2H3IA

Solution structure of the hiv-1 myristoylated matrix protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 34
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3iA00
2H3VA 4ICAA 2HMXA 2NV3A 2H3ZA 4IC9A 2H3IA 1A6SA 2K4HA 2LYBA 2GOLA 4JMUA 2K4EA 2LYAA 1ED1A 2K4IA 2H3QA 1L6NA 1HEKA 1TAMA 2H3FA 2N1RA 1HIWA 1UPHA 2JMGA 1ECWA
chains in the Genus database with same CATH superfamily
3GFKB 3RR7A 4Z6DA 2BPCA 3AU6A 2BQUA 2XO7A 4NM2A 4F5PA 2FMQA 5J2EA 2NYVA 4J9LA 2KMDA 2Y0SC 3QUCA 3ETLA 4CF3A 5KT5A 5AM0A 2AGPA 4O3OA 1K1QA 1PVRA 3SMVA 2NO5A 4HYKA 1ZQUA 4EBCA 3QEBZ 9ICAA 3RJFA 8ICRA 9ICVA 2GH1A 3MBYA 3QZ7A 4PZOA 4QZ8A 3AM9A 7ICSA 3IHQB 4EX7A 3BJYA 5ALFA 1NKCA 3FYHA 1U49A 2E3TA 7ICMA 9ICKA 4DL6A 1AROP 2K89A 3GILA 2O6KA 3ETRA 2ZIUB 3A0BU 1KFSA 1OUQA 3C28A 1KSPA 4DFDA 3K1ZA 1MSWD 2ZUBA 4Y2XA 1MQ3A 3PX4A 1NOMA 2K4EA 1IG6A 4M9HA 7ICRA 2XICA 3LWMA 3IV6A 2M9NA 2LHTA 9ICHA 5KG5A 3THVA 2ZIWB 4R64A 2HOIA 2EH9A 3SD7A 4FE3A 9ICNA 1UA1A 2HCFA 5ALRA 4KLIA 4TQSA 5KFPA 3MFHA 4DOAA 3T79A 2R8GA 1KKXA 5KFTA 2RP5A 5ALPA 4FS2A 2KKVA 1Z00A 1JXEA 3H8SA 4OCZA 5L1KA 5DLFA 1WCLA 1ZQZA 4PHEA 2RDIA 4F5NA 3PV8A 4F2SA 3H8JA 3WKCA 2W9CB 4I28A 2VA2A 1JMSA 1UCVA 2I9GA 1ZJNA 3M7DA 1L7PA 5J29A 4DL4A 1LKYA 5ALXA 1PK3A 3K1RB 4AYBC 4O5KA 4HAIA 5GTIU 4RQ3A 4J03A 4QZHA 2FE9A 3Q8QB 3MDAA 9ICTA 2V4RA 3QU9A 4I2GA 3WK9A 3ZDCA 4RQ2A 4YR3A 2PMZF 4U6PA 3KTQA 4J9NA 4YXMA 4G9BA 2JMGA 1D8LA 5H2FU 1SL2A 2QB0B 2HBLA 2AQ4A 4UB8U 5ALOA 2E8PA 2OYYA 1JXLA 1TE2A 1SXEA 4KLHA 2KVSA 4KLLA 4DO9A 3UMBA 8ICLA 2IOFA 3OGUA 8ICHA 2KEYA 4O3RA 3G6VA 1DOQA 2RDJA 4RQNA 5IILA 5ALYA 3F5EA 4F71A 1SWWA 4KN7A 1RYSA 3FM9A 2P66A 2JV3A 2LBOA 3I76A 5KFYA 4JWMA 2YMQA 1UQVA 3LVWA 3QNMA 3QZ8A 3T5HA 5KFLA 4I2DA 3NUQA 3QEAZ 3JPOA 1LVHA 1SV4A 2ZTCA 8ICTA 2Y1IA 2VJ4A 2ISPA 4B9LA 4KLJA 2N1RA 5FP0A 1N62A 2WAQF 4DQSA 2LI6A 1T8EA 4ECRA 4DS5A 2C28A 3KZIU 4FBTA 2H3IA 1N60A 4DFMA 3CP8A 3HT3A 5AK4A 2W9BA 2MU2A 3Q8KA 3SENA 2AXTU 1OXJA 3SV4A 2DPJA 4QNLA 1RXWA 4E0DA 4KLGA 1Q8KA 1JROA 3J81j 4B9VA 1BPEA 4DEZA 1S0OA 4P4OA 3BS7A 3OJSA 5KFJA 2RQ5A 3MR2A 1WG8A 2CRXA 4KTQA 1TK5A 4RT2A 2R8HA 1ZYQA 2ES6A 5E79U 1QSYA 3RAXA 3KKAA 4OJLA 2WF6A 4QZAA 1ZQLA 2FLLA 5D4BA 1D8YA 4JV1A 1FO4A 3T5LA 4TUPA 4J9MA 2E1FA 1YT3A 4UBBA 5KFMA 4Y2TA 1AQ6A 4Y2YA 2H3QA 4Y2SA 2YX8A 2ZG6A 8ICAA 2WF7A 4NLBA 3SAFA 1BGXT 4DL2A 2G5HB 3OSPA 1HIWA 5L1MA 1NK9A 1ZD4A 2A3VA 4PH5A 4IQVA 5ALWA 2DKXA 4K4HA 3WKBA 1ZOLA 1ZQAA 3FC4A 4O5EA 5IIJA 5KG1A 1XSPA 4B9SA 3F5AA 2UVRA 2YTUA 3MFIA 1S76D 2PMZC 3TAPA 3WKEA 4FO6A 3PSPA 2BPFA 4UARA 2DWQA 4MFFA 2G08A 2LMRA 2ZIVB 3OPXA 1ZQOA 1SL0A 5KG4A 2BHNA 3BZKA 2P6UA 2DFLA 1YZ6A 1COOA 4UAUA 3Q8PB 2KZZA 1ZQVA 1ZQPA 3WK4A 4ED0A 2YN4A 3KOOA 1K5OA 2F8LA 2ASLA 2A1JB 5BPCA 3JPTA 3PMNA 4BGDA 4RQ6A 2UVUA 3TANA 1HJPA 2OM6A 7ICTA 2ZIWA 1ZQYA 3NVZA 4NM1A 1HUZA 3OTQA 2AHOB 2D3DA 3AQFA 4RZRA 4F4WA 8ICMA 3VC8A 1CRXA 2WAQC 4I2HA 5J0XA 2W9MA 4J9RA 2WHEA 1MQ2A 3PR4A 5EWFA 4USAA 4P0PA 7ICQA 1ZQJA 1ZQQA 4RU9A 2KFZA 3OHAA 5AI5A 2IHMA 3N7RC 4RPXA 1ZQFA 3I28A 3QXGA 3NRWA 1N5XA 5KFFA 1UA0A 4QZEA 4PZNA 5ALEA 1S8OA 4GC6A 2VJ5A 4I2FA 3QUTA 2ZIXB 5TISU 4RQ4A 4RUCA 1U4BA 3E2EA 4RQ8A 2JRZA 4XQ8A 3OHBA 5KFSA 3AEVA 1NK5A 2BGWA 2ISOA 4MHVA 4R8UA 1RDFA 4I27A 3HKZC 5J2HA 1K1SA 4DQQA 1C20A 3JPPA 4GLXA 2B0CA 5DDMA 2QB0A 3PZPA 5ALMA 4CF4A 4GFJA 3UXPA 3KKAC 3B0YA 4X5VA 1PVPA 3HRDD 3L4PA 1S0NA 3RR8A 3PVXA 2WF8A 3C5FA 4ZH4A 1ZXIA 1T94A 2E8MA 5KFVA 1DGSA 7ICGA 2DPIA 2ZJ5A 5J0WA 2GWSA 5DB8A 3JPRA 2EAMA 5DLGA 4KLFA 1N56A 1RZTA 3QUQA 2W03A 4ECQA 3M9OB 8ICFA 8ICJA 5AI0A 4C7YA 2F3NA 3SAGA 3NASA 2RLTA 3PMLA 3PX6A 5HR7A 2Q4TA 2XI9A 3ZDDA 3H40A 4B9MA 3B0XA 2R8IA 3RAQA 2G07A 2CPRA 2K8AA 3M8SA 3MGHA 4JWNA 2FPMA 4NV0A 3SI8A 4PJ0U 4MEYA 1V9PA 3ZDEA 1URJA 4NWIA 3RJJA 8ICKA 1MA7A 1IIPA 4BUGA 2ZXHA 3E0FA 4C8NA 8ICCA 1A77A 9ICUA 2HMXA 2KHVA 4UB2A 2PI5A 1NK7A 5ALKA 3U26A 2F1HA 2VA8A 1JX4A 4TQRA 4QWCA 3D2NA 5J2KA 1RYRA 1N61A 5AKJA 2WTFA 5G5HA 1PUZA 1XS9D 5EE3A 2QLTA 1WUDA 1S10A 5AKZA 2NRTA 1S0VA 1ZQDA 4QW9A 4G3IA 3TFSA 1S97A 3NVVA 1N5WA 1SB3C 5J0SA 1V38A 2W8KA 7ICLA 7ICUA 4RUAA 4GXIA 2XC9A 2UVWA 5AIAA 1JRPA 3WU2U 4QZBA 1X9SA 5KFKA 8ICVA 4M9GA 2KSOB 3PSFA 3UM9A 1XO1A 1RQNA 2W43A 5KFEA 4M04A 4I2IA 3PW5A 2KD1A 1PZNA 2JH7A 2LPEA 3CNHA 2DUYA 5KT6A 3BDPA 5ALDA 1TK8A 2EQYA 4DSIA 5GTHU 4P0QB 4KLTA 4YD1A 2W7PA 2HVIA 3MGVA 2KN7A 5AM3A 4CRXA 2Q0ZX 4K4IA 3DDHA 3GIIA 2ZIVA 2F1JA 1BVSA 4DSEA 2PXIA 5DGAA 2KE7A 4JB3A 2V4QA 1DK2A 1TKDA 3PW2A 4DCCA 3WK5A 5C5JA 4NXZA 1Z4NA 3LVVA 3HPOA 3A0HU 4M9JA 5HHHA 1DK3A 1L7NA 4XA5A 3Q8MA 3ISCA 5EOZA 3UQ0A 5C0YA 4Z6EA 1Z1BA 2A1JA 1COKA 3EZ5A 5J0TA 1QSLA 4UQGA 4YQWA 4QW8A 3H8MA 1L7OA 4M0AA 2B21A 4YP3A 5AKXA 5KG7A 7ICFA 3UPQA 3FAHA 1KEJA 4KN4A 3TADC 2ZJ8A 4EEKA 1QLNA 1KLNA 2HOFA 3RFAA 4F5QA 5DQHA 2XY6A 3UMCA 4O0IA 9ICBA 3R9KA 2HHWA 5L9XA 3G6XA 1L3UA 5CRXA 2FDRA 3BQ0A 3JPQA 3TAQA 3RBDA 5D46A 4M47A 4BXOB 2Y9TA 3QU2A 3M8RA 4PGXA 3QE9Y 2YMPA 3K75D 3BQ7A 2NO4A 5J2JA 4QWBA 5AM1A 3V7JA 3RTVA 2J6TA 5AKLA 4EEYA 5KFAA 2BCSA 1IXRA 1KFTA 1KL9A 4DFKA 4KMUA 4TUSA 4Y2PA 4Q44A 4PGYA 4UB4A 2ZJAA 2ZIXA 1L8LA 2K4PA 5J0UA 4CE6A 4GIBA 3LK9A 1TAUA 3RJHA 2KICA 4QZGA 3Q8RB 4J9OA 3KHLA 2QARA 4KLSA 2F1IA 4NLNA 3JPSA 4DQRA 2FPKA 4EELA 1KN5A 2HBMA 2YMMA 2LKYA 4J9KA 4Y2QA 5B66U 3ALRA 1ZQWA 4IQTA 2KV2A 3H4DA 5DKWA 5L1JA 2PFOA 5ALJA 1UT5A 4IQUA 5KFCA 1H38A 4M9LA 1F0MA 4R63A 4BDPA 5J2BA 4J9SA 3H0RB 1U48A 3RJIA 5KL1B 2J6SA 2PKEA 2HVHA 3VCBA 4NLCA 9ICQA 1N63A 4QWDA 1UT8A 1XSLA 1N48A 4QZIA 4EENA 2W04A 4F93B 3ZD9A 2DGZA 2HW3A 5J2DA 5KG0A 4O5CA 4O9MA 2PI4A 2VIXA 7ICNA 2KHQA 4R65A 3WKAA 1ZRNA 1KQQA 2HHVA 5KAIU 5AICA 4DSJA 4Y2UA 3H4BA 4RT3A 4DL3A 4UB5A 9ICEA 2C2RA 4YCXA 4PGQA 3QU4A 3QX7A 2NV3A 2G09A 2XY7A 1U47A 4DOBA 1T3NA 4QZCA 3ORYA 3HJEA 2XCPA 2VKQA 4QZFA 3MDCA 2IA6A 5DB7A 4C8MA 1VLBA 4UAYA 5JU5A 1TFRA 1TVAA 3CYMA 3EPIA 1X9XA 4LZDA 3SYZA 1KRPA 2F8KA 2ESEA 8ICNA 3HKZF 3T5JA 3PNCA 1BPZA 5AKHA 1ZQ1C 3O0FA 1FEZA 7ICJA 3NGDA 1P7DA 1HEKA 2HHXA 3ZI4A 2KKPA 4EBEA 2BZFA 2MA1A 3SR6A 4PHPA 2HHUA 3G6YA 2W8LA 1PK1B 4F4ZA 4P0QA 4ZOHC 5CA7A 2K4HA 5KT3A 8ICEA 3TKAA 8ICQA 1SXDA 5ALQA 2WB1F 3RB6A 4DOCA 5EWGA 1QQ5A 4ECUA 5KFWA 3PX0A 3PSTA 4DSKA 1T3QA 2JH1A 3V6KA 3GZFA 1NJWA 4P2HA 5AI6A 2AGQA 5DBAA 3KHHA 3H0LB 5DQIA 2ZXIA 4FZLA 9ICFA 2ZIUA 2KG5A 5J0OA 4O3SA 1ZQHA 4C8OA 1DRGA 3BQ1A 1MN8A 3H8WA 4FS1A 5KFDA 1S5LU 1O03A 2K60A 1J2MA 4YR0A 1B4FA 5AI9A 3ISBA 3WKDA 5AKGA 1ZQSA 1KDHA 3SQIA 2GLEA 2K8CB 4KLOA 1ED1A 2H5XA 4C80A 1LB2B 3RRGA 3L3FX 3GIMA 1ZQIA 3UQ2A 3E58A 2W9AA 4YG2A 3ICXA 5CHGA 1UHUA 9ICSA 3ONNA 5ALUA 2WF5A 3HW8A 1SZHA 7ICHA 1ZQKA 1Z1VA 4BXOA 4DFJA 1ZQEA 2BR0A 4MFCA 3M9NB 3RB3A 2OXOA 3C1ZA 1U9LA 3N7SC 1TV9A 3NS1A 2Z7JA 3F2BA 2W9CA 1L3TA 3SZ2A 4F4KA 3IDWA 4ED7A 2I1QA 3EW9A 1O08A 5KFQA 4F5OA 4YVZA 2LYBA 2XGQA 4NL9A 5CWRA 4C8KA 2BDPA 3WK7A 2EZZA 2KZMA 4RPYA 4F4XA 4C4TA 7ICPA 3RRHA 1ZQXA 8ICSA 3DV9A 2H3VA 2JR5A 4ICAA 3ZDAA 5K4LA 3SAHA 2JZBB 5AHXA 2BPGA 1D9FA 3AUOA 5L1LA 2NRWA 1XNSA 4CDGA 3RJEA 9ICPA 4FFDA 1L5UA 3IRUA 1NNLA 4F2RA 2RHFA 4EYHB 4LZGA 4BWJA 1UPHA 4IRDA 4F4YA 2A1AA 2MUTB 3IG8A 1Z19A 1SKWA 2HBJA 1X40A 5IINA 8ICPA 4I29A 4PHDA 1ZQCA 3HWTA 5AK6A 5J0RA 3TADA 3T5KA 1VDVA 1L6NA 5DB9A 2WB1C 4YN4A 1KTQA 5AK5A 5KFIA 4Z6CA 5BOLA 3PW7A 1PVQA 1NKEA 2BKEA 3TACB 2PFPA 2EAOA 4ECSA 5HP4A 2AU0A 2QB1A 5ALNA 1D8BA 4MEXA 2EZXA 2DKZA 2KJ8A 1L3VA 4I2JA 1NK8A 1KBUA 3Q8SB 7ICEA 5AKYA 4O3QA 3UXNA 5L1IA 4BJQA 3N4MB 5JTIA 2E5SA 1B0XA 1TAMA 2IOFK 5DBCA 9ICCA 5F3XB 1FFVA 4UB3A 2W3SA 2IOHA 5EWEA 1BNPA 4I2EA 1C7YA 5KT4A 2EZYA 2KOBA 2CXYA 3MR6A 3KBBA 5HNKA 2MRLA 1XO0A 3ZD8A 1ZJMA 1S0MA 9ICJA 5J0YA 4J9QA 3GV5B 2AH5A 1ZD2P 4GC7A 4ECZA 5HMLA 3RJGA 1QSSA 4P4PA 4A8EA 3ED5A 2JEIA 1BPDA 2KP7A 4QZDA 3MGIA 1XC9A 1ZQRA 5AKIA 3C2KA 2XIDA 4F50A 2R8JA 1SWVA 2YQEA 4I2BA 3GV7B 5F9NA 4ECWA 1Z3EB 4IRCA 1ZD3A 1PK1A 1X6JA 2PFNA 3TQ1A 9ICXA 3BQ2A 8ICYA 4IQWA 4ED3A 1X66A 2B6GA 1N2XA 2ZUCA 1IV8A 2DBYA 4QWAA 2GO7A 1CI4A 4FZNA 2D8CA 3PSIA 4RNMA 4PPXA 1XSNA 4NL9C 3GIJA 4RQ1A 5ALLA 3Q8LA 3CRXA 4O3PA 4UW9A 3OJUA 5DDYA 2OH2A 5AIBA 4NLGA 8ICIA 4KITB 1XU4A 2NRVA 1RXVA 5AI4A 5J8YA 1F5SA 2AQ0A 4O3NA 4DQIA 1ZD5A 1BPYA 2G06A 5KT2A 4YMNA 2BCRA 4DF4A 4Y2VA 4TUQA 3FDSA 3MABA 2JHDA 2KIWA 5IIIA 5EE1A 4UATA 4PL2A 2HHQA 1WYGA 4RNNA 1HUOA 4EZ9A 2HHTA 4M6WB 2RRDA 3AQEA 2G0AA 2F76X 4EBDA 2ZTEA 3PY8A 3F2DA 5DG8A 4JMUA 2Y1JA 3GIKA 3F53A 2HSZA 5CEHA 4F91B 3KD3A 5EE9A 2VA3A 1NZPA 1V85A 2BDUA 4ECYA 4F8RA 2KNJA 9ICMA 4FBUA 2C2EA 1B43A 2JEJA 4KLUA 5IIOA 3C2MA 4DWIA 3V7KA 3SEIA 9ICOA 2HI0A 3N7PD 5AM4A 4UB6U 2EDUA 3SV3A 3T3FA 2ATLA 4ECTA 3M1YA 4P0PB 1GO3F 4RNOA 5DBBA 5DB6A 2W55A 1CUKA 3OSNA 2UVVA 4ED1A 5T14A 2BCQA 2JEGA 3RF9A 2JZBA 2YMLA 1JN3A 1MC8A 1ZRMA 2LYAA 2EANA 2W3RA 2F2AB 9ICIA 2KJ5A 3HP6A 2FPLA 2YB4A 3V6HA 4C4SA 9ICWA 2EAPA 3MR5A 4RQMA 4JV0A 2HHSA 3H0MB 3KZXA 2MUTA 8ICWA 4M2YA 2XVTA 1B22A 4IR1A 5J2FA 2GOLA 4R8UB 5BOMA 4I2CA 3WK8A 4DL7A 1NJYA 3IG5A 3UMGA 1JI7A 2W7OA 4QZ9A 3EWAA 3UXOA 1NK6A 2V9WA 4Y2RA 2BCVA 2CN1A 4DLEA 4K4GA 4PL1A 4OJ5A 3NVWA 3BS5B 4LJXA 2OWOA 4ACOA 5DQGA 1Y88A 8ICUA 3D6JA 7ICVA 3HILA 2IMWP 2WFAA 3RH4A 5ALZA 4JK1A 5JRTA 1J2NA 1WWUA 1V97A 1ZQTA 4CNQA 4ECXA 3AN1A 2QKQA 4NJ8A 5TZVA 5D49A 3C23A 5J2CA 4UAZA 1J97A 4OD0A 5KFUA 3M6KA 4PHAA 4Q8FA 3TI0A 3MC1A 2KIVA 2KVCA 2BQ3A 4NLZA 2G5IB 5KFGA 5J8YC 2J6UA 2HBKA 5KL8B 3NRZA 2JGAA 5AM5A 9ICGA 4BX9C 3GDXA 4EZ6A 4YD2A 4ECVA 5AK3A 3PR5B 3QU7A 1NI3A 1NK4A 3AL0B 4OJPA 2DQNB 4MF2A 5KG2A 5ALGA 4B9UA 1BPBA 2DL0A 3EUB2 3DEEA 3TFRA 4OJOA 4UAVA 2L5YA 4QIWF 5KFZA 4F92B 1BNOA 1NJXA 2KSOA 4RQ5A 3S6JA 4EYIB 4QJFB 2FMSA 5HHIA 4AP9A 4C4RA 4BWMA 4UB1A 2FMPA 4RQ0A 2LYHA 3JPNA 2AGOA 4ED2A 2NRXA 2H3ZA 1SV0A 2ZUDA 4KLDA 5KFOA 5EE0A 5B5EU 8ICGA 5J2AA 3RB4A 3V72A 3AU2A 1Z4OA 1L8OA 3IM1A 2XY5A 1YZ7A 2LM1A 2NRZA 2HOQA 1CEZA 2IHNA 4B6JA 4DFPA 4IR9A 4CGZA 3KHGA 4GXJA 2E8NA 5AKKA 5ALSA 4XUSA 3RBEA 2MAXA 4JV2A 1X42A 5F9LA 2P35A 5J0PA 7ICIA 3C5GA 1X2IA 3BQTA 3EPGA 2FLPA 1FIQA 4NLKA 5J2GA 5AI8A 3WK6A 3ISDA 1ZQMA 2K4IA 3N28A 4U7CA 4IS7A 3LWLA 4WJ3B 2I5HA 2ODGA 3L5KA 4MFAA 2E8OA 3B9JA 3PO5A 2MSNA 2Y9UA 3H7IA 2KK0A 1WCNA 1M6YA 1QQ7A 2K8BB 2BQRA 4M6WA 2FLNA 4CF5A 1ZETA 1QH9A 3RJKA 1NJZA 8ICBA 2YB1A 3QYPA 1RM6C 4B9TA 4KMOB 5CR0A 4FZMA 3PW4A 2C2DA 4M9NA 1ECWA 4UASA 1QQ6A 2M0NA 1Q3UA 5IIKA 4Q8EA 3LYSA 4US8A 5KFRA 3V7LA 4DQPA 1RQLA 4O3MA 2LM4A 1OW5A 3EYZA 2R18A 5KAFU 1IM4A 3RH6A 2OCEA 4C7ZA 4IL6U 5HMMA 5J2IA 2HDOA 5DG9A 5J0QA 3V6JA 2KTQA 4IRKA 2FJ6A 3K4GA 1X9WA 1A76A 3HX0A 4C0ZA 1DXSA 5ALVA 1DGJA 3C1YA 4B9NA 5AKEA 4YMMA 1TK0A 5ALHA 4UAWA 3NVYA 2VANA 3RH5A 1RYUA 2ASDA 2ZTDA 4ELUA 5ALTA 4US9A 1Z00B 2E1EA 2JXJA 2BCUA 1SGGA 2ASJA 1A0PA 1F44A 5KG6A 3PW0A 2F44A 5KFXA 2F77X 4QIWC 5KG3A 5DG7A 1L3SA 1NZBA 1A6SA 2IBKA 1Q46A 4OJ6A 1KFDA 2Y0SF 1ZQGA 2OEHA 1LKYB 3D2QA 4OO1J 9ICLA 2H3FA 4DSLA 4CCHA 4DL5A 4Y2JA 2D6FC 4LVSA 5KFNA 5KFHA 2QARB 2PFQA 4KLQA 4R66A 7ICKA 1D9DA 3CW2C 5KFBA 1QCKA 4J9PA 1ZQBA 1ZQNA 5KNIA 3C2LA 1JUDA 4UBCA 1XWLA 3LDAA 4ED8A 5DGBA 4DSFA 5CJ7A 2XGPA 4KLMA 1JALA 3QUBA 1SL1A 3BS5A 1SV0C 3GQCA 4RPZA 4ELVA 1S9FA 1SKSA 5G5GA 4NY8A 3I1YA 1Q3VA 2OHFA 3GV8B 4KLEA 4DS4A 1JIHA 2YY6A 2C22A 1X9MA 8ICZA 2I6XA 4ED6A 5KTQA 3KFUF 3BZCA 4TURA 9ICRA 3TARA 4JUZA 4GXKA 4Q45A 3M6ZA 8ICXA 1TAQA 1QTMA 1BPXA 3C21A 5AM2A 1SIJA 4DLGA 4YXJA 1T7PA 1X6IA 2FI1A 5KT7A 5JUMA 4MF8A 4F3OA 5CB1A 1VJ5A 3M9MB 1NK0A 1SZPA 7ICOA 4ELTA 2W54A 4XRHA 3KHRA 4QWEA 1L7MA 3F2CA 3PO4A 4IC9A 1S77D 3RB0A 2DF4B 8ICOA 2P6RA 2WF9A 1RPLA 3D2SA 3QU5A 2JEFA 4KX5A 4F5RA 2W9BB 5CP2A 4I2AA 4Z6FA 3N97B 1WWVA 3IP4B 1T4GA 3NTUA 1EXNA 3IN5A 3C29A 4Q43A 4DF8A 4YFKA 2XCAA 1LV5A 3MR3A 2W11A 4EX6A 4C8LA 5HR6A 4AYBF 2KFNA 4P4MA 2KJ9A 2A19A 5A0LA 1NKBA 3AMZA 4YMOA 5IIMA 2ALZA 1U45A 2R8KA 3GU3A 2KZ3A 1KW4A 1SKRA 4KX3A 4F72A 4YR2A 2AJQA 1FFUA 1RG6A 4RQ7A 5ALIA 3ZDBA
chains in the Genus database with same CATH topology
2WAQF 2YB4A 2KJ8A 2RP5A 5KL1B 2KKVA 2M0NA 3DEEA 1Q3UA 4OJOA 2G08A 1KBUA 3LYSA 2ZIVB 4NLCA 3VCBA 3HKZC 3OPXA 4P0QA 4QIWF 3H0MB 3KZXA 2H3IA 4O3MA 2G06A 2HOFA 3CP8A 3RFAA 2R18A 1Q3VA 2XVTA 2K4HA 2LYBA 2GOLA 2W04A 2Y0SC 4BJQA 3PZPA 2E5SA 4QJFB 4GFJA 2JHDA 1PVRA 1TAMA 3SMVA 2KIWA 3KFUF 1L6NA 5CRXA 2WB1F 1PVPA 2DGZA 3M7DA 3IG5A 4PL2A 2F8LA 3M6ZA 2W7OA 1T94A 2H3VA 4QNLA 2KOBA 3PSTA 3PSFA 4ICAA 2GH1A 2RRDA 3AQEA 3SAHA 2JH1A 4AYBC 3GZFA 2MRLA 2G0AA 2H3ZA 4C0ZA 3H0LB 2F76X 2VIXA 2OM6A 2W03A 1XO0A 2KD1A 2JH7A 2ZXIA 2KHQA 2CN1A 1XNSA 4FZLA 2ZIWA 4CDGA 3F2DA 2ZIUA 2CRXA 4JMUA 3SAGA 4PL1A 1DRGA 3F53A 4OJ5A 3AQFA 4ACOA 2HOQA 5HR7A 2Q4TA 3VC8A 2PMZF 2XI9A 2E1EA 4U6PA 2RHFA 1UPHA 2G07A 2CPRA 2BDUA 1CRXA 4P0QB 2K8AA 2WAQC 2K89A 4OJLA 2KNJA 2JMGA 4A8EA 4CGZA 1A0PA 1F44A 2ZIUB 3IG8A 2ZIXA 1Z19A 2XIDA 4NV0A 2HBJA 2W7PA 2F77X 2G09A 2HBLA 2NV3A 4QIWC 3F2CA 1OUQA 3C28A 4IC9A 3MGVA 2OYYA 2DF4B 2E1FA 4P0PA 1URJA 3K1ZA 1YT3A 4NWIA 2KICA 1NZBA 4CRXA 1A6SA 1MA7A 3D2SA 4OJ6A 3SQIA 2VKQA 2ZIVA 4KX5A 2K4EA 3M6KA 3N7PD 2K8CB 2KEYA 2Y0SF 1ED1A 2K4IA 2H3QA 1IIPA 2YX8A 2ZG6A 3D2QA 4BUGA 3SAFA 4NLBA 2XICA 3N7RC 4U7CA 4OO1J 2KVCA 2G5HB 2WB1C 4WJ3B 2H3FA 3IP4B 3F5EA 2G5IB 2LHTA 3L3FX 2HBMA 1HIWA 2ZXHA 3IN5A 1GO3F 4P0PB 2LKYA 3E0FA 3LVVA 4FZNA 2HBKA 2LBOA 5KL8B 3C29A 2D6FC 3ICXA 2JGAA 3NRWA 3ONNA 2ZIWB 3ALRA 3CYMA 2A3VA 2HMXA 5HR6A 2KV2A 4BX9C 2HOIA 2KHVA 3LVWA 4AYBF 5C0YA 1Z1BA 2KJ9A 3PSIA 1SZHA 2K8BB 3HKZF 5T14A 4FE3A 5A0LA 3RF9A 3NUQA 3D2NA 1ZQ1C 3CRXA 1PVQA 2LYAA 2YB1A 3AL0B 2F2AB 3O0FA 4OJPA 2DQNB 2OXOA 3F5AA 2VJ5A 3GU3A 1P7DA 1HEKA 2KJ5A 2PMZC 4KMOB 2OH2A 2VJ4A 4KX3A 3T79A 2ZIXB 3N7SC 4FZMA 2N1RA 1WUDA 3PSPA 2KKPA 1D8BA 3H0RB 2MA1A 2Z7JA 3F2BA 1ECWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3V A;  4ICA A;  2HMX A;  2NV3 A;  2H3Z A;  4IC9 A;  2H3I A;  1A6S A;  2K4H A;  2LYB A;  2GOL A;  4JMU A;  2K4E A;  2LYA A;  1ED1 A;  2K4I A;  2H3Q A;  1L6N A;  1HEK A;  1TAM A;  2H3F A;  2N1R A;  1HIW A;  1UPH A;  2JMG A;  1ECW A; 
#chains in the Genus database with same CATH topology
 3GFK B;  3RR7 A;  4Z6D A;  2BPC A;  3AU6 A;  2BQU A;  2XO7 A;  4NM2 A;  4F5P A;  2FMQ A;  5J2E A;  2NYV A;  4J9L A;  2KMD A;  2Y0S C;  3QUC A;  3ETL A;  4CF3 A;  5KT5 A;  5AM0 A;  2AGP A;  4O3O A;  1K1Q A;  1PVR A;  3SMV A;  2NO5 A;  4HYK A;  1ZQU A;  4EBC A;  3QEB Z;  9ICA A;  3RJF A;  8ICR A;  9ICV A;  2GH1 A;  3MBY A;  3QZ7 A;  4PZO A;  4QZ8 A;  3AM9 A;  7ICS A;  3IHQ B;  4EX7 A;  3BJY A;  5ALF A;  1NKC A;  3FYH A;  1U49 A;  2E3T A;  7ICM A;  9ICK A;  4DL6 A;  1ARO P;  2K89 A;  3GIL A;  2O6K A;  3ETR A;  2ZIU B;  3A0B U;  1KFS A;  1OUQ A;  3C28 A;  1KSP A;  4DFD A;  3K1Z A;  1MSW D;  2ZUB A;  4Y2X A;  1MQ3 A;  3PX4 A;  1NOM A;  2K4E A;  1IG6 A;  4M9H A;  7ICR A;  2XIC A;  3LWM A;  3IV6 A;  2M9N A;  2LHT A;  9ICH A;  5KG5 A;  3THV A;  2ZIW B;  4R64 A;  2HOI A;  2EH9 A;  3SD7 A;  4FE3 A;  9ICN A;  1UA1 A;  2HCF A;  5ALR A;  4KLI A;  4TQS A;  5KFP A;  3MFH A;  4DOA A;  3T79 A;  2R8G A;  1KKX A;  5KFT A;  2RP5 A;  5ALP A;  4FS2 A;  2KKV A;  1Z00 A;  1JXE A;  3H8S A;  4OCZ A;  5L1K A;  5DLF A;  1WCL A;  1ZQZ A;  4PHE A;  2RDI A;  4F5N A;  3PV8 A;  4F2S A;  3H8J A;  3WKC A;  2W9C B;  4I28 A;  2VA2 A;  1JMS A;  1UCV A;  2I9G A;  1ZJN A;  3M7D A;  1L7P A;  5J29 A;  4DL4 A;  1LKY A;  5ALX A;  1PK3 A;  3K1R B;  4AYB C;  4O5K A;  4HAI A;  5GTI U;  4RQ3 A;  4J03 A;  4QZH A;  2FE9 A;  3Q8Q B;  3MDA A;  9ICT A;  2V4R A;  3QU9 A;  4I2G A;  3WK9 A;  3ZDC A;  4RQ2 A;  4YR3 A;  2PMZ F;  4U6P A;  3KTQ A;  4J9N A;  4YXM A;  4G9B A;  2JMG A;  1D8L A;  5H2F U;  1SL2 A;  2QB0 B;  2HBL A;  2AQ4 A;  4UB8 U;  5ALO A;  2E8P A;  2OYY A;  1JXL A;  1TE2 A;  1SXE A;  4KLH A;  2KVS A;  4KLL A;  4DO9 A;  3UMB A;  8ICL A;  2IOF A;  3OGU A;  8ICH A;  2KEY A;  4O3R A;  3G6V A;  1DOQ A;  2RDJ A;  4RQN A;  5IIL A;  5ALY A;  3F5E A;  4F71 A;  1SWW A;  4KN7 A;  1RYS A;  3FM9 A;  2P66 A;  2JV3 A;  2LBO A;  3I76 A;  5KFY A;  4JWM A;  2YMQ A;  1UQV A;  3LVW A;  3QNM A;  3QZ8 A;  3T5H A;  5KFL A;  4I2D A;  3NUQ A;  3QEA Z;  3JPO A;  1LVH A;  1SV4 A;  2ZTC A;  8ICT A;  2Y1I A;  2VJ4 A;  2ISP A;  4B9L A;  4KLJ A;  2N1R A;  5FP0 A;  1N62 A;  2WAQ F;  4DQS A;  2LI6 A;  1T8E A;  4ECR A;  4DS5 A;  2C28 A;  3KZI U;  4FBT A;  2H3I A;  1N60 A;  4DFM A;  3CP8 A;  3HT3 A;  5AK4 A;  2W9B A;  2MU2 A;  3Q8K A;  3SEN A;  2AXT U;  1OXJ A;  3SV4 A;  2DPJ A;  4QNL A;  1RXW A;  4E0D A;  4KLG A;  1Q8K A;  1JRO A;  3J81 j;  4B9V A;  1BPE A;  4DEZ A;  1S0O A;  4P4O A;  3BS7 A;  3OJS A;  5KFJ A;  2RQ5 A;  3MR2 A;  1WG8 A;  2CRX A;  4KTQ A;  1TK5 A;  4RT2 A;  2R8H A;  1ZYQ A;  2ES6 A;  5E79 U;  1QSY A;  3RAX A;  3KKA A;  4OJL A;  2WF6 A;  4QZA A;  1ZQL A;  2FLL A;  5D4B A;  1D8Y A;  4JV1 A;  1FO4 A;  3T5L A;  4TUP A;  4J9M A;  2E1F A;  1YT3 A;  4UBB A;  5KFM A;  4Y2T A;  1AQ6 A;  4Y2Y A;  2H3Q A;  4Y2S A;  2YX8 A;  2ZG6 A;  8ICA A;  2WF7 A;  4NLB A;  3SAF A;  1BGX T;  4DL2 A;  2G5H B;  3OSP A;  1HIW A;  5L1M A;  1NK9 A;  1ZD4 A;  2A3V A;  4PH5 A;  4IQV A;  5ALW A;  2DKX A;  4K4H A;  3WKB A;  1ZOL A;  1ZQA A;  3FC4 A;  4O5E A;  5IIJ A;  5KG1 A;  1XSP A;  4B9S A;  3F5A A;  2UVR A;  2YTU A;  3MFI A;  1S76 D;  2PMZ C;  3TAP A;  3WKE A;  4FO6 A;  3PSP A;  2BPF A;  4UAR A;  2DWQ A;  4MFF A;  2G08 A;  2LMR A;  2ZIV B;  3OPX A;  1ZQO A;  1SL0 A;  5KG4 A;  2BHN A;  3BZK A;  2P6U A;  2DFL A;  1YZ6 A;  1COO A;  4UAU A;  3Q8P B;  2KZZ A;  1ZQV A;  1ZQP A;  3WK4 A;  4ED0 A;  2YN4 A;  3KOO A;  1K5O A;  2F8L A;  2ASL A;  2A1J B;  5BPC A;  3JPT A;  3PMN A;  4BGD A;  4RQ6 A;  2UVU A;  3TAN A;  1HJP A;  2OM6 A;  7ICT A;  2ZIW A;  1ZQY A;  3NVZ A;  4NM1 A;  1HUZ A;  3OTQ A;  2AHO B;  2D3D A;  3AQF A;  4RZR A;  4F4W A;  8ICM A;  3VC8 A;  1CRX A;  2WAQ C;  4I2H A;  5J0X A;  2W9M A;  4J9R A;  2WHE A;  1MQ2 A;  3PR4 A;  5EWF A;  4USA A;  4P0P A;  7ICQ A;  1ZQJ A;  1ZQQ A;  4RU9 A;  2KFZ A;  3OHA A;  5AI5 A;  2IHM A;  3N7R C;  4RPX A;  1ZQF A;  3I28 A;  3QXG A;  3NRW A;  1N5X A;  5KFF A;  1UA0 A;  4QZE A;  4PZN A;  5ALE A;  1S8O A;  4GC6 A;  2VJ5 A;  4I2F A;  3QUT A;  2ZIX B;  5TIS U;  4RQ4 A;  4RUC A;  1U4B A;  3E2E A;  4RQ8 A;  2JRZ A;  4XQ8 A;  3OHB A;  5KFS A;  3AEV A;  1NK5 A;  2BGW A;  2ISO A;  4MHV A;  4R8U A;  1RDF A;  4I27 A;  3HKZ C;  5J2H A;  1K1S A;  4DQQ A;  1C20 A;  3JPP A;  4GLX A;  2B0C A;  5DDM A;  2QB0 A;  3PZP A;  5ALM A;  4CF4 A;  4GFJ A;  3UXP A;  3KKA C;  3B0Y A;  4X5V A;  1PVP A;  3HRD D;  3L4P A;  1S0N A;  3RR8 A;  3PVX A;  2WF8 A;  3C5F A;  4ZH4 A;  1ZXI A;  1T94 A;  2E8M A;  5KFV A;  1DGS A;  7ICG A;  2DPI A;  2ZJ5 A;  5J0W A;  2GWS A;  5DB8 A;  3JPR A;  2EAM A;  5DLG A;  4KLF A;  1N56 A;  1RZT A;  3QUQ A;  2W03 A;  4ECQ A;  3M9O B;  8ICF A;  8ICJ A;  5AI0 A;  4C7Y A;  2F3N A;  3SAG A;  3NAS A;  2RLT A;  3PML A;  3PX6 A;  5HR7 A;  2Q4T A;  2XI9 A;  3ZDD A;  3H40 A;  4B9M A;  3B0X A;  2R8I A;  3RAQ A;  2G07 A;  2CPR A;  2K8A A;  3M8S A;  3MGH A;  4JWN A;  2FPM A;  4NV0 A;  3SI8 A;  4PJ0 U;  4MEY A;  1V9P A;  3ZDE A;  1URJ A;  4NWI A;  3RJJ A;  8ICK A;  1MA7 A;  1IIP A;  4BUG A;  2ZXH A;  3E0F A;  4C8N A;  8ICC A;  1A77 A;  9ICU A;  2HMX A;  2KHV A;  4UB2 A;  2PI5 A;  1NK7 A;  5ALK A;  3U26 A;  2F1H A;  2VA8 A;  1JX4 A;  4TQR A;  4QWC A;  3D2N A;  5J2K A;  1RYR A;  1N61 A;  5AKJ A;  2WTF A;  5G5H A;  1PUZ A;  1XS9 D;  5EE3 A;  2QLT A;  1WUD A;  1S10 A;  5AKZ A;  2NRT A;  1S0V A;  1ZQD A;  4QW9 A;  4G3I A;  3TFS A;  1S97 A;  3NVV A;  1N5W A;  1SB3 C;  5J0S A;  1V38 A;  2W8K A;  7ICL A;  7ICU A;  4RUA A;  4GXI A;  2XC9 A;  2UVW A;  5AIA A;  1JRP A;  3WU2 U;  4QZB A;  1X9S A;  5KFK A;  8ICV A;  4M9G A;  2KSO B;  3PSF A;  3UM9 A;  1XO1 A;  1RQN A;  2W43 A;  5KFE A;  4M04 A;  4I2I A;  3PW5 A;  2KD1 A;  1PZN A;  2JH7 A;  2LPE A;  3CNH A;  2DUY A;  5KT6 A;  3BDP A;  5ALD A;  1TK8 A;  2EQY A;  4DSI A;  5GTH U;  4P0Q B;  4KLT A;  4YD1 A;  2W7P A;  2HVI A;  3MGV A;  2KN7 A;  5AM3 A;  4CRX A;  2Q0Z X;  4K4I A;  3DDH A;  3GII A;  2ZIV A;  2F1J A;  1BVS A;  4DSE A;  2PXI A;  5DGA A;  2KE7 A;  4JB3 A;  2V4Q A;  1DK2 A;  1TKD A;  3PW2 A;  4DCC A;  3WK5 A;  5C5J A;  4NXZ A;  1Z4N A;  3LVV A;  3HPO A;  3A0H U;  4M9J A;  5HHH A;  1DK3 A;  1L7N A;  4XA5 A;  3Q8M A;  3ISC A;  5EOZ A;  3UQ0 A;  5C0Y A;  4Z6E A;  1Z1B A;  2A1J A;  1COK A;  3EZ5 A;  5J0T A;  1QSL A;  4UQG A;  4YQW A;  4QW8 A;  3H8M A;  1L7O A;  4M0A A;  2B21 A;  4YP3 A;  5AKX A;  5KG7 A;  7ICF A;  3UPQ A;  3FAH A;  1KEJ A;  4KN4 A;  3TAD C;  2ZJ8 A;  4EEK A;  1QLN A;  1KLN A;  2HOF A;  3RFA A;  4F5Q A;  5DQH A;  2XY6 A;  3UMC A;  4O0I A;  9ICB A;  3R9K A;  2HHW A;  5L9X A;  3G6X A;  1L3U A;  5CRX A;  2FDR A;  3BQ0 A;  3JPQ A;  3TAQ A;  3RBD A;  5D46 A;  4M47 A;  4BXO B;  2Y9T A;  3QU2 A;  3M8R A;  4PGX A;  3QE9 Y;  2YMP A;  3K75 D;  3BQ7 A;  2NO4 A;  5J2J A;  4QWB A;  5AM1 A;  3V7J A;  3RTV A;  2J6T A;  5AKL A;  4EEY A;  5KFA A;  2BCS A;  1IXR A;  1KFT A;  1KL9 A;  4DFK A;  4KMU A;  4TUS A;  4Y2P A;  4Q44 A;  4PGY A;  4UB4 A;  2ZJA A;  2ZIX A;  1L8L A;  2K4P A;  5J0U A;  4CE6 A;  4GIB A;  3LK9 A;  1TAU A;  3RJH A;  2KIC A;  4QZG A;  3Q8R B;  4J9O A;  3KHL A;  2QAR A;  4KLS A;  2F1I A;  4NLN A;  3JPS A;  4DQR A;  2FPK A;  4EEL A;  1KN5 A;  2HBM A;  2YMM A;  2LKY A;  4J9K A;  4Y2Q A;  5B66 U;  3ALR A;  1ZQW A;  4IQT A;  2KV2 A;  3H4D A;  5DKW A;  5L1J A;  2PFO A;  5ALJ A;  1UT5 A;  4IQU A;  5KFC A;  1H38 A;  4M9L A;  1F0M A;  4R63 A;  4BDP A;  5J2B A;  4J9S A;  3H0R B;  1U48 A;  3RJI A;  5KL1 B;  2J6S A;  2PKE A;  2HVH A;  3VCB A;  4NLC A;  9ICQ A;  1N63 A;  4QWD A;  1UT8 A;  1XSL A;  1N48 A;  4QZI A;  4EEN A;  2W04 A;  4F93 B;  3ZD9 A;  2DGZ A;  2HW3 A;  5J2D A;  5KG0 A;  4O5C A;  4O9M A;  2PI4 A;  2VIX A;  7ICN A;  2KHQ A;  4R65 A;  3WKA A;  1ZRN A;  1KQQ A;  2HHV A;  5KAI U;  5AIC A;  4DSJ A;  4Y2U A;  3H4B A;  4RT3 A;  4DL3 A;  4UB5 A;  9ICE A;  2C2R A;  4YCX A;  4PGQ A;  3QU4 A;  3QX7 A;  2NV3 A;  2G09 A;  2XY7 A;  1U47 A;  4DOB A;  1T3N A;  4QZC A;  3ORY A;  3HJE A;  2XCP A;  2VKQ A;  4QZF A;  3MDC A;  2IA6 A;  5DB7 A;  4C8M A;  1VLB A;  4UAY A;  5JU5 A;  1TFR A;  1TVA A;  3CYM A;  3EPI A;  1X9X A;  4LZD A;  3SYZ A;  1KRP A;  2F8K A;  2ESE A;  8ICN A;  3HKZ F;  3T5J A;  3PNC A;  1BPZ A;  5AKH A;  1ZQ1 C;  3O0F A;  1FEZ A;  7ICJ A;  3NGD A;  1P7D A;  1HEK A;  2HHX A;  3ZI4 A;  2KKP A;  4EBE A;  2BZF A;  2MA1 A;  3SR6 A;  4PHP A;  2HHU A;  3G6Y A;  2W8L A;  1PK1 B;  4F4Z A;  4P0Q A;  4ZOH C;  5CA7 A;  2K4H A;  5KT3 A;  8ICE A;  3TKA A;  8ICQ A;  1SXD A;  5ALQ A;  2WB1 F;  3RB6 A;  4DOC A;  5EWG A;  1QQ5 A;  4ECU A;  5KFW A;  3PX0 A;  3PST A;  4DSK A;  1T3Q A;  2JH1 A;  3V6K A;  3GZF A;  1NJW A;  4P2H A;  5AI6 A;  2AGQ A;  5DBA A;  3KHH A;  3H0L B;  5DQI A;  2ZXI A;  4FZL A;  9ICF A;  2ZIU A;  2KG5 A;  5J0O A;  4O3S A;  1ZQH A;  4C8O A;  1DRG A;  3BQ1 A;  1MN8 A;  3H8W A;  4FS1 A;  5KFD A;  1S5L U;  1O03 A;  2K60 A;  1J2M A;  4YR0 A;  1B4F A;  5AI9 A;  3ISB A;  3WKD A;  5AKG A;  1ZQS A;  1KDH A;  3SQI A;  2GLE A;  2K8C B;  4KLO A;  1ED1 A;  2H5X A;  4C80 A;  1LB2 B;  3RRG A;  3L3F X;  3GIM A;  1ZQI A;  3UQ2 A;  3E58 A;  2W9A A;  4YG2 A;  3ICX A;  5CHG A;  1UHU A;  9ICS A;  3ONN A;  5ALU A;  2WF5 A;  3HW8 A;  1SZH A;  7ICH A;  1ZQK A;  1Z1V A;  4BXO A;  4DFJ A;  1ZQE A;  2BR0 A;  4MFC A;  3M9N B;  3RB3 A;  2OXO A;  3C1Z A;  1U9L A;  3N7S C;  1TV9 A;  3NS1 A;  2Z7J A;  3F2B A;  2W9C A;  1L3T A;  3SZ2 A;  4F4K A;  3IDW A;  4ED7 A;  2I1Q A;  3EW9 A;  1O08 A;  5KFQ A;  4F5O A;  4YVZ A;  2LYB A;  2XGQ A;  4NL9 A;  5CWR A;  4C8K A;  2BDP A;  3WK7 A;  2EZZ A;  2KZM A;  4RPY A;  4F4X A;  4C4T A;  7ICP A;  3RRH A;  1ZQX A;  8ICS A;  3DV9 A;  2H3V A;  2JR5 A;  4ICA A;  3ZDA A;  5K4L A;  3SAH A;  2JZB B;  5AHX A;  2BPG A;  1D9F A;  3AUO A;  5L1L A;  2NRW A;  1XNS A;  4CDG A;  3RJE A;  9ICP A;  4FFD A;  1L5U A;  3IRU A;  1NNL A;  4F2R A;  2RHF A;  4EYH B;  4LZG A;  4BWJ A;  1UPH A;  4IRD A;  4F4Y A;  2A1A A;  2MUT B;  3IG8 A;  1Z19 A;  1SKW A;  2HBJ A;  1X40 A;  5IIN A;  8ICP A;  4I29 A;  4PHD A;  1ZQC A;  3HWT A;  5AK6 A;  5J0R A;  3TAD A;  3T5K A;  1VDV A;  1L6N A;  5DB9 A;  2WB1 C;  4YN4 A;  1KTQ A;  5AK5 A;  5KFI A;  4Z6C A;  5BOL A;  3PW7 A;  1PVQ A;  1NKE A;  2BKE A;  3TAC B;  2PFP A;  2EAO A;  4ECS A;  5HP4 A;  2AU0 A;  2QB1 A;  5ALN A;  1D8B A;  4MEX A;  2EZX A;  2DKZ A;  2KJ8 A;  1L3V A;  4I2J A;  1NK8 A;  1KBU A;  3Q8S B;  7ICE A;  5AKY A;  4O3Q A;  3UXN A;  5L1I A;  4BJQ A;  3N4M B;  5JTI A;  2E5S A;  1B0X A;  1TAM A;  2IOF K;  5DBC A;  9ICC A;  5F3X B;  1FFV A;  4UB3 A;  2W3S A;  2IOH A;  5EWE A;  1BNP A;  4I2E A;  1C7Y A;  5KT4 A;  2EZY A;  2KOB A;  2CXY A;  3MR6 A;  3KBB A;  5HNK A;  2MRL A;  1XO0 A;  3ZD8 A;  1ZJM A;  1S0M A;  9ICJ A;  5J0Y A;  4J9Q A;  3GV5 B;  2AH5 A;  1ZD2 P;  4GC7 A;  4ECZ A;  5HML A;  3RJG A;  1QSS A;  4P4P A;  4A8E A;  3ED5 A;  2JEI A;  1BPD A;  2KP7 A;  4QZD A;  3MGI A;  1XC9 A;  1ZQR A;  5AKI A;  3C2K A;  2XID A;  4F50 A;  2R8J A;  1SWV A;  2YQE A;  4I2B A;  3GV7 B;  5F9N A;  4ECW A;  1Z3E B;  4IRC A;  1ZD3 A;  1PK1 A;  1X6J A;  2PFN A;  3TQ1 A;  9ICX A;  3BQ2 A;  8ICY A;  4IQW A;  4ED3 A;  1X66 A;  2B6G A;  1N2X A;  2ZUC A;  1IV8 A;  2DBY A;  4QWA A;  2GO7 A;  1CI4 A;  4FZN A;  2D8C A;  3PSI A;  4RNM A;  4PPX A;  1XSN A;  4NL9 C;  3GIJ A;  4RQ1 A;  5ALL A;  3Q8L A;  3CRX A;  4O3P A;  4UW9 A;  3OJU A;  5DDY A;  2OH2 A;  5AIB A;  4NLG A;  8ICI A;  4KIT B;  1XU4 A;  2NRV A;  1RXV A;  5AI4 A;  5J8Y A;  1F5S A;  2AQ0 A;  4O3N A;  4DQI A;  1ZD5 A;  1BPY A;  2G06 A;  5KT2 A;  4YMN A;  2BCR A;  4DF4 A;  4Y2V A;  4TUQ A;  3FDS A;  3MAB A;  2JHD A;  2KIW A;  5III A;  5EE1 A;  4UAT A;  4PL2 A;  2HHQ A;  1WYG A;  4RNN A;  1HUO A;  4EZ9 A;  2HHT A;  4M6W B;  2RRD A;  3AQE A;  2G0A A;  2F76 X;  4EBD A;  2ZTE A;  3PY8 A;  3F2D A;  5DG8 A;  4JMU A;  2Y1J A;  3GIK A;  3F53 A;  2HSZ A;  5CEH A;  4F91 B;  3KD3 A;  5EE9 A;  2VA3 A;  1NZP A;  1V85 A;  2BDU A;  4ECY A;  4F8R A;  2KNJ A;  9ICM A;  4FBU A;  2C2E A;  1B43 A;  2JEJ A;  4KLU A;  5IIO A;  3C2M A;  4DWI A;  3V7K A;  3SEI A;  9ICO A;  2HI0 A;  3N7P D;  5AM4 A;  4UB6 U;  2EDU A;  3SV3 A;  3T3F A;  2ATL A;  4ECT A;  3M1Y A;  4P0P B;  1GO3 F;  4RNO A;  5DBB A;  5DB6 A;  2W55 A;  1CUK A;  3OSN A;  2UVV A;  4ED1 A;  5T14 A;  2BCQ A;  2JEG A;  3RF9 A;  2JZB A;  2YML A;  1JN3 A;  1MC8 A;  1ZRM A;  2LYA A;  2EAN A;  2W3R A;  2F2A B;  9ICI A;  2KJ5 A;  3HP6 A;  2FPL A;  2YB4 A;  3V6H A;  4C4S A;  9ICW A;  2EAP A;  3MR5 A;  4RQM A;  4JV0 A;  2HHS A;  3H0M B;  3KZX A;  2MUT A;  8ICW A;  4M2Y A;  2XVT A;  1B22 A;  4IR1 A;  5J2F A;  2GOL A;  4R8U B;  5BOM A;  4I2C A;  3WK8 A;  4DL7 A;  1NJY A;  3IG5 A;  3UMG A;  1JI7 A;  2W7O A;  4QZ9 A;  3EWA A;  3UXO A;  1NK6 A;  2V9W A;  4Y2R A;  2BCV A;  2CN1 A;  4DLE A;  4K4G A;  4PL1 A;  4OJ5 A;  3NVW A;  3BS5 B;  4LJX A;  2OWO A;  4ACO A;  5DQG A;  1Y88 A;  8ICU A;  3D6J A;  7ICV A;  3HIL A;  2IMW P;  2WFA A;  3RH4 A;  5ALZ A;  4JK1 A;  5JRT A;  1J2N A;  1WWU A;  1V97 A;  1ZQT A;  4CNQ A;  4ECX A;  3AN1 A;  2QKQ A;  4NJ8 A;  5TZV A;  5D49 A;  3C23 A;  5J2C A;  4UAZ A;  1J97 A;  4OD0 A;  5KFU A;  3M6K A;  4PHA A;  4Q8F A;  3TI0 A;  3MC1 A;  2KIV A;  2KVC A;  2BQ3 A;  4NLZ A;  2G5I B;  5KFG A;  5J8Y C;  2J6U A;  2HBK A;  5KL8 B;  3NRZ A;  2JGA A;  5AM5 A;  9ICG A;  4BX9 C;  3GDX A;  4EZ6 A;  4YD2 A;  4ECV A;  5AK3 A;  3PR5 B;  3QU7 A;  1NI3 A;  1NK4 A;  3AL0 B;  4OJP A;  2DQN B;  4MF2 A;  5KG2 A;  5ALG A;  4B9U A;  1BPB A;  2DL0 A;  3EUB 2;  3DEE A;  3TFR A;  4OJO A;  4UAV A;  2L5Y A;  4QIW F;  5KFZ A;  4F92 B;  1BNO A;  1NJX A;  2KSO A;  4RQ5 A;  3S6J A;  4EYI B;  4QJF B;  2FMS A;  5HHI A;  4AP9 A;  4C4R A;  4BWM A;  4UB1 A;  2FMP A;  4RQ0 A;  2LYH A;  3JPN A;  2AGO A;  4ED2 A;  2NRX A;  2H3Z A;  1SV0 A;  2ZUD A;  4KLD A;  5KFO A;  5EE0 A;  5B5E U;  8ICG A;  5J2A A;  3RB4 A;  3V72 A;  3AU2 A;  1Z4O A;  1L8O A;  3IM1 A;  2XY5 A;  1YZ7 A;  2LM1 A;  2NRZ A;  2HOQ A;  1CEZ A;  2IHN A;  4B6J A;  4DFP A;  4IR9 A;  4CGZ A;  3KHG A;  4GXJ A;  2E8N A;  5AKK A;  5ALS A;  4XUS A;  3RBE A;  2MAX A;  4JV2 A;  1X42 A;  5F9L A;  2P35 A;  5J0P A;  7ICI A;  3C5G A;  1X2I A;  3BQT A;  3EPG A;  2FLP A;  1FIQ A;  4NLK A;  5J2G A;  5AI8 A;  3WK6 A;  3ISD A;  1ZQM A;  2K4I A;  3N28 A;  4U7C A;  4IS7 A;  3LWL A;  4WJ3 B;  2I5H A;  2ODG A;  3L5K A;  4MFA A;  2E8O A;  3B9J A;  3PO5 A;  2MSN A;  2Y9U A;  3H7I A;  2KK0 A;  1WCN A;  1M6Y A;  1QQ7 A;  2K8B B;  2BQR A;  4M6W A;  2FLN A;  4CF5 A;  1ZET A;  1QH9 A;  3RJK A;  1NJZ A;  8ICB A;  2YB1 A;  3QYP A;  1RM6 C;  4B9T A;  4KMO B;  5CR0 A;  4FZM A;  3PW4 A;  2C2D A;  4M9N A;  1ECW A;  4UAS A;  1QQ6 A;  2M0N A;  1Q3U A;  5IIK A;  4Q8E A;  3LYS A;  4US8 A;  5KFR A;  3V7L A;  4DQP A;  1RQL A;  4O3M A;  2LM4 A;  1OW5 A;  3EYZ A;  2R18 A;  5KAF U;  1IM4 A;  3RH6 A;  2OCE A;  4C7Z A;  4IL6 U;  5HMM A;  5J2I A;  2HDO A;  5DG9 A;  5J0Q A;  3V6J A;  2KTQ A;  4IRK A;  2FJ6 A;  3K4G A;  1X9W A;  1A76 A;  3HX0 A;  4C0Z A;  1DXS A;  5ALV A;  1DGJ A;  3C1Y A;  4B9N A;  5AKE A;  4YMM A;  1TK0 A;  5ALH A;  4UAW A;  3NVY A;  2VAN A;  3RH5 A;  1RYU A;  2ASD A;  2ZTD A;  4ELU A;  5ALT A;  4US9 A;  1Z00 B;  2E1E A;  2JXJ A;  2BCU A;  1SGG A;  2ASJ A;  1A0P A;  1F44 A;  5KG6 A;  3PW0 A;  2F44 A;  5KFX A;  2F77 X;  4QIW C;  5KG3 A;  5DG7 A;  1L3S A;  1NZB A;  1A6S A;  2IBK A;  1Q46 A;  4OJ6 A;  1KFD A;  2Y0S F;  1ZQG A;  2OEH A;  1LKY B;  3D2Q A;  4OO1 J;  9ICL A;  2H3F A;  4DSL A;  4CCH A;  4DL5 A;  4Y2J A;  2D6F C;  4LVS A;  5KFN A;  5KFH A;  2QAR B;  2PFQ A;  4KLQ A;  4R66 A;  7ICK A;  1D9D A;  3CW2 C;  5KFB A;  1QCK A;  4J9P A;  1ZQB A;  1ZQN A;  5KNI A;  3C2L A;  1JUD A;  4UBC A;  1XWL A;  3LDA A;  4ED8 A;  5DGB A;  4DSF A;  5CJ7 A;  2XGP A;  4KLM A;  1JAL A;  3QUB A;  1SL1 A;  3BS5 A;  1SV0 C;  3GQC A;  4RPZ A;  4ELV A;  1S9F A;  1SKS A;  5G5G A;  4NY8 A;  3I1Y A;  1Q3V A;  2OHF A;  3GV8 B;  4KLE A;  4DS4 A;  1JIH A;  2YY6 A;  2C22 A;  1X9M A;  8ICZ A;  2I6X A;  4ED6 A;  5KTQ A;  3KFU F;  3BZC A;  4TUR A;  9ICR A;  3TAR A;  4JUZ A;  4GXK A;  4Q45 A;  3M6Z A;  8ICX A;  1TAQ A;  1QTM A;  1BPX A;  3C21 A;  5AM2 A;  1SIJ A;  4DLG A;  4YXJ A;  1T7P A;  1X6I A;  2FI1 A;  5KT7 A;  5JUM A;  4MF8 A;  4F3O A;  5CB1 A;  1VJ5 A;  3M9M B;  1NK0 A;  1SZP A;  7ICO A;  4ELT A;  2W54 A;  4XRH A;  3KHR A;  4QWE A;  1L7M A;  3F2C A;  3PO4 A;  4IC9 A;  1S77 D;  3RB0 A;  2DF4 B;  8ICO A;  2P6R A;  2WF9 A;  1RPL A;  3D2S A;  3QU5 A;  2JEF A;  4KX5 A;  4F5R A;  2W9B B;  5CP2 A;  4I2A A;  4Z6F A;  3N97 B;  1WWV A;  3IP4 B;  1T4G A;  3NTU A;  1EXN A;  3IN5 A;  3C29 A;  4Q43 A;  4DF8 A;  4YFK A;  2XCA A;  1LV5 A;  3MR3 A;  2W11 A;  4EX6 A;  4C8L A;  5HR6 A;  4AYB F;  2KFN A;  4P4M A;  2KJ9 A;  2A19 A;  5A0L A;  1NKB A;  3AMZ A;  4YMO A;  5IIM A;  2ALZ A;  1U45 A;  2R8K A;  3GU3 A;  2KZ3 A;  1KW4 A;  1SKR A;  4KX3 A;  4F72 A;  4YR2 A;  2AJQ A;  1FFU A;  1RG6 A;  4RQ7 A;  5ALI A;  3ZDB A; 
#chains in the Genus database with same CATH homology
 2WAQ F;  2YB4 A;  2KJ8 A;  2RP5 A;  5KL1 B;  2KKV A;  2M0N A;  3DEE A;  1Q3U A;  4OJO A;  2G08 A;  1KBU A;  3LYS A;  2ZIV B;  4NLC A;  3VCB A;  3HKZ C;  3OPX A;  4P0Q A;  4QIW F;  3H0M B;  3KZX A;  2H3I A;  4O3M A;  2G06 A;  2HOF A;  3CP8 A;  3RFA A;  2R18 A;  1Q3V A;  2XVT A;  2K4H A;  2LYB A;  2GOL A;  2W04 A;  2Y0S C;  4BJQ A;  3PZP A;  2E5S A;  4QJF B;  4GFJ A;  2JHD A;  1PVR A;  1TAM A;  3SMV A;  2KIW A;  3KFU F;  1L6N A;  5CRX A;  2WB1 F;  1PVP A;  2DGZ A;  3M7D A;  3IG5 A;  4PL2 A;  2F8L A;  3M6Z A;  2W7O A;  1T94 A;  2H3V A;  4QNL A;  2KOB A;  3PST A;  3PSF A;  4ICA A;  2GH1 A;  2RRD A;  3AQE A;  3SAH A;  2JH1 A;  4AYB C;  3GZF A;  2MRL A;  2G0A A;  2H3Z A;  4C0Z A;  3H0L B;  2F76 X;  2VIX A;  2OM6 A;  2W03 A;  1XO0 A;  2KD1 A;  2JH7 A;  2ZXI A;  2KHQ A;  2CN1 A;  1XNS A;  4FZL A;  2ZIW A;  4CDG A;  3F2D A;  2ZIU A;  2CRX A;  4JMU A;  3SAG A;  4PL1 A;  1DRG A;  3F53 A;  4OJ5 A;  3AQF A;  4ACO A;  2HOQ A;  5HR7 A;  2Q4T A;  3VC8 A;  2PMZ F;  2XI9 A;  2E1E A;  4U6P A;  2RHF A;  1UPH A;  2G07 A;  2CPR A;  2BDU A;  1CRX A;  4P0Q B;  2K8A A;  2WAQ C;  2K89 A;  4OJL A;  2KNJ A;  2JMG A;  4A8E A;  4CGZ A;  1A0P A;  1F44 A;  2ZIU B;  3IG8 A;  2ZIX A;  1Z19 A;  2XID A;  4NV0 A;  2HBJ A;  2W7P A;  2F77 X;  2G09 A;  2HBL A;  2NV3 A;  4QIW C;  3F2C A;  1OUQ A;  3C28 A;  4IC9 A;  3MGV A;  2OYY A;  2DF4 B;  2E1F A;  4P0P A;  1URJ A;  3K1Z A;  1YT3 A;  4NWI A;  2KIC A;  1NZB A;  4CRX A;  1A6S A;  1MA7 A;  3D2S A;  4OJ6 A;  3SQI A;  2VKQ A;  2ZIV A;  4KX5 A;  2K4E A;  3M6K A;  3N7P D;  2K8C B;  2KEY A;  2Y0S F;  1ED1 A;  2K4I A;  2H3Q A;  1IIP A;  2YX8 A;  2ZG6 A;  3D2Q A;  4BUG A;  3SAF A;  4NLB A;  2XIC A;  3N7R C;  4U7C A;  4OO1 J;  2KVC A;  2G5H B;  2WB1 C;  4WJ3 B;  2H3F A;  3IP4 B;  3F5E A;  2G5I B;  2LHT A;  3L3F X;  2HBM A;  1HIW A;  2ZXH A;  3IN5 A;  1GO3 F;  4P0P B;  2LKY A;  3E0F A;  3LVV A;  4FZN A;  2HBK A;  2LBO A;  5KL8 B;  3C29 A;  2D6F C;  3ICX A;  2JGA A;  3NRW A;  3ONN A;  2ZIW B;  3ALR A;  3CYM A;  2A3V A;  2HMX A;  5HR6 A;  2KV2 A;  4BX9 C;  2HOI A;  2KHV A;  3LVW A;  4AYB F;  5C0Y A;  1Z1B A;  2KJ9 A;  3PSI A;  1SZH A;  2K8B B;  3HKZ F;  5T14 A;  4FE3 A;  5A0L A;  3RF9 A;  3NUQ A;  3D2N A;  1ZQ1 C;  3CRX A;  1PVQ A;  2LYA A;  2YB1 A;  3AL0 B;  2F2A B;  3O0F A;  4OJP A;  2DQN B;  2OXO A;  3F5A A;  2VJ5 A;  3GU3 A;  1P7D A;  1HEK A;  2KJ5 A;  2PMZ C;  4KMO B;  2OH2 A;  2VJ4 A;  4KX3 A;  3T79 A;  2ZIX B;  3N7S C;  4FZM A;  2N1R A;  1WUD A;  3PSP A;  2KKP A;  1D8B A;  3H0R B;  2MA1 A;  2Z7J A;  3F2B A;  1ECW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...