1N63A

Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 48
structure length 160
sequence length 160
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n63A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n63A01
4YSYB 2K9XA 3VR9B 3W9CB 5EE3A 5AUIA 2B76B 1ZOYB 1VJKA 2JX5A 3SR6A 3AECB 2DBYA 2LEKA 2MH7A 5H92C 4JX1C 3SFEB 4N6EB 1SF0A 1JQ4A 2L83A 1RM6C 1E7PB 1XLNA 1I7HA 2WDVB 1YJJA 1TKYA 3L4PA 3AM9A 1TJEA 1JW9D 2WU2B 3AE7B 4LTUA 1UWMA 1FXIA 1ROEA 1QT9A 3HVZA 3W5UB 2MJDA 2PVGC 3NVYA 3AE8B 1DOYA 3NVWA 1OQRA 1JROA 1L0VB 4USAA 3AEAB 4WQMA 4KX6B 1DOXA 2G1EA 1XLPA 2MJEA 1XLQA 1FFVA 1N62A 3LXFA 1E10A 1WWTA 3B9JA 4N59A 1E6EB 5EE0A 1PFDA 4YXDB 1L5PA 3FAHA 1AYFA 1NYRA 4US9A 2WQYB 4JWSC 3AN1A 3AH7A 2W3SA 2WP9B 2L52A 3AEBB 3P4SB 5EE9A 3EUB2 1ZUD2 5GXGB 5C2TB 3AEDB 4YSXB 1TKEA 3P1MA 3AV8A 2DWQA 3B2FA 2BS3B 2CJOA 3CWIA 1N5XA 1AWDA 1VLBA 1FMAD 2PVOD 3AE2B 1J7AA 2BS4B 3DWMA 1QOGA 1FXAA 1NI3A 2K5PA 2MJ3A 3AE6B 3VRAB 5C3JB 1PDXA 1QOFA 1DGJA 1TYGB 1NYQA 2FBWB 1N63A 4C7YA 1FRDA 1CJEA 1QOBA 1XO3A 1FRRA 1RYJA 1DOIA 3P4PB 2KAJA 1VDVA 3ZYYX 3AEEB 2QIEB 2W54A 1L6UA 3P4QB 1JWBD 1R7SA 2JQRB 2KMMA 3AB5A 3AE9B 1QF6A 4YTMB 1XLOA 5EE1A 1T3QA 3AE3B 4N58A 2WLBA 1JALA 3SFDB 5MPOA 1FO4A 1NVID 1RWSA 2W55A 3DWGC 4ITKA 2CJNA 1N5WA 1SB3C 1V8CA 1J7CA 5G5GA 1RFKA 4US8A 1J7BA 1YJIA 2H88B 3NVZA 3LB8C 3KWLA 4HROA 2E3TA 3NRZA 5G5HA 3P4RB 2PKOA 1KFYB 3AE5B 2AX5A 3CIRB 3HRDD 3P63A 4HRSA 1L6VA 3AE1B 3FC4A 4YSZB 1WYGA 5H8YE 4FXCA 3HUIA 1FFUA 4A9AA 2WDRB 3NS1A 1IUEA 3B2GA 4YTPB 3WCQA 1FIQA 1OQQA 2M56B 1N60A 1PUTA 1JRPA 2PIAA 3ETRA 4ZHOA 4P6VF 1YQ4B 3AEFB 3VRBB 1ZXIA 1E0ZA 4C80A 2ACZB 1JWAD 2WS3B 4YTNB 3AEGB 3PO0A 2CU3A 2OHFA 1TKGA 4IDIA 1V97A 2BS2B 3W5VB 1B9RA 3AE4B 2HTME 4JWUC 2EKIA 1YQ3B 4ZHPA 2M19A 1F0ZA 2WU5B 1OFFA 1EWYC 2WDQB 4ZOHC 1QLBB 2W3RA 1WXQA 3AMZA 1ZP0B 2BT6A 2K22A 1QOAA 2QJLA 3RPFC 1GAQB 4YT0B 2Q5WD 1WGKA 1GPXA 1SIJA 1N61A 1KF6B 5AUKA 1NENB 1A70A 1NEKB 3BIID 4WWMA 1WRIA 3NVVA 1FM0D 1KRHA 2H89B 3VR8B 4C7ZA 1CZPA 3ABVB 1E9MA 2Y5CA 2N0SB
chains in the Genus database with same CATH superfamily
2QSDA 4Z6CA 5ALIA 4EX7A 2AU0A 3V6JA 3PO4A 4L1BA 4WURA 3S2AA 2VA3A 2LFIA 4FA6A 4OZAA 3WALA 4C8NA 2HBLA 2BVCA 1A76A 2DBYA 3CW2C 2O6VA 1SF0A 1JRUA 5E79U 4R8UA 2RGFA 1Y8RC 4NL9C 2HBMA 4IRCA 4QZDA 3FM9A 1YD8U 3EFCA 2LMCA 2AGQA 2LI5A 4LCDE 4W9KA 3KKAA 4RPZA 2PFQA 1QT9A 1K5OA 3W5UB 3TKAA 4M47A 5ALRA 3UMGA 2EAMA 5E6OA 4USAA 3H4DA 4GLXA 2PI5A 2F1JA 3U30A 1S0MA 2QARB 3TFSA 1JI7A 1P7DA 1E6EB 3EPGA 2KOXA 4RPXA 2MWSB 3IAS1 3AN1A 3BVMA 1RPLA 4QWAA 2ZIUB 1RYUA 1FNWA 3AEBB 3EW9A 4ICUA 4OVVA 4EZJA 3HILA 9ICJA 5BYRA 1YOVB 3R3MA 2BS3B 2Y5BB 2EZYA 4IUMB 4UAUA 1BT0A 5J29A 1FMAD 1LV5A 2WF8A 5AI0A 4QJFB 2NRVA 4FFDA 2E1FA 1VZ8A 3UXOA 1UELA 4N9F4 3WAOA 4RM9A 2ZTCA 4C56C 3TI0A 1MQ2A 1YX6B 1EU3A 3EA6A 3KD3A 1X9MA 4BJQA 5AZGA 3AE9B 3D32A 1WGGA 3APCA 1D5XC 4Y2VA 4DF4A 2LVPA 3A33B 3AE3B 1WY8A 3PSPA 2MBHA 4B9MA 3H8JA 2M1MA 2NS5A 4Z6FA 3JPPA 3TIXA 2W7PA 3RYTA 1N5WA 3AU5A 2DAFA 3PLUA 3JW0X 5C1ZA 1X2IA 2KX3A 4FHJA 2KIVA 3SMVA 5AM1A 1K52A 2JXTA 7ICVA 4EOYA 1Z19A 4I6PA 4JV2A 1JMSA 2K4HA 3GV5B 1QKZA 5T14A 3Q8PB 4DSEA 2V4LA 4KZ0A 4M8NA 2BYFA 1WH3A 5AKKA 2DHZA 4KLQA 2H3QA 1BPYA 3IAM1 2GOLA 4TQ1A 2ZPYA 2VJ4A 4NY0A 4C80A 2ACZB 2KV2A 3M1YA 4B6JA 8ICQA 3NZ3A 4DDID 1TK8A 3F2BA 3MJWA 2DZMA 4F4ZA 1KLNA 4KX5A 2EDUA 4GU2A 3X0WA 1KFSA 2B21A 1QOAA 1UT5A 4EE2A 2FPMA 1R4NI 4B0MA 5KFDA 1PK3A 2D10A 2KQSA 5KHOA 8ICJA 3RRHA 3TAQA 3KZXA 3RJEA 3RJJA 3DDHA 5J2HA 5DG9A 1ZQYA 1ET6A 1BXTA 4I6LB 5GTIU 1YN4A 1JQ4A 3MR5A 2WX0A 5DLFA 2K6DB 2KXJA 2A3VA 3W1YA 2QDFA 4PHDA 2WXFA 1FCCC 1JW9D 2JEFA 4LTUA 4K3CA 3OHAA 1ZPSA 4LZDA 1XS9D 1TVAA 4BXOB 4ICVA 5DPSA 3NVYA 2BCVA 2KN5A 2OXOA 2YY6A 3RZWC 4AYBF 4DFKA 1XLPA 2DYMA 3MR2A 3UIPB 1FFVA 4PS3A 3K4GA 5BO4B 4X57B 4RQ7A 2DNFA 3L13A 3MP9A 2LHEA 2K1FA 3IHQB 2FNJB 5CHGA 1TBEA 4RNAA 5KL8B 1IBXA 1UHUA 4GDLB 4RF0A 3UMCA 2XVTA 2L8JA 4ANWA 1X9SA 2WB1F 4GOCA 3VDZA 4I6NB 3RAQA 2JYTA 2WXGA 1QOGA 4XE0A 4MJSA 3GQCA 1EUVB 9ICOA 1UF0A 1ZQPA 4UBCA 3IV6A 4KLSA 1SV0C 2K8CB 3V6HA 1CK1A 5DDMA 3M95A 3OSNA 1T8EA 2UVWA 9ICUA 2EMSA 4HPPA 2JEGA 1V2YA 3APDA 4RQ6A 1BPDA 2OOBB 4KGRA 5ALQA 4B6WA 5AKZA 1XF5L 5J0QA 4GDLA 3SFDB 5MPOA 1WXAA 5J2BA 2ZCBA 1KLVA 4ITKA 3C2MA 4HXDA 1NOMA 9ICVA 2H3VA 4CF3A 5J0SA 4QZGA 4DL4A 3JPOA 4OJ6A 2BCRA 1E7UA 3AE5B 4HRSA 1V81A 1LQBA 4KN4A 1TFRA 4NQLB 4ED1A 3QJZA 2KHQA 3H0MB 2RRDA 3KQ4A 3E56A 3B2GA 4OCZA 2KDBA 2GLSA 2ZJ5A 4RCOA 1FIQA 2KTRB 4MF2A 1WGHA 2KJRA 4DOCA 2ES6A 4P4MA 2NCNA 4REZA 1BPZA 3PR5B 4WJ3B 8ICMA 3A4SC 4DXAB 4EENA 3ZLZA 3KTQA 4YL8A 4UAWA 2NBUA 3TEWA 3G6VA 2EAPA 4QIWC 3IT4B 5B5EU 3QWZB 1WXSA 7ICLA 4FHKA 1IV8A 2XICA 5AK4A 4ED2A 1U47A 1NJWA 4ED8A 3H7PA 1QZEA 2VZKB 1RFAA 3ENEA 2V4QA 1A70A 4QZ8A 3M6ZA 2C28A 2WXJA 1TV9A 4JV0A 1SE3A 3AI5A 4C7ZA 2W9BB 2XO7A 1F1HA 4YSYB 5AK5A 4KDLB 5JTIA 4J9SA 5L9XA 1JCKB 1I4HA 3AECB 2KC2A 3RI7C 2ALZA 3GFKB 3IG3A 1R4NB 2IO0B 1E7PB 8ICAA 3VTUA 3KHGA 2JZ3B 3L4PA 1M94A 1TK0A 1A77A 3RBEA 5KFHA 2W9MA 2CKHB 1OQRA 3APFA 1NJZA 4KX6B 3RB3A 4B9LA 1RZTA 1N62A 3GILA 1X42A 1P1AA 3JPNA 1UUPA 3RR8A 2NBWB 1WYWB 3SAGA 2E8OA 4LJXA 2WF9A 4M9GA 4DFDA 4E71A 1VD2A 1NDDA 1HXYD 2WGSA 4PGQA 3RH4A 1WGDA 5C2TB 3PMLA 4QZHA 1PGAA 2RLTA 2CN1A 3TEXA 3F53A 2QB0A 3CP8A 1WSPA 2M9NA 4FO6A 3Q3NC 1WRDB 2K8BB 4BKGA 3OHBA 1SV4A 2ASJA 1NI3A 2MBEA 4AYBC 3LYYA 2WXMA 9ICHA 3DVGX 1BPBA 4GC6A 4RQMA 1RAXA 3JPQA 2BKEA 5CJ7A 2KAJA 3Q3OC 3ZYYX 3E9SA 3EFUA 4ECRA 3Q3JA 4MEMA 2J42A 3R9KA 5AHXA 1R7SA 3MGIA 2KMMA 2X38A 4BKTA 3KHHA 5KFEA 4U6PA 5J0XA 1XWLA 4B95A 5DG8A 3GIIA 1IBXB 4IWQA 1FD6A 1U45A 2PMZF 1RWSA 1D8LA 2IOFK 3C1YA 5IN7A 2AQ0A 4KV2A 2JEJA 2C7NB 1UWXA 3OSPA 2IBIB 4DDGD 2O2VB 3QARA 4URKA 5J18A 2D3AA 1ZJNA 1F9JA 2J7QB 1JN3A 2J4XA 4K7WA 3WA0A 1Q10A 5BMHA 2LGSA 1BPEA 1IUEA 2Q4TA 1JX4A 5DBCA 2KYWA 3BS5A 2JZBA 4MFAA 3RFZB 4TURA 1SIFA 2G06A 5DDYA 5KL1B 3HJEA 4O5EA 7ICNA 2VKQA 5J2FA 3ZNID 2W8LA 4HWIB 4IOIE 1OQYA 3W5VB 1ZQXA 3O0FA 2WWZA 2XY5A 1SV0A 2K4EA 5D49A 4PJ0U 2IDYA 4R65A 3GV7B 4X5VA 4DHZB 3K9PB 3C0RB 4W9GA 2KJ9A 3ZTDA 4LZGA 4ELUA 1NK5A 4ARCA 4GSWA 4MM3A 4GB9A 3QYPA 5AUKA 1TT5B 2I38A 2GRIA 2AL3A 2V9HA 4Y2YA 5EE1A 5KFGA 2KEYA 4ELVA 2KWUB 4N58A 4BBNF 5JHAA 2KN4A 1MA7A 3H7SA 3C21A 1Q0WB 4NNJB 2HHQA 4YWGG 1XCTL 4MHVA 2L7RA 5H92C 3WKCA 2HW3A 3SEBA 4JX1C 2GB1A 4N6EB 2L00B 2C2RA 3ONSA 3LYSA 3PR4A 1YMHE 3U7DA 2CHZA 5JH5C 4C4RA 3MC8A 1GC6A 1XCQL 3V6KA 2O6VD 5HHDG 1ROEA 1X40A 1NK7A 2N9PC 3QHTA 3H7PB 4I2IA 1K50A 4PHEA 4M2YA 5J2EA 7ICKA 3LJ3A 5FKAC 1JROA 1S8OA 1L0VB 5AKYA 4WQMA 1XXGA 3B0YA 5AIBA 2IHMA 2BKRB 3QU9A 4KLEA 4YR3A 2BDUA 5D94A 1RYSA 7ICUA 1NK4A 4RQ8A 1SKRA 3VCBA 2HHUA 3MR6A 4DQSA 1H4RA 2D2QA 4MFCA 5J2DA 4W9CA 5D2MB 4IR1A 4KSLC 2DKXA 4OVUA 4ANVA 4YSXB 1HEZE 3VQIA 2J6TA 4OJLA 1ZQIA 2BYVE 2M8SA 3L5KA 5JRTA 5J2IA 5J2JA 4DFMA 2PVOD 1V85A 4XC2A 3AE6B 3RNCC 2F2AB 4FN2A 4JE3B 4J03A 2MRPA 4F92B 2MUTB 3D2QA 4UAZA 1HTQA 1S3SG 4Q43A 2ZZPB 1D4BA 2JT4B 2WB1C 3DVNU 4EEKA 4ACOA 2AQ2B 5AKEA 5C23A 2MCNB 1ZQNA 2OEHA 4RM8A 4FADA 3GDXA 1U9LA 3EHVA 1WXVA 2KX0A 2WLBA 4EFOA 4DSIA 1QQRA 2KACA 1JWSD 1ZD4A 4JPSA 5ALWA 2LGDA 4GDKA 1UA0A 4WJOA 4C4TA 2D3DA 2BB5A 2K8BA 3DBRI 4OO1J 4F4KA 3QX7A 4QWEA 4YFKA 1LM8B 4UARA 2AX5A 2ZW1A 1LB2B 2HHXA 3Q8FA 5ALHA 4XQ8A 3RJKA 2EZXA 5L1MA 1LGRA 5GMVA 2VIXA 4GFJA 2D8CA 1NK8A 7ICHA 4KVGB 4UDUC 2RR9A 3NS8A 1JWUD 1DK2A 2NO5A 3Q8LA 3I9V1 3IDWA 5TZVA 4MFFA 1B22A 1WX9A 2H3IA 1D9DA 2LWPA 4ECWA 2W82A 3HK0A 2R8IA 2INNE 5AK6A 2KVZA 3AULA 3PT2B 5HKHA 1X1MA 3GE8C 5IIJA 5IILA 2WU5B 3DHIC 4CHKA 1FXTB 3R66C 2IYDB 4JQWC 1TK5A 1L0XB 1N61A 2IGDA 3V3XA 3T3FA 3Q8EA 2B6GA 2QARA 5ALLA 2F1IA 3PO5A 4O1NA 3RR7A 2E6XA 1JXEA 4J3OD 2JZBB 2K9XA 3OTQA 3BY4B 2XCPA 4YG2A 1GO3F 2A5UA 1ZQKA 5A0LA 2ATLA 1M6YA 5DB8A 3M7DA 2NRWA 2KTQA 4KIKB 2WHEA 4P0QA 2C22A 3PSFA 2KLCA 4BWJA 2A19A 4W9EA 4YP3A 2NVUI 4EKUA 2A1JA 2K3UA 2XK5B 5AK3A 2FLPA 4ANUA 2ZUBA 3HVZA 3VHTC 1F2RI 3FYHA 2L0FA 2KMCA 2MP2A 5IOIA 1C79A 4MELA 4MM3B 3PX6A 2QILA 2OEDA 3QQ8B 3GV8B 2ZNVB 3HKZF 2BB6A 2FIFA 3UM9A 4Y2JA 1PGXA 1MG8A 3H8HA 3RFAA 1XU4A 4BKSD 1HJPA 3KYDD 3DBRB 2ZW0A 3F2DA 4IWPA 1TS5A 4C4VA 1BNOA 3ISBA 3RJIA 2WP9B 3MHZA 4A90A 4KIKA 4LNFA 5HNKA 1ZQAA 2FUG1 3IFWB 1NK6A 3ZVVA 4O3PA 4ECUA 4KLFA 2I5HA 5KFCA 2XK5A 5KFVA 1J19A 3DHGC 2VANA 1ZD3A 4J9NA 2MJ3A 4AJYB 1Z3EB 3MGVA 1TYGB 2MEKA 5KFQA 3OGUA 4F5NA 5F9LA 2PW9A 3ZQ4A 3RF9A 4M9LA 1K51A 2KTRA 2D11A 3BINA 4DFPA 3AEEB 2EMTA 3PZPA 3Q14C 2PKEA 1UGMA 2D07B 5E6PA 2YMPA 4AJWA 4B0EA 2JZZA 1OEYJ 1FO4A 1YZ6A 4TMAB 2V1YA 4KN7A 1F0MA 2H88B 2KOBA 1UZXB 2FAZA 4EZ9A 4JWMA 2JZPA 1M4VA 3SI8A 2KDEB 4DBGA 1IPGA 1AW7A 3PRMB 4L2YA 3AE1B 3TJPA 1WFYA 3UGBB 4UB2A 9ICGA 1VRAB 2BKFA 2DYOA 4OZBA 3SAHA 2GH1A 4YTPB 2L3ZA 1LKYB 4PGXA 4KLIA 2KNBA 7ICFA 1TY2A 3N7PD 5ALKA 1ZKHA 1JRPA 1EWCA 5KFYA 5KFZA 3A9KB 3ZKJC 4K4GA 4YD1A 2IY1B 2G5IB 5KG0A 2RHFA 3TMPB 2J6UA 2ZEQA 3AE4B 3ZNHB 3BJYA 2FE8A 2C9WB 1L3UA 1V1PB 1ZDXA 4W9JA 3HIZA 4WWOA 2I2YA 4FZNA 3ZNGC 4KMOB 5J2AA 5BPCA 4JB3A 1WGKA 4ECSA 4RFBA 2HE7A 1J2NA 2ASLA 1HZ6A 2INDC 4I2HA 3TCAA 3KBBA 3UI3A 1FM0D 5EOZA 1EU4A 3PZ7A 2RD0A 2JF5A 3ZTCA 2IO1B 4ECXA 5ALOA 2KNJA 4XX5A 4FZLA 1WX8A 3VAWA 2JWZA 2K39A 2I1QA 3C19A 4Y2SA 1LVHA 1MQ3A 4F8RA 4UASA 5AKGA 5DBBA 3SQIA 1TKYA 4EX6A 1ESFA 1YN3A 3SD5A 4KLUA 4IQUA 1C77A 4PPXA 4YXMA 3GIKA 3K1ZA 2PVGC 2KMDA 2LPEA 4A55A 2XBBC 2KVRA 4AP9A 2MJEA 2J52A 3OG5A 2BF8B 4RGMA 3UMBA 2UVRA 2XEWA 4ZH4A 2LXCA 2UYZB 3V72A 4GXIA 3PW7A 1ZQOA 4IG7B 1T94A 5H2FU 1Z4NA 3DHHC 3KHRA 2MW5A 4GXKA 2JEIA 3OLMD 3HWTA 2O2VA 2QKQA 3J81j 4NLBA 2PJHA 2GMIC 2MRLA 2HDOA 2BS4B 2R8JA 3LVWA 1WF9A 1DGJA 4DXGA 1SL0A 4L23A 4Q2JA 2G09A 3QK0A 2KZRA 1SBBB 2YX8A 3PW0A 4EEYA 2KDMA 3DVGY 4UATA 2GI9A 4XRHA 9ICRA 3AB5A 3GP7A 4YTMB 1TIFA 4CQNA 2Y5PA 3BVGA 7ICIA 1N48A 4DLGA 5AIAA 3VTWA 2B3AA 2LMRA 3ZDBA 1TKDA 1ZQEA 1F5SA 1WJ6A 2BQQA 4CYEA 3KZIU 5J17A 3UF8A 1KFYB 3ZXVA 4C00A 4A8XC 5DB9A 2WYQA 4NJCA 3ZD9A 5BOMA 2BPGA 4NLKA 3ZDAA 3WCQA 2BPSA 4QNLA 4EBDA 3Q6BA 3IG5A 3UPQA 2PIAA 2BBCA 3N3KB 1B0XA 3ZGZA 2WXHA 1PK1B 1TAQA 3P42A 3ISCA 5DPWA 2KFNA 2CS4A 3N1YC 2L1AA 1D8BA 2QMTA 4F5PA 3O13A 4II3B 2ZJAA 1ZQDA 2WDQB 5IO9A 3LVVA 1ENFA 2QJLA 1WWUA 4KLOA 1J2MA 2Q5WD 2KFJA 1S1QB 2KHVA 4I28A 4G0NB 4JGHB 4F91B 5ALMA 5D3DA 4NLNA 2IOHA 1ZYQA 9ICTA 2MBOA 5ALYA 1LXDA 2C5LC 2KKCA 2J6SA 2B76B 2MLBA 1XD3B 2CU1A 1UD7A 2L83A 2KICA 2W9AA 3FILA 1P9DU 1ECWA 4C0ZA 1TZ1A 1S0NA 3AM9A 2KFKB 3CSFA 4DS4A 2BTEA 3HHMA 3NUHB 4EEWA 9ICCA 4A8EA 4DSKA 3CNHA 1Q46A 2LYAA 3VH3B 5AKLA 5KG4A 3UQBA 1DOXA 3IXSA 4ED3A 4R64A 4DQRA 2BDPA 9ICSA 2W9BA 2DX5B 2MAXA 3A1QA 4KDIC 1MI0A 2P66A 4ECQA 1T0RC 2N7JA 4KKIA 2G4SA 4C8LA 3BVZA 5ALGA 2AWTA 4TV3A 5BMIA 3SZ2A 5EE9A 2X8XX 1Z00A 4ZRJA 2DWQA 4NV0A 3MJ5A 3M8SA 1YQBA 1L0YB 3K9OB 4DQQA 4OJ5A 1VZ7A 3PSTA 1UBQA 2OJWA 1WWVA 2LHDA 3ETLA 4BDPA 4MSQB 1N2XA 1C3TA 5HMMA 4RPYA 2GOWA 2LGYA 5JXVA 1N56A 3TANA 1RYJA 9ICNA 4WJPA 2FCNA 5AKHA 3Q8MA 2ZJDA 5L1LA 2LJIA 3QU4A 1RXWA 3KFUF 1T3QA 1UPHA 1RG6A 2DZIA 3VUXA 4DQOC 2W55A 2PFPA 1ZRNA 5D7GA 4ECVA 3AQFA 3L3FX 1R4MI 1C1YB 2DF4B 2INCC 5KG3A 3KWLA 4QIWF 3HRDD 5DQHA 4F5QA 3KUDB 4MJSB 3V05A 1OW5A 3V7LA 2F3NA 5DB7A 4YR0A 2EELA 5AKJA 1COOA 5CHFA 4RUCA 2JVCA 2HJ1A 2ISPA 4FLHA 3M62B 2R2OA 2Y0SC 4E3CA 1XEEA 2Y9UA 4QWDA 1PUTA 2E5SA 1KW4A 1E0ZA 1VJ5A 4UW9A 2O6VB 3AEGB 1FPYA 1TKGA 3EZ5A 1C7YA 3PSIA 2RDIA 3PHWB 2ZTEA 2F8KA 1XQQA 5HFYA 1DRGA 2I1JA 5FR3A 5KFTA 1L5UA 2KTFA 2KG5A 2ON8A 3SYZA 1Z4OA 2GO7A 5KG5A 1JWMD 2W3RA 2W9CB 2MBBB 2VH1A 3N32A 1GJZA 2AQ1B 3F2CA 4YT0B 1SIJA 4IM0A 5CHWA 3PMNA 2YMMA 4P0PA 1ZXHA 4LLGM 1MSWD 3I5JC 3ISDA 3VR8B 1CZPA 4HCPB 1PUZA 1UGJA 2JSVX 2RDBC 2KSOB 3BQTA 3VRAB 2DZKA 3CMMB 4KGTA 1ZD5A 4HYKA 5T8IA 4HPMB 5AI4A 3ZDCA 8ICVA 3RB0A 1I7HA 5DGAA 5D4BA 2XN9C 5DLGA 2BYEA 3RH5A 4DHJB 1T3NA 4F2SA 4PH5A 5CEHA 1ZQZA 4A3PA 4F3OA 4NWIA 2JRHA 2G4DB 2MJDA 4LNOA 4KLMA 3N1XC 3NVWA 4QZ9A 4GIVA 4FJVB 3H0LB 1KOTA 4RF1A 8ICOA 3LXFA 4B9SA 2NTSA 5EE0A 2HVIA 9ICBA 2YB1A 4O3NA 1NK9A 3FAHA 4DOBA 1XSLA 1L6NA 1KSPA 2CXYA 1BVSA 2G0AA 2DUYA 3N28A 4DOAA 3EUB2 5KG2A 1P7EA 1XSPA 2F8LA 4MF8A 3DV9A 2PMVA 2KIWA 1OTRB 3I3TB 1HQRD 5LXIB 4HDOA 4Y2XA 4FS1A 3DWMA 5KFRA 4EBCA 1KKXA 5C3JB 4ZRQA 3QU2A 1SWVA 5CRXA 3K1RB 1PDXA 3ML8A 2FBWB 2F44A 1TS4A 3NUQA 1B4FA 2JUOA 3PREA 4IRDA 1CJEA 3H1UA 3A1QB 2EANA 1NI2A 5ALFA 5CA7A 5KFPA 2WF7A 1VDVA 2ZUCA 4K4HA 3C28A 4F50A 3HPOA 1QF6A 2LM1A 2IPKD 2HCFA 3N4MB 1X6JA 2IZVB 1V9PA 2L76A 1RRBA 2M4NA 2VH2A 1AROP 3T79A 4LJPB 3RB6A 2H5XA 1V8CA 2ASDA 3TEYA 3M9OB 2LHTA 4GXJA 3T5HA 1V5TA 3P4RB 3W9CB 4M9HA 3GIMA 4FS2A 3VXWA 5LLIA 3QEBZ 5IIIA 3DDCB 5ALEA 3PRPB 2WXOA 5J0OA 4EZKA 1IYFA 1RXVA 3N97B 4DHZE 2HBKA 4RT2A 5AI5A 1KBUA 3A4RA 3A0HU 4Y2TA 1SE9A 9ICAA 4NLCA 3ED5A 3NASA 1KRPA 1S76D 1V6EA 4QZFA 2MU2A 3G6YA 2HTME 1XC9A 1RQLA 3PV8A 1EWYC 1SGGA 1U48A 3WANA 1L8OA 4ECTA 2BT6A 2QLTA 1QILA 3MC1A 2G9HD 4C8OA 1GPXA 1QTMA 1WZ3A 3ZJTA 5K4LA 4PK1A 2ONQA 2FJ6A 1KEJA 2H89B 3PZDA 2HOQA 2N0SB 1ZW7A 2UVUA 2KDIA 2VZKD 3N1ZC 4I29A 3PZ8A 7ICPA 1L7NA 1UNSA 1ZOYB 4GN1A 4KX3A 1J97A 2GBJA 1R4MB 3P2BA 2XC9A 4G11A 1F44A 4B9TA 5JZEB 3TARA 2EZZA 2RP5A 1T7PA 4NM1A 4ZRIA 3H8WA 4NAMA 1SXTA 2JMGA 1UWMA 3RJFA 2HHVA 1SE2A 3U2SC 3IG8A 1TS3A 4R3DA 2WXKA 8ICGA 3QUBA 2SAKA 2YEPF 5HR7A 2OM6A 1WWTA 3B9JA 3JPTA 3RB4A 3HW8A 4NL9A 5KFJA 1G6JA 2W43A 1N6ZA 4US9A 1I4QA 2KZ3A 2ZXIA 4TQRA 1WR6E 5KFUA 3NZSA 1KL9A 5KG6A 4CNQA 1MHHE 3RT3B 3PLVA 2KJHB 2RMMA 4MT5A 3QZ8A 4UB6U 2NPTB 4BAXA 2HD5B 4NJ6A 1KFDA 4RT3A 2CJOA 4P4OA 5KFXA 4NZLB 4M0WB 1OEYA 5CX3A 2C2EA 3HM6X 4YCXA 5KT6A 2V3SA 3TAPA 4UAYA 1TY0A 2Y3AA 3R7QA 1I42A 3EECA 4R66A 3GZNI 2I6XA 4HJKA 1N63A 2K60A 2LBOA 2H3ZA 1QOBA 4P1BC 3ZI4A 4KITB 2PMZC 1CUKA 8ICLA 2WXNA 2Y9TA 2XI9A 5HI1A 4HLEA 1WCLA 4YMOA 4BGDA 5D46A 1XLOA 1RQNA 3CF6E 3DBLB 2J53A 2HHSA 1JALA 4ZRPA 4WJNA 4KMUA 1GOZA 4CDGA 4CRXA 1ZQQA 4ZRKA 3HX0A 2JHDA 2L05A 3H0RB 4M01A 3VH4B 4WIPA 1CMXB 5KFOA 3KVFB 2KZZA 3BQ0A 3S6JA 3KW5B 3MC9A 1XO0A 3N20C 3PHXB 1WYGA 4KLDA 3HUIA 2AH5A 2PFOA 2KO3A 1C78A 1ZOLA 3CYMA 4DFJA 5C0YA 1OQQA 1F2RC 5ALJA 3H40A 3QU7A 5KNIA 3AEFB 3CSTA 5AM3A 5CTRC 3MABA 4J9PA 5KFSA 1KN5A 2KMAA 1WMHB 4GC7A 4PYZA 4CCHA 2EKIA 7ICRA 3M3JA 3D2NA 1SKSA 5BYQA 1Q8KA 1TS2A 1WXQA 2HDEA 5JUMA 2UWQA 4I2GA 3T5JA 4J9RA 4XGAB 3PPAA 5EWEA 3G6XA 4UB5A 1ZJMA 4IWOA 2KJ5A 2YQEA 4UB3A 1S0VA 1LKYA 4AS1A 4N59A 2PI4A 1KM7A 3VC8A 1ZQJA 2QCZA 2DFLA 2JXJA 3R8BA 1QSYA 2JX5A 1Q3UA 1GUAB 3I28A 2MH7A 3GOEA 4LVSA 4Z6EA 4KLTA 4HVBA 3DOWA 1WMHA 3RJHA 5F9NA 2KD0A 1BGXT 3HVDA 2Y1JA 4E74A 2AGPA 5L1JA 1UCVA 4IC7B 1EO6A 4EBEA 4G3XB 4OHJA 4BX9C 4XA5A 2KWVB 1FNVA 4FZMA 3WKAA 3BQ1A 2NBVB 3AE8B 3WKDA 4MEYA 4DO9A 2G1EA 2IO3B 2BWFA 2LRWA 3SV4A 1MFWA 1NBFC 2BQUA 4W9LA 1XT9B 1E10A 4IW0A 4M6WA 1FEZA 1WJ4A 2KFZA 2NO4A 2WFAA 2D5GA 2K8CA 4PL1A 3OPXA 2DGZA 5KFBA 4ECYA 1OUQA 1UH6A 4K3BA 3HP6A 1AARA 1JIHA 3L17A 4MGIE 4ED0A 2YB4A 9ICMA 3LDZE 1S10A 3MR3A 3Q69A 2R8GA 3KLSX 2BQRA 4E0DA 4P0QB 3JVZX 4NPNA 4DXFA 3C2LA 1D8YA 4MGZE 4YMNA 1URJA 3HT3A 5HMLA 1N5XA 4ECZA 4C8MA 1VLBA 2LZ6A 3QU5A 4RQ1A 2K8HA 3RNAC 4KZCA 2IGHA 2K5PA 2GBMA 2FMQA 1YX5B 4KSKC 4BUGA 3Q8QB 5J2KA 3PW4A 8ICYA 2GBKA 3ZRFA 1FNUA 1ZQRA 3C23A 8ICNA 1WGYA 2XIDA 2P35A 3NG0A 3T3OA 1KQQA 3UQ0A 3BDPA 5ALNA 4MDKE 4RQ5A 4W9HA 4UBBA 1F52A 4I2JA 3PNCA 2CHXA 1V1OA 4AWJA 1PK1A 4GLSC 4F4YA 1NVID 4PYUA 5LXHA 3DWGC 2KK8A 1D5ZC 3UXPA 4J9MA 4R63A 2FCMA 1J7CA 2JXXA 2N9KA 1YJIA 2ZPNA 4M0WA 3GB1A 2E3TA 2W9CA 3IRUA 2GWSA 3QXGA 2W7OA 3ZDDA 3Q2AC 3FC4A 4YSZB 4J9LA 5H8YE 4FE3A 4FXCA 2AXTU 4BFRA 2WDRB 4HJGE 3LWMA 5B66U 4DSLA 2M56B 3MDCA 3V60A 1U4BA 2KC1A 8ICSA 4IQTA 7ICEA 3D6JA 2WAQC 4GGQA 5KFIA 2DKZA 2CU3A 1E8YA 5J0WA 2R61A 1V97A 2AEHA 1D9FA 2LYBA 4RUAA 2QEJC 5L1IA 4D2KA 4MEXA 1F0ZA 2BR0A 3SU8X 3OAWA 1WCNA 3PSEB 3V6CB 4ARIA 4YR2A 3PGEA 4TQSA 4DCCA 1I4XA 2KK0A 2JWUA 5J0PA 2AQ3B 2JRIB 2K4PA 3NY5A 4QAYA 5IA7A 3A9KA 4WWNA 2W03A 3SR6A 4AP4C 4II2B 2KJ8A 3PX0A 4DF8A 3MDAA 1T0QC 5AM4A 4RNNA 1CRXA 1ZE3D 4DSJA 4C4SA 1NJYA 3M9MB 1A0PA 2HJ8A 4HKQA 2XY6A 2HTHA 5AZFA 1C4CA 3OJUA 4IQVA 1L3SA 3QUCA 2D3CA 3SHQA 3KUZA 2BGWA 2LJ5A 2MA1A 3FDSA 3WK4A 1SGHA 3UXNA 2HBJA 4KGSA 4LJOB 3L54A 4TQ0A 4HEA1 4W9IA 4KTQA 3DBHB 5TISU 4YXDB 3QC8B 2BPCA 1L7MA 2ZVNA 2DAJA 1T6BX 2L52A 3PV1A 5BMGA 2WF5A 1X6IA 2C7MB 1ZUD2 2W11A 4UB1A 1TKEA 1WR1A 3P1MA 5FR6A 4JMUA 1X9WA 5I4DA 3OJ3A 2N9EB 4GDKB 2NTTA 3KYCD 3Q8SB 3WU2U 1J7AA 1FXAA 2FCSA 3QCAA 4OJOA 1GB4A 1KJTA 2W04A 2BWES 1PVQA 2UVVA 2C2DA 3Q8KA 4GIBA 2WNMA 5J2GA 8ICKA 1AN8A 3TL5A 1QLNA 4RNMA 4M02A 1YN5A 4JK1A 3P4QB 3R2TA 2NRXA 2ZIVA 2JQRB 1KLGD 4U7CA 1UBIA 4QZIA 1ISNA 4IKGA 1TAUA 1WIAA 3TQ1A 5KT7A 2JH1A 4HKZE 4EZ6A 1TTNA 4J9KA 1MC8A 1SXDA 1XNSA 1KLUD 4NQKE 1KDHA 3TACB 2Z7JA 5AM2A 1IGDA 3N30A 3W1SC 3T8MA 2R2QA 4ZDVA 1RFKA 1HA5A 3NVZA 1ZQWA 3NRZA 3H8SA 4ICAA 2PKOA 1SXEA 3KH0A 4KLHA 2KJ6A 5KT5A 3VVWB 4DQIA 1FFUA 5ALZA 4OZCA 2IHNA 3K75D 1V9JA 2QHOA 2Z0EB 4DL2A 1H38A 4CE6A 2WTFA 2K0PA 4ACFA 4Y2PA 3NGDA 3WKBA 2DQNB 2DPIA 3MHSD 4RMAA 3M9NB 3KWVA 4DLEA 1MJDA 3BYTB 2K6QA 1RDFA 3W2DA 3RD2A 2FMSA 2INPE 3AEVA 8ICXA 3M8RA 5EDSA 5KG1A 1J8CA 1ZQVA 3WK9A 4DEZA 1PYWD 3NRWA 3EC8A 4O3SA 1B9RA 1WM2A 1KTKA 4FBUA 4AQ7A 2BHNA 4Q8EA 1NK0A 1PZNA 4F5RA 4ZHPA 3A0BU 2ZUDA 3B0XA 3ALBA 3AMZA 4RQNA 2R8HA 3RTVA 2MP2B 3I76A 3TSSA 2DPJA 4O5CA 1E90A 3BIID 1NZPA 4QZAA 1EF5A 2OWOA 5G2NA 3ZIMA 3BQ7A 3DEEA 3QUTA 2MX2A 2OJRA 3I1YA 5HHIA 3SDLC 2BW2A 5DPTA 5EE3A 1S97A 3RNGC 2ZIUA 1L3TA 3TEZA 2WXRA 2WDTB 8ICUA 4DQPA 1WX7A 2PEAA 2YTUA 3H7IA 2JPHA 2WU2B 2VA8A 4RQ0A 4EELA 4RU9A 2NV3A 1MG4A 4K7SA 5E6NA 4B9KA 3T9LA 3X23A 1SKWA 1Z5SB 5AICA 1DOYA 1Z1VA 2HSZA 9ICEA 3ALRA 3MGHA 2BQ3A 1V80A 3B0AA 4RH6A 2MUTA 4DWFA 4OW0A 5HG2A 4BZAA 2CHWA 5KG7A 1PFDA 2BYTA 2NYVA 3M6KA 1V86A 3PW5A 1AYFA 2IOFA 4CO7A 2KP7A 2EAOA 4ELTA 2KSOA 2BCSA 1HTOA 1XO1A 2W8KA 1STEA 3QX1A 4GMVA 4F93B 4TUQA 3EWAA 1JUDA 3AEDB 5KAFU 1YT3A 2AJQA 9ICKA 9ICIA 1ZQHA 1IXRA 1HZ5A 5DKWA 4J9OA 3CWIA 2P6RA 3ICXA 5ALUA 1D5MC 1AWDA 2IA6A 1A5RA 4DHJD 1ZQMA 3V61A 5IIKA 3AU4A 1D3ZA 2JY6A 2FPLA 4Q44A 1FRRA 3WAPA 3P4PB 4HPLB 4NAWB 1SL2A 2QIEB 1L6UA 1JWBD 4OD0A 4DL5A 3AXCA 3N7RC 4FJYA 5LNK1 4YVZA 2GBNA 2CR5A 1Z00B 3RNEC 3R2IA 2Z8LA 2NR2A 2CJNA 2K89A 5G5GA 3H9DA 3LB8C 2LYHA 5KT4A 1DOQA 4NLGA 2OCEA 1FEHA 2WX1A 2WAQF 3MC0B 3P63A 3V62A 1ZQSA 3Q8AA 1COKA 5DG7A 3BYYB 4HK2A 1E8WA 8ICPA 3I57A 1SL1A 2Q0ZX 3SAFA 4MH8A 4IM3A 2CPRA 4RQ4A 3RUIB 1L2NA 1N60A 1ZETA 2FLLA 5AEKB 1ZQGA 3GZFA 4KLLA 3V6EB 2OH2A 1ZGUB 2WS3B 5BOLA 2V3NA 1X9XA 3NOBA 1RLFA 2FMPA 3IT6B 2VA2A 4WWPA 4G9BA 2ZIWB 3KUCB 1QSLA 3IP4B 1E7VA 3LK9A 2R8KA 3PTFC 1ZP0B 3ZW3A 1S5LU 1T5XD 1SZPA 3RPFC 4ASWC 3N9YC 3LDAA 1KF6B 2YVCA 3OJSA 5J8YA 3NVVA 2J0MA 2JRZA 3W1SA 1V5OA 4S17A 4A20A 3UIOB 5TSSA 3L10B 5AM5A 4EYHB 5G55A 2XGQA 4AOFA 4Y2QA 3BWUD 1WJNA 1I35A 1Z2MA 3WAMA 2VRRB 3SFEB 5DQIA 2ZXHA 2LEKA 4BOZB 3TADC 4EZLA 1Y88A 3ZD8A 3ZRCA 1ZRMA 1ZDVA 3D2SA 1K8RB 2ZG6A 2I1KA 3JPRA 1LO5D 1YJJA 3L08A 3OJ4B 4DS5A 1EF1A 2PXIA 2WHIA 4WAAA 2KWDA 5AI8A 1SZHA 3ZDEA 1C4PA 2JH7A 2K8AA 8ICFA 1D6EC 1WE7A 1L3VA 3ECIA 3PW2A 3QNMA 1SJHD 1XLQA 3B08A 2A1AA 2XGPA 3SV3A 1JMLA 4ED7A 1OXJA 8ICBA 5L83A 1GB1A 4ZYSA 2WQYB 1S77D 5FK9C 5L95C 4DK5A 2PFNA 4EUTA 1Q5WB 2YLMA 2KHWB 2E8NA 1B1ZA 1IM4A 3AV8A 3ZNZB 3Q3FA 1PVPA 2WXQA 1Q3VA 2WXIA 2AQ4A 7ICJA 2B0CA 4XWWA 4JV1A 2FDRA 9ICQA 1PQSA 1YJ1A 3BK1A 4Q45A 1EM7A 3ZUNA 3EPIA 2REXA 2BCUA 5C5JA 1AQ6A 4C7YA 4NLZA 5KT2A 4QZEA 3C5FA 2KN7A 4KKJA 2N1RA 1HUZA 1L4DB 3ORYA 4F5OA 2HOFA 2EH9A 1L7OA 2XCAA 1NKEA 2LUEA 4IL6U 3U26A 9ICXA 2N7DA 2NPTA 1X66A 8ICZA 1TZOA 2KT7A 2G5HB 1BNPA 1SE4A 4US8A 4F1SA 1T0SC 2M0XA 3BZDB 2RDHA 4JL9A 3QIJA 5G5HA 4F71A 4XZ4A 4JWNA 3H4BA 3NTUA 3VFKA 1ED1A 4DL3A 2BZFA 1Z1BA 4TSSA 4P7IA 1MVKA 3Q8CA 2M0NA 4K4IA 7ICTA 9ICWA 3WK6A 4CF4A 1GC7A 1BPXA 1O08A 8ICEA 3A9JA 3ZJUA 2R18A 1Y56A 4P6VF 1YQ4B 3QAQA 2GLEA 1ZXIA 3GU3A 4ZHOA 4M0AA 2D3BA 4YTNB 3PO0A 4NM2A 4CGZA 4PHPA 3FILB 3OWEB 2BS2B 4LDTB 1NNLA 4PL2A 2WXLA 1YQ3B 4IQWA 2CRXA 2FCQA 2KFKA 2HHTA 1QLBB 2PLPA 2N9XA 2AYOB 2GBRA 3PVLA 1ZQCA 5DGBA 1NEKB 2MHJA 3UQAA 2RSUA 4J9QA 1GG3A 1WE6A 5E6JA 3ABVB 2Y5CA 2ZCCA 7ICMA 3EGRA 2ODGA 1L7PA 2W9NA 4O3MA 3EYZA 3QA8A 5AUIA 1VJKA 2N1VA 2LXAA 3VUYA 2RDGA 3RN9C 1XLNA 1DYQA 1J0GA 2QB0B 3ZO5B 4K1RB 5L1KA 2LASA 3RJGA 1IGCA 4LK0M 1ZQ1C 2AHOB 1OGWA 4P4PA 4MACA 1NKCA 1T0YA 3C2KA 1MN8A 3ONNA 4IM2A 1A6SA 3Q8RB 5DPRA 2A4ZA 2BPFA 2JU6X 3TFRA 8ICTA 2PTLA 1I4RA 1E8ZA 4DL7A 2D6FC 2PE9A 4HDQA 4F7ZA 3RRGA 3DPDA 4MSMB 3ZXRA 1S0OA 2G08A 5DBAA 2N7EA 4RQ3A 4DSFA 2O6KA 1UQVA 1T4GA 5J8YC 4R8UB 1IIPA 1C76A 1VZ6A 1WGRA 2KWCA 5D3IB 2NRTA 3QZ7A 5BYSA 2JR5A 1SEBD 2JYEA 4HCNB 4K81A 4P16A 4RQ2A 2Y1IA 1L7YA 4C8KA 2QC8A 1KTQA 4IC9A 2L32A 3QEAZ 1DGSA 3AU2A 4OVZA 4AUQC 1K1SA 4XUSA 4I27A 2N4FA 2LD9A 1ZQUA 1XO3A 4PS7A 2NRZA 3BQ2A 1DOIA 2C7HA 3RNBC 1ZQBA 4M6WB 3RZFA 3UINB 3L0WB 2IMWP 4IS7A 1GNUA 1WM3A 3R7RA 2ZIXA 4QZBA 1CI4A 1ET9A 2M17A 1CEZA 5AKXA 4B9VA 4Y2UA 2ZJ8A 4YXJA 1NKBA 5ALDA 1ZQTA 4HAIA 4YQWA 1SB3C 3IHPC 3HKZC 4O5KA 2Z0DB 1WXMA 2ZTDA 3AL0B 5CWRA 3CIRB 4TUPA 4A9AA 4XWTA 1O03A 4M9NA 2WF6A 2RDJA 2JGAA 4RGTA 3WK5A 1V49A 1QH9A 1JXLA 3HM3A 3BZKA 2L5YA 4WJQA 4M04A 3NHEB 2KZMA 1HIWA 4OJPA 4B9NA 4I2DA 5ALTA 3RNFC 3T5LA 3TBLD 3IM1A 3WKEA 5DB6A 2VJ5A 4K7UA 2DENB 3QUQA 3Q3MC 5KTQA 1NZBA 4ZYNA 4JLCA 8ICIA 2FPKA 2OYYA 1OFFA 2IY0B 1YZ7A 5CHVC 2E8PA 4ZOHC 2M0AA 2HOIA 2K22A 2KKPA 3RULA 1WI0A 5ALXA 1HUOA 4LDTD 1NENB 2EKEC 1BUIC 1WRIA 1WG8A 1KRHA 1ZQLA 8ICHA 3JSVA 1QQ6A 5KFMA 3T5KA 2KQ7A 4TUUA 3A9JB 2LRUA 7ICGA 1QSSA 1P7FA 3BS7A 1QQ5A 4P1CC 1PGBA 4S0RA 3J9CA 4A6QA 2FLNA 7ICOA 5ALVA 2J0KA 1RM6C 2RQ5A 3MFHA 5GTHU 4QWCA 2FE9A 2KKVA 3DBLI 3FKYA 2AGOA 3U7ZA 4BVUC 4QW9A 4MH0E 1TJEA 2Y0SF 4P2HA 1V1PA 3AE7B 3BK2A 1ACCA 3U52E 3LWLA 2BCQA 4B9UA 1MPEA 2PE6B 3PRZA 3RMKC 5J0TA 4Z6DA 5HP4A 2ESEA 3H6NA 1ZD2P 3GZNB 4O9MA 1F77A 4H2AA 5D6JB 4WAFA 4BKSA 1U49A 2J0JA 2DLBA 2RPVA 3ML9A 3SENA 4NXZA 2YEPB 4EYIB 1NYRA 4UAVA 2ISOA 2ZIVB 2AL6A 3AH7A 2W3SA 2KVSA 3B1LX 2XNAC 1E5WA 3P4SB 3E0FA 2SEBD 4PS8A 5KHQA 2MQJA 2V3PA 2LI6A 5AZHA 1TAMA 4KLGA 2XY7A 3QE9Y 3MFGA 2L0TA 4Y2RA 1K53A 4PZOA 2WXPA 5JU5A 3WIMA 1UA1A 2ZVOA 5IIMA 4BXOA 4F72A 5KFNA 4QWBA 4JUZA 3PVXA 1U4AA 2LGIA 2FI1A 2BGFA 3VTVA 2G07A 4UQGA 1NYQA 4GXBA 4W9DA 2MBQA 1DK3A 4O3OA 3IBEA 4J6IA 4I2AA 2V9WA 2W54A 3SEIA 1HE8A 3GIJA 5J0RA 4DWIA 4IRKA 2HI0A 1QQ7A 4Q8FA 2QB1A 2G45B 2KLGA 4FJZA 3L16A 2E1EA 3C5GA 3U4EG 2ZIWA 5CP2A 4RZRA 1J7BA 4G3IA 4G50A 4HROA 3Q8BA 1P0RA 1SSNA 1L6VA 5FP0A 3E2EA 1IG6A 8ICRA 2IJ0A 4P0PB 2F1HA 4M9JA 2DZJA 2UU7A 3NS1A 5KT3A 1S9FA 3JPSA 2K4IA 3AU6A 4WQOB 1Q1OA 3ZJVA 2F77X 2PPHA 1FCLA 3KKAC 3RAXA 3VRBB 2G3QB 2YMLA 4I2BA 1V38A 9ICPA 2ZIXB 3THVA 1C9FA 4MGKE 3DCGA 2OHFA 7ICSA 4I2FA 5IINA 4XYCA 1C4AA 2YMQA 5CB1A 2HHWA 3BZCA 2NMQA 3DQVA 3O65B 1DXSA 5J2CA 4W9FA 4JWUC 3GE3C 4F4XA 5IAAC 3KOOA 2K25A 4NJ7A 4A3OA 4YMMA 2JV3A 1UT8A 1VCBA 2KD1A 1GAQB 1QCKA 2FIDA 4MGYE 5KAIU 3V7KA 1VR9A 2KDFB 2LVOA 4WWMA 1P3QU 3PY8A 2I9GA 1K1QA 3VR9B 3ZDMC 4BOSC 4FBJB 4C4VB 2MSED 4O0IA 1WJUA 1TE2A 4PGYA 5J2RA 3GS2A 1MHXA 4TUSA 2LKYA 3WK7A 2WDVB 1L4ZB 3MTNB 3I63C 2LGXA 5JHBA 1YNTE 4NJ8A 5F3XB 1C20A 1FXIA 2P6UA 5IIOA 4QZCA 2KQ4X 1E8XA 2ASQA 2KE7A 3F5EA 1H8CA 1RYRA 4I2EA 4M00A 1I4GA 3AEAB 3V7JA 2N1WA 2Z59B 2MSNA 3SD7A 1B43A 3MBYA 3JSVB 2KANA 4LNIA 3AUOA 4F2RA 1L5PA 4ANXA 4JWSC 1P98A 5EWGA 1L8LA 2FUHB 2LM4A 2HVHA 4QW8A 3U8ZA 4BBNC 4F8CB 1IP9A 4YD2A 5KFFA 4FULA 4LNKA 4RGOS 3F5AA 2IGGA 4BWMA 5GXGB 2V4IB 4UB8U 4UB4A 3C8YA 3H8MA 4O3RA 3B2FA 1HEKA 4DL6A 2KVCA 2ICIA 5CR0A 3WK8A 3MFIA 7ICQA 5HHHA 4XDDA 3AE2B 2D3GA 1BMLC 4WH4A 4XDCA 3RH6A 3AQEA 3N7SC 1QOFA 1EXNA 2H3FA 3T3NA 1FRDA 4RGNA 5AM0A 4NY8A 5IKCM 4I2CA 5EWFA 1PVRA 2DYBA 1XSNA 2YN4A 2IBKA 3JYUA 4YN4A 2LVQA 3DBHI 3PS6A 4JIOU 5J0UA 5ALSA 5IP4D 5HR6A 4M8MA 3VUWA 3C29A 5DCNA 1KFTA 2C60A 2V0GA 3TADA 5AKIA 3TUOA 5ALPA 1SJED 3DBSA 9ICLA 4CF5A 2F76X 2DL0A 3M63B 5TR5A 4TKNA 4F4WA 5KFWA 4KLJA 1SWWA 3DVNV 3CRXA 2MA9B 2ZNVC 2HMXA 4O3QA 1KH0A 2N9LA 4FBTA 9ICFA 2TSSA 1YIWA 3IVFA 4NAWA 1CQVA 3UQ2A 1LFDA 1WUDA 3ETRA 2RPQA 5J0YA 2E8MA 4RNOA 1NJXA 1I4PA 1WZ0A 3URYA 3RBDA 3IN5A 1JWAD 5DQGA 4IDIA 3ZDTA 4IR9A 5KFKA 3RCZA 3E58A 5KFLA 4ED6A 4PHAA 2LUMA 2A1JB 2EQYA 2M19A 4PT5A 5AI6A 3PX4A 8ICCA 2IO2B 5KFAA 3NJTA 3KHLA 1ZQFA 8ICWA 2V4RA 5AI9A 4LNNA 1TGZB 3BS5B 1E9MA 3NZUA 4PZNA 3C1ZA
chains in the Genus database with same CATH topology
2QSDA 4L1BA 2K9XA 2VZKD 4WURA 5TSSA 3BWUD 3PZ8A 2LFIA 4OZAA 1UNSA 1ZOYB 3SFEB 2DBYA 2LEKA 1SF0A 1ZDVA 1LO5D 1YJJA 2K3UA 2LMCA 1SXTA 4NAMA 2KWDA 1UWMA 1QT9A 1SE2A 3HVZA 3U2SC 1C4PA 1F2RI 1TS3A 3W5UB 4R3DA 1C79A 2WXKA 4MM3B 4USAA 2QILA 1D6EC 2OEDA 2SAKA 1SJHD 1XLQA 2BB6A 2YEPF 1JMLA 1PGXA 1WWTA 3B9JA 3H8HA 1E6EB 1GB1A 4ZYSA 3IAS1 4US9A 1I4QA 2WQYB 2ZW0A 5FK9C 3AN1A 1TS5A 3BVMA 3MHZA 2WP9B 1FNWA 1MHHE 3AEBB 4A90A 4MT5A 2RMMA 1B1ZA 2FUG1 3AV8A 2WXQA 5BYRA 2WXIA 2BS3B 2CJOA 4XWWA 4NZLB 3BK1A 1FMAD 1EM7A 1TY0A 2MJ3A 2Y3AA 1TYGB 2MEKA 1N63A 4C7YA 1QOBA 1VZ8A 4C56C 2PW9A 2WXNA 1K51A 4KKJA 3ZQ4A 1L4DB 1EU3A 3EA6A 3AEEB 5HI1A 3AE9B 1XLOA 1D5XC 2J53A 3AE3B 1JALA 4ZRPA 4B0EA 1FO4A 4TMAB 1GOZA 1TZOA 1N5WA 1SE4A 4US8A 2H88B 3BZDB 4WIPA 2RDHA 2JZPA 5G5HA 1M4VA 1AW7A 1K52A 2JXTA 4L2YA 3AE1B 1WYGA 4TSSA 3HUIA 1MVKA 1VRAB 2DYOA 3Q8CA 4OZBA 1QKZA 1C78A 4YTPB 1TY2A 1OQQA 1F2RC 3IAM1 1JRPA 1EWCA 3ZJUA 1Y56A 4P6VF 1YQ4B 3AEFB 4TQ1A 1ZXIA 4ZHOA 4C80A 2ACZB 4YTNB 3PO0A 3OWEB 3FILB 2BS2B 3NZ3A 2WXLA 3AE4B 2EKIA 1YQ3B 2FE8A 1V1PB 1ZDXA 2I2YA 5BYQA 1QLBB 1TS2A 1WXQA 2HDEA 1QOAA 2PLPA 1WGKA 4RFBA 4EE2A 4B0MA 1HZ6A 1NEKB 3UI3A 1FM0D 1EU4A 3PZ7A 5E6JA 4AS1A 3ABVB 2Y5CA 4N59A 3EGRA 3R8BA 5AUIA 2JX5A 1VJKA 1ET6A 2MH7A 1BXTA 1YN4A 1JQ4A 2RDGA 1XLNA 1DYQA 1TKYA 2WXFA 1ESFA 1FCCC 1YN3A 3HVDA 1JW9D 1C77A 4LTUA 1IGCA 4LK0M 4OHJA 1ZPSA 4MACA 2PVGC 3NVYA 1FNVA 3AE8B 4A55A 2G1EA 1XLPA 2DYMA 2MJEA 2J52A 2JU6X 1FFVA 1E10A 2PTLA 4RGMA 1I4RA 3MP9A 2D5GA 2LHEA 4RNAA 3Q69A 3KLSX 1IBXA 4GDLB 1C76A 1VZ6A 4RF0A 5BYSA 5D3IB 4DXFA 1SEBD 2JYEA 4P16A 1N5XA 1VLBA 2L32A 2BS4B 4OVZA 2JYTA 2WXGA 1QOGA 2IGHA 2K5PA 4XE0A 1DGJA 1FNUA 1XO3A 4DXGA 4L23A 4Q2JA 1DOIA 1SBBB 3T3OA 2KDMA 1CK1A 2GI9A 3AB5A 3GP7A 4YTMB 4CQNA 2Y5PA 1ET9A 3BVGA 1V1OA 4KGRA 4GLSC 1XF5L 3SFDB 5MPOA 1NVID 3DWGC 4ITKA 1SB3C 1D5ZC 2N9KA 1J7CA 1YJIA 4M0WA 3GB1A 2E3TA 1KFYB 3AE5B 4HRSA 3CIRB 3FC4A 4A8XC 4YSZB 4NJCA 4XWTA 4FXCA 5H8YE 4A9AA 2WDRB 4HJGE 3KQ4A 4RGTA 3E56A 3B2GA 3WCQA 4RCOA 1FIQA 2M56B 2PIAA 4REZA 2BBCA 3ZGZA 2WXHA 2CU3A 2R61A 1V97A 3TEWA 3P42A 2QEJC 3IT4B 2L1AA 2QMTA 3O13A 4D2KA 1F0ZA 1OFFA 2WDQB 4ZOHC 1ENFA 2M0AA 2K22A 4ARIA 2QJLA 1I4XA 2Q5WD 2VZKB 2JWUA 1NENB 1A70A 1BUIC 1WRIA 2AQ3B 2WXJA 1KRHA 1SE3A 4C7ZA 4YSYB 5D3DA 1JCKB 1P7FA 2B76B 1I4HA 3AECB 3SR6A 1PGBA 4A6QA 3J9CA 2L83A 1RM6C 1ZE3D 3FILA 1E7PB 3L4PA 3U7ZA 4HKQA 3AM9A 1TJEA 1V1PA 3BK2A 3AE7B 2BTEA 1C4CA 1ACCA 3U52E 3NUHB 1MPEA 1OQRA 4H2AA 1DOXA 1F77A 4KX6B 3IXSA 4WAFA 4KGSA 4TQ0A 1N62A 4HEA1 1UUPA 2DLBA 1MI0A 2RPVA 4YXDB 4KKIA 2N7JA 2YEPB 1NYRA 3AH7A 2W3SA 3BVZA 1T6BX 2L52A 1HXYD 5BMGA 2XNAC 5BMIA 3P4SB 5EE9A 1ZUD2 2SEBD 5C2TB 1PGAA 1TKEA 2V3PA 3P1MA 2DWQA 3TEXA 3MJ5A 5I4DA 3MFGA 4GDKB 1WSPA 1K53A 1L0YB 2WXPA 2NTTA 1J7AA 1VZ7A 1FXAA 1NI3A 1GB4A 2LHDA 2LGIA 3LYYA 1NYQA 2WXMA 2WNMA 5JXVA 1RYJA 1AN8A 2KAJA 1YN5A 3ZYYX 3E9SA 3P4QB 2W54A 3R2TA 2J42A 2KMMA 1R7SA 2JQRB 1KLGD 2X38A 2LJIA 4IKGA 1T3QA 4HKZE 1IBXB 4DQOC 1FD6A 1KLUD 1RWSA 2W55A 5D7GA 1IGDA 3U4EG 1UWXA 1RFKA 1J7BA 1HA5A 3NVZA 3KWLA 4HROA 3Q8BA 3NRZA 2PKOA 3HRDD 3V05A 1SSNA 1L6VA 2J4XA 2EELA 1Q10A 5BMHA 2IJ0A 1FFUA 4OZCA 3NS1A 1IUEA 2K0PA 3RFZB 3ZJVA 1XEEA 1PUTA 1FCLA 3VRBB 1E0ZA 3KWVA 3BYTB 3W2DA 1C9FA 3AEGB 2OHFA 2INPE 1TKGA 4IOIE 1C4AA 2NMQA 3W5VB 1PYWD 1B9RA 4JWUC 1KTKA 5HFYA 4AQ7A 5FR3A 2IDYA 2ON8A 4ZHPA 1JWMD 2W3RA 3AMZA 2AQ1B 4ARCA 1GAQB 4YT0B 3TSSA 1SIJA 5AUKA 2I38A 3BIID 4LLGM 1VR9A 1ZXHA 4WWMA 2GRIA 3VR8B 1CZPA 5EE1A 4N58A 2KN4A 2BW2A 1UGJA 3VR9B 2JSVX 5EE3A 3VRAB 4YWGG 1XCTL 3SEBA 5H92C 4KGTA 4JX1C 5T8IA 2GB1A 4N6EB 2WXRA 3TEZA 3GS2A 1MHXA 1YMHE 1I7HA 2WDVB 2XN9C 1L4ZB 1YNTE 1XCQL 2WU2B 5HHDG 1FXIA 1ROEA 2KQ4X 1K50A 2MJDA 1DOYA 3NVWA 5FKAC 1JROA 1I4GA 1L0VB 3AEAB 4WQMA 1XXGA 4RF1A 3LXFA 4RH6A 4OW0A 5HG2A 2NTSA 5EE0A 1PFDA 2BYTA 1L5PA 3FAHA 1AYFA 4JWSC 1STEA 4RGOS 2IGGA 3EUB2 5GXGB 1P7EA 4YSXB 1HEZE 2V4IB 3AEDB 3VQIA 3C8YA 3B2FA 1HZ5A 2PMVA 3CWIA 2ICIA 1HQRD 1D5MC 1AWDA 2PVOD 4XDDA 3AE2B 3DWMA 1BMLC 4WH4A 3AE6B 5C3JB 4XDCA 4ZRQA 1PDXA 1QOFA 2FBWB 1TS4A 4JE3B 1FRDA 4RGNA 3T3NA 1CJEA 1FRRA 3P4PB 4NAWB 1VDVA 1D4BA 2QIEB 1L6UA 1JWBD 2AQ2B 1QF6A 5LNK1 2IPKD 2WLBA 1QQRA 2KACA 1JWSD 2V0GA 3R2IA 2Z8LA 4JPSA 3TUOA 2CJNA 1SJED 1V8CA 3TEYA 5G5GA 3LB8C 2BB5A 3P4RB 3W9CB 1FEHA 3N9YC 2ZW1A 3MC0B 2AX5A 3P63A 3Q8FA 3Q8AA 3BYYB 1KH0A 3I57A 4UDUC 1JWUD 2N9LA 4MH8A 2TSSA 2WXOA 1CQVA 1N60A 3I9V1 3ETRA 1I4PA 3URYA 1JWAD 2WS3B 2V3NA 2W82A 4IDIA 2INNE 3IT6B 2HTME 2LUMA 4PT5A 2M19A 2WU5B 1EWYC 1ZP0B 2BT6A 1QILA 1T5XD 2G9HD 3RPFC 1GPXA 1L0XB 1N61A 1KF6B 3ZJTA 2IGDA 3V3XA 3Q8EA 2ONQA 3NVVA 4O1NA 2H89B 2E6XA 3W1SA 1E9MA 2N0SB 4J3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSY B;  2K9X A;  3VR9 B;  3W9C B;  5EE3 A;  5AUI A;  2B76 B;  1ZOY B;  1VJK A;  2JX5 A;  3SR6 A;  3AEC B;  2DBY A;  2LEK A;  2MH7 A;  5H92 C;  4JX1 C;  3SFE B;  4N6E B;  1SF0 A;  1JQ4 A;  2L83 A;  1RM6 C;  1E7P B;  1XLN A;  1I7H A;  2WDV B;  1YJJ A;  1TKY A;  3L4P A;  3AM9 A;  1TJE A;  1JW9 D;  2WU2 B;  3AE7 B;  4LTU A;  1UWM A;  1FXI A;  1ROE A;  1QT9 A;  3HVZ A;  3W5U B;  2MJD A;  2PVG C;  3NVY A;  3AE8 B;  1DOY A;  3NVW A;  1OQR A;  1JRO A;  1L0V B;  4USA A;  3AEA B;  4WQM A;  4KX6 B;  1DOX A;  2G1E A;  1XLP A;  2MJE A;  1XLQ A;  1FFV A;  1N62 A;  3LXF A;  1E10 A;  1WWT A;  3B9J A;  4N59 A;  1E6E B;  5EE0 A;  1PFD A;  4YXD B;  1L5P A;  3FAH A;  1AYF A;  1NYR A;  4US9 A;  2WQY B;  4JWS C;  3AN1 A;  3AH7 A;  2W3S A;  2WP9 B;  2L52 A;  3AEB B;  3P4S B;  5EE9 A;  3EUB 2;  1ZUD 2;  5GXG B;  5C2T B;  3AED B;  4YSX B;  1TKE A;  3P1M A;  3AV8 A;  2DWQ A;  3B2F A;  2BS3 B;  2CJO A;  3CWI A;  1N5X A;  1AWD A;  1VLB A;  1FMA D;  2PVO D;  3AE2 B;  1J7A A;  2BS4 B;  3DWM A;  1QOG A;  1FXA A;  1NI3 A;  2K5P A;  2MJ3 A;  3AE6 B;  3VRA B;  5C3J B;  1PDX A;  1QOF A;  1DGJ A;  1TYG B;  1NYQ A;  2FBW B;  1N63 A;  4C7Y A;  1FRD A;  1CJE A;  1QOB A;  1XO3 A;  1FRR A;  1RYJ A;  1DOI A;  3P4P B;  2KAJ A;  1VDV A;  3ZYY X;  3AEE B;  2QIE B;  2W54 A;  1L6U A;  3P4Q B;  1JWB D;  1R7S A;  2JQR B;  2KMM A;  3AB5 A;  3AE9 B;  1QF6 A;  4YTM B;  1XLO A;  5EE1 A;  1T3Q A;  3AE3 B;  4N58 A;  2WLB A;  1JAL A;  3SFD B;  5MPO A;  1FO4 A;  1NVI D;  1RWS A;  2W55 A;  3DWG C;  4ITK A;  2CJN A;  1N5W A;  1SB3 C;  1V8C A;  1J7C A;  5G5G A;  1RFK A;  4US8 A;  1J7B A;  1YJI A;  2H88 B;  3NVZ A;  3LB8 C;  3KWL A;  4HRO A;  2E3T A;  3NRZ A;  5G5H A;  3P4R B;  2PKO A;  1KFY B;  3AE5 B;  2AX5 A;  3CIR B;  3HRD D;  3P63 A;  4HRS A;  1L6V A;  3AE1 B;  3FC4 A;  4YSZ B;  1WYG A;  5H8Y E;  4FXC A;  3HUI A;  1FFU A;  4A9A A;  2WDR B;  3NS1 A;  1IUE A;  3B2G A;  4YTP B;  3WCQ A;  1FIQ A;  1OQQ A;  2M56 B;  1N60 A;  1PUT A;  1JRP A;  2PIA A;  3ETR A;  4ZHO A;  4P6V F;  1YQ4 B;  3AEF B;  3VRB B;  1ZXI A;  1E0Z A;  4C80 A;  2ACZ B;  1JWA D;  2WS3 B;  4YTN B;  3AEG B;  3PO0 A;  2CU3 A;  2OHF A;  1TKG A;  4IDI A;  1V97 A;  2BS2 B;  3W5V B;  1B9R A;  3AE4 B;  2HTM E;  4JWU C;  2EKI A;  1YQ3 B;  4ZHP A;  2M19 A;  1F0Z A;  2WU5 B;  1OFF A;  1EWY C;  2WDQ B;  4ZOH C;  1QLB B;  2W3R A;  1WXQ A;  3AMZ A;  1ZP0 B;  2BT6 A;  2K22 A;  1QOA A;  2QJL A;  3RPF C;  1GAQ B;  4YT0 B;  2Q5W D;  1WGK A;  1GPX A;  1SIJ A;  1N61 A;  1KF6 B;  5AUK A;  1NEN B;  1A70 A;  1NEK B;  3BII D;  4WWM A;  1WRI A;  3NVV A;  1FM0 D;  1KRH A;  2H89 B;  3VR8 B;  4C7Z A;  1CZP A;  3ABV B;  1E9M A;  2Y5C A;  2N0S B; 
#chains in the Genus database with same CATH topology
 2QSD A;  4Z6C A;  5ALI A;  4EX7 A;  2AU0 A;  3V6J A;  3PO4 A;  4L1B A;  4WUR A;  3S2A A;  2VA3 A;  2LFI A;  4FA6 A;  4OZA A;  3WAL A;  4C8N A;  2HBL A;  2BVC A;  1A76 A;  2DBY A;  3CW2 C;  2O6V A;  1SF0 A;  1JRU A;  5E79 U;  4R8U A;  2RGF A;  1Y8R C;  4NL9 C;  2HBM A;  4IRC A;  4QZD A;  3FM9 A;  1YD8 U;  3EFC A;  2LMC A;  2AGQ A;  2LI5 A;  4LCD E;  4W9K A;  3KKA A;  4RPZ A;  2PFQ A;  1QT9 A;  1K5O A;  3W5U B;  3TKA A;  4M47 A;  5ALR A;  3UMG A;  2EAM A;  5E6O A;  4USA A;  3H4D A;  4GLX A;  2PI5 A;  2F1J A;  3U30 A;  1S0M A;  2QAR B;  3TFS A;  1JI7 A;  1P7D A;  1E6E B;  3EPG A;  2KOX A;  4RPX A;  2MWS B;  3IAS 1;  3AN1 A;  3BVM A;  1RPL A;  4QWA A;  2ZIU B;  1RYU A;  1FNW A;  3AEB B;  3EW9 A;  4ICU A;  4OVV A;  4EZJ A;  3HIL A;  9ICJ A;  5BYR A;  1YOV B;  3R3M A;  2BS3 B;  2Y5B B;  2EZY A;  4IUM B;  4UAU A;  1BT0 A;  5J29 A;  1FMA D;  1LV5 A;  2WF8 A;  5AI0 A;  4QJF B;  2NRV A;  4FFD A;  2E1F A;  1VZ8 A;  3UXO A;  1UEL A;  4N9F 4;  3WAO A;  4RM9 A;  2ZTC A;  4C56 C;  3TI0 A;  1MQ2 A;  1YX6 B;  1EU3 A;  3EA6 A;  3KD3 A;  1X9M A;  4BJQ A;  5AZG A;  3AE9 B;  3D32 A;  1WGG A;  3APC A;  1D5X C;  4Y2V A;  4DF4 A;  2LVP A;  3A33 B;  3AE3 B;  1WY8 A;  3PSP A;  2MBH A;  4B9M A;  3H8J A;  2M1M A;  2NS5 A;  4Z6F A;  3JPP A;  3TIX A;  2W7P A;  3RYT A;  1N5W A;  3AU5 A;  2DAF A;  3PLU A;  3JW0 X;  5C1Z A;  1X2I A;  2KX3 A;  4FHJ A;  2KIV A;  3SMV A;  5AM1 A;  1K52 A;  2JXT A;  7ICV A;  4EOY A;  1Z19 A;  4I6P A;  4JV2 A;  1JMS A;  2K4H A;  3GV5 B;  1QKZ A;  5T14 A;  3Q8P B;  4DSE A;  2V4L A;  4KZ0 A;  4M8N A;  2BYF A;  1WH3 A;  5AKK A;  2DHZ A;  4KLQ A;  2H3Q A;  1BPY A;  3IAM 1;  2GOL A;  4TQ1 A;  2ZPY A;  2VJ4 A;  4NY0 A;  4C80 A;  2ACZ B;  2KV2 A;  3M1Y A;  4B6J A;  8ICQ A;  3NZ3 A;  4DDI D;  1TK8 A;  3F2B A;  3MJW A;  2DZM A;  4F4Z A;  1KLN A;  4KX5 A;  2EDU A;  4GU2 A;  3X0W A;  1KFS A;  2B21 A;  1QOA A;  1UT5 A;  4EE2 A;  2FPM A;  1R4N I;  4B0M A;  5KFD A;  1PK3 A;  2D10 A;  2KQS A;  5KHO A;  8ICJ A;  3RRH A;  3TAQ A;  3KZX A;  3RJE A;  3RJJ A;  3DDH A;  5J2H A;  5DG9 A;  1ZQY A;  1ET6 A;  1BXT A;  4I6L B;  5GTI U;  1YN4 A;  1JQ4 A;  3MR5 A;  2WX0 A;  5DLF A;  2K6D B;  2KXJ A;  2A3V A;  3W1Y A;  2QDF A;  4PHD A;  2WXF A;  1FCC C;  1JW9 D;  2JEF A;  4LTU A;  4K3C A;  3OHA A;  1ZPS A;  4LZD A;  1XS9 D;  1TVA A;  4BXO B;  4ICV A;  5DPS A;  3NVY A;  2BCV A;  2KN5 A;  2OXO A;  2YY6 A;  3RZW C;  4AYB F;  4DFK A;  1XLP A;  2DYM A;  3MR2 A;  3UIP B;  1FFV A;  4PS3 A;  3K4G A;  5BO4 B;  4X57 B;  4RQ7 A;  2DNF A;  3L13 A;  3MP9 A;  2LHE A;  2K1F A;  3IHQ B;  2FNJ B;  5CHG A;  1TBE A;  4RNA A;  5KL8 B;  1IBX A;  1UHU A;  4GDL B;  4RF0 A;  3UMC A;  2XVT A;  2L8J A;  4ANW A;  1X9S A;  2WB1 F;  4GOC A;  3VDZ A;  4I6N B;  3RAQ A;  2JYT A;  2WXG A;  1QOG A;  4XE0 A;  4MJS A;  3GQC A;  1EUV B;  9ICO A;  1UF0 A;  1ZQP A;  4UBC A;  3IV6 A;  4KLS A;  1SV0 C;  2K8C B;  3V6H A;  1CK1 A;  5DDM A;  3M95 A;  3OSN A;  1T8E A;  2UVW A;  9ICU A;  2EMS A;  4HPP A;  2JEG A;  1V2Y A;  3APD A;  4RQ6 A;  1BPD A;  2OOB B;  4KGR A;  5ALQ A;  4B6W A;  5AKZ A;  1XF5 L;  5J0Q A;  4GDL A;  3SFD B;  5MPO A;  1WXA A;  5J2B A;  2ZCB A;  1KLV A;  4ITK A;  3C2M A;  4HXD A;  1NOM A;  9ICV A;  2H3V A;  4CF3 A;  5J0S A;  4QZG A;  4DL4 A;  3JPO A;  4OJ6 A;  2BCR A;  1E7U A;  3AE5 B;  4HRS A;  1V81 A;  1LQB A;  4KN4 A;  1TFR A;  4NQL B;  4ED1 A;  3QJZ A;  2KHQ A;  3H0M B;  2RRD A;  3KQ4 A;  3E56 A;  3B2G A;  4OCZ A;  2KDB A;  2GLS A;  2ZJ5 A;  4RCO A;  1FIQ A;  2KTR B;  4MF2 A;  1WGH A;  2KJR A;  4DOC A;  2ES6 A;  4P4M A;  2NCN A;  4REZ A;  1BPZ A;  3PR5 B;  4WJ3 B;  8ICM A;  3A4S C;  4DXA B;  4EEN A;  3ZLZ A;  3KTQ A;  4YL8 A;  4UAW A;  2NBU A;  3TEW A;  3G6V A;  2EAP A;  4QIW C;  3IT4 B;  5B5E U;  3QWZ B;  1WXS A;  7ICL A;  4FHK A;  1IV8 A;  2XIC A;  5AK4 A;  4ED2 A;  1U47 A;  1NJW A;  4ED8 A;  3H7P A;  1QZE A;  2VZK B;  1RFA A;  3ENE A;  2V4Q A;  1A70 A;  4QZ8 A;  3M6Z A;  2C28 A;  2WXJ A;  1TV9 A;  4JV0 A;  1SE3 A;  3AI5 A;  4C7Z A;  2W9B B;  2XO7 A;  1F1H A;  4YSY B;  5AK5 A;  4KDL B;  5JTI A;  4J9S A;  5L9X A;  1JCK B;  1I4H A;  3AEC B;  2KC2 A;  3RI7 C;  2ALZ A;  3GFK B;  3IG3 A;  1R4N B;  2IO0 B;  1E7P B;  8ICA A;  3VTU A;  3KHG A;  2JZ3 B;  3L4P A;  1M94 A;  1TK0 A;  1A77 A;  3RBE A;  5KFH A;  2W9M A;  2CKH B;  1OQR A;  3APF A;  1NJZ A;  4KX6 B;  3RB3 A;  4B9L A;  1RZT A;  1N62 A;  3GIL A;  1X42 A;  1P1A A;  3JPN A;  1UUP A;  3RR8 A;  2NBW B;  1WYW B;  3SAG A;  2E8O A;  4LJX A;  2WF9 A;  4M9G A;  4DFD A;  4E71 A;  1VD2 A;  1NDD A;  1HXY D;  2WGS A;  4PGQ A;  3RH4 A;  1WGD A;  5C2T B;  3PML A;  4QZH A;  1PGA A;  2RLT A;  2CN1 A;  3TEX A;  3F53 A;  2QB0 A;  3CP8 A;  1WSP A;  2M9N A;  4FO6 A;  3Q3N C;  1WRD B;  2K8B B;  4BKG A;  3OHB A;  1SV4 A;  2ASJ A;  1NI3 A;  2MBE A;  4AYB C;  3LYY A;  2WXM A;  9ICH A;  3DVG X;  1BPB A;  4GC6 A;  4RQM A;  1RAX A;  3JPQ A;  2BKE A;  5CJ7 A;  2KAJ A;  3Q3O C;  3ZYY X;  3E9S A;  3EFU A;  4ECR A;  3Q3J A;  4MEM A;  2J42 A;  3R9K A;  5AHX A;  1R7S A;  3MGI A;  2KMM A;  2X38 A;  4BKT A;  3KHH A;  5KFE A;  4U6P A;  5J0X A;  1XWL A;  4B95 A;  5DG8 A;  3GII A;  1IBX B;  4IWQ A;  1FD6 A;  1U45 A;  2PMZ F;  1RWS A;  1D8L A;  2IOF K;  3C1Y A;  5IN7 A;  2AQ0 A;  4KV2 A;  2JEJ A;  2C7N B;  1UWX A;  3OSP A;  2IBI B;  4DDG D;  2O2V B;  3QAR A;  4URK A;  5J18 A;  2D3A A;  1ZJN A;  1F9J A;  2J7Q B;  1JN3 A;  2J4X A;  4K7W A;  3WA0 A;  1Q10 A;  5BMH A;  2LGS A;  1BPE A;  1IUE A;  2Q4T A;  1JX4 A;  5DBC A;  2KYW A;  3BS5 A;  2JZB A;  4MFA A;  3RFZ B;  4TUR A;  1SIF A;  2G06 A;  5DDY A;  5KL1 B;  3HJE A;  4O5E A;  7ICN A;  2VKQ A;  5J2F A;  3ZNI D;  2W8L A;  4HWI B;  4IOI E;  1OQY A;  3W5V B;  1ZQX A;  3O0F A;  2WWZ A;  2XY5 A;  1SV0 A;  2K4E A;  5D49 A;  4PJ0 U;  2IDY A;  4R65 A;  3GV7 B;  4X5V A;  4DHZ B;  3K9P B;  3C0R B;  4W9G A;  2KJ9 A;  3ZTD A;  4LZG A;  4ELU A;  1NK5 A;  4ARC A;  4GSW A;  4MM3 A;  4GB9 A;  3QYP A;  5AUK A;  1TT5 B;  2I38 A;  2GRI A;  2AL3 A;  2V9H A;  4Y2Y A;  5EE1 A;  5KFG A;  2KEY A;  4ELV A;  2KWU B;  4N58 A;  4BBN F;  5JHA A;  2KN4 A;  1MA7 A;  3H7S A;  3C21 A;  1Q0W B;  4NNJ B;  2HHQ A;  4YWG G;  1XCT L;  4MHV A;  2L7R A;  5H92 C;  3WKC A;  2HW3 A;  3SEB A;  4JX1 C;  2GB1 A;  4N6E B;  2L00 B;  2C2R A;  3ONS A;  3LYS A;  3PR4 A;  1YMH E;  3U7D A;  2CHZ A;  5JH5 C;  4C4R A;  3MC8 A;  1GC6 A;  1XCQ L;  3V6K A;  2O6V D;  5HHD G;  1ROE A;  1X40 A;  1NK7 A;  2N9P C;  3QHT A;  3H7P B;  4I2I A;  1K50 A;  4PHE A;  4M2Y A;  5J2E A;  7ICK A;  3LJ3 A;  5FKA C;  1JRO A;  1S8O A;  1L0V B;  5AKY A;  4WQM A;  1XXG A;  3B0Y A;  5AIB A;  2IHM A;  2BKR B;  3QU9 A;  4KLE A;  4YR3 A;  2BDU A;  5D94 A;  1RYS A;  7ICU A;  1NK4 A;  4RQ8 A;  1SKR A;  3VCB A;  2HHU A;  3MR6 A;  4DQS A;  1H4R A;  2D2Q A;  4MFC A;  5J2D A;  4W9C A;  5D2M B;  4IR1 A;  4KSL C;  2DKX A;  4OVU A;  4ANV A;  4YSX B;  1HEZ E;  3VQI A;  2J6T A;  4OJL A;  1ZQI A;  2BYV E;  2M8S A;  3L5K A;  5JRT A;  5J2I A;  5J2J A;  4DFM A;  2PVO D;  1V85 A;  4XC2 A;  3AE6 B;  3RNC C;  2F2A B;  4FN2 A;  4JE3 B;  4J03 A;  2MRP A;  4F92 B;  2MUT B;  3D2Q A;  4UAZ A;  1HTQ A;  1S3S G;  4Q43 A;  2ZZP B;  1D4B A;  2JT4 B;  2WB1 C;  3DVN U;  4EEK A;  4ACO A;  2AQ2 B;  5AKE A;  5C23 A;  2MCN B;  1ZQN A;  2OEH A;  4RM8 A;  4FAD A;  3GDX A;  1U9L A;  3EHV A;  1WXV A;  2KX0 A;  2WLB A;  4EFO A;  4DSI A;  1QQR A;  2KAC A;  1JWS D;  1ZD4 A;  4JPS A;  5ALW A;  2LGD A;  4GDK A;  1UA0 A;  4WJO A;  4C4T A;  2D3D A;  2BB5 A;  2K8B A;  3DBR I;  4OO1 J;  4F4K A;  3QX7 A;  4QWE A;  4YFK A;  1LM8 B;  4UAR A;  2AX5 A;  2ZW1 A;  1LB2 B;  2HHX A;  3Q8F A;  5ALH A;  4XQ8 A;  3RJK A;  2EZX A;  5L1M A;  1LGR A;  5GMV A;  2VIX A;  4GFJ A;  2D8C A;  1NK8 A;  7ICH A;  4KVG B;  4UDU C;  2RR9 A;  3NS8 A;  1JWU D;  1DK2 A;  2NO5 A;  3Q8L A;  3I9V 1;  3IDW A;  5TZV A;  4MFF A;  1B22 A;  1WX9 A;  2H3I A;  1D9D A;  2LWP A;  4ECW A;  2W82 A;  3HK0 A;  2R8I A;  2INN E;  5AK6 A;  2KVZ A;  3AUL A;  3PT2 B;  5HKH A;  1X1M A;  3GE8 C;  5IIJ A;  5IIL A;  2WU5 B;  3DHI C;  4CHK A;  1FXT B;  3R66 C;  2IYD B;  4JQW C;  1TK5 A;  1L0X B;  1N61 A;  2IGD A;  3V3X A;  3T3F A;  3Q8E A;  2B6G A;  2QAR A;  5ALL A;  2F1I A;  3PO5 A;  4O1N A;  3RR7 A;  2E6X A;  1JXE A;  4J3O D;  2JZB B;  2K9X A;  3OTQ A;  3BY4 B;  2XCP A;  4YG2 A;  1GO3 F;  2A5U A;  1ZQK A;  5A0L A;  2ATL A;  1M6Y A;  5DB8 A;  3M7D A;  2NRW A;  2KTQ A;  4KIK B;  2WHE A;  4P0Q A;  2C22 A;  3PSF A;  2KLC A;  4BWJ A;  2A19 A;  4W9E A;  4YP3 A;  2NVU I;  4EKU A;  2A1J A;  2K3U A;  2XK5 B;  5AK3 A;  2FLP A;  4ANU A;  2ZUB A;  3HVZ A;  3VHT C;  1F2R I;  3FYH A;  2L0F A;  2KMC A;  2MP2 A;  5IOI A;  1C79 A;  4MEL A;  4MM3 B;  3PX6 A;  2QIL A;  2OED A;  3QQ8 B;  3GV8 B;  2ZNV B;  3HKZ F;  2BB6 A;  2FIF A;  3UM9 A;  4Y2J A;  1PGX A;  1MG8 A;  3H8H A;  3RFA A;  1XU4 A;  4BKS D;  1HJP A;  3KYD D;  3DBR B;  2ZW0 A;  3F2D A;  4IWP A;  1TS5 A;  4C4V A;  1BNO A;  3ISB A;  3RJI A;  2WP9 B;  3MHZ A;  4A90 A;  4KIK A;  4LNF A;  5HNK A;  1ZQA A;  2FUG 1;  3IFW B;  1NK6 A;  3ZVV A;  4O3P A;  4ECU A;  4KLF A;  2I5H A;  5KFC A;  2XK5 A;  5KFV A;  1J19 A;  3DHG C;  2VAN A;  1ZD3 A;  4J9N A;  2MJ3 A;  4AJY B;  1Z3E B;  3MGV A;  1TYG B;  2MEK A;  5KFQ A;  3OGU A;  4F5N A;  5F9L A;  2PW9 A;  3ZQ4 A;  3RF9 A;  4M9L A;  1K51 A;  2KTR A;  2D11 A;  3BIN A;  4DFP A;  3AEE B;  2EMT A;  3PZP A;  3Q14 C;  2PKE A;  1UGM A;  2D07 B;  5E6P A;  2YMP A;  4AJW A;  4B0E A;  2JZZ A;  1OEY J;  1FO4 A;  1YZ6 A;  4TMA B;  2V1Y A;  4KN7 A;  1F0M A;  2H88 B;  2KOB A;  1UZX B;  2FAZ A;  4EZ9 A;  4JWM A;  2JZP A;  1M4V A;  3SI8 A;  2KDE B;  4DBG A;  1IPG A;  1AW7 A;  3PRM B;  4L2Y A;  3AE1 B;  3TJP A;  1WFY A;  3UGB B;  4UB2 A;  9ICG A;  1VRA B;  2BKF A;  2DYO A;  4OZB A;  3SAH A;  2GH1 A;  4YTP B;  2L3Z A;  1LKY B;  4PGX A;  4KLI A;  2KNB A;  7ICF A;  1TY2 A;  3N7P D;  5ALK A;  1ZKH A;  1JRP A;  1EWC A;  5KFY A;  5KFZ A;  3A9K B;  3ZKJ C;  4K4G A;  4YD1 A;  2IY1 B;  2G5I B;  5KG0 A;  2RHF A;  3TMP B;  2J6U A;  2ZEQ A;  3AE4 B;  3ZNH B;  3BJY A;  2FE8 A;  2C9W B;  1L3U A;  1V1P B;  1ZDX A;  4W9J A;  3HIZ A;  4WWO A;  2I2Y A;  4FZN A;  3ZNG C;  4KMO B;  5J2A A;  5BPC A;  4JB3 A;  1WGK A;  4ECS A;  4RFB A;  2HE7 A;  1J2N A;  2ASL A;  1HZ6 A;  2IND C;  4I2H A;  3TCA A;  3KBB A;  3UI3 A;  1FM0 D;  5EOZ A;  1EU4 A;  3PZ7 A;  2RD0 A;  2JF5 A;  3ZTC A;  2IO1 B;  4ECX A;  5ALO A;  2KNJ A;  4XX5 A;  4FZL A;  1WX8 A;  3VAW A;  2JWZ A;  2K39 A;  2I1Q A;  3C19 A;  4Y2S A;  1LVH A;  1MQ3 A;  4F8R A;  4UAS A;  5AKG A;  5DBB A;  3SQI A;  1TKY A;  4EX6 A;  1ESF A;  1YN3 A;  3SD5 A;  4KLU A;  4IQU A;  1C77 A;  4PPX A;  4YXM A;  3GIK A;  3K1Z A;  2PVG C;  2KMD A;  2LPE A;  4A55 A;  2XBB C;  2KVR A;  4AP9 A;  2MJE A;  2J52 A;  3OG5 A;  2BF8 B;  4RGM A;  3UMB A;  2UVR A;  2XEW A;  4ZH4 A;  2LXC A;  2UYZ B;  3V72 A;  4GXI A;  3PW7 A;  1ZQO A;  4IG7 B;  1T94 A;  5H2F U;  1Z4N A;  3DHH C;  3KHR A;  2MW5 A;  4GXK A;  2JEI A;  3OLM D;  3HWT A;  2O2V A;  2QKQ A;  3J81 j;  4NLB A;  2PJH A;  2GMI C;  2MRL A;  2HDO A;  2BS4 B;  2R8J A;  3LVW A;  1WF9 A;  1DGJ A;  4DXG A;  1SL0 A;  4L23 A;  4Q2J A;  2G09 A;  3QK0 A;  2KZR A;  1SBB B;  2YX8 A;  3PW0 A;  4EEY A;  2KDM A;  3DVG Y;  4UAT A;  2GI9 A;  4XRH A;  9ICR A;  3AB5 A;  3GP7 A;  4YTM B;  1TIF A;  4CQN A;  2Y5P A;  3BVG A;  7ICI A;  1N48 A;  4DLG A;  5AIA A;  3VTW A;  2B3A A;  2LMR A;  3ZDB A;  1TKD A;  1ZQE A;  1F5S A;  1WJ6 A;  2BQQ A;  4CYE A;  3KZI U;  5J17 A;  3UF8 A;  1KFY B;  3ZXV A;  4C00 A;  4A8X C;  5DB9 A;  2WYQ A;  4NJC A;  3ZD9 A;  5BOM A;  2BPG A;  4NLK A;  3ZDA A;  3WCQ A;  2BPS A;  4QNL A;  4EBD A;  3Q6B A;  3IG5 A;  3UPQ A;  2PIA A;  2BBC A;  3N3K B;  1B0X A;  3ZGZ A;  2WXH A;  1PK1 B;  1TAQ A;  3P42 A;  3ISC A;  5DPW A;  2KFN A;  2CS4 A;  3N1Y C;  2L1A A;  1D8B A;  2QMT A;  4F5P A;  3O13 A;  4II3 B;  2ZJA A;  1ZQD A;  2WDQ B;  5IO9 A;  3LVV A;  1ENF A;  2QJL A;  1WWU A;  4KLO A;  1J2M A;  2Q5W D;  2KFJ A;  1S1Q B;  2KHV A;  4I28 A;  4G0N B;  4JGH B;  4F91 B;  5ALM A;  5D3D A;  4NLN A;  2IOH A;  1ZYQ A;  9ICT A;  2MBO A;  5ALY A;  1LXD A;  2C5L C;  2KKC A;  2J6S A;  2B76 B;  2MLB A;  1XD3 B;  2CU1 A;  1UD7 A;  2L83 A;  2KIC A;  2W9A A;  3FIL A;  1P9D U;  1ECW A;  4C0Z A;  1TZ1 A;  1S0N A;  3AM9 A;  2KFK B;  3CSF A;  4DS4 A;  2BTE A;  3HHM A;  3NUH B;  4EEW A;  9ICC A;  4A8E A;  4DSK A;  3CNH A;  1Q46 A;  2LYA A;  3VH3 B;  5AKL A;  5KG4 A;  3UQB A;  1DOX A;  3IXS A;  4ED3 A;  4R64 A;  4DQR A;  2BDP A;  9ICS A;  2W9B A;  2DX5 B;  2MAX A;  3A1Q A;  4KDI C;  1MI0 A;  2P66 A;  4ECQ A;  1T0R C;  2N7J A;  4KKI A;  2G4S A;  4C8L A;  3BVZ A;  5ALG A;  2AWT A;  4TV3 A;  5BMI A;  3SZ2 A;  5EE9 A;  2X8X X;  1Z00 A;  4ZRJ A;  2DWQ A;  4NV0 A;  3MJ5 A;  3M8S A;  1YQB A;  1L0Y B;  3K9O B;  4DQQ A;  4OJ5 A;  1VZ7 A;  3PST A;  1UBQ A;  2OJW A;  1WWV A;  2LHD A;  3ETL A;  4BDP A;  4MSQ B;  1N2X A;  1C3T A;  5HMM A;  4RPY A;  2GOW A;  2LGY A;  5JXV A;  1N56 A;  3TAN A;  1RYJ A;  9ICN A;  4WJP A;  2FCN A;  5AKH A;  3Q8M A;  2ZJD A;  5L1L A;  2LJI A;  3QU4 A;  1RXW A;  3KFU F;  1T3Q A;  1UPH A;  1RG6 A;  2DZI A;  3VUX A;  4DQO C;  2W55 A;  2PFP A;  1ZRN A;  5D7G A;  4ECV A;  3AQF A;  3L3F X;  1R4M I;  1C1Y B;  2DF4 B;  2INC C;  5KG3 A;  3KWL A;  4QIW F;  3HRD D;  5DQH A;  4F5Q A;  3KUD B;  4MJS B;  3V05 A;  1OW5 A;  3V7L A;  2F3N A;  5DB7 A;  4YR0 A;  2EEL A;  5AKJ A;  1COO A;  5CHF A;  4RUC A;  2JVC A;  2HJ1 A;  2ISP A;  4FLH A;  3M62 B;  2R2O A;  2Y0S C;  4E3C A;  1XEE A;  2Y9U A;  4QWD A;  1PUT A;  2E5S A;  1KW4 A;  1E0Z A;  1VJ5 A;  4UW9 A;  2O6V B;  3AEG B;  1FPY A;  1TKG A;  3EZ5 A;  1C7Y A;  3PSI A;  2RDI A;  3PHW B;  2ZTE A;  2F8K A;  1XQQ A;  5HFY A;  1DRG A;  2I1J A;  5FR3 A;  5KFT A;  1L5U A;  2KTF A;  2KG5 A;  2ON8 A;  3SYZ A;  1Z4O A;  2GO7 A;  5KG5 A;  1JWM D;  2W3R A;  2W9C B;  2MBB B;  2VH1 A;  3N32 A;  1GJZ A;  2AQ1 B;  3F2C A;  4YT0 B;  1SIJ A;  4IM0 A;  5CHW A;  3PMN A;  2YMM A;  4P0P A;  1ZXH A;  4LLG M;  1MSW D;  3I5J C;  3ISD A;  3VR8 B;  1CZP A;  4HCP B;  1PUZ A;  1UGJ A;  2JSV X;  2RDB C;  2KSO B;  3BQT A;  3VRA B;  2DZK A;  3CMM B;  4KGT A;  1ZD5 A;  4HYK A;  5T8I A;  4HPM B;  5AI4 A;  3ZDC A;  8ICV A;  3RB0 A;  1I7H A;  5DGA A;  5D4B A;  2XN9 C;  5DLG A;  2BYE A;  3RH5 A;  4DHJ B;  1T3N A;  4F2S A;  4PH5 A;  5CEH A;  1ZQZ A;  4A3P A;  4F3O A;  4NWI A;  2JRH A;  2G4D B;  2MJD A;  4LNO A;  4KLM A;  3N1X C;  3NVW A;  4QZ9 A;  4GIV A;  4FJV B;  3H0L B;  1KOT A;  4RF1 A;  8ICO A;  3LXF A;  4B9S A;  2NTS A;  5EE0 A;  2HVI A;  9ICB A;  2YB1 A;  4O3N A;  1NK9 A;  3FAH A;  4DOB A;  1XSL A;  1L6N A;  1KSP A;  2CXY A;  1BVS A;  2G0A A;  2DUY A;  3N28 A;  4DOA A;  3EUB 2;  5KG2 A;  1P7E A;  1XSP A;  2F8L A;  4MF8 A;  3DV9 A;  2PMV A;  2KIW A;  1OTR B;  3I3T B;  1HQR D;  5LXI B;  4HDO A;  4Y2X A;  4FS1 A;  3DWM A;  5KFR A;  4EBC A;  1KKX A;  5C3J B;  4ZRQ A;  3QU2 A;  1SWV A;  5CRX A;  3K1R B;  1PDX A;  3ML8 A;  2FBW B;  2F44 A;  1TS4 A;  3NUQ A;  1B4F A;  2JUO A;  3PRE A;  4IRD A;  1CJE A;  3H1U A;  3A1Q B;  2EAN A;  1NI2 A;  5ALF A;  5CA7 A;  5KFP A;  2WF7 A;  1VDV A;  2ZUC A;  4K4H A;  3C28 A;  4F50 A;  3HPO A;  1QF6 A;  2LM1 A;  2IPK D;  2HCF A;  3N4M B;  1X6J A;  2IZV B;  1V9P A;  2L76 A;  1RRB A;  2M4N A;  2VH2 A;  1ARO P;  3T79 A;  4LJP B;  3RB6 A;  2H5X A;  1V8C A;  2ASD A;  3TEY A;  3M9O B;  2LHT A;  4GXJ A;  3T5H A;  1V5T A;  3P4R B;  3W9C B;  4M9H A;  3GIM A;  4FS2 A;  3VXW A;  5LLI A;  3QEB Z;  5III A;  3DDC B;  5ALE A;  3PRP B;  2WXO A;  5J0O A;  4EZK A;  1IYF A;  1RXV A;  3N97 B;  4DHZ E;  2HBK A;  4RT2 A;  5AI5 A;  1KBU A;  3A4R A;  3A0H U;  4Y2T A;  1SE9 A;  9ICA A;  4NLC A;  3ED5 A;  3NAS A;  1KRP A;  1S76 D;  1V6E A;  4QZF A;  2MU2 A;  3G6Y A;  2HTM E;  1XC9 A;  1RQL A;  3PV8 A;  1EWY C;  1SGG A;  1U48 A;  3WAN A;  1L8O A;  4ECT A;  2BT6 A;  2QLT A;  1QIL A;  3MC1 A;  2G9H D;  4C8O A;  1GPX A;  1QTM A;  1WZ3 A;  3ZJT A;  5K4L A;  4PK1 A;  2ONQ A;  2FJ6 A;  1KEJ A;  2H89 B;  3PZD A;  2HOQ A;  2N0S B;  1ZW7 A;  2UVU A;  2KDI A;  2VZK D;  3N1Z C;  4I29 A;  3PZ8 A;  7ICP A;  1L7N A;  1UNS A;  1ZOY B;  4GN1 A;  4KX3 A;  1J97 A;  2GBJ A;  1R4M B;  3P2B A;  2XC9 A;  4G11 A;  1F44 A;  4B9T A;  5JZE B;  3TAR A;  2EZZ A;  2RP5 A;  1T7P A;  4NM1 A;  4ZRI A;  3H8W A;  4NAM A;  1SXT A;  2JMG A;  1UWM A;  3RJF A;  2HHV A;  1SE2 A;  3U2S C;  3IG8 A;  1TS3 A;  4R3D A;  2WXK A;  8ICG A;  3QUB A;  2SAK A;  2YEP F;  5HR7 A;  2OM6 A;  1WWT A;  3B9J A;  3JPT A;  3RB4 A;  3HW8 A;  4NL9 A;  5KFJ A;  1G6J A;  2W43 A;  1N6Z A;  4US9 A;  1I4Q A;  2KZ3 A;  2ZXI A;  4TQR A;  1WR6 E;  5KFU A;  3NZS A;  1KL9 A;  5KG6 A;  4CNQ A;  1MHH E;  3RT3 B;  3PLV A;  2KJH B;  2RMM A;  4MT5 A;  3QZ8 A;  4UB6 U;  2NPT B;  4BAX A;  2HD5 B;  4NJ6 A;  1KFD A;  4RT3 A;  2CJO A;  4P4O A;  5KFX A;  4NZL B;  4M0W B;  1OEY A;  5CX3 A;  2C2E A;  3HM6 X;  4YCX A;  5KT6 A;  2V3S A;  3TAP A;  4UAY A;  1TY0 A;  2Y3A A;  3R7Q A;  1I42 A;  3EEC A;  4R66 A;  3GZN I;  2I6X A;  4HJK A;  1N63 A;  2K60 A;  2LBO A;  2H3Z A;  1QOB A;  4P1B C;  3ZI4 A;  4KIT B;  2PMZ C;  1CUK A;  8ICL A;  2WXN A;  2Y9T A;  2XI9 A;  5HI1 A;  4HLE A;  1WCL A;  4YMO A;  4BGD A;  5D46 A;  1XLO A;  1RQN A;  3CF6 E;  3DBL B;  2J53 A;  2HHS A;  1JAL A;  4ZRP A;  4WJN A;  4KMU A;  1GOZ A;  4CDG A;  4CRX A;  1ZQQ A;  4ZRK A;  3HX0 A;  2JHD A;  2L05 A;  3H0R B;  4M01 A;  3VH4 B;  4WIP A;  1CMX B;  5KFO A;  3KVF B;  2KZZ A;  3BQ0 A;  3S6J A;  3KW5 B;  3MC9 A;  1XO0 A;  3N20 C;  3PHX B;  1WYG A;  4KLD A;  3HUI A;  2AH5 A;  2PFO A;  2KO3 A;  1C78 A;  1ZOL A;  3CYM A;  4DFJ A;  5C0Y A;  1OQQ A;  1F2R C;  5ALJ A;  3H40 A;  3QU7 A;  5KNI A;  3AEF B;  3CST A;  5AM3 A;  5CTR C;  3MAB A;  4J9P A;  5KFS A;  1KN5 A;  2KMA A;  1WMH B;  4GC7 A;  4PYZ A;  4CCH A;  2EKI A;  7ICR A;  3M3J A;  3D2N A;  1SKS A;  5BYQ A;  1Q8K A;  1TS2 A;  1WXQ A;  2HDE A;  5JUM A;  2UWQ A;  4I2G A;  3T5J A;  4J9R A;  4XGA B;  3PPA A;  5EWE A;  3G6X A;  4UB5 A;  1ZJM A;  4IWO A;  2KJ5 A;  2YQE A;  4UB3 A;  1S0V A;  1LKY A;  4AS1 A;  4N59 A;  2PI4 A;  1KM7 A;  3VC8 A;  1ZQJ A;  2QCZ A;  2DFL A;  2JXJ A;  3R8B A;  1QSY A;  2JX5 A;  1Q3U A;  1GUA B;  3I28 A;  2MH7 A;  3GOE A;  4LVS A;  4Z6E A;  4KLT A;  4HVB A;  3DOW A;  1WMH A;  3RJH A;  5F9N A;  2KD0 A;  1BGX T;  3HVD A;  2Y1J A;  4E74 A;  2AGP A;  5L1J A;  1UCV A;  4IC7 B;  1EO6 A;  4EBE A;  4G3X B;  4OHJ A;  4BX9 C;  4XA5 A;  2KWV B;  1FNV A;  4FZM A;  3WKA A;  3BQ1 A;  2NBV B;  3AE8 B;  3WKD A;  4MEY A;  4DO9 A;  2G1E A;  2IO3 B;  2BWF A;  2LRW A;  3SV4 A;  1MFW A;  1NBF C;  2BQU A;  4W9L A;  1XT9 B;  1E10 A;  4IW0 A;  4M6W A;  1FEZ A;  1WJ4 A;  2KFZ A;  2NO4 A;  2WFA A;  2D5G A;  2K8C A;  4PL1 A;  3OPX A;  2DGZ A;  5KFB A;  4ECY A;  1OUQ A;  1UH6 A;  4K3B A;  3HP6 A;  1AAR A;  1JIH A;  3L17 A;  4MGI E;  4ED0 A;  2YB4 A;  9ICM A;  3LDZ E;  1S10 A;  3MR3 A;  3Q69 A;  2R8G A;  3KLS X;  2BQR A;  4E0D A;  4P0Q B;  3JVZ X;  4NPN A;  4DXF A;  3C2L A;  1D8Y A;  4MGZ E;  4YMN A;  1URJ A;  3HT3 A;  5HML A;  1N5X A;  4ECZ A;  4C8M A;  1VLB A;  2LZ6 A;  3QU5 A;  4RQ1 A;  2K8H A;  3RNA C;  4KZC A;  2IGH A;  2K5P A;  2GBM A;  2FMQ A;  1YX5 B;  4KSK C;  4BUG A;  3Q8Q B;  5J2K A;  3PW4 A;  8ICY A;  2GBK A;  3ZRF A;  1FNU A;  1ZQR A;  3C23 A;  8ICN A;  1WGY A;  2XID A;  2P35 A;  3NG0 A;  3T3O A;  1KQQ A;  3UQ0 A;  3BDP A;  5ALN A;  4MDK E;  4RQ5 A;  4W9H A;  4UBB A;  1F52 A;  4I2J A;  3PNC A;  2CHX A;  1V1O A;  4AWJ A;  1PK1 A;  4GLS C;  4F4Y A;  1NVI D;  4PYU A;  5LXH A;  3DWG C;  2KK8 A;  1D5Z C;  3UXP A;  4J9M A;  4R63 A;  2FCM A;  1J7C A;  2JXX A;  2N9K A;  1YJI A;  2ZPN A;  4M0W A;  3GB1 A;  2E3T A;  2W9C A;  3IRU A;  2GWS A;  3QXG A;  2W7O A;  3ZDD A;  3Q2A C;  3FC4 A;  4YSZ B;  4J9L A;  5H8Y E;  4FE3 A;  4FXC A;  2AXT U;  4BFR A;  2WDR B;  4HJG E;  3LWM A;  5B66 U;  4DSL A;  2M56 B;  3MDC A;  3V60 A;  1U4B A;  2KC1 A;  8ICS A;  4IQT A;  7ICE A;  3D6J A;  2WAQ C;  4GGQ A;  5KFI A;  2DKZ A;  2CU3 A;  1E8Y A;  5J0W A;  2R61 A;  1V97 A;  2AEH A;  1D9F A;  2LYB A;  4RUA A;  2QEJ C;  5L1I A;  4D2K A;  4MEX A;  1F0Z A;  2BR0 A;  3SU8 X;  3OAW A;  1WCN A;  3PSE B;  3V6C B;  4ARI A;  4YR2 A;  3PGE A;  4TQS A;  4DCC A;  1I4X A;  2KK0 A;  2JWU A;  5J0P A;  2AQ3 B;  2JRI B;  2K4P A;  3NY5 A;  4QAY A;  5IA7 A;  3A9K A;  4WWN A;  2W03 A;  3SR6 A;  4AP4 C;  4II2 B;  2KJ8 A;  3PX0 A;  4DF8 A;  3MDA A;  1T0Q C;  5AM4 A;  4RNN A;  1CRX A;  1ZE3 D;  4DSJ A;  4C4S A;  1NJY A;  3M9M B;  1A0P A;  2HJ8 A;  4HKQ A;  2XY6 A;  2HTH A;  5AZF A;  1C4C A;  3OJU A;  4IQV A;  1L3S A;  3QUC A;  2D3C A;  3SHQ A;  3KUZ A;  2BGW A;  2LJ5 A;  2MA1 A;  3FDS A;  3WK4 A;  1SGH A;  3UXN A;  2HBJ A;  4KGS A;  4LJO B;  3L54 A;  4TQ0 A;  4HEA 1;  4W9I A;  4KTQ A;  3DBH B;  5TIS U;  4YXD B;  3QC8 B;  2BPC A;  1L7M A;  2ZVN A;  2DAJ A;  1T6B X;  2L52 A;  3PV1 A;  5BMG A;  2WF5 A;  1X6I A;  2C7M B;  1ZUD 2;  2W11 A;  4UB1 A;  1TKE A;  1WR1 A;  3P1M A;  5FR6 A;  4JMU A;  1X9W A;  5I4D A;  3OJ3 A;  2N9E B;  4GDK B;  2NTT A;  3KYC D;  3Q8S B;  3WU2 U;  1J7A A;  1FXA A;  2FCS A;  3QCA A;  4OJO A;  1GB4 A;  1KJT A;  2W04 A;  2BWE S;  1PVQ A;  2UVV A;  2C2D A;  3Q8K A;  4GIB A;  2WNM A;  5J2G A;  8ICK A;  1AN8 A;  3TL5 A;  1QLN A;  4RNM A;  4M02 A;  1YN5 A;  4JK1 A;  3P4Q B;  3R2T A;  2NRX A;  2ZIV A;  2JQR B;  1KLG D;  4U7C A;  1UBI A;  4QZI A;  1ISN A;  4IKG A;  1TAU A;  1WIA A;  3TQ1 A;  5KT7 A;  2JH1 A;  4HKZ E;  4EZ6 A;  1TTN A;  4J9K A;  1MC8 A;  1SXD A;  1XNS A;  1KLU D;  4NQK E;  1KDH A;  3TAC B;  2Z7J A;  5AM2 A;  1IGD A;  3N30 A;  3W1S C;  3T8M A;  2R2Q A;  4ZDV A;  1RFK A;  1HA5 A;  3NVZ A;  1ZQW A;  3NRZ A;  3H8S A;  4ICA A;  2PKO A;  1SXE A;  3KH0 A;  4KLH A;  2KJ6 A;  5KT5 A;  3VVW B;  4DQI A;  1FFU A;  5ALZ A;  4OZC A;  2IHN A;  3K75 D;  1V9J A;  2QHO A;  2Z0E B;  4DL2 A;  1H38 A;  4CE6 A;  2WTF A;  2K0P A;  4ACF A;  4Y2P A;  3NGD A;  3WKB A;  2DQN B;  2DPI A;  3MHS D;  4RMA A;  3M9N B;  3KWV A;  4DLE A;  1MJD A;  3BYT B;  2K6Q A;  1RDF A;  3W2D A;  3RD2 A;  2FMS A;  2INP E;  3AEV A;  8ICX A;  3M8R A;  5EDS A;  5KG1 A;  1J8C A;  1ZQV A;  3WK9 A;  4DEZ A;  1PYW D;  3NRW A;  3EC8 A;  4O3S A;  1B9R A;  1WM2 A;  1KTK A;  4FBU A;  4AQ7 A;  2BHN A;  4Q8E A;  1NK0 A;  1PZN A;  4F5R A;  4ZHP A;  3A0B U;  2ZUD A;  3B0X A;  3ALB A;  3AMZ A;  4RQN A;  2R8H A;  3RTV A;  2MP2 B;  3I76 A;  3TSS A;  2DPJ A;  4O5C A;  1E90 A;  3BII D;  1NZP A;  4QZA A;  1EF5 A;  2OWO A;  5G2N A;  3ZIM A;  3BQ7 A;  3DEE A;  3QUT A;  2MX2 A;  2OJR A;  3I1Y A;  5HHI A;  3SDL C;  2BW2 A;  5DPT A;  5EE3 A;  1S97 A;  3RNG C;  2ZIU A;  1L3T A;  3TEZ A;  2WXR A;  2WDT B;  8ICU A;  4DQP A;  1WX7 A;  2PEA A;  2YTU A;  3H7I A;  2JPH A;  2WU2 B;  2VA8 A;  4RQ0 A;  4EEL A;  4RU9 A;  2NV3 A;  1MG4 A;  4K7S A;  5E6N A;  4B9K A;  3T9L A;  3X23 A;  1SKW A;  1Z5S B;  5AIC A;  1DOY A;  1Z1V A;  2HSZ A;  9ICE A;  3ALR A;  3MGH A;  2BQ3 A;  1V80 A;  3B0A A;  4RH6 A;  2MUT A;  4DWF A;  4OW0 A;  5HG2 A;  4BZA A;  2CHW A;  5KG7 A;  1PFD A;  2BYT A;  2NYV A;  3M6K A;  1V86 A;  3PW5 A;  1AYF A;  2IOF A;  4CO7 A;  2KP7 A;  2EAO A;  4ELT A;  2KSO A;  2BCS A;  1HTO A;  1XO1 A;  2W8K A;  1STE A;  3QX1 A;  4GMV A;  4F93 B;  4TUQ A;  3EWA A;  1JUD A;  3AED B;  5KAF U;  1YT3 A;  2AJQ A;  9ICK A;  9ICI A;  1ZQH A;  1IXR A;  1HZ5 A;  5DKW A;  4J9O A;  3CWI A;  2P6R A;  3ICX A;  5ALU A;  1D5M C;  1AWD A;  2IA6 A;  1A5R A;  4DHJ D;  1ZQM A;  3V61 A;  5IIK A;  3AU4 A;  1D3Z A;  2JY6 A;  2FPL A;  4Q44 A;  1FRR A;  3WAP A;  3P4P B;  4HPL B;  4NAW B;  1SL2 A;  2QIE B;  1L6U A;  1JWB D;  4OD0 A;  4DL5 A;  3AXC A;  3N7R C;  4FJY A;  5LNK 1;  4YVZ A;  2GBN A;  2CR5 A;  1Z00 B;  3RNE C;  3R2I A;  2Z8L A;  2NR2 A;  2CJN A;  2K89 A;  5G5G A;  3H9D A;  3LB8 C;  2LYH A;  5KT4 A;  1DOQ A;  4NLG A;  2OCE A;  1FEH A;  2WX1 A;  2WAQ F;  3MC0 B;  3P63 A;  3V62 A;  1ZQS A;  3Q8A A;  1COK A;  5DG7 A;  3BYY B;  4HK2 A;  1E8W A;  8ICP A;  3I57 A;  1SL1 A;  2Q0Z X;  3SAF A;  4MH8 A;  4IM3 A;  2CPR A;  4RQ4 A;  3RUI B;  1L2N A;  1N60 A;  1ZET A;  2FLL A;  5AEK B;  1ZQG A;  3GZF A;  4KLL A;  3V6E B;  2OH2 A;  1ZGU B;  2WS3 B;  5BOL A;  2V3N A;  1X9X A;  3NOB A;  1RLF A;  2FMP A;  3IT6 B;  2VA2 A;  4WWP A;  4G9B A;  2ZIW B;  3KUC B;  1QSL A;  3IP4 B;  1E7V A;  3LK9 A;  2R8K A;  3PTF C;  1ZP0 B;  3ZW3 A;  1S5L U;  1T5X D;  1SZP A;  3RPF C;  4ASW C;  3N9Y C;  3LDA A;  1KF6 B;  2YVC A;  3OJS A;  5J8Y A;  3NVV A;  2J0M A;  2JRZ A;  3W1S A;  1V5O A;  4S17 A;  4A20 A;  3UIO B;  5TSS A;  3L10 B;  5AM5 A;  4EYH B;  5G55 A;  2XGQ A;  4AOF A;  4Y2Q A;  3BWU D;  1WJN A;  1I35 A;  1Z2M A;  3WAM A;  2VRR B;  3SFE B;  5DQI A;  2ZXH A;  2LEK A;  4BOZ B;  3TAD C;  4EZL A;  1Y88 A;  3ZD8 A;  3ZRC A;  1ZRM A;  1ZDV A;  3D2S A;  1K8R B;  2ZG6 A;  2I1K A;  3JPR A;  1LO5 D;  1YJJ A;  3L08 A;  3OJ4 B;  4DS5 A;  1EF1 A;  2PXI A;  2WHI A;  4WAA A;  2KWD A;  5AI8 A;  1SZH A;  3ZDE A;  1C4P A;  2JH7 A;  2K8A A;  8ICF A;  1D6E C;  1WE7 A;  1L3V A;  3ECI A;  3PW2 A;  3QNM A;  1SJH D;  1XLQ A;  3B08 A;  2A1A A;  2XGP A;  3SV3 A;  1JML A;  4ED7 A;  1OXJ A;  8ICB A;  5L83 A;  1GB1 A;  4ZYS A;  2WQY B;  1S77 D;  5FK9 C;  5L95 C;  4DK5 A;  2PFN A;  4EUT A;  1Q5W B;  2YLM A;  2KHW B;  2E8N A;  1B1Z A;  1IM4 A;  3AV8 A;  3ZNZ B;  3Q3F A;  1PVP A;  2WXQ A;  1Q3V A;  2WXI A;  2AQ4 A;  7ICJ A;  2B0C A;  4XWW A;  4JV1 A;  2FDR A;  9ICQ A;  1PQS A;  1YJ1 A;  3BK1 A;  4Q45 A;  1EM7 A;  3ZUN A;  3EPI A;  2REX A;  2BCU A;  5C5J A;  1AQ6 A;  4C7Y A;  4NLZ A;  5KT2 A;  4QZE A;  3C5F A;  2KN7 A;  4KKJ A;  2N1R A;  1HUZ A;  1L4D B;  3ORY A;  4F5O A;  2HOF A;  2EH9 A;  1L7O A;  2XCA A;  1NKE A;  2LUE A;  4IL6 U;  3U26 A;  9ICX A;  2N7D A;  2NPT A;  1X66 A;  8ICZ A;  1TZO A;  2KT7 A;  2G5H B;  1BNP A;  1SE4 A;  4US8 A;  4F1S A;  1T0S C;  2M0X A;  3BZD B;  2RDH A;  4JL9 A;  3QIJ A;  5G5H A;  4F71 A;  4XZ4 A;  4JWN A;  3H4B A;  3NTU A;  3VFK A;  1ED1 A;  4DL3 A;  2BZF A;  1Z1B A;  4TSS A;  4P7I A;  1MVK A;  3Q8C A;  2M0N A;  4K4I A;  7ICT A;  9ICW A;  3WK6 A;  4CF4 A;  1GC7 A;  1BPX A;  1O08 A;  8ICE A;  3A9J A;  3ZJU A;  2R18 A;  1Y56 A;  4P6V F;  1YQ4 B;  3QAQ A;  2GLE A;  1ZXI A;  3GU3 A;  4ZHO A;  4M0A A;  2D3B A;  4YTN B;  3PO0 A;  4NM2 A;  4CGZ A;  4PHP A;  3FIL B;  3OWE B;  2BS2 B;  4LDT B;  1NNL A;  4PL2 A;  2WXL A;  1YQ3 B;  4IQW A;  2CRX A;  2FCQ A;  2KFK A;  2HHT A;  1QLB B;  2PLP A;  2N9X A;  2AYO B;  2GBR A;  3PVL A;  1ZQC A;  5DGB A;  1NEK B;  2MHJ A;  3UQA A;  2RSU A;  4J9Q A;  1GG3 A;  1WE6 A;  5E6J A;  3ABV B;  2Y5C A;  2ZCC A;  7ICM A;  3EGR A;  2ODG A;  1L7P A;  2W9N A;  4O3M A;  3EYZ A;  3QA8 A;  5AUI A;  1VJK A;  2N1V A;  2LXA A;  3VUY A;  2RDG A;  3RN9 C;  1XLN A;  1DYQ A;  1J0G A;  2QB0 B;  3ZO5 B;  4K1R B;  5L1K A;  2LAS A;  3RJG A;  1IGC A;  4LK0 M;  1ZQ1 C;  2AHO B;  1OGW A;  4P4P A;  4MAC A;  1NKC A;  1T0Y A;  3C2K A;  1MN8 A;  3ONN A;  4IM2 A;  1A6S A;  3Q8R B;  5DPR A;  2A4Z A;  2BPF A;  2JU6 X;  3TFR A;  8ICT A;  2PTL A;  1I4R A;  1E8Z A;  4DL7 A;  2D6F C;  2PE9 A;  4HDQ A;  4F7Z A;  3RRG A;  3DPD A;  4MSM B;  3ZXR A;  1S0O A;  2G08 A;  5DBA A;  2N7E A;  4RQ3 A;  4DSF A;  2O6K A;  1UQV A;  1T4G A;  5J8Y C;  4R8U B;  1IIP A;  1C76 A;  1VZ6 A;  1WGR A;  2KWC A;  5D3I B;  2NRT A;  3QZ7 A;  5BYS A;  2JR5 A;  1SEB D;  2JYE A;  4HCN B;  4K81 A;  4P16 A;  4RQ2 A;  2Y1I A;  1L7Y A;  4C8K A;  2QC8 A;  1KTQ A;  4IC9 A;  2L32 A;  3QEA Z;  1DGS A;  3AU2 A;  4OVZ A;  4AUQ C;  1K1S A;  4XUS A;  4I27 A;  2N4F A;  2LD9 A;  1ZQU A;  1XO3 A;  4PS7 A;  2NRZ A;  3BQ2 A;  1DOI A;  2C7H A;  3RNB C;  1ZQB A;  4M6W B;  3RZF A;  3UIN B;  3L0W B;  2IMW P;  4IS7 A;  1GNU A;  1WM3 A;  3R7R A;  2ZIX A;  4QZB A;  1CI4 A;  1ET9 A;  2M17 A;  1CEZ A;  5AKX A;  4B9V A;  4Y2U A;  2ZJ8 A;  4YXJ A;  1NKB A;  5ALD A;  1ZQT A;  4HAI A;  4YQW A;  1SB3 C;  3IHP C;  3HKZ C;  4O5K A;  2Z0D B;  1WXM A;  2ZTD A;  3AL0 B;  5CWR A;  3CIR B;  4TUP A;  4A9A A;  4XWT A;  1O03 A;  4M9N A;  2WF6 A;  2RDJ A;  2JGA A;  4RGT A;  3WK5 A;  1V49 A;  1QH9 A;  1JXL A;  3HM3 A;  3BZK A;  2L5Y A;  4WJQ A;  4M04 A;  3NHE B;  2KZM A;  1HIW A;  4OJP A;  4B9N A;  4I2D A;  5ALT A;  3RNF C;  3T5L A;  3TBL D;  3IM1 A;  3WKE A;  5DB6 A;  2VJ5 A;  4K7U A;  2DEN B;  3QUQ A;  3Q3M C;  5KTQ A;  1NZB A;  4ZYN A;  4JLC A;  8ICI A;  2FPK A;  2OYY A;  1OFF A;  2IY0 B;  1YZ7 A;  5CHV C;  2E8P A;  4ZOH C;  2M0A A;  2HOI A;  2K22 A;  2KKP A;  3RUL A;  1WI0 A;  5ALX A;  1HUO A;  4LDT D;  1NEN B;  2EKE C;  1BUI C;  1WRI A;  1WG8 A;  1KRH A;  1ZQL A;  8ICH A;  3JSV A;  1QQ6 A;  5KFM A;  3T5K A;  2KQ7 A;  4TUU A;  3A9J B;  2LRU A;  7ICG A;  1QSS A;  1P7F A;  3BS7 A;  1QQ5 A;  4P1C C;  1PGB A;  4S0R A;  3J9C A;  4A6Q A;  2FLN A;  7ICO A;  5ALV A;  2J0K A;  1RM6 C;  2RQ5 A;  3MFH A;  5GTH U;  4QWC A;  2FE9 A;  2KKV A;  3DBL I;  3FKY A;  2AGO A;  3U7Z A;  4BVU C;  4QW9 A;  4MH0 E;  1TJE A;  2Y0S F;  4P2H A;  1V1P A;  3AE7 B;  3BK2 A;  1ACC A;  3U52 E;  3LWL A;  2BCQ A;  4B9U A;  1MPE A;  2PE6 B;  3PRZ A;  3RMK C;  5J0T A;  4Z6D A;  5HP4 A;  2ESE A;  3H6N A;  1ZD2 P;  3GZN B;  4O9M A;  1F77 A;  4H2A A;  5D6J B;  4WAF A;  4BKS A;  1U49 A;  2J0J A;  2DLB A;  2RPV A;  3ML9 A;  3SEN A;  4NXZ A;  2YEP B;  4EYI B;  1NYR A;  4UAV A;  2ISO A;  2ZIV B;  2AL6 A;  3AH7 A;  2W3S A;  2KVS A;  3B1L X;  2XNA C;  1E5W A;  3P4S B;  3E0F A;  2SEB D;  4PS8 A;  5KHQ A;  2MQJ A;  2V3P A;  2LI6 A;  5AZH A;  1TAM A;  4KLG A;  2XY7 A;  3QE9 Y;  3MFG A;  2L0T A;  4Y2R A;  1K53 A;  4PZO A;  2WXP A;  5JU5 A;  3WIM A;  1UA1 A;  2ZVO A;  5IIM A;  4BXO A;  4F72 A;  5KFN A;  4QWB A;  4JUZ A;  3PVX A;  1U4A A;  2LGI A;  2FI1 A;  2BGF A;  3VTV A;  2G07 A;  4UQG A;  1NYQ A;  4GXB A;  4W9D A;  2MBQ A;  1DK3 A;  4O3O A;  3IBE A;  4J6I A;  4I2A A;  2V9W A;  2W54 A;  3SEI A;  1HE8 A;  3GIJ A;  5J0R A;  4DWI A;  4IRK A;  2HI0 A;  1QQ7 A;  4Q8F A;  2QB1 A;  2G45 B;  2KLG A;  4FJZ A;  3L16 A;  2E1E A;  3C5G A;  3U4E G;  2ZIW A;  5CP2 A;  4RZR A;  1J7B A;  4G3I A;  4G50 A;  4HRO A;  3Q8B A;  1P0R A;  1SSN A;  1L6V A;  5FP0 A;  3E2E A;  1IG6 A;  8ICR A;  2IJ0 A;  4P0P B;  2F1H A;  4M9J A;  2DZJ A;  2UU7 A;  3NS1 A;  5KT3 A;  1S9F A;  3JPS A;  2K4I A;  3AU6 A;  4WQO B;  1Q1O A;  3ZJV A;  2F77 X;  2PPH A;  1FCL A;  3KKA C;  3RAX A;  3VRB B;  2G3Q B;  2YML A;  4I2B A;  1V38 A;  9ICP A;  2ZIX B;  3THV A;  1C9F A;  4MGK E;  3DCG A;  2OHF A;  7ICS A;  4I2F A;  5IIN A;  4XYC A;  1C4A A;  2YMQ A;  5CB1 A;  2HHW A;  3BZC A;  2NMQ A;  3DQV A;  3O65 B;  1DXS A;  5J2C A;  4W9F A;  4JWU C;  3GE3 C;  4F4X A;  5IAA C;  3KOO A;  2K25 A;  4NJ7 A;  4A3O A;  4YMM A;  2JV3 A;  1UT8 A;  1VCB A;  2KD1 A;  1GAQ B;  1QCK A;  2FID A;  4MGY E;  5KAI U;  3V7K A;  1VR9 A;  2KDF B;  2LVO A;  4WWM A;  1P3Q U;  3PY8 A;  2I9G A;  1K1Q A;  3VR9 B;  3ZDM C;  4BOS C;  4FBJ B;  4C4V B;  2MSE D;  4O0I A;  1WJU A;  1TE2 A;  4PGY A;  5J2R A;  3GS2 A;  1MHX A;  4TUS A;  2LKY A;  3WK7 A;  2WDV B;  1L4Z B;  3MTN B;  3I63 C;  2LGX A;  5JHB A;  1YNT E;  4NJ8 A;  5F3X B;  1C20 A;  1FXI A;  2P6U A;  5IIO A;  4QZC A;  2KQ4 X;  1E8X A;  2ASQ A;  2KE7 A;  3F5E A;  1H8C A;  1RYR A;  4I2E A;  4M00 A;  1I4G A;  3AEA B;  3V7J A;  2N1W A;  2Z59 B;  2MSN A;  3SD7 A;  1B43 A;  3MBY A;  3JSV B;  2KAN A;  4LNI A;  3AUO A;  4F2R A;  1L5P A;  4ANX A;  4JWS C;  1P98 A;  5EWG A;  1L8L A;  2FUH B;  2LM4 A;  2HVH A;  4QW8 A;  3U8Z A;  4BBN C;  4F8C B;  1IP9 A;  4YD2 A;  5KFF A;  4FUL A;  4LNK A;  4RGO S;  3F5A A;  2IGG A;  4BWM A;  5GXG B;  2V4I B;  4UB8 U;  4UB4 A;  3C8Y A;  3H8M A;  4O3R A;  3B2F A;  1HEK A;  4DL6 A;  2KVC A;  2ICI A;  5CR0 A;  3WK8 A;  3MFI A;  7ICQ A;  5HHH A;  4XDD A;  3AE2 B;  2D3G A;  1BML C;  4WH4 A;  4XDC A;  3RH6 A;  3AQE A;  3N7S C;  1QOF A;  1EXN A;  2H3F A;  3T3N A;  1FRD A;  4RGN A;  5AM0 A;  4NY8 A;  5IKC M;  4I2C A;  5EWF A;  1PVR A;  2DYB A;  1XSN A;  2YN4 A;  2IBK A;  3JYU A;  4YN4 A;  2LVQ A;  3DBH I;  3PS6 A;  4JIO U;  5J0U A;  5ALS A;  5IP4 D;  5HR6 A;  4M8M A;  3VUW A;  3C29 A;  5DCN A;  1KFT A;  2C60 A;  2V0G A;  3TAD A;  5AKI A;  3TUO A;  5ALP A;  1SJE D;  3DBS A;  9ICL A;  4CF5 A;  2F76 X;  2DL0 A;  3M63 B;  5TR5 A;  4TKN A;  4F4W A;  5KFW A;  4KLJ A;  1SWW A;  3DVN V;  3CRX A;  2MA9 B;  2ZNV C;  2HMX A;  4O3Q A;  1KH0 A;  2N9L A;  4FBT A;  9ICF A;  2TSS A;  1YIW A;  3IVF A;  4NAW A;  1CQV A;  3UQ2 A;  1LFD A;  1WUD A;  3ETR A;  2RPQ A;  5J0Y A;  2E8M A;  4RNO A;  1NJX A;  1I4P A;  1WZ0 A;  3URY A;  3RBD A;  3IN5 A;  1JWA D;  5DQG A;  4IDI A;  3ZDT A;  4IR9 A;  5KFK A;  3RCZ A;  3E58 A;  5KFL A;  4ED6 A;  4PHA A;  2LUM A;  2A1J B;  2EQY A;  2M19 A;  4PT5 A;  5AI6 A;  3PX4 A;  8ICC A;  2IO2 B;  5KFA A;  3NJT A;  3KHL A;  1ZQF A;  8ICW A;  2V4R A;  5AI9 A;  4LNN A;  1TGZ B;  3BS5 B;  1E9M A;  3NZU A;  4PZN A;  3C1Z A; 
#chains in the Genus database with same CATH homology
 2QSD A;  4L1B A;  2K9X A;  2VZK D;  4WUR A;  5TSS A;  3BWU D;  3PZ8 A;  2LFI A;  4OZA A;  1UNS A;  1ZOY B;  3SFE B;  2DBY A;  2LEK A;  1SF0 A;  1ZDV A;  1LO5 D;  1YJJ A;  2K3U A;  2LMC A;  1SXT A;  4NAM A;  2KWD A;  1UWM A;  1QT9 A;  1SE2 A;  3HVZ A;  3U2S C;  1C4P A;  1F2R I;  1TS3 A;  3W5U B;  4R3D A;  1C79 A;  2WXK A;  4MM3 B;  4USA A;  2QIL A;  1D6E C;  2OED A;  2SAK A;  1SJH D;  1XLQ A;  2BB6 A;  2YEP F;  1JML A;  1PGX A;  1WWT A;  3B9J A;  3H8H A;  1E6E B;  1GB1 A;  4ZYS A;  3IAS 1;  4US9 A;  1I4Q A;  2WQY B;  2ZW0 A;  5FK9 C;  3AN1 A;  1TS5 A;  3BVM A;  3MHZ A;  2WP9 B;  1FNW A;  1MHH E;  3AEB B;  4A90 A;  4MT5 A;  2RMM A;  1B1Z A;  2FUG 1;  3AV8 A;  2WXQ A;  5BYR A;  2WXI A;  2BS3 B;  2CJO A;  4XWW A;  4NZL B;  3BK1 A;  1FMA D;  1EM7 A;  1TY0 A;  2MJ3 A;  2Y3A A;  1TYG B;  2MEK A;  1N63 A;  4C7Y A;  1QOB A;  1VZ8 A;  4C56 C;  2PW9 A;  2WXN A;  1K51 A;  4KKJ A;  3ZQ4 A;  1L4D B;  1EU3 A;  3EA6 A;  3AEE B;  5HI1 A;  3AE9 B;  1XLO A;  1D5X C;  2J53 A;  3AE3 B;  1JAL A;  4ZRP A;  4B0E A;  1FO4 A;  4TMA B;  1GOZ A;  1TZO A;  1N5W A;  1SE4 A;  4US8 A;  2H88 B;  3BZD B;  4WIP A;  2RDH A;  2JZP A;  5G5H A;  1M4V A;  1AW7 A;  1K52 A;  2JXT A;  4L2Y A;  3AE1 B;  1WYG A;  4TSS A;  3HUI A;  1MVK A;  1VRA B;  2DYO A;  3Q8C A;  4OZB A;  1QKZ A;  1C78 A;  4YTP B;  1TY2 A;  1OQQ A;  1F2R C;  3IAM 1;  1JRP A;  1EWC A;  3ZJU A;  1Y56 A;  4P6V F;  1YQ4 B;  3AEF B;  4TQ1 A;  1ZXI A;  4ZHO A;  4C80 A;  2ACZ B;  4YTN B;  3PO0 A;  3OWE B;  3FIL B;  2BS2 B;  3NZ3 A;  2WXL A;  3AE4 B;  2EKI A;  1YQ3 B;  2FE8 A;  1V1P B;  1ZDX A;  2I2Y A;  5BYQ A;  1QLB B;  1TS2 A;  1WXQ A;  2HDE A;  1QOA A;  2PLP A;  1WGK A;  4RFB A;  4EE2 A;  4B0M A;  1HZ6 A;  1NEK B;  3UI3 A;  1FM0 D;  1EU4 A;  3PZ7 A;  5E6J A;  4AS1 A;  3ABV B;  2Y5C A;  4N59 A;  3EGR A;  3R8B A;  5AUI A;  2JX5 A;  1VJK A;  1ET6 A;  2MH7 A;  1BXT A;  1YN4 A;  1JQ4 A;  2RDG A;  1XLN A;  1DYQ A;  1TKY A;  2WXF A;  1ESF A;  1FCC C;  1YN3 A;  3HVD A;  1JW9 D;  1C77 A;  4LTU A;  1IGC A;  4LK0 M;  4OHJ A;  1ZPS A;  4MAC A;  2PVG C;  3NVY A;  1FNV A;  3AE8 B;  4A55 A;  2G1E A;  1XLP A;  2DYM A;  2MJE A;  2J52 A;  2JU6 X;  1FFV A;  1E10 A;  2PTL A;  4RGM A;  1I4R A;  3MP9 A;  2D5G A;  2LHE A;  4RNA A;  3Q69 A;  3KLS X;  1IBX A;  4GDL B;  1C76 A;  1VZ6 A;  4RF0 A;  5BYS A;  5D3I B;  4DXF A;  1SEB D;  2JYE A;  4P16 A;  1N5X A;  1VLB A;  2L32 A;  2BS4 B;  4OVZ A;  2JYT A;  2WXG A;  1QOG A;  2IGH A;  2K5P A;  4XE0 A;  1DGJ A;  1FNU A;  1XO3 A;  4DXG A;  4L23 A;  4Q2J A;  1DOI A;  1SBB B;  3T3O A;  2KDM A;  1CK1 A;  2GI9 A;  3AB5 A;  3GP7 A;  4YTM B;  4CQN A;  2Y5P A;  1ET9 A;  3BVG A;  1V1O A;  4KGR A;  4GLS C;  1XF5 L;  3SFD B;  5MPO A;  1NVI D;  3DWG C;  4ITK A;  1SB3 C;  1D5Z C;  2N9K A;  1J7C A;  1YJI A;  4M0W A;  3GB1 A;  2E3T A;  1KFY B;  3AE5 B;  4HRS A;  3CIR B;  3FC4 A;  4A8X C;  4YSZ B;  4NJC A;  4XWT A;  4FXC A;  5H8Y E;  4A9A A;  2WDR B;  4HJG E;  3KQ4 A;  4RGT A;  3E56 A;  3B2G A;  3WCQ A;  4RCO A;  1FIQ A;  2M56 B;  2PIA A;  4REZ A;  2BBC A;  3ZGZ A;  2WXH A;  2CU3 A;  2R61 A;  1V97 A;  3TEW A;  3P42 A;  2QEJ C;  3IT4 B;  2L1A A;  2QMT A;  3O13 A;  4D2K A;  1F0Z A;  1OFF A;  2WDQ B;  4ZOH C;  1ENF A;  2M0A A;  2K22 A;  4ARI A;  2QJL A;  1I4X A;  2Q5W D;  2VZK B;  2JWU A;  1NEN B;  1A70 A;  1BUI C;  1WRI A;  2AQ3 B;  2WXJ A;  1KRH A;  1SE3 A;  4C7Z A;  4YSY B;  5D3D A;  1JCK B;  1P7F A;  2B76 B;  1I4H A;  3AEC B;  3SR6 A;  1PGB A;  4A6Q A;  3J9C A;  2L83 A;  1RM6 C;  1ZE3 D;  3FIL A;  1E7P B;  3L4P A;  3U7Z A;  4HKQ A;  3AM9 A;  1TJE A;  1V1P A;  3BK2 A;  3AE7 B;  2BTE A;  1C4C A;  1ACC A;  3U52 E;  3NUH B;  1MPE A;  1OQR A;  4H2A A;  1DOX A;  1F77 A;  4KX6 B;  3IXS A;  4WAF A;  4KGS A;  4TQ0 A;  1N62 A;  4HEA 1;  1UUP A;  2DLB A;  1MI0 A;  2RPV A;  4YXD B;  4KKI A;  2N7J A;  2YEP B;  1NYR A;  3AH7 A;  2W3S A;  3BVZ A;  1T6B X;  2L52 A;  1HXY D;  5BMG A;  2XNA C;  5BMI A;  3P4S B;  5EE9 A;  1ZUD 2;  2SEB D;  5C2T B;  1PGA A;  1TKE A;  2V3P A;  3P1M A;  2DWQ A;  3TEX A;  3MJ5 A;  5I4D A;  3MFG A;  4GDK B;  1WSP A;  1K53 A;  1L0Y B;  2WXP A;  2NTT A;  1J7A A;  1VZ7 A;  1FXA A;  1NI3 A;  1GB4 A;  2LHD A;  2LGI A;  3LYY A;  1NYQ A;  2WXM A;  2WNM A;  5JXV A;  1RYJ A;  1AN8 A;  2KAJ A;  1YN5 A;  3ZYY X;  3E9S A;  3P4Q B;  2W54 A;  3R2T A;  2J42 A;  2KMM A;  1R7S A;  2JQR B;  1KLG D;  2X38 A;  2LJI A;  4IKG A;  1T3Q A;  4HKZ E;  1IBX B;  4DQO C;  1FD6 A;  1KLU D;  1RWS A;  2W55 A;  5D7G A;  1IGD A;  3U4E G;  1UWX A;  1RFK A;  1J7B A;  1HA5 A;  3NVZ A;  3KWL A;  4HRO A;  3Q8B A;  3NRZ A;  2PKO A;  3HRD D;  3V05 A;  1SSN A;  1L6V A;  2J4X A;  2EEL A;  1Q10 A;  5BMH A;  2IJ0 A;  1FFU A;  4OZC A;  3NS1 A;  1IUE A;  2K0P A;  3RFZ B;  3ZJV A;  1XEE A;  1PUT A;  1FCL A;  3VRB B;  1E0Z A;  3KWV A;  3BYT B;  3W2D A;  1C9F A;  3AEG B;  2OHF A;  2INP E;  1TKG A;  4IOI E;  1C4A A;  2NMQ A;  3W5V B;  1PYW D;  1B9R A;  4JWU C;  1KTK A;  5HFY A;  4AQ7 A;  5FR3 A;  2IDY A;  2ON8 A;  4ZHP A;  1JWM D;  2W3R A;  3AMZ A;  2AQ1 B;  4ARC A;  1GAQ B;  4YT0 B;  3TSS A;  1SIJ A;  5AUK A;  2I38 A;  3BII D;  4LLG M;  1VR9 A;  1ZXH A;  4WWM A;  2GRI A;  3VR8 B;  1CZP A;  5EE1 A;  4N58 A;  2KN4 A;  2BW2 A;  1UGJ A;  3VR9 B;  2JSV X;  5EE3 A;  3VRA B;  4YWG G;  1XCT L;  3SEB A;  5H92 C;  4KGT A;  4JX1 C;  5T8I A;  2GB1 A;  4N6E B;  2WXR A;  3TEZ A;  3GS2 A;  1MHX A;  1YMH E;  1I7H A;  2WDV B;  2XN9 C;  1L4Z B;  1YNT E;  1XCQ L;  2WU2 B;  5HHD G;  1FXI A;  1ROE A;  2KQ4 X;  1K50 A;  2MJD A;  1DOY A;  3NVW A;  5FKA C;  1JRO A;  1I4G A;  1L0V B;  3AEA B;  4WQM A;  1XXG A;  4RF1 A;  3LXF A;  4RH6 A;  4OW0 A;  5HG2 A;  2NTS A;  5EE0 A;  1PFD A;  2BYT A;  1L5P A;  3FAH A;  1AYF A;  4JWS C;  1STE A;  4RGO S;  2IGG A;  3EUB 2;  5GXG B;  1P7E A;  4YSX B;  1HEZ E;  2V4I B;  3AED B;  3VQI A;  3C8Y A;  3B2F A;  1HZ5 A;  2PMV A;  3CWI A;  2ICI A;  1HQR D;  1D5M C;  1AWD A;  2PVO D;  4XDD A;  3AE2 B;  3DWM A;  1BML C;  4WH4 A;  3AE6 B;  5C3J B;  4XDC A;  4ZRQ A;  1PDX A;  1QOF A;  2FBW B;  1TS4 A;  4JE3 B;  1FRD A;  4RGN A;  3T3N A;  1CJE A;  1FRR A;  3P4P B;  4NAW B;  1VDV A;  1D4B A;  2QIE B;  1L6U A;  1JWB D;  2AQ2 B;  1QF6 A;  5LNK 1;  2IPK D;  2WLB A;  1QQR A;  2KAC A;  1JWS D;  2V0G A;  3R2I A;  2Z8L A;  4JPS A;  3TUO A;  2CJN A;  1SJE D;  1V8C A;  3TEY A;  5G5G A;  3LB8 C;  2BB5 A;  3P4R B;  3W9C B;  1FEH A;  3N9Y C;  2ZW1 A;  3MC0 B;  2AX5 A;  3P63 A;  3Q8F A;  3Q8A A;  3BYY B;  1KH0 A;  3I57 A;  4UDU C;  1JWU D;  2N9L A;  4MH8 A;  2TSS A;  2WXO A;  1CQV A;  1N60 A;  3I9V 1;  3ETR A;  1I4P A;  3URY A;  1JWA D;  2WS3 B;  2V3N A;  2W82 A;  4IDI A;  2INN E;  3IT6 B;  2HTM E;  2LUM A;  4PT5 A;  2M19 A;  2WU5 B;  1EWY C;  1ZP0 B;  2BT6 A;  1QIL A;  1T5X D;  2G9H D;  3RPF C;  1GPX A;  1L0X B;  1N61 A;  1KF6 B;  3ZJT A;  2IGD A;  3V3X A;  3Q8E A;  2ONQ A;  3NVV A;  4O1N A;  2H89 B;  2E6X A;  3W1S A;  1E9M A;  2N0S B;  4J3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...