1N63A

Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
160
structure length
160
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
total genus 48
structure length 160
sequence length 160
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n63A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n63A01
1WGKA 3AE9B 1I7HA 2MJ3A 3FC4A 3NVYA 3SR6A 3CWIA 3HUIA 1JQ4A 2BS4B 2W54A 1SB3C 1KF6B 2H89B 3DWGC 2Q5WD 1RWSA 2LEKA 1L6UA 1T3QA 1A70A 2QIEB 3AEEB 1RM6C 1ZUD2 2ACZB 1GAQB 1V97A 1QLBB 2L83A 1E6EB 2PVOD 3FAHA 2WLBA 1XLNA 3AEBB 1QOGA 4WWMA 3SFDB 4ZHOA 3P4PB 1DOXA 1FXAA 4C80A 1WWTA 2BS3B 1FXIA 1SIJA 1OQQA 1ZP0B 2WDQB 3NVWA 4YTNB 2W3RA 3AEGB 3AN1A 1RFKA 1TKYA 2DBYA 3WCQA 1NEKB 3AM9A 1J7CA 1XLQA 3P63A 5EE9A 2WDRB 1AYFA 2HTME 2WS3B 3AE1B 1F0ZA 3P4QB 1L6VA 1QOFA 2G1EA 1V8CA 2MJDA 4JWSC 1JROA 3AB5A 2B76B 5EE3A 5MPOA 2E3TA 1NENB 5C2TB 1VDVA 1PDXA 4YSYB 2WU5B 3AV8A 1YQ4B 4HRSA 3VR9B 1FRDA 1FO4A 2AX5A 4P6VF 3AE3B 1FM0D 1ROEA 3P1MA 4N6EB 2WDVB 3AH7A 3PO0A 4YTPB 1NVID 5C3JB 2W55A 5G5GA 4ITKA 4JX1C 1N62A 2BT6A 1AWDA 1QOAA 3EUB2 2K5PA 2MJEA 3AE6B 1N63A 1JW9D 3AEDB 5H8YE 1ZOYB 2K22A 5EE0A 2WU2B 3LXFA 2H88B 3LB8C 1N5XA 4YSZB 2PVGC 2DWQA 3HVZA 3AEAB 3AEFB 1E10A 2L52A 3SFEB 1YJJA 1IUEA 3CIRB 1YQ3B 5H92C 3P4RB 1TJEA 1JWAD 3AE8B 1NYQA 4US9A 1NYRA 3L4PA 1FRRA 2CJNA 4KX6B 1NI3A 1UWMA 4N59A 1E7PB 4N58A 3RPFC 1E0ZA 3NVVA 2FBWB 2PIAA 2WQYB 4YXDB 1TKEA 3HRDD 4C7ZA 2JQRB 3DWMA 4WQMA 3W9CB 2MH7A 3AE4B 1FIQA 1J7AA 1VJKA 2CJOA 3NS1A 2W3SA 1KRHA 3AMZA 1CJEA 3AE2B 1JWBD 1VLBA 2KMMA 3B9JA 1WRIA 2WP9B 3ABVB 3W5UB 4YSXB 2CU3A 1GPXA 1PUTA 4A9AA 3BIID 1R7SA 1N5WA 4FXCA 3NRZA 1QF6A 4US8A 4USAA 1TYGB 2M19A 2M56B 1SF0A 2PKOA 1XLOA 1XLPA 2OHFA 2QJLA 3VRBB 3KWLA 3ETRA 2K9XA 1J7BA 5GXGB 1PFDA 1DOIA 1CZPA 1DGJA 1FFUA 3B2GA 1JRPA 1FMAD 1OFFA 1L5PA 4LTUA 2JX5A 2KAJA 5AUIA 4JWUC 4HROA 3AECB 1N61A 1E9MA 1KFYB 1ZXIA 1XO3A 2N0SB 3AE5B 4C7YA 4IDIA 1N60A 1JALA 5EE1A 3B2FA 3VRAB 1QT9A 3VR8B 4ZOHC 1YJIA 1TKGA 3ZYYX 2BS2B 1WXQA 1EWYC 1QOBA 3AE7B 2EKIA 1RYJA 3W5VB 1OQRA 4YTMB 1DOYA 3P4SB 4ZHPA 1L0VB 1B9RA 5G5HA 1WYGA 5AUKA 4YT0B 2Y5CA 3NVZA 1FFVA
chains in the Genus database with same CATH superfamily
3AU5A 1I35A 2XGPA 1JQ4A 1FNUA 2DKZA 3DEEA 2YEPB 3F2CA 2Q5WD 3QAQA 1SGHA 2L0TA 4JL9A 4RNOA 3HK0A 4M0AA 2BW2A 4DQOC 4OJLA 3CYMA 4EBCA 9ICJA 4DXAB 1XLNA 5J2DA 2P66A 2JXXA 4WWMA 4C80A 3TIXA 4RGMA 4PHEA 1FPYA 3ZJUA 5JUMA 2LZ6A 1ZQKA 3QE9Y 1JMLA 4F50A 4HXDA 2CKHB 2A1JB 2W9NA 4IRDA 2W7OA 1ZQAA 3GZNI 2WF7A 4HK2A 2HHWA 4LNFA 3GZFA 5AM0A 3QARA 4A3OA 4P6VF 4S17A 3DQVA 1KQQA 3RFZB 3THVA 2DZKA 5DQGA 4IC9A 5ALXA 4NL9A 3UM9A 1BPXA 2BHNA 4FS1A 3PSFA 4EZJA 2WF8A 1Z00A 2RGFA 3TADC 4O3OA 5DGAA 2G9HD 4RQ2A 4OVUA 2KZRA 2PVGC 5J2FA 1NNLA 2JXTA 4QZBA 1GB1A 4IM2A 3P42A 5J17A 1WZ0A 2RMMA 2ZVOA 3IN5A 5CTRC 4P1BC 2DKXA 3V05A 9ICKA 3T5LA 3A33B 1F0MA 1RDFA 5AM4A 1AROP 1NI3A 3KFUF 1UWMA 3MC0B 2HD5B 2FJ6A 1V1PB 2JQRB 3IHQB 4HJGE 1WSPA 1QQ6A 3A0BU 3D6JA 3NS1A 5EWGA 5HMLA 2CS4A 3I57A 2FLNA 1JWMD 3I3TB 2RDIA 2KMMA 1LGRA 2BGFA 2LPEA 2LJ5A 1QTMA 2Y0SF 2VRRB 1JUDA 4JWMA 4IS7A 1T3NA 1T0YA 3ZKJC 2YEPF 3DBHB 2LVQA 3HM6X 4MEXA 1XLPA 1YNTE 5IA7A 1URJA 4A6QA 2KKPA 3R2IA 3OJSA 2QARA 2MA1A 3A0HU 4JLCA 2FLPA 3OPXA 3B2GA 1JRPA 2N1RA 4CDGA 1L5PA 1PQSA 2L0FA 1C1YB 4KLOA 2L76A 2O6VD 2DENB 4MH0E 4QJFB 2KVZA 4RNMA 4YR3A 3APDA 2FE9A 1KFDA 3U52E 2G5HB 3PW4A 5AZHA 1TKGA 1YZ7A 4LJOB 5ALGA 2KYWA 2KC2A 1S9FA 9ICUA 3QU7A 4O3NA 4F2RA 2D3BA 3N1XC 4MEYA 4YVZA 3RUIB 3AI5A 2K6DB 1JX4A 5L83A 2Y1IA 3DBSA 1EM7A 3H8JA 2LYAA 5L1KA 4KIKA 4CHKA 1HXYD 1ECWA 3T3OA 4AP9A 4JE3B 1L6UA 5DG8A 1E8WA 9ICNA 1QQRA 3AQFA 1V85A 5KFEA 2QEJC 3GIKA 1DOXA 2V9WA 2VA2A 3RJGA 3QX1A 5JHBA 3ZDTA 1K5OA 2XY7A 1WXVA 2A4ZA 4DHZE 3U8ZA 3V72A 1TS5A 3PREA 4Y2QA 4LZDA 3JSVB 1U9LA 3PR5B 3H9DA 2MP2B 5ALZA 5AHXA 2KWVB 2CHXA 2MHJA 2Z0EB 1RQNA 4DCCA 2Y1JA 2G3QB 2JPHA 2VKQA 1KJTA 5E6PA 2CHWA 3N7SC 2BZFA 4HRSA 4PPXA 2KVRA 9ICAA 2MRPA 3Q3OC 1E90A 3T5HA 3OJUA 1SE3A 2IMWP 8ICZA 3PO0A 4LDTB 5TR5A 3T3FA 2DZJA 4ITKA 1ZQRA 3A1QA 2WYQA 4LK0M 1E7VA 2BT6A 2ZNVB 1ZQCA 2V3PA 2PI5A 2ICIA 4PHAA 2IO0B 5KHOA 2XN9C 4UQGA 3N9YC 2O2VB 4C56C 2ALZA 2J0KA 1YJJA 3CIRB 4M04A 1NK6A 3Q8QB 4F92B 1RQLA 2INPE 2R8IA 2W9MA 5J0PA 2HHVA 2FCQA 2I38A 2ZCBA 4EZ6A 3LWMA 3RPFC 4DHJB 4OO1J 1WF9A 2PIAA 1SV0C 3JPOA 3QU4A 9ICMA 4DBGA 2ZUDA 2UYZB 1NKCA 4RM9A 1YZ6A 4IRCA 3WK5A 3V3XA 3BYTB 1VLBA 3B9JA 1ZRNA 3RH5A 3BYYB 4TQRA 3EFUA 4DSLA 8ICJA 3V61A 3NRZA 4EELA 3WALA 1NJZA 2K6QA 4XC2A 2YMQA 1Q3UA 1B22A 1VCBA 2JU6X 1RLFA 2PI4A 2WXOA 4GSWA 3RJEA 1YN5A 1J7BA 2AYOB 3R3MA 4F8CB 4YR0A 4ED3A 4FZLA 5L1MA 2WHIA 2WXKA 1C77A 5IN7A 1JCKB 2RSUA 4M2YA 4NJ6A 4ZRJA 2CPRA 2KANA 2E8OA 1TAUA 5KT4A 4YXJA 4FJZA 1UNSA 3AECB 3JW0X 1MG4A 1KFYB 4K3BA 1V5TA 3KLSX 1JALA 5IIJA 1M4VA 2P6RA 4ED0A 1QT9A 2D2QA 1PVQA 5KT2A 3I76A 3RJHA 2OJWA 4CCHA 9ICQA 5KFRA 1XO0A 2N1WA 5K4LA 1WYGA 2I9GA 4WJNA 1ZDVA 1IBXA 2KD1A 2LI6A 2Y5CA 1EUVB 1TY0A 2WXJA 1YIWA 3SV4A 3ZUNA 1TS4A 2C2DA 3KKAC 3SR6A 3HUIA 4J9LA 3KHGA 1F52A 3OGUA 4KN4A 5CB1A 4KLFA 1RYUA 3S6JA 2LEKA 2LYBA 4QWAA 4IM3A 2ACZB 2HMXA 1QLBB 2NRWA 1TBEA 3SFDB 2KHWB 1KSPA 1ZQSA 3ML8A 3Q14C 3O0FA 4BBNF 2BDUA 8ICXA 4Q45A 2WDQB 3RB3A 1N6ZA 4KZCA 2XCPA 2KQ4X 2HI0A 3BZCA 4WIPA 5KFHA 1BXTA 4YXMA 1NKBA 1UWXA 4B9UA 4NLGA 4DHZB 3AE1B 5A0LA 4RQMA 3ZD9A 2IDYA 4NAWB 5FK9C 2PMZF 1VDVA 1WH3A 4ANUA 1PDXA 2IA6A 4YSYB 4BOZB 2KQ7A 3OTQA 3QA8A 2LHTA 1ROEA 4YG2A 1YX5B 2MA9B 4MACA 5HI1A 4CGZA 3MJ5A 5EDSA 4IWOA 1P7FA 3ZDBA 1Q46A 3UMCA 8ICCA 1QOAA 1KOTA 5AIAA 1TVAA 4LCDE 2KE7A 3H4BA 2WNMA 4NLNA 5DPRA 2EZZA 2WB1C 3CSTA 2DL0A 4BJQA 3SEBA 2GMIC 3KH0A 1IUEA 4FA6A 3P4RB 4NJ8A 7ICVA 2C9WB 4XX5A 2ZIXB 5IO9A 4M9HA 3DDHA 2J6UA 5JHAA 2B6GA 4EYIB 3MDCA 1N48A 1P98A 4DL4A 4O0IA 1BPYA 4IUMB 4RGTA 4C0ZA 4XZ4A 2ZUCA 4DOAA 1K51A 1ENFA 1ZPSA 4MSMB 2YN4A 4FZMA 5BYSA 2C22A 1F1HA 4S0RA 3HILA 2ONQA 3PW7A 2W7PA 4KDLB 1KH0A 3BIID 2KN4A 1JWUD 2IY0B 4MJSA 3W2DA 4UAUA 2IGGA 3ICXA 3MR2A 2PKOA 1XWLA 3I63C 3JPTA 3KUCB 4KKIA 3V7LA 8ICAA 4X5VA 4KITB 3M7DA 4Y2TA 2O6KA 4JIOU 1CZPA 4OCZA 2EAOA 2D11A 3KHHA 1AW7A 3ED5A 4KTQA 3SAFA 4AWJA 2KX3A 5ALTA 1N56A 4UAWA 2KAJA 2KJ9A 4A3PA 1WFYA 3PZPA 3HVDA 5GTIU 2ASQA 4Q43A 1S5LU 1Y8RC 1TZ1A 1ZXIA 8ICKA 3RB4A 3T5JA 1N60A 2WF6A 4Y2PA 3VRAB 2X38A 3VR8B 3N4MB 3AL0B 3ECIA 3UGBB 4GFJA 1ZQYA 2M0XA 3RNCC 1MN8A 4YTMB 1GUAB 2GI9A 1IPGA 3TADA 3P4SB 2G5IB 2KN5A 3PMLA 2X8XX 2WXLA 3QJZA 3UI3A 1R4NB 1X42A 1YN3A 1TT5B 3AE9B 4K4HA 3KYCD 3E56A 3D2SA 2G4SA 1SB3C 5F3XB 2A1AA 2P35A 2QIEB 5KFCA 1A70A 1L4ZB 1V2YA 1WGDA 1C4PA 3SAHA 2MSED 2WXGA 4IWQA 1V38A 4MGZE 5J2HA 4UBCA 1MQ2A 1SXDA 3NASA 1XSPA 1QOGA 3KBBA 4JV2A 2ZUBA 3H7IA 3DCGA 4KLQA 2KOBA 4DOBA 1L5UA 3GILA 3NVWA 5KFDA 2BB5A 2INDC 3L17A 4R64A 1J7CA 4PS3A 5DB7A 2LRWA 7ICGA 2GO7A 4DS5A 2KFKB 3C19A 4G11A 1X6JA 4BX9C 3MR6A 4FN2A 1S0VA 3M1YA 2KSOA 4ECZA 1QOFA 2I1QA 2GBKA 2IOFA 3IV6A 3AB5A 5DPWA 4YMMA 3RMKC 1X9WA 3MABA 2BCRA 2AX5A 5DKWA 3ISBA 1BGXT 2UU7A 3EFCA 4RPYA 2WDVB 1WJ4A 1F2RI 4ZRPA 5HFYA 4Q8EA 2M4NA 4EZKA 3SFEB 3NZUA 4PL1A 4O5KA 4ASWC 5EE0A 5DBCA 2D6FC 2RDGA 4Y2SA 1TE2A 2RHFA 4QZCA 5L95C 3OLMD 4AP4C 4AUQC 3UQAA 1YN4A 4HKQA 3RFAA 3UPQA 2IOFK 2F8LA 3C5FA 4IG7B 1A6SA 3BJYA 2QB0B 4Z6DA 1WX8A 2WFAA 2JHDA 4RGOS 1NYRA 3MFGA 4KMOB 3B0XA 3L3FX 4PYZA 3TL5A 2GBNA 3NZSA 4YXDB 3EECA 4LJPB 5E6JA 4EKUA 3C8YA 3IBEA 1WE6A 4FBJB 4O3QA 2JEGA 2DPJA 1KRHA 1AQ6A 2AQ3B 5BMGA 3AMZA 2KACA 4NLKA 2M17A 2LGXA 2OM6A 7ICEA 2ZEQA 2JXJA 1U47A 5BYQA 5IIMA 3ETLA 4PGQA 3MFHA 3GE8C 1SL0A 5IOIA 5D6JB 2G06A 3Q8RB 4LLGM 3BS5A 1QSYA 1I4RA 1ZGUB 2O6VA 2JYEA 3BQ7A 1UHUA 4EUTA 4LTUA 4O5EA 3ZJVA 4BWJA 3FDSA 1X40A 2AQ1B 3IAS1 1MC8A 1V5OA 4QZEA 4JWUC 3QHTA 1FEZA 5AKHA 4HROA 4GXJA 1PUZA 3HPOA 4ED7A 5JZEB 4ED1A 1ZD3A 3RR7A 4FJVB 4IDIA 4QZAA 1RXVA 2W8KA 5D46A 1K1SA 4R3DA 2WGSA 3TUOA 2Z8LA 1Z00B 3GFKB 5ALJA 2KTFA 1X6IA 2DFLA 3W5VB 1DOYA 5CHFA 3CSFA 2K39A 5GMVA 4P4OA 3C0RB 4QAYA 2MQJA 3NVZA 1XQQA 3PRZA 3CWIA 2NS5A 3NVYA 3ISDA 1SL2A 1ZW7A 3UQ0A 2VA3A 4ICAA 1SXEA 1KF6B 2H89B 2UWQA 3UINB 5C0YA 2R2OA 4ZDVA 1SV0A 2WLBA 7ICHA 2LVPA 4P4MA 5AI4A 1P1AA 3C2MA 4ICUA 4FS2A 2I6XA 3UF8A 2LUMA 5J0OA 2E6XA 5ALSA 3UIOB 5DDYA 4YCXA 3X0WA 1NKEA 1EF5A 2ZPNA 4I27A 1WXMA 2MU2A 1UA0A 2P6UA 2ZZPB 1F0ZA 2QARB 2G1EA 1ZKHA 5EE3A 3ML9A 2QCZA 2WXQA 2YVCA 5CWRA 1GB4A 1V9PA 2OJRA 4Y2RA 3ZLZA 3QUTA 2WF5A 2UVUA 4ECTA 4I6LB 2Y9UA 4MF8A 1NVID 2ZJDA 4WJOA 1XXGA 4FULA 1T94A 1SZPA 2FIFA 2L3ZA 1WM3A 7ICKA 3ZDDA 1FD6A 4EBDA 2D10A 3P2BA 3QC8B 5DPTA 3CRXA 1Z1VA 2XGQA 4OJ6A 5AKXA 3UXPA 5HHIA 4B9TA 4AQ7A 1MSWD 5T8IA 1HIWA 1ZQPA 1C76A 4J3OD 4TUPA 2LI5A 1TJEA 2KK0A 4NJ7A 3RZFA 4US9A 1S77D 2PE9A 4K7UA 4PJ0U 1F77A 2HHUA 2CJNA 1GC7A 3V7JA 4C8MA 2DF4B 1E7PB 5DLGA 3H8HA 4KIKB 4CF4A 4DF8A 2IGDA 2DZIA 1IGDA 4C7ZA 3KKAA 1HTQA 1T5XD 2K8CB 1UELA 4J9SA 2K89A 1X9XA 1J7AA 1VJKA 4QZGA 5JU5A 1S10A 1F44A 1WUDA 2W3SA 4DFMA 1ZQWA 1X9SA 1ZXHA 3AE2B 3GOEA 4TKNA 3MC8A 3U30A 5G55A 4CF3A 5CA7A 1VZ8A 4PHDA 3PHXB 3APCA 3BWUD 4AYBF 5KFSA 9ICCA 1SZHA 4I2EA 2L1AA 4XDDA 1UF0A 4A8XC 2QILA 1QKZA 2Y0SC 3RJKA 3GE3C 4RGNA 5E6OA 5C23A 2KO3A 3SD7A 4E71A 3KUDB 1LFDA 5BPCA 3ZDMC 1M94A 3Q8EA 2R18A 1K50A 8ICFA 4QIWF 1RYSA 2LXAA 4DQPA 3PW5A 4KLTA 4HPPA 3T3NA 3N28A 2JZ3B 5DQHA 4MM3A 2NMQA 3DVNV 3A1QB 1KL9A 2N9EB 4B0MA 3QZ8A 1DXSA 3IDWA 3LVVA 3HKZF 1KFSA 2W04A 1D5MC 1PVPA 2L5YA 4UB3A 1UD7A 5G5HA 3HWTA 1D8YA 4IQVA 3NRWA 2YY6A 3PT2B 3PZ7A 2BPGA 3RH4A 2ZPYA 8ICEA 4J9NA 4RQ6A 1UT8A 3N32A 1UGMA 1RM6C 4LJXA 1XSLA 1I4GA 3PGEA 1L2NA 2BYTA 1TAQA 5DPSA 3W1SC 4DF4A 3NUQA 3L16A 3MJWA 4KLDA 3QK0A 4KLJA 4ECSA 1WJUA 2JH1A 8ICRA 4L2YA 1C9FA 5IIIA 3KZIU 1MFWA 3A9KB 3JPSA 3ALBA 4M9JA 4H2AA 4F3OA 1PK3A 8ICOA 5ALMA 1J0GA 4UASA 5AI0A 2AHOB 3BDPA 4RT3A 1FXTB 1WJNA 1KLVA 5DLFA 3N1ZC 4LNKA 4BWMA 1MJDA 2CU1A 2K4EA 3D2NA 4IQUA 4QZ8A 1FCCC 4W9IA 3Q3NC 3QCAA 4JX1C 4RQ5A 4EYHB 4O3PA 1TAMA 3Q8KA 8ICMA 4QWCA 3G6XA 4HKZE 5IIKA 1R4NI 2BWFA 2K22A 2LM1A 2K8HA 3RBEA 2H88B 2BCQA 3RAXA 3WKEA 5KFWA 4OJPA 2A3VA 4CE6A 2ZTDA 1SJHD 3E58A 5HHHA 1XC9A 3M9MB 4ICVA 3Q8AA 3TEXA 1IBXB 2H3ZA 2FPMA 5DB8A 2K8BA 2QDFA 1FRRA 3IXSA 3VTVA 4E3CA 3IAM1 1L7PA 1STEA 4EEKA 1V49A 3NVVA 3OSPA 1Q10A 3EGRA 1QQ5A 1VD2A 2BQRA 2J52A 3DWMA 1RPLA 1D8LA 3LYSA 1B0XA 1S0NA 4GDKA 3FM9A 2WWZA 3T5KA 4IM0A 3E9SA 2NPTA 9ICRA 5H2FU 1SE9A 5FR3A 3MDAA 4PL2A 2D3GA 1SKWA 1L3VA 8ICHA 4WAFA 4PS7A 4J9PA 3TBLD 2L32A 4B95A 2OHFA 2QJLA 1ZQJA 4I2JA 1LV5A 5BO4B 4R63A 4BZAA 5ALKA 1OFFA 1PYWD 1HUOA 1ET6A 4GMVA 1T6BX 4MSQB 3KW5B 3BVMA 1RFAA 1HEKA 3I5JC 4C4RA 4DHJD 4UB2A 1I4PA 2KD0A 5JRTA 2NO4A 4F71A 5KFNA 2AQ4A 1E9MA 2JYTA 5J2CA 2KDEB 4NJCA 4MFAA 3RR8A 4UB1A 4XA5A 8ICYA 4TQ0A 2J53A 2LVOA 3Q8SB 1JN3A 4QWDA 2K60A 5I4DA 3SMVA 1EXNA 2ES6A 1NBFC 4R8UA 1ZQQA 2YMPA 5IP4D 3QWZB 3H0RB 2NRVA 3FC4A 4C8KA 5J0QA 3NGDA 1JXLA 2PMVA 3ZDAA 1RXWA 1NZPA 5L9XA 2Q0ZX 7ICLA 1RWSA 2GBRA 1F5SA 1TIFA 2RD0A 2D07B 1ZD4A 5KTQA 1J8CA 3ZIMA 2FDRA 4P0PA 3AEBB 4I2BA 5CX3A 1UBQA 1KLGD 4ECUA 3V7KA 4C8NA 2HDEA 4HCNB 2BYVE 1O08A 2PLPA 4ZYNA 1VRAB 2BBCA 5KHQA 3OSNA 3JPQA 1TK5A 2E1FA 3TKAA 3AN1A 4MJSB 1TKYA 1XT9B 2K0PA 5E6NA 4I2DA 3C23A 5KFQA 1D5XC 7ICMA 3P4QB 2B76B 2K4HA 4NQLB 1WM2A 2C60A 5LLIA 5EWFA 2AJQA 4B0EA 4R65A 9ICHA 9ICBA 5KAFU 2KFJA 1C3TA 9ICIA 1LXDA 3SV3A 1UBIA 2AQ2B 1Q5WB 1ZOYB 4I28A 5F9NA 4O1NA 3VCBA 2FMQA 3HP6A 2IO1B 2ZIUA 3C21A 2LKYA 5ALYA 2KDBA 2LWPA 2Z7JA 3ISCA 3AEAB 3QU5A 4OD0A 3Q8BA 2GOWA 3MGVA 1UT5A 3GV8B 5KG5A 4UW9A 2ODGA 3GIIA 3OWEB 1KFTA 3LDAA 2KZMA 2JEFA 5KFMA 1MI0A 2C7HA 3C1ZA 1D5ZC 1IM4A 4J03A 1HQRD 2GH1A 4WQMA 1K53A 4PHPA 1OUQA 2L05A 2G45B 2ZJAA 2WXPA 1C20A 1BPBA 1JWBD 2RDJA 2ZVNA 1CRXA 5CHVC 1N5WA 4MELA 3MR5A 2J0JA 5KFZA 5ALPA 1SL1A 1UQVA 3PSIA 1U45A 1CK1A 2M0NA 4UB6U 4JV0A 2KSOB 4FBTA 1WGHA 5AK4A 2ZTCA 1NK8A 3TEZA 4ECRA 4JGHB 2XICA 3QEBZ 4ELVA 4K7SA 3C1YA 3PV1A 4RUCA 4OZCA 5D3IB 4UDUC 1F9JA 2REXA 1ZQVA 4YMNA 5J2AA 4P1CC 2JGAA 2ZIVA 3M9OB 2KWUB 1NJWA 2HBJA 1WI0A 2QB1A 2NTTA 4B9LA 1Q1OA 2FE8A 2KJ8A 1PGAA 5HHDG 2DNFA 3RT3B 4QW8A 2HOQA 4W9EA 2A19A 1COKA 4QZIA 5HP4A 1ISNA 2Z59B 3ENEA 1DOQA 4WWPA 4GGQA 5DGBA 1BPZA 1T3QA 1U4BA 1TKDA 2HE7A 1V97A 2N7JA 5CRXA 1KEJA 3P4PB 4GDLA 2BS3B 1TFRA 4JMUA 4K4GA 4IL6U 1Z5SB 3H40A 5ALRA 2JEJA 7ICPA 2DUYA 1J97A 1ZP0B 5DB6A 2NCNA 2JWZA 3VDZA 4FADA 2ZCCA 3RD2A 1UUPA 5KFAA 2LRUA 2ZG6A 1E7UA 5DG7A 3P63A 4KLSA 4ANVA 1BMLC 3EZ5A 2N9XA 2RPQA 4X57B 3EPIA 1I4XA 1L6VA 2KTRA 1UCVA 3BS5B 3D32A 3DVGX 1TK0A 2O6VB 4BDPA 5C2TB 3H4DA 2C28A 4BGDA 2WU5B 3ONNA 1L6NA 1ZJMA 1WR1A 2LHEA 4NXZA 4XDCA 3DBLB 1HZ6A 5KG6A 1JWSD 2JV3A 4MDKE 2HW3A 3L0WB 4RQNA 2AGOA 3K9OB 3AEDB 2MJEA 3NUHB 4WWNA 5FKAC 4TV3A 1YJ1A 2DYOA 4Y2UA 3C2KA 1NOMA 4DQIA 2I1JA 3C28A 8ICLA 2TSSA 5BYRA 2KDIA 5HR6A 4OJ5A 2LGYA 4DFDA 2XEWA 9ICOA 5J2EA 4F5PA 1OEYJ 5L1IA 3AE8B 2JF5A 2V1YA 4GN1A 3AUOA 2BPFA 3L4PA 4GIBA 9ICTA 1TS2A 4N58A 1C4AA 1C79A 2KEYA 2KIVA 2FBWB 3TSSA 4YQWA 4DSIA 3NJTA 2H3VA 2MWSB 4IRKA 2RR9A 3FKYA 2MAXA 2HBLA 3TFRA 2YMMA 2KK8A 3W9CB 1RRBA 3BINA 4KLMA 1EU3A 3QX7A 2PPHA 5AKKA 2UVRA 5C5JA 1IGCA 5KFUA 3KZXA 1XO1A 2BR0A 2QSDA 4N9F4 3W1SA 2DPIA 3TFSA 4GLSC 1UPHA 3C29A 2IBKA 2SAKA 4REZA 4HVBA 5JTIA 4XGAB 1WMHA 4KLHA 4MFCA 4L23A 1MHXA 3QQ8B 2FPLA 5ALVA 2WX1A 4OHJA 3PPAA 4FO6A 3H7PA 2KFZA 1D3ZA 2H3QA 1BNPA 4RPXA 2FUHB 2WAQC 2V3NA 3A9JA 4KX5A 4M8MA 2OWOA 4Z6FA 4DXFA 4URKA 2FLLA 5AI5A 1XO3A 3RRGA 3F53A 2F77X 4KZ0A 5EWEA 3J9CA 2EKEC 8ICUA 5IIOA 3AE7B 4Y2XA 1A77A 3RCZA 3ZTCA 1RAXA 3AU4A 5KG0A 4TSSA 3TJPA 2QHOA 4K4IA 3KWVA 4K7WA 2AXTU 5J0WA 1ZE3D 2JY6A 7ICSA 2KG5A 2FNJB 1I42A 2W9CA 2W03A 3B0AA 4KDIC 4PS8A 3RNAC 1ZQXA 2KVSA 3DHGC 4PYUA 1S0MA 4ED8A 3QYPA 3IHPC 3N3KB 4K1RB 4C4SA 4HJKA 1JIHA 2JZBA 1GAQB 4FBUA 3KUZA 4E0DA 2LXCA 4RT2A 1T0RC 1ZQFA 3SD5A 4IQTA 3AEVA 1BUIC 2R8JA 1SIJA 2JMGA 1PK1A 3M9NB 3UQBA 1B1ZA 2NYVA 4J9OA 1V1OA 7ICNA 4DQRA 1AYFA 2WDRB 3IT6B 3WK8A 3MFIA 2PXIA 2CRXA 3BVZA 3IRUA 7ICJA 3ZNID 1H4RA 1ZQZA 5MPOA 4CRXA 2BCSA 1WYWB 2E3TA 4BKSD 8ICBA 3WAOA 3KHRA 3VR9B 4M8NA 1S3SG 5TZVA 1FRDA 3SDLC 2N7EA 4Q44A 5DDMA 2NV3A 3AH7A 5KFXA 3DBHI 2MBOA 4MM3B 2KMAA 1K1QA 1Y88A 4EEWA 3U4EG 3SQIA 2IHNA 2UVWA 4F72A 2F1IA 2NTSA 2CR5A 2DWQA 1LB2B 4P0QA 3AEFB 3KYDD 3KTQA 1QSSA 5AKGA 3QZ7A 5AM1A 4M9NA 1JWAD 2XC9A 2CHZA 4GXBA 3Q8FA 4I6NB 3RF9A 4I2CA 5G2NA 1KW4A 5ALUA 4O3SA 4B9KA 2MSNA 4QZDA 2DQNB 2XO7A 4RF1A 4I2AA 4UB5A 2LJIA 1LVHA 4DQSA 2KNJA 1QLNA 3VXWA 5AM2A 4RQ8A 3MGHA 3RAQA 1V6EA 2CJOA 3GZNB 2KJ5A 5CP2A 4BVUC 3EC8A 4M00A 3MBYA 3W5UB 2A5UA 2HVHA 4EE2A 3EWAA 4P2HA 1SKSA 4NV0A 3PX6A 1WX9A 1LKYA 3LWLA 2LGDA 3I1YA 2ASLA 1S0OA 9ICLA 2DHZA 1DOIA 1DGJA 1IYFA 4DSKA 3FYHA 4F4WA 9ICFA 1WE7A 1HZ5A 4HYKA 2MBEA 4JUZA 4KSLC 4YR2A 2KIWA 2EAPA 1L7OA 4M6WA 5J2JA 4F2SA 1LM8B 5CHWA 4JWNA 1SE2A 4QIWC 5ALOA 2J0MA 3C2LA 4RF0A 4BXOA 2KLGA 3AE5B 2CXYA 5AIBA 3PV8A 4O3MA 1GJZA 2L00B 4PGYA 3RULA 1UH6A 5AI6A 4ZH4A 1DK2A 3N30A 4KLLA 2I1KA 2W11A 2EKIA 5KFTA 4O3RA 2XY6A 4ZHPA 4UAYA 1ZOLA 3SYZA 2G4DB 2KWDA 1NZBA 2K8BB 4UAVA 1L7YA 1Q8KA 3O65B 2QC8A 3R2TA 4DLGA 1UZXB 2MJ3A 1R4MB 7ICFA 2W54A 3TQ1A 1KM7A 1BT0A 1N2XA 3DWGC 4Y2YA 3AEEB 5AZFA 3DVGY 1BVSA 4KV2A 3VRBB 1V86A 3FAHA 4GDKB 3I28A 5DBAA 2WB1F 4EBEA 9ICVA 1FXAA 2JT4B 3Q6BA 4NPNA 3QUQA 4LZGA 2V9HA 5J0SA 1NEKB 2R61A 5EE9A 2QMTA 1HE8A 2AL6A 2AL3A 2WS3B 1NK4A 4A90A 2E8MA 2FMSA 1SWVA 2EZXA 3ZVVA 2DX5B 2PFQA 1NK7A 2V4QA 2C7NB 4LNIA 5D4BA 2LM4A 3AE3B 3EHVA 4O9MA 2H5XA 4ECYA 1ZETA 4B6JA 3M63B 3PZ8A 3Q69A 2KKVA 4DDID 4KLIA 4GC6A 2IJ0A 1IIPA 1N62A 2ATLA 2NRTA 2ZTEA 2AGPA 2JEIA 2KV2A 4WJ3B 4YSZB 2L8JA 1P7DA 3CF6E 4XWTA 2OXOA 3CNHA 3HVZA 1E10A 2YB1A 2OH2A 2ASJA 2VANA 4BKTA 3AXCA 2HBKA 4PZOA 3MHZA 4R8UB 1SWWA 3IG3A 3V6HA 3Q8PB 5TSSA 2OCEA 4XUSA 2E1EA 5J0TA 5J2KA 2MBBB 2Y5BB 7ICRA 4W9DA 2C2RA 3L54A 2D3DA 3KOOA 3V6KA 2MH7A 2KX0A 1ET9A 5DQIA 1U48A 1A5RA 2N7DA 5JXVA 3D2QA 2LUEA 4P0PB 2XVTA 2IO2B 2KMDA 5HNKA 1S8OA 4WJQA 4GB9A 1CI4A 1ZYQA 1VZ6A 1X2IA 1FNWA 3MC9A 9ICXA 3WKCA 5J2GA 2QLTA 2VH1A 1QSLA 2ZIWA 4M0WA 2YMLA 4ACOA 1SF0A 1XF5L 2NVUI 3KVFB 1WWVA 5D3DA 3ETRA 2HJ8A 2K9XA 4ECQA 4XE0A 1VJ5A 5KG4A 2J6TA 4GLXA 1WG8A 2KWCA 4JPSA 1MPEA 4FE3A 3SZ2A 5DB9A 5BOLA 2JX5A 4ZRKA 4A55A 1Z1BA 2AH5A 1WXAA 2AU0A 3OG5A 1E8ZA 3PSPA 5KL1B 3RJFA 3NY5A 4D2KA 3RH6A 5L1LA 5AZGA 3R9KA 3N20C 3UXOA 4HDOA 4ZOHC 5ALLA 1YJIA 3V6JA 2UVVA 5ALIA 5KT6A 5KT5A 2ZIUB 2DGZA 4IR1A 1XNSA 1RYJA 4OW0A 3VQIA 4ZYSA 1B9RA 3BK1A 4MH8A 5DCNA 3V6CB 2ZXIA 1D9DA 4DSFA 2D8CA 2FCNA 2YB4A 3U2SC 1J2NA 2BS4B 1OQYA 3AQEA 7ICIA 3SU8X 4G3IA 4U6PA 4IW0A 3BQ2A 2K8AA 1YOVB 1E6EB 2GB1A 3R66C 3WK9A 2Y5PA 4ZHOA 1ZDXA 2KDMA 4I29A 1FXIA 5AKJA 1E5WA 1MG8A 3ZNZB 4AOFA 3BQTA 1V9JA 3WCQA 2W3RA 3PW2A 4QWEA 1RFKA 1WRDB 2AWTA 4JK1A 2HHXA 3OAWA 3V60A 3GU3A 3F2BA 5J8YC 3TARA 1GNUA 5BMHA 3ZJTA 1V8CA 4U7CA 4F93B 1V80A 2ESEA 1NENB 2PEAA 4CYEA 5LXIB 1ZQEA 1YD8U 4YN4A 3MC1A 4ZRIA 2Y3AA 3ZO5B 3PHWB 4N6EB 1OXJA 2EZYA 2KLCA 2B3AA 3UXNA 1AWDA 2E8PA 2KC1A 3AE6B 5IKCM 5C1ZA 3WKDA 4M9GA 2ZIVB 1QZEA 3QUCA 4FHJA 4KGRA 2KDFB 3VH3B 1PVRA 5B5EU 2BDPA 2EAMA 1YQ3B 1Y56A 4MHVA 1TGZB 4DL7A 1ZQNA 5D7GA 1EF1A 1VZ7A 1FNVA 4QWBA 5CJ7A 1B43A 1TKEA 3RNGC 3R8BA 2D3AA 4RQ1A 1WZ3A 3IFWB 4TMAB 2W82A 2D3CA 4F5RA 4JV1A 4A20A 4GDLB 1Q3VA 2RPVA 3FILA 3RRHA 2WP9B 3K9PB 7ICQA 4NAMA 3AU6A 4A9AA 2PFOA 1HUZA 2W9BA 2LMRA 1R7SA 2PW9A 4FXCA 1ED1A 4UARA 4YD1A 2EDUA 1TYGB 2INNE 4DFPA 1NK0A 2BQQA 3RI7C 3PTFC 3ZGZA 4XQ8A 1RZTA 2XIDA 2Q4TA 7ICOA 2KTRB 5IAAC 3WKBA 4EX7A 3RB6A 5KFFA 3BVGA 2BPSA 4C4VA 4NM2A 4DK5A 4YWGG 4YMOA 4B9SA 2F44A 5AKIA 3U26A 4KGTA 4DWFA 2VZKB 2K4IA 3QXGA 4NNJB 5ALDA 1N61A 4J9MA 5LNK1 3LYYA 4I6PA 4LDTD 4LNOA 3B2FA 5KFYA 2MCNB 1F2RC 3AULA 3WK7A 2FI1A 1TS3A 3IG8A 3W1YA 1P9DU 1JRUA 1QOBA 3RYTA 3RB0A 1L3SA 4DWIA 4NZLB 2BGWA 2GOLA 1BPEA 2I5HA 1WWUA 4F8RA 4ACFA 8ICTA 2R8GA 4XRHA 4IOIE 4HPMB 1IP9A 4KX3A 4J9KA 3H8SA 2G09A 2XCAA 1ZQTA 3HX0A 4IR9A 2N9PC 4ECVA 1X1MA 5J0YA 2BCVA 4OVVA 2RRDA 4KSKC 2VA8A 5T14A 2C7MB 4RCOA 4DSEA 4QZ9A 2FMPA 2WDTB 2HSZA 1LQBA 1WWTA 1QH9A 2HDOA 1ZRMA 4NWIA 5TISU 3TI0A 2XBBC 4YTNB 3GV7B 4W9LA 3IM1A 3HHMA 5HKHA 5AM5A 1ZQUA 5KG2A 4P4PA 2ISOA 2HTME 2MBQA 4HCPB 4HDQA 1E8YA 4KGSA 4P16A 3RJIA 4WURA 3V6EB 1WMHB 4BKSA 2M8SA 2AQ0A 4RQ7A 2SEBD 2MRLA 4ARIA 3H7PB 4NLBA 1X66A 2LMCA 2KP7A 2LGSA 3N7RC 3RTVA 3A9JB 3ZDCA 3PRMB 3H0LB 2ZNVC 3TAQA 2WXMA 5LXHA 2KHQA 2W55A 2NBUA 3UQ2A 2BQUA 3ZRCA 1L4DB 3DVNU 2EANA 5AKZA 2R8KA 1N63A 3TEWA 4GIVA 2HBMA 2OYYA 4MF2A 2FCMA 1R4MI 3LXFA 2KXJA 3SAGA 4OVZA 3BZKA 2NBVB 3NG0A 4KLEA 3DDCB 4BBNC 3PZDA 5CHGA 4ARCA 2KJ6A 1ZQIA 4F4XA 3PSEB 1OEYA 2Y9TA 4MT5A 4TUUA 5AK3A 3URYA 3SENA 2W9CB 4RQ3A 1S97A 1DGSA 2RQ5A 4GOCA 2KHVA 2J7QB 4Y2VA 2YLMA 4I2FA 2KMCA 4LVSA 5J2RA 2JZBB 2F8KA 2PMZC 2BYEA 3B1LX 2C5LC 2BKRB 2VIXA 5D94A 4W9FA 1M6YA 2GWSA 4DQQA 1CJEA 4PH5A 2BYFA 1JMSA 1WRIA 1A76A 1KN5A 1PK1B 1Z4OA 4DFJA 4RUAA 1L7NA 2J4XA 5D2MB 2IPKD 2VH2A 1GG3A 5AM3A 4R66A 3PX4A 1U49A 1WR6E 2M19A 1L8OA 4F5QA 4RU9A 3MP9A 3NS8A 8ICWA 1I4HA 1O03A 2W43A 1X9MA 4C8LA 1SBBB 2HOFA 5KFBA 2FPKA 2DYMA 4UAZA 2K8CA 1D4BA 4QNLA 4EENA 3GDXA 2XK5A 4K81A 3BS7A 4B9NA 5AUIA 2KVCA 2K25A 3VVWB 3ZXRA 4PGXA 1RG6A 4C7YA 5KFJA 3LVWA 1YT3A 1QILA 2WF9A 2JWUA 1QQ7A 2L7RA 3Q3FA 1T0SC 4OZBA 4GC7A 3PR4A 1BNOA 2R8HA 4BFRA 4P0QB 3K75D 1L0VB 4DSJA 5BOMA 4C4TA 3PVXA 4PT5A 4XWWA 3M62B 3H8MA 1EO6A 5KNIA 4KLGA 1MQ3A 3ZTDA 1K8RB 3UMGA 2ZJ8A 3E0FA 4PZNA 2IO3B 2E5SA 2OOBB 2JRIB 3OJ4B 2GLEA 1P7EA 5AKYA 3WK6A 4HWIB 1SSNA 1D9FA 3NZ3A 1D8BA 2HHQA 3PMNA 1YX6B 3ONSA 2HJ1A 2K3UA 2B21A 4J9QA 5CEHA 2WXHA 1LKYB 2G0AA 2MUTA 3F5AA 3ORYA 2F1HA 1NK5A 4HAIA 5D49A 2EQYA 4WWOA 8ICQA 9ICGA 3U7ZA 2V3SA 3A4SC 5AEKB 2BQ3A 2G08A 8ICSA 1ZQHA 1Z19A 2HHTA 4RH6A 5KG3A 2WXRA 3OJ3A 4M6WB 5KFVA 3PO5A 1FM0D 3P1MA 3VFKA 5J29A 1WGRA 2ZW0A 4BXOB 3M6ZA 4F1SA 1CEZA 2XY5A 1HA5A 3APFA 3F2DA 3ZI4A 5H8YE 3BK2A 4W9HA 2R2QA 4WQOB 4AJWA 2WU2B 3A9KA 3LB8C 1N5XA 4FHKA 4IWPA 3RZWC 4RPZA 3GP7A 3GQCA 2WX0A 1CMXB 3QNMA 4I2HA 5KFPA 3OHAA 3RBDA 5F9LA 2FCSA 3N7PD 2ISPA 3B08A 2VJ5A 3ZRFA 4OZAA 1EWCA 2XI9A 2WTFA 4YL8A 2WQYB 4NLCA 5AKEA 3IG5A 1GO3F 2XNAC 1FIQA 1MHHE 3R7QA 5KG1A 1ZQMA 2KN7A 1ZJNA 2IBIB 4BUGA 2MW5A 3Q8LA 3DOWA 2EELA 5ALQA 2NO5A 4W9KA 2V4RA 4USAA 1WIAA 4DOCA 4L1BA 4DS4A 2A1JA 4DXGA 3TACB 2F76X 5GXGB 7ICUA 2EMSA 1PFDA 1FFUA 3Q8CA 2IY1B 4W9GA 4EZLA 1WXSA 4IKGA 5J8YA 5AI9A 3F5EA 5ALNA 1WX7A 2DAJA 4J9RA 4ELTA 3M8SA 5KFOA 3TANA 2M0AA 1L0YB 4RNAA 3H1UA 4ECWA 2IZVB 4EFOA 2INCC 2N0SB 4DO9A 2LFIA 4KVGB 4I2GA 4RZRA 1WJ6A 4F5OA 4CQNA 2G07A 1KLUD 2OEDA 1EWYC 4MGIE 4KMUA 2LD9A 1L0XB 1SV4A 1J19A 5AI8A 1ZQOA 1DYQA 9ICSA 1J2MA 1KLNA 4G0NB 3VH4B 3PY8A 2HVIA 2GLSA 3RNBC 2JRZA 1FFVA 4ELUA 1ZD2P 5DG9A 4CF5A 4OJOA 4EEYA 3H7SA 1NJXA 1FCLA 3DV9A 3RNEC 1V1PA 2KZZA 4FJYA 1T0QC 3NHEB 2FAZA 3LDZE 3DBRB 3M6KA 1ACCA 1ZQBA 4LNNA 4MFFA 4F4YA 2GBMA 1XCQL 4G50A 1OQQA 3E2EA 1L3UA 1NDDA 2WXNA 2ZIWB 2M1MA 1SGGA 4M0WB 3RN9C 1XLQA 2H3FA 1OTRB 2BVCA 2PJHA 2NR2A 1RYRA 4HEA1 4RFBA 3GIMA 5KFKA 1C78A 4M01A 1JROA 1HEZE 5IILA 4I2IA 9ICPA 1I4QA 2JSVX 3AV8A 1YQ4B 5KG7A 5ALFA 1YMHE 3SHQA 3JPNA 1CQVA 3QUBA 3SI8A 4MGKE 4YTPB 3VC8A 1B4FA 5C3JB 5G5GA 1TK8A 3IVFA 1L8LA 4BOSC 3VUYA 2C2EA 1U4AA 3EUB2 2ASDA 4GXKA 1NI2A 1XEEA 2FIDA 2JVCA 3X23A 3QU9A 2EH9A 3TMPB 3BY4B 4BKGA 4EX6A 1P0RA 3MHSD 3M95A 3VTWA 5H92C 1QCKA 4Z6CA 2N1VA 4HLEA 3R7RA 1PZNA 1ZD5A 4AS1A 5J0UA 4N59A 1DRGA 5JH5C 3EPGA 4K3CA 2F2AB 4BAXA 3UIPB 4B9VA 4Q8FA 9ICWA 5ALEA 3Q2AC 1WCLA 3LJ3A 1WGYA 3K4GA 1KTKA 1ZQLA 2PKEA 4B6WA 5AICA 3Q8MA 3WAMA 5AK5A 2CU3A 3MR3A 8ICPA 2J6SA 1PUTA 2D5GA 2EMTA 3ZDEA 2HTHA 1QF6A 1TTNA 2M56B 2QKQA 4KN7A 1GC6A 3MTNB 3HIZA 3JSVA 5ALWA 1BPDA 2MP2A 3V62A 3KD3A 5KAIU 5HG2A 4TUQA 1ESFA 1SEBD 3CMMB 3SEIA 1XCTL 1SXTA 2KTQA 5AKLA 3M3JA 2NRZA 3O13A 4NL9C 5KT3A 2JR5A 3HM3A 3UMBA 2WXIA 5J18A 4II2B 2KJRA 4Q2JA 4ANXA 5KFLA 4RMAA 1KDHA 3WIMA 4RQ0A 1IG6A 3VTUA 3ZYYX 3ZD8A 2BS2B 3BZDB 9ICEA 3N1YC 4HPLB 2KQSA 2O2VA 4GU2A 1SE4A 1WY8A 2YX8A 4F91B 3H6NA 5AUKA 4M9LA 4YT0B 4AYBC 3A4RA 3GIJA 2JZZA 4EOYA 4KKJA 1V81A 4IC7B 8ICIA 4XYCA 4F7ZA 3JPRA 2KFNA 1ZUD2 5AK6A 2KKCA 1D6EC 4CO7A 2V4LA 5DBBA 2IOHA 1IXRA 3FILB 2IHMA 4WJPA 3VHTC 3ZW3A 2W9BB 2DBYA 2DAFA 3GS2A 1JI7A 3AM9A 3VUXA 1MA7A 1TZOA 3I9V1 2V0GA 2BWES 2WHEA 3HKZC 3IT4B 2GRIA 3JVZX 3WA0A 4JWSC 4QZFA 3WANA 3MGIA 3L10B 4O5CA 7ICTA 2I2YA 3PNCA 3BQ1A 4C4VB 4DEZA 5BMIA 3PSTA 1FO4A 1C7YA 4FZNA 3WAPA 1DK3A 4C00A 4TQ1A 3NTUA 2VJ4A 1EU4A 3LK9A 3T9LA 2NPTB 3HT3A 3EYZA 8ICVA 2WXFA 1L3TA 4JB3A 5B66U 2K4PA 4QW9A 1TY2A 2KJHB 2J42A 1OW5A 2BPCA 3T79A 2WAQF 1A0PA 4DL6A 3TCAA 4EZ9A 2JUOA 3QU2A 4JQWC 1S1QB 1XU4A 3JYUA 3WK4A 1E0ZA 2NBWB 2Z0DB 4G9BA 2LBOA 1G6JA 3HRDD 2KOXA 2DYBA 4NM1A 3AE4B 3L08A 3QEAZ 3J81j 3PW0A 4M47A 4YSXB 4UB8U 3PO4A 1FEHA 2MEKA 1P3QU 4DLEA 2ON8A 1H38A 4US8A 2MLBA 5KT7A 1VR9A 3ZXVA 1L7MA 1XLOA 1HTOA 1UA1A 2N9LA 3KWLA 4YFKA 5J2IA 2LYHA 1NK9A 2OEHA 4NAWA 1HJPA 2RP5A 1K52A 4M02A 2DZMA 2M9NA 2IGHA 4PK1A 4RM8A 2K1FA 1WCNA 2ZXHA 3PX0A 4AJYB 4UBBA 1NJYA 1JXEA 2JH7A 1KKXA 3HJEA 2KNBA 3G6YA 3PVLA 1UGJA 4DDGD 4NLZA 8ICGA 4W9CA 1WXQA 4FFDA 4TQSA 1KRPA 5J0XA 2PFPA 3DHHC 4DL2A 4E74A 3N97B 4MGYE 4RNNA 1PGXA 4ED2A 3VAWA 3DBLI 2PFNA 2F1JA 2ZIXA 4NQKE 4ANWA 1WGKA 1I7HA 4WH4A 5J2BA 5IINA 2JRHA 2RDBC 2F3NA 4QZHA 2GBJA 4ZRQA 4GXIA 1Z2MA 1T8EA 5CR0A 3CP8A 1GOZA 2PVOD 2L83A 3PS6A 4TUSA 2VZKD 4G3XB 4II3B 1Z4NA 4DL5A 1ZQGA 3DPDA 1S76D 1Z3EB 3TAPA 3CW2C 3L5KA 1C4CA 2AGQA 2YTUA 1ZQDA 5E79U 1COOA 4C8OA 1XS9D 1OGWA 3AEGB 1WGGA 2ZJ5A 2RDHA 2KT7A 4Z6EA 1YQBA 4WAAA 4P7IA 5KFGA 5ALHA 3KQ4A 2MBHA 2HCFA 1ZQ1C 2MJDA 3PLUA 4YP3A 3GB1A 5L1JA 2JZPA 2N9KA 3OHBA 2H3IA 2CN1A 2KICA 2FUG1 2XK5B 2LHDA 8ICNA 2V4IB 3VUWA 2RLTA 1LO5D 2K5PA 1H8CA 1JW9D 2B0CA 1AN8A 3B0YA 3DHIC 3ZNHB 1MVKA 1Q0WB 2LASA 5FR6A 1SKRA 4ED6A 2E8NA 2W8LA 1TV9A 1PGBA 2L52A 3U7DA 2BTEA 4NY8A 2HOIA 1T4GA 3ALRA 2HHSA 2LGIA 5FP0A 3DBRI 4KLUA 4KX6B 3K1RB 4CNQA 4ECXA 3G6VA 3ZNGC 1IV8A 4YD2A 1KTQA 1CUKA 4UATA 2NRXA 3WU2U 1XSNA 2BKEA 3EA6A 3ABVB 4B9MA 3H8WA 1GPXA 4NY0A 4DL3A 3T8MA 4Y2JA 4UB4A 1SIFA 4W9JA 2MUTB 2KFKA 4FLHA 1AARA 3NOBA 2MX2A 3ZQ4A 3AU2A 2AEHA 1FMAD 2IYDB 3HW8A 2YQEA 3EW9A 5J0RA 3S2AA 3H0MB 2W9AA 1KBUA 4IQWA 4RQ4A 3RJJA 3QIJA 5KL8B 3IP4B 3RNFC 2KZ3A 2BKFA 2ZW1A 5GTHU 4A8EA 5EOZA 1E8XA 5EE1A 1T7PA 3KHLA 4F5NA 4MEMA 3WKAA 4TURA 3Q3MC 3L13A 4DFKA 2PTLA 3PRPB 4F4ZA 1XD3B 2BF8B 3Q3JA 3C5GA 5HMMA 3BQ0A 3PLVA 3JPPA 3M8RA 3GV5B 1OQRA 4F4KA 2DLBA 1SJED 4J6IA 2QB0A 3K1ZA 2PE6B 5HR7A 3TEYA 5KFIA 2N4FA 2BB6A 2BCUA 1NYQA
chains in the Genus database with same CATH topology
3CWIA 3NVYA 1JQ4A 1FNUA 1KF6B 2H89B 2YEPB 2Q5WD 1GAQB 2BW2A 4DQOC 2WLBA 1XLNA 4WWMA 1P7EA 4C80A 1BUIC 1SSNA 4RGMA 3NZ3A 1SIJA 2LUMA 3ZJUA 2E6XA 1JMLA 2K3UA 1B1ZA 2WXHA 1V1OA 2WDRB 1AYFA 3IT6B 3U7ZA 3BVZA 1F0ZA 2G1EA 5MPOA 5EE3A 2E3TA 2WXQA 1GB4A 4RH6A 3VR9B 2WXRA 1FRDA 4P6VF 3P1MA 1FM0D 3AH7A 3RFZB 1NVID 2ZW0A 4MM3B 1XXGA 1HA5A 5H8YE 3BK2A 3U4EG 2WU2B 1FD6A 3LB8C 1N5XA 2G9HD 2NTSA 2PVGC 2DWQA 3AEFB 2JXTA 3GP7A 4AQ7A 1GB1A 3P42A 5T8IA 1C76A 2RMMA 4J3OD 3V05A 1TJEA 1JWAD 3Q8FA 4US9A 1F77A 2CJNA 1NI3A 1UWMA 1EWCA 1E7PB 4OZAA 3MC0B 3H8HA 2IGDA 2WQYB 4RF1A 1IGDA 4C7ZA 2LJIA 1T5XD 1V1PB 2JQRB 2XNAC 1FIQA 1MHHE 1J7AA 1VJKA 2CJOA 4HJGE 1WSPA 3NS1A 3I57A 2W3SA 1JWMD 1ZXHA 3AE2B 2KMMA 3W5UB 1VZ8A 2EELA 4EE2A 3BWUD 2L1AA 2YEPF 4USAA 4XDDA 4A8XC 1XLPA 1YNTE 4L1BA 2QILA 1QKZA 4DXGA 4RGNA 4A6QA 3R2IA 5GXGB 1PFDA 1DOIA 1DGJA 1FFUA 3B2GA 1JRPA 3Q8CA 3Q8EA 4IKGA 1K50A 1HZ5A 1L5PA 3T3NA 2M0AA 1L0YB 1SE2A 4RNAA 4RF0A 2NMQA 2N0SB 3AE5B 2LFIA 3U52E 4CQNA 1KLUD 1TKGA 2OEDA 4B0MA 1EWYC 1L0XB 1D5MC 2EKIA 1DYQA 4ZHPA 5G5HA 2KWDA 3R2TA 1EM7A 1FFVA 2MJ3A 3PZ7A 2W54A 1HXYD 3DWGC 3T3OA 1FCLA 3AEEB 1L6UA 1V1PA 4JE3B 1RM6C 1I4GA 1QQRA 2BYTA 3VRBB 3FAHA 4GDKB 2QEJC 1DOXA 1ACCA 1FXAA 1XCQL 1OQQA 2WXNA 4L2YA 1C9FA 1NEKB 2R61A 1XLQA 2QMTA 5EE9A 1TS5A 4H2AA 2WS3B 4HEA1 4RFBA 4A90A 1C78A 1JROA 1HEZE 1I4QA 2JSVX 3AV8A 4HRSA 1YQ4B 1YMHE 3AE3B 1CQVA 1SE3A 3PO0A 1FCCC 3PZ8A 3Q69A 4YTPB 5C3JB 5G5GA 4ITKA 4JX1C 4LK0M 2IJ0A 1N62A 2BT6A 3EUB2 2V3PA 2ICIA 4HKZE 2K22A 1XEEA 2H88B 4YSZB 4XWTA 2XN9C 3HVZA 1E10A 3N9YC 4C56C 1SJHD 1YJJA 3MHZA 3CIRB 3Q8AA 5H92C 3TEXA 1IBXB 2INPE 4AS1A 1FRRA 3IXSA 2I38A 4N59A 5TSSA 3RPFC 3IAM1 1STEA 3NVVA 1Q10A 2PIAA 3EGRA 2J52A 3DWMA 2MH7A 1ET9A 5JXVA 3E9SA 1KTKA 1VZ6A 3V3XA 3BYTB 5FR3A 1VLBA 1FNWA 3B9JA 3BYYB 2CU3A 4WAFA 2D5GA 1PUTA 2L32A 4M0WA 3NRZA 1QF6A 2M56B 1SF0A 1XF5L 2OHFA 2QJLA 5D3DA 2JU6X 3ETRA 2WXOA 2K9XA 1YN5A 4XE0A 1J7BA 5HG2A 2WXKA 1SEBD 1ESFA 1OFFA 1C77A 1ET6A 1MPEA 1PYWD 1T6BX 1XCTL 1SXTA 2JX5A 1JCKB 3BVMA 4A55A 3O13A 1I4PA 2WXIA 1UNSA 3AECB 1E9MA 4NJCA 1KFYB 2JYTA 4Q2JA 4D2KA 3KLSX 1JALA 1M4VA 1QT9A 4ZOHC 1YJIA 4TQ0A 3ZYYX 2BS2B 3BZDB 2J53A 1RYJA 4OW0A 5I4DA 3VQIA 4ZYSA 1SE4A 1B9RA 3BK1A 4MH8A 1WYGA 1IBXA 5AUKA 1ZDVA 4YT0B 2Y5CA 1TY0A 2WXJA 3U2SC 1TS4A 3FC4A 3SR6A 3HUIA 4KKJA 2BS4B 2PMVA 1RWSA 2LEKA 1ZUD2 2ACZB 1QLBB 2GB1A 1E6EB 4JPSA 4ZHOA 2Y5PA 3AEBB 3SFDB 1ZDXA 1D6EC 2KDMA 1KLGD 2HDEA 1FXIA 3FILB 2PLPA 1VRAB 2BBCA 2WDQB 3WCQA 2W3RA 3AN1A 1RFKA 1TKYA 2DBYA 2KQ4X 3GS2A 3AM9A 4WIPA 1TZOA 1BXTA 2K0PA 1UWXA 3I9V1 2V0GA 3AE1B 5BMHA 3IT4B 3ZJTA 1D5XC 3P4QB 2GRIA 1V8CA 4JWSC 2IDYA 2B76B 4NAWB 5FK9C 1NENB 1VDVA 2I2YA 1PDXA 4YSYB 5BMIA 4B0EA 2Y3AA 1FO4A 1ROEA 4N6EB 4MACA 5HI1A 4TQ1A 3MJ5A 1P7FA 1EU4A 2AQ2B 1AWDA 1QOAA 3AE6B 1ZOYB 2WXFA 2WNMA 4O1NA 4KGRA 1TY2A 3SEBA 2J42A 3AEAB 1IUEA 1YQ3B 3P4RB 3Q8BA 1Y56A 5D7GA 1VZ7A 3OWEB 1E0ZA 1FNVA 1MI0A 1TKEA 4RGTA 3HRDD 1D5ZC 1HQRD 4WQMA 3R8BA 1K51A 1K53A 3AE4B 4TMAB 1ENFA 1ZPSA 2W82A 2WXPA 5BYSA 4GDLB 2RPVA 1JWBD 3FILA 2ONQA 2WP9B 4NAMA 4YSXB 1KH0A 4A9AA 3BIID 2MEKA 1FEHA 1R7SA 2PW9A 1N5WA 1JWUD 2KN4A 2ON8A 2INNE 2IGGA 4US8A 1TYGB 1VR9A 4FXCA 3W2DA 2PKOA 1XLOA 2N9LA 3KWLA 3ZGZA 4KKIA 1CK1A 1CZPA 1K52A 3BVGA 1AW7A 2IGHA 4YWGG 3TEZA 2KAJA 4KGTA 3HVDA 2VZKB 4OZCA 1N61A 5D3IB 1ZXIA 5LNK1 3LYYA 4UDUC 1N60A 1UGJA 3B2FA 3VRAB 2X38A 3VR8B 1F2RC 1WXQA 1TS3A 1QOBA 2NTTA 4NZLB 2FE8A 2GI9A 4YTMB 1PGAA 3P4SB 5HHDG 1PGXA 4IOIE 2WXLA 3UI3A 1WGKA 1YN3A 3AE9B 1I7HA 4WH4A 3E56A 1SB3C 2QIEB 4ZRQA 1T3QA 1A70A 1L4ZB 2WXGA 1C4PA 1V97A 1GOZA 2PVOD 2L83A 4RCOA 2N7JA 2VZKD 1QOGA 3P4PB 1C4CA 1WWTA 2BS3B 1ZP0B 4YTNB 3NVWA 2BB5A 3AEGB 1UUPA 1J7CA 2RDHA 3P63A 4KGSA 2HTME 1BMLC 4P16A 4WURA 1I4XA 1L6VA 1QOFA 2SEBD 3KQ4A 2MJDA 4ARIA 3AB5A 2LMCA 3GB1A 5C2TB 2WU5B 2AX5A 2LHEA 2JZPA 4XDCA 2N9KA 2FUG1 2WDVB 1HZ6A 1F2RI 4ZRPA 2WXMA 2LHDA 2W55A 5HFYA 1JWSD 2V4IB 1L4DB 3AEDB 2MJEA 3NUHB 1LO5D 2K5PA 5FKAC 1N63A 1JW9D 1AN8A 3SFEB 3TEWA 5EE0A 2DYOA 2RDGA 1MVKA 3LXFA 4OVZA 2TSSA 5BYRA 1YN4A 4HKQA 1PGBA 2L52A 4ARCA 2BTEA 2LGIA 3AE8B 4MT5A 4RGOS 1NYRA 3MFGA 3L4PA 1TS2A 4KX6B 4N58A 3URYA 1C4AA 1C79A 2FBWB 3TSSA 4YXDB 5E6JA 3C8YA 3W9CB 1EU3A 1KRHA 2AQ3B 5BMGA 3AMZA 2KACA 1CJEA 3EA6A 1IGCA 1WRIA 2QSDA 3ABVB 3W1SA 1GPXA 4GLSC 2J4XA 2IPKD 5BYQA 2M19A 2SAKA 4REZA 3MP9A 4L23A 3ZQ4A 1MHXA 1I4HA 4LLGM 4OHJA 1I4RA 1SBBB 1FMAD 2JYEA 4LTUA 3ZJVA 2DYMA 2V3NA 2AQ1B 3IAS1 1D4BA 4DXFA 5AUIA 4JWUC 4HROA 2ZW1A 1XO3A 4C7YA 4IDIA 5EE1A 1QILA 4R3DA 2JWUA 3J9CA 4OZBA 3TUOA 2PTLA 2Z8LA 3AE7B 3W5VB 1OQRA 1DOYA 4TSSA 1L0VB 2DLBA 1SJED 3KWVA 4PT5A 1ZE3D 3TEYA 4XWWA 2BB6A 3NVZA 1NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGK A;  3AE9 B;  1I7H A;  2MJ3 A;  3FC4 A;  3NVY A;  3SR6 A;  3CWI A;  3HUI A;  1JQ4 A;  2BS4 B;  2W54 A;  1SB3 C;  1KF6 B;  2H89 B;  3DWG C;  2Q5W D;  1RWS A;  2LEK A;  1L6U A;  1T3Q A;  1A70 A;  2QIE B;  3AEE B;  1RM6 C;  1ZUD 2;  2ACZ B;  1GAQ B;  1V97 A;  1QLB B;  2L83 A;  1E6E B;  2PVO D;  3FAH A;  2WLB A;  1XLN A;  3AEB B;  1QOG A;  4WWM A;  3SFD B;  4ZHO A;  3P4P B;  1DOX A;  1FXA A;  4C80 A;  1WWT A;  2BS3 B;  1FXI A;  1SIJ A;  1OQQ A;  1ZP0 B;  2WDQ B;  3NVW A;  4YTN B;  2W3R A;  3AEG B;  3AN1 A;  1RFK A;  1TKY A;  2DBY A;  3WCQ A;  1NEK B;  3AM9 A;  1J7C A;  1XLQ A;  3P63 A;  5EE9 A;  2WDR B;  1AYF A;  2HTM E;  2WS3 B;  3AE1 B;  1F0Z A;  3P4Q B;  1L6V A;  1QOF A;  2G1E A;  1V8C A;  2MJD A;  4JWS C;  1JRO A;  3AB5 A;  2B76 B;  5EE3 A;  5MPO A;  2E3T A;  1NEN B;  5C2T B;  1VDV A;  1PDX A;  4YSY B;  2WU5 B;  3AV8 A;  1YQ4 B;  4HRS A;  3VR9 B;  1FRD A;  1FO4 A;  2AX5 A;  4P6V F;  3AE3 B;  1FM0 D;  1ROE A;  3P1M A;  4N6E B;  2WDV B;  3AH7 A;  3PO0 A;  4YTP B;  1NVI D;  5C3J B;  2W55 A;  5G5G A;  4ITK A;  4JX1 C;  1N62 A;  2BT6 A;  1AWD A;  1QOA A;  3EUB 2;  2K5P A;  2MJE A;  3AE6 B;  1N63 A;  1JW9 D;  3AED B;  5H8Y E;  1ZOY B;  2K22 A;  5EE0 A;  2WU2 B;  3LXF A;  2H88 B;  3LB8 C;  1N5X A;  4YSZ B;  2PVG C;  2DWQ A;  3HVZ A;  3AEA B;  3AEF B;  1E10 A;  2L52 A;  3SFE B;  1YJJ A;  1IUE A;  3CIR B;  1YQ3 B;  5H92 C;  3P4R B;  1TJE A;  1JWA D;  3AE8 B;  1NYQ A;  4US9 A;  1NYR A;  3L4P A;  1FRR A;  2CJN A;  4KX6 B;  1NI3 A;  1UWM A;  4N59 A;  1E7P B;  4N58 A;  3RPF C;  1E0Z A;  3NVV A;  2FBW B;  2PIA A;  2WQY B;  4YXD B;  1TKE A;  3HRD D;  4C7Z A;  2JQR B;  3DWM A;  4WQM A;  3W9C B;  2MH7 A;  3AE4 B;  1FIQ A;  1J7A A;  1VJK A;  2CJO A;  3NS1 A;  2W3S A;  1KRH A;  3AMZ A;  1CJE A;  3AE2 B;  1JWB D;  1VLB A;  2KMM A;  3B9J A;  1WRI A;  2WP9 B;  3ABV B;  3W5U B;  4YSX B;  2CU3 A;  1GPX A;  1PUT A;  4A9A A;  3BII D;  1R7S A;  1N5W A;  4FXC A;  3NRZ A;  1QF6 A;  4US8 A;  4USA A;  1TYG B;  2M19 A;  2M56 B;  1SF0 A;  2PKO A;  1XLO A;  1XLP A;  2OHF A;  2QJL A;  3VRB B;  3KWL A;  3ETR A;  2K9X A;  1J7B A;  5GXG B;  1PFD A;  1DOI A;  1CZP A;  1DGJ A;  1FFU A;  3B2G A;  1JRP A;  1FMA D;  1OFF A;  1L5P A;  4LTU A;  2JX5 A;  2KAJ A;  5AUI A;  4JWU C;  4HRO A;  3AEC B;  1N61 A;  1E9M A;  1KFY B;  1ZXI A;  1XO3 A;  2N0S B;  3AE5 B;  4C7Y A;  4IDI A;  1N60 A;  1JAL A;  5EE1 A;  3B2F A;  3VRA B;  1QT9 A;  3VR8 B;  4ZOH C;  1YJI A;  1TKG A;  3ZYY X;  2BS2 B;  1WXQ A;  1EWY C;  1QOB A;  3AE7 B;  2EKI A;  1RYJ A;  3W5V B;  1OQR A;  4YTM B;  1DOY A;  3P4S B;  4ZHP A;  1L0V B;  1B9R A;  5G5H A;  1WYG A;  5AUK A;  4YT0 B;  2Y5C A;  3NVZ A;  1FFV A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  1I35 A;  2XGP A;  1JQ4 A;  1FNU A;  2DKZ A;  3DEE A;  2YEP B;  3F2C A;  2Q5W D;  3QAQ A;  1SGH A;  2L0T A;  4JL9 A;  4RNO A;  3HK0 A;  4M0A A;  2BW2 A;  4DQO C;  4OJL A;  3CYM A;  4EBC A;  9ICJ A;  4DXA B;  1XLN A;  5J2D A;  2P66 A;  2JXX A;  4WWM A;  4C80 A;  3TIX A;  4RGM A;  4PHE A;  1FPY A;  3ZJU A;  5JUM A;  2LZ6 A;  1ZQK A;  3QE9 Y;  1JML A;  4F50 A;  4HXD A;  2CKH B;  2A1J B;  2W9N A;  4IRD A;  2W7O A;  1ZQA A;  3GZN I;  2WF7 A;  4HK2 A;  2HHW A;  4LNF A;  3GZF A;  5AM0 A;  3QAR A;  4A3O A;  4P6V F;  4S17 A;  3DQV A;  1KQQ A;  3RFZ B;  3THV A;  2DZK A;  5DQG A;  4IC9 A;  5ALX A;  4NL9 A;  3UM9 A;  1BPX A;  2BHN A;  4FS1 A;  3PSF A;  4EZJ A;  2WF8 A;  1Z00 A;  2RGF A;  3TAD C;  4O3O A;  5DGA A;  2G9H D;  4RQ2 A;  4OVU A;  2KZR A;  2PVG C;  5J2F A;  1NNL A;  2JXT A;  4QZB A;  1GB1 A;  4IM2 A;  3P42 A;  5J17 A;  1WZ0 A;  2RMM A;  2ZVO A;  3IN5 A;  5CTR C;  4P1B C;  2DKX A;  3V05 A;  9ICK A;  3T5L A;  3A33 B;  1F0M A;  1RDF A;  5AM4 A;  1ARO P;  1NI3 A;  3KFU F;  1UWM A;  3MC0 B;  2HD5 B;  2FJ6 A;  1V1P B;  2JQR B;  3IHQ B;  4HJG E;  1WSP A;  1QQ6 A;  3A0B U;  3D6J A;  3NS1 A;  5EWG A;  5HML A;  2CS4 A;  3I57 A;  2FLN A;  1JWM D;  3I3T B;  2RDI A;  2KMM A;  1LGR A;  2BGF A;  2LPE A;  2LJ5 A;  1QTM A;  2Y0S F;  2VRR B;  1JUD A;  4JWM A;  4IS7 A;  1T3N A;  1T0Y A;  3ZKJ C;  2YEP F;  3DBH B;  2LVQ A;  3HM6 X;  4MEX A;  1XLP A;  1YNT E;  5IA7 A;  1URJ A;  4A6Q A;  2KKP A;  3R2I A;  3OJS A;  2QAR A;  2MA1 A;  3A0H U;  4JLC A;  2FLP A;  3OPX A;  3B2G A;  1JRP A;  2N1R A;  4CDG A;  1L5P A;  1PQS A;  2L0F A;  1C1Y B;  4KLO A;  2L76 A;  2O6V D;  2DEN B;  4MH0 E;  4QJF B;  2KVZ A;  4RNM A;  4YR3 A;  3APD A;  2FE9 A;  1KFD A;  3U52 E;  2G5H B;  3PW4 A;  5AZH A;  1TKG A;  1YZ7 A;  4LJO B;  5ALG A;  2KYW A;  2KC2 A;  1S9F A;  9ICU A;  3QU7 A;  4O3N A;  4F2R A;  2D3B A;  3N1X C;  4MEY A;  4YVZ A;  3RUI B;  3AI5 A;  2K6D B;  1JX4 A;  5L83 A;  2Y1I A;  3DBS A;  1EM7 A;  3H8J A;  2LYA A;  5L1K A;  4KIK A;  4CHK A;  1HXY D;  1ECW A;  3T3O A;  4AP9 A;  4JE3 B;  1L6U A;  5DG8 A;  1E8W A;  9ICN A;  1QQR A;  3AQF A;  1V85 A;  5KFE A;  2QEJ C;  3GIK A;  1DOX A;  2V9W A;  2VA2 A;  3RJG A;  3QX1 A;  5JHB A;  3ZDT A;  1K5O A;  2XY7 A;  1WXV A;  2A4Z A;  4DHZ E;  3U8Z A;  3V72 A;  1TS5 A;  3PRE A;  4Y2Q A;  4LZD A;  3JSV B;  1U9L A;  3PR5 B;  3H9D A;  2MP2 B;  5ALZ A;  5AHX A;  2KWV B;  2CHX A;  2MHJ A;  2Z0E B;  1RQN A;  4DCC A;  2Y1J A;  2G3Q B;  2JPH A;  2VKQ A;  1KJT A;  5E6P A;  2CHW A;  3N7S C;  2BZF A;  4HRS A;  4PPX A;  2KVR A;  9ICA A;  2MRP A;  3Q3O C;  1E90 A;  3T5H A;  3OJU A;  1SE3 A;  2IMW P;  8ICZ A;  3PO0 A;  4LDT B;  5TR5 A;  3T3F A;  2DZJ A;  4ITK A;  1ZQR A;  3A1Q A;  2WYQ A;  4LK0 M;  1E7V A;  2BT6 A;  2ZNV B;  1ZQC A;  2V3P A;  2PI5 A;  2ICI A;  4PHA A;  2IO0 B;  5KHO A;  2XN9 C;  4UQG A;  3N9Y C;  2O2V B;  4C56 C;  2ALZ A;  2J0K A;  1YJJ A;  3CIR B;  4M04 A;  1NK6 A;  3Q8Q B;  4F92 B;  1RQL A;  2INP E;  2R8I A;  2W9M A;  5J0P A;  2HHV A;  2FCQ A;  2I38 A;  2ZCB A;  4EZ6 A;  3LWM A;  3RPF C;  4DHJ B;  4OO1 J;  1WF9 A;  2PIA A;  1SV0 C;  3JPO A;  3QU4 A;  9ICM A;  4DBG A;  2ZUD A;  2UYZ B;  1NKC A;  4RM9 A;  1YZ6 A;  4IRC A;  3WK5 A;  3V3X A;  3BYT B;  1VLB A;  3B9J A;  1ZRN A;  3RH5 A;  3BYY B;  4TQR A;  3EFU A;  4DSL A;  8ICJ A;  3V61 A;  3NRZ A;  4EEL A;  3WAL A;  1NJZ A;  2K6Q A;  4XC2 A;  2YMQ A;  1Q3U A;  1B22 A;  1VCB A;  2JU6 X;  1RLF A;  2PI4 A;  2WXO A;  4GSW A;  3RJE A;  1YN5 A;  1J7B A;  2AYO B;  3R3M A;  4F8C B;  4YR0 A;  4ED3 A;  4FZL A;  5L1M A;  2WHI A;  2WXK A;  1C77 A;  5IN7 A;  1JCK B;  2RSU A;  4M2Y A;  4NJ6 A;  4ZRJ A;  2CPR A;  2KAN A;  2E8O A;  1TAU A;  5KT4 A;  4YXJ A;  4FJZ A;  1UNS A;  3AEC B;  3JW0 X;  1MG4 A;  1KFY B;  4K3B A;  1V5T A;  3KLS X;  1JAL A;  5IIJ A;  1M4V A;  2P6R A;  4ED0 A;  1QT9 A;  2D2Q A;  1PVQ A;  5KT2 A;  3I76 A;  3RJH A;  2OJW A;  4CCH A;  9ICQ A;  5KFR A;  1XO0 A;  2N1W A;  5K4L A;  1WYG A;  2I9G A;  4WJN A;  1ZDV A;  1IBX A;  2KD1 A;  2LI6 A;  2Y5C A;  1EUV B;  1TY0 A;  2WXJ A;  1YIW A;  3SV4 A;  3ZUN A;  1TS4 A;  2C2D A;  3KKA C;  3SR6 A;  3HUI A;  4J9L A;  3KHG A;  1F52 A;  3OGU A;  4KN4 A;  5CB1 A;  4KLF A;  1RYU A;  3S6J A;  2LEK A;  2LYB A;  4QWA A;  4IM3 A;  2ACZ B;  2HMX A;  1QLB B;  2NRW A;  1TBE A;  3SFD B;  2KHW B;  1KSP A;  1ZQS A;  3ML8 A;  3Q14 C;  3O0F A;  4BBN F;  2BDU A;  8ICX A;  4Q45 A;  2WDQ B;  3RB3 A;  1N6Z A;  4KZC A;  2XCP A;  2KQ4 X;  2HI0 A;  3BZC A;  4WIP A;  5KFH A;  1BXT A;  4YXM A;  1NKB A;  1UWX A;  4B9U A;  4NLG A;  4DHZ B;  3AE1 B;  5A0L A;  4RQM A;  3ZD9 A;  2IDY A;  4NAW B;  5FK9 C;  2PMZ F;  1VDV A;  1WH3 A;  4ANU A;  1PDX A;  2IA6 A;  4YSY B;  4BOZ B;  2KQ7 A;  3OTQ A;  3QA8 A;  2LHT A;  1ROE A;  4YG2 A;  1YX5 B;  2MA9 B;  4MAC A;  5HI1 A;  4CGZ A;  3MJ5 A;  5EDS A;  4IWO A;  1P7F A;  3ZDB A;  1Q46 A;  3UMC A;  8ICC A;  1QOA A;  1KOT A;  5AIA A;  1TVA A;  4LCD E;  2KE7 A;  3H4B A;  2WNM A;  4NLN A;  5DPR A;  2EZZ A;  2WB1 C;  3CST A;  2DL0 A;  4BJQ A;  3SEB A;  2GMI C;  3KH0 A;  1IUE A;  4FA6 A;  3P4R B;  4NJ8 A;  7ICV A;  2C9W B;  4XX5 A;  2ZIX B;  5IO9 A;  4M9H A;  3DDH A;  2J6U A;  5JHA A;  2B6G A;  4EYI B;  3MDC A;  1N48 A;  1P98 A;  4DL4 A;  4O0I A;  1BPY A;  4IUM B;  4RGT A;  4C0Z A;  4XZ4 A;  2ZUC A;  4DOA A;  1K51 A;  1ENF A;  1ZPS A;  4MSM B;  2YN4 A;  4FZM A;  5BYS A;  2C22 A;  1F1H A;  4S0R A;  3HIL A;  2ONQ A;  3PW7 A;  2W7P A;  4KDL B;  1KH0 A;  3BII D;  2KN4 A;  1JWU D;  2IY0 B;  4MJS A;  3W2D A;  4UAU A;  2IGG A;  3ICX A;  3MR2 A;  2PKO A;  1XWL A;  3I63 C;  3JPT A;  3KUC B;  4KKI A;  3V7L A;  8ICA A;  4X5V A;  4KIT B;  3M7D A;  4Y2T A;  2O6K A;  4JIO U;  1CZP A;  4OCZ A;  2EAO A;  2D11 A;  3KHH A;  1AW7 A;  3ED5 A;  4KTQ A;  3SAF A;  4AWJ A;  2KX3 A;  5ALT A;  1N56 A;  4UAW A;  2KAJ A;  2KJ9 A;  4A3P A;  1WFY A;  3PZP A;  3HVD A;  5GTI U;  2ASQ A;  4Q43 A;  1S5L U;  1Y8R C;  1TZ1 A;  1ZXI A;  8ICK A;  3RB4 A;  3T5J A;  1N60 A;  2WF6 A;  4Y2P A;  3VRA B;  2X38 A;  3VR8 B;  3N4M B;  3AL0 B;  3ECI A;  3UGB B;  4GFJ A;  1ZQY A;  2M0X A;  3RNC C;  1MN8 A;  4YTM B;  1GUA B;  2GI9 A;  1IPG A;  3TAD A;  3P4S B;  2G5I B;  2KN5 A;  3PML A;  2X8X X;  2WXL A;  3QJZ A;  3UI3 A;  1R4N B;  1X42 A;  1YN3 A;  1TT5 B;  3AE9 B;  4K4H A;  3KYC D;  3E56 A;  3D2S A;  2G4S A;  1SB3 C;  5F3X B;  2A1A A;  2P35 A;  2QIE B;  5KFC A;  1A70 A;  1L4Z B;  1V2Y A;  1WGD A;  1C4P A;  3SAH A;  2MSE D;  2WXG A;  4IWQ A;  1V38 A;  4MGZ E;  5J2H A;  4UBC A;  1MQ2 A;  1SXD A;  3NAS A;  1XSP A;  1QOG A;  3KBB A;  4JV2 A;  2ZUB A;  3H7I A;  3DCG A;  4KLQ A;  2KOB A;  4DOB A;  1L5U A;  3GIL A;  3NVW A;  5KFD A;  2BB5 A;  2IND C;  3L17 A;  4R64 A;  1J7C A;  4PS3 A;  5DB7 A;  2LRW A;  7ICG A;  2GO7 A;  4DS5 A;  2KFK B;  3C19 A;  4G11 A;  1X6J A;  4BX9 C;  3MR6 A;  4FN2 A;  1S0V A;  3M1Y A;  2KSO A;  4ECZ A;  1QOF A;  2I1Q A;  2GBK A;  2IOF A;  3IV6 A;  3AB5 A;  5DPW A;  4YMM A;  3RMK C;  1X9W A;  3MAB A;  2BCR A;  2AX5 A;  5DKW A;  3ISB A;  1BGX T;  2UU7 A;  3EFC A;  4RPY A;  2WDV B;  1WJ4 A;  1F2R I;  4ZRP A;  5HFY A;  4Q8E A;  2M4N A;  4EZK A;  3SFE B;  3NZU A;  4PL1 A;  4O5K A;  4ASW C;  5EE0 A;  5DBC A;  2D6F C;  2RDG A;  4Y2S A;  1TE2 A;  2RHF A;  4QZC A;  5L95 C;  3OLM D;  4AP4 C;  4AUQ C;  3UQA A;  1YN4 A;  4HKQ A;  3RFA A;  3UPQ A;  2IOF K;  2F8L A;  3C5F A;  4IG7 B;  1A6S A;  3BJY A;  2QB0 B;  4Z6D A;  1WX8 A;  2WFA A;  2JHD A;  4RGO S;  1NYR A;  3MFG A;  4KMO B;  3B0X A;  3L3F X;  4PYZ A;  3TL5 A;  2GBN A;  3NZS A;  4YXD B;  3EEC A;  4LJP B;  5E6J A;  4EKU A;  3C8Y A;  3IBE A;  1WE6 A;  4FBJ B;  4O3Q A;  2JEG A;  2DPJ A;  1KRH A;  1AQ6 A;  2AQ3 B;  5BMG A;  3AMZ A;  2KAC A;  4NLK A;  2M17 A;  2LGX A;  2OM6 A;  7ICE A;  2ZEQ A;  2JXJ A;  1U47 A;  5BYQ A;  5IIM A;  3ETL A;  4PGQ A;  3MFH A;  3GE8 C;  1SL0 A;  5IOI A;  5D6J B;  2G06 A;  3Q8R B;  4LLG M;  3BS5 A;  1QSY A;  1I4R A;  1ZGU B;  2O6V A;  2JYE A;  3BQ7 A;  1UHU A;  4EUT A;  4LTU A;  4O5E A;  3ZJV A;  4BWJ A;  3FDS A;  1X40 A;  2AQ1 B;  3IAS 1;  1MC8 A;  1V5O A;  4QZE A;  4JWU C;  3QHT A;  1FEZ A;  5AKH A;  4HRO A;  4GXJ A;  1PUZ A;  3HPO A;  4ED7 A;  5JZE B;  4ED1 A;  1ZD3 A;  3RR7 A;  4FJV B;  4IDI A;  4QZA A;  1RXV A;  2W8K A;  5D46 A;  1K1S A;  4R3D A;  2WGS A;  3TUO A;  2Z8L A;  1Z00 B;  3GFK B;  5ALJ A;  2KTF A;  1X6I A;  2DFL A;  3W5V B;  1DOY A;  5CHF A;  3CSF A;  2K39 A;  5GMV A;  4P4O A;  3C0R B;  4QAY A;  2MQJ A;  3NVZ A;  1XQQ A;  3PRZ A;  3CWI A;  2NS5 A;  3NVY A;  3ISD A;  1SL2 A;  1ZW7 A;  3UQ0 A;  2VA3 A;  4ICA A;  1SXE A;  1KF6 B;  2H89 B;  2UWQ A;  3UIN B;  5C0Y A;  2R2O A;  4ZDV A;  1SV0 A;  2WLB A;  7ICH A;  2LVP A;  4P4M A;  5AI4 A;  1P1A A;  3C2M A;  4ICU A;  4FS2 A;  2I6X A;  3UF8 A;  2LUM A;  5J0O A;  2E6X A;  5ALS A;  3UIO B;  5DDY A;  4YCX A;  3X0W A;  1NKE A;  1EF5 A;  2ZPN A;  4I27 A;  1WXM A;  2MU2 A;  1UA0 A;  2P6U A;  2ZZP B;  1F0Z A;  2QAR B;  2G1E A;  1ZKH A;  5EE3 A;  3ML9 A;  2QCZ A;  2WXQ A;  2YVC A;  5CWR A;  1GB4 A;  1V9P A;  2OJR A;  4Y2R A;  3ZLZ A;  3QUT A;  2WF5 A;  2UVU A;  4ECT A;  4I6L B;  2Y9U A;  4MF8 A;  1NVI D;  2ZJD A;  4WJO A;  1XXG A;  4FUL A;  1T94 A;  1SZP A;  2FIF A;  2L3Z A;  1WM3 A;  7ICK A;  3ZDD A;  1FD6 A;  4EBD A;  2D10 A;  3P2B A;  3QC8 B;  5DPT A;  3CRX A;  1Z1V A;  2XGQ A;  4OJ6 A;  5AKX A;  3UXP A;  5HHI A;  4B9T A;  4AQ7 A;  1MSW D;  5T8I A;  1HIW A;  1ZQP A;  1C76 A;  4J3O D;  4TUP A;  2LI5 A;  1TJE A;  2KK0 A;  4NJ7 A;  3RZF A;  4US9 A;  1S77 D;  2PE9 A;  4K7U A;  4PJ0 U;  1F77 A;  2HHU A;  2CJN A;  1GC7 A;  3V7J A;  4C8M A;  2DF4 B;  1E7P B;  5DLG A;  3H8H A;  4KIK B;  4CF4 A;  4DF8 A;  2IGD A;  2DZI A;  1IGD A;  4C7Z A;  3KKA A;  1HTQ A;  1T5X D;  2K8C B;  1UEL A;  4J9S A;  2K89 A;  1X9X A;  1J7A A;  1VJK A;  4QZG A;  5JU5 A;  1S10 A;  1F44 A;  1WUD A;  2W3S A;  4DFM A;  1ZQW A;  1X9S A;  1ZXH A;  3AE2 B;  3GOE A;  4TKN A;  3MC8 A;  3U30 A;  5G55 A;  4CF3 A;  5CA7 A;  1VZ8 A;  4PHD A;  3PHX B;  3APC A;  3BWU D;  4AYB F;  5KFS A;  9ICC A;  1SZH A;  4I2E A;  2L1A A;  4XDD A;  1UF0 A;  4A8X C;  2QIL A;  1QKZ A;  2Y0S C;  3RJK A;  3GE3 C;  4RGN A;  5E6O A;  5C23 A;  2KO3 A;  3SD7 A;  4E71 A;  3KUD B;  1LFD A;  5BPC A;  3ZDM C;  1M94 A;  3Q8E A;  2R18 A;  1K50 A;  8ICF A;  4QIW F;  1RYS A;  2LXA A;  4DQP A;  3PW5 A;  4KLT A;  4HPP A;  3T3N A;  3N28 A;  2JZ3 B;  5DQH A;  4MM3 A;  2NMQ A;  3DVN V;  3A1Q B;  1KL9 A;  2N9E B;  4B0M A;  3QZ8 A;  1DXS A;  3IDW A;  3LVV A;  3HKZ F;  1KFS A;  2W04 A;  1D5M C;  1PVP A;  2L5Y A;  4UB3 A;  1UD7 A;  5G5H A;  3HWT A;  1D8Y A;  4IQV A;  3NRW A;  2YY6 A;  3PT2 B;  3PZ7 A;  2BPG A;  3RH4 A;  2ZPY A;  8ICE A;  4J9N A;  4RQ6 A;  1UT8 A;  3N32 A;  1UGM A;  1RM6 C;  4LJX A;  1XSL A;  1I4G A;  3PGE A;  1L2N A;  2BYT A;  1TAQ A;  5DPS A;  3W1S C;  4DF4 A;  3NUQ A;  3L16 A;  3MJW A;  4KLD A;  3QK0 A;  4KLJ A;  4ECS A;  1WJU A;  2JH1 A;  8ICR A;  4L2Y A;  1C9F A;  5III A;  3KZI U;  1MFW A;  3A9K B;  3JPS A;  3ALB A;  4M9J A;  4H2A A;  4F3O A;  1PK3 A;  8ICO A;  5ALM A;  1J0G A;  4UAS A;  5AI0 A;  2AHO B;  3BDP A;  4RT3 A;  1FXT B;  1WJN A;  1KLV A;  5DLF A;  3N1Z C;  4LNK A;  4BWM A;  1MJD A;  2CU1 A;  2K4E A;  3D2N A;  4IQU A;  4QZ8 A;  1FCC C;  4W9I A;  3Q3N C;  3QCA A;  4JX1 C;  4RQ5 A;  4EYH B;  4O3P A;  1TAM A;  3Q8K A;  8ICM A;  4QWC A;  3G6X A;  4HKZ E;  5IIK A;  1R4N I;  2BWF A;  2K22 A;  2LM1 A;  2K8H A;  3RBE A;  2H88 B;  2BCQ A;  3RAX A;  3WKE A;  5KFW A;  4OJP A;  2A3V A;  4CE6 A;  2ZTD A;  1SJH D;  3E58 A;  5HHH A;  1XC9 A;  3M9M B;  4ICV A;  3Q8A A;  3TEX A;  1IBX B;  2H3Z A;  2FPM A;  5DB8 A;  2K8B A;  2QDF A;  1FRR A;  3IXS A;  3VTV A;  4E3C A;  3IAM 1;  1L7P A;  1STE A;  4EEK A;  1V49 A;  3NVV A;  3OSP A;  1Q10 A;  3EGR A;  1QQ5 A;  1VD2 A;  2BQR A;  2J52 A;  3DWM A;  1RPL A;  1D8L A;  3LYS A;  1B0X A;  1S0N A;  4GDK A;  3FM9 A;  2WWZ A;  3T5K A;  4IM0 A;  3E9S A;  2NPT A;  9ICR A;  5H2F U;  1SE9 A;  5FR3 A;  3MDA A;  4PL2 A;  2D3G A;  1SKW A;  1L3V A;  8ICH A;  4WAF A;  4PS7 A;  4J9P A;  3TBL D;  2L32 A;  4B95 A;  2OHF A;  2QJL A;  1ZQJ A;  4I2J A;  1LV5 A;  5BO4 B;  4R63 A;  4BZA A;  5ALK A;  1OFF A;  1PYW D;  1HUO A;  1ET6 A;  4GMV A;  1T6B X;  4MSQ B;  3KW5 B;  3BVM A;  1RFA A;  1HEK A;  3I5J C;  4C4R A;  4DHJ D;  4UB2 A;  1I4P A;  2KD0 A;  5JRT A;  2NO4 A;  4F71 A;  5KFN A;  2AQ4 A;  1E9M A;  2JYT A;  5J2C A;  2KDE B;  4NJC A;  4MFA A;  3RR8 A;  4UB1 A;  4XA5 A;  8ICY A;  4TQ0 A;  2J53 A;  2LVO A;  3Q8S B;  1JN3 A;  4QWD A;  2K60 A;  5I4D A;  3SMV A;  1EXN A;  2ES6 A;  1NBF C;  4R8U A;  1ZQQ A;  2YMP A;  5IP4 D;  3QWZ B;  3H0R B;  2NRV A;  3FC4 A;  4C8K A;  5J0Q A;  3NGD A;  1JXL A;  2PMV A;  3ZDA A;  1RXW A;  1NZP A;  5L9X A;  2Q0Z X;  7ICL A;  1RWS A;  2GBR A;  1F5S A;  1TIF A;  2RD0 A;  2D07 B;  1ZD4 A;  5KTQ A;  1J8C A;  3ZIM A;  2FDR A;  4P0P A;  3AEB B;  4I2B A;  5CX3 A;  1UBQ A;  1KLG D;  4ECU A;  3V7K A;  4C8N A;  2HDE A;  4HCN B;  2BYV E;  1O08 A;  2PLP A;  4ZYN A;  1VRA B;  2BBC A;  5KHQ A;  3OSN A;  3JPQ A;  1TK5 A;  2E1F A;  3TKA A;  3AN1 A;  4MJS B;  1TKY A;  1XT9 B;  2K0P A;  5E6N A;  4I2D A;  3C23 A;  5KFQ A;  1D5X C;  7ICM A;  3P4Q B;  2B76 B;  2K4H A;  4NQL B;  1WM2 A;  2C60 A;  5LLI A;  5EWF A;  2AJQ A;  4B0E A;  4R65 A;  9ICH A;  9ICB A;  5KAF U;  2KFJ A;  1C3T A;  9ICI A;  1LXD A;  3SV3 A;  1UBI A;  2AQ2 B;  1Q5W B;  1ZOY B;  4I28 A;  5F9N A;  4O1N A;  3VCB A;  2FMQ A;  3HP6 A;  2IO1 B;  2ZIU A;  3C21 A;  2LKY A;  5ALY A;  2KDB A;  2LWP A;  2Z7J A;  3ISC A;  3AEA B;  3QU5 A;  4OD0 A;  3Q8B A;  2GOW A;  3MGV A;  1UT5 A;  3GV8 B;  5KG5 A;  4UW9 A;  2ODG A;  3GII A;  3OWE B;  1KFT A;  3LDA A;  2KZM A;  2JEF A;  5KFM A;  1MI0 A;  2C7H A;  3C1Z A;  1D5Z C;  1IM4 A;  4J03 A;  1HQR D;  2GH1 A;  4WQM A;  1K53 A;  4PHP A;  1OUQ A;  2L05 A;  2G45 B;  2ZJA A;  2WXP A;  1C20 A;  1BPB A;  1JWB D;  2RDJ A;  2ZVN A;  1CRX A;  5CHV C;  1N5W A;  4MEL A;  3MR5 A;  2J0J A;  5KFZ A;  5ALP A;  1SL1 A;  1UQV A;  3PSI A;  1U45 A;  1CK1 A;  2M0N A;  4UB6 U;  4JV0 A;  2KSO B;  4FBT A;  1WGH A;  5AK4 A;  2ZTC A;  1NK8 A;  3TEZ A;  4ECR A;  4JGH B;  2XIC A;  3QEB Z;  4ELV A;  4K7S A;  3C1Y A;  3PV1 A;  4RUC A;  4OZC A;  5D3I B;  4UDU C;  1F9J A;  2REX A;  1ZQV A;  4YMN A;  5J2A A;  4P1C C;  2JGA A;  2ZIV A;  3M9O B;  2KWU B;  1NJW A;  2HBJ A;  1WI0 A;  2QB1 A;  2NTT A;  4B9L A;  1Q1O A;  2FE8 A;  2KJ8 A;  1PGA A;  5HHD G;  2DNF A;  3RT3 B;  4QW8 A;  2HOQ A;  4W9E A;  2A19 A;  1COK A;  4QZI A;  5HP4 A;  1ISN A;  2Z59 B;  3ENE A;  1DOQ A;  4WWP A;  4GGQ A;  5DGB A;  1BPZ A;  1T3Q A;  1U4B A;  1TKD A;  2HE7 A;  1V97 A;  2N7J A;  5CRX A;  1KEJ A;  3P4P B;  4GDL A;  2BS3 B;  1TFR A;  4JMU A;  4K4G A;  4IL6 U;  1Z5S B;  3H40 A;  5ALR A;  2JEJ A;  7ICP A;  2DUY A;  1J97 A;  1ZP0 B;  5DB6 A;  2NCN A;  2JWZ A;  3VDZ A;  4FAD A;  2ZCC A;  3RD2 A;  1UUP A;  5KFA A;  2LRU A;  2ZG6 A;  1E7U A;  5DG7 A;  3P63 A;  4KLS A;  4ANV A;  1BML C;  3EZ5 A;  2N9X A;  2RPQ A;  4X57 B;  3EPI A;  1I4X A;  1L6V A;  2KTR A;  1UCV A;  3BS5 B;  3D32 A;  3DVG X;  1TK0 A;  2O6V B;  4BDP A;  5C2T B;  3H4D A;  2C28 A;  4BGD A;  2WU5 B;  3ONN A;  1L6N A;  1ZJM A;  1WR1 A;  2LHE A;  4NXZ A;  4XDC A;  3DBL B;  1HZ6 A;  5KG6 A;  1JWS D;  2JV3 A;  4MDK E;  2HW3 A;  3L0W B;  4RQN A;  2AGO A;  3K9O B;  3AED B;  2MJE A;  3NUH B;  4WWN A;  5FKA C;  4TV3 A;  1YJ1 A;  2DYO A;  4Y2U A;  3C2K A;  1NOM A;  4DQI A;  2I1J A;  3C28 A;  8ICL A;  2TSS A;  5BYR A;  2KDI A;  5HR6 A;  4OJ5 A;  2LGY A;  4DFD A;  2XEW A;  9ICO A;  5J2E A;  4F5P A;  1OEY J;  5L1I A;  3AE8 B;  2JF5 A;  2V1Y A;  4GN1 A;  3AUO A;  2BPF A;  3L4P A;  4GIB A;  9ICT A;  1TS2 A;  4N58 A;  1C4A A;  1C79 A;  2KEY A;  2KIV A;  2FBW B;  3TSS A;  4YQW A;  4DSI A;  3NJT A;  2H3V A;  2MWS B;  4IRK A;  2RR9 A;  3FKY A;  2MAX A;  2HBL A;  3TFR A;  2YMM A;  2KK8 A;  3W9C B;  1RRB A;  3BIN A;  4KLM A;  1EU3 A;  3QX7 A;  2PPH A;  5AKK A;  2UVR A;  5C5J A;  1IGC A;  5KFU A;  3KZX A;  1XO1 A;  2BR0 A;  2QSD A;  4N9F 4;  3W1S A;  2DPI A;  3TFS A;  4GLS C;  1UPH A;  3C29 A;  2IBK A;  2SAK A;  4REZ A;  4HVB A;  5JTI A;  4XGA B;  1WMH A;  4KLH A;  4MFC A;  4L23 A;  1MHX A;  3QQ8 B;  2FPL A;  5ALV A;  2WX1 A;  4OHJ A;  3PPA A;  4FO6 A;  3H7P A;  2KFZ A;  1D3Z A;  2H3Q A;  1BNP A;  4RPX A;  2FUH B;  2WAQ C;  2V3N A;  3A9J A;  4KX5 A;  4M8M A;  2OWO A;  4Z6F A;  4DXF A;  4URK A;  2FLL A;  5AI5 A;  1XO3 A;  3RRG A;  3F53 A;  2F77 X;  4KZ0 A;  5EWE A;  3J9C A;  2EKE C;  8ICU A;  5IIO A;  3AE7 B;  4Y2X A;  1A77 A;  3RCZ A;  3ZTC A;  1RAX A;  3AU4 A;  5KG0 A;  4TSS A;  3TJP A;  2QHO A;  4K4I A;  3KWV A;  4K7W A;  2AXT U;  5J0W A;  1ZE3 D;  2JY6 A;  7ICS A;  2KG5 A;  2FNJ B;  1I42 A;  2W9C A;  2W03 A;  3B0A A;  4KDI C;  4PS8 A;  3RNA C;  1ZQX A;  2KVS A;  3DHG C;  4PYU A;  1S0M A;  4ED8 A;  3QYP A;  3IHP C;  3N3K B;  4K1R B;  4C4S A;  4HJK A;  1JIH A;  2JZB A;  1GAQ B;  4FBU A;  3KUZ A;  4E0D A;  2LXC A;  4RT2 A;  1T0R C;  1ZQF A;  3SD5 A;  4IQT A;  3AEV A;  1BUI C;  2R8J A;  1SIJ A;  2JMG A;  1PK1 A;  3M9N B;  3UQB A;  1B1Z A;  2NYV A;  4J9O A;  1V1O A;  7ICN A;  4DQR A;  1AYF A;  2WDR B;  3IT6 B;  3WK8 A;  3MFI A;  2PXI A;  2CRX A;  3BVZ A;  3IRU A;  7ICJ A;  3ZNI D;  1H4R A;  1ZQZ A;  5MPO A;  4CRX A;  2BCS A;  1WYW B;  2E3T A;  4BKS D;  8ICB A;  3WAO A;  3KHR A;  3VR9 B;  4M8N A;  1S3S G;  5TZV A;  1FRD A;  3SDL C;  2N7E A;  4Q44 A;  5DDM A;  2NV3 A;  3AH7 A;  5KFX A;  3DBH I;  2MBO A;  4MM3 B;  2KMA A;  1K1Q A;  1Y88 A;  4EEW A;  3U4E G;  3SQI A;  2IHN A;  2UVW A;  4F72 A;  2F1I A;  2NTS A;  2CR5 A;  2DWQ A;  1LB2 B;  4P0Q A;  3AEF B;  3KYD D;  3KTQ A;  1QSS A;  5AKG A;  3QZ7 A;  5AM1 A;  4M9N A;  1JWA D;  2XC9 A;  2CHZ A;  4GXB A;  3Q8F A;  4I6N B;  3RF9 A;  4I2C A;  5G2N A;  1KW4 A;  5ALU A;  4O3S A;  4B9K A;  2MSN A;  4QZD A;  2DQN B;  2XO7 A;  4RF1 A;  4I2A A;  4UB5 A;  2LJI A;  1LVH A;  4DQS A;  2KNJ A;  1QLN A;  3VXW A;  5AM2 A;  4RQ8 A;  3MGH A;  3RAQ A;  1V6E A;  2CJO A;  3GZN B;  2KJ5 A;  5CP2 A;  4BVU C;  3EC8 A;  4M00 A;  3MBY A;  3W5U B;  2A5U A;  2HVH A;  4EE2 A;  3EWA A;  4P2H A;  1SKS A;  4NV0 A;  3PX6 A;  1WX9 A;  1LKY A;  3LWL A;  2LGD A;  3I1Y A;  2ASL A;  1S0O A;  9ICL A;  2DHZ A;  1DOI A;  1DGJ A;  1IYF A;  4DSK A;  3FYH A;  4F4W A;  9ICF A;  1WE7 A;  1HZ5 A;  4HYK A;  2MBE A;  4JUZ A;  4KSL C;  4YR2 A;  2KIW A;  2EAP A;  1L7O A;  4M6W A;  5J2J A;  4F2S A;  1LM8 B;  5CHW A;  4JWN A;  1SE2 A;  4QIW C;  5ALO A;  2J0M A;  3C2L A;  4RF0 A;  4BXO A;  2KLG A;  3AE5 B;  2CXY A;  5AIB A;  3PV8 A;  4O3M A;  1GJZ A;  2L00 B;  4PGY A;  3RUL A;  1UH6 A;  5AI6 A;  4ZH4 A;  1DK2 A;  3N30 A;  4KLL A;  2I1K A;  2W11 A;  2EKI A;  5KFT A;  4O3R A;  2XY6 A;  4ZHP A;  4UAY A;  1ZOL A;  3SYZ A;  2G4D B;  2KWD A;  1NZB A;  2K8B B;  4UAV A;  1L7Y A;  1Q8K A;  3O65 B;  2QC8 A;  3R2T A;  4DLG A;  1UZX B;  2MJ3 A;  1R4M B;  7ICF A;  2W54 A;  3TQ1 A;  1KM7 A;  1BT0 A;  1N2X A;  3DWG C;  4Y2Y A;  3AEE B;  5AZF A;  3DVG Y;  1BVS A;  4KV2 A;  3VRB B;  1V86 A;  3FAH A;  4GDK B;  3I28 A;  5DBA A;  2WB1 F;  4EBE A;  9ICV A;  1FXA A;  2JT4 B;  3Q6B A;  4NPN A;  3QUQ A;  4LZG A;  2V9H A;  5J0S A;  1NEK B;  2R61 A;  5EE9 A;  2QMT A;  1HE8 A;  2AL6 A;  2AL3 A;  2WS3 B;  1NK4 A;  4A90 A;  2E8M A;  2FMS A;  1SWV A;  2EZX A;  3ZVV A;  2DX5 B;  2PFQ A;  1NK7 A;  2V4Q A;  2C7N B;  4LNI A;  5D4B A;  2LM4 A;  3AE3 B;  3EHV A;  4O9M A;  2H5X A;  4ECY A;  1ZET A;  4B6J A;  3M63 B;  3PZ8 A;  3Q69 A;  2KKV A;  4DDI D;  4KLI A;  4GC6 A;  2IJ0 A;  1IIP A;  1N62 A;  2ATL A;  2NRT A;  2ZTE A;  2AGP A;  2JEI A;  2KV2 A;  4WJ3 B;  4YSZ B;  2L8J A;  1P7D A;  3CF6 E;  4XWT A;  2OXO A;  3CNH A;  3HVZ A;  1E10 A;  2YB1 A;  2OH2 A;  2ASJ A;  2VAN A;  4BKT A;  3AXC A;  2HBK A;  4PZO A;  3MHZ A;  4R8U B;  1SWW A;  3IG3 A;  3V6H A;  3Q8P B;  5TSS A;  2OCE A;  4XUS A;  2E1E A;  5J0T A;  5J2K A;  2MBB B;  2Y5B B;  7ICR A;  4W9D A;  2C2R A;  3L54 A;  2D3D A;  3KOO A;  3V6K A;  2MH7 A;  2KX0 A;  1ET9 A;  5DQI A;  1U48 A;  1A5R A;  2N7D A;  5JXV A;  3D2Q A;  2LUE A;  4P0P B;  2XVT A;  2IO2 B;  2KMD A;  5HNK A;  1S8O A;  4WJQ A;  4GB9 A;  1CI4 A;  1ZYQ A;  1VZ6 A;  1X2I A;  1FNW A;  3MC9 A;  9ICX A;  3WKC A;  5J2G A;  2QLT A;  2VH1 A;  1QSL A;  2ZIW A;  4M0W A;  2YML A;  4ACO A;  1SF0 A;  1XF5 L;  2NVU I;  3KVF B;  1WWV A;  5D3D A;  3ETR A;  2HJ8 A;  2K9X A;  4ECQ A;  4XE0 A;  1VJ5 A;  5KG4 A;  2J6T A;  4GLX A;  1WG8 A;  2KWC A;  4JPS A;  1MPE A;  4FE3 A;  3SZ2 A;  5DB9 A;  5BOL A;  2JX5 A;  4ZRK A;  4A55 A;  1Z1B A;  2AH5 A;  1WXA A;  2AU0 A;  3OG5 A;  1E8Z A;  3PSP A;  5KL1 B;  3RJF A;  3NY5 A;  4D2K A;  3RH6 A;  5L1L A;  5AZG A;  3R9K A;  3N20 C;  3UXO A;  4HDO A;  4ZOH C;  5ALL A;  1YJI A;  3V6J A;  2UVV A;  5ALI A;  5KT6 A;  5KT5 A;  2ZIU B;  2DGZ A;  4IR1 A;  1XNS A;  1RYJ A;  4OW0 A;  3VQI A;  4ZYS A;  1B9R A;  3BK1 A;  4MH8 A;  5DCN A;  3V6C B;  2ZXI A;  1D9D A;  4DSF A;  2D8C A;  2FCN A;  2YB4 A;  3U2S C;  1J2N A;  2BS4 B;  1OQY A;  3AQE A;  7ICI A;  3SU8 X;  4G3I A;  4U6P A;  4IW0 A;  3BQ2 A;  2K8A A;  1YOV B;  1E6E B;  2GB1 A;  3R66 C;  3WK9 A;  2Y5P A;  4ZHO A;  1ZDX A;  2KDM A;  4I29 A;  1FXI A;  5AKJ A;  1E5W A;  1MG8 A;  3ZNZ B;  4AOF A;  3BQT A;  1V9J A;  3WCQ A;  2W3R A;  3PW2 A;  4QWE A;  1RFK A;  1WRD B;  2AWT A;  4JK1 A;  2HHX A;  3OAW A;  3V60 A;  3GU3 A;  3F2B A;  5J8Y C;  3TAR A;  1GNU A;  5BMH A;  3ZJT A;  1V8C A;  4U7C A;  4F93 B;  1V80 A;  2ESE A;  1NEN B;  2PEA A;  4CYE A;  5LXI B;  1ZQE A;  1YD8 U;  4YN4 A;  3MC1 A;  4ZRI A;  2Y3A A;  3ZO5 B;  3PHW B;  4N6E B;  1OXJ A;  2EZY A;  2KLC A;  2B3A A;  3UXN A;  1AWD A;  2E8P A;  2KC1 A;  3AE6 B;  5IKC M;  5C1Z A;  3WKD A;  4M9G A;  2ZIV B;  1QZE A;  3QUC A;  4FHJ A;  4KGR A;  2KDF B;  3VH3 B;  1PVR A;  5B5E U;  2BDP A;  2EAM A;  1YQ3 B;  1Y56 A;  4MHV A;  1TGZ B;  4DL7 A;  1ZQN A;  5D7G A;  1EF1 A;  1VZ7 A;  1FNV A;  4QWB A;  5CJ7 A;  1B43 A;  1TKE A;  3RNG C;  3R8B A;  2D3A A;  4RQ1 A;  1WZ3 A;  3IFW B;  4TMA B;  2W82 A;  2D3C A;  4F5R A;  4JV1 A;  4A20 A;  4GDL B;  1Q3V A;  2RPV A;  3FIL A;  3RRH A;  2WP9 B;  3K9P B;  7ICQ A;  4NAM A;  3AU6 A;  4A9A A;  2PFO A;  1HUZ A;  2W9B A;  2LMR A;  1R7S A;  2PW9 A;  4FXC A;  1ED1 A;  4UAR A;  4YD1 A;  2EDU A;  1TYG B;  2INN E;  4DFP A;  1NK0 A;  2BQQ A;  3RI7 C;  3PTF C;  3ZGZ A;  4XQ8 A;  1RZT A;  2XID A;  2Q4T A;  7ICO A;  2KTR B;  5IAA C;  3WKB A;  4EX7 A;  3RB6 A;  5KFF A;  3BVG A;  2BPS A;  4C4V A;  4NM2 A;  4DK5 A;  4YWG G;  4YMO A;  4B9S A;  2F44 A;  5AKI A;  3U26 A;  4KGT A;  4DWF A;  2VZK B;  2K4I A;  3QXG A;  4NNJ B;  5ALD A;  1N61 A;  4J9M A;  5LNK 1;  3LYY A;  4I6P A;  4LDT D;  4LNO A;  3B2F A;  5KFY A;  2MCN B;  1F2R C;  3AUL A;  3WK7 A;  2FI1 A;  1TS3 A;  3IG8 A;  3W1Y A;  1P9D U;  1JRU A;  1QOB A;  3RYT A;  3RB0 A;  1L3S A;  4DWI A;  4NZL B;  2BGW A;  2GOL A;  1BPE A;  2I5H A;  1WWU A;  4F8R A;  4ACF A;  8ICT A;  2R8G A;  4XRH A;  4IOI E;  4HPM B;  1IP9 A;  4KX3 A;  4J9K A;  3H8S A;  2G09 A;  2XCA A;  1ZQT A;  3HX0 A;  4IR9 A;  2N9P C;  4ECV A;  1X1M A;  5J0Y A;  2BCV A;  4OVV A;  2RRD A;  4KSK C;  2VA8 A;  5T14 A;  2C7M B;  4RCO A;  4DSE A;  4QZ9 A;  2FMP A;  2WDT B;  2HSZ A;  1LQB A;  1WWT A;  1QH9 A;  2HDO A;  1ZRM A;  4NWI A;  5TIS U;  3TI0 A;  2XBB C;  4YTN B;  3GV7 B;  4W9L A;  3IM1 A;  3HHM A;  5HKH A;  5AM5 A;  1ZQU A;  5KG2 A;  4P4P A;  2ISO A;  2HTM E;  2MBQ A;  4HCP B;  4HDQ A;  1E8Y A;  4KGS A;  4P16 A;  3RJI A;  4WUR A;  3V6E B;  1WMH B;  4BKS A;  2M8S A;  2AQ0 A;  4RQ7 A;  2SEB D;  2MRL A;  4ARI A;  3H7P B;  4NLB A;  1X66 A;  2LMC A;  2KP7 A;  2LGS A;  3N7R C;  3RTV A;  3A9J B;  3ZDC A;  3PRM B;  3H0L B;  2ZNV C;  3TAQ A;  2WXM A;  5LXH A;  2KHQ A;  2W55 A;  2NBU A;  3UQ2 A;  2BQU A;  3ZRC A;  1L4D B;  3DVN U;  2EAN A;  5AKZ A;  2R8K A;  1N63 A;  3TEW A;  4GIV A;  2HBM A;  2OYY A;  4MF2 A;  2FCM A;  1R4M I;  3LXF A;  2KXJ A;  3SAG A;  4OVZ A;  3BZK A;  2NBV B;  3NG0 A;  4KLE A;  3DDC B;  4BBN C;  3PZD A;  5CHG A;  4ARC A;  2KJ6 A;  1ZQI A;  4F4X A;  3PSE B;  1OEY A;  2Y9T A;  4MT5 A;  4TUU A;  5AK3 A;  3URY A;  3SEN A;  2W9C B;  4RQ3 A;  1S97 A;  1DGS A;  2RQ5 A;  4GOC A;  2KHV A;  2J7Q B;  4Y2V A;  2YLM A;  4I2F A;  2KMC A;  4LVS A;  5J2R A;  2JZB B;  2F8K A;  2PMZ C;  2BYE A;  3B1L X;  2C5L C;  2BKR B;  2VIX A;  5D94 A;  4W9F A;  1M6Y A;  2GWS A;  4DQQ A;  1CJE A;  4PH5 A;  2BYF A;  1JMS A;  1WRI A;  1A76 A;  1KN5 A;  1PK1 B;  1Z4O A;  4DFJ A;  4RUA A;  1L7N A;  2J4X A;  5D2M B;  2IPK D;  2VH2 A;  1GG3 A;  5AM3 A;  4R66 A;  3PX4 A;  1U49 A;  1WR6 E;  2M19 A;  1L8O A;  4F5Q A;  4RU9 A;  3MP9 A;  3NS8 A;  8ICW A;  1I4H A;  1O03 A;  2W43 A;  1X9M A;  4C8L A;  1SBB B;  2HOF A;  5KFB A;  2FPK A;  2DYM A;  4UAZ A;  2K8C A;  1D4B A;  4QNL A;  4EEN A;  3GDX A;  2XK5 A;  4K81 A;  3BS7 A;  4B9N A;  5AUI A;  2KVC A;  2K25 A;  3VVW B;  3ZXR A;  4PGX A;  1RG6 A;  4C7Y A;  5KFJ A;  3LVW A;  1YT3 A;  1QIL A;  2WF9 A;  2JWU A;  1QQ7 A;  2L7R A;  3Q3F A;  1T0S C;  4OZB A;  4GC7 A;  3PR4 A;  1BNO A;  2R8H A;  4BFR A;  4P0Q B;  3K75 D;  1L0V B;  4DSJ A;  5BOM A;  4C4T A;  3PVX A;  4PT5 A;  4XWW A;  3M62 B;  3H8M A;  1EO6 A;  5KNI A;  4KLG A;  1MQ3 A;  3ZTD A;  1K8R B;  3UMG A;  2ZJ8 A;  3E0F A;  4PZN A;  2IO3 B;  2E5S A;  2OOB B;  2JRI B;  3OJ4 B;  2GLE A;  1P7E A;  5AKY A;  3WK6 A;  4HWI B;  1SSN A;  1D9F A;  3NZ3 A;  1D8B A;  2HHQ A;  3PMN A;  1YX6 B;  3ONS A;  2HJ1 A;  2K3U A;  2B21 A;  4J9Q A;  5CEH A;  2WXH A;  1LKY B;  2G0A A;  2MUT A;  3F5A A;  3ORY A;  2F1H A;  1NK5 A;  4HAI A;  5D49 A;  2EQY A;  4WWO A;  8ICQ A;  9ICG A;  3U7Z A;  2V3S A;  3A4S C;  5AEK B;  2BQ3 A;  2G08 A;  8ICS A;  1ZQH A;  1Z19 A;  2HHT A;  4RH6 A;  5KG3 A;  2WXR A;  3OJ3 A;  4M6W B;  5KFV A;  3PO5 A;  1FM0 D;  3P1M A;  3VFK A;  5J29 A;  1WGR A;  2ZW0 A;  4BXO B;  3M6Z A;  4F1S A;  1CEZ A;  2XY5 A;  1HA5 A;  3APF A;  3F2D A;  3ZI4 A;  5H8Y E;  3BK2 A;  4W9H A;  2R2Q A;  4WQO B;  4AJW A;  2WU2 B;  3A9K A;  3LB8 C;  1N5X A;  4FHK A;  4IWP A;  3RZW C;  4RPZ A;  3GP7 A;  3GQC A;  2WX0 A;  1CMX B;  3QNM A;  4I2H A;  5KFP A;  3OHA A;  3RBD A;  5F9L A;  2FCS A;  3N7P D;  2ISP A;  3B08 A;  2VJ5 A;  3ZRF A;  4OZA A;  1EWC A;  2XI9 A;  2WTF A;  4YL8 A;  2WQY B;  4NLC A;  5AKE A;  3IG5 A;  1GO3 F;  2XNA C;  1FIQ A;  1MHH E;  3R7Q A;  5KG1 A;  1ZQM A;  2KN7 A;  1ZJN A;  2IBI B;  4BUG A;  2MW5 A;  3Q8L A;  3DOW A;  2EEL A;  5ALQ A;  2NO5 A;  4W9K A;  2V4R A;  4USA A;  1WIA A;  4DOC A;  4L1B A;  4DS4 A;  2A1J A;  4DXG A;  3TAC B;  2F76 X;  5GXG B;  7ICU A;  2EMS A;  1PFD A;  1FFU A;  3Q8C A;  2IY1 B;  4W9G A;  4EZL A;  1WXS A;  4IKG A;  5J8Y A;  5AI9 A;  3F5E A;  5ALN A;  1WX7 A;  2DAJ A;  4J9R A;  4ELT A;  3M8S A;  5KFO A;  3TAN A;  2M0A A;  1L0Y B;  4RNA A;  3H1U A;  4ECW A;  2IZV B;  4EFO A;  2INC C;  2N0S B;  4DO9 A;  2LFI A;  4KVG B;  4I2G A;  4RZR A;  1WJ6 A;  4F5O A;  4CQN A;  2G07 A;  1KLU D;  2OED A;  1EWY C;  4MGI E;  4KMU A;  2LD9 A;  1L0X B;  1SV4 A;  1J19 A;  5AI8 A;  1ZQO A;  1DYQ A;  9ICS A;  1J2M A;  1KLN A;  4G0N B;  3VH4 B;  3PY8 A;  2HVI A;  2GLS A;  3RNB C;  2JRZ A;  1FFV A;  4ELU A;  1ZD2 P;  5DG9 A;  4CF5 A;  4OJO A;  4EEY A;  3H7S A;  1NJX A;  1FCL A;  3DV9 A;  3RNE C;  1V1P A;  2KZZ A;  4FJY A;  1T0Q C;  3NHE B;  2FAZ A;  3LDZ E;  3DBR B;  3M6K A;  1ACC A;  1ZQB A;  4LNN A;  4MFF A;  4F4Y A;  2GBM A;  1XCQ L;  4G50 A;  1OQQ A;  3E2E A;  1L3U A;  1NDD A;  2WXN A;  2ZIW B;  2M1M A;  1SGG A;  4M0W B;  3RN9 C;  1XLQ A;  2H3F A;  1OTR B;  2BVC A;  2PJH A;  2NR2 A;  1RYR A;  4HEA 1;  4RFB A;  3GIM A;  5KFK A;  1C78 A;  4M01 A;  1JRO A;  1HEZ E;  5IIL A;  4I2I A;  9ICP A;  1I4Q A;  2JSV X;  3AV8 A;  1YQ4 B;  5KG7 A;  5ALF A;  1YMH E;  3SHQ A;  3JPN A;  1CQV A;  3QUB A;  3SI8 A;  4MGK E;  4YTP B;  3VC8 A;  1B4F A;  5C3J B;  5G5G A;  1TK8 A;  3IVF A;  1L8L A;  4BOS C;  3VUY A;  2C2E A;  1U4A A;  3EUB 2;  2ASD A;  4GXK A;  1NI2 A;  1XEE A;  2FID A;  2JVC A;  3X23 A;  3QU9 A;  2EH9 A;  3TMP B;  3BY4 B;  4BKG A;  4EX6 A;  1P0R A;  3MHS D;  3M95 A;  3VTW A;  5H92 C;  1QCK A;  4Z6C A;  2N1V A;  4HLE A;  3R7R A;  1PZN A;  1ZD5 A;  4AS1 A;  5J0U A;  4N59 A;  1DRG A;  5JH5 C;  3EPG A;  4K3C A;  2F2A B;  4BAX A;  3UIP B;  4B9V A;  4Q8F A;  9ICW A;  5ALE A;  3Q2A C;  1WCL A;  3LJ3 A;  1WGY A;  3K4G A;  1KTK A;  1ZQL A;  2PKE A;  4B6W A;  5AIC A;  3Q8M A;  3WAM A;  5AK5 A;  2CU3 A;  3MR3 A;  8ICP A;  2J6S A;  1PUT A;  2D5G A;  2EMT A;  3ZDE A;  2HTH A;  1QF6 A;  1TTN A;  2M56 B;  2QKQ A;  4KN7 A;  1GC6 A;  3MTN B;  3HIZ A;  3JSV A;  5ALW A;  1BPD A;  2MP2 A;  3V62 A;  3KD3 A;  5KAI U;  5HG2 A;  4TUQ A;  1ESF A;  1SEB D;  3CMM B;  3SEI A;  1XCT L;  1SXT A;  2KTQ A;  5AKL A;  3M3J A;  2NRZ A;  3O13 A;  4NL9 C;  5KT3 A;  2JR5 A;  3HM3 A;  3UMB A;  2WXI A;  5J18 A;  4II2 B;  2KJR A;  4Q2J A;  4ANX A;  5KFL A;  4RMA A;  1KDH A;  3WIM A;  4RQ0 A;  1IG6 A;  3VTU A;  3ZYY X;  3ZD8 A;  2BS2 B;  3BZD B;  9ICE A;  3N1Y C;  4HPL B;  2KQS A;  2O2V A;  4GU2 A;  1SE4 A;  1WY8 A;  2YX8 A;  4F91 B;  3H6N A;  5AUK A;  4M9L A;  4YT0 B;  4AYB C;  3A4R A;  3GIJ A;  2JZZ A;  4EOY A;  4KKJ A;  1V81 A;  4IC7 B;  8ICI A;  4XYC A;  4F7Z A;  3JPR A;  2KFN A;  1ZUD 2;  5AK6 A;  2KKC A;  1D6E C;  4CO7 A;  2V4L A;  5DBB A;  2IOH A;  1IXR A;  3FIL B;  2IHM A;  4WJP A;  3VHT C;  3ZW3 A;  2W9B B;  2DBY A;  2DAF A;  3GS2 A;  1JI7 A;  3AM9 A;  3VUX A;  1MA7 A;  1TZO A;  3I9V 1;  2V0G A;  2BWE S;  2WHE A;  3HKZ C;  3IT4 B;  2GRI A;  3JVZ X;  3WA0 A;  4JWS C;  4QZF A;  3WAN A;  3MGI A;  3L10 B;  4O5C A;  7ICT A;  2I2Y A;  3PNC A;  3BQ1 A;  4C4V B;  4DEZ A;  5BMI A;  3PST A;  1FO4 A;  1C7Y A;  4FZN A;  3WAP A;  1DK3 A;  4C00 A;  4TQ1 A;  3NTU A;  2VJ4 A;  1EU4 A;  3LK9 A;  3T9L A;  2NPT B;  3HT3 A;  3EYZ A;  8ICV A;  2WXF A;  1L3T A;  4JB3 A;  5B66 U;  2K4P A;  4QW9 A;  1TY2 A;  2KJH B;  2J42 A;  1OW5 A;  2BPC A;  3T79 A;  2WAQ F;  1A0P A;  4DL6 A;  3TCA A;  4EZ9 A;  2JUO A;  3QU2 A;  4JQW C;  1S1Q B;  1XU4 A;  3JYU A;  3WK4 A;  1E0Z A;  2NBW B;  2Z0D B;  4G9B A;  2LBO A;  1G6J A;  3HRD D;  2KOX A;  2DYB A;  4NM1 A;  3AE4 B;  3L08 A;  3QEA Z;  3J81 j;  3PW0 A;  4M47 A;  4YSX B;  4UB8 U;  3PO4 A;  1FEH A;  2MEK A;  1P3Q U;  4DLE A;  2ON8 A;  1H38 A;  4US8 A;  2MLB A;  5KT7 A;  1VR9 A;  3ZXV A;  1L7M A;  1XLO A;  1HTO A;  1UA1 A;  2N9L A;  3KWL A;  4YFK A;  5J2I A;  2LYH A;  1NK9 A;  2OEH A;  4NAW A;  1HJP A;  2RP5 A;  1K52 A;  4M02 A;  2DZM A;  2M9N A;  2IGH A;  4PK1 A;  4RM8 A;  2K1F A;  1WCN A;  2ZXH A;  3PX0 A;  4AJY B;  4UBB A;  1NJY A;  1JXE A;  2JH7 A;  1KKX A;  3HJE A;  2KNB A;  3G6Y A;  3PVL A;  1UGJ A;  4DDG D;  4NLZ A;  8ICG A;  4W9C A;  1WXQ A;  4FFD A;  4TQS A;  1KRP A;  5J0X A;  2PFP A;  3DHH C;  4DL2 A;  4E74 A;  3N97 B;  4MGY E;  4RNN A;  1PGX A;  4ED2 A;  3VAW A;  3DBL I;  2PFN A;  2F1J A;  2ZIX A;  4NQK E;  4ANW A;  1WGK A;  1I7H A;  4WH4 A;  5J2B A;  5IIN A;  2JRH A;  2RDB C;  2F3N A;  4QZH A;  2GBJ A;  4ZRQ A;  4GXI A;  1Z2M A;  1T8E A;  5CR0 A;  3CP8 A;  1GOZ A;  2PVO D;  2L83 A;  3PS6 A;  4TUS A;  2VZK D;  4G3X B;  4II3 B;  1Z4N A;  4DL5 A;  1ZQG A;  3DPD A;  1S76 D;  1Z3E B;  3TAP A;  3CW2 C;  3L5K A;  1C4C A;  2AGQ A;  2YTU A;  1ZQD A;  5E79 U;  1COO A;  4C8O A;  1XS9 D;  1OGW A;  3AEG B;  1WGG A;  2ZJ5 A;  2RDH A;  2KT7 A;  4Z6E A;  1YQB A;  4WAA A;  4P7I A;  5KFG A;  5ALH A;  3KQ4 A;  2MBH A;  2HCF A;  1ZQ1 C;  2MJD A;  3PLU A;  4YP3 A;  3GB1 A;  5L1J A;  2JZP A;  2N9K A;  3OHB A;  2H3I A;  2CN1 A;  2KIC A;  2FUG 1;  2XK5 B;  2LHD A;  8ICN A;  2V4I B;  3VUW A;  2RLT A;  1LO5 D;  2K5P A;  1H8C A;  1JW9 D;  2B0C A;  1AN8 A;  3B0Y A;  3DHI C;  3ZNH B;  1MVK A;  1Q0W B;  2LAS A;  5FR6 A;  1SKR A;  4ED6 A;  2E8N A;  2W8L A;  1TV9 A;  1PGB A;  2L52 A;  3U7D A;  2BTE A;  4NY8 A;  2HOI A;  1T4G A;  3ALR A;  2HHS A;  2LGI A;  5FP0 A;  3DBR I;  4KLU A;  4KX6 B;  3K1R B;  4CNQ A;  4ECX A;  3G6V A;  3ZNG C;  1IV8 A;  4YD2 A;  1KTQ A;  1CUK A;  4UAT A;  2NRX A;  3WU2 U;  1XSN A;  2BKE A;  3EA6 A;  3ABV B;  4B9M A;  3H8W A;  1GPX A;  4NY0 A;  4DL3 A;  3T8M A;  4Y2J A;  4UB4 A;  1SIF A;  4W9J A;  2MUT B;  2KFK A;  4FLH A;  1AAR A;  3NOB A;  2MX2 A;  3ZQ4 A;  3AU2 A;  2AEH A;  1FMA D;  2IYD B;  3HW8 A;  2YQE A;  3EW9 A;  5J0R A;  3S2A A;  3H0M B;  2W9A A;  1KBU A;  4IQW A;  4RQ4 A;  3RJJ A;  3QIJ A;  5KL8 B;  3IP4 B;  3RNF C;  2KZ3 A;  2BKF A;  2ZW1 A;  5GTH U;  4A8E A;  5EOZ A;  1E8X A;  5EE1 A;  1T7P A;  3KHL A;  4F5N A;  4MEM A;  3WKA A;  4TUR A;  3Q3M C;  3L13 A;  4DFK A;  2PTL A;  3PRP B;  4F4Z A;  1XD3 B;  2BF8 B;  3Q3J A;  3C5G A;  5HMM A;  3BQ0 A;  3PLV A;  3JPP A;  3M8R A;  3GV5 B;  1OQR A;  4F4K A;  2DLB A;  1SJE D;  4J6I A;  2QB0 A;  3K1Z A;  2PE6 B;  5HR7 A;  3TEY A;  5KFI A;  2N4F A;  2BB6 A;  2BCU A;  1NYQ A; 
#chains in the Genus database with same CATH homology
 3CWI A;  3NVY A;  1JQ4 A;  1FNU A;  1KF6 B;  2H89 B;  2YEP B;  2Q5W D;  1GAQ B;  2BW2 A;  4DQO C;  2WLB A;  1XLN A;  4WWM A;  1P7E A;  4C80 A;  1BUI C;  1SSN A;  4RGM A;  3NZ3 A;  1SIJ A;  2LUM A;  3ZJU A;  2E6X A;  1JML A;  2K3U A;  1B1Z A;  2WXH A;  1V1O A;  2WDR B;  1AYF A;  3IT6 B;  3U7Z A;  3BVZ A;  1F0Z A;  2G1E A;  5MPO A;  5EE3 A;  2E3T A;  2WXQ A;  1GB4 A;  4RH6 A;  3VR9 B;  2WXR A;  1FRD A;  4P6V F;  3P1M A;  1FM0 D;  3AH7 A;  3RFZ B;  1NVI D;  2ZW0 A;  4MM3 B;  1XXG A;  1HA5 A;  5H8Y E;  3BK2 A;  3U4E G;  2WU2 B;  1FD6 A;  3LB8 C;  1N5X A;  2G9H D;  2NTS A;  2PVG C;  2DWQ A;  3AEF B;  2JXT A;  3GP7 A;  4AQ7 A;  1GB1 A;  3P42 A;  5T8I A;  1C76 A;  2RMM A;  4J3O D;  3V05 A;  1TJE A;  1JWA D;  3Q8F A;  4US9 A;  1F77 A;  2CJN A;  1NI3 A;  1UWM A;  1EWC A;  1E7P B;  4OZA A;  3MC0 B;  3H8H A;  2IGD A;  2WQY B;  4RF1 A;  1IGD A;  4C7Z A;  2LJI A;  1T5X D;  1V1P B;  2JQR B;  2XNA C;  1FIQ A;  1MHH E;  1J7A A;  1VJK A;  2CJO A;  4HJG E;  1WSP A;  3NS1 A;  3I57 A;  2W3S A;  1JWM D;  1ZXH A;  3AE2 B;  2KMM A;  3W5U B;  1VZ8 A;  2EEL A;  4EE2 A;  3BWU D;  2L1A A;  2YEP F;  4USA A;  4XDD A;  4A8X C;  1XLP A;  1YNT E;  4L1B A;  2QIL A;  1QKZ A;  4DXG A;  4RGN A;  4A6Q A;  3R2I A;  5GXG B;  1PFD A;  1DOI A;  1DGJ A;  1FFU A;  3B2G A;  1JRP A;  3Q8C A;  3Q8E A;  4IKG A;  1K50 A;  1HZ5 A;  1L5P A;  3T3N A;  2M0A A;  1L0Y B;  1SE2 A;  4RNA A;  4RF0 A;  2NMQ A;  2N0S B;  3AE5 B;  2LFI A;  3U52 E;  4CQN A;  1KLU D;  1TKG A;  2OED A;  4B0M A;  1EWY C;  1L0X B;  1D5M C;  2EKI A;  1DYQ A;  4ZHP A;  5G5H A;  2KWD A;  3R2T A;  1EM7 A;  1FFV A;  2MJ3 A;  3PZ7 A;  2W54 A;  1HXY D;  3DWG C;  3T3O A;  1FCL A;  3AEE B;  1L6U A;  1V1P A;  4JE3 B;  1RM6 C;  1I4G A;  1QQR A;  2BYT A;  3VRB B;  3FAH A;  4GDK B;  2QEJ C;  1DOX A;  1ACC A;  1FXA A;  1XCQ L;  1OQQ A;  2WXN A;  4L2Y A;  1C9F A;  1NEK B;  2R61 A;  1XLQ A;  2QMT A;  5EE9 A;  1TS5 A;  4H2A A;  2WS3 B;  4HEA 1;  4RFB A;  4A90 A;  1C78 A;  1JRO A;  1HEZ E;  1I4Q A;  2JSV X;  3AV8 A;  4HRS A;  1YQ4 B;  1YMH E;  3AE3 B;  1CQV A;  1SE3 A;  3PO0 A;  1FCC C;  3PZ8 A;  3Q69 A;  4YTP B;  5C3J B;  5G5G A;  4ITK A;  4JX1 C;  4LK0 M;  2IJ0 A;  1N62 A;  2BT6 A;  3EUB 2;  2V3P A;  2ICI A;  4HKZ E;  2K22 A;  1XEE A;  2H88 B;  4YSZ B;  4XWT A;  2XN9 C;  3HVZ A;  1E10 A;  3N9Y C;  4C56 C;  1SJH D;  1YJJ A;  3MHZ A;  3CIR B;  3Q8A A;  5H92 C;  3TEX A;  1IBX B;  2INP E;  4AS1 A;  1FRR A;  3IXS A;  2I38 A;  4N59 A;  5TSS A;  3RPF C;  3IAM 1;  1STE A;  3NVV A;  1Q10 A;  2PIA A;  3EGR A;  2J52 A;  3DWM A;  2MH7 A;  1ET9 A;  5JXV A;  3E9S A;  1KTK A;  1VZ6 A;  3V3X A;  3BYT B;  5FR3 A;  1VLB A;  1FNW A;  3B9J A;  3BYY B;  2CU3 A;  4WAF A;  2D5G A;  1PUT A;  2L32 A;  4M0W A;  3NRZ A;  1QF6 A;  2M56 B;  1SF0 A;  1XF5 L;  2OHF A;  2QJL A;  5D3D A;  2JU6 X;  3ETR A;  2WXO A;  2K9X A;  1YN5 A;  4XE0 A;  1J7B A;  5HG2 A;  2WXK A;  1SEB D;  1ESF A;  1OFF A;  1C77 A;  1ET6 A;  1MPE A;  1PYW D;  1T6B X;  1XCT L;  1SXT A;  2JX5 A;  1JCK B;  3BVM A;  4A55 A;  3O13 A;  1I4P A;  2WXI A;  1UNS A;  3AEC B;  1E9M A;  4NJC A;  1KFY B;  2JYT A;  4Q2J A;  4D2K A;  3KLS X;  1JAL A;  1M4V A;  1QT9 A;  4ZOH C;  1YJI A;  4TQ0 A;  3ZYY X;  2BS2 B;  3BZD B;  2J53 A;  1RYJ A;  4OW0 A;  5I4D A;  3VQI A;  4ZYS A;  1SE4 A;  1B9R A;  3BK1 A;  4MH8 A;  1WYG A;  1IBX A;  5AUK A;  1ZDV A;  4YT0 B;  2Y5C A;  1TY0 A;  2WXJ A;  3U2S C;  1TS4 A;  3FC4 A;  3SR6 A;  3HUI A;  4KKJ A;  2BS4 B;  2PMV A;  1RWS A;  2LEK A;  1ZUD 2;  2ACZ B;  1QLB B;  2GB1 A;  1E6E B;  4JPS A;  4ZHO A;  2Y5P A;  3AEB B;  3SFD B;  1ZDX A;  1D6E C;  2KDM A;  1KLG D;  2HDE A;  1FXI A;  3FIL B;  2PLP A;  1VRA B;  2BBC A;  2WDQ B;  3WCQ A;  2W3R A;  3AN1 A;  1RFK A;  1TKY A;  2DBY A;  2KQ4 X;  3GS2 A;  3AM9 A;  4WIP A;  1TZO A;  1BXT A;  2K0P A;  1UWX A;  3I9V 1;  2V0G A;  3AE1 B;  5BMH A;  3IT4 B;  3ZJT A;  1D5X C;  3P4Q B;  2GRI A;  1V8C A;  4JWS C;  2IDY A;  2B76 B;  4NAW B;  5FK9 C;  1NEN B;  1VDV A;  2I2Y A;  1PDX A;  4YSY B;  5BMI A;  4B0E A;  2Y3A A;  1FO4 A;  1ROE A;  4N6E B;  4MAC A;  5HI1 A;  4TQ1 A;  3MJ5 A;  1P7F A;  1EU4 A;  2AQ2 B;  1AWD A;  1QOA A;  3AE6 B;  1ZOY B;  2WXF A;  2WNM A;  4O1N A;  4KGR A;  1TY2 A;  3SEB A;  2J42 A;  3AEA B;  1IUE A;  1YQ3 B;  3P4R B;  3Q8B A;  1Y56 A;  5D7G A;  1VZ7 A;  3OWE B;  1E0Z A;  1FNV A;  1MI0 A;  1TKE A;  4RGT A;  3HRD D;  1D5Z C;  1HQR D;  4WQM A;  3R8B A;  1K51 A;  1K53 A;  3AE4 B;  4TMA B;  1ENF A;  1ZPS A;  2W82 A;  2WXP A;  5BYS A;  4GDL B;  2RPV A;  1JWB D;  3FIL A;  2ONQ A;  2WP9 B;  4NAM A;  4YSX B;  1KH0 A;  4A9A A;  3BII D;  2MEK A;  1FEH A;  1R7S A;  2PW9 A;  1N5W A;  1JWU D;  2KN4 A;  2ON8 A;  2INN E;  2IGG A;  4US8 A;  1TYG B;  1VR9 A;  4FXC A;  3W2D A;  2PKO A;  1XLO A;  2N9L A;  3KWL A;  3ZGZ A;  4KKI A;  1CK1 A;  1CZP A;  1K52 A;  3BVG A;  1AW7 A;  2IGH A;  4YWG G;  3TEZ A;  2KAJ A;  4KGT A;  3HVD A;  2VZK B;  4OZC A;  1N61 A;  5D3I B;  1ZXI A;  5LNK 1;  3LYY A;  4UDU C;  1N60 A;  1UGJ A;  3B2F A;  3VRA B;  2X38 A;  3VR8 B;  1F2R C;  1WXQ A;  1TS3 A;  1QOB A;  2NTT A;  4NZL B;  2FE8 A;  2GI9 A;  4YTM B;  1PGA A;  3P4S B;  5HHD G;  1PGX A;  4IOI E;  2WXL A;  3UI3 A;  1WGK A;  1YN3 A;  3AE9 B;  1I7H A;  4WH4 A;  3E56 A;  1SB3 C;  2QIE B;  4ZRQ A;  1T3Q A;  1A70 A;  1L4Z B;  2WXG A;  1C4P A;  1V97 A;  1GOZ A;  2PVO D;  2L83 A;  4RCO A;  2N7J A;  2VZK D;  1QOG A;  3P4P B;  1C4C A;  1WWT A;  2BS3 B;  1ZP0 B;  4YTN B;  3NVW A;  2BB5 A;  3AEG B;  1UUP A;  1J7C A;  2RDH A;  3P63 A;  4KGS A;  2HTM E;  1BML C;  4P16 A;  4WUR A;  1I4X A;  1L6V A;  1QOF A;  2SEB D;  3KQ4 A;  2MJD A;  4ARI A;  3AB5 A;  2LMC A;  3GB1 A;  5C2T B;  2WU5 B;  2AX5 A;  2LHE A;  2JZP A;  4XDC A;  2N9K A;  2FUG 1;  2WDV B;  1HZ6 A;  1F2R I;  4ZRP A;  2WXM A;  2LHD A;  2W55 A;  5HFY A;  1JWS D;  2V4I B;  1L4D B;  3AED B;  2MJE A;  3NUH B;  1LO5 D;  2K5P A;  5FKA C;  1N63 A;  1JW9 D;  1AN8 A;  3SFE B;  3TEW A;  5EE0 A;  2DYO A;  2RDG A;  1MVK A;  3LXF A;  4OVZ A;  2TSS A;  5BYR A;  1YN4 A;  4HKQ A;  1PGB A;  2L52 A;  4ARC A;  2BTE A;  2LGI A;  3AE8 B;  4MT5 A;  4RGO S;  1NYR A;  3MFG A;  3L4P A;  1TS2 A;  4KX6 B;  4N58 A;  3URY A;  1C4A A;  1C79 A;  2FBW B;  3TSS A;  4YXD B;  5E6J A;  3C8Y A;  3W9C B;  1EU3 A;  1KRH A;  2AQ3 B;  5BMG A;  3AMZ A;  2KAC A;  1CJE A;  3EA6 A;  1IGC A;  1WRI A;  2QSD A;  3ABV B;  3W1S A;  1GPX A;  4GLS C;  2J4X A;  2IPK D;  5BYQ A;  2M19 A;  2SAK A;  4REZ A;  3MP9 A;  4L23 A;  3ZQ4 A;  1MHX A;  1I4H A;  4LLG M;  4OHJ A;  1I4R A;  1SBB B;  1FMA D;  2JYE A;  4LTU A;  3ZJV A;  2DYM A;  2V3N A;  2AQ1 B;  3IAS 1;  1D4B A;  4DXF A;  5AUI A;  4JWU C;  4HRO A;  2ZW1 A;  1XO3 A;  4C7Y A;  4IDI A;  5EE1 A;  1QIL A;  4R3D A;  2JWU A;  3J9C A;  4OZB A;  3TUO A;  2PTL A;  2Z8L A;  3AE7 B;  3W5V B;  1OQR A;  1DOY A;  4TSS A;  1L0V B;  2DLB A;  1SJE D;  3KWV A;  4PT5 A;  1ZE3 D;  3TEY A;  4XWW A;  2BB6 A;  3NVZ A;  1NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...