2OEHA

Determination of the three-dimensional structure of the mrf2-dna complex using paramagnetic spin labeling
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*AP*CP*AP*AP*TP*AP*TP*AP*AP*CP*GP*TP*CP*G)-3'
publication title Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2oehA00
1KN5A 1KQQA 2RQ5A 5K4LA 2JRZA 2LI6A 1IG6A 1KKXA 2CXYA 4LJXA 2LM1A 1RYUA 1C20A 2JXJA 2YQEA 2EH9A 2OEHA 2EQYA 5CEHA 2KK0A
chains in the Genus database with same CATH superfamily
1ZQRA 1D8YA 3NRWA 3RB4A 1N56A 1O03A 1ZQVA 1T94A 1TFRA 4R64A 1HUZA 1ZQQA 5J0TA 3RJGA 3MR3A 5KT4A 3SV4A 1RQLA 3C29A 3RBDA 5ALPA 1MSWD 1UHUA 4TURA 5D46A 1ZQKA 3D2NA 3OSPA 4DO9A 2Y9UA 2C2RA 4OJPA 1X6IA 2WF9A 4NLKA 5BPCA 2WF6A 3M9NB 1UPHA 4PHPA 5KFXA 2ASDA 1ZQDA 3B9JA 4KLUA 2JHDA 3B0XA 3GZFA 3H8WA 4RQ5A 1DGSA 4KN7A 2XY5A 2G5HB 2V4RA 3ISCA 3KBBA 5ALHA 5EWFA 1N48A 1SKWA 2LYBA 4OJ6A 5J0SA 2MU2A 5AI6A 4AYBC 3H40A 4UB5A 4F2RA 2DBYA 4UAUA 3F2DA 2Y1JA 1V9PA 1X42A 3RB0A 5HMMA 5KFGA 2N1RA 5J2HA 2YMQA 5ALTA 3EPGA 3Q8KA 4A8EA 3NUQA 3UM9A 1K1QA 5HHHA 5JUMA 3N4MB 2BDPA 3AN1A 2VANA 5AK3A 2ODGA 2BCVA 4DFKA 1F0MA 1NI3A 4HAIA 3JPRA 4F4ZA 3QEAZ 2RDJA 1NK5A 3TFRA 3GIJA 5ALLA 4DLGA 1TAQA 4QZ8A 1J97A 2OXOA 2ATLA 2BQUA 1CI4A 2AJQA 4QZDA 4R8UB 1NK8A 4UW9A 3ZDAA 1ZQSA 5DG8A 1QSYA 3NGDA 3GFKB 3NVVA 5AM5A 3ZDEA 3BS5A 2RDIA 4DOCA 1NKCA 5AKXA 2J6TA 3IN5A 5KG7A 5G5HA 3MFIA 1TKDA 3T5HA 3ONNA 2JRZA 2XY7A 4O5CA 3I1YA 5AKJA 4DFDA 3VCBA 1UT8A 5KFCA 4KN4A 1LKYA 2K4HA 4O5KA 4J9PA 1C20A 4RQ3A 1B22A 1KEJA 3GIIA 1L3VA 4RNOA 2BCUA 1NKEA 2FDRA 5GTIU 2XICA 3SEIA 2K8BB 2Q0ZX 2DKXA 2E1FA 3KHLA 5EWEA 3HP6A 2HOIA 4TUQA 1KKXA 8ICWA 2FLLA 3UQ0A 9ICFA 4YMOA 5TZVA 3JPOA 4XA5A 3MDAA 4FE3A 5J2CA 1D8LA 5ALVA 1TE2A 2MUTB 4PJ0U 1SL2A 1WUDA 4Q45A 2UVRA 2JGAA 4RT3A 5KG4A 1L7PA 5AKZA 5IIMA 1PVQA 2V9WA 5KFMA 3UMBA 3TQ1A 2B6GA 1ZJNA 4FO6A 4EZ6A 2KSOB 1Q3UA 2JEGA 1A77A 3TACB 2F1JA 3C2MA 3SMVA 2HHVA 9ICLA 2DWQA 8ICGA 4NV0A 5J0RA 3T79A 1ZOLA 1SV4A 3IP4B 1J2NA 8ICHA 4GC6A 2LI6A 5KFYA 3CP8A 5J2KA 2EAPA 1C7YA 2HOQA 2LMRA 4RNMA 2AU0A 4NL9A 1S77D 3QYPA 5CEHA 2KG5A 8ICRA 3C1ZA 2PFOA 3SZ2A 2KD1A 3ED5A 4IQVA 3WKEA 1WG8A 5A0LA 4JUZA 8ICZA 2ALZA 2ZIWA 2PKEA 2KMDA 1L8LA 1PZNA 4UAWA 3CNHA 3K1ZA 2VKQA 4YR2A 4C7ZA 4QWDA 2HHTA 3PW4A 2ZIUA 3IM1A 5ALRA 4P0QB 5EE1A 4FZMA 3TANA 7ICPA 4BXOB 2YB1A 3GDXA 3OHAA 1ZD5A 5IINA 4RQ0A 3NTUA 2CPRA 5HR6A 4EZ9A 5KFKA 5J0QA 4DSJA 2YN4A 3MABA 5AI5A 1H38A 2HMXA 5DB7A 2ZJ8A 4US8A 2LM1A 7ICUA 4OCZA 1Z00A 9ICTA 4F5NA 2ISPA 2IHNA 1VLBA 2ZUBA 4DL5A 4B9MA 2RP5A 9ICHA 5DBBA 2H3IA 5HMLA 1FO4A 2GH1A 4DSKA 5KFDA 5KT7A 4PHDA 4O3RA 4IC9A 4J9MA 4M9HA 2KIVA 5F9LA 3RBEA 4ECTA 3UXOA 8ICMA 2LKYA 2WAQF 1D8BA 1V85A 2YMMA 4DS4A 1ZQLA 3Q8MA 2HOFA 2KZMA 4NJ8A 2HBLA 2E8PA 3T5LA 4FS1A 2FPKA 4I29A 7ICSA 3KHHA 3UPQA 1SL1A 3WK6A 2ZJ5A 4GXKA 1S9FA 1X9WA 2G5IB 2KP7A 1JRPA 5KNIA 1RYSA 1ZRMA 3M9OB 2PFNA 4QWBA 3H7IA 3DV9A 3AU2A 5ALMA 1UA0A 1ZQGA 1UT5A 1HIWA 3NVYA 4RPYA 3KHRA 4CF4A 5KFEA 2XCAA 3MGHA 3QU9A 5E79U 4Y2UA 4NLZA 3FDSA 1RPLA 3RJEA 4C4RA 4Y2PA 5KFBA 5B66U 5KFRA 3OHBA 2B0CA 3C5GA 2WB1F 3QZ7A 1KW4A 3JPTA 2CXYA 5IIKA 2A1JA 4QZBA 4B9TA 4C4SA 3PSPA 4IQWA 5J0OA 1ZQIA 2EDUA 4R63A 2OEHA 4MEXA 9ICXA 2RQ5A 5EE3A 2YMLA 1RZTA 1QTMA 4B6JA 2W9BA 5J2FA 5JTIA 5AKGA 3QUQA 4RQ8A 2HVIA 4QZHA 3FAHA 5DDMA 5KT3A 1NKBA 2KE7A 4M6WB 4BX9C 5AKHA 4ED6A 2YQEA 3EPIA 4NL9C 4ED0A 1F5SA 2PMZF 4P4MA 3J81j 5J2AA 2IA6A 5J2EA 3BDPA 4I2DA 1KLNA 2G09A 3RTVA 1N60A 3M1YA 4M0AA 1RG6A 4PL2A 1CEZA 2KJ9A 5CR0A 2EAMA 2E5SA 5F9NA 8ICOA 1XO1A 1GO3F 3N7SC 5AKIA 5AIBA 1NK0A 2KFNA 2KTQA 4J9SA 1ZJMA 1HUOA 2HDOA 4O3MA 1BPXA 4KITB 1V38A 1N62A 2P66A 2GWSA 5ALWA 4C8OA 2W8KA 4MF2A 9ICIA 1CUKA 4KMOB 1RYUA 3G6YA 1B43A 4Y2TA 2KOBA 5L1LA 4Y2SA 4F4KA 5IIJA 1JROA 2QARB 3HX0A 1ZQHA 1SWVA 3IG5A 2YTUA 8ICXA 4KLHA 2UVVA 4KX5A 1OW5A 3NASA 3KOOA 2RRDA 7ICGA 3PX6A 9ICQA 3AU6A 2XIDA 4QW8A 2LYAA 4PPXA 4U6PA 1F44A 5KFHA 4RUAA 4RT2A 5J2GA 1SKRA 3C23A 5ALFA 3KFUF 2W04A 9ICCA 5AM1A 5JU5A 4NLBA 1S5LU 4CF5A 3EWAA 2B21A 2WHEA 2BR0A 2DGZA 5CWRA 5IILA 2VA3A 3MGVA 3RH6A 5EWGA 4ECSA 2FE9A 5J29A 4KLIA 4FZLA 5AK5A 4KLFA 1B0XA 4YCXA 3KD3A 1RXVA 4R8UA 2HHXA 2HI0A 2K4PA 4ICAA 3ALRA 2K60A 3WKCA 4RUCA 4I27A 1L7MA 2NRTA 3PR5B 4QWEA 4DL4A 2F77X 4UASA 2KKVA 1DRGA 2IOFA 1T3NA 2ZTCA 4DL2A 2HVHA 3ICXA 1N61A 1ZQEA 8ICAA 5DBAA 2ASLA 5DB9A 1DK2A 5ALNA 2P6UA 2ISOA 4QNLA 2DQNB 2QB0B 1ZQTA 4DQIA 3MC1A 1PK3A 2AHOB 4EEKA 2K8AA 4PGQA 1A76A 4UBBA 8ICSA 4M2YA 1BPBA 5J0WA 1JIHA 3PX4A 4BWJA 1FEZA 8ICTA 4QWAA 2GO7A 3V7KA 2Y0SF 2C2EA 2AH5A 3SYZA 4XUSA 3BQ0A 2LPEA 4LZDA 4QZFA 5KAFU 3V6KA 2NRXA 2MRLA 4C80A 2RHFA 4ECZA 4I2FA 4UBCA 5ALXA 2HHUA 2ZXIA 4PHAA 2BPCA 4Y2YA 3RAQA 4DSEA 4IS7A 1YZ7A 2D6FC 4DL6A 5KT5A 9ICGA 2K89A 4C4TA 4RQ1A 4O9MA 5DQGA 3HKZF 1SL0A 2BPGA 2KSOA 1COOA 4CCHA 3SENA 4O3PA 5DLFA 4C8NA 3EZ5A 4YVZA 3ETLA 3Q8LA 3LVVA 3S6JA 5AKLA 4YXMA 4EBDA 3V6JA 4M47A 2CN1A 3WK4A 1U9LA 1QCKA 4GFJA 2WF5A 1Q3VA 4RPXA 1J2MA 5AM2A 3UMGA 4IR9A 5AM3A 2HBJA 3JPQA 2MSNA 3SD7A 4NWIA 2QB1A 4JK1A 4ECWA 3H8JA 3NVWA 3BS7A 5KFLA 2GOLA 3M9MB 3D6JA 1A6SA 1URJA 1U48A 3N97B 4B9NA 2AGQA 4PHEA 1AQ6A 2JMGA 4KLGA 5DDYA 4QZAA 5CA7A 3QU5A 4XQ8A 3G6XA 5DLGA 3I76A 3QZ8A 4FBUA 4GIBA 5KFVA 3QUCA 5CJ7A 3T5KA 3KKAA 1X2IA 1RQNA 2JEJA 4P0QA 2ZTEA 3H0MB 2ZIVB 4IRCA 1ZD2P 5KFQA 2FPLA 3ZDDA 3CYMA 9ICJA 5AI0A 1X6JA 5AICA 4F91B 3NVZA 1K1SA 1BNPA 4C7YA 4RQ2A 5KFUA 1SV0A 4OJ5A 5DG7A 4K4GA 1U4BA 3L4PA 4CE6A 3DEEA 5J8YC 8ICFA 4QZIA 5CHGA 2ZJAA 2MAXA 4QWCA 4X5VA 1TAUA 3HW8A 4TUSA 3NS1A 3RB6A 5DB6A 3T5JA 3OTQA 4OJOA 1U49A 7ICIA 2XI9A 4YR0A 4KLMA 4ECVA 2KHQA 2F3NA 4UAYA 4Q8EA 4RQNA 1JUDA 4ED3A 3F2CA 4KLOA 2FLNA 2HW3A 1X9SA 1IIPA 3PMNA 1ZQOA 3GQCA 1IV8A 2OCEA 2P35A 3L3FX 3IV6A 4TQSA 4UB6U 1LV5A 2JH7A 1A0PA 4G3IA 3HPOA 4O3OA 4J03A 1WWVA 5J2IA 2D8CA 1Q46A 1KSPA 5CP2A 3RJJA 2FPMA 2I5HA 5KL1B 2OH2A 8ICBA 3SAFA 4JV2A 4DL3A 5KAIU 3BZCA 3PZPA 2HHWA 1L7NA 2K4EA 2I1QA 3AQFA 3FM9A 3EYZA 2IBKA 2KJ8A 4YFKA 3RF9A 2QKQA 4DQQA 4NY8A 1KBUA 3V72A 4J9RA 5CRXA 4IRKA 5AIAA 4GXIA 2FLPA 3E2EA 8ICCA 5ALJA 8ICKA 1JMSA 2XY6A 5AI8A 1NZPA 5L1IA 4LZGA 4F4XA 3QU4A 5D49A 2KNJA 7ICJA 1Z4NA 4XRHA 4AP9A 3PVXA 1ZQNA 5H2FU 2JZBB 2NRWA 4MHVA 2KFZA 7ICMA 1S0VA 4MFAA 1WYGA 4Z6FA 2Y1IA 3JPPA 2LM4A 4QJFB 5KFTA 2W9CB 5L9XA 5J2DA 1RM6C 2NV3A 1JALA 9ICMA 2DPIA 1RYRA 1MQ3A 4MEYA 4Z6CA 4GLXA 3AMZA 4JV1A 2KN7A 1JXEA 2EAOA 2KZ3A 3M6ZA 3WK9A 5ALSA 4I2CA 1KRPA 2FI1A 2AQ0A 3RH5A 4I2GA 2WAQC 5ALZA 1XSNA 4F5QA 1TV9A 1SGGA 2PI4A 3M8RA 3RRGA 3LYSA 4FZNA 3OJUA 4M6WA 3D2QA 5FP0A 5ALOA 5KFPA 1D9FA 4GC7A 3Q8QB 3AEVA 3BQ2A 3GV7B 1NNLA 3NRZA 2M9NA 3QU7A 3PSTA 1WCNA 3SV3A 1L5UA 3PNCA 4Q8FA 2BPFA 1TVAA 3WU2U 4M9LA 2HCFA 1QH9A 4ED8A 1ZETA 1SZPA 4TQRA 5ALGA 2E8MA 1XSLA 1ECWA 1ZQFA 4C0ZA 3Q8PB 4F72A 4RU9A 2AGPA 3KKAC 4QZGA 2WF8A 3MFHA 1LB2B 2H5XA 2KV2A 2JV3A 4C8LA 4B9LA 4J9NA 4RNNA 1MA7A 3EW9A 5IIOA 3MR5A 1L7OA 4RQ6A 4J9KA 5IIIA 2WB1C 1SXEA 2QARA 1SV0C 2YX8A 4P0PA 4B9VA 4RQ7A 3ZDBA 1BVSA 2R18A 3HT3A 5D4BA 3N7RC 4NLGA 1PK1B 2DL0A 9ICAA 5K4LA 5J2JA 2G0AA 1L8OA 2ZIUB 9ICKA 5KG3A 1U47A 4KLLA 4I2IA 3T3FA 4BWMA 3AUOA 3QU2A 4I2HA 2PMZC 3IHQB 4O3NA 5J2BA 4DF8A 4UARA 4USAA 1Z19A 3PX0A 4FFDA 2C28A 4YR3A 1B4FA 2I6XA 3F53A 2Q4TA 4O5EA 2IOFK 2CRXA 3N28A 3AL0B 4Y2RA 3ISBA 2BKEA 4UAZA 5AKKA 3LK9A 2BGWA 3FYHA 8ICQA 1PVRA 3V7LA 3C2LA 3OPXA 4ECYA 5JRTA 4YMMA 2YMPA 2QB0A 3UQ2A 1XS9D 9ICPA 2XVTA 4QIWF 2W8LA 4Y2JA 1IG6A 2FMPA 4M9JA 9ICOA 3RJKA 2BDUA 4OO1J 5ALKA 4WJ3B 3DDHA 2ZIXB 4EYIB 4F4WA 3MDCA 4J9OA 2NRVA 5AKEA 3A0HU 1L6NA 7ICKA 3WK8A 4KLQA 3RR8A 2F2AB 2KZZA 7ICRA 2W43A 4O3SA 4R65A 4MFCA 4F5OA 8ICIA 2BCRA 5J8YA 1HEKA 1OUQA 4DLEA 2V4QA 1NK6A 2LYHA 1ZQPA 5L1MA 1PUZA 4F71A 3WK7A 1ZQAA 3KTQA 2OYYA 1UQVA 4IR1A 4O0IA 4PZNA 4CDGA 2F8KA 1FFVA 2F1IA 3QUTA 3RB3A 4MF8A 3BQTA 4TUPA 2YY6A 3UXPA 1CRXA 5AK4A 3A0BU 4RQMA 3RFAA 4QZEA 8ICNA 3EUB2 4KMUA 1FFUA 3GILA 2VIXA 5ALUA 2G08A 2W11A 2JH1A 1X66A 5DBCA 2Y0SC 2W3SA 2AXTU 4ELUA 9ICUA 3PW5A 3K4GA 1Z4OA 3SAGA 2FJ6A 4ELTA 2NO4A 2Z7JA 2ZIVA 1S97A 1DGJA 5BOMA 5AI9A 1NOMA 3CRXA 1KDHA 9ICSA 9ICBA 4CRXA 3ZD8A 4CF3A 3RJFA 3TAPA 2OWOA 5ALIA 3HKZC 1NK4A 4EBCA 1KFDA 5ALQA 1NK7A 4UB2A 2XGQA 4OD0A 3SAHA 3TI0A 4ELVA 4ZOHC 4IRDA 3H8MA 2MUTA 4IQUA 2H3VA 2EZXA 3C1YA 4IL6U 2GLEA 4EELA 2W7OA 3PY8A 1JI7A 5CB1A 4C8KA 4DCCA 3JPSA 4DFMA 5GTHU 7ICTA 1QLNA 1IM4A 1OXJA 2KICA 2W9MA 2UVWA 3GIKA 1QSLA 2F8LA 3TADA 5EE9A 1VJ5A 4I28A 1KFSA 1ZQ1C 1XNSA 3O0FA 4AYBF 4NLNA 1KN5A 2BHNA 1MN8A 3QE9Y 3C21A 1SXDA 4F50A 1ZD3A 3KZXA 4YXJA 1MC8A 1X9MA 4I2BA 3WKAA 1ZRNA 4LVSA 4YD2A 1QQ7A 5HNKA 3OJSA 2XO7A 4HYKA 3WKDA 1ZXIA 2KHVA 5DGAA 4YG2A 1JN3A 4Q43A 2F44A 2C22A 2DPJA 4EX7A 3V7JA 2NO5A 2ASJA 4EENA 3RJIA 5C0YA 2PFPA 5DG9A 2DKZA 8ICYA 3K75D 3PV8A 4P2HA 2XCPA 1XSPA 2K8CB 3PO4A 4K4HA 4M04A 7ICFA 2JZBA 4BXOA 1SIJA 3TKAA 1NJZA 3H8SA 1SKSA 5ALDA 9ICWA 1N5WA 1NJYA 5J0PA 1S0OA 4NM2A 4UB8U 8ICUA 4I2JA 5L1JA 4F93B 4R66A 3D2SA 3HJEA 2R8IA 2W9CA 2HHSA 1QSSA 9ICEA 1RDFA 3ZDCA 3QNMA 3QUBA 5J0XA 4UB4A 3H4DA 1LVHA 1KQQA 4ECQA 4DQSA 2ZUDA 1KTQA 4PL1A 1KL9A 2QLTA 2D3DA 4J9QA 4FS2A 1AROP 4Q44A 2BQ3A 1BPZA 1SB3C 2VA2A 5KFWA 7ICEA 5F3XB 4QZ9A 5KFOA 5L1KA 2BZFA 3HILA 3QXGA 4F3OA 8ICEA 3WKBA 1TK0A 3JPNA 3UXNA 1WCLA 4KX3A 1ZYQA 5KTQA 4EEYA 3GV8B 2EZYA 3G6VA 3PSFA 4JWMA 5J0UA 5J0YA 1ZQUA 3HRDD 2ZXHA 2PI5A 5C5JA 3PW7A 3B0YA 4PZOA 1T8EA 2J6UA 4UQGA 2IOHA 4FBTA 8ICLA 3AM9A 3BJYA 2P6RA 2KIWA 2OHFA 1IXRA 5BOLA 1NJWA 1NK9A 1QQ5A 4MFFA 5AI4A 2W55A 1ZQWA 3BS5B 1M6YA 3L5KA 2E8OA 4YQWA 3TAQA 2ZG6A 2WF7A 2BCSA 4LJXA 2E1EA 2IMWP 4U7CA 2R8GA 3U26A 8ICPA 2R8KA 1DOQA 1MQ2A 4US9A 2PFQA 4KLDA 1LKYB 2R8JA 1PK1A 2KVSA 1S0NA 4DSIA 5DQIA 3R9KA 4F5RA 4BGDA 5KT2A 3M8SA 4DSFA 2FMSA 4UB1A 3PSIA 4JB3A 2DF4B 3LVWA 4RPZA 3BZKA 3OSNA 4QW9A 1ZQXA 4RQ4A 3TADC 5AM4A 3ZD9A 1ZQBA 1UCVA 1N5XA 3UMCA 1T3QA 3F5EA 2LHTA 4G9BA 4IQTA 3MBYA 2A1AA 2H3FA 2W9AA 2AGOA 4GXJA 8ICVA 5KFSA 3RJHA 1WWUA 3I28A 5HHIA 4DL7A 5KFZA 3C5FA 2VJ5A 4ED2A 2KVCA 5KL8B 3PO5A 5DKWA 3H0LB 1XWLA 1BPYA 4UB3A 3LWLA 2I9GA 2W3RA 1COKA 1EXNA 4F4YA 4F92B 3IRUA 4OJLA 4Y2QA 1S76D 4BDPA 4BUGA 3WK5A 4NM1A 1UA1A 4F2SA 1V97A 2XC9A 4YP3A 2UVUA 3E0FA 2KJ5A 3PMLA 1FIQA 1S0MA 3K1RB 1TK8A 5AM0A 1JX4A 5KG0A 2K4IA 1YZ6A 3M7DA 3BQ1A 1TAMA 4J9LA 9ICRA 3IG8A 2H3ZA 3RR7A 3TARA 2M0NA 2JR5A 2A19A 4EX6A 4RZRA 4M9NA 3C28A 3KHGA 1NZBA 1T4GA 3ZI4A 2YB4A 2R8HA 2ZIXA 1ZQCA 3LDAA 1X40A 1Y88A 4UATA 4Z6DA 3THVA 3F5AA 3ORYA 5KG1A 2L5YA 2DUYA 3IDWA 1S8OA 4Y2XA 4P4PA 2PXIA 1ZQJA 2W03A 2RLTA 2H3QA 4DFPA 2HBMA 5DGBA 4F8RA 4KLTA 2ZIWB 2ZUCA 3CW2C 4DQPA 3VC8A 5B5EU 5KT6A 1SWWA 2MA1A 1YT3A 4B9UA 2E8NA 4Z6EA 7ICLA 3RRHA 3SQIA 2G07A 3GIMA 4DQRA 1NJXA 2EANA 2BCQA 1K5OA 2EZZA 2DFLA 1HJPA 2BQRA 1Z1BA 2VJ4A 1ZQYA 3FC4A 2XGPA 4ECUA 4PH5A 5AK6A 3SI8A 5KG6A 5HR7A 2W7PA 3QEBZ 4K4IA 1RXWA 2A3VA 4KLEA 4JV0A 3TFSA 4KLJA 1BGXT 2C2DA 4ZH4A 1S10A 2HSZA 5HP4A 2JXJA 2WFAA 2IHMA 3QX7A 4PGXA 4EYHB 3RAXA 1ED1A 3PR4A 4ED7A 1Z00B 4KTQA 4KLSA 4E0DA 3M6KA 4O3QA 1DK3A 2O6KA 4DOBA 3MR2A 2KEYA 4ECXA 1VDVA 4QIWC 4CNQA 5KFFA 2E3TA 4YN4A 1ZQMA 1XO0A 2WTFA 3N7PD 2J6SA 2FMQA 4YMNA 4DS5A 4YD1A 2OM6A 1Z3EB 2LBOA 5KG5A 3Q8RB 5DB8A 8ICJA 1PVPA 2JEIA 2Y9TA 1U45A 2ES6A 7ICOA 3Q8SB 3GU3A 1KFTA 4EBEA 1T7PA 2AQ4A 2HBKA 4UAVA 4BJQA 1L3UA 2JEFA 5ALEA 4Y2VA 4ECRA 2VA8A 4DOAA 3H0RB 7ICNA 7ICHA 9ICVA 3HWTA 5KFNA 4F5PA 3MR6A 4JMUA 1XC9A 2ESEA 2F1HA 5DQHA 2F76X 4M9GA 4PGYA 5AHXA 4B9SA 7ICVA 4DSLA 3H4BA 5ALYA 3RH4A 4DWIA 2KKPA 1L3SA 2KK0A 4JWNA 4P0PB 3V6HA 1ZD4A 1N2XA 2NYVA 1BPDA 9ICNA 4NLCA 1O08A 3SR6A 1SZHA 1ZQZA 3ISDA 1JXLA 4DFJA 1XU4A 5EE0A 1BPEA 5T14A 4CGZA 4I2EA 5KFIA 2A1JB 1DXSA 2W54A 2NRZA 1BNOA 4NXZA 4DEZA 3PW0A 2EH9A 5TISU 3KZIU 3GV5B 4QZCA 3C2KA 2EQYA 1D9DA 5G5GA 3OGUA 5EOZA 2HHQA 4DF4A 7ICQA 1Z1VA 1L3TA 4P4OA 2ZTDA 1Q8KA 4ED1A 1P7DA 3BQ7A 1N63A 4C8MA 3E58A 5AKYA 4ACOA 3MGIA 1TK5A 3LWMA 5KG2A 5KFJA 3PW2A 1X9XA 4I2AA 2W9BB 5KFAA 3ETRA 2G06A 3AQEA 3F2BA 1QQ6A
chains in the Genus database with same CATH topology
1KN5A 1KQQA 2RQ5A 5K4LA 2JRZA 2LI6A 1IG6A 1KKXA 2CXYA 4LJXA 2LM1A 1RYUA 1C20A 2JXJA 2YQEA 2EH9A 2OEHA 2EQYA 5CEHA 2KK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  1KQQ A;  2RQ5 A;  5K4L A;  2JRZ A;  2LI6 A;  1IG6 A;  1KKX A;  2CXY A;  4LJX A;  2LM1 A;  1RYU A;  1C20 A;  2JXJ A;  2YQE A;  2EH9 A;  2OEH A;  2EQY A;  5CEH A;  2KK0 A; 
#chains in the Genus database with same CATH topology
 1ZQR A;  1D8Y A;  3NRW A;  3RB4 A;  1N56 A;  1O03 A;  1ZQV A;  1T94 A;  1TFR A;  4R64 A;  1HUZ A;  1ZQQ A;  5J0T A;  3RJG A;  3MR3 A;  5KT4 A;  3SV4 A;  1RQL A;  3C29 A;  3RBD A;  5ALP A;  1MSW D;  1UHU A;  4TUR A;  5D46 A;  1ZQK A;  3D2N A;  3OSP A;  4DO9 A;  2Y9U A;  2C2R A;  4OJP A;  1X6I A;  2WF9 A;  4NLK A;  5BPC A;  2WF6 A;  3M9N B;  1UPH A;  4PHP A;  5KFX A;  2ASD A;  1ZQD A;  3B9J A;  4KLU A;  2JHD A;  3B0X A;  3GZF A;  3H8W A;  4RQ5 A;  1DGS A;  4KN7 A;  2XY5 A;  2G5H B;  2V4R A;  3ISC A;  3KBB A;  5ALH A;  5EWF A;  1N48 A;  1SKW A;  2LYB A;  4OJ6 A;  5J0S A;  2MU2 A;  5AI6 A;  4AYB C;  3H40 A;  4UB5 A;  4F2R A;  2DBY A;  4UAU A;  3F2D A;  2Y1J A;  1V9P A;  1X42 A;  3RB0 A;  5HMM A;  5KFG A;  2N1R A;  5J2H A;  2YMQ A;  5ALT A;  3EPG A;  3Q8K A;  4A8E A;  3NUQ A;  3UM9 A;  1K1Q A;  5HHH A;  5JUM A;  3N4M B;  2BDP A;  3AN1 A;  2VAN A;  5AK3 A;  2ODG A;  2BCV A;  4DFK A;  1F0M A;  1NI3 A;  4HAI A;  3JPR A;  4F4Z A;  3QEA Z;  2RDJ A;  1NK5 A;  3TFR A;  3GIJ A;  5ALL A;  4DLG A;  1TAQ A;  4QZ8 A;  1J97 A;  2OXO A;  2ATL A;  2BQU A;  1CI4 A;  2AJQ A;  4QZD A;  4R8U B;  1NK8 A;  4UW9 A;  3ZDA A;  1ZQS A;  5DG8 A;  1QSY A;  3NGD A;  3GFK B;  3NVV A;  5AM5 A;  3ZDE A;  3BS5 A;  2RDI A;  4DOC A;  1NKC A;  5AKX A;  2J6T A;  3IN5 A;  5KG7 A;  5G5H A;  3MFI A;  1TKD A;  3T5H A;  3ONN A;  2JRZ A;  2XY7 A;  4O5C A;  3I1Y A;  5AKJ A;  4DFD A;  3VCB A;  1UT8 A;  5KFC A;  4KN4 A;  1LKY A;  2K4H A;  4O5K A;  4J9P A;  1C20 A;  4RQ3 A;  1B22 A;  1KEJ A;  3GII A;  1L3V A;  4RNO A;  2BCU A;  1NKE A;  2FDR A;  5GTI U;  2XIC A;  3SEI A;  2K8B B;  2Q0Z X;  2DKX A;  2E1F A;  3KHL A;  5EWE A;  3HP6 A;  2HOI A;  4TUQ A;  1KKX A;  8ICW A;  2FLL A;  3UQ0 A;  9ICF A;  4YMO A;  5TZV A;  3JPO A;  4XA5 A;  3MDA A;  4FE3 A;  5J2C A;  1D8L A;  5ALV A;  1TE2 A;  2MUT B;  4PJ0 U;  1SL2 A;  1WUD A;  4Q45 A;  2UVR A;  2JGA A;  4RT3 A;  5KG4 A;  1L7P A;  5AKZ A;  5IIM A;  1PVQ A;  2V9W A;  5KFM A;  3UMB A;  3TQ1 A;  2B6G A;  1ZJN A;  4FO6 A;  4EZ6 A;  2KSO B;  1Q3U A;  2JEG A;  1A77 A;  3TAC B;  2F1J A;  3C2M A;  3SMV A;  2HHV A;  9ICL A;  2DWQ A;  8ICG A;  4NV0 A;  5J0R A;  3T79 A;  1ZOL A;  1SV4 A;  3IP4 B;  1J2N A;  8ICH A;  4GC6 A;  2LI6 A;  5KFY A;  3CP8 A;  5J2K A;  2EAP A;  1C7Y A;  2HOQ A;  2LMR A;  4RNM A;  2AU0 A;  4NL9 A;  1S77 D;  3QYP A;  5CEH A;  2KG5 A;  8ICR A;  3C1Z A;  2PFO A;  3SZ2 A;  2KD1 A;  3ED5 A;  4IQV A;  3WKE A;  1WG8 A;  5A0L A;  4JUZ A;  8ICZ A;  2ALZ A;  2ZIW A;  2PKE A;  2KMD A;  1L8L A;  1PZN A;  4UAW A;  3CNH A;  3K1Z A;  2VKQ A;  4YR2 A;  4C7Z A;  4QWD A;  2HHT A;  3PW4 A;  2ZIU A;  3IM1 A;  5ALR A;  4P0Q B;  5EE1 A;  4FZM A;  3TAN A;  7ICP A;  4BXO B;  2YB1 A;  3GDX A;  3OHA A;  1ZD5 A;  5IIN A;  4RQ0 A;  3NTU A;  2CPR A;  5HR6 A;  4EZ9 A;  5KFK A;  5J0Q A;  4DSJ A;  2YN4 A;  3MAB A;  5AI5 A;  1H38 A;  2HMX A;  5DB7 A;  2ZJ8 A;  4US8 A;  2LM1 A;  7ICU A;  4OCZ A;  1Z00 A;  9ICT A;  4F5N A;  2ISP A;  2IHN A;  1VLB A;  2ZUB A;  4DL5 A;  4B9M A;  2RP5 A;  9ICH A;  5DBB A;  2H3I A;  5HML A;  1FO4 A;  2GH1 A;  4DSK A;  5KFD A;  5KT7 A;  4PHD A;  4O3R A;  4IC9 A;  4J9M A;  4M9H A;  2KIV A;  5F9L A;  3RBE A;  4ECT A;  3UXO A;  8ICM A;  2LKY A;  2WAQ F;  1D8B A;  1V85 A;  2YMM A;  4DS4 A;  1ZQL A;  3Q8M A;  2HOF A;  2KZM A;  4NJ8 A;  2HBL A;  2E8P A;  3T5L A;  4FS1 A;  2FPK A;  4I29 A;  7ICS A;  3KHH A;  3UPQ A;  1SL1 A;  3WK6 A;  2ZJ5 A;  4GXK A;  1S9F A;  1X9W A;  2G5I B;  2KP7 A;  1JRP A;  5KNI A;  1RYS A;  1ZRM A;  3M9O B;  2PFN A;  4QWB A;  3H7I A;  3DV9 A;  3AU2 A;  5ALM A;  1UA0 A;  1ZQG A;  1UT5 A;  1HIW A;  3NVY A;  4RPY A;  3KHR A;  4CF4 A;  5KFE A;  2XCA A;  3MGH A;  3QU9 A;  5E79 U;  4Y2U A;  4NLZ A;  3FDS A;  1RPL A;  3RJE A;  4C4R A;  4Y2P A;  5KFB A;  5B66 U;  5KFR A;  3OHB A;  2B0C A;  3C5G A;  2WB1 F;  3QZ7 A;  1KW4 A;  3JPT A;  2CXY A;  5IIK A;  2A1J A;  4QZB A;  4B9T A;  4C4S A;  3PSP A;  4IQW A;  5J0O A;  1ZQI A;  2EDU A;  4R63 A;  2OEH A;  4MEX A;  9ICX A;  2RQ5 A;  5EE3 A;  2YML A;  1RZT A;  1QTM A;  4B6J A;  2W9B A;  5J2F A;  5JTI A;  5AKG A;  3QUQ A;  4RQ8 A;  2HVI A;  4QZH A;  3FAH A;  5DDM A;  5KT3 A;  1NKB A;  2KE7 A;  4M6W B;  4BX9 C;  5AKH A;  4ED6 A;  2YQE A;  3EPI A;  4NL9 C;  4ED0 A;  1F5S A;  2PMZ F;  4P4M A;  3J81 j;  5J2A A;  2IA6 A;  5J2E A;  3BDP A;  4I2D A;  1KLN A;  2G09 A;  3RTV A;  1N60 A;  3M1Y A;  4M0A A;  1RG6 A;  4PL2 A;  1CEZ A;  2KJ9 A;  5CR0 A;  2EAM A;  2E5S A;  5F9N A;  8ICO A;  1XO1 A;  1GO3 F;  3N7S C;  5AKI A;  5AIB A;  1NK0 A;  2KFN A;  2KTQ A;  4J9S A;  1ZJM A;  1HUO A;  2HDO A;  4O3M A;  1BPX A;  4KIT B;  1V38 A;  1N62 A;  2P66 A;  2GWS A;  5ALW A;  4C8O A;  2W8K A;  4MF2 A;  9ICI A;  1CUK A;  4KMO B;  1RYU A;  3G6Y A;  1B43 A;  4Y2T A;  2KOB A;  5L1L A;  4Y2S A;  4F4K A;  5IIJ A;  1JRO A;  2QAR B;  3HX0 A;  1ZQH A;  1SWV A;  3IG5 A;  2YTU A;  8ICX A;  4KLH A;  2UVV A;  4KX5 A;  1OW5 A;  3NAS A;  3KOO A;  2RRD A;  7ICG A;  3PX6 A;  9ICQ A;  3AU6 A;  2XID A;  4QW8 A;  2LYA A;  4PPX A;  4U6P A;  1F44 A;  5KFH A;  4RUA A;  4RT2 A;  5J2G A;  1SKR A;  3C23 A;  5ALF A;  3KFU F;  2W04 A;  9ICC A;  5AM1 A;  5JU5 A;  4NLB A;  1S5L U;  4CF5 A;  3EWA A;  2B21 A;  2WHE A;  2BR0 A;  2DGZ A;  5CWR A;  5IIL A;  2VA3 A;  3MGV A;  3RH6 A;  5EWG A;  4ECS A;  2FE9 A;  5J29 A;  4KLI A;  4FZL A;  5AK5 A;  4KLF A;  1B0X A;  4YCX A;  3KD3 A;  1RXV A;  4R8U A;  2HHX A;  2HI0 A;  2K4P A;  4ICA A;  3ALR A;  2K60 A;  3WKC A;  4RUC A;  4I27 A;  1L7M A;  2NRT A;  3PR5 B;  4QWE A;  4DL4 A;  2F77 X;  4UAS A;  2KKV A;  1DRG A;  2IOF A;  1T3N A;  2ZTC A;  4DL2 A;  2HVH A;  3ICX A;  1N61 A;  1ZQE A;  8ICA A;  5DBA A;  2ASL A;  5DB9 A;  1DK2 A;  5ALN A;  2P6U A;  2ISO A;  4QNL A;  2DQN B;  2QB0 B;  1ZQT A;  4DQI A;  3MC1 A;  1PK3 A;  2AHO B;  4EEK A;  2K8A A;  4PGQ A;  1A76 A;  4UBB A;  8ICS A;  4M2Y A;  1BPB A;  5J0W A;  1JIH A;  3PX4 A;  4BWJ A;  1FEZ A;  8ICT A;  4QWA A;  2GO7 A;  3V7K A;  2Y0S F;  2C2E A;  2AH5 A;  3SYZ A;  4XUS A;  3BQ0 A;  2LPE A;  4LZD A;  4QZF A;  5KAF U;  3V6K A;  2NRX A;  2MRL A;  4C80 A;  2RHF A;  4ECZ A;  4I2F A;  4UBC A;  5ALX A;  2HHU A;  2ZXI A;  4PHA A;  2BPC A;  4Y2Y A;  3RAQ A;  4DSE A;  4IS7 A;  1YZ7 A;  2D6F C;  4DL6 A;  5KT5 A;  9ICG A;  2K89 A;  4C4T A;  4RQ1 A;  4O9M A;  5DQG A;  3HKZ F;  1SL0 A;  2BPG A;  2KSO A;  1COO A;  4CCH A;  3SEN A;  4O3P A;  5DLF A;  4C8N A;  3EZ5 A;  4YVZ A;  3ETL A;  3Q8L A;  3LVV A;  3S6J A;  5AKL A;  4YXM A;  4EBD A;  3V6J A;  4M47 A;  2CN1 A;  3WK4 A;  1U9L A;  1QCK A;  4GFJ A;  2WF5 A;  1Q3V A;  4RPX A;  1J2M A;  5AM2 A;  3UMG A;  4IR9 A;  5AM3 A;  2HBJ A;  3JPQ A;  2MSN A;  3SD7 A;  4NWI A;  2QB1 A;  4JK1 A;  4ECW A;  3H8J A;  3NVW A;  3BS7 A;  5KFL A;  2GOL A;  3M9M B;  3D6J A;  1A6S A;  1URJ A;  1U48 A;  3N97 B;  4B9N A;  2AGQ A;  4PHE A;  1AQ6 A;  2JMG A;  4KLG A;  5DDY A;  4QZA A;  5CA7 A;  3QU5 A;  4XQ8 A;  3G6X A;  5DLG A;  3I76 A;  3QZ8 A;  4FBU A;  4GIB A;  5KFV A;  3QUC A;  5CJ7 A;  3T5K A;  3KKA A;  1X2I A;  1RQN A;  2JEJ A;  4P0Q A;  2ZTE A;  3H0M B;  2ZIV B;  4IRC A;  1ZD2 P;  5KFQ A;  2FPL A;  3ZDD A;  3CYM A;  9ICJ A;  5AI0 A;  1X6J A;  5AIC A;  4F91 B;  3NVZ A;  1K1S A;  1BNP A;  4C7Y A;  4RQ2 A;  5KFU A;  1SV0 A;  4OJ5 A;  5DG7 A;  4K4G A;  1U4B A;  3L4P A;  4CE6 A;  3DEE A;  5J8Y C;  8ICF A;  4QZI A;  5CHG A;  2ZJA A;  2MAX A;  4QWC A;  4X5V A;  1TAU A;  3HW8 A;  4TUS A;  3NS1 A;  3RB6 A;  5DB6 A;  3T5J A;  3OTQ A;  4OJO A;  1U49 A;  7ICI A;  2XI9 A;  4YR0 A;  4KLM A;  4ECV A;  2KHQ A;  2F3N A;  4UAY A;  4Q8E A;  4RQN A;  1JUD A;  4ED3 A;  3F2C A;  4KLO A;  2FLN A;  2HW3 A;  1X9S A;  1IIP A;  3PMN A;  1ZQO A;  3GQC A;  1IV8 A;  2OCE A;  2P35 A;  3L3F X;  3IV6 A;  4TQS A;  4UB6 U;  1LV5 A;  2JH7 A;  1A0P A;  4G3I A;  3HPO A;  4O3O A;  4J03 A;  1WWV A;  5J2I A;  2D8C A;  1Q46 A;  1KSP A;  5CP2 A;  3RJJ A;  2FPM A;  2I5H A;  5KL1 B;  2OH2 A;  8ICB A;  3SAF A;  4JV2 A;  4DL3 A;  5KAI U;  3BZC A;  3PZP A;  2HHW A;  1L7N A;  2K4E A;  2I1Q A;  3AQF A;  3FM9 A;  3EYZ A;  2IBK A;  2KJ8 A;  4YFK A;  3RF9 A;  2QKQ A;  4DQQ A;  4NY8 A;  1KBU A;  3V72 A;  4J9R A;  5CRX A;  4IRK A;  5AIA A;  4GXI A;  2FLP A;  3E2E A;  8ICC A;  5ALJ A;  8ICK A;  1JMS A;  2XY6 A;  5AI8 A;  1NZP A;  5L1I A;  4LZG A;  4F4X A;  3QU4 A;  5D49 A;  2KNJ A;  7ICJ A;  1Z4N A;  4XRH A;  4AP9 A;  3PVX A;  1ZQN A;  5H2F U;  2JZB B;  2NRW A;  4MHV A;  2KFZ A;  7ICM A;  1S0V A;  4MFA A;  1WYG A;  4Z6F A;  2Y1I A;  3JPP A;  2LM4 A;  4QJF B;  5KFT A;  2W9C B;  5L9X A;  5J2D A;  1RM6 C;  2NV3 A;  1JAL A;  9ICM A;  2DPI A;  1RYR A;  1MQ3 A;  4MEY A;  4Z6C A;  4GLX A;  3AMZ A;  4JV1 A;  2KN7 A;  1JXE A;  2EAO A;  2KZ3 A;  3M6Z A;  3WK9 A;  5ALS A;  4I2C A;  1KRP A;  2FI1 A;  2AQ0 A;  3RH5 A;  4I2G A;  2WAQ C;  5ALZ A;  1XSN A;  4F5Q A;  1TV9 A;  1SGG A;  2PI4 A;  3M8R A;  3RRG A;  3LYS A;  4FZN A;  3OJU A;  4M6W A;  3D2Q A;  5FP0 A;  5ALO A;  5KFP A;  1D9F A;  4GC7 A;  3Q8Q B;  3AEV A;  3BQ2 A;  3GV7 B;  1NNL A;  3NRZ A;  2M9N A;  3QU7 A;  3PST A;  1WCN A;  3SV3 A;  1L5U A;  3PNC A;  4Q8F A;  2BPF A;  1TVA A;  3WU2 U;  4M9L A;  2HCF A;  1QH9 A;  4ED8 A;  1ZET A;  1SZP A;  4TQR A;  5ALG A;  2E8M A;  1XSL A;  1ECW A;  1ZQF A;  4C0Z A;  3Q8P B;  4F72 A;  4RU9 A;  2AGP A;  3KKA C;  4QZG A;  2WF8 A;  3MFH A;  1LB2 B;  2H5X A;  2KV2 A;  2JV3 A;  4C8L A;  4B9L A;  4J9N A;  4RNN A;  1MA7 A;  3EW9 A;  5IIO A;  3MR5 A;  1L7O A;  4RQ6 A;  4J9K A;  5III A;  2WB1 C;  1SXE A;  2QAR A;  1SV0 C;  2YX8 A;  4P0P A;  4B9V A;  4RQ7 A;  3ZDB A;  1BVS A;  2R18 A;  3HT3 A;  5D4B A;  3N7R C;  4NLG A;  1PK1 B;  2DL0 A;  9ICA A;  5K4L A;  5J2J A;  2G0A A;  1L8O A;  2ZIU B;  9ICK A;  5KG3 A;  1U47 A;  4KLL A;  4I2I A;  3T3F A;  4BWM A;  3AUO A;  3QU2 A;  4I2H A;  2PMZ C;  3IHQ B;  4O3N A;  5J2B A;  4DF8 A;  4UAR A;  4USA A;  1Z19 A;  3PX0 A;  4FFD A;  2C28 A;  4YR3 A;  1B4F A;  2I6X A;  3F53 A;  2Q4T A;  4O5E A;  2IOF K;  2CRX A;  3N28 A;  3AL0 B;  4Y2R A;  3ISB A;  2BKE A;  4UAZ A;  5AKK A;  3LK9 A;  2BGW A;  3FYH A;  8ICQ A;  1PVR A;  3V7L A;  3C2L A;  3OPX A;  4ECY A;  5JRT A;  4YMM A;  2YMP A;  2QB0 A;  3UQ2 A;  1XS9 D;  9ICP A;  2XVT A;  4QIW F;  2W8L A;  4Y2J A;  1IG6 A;  2FMP A;  4M9J A;  9ICO A;  3RJK A;  2BDU A;  4OO1 J;  5ALK A;  4WJ3 B;  3DDH A;  2ZIX B;  4EYI B;  4F4W A;  3MDC A;  4J9O A;  2NRV A;  5AKE A;  3A0H U;  1L6N A;  7ICK A;  3WK8 A;  4KLQ A;  3RR8 A;  2F2A B;  2KZZ A;  7ICR A;  2W43 A;  4O3S A;  4R65 A;  4MFC A;  4F5O A;  8ICI A;  2BCR A;  5J8Y A;  1HEK A;  1OUQ A;  4DLE A;  2V4Q A;  1NK6 A;  2LYH A;  1ZQP A;  5L1M A;  1PUZ A;  4F71 A;  3WK7 A;  1ZQA A;  3KTQ A;  2OYY A;  1UQV A;  4IR1 A;  4O0I A;  4PZN A;  4CDG A;  2F8K A;  1FFV A;  2F1I A;  3QUT A;  3RB3 A;  4MF8 A;  3BQT A;  4TUP A;  2YY6 A;  3UXP A;  1CRX A;  5AK4 A;  3A0B U;  4RQM A;  3RFA A;  4QZE A;  8ICN A;  3EUB 2;  4KMU A;  1FFU A;  3GIL A;  2VIX A;  5ALU A;  2G08 A;  2W11 A;  2JH1 A;  1X66 A;  5DBC A;  2Y0S C;  2W3S A;  2AXT U;  4ELU A;  9ICU A;  3PW5 A;  3K4G A;  1Z4O A;  3SAG A;  2FJ6 A;  4ELT A;  2NO4 A;  2Z7J A;  2ZIV A;  1S97 A;  1DGJ A;  5BOM A;  5AI9 A;  1NOM A;  3CRX A;  1KDH A;  9ICS A;  9ICB A;  4CRX A;  3ZD8 A;  4CF3 A;  3RJF A;  3TAP A;  2OWO A;  5ALI A;  3HKZ C;  1NK4 A;  4EBC A;  1KFD A;  5ALQ A;  1NK7 A;  4UB2 A;  2XGQ A;  4OD0 A;  3SAH A;  3TI0 A;  4ELV A;  4ZOH C;  4IRD A;  3H8M A;  2MUT A;  4IQU A;  2H3V A;  2EZX A;  3C1Y A;  4IL6 U;  2GLE A;  4EEL A;  2W7O A;  3PY8 A;  1JI7 A;  5CB1 A;  4C8K A;  4DCC A;  3JPS A;  4DFM A;  5GTH U;  7ICT A;  1QLN A;  1IM4 A;  1OXJ A;  2KIC A;  2W9M A;  2UVW A;  3GIK A;  1QSL A;  2F8L A;  3TAD A;  5EE9 A;  1VJ5 A;  4I28 A;  1KFS A;  1ZQ1 C;  1XNS A;  3O0F A;  4AYB F;  4NLN A;  1KN5 A;  2BHN A;  1MN8 A;  3QE9 Y;  3C21 A;  1SXD A;  4F50 A;  1ZD3 A;  3KZX A;  4YXJ A;  1MC8 A;  1X9M A;  4I2B A;  3WKA A;  1ZRN A;  4LVS A;  4YD2 A;  1QQ7 A;  5HNK A;  3OJS A;  2XO7 A;  4HYK A;  3WKD A;  1ZXI A;  2KHV A;  5DGA A;  4YG2 A;  1JN3 A;  4Q43 A;  2F44 A;  2C22 A;  2DPJ A;  4EX7 A;  3V7J A;  2NO5 A;  2ASJ A;  4EEN A;  3RJI A;  5C0Y A;  2PFP A;  5DG9 A;  2DKZ A;  8ICY A;  3K75 D;  3PV8 A;  4P2H A;  2XCP A;  1XSP A;  2K8C B;  3PO4 A;  4K4H A;  4M04 A;  7ICF A;  2JZB A;  4BXO A;  1SIJ A;  3TKA A;  1NJZ A;  3H8S A;  1SKS A;  5ALD A;  9ICW A;  1N5W A;  1NJY A;  5J0P A;  1S0O A;  4NM2 A;  4UB8 U;  8ICU A;  4I2J A;  5L1J A;  4F93 B;  4R66 A;  3D2S A;  3HJE A;  2R8I A;  2W9C A;  2HHS A;  1QSS A;  9ICE A;  1RDF A;  3ZDC A;  3QNM A;  3QUB A;  5J0X A;  4UB4 A;  3H4D A;  1LVH A;  1KQQ A;  4ECQ A;  4DQS A;  2ZUD A;  1KTQ A;  4PL1 A;  1KL9 A;  2QLT A;  2D3D A;  4J9Q A;  4FS2 A;  1ARO P;  4Q44 A;  2BQ3 A;  1BPZ A;  1SB3 C;  2VA2 A;  5KFW A;  7ICE A;  5F3X B;  4QZ9 A;  5KFO A;  5L1K A;  2BZF A;  3HIL A;  3QXG A;  4F3O A;  8ICE A;  3WKB A;  1TK0 A;  3JPN A;  3UXN A;  1WCL A;  4KX3 A;  1ZYQ A;  5KTQ A;  4EEY A;  3GV8 B;  2EZY A;  3G6V A;  3PSF A;  4JWM A;  5J0U A;  5J0Y A;  1ZQU A;  3HRD D;  2ZXH A;  2PI5 A;  5C5J A;  3PW7 A;  3B0Y A;  4PZO A;  1T8E A;  2J6U A;  4UQG A;  2IOH A;  4FBT A;  8ICL A;  3AM9 A;  3BJY A;  2P6R A;  2KIW A;  2OHF A;  1IXR A;  5BOL A;  1NJW A;  1NK9 A;  1QQ5 A;  4MFF A;  5AI4 A;  2W55 A;  1ZQW A;  3BS5 B;  1M6Y A;  3L5K A;  2E8O A;  4YQW A;  3TAQ A;  2ZG6 A;  2WF7 A;  2BCS A;  4LJX A;  2E1E A;  2IMW P;  4U7C A;  2R8G A;  3U26 A;  8ICP A;  2R8K A;  1DOQ A;  1MQ2 A;  4US9 A;  2PFQ A;  4KLD A;  1LKY B;  2R8J A;  1PK1 A;  2KVS A;  1S0N A;  4DSI A;  5DQI A;  3R9K A;  4F5R A;  4BGD A;  5KT2 A;  3M8S A;  4DSF A;  2FMS A;  4UB1 A;  3PSI A;  4JB3 A;  2DF4 B;  3LVW A;  4RPZ A;  3BZK A;  3OSN A;  4QW9 A;  1ZQX A;  4RQ4 A;  3TAD C;  5AM4 A;  3ZD9 A;  1ZQB A;  1UCV A;  1N5X A;  3UMC A;  1T3Q A;  3F5E A;  2LHT A;  4G9B A;  4IQT A;  3MBY A;  2A1A A;  2H3F A;  2W9A A;  2AGO A;  4GXJ A;  8ICV A;  5KFS A;  3RJH A;  1WWU A;  3I28 A;  5HHI A;  4DL7 A;  5KFZ A;  3C5F A;  2VJ5 A;  4ED2 A;  2KVC A;  5KL8 B;  3PO5 A;  5DKW A;  3H0L B;  1XWL A;  1BPY A;  4UB3 A;  3LWL A;  2I9G A;  2W3R A;  1COK A;  1EXN A;  4F4Y A;  4F92 B;  3IRU A;  4OJL A;  4Y2Q A;  1S76 D;  4BDP A;  4BUG A;  3WK5 A;  4NM1 A;  1UA1 A;  4F2S A;  1V97 A;  2XC9 A;  4YP3 A;  2UVU A;  3E0F A;  2KJ5 A;  3PML A;  1FIQ A;  1S0M A;  3K1R B;  1TK8 A;  5AM0 A;  1JX4 A;  5KG0 A;  2K4I A;  1YZ6 A;  3M7D A;  3BQ1 A;  1TAM A;  4J9L A;  9ICR A;  3IG8 A;  2H3Z A;  3RR7 A;  3TAR A;  2M0N A;  2JR5 A;  2A19 A;  4EX6 A;  4RZR A;  4M9N A;  3C28 A;  3KHG A;  1NZB A;  1T4G A;  3ZI4 A;  2YB4 A;  2R8H A;  2ZIX A;  1ZQC A;  3LDA A;  1X40 A;  1Y88 A;  4UAT A;  4Z6D A;  3THV A;  3F5A A;  3ORY A;  5KG1 A;  2L5Y A;  2DUY A;  3IDW A;  1S8O A;  4Y2X A;  4P4P A;  2PXI A;  1ZQJ A;  2W03 A;  2RLT A;  2H3Q A;  4DFP A;  2HBM A;  5DGB A;  4F8R A;  4KLT A;  2ZIW B;  2ZUC A;  3CW2 C;  4DQP A;  3VC8 A;  5B5E U;  5KT6 A;  1SWW A;  2MA1 A;  1YT3 A;  4B9U A;  2E8N A;  4Z6E A;  7ICL A;  3RRH A;  3SQI A;  2G07 A;  3GIM A;  4DQR A;  1NJX A;  2EAN A;  2BCQ A;  1K5O A;  2EZZ A;  2DFL A;  1HJP A;  2BQR A;  1Z1B A;  2VJ4 A;  1ZQY A;  3FC4 A;  2XGP A;  4ECU A;  4PH5 A;  5AK6 A;  3SI8 A;  5KG6 A;  5HR7 A;  2W7P A;  3QEB Z;  4K4I A;  1RXW A;  2A3V A;  4KLE A;  4JV0 A;  3TFS A;  4KLJ A;  1BGX T;  2C2D A;  4ZH4 A;  1S10 A;  2HSZ A;  5HP4 A;  2JXJ A;  2WFA A;  2IHM A;  3QX7 A;  4PGX A;  4EYH B;  3RAX A;  1ED1 A;  3PR4 A;  4ED7 A;  1Z00 B;  4KTQ A;  4KLS A;  4E0D A;  3M6K A;  4O3Q A;  1DK3 A;  2O6K A;  4DOB A;  3MR2 A;  2KEY A;  4ECX A;  1VDV A;  4QIW C;  4CNQ A;  5KFF A;  2E3T A;  4YN4 A;  1ZQM A;  1XO0 A;  2WTF A;  3N7P D;  2J6S A;  2FMQ A;  4YMN A;  4DS5 A;  4YD1 A;  2OM6 A;  1Z3E B;  2LBO A;  5KG5 A;  3Q8R B;  5DB8 A;  8ICJ A;  1PVP A;  2JEI A;  2Y9T A;  1U45 A;  2ES6 A;  7ICO A;  3Q8S B;  3GU3 A;  1KFT A;  4EBE A;  1T7P A;  2AQ4 A;  2HBK A;  4UAV A;  4BJQ A;  1L3U A;  2JEF A;  5ALE A;  4Y2V A;  4ECR A;  2VA8 A;  4DOA A;  3H0R B;  7ICN A;  7ICH A;  9ICV A;  3HWT A;  5KFN A;  4F5P A;  3MR6 A;  4JMU A;  1XC9 A;  2ESE A;  2F1H A;  5DQH A;  2F76 X;  4M9G A;  4PGY A;  5AHX A;  4B9S A;  7ICV A;  4DSL A;  3H4B A;  5ALY A;  3RH4 A;  4DWI A;  2KKP A;  1L3S A;  2KK0 A;  4JWN A;  4P0P B;  3V6H A;  1ZD4 A;  1N2X A;  2NYV A;  1BPD A;  9ICN A;  4NLC A;  1O08 A;  3SR6 A;  1SZH A;  1ZQZ A;  3ISD A;  1JXL A;  4DFJ A;  1XU4 A;  5EE0 A;  1BPE A;  5T14 A;  4CGZ A;  4I2E A;  5KFI A;  2A1J B;  1DXS A;  2W54 A;  2NRZ A;  1BNO A;  4NXZ A;  4DEZ A;  3PW0 A;  2EH9 A;  5TIS U;  3KZI U;  3GV5 B;  4QZC A;  3C2K A;  2EQY A;  1D9D A;  5G5G A;  3OGU A;  5EOZ A;  2HHQ A;  4DF4 A;  7ICQ A;  1Z1V A;  1L3T A;  4P4O A;  2ZTD A;  1Q8K A;  4ED1 A;  1P7D A;  3BQ7 A;  1N63 A;  4C8M A;  3E58 A;  5AKY A;  4ACO A;  3MGI A;  1TK5 A;  3LWM A;  5KG2 A;  5KFJ A;  3PW2 A;  1X9X A;  4I2A A;  2W9B B;  5KFA A;  3ETR A;  2G06 A;  3AQE A;  3F2B A;  1QQ6 A; 
#chains in the Genus database with same CATH homology
 1KN5 A;  1KQQ A;  2RQ5 A;  5K4L A;  2JRZ A;  2LI6 A;  1IG6 A;  1KKX A;  2CXY A;  4LJX A;  2LM1 A;  1RYU A;  1C20 A;  2JXJ A;  2YQE A;  2EH9 A;  2OEH A;  2EQY A;  5CEH A;  2KK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...