3QUBA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47ala mutant complexed with sulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
MRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHAGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 77
structure length 223
sequence length 223
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qubA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qubA01
3OCZA 2YN4A 2HCFA 2JAWA 1JUDA 3ZVLA 1L7OA 4DWOA 1VJ5A 3E81A 2R8EA 4EX7A 5ALQA 1U02A 4UMFA 5AICA 2HI0A 1F5SA 2FPRA 1O03A 4YIKA 3ZWKA 5AESA 5AM3A 1RQLA 5AKKA 4BYGA 1Q92A 2AMYA 3R09A 2HF7A 4UW9A 1EK2A 3IB6A 5AI4A 3OTQA 4EX6A 3ZTYA 3KDPA 4HGNA 3A1CA 4J2TA 4E88A 1XP5A 1RLTA 3S6JA 2B30A 3IJ5A 3DDHA 2RARA 4MWOA 4Y2SA 4UATA 2WF6A 4HGQA 4KX3A 1Z88A 4XE5A 3QGMA 3WK7A 1RMYA 3QU2A 2Q5EA 3EF0A 3ZTWA 3I76A 2B82A 1Y8AA 1U2TA 3UM9A 1Z4KA 4GXTA 3F9RA 5AK5A 1RMQA 2GHQA 2C88A 2FUCA 1XVIA 2B1RA 4Y2QA 3NANA 2YJ5A 4I9GA 5AW4A 4BNDB 5AK4A 4JDPA 1QYIA 4BBJA 3UMBA 5ALYA 1RKQA 2HO4A 3NUQA 1RKVA 3AR7A 4Y2JA 4CF3A 3KOOA 1RRCA 2BY4A 2RB5A 3CNHA 2IOFK 3SLRA 3NAMA 5AW0A 2HDOA 4EELA 2IYEA 2Q4TA 3QU7A 3FM9A 1S2OA 4AP9A 3I28A 2CN1A 1VJRA 3RF6A 4ZEXA 3WKDA 3PGLA 3R4CA 3QNMA 4UAUA 4JB3A 2RAVA 2WF7A 4HGOA 3OCWA 2FPXA 1Z4PX 3OCYA 3M9LA 1AQ6A 4PNHA 3OCUA 4OHFA 3ZI4A 4Y2TA 5AW7A 3UMCA 1RPZA 3L8GA 3N07A 5AVXA 2PQ0A 4J03A 1J97A 3QUQA 1L8OA 3DNPA 3AR2A 5A3RA 4UM5A 1Z4IA 4ZEWA 4YGYA 3B9RA 4KX5A 4HAIA 5ALJA 3NALA 5ALDA 1LTQA 2B8JA 3KC2A 1QQ6A 3MMZA 1EK1A 4Y2XA 4Y2PA 1YS9A 3HYCA 3N1UA 3WKBA 3L0CA 1TJ4A 4KNVA 4G63A 2W43A 1ZRMA 5ALFA 1T5TA 5AIBA 4UU0A 1T5SA 4F71A 3WK9A 3VAYA 5AW6A 2JAOA 3L5KA 1KYTA 4MUMA 4HGPA 2WF5A 1WPGA 1ZD2P 2I6XA 4CE6A 3W5DA 1ZJJA 4QJBA 2GFHA 5ALUA 1Z4MA 2G1AA 5AM5A 1ZD3A 5IT4A 5AM0A 5AIAA 2PKEA 2OYCA 2ZBEA 1U2SA 1TJ3A 3N8GA 2WHEA 3ZWDA 2P69A 3FVVA 3QU9A 5ALSA 3NASA 2YJ4A 4ZEVA 4FFDA 3E84A 3QUCA 5AVYA 2C9MA 2AGVA 2B0CA 3E58A 3E8MA 5AKGA 4YH1A 2ZXEA 3DAOA 2I7DA 3SF0A 3ZW7A 1O08A 1SU4A 5AI6A 2YY6A 4BEVA 3L1VA 1U7OA 5AVUA 5ALTA 1Z4LA 3IRUA 5ALVA 5ALGA 1TJ5A 2WF9A 3PCTA 2QLTA 3WGVA 3U7FB 1YNSA 4L6AA 3N28A 1YDFA 3B8EA 4CF4A 3ZX5A 4OD0A 4YCMA 3AR4A 1SWVA 2HHLA 3QUTA 1WVIA 1QQ5A 3WKEA 3U7GA 3OCVA 2QYHA 3SKYA 5ALIA 5AKXA 3DV9A 2WM8A 4NABA 1XPJA 1L7PA 5AKIA 4XOUA 3ED5A 3MC1A 5AKHA 2G08A 4EENA 5AW8A 1QQ7A 3I6BA 1ZD5A 4IG4A 3ZX4A 2CFTA 1TE2A 3PGVA 2FEAA 5ALPA 1L8LA 4HYTA 3L7YA 3ESRA 4XQ0A 2BDEA 3ZVNA 3WK8A 4YIHA 1N8NA 3NIWA 5T41A 4UMEA 1SWWA 3QUBA 3FZQA 3MPOA 3AR6A 1YJ5A 2YFYA 2Q4RA 4NV0A 2NO4A 1RDFA 1CQZA 5AKYA 4DCCA 5AVTA 2O2XA 4BKMA 2P9JA 5ALEA 4H1WA 2IOHA 5AVVA 5AKLA 5AW1A 3A1EA 4IFTA 5AW3A 5FP0A 3L8EA 3WGUA 2OBBA 2YJ6A 1N9KA 5E0OA 3BA6A 2B8EA 4CF5A 2FPUA 5AW9A 5ALMA 2ZBGA 2D2VA 1L7MA 3L8FA 2FI1A 3NRJA 2YMPA 2C8KA 2YMMA 2FDRA 5AI9A 4UARA 3U7HB 1Z4OA 1T9ZA 4UMDA 2G09A 4NWIA 2GO7A 2HSZA 4Y2VA 5AI0A 3ET4A 5ALXA 3P96A 2W4MA 4L6CA 3U26A 5AM4A 3L8HA 3WK6A 2ODAA 4UAVA 3EF1A 2YMLA 4KN8A 4Y3UA 1QH9A 1Z5UA 4AS2A 3QXGA 1ZRNA 2HX1A 1RKUA 3UMGA 4FYPA 4UU1A 1ZOLA 2WF8A 5AVSA 3ET5A 2NO5A 4DFDA 2RBKA 4RESA 5A3SA 2EAUA 4KNWA 3J7TA 2G80A 1RQNA 1Z4JA 3ONNA 5IT0A 3L0YA 5AW5A 2C8LA 4HGRA 4OCZA 2GMWA 3AR5A 2IA5A 3KBBA 5ALKA 3WK5A 4UM7A 2G06A 3HLTA 1YMQA 1ZS9A 3WKCA 2HF2A 2X4DA 5AKJA 3OCXA 3ZU6A 1RC8A 4BEWA 2AH5A 2AUTA 5AVWA 4UMVA 5ALHA 2B1QA 1NNLA 4KYTA 2ZG6A 2YJ3A 1L6RA 5AVQA 4Y2RA 4BX2A 5AK6A 4YCNA 1X42A 3QU5A 1RMTA 2JAUA 5ALLA 3L1UA 1NF2A 3PDWA 4C4SA 3SHQA 3AR8A 2P11A 3U13A 4G9BA 2WFAA 2YMQA 3B9BA 2EARA 3AR9A 3FPBA 2YBDA 5AVZA 3R9KA 1S8OA 1K1EA 1NRWA 5ALZA 2FPWA 3WKAA 1RLOA 4RETA 2NYVA 2W11A 5AKEA 4BX3A 3QU4A 3QYPA 2MU1A 3SMVA 4BX0A 3ESQA 2O9JA 5AI5A 5AKZA 1Z4QA 3FGOA 4UASA 5ALWA 2I34A 5AM2A 3KZXA 2G07A 2VKQA 4YCLA 5ALNA 1WZCA 2JARA 1RLMA 5AVRA 3A3YA 3N5KA 1CR6A 4EZEA 5AK3A 4XPZA 1Z4NA 2HEGA 2DQSA 3EWIA 5AHXA 3MN1A 5JJBA 1MH9A 1FEZA 4FE3A 5A3QA 3AR3A 3ZUPA 4DW8A 3EPRA 2OM6A 2EATA 1L7NA 2FPSA 1J8DA 3GYGA 4B6JA 1YV9A 2I55A 4L57A 3ZVMA 1PW5A 2G0AA 2PR7A 3W5CA 4C4RA 1LVHA 2FUEA 2GHTA 4GIBA 1Z5GA 2CFRA 3OPXA 3W5BA 3M1YA 1ZD4A 3BWVA 5IS2A 4NAVA 4AS3A 5AI8A 1U7PA 3K1ZA 2HOQA 3A1DA 4Y2UA 2IOFA 5ALOA 2P27A 5AM1A 2JGAA 2ZOSA 2R8XA 3QX7A 4EEKA 3SKXA 2MSNA 4Y2YA 4O8CA 3D6JA 1VFPA 2C4NA 3I1YA 4I9FA 4NFLA 4QQFA 2ZBFA 1TA0A 3U7EB 3CZ4A 3WK4A 4CNQA 2MU2A 3U19A 4OFZA 4BNDA 5AW2A 1IWOA 1WR8A 2CFSA 2I33A 2R8ZA 5ALRA 3SD7A 2R8YA 2I54A 3TLMA 3FPSA 1Q91A 3L0BA 2BDUA 2OA0A 3RFUA 3W5AA 3KD3A 3QLEA 4C4TA 2ZBDA 4F72A
chains in the Genus database with same CATH superfamily
4JK1A 3A9VA 5YASA 3VNAA 2J5QA 3VOSA 1TT7A 2R00C 3ST7A 1IHOA 2G1UA 4Y6RA 1USIA 4OFWA 4YPOA 1QORA 3HCDA 3BX1A 2QY6A 3GFBA 4QYIB 5LQSA 2D7DA 1GG5A 4U4AA 3NDPA 3SQDA 4LCJA 1JEJA 3URKA 2GZRA 4ME6A 1GUDA 1JEEA 3ZWKA 4UNPA 3QUAA 1BCRB 1VE9A 3HS3A 5I3ZA 4JXXA 5JDCA 4O4LF 1JJ7A 5DTMA 5TF4A 3DHWC 4UD2A 3TR5A 1VSTA 2GM9A 3HNPA 3FIUA 4H31A 2CF6A 3KUUA 4F6RB 4B3SB 1UDXA 4DM7A 2PT5A 4D99A 1BXGB 4R63A 4DA4A 1ZQKA 2OBXA 1TK5A 3LT4A 2HFKA 4LK3A 4OY3A 1E9VA 5F98A 3PQ8A 3UPTA 4YR9A 3KNZA 4ERXA 4M37A 1X92A 2GZAA 3RVSA 4BNMA 4EVIA 4RTPA 2NU8A 4DMHA 4BO9A 1RADA 3LHFA 3ND8A 4GWGA 4FIDA 2ZUSA 4BV9A 1CFJA 5IULC 2V4ZA 2PX0A 3C39A 1JBKA 2CXRA 5JECA 3T4EA 2CLHB 4FEAA 1EDDA 1FSSA 5CTJA 2XOKA 1EJ2A 3BF8A 4YK7A 3RQIA 2B3DA 4AW9A 2IHJA 2QNRA 4LVUA 3LX5A 4ZQFA 5ECWA 1FOEB 4KQ2A 2CV0A 4D3XA 1J22A 4EG5A 1GCAA 4EFLA 2EFEB 4JBXA 4RMJA 5SZKB 2QUKA 1EX1A 2C98A 2GYYA 2RAPA 3HLYA 4GOLD 5ADUS 3X1DA 4Q19A 2RHHA 3AWIA 3COVA 4YDRA 3R7NA 3VR4A 3ZGYA 2FHSA 3OSNA 5L1KA 1JHQA 1YRQA 2G82A 5A03A 4ZQGA 1E6MA 1HE8B 2YJ5A 4ZN6A 5K0BA 2CSXA 1ZHOA 4IR1A 3TTYA 3UMJA 3C97A 2ZJ0A 2CVFA 3E2IA 3WGYA 3OEHA 3S7ZA 4N3AA 1A9TA 4YAIA 1EJ0A 1QF7A 3IAUA 3RJ9A 2JHAA 2RB5A 3BG5A 3NW9A 1T91A 2FG5A 1KFJB 1NYQA 1NVTA 2CCKA 4FFBB 3H0LB 3V2UA 3GFKB 3K0CA 3N0WA 4CIWA 2QE7A 1S9FA 5LMZA 3B6KA 4K0RA 1VM6A 3MR2A 1DQRA 2JLBA 4P36A 4PRKA 4TTJA 5KCMA 5JXHA 4UAUA 4DMUB 4DV5B 3A31A 3IQGX 2WMNB 4LIPD 1TCBA 3MJ4A 3O8QA 4HAYA 5CGQB 5EZYA 1NW9B 1TGVA 4LJ9A 4TXMA 3TR6A 1MFPA 3TZKA 2IYLD 4CM5A 5C5DA 3SXUA 3GBSA 3UUGA 1SQ6A 3BFXA 3GEHA 1OILA 2BPOA 2L0XA 8ADHA 5HZHA 4B33A 3UJCA 2VJKA 3MJSA 1G6OA 5HOEA 2VJBA 2REQB 3PD1A 2HMSA 1KFEB 4U9UA 3T15A 4TL8A 2FPPB 1OXBB 3QTLA 2YNMC 3L8CA 5EPOA 4A8TA 1JFRA 1YRYE 5HDBB 4GRAA 3E18A 3MS4A 1E3IA 4Z3OA 3NBMA 4O4HA 4CT5A 1R6TA 1U9IC 4LMAA 4ZI7F 3IT1A 1JQLB 3LRPA 3QI2A 1NKEA 3DOUA 5D7NA 1TYAE 2SCUB 2NTVA 1XPUA 3RUEA 2YV2A 2B4TO 1IPEA 3WLOA 3RRHA 1EK1A 2MTBA 3LC1O 4NICA 5IKXA 3Q7IA 1RQGA 1AM4D 3UHJA 2ZDGA 4B9SA 1M6EX 1M1NB 2GYWA 2C2RA 2XUHA 3EEFA 3OOJA 3W7BA 4CU5A 5FBQB 2UXCB 2VJ4A 5KG6A 3KYBA 3OZFA 2J45A 2GO1A 4KNVA 4KYUA 3GUUA 1X80B 4OBEA 2XXAB 1Y3CE 3K4QA 1ENPA 1N7HA 5AIBA 1VG8A 3AEUB 3E03A 4ZD6A 4CQMA 3H1AA 4JASB 1KQQA 4HLUA 4UDOA 4B46A 3WL4A 4IV0A 3R8FA 5F51A 1U9IA 3QRWA 4LYJA 4YWJA 3WDSA 1WO8A 3H8WA 5KWJA 2K89A 4ED0A 1NVVQ 2A92A 2WM3A 2JFOA 5ALUA 2GFHA 1Y80A 5AM5A 1ORIA 3JQ7A 1B41A 4GUAA 5F2KA 3SX0A 3HJCA 1WUHS 3H9EO 4R1OA 3LWNA 3ECSA 5KWVA 4FE7A 1NDUA 5DMHA 3DLHA 4AJ1A 3W6UA 3BM5A 1QSLA 2BTOA 2QLNA 4I7EA 4IDHA 4MQEB 1MXFA 5FXMA 1QSGA 2YW9A 3UWPA 3ZV5A 1UBRS 3A4VA 3DWFA 1U2SA 1HT3A 4DEVA 4L7VA 3A4YA 3SVLA 3JTEA 1W5SA 1R9GA 3GN1A 4B3HA 3ZKWA 2WJVA 1V8BA 2ERYA 1S76D 4X7PA 2BQUA 3LQYA 3HXQA 2CBGA 2NZUG 3VR2A 4KFCA 1G66A 2BWJA 1LDYA 5AVYA 4JXKA 3G5UA 1PJZA 7ICRA 3AI3A 2X86A 2O6HA 5CX1A 4RA6B 3LVRE 5CBKA 2DHCA 1ONSA 1KJJA 4QQKA 3IUNA 3QVUA 2RDJA 3I01M 2DY0A 4NE9A 1XC7A 1XC9A 2IPOA 4X5OA 4DLVA 3HMQA 4ZQCB 5IFKA 3K16A 5FV7A 121PA 2KS6A 4H6PA 2EZ4A 1PT8A 4QGAA 1LSOA 4QWWA 3WP0A 3FWKA 1O08A 1RHJA 1P4RA 5AI6A 2J3QA 2KLBA 2OAGA 3A6KA 2F48A 4R7GA 1GO2A 2KW5A 5FQNA 1NY5A 3NEYA 4UBCA 1E7SA 3PD7A 4G0NA 5E7IA 3E7DA 4JV1A 2VP5A 2ZS7A 3SQMA 3SXJA 1JMYA 1VE1A 1YSCA 4PG4A 4BX9A 3K70D 1BJRE 1JE1A 4MQUA 3HB5X 4RT2A 3Q72A 1TO1E 4RNOA 2CUKA 2G8NA 4I2GA 1G4AE 1W88A 3PCTA 1D2HA 3ZHOA 3Q6MA 1I5EA 4NARA 4M46A 4KBGA 4DLWA 2WM9B 1X9GA 3SJZA 3UXEA 1FXWA 1G5IA 5DB9A 4RHYA 1PGPA 1SWVA 4QREA 1TQ2A 5E2IA 2Z1MA 4XB1A 3T5DA 1RE0A 3OJFA 2B1JA 5BVGA 2WHYA 2GPJA 2I71A 5LQRA 2CNBA 4XOIA 3MIZA 2NVUA 5HM8A 3V4VB 5I4BA 5JFGA 4UHDA 3I9V1 4ZU3A 2PZFA 4QJFB 1NX6A 2EBUA 4BMPB 1G42A 1NRIA 2HTFA 2NSLA 4KDEA 4PPNA 4C8LA 4OPMA 1X9SA 4Q7EA 4XIGS 1XJCA 2XYVA 2WUEA 3CCCA 3IG8A 3C29A 3PY8A 2WFLA 4GWLA 1QRDA 4NJEB 4NEQA 4FDLA 2G08A 5CJJA 1D5CA 5L1JA 1OXKB 1V37A 1CDDA 4PLCA 2H1CA 3AM1A 3ENWA 1Q1AA 3C41J 1PS8A 1FRVA 3NV9A 2ZJ3A 5C7LO 4G41A 4IEEA 1XMIA 1KFSA 2EKBA 4PRYA 1H0RA 4V0OA 3WNVA 1S89A 1Q22A 1II0A 3HUTA 4LXXA 4P4PA 2Z30A 3R6GA 3REOA 1JEQA 4BQPA 1GSHA 4DWVA 1APBA 7ICEA 4ZZ1A 2XOXA 3PC7A 1P1JA 2DULA 3JX9A 3A27A 3CLUD 3WADA 1QSYA 1ZUNA 2XLBA 2F1HA 4WZAA 4OSPA 1W44A 3GW8A 3UXOA 3U3XA 4EZBA 2PFOA 4V1CA 3SK0A 1Z17A 3M6UA 3ODGA 3T12A 3COPA 1IOZA 3CYFA 5A7HA 5GTHU 3MPOA 4RL4A 4O9MA 4MB0A 3U80A 5I7WA 3QBEA 2GERA 3AI2A 1CLEA 1SKYB 3I6ZA 4KYVA 5CDTA 3VBCA 4ZOEA 1Q21A 2XTMA 1D1TA 5AKYA 3WIOA 3H75A 3ZWAA 3PNQA 4LHXA 4UM8B 2GCEA 3ZE0B 5AW1A 4QSHA 4YRKA 4RKEA 2K7FA 2EKLA 3O3OB 4H60A 1N32B 1R5OA 3IVMA 4IIDA 2CCGA 3KZ1E 4IS3A 1G9TA 3HXMA 1YJ8A 3RIGA 1H4VB 2GBCA 3ZYZA 3HQ4O 3NATA 4J1SA 1JI3A 2PRSA 4J6FA 3ZLJA 2DXIA 1YE3A 3LUPA 2JH9A 4KMOB 4AWBA 4OP1A 5IXYA 3FZGA 4O2LA 1LNZA 3VNVA 2XYGA 3SOZA 3HZZA 3MLBA 3T3GA 2XSZD 3VU0A 1MB0A 1SUFA 1F17A 2VZLA 3FAHA 1B15A 1KJQA 3MB8A 4DCVA 2FMSA 1NAHA 2R1VB 3LPCA 1AMOA 3CB2A 3I5UA 3PW7A 1KTQA 4G8DA 3V4LA 5EIBD 3TLGA 4F2GA 2Y71A 2ZR7A 3TTSA 4TUQA 2D06A 1EHIA 2HDWA 3DZDA 2G7ZA 5COQA 5K0LA 3U9SA 5IK2D 4IJKA 2C5SA 1S2LA 2V4RA 1KK1A 3D5EA 4B6QA 5F3WB 2F9MA 2HGZA 3IX7A 4KN8A 5L7TA 3JWPA 3T06B 3W2EA 3QG1A 1ZRNA 4P84A 1CUBA 1VGQA 2QM3A 4R8UA 1OAOA 1X1QA 3E0XA 2PX4A 4I81A 3VAZA 5DKFA 1ZAYA 3CRQA 4Z4GA 1JFVA 2XVZA 2V6GA 2AKAB 3QELA 1TAUA 4UU1A 3MFQA 1YL6A 3CSSA 1U9CA 4EI9A 2YIVX 4KLMA 3KU1A 2C3MA 3BQNB 3Q3IA 4FX5A 1ZQDA 2B2CA 4YMWA 3O2SB 3A7DA 2OFPA 3V1KA 1UXHA 1BHQ1 3EOBI 3FYUC 3OURA 1OY1A 4NECA 1Z45A 2IQIA 2UYQA 1COWA 3D6HA 3IVRA 4NPCA 3EYZA 5K1ZA 4YDHB 4CM8B 1HX7A 5GTIU 3NHYA 2H7XA 2R7NA 1Z2DA 1SBNE 2F9LA 4AL4A 1IXYA 1UWLA 5CTAA 1ORDA 1Z38A 2BFEB 3WY9A 1XOIA 3R5JA 4HXYA 5K05A 2EOAA 1ADYA 4R51A 4RD2A 4HFNA 1IRIA 2I66A 3OHMA 1YAJA 4YR7A 4L9WA 1E2QA 4GVLA 3JYNA 5C18A 2HV9A 2JGEA 1Q6YA 1LDMA 4HGZA 2W71A 3EVZA 4HVCA 3CVWA 2FQXA 2O3QA 5CJPA 4F5OA 2W2OA 3WLSA 2ZCUA 4R6XA 4DJ5X 3QJ5A 3GFSA 3FXAA 1MQ3A 5JZSA 3OPMA 2XB4A 3K9FC 2X5OA 4H7DA 3CLTD 3KZCA 5EWEA 1P7YA 1XCBA 4LVCA 5HTKA 1DXHA 3IQDB 3ZOZA 2IW3A 4LYAA 1Z28A 1XCJA 4YD1A 1T9AA 4RXTA 2YJ3A 1U65A 2FEXA 4OJTA 4P1ZA 1IY8A 1FFGA 1K97A 3GDHA 1E2HA 4MUFA 4EDHA 2PUEA 1I5RA 1FUIA 1W36D 4F2SA 1V41E 1VP9A 3JQAB 3MWKA 4BN5A 4JP8A 5FBVB 3PI7A 3KB1A 4MS3A 3WLFA 5GJVC 1NPTO 5DI3B 1DC6A 2R6AA 1JQKA 2FE1A 1GNLA 1OC4A 1P1RA 3R5KA 3WLTA 5AUPB 1Q74A 3L46A 1DCTA 4M7RA 2WYVA 1NN1A 2UAGA 4GXJA 4HSEA 4MQEA 1C3VA 5DNWA 3REQB 1XVUA 3B48A 3FUWA 1IJFA 2XB2A 4M1EA 1VI5A 4LOKA 4EARA 1H4SA 5DDMA 2R3SA 1F9EA 4KLJA 3G23A 3R75A 3ESBA 3FAZA 4BNZA 4BZQA 2CVPA 3E82A 5AKEA 1AS2A 4N65A 5BPHA 2NZWA 2MU1A 1O4WA 3BFVA 3DTVD 3ICCA 3P0HA 4HDSB 3NKFA 2VF8A 4WXRA 1NBEA 1C9YA 4RD4A 5DN6A 5EKDA 1ZH6A 3O92A 1YMVA 1ZU4A 1ZVKA 4XJVA 4JROA 4WH0A 2YZKA 2RI6A 1KP9A 2FPGA 9ICOA 1NURA 3AUUA 3PUIA 3QBJA 1XHEA 3KEQA 2TECE 3AEXA 3MCVA 3W5UA 4FM9A 3ZUGA 2O8CB 4DC0A 2N1RA 1EUZA 4XLLA 5T5QA 2H3ZA 4U6QA 4DL6A 1VJ1A 3PUYA 4JCOA 2WTUA 1XWLA 4JT4A 1CR6A 1KKXA 3QY9A 3C3DA 4IJMA 5AK3A 3E05A 4KQEA 2R1UA 2GTIA 4JMPA 1JR3D 2RFLA 4CZ2A 1UF9A 4ZJUA 2W9AA 2OFFA 2IPAB 3T7KA 3LK9A 4BDPA 1TAQA 1E7RA 2P3SA 4FDAA 4LBWA 3QNUA 1F8GA 1Y63A 3P20A 3VGPA 3D2BA 3TW4A 1U7HA 1L7NA 2VO1A 1J9GA 3MMNA 3O95A 4Q4HA 4ER7A 3NVVA 4XGQA 1H94A 1AS3A 2VUTA 3EARA 1PNOA 2VSXA 3C2MA 3N5CA 4DNXA 3TZHA 3W5CA 1UFOA 3AM3A 1M9NA 5LR6A 2HQRA 1VLBA 3SI8A 1A97A 1RJGA 3EEIA 2CXPA 3WIDA 4MRSA 5SZIA 5KQPA 4QZCA 4GIBA 3RU3A 3GLIE 1M2JA 5CURA 3G0HA 2F4NA 1YZNA 4ZO9A 1WRBA 2O6KA 2FZEA 3CXUA 1FSFA 1OI7A 3OP1A 4GX2A 3RS3A 3ZS9A 4EKDA 3K9BA 2JH1A 2ZDQA 4XX0B 3RUIA 4C6TA 4ZHQA 3P0FA 3QF7A 1G38A 3KXLA 5ELMA 5K6AA 4W1SA 2MA1A 2G1JA 1U98A 2VJPA 1E6CA 3ANTA 4WHMA 1JU4A 3RVPA 3L8DA 1W0KD 1YNOA 2OXCA 4QDOA 5IDXA 5JNUA 3QX7A 1NMXA 1RM3A 2FMHA 1P9OA 2QRNA 5C80A 4C7KA 1UK6A 1UJMA 5HIIA 2MSNA 3JAKB 1C0KA 3OHPA 1BE0A 4DV6B 4OHYA 3VMMA 1J33A 3UCFA 3NRCA 3FHOA 2JRZA 3SIRA 1KAQA 1Z6ZA 3JR7A 1H8ED 1Z06A 3H2GA 1DAOA 4R2HA 4EJ6A 1TYEB 1G98A 3AINA 1ODTC 2JFWA 3NVKI 2QPOA 1R2QA 3HACA 2F8LA 3KQTA 4JL5A 3ZCXA 2F7SA 5H80A 3UHFA 3L7MA 2E4WA 3NLLA 5DHUA 3QW2A 3IKJA 4O3MA 4NHEA 4MAMA 3TLMA 3LY9A 4BNTA 4EGCB 1ZIOA 1GYRA 3PC8C 3LY7A 4RHFA 2C7OA 4D9MA 3BJEA 4ABTA 1U3VA 4I1YA 3K6JA 1NM5A 2ZKIA 3G8BA 1SK8A 2VLIA 2V6IA 3ZCQA 4DDKA 5EWMB 4CM9A 3I5XA 3OCZA 4M0UA 2B6GA 4TUYA 1F7UA 4N0PA 2JAWA 5DBHX 2AE2A 4K4HA 1X39A 2BGIA 4I2IA 3QVGA 1UMCA 4C78A 2X8WA 2VA9A 3HBNA 1FVOA 2I1LA 1KDPA 1GPDG 5KFEA 1FPMA 3IDFA 1VBKA 5BVHA 1O03A 1UWKA 3JWIA 3QPDA 1KI9A 2D2IA 3N8HA 2MINA 2OZVA 3DBHA 4WESA 3OQ1A 3T7RA 3UJ7A 3UOWA 1XLVA 5A4MS 1RQLA 2NX2A 4ACOA 1W5FA 4GX1A 3MTJA 4JJ6A 1YZHA 1GG8A 1H0KA 2V54A 1JQ3A 1OBVA 4NZPA 3UGQA 3B6MA 3PRKE 4MRVA 3V55A 4AUNA 3DNFA 1QO9A 4H35A 4Z6CA 1K6EA 4WERA 4ZYTA 1TI7A 1VOTA 4OFXA 2QP4A 2WU1A 3JQ7B 1PZMA 4ETMA 4YLGA 3E9DA 5LD2C 2Q4OA 3SV3A 2GUWA 2FN4A 2AZMA 4UVGA 2ZSJA 4D9GA 2BE7A 3AUJB 3QWHA 1IHXA 3EXHC 4PFSA 4QQ8A 4CLXA 2R0QC 3GZFA 3NWPA 3PYLA 4BS9A 3BH7A 3BJZA 3CJTA 3FYTA 3WLIA 3ZDZB 5LP1A 2ZJ1A 3PNMA 2H2HA 4EZ6A 2FMIA 2HL6A 2KPOA 4MQFB 3OGUA 3OJLA 4G5FA 5FPYA 4MA0A 5HK8A 5DXJA 1P17A 4MJ3A 4BJ6A 4R83A 3FVWA 4FB5A 2Q5EA 1NVUQ 2Q1SA 3G79A 2Q29A 1J99A 5JEDA 2J0SA 1MVLA 5GVSA 5K0TA 2GCOB 4IIFA 4V03A 3NUZA 1Q1GA 4KQXA 1JFLA 4Z1OA 1V4NA 3QY0A 3UK0A 2WJIA 1TQDA 2H17A 3Q98A 4Z4QA 1ISHA 3AJAA 4Q39A 1VJTA 4Y2QA 2PEYA 4M9XA 8LDHA 3K09C 3Q8SB 2Q2QA 4MHOA 1R0XA 4AI6A 2BM8A 3RWOA 4DS5A 4I27A 3BH0A 4DIOA 3FDJA 5H9VA 3TINA 4M9QA 2BEKA 2G5IB 4EBCA 3ZDAA 3ZDEA 2CYCA 2HO4A 2Q2OA 3Q7EA 3OZCA 4NDZA 5LCXA 5DB6A 3B9PA 1PGOA 4B2YA 2REQA 2LP4Y 1KI6A 1F4LA 2IEGA 3ETJA 1MNQA 2DPMA 2NZ2A 5AW0A 5FUQA 4EELA 2HF9A 5H3HA 1KVUA 1RZVA 1JBQA 2O3TA 4TKMA 2YIJA 2YHSA 3CPJB 1K4YA 2BMAA 3JV7A 3LX6A 4RY8A 1MNAA 1OXUA 3CTPA 3ZVRA 1RP1A 2FPLA 3TQRA 1O5IA 3JQDA 4IHKA 5D00A 3NNDA 3BHIA 4DY6A 1CY8A 1SO8A 1A9PA 3FPJA 1DV2A 1M0WA 2EEZA 4M49A 2G9UA 4OMUA 1KFTA 3C6MA 4W1PA 1QC5B 4HDAA 1M34B 2WHXA 2X1HA 3PNSA 4LDPA 1WXIA 4RELA 3CUVA 2Y0EA 4JUFA 4N54A 4OOFA 4BLVA 3EE6A 3HWX1 2NSYA 3ZHQA 1EKXA 4C4AA 1WXFA 1Y1TA 2PQMA 2Y9UA 1YZ6A 3G88A 4PV7A 4RK5A 1WLYA 3EQ7A 2QTZA 1NR5A 5AVXA 1YU9A 2ODTX 4GZ3A 4RLSA 5G0WA 1UODA 3NWBA 4M0AA 3D7MA 4N82A 4CRXA 1L8OA 4ECWA 4WNAA 1PLLA 2PLWA 4G84A 5CHGA 2F59A 2VI5A 1NHWA 5DI9A 4RJLA 2DHEA 3GCDA 1T4CA 3B9RA 3DE4X 4CUKA 2CXUA 4K9QA 4KP7A 4EHLA 1V6SA 1ARZA 1GNRA 2H8KA 1RHRA 3D3KA 4X90A 2R6R1 4B3CA 4RDXA 3MMZA 5SYAA 2C57A 1MVOA 3LY5A 1W4BA 4IGAA 4RPCA 5HIJA 2YXBA 1FXSA 4FEEA 2RJNA 4Q34A 1HF3A 2VNAA 4PZLA 1KI8A 2QTTA 1AF7A 4Y6PA 5C46F 4ZTBA 1GDHA 4PHFA 1HZZC 1YI1A 1XF1A 3IL2A 5L3SB 3REGA 1LFDB 1XKXA 1MDFA 1PEAA 4PIPA 1DXQA 1EM6A 1M6HA 3GLUA 1F20A 3AONB 2JGRA 4FW9A 3VAYA 5LZ2A 2CF5A 4ECZA 4YV7A 3KZOA 4ARUA 1W88B 3L5KA 1KYTA 1QQTA 4O2BA 5BSMA 1BX1A 2D1YA 2FF5A 4RAOA 1FDSA 1PT7A 4BNYA 3BSWA 4I1SA 3WB9A 3W5DA 1YWGO 1BOOA 3WLPA 2G1AA 2W00A 2OB1A 3YASA 3WJ7A 1EUDA 1P6XA 3BAZA 3PT9A 4FBMA 3R5HA 3DT9A 4U7HA 16PKA 3TX6A 4HTFB 3QENA 3V8VA 5JYBA 5ILOA 3VJLA 1BZYA 1QR2A 1MB3A 1PBNA 1P1IA 2RKWA 5G3YA 1F0KA 2I6TA 2QAGB 4CJXA 2JASA 3GVPA 1FMCA 2J9RA 3EEOA 2ZTSA 1JMSA 4FDVA 5CIWA 1TM3E 2FSVA 2WIDA 4FZ3A 2RJOA 5ESXA 2NUAA 3NASA 1JI7A 1PQWA 4C3VA 3ZGLA 2FEKA 4PAOA 4ZEVA 4Q48A 1D2RA 1VA5A 2HDNB 2XB8A 1VDZA 2XYPA 3I6QA 1SHJA 3IAM6 1W1IA 5DRTA 3ZWNA 4UTRA 1JDZA 3D6NB 3DDSA 1LB1B 3DMDA 4OXNA 1B4DA 1HLFA 3A26A 2I80A 3AOEC 3MUFA 2R1VA 2IYOA 2BKVA 2I7DA 3P45A 2H85A 3RBDA 2R5WA 3RRBA 4HQ6A 2QU8A 3JRWA 3HHEA 3WR5A 5F77A 2FFHA 1NNEA 1SOVA 4TRJA 2JZNA 2I5HA 1V5EA 3MT8A 1NF9A 2V7UA 1SUBA 1L4EA 3VX4A 5KOIA 1S2DA 5JYCA 2CDCA 1MG0A 3BL5A 4GH5A 4CCWA 1W4ZA 1J20A 3H2KA 3MLAA 3NORA 4ILEA 4W7SA 7AT1A 5ADVA 1N78A 3EQ2A 3KPVA 4IIHA 2YXDA 3R24A 5SY6A 3RHSA 1RRVA 1Z35A 1GDDA 1KQOA 1M8PA 4G97A 3ZDXB 1NRXA 4N12A 5DB4A 1Q1EA 3WQRA 1N7GA 1N2OA 2J6IA 5K4HA 3MT0A 4KQIA 1NVDA 2WC1A 3H84A 4KO8A 4URXR 4O0IA 4UUQA 1QHNA 4C9BA 1NW6A 4MUGA 5KFAA 5J0PA 2F64A 3RYIB 4BVGA 2X1MA 5LXTF 2VWPA 4KXQA 3TNDA 3SF0A 3RJHA 4R9NA 5DGHA 5BR1A 3TF5A 2QG9A 3KQKA 2Y1IA 4R64A 2IOQA 5EXSA 4GQIA 1GRRA 4F6LA 1DGJA 2CFCA 3ISJA 2EGGA 2OCGA 2O5EA 4XQCA 2HBYA 1XDSA 1J2YA 1VSBA 1PZXA 2X7HA 1L7PA 4ICAA 2N75A 4FNGA 3ZPXA 4CEJB 4ZOHC 1T29A 2C54A 5ICGA 3WJ1A 2YINC 1NI5A 2HHUA 2VJOA 5ES4B 5AW8A 3ZGNA 4QULA 4LZOA 2JEGA 2FLKA 4MIYA 1V5GA 4DS4A 4F3KA 3R9WA 1KQGA 7ICQA 2R6FA 4LBZA 1C0LA 1TE2A 3FTQA 1GPH1 1B0XA 4XWYA 4GPTA 3O8CA 1ZMTA 1MO5A 2K4PA 1V6CA 3PXXA 4NRDA 2MSKA 4QRHA 5JLJA 3MFIA 2D13A 2EP5A 4MWSA 3T9EA 4CDGA 4OH1A 4M1KA 4QGFA 3AUSA 1WU8A 4D81A 1DAMA 1NI4B 4WJLA 3PUXA 3TTUA 3T52A 1TU0A 1PR6A 4F91B 5LNK6 4U39A 2EH9A 3QTTA 4J16A 4Y98A 5KFPA 3T3IA 1SGWA 4YT4A 4IDEA 3LK7A 4DCCA 1F5NA 1ZLYA 5H68A 3VYWA 4CFZA 8ICYA 4MFCA 2QN3A 3MAAC 4I19A 3AY3A 4W5HA 1PJQA 2O8NA 5E4TA 4IFEA 3GOQA 4QM6A 3L8EA 4YUVA 1WZUA 2C97A 5KFQA 2DKOA 1X1BA 2H3IA 2QTBA 2MR6A 4TWZA 4NL9A 4XQ8A 1V9CA 2BQRA 2Q50A 4ELTA 3DCYA 4DARA 2PKXA 4QUEA 1CPYA 1WUDA 2PS3A 1U8ZA 3LIPA 2OD9A 3O03A 1MQ9A 1I51A 1URPA 2ZB3A 3AEQB 4J0IA 3SS9X 1GD1O 3PPWA 4NYIR 4KXYA 3S2GA 4B2PA 5KFZA 3KFLA 3RB0A 4B31A 3RJEA 2PSHA 2FX2A 3DOOA 3O47A 2CXHA 2YMPA 3K1TA 2D6FC 1H69A 2DCMA 2DLNA 3C15C 4AZ0A 3F5QA 2PZMA 1NZDA 1PDOA 1WTAA 2BEUB 1Q3KA 3PUKA 1PK8A 3WRXA 4ZT6A 1EVIA 2W54A 1QFYA 1PYGA 2W6JD 4UCFA 4D4HA 1XCMA 2OORC 4U0KA 5KOJA 1NLFA 2XVXA 3W4KA 3P96A 2F43A 2W2VA 1XTSA 3CJRA 4X44A 1VRVA 3PV8A 2GKGA 3R8CA 1D2NA 2YYSA 5CCDA 4F45A 5A3JA 3KAQA 1PFYA 1UPUA 1VL2A 1ZXLA 2ZS9A 1Z6GA 3NDIA 4HFMA 3IMFA 4QYIA 5FKJA 5KTSA 1QCKA 5IAEA 4YG2A 1RYMA 4J9OA 5JIBA 4U63A 3L8MA 8GPBA 1QCDA 4OXXA 1SZJG 1BPDA 3AHGA 4H77A 5H83A 2FMUA 5BURA 4XIYA 3OT5A 1HTWA 3EMDA 5AOVA 2A1UB 5AT1A 1M34A 4HNHA 1FIQA 1F4PA 2AN5A 2QXTA 4WY8A 3SHFA 3T3MB 2VUUA 4DA9A 4QXAA 3FOCA 4WLEA 3SQNA 4DMCA 1S2GA 1AB6A 1BAPA 3EIWA 3O74A 1HDGO 1I1HA 4PZ9A 4X9XA 3UWMA 3LKVA 3VTZA 4B79A 4ECYA 3COSA 3G2PA 4AIRA 2VT3A 2FZWA 2ZB8A 5FPPA 5GV7A 4WZBB 2GEJA 1O0SA 1YVRA 3DSRA 4JLNA 4U7TB 3JAKA 4BRZA 2X0DA 2GEDA 4YJFB 2OMKA 3E53A 4YDQA 2C1ZA 4R6WA 4CQMB 4MYHA 4AY2A 3EVEA 1FDRA 5H3CA 3DAFA 2ZRQA 4CMKA 3AR5A 4ZI7B 2VSFA 3WYDA 2QYOA 1SXJC 4YAFA 4XD7D 3W2FA 2AN1A 2IT1A 2VDNB 1RHQA 5JCJD 3KUDA 3WMXA 1R3DA 3UPUA 1ZS9A 3I9LA 4OUKX 1S97A 2WTNA 4YCBA 5AKJA 4AMZA 1OH6A 3HW8A 3NTVA 4WUVA 5IM4A 5EVCA 4DIBA 4FGLA 1EPUA 5JDIC 3LT0A 5JPDA 1U3CA 4UMVA 1ZM4A 3DKPA 1YRLA 2X8AA 2P9FA 1KJ8A 2XUOA 4QZGA 3PNBA 4IJVA 4KYTA 1XRLA 3WNDA 4DCJA 4Q24A 1G19A 3O4FA 4RY0A 4YRLA 2R8OA 1I3CA 1PVPA 4Z7QB 3DBIA 3KTAA 4BX2A 2ZCJA 3OECA 1BX0A 5DHAA 2Y66A 1NBHA 3K0SA 5IIJA 4XPIA 2HADA 4KO3S 3H4IA 5F52A 5CFPA 3CIFA 3L1UA 3T4PA 2CVOA 4B6RA 3WGGA 1W94A 2VJMA 1J42A 5CP2A 3EXEA 2BTEA 3L2OB 3FR7A 3HCAA 3ZY5A 2WYWA 3HR4A 2B7BA 4EAAA 4KPUB 1E3QA 4Q7QA 1PGNA 2PS0A 3PC4A 1IUPA 3W6ZA 3WYEA 2YBDA 4AO6A 1YTUA 2NUBA 1YB5A 3VPSA 3E0FA 3F2CA 2XYQA 2ODBA 4UAJA 5IUJC 1M6NA 1GTZA 3TJRA 4DJAA 4ZA2A 3A11A 2Y9TA 1ZSNA 4KQCA 1E9BA 3P9QA 4PTZA 2GWSA 2CNLA 3OQIA 4GP6A 4ZH4A 3ROQA 4BC1A 2PV7A 3HEBA 1LCIA 5AKZA 1Z74A 2GEUA 3LD9A 2WJ4A 2QE7D 1SBHA 2ODQA 2Q49A 4MMZB 4IFIA 4HY3A 1XEXB 2XVYA 2YJNA 3ESYA 4FFNA 2ZRMA 4IBOA 3N5KA 1KBOA 1MX5A 1H65A 1AA9A 1Y1KE 2HA4A 3D81A 3K73O 3K0AA 3PXGA 4EABA 2QDXA 2C3OA 3I9NA 1UFQA 5JMWA 4M8SA 1EU1A 1ZGAA 4GKAA 4P7GA 4WZ6A 3PX6A 5EHZA 1HFJA 3KP1A 1DC5A 2AHOB 1NU6A 5FTMA 3QZ8A 3NHFA 4G9EA 3AETA 5KTKA 2ATEA 1X8LA 5LC1A 3LBIA 2BR3A 1KE2A 3UA3A 3B7WA 1NWCA 4GI3A 1YV9A 1LJUA 3INTA 5AD1A 2F1IA 3ANNA 4C4RA 1VG0B 2B9VA 3GBPA 3TPCA 4IG9A 4GW3A 4XIIA 2FUEA 4IKPA 3KJFA 1IIPA 3C6QA 4TT8A 5COBA 3PR5B 3OPXA 1ZHFA 2VHZA 1ZD4A 3O83A 5IARA 1KRPA 1AS0A 1ESMA 5E79U 1B00A 4NAVA 3PDIA 3T9CA 5HXAA 1PVVA 3QXSA 6Q21A 4AS1A 4M86A 5JAPA 4DL4A 2LKYA 4NCJA 2BPGA 4L76A 2Q7DA 4DG5A 1KL9A 2Q4EA 1C81A 4HAXA 1QCZA 1CX9B 5BSEA 3DF9A 3MWLA 2AJCA 2WU4A 5FD8A 1V48A 2GHRA 1L7RA 1SBTA 4Y7CA 4XASA 2PLNA 5AH0A 3ZXXA 4DA8A 4E2ZA 2O50A 4PO8A 5D5PA 1TLTA 5HGXA 3EPLA 1CUYA 2W2KB 3IOCA 4L5AA 4OYLA 1SL1A 4RK4A 3PI6A 1XWFA 4MI1A 4RJJA 5FUMA 3CZ4A 4MUNA 2KTQA 3UGTA 3BZKA 2MU2A 1T3NA 5JI2E 3QHPA 1LD3A 2J87A 3ADKA 4GEKA 2VDPB 3TD9A 3E3AA 2VH2A 3SS8A 2BRUA 4WNAB 2IU6A 3LMKA 4Y1GA 3UWKA 5D3QA 4DNOA 2QKYA 4LECA 4KTVE 3THXB 5JXJA 3TQHA 1JDUA 2XD4A 3EEQA 5BQ5A 4EY8A 5FWYA 1Y7PA 2HREA 1JVNA 2CJWA 2X2FA 5LZ8A 4KLTA 5DHPA 1ZQAA 3OJUA 2WVAA 4O4JF 3TIIA 2XW6A 1NC1A 1BE6A 2GN6A 1A5BB 2R2GA 3BBPA 3CR3C 4OKNA 5TPZD 4R9VA 4M0EA 1ZQGA 1U2PA 4YNBA 1K6XA 5EQJB 2W6CX 2K7ZA 2I7VA 2K5UA 3I5MA 2FMFA 3NH9A 4M21A 1M66A 2W6OA 2V96A 2NUTA 2GPSA 2VBCA 3HP7A 4GOMD 3O84A 3LBNA 2PU5A 4PYIA 2YWCA 2R8EA 1PR9A 3MBIA 4BP9A 4KMOA 1GOTA 3RREA 4B8YA 1YT3A 5B7PA 1GA4A 3K2BA 1NN0A 1KYVA 4MTLA 4ZVMA 4CKEB 1HQDA 1RWOA 1GPNA 4H27A 5HP4A 1LWNA 4LYEA 1Z3IX 3KDAA 4E4RA 4JUDX 4HQLA 1ECFA 1QX3A 2IS1A 3OJEA 4JP2A 2WJJA 4FDMA 5LP6C 3V7YA 1A88A 2CFOA 2QRMA 1NW3A 5HUQA 1X1DA 3SC2A 3URMA 3O31A 4Q7MB 4CTMA 1XBTA 3FDZB 2OYRA 4JYPA 2PGLA 1CK4A 1ESDA 1UKEA 2C22A 2B20A 4OUDA 2X9LA 4INZA 4FR2A 2XVMA 1DCFA 1NAIA 1XZQA 1SKWA 4I29A 4GECA 1XXHA 3PEYA 1U28C 5CLHA 1JB9A 3OTIA 2KNJA 4RPKA 3A9SA 2HA0A 1IG3A 1VKRA 2A0KA 3KLNA 4TTQA 3S0JA 3IAS1 1NYRA 2XBMA 2GYVA 1CUIA 4C20A 1IBKB 2XRFA 2AJ8A 1GCOA 1Y4UA 2UZ0A 2VP6A 2NPFA 2OTCA 4LJRA 1Y9EA 2ZIEA 3OLWA 2K87A 5DU2A 3VPBA 4YONB 3RVMA 5C3UA 2DPGA 5CBPA 2EZ8A 3QE2A 3GAMA 3GAAA 4HO1X 2AF3C 3C3KA 2QT0A 2XAUA 4LDQA 1QGOA 2B1RA 3M1LA 1VKHA 1HL3A 3OT1B 2QPTA 3LHIA 1LI5A 4EB3A 2GXAA 4X8LA 4XGRA 1SCKA 3B0YA 4QLOA 4ECQA 3G6XA 5JARA 1F12A 3KQPA 4REOA 3D8TA 1BPBA 4FYWA 4GPBA 1GGNA 2R4UA 1RRCA 4UZFA 5KFRA 4X66B 8OHMA 1H9BA 1AHPA 1F51E 4WBXC 4W63A 2HBMA 4RTMA 8AT1A 2ARKA 2A33A 4BQNA 5K8CA 2DHQA 2GN2A 3QEJA 4WZZA 4X7RA 5DP2A 5E1BA 2B94A 2K2QB 4MCIA 1M5UA 5HKAA 3WJ2A 1XV5A 1O95C 1TVAA 2PA0A 4JB3A 1SIJA 3LQQA 2NXWA 4PZEA 1P7DA 3O2QB 3DZJA 4X91A 3UXHA 2UUPA 3IT2A 1OI2A 5MHTA 4JMLA 5EOVA 1SHKA 4OG2A 5K45A 2GR9A 1NT4A 4AJOA 2HA7A 1E20A 1XNGA 5CNMA 1NQOA 3HH8A 4Z49A 1IY1A 2NU9A 3T1HB 3NMUF 4RQNA 3DEIA 4LGVA 3PFKA 3OEYA 2PEZA 3O5AA 3F5EA 4FUTA 4IVQA 5COAA 3WWEA 5J2CA 1TYCA 3ICOA 4V2UA 1RI2A 3DF7A 4LVNA 3D8NA 7ICGA 1LTQA 4FNMA 1V8PA 2ZIUA 3CE6A 4ZOLF 1SXEA 1O77A 2BUAA 2PU7A 1BD3A 2WV9A 2P1RA 4OQYA 5DNAA 2RHRA 5EVJA 1JHXA 2C4HA 2PKCA 4GWKA 2QGFA 1JHMA 1XQ9A 3KB6A 3OO0A 4B9TA 3DL7A 3M49A 3AU6A 1QTMA 4G36A 1QAQA 4D9NA 3L0IB 1XD8A 3H8MA 4DBLE 7REQA 2ZM6B 1IUKA 1H1TA 2QAGA 3AESB 1H23A 1S8NA 3CJQA 3PCXA 4I8XA 1NBWB 4JBHA 4J9UE 2XWJI 4Y6QA 1T5SA 3MJCA 2WWGA 3BTUA 1RBYA 4TYPA 3P26A 3EFBA 2OHJA 4HGPA 3T5JA 1IM5A 2R66A 2YIMA 2C2GA 1E3SA 3KUKA 3QKTA 1T0UA 3OQIB 3R9IA 3KHTA 3TG2A 1OMOA 1AK1A 4X61A 5FRDA 3UQ0A 5IBQA 2FK8A 1JA9A 2X5KO 2VVTA 4C7OB 1ZJ6A 4RCVA 5SY4A 3WDLA 2IITA 4CKXA 3I04M 4YJGB 5BN3A 1NJ2A 3C6YA 5J8YC 3L07A 4M98A 1QIFA 3B9JA 2GXQA 2ZGVA 4Q4HB 3T0IA 4E11A 5KDDA 3U4GA 4PWZA 1WHSA 1RP7A 4QDZA 1MCZA 4NR0A 3BWDD 3BRSA 3D3WA 5FB3A 1HGXA 1IZ9A 1RM5A 2WAMA 4WXMA 3WDKA 2OXTA 3VZRA 1D03A 1Z83A 3ZHCA 4A10A 4JUZA 4CV1A 4HNQA 4HDNB 3CINA 1ZR4A 3FVVA 5CVVA 1SBIA 3TQCA 5ALSA 3FRJA 5A3RA 4OB7A 3GD7A 4L51A 3D8RA 5CXUA 4XX0A 4BBZA 1K1QA 3DL4A 1ATIA 3LU1A 4FX2A 3K0FA 2B0CA 3OIGA 9ICGA 3EUWA 4W5WA 2XGJA 4IQTA 3BQ9A 1ZN8A 1DGQA 5K3BA 3MWDA 3P2KA 4BLSA 3F7OA 3T7JA 4BFXA 4MHVA 2FWPA 3J81j 3T7CA 4H3KB 3DB1A 2QR5A 1X8JA 4ND3A 1Q12A 1NYLA 2QE6A 1W48A 2WJGA 4LWQA 2B3TA 4ZVPA 2QTVB 2YY6A 5MN5A 4OTZA 5JAIA 4WECA 4RABA 1J0CA 1Y4ZA 1RI5A 2GHIA 2HRZA 1W0JD 1NUQA 2XTNA 1CUJA 4FXOA 3U0VA 4BLPA 1QM5A 1G63A 3ADCA 1F0YA 1EDOA 2GNAA 3LPLA 4FCWA 2OG2A 3D0KA 4L3OA 3IRUA 1DZ3A 4BKPA 5EXXA 5I4KA 4DLUA 4E5KA 3AKDA 3OKPA 3ETGA 3T94A 1TVMA 4S2EA 9ABPA 1AX9A 4EY6A 3PSIA 1CB7A 1EX9A 4BWFB 3ZVKA 3OA0A 2GKOA 5EZYF 1QOZA 3I32A 3N86A 1LH0A 4O25A 4CCSA 4UHBA 3TSCA 2HUPA 3UYKA 3QUTA 1D0IA 1EFRD 1WVIA 4WK2B 4M6WA 2FWRA 3DC7A 4CKWB 2IYYA 3FB1A 4HGYA 4TL9A 3FFBA 3FOFC 2BEJA 5KEIA 4MDFA 2ZIXA 5TE9A 4E32A 1V38A 2AXPA 2C29D 2A9VA 5AKXA 3FSGA 2WM8A 4P3XA 3OJCA 2IWRA 1ZK4A 1KPHA 1OHHD 1ZC3A 1ZISA 3B1YA 4GMGA 4JOCA 3N2YA 4Q82A 4XOUA 2ATVA 1KZGB 4DQKA 5B4UA 2AJDA 1NVFA 3QX9A 1RYUA 2B4KA 5IK2A 5JANA 1ZJMA 1NDQA 4ENUA 2I91A 2H65A 1M2GA 1JDBB 1SXJB 3ENQA 3OWXA 4GR4A 3GEBA 3EW9A 5CUQA 2GD6A 5F1OA 4BMXA 4F46A 2D74A 2BKAA 2W37A 3AHFA 2ZZMA 1V8FA 1P4AA 1XXHE 2C5BA 2OLJA 3C6ZA 1OOEA 3L7YA 3TJZA 4DC9A 1I8TA 3I53A 3AB7A 2HEIA 4AKGA 1P7PA 1W76A 3D6TB 3IVXA 4IQ8A 4IJ5A 4KDCA 4CLEA 4TKVA 1T1EA 3B70A 3CRMA 3ETLA 2W7OA 4RE6A 5HQJA 1T7PA 2HVHA 4TWJA 2I76A 4YAUA 2BN4A 3H3FA 7ICVA 1Q1ZA 3QUBA 5EHQA 3NEPX 4X0EA 1UQUA 2UDPA 2F1RA 3E8XA 3JVEA 3NR2A 3D0OA 2YFYA 3CKYA 3PJDA 5JE8A 1F8YA 1UPFA 1RDFA 4LDJA 2ORYA 4WZAE 2NRZA 1CY2A 1YZTA 3U3KA 3CRNA 2B8TA 3TJMA 3N75A 1ZQ9A 4E15A 3GK3A 4RZRA 1PWHA 3DW1X 3Q2IA 1QTRA 4JJKA 3TQTA 1GT6A 2OL4A 4BMDA 3G3EA 2MR5A 3CXRA 2BGUA 3DPUA 3FZYA 3UHAA 1C2TA 2ST1A 2VNHA 3BXXA 4WKPA 5F73A 4D9EA 2B8EA 2FH5B 4B2IA 1E1RA 3GJ8A 3U0BA 4MW9A 1JG6A 3AO0B 4W7HA 5CB8A 2WJPA 2E4ZA 4BE4A 1S9DA 1XU9A 2X22A 4ZGGA 2PFKA 4K40A 3RBXA 1NJ5A 3GNSA 3USES 3T0GA 1NJXA 1V8ZA 2PS1A 5DK6A 2FEWB 1QG0A 3GIJA 1R5JA 4CG0A 2R8JA 1AHNA 2Y77A 4BP3A 7ICFA 3SYTA 1LKZA 2B6HA 1RXCA 2PZBA 4D42A 4BDSA 5CWRA 5CT9A 3PF8A 3RUFA 5LQKA 2QOEA 2Z8ZA 4ZO7A 4L4YA 1UXGA 1ZNQO 3UKOA 5BWCA 5AI0A 3GV7B 3EZYA 3RTGA 3F6SA 3VDNB 8ICXA 2HU7A 2QX8A 1CUXA 1YL5A 3WS7A 2WQZA 3CWQA 4Q01A 2BDPA 1CF9A 4REMA 4JBWA 1HDIA 5CXXA 4XYEA 2IYFA 1X0VA 3WU2U 2OXFA 4Y3UA 3TUZC 3GFVA 1K66A 1G20A 3WIBA 3CGWA 4RT3A 5I7UA 3GQBB 3H1GA 1WOYA 1RKUA 4YXWA 3AEKA 3RS4A 2V5VA 1XZFA 3LGXA 1ESZA 3EPHA 3LKBA 1SY7A 4X84A 4NJMB 2J6SA 2WLSA 1KEKA 3BDAA 1E2GA 1YFZA 4O4LB 3AJ9A 4JP5A 4QXMA 3N2NA 5C7OO 4MCAA 3LO8A 1NJGA 4OQNA 1B42A 5DTQA 2ZAIA 2FZVA 2WWVD 2OV6A 2ATIA 1ZL2A 4O02B 1QNLA 3ABZA 3BB1A 4ACAA 1Q8KA 1PR2A 4TTPA 2ZYIA 3IIEA 3RSFA 1H2HA 1V7CA 1L3UA 7ICHA 3CFYA 1YDHA 2XDQB 3R7WA 4DLNA 4F7WA 2AC4A 4Q3OA 2BZ0A 2Z1NA 4PLWA 1KF0A 1T36B 5SYMA 4K6MA 4Q66C 3UEOA 2PCLA 5IC4A 1OW5A 1AN0A 4IUDS 4R1LA 2FE4A 4QL3A 2Z8XA 2A57A 2XB9A 3HB1A 3K0EA 3M5WA 2WKQA 5BOVA 5IASA 1SH7A 3M2TA 5EJAA 3SP1A 3UXNA 4ZU1X 2NPIA 5DOZA 5JAQA 4DDVA 3BQ0A 3KKAA 1XVTA 1WUYA 2NO7A 1V96A 2VYVD 3FVRA 1I2ZA 4R5HA 4C5AA 3T5KA 4Q9LA 1HA3A 3BSSA 4RVDA 3W3AH 1Y6JA 3OE4A 2L82A 2B99A 5K51A 3AUXA 3AL3A 3WGMA 1TC1A 4QX6A 2J5BA 4BTVA 1XU7A 4YUXA 1MW8X 1GADO 3Q7PA 3ZCSA 3JQGB 3WC4A 1U4SA 2DF8A 1QP7A 4AYXA 1GFIA 1ZGZA 4IQ0A 3O4GA 2OT3B 4YCNA 1CUWA 3B13B 1IQ0A 1ZAKA 1GCIA 4RL6A 4ZARA 5F5XA 3JQPA 1CERA 3TUIC 4DJFC 1LVGA 3T5PA 3IBYA 4LMRA 2P11A 3CGGA 1PJ3A 1NQUA 4G9BA 1D4ZA 1YKSA 4X7MA 4MRAA 2WSMA 3X1JA 1NSTA 6CHYA 4D26A 2JCBA 3C6KA 3R9KA 3M6XA 1S8OA 2VBIA 4BZWA 5HQ3B 2W6ID 4O3OA 1CEQA 2YHBA 3I2GA 4MCHA 3H7IA 3PIRA 4QU9A 2CB9A 2LCFA 2VP9A 2XMGA 3DMHA 3E6AA 4I8DA 8ICZA 2WWWA 5TPWA 3WB2A 3WZMA 4F4WA 1HT0A 4PHAA 2O7NA 1PKEA 1Z00A 3OCJA 3ZIAA 4ZOBA 4IWYA 2I9KA 4HEJA 4BX9C 4MLPA 5AI5A 1RABA 4R1QA 3QELB 4HTFA 5EIAA 5J5CA 3VPAA 3FGOA 1T6XA 1FMJA 1US8B 3SZ3A 3BTSA 4XDZA 1EP1B 2QMQA 5LJIA 3C3PA 4UM9B 3QLUA 1DO2A 1SPXA 1RLMA 3TWOA 4XJTA 3U9LA 4DMKA 2GBGA 2PUCA 4GBJA 1BDHA 3FMGA 3PITA 4WUTA 4HWRA 4F92B 3T7TA 5I7AA 1ZH4A 2NG1A 4V02A 1VMIA 4ZVVA 3S55A 1O95D 2TRSB 1D8LA 1FEZA 1XTQA 4FE3A 1S8AA 2QW8A 3U4QA 1AZWA 5JMPA 2JIZA 2EATA 1J07A 5AJVB 2KK0A 5A4AA 4QICA 3ZWXA 5J2AA 1U4NA 3TCKA 3IPXA 2FR8A 1QGUA 2ZYTX 2H08A 4IIBA 5A4IS 4J3FA 4M8NE 1T5IA 3MMPA 3OOEA 4JJFA 4PGMA 1G2IA 1OYWA 5JC8A 4FJ1A 4KQ6A 2WJWA 1FX0A 1TQ8A 4GM1A 3U7QB 3WMGA 3ZWMA 4OQ4A 1U7PA 3P1JA 5LXTB 2OHFA 4RQ8A 3PZPA 1PNTA 1XWIA 2GILA 1J0XO 3KZKA 2HHAA 4QBTA 4ZT2A 5HFAA 1I2CA 5F3DA 4ZCLA 1LTHR 1K6JA 5DG8A 4MV6A 4IZOA 3RRMA 5FPKA 3DMTC 4JB8A 4FMBB 4FQ7A 3WZLA 2FPMA 4HWGA 1KYIA 4D3FA 3DL0A 2OE2A 3QIVA 3FNRA 4P2GA 4U2KA 3TBFA 2PPVA 4F60A 2JVIA 1KQPA 4E0DA 5LJLA 4C14A 1V7PC 1F44A 2JCXA 2NO0A 3EN0A 2C4NA 2G8LA 2LD4A 2DHRA 4P08A 1JECA 1QF6A 2CLMB 4NYJR 2FP3A 4NL4H 1ORRA 3LS2A 3R0QA 1Z19A 5KX5B 1EE1A 2H2AA 3RVRA 5BQFA 2JVJA 3DGFC 2CXSA 4PZYA 4G4GA 5AW2A 4FSXA 1RI4A 1YD7A 2C59A 3DUFA 1SD2A 3IBCA 3OE1A 4H1UA 4IKOA 4J4BA 4RS4A 3AJEA 4PXSA 3GP8A 2EQ5A 4M1SA 2HRBA 3GLVA 4BN0A 5B53A 4IS2A 3FPEA 5L1LA 1MG5A 3Q88A 2WZQA 3OLXA 5DPMA 3BZWA 3V8NA 3GUHA 4RK0A 4H2DA 1G20B 3PWKA 4AY4A 1KIFA 2ZJ5A 2AJTA 3IR7A 3SHOA 2P3QA 4BCCA 5KPJA 1K4KA 2E9SA 2QSYA 2CGEA 1EE9A 1DRJA 1U2GC 1JUDA 2UVWA 2XQIA 3DDWA 4P93A 4NCIA 1EXDA 3E22B 2XF8A 2VDQB 3FNEA 2GBFA 4RZSA 3EX7C 2NUPB 3RJGA 4HZGA 4B82A 2FW7A 1IHYA 1N7JA 4PL2A 5ALQA 3G7SA 2PLAA 3JQBA 3F67A 1PTJC 4BYMA 3NBFA 3EWAA 1IE3A 2DPXA 4EOGA 5KOJB 3ESXA 2UXDB 1JYEA 4QDJA 3PT5A 2GAJA 2XUIA 1A8HA 1IQPA 1QIIA 3ZEAA 5IH7A 1KEWA 4ND7A 5LWHA 2JAHA 1PX0A 1KI3A 1Q92A 2JI6A 1XCGB 1UZAA 1CR1A 2OGSA 2OHXA 2GARA 4RDHA 2HHTA 4YVZA 2XADA 3RARA 2XUAA 3LECA 4J2TA 4FKBA 3A6ZA 2B92A 4X5VA 3KQSA 2H18A 1I5OA 1SN7A 3AUFA 4MYSA 5BOLA 1A8UA 2HPVA 2OCDA 4KI0A 5JHGB 2WILA 2ONJA 1YE5A 1Z13A 4I99A 2A5JA 2R7MA 3KQVA 1JDSA 1VE3A 1JALA 1LPAB 2VXOA 1JEQB 4HYEA 4IJWA 4URYR 1JYSA 3RVNA 4DJJA 4EA8A 4ESHA 2C7PA 3QU2A 4I6EA 3PEWA 3AJDA 4OLHA 1IK4A 1JEDA 5EMLA 3MBKA 5IN4A 1V5IA 2FSUA 1VJDA 4ZODA 1Y8AA 5INTA 5K7SA 1MA3A 2VNKA 4M3NA 1DJPA 4NK5A 3T1OA 5IF9A 2GHQA 5ES3A 4C0KA 1GGMA 1ML4A 1HYQA 1RRGA 2UVPA 1AU9A 3RVQA 5DTJA 3S7TA 4F4UA 4TQRA 3NNNA 4GEGA 2IV2X 5IYZB 1PJTA 2PRZA 4YD2A 1N9GA 4X71A 1QGDA 5AW4A 1HKUA 2AXEA 4BRUA 4W5NA 2P5UA 3OZSA 1ZBDA 3HVUA 3TTVA 2QT1A 1RBZA 4G5XA 4E12A 5TGZA 2FMTA 3NUQA 1PL0A 3OZRA 2PAAA 1TPZA 4II7A 4IOMA 4BFTA 1VIYA 1LBIA 1YJAA 2OSVA 4K9OA 4KQJA 1ZOPA 1U3UA 7ICTA 5B3LA 5KTQA 1P39A 1LDGA 2LUOA 3BMXA 3Q2OA 4BWGA 5BN4B 4Q44A 3N97B 4LX0A 3TAHA 3CWZA 3QVLA 4BZZA 5CAEA 3PC8A 3OTWA 1Z07A 3ABRB 2EIHA 2FJ6A 1EP9A 3KOUA 2WB1C 2X1VA 1TEZA 1SB3C 3R77A 3OAAD 2ZAYA 4M0CA 5FLEX 1CYDA 1CP3A 2I6UA 3GVCA 3N0VA 4QEDA 3OCUA 1ZQVA 2KSOB 4N3GA 1N6PA 3W6PA 3ESAA 2UVDA 1KH3A 3A1FA 3FDIA 3GJ7A 4UPVA 3V97A 1PEKE 5T4FA 2R00A 1CXZA 1KEEB 3HC7A 4YJDA 1IBCA 2Q3FA 1D8BA 4IMRA 1OT3A 1OX5A 3C1ZA 1XI2A 4X92A 4ESVA 1KDTA 2ORIA 1OI3A 4V0RA 2UVUA 3FWZA 4ARZB 1XFDA 2D00A 3AL2A 4YMOA 4KQGA 1CW2B 2GASA 2Q5QA 3UAYA 2BH2A 4DRXB 5MDHA 1IJEA 1MLDA 3DONA 1RQRA 5ALJA 1XJQA 4AJEA 4QPCA 1QGUB 1EWRA 3DEFA 4QASA 5AHOA 1U3DA 1XNHA 4P4OA 3K53A 2FUG1 1ZD8A 4C2UA 1IBSA 2XITA 3F4LA 4TURA 1LLCA 2YYYA 2RGXA 2SICE 4UB6U 4KIWA 3DDCA 4BASA 2ACKA 1WCXA 3GXBA 1C7IA 3TCXB 1NK6A 1VHTA 5KG3A 2OZLA 4XM2A 5DEOA 1C7ZA 3RSQA 4UTVA 2H29A 2WAQC 1DDOA 2QLMA 1IATA 4BL5A 3E8SA 2YVLA 4JLJA 3HEMA 3W1WA 4O4JA 3PE3A 1BHSA 3VR3A 2WOOA 1UBTS 2B35A 3NQ41 4MV7A 1N4AA 4YYEA 5JSZA 1Z0AA 3CW8X 4JD5A 1C7QA 1UOEA 4MV9A 1AT1A 1HY3A 1MH1A 1IOLA 3N6XA 1PVOA 3RUPA 2ZIZA 3E15A 3L93A 3AHJA 1AGYA 2DH6A 3GXOA 3LHKA 4CKBA 1Y1QA 4EYHB 1YBMA 3NH6A 4Q7LA 3BPSA 2ZBUA 4EGAA 1QP0A 5HW0A 4BQFA 1KYQA 3LSYA 1ZQLA 2C04A 2HXSA 2Y92A 1KFBB 1RJ9B 3NVMB 1HUQA 2YXEA 4JLBA 5FTJA 5JH7B 2YV4A 2BGTA 1A2BA 1U6JA 1DUIA 2AZ4A 1X80A 2HPZA 2WZDA 2Y4NA 3C0KA 1EDEA 4WJZA 3TZQA 2JI9A 3A1SA 3V8EA 2GS9A 1QIJA 1IXKA 1SXJD 1KVQA 2R751 4FBLA 2CZGA 4DT1A 3KL2A 3KVNA 4FFDA 1WULS 2Q3BA 5DYYA 4HH0A 3OETA 4R8SA 3KXPA 3HV0A 2Y0SC 2WG1A 1DEHA 4HJRA 4L9SA 5FDFA 3KR1A 3QF4A 1RRPA 1FDVA 2OWOA 3K0CC 1H38A 1X7GA 1OYVA 2BIFA 2HBRA 1ZWLA 4DE5A 3ANYB 4UNNA 2IH5A 3TRIA 1NFRA 1E1NA 1QZXA 3F8WA 5FOTA 4RV9A 2QSZA 3PGJA 1QH0A 2Q9UA 1SU7A 1RM4A 2KMLA 4ZOLA 2X3FA 1DFHA 1XFAA 4BFWA 1MA0A 1U1EA 4IW3B 2CHEA 3WB0A 4FOOA 2ZI3A 3PQFA 1J56A 3QMMA 3TN7A 4YUAA 1OJLA 4RYLA 1AV7A 5BNWA 1N1EA 2N9UA 3RJFA 2C2XA 4KYIB 4EVSA 4D3ZA 4QDTA 4R0MA 4L8LA 2CLCX 4P3KA 2CL7X 1I32A 1HH4A 1JWAB 4IM7A 5F23A 3R0ZA 1UDRA 2QARB 1O1YA 1BYIA 1OTHA 2Z3ZA 2ZWIA 3MGCA 4OO3A 2F55A 3LF2A 1XN1A 3VO1A 6LDHA 4W5QA 2OH2A 4NZNA 3H99A 3KWMA 3OPVA 2F77X 3TKAA 3ZHUA 1KTIA 1JS1X 2WLTA 4C0WA 5JAHA 1E3MA 2O8VA 4YXMA 2PSJA 4MYCA 3KAJA 3PNYA 3CSUA 5G0SA 3ZK8A 2HHHB 2QV0A 3QFCA 1VLQA 1P5ZB 1I36A 1W8IA 1JKJA 3KLBA 4GGMX 4MVJA 1VBNA 3RS9A 3ZHBA 3F4BA 1Z2AA 2GPWA 3GJSA 3HP6A 1USGA 1IMOA 3JYLA 2R79A 1Y8QB 1B43A 4URFA 5CRXA 2AOTB 3KEFA 4ICIA 4M1WA 1LQTA 2HK8A 3HKCB 3LL7A 2WVJA 4B84A 4ZYYA 1FUUA 1XPJA 2I4LA 4LWPA 4O4JB 4XR4A 4YB8A 3GA5A 2UVVA 1Z3EB 1UJ2A 4L8GA 2IU0A 1B23P 2ZYSA 4D4JA 1R6DA 3PHLA 4LUCA 3PYXA 1K75A 2VA3A 1AQYA 2IDMA 2JI7A 2ZSEA 1AV6A 4EENA 2JANA 2H6EA 2AI3A 2DVMA 2QL9A 3IHTA 2HW3A 2ISOA 4CL0A 2IZOA 5IKEA 3WG9A 3PXEA 4BAGA 4YMMA 1HV8A 2IS6A 4HNRA 1KRWA 3JZIA 4X1OA 4KACA 2JEJA 1G8FA 1R0SA 2RHWA 4HMPA 5AXCA 3LWDA 2PJZA 4EKYA 3VYUB 1GSOA 1FLAA 4JGGA 4BNXA 4D56A 1U48A 3OX3A 3X1WA 4EEYA 5EKTA 2G04A 5HM6A 5EERA 4YIHA 5HUJA 4GZLA 4B3XA 2OK8A 1LBTA 2JCYA 1UP4A 4HVLA 1SVWA 3QQ5A 1JEAA 2G1KA 3JZAA 4MS4B 2Z2XA 4EF5A 1CRQA 1OE0A 2IDZA 2GLTA 1M2WA 1I4TD 3FI9A 4NH0A 4B81A 2O2XA 4QG7A 1JYFA 3G6WA 3S29A 1B3RA 1NJFA 4RDIA 1DXYA 1F4VA 5JJBA 1E0AA 2P77A 2OO7A 3RK1A 2FDCA 3S28A 3WGUA 2OBBA 4AK9A 3QKUA 1BCRA 2CL0X 2NRVA 2H2GA 2WSBA 2YJ6A 3EB9A 5FL7D 1DKMA 3K2IA 4AG5A 2NADA 4DSAA 3CX4A 4HVTA 4G0OA 2EGUA 3PVZA 1JPJA 1HT2E 4PNZA 4D9HA 3C23A 4RV5A 4BNKA 1V95A 5KT7A 1ZNWA 1GYPA 1A9ZA 4V1CB 4B9UA 5KB3A 4IKEA 3C5VA 3EULA 2A4MA 1K5DA 1KC3A 5JSUA 4F93B 1QGYA 2FPIA 5AYVA 3PO5A 2YWJA 2WTFA 1NTRA 2BFFA 3H2HA 4IWXA 3ES9A 1XQWA 2QSUA 3C5CA 3PQ7A 5HX7A 1PK9A 4AYTA 1NVAA 1NK5A 1EH5A 3MFHA 1JFFB 1NUSA 1V3QE 2PVPA 3I9V6 3QVWA 4K87A 5ER6A 3TFSA 3TAUA 1FYXA 2MINB 4N03A 2PUFA 1S5PA 3SE0A 4CMGA 4PVCA 2Q6KA 5AM4A 1ZCZA 2MYUA 3FC4A 1D2MA 1THGA 1XVVA 5HEKA 5KFKA 1E2FA 2WTMA 2E55A 4AP6A 1CJMA 1RWXA 3FKSD 5TX7A 1D7AA 2E4AA 4G1MB 3STHA 2VNJA 1EGHA 2PRYA 3BCRA 1CCWA 2ONCA 1HSZA 2AR0A 1LW6E 2H2DA 3FNBA 3HKCA 4QO8A 3IQZA 5GAJA 1YA4A 4TT3A 3SYMA 3TFRA 3SC6A 2V4UA 2XWSA 5CJ7A 1V47A 3IMGA 2OKCA 3NC1C 1P29A 4O3QA 4B73A 3FTCA 3HUFA 1ZUHA 2CCJA 1GGFA 2P78A 1X1AA 2RIRA 2KQUA 1RAHA 2WT9A 1N5IA 2XKJE 3JARB 2DWCA 3PC6A 4GRDA 5G5GA 2QMOA 2CBZA 4FSDA 5J47A 5F9HA 2F90A 5BVGB 1T2EA 3F53A 1A8QA 2FETA 4KMSA 5EJMA 5LMCA 1PK1A 3GJXC 3KV1A 2FZCA 5D2CA 2HA2A 4EHKA 2QI9F 2C9BA 1YQ9A 2P9YA 2DRIA 3DZGA 4LK2A 5DIZA 4BUZA 3U1BA 2R8GA 2QZJA 3EPKA 2I8CA 1WMSA 2X15A 1RQNA 1WL8A 4I3FA 5J40A 4WN3A 4D9CA 4EUKA 4FPXA 3I4FA 3K96A 1P1CA 2PBRA 2VJQA 4KQ9A 1EG7A 5C1BA 3KPYA 3A8TA 2A30A 1E6KA 2I6FA 3IT3A 4OCZA 2Y4OA 3A32A 1CZNA 1SVSA 4PPXA 1I7NA 1MDBA 1OREA 1SQ5A 1DFGA 2HWWA 2IA5A 3EC7A 3FY4A 1W2WB 3M9XA 3V4FA 5T3YA 3ZU2A 3VC8A 3EODA 3RB4A 2C2DA 4HH1A 3W05A 1BPXA 4IINA 1M1YB 2AG5A 5KFHA 5HIAA 3R0IA 4GLOA 3S1AB 4BP1A 1S7GA 3CNNA 4PG8A 4DB2A 4K81B 3G13A 4PH5A 3SBXA 1ZICA 1P72A 4OYHA 4L8FA 3SZMA 4A0RA 1GPYA 5TVGA 1N0VC 4KKXB 5FFMA 1KSPA 3BICA 2KI5A 3PGKA 3WV5A 4LFAB 5EE5B 4GVXA 5IC6A 4YHHB 1YQDA 1RYDA 1TMYA 3OE7A 4WADA 1Z26A 1I1QB 1W0JA 1P0FA 3IMKA 1QZZA 1A72A 2WRZA 3L49A 5FNVB 3CISA 4Z0PA 5KVQA 5U4XA 4F6CA 1J1IA 3RBVA 2P65A 2H3FA 1AQLA 1K06A 1N2GA 4CKBB 1V85A 4JENA 4U0JA 3SHQA 4NYIQ 1RWWA 2P9TA 3TQIA 1KQNA 2CNWA 2D2XA 5LYJB 4B4VA 1FFDA 3ZV7A 3UJHA 1CWUA 4OXQA 1EI9A 1FDTA 2G5TA 4M9GA 4NAUA 3DV0B 1W5BA 3LYHA 4S1VA 2A9OA 4X63A 1EM8A 1D9DA 2FHPA 3G2KA 3R5SA 1EMDA 4F12A 5F9FA 2E82A 4RSMA 4F4HA 3WKAA 1XZDA 4OJ6A 1QFZA 4NAHA 4ASUD 2XQGA 3NJ8A 3MCAA 1LBSA 2PH7A 5E4YA 4WCFC 4BX3A 4D96A 2J4DA 4GG1A 1ZQRA 1S4MA 3OZGA 4DLYA 1JR3E 1NXXA 4P7KA 4ND4A 4KVZA 5EFZA 1DHRA 5C1IA 3BJMA 4X95A 1A27A 2HWXA 2ZRIA 5DN6D 1BYUA 3DXFA 4HDKB 1Q0UA 1WQ4A 2CD7A 2QWXA 1HOTA 3KVYA 4BMNA 5BV8A 1O89A 1NP7A 2V9ZA 2HY7A 3F46A 3GLGB 1Y4DE 4JOBA 1XYYA 4YCLA 2ZROA 2JLVA 3EVDA 3AL0B 2JARA 3GYBA 3UT5B 1WW2A 3WYNA 4BJ3A 2H54A 3D3NA 4M89A 1XPOA 2WAOA 2GFQA 2WUGA 1Z4NA 1MORA 4LRSB 1AD2A 5IC5A 3WFIA 3UYLA 2W22A 1XA3A 1ND5A 1E32A 1ZQSA 2IYNA 4NPAA 1M8KA 2VUHB 7ICSA 4KLHA 1BRMA 1SKAA 1WDKA 1E0DA 1HE3A 4NP6A 5P21A 3KKOA 3EJ6A 4HNSA 4QNNA 1QP8A 2B4YA 4EFKA 2O06A 2PZAA 3KZVA 1RPNA 4J9LA 3L6OO 1STOA 4P54A 3AMVA 1IM8A 3T3DA 1M7GA 1UEJA 2I55A 2QTVA 3OZUA 4GC7A 4LMBA 4M1QA 5E2BA 3UCEA 3CW9A 2EFHB 3GLFB 5JBIA 3IPAA 1VLMA 5AUNB 2HW8A 2HWYA 3DE3X 1LVUA 3EVGA 4MVJM 3NTQA 2EV9A 3QEMB 3FETA 1DOQA 1D0SA 2PL9A 3PEVA 1XSLA 3FYDA 3T34A 5DVZA 2WKRA 4Y9UA 2O8EA 3MINA 4NNJA 3TB4A 1G5PA 2NU7B 5ALOA 2ZS8A 1QDUA 1DKLA 1Q83A 3M6MD 1DWUA 1N3YA 1UIMA 1VLHA 1OB5A 3OSZA 1QGAA 5A5DA 1AZTA 4US9A 4LZLA 4II2A 1HDZA 5A3VA 3I12A 4GICA 5CR9A 2AJQA 4R65A 1GN8A 3D3JA 3D6JA 1LRLA 5B1DA 5HFNA 3P9RA 2J0UA 1F38A 1LW7A 4C6RA 5DFAA 2ETVA 4EB0A 1DKOA 3AOEA 3B5IA 1KORA 3H1BA 1Q84A 4EZIA 2A14A 2BC9A 3FOEC 1Y9AA 1QHEA 1WY5A 2XYHA 4ZCTA 5KU7A 3WTBA 4KQWA 3W8RA 3TSYA 4Z3KA 5L3QA 4CNQA 1H3FA 4DV3B 4A36A 4CHTA 3SHVA 5CB6A 3GRKA 4CLHA 3F7MA 4GM0A 3RUAA 1IWOA 3G0CA 3PL1A 2FQYA 2LPEA 2Q07A 3VAAA 1XAHA 3DYVA 4PG6A 2YVAA 1QG4A 4EI8A 3KD3A 2CHUA 4M04A 3KZMA 4MR9B 4ZO6A 2R8KA 1P18A 4DL9A 2VPIA 3FHLA 4C8OA 1N2IA 2BSQA 5K8IA 5FO0A 4QFBA 1VB5A 4JBYA 3RFUA 2NVWA 2XIDA 1MRNA 2I4IA 2VYQA 2C5EA 1SKYE 1V35A 4KH0A 4H6VA 5FOSA 5J2EA 4PYQA 1FFBA 2XZTA 4X3CA 1YZQA 2ECQA 1S77D 2IYZA 2NIPA 2Z8YA 4GSKA 4M9UA 5FUYA 2FZKA 4ARBA 3HXPA 4WW0A 5I51A 5ITWA 1FTGA 4X45A 3MBYA 3KKNA 3KYJB 1DLJA 1KMHB 2B1GA 3E81A 4HQOA 5EUCA 1VJ0A 3BQMB 3KFVA 7GPBA 2DUWA 1QYDA 2FEPA 1DQZA 5CDFE 1KRXA 2FMPA 2I1VB 2I7XA 3F3SA 5AICA 3KKLA 4IIVA 4J49A 3KQHA 2AVNA 1YBVA 2QRVB 2R4QA 4F8RA 4DLRA 4KAAA 5A02A 4FBGA 1OZGA 4N0QA 1BCSB 3TZCA 4E46A 1NOIA 1UPTA 3KE8A 1M6VA 2ZSKA 4MKIA 3SQIA 5AESA 2ZSDA 3RYFB 4BMZA 3HU2A 2KJ5A 3RDPA 1I1NA 4PS1A 5F7OA 2DZDA 2AD1A 2AMYA 2ZM5A 3L7OA 3BMCB 1AA6A 2C99A 4EJSB 1SKQA 3WA7A 1NM5C 2CDAA 3R6TA 4EX6A 5CH5A 4N7JA 4BMYA 1WY7A 2JJ1A 3BORA 3IUBA 3JARA 4DL3A 2IEBA 2QTWB 3P9KA 2IEYA 2VNIA 1BDBA 2Z5VA 3KM0A 4QUDA 8ICAA 5FFFA 3THWA 3WMEA 1WHTA 4WNCA 3QYFA 4LXUA 4LC9A 4TYWA 3V6HA 2WF6A 4O4LA 4CT4B 2H5EA 1HDXA 3A6EA 2W83A 3MTGA 4TWBA 2P2CA 4ZO8A 1X1SA 3DVSX 3T4UA 1P91A 3NPAA 3MGKA 2NZVG 1V97A 1MIHA 3NOVA 1E1CA 3P2MA 3WIEA 4DEYA 1KO5A 4FT2A 1XDUA 2GZMA 4ED8A 5EIFA 4YUWA 1CJVC 1I3OA 3O4IA 5BMVA 5IZCC 3TLEA 2X0KA 1UJ4A 4PPGA 2W3RA 4UB4A 3DOHA 4ALLA 4DPMA 1C2YA 5LP6F 1G8YA 2RHBA 3THOA 4LZDA 2IEDA 2TYSB 3ROMA 5HVNA 5C53B 4I2JA 1D6SA 4PLPA 3QSGA 4C3UA 9ICCA 4IJ6A 3ZGZA 4U6PA 1R18A 2IXAA 4IL6U 1XVIA 4UCQA 1ZQXA 5DGBA 4DLEA 1C4KA 1JB1A 1E2LA 2D5BA 4NM2A 3AILA 4LX8A 4OQMA 2OXIA 3TRFA 3AQEA 1AKUA 1RCUA 1Z0UA 4I9HA 4O1HA 3DLTA 4Z0HO 4BFYA 4HI0E 2BR4A 3UMBA 1O96A 2GF2A 1HMPA 5L95A 2DFPA 1JDJA 4V2IA 2KJQA 3IEIA 4PLZA 3HCEA 1C29B 1U3TA 2OENG 3MMSA 1BRTA 4I6GA 3WGZA 4LXGA 4BNJA 4P32A 4AMVA 1L9KA 3F9CA 3FCSB 4LY6A 5IAJA 4OX9B 3ONEA 4C3ZA 2I4TA 2AQ8A 3O1JC 3WMRA 1NYTA 1EZ4A 1UMBB 4ZVNA 1Y6GA 1IOVA 1WD7A 1NF8A 3ZWOA 3DOFA 1GPMA 4Q16A 3GJ4A 2IA6A 1J9EA 1VFNA 1ADFA 3Q6NA 3H8VA 3LBHA 1I7SB 1RXIA 5C5EA 3OTHA 4TS3A 1N1GA 1IXSB 1CQWA 2GOYA 2QD3A 3ZI4A 1X7WA 3AV0B 3UMCA 4A7PA 3ID6C 3OPYI 1YUBA 2C2EA 1I30A 1W30A 3B53X 2QN1A 3IO5A 3L8GA 1Q2UA 4I4NA 3JPNA 5FBLB 4DBZA 1E5TA 3IAM1 3NT2A 3RD5A 4MDHA 4CIYA 1VCMA 3EW7A 4DGQA 2NXCA 4LNUA 5G4KA 1VCNA 1C50A 2QRVA 3A9CA 1Q1NA 4Z53A 5JADA 4P31A 2Q9BA 5JZ9A 1Z75A 1N92A 2MSLA 1RLUA 3EVAA 4ZEWA 5J0RA 5A4KA 9GPBA 5M29A 4MITA 3PHBE 1RG6A 1NASA 1VPTA 8ICJA 3ABSB 4YRPA 1QCCA 5EPEA 3AWDA 4I1VA 5C31A 4AZ3B 4C08A 1ONPA 4DSUA 2SHKA 2VK2A 1RWVA 2YZ7A 4J43A 4RD0A 5DM2A 3SZGA 1Z6TA 1ZXBA 2IIQA 4MW0A 4B7CA 4Y2XA 2XMPA 3GPIA 3GVXA 4C03A 1XTJA 1HJPA 4P2HA 3FCEA 3GX1A 5CT6A 5KYXB 4GDFA 1KHTA 1T8RA 3JZMA 3DWEX 3IHLA 3MQ2A 4IF4A 4C4YA 4DYVA 4KPEC 4R3NA 4YFKA 2B8WA 4RQBA 4URVR 2NV0A 2BJHA 2O2GA 3IBGA 3HBAA 3JD3A 1DV1A 4D9IA 3LDGA 3EK2A 2QD5A 3K15A 4JLVA 4NCNA 4X1KA 4QYSA 5EWJA 2P67A 1FQOA 4PY2A 4KE7A 1RZ3A 1NK7A 1GAQA 4NLLA 5EMJA 4PHDA 4C43A 2Q1YA 4I28A 1BDJA 2BD0A 3CV3A 4RUKA 2IS2A 5I9IA 1A5AB 3X0DA 1GKIA 3CG0A 3NXKA 2UUBB 4G86A 4RK1A 3BILA 1GZUA 1DLIA 5HYVA 4G6ZA 4CQLA 2O2ZA 5K03A 1IOWA 1OH7A 5AHRA 3IS3A 2CLFB 3O8DA 1B7GO 3LT1A 4FCCA 1C5KA 1LC3A 5CA1B 1YQUA 1M5TA 4RGBA 6REQB 1NFFA 2P69A 4I6JA 2N1BA 3BREA 3WSTA 3RTVA 1E62A 4JI1B 3UT6A 1ZQMA 1P5HA 1EIZA 4L0DA 1ZQQA 4YJHA 3F0TA 3BRWD 1SEPA 5REQA 3IE1A 1XMQB 2DPLA 2XMBA 3EBPA 3E8MA 4B48A 2M32A 2DJIA 4BVAA 2I7CA 1HE4A 1AKWA 1E63A 1ZP6A 2AHOA 2NZJA 2VQ3A 4K6CA 4NH4A 3V42A 1AUOA 2IBMA 5CFMA 5I8PA 2ZXHA 2CLLB 1SU4A 3T79A 4KE8A 4X6UA 2WQ6A 5J4LA 4JBNA 2BHNA 3FUCA 2NVOA 2R9VA 2WU3A 3NHLA 3OLZA 2P6NA 4XWGA 4S1NA 5ECGC 2V59A 1W85B 2P79A 1ZD1A 2RH5A 5DQHA 3M6AA 3R0XA 5B2ZA 5HF8A 3IPCA 5ALTA 4BV2A 3F5FA 3K2EA 1L7EA 5DM1A 3AVVA 1TJ5A 1QGZA 2E1EA 1ZH2A 2WWIA 3K9GA 4G89A 4JIGA 4CM8A 1U8FO 2QLTA 3FCCA 3KR0A 1XSNA 3V4OA 3OG9A 1AGXA 3ABIA 4NMLA 1M6WA 2G4VA 2JCSA 4Q6WA 3GHHA 1MQ8B 5F2NA 2RH4A 4FS2A 3GNLA 3BB3A 3CEJA 5K0JA 2D2FA 3H97A 2XJ9A 4UXJA