2OEHA

Determination of the three-dimensional structure of the mrf2-dna complex using paramagnetic spin labeling
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(P*TP*AP*CP*AP*AP*TP*AP*TP*AP*AP*CP*GP*TP*CP*G)-3'
publication title Determination of the three-dimensional structure of the Mrf2-DNA complex using paramagnetic spin labeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2oehA00
1RYUA 2CXYA 2LI6A 1KKXA 5K4LA 1KN5A 1KQQA 2KK0A 1C20A 5CEHA 2EH9A 2OEHA 2RQ5A 4LJXA 2YQEA 2EQYA 2JXJA 2LM1A 1IG6A 2JRZA
chains in the Genus database with same CATH superfamily
1T3QA 5J29A 2ZTEA 4NWIA 5KFLA 9ICFA 1ZETA 3UXPA 1KW4A 2EAPA 4UB5A 4UW9A 4ECSA 5GTIU 1TE2A 5J2EA 4GC6A 4C4SA 1ZD2P 5KFFA 3TAQA 3TQ1A 3C5GA 4YCXA 3ZDCA 3OHAA 3MFIA 2F2AB 3I1YA 4PL1A 4ECTA 5D46A 3K4GA 4JK1A 2UVWA 4QZIA 2K8CB 2OHFA 2NRVA 4I2DA 1IXRA 3AM9A 3GU3A 1SV4A 3HPOA 4DOBA 5ALSA 4DLEA 4J9RA 1T8EA 4RQ2A 3KKAC 7ICGA 4DFMA 1ZQOA 3QU5A 4PGXA 1Z19A 4AYBC 1NNLA 2ASLA 5KFEA 2BDPA 2YMPA 1ZQAA 3NUQA 1SZHA 3V72A 7ICNA 2ISOA 3OJSA 1BPXA 4EBDA 4ECUA 2G5IB 4DL2A 3PMLA 3RR7A 1UA0A 4QZFA 2VA2A 4R65A 1YT3A 4DL7A 1PK3A 2CPRA 1ZQUA 2HOIA 8ICQA 4RQNA 3KBBA 2ZUDA 8ICKA 2NYVA 2JEFA 2F8KA 5DBCA 1MSWD 1XSNA 5CHGA 1PZNA 3JPRA 3RB0A 7ICEA 8ICTA 3SV4A 1QCKA 1ZRMA 4EENA 1OW5A 5CA7A 4FBTA 2B6GA 3F2CA 1N56A 4J9SA 3H8WA 5DG9A 2W9CB 4RQ0A 2H3VA 4CDGA 2A1JA 4IQTA 1SXEA 4YQWA 8ICHA 1RDFA 4GLXA 5EWEA 4KLDA 1K1SA 1SXDA 1XO1A 5KFHA 4QZDA 5C0YA 2DL0A 3D2SA 4UBCA 4I2HA 1O03A 2EZYA 2KVCA 5AI9A 3QU4A 1UT8A 1NKCA 5EE0A 3AQEA 4YMNA 1ZQIA 5D4BA 5AIBA 4R8UA 1XNSA 3PNCA 3PY8A 4IRDA 1NK0A 9ICWA 5J0OA 4DL5A 1RXWA 1A77A 2HHQA 3LWLA 1T4GA 4NV0A 1B0XA 4EYIB 3EUB2 3EWAA 8ICUA 3Q8RB 4QWEA 4RQ8A 3IRUA 2Y9UA 3LDAA 9ICPA 5DQIA 5A0LA 5JTIA 7ICTA 3GIKA 2PMZF 3JPPA 4DQPA 2RDIA 1F44A 4UB6U 2LKYA 2KSOB 3PO5A 2VANA 3PSPA 1IG6A 2MRLA 2VA8A 4MFAA 3MDCA 1L5UA 2CXYA 3RB3A 3MABA 1ZQVA 3RH6A 4Y2SA 5J2IA 2L5YA 4UARA 4KLQA 5J0SA 4DQSA 1AQ6A 4F91B 3PVXA 5KFNA 2ES6A 4B9LA 8ICPA 2DWQA 2RRDA 3QUCA 2ZUCA 1MN8A 3ZDBA 2FI1A 1NI3A 5J0RA 7ICQA 2KFZA 4A8EA 2QLTA 3AU6A 4JUZA 5JRTA 5T14A 3UMGA 4DOAA 3QEBZ 1KL9A 3AN1A 4BGDA 3U26A 3H0MB 3NVYA 9ICTA 4GFJA 5J0WA 1NK4A 5DB9A 2NO5A 5ALPA 4I28A 4F4XA 2W11A 5G5GA 1ZD5A 5KFPA 2FJ6A 2YN4A 3VC8A 8ICFA 1QQ6A 3EYZA 3BZCA 2JV3A 3NVVA 4PHAA 1ZRNA 1KQQA 9ICMA 2BR0A 4PZOA 3WK6A 2W8LA 1TV9A 4RPZA 3E2EA 2WB1C 4Z6EA 3BS5B 1TK5A 3AEVA 1KDHA 1NOMA 4CCHA 5KT2A 1NJXA 4YD2A 8ICYA 1RM6C 1SZPA 4JB3A 1TK8A 4Y2QA 7ICPA 4FZLA 2W54A 1H38A 2R8HA 1KN5A 2AQ0A 4UAUA 2H3QA 2WF7A 4IRCA 5AI5A 4QWBA 2K60A 4EEKA 3LYSA 4KLSA 2FPLA 2G06A 1RQNA 3J81j 3PSTA 3RFAA 1S0VA 3RAQA 1DK2A 3ICXA 3S6JA 1Z00A 2BCSA 1ZQQA 1RYUA 3GV8B 4EELA 4I2EA 4UAYA 5KAFU 4FE3A 3QX7A 3LVVA 5AM4A 5ALNA 9ICRA 1Z4NA 4US8A 4PPXA 1UCVA 3BQ1A 2WFAA 5DQHA 1SKSA 5HMMA 3MR3A 3V6HA 3N7RC 2D8CA 5KT5A 4M9GA 1XSPA 1D8LA 4GC7A 1ZQMA 2W8KA 5KFQA 2GLEA 2M9NA 1QQ7A 3KKAA 2ATLA 4F5OA 5KFXA 5CRXA 4USAA 4ED2A 1SWWA 3H0RB 1LV5A 4C8NA 4QW8A 2LYAA 2E8PA 4DSIA 3QE9Y 3M8SA 3HP6A 2ZJAA 2IOHA 1TAUA 4OJOA 2ZIUB 3QUBA 3WK4A 2KKPA 4Y2XA 3GQCA 3UPQA 3ZDEA 2BCVA 2MA1A 2HI0A 3B0YA 4KLFA 1X40A 4YMMA 4BX9C 2JZBA 4UB3A 4E0DA 1X6IA 4RQMA 2HDOA 4J9NA 4IR9A 1B43A 1KLNA 5KFDA 4XUSA 4ED7A 3PV8A 2HSZA 5AKHA 4RT2A 3PW0A 1U49A 1KBUA 2FMPA 3A0HU 1C7YA 5L1KA 1ZD3A 4DSKA 3H8MA 5L1IA 2W9CA 2EZZA 2BPGA 2KZZA 5KFVA 1NKEA 2E1FA 4QZ8A 4BWJA 2P6RA 2VA3A 3AMZA 2W43A 3OPXA 2Y1IA 3RBDA 2RDJA 1ZQNA 4PL2A 3C2LA 5KFOA 3PW7A 4BXOB 2AQ4A 2ODGA 2JEGA 3UXOA 3LK9A 2HCFA 2K4EA 4DLGA 4DFJA 2C22A 3QXGA 4C8LA 1O08A 4EYHB 5IIOA 2YQEA 4F50A 2Y9TA 3GZFA 5J0TA 4K4HA 2M0NA 3F53A 3RJEA 2ZTDA 4F3OA 3R9KA 4KX3A 3C29A 2WTFA 3PX4A 4NY8A 4O5KA 4QZBA 1RPLA 4Y2JA 2CN1A 3E58A 5CJ7A 1UPHA 4RQ3A 1QTMA 4KLOA 7ICUA 4P0PB 5F9LA 2KSOA 4IS7A 5ALXA 1PVRA 2WB1F 3M9NB 3RR8A 4RZRA 3HJEA 2RP5A 2G08A 1L8OA 8ICMA 2F3NA 5KFKA 2HBKA 1MC8A 7ICVA 5HR7A 4B9SA 4XRHA 1SIJA 1Q3UA 5KFJA 5TISU 2KHQA 3SQIA 7ICFA 2ZUBA 4UQGA 1RYRA 3QZ7A 2BHNA 2PKEA 4R63A 9ICNA 5TZVA 3BDPA 5DKWA 2KZ3A 8ICIA 2N1RA 4RPYA 4PHEA 3PO4A 1BPZA 5AM5A 1COKA 5KG0A 2JR5A 1QSSA 1J2NA 2ALZA 4QWAA 1ZQZA 2HHUA 1NZPA 4KMUA 2I1QA 5KNIA 2XVTA 3ZDDA 5J2CA 3ZD8A 4DEZA 4KLLA 4YR0A 4F5PA 2ISPA 3M7DA 3SAHA 2XGPA 2E3TA 3PMNA 4B9UA 5F9NA 4EX6A 1BVSA 3QU7A 1L6NA 2C28A 3L3FX 2ZXIA 4PZNA 4CF4A 4F4ZA 2JXJA 3EPGA 1J2MA 2HMXA 4KX5A 1BNPA 4TUQA 2WF8A 3H8SA 2F76X 4YP3A 1X66A 2FMSA 2KEYA 2NO4A 2J6TA 4NJ8A 3DEEA 3WK7A 5J2DA 4IQVA 5J0QA 3HKZF 4NLCA 2K89A 3SV3A 4MF8A 4C7YA 3C2KA 2I9GA 9ICSA 1X42A 2BZFA 5CB1A 5IILA 8ICRA 2IOFK 1XO0A 4QIWF 1QH9A 4PHDA 4DSJA 1YZ7A 1COOA 2WF6A 3TADC 2HHWA 1XWLA 4C4TA 4B9NA 4DF4A 3KD3A 2ZJ5A 4EBEA 4UBBA 1SV0A 2ZIXB 4UASA 2RQ5A 4I29A 5KG4A 8ICSA 5KG3A 8ICJA 5IINA 1RYSA 8ICNA 4YR2A 1ZXIA 3NGDA 2W3RA 5AIAA 5ALOA 1CI4A 5DQGA 2O6KA 4RNNA 5KTQA 3CRXA 5IIMA 4KLIA 2UVVA 2KJ8A 3VCBA 4CRXA 3EW9A 5AICA 3MGHA 1K5OA 3KHGA 1TAQA 4NLZA 2F77X 2DQNB 1IV8A 1L7PA 1VDVA 3M1YA 4EZ9A 4F4KA 3NS1A 4F71A 4P0QB 4RNOA 3T5HA 5DDYA 2Q4TA 2W3SA 2B0CA 4TUSA 4DS4A 4M9HA 2IA6A 1S10A 3SI8A 3D2QA 2RHFA 4F4WA 3GILA 1XSLA 2KJ5A 4UAZA 4O9MA 1WWUA 4O3NA 3BZKA 3ETLA 3GDXA 3L4PA 5KFMA 3WKEA 4KLUA 4CNQA 3QYPA 2K8AA 9ICJA 2ZTCA 1Z1VA 1ZQXA 3M9MB 4P2HA 4DO9A 5KG2A 4KLTA 5IIIA 5AKIA 3IG5A 2YMLA 4RT3A 1BGXT 5HHHA 1VJ5A 3RH4A 8ICAA 3EPIA 8ICZA 4Z6DA 2A3VA 7ICOA 3T5KA 4M6WA 1JI7A 9ICOA 2LHTA 1X9WA 4BXOA 3LVWA 1MA7A 4YXMA 3FAHA 2OCEA 5KL1B 5D49A 4IQWA 3C23A 3V7JA 4Q8EA 4Z6FA 1D8BA 5EE1A 3ZD9A 1N60A 4KLHA 5AM1A 2VKQA 4AP9A 1VLBA 2H3IA 4FZMA 2ZIVB 3ORYA 5ALJA 3OSNA 2FMQA 5J2HA 2KIWA 4JV0A 2ZXHA 1DXSA 5L1JA 3PW2A 3C2MA 1U48A 4YMOA 1ZQWA 4FFDA 4NLBA 2K8BB 3G6YA 5E79U 3B9JA 4ECVA 4NLKA 1AROP 5B66U 4PJ0U 1SKRA 9ICBA 2W55A 5ALIA 5J2GA 2OM6A 2DFLA 4M9JA 8ICGA 4B6JA 2DGZA 2JH1A 1BNOA 3V6KA 4P0PA 5K4LA 5J2FA 1OXJA 1MQ2A 2R8JA 3MGVA 2FPMA 5CEHA 2KNJA 2XICA 4RPXA 5HR6A 2PI4A 2OEHA 1L7OA 1N2XA 5ALFA 5KT3A 1HUZA 3ISDA 5J0YA 8ICBA 4QZGA 5AI6A 2XCPA 5KFAA 4X5VA 2UVRA 3LWMA 2XC9A 3KHLA 3SAFA 5DBAA 4ICAA 4O3RA 1RZTA 2NRXA 3HILA 2BGWA 3IG8A 1N5WA 2WAQC 3Q8LA 1U4BA 3NRWA 1SB3C 4DQRA 3RJKA 4YR3A 4DQQA 1T7PA 3BQ2A 4AYBF 1ZQFA 9ICAA 9ICUA 4F5NA 4Z6CA 3TFSA 5DGAA 3AU2A 3WKBA 4UATA 4DL6A 3GV5B 3IDWA 5ALUA 2V4RA 9ICQA 4CGZA 2P35A 1DGJA 4Y2TA 4NLGA 2VIXA 3IN5A 7ICJA 2KMDA 1FFVA 4C80A 1LKYB 4CF5A 1QSYA 1Q8KA 4PH5A 3G6VA 5J0XA 5DLFA 3TARA 4RQ4A 1CUKA 1J97A 3H40A 1DOQA 3B0XA 1ZQGA 4NXZA 5ALQA 4PGQA 4M0AA 9ICXA 2LBOA 5ALEA 4R64A 4C4RA 2BQUA 2Y1JA 2E5SA 2KICA 5ALLA 4C8MA 4ELVA 4P4OA 4RQ6A 1WCNA 4RQ5A 4Y2UA 1BPBA 2YX8A 3TADA 1SL0A 2ZG6A 2FLNA 5EE9A 8ICEA 1N62A 3Q8MA 1Q3VA 2BPFA 2W9MA 2ZIWB 3ED5A 1MQ3A 2OYYA 5KT6A 1ZQYA 4DQIA 3RJIA 4YVZA 4F93B 4Q8FA 1ZOLA 3KOOA 2CRXA 3NTUA 1DGSA 4DFPA 3C21A 1ZQHA 2J6SA 1XU4A 2KOBA 2ZIXA 2QKQA 4O3PA 4ACOA 1U47A 1N5XA 3BQ7A 5DG8A 4ED8A 4TQSA 2BCUA 3IV6A 2W9BB 3H0LB 4FO6A 2HHTA 4UB8U 2KHVA 2H5XA 2HBJA 3N4MB 1A76A 3BJYA 1ED1A 2EH9A 4J03A 5DGBA 4DOCA 4K4IA 2EDUA 2IOFA 1DK3A 3CYMA 4P4PA 3RB4A 1WUDA 1WYGA 2GH1A 5ALVA 2KTQA 1N63A 2B21A 1V38A 1XC9A 3KHHA 1F0MA 1RQLA 4P0QA 4DFKA 4HAIA 4O3QA 1D9DA 3V6JA 5C5JA 3TACB 1LVHA 3NVZA 4OJLA 4IC9A 4YN4A 2F1JA 5J2AA 1JMSA 1JRPA 7ICKA 4ECYA 1UA1A 4R8UB 5DLGA 4BDPA 2VJ5A 4F4YA 1FIQA 1ZQDA 2AGPA 5DB7A 2KFNA 3UQ0A 5L9XA 2F8LA 2LM4A 5ALRA 1L3TA 3H7IA 5JU5A 5KT4A 1S0NA 2AHOB 2OH2A 5ALZA 2PFNA 4YXJA 2AGQA 9ICHA 2IBKA 3N7PD 4OJPA 2HHXA 5CP2A 2EZXA 3THVA 1YZ6A 1PVPA 3G6XA 5DDMA 3N28A 4UB4A 1NK8A 2C2RA 3KZIU 4ECXA 2FPKA 4QZCA 1NJZA 1S97A 5AK4A 5HP4A 3WK5A 4C8KA 2BCQA 1V9PA 3SEIA 1ZQJA 1ZQSA 3MR2A 3IP4B 3Q8PB 3TKAA 2ZIVA 5AK5A 3K75D 4FZNA 4WJ3B 3FDSA 2IHMA 9ICKA 5ALGA 4RNMA 4KLEA 5CWRA 1BPEA 3JPTA 5KG1A 4U7CA 1S76D 1X6JA 5AKZA 2FLLA 4LZGA 2XIDA 4NM2A 1IIPA 3ONNA 2BPCA 4R66A 1N61A 5KFCA 4NM1A 2LMRA 1KRPA 4DL3A 5BPCA 4NL9C 4EBCA 3JPQA 2YY6A 4DSEA 3M9OB 3V7KA 1NJYA 3WK9A 2G0AA 5AKLA 1ZJMA 1KFSA 1NZBA 4M2YA 1Z3EB 1T3NA 2ZJ8A 2C2DA 1X9MA 2JMGA 5KFRA 1TFRA 5FP0A 1WCLA 2VJ4A 1RG6A 1TK0A 5AM0A 5HMLA 3A0BU 1IM4A 3QNMA 2V4QA 4B9TA 1BPYA 2KG5A 3RBEA 3BS5A 2DPJA 2DKXA 2D6FC 2WHEA 3PW5A 1URJA 5ALKA 4Q44A 3F2DA 5G5HA 1L8LA 2XI9A 3AUOA 1BPDA 2QARB 4ELUA 4C0ZA 4RUCA 3RRHA 5BOMA 1K1QA 4RQ1A 4I2AA 4EX7A 1ZD4A 3C5FA 2GO7A 3HT3A 4C7ZA 1NJWA 1TAMA 1RXVA 4JWNA 5ALHA 5KG6A 5AKEA 4M9NA 2DBYA 5H2FU 2LI6A 8ICVA 4I27A 3M6ZA 2QB0B 5HHIA 2EAMA 9ICLA 3SAGA 5J8YC 5L1MA 5L1LA 3RJGA 4RUAA 1HEKA 3BQ0A 3QEAZ 4ELTA 4O3SA 1LKYA 4KN4A 4QWDA 4F92B 3AQFA 3T3FA 2KN7A 3E0FA 3ZI4A 2G5HB 1XS9D 5KFTA 4US9A 3RJFA 4B9MA 2GOLA 1DRGA 5KFGA 1FFUA 5J2KA 1T94A 4BUGA 5KFBA 2K4HA 1SL2A 3RH5A 4UAVA 1X9SA 1QQ5A 3PSFA 3UMBA 2BDUA 4QWCA 5ALDA 1L3SA 1SGGA 1JROA 3GIJA 2OXOA 2BQ3A 3OGUA 3SR6A 2D3DA 2ZIWA 2MUTB 5AHXA 4QZ9A 2RLTA 3QZ8A 5AK6A 5J2JA 4IRKA 4NLNA 2JH7A 3IHQB 2LYBA 5KFWA 5ALMA 2E8OA 4YD1A 1ZQRA 1FO4A 3KTQA 2W04A 4KTQA 2JZBB 4MHVA 2ZIUA 4O3MA 4J9QA 1CRXA 2KE7A 4G9BA 3KHRA 4BJQA 5EOZA 9ICGA 4ECZA 4J9PA 5HNKA 2KK0A 4DWIA 2C2EA 2ASDA 3D6JA 2W9BA 3GFKB 4OJ5A 1TVAA 5JUMA 2ASJA 5AKXA 4KLGA 5B5EU 2F1IA 4IQUA 3RTVA 2YB1A 4ECRA 4O5CA 2PI5A 1PK1B 4Q43A 1KKXA 2J6UA 4F2RA 5KAIU 2EANA 5ALWA 3RAXA 3MGIA 4J9LA 3SZ2A 3DDHA 4O3OA 4MF2A 2FLPA 5EWFA 1GO3F 3I76A 2LPEA 5AM2A 4MEYA 1ZQLA 3N97B 5AK3A 3NVWA 2R8GA 4F8RA 3PSIA 2HBMA 9ICEA 5KG5A 4DS5A 2HW3A 4F5QA 3GIIA 1JX4A 4M9LA 2FDRA 3JPOA 4ZH4A 5AI4A 4ED0A 1TKDA 3UXNA 4G3IA 1ZQCA 1ZQ1C 1SWVA 1SL1A 1CEZA 7ICLA 2XO7A 1UHUA 1V97A 1KFDA 4KLMA 9ICIA 2HVIA 3MFHA 5GTHU 4YG2A 3FC4A 1LB2B 2W03A 5KFYA 5J0UA 2PFOA 2NV3A 3Q8QB 2JRZA 3Q8SB 1X9XA 1Z1BA 2WF9A 5AKYA 3HX0A 2YMQA 4GIBA 1NKBA 2W7OA 3F5EA 4DF8A 3TANA 1L7NA 4FBUA 3UQ2A 3MBYA 5IIJA 4LJXA 5IIKA 2LYHA 2PXIA 4M47A 4PHPA 2EQYA 1D9FA 2R18A 3MDAA 4NL9A 4J9KA 5KFUA 2PFPA 1NK7A 3L5KA 4QJFB 4FS2A 1S0MA 3CP8A 5J0PA 1V85A 3AL0B 3WKDA 4DSFA 4Y2YA 1JXEA 2IMWP 1JN3A 4FS1A 4F72A 4TURA 5EE3A 2HOQA 7ICMA 1A0PA 3O0FA 3M8RA 4I2IA 2BQRA 7ICIA 1ZQEA 2KKVA 4UB1A 2R8IA 2XY5A 2MSNA 5DB8A 4LVSA 7ICRA 7ICSA 3WKAA 5CR0A 3C1YA 1Y88A 2DF4B 1UQVA 2HOFA 2YB4A 3RF9A 4JMUA 2E8MA 2Y0SC 2DPIA 4IR1A 9ICVA 1B22A 1S77D 3HRDD 2QARA 2AU0A 3PZPA 2F44A 2MU2A 2KV2A 3PR4A 2DUYA 3ETRA 4YFKA 2BCRA 1JALA 3MR6A 5J8YA 3OJUA 2KP7A 2MAXA 3V7LA 5KT7A 4GXJA 4QZAA 4KITB 4J9OA 1EXNA 1JIHA 3RJJA 2JHDA 2W7PA 3QU2A 4KMOB 4QNLA 3CNHA 3TAPA 2QB0A 4DCCA 2FE9A 4C8OA 2AJQA 5KFZA 3IM1A 5KG7A 3WKCA 3K1ZA 3NASA 2QB1A 1PVQA 1U9LA 5DB6A 8ICCA 3MR5A 3RB6A 4Q45A 1KSPA 2BKEA 2W9AA 2R8KA 3GIMA 2K4IA 3KFUF 2AGOA 1X2IA 1SV0C 3OSPA 3GV7B 1P7DA 2A19A 2YTUA 1WG8A 3C28A 1OUQA 1KFTA 4RQ7A 4O0IA 4JV2A 3H8JA 3PX6A 2MUTA 2XGQA 1ZYQA 4OO1J 3D2NA 1L3VA 1NK5A 2YMMA 2KIVA 1QLNA 2A1JB 8ICOA 4I2JA 1KTQA 1JUDA 4MEXA 4OJ6A 1JXLA 4JV1A 4I2CA 2WF5A 4BWMA 3HKZC 3TFRA 2F1HA 4DFDA 3SD7A 2K4PA 4UAWA 2GWSA 1ZJNA 1PUZA 4QIWC 5AM3A 2NRZA 5ALYA 8ICLA 2H3ZA 4OCZA 3QU9A 3SMVA 4KN7A 1HJPA 3WK8A 2XCAA 1UT5A 3JPNA 2AXTU 5AKJA 3OHBA 3ALRA 2P66A 2UVUA 1Z4OA 3Q8KA 2H3FA 4EEYA 8ICWA 1PK1A 3HWTA 7ICHA 3FM9A 5KFSA 3FYHA 2E1EA 1ZQKA 4TUPA 4J9MA 3HW8A 3H4BA 4GXIA 4I2GA 4M6WB 3T79A 8ICXA 2HHVA 3EZ5A 3QUQA 3F5AA 3KZXA 5KL8B 4Y2VA 4QZEA 3ZDAA 4ED3A 3RRGA 4CE6A 5DBBA 3C1ZA 2IHNA 3TI0A 1S8OA 2PFQA 3DV9A 1HIWA 4P4MA 3M6KA 4ZOHC 2HHSA 3T5LA 1NK9A 4F2SA 2JEIA 1M6YA 3PW4A 1U45A 2NRWA 1ZQPA 4XA5A 4ECWA 2AH5A 3I28A 3BQTA 4DSLA 2Q0ZX 2KVSA 1N48A 2G07A 4LZDA 4ECQA 4KLJA 2KZMA 2WAQF 4QZHA 4XQ8A 4GXKA 5AKGA 3WU2U 1L7MA 1ECWA 4QW9A 3F2BA 2ESEA 2JEJA 2G09A 4Y2RA 1KEJA 1QSLA 3UM9A 2EAOA 2I5HA 1S5LU 5EWGA 1C20A 4MFFA 1Q46A 1ZQBA 4TQRA 4M04A 4ED6A 1B4FA 9ICCA 5ALTA 1SKWA 2Y0SF 5F3XB 4K4GA 4HYKA 2PMZC 4PGYA 2LM1A 2V9WA 2HVHA 5AI8A 4O5EA 3N7SC 2XY7A 1ZQTA 5KFIA 2NRTA 4UB2A 3H4DA 1S0OA 4B9VA 4DL4A 2KJ9A 2XY6A 1WWVA 5DG7A 3MC1A 2HBLA 5BOLA 4F5RA 4MFCA 3QUTA 2DKZA 2A1AA 1A6SA 1L3UA 4JWMA 3K1RB 3OTQA 1FEZA 2KD1A 1NK6A 4Y2PA 2JGAA 2Z7JA 3PR5B 4CF3A 1D8YA 4IL6U 4ED1A 1S9FA 5J2BA 2E8NA 3SYZA 4I2BA 3ISCA 3JPSA 4I2FA 3ISBA 1F5SA 3T5JA 4U6PA 3RJHA 5AI0A 3PX0A 4EZ6A 2I6XA 3UMCA 3NRZA 3SENA 3BS7A 1Z00B 4RU9A 2OWOA 5AKKA 1HUOA 2P6UA 3CW2C 4OD0A
chains in the Genus database with same CATH topology
1RYUA 2CXYA 2LI6A 1KKXA 5K4LA 1KN5A 1KQQA 2KK0A 1C20A 5CEHA 2EH9A 2OEHA 2RQ5A 4LJXA 2YQEA 2EQYA 2JXJA 2LM1A 1IG6A 2JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYU A;  2CXY A;  2LI6 A;  1KKX A;  5K4L A;  1KN5 A;  1KQQ A;  2KK0 A;  1C20 A;  5CEH A;  2EH9 A;  2OEH A;  2RQ5 A;  4LJX A;  2YQE A;  2EQY A;  2JXJ A;  2LM1 A;  1IG6 A;  2JRZ A; 
#chains in the Genus database with same CATH topology
 1T3Q A;  5J29 A;  2ZTE A;  4NWI A;  5KFL A;  9ICF A;  1ZET A;  3UXP A;  1KW4 A;  2EAP A;  4UB5 A;  4UW9 A;  4ECS A;  5GTI U;  1TE2 A;  5J2E A;  4GC6 A;  4C4S A;  1ZD2 P;  5KFF A;  3TAQ A;  3TQ1 A;  3C5G A;  4YCX A;  3ZDC A;  3OHA A;  3MFI A;  2F2A B;  3I1Y A;  4PL1 A;  4ECT A;  5D46 A;  3K4G A;  4JK1 A;  2UVW A;  4QZI A;  2K8C B;  2OHF A;  2NRV A;  4I2D A;  1IXR A;  3AM9 A;  3GU3 A;  1SV4 A;  3HPO A;  4DOB A;  5ALS A;  4DLE A;  4J9R A;  1T8E A;  4RQ2 A;  3KKA C;  7ICG A;  4DFM A;  1ZQO A;  3QU5 A;  4PGX A;  1Z19 A;  4AYB C;  1NNL A;  2ASL A;  5KFE A;  2BDP A;  2YMP A;  1ZQA A;  3NUQ A;  1SZH A;  3V72 A;  7ICN A;  2ISO A;  3OJS A;  1BPX A;  4EBD A;  4ECU A;  2G5I B;  4DL2 A;  3PML A;  3RR7 A;  1UA0 A;  4QZF A;  2VA2 A;  4R65 A;  1YT3 A;  4DL7 A;  1PK3 A;  2CPR A;  1ZQU A;  2HOI A;  8ICQ A;  4RQN A;  3KBB A;  2ZUD A;  8ICK A;  2NYV A;  2JEF A;  2F8K A;  5DBC A;  1MSW D;  1XSN A;  5CHG A;  1PZN A;  3JPR A;  3RB0 A;  7ICE A;  8ICT A;  3SV4 A;  1QCK A;  1ZRM A;  4EEN A;  1OW5 A;  5CA7 A;  4FBT A;  2B6G A;  3F2C A;  1N56 A;  4J9S A;  3H8W A;  5DG9 A;  2W9C B;  4RQ0 A;  2H3V A;  4CDG A;  2A1J A;  4IQT A;  1SXE A;  4YQW A;  8ICH A;  1RDF A;  4GLX A;  5EWE A;  4KLD A;  1K1S A;  1SXD A;  1XO1 A;  5KFH A;  4QZD A;  5C0Y A;  2DL0 A;  3D2S A;  4UBC A;  4I2H A;  1O03 A;  2EZY A;  2KVC A;  5AI9 A;  3QU4 A;  1UT8 A;  1NKC A;  5EE0 A;  3AQE A;  4YMN A;  1ZQI A;  5D4B A;  5AIB A;  4R8U A;  1XNS A;  3PNC A;  3PY8 A;  4IRD A;  1NK0 A;  9ICW A;  5J0O A;  4DL5 A;  1RXW A;  1A77 A;  2HHQ A;  3LWL A;  1T4G A;  4NV0 A;  1B0X A;  4EYI B;  3EUB 2;  3EWA A;  8ICU A;  3Q8R B;  4QWE A;  4RQ8 A;  3IRU A;  2Y9U A;  3LDA A;  9ICP A;  5DQI A;  5A0L A;  5JTI A;  7ICT A;  3GIK A;  2PMZ F;  3JPP A;  4DQP A;  2RDI A;  1F44 A;  4UB6 U;  2LKY A;  2KSO B;  3PO5 A;  2VAN A;  3PSP A;  1IG6 A;  2MRL A;  2VA8 A;  4MFA A;  3MDC A;  1L5U A;  2CXY A;  3RB3 A;  3MAB A;  1ZQV A;  3RH6 A;  4Y2S A;  5J2I A;  2L5Y A;  4UAR A;  4KLQ A;  5J0S A;  4DQS A;  1AQ6 A;  4F91 B;  3PVX A;  5KFN A;  2ES6 A;  4B9L A;  8ICP A;  2DWQ A;  2RRD A;  3QUC A;  2ZUC A;  1MN8 A;  3ZDB A;  2FI1 A;  1NI3 A;  5J0R A;  7ICQ A;  2KFZ A;  4A8E A;  2QLT A;  3AU6 A;  4JUZ A;  5JRT A;  5T14 A;  3UMG A;  4DOA A;  3QEB Z;  1KL9 A;  3AN1 A;  4BGD A;  3U26 A;  3H0M B;  3NVY A;  9ICT A;  4GFJ A;  5J0W A;  1NK4 A;  5DB9 A;  2NO5 A;  5ALP A;  4I28 A;  4F4X A;  2W11 A;  5G5G A;  1ZD5 A;  5KFP A;  2FJ6 A;  2YN4 A;  3VC8 A;  8ICF A;  1QQ6 A;  3EYZ A;  3BZC A;  2JV3 A;  3NVV A;  4PHA A;  1ZRN A;  1KQQ A;  9ICM A;  2BR0 A;  4PZO A;  3WK6 A;  2W8L A;  1TV9 A;  4RPZ A;  3E2E A;  2WB1 C;  4Z6E A;  3BS5 B;  1TK5 A;  3AEV A;  1KDH A;  1NOM A;  4CCH A;  5KT2 A;  1NJX A;  4YD2 A;  8ICY A;  1RM6 C;  1SZP A;  4JB3 A;  1TK8 A;  4Y2Q A;  7ICP A;  4FZL A;  2W54 A;  1H38 A;  2R8H A;  1KN5 A;  2AQ0 A;  4UAU A;  2H3Q A;  2WF7 A;  4IRC A;  5AI5 A;  4QWB A;  2K60 A;  4EEK A;  3LYS A;  4KLS A;  2FPL A;  2G06 A;  1RQN A;  3J81 j;  3PST A;  3RFA A;  1S0V A;  3RAQ A;  1DK2 A;  3ICX A;  3S6J A;  1Z00 A;  2BCS A;  1ZQQ A;  1RYU A;  3GV8 B;  4EEL A;  4I2E A;  4UAY A;  5KAF U;  4FE3 A;  3QX7 A;  3LVV A;  5AM4 A;  5ALN A;  9ICR A;  1Z4N A;  4US8 A;  4PPX A;  1UCV A;  3BQ1 A;  2WFA A;  5DQH A;  1SKS A;  5HMM A;  3MR3 A;  3V6H A;  3N7R C;  2D8C A;  5KT5 A;  4M9G A;  1XSP A;  1D8L A;  4GC7 A;  1ZQM A;  2W8K A;  5KFQ A;  2GLE A;  2M9N A;  1QQ7 A;  3KKA A;  2ATL A;  4F5O A;  5KFX A;  5CRX A;  4USA A;  4ED2 A;  1SWW A;  3H0R B;  1LV5 A;  4C8N A;  4QW8 A;  2LYA A;  2E8P A;  4DSI A;  3QE9 Y;  3M8S A;  3HP6 A;  2ZJA A;  2IOH A;  1TAU A;  4OJO A;  2ZIU B;  3QUB A;  3WK4 A;  2KKP A;  4Y2X A;  3GQC A;  3UPQ A;  3ZDE A;  2BCV A;  2MA1 A;  2HI0 A;  3B0Y A;  4KLF A;  1X40 A;  4YMM A;  4BX9 C;  2JZB A;  4UB3 A;  4E0D A;  1X6I A;  4RQM A;  2HDO A;  4J9N A;  4IR9 A;  1B43 A;  1KLN A;  5KFD A;  4XUS A;  4ED7 A;  3PV8 A;  2HSZ A;  5AKH A;  4RT2 A;  3PW0 A;  1U49 A;  1KBU A;  2FMP A;  3A0H U;  1C7Y A;  5L1K A;  1ZD3 A;  4DSK A;  3H8M A;  5L1I A;  2W9C A;  2EZZ A;  2BPG A;  2KZZ A;  5KFV A;  1NKE A;  2E1F A;  4QZ8 A;  4BWJ A;  2P6R A;  2VA3 A;  3AMZ A;  2W43 A;  3OPX A;  2Y1I A;  3RBD A;  2RDJ A;  1ZQN A;  4PL2 A;  3C2L A;  5KFO A;  3PW7 A;  4BXO B;  2AQ4 A;  2ODG A;  2JEG A;  3UXO A;  3LK9 A;  2HCF A;  2K4E A;  4DLG A;  4DFJ A;  2C22 A;  3QXG A;  4C8L A;  1O08 A;  4EYH B;  5IIO A;  2YQE A;  4F50 A;  2Y9T A;  3GZF A;  5J0T A;  4K4H A;  2M0N A;  3F53 A;  3RJE A;  2ZTD A;  4F3O A;  3R9K A;  4KX3 A;  3C29 A;  2WTF A;  3PX4 A;  4NY8 A;  4O5K A;  4QZB A;  1RPL A;  4Y2J A;  2CN1 A;  3E58 A;  5CJ7 A;  1UPH A;  4RQ3 A;  1QTM A;  4KLO A;  7ICU A;  4P0P B;  5F9L A;  2KSO A;  4IS7 A;  5ALX A;  1PVR A;  2WB1 F;  3M9N B;  3RR8 A;  4RZR A;  3HJE A;  2RP5 A;  2G08 A;  1L8O A;  8ICM A;  2F3N A;  5KFK A;  2HBK A;  1MC8 A;  7ICV A;  5HR7 A;  4B9S A;  4XRH A;  1SIJ A;  1Q3U A;  5KFJ A;  5TIS U;  2KHQ A;  3SQI A;  7ICF A;  2ZUB A;  4UQG A;  1RYR A;  3QZ7 A;  2BHN A;  2PKE A;  4R63 A;  9ICN A;  5TZV A;  3BDP A;  5DKW A;  2KZ3 A;  8ICI A;  2N1R A;  4RPY A;  4PHE A;  3PO4 A;  1BPZ A;  5AM5 A;  1COK A;  5KG0 A;  2JR5 A;  1QSS A;  1J2N A;  2ALZ A;  4QWA A;  1ZQZ A;  2HHU A;  1NZP A;  4KMU A;  2I1Q A;  5KNI A;  2XVT A;  3ZDD A;  5J2C A;  3ZD8 A;  4DEZ A;  4KLL A;  4YR0 A;  4F5P A;  2ISP A;  3M7D A;  3SAH A;  2XGP A;  2E3T A;  3PMN A;  4B9U A;  5F9N A;  4EX6 A;  1BVS A;  3QU7 A;  1L6N A;  2C28 A;  3L3F X;  2ZXI A;  4PZN A;  4CF4 A;  4F4Z A;  2JXJ A;  3EPG A;  1J2M A;  2HMX A;  4KX5 A;  1BNP A;  4TUQ A;  2WF8 A;  3H8S A;  2F76 X;  4YP3 A;  1X66 A;  2FMS A;  2KEY A;  2NO4 A;  2J6T A;  4NJ8 A;  3DEE A;  3WK7 A;  5J2D A;  4IQV A;  5J0Q A;  3HKZ F;  4NLC A;  2K89 A;  3SV3 A;  4MF8 A;  4C7Y A;  3C2K A;  2I9G A;  9ICS A;  1X42 A;  2BZF A;  5CB1 A;  5IIL A;  8ICR A;  2IOF K;  1XO0 A;  4QIW F;  1QH9 A;  4PHD A;  4DSJ A;  1YZ7 A;  1COO A;  2WF6 A;  3TAD C;  2HHW A;  1XWL A;  4C4T A;  4B9N A;  4DF4 A;  3KD3 A;  2ZJ5 A;  4EBE A;  4UBB A;  1SV0 A;  2ZIX B;  4UAS A;  2RQ5 A;  4I29 A;  5KG4 A;  8ICS A;  5KG3 A;  8ICJ A;  5IIN A;  1RYS A;  8ICN A;  4YR2 A;  1ZXI A;  3NGD A;  2W3R A;  5AIA A;  5ALO A;  1CI4 A;  5DQG A;  2O6K A;  4RNN A;  5KTQ A;  3CRX A;  5IIM A;  4KLI A;  2UVV A;  2KJ8 A;  3VCB A;  4CRX A;  3EW9 A;  5AIC A;  3MGH A;  1K5O A;  3KHG A;  1TAQ A;  4NLZ A;  2F77 X;  2DQN B;  1IV8 A;  1L7P A;  1VDV A;  3M1Y A;  4EZ9 A;  4F4K A;  3NS1 A;  4F71 A;  4P0Q B;  4RNO A;  3T5H A;  5DDY A;  2Q4T A;  2W3S A;  2B0C A;  4TUS A;  4DS4 A;  4M9H A;  2IA6 A;  1S10 A;  3SI8 A;  3D2Q A;  2RHF A;  4F4W A;  3GIL A;  1XSL A;  2KJ5 A;  4UAZ A;  4O9M A;  1WWU A;  4O3N A;  3BZK A;  3ETL A;  3GDX A;  3L4P A;  5KFM A;  3WKE A;  4KLU A;  4CNQ A;  3QYP A;  2K8A A;  9ICJ A;  2ZTC A;  1Z1V A;  1ZQX A;  3M9M B;  4P2H A;  4DO9 A;  5KG2 A;  4KLT A;  5III A;  5AKI A;  3IG5 A;  2YML A;  4RT3 A;  1BGX T;  5HHH A;  1VJ5 A;  3RH4 A;  8ICA A;  3EPI A;  8ICZ A;  4Z6D A;  2A3V A;  7ICO A;  3T5K A;  4M6W A;  1JI7 A;  9ICO A;  2LHT A;  1X9W A;  4BXO A;  3LVW A;  1MA7 A;  4YXM A;  3FAH A;  2OCE A;  5KL1 B;  5D49 A;  4IQW A;  3C23 A;  3V7J A;  4Q8E A;  4Z6F A;  1D8B A;  5EE1 A;  3ZD9 A;  1N60 A;  4KLH A;  5AM1 A;  2VKQ A;  4AP9 A;  1VLB A;  2H3I A;  4FZM A;  2ZIV B;  3ORY A;  5ALJ A;  3OSN A;  2FMQ A;  5J2H A;  2KIW A;  4JV0 A;  2ZXH A;  1DXS A;  5L1J A;  3PW2 A;  3C2M A;  1U48 A;  4YMO A;  1ZQW A;  4FFD A;  4NLB A;  2K8B B;  3G6Y A;  5E79 U;  3B9J A;  4ECV A;  4NLK A;  1ARO P;  5B66 U;  4PJ0 U;  1SKR A;  9ICB A;  2W55 A;  5ALI A;  5J2G A;  2OM6 A;  2DFL A;  4M9J A;  8ICG A;  4B6J A;  2DGZ A;  2JH1 A;  1BNO A;  3V6K A;  4P0P A;  5K4L A;  5J2F A;  1OXJ A;  1MQ2 A;  2R8J A;  3MGV A;  2FPM A;  5CEH A;  2KNJ A;  2XIC A;  4RPX A;  5HR6 A;  2PI4 A;  2OEH A;  1L7O A;  1N2X A;  5ALF A;  5KT3 A;  1HUZ A;  3ISD A;  5J0Y A;  8ICB A;  4QZG A;  5AI6 A;  2XCP A;  5KFA A;  4X5V A;  2UVR A;  3LWM A;  2XC9 A;  3KHL A;  3SAF A;  5DBA A;  4ICA A;  4O3R A;  1RZT A;  2NRX A;  3HIL A;  2BGW A;  3IG8 A;  1N5W A;  2WAQ C;  3Q8L A;  1U4B A;  3NRW A;  1SB3 C;  4DQR A;  3RJK A;  4YR3 A;  4DQQ A;  1T7P A;  3BQ2 A;  4AYB F;  1ZQF A;  9ICA A;  9ICU A;  4F5N A;  4Z6C A;  3TFS A;  5DGA A;  3AU2 A;  3WKB A;  4UAT A;  4DL6 A;  3GV5 B;  3IDW A;  5ALU A;  2V4R A;  9ICQ A;  4CGZ A;  2P35 A;  1DGJ A;  4Y2T A;  4NLG A;  2VIX A;  3IN5 A;  7ICJ A;  2KMD A;  1FFV A;  4C80 A;  1LKY B;  4CF5 A;  1QSY A;  1Q8K A;  4PH5 A;  3G6V A;  5J0X A;  5DLF A;  3TAR A;  4RQ4 A;  1CUK A;  1J97 A;  3H40 A;  1DOQ A;  3B0X A;  1ZQG A;  4NXZ A;  5ALQ A;  4PGQ A;  4M0A A;  9ICX A;  2LBO A;  5ALE A;  4R64 A;  4C4R A;  2BQU A;  2Y1J A;  2E5S A;  2KIC A;  5ALL A;  4C8M A;  4ELV A;  4P4O A;  4RQ6 A;  1WCN A;  4RQ5 A;  4Y2U A;  1BPB A;  2YX8 A;  3TAD A;  1SL0 A;  2ZG6 A;  2FLN A;  5EE9 A;  8ICE A;  1N62 A;  3Q8M A;  1Q3V A;  2BPF A;  2W9M A;  2ZIW B;  3ED5 A;  1MQ3 A;  2OYY A;  5KT6 A;  1ZQY A;  4DQI A;  3RJI A;  4YVZ A;  4F93 B;  4Q8F A;  1ZOL A;  3KOO A;  2CRX A;  3NTU A;  1DGS A;  4DFP A;  3C21 A;  1ZQH A;  2J6S A;  1XU4 A;  2KOB A;  2ZIX A;  2QKQ A;  4O3P A;  4ACO A;  1U47 A;  1N5X A;  3BQ7 A;  5DG8 A;  4ED8 A;  4TQS A;  2BCU A;  3IV6 A;  2W9B B;  3H0L B;  4FO6 A;  2HHT A;  4UB8 U;  2KHV A;  2H5X A;  2HBJ A;  3N4M B;  1A76 A;  3BJY A;  1ED1 A;  2EH9 A;  4J03 A;  5DGB A;  4DOC A;  4K4I A;  2EDU A;  2IOF A;  1DK3 A;  3CYM A;  4P4P A;  3RB4 A;  1WUD A;  1WYG A;  2GH1 A;  5ALV A;  2KTQ A;  1N63 A;  2B21 A;  1V38 A;  1XC9 A;  3KHH A;  1F0M A;  1RQL A;  4P0Q A;  4DFK A;  4HAI A;  4O3Q A;  1D9D A;  3V6J A;  5C5J A;  3TAC B;  1LVH A;  3NVZ A;  4OJL A;  4IC9 A;  4YN4 A;  2F1J A;  5J2A A;  1JMS A;  1JRP A;  7ICK A;  4ECY A;  1UA1 A;  4R8U B;  5DLG A;  4BDP A;  2VJ5 A;  4F4Y A;  1FIQ A;  1ZQD A;  2AGP A;  5DB7 A;  2KFN A;  3UQ0 A;  5L9X A;  2F8L A;  2LM4 A;  5ALR A;  1L3T A;  3H7I A;  5JU5 A;  5KT4 A;  1S0N A;  2AHO B;  2OH2 A;  5ALZ A;  2PFN A;  4YXJ A;  2AGQ A;  9ICH A;  2IBK A;  3N7P D;  4OJP A;  2HHX A;  5CP2 A;  2EZX A;  3THV A;  1YZ6 A;  1PVP A;  3G6X A;  5DDM A;  3N28 A;  4UB4 A;  1NK8 A;  2C2R A;  3KZI U;  4ECX A;  2FPK A;  4QZC A;  1NJZ A;  1S97 A;  5AK4 A;  5HP4 A;  3WK5 A;  4C8K A;  2BCQ A;  1V9P A;  3SEI A;  1ZQJ A;  1ZQS A;  3MR2 A;  3IP4 B;  3Q8P B;  3TKA A;  2ZIV A;  5AK5 A;  3K75 D;  4FZN A;  4WJ3 B;  3FDS A;  2IHM A;  9ICK A;  5ALG A;  4RNM A;  4KLE A;  5CWR A;  1BPE A;  3JPT A;  5KG1 A;  4U7C A;  1S76 D;  1X6J A;  5AKZ A;  2FLL A;  4LZG A;  2XID A;  4NM2 A;  1IIP A;  3ONN A;  2BPC A;  4R66 A;  1N61 A;  5KFC A;  4NM1 A;  2LMR A;  1KRP A;  4DL3 A;  5BPC A;  4NL9 C;  4EBC A;  3JPQ A;  2YY6 A;  4DSE A;  3M9O B;  3V7K A;  1NJY A;  3WK9 A;  2G0A A;  5AKL A;  1ZJM A;  1KFS A;  1NZB A;  4M2Y A;  1Z3E B;  1T3N A;  2ZJ8 A;  2C2D A;  1X9M A;  2JMG A;  5KFR A;  1TFR A;  5FP0 A;  1WCL A;  2VJ4 A;  1RG6 A;  1TK0 A;  5AM0 A;  5HML A;  3A0B U;  1IM4 A;  3QNM A;  2V4Q A;  4B9T A;  1BPY A;  2KG5 A;  3RBE A;  3BS5 A;  2DPJ A;  2DKX A;  2D6F C;  2WHE A;  3PW5 A;  1URJ A;  5ALK A;  4Q44 A;  3F2D A;  5G5H A;  1L8L A;  2XI9 A;  3AUO A;  1BPD A;  2QAR B;  4ELU A;  4C0Z A;  4RUC A;  3RRH A;  5BOM A;  1K1Q A;  4RQ1 A;  4I2A A;  4EX7 A;  1ZD4 A;  3C5F A;  2GO7 A;  3HT3 A;  4C7Z A;  1NJW A;  1TAM A;  1RXV A;  4JWN A;  5ALH A;  5KG6 A;  5AKE A;  4M9N A;  2DBY A;  5H2F U;  2LI6 A;  8ICV A;  4I27 A;  3M6Z A;  2QB0 B;  5HHI A;  2EAM A;  9ICL A;  3SAG A;  5J8Y C;  5L1M A;  5L1L A;  3RJG A;  4RUA A;  1HEK A;  3BQ0 A;  3QEA Z;  4ELT A;  4O3S A;  1LKY A;  4KN4 A;  4QWD A;  4F92 B;  3AQF A;  3T3F A;  2KN7 A;  3E0F A;  3ZI4 A;  2G5H B;  1XS9 D;  5KFT A;  4US9 A;  3RJF A;  4B9M A;  2GOL A;  1DRG A;  5KFG A;  1FFU A;  5J2K A;  1T94 A;  4BUG A;  5KFB A;  2K4H A;  1SL2 A;  3RH5 A;  4UAV A;  1X9S A;  1QQ5 A;  3PSF A;  3UMB A;  2BDU A;  4QWC A;  5ALD A;  1L3S A;  1SGG A;  1JRO A;  3GIJ A;  2OXO A;  2BQ3 A;  3OGU A;  3SR6 A;  2D3D A;  2ZIW A;  2MUT B;  5AHX A;  4QZ9 A;  2RLT A;  3QZ8 A;  5AK6 A;  5J2J A;  4IRK A;  4NLN A;  2JH7 A;  3IHQ B;  2LYB A;  5KFW A;  5ALM A;  2E8O A;  4YD1 A;  1ZQR A;  1FO4 A;  3KTQ A;  2W04 A;  4KTQ A;  2JZB B;  4MHV A;  2ZIU A;  4O3M A;  4J9Q A;  1CRX A;  2KE7 A;  4G9B A;  3KHR A;  4BJQ A;  5EOZ A;  9ICG A;  4ECZ A;  4J9P A;  5HNK A;  2KK0 A;  4DWI A;  2C2E A;  2ASD A;  3D6J A;  2W9B A;  3GFK B;  4OJ5 A;  1TVA A;  5JUM A;  2ASJ A;  5AKX A;  4KLG A;  5B5E U;  2F1I A;  4IQU A;  3RTV A;  2YB1 A;  4ECR A;  4O5C A;  2PI5 A;  1PK1 B;  4Q43 A;  1KKX A;  2J6U A;  4F2R A;  5KAI U;  2EAN A;  5ALW A;  3RAX A;  3MGI A;  4J9L A;  3SZ2 A;  3DDH A;  4O3O A;  4MF2 A;  2FLP A;  5EWF A;  1GO3 F;  3I76 A;  2LPE A;  5AM2 A;  4MEY A;  1ZQL A;  3N97 B;  5AK3 A;  3NVW A;  2R8G A;  4F8R A;  3PSI A;  2HBM A;  9ICE A;  5KG5 A;  4DS5 A;  2HW3 A;  4F5Q A;  3GII A;  1JX4 A;  4M9L A;  2FDR A;  3JPO A;  4ZH4 A;  5AI4 A;  4ED0 A;  1TKD A;  3UXN A;  4G3I A;  1ZQC A;  1ZQ1 C;  1SWV A;  1SL1 A;  1CEZ A;  7ICL A;  2XO7 A;  1UHU A;  1V97 A;  1KFD A;  4KLM A;  9ICI A;  2HVI A;  3MFH A;  5GTH U;  4YG2 A;  3FC4 A;  1LB2 B;  2W03 A;  5KFY A;  5J0U A;  2PFO A;  2NV3 A;  3Q8Q B;  2JRZ A;  3Q8S B;  1X9X A;  1Z1B A;  2WF9 A;  5AKY A;  3HX0 A;  2YMQ A;  4GIB A;  1NKB A;  2W7O A;  3F5E A;  4DF8 A;  3TAN A;  1L7N A;  4FBU A;  3UQ2 A;  3MBY A;  5IIJ A;  4LJX A;  5IIK A;  2LYH A;  2PXI A;  4M47 A;  4PHP A;  2EQY A;  1D9F A;  2R18 A;  3MDA A;  4NL9 A;  4J9K A;  5KFU A;  2PFP A;  1NK7 A;  3L5K A;  4QJF B;  4FS2 A;  1S0M A;  3CP8 A;  5J0P A;  1V85 A;  3AL0 B;  3WKD A;  4DSF A;  4Y2Y A;  1JXE A;  2IMW P;  1JN3 A;  4FS1 A;  4F72 A;  4TUR A;  5EE3 A;  2HOQ A;  7ICM A;  1A0P A;  3O0F A;  3M8R A;  4I2I A;  2BQR A;  7ICI A;  1ZQE A;  2KKV A;  4UB1 A;  2R8I A;  2XY5 A;  2MSN A;  5DB8 A;  4LVS A;  7ICR A;  7ICS A;  3WKA A;  5CR0 A;  3C1Y A;  1Y88 A;  2DF4 B;  1UQV A;  2HOF A;  2YB4 A;  3RF9 A;  4JMU A;  2E8M A;  2Y0S C;  2DPI A;  4IR1 A;  9ICV A;  1B22 A;  1S77 D;  3HRD D;  2QAR A;  2AU0 A;  3PZP A;  2F44 A;  2MU2 A;  2KV2 A;  3PR4 A;  2DUY A;  3ETR A;  4YFK A;  2BCR A;  1JAL A;  3MR6 A;  5J8Y A;  3OJU A;  2KP7 A;  2MAX A;  3V7L A;  5KT7 A;  4GXJ A;  4QZA A;  4KIT B;  4J9O A;  1EXN A;  1JIH A;  3RJJ A;  2JHD A;  2W7P A;  3QU2 A;  4KMO B;  4QNL A;  3CNH A;  3TAP A;  2QB0 A;  4DCC A;  2FE9 A;  4C8O A;  2AJQ A;  5KFZ A;  3IM1 A;  5KG7 A;  3WKC A;  3K1Z A;  3NAS A;  2QB1 A;  1PVQ A;  1U9L A;  5DB6 A;  8ICC A;  3MR5 A;  3RB6 A;  4Q45 A;  1KSP A;  2BKE A;  2W9A A;  2R8K A;  3GIM A;  2K4I A;  3KFU F;  2AGO A;  1X2I A;  1SV0 C;  3OSP A;  3GV7 B;  1P7D A;  2A19 A;  2YTU A;  1WG8 A;  3C28 A;  1OUQ A;  1KFT A;  4RQ7 A;  4O0I A;  4JV2 A;  3H8J A;  3PX6 A;  2MUT A;  2XGQ A;  1ZYQ A;  4OO1 J;  3D2N A;  1L3V A;  1NK5 A;  2YMM A;  2KIV A;  1QLN A;  2A1J B;  8ICO A;  4I2J A;  1KTQ A;  1JUD A;  4MEX A;  4OJ6 A;  1JXL A;  4JV1 A;  4I2C A;  2WF5 A;  4BWM A;  3HKZ C;  3TFR A;  2F1H A;  4DFD A;  3SD7 A;  2K4P A;  4UAW A;  2GWS A;  1ZJN A;  1PUZ A;  4QIW C;  5AM3 A;  2NRZ A;  5ALY A;  8ICL A;  2H3Z A;  4OCZ A;  3QU9 A;  3SMV A;  4KN7 A;  1HJP A;  3WK8 A;  2XCA A;  1UT5 A;  3JPN A;  2AXT U;  5AKJ A;  3OHB A;  3ALR A;  2P66 A;  2UVU A;  1Z4O A;  3Q8K A;  2H3F A;  4EEY A;  8ICW A;  1PK1 A;  3HWT A;  7ICH A;  3FM9 A;  5KFS A;  3FYH A;  2E1E A;  1ZQK A;  4TUP A;  4J9M A;  3HW8 A;  3H4B A;  4GXI A;  4I2G A;  4M6W B;  3T79 A;  8ICX A;  2HHV A;  3EZ5 A;  3QUQ A;  3F5A A;  3KZX A;  5KL8 B;  4Y2V A;  4QZE A;  3ZDA A;  4ED3 A;  3RRG A;  4CE6 A;  5DBB A;  3C1Z A;  2IHN A;  3TI0 A;  1S8O A;  2PFQ A;  3DV9 A;  1HIW A;  4P4M A;  3M6K A;  4ZOH C;  2HHS A;  3T5L A;  1NK9 A;  4F2S A;  2JEI A;  1M6Y A;  3PW4 A;  1U45 A;  2NRW A;  1ZQP A;  4XA5 A;  4ECW A;  2AH5 A;  3I28 A;  3BQT A;  4DSL A;  2Q0Z X;  2KVS A;  1N48 A;  2G07 A;  4LZD A;  4ECQ A;  4KLJ A;  2KZM A;  2WAQ F;  4QZH A;  4XQ8 A;  4GXK A;  5AKG A;  3WU2 U;  1L7M A;  1ECW A;  4QW9 A;  3F2B A;  2ESE A;  2JEJ A;  2G09 A;  4Y2R A;  1KEJ A;  1QSL A;  3UM9 A;  2EAO A;  2I5H A;  1S5L U;  5EWG A;  1C20 A;  4MFF A;  1Q46 A;  1ZQB A;  4TQR A;  4M04 A;  4ED6 A;  1B4F A;  9ICC A;  5ALT A;  1SKW A;  2Y0S F;  5F3X B;  4K4G A;  4HYK A;  2PMZ C;  4PGY A;  2LM1 A;  2V9W A;  2HVH A;  5AI8 A;  4O5E A;  3N7S C;  2XY7 A;  1ZQT A;  5KFI A;  2NRT A;  4UB2 A;  3H4D A;  1S0O A;  4B9V A;  4DL4 A;  2KJ9 A;  2XY6 A;  1WWV A;  5DG7 A;  3MC1 A;  2HBL A;  5BOL A;  4F5R A;  4MFC A;  3QUT A;  2DKZ A;  2A1A A;  1A6S A;  1L3U A;  4JWM A;  3K1R B;  3OTQ A;  1FEZ A;  2KD1 A;  1NK6 A;  4Y2P A;  2JGA A;  2Z7J A;  3PR5 B;  4CF3 A;  1D8Y A;  4IL6 U;  4ED1 A;  1S9F A;  5J2B A;  2E8N A;  3SYZ A;  4I2B A;  3ISC A;  3JPS A;  4I2F A;  3ISB A;  1F5S A;  3T5J A;  4U6P A;  3RJH A;  5AI0 A;  3PX0 A;  4EZ6 A;  2I6X A;  3UMC A;  3NRZ A;  3SEN A;  3BS7 A;  1Z00 B;  4RU9 A;  2OWO A;  5AKK A;  1HUO A;  2P6U A;  3CW2 C;  4OD0 A; 
#chains in the Genus database with same CATH homology
 1RYU A;  2CXY A;  2LI6 A;  1KKX A;  5K4L A;  1KN5 A;  1KQQ A;  2KK0 A;  1C20 A;  5CEH A;  2EH9 A;  2OEH A;  2RQ5 A;  4LJX A;  2YQE A;  2EQY A;  2JXJ A;  2LM1 A;  1IG6 A;  2JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...