1IXRA

Ruva-ruvb complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
135
structure length
135
Chain Sequence
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Holliday junction DNA helicase ruvA
total genus 29
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ixrA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ixrA01
4A3JG 1TVAA 1AROP 4X64L 4YMNA 5J2DA 3STBD 3M85A 4O2DA 1CUKA 3K0XA 4IOCA 4DL6A 3V6JA 2JZBB 1FVIA 4RNOA 4A3FH 2HIVA 3T1YQ 4F4ZA 3M3YH 4MFAA 4JI7Q 4GOPC 2BH2A 4J9PA 2VY3A 5KT6A 4ME3A 2ID0A 1D9DA 3RAQA 1JJGA 4I2JA 4P4MA 5CA7A 9ICBA 1PH2A 1P16A 3KF6A 1VQFA 2VANA 1KRPA 4LF9L 4B9NA 4Q8FA 4LNQA 2FPKA 4IRCA 4NLZA 2HVIA 1V43A 1J5EL 1EUJA 4DV1L 9ICPA 4DV3Q 4DV1Q 2RF4A 3MFHA 4M9HA 1JXLA 4DSIA 4GLXA 1XMQQ 4JYAQ 1X65A 4BXOA 3Q8QB 4KHZA 2C2RA 1Q81C 7ICKA 4MF8A 2KZ3A 4X5VA 5CB1A 3MR3A 1IBKQ 4LFCQ 3PO2H 3LWMA 4FO6A 2WP8J 4DV0L 4DFMA 1DGSA 2PFNA 2R7ZH 5J0QA 3UDXA 2JEGA 1EXNA 1ZQVA 1QUQA 3ULLA 1XMOQ 3Q8KA 1Y1VG 1QZHA 1QVGA 4QL5A 8ICFA 3S2HH 3RH4A 4X64Q 1BPBA 2IY5B 3RJKA 3IRBA 2OTLA 3PO4A 1I3QH 4F4WA 4BDPA 3HOWG 1NY4A 1VQ4A 1KXLA 2F1HA 5DB6A 4B3SL 5BR8Q 3MR6A 4CCHA 5H1SE 3CPWA 1A63A 4F4YA 3CCUA 4YQWA 4DR2L 4YD2A 4JOIA 1PH7A 1MSWD 4E0DA 1E7ZA 5J2HA 3RR7A 1G291 4BBRG 4JV0A 5KG7A 2HHHQ 2UUAL 4ECTA 2DGYA 5IP7G 3A0JA 1HNZQ 1UE5A 2XGTA 1Y1WH 1LTLA 3C1YA 5HHHA 1NK4A 2RHQB 5J2IA 1KL9A 2LYHA 5DLGA 1SL1A 1WI5A 2BQUA 7ICTA 3HP6A 5LMNL 5KG4A 3KHLA 2I5MX 3I2ZA 4DV7Q 2Y1IA 3JAMi 4IFDJ 4J9NA 1VQNA 2V4QA 3S1NH 2R8KA 1X54A 4TQSA 1JXEA 1UE1A 4B3MQ 9ICCA 2JA8H 4ELTA 2AQ4A 1ZJNA 1M90C 2FPMA 4BWJA 1BBUA 4RPXA 2Z0SA 1KIXA 4JI6L 3T5HA 1PA6A 2ATWA 3S2DH 3IM1A 4IQUA 2UU9L 4PH5A 4ED8A 8ICYA 3ER0A 4GXIA 1Z3EB 5DGBA 5M3MH 1IBMQ 2YYZA 2BHNA 4DL5A 5KG5A 4IR1A 1IBML 2W8KA 4RNMA 1E3PA 2BPCA 4GS3A 4DQRA 1W3SA 4OO1G 1SROA 5LMUQ 4B9LA 1C9OA 3HOXG 4RQ4A 4QJFA 4ECVA 5DQHA 4DL7A 4JI1L 4DSKA 1AE2A 2ATLA 4L5SA 5GAEC 1PH6A 5IIMA 4LF9Q 1QVCA 1X9MA 4KLQA 1ZQEA 2J6UA 2NZHA 2PI2A 3TFSA 1XC9A 1WCNA 1PVOA 1FGUA 4DUZQ 2A8VA 2IX1A 3H15A 4GC6A 1L3UA 5KFKA 1S0NA 1SKWA 4JG2A 5J2EA 3K80C 5KFFA 2KBNA 1I50H 3TRZA 1NK6A 2QGQA 3NGDA 1L3TA 2BGWA 3Q8SB 2VA2A 3ZJYC 2FPLA 3GQCA 1ZQJA 4UP8A 2UVVA 3OSNA 2OQKA 4JV5Q 4G3IA 1NBWA 1XNQL 2BPFA 5KT3A 4JI8Q 3I56A 4RQ2A 1T3NA 2JA8G 4DV6L 3UE0A 3CC7A 4ECQA 4FS2A 2B29A 2AWNA 2W8LA 2A1JB 7ICIA 5HNKA 1YVCA 3AFQA 2XGQA 1IBLL 3AEVA 2Y1JA 4HJ5A 4QZ8A 4JI8L 1T8EA 2Q0ZX 1YHAA 2QA4A 5DKWA 3H0GH 1X3FA 3NELA 7ICSA 4OO1I 3H0GG 4IQVA 4A3LG 4JI6Q 4JV2A 1HR0W 1H95A 1OXXK 1VQ5A 2N8NA 3GDXA 3HW8A 2Q2TA 4IQTA 4DUYL 2NN6G 4DR3L 4DKAC 5KFHA 1BPYA 3BZKA 1HNXL 2UXCQ 2BKEA 2R92H 2V4RA 3G6XA 2XY6A 4JI1Q 4DUZL 3MGIA 2PI2E 1Q8KA 2XC9A 3CXCA 1UE7A 3HWTA 4DL3A 3K81C 1CKNB 2AGPA 1ZYQA 2W9CB 1XMQL 4JYAL 3PW7A 4PZ7A 3W5OA 1K1QA 2VW9A 3HOWH 4DQPA 3HOVH 3BQ0A 1AE3A 1K3RA 3CCQA 1SKRA 4LF8Q 2WAQG 4JWNA 4M6WB 4DV4Q 1Y1VH 5L1JA 2K5NA 3QZ8A 2XCAA 1X56A 5J3BA 5EWEA 4X66L 3DM3A 1V1QA 4PGYA 2OCEA 2IX0A 3EPGA 5KFXA 3EN2A 4P2HA 4DSEA 2FMPA 4R4QA 4YCVA 4DEZA 2UU9Q 4C2MH 1HZ9A 3TAQA 4LZDA 4F5OA 2XTIA 4DV7L 1TKDA 3ORYA 1VQMA 4IPHA 2R92G 3RLFA 3CCJA 3Q8PB 2H5XA 4RT2A 2B63H 2DPJA 2MFIA 1PH9A 4BBSG 3C21A 5KFMA 4M47A 3GD7A 1SRUA 3GTKH 2UXDL 2ZJQA 1CKOA 4A3LH 3NBHB 2YTVA 3MDAA 4DV2Q 1T9HA 3ETLA 1WFQA 5J0RA 1UEBA 3GTGH 7ICUA 1JE5A 3JPSA 1KLNA 4HIDA 2F52A 4EZ6A 1VQJA 4B9SA 4JI0L 9ICVA 4TQRA 3N97B 4RT3A 4OWWB 1VCIA 1ZQXA 1NMFA 4ED3A 4TURA 3ICEA 5KFDA 4RU9A 1P8LA 2N78A 4DV3L 1HNZL 3BU2A 4UAWA 2R8JA 5C0XJ 4TUPA 4DLGA 2NVTH 4DL4A 1BPZA 1S0MA 9ICKA 1X9SA 4YCXA 4RQ8A 5FLMG 2HHHL 1NMGA 5IINA 4PMWA 3EW9A 3B0YA 1TWAH 5JUMA 3K8AA 3JC66 4JOIC 1ZQZA 2VUMG 2NRTA 3HKSA 4KLMA 4YR3A 3WWVA 3TFRA 3EWAA 4DWIA 2WB1G 1O7IA 9ICNA 2CQOA 1SN8A 1VQDA 4HYKA 4F4KA 4BY7G 3T5JA 3PR5B 1HR0L 4YCUA 1N9WA 8ICLA 2ZJAA 9ICIA 3T5KA 4RMFA 4YMOA 3EPIA 4AIMA 1D8LA 3J81c 4I2IA 3S17H 4A3DH 3SZ2A 3H7IA 2BCRA 3F2BA 4K4HA 3E2EA 1GO3E 4BXOB 2BCQA 4DR4L 9ICEA 2RDIA 3K7UC 5F9NA 2BA1A 3ZDBA 4TUSA 1NKCA 4LF8L 3AFPA 4RPZA 2ES2A 5DLQE 3MDCA 3PO2G 4RQ0A 1ZQWA 2JA6G 5M5YH 1ZQTA 4MFFA 4J9OA 5KG2A 4PZ8A 4B3RL 1PH3A 4DFKA 4DQQA 1IZ6A 5KFWA 7ICQA 3E0EA 8ICEA 3ZD9A 4M9GA 3PIOA 1RXWA 3M8RA 4P71A 3HOYH 4JI5L 4JBMA 1ZQKA 3RRHA 4JI3Q 5IIIA 4A3GG 1ZJMA 5DQGA 5CHGA 5IYCH 3RLOA 4EBCA 3HOZH 7ICOA 2E5LL 7ICPA 2BQ3A 1IM4A 4DNIA 5J0UA 9ICGA 1G6PA 4DK3C 1N8RC 2F1JA 5KFQA 3BZCA 3H4DA 3JPRA 8ICOA 4UAYA 1BGXT 3PW5A 1ZQQA 4APVA 5IP7H 4PZ6A 1BPDA 4GNXA 1ZETA 2HHWA 1N32L 4ECWA 7ICRA 5KFEA 2HHVA 4LF6Q 3PUZA 5KFOA 4JV5L 1XPRA 1BPEA 3EIVA 4C8LA 3RJFA 1TWGH 3KJPA 3M4OH 2JA9A 9ICAA 3JPNA 2AKWB 4TUQA 1YJ9A 3PNCA 2C35B 4WJ3M 2UXCL 1ZQGA 3GV8B 4DR1Q 4JI7L 4MZ9A 4NXZA 5KFIA 2HW3A 2ALZA 4DUYQ 1L3SA 4NLKA 2PMZE 3RZDH 4JI4L 8ICPA 4MFCA 3F8TA 1JJ2A 2ISPA 5D4BA 3F2CA 1XO1A 5KT7A 2XO7A 1T7PA 4O5KA 1TFRA 2JA5G 1KHIA 4C3JH 4UB2A 3MGHA 3J7ZC 1GD7A 1S97A 3KDFA 3J7A5 2JE6I 4K0KQ 2PQAB 3PX4A 3N4MB 3GV7B 4KLOA 2VL6A 3T1HQ 1S77D 5DG8A 3ZDEA 4YD1A 4PG3A 8ICNA 4KLGA 4AH6A 5IWAL 5C3EH 1SLJA 5C4JH 4QZIA 2ASJA 2VQFL 4QY7A 1S72A 2YTYA 5IIKA 2F4VQ 1XNQQ 4RQ1A 1ASZA 4RG1A 5C4XG 4I2DA 4HIKA 3TS0A 3SYZA 8ICKA 3LDAA 5IT9c 5J0PA 2R7DA 3RNUA 2FMSA 2I5LX 4IO9A 2ZJ8A 4A3EG 2JEBI 4C8KA 1QTMA 4QGUA 5DDMA 5KFBA 2ALYB 1VQ8A 1S10A 2Y0SG 3S1QH 1RYRA 7ICEA 7ICHA 1YBYA 4JK1A 4I29A 4DF8A 2NRZA 1PYSB 4GLAC 4YXJA 3SV3A 4A3CG 1YNXA 2NVQH 1XSPA 4DFJA 3TARA 2BCSA 3G48A 4JBKA 4UP9A 4C3HH 3PR4A 1COOA 2I0QA 3QEBZ 1EIFA 3LWLA 4J9MA 5C5JA 3T1HL 1X6OA 2KFZA 2KFNA 3VDYA 4A3CH 4DPGA 3ERSX 2W9MA 1MQ2A 3HX0A 4A76A 3A5UA 2MO1A 4DR7Q 3OHAA 2HHXA 4OWTB 4Y7NH 1A62A 3KHGA 3G6YA 2C22A 2J6SA 4BXXH 3Q8MA 1KSPA 1VQ9A 3HKZG 5IYBH 3GTMH 5TZVA 2HHUA 1EQRA 3RH6A 1U5KA 1RXVA 1NKEA 4K4IA 4LF7L 4KLSA 3QEAZ 4NM1A 4JI3L 1NOMA 5KG0A 3PF5A 1N48A 1OXUA 4B9VA 4OONA 4R8UB 5DBAA 2E5LQ 4L5TA 1B7YB 2CFMA 2UVRA 5KFZA 4DR5Q 1JMSA 2IHEA 1Z9FA 5KFAA 2EIFA 5J0YA 5GQOA 3LGJA 2D62A 2ZUDA 9ICOA 4YN4A 5JEAG 4KMUA 3CC4A 1U45A 3Q8RB 5KFUA 2ZTDA 3PUWA 3TREA 4I2FA 1N32Q 4YHHL 3ISCA 5C44H 1L1OA 4OX9Q 4PGXA 1MIUA 1YEZA 1KQSA 1B70B 1S76D 1N36Q 3ULJA 4RQ7A 1A77A 5LMNQ 3PX6A 4P73A 4R4TA 4J9QA 3AYHB 1E24A 2QEXA 9ICRA 2ZJRA 2IHFA 4P74A 1A76A 3H3VI 4F93B 4KLKA 3H4BA 4DSJA 1QVFA 4NPSA 1NJIC 1VQGA 1KFTA 5DG7A 4X6AH 4PPXA 3GO5A 4IFDI 4ED1A 3MFIA 1PYBA 3SV4A 3M4PA 4BA1I 1ZQFA 5CP2A 3RJJA 1Z47A 4QIWE 3BQ1A 4I28A 4A75A 3V7LA 3UQ2A 1TWFH 3RLNA 2R8HA 4RQ3A 1ZQDA 1HNWQ 5KG6A 4J9KA 2ZJ5A 4YWLA 3CCRA 4R4OA 4M9JA 2DPIA 3GIJA 1I94L 3UXNA 3I4NG 1CKNA 1VQPA 4I2HA 4OXPA 4XIGS 3BQ2A 7ICGA 4ECRA 3AQQA 3CCLA 2VS1A 1YZ6A 3UDGA 4F2RA 1VQHA 5HMMA 2R93G 1CEZA 2MO0A 4RUAA 4DV0Q 2UUCL 5J29A 4Y52H 4C3IH 1HUOA 4A3FG 4QWEA 3QE9Y 8ICRA 1GVPA 1Q1EA 2E2JH 1L1OC 1MJEA 4C8OA 3B6YA 1IL2A 2FLLA 4DF4A 1Q46A 4HJ9A 1ZQCA 1JX4A 4A4IA 1N36L 2K50A 5K36G 2JA5H 1VQ6A 2DFLA 1YJNA 1Y14B 3UXPA 2AU0A 3PSIA 3MR2A 4A3KG 2NRVA 4DSLA 1Q12A 1X3GA 1I94Q 4MNOA 4QWDA 3RH5A 1TXYA 8ICQA 4KLHA 3UE1A 4NXNL 5JEAJ 5KFLA 5C4XH 1K83H 2MNAA 1X9NA 1TAUA 4DV5L 1TWHH 3L0OA 2PFQA 4KI0A 3M9MB 4RQ6A 2AGOA 5BPCA 4KLTA 1K9MC 3KOJA 3OJUA 2VA3A 4LFBL 1EIYB 1KDHA 2F4VL 4LUVA 4DK6C 4JUZA 5J2KA 1UE6A 8ICIA 2EQSA 1PFSA 1K8AC 4Q8EA 4J9LA 3PO3G 2P66A 5IP9G 5C0XG 4DSFA 2BQRA 4P75A 4O0IA 2D0PA 1WCMH 2A19A 3RB6A 2KZZA 4K0KL 4PHEA 4GN4B 1VQLA 1K8GA 2C28A 3PV8A 5FLMH 5CR0A 3UPQA 4QZEA 4KHPQ 5EWFA 3T1YL 4PHDA 4YMMA 1LM0A 4UBBA 1VQBA 2Y0SE 3UDFA 1D9FA 1D7QA 4DV2L 4X62L 2IHNA 2AWOA 5M3FG 3UQ0A 4F50A 1IYJB 3PUVA 3AU2A 4AYBE 2BCUA 5HY6A 1FJGQ 2XY5A 4KHPL 5KFPA 2BR0A 3M8SA 2IHMA 1E22A 4IJLA 2Q2UA 5L9XA 2RCNA 2HT1A 4GN5A 4B3TL 2GN5A 1JIHA 1S0VA 1ASYA 3SGIA 4AYBG 2VQEQ 4O3NA 1YHBA 7ICJA 1RIPA 2ZTEA 3KFUA 4BBSH 2K14A 4LFAL 4GN3B 2VQFQ 4HIMA 3PMLA 3G4SA 4EBDA 4UB5A 8ICGA 1XWLA 1XPOA 2WFWA 3W1GA 3T3FA 2BCVA 3MABA 1NJZA 2JQOA 3RBEA 3FHWA 4PHPA 3C2LA 3OHBA 3GTPH 3W1BA 5J2AA 4LW1A 2JJQA 4NLNA 5KFJA 5IILA 3PCOB 1L3VA 5IY0A 5FLXc 3BDPA 5KT4A 5DG9A 4NM2A 1ZQUA 2HHQA 2AMCB 2I9GA 4MEXA 1Q82C 4JCVE 4EQ5A 1XPUA 4IRKA 2P6RA 2Z6KA 1OXVA 3THVA 4H02A 5C3EG 3RZOH 1NK0A 1E1OA 1YIJA 3J81i 4JV1A 3H8JA 4QZHA 4KTQA 1HUZA 5D46A 3C2MA 1N33Q 1ZQNA 3RBDA 4X62Q 2JA7H 1MKHA 2JEIA 1ZQPA 1KFDA 1BKBA 4NB3A 1S0OA 3V6HA 4OWXB 5CWRA 3S15H 4MTNA 1PHJA 3F2DA 4I2BA 3B0XA 4IRDA 3OJSA 3GTLH 1NKBA 4YVZA 1L0WA 1U48A 5M5WH 5KFGA 2PXIA 2J6TA 5C44G 3JPQA 3C23A 5D49A 4PGQA 8ICTA 4DLEA 4EBEA 4IPDA 3KF6B 1FJGL 4J9RA 8ICMA 4UBCA 5JJKA 1PH5A 4QQBX 4UAZA 1PH8A 4R4CA 3HOUG 1NE3A 3ZDCA 3KLWA 4B9TA 1SMXA 4TVAB 3HOUH 5KG1A 3UXOA 1S3OA 2A1JA 1Z00B 4NXNQ 3F1ZA 3ZDDA 3PGZA 9ICXA 5DDYA 4EYHB 3TANA 3FKIH 4Z6FA 4HJAA 2NRXA 4JC0A 2E8GA 4LF4Q 4Q44A 4NY8A 4DR4Q 2KHIA 4KLUA 1QZGA 3QZ7A 3CCMA 9ICFA 3NENA 5J0WA 4ELVA 3Q8DA 2F1IA 4A3BG 2WAQE 1LB2B 3J81j 4A3GH 3MBYA 4ED2A 2JZBA 3I4MG 4FBTA 4KLFA 3FP9A 1KEJA 3GIKA 2PQAA 1Q86C 5DGAA 5C0XI 2BDPA 4JI0Q 4UB1A 4R63A 4QWCA 4FS1A 2F3IA 1WJJA 1BPXA 5J2CA 1T4GA 1HNWL 4O3PA 1WOCA 4RNNA 1WCMG 3PF4A 2LXJA 3TQ1A 3JPOA 4XUSA 4YP3A 9ICUA 2OTJA 2I1QA 2CWAA 4ECSA 4O3OA 1J6QA 3H8WA 4QWAA 2XY7A 1IBKL 2XGPA 3RTVA 1MC8A 3RJHA 1W2BA 3CPFA 2WB1E 2UXBQ 4LWCA 1L2FA 2ASDA 1EOVA 1L1OB 3CMAA 1YITA 2DUDA 3CMEA 5IYDH 9ICWA 4UB3A 1CSQA 4M04A 5KTQA 3CW2C 4LFCL 4BY7H 2R7FA 5AJ3Q 4GKJL 4DR2Q 4X66Q 4AQYL 7ICFA 4RZRA 2FLPA 1X9WA 2JEAI 5FJ8G 4AQYQ 9ICSA 1VS0A 3TAPA 4KN4A 4F8RA 1CKMA 3G6EA 4F5PA 1SE8A 3S1RH 4ELUA 2L15A 4YHHQ 3C5FA 2KCMA 3G6VA 1TK8A 2KCTA 2ASLA 2W9BA 1MJCA 1EQQA 4MEYA 7ICMA 4LUOA 4F92B 2ZJPA 3JPPA 3RN5A 2UXDQ 1HR0Q 8ICXA 2AQ0A 3AU6A 7ICNA 9ICHA 2KHJA 2PFOA 8ICUA 2LSSA 1PH1A 1XTDA 2R7ZG 5JJIA 1LUZA 1KAWA 2OWOA 4YR2A 4A3IG 4LF7Q 3JAMc 3RRGA 4M6WA 2VZAA 3K4GA 3K7AH 3BQTA 4F2SA 1KRTA 4EYIB 1ZQBA 1J5EQ 4IOAA 4B9UA 4RQ5A 4DR7L 3H40A 1JT8A 5J0XA 4KLJA 1LV5A 3ZDAA 2ZM6Q 1RYSA 3U4VA 4DV4L 4Z6CA 4YY3Q 3CCSA 2K5HA 1QSSA 1L5UA 7ICLA 4DV6Q 4GOPA 3PY8A 1NJYA 4Q45A 3PUYA 5ELNA 1U0LA 5KFYA 1S9FA 1PH4A 4DFPA 4UP7A 4BXXG 2UUBQ 4QZFA 2VNUD 2K4KA 4XQ8A 1KD1C 4XRHA 5F9LA 4DOCA 2UVWA 1HNXQ 4QW9A 3PW2A 1Q7YC 3PUXA 3OTOQ 1ZQHA 2XCPA 4LF5L 5J2JA 4QW8A 3I4OA 4DR3Q 1KRSA 1RL2A 5DQIA 3EBEA 3HOVG 1X2IA 4I2CA 4DS5A 1UT5A 1U47A 3BJUA 4GKKL 3RB3A 3HOXH 2GWSA 4IR9A 5IWAQ 4BY1H 2LXKA 3CAMA 4LVSA 1B43A 1KFSA 4YWKA 1WCLA 4C8NA 4QZBA 1HJPA 3OSPA 2VQEL 2EXDA 4P4PA 3ULPA 1OXSC 3JPTA 1QSLA 1EFWA 3RJIA 1HZAA 1TWCH 2AHOB 8ICSA 2CWPA 3L2PA 2FMQA 1NJWA 3A5ZB 2NVXH 4NXMQ 2ASBA 1YI2A 1D8YA 3NTUA 5J0SA 4O5CA 4F91B 4UY8C 5DB7A 4B9MA 3OW2A 2WTFA 2RDJA 1RZTA 4DR6L 1K0RA 3J80c 4MF2A 5DB9A 2E2IH 2R8GA 4GNXB 5L1LA 3PW0A 4HJ8A 4IPGA 2JA7G 1ZQSA 4R8UA 3PX0A 1V9PA 1JJCB 4Q43A 1XSLA 4YY3L 1X3EA 5J2BA 4BWMA 1S40A 1NTGA 4JBJA 2JK8A 2KTQA 2MUTB 2PNHA 1KTQA 8ICHA 4QZDA 3MXNB 1VQKA 4JI2L 1Y1WG 4DAMA 5IYBG 4F5RA 1JB7A 4HIOA 3MEFA 3I4MH 3GTOH 4B3TQ 3SI8A 5DBBA 4KLLA 1B8AA 1PZNA 2YTXA 4I2GA 2N49A 4ECZA 3RAXA 3ISBA 4YCWA 4A3MG 3RN2A 1SR3A 4I2AA 4A93H 3D0FA 4B3ML 4QZGA 3I4NH 3KDFB 5J0TA 2R8IA 4F5NA 4FBUA 2PFPA 2PI5A 3KYHC 1ZQMA 1JN3A 4NLGA 4JI5Q 2B3GA 4O5EA 3FKIG 4KN7A 4ECUA 5GAHC 3ZD8A 3RJGA 3V72A 4DOBA 1OXTA 5FJ8H 2Q2IA 3M9NB 1XS9D 4B3RQ 4EZ9A 3RB4A 5M3MG 2UUBL 2CCZA 5GADC 5J0OA 1RPLA 2W9CA 1UA1A 2C2EA 1VQEA 1ZQIA 1U9LA 2BA0A 4ED7A 2ISOA 1VQCA 5AJ3L 4GKJQ 5BOLA 2GVBA 4LFBQ 4A3IH 1K73C 2R6GA 1BVSA 1ZQLA 3H8SA 1TAQA 4KITB 3K75D 4ED6A 9ICLA 3M9BA 1UT8A 4PHAA 1SL0A 4DQIA 1SL2A 5M5XH 1C0AA 5DBCA 2V9WA 2RHSB 2E2HH 3E9IA 2UUAQ 4B3SQ 4OX9L 3DLLA 5LMUL 1WYDA 3PO5A 4BY1G 4POFA 4X65L 4HJ7A 4GC7A 4IPCA 4R65A 8ICWA 1NK7A 4ECXA 5IP9H 4DS4A 8ICJA 3PO3H 2Q2HA 4F4XA 2N3SA 1MQ3A 5EAYA 4IFDG 3PIPA 1TK0A 1TK5A 2D0OA 2YU9H 4POGA 4YXMA 3KTQA 4GXKA 4JWMA 1Z00A 1Q1BA 4ED0A 3U58A 2OQ0A 3KHRA 3C5GA 5IYDG 4BBRH 1B22A 2CKZB 3MR5A 3OYYA 2R93H 3S24A 2VA8A 2UUCQ 5CJ7A 3OGUA 4LZGA 2MQHA 1OTCA 2ZM6L 4I2EA 3I7FA 3H3VH 1ZQRA 4I27A 1XU4A 9ICQA 4F3OA 4LF4L 2UVUA 3GIIA 1N34Q 3KHHA 4DOAA 1JMCA 8ICCA 4EEYA 3RJEA 5EWGA 3HPOA 1CSPA 2ZTCA 5IIJA 1ZQOA 3CD6A 4A93G 3PV0A 1A8VA 5ELOA 1ZQYA 3UDIA 3STBC 4IQWA 1M1KC 4A3KH 4GNXC 4L5RC 1SFOH 4XA5A 1NK5A 1VQ7A 2B21A 3D31A 2AGQA 4XTCS 3GTJH 4UQGA 4A3BH 5HHIA 3BJYA 5L1IA 1TV9A 3S1MH 1XMOL 4F5QA 2GVAA 1KC8C 4A3EH 1VQAA 1QSYA 3AUOA 2ZUCA 1SZPA 1XJVA 1Y88A 1GKHA 2KZMA 3GDEA 2IT1A 5E7NA 2HVHA 4DAYB 4O9MA 8ICAA 1X55A 3CP0A 3U4ZA 4RPYA 1AH9A 1I6HH 4LUZA 3CC2A 5HP4A 3E9HA 9ICJA 1GM5A 3CQZH 4QWBA 2UXBL 5HGQA 4A3JH 2W9BB 2BH8A 4DR5L 1LYLA 2KN7A 3T5LA 3HOYG 2V1CC 3TEHB 1DOQA 1NJXA 3HFZB 2KENA 4C8MA 3GV5B 3J80i 3EYZA 3A74A 1XNRQ 5J2GA 3M4QA 4UB4A 5KFRA 3TI0A 4WJ4A 4X65Q 4ECYA 3V7KA 3C2KA 9ICTA 1QUQB 4YR0A 5KFVA 2YV5A 5KT5A 4R4IA 2M9NA 4EX5A 1N56A 3IHQB 1HH2P 3L7ZC 4DR6Q 3C1ZA 2NVYH 5EOZA 4UPAA 5KG3A 1U49A 4Z6EA 3GIMA 5LMNW 3Q8LA 2HHTA 4KLEA 3EZ5A 4JI2Q 3PW4A 4M0AA 2W9AA 4M2YA 5IE8A 1HZCA 2IA6A 1C7YA 2P6UA 1N33L 5BOMA 2IMWP 2BPGA 1YHQA 1EWIA 1NK8A 4A3DG 3S16H 3HOZG 1G51A 4P4OA 8ICVA 5IIOA 3HT3A 1PV4A 4GKKQ 4R64A 4L5QA 2K75A 4GXJA 3RR8A 2JEJA 3NEMA 4ALPA 5GROA 5DLFA 3RB0A 1EYGA 4GLVB 4FDBA 2AJQA 4QZAA 2JEFA 1XSNA 3V6KA 3M7NA 4M9NA 3M9OB 4QZ9A 4TQUS 3FDSA 2NN6I 4O0AA 3RR5A 1IBLQ 2NZOA 1VQIA 1UWVA 1FL0A 1YJWA 2K5VA 1HZBA 2C2DA 3CCVA 3GILA 9ICMA 5KFNA 1VQOA 5M3FH 2MAXA 4DQSA 3HKZE 4O3QA 4IJHA 4LF6L 4J9SA 3V7JA 3TQYA 3G71A 1U4BA 8ICBA 1NK9A 2PI4A 1A0IA 2FLNA 3GTQH 1IXRA 5KT2A 4Z6DA 3ISDA 4DL2A 3CF5A 5KFTA 2ZUBA 4P72A 1E1TA 4YWMA 5HMLA 4RUCA 4LF5Q 4DR1L 3U50C 5BR8L 4K4GA 3OTOL 4A3MH 4J15A 2IBKA 4M9LA 7ICVA 5L1KA 4GOPB 4O3SA 5J2FA 4JI4Q 2HHSA 2A1AA 4BA2I 2I5HA 1SKSA 4KLDA 4DO9A 1UA0A 1QLNA 2B63G 3PMNA 4ZH4A 1XNRL 4YFKA 3TS2A 2HQLA 8ICZA 4KLIA 2FXQA 3S14H 3I55A 5KFCA 2MUTA 4YG2A 3PVXA 5DB8A 5IYCG 1K1SA 3GFKB 5KFSA 1H38A 1ZQAA 4R66A 4NXML 3KF8B 4LFAQ 3KJOA 5JJLA 2VUMH 2NRWA 4JBWA 4DV5Q 1N34L 3LK9A 1R9TH 4O3RA 3FYHA 1BBWA 4QZCA 2Z6KC 5GAGC 2HIXA 4BGDA 3CCEA 4R1JA 1I5FA 2JA6H 2K52A
chains in the Genus database with same CATH superfamily
5ALZA 4A3JG 1TVAA 4ZRZA 1AROP 4X64L 4YMNA 1N5WA 5J2DA 3STBD 4XQJA 4O2DA 3WK7A 2EAPA 3A8JE 2QEJC 1RQNA 1CUKA 4Y7NB 2G5DA 3K0XA 5ALVA 1LTBD 3OWEB 4IOCA 4DL6A 3V6JA 2JZBB 3IDWA 1FVIA 2A68C 2G9HD 4RNOA 4A3FH 3RF9A 2HIVA 1EU4A 5HURA 2FFKB 5IGFA 1SMYD 2N1RA 5ALJA 4F4ZA 4MFAA 4B08A 1QQ6A 3T1YQ 4JI7Q 3M3YH 1FFUA 2DNEA 4GOPC 2BH2A 4J9PA 3WKCA 2NTSA 2VY3A 5KT6A 1CZGA 4XT1B 5AKGA 4CKCA 2HBKA 4ME3A 1STHA 2ID0A 3VCBA 3UMBA 1D9DA 4N9TA 2F44A 3RAQA 1JJGA 4I2JA 4P4MA 1OUQA 1MGSA 3RFAA 5K5PA 1T3QA 2VJ4A 4KKUA 5CA7A 3M7DA 9ICBA 4C2MB 1PH2A 2KJ5A 1P16A 3MC0B 3KF6A 1VQFA 2VANA 2K1BA 1KRPA 1Y8NB 4LF9L 4B9NA 2KHQA 4Q8FA 4LNQA 2FPKA 4IRCA 4NLZA 2VB2X 2HVIA 1V43A 2K01A 3A54A 4DFAA 1EUJA 1J5EL 4DV1L 5BN5A 2ICIA 9ICPA 4DV3Q 1V1PB 5ALWA 1JE4A 4DV1Q 4OJ5A 3MFHA 2RF4A 1J2NA 4M9HA 5CBEE 5A2QL 1JXLA 2RA4A 3CYMA 4DSIA 1AFPA 4NJ8A 4GLXA 1XMQQ 4JYAQ 1X65A 5AIBA 4BXOA 3Q8QB 3HOYB 4KHZA 2C2RA 2XVSA 1Q81C 7ICKA 2LYAA 4MF8A 2KZ3A 4X5VA 5CB1A 3MR3A 1G2SA 1IBKQ 4LFCQ 5EE1A 5I6YA 3PO2H 3LWMA 4FO6A 2WP8J 3GTPB 4DV0L 3TDQA 4DFMA 5JVH3 3M85A 3URYA 1N5XA 1DGSA 2B2TC 3TADC 2PFNA 2R7ZH 5J0QA 3UDXA 2JEGA 1KNAA 1EXNA 1UHUA 1ZQVA 2DQNB 1QUQA 2H4OA 2JN4A 1FNUA 3ULLA 3Q8KA 1Y1VG 1ZYRD 4DK1A 1XMOQ 1QZHA 2W11A 3EA6A 2K5WA 3TZUA 3GQBA 1QVGA 1A0PA 4QL5A 8ICFA 3S2HH 3RH4A 3OOCA 3I8ZA 4X64Q 2F3VA 1ZYRC 4U68A 3D6CA 1BPBA 2EZYA 4KKSA 2IY5B 2A6ED 3RJKA 3IRBA 2OTLA 3PO4A 1I3QH 2IX3A 4F4WA 4BDPA 3HOWG 1PRTC 1NY4A 1VQ4A 4DF7A 1NZBA 2F1HA 5DB6A 4B3SL 2B63B 1KXLA 5BR8Q 1TWHB 4BJQA 4PMBA 3MR6A 5CGKA 2WAQC 1WD1A 2E2JB 4FF2A 5CMDA 1PRTD 2JXMB 3E0FA 1N63A 4CCHA 3A0BU 3KLSA 5H1SE 3CPWA 1A63A 4F4YA 2QB0A 4YQWA 3CCUA 2O6KA 4DR2L 4YD2A 2H1EA 4JOIA 5KEEA 1PH7A 1MSWD 4E0DA 1E7ZA 5J2HA 2GLEA 3RR7A 1ET9A 1G291 5C3WA 5C4XB 2RSOA 4BBRG 4JV0A 5KG7A 3KBGA 2HHHQ 2UUAL 1JORA 3T4AC 3V05A 3MTSA 4ECTA 2TSSA 2FMCA 2DGYA 5IP7G 3A0JA 4A3EB 1HNZQ 1UE5A 2EAMA 2XGTA 1XO0A 1Y1WH 1LTLA 3LWUA 4IL6U 1LT4D 1J9OA 3NTHA 3C1YA 5HHHA 1NK4A 1JICA 5M3FB 3HJEA 2RHQB 2XN9C 2F4IA 2KEYA 3P7JA 4KK7A 4J03A 1G91A 5J2IA 1KL9A 2LYHA 2K5QA 2ZIVB 3IN5A 5DLGA 4O42A 1SL1A 1WI5A 1E2WA 2BQUA 3TN2A 7ICTA 4RGTA 3HP6A 5LMNL 4X3SA 4NMZA 3JAME 5KG4A 3KHLA 2I5MX 3I2ZA 4DV7Q 2Y1IA 2NWGA 3JAMi 4IFDJ 3DEEA 4J9NA 3VR4A 1VQNA 1L8LA 1V38A 2V4QA 2R8KA 3S1NH 2LY7A 1A15A 1X54A 2RRDA 4TQSA 1JXEA 1HQMC 1M8AA 2B2UA 1BNPA 1UE1A 4B3MQ 5FO9B 9ICCA 2JA8H 4ELTA 1MBYA 3L4PA 3H94A 4BY1B 2AQ4A 2NVQB 3KOOA 1ZJNA 1M90C 2FPMA 4BWJA 1BBUA 1F9QA 2VIXA 4RPXA 2L55A 2Z0SA 5G5HA 1KIXA 1JOKA 4DAYA 2L1BA 4JI6L 3KD3A 1NR4A 1NI3A 3T5HA 1PA6A 5CORA 4OCZA 2PQEA 4K5XA 2ATWA 2YN4A 3S2DH 1MSHA 3IM1A 4IQUA 1E2VA 5M5WB 2UU9L 4PH5A 4ED8A 2F0JA 8ICYA 4KY5A 2IX1A 4RCNA 3ER0A 4BS9A 4GXIA 1Z3EB 5DGBA 1PVQA 2MSNA 4QJFB 5M3MH 2C9OA 4C56C 1IBMQ 2YYZA 2BHNA 3E58A 4PJ0U 4DL5A 4NLBA 1EQTA 3EJIA 1KKXA 2B8FA 1DXSA 5KG5A 1XNSA 2CPRA 2W8KA 4IR1A 1IBML 2PZTA 3TKAA 4RNMA 3GTQB 1E3PA 2BPCA 4GS3A 4DQRA 1W3SA 4OO1G 5AKZA 1SROA 2KOLA 1EEID 5LMUQ 1ZD5A 4B9LA 1C9OA 3GTJB 2CW0C 1XXGA 3VR5A 3NUQA 3AB9A 4RQ4A 3HOXG 1JI7A 2I6XA 4ECVA 1F9SA 5DQHA 1B3AA 4QJFA 4DL7A 5AKXA 4X3TA 4JI1L 2F0UA 4DSKA 1AE2A 2ATLA 4L5SA 3FC4A 5GAEC 2F8LA 1PH6A 3BDCA 5IIMA 4LF9Q 2F0FA 4CBVA 3HOXB 4I65A 1WD0A 1QVCA 1X9MA 2WB1C 4C3HB 4KLQA 1IG6A 2E8PA 4UB6U 4A8EA 1ZQEA 1D8BA 4NLCA 4JMUA 1D5XC 2J6UA 2NZHA 2ZXHA 2PI2A 3TFSA 1XC9A 1WCNA 2K4PA 1FGUA 3I4LA 4DUZQ 2EJMA 1KLUD 2QKIC 2KUMA 2A5HA 4GC6A 3LWEA 1L3UA 3H15A 2JA6B 2R92B 5KFKA 1S0NA 1SKWA 2D5DA 5J2EA 4JG2A 5E79U 3K80C 1B3QA 3S17B 5KFFA 2KBNA 1I50H 2PW7A 2JMGA 4OEMB 3TRZA 2XWJB 1A2TA 2EY5A 1S5FD 1Y69U 1NK6A 3NRZA 5M9OA 2QGQA 2LMCB 3K7AB 1X40A 2QARB 3NGDA 1L3TA 1H9RA 4H44C 2RBMA 1EZ6A 5EPLA 5A0LA 2BGWA 3Q8SB 2VA2A 3CRXA 3ZJYC 2FPLA 3GQCA 1ZQJA 4UP8A 1CI4A 3S1NB 1BO0A 3TBIB 2UVVA 3OSNA 2OQKA 3K5MA 2RVLA 4OL7A 5E4XA 4JV5Q 4G3IA 1TQOA 1NBWA 4ZOHC 1XNQL 2BPFA 5ELCA 2HBMA 1WTQA 5KT3A 4JI8Q 4F87A 3I56A 3H09A 3QUCA 2JA7B 4RQ2A 1T3NA 2Q8RE 2JA8G 2KQ3A 2NN6H 4UATA 4IUQA 3UE0A 4ECQA 5FOBB 3CC7A 4DV6L 4FS2A 2B29A 1PFBA 2AWNA 4FXDA 2W8LA 4LAAA 2A1JB 1LTGD 7ICIA 5HNKA 3AEVA 1YVCA 2XGQA 3AFQA 2ODGA 1IBLL 2Y1JA 1LT6D 3NUCA 4HJ5A 2LBOA 4QZ8A 2NV3A 4JI8L 3ETRA 1T8EA 1B4FA 5K4LA 3SENA 1BCPD 2M0NA 2Q0ZX 5I4DA 1YHAA 3RD4A 2LS01 2MHVA 3Q22A 2QA4A 5DKWA 3H0GH 1X3FA 4QNLA 5AI4A 3NELA 5I2XA 4C7ZA 7ICSA 4OO1I 3H0GG 4IQVA 4A3LG 4JI6Q 5EE0A 1DZ1A 2EYOA 4TKOB 4JV2A 3OMGA 1HR0W 1OXXK 1LACA 1H95A 4NL9C 1SV4A 4OJPA 1VQ5A 2RQ5A 2N8NA 3GDXA 5G5GA 1DGJA 3HW8A 4PMCA 2Q2TA 4IQTA 1PVPA 3IG8A 3BVMA 1HFGA 4DUYL 4FVMA 2NN6G 4DR3L 4DKAC 5JPNC 5KFHA 2QDLA 4A3MB 3BZKA 1BPYA 5AM4A 1W6JA 1QJOA 4C3IG 1HNXL 2UXCQ 2BKEA 5FP0A 1T5EA 2V4RA 3G6XA 2XY6A 4JI1Q 4DUZL 2R92H 3MGIA 2PI2E 1Q8KA 2X6LA 1AW7A 1AQ6A 2XC9A 3CXCA 4MHVA 1UE7A 4G57A 2F76X 3HWTA 5EKKA 4DL3A 3K81C 1CKNB 1JOOA 1X3PA 2AGPA 3DWQA 3VR2A 2A69D 1ZYQA 2W9CB 1XMQL 1C8CA 4JYAL 3PW7A 1EY7A 1BF4A 4PZ7A 1RTOA 1K1QA 3W5OA 3I72A 2QCPX 2VW9A 3HOWH 1VJ5A 4DQPA 3QG1A 3HOVH 3BQ0A 1AE3A 2A3VA 2CQAA 1K3RA 3CCQA 1SKRA 1EY8A 4LF8Q 2EANA 1TY0A 3QU9A 2WAQG 4JWNA 4M6WB 4DV4Q 1GUSA 5C6AA 1Y1VH 5L1JA 1O78A 2K5NA 3WK4A 3QZ8A 3TP7A 5EPKA 3MXNA 2XCAA 1MD2D 2EXZA 1X56A 5IT9L 3GP7A 5BN4A 5E1FA 3I76A 5J3BA 4HAIA 1TAMA 5EWEA 1UQVA 1I4PA 2IL8A 4X66L 1BQQT 3DM3A 5KGUA 2G07A 1V1QA 3L3OC 1BNOA 3NE5B 4HCEA 4PGYA 1O7LA 4IUNA 2PYKA 2OCEA 5CV9A 4DNRB 3HILA 2IX0A 1K28A 3EPGA 5KFXA 3EN2A 2XRQD 3S2DB 4P2HA 4DSEA 1GHJA 2GH1A 5ALYA 2FMPA 4R4QA 4G7HC 1K8OA 4YCVA 2HBLA 1ED1A 4DEZA 1NCVA 2UU9Q 4KN4C 1QNUA 4C2MH 1HZ9A 1I50B 4HN7A 3TAQA 2W3SA 4LZDA 1FIQA 4F5OA 2XTIA 4DV7L 1TKDA 2F0OA 3D6JA 3ORYA 1VQMA 4IPHA 2R92G 3RLFA 3QO2A 4XYQA 3CCJA 4QB4A 3Q8PB 2H5XA 4RT2A 1D5ZC 2B63H 1XX8A 2KVCA 2EY1A 5KYIA 2DPJA 1EY4A 2MFIA 3MEHA 1PH9A 2G9DA 2K5DA 3SVMA 1O08A 4BBSG 3C21A 5KFMA 2CH4A 5HGTA 1ZQ1C 1GHKA 4AYBB 4M47A 3GD7A 1SRUA 2JP1A 2BE5C 3GTKH 2UXDL 1TWAB 4OHJA 1WUDA 1CKOA 3LVVA 3NBHB 4RAUC 2YTVA 3MDAA 4DV2Q 2ZJQA 1T9HA 3PO3B 3ETLA 1A6SA 1WFQA 5J0RA 1DXMA 1UEBA 3DHQA 4RH6A 2YB1A 3T13A 3GTGH 7ICUA 1JE5A 2J7ZA 1GUTA 3JPSA 1KLNA 4HIDA 2F52A 4EZ6A 1VQJA 3VYTA 4B9SA 1KNEA 3V96A 1DK3A 3SQIA 1QG7A 1NNLA 5JEAH 4JI0L 1U4LA 4ODGA 9ICVA 2OM6A 4TQRA 3N97B 1ML0D 4RT3A 3AMZA 4OWWB 1VCIA 1ZQXA 1NMFA 4DK0A 4HSVA 2ESEA 1CQVA 2Z6BA 4N8X1 4ED3A 2AQ1B 4TURA 3ICEA 3S1RB 3B9JA 1D1IA 5IOCA 3J80E 3QWNA 1FFVA 5KFDA 4HTHA 3KZIU 4RU9A 2A8VA 3WK9A 1P8LA 1V1OA 2N78A 5LHY1 4DV3L 1HNZL 3BU2A 4UAWA 2R8JA 1Q8IA 5C0XJ 4TUPA 4Y2QA 4DLGA 4QUFA 2NVTH 1LT3D 4DL4A 3ND9A 1BPZA 1S0MA 9ICKA 1TWGB 5T14A 1X9SA 4NKLA 4A3DB 2Y0SC 4YCXA 4RQ8A 2HD3A 5FLMG 2G08A 2HHHL 3GTMB 1WTPA 1NMGA 5IINA 5B5EU 4PMWA 3EW9A 3B0YA 3PQIA 2KKPA 1TWAH 2F0DA 3O13A 5JUMA 4KTAA 1GJXA 3K8AA 3JC66 3NP8A 4JOIC 2WAQB 1ZQZA 1S8OA 4US8A 2VUMG 2NRTA 1B1ZA 3K5NA 3HKSA 4KLMA 2RSNA 2EYHA 4YR3A 4C4TA 2JHDA 3WWVA 3TFRA 2E74C 2NYZD 3EWAA 3H6MA 4DGZA 2QB1A 4DWIA 2WB1G 2HBJA 1O7IA 1OW5A 2Q8IB 9ICNA 2CQOA 1SN8A 1VQDA 2Z8LA 4HYKA 2B8GA 1A3UA 4F4KA 3H0RB 2B2VA 1VMCA 4BY7G 3T5JA 3PR5B 3KK7A 1OO9B 1HR0L 4KX5A 1X6JA 5CBAE 3CQZB 3MZ5A 1N9WA 4KY7A 2EYFA 4YCUA 8ICLA 1EQVA 2ZJAA 1YZ7A 1VDVA 9ICIA 3T5KA 4RMFA 4YMOA 3EPIA 4AIMA 3KBBA 1D8LA 4I2IA 3J81c 3SAFA 3S17H 5AKYA 3HKZC 3H7IA 3F2BA 3SZ2A 2BCRA 4K4HA 3E2EA 3DM1A 3JAML 1GO3E 2KSOB 4BXOB 2BCQA 2DN8A 5M5XB 2W03A 3RZOB 4DR4L 9ICEA 1C4QA 5AI5A 2RDIA 2NB0A 3K7UC 5F9NA 2BA1A 3SDZA 1X9XA 3ZDBA 4TUSA 1NKCA 4ZAIA 3TP6A 3E6ZX 4LF8L 4XQQA 3AFPA 1EL0A 4CKEA 4RPZA 2ES2A 5DLQE 1X66A 4IZ8A 2XI9A 2DKXA 3R9KA 3HGBA 3KF8A 3MDCA 4ZKBB 5AKEA 4EX6A 2WF6A 2YMLA 3PO2G 4RQ0A 3KUPA 1SYGA 5BN3A 2R7ZB 1ZQWA 2JA6G 4USAA 5M5YH 1ZQTA 1BUVT 5EE3A 4MFFA 5I2YA 4J9OA 4BBRB 4F7XA 5KG2A 2L11A 4PZ8A 2G5IB 4B3RL 1PH3A 3WK5A 1WTWA 3VYSA 4DFKA 4DQQA 1IZ6A 2LM1A 2Y0SB 5KFWA 7ICQA 3E0EA 8ICEA 3ZD9A 4M9GA 1SSOA 3MVVA 3PIOA 3NRWA 1RXWA 5J1ZA 3M8RA 4XXEA 2CH4W 5AFWA 4KX3A 2E2DC 2C5CA 3HG9A 4P71A 3HOYH 1M6YA 3N7PD 4JI5L 3DUZA 1ZQKA 4JBMA 1IV8A 3RRHA 1K83B 4JI3Q 5IIIA 5AM1A 2E8NA 4GIBA 4A3GG 2K4HA 1ZJMA 4RQMA 5DQGA 5CHGA 5IYCH 2K8CB 5T1IA 2NO5A 1PK3A 2F0MA 3RLOA 4EBCA 3HOZH 3QOLA 7ICOA 2E5LL 7ICPA 2BQ3A 1IM4A 4H13C 4DNIA 1J8IA 5J0UA 9ICGA 1G6PA 4DK3C 5KNIA 1N8RC 3I3CA 2VUMB 2F1JA 2E2IB 2PZWA 4K5WA 1JALA 4OJOA 2F0TA 3BVGA 3BZCA 5KFQA 3H4DA 3JPRA 8ICOA 2JV3A 5AKHA 1JR0D 4UAYA 1BGXT 1T94A 3PW5A 1ZQQA 1B9MA 4APVA 1Z1VA 1BCPF 4LJZC 5IP7H 4PZ6A 4FZMA 1BPDA 4GNXA 1ZETA 2HHWA 1LTTD 1N32L 3K57A 2W04A 4ECWA 2F0LA 7ICRA 1J2MA 5KFEA 2L4NA 3S6JA 2HHVA 4LF6Q 2EYJA 3PUZA 5KFOA 1PTOH 3SAGA 4JV5L 1XPRA 1BPEA 5AHXA 4JK1C 3EIVA 4C8LA 1ZD3A 3X3MA 1EY5A 3RJFA 4A3JB 2YMQA 1TWGH 1RCVD 3KJPA 2K8AA 3M4OH 4IALA 5AKJA 1TWFB 2JA9A 9ICAA 1H9MA 3NASA 3JPNA 1D1KA 3WKDA 3DDHA 4X3UA 3A8IE 2AKWB 4TUQA 1YJ9A 3K5LA 4HAEA 3PNCA 2C35B 2ICEC 3TP5A 2UXCL 3QOJA 1ZQGA 4WJ3M 3H3VC 3GV8B 4DR1Q 4JI7L 1FD7D 2R61A 4MZ9A 1HTLD 3I91A 4NXZA 3SD7A 5KFIA 3M6KA 2HW3A 2ALZA 1STYA 4DUYQ 1L3SA 4NLKA 1YNJD 2PMZE 2KVSA 2K7VA 4UW9A 3RZDH 4JI4L 4E6IA 8ICPA 4MFCA 3F8TA 1JJ2A 4RGOS 2ISPA 2ZIWA 5D4BA 4YIJA 4Y2JA 3F2CA 1XO1A 2G06A 5KT7A 5CC4A 3HKZF 2XO7A 1T7PA 1DK2A 3G7LA 4O5KA 1R4PB 5B66U 3NWSA 1SYCA 1TFRA 5CV7A 2JA5G 1KHIA 1LKYB 3SK8A 3QUBA 4UB2A 3MGHA 1C48A 4KN7C 4C3JH 3J7ZC 1GD7A 2JYOA 1S97A 3KDFA 5EE9A 4OELB 3J7A5 2JE6I 3IV6A 2PQAB 4K0KQ 3PX4A 1G6ZA 2E1FA 2FE9A 3N4MB 3MHBA 3GV7B 4KLOA 2VL6A 4R8IA 1S77D 3T1HQ 4FFDA 3ZDEA 4YD1A 5DG8A 1E0BA 1Y8PB 4PG3A 3PIP3 4RHSA 8ICNA 1STEA 4KLGA 4AH6A 2JH7A 1SYBA 5IWAL 5C3EH 1SLJA 1L7PA 5C4JH 4QZIA 2ASJA 3HOUB 2VQFL 4QY7A 2D2CC 1CQFA 1S72A 4Y2UA 2YU9B 2WF9A 1SIJA 2E76C 2YTYA 3NK9A 5IIKA 2F4VQ 4G7OC 1KBUA 4RQ1A 1XNQQ 1ASZA 4RG1A 5C4XG 4I2DA 1WTXA 4HIKA 2L0CA 3TS0A 3SYZA 8ICKA 3LDAA 4NP5A 5IT9c 5J0PA 2R7DA 1TIID 4Q5VA 5FKAC 4UAVA 3R3OA 1FEZA 5DNFA 5IGEA 5ALDA 1C20A 3RNUA 2FMSA 2I5LX 4IO9A 2KG5A 2ZJ8A 2BZFA 5KNCA 4A3EG 2JEBI 1L8OA 4C8KA 5EBCA 4NDXA 1QTMA 4QGUA 3OW7A 1EY0A 1GUWA 3H0MB 4C7YA 5EPJA 5DDMA 5KFBA 2ALYB 5DAUA 1VQ8A 2K8BB 1S10A 2LI6A 2KCCA 2Y0SG 3S1QH 1RYRA 4N9PA 3AM9A 7ICEA 7ICHA 1YBYA 1RQLA 4JK1A 4DF8A 4I29A 1SNPA 1Q90A 2KMDA 2NRZA 1PYSB 1VDZA 4QF4A 4GLAC 4YXJA 3SV3A 4A3CG 4EX7A 1Y1VB 2M9VA 2EZVA 1YNXA 2NVQH 4IS7A 4CNQA 1XSPA 4ZUJA 4DFJA 3TARA 2BCSA 3G48A 3UI2A 4JBKA 3C1EA 4UP9A 4C3HH 3PR4A 1COOA 2B39A 2I0QA 3QEBZ 4V0BA 5HR7A 1JCKB 1EIFA 3LWLA 4J9MA 4HSPA 4RGMA 2NBFA 1HA6A 5C5JA 1PZJD 3T1HL 4BX9C 1X6OA 2KFZA 2KFNA 3VDYA 1I6VC 3DWPA 1HUNA 1TS2A 4A3CH 1AP0A 1I4XA 3ERSX 1TE2A 2W9MA 1MQ2A 3HX0A 2BCOA 4DPGA 4A76A 2B2YA 2MO1A 3A5UA 1MSGA 4DR7Q 5C5MA 3OHAA 2HHXA 2K4IA 1VMPA 2DY7A 4OWTB 2RCFA 4Y7NH 2NVTB 1A62A 1RODA 5EGTA 3KHGA 3G6YA 2C22A 2J6SA 4WJWA 3Q8MA 1KSPA 1VQ9A 4BXXH 3HKZG 5IYBH 5ELFA 3GTMH 5TZVA 5CRXA 3MGVA 2HHUA 1SWWA 1EQRA 1STNA 3RH6A 4RKBA 1MI2A 2EZZA 1U5KA 1RXVA 4I7ZC 1NKEA 4K4IA 2WF8A 4LF7L 4KLSA 2AQ3B 3QEAZ 4NM1A 2O2LD 4HR7B 2A73B 4JI3L 1B0XA 1NOMA 3T16A 5KG0A 3PF5A 1N48A 3N7RC 2OXOA 1OXUA 4B9VA 1FGBD 4ZYSA 3K1RB 3HRDD 4R8UB 4OONA 1QH9A 2KE7A 5DBAA 2E5LQ 3NVWA 4L5TA 1B7YB 2CFMA 5ELEA 1PLFA 4ABNA 2UVRA 5KFZA 2ZG6A 3BS7A 4DR5Q 1JMSA 2IHEA 2IPKD 1Z9FA 5KFAA 4FXGC 4BY7B 2EIFA 3VA5A 5J0YA 5GQOA 3LGJA 2D62A 4P0PB 2ZUDA 1WYGA 1XTCD 9ICOA 4YN4A 3SK5A 5FLXL 1ENCA 5JEAG 3K58A 4UDUC 1KDAA 4KMUA 3CC4A 3QXGA 2PNRC 1U45A 1TT2A 2W54A 3Q8RB 1EWHA 5KFUA 4CGYB 2ZTDA 3PUWA 3TREA 4I2FA 2F0HA 3QJYA 4YHHL 3ISCA 1N32Q 5AM2A 2PPBC 5C44H 1L1OA 5EKIA 4PGXA 1MIUA 1YEZA 1KQSA 1B70B 4OX9Q 1S76D 1F0MA 3UM9A 1N36Q 3ULJA 2VKQA 2B2UC 2K60A 4RQ7A 3FAHA 2SEBD 4M8AA 2KIVA 1LO5D 1HHVA 2KECA 1A77A 3C29A 1DONA 5LMNQ 2DF4B 1H9KA 1AZPA 1EZ8A 3PX6A 4CF3A 4P73A 4FF1A 4R4TA 4J9QA 5D14A 3AYHB 1E24A 2QEXA 9ICRA 2NZ1D 2ZJRA 2HCCA 2IHFA 3TMEA 4P74A 3CHBD 2K6AA 1A76A 4RWSC 4F93B 1F5SA 1DCZA 4KLKA 3H3VI 2YTUA 3H4BA 4DSJA 3F5AA 1R4QB 4DXGA 2D6FC 1Q3UA 1QVFA 4NPSA 1NJIC 1VQGA 3OWFA 4FO2A 1KFTA 5DG7A 1RYUA 4PPXA 4X6AH 3GO5A 2IOHA 3ERQA 5EQ0A 3GV6A 2WFAA 4IFDI 4ED1A 3MFIA 1PYBA 3TZDA 3SV4A 3M4PA 4BA1I 4DAPA 1PK1A 4PZOA 1ZQFA 5CP2A 2NUCA 3RJJA 1Z47A 5ALEA 4QIWE 3CNHA 2PO4A 3BQ1A 1SAPA 4I28A 4A75A 3V7LA 3UQ2A 1IIPA 2E1EA 1TWFH 3RLNA 1PRTF 2R8HA 4RQ3A 5ALKA 3NVZA 2ZIUA 1ZQDA 4ID6A 1HNWQ 1TVXA 5KG6A 2A6EC 1IKLA 4J9KA 1I4HA 4LMQD 2AXTU 2ZJ5A 1RHPA 1SJED 5C4ZA 4YWLA 2NTTA 3CCRA 4R4OA 5C4HA 4M9JA 3PO2B 2DPIA 3GIJA 1YNNC 3SEBA 1I94L 3UXNA 2L5TA 1CKNA 1VQPA 3I4NG 4FYDA 2EH9A 4I2HA 4OXPA 4XIGS 3BQ2A 7ICGA 4ECRA 3AQQA 3CCLA 2VS1A 1YZ6A 3UDGA 4OJ6A 2SNMA 4F2RA 5L1MA 3QNMA 1VQHA 2Q8TA 4C3IB 5HMMA 1F2YA 4RGNA 4UB8U 4A93B 2R93G 1CEZA 3KKAC 2IWHA 2MO0A 4RUAA 1QE6A 1UEAB 4DV0Q 5G3LD 2UUCL 5J29A 4S3SA 4Y52H 1EY6A 4C3IH 2QW7A 1RDPD 5AIAA 1HUOA 4CJ1B 4A3FG 4QWEA 3QE9Y 3BYTB 8ICRA 1GVPA 1Q1EA 1SDFA 1GO3F 1L1OC 1MJEA 2E2JH 4C8OA 3B6YA 2JA8B 1IL2A 2FLLA 1Q3VA 4DF4A 2R18A 3T56B 4EGVA 2EY2A 2K04A 2EYPA 1Q46A 4HJ9A 1ZQCA 1JX4A 4A4IA 1N36L 2B0CA 2K50A 5K36G 3NTIA 2JA5H 1VQ6A 3I28A 1DOMA 3A55A 2DFLA 5CEHA 5CR3A 1YJNA 1U9RA 4XQNA 3GTLB 3P75A 1Y14B 1QOHA 3UXPA 1HA5A 2AU0A 3PSIA 1P7DA 2F8KA 3FKIB 3MR2A 4A3KG 2FDRA 5KAFU 2NRVA 1N61A 4DSLA 1H9JA 5F3XB 1Q12A 1X3GA 3ZI4A 1I94Q 1HPCA 3PSPA 4QWDA 4MNOA 3RH5A 4V190 1TXYA 1IYUA 8ICQA 4KKTA 4KLHA 3UE1A 4NXNL 4L63B 5JEAJ 3NBHA 1G2TA 2E5SA 1S4ZA 3EROA 5M3MB 5KFLA 5C4XH 4NL9A 1K83H 2MNAA 1X9NA 1TAUA 1IW7C 4G4KA 4DV5L 1KAAA 1TWHH 2YMMA 2I46A 3L0OA 2PFQA 2LMRA 4F71A 1SE2A 1CTMA 4EQNA 4KI0A 3M9MB 4RQ6A 1DOLA 5C0YA 2DGZA 2K28A 2AGOA 4PL1A 5BPCA 4KLTA 1K9MC 3KOJA 3OJUA 2VA3A 4LFBL 1SBBB 1EIYB 4PL2A 1KDHA 1SGGA 3EVQA 2F4VL 4LUVA 3M6ZA 4NWIA 4DK6C 4JUZA 5J2KA 1UE6A 8ICIA 1EIGA 1PFSA 2EQSA 2YMPA 1K8AC 4Q8EA 4J9LA 5E4WC 3IFTA 3PO3G 4O1NA 3CU7A 2P66A 3OHXC 5I6WA 4F88A 4DSFA 3U9SA 2F77X 4CDCC 5IP9G 3EUB2 5C0XG 1N62A 2BQRA 1HEKA 4P75A 4O0IA 2D0PA 1WCMH 2A19A 3RB6A 2KZZA 4K0KL 5AI8A 3D2SA 1ESFA 5AM0A 4PHEA 4GN4B 1VQLA 1K8GA 4UHVA 2C28A 3PV8A 5FLMH 2NYVA 2NVXH 4BWGB 5DM63 4WORA 5CR0A 1L0YB 1PXUA 3UPQA 4QZEA 2KCNA 4KHPQ 5EWFA 3T1YL 4PHDA 3HS0C 4YMMA 1LM0A 4UBBA 3T79A 1LTSD 1VQBA 2KKVA 1D9FA 2Y0SE 3UDFA 4DV2L 1TKWB 1D7QA 1U4MA 4X62L 2IOFA 2LKVA 2IHNA 1ET6A 2AWOA 1NAPA 2JH1A 3UQ0A 5M3FG 4F50A 3L9AX 4HMJA 4MHEA 1IYJB 3W3AA 2Y9TA 3PUVA 5KRUA 3AU2A 1F9PA 3OIQA 4ICAA 1EIHA 5H2FU 1NZPA 1Z6HA 4AYBE 2EZXA 2BCUA 4P2CB 3ED5A 2GOLA 5FK9C 5HY6A 1FJGQ 2XY5A 4KHPL 5KFPA 2BR0A 3M8SA 2IHMA 1O7ZA 3CRKC 2RLTA 2EJFC 4ZLTF 4IUTA 4KD3A 1E22A 3O0FA 4IJLA 2Q2UA 4A93H 3SXHA 2LPEA 5L9XA 2RCNA 2HT1A 4GN5A 4B3TL 2GN5A 1JIHA 1S0VA 5EJWA 1FO4A 1ASYA 3SGIA 4AYBG 2VQEQ 4O3NA 1YHBA 7ICJA 1SNOA 1RIPA 2ZTEA 2KJ9A 5KIXA 5KNDA 2YX8A 5JOBA 3KFUA 2K14A 1PUZA 4Y2PA 2PW5A 1U4PA 4LFAL 4GN3B 2VQFQ 4HIMA 3PMLA 3G4SA 5ALOA 4A3KB 4EBDA 3KLRA 4UB5A 8ICGA 1DM0B 4Y2SA 1LLRD 1I3QB 3I73A 3R2TA 1X6IA 3E3XA 1N2XA 1K5OA 1XWLA 1XPOA 2WFWA 5L37A 3W1GA 3T3FA 1SYFA 2BCVA 3MABA 3ONAB 3GTKB 2I07B 1NJZA 2JQOA 3RBEA 2RDGA 4PHPA 1BR9A 3FHWA 1LTAD 3G6JB 3P1HA 4UAUA 3K6OA 4J8QA 3C2LA 3OHBA 3GTPH 3W1BA 5J2AA 2K4EA 4LW1A 2JJQA 4NLNA 4KV6A 5KFJA 5IILA 2H3IA 3PCOB 4RHRA 1L3VA 4P0PA 5IY0A 1I4RA 5FLXc 4ZK9B 1SNCA 4Y2YA 3BDPA 2K89A 2FINB 1KDBA 5KT4A 5DG9A 1NNXA 1XYIA 4NM2A 1ZQUA 2HHQA 2AMCB 4EELA 2I9GA 3NVVA 4DCCA 4MEXA 3FMCA 1Q82C 4JCVE 2L5YA 1VF5C 4EQ5A 1XPUA 1GOZA 1NR2A 2HCFA 4IRKA 2HUGA 2P6RA 2Z6KA 4ACOA 1JWUD 1OXVA 3THVA 1ZD2P 4H02A 5C3EG 3H0GB 3RZOH 2DJGC 1NK0A 1E1OA 3C2PA 2WAQF 2QDBA 1ICFB 2Z1CA 1YIJA 3J81i 4JV1A 4FZNA 3M7GA 3NHHA 3F5EA 3H8JA 4QZHA 3N28A 4KTQA 3ICXA 1HUZA 3AU7A 5D46A 3C2MA 1Z1BA 1ZQNA 1N33Q 4QUCA 1GUOA 1KTKA 3U26A 3RBDA 3S15B 5C5LA 4X62Q 2JA7H 1MKHA 2JEIA 1S5DD 1ZQPA 3AQFA 2Z4IA 2QARA 1CA5A 4PNYA 1BKBA 4NB3A 1PYWD 1S0OA 3V6HA 4OWXB 5CWRA 3S15H 4MTNA 4JPBW 3KBXA 1DD2A 1PHJA 2E8MA 2E8OA 3F2DA 3B0XA 4I2BA 2L12A 4IRDA 1SE4A 3N7SC 3OJSA 1RTNA 4TSSA 1JC7A 1L7NA 3GTLH 1JWMD 3IG5A 2LFNA 3RMHA 2P5ZX 1PK1B 1NKBA 4YVZA 1L0WA 5AK3A 1U48A 3BYYB 5M5WH 1JQYD 5KFGA 2PXIA 2J6TA 4B9XA 5C44G 2A74C 3JPQA 3C23A 1O03A 5D49A 4PGQA 8ICTA 1BBXC 4DLEA 4EBEA 1HRJA 2AUJD 4IPDA 2IW3A 2Y9UA 3KF6B 4J9RA 8ICMA 4ME5A 3J80L 1FJGL 4UBCA 4EQOA 5LL6S 5JJKA 3HEJA 1PH5A 1EWCA 5ELDA 4QQBX 4ZCKA 4UAZA 2SDFA 1PH8A 4R4CA 2O5JC 1CFMA 3HOUG 1NE3A 2O4XA 2TMPA 3ZDCA 1K3BC 3KLWA 5ALPA 4B9TA 4WJ3B 1SMXA 2CVRA 4TVAB 1BCPB 3HOUH 2Z4HA 5KG1A 3UXOA 1S3OA 1B50A 4CKBA 2A1JA 1Z00B 4NXNQ 3F1ZA 4C1NI 3AL0B 2EOTA 4RFBA 4PV1C 3BZDB 3ZYYX 3ZDDA 3PGZA 9ICXA 5DDYA 4EYHB 3TANA 3FKIH 4Z6FA 3QUTA 5AI9A 4CHTB 4HJAA 3HOWB 5AM3A 1YNND 1QQ7A 1RF2D 2NRXA 1HFNA 4JC0A 2E8GA 4LF4Q 1DJRD 4BBSH 2WF7A 3DEOA 4Q44A 4NY8A 2EY6A 4DR4Q 1V97A 2KHIA 4L6TB 4KLUA 1QZGA 3QZ7A 3CCMA 4Y2TA 9ICFA 3NENA 5J0WA 4ELVA 3Q8DA 2XNAC 1B44D 2F1IA 2KOBA 2MUYA 1QWYA 5A35A 4A3BG 3J81j 1LB2B 2WAQE 4A3GH 1E2ZA 3MBYA 2NVYB 4ED2A 2JZBA 2F3WA 2HQEA 3I4MG 2HOQA 1KQQA 4FBTA 2Y0SF 1EYAA 4F8MA 4KLFA 2V4DA 3FP9A 3S1QB 1KEJA 4CDDC 3GIKA 2MU2A 1TS3A 1HXYD 3HOZB 2PQAA 1Q86C 2OHFA 5DGAA 1QB5D 2SOBA 3TSSA 2ZXIA 2MA1A 2JR5A 5C0XI 3EFXD 4IFDH 2BDPA 1ZRNA 1EYCA 4JI0Q 4Y2VA 4UB1A 4R63A 3BQ7A 1FYCA 4QWCA 3IL8A 5AK4A 4FS1A 2F3IA 1WJJA 1BPXA 4CDEC 5J2CA 4US9A 2E3TA 1T4GA 3IRUA 1TS4A 1S5BD 1HNWL 1SB3C 4O3PA 1WOCA 3E0JA 4RNNA 1WCMG 3PF4A 2LXJA 3TQ1A 3JPOA 2ZXOA 4XUSA 4YP3A 9ICUA 2OTJA 2HOIA 2I1QA 2CWAA 4K8JA 2LHTA 4ECSA 2F2AB 1HUMA 3OIPA 4B9WA 1CK1A 2KD1A 1KN5A 1V1PA 1WCMB 4OIKA 5ALIA 2WB1F 4O3OA 1J6QA 2EJGC 1B9NA 3H8WA 2KHSA 3Q0AA 4QWAA 2XY7A 3ONNA 1IBKL 2XGPA 3RTVA 1B4OA 3HOVB 1MC8A 3RJHA 1W2BA 2WIIB 3CPFA 2WB1E 4K6LA 2UXBQ 4LWCA 1L2FA 3FPUB 2ASDA 1EOVA 1L1OB 3CMAA 1YITA 3AN1A 2DUDA 3CMEA 5IYDH 9ICWA 4UB3A 1CSQA 1STBA 4H7BA 4M04A 4Z9CB 5KTQA 1A6XA 1PMRA 2AH5A 2YB4A 3CW2C 4LFCL 4BY7H 2R7FA 5JJZA 2FMMA 3FVQA 5AJ3Q 4GKJL 4FP5D 4X66Q 4DR2Q 4AQYL 7ICFA 4RZRA 2FLPA 1X9WA 4RA8A 2JEAI 3FPPA 5FJ8G 4AQYQ 2O5IC 9ICSA 1VS0A 2ES6A 3WKBA 3TAPA 1EU3A 4KN4A 4F8RA 2K05A 4JVZA 2EDGA 4AYBC 3IKJA 1CKMA 1K0SA 1F44A 3G6EA 5IGDA 4F5PA 1SE8A 3TACB 1TWCB 3S1RH 2NVXB 4ELUA 2LKYA 1DYQA 2L15A 2DJFC 4YHHQ 5IIFA 3C5FA 2KCMA 4U6PA 3AQEA 1Z7TA 3G6VA 1TK8A 2KCTA 2ASLA 2W9BA 1MJCA 1JB3A 4MEYA 1EQQA 7ICMA 2F0EA 2MJ8A 4LUOA 4F92B 2AQ2B 3JPPA 1VLBA 5E3FA 2ZJPA 3RN5A 2UXDQ 3D4RA 1HR0Q 2QB0B 1UUPA 8ICXA 2R93B 5KL1B 2AQ0A 2ENBA 3KFUF 3GTOB 1CHPD 3AU6A 7ICNA 9ICHA 2RDFA 2KHJA 1D6EC 3MWYW 2PFOA 2P35A 8ICUA 2LSSA 1L7OA 2GA4B 3SHLA 1PH1A 3SR6A 2OYYA 2WKDA 5ALMA 1XTDA 2JGAA 4C1NK 2R7ZG 5JJIA 2XVTA 4L8JA 4I7AA 5KNBA 1LUZA 1KAWA 2K03A 5I9PA 2OWOA 4YR2A 4A3IG 4LF7Q 3JAMc 1AN8A 4DU9A 3RRGA 5G3LF 4M6WA 3BS5B 3I4NB 2XRSD 2VZAA 3U9OA 4PZNA 3WOFA 1F77A 3K4GA 1FNVA 3K7AH 3BQTA 3I90A 2D3DA 2CRXA 4F2SA 4EYIB 1ZQBA 1KRTA 2CXYA 1J5EQ 4IOAA 4DA2A 2WHEA 4IURA 4B9UA 4RQ5A 1SNMA 4DXFA 1FNWA 4DR7L 3QU2A 3H40A 2WB1B 1JT8A 3LVWA 5J0XA 4KLJA 2E2HB 4RQNA 5FO8B 4OGQC 1LV5A 3ZDAA 3QU4A 1RYSA 2ZM6Q 4OO1H 3U4VA 4DV4L 4Z6CA 4YY3Q 1AEXA 3CCSA 3K1ZA 2K5HA 3I4MB 1CRXA 3SAHA 2PMZB 3J81L 1QSSA 1BOSA 2KSOA 1T5XD 1L5UA 1SNDA 2K32A 3A8KE 7ICLA 4DV6Q 1SJHD 4GOPA 2IOFK 3PY8A 2F0GA 3SMVA 4Q45A 1NJYA 3PUYA 5ELNA 1H9SA 5KFYA 1U0LA 1WTHA 3LYSA 3SK6A 1CZWA 1S9FA 1PH4A 4DFPA 4UP7A 4BXXG 5CYUA 4QZFA 1F2LA 2UUBQ 2B2VC 2VNUD 2K4KA 3WKAA 4XQ8A 1KD1C 3CP8A 4XRHA 1KABA 5KAIU 3VYUA 5F9LA 4DOCA 1Y1WB 4R8NA 2UVWA 2EDUA 1HNXQ 2ZIUB 4QW9A 1D2BA 3PW2A 1Q7YC 3PUXA 5AK5A 3OTOQ 1WTRA 1I6HB 1ZQHA 3WU2U 2YY6A 1RDFA 5JTIA 2XCPA 4LF5L 1UNSA 4EENA 5J2JA 4QW8A 3I4OA 4DR3Q 5J22A 5FLXE 1KRSA 2XICA 5ALLA 4CF4A 2ZIXB 1RL2A 4IC9A 5DQIA 4EEKA 3EBEA 5NUCA 3HOVG 3T51B 1X2IA 4I2CA 4DS5A 1LKYA 1UT5A 1U47A 3BJUA 2RP5A 1LT5D 3H91A 5FO7B 3BG3A 1D5MC 5AI0A 3RB3A 3HOXH 4GKKL 5K36H 4HCSA 2GWSA 4IR9A 5IWAQ 4BY1H 2LXKA 3GTGB 3KLSX 4M1UB 3CAMA 3QYPA 4LVSA 1B43A 1KFSA 3TADA 2B2TA 3C1FA 3PIO3 4YWKA 1WCLA 4C8NA 4QZBA 3D2NA 1WG8A 1HJPA 5JRTA 3VYRA 2A6HD 3OSPA 4K8IA 2EXDA 2VQEL 4IUPA 5ALUA 4KMUC 1JRPA 5KYLA 4P4PA 4O3MA 3ULPA 1COKA 3FRPB 2RKSA 5ALGA 3JPTA 1QSLA 1OXSC 3RJIA 3NPPA 1EFWA 1HZAA 3P20A 1CA6A 3BS5A 3LNNA 1HIWA 4ZUIA 2AHOB 1TWCH 8ICSA 1X32A 2CWPA 2FMQA 1NJWA 3A5ZB 4R9WA 3L2PA 4NXMQ 2ASBA 1YI2A 1D8YA 3NTUA 5J0SA 4O5CA 4UARA 5AK6A 1SV0A 4F91B 4UY8C 5DB7A 2WF5A 5IGCA 3DV9A 4B9MA 4A3LH 3OW2A 2WTFA 3C28A 1ICWA 2RDJA 2MGSA 1RZTA 2WV6D 4DR6L 1K0RA 3J80c 4MF2A 2R3ZA 5DB9A 4HEDA 2E2IH 4OJLA 2R8GA 2D9UA 2DL0A 1KW4A 4GNXB 5L1LA 3PW0A 1I4GA 4KJOA 3L5KA 5CV5A 1J97A 4IPGA 4DN4M 4HJ8A 2JA7G 1ZQSA 3C46A 4R8UA 3PX0A 1V9PA 1IHZA 5HR6A 2VXWA 1JJCB 4Q43A 2KEDA 3NTKA 3S16B 1XSLA 3VR3A 4YY3L 1X3EA 3QUQA 2BDNA 5J2BA 5D3DA 4BWMA 1S40A 1NTGA 4JBJA 2JK8A 2JXJA 4N8FA 2KTQA 2MUTB 4A3GB 2PNHA 1KTQA 4QZDA 8ICHA 3MXNB 1TY2A 4ULLA 4XT3B 5I9OA 1LVHA 1OXJA 1YT3A 1VQKA 4JI2L 1Y1WG 4DAMA 5IYBG 4F5RA 3KZXA 1LABA 4HIOA 1JB7A 1CI3M 3N52A 3MEFA 3I4MH 3GTOH 4B3TQ 3SI8A 5DBBA 4KLLA 1B8AA 1PZNA 2MP1A 3IP4B 2F0PA 2YTXA 1II3A 4J1MA 5JU5A 4I2GA 4OD0A 2N49A 2RQXA 5JVG3 4ECZA 2YQEA 3RAXA 4RCOA 3R93A 3ISBA 4YCWA 4A3MG 5AKIA 3RN2A 1DRGA 2OEHA 2EYMA 3FDTA 2AUKA 5AM5A 2EVBA 3J7AF 1SR3A 4I2AA 2BDUA 3GU3A 2RHFA 4CGZA 1A2UA 2F0KA 3D0FA 4B6JA 4B3ML 4KHVA 1CHQD 4QZGA 2BDOA 3I4NH 3KDFB 5J0TA 2R8IA 4F5NA 4FBUA 2PFPA 2PI5A 3HZXA 1ZQMA 1JN3A 4NLGA 3KYHC 4JI5Q 2B3GA 5D3IB 4O5EA 3RZDB 3A0HU 1CM9A 3FKIG 4H0LC 2Q4TA 4KN7A 3CKIB 3D6WA 4ECUA 4Q0FA 5GAHC 3ZD8A 1RJTA 3RJGA 2KICA 1SMYC 1PRTB 4G7ZC 3V72A 4DOBA 1BDOA 1OXTA 5FJ8H 2Q2IA 3HP3A 5T1GA 3PSFA 3M9NB 2QLTA 1XS9D 4B3RQ 1SV0C 1ESRA 4EZ9A 3S1MB 5J8YC 1WTVA 3RB4A 5M3MG 2UUBL 4CJ2C 2CCZA 4MN3A 5GADC 5J0OA 1RPLA 2W9CA 1UA1A 2C2EA 3A56A 1VQEA 1ZQIA 1U9LA 2BA0A 3DEPA 4ED7A 2ISOA 5AKKA 1O80A 1VQCA 2A69C 2F1MA 3N6RA 5AJ3L 4GKJQ 1JOQA 5BOLA 1MHWC 5COYA 5EBDA 2GVBA 4DNTB 4LFBQ 2GO7A 3ALRA 2B2WC 1TR5A 2HDOA 4A3IH 5ALTA 1ECWA 4CDGA 2R6GA 1K73C 1BVSA 1SXDA 3H8SA 1TAQA 4KITB 3K75D 5ALFA 4ED6A 1ZQLA 9ICLA 2F0NA 5IODA 4CF5A 1UT8A 4PHAA 2X6GA 1SL0A 3IFDA 3M9BA 1WWUA 3Q6SA 1JWSD 4DQIA 1SE3A 2F0QA 1SL2A 2HCIA 4WRDA 1PTOC 3K59A 5M5XH 1C0AA 2K33A 3T53B 1WWVA 5DBCA 2V9WA 2RHSB 2XIWA 3E9IA 4PQXA 2E2HH 2UUAQ 4B3SQ 4OX9L 4FF4A 3PZPA 1PTOD 3DLLA 1EY9A 1L6NA 5LMUL 1WYDA 3PO5A 4BY1G 4POFA 4QIWF 1HTPA 4X65L 4HJ7A 4GC7A 2DUYA 3UMCA 1PDQA 2F0IA 4BUGA 2WKCA 5JAVA 1PTOF 1O7YA 4IPCA 3DMUA 4R65A 1ZEQX 8ICWA 1NK7A 5TSSA 4ECXA 4LK1C 5IP9H 5C0XH 4DS4A 8ICJA 3PO3H 2Q2HA 2LYBA 4F4XA 4RKLA 1W6KA 2KVMA 2N3SA 1MQ3A 5EAYA 4IFDG 3PIPA 1TK0A 4NW2A 1TK5A 2D0OA 1LTRD 2YU9H 3BVZA 1PVOA 4A3IB 4POGA 4YXMA 3KTQA 4GXKA 4JWMA 1Z4NA 1SZHA 4KJNA 2QKQA 1Z00A 1Q1BA 2KJ8A 4ED0A 2LM4A 3S2HB 1X3QA 4U673 3A7AB 4C4SA 2B2YC 3SK4A 2OQ0A 3U58A 3KHRA 3C5GA 4C3JB 2F0SA 5KL8B 5IYDG 3C3LA 4C0ZA 4BBRH 1B22A 2CKZB 3MR5A 3OYYA 4ZQ3A 4DAVA 2R93H 1KLGD 1STGA 3S24A 3VC8A 2VA8A 3QU5A 3WK8A 5CJ7A 2UUCQ 3OGUA 4ZKCB 1RG6A 4LZGA 2MQHA 1OTCA 1U4RA 2NO4A 4AYBF 4U7CA 1EYDA 1QCKA 1XWEA 2KEEA 2ZM6L 1ZRMA 3QX7A 2W7PA 4I2EA 3I7FA 3H3VH 2VB3X 1ZQRA 4I27A 4UASA 1XU4A 9ICQA 5GTIU 2G5HB 4F3OA 4IUUA 4LF4L 2UVUA 3GIIA 1SYEA 5J39A 1N34Q 5DEHA 3KHHA 4WFN3 3F53A 4DOAA 1A3VA 8ICCA 1JMCA 4EEYA 3RJEA 5C3XA 1QILA 3BDOA 5EWGA 3HPOA 1CSPA 2ZTCA 5IIJA 1LTID 3SR1A 2KIWA 2JRZA 1VF7A 3PMFA 5IGBA 3DWAA 1ZQOA 3CD6A 3WKEA 1TS5A 2KJXA 2M00A 4A93G 4FZLA 1ONLA 3PV0A 1A8VA 5GTHU 1RD9D 1ZQYA 5ELOA 4K5VA 3UDIA 3NQTA 3STBC 3FM9A 3ND8A 1V8QA 1S5LU 4IQWA 4CDFC 1SXEA 1QCBD 1M1KC 4A3KH 4GNXC 4L5RC 4EVOA 5F2DA 4K6DA 1SFOH 3H0LB 2A68D 3EQLC 3K0YA 4XA5A 1NK5A 4QMGA 2B21A 1VQ7A 3A7LA 1EOTA 3D31A 5CV4A 5D65A 2AGQA 4XTCS 3GTJH 4UQGA 4A3BH 5HHIA 3ITPA 3BJYA 5L1IA 1ZOLA 4UAIA 3X3NA 2HOFA 2DKZA 2F03A 1TV9A 3S1MH 1I4QA 2PKEA 4A3DH 1G8ZD 2WACA 1XMOL 4F5QA 3SEIA 2GVAA 1KC8C 2KHVA 4A3EH 1Q3LA 1VQAA 5AI6A 2BOSA 1QSYA 3AUOA 2H3ZA 2ZUCA 3SE0A 1SZPA 1ZKOA 1UAPA 1XJVA 1Y88A 1ZXTA 1URJA 1IW7D 1GKHA 2KZMA 1Y8OB 3GDEA 1F9RA 2IT1A 1BXTA 1R9TB 2PMZC 5ALQA 1PFNA 2F0VA 5E7NA 5EKLA 2HVHA 5DM73 4DAYB 1K8MA 1S5CD 4O9MA 2PMZF 4X3KA 4HMIA 8ICAA 1ILPA 3NWTA 1X55A 3CP0A 3DXJC 2XSCA 4RPYA 3NXWA 3U4ZA 1EEFD 1AH9A 1I6HH 2SNSA 5ELBA 4LUZA 3CC2A 4OO1J 2H3QA 3NS1A 5HP4A 4CRXA 3E9HA 9ICJA 4QIWC 1GM5A 2L9HA 3MXGA 1IKMA 1EFID 2F0WA 3CQZH 3NSWA 4EQPA 3MXUA 2J4XA 2W43A 5C44B 3Q23A 2VJ5A 4QWBA 2UXBL 5HGQA 4A3JH 1NUCA 1TU2B 2W9BB 2OF1A 3AMUA 2G09A 2BH8A 2F3NA 4DR5L 3OSOA 1LYLA 1CT1D 3J7YW 2KN7A 3T5LA 3HOYG 2V1CC 5CV8A 4A3FB 2JSOA 3TEHB 1DOQA 1NJXA 1FR3A 3MXPA 3R8BA 3HFZB 2KENA 4IQZA 4C8MA 3GV5B 3J80i 1SYDA 2ZT9C 3M3YB 2JA5B 3W2DA 2KA7A 5JPMC 3EYZA 3A74A 1L0XB 1XNRQ 5J2GA 3M4QA 2EYLA 4UB4A 5KFRA 3Q24A 3TI0A 4FF3A 4WJ4A 5CV6A 3TP8A 3MAQA 1RM6C 4X65Q 4ECYA 1STAA 1GXDC 2D8CA 3V7KA 3C2KA 1B53A 9ICTA 1QUQB 4YR0A 5KFVA 1PFMA 2FHTA 1L7MA 2YV5A 5KT5A 5IGGA 2OEOA 4MTKA 2M9NA 1Z4OA 3MC1A 4R4IA 1N56A 1PVRA 4OIJA 4EX5A 3IHQB 1HH2P 2N55A 3L7ZC 4G9BA 5TISU 2K52A 2PCFB 4KMOB 3M1YA 2PZUA 4DR6Q 4GZYC 3C1ZA 2NVYH 4CE6A 1KDCA 4A3BB 1RKNA 3NBIA 5EOZA 2IJ0A 4UPAA 4C3HG 4P0QB 5KG3A 1U49A 4KY6A 1ILQA 4Z6EA 3GIMA 3CRLC 5LMNW 3Q8LA 2W3RA 3I1YA 2HHTA 4KLEA 3EZ5A 1MA7A 5AKLA 4JI2Q 2ZXRA 3PW4A 4M0AA 2W9AA 4LJXA 3OPOA 4M2YA 3R2IA 5IE8A 3MFYA 1HZCA 3OMCA 2IA6A 1AZQA 2J0TD 1C7YA 5ISRA 2P6UA 1N33L 3D4DA 5BOMA 2E75C 2W7OA 5C4JB 4P0QA 1BCPC 2ZIWB 3BS1A 2IMWP 3UMGA 2BPGA 1QNKA 1YHQA 3WDNA 1EWIA 1H9SB 2RDHA 1NK8A 4Y2RA 4A3DG 4BBSB 3S16H 3HOZG 4XDXA 2EQYA 1G51A 4FXKC 4J6HA 3MA2B 4P4OA 5ALXA 2FJ6A 4IN3A 5AICA 3HRZC 8ICVA 3NQIA 5IIOA 3HT3A 1PV4A 2MPMA 4GKKQ 4R64A 4L5QA 2K75A 1V85A 4GXJA 3RR8A 2ZIXA 1M4VA 2JEJA 1WVLA 2G0AA 3E5SA 3NEMA 1SEBD 2KNJA 4K2LA 3LX0A 4ALPA 5ALRA 5GROA 2ZXPA 3PSTA 5DLFA 4DFDA 2KP7A 3RB0A 1EYGA 4GLVB 1F2ZA 1PZID 1YNJC 4FDBA 2AJQA 2CHBD 3K5OA 4QZAA 2JEFA 1F2MA 1DOKA 3M4OB 5ALSA 4GFJA 1XSNA 3V6KA 3I70A 3M7NA 1ENFA 3S9WA 4M9NA 3M9OB 3D3RA 1JROA 2HDMA 4QZ9A 3VR6A 3D4WA 1JUDA 3OPXA 4TQUS 3RUZA 4C4RA 3FDSA 2NN6I 4O0AA 3RR5A 1IBLQ 3IAYA 2NZOA 1VQIA 1UWVA 2DNCA 5LL6X 1BNZA 4QCLA 1Z19A 1ZD4A 1FL0A 1PZKD 4FNFA 3F2UA 1YJWA 1NSNS 2K5VA 1HZBA 2C2DA 3CCVA 3GILA 9ICMA 5KFNA 1VQOA 2CN1A 5M3FH 1SNQA 2MAXA 3D8GA 4DQSA 3HKZE 4O3QA 2Z7JA 2A6HC 4IJHA 4J9SA 4LF6L 3V7JA 2CW0D 4ILWA 3TQYA 3G71A 1U4BA 8ICBA 2XWBB 1NK9A 2PI4A 1A0IA 2FLNA 1A3TA 3M4YA 2EPBA 1GUGA 3GTQH 1IXRA 5KT2A 4Z6DA 3ISDA 3QR8A 4DL2A 3QB3A 3CF5A 5KFTA 2N88A 1S5ED 1IYVA 2ZUBA 4C80A 1HCZA 3QIAA 4P72A 1QQ5A 1E1TA 4JW0A 4YWMA 5J8YA 1UPHA 5HMLA 3MFGA 4RUCA 4LF5Q 4DR1L 3U50C 5BR8L 3VA7A 4K4GA 2FI1A 3OTOL 2QILA 2W55A 3WOEA 4A3MH 4J15A 3FEWX 1SXTA 2IBKA 1ZXIA 4M9LA 7ICVA 5L1KA 4GOPB 4CJ0B 2FJ2A 4O3SA 1B2TA 5J2FA 2B2WA 2WINB 1ENAA 2HHSA 4JI4Q 2A1AA 4BA2I 1SWVA 2I5HA 4NV0A 2Z9HA 2MRLA 3QU7A 1SKSA 3L3FX 5ALHA 4KLDA 4DO9A 1N60A 1UA0A 2EE1A 1QLNA 4XYOA 4K14A 2B63G 3PMNA 4ZH4A 4Y2XA 1XNRL 2QF7A 3WK6A 4MIUA 4YFKA 2BE5D 3TS2A 1IL8A 1UCVA 8ICZA 2HQLA 2ZIVA 4KLIA 2FXQA 1SFOB 1PTOB 1WTOA 3HKZB 2HSZA 3S14H 3I55A 2KV2A 3H8MA 3BDLA 5KFCA 1GUNA 2MUTA 3GV3A 4YG2A 3PVXA 4QIWB 5DB8A 4FE3A 5IYCG 1K1SA 3GFKB 5KFSA 1H38A 2XIDA 4R66A 1ZQAA 3OTQA 2OXPA 5C3EB 4NXML 3S14B 3KF8B 1MN8A 2HMXA 4LFAQ 2OT2A 3KJOA 4TRDA 2H3FA