1K1QA 4M6WB 4OJ6A 4F4YA 3HJEA 4KLUA 3DM1A 5HY6A 1XXGA 2F8LA 9ICJA 2FPMA 2ODGA 3BYTB 1N62A 1KLNA 2H3FA 2W9CB 1LYLA 3N52A 5G3LF 4NXNL 3VR5A 1R4PB 3M4OH 3S16H 2OTJA 2IMWP 4M9HA 3QOLA 3DXJC 1KXLA 2NBFA 4OEMB 4NXNQ 1SV0C 4DR6Q 5CRXA 1FYCA 1Q8KA 5J2KA 4L8JA 1ZETA 4TVAB 4G7OC 4GS3A 3OPXA 4IQWA 2G0AA 4IR1A 1UHUA 1T5EA 1I4XA 3NSWA 4YIJA 2RP5A 4A3DG 4B9SA 2EZXA 8ICNA 3UDFA 1PH1A 2CRXA 4P0PB 3O13A 1CHPD 1WYDA 5ALFA 2QB0A 4ABNA 5AIAA 3WKAA 1RD9D 4UAVA 1PUZA 3K1RB 1AP0A 4RUCA 4CNQA 4FXGC 1TE2A 4ED0A 2IX1A 4OX9L 3Q8SB 1B4FA 1KFTA 2RCFA 3LYSA 4KLQA 4GXIA 2Q4TA 3WK4A 4ZUIA 2XY7A 1D2BA 4QWCA 2AQ3B 3H15A 3NXWA 4CJ2C 5ALGA 2WAQB 1RPLA 1KDBA 2BCSA 1V85A 4PGXA 1LV9A 5LL6S 5J0QA 1SEBD 1PRTD 2PQEA 1F77A 4US9A 4NKLA 4KLDA 3RR5A 2L5TA 3BJUA 2N88A 1ZQHA 1I5FA 3HGBA 4MTKA 2JZBB 3F2CA 2MO0A 4DV6L 4IOCA 3B0XA 5AKKA 2R8HA 1RODA 4A3FB 2JXJA 2KUMA 2K5VA 4HJ8A 5EWEA 1S0OA 3E58A 3NTIA 5CEHA 4Q45A 1E2WA 1ET6A 4IRKA 4DV6Q 1NJXA 1OXTA 2DJFC 3J7A5 1RDFA 4RQ8A 1RXWA 4UAIA 3SV3A 1CKNA 5AI5A 1RQNA 3K6OA 2ZJ5A 4Q44A 3JPTA 1KRPA 4MHEA 5KAFU 4DO9A 2R92G 3BDPA 3BDLA 2SNMA 2XTIA 2RHFA 1HCZA 4RT2A 3H8SA 5AI6A 3W2DA 5DGBA 4DUZL 1DRGA 2D2CC 4KI0A 5BOLA 3I8ZA 4R4QA 3KHRA 1HA5A 5LHY1 1R9TB 1KDHA 2F3NA 2AJQA 5DG7A 2P6RA 2H4OA 4DAMA 1XYIA 3K7UC 5COYA 4A3BB 1UUPA 3S14B 2KBNA 2F1MA 3K5MA 1TVAA 1YNNC 5J2GA 4BY1H 3M85A 5GTIU 4DUZQ 2E5SA 5KG7A 3CQZH 2AH5A 4P4MA 1S0MA 5ALKA 2PFNA 1G8ZD 5J1ZA 3GV7B 4QZAA 5AI9A 1STAA 2JP1A 5D3DA 4JI4L 2RSOA 2JA5B 5J0OA 4RGTA 3V96A 4PH5A 1UA1A 2F0EA 2EPBA 2E8MA 2EXDA 3G7LA 5GAGC 5ALOA 4ZCKA 4DK0A 1X9XA 1TK8A 2YYZA 5FLXc 1E24A 2JH7A 4EYIB 2X6GA 3E9HA 4KKSA 4BBSG 2KJ8A 3AYHB 2LPEA 2YTVA 3TZDA 5D65A 3BZKA 3C3LA 3U4ZA 5FOBB 2RCNA 2LFNA 1RKNA 5K5PA 1SWVA 4Y2QA 2KEYA 1W6KA 3RTVA 1XPOA 3CRLC 3D0FA 1VF7A 2W8LA 3KBBA 2WKCA 2YMLA 2IPKD 5CGKA 2V4QA 1ZD5A 4WJ3B 3D2SA 3WK5A 2GWSA 1PTOF 4PPXA 1BNPA 2G5IB 5ISRA 1J5EQ 5L1JA 1QQ6A 2KICA 3QB3A 3PQIA 1B44D 5CV4A 5C5LA 3SXHA 1VDZA 4XQQA 3ICXA 4ILWA 3TSSA 3TS0A 3S15B 1D1IA 3NELA 4K5XA 2KHQA 2AXTU 4ECZA 2F1JA 1CZGA 2OQ0A 1ICFB 3L0OA 3OMGA 4YCVA 5I9PA 1X55A 4RNNA 3K57A 5M3MB 3JAML 5AKXA 3J81c 4LF5Q 3NS1A 4J1MA 1EY4A 1VMPA 1VQ9A 1NK5A 3TREA 2PNRC 3MHBA 3CRKC 2DY8A 4DXGA 3HPOA 4ZKBB 4MNOA 3VR6A 3PF4A 1EQQA 3R2TA 2BQRA 1UA0A 4K2LA 3H3VH 5DDMA 1Z00B 1HFGA 5AICA 4EENA 3I4OA 3M9NB 4BXXG 1X9SA 2ZXHA 4FE3A 1FO4A 1OXXK 1VQGA 2Z8LA 4KX3A 3DM3A 4DPGA 4AYBC 1PZID 3HP3A 4GN4B 4PZNA 3QE9Y 3D4WA 3RZDH 2F0LA 2EQYA 5EE1A 3ZI4A 1BDOA 1DYQA 1HZ9A 1HIWA 3G71A 1OW5A 5AM0A 1SXDA 3GIMA 3GO5A 4DL4A 1A0PA 1SNOA 4DUYQ 4DR5L 3I4MG 4XYQA 5AKEA 4Y2UA 4OWTB 4ICAA 3KHHA 1MSHA 3GDXA 2KJ5A 3GTKB 2IHMA 5IGEA 3WKBA 3E3XA 5AFWA 4R65A 1X3EA 4DR5Q 1ML0D 4J15A 4JK1A 1LTGD 3S2HH 2FINB 4JI1L 4BWJA 5IGGA 7ICVA 4GLVB 3I76A 2K03A 5DBAA 1W6JA 3Q8KA 2N3SA 2Y0SB 1TWGB 4PG3A 1KN5A 2ZXIA 3LDAA 1X3PA 1WCMB 4N9TA 1SJED 3JPNA 4JI1Q 3C2PA 1SNPA 1CKMA 3BS7A 2YTUA 4QQBX 1XMQQ 2F0IA 3VDYA 3PSPA 4IALA 4H0LC 1HTLD 1YT3A 2P35A 4EZ6A 5HHHA 3I90A 4A3KG 3S14H 1G6ZA 2HHSA 3WOEA 1PDQA 1QOHA 3A8JE 1PH8A 1A2TA 3UMGA 3W3AA 1NNLA 2A73B 4Q8EA 1ZQQA 5KFGA 4UB1A 1YJNA 2LYHA 1UE5A 4A3EB 1IV8A 4JOIA 1O08A 5L1MA 3PX4A 2M2LA 3MEHA 1CUKA 5F2DA 3ER0A 7ICEA 1KW4A 3MDCA 1A62A 4WORA 3V6HA 3VYTA 1E2ZA 1ZQPA 3AMZA 8ICSA 2YU9B 1CT1D 2E75C 3NQTA 1EIHA 1L6NA 1JOKA 3SK4A 3J80L 1JB7A 3BS5B 3K80C 3ND8A 4PL2A 5M5XB 1KRTA 4GKJL 2HMXA 3D2QA 4IQVA 1W3SA 1QSYA 2X69A 1QUQB 1HJPA 3CCQA 3RZOH 5E7NA 3IM1A 2IX3A 1LACA 4B3RL 3RB4A 3M8SA 2MFIA 5C3WA 5KFXA 5J2FA 1XC9A 8ICTA 1V8QA 2NRXA 1ZQTA 2AMCB 1JXEA 2Q0ZX 2YMMA 2BA0A 1XNQL 4DR2Q 4JV0A 4GKJQ 1EZ8A 2OTLA 4UB3A 3CHBD 2ZIVB 1QZHA 5KFIA 3HOWH 4B3RQ 1ZQWA 3MR5A 3G6XA 1XNQQ 4KHPQ 2DKZA 4TURA 2A1JA 2NZHA 1PVQA 1MSGA 4BBRG 2DPJA 1VQOA 1E1OA 4UB2A 2LMRA 1Q8IA 8ICIA 2IOFA 3GV5B 2CWPA 4I28A 4GNXC 4O3MA 2Z4IA 5CBAE 2JA7H 5C0YA 2NVXH 4XQNA 2HHXA 1PYBA 2XGPA 4JBJA 4GLXA 2FFKB 1X9NA 1PH3A 2W43A 7ICLA 2CPRA 1XWEA 2Z6KA 2Y1IA 4KLKA 2BR0A 3FPUB 1JMSA 1T7PA 2KHSA 3H94A 3FKIG 1ZQZA 3QZ7A 5LMNW 1ET9A 5CB1A 4KKUA 1HNZL 3GQBA 3F2DA 1STNA 1CA5A 3QUTA 4JMUA 1J9OA 2AU0A 1ASZA 4F50A 3UMBA 1HR0W 4K2KA 3MC1A 1CI4A 1JROA 1SSOA 4YXJA 2EYLA 4KD3A 1EFWA 5ALMA 2XNAC 1DM0B 4X64L 2R93H 4PZ6A 8ICFA 2LM1A 5IILA 2ZIWB 2EYFA 3QR8A 5JJIA 2EZYA 2DGYA 1AQ6A 4XRHA 2F3IA 2YB4A 4TQUS 1QH9A 4X64Q 4DL6A 2AQ0A 4AP9A 4JI0L 4BDPA 4A3KH 4GKKQ 5M3FG 4LW1A 1K8MA 3J7AF 2B63B 4RNOA 4K8JA 5HP4A 3A5UA 7ICKA 2CQAA 4JI0Q 4NXML 4AH6A 5E3FA 4UBCA 1JT8A 5ELDA 4PNYA 3TQYA 3PV8A 4GN3B 4RCNA 4QW9A 4NXMQ 4FXDA 4GOPC 3BU2A 3SEIA 2WFAA 1EY5A 1II3A 1LO5D 5J2BA 1QILA 1PRTC 2Z7JA 2GVBA 1D5XC 5T1GA 1QQ7A 2GVAA 1WTOA 8ICWA 2QEXA 4RQ1A 4QZIA 3Q8PB 2LMCB 3ORYA 1XS9D 4U68A 5C44G 1GO3E 1NR2A 2M9NA 1JIHA 5AIBA 4OJPA 1F9QA 3I4NB 4L6TB 3HOUH 4UB4A 2PMZE 5EE0A 4MEYA 4QCLA 4BGDA 4TUSA 2B2YA 2RVLA 1KC8C 2LXKA 3PW2A 1Z1VA 4B3SL 1Q12A 1N8RC 2ZXPA 4C2MB 2JV3A 2E2IB 4AQYL 1L7MA 2YX8A 4RAUC 2I1QA 2V4DA 4IPDA 1SZHA 3MVVA 1IHZA 4KTAA 4DV3L 4JI5L 1B7YB 3WKEA 1PRTF 4B9XA 4CDFC 2R7ZG 2UXBQ 3OSOA 4ELVA 5FLMH 1JORA 4LF8Q 3HOVH 1A15A 5KYIA 2YMPA 5DB6A 4QIWC 4QZDA 4DV3Q 4JI5Q 1EQVA 2KHJA 1X66A 4LWCA 2VQEL 2HHVA 4UARA 3CCEA 5IT9E 4IO9A 4ED3A 4JV5L 1ZQOA 3HKZG 1AROP 4AYBG 4M9GA 3IDWA 3ZDCA 1FNWA 2B2WC 3AN1A 4QWEA 3HOZB 1S10A 1STGA 2VQEQ 2W9MA 3FEWX 1S5LU 4ECWA 1TR5A 2G5DA 1Z4OA 4JV5Q 4A3MB 2C9OA 3NUQA 1OTCA 2O5JC 3OHXC 5GROA 3S6JA 2PI4A 4Y2YA 1MQ2A 4RA8A 5CORA 2GH1A 2DF4B 1JUDA 1VQIA 1MJEA 1L5UA 4DQQA 3E0JA 4YCXA 3ZDBA 5DQGA 2R7DA 3KJOA 4I65A 4CRXA 4NXZA 8ICRA 8ICYA 4HAEA 4F8RA 3K0YA 2JR5A 9ICSA 1M8AA 4UASA 4NLNA 3ULLA 3RB0A 2FJ6A 1EY0A 2ZJQA 1PTOH 4DXFA 5M3FH 4ED1A 4DV4L 1FJGL 3RB6A 1WUDA 3VYUA 4CKBA 3H3VI 4ZLTF 2ZIXA 5KG0A 3ZD8A 2D5DA 3RMHA 5L37A 2JMGA 4QZ8A 4OO1G 2UU9L 4RHRA 2CXYA 4K6LA 5J2EA 4RUAA 1R4QB 3AEVA 4HR7B 2W9BA 5HGTA 7ICMA 5J2CA 3IL8A 3U9SA 2L15A 3PSIA 5C5JA 1GXDC 2OT2A 4JPBW 4B9MA 4EX7A 1DOKA 1EWCA 4OJ5A 3RLNA 4DAYA 5JEAH 2UU9Q 2XCPA 3NE5B 4JK1C 2WB1C 1HR0L 5K4LA 1N9WA 3RRHA 3I70A 1FR3A 2CKZB 2EE1A 3PR4A 3RR8A 1GUNA 4UP7A 3ZJYC 5LMNQ 4A3GH 4Y2SA 5CJ7A 3F5AA 1H9KA 2XGTA 1RYRA 3GZFA 3ETLA 3PY8A 1EEID 1QG7A 4IUTA 1Y1VG 4LMQD 4ED2A 5IY0A 3GTOB 1BCPB 4A3JG 3GD7A 4OGQC 3T16A 1L7NA 3FYHA 3V72A 1QZGA 3NTKA 3FC4A 1BPZA 1K0RA 4HN7A 1EWIA 2VJ5A 3MEFA 2Q2HA 4EBEA 2MSNA 1SNQA 1PH4A 3HOXB 3KLRA 4R8IA 3QZ8A 5GAEC 3OTOQ 4O3PA 2D3DA 8ICOA 1LVHA 2XCAA 4GFJA 1ZYQA 4C3JH 2F0PA 2R7ZH 3V6KA 2WB1F 1Q3UA 4DFPA 3DEOA 1T3NA 4UP9A 4CE6A 2KJXA 3SK8A 3M7NA 4BA2I 5J0YA 4J9KA 2E5LQ 2HCFA 1N63A 2KCCA 2ZTEA 2QEJC 4C2MH 1WD1A 1VQPA 1HPCA 5EPJA 4DV2L 5F9LA 1VQJA 5KFJA 3DV9A 2MUTA 3M3YB 5C4ZA 3PIOA 2RQXA 4DNIA 5C0XI 3HOYB 2HIVA 1KBUA 2A74C 1DCZA 7ICIA 2HOIA 3A54A 2NTTA 4BA1I 4C3HG 3VR2A 1S3OA 3H0MB 5ALZA 1OUQA 1YJWA 4YWLA 1IKLA 3BYYB 1NJIC 2DPIA 3EZ5A 4GXJA 2BHNA 4DOBA 4QUFA 2K33A 4K5WA 2KE7A 3AU2A 5KFQA 4AQYQ 3MAQA 3K5OA 5AKJA 3QIAA 3GTGH 1VQMA 1KQSA 3A0HU 2JRZA 3PUZA 3PO4A 4BWMA 3DWQA 2FMPA 4KLIA 4KLGA 2NVYB 4O1NA 5ELEA 2KK0A 2E76C 4ED7A 1N34L 1ZQKA 1TY2A 3GTQH 2JA8B 4IFDH 4O2DA 1I6HH 4XT1B 3RBDA 3K7AB 3QXGA 1B70B 3VYRA 1KTQA 3GU3A 4JYAQ 2ZUBA 1N34Q 1RDPD 2TSSA 1BR9A 3E9IA 4IUNA 3H6MA 1X9WA 2QDBA 3H0LB 5C0XJ 2VIXA 2XO7A 1TWFB 4TRDA 5IWAL 5LMUQ 3A5ZB 2K4EA 3ICEA 4OO1H 4FFDA 4Y2JA 1D5ZC 4KHVA 5ELFA 3J81i 1O78A 4JI8L 4K5VA 4DF4A 2UVRA 1EQRA 1X6IA 2VA2A 1K3RA 2PW7A 5IWAQ 5K36H 2QARA 4CDDC 3PX6A 2FLNA 3I7FA 2FLLA 3S16B 3M4OB 1S77D 2XN9C 5FK9C 1BVSA 3SZ2A 2B2TC 1SL2A 4JI8Q 3T4AC 1TWAH 5A2QE 3H7IA 1JB3A 3LGJA 3F5EA 3NBHB 5IP9G 4RPXA 3SAGA 2CVRA 1PH5A 1Y1VH 4EELA 3RB3A 2K28A 5KFAA 1NBWA 4DK6C 4A3JH 1Q82C 3LNNA 4JI6L 5C4XG 3TMEA 5D46A 1BPXA 1TS4A 4F5OA 4YY3L 3CCUA 3UE0A 1BBXC 2DWQA 3WKCA 5A35A 4JBWA 2AWOA 1QLNA 3AM9A 3QUBA 8ICLA 4JI6Q 3I72A 5C3XA 2KQ3A 5FO7B 3IN5A 3IKJA 2EH9A 3LWMA 4J9LA 4YY3Q 4X3TA 2JEBI 3BQ7A 4PGYA 5C3EH 1WTQA 5IYCH 4YCWA 4BY7G 4A3IG 1E7ZA 1CTMA 3L7ZC 2E8NA 2W54A 4KN4C 4KJNA 4UPAA 4IL6U 1TS3A 1TFRA 1UT5A 3R9KA 4PV1C 4KJOA 1YHAA 4RNMA 1IZ6A 5ELCA 1CZWA 2CQOA 2X6LA 2EOTA 2IHNA 2K6AA 3MFIA 5ALYA 3SK6A 1MGSA 4ZK9B 1H9MA 2SNSA 1SNCA 1D8BA 5CV9A 3DMUA 1NJYA 1EIYB 3IRBA 1X2IA 2KSOB 1PXUA 4I2BA 3I4LA 3MGHA 4HMJA 1HZCA 3U9OA 1V97A 1QQ5A 1UE7A 3LK9A 1HHVA 1YJ9A 4X6AH 1I4GA 2BCOA 2LYBA 2OH2A 3PO3H 3ITPA 3A0BU 2HVIA 2MGSA 5KT6A 2M00A 4O0AA 8ICBA 1DOQA 2AQ1B 1TQOA 2AUKA 5J2AA 1DGSA 5KT3A 1LTID 2B2YC 2QB1A 4J9PA 9ICGA 8ICVA 1KNAA 4TQRA 4MN3A 1EYDA 5NUCA 2BDOA 3HOYH 3QX7A 2LKYA 3UPQA 2KFZA 4HCEA 2JEJA 4R4TA 1KDAA 2HDLA 5KFOA 4YWMA 1PK3A 2XC9A 4B9NA 1KABA 4JG2A 4KD4A 3GTLB 4C4SA 4DR4L 4LVSA 5JU5A 2NZ1D 3IFTA 2JEFA 4YWKA 4F5QA 1DD2A 2JYOA 4ED8A 3H0GG 4LUZA 4HTHA 2CW0C 5H2FU 3SMVA 4L5TA 4O0IA 3CQZB 3T56B 3D4RA 5G5HA 2SDFA 3JPRA 3FHWA 4TSSA 3DWAA 1EY7A 2J0TD 1WTPA 5KFLA 1AW7A 2ALYB 1PK1B 3PUXA 4DFJA 1BF4A 3NWTA 5CV8A 1XU4A 1NZPA 3RUZA 3R3OA 4C7ZA 3M1YA 1MN8A 2Q8TA 1CM9A 1KEJA 4M2YA 1PH2A 4DNTB 2XIWA 1N36Q 3M9MB 2F0HA 2J7ZA 2KCTA 3WK7A 5IP9H 3ULPA 1U47A 3HRDD 1S76D 3QUQA 5KG3A 4I2HA 1D8YA 1ZQCA 3ZDAA 3I73A 5C4XH 2XWJB 1PVOA 4I2GA 1AE2A 2WB1G 3P7JA 3PIO3 2KCNA 5IYBG 1LKYA 3KF8A 5BN5A 2AQ2B 5ALUA 5KFTA 1WJJA 1WTVA 4JB3A 3Q8LA 3LWUA 2JN4A 5IYDG 1UE1A 4YR2A 2E2DC 5L1LA 4RQ5A 3G6JB 1AN8A 5D4BA 5IT9L 1VDVA 2KNJA 3ISCA 7ICUA 4RWSC 4BY7H 4O5EA 4A3IH 1SIJA 2VA3A 2XVSA 1SWWA 5CR0A 4DF7A 1X3QA 3HFZB 2K4HA 4G7ZC 4XT3B 4GNXA 1HQRD 2PKEA 3VCBA 2LM4A 4YG2A 2Z4HA 3F1ZA 3OIPA 4UB5A 3CC2A 4P72A 1LLRD 1ASYA 2YMQA 4MEXA 3C5FA 1YNJD 2EYHA 4ZRZA 5EKLA 5BPCA 4IR9A 5J2HA 4C80A 2JQOA 2R6GA 4Y2PA 9ICUA 4GC7A 2R7FA 2VANA 1MBYA 1D5MC 1BGXT 4LUVA 5M5WH 3KJPA 4QGUA 4I27A 4O5KA 2XY5A 2EY2A 2JJQA 5KG6A 2IHEA 3RZDB 1K5OA 4CDGA 4RPYA 2OHFA 2QW7A 5I6WA 4LF6L 1JALA 4OX9Q 1LABA 4ME3A 4QUCA 3EPIA 1E2VA 2OXOA 3WK9A 4QZCA 1XX8A 4OIJA 4DKAC 2IL8A 1IYJB 1F2ZA 4B3TL 1B1ZA 3E0EA 4LFCL 4IUPA 1VQAA 4NLZA 2AGPA 4G57A 2JEAI 3J7ZC 2LI6A 4NLCA 5AKYA 4QZGA 3ERSX 1JICA 4B3TQ 2VQFL 3GTMH 3S2HB 3NHHA 4H02A 2G08A 2XICA 3NQIA 2K8BB 4JI3L 2NRTA 2NV3A 3NWSA 1WTWA 1L3UA 4OONA 4ZYSA 3T5LA 3UDIA 4DGZA 2VQFQ 3IG5A 3BS1A 5AKLA 1V1PB 4JI3Q 4NY8A 1RTOA 3UQ0A 1K3BC 2F3VA 4GOPA 1WTRA 3J7YW 2OQKA 4NL9C 3MZ5A 4C8MA 3TP6A 4CJ0B 4WFN3 1SE8A 2B2UA 2WF7A 2LBOA 5IP7H 1UAPA 4DQIA 1Z47A 5KFFA 2PMZB 4FF4A 1VQNA 1HUOA 3E6ZX 9ICVA 1C9OA 2FJ2A 1CA6A 3M8RA 3KF6A 3SVMA 3PV0A 3TARA 4BX9C 4IURA 1MQ3A 4HIDA 3D8GA 3S1RH 2KHIA 4NW2A 4X62L 4HSVA 4EEYA 4F4WA 1S5CD 1T9HA 1PVRA 2K8AA 4K4GA 2ZG6A 4IZ8A 3L2PA 4A3FG 4JI4Q 3JAMc 1I4QA 5KEEA 4HAIA 3EPGA 4DQPA 1CEZA 2HQEA 4X62Q 1SYEA 8ICEA 1TWCB 4B9UA 5IYDH 1VQFA 4KLFA 2NRZA 4N8X1 4UQGA 2ZXRA 3OSNA 4NP5A 3L3FX 1KKXA 3IG8A 3VA5A 3ONNA 2RLTA 1ZYRD 1C20A 1D9DA 3SR6A 4QZBA 3CPFA 4RGNA 2ZUDA 2LY7A 3TACB 3N28A 2W7OA 2MPMA 4NPSA 4R8NA 4AIMA 4KN7A 3GV8B 8ICXA 5CV6A 1IM4A 4GIBA 3N97B 5C6AA 4EQNA 3PO2G 1EY8A 5ALPA 2A8VA 4PHDA 2EIFA 2PZUA 4NM1A 2OEOA 1SFOB 1NNXA 5DLFA 4A3BG 2P66A 2RA4A 3HOWB 3NP8A 2YV5A 2UUBL 1I4RA 2B2WA 4B9VA 1J2MA 1I4HA 3NVWA 2HSZA 1FGUA 3N6RA 4UAWA 2K01A 1IXRA 3Q24A 1GVPA 3I91A 4NM2A 2KHVA 4JUZA 4Z6DA 3RF9A 1U45A 2L1BA 2JA5G 5C0XG 4EQOA 1D7QA 3RJEA 2LXJA 3CP8A 2JA7B 3BDOA 4L63B 1ZJNA 3K58A 2NVXB 3C1YA 2PCFB 1F2YA 4YMNA 4RKBA 3TANA 2WF8A 5TZVA 2ASDA 1SKWA 1ZQRA 1IW7D 1M4VA 1DK3A 2F77X 1NTGA 1O7IA 3BVMA 2RDHA 4DR1L 3IRUA 4CHTB 2EAOA 3A8KE 2JK8A 5IODA 4GC6A 2HOQA 2G9HD 4KLTA 3HKZC 2CCZA 2NN6I 3IHQB 4F72A 2HHTA 4DR1Q 1HRJA 4O5CA 2I5MX 3EIVA 2H3QA 2PFPA 2MP1A 3MXNA 5TISU 3RH4A 4P0QB 2EVBA 3EVQA 4EQ5A 2ATWA 1AE3A 1WTHA 5KFUA 4QJFA 2BPCA 5JVH3 2HOFA 1SYGA 1U4MA 3G48A 4DOAA 1TS5A 4YP3A 4QMGA 2KJ9A 1TY0A 2R92H 3MR2A 2R93B 3T13A 5DQHA 1NJZA 4ECYA 1YVCA 5KFBA 1IBKL 1HNXL 5CP2A 2K05A 3TN2A 3EJIA 1EIGA 3P20A 4MHVA 1YHBA 5AHXA 5M3MG 1Y1WG 1F5SA 4J03A 2RRDA 5ELOA 2E2HB 9ICHA 3QJYA 4A3KB 4K14A 1IBKQ 1T5XD 2KVCA 4IJLA 1KQQA 1HNXQ 2JA6G 3S2DH 7ICNA 2XSCA 5AJ3L 1Q81C 2W55A 2IOHA 2B8GA 3SENA 4AYBF 3HKZF 8ICHA 4FNFA 2J6SA 9ICKA 1P16A 1Y8OB 2RSNA 3OW2A 3T1HL 4ZKCB 4YD1A 1Z19A 3J80c 4ECVA 1JJCB 4TKOB 4HIKA 2C2EA 1BNOA 1JE5A 5AJ3Q 4R8UA 4FVMA 4A3CG 3M4QA 1XJVA 3CRXA 3HT3A 3T1HQ 3E5SA 4UHVA 3VR4A 3RAXA 3FMCA 4XXEA 4A75A 3CKIB 4BBSH 1L0YB 1ZQNA 2EZZA 5KFWA 2KA7A 4Z6CA 2V9WA 1XPUA 4DSEA 4JV2A 1QNUA 1ZQDA 1FL0A 5B5EU 3ONAB 1AZPA 2E2JH 1ZQMA 2B29A 1Q1BA 5GAHC 1NCVA 2VJ4A 1I3QB 3HOUB 1HTPA 1DXSA 1ZQXA 4DV1L 1F0MA 2YY6A 2BZFA 1BKBA 1SRUA 4IPCA 2N78A 3K1ZA 4MFAA 5FJ8G 5J0PA 4JW0A 3OOCA 1QCKA 1BO0A 3FDSA 2W8KA 1TWCH 1RHPA 2JSOA 2Z9HA 5AKZA 1JQYD 3M4PA 1LUZA 3T5KA 4WRDA 5I9OA 3CCVA 1ENFA 4DV1Q 1SYFA 2F0QA 2WB1E 3NRZA 4NLBA 4KLHA 2R8JA 2Y0SG 5EQ0A 2BCUA 3M7DA 2PFOA 1X6JA 4O3NA 1Q86C 4RQNA 3RN5A 2K60A 4CDEC 1FEZA 3I2ZA 5G5GA 2F0GA 2JGAA 1QVGA 1VJ5A 2PFQA 1HUMA 3HOVB 1ESFA 2K8CB 2EY6A 1CK1A 5KNIA 3ZYYX 1SFOH 4MF2A 1PV4A 1G2TA 1RJTA 1NOMA 4QZ9A 4E6IA 1PH9A 2F4VL 4RQ0A 4B3ML 3QU2A 9ICFA 4RG1A 1W2BA 1ZKOA 4B9LA 4R63A 1ZD4A 4BXXH 5ALEA 4DLEA 1A0IA 1KNEA 5KFNA 4C8KA 1SB3C 4B3MQ 3LVWA 4PJ0U 5DKWA 1XSLA 2FDRA 1IIPA 2QLTA 3PF5A 2F0JA 5JVG3 3L4PA 5EJWA 1DJRD 1J6QA 4N9PA 1Q1EA 1A3VA 4XTCS 3C1EA 3N7SC 3I4MH 4PHEA 3CCJA 3EUB2 2ID0A 2AGOA 7ICTA 4F91B 3K8AA 4IN3A 4X3UA 4LNQA 2B0CA 1KRSA 3CD6A 1L8LA 3RN2A 3RNUA 5A0LA 4X3SA 4XIGS 1Y1WH 3S1NH 3D4DA 9ICBA 2L4NA 2B2TA 1PTOB 1JC7A 1G51A 4DL7A 1RCVD 1X6OA 2I07B 3HEJA 5CV5A 5M3FB 1OXSC 2JA6H 1RYSA 2DNCA 1QVFA 1CSPA 4M8AA 4PMCA 2UUCL 2KKPA 2XI9A 4PHAA 5KG5A 1HNZQ 1NR4A 3GILA 2ZTCA 1TK0A 1OO9B 1V1OA 2NYVA 1SXEA 4FP5D 4RQ3A 4R64A 4R4OA 2UUCQ 1RTNA 3TADA 3JC66 4F5NA 5AM2A 1YNJC 2E2HH 2UXDL 1JWMD 2A68D 1MJCA 1N5XA 4EX6A 2DJGC 2B21A 5AK3A 5F9NA 1I6VC 9ICIA 1U9LA 8ICZA 3WKDA 4KN4A 5E4XA 4A3GB 5DDYA 1ZQGA 3EA6A 2UXDQ 4LZDA 1JR0D 1Y88A 2MRLA 3QU4A 1ZQYA 7ICFA 9ICCA 7ICRA 4HMIA 4KITB 4DFKA 1BPBA 3RD4A 1S0VA 3HZXA 1C0AA 1X65A 1JJ2A 1KFDA 1SZPA 5ALIA 4J8QA 3CC4A 3GIIA 2FXQA 4JVZA 8ICJA 3K5NA 1FIQA 5EPKA 1F44A 4BWGB 2EANA 1X54A 1K8AC 3WK8A 9ICQA 2B2UC 3G4SA 2BPFA 5KFSA 9ICRA 3GTPH 2PZWA 2Z1CA 1CSQA 1P7DA 3BVZA 1BUVT 4C3JB 1Y14B 4QZEA 1NK0A 1I3QH 1YI2A 2R7ZB 1B4OA 5IGFA 1B0XA 2JHDA 1NSNS 1DZ1A 2NVTH 1NK4A 3GDEA 4I2FA 4LFAL 3SE0A 4DNRB 5AM3A 3C2KA 2O2LD 5EGTA 4EZ9A 5J3BA 1PHJA 4M47A 3CF5A 4FO2A 1AZQA 2N55A 4YCUA 3KDFA 3IV6A 4FZMA 1S9FA 1SYBA 1EYGA 4B3SQ 2FPKA 4QW8A 5C5MA 4L5RC 2F0TA 1XSNA 3D6CA 4IC9A 1RXVA 2NWGA 4QL5A 4BBRH 5KL8B 5J8YC 5J0UA 3CAMA 5IIJA 2AQ4A 5JJZA 3HILA 2G5HB 4OJLA 1J8IA 4LF4L 1A3UA 4KN7C 1VQBA 3VYSA 5BR8L 1SE4A 4K4IA 2ZIUA 2DUYA 3T51B 3KOOA 2L11A 2OXPA 5IINA 1COOA 2QDLA 2OYYA 3GTGB 1P8LA 3NUCA 1A77A 3LX0A 2HCCA 5KNBA 2L5YA 1JRPA 2K5QA 3KHGA 2AKWB 4U673 4J9MA 7ICGA 8ICCA 1XSPA 3FKIH 3PZPA 5AI0A 4NJ8A 4KMUC 1VQHA 2VUMG 1Z00A 3GTQB 4WJ4A 3B0YA 3PCOB 3I4NG 1I6HB 4HIOA 1VQCA 4EBDA 1RL2A 4LF9L 3FRPB 4NWIA 1ZYRC 3T1YL 4BXOB 3KHLA 1AFPA 1ZOLA 1S5FD 4OHJA 4LF9Q 1EU4A 1O7YA 4MZ9A 1S40A 1ZD2P 2DL0A 2BDUA 2I5LX 3T1YQ 4QIWF 1TT2A 3EYZA 3ZD9A 5ALXA 4HJ7A 1GUGA 3NBIA 1MHWC 4CF3A 5H1SE 1E22A 4KLJA 4FF1A 3ZDEA 4DEZA 4QWAA 1TWAB 2L9HA 5HNKA 2N1RA 2KVMA 5HGQA 5CBEE 3DHQA 1N32L 1QB5D 5M5YH 1E0BA 4Z9CB 3FM9A 2VB3X 1T94A 1Y1VB 4DV4Q 1S5ED 1FJGQ 4A3JB 5L1IA 1HZBA 3UXOA 5J2DA 5EAYA 3SYZA 3S9WA 5KFRA 2G9DA 3TAQA 3PGZA 4F88A 1H9SB 3OMCA 2IHFA 2MJ8A 3V7LA 1IW7C 2Q8IB 2K04A 3MGVA 4DV5L 3B9JA 4U6PA 4DOCA 1SKRA 5C4JH 5ELBA 5C3EB 5C44H 3OHBA 5CMDA 4M0AA 4PQXA 1ILQA 1HR0Q 5GADC 1EOVA 3SEBA 1QSLA 5J29A 3AU6A 2ZM6L 1VQ5A 2MUYA 5AI8A 1TKWB 2XRQD 4UATA 5EOZA 4O9MA 4QZHA 1TAMA 3M6ZA 1QWYA 1SAPA 1JMCA 4RU9A 2ICEC 5EKKA 9ICXA 1EL0A 2RDIA 4RQMA 3A7LA 4RH6A 2C2RA 3RH5A 1L1OC 2W3RA 3MR6A 1KTKA 1SKSA 1WOCA 2TMPA 3C46A 4GZYC 4CCHA 1XPRA 2UXCL 3TFRA 4GNXB 3PO3B 2K4PA 1DK2A 3BZCA 3RJGA 3KZXA 4JWMA 1YBYA 4P4PA 1SL1A 1QUQA 2BE5D 4RGOS 4F4XA 4ZH4A 4KV6A 4DK1A 2QB0B 4DSFA 5BOMA 5D49A 1BBUA 4YR3A 2KZZA 2ZTDA 1LTAD 2VA8A 4LAAA 4A3DH 3ED5A 5F3XB 4A93G 3RZOB 2ZIVA 1JE4A 2H3IA 4NL9A 4OL7A 4FF3A 1ZQLA 4LZGA 1V38A 4DV2Q 1I4PA 3JAMi 2VUMH 1PTOD 4F4KA 2K1BA 1JJGA 3BQ0A 4C3IG 4F93B 3JPSA 3QUCA 5AK4A 5ALNA 4CF5A 2ISOA 1PYWD 3MFYA 3QWNA 2F44A 3PIP3 1X3FA 4FZNA 4RZRA 2PI5A 1YITA 3TBIB 3RRGA 2F1HA 2F0DA 1NK9A 1BOSA 4PMBA 2EXZA 3TQ1A 1O7LA 1GOZA 4C4RA 4CDCC 2R18A 2K5NA 5CYUA 2KV2A 4DSIA 3TS2A 5I2XA 2IA6A 4GXKA 4KLMA 2MHVA 3CCLA 3H3VC 4FXKC 5KG1A 1CKNB 5AM5A 2E8PA 2EAPA 2VKQA 3NGDA 1SR3A 3C28A 1SXTA 4K0KL 3R93A 2BCRA 2XRSD 8ICPA 3QG1A 5KFYA 4R4IA 2PI2A 1PH7A 1LM0A 2WAQC 3H8JA 1FVIA 1Y69U 3P75A 4Q5VA 4GOPB 2BCVA 5C4XB 4K0KQ 1PRTB 4MF8A 2HCIA 3OIQA 5HMMA 3K81C 5FLXE 1X9MA 3JAME 2ZIWA 2EYMA 3MDAA 1AH9A 2W11A 3T5HA 4IJHA 3HKSA 4UP8A 1V9PA 2K5DA 2ASJA 1ZD3A 2ALZA 3ULJA 3G6YA 3CCMA 4IUQA 5KG2A 3JPQA 1UPHA 4I7ZC 3D6WA 4BY7B 4A3IB 1Q3VA 3Q6SA 2A69D 2PYKA 4N8FA 5IIFA 1EY9A 1HFNA 2Y9TA 2O4XA 1NY4A 2DKXA 1LB2B 3OYYA 1EOTA 4DS4A 1DXMA 4B9TA 3TI0A 2NYZD 4J6HA 3SHLA 4F8MA 4DL3A 4HJ9A 1L3TA 7ICQA 3TADC 3GV6A 2JA8G 1K83H 1SBBB 1U4LA 3CCSA 3H4DA 4WJ3M 2WF6A 9ICEA 3KFUA 3JPOA 4DF8A 3NVVA 1L3VA 3TZUA 5EKIA 9ICTA 1CI3M 3AU7A 5M5WB 1KD1C 2F0MA 2NZOA 2BA1A 3J81E 2KVSA 2WINB 2K89A 4ECXA 4QIWB 5E4WC 3PMNA 3Q8RB 3EBEA 5BN3A 2JE6I 4RQ6A 1FD7D 1NKBA 1WI5A 4ME5A 8ICMA 1RYUA 1H95A 2Q8RE 2K7VA 4DS5A 4YHHL 1WFQA 9ICLA 2RDJA 3AFQA 1N33L 5CWRA 3HX0A 1WD0A 5EWFA 1VQ7A 1MKHA 4LJZC 3NASA 3J80i 1TU2B 4A93H 2KENA 4OELB 2NRVA 1M6YA 1GD7A 3K0XA 4YHHQ 2CN1A 4FYDA 3M9OB 4L5QA 3I28A 2K50A 1XO1A 1QCBD 2A68C 4C3HH 3NVYA 2ZJAA 5CR3A 1T3QA 2KEEA 3KTQA 3T3FA 4F2SA 4C3IH 5I2YA 1Q7YC 3GTMB 1Y8PB 1A6XA 5AM4A 3MFGA 2D8CA 2W04A 2CH4W 5J2IA 3QEAZ 1E3PA 1WTXA 1RZTA 4UAZA 4I2EA 2PW5A 3SK5A 1LT5D 1ONLA 1VS0A 3N7RC 3S17H 3EN2A 4JC0A 1B9MA 4NDXA 2F3WA 2WHEA 5KFHA 2B39A 2WP8J 3URYA 3NTUA 1VQKA 2CFMA 5IE8A 3PX0A 2MAXA 3A0JA 4FDBA 1YZ6A 1F2MA 4GN5A 1QJOA 4AYBE 1L7OA 3HKZE 4TUQA 3MWYW 4QB4A 3CC7A 5ALTA 3RLOA 4APVA 1XO0A 3A8IE 2F1IA 4BJQA 1U9RA 2K4KA 4DR4Q 1NKEA 4TQSA 2ES6A 1I50H 3OJUA 4DV7L 5L9XA 1F2LA 1DGJA 1QSSA 2ZJ8A 3S1RB 5HHIA 5IT9c 3TP7A 5IIMA 4Y7NH 4P2CB 2EZVA 2H1EA 4A8EA 2WB1B 4JBMA 2J6TA 1KLUD 4IQUA 4L5SA 1IL8A 2ASLA 5ALWA 5L1KA 1NZBA 2NRWA 3BVGA 5IGCA 4Y2TA 3V2TA 1K1SA 1BPDA 2NVQB 4KTQA 3MFHA 3EWAA 1SJHD 4DR7L 1BCPD 3PSTA 1IBML 4RT3A 5T1IA 2UUAL 3L9AX 3OWFA 3NENA 5C3EG 4A3DB 1QNKA 4F3OA 2W7PA 3QYPA 4FZLA 2E3TA 4ZAIA 1Q3LA 1XTCD 1IBMQ 1NK7A 2UUAQ 2Z0SA 2EJGC 1BNZA 2JEIA 2EAMA 4NLGA 1EYAA 1SL0A 3NEMA 4BY1G 1LTSD 1PZKD 3CU7A 3TFSA 1STEA 1SYDA 3K75D 3H8WA 2Y0SC 4YMOA 4I2IA 1ZQAA 4B08A 4K6DA 2WF5A 4DR6L 1S72A 1EXNA 2MNAA 5KT7A 1STHA 1IL2A 9ICMA 2KZMA 3BJYA 2ENBA 1UNSA 2KP7A 1N48A 8ICKA 1VCIA 3DLLA 1LT3D 3T5JA 2OEHA 2K75A 4F4ZA 1FFUA 5AK6A 1NMGA 3C21A 3AFPA 4H7BA 3S1QH 3QNMA 3A7AB 2KECA 2N49A 4RGMA 2HBJA 4DK3C 3GP7A 4YFKA 2JEGA 5TSSA 2B6GA 2OM6A 4C0ZA 2FI1A 3HRZC 3TP8A 1COKA 2HDMA 2OWOA 3WOFA 2A6HD 2A1JB 2KN7A 2R92B 1ZEQX 2Y0SF 2PPBC 3K5LA 4LF6Q 3UE1A 3AQEA 2EY5A 4UAYA 1SN8A 3OTQA 1H9JA 3HG9A 3WDNA 2ES2A 1GJXA 3GQCA 1ZQSA 1EWHA 1A3TA 2FMMA 2HUGA 4LFCQ 1LTRD 1NAPA 3S2DB 9ICNA 2O6KA 3H0GH 3E2EA 1PZJD 2F4IA 1Q46A 1JI7A 1WWVA 4YN4A 1K8OA 2Y1JA 1EEFD 2H5XA 4KLEA 1U4BA 4QNLA 1LTBD 2F8KA 4R4CA 5C4HA 2IY5B 4EEKA 4P2HA 4FS2A 3DDHA 9ICPA 1UWVA 2KZ3A 1S5BD 2L0CA 5AKHA 4F92B 2H3ZA 2ICIA 5DM73 2A6ED 5JEAJ 1WCLA 3C29A 4TUPA 2E8GA 4BBSB 3H8MA 1GUTA 3O0FA 2PQAA 4EQPA 4DU9A 4POFA 3W1BA 3GTJB 4OWWB 2WAQG 2A3VA 1B50A 1BBWA 2NB0A 2FMQA 4E0D