2H3IA

Solution structure of the hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 34
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3iA00
1A6SA 2H3IA 4JMUA 1UPHA 2H3VA 2HMXA 2JMGA 1HIWA 2N1RA 1HEKA 2LYBA 2K4HA 1ED1A 2GOLA 1TAMA 1ECWA 2LYAA 4ICAA 1L6NA 2H3ZA 2H3FA 2K4IA 4IC9A 2K4EA 2NV3A 2H3QA
chains in the Genus database with same CATH superfamily
4IQTA 4P0PA 8ICQA 3F53A 3N4MB 3LWMA 4I2HA 5J2CA 8ICNA 3FDSA 3JPQA 2KVSA 4RQ1A 2P35A 2JZBA 9ICTA 5EE1A 1X9WA 5F9LA 3DDHA 2NO5A 3UXPA 5AM1A 5IIIA 4BWMA 3WKDA 1IIPA 3C5GA 2WF9A 3RFAA 1BGXT 3UMCA 3KKAC 2KHVA 1X6JA 3WK9A 7ICJA 2BCUA 2G09A 3NTUA 4B9LA 1NKBA 1TAMA 3HW8A 2ZIVB 3ORYA 2J6TA 4I2JA 4HAIA 2W11A 1WYGA 4QWDA 5KT7A 3WKAA 3PW2A 3TAPA 4I2CA 3WK8A 4AYBF 4G3IA 4DL7A 3HJEA 1PVPA 1L8LA 1U9LA 9ICIA 4C7YA 2C28A 3SAFA 1XO1A 5KNIA 4PL2A 1ZQSA 5J0PA 3ZD8A 2G06A 2LM4A 1UHUA 4M9HA 3JPRA 4RQ2A 3CRXA 5J8YC 2VJ5A 5BPCA 1Z00A 5E79U 1ZQHA 8ICAA 3TQ1A 4O9MA 2P66A 3MR2A 4DSJA 1NOMA 1N5WA 3THVA 3PR4A 2BPCA 5G5GA 4QW8A 5AI9A 2BGWA 2KNJA 2JV3A 1Z3EB 4O0IA 2E8MA 2PKEA 2ZIUB 2B21A 4UB1A 1ZETA 1SKWA 4DOCA 3BQ7A 2B0CA 4OJ5A 4F50A 1QLNA 3NRWA 9ICXA 4F71A 4RU9A 1A6SA 3SENA 1JXEA 1H38A 2ATLA 2BCVA 2HHUA 2EAMA 4EBDA 4WJ3B 2ZG6A 2VIXA 2GOLA 4UB4A 3QZ7A 2OWOA 4MF8A 5KT3A 5AKYA 3M8RA 1JI7A 4RZRA 3B0YA 1JN3A 2IOFK 1RZTA 2PFNA 3T3FA 2DWQA 4O5EA 1ZQGA 1ZQDA 4JWNA 2QB1A 7ICKA 3AN1A 2K8BB 1HUZA 4HYKA 3KHHA 4UASA 4F4KA 4CF3A 3KD3A 1A77A 3G6XA 2HVHA 1QCKA 2M9NA 5KFMA 4DFPA 3RJGA 2OXOA 4QW9A 1B0XA 3ZDBA 2JEGA 3C2KA 4Q43A 5CRXA 4GC6A 1MQ3A 7ICPA 2PFOA 5AKGA 3PMNA 1F44A 1TKDA 4PZOA 3H8JA 1ZQZA 4NM1A 5AIAA 4NL9C 3RJEA 2WF7A 9ICMA 5L1KA 1QSSA 4BJQA 4ECYA 2ZIXB 3GV7B 1MA7A 1P7DA 5J8YA 5J0OA 2YN4A 3M9OB 1RPLA 5AK5A 1CRXA 3WK6A 8ICJA 3RBDA 4UAUA 3OJUA 3SEIA 2HBKA 1NK4A 1HUOA 1DRGA 1D8LA 3B0XA 3E58A 2VKQA 2C2DA 3F5EA 3KZXA 4XQ8A 2OEHA 4DOBA 2FPMA 4DF4A 2PI4A 1Z00B 2E8PA 9ICJA 4I2AA 2PFQA 1K1SA 2RQ5A 2DQNB 3OPXA 2H3ZA 1IXRA 5DLFA 4ED7A 4CGZA 3KHRA 3RJFA 4O5CA 2KIVA 1BPDA 5DQIA 5KL1B 3E2EA 2I1QA 3TKAA 1BNPA 3ED5A 2LM1A 5DG9A 7ICNA 2K4HA 5IILA 4YMNA 1V38A 5F3XB 4O3QA 1LB2B 4CNQA 3BZCA 2IOHA 2XIDA 2PMZF 4MFFA 4KLQA 2PXIA 3C2MA 4IQUA 4NV0A 4QZGA 4BDPA 3GU3A 3NGDA 1VDVA 2KFZA 2QARB 2XGPA 4IQVA 4JUZA 2WTFA 2KFNA 3QEBZ 4M9JA 4M04A 1SV0C 1ZQXA 1MC8A 2DBYA 2G5HB 1FFVA 1O03A 4O3RA 5J2EA 4BXOB 1ZQAA 5KG3A 1COOA 4YMOA 4DSIA 4PPXA 5DBBA 5ALWA 5J2BA 2W9BA 3RRGA 5J2GA 4ED8A 3RRHA 1ZQFA 5ALVA 1N63A 1XSPA 2O6KA 2G5IB 3WKEA 2HHXA 3KHGA 1ZQLA 2PI5A 8ICIA 1IG6A 3KOOA 4C4RA 1NZBA 4Q44A 2HBJA 2I6XA 5J0RA 4EYIB 2YB4A 1FFUA 4IL6U 3LVWA 5ALPA 4R8UB 5DG7A 1DK2A 2WF6A 3EZ5A 5AM5A 1N60A 1KL9A 5JUMA 3I76A 1NKCA 2KIWA 5DDYA 1PZNA 5J0UA 3M9NB 2VA2A 2KICA 1URJA 3Q8SB 3OSPA 4IR1A 3D2SA 1ED1A 3RB6A 2FPKA 4DWIA 4KLLA 3ZDAA 3ALRA 3U26A 3Q8PB 3UMBA 2MAXA 3T5JA 2KHQA 2BKEA 5JU5A 3UM9A 1L3VA 4BUGA 3MABA 1D9FA 5ALYA 1S0OA 3T5HA 3SI8A 1S10A 3GFKB 1U45A 4KLMA 1S0NA 4Q8FA 5B66U 2H5XA 3BDPA 2EH9A 3PY8A 1SZPA 3R9KA 2AGPA 4OJPA 5GTHU 1HJPA 2R8HA 4YG2A 3A0BU 5T14A 3FAHA 2C2RA 1KW4A 4DSLA 3GZFA 5EWGA 1VLBA 4Y2UA 4O3PA 3ISCA 4RPZA 2F8LA 2W04A 1NK6A 8ICEA 5KFJA 3WK5A 1ZD2P 4GC7A 5TISU 4UBCA 4E0DA 1S77D 2Y0SF 2KOBA 3N7RC 4DL2A 5DBCA 2KG5A 3AUOA 2W8LA 1ZQTA 4DL5A 1HIWA 3AMZA 4JV2A 5EOZA 1X6IA 3ZDEA 1S0VA 4C0ZA 2R8GA 4DS5A 1XU4A 4RQNA 2BQRA 5GTIU 2ODGA 8ICTA 5CJ7A 3SV3A 5C0YA 1IV8A 2ZTEA 2I9GA 3LYSA 3T5LA 3RJHA 5KG1A 4US9A 1A76A 1RXWA 1NK8A 2WB1C 4GXJA 2KTQA 3OGUA 8ICZA 3EUB2 4TQRA 1HEKA 4CCHA 1V9PA 4KLEA 2R18A 2ISPA 1PK1B 2P6UA 2HBLA 4ICAA 4YXMA 1NK7A 1MN8A 4DSKA 2KV2A 3GQCA 1KN5A 2E1FA 2JXJA 1ZQUA 3H40A 1AROP 3ONNA 1X9SA 2Y1JA 4QWBA 1TK8A 1TAUA 2F77X 2WAQF 4LJXA 2XI9A 4KMOB 5ALLA 4FZMA 2RDIA 4F4YA 3KFUF 3Q8RB 4F5OA 1SWWA 3M9MB 1S8OA 4F4ZA 2CPRA 5J0SA 5KAIU 2W9AA 2HOQA 5TZVA 5D4BA 4RT2A 2FLNA 3AQEA 2YMPA 2HHQA 7ICOA 2WF5A 4F2SA 2W03A 5KFDA 3T5KA 4MFAA 1RYUA 3WKCA 1L7NA 1OUQA 3MC1A 3UMGA 2KN7A 4DSFA 3AM9A 1X9MA 2KJ5A 1N2XA 4QJFB 4Y2JA 3GILA 4ZOHC 4ECUA 4EX6A 1XNSA 5KFOA 5D49A 1UPHA 5L1LA 2W55A 5KL8B 3HKZF 2IHNA 5KG0A 1QQ6A 4FS1A 3K4GA 2W9BB 4RUCA 4FZLA 3LVVA 2ASDA 3IN5A 4FBTA 3AU6A 1B43A 3KBBA 1NK0A 3CYMA 5KFVA 3UXNA 2W43A 1X9XA 4Z6EA 4ECVA 2EANA 5ALNA 3OJSA 5J0XA 3MDAA 3CP8A 2UVRA 8ICXA 2BPGA 1N5XA 5DLGA 4R8UA 4UB2A 1BVSA 3L3FX 2KKPA 2IOFA 1PVRA 5HP4A 3QUTA 7ICGA 5DB7A 3ZI4A 1A0PA 3PO4A 5FP0A 3PVXA 1J2MA 1L8OA 3D6JA 3QE9Y 4B9VA 4DOAA 1ZQYA 4RQ0A 3UQ0A 5AI6A 5D46A 4UB8U 1SZHA 3M6ZA 4IRDA 5ALRA 4B9SA 5KT2A 1Q8KA 3GV5B 1LKYB 4RPYA 1RG6A 5BOLA 4OO1J 3NUQA 3QNMA 2V9WA 4QZEA 4I2GA 5AKJA 4YR3A 2OCEA 2AGQA 2G07A 3IP4B 1S9FA 5CHGA 4Y2XA 3RB3A 5DDMA 2KSOA 4M6WB 3I1YA 1ZQCA 1RDFA 4U6PA 8ICHA 3H0RB 2W7PA 4QZ9A 4UQGA 4I2EA 4Y2RA 2JH1A 4QZFA 2JH7A 3RB0A 1AQ6A 4J9RA 1WWVA 5KFSA 2AH5A 4RQ6A 1O08A 9ICGA 2K4EA 2CN1A 3QU7A 3QU4A 2ZXHA 5IIOA 5AK4A 3RAQA 4FFDA 3RH5A 5ALKA 3N97B 1N61A 2E5SA 2Y0SC 2OYYA 3EWAA 5DGAA 4UAWA 2KE7A 4EZ9A 5EE9A 4YD1A 4CE6A 1WG8A 2MSNA 5ALDA 5KFPA 2RRDA 4DF8A 9ICNA 3PSFA 7ICIA 1UA1A 2HHVA 2V4QA 4PH5A 1F5SA 1F0MA 1KKXA 3UPQA 5ALSA 5AKIA 1Q46A 1S0MA 4TUQA 2ZXIA 2PFPA 2XY5A 3TAQA 1PK1A 9ICLA 5J2JA 1S5LU 1NKEA 5DB8A 3HILA 3MFIA 2YMMA 2BHNA 5J0WA 3IG5A 3A0HU 2R8IA 2KVCA 2E8OA 2A1JA 5KAFU 1ZQVA 1T4GA 2FMSA 5L1JA 1QTMA 4KN4A 3IM1A 4A8EA 4Y2SA 2K8AA 1Z19A 5J2AA 7ICTA 2M0NA 3RAXA 4M0AA 2XVTA 2K4IA 2E3TA 5J2IA 4ED3A 2ZIWA 2LI6A 3TI0A 5BOMA 9ICEA 2KMDA 4FE3A 1CEZA 2JGAA 1WUDA 4J9OA 4Y2PA 1WCLA 1KSPA 3JPOA 5KG2A 1ZQOA 4JMUA 4DLEA 2QARA 4DO9A 3FM9A 3WK7A 4J9QA 5CEHA 3MBYA 4ED1A 2MA1A 4TQSA 9ICCA 1KRPA 4F3OA 5J29A 2KJ9A 1NJZA 1DXSA 3JPNA 4O3NA 4KLIA 3QUBA 3ISDA 1SL0A 8ICMA 4UAYA 3HRDD 5F9NA 1VJ5A 4OD0A 9ICQA 3G6VA 4USAA 4F2RA 4AYBC 5KFXA 3BJYA 2JR5A 3F2DA 5IIMA 4QWEA 3H7IA 2VA3A 3RR7A 3C29A 3H4DA 2FE9A 3GIJA 5KG6A 4IRKA 3PX4A 3MR3A 5KT6A 3HWTA 3CNHA 2ESEA 5EE0A 2AQ4A 3BS5A 1J2NA 4P0QB 4KLUA 4F5PA 4EBEA 1RYRA 4MFCA 3C23A 2K60A 1KFDA 4YR2A 5KT4A 3TADC 4P0QA 2EZXA 4UARA 1UCVA 3IHQB 4Y2YA 8ICOA 3PSPA 2DPIA 2F8KA 5KG7A 3V7KA 1U49A 2NYVA 3H0MB 4MEXA 4X5VA 5CA7A 2HCFA 3O0FA 5DQGA 1ZRNA 2WF8A 1QQ5A 7ICSA 1FO4A 4ECWA 7ICMA 7ICRA 3J81j 5J0QA 2WHEA 1V97A 5KFNA 5AI5A 1ZOLA 3OHBA 1JXLA 4OJOA 1Z1BA 4F93B 5ALIA 4GLXA 2BCSA 2FI1A 4I2BA 4RQ7A 3EPGA 3NRZA 1NZPA 4DFJA 4O3SA 4NLGA 5KG4A 4JWMA 3JPTA 4QIWC 3M7DA 1OXJA 4J9MA 2HHWA 1JUDA 2AHOB 5HMMA 3MFHA 5AK6A 2W54A 3V7JA 5AI0A 9ICKA 2FMPA 2AGOA 2ZIVA 5J0TA 5KFHA 4GXKA 8ICBA 1KEJA 1C7YA 5ALEA 3MDCA 3C1YA 3TARA 3H4BA 2KD1A 5DB6A 3F2BA 1JMSA 5ALMA 1EXNA 2ISOA 2JHDA 4DL4A 4M9GA 5KFBA 4IRCA 2A3VA 2XO7A 3MGHA 2OHFA 2C2EA 4P0PB 1XSNA 3M8SA 5ALZA 1SKSA 1TK5A 2W7OA 2NRWA 3GIIA 4F8RA 4XRHA 4EBCA 2YMLA 3SD7A 4ED2A 7ICLA 2W8KA 4KLFA 4UB3A 5JRTA 1L6NA 4F5RA 1ZQPA 1ZQKA 3JPPA 4YVZA 4ECRA 1LVHA 2YX8A 2DL0A 1BPXA 2ZIUA 4QWAA 2A19A 2ASLA 4KLOA 2WAQC 4QZCA 3C21A 3PR5B 4J9NA 5DBAA 2F44A 5AIBA 8ICFA 4M9NA 3QYPA 1NK9A 2KP7A 5CWRA 7ICEA 5ALHA 3KHLA 1FIQA 5AKEA 3ZDCA 2KK0A 3QXGA 4R64A 4PHPA 2LHTA 4DQIA 2NRXA 3PZPA 4DFMA 2JMGA 4EELA 4P4PA 3WKBA 1MQ2A 4XA5A 4C8OA 3M1YA 2LYAA 2K8CB 2EZYA 7ICUA 2BCRA 8ICVA 3HX0A 4Y2TA 3ZDDA 4YXJA 3UQ2A 4KLGA 9ICVA 1ZQNA 1IM4A 2R8KA 3RF9A 2H3IA 4LZDA 4DSEA 4YQWA 5H2FU 3L5KA 3PV8A 1ZQQA 4BXOA 5AKXA 4UATA 3DV9A 4DQPA 1XO0A 4J03A 3NVVA 4RQ4A 4EEYA 5C5JA 4PJ0U 2XY7A 2HVIA 1X40A 4RUAA 2LPEA 4PHEA 1X2IA 1ZJMA 4ECSA 2W9MA 2DKXA 2HW3A 1MSWD 9ICFA 2XGQA 2UVVA 2E8NA 1TK0A 2G0AA 4M2YA 2NRVA 5ALQA 1LKYA 4ECTA 1BPEA 1NI3A 1SV4A 4C7ZA 5DQHA 2AU0A 3F5AA 4KX3A 4C8MA 4B9NA 1BNOA 1B4FA 3V6JA 1ZQIA 5AI8A 1DK3A 4QNLA 5KFYA 3FC4A 4QZBA 2BCQA 4JV1A 3LWLA 2LBOA 4ECZA 4OCZA 2A1AA 1SXDA 3D2QA 3M6KA 1PVQA 1N48A 3HKZC 1K5OA 4M6WA 2AXTU 4Z6CA 5ALUA 9ICSA 3RH4A 2Y1IA 2KZZA 3H8WA 1S97A 2MRLA 5AKHA 4P2HA 3SR6A 1CUKA 3T79A 2EQYA 1DGSA 4K4GA 1UT8A 8ICYA 5CR0A 3WK4A 3PW7A 2F1IA 5EE3A 2ZUCA 4NJ8A 4NLCA 5KFIA 1XS9D 5HR7A 1ZD3A 3AU2A 2NRTA 4MF2A 1RQLA 1TAQA 4I2IA 3KKAA 3PSIA 2ZTDA 3C28A 5AICA 3GIMA 4NXZA 4IS7A 9ICPA 3RJJA 2BQ3A 4JK1A 5L9XA 4F4XA 3LK9A 3N7PD 2V4RA 2CRXA 3BS5B 1J97A 2FLLA 5HMLA 3MR5A 4QWCA 1JROA 4RQ5A 4DEZA 2ES6A 2DGZA 4KLJA 1DGJA 4PL1A 4NM2A 5ALJA 4ELUA 9ICRA 3IRUA 2RP5A 3BZKA 5IIJA 3GIKA 3VC8A 2GWSA 5HHIA 2Q0ZX 4LVSA 4YFKA 4UB5A 4I2DA 4EZ6A 4R65A 3RTVA 3RR8A 3RH6A 1BPYA 1Y88A 4B6JA 1Q3UA 1YT3A 4LZGA 1COKA 4BGDA 2DUYA 1RYSA 4DQSA 1SV0A 4RNOA 2IBKA 1KLNA 3PNCA 2PMZC 2VJ4A 4PZNA 3KTQA 8ICCA 4GXIA 1ZQEA 2Z7JA 3GV8B 2B6GA 4RPXA 2FPLA 1T7PA 1D9DA 1X42A 4EYHB 2BR0A 2KKVA 3RJIA 2ASJA 5DG8A 1TE2A 1N62A 2IA6A 2HBMA 4K4HA 9ICWA 3H0LB 5KFZA 3PSTA 4IQWA 2HMXA 5KT5A 1WWUA 4PGYA 4FZNA 7ICQA 1K1QA 4Z6FA 2G08A 4GIBA 2EDUA 3D2NA 1V85A 3ETRA 5ALFA 3BQ2A 4J9LA 1CI4A 1T3NA 4I2FA 4DS4A 1GO3F 2OM6A 2NO4A 2N1RA 4F72A 1D8YA 1NJWA 1NJYA 4U7CA 2F1HA 3Q8QB 4B9TA 4F5NA 2HHTA 3TACB 3V6HA 3IV6A 1SKRA 3K1ZA 4NWIA 1TVAA 1LV5A 1M6YA 1UA0A 4ELTA 4YN4A 2LKYA 2XC9A 3AQFA 3TFRA 4FBUA 5J2FA 1KBUA 1KFSA 2HSZA 4NL9A 4ACOA 4UAVA 1PUZA 4B9UA 1NJXA 3N7SC 5L1IA 1Z4OA 1U48A 4ECQA 4C80A 4UBBA 2F76X 3NS1A 1ZYQA 5KFEA 2ZUDA 4FS2A 2DKZA 3OTQA 5KFKA 2OH2A 3GDXA 2JEJA 2ZTCA 2AQ0A 3L4PA 2UVUA 2F1JA 4C8NA 3QU2A 2GH1A 2KZMA 5CB1A 3HT3A 7ICHA 5AKKA 4DL3A 1X66A 5EWFA 1QQ7A 3AL0B 2RHFA 2H3QA 4M9LA 4KLTA 4QZAA 1Z4NA 2D6FC 2YQEA 4UB6U 3MR6A 5AM0A 3H8MA 2W9CA 4DCCA 2E1EA 4R66A 4QZDA 4YR0A 2CXYA 4I27A 3BS7A 2K89A 1NK5A 2C22A 3LDAA 1SL1A 3Q8MA 2MU2A 3KZIU 3K75D 2NRZA 5KFAA 1SXEA 5J2DA 3BQTA 4KLSA 5KFTA 2GO7A 5AM2A 2DPJA 2HHSA 3PMLA 2XCAA 5K4LA 2JEIA 4CDGA 2ZIWB 3SMVA 2J6UA 4Y2QA 3SV4A 2UVWA 3RB4A 3Q8LA 4NY8A 4BX9C 1QH9A 3PW4A 1SB3C 5JTIA 4O3MA 1L7OA 2H3VA 4OJ6A 3G6YA 4DFKA 3TANA 1SIJA 2DFLA 1KQQA 5KFWA 2XCPA 3QU9A 2L5YA 3WU2U 2Y9TA 3V6KA 4UW9A 4J9SA 4EX7A 3UXOA 2QLTA 1KDHA 3K1RB 1ZXIA 5A0LA 2VA8A 8ICPA 3RBEA 2HDOA 3V7LA 3PO5A 5DKWA 5DB9A 1U4BA 1DOQA 4NLZA 2D3DA 2YMQA 3VCBA 2D8CA 3QX7A 2K4PA 5AI4A 4F91B 4KITB 5J2KA 2Q4TA 8ICRA 4EEKA 1NNLA 2QB0A 5AKZA 2ZJAA 3BQ1A 4R63A 4DLGA 8ICKA 2FLPA 2YB1A 5G5HA 4RT3A 4QZHA 4IR9A 2W9CB 2ZUBA 7ICVA 2WB1F 5J2HA 4DFDA 3EYZA 2KSOB 3AEVA 5ALXA 3E0FA 3QZ8A 1ZJNA 4KLHA 1ZQ1C 1B22A 3TFSA 4EENA 2LYBA 4Z6DA 4K4IA 4NLBA 3OHAA 5J0YA 9ICUA 4ELVA 5KFFA 3NVWA 3CW2C 3NASA 4I29A 2HOIA 4CRXA 3ICXA 4YD2A 4RNMA 1WCNA 3EW9A 3NVYA 3HPOA 4ZH4A 3V72A 5AKLA 5HR6A 5B5EU 1T3QA 2XY6A 3F2CA 4US8A 3PX0A 4RNNA 2F3NA 3PW0A 2P6RA 1KTQA 8ICGA 4JB3A 2ZIXA 5KFQA 4Q8EA 8ICUA 4O5KA 3QUCA 2KJ8A 4YMMA 4TUPA 4C8KA 2KEYA 3I28A 1SGGA 1FEZA 1C20A 1U47A 4PHDA 4NLNA 3IG8A 1Q3VA 1KFTA 4BWJA 2DF4B 1L3TA 5DGBA 4PGXA 4RQMA 2R8JA 2MUTA 8ICSA 3C2LA 4GFJA 4IC9A 4KX5A 2FMQA 1S76D 4RQ8A 2F2AB 4I28A 2RDJA 2Y9UA 4CF4A 1ZQMA 3OSNA 4Y2VA 1JALA 2ALZA 3PX6A 1RQNA 1ZQBA 4B9MA 1YZ6A 5HNKA 2BQUA 3SAGA 5KFRA 4TUSA 4MEYA 3SYZA 1UQVA 2IMWP 5KFLA 4DQQA 1L3UA 4F5QA 1PK3A 4YP3A 4J9KA 3H8SA 2MUTB 5CP2A 1ZQWA 3DEEA 1JX4A 2A1JB 1T8EA 2VANA 3JPSA 5ALGA 4C8LA 5ALOA 1UT5A 1JIHA 4ECXA 2JZBB 1ZQJA 3PW5A 2KZ3A 4DL6A 1D8BA 2EAOA 2RLTA 4P4MA 1L3SA 9ICBA 1ZD4A 5IIKA 1QSLA 1QSYA 2EAPA 3C5FA 3SQIA 2QKQA 4P4OA 4KMUA 5KTQA 2HOFA 5AM4A 4Q45A 4PHAA 2W3RA 1T94A 5HHHA 4XUSA 5ALTA 1ZRMA 4F92B 2YTUA 4JV0A 1ECWA 3B9JA 5KFGA 1N56A 2EZZA 5L1MA 2QB0B 1ZD5A 4AP9A 4KLDA 4G9BA 2I5HA 1Z1VA 1XC9A 4NLKA 1BPBA 3IDWA 2BDPA 2ZJ5A 1SL2A 5KFUA 4C4SA 1SWVA 9ICHA 3MGIA 5IINA 3S6JA 4QZ8A 2BPFA 5AK3A 4QZIA 1BPZA 3EPIA 4CF5A 2W3SA 1TV9A 3NVZA 4TURA 2LYHA 1RM6C 2WFAA 1ZQRA 4C4TA 2J6SA 1JRPA 2HI0A 5EWEA 1OW5A 4MHVA 9ICAA 3TADA 4ED0A 2YY6A 5KG5A 3QUQA 4O3OA 2FJ6A 4KN7A 4OJLA 2NV3A 2ZJ8A 1XWLA 4UAZA 5AM3A 3ZD9A 4PGQA 3SAHA 4FO6A 3N28A 9ICOA 3ETLA 4ED6A 2GLEA 5AHXA 7ICFA 1RXVA 8ICWA 2BZFA 4RQ3A 2XICA 1L7MA 2FDRA 1L5UA 2IHMA 2JEFA 1L7PA 3HP6A 2LMRA 4QIWF 3Q8KA 3MGVA 4KTQA 4F4WA 3ISBA 8ICLA 2AJQA 3RJKA 4M47A 3QEAZ 2BDUA 1TFRA 3BQ0A 4DQRA 3FYHA 4J9PA 3SZ2A 2H3FA 1YZ7A 5KFCA 3QU5A 1XSLA 4YCXA 3C1ZA 2JRZA
chains in the Genus database with same CATH topology
4P0PA 2HBKA 2JGAA 2KJ8A 2KJ5A 2OH2A 4U6PA 1DRGA 1WUDA 2Y0SF 2KOBA 4QJFB 1A6SA 2KEYA 3H0RB 3N7RC 1NZBA 2W7PA 3F53A 1XNSA 2LHTA 4JMUA 5A0LA 2HBJA 2VKQA 1UPHA 3PZPA 2Z7JA 3F5EA 3KZXA 2ZG6A 3IG8A 2JH1A 2JMGA 1HIWA 2VIXA 3HKZF 2JH7A 5KL8B 1Q3VA 2GH1A 2DF4B 3M7DA 4QIWC 2YB4A 4NLCA 2GOLA 3LVWA 5HR7A 4C0ZA 2MA1A 2LYAA 2K8CB 3VCBA 2DQNB 3OPXA 2H3ZA 4FZLA 4GFJA 2KKVA 2K4EA 3LVVA 4IC9A 4KX5A 3IN5A 2CN1A 4CGZA 3AL0B 2RHFA 5C0YA 3PSIA 2KJ9A 2ZXHA 2H3QA 2F2AB 3LYSA 3C28A 3CYMA 2KIWA 3RF9A 2Q4TA 2HBMA 2H3IA 2ZIVA 5KL1B 2D6FC 1IIPA 3H0LB 2WB1C 2E5SA 2Y0SC 2KICA 2OYYA 3PSTA 3RFAA 4AYBC 2HMXA 1URJA 2KHVA 1HEKA 3F2DA 2E1EA 2KD1A 3CP8A 3N7PD 3F2BA 1ED1A 2K4HA 2R18A 2YB1A 2CRXA 2G09A 4FZNA 1TAMA 2K8BB 3C29A 1XO0A 3ALRA 2JHDA 2ZIVB 4WJ3B 2HBLA 4ICAA 2K89A 3D2SA 2G08A 2RRDA 2KV2A 2DGZA 2A3VA 3L3FX 2WB1F 2KKPA 3D2NA 2XIDA 4OJLA 4PL1A 3SAGA 1PVRA 3PSFA 2E1FA 2NV3A 2PMZF 4P0PB 2KHQA 4P0QB 2OXOA 2RP5A 1A0PA 3VC8A 4BUGA 3E0FA 3SAHA 3ONNA 4NV0A 2W7OA 1ZQ1C 4AYBF 3GU3A 5CRXA 1GO3F 2OM6A 2N1RA 1PVPA 2F77X 2ZXIA 2WAQF 3SAFA 2LYBA 4P0QA 2XI9A 2G0AA 4U7CA 4NLBA 4KMOB 3DEEA 4FZMA 4PL2A 3PSPA 1F44A 1L6NA 2G06A 3F5AA 4KX3A 4CDGA 2XICA 3H0MB 3KFUF 2ZIWB 2G5HB 3SMVA 1SZHA 3M6ZA 3K1ZA 4NWIA 2HOIA 3CRXA 2VJ5A 2CPRA 4CRXA 2YX8A 3IG5A 3O0FA 4QNLA 2HOQA 1D8BA 2KVCA 4BX9C 2ZIUA 3ICXA 2LKYA 4OJPA 4QIWF 1Q3UA 3AQEA 3MGVA 3AQFA 1YT3A 2LBOA 4BJQA 1KBUA 2ZIXB 5T14A 4O3MA 4OO1J 3D2QA 1MA7A 5HR6A 2H3VA 3NUQA 4OJ6A 3GZFA 3M6KA 2WAQC 4ACOA 2W03A 4A8EA 3SQIA 1PVQA 3F2CA 1P7DA 3HKZC 1Z19A 2K8AA 2KNJA 2BDUA 2F8LA 2HOFA 2W04A 2M0NA 2ZIUB 3N7SC 1CRXA 2G07A 2XVTA 3IP4B 1OUQA 2H3FA 2ZIXA 1T94A 2K4IA 4OJ5A 2F76X 2MRLA 4OJOA 2G5IB 3NRWA 2PMZC 2ZIWA 3T79A 2VJ4A 1Z1BA 1ECWA 4FE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6S A;  2H3I A;  4JMU A;  1UPH A;  2H3V A;  2HMX A;  2JMG A;  1HIW A;  2N1R A;  1HEK A;  2LYB A;  2K4H A;  1ED1 A;  2GOL A;  1TAM A;  1ECW A;  2LYA A;  4ICA A;  1L6N A;  2H3Z A;  2H3F A;  2K4I A;  4IC9 A;  2K4E A;  2NV3 A;  2H3Q A; 
#chains in the Genus database with same CATH topology
 4IQT A;  4P0P A;  8ICQ A;  3F53 A;  3N4M B;  3LWM A;  4I2H A;  5J2C A;  8ICN A;  3FDS A;  3JPQ A;  2KVS A;  4RQ1 A;  2P35 A;  2JZB A;  9ICT A;  5EE1 A;  1X9W A;  5F9L A;  3DDH A;  2NO5 A;  3UXP A;  5AM1 A;  5III A;  4BWM A;  3WKD A;  1IIP A;  3C5G A;  2WF9 A;  3RFA A;  1BGX T;  3UMC A;  3KKA C;  2KHV A;  1X6J A;  3WK9 A;  7ICJ A;  2BCU A;  2G09 A;  3NTU A;  4B9L A;  1NKB A;  1TAM A;  3HW8 A;  2ZIV B;  3ORY A;  2J6T A;  4I2J A;  4HAI A;  2W11 A;  1WYG A;  4QWD A;  5KT7 A;  3WKA A;  3PW2 A;  3TAP A;  4I2C A;  3WK8 A;  4AYB F;  4G3I A;  4DL7 A;  3HJE A;  1PVP A;  1L8L A;  1U9L A;  9ICI A;  4C7Y A;  2C28 A;  3SAF A;  1XO1 A;  5KNI A;  4PL2 A;  1ZQS A;  5J0P A;  3ZD8 A;  2G06 A;  2LM4 A;  1UHU A;  4M9H A;  3JPR A;  4RQ2 A;  3CRX A;  5J8Y C;  2VJ5 A;  5BPC A;  1Z00 A;  5E79 U;  1ZQH A;  8ICA A;  3TQ1 A;  4O9M A;  2P66 A;  3MR2 A;  4DSJ A;  1NOM A;  1N5W A;  3THV A;  3PR4 A;  2BPC A;  5G5G A;  4QW8 A;  5AI9 A;  2BGW A;  2KNJ A;  2JV3 A;  1Z3E B;  4O0I A;  2E8M A;  2PKE A;  2ZIU B;  2B21 A;  4UB1 A;  1ZET A;  1SKW A;  4DOC A;  3BQ7 A;  2B0C A;  4OJ5 A;  4F50 A;  1QLN A;  3NRW A;  9ICX A;  4F71 A;  4RU9 A;  1A6S A;  3SEN A;  1JXE A;  1H38 A;  2ATL A;  2BCV A;  2HHU A;  2EAM A;  4EBD A;  4WJ3 B;  2ZG6 A;  2VIX A;  2GOL A;  4UB4 A;  3QZ7 A;  2OWO A;  4MF8 A;  5KT3 A;  5AKY A;  3M8R A;  1JI7 A;  4RZR A;  3B0Y A;  1JN3 A;  2IOF K;  1RZT A;  2PFN A;  3T3F A;  2DWQ A;  4O5E A;  1ZQG A;  1ZQD A;  4JWN A;  2QB1 A;  7ICK A;  3AN1 A;  2K8B B;  1HUZ A;  4HYK A;  3KHH A;  4UAS A;  4F4K A;  4CF3 A;  3KD3 A;  1A77 A;  3G6X A;  2HVH A;  1QCK A;  2M9N A;  5KFM A;  4DFP A;  3RJG A;  2OXO A;  4QW9 A;  1B0X A;  3ZDB A;  2JEG A;  3C2K A;  4Q43 A;  5CRX A;  4GC6 A;  1MQ3 A;  7ICP A;  2PFO A;  5AKG A;  3PMN A;  1F44 A;  1TKD A;  4PZO A;  3H8J A;  1ZQZ A;  4NM1 A;  5AIA A;  4NL9 C;  3RJE A;  2WF7 A;  9ICM A;  5L1K A;  1QSS A;  4BJQ A;  4ECY A;  2ZIX B;  3GV7 B;  1MA7 A;  1P7D A;  5J8Y A;  5J0O A;  2YN4 A;  3M9O B;  1RPL A;  5AK5 A;  1CRX A;  3WK6 A;  8ICJ A;  3RBD A;  4UAU A;  3OJU A;  3SEI A;  2HBK A;  1NK4 A;  1HUO A;  1DRG A;  1D8L A;  3B0X A;  3E58 A;  2VKQ A;  2C2D A;  3F5E A;  3KZX A;  4XQ8 A;  2OEH A;  4DOB A;  2FPM A;  4DF4 A;  2PI4 A;  1Z00 B;  2E8P A;  9ICJ A;  4I2A A;  2PFQ A;  1K1S A;  2RQ5 A;  2DQN B;  3OPX A;  2H3Z A;  1IXR A;  5DLF A;  4ED7 A;  4CGZ A;  3KHR A;  3RJF A;  4O5C A;  2KIV A;  1BPD A;  5DQI A;  5KL1 B;  3E2E A;  2I1Q A;  3TKA A;  1BNP A;  3ED5 A;  2LM1 A;  5DG9 A;  7ICN A;  2K4H A;  5IIL A;  4YMN A;  1V38 A;  5F3X B;  4O3Q A;  1LB2 B;  4CNQ A;  3BZC A;  2IOH A;  2XID A;  2PMZ F;  4MFF A;  4KLQ A;  2PXI A;  3C2M A;  4IQU A;  4NV0 A;  4QZG A;  4BDP A;  3GU3 A;  3NGD A;  1VDV A;  2KFZ A;  2QAR B;  2XGP A;  4IQV A;  4JUZ A;  2WTF A;  2KFN A;  3QEB Z;  4M9J A;  4M04 A;  1SV0 C;  1ZQX A;  1MC8 A;  2DBY A;  2G5H B;  1FFV A;  1O03 A;  4O3R A;  5J2E A;  4BXO B;  1ZQA A;  5KG3 A;  1COO A;  4YMO A;  4DSI A;  4PPX A;  5DBB A;  5ALW A;  5J2B A;  2W9B A;  3RRG A;  5J2G A;  4ED8 A;  3RRH A;  1ZQF A;  5ALV A;  1N63 A;  1XSP A;  2O6K A;  2G5I B;  3WKE A;  2HHX A;  3KHG A;  1ZQL A;  2PI5 A;  8ICI A;  1IG6 A;  3KOO A;  4C4R A;  1NZB A;  4Q44 A;  2HBJ A;  2I6X A;  5J0R A;  4EYI B;  2YB4 A;  1FFU A;  4IL6 U;  3LVW A;  5ALP A;  4R8U B;  5DG7 A;  1DK2 A;  2WF6 A;  3EZ5 A;  5AM5 A;  1N60 A;  1KL9 A;  5JUM A;  3I76 A;  1NKC A;  2KIW A;  5DDY A;  1PZN A;  5J0U A;  3M9N B;  2VA2 A;  2KIC A;  1URJ A;  3Q8S B;  3OSP A;  4IR1 A;  3D2S A;  1ED1 A;  3RB6 A;  2FPK A;  4DWI A;  4KLL A;  3ZDA A;  3ALR A;  3U26 A;  3Q8P B;  3UMB A;  2MAX A;  3T5J A;  2KHQ A;  2BKE A;  5JU5 A;  3UM9 A;  1L3V A;  4BUG A;  3MAB A;  1D9F A;  5ALY A;  1S0O A;  3T5H A;  3SI8 A;  1S10 A;  3GFK B;  1U45 A;  4KLM A;  1S0N A;  4Q8F A;  5B66 U;  2H5X A;  3BDP A;  2EH9 A;  3PY8 A;  1SZP A;  3R9K A;  2AGP A;  4OJP A;  5GTH U;  1HJP A;  2R8H A;  4YG2 A;  3A0B U;  5T14 A;  3FAH A;  2C2R A;  1KW4 A;  4DSL A;  3GZF A;  5EWG A;  1VLB A;  4Y2U A;  4O3P A;  3ISC A;  4RPZ A;  2F8L A;  2W04 A;  1NK6 A;  8ICE A;  5KFJ A;  3WK5 A;  1ZD2 P;  4GC7 A;  5TIS U;  4UBC A;  4E0D A;  1S77 D;  2Y0S F;  2KOB A;  3N7R C;  4DL2 A;  5DBC A;  2KG5 A;  3AUO A;  2W8L A;  1ZQT A;  4DL5 A;  1HIW A;  3AMZ A;  4JV2 A;  5EOZ A;  1X6I A;  3ZDE A;  1S0V A;  4C0Z A;  2R8G A;  4DS5 A;  1XU4 A;  4RQN A;  2BQR A;  5GTI U;  2ODG A;  8ICT A;  5CJ7 A;  3SV3 A;  5C0Y A;  1IV8 A;  2ZTE A;  2I9G A;  3LYS A;  3T5L A;  3RJH A;  5KG1 A;  4US9 A;  1A76 A;  1RXW A;  1NK8 A;  2WB1 C;  4GXJ A;  2KTQ A;  3OGU A;  8ICZ A;  3EUB 2;  4TQR A;  1HEK A;  4CCH A;  1V9P A;  4KLE A;  2R18 A;  2ISP A;  1PK1 B;  2P6U A;  2HBL A;  4ICA A;  4YXM A;  1NK7 A;  1MN8 A;  4DSK A;  2KV2 A;  3GQC A;  1KN5 A;  2E1F A;  2JXJ A;  1ZQU A;  3H40 A;  1ARO P;  3ONN A;  1X9S A;  2Y1J A;  4QWB A;  1TK8 A;  1TAU A;  2F77 X;  2WAQ F;  4LJX A;  2XI9 A;  4KMO B;  5ALL A;  4FZM A;  2RDI A;  4F4Y A;  3KFU F;  3Q8R B;  4F5O A;  1SWW A;  3M9M B;  1S8O A;  4F4Z A;  2CPR A;  5J0S A;  5KAI U;  2W9A A;  2HOQ A;  5TZV A;  5D4B A;  4RT2 A;  2FLN A;  3AQE A;  2YMP A;  2HHQ A;  7ICO A;  2WF5 A;  4F2S A;  2W03 A;  5KFD A;  3T5K A;  4MFA A;  1RYU A;  3WKC A;  1L7N A;  1OUQ A;  3MC1 A;  3UMG A;  2KN7 A;  4DSF A;  3AM9 A;  1X9M A;  2KJ5 A;  1N2X A;  4QJF B;  4Y2J A;  3GIL A;  4ZOH C;  4ECU A;  4EX6 A;  1XNS A;  5KFO A;  5D49 A;  1UPH A;  5L1L A;  2W55 A;  5KL8 B;  3HKZ F;  2IHN A;  5KG0 A;  1QQ6 A;  4FS1 A;  3K4G A;  2W9B B;  4RUC A;  4FZL A;  3LVV A;  2ASD A;  3IN5 A;  4FBT A;  3AU6 A;  1B43 A;  3KBB A;  1NK0 A;  3CYM A;  5KFV A;  3UXN A;  2W43 A;  1X9X A;  4Z6E A;  4ECV A;  2EAN A;  5ALN A;  3OJS A;  5J0X A;  3MDA A;  3CP8 A;  2UVR A;  8ICX A;  2BPG A;  1N5X A;  5DLG A;  4R8U A;  4UB2 A;  1BVS A;  3L3F X;  2KKP A;  2IOF A;  1PVR A;  5HP4 A;  3QUT A;  7ICG A;  5DB7 A;  3ZI4 A;  1A0P A;  3PO4 A;  5FP0 A;  3PVX A;  1J2M A;  1L8O A;  3D6J A;  3QE9 Y;  4B9V A;  4DOA A;  1ZQY A;  4RQ0 A;  3UQ0 A;  5AI6 A;  5D46 A;  4UB8 U;  1SZH A;  3M6Z A;  4IRD A;  5ALR A;  4B9S A;  5KT2 A;  1Q8K A;  3GV5 B;  1LKY B;  4RPY A;  1RG6 A;  5BOL A;  4OO1 J;  3NUQ A;  3QNM A;  2V9W A;  4QZE A;  4I2G A;  5AKJ A;  4YR3 A;  2OCE A;  2AGQ A;  2G07 A;  3IP4 B;  1S9F A;  5CHG A;  4Y2X A;  3RB3 A;  5DDM A;  2KSO A;  4M6W B;  3I1Y A;  1ZQC A;  1RDF A;  4U6P A;  8ICH A;  3H0R B;  2W7P A;  4QZ9 A;  4UQG A;  4I2E A;  4Y2R A;  2JH1 A;  4QZF A;  2JH7 A;  3RB0 A;  1AQ6 A;  4J9R A;  1WWV A;  5KFS A;  2AH5 A;  4RQ6 A;  1O08 A;  9ICG A;  2K4E A;  2CN1 A;  3QU7 A;  3QU4 A;  2ZXH A;  5IIO A;  5AK4 A;  3RAQ A;  4FFD A;  3RH5 A;  5ALK A;  3N97 B;  1N61 A;  2E5S A;  2Y0S C;  2OYY A;  3EWA A;  5DGA A;  4UAW A;  2KE7 A;  4EZ9 A;  5EE9 A;  4YD1 A;  4CE6 A;  1WG8 A;  2MSN A;  5ALD A;  5KFP A;  2RRD A;  4DF8 A;  9ICN A;  3PSF A;  7ICI A;  1UA1 A;  2HHV A;  2V4Q A;  4PH5 A;  1F5S A;  1F0M A;  1KKX A;  3UPQ A;  5ALS A;  5AKI A;  1Q46 A;  1S0M A;  4TUQ A;  2ZXI A;  2PFP A;  2XY5 A;  3TAQ A;  1PK1 A;  9ICL A;  5J2J A;  1S5L U;  1NKE A;  5DB8 A;  3HIL A;  3MFI A;  2YMM A;  2BHN A;  5J0W A;  3IG5 A;  3A0H U;  2R8I A;  2KVC A;  2E8O A;  2A1J A;  5KAF U;  1ZQV A;  1T4G A;  2FMS A;  5L1J A;  1QTM A;  4KN4 A;  3IM1 A;  4A8E A;  4Y2S A;  2K8A A;  1Z19 A;  5J2A A;  7ICT A;  2M0N A;  3RAX A;  4M0A A;  2XVT A;  2K4I A;  2E3T A;  5J2I A;  4ED3 A;  2ZIW A;  2LI6 A;  3TI0 A;  5BOM A;  9ICE A;  2KMD A;  4FE3 A;  1CEZ A;  2JGA A;  1WUD A;  4J9O A;  4Y2P A;  1WCL A;  1KSP A;  3JPO A;  5KG2 A;  1ZQO A;  4JMU A;  4DLE A;  2QAR A;  4DO9 A;  3FM9 A;  3WK7 A;  4J9Q A;  5CEH A;  3MBY A;  4ED1 A;  2MA1 A;  4TQS A;  9ICC A;  1KRP A;  4F3O A;  5J29 A;  2KJ9 A;  1NJZ A;  1DXS A;  3JPN A;  4O3N A;  4KLI A;  3QUB A;  3ISD A;  1SL0 A;  8ICM A;  4UAY A;  3HRD D;  5F9N A;  1VJ5 A;  4OD0 A;  9ICQ A;  3G6V A;  4USA A;  4F2R A;  4AYB C;  5KFX A;  3BJY A;  2JR5 A;  3F2D A;  5IIM A;  4QWE A;  3H7I A;  2VA3 A;  3RR7 A;  3C29 A;  3H4D A;  2FE9 A;  3GIJ A;  5KG6 A;  4IRK A;  3PX4 A;  3MR3 A;  5KT6 A;  3HWT A;  3CNH A;  2ESE A;  5EE0 A;  2AQ4 A;  3BS5 A;  1J2N A;  4P0Q B;  4KLU A;  4F5P A;  4EBE A;  1RYR A;  4MFC A;  3C23 A;  2K60 A;  1KFD A;  4YR2 A;  5KT4 A;  3TAD C;  4P0Q A;  2EZX A;  4UAR A;  1UCV A;  3IHQ B;  4Y2Y A;  8ICO A;  3PSP A;  2DPI A;  2F8K A;  5KG7 A;  3V7K A;  1U49 A;  2NYV A;  3H0M B;  4MEX A;  4X5V A;  5CA7 A;  2HCF A;  3O0F A;  5DQG A;  1ZRN A;  2WF8 A;  1QQ5 A;  7ICS A;  1FO4 A;  4ECW A;  7ICM A;  7ICR A;  3J81 j;  5J0Q A;  2WHE A;  1V97 A;  5KFN A;  5AI5 A;  1ZOL A;  3OHB A;  1JXL A;  4OJO A;  1Z1B A;  4F93 B;  5ALI A;  4GLX A;  2BCS A;  2FI1 A;  4I2B A;  4RQ7 A;  3EPG A;  3NRZ A;  1NZP A;  4DFJ A;  4O3S A;  4NLG A;  5KG4 A;  4JWM A;  3JPT A;  4QIW C;  3M7D A;  1OXJ A;  4J9M A;  2HHW A;  1JUD A;  2AHO B;  5HMM A;  3MFH A;  5AK6 A;  2W54 A;  3V7J A;  5AI0 A;  9ICK A;  2FMP A;  2AGO A;  2ZIV A;  5J0T A;  5KFH A;  4GXK A;  8ICB A;  1KEJ A;  1C7Y A;  5ALE A;  3MDC A;  3C1Y A;  3TAR A;  3H4B A;  2KD1 A;  5DB6 A;  3F2B A;  1JMS A;  5ALM A;  1EXN A;  2ISO A;  2JHD A;  4DL4 A;  4M9G A;  5KFB A;  4IRC A;  2A3V A;  2XO7 A;  3MGH A;  2OHF A;  2C2E A;  4P0P B;  1XSN A;  3M8S A;  5ALZ A;  1SKS A;  1TK5 A;  2W7O A;  2NRW A;  3GII A;  4F8R A;  4XRH A;  4EBC A;  2YML A;  3SD7 A;  4ED2 A;  7ICL A;  2W8K A;  4KLF A;  4UB3 A;  5JRT A;  1L6N A;  4F5R A;  1ZQP A;  1ZQK A;  3JPP A;  4YVZ A;  4ECR A;  1LVH A;  2YX8 A;  2DL0 A;  1BPX A;  2ZIU A;  4QWA A;  2A19 A;  2ASL A;  4KLO A;  2WAQ C;  4QZC A;  3C21 A;  3PR5 B;  4J9N A;  5DBA A;  2F44 A;  5AIB A;  8ICF A;  4M9N A;  3QYP A;  1NK9 A;  2KP7 A;  5CWR A;  7ICE A;  5ALH A;  3KHL A;  1FIQ A;  5AKE A;  3ZDC A;  2KK0 A;  3QXG A;  4R64 A;  4PHP A;  2LHT A;  4DQI A;  2NRX A;  3PZP A;  4DFM A;  2JMG A;  4EEL A;  4P4P A;  3WKB A;  1MQ2 A;  4XA5 A;  4C8O A;  3M1Y A;  2LYA A;  2K8C B;  2EZY A;  7ICU A;  2BCR A;  8ICV A;  3HX0 A;  4Y2T A;  3ZDD A;  4YXJ A;  3UQ2 A;  4KLG A;  9ICV A;  1ZQN A;  1IM4 A;  2R8K A;  3RF9 A;  2H3I A;  4LZD A;  4DSE A;  4YQW A;  5H2F U;  3L5K A;  3PV8 A;  1ZQQ A;  4BXO A;  5AKX A;  4UAT A;  3DV9 A;  4DQP A;  1XO0 A;  4J03 A;  3NVV A;  4RQ4 A;  4EEY A;  5C5J A;  4PJ0 U;  2XY7 A;  2HVI A;  1X40 A;  4RUA A;  2LPE A;  4PHE A;  1X2I A;  1ZJM A;  4ECS A;  2W9M A;  2DKX A;  2HW3 A;  1MSW D;  9ICF A;  2XGQ A;  2UVV A;  2E8N A;  1TK0 A;  2G0A A;  4M2Y A;  2NRV A;  5ALQ A;  1LKY A;  4ECT A;  1BPE A;  1NI3 A;  1SV4 A;  4C7Z A;  5DQH A;  2AU0 A;  3F5A A;  4KX3 A;  4C8M A;  4B9N A;  1BNO A;  1B4F A;  3V6J A;  1ZQI A;  5AI8 A;  1DK3 A;  4QNL A;  5KFY A;  3FC4 A;  4QZB A;  2BCQ A;  4JV1 A;  3LWL A;  2LBO A;  4ECZ A;  4OCZ A;  2A1A A;  1SXD A;  3D2Q A;  3M6K A;  1PVQ A;  1N48 A;  3HKZ C;  1K5O A;  4M6W A;  2AXT U;  4Z6C A;  5ALU A;  9ICS A;  3RH4 A;  2Y1I A;  2KZZ A;  3H8W A;  1S97 A;  2MRL A;  5AKH A;  4P2H A;  3SR6 A;  1CUK A;  3T79 A;  2EQY A;  1DGS A;  4K4G A;  1UT8 A;  8ICY A;  5CR0 A;  3WK4 A;  3PW7 A;  2F1I A;  5EE3 A;  2ZUC A;  4NJ8 A;  4NLC A;  5KFI A;  1XS9 D;  5HR7 A;  1ZD3 A;  3AU2 A;  2NRT A;  4MF2 A;  1RQL A;  1TAQ A;  4I2I A;  3KKA A;  3PSI A;  2ZTD A;  3C28 A;  5AIC A;  3GIM A;  4NXZ A;  4IS7 A;  9ICP A;  3RJJ A;  2BQ3 A;  4JK1 A;  5L9X A;  4F4X A;  3LK9 A;  3N7P D;  2V4R A;  2CRX A;  3BS5 B;  1J97 A;  2FLL A;  5HML A;  3MR5 A;  4QWC A;  1JRO A;  4RQ5 A;  4DEZ A;  2ES6 A;  2DGZ A;  4KLJ A;  1DGJ A;  4PL1 A;  4NM2 A;  5ALJ A;  4ELU A;  9ICR A;  3IRU A;  2RP5 A;  3BZK A;  5IIJ A;  3GIK A;  3VC8 A;  2GWS A;  5HHI A;  2Q0Z X;  4LVS A;  4YFK A;  4UB5 A;  4I2D A;  4EZ6 A;  4R65 A;  3RTV A;  3RR8 A;  3RH6 A;  1BPY A;  1Y88 A;  4B6J A;  1Q3U A;  1YT3 A;  4LZG A;  1COK A;  4BGD A;  2DUY A;  1RYS A;  4DQS A;  1SV0 A;  4RNO A;  2IBK A;  1KLN A;  3PNC A;  2PMZ C;  2VJ4 A;  4PZN A;  3KTQ A;  8ICC A;  4GXI A;  1ZQE A;  2Z7J A;  3GV8 B;  2B6G A;  4RPX A;  2FPL A;  1T7P A;  1D9D A;  1X42 A;  4EYH B;  2BR0 A;  2KKV A;  3RJI A;  2ASJ A;  5DG8 A;  1TE2 A;  1N62 A;  2IA6 A;  2HBM A;  4K4H A;  9ICW A;  3H0L B;  5KFZ A;  3PST A;  4IQW A;  2HMX A;  5KT5 A;  1WWU A;  4PGY A;  4FZN A;  7ICQ A;  1K1Q A;  4Z6F A;  2G08 A;  4GIB A;  2EDU A;  3D2N A;  1V85 A;  3ETR A;  5ALF A;  3BQ2 A;  4J9L A;  1CI4 A;  1T3N A;  4I2F A;  4DS4 A;  1GO3 F;  2OM6 A;  2NO4 A;  2N1R A;  4F72 A;  1D8Y A;  1NJW A;  1NJY A;  4U7C A;  2F1H A;  3Q8Q B;  4B9T A;  4F5N A;  2HHT A;  3TAC B;  3V6H A;  3IV6 A;  1SKR A;  3K1Z A;  4NWI A;  1TVA A;  1LV5 A;  1M6Y A;  1UA0 A;  4ELT A;  4YN4 A;  2LKY A;  2XC9 A;  3AQF A;  3TFR A;  4FBU A;  5J2F A;  1KBU A;  1KFS A;  2HSZ A;  4NL9 A;  4ACO A;  4UAV A;  1PUZ A;  4B9U A;  1NJX A;  3N7S C;  5L1I A;  1Z4O A;  1U48 A;  4ECQ A;  4C80 A;  4UBB A;  2F76 X;  3NS1 A;  1ZYQ A;  5KFE A;  2ZUD A;  4FS2 A;  2DKZ A;  3OTQ A;  5KFK A;  2OH2 A;  3GDX A;  2JEJ A;  2ZTC A;  2AQ0 A;  3L4P A;  2UVU A;  2F1J A;  4C8N A;  3QU2 A;  2GH1 A;  2KZM A;  5CB1 A;  3HT3 A;  7ICH A;  5AKK A;  4DL3 A;  1X66 A;  5EWF A;  1QQ7 A;  3AL0 B;  2RHF A;  2H3Q A;  4M9L A;  4KLT A;  4QZA A;  1Z4N A;  2D6F C;  2YQE A;  4UB6 U;  3MR6 A;  5AM0 A;  3H8M A;  2W9C A;  4DCC A;  2E1E A;  4R66 A;  4QZD A;  4YR0 A;  2CXY A;  4I27 A;  3BS7 A;  2K89 A;  1NK5 A;  2C22 A;  3LDA A;  1SL1 A;  3Q8M A;  2MU2 A;  3KZI U;  3K75 D;  2NRZ A;  5KFA A;  1SXE A;  5J2D A;  3BQT A;  4KLS A;  5KFT A;  2GO7 A;  5AM2 A;  2DPJ A;  2HHS A;  3PML A;  2XCA A;  5K4L A;  2JEI A;  4CDG A;  2ZIW B;  3SMV A;  2J6U A;  4Y2Q A;  3SV4 A;  2UVW A;  3RB4 A;  3Q8L A;  4NY8 A;  4BX9 C;  1QH9 A;  3PW4 A;  1SB3 C;  5JTI A;  4O3M A;  1L7O A;  2H3V A;  4OJ6 A;  3G6Y A;  4DFK A;  3TAN A;  1SIJ A;  2DFL A;  1KQQ A;  5KFW A;  2XCP A;  3QU9 A;  2L5Y A;  3WU2 U;  2Y9T A;  3V6K A;  4UW9 A;  4J9S A;  4EX7 A;  3UXO A;  2QLT A;  1KDH A;  3K1R B;  1ZXI A;  5A0L A;  2VA8 A;  8ICP A;  3RBE A;  2HDO A;  3V7L A;  3PO5 A;  5DKW A;  5DB9 A;  1U4B A;  1DOQ A;  4NLZ A;  2D3D A;  2YMQ A;  3VCB A;  2D8C A;  3QX7 A;  2K4P A;  5AI4 A;  4F91 B;  4KIT B;  5J2K A;  2Q4T A;  8ICR A;  4EEK A;  1NNL A;  2QB0 A;  5AKZ A;  2ZJA A;  3BQ1 A;  4R63 A;  4DLG A;  8ICK A;  2FLP A;  2YB1 A;  5G5H A;  4RT3 A;  4QZH A;  4IR9 A;  2W9C B;  2ZUB A;  7ICV A;  2WB1 F;  5J2H A;  4DFD A;  3EYZ A;  2KSO B;  3AEV A;  5ALX A;  3E0F A;  3QZ8 A;  1ZJN A;  4KLH A;  1ZQ1 C;  1B22 A;  3TFS A;  4EEN A;  2LYB A;  4Z6D A;  4K4I A;  4NLB A;  3OHA A;  5J0Y A;  9ICU A;  4ELV A;  5KFF A;  3NVW A;  3CW2 C;  3NAS A;  4I29 A;  2HOI A;  4CRX A;  3ICX A;  4YD2 A;  4RNM A;  1WCN A;  3EW9 A;  3NVY A;  3HPO A;  4ZH4 A;  3V72 A;  5AKL A;  5HR6 A;  5B5E U;  1T3Q A;  2XY6 A;  3F2C A;  4US8 A;  3PX0 A;  4RNN A;  2F3N A;  3PW0 A;  2P6R A;  1KTQ A;  8ICG A;  4JB3 A;  2ZIX A;  5KFQ A;  4Q8E A;  8ICU A;  4O5K A;  3QUC A;  2KJ8 A;  4YMM A;  4TUP A;  4C8K A;  2KEY A;  3I28 A;  1SGG A;  1FEZ A;  1C20 A;  1U47 A;  4PHD A;  4NLN A;  3IG8 A;  1Q3V A;  1KFT A;  4BWJ A;  2DF4 B;  1L3T A;  5DGB A;  4PGX A;  4RQM A;  2R8J A;  2MUT A;  8ICS A;  3C2L A;  4GFJ A;  4IC9 A;  4KX5 A;  2FMQ A;  1S76 D;  4RQ8 A;  2F2A B;  4I28 A;  2RDJ A;  2Y9U A;  4CF4 A;  1ZQM A;  3OSN A;  4Y2V A;  1JAL A;  2ALZ A;  3PX6 A;  1RQN A;  1ZQB A;  4B9M A;  1YZ6 A;  5HNK A;  2BQU A;  3SAG A;  5KFR A;  4TUS A;  4MEY A;  3SYZ A;  1UQV A;  2IMW P;  5KFL A;  4DQQ A;  1L3U A;  4F5Q A;  1PK3 A;  4YP3 A;  4J9K A;  3H8S A;  2MUT B;  5CP2 A;  1ZQW A;  3DEE A;  1JX4 A;  2A1J B;  1T8E A;  2VAN A;  3JPS A;  5ALG A;  4C8L A;  5ALO A;  1UT5 A;  1JIH A;  4ECX A;  2JZB B;  1ZQJ A;  3PW5 A;  2KZ3 A;  4DL6 A;  1D8B A;  2EAO A;  2RLT A;  4P4M A;  1L3S A;  9ICB A;  1ZD4 A;  5IIK A;  1QSL A;  1QSY A;  2EAP A;  3C5F A;  3SQI A;  2QKQ A;  4P4O A;  4KMU A;  5KTQ A;  2HOF A;  5AM4 A;  4Q45 A;  4PHA A;  2W3R A;  1T94 A;  5HHH A;  4XUS A;  5ALT A;  1ZRM A;  4F92 B;  2YTU A;  4JV0 A;  1ECW A;  3B9J A;  5KFG A;  1N56 A;  2EZZ A;  5L1M A;  2QB0 B;  1ZD5 A;  4AP9 A;  4KLD A;  4G9B A;  2I5H A;  1Z1V A;  1XC9 A;  4NLK A;  1BPB A;  3IDW A;  2BDP A;  2ZJ5 A;  1SL2 A;  5KFU A;  4C4S A;  1SWV A;  9ICH A;  3MGI A;  5IIN A;  3S6J A;  4QZ8 A;  2BPF A;  5AK3 A;  4QZI A;  1BPZ A;  3EPI A;  4CF5 A;  2W3S A;  1TV9 A;  3NVZ A;  4TUR A;  2LYH A;  1RM6 C;  2WFA A;  1ZQR A;  4C4T A;  2J6S A;  1JRP A;  2HI0 A;  5EWE A;  1OW5 A;  4MHV A;  9ICA A;  3TAD A;  4ED0 A;  2YY6 A;  5KG5 A;  3QUQ A;  4O3O A;  2FJ6 A;  4KN7 A;  4OJL A;  2NV3 A;  2ZJ8 A;  1XWL A;  4UAZ A;  5AM3 A;  3ZD9 A;  4PGQ A;  3SAH A;  4FO6 A;  3N28 A;  9ICO A;  3ETL A;  4ED6 A;  2GLE A;  5AHX A;  7ICF A;  1RXV A;  8ICW A;  2BZF A;  4RQ3 A;  2XIC A;  1L7M A;  2FDR A;  1L5U A;  2IHM A;  2JEF A;  1L7P A;  3HP6 A;  2LMR A;  4QIW F;  3Q8K A;  3MGV A;  4KTQ A;  4F4W A;  3ISB A;  8ICL A;  2AJQ A;  3RJK A;  4M47 A;  3QEA Z;  2BDU A;  1TFR A;  3BQ0 A;  4DQR A;  3FYH A;  4J9P A;  3SZ2 A;  2H3F A;  1YZ7 A;  5KFC A;  3QU5 A;  1XSL A;  4YCX A;  3C1Z A;  2JRZ A; 
#chains in the Genus database with same CATH homology
 4P0P A;  2HBK A;  2JGA A;  2KJ8 A;  2KJ5 A;  2OH2 A;  4U6P A;  1DRG A;  1WUD A;  2Y0S F;  2KOB A;  4QJF B;  1A6S A;  2KEY A;  3H0R B;  3N7R C;  1NZB A;  2W7P A;  3F53 A;  1XNS A;  2LHT A;  4JMU A;  5A0L A;  2HBJ A;  2VKQ A;  1UPH A;  3PZP A;  2Z7J A;  3F5E A;  3KZX A;  2ZG6 A;  3IG8 A;  2JH1 A;  2JMG A;  1HIW A;  2VIX A;  3HKZ F;  2JH7 A;  5KL8 B;  1Q3V A;  2GH1 A;  2DF4 B;  3M7D A;  4QIW C;  2YB4 A;  4NLC A;  2GOL A;  3LVW A;  5HR7 A;  4C0Z A;  2MA1 A;  2LYA A;  2K8C B;  3VCB A;  2DQN B;  3OPX A;  2H3Z A;  4FZL A;  4GFJ A;  2KKV A;  2K4E A;  3LVV A;  4IC9 A;  4KX5 A;  3IN5 A;  2CN1 A;  4CGZ A;  3AL0 B;  2RHF A;  5C0Y A;  3PSI A;  2KJ9 A;  2ZXH A;  2H3Q A;  2F2A B;  3LYS A;  3C28 A;  3CYM A;  2KIW A;  3RF9 A;  2Q4T A;  2HBM A;  2H3I A;  2ZIV A;  5KL1 B;  2D6F C;  1IIP A;  3H0L B;  2WB1 C;  2E5S A;  2Y0S C;  2KIC A;  2OYY A;  3PST A;  3RFA A;  4AYB C;  2HMX A;  1URJ A;  2KHV A;  1HEK A;  3F2D A;  2E1E A;  2KD1 A;  3CP8 A;  3N7P D;  3F2B A;  1ED1 A;  2K4H A;  2R18 A;  2YB1 A;  2CRX A;  2G09 A;  4FZN A;  1TAM A;  2K8B B;  3C29 A;  1XO0 A;  3ALR A;  2JHD A;  2ZIV B;  4WJ3 B;  2HBL A;  4ICA A;  2K89 A;  3D2S A;  2G08 A;  2RRD A;  2KV2 A;  2DGZ A;  2A3V A;  3L3F X;  2WB1 F;  2KKP A;  3D2N A;  2XID A;  4OJL A;  4PL1 A;  3SAG A;  1PVR A;  3PSF A;  2E1F A;  2NV3 A;  2PMZ F;  4P0P B;  2KHQ A;  4P0Q B;  2OXO A;  2RP5 A;  1A0P A;  3VC8 A;  4BUG A;  3E0F A;  3SAH A;  3ONN A;  4NV0 A;  2W7O A;  1ZQ1 C;  4AYB F;  3GU3 A;  5CRX A;  1GO3 F;  2OM6 A;  2N1R A;  1PVP A;  2F77 X;  2ZXI A;  2WAQ F;  3SAF A;  2LYB A;  4P0Q A;  2XI9 A;  2G0A A;  4U7C A;  4NLB A;  4KMO B;  3DEE A;  4FZM A;  4PL2 A;  3PSP A;  1F44 A;  1L6N A;  2G06 A;  3F5A A;  4KX3 A;  4CDG A;  2XIC A;  3H0M B;  3KFU F;  2ZIW B;  2G5H B;  3SMV A;  1SZH A;  3M6Z A;  3K1Z A;  4NWI A;  2HOI A;  3CRX A;  2VJ5 A;  2CPR A;  4CRX A;  2YX8 A;  3IG5 A;  3O0F A;  4QNL A;  2HOQ A;  1D8B A;  2KVC A;  4BX9 C;  2ZIU A;  3ICX A;  2LKY A;  4OJP A;  4QIW F;  1Q3U A;  3AQE A;  3MGV A;  3AQF A;  1YT3 A;  2LBO A;  4BJQ A;  1KBU A;  2ZIX B;  5T14 A;  4O3M A;  4OO1 J;  3D2Q A;  1MA7 A;  5HR6 A;  2H3V A;  3NUQ A;  4OJ6 A;  3GZF A;  3M6K A;  2WAQ C;  4ACO A;  2W03 A;  4A8E A;  3SQI A;  1PVQ A;  3F2C A;  1P7D A;  3HKZ C;  1Z19 A;  2K8A A;  2KNJ A;  2BDU A;  2F8L A;  2HOF A;  2W04 A;  2M0N A;  2ZIU B;  3N7S C;  1CRX A;  2G07 A;  2XVT A;  3IP4 B;  1OUQ A;  2H3F A;  2ZIX A;  1T94 A;  2K4I A;  4OJ5 A;  2F76 X;  2MRL A;  4OJO A;  2G5I B;  3NRW A;  2PMZ C;  2ZIW A;  3T79 A;  2VJ4 A;  1Z1B A;  1ECW A;  4FE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...