3QUBA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47ala mutant complexed with sulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
MRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHAGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qubA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qubA01
1L6RA 4ZEVA 1Z4IA 4YCMA 2HCFA 2ZBFA 1N9KA 3BA6A 2C9MA 3R4CA 5AKIA 5AKHA 4AP9A 2GHTA 5ALGA 3AR3A 1Z88A 1WPGA 3RF6A 5AVYA 1U7OA 3AR4A 4HAIA 4HGRA 3ZTYA 2YBDA 2EATA 2B1RA 4YH1A 2YJ3A 4XE5A 3NALA 4JDPA 3WKBA 2GMWA 2YN4A 4UMVA 4Y2QA 3L8FA 2O9JA 5AVTA 3U7HB 3KD3A 1RPZA 5AM1A 2DQSA 5ALHA 2G09A 3U7EB 5AIAA 4JB3A 3WK8A 2AUTA 4UASA 1VJ5A 2WF9A 1RKUA 4CF3A 4I9FA 3CZ4A 2CFSA 4OFZA 3OCXA 2PR7A 4UAVA 3PDWA 1ZD2P 4KX3A 2EAUA 2W43A 4Y2XA 4EENA 2B30A 3EF0A 4BYGA 5AI8A 1J97A 3WGUA 2FPSA 5AM2A 3F9RA 1ZRNA 2YMMA 1YNSA 2R8XA 2Q5EA 3PGLA 4AS3A 5AM4A 3D6JA 2B8EA 3RFUA 2IOHA 3W5CA 4MWOA 4KNWA 5ALJA 1NF2A 3DNPA 2R8YA 4Y2VA 3L1UA 5A3QA 3ZVMA 1ZD4A 4EEKA 2WHEA 4OCZA 2P9JA 2P11A 4BBJA 5AKXA 1PW5A 3MMZA 1ZRMA 3QLEA 4NV0A 2I34A 2JAUA 3ONNA 4BX2A 2WF7A 2W11A 3PCTA 1ZS9A 1RMQA 1WVIA 4RETA 2R8EA 5AICA 2NO5A 3QUTA 3OCZA 3L7YA 3U26A 2G06A 2ZXEA 2PKEA 4KN8A 1T9ZA 2YY6A 1J8DA 3SF0A 3ZWDA 3ESRA 3U13A 4HGQA 5AW4A 2JAOA 5AKKA 3FPBA 1O08A 3EPRA 2JAWA 2R8ZA 5IT4A 2AGVA 4GIBA 1T5TA 2Q4TA 1SWWA 3N28A 2YMQA 3B8EA 3IJ5A 4E88A 1RLOA 3KBBA 3U19A 5AIBA 3OCUA 3TLMA 1NRWA 1RMYA 4BNDB 4UMFA 5ALYA 4KNVA 2BDEA 4ZEWA 2NO4A 3EWIA 3A1CA 3ESQA 4AS2A 3W5BA 4HYTA 3N8GA 2FUEA 5AW3A 1ZD3A 2YFYA 3ZVNA 1K1EA 5AVRA 3QU2A 1CQZA 4CF4A 3FVVA 3A1DA 3KOOA 3FGOA 4HGNA 2I33A 2YJ5A 3MN1A 5AW5A 3FPSA 3N07A 4BNDA 2IYEA 1TJ5A 2WF5A 1EK2A 2D2VA 5AKJA 3UMBA 3IB6A 3NANA 3ZWKA 5AW2A 3W5DA 4RESA 3L5KA 3DDHA 1SU4A 3KDPA 1Z4JA 3QUBA 1QYIA 3FM9A 1S8OA 3I28A 1EK1A 1Q91A 3K1ZA 4L57A 3HLTA 5ALNA 1WZCA 5ALSA 5ALZA 2HSZA 1YV9A 3WKEA 4KX5A 2B82A 1YJ5A 4NAVA 3ZW7A 3ZX5A 3AR7A 4XPZA 3P96A 4F71A 1Q92A 1RC8A 1WR8A 2G1AA 4BEVA 2YMPA 2G07A 4BKMA 5AW6A 2IA5A 4IFTA 1U2SA 4BEWA 3EF1A 2OA0A 1S2OA 2WF6A 3L8GA 3DV9A 2FPXA 3E58A 2FDRA 3QXGA 5FP0A 2C88A 2WFAA 3KZXA 3QX7A 2X4DA 4DWOA 4UATA 2HI0A 1QQ6A 5AI6A 2I54A 2RBKA 3ZVLA 3VAYA 1XP5A 3QGMA 2C4NA 2GO7A 1SWVA 1U02A 3MPOA 4UM5A 2YMLA 4QQFA 3WK7A 1JUDA 1LTQA 3J7TA 2G0AA 3L8EA 2BDUA 3QU7A 1ZOLA 4DCCA 5AK5A 1Z4NA 3NIWA 4OHFA 5E0OA 2HEGA 2OYCA 3UM9A 2RB5A 3ZI4A 3W5AA 3L0CA 5AW9A 3WK5A 4BX0A 2ZBDA 5AVVA 1FEZA 2RAVA 1RLMA 2AMYA 1Z5UA 4C4SA 2C8KA 1CR6A 2ZOSA 5AVWA 2HX1A 1O03A 5AK4A 3SD7A 3AR5A 3ZU6A 2QYHA 4MUMA 3U7GA 3FZQA 3BWVA 1Z4KA 1X42A 1Z4LA 3SKYA 5AKZA 4FYPA 2AH5A 2HO4A 4FFDA 4FE3A 5AW0A 3OCWA 5ALMA 3NRJA 4EX7A 3NASA 3PGVA 5AVXA 2MSNA 1TA0A 4Y2YA 2B8JA 2HF2A 2OM6A 1L7PA 5AESA 5AK3A 3ZTWA 3N1UA 2WF8A 2C8LA 5ALDA 1L8OA 4KYTA 3SKXA 2FUCA 3NAMA 2JARA 1RKVA 2I7DA 3AR2A 4IG4A 5AW7A 2P69A 3ET5A 3AR6A 3QU9A 5ALTA 2G08A 1RQLA 1TJ4A 5AVZA 5ALRA 5AK6A 3KC2A 4L6CA 5IT0A 2YJ6A 4QJBA 2B0CA 5ALIA 3CNHA 4UU0A 1RRCA 3E84A 1TE2A 3AR9A 2P27A 1Z4QA 2HF7A 2Q4RA 3OTQA 3N5KA 4YCNA 5AM5A 5ALKA 1U2TA 2FPWA 2YJ4A 4H1WA 2B1QA 3OPXA 3QNMA 4PNHA 4Y2TA 3GYGA 4Y2UA 2I6XA 5AKYA 5AVQA 1NNLA 4EELA 1U7PA 4J03A 5AI5A 4UM7A 3QUQA 4L6AA 2OBBA 5ALPA 1RMTA 3WKCA 4DW8A 4UMDA 4YCLA 1T5SA 1N8NA 1Z5GA 5ALEA 4G63A 3B9RA 3IRUA 5ALVA 2FI1A 4HGOA 2NYVA 2PQ0A 2JGAA 1XPJA 5ALWA 4C4RA 1Z4MA 3B9BA 5AM0A 1QQ7A 5AVSA 2VKQA 2FPUA 2MU2A 1LVHA 3WGVA 4C4TA 4UMEA 5ALFA 2FEAA 3E81A 1KYTA 4YIKA 4UARA 2MU1A 4CF5A 2EARA 2ODAA 1Z4OA 1L8LA 1TJ3A 4UU1A 2CN1A 3OCYA 1RLTA 5AW1A 2IOFA 4HGPA 4G9BA 1RDFA 5AKEA 1IWOA 4UAUA 2QLTA 5IS2A 3OCVA 2HOQA 4BX3A 1VFPA 1YMQA 1AQ6A 3WK9A 4OD0A 3E8MA 5AI4A 1Z4PX 4CNQA 4I9GA 3QUCA 3M1YA 5ALQA 1QH9A 4CE6A 5AM3A 4Y2JA 3R9KA 2WM8A 1YS9A 2HDOA 3AR8A 1QQ5A 3I6BA 2I55A 5ALOA 4YGYA 3WKDA 3S6JA 3A1EA 5JJBA 5AHXA 2BY4A 4NWIA 2ZBEA 3QYPA 1L7NA 1L7MA 4NABA 2RARA 3ED5A 1ZJJA 2IOFK 3ET4A 4J2TA 2O2XA 1RQNA 1Y8AA 4EZEA 3L1VA 3QU5A 3UMCA 2ZBGA 5AI0A 2CFTA 4Y2RA 4ZEXA 3QU4A 3SLRA 4Y2PA 1ZD5A 1VJRA 1L7OA 2ZG6A 3I1YA 2W4MA 4DFDA 2CFRA 1MH9A 1XVIA 3HYCA 4O8CA 5ALUA 2FPRA 3U7FB 3DAOA 4GXTA 4XQ0A 5AW8A 3UMGA 3ZX4A 4EX6A 3NUQA 4XOUA 3SMVA 1RKQA 3M9LA 2GFHA 4B6JA 1F5SA 3SHQA 4Y3UA 5AKLA 4YIHA 3WK6A 4UW9A 5ALLA 3L0YA 5A3RA 5T41A 3WKAA 3I76A 5AI9A 5AVUA 5ALXA 3MC1A 3R09A 3A3YA 2G80A 3L0BA 4NFLA 3ZUPA 3WK4A 3L8HA 5A3SA 1YDFA 5AKGA 2HHLA 4F72A 4Y2SA 2GHQA
chains in the Genus database with same CATH superfamily
1WNFA 3ORFA 2IHTA 1OPXA 4Q9JA 1CZUA 1R0YA 3M81A 4PICA 4BQNA 3PW2A 1NQOA 3I32A 1YS4A 3PNYA 1FU8A 4HQFA 4IFIA 3QEAZ 4FTWA 3H0KA 3LXRA 2Z5GA 4B85A 3TAQA 4EIWA 2OECA 4YRDA 4UASA 2X3FA 3GLFB 1MB3A 3GBPA 4DR2B 3DTVA 2P5TB 4OFZA 4O4IB 4RVUA 3W1VA 5JNVA 2J0UB 5CVJA 4HNAA 1HE4A 8ICNA 1KPHA 5AM2A 4YAOA 3GZTB 1RXUA 4GMFA 4E15A 3P7MA 2YHBA 1GVNB 1I36A 4RVHA 1RPLA 2REBA 2HQOA 3TEFA 2VF8A 2WHEA 4G0YA 3IX7A 3HVHA 4YCJA 4GLXA 4RPZA 4RKFA 4L9AA 2XKKA 3QPVA 2RCYA 1FXWA 3HR7A 3SBXA 4WOPA 1YULA 2G06A 2FZKA 4KN8A 4BY9E 4HPWA 2NVUA 5EFZA 2ILTA 2X5OA 5CB4F 1QFZA 1JQAA 1XMJA 3T6KA 3UT6A 1GDTA 4ETMA 4GGOA 4NU5A 4D3XA 2KN7A 3LUKA 3V9AA 5JT1A 2Y1IA 3EASA 5DLEA 4B6GA 4QOJA 4LBWA 1SC3A 4FK8A 3GMTA 2AVNA 2I7VA 3PYXA 5K05A 3O4FA 1HXHA 1K86A 3ERCA 1IRXA 3P19A 1T8WA 1MRZA 1S7CA 5BN3B 5KFWA 2YX1A 1PD1A 3V8VA 2IXGA 4I9NA 5G4LA 3LL4A 2VJYA 2IS4A 2HPAA 4G0XA 1SXPA 1E79D 4F4KA 4M0PA 2PT5A 3FF1A 3JY6A 4PO9A 4MUHA 4DA0A 4DJEC 3UUEA 4FBLA 2RHTA 1E7WA 4PHDA 5E7QA 2AMLA 2FW7A 2XYQA 3QX7A 3L8CA 1UK6A 5AI6A 1XZCA 1VI5A 5DLQC 3PWSA 1XZIA 3PFGA 3RAQA 3CRVA 2ZXIA 5DK4A 1XNSA 5AOVA 3EW9A 5BSGA 4CMEA 4HS9A 1KI2A 1SUIA 3DMRA 2Z9BA 3O3NB 1NOKA 2J6BA 2CHFA 4C4SA 4GBGA 1T8TA 1ZCFA 4GX5A 4BRWA 3EGDA 4WNAB 1NXOA 3M6ZA 4BFCA 2VP2A 2APJA 1E66A 2F3RA 2BHLA 1L5MA 4X20A 2FP3A 2OPBA 4NZ9A 1BPEA 2P69A 1U28C 4WACA 1O96B 4FOOA 1MDBA 3ZWBA 1G7RA 3EYAA 2YJ4A 3FG9A 2J3DA 5M34A 4OM8A 1O0BA 2X0JA 3QY9A 2Z09A 1NKBA 3TUIC 1T2UA 3UA4A 4YCLA 2E89A 4LEIA 4U2DA 1GR1A 3SSMA 1JDBC 4C4OA 3K8ZA 1ZOPA 4RH3A 2ODGA 2XECA 2QMUA 2PGXA 3WQQA 1NMZA 4E5DA 3GLHB 4JB0A 1D2MA 2GK3A 3K35A 2WLTA 4DMRA 4ME6A 2RKOA 3DEJA 2AG6A 2VSOA 4RAOA 3I8OA 3G0DA 3MGVA 3C3DA 1RWOA 4NG5A 4HQ6A 1VBFA 1ESNA 1QVRA 3NYIA 3GLGE 2DH5A 4WECA 4GGPA 4BO0A 3PC2A 4EZEA 2OPHA 2OO5C 3PQ8A 2W9XA 1PFKA 1XTVA 3N2KB 4CF6A 1Z34A 3LLMA 1N0WA 5AJHA 1IAQA 3EMDA 3IV9A 1RVDA 4Y3UA 2BGJA 4MVJH 5KYYB 4DYHA 3IIJA 3EB9A 4W9NC 1P7DA 4EFKA 5LP1A 3OE7A 3L0BA 1PNTA 3VKFA 3IELA 2WP8J 2IT1A 4HB3A 3AZPA 4N0MA 8ICRA 3HUFA 4ZPXA 3QIAA 5IZCA 5IXYA 3EZ6A 3ZD9A 2XA1A 1Z47A 3WX0A 2IF2A 4N3NA 5ITVA 1HEIA 1WBDA 4DC0A 2BR0A 1QF6A 3UJAA 3DT9A 1ULTA 2PGOA 2XCOA 2RH5A 4B6FA 2O19A 3WMRA 5AI8A 1R0RE 5CLLA 4QFDA 1QO9A 2WWFA 3PE6A 3ZBQA 1W0KD 4ZXFA 2AFIE 2ST1A 4R9RA 4P7JA 1S2GA 4PN7A 1M7GA 4ENSA 2NYUA 2R6DA 2XNHA 3VOTA 4LDJA 2WFLB 3DGEC 3VBEA 3A6DA 1JVBA 4U6QA 3L7IA 4DS4A 5BP7A 3IUMA 3OP1A 1GPKA 4ARAA 4Z53A 2XVMA 1IZ8A 1C9DB 1QG6A 5TF4A 4GX2A 2WU0A 3FPBA 4PRKA 1JI0A 4Z6KA 4F3RA 4DOMA 2B8NA 3TSOA 4OEHA 1LBEA 3FPEA 2QN9A 5G2OA 4AUKA 3AETA 1GRQA 2KMLA 4IDFA 1YDEA 4HNVA 2HWKA 2ZQYA 2KB0A 5TMEA 3RJZA 3QV2A 4MW6A 4DXAA 1YR9A 2XZOA 3OJWA 3RC3A 4EA9A 2P4SA 3OX1A 1Q91A 2F3TA 2GLXA 3P52A 1HT2E 1BN7A 2WTBA 5FBKA 3DOHA 4NICA 3HDQA 4HWPA 4AIIA 2F3UA 5EE5B 1XR3A 4W1PA 1ULUA 5IEJA 1OFTA 3SAFA 4DLVA 4XFKA 4G3XA 5BW8A 1QP8A 3ZZMA 2MYTA 8ICPA 1MG5A 3ZGZA 2QHXA 4IUBS 1FIUA 4KPUB 1HV8A 1O97C 3FTPA 2XMDA 1EE1A 1AHHA 3LK9A 3QVOA 1Y9EA 3MCAA 2ZSKA 4BGVA 2V4QA 2PD4A 1J5PA 2NTEA 1PJQA 1THGA 1PG2A 4TVKA 2PUCA 3GZ4A 3HCPA 5KVSA 2W8BB 3N0TA 3VC7A 3L01A 1GEEA 2JLZA 2PMZC 1QH0A 4CQMA 3H83A 3KPJA 3G2HA 3R0JA 1UZNA 5AO9A 1HG0A 5AW7A 3ZIAD 5AVZA 2YWXA 1YQTA 1T3LA 3Q88A 3FOWA 4AKSA 5JBNA 3NRCA 4P7FA 4J16C 1ZH8A 4LOIA 1FDOA 1IXRC 3EUFA 1E3SA 4XCXA 4P5EA 3PRKE 3A4MA 1NT4A 2XI9A 1G3RA 3UMJA 5JSFA 4HRXA 5LYJA 4CLOA 1NC3A 2X23A 3RVLA 1XLTA 1T5HX 4W1QA 3NHUA 5A3JA 2ZYRA 3WWOA 4QE3A 2DPGA 2H2DA 2F3QA 4QELA 2PSSA 1BE8A 2VK1A 3ZQKA 1QH9A 1PJLA 2KJ5A 4BO2A 2YQ4A 4JGIA 3RRNA 4ZHSA 5J2TA 4LGYA 3K31A 1RQNA 3GELA 1EXDA 5TPWA 4UCXA 2K4EA 3UUWA 1NJWA 3G8DA 3AVXA 4QSMA 4X00A 4YXJA 3F5EA 1M54A 2IUEA 2YV3A 1GA4A 3IUSA 1XA0A 1SXJB 4RADA 4E2WA 4F97A 3N87A 3BICA 3A04A 5LU9A 1LLUA 1C2TA 3ISDA 3IAS6 3D2NA 3DVAA 2A1UB 1JEQA 3UXNA 4TTSA 1KEEA 2EYUA 3CF4G 1E6UA 4PHCA 1Q83A 4MQEB 4P3PA 4BNVA 1RPJA 4JVLA 1EZ4A 5H3HA 1M2WA 1GADO 1JIKA 2Z8YM 4NXMB 4EHHA 2Y1XA 2EFEB 1NASA 2G71A 1WZUA 1O8BA 4V02A 3CH6A 3D5QA 2RDJA 5ILQA 5HJ7A 4I81A 2FNAA 4B3TB 4DQPA 5CP8A 2A1IA 1E77A 3JZIA 1X0XA 4TXLA 2R4UA 3NWOA 1PK1A 1K7YA 5HQ3A 3C6YA 4GPBA 3ZK8A 3B3JA 4RPIA 5JXWA 3U4AA 3MBIA 4EEKA 2C7QA 3ETRA 1S0MA 3MGHA 1WU8A 4TM7A 4IGFA 1OPRA 5AHOA 1GCAA 2YZ7A 1NVUQ 2CDCA 3KHSA 1Q3TA 1MB9A 5EMKA 1YS7A 3P9RA 1J8DA 1XZNA 3W6OA 5HDQA 4I28A 3ZWDA 2JJMA 1WSBA 4O8ZA 1X1AA 3N53A 4XX0B 4EABA 2UYQA 1U0TA 1GRRA 5E6UA 1AKWA 1ESDA 2QZ4A 4LMRA 5IK2A 4YT2A 2Q6VA 5GZ3A 3QU2A 1CVIA 2BT4A 2AXTU 4GNRA 4PVCA 3N07A 2QJFA 2QSUA 1Y3CE 4OM7A 3K9BA 1ECFA 4YBRA 1IBLB 4Z3DA 4RMGA 1NBIA 2SKEA 1HQCA 5ALZA 1MV8A 2J9XB 1RWNA 1M34A 3ESZA 2XE6A 3FLEA 3AVQA 4YRLA 4WXYB 3ES9A 2NNLD 4DPMA 1ZQSA 2Q6TA 4G26A 1RAHA 2E8NA 1CFJA 1Y8QB 3K4PA 2JG3A 2G63A 3TIXB 1NL3A 2JEIA 3WY9A 3A32A 2FQXA 2VT7A 1DAMA 5B2EA 1U1DA 1UUFA 1JSXA 5TZVA 8ICQA 4BMYA 3GRZA 2IJGX 3WSTA 2XAAA 3P2YA 4FS8A 4EY3A 5C5EA 3I1JA 1UKYA 1OROA 2NUBA 4CT4B 2X76A 3D2QA 2FJUA 2FWNA 1TOAA 3DEAA 1N7JA 1LPPA 4EUHA 3E22B 2PX6A 1KY2A 2A9QA 1ZGGA 4HDOB 2HBQA 2W3RA 4O5EA 2OAGA 3RSHA 4R0MA 4F5QA 2NV6A 5EWJA 3F97A 3C43A 2AZXA 1QIHA 1P0CA 1PK3A 3C3JA 4DF3A 3C7DB 1USKA 3JAKB 2EEPA 1IG3A 2NYRA 2G3YA 5AKYA 1MC5A 4KLAA 2G9VA 3TTVA 1D4FA 4GKJB 4XYLA 4BJ6A 3D5TA 1O5OA 4Y8VA 4RCVA 1GQSA 2VEOA 3RBXA 2Y66A 1S2NA 1SKSA 2Q46A 1NN0A 5KKCA 5EKXA 3UK0A 4U7GA 3TLYA 3CO0S 3C1ZA 2GFQA 3MW8A 4C22A 1VIAA 1OR8A 5C8XA 3ESAA 4NBSA 5A04A 5BMVB 3BUSA 1TU0A 4LISA 2KBEA 2QXYA 2VRCA 2A9RA 1TLFA 3U40A 3AW9A 3HB9A 7ICOA 2F55A 1AXRA 5EEGA 2QQFA 3V6JA 2WDZA 5JC8A 5L1JA 1QQ5A 4GD3Q 1BFKA 1VKZA 4QKQA 1XDWA 2MR5A 1NY5A 2XZDA 4A23A 1GPH1 4P4SA 1BVSA 1QOZA 1GAEO 3LW8A 1TEZA 3M4YA 1H5UA 4NYJQ 2G5TA 5HGJA 2P2GA 1RSZA 5LBTA 1PW7A 4YIHA 2WIBA 1OZFA 3UHPA 2XGOA 3TX2A 4MW0A 4RNDB 5AI9A 3Q7SA 1Y89A 4X7BA 4UNPA 1JSRA 4MZXA 2VWHA 4C7KA 3MT9A 1EESA 2ZRDA 3KJQA 5H83A 4BNUA 2YJ3A 1FUKA 3CUEF 1LKYB 4QD3A 4KE9A 1FXUA 2H2AA 1W2WB 4OIFA 1GAQA 4FS3A 4PIPA 2ANCA 2RI0A 2EG9A 5CCBA 1B22A 4QC2A 4IDAA 1KF0A 1VA4A 2F4NA 1NV9A 2R1VB 3OPVA 2FN4A 3DF7A 4ZANA 4ZHQB 4M38A 4LDNA 4YROA 1V6SA 1Q20A 2WSMA 2CGEA 3H2ZA 1QRAA 3PCXA 1CD5A 3N7TA 2UZ3A 1XZEA 8ICCA 4ODIA 3OA0A 1RMQA 4DGQA 3PDIB 2ZR7A 4B43A 3IP3A 2B78A 3CPSA 1W36D 5EWMA 3O90A 2E4VA 3RTDA 1H2EA 2F2AB 1VLHA 4LOLA 3EEQA 2WDPA 4DS3A 1UBRS 1KJWA 3BXHA 4FYMA 5TVKA 5EUCA 3AEVA 3EYWA 3VKGA 5C53B 4QZEA 4NY8A 3KKZA 5JS2A 2I33A 2WZDA 1Q0TA 5AJUA 3CX6A 3PQ5A 1LS6A 3H19A 2RK4A 2ZYIA 1WMDA 3MBYA 3WSWA 4X6YA 2IS1A 3LMKA 1QQBA 3WLIA 4ED6A 4LW8A 5JARA 2C2EA 1YQDA 2BR4A 4O4JB 2I62A 2Y0DA 1FF9A 2BFDB 2G1KA 1JSCA 3DOOA 2OXRA 5JE8A 3OLWA 5CYFA 3WLEA 3ZNOA 2BCUA 2V45A 2VDUE 3HUEA 2FPXA 3Q41A 1Z0ZA 4KYIB 3F71A 2R86A 3R6DA 3Q98A 4YRGA 1U02A 3MJFA 2NU8A 2JLQA 3REQB 3GJ5A 3AOEA 4DCJA 1DAKA 3J7TA 5GIOE 1J1ZA 1D8BA 1JKIA 3G8AA 3WNDA 3GJ6A 4ZKDA 3H1TA 1ESZA 5JMOA 3FH0A 2J67A 1AHNA 2KQUA 3T4UA 4Q43A 2ZOSA 3VNVA 1ZCAA 2GF0A 3IEUA 2P3LA 3G7SA 3T3DA 1G5FA 3H97A 1SD2A 2C84A 3HEMA 2BCEA 1VZ3A 5EC8A 2JV3A 5CT6A 3N2NA 2RJOA 1L8QA 1PL8A 1SU6A 4JBLA 1L8OA 4JY7A 3CZ9A 1P9WA 2FUKA 2GASA 3T7KA 2Y71A 2WJ4A 2QX9A 2KS6A 4Q3BA 2I6TA 1ZQJA 3UMRA 4UHKA 2QORA 6REQA 3AILA 3OC0A 3KP1A 1C3XA 2RGEA 2JD1A 5DYGA 4MYHA 2E82A 3LYUA 3AWDA 1E6CA 3IQIX 4YMUA 3NC4A 5TRTA 3OLZA 3B6EA 1I3LA 4FDLA 5GZ1A 5K0SA 1OXKB 2GRUA 1SJ9A 2KKVA 4AJHA 2VC2B 4KI7A 1SKRA 1N6RA 3GQBB 2W6ID 2RGRA 1QTMA 4PGXA 4DAOA 3KPYA 2DYKA 2CSUA 4CTNA 1NHGA 3MAAC 1DEAA 1EI9A 1M1NA 1QIMA 1YHYA 2A5LA 2CMHA 1XZAA 3NGLA 3KOXA 1P9RA 3KT0A 1Z22A 3KJNA 1GHTA 1I5RA 4LZNA 3VR5D 1SZCA 1WVMA 1KVUA 2G6BA 4KACA 3EAQA 2JZBB 1NIPA 2HK8A 4RELA 2QTZA 1KP9A 3ZQUA 3KJEA 4UVHA 2QPOA 4IR7A 3DAOA 2P8JA 3WDKA 4R8VA 1CP2A 4F12A 1NA5A 3KHUA 2I76A 4NENA 3M34A 1QCKA 3LHKA 2BGIA 2ECKA 1W49A 2ZR9A 4O29A 2H7CA 1A8UA 3ZHZA 1DJPA 2I2DA 3R4CA 2OCYC 3WGIA 4GKKB 3I42A 3CUUA 4KHPB 1J0BA 1RPZA 1N77A 1XL0A 3NMUF 4P4TA 1WUJS 1TMGE 2NUTB 1DQRA 2UVDA 3ZHRA 4YRAA 4IV5A 3ZGYA 3HACA 3I9MA 4GL2A 4RF3A 3IQDB 4EQ6B 4L95C 3QWHA 2BKEA 3KX2A 2Y1EA 2ZSEA 4UM8B 4JZYA 1BEZA 1UAGA 1T1GA 1QG0A 1ZM9A 5IHPA 1KEKA 5UKDA 1KERA 2GF9A 1Q0HA 4JOSA 3UHAA 1DBWA 3CA8A 4EZBA 5I7OA 4TUQA 1SK8A 4DL9A 2VQ6A 4DYVA 4GX0A 1N6LA 4GBJA 3CSSA 3QKTA 4RZUA 3HH8A 5EE3A 1QFYA 2XICA 2W4QA 1W8IA 1JDSA 1CR1A 2WQZA 4IG9A 4U39A 3RSCA 4MITA 3LX6A 3W3AD 4PSKA 3GLIB 1N2CE 1UDRA 2YMQA 4RIIA 2IIBA 5I9LA 5LLSA 1PVVA 3CY6A 5IAOA 2YFYA 1Z5ZA 4I4TA 1IM8A 2IYLD 4B4VA 2CL7X 3FGOA 3QITA 2IDKA 5TQVA 2YX8A 1QF9A 3QXJA 1BKYA 3TCXB 4BLWA 4A0SA 4RD2A 3SYTA 1UPBA 4R7TA 3KDPA 4UBJA 5KOJB 1KQQA 5CBPB 3R5TA 3CRQA 2ZVJA 1CUEA 4C05A 2VTBB 4GX1A 3BG5A 5EE1A 1I9CA 4CMIA 4LOKA 1WW2A 5HEKA 4NSNA 1Q0PA 4G5OA 3RS4A 5CEEA 4KQCA 4D3SA 4Q7JB 5JROA 2OK8A 1DHTA 2ZAGA 3T9AA 1ZM4A 2CL5A 5IVIA 3GEDA 3PFWO 2QAGC 1HNNA 2DLNA 3DKPA 3U61B 1JHRA 1D1QA 4RWZA 3CCBA 4TSKA 3K9GA 2ZBVA 3WJ1A 1T3HA 1NURA 5KAPA 3CX4A 1ISMA 2XI4A 3OCWA 4B9SA 2KSOB 1ZINA 4P2GA 3SQIA 2KIWA 3NM5A 3H5LA 3FSGD 4GVXA 3HCNA 2GCOB 1P39A 1QU2A 2VH5R 7REQB 2F9LA 3OETA 3D3WB 2QB0B 1E0KA 3I9FA 1XEXA 3IMCA 2R6JA 1AKMA 4D8UA 5A5EA 2I6XA 1ZI9A 4KDFA 3I4FA 1A0PA 4QULA 3W5SA 2JAXA 2V9CA 4Q93A 3N97B 1P75A 1QC5B 2Q49A 2QD4A 3L92A 3DO5A 1QGYA 3FI0A 1ZG3A 5DXAA 4D9FA 3DL4A 1X8KA 1M33A 3BIJA 1PZXA 3SZ3A 3DQQA 3L49A 4P4GA 1I0IA 4IXMA 2QQGA 4L9RA 4O2BA 4YQYA 3LQFA 1EFHA 1ZRSA 1WDMA 5ICGA 2QV7A 1JA9A 3AFNA 4RD6A 3KB6A 4CLHA 2W90A 3C85A 2PS3A 3LUFA 3PC8C 1KVRA 1P7PA 2QRVB 3PS9A 2BMWA 3VUFA 4KWIA 2OCKA 4CEHA 3WL3A 3QVUA 4IW3B 4KLRA 3HEBA 4JLAA 2J5RA 2AFHE 4OL9A 1VMEA 1OZGA 4RGQA 1QAOA 1YAJA 5DQHA 1TF7A 3DS8A 1OWOA 1YXMA 1KE2A 1FS5A 1E9SA 1BEUB 3MGGA 1OSNA 5G41A 1QSLA 4XOUA 4NJ8A 1JQLB 2QTWB 2QLMA 3T9FA 1O9BA 2Y0PA 5REQB 2GKGA 3L6DA 2PGDA 1NVGA 4I4IA 2IEYA 5KIAA 2FQYA 4UDNA 5CFPA 5CX1B 4JLDA 2DERA 1X2EA 1ND6A 4KBFA 4UHBA 4YJ2A 1YH3A 5FOWA 1TZKA 2XB4A 3AR4A 2JFZA 3ORQA 3C5GA 1MMFB 3IUYA 5JVDB 4TTPA 5B58C 4J4TA 3V1KA 2GYYA 3ZVRA 3P4UA 5CGQB 1Q1NA 4BKQA 4AZ3B 5JY1A 5IH3A 2GARA 1QBKC 4IUCS 1OH7A 4HB0A 3N2YA 3F9RA 3SC2B 2IUTA 2IXBA 1E2IA 3IPCA 3D7KA 2YS6A 3RC2A 3PQ4A 2XRYA 1KYXA 3RHFA 2FPIB 3DLAA 3TNJA 1NXQA 3HA5A 3L4EA 4M89A 6GPBA 1G42A 3FNRA 3FDSA 3MCWA 3BCUA 2PPLA 3TZKA 5HF6A 2H54A 1I5OA 2C29D 5DQIA 4REQA 2Q1YA 5I5EA 4FHEA 1EVZA 7ABPA 2NO5A 3UXHA 1E2QA 3VX4A 2OV6A 5BSRA 3M6FA 1LUAA 1XPRA 2D74A 2JI7A 3K9FC 2XADA 5JCJA 4EI9A 1Y6FA 3C45A 1OAAA 4IV0A 5SZKB 2PBLA 1V41E 3MERA 1UJBA 4MEBA 4I55F 4A3SA 4F4YA 3GARA 3AG5A 3AB7A 3E9NA 3NM4A 1AU9A 1SR8A 4Y6OA 4FLFA 1UBUS 3DEIA 3HJTA 1VI6A 4U6PA 3A3NA 3SQMA 3WDLA 3EDYA 3OSUA 1AV7A 3QVVA 4MWCA 1TKAA 2QTNA 3OICA 3TOCA 3BRQA 1P5JA 4TT3D 5DTIA 3CURA 5KFTA 4H59A 1PDWA 5CBKA 2ZUEA 3QUBA 1LSOA 5C8YF 1N33B 2CLOB 1YE3A 1GCIA 2I6QA 5EOVA 4LY0A 1HQYE 2X15A 4M49A 5IG2A 3UG7A 3B5IA 4R1LA 3IDFA 3ILVA 3AUJB 2IA5A 4IFTA 3BERA 4BO9A 3GN1A 2H1FA 1S2OA 5MHTA 2K2WA 1QQ6A 1OCEA 4A8EA 1ZQ9A 4G0VA 1YB1A 4Z2AA 4P34A 2FMFA 5H3CA 4ID9A 4M6WB 1PL6A 1PWZA 3PUIA 1WCWA 2ODQA 2RHMA 4OK5A 2IUFA 2YASA 4UUPA 3FCAA 1UPTA 1T2VA 1M74A 4B0OA 1J5XA 4NJMA 2AOUB 3NORA 1O9HA 2CK3D 5ALMA 4A6PA 1DIOB 4H7FA 4KQ2A 5EG5A 5I9TA 3TCKA 2EW8A 5J2EA 1DIHA 2WF8A 4KYTA 4NMXB 1FE8A 1C29B 2Y2UA 1RRCA 4QUJA 4EBFA 3UPDA 2W2LD 4MWSA 3I12A 1W4CA 2VPXA 3FCXA 4KLLA 2W9CB 4UUOA 4P08A 3L7MA 1OXMA 2LIPA 4DJDC 2FWRA 4RULA 2QRJA 4CR6A 5FR1A 2G1JA 2QEQA 1DJQA 3A1VA 3HYSA 4Z2YA 2XIDA 2PNJA 3FNQA 3KTDA 4K28A 1BVYF 4K46A 2VKQA 5K0BA 2EZ9A 3WGVA 4DIOA 4DZTA 1G60A 3OJXA 4Y6SA 4ZXPA 4H35A 3I2YX 4W82A 3SZRA 3MELA 1EINA 5JS6A 2ECQA 1R8YA 1F5NA 4C0ZA 3OCVA 5KG2A 4LJYA 1DKLA 2PXHA 1W29A 5FHRA 3KJGA 3TG2A 2VJLA 3FNHA 1Q11A 4MVCA 3S2GA 4DJJA 5CFMA 1AQJA 2OO3A 4S12A 2CXTA 4JSTA 2H06A 4YV2A 1G41A 1T9GR 2FMQA 4F84A 4NY1A 2EP8A 3FPAA 1O8CA 3NUZA 1LK7A 3OD5A 1DJOA 4XQEA 2RE8A 4GC6A 2V6FA 1JPUA 2QR5A 1ESEA 4I50F 2ZI6A 4Y98A 3QTBA 1LFAA 3QEBZ 4RUCA 1FTNA 1LJLA 5AVUA 3C0KA 3KXPA 4RK6A 4R40A 5FOSA 4Y2SA 2BM0A 5AKIA 1G3IA 3T3GA 3S8EA 3JWEA 1YR2A 3NUGA 3CWQA 2ORWA 4FS2A 4GMDA 4AJ9A 2CB0A 5B30A 1RP1A 5AVKA 4ARUA 1E6WA 4IX9A 3FETA 1PQ4A 4HSGA 3S2YA 4ITVA 1SCQA 1JJAA 5A05A 4ZZ3A 4C7OA 4D6YA 2Q5EA 3KVNA 1J1IA 5AM4A 3HL0A 2I8AA 4J9OA 4QGFA 1V4VA 3U3KA 1SB9A 5D3MB 3EVZA 2AF4C 4GE3A 5DMHA 3VZRA 3IUPA 1EIWA 3GZNB 5LXTB 5LUBA 3T35A 1LFDB 4CDRA 1P2UA 3NEYA 3R6WA 1ZQUA 4FZRA 5B5SA 3ETHA 2QVLA 1UMCA 3RKSA 2BFBB 2JAOA 5DYWA 1PN3A 2XWSA 3IAHA 3PPYA 1X80A 2X2OA 4TZTA 2Z2ZA 3DKVA 4YRFA 1M0TA 4QPJC 2HHVA 2VJOA 4MCIA 5IDWA 2RHLA 2WI8A 1M2FA 2W42A 4HFJA 3ZVNA 1KOGA 3BQMB 1L6IA 2QBYA 1YVUA 1DG9A 4HH4A 3GXBA 3ZXYA 2X8JB 2B4KA 3KDAA 3UMBA 4PPYA 3IMFA 5JHGB 4C6TB 3RIGA 3ROZA 4ABYA 5ALNA 3EZYA 4O3OA 3QFSA 3PTLA 3UAVA 4MHTA 3AY0A 3TZ6A 3TANA 2FRVA 3EWAA 4M46A 4MDHA 1YZLA 1KJNA 5DBAA 1OXUA 4D46A 1DC4A 1UPHA 4LDZA 5FWYB 3A06A 3E61A 4LQCA 3TQTA 3ZHBA 5DPMA 3STVA 5F2NA 2OFPA 5DHUA 2LKCA 4MF2A 4KXFB 4X60A 2ZWIA 2I2CA 4CM1A 3RGWS 2Y9MB 3IR5A 5K3AA 4DA9A 3G2LA 2GKOA 3TIIA 4HDKA 5IULC 4QODA 4DLXA 5K03A 4A15A 3K1RB 1JIXA 5JAHA 1VMDA 4BBPA 1C30A 2PQ2A 5BN4B 3ENVA 4P3KA 4G1VA 3GPLA 3Q8MA 2BLNA 2I7DA 3DBLB 3GT4A 2EF1A 3L7OA 2WWXA 3IMEA 3QX3A 3E7WA 3G6XA 5LNK1 4A1FA 3N5KA 1CS0B 4LF4B 4WGFA 2YXEA 2XE7A 3ZV4A 3D81A 4BGIA 3E27A 3LOUA 2JEOA 3HY6A 1E2EA 2CXUA 4FSXA 1XO1A 3V4ZA 5B7GA 4EPXA 1M1ZA 1QG2A 1K9VF 3WGGA 5INTA 2OLJA 1IVSA 5KNDA 1DC7A 3O8RA 3KSUA 2Z4SA 1XSNA 1KJ9A 2ZTMA 1NKEA 2KE5A 1URPA 1V39A 1VB5A 2DPJA 3FCEA 4CCYA 5B3LA 4DREA 4H7KA 5CURA 1NVKA 3R8XA 5C8DA 1YMQA 4IOLA 3UC5A 5KDOA 3LM8A 2QR2A 1X9XA 1JSZA 1B4DA 5EMLA 4JR1A 3QVLA 2VNKA 4JI0B 4BXOB 3IBSA 2Y9PB 4CKBB 1P1HA 2FJ0A 2PUBA 4Q6BA 1O0SA 1WEHA 3THVA 1C7RA 3I0NA 3NOVA 1C20A 2XTNA 5CA0B 4HMPA 1C81A 1EA7A 3FYUB 1Z2PX 1SUAA 1DQSA 4OXIA 2HWWA 4KLSA 4FZVA 5MN4A 2CXRA 4P82A 1JH9A 4FZ5A 2AW3A 1JHZA 4HXYA 3ZHCA 1DQZA 4FGKA 4ZCMA 2GHTA 4RBNA 3PICA 5EWEA 4PWZA 4HGRA 2ZYTX 2DULA 2XOKD 1H22A 3PJDA 3TN7A 4XIGS 4XLLA 5AVTA 2DQSA 4OK3A 4TMKA 5AIAA 2CMGA 4MQ6A 1RXCA 1V4BA 3UB3A 4CGYA 3FGZA 2C20A 3K7EA 1UCVA 4Z54A 1EG7A 3DHWC 2WAOA 4NMLA 2E48A 4JBWA 2PSFA 1BHJA 2WVJA 3X1MA 4JKYA 1EFRA 1T6XA 4EDFA 3PX0A 3HA7A 3VH4A 3LDUA 1U4BA 2QL5A 3HJNA 1G7TA 1ML4A 3PXAA 5A1TA 5DM60 1ACLA 3NDJA 4CRXA 3GROA 4WZAE 2VDWB 1ZLYA 2ATIA 3FZNA 3HNPA 2IL1A 2WNIA 3L7YA 1HA3A 4UPVA 4PXYA 4AQ7A 3OIGA 1Y82A 2HHJA 1Q6ZA 1S9FA 1QGZA 4D92A 4WA7A 3OUUA 3O1LA 4M55A 4HUQA 2OWDA 5FI3A 1ZFNA 1ZHHA 3HWWA 1ADBA 4M0MA 4AJPA 1XTRA 1WD5A 4LGCA 1CNFA 4OJOA 2Y1DA 2CMKA 4ZYUA 4KXYA 4DXHA 2HHWA 5LD2C 4BWFB 1IY1A 2A3RA 2IVZA 2QZPA 4IH1A 3VKHA 1BWPA 4F4WA 1NXXA 3GL9A 5HRCA 4HDMA 2VTDA 4IIBA 3W9SA 3T34A 2H3QA 2J5QA 4OH7A 2OFFA 1COOA 3DBIA 3K0HA 2RQ5A 3Q12A 1Q3HA 3U31A 1OB2A 5HHHA 4DWOA 1UBEA 4RKQA 4QUHA 5B3JA 1T6NA 2ZAOA 3O4VA 3D6HA 4NI5A 2VCEA 4HRYA 1IQ0A 1UPUA 4IHJA 1AHPA 3N8IA 3D0RA 4KDCA 3AHGA 1N5OX 1D6NA 1S10A 3CXUA 2RAVA 2I2FA 2VQDA 2HX1A 4IH9A 5TISU 5KFJA 1IK4A 4HEA1 1JJ7A 2JFVA 1WTCA 2QRZA 3BFKA 3VAZA 1DXSA 1BVHA 4YK7A 4HN4B 3HT3A 5FJJA 5FAXA 5CDUA 4N7MA 5CT9A 4BATA 1KBOA 3S1LA 1GG9A 5TDHA 1URJA 2ARKA 4S1NA 1V8ZA 1EFVA 4HTAA 5HIIA 2O5RA 4NYIR 2N75A 5JXIA 4MUXA 1T10A 2HH9A 2EJCA 1SEVA 3SU8A 3T3HA 3PGXA 1GPWB 2MAXA 4F5OA 2V5UA 4Q39A 4ND8B 1L0BA 1KI1A 3CVOA 1K4MA 5LP6C 3UQ0A 2HLPA 4CEIB 4MW9A 3PHHA 4OQEA 5A6SA 2PFOA 2HW8A 2QIOA 2VG8A 1P1JA 1T7PA 2BONA 2RHBA 4B8WA 3T1TA 3AMVA 2NV3A 3M5CA 3KVYA 4RVDA 4F4JA 3WK9A 1Q57A 1DTSA 3VSDA 1S76D 1RYYA 2D2XA 4A0HA 4WW0A 3H8SA 3ED5A 3STYA 4H2DA 4DB4A 4XIJA 2HD4A 4KPFC 4RZSA 3FYSA 4LHSA 3G17A 2GCPA 1YFJA 1GQ2A 1XZHA 3TKLA 4B9UA 2GK4A 1ZI6A 1CQIB 2HMUA 1T8SA 2AGOA 1KXJA 4DCMA 1ARZA 2GEDA 5PGMA 5CXUA 3OGUA 2P6MA 3RRHA 4J7XA 1AKUA 3QBDA 1KAEA 5F3WB 5G53C 4AKGA 3TRIA 5E4YA 4OU5A 4EYKA 5HCUA 9ICXA 1B16A 4X1OA 3C2QA 1OZ0A 1JDPA 3RNOA 5EERA 2AQ4A 5KL8B 2NPFA 4ZAZA 2X6RA 2Z2XA 4XGKA 2VOJA 4LPSA 1AD2A 1P33A 1ZQHA 5IYZA 3C6MA 3L04A 1RHKA 4OB7A 2QTVA 2WF9A 2G36A 1NMEA 4YQZA 2VPYA 4MUGA 3O4IA 1X39A 4B80A 1YS6A 1E63A 4RS4A 4NDNE 4ZJZA 4I1OA 4FSHA 3GUZA 4E4RA 1V3VA 3FVTA 5BSHA 3IR6A 1ODJA 1R0ZA 3WR5A 2VJMB 2W04A 3G6VA 4HDCA 1RZRA 3OEWA 1TMKA 1GU0A 4J2OA 1V11A 3NAQA 3TOSA 2P1RA 2Q3HA 1ODFA 3EC2A 1XRMA 3GB9A 3SR6A 3IMKA 4YECA 1FJGB 4ROTA 5HZMA 4B31A 2NXJA 1F9EA 3ALRA 3TQCA 2R8EA 1Z3IX 1VJDA 1ZL2A 2WAMA 4WHMA 1UC8A 5K3EA 4BX9A 3RFTA 3ESRA 1OBOA 1X14A 1ZSNA 4ZCSA 1XDDA 5L9XA 3BMOB 5HA5A 3T54A 3TKAA 2EAMA 2HYDA 1JLLA 2AOXA 3GGDA 3EOZA 1KKXA 2MINB 3DFFA 4L7VA 4Q7EA 3QEKA 2Z58A 4LJKA 3SS9X 1U1FA 2H17A 4RTKA 3VU8A 2J5KA 3AJRA 1KJZA 2FK8A 5FPTA 3NYQA 3CU5A 5TV2A 1Z0IA 5SZIA 2FRDA 3W5VA 1IIBA 5I4IA 2AI2A 1EK1A 4FR2A 2CBZA 1XELA 1FCJA 4UAWA 2C3YA 4TUYA 1P18A 1VRVA 3G1TA 1PJSA 4IF4A 3LA8A 4MS3B 4JU8A 3W4KA 1XMQB 2BI7A 3L0ZA 5CH8A 1DAFA 9ICIA 5FPYA 3RCBA 3U4QA 3UH0A 3QEMB 3QXGA 4RLFA 5IC5A 2G77B 5LB4A 1M6VB 4WY5A 3Q6NA 1JU9A 4TGLA 4JHXA 5J0XA 1GGKA 1NW6A 2Q4BA 3BDAA 3HB5X 2VNJA 1ZPDA 1PT7A 3X1XA 3KEQA 4IDEA 3L0CA 4BX0A 1Z56C 3LLVA 4QZHA 5AVVA 5CM9C 3O8CA 2Q6KA 1K7CA 1GZUA 2XVZA 5DYIA 1FNCA 1QKKA 3RH0A 3ONEA 2HHCA 4DSOA 3SD7A 2FLVA 4XSGA 5GWXA 4UC0A 3ANSA 3H75A 5FFNA 3TZHA 2XQKA 1NRIA 4EVQA 1AB5A 1YQXA 1OREA 1Q7GA 4UHJA 3JR3A 2IYQA 1RXVA 5JJIA 1NONA 5B53A 3SJUA 2X5KO 1R00A 4PYLA 2HUNA 5DB7A 5FTWA 1G66A 1JBKA 2Y2VA 1AUOA 4QEKA 2P27A 2R6HA 1QJ4A 4PG4A 4KNYA 1BA3A 5KFGA 1YB7A 5I47A 2ODBA 3H4BA 1BMQA 3KD2A 4CU5A 2LXNA 5JZ9A 1UJNA 1T1IA 3H18A 3O4GA 4OB6A 4G5FA 2OKGA 2RK3A 1Q95A 3D3QA 2Q45A 1BPBA 3G0IA 1Z19A 4CZ2A 3HV0A 1XZDA 3EIOA 1U0RA 4U7CA 4M8LA 3U3RA 4Q8FA 4YP5A 1H9CA 1Q46A 5TSDA 1EDZA 2HU2A 3E8MA 5DZSA 4CIBA 5JDIC 5IVDA 3BWBA 3FCOA 2BHNA 5KNIA 4MR7A 1MRSA 1R4MA 4D8WA 4Z0TA 4OTZA 1EPUA 4N9QA 3NJ8A 5F9LA 2D5CA 3H42B 2O2XA 4WEQA 5K0ZA 4WKBA 2QW0X 3L06A 4DLEA 1PI3A 4G09A 3BEDA 4IFBA 3HTXA 1Q0UA 4UEKA 2W4MA 1OBFO 2HZ7A 3AF2A 4KZPA 2H4FA 2EL9A 2JLUA 3NUQA 2H3HA 5CDTA 2XYPA 3JSAA 2RHFA 2C83A 3HP1A 4EARA 1SKAA 4TS4A 1D09A 3RJKA 4Q1BA 1OJLA 4O0IA 5FIUA 3W4JA 5FBLB 1Z4IA 4IUYA 2QVCA 1SHKA 1USVA 2QUIA 1C7YA 4NZPA 1XG5A 1XLVA 4PS1A 3PPXA 1QP4A 1W88B 3G3EA 2FSUA 5C80A 3CIOA 1SZJG 4D4JA 4LRWA 4ZP1A 1FOEB 5KREA 1Y3FE 3HPQA 2PZGA 5ELMA 2WFMA 1EGVB 1U9YA 2HRBA 3SV4A 5KYWB 4IEFB 1CX9B 4U2BA 2IOHA 2ZJYA 2NXNA 1HG1A 4I19A 2P62A 2P7HA 3FFAA 4FOSA 2PZEA 3EIWA 4UUMA 5DTEA 1QB8A 1CUWA 2AK3A 3STXA 2WZQA 2F76X 4E7PA 4UAYA 2WF7A 3NP9A 1I9GA 4Q12A 1RYFA 4Q45A 1RBYA 1EUYA 4XWOA 2R87A 3Q0TA 3RAEC 4YCSA 2FE9A 4LTNA 1E9RA 4J76A 1XVTA 4M1KA 2KNJA 4L4YA 3O3MB 1TAGA 1EXWA 2R8ZA 4LQDA 4N47A 3OZWA 3WLOA 4KLEA 9ATCA 4A8JC 1FQOA 1UXKA 3OCUA 4N6NA 1JDBB 1OYYA 1HOXA 4EI8A 4R1MA 1QFSA 2BEWA 1V25A 2EERA 2ZJ5A 2M9NA 2LYBA 1WWVA 3PQFA 2UU9B 4IIYA 4LJ6A 4KR7A 2ZB8A 4O59O 2J6CA 2YS7A 1ZXXA 1WIWA 2XT9A 2C4HA 2J30A 3O31A 1PV4A 4R64A 4GAEA 1GP2A 3ELBA 5JSZB 1R10A 5L1MA 5K3OA 2PSJA 2H11A 3MABA 2Q8NA 1L5KA 3B38A 3TPCA 2D3WA 3HFGA 1E61A 1U65A 3W3ZB 3D4PA 2QRPA 4J4HA 4ZGGA 3GEIA 3DVRX 1HJPA 3TMAA 1MO3A 3TFRA 5FBVB 4F2HA 4QL3A 3HO1A 1V4NA 3RLIA 2E1FA 4N41A 2TSYB 2W48A 2YV2A 3ZCUA 1O95A 4RQ2A 1JQ5A 2RONA 1SIOA 2I99A 4E22A 3AM5A 5IMSA 2A9FA 5K3BA 1ID8A 4P5PA 2FLKA 1NJ2A 1X9MA 4RPJA 1NRXA 4IQFA 1DSSG 2YC4C 1OKKD 3TR0A 4JK3A 5C7IO 3RJEA 5IINA 2OCDA 4DN6A 3L0IB 4HDNA 1MFZA 1G8SA 2J8ZA 1WKVA 1XS9D 3ZTWA 5LP6B 3X2EA 3VA7A 4QGHA 4KWEA 1BE6A 1T3GA 5ER6A 3ZDZB 1QO7A 2FH5B 1K06A 1C0LA 3NBAA 3GRKA 4BRZA 4DHEA 9ICFA 4L85A 2HBRA 5EHNA 4NPCA 4E0DA 1CZLA 3KR2A 4BDPA 1J24A 3BJMA 1F8YA 3GVIA 5SICE 4ED8A 4LYHA 1V7CA 1FRNA 2HTEA 1KYZA 4GPTA 4FHDA 5D87A 3AERA 1ZQMA 3R2JA 1K3UB 2I65A 3B9BA 2IQ5A 4C4TA 2FUNB 3WLAA 2BZSA 3COYA 1SKQA 1YCDA 9ICRA 1M2KA 4UNSA 5DB6A 1U8EA 1Y33E 1E3LA 1IZZA 2H7VA 4C5AA 4ZYWA 4JJ7A 3UHFA 2NAFA 3NVWA 3JWPA 3LQ1A 5FTJA 2P4QA 3ZXUB 4TLEA 4F8RA 3ROXA 1KJYA 5DDIP 3O8OA 1I7DA 4QARA 5FOVA 1SVNA 3OZDA 3LNCA 1FNNA 5K0TA 4NLKA 3DFKA 1QIIA 1XSPA 1F20A 1WY7A 9ICSA 1J49A 3T8YA 1USIA 2J3EA 1PEYA 2DL0A 3UMFA 3KSZO 5BUSA 3CKYA 4IX1A 4D4MA 1JALA 5FR2A 4US8A 3UNXA 3GAFA 3B2EA 5IM5A 1IOWA 2ZYDA 5I7VA 1SKBA 3W8FA 4DUGA 1Z9BA 1PT5A 4C6RA 1Z6GA 4YQWA 2C3PA 3FE2A 2Y1LA 2WU3A 5DHRA 5B57C 3PUHA 3BMQB 4BMCA 1ZSVA 1BW9B 3VVCA 5CEJA 4HWGA 4NCXA 5HWSA 3C5VA 5CFNA 4OMUA 4PW0A 2JVKA 1MTZA 5TGZA 2O2GA 4QUEA 3UVEA 1DWOA 3PR5B 2Q2OA 3FUUA 4DEYA 1YAHA 2EAUA 1N2OA 2K8BB 3JQAA 5LZ8A 2DQ4A 5GP1A 2HOFA 2R8XA 3KT8A 3EY4A 5ESXA 3VHXB 2EQ5A 2ZANA 2WMOB 2ROQA 1WMAA 3H6HA 4YMIA 4M9LA 1RABA 1Z68A 3R3WA 5CTJA 3KKMA 2B4AA 3GUYA 3O74A 2IPLA 2BEUA 4HO1X 1FNDA 2ZSIA 2AJDA 2ZIWB 5FD8A 3KUUA 5TPZA 2A94A 3SWWA 1ENYA 4F92B 8ICTA 5CNJA 3VR3A 3KFXA 2NUAB 1ZJMA 1YB6A 5EXTA 1JWAB 5EXDA 1OLSA 3C5WP 4R81A 2UVPA 5KNBD 5IWAB 3TXAA 4P98A 4EHLA 3VTZA 4YRZA 1WHTA 3M6WA 1G64A 4D9EA 1EDDA 3UYKA 1JHPA 3STHA 3MN1A 5F9FA 3ZWPA 1L8XA 1GTL1 4AG3A 1I4TD 1Z7EA 2WT9A 4KBYA 4B4WA 5HKKD 5DT9A 2C4KA 2W6OA 5H7XA 2A9VA 1S89A 3TVTA 5HVNA 2FETA 2N46A 4TVBA 1HLGA 1L5NA 4GKAA 4KMUA 4F71A 3LHSA 1FVHA 1OI7A 2PH3A 2PS9A 1QVZA 3H87A 5DMXA 4GVPA 5EL0A 4F5ZA 1TEVA 1BVUA 2Z3ZA 2IPOA 3RSGA 3CPJB 4V0NA 1BH6A 1KH2A 1Y98A 4V2UA 3WIUA 2PWZA 1SIBE 4KL8S 5AMXA 1D2AA 4U3JA 3LF1A 3E1GA 4LVOA 4C78A 1JV2B 1LWNA 3G85A 4QIWF 2H2IA 4K5QA 1ZGZA 1KZ9A 3KUCA 5BSEA 1I3KA 1VOTA 4JIGA 4LSGA 5JBQA 4X45A 1Y1SA 2WY2D 4BLRA 1ZJNA 5A1JA 2BJVA 3OJEA 1X74A 4UUAA 5F78A 5JJ5A 1ZD9A 1TF2A 2A86A 2NO0A 1Y42X 5ADUS 2J0QA 2PWYA 5L7YA 5CPBA 1WKBA 1RT9A 4RDIA 1T9KA 2YHUA 3M3HA 4BU1A 1Q2UA 3ND7A 1RRVA 3IP5A 4MR9B 1CRWG 2DE0X 2WPNA 3KAQA 5AVQA 1KTQA 2XCRB 2OFOA 3UFBA 3G5UA 1HYGA 4YLYA 4FQ8A 5H5JA 3THWA 1KI9A 2YJZA 4F5PA 3OT1A 1WM1A 1SG6A 5AM0A 3A27A 3NVMB 4QHTA 8OHMA 2JIRA 2MU1A 2RDMA 2PXIA 5ICSA 1JVNA 3PYMA 4RYDA 3R6GA 3NG1A 2EBFX 2P75A 4Q9HA 3L6BA 2Z6AA 1IMJA 1JR3A 1JQ3A 3N39C 5ARCA 3PWTA 5KFBA 4I9GA 3CW2C 2UKDA 3NTVA 2OR3A 2ASDA 1GGNA 3OZCA 3FI9A 3BE4A 4OLFA 2HA2A 4F45A 2V98A 5K8UA 2PKXA 2YZNA 2QARA 4ZVSA 4AG6A 3RBAA 4NL9C 2BBOA 1ICEA 5K8TA 5IBPA 4XB6B 4BCDA 3AJEA 5AR1A 3VPGA 1EP2B 4J0DA 2GESA 3ANTA 2FW6A 2FSPA 1FDWA 4XIYA 2HBJA 1KSHA 4ZGBA 1A7AA 3I2JA 2GM9A 3R09A 3VR1A 2W6JD 2DGZA 2ADFA 3M6MD 5C7OO 1LBQA 1U81A 4K03A 3IDQA 3RVNA 4GSLA 2YBDA 1SHZA 3HJCA 4IZIA 4KP7A 3AEXA 4PLGA 4DQVA 1JLHA 3AZOA 4FQ5A 3CLHA 4YJGB 2YWGA 2GPBA 4J0QA 5K3DA 3IURA 3T5TA 4I8XA 4DLRA 4QNNA 2ZP1A 2KFNA 4BNNA 3HK2A 3EFOA 1IY0A 1E2UA 3WYAA 5GINE 3NC1C 1LI5A 1RQPA 3F6CA 3U16A 1YZ6A 7ICSA 2M98A 3K1AA 3WGUA 3SVLA 4PJ0U 3AKEA 2Z2IA 1YB4A 3B6KA 2PL5A 4A8JB 2XVXA 1P1BA 2B83A 2FLNA 2PUJA 4PTYA 2JEZA 3NTUA 3TRDA 2P9JA 4XB1A 5BSTA 4I5FA 3O8QA 1KO5A 1ZRMA 1T1EA 3GRUA 3ONNA 2FK7A 3HXMA 1EXNA 4BUJA 5BMOA 4H17A 2EGUA 2BTEA 5EMMA 2ONZA 5EKSA 2JJ2D 4G5QA 3B20A 2IWRA 4EUFA 1PR2A 1AN9A 16PKA 4DV2B 2D5BA 2VWQA 5KWEA 4PRZA 1YCFA 3FA2A 3FYTA 2ZI5A 2AFIB 4BHTA 3GDHA 1GQYA 1G59A 4IS3A 4JVMA 4AXXA 3H04A 4O3QA 5GONB 2J7KA 1E64A 1IZYA 1CEZA 3MINB 2QMEA 3TM4A 1QOQB 1HZJA 4GR5A 4OQLA 2JGDA 2R5NA 4HN2A 2ZT6A 4AYWA 5T8KC 1TM2A 1LLDA 3TAPA 2XMZA 3A14A 1W36C 2PCLA 1TQ2A 2VJBA 4ER3A 1H2AS 2C9ZA 2C5EA 3THYB 4JFRA 2Q2QA 2BDTA 5JNLA 1DCKA 3NP7A 1IRIA 4GGMX 3QMWA 1FSGA 4LJ5A 1RPTA 5BRAA 4C43A 3P8ZA 1XZKA 1LSUA 5D49A 3ZE6A 5BUCA 1BYIA 4CIXA 3IHKA 3HCOA 3LX5A 5TXGA 2FR8C 2VJ5A 2QP9X 4MRMB 5JCPA 3VI4B 1US8B 2YICA 4R31A 2OL4A 5K6RA 2AJBA 2WTMA 3UTCA 3SQNA 1RZ3A 5DT2A 1V16B 4HTFB 1J2MA 4V0RA 3SCZA 4ZPJA 3ZW8A 1D4ZA 5BUZA 2OZVA 3QH4A 3AR2A 1MDFA 3SG0A 4EHBA 2A1TS 3VNSA 3JR7A 1KO4A 2I3AA 2XGMA 3V32A 4E2XA 1CLEA 4D2IA 1LF0A 2WPDA 2POCA 1NW4A 1UWVA 2CE2X 1ZL0A 5C4IA 5GJWC 1E1DA 1XHFA 5LUAA 4LV8B 3F7TA 2CJPA 1KAHA 4C29A 3K1YA 4BUZA 1ZEMA 1JQDA 1JKJB 4TS1A 4J03A 1FUIA 4GOKA 2I1LA 1P62B 4LDPA 3ICQB 4DDMA 1VXOA 4JODA 2KYRA 4HLUA 4U7TB 1HDXA 3DULA 2QD1A 1WABA 4IIJA 3P94A 1E3QA 2VTKA 4QPZA 1HE5A 3UAWA 3BGVA 3DEYX 5LMCA 521PA 2YNMA 3CG4A 1RZUA 2BOVA 3E05A 1Z82A 3BVPA 4R1TA 3BCSA 4PZPA 4MV4A 2PT9A 2QE7D 4CVNA 3FSRA 1GGEA 1VDZA 4W4TA 4Y2JA 3D2CA 3WWDA 2AE2A 2DWCA 4M53A 3SXUB 5HFJA 4Z8YA 3WYNA 1LKZA 4TWBA 4RSRA 3JQEA 1M9NA 1VL8A 3H2BA 4U7WA 1HBJA 5LLDA 2ACVA 4Z9YA 2AOWA 2GA9A 2A9JA 4XQ0A 5LQMA 4HPJB 5DI3B 1X77A 5JG7A 3M9LA 1C7EA 5EMHA 4DMKA 5ITWA 4A03A 5CH3A 2NOAA 5H68A 1MNQA 3ZPXA 3PC6A 1JLMA 3NBQA 3K6JA 1RAIA 3EJWA 3KLBA 2NACA 3NWPA 1GTZA 2QR3A 5DWQA 5ITZA 2M6RA 5AVYA 1E5DA 5FPQA 4B7ZA 1YZNA 2JF0A 3ICCA 4YJ3B 3GNTA 2Z1MA 4X94A 1U2GC 1Q8KA 3SSOA 3TW6A 2FWPA 2IXTA 4ED7A 5G02A 4P0PB 1RE1A 4L22A 4RPHA 1WUHS 3D7NA 1QZXA 3ANYB 3OCXA 3RFXA 4FMDB 1QHIA 4R16A 3KWMA 3WMGA 2XT6A 4ND2A 4ZN6A 3M1LA 7ICKA 3M3PA 4OQDA 4HX2A 3B6ZA 3GAAA 3LWLA 2C5SA 1YUMA 3T0GA 2JDID 2D8AA 4MGEA 4GMHA 2PH7A 3DG9A 3BH7A 1G5PA 1O94A 3JQFA 5I9MA 4XWYA 1QVWA 3SEAA 4MJLA 5FJIA 4ZQFA 3MWEB 2RRDA 4F8JA 3OQNA 4XARA 1T5LA 3NHKA 2GX6A 2YY6A 2YOGA 1SB8A 2WIDA 4AJNA 1BPXA 3RREA 5G0TA 1M1XB 4L9SA 4MFCA 1I1NA 1NUHA 3CB2A 1DQNA 3REOA 3L43A 2WTNA 1W19A 3OOWA 4CQLA 2AUNA 3MHPA 1II8B 1BPDA 2BZ1A 3QW2A 2QSYA 4DY4A 3D6AA 1KDTA 4J3JA 1XC7A 1MNAA 3ETNA 5LFAA 1NW8A 1NQ5A 1X3LA 3U7QB 1M1YA 3X1ZA 5JQGF 3S28A 2JAPA 1ZOOA 1V96A 2GD0A 1KJJA 2PIDA 4GLFA 4UBCA 3ADPA 2VPIA 3OIDA 2WIKA 3PUZA 4PHAA 5DB9A 1Y9DA 5F35A 5HJ5A 5ARBA 4JI4B 1TC2A 5BV7A 3QE4A 4Z4FA 2NTYC 4B1FA 3VZSA 2A5DA 5TS3A 1YIDA 2FEOA 3N58A 4DCCA 2W6ZA 4ZO6A 8MHTA 2J33A 4GFJA 3BK2A 5BOLA 4HT3B 1N0UA 4UZEA 3EDRA 1U2DC 2ZE7A 5EZYA 3KSBC 3VU9A 3QVTA 4J7AA 1CUDA 1ULAA 2C8KA 4OLHA 1J8FA 4ZCRA 3TCNA 3VBCA 4L8GA 1TYBE 3RV4A 2ZSJA 5A71A 1SUEA 1F0KA 4JP1A 1QG4A 5T5QA 2ES6A 4LVCA 4NBUA 1BX1A 1SK9A 3RIYA 2YB4A 3A0HU 4OO3A 4EG0A 1XEFA 1TK9A 2QP4A 2JD2A 1XN4A 1R5JA 5DIZA 3INGA 3Q7RA 3RB0A 2PXCA 2EZXA 3QZUA 3DB2A 2EOAA 3LBFA 3D2BA 4PNHA 3RJ5A 1D4OA 1JQKA 2DSNA 2C9CA 3KHKA 1Z7BA 4YAWA 7ICNA 1EWVA 2I3ZA 3KALA 3BZCA 3G0CA 3IKLA 1L3TA 3ECCA 1SCIA 4JMUA 4O2AA 3R7FA 4WH0A 3D54D 2J9FA 4D57A 4P0QB 4TM8A 2VDKB 2QRGA 1B14A 3U5ZB 1RJWA 2GN6A 3WYBA 2PHZA 3GLQA 1TTQB 4EY6A 3K8OE 4NBLA 2VHZA 1OAOA 3DZIA 4QW9A 4DPLA 3V8RA 3DKIA 1VE7A 1M76A 3GFOA 1P4GA 1N5KA 4DG5A 1D2HA 3A0BU 3BJYA 5IN5A 1Z3EB 3X1DA 5DM1A 3ET4A 3K6KA 2AE1A 4G5YA 2LBOA 1A97A 1RHJA 4FGLA 5GVRA 4QUIA 3URKA 4M8IA 2B7LA 4WIAA 1PQPA 2A33A 5BT9A 2VAVA 1V45E 4MX8A 3RG2A 3ZX4A 3T3EA 5KAFU 3EJ6A 3CIFA 1U0LA 3JATA 1XAGA 4OP1A 3I76A 1CDEA 3PNKA 1M72A 3LJKA 1M7BA 3UWPA 4OHMA 2BEKA 3LFUA 3PF9A 3SJZA 4ZOEA 3G5TA 4JEHA 3RF6A 5E0KB 4RL6A 2F00A 2AOVA 2W5UA 4MUKA 1B8VA 5CHYA 3X43A 5EUQB 3HB1A 4XPIA 3OHSX 1R18A 1OUQA 1AKQA 3NDIA 4N3BA 4E1BA 3ZD8A 2WD8A 4RY0A 2QAGB 3FNFA 1N9ZA 1BAPA 3I01A 1XJCA 4UAVA 4LXHA 1H4SA 4YRRA 1CF4A 4HP8A 1NIJA 3IH5A 2UVRA 2YMMA 2QPTA 2BJHA 3PUKA 1IEVA 1I01A 4BZXA 4CI9A 4MS4B 2WD7B 4BZWA 4DZZA 3JPPA 3M3DA 3CC8A 4FMBB 1YOVA 3T0IA 5HTOA 4RY8A 1PTJC 4JA0A 3EEFA 3WL4A 4JX8A 4POAA 4KLTA 4R6WA 2FV8A 4BEBA 1JX6A 2ZIXA 4I3FA 1PD0A 1XD2B 1I2DA 2PL9A 2Q5IA 1NBMA 4NMMA 4YO8A 1W96A 2KLHA 1MZPA 3AEYA 5CGZA 2C98A 5EN4A 1MIOB 3CJRA 4US2R 3IJPA 1Q50A 4HHEA 3GA5A 1Q0QA 4WXRA 3OM0A 4W5JA 3N2GB 5B1DA 1T3TA 2PS1A 3FMOB 3O8NA 1BJTA 4W5QA 1NKSA 2GWSA 5KTNA 3O7WA 4FYYA 5CIYA 5J5AA 1VA5A 1DT5A 4RAQA 1JFFB 3PO4A 2O20A 3MTGA 2G5GX 4R7GA 3DHYA 2V6JA 4Q05A 4JMLA 4ZALA 2FJPA 4HZUA 2OLKA 3HKDB 4LWOA 4I3GA 2VA8A 2TMGA 2GT1A 4WESA 4LY3A 2W0SA 4EJ2A 1MRNA 2QN6A 2PQMA 3BHJA 1G21E 4GBMA 1WZNA 1K1SA 4MR8A 5DISB 2P35A 3DDUA 3UN1A 3AKCA 4FOLA 1LVGA 2CVOA 1EYZA 4PG6A 2BEVA 1SHUX 8ICWA 3KYCB 4MI6A 4ECXA 3AF3A 2AB0A 1C41A 1Y4DE 1NLUA 1PWYE 2Y3IA 3RLFA 3ZGVA 3D8RA 4CLEA 5KC9A 1NDUA 2ZTCA 5KFPA 1EMDA 2IYYA 2BDPA 3SE7A 1O7JA 1WOYA 5E1BA 2C97A 2IPXA 4IP0A 2J9ZB 3DTVD 3TD2A 3LPNA 2D0DA 1Q1EA 3L84A 1EFUA 4V1CB 2NZJA 1UFRA 3O7MA 1QHFA 1Y3IA 4I2CA 3BMCB 4OP3A 1MXFA 1RHQA 4TTVA 2C31A 1SQSA 3EPGA 1FLDA 4ZOQI 1P8JA 4O5KA 3H4VA 2BGUA 3ZEAA 3RJGA 1UT8A 2CUTA 1UC5B 1U7TA 1KEUA 4BUGA 4DRYA 2JH8A 2ZWMA 1IJBA 5KVVA 2VOEA 3PQ7A 4OA8A 3OIWA 4EY4A 2CB9A 4YO7A 3RYFB 5EJEA 2LCIA 1U8AA 4KYUA 2C7GA 4F4ZA 3JQ8A 2BWJA 1G6Q1 1QIGA 1DBQA 1JFTA 2JNWA 2PMCA 2HNBA 3NB0A 4RQTA 4KQEA 1VGRA 3C1YA 3JQ9A 3ZY4A 1MU0A 1HO3A 4H15A 1KY4A 1RXSA 1S3SA 1UBTS 3AG6A 1P3DA 2O8BA 5C1IA 3ON5A 2BTQB 4TRJA 1MSWD 5DK6A 3DE4X 4MW2A 4DWVA 3O84A 3JARA 4IEEA 1ODKA 1PVDA 4DQIA 1P45A 2IUYA 4FX2A 3W6PA 1PZGA 1EFCA 1H3NA 3R3JA 1FW8A 2YHIA 1VYTA 5LOVB 4YUVA 1J2UA 1RBZA 1GA1A 3DO6A 3KT3A 4BP8A 1SURA 3ZOKA 2IY9A 3SHVA 1P3JA 2G80A 1D6MA 3VDNB 1AN0A 1YR7A 3D6NB 1NR1A 3ROGA 4BVHA 3GT7A 1XMVA 1UM9A 3DAPA 4D9CA 1EA5A 2BFFA 3IV6A 1E9CA 3FWYA 1KN5A 5EEHA 1MGPA 1MO5A 1G1MA 1N6KA 3I8XA 1Y34E 4N48A 3WIVA 1RKUA 1T6YA 3FTCA 5HOEA 4V0KA 2J6UA 5B3KA 3P0IA 3L41A 1SCJA 3WGNA 1CUGA 2WNSA 4JKIA 3EGIA 2V7QD 1TK0A 2JK0A 5FA5A 2ZSAA 3EBPA 1JILA 1G2PA 2VDJA 4JUAA 3C8HA 3IPYA 2BQRA 4ZTBA 4KSCA 3RWBA 4PLPA 1S9DA 4EFDA 3FMGA 2OOSA 4KUEA 4NK4A 2D13A 3DD5A 3DE2X 3EH1A 2BE7A 1YZKA 4G9EA 3WXBA 2YCBA 5CB4B 2HCBA 5CK5A 2PYZA 3JSXA 2C2WA 5KFEA 4BLPA 2RI1A 1EDEA 4RPCA 3OF5A 2DUMA 8ICJA 3K30A 3ZN2A 2E5SA 4HYTA 2FUEA 1MENA 3CG0A 2RCNA 4XWGA 5EA2A 3V00A 1CJBA 5GM2A 1C1YA 1QK4A 4BKUA 4Q8EA 5HDBB 1WXDA 5BXQC 4BNTA 4ZK2A 1U04A 4A8HA 4RKRA 3BIFA 5TGTA 1WP9A 1A9QA 4ZA2A 2OV4A 4O4LF 2O0HA 1CVLA 2H9IA 3S5UA 1R0KA 2HHQA 4YBZA 3RR7A 3BGSA 3ELWA 1Z2CA 1E6MA 3UC9A 1UA1A 4PAGA 5AW6A 5EZQA 1GZSA 3MMPA 4N0PA 4ACOA 4F3CA 3E58A 4FKZA 1N63A 4ZOLA 1KGSA 1CY1A 2EWVA 3OE7D 4D8TA 5KG3A 2ORED 5DGXA 5K0LA 2Y0CA 2XLBA 3ZKWB 5H9VA 1TT7A 3GX1A 2WKSA 5BWLA 2XX3A 2HHSA 4W5HA 1RTKA 4CMKA 4O33A 5E3HA 3WTBA 5IXJA 4BVJA 2ENUA 2CBGA 2DBQA 1Y1PA 5J23A 1QV9A 3KDSE 1X7GA 1I7QB 3R6TA 1EJ6A 4MV8A 1PL0A 5LC1A 1F60A 9ICEA 3C3KA 1DDGA 3O2QB 2JR5A 5I9NA 5EWLA 3CNBA 4QOEA 4JK1A 2X1MA 2YWRA 3AESB 2VNHA 2GAOA 5KSWB 5AK6A 1AS0A 3U39A 1P80A 5IT0A 1PT9A 4EJ6A 1RFGE 3GEPA 3CE9A 3AR9A 1G5RA 4R8LA 4OUDB 3ZCPA 1RZVA 4OYHA 2FG7C 3V7WA 3OQPA 4ICAA 1PVRA 5LQSA 2FZ5A 2LNDA 1FP1D 3KJIA 3GHHA 4PZCA 3HRDD 4OI1A 1AK1A 5FADA 4G89A 9ICQA 1GKUB 3WLFA 3N7SC 3KQVA 2D59A 3E5RA 1PLLA 3GGSA 4GZLA 3RJMA 2X42A 1RCTE 4KMOB 5J8YA 3KR1A 3X1JA 2QSJA 1UDBA 3RADC 1TDJA 3UW1A 3A0UA 4KWHA 4EG5A 4TUSA 3UJ9A 1V3QE 3D8TA 1ZRHA 3MTEA 1F4LA 3WOHA 3VO9A 5AI4A 1VBMA 2JJ8A 4ZYVA 4QYXA 4RXTA 2C7PA 4CE6A 2UVWA 3SX4A 2ZR8A 1QAMA 2N3ZA 2O6HA 2QV0A 3GFVA 2A3NA 4JFAA 4JVNA 2BFNA 1XF1A 2ZCJA 3FOEC 2MOKA 1IY9A 2OBMA 1L1FA 1WCV1 1P9NA 1MAWA 1RHRA 4ZEXA 4FBTA 3PD7A 2OCGA 2O5VA 2QS9A 4RK5A 3HBNA 4YMHA 8AT1A 1P6XA 4O8CA 3KAPA 4YRSA 1FJHA 2R7NA 3F1LA 4D42A 4Q3OA 4QOSA 1YRYE 3SYMA 4PYJA 1J06A 1QGDA 1RLIA 2NZ2A 8ICOA 2HGSA 1XQVA 5DO9A 3RRZA 2FX2A 4DG8A 5DCYA 1SOVA 4DABA 3H5TA 4U2GA 3JQ7B 1BJRE 1TM7E 2DUJA 3R0QA 2MSEB 5EZ5A 1TTTA 3MFYA 5AM1A 3PPWA 4L2IA 2AFHB 4CEJB 4WUTA 3LUCA 5IIIA 4CF3A 3QYAA 1NX9A 3A4IA 1ZK0A 1LLQA 3DFZA 1OVGA 1F6DA 3UMYA 1P61B 2QYOA 4CQMD 3D6JA 3PT9A 3WWCA 2P5UA 4LSMA 3WAGA 4DS5A 2R8YA 3QE9Y 3PUVA 4JJ6A 1VG0B 4HUTA 4Y9DA 4RM3A 3OHMA 1L7QA 4YAJA 3EXHC 3UH1A 2FDXA 4G9GA 4EJSC 1DHRA 2PX2A 4PQYA 2LYAA 1G4AE 2GJAA 3DUWA 5IMBA 1UJMA 5C5JA 3CW9A 2OQIA 4N54A 4HJXA 1U8UA 5AYVA 1SC6A 3P9SA 4R41A 2HLNA 3T3OA 1MOSA 2HJWA 4RDHA 4MSUA 1SWWA 3C14C 2DH6A 1VJ0A 4R0NA 1X7DA 3CJQA 1N8SA 1I51A 2PJDA 3ELYA 4QA9A 1RXEA 3WV4A 2SKCA 3C3AA 4PWYA 4HJRA 1A1SA 1BXZA 2BQ3A 4MVXA 3GUUA 3F98A 1Z0FA 1V8FA 4HGNA 1ZQPA 1DAHA 3NDPA 2FSVC 1W5TA 5LNK6 3WS7A 4HVTA 4JIMA 3T1QA 3CNQS 2H4HA 1W25A 3JVUA 3ZY3A 2KFZA 1GPYA 2A0XA 1K08A 3RIXA 1A0OA 5B6PA 3ASUA 3V1NA 3FLBA 4O5CA 5DW0A 5K2MA 3HA2A 4J1SA 3CZPA 4HX9A 4FR5A 2UAGA 3AJ9A 2ACWA 4UB4A 1PL7A 2WSSA 1BDMA 1DXHA 2EFHB 5JZBA 3WK7A 4C8NA 1AGPA 3QWFA 5AK5A 3DBRA 1M0EA 2ERCA 3AUOA 3GF4A 3U4DA 5EP3A 4LYYA 2GJKA 4UBOA 2YV5A 3H1EA 3NTXA 4RMNA 4LG1A 5K09A 1IQUA 4WLUA 5JAMA 3I45A 4YLEA 5CNMA 3DFMA 4Q4HA 1H2RS 4ER6A 3G6WA 3KL4A 5LDDC 2ZATA 4HNTA 4HFNA 4RIHA 2AGQA 8LDHA 9ICBA 2BCVA 4K26A 1QH1B 4L02A 2W7TA 3H4TA 4P38A 2VLBA 3KKPA 1PK8A 3ADKA 1DTWA 1TW2A 3LDHA 1CTQA 1GPDG 1VSQA 2I78A 3RODA 4UTXA 1NBOA 2YJNA 4P36A 3CX7A 3M9MB 3EMKA 1EM8B 3K6SA 5KYVA 3EUWA 4DDVA 4RW0A 2OMEA 4A6XA 2HU7A 4NRDA 2VPWA 2DC1A 4TX1A 3O1JC 4KO1S 4YONB 3JD1A 1W76A 2AJCA 1IATA 1X86B 2D8MA 2H5JA 5J2UF 3RJFA 3IQWA 3I6BA 1H5NA 3GV8B 2EXXA 2MSWA 3PA8A 3DEEA 1P5HA 2PLAA 3UXPA 5LD2B 1KYQA 5EIFA 4E4YA 3S27A 1VYHA 2OVBA 3ANXA 3OWXA 2NXCA 1UQRA 3T1VA 2Q3DA 3ETJA 4P7BA 4JKOA 1OI3A 2K7ZA 5IHXA 4QECA 3OE5A 4EHNA 1ZNYA 1XYGA 3VJLA 1EFPB 2H9YA 1IOZA 5AJTA 5J0WA 8ICHA 4QWMA 3HVUA 3DBOB 1LI7A 4BGDA 3PGKA 1K3FA 4AYXA 3KWFA 3DLIA 3PIDA 2OWEA 2ZVPX 4C4AA 1QFJA 1E3EA 3GIJA 2D5IA 2K5UA 3JASA 4Z8XA 1U47A 2X0DA 3NIGB 4F2RA 5DBHX 3USCS 3PX3A 2L19A 2O2ZA 2BGNA 2G40A 4ZC1A 5FH9A 1ZMTA 3JQGB 3IUEA 1X6JA 3DMTC 1E8NA 5L53A 2NRWA 4Y7CA 1SBNE 3VNRA 1RI2A 1MO6A 4YASA 1QTIA 4N8SA 3ESCA 1JIVA 2JFOA 3W2TA 3DOEA 1UWCA 4EZIA 5H02A 3I5XA 1I3MA 1TADA 2VJ4A 1MB2A 2JAUA 3QKRA 1UT5A 1QHNA 3AUSA 3T4PA 1EVLA 3WYGA 1IAVA 2QQEA 3LLSA 5JANA 3B2NA 2MSKA 1UBMS 5F9HA 2IYSA 4HEA6 4DT1A 5BV1A 3ABRB 3H6KA 2HWXA 4RA9B 1XJ5A 3OX3A 2ORVA 1RM3A 1HTWA 1Z37A 4FFBB 2XMQA 4CUKA 3I6MA 3J81A 2H59A 3VYVA 3BB1A 1QS0A 1H2ZA 4LV6A 1T94A 3BWMA 2VRCD 1OX4B 3PCRB 5KS2A 4RVNA 5IJWA 1T8RA 2ZRHA 3SICE 1UC4B 1Y7PA 3EDQA 3S7TA 4BFXA 1JN0A 2QL7A 3RE1A 3W7AA 2J4FA 4YYZA 3RH5A 1ZVQA 4WK4B 3B9PA 4YR9A 2EZYA 4BE9A 4B3GA 3MB8A 4OX9Y 1DO0A 3VR5H 5K8IA 3RC9A 1R27A 3DGFC 1FYVA 3ZCQA 3BILA 4MV3A 1LV5A 4OYRA 3UAYA 3WRVA 5DM70 4JEUA 1FXWF 4IGEA 3WU2U 3QJ5A 2W7OA 2IEAA 2B34A 1D8AA 1DO2A 2A1TR 2BDUA 3BFXA 1T0HB 1CFZA 1NBAA 3RT1A 3K0CA 4KIFA 1OWMA 1TXGA 3V42A 3NM6B 2Z9DA 1IZ0A 3ZLUA 3WIDA 1QGUB 4XUCA 2HCJB 3ZGOA 1NM5C 3HS3A 3UCEA 2AQIA 2EW1A 5A9SB 2F48A 3RVMA 4Y2YA 2HU8A 1J2JA 3WRYC 3LU1A 2EHDA 2HF2A 3BKXA 2H1SA 2ZZKA 3THRA 1BXGB 1X40A 1V37A 1THTA 3FOCA 3SKXA 3V2HA 3EVNA 3H6GA 4TLLB 4BO3A 5JJKA 4QSHA 2H4XA 4F4FA 1P0PA 5EIBD 1X9IA 1UR5A 4QHYA 1SB3C 2PUGA 4L73A 3WHIA 1XRPA 3VC8A 1OOEA 3IDZA 2COUA 3IG8A 4HZIA 3ETEA 3FIJA 1A5BB 3VX3A 2E6KA 4EGCB 4ELTA 1QQAA 3K71B 3FKQA 3L6EA 2EL7A 3D7SA 1TAQA 3TW8A 4FS1A 5HKAA 2Q62A 1EK5A 4RQ6A 1I1OA 1JXMA 4F6RB 4F4XA 4HXEB 3HLKA 3AP1A 4A5SA 4HDSB 1X15A 1HLFA 4IR1A 1GCOA 2N1BA 1WPXA 3HB7A 4B2LA 1GZ5A 3GLRA 3AGPA 1JIIA 1AV6A 2HOQA 2I3BA 3W3AH 4DMUB 4C88A 3GLSA 1XTKA 3EXG1 2ZIVB 1X6IA 3L0PA 3H8MA 1ZP6A 3ZCSA 2JGEA 2UYCA 1PGOA 4I1SA 2G8LA 4PLYA 3E0FA 4R8UA 3OAAD 3AF1A 3FRIA 3AEUA 4MVJI 4RIEA 4PGMA 2ZBGA 2P9FA 4ZEOA 4Z4EA 4URVR 5IJ0B 4E33A 4L4RA 3E23A 2C61A 4H7HA 1Y8RA 3RYHB 5T4BA 1W6UA 1JG2A 1FNBA 1UDAA 4I4CA 1CRZA 2DF4B 1NW3A 2LDXA 2FX5A 5A0FA 1AB6A 3K92A 3L4BA 2EYQA 4FT4A 5C37A 3MS4A 2ZTLA 1J99A 1C3JA 2H4ZA 1AX9A 2V5VA 1KWGA 3ZQJA 5IANA 3RYIB 3EOAI 3FB4A 1TYEB 4PVDA 2NUPB 5BOMA 2HHAA 1Q3VA 2L0XA 3EVGA 2OZKA 4AWBA 5U4QA 3U7EB 3R8FA 5KQLA 1U9IA 2DR2A 3P9NA 3SF8A 4YI3A 1MX3A 1KEPA 5IWCA 2YWDA 4N82A 4TKVB 1GRNA 4DOBA 1N1DA 4C3VA 3A6JA 4GBED 1C8LA 1YHNA 1OMOA 1FX0A 3EQ2A 1OXJA 1UBKS 2P4UA 4EFMA 1WUKS 1U0HC 3I9NA 5B7PA 3AQ4A 4G4GA 1Y1LA 1W8DA 1TB4A 5JTTA 5FHQA 2B92A 2W70A 3PZBA 3M7IA 2ZTVA 5DX0A 4NPAA 5KJEA 1M66A 4UOQA 4LK2A 2BFMA 1T5TA 1M2HA 3NVDA 1QLJA 2W7PA 2FRXA 3CVYA 4M9UA 4C4XA 3BREA 5IABA 3PNOA 1ZEJA 4IDBA 4UMFA 5B7NA 3IOYA 3DV0A 3L7BA 3AQEA 2I9GA 1GGMA 5C5IA 3H11A 4LFAB 3LX4A 3OFKA 1ECGA 4DQDA 1JA1A 3QPWA 3OZEA 4NH0A 1JHVA 2VBGA 3QK7A 3LBHA 2D2VA 3LKDA 1YJAA 3JRNA 5IJ9B 1QYVA 4J43A 3GEEA 4RA6A 4WZAB 2VHYA 3MA0A 2XF2A 3BGOS 1AF4A 3OQIA 3OMLA 1DEOA 1HQDA 2L69A 3RS7A 4LNHA 2CHVA 3PSTA 1X70A 2ICAA 2PZBA 4GUAA 3MWYW 3Q7EA 1LX7A 3T7EA 2HHTA 4B9AA 1FX1A 1H8HA 2XWQA 3C7KA 3QBTA 4PGGA 1PT8A 2QXUA 5U9CA 4BWGA 2W6NA 3K09C 4M7PA 2NN3C 3OZBA 4ABTA 4AUMA 2IPMA 3IVMA 1Q2XA 4YQEA 4PCVA 3WLMA 1ONPA 2YHSA 1HMYA 4RNCA 1E2NA 1TUEA 4KKVA 4EYSA 3NOQA 1W4AA 3EBLA 4ECSA 2YW9A 3A6GA 4QZFA 2V97A 3ZBPA 3KT6A 4FNMA 4BUCA 2F6RA 4OO1J 2WE7A 4WBNA 3VKWA 2QY9A 3NRJA 4ZKEA 1G55A 3OA2A 2OBXA 2C8LA 3A37A 1CQPA 5FYDA 4ACBA 1X7ZA 3C87A 2QN2A 3KC2A 3VVMA 4AJIA 2ZTEA 4QW8A 3H40A 4BMOB 4WNIA 1D2GA 1OHHA 1SPXA 4MNTA 1ZXBA 4IHQA 4KXNA 4OREX 1FSFA 5A0VA 5CR9A 4QDKA 4J1TC 1KK3A 1H2YA 4XKJA 1EUCA 3GLGB 4UPEA 4ZYZA 1EXMA 3FAZA 4JJFA 1WF6A 4Z3KA 3IEIA 1IBKB 3FUCA 3CZMA 2NZXA 4N7BA 1QK3A 1DTEA 5B7QA 3UMSA 4LCJA 4BQFA 5FEMA 4DSFA 2G82A 1A82A 1SXQA 1IWOA 4IQ8A 5EJ2A 3LLCA 4OD0A 2GCEA 3QFFA 5CVCA 1Z4PX 1I4WA 1KFCB 1YJXA 5HK8A 2XE4A 5J5VA 1L2TA 1CUAA 3VQTA 1QTRA 4UTPA 4FUQA 2C77A 3ZU2A 7YASA 1MC4A 2UUPA 2AU0A 2D54A 4W1RA 3II6X 1ZJJA 1CDOA 3CKLA 3CZCA 5EJ7A 3TXYA 3CPHA 4N40A 2BHTA 4NMHA 4WMLA 4PZNA 1N3IA 3DFUA 3WJAA 3T5PA 1V5WA 1EE2A 1EQAA 2RIRA 5I9BA 2HDNB 4MJ7A 3REGA 5BN5A 1NF9A 3QW4B 5AW8A 4MVJM 2VXCA 1M6NA 4PY2A 2COKA 1SOMA