1N63A

Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 160
sequence length 160
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n63A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n63A01
1AWDA 1UWMA 3AEBB 3HRDD 1YJJA 1L6VA 3AM9A 1OQRA 1F0ZA 1JQ4A 1N5WA 1QOAA 1ROEA 1FMAD 2M19A 1E6EB 1TKGA 2HTME 1TKYA 1WGKA 3W5VB 3VRAB 4A9AA 1KF6B 1E7PB 1V8CA 1YJIA 2ACZB 2WS3B 5AUIA 2DBYA 1J7CA 1JWBD 3HUIA 5H8YE 5MPOA 2JX5A 3EUB2 2WLBA 5AUKA 1NYQA 1WXQA 3AECB 1FFVA 2W55A 4KX6B 3AEEB 1E10A 4YSZB 3P4SB 1FRRA 2N0SB 4ZOHC 1ZXIA 3AE8B 3AEFB 4N58A 3P4QB 1V97A 4LTUA 3LB8C 1A70A 4YSXB 1DOXA 2WU2B 1EWYC 4WQMA 3P63A 3AE1B 4FXCA 1RFKA 2K9XA 2JQRB 4JWSC 1B9RA 3B2GA 1XLPA 1FXAA 3AEDB 2AX5A 1JW9D 2PVOD 1WYGA 3CWIA 1NYRA 2WU5B 3SR6A 1JWAD 1I7HA 2CJNA 1IUEA 4YT0B 2EKIA 3AH7A 2H89B 4HRSA 3NVZA 1SF0A 1FFUA 2WDVB 4US9A 3NS1A 3P1MA 1N60A 4ZHPA 2E3TA 1N63A 1ZOYB 1GAQB 1JROA 1QOBA 1DOYA 1VLBA 4IDIA 5C2TB 3VR9B 1AYFA 2MJ3A 2OHFA 2K22A 1FM0D 3P4PB 1FO4A 5EE3A 3AE9B 3AE2B 4HROA 1QT9A 3W5UB 3AEGB 4ZHOA 2LEKA 2W54A 3AMZA 1DGJA 3DWMA 2PIAA 3WCQA 1J7AA 1JALA 1XLNA 1ZP0B 2BS3B 1WWTA 5GXGB 4C7ZA 5H92C 2MH7A 2L52A 2Q5WD 1L6UA 4N59A 3SFDB 3NVYA 3FAHA 2G1EA 3AE4B 4C7YA 3B9JA 4YXDB 1QF6A 1CZPA 3AE6B 3W9CB 2PKOA 1XLQA 1RWSA 4YTMB 1CJEA 3PO0A 2FBWB 2CU3A 3NRZA 3AN1A 1QOGA 1OQQA 1OFFA 2Y5CA 1VJKA 1FXIA 5G5GA 3AE7B 4WWMA 3ETRA 1NEKB 4US8A 1RM6C 1PUTA 1L0VB 2CJOA 1XLOA 2KAJA 2WDRB 3KWLA 5EE1A 1FRDA 1RYJA 5G5HA 1YQ4B 2W3SA 1E9MA 3ABVB 3ZYYX 1ZUD2 4ITKA 1PFDA 4JX1C 5EE0A 1SB3C 1DOIA 1L5PA 1KRHA 3RPFC 1SIJA 3DWGC 4YTPB 2KMMA 2WQYB 4USAA 3AB5A 1NENB 2BT6A 3AEAB 3BIID 1N62A 1QLBB 2H88B 2PVGC 2QIEB 2QJLA 3NVWA 3VRBB 1QOFA 2BS4B 1N5XA 2WDQB 1T3QA 3AE5B 1N61A 3AV8A 1E0ZA 2DWQA 3LXFA 2W3RA 1GPXA 4P6VF 1YQ3B 2MJDA 1XO3A 3NVVA 2K5PA 3CIRB 3HVZA 4YTNB 4YSYB 1TKEA 1PDXA 3L4PA 2M56B 1J7BA 2B76B 1JRPA 1R7SA 2L83A 3B2FA 1FIQA 1WRIA 2MJEA 3P4RB 1NVID 5C3JB 3SFEB 1NI3A 1KFYB 4JWUC 1TYGB 2BS2B 5EE9A 3VR8B 1TJEA 4C80A 3AE3B 3FC4A 4N6EB 2WP9B 1VDVA
chains in the Genus database with same CATH superfamily
3NGDA 1SIFA 2C7NB 1QSYA 3GDXA 4O9MA 3C23A 3QU9A 4J9MA 4UAZA 4CRXA 3PW7A 3VUYA 5J0RA 2BWFA 1CRXA 4A9AA 2W8KA 4M00A 1KFDA 2ZIXB 3Q8SB 2B3AA 5AUIA 1TE2A 4O3OA 4TURA 4URKA 3H0LB 1JX4A 3NTUA 2CKHB 5AUKA 4FULA 1SL0A 4MGKE 4G3XB 3RN9C 4I2IA 4UB1A 2V4RA 4KLJA 3QJZA 5JRTA 3HX0A 4XYCA 2R8IA 3CNHA 3OJSA 5AI6A 5KL1B 2MBQA 2XK5A 4RGMA 4NLCA 3VVWB 1PVRA 1C9FA 3NHEB 3KKAA 2JQRB 1U49A 3KQ4A 8ICEA 1WJ4A 4FA6A 2HBKA 1UF0A 2RPVA 3BZKA 4GDKA 9ICTA 3JSVA 5DCNA 3ZDBA 2RDGA 3IHPC 3F2DA 1H38A 2BPSA 3P1MA 3L5KA 2HD5B 3V7KA 1UNSA 1E90A 1DOYA 5AKXA 3VR9B 2OHFA 1P7FA 1FO4A 2JRZA 2K4HA 1QQRA 4PZOA 4S0RA 5JZEB 3AEGB 2PPHA 1ZD4A 1B22A 2INPE 1SWWA 5ALWA 3K9PB 2WXHA 1ZP0B 5AKGA 5GXGB 2K39A 1DXSA 5CR0A 4F5NA 3Q3FA 9ICLA 2MH7A 5H92C 2KWCA 3L0WB 5AK6A 4L1BA 4KDIC 4OO1J 2YY6A 2BWES 4PPXA 1YZ7A 1F2RC 1OQQA 2ZEQA 1OFFA 1XQQA 4EOYA 1ZQ1C 1TS4A 3IG3A 2J42A 2C7HA 1BPXA 1SXEA 5J2GA 4Y2TA 1NK7A 3TMPB 2L8JA 2VJ5A 2QEJC 1BMLC 2K4PA 3C2KA 2XICA 3UMBA 4DFMA 1UBIA 4ZRJA 5LXIB 2FDRA 3MR3A 2OH2A 2XY7A 3DDHA 3I1YA 3OJ4B 1MN8A 3IAM1 4I28A 3ZDEA 2Y9UA 4GDLB 4MT5A 4D2KA 1ZQEA 4DEZA 1K8RB 1Z2MA 4JK1A 1DGSA 1V85A 3RBDA 1VZ7A 2MQJA 5ALZA 1XD3B 3AQFA 1GPXA 4QWAA 4WWNA 1I35A 3AI5A 4XWWA 5AM5A 3FKYA 2RMMA 2EMSA 3A9KB 2BCSA 3TIXA 2I5HA 4ZYNA 5ALYA 1NVID 2HE7A 3A0HU 1ZQAA 5H2FU 4DQIA 1V49A 2KWVB 3U2SC 5F9NA 4A6QA 3PY8A 3X23A 2RDJA 1KL9A 2QB0A 4A8EA 4ECTA 2EELA 3OJUA 3AE3B 3ALBA 1ZD5A 2XO7A 3GIJA 3KD3A 3AEBB 3VTUA 3CP8A 1OEYJ 5KAFU 1F5SA 2LGSA 4FE3A 5AIBA 1X9XA 1GB4A 3LWLA 3H7SA 1U4AA 1WR6E 4FJZA 2FUG1 5ALPA 1XC9A 1L7PA 5KFXA 3OAWA 4IC9A 4II2B 2V9WA 8ICSA 4S17A 5DLGA 5IKCM 4M8NA 3H1UA 2W55A 2XY6A 5AZFA 4FS2A 4KLFA 4FZMA 4ED3A 1SV4A 4DOCA 4RF0A 3B0YA 3F5AA 2QLTA 4ZOHC 3BQ1A 1ZQTA 2A5UA 2FCQA 4BUGA 2IGHA 2KWDA 3F53A 1SXTA 1DOXA 4IM3A 1EWYC 5FP0A 1XO0A 5AI9A 1C76A 3ISDA 1XNSA 3V62A 1DK2A 1SSNA 1BPZA 2GRIA 3QHTA 3MR5A 3LVVA 3MDCA 1KLNA 4TUQA 5ALOA 1SJED 3GV7B 2ASDA 5L1JA 5J0XA 1MC8A 2XVTA 1UPHA 1SE3A 1S0MA 5D94A 4E71A 1QCKA 3WK7A 2FMSA 2KG5A 4ZHPA 1COOA 1JROA 1WGHA 1VLBA 2DZIA 2ZW1A 4JIOU 3C5FA 3EFCA 1MPEA 4O5EA 4K7UA 4TKNA 2TSSA 1WWVA 1U48A 2W7OA 3RTVA 2B6GA 3VTWA 3UGBB 1UUPA 1F44A 2IO2B 5E6NA 1KRPA 4C4VB 1WGDA 3RNFC 3M1YA 3SAHA 2LBOA 4CF3A 1S0NA 2A19A 2BYEA 4AYBC 2N9XA 5BMGA 4RGNA 3B9JA 1FCCC 4LJXA 1TV9A 4B9NA 2PKOA 4RQ3A 3V61A 2N7EA 1WZ0A 1V5OA 4W9FA 5FR3A 3RH5A 5KFUA 4DOBA 2AQ2B 2AQ1B 3BWUD 3PMNA 1XS9D 2G4DB 2MBBB 2WXJA 5G5GA 3UXOA 2ASJA 5HHHA 1NK4A 7ICJA 2KVZA 3F5EA 3DQVA 1FXTB 3B1LX 5KG5A 4I2EA 3OG5A 4I6PA 4P0PA 2W3SA 1OEYA 3KOOA 2VZKB 4NNJB 2LYBA 1IV8A 2ZUBA 1J2MA 5KTQA 4LVSA 1RYRA 3BVGA 3PSFA 3P4QB 5DPRA 2YEPB 5J2AA 2WYQA 3ZDMC 1C4CA 2WQYB 3WKAA 4NM1A 1NENB 4ZH4A 2KMDA 1ZE3D 2KMCA 1WUDA 3RI7C 2HHUA 2NS5A 2JF5A 3H7PA 2V3SA 1SKSA 2HJ8A 4QZAA 1E8XA 1YOVB 4C8MA 1FNUA 5JU5A 2D11A 4C00A 3THVA 4CF4A 2D3AA 3RZFA 2WB1F 3QC8B 2AGOA 2KTRB 1R4NI 2PE9A 3PVXA 5DLFA 3QU7A 1TK0A 3RAXA 4KLDA 4L2YA 5AK4A 2WXRA 3RJJA 4HDQA 4KIKA 2ZIWB 3QU5A 4WJOA 2H3VA 2N9LA 3U52E 4CF5A 3DVNV 3L54A 3VUXA 4KLTA 4TQ1A 1L7NA 3IT6B 2LVPA 8ICAA 3C5GA 1T7PA 4LZGA 2MP2B 5ALGA 2K8AA 3PRPB 5D6JB 4MGZE 3IG5A 2L3ZA 2LGIA 2KC1A 3N97B 3HIZA 1MHXA 2W03A 1WGRA 5C3JB 5AHXA 1HEZE 1KF6B 2PTLA 2C2EA 4PL2A 1BPEA 5H8YE 4EZ9A 3BVMA 3RNAC 1NYQA 1WXQA 4P1BC 5KFOA 4K4HA 2ON8A 4NZLB 3UXNA 4ECXA 1X40A 4BZAA 1K53A 5IO9A 3GIKA 1S5LU 4E0DA 5IIMA 1WXMA 1HIWA 4RM9A 4ANVA 3TANA 3EHVA 3V6KA 1NJWA 3ZJVA 3H8JA 9ICSA 8ICRA 4RPXA 2BYFA 4OVVA 1KJTA 2JGAA 2KEYA 5FKAC 1QSSA 2KJ6A 1NYRA 3NOBA 5ALMA 4M6WA 4AWJA 1T0RC 9ICNA 2ZNVC 2KC2A 1XU4A 3NVZA 2N9EB 4EBEA 5D3DA 1N63A 3I9V1 2XK5B 8ICHA 1ZQLA 2KHWB 1ZQCA 3PZPA 8ICTA 5EE3A 4DK5A 3NUQA 3W5UB 3ML8A 4I2HA 1BPDA 4QIWC 1V6EA 2K6DB 2LJIA 4GDKB 5ALRA 5FK9C 3GZNI 5KFEA 5ALIA 5JHAA 2WF6A 2DKXA 2KFJA 2L7RA 3JSVB 1UHUA 3MGHA 4QZFA 3AE4B 2WX1A 4JV2A 4EEWA 7ICIA 2CPRA 3WKBA 3APCA 4BWJA 1XXGA 4I29A 2XI9A 4Z6CA 2GBKA 4NJ7A 8ICPA 2IBKA 1GNUA 3TARA 4WWMA 1NEKB 4C0ZA 4F2SA 1YNTE 2DENB 4LLGM 4DQPA 3MFHA 1E9MA 3OHBA 4R66A 2KVSA 3JYUA 4MGIE 2KFNA 1SGHA 2G5HB 5FR6A 3KHLA 2GH1A 2ES6A 5EE0A 2ZJ8A 2PMZF 1U4BA 2AU0A 4KKJA 3BIID 1TIFA 4RF1A 4QZBA 1YJ1A 3AU2A 3SV4A 2NO4A 4HLEA 3W1SC 2BYTA 2GI9A 4ECSA 2N4FA 4DLGA 1E0ZA 4PGXA 1EXNA 2W3RA 4JWNA 2PI5A 2FUHB 4M01A 1Y88A 1PDXA 3V60A 1NZPA 2F2AB 1KN5A 3JPQA 1NI3A 2E8OA 4CDGA 3R2IA 4GXKA 1JWSD 3HILA 4BGDA 4UBBA 2YMQA 1S77D 2Z7JA 1F9JA 2D3DA 2DX5B 2KX3A 2NBVB 3EFUA 5KFQA 1BPBA 2WX0A 3PSIA 4UAWA 4IQWA 3Q8KA 5ALJA 5L1LA 2HVIA 4A3OA 1FMAD 3Q8BA 1H8CA 2BGWA 4OVUA 3W5VB 5AKYA 2NYVA 5T14A 2ACZB 3AU5A 3IM1A 1JWBD 4HCNB 4M04A 2WLBA 3N32A 2HDOA 4K81A 2BPCA 3ONNA 3H8MA 1E10A 1FD6A 4IWPA 2DUYA 2HBMA 5GTIU 4ED8A 1ZGUB 1ZW7A 2VANA 3IDWA 4XRHA 2KN4A 2ZW0A 4RQ2A 2DYBA 2E1EA 3KYCD 3CW2C 2GLSA 1R4MI 2J53A 5CHGA 4DHZB 3B2GA 1S76D 4W9HA 2FLLA 3TEWA 2LM1A 4ECUA 5LLIA 2WU5B 1ZRNA 1R4NB 3N9YC 4YT0B 2NV3A 2MCNB 2K25A 2K8CA 5IA7A 2CU1A 2L00B 3MABA 3Q69A 4R3DA 3T5JA 2OCEA 3SDLC 4PT5A 3ZVVA 5KT5A 2M9NA 2G08A 2L32A 3MHZA 1CEZA 3ZRCA 4ZRIA 3WK4A 2Z59B 3WIMA 9ICWA 4O3QA 4IWOA 3KVFB 1ZQDA 3UXPA 3PMLA 2OOBB 1V38A 4J6IA 4MEMA 4EEKA 4W9EA 3WCQA 8ICFA 3C1YA 4DL5A 2FJ6A 4GN1A 1RXVA 5ALSA 3PLUA 3M8RA 1X9SA 4Y2RA 4RQ0A 3DV9A 1TK5A 2K8BA 3SFDB 4A20A 1ZDVA 1QF6A 3LDZE 1HTQA 4B9UA 4U6PA 4ELVA 1WSPA 3AE6B 3TBLD 5AM0A 2WXQA 2BQQA 2F1HA 4CE6A 3DHGC 3KUZA 4HXDA 4W9JA 4OZCA 4YTMB 1TFRA 4XA5A 5J2FA 3BS5A 4IQTA 5CA7A 5AI8A 2HHXA 1EF5A 4OVZA 3AULA 4BAXA 3I63C 3TJPA 4CO7A 5AKZA 2GB1A 4RPZA 4US8A 1IPGA 1SV0C 2CJOA 2WDRB 4PJ0U 1ACCA 4RQ7A 1ECWA 3QARA 2MHJA 2DPJA 4RNAA 5J2EA 4MSQB 1FNVA 2KK0A 1PVPA 1A5RA 3QNMA 1KTQA 1JXLA 4PS3A 3F2BA 4B9TA 2QIEB 5KFTA 3M6KA 1QOFA 3IT4B 2BF8B 2Y0SC 3K75D 3V6EB 4PS7A 3EA6A 1KLUD 5BOMA 1MFWA 4P0PB 4B0MA 3PX6A 9ICMA 2RRDA 2AQ3B 3GZNB 4NWIA 4RQ5A 1N2XA 4P4OA 2W11A 4DL3A 3V7JA 3TCAA 2XC9A 3RB6A 4DFDA 2EH9A 5E6OA 4B6WA 4XX5A 2WP9B 2NMQA 4AQ7A 4ECVA 3QAQA 3H7PB 1AWDA 3UQ2A 2A1JA 2Y5BB 1XEEA 3AM9A 1V9PA 7ICOA 1T3NA 3MTNB 3L3FX 3ALRA 3EZ5A 3KKAC 3KHRA 3SMVA 4EZ6A 1V1PA 2HTME 5F3XB 1V9JA 3H9DA 1X42A 7ICPA 5DPTA 4DSKA 5MPOA 5KFLA 3ZNID 1E8YA 3RB3A 1SKWA 1RAXA 2YVCA 4TUPA 4KIKB 1LQBA 3QZ7A 1WX8A 3MGVA 4KX6B 2FCSA 2YTUA 3RJGA 3OPXA 3SEIA 3E9SA 3T3OA 4WWOA 1V97A 1ZQSA 4WH4A 1Z1BA 3VDZA 1FEHA 4K3BA 4YMMA 1WH3A 5TR5A 4F4XA 1ZQUA 3HJEA 7ICVA 3AEDB 5KG4A 4B0EA 2FCMA 5J0QA 3RD2A 3BDPA 2I1KA 3WALA 2FMPA 1I7HA 2PEAA 3VH4B 9ICJA 4Q8FA 2H89B 1UT8A 1FFUA 1WWUA 2ALZA 1L4ZB 4O3PA 9ICHA 3QE9Y 1ZOYB 3ZTCA 1IBXA 5EOZA 3M95A 5KFPA 4IDIA 1SE2A 3VTVA 1D8LA 2LASA 3PZ7A 4GIVA 2ZTEA 2KJ9A 1OW5A 2NRZA 1YZ6A 1ZQXA 3AMZA 2LGDA 2RDIA 1JALA 1WF9A 4M6WB 4CNQA 3RJEA 3ZXRA 4Q8EA 1B9RA 3UQ0A 4ECZA 2JEGA 3PO4A 5KG2A 1UT5A 4MACA 1CZPA 2LMRA 1X66A 4PHDA 1B1ZA 4LDTB 5D2MB 4N9F4 4LNIA 4QWBA 1S1QB 9ICCA 3BS7A 3VHTC 2G06A 4R63A 2NBUA 3U30A 4DL2A 1R4MB 2WXKA 4JE3B 5G5HA 4DSFA 3ABVB 4Q44A 4RZRA 3ZYYX 1F1HA 3IAS1 1ZETA 1O08A 1KTKA 2KNBA 1HA5A 2BYVE 3AB5A 2R8KA 2Y3AA 4F4ZA 1SE9A 3APDA 3M62B 1N5XA 1MG4A 2RP5A 4DXGA 4F72A 3TAQA 4PK1A 3ZNZB 3AU4A 4I6LB 4P6VF 1P9DU 2IO0B 3U7ZA 3PRMB 2LYAA 5AK5A 1GJZA 3TUOA 2GO7A 4F5PA 2BQ3A 3TAPA 2JEJA 3ZDCA 4YP3A 2D07B 4JL9A 4ECWA 4PHPA 1ZQRA 1GC7A 2KOBA 1P1AA 3ED5A 5C5JA 2BDUA 1KFYB 2WXLA 3H0MB 3DBHI 3DVGX 2DYOA 9ICVA 2JUOA 1TJEA 2IOFK 2Y1IA 2LI6A 2PKEA 3RB0A 3HT3A 2ZXHA 3FM9A 5G2NA 2BCRA 2MEKA 4GIBA 2M0AA 5I4DA 3PVLA 3IXSA 2QDFA 1N6ZA 5E6PA 3I3TB 3QU2A 4UB6U 3Q8LA 3PW0A 2ZVNA 2LVQA 3PSPA 5HHDG 5BYRA 4BKSA 4NY8A 3KTQA 3T3FA 2I1JA 4RQ4A 4O5CA 1TS2A 2G07A 2JYEA 4UB8U 1HTOA 4J9OA 2HTHA 4RQMA 5J8YA 3RJKA 4J9LA 4OJPA 2NRWA 2KXJA 3CWIA 4NLGA 2GBMA 2PFQA 2L5YA 4A8XC 9ICPA 2R8JA 4IL6U 8ICOA 3O0FA 1NKEA 3ZDDA 4YD1A 3ZNGC 3QUCA 3RH4A 1AQ6A 2W7PA 4EX6A 1PYWD 4MFFA 3AE2B 4UASA 2PW9A 4DHJB 4DSEA 2H3QA 4X57B 3N28A 2BS3B 4ASWC 9ICKA 1RDFA 2YB1A 3DHIC 4F4YA 2K8CB 4N59A 4CGZA 3NVYA 2IGDA 4ICVA 2GLEA 3H8WA 5J2HA 2NBWB 1XLQA 4TQSA 2LD9A 4LK0M 5KHQA 2FBWB 2W8LA 2SEBD 4WJNA 3ZGZA 3A9JA 4F3OA 3LVWA 2KDIA 1AN8A 5J0SA 2IO3B 2KZ3A 2BB5A 2HHQA 1PGBA 4YR3A 5KFFA 2ZZPB 2KNJA 1WM2A 3N1YC 3T9LA 3RJIA 1QLNA 2PE6B 3WAOA 2K8BB 1L5PA 4GXIA 1MHHE 5KG1A 3MR2A 1SIJA 2MWSB 2R2OA 3HM6X 1MI0A 2V1YA 2NRXA 5J2BA 1TTNA 3WA0A 1N62A 3BS5B 2H88B 5J0UA 2BS4B 4YL8A 3TL5A 1S9FA 5B5EU 1ZQFA 4RNMA 2MSNA 4KDLB 2E8MA 1FIQA 5IIOA 2ZIUA 2L0TA 1SZHA 2WF8A 3V72A 3ZRFA 4DFJA 1I42A 4C80A 2KJHB 2QCZA 4GMVA 4N6EB 3SU8X 2K3UA 3D32A 1L3TA 1PK1A 1D8BA 3P2BA 1ZYQA 2MA1A 1OQRA 3L10B 5AKKA 1SXDA 3ZD8A 4MFCA 4IC7B 2CRXA 2N1WA 3VH3B 1TKYA 3RULA 3VRAB 4OZBA 2A1AA 1E7PB 2WS3B 3DBLI 3MJWA 4GLSC 3EWAA 1ZQMA 1F0MA 4EENA 2KMAA 3EUB2 2BDPA 1DOQA 2OJWA 1CI4A 1BGXT 3BYYB 4AYBF 4FHJA 2YN4A 2KSOA 4YSZB 3P4SB 2ZJAA 4F4WA 2BCVA 4NAWA 3NG0A 4HDOA 1HZ6A 3AEFB 2KK8A 4NJCA 2A1JB 5D4BA 4F5RA 1ZQQA 2BCQA 2KT7A 4NLBA 3PW4A 2LGYA 4JPSA 1Z19A 2JEFA 1V1PB 2KDFB 4YQWA 3RJHA 7ICMA 4EELA 4GOCA 2PJHA 1GC6A 2O6VD 3MC8A 1WJNA 3TADA 5IINA 4DQQA 3JPSA 4DSJA 3PRZA 1VRAB 4US9A 2JEIA 2JH1A 3NZUA 5AICA 5L9XA 2N7JA 4I6NB 2P6UA 3WU2U 4NL9C 2ZPYA 4K7SA 3QA8A 1GUAB 3UMGA 2KIVA 1D5ZC 1WIAA 3ICXA 1CQVA 2XGPA 5AIAA 4OD0A 3PPAA 4RU9A 3T5LA 1Q5WB 5KHOA 1L6UA 3DBSA 2K8HA 2L1AA 1IIPA 3M9NB 4FBUA 3GFKB 1IM4A 1IBXB 4JLCA 3GP7A 2CU3A 2WXOA 1QKZA 4RT3A 1VJKA 2E5SA 3NUHB 3S2AA 4ELTA 3ETRA 1E7UA 1PUTA 4TV3A 2ZTCA 1XLOA 1IP9A 3C29A 1QQ5A 1RQLA 2LJ5A 5J2DA 4M02A 4WIPA 4Y2JA 9ICXA 4Y2YA 2XGQA 3Q2AC 4DFPA 1WXVA 2O2VA 4YTPB 3ZD9A 2K6QA 3VCBA 4P1CC 2ESEA 5C0YA 4BBNF 3NVWA 2YMMA 4PGYA 4GB9A 3R9KA 3IBEA 5AK3A 2JMGA 1JRUA 4LNOA 2ZJ5A 5KFCA 5HP4A 4QZHA 2IYDB 3CIRB 4LJPB 4M9HA 3I5JC 3LWMA 3L4PA 4KLOA 4QW9A 2B76B 4ZDVA 1GO3F 3M63B 2OXOA 4C8KA 1J8CA 4QZGA 5KT7A 4J9SA 3M7DA 5EE9A 1ZQJA 2VA3A 2CHZA 3RT3B 4WAAA 5LXHA 2WGSA 3ZKJC 2RSUA 4MJSA 2LHDA 4JMUA 4RQ1A 4LNKA 1T8EA 5ALEA 5AM4A 5KT4A 1KH0A 1WE7A 2N1VA 4F50A 4Y2UA 9ICRA 1N5WA 4QZIA 4HJKA 1TS5A 2M19A 4QIWF 4UAYA 1F52A 2UWQA 2ZTDA 1XSNA 2VA2A 2GMIC 1EF1A 2JZ3B 7ICKA 2V3NA 3IP4B 2O6KA 3B0XA 4BOSC 1FRRA 1UD7A 1D4BA 2JH7A 2CS4A 1KQQA 4ELUA 2H3IA 1UGMA 4Q2JA 1WXAA 4ED6A 3QCAA 2KP7A 5DQHA 3BQTA 3G6XA 4WQMA 2ZCBA 5HHIA 4IRKA 4EE2A 3N7SC 3AE1B 2E1FA 1LXDA 3Q3JA 4M9JA 2DNFA 1RYSA 2LI5A 1P3QU 4PH5A 3PO5A 4DSIA 4DQSA 1LFDA 3IVFA 5AM1A 5KFIA 5AI4A 2R8GA 5KL8B 5IILA 4A3PA 1UH6A 2DF4B 3UM9A 1I4QA 4AJWA 3KW5B 2OEDA 3LJ3A 2IZVB 2J4XA 4FBJB 1T6BX 3JPPA 2MJ3A 4I2AA 2IGGA 3WANA 3SAGA 4BBNC 4QZ9A 2F3NA 3Q8QB 2XBBC 1L0XB 3R66C 3UINB 2OYYA 4MM3A 4DDID 5EDSA 2W04A 3GU3A 2AGQA 2KDEB 8ICZA 2V4IB 4G11A 4DWIA 4QAYA 3SD5A 3BZCA 3TFRA 2C2DA 2JWZA 1JMLA 4FJVB 2W43A 8ICGA 3O65B 2EZXA 2XIDA 5J29A 1HUZA 3I57A 3QWZB 3RUIB 3BYTB 5KFMA 2C22A 4NPNA 4OHJA 3TEXA 2ZUDA 1X2IA 1KFTA 5BYQA 1FRDA 7ICEA 4NLZA 3PLVA 5IP4D 4ANUA 1K5OA 2DFLA 4UW9A 3PX0A 3C1ZA 2IDYA 2DAFA 3BK1A 3RPFC 1K52A 4IUMB 4RM8A 4UB3A 2JVCA 3ZUNA 2F1JA 1SL1A 2B21A 3W9CB 3RB4A 2AHOB 3RAQA 2PVGC 3A9JB 4WWPA 1M94A 4MGYE 4I2JA 3H40A 1T3QA 3AE5B 1N61A 2L0FA 3JPNA 3C8YA 3UQAA 3W1YA 2KHQA 4KVGB 4F5OA 5DB8A 3L13A 3SHQA 3VQIA 4FO6A 3HVZA 5J0PA 5GTHU 3U26A 4O3MA 2YLMA 4DLEA 4B9LA 3FILA 1J7BA 3ZNHB 5KG6A 5DBBA 1L7YA 4R8UA 3P4RB 4EZJA 3HWTA 4TQRA 2D3CA 1NZBA 4JWUC 3PTFC 1QSLA 1NI2A 5CHVC 4EZLA 1TYGB 4DWFA 3Q8EA 2FE8A 2YEPF 2FNJB 3ZIMA 1WZ3A 4G9BA 1KOTA 1YJJA 1L6VA 4K3CA 1ZQPA 3K1RB 2I38A 4F8RA 1HE8A 1EM7A 1E6EB 3GZFA 1P7EA 1ZJMA 1TKGA 2JU6X 3KYDD 5TSSA 4Z6FA 2DBYA 1B4FA 3H4BA 1JCKB 2ZIUB 1WY8A 2AL6A 2JX5A 3AECB 3QIJA 4ACFA 1A0PA 3HKZF 4MEYA 3DVGY 4HWIB 1M4VA 5L1MA 2FE9A 3EPGA 4KLHA 1PK1B 2Q4TA 4KLIA 2DAJA 2N1RA 3OSPA 3P63A 5BPCA 3L17A 4K7WA 3ISBA 2V9HA 1ZD2P 3QEBZ 1F2RI 2PFNA 1Z4OA 3PW2A 3D2QA 4RUCA 5KT6A 1JWAD 1EU3A 2MX2A 3AH7A 1YIWA 2KSOB 2M1MA 4NAWB 5L83A 4PYUA 3E56A 2RDBC 2FPMA 3U4EG 3WKDA 3Q3OC 3M6ZA 3Q8RB 2ICIA 2QB0B 2Y0SF 4RGOS 1T0SC 1YN3A 4ZHOA 4WJQA 4LJOB 1BUIC 4C8OA 1WJ6A 5AZGA 4MELA 4FBTA 1BNPA 4R64A 2HDEA 2BW2A 4RGTA 3PW5A 3GOEA 1BVSA 1NKBA 1A6SA 2W9CA 2FPKA 3G6VA 1D8YA 1YN4A 2K60A 2LFIA 5AKHA 3WKEA 4RQ6A 5CJ7A 1QQ7A 4C56C 4YR0A 1RWSA 1EUVB 2LWPA 2F77X 1S97A 1WXSA 2QKQA 1JXEA 3NRZA 5KT3A 3A4SC 2YMPA 4YG2A 2KX0A 1RFAA 2ZIXA 1L0VB 2KAJA 1ZQNA 1M6YA 1ZQKA 4BDPA 3ZO5B 2WNMA 4J9KA 2KVCA 1L6NA 4KX5A 1ISNA 4DQOC 3GV8B 4G50A 4W9KA 4MF2A 4F2RA 4BKTA 2IY1B 3RJFA 5HNKA 8ICLA 3AEAB 2JYTA 2J6TA 2HBJA 9ICIA 2AQ0A 4FLHA 5J0TA 3HKZC 1JWMD 5BO4B 4XDDA 4BFRA 1YD8U 1XF5L 4XGAB 2QILA 4NM2A 1EO6A 3CYMA 2HHTA 1MG8A 1K1SA 1Q0WB 2G0AA 5ALDA 2ZG6A 1UA0A 1R7SA 3IG8A 4F8CB 3D2NA 1UELA 4NAMA 2O2VB 1RXWA 2H3ZA 4DL7A 1ZDXA 3EECA 3Q8CA 5CWRA 1MJDA 2Z0EB 1Q8KA 4QWDA 2KVRA 4CCHA 4KLEA 2Q0ZX 2BBCA 1D6EC 1UWMA 3PT2B 1ZD3A 3IV6A 4YMOA 2GOWA 3H6NA 4KGSA 1EWCA 2RQ5A 5DG7A 2KIWA 1TS3A 5D46A 1YJIA 3MP9A 2LM4A 2BGFA 4MEXA 1WFYA 2BKFA 4P4PA 1XO1A 2R2QA 2P66A 3ORYA 3CF6E 2LVOA 2GOLA 4BOZB 2Y9TA 3G6YA 3AEEB 3KH0A 3VAWA 1TVAA 4L23A 4MJSB 3HM3A 3V05A 2BPFA 3T5KA 1WE6A 2KACA 1MQ3A 2IMWP 3NS8A 2GBRA 2G3QB 2J0KA 3TQ1A 2JZZA 4LTUA 1V80A 5CTRC 3N30A 1HUOA 4KLUA 4FXCA 1C4PA 1WI0A 2OEHA 2LKYA 3N20C 2VZKD 1ZQWA 1Z4NA 4JWMA 1X1MA 2EDUA 3KZXA 3QUTA 4Y2QA 1GB1A 4DO9A 1D9FA 2EANA 3NS1A 3WK6A 4F5QA 1X6JA 5AKEA 8ICJA 4C8LA 1CK1A 3E0FA 1QOBA 3LYSA 3PHWB 3V6CB 4UARA 3NY5A 3AE9B 4HROA 2W54A 4FHKA 4MSMB 1YT3A 3PSEB 2AL3A 2FLPA 4FN2A 1J7AA 3RFAA 2KQSA 1ZJNA 2WF7A 2WF9A 3OTQA 4FZLA 3ZTDA 1YX5B 5DB7A 2IOFA 2WXNA 3MHSD 2ASQA 2OM6A 1WCNA 4I2CA 1L3SA 5HI1A 1UQVA 3T79A 1O03A 4F1SA 4J9QA 3OSNA 1L7OA 1FXIA 2AQ4A 2CHXA 4MM3B 5IIIA 1Z1VA 3PX4A 3RNCC 1WJUA 3RF9A 3VC8A 2KD1A 5D7GA 5HKHA 1PFDA 4RNNA 7ICGA 1SB3C 3W1SA 3R8BA 2KFZA 1SEBD 3TEYA 4USAA 3C0RB 2F44A 2BT6A 3MC1A 1FPYA 2BCUA 1HEKA 3QUBA 4EUTA 4OCZA 3AV8A 4Z6DA 3OGUA 4PGQA 2MJDA 4XDCA 1WX7A 1XO3A 2M17A 4NJ6A 1FEZA 2MUTA 3H4DA 5HMMA 5ALLA 3ISCA 4KN7A 1KFSA 4ZRKA 2WXGA 4EYIB 5J2RA 2RR9A 3SFEB 4HK2A 3ZI4A 2A4ZA 4J03A 2KV2A 5IOIA 2F8KA 2IBIB 1XWLA 2BS2B 3A1QA 3MC9A 1C1YB 2LXCA 3MGIA 4W9DA 1C77A 1ZQIA 2OJRA 3K9OB 3URYA 3ZXVA 1L3UA 1D3ZA 1JQ4A 5L1IA 1V2YA 4O5KA 3FILB 1Z00A 4J9NA 2KLCA 4HPLB 4IS7A 4A90A 2QMTA 4R8UB 5AEKB 1J7CA 3DHHC 2WAQC 1XCQL 2KJRA 4GC6A 2EQYA 3TADC 4ANWA 7ICTA 1NK0A 2JV3A 2ZUCA 2Y5PA 4DF8A 2BPGA 2N0SB 4U7CA 3AE8B 3HW8A 4RQ8A 1TBEA 3Q14C 1E8ZA 5AKJA 3ML9A 4ECYA 4WAFA 2BTEA 4IM2A 5KG3A 2DHZA 3U8ZA 3CRXA 2NVUI 4MH8A 3QZ8A 2FMQA 2D5GA 4JQWC 3KBBA 4F92B 4RT2A 1BNOA 5CHWA 4WJPA 3HHMA 3L16A 4QZEA 1OQYA 2FAZA 1XT9B 4TMAB 3BQ7A 3T5HA 3BK2A 1UGJA 5KFAA 2MSED 3N1ZC 1BXTA 2PMVA 1IYFA 4NLKA 4O1NA 2WXFA 1GAQB 5AI0A 1NKCA 4RNOA 3AL0B 1Q46A 2BHNA 2I1QA 4BX9C 4FFDA 3K1ZA 2KANA 1NK6A 2VA8A 1NDDA 4PHAA 2JZPA 3GIIA 4M0AA 1NJYA 4LNNA 2H5XA 3Q8MA 2G1EA 2D8CA 3C21A 1ZQGA 3KZIU 4BVUC 1ENFA 1NK8A 5J17A 3A33B 2KD0A 3W2DA 1LO5D 4RMAA 4HJGE 4M2YA 5KFHA 3N1XC 1C7YA 3PNCA 5JUMA 3QYPA 2K0PA 3PV8A 1ZQHA 1IG6A 1N56A 2C9WB 1JI7A 2EZYA 4KLMA 4DHZE 1KEJA 3J9CA 3UIOB 3HVDA 2W9CB 3QX1A 4ICAA 1S10A 5AM3A 1ESFA 4I2GA 1A77A 4RUAA 2XY5A 2HOFA 1IGCA 4HYKA 1COKA 1C20A 1QQ6A 4JV0A 5JTIA 5B66U 3AEVA 1NNLA 2JWUA 2NCNA 1ED1A 1D5MC 4KSKC 2DWQA 3LXFA 1JN3A 1L8LA 4LZDA 3S6JA 2JRIB 2UU7A 4IR9A 5CEHA 5AM2A 1PGAA 2K5PA 4YTNB 4Y2VA 2W9AA 5F9LA 2M56B 4KZCA 2MBEA 5GMVA 2KN5A 3SV3A 2HVHA 3RZWC 2PLPA 1C3TA 5L1KA 2KLGA 3UF8A 1TZ1A 3Q3MC 1TY0A 4ACOA 2BQUA 8ICUA 5DKWA 3MC0B 5C1ZA 3WK5A 1BPYA 3N3KB 5DQIA 3DBRI 3ZJUA 2JXJA 1P0RA 1YMHE 3M8SA 4GLXA 5IN7A 3DVNU 2CHWA 9ICOA 2J7QB 4KN4A 5BYSA 2BR0A 4IG7B 1WGGA 3TKAA 9ICFA 4C4TA 4QWEA 3C2MA 4K1RB 3NJTA 3MFGA 3DDCB 1FFVA 4IWQA 1L7MA 4ED1A 2I9GA 4HKQA 4XC2A 1LV5A 4LCDE 2LUEA 2D3GA 3QUQA 1NBFC 2KKVA 5KFGA 5A0LA 2DPIA 5TZVA 1P98A 2KTQA 2ONQA 4GSWA 3UIPB 4AUQC 1TT5B 4Q43A 7ICSA 7ICNA 7ICHA 3HP6A 7ICFA 4YWGG 4TUSA 3GIMA 1U45A 1B0XA 1TZOA 4BXOA 2M8SA 2R18A 4EEYA 1PQSA 2KZZA 1K51A 3N7RC 2LUMA 3TEZA 2C2RA 1SF0A 1QH9A 4J9PA 5JHBA 2PFOA 2WXMA 2E3TA 2DZMA 1K50A 2DQNB 2Z0DB 3SZ2A 1FM0D 1TAMA 9ICEA 4AP9A 4YCXA 4YMNA 1NK5A 2LEKA 2AH5A 2HI0A 2ASLA 1D9DA 2EAMA 1WRDB 1PUZA 3OHAA 2ZNVB 1XLNA 3RH6A 4QZCA 3KWVA 4Z6EA 4NQKE 2MBHA 2ODGA 3M9MB 4IRDA 2G4SA 2FIFA 2MBOA 3Q8AA 2JZBA 2P6RA 1N48A 3AN1A 3GQCA 1QOGA 2UYZB 1Q3UA 3T3NA 2CXYA 4CYEA 3E2EA 4NXZA 2DLBA 9ICQA 8ICIA 4ECQA 1TY2A 2IY0B 2J6UA 3DBHB 2P35A 1NOMA 1LVHA 4DOAA 3FDSA 4MDKE 3PS6A 2IOHA 3H0RB 3PHXB 1YQ4B 2W9BA 2XCAA 2C28A 2ZXIA 3GILA 4JX1C 4MF8A 2WTFA 1DOIA 4HKZE 1GG3A 1ET6A 1AW7A 2JRHA 4HPMB 1KDHA 4KLSA 5CP2A 1J2NA 4P4MA 2QJLA 3VRBB 2J0MA 3ZDAA 2NO5A 1WYWB 1WG8A 4I27A 1FCLA 3WAPA 4M0WA 5J0OA 2ZVOA 1OXJA 2R61A 4YD2A 1MVKA 4P0QA 3B2FA 2L83A 1URJA 3CSFA 1SWVA 3PREA 3V3XA 2JHDA 2N7DA 2JPHA 4E74A 4IW0A 3UI3A 5KFZA 4DS5A 5J2IA 1GOZA 4A55A 1S0OA 3EW9A 3IHQB 2QHOA 3WK9A 1YN5A 3MFIA 4KV2A 5L95C 5J2JA 2D10A 2HOQA 2W82A 4QJFB 2KE7A 3LDAA 2IO1B 1F0ZA 1J0GA 4HVBA 2MUTB 1QOAA 5ALVA 2XCPA 3EC8A 2KDBA 1WGKA 5CHFA 3WK8A 1V8CA 2HHWA 4RCOA 8ICKA 3R7RA 1K1QA 1WGYA 2IHMA 1YX6B 2ZJDA 2L76A 1OGWA 1V1OA 4DCCA 2VJ4A 3A1QB 1SJHD 3IRUA 4KX3A 3C2LA 4DS4A 4LDTD 2JSVX 1ZXIA 3BQ2A 4Y2SA 2WWZA 3D2SA 1KBUA 1A70A 3PGEA 1SGGA 7ICRA 3Q3NC 1Z00B 1L0YB 3GS2A 2KHVA 4AP4C 5KFNA 2IA6A 4OJ5A 1F77A 3NZ3A 1ZXHA 4DXFA 2I6XA 4O0IA 1VJ5A 1I4HA 1IUEA 2KICA 3ETLA 2EKIA 2INCC 3SAFA 3NZSA 5BMIA 1T0YA 3AUOA 5JXVA 2WXPA 4QWCA 1VZ8A 4F4KA 4XUSA 2DZJA 3RNGC 1SBBB 3UPQA 2ISOA 4LNFA 4REZA 3DBRB 1RRBA 5C2TB 2ZPNA 3RRHA 4YFKA 1T4GA 3R3MA 5KFVA 3QX7A 2GWSA 2F1IA 1RLFA 2YX8A 2E8NA 1WM3A 4B9VA 2JY6A 5TISU 4C7ZA 2K4EA 4J9RA 2L52A 2O6VA 1EU4A 3RRGA 2BKEA 3DEEA 2ZIVA 1L8OA 2KO3A 2MU2A 2OWOA 3ONSA 2AJQA 2HBLA 2QC8A 3UQBA 1DYQA 5D49A 2JXXA 4IOIE 4JB3A 4MHVA 1V86A 1XCTL 3EYZA 1RYJA 5AI5A 4JGHB 3RFZB 2K1FA 2CN1A 1UCVA 3QXGA 3M9OB 8ICMA 3IFWB 4UBCA 4BKGA 5HG2A 2KN7A 2M4NA 2QARA 4M8MA 2KZRA 3RNEC 4G0NB 1FNWA 2KMMA 2KQ7A 2KQ4X 1UBQA 2W9MA 3DBLB 4DXAB 1MSWD 4ZYSA 2QB1A 2UVUA 2FIDA 2WDQB 3SD7A 4IM0A 1U9LA 2G45B 4R65A 2WHEA 3UMCA 4EBCA 4GFJA 5BOLA 8ICXA 2EMTA 1E8WA 4YSYB 1V5TA 5KFKA 1JRPA 2HHSA 1WX9A 3RCZA 1WRIA 3T8MA 5EWFA 3LK9A 3M3JA 5KAIU 2FLNA 3KUDB 4M9LA 2VH2A 5EWEA 2G09A 3VR8B 4Y2XA 4FS1A 4OJLA 3SYZA 2KTFA 3B08A 1AARA 4KMUA 8ICBA 1CMXB 1Z3EB 1KLGD 4QZ8A 1X9WA 3D6JA 4DHJD 1MA7A 5KFYA 3I28A 3J81j 3KLSX 1ZRMA 4TUUA 1T94A 3F2CA 3HPOA 1S0VA 3HUIA 3SEBA 1XSLA 9ICBA 2NTTA 9ICGA 2VIXA 4B95A 4ED7A 3VFKA 3ENEA 4ED0A 1UZXB 1Y56A 4F93B 4JV1A 2C7MB 3AXCA 2NPTA 2KOXA 3GE3C 2WU2B 1V81A 4IKGA 1WCLA 5KNIA 4WQOB 1RFKA 2WDTB 1QTMA 2QSDA 4JUZA 1XLPA 2WB1C 2KWUB 2GBJA 1TAUA 4DBGA 1JW9D 2M0XA 3MDAA 4FJYA 4IQUA 5DQGA 4B9KA 1I4GA 3JW0X 1Y8RC 2LRWA 4NL9A 5KFBA 1OUQA 3WAMA 4QW8A 4I2BA 1L3VA 1SZPA 2WFAA 3N4MB 1TGZB 3PZ8A 2KFKA 1KSPA 3PR4A 3ECIA 4EZKA 2JR5A 4C4RA 1L2NA 4KLQA 2MLBA 5DPWA 4IRCA 4IR1A 5ALQA 1H4RA 4PZNA 5ALHA 1Q3VA 4NY0A 5KFSA 2E8PA 4WURA 1DGJA 3DWMA 2PIAA 9ICUA 1NJXA 4C4SA 4BXOB 4P16A 4KGTA 2V3PA 1PVQA 3FAHA 3TFSA 2DZKA 2LPEA 5J18A 1SKRA 4HAIA 3RMKC 8ICVA 1A76A 2BVCA 5HMLA 2KDMA 4HPPA 8ICYA 3AE7B 4B9MA 5IIJA 1KLVA 4NQLB 1RG6A 2C5LC 1HZ5A 7ICQA 3DPDA 1C78A 3ZDTA 3EGRA 2HCFA 2KKCA 4IQVA 4DQRA 2PFPA 1L5UA 1BT0A 1IGDA 1ZUD2 2XNAC 4UQGA 3DCGA 3GV5B 5KT2A 5J2KA 3R2TA 1T0QC 5AKIA 4YVZA 1MQ2A 1WMHA 3TI0A 2JZBB 1RZTA 3LB8C 4W9CA 4F7ZA 1QLBB 2HJ1A 2JXTA 1PZNA 1X9MA 4KKIA 3N7PD 2AEHA 3PV1A 2Z8LA 4UB4A 3VUWA 2AXTU 1LKYA 4NLNA 3QU4A 2RPQA 1TKDA 3O13A 2RD0A 9ICAA 5E79U 2W9BB 4DL4A 4OZAA 2I2YA 5DPSA 8ICQA 4Y2PA 4II3B 1CUKA 3B0AA 5ALUA 1KW4A 5K4LA 3OWEB 2YB4A 5G55A 4CHKA 4P2HA 1ZPSA 3ZJTA 2BQRA 3ZW3A 1HJPA 3C19A 1AROP 2CR5A 2UVRA 5DDMA 2H3FA 4F91B 3SI8A 4DFKA 3SQIA 2RGFA 4ED2A 1DK3A 3A4RA 3HRDD 4M0WB 4F71A 2FI1A 4EX7A 5AZHA 4W9LA 2ATLA 2NR2A 8ICNA 5ALKA 3MJ5A 4ANXA 5JH5C 4P0QB 4M47A 2V0GA 1ET9A 4O3RA 1RPLA 1ZQOA 4OW0A 2INNE 4HEA1 2IHNA 5DGBA 3BY4B 5DB6A 2KJ8A 2PMZC 3PR5B 2A3VA 2WXIA 4YXMA 3KHGA 2NRVA 2UVVA 5HR6A 7ICLA 1VCBA 3PZDA 4FADA 2G9HD 4DSLA 2HHVA 4N58A 4PL1A 4GXBA 4ICUA 2MA9B 5BMHA 1QILA 3U7DA 1WR1A 4PS8A 4E3CA 3K4GA 3ZLZA 3Q8PB 2KKPA 1X6IA 5IAAC 2K9XA 3R7QA 1ZQBA 2ISPA 1HQRD 4JWSC 5KFRA 5DGAA 3EPIA 2IJ0A 2EAOA 2PVOD 5DG9A 5J8YC 2CJNA 2RDHA 3H8SA 5CB1A 3OJ3A 5KFJA 4PYZA 1T5XD 1KKXA 4HRSA 1OTRB 4UB5A 3QEAZ 4YN4A 1XSPA 4O3SA 3FYHA 1P7DA 2LXAA 4FZNA 3V6HA 1NK9A 3RR7A 4AOFA 5EWGA 3OLMD 3H8HA 1QT9A 3L08A 5C23A 3BINA 1VD2A 3CSTA 4ARCA 3JPRA 4UAVA 2RHFA 1DRGA 1WWTA 4EFOA 2Q5WD 2INDC 4MFAA 2N9PC 4C7YA 1SE4A 1IXRA 1ZOLA 1CJEA 2V4QA 4KGRA 1RYUA 2X8XX 3E58A 4GDLA 3P42A 2BB6A 2Y5CA 1JIHA 4NV0A 4UB2A 4M9GA 4DDGD 5KG0A 4RPYA 2W9NA 4NJ8A 2F76X 3PSTA 5EE1A 3KWLA 5J0WA 2YQEA 3AU6A 5HFYA 1I4PA 5ALNA 2AYOB 5ALXA 2O6VB 2WF5A 5J2CA 2WAQF 2LRUA 2ZIVB 3A9KA 2K89A 1YQBA 2BKRB 4KTQA 3DOWA 5CX3A 3RYTA 2MAXA 2IPKD 4GU2A 1Q10A 1E7VA 1D5XC 4B9SA 2DGZA 3H7IA 4EBDA 4DF4A 1C4AA 1JWUD 5ALTA 2RLTA 2DKZA 2MRLA 3NASA 4UAUA 1YQ3B 1G6JA 1C79A 3RNBC 5DBCA 5ALFA 2LHTA 2B0CA 2HMXA 1I4RA 1TKEA 4EKUA 1I4XA 3MR6A 2VH1A 2NRTA 2LHEA 2QARB 3MBYA 1PGXA 2Y1JA 4BKSD 4I2DA 4YR2A 3C28A 4K4GA 1ZQZA 1UA1A 4QNLA 2KJ5A 5AKLA 1Q1OA 2J0JA 2LYHA 3FC4A 1VDVA 1U47A 4PHEA 3V6JA 1RQNA 3JVZX 4KITB 1ROEA 4TQ0A 4GC7A 2EZZA 2BZFA 1UWXA 2R8HA 4GXJA 2K4IA 3HK0A 1NJZA 2E6XA 1QZEA 5T8IA 4RFBA 2AGPA 5J0YA 4TSSA 2LGXA 2M0NA 3IN5A 4YSXB 3QK0A 2HW3A 5KFDA 3Q8FA 2VRRB 1FXAA 2AX5A 4M9NA 1WYGA 4C4VA 4XWTA 4C8NA 5IIKA 1TAQA 3SR6A 2XEWA 4WJ3B 4GGQA 2DL0A 4J3OD 4ZRQA 4YXJA 8ICCA 1S8OA 3SENA 2AWTA 2WHIA 4X5VA 1ZQYA 4Q45A 1Z5SB 2JT4B 2LMCA 1N60A 2SAKA 2YMLA 2WDVB 4W9GA 4KMOB 4I2FA 2NPTB 1LM8B 4UDUC 5DG8A 1AYFA 2K22A 4QZDA 2D6FC 3P4PB 3KUCB 4ECRA 3TACB 3JPOA 1ZKHA 4H2AA 4AS1A 2MW5A 4DL6A 1SL2A 5KFWA 1VZ6A 8ICWA 1KM7A 4XQ8A 3BVZA 4MH0E 5D3IB 4XZ4A 1S3SG 1HXYD 2EKEC 1LGRA 4YXDB 1ZQVA 3RBEA 5KG7A 1E5WA 7ICUA 2XN9C 1JUDA 2REXA 4K4IA 2KFKB 2VKQA 3AQEA 4OJ6A 4BJQA 3PO0A 5CRXA 1L4DB 4O3NA 4RH6A 4XE0A 2X38A 3I76A 2HOIA 5DDYA 2F8LA 2D2QA 3GB1A 2EAPA 1PK3A 2N9KA 1RM6C 2GBNA 2FPLA 3CMMB 3QQ8B 4ZRPA 4EYHB 4KLGA 1B43A 5LNK1 2KYWA 4ITKA 4KSLC 3BQ0A 2KTRA 1LB2B 4UATA 4P7IA 1KRHA 4RQNA 3GE8C 3BJYA 3X0WA 1J19A 3DWGC 1TK8A 3TSSA 5E6JA 4ARIA 2ZCCA 4AJYB 2V4LA 2ZIWA 2NTSA 1J97A 3WKCA 1STEA 2D3BA 3BZDB 2MRPA 5DB9A 2PXIA 2PI4A 2FCNA 3VXWA 1SV0A 4BWMA 5DBAA 3NVVA 3RR8A 2MP2A 3APFA 4KZ0A 2KZMA 5HR7A 2UVWA 3V7LA 3KFUF 3Q6BA 1VR9A 2HSZA 2J52A 2MJEA 2G5IB 3LYYA 4W9IA 1WMHB 2J6SA 4G3IA 4HCPB 3NRWA 4CQNA 1JMSA 4OJOA 2C60A 3ZQ4A 4B6JA 3KHHA 4KLLA 2L05A 2DYMA 3JPTA 2LZ6A 1LKYB 3A0BU
chains in the Genus database with same CATH topology
1AWDA 1YJJA 1L6VA 3AM9A 1XEEA 1F0ZA 1QOAA 2I38A 1EM7A 1E6EB 1P7EA 1V1PA 1TKGA 2HTME 2JU6X 1WGKA 4A9AA 5TSSA 1V8CA 5AUIA 5MPOA 2DBYA 1JCKB 4RCOA 2JX5A 5AUKA 3AECB 1V1OA 4KX6B 1SJHD 1M4VA 2JSVX 1ZXIA 3E9SA 3T3OA 1V97A 4WH4A 1A70A 1FEHA 4RGMA 3P63A 1C9FA 1L0YB 3GS2A 2JQRB 3KQ4A 2RPVA 3AEDB 1F2RI 1F77A 3NZ3A 4B0EA 1ZXHA 4DXFA 1I4HA 1I7HA 1JWAD 5BMIA 1IUEA 2EKIA 5JXVA 1EU3A 3AH7A 2H89B 2RDGA 2WXPA 4NAWB 1VZ8A 1FFUA 3P1MA 1L4ZB 3E56A 3U4EG 1ZOYB 1SBBB 1UNSA 4REZA 1IBXA 1DOYA 5C2TB 4IDIA 2ICIA 3VR9B 1P7FA 1SE2A 2OHFA 4RGOS 1FO4A 1QQRA 1YN3A 3PZ7A 4ZHOA 3AEGB 1BUIC 3AMZA 2INPE 2WXHA 1ZP0B 1JALA 5GXGB 2HDEA 4C7ZA 5H92C 2BW2A 4RGTA 2MH7A 2L52A 1EU4A 1YN4A 1B9RA 2LFIA 4MACA 4L1BA 1CZPA 4C56C 1RWSA 1B1ZA 3NRZA 1F2RC 1OQQA 1OFFA 1TS4A 2J42A 1DYQA 4IOIE 1L0VB 2KAJA 1XCTL 2WXKA 4JE3B 3RFZB 1RYJA 2QEJC 5G5HA 1BMLC 2WNMA 4DQOC 3ABVB 3ZYYX 3IAS1 4A90A 5HG2A 1KTKA 3IAM1 1FNWA 2KMMA 1HA5A 3AB5A 3AEAB 2JYTA 2KQ4X 2Y3AA 4GDLB 4MT5A 4D2KA 4ZYSA 1N5XA 1JWMD 2WDQB 1VZ7A 4XDDA 4DXGA 1XF5L 1GPXA 4P6VF 2QILA 3U7ZA 3TUOA 4XWWA 4YSYB 2RMMA 1JRPA 1R7SA 1WRIA 1NVID 4NAMA 1KFYB 2WXLA 3U2SC 4A6QA 1ZDXA 3Q8CA 2DYOA 3VR8B 1TJEA 2EELA 3AE3B 2BBCA 1D6EC 1UWMA 3AEBB 2MEKA 4KGSA 1EWCA 1KLGD 2M0AA 5I4DA 1GB4A 1TS3A 3IXSA 3KLSX 1YJIA 3MP9A 2FUG1 3HUIA 3SEBA 2W55A 2NTTA 3AEEB 5HHDG 5BYRA 4L23A 4RF0A 4ZOHC 1TS2A 2KWDA 2IGHA 3V05A 1Y56A 3P4QB 2JYEA 1SXTA 2KACA 4LTUA 1DOXA 2WU2B 1EWYC 4IKGA 1C76A 4FXCA 1RFKA 1C4PA 1SSNA 2QSDA 1XLPA 2GRIA 2VZKD 1JW9D 3CWIA 1SJED 1I4GA 1SE3A 4A8XC 1GB1A 3NS1A 3PZ8A 4ZHPA 1CK1A 1JROA 1QOBA 1VLBA 2ZW1A 1MPEA 1PYWD 3AE9B 2TSSA 3AE2B 4HROA 2PW9A 2W54A 4WURA 1DGJA 1UUPA 3DWMA 2PIAA 1J7AA 2BS3B 4P16A 4KGTA 4N59A 2V3PA 3NVYA 3FAHA 2IGDA 2WXNA 4RGNA 3B9JA 1FCCC 5BMGA 2PKOA 1XLQA 4LK0M 5HI1A 2FBWB 2SEBD 5FR3A 3ZGZA 2AQ2B 3BWUD 2AQ1B 1AN8A 2BB5A 1PGBA 2KDMA 2WXJA 1FXIA 5G5GA 3AE7B 4MM3B 1HZ5A 1C78A 2W3SA 3EGRA 2VZKB 1IGDA 1ZUD2 2XNAC 5D7GA 3BVGA 1PFDA 1SB3C 3W1SA 3R8BA 1L5PA 3R2TA 2YEPB 1MHHE 1SIJA 1C4CA 1SEBD 1MI0A 3TEYA 2WQYB 4USAA 3LB8C 1NENB 2BT6A 1N62A 1QLBB 2H88B 2JXTA 1ZE3D 4KKIA 2BS4B 2Z8LA 3AV8A 3O13A 2MJDA 4XDCA 1XO3A 1FNUA 4OZAA 2I2YA 3OWEB 1FIQA 2WXGA 3ZJTA 1ZPSA 4L2YA 3SFEB 2WXRA 2BS2B 2N9LA 3U52E 4C80A 4N6EB 1C77A 4TQ1A 2K3UA 3IT6B 3URYA 3HRDD 1OQRA 1JQ4A 3MJ5A 3FILB 2LGIA 1MHXA 1ET9A 1TKYA 5C3JB 3VRAB 1HEZE 1KF6B 1E7PB 2QMTA 2WS3B 2PTLA 2INNE 4GLSC 4HEA1 1J7CA 4OZBA 4OW0A 5H8YE 1XCQL 3EUB2 3BVMA 1NYQA 1WXQA 2WXIA 3BYYB 2ON8A 2Y5PA 4NZLB 4YSZB 2G9HD 3P4SB 2N0SB 3AE8B 1HZ6A 1K53A 3AEFB 4N58A 4NJCA 2BTEA 4WAFA 5BMHA 1QILA 4JPSA 4MH8A 1V1PB 2K9XA 3ZJVA 2D5GA 4JWSC 1HQRD 2IJ0A 2PVOD 5FKAC 4TMAB 1NYRA 2CJNA 2RDHA 3BK2A 1T5XD 1UGJA 1BXTA 3NVZA 1VRAB 2PMVA 4HRSA 4US9A 4O1NA 5D3DA 1N63A 2WXFA 2N7JA 1GAQB 3I9V1 5EE3A 3H8HA 3W5UB 1QT9A 2LJIA 4GDKB 5FK9C 1D5ZC 2JZPA 1CQVA 4ARCA 1WWTA 2Q5WD 1L6UA 2G1EA 3AE4B 4C7YA 2L1AA 1SE4A 1ENFA 1CJEA 1IBXB 4KGRA 1XXGA 3GP7A 2CU3A 2WXOA 3W2DA 1QKZA 1LO5D 3P42A 4HJGE 2BB6A 2Y5CA 1VJKA 3NUHB 4WWMA 3ETRA 1NEKB 2K0PA 1PUTA 1YNTE 3KWLA 1XLOA 5EE1A 4LLGM 5HFYA 4WIPA 1I4PA 1E9MA 3J9CA 3HVDA 5EE0A 1ESFA 4YTPB 4KKJA 1IGCA 3BIID 4RF1A 2JWUA 3NVWA 2IPKD 1Q10A 1D5XC 2BYTA 2GI9A 1D5MC 1E0ZA 2DWQA 1C4AA 1JWUD 3LXFA 2W3RA 1YQ3B 1C79A 1PGAA 2K5PA 3CIRB 4YTNB 1TKEA 1PDXA 3L4PA 1I4RA 2M56B 2B76B 1I4XA 2LHEA 2PLPA 1PGXA 1NI3A 3R2IA 1TY0A 1JWSD 5EE9A 3MC0B 3FC4A 1VDVA 2LHDA 3ZJUA 1YMHE 1KH0A 1N5WA 1ROEA 4AQ7A 1FMAD 1TS5A 2M19A 3Q8BA 4TQ0A 5BYSA 1UWXA 3W5VB 2ACZB 1JWBD 2V3NA 2E6XA 2WLBA 5T8IA 3MFGA 4RFBA 1FFVA 1E10A 4TSSA 1FD6A 1FRRA 1D4BA 4HKQA 4Q2JA 2KN4A 4YSXB 2ZW0A 4WQMA 3Q8FA 2ONQA 4EE2A 3AE1B 2J53A 3B2GA 3TEWA 1FXAA 2AX5A 4YWGG 1WYGA 1TZOA 4XWTA 2WU5B 3SR6A 3N9YC 4YT0B 4J3OD 4ZRQA 1K51A 2LUMA 3Q69A 4R3DA 1I4QA 3TEZA 1SF0A 2LMCA 2WDVB 4PT5A 1N60A 2SAKA 2WXMA 2E3TA 2OEDA 4UDUC 1K50A 2L32A 2J4XA 3MHZA 1T6BX 1AYFA 2MJ3A 2K22A 1FM0D 3P4PB 2IGGA 1L0XB 2LEKA 4H2AA 4AS1A 3WCQA 1XLNA 1VZ6A 5D3IB 3BVZA 2V4IB 3KWVA 1HXYD 3SFDB 1ZDVA 4YXDB 1QF6A 1WSPA 2XN9C 3AE6B 1JMLA 2WXQA 4YTMB 3PO0A 2V0GA 4OZCA 3Q8AA 1L4DB 3I57A 4RH6A 4XE0A 3BYTB 2X38A 3AN1A 3T3NA 1QOGA 4OVZA 4OHJA 2DLBA 3TEXA 1TY2A 3GB1A 2GB1A 2N9KA 4US8A 1RM6C 2CJOA 2WDRB 1ACCA 1FRDA 4ZRPA 5BYQA 1YQ4B 4RNAA 5LNK1 4ITKA 1FNVA 4JX1C 4HKZE 1DOIA 2IDYA 1ET6A 1AW7A 1KRHA 3BK1A 1K52A 3RPFC 4ARIA 3DWGC 3TSSA 5E6JA 3W9CB 2QIEB 2PVGC 2QJLA 3VRBB 2NTSA 1QOFA 1STEA 3BZDB 3IT4B 1T3QA 3AE5B 1N61A 3C8YA 1FCLA 3EA6A 1KLUD 4M0WA 3VQIA 3NVVA 3HVZA 4B0MA 2R61A 1MVKA 3FILA 2AQ3B 1J7BA 3B2FA 2L83A 1VR9A 3V3XA 2J52A 2MJEA 3P4RB 3LYYA 4JWUC 3UI3A 4CQNA 3ZQ4A 4A55A 1GOZA 1TYGB 1YN5A 3Q8EA 2FE8A 2DYMA 2YEPF 2WP9B 2NMQA 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWD A;  1UWM A;  3AEB B;  3HRD D;  1YJJ A;  1L6V A;  3AM9 A;  1OQR A;  1F0Z A;  1JQ4 A;  1N5W A;  1QOA A;  1ROE A;  1FMA D;  2M19 A;  1E6E B;  1TKG A;  2HTM E;  1TKY A;  1WGK A;  3W5V B;  3VRA B;  4A9A A;  1KF6 B;  1E7P B;  1V8C A;  1YJI A;  2ACZ B;  2WS3 B;  5AUI A;  2DBY A;  1J7C A;  1JWB D;  3HUI A;  5H8Y E;  5MPO A;  2JX5 A;  3EUB 2;  2WLB A;  5AUK A;  1NYQ A;  1WXQ A;  3AEC B;  1FFV A;  2W55 A;  4KX6 B;  3AEE B;  1E10 A;  4YSZ B;  3P4S B;  1FRR A;  2N0S B;  4ZOH C;  1ZXI A;  3AE8 B;  3AEF B;  4N58 A;  3P4Q B;  1V97 A;  4LTU A;  3LB8 C;  1A70 A;  4YSX B;  1DOX A;  2WU2 B;  1EWY C;  4WQM A;  3P63 A;  3AE1 B;  4FXC A;  1RFK A;  2K9X A;  2JQR B;  4JWS C;  1B9R A;  3B2G A;  1XLP A;  1FXA A;  3AED B;  2AX5 A;  1JW9 D;  2PVO D;  1WYG A;  3CWI A;  1NYR A;  2WU5 B;  3SR6 A;  1JWA D;  1I7H A;  2CJN A;  1IUE A;  4YT0 B;  2EKI A;  3AH7 A;  2H89 B;  4HRS A;  3NVZ A;  1SF0 A;  1FFU A;  2WDV B;  4US9 A;  3NS1 A;  3P1M A;  1N60 A;  4ZHP A;  2E3T A;  1N63 A;  1ZOY B;  1GAQ B;  1JRO A;  1QOB A;  1DOY A;  1VLB A;  4IDI A;  5C2T B;  3VR9 B;  1AYF A;  2MJ3 A;  2OHF A;  2K22 A;  1FM0 D;  3P4P B;  1FO4 A;  5EE3 A;  3AE9 B;  3AE2 B;  4HRO A;  1QT9 A;  3W5U B;  3AEG B;  4ZHO A;  2LEK A;  2W54 A;  3AMZ A;  1DGJ A;  3DWM A;  2PIA A;  3WCQ A;  1J7A A;  1JAL A;  1XLN A;  1ZP0 B;  2BS3 B;  1WWT A;  5GXG B;  4C7Z A;  5H92 C;  2MH7 A;  2L52 A;  2Q5W D;  1L6U A;  4N59 A;  3SFD B;  3NVY A;  3FAH A;  2G1E A;  3AE4 B;  4C7Y A;  3B9J A;  4YXD B;  1QF6 A;  1CZP A;  3AE6 B;  3W9C B;  2PKO A;  1XLQ A;  1RWS A;  4YTM B;  1CJE A;  3PO0 A;  2FBW B;  2CU3 A;  3NRZ A;  3AN1 A;  1QOG A;  1OQQ A;  1OFF A;  2Y5C A;  1VJK A;  1FXI A;  5G5G A;  3AE7 B;  4WWM A;  3ETR A;  1NEK B;  4US8 A;  1RM6 C;  1PUT A;  1L0V B;  2CJO A;  1XLO A;  2KAJ A;  2WDR B;  3KWL A;  5EE1 A;  1FRD A;  1RYJ A;  5G5H A;  1YQ4 B;  2W3S A;  1E9M A;  3ABV B;  3ZYY X;  1ZUD 2;  4ITK A;  1PFD A;  4JX1 C;  5EE0 A;  1SB3 C;  1DOI A;  1L5P A;  1KRH A;  3RPF C;  1SIJ A;  3DWG C;  4YTP B;  2KMM A;  2WQY B;  4USA A;  3AB5 A;  1NEN B;  2BT6 A;  3AEA B;  3BII D;  1N62 A;  1QLB B;  2H88 B;  2PVG C;  2QIE B;  2QJL A;  3NVW A;  3VRB B;  1QOF A;  2BS4 B;  1N5X A;  2WDQ B;  1T3Q A;  3AE5 B;  1N61 A;  3AV8 A;  1E0Z A;  2DWQ A;  3LXF A;  2W3R A;  1GPX A;  4P6V F;  1YQ3 B;  2MJD A;  1XO3 A;  3NVV A;  2K5P A;  3CIR B;  3HVZ A;  4YTN B;  4YSY B;  1TKE A;  1PDX A;  3L4P A;  2M56 B;  1J7B A;  2B76 B;  1JRP A;  1R7S A;  2L83 A;  3B2F A;  1FIQ A;  1WRI A;  2MJE A;  3P4R B;  1NVI D;  5C3J B;  3SFE B;  1NI3 A;  1KFY B;  4JWU C;  1TYG B;  2BS2 B;  5EE9 A;  3VR8 B;  1TJE A;  4C80 A;  3AE3 B;  3FC4 A;  4N6E B;  2WP9 B;  1VDV A; 
#chains in the Genus database with same CATH topology
 3NGD A;  1SIF A;  2C7N B;  1QSY A;  3GDX A;  4O9M A;  3C23 A;  3QU9 A;  4J9M A;  4UAZ A;  4CRX A;  3PW7 A;  3VUY A;  5J0R A;  2BWF A;  1CRX A;  4A9A A;  2W8K A;  4M00 A;  1KFD A;  2ZIX B;  3Q8S B;  2B3A A;  5AUI A;  1TE2 A;  4O3O A;  4TUR A;  4URK A;  3H0L B;  1JX4 A;  3NTU A;  2CKH B;  5AUK A;  4FUL A;  1SL0 A;  4MGK E;  4G3X B;  3RN9 C;  4I2I A;  4UB1 A;  2V4R A;  4KLJ A;  3QJZ A;  5JRT A;  3HX0 A;  4XYC A;  2R8I A;  3CNH A;  3OJS A;  5AI6 A;  5KL1 B;  2MBQ A;  2XK5 A;  4RGM A;  4NLC A;  3VVW B;  1PVR A;  1C9F A;  3NHE B;  3KKA A;  2JQR B;  1U49 A;  3KQ4 A;  8ICE A;  1WJ4 A;  4FA6 A;  2HBK A;  1UF0 A;  2RPV A;  3BZK A;  4GDK A;  9ICT A;  3JSV A;  5DCN A;  3ZDB A;  2RDG A;  3IHP C;  3F2D A;  1H38 A;  2BPS A;  3P1M A;  3L5K A;  2HD5 B;  3V7K A;  1UNS A;  1E90 A;  1DOY A;  5AKX A;  3VR9 B;  2OHF A;  1P7F A;  1FO4 A;  2JRZ A;  2K4H A;  1QQR A;  4PZO A;  4S0R A;  5JZE B;  3AEG B;  2PPH A;  1ZD4 A;  1B22 A;  2INP E;  1SWW A;  5ALW A;  3K9P B;  2WXH A;  1ZP0 B;  5AKG A;  5GXG B;  2K39 A;  1DXS A;  5CR0 A;  4F5N A;  3Q3F A;  9ICL A;  2MH7 A;  5H92 C;  2KWC A;  3L0W B;  5AK6 A;  4L1B A;  4KDI C;  4OO1 J;  2YY6 A;  2BWE S;  4PPX A;  1YZ7 A;  1F2R C;  1OQQ A;  2ZEQ A;  1OFF A;  1XQQ A;  4EOY A;  1ZQ1 C;  1TS4 A;  3IG3 A;  2J42 A;  2C7H A;  1BPX A;  1SXE A;  5J2G A;  4Y2T A;  1NK7 A;  3TMP B;  2L8J A;  2VJ5 A;  2QEJ C;  1BML C;  2K4P A;  3C2K A;  2XIC A;  3UMB A;  4DFM A;  1UBI A;  4ZRJ A;  5LXI B;  2FDR A;  3MR3 A;  2OH2 A;  2XY7 A;  3DDH A;  3I1Y A;  3OJ4 B;  1MN8 A;  3IAM 1;  4I28 A;  3ZDE A;  2Y9U A;  4GDL B;  4MT5 A;  4D2K A;  1ZQE A;  4DEZ A;  1K8R B;  1Z2M A;  4JK1 A;  1DGS A;  1V85 A;  3RBD A;  1VZ7 A;  2MQJ A;  5ALZ A;  1XD3 B;  3AQF A;  1GPX A;  4QWA A;  4WWN A;  1I35 A;  3AI5 A;  4XWW A;  5AM5 A;  3FKY A;  2RMM A;  2EMS A;  3A9K B;  2BCS A;  3TIX A;  2I5H A;  4ZYN A;  5ALY A;  1NVI D;  2HE7 A;  3A0H U;  1ZQA A;  5H2F U;  4DQI A;  1V49 A;  2KWV B;  3U2S C;  5F9N A;  4A6Q A;  3PY8 A;  3X23 A;  2RDJ A;  1KL9 A;  2QB0 A;  4A8E A;  4ECT A;  2EEL A;  3OJU A;  3AE3 B;  3ALB A;  1ZD5 A;  2XO7 A;  3GIJ A;  3KD3 A;  3AEB B;  3VTU A;  3CP8 A;  1OEY J;  5KAF U;  1F5S A;  2LGS A;  4FE3 A;  5AIB A;  1X9X A;  1GB4 A;  3LWL A;  3H7S A;  1U4A A;  1WR6 E;  4FJZ A;  2FUG 1;  5ALP A;  1XC9 A;  1L7P A;  5KFX A;  3OAW A;  4IC9 A;  4II2 B;  2V9W A;  8ICS A;  4S17 A;  5DLG A;  5IKC M;  4M8N A;  3H1U A;  2W55 A;  2XY6 A;  5AZF A;  4FS2 A;  4KLF A;  4FZM A;  4ED3 A;  1SV4 A;  4DOC A;  4RF0 A;  3B0Y A;  3F5A A;  2QLT A;  4ZOH C;  3BQ1 A;  1ZQT A;  2A5U A;  2FCQ A;  4BUG A;  2IGH A;  2KWD A;  3F53 A;  1SXT A;  1DOX A;  4IM3 A;  1EWY C;  5FP0 A;  1XO0 A;  5AI9 A;  1C76 A;  3ISD A;  1XNS A;  3V62 A;  1DK2 A;  1SSN A;  1BPZ A;  2GRI A;  3QHT A;  3MR5 A;  3LVV A;  3MDC A;  1KLN A;  4TUQ A;  5ALO A;  1SJE D;  3GV7 B;  2ASD A;  5L1J A;  5J0X A;  1MC8 A;  2XVT A;  1UPH A;  1SE3 A;  1S0M A;  5D94 A;  4E71 A;  1QCK A;  3WK7 A;  2FMS A;  2KG5 A;  4ZHP A;  1COO A;  1JRO A;  1WGH A;  1VLB A;  2DZI A;  2ZW1 A;  4JIO U;  3C5F A;  3EFC A;  1MPE A;  4O5E A;  4K7U A;  4TKN A;  2TSS A;  1WWV A;  1U48 A;  2W7O A;  3RTV A;  2B6G A;  3VTW A;  3UGB B;  1UUP A;  1F44 A;  2IO2 B;  5E6N A;  1KRP A;  4C4V B;  1WGD A;  3RNF C;  3M1Y A;  3SAH A;  2LBO A;  4CF3 A;  1S0N A;  2A19 A;  2BYE A;  4AYB C;  2N9X A;  5BMG A;  4RGN A;  3B9J A;  1FCC C;  4LJX A;  1TV9 A;  4B9N A;  2PKO A;  4RQ3 A;  3V61 A;  2N7E A;  1WZ0 A;  1V5O A;  4W9F A;  5FR3 A;  3RH5 A;  5KFU A;  4DOB A;  2AQ2 B;  2AQ1 B;  3BWU D;  3PMN A;  1XS9 D;  2G4D B;  2MBB B;  2WXJ A;  5G5G A;  3UXO A;  2ASJ A;  5HHH A;  1NK4 A;  7ICJ A;  2KVZ A;  3F5E A;  3DQV A;  1FXT B;  3B1L X;  5KG5 A;  4I2E A;  3OG5 A;  4I6P A;  4P0P A;  2W3S A;  1OEY A;  3KOO A;  2VZK B;  4NNJ B;  2LYB A;  1IV8 A;  2ZUB A;  1J2M A;  5KTQ A;  4LVS A;  1RYR A;  3BVG A;  3PSF A;  3P4Q B;  5DPR A;  2YEP B;  5J2A A;  2WYQ A;  3ZDM C;  1C4C A;  2WQY B;  3WKA A;  4NM1 A;  1NEN B;  4ZH4 A;  2KMD A;  1ZE3 D;  2KMC A;  1WUD A;  3RI7 C;  2HHU A;  2NS5 A;  2JF5 A;  3H7P A;  2V3S A;  1SKS A;  2HJ8 A;  4QZA A;  1E8X A;  1YOV B;  4C8M A;  1FNU A;  5JU5 A;  2D11 A;  4C00 A;  3THV A;  4CF4 A;  2D3A A;  3RZF A;  2WB1 F;  3QC8 B;  2AGO A;  2KTR B;  1R4N I;  2PE9 A;  3PVX A;  5DLF A;  3QU7 A;  1TK0 A;  3RAX A;  4KLD A;  4L2Y A;  5AK4 A;  2WXR A;  3RJJ A;  4HDQ A;  4KIK A;  2ZIW B;  3QU5 A;  4WJO A;  2H3V A;  2N9L A;  3U52 E;  4CF5 A;  3DVN V;  3L54 A;  3VUX A;  4KLT A;  4TQ1 A;  1L7N A;  3IT6 B;  2LVP A;  8ICA A;  3C5G A;  1T7P A;  4LZG A;  2MP2 B;  5ALG A;  2K8A A;  3PRP B;  5D6J B;  4MGZ E;  3IG5 A;  2L3Z A;  2LGI A;  2KC1 A;  3N97 B;  3HIZ A;  1MHX A;  2W03 A;  1WGR A;  5C3J B;  5AHX A;  1HEZ E;  1KF6 B;  2PTL A;  2C2E A;  4PL2 A;  1BPE A;  5H8Y E;  4EZ9 A;  3BVM A;  3RNA C;  1NYQ A;  1WXQ A;  4P1B C;  5KFO A;  4K4H A;  2ON8 A;  4NZL B;  3UXN A;  4ECX A;  1X40 A;  4BZA A;  1K53 A;  5IO9 A;  3GIK A;  1S5L U;  4E0D A;  5IIM A;  1WXM A;  1HIW A;  4RM9 A;  4ANV A;  3TAN A;  3EHV A;  3V6K A;  1NJW A;  3ZJV A;  3H8J A;  9ICS A;  8ICR A;  4RPX A;  2BYF A;  4OVV A;  1KJT A;  2JGA A;  2KEY A;  5FKA C;  1QSS A;  2KJ6 A;  1NYR A;  3NOB A;  5ALM A;  4M6W A;  4AWJ A;  1T0R C;  9ICN A;  2ZNV C;  2KC2 A;  1XU4 A;  3NVZ A;  2N9E B;  4EBE A;  5D3D A;  1N63 A;  3I9V 1;  2XK5 B;  8ICH A;  1ZQL A;  2KHW B;  1ZQC A;  3PZP A;  8ICT A;  5EE3 A;  4DK5 A;  3NUQ A;  3W5U B;  3ML8 A;  4I2H A;  1BPD A;  4QIW C;  1V6E A;  2K6D B;  2LJI A;  4GDK B;  5ALR A;  5FK9 C;  3GZN I;  5KFE A;  5ALI A;  5JHA A;  2WF6 A;  2DKX A;  2KFJ A;  2L7R A;  3JSV B;  1UHU A;  3MGH A;  4QZF A;  3AE4 B;  2WX1 A;  4JV2 A;  4EEW A;  7ICI A;  2CPR A;  3WKB A;  3APC A;  4BWJ A;  1XXG A;  4I29 A;  2XI9 A;  4Z6C A;  2GBK A;  4NJ7 A;  8ICP A;  2IBK A;  1GNU A;  3TAR A;  4WWM A;  1NEK B;  4C0Z A;  4F2S A;  1YNT E;  2DEN B;  4LLG M;  4DQP A;  3MFH A;  1E9M A;  3OHB A;  4R66 A;  2KVS A;  3JYU A;  4MGI E;  2KFN A;  1SGH A;  2G5H B;  5FR6 A;  3KHL A;  2GH1 A;  2ES6 A;  5EE0 A;  2ZJ8 A;  2PMZ F;  1U4B A;  2AU0 A;  4KKJ A;  3BII D;  1TIF A;  4RF1 A;  4QZB A;  1YJ1 A;  3AU2 A;  3SV4 A;  2NO4 A;  4HLE A;  3W1S C;  2BYT A;  2GI9 A;  4ECS A;  2N4F A;  4DLG A;  1E0Z A;  4PGX A;  1EXN A;  2W3R A;  4JWN A;  2PI5 A;  2FUH B;  4M01 A;  1Y88 A;  1PDX A;  3V60 A;  1NZP A;  2F2A B;  1KN5 A;  3JPQ A;  1NI3 A;  2E8O A;  4CDG A;  3R2I A;  4GXK A;  1JWS D;  3HIL A;  4BGD A;  4UBB A;  2YMQ A;  1S77 D;  2Z7J A;  1F9J A;  2D3D A;  2DX5 B;  2KX3 A;  2NBV B;  3EFU A;  5KFQ A;  1BPB A;  2WX0 A;  3PSI A;  4UAW A;  4IQW A;  3Q8K A;  5ALJ A;  5L1L A;  2HVI A;  4A3O A;  1FMA D;  3Q8B A;  1H8C A;  2BGW A;  4OVU A;  3W5V B;  5AKY A;  2NYV A;  5T14 A;  2ACZ B;  3AU5 A;  3IM1 A;  1JWB D;  4HCN B;  4M04 A;  2WLB A;  3N32 A;  2HDO A;  4K81 A;  2BPC A;  3ONN A;  3H8M A;  1E10 A;  1FD6 A;  4IWP A;  2DUY A;  2HBM A;  5GTI U;  4ED8 A;  1ZGU B;  1ZW7 A;  2VAN A;  3IDW A;  4XRH A;  2KN4 A;  2ZW0 A;  4RQ2 A;  2DYB A;  2E1E A;  3KYC D;  3CW2 C;  2GLS A;  1R4M I;  2J53 A;  5CHG A;  4DHZ B;  3B2G A;  1S76 D;  4W9H A;  2FLL A;  3TEW A;  2LM1 A;  4ECU A;  5LLI A;  2WU5 B;  1ZRN A;  1R4N B;  3N9Y C;  4YT0 B;  2NV3 A;  2MCN B;  2K25 A;  2K8C A;  5IA7 A;  2CU1 A;  2L00 B;  3MAB A;  3Q69 A;  4R3D A;  3T5J A;  2OCE A;  3SDL C;  4PT5 A;  3ZVV A;  5KT5 A;  2M9N A;  2G08 A;  2L32 A;  3MHZ A;  1CEZ A;  3ZRC A;  4ZRI A;  3WK4 A;  2Z59 B;  3WIM A;  9ICW A;  4O3Q A;  4IWO A;  3KVF B;  1ZQD A;  3UXP A;  3PML A;  2OOB B;  1V38 A;  4J6I A;  4MEM A;  4EEK A;  4W9E A;  3WCQ A;  8ICF A;  3C1Y A;  4DL5 A;  2FJ6 A;  4GN1 A;  1RXV A;  5ALS A;  3PLU A;  3M8R A;  1X9S A;  4Y2R A;  4RQ0 A;  3DV9 A;  1TK5 A;  2K8B A;  3SFD B;  4A20 A;  1ZDV A;  1QF6 A;  3LDZ E;  1HTQ A;  4B9U A;  4U6P A;  4ELV A;  1WSP A;  3AE6 B;  3TBL D;  5AM0 A;  2WXQ A;  2BQQ A;  2F1H A;  4CE6 A;  3DHG C;  3KUZ A;  4HXD A;  4W9J A;  4OZC A;  4YTM B;  1TFR A;  4XA5 A;  5J2F A;  3BS5 A;  4IQT A;  5CA7 A;  5AI8 A;  2HHX A;  1EF5 A;  4OVZ A;  3AUL A;  4BAX A;  3I63 C;  3TJP A;  4CO7 A;  5AKZ A;  2GB1 A;  4RPZ A;  4US8 A;  1IPG A;  1SV0 C;  2CJO A;  2WDR B;  4PJ0 U;  1ACC A;  4RQ7 A;  1ECW A;  3QAR A;  2MHJ A;  2DPJ A;  4RNA A;  5J2E A;  4MSQ B;  1FNV A;  2KK0 A;  1PVP A;  1A5R A;  3QNM A;  1KTQ A;  1JXL A;  4PS3 A;  3F2B A;  4B9T A;  2QIE B;  5KFT A;  3M6K A;  1QOF A;  3IT4 B;  2BF8 B;  2Y0S C;  3K75 D;  3V6E B;  4PS7 A;  3EA6 A;  1KLU D;  5BOM A;  1MFW A;  4P0P B;  4B0M A;  3PX6 A;  9ICM A;  2RRD A;  2AQ3 B;  3GZN B;  4NWI A;  4RQ5 A;  1N2X A;  4P4O A;  2W11 A;  4DL3 A;  3V7J A;  3TCA A;  2XC9 A;  3RB6 A;  4DFD A;  2EH9 A;  5E6O A;  4B6W A;  4XX5 A;  2WP9 B;  2NMQ A;  4AQ7 A;  4ECV A;  3QAQ A;  3H7P B;  1AWD A;  3UQ2 A;  2A1J A;  2Y5B B;  1XEE A;  3AM9 A;  1V9P A;  7ICO A;  1T3N A;  3MTN B;  3L3F X;  3ALR A;  3EZ5 A;  3KKA C;  3KHR A;  3SMV A;  4EZ6 A;  1V1P A;  2HTM E;  5F3X B;  1V9J A;  3H9D A;  1X42 A;  7ICP A;  5DPT A;  4DSK A;  5MPO A;  5KFL A;  3ZNI D;  1E8Y A;  3RB3 A;  1SKW A;  1RAX A;  2YVC A;  4TUP A;  4KIK B;  1LQB A;  3QZ7 A;  1WX8 A;  3MGV A;  4KX6 B;  2FCS A;  2YTU A;  3RJG A;  3OPX A;  3SEI A;  3E9S A;  3T3O A;  4WWO A;  1V97 A;  1ZQS A;  4WH4 A;  1Z1B A;  3VDZ A;  1FEH A;  4K3B A;  4YMM A;  1WH3 A;  5TR5 A;  4F4X A;  1ZQU A;  3HJE A;  7ICV A;  3AED B;  5KG4 A;  4B0E A;  2FCM A;  5J0Q A;  3RD2 A;  3BDP A;  2I1K A;  3WAL A;  2FMP A;  1I7H A;  2PEA A;  3VH4 B;  9ICJ A;  4Q8F A;  2H89 B;  1UT8 A;  1FFU A;  1WWU A;  2ALZ A;  1L4Z B;  4O3P A;  9ICH A;  3QE9 Y;  1ZOY B;  3ZTC A;  1IBX A;  5EOZ A;  3M95 A;  5KFP A;  4IDI A;  1SE2 A;  3VTV A;  1D8L A;  2LAS A;  3PZ7 A;  4GIV A;  2ZTE A;  2KJ9 A;  1OW5 A;  2NRZ A;  1YZ6 A;  1ZQX A;  3AMZ A;  2LGD A;  2RDI A;  1JAL A;  1WF9 A;  4M6W B;  4CNQ A;  3RJE A;  3ZXR A;  4Q8E A;  1B9R A;  3UQ0 A;  4ECZ A;  2JEG A;  3PO4 A;  5KG2 A;  1UT5 A;  4MAC A;  1CZP A;  2LMR A;  1X66 A;  4PHD A;  1B1Z A;  4LDT B;  5D2M B;  4N9F 4;  4LNI A;  4QWB A;  1S1Q B;  9ICC A;  3BS7 A;  3VHT C;  2G06 A;  4R63 A;  2NBU A;  3U30 A;  4DL2 A;  1R4M B;  2WXK A;  4JE3 B;  5G5H A;  4DSF A;  3ABV B;  4Q44 A;  4RZR A;  3ZYY X;  1F1H A;  3IAS 1;  1ZET A;  1O08 A;  1KTK A;  2KNB A;  1HA5 A;  2BYV E;  3AB5 A;  2R8K A;  2Y3A A;  4F4Z A;  1SE9 A;  3APD A;  3M62 B;  1N5X A;  1MG4 A;  2RP5 A;  4DXG A;  4F72 A;  3TAQ A;  4PK1 A;  3ZNZ B;  3AU4 A;  4I6L B;  4P6V F;  1P9D U;  2IO0 B;  3U7Z A;  3PRM B;  2LYA A;  5AK5 A;  1GJZ A;  3TUO A;  2GO7 A;  4F5P A;  2BQ3 A;  3TAP A;  2JEJ A;  3ZDC A;  4YP3 A;  2D07 B;  4JL9 A;  4ECW A;  4PHP A;  1ZQR A;  1GC7 A;  2KOB A;  1P1A A;  3ED5 A;  5C5J A;  2BDU A;  1KFY B;  2WXL A;  3H0M B;  3DBH I;  3DVG X;  2DYO A;  9ICV A;  2JUO A;  1TJE A;  2IOF K;  2Y1I A;  2LI6 A;  2PKE A;  3RB0 A;  3HT3 A;  2ZXH A;  3FM9 A;  5G2N A;  2BCR A;  2MEK A;  4GIB A;  2M0A A;  5I4D A;  3PVL A;  3IXS A;  2QDF A;  1N6Z A;  5E6P A;  3I3T B;  3QU2 A;  4UB6 U;  3Q8L A;  3PW0 A;  2ZVN A;  2LVQ A;  3PSP A;  5HHD G;  5BYR A;  4BKS A;  4NY8 A;  3KTQ A;  3T3F A;  2I1J A;  4RQ4 A;  4O5C A;  1TS2 A;  2G07 A;  2JYE A;  4UB8 U;  1HTO A;  4J9O A;  2HTH A;  4RQM A;  5J8Y A;  3RJK A;  4J9L A;  4OJP A;  2NRW A;  2KXJ A;  3CWI A;  4NLG A;  2GBM A;  2PFQ A;  2L5Y A;  4A8X C;  9ICP A;  2R8J A;  4IL6 U;  8ICO A;  3O0F A;  1NKE A;  3ZDD A;  4YD1 A;  3ZNG C;  3QUC A;  3RH4 A;  1AQ6 A;  2W7P A;  4EX6 A;  1PYW D;  4MFF A;  3AE2 B;  4UAS A;  2PW9 A;  4DHJ B;  4DSE A;  2H3Q A;  4X57 B;  3N28 A;  2BS3 B;  4ASW C;  9ICK A;  1RDF A;  2YB1 A;  3DHI C;  4F4Y A;  2K8C B;  4N59 A;  4CGZ A;  3NVY A;  2IGD A;  4ICV A;  2GLE A;  3H8W A;  5J2H A;  2NBW B;  1XLQ A;  4TQS A;  2LD9 A;  4LK0 M;  5KHQ A;  2FBW B;  2W8L A;  2SEB D;  4WJN A;  3ZGZ A;  3A9J A;  4F3O A;  3LVW A;  2KDI A;  1AN8 A;  5J0S A;  2IO3 B;  2KZ3 A;  2BB5 A;  2HHQ A;  1PGB A;  4YR3 A;  5KFF A;  2ZZP B;  2KNJ A;  1WM2 A;  3N1Y C;  3T9L A;  3RJI A;  1QLN A;  2PE6 B;  3WAO A;  2K8B B;  1L5P A;  4GXI A;  1MHH E;  5KG1 A;  3MR2 A;  1SIJ A;  2MWS B;  2R2O A;  3HM6 X;  1MI0 A;  2V1Y A;  2NRX A;  5J2B A;  1TTN A;  3WA0 A;  1N62 A;  3BS5 B;  2H88 B;  5J0U A;  2BS4 B;  4YL8 A;  3TL5 A;  1S9F A;  5B5E U;  1ZQF A;  4RNM A;  2MSN A;  4KDL B;  2E8M A;  1FIQ A;  5IIO A;  2ZIU A;  2L0T A;  1SZH A;  2WF8 A;  3V72 A;  3ZRF A;  4DFJ A;  1I42 A;  4C80 A;  2KJH B;  2QCZ A;  4GMV A;  4N6E B;  3SU8 X;  2K3U A;  3D32 A;  1L3T A;  1PK1 A;  1D8B A;  3P2B A;  1ZYQ A;  2MA1 A;  1OQR A;  3L10 B;  5AKK A;  1SXD A;  3ZD8 A;  4MFC A;  4IC7 B;  2CRX A;  2N1W A;  3VH3 B;  1TKY A;  3RUL A;  3VRA B;  4OZB A;  2A1A A;  1E7P B;  2WS3 B;  3DBL I;  3MJW A;  4GLS C;  3EWA A;  1ZQM A;  1F0M A;  4EEN A;  2KMA A;  3EUB 2;  2BDP A;  1DOQ A;  2OJW A;  1CI4 A;  1BGX T;  3BYY B;  4AYB F;  4FHJ A;  2YN4 A;  2KSO A;  4YSZ B;  3P4S B;  2ZJA A;  4F4W A;  2BCV A;  4NAW A;  3NG0 A;  4HDO A;  1HZ6 A;  3AEF B;  2KK8 A;  4NJC A;  2A1J B;  5D4B A;  4F5R A;  1ZQQ A;  2BCQ A;  2KT7 A;  4NLB A;  3PW4 A;  2LGY A;  4JPS A;  1Z19 A;  2JEF A;  1V1P B;  2KDF B;  4YQW A;  3RJH A;  7ICM A;  4EEL A;  4GOC A;  2PJH A;  1GC6 A;  2O6V D;  3MC8 A;  1WJN A;  3TAD A;  5IIN A;  4DQQ A;  3JPS A;  4DSJ A;  3PRZ A;  1VRA B;  4US9 A;  2JEI A;  2JH1 A;  3NZU A;  5AIC A;  5L9X A;  2N7J A;  4I6N B;  2P6U A;  3WU2 U;  4NL9 C;  2ZPY A;  4K7S A;  3QA8 A;  1GUA B;  3UMG A;  2KIV A;  1D5Z C;  1WIA A;  3ICX A;  1CQV A;  2XGP A;  5AIA A;  4OD0 A;  3PPA A;  4RU9 A;  3T5L A;  1Q5W B;  5KHO A;  1L6U A;  3DBS A;  2K8H A;  2L1A A;  1IIP A;  3M9N B;  4FBU A;  3GFK B;  1IM4 A;  1IBX B;  4JLC A;  3GP7 A;  2CU3 A;  2WXO A;  1QKZ A;  4RT3 A;  1VJK A;  2E5S A;  3NUH B;  3S2A A;  4ELT A;  3ETR A;  1E7U A;  1PUT A;  4TV3 A;  2ZTC A;  1XLO A;  1IP9 A;  3C29 A;  1QQ5 A;  1RQL A;  2LJ5 A;  5J2D A;  4M02 A;  4WIP A;  4Y2J A;  9ICX A;  4Y2Y A;  2XGQ A;  3Q2A C;  4DFP A;  1WXV A;  2O2V A;  4YTP B;  3ZD9 A;  2K6Q A;  3VCB A;  4P1C C;  2ESE A;  5C0Y A;  4BBN F;  3NVW A;  2YMM A;  4PGY A;  4GB9 A;  3R9K A;  3IBE A;  5AK3 A;  2JMG A;  1JRU A;  4LNO A;  2ZJ5 A;  5KFC A;  5HP4 A;  4QZH A;  2IYD B;  3CIR B;  4LJP B;  4M9H A;  3I5J C;  3LWM A;  3L4P A;  4KLO A;  4QW9 A;  2B76 B;  4ZDV A;  1GO3 F;  3M63 B;  2OXO A;  4C8K A;  1J8C A;  4QZG A;  5KT7 A;  4J9S A;  3M7D A;  5EE9 A;  1ZQJ A;  2VA3 A;  2CHZ A;  3RT3 B;  4WAA A;  5LXH A;  2WGS A;  3ZKJ C;  2RSU A;  4MJS A;  2LHD A;  4JMU A;  4RQ1 A;  4LNK A;  1T8E A;  5ALE A;  5AM4 A;  5KT4 A;  1KH0 A;  1WE7 A;  2N1V A;  4F50 A;  4Y2U A;  9ICR A;  1N5W A;  4QZI A;  4HJK A;  1TS5 A;  2M19 A;  4QIW F;  4UAY A;  1F52 A;  2UWQ A;  2ZTD A;  1XSN A;  2VA2 A;  2GMI C;  1EF1 A;  2JZ3 B;  7ICK A;  2V3N A;  3IP4 B;  2O6K A;  3B0X A;  4BOS C;  1FRR A;  1UD7 A;  1D4B A;  2JH7 A;  2CS4 A;  1KQQ A;  4ELU A;  2H3I A;  1UGM A;  4Q2J A;  1WXA A;  4ED6 A;  3QCA A;  2KP7 A;  5DQH A;  3BQT A;  3G6X A;  4WQM A;  2ZCB A;  5HHI A;  4IRK A;  4EE2 A;  3N7S C;  3AE1 B;  2E1F A;  1LXD A;  3Q3J A;  4M9J A;  2DNF A;  1RYS A;  2LI5 A;  1P3Q U;  4PH5 A;  3PO5 A;  4DSI A;  4DQS A;  1LFD A;  3IVF A;  5AM1 A;  5KFI A;  5AI4 A;  2R8G A;  5KL8 B;  5IIL A;  4A3P A;  1UH6 A;  2DF4 B;  3UM9 A;  1I4Q A;  4AJW A;  3KW5 B;  2OED A;  3LJ3 A;  2IZV B;  2J4X A;  4FBJ B;  1T6B X;  3JPP A;  2MJ3 A;  4I2A A;  2IGG A;  3WAN A;  3SAG A;  4BBN C;  4QZ9 A;  2F3N A;  3Q8Q B;  2XBB C;  1L0X B;  3R66 C;  3UIN B;  2OYY A;  4MM3 A;  4DDI D;  5EDS A;  2W04 A;  3GU3 A;  2AGQ A;  2KDE B;  8ICZ A;  2V4I B;  4G11 A;  4DWI A;  4QAY A;  3SD5 A;  3BZC A;  3TFR A;  2C2D A;  2JWZ A;  1JML A;  4FJV B;  2W43 A;  8ICG A;  3O65 B;  2EZX A;  2XID A;  5J29 A;  1HUZ A;  3I57 A;  3QWZ B;  3RUI B;  3BYT B;  5KFM A;  2C22 A;  4NPN A;  4OHJ A;  3TEX A;  2ZUD A;  1X2I A;  1KFT A;  5BYQ A;  1FRD A;  7ICE A;  4NLZ A;  3PLV A;  5IP4 D;  4ANU A;  1K5O A;  2DFL A;  4UW9 A;  3PX0 A;  3C1Z A;  2IDY A;  2DAF A;  3BK1 A;  3RPF C;  1K52 A;  4IUM B;  4RM8 A;  4UB3 A;  2JVC A;  3ZUN A;  2F1J A;  1SL1 A;  2B21 A;  3W9C B;  3RB4 A;  2AHO B;  3RAQ A;  2PVG C;  3A9J B;  4WWP A;  1M94 A;  4MGY E;  4I2J A;  3H40 A;  1T3Q A;  3AE5 B;  1N61 A;  2L0F A;  3JPN A;  3C8Y A;  3UQA A;  3W1Y A;  2KHQ A;  4KVG B;  4F5O A;  5DB8 A;  3L13 A;  3SHQ A;  3VQI A;  4FO6 A;  3HVZ A;  5J0P A;  5GTH U;  3U26 A;  4O3M A;  2YLM A;  4DLE A;  4B9L A;  3FIL A;  1J7B A;  3ZNH B;  5KG6 A;  5DBB A;  1L7Y A;  4R8U A;  3P4R B;  4EZJ A;  3HWT A;  4TQR A;  2D3C A;  1NZB A;  4JWU C;  3PTF C;  1QSL A;  1NI2 A;  5CHV C;  4EZL A;  1TYG B;  4DWF A;  3Q8E A;  2FE8 A;  2YEP F;  2FNJ B;  3ZIM A;  1WZ3 A;  4G9B A;  1KOT A;  1YJJ A;  1L6V A;  4K3C A;  1ZQP A;  3K1R B;  2I38 A;  4F8R A;  1HE8 A;  1EM7 A;  1E6E B;  3GZF A;  1P7E A;  1ZJM A;  1TKG A;  2JU6 X;  3KYD D;  5TSS A;  4Z6F A;  2DBY A;  1B4F A;  3H4B A;  1JCK B;  2ZIU B;  1WY8 A;  2AL6 A;  2JX5 A;  3AEC B;  3QIJ A;  4ACF A;  1A0P A;  3HKZ F;  4MEY A;  3DVG Y;  4HWI B;  1M4V A;  5L1M A;  2FE9 A;  3EPG A;  4KLH A;  1PK1 B;  2Q4T A;  4KLI A;  2DAJ A;  2N1R A;  3OSP A;  3P63 A;  5BPC A;  3L17 A;  4K7W A;  3ISB A;  2V9H A;  1ZD2 P;  3QEB Z;  1F2R I;  2PFN A;  1Z4O A;  3PW2 A;  3D2Q A;  4RUC A;  5KT6 A;  1JWA D;  1EU3 A;  2MX2 A;  3AH7 A;  1YIW A;  2KSO B;  2M1M A;  4NAW B;  5L83 A;  4PYU A;  3E56 A;  2RDB C;  2FPM A;  3U4E G;  3WKD A;  3Q3O C;  3M6Z A;  3Q8R B;  2ICI A;  2QB0 B;  2Y0S F;  4RGO S;  1T0S C;  1YN3 A;  4ZHO A;  4WJQ A;  4LJO B;  1BUI C;  4C8O A;  1WJ6 A;  5AZG A;  4MEL A;  4FBT A;  1BNP A;  4R64 A;  2HDE A;  2BW2 A;  4RGT A;  3PW5 A;  3GOE A;  1BVS A;  1NKB A;  1A6S A;  2W9C A;  2FPK A;  3G6V A;  1D8Y A;  1YN4 A;  2K60 A;  2LFI A;  5AKH A;  3WKE A;  4RQ6 A;  5CJ7 A;  1QQ7 A;  4C56 C;  4YR0 A;  1RWS A;  1EUV B;  2LWP A;  2F77 X;  1S97 A;  1WXS A;  2QKQ A;  1JXE A;  3NRZ A;  5KT3 A;  3A4S C;  2YMP A;  4YG2 A;  2KX0 A;  1RFA A;  2ZIX A;  1L0V B;  2KAJ A;  1ZQN A;  1M6Y A;  1ZQK A;  4BDP A;  3ZO5 B;  2WNM A;  4J9K A;  2KVC A;  1L6N A;  4KX5 A;  1ISN A;  4DQO C;  3GV8 B;  4G50 A;  4W9K A;  4MF2 A;  4F2R A;  4BKT A;  2IY1 B;  3RJF A;  5HNK A;  8ICL A;  3AEA B;  2JYT A;  2J6T A;  2HBJ A;  9ICI A;  2AQ0 A;  4FLH A;  5J0T A;  3HKZ C;  1JWM D;  5BO4 B;  4XDD A;  4BFR A;  1YD8 U;  1XF5 L;  4XGA B;  2QIL A;  4NM2 A;  1EO6 A;  3CYM A;  2HHT A;  1MG8 A;  1K1S A;  1Q0W B;  2G0A A;  5ALD A;  2ZG6 A;  1UA0 A;  1R7S A;  3IG8 A;  4F8C B;  3D2N A;  1UEL A;  4NAM A;  2O2V B;  1RXW A;  2H3Z A;  4DL7 A;  1ZDX A;  3EEC A;  3Q8C A;  5CWR A;  1MJD A;  2Z0E B;  1Q8K A;  4QWD A;  2KVR A;  4CCH A;  4KLE A;  2Q0Z X;  2BBC A;  1D6E C;  1UWM A;  3PT2 B;  1ZD3 A;  3IV6 A;  4YMO A;  2GOW A;  3H6N A;  4KGS A;  1EWC A;  2RQ5 A;  5DG7 A;  2KIW A;  1TS3 A;  5D46 A;  1YJI A;  3MP9 A;  2LM4 A;  2BGF A;  4MEX A;  1WFY A;  2BKF A;  4P4P A;  1XO1 A;  2R2Q A;  2P66 A;  3ORY A;  3CF6 E;  2LVO A;  2GOL A;  4BOZ B;  2Y9T A;  3G6Y A;  3AEE B;  3KH0 A;  3VAW A;  1TVA A;  4L23 A;  4MJS B;  3HM3 A;  3V05 A;  2BPF A;  3T5K A;  1WE6 A;  2KAC A;  1MQ3 A;  2IMW P;  3NS8 A;  2GBR A;  2G3Q B;  2J0K A;  3TQ1 A;  2JZZ A;  4LTU A;  1V80 A;  5CTR C;  3N30 A;  1HUO A;  4KLU A;  4FXC A;  1C4P A;  1WI0 A;  2OEH A;  2LKY A;  3N20 C;  2VZK D;  1ZQW A;  1Z4N A;  4JWM A;  1X1M A;  2EDU A;  3KZX A;  3QUT A;  4Y2Q A;  1GB1 A;  4DO9 A;  1D9F A;  2EAN A;  3NS1 A;  3WK6 A;  4F5Q A;  1X6J A;  5AKE A;  8ICJ A;  4C8L A;  1CK1 A;  3E0F A;  1QOB A;  3LYS A;  3PHW B;  3V6C B;  4UAR A;  3NY5 A;  3AE9 B;  4HRO A;  2W54 A;  4FHK A;  4MSM B;  1YT3 A;  3PSE B;  2AL3 A;  2FLP A;  4FN2 A;  1J7A A;  3RFA A;  2KQS A;  1ZJN A;  2WF7 A;  2WF9 A;  3OTQ A;  4FZL A;  3ZTD A;  1YX5 B;  5DB7 A;  2IOF A;  2WXN A;  3MHS D;  2ASQ A;  2OM6 A;  1WCN A;  4I2C A;  1L3S A;  5HI1 A;  1UQV A;  3T79 A;  1O03 A;  4F1S A;  4J9Q A;  3OSN A;  1L7O A;  1FXI A;  2AQ4 A;  2CHX A;  4MM3 B;  5III A;  1Z1V A;  3PX4 A;  3RNC C;  1WJU A;  3RF9 A;  3VC8 A;  2KD1 A;  5D7G A;  5HKH A;  1PFD A;  4RNN A;  7ICG A;  1SB3 C;  3W1S A;  3R8B A;  2KFZ A;  1SEB D;  3TEY A;  4USA A;  3C0R B;  2F44 A;  2BT6 A;  3MC1 A;  1FPY A;  2BCU A;  1HEK A;  3QUB A;  4EUT A;  4OCZ A;  3AV8 A;  4Z6D A;  3OGU A;  4PGQ A;  2MJD A;  4XDC A;  1WX7 A;  1XO3 A;  2M17 A;  4NJ6 A;  1FEZ A;  2MUT A;  3H4D A;  5HMM A;  5ALL A;  3ISC A;  4KN7 A;  1KFS A;  4ZRK A;  2WXG A;  4EYI B;  5J2R A;  2RR9 A;  3SFE B;  4HK2 A;  3ZI4 A;  2A4Z A;  4J03 A;  2KV2 A;  5IOI A;  2F8K A;  2IBI B;  1XWL A;  2BS2 B;  3A1Q A;  3MC9 A;  1C1Y B;  2LXC A;  3MGI A;  4W9D A;  1C77 A;  1ZQI A;  2OJR A;  3K9O B;  3URY A;  3ZXV A;  1L3U A;  1D3Z A;  1JQ4 A;  5L1I A;  1V2Y A;  4O5K A;  3FIL B;  1Z00 A;  4J9N A;  2KLC A;  4HPL B;  4IS7 A;  4A90 A;  2QMT A;  4R8U B;  5AEK B;  1J7C A;  3DHH C;  2WAQ C;  1XCQ L;  2KJR A;  4GC6 A;  2EQY A;  3TAD C;  4ANW A;  7ICT A;  1NK0 A;  2JV3 A;  2ZUC A;  2Y5P A;  4DF8 A;  2BPG A;  2N0S B;  4U7C A;  3AE8 B;  3HW8 A;  4RQ8 A;  1TBE A;  3Q14 C;  1E8Z A;  5AKJ A;  3ML9 A;  4ECY A;  4WAF A;  2BTE A;  4IM2 A;  5KG3 A;  2DHZ A;  3U8Z A;  3CRX A;  2NVU I;  4MH8 A;  3QZ8 A;  2FMQ A;  2D5G A;  4JQW C;  3KBB A;  4F92 B;  4RT2 A;  1BNO A;  5CHW A;  4WJP A;  3HHM A;  3L16 A;  4QZE A;  1OQY A;  2FAZ A;  1XT9 B;  4TMA B;  3BQ7 A;  3T5H A;  3BK2 A;  1UGJ A;  5KFA A;  2MSE D;  3N1Z C;  1BXT A;  2PMV A;  1IYF A;  4NLK A;  4O1N A;  2WXF A;  1GAQ B;  5AI0 A;  1NKC A;  4RNO A;  3AL0 B;  1Q46 A;  2BHN A;  2I1Q A;  4BX9 C;  4FFD A;  3K1Z A;  2KAN A;  1NK6 A;  2VA8 A;  1NDD A;  4PHA A;  2JZP A;  3GII A;  4M0A A;  1NJY A;  4LNN A;  2H5X A;  3Q8M A;  2G1E A;  2D8C A;  3C21 A;  1ZQG A;  3KZI U;  4BVU C;  1ENF A;  1NK8 A;  5J17 A;  3A33 B;  2KD0 A;  3W2D A;  1LO5 D;  4RMA A;  4HJG E;  4M2Y A;  5KFH A;  3N1X C;  1C7Y A;  3PNC A;  5JUM A;  3QYP A;  2K0P A;  3PV8 A;  1ZQH A;  1IG6 A;  1N56 A;  2C9W B;  1JI7 A;  2EZY A;  4KLM A;  4DHZ E;  1KEJ A;  3J9C A;  3UIO B;  3HVD A;  2W9C B;  3QX1 A;  4ICA A;  1S10 A;  5AM3 A;  1ESF A;  4I2G A;  1A77 A;  4RUA A;  2XY5 A;  2HOF A;  1IGC A;  4HYK A;  1COK A;  1C20 A;  1QQ6 A;  4JV0 A;  5JTI A;  5B66 U;  3AEV A;  1NNL A;  2JWU A;  2NCN A;  1ED1 A;  1D5M C;  4KSK C;  2DWQ A;  3LXF A;  1JN3 A;  1L8L A;  4LZD A;  3S6J A;  2JRI B;  2UU7 A;  4IR9 A;  5CEH A;  5AM2 A;  1PGA A;  2K5P A;  4YTN B;  4Y2V A;  2W9A A;  5F9L A;  2M56 B;  4KZC A;  2MBE A;  5GMV A;  2KN5 A;  3SV3 A;  2HVH A;  3RZW C;  2PLP A;  1C3T A;  5L1K A;  2KLG A;  3UF8 A;  1TZ1 A;  3Q3M C;  1TY0 A;  4ACO A;  2BQU A;  8ICU A;  5DKW A;  3MC0 B;  5C1Z A;  3WK5 A;  1BPY A;  3N3K B;  5DQI A;  3DBR I;  3ZJU A;  2JXJ A;  1P0R A;  1YMH E;  3M8S A;  4GLX A;  5IN7 A;  3DVN U;  2CHW A;  9ICO A;  2J7Q B;  4KN4 A;  5BYS A;  2BR0 A;  4IG7 B;  1WGG A;  3TKA A;  9ICF A;  4C4T A;  4QWE A;  3C2M A;  4K1R B;  3NJT A;  3MFG A;  3DDC B;  1FFV A;  4IWQ A;  1L7M A;  4ED1 A;  2I9G A;  4HKQ A;  4XC2 A;  1LV5 A;  4LCD E;  2LUE A;  2D3G A;  3QUQ A;  1NBF C;  2KKV A;  5KFG A;  5A0L A;  2DPI A;  5TZV A;  1P98 A;  2KTQ A;  2ONQ A;  4GSW A;  3UIP B;  4AUQ C;  1TT5 B;  4Q43 A;  7ICS A;  7ICN A;  7ICH A;  3HP6 A;  7ICF A;  4YWG G;  4TUS A;  3GIM A;  1U45 A;  1B0X A;  1TZO A;  4BXO A;  2M8S A;  2R18 A;  4EEY A;  1PQS A;  2KZZ A;  1K51 A;  3N7R C;  2LUM A;  3TEZ A;  2C2R A;  1SF0 A;  1QH9 A;  4J9P A;  5JHB A;  2PFO A;  2WXM A;  2E3T A;  2DZM A;  1K50 A;  2DQN B;  2Z0D B;  3SZ2 A;  1FM0 D;  1TAM A;  9ICE A;  4AP9 A;  4YCX A;  4YMN A;  1NK5 A;  2LEK A;  2AH5 A;  2HI0 A;  2ASL A;  1D9D A;  2EAM A;  1WRD B;  1PUZ A;  3OHA A;  2ZNV B;  1XLN A;  3RH6 A;  4QZC A;  3KWV A;  4Z6E A;  4NQK E;  2MBH A;  2ODG A;  3M9M B;  4IRD A;  2G4S A;  2FIF A;  2MBO A;  3Q8A A;  2JZB A;  2P6R A;  1N48 A;  3AN1 A;  3GQC A;  1QOG A;  2UYZ B;  1Q3U A;  3T3N A;  2CXY A;  4CYE A;  3E2E A;  4NXZ A;  2DLB A;  9ICQ A;  8ICI A;  4ECQ A;  1TY2 A;  2IY0 B;  2J6U A;  3DBH B;  2P35 A;  1NOM A;  1LVH A;  4DOA A;  3FDS A;  4MDK E;  3PS6 A;  2IOH A;  3H0R B;  3PHX B;  1YQ4 B;  2W9B A;  2XCA A;  2C28 A;  2ZXI A;  3GIL A;  4JX1 C;  4MF8 A;  2WTF A;  1DOI A;  4HKZ E;  1GG3 A;  1ET6 A;  1AW7 A;  2JRH A;  4HPM B;  1KDH A;  4KLS A;  5CP2 A;  1J2N A;  4P4M A;  2QJL A;  3VRB B;  2J0M A;  3ZDA A;  2NO5 A;  1WYW B;  1WG8 A;  4I27 A;  1FCL A;  3WAP A;  4M0W A;  5J0O A;  2ZVO A;  1OXJ A;  2R61 A;  4YD2 A;  1MVK A;  4P0Q A;  3B2F A;  2L83 A;  1URJ A;  3CSF A;  1SWV A;  3PRE A;  3V3X A;  2JHD A;  2N7D A;  2JPH A;  4E74 A;  4IW0 A;  3UI3 A;  5KFZ A;  4DS5 A;  5J2I A;  1GOZ A;  4A55 A;  1S0O A;  3EW9 A;  3IHQ B;  2QHO A;  3WK9 A;  1YN5 A;  3MFI A;  4KV2 A;  5L95 C;  5J2J A;  2D10 A;  2HOQ A;  2W82 A;  4QJF B;  2KE7 A;  3LDA A;  2IO1 B;  1F0Z A;  1J0G A;  4HVB A;  2MUT B;  1QOA A;  5ALV A;  2XCP A;  3EC8 A;  2KDB A;  1WGK A;  5CHF A;  3WK8 A;  1V8C A;  2HHW A;  4RCO A;  8ICK A;  3R7R A;  1K1Q A;  1WGY A;  2IHM A;  1YX6 B;  2ZJD A;  2L76 A;  1OGW A;  1V1O A;  4DCC A;  2VJ4 A;  3A1Q B;  1SJH D;  3IRU A;  4KX3 A;  3C2L A;  4DS4 A;  4LDT D;  2JSV X;  1ZXI A;  3BQ2 A;  4Y2S A;  2WWZ A;  3D2S A;  1KBU A;  1A70 A;  3PGE A;  1SGG A;  7ICR A;  3Q3N C;  1Z00 B;  1L0Y B;  3GS2 A;  2KHV A;  4AP4 C;  5KFN A;  2IA6 A;  4OJ5 A;  1F77 A;  3NZ3 A;  1ZXH A;  4DXF A;  2I6X A;  4O0I A;  1VJ5 A;  1I4H A;  1IUE A;  2KIC A;  3ETL A;  2EKI A;  2INC C;  3SAF A;  3NZS A;  5BMI A;  1T0Y A;  3AUO A;  5JXV A;  2WXP A;  4QWC A;  1VZ8 A;  4F4K A;  4XUS A;  2DZJ A;  3RNG C;  1SBB B;  3UPQ A;  2ISO A;  4LNF A;  4REZ A;  3DBR B;  1RRB A;  5C2T B;  2ZPN A;  3RRH A;  4YFK A;  1T4G A;  3R3M A;  5KFV A;  3QX7 A;  2GWS A;  2F1I A;  1RLF A;  2YX8 A;  2E8N A;  1WM3 A;  4B9V A;  2JY6 A;  5TIS U;  4C7Z A;  2K4E A;  4J9R A;  2L52 A;  2O6V A;  1EU4 A;  3RRG A;  2BKE A;  3DEE A;  2ZIV A;  1L8O A;  2KO3 A;  2MU2 A;  2OWO A;  3ONS A;  2AJQ A;  2HBL A;  2QC8 A;  3UQB A;  1DYQ A;  5D49 A;  2JXX A;  4IOI E;  4JB3 A;  4MHV A;  1V86 A;  1XCT L;  3EYZ A;  1RYJ A;  5AI5 A;  4JGH B;  3RFZ B;  2K1F A;  2CN1 A;  1UCV A;  3QXG A;  3M9O B;  8ICM A;  3IFW B;  4UBC A;  4BKG A;  5HG2 A;  2KN7 A;  2M4N A;  2QAR A;  4M8M A;  2KZR A;  3RNE C;  4G0N B;  1FNW A;  2KMM A;  2KQ7 A;  2KQ4 X;  1UBQ A;  2W9M A;  3DBL B;  4DXA B;  1MSW D;  4ZYS A;  2QB1 A;  2UVU A;  2FID A;  2WDQ B;  3SD7 A;  4IM0 A;  1U9L A;  2G45 B;  4R65 A;  2WHE A;  3UMC A;  4EBC A;  4GFJ A;  5BOL A;  8ICX A;  2EMT A;  1E8W A;  4YSY B;  1V5T A;  5KFK A;  1JRP A;  2HHS A;  1WX9 A;  3RCZ A;  1WRI A;  3T8M A;  5EWF A;  3LK9 A;  3M3J A;  5KAI U;  2FLN A;  3KUD B;  4M9L A;  2VH2 A;  5EWE A;  2G09 A;  3VR8 B;  4Y2X A;  4FS1 A;  4OJL A;  3SYZ A;  2KTF A;  3B08 A;  1AAR A;  4KMU A;  8ICB A;  1CMX B;  1Z3E B;  1KLG D;  4QZ8 A;  1X9W A;  3D6J A;  4DHJ D;  1MA7 A;  5KFY A;  3I28 A;  3J81 j;  3KLS X;  1ZRM A;  4TUU A;  1T94 A;  3F2C A;  3HPO A;  1S0V A;  3HUI A;  3SEB A;  1XSL A;  9ICB A;  2NTT A;  9ICG A;  2VIX A;  4B95 A;  4ED7 A;  3VFK A;  3ENE A;  4ED0 A;  1UZX B;  1Y56 A;  4F93 B;  4JV1 A;  2C7M B;  3AXC A;  2NPT A;  2KOX A;  3GE3 C;  2WU2 B;  1V81 A;  4IKG A;  1WCL A;  5KNI A;  4WQO B;  1RFK A;  2WDT B;  1QTM A;  2QSD A;  4JUZ A;  1XLP A;  2WB1 C;  2KWU B;  2GBJ A;  1TAU A;  4DBG A;  1JW9 D;  2M0X A;  3MDA A;  4FJY A;  4IQU A;  5DQG A;  4B9K A;  1I4G A;  3JW0 X;  1Y8R C;  2LRW A;  4NL9 A;  5KFB A;  1OUQ A;  3WAM A;  4QW8 A;  4I2B A;  1L3V A;  1SZP A;  2WFA A;  3N4M B;  1TGZ B;  3PZ8 A;  2KFK A;  1KSP A;  3PR4 A;  3ECI A;  4EZK A;  2JR5 A;  4C4R A;  1L2N A;  4KLQ A;  2MLB A;  5DPW A;  4IRC A;  4IR1 A;  5ALQ A;  1H4R A;  4PZN A;  5ALH A;  1Q3V A;  4NY0 A;  5KFS A;  2E8P A;  4WUR A;  1DGJ A;  3DWM A;  2PIA A;  9ICU A;  1NJX A;  4C4S A;  4BXO B;  4P16 A;  4KGT A;  2V3P A;  1PVQ A;  3FAH A;  3TFS A;  2DZK A;  2LPE A;  5J18 A;  1SKR A;  4HAI A;  3RMK C;  8ICV A;  1A76 A;  2BVC A;  5HML A;  2KDM A;  4HPP A;  8ICY A;  3AE7 B;  4B9M A;  5IIJ A;  1KLV A;  4NQL B;  1RG6 A;  2C5L C;  1HZ5 A;  7ICQ A;  3DPD A;  1C78 A;  3ZDT A;  3EGR A;  2HCF A;  2KKC A;  4IQV A;  4DQR A;  2PFP A;  1L5U A;  1BT0 A;  1IGD A;  1ZUD 2;  2XNA C;  4UQG A;  3DCG A;  3GV5 B;  5KT2 A;  5J2K A;  3R2T A;  1T0Q C;  5AKI A;  4YVZ A;  1MQ2 A;  1WMH A;  3TI0 A;  2JZB B;  1RZT A;  3LB8 C;  4W9C A;  4F7Z A;  1QLB B;  2HJ1 A;  2JXT A;  1PZN A;  1X9M A;  4KKI A;  3N7P D;  2AEH A;  3PV1 A;  2Z8L A;  4UB4 A;  3VUW A;  2AXT U;  1LKY A;  4NLN A;  3QU4 A;  2RPQ A;  1TKD A;  3O13 A;  2RD0 A;  9ICA A;  5E79 U;  2W9B B;  4DL4 A;  4OZA A;  2I2Y A;  5DPS A;  8ICQ A;  4Y2P A;  4II3 B;  1CUK A;  3B0A A;  5ALU A;  1KW4 A;  5K4L A;  3OWE B;  2YB4 A;  5G55 A;  4CHK A;  4P2H A;  1ZPS A;  3ZJT A;  2BQR A;  3ZW3 A;  1HJP A;  3C19 A;  1ARO P;  2CR5 A;  2UVR A;  5DDM A;  2H3F A;  4F91 B;  3SI8 A;  4DFK A;  3SQI A;  2RGF A;  4ED2 A;  1DK3 A;  3A4R A;  3HRD D;  4M0W B;  4F71 A;  2FI1 A;  4EX7 A;  5AZH A;  4W9L A;  2ATL A;  2NR2 A;  8ICN A;  5ALK A;  3MJ5 A;  4ANX A;  5JH5 C;  4P0Q B;  4M47 A;  2V0G A;  1ET9 A;  4O3R A;  1RPL A;  1ZQO A;  4OW0 A;  2INN E;  4HEA 1;  2IHN A;  5DGB A;  3BY4 B;  5DB6 A;  2KJ8 A;  2PMZ C;  3PR5 B;  2A3V A;  2WXI A;  4YXM A;  3KHG A;  2NRV A;  2UVV A;  5HR6 A;  7ICL A;  1VCB A;  3PZD A;  4FAD A;  2G9H D;  4DSL A;  2HHV A;  4N58 A;  4PL1 A;  4GXB A;  4ICU A;  2MA9 B;  5BMH A;  1QIL A;  3U7D A;  1WR1 A;  4PS8 A;  4E3C A;  3K4G A;  3ZLZ A;  3Q8P B;  2KKP A;  1X6I A;  5IAA C;  2K9X A;  3R7Q A;  1ZQB A;  2ISP A;  1HQR D;  4JWS C;  5KFR A;  5DGA A;  3EPI A;  2IJ0 A;  2EAO A;  2PVO D;  5DG9 A;  5J8Y C;  2CJN A;  2RDH A;  3H8S A;  5CB1 A;  3OJ3 A;  5KFJ A;  4PYZ A;  1T5X D;  1KKX A;  4HRS A;  1OTR B;  4UB5 A;  3QEA Z;  4YN4 A;  1XSP A;  4O3S A;  3FYH A;  1P7D A;  2LXA A;  4FZN A;  3V6H A;  1NK9 A;  3RR7 A;  4AOF A;  5EWG A;  3OLM D;  3H8H A;  1QT9 A;  3L08 A;  5C23 A;  3BIN A;  1VD2 A;  3CST A;  4ARC A;  3JPR A;  4UAV A;  2RHF A;  1DRG A;  1WWT A;  4EFO A;  2Q5W D;  2IND C;  4MFA A;  2N9P C;  4C7Y A;  1SE4 A;  1IXR A;  1ZOL A;  1CJE A;  2V4Q A;  4KGR A;  1RYU A;  2X8X X;  3E58 A;  4GDL A;  3P42 A;  2BB6 A;  2Y5C A;  1JIH A;  4NV0 A;  4UB2 A;  4M9G A;  4DDG D;  5KG0 A;  4RPY A;  2W9N A;  4NJ8 A;  2F76 X;  3PST A;  5EE1 A;  3KWL A;  5J0W A;  2YQE A;  3AU6 A;  5HFY A;  1I4P A;  5ALN A;  2AYO B;  5ALX A;  2O6V B;  2WF5 A;  5J2C A;  2WAQ F;  2LRU A;  2ZIV B;  3A9K A;  2K89 A;  1YQB A;  2BKR B;  4KTQ A;  3DOW A;  5CX3 A;  3RYT A;  2MAX A;  2IPK D;  4GU2 A;  1Q10 A;  1E7V A;  1D5X C;  4B9S A;  2DGZ A;  3H7I A;  4EBD A;  4DF4 A;  1C4A A;  1JWU D;  5ALT A;  2RLT A;  2DKZ A;  2MRL A;  3NAS A;  4UAU A;  1YQ3 B;  1G6J A;  1C79 A;  3RNB C;  5DBC A;  5ALF A;  2LHT A;  2B0C A;  2HMX A;  1I4R A;  1TKE A;  4EKU A;  1I4X A;  3MR6 A;  2VH1 A;  2NRT A;  2LHE A;  2QAR B;  3MBY A;  1PGX A;  2Y1J A;  4BKS D;  4I2D A;  4YR2 A;  3C28 A;  4K4G A;  1ZQZ A;  1UA1 A;  4QNL A;  2KJ5 A;  5AKL A;  1Q1O A;  2J0J A;  2LYH A;  3FC4 A;  1VDV A;  1U47 A;  4PHE A;  3V6J A;  1RQN A;  3JVZ X;  4KIT B;  1ROE A;  4TQ0 A;  4GC7 A;  2EZZ A;  2BZF A;  1UWX A;  2R8H A;  4GXJ A;  2K4I A;  3HK0 A;  1NJZ A;  2E6X A;  1QZE A;  5T8I A;  4RFB A;  2AGP A;  5J0Y A;  4TSS A;  2LGX A;  2M0N A;  3IN5 A;  4YSX B;  3QK0 A;  2HW3 A;  5KFD A;  3Q8F A;  2VRR B;  1FXA A;  2AX5 A;  4M9N A;  1WYG A;  4C4V A;  4XWT A;  4C8N A;  5IIK A;  1TAQ A;  3SR6 A;  2XEW A;  4WJ3 B;  4GGQ A;  2DL0 A;  4J3O D;  4ZRQ A;  4YXJ A;  8ICC A;  1S8O A;  3SEN A;  2AWT A;  2WHI A;  4X5V A;  1ZQY A;  4Q45 A;  1Z5S B;  2JT4 B;  2LMC A;  1N60 A;  2SAK A;  2YML A;  2WDV B;  4W9G A;  4KMO B;  4I2F A;  2NPT B;  1LM8 B;  4UDU C;  5DG8 A;  1AYF A;  2K22 A;  4QZD A;  2D6F C;  3P4P B;  3KUC B;  4ECR A;  3TAC B;  3JPO A;  1ZKH A;  4H2A A;  4AS1 A;  2MW5 A;  4DL6 A;  1SL2 A;  5KFW A;  1VZ6 A;  8ICW A;  1KM7 A;  4XQ8 A;  3BVZ A;  4MH0 E;  5D3I B;  4XZ4 A;  1S3S G;  1HXY D;  2EKE C;  1LGR A;  4YXD B;  1ZQV A;  3RBE A;  5KG7 A;  1E5W A;  7ICU A;  2XN9 C;  1JUD A;  2REX A;  4K4I A;  2KFK B;  2VKQ A;  3AQE A;  4OJ6 A;  4BJQ A;  3PO0 A;  5CRX A;  1L4D B;  4O3N A;  4RH6 A;  4XE0 A;  2X38 A;  3I76 A;  2HOI A;  5DDY A;  2F8L A;  2D2Q A;  3GB1 A;  2EAP A;  1PK3 A;  2N9K A;  1RM6 C;  2GBN A;  2FPL A;  3CMM B;  3QQ8 B;  4ZRP A;  4EYH B;  4KLG A;  1B43 A;  5LNK 1;  2KYW A;  4ITK A;  4KSL C;  3BQ0 A;  2KTR A;  1LB2 B;  4UAT A;  4P7I A;  1KRH A;  4RQN A;  3GE8 C;  3BJY A;  3X0W A;  1J19 A;  3DWG C;  1TK8 A;  3TSS A;  5E6J A;  4ARI A;  2ZCC A;  4AJY B;  2V4L A;  2ZIW A;  2NTS A;  1J97 A;  3WKC A;  1STE A;  2D3B A;  3BZD B;  2MRP A;  5DB9 A;  2PXI A;  2PI4 A;  2FCN A;  3VXW A;  1SV0 A;  4BWM A;  5DBA A;  3NVV A;  3RR8 A;  2MP2 A;  3APF A;  4KZ0 A;  2KZM A;  5HR7 A;  2UVW A;  3V7L A;  3KFU F;  3Q6B A;  1VR9 A;  2HSZ A;  2J52 A;  2MJE A;  2G5I B;  3LYY A;  4W9I A;  1WMH B;  2J6S A;  4G3I A;  4HCP B;  3NRW A;  4CQN A;  1JMS A;  4OJO A;  2C60 A;  3ZQ4 A;  4B6J A;  3KHH A;  4KLL A;  2L05 A;  2DYM A;  3JPT A;  2LZ6 A;  1LKY B;  3A0B U; 
#chains in the Genus database with same CATH homology
 1AWD A;  1YJJ A;  1L6V A;  3AM9 A;  1XEE A;  1F0Z A;  1QOA A;  2I38 A;  1EM7 A;  1E6E B;  1P7E A;  1V1P A;  1TKG A;  2HTM E;  2JU6 X;  1WGK A;  4A9A A;  5TSS A;  1V8C A;  5AUI A;  5MPO A;  2DBY A;  1JCK B;  4RCO A;  2JX5 A;  5AUK A;  3AEC B;  1V1O A;  4KX6 B;  1SJH D;  1M4V A;  2JSV X;  1ZXI A;  3E9S A;  3T3O A;  1V97 A;  4WH4 A;  1A70 A;  1FEH A;  4RGM A;  3P63 A;  1C9F A;  1L0Y B;  3GS2 A;  2JQR B;  3KQ4 A;  2RPV A;  3AED B;  1F2R I;  1F77 A;  3NZ3 A;  4B0E A;  1ZXH A;  4DXF A;  1I4H A;  1I7H A;  1JWA D;  5BMI A;  1IUE A;  2EKI A;  5JXV A;  1EU3 A;  3AH7 A;  2H89 B;  2RDG A;  2WXP A;  4NAW B;  1VZ8 A;  1FFU A;  3P1M A;  1L4Z B;  3E56 A;  3U4E G;  1ZOY B;  1SBB B;  1UNS A;  4REZ A;  1IBX A;  1DOY A;  5C2T B;  4IDI A;  2ICI A;  3VR9 B;  1P7F A;  1SE2 A;  2OHF A;  4RGO S;  1FO4 A;  1QQR A;  1YN3 A;  3PZ7 A;  4ZHO A;  3AEG B;  1BUI C;  3AMZ A;  2INP E;  2WXH A;  1ZP0 B;  1JAL A;  5GXG B;  2HDE A;  4C7Z A;  5H92 C;  2BW2 A;  4RGT A;  2MH7 A;  2L52 A;  1EU4 A;  1YN4 A;  1B9R A;  2LFI A;  4MAC A;  4L1B A;  1CZP A;  4C56 C;  1RWS A;  1B1Z A;  3NRZ A;  1F2R C;  1OQQ A;  1OFF A;  1TS4 A;  2J42 A;  1DYQ A;  4IOI E;  1L0V B;  2KAJ A;  1XCT L;  2WXK A;  4JE3 B;  3RFZ B;  1RYJ A;  2QEJ C;  5G5H A;  1BML C;  2WNM A;  4DQO C;  3ABV B;  3ZYY X;  3IAS 1;  4A90 A;  5HG2 A;  1KTK A;  3IAM 1;  1FNW A;  2KMM A;  1HA5 A;  3AB5 A;  3AEA B;  2JYT A;  2KQ4 X;  2Y3A A;  4GDL B;  4MT5 A;  4D2K A;  4ZYS A;  1N5X A;  1JWM D;  2WDQ B;  1VZ7 A;  4XDD A;  4DXG A;  1XF5 L;  1GPX A;  4P6V F;  2QIL A;  3U7Z A;  3TUO A;  4XWW A;  4YSY B;  2RMM A;  1JRP A;  1R7S A;  1WRI A;  1NVI D;  4NAM A;  1KFY B;  2WXL A;  3U2S C;  4A6Q A;  1ZDX A;  3Q8C A;  2DYO A;  3VR8 B;  1TJE A;  2EEL A;  3AE3 B;  2BBC A;  1D6E C;  1UWM A;  3AEB B;  2MEK A;  4KGS A;  1EWC A;  1KLG D;  2M0A A;  5I4D A;  1GB4 A;  1TS3 A;  3IXS A;  3KLS X;  1YJI A;  3MP9 A;  2FUG 1;  3HUI A;  3SEB A;  2W55 A;  2NTT A;  3AEE B;  5HHD G;  5BYR A;  4L23 A;  4RF0 A;  4ZOH C;  1TS2 A;  2KWD A;  2IGH A;  3V05 A;  1Y56 A;  3P4Q B;  2JYE A;  1SXT A;  2KAC A;  4LTU A;  1DOX A;  2WU2 B;  1EWY C;  4IKG A;  1C76 A;  4FXC A;  1RFK A;  1C4P A;  1SSN A;  2QSD A;  1XLP A;  2GRI A;  2VZK D;  1JW9 D;  3CWI A;  1SJE D;  1I4G A;  1SE3 A;  4A8X C;  1GB1 A;  3NS1 A;  3PZ8 A;  4ZHP A;  1CK1 A;  1JRO A;  1QOB A;  1VLB A;  2ZW1 A;  1MPE A;  1PYW D;  3AE9 B;  2TSS A;  3AE2 B;  4HRO A;  2PW9 A;  2W54 A;  4WUR A;  1DGJ A;  1UUP A;  3DWM A;  2PIA A;  1J7A A;  2BS3 B;  4P16 A;  4KGT A;  4N59 A;  2V3P A;  3NVY A;  3FAH A;  2IGD A;  2WXN A;  4RGN A;  3B9J A;  1FCC C;  5BMG A;  2PKO A;  1XLQ A;  4LK0 M;  5HI1 A;  2FBW B;  2SEB D;  5FR3 A;  3ZGZ A;  2AQ2 B;  3BWU D;  2AQ1 B;  1AN8 A;  2BB5 A;  1PGB A;  2KDM A;  2WXJ A;  1FXI A;  5G5G A;  3AE7 B;  4MM3 B;  1HZ5 A;  1C78 A;  2W3S A;  3EGR A;  2VZK B;  1IGD A;  1ZUD 2;  2XNA C;  5D7G A;  3BVG A;  1PFD A;  1SB3 C;  3W1S A;  3R8B A;  1L5P A;  3R2T A;  2YEP B;  1MHH E;  1SIJ A;  1C4C A;  1SEB D;  1MI0 A;  3TEY A;  2WQY B;  4USA A;  3LB8 C;  1NEN B;  2BT6 A;  1N62 A;  1QLB B;  2H88 B;  2JXT A;  1ZE3 D;  4KKI A;  2BS4 B;  2Z8L A;  3AV8 A;  3O13 A;  2MJD A;  4XDC A;  1XO3 A;  1FNU A;  4OZA A;  2I2Y A;  3OWE B;  1FIQ A;  2WXG A;  3ZJT A;  1ZPS A;  4L2Y A;  3SFE B;  2WXR A;  2BS2 B;  2N9L A;  3U52 E;  4C80 A;  4N6E B;  1C77 A;  4TQ1 A;  2K3U A;  3IT6 B;  3URY A;  3HRD D;  1OQR A;  1JQ4 A;  3MJ5 A;  3FIL B;  2LGI A;  1MHX A;  1ET9 A;  1TKY A;  5C3J B;  3VRA B;  1HEZ E;  1KF6 B;  1E7P B;  2QMT A;  2WS3 B;  2PTL A;  2INN E;  4GLS C;  4HEA 1;  1J7C A;  4OZB A;  4OW0 A;  5H8Y E;  1XCQ L;  3EUB 2;  3BVM A;  1NYQ A;  1WXQ A;  2WXI A;  3BYY B;  2ON8 A;  2Y5P A;  4NZL B;  4YSZ B;  2G9H D;  3P4S B;  2N0S B;  3AE8 B;  1HZ6 A;  1K53 A;  3AEF B;  4N58 A;  4NJC A;  2BTE A;  4WAF A;  5BMH A;  1QIL A;  4JPS A;  4MH8 A;  1V1P B;  2K9X A;  3ZJV A;  2D5G A;  4JWS C;  1HQR D;  2IJ0 A;  2PVO D;  5FKA C;  4TMA B;  1NYR A;  2CJN A;  2RDH A;  3BK2 A;  1T5X D;  1UGJ A;  1BXT A;  3NVZ A;  1VRA B;  2PMV A;  4HRS A;  4US9 A;  4O1N A;  5D3D A;  1N63 A;  2WXF A;  2N7J A;  1GAQ B;  3I9V 1;  5EE3 A;  3H8H A;  3W5U B;  1QT9 A;  2LJI A;  4GDK B;  5FK9 C;  1D5Z C;  2JZP A;  1CQV A;  4ARC A;  1WWT A;  2Q5W D;  1L6U A;  2G1E A;  3AE4 B;  4C7Y A;  2L1A A;  1SE4 A;  1ENF A;  1CJE A;  1IBX B;  4KGR A;  1XXG A;  3GP7 A;  2CU3 A;  2WXO A;  3W2D A;  1QKZ A;  1LO5 D;  3P42 A;  4HJG E;  2BB6 A;  2Y5C A;  1VJK A;  3NUH B;  4WWM A;  3ETR A;  1NEK B;  2K0P A;  1PUT A;  1YNT E;  3KWL A;  1XLO A;  5EE1 A;  4LLG M;  5HFY A;  4WIP A;  1I4P A;  1E9M A;  3J9C A;  3HVD A;  5EE0 A;  1ESF A;  4YTP B;  4KKJ A;  1IGC A;  3BII D;  4RF1 A;  2JWU A;  3NVW A;  2IPK D;  1Q10 A;  1D5X C;  2BYT A;  2GI9 A;  1D5M C;  1E0Z A;  2DWQ A;  1C4A A;  1JWU D;  3LXF A;  2W3R A;  1YQ3 B;  1C79 A;  1PGA A;  2K5P A;  3CIR B;  4YTN B;  1TKE A;  1PDX A;  3L4P A;  1I4R A;  2M56 B;  2B76 B;  1I4X A;  2LHE A;  2PLP A;  1PGX A;  1NI3 A;  3R2I A;  1TY0 A;  1JWS D;  5EE9 A;  3MC0 B;  3FC4 A;  1VDV A;  2LHD A;  3ZJU A;  1YMH E;  1KH0 A;  1N5W A;  1ROE A;  4AQ7 A;  1FMA D;  1TS5 A;  2M19 A;  3Q8B A;  4TQ0 A;  5BYS A;  1UWX A;  3W5V B;  2ACZ B;  1JWB D;  2V3N A;  2E6X A;  2WLB A;  5T8I A;  3MFG A;  4RFB A;  1FFV A;  1E10 A;  4TSS A;  1FD6 A;  1FRR A;  1D4B A;  4HKQ A;  4Q2J A;  2KN4 A;  4YSX B;  2ZW0 A;  4WQM A;  3Q8F A;  2ONQ A;  4EE2 A;  3AE1 B;  2J53 A;  3B2G A;  3TEW A;  1FXA A;  2AX5 A;  4YWG G;  1WYG A;  1TZO A;  4XWT A;  2WU5 B;  3SR6 A;  3N9Y C;  4YT0 B;  4J3O D;  4ZRQ A;  1K51 A;  2LUM A;  3Q69 A;  4R3D A;  1I4Q A;  3TEZ A;  1SF0 A;  2LMC A;  2WDV B;  4PT5 A;  1N60 A;  2SAK A;  2WXM A;  2E3T A;  2OED A;  4UDU C;  1K50 A;  2L32 A;  2J4X A;  3MHZ A;  1T6B X;  1AYF A;  2MJ3 A;  2K22 A;  1FM0 D;  3P4P B;  2IGG A;  1L0X B;  2LEK A;  4H2A A;  4AS1 A;  3WCQ A;  1XLN A;  1VZ6 A;  5D3I B;  3BVZ A;  2V4I B;  3KWV A;  1HXY D;  3SFD B;  1ZDV A;  4YXD B;  1QF6 A;  1WSP A;  2XN9 C;  3AE6 B;  1JML A;  2WXQ A;  4YTM B;  3PO0 A;  2V0G A;  4OZC A;  3Q8A A;  1L4D B;  3I57 A;  4RH6 A;  4XE0 A;  3BYT B;  2X38 A;  3AN1 A;  3T3N A;  1QOG A;  4OVZ A;  4OHJ A;  2DLB A;  3TEX A;  1TY2 A;  3GB1 A;  2GB1 A;  2N9K A;  4US8 A;  1RM6 C;  2CJO A;  2WDR B;  1ACC A;  1FRD A;  4ZRP A;  5BYQ A;  1YQ4 B;  4RNA A;  5LNK 1;  4ITK A;  1FNV A;  4JX1 C;  4HKZ E;  1DOI A;  2IDY A;  1ET6 A;  1AW7 A;  1KRH A;  3BK1 A;  1K52 A;  3RPF C;  4ARI A;  3DWG C;  3TSS A;  5E6J A;  3W9C B;  2QIE B;  2PVG C;  2QJL A;  3VRB B;  2NTS A;  1QOF A;  1STE A;  3BZD B;  3IT4 B;  1T3Q A;  3AE5 B;  1N61 A;  3C8Y A;  1FCL A;  3EA6 A;  1KLU D;  4M0W A;  3VQI A;  3NVV A;  3HVZ A;  4B0M A;  2R61 A;  1MVK A;  3FIL A;  2AQ3 B;  1J7B A;  3B2F A;  2L83 A;  1VR9 A;  3V3X A;  2J52 A;  2MJE A;  3P4R B;  3LYY A;  4JWU C;  3UI3 A;  4CQN A;  3ZQ4 A;  4A55 A;  1GOZ A;  1TYG B;  1YN5 A;  3Q8E A;  2FE8 A;  2DYM A;  2YEP F;  2WP9 B;  2NMQ A;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...