2H3IA

Solution structure of the hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 34
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3iA00
1ECWA 1HIWA 2H3QA 2K4EA 1ED1A 2H3VA 2N1RA 2LYAA 2JMGA 1L6NA 2K4HA 4ICAA 2NV3A 4JMUA 1UPHA 2HMXA 2H3FA 2LYBA 1TAMA 1A6SA 2H3IA 2H3ZA 2GOLA 1HEKA 2K4IA 4IC9A
chains in the Genus database with same CATH superfamily
5DGAA 4ACOA 1MQ2A 2NRXA 2PFNA 4U6PA 1TAQA 5DLFA 4B9VA 9ICNA 4K4GA 1Q8KA 1S0VA 4C8OA 1KDHA 3OJUA 5ALYA 2KZ3A 1Z00B 2E1EA 4IRDA 1KL9A 5AM5A 1A6SA 1XO1A 1SWVA 2ZG6A 2LHTA 1ZQZA 2V4RA 3RJHA 5DG8A 2OYYA 1RPLA 2BQRA 3GQCA 1TE2A 5BOMA 1K1SA 2HHVA 2W9AA 2LM4A 5HNKA 3I1YA 2OCEA 5CWRA 4GXIA 1UCVA 5KFBA 3SR6A 1SV0C 3ALRA 2LMRA 4DQQA 3H8JA 1JXEA 2FE9A 3JPRA 4FZNA 5L9XA 2C2DA 2PFQA 2PXIA 4J9MA 4NL9C 1N56A 4BGDA 3NRZA 5AKJA 2R8KA 2Y9UA 5CP2A 3F2CA 1IXRA 3H0RB 4O0IA 1NKEA 4R8UB 2ZIUA 2HI0A 3T3FA 2HOQA 2IMWP 5JTIA 3PMNA 1U9LA 4NLBA 3Q8KA 5AKGA 4R65A 2KHQA 2R8GA 5IIIA 4BUGA 1KW4A 3PX0A 1JX4A 5AK6A 4F2RA 4PH5A 1FIQA 5AICA 3B0XA 8ICOA 1LVHA 2I5HA 3S6JA 4XA5A 3EZ5A 4ECRA 5AI5A 3FC4A 3CYMA 4I29A 1TKDA 4DQIA 2A19A 2BPFA 1V97A 4DFPA 3N7PD 5J2FA 5ALLA 3G6VA 5J0RA 2JH1A 4RU9A 1A77A 2E8PA 5HHHA 3RAXA 9ICGA 2VA8A 2MSNA 3Q8QB 2FPKA 2R8IA 2ZIUB 3O0FA 4B9NA 2KFNA 2ASLA 1J97A 5G5GA 3KHRA 2G09A 4IC9A 4DQRA 7ICIA 3CP8A 2YMQA 7ICTA 1DRGA 2YB1A 4LJXA 2JMGA 2KJ5A 4UB8U 7ICMA 4KLGA 5CHGA 3THVA 2D3DA 4YVZA 3MR6A 4DOAA 2W11A 5KG0A 2KIVA 1RZTA 7ICRA 1KFDA 4YCXA 3UPQA 1KN5A 3PW0A 3GV7B 4DSKA 4DFMA 2G5IB 3LWLA 2KD1A 5DBAA 4ECYA 4M9NA 1XO0A 2PKEA 3AM9A 2XY5A 3ZDCA 1O03A 4USAA 1UT5A 1RXVA 1BPYA 5EWEA 4YN4A 4QZDA 1ZQPA 1S0NA 1U4BA 3ED5A 4OJOA 2F1JA 5A0LA 4J9PA 2JH7A 2F1HA 7ICOA 4Y2QA 4RQ8A 4DOCA 3FYHA 2I1QA 4BWMA 4RQ2A 1ZJMA 4QZAA 5J2IA 2H3IA 4EEKA 4KLFA 2K8BB 3IP4B 1ZD5A 2BCRA 4QW9A 3GFKB 3UMGA 1QQ5A 2H5XA 3G6XA 2HVHA 8ICNA 4I2IA 4M47A 4F93B 3CW2C 1J2MA 5DGBA 3JPOA 2WAQF 1JN3A 4NXZA 1WCLA 2K8AA 2ZJ8A 3V6HA 4MFCA 1SGGA 4CF4A 4X5VA 5KTQA 3MC1A 4JWNA 5KFFA 4Q43A 5DQGA 3JPNA 1B43A 1U47A 2DWQA 4KN4A 1L7MA 1VJ5A 4DL5A 1LKYA 2KFZA 1ZXIA 3BQTA 3QUTA 5KAIU 1KEJA 1Q3VA 1QSLA 4RQ5A 1CI4A 2KICA 4TUQA 1UHUA 4YR3A 2M9NA 1JXLA 1TAUA 1J2NA 4GFJA 2P6UA 3RBEA 3ICXA 1ZQRA 3RBDA 3NVZA 3C2KA 1XSLA 4ECSA 2JEIA 5J0UA 2BZFA 4TUSA 5KFAA 3R9KA 4KLDA 8ICXA 3NGDA 3RF9A 3OGUA 3ISBA 2AJQA 1KRPA 3KKAC 1NJWA 4BXOA 1BNOA 2YN4A 5AM0A 4C0ZA 3GILA 4OJLA 4F4XA 4ED1A 4O3SA 4QZ8A 3L4PA 3WKCA 3EPIA 3EUB2 4OO1J 3PSPA 4MF8A 4RQMA 2XGPA 4HAIA 5AKHA 2LYAA 4B9SA 4KLOA 2DPIA 3QUBA 1BPZA 5AI8A 2PI4A 2W54A 3RJKA 4I2AA 2YQEA 2F76X 8ICMA 2ISPA 3AU6A 4O5EA 1SKRA 3SAHA 1BPXA 4Q8EA 3M8SA 2GH1A 2K4EA 9ICEA 2KV2A 1JIHA 2ISOA 2JZBB 4QZIA 3HJEA 4CCHA 2FLNA 4DO9A 4NY8A 1ZQGA 8ICQA 3KHGA 4ZOHC 2BCSA 3V6JA 3BQ1A 2DF4B 2RP5A 3IV6A 3NTUA 1ZRMA 2RLTA 5DG9A 4PGXA 4Y2JA 3A0HU 3PSTA 2ESEA 5DB7A 5DDYA 2M0NA 2EH9A 3NVVA 2EAMA 4DLEA 4DL6A 5HR6A 2HCFA 3FDSA 3NVWA 2DKXA 8ICWA 2FI1A 1PK1A 4DCCA 5ALVA 4LZGA 2HHXA 2ASJA 3C23A 4ECTA 2G0AA 3OPXA 3UXOA 4UB5A 3M1YA 4RQ1A 2EZYA 1ZQAA 3M9OB 4CF5A 1OW5A 2PMZF 3SAGA 4OJ6A 3A0BU 4EX6A 2WF7A 2WB1F 2UVUA 3B9JA 4JV2A 5KT5A 4QNLA 3RRHA 4O3MA 1ZQNA 1PVQA 1MC8A 1SWWA 5AM4A 4J9OA 2NV3A 8ICIA 2D8CA 5J0WA 4YXJA 1N5XA 3RJGA 4JV1A 2MA1A 4CNQA 7ICUA 1ZQFA 3NUQA 4AP9A 3KD3A 3C21A 1N60A 3QZ7A 1S0MA 3CRXA 2KVSA 5AI9A 2EQYA 4FE3A 1Z4OA 2WF5A 3QU2A 2OEHA 3QNMA 1C20A 2WF9A 1U48A 1ZQJA 5KFJA 2P6RA 1ZQIA 4I2BA 5KG4A 3TI0A 1ZQYA 1DK2A 2R8HA 5DQHA 2RDJA 3MFHA 4F3OA 2ZIXA 3FM9A 4UARA 4EYHB 4YQWA 3RB3A 5T14A 2F8LA 4FBUA 8ICTA 4C4SA 2L5YA 2KN7A 3PW5A 2A1JA 4NJ8A 3SZ2A 8ICUA 2QARB 4JV0A 3FAHA 3PR5B 4PHDA 1LV5A 5J2GA 3Q8SB 2AXTU 1S76D 1ZQOA 4RNMA 2O6KA 2BR0A 2K4HA 3BQ0A 3WK4A 4G9BA 1NKCA 2DL0A 2HHQA 3D2QA 2JR5A 1KKXA 5JRTA 3PNCA 2AHOB 5BPCA 4GC6A 4O3PA 4ELVA 3UXNA 4DF8A 1HEKA 2QLTA 2KHVA 3L3FX 3C2MA 2UVRA 1KSPA 3ZDAA 4PZNA 1ZD2P 2A1JB 4RQ0A 3RJJA 1FO4A 2BDPA 1X42A 1NK6A 4I2EA 3PR4A 4U7CA 1Z00A 2W7PA 3ZDEA 1S10A 1NOMA 9ICXA 5DKWA 3H8WA 4Y2PA 2HHUA 1ZQDA 2H3QA 3WKEA 3QZ8A 1SZHA 5DBCA 1NJZA 1NK4A 8ICHA 1UPHA 5J8YA 1D8BA 4RT3A 1BNPA 4KX3A 3ZD8A 2KTQA 9ICPA 2OWOA 4PL2A 5D49A 1KFTA 5E79U 5J2CA 4KLIA 4YD2A 1JUDA 1SZPA 4UBCA 4KITB 4MEYA 3TANA 2FPMA 4PPXA 2YX8A 4RUCA 2OH2A 1L6NA 2HW3A 2XIDA 3WK6A 3RAQA 1X9WA 2UVWA 8ICYA 2FLPA 7ICQA 1PVRA 4RQ6A 2ZIVA 4O3RA 3SEIA 5ALTA 5J2KA 4RNNA 1DK3A 3QEAZ 3UMBA 4R8UA 5ALQA 4TURA 4NV0A 3QX7A 5J29A 3LK9A 4ED0A 4DL3A 5ALWA 2DBYA 4BDPA 2GLEA 1ZD3A 5EE9A 1MN8A 5ALZA 4OJ5A 4IQUA 4O3QA 3K75D 2QB0B 4JWMA 4KLSA 5TZVA 5DG7A 2F3NA 4F4ZA 3TQ1A 2OHFA 1L7OA 5KT7A 2EDUA 2F2AB 2AH5A 3Q8MA 1BPEA 3M9MB 1N48A 5F9NA 9ICTA 5J0QA 5CJ7A 2ZIVB 3TADC 2ZJ5A 4F2SA 4EELA 2HHWA 2JGAA 4IRKA 3LYSA 2ALZA 5KFGA 2N1RA 5AM1A 1YZ7A 3N7RC 3U26A 2RHFA 4YR2A 4Q44A 5AIBA 4YMMA 3RFAA 4J9RA 3MFIA 2ZXIA 3TFRA 5KFPA 2VJ4A 4BX9C 1MA7A 2AQ0A 1P7DA 1ZQUA 2BDUA 2IOFK 2IOHA 1NJYA 2B21A 2J6SA 3VCBA 3QU5A 4YFKA 4FBTA 3HRDD 3ETRA 2A1AA 2BKEA 9ICOA 3ISDA 4KLUA 3T5HA 4EZ6A 3WK7A 3PW7A 4K4IA 5L1JA 2F44A 4OJPA 4RPZA 5DB6A 2NYVA 1TVAA 9ICHA 2XICA 3NVYA 4K4HA 3JPQA 5IIJA 1ED1A 5ALNA 2LBOA 2HBKA 4EBDA 3Q8LA 5ALRA 4M9HA 4DL4A 4ICAA 1Y88A 8ICZA 3OHAA 5KL8B 4DFKA 5J0TA 1OUQA 4B9LA 3WKBA 4I2HA 4ECXA 1L3UA 2ZJAA 5KNIA 1XS9D 3ONNA 4M6WB 2VJ5A 1QCKA 3K1RB 4C7YA 1Z3EB 3PZPA 3PMLA 3RH6A 2FPLA 4UB1A 3H0MB 3HILA 2ZTDA 4PJ0U 3ZI4A 1RG6A 4Y2RA 2XGQA 4DS4A 5IIKA 1PK3A 4YR0A 4ECZA 5ALHA 4KX5A 4KMUA 1B0XA 4JK1A 2K4IA 3Q8PB 1JROA 5AKZA 4DL2A 1MSWD 8ICRA 4IRCA 5KFKA 2ZXHA 3V72A 1X9XA 3PSIA 4DL7A 3SQIA 1PVPA 3DEEA 3C2LA 3DDHA 2Q0ZX 3N7SC 3ISCA 1TK0A 2BQUA 3LDAA 4RQNA 4J03A 2EAPA 4FZMA 3EPGA 3V7KA 1IV8A 3H7IA 1D8YA 4EZ9A 3ZDBA 1IG6A 3JPPA 3PSFA 2YB4A 4Z6CA 7ICGA 5CA7A 4ED2A 5GTIU 2AQ4A 1BPBA 1S9FA 4DS5A 4NLZA 3PX4A 3BJYA 2Y1IA 4Y2VA 1L8OA 2GOLA 2WAQC 4DEZA 2KJ9A 1YZ6A 1A0PA 3QU9A 4QWCA 5AKKA 5ALKA 2A3VA 3AEVA 4NL9A 5KT6A 4ED6A 2E1FA 3AQEA 3T5KA 2NO5A 4NLNA 4UB2A 4I2GA 1RYSA 2HSZA 2EZXA 4PHAA 4DSJA 4M9LA 2B0CA 1QQ6A 1D9DA 8ICPA 3KTQA 5HMMA 1CRXA 2HBMA 1ZYQA 4UAUA 9ICRA 3H0LB 4XUSA 2JZBA 4F92B 3TFSA 5J2EA 4C8KA 4RPXA 2I9GA 8ICFA 3MGVA 3F5EA 7ICKA 2HMXA 4B9MA 2Y9TA 5F9LA 5D46A 1X66A 4O5KA 5HR7A 1ZQEA 2AU0A 1RYUA 5KG6A 3GIIA 2Y0SF 5KFMA 3IDWA 1OXJA 3QXGA 4P4PA 2FLLA 4PHEA 4QJFB 1JALA 1X9SA 4RPYA 2YMLA 5KT3A 2FJ6A 2DKZA 5KG5A 3K4GA 2CN1A 4YP3A 4I2DA 2CPRA 2DFLA 1LB2B 4XQ8A 1XSPA 4QZEA 3G6YA 2HHSA 3SAFA 1X6JA 4RZRA 9ICWA 1NK8A 1FFUA 3MR2A 2YTUA 3F53A 4I2CA 1V9PA 3V7JA 1RM6C 5AKYA 1TK8A 4DSIA 2ZUCA 3V6KA 1XU4A 4DF4A 1RQNA 4DFJA 3H4BA 2B6GA 2KK0A 7ICSA 3QE9Y 1T3NA 3D6JA 4ELUA 4DFDA 3IG8A 5ALIA 2BPCA 4C80A 5JU5A 3QU7A 3J81j 2IBKA 5J2DA 4IQWA 4P0PA 4C4RA 1DOQA 1NK9A 1Z1VA 3GIKA 3GV5B 5J2HA 1K5OA 5KFQA 3HW8A 1K1QA 8ICEA 1ZQVA 3M6KA 4Q45A 2KOBA 4DSFA 4UB6U 1BVSA 5KFHA 5JUMA 2YY6A 5J8YC 2W3RA 1FFVA 3HP6A 4YMOA 3PX6A 2AGQA 4I27A 1UA0A 5KFTA 2IA6A 4DSEA 2DUYA 3TAPA 2XVTA 2HOIA 3GU3A 2G08A 5ALXA 2VANA 2DPJA 3QU4A 1SL2A 2NRTA 3AMZA 4P0PB 3SMVA 2KZZA 5EE3A 4QWEA 2NO4A 4WJ3B 2DQNB 5J0SA 2XI9A 1SB3C 2QARA 1XC9A 1L7NA 2KIWA 3GIMA 2JV3A 1HUZA 3BS5B 2E8NA 2LM1A 3AN1A 2K89A 3LWMA 5ALMA 2J6TA 1V85A 4KLTA 2XO7A 4R64A 4FS2A 3EW9A 3RB6A 4KLLA 2WTFA 1CUKA 1S97A 3L5KA 4J9LA 2QB1A 7ICFA 2WF8A 5F3XB 2H3FA 3AQFA 5ALSA 4UAYA 5DDMA 1KQQA 3H8MA 4ELTA 2MRLA 4KLHA 4FZLA 1D9FA 3HX0A 5KFSA 2AGOA 3GV8B 4EYIB 1X6IA 4F4YA 2VKQA 1WWVA 5KFRA 5KFXA 1NZBA 2WFAA 3F2BA 5J2JA 2YMMA 5KFOA 2KVCA 2W43A 4YD1A 3RH5A 1H38A 1S8OA 2XCPA 2E8MA 4BWJA 4F5OA 4M9GA 2OXOA 2KSOB 1EXNA 5KFVA 1ZQTA 1T94A 4OCZA 4QWBA 4AYBF 5EWFA 4C4TA 2GWSA 1MQ3A 4G3IA 4TQRA 4MFAA 5AK4A 1ZETA 1Z19A 5KT4A 4MF2A 3HKZF 2I6XA 5AHXA 4NLKA 1PZNA 5AK3A 4Y2YA 2NRWA 2Q4TA 4GIBA 7ICEA 3MGHA 3KHHA 1F5SA 4PHPA 1SL0A 1X9MA 3SV3A 1RDFA 1S5LU 2W9BB 2C28A 3AL0B 4ED7A 2FMPA 2V4QA 3IRUA 5AKIA 3TAQA 1XWLA 4NM2A 2DGZA 5KFIA 1A76A 4J9SA 2ZUDA 3IN5A 5GTHU 5KT2A 5AM2A 1ZQHA 3OSNA 4I2FA 2HBJA 4J9KA 7ICNA 3NRWA 4GXJA 1C7YA 3SI8A 1WG8A 3MR3A 3N28A 2K4PA 2WF6A 4Y2XA 5HHIA 4QZCA 2W3SA 2VIXA 1TK5A 4QIWF 2HBLA 4R63A 4DWIA 2MUTB 4IQVA 1NI3A 1IM4A 1ZQXA 5KFWA 4IR1A 1T7PA 1ZQWA 2QB0A 5DQIA 1SIJA 4F71A 3M8RA 2RQ5A 3RJEA 3VC8A 2PFOA 5ALOA 4F5NA 4NM1A 1QTMA 5DBBA 4UASA 2HOFA 3GDXA 3M7DA 2C2RA 5L1LA 2W9CB 3C1ZA 4J9NA 1T4GA 4PZOA 3NS1A 4CF3A 5AK5A 5KFNA 1NK7A 9ICLA 3PV8A 4EEYA 2LYHA 3IM1A 1ZQLA 3KFUF 4NLGA 2RDIA 1DGJA 8ICSA 3BDPA 3AU2A 2H3VA 8ICJA 2NRVA 2GO7A 4IL6U 4UATA 1VLBA 3E2EA 2K8CB 1SKSA 5J0PA 2G06A 3WKDA 4GXKA 1BGXT 1NKBA 4P0QA 3N4MB 4UAZA 1NNLA 1RYRA 8ICLA 3B0YA 1L3VA 1ZQMA 1AQ6A 5J0YA 2FMSA 4PL1A 2FDRA 4FO6A 2ZIWB 3MDCA 1YT3A 3Q8RB 5J2BA 5ALPA 2E5SA 1N2XA 3M9NB 4B6JA 1KLNA 4RQ3A 1IIPA 2VA2A 4EENA 3KZXA 4LVSA 1SL1A 3UXPA 7ICLA 1UA1A 4F4KA 2JXJA 2LKYA 4P0QB 3BZCA 1Z1BA 4M6WA 2C22A 2JHDA 4QZ9A 4MFFA 1JRPA 2VA3A 5AM3A 2JEGA 3WK9A 2FMQA 2F77X 4YG2A 1COKA 1SV4A 5DB9A 1QQ7A 1XSNA 3T5JA 1ZOLA 3PY8A 4F8RA 4QWDA 4KLMA 2E8OA 4IQTA 2W04A 5KFUA 2W8LA 3MABA 4F5QA 1AROP 2V9WA 8ICKA 4GLXA 3ORYA 2XC9A 4B9UA 5HMLA 4ECVA 1NK5A 2Y1JA 3WU2U 2W9MA 5ALEA 1F0MA 5AKXA 4TQSA 2KKPA 1BPDA 2HHTA 1HJPA 8ICAA 3QUQA 3N97B 4C7ZA 1WCNA 4Z6FA 4ECWA 5CRXA 2E3TA 4P4MA 3DV9A 4E0DA 3QUCA 8ICVA 9ICMA 2XCAA 3UQ2A 4M0AA 2ODGA 3SENA 4F5PA 1SKWA 1GO3F 5B66U 2HVIA 2KJ8A 9ICFA 3GIJA 4QWAA 3T5LA 5DLGA 1Q3UA 2R8JA 4Z6EA 4KN7A 1TFRA 2ASDA 5J0OA 1FEZA 9ICUA 3RR7A 2BCQA 2ZUBA 4P2HA 2ES6A 5KG2A 1S77D 1VDVA 5KAFU 3HWTA 4ECQA 1X2IA 4NWIA 2G07A 4DQPA 2Z7JA 1TAMA 1HUOA 1WWUA 3UM9A 5J2AA 3RTVA 2W03A 3EYZA 4QZFA 5KFYA 3C29A 4US8A 2AGPA 4UB3A 4F5RA 3OSPA 5KFLA 4P4OA 1KFSA 2ZTCA 3OHBA 5AI6A 4QZGA 2KNJA 1XNSA 4CGZA 1SV0A 5AI0A 1ECWA 4F91B 4US9A 3MR5A 4O5CA 1ZQKA 3SV4A 5G5HA 4C8NA 7ICVA 1ZQQA 1UQVA 5ALDA 4BJQA 4UBBA 4C8LA 1N61A 5CB1A 3IHQB 4UAVA 4JB3A 3LVVA 2G5HB 7ICJA 3TADA 3F2DA 3I76A 5L1IA 1RXWA 3QYPA 1N63A 3WK8A 3WK5A 1M6YA 2IHNA 3KBBA 4CE6A 1L3SA 1D8LA 1V38A 5EE1A 5TISU 4Z6DA 2BCUA 3MDAA 1QSYA 3LVWA 4IR9A 2F8KA 4C8MA 4CDGA 1NK0A 4ED8A 1KBUA 2KKVA 1QH9A 3RB0A 3SYZA 1SXEA 3GZFA 5EWGA 5KG1A 2CRXA 3HT3A 1Z4NA 2XY6A 3RB4A 4JMUA 2Y0SC 3C1YA 3BQ7A 1NJXA 2EANA 2D6FC 5AIAA 4F72A 1L8LA 1ZQ1C 4DOBA 1ZQBA 2KZMA 2HDOA 4GC7A 9ICBA 4FFDA 5B5EU 2ATLA 3C5GA 1LKYB 2WHEA 4Y2SA 4DLGA 1QLNA 2KG5A 2BQ3A 9ICJA 4F4WA 9ICQA 3HPOA 1JI7A 4RNOA 9ICAA 1Q46A 3NASA 8ICBA 2KMDA 5L1KA 4KLJA 1F44A 4M9JA 3BS7A 1X40A 3F5AA 4HYKA 2BGWA 2BHNA 2H3ZA 3JPSA 4MEXA 5ALFA 5IIMA 4DQSA 4BXOB 4YMNA 3MBYA 5DB8A 2P66A 4PGYA 1U49A 4YXMA 2K60A 3D2SA 1L3TA 5CEHA 3C5FA 3E0FA 1ZJNA 4TUPA 1T3QA 2KEYA 1ZRNA 2XY7A 3BS5A 1SXDA 4O3NA 1B4FA 2PFPA 3IG5A 3OTQA 4Q8FA 1UT8A 2LPEA 4EBEA 4M04A 3PO4A 1O08A 5D4BA 3PW4A 2UVVA 5BOLA 5KFDA 3C28A 5L1MA 4QZBA 4KTQA 2KP7A 2PMZC 2W55A 3TARA 5KFEA 5CR0A 1URJA 1JMSA 2WB1C 3V7LA 1TV9A 4ECUA 5C5JA 4ZH4A 3JPTA 2W8KA 1DXSA 5KFCA 3TACB 2W7OA 3UQ0A 4QZHA 1RQLA 1T8EA 5C0YA 1COOA 2KSOA 4J9QA 3T79A 2LI6A 2KE7A 5IINA 4FS1A 4B9TA 7ICPA 5K4LA 3KOOA 2JEJA 2BCVA 2PI5A 4Y2TA 4LZDA 7ICHA 4UQGA 8ICGA 2C2EA 1N62A 1PK1B 4OD0A 4IS7A 4EX7A 5IILA 1L5UA 3TKAA 9ICCA 4RUAA 4UAWA 2W9BA 1L7PA 2MU2A 5AKLA 1WYGA 3KKAA 2EAOA 4NLCA 1N5WA 4RQ7A 5HP4A 4O9MA 2LYBA 3MGIA 3BQ2A 4UB4A 5H2FU 4M2YA 5EOZA 3RH4A 8ICCA 3ETLA 3EWAA 3KHLA 2NRZA 1U45A 1DGSA 5ALGA 5KL1B 1ZQCA 3D2NA 1WUDA 5ALJA 3RJIA 2IHMA 3QEBZ 1PUZA 4PGQA 4AYBC 1CEZA 3RR8A 2MUTA 3WKAA 2CXYA 1ZD4A 5KG3A 4KLQA 4R66A 2J6UA 3H8SA 3HKZC 5AI4A 3PVXA 2IOFA 9ICVA 4EBCA 4XRHA 4RT2A 4UW9A 9ICKA 2JEFA 2ZIXB 4A8EA 1KTQA 5FP0A 3ZD9A 1NZPA 4Y2UA 2W9CA 4KMOB 5EE0A 2EZZA 5J0XA 3H40A 2MAXA 5AKEA 2P35A 3RRGA 2JRZA 3KZIU 5IIOA 1S0OA 3I28A 2QKQA 3E58A 1B22A 2OM6A 3BZKA 1QSSA 4I28A 3H4DA 3AUOA 3SD7A 1ZQSA 3RJFA 4QIWC 9ICSA 4I2JA 4DSLA 3M6ZA 1HIWA 3UMCA 5KG7A 2RRDA 4RQ4A 4KLEA 2ZTEA 2R18A 3CNHA 4O3OA 4QW8A 3OJSA 4JUZA 3ZDDA 2F1IA 2ZIWA 4MHVA 4F50A 3PW2A 5KFZA 2BPGA 3PO5A 9ICIA 4ED3A 4CRXA 2YMPA 3K1ZA 5ALUA
chains in the Genus database with same CATH topology
3GU3A 3IP4B 2G08A 4ACOA 2Y0SF 3N7PD 3LYSA 3SAHA 2H3QA 3IG5A 2GH1A 2K4EA 3CRXA 5CRXA 2JH1A 2KV2A 4U6PA 2N1RA 4FE3A 3AL0B 4QJFB 4P0PB 4PL1A 3SMVA 5KL1B 3N7RC 2ZXHA 3D2NA 1SZHA 1WUDA 2RHFA 2DQNB 4WJ3B 2XI9A 2ZIWB 3RFAA 2WAQF 1UPHA 1D8BA 2DGZA 2ZXIA 3PSIA 4KX3A 2K8AA 3SQIA 1PVPA 1YT3A 3DEEA 3LVWA 2KIWA 4AYBC 2CN1A 2ZIXA 1GO3F 2E1EA 4PL2A 3IN5A 2E5SA 2ZIUB 3O0FA 4CDGA 2CPRA 3N7SC 2DF4B 2RP5A 1A6SA 2VJ4A 2KJ8A 2ZG6A 2LHTA 3C28A 2K89A 4BX9C 1IIPA 5T14A 2HBJA 2F8LA 2OYYA 2KKVA 2G09A 4IC9A 1KBUA 3NRWA 3CP8A 1Q3UA 1MA7A 3HKZC 3KZXA 2PMZC 3SAFA 4FZMA 1P7DA 3PSTA 1DRGA 2BDUA 3F53A 2YB1A 3GZFA 3VCBA 1URJA 2M0NA 2WB1C 2YX8A 2CRXA 2OH2A 2JMGA 1L6NA 2KJ5A 2VIXA 5HR6A 2XIDA 4JMUA 2Y0SC 1Q3VA 4QIWF 2ZIXB 2KICA 2HBLA 2YB4A 3PSFA 2D6FC 1PVRA 4NWIA 2G07A 4A8EA 2Z7JA 2H3FA 3AQFA 1ZQ1C 1TAMA 4GFJA 2MRLA 2ZIVA 2W7OA 4FZLA 2LKYA 3ALRA 4P0QB 3ICXA 4OJPA 2GOLA 2W03A 2WAQC 2KJ9A 1Z1BA 3IG8A 4NV0A 2VKQA 2XICA 4KMOB 5C0YA 3C29A 1A0PA 4FZNA 2JHDA 1NZBA 2A3VA 2G5IB 1ED1A 2KD1A 3T79A 3F2BA 2G0AA 3OPXA 2LBOA 2HBKA 1XO0A 3VC8A 3RF9A 2K4HA 4ICAA 4P0PA 2KVCA 2E1FA 2F77X 3AQEA 5KL8B 4C0ZA 4OJ5A 4OJLA 3D2QA 2PMZF 1OUQA 2HOFA 3SAGA 4OJ6A 3F2CA 2OM6A 3M7DA 1F44A 3H0RB 2OXOA 2KNJA 2WB1F 2ZIUA 1XNSA 3F5AA 3ONNA 4CGZA 2H3ZA 2VJ5A 4QIWC 1HEKA 2HOQA 4OJOA 2KHVA 3M6ZA 3KFUF 3L3FX 1ECWA 2W04A 5A0LA 3PZPA 1HIWA 1CRXA 2JH7A 4OO1J 1T94A 3PSPA 2H3VA 4NLBA 2HBMA 3H0MB 3M6KA 2RRDA 4QNLA 2KHQA 2LYAA 4AYBF 2KOBA 4O3MA 3H0LB 4BUGA 2R18A 2F2AB 1PVQA 2NV3A 4BJQA 3D2SA 4NLCA 2K8CB 1Z19A 2ZIWA 3HKZF 3F5EA 3MGVA 3E0FA 2HMXA 2G06A 3LVVA 2ZIVB 2LYBA 2G5HB 2MA1A 3CYMA 5HR7A 2F76X 2KEYA 4U7CA 2W7PA 2KKPA 4KX5A 2Q4TA 2H3IA 4CRXA 3K1ZA 3F2DA 2XVTA 2HOIA 4P0QA 2K4IA 2K8BB 2JGAA 3NUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ECW A;  1HIW A;  2H3Q A;  2K4E A;  1ED1 A;  2H3V A;  2N1R A;  2LYA A;  2JMG A;  1L6N A;  2K4H A;  4ICA A;  2NV3 A;  4JMU A;  1UPH A;  2HMX A;  2H3F A;  2LYB A;  1TAM A;  1A6S A;  2H3I A;  2H3Z A;  2GOL A;  1HEK A;  2K4I A;  4IC9 A; 
#chains in the Genus database with same CATH topology
 5DGA A;  4ACO A;  1MQ2 A;  2NRX A;  2PFN A;  4U6P A;  1TAQ A;  5DLF A;  4B9V A;  9ICN A;  4K4G A;  1Q8K A;  1S0V A;  4C8O A;  1KDH A;  3OJU A;  5ALY A;  2KZ3 A;  1Z00 B;  2E1E A;  4IRD A;  1KL9 A;  5AM5 A;  1A6S A;  1XO1 A;  1SWV A;  2ZG6 A;  2LHT A;  1ZQZ A;  2V4R A;  3RJH A;  5DG8 A;  2OYY A;  1RPL A;  2BQR A;  3GQC A;  1TE2 A;  5BOM A;  1K1S A;  2HHV A;  2W9A A;  2LM4 A;  5HNK A;  3I1Y A;  2OCE A;  5CWR A;  4GXI A;  1UCV A;  5KFB A;  3SR6 A;  1SV0 C;  3ALR A;  2LMR A;  4DQQ A;  3H8J A;  1JXE A;  2FE9 A;  3JPR A;  4FZN A;  5L9X A;  2C2D A;  2PFQ A;  2PXI A;  4J9M A;  4NL9 C;  1N56 A;  4BGD A;  3NRZ A;  5AKJ A;  2R8K A;  2Y9U A;  5CP2 A;  3F2C A;  1IXR A;  3H0R B;  4O0I A;  1NKE A;  4R8U B;  2ZIU A;  2HI0 A;  3T3F A;  2HOQ A;  2IMW P;  5JTI A;  3PMN A;  1U9L A;  4NLB A;  3Q8K A;  5AKG A;  4R65 A;  2KHQ A;  2R8G A;  5III A;  4BUG A;  1KW4 A;  3PX0 A;  1JX4 A;  5AK6 A;  4F2R A;  4PH5 A;  1FIQ A;  5AIC A;  3B0X A;  8ICO A;  1LVH A;  2I5H A;  3S6J A;  4XA5 A;  3EZ5 A;  4ECR A;  5AI5 A;  3FC4 A;  3CYM A;  4I29 A;  1TKD A;  4DQI A;  2A19 A;  2BPF A;  1V97 A;  4DFP A;  3N7P D;  5J2F A;  5ALL A;  3G6V A;  5J0R A;  2JH1 A;  4RU9 A;  1A77 A;  2E8P A;  5HHH A;  3RAX A;  9ICG A;  2VA8 A;  2MSN A;  3Q8Q B;  2FPK A;  2R8I A;  2ZIU B;  3O0F A;  4B9N A;  2KFN A;  2ASL A;  1J97 A;  5G5G A;  3KHR A;  2G09 A;  4IC9 A;  4DQR A;  7ICI A;  3CP8 A;  2YMQ A;  7ICT A;  1DRG A;  2YB1 A;  4LJX A;  2JMG A;  2KJ5 A;  4UB8 U;  7ICM A;  4KLG A;  5CHG A;  3THV A;  2D3D A;  4YVZ A;  3MR6 A;  4DOA A;  2W11 A;  5KG0 A;  2KIV A;  1RZT A;  7ICR A;  1KFD A;  4YCX A;  3UPQ A;  1KN5 A;  3PW0 A;  3GV7 B;  4DSK A;  4DFM A;  2G5I B;  3LWL A;  2KD1 A;  5DBA A;  4ECY A;  4M9N A;  1XO0 A;  2PKE A;  3AM9 A;  2XY5 A;  3ZDC A;  1O03 A;  4USA A;  1UT5 A;  1RXV A;  1BPY A;  5EWE A;  4YN4 A;  4QZD A;  1ZQP A;  1S0N A;  1U4B A;  3ED5 A;  4OJO A;  2F1J A;  5A0L A;  4J9P A;  2JH7 A;  2F1H A;  7ICO A;  4Y2Q A;  4RQ8 A;  4DOC A;  3FYH A;  2I1Q A;  4BWM A;  4RQ2 A;  1ZJM A;  4QZA A;  5J2I A;  2H3I A;  4EEK A;  4KLF A;  2K8B B;  3IP4 B;  1ZD5 A;  2BCR A;  4QW9 A;  3GFK B;  3UMG A;  1QQ5 A;  2H5X A;  3G6X A;  2HVH A;  8ICN A;  4I2I A;  4M47 A;  4F93 B;  3CW2 C;  1J2M A;  5DGB A;  3JPO A;  2WAQ F;  1JN3 A;  4NXZ A;  1WCL A;  2K8A A;  2ZJ8 A;  3V6H A;  4MFC A;  1SGG A;  4CF4 A;  4X5V A;  5KTQ A;  3MC1 A;  4JWN A;  5KFF A;  4Q43 A;  5DQG A;  3JPN A;  1B43 A;  1U47 A;  2DWQ A;  4KN4 A;  1L7M A;  1VJ5 A;  4DL5 A;  1LKY A;  2KFZ A;  1ZXI A;  3BQT A;  3QUT A;  5KAI U;  1KEJ A;  1Q3V A;  1QSL A;  4RQ5 A;  1CI4 A;  2KIC A;  4TUQ A;  1UHU A;  4YR3 A;  2M9N A;  1JXL A;  1TAU A;  1J2N A;  4GFJ A;  2P6U A;  3RBE A;  3ICX A;  1ZQR A;  3RBD A;  3NVZ A;  3C2K A;  1XSL A;  4ECS A;  2JEI A;  5J0U A;  2BZF A;  4TUS A;  5KFA A;  3R9K A;  4KLD A;  8ICX A;  3NGD A;  3RF9 A;  3OGU A;  3ISB A;  2AJQ A;  1KRP A;  3KKA C;  1NJW A;  4BXO A;  1BNO A;  2YN4 A;  5AM0 A;  4C0Z A;  3GIL A;  4OJL A;  4F4X A;  4ED1 A;  4O3S A;  4QZ8 A;  3L4P A;  3WKC A;  3EPI A;  3EUB 2;  4OO1 J;  3PSP A;  4MF8 A;  4RQM A;  2XGP A;  4HAI A;  5AKH A;  2LYA A;  4B9S A;  4KLO A;  2DPI A;  3QUB A;  1BPZ A;  5AI8 A;  2PI4 A;  2W54 A;  3RJK A;  4I2A A;  2YQE A;  2F76 X;  8ICM A;  2ISP A;  3AU6 A;  4O5E A;  1SKR A;  3SAH A;  1BPX A;  4Q8E A;  3M8S A;  2GH1 A;  2K4E A;  9ICE A;  2KV2 A;  1JIH A;  2ISO A;  2JZB B;  4QZI A;  3HJE A;  4CCH A;  2FLN A;  4DO9 A;  4NY8 A;  1ZQG A;  8ICQ A;  3KHG A;  4ZOH C;  2BCS A;  3V6J A;  3BQ1 A;  2DF4 B;  2RP5 A;  3IV6 A;  3NTU A;  1ZRM A;  2RLT A;  5DG9 A;  4PGX A;  4Y2J A;  3A0H U;  3PST A;  2ESE A;  5DB7 A;  5DDY A;  2M0N A;  2EH9 A;  3NVV A;  2EAM A;  4DLE A;  4DL6 A;  5HR6 A;  2HCF A;  3FDS A;  3NVW A;  2DKX A;  8ICW A;  2FI1 A;  1PK1 A;  4DCC A;  5ALV A;  4LZG A;  2HHX A;  2ASJ A;  3C23 A;  4ECT A;  2G0A A;  3OPX A;  3UXO A;  4UB5 A;  3M1Y A;  4RQ1 A;  2EZY A;  1ZQA A;  3M9O B;  4CF5 A;  1OW5 A;  2PMZ F;  3SAG A;  4OJ6 A;  3A0B U;  4EX6 A;  2WF7 A;  2WB1 F;  2UVU A;  3B9J A;  4JV2 A;  5KT5 A;  4QNL A;  3RRH A;  4O3M A;  1ZQN A;  1PVQ A;  1MC8 A;  1SWW A;  5AM4 A;  4J9O A;  2NV3 A;  8ICI A;  2D8C A;  5J0W A;  4YXJ A;  1N5X A;  3RJG A;  4JV1 A;  2MA1 A;  4CNQ A;  7ICU A;  1ZQF A;  3NUQ A;  4AP9 A;  3KD3 A;  3C21 A;  1N60 A;  3QZ7 A;  1S0M A;  3CRX A;  2KVS A;  5AI9 A;  2EQY A;  4FE3 A;  1Z4O A;  2WF5 A;  3QU2 A;  2OEH A;  3QNM A;  1C20 A;  2WF9 A;  1U48 A;  1ZQJ A;  5KFJ A;  2P6R A;  1ZQI A;  4I2B A;  5KG4 A;  3TI0 A;  1ZQY A;  1DK2 A;  2R8H A;  5DQH A;  2RDJ A;  3MFH A;  4F3O A;  2ZIX A;  3FM9 A;  4UAR A;  4EYH B;  4YQW A;  3RB3 A;  5T14 A;  2F8L A;  4FBU A;  8ICT A;  4C4S A;  2L5Y A;  2KN7 A;  3PW5 A;  2A1J A;  4NJ8 A;  3SZ2 A;  8ICU A;  2QAR B;  4JV0 A;  3FAH A;  3PR5 B;  4PHD A;  1LV5 A;  5J2G A;  3Q8S B;  2AXT U;  1S76 D;  1ZQO A;  4RNM A;  2O6K A;  2BR0 A;  2K4H A;  3BQ0 A;  3WK4 A;  4G9B A;  1NKC A;  2DL0 A;  2HHQ A;  3D2Q A;  2JR5 A;  1KKX A;  5JRT A;  3PNC A;  2AHO B;  5BPC A;  4GC6 A;  4O3P A;  4ELV A;  3UXN A;  4DF8 A;  1HEK A;  2QLT A;  2KHV A;  3L3F X;  3C2M A;  2UVR A;  1KSP A;  3ZDA A;  4PZN A;  1ZD2 P;  2A1J B;  4RQ0 A;  3RJJ A;  1FO4 A;  2BDP A;  1X42 A;  1NK6 A;  4I2E A;  3PR4 A;  4U7C A;  1Z00 A;  2W7P A;  3ZDE A;  1S10 A;  1NOM A;  9ICX A;  5DKW A;  3H8W A;  4Y2P A;  2HHU A;  1ZQD A;  2H3Q A;  3WKE A;  3QZ8 A;  1SZH A;  5DBC A;  1NJZ A;  1NK4 A;  8ICH A;  1UPH A;  5J8Y A;  1D8B A;  4RT3 A;  1BNP A;  4KX3 A;  3ZD8 A;  2KTQ A;  9ICP A;  2OWO A;  4PL2 A;  5D49 A;  1KFT A;  5E79 U;  5J2C A;  4KLI A;  4YD2 A;  1JUD A;  1SZP A;  4UBC A;  4KIT B;  4MEY A;  3TAN A;  2FPM A;  4PPX A;  2YX8 A;  4RUC A;  2OH2 A;  1L6N A;  2HW3 A;  2XID A;  3WK6 A;  3RAQ A;  1X9W A;  2UVW A;  8ICY A;  2FLP A;  7ICQ A;  1PVR A;  4RQ6 A;  2ZIV A;  4O3R A;  3SEI A;  5ALT A;  5J2K A;  4RNN A;  1DK3 A;  3QEA Z;  3UMB A;  4R8U A;  5ALQ A;  4TUR A;  4NV0 A;  3QX7 A;  5J29 A;  3LK9 A;  4ED0 A;  4DL3 A;  5ALW A;  2DBY A;  4BDP A;  2GLE A;  1ZD3 A;  5EE9 A;  1MN8 A;  5ALZ A;  4OJ5 A;  4IQU A;  4O3Q A;  3K75 D;  2QB0 B;  4JWM A;  4KLS A;  5TZV A;  5DG7 A;  2F3N A;  4F4Z A;  3TQ1 A;  2OHF A;  1L7O A;  5KT7 A;  2EDU A;  2F2A B;  2AH5 A;  3Q8M A;  1BPE A;  3M9M B;  1N48 A;  5F9N A;  9ICT A;  5J0Q A;  5CJ7 A;  2ZIV B;  3TAD C;  2ZJ5 A;  4F2S A;  4EEL A;  2HHW A;  2JGA A;  4IRK A;  3LYS A;  2ALZ A;  5KFG A;  2N1R A;  5AM1 A;  1YZ7 A;  3N7R C;  3U26 A;  2RHF A;  4YR2 A;  4Q44 A;  5AIB A;  4YMM A;  3RFA A;  4J9R A;  3MFI A;  2ZXI A;  3TFR A;  5KFP A;  2VJ4 A;  4BX9 C;  1MA7 A;  2AQ0 A;  1P7D A;  1ZQU A;  2BDU A;  2IOF K;  2IOH A;  1NJY A;  2B21 A;  2J6S A;  3VCB A;  3QU5 A;  4YFK A;  4FBT A;  3HRD D;  3ETR A;  2A1A A;  2BKE A;  9ICO A;  3ISD A;  4KLU A;  3T5H A;  4EZ6 A;  3WK7 A;  3PW7 A;  4K4I A;  5L1J A;  2F44 A;  4OJP A;  4RPZ A;  5DB6 A;  2NYV A;  1TVA A;  9ICH A;  2XIC A;  3NVY A;  4K4H A;  3JPQ A;  5IIJ A;  1ED1 A;  5ALN A;  2LBO A;  2HBK A;  4EBD A;  3Q8L A;  5ALR A;  4M9H A;  4DL4 A;  4ICA A;  1Y88 A;  8ICZ A;  3OHA A;  5KL8 B;  4DFK A;  5J0T A;  1OUQ A;  4B9L A;  3WKB A;  4I2H A;  4ECX A;  1L3U A;  2ZJA A;  5KNI A;  1XS9 D;  3ONN A;  4M6W B;  2VJ5 A;  1QCK A;  3K1R B;  4C7Y A;  1Z3E B;  3PZP A;  3PML A;  3RH6 A;  2FPL A;  4UB1 A;  3H0M B;  3HIL A;  2ZTD A;  4PJ0 U;  3ZI4 A;  1RG6 A;  4Y2R A;  2XGQ A;  4DS4 A;  5IIK A;  1PK3 A;  4YR0 A;  4ECZ A;  5ALH A;  4KX5 A;  4KMU A;  1B0X A;  4JK1 A;  2K4I A;  3Q8P B;  1JRO A;  5AKZ A;  4DL2 A;  1MSW D;  8ICR A;  4IRC A;  5KFK A;  2ZXH A;  3V72 A;  1X9X A;  3PSI A;  4DL7 A;  3SQI A;  1PVP A;  3DEE A;  3C2L A;  3DDH A;  2Q0Z X;  3N7S C;  3ISC A;  1TK0 A;  2BQU A;  3LDA A;  4RQN A;  4J03 A;  2EAP A;  4FZM A;  3EPG A;  3V7K A;  1IV8 A;  3H7I A;  1D8Y A;  4EZ9 A;  3ZDB A;  1IG6 A;  3JPP A;  3PSF A;  2YB4 A;  4Z6C A;  7ICG A;  5CA7 A;  4ED2 A;  5GTI U;  2AQ4 A;  1BPB A;  1S9F A;  4DS5 A;  4NLZ A;  3PX4 A;  3BJY A;  2Y1I A;  4Y2V A;  1L8O A;  2GOL A;  2WAQ C;  4DEZ A;  2KJ9 A;  1YZ6 A;  1A0P A;  3QU9 A;  4QWC A;  5AKK A;  5ALK A;  2A3V A;  3AEV A;  4NL9 A;  5KT6 A;  4ED6 A;  2E1F A;  3AQE A;  3T5K A;  2NO5 A;  4NLN A;  4UB2 A;  4I2G A;  1RYS A;  2HSZ A;  2EZX A;  4PHA A;  4DSJ A;  4M9L A;  2B0C A;  1QQ6 A;  1D9D A;  8ICP A;  3KTQ A;  5HMM A;  1CRX A;  2HBM A;  1ZYQ A;  4UAU A;  9ICR A;  3H0L B;  4XUS A;  2JZB A;  4F92 B;  3TFS A;  5J2E A;  4C8K A;  4RPX A;  2I9G A;  8ICF A;  3MGV A;  3F5E A;  7ICK A;  2HMX A;  4B9M A;  2Y9T A;  5F9L A;  5D46 A;  1X66 A;  4O5K A;  5HR7 A;  1ZQE A;  2AU0 A;  1RYU A;  5KG6 A;  3GII A;  2Y0S F;  5KFM A;  3IDW A;  1OXJ A;  3QXG A;  4P4P A;  2FLL A;  4PHE A;  4QJF B;  1JAL A;  1X9S A;  4RPY A;  2YML A;  5KT3 A;  2FJ6 A;  2DKZ A;  5KG5 A;  3K4G A;  2CN1 A;  4YP3 A;  4I2D A;  2CPR A;  2DFL A;  1LB2 B;  4XQ8 A;  1XSP A;  4QZE A;  3G6Y A;  2HHS A;  3SAF A;  1X6J A;  4RZR A;  9ICW A;  1NK8 A;  1FFU A;  3MR2 A;  2YTU A;  3F53 A;  4I2C A;  1V9P A;  3V7J A;  1RM6 C;  5AKY A;  1TK8 A;  4DSI A;  2ZUC A;  3V6K A;  1XU4 A;  4DF4 A;  1RQN A;  4DFJ A;  3H4B A;  2B6G A;  2KK0 A;  7ICS A;  3QE9 Y;  1T3N A;  3D6J A;  4ELU A;  4DFD A;  3IG8 A;  5ALI A;  2BPC A;  4C80 A;  5JU5 A;  3QU7 A;  3J81 j;  2IBK A;  5J2D A;  4IQW A;  4P0P A;  4C4R A;  1DOQ A;  1NK9 A;  1Z1V A;  3GIK A;  3GV5 B;  5J2H A;  1K5O A;  5KFQ A;  3HW8 A;  1K1Q A;  8ICE A;  1ZQV A;  3M6K A;  4Q45 A;  2KOB A;  4DSF A;  4UB6 U;  1BVS A;  5KFH A;  5JUM A;  2YY6 A;  5J8Y C;  2W3R A;  1FFV A;  3HP6 A;  4YMO A;  3PX6 A;  2AGQ A;  4I27 A;  1UA0 A;  5KFT A;  2IA6 A;  4DSE A;  2DUY A;  3TAP A;  2XVT A;  2HOI A;  3GU3 A;  2G08 A;  5ALX A;  2VAN A;  2DPJ A;  3QU4 A;  1SL2 A;  2NRT A;  3AMZ A;  4P0P B;  3SMV A;  2KZZ A;  5EE3 A;  4QWE A;  2NO4 A;  4WJ3 B;  2DQN B;  5J0S A;  2XI9 A;  1SB3 C;  2QAR A;  1XC9 A;  1L7N A;  2KIW A;  3GIM A;  2JV3 A;  1HUZ A;  3BS5 B;  2E8N A;  2LM1 A;  3AN1 A;  2K89 A;  3LWM A;  5ALM A;  2J6T A;  1V85 A;  4KLT A;  2XO7 A;  4R64 A;  4FS2 A;  3EW9 A;  3RB6 A;  4KLL A;  2WTF A;  1CUK A;  1S97 A;  3L5K A;  4J9L A;  2QB1 A;  7ICF A;  2WF8 A;  5F3X B;  2H3F A;  3AQF A;  5ALS A;  4UAY A;  5DDM A;  1KQQ A;  3H8M A;  4ELT A;  2MRL A;  4KLH A;  4FZL A;  1D9F A;  3HX0 A;  5KFS A;  2AGO A;  3GV8 B;  4EYI B;  1X6I A;  4F4Y A;  2VKQ A;  1WWV A;  5KFR A;  5KFX A;  1NZB A;  2WFA A;  3F2B A;  5J2J A;  2YMM A;  5KFO A;  2KVC A;  2W43 A;  4YD1 A;  3RH5 A;  1H38 A;  1S8O A;  2XCP A;  2E8M A;  4BWJ A;  4F5O A;  4M9G A;  2OXO A;  2KSO B;  1EXN A;  5KFV A;  1ZQT A;  1T94 A;  4OCZ A;  4QWB A;  4AYB F;  5EWF A;  4C4T A;  2GWS A;  1MQ3 A;  4G3I A;  4TQR A;  4MFA A;  5AK4 A;  1ZET A;  1Z19 A;  5KT4 A;  4MF2 A;  3HKZ F;  2I6X A;  5AHX A;  4NLK A;  1PZN A;  5AK3 A;  4Y2Y A;  2NRW A;  2Q4T A;  4GIB A;  7ICE A;  3MGH A;  3KHH A;  1F5S A;  4PHP A;  1SL0 A;  1X9M A;  3SV3 A;  1RDF A;  1S5L U;  2W9B B;  2C28 A;  3AL0 B;  4ED7 A;  2FMP A;  2V4Q A;  3IRU A;  5AKI A;  3TAQ A;  1XWL A;  4NM2 A;  2DGZ A;  5KFI A;  1A76 A;  4J9S A;  2ZUD A;  3IN5 A;  5GTH U;  5KT2 A;  5AM2 A;  1ZQH A;  3OSN A;  4I2F A;  2HBJ A;  4J9K A;  7ICN A;  3NRW A;  4GXJ A;  1C7Y A;  3SI8 A;  1WG8 A;  3MR3 A;  3N28 A;  2K4P A;  2WF6 A;  4Y2X A;  5HHI A;  4QZC A;  2W3S A;  2VIX A;  1TK5 A;  4QIW F;  2HBL A;  4R63 A;  4DWI A;  2MUT B;  4IQV A;  1NI3 A;  1IM4 A;  1ZQX A;  5KFW A;  4IR1 A;  1T7P A;  1ZQW A;  2QB0 A;  5DQI A;  1SIJ A;  4F71 A;  3M8R A;  2RQ5 A;  3RJE A;  3VC8 A;  2PFO A;  5ALO A;  4F5N A;  4NM1 A;  1QTM A;  5DBB A;  4UAS A;  2HOF A;  3GDX A;  3M7D A;  2C2R A;  5L1L A;  2W9C B;  3C1Z A;  4J9N A;  1T4G A;  4PZO A;  3NS1 A;  4CF3 A;  5AK5 A;  5KFN A;  1NK7 A;  9ICL A;  3PV8 A;  4EEY A;  2LYH A;  3IM1 A;  1ZQL A;  3KFU F;  4NLG A;  2RDI A;  1DGJ A;  8ICS A;  3BDP A;  3AU2 A;  2H3V A;  8ICJ A;  2NRV A;  2GO7 A;  4IL6 U;  4UAT A;  1VLB A;  3E2E A;  2K8C B;  1SKS A;  5J0P A;  2G06 A;  3WKD A;  4GXK A;  1BGX T;  1NKB A;  4P0Q A;  3N4M B;  4UAZ A;  1NNL A;  1RYR A;  8ICL A;  3B0Y A;  1L3V A;  1ZQM A;  1AQ6 A;  5J0Y A;  2FMS A;  4PL1 A;  2FDR A;  4FO6 A;  2ZIW B;  3MDC A;  1YT3 A;  3Q8R B;  5J2B A;  5ALP A;  2E5S A;  1N2X A;  3M9N B;  4B6J A;  1KLN A;  4RQ3 A;  1IIP A;  2VA2 A;  4EEN A;  3KZX A;  4LVS A;  1SL1 A;  3UXP A;  7ICL A;  1UA1 A;  4F4K A;  2JXJ A;  2LKY A;  4P0Q B;  3BZC A;  1Z1B A;  4M6W A;  2C22 A;  2JHD A;  4QZ9 A;  4MFF A;  1JRP A;  2VA3 A;  5AM3 A;  2JEG A;  3WK9 A;  2FMQ A;  2F77 X;  4YG2 A;  1COK A;  1SV4 A;  5DB9 A;  1QQ7 A;  1XSN A;  3T5J A;  1ZOL A;  3PY8 A;  4F8R A;  4QWD A;  4KLM A;  2E8O A;  4IQT A;  2W04 A;  5KFU A;  2W8L A;  3MAB A;  4F5Q A;  1ARO P;  2V9W A;  8ICK A;  4GLX A;  3ORY A;  2XC9 A;  4B9U A;  5HML A;  4ECV A;  1NK5 A;  2Y1J A;  3WU2 U;  2W9M A;  5ALE A;  1F0M A;  5AKX A;  4TQS A;  2KKP A;  1BPD A;  2HHT A;  1HJP A;  8ICA A;  3QUQ A;  3N97 B;  4C7Z A;  1WCN A;  4Z6F A;  4ECW A;  5CRX A;  2E3T A;  4P4M A;  3DV9 A;  4E0D A;  3QUC A;  8ICV A;  9ICM A;  2XCA A;  3UQ2 A;  4M0A A;  2ODG A;  3SEN A;  4F5P A;  1SKW A;  1GO3 F;  5B66 U;  2HVI A;  2KJ8 A;  9ICF A;  3GIJ A;  4QWA A;  3T5L A;  5DLG A;  1Q3U A;  2R8J A;  4Z6E A;  4KN7 A;  1TFR A;  2ASD A;  5J0O A;  1FEZ A;  9ICU A;  3RR7 A;  2BCQ A;  2ZUB A;  4P2H A;  2ES6 A;  5KG2 A;  1S77 D;  1VDV A;  5KAF U;  3HWT A;  4ECQ A;  1X2I A;  4NWI A;  2G07 A;  4DQP A;  2Z7J A;  1TAM A;  1HUO A;  1WWU A;  3UM9 A;  5J2A A;  3RTV A;  2W03 A;  3EYZ A;  4QZF A;  5KFY A;  3C29 A;  4US8 A;  2AGP A;  4UB3 A;  4F5R A;  3OSP A;  5KFL A;  4P4O A;  1KFS A;  2ZTC A;  3OHB A;  5AI6 A;  4QZG A;  2KNJ A;  1XNS A;  4CGZ A;  1SV0 A;  5AI0 A;  1ECW A;  4F91 B;  4US9 A;  3MR5 A;  4O5C A;  1ZQK A;  3SV4 A;  5G5H A;  4C8N A;  7ICV A;  1ZQQ A;  1UQV A;  5ALD A;  4BJQ A;  4UBB A;  4C8L A;  1N61 A;  5CB1 A;  3IHQ B;  4UAV A;  4JB3 A;  3LVV A;  2G5H B;  7ICJ A;  3TAD A;  3F2D A;  3I76 A;  5L1I A;  1RXW A;  3QYP A;  1N63 A;  3WK8 A;  3WK5 A;  1M6Y A;  2IHN A;  3KBB A;  4CE6 A;  1L3S A;  1D8L A;  1V38 A;  5EE1 A;  5TIS U;  4Z6D A;  2BCU A;  3MDA A;  1QSY A;  3LVW A;  4IR9 A;  2F8K A;  4C8M A;  4CDG A;  1NK0 A;  4ED8 A;  1KBU A;  2KKV A;  1QH9 A;  3RB0 A;  3SYZ A;  1SXE A;  3GZF A;  5EWG A;  5KG1 A;  2CRX A;  3HT3 A;  1Z4N A;  2XY6 A;  3RB4 A;  4JMU A;  2Y0S C;  3C1Y A;  3BQ7 A;  1NJX A;  2EAN A;  2D6F C;  5AIA A;  4F72 A;  1L8L A;  1ZQ1 C;  4DOB A;  1ZQB A;  2KZM A;  2HDO A;  4GC7 A;  9ICB A;  4FFD A;  5B5E U;  2ATL A;  3C5G A;  1LKY B;  2WHE A;  4Y2S A;  4DLG A;  1QLN A;  2KG5 A;  2BQ3 A;  9ICJ A;  4F4W A;  9ICQ A;  3HPO A;  1JI7 A;  4RNO A;  9ICA A;  1Q46 A;  3NAS A;  8ICB A;  2KMD A;  5L1K A;  4KLJ A;  1F44 A;  4M9J A;  3BS7 A;  1X40 A;  3F5A A;  4HYK A;  2BGW A;  2BHN A;  2H3Z A;  3JPS A;  4MEX A;  5ALF A;  5IIM A;  4DQS A;  4BXO B;  4YMN A;  3MBY A;  5DB8 A;  2P66 A;  4PGY A;  1U49 A;  4YXM A;  2K60 A;  3D2S A;  1L3T A;  5CEH A;  3C5F A;  3E0F A;  1ZJN A;  4TUP A;  1T3Q A;  2KEY A;  1ZRN A;  2XY7 A;  3BS5 A;  1SXD A;  4O3N A;  1B4F A;  2PFP A;  3IG5 A;  3OTQ A;  4Q8F A;  1UT8 A;  2LPE A;  4EBE A;  4M04 A;  3PO4 A;  1O08 A;  5D4B A;  3PW4 A;  2UVV A;  5BOL A;  5KFD A;  3C28 A;  5L1M A;  4QZB A;  4KTQ A;  2KP7 A;  2PMZ C;  2W55 A;  3TAR A;  5KFE A;  5CR0 A;  1URJ A;  1JMS A;  2WB1 C;  3V7L A;  1TV9 A;  4ECU A;  5C5J A;  4ZH4 A;  3JPT A;  2W8K A;  1DXS A;  5KFC A;  3TAC B;  2W7O A;  3UQ0 A;  4QZH A;  1RQL A;  1T8E A;  5C0Y A;  1COO A;  2KSO A;  4J9Q A;  3T79 A;  2LI6 A;  2KE7 A;  5IIN A;  4FS1 A;  4B9T A;  7ICP A;  5K4L A;  3KOO A;  2JEJ A;  2BCV A;  2PI5 A;  4Y2T A;  4LZD A;  7ICH A;  4UQG A;  8ICG A;  2C2E A;  1N62 A;  1PK1 B;  4OD0 A;  4IS7 A;  4EX7 A;  5IIL A;  1L5U A;  3TKA A;  9ICC A;  4RUA A;  4UAW A;  2W9B A;  1L7P A;  2MU2 A;  5AKL A;  1WYG A;  3KKA A;  2EAO A;  4NLC A;  1N5W A;  4RQ7 A;  5HP4 A;  4O9M A;  2LYB A;  3MGI A;  3BQ2 A;  4UB4 A;  5H2F U;  4M2Y A;  5EOZ A;  3RH4 A;  8ICC A;  3ETL A;  3EWA A;  3KHL A;  2NRZ A;  1U45 A;  1DGS A;  5ALG A;  5KL1 B;  1ZQC A;  3D2N A;  1WUD A;  5ALJ A;  3RJI A;  2IHM A;  3QEB Z;  1PUZ A;  4PGQ A;  4AYB C;  1CEZ A;  3RR8 A;  2MUT A;  3WKA A;  2CXY A;  1ZD4 A;  5KG3 A;  4KLQ A;  4R66 A;  2J6U A;  3H8S A;  3HKZ C;  5AI4 A;  3PVX A;  2IOF A;  9ICV A;  4EBC A;  4XRH A;  4RT2 A;  4UW9 A;  9ICK A;  2JEF A;  2ZIX B;  4A8E A;  1KTQ A;  5FP0 A;  3ZD9 A;  1NZP A;  4Y2U A;  2W9C A;  4KMO B;  5EE0 A;  2EZZ A;  5J0X A;  3H40 A;  2MAX A;  5AKE A;  2P35 A;  3RRG A;  2JRZ A;  3KZI U;  5IIO A;  1S0O A;  3I28 A;  2QKQ A;  3E58 A;  1B22 A;  2OM6 A;  3BZK A;  1QSS A;  4I28 A;  3H4D A;  3AUO A;  3SD7 A;  1ZQS A;  3RJF A;  4QIW C;  9ICS A;  4I2J A;  4DSL A;  3M6Z A;  1HIW A;  3UMC A;  5KG7 A;  2RRD A;  4RQ4 A;  4KLE A;  2ZTE A;  2R18 A;  3CNH A;  4O3O A;  4QW8 A;  3OJS A;  4JUZ A;  3ZDD A;  2F1I A;  2ZIW A;  4MHV A;  4F50 A;  3PW2 A;  5KFZ A;  2BPG A;  3PO5 A;  9ICI A;  4ED3 A;  4CRX A;  2YMP A;  3K1Z A;  5ALU A; 
#chains in the Genus database with same CATH homology
 3GU3 A;  3IP4 B;  2G08 A;  4ACO A;  2Y0S F;  3N7P D;  3LYS A;  3SAH A;  2H3Q A;  3IG5 A;  2GH1 A;  2K4E A;  3CRX A;  5CRX A;  2JH1 A;  2KV2 A;  4U6P A;  2N1R A;  4FE3 A;  3AL0 B;  4QJF B;  4P0P B;  4PL1 A;  3SMV A;  5KL1 B;  3N7R C;  2ZXH A;  3D2N A;  1SZH A;  1WUD A;  2RHF A;  2DQN B;  4WJ3 B;  2XI9 A;  2ZIW B;  3RFA A;  2WAQ F;  1UPH A;  1D8B A;  2DGZ A;  2ZXI A;  3PSI A;  4KX3 A;  2K8A A;  3SQI A;  1PVP A;  1YT3 A;  3DEE A;  3LVW A;  2KIW A;  4AYB C;  2CN1 A;  2ZIX A;  1GO3 F;  2E1E A;  4PL2 A;  3IN5 A;  2E5S A;  2ZIU B;  3O0F A;  4CDG A;  2CPR A;  3N7S C;  2DF4 B;  2RP5 A;  1A6S A;  2VJ4 A;  2KJ8 A;  2ZG6 A;  2LHT A;  3C28 A;  2K89 A;  4BX9 C;  1IIP A;  5T14 A;  2HBJ A;  2F8L A;  2OYY A;  2KKV A;  2G09 A;  4IC9 A;  1KBU A;  3NRW A;  3CP8 A;  1Q3U A;  1MA7 A;  3HKZ C;  3KZX A;  2PMZ C;  3SAF A;  4FZM A;  1P7D A;  3PST A;  1DRG A;  2BDU A;  3F53 A;  2YB1 A;  3GZF A;  3VCB A;  1URJ A;  2M0N A;  2WB1 C;  2YX8 A;  2CRX A;  2OH2 A;  2JMG A;  1L6N A;  2KJ5 A;  2VIX A;  5HR6 A;  2XID A;  4JMU A;  2Y0S C;  1Q3V A;  4QIW F;  2ZIX B;  2KIC A;  2HBL A;  2YB4 A;  3PSF A;  2D6F C;  1PVR A;  4NWI A;  2G07 A;  4A8E A;  2Z7J A;  2H3F A;  3AQF A;  1ZQ1 C;  1TAM A;  4GFJ A;  2MRL A;  2ZIV A;  2W7O A;  4FZL A;  2LKY A;  3ALR A;  4P0Q B;  3ICX A;  4OJP A;  2GOL A;  2W03 A;  2WAQ C;  2KJ9 A;  1Z1B A;  3IG8 A;  4NV0 A;  2VKQ A;  2XIC A;  4KMO B;  5C0Y A;  3C29 A;  1A0P A;  4FZN A;  2JHD A;  1NZB A;  2A3V A;  2G5I B;  1ED1 A;  2KD1 A;  3T79 A;  3F2B A;  2G0A A;  3OPX A;  2LBO A;  2HBK A;  1XO0 A;  3VC8 A;  3RF9 A;  2K4H A;  4ICA A;  4P0P A;  2KVC A;  2E1F A;  2F77 X;  3AQE A;  5KL8 B;  4C0Z A;  4OJ5 A;  4OJL A;  3D2Q A;  2PMZ F;  1OUQ A;  2HOF A;  3SAG A;  4OJ6 A;  3F2C A;  2OM6 A;  3M7D A;  1F44 A;  3H0R B;  2OXO A;  2KNJ A;  2WB1 F;  2ZIU A;  1XNS A;  3F5A A;  3ONN A;  4CGZ A;  2H3Z A;  2VJ5 A;  4QIW C;  1HEK A;  2HOQ A;  4OJO A;  2KHV A;  3M6Z A;  3KFU F;  3L3F X;  1ECW A;  2W04 A;  5A0L A;  3PZP A;  1HIW A;  1CRX A;  2JH7 A;  4OO1 J;  1T94 A;  3PSP A;  2H3V A;  4NLB A;  2HBM A;  3H0M B;  3M6K A;  2RRD A;  4QNL A;  2KHQ A;  2LYA A;  4AYB F;  2KOB A;  4O3M A;  3H0L B;  4BUG A;  2R18 A;  2F2A B;  1PVQ A;  2NV3 A;  4BJQ A;  3D2S A;  4NLC A;  2K8C B;  1Z19 A;  2ZIW A;  3HKZ F;  3F5E A;  3MGV A;  3E0F A;  2HMX A;  2G06 A;  3LVV A;  2ZIV B;  2LYB A;  2G5H B;  2MA1 A;  3CYM A;  5HR7 A;  2F76 X;  2KEY A;  4U7C A;  2W7P A;  2KKP A;  4KX5 A;  2Q4T A;  2H3I A;  4CRX A;  3K1Z A;  3F2D A;  2XVT A;  2HOI A;  4P0Q A;  2K4I A;  2K8B B;  2JGA A;  3NUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...