2OEHA

Determination of the three-dimensional structure of the mrf2-dna complex using paramagnetic spin labeling
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
b'RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*AP*CP*AP*AP*TP*AP*TP*AP*AP*CP*GP*TP*CP*G)-3'
publication title Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2oehA00
2JRZA 2EH9A 2OEHA 2YQEA 2KK0A 1KN5A 1KKXA 2JXJA 1KQQA 2RQ5A 2EQYA 5CEHA 1IG6A 1C20A 5K4LA 4LJXA 2LI6A 2LM1A 1RYUA 2CXYA
chains in the Genus database with same CATH superfamily
2AXTU 1VDVA 4RUAA 4DL2A 2MU2A 2YN4A 2W9MA 2KSOA 3ZD8A 4ECQA 3D2SA 1ECWA 2W9BA 3BS7A 5ALHA 1UHUA 3EPGA 1ZQCA 4KLMA 4ED8A 2E1EA 3PW4A 2BDUA 3ETRA 3QYPA 8ICTA 3B0XA 1BPYA 3ZDAA 1LKYB 1WG8A 3T79A 2BCQA 4FZMA 5J0SA 4OCZA 9ICWA 2EZYA 3KD3A 4OJ5A 5KFCA 4EZ9A 4I2EA 9ICAA 3AU2A 5HP4A 1UCVA 2QKQA 3HPOA 1NKEA 3BQ7A 2FLNA 1NOMA 5KFAA 2F8KA 2JEGA 3V7KA 2CXYA 2NRWA 1XSPA 2M0NA 4PZOA 1PVRA 1L3UA 2JR5A 2W54A 1NJYA 2IA6A 1S8OA 2K60A 5JRTA 4M0AA 3HX0A 3MR2A 2RQ5A 5KFTA 2XC9A 2BDPA 1SB3C 4QWAA 1HUZA 2XY6A 2HHTA 5EE0A 4F4ZA 8ICOA 2JH1A 2JGAA 3ZDBA 4F2SA 4B9TA 1SKRA 1CUKA 5TISU 1X9MA 2IHNA 3RJJA 1KN5A 2KV2A 4US8A 1QCKA 4F4XA 4RQ0A 2ZUDA 1QQ7A 4CNQA 4C4SA 1HEKA 4KLSA 2WB1C 7ICQA 4Z6FA 5CRXA 3QU7A 5K4LA 9ICIA 1DK2A 2F77X 1NK4A 1ZQTA 4YCXA 3VCBA 5J0PA 2G09A 5KG0A 5KFJA 5DGBA 4EYIB 2PFQA 2IOHA 4M9LA 3NS1A 4PL2A 2W9AA 3OTQA 4F5QA 3T5KA 3BQ0A 2BPCA 5ALFA 5AK5A 4ED7A 3TAPA 1UA0A 3GDXA 4DL5A 2HHXA 2GOLA 5KG5A 1NNLA 1D9FA 1HIWA 2HHSA 4Y2PA 2ZJ5A 3RH5A 1KSPA 2KKVA 8ICKA 2XY5A 4B6JA 5AKZA 2A1JA 3U26A 4LJXA 2PMZC 3H7IA 2FDRA 3BQ2A 1QTMA 1J2NA 4GC7A 3M8RA 2MUTB 5L1JA 4LZDA 4UASA 5KFIA 5BOLA 4RQMA 4JV0A 4DWIA 2VIXA 3WU2U 8ICNA 2XY7A 5ALUA 5DBAA 3KHGA 4J9OA 4K4GA 4ECSA 3BS5B 2ES6A 3OGUA 2HHWA 4KMOB 4MEYA 3Q8PB 3RRHA 4UB1A 5HMMA 2J6SA 9ICEA 3F53A 5CB1A 1NKBA 3WK7A 5J0YA 2F44A 3HP6A 4OO1J 2XCAA 9ICRA 1H38A 5ALPA 7ICUA 3ICXA 3SR6A 1JROA 5GTIU 2Y0SC 1T94A 4Y2JA 3H8WA 4NY8A 2HBMA 3OHBA 3GIJA 2W9CA 2HHQA 2LM4A 3GFKB 4YMMA 5J2DA 1WCLA 4UB2A 4QJFB 2WFAA 2K8AA 1V97A 3BZCA 2HW3A 5DB8A 1N2XA 1ZRNA 4Z6EA 2ZIWB 1ZQVA 3L5KA 3MGIA 4O9MA 8ICVA 1ZQSA 3EZ5A 1NK6A 2KG5A 2LKYA 2MAXA 5IIKA 4QW8A 2KKPA 4R66A 2YMPA 1ZQBA 3TQ1A 2Y1IA 2I9GA 1AROP 5ALXA 2ODGA 2E8NA 3H8SA 4PHDA 9ICOA 3SZ2A 3I76A 3WK5A 5KFMA 4NLZA 3ONNA 3ZDEA 1ZQYA 3I1YA 4CF3A 2ZUBA 5ALOA 2JZBB 3L4PA 2C22A 3E0FA 3HT3A 1S5LU 1T8EA 2MRLA 3PMNA 8ICPA 1TAQA 3LVVA 4YR0A 2UVRA 2Y9TA 4DL7A 5ALQA 3J81j 4FO6A 4KX3A 1Q3UA 1RYSA 4YR3A 5AHXA 5ALVA 3NTUA 2I1QA 4IR9A 5KFYA 5KTQA 4Q44A 1PVPA 3E2EA 4NLBA 1IM4A 2OWOA 5KAFU 2G08A 1YZ6A 3MR6A 2Y0SF 2FMPA 2K4PA 2LYAA 2LM1A 2KVCA 1XNSA 1SZHA 2DQNB 5DB9A 4B9LA 4O3NA 1BPBA 1VJ5A 3EW9A 2ISPA 3PSTA 3C29A 5ALZA 2BCSA 7ICVA 4KN7A 3H0MB 4QWDA 3QU9A 5AI6A 3PW7A 4Q8FA 3N7PD 1P7DA 4EBEA 2AQ0A 5J0QA 2W03A 4IQUA 2H3FA 4FE3A 1IIPA 4UQGA 4BX9C 1COOA 3GV7B 5J2HA 4Y2TA 4ECXA 5AM0A 4P4PA 4ED0A 1RQLA 5KFXA 4YXMA 5J2GA 4ELVA 1Z3EB 3JPPA 4DF8A 3RAXA 1X2IA 1ZQQA 4GLXA 4RQ2A 1L3TA 3C5GA 1XWLA 4YQWA 1NKCA 2JEIA 3N4MB 2AH5A 4P4OA 2V4QA 5KFEA 3O0FA 4Y2QA 4PHPA 5CJ7A 1S0MA 2AQ4A 1RYRA 3QEAZ 5KFOA 1V9PA 2XCPA 1PUZA 2KICA 5IIIA 4DFKA 3ZDCA 1KFTA 5ALGA 2R8KA 3NVZA 4TQRA 2EZZA 3N97B 4M2YA 1ZJNA 1X9XA 3HKZC 3M8SA 4KLJA 9ICVA 2BPGA 3LWMA 4EEKA 8ICFA 2JRZA 5L1MA 2KZMA 2VA8A 3IP4B 4Y2SA 1F5SA 1SWWA 2QARA 1N48A 8ICBA 4DOAA 3CNHA 2OYYA 2FPKA 2VANA 5J2KA 4US9A 2KHVA 3T3FA 3EPIA 1WWUA 3D2QA 4DQPA 2EAPA 4KX5A 4XA5A 5DDMA 2RLTA 3GU3A 5AKIA 5DGAA 1S97A 1OUQA 4P4MA 2Y9UA 4GXJA 2D3DA 2PI4A 5DQGA 4UAUA 1BPDA 5JTIA 2A19A 5IILA 2JEFA 5CR0A 2HHUA 2KOBA 8ICHA 2KSOB 5KFLA 2L5YA 2W9BB 4C7YA 2DWQA 2BCVA 4YMOA 5G5HA 3MBYA 1ZQZA 3RR7A 1SZPA 4RQNA 4UARA 5ALYA 4FBTA 3TAQA 1RG6A 1X9WA 5KFNA 3B0YA 4OJOA 9ICNA 4IRKA 2BZFA 2B6GA 3JPOA 2R18A 2R8HA 2DKZA 2AGPA 4I27A 4R8UB 2EANA 2WF9A 2DF4B 2WHEA 1D8YA 4XUSA 1ZD4A 4M6WA 1U47A 5ALJA 3PSPA 4ED2A 4KLGA 1KFDA 3V72A 1CRXA 2ATLA 1DOQA 4P0PA 4Y2YA 1SL2A 1ZETA 3R9KA 2ZXHA 2NO5A 1NK8A 3PO5A 3UQ0A 5DKWA 3FDSA 3HKZF 3PSIA 3JPQA 5EE1A 1QQ5A 4MF2A 4ECYA 2FE9A 1OXJA 5J29A 3M7DA 3IDWA 4UB6U 1Q3VA 2ALZA 4GXKA 1WUDA 4EYHB 1TV9A 2ZG6A 2D6FC 1SIJA 9ICCA 2DGZA 4OD0A 3V6HA 4NLKA 4QZFA 1ZQOA 4JMUA 3OSNA 1URJA 4XRHA 3M9NB 2K4EA 4YXJA 4KLTA 5AI0A 1NK0A 4NL9A 3TACB 4UAVA 5J8YA 2YQEA 4O3RA 4O5KA 3IM1A 1KL9A 4XQ8A 1J97A 1SGGA 3HWTA 1S9FA 5DG7A 1NK5A 9ICJA 1ZQLA 9ICPA 3UQ2A 1UQVA 1K1QA 3T5LA 2ZTEA 3RB3A 4TURA 5J0TA 2DUYA 3IG8A 3PZPA 2P35A 2BQRA 1N60A 3B9JA 1NJZA 4I29A 3V6JA 2K89A 1CI4A 3IG5A 4QZCA 3C28A 5KT3A 4RUCA 3PMLA 1KBUA 5KFQA 2G07A 1F0MA 5C0YA 4EBCA 5CWRA 4LZGA 4U6PA 1WCNA 3DDHA 5DDYA 1Z1BA 1BVSA 1PK3A 3CYMA 4I2BA 4RQ7A 5KT7A 5G5GA 1YT3A 2F2AB 3FC4A 3TI0A 3LWLA 4HYKA 4DSFA 3AMZA 3LDAA 7ICPA 2PFNA 1L8OA 3KZIU 5FP0A 5AI5A 4RNOA 4KLDA 5EOZA 2W8KA 3C1YA 5AKHA 2HVHA 5KT5A 7ICIA 4BWJA 4DSEA 3UMBA 2E5SA 4IC9A 3JPRA 1ZQJA 3WK4A 4I2IA 5AI8A 2V4RA 5ALMA 3GIMA 5AM1A 1ZQ1C 1ZQHA 5GTHU 3PV8A 3K4GA 5KT6A 5DQHA 5KL1B 5AKJA 1S76D 1PVQA 3PR5B 1K5OA 4DOBA 2B0CA 2KD1A 3C2LA 2ZXIA 4PH5A 1FO4A 2W9CB 2OCEA 3KOOA 4O5CA 5AIAA 5DB7A 4UB3A 2FJ6A 4QIWC 3RH6A 3RB0A 1D8LA 4QNLA 3H4BA 5D4BA 4NXZA 2CRXA 3LK9A 2YY6A 2AGQA 7ICOA 3C21A 1N5WA 1ZQPA 2F3NA 2YMLA 3CW2C 5DBCA 3KKAA 1OW5A 5KFSA 4IQTA 5DQIA 5AKGA 1WWVA 4KLHA 5D46A 4YVZA 5J0OA 1BGXT 3QZ8A 5AK3A 2KZZA 4QZEA 4BDPA 2F1IA 1UA1A 4CDGA 1QSLA 7ICFA 1BNPA 1TK0A 2BHNA 2GLEA 5AKYA 3KHHA 2WAQC 1ZQWA 1KFSA 4DLEA 5D49A 4JWNA 4I2DA 3A0HU 1QLNA 2K8BB 1MN8A 4ED6A 2VJ4A 4Q8EA 5T14A 4QWBA 2R8GA 3QZ7A 5DLGA 3GZFA 2KIVA 4YD2A 2VA2A 2K8CB 2C2RA 2KN7A 4NWIA 5EE9A 4QZIA 4ECWA 1L6NA 9ICHA 3M6ZA 2JH7A 3MDAA 4F5PA 2WB1F 1BPXA 4RQ1A 2J6TA 3ALRA 3Q8QB 3ETLA 3CRXA 3NGDA 2LYHA 7ICNA 3H0RB 1COKA 3RJGA 2W43A 3S6JA 2KVSA 2KEYA 3FM9A 4ECTA 4I2AA 4C8MA 3ZI4A 7ICGA 3C5FA 1S0NA 1ZD3A 1RQNA 1Y88A 3PW0A 2MA1A 4FZNA 4NL9C 5J8YC 5J2IA 7ICEA 3WKAA 4KLIA 2JMGA 3RTVA 4MFCA 4PHEA 9ICBA 5TZVA 5KFRA 1L7MA 1JUDA 4IQVA 4F91B 2ZTDA 1TAMA 1Q8KA 4MF8A 1IG6A 4Y2RA 5EWFA 2HOQA 2PMZF 2Q4TA 2LHTA 1RXVA 5ALLA 2EZXA 1SV0A 3SI8A 2HMXA 1X42A 2KJ9A 1TK8A 1Z4OA 4EX7A 1ZQDA 3UXNA 5EE3A 3KHLA 3H8JA 2BGWA 8ICYA 4RQ8A 4I2HA 3BQTA 1UT5A 1ZXIA 2GH1A 2QARB 4DQIA 4QWCA 2P6RA 4Y2XA 3SEIA 2DBYA 1FEZA 3MFHA 3V7JA 1BNOA 2BQUA 1D8BA 4M9JA 3HILA 2ZIXB 2XI9A 3KBBA 1TK5A 5AIBA 5KG3A 3K1RB 1UT8A 1C20A 8ICLA 5AICA 3F2CA 2WF6A 1RDFA 2BR0A 2ZTCA 4UAWA 4F4YA 5F3XB 2MSNA 2C2EA 4M04A 4J9MA 1RZTA 4QW9A 4BWMA 2KMDA 2W04A 3Q8KA 3RBEA 4TUSA 4RQ4A 4EX6A 1NK9A 3Q8LA 4ED3A 1MQ3A 4B9VA 3D2NA 8ICRA 1C7YA 3AM9A 3IN5A 3RJFA 3QUQA 4KITB 3QUCA 4RPZA 3JPSA 4I28A 4EZ6A 4PGYA 4O0IA 9ICGA 3K1ZA 2G0AA 4F5NA 4C8NA 3SV3A 5J2BA 2I6XA 4MFFA 4CRXA 1N56A 4P0PB 4UATA 2CPRA 1HUOA 1L3VA 4I2JA 2FLLA 1JRPA 7ICMA 1PK1A 2HBJA 3KKAC 4YFKA 4QZGA 4O5EA 2E3TA 5J2AA 1SWVA 1TAUA 1ZOLA 2ZIWA 4BXOB 1Z19A 4KLLA 1XSLA 4ED1A 1WYGA 2E8OA 7ICSA 1MQ2A 1ZQMA 4TUPA 5H2FU 4C80A 4F92B 2XICA 3HW8A 3G6XA 2ZIVA 3OJUA 7ICJA 3V7LA 3F2DA 3RJEA 2HHVA 4J9SA 3OJSA 3MGVA 4PJ0U 9ICQA 3AQFA 4I2FA 3PR4A 2FPLA 9ICLA 2JZBA 1U9LA 2NV3A 3FYHA 8ICAA 3UPQA 1ZD2P 5EWEA 8ICXA 3C2KA 3RFAA 4ECZA 8ICQA 4CGZA 4R64A 2VKQA 4NLGA 4YP3A 1O03A 2Y1JA 3NVVA 2HVIA 4DSLA 2EAMA 4NLNA 1KRPA 2PI5A 3Q8MA 2E8MA 4FFDA 5IINA 1SKWA 1HJPA 5KFFA 4X5VA 1JIHA 5JU5A 5KNIA 3RBDA 3HRDD 4DF4A 3WKDA 4C7ZA 2NRTA 4UW9A 2BKEA 1JMSA 1U48A 4RPYA 4F50A 5E79U 5KT4A 3QNMA 8ICWA 3PSFA 5IIOA 2NYVA 1JXEA 3M9OB 7ICTA 4QZDA 1Q46A 3V6KA 4F5RA 4ECRA 2IHMA 2BQ3A 3RF9A 4KLEA 2ASJA 3SAGA 4FS1A 5DB6A 5CHGA 1ZQEA 5AI9A 4DL3A 2A1AA 2YB1A 1B22A 4P2HA 2QB0A 4DS5A 1N5XA 2KIWA 4I2GA 2KTQA 1L8LA 3IHQB 2OM6A 4ECUA 3RB4A 3NVYA 1L3SA 5J0WA 1U45A 9ICSA 1RXWA 5KAIU 4UAYA 1MA7A 4JK1A 2KNJA 2N1RA 1S0VA 5KFGA 7ICRA 4KN4A 2LPEA 2P66A 2B21A 3GQCA 1SV0C 3UMCA 5KG1A 4NV0A 2LBOA 2XVTA 3AN1A 2ASDA 3F2BA 2NRXA 3F5EA 2DFLA 3M6KA 4PL1A 1ZQKA 1X6IA 4QZAA 3KHRA 2KE7A 3G6VA 3QUTA 5L9XA 5ALWA 4HAIA 5F9NA 4KLQA 4OJPA 3T5JA 1V38A 5J2CA 4JV1A 2H3VA 2EAOA 3GIKA 4NLCA 2CN1A 2RDIA 4NM2A 3MABA 1ZQRA 3QX7A 2NO4A 4P0QA 2RRDA 1XC9A 4RNMA 2ESEA 5ALDA 2H5XA 2ZIUA 3H8MA 1O08A 3PNCA 2OEHA 3TARA 2YMQA 1MSWD 3C1ZA 2GWSA 4B9SA 4F8RA 3FAHA 3TKAA 5KFHA 4K4HA 5KG2A 5DG8A 1J2MA 3AQEA 2M9NA 5KFZA 7ICKA 4DFDA 2IBKA 3SMVA 2IMWP 2A1JB 4KMUA 1XU4A 4J9NA 1Z1VA 5HHHA 3DEEA 2QB1A 4O3OA 4M47A 2DPIA 4PZNA 4GIBA 4NM1A 2QLTA 3QU4A 4IR1A 1ZQFA 3WK8A 8ICCA 5L1IA 1XS9D 4R65A 2H3QA 1FFUA 1U4BA 9ICMA 1NK7A 4F71A 1RPLA 4O3SA 5KFDA 1KDHA 4RZRA 4J9PA 4RQ3A 3QUBA 3H0LB 2XGPA 4R8UA 2ASLA 4A8EA 1ZQNA 4ZOHC 4DS4A 1YZ7A 4JUZA 3ISDA 2NRVA 2F1JA 4CE6A 4Y2UA 4RQ6A 4R63A 1ZYQA 4AP9A 1VLBA 5KFBA 1XO1A 4ICAA 1ZQAA 2W7PA 2LMRA 3BQ1A 3QU5A 3SD7A 1QQ6A 1QH9A 3GILA 1KEJA 1KLNA 4DSIA 5AK4A 4NJ8A 3WKCA 2NRZA 4LVSA 4I2CA 1N62A 4KTQA 2AHOB 4DSJA 8ICEA 2PFOA 5AM3A 1ZD5A 3QXGA 2WF8A 1Z00A 4DOCA 3MC1A 4DFJA 2E1FA 2WTFA 5J2FA 4F93B 2UVUA 4JV2A 4DL6A 2HOFA 5ALNA 1FIQA 2W55A 3Q8SB 2HI0A 3RJKA 5BPCA 3GV5B 4QZHA 3PO4A 1A76A 2E8PA 3RH4A 2F1HA 2XGQA 1ED1A 2YX8A 4RNNA 2UVVA 4UB8U 4C4RA 2HSZA 4OJ6A 3PVXA 4Y2VA 4EBDA 4Z6DA 2XO7A 2I5HA 8ICSA 4RU9A 3TANA 2KJ5A 2ISOA 3N7SC 1IXRA 4F3OA 4F4KA 2C2DA 3KTQA 3F5AA 2ZJ8A 1DGJA 3E58A 3ZD9A 9ICUA 4B9MA 1LKYA 5KFVA 8ICZA 9ICKA 1N61A 4CCHA 3C23A 2Z7JA 3ZDDA 3C2MA 2IOFK 3SAFA 4BUGA 5HMLA 8ICMA 2JEJA 4MEXA 8ICUA 1QSSA 1S77D 4C4TA 2VJ5A 5AKEA 1TKDA 2JV3A 3NASA 1EXNA 5CEHA 4DO9A 1S0OA 2WF5A 4YD1A 9ICTA 2FMQA 5AM2A 4QIWF 4O3PA 2H3ZA 2IOFA 3NRWA 3D6JA 3EUB2 3SYZA 5KG6A 2G5HB 2UVWA 4J03A 2YMMA 4MFAA 3OHAA 3SQIA 2EDUA 3SENA 2AU0A 1LVHA 3VC8A 1KKXA 4YMNA 4DL4A 2O6KA 3RAQA 1RM6C 4Q43A 2W7OA 1DK3A 2G06A 1A77A 3MFIA 4DFPA 1SXEA 4UBBA 1SXDA 4ACOA 1ZQGA 3Q8RB 1PZNA 5AKLA 4IQWA 4IS7A 4DEZA 2ZUCA 1D9DA 1PK1B 1TFRA 2LYBA 7ICLA 3UM9A 3AEVA 4U7CA 3TADC 5C5JA 2WAQF 2YB4A 4K4IA 1JX4A 4MHVA 4FBUA 1TE2A 4UBCA 2LI6A 4BGDA 3WK9A 5BOMA 1XSNA 2EH9A 2BCRA 1KTQA 2FI1A 5ALKA 5KT2A 1L7NA 2KFZA 4RT2A 5ALEA 5HNKA 3LYSA 4C8LA 4RT3A 2AGOA 1LV5A 2DKXA 2ZIVB 1B4FA 5KL8B 3DV9A 4F5OA 3PW5A 4PHAA 3BZKA 4EEYA 4YN4A 5CA7A 1RYUA 4J9LA 2PXIA 1SL0A 4J9RA 1ZJMA 3JPNA 2K4HA 1ZQXA 2WF7A 1NZPA 2JXJA 1DXSA 4F72A 3LVWA 1UPHA 5L1LA 4EELA 2PKEA 2F8LA 2MUTA 3AU6A 4KLOA 2H3IA 4AYBC 2RDJA 2J6UA 2GO7A 4ELTA 4CF5A 1JI7A 4O3QA 5AKXA 3IRUA 4UB5A 1JN3A 4JB3A 2HBKA 3BS5A 1JALA 4QWEA 2VA3A 5ALSA 1XO0A 4M9GA 2KFNA 4M9NA 1A6SA 1ZRMA 4DLGA 2KZ3A 5DBBA 5AI4A 4TUQA 1NJWA 4M9HA 3RRGA 3KFUF 2BCUA 3UMGA 4B9NA 4M6WB 5AKKA 2HCFA 5L1KA 3ISBA 1TVAA 4BJQA 4PGQA 4KLUA 2F76X 5DG9A 5CP2A 2QB0B 4C0ZA 3HJEA 4PGXA 3A0BU 1F44A 5HHIA 5J2EA 2R8IA 4UAZA 4GFJA 4IL6U 1ZQUA 2C28A 3K75D 1N63A 3M1YA 4FS2A 3N28A 4DQRA 1X9SA 1T3NA 3WKEA 2HDOA 2P6UA 4ELUA 9ICFA 5EWGA 1JXLA 5JUMA 5KG7A 2HBLA 3N7RC 5J0RA 3ED5A 5J0XA 2KK0A 9ICXA 1M6YA 5A0LA 5AM4A 1NI3A 2PFPA 4DSKA 4Q45A 3OSPA 2FPMA 3MGHA 1CEZA 1DGSA 3WKBA 5AK6A 1SL1A 1B43A 4FZLA 4EENA 4QZ8A 1GO3F 3GV8B 2BPFA 2FLPA 1BPZA 4AYBF 4C8KA 4RPXA 3TFRA 5J2JA 4C8OA 4WJ3B 2DL0A 3IV6A 5HR6A 4P0QB 4OJLA 4UB4A 4G3IA 2K4IA 3MR5A 3THVA 2ZIUB 3M9MB 8ICJA 4QZBA 3ISCA 5ALRA 1LB2B 4B9UA 5B66U 4GC6A 1L7PA 4YG2A 4O3MA 3AL0B 1V85A 3QEBZ 2ZIXA 5B5EU 3NVWA 3SAHA 3BJYA 1L7OA 3MDCA 3AUOA 3RB6A 2Q0ZX 3RJHA 2ZJAA 2V9WA 2RHFA 3QE9Y 1X66A 5KG4A 5ALIA 1SKSA 1L5UA 5KFWA 1B0XA 4RQ5A 3PX4A 2R8JA 5IIJA 3H40A 1AQ6A 2OHFA 3EYZA 2RP5A 3T5HA 1T3QA 3MR3A 4DFMA 3H4DA 1NZBA 2A3VA 1BPEA 3L3FX 5IIMA 4KLFA 3PX6A 1S10A 4G9BA 8ICIA 3WK6A 4F4WA 2OXOA 2AJQA 1T4GA 1IV8A 2W3RA 2YTUA 1X40A 2KJ8A 4DCCA 4ZH4A 4GXIA 3JPTA 3PW2A 4F2RA 2D8CA 1X6JA 1KW4A 3SV4A 5KFPA 1FFVA 3G6YA 1K1SA 4DQSA 2FMSA 1MC8A 2OH2A 5AM5A 2EQYA 4Z6CA 3TFSA 4IRDA 3NRZA 4DQQA 2G5IB 3UXOA 2KP7A 3KZXA 1Z4NA 5KFKA 7ICHA 3PY8A 4BXOA 5F9LA 3BDPA 3QU2A 1U49A 2XIDA 3GIIA 3PX0A 2HOIA 3UXPA 3EWAA 2KHQA 4CF4A 2JHDA 2DPJA 1Z00B 1DRGA 1A0PA 3OPXA 4E0DA 1SV4A 4J9KA 4J9QA 4PPXA 1QSYA 4USAA 2W11A 3NUQA 4JWMA 4TQSA 3ORYA 3I28A 3CP8A 3TADA 5DLFA 5HR7A 4YR2A 5KFUA 1KQQA 1T7PA 4IRCA 4ECVA 3RJIA 3RR8A 8ICGA 4QZ9A 5J0UA 1ZQIA 2W3SA 2W8LA 5ALTA 1NJXA
chains in the Genus database with same CATH topology
2JRZA 2EH9A 2OEHA 2YQEA 2KK0A 1KN5A 1KKXA 2JXJA 1KQQA 2RQ5A 2EQYA 5CEHA 1IG6A 1C20A 5K4LA 4LJXA 2LI6A 2LM1A 1RYUA 2CXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRZ A;  2EH9 A;  2OEH A;  2YQE A;  2KK0 A;  1KN5 A;  1KKX A;  2JXJ A;  1KQQ A;  2RQ5 A;  2EQY A;  5CEH A;  1IG6 A;  1C20 A;  5K4L A;  4LJX A;  2LI6 A;  2LM1 A;  1RYU A;  2CXY A; 
#chains in the Genus database with same CATH topology
 2AXT U;  1VDV A;  4RUA A;  4DL2 A;  2MU2 A;  2YN4 A;  2W9M A;  2KSO A;  3ZD8 A;  4ECQ A;  3D2S A;  1ECW A;  2W9B A;  3BS7 A;  5ALH A;  1UHU A;  3EPG A;  1ZQC A;  4KLM A;  4ED8 A;  2E1E A;  3PW4 A;  2BDU A;  3ETR A;  3QYP A;  8ICT A;  3B0X A;  1BPY A;  3ZDA A;  1LKY B;  1WG8 A;  3T79 A;  2BCQ A;  4FZM A;  5J0S A;  4OCZ A;  9ICW A;  2EZY A;  3KD3 A;  4OJ5 A;  5KFC A;  4EZ9 A;  4I2E A;  9ICA A;  3AU2 A;  5HP4 A;  1UCV A;  2QKQ A;  3HPO A;  1NKE A;  3BQ7 A;  2FLN A;  1NOM A;  5KFA A;  2F8K A;  2JEG A;  3V7K A;  2CXY A;  2NRW A;  1XSP A;  2M0N A;  4PZO A;  1PVR A;  1L3U A;  2JR5 A;  2W54 A;  1NJY A;  2IA6 A;  1S8O A;  2K60 A;  5JRT A;  4M0A A;  3HX0 A;  3MR2 A;  2RQ5 A;  5KFT A;  2XC9 A;  2BDP A;  1SB3 C;  4QWA A;  1HUZ A;  2XY6 A;  2HHT A;  5EE0 A;  4F4Z A;  8ICO A;  2JH1 A;  2JGA A;  3ZDB A;  4F2S A;  4B9T A;  1SKR A;  1CUK A;  5TIS U;  1X9M A;  2IHN A;  3RJJ A;  1KN5 A;  2KV2 A;  4US8 A;  1QCK A;  4F4X A;  4RQ0 A;  2ZUD A;  1QQ7 A;  4CNQ A;  4C4S A;  1HEK A;  4KLS A;  2WB1 C;  7ICQ A;  4Z6F A;  5CRX A;  3QU7 A;  5K4L A;  9ICI A;  1DK2 A;  2F77 X;  1NK4 A;  1ZQT A;  4YCX A;  3VCB A;  5J0P A;  2G09 A;  5KG0 A;  5KFJ A;  5DGB A;  4EYI B;  2PFQ A;  2IOH A;  4M9L A;  3NS1 A;  4PL2 A;  2W9A A;  3OTQ A;  4F5Q A;  3T5K A;  3BQ0 A;  2BPC A;  5ALF A;  5AK5 A;  4ED7 A;  3TAP A;  1UA0 A;  3GDX A;  4DL5 A;  2HHX A;  2GOL A;  5KG5 A;  1NNL A;  1D9F A;  1HIW A;  2HHS A;  4Y2P A;  2ZJ5 A;  3RH5 A;  1KSP A;  2KKV A;  8ICK A;  2XY5 A;  4B6J A;  5AKZ A;  2A1J A;  3U26 A;  4LJX A;  2PMZ C;  3H7I A;  2FDR A;  3BQ2 A;  1QTM A;  1J2N A;  4GC7 A;  3M8R A;  2MUT B;  5L1J A;  4LZD A;  4UAS A;  5KFI A;  5BOL A;  4RQM A;  4JV0 A;  4DWI A;  2VIX A;  3WU2 U;  8ICN A;  2XY7 A;  5ALU A;  5DBA A;  3KHG A;  4J9O A;  4K4G A;  4ECS A;  3BS5 B;  2ES6 A;  3OGU A;  2HHW A;  4KMO B;  4MEY A;  3Q8P B;  3RRH A;  4UB1 A;  5HMM A;  2J6S A;  9ICE A;  3F53 A;  5CB1 A;  1NKB A;  3WK7 A;  5J0Y A;  2F44 A;  3HP6 A;  4OO1 J;  2XCA A;  9ICR A;  1H38 A;  5ALP A;  7ICU A;  3ICX A;  3SR6 A;  1JRO A;  5GTI U;  2Y0S C;  1T94 A;  4Y2J A;  3H8W A;  4NY8 A;  2HBM A;  3OHB A;  3GIJ A;  2W9C A;  2HHQ A;  2LM4 A;  3GFK B;  4YMM A;  5J2D A;  1WCL A;  4UB2 A;  4QJF B;  2WFA A;  2K8A A;  1V97 A;  3BZC A;  2HW3 A;  5DB8 A;  1N2X A;  1ZRN A;  4Z6E A;  2ZIW B;  1ZQV A;  3L5K A;  3MGI A;  4O9M A;  8ICV A;  1ZQS A;  3EZ5 A;  1NK6 A;  2KG5 A;  2LKY A;  2MAX A;  5IIK A;  4QW8 A;  2KKP A;  4R66 A;  2YMP A;  1ZQB A;  3TQ1 A;  2Y1I A;  2I9G A;  1ARO P;  5ALX A;  2ODG A;  2E8N A;  3H8S A;  4PHD A;  9ICO A;  3SZ2 A;  3I76 A;  3WK5 A;  5KFM A;  4NLZ A;  3ONN A;  3ZDE A;  1ZQY A;  3I1Y A;  4CF3 A;  2ZUB A;  5ALO A;  2JZB B;  3L4P A;  2C22 A;  3E0F A;  3HT3 A;  1S5L U;  1T8E A;  2MRL A;  3PMN A;  8ICP A;  1TAQ A;  3LVV A;  4YR0 A;  2UVR A;  2Y9T A;  4DL7 A;  5ALQ A;  3J81 j;  4FO6 A;  4KX3 A;  1Q3U A;  1RYS A;  4YR3 A;  5AHX A;  5ALV A;  3NTU A;  2I1Q A;  4IR9 A;  5KFY A;  5KTQ A;  4Q44 A;  1PVP A;  3E2E A;  4NLB A;  1IM4 A;  2OWO A;  5KAF U;  2G08 A;  1YZ6 A;  3MR6 A;  2Y0S F;  2FMP A;  2K4P A;  2LYA A;  2LM1 A;  2KVC A;  1XNS A;  1SZH A;  2DQN B;  5DB9 A;  4B9L A;  4O3N A;  1BPB A;  1VJ5 A;  3EW9 A;  2ISP A;  3PST A;  3C29 A;  5ALZ A;  2BCS A;  7ICV A;  4KN7 A;  3H0M B;  4QWD A;  3QU9 A;  5AI6 A;  3PW7 A;  4Q8F A;  3N7P D;  1P7D A;  4EBE A;  2AQ0 A;  5J0Q A;  2W03 A;  4IQU A;  2H3F A;  4FE3 A;  1IIP A;  4UQG A;  4BX9 C;  1COO A;  3GV7 B;  5J2H A;  4Y2T A;  4ECX A;  5AM0 A;  4P4P A;  4ED0 A;  1RQL A;  5KFX A;  4YXM A;  5J2G A;  4ELV A;  1Z3E B;  3JPP A;  4DF8 A;  3RAX A;  1X2I A;  1ZQQ A;  4GLX A;  4RQ2 A;  1L3T A;  3C5G A;  1XWL A;  4YQW A;  1NKC A;  2JEI A;  3N4M B;  2AH5 A;  4P4O A;  2V4Q A;  5KFE A;  3O0F A;  4Y2Q A;  4PHP A;  5CJ7 A;  1S0M A;  2AQ4 A;  1RYR A;  3QEA Z;  5KFO A;  1V9P A;  2XCP A;  1PUZ A;  2KIC A;  5III A;  4DFK A;  3ZDC A;  1KFT A;  5ALG A;  2R8K A;  3NVZ A;  4TQR A;  2EZZ A;  3N97 B;  4M2Y A;  1ZJN A;  1X9X A;  3HKZ C;  3M8S A;  4KLJ A;  9ICV A;  2BPG A;  3LWM A;  4EEK A;  8ICF A;  2JRZ A;  5L1M A;  2KZM A;  2VA8 A;  3IP4 B;  4Y2S A;  1F5S A;  1SWW A;  2QAR A;  1N48 A;  8ICB A;  4DOA A;  3CNH A;  2OYY A;  2FPK A;  2VAN A;  5J2K A;  4US9 A;  2KHV A;  3T3F A;  3EPI A;  1WWU A;  3D2Q A;  4DQP A;  2EAP A;  4KX5 A;  4XA5 A;  5DDM A;  2RLT A;  3GU3 A;  5AKI A;  5DGA A;  1S97 A;  1OUQ A;  4P4M A;  2Y9U A;  4GXJ A;  2D3D A;  2PI4 A;  5DQG A;  4UAU A;  1BPD A;  5JTI A;  2A19 A;  5IIL A;  2JEF A;  5CR0 A;  2HHU A;  2KOB A;  8ICH A;  2KSO B;  5KFL A;  2L5Y A;  2W9B B;  4C7Y A;  2DWQ A;  2BCV A;  4YMO A;  5G5H A;  3MBY A;  1ZQZ A;  3RR7 A;  1SZP A;  4RQN A;  4UAR A;  5ALY A;  4FBT A;  3TAQ A;  1RG6 A;  1X9W A;  5KFN A;  3B0Y A;  4OJO A;  9ICN A;  4IRK A;  2BZF A;  2B6G A;  3JPO A;  2R18 A;  2R8H A;  2DKZ A;  2AGP A;  4I27 A;  4R8U B;  2EAN A;  2WF9 A;  2DF4 B;  2WHE A;  1D8Y A;  4XUS A;  1ZD4 A;  4M6W A;  1U47 A;  5ALJ A;  3PSP A;  4ED2 A;  4KLG A;  1KFD A;  3V72 A;  1CRX A;  2ATL A;  1DOQ A;  4P0P A;  4Y2Y A;  1SL2 A;  1ZET A;  3R9K A;  2ZXH A;  2NO5 A;  1NK8 A;  3PO5 A;  3UQ0 A;  5DKW A;  3FDS A;  3HKZ F;  3PSI A;  3JPQ A;  5EE1 A;  1QQ5 A;  4MF2 A;  4ECY A;  2FE9 A;  1OXJ A;  5J29 A;  3M7D A;  3IDW A;  4UB6 U;  1Q3V A;  2ALZ A;  4GXK A;  1WUD A;  4EYH B;  1TV9 A;  2ZG6 A;  2D6F C;  1SIJ A;  9ICC A;  2DGZ A;  4OD0 A;  3V6H A;  4NLK A;  4QZF A;  1ZQO A;  4JMU A;  3OSN A;  1URJ A;  4XRH A;  3M9N B;  2K4E A;  4YXJ A;  4KLT A;  5AI0 A;  1NK0 A;  4NL9 A;  3TAC B;  4UAV A;  5J8Y A;  2YQE A;  4O3R A;  4O5K A;  3IM1 A;  1KL9 A;  4XQ8 A;  1J97 A;  1SGG A;  3HWT A;  1S9F A;  5DG7 A;  1NK5 A;  9ICJ A;  1ZQL A;  9ICP A;  3UQ2 A;  1UQV A;  1K1Q A;  3T5L A;  2ZTE A;  3RB3 A;  4TUR A;  5J0T A;  2DUY A;  3IG8 A;  3PZP A;  2P35 A;  2BQR A;  1N60 A;  3B9J A;  1NJZ A;  4I29 A;  3V6J A;  2K89 A;  1CI4 A;  3IG5 A;  4QZC A;  3C28 A;  5KT3 A;  4RUC A;  3PML A;  1KBU A;  5KFQ A;  2G07 A;  1F0M A;  5C0Y A;  4EBC A;  5CWR A;  4LZG A;  4U6P A;  1WCN A;  3DDH A;  5DDY A;  1Z1B A;  1BVS A;  1PK3 A;  3CYM A;  4I2B A;  4RQ7 A;  5KT7 A;  5G5G A;  1YT3 A;  2F2A B;  3FC4 A;  3TI0 A;  3LWL A;  4HYK A;  4DSF A;  3AMZ A;  3LDA A;  7ICP A;  2PFN A;  1L8O A;  3KZI U;  5FP0 A;  5AI5 A;  4RNO A;  4KLD A;  5EOZ A;  2W8K A;  3C1Y A;  5AKH A;  2HVH A;  5KT5 A;  7ICI A;  4BWJ A;  4DSE A;  3UMB A;  2E5S A;  4IC9 A;  3JPR A;  1ZQJ A;  3WK4 A;  4I2I A;  5AI8 A;  2V4R A;  5ALM A;  3GIM A;  5AM1 A;  1ZQ1 C;  1ZQH A;  5GTH U;  3PV8 A;  3K4G A;  5KT6 A;  5DQH A;  5KL1 B;  5AKJ A;  1S76 D;  1PVQ A;  3PR5 B;  1K5O A;  4DOB A;  2B0C A;  2KD1 A;  3C2L A;  2ZXI A;  4PH5 A;  1FO4 A;  2W9C B;  2OCE A;  3KOO A;  4O5C A;  5AIA A;  5DB7 A;  4UB3 A;  2FJ6 A;  4QIW C;  3RH6 A;  3RB0 A;  1D8L A;  4QNL A;  3H4B A;  5D4B A;  4NXZ A;  2CRX A;  3LK9 A;  2YY6 A;  2AGQ A;  7ICO A;  3C21 A;  1N5W A;  1ZQP A;  2F3N A;  2YML A;  3CW2 C;  5DBC A;  3KKA A;  1OW5 A;  5KFS A;  4IQT A;  5DQI A;  5AKG A;  1WWV A;  4KLH A;  5D46 A;  4YVZ A;  5J0O A;  1BGX T;  3QZ8 A;  5AK3 A;  2KZZ A;  4QZE A;  4BDP A;  2F1I A;  1UA1 A;  4CDG A;  1QSL A;  7ICF A;  1BNP A;  1TK0 A;  2BHN A;  2GLE A;  5AKY A;  3KHH A;  2WAQ C;  1ZQW A;  1KFS A;  4DLE A;  5D49 A;  4JWN A;  4I2D A;  3A0H U;  1QLN A;  2K8B B;  1MN8 A;  4ED6 A;  2VJ4 A;  4Q8E A;  5T14 A;  4QWB A;  2R8G A;  3QZ7 A;  5DLG A;  3GZF A;  2KIV A;  4YD2 A;  2VA2 A;  2K8C B;  2C2R A;  2KN7 A;  4NWI A;  5EE9 A;  4QZI A;  4ECW A;  1L6N A;  9ICH A;  3M6Z A;  2JH7 A;  3MDA A;  4F5P A;  2WB1 F;  1BPX A;  4RQ1 A;  2J6T A;  3ALR A;  3Q8Q B;  3ETL A;  3CRX A;  3NGD A;  2LYH A;  7ICN A;  3H0R B;  1COK A;  3RJG A;  2W43 A;  3S6J A;  2KVS A;  2KEY A;  3FM9 A;  4ECT A;  4I2A A;  4C8M A;  3ZI4 A;  7ICG A;  3C5F A;  1S0N A;  1ZD3 A;  1RQN A;  1Y88 A;  3PW0 A;  2MA1 A;  4FZN A;  4NL9 C;  5J8Y C;  5J2I A;  7ICE A;  3WKA A;  4KLI A;  2JMG A;  3RTV A;  4MFC A;  4PHE A;  9ICB A;  5TZV A;  5KFR A;  1L7M A;  1JUD A;  4IQV A;  4F91 B;  2ZTD A;  1TAM A;  1Q8K A;  4MF8 A;  1IG6 A;  4Y2R A;  5EWF A;  2HOQ A;  2PMZ F;  2Q4T A;  2LHT A;  1RXV A;  5ALL A;  2EZX A;  1SV0 A;  3SI8 A;  2HMX A;  1X42 A;  2KJ9 A;  1TK8 A;  1Z4O A;  4EX7 A;  1ZQD A;  3UXN A;  5EE3 A;  3KHL A;  3H8J A;  2BGW A;  8ICY A;  4RQ8 A;  4I2H A;  3BQT A;  1UT5 A;  1ZXI A;  2GH1 A;  2QAR B;  4DQI A;  4QWC A;  2P6R A;  4Y2X A;  3SEI A;  2DBY A;  1FEZ A;  3MFH A;  3V7J A;  1BNO A;  2BQU A;  1D8B A;  4M9J A;  3HIL A;  2ZIX B;  2XI9 A;  3KBB A;  1TK5 A;  5AIB A;  5KG3 A;  3K1R B;  1UT8 A;  1C20 A;  8ICL A;  5AIC A;  3F2C A;  2WF6 A;  1RDF A;  2BR0 A;  2ZTC A;  4UAW A;  4F4Y A;  5F3X B;  2MSN A;  2C2E A;  4M04 A;  4J9M A;  1RZT A;  4QW9 A;  4BWM A;  2KMD A;  2W04 A;  3Q8K A;  3RBE A;  4TUS A;  4RQ4 A;  4EX6 A;  1NK9 A;  3Q8L A;  4ED3 A;  1MQ3 A;  4B9V A;  3D2N A;  8ICR A;  1C7Y A;  3AM9 A;  3IN5 A;  3RJF A;  3QUQ A;  4KIT B;  3QUC A;  4RPZ A;  3JPS A;  4I28 A;  4EZ6 A;  4PGY A;  4O0I A;  9ICG A;  3K1Z A;  2G0A A;  4F5N A;  4C8N A;  3SV3 A;  5J2B A;  2I6X A;  4MFF A;  4CRX A;  1N56 A;  4P0P B;  4UAT A;  2CPR A;  1HUO A;  1L3V A;  4I2J A;  2FLL A;  1JRP A;  7ICM A;  1PK1 A;  2HBJ A;  3KKA C;  4YFK A;  4QZG A;  4O5E A;  2E3T A;  5J2A A;  1SWV A;  1TAU A;  1ZOL A;  2ZIW A;  4BXO B;  1Z19 A;  4KLL A;  1XSL A;  4ED1 A;  1WYG A;  2E8O A;  7ICS A;  1MQ2 A;  1ZQM A;  4TUP A;  5H2F U;  4C80 A;  4F92 B;  2XIC A;  3HW8 A;  3G6X A;  2ZIV A;  3OJU A;  7ICJ A;  3V7L A;  3F2D A;  3RJE A;  2HHV A;  4J9S A;  3OJS A;  3MGV A;  4PJ0 U;  9ICQ A;  3AQF A;  4I2F A;  3PR4 A;  2FPL A;  9ICL A;  2JZB A;  1U9L A;  2NV3 A;  3FYH A;  8ICA A;  3UPQ A;  1ZD2 P;  5EWE A;  8ICX A;  3C2K A;  3RFA A;  4ECZ A;  8ICQ A;  4CGZ A;  4R64 A;  2VKQ A;  4NLG A;  4YP3 A;  1O03 A;  2Y1J A;  3NVV A;  2HVI A;  4DSL A;  2EAM A;  4NLN A;  1KRP A;  2PI5 A;  3Q8M A;  2E8M A;  4FFD A;  5IIN A;  1SKW A;  1HJP A;  5KFF A;  4X5V A;  1JIH A;  5JU5 A;  5KNI A;  3RBD A;  3HRD D;  4DF4 A;  3WKD A;  4C7Z A;  2NRT A;  4UW9 A;  2BKE A;  1JMS A;  1U48 A;  4RPY A;  4F50 A;  5E79 U;  5KT4 A;  3QNM A;  8ICW A;  3PSF A;  5IIO A;  2NYV A;  1JXE A;  3M9O B;  7ICT A;  4QZD A;  1Q46 A;  3V6K A;  4F5R A;  4ECR A;  2IHM A;  2BQ3 A;  3RF9 A;  4KLE A;  2ASJ A;  3SAG A;  4FS1 A;  5DB6 A;  5CHG A;  1ZQE A;  5AI9 A;  4DL3 A;  2A1A A;  2YB1 A;  1B22 A;  4P2H A;  2QB0 A;  4DS5 A;  1N5X A;  2KIW A;  4I2G A;  2KTQ A;  1L8L A;  3IHQ B;  2OM6 A;  4ECU A;  3RB4 A;  3NVY A;  1L3S A;  5J0W A;  1U45 A;  9ICS A;  1RXW A;  5KAI U;  4UAY A;  1MA7 A;  4JK1 A;  2KNJ A;  2N1R A;  1S0V A;  5KFG A;  7ICR A;  4KN4 A;  2LPE A;  2P66 A;  2B21 A;  3GQC A;  1SV0 C;  3UMC A;  5KG1 A;  4NV0 A;  2LBO A;  2XVT A;  3AN1 A;  2ASD A;  3F2B A;  2NRX A;  3F5E A;  2DFL A;  3M6K A;  4PL1 A;  1ZQK A;  1X6I A;  4QZA A;  3KHR A;  2KE7 A;  3G6V A;  3QUT A;  5L9X A;  5ALW A;  4HAI A;  5F9N A;  4KLQ A;  4OJP A;  3T5J A;  1V38 A;  5J2C A;  4JV1 A;  2H3V A;  2EAO A;  3GIK A;  4NLC A;  2CN1 A;  2RDI A;  4NM2 A;  3MAB A;  1ZQR A;  3QX7 A;  2NO4 A;  4P0Q A;  2RRD A;  1XC9 A;  4RNM A;  2ESE A;  5ALD A;  2H5X A;  2ZIU A;  3H8M A;  1O08 A;  3PNC A;  2OEH A;  3TAR A;  2YMQ A;  1MSW D;  3C1Z A;  2GWS A;  4B9S A;  4F8R A;  3FAH A;  3TKA A;  5KFH A;  4K4H A;  5KG2 A;  5DG8 A;  1J2M A;  3AQE A;  2M9N A;  5KFZ A;  7ICK A;  4DFD A;  2IBK A;  3SMV A;  2IMW P;  2A1J B;  4KMU A;  1XU4 A;  4J9N A;  1Z1V A;  5HHH A;  3DEE A;  2QB1 A;  4O3O A;  4M47 A;  2DPI A;  4PZN A;  4GIB A;  4NM1 A;  2QLT A;  3QU4 A;  4IR1 A;  1ZQF A;  3WK8 A;  8ICC A;  5L1I A;  1XS9 D;  4R65 A;  2H3Q A;  1FFU A;  1U4B A;  9ICM A;  1NK7 A;  4F71 A;  1RPL A;  4O3S A;  5KFD A;  1KDH A;  4RZR A;  4J9P A;  4RQ3 A;  3QUB A;  3H0L B;  2XGP A;  4R8U A;  2ASL A;  4A8E A;  1ZQN A;  4ZOH C;  4DS4 A;  1YZ7 A;  4JUZ A;  3ISD A;  2NRV A;  2F1J A;  4CE6 A;  4Y2U A;  4RQ6 A;  4R63 A;  1ZYQ A;  4AP9 A;  1VLB A;  5KFB A;  1XO1 A;  4ICA A;  1ZQA A;  2W7P A;  2LMR A;  3BQ1 A;  3QU5 A;  3SD7 A;  1QQ6 A;  1QH9 A;  3GIL A;  1KEJ A;  1KLN A;  4DSI A;  5AK4 A;  4NJ8 A;  3WKC A;  2NRZ A;  4LVS A;  4I2C A;  1N62 A;  4KTQ A;  2AHO B;  4DSJ A;  8ICE A;  2PFO A;  5AM3 A;  1ZD5 A;  3QXG A;  2WF8 A;  1Z00 A;  4DOC A;  3MC1 A;  4DFJ A;  2E1F A;  2WTF A;  5J2F A;  4F93 B;  2UVU A;  4JV2 A;  4DL6 A;  2HOF A;  5ALN A;  1FIQ A;  2W55 A;  3Q8S B;  2HI0 A;  3RJK A;  5BPC A;  3GV5 B;  4QZH A;  3PO4 A;  1A76 A;  2E8P A;  3RH4 A;  2F1H A;  2XGQ A;  1ED1 A;  2YX8 A;  4RNN A;  2UVV A;  4UB8 U;  4C4R A;  2HSZ A;  4OJ6 A;  3PVX A;  4Y2V A;  4EBD A;  4Z6D A;  2XO7 A;  2I5H A;  8ICS A;  4RU9 A;  3TAN A;  2KJ5 A;  2ISO A;  3N7S C;  1IXR A;  4F3O A;  4F4K A;  2C2D A;  3KTQ A;  3F5A A;  2ZJ8 A;  1DGJ A;  3E58 A;  3ZD9 A;  9ICU A;  4B9M A;  1LKY A;  5KFV A;  8ICZ A;  9ICK A;  1N61 A;  4CCH A;  3C23 A;  2Z7J A;  3ZDD A;  3C2M A;  2IOF K;  3SAF A;  4BUG A;  5HML A;  8ICM A;  2JEJ A;  4MEX A;  8ICU A;  1QSS A;  1S77 D;  4C4T A;  2VJ5 A;  5AKE A;  1TKD A;  2JV3 A;  3NAS A;  1EXN A;  5CEH A;  4DO9 A;  1S0O A;  2WF5 A;  4YD1 A;  9ICT A;  2FMQ A;  5AM2 A;  4QIW F;  4O3P A;  2H3Z A;  2IOF A;  3NRW A;  3D6J A;  3EUB 2;  3SYZ A;  5KG6 A;  2G5H B;  2UVW A;  4J03 A;  2YMM A;  4MFA A;  3OHA A;  3SQI A;  2EDU A;  3SEN A;  2AU0 A;  1LVH A;  3VC8 A;  1KKX A;  4YMN A;  4DL4 A;  2O6K A;  3RAQ A;  1RM6 C;  4Q43 A;  2W7O A;  1DK3 A;  2G06 A;  1A77 A;  3MFI A;  4DFP A;  1SXE A;  4UBB A;  1SXD A;  4ACO A;  1ZQG A;  3Q8R B;  1PZN A;  5AKL A;  4IQW A;  4IS7 A;  4DEZ A;  2ZUC A;  1D9D A;  1PK1 B;  1TFR A;  2LYB A;  7ICL A;  3UM9 A;  3AEV A;  4U7C A;  3TAD C;  5C5J A;  2WAQ F;  2YB4 A;  4K4I A;  1JX4 A;  4MHV A;  4FBU A;  1TE2 A;  4UBC A;  2LI6 A;  4BGD A;  3WK9 A;  5BOM A;  1XSN A;  2EH9 A;  2BCR A;  1KTQ A;  2FI1 A;  5ALK A;  5KT2 A;  1L7N A;  2KFZ A;  4RT2 A;  5ALE A;  5HNK A;  3LYS A;  4C8L A;  4RT3 A;  2AGO A;  1LV5 A;  2DKX A;  2ZIV B;  1B4F A;  5KL8 B;  3DV9 A;  4F5O A;  3PW5 A;  4PHA A;  3BZK A;  4EEY A;  4YN4 A;  5CA7 A;  1RYU A;  4J9L A;  2PXI A;  1SL0 A;  4J9R A;  1ZJM A;  3JPN A;  2K4H A;  1ZQX A;  2WF7 A;  1NZP A;  2JXJ A;  1DXS A;  4F72 A;  3LVW A;  1UPH A;  5L1L A;  4EEL A;  2PKE A;  2F8L A;  2MUT A;  3AU6 A;  4KLO A;  2H3I A;  4AYB C;  2RDJ A;  2J6U A;  2GO7 A;  4ELT A;  4CF5 A;  1JI7 A;  4O3Q A;  5AKX A;  3IRU A;  4UB5 A;  1JN3 A;  4JB3 A;  2HBK A;  3BS5 A;  1JAL A;  4QWE A;  2VA3 A;  5ALS A;  1XO0 A;  4M9G A;  2KFN A;  4M9N A;  1A6S A;  1ZRM A;  4DLG A;  2KZ3 A;  5DBB A;  5AI4 A;  4TUQ A;  1NJW A;  4M9H A;  3RRG A;  3KFU F;  2BCU A;  3UMG A;  4B9N A;  4M6W B;  5AKK A;  2HCF A;  5L1K A;  3ISB A;  1TVA A;  4BJQ A;  4PGQ A;  4KLU A;  2F76 X;  5DG9 A;  5CP2 A;  2QB0 B;  4C0Z A;  3HJE A;  4PGX A;  3A0B U;  1F44 A;  5HHI A;  5J2E A;  2R8I A;  4UAZ A;  4GFJ A;  4IL6 U;  1ZQU A;  2C28 A;  3K75 D;  1N63 A;  3M1Y A;  4FS2 A;  3N28 A;  4DQR A;  1X9S A;  1T3N A;  3WKE A;  2HDO A;  2P6U A;  4ELU A;  9ICF A;  5EWG A;  1JXL A;  5JUM A;  5KG7 A;  2HBL A;  3N7R C;  5J0R A;  3ED5 A;  5J0X A;  2KK0 A;  9ICX A;  1M6Y A;  5A0L A;  5AM4 A;  1NI3 A;  2PFP A;  4DSK A;  4Q45 A;  3OSP A;  2FPM A;  3MGH A;  1CEZ A;  1DGS A;  3WKB A;  5AK6 A;  1SL1 A;  1B43 A;  4FZL A;  4EEN A;  4QZ8 A;  1GO3 F;  3GV8 B;  2BPF A;  2FLP A;  1BPZ A;  4AYB F;  4C8K A;  4RPX A;  3TFR A;  5J2J A;  4C8O A;  4WJ3 B;  2DL0 A;  3IV6 A;  5HR6 A;  4P0Q B;  4OJL A;  4UB4 A;  4G3I A;  2K4I A;  3MR5 A;  3THV A;  2ZIU B;  3M9M B;  8ICJ A;  4QZB A;  3ISC A;  5ALR A;  1LB2 B;  4B9U A;  5B66 U;  4GC6 A;  1L7P A;  4YG2 A;  4O3M A;  3AL0 B;  1V85 A;  3QEB Z;  2ZIX A;  5B5E U;  3NVW A;  3SAH A;  3BJY A;  1L7O A;  3MDC A;  3AUO A;  3RB6 A;  2Q0Z X;  3RJH A;  2ZJA A;  2V9W A;  2RHF A;  3QE9 Y;  1X66 A;  5KG4 A;  5ALI A;  1SKS A;  1L5U A;  5KFW A;  1B0X A;  4RQ5 A;  3PX4 A;  2R8J A;  5IIJ A;  3H40 A;  1AQ6 A;  2OHF A;  3EYZ A;  2RP5 A;  3T5H A;  1T3Q A;  3MR3 A;  4DFM A;  3H4D A;  1NZB A;  2A3V A;  1BPE A;  3L3F X;  5IIM A;  4KLF A;  3PX6 A;  1S10 A;  4G9B A;  8ICI A;  3WK6 A;  4F4W A;  2OXO A;  2AJQ A;  1T4G A;  1IV8 A;  2W3R A;  2YTU A;  1X40 A;  2KJ8 A;  4DCC A;  4ZH4 A;  4GXI A;  3JPT A;  3PW2 A;  4F2R A;  2D8C A;  1X6J A;  1KW4 A;  3SV4 A;  5KFP A;  1FFV A;  3G6Y A;  1K1S A;  4DQS A;  2FMS A;  1MC8 A;  2OH2 A;  5AM5 A;  2EQY A;  4Z6C A;  3TFS A;  4IRD A;  3NRZ A;  4DQQ A;  2G5I B;  3UXO A;  2KP7 A;  3KZX A;  1Z4N A;  5KFK A;  7ICH A;  3PY8 A;  4BXO A;  5F9L A;  3BDP A;  3QU2 A;  1U49 A;  2XID A;  3GII A;  3PX0 A;  2HOI A;  3UXP A;  3EWA A;  2KHQ A;  4CF4 A;  2JHD A;  2DPJ A;  1Z00 B;  1DRG A;  1A0P A;  3OPX A;  4E0D A;  1SV4 A;  4J9K A;  4J9Q A;  4PPX A;  1QSY A;  4USA A;  2W11 A;  3NUQ A;  4JWM A;  4TQS A;  3ORY A;  3I28 A;  3CP8 A;  3TAD A;  5DLF A;  5HR7 A;  4YR2 A;  5KFU A;  1KQQ A;  1T7P A;  4IRC A;  4ECV A;  3RJI A;  3RR8 A;  8ICG A;  4QZ9 A;  5J0U A;  1ZQI A;  2W3S A;  2W8L A;  5ALT A;  1NJX A; 
#chains in the Genus database with same CATH homology
 2JRZ A;  2EH9 A;  2OEH A;  2YQE A;  2KK0 A;  1KN5 A;  1KKX A;  2JXJ A;  1KQQ A;  2RQ5 A;  2EQY A;  5CEH A;  1IG6 A;  1C20 A;  5K4L A;  4LJX A;  2LI6 A;  2LM1 A;  1RYU A;  2CXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...