1IXRA

Ruva-ruvb complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
135
structure length
135
Chain Sequence
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Holliday junction DNA helicase ruvA
total genus 29
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ixrA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ixrA01
3KF8B 4Q8EA 3RH5A 4NLGA 2JA8G 5HP4A 4IFDG 1YJWA 2HW3A 3MFHA 4JI2Q 1DGSA 4BY1H 3TREA 1VQFA 3KHLA 3HX0A 7ICKA 1WI5A 1EIYB 3GTGH 4ECQA 1N33L 3TS2A 4DL7A 1ZQNA 4DSLA 3MDAA 2IMWP 3BZKA 3GV7B 4DK3C 3UDIA 4QZAA 2Q2IA 4O0AA 3RJJA 3SI8A 3L2PA 4EEYA 4JWNA 5J0UA 3PR4A 4MF2A 3TARA 5D46A 1MSWD 3PW5A 1K0RA 3T1HL 1TK0A 4DV5Q 1HZAA 3SYZA 1GKHA 4PGQA 5FLMH 4ECUA 5BR8Q 1QSSA 2NN6G 4A3LG 4WJ4A 4DPGA 1X9WA 2MO0A 2KHIA 4JI5Q 4PHAA 4JYAL 1L0WA 3H7IA 1L3TA 1L1OB 2FPMA 1QVGA 2VUMH 1XMQQ 4JUZA 4LF8L 2C2RA 4MNOA 4ECYA 4KLLA 3IHQB 5KFJA 1OXTA 3RH4A 3GFKB 1S0OA 8ICTA 1JJCB 3M9NB 4A3BH 4JBMA 3MR2A 1XPRA 2ZJ5A 2HHTA 4YHHQ 1S40A 2ASBA 2CQOA 1UE6A 4BWMA 2XTIA 3ULPA 4L5RC 4QZ9A 2NZOA 1UWVA 3H0GH 1JMSA 4A3GG 4P4PA 1SZPA 2ISPA 1M1KC 3H8WA 1OXUA 4HIKA 1RIPA 3UXPA 5IYDG 3PO4A 4DR7Q 1NBWA 2UVWA 4R4QA 1VQ6A 1B43A 4GKKL 2CCZA 1KRTA 3HKZE 5KTQA 1U0LA 2ZUCA 2NVYH 4KLFA 3STBD 2UUBL 3DM3A 1W2BA 8ICIA 4DR2L 9ICUA 4A3FG 1BBWA 4J9QA 2VY3A 2ID0A 3CCRA 3EIVA 4RUCA 2F4VL 3V7JA 4GOPB 4C3IH 5LMUL 3H0GG 8ICQA 2YYZA 1EIFA 1NY4A 4DS4A 1JX4A 4DKAC 3Q8PB 5IYDH 4H02A 4Z6FA 1XU4A 3A74A 5KFEA 3ISBA 2C22A 2EXDA 4YG2A 1N32Q 3JPRA 3MXNB 3CAMA 3RJFA 4NM1A 4DR3Q 4Z6DA 4RT3A 3A5UA 1CKMA 4BBSH 4BY1G 4I2DA 1U4BA 9ICAA 9ICQA 4A3EH 1S10A 2JEFA 9ICJA 4DOBA 4JG2A 2BQUA 4RQ1A 4Z6CA 1ZQSA 3JPOA 1UT5A 3HPOA 1AROP 2DUDA 1X55A 4POFA 8ICFA 1D9FA 1QVCA 2B63H 1S72A 4ZH4A 1BGXT 4A4IA 5D49A 1Z47A 4DV7L 5J2BA 1VQ9A 5F9LA 4QJFA 2DPJA 1KQSA 1OTCA 3CCMA 1QLNA 3GIIA 2PI5A 4PPXA 1X6OA 2H5XA 4M6WB 2BH2A 1COOA 1XSLA 3A5ZB 4FBTA 3CPFA 3FYHA 3HOYG 5IYBG 3AQQA 4B3TL 1BVSA 5KFUA 4DQSA 2C2EA 3TS0A 4I27A 5KFWA 1D8LA 5J2FA 5FLXc 1ZQJA 7ICEA 5DBBA 5J2CA 4QZCA 4JYAQ 2FMQA 4G3IA 4R8UA 3AFPA 3K8AA 1N36Q 5DDYA 4IRCA 3I56A 4P2HA 3LK9A 3BJUA 1LUZA 4JV0A 1KDHA 2UUAL 2ZTDA 5KFQA 1PV4A 5JJLA 1JJGA 1X9NA 4DLGA 5J0XA 1VQJA 5CA7A 2AHOB 5HMMA 2BQ3A 5C0XI 1A63A 2RDJA 2JZBB 2VA8A 4X64Q 4BXOB 4A3JH 5KFYA 9ICFA 4UB4A 5CHGA 4GKKQ 4EYHB 2NRVA 1QUQB 2I5LX 5KFPA 4KLGA 4O3SA 3J7A5 1E24A 1IBLL 3T5JA 4DL6A 1Q12A 1XO1A 3E9IA 5CR0A 2KBNA 4P72A 3S2DH 1FGUA 2AQ0A 5J0PA 4J9OA 3TANA 4DWIA 5TZVA 4NY8A 4ELTA 2ZTEA 7ICTA 3PIPA 2VQEL 3ZD9A 5AJ3L 3UXNA 1S97A 4QWCA 3I4OA 2Y1JA 2E2JH 4DSKA 1I5FA 1GVPA 3PW2A 4DR4L 2UXCQ 2IHNA 4YD2A 4QZEA 1D7QA 1KIXA 5HMLA 1LM0A 3Q8KA 4GNXA 1ZQFA 4JV5Q 1Q1BA 4O3QA 5E7NA 1XNQL 3HP6A 4QIWE 2YTVA 3KHRA 2R92G 2R7ZG 1ZQUA 4OWXB 3ZDEA 1OXXK 2ZUBA 5KFLA 4HJAA 3IM1A 5KG3A 3L7ZC 4MFAA 3K7AH 5M3MG 1K8GA 5M3FH 2HHUA 3G6EA 4OX9L 3C2MA 1S0NA 1ZQAA 5C4XG 2AJQA 2ISOA 4AQYQ 1PH8A 4YCWA 2N8NA 1MJCA 4LUZA 2Y1IA 1J5EL 4ED1A 2V4RA 4DV1L 1ZQZA 4YY3L 3V72A 3BJYA 9ICVA 4C8KA 4YWLA 9ICKA 5L1KA 2I1QA 4MFCA 4LF7L 2R92H 4C8MA 1QVFA 4LFBL 2E5LL 4NXZA 8ICVA 2ATLA 1RXWA 1ZQIA 1KL9A 1YBYA 4A3LH 4JI3L 4M9NA 4QWAA 3PX4A 2N3SA 3TI0A 1NK7A 4GOPC 5IIJA 2WP8J 4UP9A 3CCQA 1YHQA 4KHPQ 1NMFA 4BWJA 1O7IA 4JI0L 4B3RL 5EOZA 4TUQA 8ICGA 2BKEA 3CPWA 1KRPA 4F4KA 3OSPA 4C3JH 8ICYA 5EWFA 3I4MH 1VQHA 4J9SA 5KG0A 5IP7G 1X9SA 4RPYA 3B0YA 3PX0A 1HR0Q 3SV4A 3J81j 1BKBA 5KG5A 3UDGA 1G6PA 2W9AA 2UXBQ 1Y1WG 4RG1A 3S1MH 5DLGA 4KLQA 4Y7NH 4I2HA 4TQSA 5J0OA 4DV6Q 3GTLH 2L15A 2JA5G 2C2DA 1WCNA 5CP2A 2AMCB 4GNXB 9ICNA 1J5EQ 4IQUA 8ICHA 9ICIA 2EIFA 4DUZL 4DR1L 4M2YA 4DO9A 4RNMA 2GVAA 1VQAA 1P16A 4O3NA 5FJ8H 3THVA 1NJXA 1BPZA 1HNWL 1NK6A 1T9HA 5C44H 1VQIA 2P6RA 3CD6A 3S1NH 3S17H 2JZBA 1UE7A 1XNQQ 1NK9A 4DV4L 1ZQGA 5D4BA 2PNHA 2K75A 3RBEA 3GIJA 5K36G 1QSLA 2KCMA 2MUTB 8ICZA 4X64L 1RZTA 2I9GA 3JC66 2BCRA 4M9LA 2PI4A 2BGWA 3BQ0A 4K4GA 1W3SA 4LUVA 1BBUA 4KN4A 4JOIA 5KG7A 4RQ6A 1XMOL 3OJSA 5KT6A 2A1JB 3JPTA 2FLPA 3RNUA 1S77D 3RN5A 1TV9A 7ICUA 4FO6A 4JI2L 1ZQWA 1N56A 3GTMH 3T1YL 1I94L 5KFOA 1VQMA 1PH3A 4F5RA 2JEIA 3KOJA 5J2AA 2PFQA 4OO1I 9ICOA 2V4QA 1IM4A 1L3UA 4I2EA 3AUOA 4YN4A 1OXVA 4FS1A 4POGA 3C2LA 9ICLA 4UQGA 4LF4L 4NXMQ 3ISCA 2HHQA 4DQQA 4J9KA 3DLLA 4M04A 3HOXG 4PZ7A 2IHFA 3J81i 4RUAA 3E0EA 3ZD8A 1CKNA 3SV3A 1BPDA 2AGQA 4UB5A 3PGZA 2Q0ZX 4NLZA 4JI0Q 4B3RQ 4BBRG 4RNNA 3CMEA 3AYHB 1EYGA 3K4GA 2EQSA 3NENA 4K0KL 3S16H 4K4IA 4GN4B 1Z9FA 3ULLA 4R64A 1N9WA 4OWWB 3AFQA 2JJQA 2XC9A 2BQRA 4PGXA 1NMGA 5M5YH 5L1JA 1SL1A 5LMNQ 1FJGQ 2VA3A 5KFAA 4DL5A 1EQRA 2N78A 1LTLA 3OSNA 4L5QA 1TFRA 1BPBA 5IY0A 4RQ4A 4IQTA 4QZIA 3OW2A 3JAMc 2K5HA 4F4YA 1QZHA 3H15A 1TWFH 1NJIC 4GN3B 4A93G 2IX0A 2FPLA 4YCUA 4GC7A 4DR7L 1HJPA 4IFDI 4IFDJ 8ICPA 3M9BA 4F4WA 5IP9H 3LGJA 3HW8A 1ZYQA 3CC4A 2W9BA 2AGOA 4R1JA 4DR2Q 1KFDA 2R8JA 4A3DH 3KDFA 1XJVA 2UUBQ 4BXXH 7ICMA 1XSNA 1SR3A 2F1HA 4HIMA 2K50A 3EYZA 2FLNA 1B7YB 8ICOA 4DR4Q 3LDAA 2HIVA 1E1OA 4AH6A 4NXNL 5KFNA 2XCPA 4RZRA 3MDCA 3PW0A 7ICSA 2B21A 5J0SA 1VS0A 1ZQYA 5M3FG 1P8LA 2CWPA 1I94Q 2BHNA 4DV3Q 1C0AA 3RB6A 1LV5A 5J2IA 1N48A 5DB8A 5BR8L 4DR5Q 3GDXA 3Q8DA 5HGQA 3ZDCA 3ETLA 1U47A 3K75D 2NVQH 1IBKQ 2NRTA 1HUZA 4LF5L 4J9RA 3PUZA 3I55A 3RR5A 2PQAA 1KTQA 4NXNQ 4MEXA 1K1QA 1PHJA 4ECZA 3G6VA 4HIOA 5GAEC 2JK8A 1RPLA 2PMZE 2GWSA 3M9OB 4ED7A 4IOCA 4YMMA 4A3CG 5IIIA 4LF4Q 3Q8RB 4NXML 4O5CA 2PXIA 4KLIA 2QGQA 2YV5A 4TQRA 3FKIH 5HHIA 4JI7L 4OONA 3JPSA 3M9MB 5IIMA 3STBC 3D31A 4KLSA 5IILA 4Q43A 4F2RA 3NGDA 1N36L 1JE5A 5C3EG 4YCXA 4DV0L 2KN7A 4F92B 3K80C 2JA6H 1Q81C 3RZOH 5KFRA 2AKWB 1SKRA 3PIOA 1S0MA 3H3VI 3ICEA 1YNXA 2FLLA 3PMLA 4LFAL 4DR6Q 4RQ3A 5KT2A 1Y1VG 2CFMA 2ALZA 3HOWG 4RPXA 4ECWA 2K5VA 4LF6Q 4UB1A 2ASJA 3PR5B 3V6JA 1HZCA 1WFQA 4F4XA 2UVVA 2V9WA 5DQHA 3HWTA 2ASLA 1VQLA 4TURA 1YIJA 4BDPA 5BOLA 2BCVA 4F5QA 1YJNA 2FMPA 4I2GA 4A76A 4A3BG 1SFOH 3T3FA 1VQEA 1S76D 3G4SA 1FL0A 3F2DA 4IOAA 5J0QA 1OXSC 3KFUA 2YTXA 1Z3EB 1ZQCA 4ED3A 3HOVH 2BPCA 2ZTCA 3GIMA 1UE1A 1Y1VH 1Z00B 3U58A 1SRUA 1A76A 4OWTB 1NE3A 2Z6KA 3OGUA 2HHVA 1PVOA 3RJKA 1B70B 4HYKA 5EWGA 5GQOA 4FBUA 8ICUA 1VQDA 1ZQKA 1HNZL 4QWEA 5DG8A 3PMNA 2OQ0A 4XTCS 3TAPA 5J2DA 2RF4A 3HT3A 4F5PA 1NJZA 3NEMA 3RB0A 4JWMA 4B3ML 3C23A 4ECSA 4YY3Q 3EZ5A 1U48A 2FMSA 1SLJA 4LNQA 8ICNA 2QA4A 1V43A 1K9MC 4PH5A 4B9NA 4IJHA 1YJ9A 3IRBA 3UQ2A 1XMOQ 2XY7A 8ICJA 2BPGA 2DPIA 3Q8QB 4F5NA 2W9MA 1VQPA 3V6HA 4ALPA 2JA5H 4YR0A 4DV4Q 1JB7A 2ZJQA 1JIHA 5IWAL 1ZQBA 3PUXA 2KFZA 4RQ0A 1AE2A 1TWGH 2RHQB 4UAWA 1VQGA 1KFSA 4QW8A 9ICCA 4A3MH 4M47A 5KFGA 2R8HA 2ZJ8A 2HHWA 4YHHL 1DOQA 4F8RA 4DV1Q 4X66Q 1XNRQ 2A1AA 2VQEQ 3RR8A 1ZQMA 3L0OA 4QWBA 2R6GA 1IBMQ 7ICGA 3W1BA 4LF8Q 4PHEA 2KZ3A 1XMQL 4RQ5A 1G51A 1V1QA 5H1SE 1NOMA 3MGHA 4A3MG 5HNKA 1TWCH 4GOPA 5IYCG 3RN2A 3MEFA 4XA5A 2NZHA 5J2EA 4RMFA 3N4MB 2D0OA 4DV5L 4YWMA 1C7YA 4UB2A 3EPGA 1JJ2A 1XS9D 5GAGC 1HR0L 3Q8MA 2PFNA 1N34Q 3CCEA 3CCLA 3GDEA 1X2IA 1ZQQA 1HH2P 3E9HA 3RJHA 3NBHB 4A3CH 4ME3A 4RT2A 3ERSX 4GXIA 1BPXA 4X6AH 5C4XH 4BA1I 3CQZH 5J0TA 3EW9A 3C1ZA 2KENA 3PF5A 2KHJA 4X66L 2R93G 1HZ9A 2HHHQ 4YMNA 5C44G 4JI3Q 2BPFA 2YTYA 4LFCQ 1NK8A 3C1YA 5JJKA 1NKEA 5DBCA 5KFKA 4LFBQ 3GTKH 1MIUA 5KFTA 1PZNA 4O3PA 1IBML 2BA0A 1YZ6A 1NTGA 5DBAA 3CF5A 4GLVB 3RLOA 5JUMA 2UXDL 3BQTA 3W5OA 5C5JA 5IYBH 1PH5A 3BDPA 1NK5A 2MQHA 4YVZA 4DFMA 2MUTA 2VL6A 1ZQTA 2DFLA 1SMXA 4P74A 3MR3A 3PY8A 2VNUD 4QZHA 5IE8A 1K73C 2Z6KC 4KLKA 4YMOA 3PCOB 4PHPA 2BR0A 1CSQA 1KSPA 4JOIC 3MBYA 4C8LA 4UY8C 1KFTA 1Y1WH 4LF6L 3M4PA 1UEBA 2E5LQ 2J6UA 1PA6A 1MJEA 3QZ8A 4IPGA 4A3JG 7ICRA 5J29A 4KLOA 5IP9G 4ELVA 3C21A 4A3EG 7ICNA 3GIKA 4FS2A 4BBSG 3OYYA 3K0XA 3PO5A 4PMWA 3S24A 1WYDA 7ICVA 4F5OA 3H40A 3EBEA 4DV7Q 4DLEA 3GILA 3S15H 4O3RA 3S1QH 4GKJL 1VQCA 3ER0A 4JI7Q 3RLFA 4YWKA 4TUSA 2NN6I 1NJWA 3H4DA 4RPZA 4JV5L 4UBBA 1U45A 5IP7H 4DOAA 1S9FA 4E0DA 2OQKA 3V6KA 5KG1A 1UE5A 4B9LA 3I7FA 3I2ZA 2XGPA 5ELOA 3TEHB 4O5KA 2BA1A 2NVTH 1X3FA 4LFAQ 4DR6L 4LF5Q 5EWEA 4Q8FA 3FP9A 5LMNW 3OHAA 4ECRA 2J6TA 1CSPA 4APVA 2RCNA 1XTDA 4J9LA 2ZUDA 4L5TA 5GADC 1X3GA 2JE6I 3BU2A 4DFJA 1NK0A 1JXEA 7ICLA 3AU2A 5LMUQ 1BPYA 4NM2A 3EN2A 9ICPA 2PI2E 1HNXQ 1NKCA 1L3VA 1JXLA 2UUCQ 4DSFA 1X9MA 1SN8A 3H3VH 4MFFA 2JA9A 3PW4A 5C3EH 2C28A 4P4OA 2IX1A 4DNIA 4YD1A 5DLFA 5KFDA 3KF6B 4IRDA 1K8AC 5DDMA 3NTUA 1ZJNA 1HZBA 3MGIA 4QY7A 1XPOA 9ICEA 2F1IA 1AH9A 3AEVA 4LF9L 5J2GA 3G6XA 1PH7A 5F9NA 2ES2A 4A75A 1U49A 3RB4A 4IJLA 1CUKA 3E2EA 4DEZA 4ED6A 1QZGA 2HHXA 1XPUA 1TXYA 2PQAB 5KFHA 2VS1A 4P75A 1SL2A 3TFSA 4NB3A 4DUZQ 2LSSA 3CP0A 2E2HH 2R93H 4GLAC 5FJ8G 8ICLA 1D8YA 4LUOA 1L1OC 4IO9A 3RTVA 3HKZG 4DR5L 4JI5L 1KC8C 1XWLA 3F2BA 4GXKA 2XO7A 5DG7A 1MQ2A 3MR6A 4C8OA 2JQOA 4RQ8A 5M3MH 3M4OH 2NRWA 1LYLA 3UPQA 5FLMG 4QZBA 3T1HQ 5J3BA 4YXJA 4A3KG 4DL4A 3CCSA 2XY5A 3PV8A 1D9DA 5BPCA 3K7UC 4DQPA 8ICRA 1E3PA 2F3IA 1ZJMA 5KG6A 5M5WH 1YITA 4DFKA 4EX5A 4KTQA 4MF8A 4DQIA 3D0FA 1ZQPA 1YHAA 4ELUA 4RU9A 2ZJAA 3QZ7A 9ICGA 2PI2A 1Q82C 2KFNA 4KHPL 4IRKA 4GS3A 1K3RA 2W8KA 4O2DA 1NK4A 4IPDA 4I2JA 4QZ8A 2BH8A 1XSPA 3H8SA 2R7DA 5M5XH 1RYRA 2WFWA 2AU0A 5LMNL 4JI8L 2NVXH 1FJGL 3GTQH 3KJPA 5IYCH 4UBCA 4A3GH 2VW9A 2BCUA 4M9JA 3UXOA 2OTLA 3C2KA 2Y0SE 3HOUG 3KTQA 2UVRA 2HT1A 4PHDA 4I2IA 4GNXC 2BCQA 1Q46A 2AGPA 4JI1L 4DV2Q 3T1YQ 4PGYA 4NLKA 4K0KQ 8ICWA 4ED8A 4KITB 1X56A 1L3SA 1NJYA 4F4ZA 3WWVA 1IXRA 4DF4A 3J7ZC 3FHWA 4I28A 8ICXA 3ISDA 4OX9Q 4IPHA 2ZM6Q 5J0RA 1VQ7A 3KLWA 2W9BB 3PNCA 2MFIA 2OWOA 2K4KA 2KZMA 4B9SA 1TWHH 2R8GA 4BXOA 1VQ8A 1EXNA 1ZQRA 3HOZG 4C8NA 5CJ7A 3ZJYC 1Q7YC 7ICQA 3PUVA 2I5MX 2WAQG 2JEGA 4B9TA 5DB6A 2Q2UA 1VQBA 5L9XA 2UXCL 2JA7H 5J2JA 1QUQA 2UXDQ 4Z6EA 3M85A 2ATWA 4F2SA 4EZ6A 9ICRA 4DR1Q 3Q8LA 1ASYA 1J6QA 1E22A 1JMCA 1Y14B 1XNRL 4B9MA 2Q2TA 4I2AA 3CC2A 2LXJA 3HOXH 4AIMA 1L2FA 4BGDA 4GC6A 4LW1A 1TAQA 1A77A 4XIGS 2XGQA 3BZCA 2HQLA 4JCVE 4BBRH 1SL0A 3EWAA 1X54A 2CWAA 1PH9A 2UXBL 4BA2I 1MQ3A 5GROA 2Y0SG 1HR0W 3U4ZA 2RHSB 3QE9Y 3TQYA 3U50C 1EWIA 3I4MG 4KLEA 1FVIA 2WAQE 2ZM6L 1N33Q 4RQ7A 1RXVA 4ED2A 5J2HA 3Q8SB 9ICTA 1IBKL 5CWRA 3ORYA 5DGBA 4NLNA 4A3IH 3MABA 4GN5A 3G6YA 1RL2A 3GTJH 1A62A 1EQQA 4IQVA 4IR1A 4GKJQ 2HHSA 1PFSA 1E1TA 5KFCA 4A93H 4AYBE 4X5VA 3RH6A 1L1OA 2R7FA 3TFRA 1T7PA 4KMUA 8ICEA 4J9MA 5DGAA 1PH4A 1SROA 3RB3A 3VDYA 2NRXA 1ZQDA 1N8RC 1Q86C 4WJ3M 1YHBA 2JEJA 2VQFL 1PYSB 2JEAI 2JA8H 4X65L 4LZGA 5CB1A 1SE8A 3OTOL 4EBDA 4DV6L 5KFIA 3UE0A 4DUYL 1ZETA 1QSYA 2WB1E 1EOVA 3KHHA 4QGUA 1LB2B 3M3YH 2UU9L 3KYHC 2JA6G 2RDIA 4ECVA 3HOZH 2B63G 4MEYA 1Z00A 2IHMA 1VQNA 5KT5A 3GV5B 5IINA 9ICBA 1JT8A 4KLJA 4EQ5A 3QEBZ 2BCSA 1H38A 4KLTA 4A3FH 3TAQA 4AYBG 1RYSA 1H95A 4F3OA 1VCIA 4F50A 1KLNA 2J6SA 4B9VA 7ICIA 4JI4Q 1WCMG 3KDFB 5JEAG 4R4CA 5AJ3Q 4XRHA 4BXXG 3GV8B 4DV0Q 3T5HA 4YCVA 4Q45A 3AU6A 3M8RA 4LFCL 3S1RH 3KHGA 1KEJA 3EPIA 4JBWA 4DK6C 4YXMA 3GTOH 2I5HA 4BY7H 5KG4A 4HJ8A 4KN7A 2W9CB 3MR5A 1YEZA 5DLQE 4YFKA 1AE3A 4J15A 2N49A 2D62A 3RLNA 1EUJA 2FXQA 4LZDA 4KI0A 3G71A 1UA1A 4I2BA 4C2MH 5ELNA 3S2HH 1PH6A 1GO3E 5BOMA 5KFVA 2UUCL 4R66A 4QZGA 4B3SL 2MO1A 8ICCA 9ICXA 4A3KH 2MNAA 2PFPA 1Y88A 2JA7G 4OXPA 4ECTA 3CC7A 2GN5A 4EYIB 2HVIA 4DV3L 3ULJA 2VA2A 3I4NG 3FDSA 5L1IA 3LWMA 4I2CA 3G48A 4JI6L 2P6UA 1B8AA 1IL2A 4OO1G 3JPQA 1I6HH 4J9PA 3M7NA 1U5KA 3J80c 1HNXL 1ZQLA 3RR7A 2Q2HA 4Q44A 5DQIA 2IBKA 4XQ8A 1SKWA 4GLXA 2C35B 4QW9A 3JPNA 3GTPH 1R9TH 7ICHA 3RAXA 3F2CA 5C4JH 2ASDA 3HOUH 5KFZA 1ZQOA 2VUMG 4R4TA 4EZ9A 3M4QA 1IBLQ 4RNOA 3CCUA 4LF9Q 3CMAA 4DS5A 4X62L 1PH1A 3PO3H 3FKIG 2MAXA 1TAUA 4FDBA 4EBCA 2BDPA 1HNWQ 3ZDBA 3GO5A 3HOWH 2R7ZH 2UVUA 3B6YA 1E7ZA 1KAWA 1NKBA 4DQRA 3UE1A 5KG2A 5KT7A 1A8VA 3OHBA 4UP7A 2KCTA 3MFIA 1L5UA 1V9PA 3CCVA 4UAYA 1YVCA 3UDFA 5DG9A 4TQUS 3A0JA 4M6WA 4M9HA 4L5SA 4QZFA 4MTNA 1ZQEA 1B22A 2P66A 2PFOA 3BQ1A 4IPCA 3J80i 4GXJA 3PO3G 1C9OA 4YR3A 1KD1C 1ASZA 4J9NA 2IY5B 4JI4L 3V7LA 2K52A 1ZQVA 5KT3A 3PV0A 5KFFA 5DB7A 1VQOA 3CCJA 4B3TQ 4QZDA 3M8SA 3SZ2A 1IZ6A 1CKOA 4RQ2A 1ZQHA 2LXKA 2V1CC 2LYHA 2NRZA 4LVSA 3RBDA 3K81C 2HIXA 3ZDDA 8ICKA 4DSJA 3KJOA 5DKWA 1VQ4A 4K4HA 4JV2A 2I0QA 1I3QH 2ALYB 2IHEA 4Y52H 5C0XJ 1CKNB 5JJIA 4YP3A 3RZDH 4DR3L 7ICJA 5EAYA 4IQWA 1N32L 4A3IG 3HFZB 2OTJA 7ICOA 1X65A 4LF7Q 3OTOQ 5J0WA 2CKZB 2K5NA 4X65Q 1VQ5A 3RJGA 1UA0A 1I50H 4DFPA 4JC0A 7ICFA 1TVAA 2QEXA 4HJ7A 3PO2G 4KLUA 2F4VQ 4JV1A 1M90C 4DL3A 1T3NA 4JBKA 2XGTA 8ICAA 2K14A 1VQKA 2IA6A 9ICSA 4JI6Q 4BY7G 2F1JA 1N34L 3PSIA 2WB1G 4ECXA 3V7KA 4CCHA 4DAMA 1U9LA 4P71A 4HJ9A 8ICMA 4UP8A 4X62Q 1KXLA 5KFSA 4M9GA 4UAZA 2XCAA 4KHZA 1S0VA 5IIOA 3N97B 3PO2H 3OJUA 4KLMA 2VANA 4R65A 2YU9H 2AQ4A 5IT9c 3HOVG 2VQFQ 3PF4A 2KTQA 5IIKA 1A0IA 4TVAB 9ICHA 3C5GA 2FPKA 3TRZA 4PZ8A 1TK5A 3CW2C 3RRHA 1MKHA 4O3OA 3B0XA 1Q1EA 1Q8KA 1G291 3F8TA 4QL5A 1UT8A 2HHHL 4O0IA 1BPEA 3PUWA 2E2IH 1X3EA 4P4MA 4QWDA 4HJ5A 4R4OA 5GAHC 8ICSA 2R8IA 4YR2A 1PH2A 5DQGA 4I2FA 1TKDA 4KLDA 5HY6A 4B3SQ 2IT1A 4F91B 3HOYH 4XUSA 2GVBA 3F1ZA 4DSEA 4EBEA 1XC9A 2DGYA 1ZQXA 4TUPA 4UB3A 1HUOA 5KFMA 4F93B 3PX6A 4DOCA 5JEAJ 4C3HH 2W9CA 3HKSA 4IR9A 3J81c 1K1SA 3RJEA 5IWAQ 4R4IA 1S3OA 2UUAQ 1IYJB 2HVHA 2OCEA 4MZ9A 3BQ2A 8ICBA 3GQCA 2KZZA 4LWCA 3PUYA 1WOCA 5C0XG 4PZ6A 4B3MQ 2W8LA 3H4BA 5KFXA 4R63A 3TQ1A 2AWOA 3NELA 3T5LA 4DUYQ 9ICWA 1YI2A 1T4GA 4UPAA 1HNZQ 3SGIA 4O5EA 3CXCA 1QTMA 3UQ0A 5J0YA 3RRGA 2Z0SA 4JI1Q 4DV2L 4JBJA 2ZJPA 4QQBX 4A3DG 3W1GA 2VZAA 2D0PA 2F52A 3QEAZ 4P73A 4DAYB 9ICMA 4AQYL 4DF8A 3JPPA 1PYBA 4KLHA 5DB9A 1KHIA 4PG3A 3I4NH 3GD7A 1WJJA 1EFWA 4JI8Q 2ZJRA 1TK8A 2XY6A 1WCMH 4NPSA 7ICPA 2A8VA 4R8UB 1GD7A 3C5FA 2AWNA 2JEBI 3T5KA 2UU9Q 3RAQA 3S14H 1WCLA 1JN3A 1K83H 2B3GA 3PVXA 1CEZA 2A1JA 3H8JA 1MC8A 4O9MA 2A19A 3PW7A 5HHHA 4ED0A 3RJIA 2E8GA 4B9UA 4M0AA 3ZDAA 2R8KA 1GM5A 4HIDA 4I29A 5KT4A 3KF6A 1SKSA 5KFBA 4DSIA 5L1LA 3U4VA 1T8EA 2B29A 3UDXA 4JK1A 3JAMi 1TWAH 4DL2A 2WTFA 1KRSA 5J2KA 4YQWA 3LWLA 2M9NA
chains in the Genus database with same CATH superfamily
3KF8B 4Q8EA 3OPOA 2ICEC 3WOFA 2J0TD 1YNJD 4IUVA 3RH5A 4NLGA 1I3QB 2PZWA 1WUDA 2JA8G 3NWTA 5HP4A 3OSOA 4BJQA 2HW3A 1YJWA 3J7AF 3MFHA 4IFDG 5EJWA 2A68C 2F0KA 4S3SA 4JI2Q 2DY7A 1DGSA 4BY1H 1S5ED 4K5VA 3TREA 3H8MA 1VQFA 3KHLA 1B1ZA 3HX0A 3R3OA 1WTHA 7ICKA 1KAAA 1WI5A 1EIYB 3VA5A 3GTGH 1PMRA 4ECQA 2F76X 1N33L 3TS2A 4LAAA 4P0PA 3I91A 4DL7A 3ZYYX 2F0JA 1ZQNA 4DSLA 3MDAA 2IMWP 3BZKA 3GV7B 3IRUA 4DK3C 3UDIA 4QZAA 1JALA 2ESEA 2Q2IA 4O0AA 3RJJA 3SI8A 1EY6A 4O3MA 1RTNA 3VYSA 4EEYA 3L2PA 2HMXA 1Z19A 2BZFA 5J0UA 3PR4A 4JWNA 3TARA 3PSTA 4MF2A 5D46A 1MSWD 2L9HA 2NYVA 4UB8U 3WK9A 1QE6A 3PW5A 1K0RA 3K7AB 5FK9C 3T1HL 1TK0A 4DV5Q 1HZAA 5AKYA 3AMUA 3C3LA 4N9TA 3SYZA 1GKHA 4PGQA 5FLMH 4ECUA 4RKBA 1QSSA 2NN6G 5BR8Q 5CGKA 4ZK9B 3AL0B 4A3LG 4WJ4A 3MGVA 2SOBA 2A6EC 1DJRD 4DPGA 1X9WA 3K5MA 4XYOA 3EUB2 1RKNA 2MO0A 2X6GA 2KHIA 4JI5Q 4PHAA 4JYAL 4RHSA 4WFN3 4HMIA 1L0WA 1EZ6A 3H7IA 1L3TA 1L1OB 1LV9A 2FPMA 1QVGA 2VUMH 2G06A 4OO1J 1XMQQ 3AB9A 2F0TA 1A2TA 4JUZA 4LF8L 2E1EA 1NAPA 3RUZA 2C2RA 2AH5A 2BOSA 4ECYA 4KLLA 4MNOA 1M6YA 3IHQB 3NBHA 5KFJA 1OXTA 1X40A 3RH4A 1STGA 3GFKB 1S0OA 8ICTA 1JJCB 3M9NB 1IW7D 4A3BH 4JBMA 3SD7A 5KAIU 2KJ8A 2GOLA 3MR2A 1UEAB 1XPRA 2ZJ5A 2HHTA 1BOSA 1Y8NB 4KY7A 4YHHQ 1S40A 4U6PA 3NUQA 2ASBA 3GTPB 2J4XA 2CQOA 1UE6A 4BWMA 2XTIA 3PIP3 3ULPA 4QZ9A 2NZOA 5IGCA 4L5RC 3J7AV 1UWVA 3H0GH 1S4ZA 4DNTB 1JMSA 4A3GG 4P4PA 2WB1F 3S17B 1SZPA 2ISPA 1M1KC 4RGOS 3IDWA 3H8WA 1OXUA 5ELDA 4HIKA 3N28A 1RIPA 2LI6A 2QARB 3UXPA 5EGTA 5IYDG 4K8IA 3PO4A 1LKYB 5AK5A 1VDZA 2XRSD 4DR7Q 1EYCA 1NBWA 2UVWA 1PTOD 5IGBA 4OCZA 4R4QA 1B43A 2YB4A 2CCZA 1VQ6A 4GKKL 1KRTA 2W7OA 3HKZE 5KTQA 1U0LA 3MFGA 2ZUCA 2KJ9A 4CJ0B 2NVYH 4KLFA 3STBD 2UUBL 2Z7JA 5AK6A 1I4HA 3FC4A 3DM3A 4XT3B 1RD9D 1W2BA 8ICIA 2DF4B 2RA4A 4PQXA 9ICUA 4DR2L 4C4SA 4A3FG 1BBWA 1Y1VB 4J9QA 2VY3A 4BBSB 3I4NG 3R8BA 4DCCA 2ID0A 3HOZB 3CCRA 3EIVA 4RUCA 2F4VL 3V7JA 1I4RA 4N9PA 2CW0C 3A56A 4DK0A 4GOPB 3CNHA 4C3IH 5LMUL 1STYA 2ZIWB 3H0GG 8ICQA 2YYZA 4CJ2C 1EIFA 4DA2A 1NY4A 4OO1H 4QB4A 4Y2PA 4DS4A 1SV0A 1JX4A 1CTMA 4DKAC 3Q8PB 5IYDH 2F0UA 5E79U 4GFJA 4Z6FA 4G4KA 2LMCB 4H02A 5K5PA 4CRXA 1XU4A 3A74A 4XQJA 2VUMB 5ALIA 5KFEA 1FGBD 5JEAH 3ISBA 3HOVB 5M5XB 2C22A 1GHJA 2EXDA 3EJIA 3L5KA 4YG2A 1N32Q 3JPRA 2FJ6A 1N63A 3MXNB 3CAMA 3RJFA 3GTOB 4NM1A 4DR3Q 5ALHA 1YZ7A 4Z6DA 4RT3A 3A5UA 1CKMA 4BBSH 4BY1G 4I2DA 1U4BA 5EE9A 9ICAA 2W7PA 9ICQA 3Q23A 5CORA 3E5SA 4EQOA 4A3EH 1S10A 2JEFA 9ICJA 4DOBA 4JG2A 2ODGA 4RQ1A 2BQUA 4Z6CA 1ZQSA 5LHY1 3JPOA 4ZLTF 1UT5A 1SV0C 4IUTA 3HPOA 3I4NB 2WFAA 1SNOA 2LKVA 1AROP 2DUDA 4NW2A 1EY5A 2Z4HA 2K6AA 1X55A 4POFA 8ICFA 1D9FA 1QVCA 2B63H 5KEEA 1S72A 4ZH4A 4BY7B 1BGXT 4A4IA 4P0QB 5D49A 1Z47A 1ZXTA 4DV7L 5C0YA 1TS2A 5J2BA 5J39A 5F9LA 2F0HA 1VQ9A 1N60A 4QJFA 5J22A 2KK0A 2DPJA 5A2QE 2KV2A 1KQSA 1OTCA 3CCMA 1QLNA 3GIIA 2PI5A 4PPXA 1X6OA 3KUPA 5M3FB 2H5XA 2Y0SF 1JORA 4M6WB 1X3PA 2IOFA 2BH2A 5JPMC 3GTLB 1COOA 1XSLA 3A5ZB 1F2MA 4FBTA 3SQIA 1KNAA 4JW0A 1XXGA 2NBFA 3CPFA 3FYHA 5AKHA 5CV4A 3HOYG 3V96A 5IYBG 3AQQA 2YY6A 1L8LA 1BVSA 2Z6BA 5KFUA 4DQSA 4B3TL 2EYJA 2C2EA 1F9QA 1EEFD 3TS0A 2MA1A 4I27A 5KFWA 1D8LA 5J2FA 3HP3A 5FLXc 1ZRMA 3BZDB 4EGVA 1ZQJA 2EE1A 7ICEA 5DBBA 2PNRC 5J2CA 3MXPA 3TP7A 2F0VA 4QZCA 1PFBA 5ALSA 4JYAQ 2OEHA 2FMQA 4G3IA 4R8UA 3AFPA 4HR7B 3D8GA 2CRXA 1E2ZA 1NR4A 5DDYA 3K8AA 4IRCA 3I56A 1RDPD 1N36Q 4P2HA 3LK9A 3BJUA 1LUZA 3BDLA 4JV0A 4TRDA 2NTTA 1KDHA 2UUAL 1Q3UA 2ZTDA 3ICXA 1J2NA 5KFQA 1PV4A 5JJLA 1JJGA 1X9NA 4DLGA 5J0XA 5ALWA 1N2XA 1VQJA 1AW7A 5CA7A 1B3QA 2XVSA 2AHOB 2JHDA 4CDDC 5HMMA 2BQ3A 4FXGC 5C0XI 1A63A 2QARA 2RDFA 2JXJA 2RDJA 4MN3A 3TMEA 5C4HA 1ZD4A 4Q0FA 2JZBB 4HSPA 1N62A 1JCKB 2VA8A 4IZ8A 4NKLA 3VC8A 4BXOB 4PNYA 4X64Q 5KFYA 9ICFA 2KJXA 4UB4A 2NV3A 5CHGA 4A3JH 3D6WA 2QILA 4UAVA 1DGJA 1DCZA 4GKKQ 4EYHB 2NRVA 3WK5A 1QUQB 2EVBA 2I5LX 1NSNS 3C1FA 1GJXA 3E0FA 1FJGL 5AM1A 5KFPA 1C20A 1DD2A 4KLGA 4CGZA 4O3SA 1PXUA 5E4WC 3J7A5 3TSSA 2SNSA 1PTOC 1QOHA 1K8MA 1E24A 4I65A 3N7RC 1IBLL 4P0PB 3T5JA 5E1FA 4DL6A 3F53A 1XO1A 1Q12A 2NN6H 2PO4A 4L63B 1QCBD 1AFPA 3A0HU 1GOZA 3VCBA 4CF5A 3E9IA 5CR0A 4IUNA 4R9WA 3NVZA 3MHBA 3U26A 3IG8A 5EPJA 3L3FX 3K0YA 5E4XA 3VR6A 2KBNA 2K4PA 4P72A 4RKLA 5AHXA 3BVMA 3S2DH 1FGUA 2AQ0A 2QCPX 5J0PA 4J9OA 3TANA 4DWIA 5TZVA 4NY8A 5DNFA 2NVTB 4ELTA 2F8KA 3ED5A 2ZTEA 7ICTA 2A5HA 3PIPA 3ZD9A 2OT2A 5AJ3L 1BR9A 2VQEL 3UXNA 1S97A 3GTKB 4QWCA 3KZXA 2D6FC 4BBRB 5ALOA 5I4DA 2HCFA 1IW7C 3I4OA 2VIXA 5L1MA 1A0PA 2Y1JA 3K5LA 4DSKA 1D1IA 2E2JH 3DUZA 4Y2SA 1I5FA 2QB1A 1GVPA 1GUSA 1I50B 3FKIB 5NUCA 5C4ZA 3K59A 4A3JB 1PRTD 3PW2A 3NSWA 4DR4L 2UXCQ 2IHNA 2E1FA 4QZEA 4YD2A 3HOXB 1D7QA 1KIXA 5HMLA 1LM0A 1NR2A 3Q8KA 5FLXE 4GNXA 1ZQFA 4IURA 4JV5Q 2PPBC 1Q1BA 4O3QA 5AIAA 1V1PB 5E7NA 1XNQL 4YIJA 3HP6A 4QIWE 2YTVA 3KHRA 3TP6A 2R92G 2R7ZG 1ZQUA 4KKSA 5LL6X 4OWXB 2FDRA 3ZDEA 2ZUBA 5KFLA 1OXXK 3IM1A 3OPXA 5KG3A 1TT2A 2L55A 3L7ZC 4MFAA 4HJAA 1WTQA 3K7AH 5M3MG 4QCLA 5AM5A 4IC9A 2WKCA 1K8GA 4C7YA 4CKCA 1Q8IA 5M3FH 2HHUA 2KUMA 3G6EA 1SWWA 1WG8A 1T94A 1SYDA 3C2MA 1LTTD 2RQ5A 3KF8A 4OX9L 1S0NA 1ZQAA 5C4XG 2AJQA 2ISOA 4AQYQ 4O1NA 2QKIC 1PH8A 1RM6C 4QIWF 2O5JC 4YCWA 2N8NA 3DWQA 1MJCA 4LUZA 2Y1IA 1D5MC 1J5EL 4ED1A 3I8ZA 1J8IA 5ALFA 1F9RA 1FNUA 3S1NB 2V4RA 4F7XA 2L0CA 4DV1L 1ZQZA 1GO3F 5A0LA 4YY3L 3V72A 3BJYA 4C8KA 9ICVA 2A6HC 9ICKA 5ALNA 4YWLA 2W55A 5L1KA 2G5DA 1DXSA 2I1QA 2JSOA 4MFCA 1L0XB 4LF7L 2XRQD 4TKOB 2R92H 4C8MA 1ZEQX 1QVFA 4LFBL 3FAHA 2JXMB 2E5LL 2CH4W 1QQ7A 4UASA 1EZ8A 4NXZA 8ICVA 3JAME 1Z4OA 2ATLA 1OW5A 2W11A 1RXWA 1ZQIA 1L0YB 2EYFA 2K5WA 3TZUA 1KL9A 1YBYA 4A3LH 2LYBA 2K33A 4M9NA 4JI3L 4QWAA 5CRXA 1SYGA 5C44B 3KFUF 3PX4A 3PIO3 2WF8A 3ETRA 3TI0A 1NK7A 2N3SA 4GOPC 5IIJA 2WP8J 4UP9A 2EJGC 3CCQA 1YHQA 4KHPQ 1NMFA 1CFMA 4KTAA 4BWJA 1O7IA 4JI0L 4B3RL 5EOZA 4TUQA 4NV0A 3CYMA 8ICGA 2BKEA 3HEJA 3CPWA 1KRPA 4F4KA 3OSPA 5KNDA 4C3JH 8ICYA 5EWFA 1R4PB 1V1PA 2PW7A 2O4XA 3I4MH 1VQHA 4J9SA 5KG0A 4OD0A 5IP7G 1BNZA 4XYQA 1X9SA 3QU5A 4AYBF 4RPYA 3B0YA 3PX0A 5IODA 3SV4A 3J81j 1HR0Q 1BKBA 4PMCA 3NK9A 5KG5A 4QIWB 3UDGA 2W9AA 1PZID 2WAQF 1Z7TA 1G6PA 2QB0B 2UXBQ 1XYIA 2AQ1B 1G2SA 4UW9A 4KY5A 1Y1WG 3WDNA 2QKQA 2NB0A 1IV8A 4RG1A 3S1MH 5DLGA 4KLQA 4Y7NH 2EANA 4I2HA 4TQSA 4AYBC 1X9XA 1SE3A 5J0OA 4DV6Q 3IKJA 3GTLH 2B8FA 2L15A 2JA5G 1T5XD 3K58A 2R93G 1D8BA 1FNVA 2C2DA 3GQBA 3NHHA 1WCNA 5CP2A 2AMCB 5DAUA 4GNXB 9ICNA 4RWSC 4EQPA 1J5EQ 4CGYB 3TZDA 2JMGA 1I4GA 4IQUA 8ICHA 9ICIA 2EIFA 1ENCA 4DUZL 4DR1L 2KOLA 5COYA 2H4OA 4M2YA 1HUMA 4DO9A 1HA5A 4RNMA 2GVAA 1VQAA 4C56C 3CRXA 4PZOA 4A3BB 1P16A 5D3DA 4ZKBB 1B0XA 3TACB 1DYQA 4O3NA 5FJ8H 3THVA 1NJXA 1BPZA 2C9OA 1EY9A 3QR8A 2PW5A 5C3WA 1NK6A 3HOUB 1O7YA 1HNWL 1T9HA 5AM3A 1PVRA 5C44H 5CV9A 4FZLA 2VJ5A 1VQIA 2P6RA 3CD6A 3S1NH 2AUJD 3S17H 2JZBA 5I9PA 1UE7A 1BNPA 3TDQA 1XNQQ 1NK9A 2NVXB 2YTUA 1ET9A 4DV4L 1RJTA 1ZQGA 1II3A 5D4BA 2IOFK 3KKAC 4QIWC 2K75A 2PNHA 3RBEA 3GIJA 1TIID 1C48A 1H9KA 3M6KA 3HOWB 2PYKA 1QSLA 2KCMA 4Z9CB 2MUTB 8ICZA 4C1NI 4X64L 3J80E 3NTKA 1RZTA 2I9GA 2GH1A 3JC66 2MRLA 2BCRA 4M9LA 2PI4A 2BGWA 3BQ0A 4K4GA 2KD1A 1BCPF 1W3SA 4LUVA 1BBUA 2K4EA 4KN4A 2DJGC 3QU9A 4JOIA 5KG7A 4RQ6A 1XMOL 2EPBA 3E6ZX 3OJSA 4K6DA 3M6ZA 2A1JB 5KT6A 3JPTA 3T79A 2FLPA 1W6JA 4FP5D 1S77D 3RNUA 3RN5A 2DNEA 2BCOA 5T14A 1TV9A 7ICUA 2G9DA 4KD4A 1STNA 4FO6A 4JI2L 3QIAA 3OIPA 1K5OA 4Y2QA 2IOHA 1ZQWA 1N56A 4A3KB 3GTMH 4NWIA 2AQ2B 3T1YL 4KX3A 2PCFB 1FYCA 1LTID 3T13A 5KFOA 1VQMA 1I94L 1PH3A 1KKXA 2E76C 4KV6A 4F5RA 2JEIA 4FXDA 3KOJA 4ZKCB 5J2AA 3KZIU 2E2IB 1MN8A 5M3MB 3J81E 2PFQA 1CT1D 2JYOA 2K32A 4OO1I 1A6XA 9ICOA 1DXMA 2V4QA 1CA6A 2VKQA 1IM4A 1L3UA 4I2EA 3UI2A 1RHPA 3AUOA 4YN4A 1OXVA 4RQNA 4FS1A 1FD7D 3R93A 3C2LA 4POGA 5CV5A 1EQTA 4N8FA 1ILPA 9ICLA 4UQGA 4LF4L 4NXMQ 3ALRA 2XSCA 3ISCA 1PZKD 2ZIVA 2HHQA 1RQNA 5ALPA 4DQQA 2F77X 4J9KA 2DY8A 3DLLA 2WHEA 4M04A 3SHLA 1N61A 3HOXG 4PZ7A 4P0QA 2IHFA 4K2LA 3J81i 2OXOA 4OHJA 2LPEA 1QWYA 4RUAA 3E0EA 5AI8A 3ZD8A 3SV3A 1KW4A 1BPDA 2AGQA 1CKNA 4RCNA 4UB5A 3PGZA 3OMGA 2NUCA 4O42A 2Q0ZX 1NI3A 4NLZA 4MHVA 1ESFA 1D6EC 4JI0Q 4BBRG 4B3RQ 4RNNA 3CMEA 3AYHB 1EYGA 3QO2A 3K4GA 1JC7A 3EA6A 5JJZA 2EQSA 3NENA 3AMZA 1KTKA 4K0KL 3S16H 4K4IA 4GN4B 1TWAB 1Z9FA 2KHSA 3T4AC 3ULLA 5ALQA 2D9UA 4R64A 5AKEA 4FO2A 2NWGA 1N9WA 4OWWB 4WJWA 3AFQA 5IT9E 2JJQA 4FE3A 5J8YA 2XC9A 2BQRA 4PGXA 1NMGA 5M5YH 5L1JA 3CRLC 4FF2A 1JE4A 2F0EA 1SL1A 5LMNQ 1FJGQ 2VA3A 5KFAA 4DL5A 2K01A 5ELBA 2VB3X 1DONA 1EQRA 2N78A 5IGFA 1LTLA 4CF3A 3OSNA 1PFMA 1PZJD 1TFRA 1BPBA 2E8MA 4L5QA 5E3FA 4C1NK 5IY0A 4RQ4A 1WTOA 1H9SB 5CEHA 1PTOB 3IL8A 4RH6A 5KL1B 3WK7A 4IQTA 2EDGA 2QB0A 1K28A 4QZIA 4ZAIA 3OW2A 1MBYA 3JAMc 2K5HA 4F4YA 1SE2A 1QZHA 3S2HB 3BYYB 1EWCA 1S5FD 1YNNC 3H15A 5C3EB 5FO8B 4C3HB 1TWFH 4QNLA 1JOOA 1NJIC 5ALGA 4GN3B 2EY1A 4A93G 2IX0A 2FPLA 3DDHA 4GC7A 2AUKA 1HJPA 1NZPA 4I7ZC 4YCUA 1Y69U 4DR7L 1SNCA 4IFDI 4IFDJ 3D4RA 8ICPA 4JPBW 1EL0A 2Y9UA 3M9BA 1RG6A 1HRJA 4F4WA 5IP9H 3LGJA 5EE0A 3HW8A 1ZYQA 2I07B 3CC4A 2W9BA 2AGOA 4H7BA 3GTJB 1EIHA 3QYPA 2MU2A 4NP5A 4R1JA 4DR2Q 1KFDA 1HCZA 2B8GA 3GU3A 2B2UC 2R8JA 2O2LD 3ND8A 4A3DH 2R92B 2ZIXA 3KDFA 1XJVA 2UUBQ 3IFDA 4BXXH 7ICMA 1XSNA 2I46A 1SR3A 2F1HA 4HIMA 5KIXA 2K50A 2A69C 3EYZA 2FLNA 1B7YB 1YT3A 8ICOA 4DR4Q 3LDAA 2HIVA 3LVWA 3VR5A 2KOBA 1E1OA 4AH6A 4NXNL 5KFNA 2XCPA 4RZRA 3UMGA 4KY6A 3MDCA 2NTSA 1CHQD 2YMQA 5JTIA 3FDTA 3ND9A 3PW0A 7ICSA 2B21A 1K3BC 3S15B 2RDGA 5J0SA 1SXTA 1VS0A 1ZQYA 1LTRD 2B2VC 5HR7A 5M3FG 1P8LA 2CWPA 1KNEA 5EQ0A 1I94Q 2BHNA 4DV3Q 1BXTA 1C0AA 2ZXHA 3RB6A 1P7DA 5F2DA 1LV5A 5J2IA 1N48A 5DB8A 3I72A 5BR8L 4DR5Q 3GDXA 5B66U 1KDCA 3Q8DA 2YU9B 3CKIB 3L9AX 5HGQA 3ZDCA 3ETLA 3PMFA 3A0BU 1U47A 3FRPB 3K75D 2F0QA 2NVQH 1IBKQ 1UAPA 1XX8A 2NRTA 2R18A 2B39A 5EPKA 1HUZA 4LF5L 4J9RA 3E3XA 3PUZA 3I55A 3SAHA 3RR5A 2PQAA 1KTQA 4NXNQ 4MEXA 1K1QA 1PHJA 4ECZA 3G6VA 2BE5D 2LM1A 4KKTA 4HIOA 1SSOA 5C5LA 5GAEC 3QJYA 2EZYA 2F3WA 2JK8A 1RPLA 4OJ6A 1S5BD 2PMZE 2F03A 2WF5A 4CDEC 2GWSA 4IALA 3M9OB 4ED7A 4IOCA 4YMMA 4A3CG 1TE2A 3AM9A 5IIIA 3Q8RB 1AZPA 4LF4Q 4NXML 1ZOLA 4O5CA 2PXIA 3BQ7A 4KLIA 2QEJC 2QGQA 2YV5A 4TQRA 4WJ3B 5HHIA 3FKIH 4RA8A 2SNMA 5ALXA 2H1EA 4JI7L 3LWUA 4OONA 3JPSA 3V2TA 3M9MB 5C6AA 1MA7A 2CVRA 5IIMA 2IWHA 3STBC 3D31A 1PK1B 1IG6A 4KLSA 5IILA 2B2YA 3DWPA 4Q43A 4F2RA 1STAA 4C3HG 5AM0A 3NGDA 1SMYD 1JE5A 5C3EG 4YCXA 4DV0L 2KN7A 4F92B 3K80C 1N36L 2JA6H 1LVHA 1VDVA 1ET6A 1Q81C 3RZOH 4EX6A 1A3TA 2GLEA 5KFRA 1GUTA 2RSOA 2AKWB 4G7OC 1SKRA 1C4QA 4DF7A 2G5HB 1SAPA 3PIOA 3P1HA 4CDCC 1S0MA 3NTIA 3H3VI 3ICEA 2F3NA 3I73A 1YNXA 4HEDA 2FLLA 3PMLA 4LFAL 4DR6Q 4RQ3A 2DQNB 5KT2A 1E2VA 5F3XB 1Y1VG 2CFMA 2ALZA 1UPHA 3E58A 1HTPA 2YB1A 3DWAA 3HOWG 1DK2A 3RMHA 3QU4A 4RPXA 4ECWA 2HOIA 2K5VA 2K5DA 4LF6Q 4UB1A 5G3LF 3F5AA 2ASJA 4MIUA 3PR5B 3V6JA 2F1MA 3WK6A 1HZCA 1RCVD 1WFQA 4F4XA 1DOKA 3F2UA 2UVVA 2V9WA 2Z9HA 5DQHA 3HWTA 2ASLA 2WINB 2KKVA 4TURA 4EENA 1VQLA 1YIJA 3F5EA 4OJPA 5ALZA 2JH7A 5BOLA 2E5SA 4F5QA 2BCVA 4BDPA 2EYLA 2FMPA 4XXEA 4I2GA 1YJNA 4A76A 2RBMA 2RSNA 1Q3VA 4A3BG 1SFOH 3T3FA 1VQEA 1S76D 3A54A 4OJLA 3G4SA 3F2DA 2H3FA 1FL0A 2M00A 4IOAA 3I90A 5J0QA 1OXSC 1WD1A 2YTXA 3KFUA 1Z3EB 1ZQCA 1X6IA 3WKEA 1ZD5A 4XQQA 4ED3A 3GZFA 3HOVH 2BPCA 2ZTCA 3GIMA 4IQZA 1UE1A 1Y1VH 2E75C 1Z00B 3M7GA 3U58A 1SRUA 1TU2B 2KEYA 4C3IG 1JR0D 1A76A 2W3RA 4OWTB 2JH1A 4B9WA 4KK7A 3IP4B 1NE3A 4EELA 3Q24A 5AK3A 2Z6KA 3OGUA 3NVVA 2HHVA 1PVOA 4IFDH 2DBYA 4PMBA 3RJKA 1GUWA 1B70B 4HYKA 5EWGA 5GQOA 1DZ1A 4NL9C 4FBUA 8ICUA 3QUCA 4K6LA 1BQQT 1V1OA 1VQDA 1ZQKA 5EKKA 1HNZL 4F88A 1IL8A 4QWEA 5DG8A 1F9PA 3PMNA 1SEBD 2HUGA 2K4HA 2OQ0A 4J8QA 4XTCS 3TAPA 5J2DA 2DGZA 3HT3A 4F5PA 4QJFB 2RF4A 1NJZA 2L12A 1NZBA 3NEMA 3RB0A 2HBMA 4JWMA 1KLUD 4B3ML 2D2CC 3C23A 4ECSA 2KCCA 3EZ5A 4YY3Q 4HCEA 1U48A 2FMSA 1SLJA 4LNQA 1MSGA 1H9RA 2HBLA 4GIBA 3TP8A 8ICNA 4FF1A 2QA4A 3TN2A 1V43A 1K9MC 4PH5A 1QILA 5CR3A 4DAYA 2R7ZB 3K5OA 4B9NA 4IJHA 1YJ9A 1B4FA 1T5EA 3IRBA 3UQ2A 3S1MB 1XMOQ 1VMPA 1A2UA 1ZD3A 5JVG3 3PSFA 3A7AB 2XY7A 8ICJA 2BPGA 1B44D 2KSOA 2DPIA 3Q8QB 1TY2A 2WV6D 4F5NA 1CZWA 1EOTA 2E74C 2FMCA 3NUCA 2W9MA 2Z1CA 1VQPA 3NASA 1E0BA 3TADA 3V6HA 4ALPA 2JA5H 1RODA 1J97A 1PLFA 4YR0A 1FFUA 1TWGB 2LHTA 4DV4Q 1JB7A 2ZJQA 4A3EB 1JIHA 1QQ6A 5GTIU 3A8JE 5IWAL 1ZQBA 4ABNA 1FIQA 3PUXA 2KFZA 5CC4A 4RQ0A 1AE2A 4HAIA 1TWGH 1LT5D 2RHQB 4UAWA 1X66A 1VQGA 3N7PD 5AKLA 2F2AB 1KFSA 3M3YB 1O03A 2ZT9C 2EZVA 2MPMA 4QW8A 9ICCA 4CJ1B 2RQXA 4M47A 3SK6A 5KFGA 4A3MH 1PUZA 2ZIWA 2BDOA 2R8HA 2ZJ8A 2PMZC 3NVYA 2HHWA 4CBVA 1PVQA 5EBDA 4YHHL 5AI5A 1DOQA 2B2VA 4F8RA 3I70A 4RHRA 4DV1Q 4X66Q 2WB1B 1XNRQ 1H9MA 3S1RB 2A1AA 2VQEQ 1LACA 3RR8A 1ZQMA 1RYUA 3L0OA 4QWBA 2R6GA 1IBMQ 7ICGA 4OEMB 2PMZF 4WORA 3W1BA 1EWHA 1S5CD 3QU2A 4LF8Q 2F44A 4PHEA 3I3CA 1KBUA 2KZ3A 1XMQL 1ZYRC 4RQ5A 1ILQA 1RTOA 1G51A 1V1QA 3GP7A 5H1SE 1NOMA 3MGHA 3A8KE 4A3MG 5HNKA 2ZXIA 1STEA 1TWCH 4GOPA 1B50A 5IYCG 3A55A 2XVTA 4US9A 3JAML 3RN2A 1LO5D 3MEFA 4XA5A 5AKIA 2NZHA 2YN4A 2K05A 2EAMA 4NJ8A 2V4DA 3BYTB 5J2EA 3B9JA 4RMFA 3N4MB 2D0OA 2NYZD 5AFWA 5I6WA 3WK8A 3I76A 2NZ1D 3HZXA 4DV5L 2KP7A 4YWMA 1C7YA 4UB2A 3EPGA 1JJ2A 1XS9D 5GAGC 1HR0L 3Q8MA 2PFNA 1CQFA 2RCFA 1N34Q 3IFTA 2B2WA 3CCEA 3HJEA 3PZPA 3CCLA 1UUPA 3GDEA 4K5XA 1X2IA 1L6NA 2D8CA 5ALKA 4FF3A 2B2TA 1ZQQA 3SAGA 1H9JA 3RJHA 1HH2P 3E9HA 3EQLC 3NBHB 4ME3A 4A3CH 3HG9A 1B9MA 4RT2A 3QWNA 3OTQA 4UB6U 3ERSX 4GXIA 1BPXA 4X6AH 4PL2A 5C4XH 1SZHA 4BA1I 2K60A 3CQZH 1Z4NA 5J0TA 3IV6A 3EW9A 1CK1A 5ALRA 3H3VC 2WB1C 3C1ZA 2KENA 3PF5A 2KHJA 3SAFA 1V85A 1KDAA 1LTSD 1HZ9A 1I4QA 1MGSA 1A3VA 4X66L 2HHHQ 4YMNA 4OL7A 5C44G 1L7OA 1EU3A 2IX3A 4JI3Q 1HA6A 3LX0A 4FFDA 2BPFA 3BVGA 1PYWD 2YTYA 1Z6HA 4LFCQ 3NXWA 1NK8A 3C1YA 5JJKA 1NKEA 2D5DA 3LYSA 3G7LA 2E2HB 5KYIA 5DBCA 5KFKA 4LFBQ 3GTKH 1MIUA 3KLSA 5KFTA 3QUQA 4PZNA 4DFDA 1PZNA 2ZIVB 4O3PA 2WF7A 1IBML 2BA0A 1YZ6A 3SK5A 5M5YB 2RVLA 1NTGA 1S8OA 5DBAA 4XQNA 3CF5A 4GLVB 1SE4A 3RLOA 4UAUA 3H0RB 5JUMA 1SYFA 2UXDL 3BQTA 5IOCA 2AXTU 2OM6A 3W5OA 2HCIA 4HAEA 5C5JA 1FNWA 5IYBH 1PH5A 2WACA 2ZXOA 5LL6S 3BDPA 2G0AA 1NK5A 2MQHA 1Y1WB 5EE3A 2WKDA 4YVZA 3WOEA 4DFMA 3GTGB 2MUTA 2VL6A 2K4IA 2L11A 1ZQTA 2DFLA 4NLCA 1QNKA 1SMXA 4P74A 4ZYSA 3MR3A 1O7ZA 4BY1B 3PY8A 2K5QA 2LKYA 2EY5A 3SMVA 4N8X1 2B2WC 2HDLA 3A8IE 2VNUD 2JGAA 4QZHA 1PK3A 3SK4A 5IE8A 1K73C 2Z6KC 4KLKA 1SV4A 4YMOA 3PCOB 4PHPA 1DK3A 2BR0A 3R2TA 1CSQA 2E3TA 1KSPA 1PTOF 1SYBA 4JOIC 4J1MA 3MBYA 4C8LA 4UY8C 1D1KA 1KFTA 1Y1WH 5KAFU 1BDOA 4LF6L 3M4PA 4C0ZA 1UEBA 3S1QB 2H3IA 2E5LQ 1CI4A 1TKWB 2J6UA 1PA6A 4ODGA 1MJEA 3QZ8A 5I2YA 3RFAA 5AI6A 4IPGA 3Q22A 2OYYA 1ENFA 2WIIB 3ONAB 4A3JG 4KMOB 1EY7A 2KEDA 1OXJA 7ICRA 1SNDA 4P2CB 5J29A 4FVMA 4KLOA 5JPNC 5IP9G 2B2TC 4R8NA 4ELVA 3C21A 3KKAA 1COKA 3SXHA 4A3EG 7ICNA 1A3UA 4C2MB 3GIKA 4FS2A 4BBSG 1EY8A 2MUYA 3OYYA 4U68A 3VR4A 3K0XA 3PO5A 2DJFC 4PMWA 1JB3A 1DOMA 3S24A 1WYDA 7ICVA 1I4XA 4F5OA 3MVVA 3H40A 3EBEA 1X42A 1F2ZA 3NE5B 3QX7A 4DV7Q 4DLEA 3GILA 3S15H 4O3RA 3S1QH 4GKJL 1G8ZD 1VQCA 3ER0A 1JUDA 1FEZA 1SJED 2QW7A 3ITPA 1WD0A 4DAVA 4JI7Q 5IGGA 2N88A 3RLFA 4YWKA 5AKKA 1Q3LA 1WWUA 4TUSA 1QJOA 5I6YA 2NN6I 1NJWA 1UQVA 2F0DA 4L6TB 5IGDA 5C4XB 4EEKA 3H4DA 4NLBA 2HOFA 1BCPD 2JV3A 4RPZA 2EYMA 4JV5L 4DK1A 2EAOA 4UBBA 1U45A 2CW0D 4DOAA 4XDXA 5IP7H 1S9FA 4E0DA 2OQKA 3D3RA 3V6KA 2YMLA 5KG1A 4B9LA 1UE5A 3I7FA 3O13A 3W3AA 3I2ZA 3ZI4A 2XGPA 5ELOA 2DWQA 4AP9A 3TEHB 1CZGA 1O08A 4O5KA 3Q6SA 3PO2B 1SNQA 2BA1A 2E2DC 1M8AA 1ML0D 2M9VA 2NVTH 1X3FA 2DNCA 4LFAQ 4DR6L 1N5XA 2KSOB 1QB5D 4LF5Q 5EWEA 3NP8A 4Q8FA 3CP8A 1WTPA 1RF2D 2JP1A 1CI3M 1TAMA 3FP9A 3T53B 4C80A 1K0SA 5LMNW 3U9SA 3OHAA 4ECRA 4A93B 3MA2B 2J6TA 1CSPA 4APVA 2K7VA 1XTDA 2RCNA 4CDFC 4F71A 4J9LA 2ZUDA 4L5TA 3PSPA 5JVH3 1WTXA 3H0GB 2SEBD 1EYDA 5GADC 1X3GA 3WU2U 2JE6I 3IAYA 3BU2A 4DFJA 1NK0A 1JXEA 2TMPA 7ICLA 3AU2A 5KGUA 5LMUQ 1BPYA 1EYAA 1LTAD 4NM2A 3EN2A 5M9OA 9ICPA 2ZXRA 2PI2E 3D2SA 2CXYA 5AKGA 3QUBA 5GTHU 2KIWA 3SR6A 1HNXQ 1NKCA 2EOTA 1L3VA 4IL6U 2QF7A 1JXLA 5TSSA 1SYEA 2UUCQ 4DSFA 1X9MA 1SN8A 3DEOA 2Q8TA 1BCPC 3H3VH 1SGGA 5AI0A 4MFFA 3AQFA 4C7ZA 2JA9A 3PW4A 5C3EH 2C28A 1G6ZA 5AI4A 4P4OA 4L8JA 3J81L 2IX1A 1LT3D 5TISU 4DNIA 2KIVA 1U4RA 1URJA 2DKZA 4YD1A 5DLFA 5KFDA 5KYLA 3KF6B 4IRDA 1K8AC 2EYHA 2KECA 5DDMA 3NTUA 4KJNA 1ZJNA 3S6JA 1HZBA 3MGIA 4QY7A 1XPOA 1PRTF 9ICEA 2F1IA 2D3DA 3AEVA 4UDUC 3D6CA 1ZRNA 3VYUA 4DN4M 5J2GA 4LF9L 3G6XA 4Y2VA 1MD2D 1L7PA 5F9NA 5G5GA 4UHVA 1PH7A 2ES2A 4A75A 1U49A 3RB4A 2KICA 3MWYW 1EIGA 1CUKA 4IJLA 3E2EA 4DEZA 1O78A 4ED6A 1QZGA 2HHXA 1XPUA 3MXGA 1N5WA 1TXYA 2PQAB 2LYAA 3PQIA 5KFHA 2VS1A 2HCCA 1SL2A 4P75A 5M5WB 3QOJA 3TFSA 3MZ5A 4KKUA 4NB3A 4C4TA 4DUZQ 2LSSA 3CP0A 2E2HH 3J80L 3DM1A 2R93H 2EZXA 1CQVA 3WK4A 3SK8A 2KJ5A 4GLAC 2MJ8A 5FJ8G 8ICLA 4KN7C 1D8YA 3RZDB 4Y2RA 4LUOA 1L1OC 4NMZA 4IO9A 1MHWC 3RTVA 1YNJC 3HKZG 4DR5L 4JI5L 2IJ0A 2W54A 1KC8C 1XWLA 1UNSA 3F2BA 4GXKA 1VF7A 2XO7A 5DG7A 2A68D 1MQ2A 2HOQA 3MR6A 3KBBA 4C8OA 2JQOA 4RQ8A 1UHUA 5M3MH 5K36H 3M4OH 2NRWA 3T56B 1LYLA 3L3OC 1ED1A 3UPQA 2Z4IA 5FLMG 4QZBA 3T1HQ 5J3BA 1CM9A 3D4WA 3V05A 4YXJA 3NQIA 4A3KG 4DL4A 3H09A 3OIQA 2XY5A 3CCSA 3PV8A 1D9DA 5BPCA 3K7UC 4DQPA 1VJ5A 8ICRA 1WWVA 1DOLA 1SDFA 2A6HD 2R3ZA 4U673 1E3PA 5CMDA 2F3IA 4UATA 2EH9A 1ZJMA 5KG6A 5M5WH 3NWSA 1YITA 4DFKA 1L7NA 4KTQA 4MF8A 4DQIA 3D0FA 1ZQPA 4EX5A 1YHAA 4ELUA 4RU9A 5EKLA 2ZJAA 2KKPA 3QZ7A 9ICGA 2PI2A 2RDHA 2KFNA 1Q82C 2P35A 3I4LA 4KHPL 4ZUJA 3EFXD 4RGNA 4IRKA 1TWCB 4GS3A 2O5IC 5KNBA 1F44A 1K3RA 1E2WA 2W8KA 4O2DA 1EQVA 3TP5A 1NK4A 4IPDA 1C8CA 4I2JA 4QZ8A 2BH8A 1XSPA 3T16A 3H8SA 2PZTA 3LWEA 3D6JA 2R7DA 1RYRA 2WFWA 2AU0A 4BS9A 4JI8L 5M5XH 5C0XH 5LMNL 1BNOA 2NVXH 2LBOA 1V38A 4UBCA 5IYCH 2N1RA 2A73B 3KJPA 5AI9A 3GTQH 3I4MB 4A3GH 2F4IA 2VW9A 2L1BA 2BCUA 5AM4A 1HQMC 1GUNA 3HKZF 4M9JA 3UXOA 5JRTA 1I6VC 1JOKA 2Q8RE 5C3XA 3C2KA 2OTLA 2PKEA 5HR6A 2Y0SE 1GHKA 3HOUG 3KTQA 2UVRA 1AN8A 2G5IB 4KD3A 2HT1A 1AEXA 1A15A 4PHDA 4I2IA 4GNXC 2BCQA 1Q46A 5IT9L 4A3GB 1ESRA 2AGPA 5CV7A 4JI1L 4DV2Q 1B3AA 4DGZA 3T1YQ 4PGYA 4NLKA 4LMQD 4I7AA 4K0KQ 8ICWA 2FINB 5KL8B 1M4VA 3VR3A 5ALYA 4ED8A 5KNCA 4KITB 1ZYRD 1X56A 1L3SA 1NJYA 4F4ZA 2PQEA 4B9XA 3CU7A 3WWVA 2XWJB 1AP0A 1IXRA 4DF4A 2F8LA 2CQAA 2HDOA 3J7ZC 3FHWA 4I28A 8ICXA 2H3QA 3ISDA 2KMDA 4KJOA 1S5DD 4OX9Q 4IPHA 3SDZA 2ZM6Q 2JA5B 1HEKA 3KBXA 4DU9A 3FEWX 5J0RA 1VQ7A 3KLRA 3QOLA 3KLWA 2SDFA 2W9BB 3PNCA 2HBJA 2MFIA 2OWOA 2K4KA 2BE5C 2KZMA 2GA4B 4B9SA 2QLTA 1XO0A 1TWHH 2R8GA 4BXOA 2RRDA 1VQ8A 1EXNA 5B5EU 4Y2UA 4C8NA 1ZQRA 3HOZG 5CJ7A 3ZJYC 3VA7A 1Q7YC 7ICQA 1HIWA 3PUVA 2I5MX 3D4DA 2WAQG 2JEGA 4B9TA 5DB6A 4EVOA 3MXNA 1VQBA 2Q2UA 5L9XA 1SNMA 2UXCL 1EEID 1B9NA 2HQEA 4A3DB 1BBXC 5ELEA 2JA7H 5J2JA 1QUQA 3RZOB 1IIPA 2L5YA 3MTSA 2UXDQ 3AU7A 4Z6EA 1XNSA 3M85A 2W43A 1H9SA 4LJXA 4NL9A 2ATWA 5JU5A 4F2SA 4EZ6A 3BDOA 9ICRA 1Z1BA 4DR1Q 2WF9A 3Q8LA 4IUUA 5ALUA 1ASYA 1J6QA 4Y2TA 1O7LA 2A6ED 1UCVA 1E22A 1JMCA 1Y14B 2C5CA 4IUPA 3O0FA 1F5SA 4B9MA 2M2LA 2Q2TA 1TS3A 1XNRL 2W3SA 5HGTA 2JR5A 4I2AA 4LK1C 4X3UA 3CC2A 2LXJA 2KVMA 3HOXH 4AIMA 1L2FA 2MSNA 3OWEB 4GC6A 1FFVA 4BGDA 2RP5A 2G9HD 1GUGA 1ZD2P 4LW1A 1TAQA 4QUCA 2FMMA 1A77A 1SNPA 4XIGS 3IN5A 4CHTB 5FLXL 3SENA 2XGQA 1BCPB 1J9OA 3NPPA 3RD4A 3BZCA 2HQLA 3NRZA 3SE0A 3A7LA 4JCVE 4BBRH 2RKSA 5ALVA 1SL0A 4U7CA 3K5NA 3EWAA 4ILWA 1X54A 2CWAA 1PH9A 2F0WA 2UXBL 2M0NA 4BA2I 3H0MB 1SFOB 3K6OA 3N6RA 1NNLA 1MQ3A 5GROA 2PZUA 4G57A 4G7ZC 2LFNA 2KEEA 4CF4A 3TADC 1TQOA 2Y0SG 4G9BA 2XNAC 3U4ZA 1HR0W 2RHSB 3QE9Y 3TQYA 3U50C 1EWIA 3I4MG 3M4OB 1VMCA 1F9SA 5FO7B 3J7YW 3QNMA 4KLEA 1FVIA 1KN5A 2WAQE 2EYOA 2Z8LA 3FPUB 3NQTA 3W2DA 4RQ7A 1RXVA 4ED2A 5J2HA 3Q8SB 2J7ZA 3SR1A 5ISRA 1N33Q 2JRZA 9ICTA 3LVVA 1IBKL 1ONLA 5CWRA 2K04A 3ORYA 5DGBA 1VLBA 4NLNA 4X3TA 4A3IH 3MABA 3C46A 4GN5A 1W6KA 3G6YA 4CDGA 1RL2A 1BO0A 4V190 3GTJH 1A62A 1EQQA 2VB2X 4X3SA 4IQVA 4IR1A 2F0GA 4M1UB 2HHSA 2ENBA 4GKJQ 1PFSA 1E1TA 5KFCA 1JQYD 4AYBE 3HRDD 4X5VA 4A93H 2E8OA 2E8PA 4ZRZA 3RH6A 1L1OA 2R7FA 2CPRA 3TFRA 1CRXA 1T7PA 4KMUA 8ICEA 4J9MA 5DGAA 2EY2A 1PH4A 2IW3A 1SROA 2F3VA 4JMUA 3WKDA 3G6JB 2YMPA 2YMMA 3S9WA 3CRKC 3QB3A 3RB3A 3VDYA 4A3IB 2NRXA 1ZQDA 1N8RC 2KQ3A 1Q86C 4RAUC 2F0SA 2E2JB 4WJ3M 1NUCA 4OJOA 1YHBA 2JEJA 2VQFL 1PYSB 2JEAI 2JA8H 2KHQA 4LZGA 3FMCA 4X65L 3KD3A 5CB1A 2EYPA 1SE8A 3OTOL 5K36G 4EBDA 1EY0A 4DV6L 2JN4A 2Q4TA 5KFIA 3K1ZA 2DL0A 3HRZC 3UE0A 3I1YA 4DUYL 2BDNA 1ZETA 3I28A 1QSYA 4KN4C 2WB1E 4XT1B 1JROA 1EOVA 1WYGA 4OJ5A 2LMRA 3KHHA 1V8QA 4QGUA 4QUFA 4G7HC 1ECWA 1LB2B 3M3YH 2UU9L 3KYHC 2JA6G 2RDIA 4A8EA 1SXEA 4BUGA 4ECVA 3HOZH 3BS5A 1TR5A 4MEYA 2B63G 1SWVA 1Z00A 3Q0AA 2IHMA 1VQNA 5KT5A 3GV5B 5IINA 9ICBA 5AIBA 4PV1C 1JT8A 4KLJA 4EQ5A 3IG5A 3QEBZ 2BCSA 3S2DB 1H38A 4KLTA 5FKAC 1SJHD 4A3FH 3TAQA 4AYBG 4DAPA 1RYSA 1H95A 2LS01 4F3OA 1VCIA 1ZKOA 4F50A 1KLNA 1AQ6A 2R61A 3MFYA 4KX5A 2J6SA 1F0MA 5J1ZA 1HUNA 1WTRA 2B6GA 2MP1A 1LLRD 3P7JA 4B9VA 7ICIA 4JI4Q 1WCMG 4H0LC 2ZIXB 3KDFB 5JEAG 4R4CA 2O6KA 5AJ3Q 4BWGB 1HFNA 2ZIUA 4XRHA 1IYUA 1MSHA 3SEBA 2K8BB 4ACOA 1GUOA 3CQZB 4BXXG 3GV8B 4DV0Q 3T5HA 1ICWA 3U9OA 4YCVA 5ALMA 2OH2A 3WKAA 2K89A 4Q45A 3AU6A 1PDQA 4HN7A 3M8RA 1JRPA 3NVWA 4LFCL 2Y0SC 3S1RH 3KHGA 1KEJA 4HMJA 2W03A 3EPIA 1TWHB 4JBWA 4DK6C 4YXMA 1X3QA 2PMZB 4ZQ3A 3C2PA 3GTOH 5I2XA 2I5HA 1J2MA 2FE9A 4BY7H 5HURA 5KG4A 2F0NA 4KN7A 2W9CB 4HJ8A 1K8OA 3SVMA 3MR5A 3HOYB 1YEZA 1V97A 5DLQE 4YFKA 1AE3A 4J15A 5ALEA 2N49A 4UARA 3URYA 1HTLD 1KLGD 3BS5B 1U9RA 2D62A 2EDUA 1EUJA 3DHQA 3RLNA 3QXGA 2E8NA 2FXQA 4LZDA 3C29A 4ZCKA 4KI0A 3G71A 1UA1A 4I2BA 4C2MH 3H0LB 5ELNA 1AZQA 2ZXPA 1PH6A 3S2HH 1GO3E 3TKAA 1JWSD 5BOMA 5KFVA 1Q90A 2UUCL 3BVZA 4R66A 4QZGA 3WKCA 4B3SL 1EY4A 2H3VA 3M7DA 1F2YA 2MO1A 8ICCA 4QMGA 9ICXA 4A3KH 3GTMB 1LTBD 1I4PA 3DEEA 4FZMA 2MNAA 2PFPA 1Y88A 2JA7G 2OF1A 3PO3B 4OXPA 2B2YC 2XI9A 3UMBA 5ALJA 4ECTA 3CC7A 2GN5A 4EYIB 4ULLA 2HVIA 3MXUA 2ZIUB 2ZG6A 3DEPA 4DV3L 3ULJA 4ME5A 2VA2A 2KE7A 3FDSA 5L1IA 3LWMA 4I2CA 4IN3A 3G48A 4JI6L 2P6UA 1B8AA 4ZUIA 1B2TA 1IL2A 4OO1G 3JPQA 2XIWA 4J9PA 3M7NA 1I6HH 1U5KA 3J80c 1HNXL 1ZQLA 1G91A 1JWMD 3RR7A 2CHBD 4Q44A 4EX7A 2Q2HA 2X69A 5DQIA 3TBIB 4JVZA 5DEHA 5AM2A 2IBKA 4PL1A 3P20A 5CV8A 5K4LA 4XQ8A 3WKBA 1SKWA 4FF4A 2EY6A 1PRTB 3OHXC 4GLXA 1LT6D 2C35B 4QW9A 3CHBD 3JPNA 2DKXA 3ONNA 1TS5A 3GTPH 1R9TH 4BX9C 2K8AA 2CN1A 7ICHA 3QUTA 4PJ0U 3RAXA 3M4YA 3NRWA 3F2CA 5ALTA 1SIJA 5C5MA 5EKIA 5C4JH 2ASDA 1X6JA 3HOUH 5KFZA 2DUYA 2B0CA 1QH9A 1ZQOA 3K57A 2VUMG 4R4TA 4EZ9A 3T51B 3H94A 4J6HA 5J8YC 3M4QA 5BN3A 4RNOA 4ZOHC 4DXGA 3CCUA 1IBLQ 4LF9Q 2F0OA 3CMAA 1U4MA 3X3MA 4DS5A 5IGEA 1Z1VA 2ZM6L 4X62L 1PH1A 2G07A 3PO3H 3FKIG 1RQLA 2MAXA 1TAUA 4FDBA 4EBCA 2BDPA 1HXYD 1HNWQ 3ZDBA 3GO5A 3HOWH 2R7ZH 2UVUA 3B6YA 2FFKB 1E7ZA 2RHFA 5I9OA 1F2LA 3R9KA 1KAWA 1NKBA 4DQRA 2RLTA 3UE1A 2HD3A 4V0BA 1D5XC 3EROA 3DMUA 4C3JB 3HKZB 4IUQA 5KG2A 5KT7A 1A8VA 3OHBA 4UP7A 2KCTA 1SYCA 3MFIA 4FYDA 2WAQC 1L5UA 1V9PA 2K03A 2XN9C 4DXFA 3CCVA 3MC0B 4LJZC 1D5ZC 1U4LA 5ALLA 4UAYA 1YVCA 5CYUA 3UDFA 5DG9A 4Y2YA 5AKJA 3AQEA 2K1BA 4KHVA 2FJ2A 4MTKA 4TQUS 3A0JA 4M6WA 4M9HA 4L5SA 2X6LA 4QZFA 4MTNA 5DM63 4F87A 1ZQEA 1B22A 2ICIA 2P66A 2PFOA 3BQ1A 4IPCA 5JOBA 3J80i 1WTWA 4GZYC 2BDUA 2YX8A 4GXJA 3PO3G 1C9OA 4E6IA 1QNUA 4YR3A 1KD1C 1ASZA 3BDCA 1HPCA 4K14A 1NCVA 3MC1A 4J9NA 1PVPA 3RF9A 2IY5B 1SB3C 3L4PA 1IKLA 3HGBA 4B08A 5ALDA 4JI4L 2Q8IB 3V7LA 2K52A 1ZQVA 1PFNA 2LY7A 5D65A 5KT3A 3PV0A 1L8OA 5KFFA 5DB7A 2F0MA 1VQOA 2XIDA 1KQQA 3CCJA 5D3IB 1S5LU 4QZDA 4B3TQ 3M8SA 3SZ2A 5A2QL 1IZ6A 1CKOA 3P75A 1JI7A 1XTCD 3C1EA 3QG1A 4RQ2A 3FM9A 2A3VA 1ZQHA 1HQRD 2LXKA 4Y7NB 2V1CC 2LYHA 5T1GA 2NRZA 2R93B 4LVSA 2EAPA 2QDLA 3RBDA 2LM4A 3K81C 2HIXA 3ZDDA 1KDBA 1VF5C 4ICAA 2CH4A 8ICKA 4DSJA 3KJOA 1EU4A 5DKWA 1DRGA 2OXPA 1VQ4A 1CA5A 4K4HA 5T1IA 4JV2A 2I0QA 1ZXIA 1I3QH 1O80A 2ALYB 2IHEA 4Y52H 5H2FU 4H44C 5C0XJ 1CKNB 2XWBB 5JJIA 1AH9A 4YP3A 3RZDH 4DR3L 7ICJA 2F0PA 5ELFA 5EAYA 4IQWA 1N32L 4A3IG 3HFZB 2OTJA 2EXZA 7ICOA 1X65A 4LF7Q 5EBCA 1IHZA 5A35A 2KNJA 5IIFA 3OTOQ 5J0WA 2CKZB 2OHFA 2OEOA 4CE6A 2K5NA 1ENAA 4RGMA 1YNND 4X65Q 2HDMA 2EQYA 2W04A 5ELCA 1VQ5A 3RJGA 1UA0A 4HSVA 1I50H 1QQ5A 4DFPA 3M1YA 7ICFA 2QDBA 4ID6A 4JC0A 1TVAA 2QEXA 4MHEA 2NO4A 4DFAA 3UMCA 4HJ7A 1IYVA 3R2IA 3PO2G 4C4RA 4KLUA 3BS1A 2F4VQ 4JV1A 3C28A 1M90C 4DL3A 1T3NA 5AKXA 1B4OA 2KCNA 4JBKA 2XGTA 8ICAA 2K14A 1VQKA 3S14B 3HS0C 2IA6A 9ICSA 4JI6Q 1K83B 2F0LA 4BY7G 5KNIA 2F1JA 3D2QA 1KABA 1N34L 3NS1A 1JWUD 1STBA 3PSIA 3FPPA 5CBAE 2WB1G 1JOQA 3BG3A 2MGSA 4KMUC 4ECXA 3OOCA 3KOOA 3V7KA 4CCHA 1Y8OB 2EJMA 1U9LA 5G5HA 5EPLA 4P71A 4DAMA 4HJ9A 8ICMA 4UP8A 4F8MA 3LNNA 3S16B 4X62Q 5FO9B 3VR2A 1KXLA 5KFSA 1U4PA 4M9GA 4C3JG 1BF4A 5C4JB 4UAZA 2XCAA 4KHZA 1S0VA 1EFID 5IIOA 2HI0A 3N97B 1QG7A 1CHPD 3HILA 3PO2H 1MI2A 2YQEA 2B2UA 3OJUA 4KLMA 2VANA 4R65A 2N55A 2YU9H 2G09A 2AQ4A 5IT9c 3HOVG 2VQFQ 5D14A 3PF4A 2KTQA 5IIKA 5FP0A 2HBKA 2NO5A 1A0IA 1I6HB 4TVAB 9ICHA 1LABA 4K5WA 3C5GA 2FPKA 3TRZA 4PZ8A 2F0FA 3BS7A 2ES6A 1TK5A 1ICFB 1LTGD 4K2KA 3CW2C 3RRHA 2AQ3B 3H6MA 1MKHA 3VYTA 1G2TA 4O3OA 5FOBB 1Q8KA 3B0XA 1Q1EA 4UAIA 1G291 1TVXA 3F8TA 3DV9A 4Y2JA 1A6SA 2GO7A 4QL5A 1UT8A 3KK7A 3SEIA 2VXWA 3KBGA 4OELB 1SBBB 3H91A 2HHHL 1LT4D 4O0IA 1BPEA 2Y9TA 3PUWA 2E2IH 4RCOA 4A3FB 1HFGA 1X3EA 4P4MA 4QWDA 2K28A 4HTHA 4Q5VA 4HJ5A 2WAQB 1HHVA 2IL8A 4R4OA 5GAHC 8ICSA 2R8IA 1QCKA 4YR2A 1PH2A 5DQGA 4I2FA 1TKDA 1OO9B 4KLDA 3NBIA 1WCMB 5HY6A 2KVCA 4B3SQ 2IT1A 4F91B 3HOYH 4XUSA 2GVBA 3F1ZA 4DSEA 2A74C 5CV6A 4EBEA 1XC9A 2DGYA 2DN8A 3GV6A 5EE1A 1ZQXA 4H13C 2I6XA 3EVQA 4TUPA 4UB3A 1HUOA 3VYRA 3PX6A 4F93B 5KFMA 1STHA 1SMYC 5BN5A 4DOCA 4NDXA 5JEAJ 4C3HH 5L37A 4CNQA 2W9CA 3HKSA 4IR9A 3J81c 1K1SA 3RJEA 1JICA 2JA7B 1IKMA 5IWAQ 3D2NA 3N52A 4R4IA 1S3OA 2NVQB 2UUAQ 1IYJB 2P5ZX 2HVHA 2OCEA 3HKZC 1FO4A 4MZ9A 4C3IB 1GXDC 3BQ2A 8ICBA 4Y2XA 3GQCA 2KZZA 4LWCA 2WF6A 4B6JA 3FVQA 3PUYA 4RGTA 1WOCA 5C0XG 2HSZA 3KLSX 4PZ6A 2H3ZA 5DM73 2W8LA 3H4BA 4B3MQ 5KFXA 4FXKC 4R63A 3DXJC 1NNXA 3TQ1A 3QU7A 2AWOA 4IS7A 2JA6B 1L7MA 2NVYB 3NELA 3T5LA 1X32A 4DUYQ 1LKYA 9ICWA 4EQNA 1YI2A 3ERQA 1T4GA 5KRUA 1ZQ1C 4UPAA 1TY0A 2EZZA 1HNZQ 3OW7A 1WTVA 3SGIA 2L5TA 4O5EA 3CXCA 4QF4A 1Y8PB 4JB3A 1QTMA 3UQ0A 2TSSA 5J0YA 4X3KA 3RRGA 2K8CB 2Z0SA 4WRDA 4JI1Q 4DV2L 4JBJA 5G3LD 2ZJPA 4QQBX 4HCSA 5CBEE 3N7SC 4A3DG 3W1GA 1FR3A 2VZAA 2D0PA 2F52A 3QEAZ 4P73A 4DAYB 4M8AA 4CKBA 3AN1A 9ICMA 2EJFC 4FNFA 4AQYL 4DF8A 3E0JA 3JPPA 3OWFA 1PYBA 2KVSA 5AKZA 4KLHA 5DB9A 1KHIA 4PG3A 3MEHA 3I4NH 3GD7A 1WJJA 1EFWA 4JI8Q 2G08A 2ZJRA 1PK1A 1T3QA 1TK8A 1TWFB 2XY6A 4FZNA 1WCMH 4NPSA 3OMCA 7ICPA 4RFBA 2A8VA 3GTQB 4DNRB 3GV3A 4R8UB 1GD7A 1XWEA 4JK1C 4OIKA 4AYBB 3C5FA 1BUVT 1F77A 2AWNA 2JEBI 3T5KA 3NTHA 2UU9Q 2XICA 3RAQA 1PRTC 1WCLA 4R8IA 4A3MB 3S14H 5AK4A 1JN3A 1K83H 4OGQC 2B3GA 1PTOH 2FI1A 3K1RB 3PVXA 4TSSA 2JA8B 5AICA 1CEZA 2A1JA 1D2BA 3H8JA 3X3NA 1RDFA 1DM0B 4K8JA 4F72A 1SXDA 1B53A 1MC8A 4USAA 1OUQA 3MAQA 2KA7A 4O9MA 2A19A 2KHVA