3QUBA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47ala mutant complexed with sulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
MRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHAGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qubA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qubA01
1Z4MA 3NALA 5AICA 4OHFA 1O03A 2HHLA 3K1ZA 1VFPA 3WKDA 1RLMA 5AM0A 1T5SA 2B1RA 5AM1A 3I76A 3NUQA 3RFUA 4FFDA 3WKCA 5ALVA 2WF9A 3J7TA 4OFZA 5ALWA 1L8OA 3DNPA 2WF5A 4H1WA 2PQ0A 4BEWA 2YFYA 5AVZA 2HDOA 2RBKA 4F71A 3OCXA 3QGMA 4RETA 5AVRA 4IFTA 3B9RA 4XQ0A 2Q4RA 4YCMA 3WKEA 5AIBA 1Z4LA 3QU5A 1F5SA 3ZTYA 1YNSA 5AVQA 5ALRA 3FGOA 2YMLA 5ALFA 1YMQA 5ALZA 5ALHA 1XVIA 2EARA 5T41A 3M9LA 4YIKA 3BWVA 3ZVNA 5AI4A 1U02A 2ZBGA 5AK3A 1ZJJA 3HYCA 2OYCA 2I34A 1RPZA 4NWIA 1RMQA 4DCCA 3L7YA 2CFTA 4HGNA 4AS3A 1WZCA 3EWIA 3PGVA 4OD0A 3B8EA 5AI5A 1U2TA 3GYGA 2PR7A 2W4MA 4CF4A 2BDEA 5AKEA 2B30A 4HYTA 4NAVA 3N1UA 3ED5A 2AMYA 3L8HA 4CF3A 2HX1A 4UM5A 3W5BA 1ZD4A 1YJ5A 4I9FA 2B8EA 4KYTA 1T9ZA 4J03A 1Z4PX 3SKXA 2HF7A 4YCNA 3QXGA 1Z4KA 4UMEA 1S2OA 3A1CA 3KC2A 4PNHA 2ZXEA 3I28A 1QQ5A 3B9BA 1RQLA 3AR7A 5AW1A 3WKBA 3R4CA 3OCUA 2YMPA 2G07A 3QU7A 5AW4A 1CR6A 2NO4A 3TLMA 4C4SA 3FPBA 4I9GA 4UMDA 2C4NA 1QQ6A 2YJ4A 2FPSA 1Z4NA 3QX7A 5ALKA 4NABA 4UAUA 5FP0A 3AR3A 2G0AA 3QU9A 4JDPA 4KX3A 3IB6A 2GFHA 2FPRA 2W11A 2ZBFA 4BX3A 3AR9A 4E88A 2RAVA 5AKGA 2C8LA 4L6CA 5ALGA 2FUCA 3QU4A 2JAOA 5AHXA 3L8FA 1RQNA 3QNMA 2R8ZA 1RC8A 5ALQA 3SKYA 2FDRA 5AW9A 1LVHA 4HAIA 1AQ6A 2P11A 3N8GA 1U7OA 3AR6A 3N5KA 3D6JA 2FI1A 5ALEA 5AW2A 3N07A 4BEVA 2O9JA 3ZVMA 4BNDB 3PDWA 4KNVA 3ET5A 3EF1A 1LTQA 1RMYA 1L7PA 3U19A 5AVTA 5ALOA 2YBDA 1J8DA 4BX2A 3W5CA 3I6BA 4MUMA 5AESA 2I33A 3KD3A 3OCYA 2PKEA 3QUQA 3S6JA 1Z4IA 2OA0A 1QYIA 4O8CA 1X42A 4HGQA 4L57A 2HOQA 2HEGA 2AH5A 2YJ6A 4KN8A 2D2VA 4B6JA 1RMTA 2P27A 3A1EA 3ESQA 3L1UA 3WK8A 4F72A 3IRUA 3UM9A 3L8GA 1WR8A 5AVYA 3QUBA 5AM4A 2AUTA 3N28A 2NYVA 2B0CA 3AR8A 4XOUA 3AR2A 5AI6A 2WHEA 1NRWA 1KYTA 2GHQA 3ZWDA 3CZ4A 1TJ4A 4Y2XA 3A3YA 3A1DA 3UMCA 3WK9A 1SU4A 2EATA 1QQ7A 4UU0A 4BX0A 4KNWA 1EK2A 1Z5GA 2FPUA 2IOFK 2G80A 2G06A 1U2SA 2B1QA 2I55A 4G63A 2BDUA 2P69A 5AKYA 1O08A 4Y2YA 2EAUA 3WKAA 3M1YA 2R8EA 5AM2A 2FEAA 3DAOA 3IJ5A 3L0YA 5ALIA 1TJ5A 4AS2A 1VJ5A 4BBJA 5AVVA 3UMGA 2CFRA 2Q5EA 3ONNA 1N9KA 3EPRA 3NRJA 4HGOA 3L5KA 3KZXA 1J97A 3VAYA 1ZD5A 2WF8A 5ALTA 5AVXA 1ZRMA 2IOHA 4MWOA 3QUTA 4Y2QA 5AIAA 3ZUPA 1PW5A 3F9RA 3FVVA 2QYHA 2MU2A 3KBBA 2W43A 5JJBA 3ZX5A 1L7MA 4C4RA 4GIBA 4Y3UA 3E81A 5AK4A 2ODAA 3UMBA 5A3SA 5AKHA 4EX7A 2WFAA 3ESRA 2JGAA 2MSNA 1S8OA 1T5TA 3U13A 1ZS9A 2AGVA 4EEKA 3W5AA 4HGPA 5AW3A 5ALXA 4L6AA 2YJ3A 2VKQA 3OCWA 4GXTA 2GMWA 2IA5A 3W5DA 2QLTA 1Z88A 4Y2VA 2JAUA 1Z4JA 4BYGA 4RESA 1YS9A 3WGUA 3U7GA 1XP5A 5AVSA 4YIHA 2OBBA 1SWWA 4UMFA 3SF0A 1RKUA 3R9KA 3RF6A 4UU1A 2HI0A 3EF0A 4BKMA 2O2XA 2YMMA 2MU1A 4AP9A 4ZEWA 1EK1A 5AKZA 1RRCA 3FZQA 5AKJA 3L0BA 1L8LA 3SHQA 3QUCA 5IT0A 1FEZA 5AVUA 1Z5UA 2HSZA 2HCFA 1TA0A 5ALMA 4UW9A 2DQSA 3OPXA 2FUEA 4BNDA 2IYEA 4OCZA 3QU2A 1IWOA 3OCVA 2JAWA 2I54A 5AK6A 5AKIA 4YH1A 2YJ5A 2C9MA 3E8MA 2R8XA 2WF7A 3ZI4A 4ZEXA 1CQZA 4QQFA 3FPSA 3I1YA 1Y8AA 2NO5A 3L0CA 3P96A 1RKVA 1NNLA 4JB3A 2IOFA 3L8EA 1SWVA 4Y2SA 5ALUA 2JARA 5ALLA 1TJ3A 4UAVA 3ZW7A 3ZVLA 1Z4QA 4Y2PA 2HO4A 1RDFA 5AW8A 3NAMA 5ALNA 1YV9A 4QJBA 4XPZA 3WK6A 1U7PA 4EZEA 2RARA 3U7HB 2ZBDA 1YDFA 3AR5A 4UASA 4G9BA 3ZX4A 3R09A 4HGRA 3SD7A 2G09A 2GO7A 1XPJA 5AKXA 1ZOLA 3WK4A 2C8KA 4YCLA 4DW8A 3ZU6A 1Z4OA 3L1VA 3U7EB 3OCZA 1RLOA 5AW0A 1N8NA 4YGYA 1TE2A 2BY4A 1VJRA 4EELA 3SLRA 3HLTA 2Q4TA 4CF5A 3QYPA 3NIWA 4J2TA 3WGVA 2GHTA 4Y2TA 3U7FB 2ZOSA 1RLTA 3SMVA 2B82A 3KDPA 1MH9A 4UMVA 5ALYA 1L7NA 3DDHA 2RB5A 2I7DA 2WF6A 2ZBEA 1ZD3A 1Q92A 4C4TA 1K1EA 3DV9A 3U26A 2G1AA 2CN1A 2CFSA 3E58A 4EX6A 3MN1A 2C88A 4Y2UA 5AK5A 4DWOA 3CNHA 2G08A 4CNQA 4DFDA 2YMQA 3MC1A 4UATA 3BA6A 3ZTWA 5ALSA 2FPXA 1ZRNA 4Y2RA 2WM8A 4ZEVA 5ALJA 3QLEA 1Q91A 5AVWA 5AW7A 1ZD2P 1NF2A 3PGLA 4IG4A 3ZWKA 5AM5A 5A3RA 5IS2A 4UM7A 5AI0A 1L7OA 3PCTA 2B8JA 5AI8A 3MPOA 2I6XA 3NASA 4EENA 3ET4A 4NV0A 4FYPA 1WVIA 1JUDA 3AR4A 3MMZA 3NANA 3OTQA 1L6RA 2YN4A 4XE5A 2FPWA 2ZG6A 2X4DA 1RKQA 2OM6A 3FM9A 5E0OA 5AW5A 3WK5A 5AI9A 3WK7A 5AM3A 4NFLA 5IT4A 4Y2JA 2HF2A 2YY6A 5ALPA 2P9JA 4CE6A 5AW6A 5A3QA 5AKKA 4KX5A 1QH9A 5ALDA 3KOOA 1WPGA 3E84A 5AKLA 4UARA 2R8YA 4FE3A
chains in the Genus database with same CATH superfamily
3ETGA 5TQJA 2EDUA 1IWBB 2QU8A 3NALA 4KVAA 4OGLA 4JLPA 1O03A 2Y67A 3UAGA 1AQLA 1I6KA 1U4OA 2VC2B 2ZR9A 3MCWA 2XCAA 3TSOA 3QKUA 1PFUA 1GTJ1 1VMEA 4I55B 4DXHA 2BMDA 1EBBA 3E5NA 4ODIA 1L5KA 6AT1A 4GXIA 2DWOA 1DK2A 4EYEA 1I36A 1KI7A 1RFLA 2HN9A 3E48A 4RH1A 5CDYA 4HAOA 1YC2A 4GVXA 1DINA 2XNHA 1IK6A 1S7CA 2PLWA 1JP7A 4FGUA 2PU5A 4LNUB 4B83A 1RXCA 4W5WA 1NBMA 3TJZA 4BKUA 4OYYA 3OTHA 4FSHA 4LXYA 5SYMA 3CW8X 3WKEA 2R25B 4Y2GA 2D6FA 1J2RA 1A2OA 2HJWA 3U7RA 4EJ6A 4KQWA 2MAXA 1N9GA 1DKQA 1WCNA 1ZK0A 3F7MA 3KHRA 4AKTA 4C7XA 5CB4A 2IDZA 2G1KA 4TUYF 2XCIA 1R88A 4EKNB 5AVQA 4DV3B 4LXUA 1HFJA 3CRZA 3GLRA 4B71A 1XZAA 5ALFA 2ODPA 3HXKA 2VJDA 2J0UA 3THVA 3JW8A 3E9ZA 4CF7A 4X63A 3ZV5A 5KOHB 1R64A 4F2DA 3WRWA 4BFCA 4MHVA 1W30A 3AO0B 8ICFA 1HYBA 2XA1A 4CFYA 3MGKA 1KVTA 3VNBA 3L7BA 5AI4A 4L5JA 1I3LA 3HN6A 4XA8A 4QTUB 3RFXA 4CIVA 4F5WA 3VZRA 1NQ5A 4DCCA 2CWWA 4ZGGA 2P6OA 5JAOA 5A62A 2EF0A 4JUZA 4M0EA 4CDNA 4D42A 2E4XA 3EWIA 2FX2A 4P1ZA 4EW6A 4JBNA 4JJ8A 1N5MA 3PLNA 4OIFA 3FZNA 4GNKA 1ZU4A 1UF9A 3IBYA 2JLYA 2KE7A 1K2VN 2QGZA 2R6DA 2QAGB 4KBGA 3VFDA 5HRUA 2XXJA 4B48A 4U7CA 1JR3E 1O6ZA 1AKWA 1AX9A 4G5YA 3WLQA 1E6WA 4WNAA 4E51A 1AB6A 5FWYB 4CF3A 1AMOA 3AVVA 3FCCA 1G8YA 3QVGB 5T4FA 2FPPB 4B3CA 5LD2B 3ZWBA 1NI3A 2HWKA 1YHNA 3LBYA 1E63A 1OLSB 1T9ZA 1Z4PX 1U63A 3JAKB 1NV8A 2KG5A 4RZHA 3TIIA 3NV9A 5DFAA 1PFGA 1SRQA 2F3QA 1M7HA 4NEGA 4EJMA 5F23A 4X3OA 3K0BA 1J1UA 3UAXA 3BQ1A 3Q7TA 1JDVA 3L06A 3D6AA 2FQ1A 3AIMA 3PWSA 4OXNA 3RD5A 4YRNA 2Y99A 1GYRA 3F53A 5JS6A 2CNWD 3MIZA 3PL5A 3I28A 1TFUA 4RCVA 2R97A 1I5RA 2WM3A 3PNBA 1RQLA 1CUYA 3AR7A 4GXRA 4BVAA 2IBKA 5B7PA 4ZO7A 4GZLA 4BTEA 3TK1A 2GBIA 4Q6WA 1CR6A 4YPVA 1FFYA 3CW9A 4UMDA 2P9FA 1IB6A 1GAQA 5AHWA 1TO2E 1V2GA 3KCQA 4EUSA 3FROA 5MN5A 1LPAB 3ZEAA 1X0VA 2V7BA 1E2DA 3WR5A 3M49A 4NH4A 4G4SP 1DXQA 2FGJA 2ORIA 3C5VA 4HLUA 2EZXA 2FPRA 4NJMB 1ZU5A 4RD6A 1H0KA 3ZPXA 2XHEA 1DHRA 4TVBA 4CV2A 2HMWA 2B4YA 2CMKA 4NG5A 2BF4A 3TD2A 2FUCA 3ZV4A 1VLZA 1Z7YA 3E4DA 1NZPA 1OLXA 3QNMA 1RYHA 4UUNA 3SHOA 1G8HA 3FTFA 2HBKA 2VJNA 3EOAI 2EFJA 3QE4A 3C7TA 2JNWA 2VDVE 3QFSA 4BL5A 1JBEA 4RQ7A 1MB0A 2GN2A 4NONA 5FORA 2OGZA 3RYHB 5ADVA 3OQBA 1ZW6A 1WNTA 3D8HA 4CCAA 5I4BA 2CL7X 1JXQA 4OLBA 2HNAA 2O9JA 2WNSA 2VAPA 4O5EA 3FXAA 1QNFA 2V6BA 1NAHA 3G5LA 4IDCA 1L4MA 1NUHA 1C3LA 2FE1A 1ZOIA 2PPVA 3EXFA 1QFZA 5EKDA 2GTPA 2V8OA 4JR0A 1RJGA 1S5LU 2XTNA 2Q1WA 3OEEA 4PC3A 5IYZB 1BDIA 1F0YA 1E9AA 4YR2A 4W5NA 3RVMA 1P2UA 2WKQA 3HNRA 4O4HA 1FVOA 1NJ2A 1DGSA 3EEIA 2CWDA 1HMPA 3C3YA 3KJNA 1Y63A 4HDQB 4IWXA 5LP6B 2ASLA 1ZOSA 5L1KA 2R11A 4PPQA 4B3XA 5KO2A 5KFMA 1WKBA 1R0YA 3QKRB 4MR9A 3QKWA 1U8AA 1DEKA 4ZDJA 4KLLA 1X42A 4LZWA 4N3CA 2GOLA 4BLSA 2ZYTX 2AH5A 4KN8A 4KYIB 5LNK6 1J2JA 4MTCA 4UBIA 5GM2A 1A96A 5BSEA 2ETVA 5TE9A 1XJ5A 4DJ5X 4FDMA 4DMRA 1M2KA 4YFVA 3UWOA 1QG2A 3FWKA 2C3YA 4XJSA 1RIIA 2JHDA 4ZV7A 4N5MA 2ZIVA 4QUKA 2ANBA 3CVXA 2XYGA 5THXA 4GUDA 3TQRA 3C8MA 3G2QA 1EXVA 2Q2NA 3ZOKA 3B3AA 1K7YA 3GPBA 3QWHA 4QGSA 1JZTA 1XJCA 1OV4A 1BN6A 2OV1A 4J2OA 1NRWA 1ZQVA 1D4OA 1ORWA 4TPKA 4AZ3B 5LNK1 1AKQA 2GNPA 2Z7JA 4RJIA 1C7ZA 4IEIA 5LFAA 3P32A 3QLVA 4HNVA 1PK1B 4YMVA 4R68A 4YV2A 4DLTA 4FCWA 5J4YA 5KOIA 1YRYE 1X2IA 2Q1XA 2ECKA 2UU9B 3MGBA 1PK7A 1X6JA 4FKZA 5IVDA 4RABA 4E13A 4FBTA 3I0NA 1N48A 4IQ0A 4Y30A 3VR5D 4MQEB 3A8TA 4UXJA 4C0HA 3OJSA 1PWZA 1E0DA 1DZIA 1BROA 3OVMA 5JQGA 4FHCA 2V0GA 3U3RA 5GVRA 2KNJA 3M6FA 2Q29A 5LJLA 1TDJA 3ND8A 1HQDA 5DOVA 3QX8A 3RU7A 3T7IA 5IBCA 1G5RA 5LMNB 5ECGC 4OJLA 2SKCA 2JFUA 3DZHA 1T9GR 1MENA 2YWBA 4N6OA 2OKGA 1D7OA 1FFWA 1QONA 3AUFA 5AM2A 3E61A 3GWZA 4IRMA 4HWGA 1P7VA 1FB5A 2BLLA 3L0YA 4NZ9A 4OGGA 3ZY5A 2X0IA 4E5KA 1PT8A 2VDQB 4DJAA 4W8HA 4UXIA 1WPXA 1KORA 4BO5A 3USZA 4CUKA 4RSMA 4EYGA 5IDQA 4P3NA 3Q8MA 1R2QA 2ZIGA 1ZGHA 1KK3A 2HA3A 1XMXA 4IHQA 3V3TA 3E9DA 1P1FA 3VJKA 3LVRE 1AROP 1DU4A 2Z3VA 3ZGXA 3CUTA 1CFJA 3VAYA 2CFIA 1LRKA 1MB9A 3RTAA 5AVXA 4IH1A 1H69A 5EJEA 2ID4A 3CP8A 4IFIA 4JLWA 2E3JA 1GXSB 2DWQA 3NYIA 1M6EX 4UHHA 4S04A 4H4DA 4BO8A 7ICGA 3EPHA 3FI9A 1W5EA 1J2NA 2WMNB 4MEXA 4IL5A 1F38A 3AG6A 2V03A 3X2FA 3UFBA 2CHUA 4BNGA 4BWJA 4B9MA 3QYAA 1A8IA 3T54A 5KNLA 4YPOA 1L7BA 4FX2A 4QE3A 1MTOA 4Z3DA 3STTA 4DR7B 3D3WB 1BC5A 3MWDA 2ZAIA 3OKPA 2V4QA 3JPPA 3CNOA 3ICOA 3TL6A 1ENPA 1NF8A 2A8YA 3D02A 1M7BA 1BCRA 3UKOA 2VT3A 2LCIA 4LAFA 5AVYA 2HRRA 3PX2A 1XEWY 3K35A 3QRWA 3T06B 1I7SB 4LTDA 3EEYA 3EY4A 1CQWA 1JIIA 2X0JA 4MVJM 3DBLB 5DX8A 4OOEA 4BJ1A 2P78A 2R86A 1KK1A 1IIBA 1U0BB 1OX5A 1VJGA 1GTZA 2WSBA 2ZJFA 3AHFA 1TV9A 1C50A 2V58A 3D4NA 1V9PA 3E7FA 4ECSA 5EMNA 3FOFC 3BQ2A 5BR7A 3SI8A 1EFVB 1XMIA 3M4JA 1SCIA 3IT1A 1Q22A 2QTWB 1U7HA 2BJWA 4O29A 4P7FA 4J9VA 1ZCAA 1U65A 4JLBA 1SIUA 3O47A 2VG8A 4Q24A 4RE6A 2Y71A 2MWMA 2QUBA 2MYUA 3ROXA 4Y7DA 4KMUA 4X91A 3OX2A 1ZNQO 3AM9A 2V4ZA 3K15A 1MABB 1UDBA 1MN8A 2IHUA 3E9EA 4PSKA 2HI0A 1TJYA 4B31A 2XZTA 3TX6A 2A86A 1PK3A 2Q9BA 2RIPA 1RHMA 4NBVA 5JCJA 1Y3IA 5CAEA 3B2EA 4BVGA 1T8RA 4M55A 4TYYA 1FLAA 3GFKB 3KUUA 4K87A 4JT2A 1FZTA 4UBJA 3FVWA 2JJ1A 4XIJA 2GTHA 2Y1OA 1B15A 2WWXA 3SR6A 2PZMA 1EINA 4K9RA 4QU5A 4C20A 8ICBA 3IDAA 1R9JA 1WDWB 1SCKA 5LB4A 2HSZA 1LSUA 3OQJA 2VPZA 2DT5A 3UMVA 3CVYA 3DBIA 4UW9A 4CKWA 2PAAA 3HJRA 3GXBA 1L5NA 4OHOA 4HFRA 4IQUA 1JQBA 2WAMA 4ZVTA 4BO2A 3BM5A 1L3IA 1GZDA 1DKLA 1Y4UA 5DG7A 1OU0A 2BFFA 3I5AA 2FWAA 4HB3A 1CIPA 3KVYA 2FW7A 4E5VA 1FUUA 1PKXA 5LQNA 3H4TA 3PUKA 3DKPA 3PFGA 4YP0A 3V6LA 2O1WA 2YJ5A 3UXOA 2XCPA 3M7DA 1SKWA 1BPXA 3E8MA 3OZCA 4DIDA 3N3BC 4YAJA 4DLBA 4C29A 2GRJA 2E4AA 3CPSA 2KSQA 2DUWA 3VYVA 5B12A 1IATA 2V59A 3JQQA 1HLGA 3FVRA 1CUAA 3CTPA 3PD7A 5DG9A 3WRYA 1Y8AA 4KK3A 1EG7A 4IEEA 4KLCA 4IXTA 3NNDA 4YAKA 5AD1A 5KYUB 2ID9A 3HACA 2VR1A 1HYQA 2OLJA 5I3ZA 1VJDA 4GI7A 5AJWA 2JFHA 3W5JA 4FI3F 3V33A 1DGJA 1G5IA 1LBTA 2B7LA 3MHTA 1USKA 4ZAWA 4B0PA 5HFJA 4WSOA 5LP6C 2BTOA 3C5EA 3A1UA 4QA9A 3STWA 2NUAA 1IOLA 2V1XA 4PLTA 2C99A 2HZBA 2JI6A 1ZY2A 5FHQA 3ONVA 1YDFA 1HTBA 2EVWX 2MSLA 2ZUVA 3CCBA 4RJTA 3V4RA 4QWCA 3GGCA 5FO0A 5KFHA 3Q3VA 2CXYA 3E1KA 4J91A 2B6GA 2XCRB 3P52A 2R4QA 2ZB3A 5KYNA 3N7RC 3I2FA 4DOBA 1LK7A 1EA5A 1V4VA 3L6BA 1DAFA 2Z2ZA 4Y18A 1UFKA 2YZMA 3TTTA 2OHVA 4HDMA 2OFPA 4R65A 3GLVA 3L4BC 4RBNA 5DOZA 3RWMB 4MA4A 2WSSA 1CB7A 3C28A 4L73A 4KACA 3IUPA 3I6ZA 4HXGA 2IOYA 1GDTA 3OEHA 5AVTA 4XA5A 3IFSA 3ZCUA 2J5XA 4YV0A 1AJEA 8OHMA 1UBOS 2QR2A 4UHBA 5GONF 2XWJI 1U45A 1XU9A 3JD1A 4NPAA 4Q18A 1R5OA 2D4AA 4O5KA 5DHUA 4ZCIA 1G6Q1 4G24A 1TE2A 4MS1B 3HBAA 4YNBA 4DV0B 4Z86A 7ICQA 2I7VA 1CEQA 3A6DA 2NU6A 3SXJA 2WJWA 1SZDA 1UP7A 1SGGA 1FP1D 3BKWA 3H84A 3IPRA 1K5OA 1P73A 3K5WA 4MLDA 1RLTA 5IK2A 1Y42X 4G4JA 5FHRA 5L45A 3U7FB 2ZEJA 1GCOA 4KMMA 3MTIA 4F38A 1L7NA 2AD1A 3VMMA 2H3QA 3AP1A 4FN5A 1JTEA 3BJMA 2P77A 4K6CA 4RL4A 2VOEA 4FU0A 4M1EA 4AJEA 4UPEA 2ISCA 3S7ZA 2G1AA 4MVWA 3VTKA 5EJIA 1N2EA 1UFQA 3VPGA 3WBJA 3N8DA 4GC7A 1QNLA 3L1IA 2D0DA 4YRJA 3S81A 4QDJA 1XR3A 3AU9A 4G4SO 2GN6A 2INGX 1L5ZA 1ZUNB 1XRLA 1ZL2A 1ULTA 3F9CA 4RGVA 2BFBA 3V5NA 5AJHA 3ZLBA 4W7IA 1GPH1 5ES3A 5BV7A 4QZ9A 2EJCA 4BLVA 2G76A 3PFFA 4QXAA 2JD1A 1I2AA 4NQZA 2VDKB 5K3SA 5KBYA 2X5NA 3HY4A 1TF5A 8ICHA 1WHSA 4FLEA 3BIOA 3INNA 4MINA 4ER7A 1P91A 3AL0C 1A7KA 5BW5A 3EMVA 4U3JB 4R63A 1FTGA 3D5TA 1X7ZB 3JAKA 4X54A 3ZWNA 2WUVA 1HURA 1CBUA 1GPBA 1T6BY 4FBLA 4H6VA 3D0KA 4TKVA 1DJMA 2JGDA 2XRMA 1N3YA 2X23A 1HF3A 3NBKA 4OQQA 3ZQJA 3MPOA 4Q44A 2NLOA 4Q7LA 4L51A 4OM7A 1XD2A 4RY2A 5LQSA 2ONJA 4NV0A 9ICTA 2CDNA 1P2GA 5AJUA 3VZQA 3WIUA 3AR4A 1K06A 8ICUA 5I7FA 5HE8A 3OTQA 3P2EA 1X1SA 2FW9A 1V38A 4M1KA 2G4LA 3IM1A 3VH4A 1I5OA 1HZZC 1JJ7A 1WWUA 1GAWA 4B4UA 5LSAA 4IJVA 5KYUA 3ZH9B 2HW8A 3BGOS 1ZQXA 2QVYX 2HF2A 2B83A 3BDAA 1LPNA 1NQAO 2I1WA 4CE6A 2HYDA 4PZ0A 1PTJA 4LGVA 1GUYA 4QIHA 4UDXX 5KTSA 3VKGA 2QZZA 3TW4A 1MVNA 1MAAA 3H6GA 3VOSA 5JAHA 1JYFA 2AHRA 1T3ZA 1YT3A 2VHJA 3C23A 5D5PA 3GFOA 2C1EA 3E4CA 2I2WA 2ZR0A 2IY9A 4F4JA 1M1YE 3LW8A 3OT1B 3HU2A 4XUCA 5CBKA 2X7JA 4US2R 2DKZA 3QKTA 1O2DA 2RCNA 2K2WA 4ZI5A 1TK9A 5KSYA 5KFTA 2FG5A 1D0SA 1V45E 1Z4MA 1V11A 4MRAA 1LQ2A 2X0RA 4E4YA 4P7BA 1K89A 3K1ZA 4YRFA 4QJFB 5JDCC 5LVAA 9ABPA 4GS5A 4W1QA 3PC6A 1E58A 2GN8A 1T5SA 4KIFA 3U4AA 3CSUA 3N0TA 3NT5A 4P0PB 1NK4A 1EH5A 4PZEA 5HCIA 3RFUA 2F43A 5KFWA 5ICFA 3VR6D 1H05A 4FIDA 4OFZA 2REQB 4ZQBA 5KFXA 4MICA 3U0VA 1N5RA 4H1WA 3QLVC 4QOJA 4FMDB 1WEKA 3AKCA 1KRWA 1C8LA 1N36B 2WA1A 3R6DA 3MFYA 2QQ0A 1G60A 2R7KA 3UAOA 3WHIA 4MVJF 1R7RA 3N8IA 1LZLA 2FG7C 4HBGA 4AC9A 1M8JA 4JA2A 1NK5A 5FBHA 5LP6A 3Q8SB 1KZHA 2GD2A 1Z28A 4PAQA 3ROEA 1VXRA 4YUAA 4HAZA 3EVGA 2GPWA 5JTTA 3MR2A 2PKRA 4JJGA 4RPGA 2OHFA 3CWQA 3EPJA 4IMRA 2PUEA 4Q9HA 4C76A 4Z9XA 2QN7A 4WLNA 3GEBA 5ALHA 3PFHA 3RYTC 1ZAKA 2CYBA 2ZSJA 2BC9A 4YRGA 5DF1A 1YZUA 1GY8A 1IUPA 3U2QA 2KIVA 1V4BA 2Y9PB 3MB8A 3K0FA 1UXJA 5J2TA 4KE9A 1RPJA 1ORIA 2JRCA 5IAJA 4NMHA 3AF1A 4NAHA 5KVQA 4BLRA 3GX1A 3EFOA 5IZCC 2VIIA 2PVCA 3KL4A 1F0NA 2JLCA 4DPKA 4U0JA 5JZMA 3GLIE 2Q0QA 5DULA 1HNNA 1RMQA 1RKXA 4O2BA 4R41A 1J2YA 3AHHA 3Q7QA 5DQHA 4JEMA 3TB6A 3WSVA 1PQ4A 2VP6A 5DGAA 1K97A 2CJWB 4ON9A 4YT5A 1S2LA 3IIJA 2A3RA 2D62A 3LT2A 2JGNA 4JVSB 5CT8A 3OWOA 5EKSA 3AVWA 2ZVQX 4REQA 4JI3B 1DI0A 5EMHA 3FRJA 3OTOB 2CHGA 3A1TA 4MGIR 1WQ4A 2IBTA 3VI4B 1J2MA 4ZJPA 3I2IA 3A6PC 2Q3DA 3TMYA 3KFUF 3WHKA 1WXWA 2B6NA 2SECE 3HO1A 1ECLA 4P3XA 2G0TA 2GN1A 2ZRGA 1AS0A 1E1KA 1XD2B 3DWGA 2YV4A 3LFHA 3LRTA 3RBZA 4O59O 4D0LB 5FWXB 5KT7A 1LX6A 4PNPA 2QL5A 2ZI7A 1BHJA 3WQHA 4BFTA 3KDSE 2WDPA 1JA0A 4ND3A 2P9TA 5BSHA 3AI7A 2WWHA 1V3QE 2VNJA 4XLTA 1GQYA 2CXPA 4B6OA 1E2FA 3JU3A 4C7OA 2ZROA 1UQRA 4M9XA 4PVCA 5LDHA 2FMKA 1OFUX 4L4XA 3RWOA 5KDOA 3R4CA 3GMTA 2O3RA 1Z37A 1JT9A 3NQ41 4DIUA 3MTQA 4MR7A 4JI1B 4LJ6A 1LBQA 3QF4B 4G8CA 4R7GA 1TEHA 1MIOB 3FPBA 2FGKA 3KOXA 3PC4A 2EANA 4CV0A 5TVKA 2H85A 3EDMA 5IANA 1EUYA 1YDMA 2ATLA 4NK5A 1QSSA 2WWIA 2ISPA 4DLVA 5F1PA 4H6XA 1M1NA 5GOZA 5DGTA 3FWPA 2P2CA 4LVOA 2WLTA 3ZCSA 3TFRA 1UKZA 4BP9A 1VLQA 2MR6A 4D8UA 4NEQA 3RVDA 4IM7A 3RSFA 2OWDA 2Q2QA 1X3LA 3HJUA 1MO3A 4TQRA 4LWZA 3HCNA 1RQNA 1IN6A 5HR6A 1DJNA 1JT2A 1YCHA 1J09A 2NQ2C 2XECA 4OY3A 3T9EA 3AIKA 2DFPA 3JQ6A 4GMKA 4DWVA 2I7CA 10MHA 1X77A 2ZJ2A 3LECA 3D7RA 3UBMA 4OL0A 3JWIA 5E9QA 4QX6A 3N8NA 2IYLD 4E0DA 1Z0DA 3WGMA 1KI6A 1QMPA 3AHIA 2JANA 4QVGA 2Q4DA 4NX2A 1OBOA 3BEOA 1RMYA 1TD1A 2FZ4A 3OG9A 4K9OA 4Q3NA 5MFPA 5JDIC 1DELA 1CXZA 1QJ4A 3HC7A 1ZQCA 1S76D 3P7MA 3WLIA 3HKEB 2VHYA 2NO1A 1AXRA 5IT9A 4WA7A 4KGDA 3ZBPA 4M37A 3LQFA 3W9BA 3BFJA 5M34A 4KLFA 3FF4A 3J80A 1OY1A 2BV3A 3DV2A 1PQPA 1NG1A 3PPXA 5CB4F 2XTMA 3F73A 4ZHQB 1UQVA 1HA3A 1U3GA 1ZQNA 4D6YA 4AIIA 4D41A 1DC5A 1RMTA 4YJ2B 4GQAA 4W8OA 4PAGA 4MIEA 3C3WA 3NBYC 1Z34A 1DX9A 2EZYA 1HWYA 2F4NA 2YS6A 4MB6A 4ZARA 4DCNA 3IRUA 5ADUS 3P2OA 1BA3A 4MROA 1HDIA 3ZJYA 3AXSA 3EK2A 2WIJA 8ICNA 1U9ZA 2F1KA 4QXMA 1K92A 2DKNA 5BQOA 2WAQF 1LH0A 3I6YA 5DO9A 1QH8B 2XYQA 2ERCA 5KPDA 1N6PA 4D56A 2AEEA 2PXAA 4JP2A 2KEYA 1N8TA 2QX4A 3IVMA 3OQ1A 1J9GA 2JEYA 4R1QA 1DBPA 1XTKA 1UFOA 3OSNA 4FW9A 1E77A 4IHJF 2CUNA 4MQ4A 3UJDA 4F7WA 3BE4A 4L9SA 1XQWA 4YQZA 1OH7A 1URJA 3ZLVA 3TL2A 3HO8A 1K5PA 1JVSA 4NV1A 2Y9TA 5B2FA 3V00A 4IRXA 3TPCA 2HU7A 5D1NA 2EAOA 5IHXA 3K9BA 5F5LA 4IO1A 4QASA 1M8FA 3NTUA 1SA0B 4ED3A 4D9FA 2NV0A 4CHTA 3V6MA 1PX0A 4G9GA 1YXMA 2O2DA 3TZCA 3UA4A 3HKDB 1HI9A 1JDNA 4DDHA 2PJRA 2W83A 2ZGVA 3TQIA 3CWZA 4EPWA 4EVRA 2AKEA 1UPFA 5TISU 1KMQA 2DRIA 1VE6A 3IEKA 4IXWA 5COAA 1YZYA 1D8YA 1DC7A 3M1YA 3R9IA 2WWTA 4E1BA 2KI5A 4U9UA 2NUPB 2IIBA 3IJ5A 1C9YA 2UXDB 2ZXIA 3WJ2A 3MWDB 1L1QA 2G82A 3OURA 4WCFA 4BB6A 5KVVA 1P2VA 5AVJA 4DMKA 3FJYA 2CFRA 2MSWA 2RCYA 2REOA 1YR8A 2JJ1D 2WZDA 5CYPA 2AI1A 1T94A 4TN5A 1WETA 3E35A 3GCGA 2VJCA 3F1LA 1RVDA 4R9UC 2GHIA 4RGQA 2UZ1B 2VUUA 4DC1A 3DFZA 3RHFA 4DN6A 2J0UB 3GFFA 5IN5A 4E2ZA 5KNCH 1NW8A 4JITA 2F3RA 2EEZA 1JSRA 2YV3A 4DDWA 2BMJA 1KP3A 2B98A 2GB4A 1IM5A 3VZCA 4HDMB 2W0SA 4AF8A 3RJFA 4Q9NA 3UYKA 3ZUPA 3PXUA 1UDWA 3EEFA 4I8DA 2ATVA 4FMPA 1TZJA 2E2WA 3KKAA 2Y77A 3LTNC 3OO1A 3M81A 1K7CA 3UGKA 4C01A 4DZRA 3B6EA 1VG1A 1MTZA 2AJBA 2HV8A 2LDBA 3A2LA 2R1UA 3HJHA 2HB6A 4HLQB 4P8RA 3G6XA 1LEHA 1HDCA 3W3AA 4LZPA 3GIIA 4DM7A 4EY8A 1JAIA 4I27A 2AS0A 4IH4A 4KBYA 1QVWA 3G9UA 4PYNA 3VHXA 5LOVA 2NU6B 2KBEA 4DMCA 4Z2AA 3WDLA 2AMJA 4X3PA 1KYXA 1E2KA 1HTTA 2GBFA 1BKSB 3FMPB 2E4VA 2Z1MA 3DZDA 2W3SA 4PHPA 1W6UA 3BMCB 4GYWA 2CUKA 3BSSA 2X6RA 4Y9UA 1Z5OA 3PC8C 1WKCA 5G02A 2K6GA 1QYXA 1E59A 1BHO1 1OQAA 3JAWA 1P62B 2EJVA 3GD7A 1JQ3A 3C0KA 4IJUA 3BS7A 3ROKA 1QZZA 4EBFA 2ZE8A 4DQPA 3QELA 4RESA 1KQNA 1RHJA 3TI9A 2F55A 1IQ0A 1BGWA 13PKA 2H92A 3EUEA 1AA6A 2O3UA 1ZAYA 1KRXA 1KZ1A 1FE8A 2PGNA 5BV1A 1NLMA 1E3QA 5HJEA 1Z38A 1FYEA 1ZGJA 3WA7A 2JLQA 4W5QA 1O9GA 1WD5A 4WE3A 1MA7A 3VH2A 3CTMA 1NSYA 2NO0A 3CPEA 4HQOA 4F8JA 1R9GA 4D4IA 3G8CA 4OJPA 4FZ3A 2F1JA 1BW9A 4HF7A 4KMOA 3SICE 1WWKA 4E4RA 2UYQA 1K7EB 4GM1A 4R4JA 4RTPA 4YACA 3RG2A 2ABWA 3NGLA 5AKZA 1OLOA 2ZBRA 4DLGA 4DSEA 2DJ5A 3ABRB 4I1VA 3ROZA 1CTQA 4DDMA 2YNMC 3DF9A 3U56A 1QGYA 1PZNA 2XCLA 3HYNA 3DNMA 4DQRA 1H5UA 4MARA 2JGJA 4F11A 4LY3A 1ST2A 1C29B 3FTCA 3WGYA 3WV4A 4ZU1X 3V32A 1GGFA 2J4DA 1QSGA 2VVTA 3ODGA 4G5HA 3VDXA 2CE2X 1NXOA 2I6GA 3L02A 2QRMA 4NMMA 5F33A 4NJ8A 3W4IA 4QO7A 2VPQA 3IUNA 4DS3A 2GM3A 1IBLB 4MEAA 4WGGA 3TEJA 3LQ4A 4OJ6A 4EAQA 4O2BF 2AYYA 2ZIUB 1WXDA 2WD9A 1HZJA 1EJ2A 1R4MB 1IM4A 2YV1A 4FZRA 3QUAA 4KO2S 3CG0A 1AK9A 4NH0A 2VPTA 3VTAA 4DQVA 3CN7A 5JFTA 4MI6A 3HA7A 5FWAA 3PEVA 1DRJA 1P6QA 1TLFA 1VL0A 4YS6A 1NVGA 3NWOA 5C5EA 4DQQA 4PSDA 4C2UA 1I2BA 2ZE5A 4GF5A 1N1MA 4QLOA 4ZEXA 1D0VA 4XWAA 1FYXA 3T9FA 4B6RA 5HRAA 5IVHA 4FLFA 3F6EX 2J33A 3VKWA 1K2WA 3G2LA 4PRYA 1QX3A 1LKYA 4WCFB 3TS1A 3OIFA 3THXA 1T5OA 3HZZA 3MGVA 1N5XA 2A0YA 2UZ3A 2PFSA 3K9CA 2PGXA 1DNPA 4US1R 3L0PA 1OI3A 5GONB 1ISIA 3DBHA 3FKSD 2B35A 3FWYA 4JFAA 4QUDA 1RDFA 3M83A 1JIKA 3ZN2A 1Z2NX 5K0GA 3FHCB 3V7WA 2HBLA 3SSMA 1DMSA 2M9NA 3ZZMA 3M9MB 1J9EA 1JJFA 1PEAA 3HJGA 3HYTA 3IV6A 4LOAA 5DBEX 3OU2A 1QTQA 1XKTA 4OB7A 3TBKA 3VU9B 1ODSA 3IERA 4LPKA 2X2PA 1IWPB 4WFKA 4PW0A 5KJ1A 4B5LA 5BN3A 2VRCA 3ORRA 5C31A 1VIAA 1M2GA 1XCMA 4DZTA 1GNSA 5BVHA 2R0QC 2GLTA 1M2EA 2HJ9A 4X5VA 3TN7A 1ATZA 3THSA 5JSYA 4YCLA 3T1HB 1KZGB 4H3HB 3EASA 4IILA 2V4MA 2C94A 4NZYA 4MW1A 2ORYA 4AULA 2Z8YM 5EXXA 3N0RA 4KIJA 1ZN9A 3LLSA 2LR0A 1XRSB 4Z5XA 3RK1A 4QBKA 3L07A 3ANTA 3GIDA 2IKQA 3O8QB 2XOXA 2EZTA 2HBQA 3ADPA 3CRVA 1U3CA 3I37X 4PF1A 5DP1A 4B34A 2H0QA 4X85A 3WJAA 5LBUA 3SLRA 3PE3A 2Q5HA 4PC6A 5INTA 2Z8YA 1XCJA 2JGLA 5JY6A 5CEJA 3OSZA 1LD3A 2I87A 4TWBA 2W2PA 2JD0A 4ED2A 1JU3A 3DTVA 3TTSA 9ICCA 1HLPA 5JBQA 4NJEA 3K70C 1CDOA 4BY9E 1I1QB 7ICKA 3CNEA 3WBBA 1FPMA 2DKOA 1KEWA 3B6JA 4DWOA 4ERXA 2QARB 1NURA 2PAFA 4WN9B 1YK1A 3TMKA 3H3FA 1XMJA 3I6IA 4EB6A 2F44A 1D2NA 4ID9A 1TO1E 3GEHA 1E5LA 2QJWA 2H1VA 3NWEA 1E1LA 3O2NA 3AF5A 3RRXA 3TRIA 4GX5A 1YVPA 4U1RA 2O2SA 1DLJA 5KG6A 2GCIA 1JHRA 2H4HA 3NT4A 1XZPA 1ZRNA 4QPNA 3V4OA 4B3HA 2G28A 5ALJA 3AYZB 3H1TA 3NGMA 3QLEA 3PIDA 3D2NA 4BZXA 5JARA 5DB6A 2VHZA 3WISA 4YUYA 3BQ0A 1P4GA 3BMOB 5G5HA 1H1DA 2HVHA 1JHUA 1TZCA 2C2EA 4NCNA 4REOA 3CN9A 2XGJA 4MUBA 2B36A 1Q50A 4UDOA 3K53A 4M22A 4YQYA 3RRNA 2JGIA 4XEUA 4C3ZA 1L7OA 5EJMA 5BYBA 1BVHA 1LSJA 1SVLA 1TD9A 4L4YA 3BK1A 3NW9A 4RJLA 2H2WA 4DJJA 4Y1EA 4DV6B 4DT1B 1Q7BA 1KPGA 1AKEA 2K7ZA 5A71A 3G2OA 3M9WA 4PSUA 5IH3A 1JPNA 4N65A 4CKCA 4YJ2A 4L08A 4WZAE 3B70A 5CUQA 4DSOA 5F9LA 5J3JA 3KM0A 5GJBA 1IXKA 1FRQA 4M1WA 4M8IA 4YX9A 2VH1A 3PDHA 1MQSA 2AEFA 2XIDA 4ZVRA 1YDHA 3NKVA 4ENPA 4OHPA 4L02A 3UV6A 5DQIA 3CJTA 5BSKA 1LY1A 3P0JA 3THXB 3T5AA 2PMEA 3HN7A 2AZDA 2FP4B 1T8SA 4G01B 1LKYB 2HPVA 4L4UA 1HG0A 3O0TA 3NR2A 4YQFA 1ZJ6A 1Q21A 1RI1A 3LPMA 4FHGA 1N2CE 4TSRA 4BV2A 2FMPA 4AKIA 2CDBA 4CQNA 3THOA 1ZM7A 1DCKA 5TMDA 2F1HA 4TYWA 3A58B 3A4NA 1E6CA 2ZZNA 1G1AA 1TCCA 2PWBA 4YP3A 3LRXA 4PNZA 3VPAA 4JLVA 4E30A 3WLSA 2P4SA 4F86A 4JEHA 3V7YA 1TQ8A 4F04A 1MNQA 3CBGA 3G9ZA 2GNOA 1O57A 1XDBA 4UZSA 5TQ0B 3B89A 3NUZA 4NFSA 4F4HA 2H2IA 2R4TA 4RAQA 1TZMA 4YJ3B 3YASA 1NVTA 5CH8A 5KIAA 3GGSA 3CEJA 2HHLA 2LXNA 1MO4A 3DTTA 3FPJA 2Z3ZA 3COWA 3F6SA 4I55F 1L4NA 3FCXA 3SVTA 5EWJB 2YTUA 1XNSA 5D6NA 1BNOA 1KI9A 2W55A 3I76A 4IVPA 5EZ6B 3AW9A 1VL8A 2RGGA 3UCXA 4CIBA 1V5FA 5JXIA 3LXUX 4JX8A 3A6KA 4RQUA 2GF9A 3WLJA 1SKBA 2VHXA 1ZXIA 2FMHA 4KR9A 3EUB2 5J0XA 2PUTA 2V5VA 1B8PA 4B2YA 4IDEA 1FY2A 5KKCA 2Q0HA 2O1XA 3U61B 3OCXA 3QGMA 3EXFB 3V8EA 1SY7A 3O03A 4A0HA 3B9RA 7YASA 3WYNA 1UPTA 1NZBA 1UJ4A 1O0BA 4YR0A 3EIHA 4JQOA 3RNLA 1N2JA 1ZSVA 5KL1B 1T7PA 1IV8A 1EBUA 2BEVA 3QY9A 3RH5A 4LYGA 4OM8A 5HHIA 5J9FA 3RC1A 4GDFA 4ZXFA 2PGIA 3ICQB 4KRXA 4UZFA 1LKZA 4FJ0A 3MWEB 5LBTA 4F6RB 4G0OA 2UVRA 1S97A 1QOPB 1Z62A 1YQ9A 2H17A 3IT2A 2QNIA 2VAXA 5CNKA 4RQ5A 2FFHA 3P4XA 1TYZA 2GK4A 2GZAA 5KYVA 2IEZA 5MGNA 4L3OA 2KKVA 1EB9A 2OXFA 5K1ZA 3PX7A 1U28C 4M9LA 1ATIA 1BMFD 2I03A 9MHTA 2WJ3A 2A4MA 3FA2A 3P97A 3SHVA 2YV5A 3ZQKA 1IZ7A 2JF0A 1COKA 4CM9D 2CXHA 1W75A 4IXDA 2J9RA 1X80A 3VYUB 2LYBA 1I9GA 3LOPA 2OXIA 4BNMA 3JRNA 1H4TA 4N03A 5I47A 1QZ3A 3BMNA 5LZ2A 4MUNA 4C05A 1UOOA 1Y5MA 3OZRA 2Y0SF 3Q3CA 4PSCA 1LW6E 1W36C 3ZW9A 2O5RA 1A5ZA 3GH3A 2E1FA 4IR1A 2NTNA 9LDTA 1HL7A 3PGVA 3ND9A 4GKAA 4IDGA 4CMEC 1YL6A 1S2DA 3H40A 1KOLA 3OT4A 1FFEA 3MSCA 1E6UA 2WB4A 5AFSA 1EQAA 3KKAC 4KO1S 4X7BA 4K9NA 2H9IA 4B0OA 2Z6AA 4BCBA 3SJZA 2ODQA 2WOJA 3D7SA 1V9CA 2BONA 4ARCA 1H4VB 3ED5A 1GZ7A 2E5FA 2IHTA 4F4DA 1HEYA 4UM5A 3ZCXA 5HWSA 3VNVA 1JEEA 1KBZA 2Z4RA 2E1EA 4F4WA 1YS6A 4G5QA 3OZGA 1Y1LA 1SCDA 2OUIA 1H6AA 3IQFA 5F1YA 4XUDA 2F59A 2HF7A 1KFCB 1OVGA 3K09A 3V55A 4HEJA 4G0VA 4XEHA 1W76A 4NENB 1S2OA 5DT2A 1GTMA 1OCEA 5G3ZA 1QYDA 1LW7A 3DOHA 1V71A 3G6KA 3H9CA 2P35A 1YZ6A 5H3CA 1XPRA 7MHTA 2H4FA 2DSNA 3BSFA 5J59A 1N6KA 1U0TA 2DPMA 3HB9A 3K7EA 1OZ0A 2QORA 4KR6A 4J9SA 3K75D 2AQ4A 1E2IA 4KQEA 4V0SA 2IQ5A 1Q1BA 5G1NA 4LJ5A 4MFCA 1AURA 1IULA 2JGFA 3ESDA 4DJTA 4FJ2A 4DAOA 4GOXA 4Q1DA 5EP1A 1BYUA 1ACJA 3H8JA 4TKZA 4HNAB 1BOOA 3SNHA 2X3FA 3TO5A 5JNSA 1G1MA 3B3JA 3NXKA 4UBLA 5HF8A 4UAUA 2R68A 1C80A 2NZ2A 2ZE6A 4DBVO 2QSYA 4I55A 5AUNB 4JS0A 4MRVA 4KX3A 3EZFA 5A3RA 3ILVA 2R8RA 3T94A 2PLAA 4XX1A 4ZAGA 4EVSA 5JW6A 5IF9A 3G9XA 2DUMA 3EBLA 1OBCA 2QRGA 5HZGA 4TLAA 4R5MA 1FUIA 2D3WA 2IPOA 2GWHA 2P2ZA 4R2HA 5G4KB 1EVIA 5JO9A 4BMPB 2VEDA 3P9SA 1M66A 3SBEA 1GA1A 1NP3A 1RC0A 3JYOA 3TZQA 3JV7A 4E7OA 3N5KA 1EJBA 3EVCA 3ZGOA 1SRRA 3MD9A 2PA3A 5FBWB 3LUHA 4EGCB 2Q0SA 2C2OA 1CUSA 3MBYA 5BVGA 1CY6A 3M6UA 1YAHA 4OXYA 4EMUA 3JQGA 4LCJA 3CPJB 2UYGA 3AJRA 4D96A 1Z1VA 2RHFA 3DYIA 3PICA 5TY0A 4DOCA 3CZQA 3NBFA 3DBVO 1O0CA 1OX4A 1KVUA 4J3NA 2XY6A 2B1IA 1FQWA 2VBCA 2O7SA 3KXLA 4FCTA 3RVBA 5FL7A 4Q1EA 3KD3A 1PUJA 2I33A 3B53X 4RKQA 1C81A 4ZZ3A 1Z4IA 4BO3A 1YZKA 4BNUA 4KMRA 2XT6A 3EUAA 4XTRA 3T5TA 2O57A 2P2DA 3IYLW 4GWGA 4F56A 3X1ZA 2FCRA 3IMEA 2H18A 3COSA 4FTWA 3K1JA 3P9QA 4FYJA 4P08A 4YCJA 5DHPA 4AJOA 4DTIA 3OAAA 4YUWA 4GFDA 1ZMOA 2LM1A 3H5NA 5DM1A 4R66A 4ZJYA 1XU7A 2P9BA 3I1JA 2JIDA 2MINA 3EGVA 1Y8RB 3CZ9A 3K9FC 4GRDA 1FDWA 1ZK1A 4QBGB 1OREA 1V35A 3RVQA 3QTBA 2DBYA 3JQBC 1L7EA 2BLNA 1OTHA 2RGCA 2OOKA 2Y1CA 5U4XA 4JOCA 1Z0UA 4HZUA 4OP2A 4UEKA 1JEYB 1SXJC 3UWSA 4AZ0B 4DLZA 1FL9A 2GPAA 3PB3A 1CRLA 2V1UA 2GHQA 4Y6LA 3WU2U 4DQIA 1A4UA 2HH9A 2IZ1A 3VM6A 3HUEA 4G36A 4FYYA 4WBNF 4J29A 3FYUB 2JEIA 2CLKB 2ISQA 3AFOA 2XGGA 1V7CA 3PFWO 4IOJA 2VXOA 3N39C 3UJ6A 3ZG6A 2PLRA 4BP8A 5BUQA 5IYZF 2C9CA 1Z3EB 1PG0A 1W4ZA 2YZ7A 5DKWA 1ODIA 3KTAA 1XCPA 1FVFA 3RC2A 3RDPA 3RUDA 3T3EA 3ZDFA 5CDFE 4EKGA 3HJAA 2BHNA 2JL1A 2CMDA 3F5FA 1G3RA 1H65A 1ZIDA 2PXHA 3HKCA 5AKYA 1A5AB 3QE3A 4HLUC 4C21A 4EUEA 2PX6A 1LQTA 2IXEA 3U4MA 3O9ZA 1YULA 4S35A 4TTTS 1D1SA 1IEWA 3ETCA 3H8MA 4BUJA 1CUUA 3AEQB 5F1KA 5E6SA 3NC1C 1WCYA 4XRRA 3T0GA 5EY5B 3FTQA 3HEMA 1K8QA 3PC3A 5BNTA 2IZOA 4PE5B 2IEBA 1TAUA 3K9GA 2F8KA 4MGZR 4UEQA 5BYKA 2VJPA 3HHPA 3RB0A 8ICQA 1Y1KE 2VDWB 5DHQA 3IJPA 4BLQA 4ZQGA 1DXSA 3UUEA 2Z4TA 3W7AA 3PGA1 3LOUA 1XF9A 3RVKA 1OX6A 3VVLA 4OXIA 5HQ3B 2WF8A 1JG1A 2QTVA 3LGSA 3OY7A 4TQ9A 1CQJA 2XKBA 3K8QA 3X2SA 3T7AA 3B9JA 4Q93A 4PV7A 4TRMA 4EAAA 4MF8A 2HQBA 4NI5A 5ITSA 4CTNA 2HXYA 4HKTA 4RNDB 3TM5A 1BEZA 3N75A 1H5NA 4PRZA 2W43A 4HPWA 3Q1KA 4XFKA 1DBSA 4FHDA 1IG0A 5G4KA 1HYHA 3VR1A 5KHAA 5IJ0A 4R2WA 1SUAA 2GX6A 1NA5A 1H9BA 3CONA 1W0KA 4C6TB 4FD3A 2VA9A 4YI3A 1N6NA 1GLGA 3NTVA 5F3RA 1NVXQ 4E2YA 3UMBA 4RY0A 3T7KA 4H15A 8ATCA 1QMGA 3VC3A 5AKHA 1LF0A 4RULA 3NHRA 3F8TA 1G5QA 1ZDMA 3WIDA 3CLHA 1Z73A 1IN7A 2W4IA 4LX8A 4REQB 4A91A 2LBOA 1JX4A 3AI2A 3A7DA 3MT9A 4K3UA 3RVOA 3HCPA 3M0EA 4EEKA 2H5LA 4HAXA 4FLMA 5CB6A 1CQPA 3RBVA 1Z25A 4ENQA 1V8ZA 4YRLA 1ORRA 3C2KA 1T2AA 1RJEA 3NVAA 3D0RA 3P19A 5IIJA 4QBTA 2YQ4A 4RFSB 2R7MA 3TB4A 3WBFA 1K0FA 2WNHA 4KQ9A 3MBIA 5T14A 3IP7A 4G25A 5LQJA 3SX0A 1KBUA 1CZOA 2DHRA 5JCOC 4ZYUA 2JAUA 5EESA 2QZ9A 3MD0A 1GUZA 1P19A 1WZEA 3GJZA 3IHKA 4Y6SA 4TRNA 5ILOA 5IVKA 2JKYA 4N76A 2X14A 3VOAA 1YB5A 1TM2A 3ZYZA 2VDMB 2A1TS 3AY6A 3TEMA 4NE9A 4EI8A 1KFEB 1OAAA 1F6BA 1YJAA 2OXRA 3IUYA 4HDRA 4JC0A 5HW0A 1JX6A 3BORA 4I9NA 3R9KA 1SKAA 1Z6QA 2BHTA 4GDMA 4A8JC 4UDNA 2NADA 1JSLA 2EFGA 2N1BA 4ECXA 3QEJA 4YRDA 4DDUA 4HNUA 3KR0A 5K3DA 2B6HA 3X43A 3CNQS 3F7TA 2VATA 3C5WP 3GEMA 3IQZA 3PG5A 3JALB 5KWEA 2KLBA 3MQFA 1M2OA 1YMUA 2G70A 2I4IA 1ZN2A 4YMGA 3A10A 4Z6DA 3LE8A 2RLTA 4F60A 2VWPA 1KFTA 3CC8A 4DNOA 1IQUA 1E20A 2D1YA 1JIVA 4R8RA 3N74A 3URKA 1VRVA 1J8FA 5I8WA 3ROQA 4PQEA 2JLSA 4BNLA 2E87A 1P6UA 1GZVA 2YYAA 4ZQIA 3USCS 1W88A 2ZTVA 3WB9A 3C4QA 5B3LA 1G291 3AETA 2FP3A 5J29A 2IYEA 2WE7A 2PMWB 3GJSA 1EJ0A 1RCUA 4LK3A 5FD8A 3S1AB 4BBAA 4BE4A 1EHCA 1EZ1A 3TLJA 4BE7B 1G8GA 5MFZA 2W2LA 4FEEA 4JXJA 4DBZA 2KVCA 4O2RA 4YH1A 2OGUA 1ST3A 4F2RA 1Z8DA 3EWNA 2B94A 2JFVA 2C7PA 2WF7A 3HL0A 4QM7A 5IPFA 1UR5A 3FFTA 3UJBA 1E1MA 3NB0A 1QPGA 2LCFA 1ZA2A 1DC3A 2XV1A 2HMXA 1B6TA 2YWJA 4L9AA 5K0TA 3VOBA 4NM1A 3MELA 3LWDA 3BB4A 1E9RA 4XAQA 3GB9A 5GV8A 3L0CA 2ECQA 4A3SA 1SXIA 2KFZA 4HQLA 1SWVA 3HMQA 1BXKA 4ED6A 1O1YA 1OF1A 2A0WA 2BEUB 1NVMB 3EN0A 3EODA 4P35A 2BT4A 5BOSB 5FEUA 2A0KA 5DYYA 3DFUA 3HA3A 3LK9A 3HCRA 2K60A 1ULHA 4WVLA 3NVYA 4Q7KA 3SZGA 1KFSA 1NSTA 1H2HA 2BMEA 3MSXA 5KCMA 5KHOC 3AM1A 2A1TR 3GPLA 5K0CA 5KNBA 1ZGGA 1PR1A 2R9VA 2YS7A 4M0MA 4Q8FA 2V0CA 3LPNA 3W2IA 5IKMA 2EKBA 3H9JA 4O3RA 2VP5A 3ZWYA 4ABYA 3SIXA 4DO9A 1GA6A 2YJGA 4IICA 4ZP1A 1JNXX 2VJLA 4AUNA 5LIRA 2W58A 2QHXA 1MT0A 1XXHB 1NASA 4JL6A 4QWAA 4D46A 5LIPA 2ZB7A 1U94A 2PTHA 2QN2A 2RH9B 5LWQA 4K8RB 4N9WA 3LYSA 3S70A 4TTRA 3ZU6A 4C2BA 3IC5A 3PEFA 4HG2A 4RHXA 3NHJA 4AUEA 2DTEA 3R20A 1IN1A 4DNPA 4CEJA 5GADl 2XEDA 4RT2A 3FMOB 4F6RA 3ENQA 3KQUA 1U3WA 2P4HX 2AG5A 1H8EA 4D9GA 1EIZA 1VI6A 1Z5ZA 4KLIA 3X1JA 3ZWWA 5B4VA 1Q7EA 5B7GA 5K6TA 4FFSA 5JJKA 4AU1A 3H42B 1N5IA 3TCNA 3NIWA 2P0EA 4CF5A 1S9DA 3REQA 1GO2A 3D1JA 5C4GB 4B9AA 1HFEL 1REQB 1UZNA 3AL0B 2E1PA 1PSWA 3DONA 4LYDA 1A9TA 5T4HA 2AE1A 4G5FA 3GDGA 3RU2A 2XBMA 3SG0A 4Q5IA 4UCWA 4K6HA 4NLBA 2I78A 5EWFA 3I9LA 3G0GA 3NYQA 2ZRJA 5BYAA 1QIHA 4ZYYA 5CAEB 3D2SA 1P3JA 1OR8A 1XSLA 1K3UB 1HG1A 1OPXA 2EF1A 2NU7A 3KKKA 3PE4A 3Q2KA 1NK7A 1DXYA 2PFQA 4GD3Q 4NR0A 4R1TA 5DM2A 5G0UA 4RZ2A 3LI2A 2AR9A 2F9LA 4JN6B 5AJVB 4YQEA 1SUBA 4WK2B 4XYMA 3EGCA 4H7PA 1HV8A 2JFBA 4ZMSA 5BVGB 3H11A 4XPIB 1WLSA 4R6XA 2R87A 5HM6A 5CLLA 2C04A 3DKKA 1T2DA 3LX8A 5CH3A 4YASA 4A26A 4B1FA 4DLWA 2XCSB 2NXNA 1GRNA 2XVMA 2BJHA 4RSRA 1IZZA 1ECGA 4MQFA 2PZBA 2QLMA 2BFCB 3ZOZA 3ABOB 3LKDA 2J4CA 3BSYA 1X7HA 1XYYA 5J2GA 1E2UA 3AETB 1FVHA 3GAZA 4AYBF 4FZJA 1C1XB 3DZFA 2Y1IA 2AKAB 2YR0A 3KUDA 3IX7A 5IKPA 3QVTA 1P1HA 4IMPA 2AOTB 2O3TA 2A35A 4X1KB 4O3SA 2EC5A 2WUWE 4EZBA 3ADKA 2Q7DA 5KFAA 2F00A 4LMBA 5FWXA 5IZ4A 3JQDA 3ORSA 1DO8A 4PG5A 3TRJA 4OX9B 1G8JA 4YCBA 1Y8QA 3AOEC 2C0PA 3DLTA 3V6JA 4DNFA 3BHMA 1BMFA 2FUG1 2GPTA 3EVFA 1OTXA 4L95C 3CSDA 5REQA 4MVJG 2OKCA 2QTZA 1MQ3A 1R10A 1P9NA 1COOA 3OJLA 4UQGA 4OXKA 5KYXB 4S0XA 1N34B 3MGAA 3KYCB 3FUWA 1GEEA 2R1VA 3H2KA 2VJOA 1J8VA 1Z6GA 3BDPA 1B6GA 1KFJB 3R6TA 1Z0KA 1P4HA 4B32A 3TG8A 4U00A 4ZCLA 5BN5B 3U44B 3A3OA 4OJQA 4EDHA 2NU8B 4AECA 4ZOEA 2P7IA 1CIJA 2R6FA 5J5CA 2J3QA 3E7DA 3GA5A 4JCCA 3ZDZB 1KFDA 4ZJUA 1L5RA 3QELB 1WPGA 1Y34E 4S1OA 5H02A 3CZAA 4CPDA 1DEOA 2NVUB 4POOA 1T8UA 4PX2A 2UV8A 2R8YA 4Q3LA 2KZ3A 4RZRA 5JT1A 1MJ5A 3WB2A 5FPPA 2JK1A 3B1WA 3RS0A 2VAWA 1GGEA 3C8DA 3I04A 3W5IA 2QKQA 3K9LA 2GAAA 2IUYA 5A7FA 3L8ZA 1U8TA 3BHNA 2C54A 4AZTA 1OUQA 1RLMA 3B38A 1Z7EA 4H3KB 3BCHA 1OFUA 5FI0B 4JIMA 3A05A 2WBLC 5ALVA 4JJ7A 1K86A 4JCOA 1X19A 4DMHA 1BXRA 5M5BA 5E9WA 1C9EA 1W5TA 2ONCA 3A2NA 3DLIA 3EXHB 3IV7A 5FJJA 2QBYA 2ZI6A 1E18A 2IUEA 2QRKA 2RAUA 1E6LA 1D9FA 4JMLA 5JBIA 3E3NA 5D51S 1DAMA 3ZNQA 3ZZTA 4B3FX 1TAGA 5FPKA 4S0ZA 3I52A 3I12A 4F5PA 1R0SA 2OG1A 4OMDA 2HRQA 4XQ0A 1M6VA 5BW6B 3RHZA 3MYYA 1RADA 2QX6A 3LBAA 4GU5A 1NZFA 1B2LA 5BOLA 3KQSA 4Q34A 2XCQA 3HSSA 3F47A 4GC6A 1MKYA 5KFEA 1FDOA 3BG5A 3KT0A 4UVIA 3NH6A 4BNZA 4YWHA 3V4SA 3RREA 2HJRA 2WUEA 4ITRC 5FFMA 1EP1B 2IE8A 4P58A 1LBSA 1SU8A 4O1HA 3J7AC 2DF8A 2NZUG 2A9OA 3PXCX 4QKQA 4WZ6A 4DKJA 4F5DA 3OPNA 2CLMB 1MJGM 2FB9A 2PFKA 1U6IA 2X13A 2YQZA 3E23A 3G8AA 3QX3A 1H38A 4JMUA 1XTSA 3D5QA 3GDFA 3AK4A 5JU6A 4YQWA 2VBIA 1R18A 4IVNA 1L4UA 1ZQKA 3DMNA 2OYCA 3VHRA 4ZAXA 3ND6A 1NIJA 3SEFA 1G4AE 4PQGA 3IAM6 1UBGA 4UXHA 4B44A 5J2FA 2RHJA 5EP3A 4CKZA 1QP7A 3V6HA 1XC7A 1PKEA 5E79U 2PBLA 4G1MB 1QR2A 3WRXC 3UQ2A 4NYIQ 3CX4A 4LV6A 4PANA 3UAZA 5CDTA 4P0QA 2O6LA 2WVAA 2J8ZA 1U2TA 3AQFA 2YN0A 2FWRA 1Y48E 3DE5X 5JQGB 5B6IA 3WHLA 1NDQA 5KAPA 4GM4A 1E0JA 5JI2E 5LMZA 1PAUA 3DJFA 4FX5A 3KKOA 3KZOA 2NRXA 8GPBA 2ZTUA 3FNHA 1ZIPA 3KDAA 1M1UA 2AMYA 3OHAA 4ZK2A 1J23A 2GT1A 1HXHA 4GI5A 2FMUA 1E8NA 1VG9B 4PZ9A 2XYRA 4XDGA 2PH7A 5IJ9B 1H9CA 4MGHA 4Y1RB 3B1XA 4MB2A 3ZNNA 4PAMA 3THWA 1G63A 3WP1B 1JEDA 4R1MA 3PGXA 3RC7A 2J4FA 1Z4KA 1C1DA 3U0BA 3N86A 4HGZA 3BRWD 1KQ3A 2IVZA 3DPSA 3M6AA 1L4GA 5C53B 4LRUA 4NPHA 2HSJA 2OV8A 2PT7A 5JE8A 2C7RA 1A3CA 3U9SA 3EPKA 2PKYX 2PGDA 4MPDA 4YTEA 2FWJA 4OQNA 3ISBA 3GRAA 4NOLA 5F9NA 1GCGA 2C5FA 2HRDA 3V1UA 4E5DA 1SXHA 5EQTA 3HJBA 1DBVO 4URUR 2J7PA 2QM3A 2HV9A 3PP8A 1YQQA 2G8LA 2GETA 3B6KA 3P45A 1JQ5A 3T1YB 4ZYVA 1I3NA 1QCDA 1Z7WA 4M2LA 1ECCA 3B82A 3TAUA 8MHTA 2RJOA 2XDWA 2VHWA 3OWXA 4RTSA 1ARZA 3K8YA 3O2SB 4I2GA 4NLLA 4QYTA 4F46A 2RGNC 1XAHA 3OZXA 1HLFA 2WHQA 3H8WA 1ORDA 2OV6A 2GF0A 4ER6A 1XEAA 4AZVA 1K4MA 3OX4A 5EWMB 2F43B 5IM5A 7ICUA 5M3BA 3JPWA 1DTEA 5JYCA 3BS4A 1YO6A 3E3AA 5C0OE 3V7NA 1SEPA 3UMYA 4R84A 1SU6A 2UVUA 3OZIA 1CR2A 4UD2A 2I22A 3H83A 1HQYE 2JAOA 3KOMA 4LWOA 2UYOA 2XMQA 3JD3A 1BKYA 3NIDB 4KLZA 5FUQA 2PZGA 3P26A 2KK0A 4M38A 1SO8A 2BGNA 2IP2A 1RRKA 5DK4A 4GPAA 5FR2A 1DOAA 4Z99A 5SICE 4CMIB 4HRXA 1XT6A 1VRCA 1CF9A 3IA2A 4Q1VA 3M4XA 4MLCA 3D6JA 4UHCA 2PSFA 1KJJA 2OLEA 3TBHA 2D5IA 4XLZA 3EY9A 1QYVA 4YXMA 3KEFA 4FDAA 5I7WA 5IZCA 4QZCA 3SS8A 1T2NA 3BB1A 1TK8A 8ICPA 3MOSA 1E66A 3ABSB 2C8JA 4OJNA 4KH0A 2IDMA 1M3SA 3LL4A 1PT5A 5I7HA 4NYJR 1ZKDA 5AJYA 3X2EA 1EDDA 2IX9A 3VV2A 4RHUA 3OSPA 5KI6A 1X1AA 3H0EA 5B7QA 3AZQA 1GHTA 4KO8A 2WU4A 3EC2A 3O3OB 5CA1A 5KOYA 1SIJA 1UMDB 1J33A 2C2GA 5KAFU 1EK6A 1CFZA 3T7EA 1WUKS 5HF9A 4YJFA 4HH4A 1RCFA 3TTYA 2OT3B 3JYLA 5FOVA 1P3Y1 2FWBA 2HEGA 3CH4B 2LI6A 4MEBA 5C8VA 4OQXA 4BB0A 4E94A 4ZTZB 1Q16A 5B6JA 5HZMA 3C6YA 1X2EA 3DOCA 1TM4E 5IMBA 3T99A 1IOZA 1KBQA 1NAIA 4JJKA 4X92A 4BWFB 1ZETA 3OLYA 3CIOA 1VPEA 2G17A 4JC8A 4QW9A 3EEOA 1N77A 3GI1A 4C3OB 5EIAA 1CF4A 1VL2A 3MOIA 3VDNB 2X2OA 4BMZA 2ORWA 4JNKA 4KZPA 1KDHA 3WYCA 3BQ7A 5AI6A 5CVCA 4KRFA 5K0SA 2GFQA 2DHEA 1UBHS 4EA7A 3KJIA 1LDGA 5C5IA 1UWVA 3WK9A 1DVRA 3GMIA 1QQ7A 1CE8A 1MMFB 2GAFA 1CY4A 4I2FA 4ROSA 2WKRA 2GERA 1FRFS 2RC6A 3IKTA 2FZLA 1Z5NA 1TEXA 1VRWA 3G0OA 3GIMA 4P5DA 2WPDA 2XMZA 1QIEA 1K88A 4DWIA 1U2SA 4IZOA 1R5NA 5E7QA 4EGAA 3Q11A 1C14A 2DBRA 1J2TA 3EULA 3PX6A 2N3ZA 3MA0A 2EAUA 4FMCB 2RB4A 4LMRA 5EIFA 2OO7A 1IVSA 3LNTA 4R8LA 5CPBA 1G59A 4C3VA 3N59A 2Y66A 5J8YC 3D43A 5FBKA 1YD7A 2VQDA 2P4UA 1ZI8A 2RGXA 1DJOA 4QYIB 1VJ5A 5AVVA 2ZJ7A 1I1HA 3IEPA 1DIRA 3MJTA 4P98A 4I9HA 1E62A 5JMTA 1Y7IA 5KVSA 2AG8A 3SJUA 5JSZB 2PL5A 2H7CA 3IO5A 2G72A 4M1QA 3X0DA 2VH2A 5HKAA 7ICRA 4MRMA 2V7VA 1FFGA 3DQPA 2CF5A 1E3TA 3K73O 3Q40A 1SC3A 4X84A 4JV5B 2DQNB 3IQHX 1B23P 4MKZA 5ALTA 5CHGA 2E82A 4TT3A 1T25A 3E7WA 2HU5A 1ZGAA 3R3HA 2OPBA 1D0IA 4X00A 1SV0C 2CHQA 4ZU6X 4Z0PA 2H63A 1QG0A 2ZP1A 4I1IA 2FYTA 4JV2A 5HIMA 2OD7A 5BN4B 1K66A 4ZI7B 5E3JA 2OZKA 3FDZA 4ZDIA 4D9JA 2OAGA 4O2AB 2AI3A 4MCAA 2BCJQ 4HSGA 1XJQA 4TS3A 2QB1A 1QIMA 3HWWA 3M82A 1EUCB 1MJNA 1PVDA 3E81A 1KVSA 1ZH6A 3OMWA 4LCEA 4XTCS 3RV3A 2O2ZA 2J7PD 5FR1A 5JWHA 2EDCA 1A6SA 4W9MC 5E8RA 5EEHA 5JZVA 2QAJA 2NO7A 3TTWA 1XRPA 3ESRA 3O8RA 1KI8A 5EJ9A 1DOZA 1KH1A 3EDQA 4KSYA 5EG5A 4ED9A 2EFYA 1FA9A 4Q01A 1KGDA 2HHJA 4BPBA 1K7XB 4JJIA 2HIMA 1ZYQA 3PNLA 1AKUA 2ZJYA 4RTQA 2LM4A 2BELA 4AY4A 2K4MA 1DRVA 4QJ5A 1Y3AA 5AJTA 4GMFA 1JJAA 5KU1A 1UPHA 2H4WA 2GMWA 1S10A 5DGXA 4S1TA 1EESA 2A5YB 2WHXA 3BHIA 4HWSA 1S89A 9ICRA 1JLRA 3M1LA 4DRXB 3TGWA 5KWSA 2YZGA 4NF2A 1IZ9A 4OPMA 3UN1A 1PV1A 5EHGA 1JS1X 1TVEA 2FR1A 3HVIA 1U2RA 1BS1A 1I4OA 1A7AA 2PRIA 4KXMA 2HA5A 5J47A 3H6KA 3O5AA 5FBQB 1FW6A 2C2MA 2CJYA 3LPLA 1RPTA 3S1AA 4D0NA 2P3LA 1SWWA 5FUXA 3IE0A 1X6IA 5EQJB 5TPWA 4QZDA 3E8SA 2G5GX 2VHVA 5CDFA 2DCMA 2G77B 4F45A 3DDCA 1KYYA 4KG7A 1AIPA 5CEFA 3FMGA 3R7SA 4MW9A 4AN1A 3SV4A 5J0TA 2FE9A 2HHTA 1TUEA 2O7RA 1ADGA 3NIBA 1U1CA 4OATA 4RLSA 2OHXA 2XIJA 4QGGA 1BOFA 4M7RA 1QYWA 1QLHA 3O8NA 1CEEA 4MRNA 1IDOA 3CVVA 5EMMA 4PVDA 1CK4A 5KDDA 3SS7X 1LC3A 4XD7D 1GTSA 2ATXA 4GOOD 2ROQA 5J2UB 3C16C 3VGPA 2ATEA 4M99A 3ZDBA 4WBSA 2CCKA 2RC5A 2QVGA 4MWGA 3EDCA 4J4BA 4G0UA 2XWSA 2QRVA 3GJ5A 1UJNA 1WXHA 2XSZD 3H99A 4DM3A 4D80A 3PIIA 1YASA 2HF8A 2QL9A 5T3UA 5L51A 1XDGA 3OCVA 3TSYA 1OYVA 4F93B 1NGSA 5EIOA 4QZGA 3WY9A 1KJ8A 3BA1A 4ND5A 3TDNA 2XTZA 3VA7A 3THYB 3F74A 1A50B 2DQYA 2J08A 4Q9LA 1PR0A 2CYCA 2E4ZA 3MQ4A 5G0SA 2C9MA 3B36A 5JAIA 3CVUA 2PUDA 3A4MA 4DUGD 2CVHA 1K8RA 3K6RA 3NM5A 3U81A 2Z2YA 4QVKA 1JDBC 4UULA 2W9AA 3RSHA 1Z8HA 4OHWA 3ZV6A 4MRMB 2HM7A 4D92A 5JAZA 4QYIA 4NXZA 1T8YA 3CZRA 3LWNA 4GOMD 2PMBA 1RKVA 1IXRA 5D3MB 3T3DA 4CI0B 5JUMA 3SQIA 1BU5A 1R9NA 3FAKA 3KAKA 1MG5A 5BSTA 2H9AA 4L4ZA 4DS5A 1TJ3A 2OZLB 3UGQA 3KKPA 2GEFA 3IMGA 1N0IA 3GROA 1Q1NA 4PR3A 3VYTB 1Y6FA 2JJYA 3DEZA 2G7ZA 4GBMA 3D54D 3E1SA 8LDHA 3CRMA 3FCAA 4XPZA 1PJ2A 2W2XA 3HB7A 3MWKA 2RARA 3ESCA 2V4UA 4PPYA 4WDRA 1ACLA 1G20E 2QDKA 2BUCA 5JYBA 1GFZA 3GUYA 1B22A 1EVZA 1EZ4A 4IKEA 4WRRA 1OB2A 3PQ6A 2J6SA 3ZGLA 5CDHA 1E2GA 2BYTA 3MTBA 2JLXA 1SKUA 4ZXPA 3CURA 4ZYZA 4UVDA 5C0YA 4P4TA 1TQDA 3T7CA 4Z4IA 1QGUA 2Y1EA 3FBGA 4LYYA 4BMNA 3NDIA 1E1CA 2PMCA 1FDTA 1Z35A 3RFCA 5BSFA 5CB0A 1GLVA 4V24A 2NP6A 3ANLA 4QBHA 3QVMA 5LQRA 3Q8KA 3ENNA 1G7RA 2YNMD 4MV0A 1U7XA 2XB4A 3DCNA 2P68A 2X1LA 3CUEF 4JYBA 4OQFA 3RSOA 4IVRA 3S2YA 4WLEA 4ARUA 2IZ5A 3BWCA 1JEAA 1QIFA 2F3SA 4FWBA 1RLOA 5L95A 1M76A 2FZ5A 3ICWA 4IKPA 1BRMA 2CPRA 4HTFA 2X15A 4DHEA 2AB0A 2YWXA 2IK8A 4EB3A 1TUBA 3IOBA 3EB9A 4US8A 1JIUA 1WUJS 2O4CA 2Q5JA 3MS4A 5CLHA 4ZV9A 4NMXB 1RKBA 1CQIA 1EMDA 1W2WB 3PDIB 5C37A 4H1HA 2PZKA 3R5XA 4P82A 3WLOA 1ZD3A 1UAYA 4H0FA 3WE7A 5CD1A 2JZNA 3PR5B 1BCSB 1ZQQA 2BH9A 3DOOA 3A3KA 5BNFA 5A6SB 2C9YA 1E0KA 3IEUA 4G0ZA 4NU5A 3AFIA 4Y2UA 5DNUA 1N5KA 5TNXA 4FGKA 3QVLA 2WZBA 4RKYA 1X80B 3EIOA 5E38A 5JV5A 1ZWKA 3JX9A 3E27A 2L17A 3A36A 2PY6A 2V96A 3IALA 4GL2A 4MVJH 4UTPA 1A9ZA 4NY1A 5LQDA 1H94A 3BA6A 4QQRA 4TTPA 3W34A 1VZ2A 1S4QA 2HNBA 2VUTA 2WIBA 5LWHA 4FNGA 4IHKA 3S99A 1BHQ1 3K0EA 4EUNA 1QDEA 1U7UA 1N2GA 1BVSA 5KFLA 2JIMA 3PMNA 3F46A 4IIHA 2PXXA 1NQUA 4L85A 1R5BA 3UQ0A 4FZVA 1COZA 4FMCF 4U2FA 4WOKA 4F2GA 3HV0A 1E3WB 1CUXA 1D5WA 2HDWA 1SQ0A 1MFPA 1LGYA 2ZVJA 4RUCA 4YBZA 5AI0A 3RRJA 1C8VB 4IWYA 4DTCA 3IOYA 1NP6A 3N2YA 1N3IA 3BAFA 1O4VA 4KWHA 1RWOA 5T8KA 3L40A 4NMWA 3SFZA 3FWNA 2XPCA 4C4OA 1L4FA 1JPVA 2QV0A 4QGAA 5LM3A 4JKYA 1UBEA 3NTLA 5BSVA 2RONA 3EIXA 2XLBA 1P45A 1EFKA 1W29A 4KLNA 2OEHA 2ONKA 4RDXA 2UVQA 5AOVA 2MT9A 4Z8XA 3WL8A 3TVYA 4MEJA 1F17A 3PEEA 4D8WA 5IFLA 3QXCA 3K4QA 3KT8A 2FJUA 4OU4A 3L18A 5DTRA 4FNOA 1Q0ZA 2Q1UA 4G41A 1YR7A 3EVAA 2JEOA 3B5EA 5ECYA 3WL7A 3T3PB 3RLIA 4G1CA 3GZJA 5LU8A 3EMDA 1GO3F 2AFIB 3PWZA 4ND4A 3NMUF 5AKKA 2W6MA 3ONDA 1BKDR 3IG8A 1A5SB 4DSKA 3BD7A 4PYOA 1U4NA 3IPXA 5T4BA 1XSNA 1I7LA 3PSAA 2HIGA 4BDTA 2C5AA 5A1TA 4MDYA 4P5PA 1DFGA 4KLDA 3MRVA 4HWTA 4R2JA 4FE3A 1ZD1A 1VSVA 1JZSA 2HF9A 2TS1A 4I5FA 1UODA 4OLJA 2X5OA 2Z57A 3D6FA 1LA2A 3JR3A 2W6ID 4FGLA 3WYEA 4KR2A 2AYXA 3EVDA 5DLYA 1VXOA 4PS1A 4R98A 5D86A 4XW2A 3BRWA 3O90A 1AO0A 2QAGA 2JS7A 2P62A 2E8PA 3IV9A 5MGBA 3ONFA 2NRWA 5J0RA 4EYIB 1OPRA 2BIFA 3P5SA 2EJWA 3Q72A 4LRWA 5G40A 4F91B 4M7OA 3K4GA 2CJWA 3BF7A 3KB1A 3ZLUA 1IHUA 1CETA 4RVNA 2D3TA 3WWZA 1XVVA 2MMCA 1LLFA 4DA7A 3TPZA 5JS1A 4JP3A 3W77A 1UM8A 3W6UA 4P3OA 4BNJA 3FGZA 2WWYA 2P2SA 4MYSA 3O3NB 3P2KA 5CBPB 3T9CA 1JRLA 3SVZA 1KAOA 1THZA 5EZYF 3WGNA 2VK2A 3I9OA 5DN6D 1UT6A 4DIBA 1PD0A 2AZXA 1Z4LA 1R8QA 3DE4X 3L0DA 3QU5A 1Z83A 2AUMA 1QF7A 2G9ZA 1Z36A 2Q3LA 5EN4A 3SQLA 2MMGA 1CQXA 1O97C 4Z9FA 1RAIA 1V7PC 5TARA 2AXQA 4YLGA 4YRKA 5JSHA 5JVDF 1OH8A 1DUVG 2JATA 3UGTA 4P4GA 1IUKA 3TAHA 7ICPA 4MUAA 4KQGA 3IVCA 1JG3A 3G82C 4LHSA 1Z6PA 2C2KA 3TOSA 3F5DA 2PNJA 3HSYA 4F2SA 1W19A 3BWVA 3DL4A 3ZVNA 3MCUA 2FPMA 3IQIX 1P5ZB 2YJZA 2Z6VA 3FOAA 3IHLA 5DNEA 1E3JA 3QVWA 4KO4S 3ZXIA 1XS9D 1GZ4A 3LZDA 2O5VA 4RA9B 4BFLA 4B6SA 1ZJJA 4MGKR 3F5EA 3NGDA 1FX1A 2FVYA 3H5IA 1R15A 1ZCBA 1ZK4A 2OUKA 3JASB 4HUQB 4K6OA 4WFJA 5GAJA 4MRSA 5LR6A 3L7YA 4PR0A 1TTPB 4ARZB 1QHSA 1WZCA 4PHCA 5FA5A 4DSIA 1S1CA 3HEBA 3CUWA 3GK3A 2VCHA 4FGJA 3A31A 3AP3A 3GYGA 4TUQA 3H19A 4HMOA 1Z08A 1WNFA 3Q0EA 4Q03A 2BFMA 2IVFA 2Q7OE 1RAGA 2QPTA 3C3BA 3K3PA 5EYPA 4C8KA 3IVRA 4CFSA 4RL6A 4FOPA 2Q5FA 1P4AA 4E1VA 3HDGA 2EQBA 5M2QA 2YWDA 2W5UA 4LHWA 2R5NA 3U31A 4QPPA 2AQKA 4I9FA 4KR0A 4MQ5A 4PONA 1FP7A 1G16A 4CJXA 1Q0QA 1BDMA 1U90A 4U8HA 4ZAYA 3UK2A 2I99A 5I9NA 3P9PA 3CKMA 4QBIA 3T5JA 2JA1A 4KYVA 4XI9A 2B4QA 3QTTA 3PXGA 4N47A 2FZGA 4MVJE 3GFGA 4BBPA 1KYQA 1SURA 1QO9A 2L0XA 4QPDA 5JSZA 3H13A 3UAVA 5HUQA 1NI4B 1YI8A 3OF5A 4J2HA 2C5EA 2PI5A 2C42A 3QVKA 1KS2A 4FYXA 1MX5A 3RUHA 2OCKA 3HPRA 4QZVA 2FFAA 4A1OA 2IA6A 2YMPA 2A7XA 1F4VA 2VYNA 4B76A 2JFGA 1XA4A 3WOVA 3Q6NA 4ZC8A 4CMBA 3D8UA 4L5CA 3RS4A 1IUNA 2VA8A 1CY0A 3HA2A 4MI1A 1BXZA 3TECE 4F7DA 5L53A 5MHTA 3ZIAA 2BDTA 2AN9A 3J81j 3H5AA 1UJBA 2YB1A 1JXEA 5KG3A 1AZWA 5CEEA 3KSBC 3G7SA 2IU6A 4RQNA 3ZDEA 3EZ5A 3NORA 2VSNA 3FCSB 5CA1B 5LOVF 3AVXA 1ZVJA 2GFHA 2VZ0A 3PUWA 3SE7A 2R6JA 2W11A 5LCXA 4COKA 1R0RE 5A0LA 2EX0A 2FFQA 4M88A 3LY7A 4RW0A 2JI9A 1KMCA 2YC4C 2OESA 2X5JO 4KB5A 4N3AA 3JTMA 2ZSBA 4M54A 4JBXA 1N6IA 1M2NA 2XTJA 1ICIA 3QU4A 4PZOA 1LDYA 2DR3A 4PLWA 4HV4A 4Z3OA 5LZ5A 3SKYA 2FDRA 1RBQA 2NT3A 3SXPA 4PL1A 2DVMA 4RA9A 1C9JA 2DPYA 4WK0B 3PQFA 4KRYA 5D3MA 4N7RA 1FS6A 1Q7GA 1ZQFA 2O52A 2EW8A 2DLCX 2EKDA 5EOZA 4RPKA 1EFHA 1VCHA 2CMFA 4KDFA 5L1LA 1KKMA 4MMZB 4IUDS 4UUAA 1OAOC 4J94A 4DKXA 5F7JA 5CK5A 4IDFA 4B3GA 1QYRA 4MDFA 1L7PA 4DQUA 3SJCA 2FNAA 1XK6A 2HO5A 2PH3A 1S77D 2GGSA 2VF5X 1OOEA 2X5XA 1PJQA 2ADOA 1ZYUA 3F6CA 3MJRA 4P93A 3WTCA 2ZYVX 2J85A 3GJ8A 1KSHA 4LGCA 3I9JA 1JXMA 1AGNA 1QK5A 3LDAA 1B6RA 3KG2A 1UBCA 2HY7A 3FDSA 5G41A 2C84A 1MDFA 2WYIA 1PFWA 4FFLA 4GRIA 3D6NB 4P38A 4ZHQF 3VGJA 3IAS6 4CIYA 2QP4A 4HUTA 4MHTA 1AD2A 2VRWA 3BTSA 1WMFA 1K9SA 2ACKA 2YUTA 3FFAA 3T4UA 3VTZA 2JFNA 4AJ1A 5ARCA 4D4MA 1TK3A 2HMVA 2P27A 4L07A 5JZ9A 4W63A 5ER9A 1J99A 3JZIA 2IGBA 4FR0A 1JA9A 4XYGA 4GFJA 2YZ2A 2OB2A 4E5SA 1FU8A 2R47A 2C2XA 1X6VA 1HX7A 1M9NA 2H8GA 2RKWA 3RCBA 3WFJA 1GXSA 4ETMA 3O91A 1XZEA 1XTUA 1Z2PX 3OQIB 3AR2A 3WBKA 1JG2A 3RTBA 3SC6A 5JJLA 2XMPA 2AMLA 4BKOA 4ELVA 3R9XB 4PYJA 3TVTA 4DR3B 4NE2A 4B4OA 3WHPA 5KG1A 1GU7A 1ESDA 1HE3A 2ILVA 4H7EA 2JIZA 5CX1A 5DBIA 5IAGA 1W4CA 2IW1A 5L4LA 4W6QA 3IQWA 4BMOB 1YBAA 2YW2A 1SELA 5D00A 4F50A 1SVUA 3SM9A 4EJSB 1D2GA 3C41J 5J23A 5I4CA 1DHTA 2WHYA 3DCJA 4DSFA 3ND7A 4HUJA 4C0ZA 3AILA 5H7XA 4BNWA 5HBGA 4XIYA 1GG9A 1O08A 1PR4A 4Y6PA 4B6PA 3GFBA 4N54A 1I6MA 2LTAA 1M5UA 4TKMA 3O9VA 2R5FA 4XQGA 1K9VF 1N25A 2BEUA 2IZZA 3OM8A 2PV7A 2XKJE 1MFZA 4UVGA 2PZFA 5CVEA 1DDIA 4JJZA 4IQ4A 4Q4HB 5TMEA 4HAWA 1QBKC 5CFMA 3PJRA 4BAGA 4ENRA 2RFLA 3IP4B 1JTFA 4TS1A 5ITWA 1T8TA 1P2FA 3BHJA 4WW0A 4DIOA 3RB3A 1AOXA