3QUBA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47ala mutant complexed with sulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
b'MRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHAGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qubA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qubA01
1XPJA 4AP9A 5IS2A 1RPZA 4G9BA 3FZQA 3UMGA 2WFAA 3NIWA 2CFTA 3WKBA 1N9KA 4OD0A 4HGOA 5AW3A 2W43A 4JDPA 3U26A 3ZX4A 2WF6A 3ZVMA 2B1RA 4EZEA 5AI5A 2I54A 4FFDA 5ALRA 3QUQA 2YJ6A 5AM4A 5A3QA 4NFLA 3UM9A 5AKJA 1L8LA 5AM1A 4AS3A 4NABA 1J8DA 4BX3A 3E8MA 4GIBA 3B9RA 1Z4KA 2G0AA 2WM8A 4ZEXA 2ZBDA 1TJ3A 2G80A 3HYCA 4EX7A 3U13A 2HF7A 3ESRA 2MU2A 2MU1A 1PW5A 1Z4OA 4EEKA 3ZTWA 2OBBA 2B82A 2YJ5A 3OCZA 3M1YA 3QX7A 2B1QA 3SMVA 2C8LA 2GHTA 3L8EA 3PGLA 1RQNA 4QJBA 4HAIA 5ALKA 4XPZA 1NF2A 3DAOA 3NAMA 1RLMA 3MPOA 1RKQA 1FEZA 4HGNA 3WKCA 4YH1A 1L7PA 5ALGA 2R8ZA 1O03A 2B30A 2JAUA 1KYTA 3MMZA 3WK4A 4CE6A 3FVVA 3QLEA 2PKEA 2YY6A 3W5CA 2WF8A 5AI0A 1LVHA 3AR2A 2FPUA 2Q5EA 4KNWA 1VFPA 2HF2A 4Y2TA 1RDFA 2FUEA 2I55A 2ODAA 3SLRA 1ZOLA 5ALLA 5ALWA 3KBBA 3NRJA 3OTQA 2GHQA 3B9BA 3VAYA 3WK8A 5AK3A 1QH9A 3QUBA 3W5DA 2HSZA 5AKHA 1L7MA 4YCMA 2EARA 1VJ5A 2P11A 3I28A 4ZEWA 1ZD3A 2IYEA 4H1WA 3EWIA 2C8KA 1YNSA 5ALXA 3A1DA 4YGYA 4XOUA 4KN8A 3AR8A 4DCCA 1ZJJA 1T9ZA 1JUDA 1TJ4A 4AS2A 3I1YA 1YV9A 3J7TA 2HO4A 1NRWA 4EX6A 3U7HB 5AKZA 3R4CA 1J97A 1N8NA 3KC2A 2G1AA 3QU2A 3QUCA 3QU7A 1L7OA 4Y3UA 3M9LA 4UASA 3ZX5A 4KX3A 2EATA 4NV0A 5AKLA 1YDFA 2G07A 5AW1A 5AW8A 3A1CA 4O8CA 2GMWA 4ZEVA 3WKAA 4BX2A 2WF9A 2YFYA 3L1VA 2C4NA 3CNHA 2OM6A 2WF5A 3KDPA 5AICA 3N8GA 2HI0A 5ALOA 2DQSA 3QU4A 3AR5A 2G09A 3NALA 3PDWA 1Z4JA 2ZBFA 4YCNA 2CN1A 5AI4A 2WF7A 2O9JA 1WZCA 1Z88A 3U19A 5ALDA 3WK7A 2JAWA 2RAVA 5AI9A 3RF6A 5AI8A 3R9KA 4NWIA 4BX0A 1NNLA 3ZWDA 1O08A 4BEVA 5AW5A 4UMDA 3ZTYA 3L8FA 2FPXA 2BDUA 2I33A 3N28A 3E58A 3NASA 1RRCA 3IJ5A 3ET5A 3SKXA 4EENA 5AVVA 3RFUA 3EPRA 1EK2A 2YMMA 2HDOA 4Y2YA 3OCXA 3A3YA 5T41A 2W4MA 4Y2XA 3QGMA 5IT4A 3N5KA 4HGPA 1TA0A 4C4RA 3GYGA 4UMFA 3PCTA 1YMQA 4DWOA 4I9FA 4NAVA 2GFHA 3OCYA 1Z4LA 1Q92A 3U7GA 1ZRNA 1RC8A 3FM9A 3PGVA 4J03A 4UU1A 4QQFA 2B8EA 2Q4RA 1Z5UA 2O2XA 2I6XA 4DFDA 3N07A 3ET4A 5AKKA 2PQ0A 3F9RA 3KOOA 2NYVA 3HLTA 1T5SA 1SU4A 4Y2UA 5ALSA 5AK6A 4XE5A 3SHQA 4Y2SA 4MUMA 2AGVA 2R8XA 3QU5A 1WPGA 3EF0A 1Z5GA 2HHLA 2FPWA 2FPRA 3L1UA 1QQ6A 1SWWA 4UAUA 1RKUA 4KNVA 5JJBA 3UMCA 1RMTA 2HOQA 1YJ5A 5AVQA 3ONNA 4CNQA 2C88A 3WGVA 5E0OA 3ZVNA 4YIKA 3L0BA 4PNHA 1AQ6A 1QQ5A 4UW9A 2RARA 4BNDA 5AIAA 5AK4A 5AKYA 3AR4A 1X42A 1TJ5A 2G06A 4YCLA 2C9MA 5AVRA 3I6BA 3OCUA 3NUQA 2BY4A 3QYPA 4CF3A 3WK5A 3BWVA 3AR6A 2JGAA 2YJ3A 3OCWA 2BDEA 2P27A 2YJ4A 1U2SA 5AKXA 4L57A 1ZRMA 1EK1A 5AW6A 4UAVA 4UMVA 3N1UA 5ALPA 5ALVA 4UU0A 2YMPA 5AW9A 1IWOA 4J2TA 3AR7A 3P96A 5ALHA 3L0YA 2G08A 5ALFA 4F72A 3ED5A 3QU9A 2YBDA 2FEAA 3K1ZA 1ZD2P 4Y2QA 2JAOA 4IFTA 4Y2VA 5AM5A 3BA6A 3SF0A 5A3SA 2MSNA 1L7NA 4OHFA 2HX1A 1MH9A 5AI6A 1L8OA 4YIHA 3WKEA 2JARA 2I34A 2HCFA 3ZW7A 1QYIA 3OPXA 3A1EA 1S8OA 1YS9A 5ALIA 2I7DA 2YMQA 4BBJA 3ZU6A 1ZD5A 5ALMA 3L5KA 1U7OA 1XP5A 2B8JA 2YMLA 3NANA 2W11A 2FDRA 3MC1A 3S6JA 1F5SA 4E88A 3U7FB 2B0CA 5AM2A 2R8YA 1VJRA 1K1EA 1RMQA 2CFRA 2ZG6A 3WK9A 4C4SA 2OA0A 1U7PA 4KX5A 4UATA 1Z4MA 3WGUA 3E81A 2ZBGA 1CQZA 3W5BA 1ZS9A 1Q91A 5AW7A 2R8EA 3L7YA 4RESA 4Y2RA 4IG4A 4L6CA 3IRUA 1ZD4A 5AW2A 2D2VA 5ALUA 3B8EA 2IOFA 4C4TA 3QUTA 2RBKA 1RLOA 3ZVLA 2RB5A 5AM3A 1Y8AA 1U02A 1WR8A 2ZBEA 4UMEA 4CF5A 3CZ4A 4GXTA 3WK6A 1RKVA 5AVSA 3DV9A 3W5AA 3D6JA 3R09A 2Q4TA 3OCVA 5ALQA 1WVIA 2IOFK 5AW4A 3AR3A 4CF4A 2FPSA 5IT0A 2VKQA 3L8GA 3MN1A 4FE3A 3WKDA 3ZUPA 1TE2A 5AVUA 3UMBA 3I76A 2AMYA 3U7EB 1RQLA 5FP0A 4BNDB 3QNMA 1RMYA 2QLTA 4HGQA 5AESA 4RETA 2PR7A 2WHEA 4L6AA 5AK5A 2AH5A 1U2TA 2P9JA 2NO4A 5ALZA 3DNPA 4B6JA 2QYHA 5AVWA 3E84A 1Z4QA 2IA5A 2GO7A 3FPSA 5AVYA 2ZOSA 4EELA 3AR9A 3ZI4A 2P69A 2NO5A 3QXGA 1XVIA 5ALNA 3SD7A 4KYTA 2FI1A 1SWVA 3SKYA 2FUCA 5ALEA 4Y2PA 3L0CA 1S2OA 1QQ7A 4I9GA 5ALYA 2CFSA 5ALJA 3ESQA 3DDHA 3KZXA 4BKMA 4BEWA 4DW8A 5AKEA 5A3RA 5AM0A 3KD3A 2EAUA 3EF1A 4UM7A 5AVXA 1RLTA 5AKGA 1CR6A 2YN4A 3ZWKA 4JB3A 4F71A 4UARA 4OFZA 4HGRA 4BYGA 1Z4NA 3FPBA 4FYPA 5AHXA 1L6RA 2AUTA 2IOHA 5AIBA 3FGOA 5AVTA 5ALTA 4OCZA 1LTQA 3IB6A 5AKIA 4XQ0A 4MWOA 5AW0A 4G63A 4UM5A 1Z4PX 5AVZA 2HEGA 4Y2JA 3TLMA 4HYTA 3L8HA 1T5TA 2ZXEA 2X4DA 1Z4IA 2OYCA
chains in the Genus database with same CATH superfamily
1PSWA 4MRNA 3PNYA 1IMJA 3Q5GA 2HEIA 2F64A 1RAHA 5EIOA 1CDZA 2ZYGA 1MORA 4LJ7A 3HABA 4AZ0A 2GN6A 3ZHZA 2NO6A 3IT2A 5H3LA 1D9XA 1FDUA 1GITA 3KX2A 1GU0A 2V4RA 1LPNA 3KAQA 1SVOA 3DVAA 3GBSA 1JQ3A 3D2QA 2FSVA 4RVCA 3LL4A 5K0FA 4M2YA 1HE4A 4QYTA 4C3VA 5HM8A 4RQ8A 2NV6A 4P4GA 1RQNA 4Z0HO 2H00A 4BO5A 3B78A 1OGIA 5IKOA 4QPCA 4TTPA 2QNBA 3G5LA 1K0UA 1NU6A 2I2FA 5L3QA 3B52X 3AERB 2L17A 3Q6IA 1GD1O 5IAJA 1K8XB 5AI0A 4UKDA 5DPMA 3SJ7A 4AKEA 3NKVA 4B9AA 1FYFA 3BULA 4UHKA 3VXKA 1VL8A 4ZXPA 3WIUA 5KDOA 1E8DA 2HPVA 3LFUA 2BAGA 1F4PA 4UB4A 2AA3A 3WQBA 4XWAA 5KT3A 3X1JA 5CRXA 4ROTA 3CFYA 3H9BA 4ED2A 3M2TA 4L4UA 1AK9A 1WBBA 1WJGA 4RZXA 4QEKA 3TL3A 3RC3A 4F85A 2QPTA 4NE7A 3QF4A 3FNQA 4ZV9A 3MXOA 3QG1A 4HRXA 1FFXB 3A1CA 1UJNA 1W0JD 4GL2A 4KLRA 4TTVA 9LDTA 1R4MB 4AZWA 3BCSA 2PXIA 3DQQA 3PQ6A 1YULA 3R8CA 3IPYA 3UOAB 4DL5A 5KHOC 1L1EA 2VCEA 3OHPA 3IEMA 3ZLTA 5CB6A 1DXSA 3TR0A 3BWMA 8ICWA 3A37A 1C4WA 5CT4A 4LJ5A 4PPFA 2G0NA 1AZLA 3D4PA 1ESMA 3T7AA 1H1DA 3GZFA 1F3OA 5IYZB 1V37A 3W1WA 5L1LA 1NDUA 2O8BA 3MJRA 3KJIA 2O3UA 1Z6XA 1MO2A 2X0EA 2W42A 4JJFA 4CCWA 1PJSA 3TD6A 4BVHA 1E60A 3GD7A 3T8YA 1AGNA 3OEYA 4CKWA 5DNAA 3A27A 5IVPA 2FMPA 2PY6A 3NUQA 5PNTA 4YJFB 1CQIA 1PJQA 4AN1A 1DUSA 3JWPA 1K7YA 2JEOA 1KYYA 3AU6A 4H7HA 3VPGA 2WD9A 1R4NB 2GCOA 2HN9A 2V7EA 4N8SA 5JZSA 3GIKA 3BRWA 3LT0A 4MCHA 2FEAA 3M6KA 1JAIA 3R9WA 4U0JA 2CVHA 2ET6A 3C3DA 4ZYXA 2W2XA 1QOQB 1YQ9A 3LPNA 3WLHA 1QSSA 3ZJVA 2MSNA 1GT6A 1Q3KA 3R7NA 2GF9A 4OFXA 8ICKA 2VBCA 2PIDA 3M6XA 4C3OB 4DMLA 3T3OA 1Z34A 3AVQA 2B5VA 1EFAA 4YAGA 3GLGE 1B2RA 2XT6A 4HB0A 4LXQA 4J7AA 5EMKA 2PX5A 5LP6F 4L6CA 4H6WA 1QVRA 2H1VA 4G5SA 2I5HA 3EPJA 1EGVB 4ZU6X 1PQ4A 2ZTSA 3NORA 1W0JA 1UM9A 3DE7X 1H2EA 3F5AA 4EZ6A 3EHDA 3TSZA 3VMMA 1GGMA 3DZGA 5AVUA 1TECE 1J23A 4FM9A 4OHBA 2RGDA 3QNMA 5EPUA 5EKUA 2HAEA 3LUDA 3B1XA 5LXTF 4OGGA 2KMLA 3RROA 4KGZA 3DJYA 3WRXA 3GH3A 3BH7A 2FSFA 1IOVA 4XH9B 1V43A 4R1QA 4IVRA 1H5QA 4DQKA 4RF4A 1YZNA 2HO5A 3IKLA 3GGJA 3CW2C 3T5CA 1DJNA 5IUJC 1J25A 4B75A 4JN6B 5A9RA 4Z3DA 2JGEA 1YRYE 4R1NA 1LB1B 1L4FA 4ZCQA 4G0UA 3W5VA 4C7JA 1AXGA 1EJ2A 1SHJA 1UDBA 3JVVA 3NOOA 2EHJA 4LDNA 7ICTA 2WIAA 3VO9A 2A59A 5BN5B 3SNHA 5KBYA 2FWMX 2C3PA 2B1RA 2CXSA 3R2JA 4J8PA 3ZKWA 4J0KA 1KO8A 2VQDA 4Y9RA 3LF2A 4P0PB 3H5WA 2GPNA 3L5OA 3NTLA 2E9SA 3OE4A 4FBTA 2QHXA 5LA6F 2W98A 4U2GA 4S1OA 4TV9B 2YHIB 4G1EB 4YECA 4IDEA 3H40A 1R64A 2W0SA 1G8GA 1CQXA 3HCAA 3AFMA 2B4TO 4GM0A 1JZTA 4RQ2A 4KLHA 3KPWA 1OY1A 2GAFA 2W2NA 1W87A 2P2NA 3E61A 3RB8A 3BORA 5EESA 2RAUA 1A5BB 5FBZA 2X0NA 5J2EA 5C46F 3C5FA 3B6IA 1I6MA 4I2CA 4ZO9A 5K8JB 2PVPA 5B3LA 1PQYA 4L28A 1ABBA 2ST1A 4Q9JA 5TX7A 2EBUA 2BIFA 4QU0A 4UTOA 4HEJA 5G0VA 1YDFA 4I1VA 1LK5A 1BHSA 1DADA 5K4GA 4JC5A 3WKAA 1AQUA 3ZZMA 5KFRA 1GV1A 2OENG 3VC7A 2WF5A 3FYHA 4QUEA 4RPHA 1YTLA 1IHUA 4EUFA 2Y1GA 3MD9A 3TF5A 5MN5A 1TVAA 3DZCA 3TEFA 4DQDA 1OX5A 4D6PA 3N2KA 3P27A 4DAEA 3C3MA 2NU6B 1IWPB 4GX0A 5CIYA 5T41A 4N8DA 3OLVA 2K5UA 1QIKA 3JQPA 1QC5B 5BWMA 2WIFA 5DW0A 3GEGA 3KD2A 4L27A 5SY6A 2JJ2D 1VIAA 2XW6A 3M6ZA 4DDMA 1MIHA 4J9VA 2RGUA 3UV3A 1KE2A 3BICA 4POOA 1WDWB 4QOHA 2HV8A 3SKVA 5I7EA 3S3TA 4MUNA 5CDSA 1XFAA 3EGEA 2BI8A 1U2QA 3ASZA 2P9FA 3HBLA 3RC7A 3FVQA 1DG3A 4DOAA 1PHPA 3T4UA 4EG4A 2H0AA 1EBFA 3WGVA 2JVIA 1EVZA 1TUBB 1KH1A 4TYNA 4WQMA 1N2IA 3NBKA 2BDEA 4P3OA 3PRJA 1BU8A 3P32A 3PPWA 2CNBA 3ESXA 3CONA 1ZD8A 1FDSA 2ATVA 4B6SA 4RFSA 3H0RB 3AJEA 2JAOA 2C2XA 3TCNA 4JBWA 3DA8A 2IF0A 4HYQA 4X90A 3FHJA 5AM5A 3SQNA 2V7PA 3EFOA 2I9KA 2D3DA 4GVXA 4Y9TA 4WX2B 2Y76A 4ZDWA 4MW9A 4JI2B 1SHTX 3O4GA 4ICAA 4DSLA 4FC7A 3KALA 1U7OA 2PZKA 3TW6A 3WBJA 1HM5A 1V25A 5KNDH 4C7OB 3GELA 4MWEA 1Y6QA 5MFPA 4LJ8A 1DQNA 3NC1C 1KQFA 2VK8A 3NM6B 2OXOA 3MAGA 5K0JA 1VSQA 2OK8A 3TLGA 4W1PA 1AGXA 4YXMA 4JCCA 2MYUA 3ZV4A 1WR8A 2AJLI 2QVYX 5IT5A 1MOZA 3G1UA 1E0DA 4ECVA 2Z4SA 4TL9A 1Z5OA 5IEBA 3AFNA 4FFNA 4MRAA 1EVQA 1V8OA 1H6AA 4RGVA 1ZQAA 5D51S 1LRJA 3OQVA 1KFSA 4XX0B 4GZMA 3VYVA 4DM4A 1FP7A 2OBNA 4MV8A 3QVOA 1YRQA 3KELA 2WV9A 4Y9UA 3UMSA 3ZW8A 2BEVA 3RTDA 3LTEA 3D7SA 3SF8B 2RP5A 2JJ2A 1NOJA 4I9UA 4XIJA 5LCXA 4LX0A 7ICVA 1LLUA 4JFRA 3KAPA 3DOIA 1NC3A 3DF9A 4MWOA 1CUJA 3RAPR 3W5JA 4BFVA 2FR1A 4UBLA 2VSXA 3B3JA 4FDTA 3N8DA 1KSJA 1F44A 5EY5B 3WMXA 1LK7A 1O7JA 2ZBQA 3DEKA 4BAGA 5DXJA 2GJ4A 5DLGA 2WSMA 3CWCA 1NUSA 1TEXA 4RPGA 2LXNA 1DEOA 3CM0A 2J3MA 1S7CA 1XZ8A 1HEYA 4U8HA 1J8DA 3Q6NA 3SFTA 3EXFA 4I99A 4RD2A 3GWGA 1TVMA 3RIXA 5EJIA 5J2DA 5AFSA 2YWBA 1K6IA 1YB1A 1B22A 3CUVA 3HVRA 3EGOA 1Z9BA 2VTEA 3SJBA 5LQAA 3HPOA 4HWRA 3MJVA 4Q7EA 3O74A 4LSZA 3C1UA 2LW7A 3RH0A 1DTWB 1QH8A 1GGJA 2J5XA 5JXWA 1K7SN 1PJCA 1ABFA 4W7IA 4PLZA 4YUXA 2NZVG 4B5KA 1H94A 1ZD3A 2ERCA 3NTRA 2Q1XA 4OHZA 1PEAA 5TMDA 3ZNNA 1NURA 1N5JA 3I6YA 3R4CA 1PK1A 5JW6A 3NM5A 3WGYA 3UT5B 4ODIA 3F2IA 4PJ0U 2JZCA 2HH9A 5C52B 4G67A 3ROGA 1WLSA 2CFCA 1XL0A 1YQXA 4AT1A 1SN7A 3QQPA 3KSUA 4AX4A 2AZDA 4K9PA 3RJIA 3M6VA 1GZ6A 2A5GA 5TR9A 2E18A 3KYJB 4EHKA 3R0IA 3G7SA 5EWMA 4RSGA 2WU0A 1GV0A 3UF0A 2RGRA 1SPBS 1Z88A 4X3CA 4OJTA 3BAZA 2GRJA 3E5HA 1ZP6A 1GPKA 4NLGA 2XMBA 4DE5A 4CF7A 3VC3A 3FPLA 1VB5A 3U17A 2V4QA 1UZNA 3RRZA 2QU8A 3VR4D 2O57A 4PZEA 2ZW9A 3QVMA 1H3EA 1XALA 5I51A 3ORYA 4BCBA 3ZDDA 3D2SA 4DMUB 4LOJA 2ZUSA 5IINA 5LJLA 1CC1S 2FHPA 1AGRA 2VHTA 1W6RA 2ZUWA 1CUDA 4DMKA 4L3OA 4EARA 2HWKA 3OLCX 3DKRA 5I9IA 3CLVA 2R1VA 5CYOA 2H5EA 3KL2A 6ADHA 1AB5A 1C9JA 3A36A 4NC9A 4M22A 3Q85A 2FW8A 3QLTA 3ER8A 2NP6A 1KS9A 3ACBA 4DL4A 4LQ4A 1T91A 1X38A 2NU7B 4WKCA 2WDPA 4FLEA 2BM8A 2WT8A 4JOCA 3I6BA 3VU9A 3PRYA 2YH2A 2XPCA 3M9NB 5B6IA 2NPOA 1USIA 3O5AA 4KWEA 4C4PA 1CNEA 3GPDG 4XA8A 3K0BA 1OXJA 3SZGA 2PFQA 1M2GA 3GV0A 1U1GA 3SAJA 2CBXA 1TPYA 1BXGB 3IJPA 4JD5A 3P4XA 9ICTA 4ECTA 4GU5A 3U9TA 4LYFA 4DKXA 4OXKA 4CT4B 3CVVA 5B1DA 3OQIA 1HPLA 3GLUA 4TXLA 5J4KA 2R6CA 4R01A 2ZBUA 4ED7A 2GK7A 3LPAA 3IALA 4GAEA 1VYTA 4MRRA 1QKJA 4KXVA 4C4SA 3JS5A 1VIYA 1AM4D 4BO4A 2JJ1A 4RTOA 1IQPA 4DL3A 3V2HA 3AJAA 1YVUA 4PHAA 3STHA 4FCCA 1T5HX 4OQ4A 4MGIR 1XZPA 9ICHA 2IKQA 5HF9A 1BZYA 4H7JA 2JKVA 2P2SA 4CKCA 1OZHA 2P3QA 5K0GA 3HQ4O 3R0XA 3TJZA 2QB0A 2Z5LA 2ZRIA 3BDIA 4KAJA 2YV2A 2WMYA 3LP5A 2X1VA 1FYDA 3NGDA 3I92A 4U2FA 3UMFA 2ECOA 1OYOA 4QLBA 1QIGA 1MB2A 2J4DA 3R5TA 4BEBA 1ZNXA 2IY7A 8ATCA 4MPRA 1MO6A 3R7WB 2AXPA 1DXQA 3VR4A 4URXR 1ZNQO 2CZQA 4RQ3A 1W4RA 1OC2A 3IXMA 4TUYA 3B3QA 4GR4A 3U3OA 1MQAA 4JOSA 2XCOA 4OOEA 2EJVA 1B93A 3L04A 1L5MA 3GLTA 2VBGA 2IXTA 3ZYZA 3UH1A 2CE7A 1GQ2A 1JDPA 4BASA 4NQRA 1VJ0A 2PZJA 2GVZC 2GPAA 1UFRA 3DOJA 5AVOA 1OTHA 1GGNA 2FFAA 1Z0FA 5KINB 2VJQA 2O05A 3UCEA 2IBKA 1P80A 3IP7A 3TACB 4J2OA 1P72A 2HQSA 1BJKA 2VJKA 1UQVA 4EUHA 3IR7A 2JB9A 5BSRA 5D6OA 1JDUA 1O96B 2IHBA 5I45A 3U6KA 1ID1A 1Y4AE 1Z4KA 1T0BA 5A2QA 4HX2A 5G4LA 3CRXA 3M6UA 3S1AB 4MFFA 2Q8PA 1PDVA 3B6ZA 1CQJB 4X5OA 2X0RA 3AQ4A 4Y6RA 2ZRNA 2Q2NA 1K5HA 4PFSA 3D5TA 1JHVA 3PVSA 1ZGZA 4N49A 5CT9A 3S8EA 3HYRA 3H1AA 1ZQZA 1MRZA 4WXHA 4N3CA 3F3YA 1ODCA 3PGA1 2REBA 1N9GB 2AGPA 1O89A 4HJXA 3P9ZA 3SLRA 5E7IA 3ZGZA 4MRSA 1BPZA 1TU4A 5KWJA 2AZ4A 3WRYA 1KAEA 1RWWA 3PHCA 4DREA 1QQBA 2B37A 4NCKA 2GN0A 1EFTA 4IIJF 1CVIA 1R0ZA 3EBPA 4RV4A 1EEHA 4UVDA 4BOYA 4GZ5A 4Y0VA 3FZEA 5AW1A 3UAXA 4IQFA 2ZWIA 1B00A 4ZWNA 1GQFA 5TS3A 1ZXBA 3C28A 3W5HA 4Q9AA 3H97A 1PQWA 3R5HA 2BWJA 3PYLA 4I6JA 2XIDA 2BEUA 3NRWA 3W1VA 4N0PA 3QGMA 2ERYA 2CY0A 1FTQA 3A3PA 4UULA 5KWIA 3K4QA 2CE2X 5E9WA 3N97B 4A6EA 5E2AA 1X1AA 1NKBA 4YTEA 5F7JA 2X9GA 4KQFA 4EJMA 2HV9A 1NI4A 2QGFA 4H4CA 5CCBA 4G0XA 4PYMA 1PZMA 4L5AA 1MABB 4NONA 2DGDA 3ZE1B 4EOGA 3JAMA 1M1YA 3L0BA 4JJ6A 2DQNB 3BXZA 2D1QA 5JO0A 1NBWB 3DMGA 3G2PA 2PEZA 3ZU5A 5I9LA 1TYZA 4BKUA 4L5BA 1LS1A 1OXTA 4LJYA 2FZEA 4ZQIA 2LWIA 4MQUA 4PBTA 3EEOA 1SEVA 3TRJA 3WWCA 3KPYA 4ZAFA 2F00A 2ASVA 1ZVVA 3I6IA 1LI5A 2W6JD 4BNFA 1N8SA 1QHNA 3W0LB 5B2FA 5D1HA 2G8LA 4YWJA 1V35A 3PX4A 1M2OB 3N0RA 3L5KA 4BTEA 2V7VA 3OJFA 5LP6B 3BFPA 4E4TA 4RNOA 4NLKA 3AMZA 1TW2A 4JNCA 4YVZA 4G8BA 1SZHA 2JFXA 4XPIB 4JT8A 4FQ5A 1MC5A 4BLQA 3DE1X 2VJAA 3LC0A 4MI6A 3AKYA 1J8YF 5MN6A 1PT6A 1XTRA 2QL6A 4GG1A 3SWWA 4C30A 4WERA 5HEKA 4YN4A 2D3TA 1U2DA 2FZ5A 5CVVA 4N18A 3OKFA 2OLEA 5CXXA 3V46A 3CF6R 1A9ZA 5FOVA 4JXKA 1L1FA 2ZXFA 1MD9A 4LY3A 3JARA 1T15A 4LZGA 5JXHA 2QUZA 3SYTA 3OHAA 4PXAA 3R3SA 4DUGA 4YT2A 1E3LA 3PUZA 1YCHA 1Z19A 5JQWA 3T9EA 5F9MA 5IMBA 1WUYA 4DVGA 1NW9B 2OCKA 4R1PA 4BEWA 5JS8A 4UB1A 2ZRCA 4UM7A 5F2KA 5HHIA 1SXJC 4D8XA 3DEHA 2YXEA 2P78A 2XGSA 2DUNA 4KLDA 5JR3A 4XGRA 3C21A 1X1SA 4K9MA 3TW4A 4B33A 1V1JA 2W8LA 2C58A 2XCPA 1P19A 4OQEA 3OF3A 4P4LA 1E6LA 3F8WA 4IIEA 4F3NA 3DEIA 4EITA 2IUFA 5C53B 1LQUA 3CJQA 1ZEMA 5DYYA 2IYUA 5KUTA 3VYRB 1ECFA 1I3MA 2C95A 3NB0A 3T5HA 4DRZA 4A82A 2IY8A 2G04A 3AT1A 3EFBA 3CSUA 2R11A 3LL7A 3CTMA 2AXEA 1GLNA 3CC8A 1R4ZA 5BMVA 5A6SB 1FFBA 3OPQA 2FMQA 4EAAA 4F91B 2AJDA 4KHPB 3W7VA 1SVMA 4JVMA 3QTLA 4DNFA 5FKJA 5IYZF 3CMCO 4YALA 1GPH1 1M6HA 2VHEA 3MCTA 1VSBA 4OBXA 4E5MA 2JI4A 2D0OB 4RV5A 4PWZA 1R0KA 4R16A 2PUDA 1YS6A 4AKGA 4DO9A 3BJZA 1GNQA 1OR8A 4RA6A 4JYZA 3PI7A 2J41A 5J2CA 4XRRA 4J49A 2DUUA 1O9BA 2A0XA 4ISCA 4OFBA 1DNPA 2LGJA 2XGJA 2QN9A 3B89A 5HDQA 1BFUA 1BGXT 4HH3C 3B9PA 1P3JA 3B12A 2HXGA 2CRXA 2G09A 4G0PA 4PC2A 2PS9A 1XO0A 4A8JC 3FOZA 2HSDA 1T1EA 3MGHA 4TUQA 5AW5A 4UMDA 1SB3C 3ESCA 221PA 1QVWA 2A9OA 4JBGA 1CUXA 4DY6A 2JASA 4RACA 4QSHA 4JEMA 3RW9A 4ER6A 5H82A 3PDUA 3EH1A 3IYLW 3FMVA 3ZWVA 5AHKA 4KPGA 1S8FA 4C21A 3GDFA 5CHYA 5AJTA 4DL9A 5BXYA 4F5NA 2PRSA 1CS0A 2XUZA 2OXEA 3ZVNA 3N3BC 3PC3A 4XA5A 2ZUCA 3TRDA 3JASA 1L7AA 2QRPA 1YFZA 4O08A 2AVDA 1KFEB 3RFVA 4HVCA 3P9RA 3TAXA 3V42A 1DFGA 5JFTA 1OIVA 4MVJE 4LXXA 1QKKA 5ALHA 2IEDA 4HWPA 4TYMA 2PLWA 5TVGA 4X5VA 1IXSB 1VLLA 1MAAA 3EXEB 3CVUA 1ISHA 1V8FA 2QW1A 5G0TA 3TNFA 1XI2A 4A6PA 4QVGA 4XD7A 3ZXUB 3PP8A 5BO5A 3FDXA 2GILA 2YWJA 3QW4B 5KYUA 4TGLA 1RZRD 1IK6A 3T95A 2YYAA 1TZBA 3CJRA 1RMQA 4I9HA 2QY9A 2NUPB 4ZCMA 2O6LA 3TLCA 4O2LA 2BGWA 4B8ZA 1PP4A 2KSOA 3BWCA 4ITRC 4E0DA 4UTZA 4FT2A 5FWNA 4BN0A 4CRXA 1ECPA 1KO4A 4I50F 5DRYA 3FTCA 4BVKA 3CZ4A 1TKRA 4GMXA 4B4WA 1IB0A 1IEWA 3ODPA 2JEYA 3GRKA 4O2BF 5JAHA 4NULA 1NJGA 5ITVA 4RD4A 1KEZA 2IPMA 2NV0A 2FMSA 1OPRA 2PUFA 4LNUB 3I9MA 3I0NA 2HK8A 2PS1A 1TF7A 2OECA 1UKCA 3M4YA 3BGSA 4Q19A 2F4VB 1XQ6A 3HS3A 4R2LA 5FAXA 4TRRA 2GBFA 3NW9A 1FUEA 4JFAA 2FLKA 5BT9A 4F9TA 3ESQA 2O8EB 5C7IO 5BW5A 1BJTA 4B4DA 3I9NA 3DKPA 4RQ5A 3OG9A 4GUDA 5IXYA 4C7XA 2DSNA 2MAXA 4IV5A 4TWAA 4OYRA 3RAFC 4OKSA 3F6BX 1W47A 5LIRA 4OQZA 2WJPA 1QB7A 4HB4A 1ZCJA 4AK9A 3CBQA 2OORA 3UFXB 2I62A 2H3FA 3BSWA 2JLWA 2QW8A 4KNYA 3LLCA 5L1MA 3IPCA 3IEXA 4F6LA 2E4AA 4RE5A 5A5VA 1LPPA 3ZLUA 1NK5A 3RUAA 1V5FA 1NPDA 2KV2A 2FWBA 3KVOA 1RWNA 5H80A 1E59A 5GQSA 3PKZA 5KKNB 4QZCA 2HLNA 2RKBA 5ALKA 5HGXA 3NAMA 1ZC4A 4M98A 1JTFA 3GRUA 2OT3B 3O94A 2O2GA 4RH3A 1SY7A 3C6QA 2AMJA 4B32A 1RZRA 3IAM6 4WT7A 3HWSA 3QLEA 4DCSA 1X2BA 4ESVA 1Y1LA 1U2GA 4GOKA 2UUCB 5A5GA 2EKLA 3OQ6A 3WWDA 2PV0A 2R1TB 1GEEA 2ODTX 5AK3A 1J33A 3W5DA 9ICGA 2NTVA 4N5HX 4GQIA 4R2WA 2AFIA 3W2GA 4FZNA 3T1QA 3G49A 4UEWA 2FPPA 4KL8S 1P9RA 3A4YA 3T1OA 1ULUA 3EAFA 1Z75A 2Y0DA 4CEJB 4TRJA 1L7OA 5FBWB 3LT2A 5B4UA 1RFGE 4IV0A 5KWVA 5F2NA 3F6RA 4V0ME 3E7WA 4TYWA 1J2YA 5KT6A 2YFYA 4PGXA 4JDUA 3K0EA 3RF9A 2BMFA 2WKPA 3AI2A 3N8NA 5C8YA 1QG2A 3IEPA 1UJMA 1D03A 1O95C 1YQTA 5KNCH 4ED6A 3D8RA 4KREA 1L1RA 3EUEA 1YASA 2HDNB 4O3RA 4FR0A 2QSYA 3JD0A 1E18A 4QPNA 3DCYA 4DA9A 3W6ZA 1JJVA 5F51A 1ZISA 5IK2A 2E8OA 2NT4A 2MSEB 2OCEA 1RYRA 3R3WA 1QO7A 1BQEA 2RAPA 3UB4A 5B6PA 1ZGHA 5DH9A 3II6X 3SC2A 2QN3A 4UHEA 5KEIA 1MA7A 4L8LA 1B6SA 2WTXA 4HATA 4LGYA 2GLUA 4ZMBA 2YVKA 3AHFA 1E6CA 1IN1A 3TQHA 2HXYA 1U2SA 4MAAA 4ZAXA 2XYHA 1GA1A 2X2EA 4WA8A 2G0TA 1GUAA 1IHOA 4MV9A 1JV2B 3UJ3X 1QLNA 2DYKA 1W88B 1E3QA 1TC2A 1DEAA 4G5HA 4MQFB 3TARA 4AJOA 4MRMB 3GDOA 4ND5A 2CVZA 3F6CA 3FUWA 4HQ0A 3FMPB 4JHXA 1H2HA 1QOPB 2VDWB 3V6KA 1ZC3A 2VDRB 2BH9A 3NJ4A 3EAQA 2WWVD 4JXJA 5BV7A 3GG2A 2JHDA 2FAXA 1N3LA 5KVVA 4D8WA 3BQ0A 4FJ2A 3RYFB 2FOLA 4A8TA 1NFQA 1VM6A 4P4OA 3NIBA 3N7RC 3RPEA 1MDFA 3RSZA 3CS3A 2OWDA 3L1KA 4KVAA 4RY0A 4QEDA 1ZVQA 3BMQB 4N48A 4YXFA 3BK2A 1JR3D 3BZBA 2OO3A 2OD9A 5JCOA 2DKOA 4G26A 1FW8A 2X9VA 1IAQA 3DOEA 4EO4A 1LDBA 1OGJA 1ODFA 3W2IA 2O52A 2IC5A 5J2JA 2Y1OA 2ZBRA 4Z6KA 4BYGA 4QNLA 4CV2A 1JSXA 2FPKA 3HU5A 2IOHA 5ALTA 1IZ7A 3QLVA 1VGRA 1E3IA 2PMFA 9ICMA 4IC9A 1QBGA 5AUOB 3UG7A 4Q03A 4LXTA 1QJCA 2R8JA 4D4MA 4O0MA 3RU9A 5CH5A 3ZWPA 4GEGA 2BH2A 3PEVA 1SXIA 2M6LA 3SX4A 3WKBA 2OFOA 5L40A 1X1TA 2O8VA 3Q9SA 2X0KA 3E23A 1DPGA 1PR2A 4MI9A 1HFKA 1P0PA 1NNI1 1OT3A 2JIBA 1Q11A 4Q7QA 1U9YA 5DSZA 3RSQA 4NK4A 2X76A 3EZ9A 3RS9A 4RTSA 4MHSA 5A5FA 3UJBA 2BFEA 1ZOOA 5ESRA 5C81A 2XUDA 3GIMA 4R05A 1XEXA 1ZQJA 3CSDA 2XA2A 2Q7OE 2CFIA 3GRAA 5B58T 1MO5A 2VP9A 2I4RA 4YV2A 4QJ3A 3B9BA 4LSWA 4AZVA 4QXPA 4E0BA 2C7RA 5JASA 2A84A 3CIOA 4B7UA 2VWGA 3UJAA 5HZHA 4Q00A 4GZ3A 3EIFA 4EA6A 3T7IA 3Q87B 5A4MS 4IEIA 3KQWA 2GVDC 4FSXA 5EHGA 1N8NA 2ZI7A 4ZQEA 1EFCA 2VJMA 3C5HA 1KSPA 4ENVA 1ENZA 1WU8A 1FSZA 3HXKA 2B8TA 3DV0B 1I51A 1SZPA 3E8XA 3B1ZA 4AQ7A 1Q3TA 2ZZNA 3WHPA 2WUGA 4M6WA 3A1WA 2AJQA 4RCVA 3KKMA 1H0HA 4CLDA 2BCJQ 1PUIA 4LUCA 4ED3A 1DPFA 4ACAA 3EZNA 4O59O 1MKYA 2DPMA 4DR1B 1SA0B 3F6EX 4D41A 3GCGA 2XE4A 5IM4F 3OBBA 4HGPA 1XMSA 2ZAYA 1XGKA 5G3YA 3ZHXA 2AI1A 1XDDA 2NACA 4C6RA 2VNHA 2F76X 1P2TA 2O2HA 2QL5A 1T13A 4TXMA 2D5BA 3RJKA 1E77A 2AHOA 2K7FA 3TVDA 3AETB 5C34B 4F2HA 1LBEA 2DLCX 3WJAA 4J0DA 1AT1A 4KLUA 1BXRA 1J9EA 5LQRA 5A05A 1QS0B 2DPIA 4GM4A 3I52A 4PTYA 1D8BA 1P29A 1EEXB 3SR4A 1LVGA 2EH9A 4JU9A 5FWXB 5ALVA 2O3TA 3IDOA 1W6UA 2FLLA 2IS6A 4N0DA 2XEXA 2D0DA 4WA7A 4BQSA 2O1WA 4LOKA 1TJNA 1ZD2P 3S2GA 2E5LB 1N33B 3EZ2A 1QQTA 1PS9A 4CMIA 1L4UA 3FCYA 4IDFA 5AI6A 4GEKA 1GXSA 2UAGA 4MDYA 1JG3A 2P6OA 2OOKA 3E0XA 3GDHA 1BHJA 1DAGA 2VYVA 1P2UA 4MB6A 2QQEA 2XUHA 2OA0A 2JLCA 5MHTA 1Z3IX 4TQ9A 2WILA 1JI3A 3MUOA 3ACCA 4AXXA 2OKGA 4PRYA 1W36D 4Y0AA 1G0NA 3JZDA 2J6BA 1HNNA 1IQ0A 4ARBA 3D6JA 1KRHA 1E4OA 3CN7A 3NIDB 2IOFK 4DV1B 3L84A 2J8ZA 1VPTA 1GGVA 1EGMB 1GG5A 1TZKA 3JQ8B 3BCHA 4RSMA 4IWXA 5FP0A 4V0SA 4C20A 4AY3A 4PC3A 1U2TA 2PSDA 4EJSA 3TS1A 4JBHA 3OE1A 3E84A 2JIMA 3NHYA 2C1EA 4AJEA 2ICAA 1QF6A 3TUIC 3QXGA 2IPLA 1AS2A 1JIQA 4MDFA 3DONA 1DBRA 3DWIA 2Q5CA 2FFHA 4Z1MA 3UXHA 5LZ2A 3LAWA 5FO1A 1U9CA 2AWOA 1E8MA 4EG1A 4QWMA 3AX6A 4JLVA 4XRHA 2VFAA 1OLOA 1WVMA 5EHNA 1JECA 2JH9A 2W6ID 1EAMA 3CUYA 3RABA 1S2DA 1UFQA 4MQ6A 3UJNA 1G4UR 1PFQA 3CLUD 5DM0A 3WMGA 2ZXEA 4PQRA 1Z4IA 4P83A 3RUDA 5YASA 1E5QA 2F3SA 1C1YA 1EZZA 2DKFA 4R2XA 5HS4A 2BQRA 1E0JA 2BCGY 4HGOA 1WABA 4WFQA 2VYND 4GZ6A 4XM0A 3CEPB 5GOZA 2Q99A 3HY4A 4XARA 1IY0A 5CVTA 2AF4C 3JSAA 1ML4A 3TM5A 4JS0A 3P9NA 1MX3A 2WWGA 4XDGA 5C35A 5IKEA 2G80A 2X58A 1HLFA 2GARA 1XIVA 3NAGA 2WTMA 1E3SA 1JJAA 5J2GA 1R74A 4ZGWA 3V8RA 4XJSA 3PYMA 2IT1A 3X1ZA 2GSWA 3SEFA 3NHFA 4JEIA 4BJ1A 1UBUS 1CUEA 4BZZA 4WOJA 3VZQA 3I64A 4JB8A 2J5BA 3TQFA 3FDFA 5C32A 2QRJA 3GRPA 1XMVA 3ESDA 2JCGA 3ZDQA 5G53C 4ND4A 2OFFA 5J5AA 1ZIDA 2CLMB 1TMKA 4QWEA 2OXIA 4U7FA 2AZTA 4ZN6A 2VA2A 3KSAC 4F3CA 4MKGA 1K86A 4MVJM 2R7NA 3FVWA 2L82A 1N2OA 2HMSA 3JQFA 5JRJA 1FC0A 3CR7A 4YAOA 3IXLA 5FOSA 2P5SA 3BPSA 2FP4B 5G1PA 1PNRA 5DASA 3GUZA 3TZBA 3QEKA 1G21B 5HW0A 4LKOA 1UMDB 2YB1A 4Y7DA 4EENA 1L3CA 4C7BA 2ZT6A 4DEYA 4L5JA 2NTEA 1DZIA 3PX3A 3IT1A 2O20A 4J6FA 4A0SA 1Z8DA 1CFJA 3CYMA 3IVMA 2FZ4A 4J0GA 3E03A 3SYNA 4AO8A 3KQLA 1A0OA 1YR2A 4RS3A 3WOVA 7ICLA 3RU2A 3I5XA 5TXGA 1ORTA 1NDQA 2NOAA 1M10A 1FRZA 3DZHA 2VYNA 4ARZB 2V7GA 1GR0A 1KFBB 4IGIA 1Y0BA 5JMWA 3TOZA 3ZV3A 2JGNA 3DQPA 2ASLA 1OLUB 3QZ8A 5KSOA 1TMYA 1GL7A 4LJ6A 3AP1A 2PUVA 1VTKA 5F3XB 1C7JA 1R0WA 4C0JA 3HR4A 3EDOA 3WGIA 1OBOA 4B3JA 4HHEA 4IFTA 1KSHA 4QUAA 1H8HD 4KXXA 2BMJA 1CEYA 6CHYA 4JP5A 4LISA 4P2BA 8ICCA 3T7SA 5G02A 5JNUA 1RQ2A 2QP3A 1DAFA 5JAZA 1G16A 1MT0A 3KQYA 3O38A 4I2BA 3LNTA 2EQBA 3FDSA 1F5SA 5AM2A 3NYWA 1O9HA 4GGPA 4I50B 5FULA 5JDIC 5TMPA 4O3SA 3HGTA 1I7QB 5DLYA 1J0AA 2ENWA 2XYVA 2VDOB 4O2BB 1EP9A 3TSOA 1G8KA 3K6JA 4BLSA 4EW6A 3GFSA 2QT1A 1RM4A 1X8LA 2RKWA 3AR3A 4HPXB 2Y68A 4B3IA 4JLAA 3PEEA 3SZUA 2EJCA 5FTWA 5FPYA 3M3HA 2QL9A 3SBEA 2AOTB 3R7SA 3EVBA 3EVEA 5ALNA 3ZQJA 3V9PA 5IEJA 2DE0X 1KEEA 3GU3A 5B55A 2R8KA 3M4NA 4CIWA 4LXHA 3RF7A 3M4XA 3ROTA 3A4MA 2H4JA 3DEZA 3M4JA 2RGXA 3NHPA 2XJ4A 1JKJA 4LDRA 1O94C 2DCUA 5FOUA 5JNLA 1OX4B 2P5TB 5C1OA 3ACDA 4FVTA 1E66A 3ENZA 1V5EA 1URPA 4MUBA 5CRIA 5CYPA 3SV3A 1KI6A 4YP5A 4XVCA 2M1ZA 1UJ6A 4NJMB 3NTXA 2JLRA 4L8WB 1NFRA 3OPNA 4AU1A 1R5JA 3CV3A 3Q1LA 2V0CA 1P7CA 1SXJB 1R6TA 4MA4A 1GL6A 3ZJTA 2FOIA 1JXEA 2XTMA 1H42A 3P2JA 2CJWA 4KO8A 4BFCA 2DGZA 2GLXA 4FFBB 4X7RA 4QBGB 4N1AA 2RDJA 1H8HA 5IULC 1V11A 2MU1A 3V8VA 3DZBA 2QDKA 5HXAA 3RJGA 5GZ1A 3LXRA 2YYSA 3Q3CA 3ZV5A 2WG1A 4ZICA 5JDCC 2HRDA 4RX1A 3W3AD 2FJPA 1SIJA 1UUFA 4A23A 2LPEA 3TCXB 5JECA 3LHSA 3PZBA 4DABA 4LZNA 3IDQA 5GAJA 1RVDA 3F53A 4GOOD 2R7MA 4TYQA 1K8ZB 1S0UA 1OT5A 4O3QA 3KR2A 1PR6A 2KKVA 3OZ7A 3E3MA 1E63A 4MKXA 4PTLA 2GTPA 4FS3A 4XOUA 3R23A 4DR4B 2XVZA 4KZPA 4K9LA 1E2GA 3P52A 4EX6A 1DIAA 1G7TA 3E0QA 1TL7C 2JKYA 5JEDA 1KTVA 3QKWA 3NBMA 5BNIA 1GUFA 4X93A 2P35A 4JITA 3LI2A 1FX0B 5AVKA 4O8CA 3Q0EA 3ZDAA 3OECA 3ZE6A 4AIRA 1SUIA 4BKPA 4E70A 3UCFA 1XTPA 2FG7C 2N1BA 1JHMA 3CEAA 3DUFB 3FPHA 1CR2A 5EPOA 4HTAA 4NZPA 2RHGB 4JYMA 5REQB 3G6YA 1IY1A 1C7QA 1KJYA 2VHUA 2F1KA 2W54A 4TSKA 3J80A 5D00A 1XD2A 1MB4A 2IWHA 2JXJA 5A7HA 1Y98A 2VPQA 3AUAA 3MQ2A 1NASA 4U3JA 1U0JA 1NJ1A 1T4GA 5HKAA 4A8JB 2WFLA 1E3JA 2FPWA 5CPFA 1SWWA 5IAKA 4GGOA 4LBYA 2YRFA 1BCSB 3BRCA 1I2MA 2G17A 4XM2A 3OFSA 3CNEA 2NZ8A 1FE8A 3VOSA 3VAAA 5AKXA 4L57A 4QU8A 1I0ZA 1JH9A 3IQDB 4W5OA 5EUBA 3AXTA 5JZOA 1PKXA 3UN1A 4L7QA 3N86A 4B3SB 1E79D 1HT1E 3EVAA 1EA7A 3ANSA 3AK4A 3U0VA 3QJYA 3UWPA 5ELLA 4B48A 4ITUA 3W2FA 5ADWA 1YKFA 4FZ5A 4Q7LA 5FLXA 1U90A 4DHWA 4XQ9A 3GHHA 4MUYA 3DYBA 3IUBA 3EDYA 3RIMA 1WBDA 3QUSA 4FP9A 5J29A 3W5SA 2ZYAA 3W34A 4KX5A 2EZYA 1C9MA 1QH1B 2W2QA 4BU0A 1H05A 3AKDA 5JBIA 2D2VA 3GFFA 3R3XA 2A86A 4XM1A 5TMEA 4RKFA 1ICIA 4K03A 3TLAA 3SZRA 4X1YB 1W49A 1Z5VA 4UBCA 2J3JA 4KH0A 2W8BA 5JISA 2XB8A 5FORA 1NVFA 3COJA 2QVLA 2FMTA 2WPNA 4M9ZA 3RC9A 3BQMB 1XNHA 2B0JA 4IWNA 1KI3A 2XTAA 1XKTA 4YFVA 1LV8A 3VPSA 1YMVA 3EGXA 1E2EA 2Z5FA 3HXQA 3ANYB 1PG0A 4C7MA 4AUNA 3ZGYA 1FVOA 2NWQA 3I0MA 3VFDA 3KJFA 1EUQA 4LVOA 2R2AA 3LY7A 4RAOA 1YZTA 3F6PA 3O9MA 4PY2A 5DE3A 4C2UA 4FUTA 1OI2A 2ZDHA 5KYGA 3EPGA 3PTAA 5IHPA 4OV6B 4C7ZA 4F0JA 5CBPA 3D3QA 4UU7A 3ELDA 5ARCA 3QKRB 2QX6A 2A1TR 2YZ2A 1A5SB 4BMCA 1BQ4A 4M9LA 1K98A 3DSRA 2FPGB 2MYTA 5KJFA 3IUEA 4FN4A 4BNJA 3B3GA 1MVNA 1IUNA 1N0UA 1DKRA 3IOMA 1D9FA 3T5DA 4EEXA 4RL4A 2G7MC 1K6JA 1OPXA 3GUYA 4D4HA 4ZCPA 4F2WA 4RABA 1N4AA 4KIJA 2G1JA 4XLTA 2KJ5A 9ICNA 1VRWA 4RQAA 2ZSHA 4QVIA 3L43A 1X94A 2QLBA 3ULKA 2Q0ZX 1QF9A 4PX5A 2Y1IA 1X9IA 3VDRA 1EP2B 5E4JA 4BTLA 3H11A 1EFLA 5KFNA 2ZVPX 4WESB 3PGLA 1EYZA 4B31A 1AJEA 4HUQB 3IVGA 3EAGA 2OCXA 5J3JA 2WUEA 3ES9A 3WK4A 1F60A 1IWBB 4FLFA 2H16A 4NS4A 4BNYA 3AUUA 3RSSA 4CETA 4FINA 3E2IA 1OGYA 4J7CA 1R27A 3LLVA 1H85A 4F84A 4MFAA 1KIAA 2V6MA 5M34A 3IQGX 2VQEB 1Y81A 4CGYA 3STYA 3IR5A 2H85A 1R18A 4O33A 1NJ8A 3ZY2A 4F97A 4C8LA 4UB2A 3EDRA 4ARUA 1C20A 3RANA 2GPWA 1WXHA 1GDTA 2FDXA 4IRMA 4Q1EA 4CTJA 3IQWA 1SKUA 2EWMA 4A8PA 4IJ5A 1C7IA 4E4YA 3MTIA 5FBRB 1HO3A 5K0BA 4P8RA 2CHVA 1WZCA 3QWBA 1AA9A 2N46A 1SZDA 3H4TA 3E58A 1OCEA 5DNDA 3STWA 3HCOA 2CB0A 5CXSA 1RYEA 3UXPA 1USKA 5ARDA 2BD0A 3IPLA 1K27A 3FM9A 2C3UA 2DY1A 4OJQA 1GTJ1 4PIPA 2VIXA 4X60A 1QRRA 3NM4A 5TEWA 2Q4RA 2B4RO 3M9XA 2KVCA 3FC4A 2P1DA 2CLFB 1K97A 3W9YA 4C0SA 2OHVA 4EF5A 5IIIA 1OLXA 5KTQA 4Z9YA 8ICSA 3TWOA 3L02A 4IYJA 4E30A 2C1ZA 3PC7A 2XNDD 5IAOA 2PDAA 3O90A 1S77D 1SXGA 9GPBA 1TQ6A 2J3EA 4DC1A 2ZULA 4ERNA 4F1KA 2GF0A 4LVUA 1X7XB 1UPHA 2YN0A 3NXSA 5MN4A 3A9RA 1VJDA 2KVSA 1HNWB 4JMUA 3NNSA 4CLXA 3K9HA 5KNBD 3FCEA 3P9IA 1NBMD 3RDPA 4OK3A 5H4GA 2W4IA 4X3PA 2NU8A 3V33A 3FXAA 1XLVA 4PPGA 3VKUA 3GEDA 1VJRA 4C89A 4D9HA 3PQCA 4ZRMA 3GDWA 2DUJA 3QVGB 3GYBA 1W85A 3FJ1A 3GIJA 4A8EA 4QOGA 3HUDA 3AESB 3M81A 3U44B 4YY3B 3OQ1A 1EB9A 2DJ5A 1GTMA 1RXVA 1KYWA 4IQ8A 7YASA 4TUPA 3DNMA 5AUPB 1XWLA 4J90A 3VSDA 5IBCA 1FY2A 1ZU4A 4WXEA 4AJPA 1L7VC 3EK2A 5LBIA 1Z5ZA 1M2VA 3KB2A 4DLEA 3IE0A 5BVGB 4EB6B 2O54A 4ZCIA 3IJRA 3A04A 2OQ2A 3MMSA 2WMDA 5FH9A 1AN9A 3EMKA 4JVOA 5KL1B 1Z2AA 1DK3A 3KHLA 4KLFA 4DTIA 4Y98A 4GKVA 1Q7TA 1NLUA 1B23P 1Z83A 5AHXA 3RR2A 3L0IB 5AIBA 1WOYA 2B36A 5JROA 5BSEA 3I2JA 4A5SA 1RNLA 2PMKA 1QPZA 3MTAA 4IEEA 2Y1EA 2L18A 3JYQA 3QI2A 1WXQA 1J39A 4D9CA 4QOSA 4G81A 1G20A 3CIFA 1SVSA 1W94A 1L5QA 2XNDA 1IATA 2VZLA 521PA 4CIXA 4Y1EA 1KMHA 3A1NA 5KB3A 1E1CA 4YMLA 1XK6A 1Q74A 2QG6A 4EI8A 4NF2A 1FMCA 5AQ1A 3P2YA 3UAZA 1GNPA 4Z4QA 3BDAA 1X1CA 5C8ZA 4S12A 4FNOA 3Q8XB 2FLNA 1L2TA 3HFJA 3JPOA 4Z7OB 1L7PA 3HXPA 2QUKA 1WV0A 3U4HA 1K92A 4M0DA 4TMXA 3F3SA 3I5MA 1SBNE 4IJ6A 5BYJA 1V6AA 4KLNA 2V6JA 3BZKA 1TZ2A 3VDXA 4QUDA 4KN5A 3EUFA 2ZJOA 2FMHA 2FE4A 4MEAA 1CX9B 2W7OA 5GADl 1RKXA 4MVJG 4RAQA 4EGCB 1UDRA 3UJCA 4TV8A 4Y30A 2ACKA 4WXRA 2A2ZA 1Z47A 1FTNA 1QHFA 3DMFA 5JD5A 4D26A 2ZJZA 1OIXA 3HVUA 1TTHA 3U19A 5LP1A 3RF6A 3QVTA 2PRJA 2VT7A 2XMCA 4HMPA 4F4DA 1UK8A 4X00A 4JP1A 1FXWA 4MLCA 4NENA 2VC2B 4DJEC 2W6NA 1F7VA 4OK6A 3I30X 1VL0A 2IZ1A 4NPHA 3ZZNA 3H75A 1UK7A 1DO0A 4FKZA 3KJNA 5CX1A 1GM5A 1Q92A 5E3HA 1P1CA 4YJHB 4YRZA 1XMJA 7ICQA 3C2QA 1MZVA 1AKMA 4HQKA 3UMYA 2Q21A 5EIXA 3Q3HA 4IH9A 2AHRA 4COKA 2QJTA 4HVLA 5IX8A 2IYTA 3H4IA 1FYEA 2PX6A 2VPYA 3UMCA 2W22A 1VHTA 2IUYA 1V96A 4UHHA 2VPXA 2YTZA 4YRTA 2Z7JA 1S0NA 1V5WA 3MK31 3K15A 1I3CA 5I7FA 2OHJA 4HFRA 1N2HA 2PYIA 1Y1RA 4UU0A 1PJAA 2KKPA 1TQDA 1UZUA 3NKFA 3PHGA 3SFVA 4FZ3A 3SDSA 1AG9A 1EXMA 5TRTA 3ELYA 1Y5MA 3ZK8A 2VQSA 4CJXA 3E4CA 3FRIA 1W46A 4JJKA 2EGUA 3OT5A 4EJ6A 1J5PA 1UXHA 5CDFA 5FLEX 2HHWA 4KLZA 4RD1A 5J9FA 4OMUA 1BMTA 2PLRA 3MJTA 3WNCA 1X9XA 1MB3A 3MRXA 4QECA 4LC1A 2EX0A 2XXAB 3NZEA 3CF0A 4MI3A 1YT5A 5D46A 5LYJA 3LBFA 1G55A 1J1ZA 3PG5A 2GEVA 4IZHA 2PQMA 3B3AA 4M9SA 4I81A 2DP4E 3RI3A 5FEMA 4LTNA 4CHGA 5KT5A 2J59A 4L0CA 2NV3A 2KZ3A 2AN3A 3ASUA 1XSLA 2W6JA 1YB4A 1ESDA 2ZKIA 1ADBA 4J0HA 3O84A 3FFBA 1GKUB 5IIMA 3PC2A 5KKCA 4I66A 2XWQA 4UNNA 2BPOA 5I9SA 2X5XA 4UB5A 2BZSA 4BNTA 1HG0A 1KOGA 5IJXA 3D31A 5AM0A 2FMFA 4BBPA 4QBIA 4DTCA 3R3ZA 5KTKA 1UAGA 2RI0A 4Q39A 4H0CA 1H2YA 3RB0A 4AJ1A 2Q5JA 4CIYA 4F2RA 1ZA1A 1PT9A 1RAGA 1ZI9A 1P60A 2HB6A 1VOTA 1UBHS 2EFCB 1HL7A 4CDRA 2I6UA 3LE8A 3RS2A 3BS5B 4AQYB 4IMRA 1DBIA 2AOUA 5FTJA 1E0KA 3FNGA 3S2EA 1PTJC 3SENA 2ZSEA 2Q3HA 3V4PB 1MJGA 1FYVA 3OD5A 3I2GA 5F3RA 3TR6A 2FG5A 2OCAA 1DGQA 4W8GA 3I23A 4F38A 4C43A 3SLGA 4JC4A 5G40A 1GADO 5KTRA 1SKMA 1R6DA 1OWOA 4C0AC 1PX2A 5EAIA 3M9OB 2VK4A 4F2PA 4RPIA 5LZ9A 4I2AA 3A6FA 5CFLA 3K16A 2HFKA 4MWCA 2R4UA 1XDSA 1UOPA 2V3VA 1LBQA 2QMHA 4TXJA 1AS3A 2ODBA 1H4VB 4IKPA 9ICEA 5HKBA 2QWXA 2C82A 2JCVA 4HXEB 2D00A 3ECCA 4NK5A 3W3ZB 3PV8A 3LDUA 4EBDA 621PA 4X66B 4K9SA 3LPMA 1RXSA 5DI3A 1PZNA 5KYKA 4ZEMA 2C4WA 1V9SA 1WQ1R 1JUDA 3RJZA 4MRVA 1QR6A 3U7HB 4DSUA 3SYLA 3ETGA 4EQ6B 4WK6A 4C2BA 4QYIA 4ELVA 1H1LA 2XF2A 4JL6A 2C97A 3NOVA 1N5XA 2CMHA 2X8JA 3IMGA 1JTVA 1DIOB 4AKTA 4XWOA 3SK0A 4GVLA 4BUJA 1Z13A 2JZOA 4E14A 4FLMA 3DBRB 5KWSA 5J2UB 2W6PA 5JSZB 3RKRA 5BPHA 4N8EA 3LCRA 2D6FC 2EVWX 4I4TA 8AT1A 2RHBA 2ZJAA 3SQDA 2ROQA 1VB3A 5FL3A 4IWYA 5JJIA 1LBSA 4I4LA 5M3BA 3DF7A 2XJ9A 3D6TB 4LF7B 1A77A 3AFGA 5B7GA 4AMGA 4RHEA 3B60A 4U63A 3KV1A 5T7BA 2BFBB 3IPXA 1C9EA 2VHZA 1ORVA 2VJCA 2PQ0A 1G3QA 3PL5A 5JALA 3RJJA 1L3TA 2AGVA 4U39A 2HIHA 1HDYA 4U2CA 2WW8A 2D8MA 5AVQA 1PJBA 4JK3A 1BOOA 4M38A 4EHIA 4HD8A 2ZIWB 3P0IA 2R1UA 3A0BU 4AJHA 4Y6GB 1TYAE 5AVRA 3AR6A 2F9LA 1HORA 1CSEE 3CZ9A 1Z6YA 4QREA 2XQGA 2Y05A 2HT1A 6AT1A 1T29A 5KT2A 3F2VA 2WD7A 2XD4A 2EANA 1VPEA 5G41A 1L7NA 3IMFA 2B5WA 4HNHA 4E1AA 2OCPA 1L8OA 3COYA 4J9SA 2AQ8A 4NYIQ 3RUPA 3TLJA 2OQIA 3G9XA 1N2JA 2B98A 3NBYC 3CH5A 2AW5A 3G0HA 2B8JA 2XVMA 4B4UA 2ZYHA 1A98A 4KPFC 1PUJA 1C0LA 2ZTUA 4E88A 5D4BA 2FKNA 2N42A 4M46A 4H1UA 1LNSA 1JE0A 3EPIA 1CKEA 1PV4A 3ADPA 1GCUA 1Z16A 4EGAA 5E7QA 3OJLA 2HK7A 2Q3FA 4NECA 3FAKA 3H9QA 4JGGA 2WD8A 1IOLA 3BXEA 1OC4A 2JIRA 3LUGA 3G8DA 1KC3A 1U0LA 1FDOA 2XCQA 1H6BA 2O2JA 5C51B 4C3ZA 3BQ9A 4WJZA 2BP7A 3HKCB 3I12A 1IBSA 2M98A 3Q7TA 3TVYA 4ED9A 1GPYA 2FZCA 2FI1A 2B8WA 2R6AA 4OJMX 5ALEA 4AROA 5MFZA 4O5CA 1U0FA 5JU6A 2UZ3A 2XB6A 1AH2A 2OP1A 2W58A 5DBBA 1NR1A 1RWOA 1X7ZA 2IYXA 2BEWA 1OV4A 4PHDA 3C5CA 4NBUA 3WICA 4YK7A 1RM5A 4NESA 1VG8A 5IIKA 4R9SA 2ACVA 1BYIA 3ZW9A 2R8IA 1PFUA 1D2AA 3Q7IA 2EXXA 3I61A 1L5NA 2I0FA 3RVBA 4HRVA 1JIKA 1VA4A 4B3GA 5BSTA 4PH5A 2VQ6A 1P61B 4RQTA 1K5GA 3T9FA 3EXIA 4UE6A 5AXAA 1O5OA 2L42A 3OEHD 2E4WA 3ZWYA 3FR8A 5EE9A 5DB9A 3LJKA 1XYGA 1SC1A 5HUQA 2A5LA 5L9XA 1PX0A 2VYCA 1ULBA 2AZXA 4FYXA 1GU7A 1NXTA 1BH6A 1XTQA 3MR5A 1IH8A 3JD2A 3NGXA 4ZHQA 2B30A 4HLUA 4I5EA 4Q7KA 5T4BA 4F4YA 2H2AA 2A6PA 1YIOA 1W34A 2GJ9A 4B9VA 2HHJA 3ANNA 4P4SA 1MXFA 1UL1X 3LCVB 4NFSA 4ALKA 4M7PA 4LCEA 3N0WA 1ACMA 4OLAA 1L4HA 3UHJA 5EE3A 1GYPA 2P68A 3OT1B 4K6KA 3HZRA 1CEQA 4EATA 1KTQA 1WCYA 2E37A 2V59A 2YWCA 2QYSA 4RYDA 4NBWA 4GE0A 3BMOA 4J91A 1YOVA 3MABA 2PNJA 4KYIB 3CNHA 1OZ0A 3ISJA 1NN5A 1QH0A 1WHSB 2FPLA 3O21A 1T10A 1BVRA 5HBGA 2GH1A 5AI4A 3SYRA 1IPHA 2YIDA 3DBLB 1MENA 3GJTA 3EYWA 5HG0A 1F0PA 3NVAA 4ECRA 1T34A 4V0KA 2ZJ0A 1QIDA 4V24A 3UA4A 5IH7A 1DK2A 2A4MA 3CPJB 2CT8A 1JIVA 4UQPA 4N0MA 3L92A 3QY9A 2H7CA 2JRCA 4Z4GA 1ZRHA 1Z26A 3GA0A 4V1CB 3F8TA 4WKOA 2PBRA 4OMCA 5G0WA 3X0DA 3K71B 3HJCA 2ON6A 1HOTA 1YCFA 1WBJB 1NNEA 1UP6A 4B81A 3K5HA 4LGMA 4OPMA 2C8VA 2REQB 3MB8A 5ICSA 1PVOA 4ZQHA 3LUJA 1HT0A 1NMXA 1DKPA 2E1EA 1NQ5A 4WBNA 2WM3A 1IM5A 2R44A 4HZUA 3OEHA 5KSPA 5IWCA 1E5DA 4CEHB 2FGKA 5BSMA 5EJEA 4PAOA 3EZGA 2GN8A 4MO9A 3IUQA 4L1KA 3HHPA 4ND3A 4B7CA 5TLSA 5L1KA 2J33A 3AEZA 2YFHA 1AZSC 2BUCA 4BQFA 2R00A 4BVFA 5JMOA 2BFDA 1GLGA 2A9JA 1SJ9A 2QTTA 1WRBA 2EYQA 2YW9A 2OP0A 3RO7A 4FDAA 1WHTA 4HQFA 3KKKA 4Q3DA 3L1HA 1IFXA 2HWWA 1C8KA 1EDOA 5DYIA 1XD8A 5E2IA 1M33A 5ICGA 3D3JA 1RM3A 3ICOA 4NZMA 4JQCA 1RT9A 1ZQHA 4AMBA 1WDMA 5K20A 1QJ4A 2IOFA 1QNLA 3KRTA 3TTSA 1B42A 2M1XA 2ZJFA 4CWAA 1RKVA 1YC5A 4FCVA 2XE7A 5KNDD 4WY5A 2F8MA 3HDHA 2FUKA 4QX6A 1JXQA 2ORWA 3USCS 3IODA 5IC5A 5I8ZA 1J56A 3L8CA 4O5KA 4NQZA 4W6QA 1TDJA 1ZWLA 2LCIA 4R1LA 1L5HB 3LVQE 1HX7A 4B6JA 4I8DA 3HB1A 3G2IA 3QVUA 2XY5A 1SRRA 1ZMTA 2JW5A 4QNMA 3LTNC 2H5JA 2CL5A 3T3FA 2IBSA 1N5IA 1VG9B 3PWSA 2IPXA 3KD3A 1DEXA 5EJ9A 3CHYA 1YSCA 3E70C 1XVLA 5ADUS 3RT1A 3Q15C 2YWEA 1U63A 2OCLA 1MR3F 3PXEA 1ST3A 2DWQA 4FD2A 2V74B 1B41A 1T5DX 1P0IA 3Q40A 3PHIA 4C7VA 5DXFA 1M2EA 1TLFA 3JQGB 4NPCA 1Z56C 4GOJA 3F7MA 2QRUA 1VHQA 4PGAA 4BLTA 3VTKA 3ZWXA 2IYLD 4XUCA 1T5TA 3VPAA 1NJFA 3AW9A 1T43A 4HY3A 4MJ3A 3EQ8A 3AVPA 1LSOA 3UWOA 1JR3A 1GKIA 2A0KA 1JEQA 3ZHRA 1EX7A 1PEDA 1P1KA 3I73A 1Q1AA 1P2GA 4PHEA 2XHZA 4OL9A 4QELA 3V1MA 4AS3A 3W6NA 2O7SA 3B9RA 3MERA 1TM2A 1VBNA 1FU4A 1P81A 2AE1A 3TFRA 5GONF 4LZLA 3FNFA 4LF6B 3WB0A 2A3NA 1E5TA 1UA0A 9ICRA 2V6BA 2LZ0A 4MVXA 2WE8A 3MPOA 2FB9A 3LX6A 2G5GX 2XWPA 4DQLA 3KEOA 4Z7NB 1DC5A 5CEHA 4ZDIA 4FBMA 4DQUA 2JBAB 1CJBA 2KP7A 4NZNA 2BM9A 3NR2A 3NRJA 2AW3A 1U9IC 1UEIA 2FX2A 3RBVA 4NBRA 4E31A 1DQPA 2IWRA 5AHOA 4BO3A 5JT1A 1XXHA 4D9EA 3TQOA 2HM7A 4D9NA 1CVLA 3SU8A 2JRLA 4YJFA 3HXOA 2F1RA 4MINA 2GJKA 2AG6A 1QP7A 5CDUA 2G76A 1D2HA 1JMVA 1KBOA 3A6ZA 4DCGA 1MJNA 4Z2YA 4UNRA 1L6IA 4M1YA 3IEUA 4EEZA 4II2A 3N3AC 1Z4JA 1D0IA 5CP8A 1M2WA 4MV3A 3EIXA 1TK2A 2DG2A 3A0HU 4ALIA 2ZWMA 5DGDA 1SQSA 3IKMB 1JJIA 1X1BA 3ROQA 2AC7A 1U5BA 3UC5A 1DX9A 5ITSA 2VP4A 2H59A 4TKUA 1T4CB 4XYMA 2L0XA 5K5EA 1Q0QA 3DVSX 5KVSA 3L8YA 3HRIA 3FKSD 3K0CC 4OM8A 4IIBA 3RBEA 3ZLJA 1P7PA 3NOXA 5HBRA 4QT0A 3CNBA 4I2FA 2B1IA 4C4AA 4P31A 4MR7B 5CA1B 3OZFA 2FXIA 3RH4A 3GDGA 4N3GA 4B84A 3JQ7B 1BW9B 4E03A 3V7WA 3FAHA 1JG7A 4ZDJA 4D46A 4LBWA 1DRUA 3WYFA 4UMVA 2J0UB 2YHAA 2VH5R 1TA4A 3T1TA 1GP2A 4OOFA 3H5IA 5ALFA 3H8JA 4RPCA 1KS2A 1XRPA 2NNLD 3HRKA 4ZAGA 2EJBA 3VJMA 2QNRA 2IGTA 3MTDA 1LX6A 4P7GA 3PC6A 2BGMA 4K40A 5EWJB 2BW0A 3C24A 5BRAA 4PIMA 2OQVA 4F50A 4W5TA 2D74A 1IG6A 1UQTA 3CN9A 4KRYA 1AUPA 5EN4A 1UF9A 2EFEB 1HDIA 3DEAA 4GX1A 3KSRA 1E98A 5EINA 4RJLA 1HDZA 2G7ZA 3KKLA 1AS0A 4U7GA 4MITA 1AHIA 3I45A 3R0QA 4QA9A 1K2VN 1K68A 1AV6A 1JLRA 3UGTA 3WLJA 2BCSA 3LUBA 3FLMA 4I3FA 3W5AA 2J48A 4P92A 2Q4TA 1BEUB 3L7AA 4OMDA 1SZCA 2E87A 3QE3A 3ZBQA 4IHQA 1UT6A 2H9YA 4HX5A 2VS1A 4HADA 3LC2O 1TKBA 4NI5A 4TV9A 2VDLB 2YHIA 5EMJA 3ZI4A 4BGVA 2HKIA 3LUHA 3BSSA 1ZO8A 3KYCA 1G5FA 4J16A 4JP8A 2CFSA 2IRWA 1ND5A 3V4OA 4U6SA 4GPEA 4ED0A 1VKHA 4DEVA 3KKOA 1UMKA 5K09A 5H70A 3GCZA 7ICHA 5LMNB 2PXCA 2EQ5A 3KYDB 2WJJA 2XCAA 1U9LA 1EQAA 2QIOA 2IXDA 3U1BA 5HGJA 2G1UA 2RK6A 4MQLA 1C4XA 2YS6A 4OSEA 3WGLA 5D1NA 3DTYA 2IPOA 3VAZA 3EG9A 4Y18A 3WL4A 2I2DA 3DT8A 1DKLA 4QUKA 5A0LA 2P9BA 5HK8A 3ANLA 5SZIA 3ZVMA 3HZHA 1Z2OX 5J8YC 1T9GS 4S3MA 2IHZA 1XZIA 4NABA 4R41A 4DDHA 4ZMRA 1WVGA 2OCDA 1W4ZA 2OOSA 4BGIA 5KYWA 4EX7A 1V6SA 4IQWA 3UB2A 2W6IA 3R6WA 3GUCA 5B57C 2GHTA 1GRCA 4DIFA 1ZICA 5T8KA 1A2OA 1UFVA 4OBEA 2ARKA 3R41A 3DMYA 1LQTA 3AEXA 1FLDA 4BUCA 5JYEA 5BURA 3Q8PB 5I4CA 4TYPA 4F06A 3T3GA 2J6HA 1KKXA 4D4LA 2RGWA 1X8JA 1VCMA 2B2CA 8ICGA 2FVXA 2H0QA 1TM5E 2DQ4A 2WFMA 3NQ41 4KV7A 2BTOA 3ZNOA 3TADA 3L7MA 4JL5A 4P35A 3T9CA 1WCXA 2O23A 3MMPA 3QFHA 4ZEVA 3GLHA 4BTVA 4DXDA 1QFYA 4AUKA 5HOQA 1LPMA 4ZT6A 3W05A 1KNXA 4ETWA 1PJ2A 2H5LA 3KHSA 3ZGNA 3PNSA 4N7BA 3A6PC 1G291 4H59A 4NDNE 4LSMA 4KAXA 3U9SA 4RQ6A 3N28A 2RGGA 4GBMA 4L4RA 2VXYA 2XQIA 2IK8A 1MXHA 4Z4EA 3BERA 2BHSA 4W63A 2C4HA 4QTUB 4C5AA 1DTSA 4C7OA 2G6TA 1Y7IA 4FS1A 3KHGA 3UFBA 4DLRA 5FEUA 3EY9A 3BIOA 5FV7A 1GYQA 5EZ6B 1M6VA 1PL8A 1C4KA 2WOOA 1TK0A 2P2LA 1Y6ZA 1NWHA 4UB8U 1GQSA 2CEKA 2FW9A 2KD1A 1IC6A 3GJ6A 4F9FA 1W2WB 4H6PA 4K2HA 2XF8A 1Z2NX 4HC4A 3PDHA 4LRYA 5DULA 2ZKLA 1GAEO 4QXMA 1XTJA 4PNHA 6YASA 5ICMA 1AUOA 3IC5A 5AKYA 3BJIC 4JR2A 3OJ0A 2QI9C 3TZEA 1J2EA 2DF8A 1KTIA 2PWBA 2YJ3A 3WS7A 4F21A 1E7YA 4GL4A 1EAYA 4R7GA 2QMYA 2C5SA 1Y8QB 4FQ8A 4K6GA 2X4GA 4QWAA 1YAJA 3OIDA 4UREA 5KJ1A 4DSKA 5SZKB 2XE6A 3NXKA 3RARA 5EMNA 5AD1A 1ZQLA 5F4BA 3GRZA 1T0PA 3HWX1 4PANA 1HDOA 1XDZA 2Z4TA 2JLAA 4ACBA 4XR4A 2R6FA 2EQAA 1Q12A 2J3QA 4KHZA 4IDHA 1DDIA 4UATA 5DGTA 1EE2A 1DWOA 1OFUA 6REQB 3VU0A 4DJFC 9ICAA 5BWNA 1RYSA 2AEEA 2XNKA 1JU3A 1V95A 1K66A 3C3KA 4BJ3A 3EH2A 1ZCZA 4GXTA 3ZPXA 2Y0BA 3MLBA 4NDAA 4WBXC 2I78A 5DYNA 4YJ2F 4JJ8A 4IOLA 1Y8CA 3K0AA 4O2RA 3UYLA 5IT0A 3FOEC 4R40A 3V6MA 5FHRA 4YV7A 3OQMA 2JRZA 1UANA 4BNDB 3TOXA 4JENA 2I29A 2UXBB 3QM1A 2NO4A 4ENSA 1BYUA 3LCUA 1JLLA 4RMGA 5K2OA 3HH8A 4Z6FA 1CDDA 3MJSA 3OLZA 3RU7A 1LNQA 2QRMA 5LDHA 5BYAA 1M7BA 3UXEA 1EDDA 3L06A 2BGTA 3ZWKA 2FJ6A 2YR0A 4Y7CA 2E4UA 3EULA 4QU5A 2HW3A 1A8HA 4LC0A 3VR3D 1I4WA 1LTQA 4HEA1 1KRWA 3BXPA 4QGSA 1OKKD 2QE7D 4KDFA 3TW8A 3QA9A 3FX2A 2XUGA 4XSHA 1YJ8A 3TLMA 2EZ8A 4UPEA 4P4MA 1SAYA 1PF7E 3BF7A 2HYDA 4QT4A 3M1IA 4BL5A 4G9BA 1CW2B 4FMCF 4POAA 3K6RA 4FDVA 4K6HA 1EU1A 3KHHA 4DLKA 5HCUA 1N5DA 5FUBA 1D04A 1X80B 4EZEA 3HWTA 9LDBA 4WCDA 5C18A 3GMTA 1Q19A 1PWXA 5DTJA 5EZYA 2HRQA 1NM5A 1IBRA 2JFVA 1CLEA 4IRKA 5JBNA 5J2UF 1UXKA 2VF5X 1Y9JA 3DHVA 4ILEA 4EEKA 3C14C 1RJ9A 1MGPA 7ICKA 4N3AA 3MTQA 2FZLA 4G3IA 1MOPA 2ADMA 3UMJA 1ONBA 5A5EA 1J99A 1Y37A 1FA9A 3WADA 2MA1A 1DGJA 1LW6E 1P0QA 4UQGA 4RE6A 1GT91 3B7WA 4MCJA 2O07A 1RDFA 4B82A 1G4HA 4KXYA 3TZ6A 5L3VA 2XKBA 4KGDA 1TCAA 4Q4AA 2JANA 1G3MA 2IW3A 2DT8A 3G8YA 3N2IA 3CLKA 1D6NA 1PL7A 1TMOA 4GC6A 3Q5DA 3OZGA 2GOYA 3AR8A 3QMPA 2RHRA 2WVHA 5DBHX 2ACWA 3C3EA 2XZOA 4JJ4A 4RTQA 3ZX5A 1NXXA 4MP3A 1Q0SA 3W3AA 5TIIA 2PE5A 3PHHA 1DXYA 4HNQA 3WBKA 3RFAA 1UDAA 3N8GA 1BXGA 2II6A 2W6CX 3PCRB 4BHTA 5DBGA 1IVNA 4FHFA 1ULAA 4ZZIA 4NWIA 4U5XA 1TAQA 1YA4A 3KQKA 3AFOA 3D59A 3MBYA 2PZLA 2SBTA 5FUYA 5LOVB 1J2TA 4E2YA 3O1HB 2P30A 5KTNA 2FSUA 1QCKA 4NLLA 4RU9A 3U4QB 2VEOA 3HPQA 3HKBB 3LC7O 4O1IA 4FHEA 5LL6P 1L4GA 2IYZA 1N5RA 3K70D 4JYPA 5JC1A 1TCCA 2B5OA 1KDPA 2P3SA 2C57A 1TCUA 3OE7D 5E7MA 3T12A 3W78A 1R8QA 1RWKA 3RHZA 3C1AA 3KE8A 1O97D 1Q14A 1OLSB 1UMCB 1F12A 2C5EA 3C1TA 3H4VA 8ICNA 1NQXA 1I24A 2BY4A 2A92A 1M72A 3GEHA 1SBIA 3VO2A 1JU4A 3C1ZA 2EZ9A 2CB9A 1K3TA 3PQ3A 4YMUA 1Z6ZA 4JLDA 4UDOA 1ZZEA 4HS9A 3PJGA 1UBSB 1SCQA 3K9LA 1D9DA 1JS1X 3VKHA 2Y99A 2WVAA 1TD9A 2C1XA 2IH5A 3NC4A 4Z51A 1CEXA 1KKMA 4IL6U 4NOJA 1RTTA 4TZKA 5A4KA 3D4OA 1MEEA 4XB6B 2BLNA 1CQZA 1C1DA 2Q5QA 3I83A 2GNOA 3L0OA 5D8DA 4IXMA 2IQIA 1JQ5A 2X42A 4XFKA 3AB7A 1C41A 4BFSA 3ZVLA 5KAFU 2QI9F 4QOJA 4TT8A 2DHDA 1AMNA 8OHMA 5B5EU 1E79A 2QVBA 3VI4B 3DLCA 4PZZA 5C4MA 4DGSA 1O96A 5ECYA 3P20A 4CGZA 3S1AA 9ICUA 5CWRA 1UOOA 3C7DB 1CQJA 4GQBA 4RXTA 2HBZA 5BPCA 2H6EA 1LJLA 3P4UA 4RSHA 4O29A 4AKIA 2ZOSA 3H0EA 4ZOQI 4Z8XA 3JYPA 3AM9A 5C5JA 2GI4A 1MV5A 4B9UA 1ZM3A 3H7AA 1AVTA 3TJRA 2EJWA 3FUUA 2QKQA 1JAZA 4YRSA 1OA1A 4M3NA 4WBSA 5F21A 1VZ3A 2R0QC 3MLEA 5LJIA 3C2KA 1SKWA 3DLHA 2ZIUB 1IULA 2DH5A 1ZJWA 3MGIA 5AO9A 5LQMA 3K1AB 4CMEA 4HKTA 4FMBB 4C8OA 5E4YA 4HSEA 2HUNA 1WMFA 2UVPB 4QZ8A 4QGBA 1MT3A 1L9XA 1NA5A 1IONA 5GONB 3M89A 4PAQA 3ECAA 4KPYA 1H1TA 2ZRMA 1X6VA 2Y2UA 3WL5A 1KAQA 5CFPA 3PNPA 3C6YA 2PWAA 3KQUA 3BSYA 4FWTA 1N6RA 4Q8FA 3GJSA 5CLFA 3M8KA 2OBBA 3SR6A 4OVKA 4OY3A 2WYWA 3GEIA 2KZMA 4KIWA 1L5FA 2J30A 1FEZA 2IP4A 4NR0A 5KX5F 1Q20A 4RZSA 2V6IA 3LK6A 16PKA 1T3SA 1CE8B 3DFIA 4L7VA 1HT2E 7ICEA 3IV7A 1Q1BA 3WXMA 5JZVA 1ZQ9A 1P9OA 2EV9A 3MGAA 3KTAB 6Q21A 1PR5A 2P11A 3TDNA 1OBFO 1V38A 1CY6A 5KCMA 4OUKX 3G6XA 4YUZA 2JGKA 1Q0TA 3NAZA 3G2KA 1SKYB 2IU4A 4G5FA 3E15A 4UASA 4TKLA 5T3UA 5AK0A 4G5OA 1IUKA 2ZIEA 2ZDQA 3WIEA 2VT3A 2BMVA 1L7XA 1QIIA 3KM0A 1GZHB 3DR5A 2JHAA 3VYSB 2ZI3A 1GTSA 2WJ4A 1OXKB 4J3JA 1D2NA 1D7AA 1S6YA 1NNLA 2FFJA 3ND5A 4H9GA 1P4SA 1CUUA 1E92A 4BB0A 2BDUA 4NE9A 1ETUA 2GEUA 5FOWA 2BF7A 3YASA 1F2TA 1Y5IA 3GLKA 3HILA 2Q07A 5LP6A 1MNAA 5IT4A 4A36A 4YRKA 2QMZA 3K5PA 1IBLB 4JLKA 4J4TA 1GFWA 1SUBA 3E8SA 2X7JA 3HR7A 1NVUQ 5KNCD 1JEOA 4JH0A 1LJUA 1APBA 3O2JA 3DOUA 2ZEJA 3SHQA 7MDHA 2P2ZA 2O8DA 3NBUA 1W7AA 2P9YA 2GD6A 4YYZA 5LXTA 4RA9B 5EWEA 5FUWA 4D92A 5BRNA 1EA5A 2BRUC 1DU4A 1BXKA 3VUFA 5F64A 5LQSA 1SOAA 2ODPA 2RB4A 3TTUA 3ZE7A 1RHUA 1K5DA 1M1UA 1JQBA 4FWIB 4LA4A 2AMFA 3ZHQA 1ZJNA 3KPVA 4DSEA 1OE0A 2DTDA 1GVHA 3LYHA 4TVOA 1C0EA 3I5AA 2VUUA 4L73A 2AZMA 1JHPA 4NBKA 2NQ8A 3UGQA 3OICA 1PYOA 2IU0A 4X8MA 1XTIA 3BK7A 1NXVA 2Y71A 1X9WA 1WKCA 3LQKA 5U4XA 2YWGA 4H4EA 4BMDA 2H1LA 1JEYA 3K8ZA 4I4IA 4I8IA 2FLPA 3GLFB 1UPTA 5EIFA 3UEOA 3INRA 1BS2A 1GYRA 8LDHA 3U3DA 3KR9A 2AOVA 3QEMA 4XUSA 2V7WA 3FZNA 4DUPA 2C2BA 5ABPA 2ZSKA 4EKIA 2AV6A 5LA6A 3ZGLA 3G59A 5EE5B 1W30A 2VKQA 5I7SA 5KNBA 3WMWA 4QATA 4LX8A 1NBMA 4GPBA 2OV2A 3OBIA 4JXXA 3EQ9A 3KUKA 1RXYA 1IV8A 4IQTA 4BNMA 5THQA 4E2FA 4B9MA 2AFIE 3OLWA 1QFMA 4O8ZA 3PT9A 4GC7A 1K2WA 5E0KB 1ZKDA 1MG0A 4NARA 4I9NA 1ZI6A 4Q3OA 1DLJA 1PDOA 8GPBA 3SI7A 3ZWQA 5KG1A 3QEOA 4BB6A 4D8VA 3F5SA 4JP3A 3LHKA 2WQ7A 3FTPA 4RM2A 4K9OA 3TRIA 2D7DA 1J9ZA 4C0KA 1GG8A 1GJRA 2ZAIA 2AE2A 3T7EA 2DQYA 1WEHA 3WIVA 1E7QA 4ILKA 4PHHA 1L7QA 1QG4A 3NH6A 4QOFA 2XE8A 3PX2A 1KOLA 3MEQA 5JG7A 4R8RA 1E2NA 2XZPA 3R5XA 5BOSB 4MVJP 1G8JA 3UAGA 1N62A 2C5LA 3DHNA 4ENTA 4NCHA 3IIJA 2MYPA 4O3FA 4ID9A 4D0NA 3FJOA 4DOCA 1SEPA 2GO1A 1KI9A 3UJHA 2NRWA 1ZJ6A 2YX8A 2B1QA 4NY8A 1FS6A 4C87A 4LHYA 3LXXA 4QO7A 5B53A 1U7WA 1VIDA 1Y3DE 4HGNA 3GD5A 3DEJA 3M7DA 2CWDA 3JQBC 2PTGA 1L5RA 1J2NA 1I5OA 1QGDA 1YIAA 2ZE8A 4XVHA 1LVHA 3PQ7A 3ZI7A 3STTA 3D4NA 1NF8A 1W48A 4YP1A 3KQPA 2GAAA 1SUAA 1WB9A 4UUMA 1B8PA 1E4EB 2BFMA 4ZRNA 3ORQA 1BD4A 1JPUA 4EVQA 2PAAA 3MB5A 3PEUA 1IBKB 1S9HA 4RD0A 4KN8A 5CA1F 4FDLA 2OHXA 4AZSA 1IXYA 3A28A 4N5MA 2J7KA 4BMSA 8ICPA 3HPRA 1M54A 4Y6LA 1A2KC 4NM1A 1NVXQ 1FJXA 3CW9A 4X61A 3ENKA 3IAXA 4P38A 5F4ZA 4CEIB 5J4LA 1EI9A 1BC5A 3EXEA 2WJ3A 1RVV1 1NYLA 4ZTUB 4H0NA 1GUBA 2FJUA 4WZBB 3NATA 2WA1A 4WIAA 2EERA 4XGKA 2QTRA 3S27A 3OFKA 4FEEA 1EK5A 6LDHA 4MS4B 2YINC 4D0GA 2D54A 1COWD 3L82B 3GFQA 2QR5A 1QONA 2NUPA 1HE5A 4N76A 1JQEA 3IP9A 1I2DA 3OCYA 5CFZA 3WLQA 3Q7EA 2Q4EA 1NKCA 3PVCA 2RFLA 1I8TA 3ZQUA 3SJUA 2Q28A 2J7PD 3A10A 5CLHA 4II7A 2EKQA 2W2MA 2XB4A 4WNAA 4DLWA 1JFFB 4BRSA 1N61A 3WMFA 1RMTA 3GLIA 3ZWNA 1LLQA 4F5YA 3L4PA 4Z9AA 2QSZA 4E3ZA 1EXDA 3IEIA 2Q45A 3PJFA 1PFKA 1L4BA 2PL9A 1L6NA 2B34A 2GN9A 5JHGB 2QPLA 3KVRA 3LSYA