1Q46A

Crystal structure of the eif2 alpha subunit from saccharomyces cerevisia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the N-terminal region of the alpha subunit of translation initiation factor 2 (eIF2alpha) from Saccharomyces cerevisiae provides a view of the loop containing serine 51, the target of the eIF2alpha-specific kinases.
pubmed doi rcsb
molecule tags Translation
molecule keywords translation initiation factor 2 alpha subunit
total genus 54
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1q46A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q46A01
4P71A 4WJ4A 1TWCH 1HR0L 3I4MH 4A3DG 1MIUA 3PUZA 3PCOB 3MXNB 4JV5L 5IT9c 4DK3C 4HJ7A 1RL2A 3KF6B 4DR2L 1X9NA 1W2BA 1J5EL 5C3EH 3L0OA 5BR8L 1TWHH 1E1TA 3EN2A 4OWTB 1EQQA 5GROA 3S15H 3S16H 4YWKA 2UUCL 1Q7YC 4DK6C 2F52A 1U0LA 4C3IH 4UP8A 4JYAQ 2AWNA 4UPAA 3Q8DA 3TS2A 4QL5A 4TQUS 1N34Q 4X6AH 2GVBA 3RNUA 3UDGA 2WAQE 4DPGA 4JI8L 4A3EH 4B3MQ 1WCMH 1K73C 3S1RH 4KLKA 4DUZQ 2UXCQ 2H5XA 5M5WH 1PH4A 4A3EG 1PH9A 2K75A 4OONA 3S24A 2VUMG 2YTVA 4DR6Q 3OYYA 3CC4A 2BH8A 1M90C 2B63G 4GN3B 1NTGA 2NN6G 2FXQA 2BA0A 2VS1A 3TQYA 2QA4A 4LF7Q 4X64Q 1L0WA 4GNXA 4LFCQ 2OCEA 5M3MH 2EQSA 3AFQA 1X3EA 4P75A 1IBKL 3CCUA 4JI7L 1X65A 2PI2E 4X62L 4A3JG 3STBC 4LF9Q 1LYLA 2MQHA 3ER0A 3E9IA 3W5OA 1P16A 1HNWL 3PO2H 5IYBG 2I0QA 2ASBA 5LMUQ 3SGIA 2IY5B 4L5QA 1KRTA 2CKZB 3BZCA 4DV2L 1K8GA 2ZJQA 3H3VH 5FLXc 4DV6Q 4R4CA 4O2DA 5M3FH 4BY1H 2JA6H 3G6EA 4OX9L 1KRSA 3KYHC 3ULLA 3M4OH 3RN2A 4AQYL 3TS0A 2UXBL 3F8TA 1QVCA 1XMOQ 1VQ7A 2IT1A 2Y0SE 5H1SE 4A3JH 4BY7H 1XNRL 3EBEA 2ES2A 4L5SA 4JI1Q 3PIOA 1NE3A 4DR5L 4B3SQ 3F2BA 1KL9A 1VQCA 1YEZA 4P73A 5FLMH 3J80c 4DUYQ 3T1YQ 1S40A 2OQ0A 2UUBL 4YY3Q 2MO1A 2R6GA 3KOJA 5AJ3Q 4BBRG 2JA5H 2UUAQ 3GTKH 5M3FG 2BA1A 5GQOA 2JA6G 4NB3A 4DR7Q 5M5XH 2ZJPA 4JI2Q 1N33Q 1YIJA 4PMWA 3F2CA 3PUVA 1NMGA 4P74A 3AFPA 1FJGQ 3A5ZB 4EQ5A 4DV7Q 3K7UC 2UU9L 2NVTH 1X3GA 3K80C 1K3RA 2YTYA 3A74A 2R92H 4ME3A 2Z6KC 2K5NA 5IWAQ 1KAWA 2Q2IA 3AEVA 1HZ9A 4LW1A 4DR4Q 1CSQA 3RLOA 4GNXC 3T1YL 4MNOA 2WFWA 2EIFA 4LUVA 3KLWA 3JAMi 1XMQL 2PI2A 5IYCG 4BBRH 4MZ9A 5C3EG 3PGZA 1PH5A 4LFAL 4JBJA 1L1OA 1XMOL 3F1ZA 1I94L 1YZ6A 2B63H 4DV5Q 3CCRA 4YCWA 4HJ5A 3M4PA 4NXMQ 4OX9Q 5M3MG 4JI5L 4KHZA 4AH6A 4GN5A 2F4VL 4O0AA 3RLFA 3ULJA 1VQEA 2AHOB 4GOPA 1G6PA 3HKZG 1A62A 4LF5L 3CPFA 4R4OA 5IYBH 2RHSB 3NENA 1SRUA 5ELNA 1E24A 1YHAA 2ZTDA 1OXTA 3I7FA 2VQFQ 3DLLA 1E1OA 2HQLA 2IHFA 3G48A 5FLMG 3BJUA 5GAHC 4GNXB 2WB1G 4X64L 4IOCA 4GOPB 1IL2A 1T9HA 3DM3A 2ATWA 2JA5G 2K5VA 4JI5Q 3GTOH 3CMAA 2I5MX 2YV5A 1QZGA 1PH7A 3FKIG 4QIWE 4A76A 1XPOA 1JB7A 2UXDQ 2DGYA 4B3TQ 1JE5A 1NMFA 1VQ6A 2JEBI 3J81i 4JI8Q 2RCNA 3HOVG 5JEAJ 2ZM6L 1XMQQ 1HH2P 1HJPA 2VQEL 2IX1A 1N34L 3ERSX 4JYAL 1KIXA 1Q86C 1V43A 2V1CC 1N36L 2UU9Q 1O7IA 4XIGS 4BBSG 1JJCB 1FJGL 2A19A 1CKOA 2R7FA 2CQOA 1LM0A 4R4QA 1YJ9A 1YJNA 1X55A 3RZDH 1K83H 1A8VA 4GOPC 1A0IA 1LTLA 2NZHA 2YYZA 3A0JA 3CMEA 2HHHL 3M85A 3B6YA 3K8AA 1S3OA 1HR0Q 5HGQA 3OW2A 1EQRA 4H02A 3HOUG 3NBHB 2MNAA 4J15A 4OO1I 4B3RL 4B3SL 4JI1L 1EIYB 4LF8L 1E7ZA 1WOCA 5E7NA 1D7QA 1CKMA 2N3SA 1XNQQ 3H0GH 1Y1WH 5LMNQ 4AQYQ 1X6OA 1TXYA 1PA6A 2JA9A 1WFQA 3PV0A 5IE8A 1SLJA 2MO0A 3CF5A 1BKBA 2HT1A 5J3BA 1XPUA 3H3VI 3HOWG 2K14A 1Q46A 5HY6A 1Q1BA 1HNXL 1I6HH 1AH9A 1XPRA 1VQ5A 1K9MC 2CCZA 5JJIA 4GN4B 1Z9FA 1D8LA 3D0FA 3K0XA 3HOXG 2OTLA 2VNUD 4YWLA 1YJWA 3CD6A 5C0XJ 2ZTCA 3CPWA 1PH1A 2R7ZH 4KI0A 1IBMQ 4A3LH 1EWIA 4BA1I 3U50C 4LF7L 3TRZA 4KHPQ 5FJ8G 4A3KH 1UWVA 1S72A 3PUYA 2OQKA 1YZ7A 1BVSA 2Q2TA 4KHPL 4WJ3M 4LF8Q 4JI0L 4JI6L 1PV4A 3HOVH 1IBML 1U5KA 5FJ8H 3M7NA 3FP9A 4GKKL 4IPDA 1TWGH 4DV3L 1C7YA 1IBLQ 3HOYH 1FL0A 4JG2A 1VQPA 1DGSA 3KF8B 1VQ4A 1M1KC 3U4VA 2R7ZG 4DV1L 4A3LG 4GLXA 3PF4A 3CXCA 1HNXQ 1I3QH 4LNQA 1B70B 2D0OA 1KHIA 1VQBA 1ASYA 3UDFA 1E22A 3CC2A 4POGA 4A3BH 2GN5A 2K4KA 1IXRA 5C44G 4IPGA 1Q1EA 1WJJA 1J5EQ 5LMNL 4DR2Q 5IYCH 5C4XH 4QY7A 4DR1L 3S17H 1WCMG 2KCTA 3S14H 4IFDJ 2E2IH 1CUKA 2RHQB 3HFZB 4OXPA 1EIFA 4A75A 1CKNA 1K0RA 1X54A 5IY0A 3CCLA 4LF4L 4B3RQ 4QQBX 4JBWA 1VQLA 3GTLH 4X66Q 3JAMc 3I56A 3GO5A 4DKAC 1QUQA 2IX0A 2ALYB 1OXSC 3M4QA 4GLAC 4PG3A 1PYSB 5GAEC 2VY3A 3JC66 2R7DA 4JOIC 4P72A 4PZ6A 1CKNB 3HOXH 1VQ9A 4LF6L 4A3BG 4DR1Q 2E5LL 2CWPA 2LXJA 3FKIH 4HIOA 4IOAA 1SE8A 4DAMA 4RMFA 1VQ8A 1H95A 1N36Q 3PUWA 4OWXB 2HIXA 5DLQE 4AYBE 2MFIA 1MJEA 4DNIA 1NBWA 4K0KL 1PYBA 2VQEQ 4OO1G 2ZM6Q 1PH2A 1HZBA 2N78A 2RF4A 5IP7H 3OTOL 4DV3Q 2UXDL 5IYDH 4APVA 4GKKQ 2KHJA 2NZOA 3PO3G 3G71A 3PF5A 3M9BA 5LMNW 1IZ6A 1Y1VH 2Q2HA 4JI0Q 4RG1A 4JI6Q 5ELOA 1VQKA 1CSPA 3CQZH 1AE3A 3I2ZA 3UDIA 4DV0Q 5JJKA 1Q82C 3KJOA 1WYDA 3ICEA 1G51A 2K5HA 4DR3L 3S2DH 2WAQG 4QJFA 1OXUA 4JBKA 2VUMH 3W1BA 2WP8J 2XTIA 4A3GH 1X56A 2Y0SG 4LF5Q 4JI4L 3HOUH 5K36G 4IJLA 3L2PA 1PHJA 5IP7G 3GD7A 1JJ2A 1QVFA 2D0PA 1C0AA 3HKZE 1YI2A 1Y1VG 2E2JH 1MKHA 3U4ZA 1VQOA 4AYBG 4YHHQ 4A3FH 4NXML 2JA7H 2N8NA 3S2HH 1YBYA 2KENA 3CAMA 3FHWA 1VQDA 5C0XI 4DV5L 4A3MH 3S1QH 4A3CH 1UE7A 1V9PA 3W1GA 4A3IG 3AYHB 1I5FA 4LFAQ 4NXNQ 4IFDI 4BA2I 2JK8A 3J81j 4HJ9A 5C0XG 1Q81C 4C3JH 4R1JA 4A3IH 4DR4L 1NY4A 4JI3L 2L15A 3I4NH 2IHEA 1YITA 1VQMA 2YU9H 4YWMA 2LXKA 4DV7L 4BY7G 3HOZG 2HHHQ 1G291 5IYDG 3CP0A 1N33L 4L5RC 4YCUA 3ULPA 4A3MG 1SN8A 2CFMA 3HOWH 3PO2G 4DR7L 1UE1A 2I5HA 1BBUA 2JA8H 2AKWB 1A63A 3RZOH 1ASZA 2UUBQ 1C9OA 1K8AC 1UE5A 1VQAA 4EX5A 2VL6A 3I4NG 4GLVB 4DR5Q 3J7A5 3T1HL 3KJPA 4UY8C 2PQAB 3UE0A 1R9TH 1YVCA 2KBNA 4B3TL 4NPSA 3MEFA 1N32L 2UXBQ 5C44H 4ALPA 2PMZE 3ZJYC 4DAYB 3CCVA 3HOYG 4IJHA 4YHHL 1FGUA 4DV6L 1VQFA 1QUQB 3BZKA 4LUZA 2XGTA 5LMUL 3I4OA 1P8LA 2QEXA 4LWCA 1QVGA 1HNWQ 1JJGA 1EOVA 2B29A 4POFA 2VQFL 2JA7G 4JI4Q 2DUDA 4Y7NH 4HIMA 4BBSH 1X3FA 2NN6I 1I50H 4R4IA 4X62Q 4LF9L 1L2FA 1QZHA 3G4SA 3E9HA 1L1OC 5JEAG 3CW2C 1GKHA 2BH2A 3K7AH 1B8AA 5C4XG 1GD7A 3NEMA 2F4VQ 4DR3Q 3KDFB 1KC8C 1YNXA 5M5YH 4JBMA 3KFUA 1SMXA 3RN5A 1VQIA 2C35B 2HIVA 3VDYA 4DR6L 2N49A 4A3CG 4C3HH 4LUOA 3J7ZC 1Q8KA 1PH3A 4A93H 1N32Q 4DUZL 2JEAI 3OTOQ 1VQNA 2UXCL 1I94Q 1OTCA 4OWWB 3GTGH 2AWOA 2NVYH 4DV0L 3NELA 3H0GG 2PQAA 4HJ8A 1Y1WG 1Y14B 1SR3A 4JCVE 3J81c 3T1HQ 1YHBA 3A5UA 2WB1E 3HKSA 3I55A 2KHIA 4AIMA 5IWAL 4A3FG 4IFDG 4BXXH 1SFOH 2UUCQ 1FVIA 1VQHA 3WWVA 2NVXH 5EAYA 5BR8Q 1HZCA 1Z47A 1HR0W 2A8VA 2CWAA 1PH8A 3L7ZC 3KF6A 1MJCA 1KXLA 2E5LQ 4JI2L 2VZAA 4A93G 3GTPH 1VQJA 2JQOA 4JV5Q 3U58A 2UUAL 2R93H 3GDEA 1VCIA 3RR5A 5GADC 3EIVA 5AJ3L 2QGQA 3BU2A 3D31A 4YY3L 4JI3Q 3LGJA 3F2DA 2I5LX 4DUYL 1GO3E 2R92G 2Z6KA 1V1QA 3AQQA 4L5TA 1Q12A 1VS0A 3KDFA 1PH6A 2F3IA 2KCMA 4GKJL 1XNRQ 3GTQH 4NXNL 3S1MH 3I4MG 4X65L 4A3DH 1NJIC 3CCJA 4XTCS 3STBD 1BBWA 2JA8G 3HOZH 3PIPA 3CCQA 1HNZQ 2Q2UA 3S1NH 4FDBA 4DV4Q 1UEBA 2D62A 4TVAB 4DV2Q 2NVQH 3CCSA 1LUZA 1YHQA 1JT8A 2EXDA 2OWOA 3M3YH 4DV1Q 2B3GA 4JOIA 1GVPA 4YCVA 5C4JH 3H15A 4A3GG 4LFBQ 2OTJA 3GTJH 1RIPA 2YTXA 4HIKA 3RLNA 1IYJB 1IBLL 2JE6I 1GM5A 1L1OB 1IBKQ 1B7YB 4JI7Q 3UE1A 2A1AA 1PVOA 4GS3A 2Z0SA 1J6QA 3CCMA 4LFCL 3PSIA 3TEHB 1XTDA 1EFWA 3E0EA 4BXXG 1WI5A 2K52A 4C2MH 1HZAA 4HJAA 4LF4Q 4IO9A 1UE6A 1XJVA 2K50A 2VW9A 4Y52H 5IP9G 1E3PA 3GTMH 1KQSA 3IRBA 4A4IA 2GVAA 1KD1C 4A3KG 4B3ML 3PUXA 2LSSA 4UP7A 4QGUA 3J80i 4PZ8A 1N8RC 4LFBL 2AMCB 1JMCA 3K81C 4K0KQ 1EYGA 1W3SA 3CC7A 5JJLA 4MTNA 1VQGA 1SROA 1EUJA 2JJQA 4PZ7A 4R4TA 4DV4L 1HNZL 2ZTEA 2ID0A 2ZJRA 2R93G 4JC0A 1OXVA 1OXXK 5IP9H 4IPCA 2E8GA 4UP9A 1XNQL 1TWAH 5GAGC 1TWFH 4BY1G 4X65Q 1PFSA 3CCEA 4HIDA 2E2HH 4LF6Q 3UDXA 4GKJQ 1N9WA 3PO3H 1AE2A 3TREA 4IPHA 2PNHA 4X66L
chains in the Genus database with same CATH superfamily
2AUKA 4XT1B 3TZUA 2EZXA 1ZYRC 1HR0L 3I4MH 1ICFB 1QE6A 1OO9B 4UBCA 1ZQGA 4I2EA 2NWGA 1GUSA 2Q8IB 4DK3C 2HSZA 2ZIXA 1Q3LA 4DR2L 3CU7A 2P35A 5BR8L 1K0SA 5TZVA 4OWTB 1ENCA 3NASA 1CK1A 1CQVA 1EZ6A 3V6HA 4DK6C 1ICWA 4JYAQ 4UP8A 4F71A 4EVOA 2W8KA 1RODA 3Q8DA 4TQUS 3WKAA 5DBAA 1N34Q 4X6AH 5AK4A 1B9NA 2DUYA 2PI4A 8ICXA 2VXWA 3URYA 3WOEA 2ZXHA 4DPGA 4A3EH 4NY8A 1K73C 1SBBB 1GHKA 3AMUA 4RPYA 2B2WC 2H5XA 2GO7A 1PH4A 3KLSA 7ICSA 1B50A 1K8OA 5ALHA 5ALFA 1LB2B 3S24A 4DR6Q 3OYYA 2B63G 1CA5A 2VIXA 3SV3A 5KG5A 4NLGA 4X64Q 1L0WA 4G7HC 4LFCQ 2DN8A 1W6JA 4RGNA 5FKAC 3RB0A 2RDIA 3B0XA 1XC9A 1X3EA 1S4ZA 4K5XA 2YMMA 1WCLA 4XYQA 1I4QA 1X9WA 2Z9HA 4A3JG 3STBC 3ISBA 4RQ6A 4ELUA 1QWYA 2ASBA 5I2YA 3SGIA 4DQRA 1MN8A 4R8UA 1MHWC 3S15B 5CB1A 3BZCA 2CKZB 1IIPA 2JA6H 2KVCA 4DUYQ 2ZUBA 3PSFA 4RT2A 3S1QB 4DSEA 3L9AX 3M4OH 2YB4A 2EY2A 3RN2A 4AQYL 3QOLA 3TS0A 2HOIA 2WAQC 4G57A 4ECTA 1XMOQ 8ICJA 1VQ7A 3OTQA 4DL4A 2NYZD 1IYUA 1NE3A 3V72A 1HPCA 3GV6A 3F2BA 2IW3A 2PMZB 4DR5L 1FFVA 1KL9A 1VQCA 3SEIA 2SEBD 2Z6BA 2KZMA 5FLMH 4M0AA 2KUMA 2AGQA 2B2YA 4YY3Q 2MO1A 1HFNA 5A2QL 3PX6A 1FD7D 4R8NA 4Y2RA 5M3FG 2BA1A 3ISDA 2BR0A 5M5XH 4J8QA 9ICRA 5JAVA 1SWVA 3F2CA 3PUVA 2FJ6A 9ICQA 1BPDA 4DV7Q 2XWJB 1MI2A 1SNPA 1X3GA 1K3RA 4MHVA 2YTYA 4K4HA 4P0PB 4FXGC 1NK8A 3H8MA 3AEVA 1HZ9A 1LT3D 2K01A 2PYKA 4DA2A 5AM3A 3T1YL 3S1MB 4B9WA 2EIFA 3RJFA 2FHTA 4LUVA 3JAMi 4IR9A 4PHDA 4BBRH 1IYVA 4IUQA 4MZ9A 5C3EG 3SAFA 5KFJA 5EJWA 1XMOL 1UT8A 2Z7JA 1JCKB 1ZQXA 2XGPA 3CCRA 5CV5A 2AXTU 5C0XH 3BQ7A 4YCWA 2R93B 2GH1A 4M9HA 4M04A 2WAQF 1I50B 4M6WA 1L3SA 2OEOA 2CHBD 4K6LA 3R3OA 2YU9B 4IZ8A 3RJKA 1KFDA 5KG2A 1FIQA 2HHUA 2Z4IA 3RLFA 1MA7A 1G6PA 2F2AB 5IYBH 3K4GA 1PMRA 4CDCC 5AI0A 4WFN3 4YQWA 8ICOA 2ZTDA 1I4RA 5T14A 3OJSA 4DLGA 1ML0D 3DWQA 3BJUA 4OJLA 5D4BA 4EX7A 2X69A 5AICA 3HP6A 3GTOH 2YV5A 4P4MA 2RCFA 5J39A 3IFTA 1QZGA 5J2JA 4QIWE 1JB7A 2UXDQ 1X2IA 3M4YA 1KW4A 1EY9A 2JEBI 5CORA 2RCNA 4JI8Q 4XQNA 1F2YA 4KN7C 3HOVG 5JEAJ 3O0FA 2ZT9C 2P66A 2A69D 2IX1A 4M9JA 4B9NA 3SD7A 1F9RA 1ZQIA 3ERSX 1EEID 4CGYB 1PFNA 4KLTA 5CBAE 1AP0A 1VJ5A 4NXZA 1UUPA 3MXPA 3IG8A 2H3FA 1CFMA 5J2EA 3NHHA 1D9DA 2D5DA 1NJZA 2R7FA 4OJ5A 1N2XA 1GXDC 3RZDH 3OIPA 3K75D 1NJYA 4KHVA 5M3FB 4J9RA 4XT3B 2HDOA 3GDXA 1EIGA 2G07A 4A3DB 3NQIA 4DK1A 2BCRA 4O9MA 3HKZC 2Q8RE 4ECYA 1A6XA 1K1QA 3RZDB 2A6EC 3MFYA 3QO2A 5E4XA 4ZRZA 3H6MA 3SMVA 1E7ZA 1WOCA 2L1BA 5E7NA 5C3WA 1ZQYA 1SV0A 2B2VC 2N3SA 1D7QA 3N7SC 2A68C 2SNSA 5LMNQ 1ZD5A 2JA9A 1WFQA 3PV0A 4DL3A 1XPUA 4ZYSA 4BJQA 2RDFA 2KICA 1Q46A 5AKHA 3TFRA 3GIMA 5F9NA 3NQTA 2VA3A 1HNXL 4QUFA 1I6HH 1AH9A 4CE6A 3T5HA 1K9MC 3PX4A 4TURA 5KFZA 3OIQA 3PY8A 1Z9FA 3BDLA 1D1KA 4DS5A 3H8WA 4EZ9A 2ESEA 3UMCA 2C2DA 1KQQA 1PTOF 1Q90A 1YJWA 4UB3A 2F0TA 4ICAA 2R7ZH 3SZ2A 1IBMQ 2G5HB 4F5OA 1EWIA 1G2TA 3U50C 4LF7L 3QR8A 3KKAA 1V85A 2YY6A 2LBOA 3NTUA 1BR9A 2HVIA 3GTKB 2OQKA 1YZ7A 1U9RA 4Z6CA 2K4EA 4WJ3M 1KRPA 2EOTA 1PV4A 4CCHA 3E58A 3M1YA 3FP9A 3M7NA 5D3IB 3JPSA 4KMUC 4GKKL 2FI1A 1C7YA 1IBLQ 2BDNA 3HOYH 1S5CD 2LM1A 4JG2A 5A0LA 2F0WA 4BXOB 1XNSA 3TAQA 1M1KC 1JUDA 4PPXA 3PF4A 1AZQA 5AM5A 1TVAA 3Q6SA 2O5JC 2HHSA 3CC2A 4JV0A 1VF7A 4A3BH 2JV3A 3DV9A 1IXRA 4IPGA 1SKRA 4IRKA 2RHQB 1SKSA 1Q1EA 3PO2B 2AQ0A 2HW3A 9ICBA 4RHSA 4QY7A 4ACOA 3S17H 4IFDJ 1IM4A 1NR2A 1TK8A 5IILA 9ICAA 4A75A 3HOZB 1O7YA 2K8BB 2NB0A 4Z6DA 4JBWA 4O3MA 3BS1A 3F5AA 4X66Q 3I56A 3GO5A 2JA7H 2ALYB 2IX0A 3PQIA 3QNMA 2D9UA 3S17B 4JOIC 3N97B 2BGWA 5KG4A 3B9JA 5FLXE 4Y2JA 3KLSX 2I46A 4A3BG 4UAVA 3TBIB 2E5LL 4DAVA 4LZDA 3MR6A 2LXJA 2BQ3A 5J1ZA 2DF4B 5KRUA 5KFRA 5M5WB 4HIOA 2CN1A 3GFKB 4DAMA 2EAPA 1H95A 5J2DA 2HIXA 5ELBA 3B0YA 1QOHA 1PYBA 3SVMA 5T1IA 3T56B 1PH2A 3MABA 5L1JA 3ETRA 3HOVB 1EY0A 1OW5A 4ECXA 4I2FA 4DV3Q 2R8GA 4UDUC 4DL2A 2KHJA 3PO3G 1PK1A 5C44B 2KZZA 1PDQA 4LF8L 4RG1A 4LF4L 1CSPA 4ZH4A 4DFDA 4PGXA 5G3LF 3UDIA 3VR6A 2FLPA 4C7ZA 3NGDA 1WYDA 2EYLA 8ICBA 2VJ5A 2A6HD 2A5HA 1PRTC 2WKCA 2MHVA 4QJFA 1OXUA 4JBKA 3AL0B 4Y2PA 4A3GH 1U9LA 2Y0SG 4Y2QA 4JI4L 5K36G 4MF8A 4O5EA 5J2CA 3L3OC 3KK7A 1QVFA 1MSWD 4CDFC 5AIAA 2MJ8A 4ECRA 4QWBA 3ITPA 4UAWA 4KITB 1X9XA 1HTLD 1SYEA 3WOFA 1NCVA 3GTPB 1VQOA 3I70A 4C4TA 1TY0A 3QIAA 2N8NA 1YBYA 3A7LA 5EPLA 5C0XI 4FF3A 4PH5A 1UE7A 1V9PA 1XWEA 3NWSA 4A3IG 1F9PA 2E74C 1UA0A 4XQQA 1JWUD 2KEEA 4NXNQ 1BPZA 3UI2A 5D46A 1L6NA 4PZOA 1T5XD 4UB5A 4C3JH 4Z6FA 3QZ7A 4CJ1B 2IHEA 1YITA 5HMLA 2XGQA 3OSPA 1PK1B 1R4PB 4A93B 3SXHA 2HHHQ 2QDLA 2QARA 4QZCA 3GV5B 3Q8QB 4AP9A 1KSPA 1JOKA 2DNEA 1Y88A 2EH9A 3M8SA 2R8KA 2KECA 2KJXA 4ECQA 1PVQA 3C2PA 5C3XA 3PO2G 1A2TA 3OPXA 5FO7B 4QIWF 2W9AA 1C20A 2F8KA 4HAEA 1RPLA 3C21A 3EYZA 1HIWA 5E1FA 1K8AC 1UE5A 1IKMA 5IIKA 3I4NG 3S1RB 2FE9A 4UY8C 1ZQZA 4C80A 3FPUB 3EJIA 4A3IB 4OJOA 4FZLA 1S0VA 4HYKA 3TKAA 2PMZE 3QWNA 4IQUA 3ZJYC 3CCVA 4YHHL 3I72A 3WK9A 4B3SQ 7ICLA 4GIBA 1ZQCA 1JICA 2W3RA 3BZKA 2FPLA 2A1JA 2J7ZA 4LUZA 3P1HA 4BS9A 2NRXA 4UATA 1P8LA 2KA7A 2QEXA 1QVGA 5DQGA 1JJGA 2JA7G 2B29A 2O2LD 4QZFA 2DUDA 2G5IB 4Z9CB 4R4IA 1O80A 1S10A 1L1OC 4ZKBB 2EYOA 1BCPC 3AQFA 1B8AA 5ALTA 2F4VQ 5KFWA 2FDRA 2B39A 2AQ3B 3EQLC 2NRTA 2KK0A 3NWTA 1SMXA 2F3VA 1IHZA 3J80L 3HX0A 8ICCA 4A3CG 4PGYA 2LI6A 1BUVT 4N9PA 3J7ZC 3MEHA 1GOZA 3TSSA 1WD1A 1PH3A 4RFBA 3LNNA 3GV3A 4DUZL 3ERQA 4U673 1OTCA 3PMNA 2B2YC 4OWWB 4ED1A 3ZDCA 3H0GG 3KZIU 1Y1WG 3T1HQ 4JCVE 1WG8A 4ELTA 1F9QA 1XS9D 4F50A 1DCZA 3HKSA 2M9NA 3IM1A 1L8LA 2QB1A 4BGDA 4AIMA 1O7LA 4OD0A 2K6AA 1RD9D 4PQXA 2A8VA 4CDGA 2CWAA 5J0YA 1B44D 4QMGA 5EQ0A 4QCLA 1NK5A 2A69C 1L7MA 3C23A 2E5LQ 2MPMA 1VQJA 4B9MA 2NN6H 2XVSA 3GDEA 2NYVA 3F5EA 5AKZA 5J2KA 3D31A 2FMMA 1A3UA 3F2DA 3GQCA 3PW0A 2Z6KA 3PW4A 3AQQA 5JOBA 1PH6A 1VS0A 4GKJL 2KCMA 3VYTA 2PFOA 4NXNL 3I4MG 8ICQA 1CZGA 3KZXA 3P75A 2ENBA 1NSNS 4QB4A 5KYLA 2Z4HA 3TACB 3T5KA 4FDBA 4CRXA 1UEBA 4HMIA 7ICIA 4TVAB 2NVQH 1LUZA 1QH9A 1JT8A 2O4XA 2EXDA 1ZQOA 4N8FA 3RRGA 4BXOA 3PO5A 1EFID 4CDDC 4A3GG 2OTJA 2X6LA 5FLXL 4DWIA 5BN5A 4HIKA 1KTQA 3IN5A 4J9OA 2W54A 1ZQJA 2SDFA 3LWEA 3RLNA 3H3VC 2JE6I 3RBDA 3F53A 2I07B 8ICPA 3HT3A 3VR2A 4KY5A 3PSPA 3UE1A 1F9SA 1STNA 5AKGA 2Z0SA 1J6QA 3CCMA 1HCZA 2NTTA 3SAHA 3HRDD 1TWGB 3FAHA 3E0EA 1T94A 3SK4A 1QCBD 1X40A 5KFGA 4C8LA 4DFKA 1JORA 5DG9A 4LF4Q 2PZUA 3R2TA 2VW9A 5KFUA 1ZQQA 1E3PA 3GTMH 1KQSA 3WKEA 4E0DA 2QLTA 4KLIA 4F72A 4HAIA 7ICRA 5KFSA 5AI5A 4QGUA 4JV2A 4Q44A 4LFBL 1N8RC 3QEBZ 2JEJA 4ZLTF 1JMCA 1X42A 4K0KQ 1EYGA 2O5IC 5K4LA 4XYOA 4DV4L 5M3MB 1L8OA 1SIJA 4US8A 3C1FA 4KLEA 2ID0A 1B4FA 5C5JA 5AFWA 3MVVA 3R2IA 4L8JA 3TZDA 1T4GA 1WWUA 4TSSA 2JN4A 3KTQA 3CRXA 4UP9A 5GAGC 4BY1G 1BXTA 1RKNA 4GKJQ 2W9BB 1AE2A 4K4IA 1T3NA 7ICGA 4X66L 3J80c 4WJ4A 4A3DG 5CYUA 4KN7A 1Y69U 4HTHA 2A68D 3PCOB 2K04A 3MXNB 4J03A 4JV5L 4I7AA 4C3IB 1RL2A 4O3RA 4DXGA 5JPMC 2F0NA 1J5EL 4IL6U 5KT3A 1PZJD 1E1TA 5CWRA 3NVYA 4PL2A 5KFLA 3PVXA 1D5ZC 5DM73 3GP7A 2P6UA 2F52A 1U49A 1ILQA 4XXEA 1B53A 8ICFA 4C3IH 4X3SA 2EDUA 2RSNA 4A3FB 5DAUA 3JPNA 2AJQA 4QL5A 1ECWA 2GVBA 3RNUA 5TISU 1JMSA 1KFTA 2WAQE 5E4WC 4PV1C 5DGAA 5J0WA 3S1RH 3BQ2A 3AU2A 3T79A 4A3JB 2UXCQ 2BQRA 1LT6D 2B8GA 1TWFB 4OONA 3LWUA 2YTVA 1LTBD 1X6IA 2ZUDA 3O13A 4GN3B 4JUZA 2NN6G 5J0SA 1IW7D 2BA0A 2VS1A 2B63B 4F88A 2VB3X 1X6JA 1Z3EB 2E1EA 2EQSA 3AFQA 4P75A 2F0FA 5KG6A 5A2QE 3CCUA 2RP5A 2PI2E 1VDZA 4X62L 1ZQKA 1HQMC 5KAIU 1LYLA 3MXNA 3E9IA 4MTKA 3W5OA 4UQGA 1Z7TA 5CHGA 3R9KA 1T5EA 2B2TC 4PL1A 4RAUC 1DK3A 1X32A 2Q8TA 1HQRD 2B2UC 2L11A 1K8GA 3H3VH 5FLXc 4OO1J 3H40A 3FMCA 4O2DA 3A0BU 5M3FH 3G6EA 4DV6Q 3RR7A 1AFPA 3KYHC 4QW9A 1S5LU 7ICPA 5I9OA 4XUSA 1QVCA 2F0QA 2IT1A 2Y0SE 4NV0A 1PZKD 4BY7H 3PV8A 3RR8A 4NLKA 1S40A 5JPNC 4F7XA 4K4GA 1ZQFA 1D8YA 2OQ0A 5AJ3Q 1QILA 2ZXOA 5M9OA 1XSNA 4BBRG 1S5ED 1RYUA 4US9A 3KBXA 1XSLA 1UEAB 2M00A 3KF8A 4X3TA 1LLRD 3PIO3 2UUAQ 4DR7Q 4DFMA 4JI2Q 2PPBC 1N33Q 4GXJA 1TAQA 1B3AA 1C48A 3AFPA 4JK1A 2E8NA 3RMHA 4DL6A 2R92H 5J8YC 4ME3A 2K5NA 5IWAQ 3P7JA 5ALZA 4C3HB 2DJFC 4PHAA 3P20A 3KLWA 2Q0ZX 1I3QB 2KSOA 5DB7A 5LL6X 4UAYA 3T5LA 2WFAA 1TY2A 4UAIA 2LKYA 5E79U 3K7AB 4J9KA 4HJ5A 2G0AA 1GO3F 1N62A 4OX9Q 4CF3A 5M3MG 5ALXA 2WTFA 8ICAA 4J9SA 1F2MA 1NK6A 3RJIA 1ZQBA 5J2BA 1H38A 4P4OA 4I2BA 3BQTA 1BQQT 1LV9A 4KLLA 3H94A 1LO5D 2F4VL 3ULJA 1SYGA 1VQEA 2WACA 2M9VA 4A3EB 2B2WA 4LF5L 4ED8A 3I28A 5ELDA 4DAPA 5J22A 1B0XA 3SK8A 2RHSB 1BPYA 4CGZA 2FMPA 2F1HA 2LYAA 3IP4B 1SL2A 2ZIWA 5ELNA 1OXTA 2VQFQ 3KKAC 1E1OA 2FLNA 3G48A 7ICKA 5GAHC 4GNXB 4GOPB 1IL2A 3QU4A 5AKIA 2HI0A 3WK5A 1AN8A 3WK6A 1ZQTA 4X64L 4RWSC 5J0UA 1ZQAA 3T3FA 2K5VA 4L63B 4USAA 1GUGA 2R8IA 1PH7A 1KDAA 2EZYA 3FKIG 2JH7A 3PX0A 2WF8A 2DGYA 4ZK9B 4B3TQ 4RQ1A 1JXEA 2BPGA 5KFMA 3G6XA 5ALWA 4C4RA 9ICMA 3L3FX 4H13C 4CJ2C 2VQEL 2IL8A 1WVLA 4J9QA 4DLEA 4QNLA 3S16H 3NXWA 4JYAL 3SV4A 4B08A 4LVSA 2IPKD 4F5QA 1N36L 2UU9Q 1O7IA 3TADA 4XIGS 1XYIA 4BBSG 2PW5A 1SNDA 5KFYA 3FRPB 2LY7A 3IKJA 2CQOA 1LM0A 5KNIA 3TAPA 2JEIA 1YJ9A 2IBKA 4YD2A 2J6SA 2NZHA 3A0JA 3H4DA 5C5MA 2B6GA 3K8AA 1SB3C 1HR0Q 3SR1A 2G08A 2R3ZA 1TWHB 2IMWP 3HOUG 3D3RA 3MDCA 1G2SA 1OXJA 1EXNA 4B3SL 1E2VA 2WB1C 4N8X1 4WJWA 4NMZA 2HMXA 1EY4A 1XNQQ 9ICKA 2K4HA 2PCFB 4AQYQ 2BE5D 1WTOA 3QEAZ 2GLEA 2EAMA 1TXYA 2EPBA 3T1YQ 1PA6A 3A55A 2KZ3A 8ICYA 2MO0A 3V05A 1BKBA 2HT1A 5KT4A 2XVTA 2AQ4A 1PRTD 4FP5D 3NS1A 2K14A 4B9VA 9ICWA 3AN1A 5L37A 3WKDA 3OHXC 3QU7A 3RH5A 2CCZA 2MSNA 4B9UA 2AGPA 8ICKA 4C1NK 2QKIC 3HOXG 1D8LA 2E76C 2OHFA 3K6OA 4YWLA 3CD6A 2AQ2B 5H2FU 1LTRD 2OM6A 3CPWA 4Z6EA 1F2ZA 5KG7A 3IV6A 4QJFB 3GV7B 2HBMA 4ED2A 2WF7A 4DFPA 1S76D 1XTCD 4BA1I 1J2NA 2KQ3A 2KJ9A 4JVZA 4I2DA 1NNXA 4A3KH 5HHIA 3PUYA 1Q8IA 4FS2A 2Q2TA 3G6JB 2IOFA 4LF8Q 3H4BA 4YR0A 1U5KA 5FJ8H 3LWLA 2ZJAA 5KNDA 3SI8A 4IPDA 4L6TB 4YR2A 4KLMA 3NTKA 3BQ1A 3E0FA 3I4MB 3VYSA 4DF4A 1VQ4A 2Z1CA 2RQXA 3MA2B 3U9SA 3ISCA 4GLXA 1HEKA 4LNQA 2D0OA 2A73B 5JTIA 5KG0A 1KFSA 1AQ6A 1ASYA 1E22A 3HOWB 2GN5A 2JXMB 4I2CA 4NJ8A 3NTHA 1J5EQ 3NRZA 1F2LA 2EYHA 4J1MA 4LZGA 5C4XH 3JPQA 4C4SA 2HOQA 1WCMG 3E5SA 3VA7A 3S14H 9ICSA 1CUKA 4AYBF 3HPOA 2Y1IA 2PFPA 1EIFA 4GC7A 2HDLA 2BPFA 2MU2A 3CKIB 9ICHA 1A3TA 4RQ5A 4CHTB 4B3RQ 2OXPA 3GTLH 4QQBX 2W7PA 2R92B 4Q0FA 1NJWA 1QUQA 3J81i 3GTGB 3HOUB 2J6UA 4ZCKA 1SL0A 3JC66 5C4HA 1C8CA 1MBYA 1BBXC 1CKNB 1BO0A 4DQPA 4A3MB 4LF6L 3UMGA 2RKSA 1WYGA 2M0NA 3K57A 4KX3A 2BCQA 3K59A 3Q8PB 4BY7B 2KSOB 4QZ9A 5J0RA 3FKIH 3K5NA 2KJ8A 4C2MB 2LKVA 4RMFA 4Y2YA 1PVPA 4O42A 1KTKA 4BBSB 2MFIA 3CRKC 5J0TA 4QUCA 1COOA 3C5FA 5KFTA 4OO1G 2TSSA 5CP2A 5KFFA 1HZBA 2N78A 1Z19A 5BN4A 4A3KB 3S6JA 2EY5A 5CR0A 2DPJA 2NTSA 1V1PB 2UXDL 1ZQVA 2YN4A 5IYDH 2W9CA 4APVA 2NZOA 4GKKQ 3PF5A 1IZ6A 1X9SA 1NK0A 1ZD2P 2XIWA 1OUQA 5JJKA 3E2EA 3UXOA 3J81E 3KLRA 4K8JA 2K5HA 4DR3L 3QU2A 3K0YA 3K5MA 3S2DH 2WAQG 4X3KA 5KFOA 4R64A 4CKCA 3W1BA 2XTIA 2BDOA 4OGQC 4LF5Q 4IJLA 1PHJA 2KCCA 1U47A 3BDOA 3IL8A 1C0AA 2ES6A 5B66U 2PKEA 4LJXA 3A56A 4NLZA 1Y1VG 2W04A 2BCUA 1XWLA 1PLFA 1EY8A 2E2JH 1GUTA 2E8PA 4AYBG 4K8IA 3SAGA 3ONNA 3FHWA 3TDQA 3UQ0A 3OW7A 1EU4A 3S1QH 4A3CH 4YCUA 3WK8A 4DO9A 5KFBA 4DSKA 2A6ED 2QW7A 2ISOA 1SXTA 4IUVA 5E3FA 3TN2A 5FO9B 8ICMA 2JK8A 4YN4A 3E6ZX 2BDUA 2B2TA 3ED5A 3J7AV 4F5RA 3JAME 2XCPA 4P0PA 2RVLA 3D2NA 3I4NH 4RGTA 3OOCA 3GU3A 2X6GA 2YU9H 1X9MA 5D49A 4DV7L 1G291 3IHQB 3CP0A 5CC4A 3QU5A 1A6SA 2QDBA 2CFMA 4RCOA 2DKXA 3GIKA 4DR7L 2L5TA 3OMGA 2F0MA 2I5HA 1BBUA 3MHBA 1B9MA 1TIID 1QJOA 2K7VA 3VR4A 3S2DB 1A63A 2LMRA 3RZOH 1G8ZD 5KEEA 5EPKA 2OXOA 1Q3VA 4EBDA 3H0GB 1Y1WB 5JU5A 4S3SA 3UE0A 1R9TH 2Y0SB 5DNFA 4P0QA 1ZJNA 4B3TL 4NPSA 4EELA 2PMZF 1PRTB 5KT2A 4ZQ3A 4ALPA 4RPZA 4DAYB 3HOYG 2FPKA 4KLDA 4IJHA 1UQVA 2O6KA 1WCNA 1FGUA 1SE4A 4DV6L 1QUQB 3T53B 2XGTA 1MGSA 2NO5A 3PW5A 7ICNA 2EDGA 4C56C 4LWCA 4P2CB 1YNNC 2HHTA 4IC9A 5KNCA 2VQFL 5KFNA 1B4OA 4Y7NH 1ZRNA 2Y0SC 1X3FA 1R9TB 2RSOA 4X62Q 3JPOA 1RXVA 4I2HA 5D65A 4ZOHC 2EYMA 1Z1BA 2WAQB 1GKHA 2E2DC 3H0LB 5HGTA 1VMPA 3LVVA 1GD7A 2D8CA 4IUTA 4KN4A 3A0HU 3PO4A 1YNXA 3KDFB 3RD4A 2A3VA 5L9XA 1EIHA 3KFUA 5EOZA 1SFOB 4DR6L 2HIVA 2KEYA 2E2HB 1HFGA 2N49A 3MC0B 4O1NA 3FYHA 4I2GA 1TAUA 4MEXA 1MQ2A 4GXKA 2NVTB 1SKWA 3OTOQ 3F2UA 1VQNA 1I94Q 1L7PA 3GTGH 2DL0A 2NVYH 5IGGA 3SK5A 4GC6A 5DGBA 2K8CB 4KX5A 1YHBA 3A5UA 1PUZA 4DCCA 1CT1D 1NK7A 2KHIA 4A3FG 5L1KA 2BQUA 1JX4A 4IFDG 3AM9A 4IQWA 1SFOH 2UUCQ 4IURA 1BNOA 1S77D 2G09A 4KKTA 1CHPD 5BR8Q 4DV1Q 1Z47A 2SNMA 1PH8A 3L7ZC 3SQIA 3KF6A 4RNNA 5GTIU 3N52A 1KXLA 3ZD8A 1V8QA 4JI2L 4A93G 1A0PA 5J2GA 7ICJA 4RU9A 3V7KA 1F77A 1IL8A 2J4XA 4B9TA 3DHQA 1RZTA 1VCIA 5GADC 3EIVA 4DK0A 4RQ3A 3BU2A 1QQ5A 3M9MB 1QSSA 2BE5C 2I5LX 1B1ZA 1PK3A 2R92G 4TQRA 2CQAA 3ND8A 3GTQH 4DSFA 4A3DH 4X65L 4R63A 1D2BA 3C46A 4H7BA 2B0CA 4BY1B 3DEEA 4XTCS 3STBD 2JA8G 2K4PA 2NZ1D 1HNZQ 2Q2UA 2F8LA 3MBYA 3S1NH 4DV2Q 4CF4A 2W7OA 4N9TA 3CCSA 1U48A 1NK4A 3N7RC 4R8UB 4KTQA 1FNVA 2NUCA 8ICVA 3EFXD 2ODGA 4LFBQ 3GV8B 3GTJH 2WHEA 1ZEQX 1RDFA 4LMQD 2NV3A 2IWHA 2ZG6A 2K4IA 1L3TA 1NKCA 2B21A 2CPRA 1L1OB 2HCFA 4RH6A 3HILA 1B7YB 1IBKQ 4JI7Q 3MGIA 4I27A 4GS3A 2HOFA 4LFCL 4M9GA 4BXXG 1TFRA 4C2MH 5CV6A 4GZYC 4IO9A 1XJVA 1KBUA 2I9GA 4QWEA 4O3NA 3EA6A 5ELCA 3M4OB 2ZUCA 1STGA 1K1SA 3QU9A 2PZWA 3HOXB 3NVVA 1QSLA 1GUWA 2M2LA 1ZQNA 1A15A 4EYHB 2Z8LA 2DQNB 2C2EA 3PUXA 5F9LA 4RZRA 1EOTA 1O78A 3DWPA 4PZ8A 3J80i 5ALUA 2XO7A 3V6JA 1IKLA 2KHQA 5DG7A 1BPXA 4C3HG 4ODGA 3CC7A 5C5LA 1RM6C 4PZ7A 1EUJA 4R4TA 4AYBC 4OEMB 1ZQDA 3SDZA 2D6FC 2R93G 4MFCA 1LT5D 4G3IA 2F1JA 1D6EC 5AM1A 1DXMA 2UVRA 4YIJA 2E8GA 4HSPA 4CF5A 2KOBA 4TRDA 1Y8NB 1PFSA 4P2HA 2L9HA 1N9WA 5KFVA 4YXMA 2W8LA 3I3CA 3NBHA 4BBRB 4RUCA 3C2LA 3TREA 4RPXA 4DV0L 4YMOA 1BDOA 4P71A 4QZHA 1TWCH 1MIUA 1ZJMA 3PUZA 1LV5A 3ZI4A 4U6PA 3RRHA 1SZPA 4K6DA 4HJ7A 3KF6B 2DPIA 4EQNA 1X9NA 1W2BA 4C1NI 4C3IG 5C3EH 5KFPA 1L0XB 3L0OA 4RQ2A 4KMUA 2Q4TA 5IGFA 3NE5B 4KLHA 4UBBA 4Q45A 4YWKA 2HBLA 1WTWA 2UUCL 3MFIA 1U0LA 2AWNA 1X66A 3TS2A 3BYYB 4ED6A 2H4OA 2UVWA 1EYAA 3UDGA 3C5GA 2K1BA 5AK5A 4ED7A 4B3MQ 1CI3M 4KLKA 1RJTA 1EQVA 3VYRA 4UB8U 2LS01 1DYQA 4MF2A 3J7AF 9ICPA 1DK2A 3WU2U 2K75A 5IE8A 1UHUA 4FF2A 2VUMG 4RCNA 3CC4A 1CZWA 3BVMA 1ESFA 3A8JE 1M90C 4V190 3ICXA 1STBA 2R8HA 5HURA 2QA4A 3KUPA 4PMCA 4GNXA 3ETLA 5KGUA 5JJZA 3I1YA 3U26A 7ICQA 1IBKL 1KABA 4JI7L 1X65A 5ALYA 4EEYA 1AEXA 5ALJA 4LF9Q 2EYPA 3X3MA 3KFUF 1ZQRA 1G6ZA 3S14B 2RDHA 3D8GA 3ER0A 2CH4W 5I9PA 1Z00B 5BOLA 5IYBG 3LVWA 2JP1A 5CMDA 5K5PA 4YFKA 1TS2A 4RHRA 2IY5B 4L5QA 2W11A 2HHQA 1FR3A 1M4VA 2ZJQA 3G7LA 4R4CA 9ICUA 1NNLA 5K36H 3ULLA 1QTMA 1JI7A 2ZIUB 3TFSA 2F0JA 5EWGA 3PW7A 2MUTB 3F8TA 4G4KA 3H09A 5TSSA 5H1SE 1KEJA 3EBEA 2ES2A 5J0OA 4JI1Q 3PIOA 1XNRL 5DDYA 4B6JA 3RF9A 4F92B 4OCZA 1YEZA 4P73A 4TUQA 2FMCA 3H8JA 2QF7A 3Q8KA 1YNND 2R6GA 4UASA 1CEZA 3U9OA 2AU0A 1TWAB 3EROA 5GQOA 5FO8B 4NB3A 1U4BA 1JOOA 2NVXB 4XRHA 2AQ1B 1A76A 4PMWA 2VKQA 2UVUA 3BVZA 2BHNA 2YMLA 4P74A 5DEHA 2JR5A 1HA6A 2UU9L 1QNKA 1RCVD 3K80C 3A74A 1KAWA 2K60A 2Q2IA 3BS5A 3HZXA 3GTQB 4DR4Q 9ICOA 1CSQA 3FDSA 1EQTA 1SNMA 4RKBA 3RLOA 4GNXC 1WTPA 1XMQL 3RZOB 2PI2A 3QX7A 5L1MA 2EJGC 5IYCG 7ICMA 4NDXA 3PGZA 4LFAL 4KLGA 4JBJA 1L1OA 3F1ZA 1SXDA 2W9MA 2B63H 1H9RA 4DV5Q 4QIWB 5CRXA 1QQ6A 1YNJC 1L7OA 5JRTA 3M4PA 2E3TA 1R4QB 1DRGA 1ZQPA 1KLUD 1ZD4A 1FO4A 2IOHA 3MR2A 2PQEA 2KKVA 2G06A 2YMPA 4MFAA 2F4IA 2KHSA 2V4DA 8ICLA 2WB1B 4AH6A 8ICTA 5IT9E 4YVZA 5HR6A 4O0AA 1EWHA 2AHOB 3TMEA 4GOPA 3DDHA 4UB6U 1A62A 3CPFA 4R4OA 2KTQA 3ND9A 3N7PD 4C8MA 4F2SA 1HNWL 1I4GA 3NENA 1SRUA 3QG1A 1YHAA 3I7FA 3HOUH 3DLLA 2HQLA 3NUQA 5FLMG 3IG5A 2WB1G 4EBEA 4KLFA 3AMZA 2ASDA 2ATWA 2DY7A 1HHVA 5BOMA 3S9WA 4JI5Q 2KIVA 2C9OA 2I5MX 2DBYA 4FF1A 4EQPA 1DM0B 4OIJA 1BF4A 3PO3B 5IINA 5L1IA 3HGBA 4UAZA 3K5LA 1NMFA 1VQ6A 4B9SA 4P0QB 5D3DA 4XA5A 3EUB2 2CW0C 2EAOA 1XMQQ 1HJPA 7ICEA 1HH2P 2IHMA 5ELFA 4J9PA 1KIXA 1Q86C 2VA2A 1DOKA 5KL1B 1V43A 2V1CC 1E2ZA 3VA5A 4YP3A 3K1RB 1FJGL 1AROP 2A19A 3TANA 1CKOA 1CHQD 4FFDA 4R4QA 1YJNA 3IAYA 4NL9A 1URJA 2YQEA 1K83H 3K5OA 1KNEA 1A0IA 1LTLA 2DJGC 2YYZA 4GOPC 3M85A 3AU6A 2BZFA 5AI8A 3B6YA 2JA5H 1QNUA 5HGQA 5AK6A 5AKJA 1TT2A 4OELB 2W9BA 4TUPA 1SAPA 2MNAA 4J15A 3KBBA 4JI1L 1Z1VA 3E3XA 4PGQA 1JROA 3AB9A 2XNAC 1CKMA 2E1FA 5ALRA 2MGSA 3RJEA 3H0GH 1Y1WH 5EE9A 4DOCA 4A8EA 3EZ5A 2DKZA 3NBIA 9ICJA 3C2MA 5ALNA 5CEHA 1NKBA 2PI5A 2XC9A 2HHXA 7ICVA 1SLJA 2JZBA 1TS3A 5J3BA 5DDMA 3V2TA 3KD3A 4P4PA 4J9MA 1D5MC 1Q1BA 3ZDEA 2NBFA 1UPHA 1TAMA 2EVBA 4M9LA 2EZZA 4C7YA 3KHLA 3EW9A 5LL6S 3EPIA 4TUSA 1CTMA 3MZ5A 4GN4B 4DAYA 5JJIA 3R93A 3PIP3 2OTLA 4HR7B 1NK9A 5CR3A 1V1OA 4O3SA 1SXEA 1LTAD 4HMJA 4KI0A 4WRDA 1TR5A 1EU3A 5HR7A 3TRZA 4FE3A 1TK0A 5FJ8G 1UWVA 9ICGA 2GWSA 3VR3A 4QZBA 5EE3A 1BVSA 4RQMA 1JC7A 4JI0L 4JI6L 3HOVH 1IBML 2FINB 1JN3A 2WIIB 3AQEA 1WTHA 1VQPA 4LAAA 1DGSA 2C28A 1QG7A 3U4VA 4Y7NB 4DV1L 1SGGA 1K8MA 4A3LG 5KAFU 1JWSD 5LHY1 3M9OB 4EGVA 3CXCA 2F0UA 4E6IA 3UM9A 1B70B 4CKEA 1KHIA 5KT7A 1JE4A 1ENAA 5C44G 2CXYA 3RB3A 1O08A 1ONLA 1FEZA 2LYBA 1TE2A 5EBDA 2EJMA 2XWBB 4DR1L 3NVZA 2KCTA 1RDPD 2ZIUA 2E2IH 1V97A 3HFZB 3I91A 5AM2A 1E2WA 1CKNA 5IY0A 2NRVA 1N60A 2V4RA 3S1NB 1H9MA 2G9HD 3JAMc 2NO4A 1N48A 1T3QA 1OXSC 4DKAC 5GAEC 4DV0Q 3Q8SB 2VY3A 4JV1A 5DG8A 2E5SA 1I4XA 4PZ6A 4I2AA 4GXIA 2K28A 1VQ9A 1IV8A 1QQ7A 5AIBA 1EY5A 2BOSA 1FNWA 2LHTA 1XU4A 1VLBA 3S2HB 4NP5A 5JUMA 3IRUA 4A3BB 1WTXA 2HDMA 1UCVA 4I2JA 1N36Q 1BGXT 3D4RA 5DLQE 2JMGA 4AYBE 3QJYA 1MJEA 2F03A 4Y2TA 1EEFD 3DUZA 2EYFA 3ORYA 4YG2A 2VQEQ 4UB2A 3CYMA 5DB8A 4KLQA 2RF4A 4F8MA 5AI6A 3S16B 3LYSA 4JWNA 1HTPA 3OTOL 2QARB 2EE1A 3DEPA 3C3LA 1SYBA 3T13A 1XXGA 3M9BA 2AUJD 5C4ZA 1Y1VH 2Q2HA 5LMNW 5ALQA 3RBEA 4JI0Q 4JI6Q 4BUGA 3I2ZA 1AE3A 1NI3A 3OGUA 3E0JA 1Y1VB 4F87A 4KLJA 1PYWD 1D9FA 3KJOA 3Q0AA 4XQJA 3ICEA 1LTID 1NKEA 8ICNA 5C4XB 4X3UA 3RH6A 4DN4M 1DOMA 2LYHA 1VDVA 4I29A 4G9BA 1STAA 1YT3A 2BCOA 3GIJA 2MP1A 2VB2X 2WP8J 3G6YA 4KD3A 1HUZA 5IIFA 5J0QA 2L5YA 3V96A 3TP6A 4RGOS 3MAQA 2D0PA 3C1ZA 2K89A 3HKZE 1WTVA 1S8OA 5HMMA 5AKYA 3OPOA 5AM4A 1RF2D 4NL9C 2Y1JA 2N1RA 2HHWA 2ICEC 2V4QA 3M8RA 5J2IA 2QEJC 1STEA 1WD0A 4YHHQ 1CRXA 4NXML 1II3A 1K3BC 3S2HH 2KENA 4ECSA 3CAMA 5KFEA 4XQ8A 1PTOD 1SMYD 3N28A 3AYHB 1I5FA 4LFAQ 4IFDI 3OHBA 5C3EB 3I8ZA 5C0XG 2XRSD 2Y9TA 4DR4L 5EGTA 1NY4A 2H3IA 4JI3L 2YB1A 2L15A 4FZMA 1LVHA 1N5XA 3HW8A 3ZYYX 1VQMA 1H9KA 4YWMA 9ICEA 2LPEA 5L1LA 2F76X 2LXKA 4BY7G 3HOZG 3LK9A 1KDCA 1F0MA 1S9FA 2G9DA 3FM9A 5G5HA 3FPPA 1N33L 2KN7A 3RJHA 4A3MG 5KFDA 3M6KA 3WKCA 7ICHA 3UMBA 1UE1A 1SZHA 1TKWB 3LWMA 3KHRA 4DSLA 2AKWB 3SENA 1XO0A 3ZDBA 5BN3A 5ALVA 4NKLA 4TKOB 2UUBQ 3I4LA 1C9OA 3LDAA 4EEKA 1VQAA 3D2QA 3FEWX 4EX5A 4DR5Q 3T1HL 2NVQB 2K5QA 4BWJA 1DGJA 3MFGA 1YVCA 5F2DA 4IR1A 1GUNA 1H9SB 4K14A 3MEFA 1EWCA 4K2LA 5J29A 2XY7A 5C44H 3AU7A 3QE9Y 4M47A 2RBMA 2E8MA 3GILA 5BPCA 3RH4A 3MXGA 5DBBA 2I6XA 3NVWA 1MD2D 5NUCA 2JA5B 3MTSA 2JEFA 3I4OA 1F44A 4JB3A 5AKEA 1L5UA 2F77X 4POFA 4JI4Q 4YMNA 2KD1A 3QOJA 3ZD9A 5DB6A 1I50H 4LF9L 1QZHA 1RYRA 1YNJD 5COYA 9ICFA 5JEAG 1I4HA 4U7CA 1S0NA 5C4XG 5EKLA 3C2KA 2E2JB 4C3JG 4UHVA 1SJED 2YX8A 2FJ2A 1KC8C 4PHEA 1CM9A 4JBMA 4PHPA 1VQIA 2C35B 3BG3A 1ESRA 1U4LA 4LUOA 4YR3A 2BPCA 2ASLA 4IQZA 5DLFA 1J9OA 2E8OA 4BWGB 4A93H 1N32Q 1KLGD 2UXCL 4MN3A 3M7GA 5KFIA 2E2IB 2AWOA 4RT3A 4HJ8A 3NELA 2HD3A 1A3VA 2PO4A 2WB1E 3I55A 1ENFA 1MC8A 4RNOA 4M2YA 3A54A 4RQ8A 1ZETA 3V7LA 1SNCA 1FVIA 3WWVA 5ALDA 4NM1A 9ICXA 4YMMA 3I76A 2PXIA 1Y8OB 2NVXH 4Y2SA 1HR0W 5C4JB 3C28A 4QZDA 2CW0D 4IQTA 1ILPA 2DWQA 3TP7A 4QZAA 3Q8MA 2ZIVB 5C0YA 2HUGA 2K05A 3K1ZA 3OSNA 3GTPH 4IUUA 4I2IA 3MC1A 3K58A 5FOBB 3RR5A 4OIKA 9ICTA 5AJ3L 1H9JA 2N55A 2QGQA 1ZQWA 2F0LA 1B2TA 8ICUA 4O3OA 1GO3E 4IALA 5JJLA 1Q12A 3KDFA 1M6YA 2F3IA 1XNRQ 2QILA 3H0RB 2HCIA 3HS0C 5I4DA 2QCPX 1ZRMA 5DQHA 4KLSA 2KFZA 4UARA 1ZXTA 3CCJA 2ISPA 1PVRA 2P5ZX 4NW2A 3LX0A 3CCQA 1C4QA 3Q8RB 2AGOA 4ILWA 4DV4Q 1B22A 1U4PA 2HHVA 3CRLC 2MA1A 2OWOA 4C0ZA 1STYA 2ZJ5A 2JEGA 5C4JH 2PMZC 5AKLA 2BKEA 2BCVA 5KT5A 4TQSA 1IYJB 4PMBA 3CHBD 2F44A 1SDFA 5D14A 1PVOA 2A1AA 4IUPA 3MWYW 3D6JA 2K03A 3TEHB 2FMQA 1EFWA 5G5GA 2HBJA 2K32A 3WK7A 1WI5A 4V0BA 1S97A 1KNAA 4F5NA 4HJAA 3QUQA 1UE6A 4Y52H 5DBCA 2KVSA 3PNCA 5I6YA 1KAAA 1DZ1A 5AI4A 3IRBA 4K5WA 5HNKA 2ASJA 1XSPA 2OT2A 1KD1C 4IQVA 1Q7YC 4A3KG 4ECWA 3PSTA 1HA5A 1SSOA 4B3ML 2LSSA 3BDCA 4UP7A 5GTHU 2XY6A 1TS4A 4F8RA 4KJNA 2H1EA 2XSCA 4DOBA 1W3SA 2JZBB 3SHLA 2L12A 4RQNA 2JJQA 5G3LD 4QZGA 4FYDA 2ZJRA 2WKDA 1OXXK 3T4AC 5IP9H 2JA8B 1GJXA 1D5XC 1SE3A 3A8IE 2RQ5A 1RG6A 2KE7A 1TWAH 1TWFH 1ZYRD 4HIDA 4FBTA 4EX6A 4QWAA 1BPBA 2P6RA 4Y2VA 5KT6A 1B3QA 3PO3H 4F3OA 4IPHA 1CI4A 4ECVA 2SOBA 2XRQD 4M6WB 2PNHA 4HN7A 4C8OA 2RHFA 3TI0A 7ICFA 4ZKCB 1Y8PB 2JH1A 1EY7A 3HG9A 3FVQA 4I65A 1WCMB 5IT9c 4IRCA 4JWMA 2L0CA 3Q23A 1U45A 8ICEA 4BX9C 2HCCA 5EKKA 4J9NA 3H8SA 4ECUA 4KKSA 1TV9A 3DEOA 3PR5B 1TWHH 5CV8A 3EN2A 1EQQA 4F4ZA 5GROA 3S15H 4G7OC 3JPTA 4ED0A 1JXLA 2KV2A 1FYCA 1RHPA 2W03A 1ZQLA 2F0OA 4UPAA 4J6HA 5KFCA 1IW7C 2R7ZB 2F3WA 5ALIA 1J97A 2RDGA 3SEBA 4QF4A 2CRXA 2W3SA 4JI8L 4EQOA 1WTRA 2W9CB 1WCMH 2G5DA 2D2CC 2EY6A 1KKXA 2KOLA 4DUZQ 4F4YA 5ELEA 4CKBA 5M5WH 1NR4A 4BDPA 4A3EG 2K5DA 4O3QA 1PH9A 4OO1H 3Q24A 2BH8A 3UXNA 4FNFA 1NTGA 1T8EA 1PTOB 2FXQA 1Z4OA 3TQYA 4LF7Q 4UB4A 3QB3A 2EZVA 2OCEA 5M3MH 2VUMB 2H3ZA 3NPPA 1BNZA 5FP0A 2MUTA 4F93B 1N61A 4DSJA 4KK7A 4FF4A 4FXDA 4J9LA 2MQHA 2PFNA 3HKZF 3L5KA 1P16A 1UAPA 3PO2H 1B43A 1JIHA 2A1JB 2DNCA 2JSOA 3MGHA 5LMUQ 1JRPA 2I0QA 3WDNA 5AK3A 1ZQUA 3RB4A 1KRTA 3ALRA 4DV2L 3GTMB 1Q3UA 3OMCA 4BY1H 3EPGA 4OX9L 2FPMA 3ZDDA 4O0IA 1KRSA 3DM1A 2UXBL 3SE0A 4DGZA 3RB6A 1U4RA 1N5WA 3RJGA 1KDHA 5I6WA 4A3JH 4L5SA 1D1IA 1S5BD 4DFJA 2UUBL 3C1YA 4ABNA 1NZPA 2XICA 5DLGA 5DKWA 2BCSA 4YD1A 1LACA 3KOJA 3BQ0A 2RLTA 8ICIA 2A74C 2JA6G 3GTKH 3FC4A 4DFAA 2ZJPA 3G6VA 1NJXA 4MFFA 1SJHD 5KIXA 4HCSA 1YIJA 1NMGA 1FJGQ 2C5CA 3A5ZB 2F0KA 4EQ5A 3K7UC 2K5WA 2NVTH 1STHA 4IRDA 4QWCA 1TU2B 2Z6KC 5KNBA 2NVYB 5KFXA 4LW1A 4OL7A 1ZQMA 2GA4B 4MNOA 2WFWA 4MEYA 5EE0A 1ZQSA 1LKYA 5AM0A 4NWIA 1DXSA 2K33A 1PH5A 1I94L 4R65A 1YZ6A 2ZIXB 1BCPD 4G7ZC 3C1EA 2RRDA 2ZJ8A 4NXMQ 5AKXA 4DQSA 3MDAA 2BDPA 4WORA 3CNHA 4JI5L 5F3XB 4KHZA 5FK9C 2YMQA 3BDPA 1JQYD 3SK6A 2MAXA 1FFUA 1TK5A 1D8BA 4WJ3B 1TVXA 4GN5A 8ICWA 3CP8A 2Y0SF 2EJFC 4H0LC 5IT9L 5ALPA 3R8BA 3RUZA 1CQFA 5IIOA 3HKZG 1PZNA 1KLNA 1RQLA 2OYYA 2RA4A 4CJ0B 3WK4A 2AH5A 4DS4A 3VYUA 2F0VA 1O7ZA 1E24A 1S0OA 3VC8A 4IUNA 4NLBA 1ZQEA 2IHFA 5ALKA 4I7ZC 4IOCA 1T9HA 3DM3A 1HRJA 5T1GA 4H44C 2JA5G 3NRWA 3OHAA 4DF8A 3CMAA 1I6VC 1PFMA 3PR4A 4A76A 1XPOA 2ZIVA 4RQ4A 3MR5A 2XIDA 2HQEA 1GUOA 3MXUA 1JE5A 2JGAA 1H9SA 2ZM6L 2LMCB 1N34L 4DEZA 1SEBD 4KN4C 4KKUA 2F0HA 4ELVA 3KHHA 2F3NA 3QYPA 1JJCB 1ZD3A 3M7DA 2NRZA 2L4NA 4GFJA 2J6TA 1X3PA 4QZEA 1K5OA 1LT4D 1X55A 1A8VA 2KHVA 2HHHL 2JA6B 3CMEA 3D2SA 4PZNA 7ICTA 1K28A 5IOCA 5IGEA 4XDXA 3DWAA 1S3OA 4ID6A 3OW2A 1L7NA 1EQRA 3D6CA 1LTGD 4H02A 1P7DA 3HJEA 3NBHB 4OO1I 4B3RL 1EIYB 1QB5D 3QZ8A 2ZIWB 3C29A 2EXZA 2H3VA 4F4KA 4U68A 4F4WA 2QB0A 1X6OA 4FZNA 1ED1A 1VMCA 2ZXRA 4K2KA 1L3VA 2RDJA 1PXUA 3CF5A 3H91A 2N88A 3H3VI 4HEDA 3HOWG 4F2RA 4MIUA 2D3DA 2XCAA 5ALOA 5HY6A 5IP7G 4O5KA 2OEHA 2PZTA 1PZID 4PJ0U 1X3QA 3PZPA 5IIJA 2WF5A 5IIIA 4FBUA 1DJRD 1XPRA 1VQ5A 3GTLB 1SYCA 1BNPA 5CGKA 2WF6A 3K0XA 8ICZA 3D0FA 2VNUD 3EWAA 5KFKA 2ZTCA 5C0XJ 4NLNA 5J2AA 1LTSD 1PH1A 4A3LH 3MGVA 4M8AA 5B5EU 3Q8LA 1W6KA 2F0DA 2J0TD 1RXWA 3QXGA 5J0PA 4C8NA 1AW7A 4KHPQ 4FVMA 4JMUA 1S72A 2XY5A 2KP7A 1ET6A 5DB9A 2IJ0A 1L0YB 1PTOC 1ZYQA 1SMYC 3ONAB 4KHPL 5KFAA 1DOLA 1ZKOA 5CA7A 1BOSA 2KNJA 2DFLA 1KDBA 1TWGH 4DV3L 3GIIA 1A2UA 1UNSA 2F0IA 1FL0A 2FFKB 1TWCB 3KF8B 5CBEE 2KJ5A 3A7AB 2R7ZG 4KLUA 5CV7A 4UW9A 9ICCA 5HP4A 1HNXQ 1I3QH 4HCEA 5JVG3 1VQBA 3OJUA 3BYTB 3UDFA 4POGA 3D6WA 1J8IA 2K4KA 4ULLA 1N63A 3IFDA 3PMFA 4JK1C 3H0MB 5A35A 1WTQA 3I73A 2HVHA 1WJJA 5LMNL 4DR2Q 1ZXIA 5ISRA 5IYCH 1HXYD 2TMPA 1ZQ1C 4OXPA 4QZIA 8ICRA 1I4PA 3N6RA 1K0RA 1X54A 3TP8A 3CCLA 3I4NB 4FO6A 5IODA 3Q22A 1VQLA 4DSIA 4DF7A 5JVH3 3M4QA 5J8YA 4GLAC 1PYSB 4PG3A 2R7DA 4ME5A 5J2FA 3KHGA 1RYSA 4P72A 3W2DA 3HOXH 1MSGA 2ALZA 4X5VA 5KG1A 2MUYA 1FGBD 4CBVA 4DR1Q 4I28A 1MSHA 3HWTA 2CWPA 2MRLA 1AZPA 1EZ8A 1HUOA 4OHJA 2GOLA 5M5YB 1LKYB 9ICNA 2KFNA 3NSWA 4IOAA 9ICVA 1SE8A 2XN9C 1VQ8A 3PUWA 4OWXB 2DGZA 4EZ6A 5ALEA 4RUAA 1JWMD 2Y9UA 1NBWA 1JR0D 4DNIA 1Z6HA 2IA6A 5ALGA 3AUOA 4DNTB 4K0KL 1SWWA 2ZM6Q 4C3JB 3GZFA 1J2MA 5ALLA 3SYZA 5IP7H 1ET9A 1SYFA 2EYJA 2VJ4A 5EWEA 1F5SA 3FDTA 2PFQA 3G71A 1S5FD 4Y2UA 2JA7B 2LFNA 3HP3A 1T7PA 1NUCA 5ELOA 1VQKA 3CQZH 3RAXA 2JXJA 2VA8A 2B2UA 3J81L 2JHDA 2YTUA 1Q82C 3NK9A 5KYIA 4KJOA 4KMOB 4EYIB 1G51A 2KVMA 1KN5A 2JYOA 3W3AA 7ICOA 2F0EA 2VUMH 3UQ2A 2F0PA 2R61A 2ZXPA 3T51B 1X56A 3QUBA 1NZBA 2ATLA 3IDWA 2W43A 4A3GB 3DMUA 3L2PA 4O5CA 3OSOA 2IHNA 4DU9A 4M9NA 1V38A 3GD7A 9ICLA 5CV9A 3BZDB 3V7JA 5JEAH 4PNYA 3OWEB 1JJ2A 1YI2A 1COKA 1MKHA 4B9XA 3BVGA 1TS5A 3U4ZA 1QSYA 4NLCA 8ICSA 3HOYB 4A3FH 2WB1F 2EQYA 1VQDA 3VR5A 3JPPA 4DNRB 4DV5L 4A3MH 3W1GA 5KFHA 5J2HA 1LTTD 8ICGA 2KG5A 1JB3A 4BA2I 1BPEA 5KFQA 3TQ1A 4HJ9A 3J81j 5EE1A 1Q81C 3KBGA 4R1JA 4A3IH 3RFAA 3PMLA 2IX3A 4ZAIA 1NOMA 1I6HB 3J7YW 5KTQA 4OJPA 4ED3A 1UA1A 2JRZA 1UT5A 1JOQA 4ZUJA 5IYDG 3X3NA 4IFDH 1SV4A 4L5RC 3ULPA 3SR6A 4DQIA 4QIWC 1SN8A 3D4WA 3M6ZA 3HOWH 4FS1A 4KV6A 4UAUA 1EYCA 1TQOA 3NTIA 5KG3A 2JA8H 3GTJB 4Q5VA 5KL8B 1DONA 1ASZA 3TP5A 1EY6A 2VL6A 3OWFA 4GLVB 3H7IA 4RQ7A 3J7A5 3KJPA 3N4MB 3CQZB 2PQAB 1JALA 2KBNA 4F4XA 2UXBQ 1FNUA 4Q8FA 1N32L 1DOQA 2C2RA 4B9LA 2DY8A 4AYBB 4Q8EA 1XX8A 5M5XB 1LABA 5EPJA 5C6AA 3UPQA 4R66A 1VQFA 4HSVA 4KY6A 2IOFK 5DQIA 5LMUL 1Z00A 4O3PA 2WINB 1HNWQ 1EOVA 4BBSH 4HIMA 5ALSA 1SE2A 2NN6I 1QLNA 2R8JA 1L2FA 5HHHA 3TADC 2F0SA 3E9HA 3G4SA 1XO1A 3FKIB 3CW2C 2BH2A 2NRWA 4IS7A 3K7AH 3NEMA 3RAQA 1RTOA 3EVQA 4DR3Q 4EENA 3NUCA 2FMSA 2PW7A 5M5YH 4YCXA 2OF1A 1PRTF 3RN5A 3THVA 8ICHA 1ZQHA 3VDYA 3MFHA 4C3HH 1QCKA 2LM4A 2KCNA 1Q8KA 1V1PA 4DL7A 2CH4A 4KD4A 4RA8A 2JEAI 2KEDA 4ECZA 2A6HC 5J0XA 3HKZB 1EL0A 2E75C 1NAPA 3M9NB 2PQAA 1SV0C 1Y14B 1SR3A 2B2VA 3J81c 5EWFA 1GHJA 3T5JA 2KKPA 5IWAL 4BXXH 1S5DD 5DM63 1PFBA 2L55A 1VQHA 3GQBA 3M3YH 4JPBW 5EAYA 4DL5A 4DXFA 1HZCA 1WWVA 4Q43A 2FLLA 4UB1A 1MJCA 2B8FA 4R9WA 2VZAA 1EYDA 4IN3A 2JQOA 4JV5Q 3U58A 2UUAL 2R93H 4NM2A 1CA6A 2C22A 3I90A 4YY3L 3HRZC 4JI3Q 3J80E 1DD2A 3LGJA 1HUNA 4DUYL 4L5TA 1V1QA 2F0GA 4M1UB 3HEJA 3V6KA 2VANA 3TARA 3S1MH 4LK1C 2QB0B 1NJIC 2V9WA 5AHXA 1S0MA 4KTAA 1K83B 5I2XA 5IIMA 1SL1A 2UVVA 2WF9A 4KLOA 1BBWA 3PIPA 3HOZH 3JAML 1U4MA 3JPRA 3BJYA 1TKDA 7ICUA 5ALMA 2D62A 1SNQA 2QKQA 3L4PA 1YHQA 5CJ7A 4CNQA 2HBKA 1IG6A 2WV6D 4Y2XA 2B3GA 2CVRA 1GVPA 4JOIA 4YCVA 3H15A 1PTOH 2ICIA 3T16A 3KOOA 4OJ6A 1RIPA 1WUDA 2H3QA 2YTXA 4BWMA 4QWDA 1IBLL 3A8KE 1GM5A 2EY1A 1SNOA 4QZ8A 3NP8A 2KIWA 1ZOLA 5EKIA 4QW8A 3PSIA 5AI9A 1SYDA 4C8KA 1XTDA 2XI9A 3VCBA 1MQ3A 3BS7A 1G91A 4YXJA 4R8IA 1HUMA 3BS5B 2K52A 3GTOB 1HZAA 1N56A 4KY7A 4F5PA 3UXPA 3RJJA 4RGMA 2R18A 4DQQA 2K50A 1M8AA 4LJZC 5EBCA 5IP9G 4ZUIA 4A4IA 2GVAA 4RKLA 4CDEC 5IGBA 4MHEA 2EANA 1L3UA 1E0BA 5CV4A 2AMCB 2K8AA 1RQNA 3K81C 3M3YB 9ICIA 1RTNA 2W55A 4FO2A 4JW0A 4DOAA 3ZDAA 2OH2A 4MTNA 1VQGA 1SROA 5IGCA 2PNRC 1HNZL 2ZTEA 3D4DA 4JC0A 1OXVA 2F1IA 3QUCA 3QUTA 1VF5C 4RNMA 4IPCA 1O03A 4K5VA 1BCPF 2ZXIA 1XNQL 3DXJC 3CCEA 4X65Q 2E2HH 4LF6Q 5AKKA 3WKBA 4F91B 2KMDA 2F1MA 3UDXA 5IGDA 1A77A 2I1QA 3RTVA 3PW2A 3MR3A 1Z4NA 4FXKC 1BCPB 4EBCA 4RQ0A
chains in the Genus database with same CATH topology
4P71A 4WJ4A 1TWCH 1HR0L 3I4MH 4A3DG 1MIUA 3PUZA 3PCOB 3MXNB 4JV5L 5IT9c 4DK3C 4HJ7A 1RL2A 3KF6B 4DR2L 1X9NA 1W2BA 1J5EL 5C3EH 3L0OA 5BR8L 1TWHH 1E1TA 3EN2A 4OWTB 1EQQA 5GROA 3S15H 3S16H 4YWKA 2UUCL 1Q7YC 4DK6C 2F52A 1U0LA 4C3IH 4UP8A 4JYAQ 2AWNA 4UPAA 3Q8DA 3TS2A 4QL5A 4TQUS 1N34Q 4X6AH 2GVBA 3RNUA 3UDGA 2WAQE 4DPGA 4JI8L 4A3EH 4B3MQ 1WCMH 1K73C 3S1RH 4KLKA 4DUZQ 2UXCQ 2H5XA 5M5WH 1PH4A 4A3EG 1PH9A 2K75A 4OONA 3S24A 2VUMG 2YTVA 4DR6Q 3OYYA 3CC4A 2BH8A 1M90C 2B63G 4GN3B 1NTGA 2NN6G 2FXQA 2BA0A 2VS1A 3TQYA 2QA4A 4LF7Q 4X64Q 1L0WA 4GNXA 4LFCQ 2OCEA 5M3MH 2EQSA 3AFQA 1X3EA 4P75A 1IBKL 3CCUA 4JI7L 1X65A 2PI2E 4X62L 4A3JG 3STBC 4LF9Q 1LYLA 2MQHA 3ER0A 3E9IA 3W5OA 1P16A 1HNWL 3PO2H 5IYBG 2I0QA 2ASBA 5LMUQ 3SGIA 2IY5B 4L5QA 1KRTA 2CKZB 3BZCA 4DV2L 1K8GA 2ZJQA 3H3VH 5FLXc 4DV6Q 4R4CA 4O2DA 5M3FH 4BY1H 2JA6H 3G6EA 4OX9L 1KRSA 3KYHC 3ULLA 3M4OH 3RN2A 4AQYL 3TS0A 2UXBL 3F8TA 1QVCA 1XMOQ 1VQ7A 2IT1A 2Y0SE 5H1SE 4A3JH 4BY7H 1XNRL 3EBEA 2ES2A 4L5SA 4JI1Q 3PIOA 1NE3A 4DR5L 4B3SQ 3F2BA 1KL9A 1VQCA 1YEZA 4P73A 5FLMH 3J80c 4DUYQ 3T1YQ 1S40A 2OQ0A 2UUBL 4YY3Q 2MO1A 2R6GA 3KOJA 5AJ3Q 4BBRG 2JA5H 2UUAQ 3GTKH 5M3FG 2BA1A 5GQOA 2JA6G 4NB3A 4DR7Q 5M5XH 2ZJPA 4JI2Q 1N33Q 1YIJA 4PMWA 3F2CA 3PUVA 1NMGA 4P74A 3AFPA 1FJGQ 3A5ZB 4EQ5A 4DV7Q 3K7UC 2UU9L 2NVTH 1X3GA 3K80C 1K3RA 2YTYA 3A74A 2R92H 4ME3A 2Z6KC 2K5NA 5IWAQ 1KAWA 2Q2IA 3AEVA 1HZ9A 4LW1A 4DR4Q 1CSQA 3RLOA 4GNXC 3T1YL 4MNOA 2WFWA 2EIFA 4LUVA 3KLWA 3JAMi 1XMQL 2PI2A 5IYCG 4BBRH 4MZ9A 5C3EG 3PGZA 1PH5A 4LFAL 4JBJA 1L1OA 1XMOL 3F1ZA 1I94L 1YZ6A 2B63H 4DV5Q 3CCRA 4YCWA 4HJ5A 3M4PA 4NXMQ 4OX9Q 5M3MG 4JI5L 4KHZA 4AH6A 4GN5A 2F4VL 4O0AA 3RLFA 3ULJA 1VQEA 2AHOB 4GOPA 1G6PA 3HKZG 1A62A 4LF5L 3CPFA 4R4OA 5IYBH 2RHSB 3NENA 1SRUA 5ELNA 1E24A 1YHAA 2ZTDA 1OXTA 3I7FA 2VQFQ 3DLLA 1E1OA 2HQLA 2IHFA 3G48A 5FLMG 3BJUA 5GAHC 4GNXB 2WB1G 4X64L 4IOCA 4GOPB 1IL2A 1T9HA 3DM3A 2ATWA 2JA5G 2K5VA 4JI5Q 3GTOH 3CMAA 2I5MX 2YV5A 1QZGA 1PH7A 3FKIG 4QIWE 4A76A 1XPOA 1JB7A 2UXDQ 2DGYA 4B3TQ 1JE5A 1NMFA 1VQ6A 2JEBI 3J81i 4JI8Q 2RCNA 3HOVG 5JEAJ 2ZM6L 1XMQQ 1HH2P 1HJPA 2VQEL 2IX1A 1N34L 3ERSX 4JYAL 1KIXA 1Q86C 1V43A 2V1CC 1N36L 2UU9Q 1O7IA 4XIGS 4BBSG 1JJCB 1FJGL 2A19A 1CKOA 2R7FA 2CQOA 1LM0A 4R4QA 1YJ9A 1YJNA 1X55A 3RZDH 1K83H 1A8VA 4GOPC 1A0IA 1LTLA 2NZHA 2YYZA 3A0JA 3CMEA 2HHHL 3M85A 3B6YA 3K8AA 1S3OA 1HR0Q 5HGQA 3OW2A 1EQRA 4H02A 3HOUG 3NBHB 2MNAA 4J15A 4OO1I 4B3RL 4B3SL 4JI1L 1EIYB 4LF8L 1E7ZA 1WOCA 5E7NA 1D7QA 1CKMA 2N3SA 1XNQQ 3H0GH 1Y1WH 5LMNQ 4AQYQ 1X6OA 1TXYA 1PA6A 2JA9A 1WFQA 3PV0A 5IE8A 1SLJA 2MO0A 3CF5A 1BKBA 2HT1A 5J3BA 1XPUA 3H3VI 3HOWG 2K14A 1Q46A 5HY6A 1Q1BA 1HNXL 1I6HH 1AH9A 1XPRA 1VQ5A 1K9MC 2CCZA 5JJIA 4GN4B 1Z9FA 1D8LA 3D0FA 3K0XA 3HOXG 2OTLA 2VNUD 4YWLA 1YJWA 3CD6A 5C0XJ 2ZTCA 3CPWA 1PH1A 2R7ZH 4KI0A 1IBMQ 4A3LH 1EWIA 4BA1I 3U50C 4LF7L 3TRZA 4KHPQ 5FJ8G 4A3KH 1UWVA 1S72A 3PUYA 2OQKA 1YZ7A 1BVSA 2Q2TA 4KHPL 4WJ3M 4LF8Q 4JI0L 4JI6L 1PV4A 3HOVH 1IBML 1U5KA 5FJ8H 3M7NA 3FP9A 4GKKL 4IPDA 1TWGH 4DV3L 1C7YA 1IBLQ 3HOYH 1FL0A 4JG2A 1VQPA 1DGSA 3KF8B 1VQ4A 1M1KC 3U4VA 2R7ZG 4DV1L 4A3LG 4GLXA 3PF4A 3CXCA 1HNXQ 1I3QH 4LNQA 1B70B 2D0OA 1KHIA 1VQBA 1ASYA 3UDFA 1E22A 3CC2A 4POGA 4A3BH 2GN5A 2K4KA 1IXRA 5C44G 4IPGA 1Q1EA 1WJJA 1J5EQ 5LMNL 4DR2Q 5IYCH 5C4XH 4QY7A 4DR1L 3S17H 1WCMG 2KCTA 3S14H 4IFDJ 2E2IH 1CUKA 2RHQB 3HFZB 4OXPA 1EIFA 4A75A 1CKNA 1K0RA 1X54A 5IY0A 3CCLA 4LF4L 4B3RQ 4QQBX 4JBWA 1VQLA 3GTLH 4X66Q 3JAMc 3I56A 3GO5A 4DKAC 1QUQA 2IX0A 2ALYB 1OXSC 3M4QA 4GLAC 4PG3A 1PYSB 5GAEC 2VY3A 3JC66 2R7DA 4JOIC 4P72A 4PZ6A 1CKNB 3HOXH 1VQ9A 4LF6L 4A3BG 4DR1Q 2E5LL 2CWPA 2LXJA 3FKIH 4HIOA 4IOAA 1SE8A 4DAMA 4RMFA 1VQ8A 1H95A 1N36Q 3PUWA 4OWXB 2HIXA 5DLQE 4AYBE 2MFIA 1MJEA 4DNIA 1NBWA 4K0KL 1PYBA 2VQEQ 4OO1G 2ZM6Q 1PH2A 1HZBA 2N78A 2RF4A 5IP7H 3OTOL 4DV3Q 2UXDL 5IYDH 4APVA 4GKKQ 2KHJA 2NZOA 3PO3G 3G71A 3PF5A 3M9BA 5LMNW 1IZ6A 1Y1VH 2Q2HA 4JI0Q 4RG1A 4JI6Q 5ELOA 1VQKA 1CSPA 3CQZH 1AE3A 3I2ZA 3UDIA 4DV0Q 5JJKA 1Q82C 3KJOA 1WYDA 3ICEA 1G51A 2K5HA 4DR3L 3S2DH 2WAQG 4QJFA 1OXUA 4JBKA 2VUMH 3W1BA 2WP8J 2XTIA 4A3GH 1X56A 2Y0SG 4LF5Q 4JI4L 3HOUH 5K36G 4IJLA 3L2PA 1PHJA 5IP7G 3GD7A 1JJ2A 1QVFA 2D0PA 1C0AA 3HKZE 1YI2A 1Y1VG 2E2JH 1MKHA 3U4ZA 1VQOA 4AYBG 4YHHQ 4A3FH 4NXML 2JA7H 2N8NA 3S2HH 1YBYA 2KENA 3CAMA 3FHWA 1VQDA 5C0XI 4DV5L 4A3MH 3S1QH 4A3CH 1UE7A 1V9PA 3W1GA 4A3IG 3AYHB 1I5FA 4LFAQ 4NXNQ 4IFDI 4BA2I 2JK8A 3J81j 4HJ9A 5C0XG 1Q81C 4C3JH 4R1JA 4A3IH 4DR4L 1NY4A 4JI3L 2L15A 3I4NH 2IHEA 1YITA 1VQMA 2YU9H 4YWMA 2LXKA 4DV7L 4BY7G 3HOZG 2HHHQ 1G291 5IYDG 3CP0A 1N33L 4L5RC 4YCUA 3ULPA 4A3MG 1SN8A 2CFMA 3HOWH 3PO2G 4DR7L 1UE1A 2I5HA 1BBUA 2JA8H 2AKWB 1A63A 3RZOH 1ASZA 2UUBQ 1C9OA 1K8AC 1UE5A 1VQAA 4EX5A 2VL6A 3I4NG 4GLVB 4DR5Q 3J7A5 3T1HL 3KJPA 4UY8C 2PQAB 3UE0A 1R9TH 1YVCA 2KBNA 4B3TL 4NPSA 3MEFA 1N32L 2UXBQ 5C44H 4ALPA 2PMZE 3ZJYC 4DAYB 3CCVA 3HOYG 4IJHA 4YHHL 1FGUA 4DV6L 1VQFA 1QUQB 3BZKA 4LUZA 2XGTA 5LMUL 3I4OA 1P8LA 2QEXA 4LWCA 1QVGA 1HNWQ 1JJGA 1EOVA 2B29A 4POFA 2VQFL 2JA7G 4JI4Q 2DUDA 4Y7NH 4HIMA 4BBSH 1X3FA 2NN6I 1I50H 4R4IA 4X62Q 4LF9L 1L2FA 1QZHA 3G4SA 3E9HA 1L1OC 5JEAG 3CW2C 1GKHA 2BH2A 3K7AH 1B8AA 5C4XG 1GD7A 3NEMA 2F4VQ 4DR3Q 3KDFB 1KC8C 1YNXA 5M5YH 4JBMA 3KFUA 1SMXA 3RN5A 1VQIA 2C35B 2HIVA 3VDYA 4DR6L 2N49A 4A3CG 4C3HH 4LUOA 3J7ZC 1Q8KA 1PH3A 4A93H 1N32Q 4DUZL 2JEAI 3OTOQ 1VQNA 2UXCL 1I94Q 1OTCA 4OWWB 3GTGH 2AWOA 2NVYH 4DV0L 3NELA 3H0GG 2PQAA 4HJ8A 1Y1WG 1Y14B 1SR3A 4JCVE 3J81c 3T1HQ 1YHBA 3A5UA 2WB1E 3HKSA 3I55A 2KHIA 4AIMA 5IWAL 4A3FG 4IFDG 4BXXH 1SFOH 2UUCQ 1FVIA 1VQHA 3WWVA 2NVXH 5EAYA 5BR8Q 1HZCA 1Z47A 1HR0W 2A8VA 2CWAA 1PH8A 3L7ZC 3KF6A 1MJCA 1KXLA 2E5LQ 4JI2L 2VZAA 4A93G 3GTPH 1VQJA 2JQOA 4JV5Q 3U58A 2UUAL 2R93H 3GDEA 1VCIA 3RR5A 5GADC 3EIVA 5AJ3L 2QGQA 3BU2A 3D31A 4YY3L 4JI3Q 3LGJA 3F2DA 2I5LX 4DUYL 1GO3E 2R92G 2Z6KA 1V1QA 3AQQA 4L5TA 1Q12A 1VS0A 3KDFA 1PH6A 2F3IA 2KCMA 4GKJL 1XNRQ 3GTQH 4NXNL 3S1MH 3I4MG 4X65L 4A3DH 1NJIC 3CCJA 4XTCS 3STBD 1BBWA 2JA8G 3HOZH 3PIPA 3CCQA 1HNZQ 2Q2UA 3S1NH 4FDBA 4DV4Q 1UEBA 2D62A 4TVAB 4DV2Q 2NVQH 3CCSA 1LUZA 1YHQA 1JT8A 2EXDA 2OWOA 3M3YH 4DV1Q 2B3GA 4JOIA 1GVPA 4YCVA 5C4JH 3H15A 4A3GG 4LFBQ 2OTJA 3GTJH 1RIPA 2YTXA 4HIKA 3RLNA 1IYJB 1IBLL