2OEHA

Determination of the three-dimensional structure of the mrf2-dna complex using paramagnetic spin labeling
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*CP*AP*AP*TP*AP*TP*AP*AP*CP*GP*TP*CP*G)-3'
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2oehA00
2EQYA 2LI6A 2LM1A 1KN5A 2YQEA 2RQ5A 2EH9A 1KKXA 5K4LA 2CXYA 2KK0A 2OEHA 2JXJA 2JRZA 1RYUA 1KQQA 1C20A 1IG6A 4LJXA 5CEHA
chains in the Genus database with same CATH superfamily
3C2KA 1T7PA 2DF4B 1ZYQA 2ZTDA 4QWEA 3QUTA 2XCAA 5ALSA 3IN5A 4GFJA 3TFSA 4K4IA 1IXRA 3T5HA 4EENA 5AI0A 5ALIA 2YY6A 1S76D 4KLDA 4YN4A 4QZGA 1ZQKA 5J29A 3AL0B 5AM5A 2ZUDA 3ZDBA 2W03A 4UAYA 4ECZA 5DQHA 2ZUBA 4YR3A 8ICOA 2J6SA 1KN5A 3ZDEA 3Q8LA 1ZOLA 3HP6A 2KICA 2Y9UA 3M7DA 4I28A 3H4DA 4IL6U 5FP0A 1PZNA 1ZQFA 8ICPA 4FZMA 5D49A 1Z1BA 1BGXT 2C2RA 1Z3EB 4I2DA 2FMPA 8ICXA 2JH1A 1GO3F 4QZHA 1SZPA 1WG8A 3WK5A 2ZJAA 4YMOA 4RNOA 1Q3VA 3RH5A 3JPRA 2YMQA 1ZQNA 3WK9A 1ZETA 2H3QA 3R9KA 1IIPA 3V72A 3OJSA 4YR0A 3TAPA 3GFKB 5KTQA 4C4SA 2PFQA 9ICXA 2WF8A 3L3FX 4C8OA 4MHVA 2G07A 8ICYA 4TQRA 4NM2A 5DB6A 4ZOHC 2W9BB 2VANA 1X9SA 3NTUA 3E2EA 4I2CA 1JMSA 1AQ6A 5EE1A 3C29A 3PSTA 2W43A 9ICPA 2LYBA 2QB0A 4RQ3A 1M6YA 2XC9A 4I2IA 3I28A 3SD7A 4ECYA 3RJGA 4JK1A 2H5XA 2PMZC 4KLIA 4ECQA 1NJXA 1JI7A 2KNJA 3KZXA 1N56A 1ZQDA 4M9HA 5ALMA 4Z6DA 2HHVA 4O5CA 5L9XA 1XNSA 2F8LA 3PW4A 1S10A 4P4OA 3H0MB 4RPZA 2H3FA 1ZQOA 3I1YA 2M0NA 4Z6FA 1X2IA 4KLJA 1L3SA 3RRGA 5KFIA 2G08A 3M9MB 3MFHA 7ICOA 5HMMA 1L3VA 4DS4A 4B9VA 2IOFK 1QSSA 5BPCA 1ZQUA 5ALDA 2YMPA 2CPRA 1PVRA 1Z4NA 3H0RB 5J2FA 4ECUA 5AICA 4MEXA 4IC9A 2AQ4A 1ZD4A 2LM4A 4C7YA 3GIKA 2XGPA 3RF9A 3THVA 1D8BA 4O5KA 4NLBA 1QSLA 4UAUA 2R8KA 2ISPA 3GV8B 5KFQA 1D9DA 2W3RA 7ICNA 1KSPA 3KHRA 1FIQA 1URJA 3PW2A 9ICCA 2DKZA 4R63A 4FZNA 3BQ0A 2GWSA 1V38A 3SZ2A 3WKBA 2KFNA 5IILA 4BWJA 3PY8A 5KFXA 5KT2A 2F44A 1WCNA 5C5JA 2W8LA 7ICKA 3PMLA 4EBEA 3TANA 2ZIWA 2KN7A 2AGQA 5DG8A 3M6KA 3KKAA 2KZZA 5AKYA 2JRZA 2Y1IA 1L7PA 4DEZA 5EWGA 4J9NA 4DF4A 3WK7A 2LBOA 2KJ9A 4RPXA 3KFUF 1CRXA 4J9RA 3OSNA 2H3ZA 4Z6CA 2B6GA 9ICBA 4F93B 2L5YA 5J2EA 8ICAA 1N2XA 4RQ0A 2GOLA 5BOMA 2KFZA 3T3FA 1NK6A 3TKAA 5KFZA 4RNMA 2KSOA 3BQTA 4BWMA 3FM9A 5KG0A 4QZBA 1SWVA 4JV1A 3JPSA 1WWVA 8ICBA 3QZ7A 2D8CA 5KL8B 9ICWA 3MDCA 4CE6A 1BPXA 4R65A 4UB5A 4UATA 2Z7JA 2HDOA 5DGBA 1XU4A 4R64A 9ICMA 1TE2A 4J03A 4NLNA 8ICJA 1IM4A 4OCZA 4OJPA 2WB1C 4KLSA 1ZQZA 2UVRA 3KKAC 1PK3A 5IIMA 4DOAA 4M6WA 1LKYB 5L1JA 5E79U 5KFDA 1H38A 3DEEA 5KT7A 2C22A 2EZXA 5CJ7A 3G6YA 1UPHA 5J2BA 5KFKA 4RQ7A 4F5OA 5CRXA 4J9PA 3F2CA 4F3OA 5DBBA 4PJ0U 5F9NA 4XQ8A 3RBDA 5AI5A 2GO7A 5JU5A 1T8EA 2BPGA 4ED2A 2ASLA 2F1HA 4BXOA 3ZD8A 5AKLA 3HRDD 1XS9D 7ICPA 5KG6A 3KHHA 3K1ZA 2W8KA 4IRDA 2E1FA 4DFMA 2P6UA 2K60A 3RR8A 2PI5A 1NZBA 2FLPA 1O08A 3AN1A 1TAUA 2A3VA 4NXZA 1NZPA 3SQIA 1S0OA 1Z1VA 5TISU 3IDWA 2W04A 3EYZA 1SXEA 2G0AA 1WYGA 2MA1A 4B9NA 3RAQA 1RQLA 5ALGA 3QUQA 3O0FA 4MFFA 3S6JA 4YFKA 2HSZA 1JRPA 3MR5A 4KN4A 5J8YC 1A0PA 4YD2A 2VA8A 4NL9A 5KFEA 2K8BB 2QLTA 2MUTA 7ICMA 3IG8A 4NJ8A 3MR3A 2KIVA 1X6IA 2CRXA 4M47A 1SV4A 3NRWA 4RU9A 1KRPA 3I76A 2ESEA 2KKVA 3NVZA 4I2GA 3UMBA 1K1SA 4R8UA 4J9QA 4DQPA 4O3MA 5KFRA 2PXIA 7ICFA 5ALZA 4C80A 2BCUA 2W7PA 1ZD5A 2WTFA 1DGJA 8ICUA 4NLKA 5C0YA 1S97A 4IQTA 8ICFA 2W9BA 4F5PA 3LWMA 3UQ0A 1OXJA 2WF9A 3NUQA 4BJQA 4Y2QA 5AKIA 1S9FA 2BHNA 4P0QA 2BCRA 5A0LA 5J2DA 1U45A 2BQUA 3MC1A 5KFGA 3UXPA 4KMOB 5ALPA 4UBBA 4MFCA 2VKQA 5KFWA 2YQEA 3RRHA 1QSYA 1U4BA 2ZXIA 2I1QA 4RQ8A 1JUDA 2KSOB 5ALEA 5HHIA 3SI8A 4C8MA 1ZQMA 5GTHU 1UQVA 2JEFA 4FS1A 3T5JA 5J0OA 2LM1A 4QZDA 3SENA 4Y2VA 2K4HA 2ZTCA 4KMUA 4TURA 3DV9A 1TAQA 3TQ1A 4FO6A 1A77A 4UW9A 4QZCA 2OCEA 3C1YA 5AKGA 1ZD2P 3Q8QB 3MR6A 3ISCA 4PHAA 1KFDA 4Q45A 3ETLA 5IIIA 4YR2A 2HOQA 4C8KA 1ZRNA 1COKA 3MGIA 3V6JA 4YCXA 9ICTA 3PV8A 5CB1A 1BPBA 3KD3A 4DS5A 4MF8A 4DFPA 4YMMA 3KZIU 1MQ3A 5KNIA 4EZ6A 5KFAA 1N5WA 3RJHA 2EANA 1MA7A 2BKEA 3MBYA 1O03A 2IBKA 3UXNA 1S0MA 2A1JB 3WK8A 8ICCA 1N63A 2DL0A 2ASJA 3PX6A 5F3XB 4RUAA 4EBCA 1FEZA 4B9UA 4J9SA 4TUQA 4DOBA 8ICQA 3QU4A 2Y0SF 5AM1A 5J0UA 4CNQA 3OHBA 4I2EA 3PNCA 2KK0A 3RJKA 1L7MA 3PZPA 2BCVA 1YZ6A 3EPIA 4Y2SA 5EE3A 2YX8A 3SAHA 4YXJA 2FPKA 4CDGA 2BPFA 1YZ7A 4RPYA 5KFVA 2HMXA 4ECTA 2F2AB 2XI9A 4J9LA 4IR1A 5AI8A 5CR0A 4KLOA 5HR7A 5KFTA 4RUCA 9ICKA 3FC4A 1N5XA 4QZFA 4KX5A 4C4TA 2MU2A 5J0TA 4WJ3B 4FE3A 4PL1A 2PI4A 4Y2JA 4PGYA 3ORYA 4O0IA 4RT3A 3EPGA 3TARA 8ICRA 2AGPA 2E1EA 3L4PA 4FFDA 4DSJA 1UHUA 3OPXA 1KW4A 1KQQA 2NRXA 4G9BA 1TK0A 3BQ7A 1SKWA 5ALJA 1B43A 1KDHA 3KBBA 3NASA 1ZQJA 4UAZA 4ECVA 2KP7A 1PVQA 4AYBF 3B0XA 4LZGA 3RTVA 4QWCA 2H3VA 3GIIA 7ICJA 2EZZA 4E0DA 4F50A 4BGDA 4UB4A 2AH5A 4O3SA 3WKDA 2YMLA 4M9GA 1L8LA 3OGUA 2W9AA 2KHQA 4QZAA 4F92B 5BOLA 4GLXA 2E8MA 2F8KA 4LJXA 2EQYA 2RHFA 2KD1A 2KJ8A 5ALLA 5L1KA 1DK2A 3WU2U 1SKRA 2E8OA 4DF8A 1ZQBA 3ALRA 3MGVA 4P4MA 5ALVA 4F4XA 5AM2A 4GIBA 1PVPA 3H4BA 3GDXA 1HUZA 2KTQA 2FJ6A 3M1YA 4UAWA 3RJJA 5CEHA 4MEYA 1BNOA 5DDMA 5GTIU 1F44A 2B21A 3UMCA 3UM9A 2KV2A 5ALWA 3FAHA 5KFJA 4AP9A 2W9CB 2ZJ5A 4YMNA 2HBJA 1HUOA 4DL2A 3LVWA 4PL2A 5KAIU 8ICHA 4PHPA 1N61A 4ZH4A 4F71A 2DGZA 2KE7A 2ATLA 3F2BA 4F5RA 1D8YA 2DQNB 5D4BA 4XUSA 3FDSA 2HBLA 2XGQA 1X9MA 2UVWA 2ZIXA 2AU0A 5AKZA 2BR0A 1A6SA 5TZVA 8ICZA 4RQNA 1RXVA 3D2NA 2JEGA 4DQRA 3IV6A 4R66A 4EBDA 4I2AA 5J0QA 3JPPA 1X9WA 4EX6A 3QYPA 4RQ2A 4RNNA 4KLMA 4U7CA 1L5UA 4UB3A 4JWMA 3DDHA 3Q8SB 2E8NA 4ELTA 3T5LA 2ZTEA 2W7OA 1VJ5A 1XC9A 1C20A 2KHVA 4P0PA 4F4KA 4C7ZA 1V9PA 1XSLA 4RQ5A 3SV4A 2HOIA 1ZQHA 1LB2B 5DG7A 2HHWA 5B5EU 9ICLA 3K75D 2HOFA 3NGDA 5KG5A 3QUCA 4PH5A 2XY6A 2W3SA 2JMGA 5KFCA 3H8JA 3LVVA 4JMUA 2G5IB 3N7PD 7ICRA 4QZEA 2KZ3A 4NWIA 1RYSA 4F8RA 4OJLA 5AIBA 8ICGA 2RDIA 2YMMA 5DB9A 1N62A 1SL0A 2KKPA 1UCVA 3CP8A 3ZD9A 3SAGA 1ZQPA 1ZQWA 2FMSA 1NI3A 5DLGA 5DLFA 2F77X 5H2FU 2NO4A 4IQVA 1KFTA 3QNMA 3SEIA 5CP2A 4DLEA 4GC6A 3QX7A 4X5VA 1XO1A 5CWRA 9ICRA 2QKQA 1B22A 3N97B 5EE9A 4PGXA 2K4PA 3L5KA 4B9SA 1NKEA 1CI4A 4DLGA 1K5OA 4EELA 5L1LA 2NO5A 3UPQA 1U47A 2F3NA 4DL5A 2G06A 5L1IA 1CEZA 4YG2A 2LYHA 4MF2A 3H7IA 2KOBA 2BCQA 2VIXA 1JIHA 4QJFB 1BNPA 2AJQA 4KLHA 9ICUA 3AEVA 4K4GA 2HHSA 3PR5B 3N4MB 2ZIWB 4B9MA 3RJFA 4M9NA 2FPLA 1UA1A 1NK5A 1ZQLA 4M9JA 2R8HA 7ICEA 4UAVA 2AQ0A 1JXLA 4Q8EA 2EH9A 5EOZA 2V9WA 2BZFA 2Q4TA 2JXJA 1ZQQA 4OJOA 4DSIA 1XO0A 3EUB2 5J0RA 5DB8A 2WHEA 8ICVA 3LYSA 2IA6A 4C0ZA 4DO9A 5DDYA 1NK4A 4I29A 3B0YA 4U6PA 4BUGA 3C23A 3F5EA 5EWEA 4EYIB 3OSPA 4ED3A 3WKEA 4QWAA 3UXOA 3PX4A 4UQGA 4UARA 3KTQA 4P0QB 2HHQA 3PSIA 1UT8A 4RQ6A 2KIWA 3BZCA 3TADA 3V6HA 2PFOA 2WAQF 2D3DA 4Q43A 3Q8PB 4NY8A 4QZ8A 4FZLA 3M9NB 4Y2RA 3SMVA 3V7KA 5JRTA 1BPEA 1JALA 4Q44A 1DOQA 3JPQA 1S0NA 2ZIUA 4YXMA 3HWTA 3RBEA 2BGWA 4K4HA 2HVHA 1PUZA 1KTQA 3RB0A 4TUPA 3GIJA 2FMQA 1QH9A 4QWBA 4JUZA 3C2LA 5J0XA 4JV0A 5J0SA 1ZQIA 1NK0A 3RH6A 2E8PA 3A0HU 2FPMA 1ZJMA 4A8EA 4ELVA 1DXSA 5KL1B 5DKWA 3RJIA 2BQRA 1X66A 3TADC 3PW5A 3KHGA 7ICSA 1RQNA 1NKCA 1ZRMA 2F1IA 4IR9A 1SZHA 4CF5A 1IV8A 1K1QA 1QQ5A 4QNLA 4HYKA 3GQCA 2XVTA 2MAXA 4DL3A 3MABA 2ASDA 3SR6A 5KFUA 1KLNA 4PHDA 3BJYA 3ZDCA 1Q46A 4KITB 2O6KA 2I9GA 3PO4A 3NVWA 9ICEA 4ELUA 3RAXA 4O3QA 4DQSA 4J9OA 3TAQA 4ECXA 3ZDAA 3F53A 2B0CA 3PO5A 2ZIVA 5J2AA 4PPXA 2WF5A 3H0LB 4RQ4A 3E58A 4US8A 2FLNA 1LV5A 4F4YA 5J0YA 2JH7A 1Z00B 2G5HB 2LPEA 5J2CA 3OJUA 1J2MA 3EWAA 3GV5B 1TK5A 2JR5A 4Y2TA 4DSEA 2ZXHA 3QE9Y 2FE9A 3LK9A 2N1RA 4FBUA 2ZIXB 3C1ZA 4R8UB 2VJ4A 5KAFU 1SXDA 1QQ6A 3D2QA 5IIOA 1RM6C 2BPCA 2DBYA 1DGSA 3MR2A 3C28A 1ZD3A 7ICHA 4OD0A 1OW5A 1V85A 4C4RA 5KFYA 3EZ5A 5AI6A 4M04A 1KFSA 2HI0A 1TFRA 1RPLA 1JX4A 2YB4A 5AIAA 1ZQGA 1JROA 2JEJA 5ALXA 5J0WA 4C8LA 2LMRA 9ICIA 1X9XA 5AM4A 5KFSA 1A76A 1D9FA 4I2FA 4QW8A 2DPIA 4QIWC 3V7LA 4J9KA 2P35A 2ODGA 2OXOA 5J0PA 5DGAA 4OJ5A 4JWNA 4BX9C 4F5QA 4LZDA 1F5SA 3PX0A 5AI9A 1TV9A 5D46A 4P2HA 5ALYA 4KLQA 4BXOB 4I2BA 4ICAA 5HMLA 2RP5A 5KFFA 4USAA 2YB1A 3WK4A 2NYVA 2FLLA 4OJ6A 4GXKA 4GC7A 5ALKA 2R18A 4F72A 2BQ3A 3E0FA 2UVUA 2F1JA 5DQIA 3ICXA 4J9MA 3ZI4A 1MSWD 1HEKA 9ICSA 2IOFA 9ICGA 3HJEA 4IRCA 1ECWA 1OUQA 3BS7A 2AHOB 2VA3A 1L6NA 2LYAA 4EEKA 4ED1A 5ALTA 5AK5A 1SIJA 3RFAA 3AMZA 4IS7A 1NJYA 2XCPA 7ICQA 2W9CA 2WF6A 3HT3A 2P66A 5KFMA 4IQWA 1RYRA 1TVAA 2LHTA 1L3UA 4QW9A 3H8SA 3LWLA 4NV0A 4TQSA 3WK6A 5DB7A 3NVYA 5AK3A 2W55A 2MRLA 5KT5A 2JEIA 2EAPA 3BS5A 1SGGA 2DUYA 4IQUA 3IG5A 2NRVA 3VCBA 4XA5A 5AI4A 5KFOA 2NRWA 3GU3A 3RR7A 1J97A 3H40A 2I5HA 2LKYA 5KG3A 3GILA 4UB8U 1JXEA 4JB3A 4M2YA 2J6TA 3OHAA 4Z6EA 4DL6A 3T79A 1B4FA 2ZUCA 1WWUA 3IM1A 5EWFA 3EW9A 2HBMA 4ECSA 2RQ5A 2E5SA 5ALRA 3G6XA 2HCFA 2XICA 1C7YA 1IG6A 5AKXA 3M6ZA 2WAQC 4ED8A 2AGOA 1F0MA 2JZBA 4O3PA 3OTQA 4KLFA 2G09A 5CHGA 1KBUA 3WKCA 3JPTA 4FBTA 3HPOA 4F5NA 2FDRA 5EE0A 2W9MA 4KLUA 2CN1A 7ICGA 5T14A 3C5GA 4RQ1A 4NM1A 1S77D 2QB1A 5KFLA 3JPOA 1J2NA 3MDAA 3WKAA 3K1RB 1X42A 1L7OA 3IHQB 3QU2A 2C2DA 2A1JA 1BPYA 3AQEA 4Y2YA 2WFAA 1JN3A 1XSNA 2KVCA 1ZQTA 4M9LA 2P6RA 4M0AA 3ISDA 2E3TA 3HW8A 4DSLA 4ED0A 4O9MA 2OHFA 7ICUA 1RG6A 1ZJNA 3D6JA 2Q0ZX 5AK6A 8ICSA 4OO1J 2RLTA 5KG4A 4QWDA 5IINA 1T3QA 1NK7A 3K4GA 4PZNA 3QU7A 5J2JA 3PW7A 3RJEA 3N7SC 1KEJA 2IMWP 4O3OA 1L3TA 1V97A 4DFJA 1FFVA 2LI6A 9ICJA 2A1AA 1L8OA 2RRDA 5AK4A 3GIMA 4YQWA 1DK3A 1QCKA 5ALFA 2F76X 2NV3A 2XO7A 2R8GA 4Q8FA 1PK1B 4DSKA 5B66U 8ICMA 1TAMA 3QUBA 3HKZC 3PW0A 2K8AA 1S0VA 1T4GA 2EZYA 1U9LA 4ECRA 1AROP 2V4RA 3N28A 2V4QA 2PFPA 2CXYA 2QB0B 2HHUA 3A0BU 3PSPA 4UB2A 2W11A 2DWQA 5DG9A 3PR4A 5AKEA 4TUSA 4UB1A 3Q8RB 2OM6A 1Z4OA 3MFIA 4CF4A 2MUTB 4KLEA 2DPJA 7ICTA 4NLCA 2W54A 1RYUA 4RT2A 1Z00A 1ZQVA 1Q3UA 2UVVA 3RH4A 1NNLA 1Y88A 1ZQXA 1KL9A 2A19A 5IIKA 2NRZA 3F5AA 4DOCA 1UA0A 2Y0SC 1QTMA 2NRTA 3AU2A 2K8CB 2YN4A 2ISOA 4YP3A 5ALQA 4C8NA 2JV3A 4NLZA 3UMGA 5KFBA 3TI0A 2C2EA 1D8LA 1SV0C 1UT5A 3TFRA 1KKXA 4PGQA 2PKEA 2R8IA 2IHNA 4Y2UA 8ICWA 5AKJA 2KMDA 4HAIA 3RB6A 1ZQYA 3C21A 4F91B 4CCHA 3D2SA 4KLTA 4KLGA 1RDFA 2HHXA 5J2GA 4I27A 7ICIA 7ICLA 4DQIA 2MSNA 2J6UA 4KTQA 4EX7A 3RB4A 3N7RC 4PZOA 4Y2PA 3ISBA 4DSFA 1N48A 5JTIA 4F2SA 3LDAA 3M8RA 1RZTA 1HIWA 2ZJ8A 3ONNA 1BPZA 9ICVA 1TK8A 5G5HA 2EDUA 2HBKA 3ETRA 2ALZA 3TACB 1SB3C 1MN8A 1HJPA 5KT3A 1TKDA 1WCLA 2D6FC 4YD1A 3H8MA 3G6VA 3AUOA 9ICOA 2ES6A 9ICFA 3BZKA 2K4EA 3Q8MA 4CGZA 2OYYA 5J8YA 4YVZA 2HW3A 3NRZA 1X6JA 2GLEA 5KT6A 1ZQ1C 4I2HA 5KFPA 1CUKA 2C28A 5AKKA 4ECWA 2XY5A 1U48A 5KT4A 4QIWF 1L7NA 3Q8KA 2VA2A 2OWOA 4DWIA 4UBCA 4DFDA 2KJ5A 8ICTA 1QLNA 1SL1A 3C2MA 9ICQA 1BVSA 2KG5A 4QZ9A 3V7JA 3KOOA 3QU5A 5ALUA 4F4ZA 4DL7A 2ZIVB 2JHDA 5ALHA 1MC8A 1SV0A 5F9LA 2PFNA 4NLGA 1NJZA 1SL2A 4QZIA 3F2DA 5J2IA 2VJ5A 1ZQAA 8ICIA 1WUDA 2IHMA 4NL9C 2OEHA 3BQ1A 1ZQRA 4M6WB 2YTUA 3GZFA 5K4LA 2KEYA 1ZQEA 1S5LU 5ALNA 3SV3A 3UQ2A 2EAOA 2QARA 2M9NA 4XRHA 1ZQSA 5DBCA 4DL4A 3B9JA 4UASA 1NJWA 4KLLA 1SKSA 4B6JA 2JGAA 2QARB 4B9TA 4B9LA 1LKYA 3CNHA 1YT3A 4JV2A 3PMNA 2H3IA 5L1MA 2XY7A 4P4PA 1PK1A 4EYHB 1U49A 2FI1A 4GXIA 1LVHA 2JZBB 3GV7B 1DRGA 3AM9A 1XSPA 5DBAA 3J81j 2WF7A 3ZDDA 4ED6A 7ICVA 2K89A 1ZQCA 5J2HA 5AM0A 3HX0A 4F4WA 5G5GA 5KG1A 2OH2A 4P0PB 3C5FA 4BDPA 3NVVA 5KG7A 3IRUA 4FS2A 2BCSA 3M9OB 2GH1A 4KN7A 1EXNA 2Y1JA 4ACOA 2RDJA 2BDPA 4EEYA 4EZ9A 5HR6A 3QEBZ 1T94A 3AQFA 4DQQA 3T5KA 9ICHA 2IOHA 9ICNA 4F2RA 9ICAA 1N60A 4ED7A 3M8SA 1ED1A 4Y2XA 3AU6A 1NK9A 3QU9A 1SWWA 1XWLA 5HHHA 1S8OA 3QEAZ 4O3RA 2DFLA 2PMZF 5AKHA 4KX3A 1Q8KA 2R8JA 4RQMA 3BS5B 4RZRA 3QXGA 1MQ2A 4AYBC 1Z19A 4IRKA 3VC8A 5JUMA 1RXWA 3JPNA 2EAMA 5HP4A 5HNKA 1T3NA 2KZMA 1X40A 4DFKA 5ALOA 1NK8A 1VDVA 3QZ8A 4DCCA 5DQGA 3NS1A 2I6XA 1P7DA 4MFAA 2ZG6A 3V6KA 2HVIA 4O5EA 1BPDA 3HKZF 4CF3A 4GXJA 3ED5A 1NOMA 4PHEA 3RB3A 5KFHA 2DKXA 3PVXA 4O3NA 4G3IA 2AXTU 5AHXA 3HILA 2BDUA 3CYMA 3FYHA 1FO4A 4CRXA 5KG2A 3SYZA 2ZIUB 3SAFA 3H8WA 4I2JA 3BDPA 4LVSA 2XIDA 8ICKA 3KHLA 1FFUA 1NKBA 3PSFA 2HHTA 1ZXIA 5KFNA 3IP4B 2WB1F 1QQ7A 1B0XA 2K4IA 1COOA 3MGHA 1VLBA 5CA7A 5AM3A 4UB6U 3BQ2A 3CRXA 3CW2C 8ICNA 8ICLA 3U26A 2KVSA 5IIJA 2Y9TA 4US9A 5J2KA 8ICEA
chains in the Genus database with same CATH topology
2EQYA 2LI6A 2LM1A 1KN5A 2YQEA 2RQ5A 2EH9A 1KKXA 5K4LA 2CXYA 2KK0A 2OEHA 2JXJA 2JRZA 1RYUA 1KQQA 1C20A 1IG6A 4LJXA 5CEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQY A;  2LI6 A;  2LM1 A;  1KN5 A;  2YQE A;  2RQ5 A;  2EH9 A;  1KKX A;  5K4L A;  2CXY A;  2KK0 A;  2OEH A;  2JXJ A;  2JRZ A;  1RYU A;  1KQQ A;  1C20 A;  1IG6 A;  4LJX A;  5CEH A; 
#chains in the Genus database with same CATH topology
 3C2K A;  1T7P A;  2DF4 B;  1ZYQ A;  2ZTD A;  4QWE A;  3QUT A;  2XCA A;  5ALS A;  3IN5 A;  4GFJ A;  3TFS A;  4K4I A;  1IXR A;  3T5H A;  4EEN A;  5AI0 A;  5ALI A;  2YY6 A;  1S76 D;  4KLD A;  4YN4 A;  4QZG A;  1ZQK A;  5J29 A;  3AL0 B;  5AM5 A;  2ZUD A;  3ZDB A;  2W03 A;  4UAY A;  4ECZ A;  5DQH A;  2ZUB A;  4YR3 A;  8ICO A;  2J6S A;  1KN5 A;  3ZDE A;  3Q8L A;  1ZOL A;  3HP6 A;  2KIC A;  2Y9U A;  3M7D A;  4I28 A;  3H4D A;  4IL6 U;  5FP0 A;  1PZN A;  1ZQF A;  8ICP A;  4FZM A;  5D49 A;  1Z1B A;  1BGX T;  2C2R A;  1Z3E B;  4I2D A;  2FMP A;  8ICX A;  2JH1 A;  1GO3 F;  4QZH A;  1SZP A;  1WG8 A;  3WK5 A;  2ZJA A;  4YMO A;  4RNO A;  1Q3V A;  3RH5 A;  3JPR A;  2YMQ A;  1ZQN A;  3WK9 A;  1ZET A;  2H3Q A;  3R9K A;  1IIP A;  3V72 A;  3OJS A;  4YR0 A;  3TAP A;  3GFK B;  5KTQ A;  4C4S A;  2PFQ A;  9ICX A;  2WF8 A;  3L3F X;  4C8O A;  4MHV A;  2G07 A;  8ICY A;  4TQR A;  4NM2 A;  5DB6 A;  4ZOH C;  2W9B B;  2VAN A;  1X9S A;  3NTU A;  3E2E A;  4I2C A;  1JMS A;  1AQ6 A;  5EE1 A;  3C29 A;  3PST A;  2W43 A;  9ICP A;  2LYB A;  2QB0 A;  4RQ3 A;  1M6Y A;  2XC9 A;  4I2I A;  3I28 A;  3SD7 A;  4ECY A;  3RJG A;  4JK1 A;  2H5X A;  2PMZ C;  4KLI A;  4ECQ A;  1NJX A;  1JI7 A;  2KNJ A;  3KZX A;  1N56 A;  1ZQD A;  4M9H A;  5ALM A;  4Z6D A;  2HHV A;  4O5C A;  5L9X A;  1XNS A;  2F8L A;  3PW4 A;  1S10 A;  4P4O A;  3H0M B;  4RPZ A;  2H3F A;  1ZQO A;  3I1Y A;  2M0N A;  4Z6F A;  1X2I A;  4KLJ A;  1L3S A;  3RRG A;  5KFI A;  2G08 A;  3M9M B;  3MFH A;  7ICO A;  5HMM A;  1L3V A;  4DS4 A;  4B9V A;  2IOF K;  1QSS A;  5BPC A;  1ZQU A;  5ALD A;  2YMP A;  2CPR A;  1PVR A;  1Z4N A;  3H0R B;  5J2F A;  4ECU A;  5AIC A;  4MEX A;  4IC9 A;  2AQ4 A;  1ZD4 A;  2LM4 A;  4C7Y A;  3GIK A;  2XGP A;  3RF9 A;  3THV A;  1D8B A;  4O5K A;  4NLB A;  1QSL A;  4UAU A;  2R8K A;  2ISP A;  3GV8 B;  5KFQ A;  1D9D A;  2W3R A;  7ICN A;  1KSP A;  3KHR A;  1FIQ A;  1URJ A;  3PW2 A;  9ICC A;  2DKZ A;  4R63 A;  4FZN A;  3BQ0 A;  2GWS A;  1V38 A;  3SZ2 A;  3WKB A;  2KFN A;  5IIL A;  4BWJ A;  3PY8 A;  5KFX A;  5KT2 A;  2F44 A;  1WCN A;  5C5J A;  2W8L A;  7ICK A;  3PML A;  4EBE A;  3TAN A;  2ZIW A;  2KN7 A;  2AGQ A;  5DG8 A;  3M6K A;  3KKA A;  2KZZ A;  5AKY A;  2JRZ A;  2Y1I A;  1L7P A;  4DEZ A;  5EWG A;  4J9N A;  4DF4 A;  3WK7 A;  2LBO A;  2KJ9 A;  4RPX A;  3KFU F;  1CRX A;  4J9R A;  3OSN A;  2H3Z A;  4Z6C A;  2B6G A;  9ICB A;  4F93 B;  2L5Y A;  5J2E A;  8ICA A;  1N2X A;  4RQ0 A;  2GOL A;  5BOM A;  2KFZ A;  3T3F A;  1NK6 A;  3TKA A;  5KFZ A;  4RNM A;  2KSO A;  3BQT A;  4BWM A;  3FM9 A;  5KG0 A;  4QZB A;  1SWV A;  4JV1 A;  3JPS A;  1WWV A;  8ICB A;  3QZ7 A;  2D8C A;  5KL8 B;  9ICW A;  3MDC A;  4CE6 A;  1BPX A;  4R65 A;  4UB5 A;  4UAT A;  2Z7J A;  2HDO A;  5DGB A;  1XU4 A;  4R64 A;  9ICM A;  1TE2 A;  4J03 A;  4NLN A;  8ICJ A;  1IM4 A;  4OCZ A;  4OJP A;  2WB1 C;  4KLS A;  1ZQZ A;  2UVR A;  3KKA C;  1PK3 A;  5IIM A;  4DOA A;  4M6W A;  1LKY B;  5L1J A;  5E79 U;  5KFD A;  1H38 A;  3DEE A;  5KT7 A;  2C22 A;  2EZX A;  5CJ7 A;  3G6Y A;  1UPH A;  5J2B A;  5KFK A;  4RQ7 A;  4F5O A;  5CRX A;  4J9P A;  3F2C A;  4F3O A;  5DBB A;  4PJ0 U;  5F9N A;  4XQ8 A;  3RBD A;  5AI5 A;  2GO7 A;  5JU5 A;  1T8E A;  2BPG A;  4ED2 A;  2ASL A;  2F1H A;  4BXO A;  3ZD8 A;  5AKL A;  3HRD D;  1XS9 D;  7ICP A;  5KG6 A;  3KHH A;  3K1Z A;  2W8K A;  4IRD A;  2E1F A;  4DFM A;  2P6U A;  2K60 A;  3RR8 A;  2PI5 A;  1NZB A;  2FLP A;  1O08 A;  3AN1 A;  1TAU A;  2A3V A;  4NXZ A;  1NZP A;  3SQI A;  1S0O A;  1Z1V A;  5TIS U;  3IDW A;  2W04 A;  3EYZ A;  1SXE A;  2G0A A;  1WYG A;  2MA1 A;  4B9N A;  3RAQ A;  1RQL A;  5ALG A;  3QUQ A;  3O0F A;  4MFF A;  3S6J A;  4YFK A;  2HSZ A;  1JRP A;  3MR5 A;  4KN4 A;  5J8Y C;  1A0P A;  4YD2 A;  2VA8 A;  4NL9 A;  5KFE A;  2K8B B;  2QLT A;  2MUT A;  7ICM A;  3IG8 A;  4NJ8 A;  3MR3 A;  2KIV A;  1X6I A;  2CRX A;  4M47 A;  1SV4 A;  3NRW A;  4RU9 A;  1KRP A;  3I76 A;  2ESE A;  2KKV A;  3NVZ A;  4I2G A;  3UMB A;  1K1S A;  4R8U A;  4J9Q A;  4DQP A;  4O3M A;  5KFR A;  2PXI A;  7ICF A;  5ALZ A;  4C80 A;  2BCU A;  2W7P A;  1ZD5 A;  2WTF A;  1DGJ A;  8ICU A;  4NLK A;  5C0Y A;  1S97 A;  4IQT A;  8ICF A;  2W9B A;  4F5P A;  3LWM A;  3UQ0 A;  1OXJ A;  2WF9 A;  3NUQ A;  4BJQ A;  4Y2Q A;  5AKI A;  1S9F A;  2BHN A;  4P0Q A;  2BCR A;  5A0L A;  5J2D A;  1U45 A;  2BQU A;  3MC1 A;  5KFG A;  3UXP A;  4KMO B;  5ALP A;  4UBB A;  4MFC A;  2VKQ A;  5KFW A;  2YQE A;  3RRH A;  1QSY A;  1U4B A;  2ZXI A;  2I1Q A;  4RQ8 A;  1JUD A;  2KSO B;  5ALE A;  5HHI A;  3SI8 A;  4C8M A;  1ZQM A;  5GTH U;  1UQV A;  2JEF A;  4FS1 A;  3T5J A;  5J0O A;  2LM1 A;  4QZD A;  3SEN A;  4Y2V A;  2K4H A;  2ZTC A;  4KMU A;  4TUR A;  3DV9 A;  1TAQ A;  3TQ1 A;  4FO6 A;  1A77 A;  4UW9 A;  4QZC A;  2OCE A;  3C1Y A;  5AKG A;  1ZD2 P;  3Q8Q B;  3MR6 A;  3ISC A;  4PHA A;  1KFD A;  4Q45 A;  3ETL A;  5III A;  4YR2 A;  2HOQ A;  4C8K A;  1ZRN A;  1COK A;  3MGI A;  3V6J A;  4YCX A;  9ICT A;  3PV8 A;  5CB1 A;  1BPB A;  3KD3 A;  4DS5 A;  4MF8 A;  4DFP A;  4YMM A;  3KZI U;  1MQ3 A;  5KNI A;  4EZ6 A;  5KFA A;  1N5W A;  3RJH A;  2EAN A;  1MA7 A;  2BKE A;  3MBY A;  1O03 A;  2IBK A;  3UXN A;  1S0M A;  2A1J B;  3WK8 A;  8ICC A;  1N63 A;  2DL0 A;  2ASJ A;  3PX6 A;  5F3X B;  4RUA A;  4EBC A;  1FEZ A;  4B9U A;  4J9S A;  4TUQ A;  4DOB A;  8ICQ A;  3QU4 A;  2Y0S F;  5AM1 A;  5J0U A;  4CNQ A;  3OHB A;  4I2E A;  3PNC A;  2KK0 A;  3RJK A;  1L7M A;  3PZP A;  2BCV A;  1YZ6 A;  3EPI A;  4Y2S A;  5EE3 A;  2YX8 A;  3SAH A;  4YXJ A;  2FPK A;  4CDG A;  2BPF A;  1YZ7 A;  4RPY A;  5KFV A;  2HMX A;  4ECT A;  2F2A B;  2XI9 A;  4J9L A;  4IR1 A;  5AI8 A;  5CR0 A;  4KLO A;  5HR7 A;  5KFT A;  4RUC A;  9ICK A;  3FC4 A;  1N5X A;  4QZF A;  4KX5 A;  4C4T A;  2MU2 A;  5J0T A;  4WJ3 B;  4FE3 A;  4PL1 A;  2PI4 A;  4Y2J A;  4PGY A;  3ORY A;  4O0I A;  4RT3 A;  3EPG A;  3TAR A;  8ICR A;  2AGP A;  2E1E A;  3L4P A;  4FFD A;  4DSJ A;  1UHU A;  3OPX A;  1KW4 A;  1KQQ A;  2NRX A;  4G9B A;  1TK0 A;  3BQ7 A;  1SKW A;  5ALJ A;  1B43 A;  1KDH A;  3KBB A;  3NAS A;  1ZQJ A;  4UAZ A;  4ECV A;  2KP7 A;  1PVQ A;  4AYB F;  3B0X A;  4LZG A;  3RTV A;  4QWC A;  2H3V A;  3GII A;  7ICJ A;  2EZZ A;  4E0D A;  4F50 A;  4BGD A;  4UB4 A;  2AH5 A;  4O3S A;  3WKD A;  2YML A;  4M9G A;  1L8L A;  3OGU A;  2W9A A;  2KHQ A;  4QZA A;  4F92 B;  5BOL A;  4GLX A;  2E8M A;  2F8K A;  4LJX A;  2EQY A;  2RHF A;  2KD1 A;  2KJ8 A;  5ALL A;  5L1K A;  1DK2 A;  3WU2 U;  1SKR A;  2E8O A;  4DF8 A;  1ZQB A;  3ALR A;  3MGV A;  4P4M A;  5ALV A;  4F4X A;  5AM2 A;  4GIB A;  1PVP A;  3H4B A;  3GDX A;  1HUZ A;  2KTQ A;  2FJ6 A;  3M1Y A;  4UAW A;  3RJJ A;  5CEH A;  4MEY A;  1BNO A;  5DDM A;  5GTI U;  1F44 A;  2B21 A;  3UMC A;  3UM9 A;  2KV2 A;  5ALW A;  3FAH A;  5KFJ A;  4AP9 A;  2W9C B;  2ZJ5 A;  4YMN A;  2HBJ A;  1HUO A;  4DL2 A;  3LVW A;  4PL2 A;  5KAI U;  8ICH A;  4PHP A;  1N61 A;  4ZH4 A;  4F71 A;  2DGZ A;  2KE7 A;  2ATL A;  3F2B A;  4F5R A;  1D8Y A;  2DQN B;  5D4B A;  4XUS A;  3FDS A;  2HBL A;  2XGQ A;  1X9M A;  2UVW A;  2ZIX A;  2AU0 A;  5AKZ A;  2BR0 A;  1A6S A;  5TZV A;  8ICZ A;  4RQN A;  1RXV A;  3D2N A;  2JEG A;  4DQR A;  3IV6 A;  4R66 A;  4EBD A;  4I2A A;  5J0Q A;  3JPP A;  1X9W A;  4EX6 A;  3QYP A;  4RQ2 A;  4RNN A;  4KLM A;  4U7C A;  1L5U A;  4UB3 A;  4JWM A;  3DDH A;  3Q8S B;  2E8N A;  4ELT A;  3T5L A;  2ZTE A;  2W7O A;  1VJ5 A;  1XC9 A;  1C20 A;  2KHV A;  4P0P A;  4F4K A;  4C7Z A;  1V9P A;  1XSL A;  4RQ5 A;  3SV4 A;  2HOI A;  1ZQH A;  1LB2 B;  5DG7 A;  2HHW A;  5B5E U;  9ICL A;  3K75 D;  2HOF A;  3NGD A;  5KG5 A;  3QUC A;  4PH5 A;  2XY6 A;  2W3S A;  2JMG A;  5KFC A;  3H8J A;  3LVV A;  4JMU A;  2G5I B;  3N7P D;  7ICR A;  4QZE A;  2KZ3 A;  4NWI A;  1RYS A;  4F8R A;  4OJL A;  5AIB A;  8ICG A;  2RDI A;  2YMM A;  5DB9 A;  1N62 A;  1SL0 A;  2KKP A;  1UCV A;  3CP8 A;  3ZD9 A;  3SAG A;  1ZQP A;  1ZQW A;  2FMS A;  1NI3 A;  5DLG A;  5DLF A;  2F77 X;  5H2F U;  2NO4 A;  4IQV A;  1KFT A;  3QNM A;  3SEI A;  5CP2 A;  4DLE A;  4GC6 A;  3QX7 A;  4X5V A;  1XO1 A;  5CWR A;  9ICR A;  2QKQ A;  1B22 A;  3N97 B;  5EE9 A;  4PGX A;  2K4P A;  3L5K A;  4B9S A;  1NKE A;  1CI4 A;  4DLG A;  1K5O A;  4EEL A;  5L1L A;  2NO5 A;  3UPQ A;  1U47 A;  2F3N A;  4DL5 A;  2G06 A;  5L1I A;  1CEZ A;  4YG2 A;  2LYH A;  4MF2 A;  3H7I A;  2KOB A;  2BCQ A;  2VIX A;  1JIH A;  4QJF B;  1BNP A;  2AJQ A;  4KLH A;  9ICU A;  3AEV A;  4K4G A;  2HHS A;  3PR5 B;  3N4M B;  2ZIW B;  4B9M A;  3RJF A;  4M9N A;  2FPL A;  1UA1 A;  1NK5 A;  1ZQL A;  4M9J A;  2R8H A;  7ICE A;  4UAV A;  2AQ0 A;  1JXL A;  4Q8E A;  2EH9 A;  5EOZ A;  2V9W A;  2BZF A;  2Q4T A;  2JXJ A;  1ZQQ A;  4OJO A;  4DSI A;  1XO0 A;  3EUB 2;  5J0R A;  5DB8 A;  2WHE A;  8ICV A;  3LYS A;  2IA6 A;  4C0Z A;  4DO9 A;  5DDY A;  1NK4 A;  4I29 A;  3B0Y A;  4U6P A;  4BUG A;  3C23 A;  3F5E A;  5EWE A;  4EYI B;  3OSP A;  4ED3 A;  3WKE A;  4QWA A;  3UXO A;  3PX4 A;  4UQG A;  4UAR A;  3KTQ A;  4P0Q B;  2HHQ A;  3PSI A;  1UT8 A;  4RQ6 A;  2KIW A;  3BZC A;  3TAD A;  3V6H A;  2PFO A;  2WAQ F;  2D3D A;  4Q43 A;  3Q8P B;  4NY8 A;  4QZ8 A;  4FZL A;  3M9N B;  4Y2R A;  3SMV A;  3V7K A;  5JRT A;  1BPE A;  1JAL A;  4Q44 A;  1DOQ A;  3JPQ A;  1S0N A;  2ZIU A;  4YXM A;  3HWT A;  3RBE A;  2BGW A;  4K4H A;  2HVH A;  1PUZ A;  1KTQ A;  3RB0 A;  4TUP A;  3GIJ A;  2FMQ A;  1QH9 A;  4QWB A;  4JUZ A;  3C2L A;  5J0X A;  4JV0 A;  5J0S A;  1ZQI A;  1NK0 A;  3RH6 A;  2E8P A;  3A0H U;  2FPM A;  1ZJM A;  4A8E A;  4ELV A;  1DXS A;  5KL1 B;  5DKW A;  3RJI A;  2BQR A;  1X66 A;  3TAD C;  3PW5 A;  3KHG A;  7ICS A;  1RQN A;  1NKC A;  1ZRM A;  2F1I A;  4IR9 A;  1SZH A;  4CF5 A;  1IV8 A;  1K1Q A;  1QQ5 A;  4QNL A;  4HYK A;  3GQC A;  2XVT A;  2MAX A;  4DL3 A;  3MAB A;  2ASD A;  3SR6 A;  5KFU A;  1KLN A;  4PHD A;  3BJY A;  3ZDC A;  1Q46 A;  4KIT B;  2O6K A;  2I9G A;  3PO4 A;  3NVW A;  9ICE A;  4ELU A;  3RAX A;  4O3Q A;  4DQS A;  4J9O A;  3TAQ A;  4ECX A;  3ZDA A;  3F53 A;  2B0C A;  3PO5 A;  2ZIV A;  5J2A A;  4PPX A;  2WF5 A;  3H0L B;  4RQ4 A;  3E58 A;  4US8 A;  2FLN A;  1LV5 A;  4F4Y A;  5J0Y A;  2JH7 A;  1Z00 B;  2G5H B;  2LPE A;  5J2C A;  3OJU A;  1J2M A;  3EWA A;  3GV5 B;  1TK5 A;  2JR5 A;  4Y2T A;  4DSE A;  2ZXH A;  3QE9 Y;  2FE9 A;  3LK9 A;  2N1R A;  4FBU A;  2ZIX B;  3C1Z A;  4R8U B;  2VJ4 A;  5KAF U;  1SXD A;  1QQ6 A;  3D2Q A;  5IIO A;  1RM6 C;  2BPC A;  2DBY A;  1DGS A;  3MR2 A;  3C28 A;  1ZD3 A;  7ICH A;  4OD0 A;  1OW5 A;  1V85 A;  4C4R A;  5KFY A;  3EZ5 A;  5AI6 A;  4M04 A;  1KFS A;  2HI0 A;  1TFR A;  1RPL A;  1JX4 A;  2YB4 A;  5AIA A;  1ZQG A;  1JRO A;  2JEJ A;  5ALX A;  5J0W A;  4C8L A;  2LMR A;  9ICI A;  1X9X A;  5AM4 A;  5KFS A;  1A76 A;  1D9F A;  4I2F A;  4QW8 A;  2DPI A;  4QIW C;  3V7L A;  4J9K A;  2P35 A;  2ODG A;  2OXO A;  5J0P A;  5DGA A;  4OJ5 A;  4JWN A;  4BX9 C;  4F5Q A;  4LZD A;  1F5S A;  3PX0 A;  5AI9 A;  1TV9 A;  5D46 A;  4P2H A;  5ALY A;  4KLQ A;  4BXO B;  4I2B A;  4ICA A;  5HML A;  2RP5 A;  5KFF A;  4USA A;  2YB1 A;  3WK4 A;  2NYV A;  2FLL A;  4OJ6 A;  4GXK A;  4GC7 A;  5ALK A;  2R18 A;  4F72 A;  2BQ3 A;  3E0F A;  2UVU A;  2F1J A;  5DQI A;  3ICX A;  4J9M A;  3ZI4 A;  1MSW D;  1HEK A;  9ICS A;  2IOF A;  9ICG A;  3HJE A;  4IRC A;  1ECW A;  1OUQ A;  3BS7 A;  2AHO B;  2VA3 A;  1L6N A;  2LYA A;  4EEK A;  4ED1 A;  5ALT A;  5AK5 A;  1SIJ A;  3RFA A;  3AMZ A;  4IS7 A;  1NJY A;  2XCP A;  7ICQ A;  2W9C A;  2WF6 A;  3HT3 A;  2P66 A;  5KFM A;  4IQW A;  1RYR A;  1TVA A;  2LHT A;  1L3U A;  4QW9 A;  3H8S A;  3LWL A;  4NV0 A;  4TQS A;  3WK6 A;  5DB7 A;  3NVY A;  5AK3 A;  2W55 A;  2MRL A;  5KT5 A;  2JEI A;  2EAP A;  3BS5 A;  1SGG A;  2DUY A;  4IQU A;  3IG5 A;  2NRV A;  3VCB A;  4XA5 A;  5AI4 A;  5KFO A;  2NRW A;  3GU3 A;  3RR7 A;  1J97 A;  3H40 A;  2I5H A;  2LKY A;  5KG3 A;  3GIL A;  4UB8 U;  1JXE A;  4JB3 A;  4M2Y A;  2J6T A;  3OHA A;  4Z6E A;  4DL6 A;  3T79 A;  1B4F A;  2ZUC A;  1WWU A;  3IM1 A;  5EWF A;  3EW9 A;  2HBM A;  4ECS A;  2RQ5 A;  2E5S A;  5ALR A;  3G6X A;  2HCF A;  2XIC A;  1C7Y A;  1IG6 A;  5AKX A;  3M6Z A;  2WAQ C;  4ED8 A;  2AGO A;  1F0M A;  2JZB A;  4O3P A;  3OTQ A;  4KLF A;  2G09 A;  5CHG A;  1KBU A;  3WKC A;  3JPT A;  4FBT A;  3HPO A;  4F5N A;  2FDR A;  5EE0 A;  2W9M A;  4KLU A;  2CN1 A;  7ICG A;  5T14 A;  3C5G A;  4RQ1 A;  4NM1 A;  1S77 D;  2QB1 A;  5KFL A;  3JPO A;  1J2N A;  3MDA A;  3WKA A;  3K1R B;  1X42 A;  1L7O A;  3IHQ B;  3QU2 A;  2C2D A;  2A1J A;  1BPY A;  3AQE A;  4Y2Y A;  2WFA A;  1JN3 A;  1XSN A;  2KVC A;  1ZQT A;  4M9L A;  2P6R A;  4M0A A;  3ISD A;  2E3T A;  3HW8 A;  4DSL A;  4ED0 A;  4O9M A;  2OHF A;  7ICU A;  1RG6 A;  1ZJN A;  3D6J A;  2Q0Z X;  5AK6 A;  8ICS A;  4OO1 J;  2RLT A;  5KG4 A;  4QWD A;  5IIN A;  1T3Q A;  1NK7 A;  3K4G A;  4PZN A;  3QU7 A;  5J2J A;  3PW7 A;  3RJE A;  3N7S C;  1KEJ A;  2IMW P;  4O3O A;  1L3T A;  1V97 A;  4DFJ A;  1FFV A;  2LI6 A;  9ICJ A;  2A1A A;  1L8O A;  2RRD A;  5AK4 A;  3GIM A;  4YQW A;  1DK3 A;  1QCK A;  5ALF A;  2F76 X;  2NV3 A;  2XO7 A;  2R8G A;  4Q8F A;  1PK1 B;  4DSK A;  5B66 U;  8ICM A;  1TAM A;  3QUB A;  3HKZ C;  3PW0 A;  2K8A A;  1S0V A;  1T4G A;  2EZY A;  1U9L A;  4ECR A;  1ARO P;  2V4R A;  3N28 A;  2V4Q A;  2PFP A;  2CXY A;  2QB0 B;  2HHU A;  3A0B U;  3PSP A;  4UB2 A;  2W11 A;  2DWQ A;  5DG9 A;  3PR4 A;  5AKE A;  4TUS A;  4UB1 A;  3Q8R B;  2OM6 A;  1Z4O A;  3MFI A;  4CF4 A;  2MUT B;  4KLE A;  2DPJ A;  7ICT A;  4NLC A;  2W54 A;  1RYU A;  4RT2 A;  1Z00 A;  1ZQV A;  1Q3U A;  2UVV A;  3RH4 A;  1NNL A;  1Y88 A;  1ZQX A;  1KL9 A;  2A19 A;  5IIK A;  2NRZ A;  3F5A A;  4DOC A;  1UA0 A;  2Y0S C;  1QTM A;  2NRT A;  3AU2 A;  2K8C B;  2YN4 A;  2ISO A;  4YP3 A;  5ALQ A;  4C8N A;  2JV3 A;  4NLZ A;  3UMG A;  5KFB A;  3TI0 A;  2C2E A;  1D8L A;  1SV0 C;  1UT5 A;  3TFR A;  1KKX A;  4PGQ A;  2PKE A;  2R8I A;  2IHN A;  4Y2U A;  8ICW A;  5AKJ A;  2KMD A;  4HAI A;  3RB6 A;  1ZQY A;  3C21 A;  4F91 B;  4CCH A;  3D2S A;  4KLT A;  4KLG A;  1RDF A;  2HHX A;  5J2G A;  4I27 A;  7ICI A;  7ICL A;  4DQI A;  2MSN A;  2J6U A;  4KTQ A;  4EX7 A;  3RB4 A;  3N7R C;  4PZO A;  4Y2P A;  3ISB A;  4DSF A;  1N48 A;  5JTI A;  4F2S A;  3LDA A;  3M8R A;  1RZT A;  1HIW A;  2ZJ8 A;  3ONN A;  1BPZ A;  9ICV A;  1TK8 A;  5G5H A;  2EDU A;  2HBK A;  3ETR A;  2ALZ A;  3TAC B;  1SB3 C;  1MN8 A;  1HJP A;  5KT3 A;  1TKD A;  1WCL A;  2D6F C;  4YD1 A;  3H8M A;  3G6V A;  3AUO A;  9ICO A;  2ES6 A;  9ICF A;  3BZK A;  2K4E A;  3Q8M A;  4CGZ A;  2OYY A;  5J8Y A;  4YVZ A;  2HW3 A;  3NRZ A;  1X6J A;  2GLE A;  5KT6 A;  1ZQ1 C;  4I2H A;  5KFP A;  1CUK A;  2C28 A;  5AKK A;  4ECW A;  2XY5 A;  1U48 A;  5KT4 A;  4QIW F;  1L7N A;  3Q8K A;  2VA2 A;  2OWO A;  4DWI A;  4UBC A;  4DFD A;  2KJ5 A;  8ICT A;  1QLN A;  1SL1 A;  3C2M A;  9ICQ A;  1BVS A;  2KG5 A;  4QZ9 A;  3V7J A;  3KOO A;  3QU5 A;  5ALU A;  4F4Z A;  4DL7 A;  2ZIV B;  2JHD A;  5ALH A;  1MC8 A;  1SV0 A;  5F9L A;  2PFN A;  4NLG A;  1NJZ A;  1SL2 A;  4QZI A;  3F2D A;  5J2I A;  2VJ5 A;  1ZQA A;  8ICI A;  1WUD A;  2IHM A;  4NL9 C;  2OEH A;  3BQ1 A;  1ZQR A;  4M6W B;  2YTU A;  3GZF A;  5K4L A;  2KEY A;  1ZQE A;  1S5L U;  5ALN A;  3SV3 A;  3UQ2 A;  2EAO A;  2QAR A;  2M9N A;  4XRH A;  1ZQS A;  5DBC A;  4DL4 A;  3B9J A;  4UAS A;  1NJW A;  4KLL A;  1SKS A;  4B6J A;  2JGA A;  2QAR B;  4B9T A;  4B9L A;  1LKY A;  3CNH A;  1YT3 A;  4JV2 A;  3PMN A;  2H3I A;  5L1M A;  2XY7 A;  4P4P A;  1PK1 A;  4EYH B;  1U49 A;  2FI1 A;  4GXI A;  1LVH A;  2JZB B;  3GV7 B;  1DRG A;  3AM9 A;  1XSP A;  5DBA A;  3J81 j;  2WF7 A;  3ZDD A;  4ED6 A;  7ICV A;  2K89 A;  1ZQC A;  5J2H A;  5AM0 A;  3HX0 A;  4F4W A;  5G5G A;  5KG1 A;  2OH2 A;  4P0P B;  3C5F A;  4BDP A;  3NVV A;  5KG7 A;  3IRU A;  4FS2 A;  2BCS A;  3M9O B;  2GH1 A;  4KN7 A;  1EXN A;  2Y1J A;  4ACO A;  2RDJ A;  2BDP A;  4EEY A;  4EZ9 A;  5HR6 A;  3QEB Z;  1T94 A;  3AQF A;  4DQQ A;  3T5K A;  9ICH A;  2IOH A;  9ICN A;  4F2R A;  9ICA A;  1N60 A;  4ED7 A;  3M8S A;  1ED1 A;  4Y2X A;  3AU6 A;  1NK9 A;  3QU9 A;  1SWW A;  1XWL A;  5HHH A;  1S8O A;  3QEA Z;  4O3R A;  2DFL A;  2PMZ F;  5AKH A;  4KX3 A;  1Q8K A;  2R8J A;  4RQM A;  3BS5 B;  4RZR A;  3QXG A;  1MQ2 A;  4AYB C;  1Z19 A;  4IRK A;  3VC8 A;  5JUM A;  1RXW A;  3JPN A;  2EAM A;  5HP4 A;  5HNK A;  1T3N A;  2KZM A;  1X40 A;  4DFK A;  5ALO A;  1NK8 A;  1VDV A;  3QZ8 A;  4DCC A;  5DQG A;  3NS1 A;  2I6X A;  1P7D A;  4MFA A;  2ZG6 A;  3V6K A;  2HVI A;  4O5E A;  1BPD A;  3HKZ F;  4CF3 A;  4GXJ A;  3ED5 A;  1NOM A;  4PHE A;  3RB3 A;  5KFH A;  2DKX A;  3PVX A;  4O3N A;  4G3I A;  2AXT U;  5AHX A;  3HIL A;  2BDU A;  3CYM A;  3FYH A;  1FO4 A;  4CRX A;  5KG2 A;  3SYZ A;  2ZIU B;  3SAF A;  3H8W A;  4I2J A;  3BDP A;  4LVS A;  2XID A;  8ICK A;  3KHL A;  1FFU A;  1NKB A;  3PSF A;  2HHT A;  1ZXI A;  5KFN A;  3IP4 B;  2WB1 F;  1QQ7 A;  1B0X A;  2K4I A;  1COO A;  3MGH A;  1VLB A;  5CA7 A;  5AM3 A;  4UB6 U;  3BQ2 A;  3CRX A;  3CW2 C;  8ICN A;  8ICL A;  3U26 A;  2KVS A;  5IIJ A;  2Y9T A;  4US9 A;  5J2K A;  8ICE A; 
#chains in the Genus database with same CATH homology
 2EQY A;  2LI6 A;  2LM1 A;  1KN5 A;  2YQE A;  2RQ5 A;  2EH9 A;  1KKX A;  5K4L A;  2CXY A;  2KK0 A;  2OEH A;  2JXJ A;  2JRZ A;  1RYU A;  1KQQ A;  1C20 A;  1IG6 A;  4LJX A;  5CEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...