1N63A

Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 160
sequence length 160
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n63A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n63A01
3W5UB 3AE5B 3P63A 1CJEA 2PIAA 2M19A 2WS3B 3ZYYX 2PVGC 4YT0B 3VR8B 5G5HA 2BT6A 1RYJA 1VJKA 5C3JB 2JX5A 2WP9B 1UWMA 4KX6B 3AN1A 1OQQA 1J7AA 1E6EB 1SIJA 3ETRA 1WGKA 1DOXA 1NEKB 2WU2B 5C2TB 3VRAB 3B2GA 1ZUD2 3AEGB 4HROA 4N59A 3W5VB 1E0ZA 2QIEB 5EE0A 1L0VB 3RPFC 2L83A 3B9JA 1WYGA 4LTUA 3ABVB 3AEEB 2L52A 2BS4B 2KAJA 4ITKA 2Q5WD 3CWIA 3P1MA 1FMAD 2EKIA 3P4QB 2KMMA 2CU3A 5H8YE 3DWGC 5GXGB 1QF6A 2AX5A 5EE9A 2W55A 1N63A 1RFKA 1A70A 3AE2B 1FFVA 4C7ZA 4US9A 4YTNB 1NYRA 3HRDD 2MJ3A 3AEDB 3SR6A 3AH7A 3NVYA 1AYFA 3AE4B 3LXFA 4JWSC 1F0ZA 1V8CA 1FRRA 3AV8A 1JROA 4US8A 1EWYC 4YTMB 1SB3C 1KRHA 1TKGA 1N62A 3AEAB 4YXDB 1PDXA 1VDVA 1XLQA 2JQRB 3CIRB 1DOIA 2H88B 1JQ4A 1L6UA 3NVVA 3NS1A 2K9XA 4JWUC 1XLOA 5G5GA 1YJIA 1JRPA 2LEKA 1VLBA 2W54A 1KFYB 3LB8C 1JW9D 4ZHOA 4ZHPA 3AM9A 4N58A 4YSXB 3AEFB 1IUEA 1FO4A 4A9AA 3FC4A 1OQRA 3AE8B 1JWBD 1V97A 3AMZA 1GPXA 4YSYB 3AE1B 1N5WA 1RM6C 2ACZB 3BIID 3HVZA 5AUKA 3SFEB 2MH7A 1FM0D 1GAQB 4ZOHC 4C7YA 1RWSA 4YSZB 5MPOA 3AE9B 1QOFA 3AECB 5EE1A 2E3TA 4YTPB 2BS3B 3P4SB 3AE6B 2BS2B 4IDIA 1ZXIA 1T3QA 3NVWA 3DWMA 1PFDA 4P6VF 1NENB 3EUB2 1FXAA 4C80A 1XLNA 4HRSA 4WWMA 1FXIA 3AB5A 1JWAD 1OFFA 1E9MA 3P4PB 1J7BA 5AUIA 2PKOA 1N5XA 1PUTA 3VRBB 1QOBA 3FAHA 1TKEA 1FRDA 2WDRB 1ZP0B 1B9RA 1YJJA 3B2FA 1E10A 3NVZA 1FFUA 1ZOYB 3AEBB 3L4PA 1QOAA 1YQ3B 2FBWB 1JALA 1QLBB 2HTME 2MJEA 2PVOD 2Y5CA 3KWLA 3P4RB 1R7SA 5EE3A 1I7HA 1KF6B 1XLPA 2W3RA 4USAA 3AE7B 2W3SA 1NI3A 2WQYB 1ROEA 1WRIA 1WWTA 1CZPA 3PO0A 3VR9B 2K22A 1NVID 2MJDA 3SFDB 1QT9A 3WCQA 2CJNA 1TKYA 1FIQA 2CJOA 3W9CB 1SF0A 2WDQB 1WXQA 2N0SB 3NRZA 2B76B 2QJLA 2K5PA 1N60A 1DGJA 1AWDA 1E7PB 1TYGB 2G1EA 3HUIA 1YQ4B 4JX1C 4WQMA 1XO3A 3AE3B 2WU5B 1L6VA 2M56B 2WDVB 2WLBA 1DOYA 1L5PA 4FXCA 2DBYA 1J7CA 1NYQA 1TJEA 5H92C 2DWQA 1N61A 4N6EB 2OHFA 1QOGA 2H89B
chains in the Genus database with same CATH superfamily
4Q45A 1EUVB 1UBQA 3ZJUA 4AP9A 3QU9A 2BQRA 3RZFA 3SEBA 4PL1A 5IOIA 1P7EA 4MF2A 4ASWC 1RXVA 5BMHA 2HOFA 2KVCA 1I42A 3PSIA 3UXNA 2DL0A 4JB3A 4QZ8A 2NTSA 3W2DA 3ETRA 2N9EB 2Z0EB 2JPHA 1I4RA 3A1QA 4ECSA 3AULA 3IXSA 1XC9A 4FADA 3ZDTA 2O2VB 5AKJA 1ZOLA 1ZXHA 2MBQA 3M8RA 1D3ZA 2FE9A 1WYGA 2KZ3A 4DSJA 2JGAA 3EWAA 2HBKA 3QARA 1QZEA 4YMNA 3Q3FA 5JXVA 9ICEA 4F5QA 1ZPSA 5J2HA 4BBNF 2CU3A 2VA8A 1NK6A 2VRRB 3SQIA 3H9DA 1Z2MA 3ZDMC 2LYAA 2B3AA 3QZ8A 5DBCA 5KFCA 2V4IB 3RMKC 5DDYA 3UMCA 4ECVA 2FNJB 7ICRA 3V7JA 1WH3A 3OHAA 2MCNB 1BPEA 1Z19A 4ICVA 3OJUA 1ZQAA 4BKSA 1X66A 3NVVA 3HK0A 1RG6A 3RULA 2JH7A 4IM0A 3WK6A 1D5ZC 5G5GA 3V7KA 1WXMA 2FCMA 2W9NA 3R3MA 5KFVA 1D4BA 2DUYA 1FD6A 4ZRKA 5H2FU 1WX7A 4KLEA 5IIMA 1TAUA 2Q4TA 4JV2A 2GB1A 3PT2B 3UMGA 4F4ZA 3ZDBA 1TY2A 3HVZA 5ALTA 1WE6A 3SFEB 3BQ7A 1P98A 2O2VA 3RD2A 3CSTA 5AM3A 3KKAA 5GTIU 4W9KA 1YZ6A 4F5NA 3H7PB 3PV1A 3UIPB 1FCLA 2L0TA 2G09A 1Z1VA 5DQHA 3VRBB 5KG0A 7ICNA 1TKEA 2BCUA 4W9DA 2Y1IA 4YCXA 3DOWA 4NLGA 1XXGA 4KKJA 2NPTB 2KO3A 1EXNA 3MBYA 2ASJA 4B9SA 4Y2VA 5DLFA 4ICUA 1R7SA 2IPKD 2K0PA 2N1WA 2KN5A 4RQ5A 3IDWA 2WQYB 2DGZA 4RT3A 1ROEA 4DFKA 2IO0B 3TANA 1NJXA 5ALQA 3MFHA 2QDFA 5HP4A 3DVGX 3H0RB 4KLMA 3BVMA 4S0RA 3PZDA 1CMXB 3UQAA 4JE3B 5J0TA 4JLCA 1SF0A 4N9F4 2N1VA 1WXQA 2J0MA 2QJLA 1E7PB 4OJ6A 4JX1C 2WXKA 5BMIA 2GH1A 4WAAA 4DS4A 3TFSA 5D3IB 4DDGD 2PW9A 3HKZF 3X23A 5J2BA 1L6NA 3K4GA 5BPCA 1ZQ1C 1HJPA 3ZKJC 1JWMD 3I5JC 3DDHA 3H7PA 1GC6A 3QIJA 3ZD9A 4QWEA 1XO0A 2C7MB 2QARB 4PL2A 1FEHA 3N28A 4MDKE 5J2DA 7ICPA 8ICSA 4FBJB 3BY4B 4M01A 4PH5A 4I29A 9ICKA 3PGEA 4BKTA 4HKQA 2RQ5A 3BQTA 3IG3A 3PREA 2NPTA 3I1YA 3EFUA 4DOBA 3C2LA 4BWMA 8ICGA 3SU8X 1FMAD 2BKFA 5CHVC 2KMMA 3ISCA 4LK0M 2E1EA 2YMMA 5AKLA 2UVVA 3WU2U 2JEIA 5TSSA 4F5OA 1L3UA 4C4VA 2KJHB 4YTNB 3DHIC 4P0QB 3SR6A 4P4PA 4DXFA 2W04A 4FJYA 5AICA 2N4FA 3MFGA 3B08A 1D8BA 2JWUA 2VJ5A 5AI4A 1VDVA 2K6DB 1S5LU 7ICQA 3RB0A 1STEA 4J9MA 4K7SA 3V60A 2SEBD 2BYVE 4NZLB 1V80A 2ZXIA 4EBDA 2W54A 3Q3JA 3JPOA 4ECYA 3F5AA 4I6NB 5LNK1 3R2IA 4KSKC 4F4YA 2YB1A 2QARA 2WXQA 1KLGD 1WXAA 3CMMB 3TL5A 2WHIA 1TTNA 1N5WA 2WXPA 1QQ6A 3N3KB 5AUKA 3KD3A 3V6CB 1RWSA 5BYRA 2KANA 2INNE 2XY5A 3QE9Y 1KFSA 7ICMA 4MJSB 1AROP 1QQ7A 2IO1B 1T3QA 2KDIA 4YL8A 3ICXA 4B9MA 3GB1A 3PZ8A 3I76A 4OO1J 1ED1A 3P4PB 2FUHB 1E9MA 5AUIA 1YX6B 2KHWB 2LM1A 4YN4A 3LWLA 3BZKA 2N7EA 3BJYA 4EENA 3MDCA 5TZVA 4P0QA 4JWNA 1MG8A 3C2KA 3KUCB 1IM4A 4PPXA 1E10A 4LCDE 1SWVA 1C4CA 2LBOA 4M2YA 8ICXA 5BMGA 4B6JA 4DQSA 4LZDA 2XGQA 1WWTA 2V4LA 2MAXA 5FP0A 3JVZX 3U26A 5JHBA 2IGGA 4PS3A 1XSNA 4B9KA 4MFFA 2HBJA 2HOIA 4DQPA 1XCTL 2KKCA 1DGJA 4C8MA 3V6KA 1ZJMA 2RRDA 2YTUA 4NXZA 4B9TA 5J2RA 5KFLA 2DX5B 2BWFA 1N61A 1YIWA 2EMSA 4PS7A 1M94A 2I9GA 5C1ZA 2WXHA 1F1HA 2M19A 4IKGA 1TZ1A 3NS8A 4MJSA 2Y9TA 5J18A 5AKYA 3Q69A 1E8WA 3V72A 1BPXA 3RH6A 3L5KA 4NLBA 4KKIA 4K4HA 2AL3A 2HCFA 4FJVB 5C2TB 3KBBA 1PGBA 4AYBF 4IM3A 4NAMA 4ED3A 1WUDA 3QUBA 3ZDEA 2BGWA 2L83A 3RJKA 4NLCA 1RPLA 4B9LA 3AEEB 1L5UA 2KAJA 4KLIA 1BMLC 1F0MA 2Q5WD 4XX5A 2NRXA 2OOBB 5J17A 2NYVA 1QF6A 2FLLA 7ICEA 2VJ4A 3AE2B 4Q2JA 2PLPA 9ICLA 1HIWA 1TS3A 1TIFA 4IRCA 5J0SA 3SZ2A 1L3TA 4IQUA 3LYYA 3VTVA 3KQ4A 1N62A 5IAAC 4ZRJA 2ZCCA 5CHWA 3ZJVA 8ICBA 2IBKA 1XLQA 5DPTA 2WHEA 3QU4A 2H88B 1JQ4A 1ZD5A 1BPDA 3JPTA 2VA3A 1M6YA 3HM6X 1XLOA 3BYTB 2Y9UA 1J2NA 4IQVA 4IRKA 3SD5A 3U7DA 3SAGA 1C9FA 1JXLA 2B0CA 1T5XD 4A9AA 2GMIC 3MR5A 3O13A 3VFKA 1J19A 4UW9A 1GPXA 4W9EA 2DAJA 4J9RA 3Q3MC 4MM3B 4F8CB 1MSWD 4UAYA 5HHDG 3H0LB 3UINB 2L76A 5CTRC 2KMCA 4OD0A 5AKHA 2OM6A 1MN8A 3APCA 4NM2A 4RH6A 3KVFB 4HPPA 4ZRPA 4HPLB 2E6XA 3ZLZA 3URYA 3M6KA 2R8IA 5ALRA 1QOBA 5K4LA 3QWZB 1T6BX 3H1UA 1B9RA 1N2XA 1YJJA 4UQGA 4ECUA 2PI4A 3AEBB 4PJ0U 4HJKA 2B21A 1WY8A 2V1YA 2KLGA 3OSNA 2PTLA 4EBEA 2KNJA 4F50A 5DLGA 5DB8A 2K4HA 2BQUA 4ECWA 3Q8CA 2EAMA 4CF4A 1SE2A 1LFDA 4QJFB 2OWOA 2ZTEA 3ONSA 2UVUA 4Z6FA 2TSSA 2F8LA 3HILA 4R3DA 2HI0A 3QK0A 1AN8A 3N97B 5FKAC 3UM9A 1PK3A 2O6VD 3KHRA 1KLNA 1E0ZA 3PX4A 8ICAA 4DS5A 5AHXA 3NOBA 2IY1B 5J2KA 1NBFC 1P1AA 4A55A 4KLGA 1L5PA 2AYOB 2ZJ8A 4NLKA 3BVGA 2YMLA 3MHSD 4RGTA 3KOOA 3L08A 3P42A 5KAFU 4NNJB 5ALYA 3H8MA 2JZ3B 2R18A 4EYIB 2GWSA 3H8JA 5C3JB 1VJ5A 2D07B 3JPNA 4UATA 1OUQA 2M0NA 1PVRA 3PW4A 3LDZE 1F44A 2JXXA 2JUOA 5KL8B 7ICKA 4PT5A 4IRDA 3TARA 3OJ4B 9ICGA 1L7MA 3FYHA 1S76D 2QILA 3VHTC 5KG6A 1NK9A 1E8YA 2G45B 3P4QB 2LD9A 1EF1A 1MHHE 3TADA 1ISNA 4KN7A 5H8YE 3TMPB 1KOTA 2ES6A 3A4SC 5KFYA 2G5IB 1RFKA 4DOCA 2FAZA 4EZ9A 4AOFA 3T5JA 4US9A 4GB9A 3TAQA 5TISU 3AEDB 2XVTA 2LPEA 3DVNU 2O6KA 2L5YA 4LJOB 4M0AA 3LK9A 2KN4A 3DBRI 4W9LA 2KSOA 1S77D 3TIXA 1PDXA 1C4PA 1LO5D 4ANXA 1GUAB 4M04A 4HYKA 3T5LA 2F8KA 4S17A 3U8ZA 2OYYA 5KT2A 2J0JA 4Y2TA 3KW5B 2HTHA 3QQ8B 3WALA 3IP4B 4TURA 4P1BC 3EPIA 1NZPA 4KLQA 2LRWA 4ZHPA 5CEHA 4PGXA 2KX3A 5L95C 4MEMA 1E5WA 1SJHD 5DB6A 2XNAC 3QYPA 2J6TA 1KLVA 4GIBA 1V97A 1UA1A 3PW2A 4GC6A 4YSYB 4UB1A 2ZUBA 2DYMA 2JHDA 2EANA 4RUCA 4GN1A 3RNGC 3L0WB 3DDCB 3RNCC 3AU4A 2LUMA 5AI8A 1XLNA 2WF9A 4QZ9A 1UA0A 5HR6A 3NRWA 2EH9A 2WF8A 2JZPA 3PRPB 1SJED 4UASA 1HXYD 4B9NA 3CYMA 2WYQA 1Y88A 2Q0ZX 3E56A 4DO9A 5KFSA 2L1AA 1IBXB 3M9MB 3V05A 4OJOA 2B6GA 3RJFA 1I7HA 2MU2A 1VZ6A 2W3RA 4USAA 5KFUA 4YP3A 2R2OA 1TKDA 1IGCA 3E9SA 3L17A 5ALDA 2MJDA 5HG2A 4TUQA 4QZEA 1RLFA 4ELTA 1C79A 9ICOA 2KHQA 1AWDA 4K3CA 1XSPA 3E0FA 4J9OA 1V81A 2KWVB 3M95A 4JV0A 4MH0E 1U45A 4DSIA 3HHMA 5BYSA 1EF5A 2IOFK 2DWQA 2OHFA 4BJQA 2AEHA 4QAYA 1RYSA 2DPJA 4C00A 1NZBA 3BWUD 4KX3A 1XNSA 2JEGA 2ATLA 4F8RA 1KRPA 2QC8A 5E79U 2KG5A 4ED6A 1SL0A 3AQFA 3VRAB 1Q10A 2EKEC 4N59A 2M8SA 4NY0A 2QIEB 3C19A 5DQIA 4RQ0A 5L1IA 5C0YA 4ED2A 5KG5A 3GILA 1VRAB 1WM2A 2ZW0A 2KTRB 2AJQA 1IBXA 4LTUA 4LZGA 1YNTE 8ICQA 1OQYA 2NBWB 2ZTDA 1SXDA 1KJTA 4DQQA 3MJ5A 3MR3A 5D2MB 3RAXA 7ICHA 5KT3A 2K4EA 3V6HA 4F3OA 1GG3A 3N1ZC 4WURA 2WF6A 2GBJA 2M1MA 3QXGA 3EFCA 1OXJA 2HMXA 4M8NA 2KFNA 4I6LB 1AQ6A 2MJ3A 4F2RA 2PE6B 3I3TB 3T3FA 3RT3B 2BGFA 5LXIB 9ICCA 3RFAA 4NQLB 5DKWA 4I2HA 5AM5A 1O03A 2C22A 2LASA 4DHJB 4BGDA 2AXTU 1SE9A 4F71A 1C20A 4I27A 2NRVA 3UQBA 2KZMA 1YZ7A 4QWBA 1SV0A 3QUTA 3TEZA 1KFYB 5J8YA 5AM0A 5EDSA 1V85A 1X42A 1ZDXA 2PMZC 3N1XC 5DG9A 4F1SA 2V4RA 3DEEA 3MC0B 5IP4D 4RM9A 4DBGA 1JWBD 3ZIMA 4E74A 2MRPA 3WKBA 2PFNA 1ZRMA 2MH7A 3KYDD 1O08A 2JY6A 3KHHA 4BVUC 1J0GA 3Q8RB 3H6NA 2KTRA 3G6XA 1XEEA 1X9WA 1ESFA 4DSLA 1DGSA 2G5HB 3OLMD 2WXRA 2BPSA 4C80A 4IWOA 1N48A 4EX7A 2CRXA 5KNIA 2ICIA 3Q8BA 2G0AA 4J9PA 4DFDA 3APDA 2YQEA 3NUHB 5IILA 3WK5A 4TSSA 3QX7A 2K8HA 3NGDA 4PYUA 4ED1A 1U4BA 2E1FA 1YQ3B 2Y5CA 3P4RB 5EWEA 2KDEB 2XIDA 5KFIA 3C5FA 1KEJA 1MG4A 3EECA 3TJPA 1TS5A 1A5RA 1WJ6A 1L4DB 2C60A 2DYOA 4XDCA 4KMOB 2N0SB 2W7PA 4DWFA 4LNOA 2D8CA 2DZIA 1C76A 2OCEA 2KWDA 1XWLA 1L6VA 4MH8A 4ZRIA 1DOYA 3CF6E 1TGZB 5KT5A 1HE8A 1RYUA 3GP7A 5J2FA 3IG8A 2D6FC 3MTNB 5KFEA 2MA1A 4QZGA 2V4QA 3ML8A 4KSLC 1JI7A 2G07A 3AE5B 3AUOA 1NKBA 3BDPA 2DQNB 3VAWA 1T0YA 1BPBA 4OCZA 1PQSA 4MFCA 1UWMA 3RAQA 5IINA 9ICNA 4J3OD 4O0IA 2FCQA 4EKUA 2MBEA 1E6EB 2K8CB 3RJHA 5HMMA 2JRZA 1RRBA 2D3CA 3RNAC 3IV6A 4P1CC 3W1SC 4FE3A 3DCGA 5DPRA 2FJ6A 2N7JA 4KGRA 4HPMB 3R8BA 3ABVB 1JMLA 4MACA 4O5KA 5AZGA 2F77X 3RRGA 3P1MA 3OGUA 3KHLA 4YD1A 1X1MA 4A3OA 3RBDA 3DWGC 5GXGB 3PW0A 5HHHA 1L3SA 1MQ3A 5J2JA 2CU1A 3U7ZA 5JUMA 1BPYA 4GSWA 2OJWA 4M00A 4RPXA 4NJ8A 1YD8U 4ZYSA 3EPGA 1TV9A 1FRRA 1UQVA 2W11A 4US8A 3SV3A 1Z1BA 4YTMB 5AK4A 2BR0A 2BCRA 1ZYQA 5AKIA 3H8HA 2IYDB 3RF9A 1ZQBA 4GDLB 5KFHA 4KZCA 4I2DA 2W9AA 2WGSA 4W9HA 2NTTA 1VCBA 1NK5A 1RFAA 2L3ZA 3AM9A 3B0YA 4TMAB 2BTEA 5AKXA 3ZNHB 1WXVA 3AE8B 4DL4A 3ZJTA 3MP9A 2H3FA 4HAIA 1SE3A 2K8CA 4NLZA 3Q8SB 3NZUA 1NOMA 5HKHA 2K8AA 4O9MA 3H7IA 8ICUA 2DKZA 2LMCA 4LVSA 3ZVVA 2GOLA 3BINA 3NTUA 1ZXIA 3ETLA 4K4IA 3PNCA 4GLXA 1RYRA 4FBUA 4GLSC 1WGGA 4TQ1A 4WWMA 2JT4B 3VXWA 2L8JA 3NJTA 3WA0A 2CXYA 4GU2A 3SAFA 1S0NA 4AQ7A 3UQ0A 1XF5L 2KDMA 3PZ7A 3CW2C 1ZQNA 1UZXB 2F44A 2ZXHA 4EEWA 4CO7A 5EE3A 4M9HA 3V7LA 5E6JA 3M9NB 1CK1A 3K1ZA 4G9BA 2A1AA 4GDLA 1V38A 4K7UA 1IIPA 2GI9A 7ICUA 4GMVA 2BKEA 4AWJA 1IG6A 7ICVA 2LGSA 1C78A 3NZSA 4CQNA 5L1MA 2BPFA 4KLUA 1ACCA 2FUG1 3Q8LA 4OZAA 4EZKA 1KFDA 2WXNA 5KAIU 4I2EA 4JIOU 2AGOA 2H5XA 2YMPA 2JYTA 1DK3A 4LJXA 4UARA 3RFZB 2Y1JA 1JN3A 2HHVA 2M0XA 2NV3A 3W5UB 1SWWA 3ZYYX 2PVGC 4C4TA 3O0FA 3VR8B 5G5HA 7ICIA 1VJKA 2DFLA 5AKKA 8ICIA 1I35A 3AN1A 8ICFA 1ZQTA 1SKWA 1Z5SB 1ECWA 3K9OB 1DOXA 1DRGA 2VKQA 2K8BB 2LRUA 5KG4A 2WX1A 1UD7A 3R7RA 4HEA1 4NL9C 2ZTCA 3ZXRA 4EUTA 2OH2A 2XGPA 4HDQA 3WKCA 4WJNA 5KFAA 5IIIA 2R8KA 5AEKB 3QU7A 2V3PA 2RP5A 2G4DB 2D3BA 2KZZA 4HVBA 2LFIA 4E0DA 1FXTB 3NVYA 2LGIA 3WK9A 4C8OA 2DZMA 1JROA 3AV8A 4G50A 1ZQKA 5EWFA 2LI6A 2WXMA 2WF5A 5J0WA 3KZIU 4J9NA 3JPQA 2KEYA 1WE7A 1COOA 3N7SC 4DF8A 2RPVA 4GXIA 1JIHA 1WGRA 3THVA 1YJIA 2LEKA 1XQQA 1ZQDA 5KG7A 1EM7A 4NM1A 1PYWD 3GDXA 4YSXB 3PO5A 3AEFB 1TS4A 4M6WB 9ICBA 1XD3B 3R7QA 1A6SA 1YN4A 2IMWP 1ET6A 4M9NA 2FPKA 1AW7A 4Z6CA 4P0PB 1PGXA 4J03A 4BKSD 1WIAA 5J0QA 2K8BA 1BVSA 1UPHA 2WXJA 4C7YA 2XBBC 5CR0A 4JQWC 3C5GA 1K1QA 2WDTB 2FMQA 4HKZE 5T8IA 1UNSA 2KMDA 2XY6A 2FLNA 3ZRCA 2KJ5A 3GIMA 3P4SB 3LVWA 3PMNA 3BQ2A 1F77A 1NENB 5ALPA 4M9JA 2PKOA 4Q8EA 1N5XA 3TI0A 4UBCA 2W9CB 3FAHA 1X2IA 3MDAA 2LXAA 2A1JB 1URJA 4FFDA 2NMQA 2WXIA 2ZEQA 1L2NA 1ZQWA 1ZOYB 3Q3NC 2PVOD 2N9PC 1U9LA 3A0HU 3UXOA 2DENB 5AK6A 4A90A 1X9SA 2W3SA 4II3B 4NQKE 1UCVA 4WJ3B 3HW8A 3E2EA 4A6QA 2YY6A 1TAMA 2KK0A 3ONNA 3VDZA 3W9CB 4DHZE 3B0AA 2KVZA 2WDQB 3ZTCA 1WI0A 3BVZA 3D6JA 4JWMA 1ZQJA 1F9JA 4M6WA 1XO3A 2RPQA 2M56B 3Q6BA 4XYCA 3RJGA 2WLBA 3A33B 1SZPA 1LGRA 3M63B 2VZKB 4RQ8A 4I2IA 4BX9C 2D2QA 4BKGA 4QZDA 1HA5A 2BB5A 4L1BA 5KFTA 2K89A 2LVQA 2ZW1A 4DQRA 3P63A 2UYZB 2LGDA 2AWTA 4YT0B 3IN5A 1UGJA 2BZFA 1KW4A 3DVNV 4GDKB 1L7YA 1KQQA 5ALIA 4O3NA 5ALMA 3RZWC 5JZEB 2MRLA 2WU2B 2KD0A 3RNFC 3WK8A 1UELA 2W9CA 1KM7A 4JPSA 3QNMA 4W9CA 2M0AA 3WK7A 2L52A 3SDLC 4QZBA 1UGMA 1V9JA 2H3QA 3KTQA 3EC8A 2LJ5A 4G3XB 5ALFA 1I4GA 1VZ7A 1Z4OA 3RN9C 2JZZA 4FS1A 5DBBA 4O3OA 2GRIA 3U4EG 3QUCA 4KLFA 4RNMA 4HLEA 9ICVA 3PVLA 4URKA 5CJ7A 1KRHA 3BYYB 2K25A 5AZHA 2LYHA 1XSLA 2EMTA 1TFRA 3MGVA 5KFKA 2KFKB 3GE3C 5TR5A 2MQJA 2NS5A 1L0XB 3X0WA 2KQ4X 1L6UA 2LVOA 1TY0A 4Q44A 4XWTA 1WF9A 4C8NA 3PO4A 1ZQMA 5A0LA 3CP8A 5JTIA 4EZ6A 5J2IA 2ZUCA 4N58A 1N56A 4ANUA 4QW9A 1WM3A 3RH5A 1PVQA 4GDKA 4RT2A 1S0OA 4DFJA 1FPYA 2P66A 1ZKHA 4XGAB 3KUZA 2K4PA 3KLSX 2CS4A 3DBRB 5BOLA 1TE2A 2EZYA 5EOZA 2VH1A 4FA6A 5MPOA 4IWPA 3AECB 4KDLB 3SI8A 4J9QA 4KLLA 5DPSA 2IA6A 3T3NA 3OJ3A 3EYZA 2RDJA 2FI1A 3Q8FA 2ZPYA 3AB5A 4LNIA 9ICMA 1Z00B 1JWAD 4YXJA 4F72A 1MHXA 2HBMA 1B43A 1UT8A 1T0RC 1SZHA 2I6XA 2X8XX 9ICWA 3VCBA 4BFRA 1F2RI 3AI5A 3T9LA 3MC9A 1I4QA 1A0PA 9ICQA 2KFKA 5GMVA 1IV8A 2DF4B 4Y2PA 1OEYJ 2XEWA 1TBEA 2WB1C 1L3VA 3D2SA 1NVID 4XWWA 3QUQA 1QILA 4C8LA 2CJOA 2W03A 2M17A 3I63C 4KTQA 5J0RA 2JXJA 5HNKA 8ICJA 8ICWA 2LUEA 3KFUF 2PKEA 1ZGUB 2BF8B 3L16A 3RTVA 3HUIA 1Q46A 3D2QA 3TSSA 3QEBZ 2CHZA 4LDTB 1D9FA 3PW5A 5ALUA 3C0RB 5L1LA 1ZQIA 5H92C 1TJEA 1T0QC 4N6EB 3RB4A 2XI9A 3T79A 2UVRA 4QIWF 3DPDA 2GLSA 1M4VA 4E3CA 1PUZA 2QB0B 4CF5A 8ICTA 4C0ZA 4J6IA 4Y2YA 3SEIA 5CHGA 2BPCA 2KKVA 2WP9B 3RI7C 1QSLA 5G2NA 1EO6A 4I2CA 1SIJA 1Z00A 3BS7A 1NEKB 3RCZA 4Y2JA 1ZUD2 3B2GA 4HROA 3SENA 2ZZPB 4CNQA 3IRUA 2HVIA 3VTWA 4C4RA 2WXGA 3P2BA 2IDYA 3R66C 5AM4A 4MELA 2GOWA 4EEYA 1CRXA 1L7OA 1HZ5A 5B66U 2LGXA 2FPLA 5KFWA 4MM3A 2EQYA 2N9LA 2VA2A 2X38A 2AX5A 3F5EA 3GIKA 1SSNA 2KMAA 1A70A 3EGRA 3PMLA 3ZDAA 4JMUA 1YT3A 2K4IA 2ALZA 1WWUA 4NV0A 4RQNA 7ICTA 2BCQA 4LLGM 4XE0A 2KC1A 2GLEA 4MHVA 4F7ZA 1SB3C 4EEKA 4ELVA 4YR2A 1GC7A 5J0PA 3M8SA 2JRHA 4AJWA 1DXSA 5KFDA 3ZNGC 4DLGA 3DBSA 3DBLB 4QZAA 1K52A 2FMSA 2JZBB 5AI6A 1WR1A 1Z3EB 1JRPA 4IQTA 3ZW3A 4W9IA 1B0XA 3RUIB 5CRXA 2KJ9A 2JRIB 2F1JA 2D10A 1S8OA 9ICFA 1IXRA 1COKA 4HWIB 3AE1B 2LKYA 5AIAA 3PVXA 2RGFA 2BHNA 2ISOA 1FM0D 3ZDCA 1K50A 2C7HA 3O65B 3V6EB 4C4SA 1ZE3D 2CKHB 4WQOB 1K51A 2H3ZA 3KHGA 5D4BA 4UB6U 9ICXA 2BS3B 4BDPA 5AM1A 1UT5A 2JMGA 4IDIA 2ZNVC 5IA7A 4RQ4A 4P6VF 2BBCA 4HRSA 5AI9A 2PI5A 2INDC 4M9LA 1OFFA 4O5EA 4DXAB 3PSFA 3OSPA 3H7SA 2C2RA 4EX6A 3F2BA 1PUTA 2LMRA 4P7IA 1FRDA 2MP2B 2WDRB 4RNAA 1T0SC 1ZP0B 3GIIA 2E8PA 2LHTA 2A3VA 1QOAA 4RNOA 5ALNA 1L4ZB 2GBRA 2ZUDA 1XLPA 4BOZB 3AE7B 1C77A 1CZPA 3UIOB 3SAHA 4ELUA 1WJ4A 1RAXA 2DZJA 2JZBA 1T3NA 2I5HA 1WGDA 2RSUA 3KKAC 2NCNA 1QKZA 4DSKA 4GIVA 4BBNC 2I1KA 4XC2A 1TAQA 4O3PA 1CI4A 4KGSA 2Z8LA 2WDVB 3VC8A 3QEAZ 1I4PA 4KIKB 1WFYA 3M62B 1TK0A 3ED5A 1ZDVA 1WX8A 4BXOB 3IFWB 1V86A 2JU6X 2SAKA 2HHUA 4UDUC 1V6EA 1C7YA 4ECTA 4RQ1A 4Y2RA 4DOAA 4LNKA 4IOIE 1GB4A 2J0KA 4OZBA 3TBLD 1I4HA 2RMMA 3NZ3A 3K1RB 2KE7A 2XICA 3LWMA 1J7AA 1ZD3A 4MGKE 1WGKA 4WJPA 4ZYNA 3M1YA 4RF1A 4PZNA 2DZKA 3N1YC 2MP2A 3W5VB 4DK5A 1K5OA 4QWDA 4I2JA 3JSVB 5KFXA 4A8EA 4RF0A 2KVRA 1LKYB 1P9DU 3HT3A 5DBAA 4F5RA 4QW8A 4DFPA 1TS2A 1YOVB 3N7RC 3OJSA 2WXOA 2EKIA 2A5UA 2HW3A 3M6ZA 1RDFA 1ZQFA 4FBTA 2LXCA 4WAFA 1LV5A 3APFA 5DG8A 1IP9A 4UB8U 2LHEA 2IGDA 2HHWA 7ICFA 2L32A 3D32A 3KWVA 3UXPA 2DHZA 3HRDD 2M4NA 2W8KA 1AYFA 1XU4A 3GE8C 2KDBA 4KLJA 5D3DA 1F0ZA 7ICOA 1L0YB 2IGHA 2Z0DB 4LJPB 3AEAB 3MC1A 4YR3A 2ZCBA 4YXDB 4WWNA 2MA9B 4I2AA 3GFKB 2ZPNA 2JQRB 4OVZA 1GJZA 4M0WB 2QB1A 4K3BA 1DOIA 2NO4A 4WJOA 2GBMA 3MABA 3QX1A 4BXOA 3Q8KA 2LI5A 2C5LC 1T8EA 3HPOA 2LJIA 5DCNA 2JXTA 3VUXA 1KFTA 3C1ZA 4B0EA 3DBLI 4QZCA 1ZQVA 2WXFA 2F1IA 2ASLA 4KLHA 4B9UA 4KLSA 2NO5A 1SV4A 3TACB 1LB2B 3D2NA 2ACZB 3GU3A 2EAOA 3N7PD 3JSVA 3AE9B 1V1PB 1LKYA 3RH4A 1BPZA 2BYFA 2YMQA 2IHMA 3HKZC 2BS2B 2ZG6A 1SKRA 1YQBA 1KDHA 1ZQYA 3NASA 2AU0A 1U49A 4I28A 4IG7B 2WFAA 3HJEA 2IJ0A 5BOMA 5KFZA 5CX3A 1L7PA 1ZQRA 4KVGB 3ZRFA 3FILB 2J4XA 2J42A 5CB1A 1QLBB 3HVDA 5GTHU 1ZQPA 1UUPA 3JPPA 1NKEA 2WF7A 1MC8A 2ONQA 4AUQC 4M0WA 5J29A 2MBBB 1SGHA 1BNPA 3WCQA 3MR6A 4PHDA 1FIQA 2EZZA 1UHUA 4JUZA 2JEJA 4GXBA 1S3SG 5B5EU 5AK3A 1FNVA 4UB4A 3WKDA 1YN5A 3LVVA 2G1EA 2RDIA 3AE3B 2A19A 2V9WA 1Q8KA 9ICTA 5IO9A 1SBBB 3VUYA 2V3SA 1WZ0A 1NYQA 4OJLA 2AQ0A 4YFKA 2I1JA 2IO3B 4DQOC 1S0VA 1JUDA 2DPIA 4ED8A 1R4MB 3ZD8A 2KT7A 5J0UA 2NR2A 8ICHA 4Y2SA 4OVUA 1QTMA 4DL2A 8ICYA 3WAOA 2ZIVB 5J0YA 2IZVB 4IQWA 5AM2A 4X5VA 1U47A 2XN9C 5AKGA 2NVUI 3N32A 3T8MA 4II2B 2ZVOA 4K1RB 3AEGB 1NKCA 5HFYA 2VH2A 4GC7A 2BQQA 1E8ZA 4PGQA 1Z4NA 2HDEA 2KJ6A 4P16A 4L23A 3RPFC 3FILA 4YXMA 1ZRNA 3JW0X 5DGAA 1HUZA 2VIXA 5HI1A 4B9VA 4DL6A 4F2SA 2D11A 4REZA 4CE6A 1S0MA 1XCQL 2W82A 1JWUD 2QHOA 3EHVA 1N63A 3IT4B 4YG2A 1ZQGA 9ICSA 4ZDVA 1J2MA 1J97A 2JSVX 2NBUA 2D3AA 3AE4B 3DHHC 5KFMA 1Q3VA 2BKRB 1XS9D 3BK2A 3C8YA 3N30A 3TAPA 4EOYA 1S9FA 2QSDA 2HOQA 4DXGA 4BWJA 5G55A 4BOSC 2YB4A 2P6RA 5ALVA 1LQBA 2NRWA 3C28A 3TQ1A 3WK4A 3H4DA 1E7VA 2CR5A 1FCCC 2G9HD 2WAQF 2J6SA 2KK8A 3LB8C 2KV2A 2GBKA 2MX2A 1JW9D 4XQ8A 4R65A 4ZHOA 2ZIVA 2L0FA 2N7DA 1OQRA 4YQWA 5BYQA 8ICCA 2GBNA 3BQ1A 4J9LA 2PE9A 4RGMA 4M9GA 2KDFB 4Z6DA 1WXSA 4AS1A 1JWSD 2JWZA 1RQNA 4TUPA 1NNLA 3BZCA 3WKEA 4DSFA 2NRTA 1S97A 2YN4A 3BS5B 3PHXB 4NY8A 1QOFA 5EE1A 3AU6A 3L13A 4TQSA 1MQ2A 2W7OA 5JU5A 1KN5A 1PFDA 5CWRA 3Q8AA 4C56C 2EZXA 3ZDDA 1FXIA 3PSEB 4ARCA 5ALXA 9ICUA 3UMBA 1UF0A 3H4BA 5ALKA 3T5HA 4IC9A 4RMAA 1K8RB 3FM9A 2KP7A 3OPXA 2F76X 1ZQEA 2Y5BB 4ED0A 4FZMA 2KQ7A 3ZUNA 4I2FA 1P3QU 3FKYA 3QC8B 4FHJA 3OAWA 4AYBC 1TK8A 1KF6B 1UWXA 1SGGA 1VR9A 1G6JA 1NI3A 1BUIC 2PFOA 2D3DA 2YVCA 3C29A 2NBVB 4GXJA 4P4OA 4K7WA 3PZPA 2MSNA 2FMPA 3B0XA 3QU5A 4DQIA 2C9WB 1T7PA 2BPGA 2V0GA 5FR3A 4IR9A 1X9XA 3RJJA 3LJ3A 3H8WA 4O3MA 1YQ4B 3I28A 4WQMA 3VH3B 4KITB 5J0XA 3WKAA 4DHJD 2EELA 2QLTA 7ICJA 2E8MA 3Q8PB 1NK0A 2R8HA 2OEHA 2LM4A 1T4GA 1J7CA 3ENEA 3SD7A 1QOGA 5ALOA 2FE8A 3I57A 2XC9A 5KFQA 1TZOA 3U2SC 3BS5A 3QJZA 3ZI4A 1EU3A 2KD1A 4BUGA 2PIAA 4CDGA 3TCAA 4FZNA 4DWIA 4ANWA 3HWTA 4FO6A 1RYJA 2JX5A 3MR2A 1R4MI 2HJ8A 1NJWA 3SHQA 2HJ1A 1OQQA 4FS2A 5J2EA 5KFPA 5AIBA 2MUTB 1NK8A 1OTRB 2N9XA 2PJHA 1NJYA 4F91B 1L0VB 5ALHA 4KV2A 7ICSA 4BAXA 3F2CA 1B1ZA 2BS4B 4L2YA 5HR7A 4UB2A 3G6YA 2LZ6A 3PR4A 4IWQA 5EE9A 4XA5A 1H4RA 3AU2A 4ZH4A 1HEKA 3LXFA 4HDOA 5AI5A 8ICEA 2KZRA 3AXCA 3PTFC 2C2DA 1MPEA 4WJQA 1KKXA 2KVSA 2BYEA 1D9DA 5KFOA 4PYZA 1TKGA 8ICPA 3WAMA 2VANA 5KHQA 1A77A 1OGWA 4QIWC 3CIRB 4YVZA 1NI2A 2KLCA 1V5TA 2ASDA 3JPRA 5IIOA 4FULA 2DLBA 3F2DA 2UVWA 5KTQA 1VLBA 4AP4C 1BNOA 3BQ0A 4U7CA 1ZQQA 2XK5B 1JXEA 1ZW7A 3ZQ4A 4EZLA 3RJIA 4KLOA 3F53A 3TADC 1KBUA 3AMZA 2CHWA 5DPWA 4IR1A 3PSPA 2BWES 1SL1A 4R64A 3IAS1 2MUTA 1F5SA 3H0MB 2XY7A 1GAQB 2BB6A 4MGYE 3OTQA 2JEFA 4C4VB 4CF3A 4YTPB 3TKAA 2AH5A 3NVWA 4GOCA 2ZJ5A 5C5JA 4CRXA 3L10B 2KFJA 4QZIA 4PGYA 3W1YA 3A9JB 3ML9A 9ICIA 2MBOA 4I6PA 1H8CA 1KH0A 4HJGE 4YMMA 2HHTA 5IIKA 3GZFA 4K4GA 5KFNA 2ASQA 1D6EC 1VZ8A 1RQLA 3VR9B 2M9NA 2PMZF 4BZAA 4RPZA 5DQGA 3SFDB 1QT9A 4ACFA 1L7NA 2HE7A 3RNBC 3DBHB 2DYBA 4IC7B 3UI3A 1IGDA 2XK5A 1H38A 1TYGB 5DGBA 4ICAA 3C21A 4P4MA 2INCC 2AGQA 3ZGZA 1N6ZA 2HHQA 1DK2A 1QLNA 3IVFA 1T94A 5J2AA 1WWVA 3G6VA 2K6QA 2LWPA 4MSMB 1PVPA 2H89B 1EWCA 2KIWA 1U4AA 2WS3B 3ZO5B 2K60A 4A3PA 3MC8A 4UB5A 4TQ0A 5DDMA 2BT6A 5KHOA 3IM1A 3AL0B 2AQ4A 5ALLA 3GZNB 3WIMA 3MHZA 4QZHA 1QSYA 2QKQA 3KUDB 2MW5A 3A9JA 3JYUA 4UAVA 5DB7A 2MLBA 1JMSA 1V9PA 4RM8A 1A76A 1GO3F 2N1RA 1B22A 2Y0SF 1U48A 5D6JB 4ITKA 4P0PA 5HMLA 2H3VA 2XCPA 4A8XC 2W55A 2W9BB 1TVAA 1MA7A 2LVPA 3N20C 2R61A 3IHPC 4YR0A 1NYRA 2ON8A 1WRDB 2O6VB 4OJPA 2Z59B 2AQ2B 8ICRA 1FEZA 4MGIE 3PR5B 5E6NA 3GV5B 3QCAA 1XO1A 4XRHA 4PZOA 4GGQA 2A1JA 4OZCA 4DHZB 4TQRA 2XCAA 5L83A 2AHOB 1P7FA 3KH0A 5JHAA 3PLVA 5KG2A 2BDUA 4IS7A 4HCPB 3S2AA 3IG5A 4JV1A 3OWEB 1WG8A 1HEZE 3TEXA 5J0OA 4DFMA 4RGOS 4Q43A 3WAPA 4J9KA 3PX0A 2KYWA 2ODGA 2KQSA 4A20A 3PLUA 5FR6A 4Y2UA 3A0BU 2EAPA 5ALJA 2G3QB 4FJZA 3U52E 2KJRA 3DWMA 4YWGG 4O3RA 1SL2A 8ICZA 2FIFA 1YMHE 2H3IA 2YEPB 1DOQA 2W9BA 2BCSA 5JH5C 7ICGA 3M7DA 3R9KA 2K3UA 1SV0C 5JRTA 2YEPF 5J8YC 3SYZA 1FNUA 1QQ5A 2AGPA 2O6VA 1D5MC 2N9KA 3U30A 2IOFA 3OG5A 1D5XC 2LGYA 3V3XA 1WRIA 2BYTA 3TEYA 1ENFA 2L7RA 8ICMA 2K22A 2OEDA 2C7NB 3AU5A 3W1SA 1X9MA 1MJDA 1TKYA 4O1NA 5T14A 4HK2A 2INPE 3NRZA 4DCCA 2B76B 1N60A 2L05A 3JPSA 1NDDA 3DBHI 1PK1B 1QH9A 2G08A 2CN1A 4NJCA 2DBYA 4PHPA 2GO7A 1P7DA 4MFAA 2C28A 1Q5WB 2AQ1B 3UGBB 1GNUA 3S6JA 4B6WA 3J81j 1V1OA 4RQMA 1F52A 4UAWA 4O3QA 1JCKB 3BZDB 4WWOA 5KT4A 2FPMA 2JH1A 4KX6B 3GS2A 1IYFA 1GB1A 1ZQHA 1ZQCA 3ALBA 5E6PA 1SIFA 5AZFA 2WNMA 3UPQA 5KT7A 3GZNI 4CHKA 5KFFA 5LXHA 3H8SA 4EFOA 3B9JA 2JV3A 4AJYB 4ECQA 4MEYA 3PV8A 1UBIA 2ZJAA 1V2YA 2RHFA 4ACOA 3DQVA 3IAM1 4B0MA 8ICOA 4B95A 1ZD2P 4C7ZA 5CP2A 4RZRA 1WJNA 4KLTA 3V62A 1WCNA 1YN3A 2QCZA 2KHVA 5IIJA 3MGHA 1KL9A 4G11A 1PK1A 3VTUA 3IHQB 1R4NB 3ZXVA 4P2HA 2KTQA 4M02A 4Z6EA 1PGAA 2LYBA 4F4XA 3DV9A 2K9XA 4JWUC 2HBLA 4IM2A 1HZ6A 4OW0A 1B4FA 3IT6B 4WIPA 5CHFA 4UB3A 2KNBA 5E6OA 1HTOA 2PMVA 1ZETA 1FO4A 1ZQUA 3KZXA 3QZ7A 2VZKD 4RFBA 4LNFA 3A9KB 5F3XB 8ICLA 2REXA 1P0RA 5DG7A 2ZIXB 4OJ5A 3BIID 3LYSA 2LHDA 4ZOHC 4PHAA 2JF5A 2MBHA 1E7UA 4DF4A 1K53A 1LXDA 3PS6A 1K1SA 2E3TA 2FDRA 2PFQA 1NJZA 2KTFA 4M47A 3PSTA 3RB6A 4RU9A 4RQ3A 1X6IA 2KSOB 5F9NA 3IBEA 1J7BA 3VQIA 2RR9A 1KLUD 3QAQA 9ICAA 1S1QB 3PPAA 3ZNZB 2QB0A 3B2FA 2ISPA 2KJ8A 5KFRA 2JVCA 1HQRD 2WWZA 3J9CA 3L4PA 2AL6A 2IHNA 3EA6A 7ICLA 2KOXA 4I2GA 2DAFA 3TUOA 4ARIA 2BW2A 2KIVA 4DL7A 5D7GA 5L1KA 4MT5A 3PO0A 2W43A 1ZQLA 2FLPA 2WAQC 4OHJA 3VH4B 3LDAA 4MSQB 1C3TA 4UAUA 3RR8A 1KTKA 1EU4A 2V9HA 4ECRA 1D8LA 3KYCD 3Q2AC 4NL9A 3DVGY 5BO4B 4EE2A 1ZQOA 1IPGA 2G4SA 1L8OA 3Q8QB 1BXTA 3V61A 2MSED 3GV7B 4CYEA 2PPHA 4U6PA 1SKSA 1BT0A 4FN2A 3A9KA 4FXCA 2ZIXA 4TUUA 2P6UA 2RDGA 4NJ7A 3MJWA 1CJEA 2ZVNA 1DYQA 4Q8FA 1ZD4A 3TEWA 3RNEC 1SXEA 1VD2A 3ECIA 1QSSA 4F92B 1OW5A 1LM8B 5I4DA 1FNWA 3K9PB 3RR7A 5AI0A 4FHKA 4PHEA 2WTFA 9ICJA 4PS8A 3WANA 1Y8RC 2OJRA 3CWIA 1PZNA 4DSEA 2E8OA 4EYHB 2HVHA 4G3IA 4YMOA 3PRZA 2KKPA 4E71A 4OVVA 3Q8MA 1JRUA 2KWUB 4M8MA 1GOZA 4IUMB 1SXTA 4TKNA 3PY8A 8ICKA 4F4WA 2UU7A 3AH7A 2YLMA 4JWSC 9ICPA 4C8KA 4ED7A 2KC2A 1EWYC 2KXJA 3Q3OC 4CGZA 4X57B 1I4XA 1Q0WB 4RQ6A 1WCLA 2MWSB 5C23A 2KN7A 3MFIA 1BGXT 3L54A 2HSZA 2ZIWB 5ALEA 4UAZA 1R4NI 3PRMB 3C2MA 2V3NA 4JK1A 2YX8A 2I2YA 5HHIA 3PX6A 3DHGC 5LLIA 3ISDA 4EELA 2DKXA 2KOBA 4RQ2A 3MGIA 1WJUA 2E5SA 2PFPA 1L8LA 1WZ3A 4YD2A 1IUEA 2JYEA 2J53A 4LDTD 1WMHB 3C23A 2ZJDA 4XDDA 2K1FA 3AQEA 3QHTA 1RM6C 1KSPA 1Q3UA 2CPRA 3NY5A 4K81A 3CRXA 2Y3AA 4YSZB 3L3FX 4R63A 5J2CA 4O3SA 2L00B 1XT9B 2KICA 1CQVA 4NJ6A 3EW9A 4DLEA 3V6JA 3RJEA 4UBBA 4F5PA 4KIKA 2I38A 2HDOA 2FCSA 5F9LA 5KT6A 3NHEB 1WGHA 1YX5B 2P35A 4QZFA 2BCVA 3Q8EA 2NRZA 4DL5A 1QQRA 4EZJA 9ICRA 4F4KA 1FFUA 2KX0A 2MJEA 1JALA 1SEBD 3KWLA 3VUWA 2RDHA 2KWCA 2WX0A 2BDPA 4DDID 2Z7JA 4JGHB 5IKCM 1TT5B 4EBCA 4KN4A 4MF8A 2F3NA 2ZIWA 3I9V1 2W8LA 3QU2A 4IL6U 4RUAA 1Q1OA 1Y56A 3CSFA 3ORYA 2K5PA 1S10A 4QWAA 9ICHA 4NPNA 8ICNA 2WU5B 1WMHA 3N4MB 3NUQA 4KGTA 4R8UB 2OXOA 4W9JA 3HX0A 3RBEA 2IO2B 1J8CA 2IY0B 5D49A 2RLTA 5ALSA 5KG3A 4WWPA 4R66A 2AQ3B 3T3OA 2EDUA 1E8XA 2Y5PA 2K39A 3ZTDA 3GQCA 3GOEA 4ZRQA 4XUSA 5CA7A 4KX5A 4HCNB 3GIJA 3TFRA 3FDSA 5D94A 1ZQXA 3NG0A 3GV8B 2FIDA 1RXWA 3RB3A 1E90A 1MFWA 1X6JA 5EE0A 5KFBA 2QEJC 5L1JA 5L9XA 3N9YC 2QMTA 2HD5B 2WB1F 2BVCA 2FCNA 2I1QA 2R8GA 4KLDA 1RZTA 1ET9A 1MVKA 4GXKA 1D8YA 2ZIUB 5KFJA 4ECXA 4WH4A 2E8NA 4F93B 4QNLA 4H2AA 1V1PA 1FFVA 2F1HA 5AKZA 5AK5A 3CNHA 2MHJA 3BK1A 1V8CA 4TUSA 1WX9A 3OHBA 3HM3A 4QWCA 4MEXA 5J2GA 4KDIC 3ZNID 2D5GA 4KZ0A 2HHXA 4R8UA 1TK5A 4DL3A 2R2QA 4HXDA 4IW0A 4NLNA 4NWIA 1F2RC 1CUKA 3NS1A 2UWQA 4I2BA 8ICVA 5EWGA 3UQ2A 1JX4A 3UF8A 2G06A 1MI0A 2DNFA 3R2TA 3A4RA 5FK9C 4NAWB 2RDBC 1WR6E 3HIZA 2F2AB 3E58A 1C4AA 5IN7A 3PW7A 1NK4A 3FC4A 2ESEA 3T5KA 1OEYA 3SMVA 1ZQZA 2PXIA 4GFJA 4KMUA 1UH6A 4LNNA 3RRHA 2RD0A 2Y0SC 3VVWB 2IOHA 1NK7A 4Y2QA 4JL9A 2XO7A 1HUOA 4RQ7A 1V49A 2J7QB 4G0NB 3AE6B 2JR5A 1LVHA 5ALWA 2ZIUA 3EUB2 1FXAA 1WYWB 4ECZA 3K75D 3H40A 2J6UA 2A4ZA 5KL1B 4PK1A 3A1QB 5KG1A 5AKEA 2MEKA 1HTQA 3NVZA 3M9OB 4O5CA 3C1YA 2BQ3A 2KACA 2FBWB 1KTQA 2HTME 4TV3A 1X40A 1ZQSA 2R8JA 1C1YB 2IBIB 4W9FA 5DB9A 3RYTA 1WGYA 1CEZA 3SV4A 1ZJNA 2W9MA 4RNNA 3QA8A 5D46A 3ALRA 1SE4A 2PEAA 4J9SA 4DEZA 3EZ5A 4RGNA 5ALGA 2HHSA 1WSPA 4W9GA 2CJNA 3M3JA 2CHXA 4ANVA 2J52A 4NAWA 4MGZE 3ISBA 3PHWB 3B1LX 2KFZA 3Q14C 3AEVA 2WXLA 4D2KA 2D3GA 4FLHA 1YJ1A 2ZNVB 5ALZA 4CCHA 4RPYA 2C2EA 4FZLA 4Y2XA 3HP6A 4XZ4A 5KFGA 4RCOA 1QCKA 1V5OA 1AARA
chains in the Genus database with same CATH topology
1EWCA 1M4VA 3ZJUA 2WS3B 3SEBA 3BWUD 4TQ0A 1P7EA 2BT6A 2WP9B 5BMHA 3W2DA 2NTSA 3MHZA 1SIJA 3ETRA 1NEKB 1I4RA 3IXSA 3VRAB 1Q10A 3B2GA 1ZUD2 4N59A 4HROA 2QIEB 1ZXHA 1VRAB 2ZW0A 1IBXA 1WYGA 2WXGA 4LTUA 2IDYA 1YNTE 4ITKA 5JXVA 1ZPSA 1HZ5A 3MJ5A 2CU3A 2N9LA 4WURA 2X38A 4A8XC 2AX5A 2W55A 1SSNA 1A70A 3EGRA 2R61A 1NYRA 2MJ3A 2V4IB 2ON8A 4LLGM 4XE0A 2AQ2B 1SB3C 4OZCA 3NVVA 1K52A 1D5ZC 1P7FA 5G5GA 3TEZA 1JRPA 1D4BA 1KFYB 1ZDXA 1FD6A 3MC0B 3OWEB 1JWBD 1HEZE 3TEXA 2GB1A 4RGOS 3AE1B 1TY2A 3SFEB 3HVZA 2MH7A 1FM0D 1K50A 1ZE3D 1K51A 1XEEA 1ESFA 2BS3B 4IDIA 1FCLA 3U52E 2WXRA 3DWMA 4P6VF 2BBCA 4YWGG 4C80A 4HRSA 1OFFA 1YMHE 2YEPB 2ICIA 3Q8BA 1PUTA 3VRBB 1TKEA 1FRDA 2WDRB 4RNAA 3NUHB 4KKJA 1XXGA 1ZP0B 2K3UA 4TSSA 2YEPF 1FNUA 1QOAA 1YQ3B 1D5MC 2N9KA 2Y5CA 3P4RB 1R7SA 1L4ZB 2IPKD 2K0PA 1D5XC 1XLPA 3AE7B 2WQYB 1ROEA 1C77A 1WRIA 3V3XA 2BYTA 1CZPA 3TEYA 1ENFA 2K22A 3BVMA 2OEDA 1TS5A 3W1SA 1L4DB 2DYOA 1TKYA 1QKZA 4JE3B 1SF0A 4O1NA 4XDCA 1WXQA 2INPE 3NRZA 2B76B 2N0SB 2QJLA 1N60A 1E7PB 4JX1C 1C76A 2WXKA 5BMIA 2KWDA 4KGSA 1L6VA 2Z8LA 4MH8A 2WDVB 1DOYA 4NJCA 1I4PA 3GP7A 5D3IB 2DBYA 2PW9A 1ZDVA 2AQ1B 1JWMD 2SAKA 2JU6X 3AE5B 4UDUC 1V1OA 4IOIE 1GB4A 1JCKB 3BZDB 4OZBA 1I4HA 1UWMA 4KX6B 2RMMA 3GS2A 4J3OD 3NZ3A 1GB1A 1FEHA 1J7AA 1E6EB 1WGKA 4RF1A 2WNMA 3W5VB 4HKQA 3B9JA 2N7JA 4RF0A 4KGRA 3R8BA 3ABVB 1JMLA 4MACA 1TS2A 2WXOA 3P1MA 1FMAD 2EKIA 2KMMA 4WAFA 3IAM1 3DWGC 4B0MA 5GXGB 4LK0M 2LHEA 2IGDA 2L32A 5TSSA 4C7ZA 3KWVA 4YTNB 3U7ZA 3HRDD 3SR6A 1AYFA 4DXFA 5D3DA 1F0ZA 4ZYSA 1L0YB 1YN3A 1FRRA 4US8A 4YTMB 2IGHA 3MFGA 3AEAB 2JWUA 4YXDB 3H8HA 1VDVA 2JQRB 4OVZA 1DOIA 4GDLB 2K9XA 1PGAA 1STEA 2SEBD 4JWUC 4NZLB 2LJIA 2JXTA 2NTTA 1HZ6A 4OW0A 2W54A 3IT6B 4WIPA 4B0EA 5LNK1 3AM9A 3R2IA 4TMAB 2PMVA 2WXFA 2BTEA 1FO4A 3AE8B 2WXQA 3MP9A 1KLGD 2VZKD 1SE3A 4RFBA 3ZJTA 3BIID 1N5WA 2ACZB 2WXPA 5AUKA 2LHDA 4ZOHC 1RWSA 5BYRA 2INNE 1K53A 3AE9B 1V1PB 2LMCA 2E3TA 2BS2B 1ZXIA 1T3QA 3PZ8A 3GB1A 4WWMA 4GLSC 4TQ1A 3P4PB 5AUIA 1E9MA 1J7BA 3VQIA 1KLUD 4AQ7A 1XF5L 2IJ0A 2KDMA 3PZ7A 1E10A 3B2FA 1HQRD 3FILB 2J4XA 3J9CA 3L4PA 1C4CA 2J42A 1QLBB 3HVDA 3EA6A 5BMGA 5EE3A 5E6JA 1UUPA 3TUOA 4ARIA 2BW2A 2ONQA 1CK1A 1WWTA 4MT5A 3PO0A 4M0WA 5D7GA 4OHJA 2IGGA 2GI9A 3WCQA 1KTKA 1FIQA 1EU4A 1C78A 1XCTL 4CQNA 1FNVA 4EE2A 1YN5A 1DGJA 1ACCA 1BXTA 2FUG1 2G1EA 4OZAA 3AE3B 2WXNA 1SBBB 4FXCA 2JYTA 1NYQA 1N61A 4DQOC 3RFZB 3W5UB 2RDGA 1CJEA 2WXHA 1DYQA 2M19A 4IKGA 3ZYYX 2PVGC 3VR8B 3TEWA 5G5HA 3Q69A 1VJKA 4KKIA 3AN1A 1DOXA 5I4DA 2XN9C 5C2TB 1FNWA 1PGBA 4NAMA 3AEGB 5HFYA 4L23A 2HDEA 4P16A 2L83A 3RPFC 3FILA 4HEA1 3AEEB 2KAJA 1BMLC 5HI1A 2Q5WD 3CWIA 4REZA 2V3PA 1XCQL 2W82A 1JWUD 1QF6A 1N63A 1GOZA 3IT4B 3AE2B 1SXTA 4Q2JA 2LFIA 2JSVX 2PLPA 3AH7A 3NVYA 1TS3A 2LGIA 3AE4B 3BK2A 4JWSC 3C8YA 3AV8A 1JROA 1EWYC 2QSDA 2WXMA 4DXGA 3LYYA 3KQ4A 1N62A 1I4XA 3ZJVA 1XLQA 2H88B 1JQ4A 2RPVA 1FCCC 1XLOA 2G9HD 2V3NA 1YJIA 2I2YA 3BYTB 2LEKA 3LB8C 1EM7A 1JW9D 4ZHOA 1PYWD 4YSXB 3AEFB 1C9FA 1TS4A 1IUEA 1T5XD 2JYEA 1OQRA 2J53A 5BYQA 4A9AA 3O13A 4XDDA 1YN4A 4RGMA 1ET6A 1AW7A 1GPXA 1RM6C 1PGXA 4AS1A 4MM3B 1JWSD 2WXJA 4C7YA 5HHDG 2Y3AA 4YSZB 4HKZE 1QOFA 5EE1A 5T8IA 1UNSA 1CQVA 3P4SB 1PFDA 2I38A 1F77A 1NENB 3Q8AA 4RH6A 4C56C 1FXIA 4ARCA 4ZRPA 2E6XA 3URYA 2PKOA 1N5XA 1QOBA 3FAHA 1T6BX 3Q8EA 1QQRA 2NMQA 2WXIA 1YJJA 1B9RA 1FFUA 1ZOYB 3AEBB 2MJEA 1JALA 1SEBD 2PVOD 3KWLA 2RDHA 4A90A 1VR9A 1KF6B 1UWXA 2W3SA 1BUIC 1NI3A 2PTLA 3Q8CA 1SE2A 4A6QA 3I9V1 2TSSA 4R3DA 3W9CB 1AN8A 5FKAC 2WDQB 1Y56A 2V0GA 3BVZA 2K5PA 5FR3A 1E0ZA 1YQ4B 4WQMA 1XO3A 2WU5B 2M56B 4KGTA 2WLBA 2EELA 4A55A 1L5PA 2VZKB 1J7CA 1HA5A 1QOGA 2FE8A 3BVGA 2BB5A 3I57A 4L1BA 4RGTA 1TZOA 2ZW1A 3P42A 3U2SC 1EU3A 3P63A 2PIAA 2AQ3B 3T3OA 4YT0B 1UGJA 1RYJA 5C3JB 2JX5A 2Y5PA 4GDKB 1OQQA 4ZRQA 2WU2B 4JPSA 5EE0A 1L0VB 2M0AA 2QEJC 4PT5A 3N9YC 2QMTA 2L52A 1B1ZA 2BS4B 1ET9A 2QILA 4L2YA 1MVKA 3P4QB 1MHHE 5H8YE 4WH4A 5EE9A 1RFKA 1I4GA 1VZ7A 4H2AA 1V1PA 1FFVA 4US9A 3U4EG 2GRIA 3AEDB 3BK1A 3LXFA 1V8CA 1MPEA 2KN4A 1KRHA 1TKGA 3BYYB 2D5GA 1PDXA 1C4PA 1LO5D 3CIRB 1L0XB 1F2RC 1L6UA 2KQ4X 3NS1A 1TY0A 4XWTA 2DLBA 1MI0A 3R2TA 1VLBA 5FK9C 4NAWB 4ZHPA 1C4AA 4N58A 3ZQ4A 2XNAC 1SJHD 3FC4A 1V97A 3AMZA 4YSYB 3IAS1 3KLSX 1GAQB 2DYMA 2BB6A 5MPOA 3AECB 4YTPB 3AE6B 3T3NA 2LUMA 3NVWA 3EUB2 1FXAA 1XLNA 3Q8FA 3AB5A 1JWAD 1MHXA 2JZPA 1SJED 1HXYD 2MEKA 3NVZA 3E56A 2L1AA 1IBXB 1KH0A 2KACA 4HJGE 2FBWB 3V05A 2HTME 1F2RI 1I4QA 1I7HA 1VZ6A 2W3RA 4USAA 1D6EC 1VZ8A 3VR9B 1IGCA 1SE4A 1NVID 3E9SA 4RGNA 2MJDA 5HG2A 3SFDB 1QILA 1QT9A 1WSPA 4XWWA 2CJNA 2CJOA 1C79A 3UI3A 2J52A 1IGDA 3TSSA 1AWDA 3HUIA 1TYGB 2WXLA 4D2KA 3ZGZA 5BYSA 5H92C 1TJEA 2DWQA 4N6EB 2OHFA 4RCOA 2H89B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5U B;  3AE5 B;  3P63 A;  1CJE A;  2PIA A;  2M19 A;  2WS3 B;  3ZYY X;  2PVG C;  4YT0 B;  3VR8 B;  5G5H A;  2BT6 A;  1RYJ A;  1VJK A;  5C3J B;  2JX5 A;  2WP9 B;  1UWM A;  4KX6 B;  3AN1 A;  1OQQ A;  1J7A A;  1E6E B;  1SIJ A;  3ETR A;  1WGK A;  1DOX A;  1NEK B;  2WU2 B;  5C2T B;  3VRA B;  3B2G A;  1ZUD 2;  3AEG B;  4HRO A;  4N59 A;  3W5V B;  1E0Z A;  2QIE B;  5EE0 A;  1L0V B;  3RPF C;  2L83 A;  3B9J A;  1WYG A;  4LTU A;  3ABV B;  3AEE B;  2L52 A;  2BS4 B;  2KAJ A;  4ITK A;  2Q5W D;  3CWI A;  3P1M A;  1FMA D;  2EKI A;  3P4Q B;  2KMM A;  2CU3 A;  5H8Y E;  3DWG C;  5GXG B;  1QF6 A;  2AX5 A;  5EE9 A;  2W55 A;  1N63 A;  1RFK A;  1A70 A;  3AE2 B;  1FFV A;  4C7Z A;  4US9 A;  4YTN B;  1NYR A;  3HRD D;  2MJ3 A;  3AED B;  3SR6 A;  3AH7 A;  3NVY A;  1AYF A;  3AE4 B;  3LXF A;  4JWS C;  1F0Z A;  1V8C A;  1FRR A;  3AV8 A;  1JRO A;  4US8 A;  1EWY C;  4YTM B;  1SB3 C;  1KRH A;  1TKG A;  1N62 A;  3AEA B;  4YXD B;  1PDX A;  1VDV A;  1XLQ A;  2JQR B;  3CIR B;  1DOI A;  2H88 B;  1JQ4 A;  1L6U A;  3NVV A;  3NS1 A;  2K9X A;  4JWU C;  1XLO A;  5G5G A;  1YJI A;  1JRP A;  2LEK A;  1VLB A;  2W54 A;  1KFY B;  3LB8 C;  1JW9 D;  4ZHO A;  4ZHP A;  3AM9 A;  4N58 A;  4YSX B;  3AEF B;  1IUE A;  1FO4 A;  4A9A A;  3FC4 A;  1OQR A;  3AE8 B;  1JWB D;  1V97 A;  3AMZ A;  1GPX A;  4YSY B;  3AE1 B;  1N5W A;  1RM6 C;  2ACZ B;  3BII D;  3HVZ A;  5AUK A;  3SFE B;  2MH7 A;  1FM0 D;  1GAQ B;  4ZOH C;  4C7Y A;  1RWS A;  4YSZ B;  5MPO A;  3AE9 B;  1QOF A;  3AEC B;  5EE1 A;  2E3T A;  4YTP B;  2BS3 B;  3P4S B;  3AE6 B;  2BS2 B;  4IDI A;  1ZXI A;  1T3Q A;  3NVW A;  3DWM A;  1PFD A;  4P6V F;  1NEN B;  3EUB 2;  1FXA A;  4C80 A;  1XLN A;  4HRS A;  4WWM A;  1FXI A;  3AB5 A;  1JWA D;  1OFF A;  1E9M A;  3P4P B;  1J7B A;  5AUI A;  2PKO A;  1N5X A;  1PUT A;  3VRB B;  1QOB A;  3FAH A;  1TKE A;  1FRD A;  2WDR B;  1ZP0 B;  1B9R A;  1YJJ A;  3B2F A;  1E10 A;  3NVZ A;  1FFU A;  1ZOY B;  3AEB B;  3L4P A;  1QOA A;  1YQ3 B;  2FBW B;  1JAL A;  1QLB B;  2HTM E;  2MJE A;  2PVO D;  2Y5C A;  3KWL A;  3P4R B;  1R7S A;  5EE3 A;  1I7H A;  1KF6 B;  1XLP A;  2W3R A;  4USA A;  3AE7 B;  2W3S A;  1NI3 A;  2WQY B;  1ROE A;  1WRI A;  1WWT A;  1CZP A;  3PO0 A;  3VR9 B;  2K22 A;  1NVI D;  2MJD A;  3SFD B;  1QT9 A;  3WCQ A;  2CJN A;  1TKY A;  1FIQ A;  2CJO A;  3W9C B;  1SF0 A;  2WDQ B;  1WXQ A;  2N0S B;  3NRZ A;  2B76 B;  2QJL A;  2K5P A;  1N60 A;  1DGJ A;  1AWD A;  1E7P B;  1TYG B;  2G1E A;  3HUI A;  1YQ4 B;  4JX1 C;  4WQM A;  1XO3 A;  3AE3 B;  2WU5 B;  1L6V A;  2M56 B;  2WDV B;  2WLB A;  1DOY A;  1L5P A;  4FXC A;  2DBY A;  1J7C A;  1NYQ A;  1TJE A;  5H92 C;  2DWQ A;  1N61 A;  4N6E B;  2OHF A;  1QOG A;  2H89 B; 
#chains in the Genus database with same CATH topology
 4Q45 A;  1EUV B;  1UBQ A;  3ZJU A;  4AP9 A;  3QU9 A;  2BQR A;  3RZF A;  3SEB A;  4PL1 A;  5IOI A;  1P7E A;  4MF2 A;  4ASW C;  1RXV A;  5BMH A;  2HOF A;  2KVC A;  1I42 A;  3PSI A;  3UXN A;  2DL0 A;  4JB3 A;  4QZ8 A;  2NTS A;  3W2D A;  3ETR A;  2N9E B;  2Z0E B;  2JPH A;  1I4R A;  3A1Q A;  4ECS A;  3AUL A;  3IXS A;  1XC9 A;  4FAD A;  3ZDT A;  2O2V B;  5AKJ A;  1ZOL A;  1ZXH A;  2MBQ A;  3M8R A;  1D3Z A;  2FE9 A;  1WYG A;  2KZ3 A;  4DSJ A;  2JGA A;  3EWA A;  2HBK A;  3QAR A;  1QZE A;  4YMN A;  3Q3F A;  5JXV A;  9ICE A;  4F5Q A;  1ZPS A;  5J2H A;  4BBN F;  2CU3 A;  2VA8 A;  1NK6 A;  2VRR B;  3SQI A;  3H9D A;  1Z2M A;  3ZDM C;  2LYA A;  2B3A A;  3QZ8 A;  5DBC A;  5KFC A;  2V4I B;  3RMK C;  5DDY A;  3UMC A;  4ECV A;  2FNJ B;  7ICR A;  3V7J A;  1WH3 A;  3OHA A;  2MCN B;  1BPE A;  1Z19 A;  4ICV A;  3OJU A;  1ZQA A;  4BKS A;  1X66 A;  3NVV A;  3HK0 A;  1RG6 A;  3RUL A;  2JH7 A;  4IM0 A;  3WK6 A;  1D5Z C;  5G5G A;  3V7K A;  1WXM A;  2FCM A;  2W9N A;  3R3M A;  5KFV A;  1D4B A;  2DUY A;  1FD6 A;  4ZRK A;  5H2F U;  1WX7 A;  4KLE A;  5IIM A;  1TAU A;  2Q4T A;  4JV2 A;  2GB1 A;  3PT2 B;  3UMG A;  4F4Z A;  3ZDB A;  1TY2 A;  3HVZ A;  5ALT A;  1WE6 A;  3SFE B;  3BQ7 A;  1P98 A;  2O2V A;  3RD2 A;  3CST A;  5AM3 A;  3KKA A;  5GTI U;  4W9K A;  1YZ6 A;  4F5N A;  3H7P B;  3PV1 A;  3UIP B;  1FCL A;  2L0T A;  2G09 A;  1Z1V A;  5DQH A;  3VRB B;  5KG0 A;  7ICN A;  1TKE A;  2BCU A;  4W9D A;  2Y1I A;  4YCX A;  3DOW A;  4NLG A;  1XXG A;  4KKJ A;  2NPT B;  2KO3 A;  1EXN A;  3MBY A;  2ASJ A;  4B9S A;  4Y2V A;  5DLF A;  4ICU A;  1R7S A;  2IPK D;  2K0P A;  2N1W A;  2KN5 A;  4RQ5 A;  3IDW A;  2WQY B;  2DGZ A;  4RT3 A;  1ROE A;  4DFK A;  2IO0 B;  3TAN A;  1NJX A;  5ALQ A;  3MFH A;  2QDF A;  5HP4 A;  3DVG X;  3H0R B;  4KLM A;  3BVM A;  4S0R A;  3PZD A;  1CMX B;  3UQA A;  4JE3 B;  5J0T A;  4JLC A;  1SF0 A;  4N9F 4;  2N1V A;  1WXQ A;  2J0M A;  2QJL A;  1E7P B;  4OJ6 A;  4JX1 C;  2WXK A;  5BMI A;  2GH1 A;  4WAA A;  4DS4 A;  3TFS A;  5D3I B;  4DDG D;  2PW9 A;  3HKZ F;  3X23 A;  5J2B A;  1L6N A;  3K4G A;  5BPC A;  1ZQ1 C;  1HJP A;  3ZKJ C;  1JWM D;  3I5J C;  3DDH A;  3H7P A;  1GC6 A;  3QIJ A;  3ZD9 A;  4QWE A;  1XO0 A;  2C7M B;  2QAR B;  4PL2 A;  1FEH A;  3N28 A;  4MDK E;  5J2D A;  7ICP A;  8ICS A;  4FBJ B;  3BY4 B;  4M01 A;  4PH5 A;  4I29 A;  9ICK A;  3PGE A;  4BKT A;  4HKQ A;  2RQ5 A;  3BQT A;  3IG3 A;  3PRE A;  2NPT A;  3I1Y A;  3EFU A;  4DOB A;  3C2L A;  4BWM A;  8ICG A;  3SU8 X;  1FMA D;  2BKF A;  5CHV C;  2KMM A;  3ISC A;  4LK0 M;  2E1E A;  2YMM A;  5AKL A;  2UVV A;  3WU2 U;  2JEI A;  5TSS A;  4F5O A;  1L3U A;  4C4V A;  2KJH B;  4YTN B;  3DHI C;  4P0Q B;  3SR6 A;  4P4P A;  4DXF A;  2W04 A;  4FJY A;  5AIC A;  2N4F A;  3MFG A;  3B08 A;  1D8B A;  2JWU A;  2VJ5 A;  5AI4 A;  1VDV A;  2K6D B;  1S5L U;  7ICQ A;  3RB0 A;  1STE A;  4J9M A;  4K7S A;  3V60 A;  2SEB D;  2BYV E;  4NZL B;  1V80 A;  2ZXI A;  4EBD A;  2W54 A;  3Q3J A;  3JPO A;  4ECY A;  3F5A A;  4I6N B;  5LNK 1;  3R2I A;  4KSK C;  4F4Y A;  2YB1 A;  2QAR A;  2WXQ A;  1KLG D;  1WXA A;  3CMM B;  3TL5 A;  2WHI A;  1TTN A;  1N5W A;  2WXP A;  1QQ6 A;  3N3K B;  5AUK A;  3KD3 A;  3V6C B;  1RWS A;  5BYR A;  2KAN A;  2INN E;  2XY5 A;  3QE9 Y;  1KFS A;  7ICM A;  4MJS B;  1ARO P;  1QQ7 A;  2IO1 B;  1T3Q A;  2KDI A;  4YL8 A;  3ICX A;  4B9M A;  3GB1 A;  3PZ8 A;  3I76 A;  4OO1 J;  1ED1 A;  3P4P B;  2FUH B;  1E9M A;  5AUI A;  1YX6 B;  2KHW B;  2LM1 A;  4YN4 A;  3LWL A;  3BZK A;  2N7E A;  3BJY A;  4EEN A;  3MDC A;  5TZV A;  4P0Q A;  4JWN A;  1MG8 A;  3C2K A;  3KUC B;  1IM4 A;  4PPX A;  1E10 A;  4LCD E;  1SWV A;  1C4C A;  2LBO A;  4M2Y A;  8ICX A;  5BMG A;  4B6J A;  4DQS A;  4LZD A;  2XGQ A;  1WWT A;  2V4L A;  2MAX A;  5FP0 A;  3JVZ X;  3U26 A;  5JHB A;  2IGG A;  4PS3 A;  1XSN A;  4B9K A;  4MFF A;  2HBJ A;  2HOI A;  4DQP A;  1XCT L;  2KKC A;  1DGJ A;  4C8M A;  3V6K A;  1ZJM A;  2RRD A;  2YTU A;  4NXZ A;  4B9T A;  5J2R A;  5KFL A;  2DX5 B;  2BWF A;  1N61 A;  1YIW A;  2EMS A;  4PS7 A;  1M94 A;  2I9G A;  5C1Z A;  2WXH A;  1F1H A;  2M19 A;  4IKG A;  1TZ1 A;  3NS8 A;  4MJS A;  2Y9T A;  5J18 A;  5AKY A;  3Q69 A;  1E8W A;  3V72 A;  1BPX A;  3RH6 A;  3L5K A;  4NLB A;  4KKI A;  4K4H A;  2AL3 A;  2HCF A;  4FJV B;  5C2T B;  3KBB A;  1PGB A;  4AYB F;  4IM3 A;  4NAM A;  4ED3 A;  1WUD A;  3QUB A;  3ZDE A;  2BGW A;  2L83 A;  3RJK A;  4NLC A;  1RPL A;  4B9L A;  3AEE B;  1L5U A;  2KAJ A;  4KLI A;  1BML C;  1F0M A;  2Q5W D;  4XX5 A;  2NRX A;  2OOB B;  5J17 A;  2NYV A;  1QF6 A;  2FLL A;  7ICE A;  2VJ4 A;  3AE2 B;  4Q2J A;  2PLP A;  9ICL A;  1HIW A;  1TS3 A;  1TIF A;  4IRC A;  5J0S A;  3SZ2 A;  1L3T A;  4IQU A;  3LYY A;  3VTV A;  3KQ4 A;  1N62 A;  5IAA C;  4ZRJ A;  2ZCC A;  5CHW A;  3ZJV A;  8ICB A;  2IBK A;  1XLQ A;  5DPT A;  2WHE A;  3QU4 A;  2H88 B;  1JQ4 A;  1ZD5 A;  1BPD A;  3JPT A;  2VA3 A;  1M6Y A;  3HM6 X;  1XLO A;  3BYT B;  2Y9U A;  1J2N A;  4IQV A;  4IRK A;  3SD5 A;  3U7D A;  3SAG A;  1C9F A;  1JXL A;  2B0C A;  1T5X D;  4A9A A;  2GMI C;  3MR5 A;  3O13 A;  3VFK A;  1J19 A;  4UW9 A;  1GPX A;  4W9E A;  2DAJ A;  4J9R A;  3Q3M C;  4MM3 B;  4F8C B;  1MSW D;  4UAY A;  5HHD G;  3H0L B;  3UIN B;  2L76 A;  5CTR C;  2KMC A;  4OD0 A;  5AKH A;  2OM6 A;  1MN8 A;  3APC A;  4NM2 A;  4RH6 A;  3KVF B;  4HPP A;  4ZRP A;  4HPL B;  2E6X A;  3ZLZ A;  3URY A;  3M6K A;  2R8I A;  5ALR A;  1QOB A;  5K4L A;  3QWZ B;  1T6B X;  3H1U A;  1B9R A;  1N2X A;  1YJJ A;  4UQG A;  4ECU A;  2PI4 A;  3AEB B;  4PJ0 U;  4HJK A;  2B21 A;  1WY8 A;  2V1Y A;  2KLG A;  3OSN A;  2PTL A;  4EBE A;  2KNJ A;  4F50 A;  5DLG A;  5DB8 A;  2K4H A;  2BQU A;  4ECW A;  3Q8C A;  2EAM A;  4CF4 A;  1SE2 A;  1LFD A;  4QJF B;  2OWO A;  2ZTE A;  3ONS A;  2UVU A;  4Z6F A;  2TSS A;  2F8L A;  3HIL A;  4R3D A;  2HI0 A;  3QK0 A;  1AN8 A;  3N97 B;  5FKA C;  3UM9 A;  1PK3 A;  2O6V D;  3KHR A;  1KLN A;  1E0Z A;  3PX4 A;  8ICA A;  4DS5 A;  5AHX A;  3NOB A;  2IY1 B;  5J2K A;  1NBF C;  1P1A A;  4A55 A;  4KLG A;  1L5P A;  2AYO B;  2ZJ8 A;  4NLK A;  3BVG A;  2YML A;  3MHS D;  4RGT A;  3KOO A;  3L08 A;  3P42 A;  5KAF U;  4NNJ B;  5ALY A;  3H8M A;  2JZ3 B;  2R18 A;  4EYI B;  2GWS A;  3H8J A;  5C3J B;  1VJ5 A;  2D07 B;  3JPN A;  4UAT A;  1OUQ A;  2M0N A;  1PVR A;  3PW4 A;  3LDZ E;  1F44 A;  2JXX A;  2JUO A;  5KL8 B;  7ICK A;  4PT5 A;  4IRD A;  3TAR A;  3OJ4 B;  9ICG A;  1L7M A;  3FYH A;  1S76 D;  2QIL A;  3VHT C;  5KG6 A;  1NK9 A;  1E8Y A;  2G45 B;  3P4Q B;  2LD9 A;  1EF1 A;  1MHH E;  3TAD A;  1ISN A;  4KN7 A;  5H8Y E;  3TMP B;  1KOT A;  2ES6 A;  3A4S C;  5KFY A;  2G5I B;  1RFK A;  4DOC A;  2FAZ A;  4EZ9 A;  4AOF A;  3T5J A;  4US9 A;  4GB9 A;  3TAQ A;  5TIS U;  3AED B;  2XVT A;  2LPE A;  3DVN U;  2O6K A;  2L5Y A;  4LJO B;  4M0A A;  3LK9 A;  2KN4 A;  3DBR I;  4W9L A;  2KSO A;  1S77 D;  3TIX A;  1PDX A;  1C4P A;  1LO5 D;  4ANX A;  1GUA B;  4M04 A;  4HYK A;  3T5L A;  2F8K A;  4S17 A;  3U8Z A;  2OYY A;  5KT2 A;  2J0J A;  4Y2T A;  3KW5 B;  2HTH A;  3QQ8 B;  3WAL A;  3IP4 B;  4TUR A;  4P1B C;  3EPI A;  1NZP A;  4KLQ A;  2LRW A;  4ZHP A;  5CEH A;  4PGX A;  2KX3 A;  5L95 C;  4MEM A;  1E5W A;  1SJH D;  5DB6 A;  2XNA C;  3QYP A;  2J6T A;  1KLV A;  4GIB A;  1V97 A;  1UA1 A;  3PW2 A;  4GC6 A;  4YSY B;  4UB1 A;  2ZUB A;  2DYM A;  2JHD A;  2EAN A;  4RUC A;  4GN1 A;  3RNG C;  3L0W B;  3DDC B;  3RNC C;  3AU4 A;  2LUM A;  5AI8 A;  1XLN A;  2WF9 A;  4QZ9 A;  1UA0 A;  5HR6 A;  3NRW A;  2EH9 A;  2WF8 A;  2JZP A;  3PRP B;  1SJE D;  4UAS A;  1HXY D;  4B9N A;  3CYM A;  2WYQ A;  1Y88 A;  2Q0Z X;  3E56 A;  4DO9 A;  5KFS A;  2L1A A;  1IBX B;  3M9M B;  3V05 A;  4OJO A;  2B6G A;  3RJF A;  1I7H A;  2MU2 A;  1VZ6 A;  2W3R A;  4USA A;  5KFU A;  4YP3 A;  2R2O A;  1TKD A;  1IGC A;  3E9S A;  3L17 A;  5ALD A;  2MJD A;  5HG2 A;  4TUQ A;  4QZE A;  1RLF A;  4ELT A;  1C79 A;  9ICO A;  2KHQ A;  1AWD A;  4K3C A;  1XSP A;  3E0F A;  4J9O A;  1V81 A;  2KWV B;  3M95 A;  4JV0 A;  4MH0 E;  1U45 A;  4DSI A;  3HHM A;  5BYS A;  1EF5 A;  2IOF K;  2DWQ A;  2OHF A;  4BJQ A;  2AEH A;  4QAY A;  1RYS A;  2DPJ A;  4C00 A;  1NZB A;  3BWU D;  4KX3 A;  1XNS A;  2JEG A;  2ATL A;  4F8R A;  1KRP A;  2QC8 A;  5E79 U;  2KG5 A;  4ED6 A;  1SL0 A;  3AQF A;  3VRA B;  1Q10 A;  2EKE C;  4N59 A;  2M8S A;  4NY0 A;  2QIE B;  3C19 A;  5DQI A;  4RQ0 A;  5L1I A;  5C0Y A;  4ED2 A;  5KG5 A;  3GIL A;  1VRA B;  1WM2 A;  2ZW0 A;  2KTR B;  2AJQ A;  1IBX A;  4LTU A;  4LZG A;  1YNT E;  8ICQ A;  1OQY A;  2NBW B;  2ZTD A;  1SXD A;  1KJT A;  4DQQ A;  3MJ5 A;  3MR3 A;  5D2M B;  3RAX A;  7ICH A;  5KT3 A;  2K4E A;  3V6H A;  4F3O A;  1GG3 A;  3N1Z C;  4WUR A;  2WF6 A;  2GBJ A;  2M1M A;  3QXG A;  3EFC A;  1OXJ A;  2HMX A;  4M8N A;  2KFN A;  4I6L B;  1AQ6 A;  2MJ3 A;  4F2R A;  2PE6 B;  3I3T B;  3T3F A;  3RT3 B;  2BGF A;  5LXI B;  9ICC A;  3RFA A;  4NQL B;  5DKW A;  4I2H A;  5AM5 A;  1O03 A;  2C22 A;  2LAS A;  4DHJ B;  4BGD A;  2AXT U;  1SE9 A;  4F71 A;  1C20 A;  4I27 A;  2NRV A;  3UQB A;  2KZM A;  1YZ7 A;  4QWB A;  1SV0 A;  3QUT A;  3TEZ A;  1KFY B;  5J8Y A;  5AM0 A;  5EDS A;  1V85 A;  1X42 A;  1ZDX A;  2PMZ C;  3N1X C;  5DG9 A;  4F1S A;  2V4R A;  3DEE A;  3MC0 B;  5IP4 D;  4RM9 A;  4DBG A;  1JWB D;  3ZIM A;  4E74 A;  2MRP A;  3WKB A;  2PFN A;  1ZRM A;  2MH7 A;  3KYD D;  1O08 A;  2JY6 A;  3KHH A;  4BVU C;  1J0G A;  3Q8R B;  3H6N A;  2KTR A;  3G6X A;  1XEE A;  1X9W A;  1ESF A;  4DSL A;  1DGS A;  2G5H B;  3OLM D;  2WXR A;  2BPS A;  4C80 A;  4IWO A;  1N48 A;  4EX7 A;  2CRX A;  5KNI A;  2ICI A;  3Q8B A;  2G0A A;  4J9P A;  4DFD A;  3APD A;  2YQE A;  3NUH B;  5IIL A;  3WK5 A;  4TSS A;  3QX7 A;  2K8H A;  3NGD A;  4PYU A;  4ED1 A;  1U4B A;  2E1F A;  1YQ3 B;  2Y5C A;  3P4R B;  5EWE A;  2KDE B;  2XID A;  5KFI A;  3C5F A;  1KEJ A;  1MG4 A;  3EEC A;  3TJP A;  1TS5 A;  1A5R A;  1WJ6 A;  1L4D B;  2C60 A;  2DYO A;  4XDC A;  4KMO B;  2N0S B;  2W7P A;  4DWF A;  4LNO A;  2D8C A;  2DZI A;  1C76 A;  2OCE A;  2KWD A;  1XWL A;  1L6V A;  4MH8 A;  4ZRI A;  1DOY A;  3CF6 E;  1TGZ B;  5KT5 A;  1HE8 A;  1RYU A;  3GP7 A;  5J2F A;  3IG8 A;  2D6F C;  3MTN B;  5KFE A;  2MA1 A;  4QZG A;  2V4Q A;  3ML8 A;  4KSL C;  1JI7 A;  2G07 A;  3AE5 B;  3AUO A;  1NKB A;  3BDP A;  2DQN B;  3VAW A;  1T0Y A;  1BPB A;  4OCZ A;  1PQS A;  4MFC A;  1UWM A;  3RAQ A;  5IIN A;  9ICN A;  4J3O D;  4O0I A;  2FCQ A;  4EKU A;  2MBE A;  1E6E B;  2K8C B;  3RJH A;  5HMM A;  2JRZ A;  1RRB A;  2D3C A;  3RNA C;  3IV6 A;  4P1C C;  3W1S C;  4FE3 A;  3DCG A;  5DPR A;  2FJ6 A;  2N7J A;  4KGR A;  4HPM B;  3R8B A;  3ABV B;  1JML A;  4MAC A;  4O5K A;  5AZG A;  2F77 X;  3RRG A;  3P1M A;  3OGU A;  3KHL A;  4YD1 A;  1X1M A;  4A3O A;  3RBD A;  3DWG C;  5GXG B;  3PW0 A;  5HHH A;  1L3S A;  1MQ3 A;  5J2J A;  2CU1 A;  3U7Z A;  5JUM A;  1BPY A;  4GSW A;  2OJW A;  4M00 A;  4RPX A;  4NJ8 A;  1YD8 U;  4ZYS A;  3EPG A;  1TV9 A;  1FRR A;  1UQV A;  2W11 A;  4US8 A;  3SV3 A;  1Z1B A;  4YTM B;  5AK4 A;  2BR0 A;  2BCR A;  1ZYQ A;  5AKI A;  3H8H A;  2IYD B;  3RF9 A;  1ZQB A;  4GDL B;  5KFH A;  4KZC A;  4I2D A;  2W9A A;  2WGS A;  4W9H A;  2NTT A;  1VCB A;  1NK5 A;  1RFA A;  2L3Z A;  3AM9 A;  3B0Y A;  4TMA B;  2BTE A;  5AKX A;  3ZNH B;  1WXV A;  3AE8 B;  4DL4 A;  3ZJT A;  3MP9 A;  2H3F A;  4HAI A;  1SE3 A;  2K8C A;  4NLZ A;  3Q8S B;  3NZU A;  1NOM A;  5HKH A;  2K8A A;  4O9M A;  3H7I A;  8ICU A;  2DKZ A;  2LMC A;  4LVS A;  3ZVV A;  2GOL A;  3BIN A;  3NTU A;  1ZXI A;  3ETL A;  4K4I A;  3PNC A;  4GLX A;  1RYR A;  4FBU A;  4GLS C;  1WGG A;  4TQ1 A;  4WWM A;  2JT4 B;  3VXW A;  2L8J A;  3NJT A;  3WA0 A;  2CXY A;  4GU2 A;  3SAF A;  1S0N A;  4AQ7 A;  3UQ0 A;  1XF5 L;  2KDM A;  3PZ7 A;  3CW2 C;  1ZQN A;  1UZX B;  2F44 A;  2ZXH A;  4EEW A;  4CO7 A;  5EE3 A;  4M9H A;  3V7L A;  5E6J A;  3M9N B;  1CK1 A;  3K1Z A;  4G9B A;  2A1A A;  4GDL A;  1V38 A;  4K7U A;  1IIP A;  2GI9 A;  7ICU A;  4GMV A;  2BKE A;  4AWJ A;  1IG6 A;  7ICV A;  2LGS A;  1C78 A;  3NZS A;  4CQN A;  5L1M A;  2BPF A;  4KLU A;  1ACC A;  2FUG 1;  3Q8L A;  4OZA A;  4EZK A;  1KFD A;  2WXN A;  5KAI U;  4I2E A;  4JIO U;  2AGO A;  2H5X A;  2YMP A;  2JYT A;  1DK3 A;  4LJX A;  4UAR A;  3RFZ B;  2Y1J A;  1JN3 A;  2HHV A;  2M0X A;  2NV3 A;  3W5U B;  1SWW A;  3ZYY X;  2PVG C;  4C4T A;  3O0F A;  3VR8 B;  5G5H A;  7ICI A;  1VJK A;  2DFL A;  5AKK A;  8ICI A;  1I35 A;  3AN1 A;  8ICF A;  1ZQT A;  1SKW A;  1Z5S B;  1ECW A;  3K9O B;  1DOX A;  1DRG A;  2VKQ A;  2K8B B;  2LRU A;  5KG4 A;  2WX1 A;  1UD7 A;  3R7R A;  4HEA 1;  4NL9 C;  2ZTC A;  3ZXR A;  4EUT A;  2OH2 A;  2XGP A;  4HDQ A;  3WKC A;  4WJN A;  5KFA A;  5III A;  2R8K A;  5AEK B;  3QU7 A;  2V3P A;  2RP5 A;  2G4D B;  2D3B A;  2KZZ A;  4HVB A;  2LFI A;  4E0D A;  1FXT B;  3NVY A;  2LGI A;  3WK9 A;  4C8O A;  2DZM A;  1JRO A;  3AV8 A;  4G50 A;  1ZQK A;  5EWF A;  2LI6 A;  2WXM A;  2WF5 A;  5J0W A;  3KZI U;  4J9N A;  3JPQ A;  2KEY A;  1WE7 A;  1COO A;  3N7S C;  4DF8 A;  2RPV A;  4GXI A;  1JIH A;  1WGR A;  3THV A;  1YJI A;  2LEK A;  1XQQ A;  1ZQD A;  5KG7 A;  1EM7 A;  4NM1 A;  1PYW D;  3GDX A;  4YSX B;  3PO5 A;  3AEF B;  1TS4 A;  4M6W B;  9ICB A;  1XD3 B;  3R7Q A;  1A6S A;  1YN4 A;  2IMW P;  1ET6 A;  4M9N A;  2FPK A;  1AW7 A;  4Z6C A;  4P0P B;  1PGX A;  4J03 A;  4BKS D;  1WIA A;  5J0Q A;  2K8B A;  1BVS A;  1UPH A;  2WXJ A;  4C7Y A;  2XBB C;  5CR0 A;  4JQW C;  3C5G A;  1K1Q A;  2WDT B;  2FMQ A;  4HKZ E;  5T8I A;  1UNS A;  2KMD A;  2XY6 A;  2FLN A;  3ZRC A;  2KJ5 A;  3GIM A;  3P4S B;  3LVW A;  3PMN A;  3BQ2 A;  1F77 A;  1NEN B;  5ALP A;  4M9J A;  2PKO A;  4Q8E A;  1N5X A;  3TI0 A;  4UBC A;  2W9C B;  3FAH A;  1X2I A;  3MDA A;  2LXA A;  2A1J B;  1URJ A;  4FFD A;  2NMQ A;  2WXI A;  2ZEQ A;  1L2N A;  1ZQW A;  1ZOY B;  3Q3N C;  2PVO D;  2N9P C;  1U9L A;  3A0H U;  3UXO A;  2DEN B;  5AK6 A;  4A90 A;  1X9S A;  2W3S A;  4II3 B;  4NQK E;  1UCV A;  4WJ3 B;  3HW8 A;  3E2E A;  4A6Q A;  2YY6 A;  1TAM A;  2KK0 A;  3ONN A;  3VDZ A;  3W9C B;  4DHZ E;  3B0A A;  2KVZ A;  2WDQ B;  3ZTC A;  1WI0 A;  3BVZ A;  3D6J A;  4JWM A;  1ZQJ A;  1F9J A;  4M6W A;  1XO3 A;  2RPQ A;  2M56 B;  3Q6B A;  4XYC A;  3RJG A;  2WLB A;  3A33 B;  1SZP A;  1LGR A;  3M63 B;  2VZK B;  4RQ8 A;  4I2I A;  4BX9 C;  2D2Q A;  4BKG A;  4QZD A;  1HA5 A;  2BB5 A;  4L1B A;  5KFT A;  2K89 A;  2LVQ A;  2ZW1 A;  4DQR A;  3P63 A;  2UYZ B;  2LGD A;  2AWT A;  4YT0 B;  3IN5 A;  1UGJ A;  2BZF A;  1KW4 A;  3DVN V;  4GDK B;  1L7Y A;  1KQQ A;  5ALI A;  4O3N A;  5ALM A;  3RZW C;  5JZE B;  2MRL A;  2WU2 B;  2KD0 A;  3RNF C;  3WK8 A;  1UEL A;  2W9C A;  1KM7 A;  4JPS A;  3QNM A;  4W9C A;  2M0A A;  3WK7 A;  2L52 A;  3SDL C;  4QZB A;  1UGM A;  1V9J A;  2H3Q A;  3KTQ A;  3EC8 A;  2LJ5 A;  4G3X B;  5ALF A;  1I4G A;  1VZ7 A;  1Z4O A;  3RN9 C;  2JZZ A;  4FS1 A;  5DBB A;  4O3O A;  2GRI A;  3U4E G;  3QUC A;  4KLF A;  4RNM A;  4HLE A;  9ICV A;  3PVL A;  4URK A;  5CJ7 A;  1KRH A;  3BYY B;  2K25 A;  5AZH A;  2LYH A;  1XSL A;  2EMT A;  1TFR A;  3MGV A;  5KFK A;  2KFK B;  3GE3 C;  5TR5 A;  2MQJ A;  2NS5 A;  1L0X B;  3X0W A;  2KQ4 X;  1L6U A;  2LVO A;  1TY0 A;  4Q44 A;  4XWT A;  1WF9 A;  4C8N A;  3PO4 A;  1ZQM A;  5A0L A;  3CP8 A;  5JTI A;  4EZ6 A;  5J2I A;  2ZUC A;  4N58 A;  1N56 A;  4ANU A;  4QW9 A;  1WM3 A;  3RH5 A;  1PVQ A;  4GDK A;  4RT2 A;  1S0O A;  4DFJ A;  1FPY A;  2P66 A;  1ZKH A;  4XGA B;  3KUZ A;  2K4P A;  3KLS X;  2CS4 A;  3DBR B;  5BOL A;  1TE2 A;  2EZY A;  5EOZ A;  2VH1 A;  4FA6 A;  5MPO A;  4IWP A;  3AEC B;  4KDL B;  3SI8 A;  4J9Q A;  4KLL A;  5DPS A;  2IA6 A;  3T3N A;  3OJ3 A;  3EYZ A;  2RDJ A;  2FI1 A;  3Q8F A;  2ZPY A;  3AB5 A;  4LNI A;  9ICM A;  1Z00 B;  1JWA D;  4YXJ A;  4F72 A;  1MHX A;  2HBM A;  1B43 A;  1UT8 A;  1T0R C;  1SZH A;  2I6X A;  2X8X X;  9ICW A;  3VCB A;  4BFR A;  1F2R I;  3AI5 A;  3T9L A;  3MC9 A;  1I4Q A;  1A0P A;  9ICQ A;  2KFK A;  5GMV A;  1IV8 A;  2DF4 B;  4Y2P A;  1OEY J;  2XEW A;  1TBE A;  2WB1 C;  1L3V A;  3D2S A;  1NVI D;  4XWW A;  3QUQ A;  1QIL A;  4C8L A;  2CJO A;  2W03 A;  2M17 A;  3I63 C;  4KTQ A;  5J0R A;  2JXJ A;  5HNK A;  8ICJ A;  8ICW A;  2LUE A;  3KFU F;  2PKE A;  1ZGU B;  2BF8 B;  3L16 A;  3RTV A;  3HUI A;  1Q46 A;  3D2Q A;  3TSS A;  3QEB Z;  2CHZ A;  4LDT B;  1D9F A;  3PW5 A;  5ALU A;  3C0R B;  5L1L A;  1ZQI A;  5H92 C;  1TJE A;  1T0Q C;  4N6E B;  3RB4 A;  2XI9 A;  3T79 A;  2UVR A;  4QIW F;  3DPD A;  2GLS A;  1M4V A;  4E3C A;  1PUZ A;  2QB0 B;  4CF5 A;  8ICT A;  4C0Z A;  4J6I A;  4Y2Y A;  3SEI A;  5CHG A;  2BPC A;  2KKV A;  2WP9 B;  3RI7 C;  1QSL A;  5G2N A;  1EO6 A;  4I2C A;  1SIJ A;  1Z00 A;  3BS7 A;  1NEK B;  3RCZ A;  4Y2J A;  1ZUD 2;  3B2G A;  4HRO A;  3SEN A;  2ZZP B;  4CNQ A;  3IRU A;  2HVI A;  3VTW A;  4C4R A;  2WXG A;  3P2B A;  2IDY A;  3R66 C;  5AM4 A;  4MEL A;  2GOW A;  4EEY A;  1CRX A;  1L7O A;  1HZ5 A;  5B66 U;  2LGX A;  2FPL A;  5KFW A;  4MM3 A;  2EQY A;  2N9L A;  2VA2 A;  2X38 A;  2AX5 A;  3F5E A;  3GIK A;  1SSN A;  2KMA A;  1A70 A;  3EGR A;  3PML A;  3ZDA A;  4JMU A;  1YT3 A;  2K4I A;  2ALZ A;  1WWU A;  4NV0 A;  4RQN A;  7ICT A;  2BCQ A;  4LLG M;  4XE0 A;  2KC1 A;  2GLE A;  4MHV A;  4F7Z A;  1SB3 C;  4EEK A;  4ELV A;  4YR2 A;  1GC7 A;  5J0P A;  3M8S A;  2JRH A;  4AJW A;  1DXS A;  5KFD A;  3ZNG C;  4DLG A;  3DBS A;  3DBL B;  4QZA A;  1K52 A;  2FMS A;  2JZB B;  5AI6 A;  1WR1 A;  1Z3E B;  1JRP A;  4IQT A;  3ZW3 A;  4W9I A;  1B0X A;  3RUI B;  5CRX A;  2KJ9 A;  2JRI B;  2F1J A;  2D10 A;  1S8O A;  9ICF A;  1IXR A;  1COK A;  4HWI B;  3AE1 B;  2LKY A;  5AIA A;  3PVX A;  2RGF A;  2BHN A;  2ISO A;  1FM0 D;  3ZDC A;  1K50 A;  2C7H A;  3O65 B;  3V6E B;  4C4S A;  1ZE3 D;  2CKH B;  4WQO B;  1K51 A;  2H3Z A;  3KHG A;  5D4B A;  4UB6 U;  9ICX A;  2BS3 B;  4BDP A;  5AM1 A;  1UT5 A;  2JMG A;  4IDI A;  2ZNV C;  5IA7 A;  4RQ4 A;  4P6V F;  2BBC A;  4HRS A;  5AI9 A;  2PI5 A;  2IND C;  4M9L A;  1OFF A;  4O5E A;  4DXA B;  3PSF A;  3OSP A;  3H7S A;  2C2R A;  4EX6 A;  3F2B A;  1PUT A;  2LMR A;  4P7I A;  1FRD A;  2MP2 B;  2WDR B;  4RNA A;  1T0S C;  1ZP0 B;  3GII A;  2E8P A;  2LHT A;  2A3V A;  1QOA A;  4RNO A;  5ALN A;  1L4Z B;  2GBR A;  2ZUD A;  1XLP A;  4BOZ B;  3AE7 B;  1C77 A;  1CZP A;  3UIO B;  3SAH A;  4ELU A;  1WJ4 A;  1RAX A;  2DZJ A;  2JZB A;  1T3N A;  2I5H A;  1WGD A;  2RSU A;  3KKA C;  2NCN A;  1QKZ A;  4DSK A;  4GIV A;  4BBN C;  2I1K A;  4XC2 A;  1TAQ A;  4O3P A;  1CI4 A;  4KGS A;  2Z8L A;  2WDV B;  3VC8 A;  3QEA Z;  1I4P A;  4KIK B;  1WFY A;  3M62 B;  1TK0 A;  3ED5 A;  1ZDV A;  1WX8 A;  4BXO B;  3IFW B;  1V86 A;  2JU6 X;  2SAK A;  2HHU A;  4UDU C;  1V6E A;  1C7Y A;  4ECT A;  4RQ1 A;  4Y2R A;  4DOA A;  4LNK A;  4IOI E;  1GB4 A;  2J0K A;  4OZB A;  3TBL D;  1I4H A;  2RMM A;  3NZ3 A;  3K1R B;  2KE7 A;  2XIC A;  3LWM A;  1J7A A;  1ZD3 A;  4MGK E;  1WGK A;  4WJP A;  4ZYN A;  3M1Y A;  4RF1 A;  4PZN A;  2DZK A;  3N1Y C;  2MP2 A;  3W5V B;  4DK5 A;  1K5O A;  4QWD A;  4I2J A;  3JSV B;  5KFX A;  4A8E A;  4RF0 A;  2KVR A;  1LKY B;  1P9D U;  3HT3 A;  5DBA A;  4F5R A;  4QW8 A;  4DFP A;  1TS2 A;  1YOV B;  3N7R C;  3OJS A;  2WXO A;  2EKI A;  2A5U A;  2HW3 A;  3M6Z A;  1RDF A;  1ZQF A;  4FBT A;  2LXC A;  4WAF A;  1LV5 A;  3APF A;  5DG8 A;  1IP9 A;  4UB8 U;  2LHE A;  2IGD A;  2HHW A;  7ICF A;  2L32 A;  3D32 A;  3KWV A;  3UXP A;  2DHZ A;  3HRD D;  2M4N A;  2W8K A;  1AYF A;  1XU4 A;  3GE8 C;  2KDB A;  4KLJ A;  5D3D A;  1F0Z A;  7ICO A;  1L0Y B;  2IGH A;  2Z0D B;  4LJP B;  3AEA B;  3MC1 A;  4YR3 A;  2ZCB A;  4YXD B;  4WWN A;  2MA9 B;  4I2A A;  3GFK B;  2ZPN A;  2JQR B;  4OVZ A;  1GJZ A;  4M0W B;  2QB1 A;  4K3B A;  1DOI A;  2NO4 A;  4WJO A;  2GBM A;  3MAB A;  3QX1 A;  4BXO A;  3Q8K A;  2LI5 A;  2C5L C;  1T8E A;  3HPO A;  2LJI A;  5DCN A;  2JXT A;  3VUX A;  1KFT A;  3C1Z A;  4B0E A;  3DBL I;  4QZC A;  1ZQV A;  2WXF A;  2F1I A;  2ASL A;  4KLH A;  4B9U A;  4KLS A;  2NO5 A;  1SV4 A;  3TAC B;  1LB2 B;  3D2N A;  2ACZ B;  3GU3 A;  2EAO A;  3N7P D;  3JSV A;  3AE9 B;  1V1P B;  1LKY A;  3RH4 A;  1BPZ A;  2BYF A;  2YMQ A;  2IHM A;  3HKZ C;  2BS2 B;  2ZG6 A;  1SKR A;  1YQB A;  1KDH A;  1ZQY A;  3NAS A;  2AU0 A;  1U49 A;  4I28 A;  4IG7 B;  2WFA A;  3HJE A;  2IJ0 A;  5BOM A;  5KFZ A;  5CX3 A;  1L7P A;  1ZQR A;  4KVG B;  3ZRF A;  3FIL B;  2J4X A;  2J42 A;  5CB1 A;  1QLB B;  3HVD A;  5GTH U;  1ZQP A;  1UUP A;  3JPP A;  1NKE A;  2WF7 A;  1MC8 A;  2ONQ A;  4AUQ C;  4M0W A;  5J29 A;  2MBB B;  1SGH A;  1BNP A;  3WCQ A;  3MR6 A;  4PHD A;  1FIQ A;  2EZZ A;  1UHU A;  4JUZ A;  2JEJ A;  4GXB A;  1S3S G;  5B5E U;  5AK3 A;  1FNV A;  4UB4 A;  3WKD A;  1YN5 A;  3LVV A;  2G1E A;  2RDI A;  3AE3 B;  2A19 A;  2V9W A;  1Q8K A;  9ICT A;  5IO9 A;  1SBB B;  3VUY A;  2V3S A;  1WZ0 A;  1NYQ A;  4OJL A;  2AQ0 A;  4YFK A;  2I1J A;  2IO3 B;  4DQO C;  1S0V A;  1JUD A;  2DPI A;  4ED8 A;  1R4M B;  3ZD8 A;  2KT7 A;  5J0U A;  2NR2 A;  8ICH A;  4Y2S A;  4OVU A;  1QTM A;  4DL2 A;  8ICY A;  3WAO A;  2ZIV B;  5J0Y A;  2IZV B;  4IQW A;  5AM2 A;  4X5V A;  1U47 A;  2XN9 C;  5AKG A;  2NVU I;  3N32 A;  3T8M A;  4II2 B;  2ZVO A;  4K1R B;  3AEG B;  1NKC A;  5HFY A;  2VH2 A;  4GC7 A;  2BQQ A;  1E8Z A;  4PGQ A;  1Z4N A;  2HDE A;  2KJ6 A;  4P16 A;  4L23 A;  3RPF C;  3FIL A;  4YXM A;  1ZRN A;  3JW0 X;  5DGA A;  1HUZ A;  2VIX A;  5HI1 A;  4B9V A;  4DL6 A;  4F2S A;  2D11 A;  4REZ A;  4CE6 A;  1S0M A;  1XCQ L;  2W82 A;  1JWU D;  2QHO A;  3EHV A;  1N63 A;  3IT4 B;  4YG2 A;  1ZQG A;  9ICS A;  4ZDV A;  1J2M A;  1J97 A;  2JSV X;  2NBU A;  2D3A A;  3AE4 B;  3DHH C;  5KFM A;  1Q3V A;  2BKR B;  1XS9 D;  3BK2 A;  3C8Y A;  3N30 A;  3TAP A;  4EOY A;  1S9F A;  2QSD A;  2HOQ A;  4DXG A;  4BWJ A;  5G55 A;  4BOS C;  2YB4 A;  2P6R A;  5ALV A;  1LQB A;  2NRW A;  3C28 A;  3TQ1 A;  3WK4 A;  3H4D A;  1E7V A;  2CR5 A;  1FCC C;  2G9H D;  2WAQ F;  2J6S A;  2KK8 A;  3LB8 C;  2KV2 A;  2GBK A;  2MX2 A;  1JW9 D;  4XQ8 A;  4R65 A;  4ZHO A;  2ZIV A;  2L0F A;  2N7D A;  1OQR A;  4YQW A;  5BYQ A;  8ICC A;  2GBN A;  3BQ1 A;  4J9L A;  2PE9 A;  4RGM A;  4M9G A;  2KDF B;  4Z6D A;  1WXS A;  4AS1 A;  1JWS D;  2JWZ A;  1RQN A;  4TUP A;  1NNL A;  3BZC A;  3WKE A;  4DSF A;  2NRT A;  1S97 A;  2YN4 A;  3BS5 B;  3PHX B;  4NY8 A;  1QOF A;  5EE1 A;  3AU6 A;  3L13 A;  4TQS A;  1MQ2 A;  2W7O A;  5JU5 A;  1KN5 A;  1PFD A;  5CWR A;  3Q8A A;  4C56 C;  2EZX A;  3ZDD A;  1FXI A;  3PSE B;  4ARC A;  5ALX A;  9ICU A;  3UMB A;  1UF0 A;  3H4B A;  5ALK A;  3T5H A;  4IC9 A;  4RMA A;  1K8R B;  3FM9 A;  2KP7 A;  3OPX A;  2F76 X;  1ZQE A;  2Y5B B;  4ED0 A;  4FZM A;  2KQ7 A;  3ZUN A;  4I2F A;  1P3Q U;  3FKY A;  3QC8 B;  4FHJ A;  3OAW A;  4AYB C;  1TK8 A;  1KF6 B;  1UWX A;  1SGG A;  1VR9 A;  1G6J A;  1NI3 A;  1BUI C;  2PFO A;  2D3D A;  2YVC A;  3C29 A;  2NBV B;  4GXJ A;  4P4O A;  4K7W A;  3PZP A;  2MSN A;  2FMP A;  3B0X A;  3QU5 A;  4DQI A;  2C9W B;  1T7P A;  2BPG A;  2V0G A;  5FR3 A;  4IR9 A;  1X9X A;  3RJJ A;  3LJ3 A;  3H8W A;  4O3M A;  1YQ4 B;  3I28 A;  4WQM A;  3VH3 B;  4KIT B;  5J0X A;  3WKA A;  4DHJ D;  2EEL A;  2QLT A;  7ICJ A;  2E8M A;  3Q8P B;  1NK0 A;  2R8H A;  2OEH A;  2LM4 A;  1T4G A;  1J7C A;  3ENE A;  3SD7 A;  1QOG A;  5ALO A;  2FE8 A;  3I57 A;  2XC9 A;  5KFQ A;  1TZO A;  3U2S C;  3BS5 A;  3QJZ A;  3ZI4 A;  1EU3 A;  2KD1 A;  4BUG A;  2PIA A;  4CDG A;  3TCA A;  4FZN A;  4DWI A;  4ANW A;  3HWT A;  4FO6 A;  1RYJ A;  2JX5 A;  3MR2 A;  1R4M I;  2HJ8 A;  1NJW A;  3SHQ A;  2HJ1 A;  1OQQ A;  4FS2 A;  5J2E A;  5KFP A;  5AIB A;  2MUT B;  1NK8 A;  1OTR B;  2N9X A;  2PJH A;  1NJY A;  4F91 B;  1L0V B;  5ALH A;  4KV2 A;  7ICS A;  4BAX A;  3F2C A;  1B1Z A;  2BS4 B;  4L2Y A;  5HR7 A;  4UB2 A;  3G6Y A;  2LZ6 A;  3PR4 A;  4IWQ A;  5EE9 A;  4XA5 A;  1H4R A;  3AU2 A;  4ZH4 A;  1HEK A;  3LXF A;  4HDO A;  5AI5 A;  8ICE A;  2KZR A;  3AXC A;  3PTF C;  2C2D A;  1MPE A;  4WJQ A;  1KKX A;  2KVS A;  2BYE A;  1D9D A;  5KFO A;  4PYZ A;  1TKG A;  8ICP A;  3WAM A;  2VAN A;  5KHQ A;  1A77 A;  1OGW A;  4QIW C;  3CIR B;  4YVZ A;  1NI2 A;  2KLC A;  1V5T A;  2ASD A;  3JPR A;  5IIO A;  4FUL A;  2DLB A;  3F2D A;  2UVW A;  5KTQ A;  1VLB A;  4AP4 C;  1BNO A;  3BQ0 A;  4U7C A;  1ZQQ A;  2XK5 B;  1JXE A;  1ZW7 A;  3ZQ4 A;  4EZL A;  3RJI A;  4KLO A;  3F53 A;  3TAD C;  1KBU A;  3AMZ A;  2CHW A;  5DPW A;  4IR1 A;  3PSP A;  2BWE S;  1SL1 A;  4R64 A;  3IAS 1;  2MUT A;  1F5S A;  3H0M B;  2XY7 A;  1GAQ B;  2BB6 A;  4MGY E;  3OTQ A;  2JEF A;  4C4V B;  4CF3 A;  4YTP B;  3TKA A;  2AH5 A;  3NVW A;  4GOC A;  2ZJ5 A;  5C5J A;  4CRX A;  3L10 B;  2KFJ A;  4QZI A;  4PGY A;  3W1Y A;  3A9J B;  3ML9 A;  9ICI A;  2MBO A;  4I6P A;  1H8C A;  1KH0 A;  4HJG E;  4YMM A;  2HHT A;  5IIK A;  3GZF A;  4K4G A;  5KFN A;  2ASQ A;  1D6E C;  1VZ8 A;  1RQL A;  3VR9 B;  2M9N A;  2PMZ F;  4BZA A;  4RPZ A;  5DQG A;  3SFD B;  1QT9 A;  4ACF A;  1L7N A;  2HE7 A;  3RNB C;  3DBH B;  2DYB A;  4IC7 B;  3UI3 A;  1IGD A;  2XK5 A;  1H38 A;  1TYG B;  5DGB A;  4ICA A;  3C21 A;  4P4M A;  2INC C;  2AGQ A;  3ZGZ A;  1N6Z A;  2HHQ A;  1DK2 A;  1QLN A;  3IVF A;  1T94 A;  5J2A A;  1WWV A;  3G6V A;  2K6Q A;  2LWP A;  4MSM B;  1PVP A;  2H89 B;  1EWC A;  2KIW A;  1U4A A;  2WS3 B;  3ZO5 B;  2K60 A;  4A3P A;  3MC8 A;  4UB5 A;  4TQ0 A;  5DDM A;  2BT6 A;  5KHO A;  3IM1 A;  3AL0 B;  2AQ4 A;  5ALL A;  3GZN B;  3WIM A;  3MHZ A;  4QZH A;  1QSY A;  2QKQ A;  3KUD B;  2MW5 A;  3A9J A;  3JYU A;  4UAV A;  5DB7 A;  2MLB A;  1JMS A;  1V9P A;  4RM8 A;  1A76 A;  1GO3 F;  2N1R A;  1B22 A;  2Y0S F;  1U48 A;  5D6J B;  4ITK A;  4P0P A;  5HML A;  2H3V A;  2XCP A;  4A8X C;  2W55 A;  2W9B B;  1TVA A;  1MA7 A;  2LVP A;  3N20 C;  2R61 A;  3IHP C;  4YR0 A;  1NYR A;  2ON8 A;  1WRD B;  2O6V B;  4OJP A;  2Z59 B;  2AQ2 B;  8ICR A;  1FEZ A;  4MGI E;  3PR5 B;  5E6N A;  3GV5 B;  3QCA A;  1XO1 A;  4XRH A;  4PZO A;  4GGQ A;  2A1J A;  4OZC A;  4DHZ B;  4TQR A;  2XCA A;  5L83 A;  2AHO B;  1P7F A;  3KH0 A;  5JHA A;  3PLV A;  5KG2 A;  2BDU A;  4IS7 A;  4HCP B;  3S2A A;  3IG5 A;  4JV1 A;  3OWE B;  1WG8 A;  1HEZ E;  3TEX A;  5J0O A;  4DFM A;  4RGO S;  4Q43 A;  3WAP A;  4J9K A;  3PX0 A;  2KYW A;  2ODG A;  2KQS A;  4A20 A;  3PLU A;  5FR6 A;  4Y2U A;  3A0B U;  2EAP A;  5ALJ A;  2G3Q B;  4FJZ A;  3U52 E;  2KJR A;  3DWM A;  4YWG G;  4O3R A;  1SL2 A;  8ICZ A;  2FIF A;  1YMH E;  2H3I A;  2YEP B;  1DOQ A;  2W9B A;  2BCS A;  5JH5 C;  7ICG A;  3M7D A;  3R9K A;  2K3U A;  1SV0 C;  5JRT A;  2YEP F;  5J8Y C;  3SYZ A;  1FNU A;  1QQ5 A;  2AGP A;  2O6V A;  1D5M C;  2N9K A;  3U30 A;  2IOF A;  3OG5 A;  1D5X C;  2LGY A;  3V3X A;  1WRI A;  2BYT A;  3TEY A;  1ENF A;  2L7R A;  8ICM A;  2K22 A;  2OED A;  2C7N B;  3AU5 A;  3W1S A;  1X9M A;  1MJD A;  1TKY A;  4O1N A;  5T14 A;  4HK2 A;  2INP E;  3NRZ A;  4DCC A;  2B76 B;  1N60 A;  2L05 A;  3JPS A;  1NDD A;  3DBH I;  1PK1 B;  1QH9 A;  2G08 A;  2CN1 A;  4NJC A;  2DBY A;  4PHP A;  2GO7 A;  1P7D A;  4MFA A;  2C28 A;  1Q5W B;  2AQ1 B;  3UGB B;  1GNU A;  3S6J A;  4B6W A;  3J81 j;  1V1O A;  4RQM A;  1F52 A;  4UAW A;  4O3Q A;  1JCK B;  3BZD B;  4WWO A;  5KT4 A;  2FPM A;  2JH1 A;  4KX6 B;  3GS2 A;  1IYF A;  1GB1 A;  1ZQH A;  1ZQC A;  3ALB A;  5E6P A;  1SIF A;  5AZF A;  2WNM A;  3UPQ A;  5KT7 A;  3GZN I;  4CHK A;  5KFF A;  5LXH A;  3H8S A;  4EFO A;  3B9J A;  2JV3 A;  4AJY B;  4ECQ A;  4MEY A;  3PV8 A;  1UBI A;  2ZJA A;  1V2Y A;  2RHF A;  4ACO A;  3DQV A;  3IAM 1;  4B0M A;  8ICO A;  4B95 A;  1ZD2 P;  4C7Z A;  5CP2 A;  4RZR A;  1WJN A;  4KLT A;  3V62 A;  1WCN A;  1YN3 A;  2QCZ A;  2KHV A;  5IIJ A;  3MGH A;  1KL9 A;  4G11 A;  1PK1 A;  3VTU A;  3IHQ B;  1R4N B;  3ZXV A;  4P2H A;  2KTQ A;  4M02 A;  4Z6E A;  1PGA A;  2LYB A;  4F4X A;  3DV9 A;  2K9X A;  4JWU C;  2HBL A;  4IM2 A;  1HZ6 A;  4OW0 A;  1B4F A;  3IT6 B;  4WIP A;  5CHF A;  4UB3 A;  2KNB A;  5E6O A;  1HTO A;  2PMV A;  1ZET A;  1FO4 A;  1ZQU A;  3KZX A;  3QZ7 A;  2VZK D;  4RFB A;  4LNF A;  3A9K B;  5F3X B;  8ICL A;  2REX A;  1P0R A;  5DG7 A;  2ZIX B;  4OJ5 A;  3BII D;  3LYS A;  2LHD A;  4ZOH C;  4PHA A;  2JF5 A;  2MBH A;  1E7U A;  4DF4 A;  1K53 A;  1LXD A;  3PS6 A;  1K1S A;  2E3T A;  2FDR A;  2PFQ A;  1NJZ A;  2KTF A;  4M47 A;  3PST A;  3RB6 A;  4RU9 A;  4RQ3 A;  1X6I A;  2KSO B;  5F9N A;  3IBE A;  1J7B A;  3VQI A;  2RR9 A;  1KLU D;  3QAQ A;  9ICA A;  1S1Q B;  3PPA A;  3ZNZ B;  2QB0 A;  3B2F A;  2ISP A;  2KJ8 A;  5KFR A;  2JVC A;  1HQR D;  2WWZ A;  3J9C A;  3L4P A;  2AL6 A;  2IHN A;  3EA6 A;  7ICL A;  2KOX A;  4I2G A;  2DAF A;  3TUO A;  4ARI A;  2BW2 A;  2KIV A;  4DL7 A;  5D7G A;  5L1K A;  4MT5 A;  3PO0 A;  2W43 A;  1ZQL A;  2FLP A;  2WAQ C;  4OHJ A;  3VH4 B;  3LDA A;  4MSQ B;  1C3T A;  4UAU A;  3RR8 A;  1KTK A;  1EU4 A;  2V9H A;  4ECR A;  1D8L A;  3KYC D;  3Q2A C;  4NL9 A;  3DVG Y;  5BO4 B;  4EE2 A;  1ZQO A;  1IPG A;  2G4S A;  1L8O A;  3Q8Q B;  1BXT A;  3V61 A;  2MSE D;  3GV7 B;  4CYE A;  2PPH A;  4U6P A;  1SKS A;  1BT0 A;  4FN2 A;  3A9K A;  4FXC A;  2ZIX A;  4TUU A;  2P6U A;  2RDG A;  4NJ7 A;  3MJW A;  1CJE A;  2ZVN A;  1DYQ A;  4Q8F A;  1ZD4 A;  3TEW A;  3RNE C;  1SXE A;  1VD2 A;  3ECI A;  1QSS A;  4F92 B;  1OW5 A;  1LM8 B;  5I4D A;  1FNW A;  3K9P B;  3RR7 A;  5AI0 A;  4FHK A;  4PHE A;  2WTF A;  9ICJ A;  4PS8 A;  3WAN A;  1Y8R C;  2OJR A;  3CWI A;  1PZN A;  4DSE A;  2E8O A;  4EYH B;  2HVH A;  4G3I A;  4YMO A;  3PRZ A;  2KKP A;  4E71 A;  4OVV A;  3Q8M A;  1JRU A;  2KWU B;  4M8M A;  1GOZ A;  4IUM B;  1SXT A;  4TKN A;  3PY8 A;  8ICK A;  4F4W A;  2UU7 A;  3AH7 A;  2YLM A;  4JWS C;  9ICP A;  4C8K A;  4ED7 A;  2KC2 A;  1EWY C;  2KXJ A;  3Q3O C;  4CGZ A;  4X57 B;  1I4X A;  1Q0W B;  4RQ6 A;  1WCL A;  2MWS B;  5C23 A;  2KN7 A;  3MFI A;  1BGX T;  3L54 A;  2HSZ A;  2ZIW B;  5ALE A;  4UAZ A;  1R4N I;  3PRM B;  3C2M A;  2V3N A;  4JK1 A;  2YX8 A;  2I2Y A;  5HHI A;  3PX6 A;  3DHG C;  5LLI A;  3ISD A;  4EEL A;  2DKX A;  2KOB A;  4RQ2 A;  3MGI A;  1WJU A;  2E5S A;  2PFP A;  1L8L A;  1WZ3 A;  4YD2 A;  1IUE A;  2JYE A;  2J53 A;  4LDT D;  1WMH B;  3C23 A;  2ZJD A;  4XDD A;  2K1F A;  3AQE A;  3QHT A;  1RM6 C;  1KSP A;  1Q3U A;  2CPR A;  3NY5 A;  4K81 A;  3CRX A;  2Y3A A;  4YSZ B;  3L3F X;  4R63 A;  5J2C A;  4O3S A;  2L00 B;  1XT9 B;  2KIC A;  1CQV A;  4NJ6 A;  3EW9 A;  4DLE A;  3V6J A;  3RJE A;  4UBB A;  4F5P A;  4KIK A;  2I38 A;  2HDO A;  2FCS A;  5F9L A;  5KT6 A;  3NHE B;  1WGH A;  1YX5 B;  2P35 A;  4QZF A;  2BCV A;  3Q8E A;  2NRZ A;  4DL5 A;  1QQR A;  4EZJ A;  9ICR A;  4F4K A;  1FFU A;  2KX0 A;  2MJE A;  1JAL A;  1SEB D;  3KWL A;  3VUW A;  2RDH A;  2KWC A;  2WX0 A;  2BDP A;  4DDI D;  2Z7J A;  4JGH B;  5IKC M;  1TT5 B;  4EBC A;  4KN4 A;  4MF8 A;  2F3N A;  2ZIW A;  3I9V 1;  2W8L A;  3QU2 A;  4IL6 U;  4RUA A;  1Q1O A;  1Y56 A;  3CSF A;  3ORY A;  2K5P A;  1S10 A;  4QWA A;  9ICH A;  4NPN A;  8ICN A;  2WU5 B;  1WMH A;  3N4M B;  3NUQ A;  4KGT A;  4R8U B;  2OXO A;  4W9J A;  3HX0 A;  3RBE A;  2IO2 B;  1J8C A;  2IY0 B;  5D49 A;  2RLT A;  5ALS A;  5KG3 A;  4WWP A;  4R66 A;  2AQ3 B;  3T3O A;  2EDU A;  1E8X A;  2Y5P A;  2K39 A;  3ZTD A;  3GQC A;  3GOE A;  4ZRQ A;  4XUS A;  5CA7 A;  4KX5 A;  4HCN B;  3GIJ A;  3TFR A;  3FDS A;  5D94 A;  1ZQX A;  3NG0 A;  3GV8 B;  2FID A;  1RXW A;  3RB3 A;  1E90 A;  1MFW A;  1X6J A;  5EE0 A;  5KFB A;  2QEJ C;  5L1J A;  5L9X A;  3N9Y C;  2QMT A;  2HD5 B;  2WB1 F;  2BVC A;  2FCN A;  2I1Q A;  2R8G A;  4KLD A;  1RZT A;  1ET9 A;  1MVK A;  4GXK A;  1D8Y A;  2ZIU B;  5KFJ A;  4ECX A;  4WH4 A;  2E8N A;  4F93 B;  4QNL A;  4H2A A;  1V1P A;  1FFV A;  2F1H A;  5AKZ A;  5AK5 A;  3CNH A;  2MHJ A;  3BK1 A;  1V8C A;  4TUS A;  1WX9 A;  3OHB A;  3HM3 A;  4QWC A;  4MEX A;  5J2G A;  4KDI C;  3ZNI D;  2D5G A;  4KZ0 A;  2HHX A;  4R8U A;  1TK5 A;  4DL3 A;  2R2Q A;  4HXD A;  4IW0 A;  4NLN A;  4NWI A;  1F2R C;  1CUK A;  3NS1 A;  2UWQ A;  4I2B A;  8ICV A;  5EWG A;  3UQ2 A;  1JX4 A;  3UF8 A;  2G06 A;  1MI0 A;  2DNF A;  3R2T A;  3A4R A;  5FK9 C;  4NAW B;  2RDB C;  1WR6 E;  3HIZ A;  2F2A B;  3E58 A;  1C4A A;  5IN7 A;  3PW7 A;  1NK4 A;  3FC4 A;  2ESE A;  3T5K A;  1OEY A;  3SMV A;  1ZQZ A;  2PXI A;  4GFJ A;  4KMU A;  1UH6 A;  4LNN A;  3RRH A;  2RD0 A;  2Y0S C;  3VVW B;  2IOH A;  1NK7 A;  4Y2Q A;  4JL9 A;  2XO7 A;  1HUO A;  4RQ7 A;  1V49 A;  2J7Q B;  4G0N B;  3AE6 B;  2JR5 A;  1LVH A;  5ALW A;  2ZIU A;  3EUB 2;  1FXA A;  1WYW B;  4ECZ A;  3K75 D;  3H40 A;  2J6U A;  2A4Z A;  5KL1 B;  4PK1 A;  3A1Q B;  5KG1 A;  5AKE A;  2MEK A;  1HTQ A;  3NVZ A;  3M9O B;  4O5C A;  3C1Y A;  2BQ3 A;  2KAC A;  2FBW B;  1KTQ A;  2HTM E;  4TV3 A;  1X40 A;  1ZQS A;  2R8J A;  1C1Y B;  2IBI B;  4W9F A;  5DB9 A;  3RYT A;  1WGY A;  1CEZ A;  3SV4 A;  1ZJN A;  2W9M A;  4RNN A;  3QA8 A;  5D46 A;  3ALR A;  1SE4 A;  2PEA A;  4J9S A;  4DEZ A;  3EZ5 A;  4RGN A;  5ALG A;  2HHS A;  1WSP A;  4W9G A;  2CJN A;  3M3J A;  2CHX A;  4ANV A;  2J52 A;  4NAW A;  4MGZ E;  3ISB A;  3PHW B;  3B1L X;  2KFZ A;  3Q14 C;  3AEV A;  2WXL A;  4D2K A;  2D3G A;  4FLH A;  1YJ1 A;  2ZNV B;  5ALZ A;  4CCH A;  4RPY A;  2C2E A;  4FZL A;  4Y2X A;  3HP6 A;  4XZ4 A;  5KFG A;  4RCO A;  1QCK A;  1V5O A;  1AAR A; 
#chains in the Genus database with same CATH homology
 1EWC A;  1M4V A;  3ZJU A;  2WS3 B;  3SEB A;  3BWU D;  4TQ0 A;  1P7E A;  2BT6 A;  2WP9 B;  5BMH A;  3W2D A;  2NTS A;  3MHZ A;  1SIJ A;  3ETR A;  1NEK B;  1I4R A;  3IXS A;  3VRA B;  1Q10 A;  3B2G A;  1ZUD 2;  4N59 A;  4HRO A;  2QIE B;  1ZXH A;  1VRA B;  2ZW0 A;  1IBX A;  1WYG A;  2WXG A;  4LTU A;  2IDY A;  1YNT E;  4ITK A;  5JXV A;  1ZPS A;  1HZ5 A;  3MJ5 A;  2CU3 A;  2N9L A;  4WUR A;  2X38 A;  4A8X C;  2AX5 A;  2W55 A;  1SSN A;  1A70 A;  3EGR A;  2R61 A;  1NYR A;  2MJ3 A;  2V4I B;  2ON8 A;  4LLG M;  4XE0 A;  2AQ2 B;  1SB3 C;  4OZC A;  3NVV A;  1K52 A;  1D5Z C;  1P7F A;  5G5G A;  3TEZ A;  1JRP A;  1D4B A;  1KFY B;  1ZDX A;  1FD6 A;  3MC0 B;  3OWE B;  1JWB D;  1HEZ E;  3TEX A;  2GB1 A;  4RGO S;  3AE1 B;  1TY2 A;  3SFE B;  3HVZ A;  2MH7 A;  1FM0 D;  1K50 A;  1ZE3 D;  1K51 A;  1XEE A;  1ESF A;  2BS3 B;  4IDI A;  1FCL A;  3U52 E;  2WXR A;  3DWM A;  4P6V F;  2BBC A;  4YWG G;  4C80 A;  4HRS A;  1OFF A;  1YMH E;  2YEP B;  2ICI A;  3Q8B A;  1PUT A;  3VRB B;  1TKE A;  1FRD A;  2WDR B;  4RNA A;  3NUH B;  4KKJ A;  1XXG A;  1ZP0 B;  2K3U A;  4TSS A;  2YEP F;  1FNU A;  1QOA A;  1YQ3 B;  1D5M C;  2N9K A;  2Y5C A;  3P4R B;  1R7S A;  1L4Z B;  2IPK D;  2K0P A;  1D5X C;  1XLP A;  3AE7 B;  2WQY B;  1ROE A;  1C77 A;  1WRI A;  3V3X A;  2BYT A;  1CZP A;  3TEY A;  1ENF A;  2K22 A;  3BVM A;  2OED A;  1TS5 A;  3W1S A;  1L4D B;  2DYO A;  1TKY A;  1QKZ A;  4JE3 B;  1SF0 A;  4O1N A;  4XDC A;  1WXQ A;  2INP E;  3NRZ A;  2B76 B;  2N0S B;  2QJL A;  1N60 A;  1E7P B;  4JX1 C;  1C76 A;  2WXK A;  5BMI A;  2KWD A;  4KGS A;  1L6V A;  2Z8L A;  4MH8 A;  2WDV B;  1DOY A;  4NJC A;  1I4P A;  3GP7 A;  5D3I B;  2DBY A;  2PW9 A;  1ZDV A;  2AQ1 B;  1JWM D;  2SAK A;  2JU6 X;  3AE5 B;  4UDU C;  1V1O A;  4IOI E;  1GB4 A;  1JCK B;  3BZD B;  4OZB A;  1I4H A;  1UWM A;  4KX6 B;  2RMM A;  3GS2 A;  4J3O D;  3NZ3 A;  1GB1 A;  1FEH A;  1J7A A;  1E6E B;  1WGK A;  4RF1 A;  2WNM A;  3W5V B;  4HKQ A;  3B9J A;  2N7J A;  4RF0 A;  4KGR A;  3R8B A;  3ABV B;  1JML A;  4MAC A;  1TS2 A;  2WXO A;  3P1M A;  1FMA D;  2EKI A;  2KMM A;  4WAF A;  3IAM 1;  3DWG C;  4B0M A;  5GXG B;  4LK0 M;  2LHE A;  2IGD A;  2L32 A;  5TSS A;  4C7Z A;  3KWV A;  4YTN B;  3U7Z A;  3HRD D;  3SR6 A;  1AYF A;  4DXF A;  5D3D A;  1F0Z A;  4ZYS A;  1L0Y B;  1YN3 A;  1FRR A;  4US8 A;  4YTM B;  2IGH A;  3MFG A;  3AEA B;  2JWU A;  4YXD B;  3H8H A;  1VDV A;  2JQR B;  4OVZ A;  1DOI A;  4GDL B;  2K9X A;  1PGA A;  1STE A;  2SEB D;  4JWU C;  4NZL B;  2LJI A;  2JXT A;  2NTT A;  1HZ6 A;  4OW0 A;  2W54 A;  3IT6 B;  4WIP A;  4B0E A;  5LNK 1;  3AM9 A;  3R2I A;  4TMA B;  2PMV A;  2WXF A;  2BTE A;  1FO4 A;  3AE8 B;  2WXQ A;  3MP9 A;  1KLG D;  2VZK D;  1SE3 A;  4RFB A;  3ZJT A;  3BII D;  1N5W A;  2ACZ B;  2WXP A;  5AUK A;  2LHD A;  4ZOH C;  1RWS A;  5BYR A;  2INN E;  1K53 A;  3AE9 B;  1V1P B;  2LMC A;  2E3T A;  2BS2 B;  1ZXI A;  1T3Q A;  3PZ8 A;  3GB1 A;  4WWM A;  4GLS C;  4TQ1 A;  3P4P B;  5AUI A;  1E9M A;  1J7B A;  3VQI A;  1KLU D;  4AQ7 A;  1XF5 L;  2IJ0 A;  2KDM A;  3PZ7 A;  1E10 A;  3B2F A;  1HQR D;  3FIL B;  2J4X A;  3J9C A;  3L4P A;  1C4C A;  2J42 A;  1QLB B;  3HVD A;  3EA6 A;  5BMG A;  5EE3 A;  5E6J A;  1UUP A;  3TUO A;  4ARI A;  2BW2 A;  2ONQ A;  1CK1 A;  1WWT A;  4MT5 A;  3PO0 A;  4M0W A;  5D7G A;  4OHJ A;  2IGG A;  2GI9 A;  3WCQ A;  1KTK A;  1FIQ A;  1EU4 A;  1C78 A;  1XCT L;  4CQN A;  1FNV A;  4EE2 A;  1YN5 A;  1DGJ A;  1ACC A;  1BXT A;  2FUG 1;  2G1E A;  4OZA A;  3AE3 B;  2WXN A;  1SBB B;  4FXC A;  2JYT A;  1NYQ A;  1N61 A;  4DQO C;  3RFZ B;  3W5U B;  2RDG A;  1CJE A;  2WXH A;  1DYQ A;  2M19 A;  4IKG A;  3ZYY X;  2PVG C;  3VR8 B;  3TEW A;  5G5H A;  3Q69 A;  1VJK A;  4KKI A;  3AN1 A;  1DOX A;  5I4D A;  2XN9 C;  5C2T B;  1FNW A;  1PGB A;  4NAM A;  3AEG B;  5HFY A;  4L23 A;  2HDE A;  4P16 A;  2L83 A;  3RPF C;  3FIL A;  4HEA 1;  3AEE B;  2KAJ A;  1BML C;  5HI1 A;  2Q5W D;  3CWI A;  4REZ A;  2V3P A;  1XCQ L;  2W82 A;  1JWU D;  1QF6 A;  1N63 A;  1GOZ A;  3IT4 B;  3AE2 B;  1SXT A;  4Q2J A;  2LFI A;  2JSV X;  2PLP A;  3AH7 A;  3NVY A;  1TS3 A;  2LGI A;  3AE4 B;  3BK2 A;  4JWS C;  3C8Y A;  3AV8 A;  1JRO A;  1EWY C;  2QSD A;  2WXM A;  4DXG A;  3LYY A;  3KQ4 A;  1N62 A;  1I4X A;  3ZJV A;  1XLQ A;  2H88 B;  1JQ4 A;  2RPV A;  1FCC C;  1XLO A;  2G9H D;  2V3N A;  1YJI A;  2I2Y A;  3BYT B;  2LEK A;  3LB8 C;  1EM7 A;  1JW9 D;  4ZHO A;  1PYW D;  4YSX B;  3AEF B;  1C9F A;  1TS4 A;  1IUE A;  1T5X D;  2JYE A;  1OQR A;  2J53 A;  5BYQ A;  4A9A A;  3O13 A;  4XDD A;  1YN4 A;  4RGM A;  1ET6 A;  1AW7 A;  1GPX A;  1RM6 C;  1PGX A;  4AS1 A;  4MM3 B;  1JWS D;  2WXJ A;  4C7Y A;  5HHD G;  2Y3A A;  4YSZ B;  4HKZ E;  1QOF A;  5EE1 A;  5T8I A;  1UNS A;  1CQV A;  3P4S B;  1PFD A;  2I38 A;  1F77 A;  1NEN B;  3Q8A A;  4RH6 A;  4C56 C;  1FXI A;  4ARC A;  4ZRP A;  2E6X A;  3URY A;  2PKO A;  1N5X A;  1QOB A;  3FAH A;  1T6B X;  3Q8E A;  1QQR A;  2NMQ A;  2WXI A;  1YJJ A;  1B9R A;  1FFU A;  1ZOY B;  3AEB B;  2MJE A;  1JAL A;  1SEB D;  2PVO D;  3KWL A;  2RDH A;  4A90 A;  1VR9 A;  1KF6 B;  1UWX A;  2W3S A;  1BUI C;  1NI3 A;  2PTL A;  3Q8C A;  1SE2 A;  4A6Q A;  3I9V 1;  2TSS A;  4R3D A;  3W9C B;  1AN8 A;  5FKA C;  2WDQ B;  1Y56 A;  2V0G A;  3BVZ A;  2K5P A;  5FR3 A;  1E0Z A;  1YQ4 B;  4WQM A;  1XO3 A;  2WU5 B;  2M56 B;  4KGT A;  2WLB A;  2EEL A;  4A55 A;  1L5P A;  2VZK B;  1J7C A;  1HA5 A;  1QOG A;  2FE8 A;  3BVG A;  2BB5 A;  3I57 A;  4L1B A;  4RGT A;  1TZO A;  2ZW1 A;  3P42 A;  3U2S C;  1EU3 A;  3P63 A;  2PIA A;  2AQ3 B;  3T3O A;  4YT0 B;  1UGJ A;  1RYJ A;  5C3J B;  2JX5 A;  2Y5P A;  4GDK B;  1OQQ A;  4ZRQ A;  2WU2 B;  4JPS A;  5EE0 A;  1L0V B;  2M0A A;  2QEJ C;  4PT5 A;  3N9Y C;  2QMT A;  2L52 A;  1B1Z A;  2BS4 B;  1ET9 A;  2QIL A;  4L2Y A;  1MVK A;  3P4Q B;  1MHH E;  5H8Y E;  4WH4 A;  5EE9 A;  1RFK A;  1I4G A;  1VZ7 A;  4H2A A;  1V1P A;  1FFV A;  4US9 A;  3U4E G;  2GRI A;  3AED B;  3BK1 A;  3LXF A;  1V8C A;  1MPE A;  2KN4 A;  1KRH A;  1TKG A;  3BYY B;  2D5G A;  1PDX A;  1C4P A;  1LO5 D;  3CIR B;  1L0X B;  1F2R C;  1L6U A;  2KQ4 X;  3NS1 A;  1TY0 A;  4XWT A;  2DLB A;  1MI0 A;  3R2T A;  1VLB A;  5FK9 C;  4NAW B;  4ZHP A;  1C4A A;  4N58 A;  3ZQ4 A;  2XNA C;  1SJH D;  3FC4 A;  1V97 A;  3AMZ A;  4YSY B;  3IAS 1;  3KLS X;  1GAQ B;  2DYM A;  2BB6 A;  5MPO A;  3AEC B;  4YTP B;  3AE6 B;  3T3N A;  2LUM A;  3NVW A;  3EUB 2;  1FXA A;  1XLN A;  3Q8F A;  3AB5 A;  1JWA D;  1MHX A;  2JZP A;  1SJE D;  1HXY D;  2MEK A;  3NVZ A;  3E56 A;  2L1A A;  1IBX B;  1KH0 A;  2KAC A;  4HJG E;  2FBW B;  3V05 A;  2HTM E;  1F2R I;  1I4Q A;  1I7H A;  1VZ6 A;  2W3R A;  4USA A;  1D6E C;  1VZ8 A;  3VR9 B;  1IGC A;  1SE4 A;  1NVI D;  3E9S A;  4RGN A;  2MJD A;  5HG2 A;  3SFD B;  1QIL A;  1QT9 A;  1WSP A;  4XWW A;  2CJN A;  2CJO A;  1C79 A;  3UI3 A;  2J52 A;  1IGD A;  3TSS A;  1AWD A;  3HUI A;  1TYG B;  2WXL A;  4D2K A;  3ZGZ A;  5BYS A;  5H92 C;  1TJE A;  2DWQ A;  4N6E B;  2OHF A;  4RCO A;  2H89 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...