1N63A

Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
b'KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 160
sequence length 160
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n63A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n63A01
1FXAA 3P4QB 3SR6A 3HRDD 1VJKA 2DWQA 3LB8C 3NVZA 1L6VA 1QT9A 1XLOA 2H88B 1XLPA 3AMZA 3LXFA 3VR8B 1CJEA 4YSYB 3AB5A 1QOAA 4ITKA 1AYFA 1SB3C 1NENB 1JWAD 3SFDB 3AE1B 2W54A 2H89B 5MPOA 3P4SB 1FMAD 1RM6C 1YQ4B 4WQMA 2WQYB 4YTNB 4YTPB 1TKEA 2CU3A 3W5UB 4A9AA 1QF6A 1YJJA 4HROA 3NS1A 3FC4A 1L6UA 1A70A 1NVID 1T3QA 2L52A 5H92C 1PFDA 4WWMA 5AUKA 3BIID 2DBYA 3AH7A 3CIRB 1IUEA 2BS2B 3EUB2 1I7HA 2Y5CA 3P1MA 2OHFA 1AWDA 2WDQB 4YTMB 1FRRA 3NRZA 1TKGA 1VLBA 1WGKA 1DOIA 3B9JA 3DWMA 1E10A 3VRAB 2K22A 2PVOD 5C2TB 4US9A 3AEEB 2N0SB 5C3JB 3SFEB 1J7CA 4P6VF 1WXQA 1ZP0B 2W3SA 1EWYC 2CJNA 4YSZB 2W55A 3RPFC 1KRHA 1GAQB 5EE9A 1E7PB 1FIQA 3NVWA 4C7ZA 1KFYB 1SF0A 3P63A 2KAJA 1TYGB 1PDXA 5EE3A 3AEBB 2BT6A 1E0ZA 1CZPA 2ACZB 1RYJA 1QOBA 1R7SA 1RWSA 1JQ4A 3WCQA 3P4PB 4USAA 3P4RB 1N63A 3VR9B 3AV8A 1N5WA 2KMMA 3AE4B 1N62A 1E6EB 1FXIA 1NYRA 1RFKA 1B9RA 1JALA 3AE9B 2L83A 1QOFA 3AEGB 4JWUC 1GPXA 1DGJA 1N61A 2PIAA 1FM0D 2WDVB 1FFUA 3L4PA 4N6EB 2Q5WD 4ZHPA 5H8YE 2WDRB 4FXCA 2MJ3A 1PUTA 5AUIA 2BS4B 1TKYA 5EE1A 4YSXB 4C7YA 2K9XA 3AECB 3AE2B 1ROEA 3HVZA 1J7BA 1WWTA 4C80A 3DWGC 1N60A 2HTME 1VDVA 1ZUD2 1WYGA 3AEDB 3CWIA 3NVYA 2K5PA 4N58A 3AM9A 3AE6B 1J7AA 3AE8B 1N5XA 4ZOHC 1XO3A 2WP9B 1JROA 2QJLA 1WRIA 2WLBA 2WU2B 3B2GA 3AE5B 2M19A 1XLQA 2EKIA 1L0VB 1XLNA 2PKOA 2PVGC 4IDIA 1L5PA 1UWMA 2E3TA 2LEKA 5GXGB 1NEKB 1OQRA 2W3RA 1KF6B 1NI3A 5EE0A 3ZYYX 3ABVB 2MH7A 3HUIA 4JWSC 1FFVA 4YXDB 2WU5B 1JWBD 3AE7B 1OQQA 5G5HA 1DOXA 1TJEA 2BS3B 3AN1A 2WS3B 3AEAB 4YT0B 3ETRA 4LTUA 1F0ZA 1ZXIA 1ZOYB 1QOGA 2QIEB 5G5GA 1YJIA 1OFFA 3PO0A 4KX6B 3B2FA 2AX5A 3VRBB 1JRPA 3W9CB 4N59A 1NYQA 2G1EA 1FRDA 1QLBB 1SIJA 3W5VB 4ZHOA 4HRSA 1JW9D 2FBWB 1V97A 3FAHA 4JX1C 1DOYA 2MJDA 1YQ3B 2B76B 2JQRB 2JX5A 1E9MA 3NVVA 2MJEA 3AE3B 3AEFB 3KWLA 1FO4A 1V8CA 4US8A 2CJOA 2M56B
chains in the Genus database with same CATH superfamily
3SR6A 2KV2A 3HRDD 3H8MA 2ALZA 2KOXA 1XLPA 3AMZA 3OG5A 1C76A 4ED0A 4GB9A 1KLUD 4F72A 5F3XB 4KDIC 4KV2A 2ZIVB 3UMGA 2KJ8A 1J0GA 5DQIA 5KG1A 3WANA 2D2QA 3PX6A 2G45B 2HHXA 2HHVA 4MDKE 4WQMA 3SEIA 3JW0X 1L7OA 2BB5A 4EKUA 1OQYA 1ZRNA 4RQ5A 5KG7A 3EWAA 2BS2B 2R2QA 3G6VA 2BWFA 1X42A 2NMQA 5KFVA 1S0OA 1WM2A 1NDDA 5GTIU 3ZDDA 1A0PA 1K50A 2VANA 2ZW0A 2QEJC 4B9NA 3N32A 3H40A 4BVUC 4RMAA 2W7OA 4TQSA 2JWUA 3RUIB 5KFOA 2KKPA 5ALLA 1LB2B 3RH4A 3C0RB 2JZ3B 3PR5B 2WXNA 2WXLA 3DHGC 2LRUA 2WXGA 5DLGA 4O3QA 1EF5A 2KMMA 4HKQA 1DRGA 5KFHA 4Y2YA 2MP2A 1KN5A 3ZO5B 3NOBA 1WH3A 1NJZA 3RAXA 2AH5A 8ICUA 1QQRA 3HKZF 2OOBB 1ZQEA 3IM1A 1C20A 4FLHA 3N9YC 4FULA 3KQ4A 5ALIA 3NTUA 3I9V1 1HXYD 3PZ8A 1WUDA 2OYYA 1WR6E 4C4VB 3HVZA 3CNHA 2HD5B 1WX7A 2KVRA 3N1YC 3T3FA 1N60A 5HKHA 3W1SC 4C00A 5KFBA 5KFSA 3UMCA 1MQ2A 3ORYA 4TUPA 4JGHB 2W9BA 1ENFA 1HTOA 4B0MA 1NKBA 2W9AA 4JWNA 1ZQBA 4HAIA 1L0VB 2PKOA 3QZ7A 1XT9B 1SIFA 3TACB 3HP6A 1L5PA 4L1BA 1ZQUA 4LZDA 4ANUA 5GTHU 1RQLA 2DNFA 5JRTA 5DPSA 4J03A 3HW8A 3SDLC 4DQQA 3FDSA 2H3IA 2N1RA 1YMHE 1TT5B 2JEFA 1TAQA 1XC9A 3PLVA 2W9CB 1ZDVA 3ZNID 4AP4C 3DQVA 4Y2SA 4TUUA 1ZQAA 2LGIA 2BPFA 1WMHA 1ZOYB 4IQTA 4ECXA 1UELA 2QIEB 2LHDA 1TBEA 3V3XA 4OVZA 4PH5A 3GZNI 3OJ3A 2BDPA 4HCPB 4QZ8A 4W9LA 3RNBC 1C7YA 5KFEA 2X8XX 2KSOB 3HILA 2K89A 2C28A 2GOWA 2R61A 2HMXA 4HCNB 1TVAA 4ELUA 7ICPA 1IBXA 5F9LA 3TL5A 3ZGZA 2JYTA 2P6RA 1VJKA 4P0PA 3NVZA 4DSFA 4RGMA 2M8SA 3KUDB 2D07B 1ZD5A 1F1HA 4ANXA 2VA3A 4J9SA 4WJ3B 1C79A 1QOAA 3ZQ4A 3UPQA 4YD1A 1YT3A 1YX6B 2NO5A 3DVGY 2LGYA 2LYAA 2W54A 1E8WA 3UIPB 4MFFA 4BOZB 2V4LA 4QWAA 2IO2B 4P1BC 2BKFA 1T0RC 5ALUA 4GIVA 3QA8A 4IRCA 1I35A 2UU7A 4MEYA 4N9F4 3EUB2 1I7HA 5D7GA 3GU3A 2XY7A 4IR1A 3NRZA 1M6YA 2VA8A 2WFAA 4RFBA 1NOMA 3UMBA 4KLDA 3F5EA 1R4MI 2OH2A 4JUZA 1SKRA 2QHOA 4FJVB 2N1WA 3LYSA 1I4GA 1NK6A 3OAWA 4X5VA 3BQ2A 1KDHA 3SD7A 2YB1A 2QSDA 3RCZA 3N7RC 3OPXA 4ANVA 3T79A 4A3PA 1SE4A 1LO5D 2PPHA 1ZQKA 1V81A 4EOYA 1A5RA 4LJOB 1K53A 1GPXA 5AI5A 2KDBA 4WAAA 3MDAA 4EBEA 3HKZC 1KJTA 5IOIA 5KL1B 1XCTL 4OZBA 2F77X 3IFWB 3N28A 2INDC 7ICOA 3V61A 9ICRA 4ARIA 1BNPA 2NBVB 5AKZA 2K5PA 3ZIMA 3HPOA 3Q6BA 2CS4A 1ZJMA 1HUZA 2K39A 1ZJNA 2C7NB 4E0DA 3MDCA 4WJOA 2WF9A 1XXGA 1M4VA 3PW2A 1SEBD 1XLNA 2P35A 1ZQ1C 2O6VB 4RNOA 1V49A 1Z4NA 2F2AB 2AL6A 2XO7A 3ZYYX 4JWSC 1FFVA 3QE9Y 3M9OB 4KX5A 2KJRA 4PL1A 4ECZA 1F44A 4I29A 3A4RA 4BZAA 4FS1A 3AEAB 4LK0M 1TY2A 3WALA 2CKHB 5G5GA 2ZTEA 1S97A 5TZVA 2RQ5A 1IGCA 1ZQYA 2PFOA 2KJ9A 4DLGA 1FNUA 3B1LX 4JLCA 4I2GA 4N59A 2PEAA 2CXYA 1QQ6A 2QMTA 4QZFA 3Q2AC 4XRHA 2INCC 4E74A 2B76B 2FPMA 4CO7A 1ZQXA 3PS6A 4XC2A 2BCUA 4US8A 1MPEA 1RG6A 3SU8X 1M94A 2KDEB 2FLLA 2EELA 3IG3A 3SYZA 2ZIUB 4YSYB 2O6VD 1WFYA 2F1IA 2R8HA 1H38A 3SFDB 2H89B 3LK9A 1MN8A 3IHPC 1RM6C 2HI0A 4OJ6A 1I4XA 4DWFA 3OWEB 1T0YA 2HCFA 3JPRA 1ESFA 3ZRFA 3M6ZA 2LKYA 2VZKB 5TSSA 3P1MA 3X0WA 3RD2A 4XUSA 3VFKA 4TURA 2KK8A 9ICNA 1FEZA 1BMLC 2NR2A 1TAMA 5L83A 9ICJA 1RRBA 4RPYA 1ZQMA 4LDTB 1NK5A 5JZEB 2FPKA 1ED1A 5ALFA 4RNNA 2NS5A 2RR9A 2E5SA 1AARA 1F2RC 3Q8KA 1YN5A 2MUTA 1V5TA 2KX0A 2EZXA 2JT4B 5CR0A 4RPXA 2ASJA 1A76A 2KC1A 2BYVE 1U4AA 4UAZA 1O08A 2IYDB 2WF6A 5DDMA 3H8JA 4DF8A 5ALZA 1XSPA 1TK5A 2QC8A 2KIWA 3TADA 3JVZX 4P7IA 5DKWA 2PIAA 2DHZA 1XEEA 1FFUA 3GP7A 2KNJA 3MR6A 2ZNVB 4WH4A 2ZUCA 1CUKA 2KWVB 3ZJVA 4NLKA 3N7SC 4DXGA 2D8CA 4PK1A 4DOAA 4CF5A 5FP0A 1ZQPA 4DL3A 4UBCA 2LUMA 2VZKD 4YVZA 1VDVA 1Z00B 1WXSA 3ZVVA 5B66U 3AM9A 3Q8EA 4ED3A 3GOEA 2BBCA 1NZBA 3BDPA 2KD0A 2AGOA 2KQ7A 4LDTD 1ZQIA 3WKEA 4TMAB 2Y1IA 2IGDA 3A33B 2AL3A 2M0XA 4BAXA 1Q8KA 4F92B 1K8RB 4UB3A 4FZNA 1IM4A 5ALGA 5CWRA 2ES6A 5D46A 2MRPA 4A55A 3BINA 5ALHA 3V60A 4ACOA 3ENEA 2R18A 2I9GA 3A9JB 4M0WA 2ZUDA 5J29A 1ZXIA 2FIDA 3QHTA 3MJWA 2KC2A 2RPVA 1SE3A 1JWSD 1D8YA 4WURA 8ICAA 2JRIB 2WX0A 3K9PB 3JPOA 1XU4A 1KKXA 1ZYQA 1SWVA 4RQ3A 5ALOA 4R65A 3RRHA 2OEDA 4AS1A 4IQVA 4TUQA 2WF5A 2BW2A 2BZFA 2WDRB 5CB1A 4XWTA 1ZDXA 4O1NA 4EZJA 1XLOA 1L6VA 4GDLA 5ALDA 1F0MA 3KZXA 1CJEA 2NPTA 1NK9A 3RZWC 4MGIE 3MJ5A 3N7PD 2FPLA 5J0SA 4EYIB 4MEXA 1EM7A 4BDPA 1YQBA 4II3B 4LNNA 4HYKA 2VH1A 3KHLA 2WX1A 3BZDB 3PW4A 3T3OA 3H0RB 2DZMA 2LJ5A 1J2NA 3KUCB 2FCSA 2ISPA 2CU3A 3V6EB 2ZVOA 2FUG1 3V62A 2Z7JA 4NY8A 3GV8B 3SEBA 4NZLB 2A5UA 1OUQA 2RLTA 1L0XB 1STEA 2J6UA 4OVUA 4LNKA 4EFOA 2ZJ5A 1SL1A 4RQ0A 3RFZB 5AZFA 5J0OA 5DG7A 4GDKA 1AROP 3IHQB 5K4LA 3OHBA 4DFDA 4QZEA 4YFKA 1UA0A 2XIDA 4DQRA 2DYBA 3F2BA 2LJIA 4ECVA 2NYVA 3X23A 2FNJB 3FKYA 4W9IA 1S76D 3ALRA 1AW7A 3M8SA 1QOFA 9ICMA 2KJHB 1RAXA 3HK0A 1FM0D 1PUZA 1MSWD 4B9KA 2FLPA 4FO6A 2F1HA 2NRZA 4MH0E 4EEWA 1SV0C 5E6JA 1KW4A 2PFNA 4NLBA 3JPSA 1QSLA 5J2AA 3SI8A 1J7BA 3NASA 2ZUBA 2G9HD 5AI4A 3AEDB 5KT4A 4QW9A 1HUOA 3AQEA 9ICLA 3SMVA 1J7AA 1WI0A 3KYCD 1T5XD 4DOBA 1COOA 2WLBA 5J2HA 4UQGA 3T8MA 2AQ4A 5DB8A 3Q8QB 4K81A 2NBWB 3A9KB 1LKYA 2Z59B 4I2HA 3K4GA 2AQ2B 5J17A 4QWDA 5AKHA 3CF6E 3L3FX 1ZD2P 9ICEA 4XDDA 4ZRQA 2GBKA 3AQFA 2LFIA 4DHJD 1SXDA 4M00A 5T8IA 2MU2A 3PLUA 2DPIA 3L5KA 1P9DU 2WGSA 4HJGE 1JUDA 1B43A 1D6EC 2IOHA 1NYQA 1SZPA 3P2BA 4K7UA 3U52E 3PNCA 2NTSA 2IHNA 3W1SA 4BBNF 1NKEA 2I1QA 1Y88A 1Q3VA 3M3JA 4ZHOA 4DQPA 3V6KA 2KKCA 1YQ3B 2MJDA 3APFA 1BGXT 2XK5A 1XF5L 2UYZB 3R7QA 4O3SA 2JF5A 1ZD3A 2KMCA 3TJPA 1ZQGA 3UIOB 2NRWA 3RJFA 4I6NB 4O3PA 5HR7A 4I2FA 2BWES 4IRKA 2K8CB 2XN9C 2BYFA 2ZG6A 5KFZA 4P0QB 2RD0A 2JXJA 4F8RA 5IO9A 4GLXA 1ZXHA 3BY4B 2ASLA 2LUEA 1WCNA 4HPPA 2MRLA 1L6UA 1QILA 1TZ1A 5AUKA 5BOMA 1LXDA 1F77A 2WDQB 2K25A 4TUSA 3KFUF 1TS2A 5J0XA 1U48A 2BKEA 2Z0EB 1YZ7A 2H3VA 4JIOU 3D6JA 2NV3A 3AEEB 2IJ0A 2HTHA 1SBBB 2KZRA 4P6VF 5FR6A 1UT8A 1X66A 5G2NA 1K1SA 4BJQA 3N1XC 5BOLA 3UGBB 1KFYB 4RM8A 3T5LA 3P63A 1Z1VA 7ICUA 4OZAA 1L3UA 2G08A 2YY6A 1SJHD 4L2YA 3B0AA 3ML8A 5H2FU 1RWSA 1WJUA 3MBYA 4RQ1A 3OHAA 4UARA 1N5WA 3PY8A 2A1JA 2IGHA 4RF1A 2KMDA 5DQHA 2N9EB 5KFQA 1JALA 2JH1A 8ICVA 2LBOA 1DGJA 2OXOA 4F50A 3KHRA 8ICPA 3H7PB 2QARB 5B5EU 3FYHA 3F53A 1S5LU 2N9LA 1B1ZA 7ICIA 1PUTA 2DAJA 5IKCM 4ZH4A 3AECB 4DWIA 5KT3A 2DF4B 4AYBF 4DSIA 3DV9A 4C80A 4XGAB 2WTFA 5ALJA 4KGSA 3KWVA 5AIBA 3NVYA 2PMZF 3WK8A 2Z8LA 7ICKA 2FMSA 8ICYA 5BYQA 5DBBA 8ICQA 4ZYSA 3MC1A 1SSNA 4WQOB 2EAMA 1T0QC 1ZE3D 3LWMA 2ZJAA 3QEBZ 3AXCA 3KH0A 2J52A 5FR3A 4C8KA 3ONSA 7ICQA 4O3MA 4A3OA 5EOZA 3J81j 3CW2C 3M7DA 3PW0A 2CR5A 4M9NA 2N9XA 3PW5A 4YT0B 3R8BA 3W2DA 4NJ6A 4GXJA 4HPLB 3NGDA 5JH5C 3JYUA 4KLEA 1S1QB 2KE7A 2EKEC 4W9CA 2KACA 4NWIA 1EU4A 3N4MB 1NK7A 1P3QU 1MQ3A 1MG8A 2WDTB 1YN4A 2D11A 2BVCA 2JYEA 4URKA 1PGBA 3QYPA 3Q8PB 3RYTA 4YCXA 3NS8A 4BBNC 1ZQCA 2KFNA 4YXMA 3AEFB 3TUOA 1D4BA 3LDZE 3KD3A 4DQSA 4LVSA 3UQAA 1HE8A 7ICFA 5EWGA 2IO3B 1SWWA 1RZTA 4RM9A 3RNGC 3LXFA 1P7DA 4YG2A 4PS8A 4W9EA 4RQ8A 4C4SA 4Y2PA 2JZZA 5AKKA 4RQ7A 4RQ2A 4A8XC 2FI1A 1X2IA 3QXGA 5ALKA 4J9LA 2HW3A 2KFKA 1L8LA 4Z6CA 3KHHA 3V6JA 2HDEA 2WQYB 4YTNB 1TKEA 4MSMB 2AHOB 3D2NA 3HIZA 1Y56A 2Y9TA 2G5HB 5JTIA 2MSED 4J9QA 1XO0A 1R4MB 1TS4A 4KLQA 3WKCA 5T14A 3VAWA 1IUEA 3U2SC 3KOOA 4M9HA 2MSNA 2KHVA 2ZIXB 5ALVA 1L7PA 3I3TB 8ICTA 5CP2A 3KW5B 3BS5A 4I6LB 5AKIA 2EMSA 3BVGA 3ZDCA 4TQRA 3DBLI 4EUTA 4CNQA 5DG8A 1L7YA 3MABA 5CTRC 1ISNA 1KRHA 3RNAC 3ZLZA 5L95C 1SF0A 4HDOA 2KDIA 2BT6A 2W8LA 2RP5A 3PO4A 1N48A 3FILA 5KT2A 1T4GA 1JWUD 4WWOA 4USAA 3RB3A 3NZ3A 1Z2MA 3RMKC 2M4NA 2D5GA 3JPNA 3BZKA 5KNIA 5KG5A 1QTMA 3DBSA 4W9JA 3A4SC 4N6EB 4J9RA 1S0MA 4F7ZA 2JEGA 2UWQA 4DFMA 2IPKD 3BYYB 3Q3NC 1YIWA 5AUIA 4YSXB 2BS4B 5KHQA 1FPYA 1FD6A 4C7YA 1YJ1A 2KX3A 3NZUA 2LM1A 2W11A 1C1YB 2KDFB 2K1FA 1WGHA 1ZQDA 1F9JA 1BPDA 3KYDD 2E8PA 2M9NA 3EPGA 4I2DA 2N7EA 4HDQA 3K9OB 5AI6A 2EMTA 3CSTA 4AYBC 4DO9A 5LXHA 3M62B 1XO3A 3DVNV 4FADA 2DFLA 4KITB 2JV3A 3CRXA 4ICUA 4XA5A 5J0TA 2M19A 4PT5A 2KVSA 2EKIA 2R8IA 2PMZC 2HVIA 1L3SA 4JWMA 2YTUA 3PX4A 1OQRA 5DPTA 7ICJA 2MP2B 5HG2A 3QAQA 4KLTA 1HQRD 2RHFA 2A19A 4UB6U 1V1OA 2D3BA 4RCOA 3Q8AA 3Q8MA 5ALPA 1BPBA 3C19A 3H8WA 1NKCA 4NM1A 2H3QA 3RJKA 4O5EA 4F5RA 3ML9A 2MAXA 3PZDA 1U9LA 1I4HA 3V6CB 1ZW7A 2L3ZA 2AGPA 2ISOA 2KTRA 2Z0DB 2N4FA 4QIWF 4UASA 5KFDA 1WSPA 3B2FA 1JRPA 3UXPA 5BYRA 5AZGA 2KTRB 4Q8FA 1IG6A 2YLMA 2W9BB 4ECSA 3SQIA 5AZHA 1HZ6A 3ZJTA 1KRPA 2BF8B 3K75D 1V97A 5ALTA 5ALEA 4MJSA 3DOWA 1V1PA 3J9CA 3NVVA 1MVKA 2OWOA 3PRPB 4HLEA 1SXTA 2NO4A 1LQBA 3RH6A 4A8EA 2N9KA 3QU7A 5J0WA 4PHPA 4BKGA 4E3CA 3AB5A 4EEKA 2XEWA 9ICXA 3M8RA 5KFRA 3M1YA 2LWPA 3BK1A 2M0NA 4GC6A 2XY6A 3SHQA 3VQIA 2C2RA 3JSVA 1YQ4B 1WMHB 3W5UB 2J0KA 1SL2A 5J2IA 1WJ6A 2K60A 4KIKA 4W9DA 3I28A 4EZ9A 4Z6EA 2NRVA 1KFDA 2NTTA 1AWDA 4HJKA 5J18A 1KSPA 1VR9A 2QILA 1E90A 4H2AA 1WIAA 3H8SA 3GV5B 4QWEA 4EBCA 3PX0A 1HTQA 1IBXB 2ZIWA 5F9NA 2KN4A 1I4QA 3SFEB 3IT4B 4P0PB 1V9PA 5HNKA 2DKXA 1PDXA 4FHJA 4J9NA 5AI8A 1CEZA 2AXTU 1ET9A 2YN4A 1SGHA 3ZD8A 5JUMA 2BTEA 1XCQL 4JK1A 5D6JB 3VR9B 4MELA 4DDGD 3IAM1 4IL6U 1TK0A 4YN4A 1EU3A 2N7DA 2AQ3B 3AE9B 4J6IA 4XQ8A 3BS7A 4FFDA 4F5PA 2IY1B 4MGYE 3PV8A 5GMVA 2I2YA 3NG0A 3L4PA 2IY0B 3PSEB 4ZHPA 2PXIA 2AJQA 2F76X 4AJWA 1H8CA 4ED7A 4F4WA 4P4OA 3D2QA 4EENA 1KTQA 2KQ4X 4YMOA 2I1KA 4GGQA 5IA7A 5KT7A 3CP8A 3PMNA 2LMRA 2ASDA 7ICEA 2GMIC 4P1CC 3TAPA 4QZHA 4Y2RA 3C29A 1X9XA 1OEYA 1WJNA 1WE7A 2FCNA 3PHXB 1XWLA 1X40A 2BPCA 1XLQA 3U8ZA 2W7PA 1WGYA 2LI5A 3H7SA 4WJPA 4RT2A 2Y9UA 1WY8A 2PJHA 4EE2A 1GB1A 1ZQWA 1NEKB 3TARA 1KF6B 1SE2A 1L0YB 3ABVB 8ICXA 2XCPA 1MG4A 3UM9A 1NJWA 2XGPA 3KUZA 1PGAA 3AE7B 4GU2A 3DEEA 2XI9A 5KFUA 3KKAC 4C8OA 2AU0A 2KVCA 2KVZA 3VH4B 2OJRA 1SGGA 1U4BA 3ETRA 7ICGA 2EAPA 2WXRA 2V9HA 1V38A 5KFYA 2WAQF 5J0UA 4YQWA 1IV8A 1SV0A 2BHNA 5J0RA 4DSJA 1HZ5A 4OCZA 2J4XA 4FS2A 2WNMA 3VRBB 5AK4A 2KJ5A 5KG3A 1JN3A 5J2GA 2QLTA 3V6HA 4LZGA 5E6PA 4G3IA 3U7ZA 1ZD4A 4QIWC 4DQIA 3HX0A 2BR0A 1JW9D 3EA6A 4KKIA 4YD2A 3MC0B 4MSQB 2JGAA 2B3AA 1UNSA 1E9MA 4DL2A 2V9WA 5DGBA 1E5WA 2C7HA 2MA1A 3KWLA 4MFCA 1V8CA 1P0RA 2I38A 2MBHA 2M56B 2DQNB 2GH1A 2DPJA 8ICWA 1ZQLA 4JV0A 3TEXA 1Y8RC 3BQTA 1F2RI 4MH8A 4LNIA 3ZDAA 2ZCBA 2MQJA 5A0LA 1MA7A 2G5IB 4NL9C 4PGQA 3GIJA 3AE1B 1J19A 3IAS1 4OJOA 3Q69A 4I27A 4IWOA 4J9KA 3VH3B 5L1KA 4OW0A 2KNBA 4HROA 3PV1A 1PYWD 1NVID 3RJEA 1PFDA 2VRRB 1Q5WB 2JSVX 4YTMB 2EZYA 5EWFA 5DLFA 3DHIC 4Q2JA 1TIFA 1HA5A 3C5GA 1E10A 4F91B 1F52A 2HBMA 4MGKE 3C5FA 7ICLA 1I4RA 1WRDB 4OZCA 2DENB 3H6NA 4EZLA 3WKAA 2ZZPB 2W55A 3E9SA 2YX8A 1E7PB 1J8CA 1FIQA 4C7ZA 4S0RA 3PZ7A 3ZI4A 3DVGX 2R2OA 1R7SA 4G3XB 3OJUA 4BOSC 4WJQA 2DLBA 3AU2A 2QCZA 2KD1A 4B6WA 3AEGB 2HBJA 1UUPA 3RN9C 4ASWC 4FA6A 3DCGA 1BT0A 5AK5A 3DDCB 4W9KA 4XX5A 4PYUA 4NJ8A 4AWJA 1GJZA 2QB1A 4NV0A 3AE2B 4PGYA 1TE2A 3MR5A 2D6FC 3H0LB 5AM1A 5I4DA 3ZTCA 2K8HA 1ZQZA 1X9WA 3OSNA 3QK0A 4UAWA 4C4TA 3O0FA 3WK9A 1ZQRA 3B2GA 1JX4A 4MM3A 2W43A 2MUTB 2K8BA 1JXEA 2IZVB 4MM3B 2FMQA 1Q0WB 1KFTA 4IDIA 3RNCC 3WAMA 1V5OA 3CMMB 3AULA 4R64A 2KMAA 5GXGB 1NNLA 5EE0A 3NY5A 4K3CA 4ZYNA 1TFRA 2E8NA 2KLCA 2XGQA 4II2B 3TMPB 2HHUA 4OJPA 3RULA 5L1IA 3ISBA 4JL9A 3B0YA 1XSNA 4I2BA 2WXFA 1F0ZA 2KWDA 1GG3A 4DEZA 1JMLA 4JPSA 2C2EA 4DL6A 2ZTDA 3PPAA 2WAQC 4F93B 4GXKA 1VZ8A 3QQ8B 3R2IA 4G0NB 1MHHE 2PFPA 4M2YA 1VRAB 4WIPA 2R8JA 4J9OA 3GFKB 1DOYA 1L3TA 4ICVA 3E56A 3MC9A 4D2KA 1FO4A 3BIID 2FJ6A 2IBKA 4U6PA 3LB8C 2N7JA 1I4PA 2B21A 1QT9A 2PTLA 4RQ6A 1GNUA 3Q3JA 2FCMA 4RGTA 3MFIA 2BYEA 3C1YA 4ARCA 3EC8A 3URYA 3QWZB 1YZ6A 4IG7B 4M0WB 1DK3A 5J2DA 1FMAD 4XE0A 1QF6A 4KZ0A 3ZTDA 3I57A 3ISCA 1UBIA 4R3DA 2LHTA 3SV4A 8ICFA 1UBQA 2WF8A 2BB6A 4Z6FA 1RYRA 8ICNA 1WGKA 4UAYA 2UVVA 1K5OA 1DOIA 1N6ZA 1UD7A 5D4BA 3L13A 3SAGA 2LYBA 4E71A 2V3SA 3APCA 4IOIE 4UBBA 5JHAA 4YXJA 1GAQB 5HI1A 4M02A 4GDLB 4O0IA 1HEKA 2NPTB 1GUAB 1TYGB 1QLNA 3G6YA 3D2SA 4ANWA 1AN8A 3FM9A 1ZKHA 2PMVA 1CZPA 2GBNA 3N20C 2LVOA 1RYJA 1QOBA 1UGMA 4IKGA 3I63C 2BYTA 5EDSA 2NVUI 1EUVB 1D5MC 1KLNA 3Q8RB 3R7RA 3QX7A 2DYOA 3S2AA 2J6TA 1UPHA 3QC8B 2WXHA 4KMOB 4K1RB 4ECYA 1WXAA 3VUXA 4IM3A 1RXWA 1L5UA 2K9XA 4WWPA 1ZQTA 3VHTC 3VTVA 3DWGC 3GB1A 2V4QA 5L1MA 3LVWA 4Y2XA 1GOZA 1ZUD2 2HTME 4WWNA 5CHFA 2IOFK 4LJXA 2XCAA 4ZOHC 2WP9B 4GDKB 2QDFA 5KFFA 4HXDA 3R9KA 1RFAA 3WKDA 9ICCA 4O5KA 5AHXA 3R66C 2LGXA 1WZ0A 3TQ1A 4I28A 1L4DB 3L08A 1AQ6A 4Y2VA 4C8NA 4KSKC 3UI3A 1UH6A 2QB0A 4F3OA 2BPGA 3VCBA 4DFJA 2IGGA 4M6WA 2WU5B 4PYZA 4A6QA 1RXVA 4UATA 2JXXA 4DQOC 2QKQA 3QU9A 4KN4A 4M6WB 3F2DA 3QX1A 3ZNHB 1A6SA 3AN1A 5EWEA 4ECUA 1TS5A 1WWUA 1DXSA 1XD3B 2JRHA 1GB4A 5HMLA 1VZ7A 4J9MA 2WHEA 4ECWA 4KX6B 3IRUA 5LNK1 4CF3A 3OSPA 1BPEA 1Q3UA 5HFYA 5KFPA 3M9MB 5D94A 2GOLA 2WXMA 3ZDMC 4EZKA 3W5VB 4QJFB 4LNOA 2MLBA 1YOVB 2FBWB 5AI9A 2B6GA 2DYMA 4F5QA 1LKYB 4GXBA 4S17A 1TKGA 3C8YA 3AUOA 5DBCA 3OGUA 3TANA 4KVGB 1X6JA 4BWMA 4ZRIA 4K4GA 2JEIA 4EX6A 7ICTA 1Z5SB 5CHVC 2LXCA 3U30A 2JZBA 3PSFA 8ICEA 4ED2A 1S77D 4WJNA 4NY0A 8ICJA 2YEPB 4ECQA 1ZPSA 3IBEA 2IOFA 4BKSD 3V05A 4RNAA 3WA0A 4Q45A 3KZIU 3FC4A 4ED8A 1ZQVA 1V80A 2RPQA 3MFGA 2WXIA 2SAKA 4RU9A 4B9SA 2ESEA 1XS9D 2OHFA 4EBDA 3DBLB 5AKXA 1WZ3A 2PFQA 3QCAA 2M1MA 3DWMA 5DQGA 1T6BX 3VRAB 5J8YC 2XK5B 3NJTA 4B9LA 5FKAC 5CJ7A 5J2FA 2C5LC 4TV3A 9ICGA 5LLIA 3ZRCA 5C3JB 1PQSA 4NPNA 5KT6A 1URJA 8ICMA 2O2VA 1Q10A 3H1UA 2K4PA 2KWCA 5EE3A 2BCRA 1PK1A 2LGSA 1E0ZA 2B0CA 1D5ZC 4UB1A 3MHSD 3QU2A 3DDHA 3OJSA 2WF7A 2IBIB 2GWSA 5DPWA 3Q14C 1RFKA 4ICAA 3M95A 1V2YA 3Q8CA 2KQSA 2DL0A 3Q8LA 4RH6A 2N9PC 4LJPB 1JWMD 2K6QA 2HHWA 7ICMA 5IP4D 3GE3C 3CSFA 4QZDA 5IILA 1U45A 1ET6A 1T0SC 4MHVA 3TSSA 4DF4A 3H4BA 1KM7A 4B6JA 2GB1A 3Q3FA 1BPYA 3RI7C 1WYGA 3W1YA 8ICZA 3AE6B 3HM3A 3UF8A 5AKEA 3OJ4B 3TI0A 2XVTA 4M9JA 5CRXA 4P16A 5TISU 3SAFA 1T8EA 3PGEA 2PVGC 3KLSX 2G0AA 5HMMA 5BMIA 1E8ZA 5DDYA 1NI3A 5AM5A 5J0QA 2A1JB 4M9LA 5IIJA 5CX3A 3VC8A 4DXAB 4F4KA 3PRMB 1WXMA 4XDCA 4HPMB 4REZA 8ICCA 2WS3B 1ACCA 4NXZA 5KG2A 3OLMD 4YR3A 1WX9A 4AJYB 2PI4A 1YJIA 5AI0A 5KG4A 1ZGUB 3LDAA 1QH9A 1FCCC 2ZNVC 4EYHB 1BUIC 1E8XA 4Y2QA 2RDIA 4AUQC 2V0GA 1WXVA 4CRXA 2JWZA 3PO5A 3WK7A 2JY6A 1GC6A 4KGTA 5C5JA 3TCAA 1VCBA 2NRTA 2LI6A 3QUCA 4NJ7A 4IR9A 7ICSA 5KFMA 2VH2A 4BWJA 1PGXA 2MCNB 3ALBA 1V6EA 2H88B 3QUTA 3TEYA 1PZNA 5DBAA 2F3NA 1XQQA 3TFRA 4B9UA 4X57B 4ZRPA 4QW8A 2KJ6A 1COKA 2UVRA 1IGDA 3KKAA 2MX2A 5IIIA 2KO3A 2NBUA 3QU5A 1S10A 5AM3A 5AK3A 4ED6A 2J0MA 4FBJB 4YTPB 4OJ5A 4P2HA 4TKNA 5C1ZA 1JI7A 1A70A 3RZFA 4C0ZA 2R8KA 3ZDBA 4QWCA 3SENA 4RQNA 4DS5A 5CHGA 2JPHA 1TTNA 2H3FA 4QZAA 1KFSA 2FMPA 1FRRA 1OW5A 3A1QA 4EX7A 2WXOA 3NUHB 4US9A 4G50A 2KN7A 1UA1A 1WJ4A 2W3SA 1S8OA 1ZP0B 2BKRB 2CJNA 3DHHC 1P1AA 5JXVA 4FE3A 1FNVA 2HJ1A 1WWVA 2KAJA 3IN5A 2H3ZA 5KFNA 2E8OA 1I42A 1S0NA 1KLGD 4CDGA 4P4MA 1C78A 2BGWA 1RLFA 3E2EA 1N63A 2KFKB 4W9GA 4NL9A 4K7SA 2LMCA 4DOCA 4GIBA 5JHBA 1B22A 4AOFA 1A77A 2H5XA 4DL7A 2KN5A 4GSWA 1WGGA 5ALMA 2RDJA 2RSUA 2KZMA 4UB2A 2KOBA 2ZJDA 4HKZE 5J2CA 3WK5A 2WXKA 3BS5B 3E0FA 5ALQA 1D9FA 4KZCA 1LFDA 3MGHA 3M63B 4QZCA 2KG5A 5D2MB 2W03A 5KT5A 4NLZA 1UGJA 2VJ5A 2WU2B 4PHDA 4O5CA 1WRIA 4YWGG 1ZETA 1MC8A 2KEYA 1NZPA 2FAZA 1IPGA 4BXOA 2I5HA 1ZRMA 1QSSA 4NAWA 2ZVNA 3FILB 3Q3OC 3OTQA 4DLEA 1XO1A 4BX9C 2D3CA 1WG8A 4RUAA 1NJXA 1L7MA 4JB3A 2BCSA 2AEHA 4JMUA 2PLPA 3ZXRA 3THVA 3ZNZB 3TBLD 2ZIVA 2YB4A 2C60A 3PRZA 4BKTA 3Q3MC 3GIIA 2F1JA 3RF9A 1KEJA 2E1EA 1QOGA 3VVWB 7ICRA 2CPRA 4RZRA 2J42A 4C4RA 1SL0A 5KFWA 4IUMB 4DL4A 3PHWB 4L23A 2AQ1B 1QLBB 5KAIU 3BQ0A 2K0PA 3VDZA 2Y0SF 2BPSA 3BZCA 4DL5A 1C4PA 1UWXA 3APDA 4JX1C 3O13A 4DSEA 2GBMA 2JX5A 3AE3B 1TKDA 3EECA 3EZ5A 3RR7A 4RGOS 1FXAA 1XSLA 2DWQA 1PVPA 2LD9A 2V3PA 2YQEA 5KFKA 5KAFU 2Y1JA 2ZPYA 3VTUA 2NRXA 2GBJA 1BNOA 4LNFA 4FBUA 4EZ6A 3H7IA 4NLGA 2MBEA 2MHJA 1LM8B 3TFSA 4KGRA 3RT3B 1ZQNA 2BQQA 3P4SB 3Q8FA 5L1LA 1WE6A 2LZ6A 2IA6A 3BK2A 3RJIA 3UQ2A 5J2KA 3GIKA 2FLNA 3MFHA 2KICA 1Z4OA 3C21A 4GXIA 2ZTCA 1D8LA 4F71A 2YMMA 1UHUA 2DBYA 5ALSA 2A4ZA 2IMWP 1CK1A 2TSSA 1R4NB 2KIVA 1K51A 2V4IB 2LVQA 2L05A 3QJZA 5IIMA 1YN3A 1HIWA 2WXJA 2I1JA 4C4VA 4MJSB 1V1PB 3C2KA 3M9NB 3RRGA 2CHWA 2PVOD 5E6OA 5C2TB 2A1AA 4IW0A 3WAPA 4UDUC 2W9MA 2YMQA 2XBBC 2K8AA 1KQQA 3MR2A 2RRDA 4NQKE 3P4RB 3JSVB 5J2EA 1FXIA 5J2BA 3C2LA 5AM4A 4F4ZA 1NYRA 2ICIA 3QU4A 3WIMA 3RB4A 4KIKB 1N61A 4YR0A 4M0AA 2GRIA 4YP3A 2JXTA 5JU5A 2FE9A 2W9CA 3ZNGC 9ICBA 5EE1A 5BYSA 9ICUA 2ZIWB 4W9FA 1EWCA 3SV3A 3RNFC 1Z3EB 3CWIA 1TGZB 2KSOA 1N5XA 5D3DA 7ICNA 1J97A 5C23A 2QJLA 1VZ6A 4QWBA 4KKJA 1ZQHA 2FUHB 4YMMA 4Q8EA 4B9MA 2WXQA 1UWMA 3QEAZ 4UB5A 3IVFA 3IG5A 3ONNA 2DZJA 1NK0A 5BMHA 3NHEB 2PI5A 3LWLA 1CQVA 1H4RA 5BMGA 4CGZA 4RT3A 1SKWA 1JWBD 3A0HU 3HJEA 4TSSA 2CN1A 5CEHA 4W9HA 2BS3B 2EAOA 2INPE 3PSTA 4C8LA 3ETLA 4MFAA 3V7KA 2RDGA 2W82A 4TQ0A 3JPQA 5AEKB 4UAUA 2K4HA 1E7VA 1T7PA 3HWTA 4MT5A 2FCQA 2SEBD 3PO0A 4F4XA 2K6DB 4ZRKA 1Q46A 4HWIB 2AX5A 2EH9A 2G1EA 1FRDA 4GLSC 2DKZA 3DPDA 1TY0A 3QARA 2Y3AA 2F8LA 3UQ0A 2L76A 4DHZE 2L0TA 1P98A 3PTFC 2G09A 4UB8U 2DZIA 4YR2A 4NM2A 2Y0SC 2VJ4A 4IM2A 3D32A 1QQ5A 4M9GA 2V3NA 1XNSA 4NLNA 1Q1OA 1WCLA 3N30A 1RDFA 5J0YA 5L1JA 1VD2A 4CCHA 1C3TA 3A0BU 1X9MA 2AWTA 2CHZA 3C1ZA 2F44A 3RJHA 4PHAA 2PKEA 2ASQA 4A9AA 4Z6DA 1JRUA 5CHWA 3LYYA 3H4DA 3V7LA 2JMGA 2UVWA 4KLGA 2LRWA 4K4IA 3N3KB 1IXRA 5KFGA 5C0YA 4KLMA 5KG6A 1ZQFA 3U4EG 1L7NA 1V86A 3PT2B 5AK6A 4QZGA 2WWZA 4B0EA 2Q4TA 2KKVA 3K1RB 3Q8SB 2ZCCA 4FJZA 2JVCA 2W04A 2HBKA 4IRDA 3VUWA 4Y2JA 4JV2A 4UAVA 3DBHB 4NQLB 3LVVA 4YSZB 1KLVA 5EE9A 3E58A 5ALWA 3EGRA 3NVWA 2LYHA 3ZKJC 1JIHA 3F5AA 4JQWC 2JZPA 3ZJUA 4KLUA 2O6VA 8ICKA 3TEZA 1JQ4A 3WKBA 5HP4A 3AV8A 2KYWA 1YNTE 1Z1BA 5BO4B 4PJ0U 1X6IA 3IV6A 2G06A 3HT3A 1OXJA 1IYFA 4O9MA 5CA7A 2Q5WD 3EFCA 5BPCA 2MJ3A 3H9DA 4OO1J 2D3GA 1C9FA 1JMSA 4FZMA 8ICRA 3PVLA 3N1ZC 2BDUA 2ODGA 2XICA 1R4NI 3NRWA 1J2MA 9ICQA 4PZNA 1WWTA 4K4HA 3JPTA 5E79U 5DG9A 1MHXA 5J8YA 3ECIA 3ZD9A 1UCVA 3MGVA 3T9LA 5FK9C 2I6XA 2HOIA 3AE5B 2WHIA 4DFPA 5IIOA 3RBEA 2JHDA 1ZQJA 2AGQA 9ICVA 5D49A 2C9WB 1E8YA 2E3TA 4RGNA 1U47A 2W3RA 3HUIA 2A3VA 5G55A 5TR5A 1PVQA 3T5HA 2O6KA 2OCEA 2ZIUA 4OVVA 3QNMA 1OQQA 1WGRA 5ALRA 4F1SA 3T3NA 5HHIA 5ALNA 4RUCA 8ICLA 2W9NA 4LLGM 2E8MA 1CI4A 4QZIA 1FXTB 8ICBA 1MI0A 4PS7A 4MACA 4EEYA 4BGDA 2LVPA 3W9CB 4UB4A 4PPXA 1ZQOA 2LGDA 3MHZA 4DSLA 2UVUA 4M01A 5J2JA 2CRXA 3F2CA 5AIAA 3B0XA 1SIJA 9ICPA 1WYWB 4DK5A 3O65B 2KLGA 2K8BB 3FAHA 2BCVA 8ICHA 1C4CA 2K4IA 1V9JA 2MJEA 5AM0A 4NAMA 4R8UA 2YMLA 4I6PA 2GI9A 4A90A 4PHEA 9ICIA 3PR4A 4IWPA 4R63A 3PREA 4R8UB 4MEMA 4GMVA 4KLSA 3NZSA 3UQBA 1AYFA 4KMUA 2K4EA 2J53A 1L2NA 3TKAA 1NENB 4F5OA 2RMMA 2FDRA 1K52A 3RFAA 4LCDE 2ZXIA 2KXJA 2VKQA 1TS3A 1KBUA 4CHKA 3QUQA 5H92C 3T5JA 3S6JA 4IQWA 3BWUD 1ECWA 3R3MA 2MBOA 2WYQA 2GLSA 1LGRA 3LJ3A 4IC7B 2AQ0A 1OEYJ 2M17A 2N1VA 1P7FA 2N0SB 2PE9A 3C2MA 1Z00A 4KLFA 3PVXA 8ICSA 1F5SA 1EWYC 5AICA 4FBTA 2RDBC 1SV4A 3SZ2A 4ED1A 1ZQQA 2V4RA 2V1YA 1MFWA 1UT5A 1P7EA 3AEBB 2YMPA 2DZKA 5KL8B 1SXEA 4A20A 2MW5A 3WCQA 4EELA 3AE4B 1B9RA 2JH7A 9ICSA 5HHDG 4UW9A 3AU5A 1L4ZB 1TK8A 1EF1A 1TAUA 2KTFA 1BPZA 5KHOA 2KFZA 3M6KA 2WDVB 4F4YA 4DXFA 4F2SA 2YVCA 2HHQA 5H8YE 2X38A 3A9JA 4QNLA 2WB1F 5E6NA 2E6XA 4IS7A 4KN7A 4G9BA 3GQCA 2IHMA 2KHWB 3KTQA 1N2XA 2L0FA 1BVSA 3C23A 1IP9A 2G4SA 4N58A 1OTRB 4IM0A 3AE8B 4RPZA 4DCCA 3L0WB 2ATLA 4MF8A 4B95A 3WU2U 1CMXB 1QZEA 2J0JA 3DBHI 1C4AA 3ED5A 8ICGA 3ICXA 3IP4B 1S3SG 2HOFA 4F2RA 3DBRB 3UINB 1FCLA 1N56A 2VIXA 1SKSA 2Y5PA 4YXDB 4U7CA 4RQ4A 3SD5A 5DB7A 1U49A 2HE7A 1KL9A 4J9PA 2KZ3A 1V85A 1TJEA 1DOXA 3L16A 3AEVA 4MF2A 3L17A 2K3UA 1UZXB 2L1AA 2FE8A 1NJYA 2KP7A 4IC9A 1RPLA 4WAFA 1Z19A 5DGAA 2KK0A 2OM6A 1D3ZA 2ZPNA 1WX8A 5IN7A 2BQRA 3PSIA 4PGXA 2L00B 3BQ7A 4GC7A 5ALXA 2QB0B 2W8KA 2CJOA 2HOQA 3EPIA 2L7RA 4G11A 4DDID 2EQYA 4OD0A 5KTQA 3BVZA 4FJYA 4FZLA 4I2AA 4C56C 2LPEA 2DAFA 4ITKA 3TEWA 3IT6B 1SB3C 9ICAA 3QUBA 2L8JA 2DX5B 4CF4A 3RNEC 4DHZB 2ZJ8A 2DUYA 4DHJB 5AKJA 1GC7A 3NS1A 1MJDA 2L52A 5AM2A 4GOCA 4WWMA 1KOTA 4BKSA 1EO6A 3JPPA 1S9FA 1WF9A 1SE9A 3Q8BA 9ICOA 3PSPA 2D3DA 1VLBA 1E7UA 5LXIB 1CRXA 2KDMA 1ZOLA 4O3OA 3T5KA 4ELTA 4KLHA 3HM6X 2K22A 3TAQA 4KLIA 1WM3A 2C7MB 4ECTA 2KFJA 2BGFA 4B9TA 3MGIA 4ZRJA 3I1YA 4ECRA 4I2CA 9ICFA 1ZQSA 1WXQA 4DBGA 4I2JA 3WK6A 2DGZA 3RPFC 2JRZA 3SAHA 2XC9A 2FIFA 4I2EA 4KSLC 2JZBB 5KFJA 1LV5A 3A9KA 3RTVA 3CYMA 4OHJA 3P4PB 1PVRA 4DSKA 1D9DA 4IQUA 1E6EB 4XZ4A 2ZXHA 3PZPA 3MR3A 2L83A 4JWUC 4M04A 2MWSB 4CQNA 5KFTA 5KFCA 1UF0A 5DB6A 1QQ7A 3IXSA 1UQVA 2LM4A 2MA9B 5DB9A 2RGFA 4ELVA 3RR8A 4M8MA 3GIMA 4FXCA 3K1ZA 3N97B 2KZZA 1SZHA 1FNWA 3QIJA 1KTKA 2IDYA 2P66A 4GFJA 9ICHA 1QSYA 1BPXA 2WB1C 9ICWA 2JUOA 1S0VA 1IIPA 4XYCA 5IIKA 1JROA 2O2VB 1L3VA 4OJLA 3V72A 2J7QB 7ICHA 2INNE 3L54A 3H8HA 3RJGA 1PK1B 5J2RA 2JU6X 5KFIA 4M8NA 3BQ1A 1NBFC 2HJ8A 2LEKA 2KTQA 2D3AA 2WXPA 4ZDVA 3IDWA 3GS2A 3VTWA 1X9SA 1DGSA 1TZOA 2LXAA 3HVDA 2IO0B 2KANA 2G3QB 2REXA 4YMNA 1PK3A 2K8CA 2XNAC 4CE6A 2RDHA 2CU1A 4P0QA 5G5HA 3B08A 2VA2A 4LTUA 4DS4A 2G07A 3UXOA 4KX3A 2KT7A 3ZDEA 3H0MB 2KWUB 3EFUA 3KBBA 3BYTB 3I76A 2CHXA 2C2DA 4KDLB 1RYSA 4F8CB 1NI2A 3GV7B 3UXNA 1KH0A 3RB0A 4IWQA 3V7JA 2BCQA 2C22A 2BQUA 1L6NA 1C77A 2Q0ZX 2GBRA 2KHQA 4NJCA 2LASA 1WR1A 2EANA 1EXNA 5DPRA 3VUYA 4KLOA 1LVHA 5KFAA 4Q44A 3P4QB 2HBLA 2F8KA 3RBDA 4CYEA 3VR8B 4K3BA 4FN2A 2EZZA 1NK4A 1GO3F 4KLLA 3GE8C 1RQNA 4BUGA 1HJPA 4RNMA 1D5XC 2ONQA 3DBRI 3WK4A 4AQ7A 5L9XA 2L32A 4HEA1 1JWAD 3RJJA 3MTNB 5AKLA 3ISDA 3AU6A 5MPOA 3TADC 2JR5A 4QAYA 3ZDTA 3KHGA 1YX5B 4BFRA 3G6XA 8ICOA 3RAQA 2R8GA 1YJJA 1SJED 2PE6B 1T3QA 3U26A 4DFKA 3EYZA 3GZFA 4Y2TA 3AH7A 3CIRB 3H7PA 2HDOA 2QARA 2J6SA 5IAAC 1FEHA 4NLCA 4P4PA 1T3NA 1DYQA 1QKZA 1OGWA 2Y5CA 3ZXVA 5HR6A 8ICIA 2NCNA 1VJ5A 2HHSA 2M0AA 4MGZE 3B9JA 3HHMA 1T94A 3GDXA 4XWWA 1J7CA 5DCNA 5KFXA 1X1MA 2D10A 2XY5A 2HHTA 2ACZB 3R2TA 3EW9A 1L8OA 4PL2A 3NUQA 2YEPF 1G6JA 1N62A 3RH5A 4I2IA 3IG8A 5HHHA 4NNJB 9ICTA 2ON8A 3U7DA 2MEKA 4J3OD 5J0PA 4QZBA 5D3IB 1DOQA 1O03A 5IINA 5KG0A 3GZNB 2ZEQA 1TKYA 2G4DB 4O3NA 3A1QB 3RB6A 4ACFA 1ROEA 2P6UA 3VXWA 2GLEA 1D8BA 2MBQA 3QZ8A 5ALYA 2JEJA 2HSZA 3I5JC 4AP9A 7ICVA 1DK2A 1RYUA 4RF0A 2GO7A 2AYOB 3ZW3A 3BJYA 1NK8A 2L5YA 2LHEA 3C28A 4HK2A 3GILA 3DVNU 3AI5A 1JXLA 3L10B 4R66A 3AL0B 4M47A 2MBBB 4GN1A 2MH7A 2OEHA 4YL8A 1WGDA 4RQMA 2PW9A 5KFLA 4TQ1A 4B9VA 1TV9A 4KLJA 3P42A 4KTQA 3EHVA 1B4FA 1B0XA 3MC8A 5AKYA 4JE3B 3TIXA 3PW7A 2EDUA 3AU4A 1OFFA 3KVFB 1HEZE 4Q43A 4K7WA 1YD8U 4JV1A 4HVBA 1K1QA 3MP9A 4O3RA 2IO1B 1BXTA 3ZUNA 4QZ9A 2ZW1A 4PS3A 3WAOA 2ZIXA 4Y2UA 4C8MA 9ICKA 2HVHA 2OJWA 4F5NA 4BXOB 4PZOA 2JQRB 2Y5BB 3BVMA 4NAWB 3PMLA 5AKGA 1QCKA 1JCKB 4FHKA 2BQ3A 4HRSA 2E1FA
chains in the Genus database with same CATH topology
3SR6A 3HRDD 3LB8C 2N7JA 1I4PA 1QT9A 1XLPA 3AMZA 2PTLA 2V3NA 1C76A 2XN9C 1KLUD 4RGTA 4ARCA 3URYA 1ZXHA 1FMAD 4WQMA 4XE0A 2BB5A 4A9AA 1QF6A 1L6UA 1QILA 3LYYA 5AUKA 3I57A 2BS2B 4R3DA 1F77A 2WDQB 2BB6A 3U4EG 2NMQA 1WGKA 1TS2A 1DOIA 4B0EA 1K50A 3AEEB 2IJ0A 2ZW0A 1SBBB 2QEJC 4P6VF 4IOIE 4YSZB 1GAQB 5EE9A 5HI1A 2JWUA 3NVWA 1KFYB 3EGRA 4GDLB 3P63A 1TYGB 4OZAA 2JZPA 1AN8A 2PMVA 3ZJUA 1SJHD 1CZPA 4L2YA 1RYJA 1QOBA 1RWSA 3TEZA 1JQ4A 2WXNA 2WXLA 2WXGA 4IKGA 3AV8A 1N5WA 2KMMA 2IGHA 4RF1A 1YNTE 2BYTA 4HKQA 1JALA 1D5MC 1QQRA 1DGJA 2DYOA 3N9YC 2WXHA 2Q5WD 3KQ4A 2N9LA 1B1ZA 3I9V1 1HXYD 2MJ3A 1PUTA 3PZ8A 1C9FA 2K9XA 3AECB 3HVZA 1WWTA 4C80A 3DWGC 1N60A 3GB1A 2HTME 1GOZA 1MHXA 1ZUD2 4KGSA 3KWVA 3NVYA 4GDKB 4ZOHC 2WP9B 5FK9C 1ENFA 4B0MA 3AE5B 2Z8LA 1L0VB 2PKOA 5BYQA 4ZYSA 1SSNA 1L4DB 1L5PA 4L1BA 2E3TA 3UI3A 4RGNA 1ZE3D 2W3RA 2IGGA 3HUIA 2J52A 5FR3A 2WU5B 4A6QA 1YMHE 4DQOC 1OQQA 3T3NA 3R8BA 3W2DA 3AN1A 4YT0B 1ZDVA 1TS5A 4LLGM 1GB4A 1VZ7A 1MI0A 2LGIA 4MACA 1ZOYB 3V3XA 2QIEB 4KX6B 2LHDA 5LNK1 4OVZA 2KACA 3W9CB 5HFYA 1EU4A 3MHZA 1YN4A 2WXMA 2R61A 1SIJA 2JYEA 3W5VB 1PGBA 2FBWB 3FAHA 1C4CA 2MJEA 1IBXA 2DYMA 3AEFB 4NAMA 3TUOA 1TKGA 3C8YA 1D4BA 3ZGZA 2JYTA 2GI9A 4A90A 1VJKA 3NVZA 4RGMA 3LXFA 1C79A 1QOAA 1AYFA 3ZQ4A 2J53A 1NENB 4A8XC 2YEPB 2W54A 2RMMA 1K52A 1ZPSA 4YTNB 3V05A 2HDEA 2WQYB 4RNAA 1TKEA 1TS3A 1Y56A 3FC4A 5H92C 1TS4A 3BWUD 3MFGA 2WXIA 2SAKA 1IUEA 3U2SC 3EUB2 1I7HA 2OHFA 5D7GA 3NRZA 4RFBA 3DWMA 1T6BX 3VRAB 1P7FA 5FKAC 2N0SB 5C3JB 3BVGA 1EWYC 1I4GA 1KRHA 1Q10A 5EE3A 1SF0A 2QSDA 1P7EA 3AEBB 2BT6A 1E0ZA 1SE4A 1LO5D 1D5ZC 3FILA 3WCQA 1JWUD 4USAA 3NZ3A 3AE4B 1B9RA 1RFKA 2D5GA 1K53A 5HHDG 1GPXA 3Q8CA 1L4ZB 4RH6A 2WDVB 4DXFA 4N6EB 1JWMD 3BYYB 2IPKD 5H8YE 2X38A 5AUIA 4YSXB 2BS4B 1FD6A 1XCTL 4C7YA 1ET6A 2E6XA 4OZBA 3TSSA 2GB1A 4ARIA 4N58A 1WYGA 2K5PA 3AE6B 3AE8B 1XO3A 2M19A 4P16A 4PT5A 1XXGA 2EKIA 1M4VA 1SEBD 1XLNA 1C4AA 2PVGC 3KLSX 5BMIA 1OQRA 1NI3A 3ZYYX 1FCLA 4JWSC 1FFVA 2Y5PA 4YXDB 5HG2A 1HQRD 1V1OA 4RCOA 3Q8AA 4XDCA 4REZA 1DOXA 1TJEA 1ACCA 2WS3B 3AEAB 4LK0M 2K3UA 1TY2A 2L1AA 2FE8A 1I4HA 5G5GA 1YJIA 1FCCC 1WSPA 3B2FA 1JRPA 1IGCA 4N59A 4WAFA 1FNUA 1BUIC 5BYRA 2QMTA 2V0GA 3ZJTA 1HZ6A 1V97A 1V1PA 2B76B 4KGTA 3J9CA 3NVVA 1MVKA 4US8A 1MPEA 2CJOA 1SXTA 1PGXA 2H88B 3TEYA 2N9KA 2EELA 3BVZA 4C56C 4YSYB 3AB5A 4ITKA 3TEWA 3IT6B 1SB3C 4ZRPA 1IGDA 3SFDB 3BK1A 2H89B 3VQIA 1RM6C 1YQ4B 4YTPB 3W5UB 1I4XA 3OWEB 3NS1A 2L52A 1A70A 1ESFA 4WWMA 2VZKB 2NTTA 5TSSA 3P1MA 1AWDA 3Q8BA 1FRRA 1VR9A 2QILA 1VLBA 4H2AA 1BMLC 2WXOA 2KDMA 1IBXB 2K22A 3NUHB 2KN4A 4US9A 1I4QA 3SFEB 1WXQA 1ZP0B 2W3SA 2CJNA 3IT4B 3RPFC 5JXVA 1F2RC 1FNVA 1YN5A 2KAJA 1PDXA 1KLGD 1ET9A 1C78A 2BTEA 4OHJA 3P4PB 1XCQL 3VR9B 1N63A 3IAM1 1E6EB 2LMCA 1EU3A 3AE9B 2L83A 2AQ3B 4JWUC 2I2YA 4CQNA 2PIAA 1XEEA 1FFUA 3GP7A 3L4PA 3IXSA 4ZHPA 4WH4A 4FXCA 3ZJVA 4HKZE 4DXGA 2WXKA 1FNWA 1KTKA 2KQ4X 2IDYA 2LUMA 2VZKD 1VDVA 3AM9A 1UGJA 3Q8EA 1JROA 2WU2B 1WRIA 4YWGG 2BBCA 2INNE 1XLQA 3H8HA 2JU6X 3FILB 4EE2A 4TMAB 2IGDA 1GB1A 2LEKA 2WXPA 1NEKB 3GS2A 1KF6B 1TZOA 1SE2A 3HVDA 1L0YB 3ABVB 1PGAA 3AE7B 2XNAC 2PLPA 2RDHA 4A55A 5G5HA 3ETRA 4LTUA 4M0WA 2WXRA 1ZXIA 3PZ7A 1QOGA 2J4XA 1HZ5A 3BYTB 2J42A 2WNMA 2RPVA 3VRBB 1SE3A 4L23A 1JWSD 2AQ1B 1QLBB 4WURA 2K0PA 3U7ZA 1KH0A 1C4PA 1JW9D 1UWXA 1C77A 2OEDA 3EA6A 3O13A 4JX1C 3MC0B 2JX5A 4KKIA 4NJCA 1UNSA 1E9MA 3AE3B 4AS1A 3KWLA 2BW2A 1V8CA 2WDRB 2I38A 4RGOS 2M56B 1FXAA 3P4QB 4XWTA 1ZDXA 4O1NA 2DWQA 1XLOA 1L6VA 2V3PA 3VR8B 3TEXA 1CJEA 1F2RI 1D5XC 4MH8A 2ONQA 3MJ5A 1EM7A 4AQ7A 2L32A 4KGRA 4HEA1 1JWAD 3AE1B 3BZDB 5MPOA 3IAS1 3T3OA 3Q69A 3P4SB 3Q8FA 2CU3A 4OW0A 3BK2A 1YJJA 4HROA 1PYWD 1SJED 1NVID 1T3QA 1PFDA 2FUG1 2DBYA 3AH7A 3CIRB 1CK1A 2JSVX 1FEHA 1QKZA 2TSSA 2Y5CA 1DYQA 3SEBA 4YTMB 1K51A 2V4IB 4NZLB 4Q2JA 1HA5A 1YN3A 1L0XB 1STEA 2M0AA 2WXJA 3B9JA 1E10A 1V1PB 2PVOD 5C2TB 4OZCA 1I4RA 4XWWA 1J7CA 3RFZB 4UDUC 2W55A 3E9SA 1E7PB 1FIQA 4C7ZA 2ACZB 3R2TA 1R7SA 2LJIA 3P4RB 2DLBA 2YEPF 1N62A 1FXIA 2ICIA 1NYRA 1AW7A 2ON8A 1QOFA 3AEGB 2MEKA 4J3OD 1N61A 1UUPA 5D3IB 1FM0D 2GRIA 2JXTA 5E6JA 5EE1A 1TKYA 5BYSA 3AE2B 1ROEA 1J7BA 1EWCA 5I4DA 2G9HD 3AEDB 3CWIA 1J7AA 1N5XA 5D3DA 1T5XD 2WLBA 2QJLA 3B2GA 4RF0A 1VZ6A 4KKJA 2LHEA 4MM3B 4IDIA 2WXQA 1UWMA 5GXGB 2AQ2B 5EE0A 5BMHA 2MH7A 1CQVA 5BMGA 1JWBD 2PW9A 4TQ1A 4XDDA 4TSSA 4ZRQA 2LFIA 2BS3B 3P42A 2INPE 2W82A 5T8IA 2RDGA 4TQ0A 4JE3B 2WXFA 1F0ZA 4MT5A 2KWDA 2SEBD 3PO0A 1OFFA 1JMLA 1HEZE 4HJGE 4JPSA 1D6EC 2AX5A 1NYQA 2G1EA 3MP9A 1FRDA 4GLSC 3U52E 1TY0A 1BXTA 2NTSA 1VZ8A 2Y3AA 3R2IA 3W1SA 1MHHE 2ZW1A 1VRAB 4WIPA 4ZHOA 1DOYA 2MJDA 1YQ3B 2JQRB 3BVMA 4NAWB 3E56A 1JCKB 1XF5L 4D2KA 1FO4A 3BIID 4HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXA A;  3P4Q B;  3SR6 A;  3HRD D;  1VJK A;  2DWQ A;  3LB8 C;  3NVZ A;  1L6V A;  1QT9 A;  1XLO A;  2H88 B;  1XLP A;  3AMZ A;  3LXF A;  3VR8 B;  1CJE A;  4YSY B;  3AB5 A;  1QOA A;  4ITK A;  1AYF A;  1SB3 C;  1NEN B;  1JWA D;  3SFD B;  3AE1 B;  2W54 A;  2H89 B;  5MPO A;  3P4S B;  1FMA D;  1RM6 C;  1YQ4 B;  4WQM A;  2WQY B;  4YTN B;  4YTP B;  1TKE A;  2CU3 A;  3W5U B;  4A9A A;  1QF6 A;  1YJJ A;  4HRO A;  3NS1 A;  3FC4 A;  1L6U A;  1A70 A;  1NVI D;  1T3Q A;  2L52 A;  5H92 C;  1PFD A;  4WWM A;  5AUK A;  3BII D;  2DBY A;  3AH7 A;  3CIR B;  1IUE A;  2BS2 B;  3EUB 2;  1I7H A;  2Y5C A;  3P1M A;  2OHF A;  1AWD A;  2WDQ B;  4YTM B;  1FRR A;  3NRZ A;  1TKG A;  1VLB A;  1WGK A;  1DOI A;  3B9J A;  3DWM A;  1E10 A;  3VRA B;  2K22 A;  2PVO D;  5C2T B;  4US9 A;  3AEE B;  2N0S B;  5C3J B;  3SFE B;  1J7C A;  4P6V F;  1WXQ A;  1ZP0 B;  2W3S A;  1EWY C;  2CJN A;  4YSZ B;  2W55 A;  3RPF C;  1KRH A;  1GAQ B;  5EE9 A;  1E7P B;  1FIQ A;  3NVW A;  4C7Z A;  1KFY B;  1SF0 A;  3P63 A;  2KAJ A;  1TYG B;  1PDX A;  5EE3 A;  3AEB B;  2BT6 A;  1E0Z A;  1CZP A;  2ACZ B;  1RYJ A;  1QOB A;  1R7S A;  1RWS A;  1JQ4 A;  3WCQ A;  3P4P B;  4USA A;  3P4R B;  1N63 A;  3VR9 B;  3AV8 A;  1N5W A;  2KMM A;  3AE4 B;  1N62 A;  1E6E B;  1FXI A;  1NYR A;  1RFK A;  1B9R A;  1JAL A;  3AE9 B;  2L83 A;  1QOF A;  3AEG B;  4JWU C;  1GPX A;  1DGJ A;  1N61 A;  2PIA A;  1FM0 D;  2WDV B;  1FFU A;  3L4P A;  4N6E B;  2Q5W D;  4ZHP A;  5H8Y E;  2WDR B;  4FXC A;  2MJ3 A;  1PUT A;  5AUI A;  2BS4 B;  1TKY A;  5EE1 A;  4YSX B;  4C7Y A;  2K9X A;  3AEC B;  3AE2 B;  1ROE A;  3HVZ A;  1J7B A;  1WWT A;  4C80 A;  3DWG C;  1N60 A;  2HTM E;  1VDV A;  1ZUD 2;  1WYG A;  3AED B;  3CWI A;  3NVY A;  2K5P A;  4N58 A;  3AM9 A;  3AE6 B;  1J7A A;  3AE8 B;  1N5X A;  4ZOH C;  1XO3 A;  2WP9 B;  1JRO A;  2QJL A;  1WRI A;  2WLB A;  2WU2 B;  3B2G A;  3AE5 B;  2M19 A;  1XLQ A;  2EKI A;  1L0V B;  1XLN A;  2PKO A;  2PVG C;  4IDI A;  1L5P A;  1UWM A;  2E3T A;  2LEK A;  5GXG B;  1NEK B;  1OQR A;  2W3R A;  1KF6 B;  1NI3 A;  5EE0 A;  3ZYY X;  3ABV B;  2MH7 A;  3HUI A;  4JWS C;  1FFV A;  4YXD B;  2WU5 B;  1JWB D;  3AE7 B;  1OQQ A;  5G5H A;  1DOX A;  1TJE A;  2BS3 B;  3AN1 A;  2WS3 B;  3AEA B;  4YT0 B;  3ETR A;  4LTU A;  1F0Z A;  1ZXI A;  1ZOY B;  1QOG A;  2QIE B;  5G5G A;  1YJI A;  1OFF A;  3PO0 A;  4KX6 B;  3B2F A;  2AX5 A;  3VRB B;  1JRP A;  3W9C B;  4N59 A;  1NYQ A;  2G1E A;  1FRD A;  1QLB B;  1SIJ A;  3W5V B;  4ZHO A;  4HRS A;  1JW9 D;  2FBW B;  1V97 A;  3FAH A;  4JX1 C;  1DOY A;  2MJD A;  1YQ3 B;  2B76 B;  2JQR B;  2JX5 A;  1E9M A;  3NVV A;  2MJE A;  3AE3 B;  3AEF B;  3KWL A;  1FO4 A;  1V8C A;  4US8 A;  2CJO A;  2M56 B; 
#chains in the Genus database with same CATH topology
 3SR6 A;  2KV2 A;  3HRD D;  3H8M A;  2ALZ A;  2KOX A;  1XLP A;  3AMZ A;  3OG5 A;  1C76 A;  4ED0 A;  4GB9 A;  1KLU D;  4F72 A;  5F3X B;  4KDI C;  4KV2 A;  2ZIV B;  3UMG A;  2KJ8 A;  1J0G A;  5DQI A;  5KG1 A;  3WAN A;  2D2Q A;  3PX6 A;  2G45 B;  2HHX A;  2HHV A;  4MDK E;  4WQM A;  3SEI A;  3JW0 X;  1L7O A;  2BB5 A;  4EKU A;  1OQY A;  1ZRN A;  4RQ5 A;  5KG7 A;  3EWA A;  2BS2 B;  2R2Q A;  3G6V A;  2BWF A;  1X42 A;  2NMQ A;  5KFV A;  1S0O A;  1WM2 A;  1NDD A;  5GTI U;  3ZDD A;  1A0P A;  1K50 A;  2VAN A;  2ZW0 A;  2QEJ C;  4B9N A;  3N32 A;  3H40 A;  4BVU C;  4RMA A;  2W7O A;  4TQS A;  2JWU A;  3RUI B;  5KFO A;  2KKP A;  5ALL A;  1LB2 B;  3RH4 A;  3C0R B;  2JZ3 B;  3PR5 B;  2WXN A;  2WXL A;  3DHG C;  2LRU A;  2WXG A;  5DLG A;  4O3Q A;  1EF5 A;  2KMM A;  4HKQ A;  1DRG A;  5KFH A;  4Y2Y A;  2MP2 A;  1KN5 A;  3ZO5 B;  3NOB A;  1WH3 A;  1NJZ A;  3RAX A;  2AH5 A;  8ICU A;  1QQR A;  3HKZ F;  2OOB B;  1ZQE A;  3IM1 A;  1C20 A;  4FLH A;  3N9Y C;  4FUL A;  3KQ4 A;  5ALI A;  3NTU A;  3I9V 1;  1HXY D;  3PZ8 A;  1WUD A;  2OYY A;  1WR6 E;  4C4V B;  3HVZ A;  3CNH A;  2HD5 B;  1WX7 A;  2KVR A;  3N1Y C;  3T3F A;  1N60 A;  5HKH A;  3W1S C;  4C00 A;  5KFB A;  5KFS A;  3UMC A;  1MQ2 A;  3ORY A;  4TUP A;  4JGH B;  2W9B A;  1ENF A;  1HTO A;  4B0M A;  1NKB A;  2W9A A;  4JWN A;  1ZQB A;  4HAI A;  1L0V B;  2PKO A;  3QZ7 A;  1XT9 B;  1SIF A;  3TAC B;  3HP6 A;  1L5P A;  4L1B A;  1ZQU A;  4LZD A;  4ANU A;  5GTH U;  1RQL A;  2DNF A;  5JRT A;  5DPS A;  4J03 A;  3HW8 A;  3SDL C;  4DQQ A;  3FDS A;  2H3I A;  2N1R A;  1YMH E;  1TT5 B;  2JEF A;  1TAQ A;  1XC9 A;  3PLV A;  2W9C B;  1ZDV A;  3ZNI D;  4AP4 C;  3DQV A;  4Y2S A;  4TUU A;  1ZQA A;  2LGI A;  2BPF A;  1WMH A;  1ZOY B;  4IQT A;  4ECX A;  1UEL A;  2QIE B;  2LHD A;  1TBE A;  3V3X A;  4OVZ A;  4PH5 A;  3GZN I;  3OJ3 A;  2BDP A;  4HCP B;  4QZ8 A;  4W9L A;  3RNB C;  1C7Y A;  5KFE A;  2X8X X;  2KSO B;  3HIL A;  2K89 A;  2C28 A;  2GOW A;  2R61 A;  2HMX A;  4HCN B;  1TVA A;  4ELU A;  7ICP A;  1IBX A;  5F9L A;  3TL5 A;  3ZGZ A;  2JYT A;  2P6R A;  1VJK A;  4P0P A;  3NVZ A;  4DSF A;  4RGM A;  2M8S A;  3KUD B;  2D07 B;  1ZD5 A;  1F1H A;  4ANX A;  2VA3 A;  4J9S A;  4WJ3 B;  1C79 A;  1QOA A;  3ZQ4 A;  3UPQ A;  4YD1 A;  1YT3 A;  1YX6 B;  2NO5 A;  3DVG Y;  2LGY A;  2LYA A;  2W54 A;  1E8W A;  3UIP B;  4MFF A;  4BOZ B;  2V4L A;  4QWA A;  2IO2 B;  4P1B C;  2BKF A;  1T0R C;  5ALU A;  4GIV A;  3QA8 A;  4IRC A;  1I35 A;  2UU7 A;  4MEY A;  4N9F 4;  3EUB 2;  1I7H A;  5D7G A;  3GU3 A;  2XY7 A;  4IR1 A;  3NRZ A;  1M6Y A;  2VA8 A;  2WFA A;  4RFB A;  1NOM A;  3UMB A;  4KLD A;  3F5E A;  1R4M I;  2OH2 A;  4JUZ A;  1SKR A;  2QHO A;  4FJV B;  2N1W A;  3LYS A;  1I4G A;  1NK6 A;  3OAW A;  4X5V A;  3BQ2 A;  1KDH A;  3SD7 A;  2YB1 A;  2QSD A;  3RCZ A;  3N7R C;  3OPX A;  4ANV A;  3T79 A;  4A3P A;  1SE4 A;  1LO5 D;  2PPH A;  1ZQK A;  1V81 A;  4EOY A;  1A5R A;  4LJO B;  1K53 A;  1GPX A;  5AI5 A;  2KDB A;  4WAA A;  3MDA A;  4EBE A;  3HKZ C;  1KJT A;  5IOI A;  5KL1 B;  1XCT L;  4OZB A;  2F77 X;  3IFW B;  3N28 A;  2IND C;  7ICO A;  3V61 A;  9ICR A;  4ARI A;  1BNP A;  2NBV B;  5AKZ A;  2K5P A;  3ZIM A;  3HPO A;  3Q6B A;  2CS4 A;  1ZJM A;  1HUZ A;  2K39 A;  1ZJN A;  2C7N B;  4E0D A;  3MDC A;  4WJO A;  2WF9 A;  1XXG A;  1M4V A;  3PW2 A;  1SEB D;  1XLN A;  2P35 A;  1ZQ1 C;  2O6V B;  4RNO A;  1V49 A;  1Z4N A;  2F2A B;  2AL6 A;  2XO7 A;  3ZYY X;  4JWS C;  1FFV A;  3QE9 Y;  3M9O B;  4KX5 A;  2KJR A;  4PL1 A;  4ECZ A;  1F44 A;  4I29 A;  3A4R A;  4BZA A;  4FS1 A;  3AEA B;  4LK0 M;  1TY2 A;  3WAL A;  2CKH B;  5G5G A;  2ZTE A;  1S97 A;  5TZV A;  2RQ5 A;  1IGC A;  1ZQY A;  2PFO A;  2KJ9 A;  4DLG A;  1FNU A;  3B1L X;  4JLC A;  4I2G A;  4N59 A;  2PEA A;  2CXY A;  1QQ6 A;  2QMT A;  4QZF A;  3Q2A C;  4XRH A;  2INC C;  4E74 A;  2B76 B;  2FPM A;  4CO7 A;  1ZQX A;  3PS6 A;  4XC2 A;  2BCU A;  4US8 A;  1MPE A;  1RG6 A;  3SU8 X;  1M94 A;  2KDE B;  2FLL A;  2EEL A;  3IG3 A;  3SYZ A;  2ZIU B;  4YSY B;  2O6V D;  1WFY A;  2F1I A;  2R8H A;  1H38 A;  3SFD B;  2H89 B;  3LK9 A;  1MN8 A;  3IHP C;  1RM6 C;  2HI0 A;  4OJ6 A;  1I4X A;  4DWF A;  3OWE B;  1T0Y A;  2HCF A;  3JPR A;  1ESF A;  3ZRF A;  3M6Z A;  2LKY A;  2VZK B;  5TSS A;  3P1M A;  3X0W A;  3RD2 A;  4XUS A;  3VFK A;  4TUR A;  2KK8 A;  9ICN A;  1FEZ A;  1BML C;  2NR2 A;  1TAM A;  5L83 A;  9ICJ A;  1RRB A;  4RPY A;  1ZQM A;  4LDT B;  1NK5 A;  5JZE B;  2FPK A;  1ED1 A;  5ALF A;  4RNN A;  2NS5 A;  2RR9 A;  2E5S A;  1AAR A;  1F2R C;  3Q8K A;  1YN5 A;  2MUT A;  1V5T A;  2KX0 A;  2EZX A;  2JT4 B;  5CR0 A;  4RPX A;  2ASJ A;  1A76 A;  2KC1 A;  2BYV E;  1U4A A;  4UAZ A;  1O08 A;  2IYD B;  2WF6 A;  5DDM A;  3H8J A;  4DF8 A;  5ALZ A;  1XSP A;  1TK5 A;  2QC8 A;  2KIW A;  3TAD A;  3JVZ X;  4P7I A;  5DKW A;  2PIA A;  2DHZ A;  1XEE A;  1FFU A;  3GP7 A;  2KNJ A;  3MR6 A;  2ZNV B;  4WH4 A;  2ZUC A;  1CUK A;  2KWV B;  3ZJV A;  4NLK A;  3N7S C;  4DXG A;  2D8C A;  4PK1 A;  4DOA A;  4CF5 A;  5FP0 A;  1ZQP A;  4DL3 A;  4UBC A;  2LUM A;  2VZK D;  4YVZ A;  1VDV A;  1Z00 B;  1WXS A;  3ZVV A;  5B66 U;  3AM9 A;  3Q8E A;  4ED3 A;  3GOE A;  2BBC A;  1NZB A;  3BDP A;  2KD0 A;  2AGO A;  2KQ7 A;  4LDT D;  1ZQI A;  3WKE A;  4TMA B;  2Y1I A;  2IGD A;  3A33 B;  2AL3 A;  2M0X A;  4BAX A;  1Q8K A;  4F92 B;  1K8R B;  4UB3 A;  4FZN A;  1IM4 A;  5ALG A;  5CWR A;  2ES6 A;  5D46 A;  2MRP A;  4A55 A;  3BIN A;  5ALH A;  3V60 A;  4ACO A;  3ENE A;  2R18 A;  2I9G A;  3A9J B;  4M0W A;  2ZUD A;  5J29 A;  1ZXI A;  2FID A;  3QHT A;  3MJW A;  2KC2 A;  2RPV A;  1SE3 A;  1JWS D;  1D8Y A;  4WUR A;  8ICA A;  2JRI B;  2WX0 A;  3K9P B;  3JPO A;  1XU4 A;  1KKX A;  1ZYQ A;  1SWV A;  4RQ3 A;  5ALO A;  4R65 A;  3RRH A;  2OED A;  4AS1 A;  4IQV A;  4TUQ A;  2WF5 A;  2BW2 A;  2BZF A;  2WDR B;  5CB1 A;  4XWT A;  1ZDX A;  4O1N A;  4EZJ A;  1XLO A;  1L6V A;  4GDL A;  5ALD A;  1F0M A;  3KZX A;  1CJE A;  2NPT A;  1NK9 A;  3RZW C;  4MGI E;  3MJ5 A;  3N7P D;  2FPL A;  5J0S A;  4EYI B;  4MEX A;  1EM7 A;  4BDP A;  1YQB A;  4II3 B;  4LNN A;  4HYK A;  2VH1 A;  3KHL A;  2WX1 A;  3BZD B;  3PW4 A;  3T3O A;  3H0R B;  2DZM A;  2LJ5 A;  1J2N A;  3KUC B;  2FCS A;  2ISP A;  2CU3 A;  3V6E B;  2ZVO A;  2FUG 1;  3V62 A;  2Z7J A;  4NY8 A;  3GV8 B;  3SEB A;  4NZL B;  2A5U A;  1OUQ A;  2RLT A;  1L0X B;  1STE A;  2J6U A;  4OVU A;  4LNK A;  4EFO A;  2ZJ5 A;  1SL1 A;  4RQ0 A;  3RFZ B;  5AZF A;  5J0O A;  5DG7 A;  4GDK A;  1ARO P;  3IHQ B;  5K4L A;  3OHB A;  4DFD A;  4QZE A;  4YFK A;  1UA0 A;  2XID A;  4DQR A;  2DYB A;  3F2B A;  2LJI A;  4ECV A;  2NYV A;  3X23 A;  2FNJ B;  3FKY A;  4W9I A;  1S76 D;  3ALR A;  1AW7 A;  3M8S A;  1QOF A;  9ICM A;  2KJH B;  1RAX A;  3HK0 A;  1FM0 D;  1PUZ A;  1MSW D;  4B9K A;  2FLP A;  4FO6 A;  2F1H A;  2NRZ A;  4MH0 E;  4EEW A;  1SV0 C;  5E6J A;  1KW4 A;  2PFN A;  4NLB A;  3JPS A;  1QSL A;  5J2A A;  3SI8 A;  1J7B A;  3NAS A;  2ZUB A;  2G9H D;  5AI4 A;  3AED B;  5KT4 A;  4QW9 A;  1HUO A;  3AQE A;  9ICL A;  3SMV A;  1J7A A;  1WI0 A;  3KYC D;  1T5X D;  4DOB A;  1COO A;  2WLB A;  5J2H A;  4UQG A;  3T8M A;  2AQ4 A;  5DB8 A;  3Q8Q B;  4K81 A;  2NBW B;  3A9K B;  1LKY A;  2Z59 B;  4I2H A;  3K4G A;  2AQ2 B;  5J17 A;  4QWD A;  5AKH A;  3CF6 E;  3L3F X;  1ZD2 P;  9ICE A;  4XDD A;  4ZRQ A;  2GBK A;  3AQF A;  2LFI A;  4DHJ D;  1SXD A;  4M00 A;  5T8I A;  2MU2 A;  3PLU A;  2DPI A;  3L5K A;  1P9D U;  2WGS A;  4HJG E;  1JUD A;  1B43 A;  1D6E C;  2IOH A;  1NYQ A;  1SZP A;  3P2B A;  4K7U A;  3U52 E;  3PNC A;  2NTS A;  2IHN A;  3W1S A;  4BBN F;  1NKE A;  2I1Q A;  1Y88 A;  1Q3V A;  3M3J A;  4ZHO A;  4DQP A;  3V6K A;  2KKC A;  1YQ3 B;  2MJD A;  3APF A;  1BGX T;  2XK5 A;  1XF5 L;  2UYZ B;  3R7Q A;  4O3S A;  2JF5 A;  1ZD3 A;  2KMC A;  3TJP A;  1ZQG A;  3UIO B;  2NRW A;  3RJF A;  4I6N B;  4O3P A;  5HR7 A;  4I2F A;  2BWE S;  4IRK A;  2K8C B;  2XN9 C;  2BYF A;  2ZG6 A;  5KFZ A;  4P0Q B;  2RD0 A;  2JXJ A;  4F8R A;  5IO9 A;  4GLX A;  1ZXH A;  3BY4 B;  2ASL A;  2LUE A;  1WCN A;  4HPP A;  2MRL A;  1L6U A;  1QIL A;  1TZ1 A;  5AUK A;  5BOM A;  1LXD A;  1F77 A;  2WDQ B;  2K25 A;  4TUS A;  3KFU F;  1TS2 A;  5J0X A;  1U48 A;  2BKE A;  2Z0E B;  1YZ7 A;  2H3V A;  4JIO U;  3D6J A;  2NV3 A;  3AEE B;  2IJ0 A;  2HTH A;  1SBB B;  2KZR A;  4P6V F;  5FR6 A;  1UT8 A;  1X66 A;  5G2N A;  1K1S A;  4BJQ A;  3N1X C;  5BOL A;  3UGB B;  1KFY B;  4RM8 A;  3T5L A;  3P63 A;  1Z1V A;  7ICU A;  4OZA A;  1L3U A;  2G08 A;  2YY6 A;  1SJH D;  4L2Y A;  3B0A A;  3ML8 A;  5H2F U;  1RWS A;  1WJU A;  3MBY A;  4RQ1 A;  3OHA A;  4UAR A;  1N5W A;  3PY8 A;  2A1J A;  2IGH A;  4RF1 A;  2KMD A;  5DQH A;  2N9E B;  5KFQ A;  1JAL A;  2JH1 A;  8ICV A;  2LBO A;  1DGJ A;  2OXO A;  4F50 A;  3KHR A;  8ICP A;  3H7P B;  2QAR B;  5B5E U;  3FYH A;  3F53 A;  1S5L U;  2N9L A;  1B1Z A;  7ICI A;  1PUT A;  2DAJ A;  5IKC M;  4ZH4 A;  3AEC B;  4DWI A;  5KT3 A;  2DF4 B;  4AYB F;  4DSI A;  3DV9 A;  4C80 A;  4XGA B;  2WTF A;  5ALJ A;  4KGS A;  3KWV A;  5AIB A;  3NVY A;  2PMZ F;  3WK8 A;  2Z8L A;  7ICK A;  2FMS A;  8ICY A;  5BYQ A;  5DBB A;  8ICQ A;  4ZYS A;  3MC1 A;  1SSN A;  4WQO B;  2EAM A;  1T0Q C;  1ZE3 D;  3LWM A;  2ZJA A;  3QEB Z;  3AXC A;  3KH0 A;  2J52 A;  5FR3 A;  4C8K A;  3ONS A;  7ICQ A;  4O3M A;  4A3O A;  5EOZ A;  3J81 j;  3CW2 C;  3M7D A;  3PW0 A;  2CR5 A;  4M9N A;  2N9X A;  3PW5 A;  4YT0 B;  3R8B A;  3W2D A;  4NJ6 A;  4GXJ A;  4HPL B;  3NGD A;  5JH5 C;  3JYU A;  4KLE A;  1S1Q B;  2KE7 A;  2EKE C;  4W9C A;  2KAC A;  4NWI A;  1EU4 A;  3N4M B;  1NK7 A;  1P3Q U;  1MQ3 A;  1MG8 A;  2WDT B;  1YN4 A;  2D11 A;  2BVC A;  2JYE A;  4URK A;  1PGB A;  3QYP A;  3Q8P B;  3RYT A;  4YCX A;  3NS8 A;  4BBN C;  1ZQC A;  2KFN A;  4YXM A;  3AEF B;  3TUO A;  1D4B A;  3LDZ E;  3KD3 A;  4DQS A;  4LVS A;  3UQA A;  1HE8 A;  7ICF A;  5EWG A;  2IO3 B;  1SWW A;  1RZT A;  4RM9 A;  3RNG C;  3LXF A;  1P7D A;  4YG2 A;  4PS8 A;  4W9E A;  4RQ8 A;  4C4S A;  4Y2P A;  2JZZ A;  5AKK A;  4RQ7 A;  4RQ2 A;  4A8X C;  2FI1 A;  1X2I A;  3QXG A;  5ALK A;  4J9L A;  2HW3 A;  2KFK A;  1L8L A;  4Z6C A;  3KHH A;  3V6J A;  2HDE A;  2WQY B;  4YTN B;  1TKE A;  4MSM B;  2AHO B;  3D2N A;  3HIZ A;  1Y56 A;  2Y9T A;  2G5H B;  5JTI A;  2MSE D;  4J9Q A;  1XO0 A;  1R4M B;  1TS4 A;  4KLQ A;  3WKC A;  5T14 A;  3VAW A;  1IUE A;  3U2S C;  3KOO A;  4M9H A;  2MSN A;  2KHV A;  2ZIX B;  5ALV A;  1L7P A;  3I3T B;  8ICT A;  5CP2 A;  3KW5 B;  3BS5 A;  4I6L B;  5AKI A;  2EMS A;  3BVG A;  3ZDC A;  4TQR A;  3DBL I;  4EUT A;  4CNQ A;  5DG8 A;  1L7Y A;  3MAB A;  5CTR C;  1ISN A;  1KRH A;  3RNA C;  3ZLZ A;  5L95 C;  1SF0 A;  4HDO A;  2KDI A;  2BT6 A;  2W8L A;  2RP5 A;  3PO4 A;  1N48 A;  3FIL A;  5KT2 A;  1T4G A;  1JWU D;  4WWO A;  4USA A;  3RB3 A;  3NZ3 A;  1Z2M A;  3RMK C;  2M4N A;  2D5G A;  3JPN A;  3BZK A;  5KNI A;  5KG5 A;  1QTM A;  3DBS A;  4W9J A;  3A4S C;  4N6E B;  4J9R A;  1S0M A;  4F7Z A;  2JEG A;  2UWQ A;  4DFM A;  2IPK D;  3BYY B;  3Q3N C;  1YIW A;  5AUI A;  4YSX B;  2BS4 B;  5KHQ A;  1FPY A;  1FD6 A;  4C7Y A;  1YJ1 A;  2KX3 A;  3NZU A;  2LM1 A;  2W11 A;  1C1Y B;  2KDF B;  2K1F A;  1WGH A;  1ZQD A;  1F9J A;  1BPD A;  3KYD D;  2E8P A;  2M9N A;  3EPG A;  4I2D A;  2N7E A;  4HDQ A;  3K9O B;  5AI6 A;  2EMT A;  3CST A;  4AYB C;  4DO9 A;  5LXH A;  3M62 B;  1XO3 A;  3DVN V;  4FAD A;  2DFL A;  4KIT B;  2JV3 A;  3CRX A;  4ICU A;  4XA5 A;  5J0T A;  2M19 A;  4PT5 A;  2KVS A;  2EKI A;  2R8I A;  2PMZ C;  2HVI A;  1L3S A;  4JWM A;  2YTU A;  3PX4 A;  1OQR A;  5DPT A;  7ICJ A;  2MP2 B;  5HG2 A;  3QAQ A;  4KLT A;  1HQR D;  2RHF A;  2A19 A;  4UB6 U;  1V1O A;  2D3B A;  4RCO A;  3Q8A A;  3Q8M A;  5ALP A;  1BPB A;  3C19 A;  3H8W A;  1NKC A;  4NM1 A;  2H3Q A;  3RJK A;  4O5E A;  4F5R A;  3ML9 A;  2MAX A;  3PZD A;  1U9L A;  1I4H A;  3V6C B;  1ZW7 A;  2L3Z A;  2AGP A;  2ISO A;  2KTR A;  2Z0D B;  2N4F A;  4QIW F;  4UAS A;  5KFD A;  1WSP A;  3B2F A;  1JRP A;  3UXP A;  5BYR A;  5AZG A;  2KTR B;  4Q8F A;  1IG6 A;  2YLM A;  2W9B B;  4ECS A;  3SQI A;  5AZH A;  1HZ6 A;  3ZJT A;  1KRP A;  2BF8 B;  3K75 D;  1V97 A;  5ALT A;  5ALE A;  4MJS A;  3DOW A;  1V1P A;  3J9C A;  3NVV A;  1MVK A;  2OWO A;  3PRP B;  4HLE A;  1SXT A;  2NO4 A;  1LQB A;  3RH6 A;  4A8E A;  2N9K A;  3QU7 A;  5J0W A;  4PHP A;  4BKG A;  4E3C A;  3AB5 A;  4EEK A;  2XEW A;  9ICX A;  3M8R A;  5KFR A;  3M1Y A;  2LWP A;  3BK1 A;  2M0N A;  4GC6 A;  2XY6 A;  3SHQ A;  3VQI A;  2C2R A;  3JSV A;  1YQ4 B;  1WMH B;  3W5U B;  2J0K A;  1SL2 A;  5J2I A;  1WJ6 A;  2K60 A;  4KIK A;  4W9D A;  3I28 A;  4EZ9 A;  4Z6E A;  2NRV A;  1KFD A;  2NTT A;  1AWD A;  4HJK A;  5J18 A;  1KSP A;  1VR9 A;  2QIL A;  1E90 A;  4H2A A;  1WIA A;  3H8S A;  3GV5 B;  4QWE A;  4EBC A;  3PX0 A;  1HTQ A;  1IBX B;  2ZIW A;  5F9N A;  2KN4 A;  1I4Q A;  3SFE B;  3IT4 B;  4P0P B;  1V9P A;  5HNK A;  2DKX A;  1PDX A;  4FHJ A;  4J9N A;  5AI8 A;  1CEZ A;  2AXT U;  1ET9 A;  2YN4 A;  1SGH A;  3ZD8 A;  5JUM A;  2BTE A;  1XCQ L;  4JK1 A;  5D6J B;  3VR9 B;  4MEL A;  4DDG D;  3IAM 1;  4IL6 U;  1TK0 A;  4YN4 A;  1EU3 A;  2N7D A;  2AQ3 B;  3AE9 B;  4J6I A;  4XQ8 A;  3BS7 A;  4FFD A;  4F5P A;  2IY1 B;  4MGY E;  3PV8 A;  5GMV A;  2I2Y A;  3NG0 A;  3L4P A;  2IY0 B;  3PSE B;  4ZHP A;  2PXI A;  2AJQ A;  2F76 X;  4AJW A;  1H8C A;  4ED7 A;  4F4W A;  4P4O A;  3D2Q A;  4EEN A;  1KTQ A;  2KQ4 X;  4YMO A;  2I1K A;  4GGQ A;  5IA7 A;  5KT7 A;  3CP8 A;  3PMN A;  2LMR A;  2ASD A;  7ICE A;  2GMI C;  4P1C C;  3TAP A;  4QZH A;  4Y2R A;  3C29 A;  1X9X A;  1OEY A;  1WJN A;  1WE7 A;  2FCN A;  3PHX B;  1XWL A;  1X40 A;  2BPC A;  1XLQ A;  3U8Z A;  2W7P A;  1WGY A;  2LI5 A;  3H7S A;  4WJP A;  4RT2 A;  2Y9U A;  1WY8 A;  2PJH A;  4EE2 A;  1GB1 A;  1ZQW A;  1NEK B;  3TAR A;  1KF6 B;  1SE2 A;  1L0Y B;  3ABV B;  8ICX A;  2XCP A;  1MG4 A;  3UM9 A;  1NJW A;  2XGP A;  3KUZ A;  1PGA A;  3AE7 B;  4GU2 A;  3DEE A;  2XI9 A;  5KFU A;  3KKA C;  4C8O A;  2AU0 A;  2KVC A;  2KVZ A;  3VH4 B;  2OJR A;  1SGG A;  1U4B A;  3ETR A;  7ICG A;  2EAP A;  2WXR A;  2V9H A;  1V38 A;  5KFY A;  2WAQ F;  5J0U A;  4YQW A;  1IV8 A;  1SV0 A;  2BHN A;  5J0R A;  4DSJ A;  1HZ5 A;  4OCZ A;  2J4X A;  4FS2 A;  2WNM A;  3VRB B;  5AK4 A;  2KJ5 A;  5KG3 A;  1JN3 A;  5J2G A;  2QLT A;  3V6H A;  4LZG A;  5E6P A;  4G3I A;  3U7Z A;  1ZD4 A;  4QIW C;  4DQI A;  3HX0 A;  2BR0 A;  1JW9 D;  3EA6 A;  4KKI A;  4YD2 A;  3MC0 B;  4MSQ B;  2JGA A;  2B3A A;  1UNS A;  1E9M A;  4DL2 A;  2V9W A;  5DGB A;  1E5W A;  2C7H A;  2MA1 A;  3KWL A;  4MFC A;  1V8C A;  1P0R A;  2I38 A;  2MBH A;  2M56 B;  2DQN B;  2GH1 A;  2DPJ A;  8ICW A;  1ZQL A;  4JV0 A;  3TEX A;  1Y8R C;  3BQT A;  1F2R I;  4MH8 A;  4LNI A;  3ZDA A;  2ZCB A;  2MQJ A;  5A0L A;  1MA7 A;  2G5I B;  4NL9 C;  4PGQ A;  3GIJ A;  3AE1 B;  1J19 A;  3IAS 1;  4OJO A;  3Q69 A;  4I27 A;  4IWO A;  4J9K A;  3VH3 B;  5L1K A;  4OW0 A;  2KNB A;  4HRO A;  3PV1 A;  1PYW D;  1NVI D;  3RJE A;  1PFD A;  2VRR B;  1Q5W B;  2JSV X;  4YTM B;  2EZY A;  5EWF A;  5DLF A;  3DHI C;  4Q2J A;  1TIF A;  1HA5 A;  3C5G A;  1E10 A;  4F91 B;  1F52 A;  2HBM A;  4MGK E;  3C5F A;  7ICL A;  1I4R A;  1WRD B;  4OZC A;  2DEN B;  3H6N A;  4EZL A;  3WKA A;  2ZZP B;  2W55 A;  3E9S A;  2YX8 A;  1E7P B;  1J8C A;  1FIQ A;  4C7Z A;  4S0R A;  3PZ7 A;  3ZI4 A;  3DVG X;  2R2O A;  1R7S A;  4G3X B;  3OJU A;  4BOS C;  4WJQ A;  2DLB A;  3AU2 A;  2QCZ A;  2KD1 A;  4B6W A;  3AEG B;  2HBJ A;  1UUP A;  3RN9 C;  4ASW C;  4FA6 A;  3DCG A;  1BT0 A;  5AK5 A;  3DDC B;  4W9K A;  4XX5 A;  4PYU A;  4NJ8 A;  4AWJ A;  1GJZ A;  2QB1 A;  4NV0 A;  3AE2 B;  4PGY A;  1TE2 A;  3MR5 A;  2D6F C;  3H0L B;  5AM1 A;  5I4D A;  3ZTC A;  2K8H A;  1ZQZ A;  1X9W A;  3OSN A;  3QK0 A;  4UAW A;  4C4T A;  3O0F A;  3WK9 A;  1ZQR A;  3B2G A;  1JX4 A;  4MM3 A;  2W43 A;  2MUT B;  2K8B A;  1JXE A;  2IZV B;  4MM3 B;  2FMQ A;  1Q0W B;  1KFT A;  4IDI A;  3RNC C;  3WAM A;  1V5O A;  3CMM B;  3AUL A;  4R64 A;  2KMA A;  5GXG B;  1NNL A;  5EE0 A;  3NY5 A;  4K3C A;  4ZYN A;  1TFR A;  2E8N A;  2KLC A;  2XGQ A;  4II2 B;  3TMP B;  2HHU A;  4OJP A;  3RUL A;  5L1I A;  3ISB A;  4JL9 A;  3B0Y A;  1XSN A;  4I2B A;  2WXF A;  1F0Z A;  2KWD A;  1GG3 A;  4DEZ A;  1JML A;  4JPS A;  2C2E A;  4DL6 A;  2ZTD A;  3PPA A;  2WAQ C;  4F93 B;  4GXK A;  1VZ8 A;  3QQ8 B;  3R2I A;  4G0N B;  1MHH E;  2PFP A;  4M2Y A;  1VRA B;  4WIP A;  2R8J A;  4J9O A;  3GFK B;  1DOY A;  1L3T A;  4ICV A;  3E56 A;  3MC9 A;  4D2K A;  1FO4 A;  3BII D;  2FJ6 A;  2IBK A;  4U6P A;  3LB8 C;  2N7J A;  1I4P A;  2B21 A;  1QT9 A;  2PTL A;  4RQ6 A;  1GNU A;  3Q3J A;  2FCM A;  4RGT A;  3MFI A;  2BYE A;  3C1Y A;  4ARC A;  3EC8 A;  3URY A;  3QWZ B;  1YZ6 A;  4IG7 B;  4M0W B;  1DK3 A;  5J2D A;  1FMA D;  4XE0 A;  1QF6 A;  4KZ0 A;  3ZTD A;  3I57 A;  3ISC A;  1UBI A;  4R3D A;  2LHT A;  3SV4 A;  8ICF A;  1UBQ A;  2WF8 A;  2BB6 A;  4Z6F A;  1RYR A;  8ICN A;  1WGK A;  4UAY A;  2UVV A;  1K5O A;  1DOI A;  1N6Z A;  1UD7 A;  5D4B A;  3L13 A;  3SAG A;  2LYB A;  4E71 A;  2V3S A;  3APC A;  4IOI E;  4UBB A;  5JHA A;  4YXJ A;  1GAQ B;  5HI1 A;  4M02 A;  4GDL B;  4O0I A;  1HEK A;  2NPT B;  1GUA B;  1TYG B;  1QLN A;  3G6Y A;  3D2S A;  4ANW A;  1AN8 A;  3FM9 A;  1ZKH A;  2PMV A;  1CZP A;  2GBN A;  3N20 C;  2LVO A;  1RYJ A;  1QOB A;  1UGM A;  4IKG A;  3I63 C;  2BYT A;  5EDS A;  2NVU I;  1EUV B;  1D5M C;  1KLN A;  3Q8R B;  3R7R A;  3QX7 A;  2DYO A;  3S2A A;  2J6T A;  1UPH A;  3QC8 B;  2WXH A;  4KMO B;  4K1R B;  4ECY A;  1WXA A;  3VUX A;  4IM3 A;  1RXW A;  1L5U A;  2K9X A;  4WWP A;  1ZQT A;  3VHT C;  3VTV A;  3DWG C;  3GB1 A;  2V4Q A;  5L1M A;  3LVW A;  4Y2X A;  1GOZ A;  1ZUD 2;  2HTM E;  4WWN A;  5CHF A;  2IOF K;  4LJX A;  2XCA A;  4ZOH C;  2WP9 B;  4GDK B;  2QDF A;  5KFF A;  4HXD A;  3R9K A;  1RFA A;  3WKD A;  9ICC A;  4O5K A;  5AHX A;  3R66 C;  2LGX A;  1WZ0 A;  3TQ1 A;  4I28 A;  1L4D B;  3L08 A;  1AQ6 A;  4Y2V A;  4C8N A;  4KSK C;  3UI3 A;  1UH6 A;  2QB0 A;  4F3O A;  2BPG A;  3VCB A;  4DFJ A;  2IGG A;  4M6W A;  2WU5 B;  4PYZ A;  4A6Q A;  1RXV A;  4UAT A;  2JXX A;  4DQO C;  2QKQ A;  3QU9 A;  4KN4 A;  4M6W B;  3F2D A;  3QX1 A;  3ZNH B;  1A6S A;  3AN1 A;  5EWE A;  4ECU A;  1TS5 A;  1WWU A;  1DXS A;  1XD3 B;  2JRH A;  1GB4 A;  5HML A;  1VZ7 A;  4J9M A;  2WHE A;  4ECW A;  4KX6 B;  3IRU A;  5LNK 1;  4CF3 A;  3OSP A;  1BPE A;  1Q3U A;  5HFY A;  5KFP A;  3M9M B;  5D94 A;  2GOL A;  2WXM A;  3ZDM C;  4EZK A;  3W5V B;  4QJF B;  4LNO A;  2MLB A;  1YOV B;  2FBW B;  5AI9 A;  2B6G A;  2DYM A;  4F5Q A;  1LKY B;  4GXB A;  4S17 A;  1TKG A;  3C8Y A;  3AUO A;  5DBC A;  3OGU A;  3TAN A;  4KVG B;  1X6J A;  4BWM A;  4ZRI A;  4K4G A;  2JEI A;  4EX6 A;  7ICT A;  1Z5S B;  5CHV C;  2LXC A;  3U30 A;  2JZB A;  3PSF A;  8ICE A;  4ED2 A;  1S77 D;  4WJN A;  4NY0 A;  8ICJ A;  2YEP B;  4ECQ A;  1ZPS A;  3IBE A;  2IOF A;  4BKS D;  3V05 A;  4RNA A;  3WA0 A;  4Q45 A;  3KZI U;  3FC4 A;  4ED8 A;  1ZQV A;  1V80 A;  2RPQ A;  3MFG A;  2WXI A;  2SAK A;  4RU9 A;  4B9S A;  2ESE A;  1XS9 D;  2OHF A;  4EBD A;  3DBL B;  5AKX A;  1WZ3 A;  2PFQ A;  3QCA A;  2M1M A;  3DWM A;  5DQG A;  1T6B X;  3VRA B;  5J8Y C;  2XK5 B;  3NJT A;  4B9L A;  5FKA C;  5CJ7 A;  5J2F A;  2C5L C;  4TV3 A;  9ICG A;  5LLI A;  3ZRC A;  5C3J B;  1PQS A;  4NPN A;  5KT6 A;  1URJ A;  8ICM A;  2O2V A;  1Q10 A;  3H1U A;  2K4P A;  2KWC A;  5EE3 A;  2BCR A;  1PK1 A;  2LGS A;  1E0Z A;  2B0C A;  1D5Z C;  4UB1 A;  3MHS D;  3QU2 A;  3DDH A;  3OJS A;  2WF7 A;  2IBI B;  2GWS A;  5DPW A;  3Q14 C;  1RFK A;  4ICA A;  3M95 A;  1V2Y A;  3Q8C A;  2KQS A;  2DL0 A;  3Q8L A;  4RH6 A;  2N9P C;  4LJP B;  1JWM D;  2K6Q A;  2HHW A;  7ICM A;  5IP4 D;  3GE3 C;  3CSF A;  4QZD A;  5IIL A;  1U45 A;  1ET6 A;  1T0S C;  4MHV A;  3TSS A;  4DF4 A;  3H4B A;  1KM7 A;  4B6J A;  2GB1 A;  3Q3F A;  1BPY A;  3RI7 C;  1WYG A;  3W1Y A;  8ICZ A;  3AE6 B;  3HM3 A;  3UF8 A;  5AKE A;  3OJ4 B;  3TI0 A;  2XVT A;  4M9J A;  5CRX A;  4P16 A;  5TIS U;  3SAF A;  1T8E A;  3PGE A;  2PVG C;  3KLS X;  2G0A A;  5HMM A;  5BMI A;  1E8Z A;  5DDY A;  1NI3 A;  5AM5 A;  5J0Q A;  2A1J B;  4M9L A;  5IIJ A;  5CX3 A;  3VC8 A;  4DXA B;  4F4K A;  3PRM B;  1WXM A;  4XDC A;  4HPM B;  4REZ A;  8ICC A;  2WS3 B;  1ACC A;  4NXZ A;  5KG2 A;  3OLM D;  4YR3 A;  1WX9 A;  4AJY B;  2PI4 A;  1YJI A;  5AI0 A;  5KG4 A;  1ZGU B;  3LDA A;  1QH9 A;  1FCC C;  2ZNV C;  4EYH B;  1BUI C;  1E8X A;  4Y2Q A;  2RDI A;  4AUQ C;  2V0G A;  1WXV A;  4CRX A;  2JWZ A;  3PO5 A;  3WK7 A;  2JY6 A;  1GC6 A;  4KGT A;  5C5J A;  3TCA A;  1VCB A;  2NRT A;  2LI6 A;  3QUC A;  4NJ7 A;  4IR9 A;  7ICS A;  5KFM A;  2VH2 A;  4BWJ A;  1PGX A;  2MCN B;  3ALB A;  1V6E A;  2H88 B;  3QUT A;  3TEY A;  1PZN A;  5DBA A;  2F3N A;  1XQQ A;  3TFR A;  4B9U A;  4X57 B;  4ZRP A;  4QW8 A;  2KJ6 A;  1COK A;  2UVR A;  1IGD A;  3KKA A;  2MX2 A;  5III A;  2KO3 A;  2NBU A;  3QU5 A;  1S10 A;  5AM3 A;  5AK3 A;  4ED6 A;  2J0M A;  4FBJ B;  4YTP B;  4OJ5 A;  4P2H A;  4TKN A;  5C1Z A;  1JI7 A;  1A70 A;  3RZF A;  4C0Z A;  2R8K A;  3ZDB A;  4QWC A;  3SEN A;  4RQN A;  4DS5 A;  5CHG A;  2JPH A;  1TTN A;  2H3F A;  4QZA A;  1KFS A;  2FMP A;  1FRR A;  1OW5 A;  3A1Q A;  4EX7 A;  2WXO A;  3NUH B;  4US9 A;  4G50 A;  2KN7 A;  1UA1 A;  1WJ4 A;  2W3S A;  1S8O A;  1ZP0 B;  2BKR B;  2CJN A;  3DHH C;  1P1A A;  5JXV A;  4FE3 A;  1FNV A;  2HJ1 A;  1WWV A;  2KAJ A;  3IN5 A;  2H3Z A;  5KFN A;  2E8O A;  1I42 A;  1S0N A;  1KLG D;  4CDG A;  4P4M A;  1C78 A;  2BGW A;  1RLF A;  3E2E A;  1N63 A;  2KFK B;  4W9G A;  4NL9 A;  4K7S A;  2LMC A;  4DOC A;  4GIB A;  5JHB A;  1B22 A;  4AOF A;  1A77 A;  2H5X A;  4DL7 A;  2KN5 A;  4GSW A;  1WGG A;  5ALM A;  2RDJ A;  2RSU A;  2KZM A;  4UB2 A;  2KOB A;  2ZJD A;  4HKZ E;  5J2C A;  3WK5 A;  2WXK A;  3BS5 B;  3E0F A;  5ALQ A;  1D9F A;  4KZC A;  1LFD A;  3MGH A;  3M63 B;  4QZC A;  2KG5 A;  5D2M B;  2W03 A;  5KT5 A;  4NLZ A;  1UGJ A;  2VJ5 A;  2WU2 B;  4PHD A;  4O5C A;  1WRI A;  4YWG G;  1ZET A;  1MC8 A;  2KEY A;  1NZP A;  2FAZ A;  1IPG A;  4BXO A;  2I5H A;  1ZRM A;  1QSS A;  4NAW A;  2ZVN A;  3FIL B;  3Q3O C;  3OTQ A;  4DLE A;  1XO1 A;  4BX9 C;  2D3C A;  1WG8 A;  4RUA A;  1NJX A;  1L7M A;  4JB3 A;  2BCS A;  2AEH A;  4JMU A;  2PLP A;  3ZXR A;  3THV A;  3ZNZ B;  3TBL D;  2ZIV A;  2YB4 A;  2C60 A;  3PRZ A;  4BKT A;  3Q3M C;  3GII A;  2F1J A;  3RF9 A;  1KEJ A;  2E1E A;  1QOG A;  3VVW B;  7ICR A;  2CPR A;  4RZR A;  2J42 A;  4C4R A;  1SL0 A;  5KFW A;  4IUM B;  4DL4 A;  3PHW B;  4L23 A;  2AQ1 B;  1QLB B;  5KAI U;  3BQ0 A;  2K0P A;  3VDZ A;  2Y0S F;  2BPS A;  3BZC A;  4DL5 A;  1C4P A;  1UWX A;  3APD A;  4JX1 C;  3O13 A;  4DSE A;  2GBM A;  2JX5 A;  3AE3 B;  1TKD A;  3EEC A;  3EZ5 A;  3RR7 A;  4RGO S;  1FXA A;  1XSL A;  2DWQ A;  1PVP A;  2LD9 A;  2V3P A;  2YQE A;  5KFK A;  5KAF U;  2Y1J A;  2ZPY A;  3VTU A;  2NRX A;  2GBJ A;  1BNO A;  4LNF A;  4FBU A;  4EZ6 A;  3H7I A;  4NLG A;  2MBE A;  2MHJ A;  1LM8 B;  3TFS A;  4KGR A;  3RT3 B;  1ZQN A;  2BQQ A;  3P4S B;  3Q8F A;  5L1L A;  1WE6 A;  2LZ6 A;  2IA6 A;  3BK2 A;  3RJI A;  3UQ2 A;  5J2K A;  3GIK A;  2FLN A;  3MFH A;  2KIC A;  1Z4O A;  3C21 A;  4GXI A;  2ZTC A;  1D8L A;  4F71 A;  2YMM A;  1UHU A;  2DBY A;  5ALS A;  2A4Z A;  2IMW P;  1CK1 A;  2TSS A;  1R4N B;  2KIV A;  1K51 A;  2V4I B;  2LVQ A;  2L05 A;  3QJZ A;  5IIM A;  1YN3 A;  1HIW A;  2WXJ A;  2I1J A;  4C4V A;  4MJS B;  1V1P B;  3C2K A;  3M9N B;  3RRG A;  2CHW A;  2PVO D;  5E6O A;  5C2T B;  2A1A A;  4IW0 A;  3WAP A;  4UDU C;  2W9M A;  2YMQ A;  2XBB C;  2K8A A;  1KQQ A;  3MR2 A;  2RRD A;  4NQK E;  3P4R B;  3JSV B;  5J2E A;  1FXI A;  5J2B A;  3C2L A;  5AM4 A;  4F4Z A;  1NYR A;  2ICI A;  3QU4 A;  3WIM A;  3RB4 A;  4KIK B;  1N61 A;  4YR0 A;  4M0A A;  2GRI A;  4YP3 A;  2JXT A;  5JU5 A;  2FE9 A;  2W9C A;  3ZNG C;  9ICB A;  5EE1 A;  5BYS A;  9ICU A;  2ZIW B;  4W9F A;  1EWC A;  3SV3 A;  3RNF C;  1Z3E B;  3CWI A;  1TGZ B;  2KSO A;  1N5X A;  5D3D A;  7ICN A;  1J97 A;  5C23 A;  2QJL A;  1VZ6 A;  4QWB A;  4KKJ A;  1ZQH A;  2FUH B;  4YMM A;  4Q8E A;  4B9M A;  2WXQ A;  1UWM A;  3QEA Z;  4UB5 A;  3IVF A;  3IG5 A;  3ONN A;  2DZJ A;  1NK0 A;  5BMH A;  3NHE B;  2PI5 A;  3LWL A;  1CQV A;  1H4R A;  5BMG A;  4CGZ A;  4RT3 A;  1SKW A;  1JWB D;  3A0H U;  3HJE A;  4TSS A;  2CN1 A;  5CEH A;  4W9H A;  2BS3 B;  2EAO A;  2INP E;  3PST A;  4C8L A;  3ETL A;  4MFA A;  3V7K A;  2RDG A;  2W82 A;  4TQ0 A;  3JPQ A;  5AEK B;  4UAU A;  2K4H A;  1E7V A;  1T7P A;  3HWT A;  4MT5 A;  2FCQ A;  2SEB D;  3PO0 A;  4F4X A;  2K6D B;  4ZRK A;  1Q46 A;  4HWI B;  2AX5 A;  2EH9 A;  2G1E A;  1FRD A;  4GLS C;  2DKZ A;  3DPD A;  1TY0 A;  3QAR A;  2Y3A A;  2F8L A;  3UQ0 A;  2L76 A;  4DHZ E;  2L0T A;  1P98 A;  3PTF C;  2G09 A;  4UB8 U;  2DZI A;  4YR2 A;  4NM2 A;  2Y0S C;  2VJ4 A;  4IM2 A;  3D32 A;  1QQ5 A;  4M9G A;  2V3N A;  1XNS A;  4NLN A;  1Q1O A;  1WCL A;  3N30 A;  1RDF A;  5J0Y A;  5L1J A;  1VD2 A;  4CCH A;  1C3T A;  3A0B U;  1X9M A;  2AWT A;  2CHZ A;  3C1Z A;  2F44 A;  3RJH A;  4PHA A;  2PKE A;  2ASQ A;  4A9A A;  4Z6D A;  1JRU A;  5CHW A;  3LYY A;  3H4D A;  3V7L A;  2JMG A;  2UVW A;  4KLG A;  2LRW A;  4K4I A;  3N3K B;  1IXR A;  5KFG A;  5C0Y A;  4KLM A;  5KG6 A;  1ZQF A;  3U4E G;  1L7N A;  1V86 A;  3PT2 B;  5AK6 A;  4QZG A;  2WWZ A;  4B0E A;  2Q4T A;  2KKV A;  3K1R B;  3Q8S B;  2ZCC A;  4FJZ A;  2JVC A;  2W04 A;  2HBK A;  4IRD A;  3VUW A;  4Y2J A;  4JV2 A;  4UAV A;  3DBH B;  4NQL B;  3LVV A;  4YSZ B;  1KLV A;  5EE9 A;  3E58 A;  5ALW A;  3EGR A;  3NVW A;  2LYH A;  3ZKJ C;  1JIH A;  3F5A A;  4JQW C;  2JZP A;  3ZJU A;  4KLU A;  2O6V A;  8ICK A;  3TEZ A;  1JQ4 A;  3WKB A;  5HP4 A;  3AV8 A;  2KYW A;  1YNT E;  1Z1B A;  5BO4 B;  4PJ0 U;  1X6I A;  3IV6 A;  2G06 A;  3HT3 A;  1OXJ A;  1IYF A;  4O9M A;  5CA7 A;  2Q5W D;  3EFC A;  5BPC A;  2MJ3 A;  3H9D A;  4OO1 J;  2D3G A;  1C9F A;  1JMS A;  4FZM A;  8ICR A;  3PVL A;  3N1Z C;  2BDU A;  2ODG A;  2XIC A;  1R4N I;  3NRW A;  1J2M A;  9ICQ A;  4PZN A;  1WWT A;  4K4H A;  3JPT A;  5E79 U;  5DG9 A;  1MHX A;  5J8Y A;  3ECI A;  3ZD9 A;  1UCV A;  3MGV A;  3T9L A;  5FK9 C;  2I6X A;  2HOI A;  3AE5 B;  2WHI A;  4DFP A;  5IIO A;  3RBE A;  2JHD A;  1ZQJ A;  2AGQ A;  9ICV A;  5D49 A;  2C9W B;  1E8Y A;  2E3T A;  4RGN A;  1U47 A;  2W3R A;  3HUI A;  2A3V A;  5G55 A;  5TR5 A;  1PVQ A;  3T5H A;  2O6K A;  2OCE A;  2ZIU A;  4OVV A;  3QNM A;  1OQQ A;  1WGR A;  5ALR A;  4F1S A;  3T3N A;  5HHI A;  5ALN A;  4RUC A;  8ICL A;  2W9N A;  4LLG M;  2E8M A;  1CI4 A;  4QZI A;  1FXT B;  8ICB A;  1MI0 A;  4PS7 A;  4MAC A;  4EEY A;  4BGD A;  2LVP A;  3W9C B;  4UB4 A;  4PPX A;  1ZQO A;  2LGD A;  3MHZ A;  4DSL A;  2UVU A;  4M01 A;  5J2J A;  2CRX A;  3F2C A;  5AIA A;  3B0X A;  1SIJ A;  9ICP A;  1WYW B;  4DK5 A;  3O65 B;  2KLG A;  2K8B B;  3FAH A;  2BCV A;  8ICH A;  1C4C A;  2K4I A;  1V9J A;  2MJE A;  5AM0 A;  4NAM A;  4R8U A;  2YML A;  4I6P A;  2GI9 A;  4A90 A;  4PHE A;  9ICI A;  3PR4 A;  4IWP A;  4R63 A;  3PRE A;  4R8U B;  4MEM A;  4GMV A;  4KLS A;  3NZS A;  3UQB A;  1AYF A;  4KMU A;  2K4E A;  2J53 A;  1L2N A;  3TKA A;  1NEN B;  4F5O A;  2RMM A;  2FDR A;  1K52 A;  3RFA A;  4LCD E;  2ZXI A;  2KXJ A;  2VKQ A;  1TS3 A;  1KBU A;  4CHK A;  3QUQ A;  5H92 C;  3T5J A;  3S6J A;  4IQW A;  3BWU D;  1ECW A;  3R3M A;  2MBO A;  2WYQ A;  2GLS A;  1LGR A;  3LJ3 A;  4IC7 B;  2AQ0 A;  1OEY J;  2M17 A;  2N1V A;  1P7F A;  2N0S B;  2PE9 A;  3C2M A;  1Z00 A;  4KLF A;  3PVX A;  8ICS A;  1F5S A;  1EWY C;  5AIC A;  4FBT A;  2RDB C;  1SV4 A;  3SZ2 A;  4ED1 A;  1ZQQ A;  2V4R A;  2V1Y A;  1MFW A;  1UT5 A;  1P7E A;  3AEB B;  2YMP A;  2DZK A;  5KL8 B;  1SXE A;  4A20 A;  2MW5 A;  3WCQ A;  4EEL A;  3AE4 B;  1B9R A;  2JH7 A;  9ICS A;  5HHD G;  4UW9 A;  3AU5 A;  1L4Z B;  1TK8 A;  1EF1 A;  1TAU A;  2KTF A;  1BPZ A;  5KHO A;  2KFZ A;  3M6K A;  2WDV B;  4F4Y A;  4DXF A;  4F2S A;  2YVC A;  2HHQ A;  5H8Y E;  2X38 A;  3A9J A;  4QNL A;  2WB1 F;  5E6N A;  2E6X A;  4IS7 A;  4KN7 A;  4G9B A;  3GQC A;  2IHM A;  2KHW B;  3KTQ A;  1N2X A;  2L0F A;  1BVS A;  3C23 A;  1IP9 A;  2G4S A;  4N58 A;  1OTR B;  4IM0 A;  3AE8 B;  4RPZ A;  4DCC A;  3L0W B;  2ATL A;  4MF8 A;  4B95 A;  3WU2 U;  1CMX B;  1QZE A;  2J0J A;  3DBH I;  1C4A A;  3ED5 A;  8ICG A;  3ICX A;  3IP4 B;  1S3S G;  2HOF A;  4F2R A;  3DBR B;  3UIN B;  1FCL A;  1N56 A;  2VIX A;  1SKS A;  2Y5P A;  4YXD B;  4U7C A;  4RQ4 A;  3SD5 A;  5DB7 A;  1U49 A;  2HE7 A;  1KL9 A;  4J9P A;  2KZ3 A;  1V85 A;  1TJE A;  1DOX A;  3L16 A;  3AEV A;  4MF2 A;  3L17 A;  2K3U A;  1UZX B;  2L1A A;  2FE8 A;  1NJY A;  2KP7 A;  4IC9 A;  1RPL A;  4WAF A;  1Z19 A;  5DGA A;  2KK0 A;  2OM6 A;  1D3Z A;  2ZPN A;  1WX8 A;  5IN7 A;  2BQR A;  3PSI A;  4PGX A;  2L00 B;  3BQ7 A;  4GC7 A;  5ALX A;  2QB0 B;  2W8K A;  2CJO A;  2HOQ A;  3EPI A;  2L7R A;  4G11 A;  4DDI D;  2EQY A;  4OD0 A;  5KTQ A;  3BVZ A;  4FJY A;  4FZL A;  4I2A A;  4C56 C;  2LPE A;  2DAF A;  4ITK A;  3TEW A;  3IT6 B;  1SB3 C;  9ICA A;  3QUB A;  2L8J A;  2DX5 B;  4CF4 A;  3RNE C;  4DHZ B;  2ZJ8 A;  2DUY A;  4DHJ B;  5AKJ A;  1GC7 A;  3NS1 A;  1MJD A;  2L52 A;  5AM2 A;  4GOC A;  4WWM A;  1KOT A;  4BKS A;  1EO6 A;  3JPP A;  1S9F A;  1WF9 A;  1SE9 A;  3Q8B A;  9ICO A;  3PSP A;  2D3D A;  1VLB A;  1E7U A;  5LXI B;  1CRX A;  2KDM A;  1ZOL A;  4O3O A;  3T5K A;  4ELT A;  4KLH A;  3HM6 X;  2K22 A;  3TAQ A;  4KLI A;  1WM3 A;  2C7M B;  4ECT A;  2KFJ A;  2BGF A;  4B9T A;  3MGI A;  4ZRJ A;  3I1Y A;  4ECR A;  4I2C A;  9ICF A;  1ZQS A;  1WXQ A;  4DBG A;  4I2J A;  3WK6 A;  2DGZ A;  3RPF C;  2JRZ A;  3SAH A;  2XC9 A;  2FIF A;  4I2E A;  4KSL C;  2JZB B;  5KFJ A;  1LV5 A;  3A9K A;  3RTV A;  3CYM A;  4OHJ A;  3P4P B;  1PVR A;  4DSK A;  1D9D A;  4IQU A;  1E6E B;  4XZ4 A;  2ZXH A;  3PZP A;  3MR3 A;  2L83 A;  4JWU C;  4M04 A;  2MWS B;  4CQN A;  5KFT A;  5KFC A;  1UF0 A;  5DB6 A;  1QQ7 A;  3IXS A;  1UQV A;  2LM4 A;  2MA9 B;  5DB9 A;  2RGF A;  4ELV A;  3RR8 A;  4M8M A;  3GIM A;  4FXC A;  3K1Z A;  3N97 B;  2KZZ A;  1SZH A;  1FNW A;  3QIJ A;  1KTK A;  2IDY A;  2P66 A;  4GFJ A;  9ICH A;  1QSY A;  1BPX A;  2WB1 C;  9ICW A;  2JUO A;  1S0V A;  1IIP A;  4XYC A;  5IIK A;  1JRO A;  2O2V B;  1L3V A;  4OJL A;  3V72 A;  2J7Q B;  7ICH A;  2INN E;  3L54 A;  3H8H A;  3RJG A;  1PK1 B;  5J2R A;  2JU6 X;  5KFI A;  4M8N A;  3BQ1 A;  1NBF C;  2HJ8 A;  2LEK A;  2KTQ A;  2D3A A;  2WXP A;  4ZDV A;  3IDW A;  3GS2 A;  3VTW A;  1X9S A;  1DGS A;  1TZO A;  2LXA A;  3HVD A;  2IO0 B;  2KAN A;  2G3Q B;  2REX A;  4YMN A;  1PK3 A;  2K8C A;  2XNA C;  4CE6 A;  2RDH A;  2CU1 A;  4P0Q A;  5G5H A;  3B08 A;  2VA2 A;  4LTU A;  4DS4 A;  2G07 A;  3UXO A;  4KX3 A;  2KT7 A;  3ZDE A;  3H0M B;  2KWU B;  3EFU A;  3KBB A;  3BYT B;  3I76 A;  2CHX A;  2C2D A;  4KDL B;  1RYS A;  4F8C B;  1NI2 A;  3GV7 B;  3UXN A;  1KH0 A;  3RB0 A;  4IWQ A;  3V7J A;  2BCQ A;  2C22 A;  2BQU A;  1L6N A;  1C77 A;  2Q0Z X;  2GBR A;  2KHQ A;  4NJC A;  2LAS A;  1WR1 A;  2EAN A;  1EXN A;  5DPR A;  3VUY A;  4KLO A;  1LVH A;  5KFA A;  4Q44 A;  3P4Q B;  2HBL A;  2F8K A;  3RBD A;  4CYE A;  3VR8 B;  4K3B A;  4FN2 A;  2EZZ A;  1NK4 A;  1GO3 F;  4KLL A;  3GE8 C;  1RQN A;  4BUG A;  1HJP A;  4RNM A;  1D5X C;  2ONQ A;  3DBR I;  3WK4 A;  4AQ7 A;  5L9X A;  2L32 A;  4HEA 1;  1JWA D;  3RJJ A;  3MTN B;  5AKL A;  3ISD A;  3AU6 A;  5MPO A;  3TAD C;  2JR5 A;  4QAY A;  3ZDT A;  3KHG A;  1YX5 B;  4BFR A;  3G6X A;  8ICO A;  3RAQ A;  2R8G A;  1YJJ A;  1SJE D;  2PE6 B;  1T3Q A;  3U26 A;  4DFK A;  3EYZ A;  3GZF A;  4Y2T A;  3AH7 A;  3CIR B;  3H7P A;  2HDO A;  2QAR A;  2J6S A;  5IAA C;  1FEH A;  4NLC A;  4P4P A;  1T3N A;  1DYQ A;  1QKZ A;  1OGW A;  2Y5C A;  3ZXV A;  5HR6 A;  8ICI A;  2NCN A;  1VJ5 A;  2HHS A;  2M0A A;  4MGZ E;  3B9J A;  3HHM A;  1T94 A;  3GDX A;  4XWW A;  1J7C A;  5DCN A;  5KFX A;  1X1M A;  2D10 A;  2XY5 A;  2HHT A;  2ACZ B;  3R2T A;  3EW9 A;  1L8O A;  4PL2 A;  3NUQ A;  2YEP F;  1G6J A;  1N62 A;  3RH5 A;  4I2I A;  3IG8 A;  5HHH A;  4NNJ B;  9ICT A;  2ON8 A;  3U7D A;  2MEK A;  4J3O D;  5J0P A;  4QZB A;  5D3I B;  1DOQ A;  1O03 A;  5IIN A;  5KG0 A;  3GZN B;  2ZEQ A;  1TKY A;  2G4D B;  4O3N A;  3A1Q B;  3RB6 A;  4ACF A;  1ROE A;  2P6U A;  3VXW A;  2GLE A;  1D8B A;  2MBQ A;  3QZ8 A;  5ALY A;  2JEJ A;  2HSZ A;  3I5J C;  4AP9 A;  7ICV A;  1DK2 A;  1RYU A;  4RF0 A;  2GO7 A;  2AYO B;  3ZW3 A;  3BJY A;  1NK8 A;  2L5Y A;  2LHE A;  3C28 A;  4HK2 A;  3GIL A;  3DVN U;  3AI5 A;  1JXL A;  3L10 B;  4R66 A;  3AL0 B;  4M47 A;  2MBB B;  4GN1 A;  2MH7 A;  2OEH A;  4YL8 A;  1WGD A;  4RQM A;  2PW9 A;  5KFL A;  4TQ1 A;  4B9V A;  1TV9 A;  4KLJ A;  3P42 A;  4KTQ A;  3EHV A;  1B4F A;  1B0X A;  3MC8 A;  5AKY A;  4JE3 B;  3TIX A;  3PW7 A;  2EDU A;  3AU4 A;  1OFF A;  3KVF B;  1HEZ E;  4Q43 A;  4K7W A;  1YD8 U;  4JV1 A;  4HVB A;  1K1Q A;  3MP9 A;  4O3R A;  2IO1 B;  1BXT A;  3ZUN A;  4QZ9 A;  2ZW1 A;  4PS3 A;  3WAO A;  2ZIX A;  4Y2U A;  4C8M A;  9ICK A;  2HVH A;  2OJW A;  4F5N A;  4BXO B;  4PZO A;  2JQR B;  2Y5B B;  3BVM A;  4NAW B;  3PML A;  5AKG A;  1QCK A;  1JCK B;  4FHK A;  2BQ3 A;  4HRS A;  2E1F A; 
#chains in the Genus database with same CATH homology
 3SR6 A;  3HRD D;  3LB8 C;  2N7J A;  1I4P A;  1QT9 A;  1XLP A;  3AMZ A;  2PTL A;  2V3N A;  1C76 A;  2XN9 C;  1KLU D;  4RGT A;  4ARC A;  3URY A;  1ZXH A;  1FMA D;  4WQM A;  4XE0 A;  2BB5 A;  4A9A A;  1QF6 A;  1L6U A;  1QIL A;  3LYY A;  5AUK A;  3I57 A;  2BS2 B;  4R3D A;  1F77 A;  2WDQ B;  2BB6 A;  3U4E G;  2NMQ A;  1WGK A;  1TS2 A;  1DOI A;  4B0E A;  1K50 A;  3AEE B;  2IJ0 A;  2ZW0 A;  1SBB B;  2QEJ C;  4P6V F;  4IOI E;  4YSZ B;  1GAQ B;  5EE9 A;  5HI1 A;  2JWU A;  3NVW A;  1KFY B;  3EGR A;  4GDL B;  3P63 A;  1TYG B;  4OZA A;  2JZP A;  1AN8 A;  2PMV A;  3ZJU A;  1SJH D;  1CZP A;  4L2Y A;  1RYJ A;  1QOB A;  1RWS A;  3TEZ A;  1JQ4 A;  2WXN A;  2WXL A;  2WXG A;  4IKG A;  3AV8 A;  1N5W A;  2KMM A;  2IGH A;  4RF1 A;  1YNT E;  2BYT A;  4HKQ A;  1JAL A;  1D5M C;  1QQR A;  1DGJ A;  2DYO A;  3N9Y C;  2WXH A;  2Q5W D;  3KQ4 A;  2N9L A;  1B1Z A;  3I9V 1;  1HXY D;  2MJ3 A;  1PUT A;  3PZ8 A;  1C9F A;  2K9X A;  3AEC B;  3HVZ A;  1WWT A;  4C80 A;  3DWG C;  1N60 A;  3GB1 A;  2HTM E;  1GOZ A;  1MHX A;  1ZUD 2;  4KGS A;  3KWV A;  3NVY A;  4GDK B;  4ZOH C;  2WP9 B;  5FK9 C;  1ENF A;  4B0M A;  3AE5 B;  2Z8L A;  1L0V B;  2PKO A;  5BYQ A;  4ZYS A;  1SSN A;  1L4D B;  1L5P A;  4L1B A;  2E3T A;  3UI3 A;  4RGN A;  1ZE3 D;  2W3R A;  2IGG A;  3HUI A;  2J52 A;  5FR3 A;  2WU5 B;  4A6Q A;  1YMH E;  4DQO C;  1OQQ A;  3T3N A;  3R8B A;  3W2D A;  3AN1 A;  4YT0 B;  1ZDV A;  1TS5 A;  4LLG M;  1GB4 A;  1VZ7 A;  1MI0 A;  2LGI A;  4MAC A;  1ZOY B;  3V3X A;  2QIE B;  4KX6 B;  2LHD A;  5LNK 1;  4OVZ A;  2KAC A;  3W9C B;  5HFY A;  1EU4 A;  3MHZ A;  1YN4 A;  2WXM A;  2R61 A;  1SIJ A;  2JYE A;  3W5V B;  1PGB A;  2FBW B;  3FAH A;  1C4C A;  2MJE A;  1IBX A;  2DYM A;  3AEF B;  4NAM A;  3TUO A;  1TKG A;  3C8Y A;  1D4B A;  3ZGZ A;  2JYT A;  2GI9 A;  4A90 A;  1VJK A;  3NVZ A;  4RGM A;  3LXF A;  1C79 A;  1QOA A;  1AYF A;  3ZQ4 A;  2J53 A;  1NEN B;  4A8X C;  2YEP B;  2W54 A;  2RMM A;  1K52 A;  1ZPS A;  4YTN B;  3V05 A;  2HDE A;  2WQY B;  4RNA A;  1TKE A;  1TS3 A;  1Y56 A;  3FC4 A;  5H92 C;  1TS4 A;  3BWU D;  3MFG A;  2WXI A;  2SAK A;  1IUE A;  3U2S C;  3EUB 2;  1I7H A;  2OHF A;  5D7G A;  3NRZ A;  4RFB A;  3DWM A;  1T6B X;  3VRA B;  1P7F A;  5FKA C;  2N0S B;  5C3J B;  3BVG A;  1EWY C;  1I4G A;  1KRH A;  1Q10 A;  5EE3 A;  1SF0 A;  2QSD A;  1P7E A;  3AEB B;  2BT6 A;  1E0Z A;  1SE4 A;  1LO5 D;  1D5Z C;  3FIL A;  3WCQ A;  1JWU D;  4USA A;  3NZ3 A;  3AE4 B;  1B9R A;  1RFK A;  2D5G A;  1K53 A;  5HHD G;  1GPX A;  3Q8C A;  1L4Z B;  4RH6 A;  2WDV B;  4DXF A;  4N6E B;  1JWM D;  3BYY B;  2IPK D;  5H8Y E;  2X38 A;  5AUI A;  4YSX B;  2BS4 B;  1FD6 A;  1XCT L;  4C7Y A;  1ET6 A;  2E6X A;  4OZB A;  3TSS A;  2GB1 A;  4ARI A;  4N58 A;  1WYG A;  2K5P A;  3AE6 B;  3AE8 B;  1XO3 A;  2M19 A;  4P16 A;  4PT5 A;  1XXG A;  2EKI A;  1M4V A;  1SEB D;  1XLN A;  1C4A A;  2PVG C;  3KLS X;  5BMI A;  1OQR A;  1NI3 A;  3ZYY X;  1FCL A;  4JWS C;  1FFV A;  2Y5P A;  4YXD B;  5HG2 A;  1HQR D;  1V1O A;  4RCO A;  3Q8A A;  4XDC A;  4REZ A;  1DOX A;  1TJE A;  1ACC A;  2WS3 B;  3AEA B;  4LK0 M;  2K3U A;  1TY2 A;  2L1A A;  2FE8 A;  1I4H A;  5G5G A;  1YJI A;  1FCC C;  1WSP A;  3B2F A;  1JRP A;  1IGC A;  4N59 A;  4WAF A;  1FNU A;  1BUI C;  5BYR A;  2QMT A;  2V0G A;  3ZJT A;  1HZ6 A;  1V97 A;  1V1P A;  2B76 B;  4KGT A;  3J9C A;  3NVV A;  1MVK A;  4US8 A;  1MPE A;  2CJO A;  1SXT A;  1PGX A;  2H88 B;  3TEY A;  2N9K A;  2EEL A;  3BVZ A;  4C56 C;  4YSY B;  3AB5 A;  4ITK A;  3TEW A;  3IT6 B;  1SB3 C;  4ZRP A;  1IGD A;  3SFD B;  3BK1 A;  2H89 B;  3VQI A;  1RM6 C;  1YQ4 B;  4YTP B;  3W5U B;  1I4X A;  3OWE B;  3NS1 A;  2L52 A;  1A70 A;  1ESF A;  4WWM A;  2VZK B;  2NTT A;  5TSS A;  3P1M A;  1AWD A;  3Q8B A;  1FRR A;  1VR9 A;  2QIL A;  1VLB A;  4H2A A;  1BML C;  2WXO A;  2KDM A;  1IBX B;  2K22 A;  3NUH B;  2KN4 A;  4US9 A;  1I4Q A;  3SFE B;  1WXQ A;  1ZP0 B;  2W3S A;  2CJN A;  3IT4 B;  3RPF C;  5JXV A;  1F2R C;  1FNV A;  1YN5 A;  2KAJ A;  1PDX A;  1KLG D;  1ET9 A;  1C78 A;  2BTE A;  4OHJ A;  3P4P B;  1XCQ L;  3VR9 B;  1N63 A;  3IAM 1;  1E6E B;  2LMC A;  1EU3 A;  3AE9 B;  2L83 A;  2AQ3 B;  4JWU C;  2I2Y A;  4CQN A;  2PIA A;  1XEE A;  1FFU A;  3GP7 A;  3L4P A;  3IXS A;  4ZHP A;  4WH4 A;  4FXC A;  3ZJV A;  4HKZ E;  4DXG A;  2WXK A;  1FNW A;  1KTK A;  2KQ4 X;  2IDY A;  2LUM A;  2VZK D;  1VDV A;  3AM9 A;  1UGJ A;  3Q8E A;  1JRO A;  2WU2 B;  1WRI A;  4YWG G;  2BBC A;  2INN E;  1XLQ A;  3H8H A;  2JU6 X;  3FIL B;  4EE2 A;  4TMA B;  2IGD A;  1GB1 A;  2LEK A;  2WXP A;  1NEK B;  3GS2 A;  1KF6 B;  1TZO A;  1SE2 A;  3HVD A;  1L0Y B;  3ABV B;  1PGA A;  3AE7 B;  2XNA C;  2PLP A;  2RDH A;  4A55 A;  5G5H A;  3ETR A;  4LTU A;  4M0W A;  2WXR A;  1ZXI A;  3PZ7 A;  1QOG A;  2J4X A;  1HZ5 A;  3BYT B;  2J42 A;  2WNM A;  2RPV A;  3VRB B;  1SE3 A;  4L23 A;  1JWS D;  2AQ1 B;  1QLB B;  4WUR A;  2K0P A;  3U7Z A;  1KH0 A;  1C4P A;  1JW9 D;  1UWX A;  1C77 A;  2OED A;  3EA6 A;  3O13 A;  4JX1 C;  3MC0 B;  2JX5 A;  4KKI A;  4NJC A;  1UNS A;  1E9M A;  3AE3 B;  4AS1 A;  3KWL A;  2BW2 A;  1V8C A;  2WDR B;  2I38 A;  4RGO S;  2M56 B;  1FXA A;  3P4Q B;  4XWT A;  1ZDX A;  4O1N A;  2DWQ A;  1XLO A;  1L6V A;  2V3P A;  3VR8 B;  3TEX A;  1CJE A;  1F2R I;  1D5X C;  4MH8 A;  2ONQ A;  3MJ5 A;  1EM7 A;  4AQ7 A;  2L32 A;  4KGR A;  4HEA 1;  1JWA D;  3AE1 B;  3BZD B;  5MPO A;  3IAS 1;  3T3O A;  3Q69 A;  3P4S B;  3Q8F A;  2CU3 A;  4OW0 A;  3BK2 A;  1YJJ A;  4HRO A;  1PYW D;  1SJE D;  1NVI D;  1T3Q A;  1PFD A;  2FUG 1;  2DBY A;  3AH7 A;  3CIR B;  1CK1 A;  2JSV X;  1FEH A;  1QKZ A;  2TSS A;  2Y5C A;  1DYQ A;  3SEB A;  4YTM B;  1K51 A;  2V4I B;  4NZL B;  4Q2J A;  1HA5 A;  1YN3 A;  1L0X B;  1STE A;  2M0A A;  2WXJ A;  3B9J A;  1E10 A;  1V1P B;  2PVO D;  5C2T B;  4OZC A;  1I4R A;  4XWW A;  1J7C A;  3RFZ B;  4UDU C;  2W55 A;  3E9S A;  1E7P B;  1FIQ A;  4C7Z A;  2ACZ B;  3R2T A;  1R7S A;  2LJI A;  3P4R B;  2DLB A;  2YEP F;  1N62 A;  1FXI A;  2ICI A;  1NYR A;  1AW7 A;  2ON8 A;  1QOF A;  3AEG B;  2MEK A;  4J3O D;  1N61 A;  1UUP A;  5D3I B;  1FM0 D;  2GRI A;  2JXT A;  5E6J A;  5EE1 A;  1TKY A;  5BYS A;  3AE2 B;  1ROE A;  1J7B A;  1EWC A;  5I4D A;  2G9H D;  3AED B;  3CWI A;  1J7A A;  1N5X A;  5D3D A;  1T5X D;  2WLB A;  2QJL A;  3B2G A;  4RF0 A;  1VZ6 A;  4KKJ A;  2LHE A;  4MM3 B;  4IDI A;  2WXQ A;  1UWM A;  5GXG B;  2AQ2 B;  5EE0 A;  5BMH A;  2MH7 A;  1CQV A;  5BMG A;  1JWB D;  2PW9 A;  4TQ1 A;  4XDD A;  4TSS A;  4ZRQ A;  2LFI A;  2BS3 B;  3P42 A;  2INP E;  2W82 A;  5T8I A;  2RDG A;  4TQ0 A;  4JE3 B;  2WXF A;  1F0Z A;  4MT5 A;  2KWD A;  2SEB D;  3PO0 A;  1OFF A;  1JML A;  1HEZ E;  4HJG E;  4JPS A;  1D6E C;  2AX5 A;  1NYQ A;  2G1E A;  3MP9 A;  1FRD A;  4GLS C;  3U52 E;  1TY0 A;  1BXT A;  2NTS A;  1VZ8 A;  2Y3A A;  3R2I A;  3W1S A;  1MHH E;  2ZW1 A;  1VRA B;  4WIP A;  4ZHO A;  1DOY A;  2MJD A;  1YQ3 B;  2JQR B;  3BVM A;  4NAW B;  3E56 A;  1JCK B;  1XF5 L;  4D2K A;  1FO4 A;  3BII D;  4HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...