3QUBA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47ala mutant complexed with sulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
MRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHAGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qubA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qubA01
4UMFA 2YMQA 5AICA 4B6JA 2P27A 3F9RA 1YNSA 3PCTA 1QYIA 4Y2XA 1Y8AA 2YFYA 2WF8A 3AR5A 1LTQA 4HGPA 5ALDA 5AW5A 3D6JA 3ZUPA 4G63A 1YMQA 1L8LA 2IOFK 1WZCA 3A1DA 3ZW7A 3PGLA 3NUQA 4YIHA 2YY6A 3L1VA 3AR6A 3DDHA 2YJ6A 3R4CA 5ALHA 3WGUA 3W5DA 3B9BA 5AKIA 2W4MA 3L5KA 5AIAA 5ALLA 3UM9A 4C4RA 5ALXA 3L0CA 3L1UA 2HOQA 3HLTA 2YJ4A 1L7NA 1XVIA 1MH9A 1L8OA 2IA5A 3SHQA 2WF9A 1L7MA 3CNHA 5AI8A 2ZBGA 1CQZA 2I33A 3N5KA 1T5SA 4PNHA 1NF2A 1U7OA 1XPJA 1F5SA 3AR4A 1TJ3A 4ZEXA 2C4NA 5AW1A 5IT4A 3WK8A 2NO4A 3WGVA 4ZEWA 3RF6A 3EF1A 2HF2A 4QJBA 3ZVNA 5A3QA 5AESA 4E88A 1EK2A 2RAVA 2R8EA 4HYTA 2DQSA 4UU1A 2EARA 1RKVA 1T5TA 2AH5A 2ZBDA 1QQ6A 3M9LA 5AVQA 2JAOA 2YMLA 3U13A 4MUMA 2RARA 2B82A 4Y3UA 4F72A 5ALJA 4FFDA 5AHXA 3U7EB 1QQ5A 4XQ0A 3QUBA 3EF0A 1Z88A 4YCMA 3WK6A 5ALIA 4CE6A 1RLTA 2P9JA 3AR2A 3L8FA 5AVYA 4OD0A 5ALKA 5ALWA 5AM3A 3ZX5A 3B9RA 1X42A 3PGVA 2B0CA 2NO5A 2G06A 1KYTA 4J2TA 5ALZA 5FP0A 2IOHA 4L6CA 2HCFA 4DCCA 3EPRA 3UMBA 4NWIA 2X4DA 2CFSA 2BY4A 1Q91A 5IT0A 5ALEA 1TE2A 2FDRA 3WK4A 4XOUA 2RB5A 1RKUA 4KNVA 2IOFA 3KBBA 5A3RA 4UAUA 3L8HA 1ZRNA 1S2OA 2WF6A 5AVTA 2ZG6A 4KX5A 1YS9A 4BYGA 2W43A 4UU0A 3SMVA 4G9BA 1RPZA 5AK4A 4DWOA 4YIKA 3WKDA 2AGVA 4Y2UA 2G09A 4DW8A 2PR7A 1RLOA 3OPXA 1T9ZA 4Y2TA 1O08A 3KD3A 4KN8A 3CZ4A 3OCZA 3ONNA 3QU7A 4Y2JA 3SD7A 2C8LA 2HF7A 2JARA 4L6AA 1RMQA 2MU1A 2CN1A 5AKEA 1J8DA 4HGQA 3U19A 5ALVA 5AW4A 4Y2RA 4CF4A 2FI1A 2ODAA 5AW6A 1Z4JA 4YCLA 4UMVA 3B8EA 5ALMA 3W5AA 1ZD3A 3A1EA 1TJ5A 2YJ3A 5AKLA 4EX6A 3RFUA 1WPGA 1ZD2P 2HHLA 4BX2A 2FPXA 2HO4A 5AM0A 2ZXEA 1YDFA 4YCNA 4AS3A 3AR3A 5AVUA 5ALFA 3QUQA 3QX7A 5ALRA 5AW0A 2YN4A 2PKEA 2WHEA 3FM9A 1EK1A 3WK7A 2GHQA 4QQFA 2I34A 3ZVLA 4CNQA 2EATA 2HSZA 1ZOLA 4CF5A 3ZTWA 3SLRA 3DAOA 2W11A 2B8EA 5T41A 3SKYA 5ALPA 4RESA 5AI4A 2MSNA 3QU2A 4Y2SA 5AI6A 2HEGA 4EEKA 3AR9A 3WK5A 4UMDA 5AVSA 3ZVMA 4AS2A 5AVZA 3L7YA 2RBKA 3AR8A 5IS2A 4NV0A 2G0AA 3U7GA 3BWVA 3MMZA 1SWWA 2YBDA 2FEAA 1RLMA 3I28A 1Z4NA 1VFPA 5AM1A 1U02A 4C4TA 5ALQA 1L7OA 2G08A 3N8GA 2G80A 2IYEA 2FUCA 1RC8A 2OM6A 4GIBA 5ALSA 5AVVA 2BDEA 3L8GA 4O8CA 5AKGA 2Q4RA 1WVIA 4OCZA 3FPSA 2HI0A 2B8JA 3FGOA 5AKJA 3QGMA 3IJ5A 3U26A 1U2SA 4HGNA 3IRUA 3M1YA 2I55A 4FE3A 1RQLA 5AI5A 2ZOSA 3SF0A 2Q4TA 1Z4IA 2QLTA 1Z4KA 1ZS9A 4I9GA 5AW2A 2QYHA 1JUDA 2FPWA 3ET4A 1L7PA 3U7FB 5AKXA 5AW3A 4AP9A 3QUTA 2C9MA 3OTQA 3N1UA 3NIWA 3GYGA 4BNDB 1VJ5A 2OA0A 5ALUA 1K1EA 2D2VA 3OCYA 4ZEVA 2B1RA 2NYVA 3NAMA 3PDWA 3ZTYA 3E58A 4H1WA 3FPBA 3IB6A 3OCWA 2CFRA 5E0OA 5ALOA 1J97A 3FZQA 2WF7A 4HGOA 5AKZA 3ESQA 3SKXA 4BBJA 3I1YA 5ALTA 5AIBA 1XP5A 4EELA 3NRJA 4IFTA 3N07A 4OHFA 3ZU6A 4EZEA 3KZXA 5AKKA 5AW7A 2I6XA 4UM5A 2FUEA 4HGRA 3MN1A 5AM4A 2GO7A 1ZD5A 2GMWA 2Q5EA 2MU2A 4NABA 2B1QA 1U2TA 2FPRA 3KC2A 2C88A 1CR6A 2JAWA 5AI0A 3QNMA 4UASA 4Y2QA 3DNPA 5AM2A 2FPUA 3EWIA 2ZBEA 4Y2YA 3W5CA 1NNLA 2O9JA 5AVWA 1YJ5A 3NALA 1YV9A 1Q92A 4I9FA 1TA0A 1L6RA 1WR8A 3OCVA 1RDFA 2I54A 3QU9A 1QQ7A 1Z4MA 3QU5A 2P11A 1Z4QA 5AK6A 1ZRMA 4UW9A 3QXGA 2PQ0A 2R8ZA 3QUCA 3VAYA 1Z4LA 4RETA 2EAUA 5AKHA 5AW8A 5AKYA 4OFZA 4XPZA 2WM8A 5AVXA 1Z4OA 3ZWDA 4YH1A 1Z5GA 4DFDA 2G1AA 3MPOA 4C4SA 3I76A 4CF3A 2GHTA 2ZBFA 4HAIA 3DV9A 3L8EA 1S8OA 3OCUA 1RKQA 5AVRA 1SWVA 3L0YA 3A1CA 2R8YA 3L0BA 1AQ6A 5A3SA 2CFTA 5JJBA 3HYCA 3N28A 5AW9A 3MC1A 4EENA 3E8MA 5AM5A 1FEZA 2O2XA 2JGAA 3A3YA 3K1ZA 2YJ5A 2YMPA 2VKQA 4BX3A 1RQNA 3WKCA 4UAVA 4BKMA 4UATA 1ZJJA 2OYCA 1SU4A 1TJ4A 3UMCA 4KNWA 4KX3A 4NAVA 3NANA 2HDOA 3WKAA 4KYTA 4Y2VA 1PW5A 4BEVA 4F71A 3ZI4A 1Z5UA 3KOOA 4L57A 2WF5A 5AK5A 2G07A 2C8KA 1VJRA 3ESRA 3ZWKA 2AUTA 3QU4A 5ALNA 3BA6A 3WKBA 3WK9A 1LVHA 1IWOA 1N9KA 3P96A 4UARA 3U7HB 3QYPA 2GFHA 3R9KA 5ALYA 4BEWA 4J03A 2YMMA 4YGYA 3ZX4A 4UM7A 4BX0A 3FVVA 4BNDA 3KDPA 5AI9A 3ET5A 4FYPA 3AR7A 1RRCA 3TLMA 3S6JA 1N8NA 5ALGA 3R09A 4EX7A 2B30A 4Y2PA 4MWOA 3E84A 2JAUA 1QH9A 4UMEA 1NRWA 3I6BA 3E81A 4NFLA 1ZD4A 1Z4PX 3QLEA 3W5BA 4XE5A 1RMYA 1U7PA 2HX1A 3WKEA 2I7DA 1RMTA 2BDUA 3NASA 4GXTA 2OBBA 4JDPA 2WFAA 3ED5A 5AK3A 2AMYA 4IG4A 2P69A 2FPSA 3UMGA 1O03A 4JB3A 3J7TA 3OCXA 2R8XA
chains in the Genus database with same CATH superfamily
4KVGA 3FYUA 4J9KA 4WASA 5LXTF 3EWNA 3K53A 3P19A 4JLMA 3X44A 3KSUA 5I7SA 1VMIA 3RYFB 2H9AA 1NGSA 4W9RA 5KWVA 5ALHA 3WGUA 5LOVB 1DGSA 2WVJA 3UGTA 2P65A 4DOBA 2P1RA 2ACVA 2BELA 5IBRA 1B22A 1QIJA 4WY8A 3BULA 1IHOA 5H59A 3RF6A 4BKQA 4D3XA 5AESA 2PG3A 4I1SA 3B1VA 1VHJA 1E7RA 1JWLA 1PWEA 4TWIA 3PNCA 2OQRA 2XCTB 1OFIA 3ANMA 3WGZA 2MSLA 1RKXA 2F3NA 3PNOA 2FPLA 4LYFA 4ABTA 4D9CA 1Q0ZA 2H3HA 2QZPA 3W2GA 1B4DA 3VR6H 4UAWA 4Y9DA 2ZK7A 2P9QA 2I03A 3ZDBA 2F1OA 3NNSA 3QFTA 1N8KA 4RMGA 4M9HA 2YC2C 3KG2A 3CMCO 3OM1A 3CFYA 1NX9A 4H7HA 2Z2YA 7ICMA 2CHGA 1BMFD 3GUVA 4LZPA 3L7OA 4EGFA 3VI4B 1QTMA 4CEHB 2CE7A 3RASA 1SKRA 3OQBA 2HKIA 3T0GA 2GXUA 4RNCA 3D1VA 3KJZA 3IILA 1PRYA 4ZTUB 4WFKA 1JPVA 1KERA 4C4OA 3NHKA 1ZQYA 5FA6A 2MSNA 3SJ7A 2CF6A 1TADA 4KQGA 5JBNA 1Z6TA 1HXHA 5FT9A 1GHTA 5M5BA 4ZAYA 4TQSA 4RHXA 2L17A 4MDHA 2PYDA 2PZAA 5TS3A 3FGOA 5GPBA 3SBOA 4PHDA 3MERA 4Q05A 2OPHA 2GOLA 3U26A 3CW8X 1UCFA 4K9NA 2Q4TA 2AEEA 1GCIA 1PSWA 2GCEA 3C1TA 3LUBA 1YOVB 4NH0A 2K87A 5KKCA 3AIIA 1CZHA 4G5HA 3HJAA 3T1OA 4DYVA 4TLLB 1EI9A 3TFQA 4WXYB 3V4ZA 2OY0A 3MN1A 3A7DA 3ZBPA 2EAMA 3GOQA 3EGEA 3BMCA 3DNPA 3IDAA 3W5IA 2ECQA 1DHRA 3VZQA 3ZIUA 2Q6LA 1DPFA 4OAQA 2LKCA 4N7BA 1QQ7A 1WHSA 1Y4UA 3OJOA 4WLNA 2ZQ5A 1N6KA 5IARA 1MD9A 1Q50A 4HB3A 3T1VA 1V47A 4DIMA 5TQ2A 1T4BA 3ETRA 1ZMXA 3NIGB 2XYGA 1NXOA 2O2XA 2CUZA 5LQMA 3D0OA 2WM9B 1ZSNA 3DBOB 2YXLA 1FTYA 1D2RA 1NVAA 5J8YA 2HJVA 3BA1A 3KHGA 1QJCA 2DEUA 5G0UA 2REQB 4EL0A 3BZKA 3PI7A 1NJZA 1G4AE 1ZH6A 1QRDA 5K0TA 4BEWA 5FXMA 4Q3BA 5H8WA 3R3SA 5FLXA 3KDPA 4Q01A 2A3VA 1PR0A 3OM9A 1RWOA 1HGXA 5HPYB 1J9EA 1VPTA 4F4YA 1KDYA 1P9OA 2PRIA 1I1NA 5HRCA 2OOKA 4MPTA 2EL9A 1RMYA 5LVAA 3LZDA 3ZWAA 4LVCA 1AKTA 2LI6A 1NUHA 2L19A 2P66A 1HMYA 3F5EA 4DC9A 4FYYA 1O03A 1HNXB 1IBLB 2BEWB 1JGTA 1XFDA 1P3JA 2GCNA 1QGUB 2ZTVA 1FNBA 4DQKA 5JLJA 1ADBA 4KFUA 3VQTA 4BGEA 2JXJA 1N5MA 2GTPA 4KDCA 2HOIA 4QT4A 4OUKX 1RHJA 5B1YA 4EB3A 1OIWA 3WLTA 3LTEA 5SY6A 5J0SA 1USGA 4RS4A 5HZHA 3B1YA 2NVWA 4GE3A 4L1KA 3V8MA 4N54A 1X86B 2R7KA 4EK9A 2ESEA 3ZKWA 7ICRA 2FHSA 2VPXA 4GMHA 3MJFA 3KT0A 1TMOA 3RFFA 3DMRA 4C0JA 5I4BA 4HQNA 2BMWA 1C1XA 1BN6A 2VH1A 2OCGA 4FUTA 4J1SA 4DA8A 2EZTA 2PMCA 3I73A 4H6XA 4HX5A 3TQSA 4ECYA 2PMBA 5CYFA 3QPUA 3ORYA 1N62A 4KYIB 1YIDA 1KVSA 3X1JA 1UBOS 4UDOA 4OJ6A 3FXAA 4JOBA 5EHXA 4G56A 3EC7A 1U99A 1DS6A 3SP1A 1FNNA 1S6YA 1UKZA 4AP5A 3NHRA 5EC8A 1E20A 1MN8A 1HLGA 1MB3A 1DWQA 1WCXA 4C0XA 4K9QA 2GZ1A 3BH7A 3MCAA 4JT4A 3CZ4A 5CBPB 1IJKA 1T13A 4HQLA 2HYDA 2FN8A 1DX4A 3WDSA 4F5OA 1Z4JA 2BTQB 3HBAA 1KE2A 3G2QA 5JY1A 3T7KA 1VG1A 3VR6D 2C04A 4LOHA 1NBOA 4R2XA 2QN1A 3W3AA 1VECA 3QFSA 1R6VA 1XVLA 3VH1A 2VBFA 4YJKA 3OWOA 1GUAA 1I3MA 4J2OA 4B74A 2QTVA 2GB4A 1SWWA 1XHLA 3IUNA 4POAA 3A4NA 1P4AA 3CCFA 1GKYA 4OMUA 4QQRA 3LVFO 1U2QA 1F2DA 3SYMA 4Q3LA 1CYDA 3EXHB 3LYHA 3D7MA 2FY8A 3H87A 4KV7A 5KQPA 4GKBA 3DWEX 4ZKEA 1T24A 5BORA 4N8SA 3U7FB 4JLUA 1YJBA 1NLZA 3QUTA 4PZNA 1PLLA 3M6ZA 1UK6A 2CJWB 2AFIA 4B85A 5BSTA 5ALUA 2CLDX 4UTOA 3MUEA 2JHFA 4HWPA 2EGGA 2IY7A 4P33A 1CXZA 1RYEA 4KRYA 2H3QA 3OO1A 4QOGA 3T4XA 1BXGB 3T1QA 2RE8A 5K4AA 1VRCA 3HUUA 3ZH9B 3IKVA 3O3MB 3V33A 5KTPA 2DETA 2REBA 3S5JA 1W4AA 4L22A 3N0VA 4JI2B 1T3GA 5BQFA 4BVKA 5K8UA 1P1KA 2F1IA 2GSWA 3JPPA 5JNTA 4YVZA 4IGAA 3FDZA 4ZOEA 1C1HA 3OE7D 1Q2XA 3RRJA 1OAAA 2BN4A 1NLMA 1H23A 4Z9YA 1QX4A 2BFBB 3CUSA 1FVOA 1T8UA 1T6BY 3AEKB 4QM6A 4NZZA 4RADA 1U7XA 1YB1A 8ICFA 2QF7A 1DJQA 1HDRA 3F98A 3O75A 3NUZA 4KPGA 2EZ8A 5JV5A 4JUIA 5KDLA 5IF3A 5DB6A 2BH9A 4EBEA 5DK6A 3E82A 1LTHR 3CLUC 4KX3A 3MZ0A 3QQ5A 4BEVA 2EFCB 3UUFA 4TUQA 4N5MA 4D4LA 3Q6NA 4GX1A 4H7PA 4TKUA 1NYQA 4UARA 1PJ3A 2WYWA 4UOQA 4F3KA 3NV9A 2BKAA 3MWEB 5E38A 4UM7A 2OSVA 1NURA 4NCXA 3O7WA 3ZU4A 4DBVO 2PQMA 4E5VA 4R40A 3NTUA 1B8OA 1QV7A 5I4KA 2XYQA 1L5QA 1GA1A 1OUQA 4RJIA 3B85A 5FI0B 1VMKA 3JQEA 1EH5A 1NYLA 1XKLA 1RQXA 1X1AA 1PJ4A 2LP4Y 2PKWA 2IPXA 3D6AA 1RAHA 5K8TA 2XUHA 3F4BA 3MXOA 2JGLA 4DL2A 2BKLA 3O8LA 3NIFB 5H81A 4CR7A 1XU7A 2GN8A 2LRHA 3LK6A 4LDNA 1VL1A 2CCJA 1FK8A 1SBNE 4DPMA 3GW8A 1I6WA 2A6PA 3GA5A 4KJXA 2FWJA 4YAFA 5FX2A 2R4QA 4N0QA 1O58A 2PBZA 1Z08A 3F7NA 4DAOA 4HZGA 1FSFA 2IA5A 3K3PA 1GNPA 1TLTA 4B6GA 1T3ZA 1ICEA 1OQAA 4UCQA 3NVWA 3N5CA 1XSNA 1RTKA 1WZEA 3NFYA 3UJCA 1H8HA 3K92A 4DMMA 1TKAA 4A0QA 3SQIA 2B99A 5K6AC 2QR5A 1EVKA 4YAWA 1Y80A 5TT0A 3HVJA 4TV8A 4YCMA 4KZPA 2IZ6A 2UXCB 1CVLA 3TBHA 4J2TA 3GVPA 1W9MA 2PLWA 5BW4A 3LCMA 5KFXA 2WJWA 3IBTA 3F0TA 3TQOA 5K0BA 1U2ZA 1I3CA 2HHQA 5C3MA 2XUFA 2OFFA 1GDDA 1Z3IX 2P5YA 4UC0A 2B8WA 4ZRMA 1RP1A 4F2RA 5GIOE 4CKZA 3HGQA 1FDRA 4JJEA 3K75D 5JNWA 1ZM4A 2G09A 2F3PA 1ZK3A 3KB8A 1TGVA 1CI4A 3HA7A 2JRCA 4XSVA 3TUZC 2ZI3A 5DNAA 5BN3B 2I29A 4HNSA 1W30A 1SZJG 3RYFA 5BWOA 1L3VA 3DBIA 4BEJA 5A6SB 5KTYA 3ZE8A 4YT2A 5F9LA 1KORA 3RU7A 4R2KA 1Z45A 3C6BA 2QQ0A 3G9XA 4MVWA 1XNQB 3EVAA 1E1MA 4F86A 4ZHSA 3I9NA 3IQDB 1WG8A 3N8GA 1C30B 2NTJA 1J7JA 1FFXB 3BQMB 4JI5B 4ELTA 4XARA 1KKMA 2ZIEA 3RC1A 1BKSB 5H9WA 2Q5OA 2KHVA 4LC1A 2VJBA 4P8RA 4EFMA 3IXQA 1QIHA 5K8JB 2QYOA 1JE1A 3O4FA 3HILA 2ECPA 3N8IA 2QNRA 3VH4A 2QK4A 2CLSA 4QYXA 2B34A 4Y2QA 1N6NA 2EP5A 2IVFA 2WKPA 2O9JA 4QIWC 5T3YA 1XYYA 2GS9A 3GFTA 3GUHA 1ZETA 4GXNA 2VJPA 1TZKA 3IODA 4H35A 4CEHA 1D03A 3QKWA 1U7TA 3OZWA 4QZ8A 5EE0A 3AL3A 4BNIA 4YMOA 5A9TA 3PTAA 1LPOA 3SDBA 2FPOA 1T9GR 4NBRA 4W9MC 1RQGA 4Z0TA 1VTKA 4XPZA 1SKQA 3U9LA 1PS0A 2P75A 4QEZA 5BQOA 5KSYA 5JISA 2BZ1A 1PK7A 1UDRA 4ALMA 1MABB 2K4PA 1VPVA 1KPIA 2QD1A 3A4LA 2LCFA 9ICMA 1R5JA 4HSGA 4FX2A 3F3MA 3KFLA 1NJYA 4OKNA 1G8FA 4X0EA 4AJLA 2BW0A 4B3MB 2O1WA 2Z1MA 3MW8A 4O5OA 1SIWA 3VR4A 3S81A 3WHKA 2H7VA 2DTXA 3G5TA 1VI2A 1M76A 3R3JA 4PICA 5C1IA 1PW5A 1OKKD 1ZISA 3DW3X 4DPKA 2G07A 3F5AA 4UUNA 2VQ3A 4KUEA 3NTLA 5JNSA 3H0EA 3WNQA 4PY2A 1IHPA 3AWIA 1Z16A 1YOVA 1E2GA 3EZLA 1JN3A 5KAIU 3H05A 1OH5A 1AGXA 4DC0A 1A4UA 3UV7A 1WKVA 2G0TA 4AQ7A 4V0OA 1LBQA 5EIBC 3ZXIA 3PX3A 4DV3B 2V7QD 3HYSA 4B79A 4BVGA 2CFIA 5DLQC 1X7YA 3CWCA 2XICA 1T91A 2P9TA 3AJ8A 4BASA 1XU4A 3PFCA 3C3PA 1KMMA 3U4IA 4M1MA 1E2EA 3UKJA 1E4YA 3R6TA 2I91A 4BMYA 3B1XA 5G53C 2B1IA 3DW1X 1PNTA 3IOEA 2B94A 5DNEA 1DL5A 2PUWA 1VA4A 2D54A 3KZIU 4BN5A 4E5YA 1GQ2A 1NT2A 2ENUA 4ZT3A 5ADVA 4ARUA 3Q4GA 2XRFA 4IJMA 1QTRA 3I9JA 3VJMA 1QQ6A 5FV4A 3HN7A 1K6MA 4X85A 4LE2A 2UVPB 4JASB 2ZJ4A 4HV4A 2ZU6A 4YRMA 1XZFA 2RHTA 1Z88A 2PI5A 4X5OA 2FRXA 3KYCB 4FMDB 4N01A 2DUUA 1SUFA 4Q21A 2REQA 5GM2A 2BMEA 4XR4A 4B71A 1LSOA 1U3UA 1ND5A 4A2PA 1J7KA 4HBZA 1J22A 3DAPA 4QUGA 5LNK1 3QMPA 2EJBA 3HRDD 4EKNB 1SZHA 3HPOA 3WK4A 4RACA 2Q1XA 3UAGA 5CXUA 1QIGA 1OV6A 1SVLA 4UHJA 4BXOB 1VBMA 5DP2A 4K9OA 1HG0A 3T9BA 1IRIA 2QRPA 3T3NA 3GLKA 2WDZA 3BS7A 4BWGA 1XMSA 2ZB8A 3B5EA 3DTNA 3QVGB 5KFNA 3TDNA 3P8ZA 2BEWA 3ORHA 4KWCA 1RMQA 3JQQA 1QGUA 1PE0A 3GMDA 3BGVA 2X1HA 1NMSA 3LM8A 3DE2X 2FPXA 5L3QB 2C96A 5DSTA 2WWWA 5D1HA 2I62A 1FYEA 4P86A 3T7EA 2FOLA 1SEVA 3H4IA 4CF5A 3OFJA 1NM5C 1LB2B 1JDPA 2EZ9A 4DUYB 3U31A 3RTGA 5LLDA 3QTBA 4NS1A 4GRAA 4Q1VA 2F3TA 4U2GA 4YG2A 1E2UA 4X20A 1V38A 1HG1A 1ZUD1 2V6GA 2G4CA 1T2FA 3B20A 2QDXA 5BW8A 2XSZA 5G0TA 2BCEA 4MVJG 3OKFA 2VJOA 4Q43A 5JD4A 2YYYA 4C14A 4D6XA 3PVCA 2ESRA 1UDCA 3SQDA 4MMYB 1K8XB 5CG2A 3PQ5A 2RHMA 2I0FA 1KVQA 5TX7A 3FD8A 4M9GA 3LGAA 3RVOA 1A7UA 3JQRA 3AZOA 4PEVA 2RG7A 5KT2A 2Y67A 2D1QA 3R3ZA 2ZEJA 3AL0C 5AKZA 3ESQA 1SOWA 1ORTA 4WA8A 1K8YB 1V8BA 1N5KA 3QLVC 2HCTA 5J0PA 2RH8A 1R0CA 2ZJ1A 3WHIA 3HWSA 4MTCA 3I52A 4IIYA 4Q5IA 2CUTA 4AJ9A 3RNOA 1QAMA 3RIEA 4B9TA 1N9ZA 5CBPA 2AX4A 2JEIA 2DYKA 3EPIA 2GEVA 2P90A 2BTQA 2O3TA 2VSOA 4UW9A 3NKFA 4DF4A 3V8QA 3EEFA 1RPTA 2R25B 4WTOA 4HAIA 4OXXA 3OCUA 4AYWA 3PICA 1YL7A 2XZOA 1YONA 3HYCA 1OGJA 5COAA 1XFAA 2P3LA 5CB8A 1LLCA 4GPTA 5IIMA 3ZJUA 3D6MA 2Z8YM 5EIAA 3A70A 1KFBB 4ZZ0A 3EXHA 1I2AA 1QK3A 4CMAA 4E6PA 3V2UA 4DSNA 2OHHA 4IGFA 2R65A 1QZ3A 4A6EA 5FOVA 1B0ZA 4B2LA 2CJWA 3CF6R 4KQMA 4M76B 2NV6A 4FS3A 4PHHA 5JQWA 2V6JA 1Z8DA 2PL5A 4HX9A 3MSXA 3ZJ4A 4C88A 3TJZA 3A2NA 1YZUA 3AHFA 3H19A 3TVYA 1AV7A 3W77A 1BXGA 3D02A 2J4DA 1Q3HA 3JD2A 1BWQA 1DV2A 3NYRA 3AHEA 5J4VA 4RVNA 1M83A 1QHIA 5CD1A 2LM4A 3UFBA 2YNMD 2WW8A 3KV3O 3WOHA 1E3DA 5JQGF 1GY8A 2EWVA 5BMVF 1S7CA 1QXSA 1PG5A 3HFJA 1KTVA 1BQ4A 2FSIA 2IU6A 1KNQA 3MAJA 2NTNA 5J0YA 3PP8A 5KI6A 13PKA 2NYAA 2ZCVA 3PNPA 5AVJA 3EGVA 3GWZA 4NLGA 1Q3UA 4KPYA 3BG5A 3Q2KA 4Z49A 4IYRA 3H86A 4MUGA 3SHQA 2YOGA 3BDAA 2IYTA 3HXLA 4EHFA 4JR0A 3IVGA 3AEKA 5I48A 1M6YA 1M8GA 2IXBA 2JAPA 4RPIA 1I6LA 2LBPA 4QAQA 2VP9A 3PDHA 2JLWA 8ADHA 3CUWA 4ETNA 1TVEA 2QROA 3CURA 2NUAA 1RLTA 1NLFA 4TVKA 3RS9A 2PZFA 1DLJA 2AFVA 3AJ9A 1MRSA 3QEJA 4OHYA 3MWEA 3LY8A 3Q6MA 3JZFA 2PLNA 3NJ4A 1WEHA 4F5YA 2SKCA 3P2KA 3ZIAA 2I7TA 4J7AA 1CG6A 4ZYWA 1XQ9A 3A14A 4OBBA 1VGQA 4QHYA 4EECA 4E0DA 1QG4A 2O2GA 4HAYA 4QRHA 1MHTA 4P4UA 4AUKA 2O0KA 3RVNA 4B8ZA 1IY8A 2Q3DA 5TMEA 4BBAA 1RLOA 4LJ4A 2Y8EA 3HFSA 1YQ9A 4LBVA 2XC9A 1ZI6A 1N2IA 1FQKA 4MQEB 4AYBF 4GH5A 3ZZTA 1W4LA 1JNYA 2NPFA 1JEQB 1QKIA 4BOYA 2V9CA 3GIJA 4CMEA 4OI0A 6GPBA 1BGVA 1D8BA 3CJTA 4ED3A 3CGWA 3RBXA 4K40A 2DKOA 4ZO9A 4BQPA 1EXNA 4FONA 2FW0A 2C4KA 3SK0A 3R8CA 5JAPA 4QPJC 4JP1A 4O2LA 3TCKA 3NTOA 3WL7A 4J91A 5BV1A 4MV1A 1FTWA 5NULA 3WBFA 5IEJA 3RBDA 4NYJQ 4JSYA 5CFRA 1KAOA 2VP3A 1VHTA 3VISA 1POXA 5KVCA 3AHIA 7MHTA 2Q9UA 5AW2A 1SFRA 4NEGA 3IPRA 3PW2A 4FGWA 1KZ1A 3WL6A 4XWGA 3K0CA 5IJXA 3C5WP 1G20A 1GPBA 3OCWA 1QKKA 3K9BA 1SC3A 1P7PA 3D7LA 4YUVA 3IB3A 1YU9A 3C3EA 1ZM2A 4J29A 1NMYA 4LYHA 5KL1B 5KOIA 4KBFA 1YRAA 1CR6A 4ACAA 4C8OA 3T35A 2WWGA 1SVUA 7YASA 3ESYA 3FCXA 1AJEA 3OY7A 5BN3A 2WVHA 4BUJA 1Y4ZA 2C28A 3W8FA 3WV5A 3LCJA 4C3ZA 5CA0B 1BYUA 5A6SA 3K0FB 2C4MA 1NJ2A 5DISB 5ESWA 4FYWA 2BEJA 5AW8A 4QNMA 4UXHA 2HDNB 4LJKA 3FPAA 4M6WB 1TAHA 5GIPE 1Z39A 2EWWA 2YL2A 3Q85A 1W75A 2XTMA 1VP9A 3K0HA 1VHWA 4B82A 4HFNA 4E46A 3S8EA 4DR2B 3M34A 4WFIA 5F7ZA 2JBHA 4BV9A 5E7MA 2Y1JA 3D3NA 2YWFA 1OH7A 1C30A 3G2IA 1FFXA 3EW7A 2HLDD 2FOXA 1NW9B 1CQWA 4YO8A 1ZEJA 3NXKA 3TOSA 4LOJA 1NC3A 1GNQA 1UPHA 2PMFA 3JY6A 4S2UA 1SBHA 4R6XA 3AT1A 2IS1A 3L84A 3PFGA 5C7IO 9ICOA 1MAAA 3M2PA 5F3DA 1L4MA 4V39A 5KO2A 2P4QA 3BEOA 3H1BA 3WJ1A 3MNFA 4OK6A 4MEXA 1PK9A 1ZINA 2VATA 4XX0A 1K4YA 4GM1A 3FVQA 4AY4A 2W04A 3I6YA 2B61A 2OBFA 5TS2A 4UDNA 3WZ2A 1QWSA 4HD8A 1O97D 4H4DA 4G63A 1OFUX 1A9RA 1O9BA 2P3SA 1T5BA 4WESB 5H02A 2QDKA 2C2KA 4QGSA 5HK8A 3FE2A 3ZHUA 1GRNA 3W6OA 1NNSA 4DR1B 1ZNWA 1R7RA 3VZCA 3LQKA 5B12A 1WMSA 3FY4A 5U4XA 2H2DA 3NS7A 3D5TA 2HDWA 1NF2A 3OQJA 1MABA 1XRPA 4YV0A 4GP7A 3QOYA 3R74A 5G4LA 4CR8A 3QZ7A 2X58A 1GRRA 2X5NA 1L3CA 2VQFB 1OAOA 1LY1A 1B4FA 3GLGB 4B3SB 1GPWB 4WQMA 4O1HA 4L5JA 2JBAB 4L28A 2X1VA 1NV8A 4ECAA 4AYBC 3MD9A 5TT1A 3Q40A 1RHKA 3M0EA 3PW0A 2NZ8A 3D2BA 3HDHA 1P29A 3KJIA 3KJGA 5GAJA 2IYZA 4KN7A 3IAXA 1FA9A 1NW3A 2YFHA 4P4NA 1MLDA 5IHXA 3G6WA 1DC8A 3IQEA 4RT2A 3U7RA 4KQ2A 10MHA 3G7SA 3VPBA 4NU0A 4HY3A 3PXUA 2GD0A 1CJKC 5GTIU 2F3QA 2CVPA 1EE2A 3E6AA 3OCZA 2R5NA 1IN6A 4ILEA 4PQYA 4KLIA 3N3BC 3C1ZA 4X63A 4MDFA 5MN4A 4GEGA 1ZONA 4WCDA 1OASA 1N2JA 4IQ8A 1ZRHA 4DJFC 3VO8A 4O3OA 1J06A 2XA2A 5K2OA 1YMVA 1PQYA 2W11A 2HBZA 2PXCA 3DHYA 5ALPA 1E6CA 1XELA 1RJGA 4ER5A 4QZBA 4HDCA 3VBCA 4CV0A 1KI1A 1Y0BA 5FRDA 3ZWVA 4XVQA 3FA2A 1YA4A 3HDVA 2CZQA 5JNRA 5D86A 1C5KA 1WVIA 2UVPA 3SV3A 4Q7LA 2OXRA 3RIGA 1YD7A 1SXJC 5BYBA 1FDWA 3R5XA 4OOFA 1I94B 3U7JA 4EHNA 4RCZA 3WGYA 3IN5A 3N1UA 5TEWA 3N8NA 2GD6A 2A5FA 4PC1A 2NRTA 3IPCA 4FSXA 4LHXA 1DXOA 2HO5A 1ISHA 2VT2A 5E0OA 2GPAA 4RHYA 3OEWA 1MQ3A 3GD7A 4B40A 4BXOA 5JAIA 3BE5A 4EZEA 4DY6A 4TOIA 2I78A 1MTOA 3H6HA 2YJGA 4CF7A 2V1UA 1IC6A 1HSZA 3DOFA 5LYJB 2R84A 1G4HA 3QVGA 3MLAA 4KFTA 4LGCA 1DG9A 4O02B 2YN2A 1J07A 1A2OA 1YV9A 1OWMA 2H2GA 3FPHA 4UB8U 1AB6A 5JC1A 4N6NA 4AKHA 4Z1MD 1GGKA 2H2FA 1RW4A 3I76A 3EQZA 2PXIA 5DMXA 2R8YA 3UWDA 4DLYA 3RHFA 4D46A 3UCEA 5AM5A 1XCMA 1C9NA 5BRJA 1A04A 4OBEA 1NVFA 5E6RA 3N0WA 3BQ9A 4K2HA 1JDUA 2AZXA 3AB3A 3OZIA 1ITZA 4R1LA 5FO1A 4W9NA 2VZ8A 3E5MA 4QTTB 2JFGA 1WQ1R 3KJQA 2XUZA 1FFEA 2RB4A 3WMEA 4HEA6 4H77A 3GV7B 1R6AA 1B14A 4A1FA 3VXKA 2C3PA 3JQ6A 3EVTA 1P7CA 5KJFA 4MJXA 2JAUA 5LWHA 2I5PO 3GLHE 3SM9A 3DE4X 1ID8A 2F8SA 4PHTA 2WLSA 1ZQOA 4DKXA 3DTYA 4M0AA 1UJBA 3ANXA 1TT7A 1SBIA 2C5AA 4ND5A 2JEZA 1HDGO 5BVGB 2EJVA 4JLKA 5E1OA 1B3RA 1OTYA 3OAAD 3GELA 4UEKA 2PS3A 3UA4A 2X8JB 3OLZA 1ISFA 2A9QA 5ALXA 2AYYA 7ICLA 2H0RA 4J16C 2HBYA 3OESA 5G5GA 2K2WA 4HDSB 4D3ZA 3PE3A 3MSCA 2XYHA 3CRMA 4HRXA 4AQYB 1XCOA 4UB2A 4RKFA 2UZ1B 3ZC3A 4CL8A 4WBNF 1BNOA 1NVKA 1YB7A 2PO7A 4ZAXA 3ISCA 5D3QA 2VQ6A 2R87A 4H3VA 5KFJA 5FJIA 2NSJA 1E60A 4CCHA 5LQNA 3UUWA 1QMGA 3TQQA 1G6HA 3ZHRA 2NPIA 4DMFA 4IFIA 4N3AA 2F8TA 5BUCA 2FNAA 3G88A 4E70A 4FHDA 2O5CA 1N60A 5E4YA 3NM6B 4LF5B 2VHTA 5JNLA 1NULA 4WCFA 2YFQA 3TH5A 4UNSA 3V1TC 3I0MA 4NL9C 3SHOA 2OFXA 3OPXA 3N59A 4DL9A 3HNOA 4GMKA 4L6AA 2HF7A 1X2EA 2ZAGA 4QKQA 2TYSB 1DT3A 5CT9A 1YIAA 5A0TA 1NWCA 3FCYA 1S2MA 5J63A 2P3QA 3LSTA 1IZYA 3W04A 4TRNA 2JKZA 5CFZA 3ZQ4A 4XTCS 2X5JO 5CB6A 4GMFA 3HVKA 1CF2O 2BM8A 3KLPX 5A7FA 3WAJA 2ONCA 3QTLA 4JQOA 4U4AA 3FCEA 4Y2SA 1DAPA 1YC2A 1E2FA 1VFPA 1L7OA 3LPDA 4PPFA 4TPKA 2KSOB 2A0UA 5EP1A 3O4JA 3ENZA 1E9RA 3GQVA 4KAJA 4ED8A 4OIFA 3GR6A 2HK9A 3OZ7A 2QVGA 3PNSA 3FMOB 2DKFA 4M1YA 4U7JA 1A6SA 3BMXA 4AVYA 3JYOA 3PZPA 5IVDA 4JDUA 4RWEA 1WPXA 4QEKA 3GNQA 4LV5B 2GZMA 3HO6A 2J6TA 1C41A 2ZUVA 1DO8A 2LGJA 4KTVE 1THTA 4JVOA 1JHVA 1RZVA 2DY0A 4L15A 2XE8A 3N2GA 3A28A 4DA6A 3RJFA 1L5KA 1CETA 3SQXA 2BHRA 9GPBA 1A5TA 3GFOA 4DIOA 3AVQA 3NHBA 5HIKA 2P2YA 4MQEA 3P9SA 4LXYA 3CW2A 3WP0A 1JTFA 3V2HA 1M1YA 4WERA 5EZ6B 3R7DA 3G0DA 1AB5A 3X1XA 4OQ4A 4AJ4A 1A97A 1PYOA 2Q2VA 1Z5GA 1R1DA 4BTVA 4YHBA 5EMLA 4LYDA 4KLDA 2R6ZA 3JSXA 3RAJA 3U80A 4G4IA 2HU2A 5F52A 4JUCA 2BKVA 3NHMA 3SSNA 1D8AA 3VHXB 3TIFA 3EDMA 4HZIA 5ER9A 4J9OA 4F4IA 3HKCB 4KLOA 3UAWA 4EQZA 4NP6A 2DBVO 3NANA 1X7WB 5F1YA 2CXXA 9MHTA 4BQRA 7MDHA 2AEMA 3QMWA 1JLLB 3EE6A 4X3CA 3H4DA 3RWMB 2ZTCA 1YZVA 4P3XA 4TLAA 3H99A 4PBSA 4F4KA 4REQB 2ZPUA 4D8WA 3V8BA 1FQOA 3JD0A 4LMBA 4P5PA 4RUCA 4ITVA 1KGDA 3NMUF 2D6FA 3KP1A 4B4DA 4LVOA 2IYUA 4AO7A 1AK9A 1LLQA 5FBKA 1B8PA 1XTUA 3UMGA 4XQCA 1CIVA 1K8QA 4DSTA 2IYNA 4JEIA 3R41A 1U49A 4KLEA 2C4TA 4AJKA 2FZLA 3IAUA 2XWSA 3JPNA 1YR2A 4OXKA 2PX6A 4RD1A 1LS6A 1YDEA 2ECKA 3TRJA 1RM4A 1LFDB 4YIHA 1LJLA 2HFKA 2CHQA 1WXEA 5HHTA 3WFIA 3K0FA 1IHXA 4IR9A 2R1TB 3OZGA 4YQFA 4MK4A 3LUDA 4JXKA 4ZCLA 5JZOA 3TARA 4M6WA 1QCZA 1HEYA 3SF8B 5HRUA 2XY5A 2P5TB 5JUWA 4S0ZA 4I1YA 4CMJA 2Q8QA 5KVQA 1RI2A 1UT5A 1AXEA 2QPLA 3WRYA 2VFAA 5EIFA 3LCRA 1DG1G 1URJA 1D8LA 4L5YA 4BFTA 1ULHA 4AS1A 2C54A 1LWNA 3WMWA 2VP0A 3KQNA 5EVJA 1ESMA 1GA4A 3T3PB 4CHTA 5I7AA 3PC7A 3FFXA 1PX2A 2Z4TA 4C3OB 3GPDG 3FI0A 4TGLA 2DXIA 2J6HA 4XLLA 2IELA 3URKA 4OBXA 3U49A 1UDXA 4USAA 4P1ZA 4EQ6B 4F85A 4EAQA 2K5UA 4RO0A 3KB6A 4C2AA 4M9XA 2JAQA 1YZ7A 4WD3A 1BHJA 1Z82A 1E0SA 2IWRA 3JQBC 3CEMA 3OTGA 4IO1A 5AKLA 1RJ9B 4EPRA 2X9NA 4HQKA 4WESA 4BMNA 4JNKA 2HY7A 5A0LA 2GPNA 5CW2A 3NAQA 1J2MA 2HSZA 3USZA 1NK5A 1GILA 2B92A 3CXUA 3V55A 2ON6A 5KAFU 4GF5A 1F4VA 1MAUA 3GH3A 5CCDA 1O57A 2GEFA 4J0CA 4KSBA 3SC2B 1OLUB 2EZZA 5ARBA 2FUCA 2GAJA 5A5DA 4OHOA 3GLGA 4EA6A 4HVTA 2PAFA 1E89A 5A4AA 2JBAA 2E4ZA 2Y1LA 4L8YA 2FF7A 2J5BA 2ZSKA 4EIWA 4M36A 1VJ5A 1Y1KE 2C8VA 4UCWA 1K7YA 2OXFA 1CUIA 4PAQA 3Q0TA 1SXPA 5CT4A 1A9QA 2LIPA 3QITA 2PNJA 4G1BA 2GLXA 2QRLA 3WQQA 2GBLA 3EWIA 2RK4A 4UXJA 2X4GA 2E3JA 2IP1A 4JP3A 1PR5A 4FOLA 3EFOB 1WOMA 3N7TA 4CMKA 3SAGA 3B3QA 2J4CA 3K6SB 1J2TA 1D1QA 2CMGA 2W2NA 3EUB2 1H2FA 3MHPA 3PFBA 1L4LA 4XQEA 3SC3A 4ELVA 1EG7A 3PW4A 3ZDXB 1THMA 3R77A 5EXSA 4IIUA 1N3IA 3ADDA 4EZ6A 3CN7A 1JKJA 2X3YA 2HQSA 2VRWA 1G7RA 1ZG3A 2FUKA 5FPHA 2BPOA 2QU8A 4QLBA 1Q74A 4KKXB 1X1TA 3V4VB 5JMPA 4MUBA 4Q4LA 5M04A 2BCJQ 1J5PA 4IHJF 4N40A 4F8RA 3EYZA 1PJ8A 2QTBA 4A10A 3T5TA 8AT1A 1HWYA 1WAMA 4Z6CA 3WJ2A 3PQ4A 4EUFA 1QP4A 5FUXA 1YQTA 3QY0A 4DZRA 1C4OA 1JIUA 1E62A 1G17A 5C1PA 5KQRA 3PVZA 1R3DA 1AC5A 4EDHA 4FYIA 4FYPA 5LD2B 3FZYA 2B30A 5JADA 5ICCA 4B2YA 1QSSA 3L7AA 2GVNA 2VPIA 4R9SA 4JDPA 4HMOA 1T2VA 1KWGA 1ZIYA 4X93A 3PRJA 3PITA 1XTKA 4CIYA 1J24A 3OOWA 2FZEA 1FFWA 5LYJA 5J2UB 2AC7A 4KQEA 4UEOA 3B6JA 4XVRA 5IJ9B 4JLVA 3FVTA 2H2IA 5JH7F 2YJ6A 4P6VF 3D8BA 4YAIA 1JR3D 4C4RA 1B2RA 4YJ3F 5BSGA 2WSIA 4M9SA 3TYXA 4XUCA 3K5HA 3DDSA 4RD0A 5BMOA 3OF3A 1E98A 4YJFA 5IDVA 1SCNE 3A6EA 5ICFA 4KXQA 1QLHA 4U7GA 3IESA 3VNRA 2XXAB 3LVRE 4RD4A 1Q0TA 3E8XA 3LBAA 2K7FA 5EJIA 2J0VA 1BVYF 4LZGA 2C9ZA 1FMJA 1SXGA 1OFUA 2FVXA 1U1FA 4CDMA 4A8EA 3QJ5A 1PBNA 5ICGA 4MVJF 1X42A 2OCAA 4RZHA 1GL3A 2Z2IA 4BBZA 3OQ6A 2FZ5A 2BL4A 4XJTA 4LKOA 3EQ8A 3R3HA 3WYFA 2Y71A 1OA1A 4ND7A 3F7TA 3FKSA 4AY5A 4DOCA 3QELB 2W37A 4ZH4A 4RPLA 1TLLA 1D09A 1CIJA 1P4RA 2HREA 3KETA 3NVYA 1NF3A 1YGPA 1Z07A 1II9A 1DWOA 2ZYRA 4GP9A 3M6AA 2WZDA 4F8JA 5C46F 2WAQC 1T25A 4L4YA 1R50A 1OYYA 3C7CB 2OE2A 1OV4A 4RTQA 5BR4A 5BVGA 5LP6A 1G55A 3ZYCA 1UANA 3QPBA 4H1UA 5FBVB 1KRWA 2JNWA 3GP5A 3RFUA 1SBTA 1O6BA 1W0KD 1LDYA 1DTWB 3F67A 2EEZA 3AM5A 5EJ9A 2ZDHA 3WGMA 5KJ1A 4JVLA 5ALRA 1FB5A 1EP3B 1AU9A 4RTPA 3I8OA 3SKYA 1G3UA 2PSFA 4HGZA 4I6GA 2BGKA 5KQMA 4I2NA 4HDSA 2NUBA 3X1MA 4NV0A 2G0AA 3AVUA 4BMXA 2H4YA 3SX0A 3F3KA 3O7MA 4TT8A 2GPYA 4QIWF 4ZOLA 3NHZA 5EP3A 4BDTA 2IY8A 3IBFA 4XWTA 3I6ZA 4Y6PA 4KGVA 2GUWA 2NMVA 3VPGA 4RJKA 4PS1A 2DQ4A 2XUDA 1NNEA 2Q1SA 3IPLA 2R6GA 2PSEA 4MWEA 1QCCA 4JBWA 1CZKA 3SBEA 5FEUA 3HL4A 1RBZA 3HJGA 5JE8A 4QBTA 1G5PA 1RCUA 2FN7A 4K4HA 2QTMA 3O4RA 1Y9AA 1JAHA 4URWR 1DINA 1Q44A 4DCNA 4H1VA 4ZYZA 1Y7IA 3IV9A 3AFOA 4N5DA 5AD1A 1MOSA 3WMFA 2R86A 4ENRA 4RLQA 4YXMA 4QOEA 2KM1A 2C3OA 5G3YA 3PEUA 3CIOA 4PLZA 4PIVA 3IC5A 1N5OX 1ONSA 1TM1E 4B48A 1RDFA 2A1JB 3QU5A 1OD6A 3C6ZA 4WGGA 3BEDA 1E2LA 2IU4A 3GQCA 2BR5A 2SICE 3SQWA 5KTNA 2ZFUA 1SZDA 3R7NA 1LLFA 4AMYA 9ICLA 2DWOA 2DCUA 5DHPA 1X3SA 1GCGA 4AJEA 4G1CA 2IYXA 3QX3A 4Z4EA 4BYMA 4Z7NB 3B2QA 1Z22A 2OGZA 2XB4A 1CU1A 1WY5A 2FWAA 4P3KA 4CIAA 1KPHA 1ZUNB 4ZALA 2OG2A 3OZAA 2WC1A 2KSOA 3DP7A 2GAIA 2IYFA 4GKVA 4XD7A 4R98A 2FDCA 3RTCA 4DUPA 1FZTA 4PHGA 1HLPA 2Q46A 2WHPB 1APBA 2O4CA 2P79A 3PUVA 4D99A 1XWLA 1I5OA 4OXRA 3NCHA 3AR7A 1J99A 1HKUA 1K98A 4G09A 3WWEA 2QT1A 3LHKA 4OQMA 3ZXYA 3W6PA 2J3JA 4KLCA 4Z3OA 1QGAA 5SYNA 4R66A 1Z38A 2P69A 3BE8A 4RHFA 1X74A 1TEZA 4TYNA 5IRCD 1A76A 4C7BA 1BWPA 2JGNA 2W98A 4IEIA 1LTQA 3H9JA 1DV1A 1IM2A 2XITA 4PG6A 2Z83A 2CRXA 2XD9A 5AK0A 5DWVA 1C50A 3WVNA 4PLTA 3TLEA 5KS2A 3ZVKA 3W7VA 5JZMA 5A4MS 2H5XA 3L49A 5LOVA 2WHRA 3CWQA 4I14A 3HBMA 3ONEA 4F92B 5HDBB 1YZ3A 4KWTA 3WGGA 5DRYA 1X9IA 3K4QA 1YJXA 3LBHA 3WLRA 3NORA 3RRNA 1O9GA 4ZCIA 3RW9A 1T2AA 2YMLA 1PTKA 3VHXA 3BL5A 3BK1A 5CVUA 1E6KA 1K6XA 2EQ5A 2C5GA 3HKCA 4H7DA 1UFKA 2FMHA 3MOGA 3ILYA 3LRXA 1X7WA 2A88A 1NAIA 2DC1A 3EYWA 3PGVA 3LHDA 2H2HA 3E22B 3W9UA 3FLBA 2HA0A 4JBXA 1XDGA 4L4XA 1JLLA 4KVZA 4XR9A 1TLFA 2MSWA 3EPRA 4F5ZA 3L4BC 4X62B 3D6HA 1RRMA 1NZJA 4REQA 2Z2XA 3L8HA 2UYGA 4MB6A 1LPPA 2B98A 4MAMA 1ZGGA 3BE6A 4DWJA 4UJ3A 4O59O 1TO1E 4G0VA 2GJ9A 4HAVA 1UJ2A 2FPGB 4FLFA 4NI5A 4R0NA 1BMQA 1DBWA 4YR2A 2JFVA 3BQNB 2XUGA 4G1FA 5KVSA 1EFAA 5BWNA 5ALMA 1Q6YA 4V02A 2BJVA 2PMEA 4HB2A 2E3TA 4QBHA 1A5BB 4U7HA 3V7JA 2EBUA 1V5EA 2R1TA 5BWLA 2EATA 1Y8QB 3I01A 3WB2A 2XGGA 4TSFA 2LHTA 2ANBA 3L7KA 3SF8A 4M0EA 4BLQA 3U17A 5EJ7A 5DBAA 4PFJA 1LPMA 5KFRA 1NKSA 2Z6UA 5BPCA 4DJ5X 4PM4A 3UHPA 1V9CA 1F8GA 4OCZA 5DBFA 4W5NA 1VE9A 4L74A 2UVUA 5KTTA 1ZY2A 4B4OA 4KUHA 2NW6A 1ENOA 2E1EA 4N82A 4BNXA 4W5OA 3LDGA 5DHTA 4EYEA 1UEXC 4RL4A 1GCUA 1UC9A 3RR8A 2NT4A 5ERGB 3QKIA 4U0JA 1E1LA 5B1HA 3PC6A 1LLUA 4TTVA 3V80A 1IB6A 2B7LA 4MS4B 5BT9A 1YBHA 1CSEE 1OB5A 1B76A 3ZUGA 4BFYA 3KJHA 4EQ6A 1VSQA 1WVMA 2RGWA 4R8VA 1S01A 1MC1A 1DIHA 1TYZA 2AWOA 4RSGA 3RVQA 3OQMA 1DEKA 2JCSA 2VQDA 3TQRA 2WLTA 3STXA 1TZBA 5HUQA 4R16A 2QW1A 4P5EA 1A5SB 1RJ9A 2WTAA 2X2FA 1I3NA 4WZBB 1F4PA 3N7SC 1G6KA 2HYIC 5B6JA 1FMCA 4OP3A 2IW1A 4JK1A 2WTEA 3EMDA 1BE8A 3WGNA 1G8JA 2FN9A 3NOOA 2EKDA 3GFRA 2R5WA 3FPEA 4DE5A 1L3UA 5EXDA 5F12A 1AKMA 2H2WA 3SC2A 3ETLA 4US9A 3M7DA 5KYXB 1PTJA 4CIBA 5L40A 2JZNA 4YALA 2J33A 4AMVA 3MJEA 1YK0A 2WMDA 4B34A 1HLDA 2F43B 1O3YA 4F4CA 5L6MB 4LPKA 1SV0C 3UTCA 1KJNA 4YRSA 2ODGA 1HO3A 3VYVA 4ZC8A 1DC6A 3EAQA 4MVJI 2ONZA 1TVKB 4M9NA 1U0RA 3EIHA 3HN2A 1TRHA 1ZL2A 1AS3A 1ZJ4A 1ZD4A 3U4QB 3A32A 4W82A 5J2DA 1SOUA 3BQ2A 1PJCA 4JOSA 3RVLA 2I1LA 4KOAA 2KJ5A 2XE7A 4R8RA 5ADWA 3RADC 5BQPA 3NDJA 1VA5A 4G2TA 1Q1EA 2BRUA 1GZ6A 4L0QA 1Z35A 4G8JA 1F9EA 1XDUA 3CRXA 3SAJA 4EHDA 3EFOA 4LSZA 5EJ5A 4HAXA 3C98A 1WTCA 1V0JA 4YRFA 3PC8A 1C81A 1DARA 1XDSA 3C1YA 3SU8A 1JJVA 4RMHA 4J07A 3WLEA 2GPWA 4BFXA 3PRHA 3T3GA 2H1FA 1DT5A 5BSHA 1KKXA 3PQ2A 3OX3A 2IY9A 4HYTA 5TQ0B 3ZBTA 4A3SA 4DDVA 5IDQA 3W05A 3DZKA 1PZFA 5L9XA 3GDHA 2Y76A 1PEYA 5MF6A 4JKOA 2ZRBA 5DGAA 3BDVA 2YH2A 2AHOB 4W8GA 1JFTA 2O7NA 4Q16A 4WPGA 3ZK7A 1A4IA 2OG1A 2H92A 2ZP1A 2ZR9A 3OPNA 3TCNA 3N74A 3U4CA 3KQSA 2C2RA 4FZVA 5J4YA 2Q3LA 5DPMA 5KHOC 1DAOA 4PHPA 3RABA 3T0FA 5I4IA 4JI0B 4ENQA 3GGSA 1WCV1 3C3CA 2XGQA 2ZXUA 1GFSA 1BW9B 2CYAA 3WL5A 2NG1A 1OVMA 1XDBA 5HKOA 3RJMA 5KFHA 3GDOA 3RSZA 3OE1A 1XEWY 5TNXA 1H6DA 1L7VC 1NW8A 2F4NA 4RTMA 4DGSA 1E0DA 2PJUA 1K75A 2J0EA 1TU4A 2Z56A 1A2KC 3PQ3A 2RHBA 5CP2A 5IJ9A 3ZHTA 3D7NA 4N7MA 2BISA 3H1AA 1N63A 4DQ0A 2I3DA 4X6XA 3A27A 2HIAA 1PQWA 2FMQA 1K1SA 2YYAA 1M7HA 2ZITA 1MAHA 2J0SA 5I9NA 5FOUA 3ZV3A 4RESA 3ZU2A 1OU4A 1SPBS 5DGHA 2HM7A 4N7RA 1U9JA 3LMKA 3NVDA 1W1WA 4D4JA 1DK2A 5F9NA 2XXAA 3SEFA 3WLIA 3OHPA 3JZIA 4PV7A 2ZUTA 3AJAA 5J2BA 2TMYA 4TMYA 3RTEA 5TZVA 4ZICA 1AZWA 1R15A 4KI0A 4PS0A 3AIKA 5FOXA 1KDPA 1BS1A 1KEPA 5JAHA 1ISJA 1YR6A 2JLZA 1A8PA 1YTLA 2ZJ7A 1FFAA 2VDJA 4O08A 5B58T 4EKEA 4R3NA 3THRA 2H1RA 4BV3A 3S8YA 4ZYYA 5HMLA 3EA5A 3GBPA 4NR0A 3L0ZA 2YWGA 1H2ZA 4H3HB 4MRVA 3GZNB 5CXSA 2CC2A 5DXAA 3QFRA 1DIRA 3L93A 2GO7A 3CR7A 4I7EA 2IQIA 1JYFA 5LU8A 1IHDA 1XROA 1RYRA 5FL3A 3PYXA 4DL5A 4RSHA 2PYZA 4EVIA 2CMDA 4AP6A 4X00A 1EFRA 3A9CA 2WU8A 1KO5A 1DTWA 3H2HA 1FF9A 1E18A 3JD1A 4I2BA 4EPTA 3HWTA 1GTZA 4XRRA 4AKIA 1CDZA 5B55A 1P7YA 3PSTA 5KX5B 4OTZA 3BH6A 1ZVMA 2BFBA 3QJGA 4GC7A 1F6BA 2R11A 2VYVD 3TLBA 3SS9X 5BV8A 4EG6A 1HTTA 3H5AA 2H29A 4K6KA 5H2FU 1J8MF 2G1KA 4UATA 5JAZA 1EP2B 3NXSA 4HAOA 2KWIA 4PGXA 2W6NA 2Z6VA 2R79A 5EHZA 2C7PA 4FZJA 1XN4A 2QX9A 4GLOA 2W0MA 3O8OB 3W78A 2GDZA 5FA5A 3SKVA 4NSNA 3N6XA 4EHJA 3KCNA 1JFVA 4ES6A 2HBQA 2WHYA 1LRJA 2I9KA 2J6SA 4CRWB 1Z0SA 3O83A 4JWTA 2AA3A 2ZTLA 2Z2KA 4XE5A 3G2MA 3HA3A 4X65B 1KO1A 5IXSA 4ECUA 3LA8A 2VTBB 1Z00B 1KJJA 2XMBA 3D2SA 3UXPA 1LBEA 2WT9A 3MJHA 2E89A 2FFQA 1XXLA 1KKUA 5KNCH 2OLKA 4HYEA 5FL7D 1QTQA 4WXMA 4QTYA 5GVRA 1YMQA 3LL4A 2A1JA 1CJVC 3R4CA 1HC7A 1IAVA 1PF7E 1ZITA 3L0CA 1FSGA 1PJRA 1NFFA 4HNRA 4RGQA 2EAOA 5JRTA 3HYRA 3LQQA 3F6EX 1ENYA 1AXRA 2KBFA 3DVLA 1ECJA 5J47A 2BIFA 5ED0A 4EYSA 3NVAA 3LOQA 3MYYA 5CPBA 3LUHA 1FP2A 2FLLA 3HBLA 4V0QA 1ZUNA 3HCCA 4P2HA 2QUZA 4CIWA 1Z34A 2AZ4A 2DWQA 1Q17A 2R4UA 3N76A 1R0ZA 1ZL0A 4Q03A 3C5GA 3MFQA 3KUXA 2OBYA 2VNJA 2IOHA 2DPMA 2WHPA 4UUOA 4ND8B 2QJOA 5AUOB 4JIMA 5FYDA 4KMOB 3C6KA 1PT5A 3HXPA 4NL4H 3EZ7A 2BLNA 5FWDA 3EGOA 1DC3A 4TX1A 3OUTA 2DX7A 4QGBA 2R85A 4PO9A 4GMDA 1GNTA 2EXXA 1V25A 1WXXA 1U4NA 1CUYA 4JQCA 2AFHE 2KZZA 2YHSA 1T0PA 3WHPA 4QL3A 2WSBA 2WTNA 5E79U 3F5MA 3QVOA 3EY9A 5D8DA 5EZYB 5WRFA 5DN6D 4AKGA 3ENQA 4FNAA 2OXEA 4LZWA 2QUBA 1WNTA 4L51A 3DLTA 5FV7A 3KSDO 3CB4A 2X0DA 1N48A 3T38A 4XUDA 2XVMA 2B7BA 2VWQA 5IWAB 4LBZA 2OD9A 5KTSA 3ZR4B 1ZM3A 3WO0A 3K2BA 3MGGA 4TL9A 4YB8A 1AOXA 1MJGM 3U0BA 3HPRA 1VL6A 4QJ3A 2L2QA 5AI6A 4L9SA 1AKUA 5GZ3A 4BMOB 2PPLA 1FBTA 4J3NA 4XCVA 5DDYA 1YBFA 3NHLA 3P0JA 5AVVA 2A57A 3RYIB 1AD2A 5DYWA 1UMCB 4RPYA 4YUYA 5JEEA 2B8JA 2C31A 4ZJUA 4RGBA 1JJIA 3BILA 2PX0A 4C2BA 3C2LA 2H4ZA 4KE9A 1Z83A 3E22A 3DOEA 4ALKA 3BKXA 3Q9LA 1L7PA 2E1RA 1ODTC 4W8HA 2PLRA 2F55A 1L7AA 5CFOA 4OSOA 1R4AA 1K2VN 4GUDA 5CB4F 4M8SA 3L01A 2WF7A 5KPJA 5JDCA 1ORDA 1G59A 4B6EA 5K4HA 4QUAA 2WWTA 4JV0A 1ZD8A 1QVZA 4B43A 4DLVA 5B66U 4E1AA 1IY9A 4J1TA 1FXWA 1QH0A 2FPGA 1MUUA 1L2TA 3NKVA 4IMPA 4HZUB 4J9PA 1I9CA 4XW2A 1ZQCA 2QTGA 3PJEA 4AC9A 1HZZC 3OCVA 2BJWA 4R8UB 3DKIA 2BR4A 2C2MA 4PPYA 4Z86A 2V45A 4JGBA 2HA3A 1F3LA 1JSZA 5J0RA 1T3LA 1OXXK 4FDVA 4ENTA 4CF3A 2GK3A 4MIEA 1YR1A 1KH2A 5BP7A 3P5BA 1SG0A 2Z9BA 3KD2A 2VA2A 2PGDA 3O1HB 3U9SA 4BLPA 5DHQA 3K73O 2WD8A 1NBMD 4DADA 2YJTD 7ICUA 4PPGA 1VQ1A 1RXIA 2BF7A 5J2JA 4U00A 1ISIA 4M1KA 5EWLB 1WM1A 4RUAA 4YT4A 3BQTA 1KHTA 2C8JA 8ICBA 4D80A 5DM2A 3DPSA 3FAHA 2R6HA 5AFSA 3WLQA 2F1HA 3QYPA 4C8LA 4KK4A 3OZEA 1MT0A 4DVJA 1ZVVA 2OWDA 2X9LA 4F5RA 4NBNA 2OCYC 3AEXA 1CB0A 2FTKE 1UOEA 2C9CA 1MOQA 2N47A 4NU6A 5F5XA 4Y2GA 3CZ9A 4MS4A 2QEQA 1FLNA 2QP9X 3TNYA 1FFDA 3RBAA 1T6NA 3UB2A 4RFLA 5TMPA 2GYVA 5CM8B 3EGWA 1WMAA 1H4SA 5HE9A 1SL0A 4NRDA 4V1CI 3LDUA 1Z6YA 2SCUB 4WZBA 5IILA 1JJBA 3RJHA 4ZHQF 3LV8A 1VG9B 2WQ7A 1KDOA 1E9AA 1Q0QA 1FRNA 4YD2A 1C7JA 1XKXA 4ZMSA 1U2DC 4QBIA 4ECXA 2ZZNA 3NEJA 3GVIA 2HK7A 3TKAA 1CRPA 3IP7A 1BXRB 5KNCD 3M9LA 4QZVA 5DO9A 4E31A 5CVVA 5KYXA 1MGPA 3ELUA 1IXZA 2PIDA 1Y1SA 4R5HA 2WJAA 1YK1A 2ZJZA 2QVBA 2F43A 3KYCA 4O4IB 2AUMA 2NU6B 5AXAA 3RR2A 5P21A 4INZA 5LQDA 2ZUFA 2YVLA 2FR1A 2DHCA 3OFSA 1J2RA 4FFPA 2CEKA 1TVKA 2RSLA 1UF9A 4JIGA 2VIXA 5KTQA 2PD6A 1P2DA 1UJCA 3U4QA 4Z6EA 3W2IA 2SBTA 2Q5LA 1IOWA 4ZO7A 3ZLVA 3A2KA 1GYPA 3I9V6 2ZDQA 4IWYA 4DW8A 4OJYA 1WXFA 2WZBA 1Y48E 4YP1A 3PSHA 2CN1A 3OF5A 2AC2A 1RC0A 5FPYA 2GHIA 2FI1A 2W9MA 4PAOA 4J9MA 3RS7A 1C8BA 5AOBA 3LI2A 5L3QA 2YYSA 1LF0A 4A8JB 1NOJA 1KHHA 1V4BA 3H2YA 4DUGA 4LECA 2PL1A 1UJ5A 5ITZB 3ND8A 3E7WA 2X76A 2MMCA 2VYQA 2QL9A 2A78A 3M1IA 5G1NA 4CG0A 1N4DA 4CN8A 1ZD1A 3NHAA 2BEVB 5TQ0A 3UY4A 2XCAA 2OGSA 2AN3A 5AMXA 4NM1A 3D7KA 3PBKA 1ZQEA 4ZVTA 2AHOA 4FN4A 2VUSA 1U9LA 3CUEF 2H9IA 1VLHA 3DWFA 1S3GA 3RUDA 3TRFA 1MB4A 2OBNA 3BE4A 2CUKA 3TD9A 4C0QC 5HFAA 3W4JA 4UREA 4PGQA 2JIQA 4YQWA 3VZDA 4HGYA 4AXBA 2IL1A 4ZEVA 1YE5A 1MZVA 1N6LA 4O3SA 1BW9A 4IIBA 2F3UA 1EVJA 4O4JF 1X9WA 4MEBA 4RC9A 3K6RA 3RG2A 3G23A 1ORIA 2I71A 1TA4A 4YT8A 2ATCA 4V3BA 4EY5A 1WW3A 4ERXA 3O9MA 1GZUA 1LI5A 9ICFA 2O0JA 2VSNA 721PA 3BHMA 3K8OE 2VSYA 5DLGA 5HOQA 4QM7A 1CY6A 4R2MA 4KDFA 5FLEX 2H5LA 4U2EA 4WFQA 1VSBA 1AS0A 2R1ZA 2KOBA 4BQIA 1Z19A 4HXFB 2QQ5A 2Y92A 3AKCA 2NRZA 4A6XA 1LDBA 4IDNA 2FETA 5CGQB 1NMZA 1W5FA 4X90A 3N2IA 3L06A 1W5EA 4OJLA 2XDAA 1G3IA 4DSAA 3U1TA 4NPAA 3GAFA 1FRVA 3A3NA 5GJWC 3R75A 2O3RA 1E9EA 3ESXA 4BGIA 2H9YA 4UJ5A 3L4JA 4FCVA 4RQ2A 4QQ8A 1X0XA 4O4HF 4YRBA 4BX0A 1RAFA 2JFWA 1JXMA 3KALA 4HX2A 3GZNA 1ZQDA 2HX1A 8ICSA 1B74A 2OBBA 1NVEA 1YRHA 4NG4A 3LCVB 5HHIA 3TB4A 3K0AB 2BKXA 1SXHA 4PXYA 1D9ZA 4DV0B 2IITA 2O1XA 3OPYI 3HDTA 3PCTA 1O0BA 2Y0CA 2WILA 4ENPA 2PEZA 3A1DA 5KYVA 3GV8B 5BRNA 2HU8A 4NBWA 4ESOA 3WB0A 1XL0A 1N2EA 5A9SB 3CO5A 1JEEA 5L9AA 4JV5B 3U7IA 4GOOD 4MW9A 1KZGB 1L4UA 3LO8A 2Y6VA 1VJGA 2N42A 3CH5A 4ADSG 3C3JA 3L6CA 5KX5A 1FYVA 1HQYE 4M4SA 4RTLA 1HE3A 1PL6A 1YZKA 3TTYA 3V00A 3D0QA 3PD7A 4CKBB 1GLVA 1M9NA 4R65A 2D5IA 4IJ6A 1KNXA 3H2JA 1AN0A 3UZUA 2YV1A 4I9HA 5SV2A 3EZ6A 4YR7A 4KR9A 1XX6A 5L1LA 1HYEA 2C59A 3AP3A 3JTEA 2GRAA 2BBTA 4D9MA 1WB4A 2DPGA 5HUJA 2LZ0A 1XMJA 1NUSA 3O8OA 2W7TA 3VYWA 2HR1A 3FTEA 5K4LA 1XLTA 2R6AA 3OG9A 4QUBA 2JFNA 4FP9A 3EF3A 3PEEA 3C41J 4AL4A 4XUGB 4XDGA 2N1BA 5TVGA 4GI3A 2WT8A 4HHEA 4XWKA 4UE2A 4WN9B 3WZLA 1WUYA 1ZNZA 4PLGA 4X54A 5AK4A 3EA4A 3DQQA 4ZVVA 1ATZA 4RPCA 4PG5A 4J49A 3C28A 1ES9A 2VTBA 1Z00A 1FNSA 2YV3A 4IWXA 4KL8S 4C2TA 5KWSA 2JK1A 3FOAA 2FMXA 3KVYA 1RBYA 5KT5A 3MMSA 1JEQA 3TW4A 2JH9A 4XI9A 3KQTA 3IQZA 1LQ2A 2VCYA 2VA3A 5COBA 3RYHB 3ROMA 4HPXB 3RS5A 1S0VA 1NXVA 2G76A 1QSYA 4LTMA 3A06A 2PH7A 3RRZA 2RCYA 3CBGA 5CB1A 1JAIA 4IQ0A 3DHNA 3F53A 4GNKA 1JMKC 1U7UA 2WD9A 3E1KA 4ZCTA 2GJAA 1EVQA 3S70A 3DOUA 2UVDA 2WUWE 3PPYA 1SXJD 2HFJA 4B6FA 4MVJM 5CDFE 4DRZA 4DQXA 4ECRA 2BBWA 2D62A 3EBOA 3Q1LA 1ZGJA 1OWOA 4ND8A 3F6PA 3NIWA 2QXTA 3FKJA 3LYLA 4FHGA 1EGMB 3E3AA 5IJZA 4ROSA 4TMTA 3RO7A 4I66A 2GYYA 2O2DA 4JL6A 2IA6A 2BBOA 2NSYA 3BRCA 1T5LA 5DHRA 4EYKA 1I2CA 2W2PA 3NT5A 4ASUA 1OXKB 4REMA 1C2TA 1VGRA 1H1LB 1EHIA 2RFLA 3L4PA 3DG9A 1QV6A 4I9FA 2A58A 4LXHA 4NAHA 3A9TA 3EDYA 2BFPA 2I4OA 3MBIA 4FE4A 4LZDA 4MXDA 4ZJPA 1C14A 3RD5A 2OMKA 4BL5A 2A92A 5CA0A 1CNMA 4J0HA 4YH1A 3V48A 1VG8A 3INNA 5EWFA 2I3GA 4K86A 4XDHA 1Z0FA 4HN2A 5CDYA 1RJDA 4RW0A 1TOAA 3KR1A 3VZSA 3F2DA 3QSYA 3UAXA 4A26A 3RYIA 2RMKA 3OKPA 3O2NA 1UMCA 5B7GA 1CPYA 1Y63A 1NKEA 4OHUA 3TR0A 1WDWB 5DT2A 3FRIA 2X8BA 3R9KA 2BMAA 5FTJA 4KFSA 1MVOA 3NX4A 4AJ1A 4XQGA 1VCIA 4EZIA 2BPCA 5LQAA 5E3JA 3FC4A 2VN8A 4PX9A 2QL7A 3REOA 3TLKA 2NV3A 1T4GA 4EPWA 3MUNA 4OGKA 3AUOA 3AI1A 1NW4A 1KVTA 5AQ1A 2DUNA 3D2NA 2ACKA 4KXLA 3PSPA 1SEPA 3OMLA 1UBNA 4Z6FA 1NR7A 3FSEA 2C5EA 3E3OA 4TWZA 5FFNA 5IIKA 3GP3A 2G4VA 4F9FA 1Z37A 5A7HA 4G6ZA 1EK5A 1F12A 2NVOA 3M6KA 3A11A 4D45A 2CXQA 5JJCA 2IXTA 4KLNA 4F6RB 4W99A 2Z4SA 4ON9A 4R8UA 2JJ1A 5KPDA 4D0RA 5AKIA 3GJSA 1M34E 1JP7A 1KYVA 2RJOA 2R47A 2CV2A 4HVCA 4IMIB 1NFRA 4J9LA 1XVIA 4RTRA 4EG1A 4P7FA 2A14A 1IJFA 7REQB 5IT9A 1E6LA 1HK7A 1T9DA 2LNDA 3VR5A 4O0MA 1OHHA 3PQDA 1EUYA 4KLAA 3V4OA 2WAQF 1HT3A 2ICAA 3HP7A 1E3EA 2BZ0A 2UYCA 5KQGA 1V3UA 3PUXA 1IULA 3UCXA 1G5RA 4Q1FA 1JT9A 2PLFA 3FSGD 1YZLA 2GA9A 1E3LA 3BFJA 4LF9B 5KYUB 4L02A 4MI9A 4RA9B 4NWIA 2OO3A 2OQIA 1NONA 2R7AA 4DDKA 3LUCA 2ZRQA 4P7JA 4L4ZA 2QOEA 1P1BA 1MORA 2X8WA 5JCOC 3DZ8A 1DAIA 4HH4A 1TK5A 3GG9A 1WCYA 4XIIA 3RK1A 2PDAA 4ABYA 3EXFB 3ND9A 3KS9A 4I5IA 4BJQA 1VYTA 1G18A 3HBFA 1XZPA 2ZRHA 3C4VA 3C3YA 1JMYA 3IR5A 4YYEA 1BZYA 1U8EA 2VPQA 5AW4A 2DTDA 3FZEA 3ZWBA 4S2EA 1GAEO 3T5DA 4Z53A 9ICTA 3PHJA 4C0WA 2SCUA 3LA6A 1T3HA 3KXPA 5EIOA 5K0LA 2I34A 5DHFA 3IPXA 4RQTA 1XAHA 4TT3A 2ALJA 1OF1A 1G41A 4FW9A 4LNHA 3THOA 4FMCF 2HN9A 5EG5A 2RGGA 2OCIA 4RK6A 1BXRA 3GRUA 1D7OA 3DDCA 4B47A 4GRIA 1QFMA 4NDNE 3FR8A 5JRZA 2QTHA 3Q0IA 3LBNA 1U2SA 1Y81A 2JLXA 2NU7B 1CFJA 3ONVA 1N0IA 1MO2A 2FW1A 1AQJA 2KV2A 2J08A 3IP4B 4G0UA 4U3JB 3OTQA 4GE0A 2XGMA 3G0HA 1QUFA 2ZVJA 3KT6A 3Q3VA 4GOLD 3OUZA 1CUSA 1L8AA 1Z2AA 4PPQA 2B35A 3NPMA 4QG7A 4JUFA 4KHPB 3TL6A 1X1SA 3KKAC 2EFEB 4BMDA 3ROZA 4CETA 1ILEA 5F3WB 2YINC 5AVWA 1QP7A 1XJQA 3L0IB 3M6WA 5AHOA 3W8RA 2Q1WA 3MT8A 4DIKA 1V95A 4UZEA 2I54A 4FINA 4F2WA 1Z4QA 1BPEA 4A2QA 2H1WA 3CVXA 4HMQA 4TV9F 1FUUA 5JHGB 4MA5A 3CPSA 4HWKA 5LMNB 2HSDA 3MBOA 1QQBA 1QB7A 3NM4A 3R2JA 2JLSA 1TK9A 4H1TA 1XRLA 4OVKA 1DI0A 2IK8A 3CF4G 2HC9A 3ZWNA 2RHLA 1YL5A 1R5OA 3EOBI 2BEVA 3KJFA 4E4TA 2VXYA 1RAAA 4PNZA 4FZ5A 1EBBA 3DTVD 3ZGNA 3IVCA 5DCLA 2PM8A 1G5FA 1M0SA 1LK7A 4C8KA 2JV3A 5ALNA 2ZRFA 4HWSA 3WFJA 5LDGA 3RVKA 2XKJE 1MB0A 5HGJA 3QUSA 2H5EA 2QW8A 3WDKA 2GDJA 4DMHA 5KNBA 4FD2A 3ADKA 1N8NA 4Y2PA 3A25A 5DQIA 3A36A 1DPGA 3S2ZA 5F4ZA 2XDWA 4QYIB 4OGLA 3H8SA 2NM0A 1JKMA 3MABA 2FPSA 4PRYA 3UOWA 5T6BA 1QFZA 1NMQA 8ICIA 4IDOA 3GARA 8ICOA 3GIDA 5E2BA 1YZGA 2I2AA 4JEUA 5HGXA 4CM8B 8ABPA 5JALA 1ZCBA 1KW4A 5ALDA 4TTAA 3IP6A 4I9NA 5F73A 1U94A 1PVPA 3D4PA 3H6KA 1BHO1 1ND6A 1P31A 3F2CA 3IGFA 2X8JA 1GL6A 5J9FA 1N0VC 3ZK9A 1E1CB 2HWYA 1KZHA 3GCDA 1FS5A 2FX2A 2JB9A 1JFSA 4P34A 3ECCA 2OKGA 1P60A 4MB2A 1WBBA 2ENWA 4QU0A 3ORFA 2YV5A 3T7AA 3MTIA 3Q8MA 1D4FA 1UKAA 4TQRA 5GGYA 3C29A 2UZ1A 2W48A 1AQYA 2H63A 3LT4A 2RCNA 3M9XA 2W2OA 1D9DA 4EJSC 4TMFA 1DKUA 4YAGA 5JXJA 3O2QB 3AFMA 2DMRA 2R6FA 3VHLB 4ARAA 1JLSA 3PIRA 4CF6A 2JAXA 4YC7A 3L3BA 4R84A 4WLUA 2FSVA 1G64A 4I2AA 2GK4A 4F4JA 3I2JA 4L8WB 4C3VA 3T5BA 4KTQA 4YFKA 7ICJA 1ESCA 3L46A 3K0AA 3OZVA 3TZ6A 5CRXA 1ECGA 1QHFA 4LJRA 5KYKA 1OYWA 1FU7A 2X7JA 3EQ2A 4RU1A 1FIUA 4P93A 4GZ5A 2IBKA 5AP9A 4B3TB 2YXPX 1YDFA 5A9SA 1VL2A 4X7MA 1EK1A 4K03A 3ZLJA 3V1LA 2A3RA 3LUJA 2ZRNA 2XVAA 5FNVF 4NM2A 4DCPA 1MIOB 1OBCA 1M2OB 3O9ZA 2HEGA 2F3SA 2QXYA 2QZJA 3M9WA 5C1BA 4RV4A 5K0FA 1HNNA 1GL9B 1VMEA 5KTKA 3OJEA 4CKBA 1QORA 5CLGA 4EABA 3PB3A 4PGFA 1N8SA 2NAFA 3UHOA 4JQZA 3KOWA 1HYBA 2C5HA 3BUSA 3KT3A 1P45A 3D1JA 1Z4KA 2WZQA 2I1VB 1TUBB 5TV2A 2AYXA 2YWRA 1GZ3A 5HE8A 1OYVA 3PNVA 2RLTA 2QXUA 2DUMA 3JAMA 1NHWA 4AY3A 3CPJB 2OB1A 4UCFA 1FRZA 4M9JA 3OHBA 3QEAZ 2VUUA 1GD1O 4FZ3A 3I1YA 4WN9A 3H11B 3JQ9A 3N07A 2HSJA 3AERB 1Y1QA 4WXPA 2H7YA 5BNWA 1HFWA 4UNRA 3AVPA 4CU5A 2HMXA 3HABA 4Z6DA 2QJRA 1SO8A 2XTNA 4ONEA 3CUKA 3ZY5A 4YACA 3PUIA 3A31A 3R0ZA 1L9KA 3WI7A 2PQ0A 2X6TA 3TSOA 3PR3A 3R3YA 2HLHA 4BCCA 1WUDA 2AN9A 1YE3A 5AVXA 3RYHA 2YWDA 1Y3BE 1M75A 3ZWDA 2Q29A 1JMSA 1GR0A 1Y6ZA 1NTOA 3L8EA 1DUVG 2GYUA 5I51A 2ZRJA 1RYDA 3KEOA 2ZZMA 4KACA 4OIMA 1SKYE 4XFJA 3AEYA 1Y1LA 4JWMA 5C9ZA 4KQIA 3MJCA 3Q9SA 3MFYA 4JMPA 2XE6A 4QRIA 3C8HA 4RVFA 1Z2CA 3ZI4A 1MCZA 1KIAA 3LCUA 3KHKA 4QAJA 1V11B 1X2IA 2ZI5A 3RUFA 4D8TA 1Y1TA 3WTBA 1EZ1A 3WIEA 3GJRA 4CLRB 4NMWA 3LDHA 2IU0A 2W2XA 1OILA 3VGPA 1O95C 3N05A 1WS6A 1FDTA 4C0HA 4WJZA 3D6FA 4MVJH 4JLOA 1T3SA 4HC4A 4KVAA 2W6MA 3PKIA 4EX7A 3ZGZA 2QRZA 1XU9A 1ZQTA 4V0MA 2XQVA 4WNAB 4BO3A 5U1PA 2ID9A 3STWA 4IG4A 2O7QA 4OI2A 2YYZA 3JQPA 3H42B 3AY0A 4RCYA 4H27A 2KVCA 4PZPA 4BQOA 1RXYA 3T5HA 2ZTHA 2P27A 2QN9A 1H1LA 4NCNA 4DBLE 1OIXA 5K1ZA 1HOTA 3H4BA 4G0QA 2JH8A 2VH5R 4B9SA 4BQFA 4J3FA 3OU6A 3PA6A 3E18A 3EVBA 3I92A 1XK7A 2ZJFA 1EVYA 1XMPA 4A2CA 3CISA 4GBED 4DA7A 3AHHA 3BXPA 1NU6A 5C34B 1L5OA 3SDZA 4BAGA 4CT5A 5EJFA 2A0WA 3OO0A 4HWOA 2AH5A 1W93A 1S0UA 3EPLA 4B44A 1KFCB 4EI9A 2RJNA 4C0BA 4YCBA 5AJWA 2QTTA 3VNQA 4M54A 3N70A 1ULAA 1R8YA 3OZCA 3WC4A 4O3PA 4II7A 4D9JA 5HQJA 1NQVA 3EJWA 3UPUA 3ICCA 3UG7A 1XL1A 3PUJA 4MYHA 2AFIE 5C5DA 3MTEA 1QWOA 2QMOA 2HHJA 3V7YA 4JL5A 4PF1A 3M1AA 1NIPA 3V3KA 1JF8A 1EK6A 1LV8A 4N7JA 3LIPA 3TLAA 2O8VA 4I28A 4Y2JA 2GVDC 2X9QA 1NMEA 1UAGA 2V7TA 3R3UA 3UJBA 2J3IA 1OWPA 1P7WA 4F6RA 3NUGA 4YUWA 1YFKA 4MHSA 3WWCA 1YH3A 1HE5A 4BTEA 5FPSA 5A5FA 4K88A 2EX1A 2QP4A 4LBWA 3LVQE 1Q46A 3MGVA 4JYMA 2VIIA 2MSEB 5J2HA 2P4HX 7ICSA 2V7PA 4KMMA 4KXYA 1PK1B 4RZQA 4NCJA 7REQA 4Q3EA 2V3VA 3TAPA 3PVSA 2QE7D 3DV2A 4UU8A 3RJEA 1PLKA 2Q0ZX 2C94A 5JEDA 3ER6A 3JPSA 1E61A 2AG8A 4BPBA 2JFXA 3CLUD 1VHDA 2HNAA 1OLUA 3UMFA 3M33A 1QX3A 4R2JA 3HZRA 3GPLA 2IXAA 4EEZA 1GGMA 3DZJA 5AOCA 4MP6A 3QFHA 4OLHA 3STYA 3JR3A 1M1ZA 4MIOA 1QVWA 4RA9A 1O54A 2XF8A 5J2IA 3ZV6A 3QHAA 1J8YF 2VR1A 4I2EA 2XH8A 3LDFA 3RC9A 1O0SA 3LNCA 5A5EA 3D2QA 2YS7A 1Z6ZA 1A7AA 3Q88A 4X3OA 3GRVA 3CLRC 4L5AA 4ETMA 5FOTA 4XYGA 2H17A 4R51A 2WIFA 4TMZA 1MTZA 5FKJA 4LZAA 5DMHA 2XOXA 1SGWA 3O5AA 1CUFA 4N6OA 4P0PB 3UKOA 4Y6QA 2FMUA 4X9XA 2Y2VA 3DM5A 5E1MA 4EAAA 1WD7A 3MGAA 1ZI9A 4YP3A 2R8ZA 3PD1A 2DQZA 3QY9A 3K6SA 1X8LA 2PMKA 3IJEB 4R81A 1QDEA 3AGPA 1EAMA 5H0IA 5KAPA 3QM1A 2HMTA 2RAPA 4QU9A 2B3TA 3A1CA 1UP7A 1EWQA 4XJVA 4D98A 1Q7RA 3ZWYA 2H4XA 4ZV7A 4YR3A 2ONJA 4NCIA 4OHCA 4PFQA 3UGKA 1I7DA 1NVDA 2Q3MA 3VO1A 3HB4X 3TO5A 2WPDA 5HF6A 1X92A 3R8XA 3AM1A 2HZBA 5EI5A 3ZH2A 3RSGA 4U3JA 5DG8A 4F8YA 3OBBA 5CX4A 1ZXXA 2I2BA 4JLDA 3O38A 4NOJA 3IOMA 1MA0A 4IYJA 4ZFNA 3T7DA 1EFKA 1V1MB 3UMJA 2VDQB 1ZQFA 3RQIA 1CR1A 3GZ4A 1Q57A 3DOJA 4M21A 4N8DA 3KXLA 1NLYA 3RF9A 1E5VA 1T6ZA 5CXQA 4PXAA 1CKEA 2FKAA 3U4AA 3VMFA 5J2UA 4UUBA 4OK5A 2O5VA 1Y8ZA 3E4CA 3B1ZA 4MVJD 1SIOA 3CVUA 2QP3A 3W5DA 3RFXA 3TGPA 3FYHA 3G9UA 2BFOA 2Q5QA 3O8BA 3R5FA 4ACOA 4DARA 1R6XA 3UK6A 4KIWA 3MILA 3JATB 2ZB4A 4P84A 3DEAA 4E2WA 3NPAA 1OGYA 2C3YA 1KH1A 4HNHA 5CT8A 4RANA 3WA7A 3PX0A 1G16A 1QR2A 1Q95A 4XQ0A 2RGRA 2C7RA 1EDOA 1YF3A 1XA4A 4ZVUA 4QODA 3B9RA 5DGDA 3E1GA 2BCSA 2N1MA 3H2ZA 2KE7A 1C1YA 2DFLA 3UMBA 3DL7A 1ZM9A 4ISBA 4UE6A 3MJVA 5CVCA 4OJOA 2GUGA 2EKPA 1SBCA 5DNYB 1ODJA 1G8KA 3QELA 3A58B 3QKUA 2DQYA 4QYIA 3DEKA 1BEUB 4PWYA 4HPJB 2WR8A 2CSXA 4MWGA 4KNYA 4BB0A 1A27A 1Z0ZA 2JFUA 3PA8A 1TK2A 2LYAA 5B5SA 5F77A 4CM8A 2BFFB 3TTSA 3KLNA 1AA9A 1J20A 1Z2DA 2UYQA 1V1RB 2Q9CA 4MUEA 3M70A 1ZN2A 2D0OB 3RC7A 4UTPA 3GJ3A 2A9OA 1PS8A 3BMNB 1XZGA 1H85A 1N5XA 3QBVA 2GILA 4BVHA 4TN5A 3LX6A 2IXFA 1RYBA 1I3OA 5KG3A 1JB1A 5C31A 5IS2A 2IZOA 3A6PC 3V8VA 4INJA 2K89A 2O06A 5KT3A 3EZNA 1T3NA 1KEKA 5B3JA 1AN9A 1E2MA 1ZJYA 1DB3A 5K3CA 4O8CA 3OJSA 4PBRA 1NQ5A 4JUDX 4KAAA 2FVYA 3IRUA 3C14C 1SZPA 4LF4B 4E07A 5DIZA 5FWAA 3MQFA 5K0EA 3JRNA 3SIWA 2Y1DA 4LJYA 2Z08A 4ZI7B 3CX7A 4B9MA 2D2VA 1WDTA 1Y1PA 2B2CA 3PDWA 2IYAA 3AKEA 4II2A 1H2XA 5FPQA 1LFAA 5EIBD 3KBOA 2Q5HA 5KCMA 2Y1WA 1GU0A 1YI1A 3CVOA 2ZXFA 4CKYA 2QAGB 5GADl 1NVVQ 1S8NA 3EHDA 1Q7CA 1ZHHA 4BNWA 4GVPA 3A1NA 5JYEA 4DOAA 3PENA 9ICNA 3QU9A 5CEJA 1HY3A 1VLVA 1YDWA 2VNIA 2IKSA 3AO0B 2QRGA 3KQMA