2OEHA

Determination of the three-dimensional structure of the mrf2-dna complex using paramagnetic spin labeling
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*CP*AP*AP*TP*AP*TP*AP*AP*CP*GP*TP*CP*G)-3'
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2oehA00
2YQEA 2CXYA 5K4LA 2EQYA 2JXJA 1KKXA 2LM1A 1RYUA 1IG6A 1C20A 2JRZA 2EH9A 2LI6A 4LJXA 2RQ5A 5CEHA 2KK0A 1KN5A 1KQQA 2OEHA
chains in the Genus database with same CATH superfamily
3NVYA 5KTQA 2IOFK 5IIMA 2Y1IA 2W8KA 2ZIUB 5AK4A 3UQ0A 2XGQA 1SXDA 3SEIA 1RXVA 1KN5A 5AI4A 8ICAA 3IRUA 9ICIA 3PX0A 5J2AA 4UATA 3RR8A 5KFQA 1ZQHA 4DEZA 5DLFA 4OJLA 1TVAA 1LKYA 2ALZA 1CEZA 4C4RA 1L7NA 5KG3A 2OXOA 1ZQ1C 3KBBA 3RBEA 1A0PA 1BPYA 3C23A 2K4PA 4UQGA 3C2KA 5EE0A 1XU4A 1NKBA 4PHDA 3H8SA 2YN4A 5A0LA 1T8EA 3ICXA 4PPXA 3OSPA 1BPEA 4RQ5A 5F3XB 4PGXA 2IOFA 5ALSA 2Y9TA 3UPQA 1FFVA 1PK1B 3SQIA 1URJA 2FJ6A 4ED2A 3B0XA 3RAXA 3C5FA 8ICSA 3ZDAA 4NWIA 3ZI4A 4F3OA 4MFCA 2KFNA 4F4YA 2JH1A 5J0XA 3Q8KA 1DOQA 1SV0C 9ICWA 2AU0A 4YQWA 4YG2A 1NJXA 3IP4B 3PX4A 8ICPA 5D49A 2ZTDA 5EOZA 1DGSA 3BDPA 3C28A 4RNOA 4O5KA 1CRXA 5FP0A 2W54A 3IDWA 3RFAA 1WCNA 2H3ZA 1RDFA 3G6XA 1NK5A 2XCAA 5D46A 4G3IA 4F71A 5J2IA 4MEXA 3RJHA 2KIWA 1LB2B 8ICEA 4RU9A 3RB6A 1S8OA 3ISDA 8ICNA 3V6HA 2MRLA 3C1YA 1LV5A 2HMXA 4F5QA 5ALXA 2ESEA 4EBEA 4DSJA 1COOA 2AQ4A 3HT3A 4JK1A 2WAQC 5KFZA 4FZMA 5EWFA 4JWMA 4P0QB 4ELVA 1S0VA 1HIWA 2R8KA 1RYUA 4CNQA 3C21A 4RQ7A 1N60A 1VDVA 1N48A 5KL1B 3T5KA 4NLNA 5AM0A 2JZBA 1RYSA 2NRWA 3GQCA 2W03A 3LWMA 1ZQLA 4CF5A 2K4IA 3E58A 4B9MA 3C2LA 5DDYA 2VIXA 2FLPA 3SZ2A 3NRWA 4JB3A 3LWLA 5AKIA 2ZJ8A 4IL6U 3RB4A 2HOFA 5ALDA 5KAIU 3RRGA 5AK3A 3BS5B 4IRCA 2YMMA 4G9BA 2PFOA 8ICBA 1ZQPA 4KMOB 2AQ0A 3N28A 2V4QA 5AKEA 2MA1A 3BQ7A 1S5LU 5KFYA 4RQ2A 1O03A 1ECWA 4UARA 3CP8A 1TAUA 1XWLA 5KFWA 5KT4A 2EAMA 2PMZC 9ICNA 4ECTA 2A3VA 4C8MA 5J0PA 3IHQB 3EWAA 2BZFA 1K5OA 4R8UA 5AKXA 2RRDA 1QCKA 4KX5A 1COKA 2NO5A 5ALKA 5AM2A 1U49A 4KITB 3GV5B 3QU4A 4EZ6A 4GLXA 2W9BB 3SENA 9ICPA 4NLKA 3RAQA 3H8WA 5ALVA 5EE3A 3Q8LA 9ICEA 2DQNB 4UAWA 5DGAA 2E1EA 1ZETA 2AGOA 2DGZA 5GTIU 4DFDA 4I2HA 3H8JA 2KJ5A 3GIKA 4UASA 4O5EA 2E8OA 1S0NA 1OW5A 4B9TA 3BQ1A 3QUTA 5HNKA 4UAUA 3LVWA 3J81j 2HOIA 3HRDD 3ZDCA 1HJPA 2KEYA 1A76A 5KFBA 4R64A 4RQ0A 1S77D 4Z6FA 4O3MA 2F1HA 2YMQA 2B0CA 8ICFA 9ICUA 3KOOA 1FEZA 1SGGA 3ISCA 4PHEA 4YP3A 1WCLA 4YCXA 4KX3A 2IOHA 5HHIA 2HOQA 8ICLA 4Y2QA 2DUYA 5KAFU 2YB1A 7ICTA 5KT6A 1NK4A 2KFZA 4F72A 4DF4A 7ICMA 2MU2A 4RQ3A 3QE9Y 2Y9UA 3JPQA 3MC1A 2LM4A 1Z00B 3QUBA 4Y2YA 4BDPA 1Z1VA 2BPCA 1V85A 1KL9A 1SL1A 5AI0A 4HYKA 4B6JA 5AIAA 3SAFA 4YMMA 1ZQTA 2HVHA 1F44A 2YB4A 4DL7A 1WUDA 4KN4A 5DG7A 2AGPA 5L1IA 4Q8EA 4J9NA 2I6XA 2K8CB 4F4ZA 5L1JA 2G06A 8ICZA 5KFXA 2K60A 4R65A 4F2RA 3ETLA 4EENA 5KFCA 9ICAA 4IQUA 2KZ3A 5G5HA 2B21A 5AI8A 1IG6A 2P6RA 1ZQUA 3SAGA 2R18A 2YY6A 5DKWA 3WK4A 3QU2A 2VJ5A 3DEEA 2XC9A 1BPXA 1SWWA 4Y2TA 4ECQA 1ZQRA 1XS9D 3R9KA 7ICKA 2FPKA 2BQUA 2WHEA 5IIJA 2WF9A 4DFPA 3O0FA 2HHVA 1RZTA 4FE3A 5ALGA 3MGHA 4GC7A 1MSWD 1FFUA 4RT2A 3MR6A 2GOLA 1ZD4A 3RJFA 7ICVA 4OJPA 1T3NA 2WF8A 2HHWA 5J0WA 2P66A 3BJYA 2KVCA 4QJFB 2EAOA 1T3QA 1UCVA 1ZYQA 5KFLA 4DS5A 2RDIA 1ZQOA 3KKAA 3MFHA 5J2BA 3OHBA 2E3TA 4IQWA 1U45A 5D4BA 5ALPA 1PZNA 9ICMA 2G07A 4O0IA 5AI5A 4ED6A 3RJIA 3GU3A 3CRXA 3NVWA 4C8OA 4X5VA 2H3FA 1ZQMA 4RUAA 5AM3A 4P4OA 5J2DA 9ICVA 4IR9A 2E8NA 1ZD2P 3SV4A 4ICAA 2ASDA 1IM4A 7ICHA 3PZPA 5C0YA 3MGIA 2V9WA 1ZQGA 2KHVA 4O3QA 2OH2A 1ZOLA 5J0UA 4FS1A 5KT7A 4KLEA 4RPZA 4QWEA 2F1IA 2HSZA 4O3OA 1ZQAA 4ED7A 3SD7A 3D6JA 3I28A 2WFAA 2LM1A 4DQRA 5KNIA 4KLDA 3NUQA 5AI9A 4CRXA 4ACOA 2EDUA 2KZMA 4DL4A 3UXNA 2FMPA 1PVQA 2YX8A 1DXSA 3T3FA 4RUCA 5ALUA 1N62A 2RLTA 1ZQNA 1Z1BA 1KFSA 5CWRA 3WKCA 4R8UB 1IV8A 2ZUCA 3B9JA 1Q3UA 1RPLA 1NK8A 3QX7A 3PSIA 3RTVA 9ICRA 2XVTA 4M9LA 8ICYA 3UMCA 4DL2A 3PV8A 4K4GA 3BZCA 1NZPA 4Y2RA 2BPGA 2FMSA 3GIJA 3GIMA 2F3NA 3ONNA 5KFAA 5F9LA 5B5EU 2I9GA 2XO7A 2ZIXB 2BCRA 2C2DA 1SWVA 2JR5A 3RH5A 4CCHA 3RBDA 3TFSA 4F50A 4QNLA 2F76X 9ICCA 7ICUA 1C7YA 2BKEA 4MHVA 2KHQA 4OCZA 4US9A 2BCSA 4Y2JA 3AU2A 2WF6A 1H38A 1TFRA 4I2IA 4DOBA 4B9SA 4RZRA 1QQ7A 4I28A 4EEKA 1N2XA 3PO4A 1X9WA 9ICTA 5CA7A 4EBDA 5E79U 4NLGA 4RPYA 5KFVA 1UHUA 2KICA 1K1SA 5KFSA 4BXOB 2LMRA 2F8LA 2XIDA 4UB3A 4YVZA 4DLEA 5TZVA 1BPBA 8ICTA 3Q8QB 4QZFA 4J03A 1JXLA 1U9LA 2UVVA 3PX6A 4M6WA 5AKKA 5GTHU 2WAQF 5KG0A 2FPLA 3AQEA 3PSTA 1F5SA 3MDAA 2BDUA 2WB1C 3ALRA 4RQMA 3EW9A 1N56A 3V6KA 3QEAZ 1P7DA 3EPGA 5DQGA 4F4KA 4C7ZA 3FDSA 1XNSA 4QWAA 4CGZA 4LZDA 1X66A 5J2CA 5DB7A 2B6GA 1XO0A 1ZJNA 2ZIXA 4GFJA 3PW0A 1RQNA 1QH9A 5L9XA 3PNCA 4QWDA 1X42A 2YMLA 5ALLA 1BGXT 4UAYA 5DG9A 1HUZA 4JV0A 2RQ5A 2HBLA 3TFRA 5AK6A 3M9NB 2DBYA 1S97A 1NKCA 3NTUA 8ICJA 4AP9A 1ZQIA 4J9LA 2UVWA 3HWTA 4M04A 3WKBA 3ZDBA 3MR5A 2YQEA 4BJQA 2ZIVA 1U47A 4JUZA 4QZ9A 3PSFA 4ED1A 1S10A 3HJEA 5ALHA 5IIIA 2I1QA 4YFKA 1X9MA 2OWOA 5J2KA 3M8SA 4Y2VA 3KTQA 4MEYA 2NRVA 3A0HU 3CNHA 2C28A 5ALOA 5J8YC 4DF8A 3PR5B 5ALIA 4DQIA 2A1AA 1QSLA 4Q44A 1TAQA 4M9HA 1KEJA 3AM9A 2C22A 4JV2A 1SL2A 2CPRA 1TKDA 7ICNA 3KHLA 2FDRA 3NASA 2F2AB 5TISU 3DDHA 4ED0A 4DFMA 4ELUA 1RQLA 5HMMA 5HR7A 4Z6CA 3D2SA 1D9DA 4QZBA 1QTMA 4M47A 4NV0A 1M6YA 2NO4A 3EPIA 2LYHA 3QU5A 3BQ2A 5G5GA 4EYHB 3F2DA 4F2SA 4DSIA 5ALEA 4UB6U 2G0AA 3JPRA 1PVPA 8ICMA 2BCUA 4OJ6A 4NM2A 2ATLA 2JZBB 5IINA 4NM1A 2XI9A 2D3DA 2EAPA 2ZJAA 2KN7A 4ECVA 2CXYA 1X9XA 3N97B 3JPSA 4ELTA 2PI5A 3EUB2 7ICEA 1Z00A 3TKAA 2HCFA 8ICCA 5AM5A 2ZXIA 1N5WA 5J0RA 4ECWA 1ZD3A 3GILA 1C20A 2KOBA 4IC9A 2MUTB 3Q8SB 4P0PB 1JN3A 1IIPA 1NJYA 3F5EA 3KFUF 4FBUA 3WKDA 2JH7A 2Z7JA 3NRZA 1BPDA 3PW5A 4F8RA 2AHOB 4QZEA 4CF4A 5CJ7A 2CRXA 1Q46A 1ZQYA 3VC8A 2W43A 2KIVA 2NRZA 2K89A 1SZHA 3WK7A 1ZRNA 1LKYB 1UA0A 1NK0A 3F2BA 2KKPA 5KFHA 2K8BB 3KHGA 2W55A 5KFMA 5AKZA 3S6JA 1XO1A 3NVZA 5EWEA 3BQ0A 4OJ5A 3OPXA 5J2EA 5DG8A 1QSYA 3IM1A 3LVVA 5DQIA 2LYBA 2JGAA 2W9BA 5AM1A 2HHSA 3PSPA 7ICFA 3GZFA 1L7PA 5K4LA 5ALZA 2MUTA 1XC9A 2G5HB 3QZ8A 3QU7A 3GV8B 1ED1A 2VA2A 5KG1A 2D8CA 1L3TA 3PW2A 3JPNA 4TUQA 4KMUA 3FC4A 2W3SA 9ICOA 4RQ6A 1NNLA 4M6WB 2F1JA 1VJ5A 3N7PD 2ZUBA 4FZNA 4UB8U 5J0QA 5KG7A 4DO9A 2HHQA 1JMSA 3G6VA 2NYVA 1L3SA 1RM6C 8ICXA 3FM9A 3IV6A 3HW8A 1ZQJA 2ZIWB 2C2RA 1PVRA 5CR0A 2R8JA 2W8LA 4I29A 8ICQA 2WF5A 1Y88A 2HHTA 1N5XA 8ICKA 2DF4B 4Y2XA 1Z4NA 4IR1A 5HMLA 5KFOA 4OD0A 4GC6A 5BOMA 4ED3A 1K1QA 2EANA 4K4IA 9ICKA 2KV2A 9ICFA 1YZ6A 1U4BA 9ICSA 2ASLA 4DSFA 2NV3A 4IQVA 4YD2A 2DPJA 4JV1A 4DLGA 1L8LA 1S76D 5KT5A 1X2IA 2BR0A 4NLBA 4A8EA 8ICIA 1SKSA 3I76A 3NVVA 1JROA 4LVSA 4E0DA 2IMWP 3C1ZA 5KG2A 5ALMA 2JHDA 3H8MA 4BGDA 4TURA 3ED5A 2ZTCA 4TUSA 4ECUA 3T5JA 1RXWA 1UT8A 1L7MA 3PY8A 5J8YA 4O9MA 4QZCA 4KLUA 7ICSA 5AK5A 4B9NA 5KL8B 2JEIA 3K1RB 2OM6A 3H0MB 4UAVA 1SXEA 2VANA 5DGBA 2M9NA 2J6TA 3TANA 1T7PA 2PKEA 3AU6A 3QUCA 1JRPA 4F4XA 2HHUA 3L3FX 1YT3A 1MQ3A 2W04A 3GDXA 4DL3A 1TK8A 1ZQVA 5DBBA 4Y2UA 3CYMA 5DLGA 1EXNA 5KT3A 2I5HA 3RB3A 1DK3A 3H40A 2DL0A 3WKAA 2ZG6A 1ZJMA 2C2EA 4BWJA 1XSLA 4I2JA 4DL6A 3K4GA 3AL0B 4USAA 5ALFA 2W9MA 4P4PA 3OGUA 4EYIB 2UVUA 3E0FA 5KFJA 4EEYA 4I2CA 3TADA 1T4GA 5KFNA 1S0MA 3ZDDA 4DOCA 2AXTU 3M8RA 4MF8A 2H3VA 4J9QA 2ZJ5A 2XGPA 5KFPA 5CB1A 3PVXA 1WWUA 3ZDEA 4EZ9A 1TE2A 3UQ2A 2GWSA 3VCBA 2A1JA 5DB8A 4P0PA 4KLTA 4QW9A 2E5SA 3LYSA 2XY5A 3JPTA 1UPHA 5KG4A 4DSLA 9ICGA 2BDPA 2KNJA 3V72A 2LBOA 3KZXA 5AICA 4MF2A 2LHTA 2FE9A 4NLCA 2G09A 4DWIA 3TACB 2FMQA 4KTQA 2KK0A 4AYBC 5KFIA 1Z4OA 3HKZF 2KTQA 3SR6A 4JMUA 9ICJA 2F77X 4UW9A 5KFRA 1NJZA 3JPOA 3V7LA 2Y0SF 4MFFA 1L7OA 1TK5A 4PH5A 9ICXA 8ICVA 4FO6A 5JUMA 1NK9A 3E2EA 4I2GA 4K4HA 4F92B 3D2QA 4IRDA 2H3IA 3BQTA 5KFKA 1WYGA 2LI6A 3QYPA 4QZDA 3N7RC 4DQSA 9ICBA 2KSOA 1QSSA 4I2DA 3U26A 4PGYA 4NL9A 3UMGA 2F8KA 2WB1F 4LZGA 1BVSA 4M0AA 3I1YA 2BCQA 2PFPA 4YD1A 1Z19A 4UB5A 4F4WA 4KLHA 2AH5A 4KN7A 4FFDA 3HKZC 4DSKA 4RPXA 5AKLA 1OUQA 1IXRA 4OJOA 4PL2A 4QZAA 1U48A 2RP5A 3H4BA 3AN1A 3WKEA 2GH1A 5HR6A 4US8A 2FLNA 4ZH4A 3C5GA 5L1KA 1L3VA 2Y1JA 3BS7A 2V4RA 1UQVA 8ICUA 4ECYA 4UAZA 4ZOHC 3AMZA 4PJ0U 1D9FA 3RH4A 2F44A 2H5XA 4ED8A 2DPIA 4YMOA 2Q0ZX 4F5OA 1ZQSA 2ES6A 5DBAA 2W9CA 2JMGA 3ZD8A 2YMPA 5BPCA 4YXMA 3SV3A 7ICQA 4R66A 1D8BA 2UVRA 2E8MA 2ZIWA 2M0NA 5BOLA 4QZGA 1N63A 2FI1A 2ISPA 1NJWA 1PK3A 3PW7A 4B9LA 4EELA 1SKRA 3HPOA 5AKGA 1RG6A 4KLLA 7ICIA 2W11A 1MN8A 3V6JA 3KHRA 4EX6A 4O3NA 1JUDA 3QXGA 8ICRA 3M6KA 2QKQA 4F93B 4F5RA 2IHMA 4C4SA 1MC8A 4NJ8A 4XUSA 5J0YA 2Y0SC 4Y2PA 3UM9A 2J6SA 2QARB 3MDCA 1SKWA 5HP4A 5EE9A 2OHFA 5HHHA 1DRGA 4PZOA 5KFEA 4YR3A 4J9OA 1NK6A 3SMVA 4DL5A 4PHAA 5L1LA 7ICPA 4PL1A 3Q8MA 3RJJA 2DKZA 4RQNA 4BWMA 3FYHA 5CP2A 4F91B 4KLGA 4C8LA 5ALNA 1X9SA 4B9UA 5DB9A 1YZ7A 2PFQA 1JI7A 3T5LA 1BNOA 1DGJA 4DFJA 2IBKA 1HEKA 4I2BA 4TUPA 4RT3A 2HBJA 2WTFA 4Q45A 2W9CB 3OSNA 1D8YA 2KP7A 5EWGA 2OCEA 1WG8A 2HHXA 2KJ8A 1V97A 1FO4A 3IG5A 4KLQA 2N1RA 4P0QA 4C4TA 2VA3A 3F5AA 4KLOA 3UXOA 1WWVA 2XY7A 1QLNA 4J9KA 5ALTA 5KFUA 3DV9A 4UB1A 3RR7A 2O6KA 2ZIVB 3ISBA 2P6UA 5AKJA 2OYYA 4M9GA 5AKHA 5J2HA 1QQ6A 2EQYA 2MSNA 3L5KA 5KT2A 1LVHA 4O3PA 2VJ4A 8ICWA 4QZIA 3Q8PB 8ICOA 3H7IA 1SV0A 2HI0A 1L8OA 3PMLA 4OO1J 3LDAA 2W9AA 1CI4A 5J2JA 5JRTA 1ZQQA 5CEHA 4ECZA 5J0OA 2R8IA 4IRKA 2JRZA 2D6FC 2W3RA 1Q3VA 2OEHA 2HVIA 3FAHA 2NRTA 4U6PA 5J2GA 1BNPA 3MGVA 4M2YA 2IHNA 3TQ1A 4BX9C 2RDJA 3LK9A 3M1YA 1TV9A 3WU2U 2K4EA 4AYBF 5J29A 1V38A 3EYZA 1XSPA 3ZD9A 2ZUDA 1SZPA 1OXJA 1UA1A 2H3QA 2HDOA 4RQ1A 2QB1A 3KD3A 4DQQA 1ZQWA 1D8LA 4NL9C 4KLFA 3TAPA 2KG5A 2DWQA 1CUKA 1ZQEA 1UT5A 5JTIA 5KFDA 1N61A 2G08A 5DB6A 3C2MA 4LJXA 2BQRA 7ICOA 1GO3F 4FS2A 4J9PA 7ICLA 3M6ZA 4PZNA 2HBKA 4TQRA 2AGQA 5F9NA 1JXEA 5KG6A 2AJQA 5T14A 4UB2A 3GIIA 5IIKA 1VLBA 1ZQZA 3GFKB 4CDGA 2BCVA 3OJUA 2IA6A 3UXPA 3HX0A 2DKXA 4Z6DA 3M9MB 3T5HA 3V7JA 4FBTA 3OTQA 1ZQDA 3C29A 2JV3A 3PW4A 3BZKA 1NK7A 3NGDA 4GXIA 3N4MB 4BUGA 4P2HA 1F0MA 7ICRA 2ZXHA 4GXJA 4JWNA 4Y2SA 1L6NA 3GV7B 1B22A 1JALA 3WK9A 4KLMA 5ALYA 5KFTA 1X6IA 3ORYA 3RH6A 2YTUA 9ICQA 3H0RB 4C7YA 5AM4A 1ZQXA 3F53A 1X6JA 1AQ6A 2JXJA 2CN1A 4XRHA 4C8KA 2W7OA 9ICLA 3M7DA 3RRHA 4FZLA 4C80A 3QEBZ 4PGQA 1TK0A 3G6YA 3BS5A 4IQTA 4YXJA 5H2FU 1L5UA 1SL0A 4QWBA 1ZQCA 4YR2A 4I2FA 7ICGA 4C8NA 3MR2A 3MR3A 2WF7A 1J2NA 2DFLA 2ISOA 4C0ZA 4EX7A 3JPPA 2G5IB 4I2EA 3CW2C 4UBCA 1T94A 4GIBA 2RHFA 3NS1A 3KZIU 4QWCA 5IIOA 1SB3C 4F5NA 2EZXA 2FPMA 1B43A 3K1ZA 4QZ8A 1FIQA 2KE7A 2GLEA 4KLSA 3WK8A 1TAMA 2JEFA 4M9NA 1NKEA 3RJEA 4Q8FA 2QLTA 4O3SA 4B9VA 5AIBA 5C5JA 1KDHA 1KQQA 1BPZA 4J9MA 2JEJA 2Q4TA 1KW4A 1L3UA 2ZTEA 2PMZF 4TQSA 1PUZA 4I2AA 4BXOA 3RB0A 5DBCA 2KZZA 3HP6A 5DQHA 2VKQA 4PHPA 2VA8A 3QUQA 1JX4A 3TARA 3D2NA 4XQ8A 3F2CA 4J9RA 4NY8A 2K4HA 2LKYA 4CE6A 4U7CA 8ICGA 1ZXIA 1PK1A 3QU9A 4YMNA 2JEGA 4QW8A 3MFIA 3QNMA 2XICA 2QB0B 2P35A 2GO7A 4KLIA 8ICHA 2PXIA 4DCCA 3MBYA 3PO5A 4DOAA 4YN4A 3OHAA 4GXKA 4YR0A 2ODGA 4DFKA 5ALWA 1NOMA 3H4DA 1NZBA 2PFNA 2LPEA 2J6UA 3IG8A 4J9SA 3K75D 3TI0A 2R8GA 5KFFA 1QQ5A 4O3RA 2K8AA 4QZHA 5B66U 5J0TA 1J2MA 1V9PA 5IILA 1B4FA 4CF3A 3Q8RB 1ZQBA 2HW3A 3THVA 4HAIA 3IN5A 2E1FA 3AEVA 1KSPA 1AROP 5J0SA 1A77A 1KRPA 2NRXA 2A1JB 3SI8A 2QB0A 5JU5A 1O08A 3WK6A 5ALJA 4F5PA 4UB4A 2XY6A 2FLLA 1KFTA 3PMNA 5AI6A 1SV4A 1KLNA 1KTQA 2QARA 5KFGA 1J97A 2R8HA 4DSEA 3RJGA 3SYZA 4WJ3B 1MQ2A 3SAHA 4O5CA 1DK2A 1S0OA 4NLZA 3MABA 1KFDA 1S9FA 2MAXA 5CRXA 5AKYA 1ZD5A 4RNMA 5AHXA 1MA7A 4DQPA 1Q8KA 2BPFA 2BHNA 3KKAC 4Z6EA 4I27A 5CHGA 3KHHA 4ECRA 4UBBA 3A0BU 1XSNA 4ECXA 3QZ7A 3EZ5A 3RF9A 1ZQFA 2EH9A 5KG5A 5L1MA 2ZIUA 4Q43A 2A19A 4KLJA 1SIJA 3UMBA 5J2FA 4M9JA 3WK5A 3TAQA 2PI4A 3OJSA 2KKVA 3L4PA 4RQ4A 1KKXA 2L5YA 1NI3A 4EBCA 2KJ9A 1Z3EB 3AQFA 4QIWC 2EZZA 1JIHA 4ECSA 3TADC 4RNNA 2KVSA 4XA5A 1ZRMA 3ETRA 2BGWA 1KBUA 3HILA 1B0XA 3M9OB 1X40A 1ZQKA 2KSOB 7ICJA 4R63A 5ALRA 2ASJA 1HUOA 2XCPA 3RJKA 2HBMA 5EE1A 4RQ8A 4IS7A 4NXZA 5DDMA 3N7SC 4DS4A 2EZYA 1RYRA 2KD1A 2E8PA 2W7PA 3V7KA 3B0YA 3PR4A 4MFAA 3H0LB 3T79A 2BQ3A 9ICHA 5ALQA 3AUOA 2LYAA 4QIWF 4P4MA 1A6SA 2KMDA
chains in the Genus database with same CATH topology
2YQEA 2CXYA 5K4LA 2EQYA 2JXJA 1KKXA 2LM1A 1RYUA 1IG6A 1C20A 2JRZA 2EH9A 2LI6A 4LJXA 2RQ5A 5CEHA 2KK0A 1KN5A 1KQQA 2OEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQE A;  2CXY A;  5K4L A;  2EQY A;  2JXJ A;  1KKX A;  2LM1 A;  1RYU A;  1IG6 A;  1C20 A;  2JRZ A;  2EH9 A;  2LI6 A;  4LJX A;  2RQ5 A;  5CEH A;  2KK0 A;  1KN5 A;  1KQQ A;  2OEH A; 
#chains in the Genus database with same CATH topology
 3NVY A;  5KTQ A;  2IOF K;  5IIM A;  2Y1I A;  2W8K A;  2ZIU B;  5AK4 A;  3UQ0 A;  2XGQ A;  1SXD A;  3SEI A;  1RXV A;  1KN5 A;  5AI4 A;  8ICA A;  3IRU A;  9ICI A;  3PX0 A;  5J2A A;  4UAT A;  3RR8 A;  5KFQ A;  1ZQH A;  4DEZ A;  5DLF A;  4OJL A;  1TVA A;  1LKY A;  2ALZ A;  1CEZ A;  4C4R A;  1L7N A;  5KG3 A;  2OXO A;  1ZQ1 C;  3KBB A;  3RBE A;  1A0P A;  1BPY A;  3C23 A;  2K4P A;  4UQG A;  3C2K A;  5EE0 A;  1XU4 A;  1NKB A;  4PHD A;  3H8S A;  2YN4 A;  5A0L A;  1T8E A;  3ICX A;  4PPX A;  3OSP A;  1BPE A;  4RQ5 A;  5F3X B;  4PGX A;  2IOF A;  5ALS A;  2Y9T A;  3UPQ A;  1FFV A;  1PK1 B;  3SQI A;  1URJ A;  2FJ6 A;  4ED2 A;  3B0X A;  3RAX A;  3C5F A;  8ICS A;  3ZDA A;  4NWI A;  3ZI4 A;  4F3O A;  4MFC A;  2KFN A;  4F4Y A;  2JH1 A;  5J0X A;  3Q8K A;  1DOQ A;  1SV0 C;  9ICW A;  2AU0 A;  4YQW A;  4YG2 A;  1NJX A;  3IP4 B;  3PX4 A;  8ICP A;  5D49 A;  2ZTD A;  5EOZ A;  1DGS A;  3BDP A;  3C28 A;  4RNO A;  4O5K A;  1CRX A;  5FP0 A;  2W54 A;  3IDW A;  3RFA A;  1WCN A;  2H3Z A;  1RDF A;  3G6X A;  1NK5 A;  2XCA A;  5D46 A;  4G3I A;  4F71 A;  5J2I A;  4MEX A;  3RJH A;  2KIW A;  1LB2 B;  8ICE A;  4RU9 A;  3RB6 A;  1S8O A;  3ISD A;  8ICN A;  3V6H A;  2MRL A;  3C1Y A;  1LV5 A;  2HMX A;  4F5Q A;  5ALX A;  2ESE A;  4EBE A;  4DSJ A;  1COO A;  2AQ4 A;  3HT3 A;  4JK1 A;  2WAQ C;  5KFZ A;  4FZM A;  5EWF A;  4JWM A;  4P0Q B;  4ELV A;  1S0V A;  1HIW A;  2R8K A;  1RYU A;  4CNQ A;  3C21 A;  4RQ7 A;  1N60 A;  1VDV A;  1N48 A;  5KL1 B;  3T5K A;  4NLN A;  5AM0 A;  2JZB A;  1RYS A;  2NRW A;  3GQC A;  2W03 A;  3LWM A;  1ZQL A;  4CF5 A;  2K4I A;  3E58 A;  4B9M A;  3C2L A;  5DDY A;  2VIX A;  2FLP A;  3SZ2 A;  3NRW A;  4JB3 A;  3LWL A;  5AKI A;  2ZJ8 A;  4IL6 U;  3RB4 A;  2HOF A;  5ALD A;  5KAI U;  3RRG A;  5AK3 A;  3BS5 B;  4IRC A;  2YMM A;  4G9B A;  2PFO A;  8ICB A;  1ZQP A;  4KMO B;  2AQ0 A;  3N28 A;  2V4Q A;  5AKE A;  2MA1 A;  3BQ7 A;  1S5L U;  5KFY A;  4RQ2 A;  1O03 A;  1ECW A;  4UAR A;  3CP8 A;  1TAU A;  1XWL A;  5KFW A;  5KT4 A;  2EAM A;  2PMZ C;  9ICN A;  4ECT A;  2A3V A;  4C8M A;  5J0P A;  3IHQ B;  3EWA A;  2BZF A;  1K5O A;  4R8U A;  5AKX A;  2RRD A;  1QCK A;  4KX5 A;  1COK A;  2NO5 A;  5ALK A;  5AM2 A;  1U49 A;  4KIT B;  3GV5 B;  3QU4 A;  4EZ6 A;  4GLX A;  2W9B B;  3SEN A;  9ICP A;  4NLK A;  3RAQ A;  3H8W A;  5ALV A;  5EE3 A;  3Q8L A;  9ICE A;  2DQN B;  4UAW A;  5DGA A;  2E1E A;  1ZET A;  2AGO A;  2DGZ A;  5GTI U;  4DFD A;  4I2H A;  3H8J A;  2KJ5 A;  3GIK A;  4UAS A;  4O5E A;  2E8O A;  1S0N A;  1OW5 A;  4B9T A;  3BQ1 A;  3QUT A;  5HNK A;  4UAU A;  3LVW A;  3J81 j;  2HOI A;  3HRD D;  3ZDC A;  1HJP A;  2KEY A;  1A76 A;  5KFB A;  4R64 A;  4RQ0 A;  1S77 D;  4Z6F A;  4O3M A;  2F1H A;  2YMQ A;  2B0C A;  8ICF A;  9ICU A;  3KOO A;  1FEZ A;  1SGG A;  3ISC A;  4PHE A;  4YP3 A;  1WCL A;  4YCX A;  4KX3 A;  2IOH A;  5HHI A;  2HOQ A;  8ICL A;  4Y2Q A;  2DUY A;  5KAF U;  2YB1 A;  7ICT A;  5KT6 A;  1NK4 A;  2KFZ A;  4F72 A;  4DF4 A;  7ICM A;  2MU2 A;  4RQ3 A;  3QE9 Y;  2Y9U A;  3JPQ A;  3MC1 A;  2LM4 A;  1Z00 B;  3QUB A;  4Y2Y A;  4BDP A;  1Z1V A;  2BPC A;  1V85 A;  1KL9 A;  1SL1 A;  5AI0 A;  4HYK A;  4B6J A;  5AIA A;  3SAF A;  4YMM A;  1ZQT A;  2HVH A;  1F44 A;  2YB4 A;  4DL7 A;  1WUD A;  4KN4 A;  5DG7 A;  2AGP A;  5L1I A;  4Q8E A;  4J9N A;  2I6X A;  2K8C B;  4F4Z A;  5L1J A;  2G06 A;  8ICZ A;  5KFX A;  2K60 A;  4R65 A;  4F2R A;  3ETL A;  4EEN A;  5KFC A;  9ICA A;  4IQU A;  2KZ3 A;  5G5H A;  2B21 A;  5AI8 A;  1IG6 A;  2P6R A;  1ZQU A;  3SAG A;  2R18 A;  2YY6 A;  5DKW A;  3WK4 A;  3QU2 A;  2VJ5 A;  3DEE A;  2XC9 A;  1BPX A;  1SWW A;  4Y2T A;  4ECQ A;  1ZQR A;  1XS9 D;  3R9K A;  7ICK A;  2FPK A;  2BQU A;  2WHE A;  5IIJ A;  2WF9 A;  4DFP A;  3O0F A;  2HHV A;  1RZT A;  4FE3 A;  5ALG A;  3MGH A;  4GC7 A;  1MSW D;  1FFU A;  4RT2 A;  3MR6 A;  2GOL A;  1ZD4 A;  3RJF A;  7ICV A;  4OJP A;  1T3N A;  2WF8 A;  2HHW A;  5J0W A;  2P66 A;  3BJY A;  2KVC A;  4QJF B;  2EAO A;  1T3Q A;  1UCV A;  1ZYQ A;  5KFL A;  4DS5 A;  2RDI A;  1ZQO A;  3KKA A;  3MFH A;  5J2B A;  3OHB A;  2E3T A;  4IQW A;  1U45 A;  5D4B A;  5ALP A;  1PZN A;  9ICM A;  2G07 A;  4O0I A;  5AI5 A;  4ED6 A;  3RJI A;  3GU3 A;  3CRX A;  3NVW A;  4C8O A;  4X5V A;  2H3F A;  1ZQM A;  4RUA A;  5AM3 A;  4P4O A;  5J2D A;  9ICV A;  4IR9 A;  2E8N A;  1ZD2 P;  3SV4 A;  4ICA A;  2ASD A;  1IM4 A;  7ICH A;  3PZP A;  5C0Y A;  3MGI A;  2V9W A;  1ZQG A;  2KHV A;  4O3Q A;  2OH2 A;  1ZOL A;  5J0U A;  4FS1 A;  5KT7 A;  4KLE A;  4RPZ A;  4QWE A;  2F1I A;  2HSZ A;  4O3O A;  1ZQA A;  4ED7 A;  3SD7 A;  3D6J A;  3I28 A;  2WFA A;  2LM1 A;  4DQR A;  5KNI A;  4KLD A;  3NUQ A;  5AI9 A;  4CRX A;  4ACO A;  2EDU A;  2KZM A;  4DL4 A;  3UXN A;  2FMP A;  1PVQ A;  2YX8 A;  1DXS A;  3T3F A;  4RUC A;  5ALU A;  1N62 A;  2RLT A;  1ZQN A;  1Z1B A;  1KFS A;  5CWR A;  3WKC A;  4R8U B;  1IV8 A;  2ZUC A;  3B9J A;  1Q3U A;  1RPL A;  1NK8 A;  3QX7 A;  3PSI A;  3RTV A;  9ICR A;  2XVT A;  4M9L A;  8ICY A;  3UMC A;  4DL2 A;  3PV8 A;  4K4G A;  3BZC A;  1NZP A;  4Y2R A;  2BPG A;  2FMS A;  3GIJ A;  3GIM A;  2F3N A;  3ONN A;  5KFA A;  5F9L A;  5B5E U;  2I9G A;  2XO7 A;  2ZIX B;  2BCR A;  2C2D A;  1SWV A;  2JR5 A;  3RH5 A;  4CCH A;  3RBD A;  3TFS A;  4F50 A;  4QNL A;  2F76 X;  9ICC A;  7ICU A;  1C7Y A;  2BKE A;  4MHV A;  2KHQ A;  4OCZ A;  4US9 A;  2BCS A;  4Y2J A;  3AU2 A;  2WF6 A;  1H38 A;  1TFR A;  4I2I A;  4DOB A;  4B9S A;  4RZR A;  1QQ7 A;  4I28 A;  4EEK A;  1N2X A;  3PO4 A;  1X9W A;  9ICT A;  5CA7 A;  4EBD A;  5E79 U;  4NLG A;  4RPY A;  5KFV A;  1UHU A;  2KIC A;  1K1S A;  5KFS A;  4BXO B;  2LMR A;  2F8L A;  2XID A;  4UB3 A;  4YVZ A;  4DLE A;  5TZV A;  1BPB A;  8ICT A;  3Q8Q B;  4QZF A;  4J03 A;  1JXL A;  1U9L A;  2UVV A;  3PX6 A;  4M6W A;  5AKK A;  5GTH U;  2WAQ F;  5KG0 A;  2FPL A;  3AQE A;  3PST A;  1F5S A;  3MDA A;  2BDU A;  2WB1 C;  3ALR A;  4RQM A;  3EW9 A;  1N56 A;  3V6K A;  3QEA Z;  1P7D A;  3EPG A;  5DQG A;  4F4K A;  4C7Z A;  3FDS A;  1XNS A;  4QWA A;  4CGZ A;  4LZD A;  1X66 A;  5J2C A;  5DB7 A;  2B6G A;  1XO0 A;  1ZJN A;  2ZIX A;  4GFJ A;  3PW0 A;  1RQN A;  1QH9 A;  5L9X A;  3PNC A;  4QWD A;  1X42 A;  2YML A;  5ALL A;  1BGX T;  4UAY A;  5DG9 A;  1HUZ A;  4JV0 A;  2RQ5 A;  2HBL A;  3TFR A;  5AK6 A;  3M9N B;  2DBY A;  1S97 A;  1NKC A;  3NTU A;  8ICJ A;  4AP9 A;  1ZQI A;  4J9L A;  2UVW A;  3HWT A;  4M04 A;  3WKB A;  3ZDB A;  3MR5 A;  2YQE A;  4BJQ A;  2ZIV A;  1U47 A;  4JUZ A;  4QZ9 A;  3PSF A;  4ED1 A;  1S10 A;  3HJE A;  5ALH A;  5III A;  2I1Q A;  4YFK A;  1X9M A;  2OWO A;  5J2K A;  3M8S A;  4Y2V A;  3KTQ A;  4MEY A;  2NRV A;  3A0H U;  3CNH A;  2C28 A;  5ALO A;  5J8Y C;  4DF8 A;  3PR5 B;  5ALI A;  4DQI A;  2A1A A;  1QSL A;  4Q44 A;  1TAQ A;  4M9H A;  1KEJ A;  3AM9 A;  2C22 A;  4JV2 A;  1SL2 A;  2CPR A;  1TKD A;  7ICN A;  3KHL A;  2FDR A;  3NAS A;  2F2A B;  5TIS U;  3DDH A;  4ED0 A;  4DFM A;  4ELU A;  1RQL A;  5HMM A;  5HR7 A;  4Z6C A;  3D2S A;  1D9D A;  4QZB A;  1QTM A;  4M47 A;  4NV0 A;  1M6Y A;  2NO4 A;  3EPI A;  2LYH A;  3QU5 A;  3BQ2 A;  5G5G A;  4EYH B;  3F2D A;  4F2S A;  4DSI A;  5ALE A;  4UB6 U;  2G0A A;  3JPR A;  1PVP A;  8ICM A;  2BCU A;  4OJ6 A;  4NM2 A;  2ATL A;  2JZB B;  5IIN A;  4NM1 A;  2XI9 A;  2D3D A;  2EAP A;  2ZJA A;  2KN7 A;  4ECV A;  2CXY A;  1X9X A;  3N97 B;  3JPS A;  4ELT A;  2PI5 A;  3EUB 2;  7ICE A;  1Z00 A;  3TKA A;  2HCF A;  8ICC A;  5AM5 A;  2ZXI A;  1N5W A;  5J0R A;  4ECW A;  1ZD3 A;  3GIL A;  1C20 A;  2KOB A;  4IC9 A;  2MUT B;  3Q8S B;  4P0P B;  1JN3 A;  1IIP A;  1NJY A;  3F5E A;  3KFU F;  4FBU A;  3WKD A;  2JH7 A;  2Z7J A;  3NRZ A;  1BPD A;  3PW5 A;  4F8R A;  2AHO B;  4QZE A;  4CF4 A;  5CJ7 A;  2CRX A;  1Q46 A;  1ZQY A;  3VC8 A;  2W43 A;  2KIV A;  2NRZ A;  2K89 A;  1SZH A;  3WK7 A;  1ZRN A;  1LKY B;  1UA0 A;  1NK0 A;  3F2B A;  2KKP A;  5KFH A;  2K8B B;  3KHG A;  2W55 A;  5KFM A;  5AKZ A;  3S6J A;  1XO1 A;  3NVZ A;  5EWE A;  3BQ0 A;  4OJ5 A;  3OPX A;  5J2E A;  5DG8 A;  1QSY A;  3IM1 A;  3LVV A;  5DQI A;  2LYB A;  2JGA A;  2W9B A;  5AM1 A;  2HHS A;  3PSP A;  7ICF A;  3GZF A;  1L7P A;  5K4L A;  5ALZ A;  2MUT A;  1XC9 A;  2G5H B;  3QZ8 A;  3QU7 A;  3GV8 B;  1ED1 A;  2VA2 A;  5KG1 A;  2D8C A;  1L3T A;  3PW2 A;  3JPN A;  4TUQ A;  4KMU A;  3FC4 A;  2W3S A;  9ICO A;  4RQ6 A;  1NNL A;  4M6W B;  2F1J A;  1VJ5 A;  3N7P D;  2ZUB A;  4FZN A;  4UB8 U;  5J0Q A;  5KG7 A;  4DO9 A;  2HHQ A;  1JMS A;  3G6V A;  2NYV A;  1L3S A;  1RM6 C;  8ICX A;  3FM9 A;  3IV6 A;  3HW8 A;  1ZQJ A;  2ZIW B;  2C2R A;  1PVR A;  5CR0 A;  2R8J A;  2W8L A;  4I29 A;  8ICQ A;  2WF5 A;  1Y88 A;  2HHT A;  1N5X A;  8ICK A;  2DF4 B;  4Y2X A;  1Z4N A;  4IR1 A;  5HML A;  5KFO A;  4OD0 A;  4GC6 A;  5BOM A;  4ED3 A;  1K1Q A;  2EAN A;  4K4I A;  9ICK A;  2KV2 A;  9ICF A;  1YZ6 A;  1U4B A;  9ICS A;  2ASL A;  4DSF A;  2NV3 A;  4IQV A;  4YD2 A;  2DPJ A;  4JV1 A;  4DLG A;  1L8L A;  1S76 D;  5KT5 A;  1X2I A;  2BR0 A;  4NLB A;  4A8E A;  8ICI A;  1SKS A;  3I76 A;  3NVV A;  1JRO A;  4LVS A;  4E0D A;  2IMW P;  3C1Z A;  5KG2 A;  5ALM A;  2JHD A;  3H8M A;  4BGD A;  4TUR A;  3ED5 A;  2ZTC A;  4TUS A;  4ECU A;  3T5J A;  1RXW A;  1UT8 A;  1L7M A;  3PY8 A;  5J8Y A;  4O9M A;  4QZC A;  4KLU A;  7ICS A;  5AK5 A;  4B9N A;  5KL8 B;  2JEI A;  3K1R B;  2OM6 A;  3H0M B;  4UAV A;  1SXE A;  2VAN A;  5DGB A;  2M9N A;  2J6T A;  3TAN A;  1T7P A;  2PKE A;  3AU6 A;  3QUC A;  1JRP A;  4F4X A;  2HHU A;  3L3F X;  1YT3 A;  1MQ3 A;  2W04 A;  3GDX A;  4DL3 A;  1TK8 A;  1ZQV A;  5DBB A;  4Y2U A;  3CYM A;  5DLG A;  1EXN A;  5KT3 A;  2I5H A;  3RB3 A;  1DK3 A;  3H40 A;  2DL0 A;  3WKA A;  2ZG6 A;  1ZJM A;  2C2E A;  4BWJ A;  1XSL A;  4I2J A;  4DL6 A;  3K4G A;  3AL0 B;  4USA A;  5ALF A;  2W9M A;  4P4P A;  3OGU A;  4EYI B;  2UVU A;  3E0F A;  5KFJ A;  4EEY A;  4I2C A;  3TAD A;  1T4G A;  5KFN A;  1S0M A;  3ZDD A;  4DOC A;  2AXT U;  3M8R A;  4MF8 A;  2H3V A;  4J9Q A;  2ZJ5 A;  2XGP A;  5KFP A;  5CB1 A;  3PVX A;  1WWU A;  3ZDE A;  4EZ9 A;  1TE2 A;  3UQ2 A;  2GWS A;  3VCB A;  2A1J A;  5DB8 A;  4P0P A;  4KLT A;  4QW9 A;  2E5S A;  3LYS A;  2XY5 A;  3JPT A;  1UPH A;  5KG4 A;  4DSL A;  9ICG A;  2BDP A;  2KNJ A;  3V72 A;  2LBO A;  3KZX A;  5AIC A;  4MF2 A;  2LHT A;  2FE9 A;  4NLC A;  2G09 A;  4DWI A;  3TAC B;  2FMQ A;  4KTQ A;  2KK0 A;  4AYB C;  5KFI A;  1Z4O A;  3HKZ F;  2KTQ A;  3SR6 A;  4JMU A;  9ICJ A;  2F77 X;  4UW9 A;  5KFR A;  1NJZ A;  3JPO A;  3V7L A;  2Y0S F;  4MFF A;  1L7O A;  1TK5 A;  4PH5 A;  9ICX A;  8ICV A;  4FO6 A;  5JUM A;  1NK9 A;  3E2E A;  4I2G A;  4K4H A;  4F92 B;  3D2Q A;  4IRD A;  2H3I A;  3BQT A;  5KFK A;  1WYG A;  2LI6 A;  3QYP A;  4QZD A;  3N7R C;  4DQS A;  9ICB A;  2KSO A;  1QSS A;  4I2D A;  3U26 A;  4PGY A;  4NL9 A;  3UMG A;  2F8K A;  2WB1 F;  4LZG A;  1BVS A;  4M0A A;  3I1Y A;  2BCQ A;  2PFP A;  4YD1 A;  1Z19 A;  4UB5 A;  4F4W A;  4KLH A;  2AH5 A;  4KN7 A;  4FFD A;  3HKZ C;  4DSK A;  4RPX A;  5AKL A;  1OUQ A;  1IXR A;  4OJO A;  4PL2 A;  4QZA A;  1U48 A;  2RP5 A;  3H4B A;  3AN1 A;  3WKE A;  2GH1 A;  5HR6 A;  4US8 A;  2FLN A;  4ZH4 A;  3C5G A;  5L1K A;  1L3V A;  2Y1J A;  3BS7 A;  2V4R A;  1UQV A;  8ICU A;  4ECY A;  4UAZ A;  4ZOH C;  3AMZ A;  4PJ0 U;  1D9F A;  3RH4 A;  2F44 A;  2H5X A;  4ED8 A;  2DPI A;  4YMO A;  2Q0Z X;  4F5O A;  1ZQS A;  2ES6 A;  5DBA A;  2W9C A;  2JMG A;  3ZD8 A;  2YMP A;  5BPC A;  4YXM A;  3SV3 A;  7ICQ A;  4R66 A;  1D8B A;  2UVR A;  2E8M A;  2ZIW A;  2M0N A;  5BOL A;  4QZG A;  1N63 A;  2FI1 A;  2ISP A;  1NJW A;  1PK3 A;  3PW7 A;  4B9L A;  4EEL A;  1SKR A;  3HPO A;  5AKG A;  1RG6 A;  4KLL A;  7ICI A;  2W11 A;  1MN8 A;  3V6J A;  3KHR A;  4EX6 A;  4O3N A;  1JUD A;  3QXG A;  8ICR A;  3M6K A;  2QKQ A;  4F93 B;  4F5R A;  2IHM A;  4C4S A;  1MC8 A;  4NJ8 A;  4XUS A;  5J0Y A;  2Y0S C;  4Y2P A;  3UM9 A;  2J6S A;  2QAR B;  3MDC A;  1SKW A;  5HP4 A;  5EE9 A;  2OHF A;  5HHH A;  1DRG A;  4PZO A;  5KFE A;  4YR3 A;  4J9O A;  1NK6 A;  3SMV A;  4DL5 A;  4PHA A;  5L1L A;  7ICP A;  4PL1 A;  3Q8M A;  3RJJ A;  2DKZ A;  4RQN A;  4BWM A;  3FYH A;  5CP2 A;  4F91 B;  4KLG A;  4C8L A;  5ALN A;  1X9S A;  4B9U A;  5DB9 A;  1YZ7 A;  2PFQ A;  1JI7 A;  3T5L A;  1BNO A;  1DGJ A;  4DFJ A;  2IBK A;  1HEK A;  4I2B A;  4TUP A;  4RT3 A;  2HBJ A;  2WTF A;  4Q45 A;  2W9C B;  3OSN A;  1D8Y A;  2KP7 A;  5EWG A;  2OCE A;  1WG8 A;  2HHX A;  2KJ8 A;  1V97 A;  1FO4 A;  3IG5 A;  4KLQ A;  2N1R A;  4P0Q A;  4C4T A;  2VA3 A;  3F5A A;  4KLO A;  3UXO A;  1WWV A;  2XY7 A;  1QLN A;  4J9K A;  5ALT A;  5KFU A;  3DV9 A;  4UB1 A;  3RR7 A;  2O6K A;  2ZIV B;  3ISB A;  2P6U A;  5AKJ A;  2OYY A;  4M9G A;  5AKH A;  5J2H A;  1QQ6 A;  2EQY A;  2MSN A;  3L5K A;  5KT2 A;  1LVH A;  4O3P A;  2VJ4 A;  8ICW A;  4QZI A;  3Q8P B;  8ICO A;  3H7I A;  1SV0 A;  2HI0 A;  1L8O A;  3PML A;  4OO1 J;  3LDA A;  2W9A A;  1CI4 A;  5J2J A;  5JRT A;  1ZQQ A;  5CEH A;  4ECZ A;  5J0O A;  2R8I A;  4IRK A;  2JRZ A;  2D6F C;  2W3R A;  1Q3V A;  2OEH A;  2HVI A;  3FAH A;  2NRT A;  4U6P A;  5J2G A;  1BNP A;  3MGV A;  4M2Y A;  2IHN A;  3TQ1 A;  4BX9 C;  2RDJ A;  3LK9 A;  3M1Y A;  1TV9 A;  3WU2 U;  2K4E A;  4AYB F;  5J29 A;  1V38 A;  3EYZ A;  1XSP A;  3ZD9 A;  2ZUD A;  1SZP A;  1OXJ A;  1UA1 A;  2H3Q A;  2HDO A;  4RQ1 A;  2QB1 A;  3KD3 A;  4DQQ A;  1ZQW A;  1D8L A;  4NL9 C;  4KLF A;  3TAP A;  2KG5 A;  2DWQ A;  1CUK A;  1ZQE A;  1UT5 A;  5JTI A;  5KFD A;  1N61 A;  2G08 A;  5DB6 A;  3C2M A;  4LJX A;  2BQR A;  7ICO A;  1GO3 F;  4FS2 A;  4J9P A;  7ICL A;  3M6Z A;  4PZN A;  2HBK A;  4TQR A;  2AGQ A;  5F9N A;  1JXE A;  5KG6 A;  2AJQ A;  5T14 A;  4UB2 A;  3GII A;  5IIK A;  1VLB A;  1ZQZ A;  3GFK B;  4CDG A;  2BCV A;  3OJU A;  2IA6 A;  3UXP A;  3HX0 A;  2DKX A;  4Z6D A;  3M9M B;  3T5H A;  3V7J A;  4FBT A;  3OTQ A;  1ZQD A;  3C29 A;  2JV3 A;  3PW4 A;  3BZK A;  1NK7 A;  3NGD A;  4GXI A;  3N4M B;  4BUG A;  4P2H A;  1F0M A;  7ICR A;  2ZXH A;  4GXJ A;  4JWN A;  4Y2S A;  1L6N A;  3GV7 B;  1B22 A;  1JAL A;  3WK9 A;  4KLM A;  5ALY A;  5KFT A;  1X6I A;  3ORY A;  3RH6 A;  2YTU A;  9ICQ A;  3H0R B;  4C7Y A;  5AM4 A;  1ZQX A;  3F53 A;  1X6J A;  1AQ6 A;  2JXJ A;  2CN1 A;  4XRH A;  4C8K A;  2W7O A;  9ICL A;  3M7D A;  3RRH A;  4FZL A;  4C80 A;  3QEB Z;  4PGQ A;  1TK0 A;  3G6Y A;  3BS5 A;  4IQT A;  4YXJ A;  5H2F U;  1L5U A;  1SL0 A;  4QWB A;  1ZQC A;  4YR2 A;  4I2F A;  7ICG A;  4C8N A;  3MR2 A;  3MR3 A;  2WF7 A;  1J2N A;  2DFL A;  2ISO A;  4C0Z A;  4EX7 A;  3JPP A;  2G5I B;  4I2E A;  3CW2 C;  4UBC A;  1T94 A;  4GIB A;  2RHF A;  3NS1 A;  3KZI U;  4QWC A;  5IIO A;  1SB3 C;  4F5N A;  2EZX A;  2FPM A;  1B43 A;  3K1Z A;  4QZ8 A;  1FIQ A;  2KE7 A;  2GLE A;  4KLS A;  3WK8 A;  1TAM A;  2JEF A;  4M9N A;  1NKE A;  3RJE A;  4Q8F A;  2QLT A;  4O3S A;  4B9V A;  5AIB A;  5C5J A;  1KDH A;  1KQQ A;  1BPZ A;  4J9M A;  2JEJ A;  2Q4T A;  1KW4 A;  1L3U A;  2ZTE A;  2PMZ F;  4TQS A;  1PUZ A;  4I2A A;  4BXO A;  3RB0 A;  5DBC A;  2KZZ A;  3HP6 A;  5DQH A;  2VKQ A;  4PHP A;  2VA8 A;  3QUQ A;  1JX4 A;  3TAR A;  3D2N A;  4XQ8 A;  3F2C A;  4J9R A;  4NY8 A;  2K4H A;  2LKY A;  4CE6 A;  4U7C A;  8ICG A;  1ZXI A;  1PK1 A;  3QU9 A;  4YMN A;  2JEG A;  4QW8 A;  3MFI A;  3QNM A;  2XIC A;  2QB0 B;  2P35 A;  2GO7 A;  4KLI A;  8ICH A;  2PXI A;  4DCC A;  3MBY A;  3PO5 A;  4DOA A;  4YN4 A;  3OHA A;  4GXK A;  4YR0 A;  2ODG A;  4DFK A;  5ALW A;  1NOM A;  3H4D A;  1NZB A;  2PFN A;  2LPE A;  2J6U A;  3IG8 A;  4J9S A;  3K75 D;  3TI0 A;  2R8G A;  5KFF A;  1QQ5 A;  4O3R A;  2K8A A;  4QZH A;  5B66 U;  5J0T A;  1J2M A;  1V9P A;  5IIL A;  1B4F A;  4CF3 A;  3Q8R B;  1ZQB A;  2HW3 A;  3THV A;  4HAI A;  3IN5 A;  2E1F A;  3AEV A;  1KSP A;  1ARO P;  5J0S A;  1A77 A;  1KRP A;  2NRX A;  2A1J B;  3SI8 A;  2QB0 A;  5JU5 A;  1O08 A;  3WK6 A;  5ALJ A;  4F5P A;  4UB4 A;  2XY6 A;  2FLL A;  1KFT A;  3PMN A;  5AI6 A;  1SV4 A;  1KLN A;  1KTQ A;  2QAR A;  5KFG A;  1J97 A;  2R8H A;  4DSE A;  3RJG A;  3SYZ A;  4WJ3 B;  1MQ2 A;  3SAH A;  4O5C A;  1DK2 A;  1S0O A;  4NLZ A;  3MAB A;  1KFD A;  1S9F A;  2MAX A;  5CRX A;  5AKY A;  1ZD5 A;  4RNM A;  5AHX A;  1MA7 A;  4DQP A;  1Q8K A;  2BPF A;  2BHN A;  3KKA C;  4Z6E A;  4I27 A;  5CHG A;  3KHH A;  4ECR A;  4UBB A;  3A0B U;  1XSN A;  4ECX A;  3QZ7 A;  3EZ5 A;  3RF9 A;  1ZQF A;  2EH9 A;  5KG5 A;  5L1M A;  2ZIU A;  4Q43 A;  2A19 A;  4KLJ A;  1SIJ A;  3UMB A;  5J2F A;  4M9J A;  3WK5 A;  3TAQ A;  2PI4 A;  3OJS A;  2KKV A;  3L4P A;  4RQ4 A;  1KKX A;  2L5Y A;  1NI3 A;  4EBC A;  2KJ9 A;  1Z3E B;  3AQF A;  4QIW C;  2EZZ A;  1JIH A;  4ECS A;  3TAD C;  4RNN A;  2KVS A;  4XA5 A;  1ZRM A;  3ETR A;  2BGW A;  1KBU A;  3HIL A;  1B0X A;  3M9O B;  1X40 A;  1ZQK A;  2KSO B;  7ICJ A;  4R63 A;  5ALR A;  2ASJ A;  1HUO A;  2XCP A;  3RJK A;  2HBM A;  5EE1 A;  4RQ8 A;  4IS7 A;  4NXZ A;  5DDM A;  3N7S C;  4DS4 A;  2EZY A;  1RYR A;  2KD1 A;  2E8P A;  2W7P A;  3V7K A;  3B0Y A;  3PR4 A;  4MFA A;  3H0L B;  3T79 A;  2BQ3 A;  9ICH A;  5ALQ A;  3AUO A;  2LYA A;  4QIW F;  4P4M A;  1A6S A;  2KMD A; 
#chains in the Genus database with same CATH homology
 2YQE A;  2CXY A;  5K4L A;  2EQY A;  2JXJ A;  1KKX A;  2LM1 A;  1RYU A;  1IG6 A;  1C20 A;  2JRZ A;  2EH9 A;  2LI6 A;  4LJX A;  2RQ5 A;  5CEH A;  2KK0 A;  1KN5 A;  1KQQ A;  2OEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...