1Q46A

Crystal structure of the eif2 alpha subunit from saccharomyces cerevisia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the N-terminal region of the alpha subunit of translation initiation factor 2 (eIF2alpha) from Saccharomyces cerevisiae provides a view of the loop containing serine 51, the target of the eIF2alpha-specific kinases.
pubmed doi rcsb
molecule tags Translation
molecule keywords translation initiation factor 2 alpha subunit
total genus 54
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1q46A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q46A01
4GOPB 3TS2A 5LMUQ 2UXCL 3CPWA 2JA5H 1FL0A 1VQAA 4JI7L 3HOUG 4LUZA 4GKKQ 4KHPQ 5C3EH 4JBWA 2B29A 4LFAQ 5C0XG 3GTMH 2R7DA 5ELNA 3GTOH 1X65A 4GLAC 4KHZA 3TQYA 5IE8A 3PUVA 2IHFA 1K8GA 2NZHA 4A3EG 4C3IH 4EX5A 4RG1A 1Q82C 2E2JH 4DV2L 2UU9L 4DUZQ 1X56A 4YWLA 3H3VH 4J15A 1VQKA 4A3KG 2K5HA 2WAQG 4LF6Q 3PIPA 3I7FA 4A3DH 4A93G 2FXQA 4DR3Q 5JJIA 4DV6Q 4BXXH 2LXKA 4Y7NH 1S40A 2UXDL 1NJIC 2YTYA 4AIMA 2ZM6L 3J7A5 1Q46A 2CWAA 1EUJA 4DV3Q 1PFSA 1WCMH 3JAMi 2A8VA 4X62Q 3GTQH 4B3RQ 4GOPC 2HT1A 1FJGQ 4OX9L 4K0KQ 3I4NH 4BXXG 3U58A 4YWMA 4P71A 3T1YL 3PCOB 2NN6G 4YCVA 3HOYG 2JA8H 4DUYQ 1K83H 1O7IA 4LFBQ 5H1SE 3RNUA 4LFCL 3A5UA 1W3SA 3HOZH 4LF8Q 1VQGA 2IT1A 2NZOA 1K8AC 2A19A 5GROA 1I94L 4DAMA 3UDXA 3EIVA 4MTNA 1VQIA 4JI4L 5IWAQ 1I6HH 1WI5A 3ULJA 1S3OA 2KBNA 4AYBG 4JI5Q 4P74A 1Q81C 3IRBA 4QY7A 4YCWA 3RN2A 3ERSX 1PA6A 2VQFL 1J5EL 1FVIA 3M3YH 4LWCA 1SRUA 4A3LH 3EN2A 2MNAA 4GS3A 3CCRA 2AWNA 4DPGA 2ZJQA 3D31A 4GKKL 3A5ZB 4X64Q 4JV5Q 4DV0L 4JI0Q 1V43A 3D0FA 3J81i 4DUYL 2UUAL 3EBEA 2PMZE 1XMOQ 1EIYB 2BH2A 1VQ4A 1SLJA 2B63G 2ZTDA 4H02A 3KJPA 3K7AH 1KIXA 1XPUA 2VUMG 3HOWH 2Y0SG 1TWGH 3CCUA 3U4ZA 4A3JH 1V9PA 4C3HH 1HNXQ 4PZ8A 2E2HH 1C0AA 3T1HQ 2UUAQ 1EOVA 2EIFA 1G291 3GO5A 4TVAB 5AJ3L 4DR3L 2NVQH 1N32L 2XTIA 4A76A 2K52A 4HIDA 3S24A 4L5QA 1BBWA 3CQZH 3KLWA 5M3MG 1WFQA 2ZM6Q 1SE8A 2Q2TA 3CC4A 5C4XG 1HR0Q 1XJVA 3ZJYC 4A3GH 2AWOA 4HJ9A 4DV4L 4FDBA 5FJ8G 4JCVE 4OWTB 3H3VI 4JG2A 2ES2A 1JE5A 1IBKL 3A0JA 1G6PA 2F52A 5HGQA 2CQOA 1Y1WH 4JI3Q 1Y1VH 3GTLH 3M4OH 1VQCA 4JI8L 1ASZA 1OXUA 2JA7H 1EQQA 1Y14B 1AE3A 1L1OA 2RHSB 3UDFA 1GD7A 4YHHL 2MFIA 2K5NA 1QVCA 1TWCH 4X66L 2C35B 5J3BA 4APVA 1QVFA 2HIXA 3MEFA 3KDFA 1KHIA 3CP0A 4P73A 2WP8J 3ULLA 5C4XH 4DV7L 1HNZQ 4GLVB 3PGZA 1X3GA 3ULPA 4JV5L 2ATWA 5E7NA 3WWVA 4JI3L 2JEBI 1WJJA 2BH8A 3PV0A 2PQAB 1EWIA 4GN5A 2PI2A 2OCEA 3STBD 1PH4A 2VQFQ 3TEHB 4PMWA 1Q7YC 1UE5A 1YNXA 2UUCQ 3FP9A 3S1NH 2NVXH 4IPHA 3JAMc 4B3TL 3FKIG 2GN5A 2KCMA 2OTLA 4OO1I 1AE2A 3KF8B 4C3JH 1YJ9A 1N9WA 2UXCQ 2KHJA 4LUVA 2HQLA 3BZCA 3L2PA 1L0WA 2E5LL 3VDYA 4AH6A 2B63H 1YHAA 4OX9Q 2QGQA 4AYBE 3RN5A 3PF5A 1YI2A 4DR5L 1N34L 1JJCB 3B6YA 4KI0A 1JB7A 1VCIA 4POGA 1I3QH 4GKJQ 1N8RC 2A1AA 2ZTCA 2D0PA 3M9BA 2K5VA 2N8NA 4PG3A 1PH7A 2JK8A 3RLNA 1XPRA 2R93G 1SN8A 3JC66 5BR8Q 4IFDG 1PHJA 3E9IA 3A74A 4B3MQ 2JA6G 3HOYH 4JOIC 1A63A 2NVTH 1VQHA 2VZAA 3RLOA 4DV2Q 1PVOA 1Z9FA 3CCQA 4QJFA 3CMAA 1BVSA 1VQPA 4DNIA 1HR0L 3S1RH 3CCMA 1VQLA 1VQEA 4A3KH 2IX1A 5JEAJ 1XNRQ 1M90C 1Y1VG 4B3ML 4LUOA 3I55A 2UUCL 3M4QA 5IP7H 4ALPA 3PF4A 1JT8A 1P16A 2GVAA 1OXXK 2K75A 4DV1Q 4LFBL 2N3SA 3NEMA 1EFWA 4JI6L 3M4PA 2OQKA 4JYAL 5BR8L 1LTLA 5LMNW 5DLQE 4BBRG 1VQBA 5LMNL 2RF4A 1FGUA 3I4NG 2KHIA 4R4CA 4NPSA 3TREA 4A3IH 4R4TA 2AHOB 2H5XA 1XPOA 4DAYB 1MJEA 4L5SA 1Z47A 3HOVG 2Z6KA 4DV6L 3HOWG 4OWXB 1D8LA 3U50C 2AKWB 4NXMQ 2UXDQ 2BA1A 5GAHC 3PO2H 4A3BG 5IY0A 1Q1EA 3UE0A 2JA5G 3CC7A 1K0RA 2MO0A 2R92H 1N33L 1E22A 2ALYB 3NBHB 5M3MH 2YTVA 3J7ZC 2Q2UA 4OO1G 1UE7A 4HIMA 1SMXA 4A3GG 4A75A 2PNHA 1YEZA 3KF6B 5FLMG 1Q8KA 2VS1A 4LFAL 4A3CG 2MQHA 2E8GA 4JI2L 2VY3A 4XIGS 3T1HL 4LF4L 2NVYH 3BZKA 4BY7G 1Y1WG 2R7FA 2R7ZG 3Q8DA 2Q2IA 2JE6I 2OQ0A 2F4VQ 4GNXC 4DR2Q 2JEAI 1RIPA 1KRSA 2JA9A 1PH3A 2VUMH 5JJKA 3STBC 2E5LQ 4IOCA 3I2ZA 1YIJA 1C7YA 4JYAQ 4LF5L 4IFDJ 1JJGA 4K0KL 4DR5Q 3K81C 3CCEA 1B7YB 4GN3B 4IPCA 2F3IA 4BY1G 4GNXA 3HFZB 4A4IA 2IHEA 3K0XA 3AFPA 3DM3A 1Q86C 1IBLL 5GAEC 4JI2Q 3L0OA 1QZGA 1JMCA 1BKBA 1PH9A 3J81c 4BBSH 3CMEA 5IYDG 4YCUA 3CCLA 4LF6L 2Y0SE 2LSSA 1A8VA 5IYBH 4OONA 4JI5L 5IP7G 5M3FH 2VQEL 1HZCA 1MJCA 1OXSC 4WJ3M 1GKHA 4GKJL 4L5RC 4NXNL 1HNXL 3UDGA 1X54A 4JBKA 1AH9A 3AFQA 4BBRH 3M7NA 5M5WH 1QUQA 2R6GA 4DR4Q 1LYLA 3SGIA 5C0XJ 1TXYA 3CPFA 3AEVA 2JJQA 3ER0A 3U4VA 1UEBA 3CD6A 1QVGA 2DUDA 2Z0SA 4X64L 3PUWA 4BBSG 5EAYA 4B3TQ 3AYHB 1B8AA 4BA1I 1NY4A 1EYGA 1HH2P 4O2DA 4PZ7A 3K80C 1N36Q 1I50H 1GO3E 4LF7L 4UY8C 2N78A 3KFUA 1IXRA 2EXDA 3CF5A 1HR0W 3MXNB 2CKZB 2R92G 1TWAH 4JC0A 4DR7Q 3GTPH 1CKNB 3K7UC 2QA4A 2HIVA 3F2BA 1HZBA 2JA8G 1N33Q 1PYBA 5IP9H 1L1OB 1WCMG 3FKIH 3KOJA 1MIUA 2VW9A 4IPDA 2XGTA 4DR1Q 2ASBA 3PO3G 1HNWL 4GLXA 3S2HH 3J81j 1FJGL 4NXML 3S2DH 3S1QH 3HOZG 3I4OA 1E24A 5GAGC 3S17H 1HZAA 2ZTEA 1X9NA 3AQQA 2RCNA 1XMOL 1J6QA 3OTOL 4R4OA 4X65L 2EQSA 2I5MX 2PQAA 1IZ6A 4X62L 3H15A 1QUQB 4B3RL 3J80c 4LNQA 3S1MH 4YHHQ 1H95A 4IO9A 4DR1L 1VQDA 3CXCA 4JI1Q 3I56A 4B3SQ 1OXVA 1L1OC 4TQUS 2UXBL 4GOPA 1IBLQ 1CKOA 4BY7H 1YZ7A 2K4KA 4RMFA 1HZ9A 1X3EA 4O0AA 5IYBG 3GD7A 4AQYL 1CSPA 1W2BA 4DK3C 1EIFA 1VQ5A 2WB1G 4UP9A 1X6OA 3NENA 1BBUA 3I4MG 1CKNA 2KCTA 3PSIA 3DLLA 4WJ4A 1NE3A 3OTOQ 4P72A 1E1TA 3T1YQ 1VQ7A 1VQ6A 5FLXc 1A0IA 4R4QA 1SROA 1GVPA 4A3FH 4BA2I 1EQRA 1KL9A 1R9TH 1VQJA 4QL5A 2HHHQ 4BY1H 4X6AH 3TS0A 1LUZA 2B3GA 3G4SA 1KQSA 2ZJRA 4XTCS 4DR4L 1V1QA 3UE1A 1X3FA 1SR3A 1TWFH 1UWVA 4IOAA 1YZ6A 2GVBA 1J5EQ 1SFOH 4UP7A 1VQ8A 1VQ9A 3HOXH 4LF4Q 4DR7L 1YJWA 2K14A 3HOUH 1IBKQ 4JI4Q 3RZDH 2R93H 4DKAC 5M5YH 2WFWA 3F8TA 1TWHH 2JA6H 4QIWE 4DV1L 1PH2A 4JI1L 4B3SL 4PZ6A 2AMCB 1S72A 4LFCQ 4DV4Q 5FLMH 1QZHA 1PH8A 1KD1C 3BU2A 4LF8L 4ME3A 1VQOA 1IL2A 1HJPA 5ELOA 1K9MC 4JI7Q 2PI2E 1E7ZA 5HY6A 5K36G 5M5XH 2CFMA 2ZJPA 1XTDA 3GDEA 1M1KC 4A93H 2WB1E 4YWKA 2OTJA 3FHWA 1IYJB 3S15H 1N32Q 4DR6Q 1K73C 4JOIA 3RR5A 4DV7Q 4GNXB 3W5OA 1PH6A 3OYYA 4GN4B 2HHHL 1KC8C 2YTXA 4QGUA 4DV0Q 5C0XI 4X66Q 1CSQA 3H0GH 5IYCG 4A3IG 1RL2A 2VNUD 2IY5B 4NXNQ 4A3EH 4DR2L 2RHQB 4P75A 2E2IH 2VL6A 1P8LA 2L15A 2N49A 4IPGA 1XNRL 1OTCA 4A3BH 1UE6A 2UXBQ 2DGYA 3W1GA 4A3DG 1UE1A 5IWAL 3I4MH 4DUZL 3OW2A 1WYDA 4YY3L 3GTKH 4C2MH 5GADC 1KAWA 4LW1A 3W1BA 4A3MG 3LGJA 4DK6C 3S14H 5IP9G 3E9HA 3KDFB 3J80i 1C9OA 5AJ3Q 1Q1BA 4A3CH 1VQFA 3KJOA 2D62A 2NN6I 3ICEA 3NELA 2YV5A 5M3FG 2KENA 4POFA 3G6EA 1YHQA 4X65Q 4JBJA 1JJ2A 4UP8A 4HIKA 4HIOA 4IFDI 1PH5A 4L5TA 3KYHC 1A62A 4QQBX 1ASYA 2ID0A 1GM5A 4LF9L 5JEAG 3HOXG 2V1CC 1D7QA 2K50A 3GTJH 1PH1A 2VQEQ 2CCZA 1HNWQ 1CKMA 1VS0A 3KF6A 4HJ8A 5C3EG 1U0LA 3M85A 2UUBQ 1IBML 1Q12A 2UU9Q 1YJNA 4A3MH 3F1ZA 4R4IA 1B70B 1LM0A 4HJAA 1YHBA 3F2CA 4NB3A 1I5FA 1G51A 3K8AA 3PUYA 5IYDH 3HKZG 1DGSA 1HNZL 4LF7Q 1OXTA 3PO2G 3UDIA 1IBMQ 1KXLA 1E1OA 5C44G 2QEXA 1I94Q 3HKSA 4DV5L 1XNQQ 1VQMA 2JA7G 3PUZA 4KLKA 1NMGA 2MO1A 4KHPL 3G48A 3CCJA 3CW2C 4A3LG 1NTGA 1PV4A 2Q2HA 3S16H 3E0EA 2CWPA 1YVCA 3RZOH 1CUKA 4JI6Q 2IX0A 2Z6KC 4DR6L 3CCVA 2I0QA 3PO3H 2JQOA 4JI8Q 4DV5Q 5C4JH 3H0GG 5IYCH 4IJHA 1XNQL 4Y52H 4DV3L 4JI0L 3L7ZC 3BJUA 1T9HA 4OXPA 1N34Q 5JJLA 1U5KA 5IT9c 3GTGH 3CAMA 1MKHA 2LXJA 1XMQL 4IJLA 4AQYQ 2WAQE 1VQNA 4OWWB 4UPAA 4YY3Q 3HKZE 2R7ZH 4MNOA 5C44H 5GQOA 2UUBL 1NBWA 1E3PA 1NMFA 2I5HA 1K3RA 1YBYA 5LMUL 1N36L 1L2FA 4MZ9A 1KRTA 2OWOA 2YYZA 1XMQQ 2I5LX 3PUXA 1PYSB 3PIOA 2YU9H 3G71A 4LF9Q 5FJ8H 4A3FG 1X55A 3CCSA 2D0OA 3RLFA 4R1JA 4LF5Q 2BA0A 5LMNQ 4HJ7A 1WOCA 3HOVH 4HJ5A 2F4VL 4EQ5A 1YITA 3CC2A 4JBMA 3TRZA 3F2DA 4A3JG
chains in the Genus database with same CATH superfamily
1PRTB 3EJIA 5LMUQ 4RQ2A 4ECRA 3NQTA 4KKTA 4NL9A 1FL0A 4JI7L 2RDHA 2A6HC 4GKKQ 3GDXA 4I2JA 2R7DA 1STNA 5ELNA 4DFMA 3TQYA 5IE8A 2RVLA 5KT5A 2NZHA 3U9SA 4A3EG 4EZ9A 4EX5A 4RG1A 4DV2L 3GQCA 3JAML 3QZ7A 5CRXA 4QWCA 3H8WA 5J0WA 2WAQG 4LF6Q 1LV5A 2DL0A 4KLFA 1TR5A 9ICIA 2FXQA 1X9XA 1ENFA 1T3QA 5J2HA 4DV6Q 2NVXB 4Y7NH 3TP7A 2C22A 4C8NA 1AW7A 5DGBA 2EYMA 2CWAA 4NLGA 4RQ6A 5F9NA 1T94A 1C4QA 3ISBA 2V4RA 4X62Q 2A8VA 1B2TA 4GOPC 4OX9L 2FPKA 3FYHA 3I4NH 8ICYA 3QYPA 1EOTA 4MHEA 4IFDH 4KY7A 3JPTA 4F87A 5FO7B 3SVMA 2RRDA 1DOQA 2E2HB 3LK9A 3K57A 1ZRMA 4PJ0U 3NTKA 1QNKA 2P5ZX 3RBDA 1VQGA 4LF8Q 2E2IB 3K1RB 2RSOA 5D14A 2KJ5A 5KFVA 5KFZA 2KA7A 3UDXA 4MTNA 4JI4L 1I6HH 5IWAQ 2KMDA 3P1HA 1CFMA 1Q81C 4QY7A 4C0ZA 2L0CA 2VJ5A 2XGPA 4LWCA 4C8LA 1MHWC 2LMRA 3L5KA 8ICLA 1V1PA 1HPCA 1ESRA 4GKKL 1F2MA 5J2BA 2W03A 5TSSA 1X6IA 4KLGA 1TQOA 2UUAL 9ICUA 2PMZE 1WWVA 3H8JA 1O08A 1JORA 1MGSA 2K5QA 3KJPA 2VUMG 4YIJA 2HHUA 2Y0SG 1TWGH 3RUZA 3CCUA 5KG7A 3RBEA 3JPNA 7ICUA 2A69C 3T1HQ 1EOVA 2EIFA 1G291 2DUYA 4DQQA 2N55A 1SZPA 4ECVA 5F2DA 3SXHA 3S24A 4HIDA 4KY5A 5M3MG 3CC4A 1SE8A 5C4XG 3RAXA 4HJ9A 3RJHA 1IV8A 1TS2A 3D6CA 1HTPA 5FJ8G 4R64A 4JG2A 5C4ZA 5IGEA 4Y2PA 3A0JA 2FJ2A 5J2JA 1J2MA 1DOKA 2F52A 1BR9A 2NVYB 3AB9A 4JI3Q 5NUCA 3GTLH 4FZNA 3DXJC 4KKSA 1FNWA 5L1JA 1WTVA 4IQTA 5I4DA 5DQGA 1L1OA 1SEBD 4F4ZA 3V6JA 1GD7A 1SV0A 1R4PB 4DFKA 1I6HB 2XCPA 4I2EA 2B2WA 4APVA 3MEFA 4RKLA 5C3EB 2ZIXA 3DEEA 4DWIA 8ICSA 5ALRA 1KHIA 2HCIA 4P73A 4TQSA 3ULLA 5C4XH 3RR8A 3PGZA 5E4XA 2PZUA 2ZXOA 5EOZA 4J9NA 2ATWA 5CV8A 3BQTA 2Q8TA 3B9JA 4KHVA 4DK0A 2EAMA 1WJJA 4UHVA 3PV0A 3HOVB 1EWIA 2AQ2B 2OCEA 3ITPA 5AKEA 3ZDDA 2LY7A 3TN2A 2FMSA 2BR0A 2PO4A 1GJXA 5J0UA 4M0AA 2A6HD 2QARB 1S5BD 3FP9A 3S1NH 2NVXH 3JAMc 2W11A 5IIFA 3Q24A 4B3TL 1L7NA 3FKIG 2KCMA 3MXNA 5CV6A 4OCZA 4QJFB 1AE2A 5DAUA 9ICBA 3M6ZA 3AL0B 5F9LA 1N9WA 2SDFA 2UXCQ 2KHJA 2W9BB 2HQLA 1L8LA 3QU2A 3BYYB 1F9RA 3L2PA 4FF2A 1O7LA 4AH6A 1EY4A 4ED8A 4IR9A 2W3RA 2QGQA 2W8LA 4DEZA 3M9MB 3B6YA 3NVZA 1ZQSA 5KGUA 2ZTCA 2D0PA 3U9OA 1XPRA 2R93G 2V9WA 3JC66 2AJQA 1IL8A 4B3MQ 3E9IA 3LVWA 2KVSA 2RSNA 3DHQA 3HOYH 4DSKA 3TADC 5AM3A 4RT3A 1VQHA 2NVTH 1L3TA 5EKLA 2PXIA 5HHHA 8ICNA 5DQHA 3UPQA 5DGAA 1JOKA 3MC1A 1BVSA 4KTAA 7ICQA 3I90A 4H44C 1SE2A 7ICTA 4CBVA 1VQPA 1VQEA 4H0LC 3TACB 3AU2A 4U673 4LUOA 2UUCL 3TI0A 2J6SA 2XO7A 1I4GA 4ALPA 1JT8A 4DF4A 4J9MA 3J80L 4JW0A 4EYHB 3J7AV 2YMPA 3R2TA 3NEMA 1EFWA 3RRHA 1LT4D 3L3OC 2JGAA 3QWNA 1ZQKA 1MI2A 4IQZA 3WK8A 4BBRG 1GUNA 5IGDA 2KQ3A 1NK4A 2RF4A 3I4NG 1FEZA 2KHIA 3NTHA 3WK6A 4R4CA 1QLNA 1TY2A 1BPDA 1FFUA 2Q8RE 2H5XA 1MJEA 1SXEA 5EPLA 7ICSA 4DV6L 2JA5B 3BQ0A 4OWXB 1D8LA 4MEXA 2BA1A 1EEFD 4A3BG 1VLBA 3HRDD 2CVRA 3MXGA 1Q1EA 9ICEA 2E5SA 2F3VA 2F76X 3CC7A 1K0RA 5BN5A 5EWGA 1D5MC 1SV4A 1E22A 1SJHD 2YTVA 3NWSA 2PPBC 2TSSA 3SD7A 1S4ZA 4J9RA 1UE7A 2B2TC 4AP9A 3PW2A 4A3GG 2PFPA 4NY8A 2PNHA 3KF6B 5E4WC 4EVOA 4DAPA 5FLMG 2F4IA 3QEAZ 2HDMA 3BVGA 4DFAA 4G4KA 3T1HL 5IINA 8ICHA 2ZG6A 1Y1WG 5CEHA 1SL0A 1E2ZA 3Q8DA 2JE6I 4UAYA 2F4VQ 5KG2A 4BY7B 2JEAI 2JA9A 2VUMH 3GIMA 2E5LQ 4JYAQ 2G06A 4F93B 2XVSA 1JJGA 2FLNA 5KFEA 4ECWA 2XNAC 4J8QA 2AGPA 2K01A 2NUCA 3K81C 4DR5Q 4GN3B 3BS7A 3SR1A 4BY1G 3C2PA 4GNXA 3KHHA 2IHEA 2JXJA 2W7PA 2HHTA 5KFAA 2ESEA 5HMLA 4IALA 3L0OA 4FXDA 5KFIA 1VF5C 3ISDA 3N4MB 5DLFA 4PZNA 3CCLA 2YB4A 5C4JB 2LSSA 5KFKA 2LBOA 8ICBA 3IL8A 5IYBH 2W9BA 5IP7G 2VQEL 1HZCA 3C2LA 4IUNA 4EYIB 4IZ8A 3IAYA 2FDRA 4F50A 1UT8A 3MR5A 4I28A 4L5RC 4DL3A 5AKIA 2NRWA 3I4MB 4GZYC 5KFPA 3NVVA 1RYSA 3AFQA 4HMJA 4ECQA 1K0SA 4IRCA 3DDHA 1D5ZC 2R6GA 4J9OA 4DSLA 1SYFA 2HW3A 2JJQA 3U4VA 4DL2A 2XVTA 1TIID 4B9WA 1G8ZD 3KKAC 1QB5D 3IFDA 3SAGA 5EAYA 3I28A 8ICVA 3KFUF 4BA1I 2JEJA 4F4XA 5BOLA 4K5XA 2KCCA 3KFUA 1L3VA 1HR0W 3MXNB 1K1QA 2F0LA 5KNDA 3H0GB 3GTPH 2KSOB 2NO5A 4LMQD 4KN7A 2BPGA 4XYOA 5KT3A 2JA8G 1SYEA 1PYBA 1RTOA 3FKIH 3DWAA 1A3UA 1SKWA 5A2QE 2IOHA 4M6WA 4IPDA 2VW9A 3SV3A 4DR1Q 3PO3G 4J9LA 2ALZA 5DKWA 1QJOA 5AHXA 5JRTA 5J2GA 4GIBA 2LYHA 4GLXA 3ZYYX 3S2DH 1ENAA 1U45A 1W6KA 4DXGA 1UAPA 5KRUA 3HOZG 2E8OA 2LYAA 1P7DA 3QOLA 1XYIA 3I4OA 1ZD2P 3S17H 2EZZA 2O6KA 1X32A 1ZQCA 1X9NA 1XMOL 1EY6A 4R4OA 2VB3X 3FPUB 9ICRA 1QUQB 4LNQA 3S1MH 1X42A 4UAVA 2KFZA 4IO9A 4BUGA 2UVRA 1PFBA 3I56A 2PZTA 4A3IB 2ZUDA 1L1OC 2JN4A 4DA2A 3RB3A 5CB1A 1IBLQ 3MR3A 5AKXA 1NR2A 3SV4A 3VYUA 1X3EA 3MGIA 4FXKC 1W2BA 2JH1A 3BVZA 1EIFA 1MSGA 4I7AA 2KOBA 4K4HA 4C8OA 1EIGA 3H8SA 5J2FA 1ZQ1C 1CKNA 1S5FD 5AM4A 2KCTA 4UDUC 3DLLA 3PSTA 3QU7A 4KLDA 4UB8U 4KLEA 3T1YQ 4LF4Q 1VQ6A 1SROA 2RP5A 2EYHA 1R9TH 4NLZA 4QL5A 1RYRA 4A3MB 2K4HA 1LTSD 1CZWA 5L9XA 1SYGA 3TZDA 2ZJRA 3QX7A 1Z1VA 5HP4A 2KE7A 1SR3A 1LO5D 4TUSA 2UVWA 4M8AA 4ZK9B 1J5EQ 5FKAC 4NM1A 4N9TA 1VQ8A 2QKQA 2LHTA 4N9PA 4CF5A 1ZJNA 2K14A 1PRTD 5D65A 1YJWA 3NP8A 3GTJB 4DAVA 2DPJA 2F0GA 4KMUA 2EE1A 3LWEA 1PVRA 2JA6H 4DV1L 1TAQA 2BCOA 3GP7A 4BY7G 1TAMA 8ICIA 4JI1L 4EGVA 2ISPA 1S72A 2AMCB 1PFNA 1KD1C 5FLMH 4LF8L 4C8KA 2SNSA 4S3SA 4IS7A 3P20A 1HIWA 1I4RA 1Q90A 4YWKA 2OTJA 2EAOA 1IYJB 1FYCA 4DR6Q 2IOFA 2MPMA 3ND9A 1K73C 3RR5A 4DV7Q 4F92B 5J0RA 1I4HA 3MABA 3MBYA 1H9SA 5HNKA 5DB9A 3OHXC 4ZOHC 3OYYA 3DWPA 4GN4B 5DM73 4QGUA 1KC8C 2G9DA 1CHQD 5J0SA 3C28A 3FDTA 3H0GH 5TISU 3H94A 3MHBA 4ZKBB 1RL2A 5J39A 3GTPB 2VNUD 3NBHA 5L1LA 4LJZC 4KLOA 4M9JA 4DSFA 2A3VA 2N49A 5M9OA 3N6RA 4IPGA 2WB1F 4FBTA 4FP5D 4YMOA 5B66U 1L0YB 2UXBQ 1WUDA 1VMCA 2F0VA 4A3DG 1U9RA 4C8MA 3TADA 1LT5D 4ULLA 1DZ1A 4KX3A 2G09A 2K5WA 2O4XA 1WYDA 3H6MA 4C2MH 1XX8A 1UPHA 3CHBD 4NMZA 3LGJA 5EPJA 1LTBD 4C3HG 4C3IG 2HOIA 4OD0A 4RU9A 4I2CA 5EPKA 2ICEC 4OO1G 4A3CH 2QEJC 3NBIA 4JV2A 4F88A 2B2UA 5CORA 4CJ0B 4UB2A 5HHIA 2NN6H 5M3FG 4POFA 5IIOA 3G6EA 3L3FX 1YHQA 1VDZA 9ICJA 2F0EA 4UP8A 4HIOA 5ALFA 5J2CA 3I72A 1NK6A 1PH5A 2B2TA 1S0MA 3KYHC 3QJYA 4L5TA 4Z6CA 1ASYA 1GM5A 1NK8A 3HOXG 4QZEA 4I2BA 4ECYA 1D7QA 2K50A 3GTJH 2F1JA 3I4NB 2EH9A 1CKMA 2IL8A 3NVWA 9ICOA 3HG9A 2UUBQ 1FO4A 3EWAA 2JRZA 1Q12A 3V05A 5KT4A 1RPLA 1AZPA 2FI1A 4GXKA 5A35A 4FZLA 4KITB 1Q3VA 1I5FA 3PUYA 5IYDH 3PO2G 1B4FA 1OXTA 2BGWA 3UDIA 1WG8A 5G5HA 4Z6FA 4BDPA 5C44G 1I94Q 1G6ZA 3C3LA 4ED3A 2EZYA 1QCBD 3URYA 3PO4A 1TKDA 4NM2A 3GV7B 2F0HA 3G48A 3P75A 4K14A 3CCJA 1PV4A 3S16H 4A3LG 5KNBA 2Z6BA 5KG6A 3V72A 2JA7B 2Z6KC 2CRXA 4PV1C 3CCVA 2I0QA 3JPPA 1HCZA 1SNOA 3RJIA 5AM1A 1SNMA 3R8BA 4L8JA 2C5CA 2JQOA 9ICKA 4JI8Q 4DV5Q 5IYCH 1ILPA 2HHVA 3Q8MA 4JI0L 2A1JB 4QWAA 4R9WA 5JJLA 2NRZA 4C80A 4TURA 1HUZA 1LTID 4U7CA 2HBMA 4FS2A 1MKHA 2LXJA 3W2DA 1F9PA 4UPAA 3HKZE 2R7ZH 4WFN3 2EJFC 1FR3A 2F0TA 2I5HA 1E3PA 1L8OA 1SBBB 5LMUL 3SK6A 5FO9B 4QZIA 1X3QA 1SNPA 4MZ9A 2YMMA 2MGSA 3A8JE 3IG5A 3KTQA 1PYSB 1ZOLA 3AU7A 3G71A 2KN7A 2E1EA 4DXFA 1X55A 8ICMA 2AUKA 2RHFA 3BS1A 2NYVA 1AN8A 4RGNA 2SOBA 4I2DA 4LF5Q 1PTOC 2EJMA 1ONLA 4RUCA 3NGDA 3PVXA 3PV8A 3AMUA 3HOVH 2KKVA 2F4VL 2WFAA 1S9FA 1Q3LA 2F0NA 1YITA 5EQ0A 2AQ4A 3CC2A 1PTOF 4JBMA 3TRZA 1L3SA 1LT3D 4GOPB 2M9NA 2UXCL 3CPWA 2XWBB 1VQAA 1ZQDA 1S76D 4B9SA 1MD2D 5KFWA 9ICWA 5C3EH 4YMMA 2N88A 5JAVA 2EY2A 3MR2A 4OIKA 3ETLA 2R61A 2R8KA 3M7DA 2LM4A 3CRKC 3K5OA 1ZQBA 5BOMA 3HZXA 1VQKA 4QWDA 5C4XB 1D2BA 1SIJA 5KFCA 5C3WA 4A3KG 3E2EA 1V1OA 4QZCA 3ZDCA 2VB2X 3WOEA 3H91A 3QU5A 1I4QA 4BXXH 1B44D 2LXKA 1COOA 3OMGA 1S40A 1SXDA 3MGVA 2UXDL 3PIO3 1CM9A 1EUJA 3SEIA 1PFSA 1WCMH 5IGGA 1A3VA 2W9CA 3JAMi 2HT1A 4O3QA 1Z1BA 5J1ZA 3U58A 4YWMA 3WKAA 3PCOB 2KTQA 3T1YL 5ALHA 4QZBA 9ICXA 4LFBQ 4PHAA 4K6DA 5H1SE 3A5UA 4YFKA 1W3SA 2A6EC 2FFKB 3MR6A 4B9TA 1DD2A 5KFNA 1S8OA 2A19A 3P7JA 1I94L 4DAMA 2ICIA 1RTNA 1AQ6A 1VQIA 1WI5A 1N5XA 3NUQA 5KG1A 1ZQPA 1O78A 5AK3A 3NVYA 1HQRD 4BXXG 1PA6A 1N2XA 2M0NA 3ERSX 2B8GA 4PQXA 1J5EL 1FVIA 3C29A 1HA5A 1CEZA 2MNAA 4QZFA 1Z19A 4GS3A 1JB3A 2AWNA 2ZJQA 3D31A 2P6UA 4JV5Q 1PRTF 4JI0Q 3OHAA 2W9AA 1V43A 1BCPD 4Y2SA 4P4MA 3D0FA 3EBEA 3NSWA 4USAA 4FO2A 3HPOA 3NTIA 1JCKB 2JYOA 2ZJ5A 4KMUC 3K7AH 3HOWH 1H9KA 4A3JH 4YG2A 4QUCA 1ZKOA 2PFQA 1A6SA 2XN9C 2E2HH 2UUAQ 4Q0FA 5ALKA 2NVQH 4TVAB 8ICUA 4A76A 4F2SA 2ZIXB 1PMRA 2HBJA 2ZM6Q 4Y2TA 1XJVA 3VYRA 1JUDA 3EPGA 2MA1A 4X5VA 2XRQD 4OWTB 1SXTA 1QCKA 1JE5A 3SK5A 2W54A 2WAQC 1A3TA 1MBYA 1KNEA 1PUZA 3SAFA 2DQNB 4ZUJA 4JI8L 3E0FA 2CQAA 2WINB 4FF3A 4G7HC 1EFID 1EQQA 1AE3A 1GUWA 3F5EA 1L6NA 2HCCA 2XY6A 2RHSB 1GUOA 3UDFA 4GC7A 1YNJD 1HUNA 2MFIA 1QG7A 4RQ5A 3KUPA 1PK3A 5J3BA 2F0OA 2D6FC 4DS4A 4C3JG 3M7GA 3KDFA 2Q0ZX 2B6GA 1EZ8A 3TKAA 7ICGA 5J2AA 1X3GA 1DOMA 1EEID 2B2VA 2WIIB 2DKZA 5E7NA 4JV5L 5IGBA 3TDQA 4Z6EA 2BCVA 1BPBA 2QB1A 4AYBF 4NDXA 1GHKA 4QZ8A 2K4IA 4O3PA 1S0NA 4PMWA 5CBAE 4QZHA 4QZGA 1UE5A 1Q7YC 4OJ6A 4KTQA 3OPOA 5DBAA 2MU2A 4M9NA 5JTIA 3IN5A 9ICGA 3OIQA 3SYZA 1UNSA 2OTLA 3RB0A 3IDWA 4UB3A 1FNVA 1S5DD 2EYPA 4YR2A 4C3JH 2CW0C 2PFOA 3WK4A 2RDGA 3TMEA 1U4MA 2D2CC 5ALUA 4N8FA 1L0WA 5AKZA 5KFTA 2Y0SF 3M9OB 1BGXT 5ALVA 2A69D 2EOTA 2F0WA 2B63H 1IKLA 3RN5A 1N34L 3PF5A 1ZXIA 2C2DA 5KFMA 2YY6A 3OPXA 1HUOA 2LFNA 4POGA 4KLQA 2MJ8A 4GKJQ 2LYBA 1N8RC 3UXPA 3M9BA 3EUB2 2BDUA 4YR0A 1SN8A 1B3AA 8ICEA 4IFDG 1WD0A 2KEDA 2K4EA 4KX5A 2W8KA 4JOIC 4FVMA 2VZAA 4RHRA 4DV2Q 2Y1IA 3EA6A 1CI3M 1HR0L 2A6ED 2OEOA 3S1RH 3CCMA 2ZIVA 4FNFA 4A3KH 2DN8A 4CKBA 4RQ3A 1Y1VG 1NK0A 1RDPD 4Y7NB 4B3ML 2E1FA 3PF4A 4IL6U 3C2KA 1P16A 3D2NA 4Q45A 8ICFA 4CJ1B 3S2DB 1OXXK 4DV1Q 4RCOA 4LFBL 3RJEA 2KEEA 4TRDA 1WCLA 4KLIA 1SMYC 2E2JB 5LMNW 1BNOA 2KHQA 3DM1A 2E3TA 3FM9A 3N7RC 1STYA 4ED0A 2KHVA 4NPSA 1RCVD 2F0KA 4A3IH 1KN5A 4ZQ3A 2G5HB 1LKYB 4RQ0A 4DAYB 5E79U 4ICAA 3UQ2A 1Z47A 2OEHA 2Z6KA 2ZT9C 3K5LA 3D4RA 1SL2A 3H0LB 3R93A 1HXYD 1W6JA 2UXDQ 3AMZA 4BWJA 2Y9TA 5I6YA 5F3XB 3T5HA 3LDAA 4G3IA 3MZ5A 3HOWB 1HTLD 3S17B 2EANA 4F2RA 2R92H 2ALYB 3DV9A 5KFRA 5M3MH 4B6JA 2Q2UA 4FYDA 4CGZA 1PTOD 4XQNA 1SMXA 3LVVA 1XSNA 4RGTA 4ZAIA 1NJXA 5FLXE 5KYIA 1X66A 2VS1A 4DUYL 1HA6A 1B1ZA 2DKXA 5IT9L 5AIBA 1UHUA 3QG1A 4LF4L 4DR7Q 2Q4TA 4I2GA 4XIGS 1URJA 1MQ3A 5ALMA 4O3MA 4L6TB 4RQ8A 3TP5A 2OQ0A 4Y2QA 4YN4A 1ZQJA 5DG7A 1RIPA 4MFCA 3MDAA 5KFHA 7ICHA 4IOCA 4IFDJ 4HCEA 4QNLA 4J03A 2K6AA 4K0KL 1KKXA 4X3TA 4DK1A 1JIHA 2IBKA 5AKGA 1JALA 3C1ZA 3WU2U 3HFZB 2K8CB 2QARA 1Q86C 5ALJA 2KECA 3ZDAA 1ED1A 4JI2Q 5KFJA 1ZD5A 3GIIA 4I2FA 1NCVA 3H0RB 1BKBA 2CW0D 3QR8A 1WTRA 4FXGC 1DXSA 1G2SA 5IYDG 3E5SA 5KFBA 4JI5L 1KDAA 2OXPA 1OXSC 1F2ZA 5C5LA 1GO3F 2B63B 3ERQA 1V97A 4UB4A 2EYLA 3HX0A 4NXNL 4C2MB 1LTTD 3NRWA 1X9MA 4IRKA 1C20A 4JBKA 1AH9A 1JMSA 3MEHA 2Z1CA 1KQQA 5M5WH 1V8QA 1H9JA 4ODGA 4PGXA 5CV4A 4ZKCB 3SGIA 4DQRA 3AEVA 3ER0A 3TAPA 3MFYA 5ALZA 3E3XA 4KJNA 4CDCC 1QVGA 4NLNA 2Z0SA 1LB2B 2X6GA 1SFOB 3D4DA 3PUWA 1BCPC 2BPFA 2XIDA 1KNAA 1L7OA 3AYHB 4RGMA 3KBGA 4QIWB 4IC9A 4RQ4A 2GWSA 1BNPA 1HH2P 3K80C 4UY8C 1F0MA 3HRZC 5IGCA 2EXDA 2K03A 5ELFA 1TWAH 1MC8A 4DFDA 2NRVA 1EU3A 1STAA 4FF1A 2FE9A 3GV8B 3F2BA 1HZBA 2K1BA 1N33Q 5IP9H 4JUZA 1RDFA 3WKBA 1RXVA 4V0BA 1Q8IA 5KFGA 2KIVA 1MA7A 5EWFA 2WF7A 2H1EA 2PCFB 1D8YA 3S2HH 4P0QA 5DDMA 4JWNA 4KN4C 5DQIA 4TQRA 4DS5A 3KBBA 4RQ1A 3K75D 2DNCA 3KKAA 1QTMA 2BHNA 3AQQA 3Q6SA 1TKWB 2EQSA 4P4PA 2PQAA 4X62L 3H15A 3O13A 3ND8A 2G0AA 1H95A 2D3DA 4RNNA 2R3ZA 4O3NA 1ZQNA 3GTGB 4PGQA 4JVZA 2V4DA 4KN7C 1CKOA 1PYWD 3NK9A 5KL8B 3T13A 1SNQA 2YTUA 2W9MA 4DK3C 8ICAA 3HP6A 1TK8A 2BPCA 4UP9A 1X6OA 3NENA 1BBUA 3PSIA 2KSOA 4OO1H 1NE3A 1KLNA 3OTOQ 1ZXTA 4A3DB 1JC7A 4P72A 4ELVA 5FLXc 1A0IA 4C4SA 1GVPA 1NKCA 3EW9A 1KL9A 4IN3A 1VQJA 3J7YW 2HHHQ 4BY1H 2XICA 2RQXA 4NKLA 1TWAB 3D8GA 4R66A 4BBSB 4UBCA 1JX4A 3K5MA 2LI6A 3FAHA 5ELBA 4DR4L 2WV6D 3WK5A 5CGKA 5AKYA 1X3FA 1NK9A 2PKEA 1DYQA 1M8AA 4KV6A 4IOAA 5JOBA 1KW4A 1ZQOA 1EXNA 3FEWX 1SFOH 2HOFA 4L63B 5JEAH 4O5CA 1FNUA 3HOUH 2F8LA 4DLEA 1IBKQ 4JI4Q 4DQPA 3UM9A 5J0XA 1FGBD 2B2VC 1EYCA 2WFWA 1Y8NB 3F8TA 4DKAC 3O0FA 3VCBA 1PH2A 3ALRA 1PZID 4B3SL 4MN3A 4PZ6A 8ICPA 4LVSA 4O9MA 1IL2A 3WDNA 2I9GA 5ELOA 4GFJA 4DFJA 2KP7A 4NLBA 4RHSA 4HSPA 3QUCA 4XQQA 2E8PA 2G5DA 3EQLC 1TVXA 5M5XH 2JHDA 4OJPA 1M1KC 4A93H 5K36G 1WTXA 1Z4OA 3Q23A 4G57A 1ZQXA 4NV0A 4NXZA 3OSNA 1KBUA 4FE3A 2RBMA 4JOIA 4GNXB 5C44B 1EYDA 3NASA 1DGJA 3UI2A 4MF8A 1PXUA 2NRTA 3IG8A 4MFFA 2F1IA 4MTKA 3K1ZA 1QQ7A 3CRLC 2WF9A 2BQUA 3HOYB 2M2LA 2IY5B 1A2TA 1AP0A 3Q8KA 4I2HA 1LV9A 2JZBB 4NXNQ 4P75A 2E2IH 9ICHA 4PHPA 3OOCA 4XQJA 4GXIA 3RB6A 1YNNC 3NRZA 1PZKD 4IRDA 2ZXIA 5KTQA 4XUSA 4DFPA 2PI5A 3A7AB 2DGYA 3W1GA 4PGYA 3I4MH 4RT2A 3A8KE 3C5GA 1NKEA 1EYAA 1RJTA 3TP6A 4DUZL 3OW2A 3J7AF 3MWYW 4CKEA 2AGOA 8ICCA 4UAIA 3W1BA 2YMQA 3RRGA 2IMWP 1Z7TA 5DEHA 1EWHA 4EENA 3GIJA 3J80i 4IURA 1C9OA 5AJ3Q 4BWGB 4YCXA 5KG3A 1VQFA 4RKBA 2Z7JA 2D62A 1G2TA 4ED2A 2PW5A 3ICEA 5KFOA 2J4XA 1GXDC 2JA6B 1VMPA 4JBJA 1JJ2A 3IRUA 1HFNA 4IQUA 4QQBX 2KNJA 1ZQAA 3HEJA 2V1CC 1XXGA 1HNWQ 4XQ8A 1BPXA 5KFFA 4UB6U 3Q8SB 3HWTA 4B9MA 2LMCB 1BOSA 1U0LA 2A73B 2NTTA 3F2UA 3CU7A 5C3EG 1IBML 2UU9Q 1SNCA 1ZYRC 3KK7A 3F1ZA 1LM0A 4G7OC 5DM63 4ED6A 4DCCA 3F2CA 5IILA 4PZOA 1DM0B 1PVPA 1IG6A 4K6LA 3OGUA 3K8AA 1K28A 2G5IB 3RZOB 4CF4A 9ICAA 4NW2A 3D3RA 2NO4A 1CT1D 2M00A 1E1OA 2Z4HA 3HKSA 1XNQQ 2G08A 5JPMC 2BCQA 1NMGA 2B2UC 2PQEA 4HCSA 1J8IA 3ORYA 3UMGA 2CXYA 3C2MA 1TK5A 1HFGA 1Z3EB 4CDGA 3MXUA 3ZD9A 3GZFA 1QOHA 5ELDA 1BNZA 2EY1A 5C3XA 4QIWF 3PO3H 4F3OA 4QMGA 1QQ5A 2L12A 1QE6A 4K8JA 4I2AA 5C4JH 4DV3L 2K89A 2RLTA 5KG4A 4CKCA 1B22A 2PMZF 1T9HA 2KKPA 1SWWA 1Z00A 2PZWA 1N34Q 4FZMA 1A77A 5IT9c 4H7BA 4EZ6A 3T51B 2BDNA 2JEGA 5EE1A 4IJLA 2N1RA 4R8UB 1EQVA 2GO7A 8ICTA 3K5NA 3BZDB 5ELEA 1STBA 4Y2XA 3N52A 2UUBL 1NMFA 1U4PA 4EQNA 1N36L 1L2FA 1TWCB 2OWOA 3OW7A 1SWVA 2YU9H 1IM4A 3QIAA 3TBIB 4A3FG 2D0OA 5CWRA 3RLFA 5AKJA 2BA0A 4MEYA 2B8FA 3E6ZX 2KD1A 3SHLA 4HJ5A 4E0DA 5ALTA 3RB4A 3M1YA 3HJEA 1DONA 2DF4B 2C28A 4DL5A 3F2DA 1ZRNA 5KYLA 4ZLTF 3HS0C 4A3JG 3S1MB 3PSPA 1CQFA 2PNRC 5AM5A 2EVBA 3HOUG 4LUZA 5CV7A 2KIWA 4RNOA 2VXWA 4LFAQ 5IOCA 5C0XG 3GTMH 3GTOH 1PZJD 1X65A 2XRSD 4KHZA 1WTQA 2IHFA 2WAQB 1J9OA 5KAFU 3L9AX 3NWTA 4ZRZA 3HKZB 4C3IH 5ISRA 1Q82C 2LS01 1X56A 4YWLA 3H3VH 2QKIC 4J15A 5CHGA 1N48A 1TV9A 1X9WA 3I7FA 5I9OA 4A3DH 4A93G 4JK1C 4RWSC 3TSSA 5JJIA 5J29A 3GILA 1DXMA 2EZXA 1F77A 2F44A 1ZQZA 1PK1A 4CGYB 4F8MA 4AIMA 2ZM6L 3J7A5 1Q46A 3KOOA 1ZQQA 1MSHA 2EYOA 4DV3Q 2HDOA 1A76A 4B3RQ 5CV9A 1S77D 4H13C 3C23A 4IQWA 4PL2A 5HMMA 4I65A 4PHEA 2NN6G 2RCFA 4PHDA 3HOYG 1KRPA 1GUSA 4DUYQ 5DB8A 2KZMA 4LFCL 1CA5A 1BUVT 3HOZH 4PMBA 1NZPA 3D6WA 2ZIWB 3NXWA 1NKBA 4EX7A 4J9PA 4TUQA 4ED1A 1O7YA 3ULJA 4BY1B 2EDGA 1S3OA 2CH4A 2NB0A 4M1UB 4AYBG 4JI5Q 3IRBA 3RN2A 1WCNA 4A3LH 1L0XB 2Y9UA 2VQFL 2CH4W 3KHRA 1B4OA 1MQ2A 3CCRA 5CYUA 4DPGA 4EEYA 3GTLB 8ICWA 2F0DA 3A5ZB 4Y2VA 4JMUA 1SB3C 4PH5A 2PFNA 2QILA 4KK7A 3J81i 3Q22A 3TFSA 1SZHA 1EIYB 1NJZA 5BPCA 1SLJA 1X3PA 3UXNA 3DUZA 4LK1C 1SDFA 4EBDA 2ZTDA 4H02A 1LTGD 2B39A 2WACA 4OELB 5AFWA 4F5QA 4C4TA 3U4ZA 1V9PA 4C3HH 1C0AA 5M3MB 3SE0A 2ZUBA 2UVVA 3GO5A 5CR3A 4DR3L 2XTIA 2E8MA 4DL7A 2Y0SB 2K52A 3ISCA 2KZZA 4L5QA 2Q2TA 5ELCA 4O5KA 3PIP3 1JXLA 3ZJYC 4A3GH 2AWOA 1STHA 4FDBA 2YB1A 2P6RA 5IGFA 2GLEA 5C4HA 2ES2A 3MDCA 1SSOA 2DWQA 1PK1B 2CQOA 4QZDA 3WOFA 2YMLA 2GOLA 2AU0A 7ICFA 3D2SA 1VQCA 2B2WC 2L1BA 1OXUA 3OSPA 1SL1A 4J6HA 3ED5A 4RQ7A 5GTIU 5L1KA 1CZGA 4R8NA 3L4PA 1B9MA 1VJ5A 5JUMA 1QVCA 1TWCH 4X66L 1QVFA 4ZUIA 1V38A 2HIXA 3GQBA 2BQRA 4DV7L 3PZPA 4GLVB 5ALSA 5AKHA 1GOZA 3ULPA 3QUQA 3THVA 5AKLA 4NLKA 2IHNA 3VYTA 4P0PB 3WWVA 2R8GA 3KHGA 3PSFA 3MAQA 3STBD 3DEOA 1ZD3A 1S0VA 2PI2A 5J0PA 3K0YA 2VQFQ 1D1IA 5C5JA 1TAUA 1SJED 1YNXA 2E75C 3TARA 5ALDA 4M2YA 3S6JA 1RHPA 4IPHA 4O3OA 3H4BA 4ECTA 2GN5A 1E2VA 4FO6A 4OO1I 3H40A 3KF8B 3MA2B 1YJ9A 5M5WB 1BCPF 3FKIB 4I27A 3BZCA 2HMXA 3V7JA 3Q8PB 7ICJA 2A68C 3KLRA 4NP5A 2DJFC 1YI2A 1RM6C 4AYBE 4OX9Q 4DR5L 4F4WA 2GH1A 2JH7A 4JB3A 4KI0A 1JB7A 2F0MA 1X2IA 3CNHA 3E58A 3PW5A 5HR7A 3DEPA 2IWHA 5BN4A 3G6JB 3Q0AA 3PMLA 1PH7A 2N8NA 2H3IA 1II3A 2L5TA 2JK8A 3SDZA 3RLNA 4CRXA 3ZI4A 4PPXA 1DOLA 5B5EU 3A74A 2JA6G 2E8NA 1A63A 4C56C 1PVOA 1Z9FA 4QWEA 3S16B 3CMAA 4DNIA 1Z6HA 5C0YA 3CYMA 3H09A 2IX1A 4C1NI 4WORA 3I55A 2RDIA 5J0TA 5KT7A 1U48A 3FPPA 5IP7H 4TSSA 2YU9B 4C7ZA 1NSNS 2GVAA 4HN7A 4DOCA 1LLRD 4BBRB 2K75A 4FS1A 3I8ZA 2N3SA 4JI6L 2OXOA 4DO9A 4DOAA 5AI5A 4JYAL 5KFSA 1LTLA 5BR8L 5DLQE 1VQBA 4RFBA 4YQWA 4ZH4A 4E6IA 1A6XA 3TREA 1ZQYA 2OH2A 3D6JA 5ALLA 4QZ9A 3I4LA 4XYQA 5ALPA 1WTPA 1PVQA 1J97A 4NJ8A 2E76C 2KCNA 4NXMQ 1H9SB 4ACOA 2L11A 3T5KA 4QW9A 3A8IE 3GTMB 2B0CA 3K4GA 4FFDA 2DY8A 4QIWC 2MUTA 5AI8A 2JA5G 4MFAA 2MO0A 3VC8A 3SK8A 4TKOB 4QCLA 5J2DA 4DLGA 1KTKA 2J7ZA 4HIMA 4UATA 2AH5A 4A75A 4UQGA 2AQ1B 1Q8KA 1I4PA 3N97B 4LFAL 4A3CG 1U4RA 4UAWA 1STGA 2E8GA 1H9MA 2BKEA 2W9CB 1DRGA 1AEXA 2K33A 2KJXA 2NVYH 1NZBA 3M4YA 3R2IA 4U68A 1BQQT 1EQTA 1SAPA 5C5MA 2R7ZG 1ZQUA 4GNXC 4B9NA 5KIXA 4DR2Q 1KRSA 1PH3A 5EJWA 3NTUA 1Y1WB 2JR5A 4PMCA 3STBC 3VYSA 4LF5L 9ICNA 1N60A 2B2YA 2K7VA 2KUMA 4ILWA 2XC9A 3CCEA 2QW7A 3SR6A 1Y69U 3RR7A 4IPCA 4JPBW 4ME5A 2BZFA 1EL0A 3ONAB 2QB0B 2ZXRA 4KLLA 3DWQA 2ASJA 1N56A 1QZGA 3OMCA 2A74C 5IIKA 4RNMA 3G6VA 2HI0A 4O1NA 3J81c 4M47A 4M04A 1JR0D 4BX9C 3VR6A 4LF6L 1A8VA 2OF1A 4OONA 4JV1A 2OHFA 2JMGA 1AROP 3I1YA 2ZIWA 4YXMA 5J2EA 3HILA 4IUUA 2O5JC 4GKJL 4CNQA 5J0YA 5AK5A 1HNXL 3UDGA 1X54A 3M7NA 3SAHA 2ATLA 4JK1A 2KHSA 1LYLA 5DLGA 1TS5A 4KY6A 5C0XJ 2I1QA 1TXYA 3CPFA 5K5PA 2XY5A 5BN3A 3H3VC 1M6YA 2Y0SC 2XSCA 2DUDA 3CD6A 4DSJA 2MUTB 4RPYA 3RH4A 1COKA 5AICA 4CF3A 3GV6A 2F77X 4X64L 4BBSG 3Q8LA 1B8AA 1EYGA 4KD3A 1RD9D 1N36Q 2KV2A 2X69A 5M5YB 5IIIA 3MFHA 4ECXA 1GO3E 1I50H 4LF7L 1IXRA 2K04A 3CF5A 4K4IA 3GIKA 3MFGA 2IX3A 1X40A 7ICPA 2CKZB 4JC0A 5KFDA 5DB7A 1LTAD 2QA4A 3IFTA 2HBLA 2HIVA 2YQEA 2TMPA 3KLSA 3PO3B 4UARA 4R63A 4QW8A 1L1OB 3BDLA 3PMNA 2R8IA 4DL4A 4ED7A 3N28A 2H3QA 2ASBA 1ZQIA 2KVMA 1HNWL 1B3QA 3E0JA 3JAME 3S15B 4IUQA 3X3NA 1EIHA 2NV3A 1ZQGA 1B53A 4BXOB 1ZQWA 3J81j 3SK4A 4UBBA 1WYGA 2HBKA 4WJ3B 1ET6A 1B0XA 4JI2L 1FJGL 1KDCA 4UASA 3JPQA 1E24A 5GAGC 3S9WA 2HOQA 2W04A 3PNCA 4CDEC 3HOZB 3WKDA 5DNFA 4X65L 5KNCA 3AQFA 5L1MA 5DBBA 3J80c 1QQ6A 3C1YA 1TS3A 2LKYA 2J0TD 5AM0A 2F0UA 2CPRA 3LNNA 5T14A 4DR1L 1VQDA 4JI1Q 1UCVA 4TQUS 2C2EA 2UXBL 2QF7A 1RG6A 3BQ7A 5KFXA 2DGZA 4KLHA 4LZDA 5D49A 1HZ9A 1SNDA 4J9QA 3GD7A 3HGBA 1CSPA 5LL6S 4AQYL 1VQ5A 3MXPA 1KLUD 4K5VA 2KK0A 4WJ4A 4N8X1 2DBYA 1FD7D 1E1TA 2FMPA 4RH6A 1VQ7A 2K8AA 1NJYA 8ICKA 4R4QA 4A3FH 4BA2I 1HHVA 3A0BU 2ZXPA 3S1RB 1B50A 1SE4A 4QWBA 5FOBB 2L55A 1QSYA 2B3GA 1UEAB 5E3FA 4C1NK 1V1QA 1EY9A 4G9BA 3OWEB 5G3LF 3TFRA 1TWFH 2EQYA 1Z4NA 5AI0A 3UE1A 4XRHA 4DQSA 5D3DA 2R92B 2GVBA 3F53A 2AQ0A 1O7ZA 4UP7A 5EWEA 3HOXH 2ZIUA 3K58A 3LX0A 4K8IA 1V1PB 5M5YH 1WCMB 1TWHH 7ICIA 2H3FA 8ICZA 2G07A 1IW7D 2NBFA 3KLSX 1O03A 2F0SA 1QZHA 1PH8A 3QUBA 2EY5A 4XXEA 2HD3A 2A68D 1VQOA 1HJPA 2NRXA 2F0JA 1ZYRD 1E7ZA 2M9VA 5HY6A 5ALOA 2BCRA 1R4QB 4K2LA 3V96A 1A0PA 3WKEA 3GDEA 3GTKB 3HKZF 1QSLA 2Z8LA 4Z6DA 3FHWA 5I9PA 3S15H 1N32Q 1KSPA 5AI9A 4CE6A 3J80E 4EX6A 3H7IA 4ECZA 1WTHA 3W5OA 1PH6A 4F5RA 2RA4A 1WD1A 2HHQA 2YTXA 4EBEA 2ZIUB 4OL7A 2EAPA 5C0XI 3MTSA 5IYCG 4X3KA 4BJQA 4OO1J 1JE4A 3GTOB 1F9QA 2BDOA 4EBCA 3OJUA 1I3QB 4DQIA 3PY8A 4DR2L 1LABA 2RHQB 1BXTA 3PR4A 4A3EH 3CRXA 1P8LA 2L15A 2E2DC 3QEBZ 1XNRL 3EPIA 1S5CD 1NR4A 2IOFK 4DOBA 7ICKA 4C3HB 5IWAL 1L5UA 2KJ8A 3GTQB 2A5HA 8ICXA 5GADC 5CP2A 4LW1A 4OJ5A 1F2LA 1S5LU 1HUMA 3VR3A 4I7ZC 2ZJ8A 2W3SA 1Q1BA 3KJOA 3H4DA 2J6UA 4B9VA 3IKJA 4B9LA 2ES6A 1BO0A 2NN6I 4C3IB 3RF9A 1RYUA 5EE3A 1K8OA 2YV5A 3I91A 2HUGA 3A55A 1E2WA 4IFDI 1MSWD 5KT2A 1XSPA 4J1MA 2LM1A 1M4VA 1LT6D 2JEIA 1TWFB 2CCZA 4OJLA 3GFKB 2VQEQ 4Q8FA 4A3JB 1VS0A 3KF6A 4HJ8A 3M85A 5DB6A 5FLXL 3I76A 2H4OA 4A3MH 1YJNA 2I6XA 4R4IA 1KTQA 1ZQMA 1YHBA 4IR1A 3T53B 4LAAA 4K4GA 1G51A 1T3NA 2D5DA 3HKZG 1DGSA 2DPIA 1WTOA 1IBMQ 3T4AC 2QEXA 5CJ7A 2JA7G 2WAQF 1L3UA 4KLKA 5K4LA 4KHPL 1ZQRA 2RDFA 3TQ1A 2UVUA 3CW2C 2F0PA 1NTGA 2Q2HA 4A93B 1YVCA 3RZOH 1CUKA 1L7MA 3BQ1A 1CI4A 2IX0A 4P2CB 3T56B 4JI6Q 4DR6L 4WRDA 2ISOA 1EY8A 1NJWA 1IKMA 3SENA 2BDPA 1G6PA 4KLUA 1XNQL 4Y52H 3H0GG 3AM9A 3NUCA 1NOMA 1H9RA 1CTMA 2R7ZB 1TWHB 2FPLA 1J2NA 4F4YA 2JA8B 4X3UA 4XT1B 2B2YC 3OJSA 3J81L 2K4PA 5AK6A 1KDBA 2BE5C 3UMBA 3CAMA 4CDFC 1FIQA 1XMQL 4DAYA 1XO0A 4KD4A 2ZUCA 4YY3Q 5JPNC 4US9A 5HR6A 4MNOA 4K2KA 5GQOA 3RH5A 2K8BB 3IHQB 1EY7A 5DG9A 1NBWA 2XIWA 1RKNA 9ICLA 1LACA 2GA4B 4F7XA 5KFYA 5DG8A 1KEJA 5J2IA 4LF9Q 2YYZA 3PIOA 1ENCA 4AYBB 1RZTA 3R9KA 3JPRA 3RTVA 3A54A 3B0YA 5FJ8H 3CCSA 3S1NB 1T4GA 4XDXA 4R1JA 2AUJD 4GXJA 9ICCA 2IPKD 5IIMA 1D8BA 1FFVA 4UAUA 4RPZA 3M8SA 1OW5A 2MSNA 1JWSD 1CA6A 3ZD8A 4EQ5A 2JZBA 2VIXA 3C46A 4RQNA 1UQVA 4RAUC 3TS2A 4K5WA 1N62A 2JA5H 4KHPQ 3QU9A 4JBWA 2B29A 2FMCA 4FBUA 3VR4A 5KT6A 1IIPA 4GLAC 1SKSA 3TAQA 1ZQTA 2A1JA 3PUVA 1DCZA 3RFAA 4OGQC 1K8GA 3V6KA 5ALWA 5IT9E 2E2JH 2UU9L 3LWMA 4DUZQ 3CP8A 3KZXA 1KFSA 4PNYA 2K5HA 1PFMA 4CHTB 3EFXD 3PIPA 3QUTA 1JXEA 3C21A 4RCNA 4A8EA 2WF8A 1C8CA 4DR3Q 2Y1JA 4A3KB 1U4LA 1S5ED 2IHMA 1NJIC 1RODA 2YTYA 3T3FA 2QDLA 4ZCKA 4RGOS 3GTQH 1A15A 2H3ZA 1FJGQ 3M8RA 4K0KQ 4Y2UA 1B9NA 3LWUA 4P71A 4YCVA 2JA8H 1K83H 1O7IA 5KG0A 3BG3A 3RNUA 1KLGD 4ECUA 2FJ6A 4KMOB 5E1FA 2JP1A 4O3RA 1ZQLA 3RJKA 3BDPA 1ET9A 2IT1A 2NZOA 3OIPA 5GROA 1K8AC 3V6HA 1UT5A 1ECWA 3EIVA 4CJ2C 1PTOH 4R65A 2W7OA 1NNLA 7ICVA 3OWFA 2DY7A 2WHEA 1D1KA 1JOOA 2KBNA 4KLMA 4P74A 5HGTA 4YCWA 1S97A 1HRJA 2ASLA 4KLSA 3M3YH 1SRUA 3OTQA 2FMQA 3EN2A 4Q8EA 5CC4A 3T5LA 4X64Q 4EQOA 4DV0L 5A2QL 2EYJA 3EYZA 2BH2A 2R8HA 1XMOQ 5J0QA 3RJFA 1VQ4A 1JOQA 3ZDBA 3QNMA 1Y8PB 1SV0C 4DF8A 3I3CA 2B63G 2NWGA 1XPUA 1PRTC 5CR0A 1CRXA 2EYFA 1KIXA 1XNSA 3AU6A 1HNXQ 4PZ8A 3FDSA 1F2YA 2MAXA 1BCPB 2VA3A 5AJ3L 2F2AB 2OM6A 1N61A 1N32L 4O0IA 4ECSA 4JWMA 2BOSA 2WB1B 4A3EB 1BBWA 3CQZH 3KLWA 1WFQA 5EE9A 3GU3A 3FRPB 2PMZC 1HR0Q 4OJOA 3HT3A 4DV4L 1MN8A 4ID6A 4JCVE 3H3VI 3HKZC 1IBKL 1QH9A 1U49A 2VA8A 3EROA 1PZNA 1X9SA 2KVCA 5HGQA 1Y1WH 4QF4A 5AK4A 1Y1VH 4HAEA 4QZAA 3M6KA 1T5EA 3FVQA 3M4OH 5I2XA 1ASZA 3QB3A 2JA7H 7ICLA 3SQIA 1Y14B 3OSOA 5LL6X 2YX8A 1PDQA 1G91A 4DNRB 1N63A 4C3JB 2XWJB 4RQMA 4YHHL 2IJ0A 2JSOA 3PO5A 5D4BA 4BGDA 3PX6A 3PW7A 1PTOB 2K5NA 2HCFA 5AI4A 5AI6A 2OYYA 2C35B 4DSIA 2VA2A 2MRLA 8ICGA 2F0FA 3PMFA 4IUVA 3CP0A 2WP8J 1BDOA 1TK0A 1DK3A 3RJGA 2C9OA 3VR2A 5LHY1 2F1HA 4JI3L 9ICQA 2JEBI 4HAIA 2DFLA 1TFRA 5J2KA 1RQLA 2BH8A 2PQAB 1ZEQX 3C1EA 4GN5A 3PO2B 1PH4A 5DDYA 1EU4A 2ENBA 2YN4A 1XTCD 4Y2YA 3TEHB 2UUCQ 4RPXA 1C48A 2RDJA 1GUTA 3BYTB 2R18A 2HVHA 1XS9D 1ZQFA 4EELA 3M3YB 4MIUA 9ICMA 2AQ3B 5JVG3 4G7ZC 4LUVA 4F5NA 3F5AA 1XSLA 7ICNA 4EEKA 4F4KA 2E5LL 3VDYA 1LKYA 3SMVA 2O2LD 4F71A 2F0IA 1YHAA 2F0QA 1SYBA 1HEKA 1JJCB 1V85A 2KEYA 3RH6A 3HW8A 1Q3UA 1VCIA 5FP0A 3SZ2A 1I3QH 1UA1A 4DNTB 8ICRA 2A1AA 4PG3A 1AZQA 2FLLA 2K5VA 2W43A 1K5OA 1F9SA 5JVH3 4F8RA 3WK9A 4V190 5BR8Q 3QOJA 3CQZB 2WF6A 1PHJA 4I29A 1QILA 1ICFB 2KZ3A 2K32A 4QB4A 1XWLA 3RLOA 1KFDA 2QDBA 3IM1A 5EKIA 3CCQA 4QJFA 5KL1B 4ZYSA 3S1QB 8ICJA 1VQLA 4J9KA 5D46A 5JU5A 1JWUD 5JEAJ 1M90C 1XNRQ 5K36H 1F5SA 3PW4A 1T5XD 3M4QA 3D2QA 2L4NA 5ALGA 4KJOA 3VA5A 2I07B 3D4WA 1Y1VB 1TY0A 3M4OB 3Q8QB 1JQYD 4HYKA 1Y88A 1TVAA 2WTFA 1S10A 2OQKA 3M4PA 5CV5A 4FF4A 4DGZA 1GUGA 3C1FA 5I2YA 3RAQA 5LMNL 7ICRA 1FGUA 5J8YC 1KFTA 2LPEA 1SMYD 2AHOB 3R3OA 4R4TA 1YNND 1D5XC 1QNUA 5D3IB 1XPOA 3J81E 4L5SA 3HOVG 1WTWA 5KFQA 3HOWG 2IW3A 2I46A 5COYA 4YVZA 4MHVA 3U50C 4US8A 3OHBA 3QE9Y 2AKWB 2JXMB 5GAHC 2O5IC 3PO2H 3AN1A 1OUQA 1QSSA 2AXTU 3TP8A 5IY0A 3UE0A 1NK5A 5KFLA 5TZVA 3PX0A 2Z4IA 4KKUA 1N33L 3NBHB 9ICSA 4B08A 3J7ZC 1OXJA 4WJWA 1DK2A 2L9HA 1YEZA 5HURA 2KJ9A 3Q8RB 3K59A 2J6TA 2MQHA 2VY3A 2BCUA 3BZKA 3UQ0A 1JRPA 2R7FA 2SEBD 3HP3A 1TU2B 4YR3A 3G6YA 3PX4A 2Q2IA 4NWIA 2KG5A 1XC9A 4OIJA 4Q5VA 1N5WA 5JJKA 1D6EC 1I4XA 1C7YA 3I2ZA 3RZDB 1YIJA 2R93B 3X3MA 1T7PA 4BS9A 2VKQA 2FHTA 1B7YB 2HQEA 4DU9A 2F3IA 2NVQB 4A4IA 2EXZA 3TANA 3K0XA 4JV0A 3AFPA 2NVTB 3DM3A 1IBLL 1JICA 5GAEC 1VF7A 2R8JA 4Q43A 4UW9A 1JMCA 4BBSH 1ML0D 1ZD4A 3I70A 3KF8A 4YCUA 3CMEA 5L37A 2Y0SE 1IYVA 3UMCA 5M3FH 5M5XB 3JPOA 2Q8IB 3W3AA 1MJCA 4UB5A 4P0QB 2H3VA 5J0OA 4WJ3M 1ZQEA 1GKHA 3H8MA 5J22A 1S0OA 2QCPX 1WVLA 1ZQHA 4M9HA 3U26A 4BBRH 1QUQA 4DR4Q 3VR5A 2FLPA 4P0PA 3T5JA 5ALEA 1UEBA 2HVIA 1NAPA 4O3SA 1U4BA 2BE5D 4A3BB 4DR7L 4B3TQ 4LZGA 1NY4A 1OO9B 4O2DA 4PZ7A 4RA8A 2EPBA 2N78A 2FMMA 5T1GA 3IP4B 1ZYQA 4DL6A 1EZ6A 1TT2A 1SKRA 2R92G 2D8CA 4O42A 1CKNB 3K7UC 2XCAA 4LJXA 1Z00B 8ICQA 4ELUA 1SE3A 3EZ5A 2JEFA 1WCMG 2IA6A 4Z9CB 3KOJA 4IQVA 1UUPA 1MIUA 4DF7A 4NL9C 1NUCA 2XGTA 1IW7C 3NE5B 4C4RA 1NK7A 3M9NB 1U47A 2DJGC 4F72A 1ICWA 2HHSA 1ILQA 3G7LA 4NXML 4GC6A 3S1QH 4YD2A 4XT3B 4IUTA 3V7LA 3KHLA 3V7KA 2ZTEA 1HZAA 1LTRD 4B9XA 2RCNA 7ICOA 1J6QA 2E74C 3OTOL 5KNIA 2I5MX 5G5GA 1IZ6A 1CK1A 1BBXC 3A7LA 4CDDC 4B3RL 4B9UA 4HR7B 4KN4A 2KFNA 4OEMB 5KEEA 4YHHQ 4F5PA 1XO1A 2ZXHA 1PLFA 1TWGB 5ALYA 2VANA 1CHPD 2OT2A 3WK7A 4HSVA 3AQEA 1L7PA 5EE0A 3RJJA 3CXCA 2FPMA 1OXVA 3KZIU 1BF4A 4B3SQ 4GOPA 4M6WB 2AGQA 4BY7H 1YZ7A 4CCHA 2K4KA 4ABNA 2MHVA 4O0AA 5IYBG 3QZ8A 2NZ1D 3KBXA 2WB1G 3FMCA 4YXJA 3I4MG 5KFUA 2WKDA 5FK9C 4RMFA 2VUMB 5H2FU 1XU4A 5GTHU 3MGHA 3FC4A 4DSEA 1ESFA 1EQRA 4X6AH 2BQ3A 1SYDA 1ZJMA 3TS0A 4O5EA 1LUZA 2F3NA 3G4SA 1KQSA 4XTCS 2VJ4A 1KDHA 4HTHA 5KAIU 1UWVA 3PW0A 2V4QA 1A2UA 1YZ6A 5G3LD 3CKIB 5CBEE 4IUPA 1D9DA 3NHHA 5EBCA 1SGGA 1VQ9A 3BDOA 2ZIVB 2F1MA 2WKCA 2PMZB 3RZDH 2KOLA 4U6PA 2R93H 5KG5A 5C6AA 3N7PD 9ICTA 1E0BA 2PYKA 4QIWE 2EJGC 2XGQA 3K6OA 3JPSA 3PR5B 3EVQA 5EBDA 2KICA 1Y8OB 4DV4Q 4LFCQ 3BU2A 2RQ5A 1K8MA 4AYBC 4ME3A 1K9MC 4JI7Q 5ALXA 2F8KA 2PI2E 4KLTA 1UA0A 2LKVA 2CFMA 2ZJPA 1NI3A 1XTDA 5ALIA 2RKSA 2WB1E 1PH9A 1I6VC 3NQIA 2JV3A 4F5OA 2HHWA 1K1SA 3UXOA 1HQMC 1CQVA 4Q44A 5EKKA 1HNZQ 2HHHL 2EDUA 1WWUA 1BPZA 2L5YA 4DV0Q 1EY0A 3GV5B 1K3BC 4X66Q 1CSQA 2BCSA 4BWMA 2DNEA 5C0XH 2C2RA 4X3SA 4A3IG 3NS1A 1IYUA 1K83B 3MVVA 2XI9A 4P2HA 1RQNA 1JI7A 4P4OA 2VL6A 4EQPA 3IV6A 3MFIA 4F91B 2NYZD 5DBCA 4C7YA 5ALQA 5FO8B 2NTSA 1OTCA 2G9HD 1UE6A 4A3BH 3I73A 3VA7A 3ICXA 1BPEA 1UE1A 2K5DA 5AM2A 3QO2A 3DMUA 3K7AB 4YY3L 1YNJC 3GTKH 3TZUA 1KAWA 2W55A 3BS5B 4UB1A 3RMHA 4DK6C 4A3MG 1VDVA 5IP9G 4M9GA 3S14H 4M9LA 3E9HA 3KDFB 2K05A 2PW7A 1O80A 1ZQVA 4I2IA 1JWMD 7ICMA 1JN3A 2K28A 4UAZA 3SI8A 3B0XA 3NELA 5AKKA 3V2TA 2SNMA 2KENA 3G6XA 1STEA 4X65Q 1I50B 3T79A 4YMNA 4HIKA 1KABA 1GHJA 1EWCA 1EY5A 1LVHA 1TS4A 2EY6A 2Z9HA 4QUFA 1A62A 2P66A 3PQIA 4R8UA 2ID0A 9ICPA 1SYCA 5J8YA 4LF9L 4Y2JA 4XA5A 4MF2A 5JEAG 2WB1C 1T8EA 5CA7A 1PH1A 1TE2A 3A0HU 4NLCA 4PL1A 3MC0B 4ELTA 1KAAA 2X6LA 4YD1A 3BS5A 1B70B 4KLJA 4HMIA 5T1IA 4HJAA 1H38A 2XY7A 2HDLA 4NB3A 3A56A 3S2HB 3KD3A 5EGTA 4R8IA 3BJYA 1D9FA 1HNZL 4LF7Q 3BDCA 1YT3A 1KXLA 3LYSA 4RZRA 4DV5L 2EZVA 1X6JA 1VQMA 3PUZA 2MO1A 1IHZA 2HSZA 2CHBD 2F03A 1ZETA 3E0EA 2CWPA 4OHJA 2QB0A 2MUYA 1RF2D 2ASDA 1B43A 3AUOA 1XWEA 5CMDA 3QXGA 3ONNA 5IODA 8ICOA 2PI4A 4IJHA 9ICFA 5IIJA 2F3WA 1JROA 4TUPA 3L7ZC 3BJUA 3C5FA 4OXPA 1QWYA 9ICVA 4A3GB 2ZJAA 5JJZA 4J9SA 1U5KA 3GTGH 7ICEA 1AFPA 1F44A 3T16A 2ODGA 3WKCA 3GV3A 4AQYQ 2WAQE 1VQNA 4OWWB 4HEDA 3NPPA 5C44H 4DN4M 1K3RA 1YBYA 4A3FB 3H0MB 3SEBA 2CN1A 3ETRA 1DJRD 1KRTA 3S14B 1XMQQ 2D9UA 2I5LX 3PUXA 5L1IA 3LWLA 2HHXA 1U9LA 3ZDEA 5M3FB 5I6WA 2B21A 1R9TB 3QU4A 2WF5A 4YP3A 5AIAA 5ALNA 3N7SC 4RUAA 5LMNQ 2FINB 3BVMA 3RD4A 4HJ7A 1WOCA 2P35A 4Y2RA 1RXWA 3HOXB 5A0LA 2QLTA 2K60A 3HOUB 3BQ2A 4BXOA 2MP1A 1BPYA 1NNXA
chains in the Genus database with same CATH topology
4GOPB 3TS2A 5LMUQ 2UXCL 3CPWA 2JA5H 1FL0A 1VQAA 4JI7L 3HOUG 4LUZA 4GKKQ 4KHPQ 5C3EH 4JBWA 2B29A 4LFAQ 5C0XG 3GTMH 2R7DA 5ELNA 3GTOH 1X65A 4GLAC 4KHZA 3TQYA 5IE8A 3PUVA 2IHFA 1K8GA 2NZHA 4A3EG 4C3IH 4EX5A 4RG1A 1Q82C 2E2JH 4DV2L 2UU9L 4DUZQ 1X56A 4YWLA 3H3VH 4J15A 1VQKA 4A3KG 2K5HA 2WAQG 4LF6Q 3PIPA 3I7FA 4A3DH 4A93G 2FXQA 4DR3Q 5JJIA 4DV6Q 4BXXH 2LXKA 4Y7NH 1S40A 2UXDL 1NJIC 2YTYA 4AIMA 2ZM6L 3J7A5 1Q46A 2CWAA 1EUJA 4DV3Q 1PFSA 1WCMH 3JAMi 2A8VA 4X62Q 3GTQH 4B3RQ 4GOPC 2HT1A 1FJGQ 4OX9L 4K0KQ 3I4NH 4BXXG 3U58A 4YWMA 4P71A 3T1YL 3PCOB 2NN6G 4YCVA 3HOYG 2JA8H 4DUYQ 1K83H 1O7IA 4LFBQ 5H1SE 3RNUA 4LFCL 3A5UA 1W3SA 3HOZH 4LF8Q 1VQGA 2IT1A 2NZOA 1K8AC 2A19A 5GROA 1I94L 4DAMA 3UDXA 3EIVA 4MTNA 1VQIA 4JI4L 5IWAQ 1I6HH 1WI5A 3ULJA 1S3OA 2KBNA 4AYBG 4JI5Q 4P74A 1Q81C 3IRBA 4QY7A 4YCWA 3RN2A 3ERSX 1PA6A 2VQFL 1J5EL 1FVIA 3M3YH 4LWCA 1SRUA 4A3LH 3EN2A 2MNAA 4GS3A 3CCRA 2AWNA 4DPGA 2ZJQA 3D31A 4GKKL 3A5ZB 4X64Q 4JV5Q 4DV0L 4JI0Q 1V43A 3D0FA 3J81i 4DUYL 2UUAL 3EBEA 2PMZE 1XMOQ 1EIYB 2BH2A 1VQ4A 1SLJA 2B63G 2ZTDA 4H02A 3KJPA 3K7AH 1KIXA 1XPUA 2VUMG 3HOWH 2Y0SG 1TWGH 3CCUA 3U4ZA 4A3JH 1V9PA 4C3HH 1HNXQ 4PZ8A 2E2HH 1C0AA 3T1HQ 2UUAQ 1EOVA 2EIFA 1G291 3GO5A 4TVAB 5AJ3L 4DR3L 2NVQH 1N32L 2XTIA 4A76A 2K52A 4HIDA 3S24A 4L5QA 1BBWA 3CQZH 3KLWA 5M3MG 1WFQA 2ZM6Q 1SE8A 2Q2TA 3CC4A 5C4XG 1HR0Q 1XJVA 3ZJYC 4A3GH 2AWOA 4HJ9A 4DV4L 4FDBA 5FJ8G 4JCVE 4OWTB 3H3VI 4JG2A 2ES2A 1JE5A 1IBKL 3A0JA 1G6PA 2F52A 5HGQA 2CQOA 1Y1WH 4JI3Q 1Y1VH 3GTLH 3M4OH 1VQCA 4JI8L 1ASZA 1OXUA 2JA7H 1EQQA 1Y14B 1AE3A 1L1OA 2RHSB 3UDFA 1GD7A 4YHHL 2MFIA 2K5NA 1QVCA 1TWCH 4X66L 2C35B 5J3BA 4APVA 1QVFA 2HIXA 3MEFA 3KDFA 1KHIA 3CP0A 4P73A 2WP8J 3ULLA 5C4XH 4DV7L 1HNZQ 4GLVB 3PGZA 1X3GA 3ULPA 4JV5L 2ATWA 5E7NA 3WWVA 4JI3L 2JEBI 1WJJA 2BH8A 3PV0A 2PQAB 1EWIA 4GN5A 2PI2A 2OCEA 3STBD 1PH4A 2VQFQ 3TEHB 4PMWA 1Q7YC 1UE5A 1YNXA 2UUCQ 3FP9A 3S1NH 2NVXH 4IPHA 3JAMc 4B3TL 3FKIG 2GN5A 2KCMA 2OTLA 4OO1I 1AE2A 3KF8B 4C3JH 1YJ9A 1N9WA 2UXCQ 2KHJA 4LUVA 2HQLA 3BZCA 3L2PA 1L0WA 2E5LL 3VDYA 4AH6A 2B63H 1YHAA 4OX9Q 2QGQA 4AYBE 3RN5A 3PF5A 1YI2A 4DR5L 1N34L 1JJCB 3B6YA 4KI0A 1JB7A 1VCIA 4POGA 1I3QH 4GKJQ 1N8RC 2A1AA 2ZTCA 2D0PA 3M9BA 2K5VA 2N8NA 4PG3A 1PH7A 2JK8A 3RLNA 1XPRA 2R93G 1SN8A 3JC66 5BR8Q 4IFDG 1PHJA 3E9IA 3A74A 4B3MQ 2JA6G 3HOYH 4JOIC 1A63A 2NVTH 1VQHA 2VZAA 3RLOA 4DV2Q 1PVOA 1Z9FA 3CCQA 4QJFA 3CMAA 1BVSA 1VQPA 4DNIA 1HR0L 3S1RH 3CCMA 1VQLA 1VQEA 4A3KH 2IX1A 5JEAJ 1XNRQ 1M90C 1Y1VG 4B3ML 4LUOA 3I55A 2UUCL 3M4QA 5IP7H 4ALPA 3PF4A 1JT8A 1P16A 2GVAA 1OXXK 2K75A 4DV1Q 4LFBL 2N3SA 3NEMA 1EFWA 4JI6L 3M4PA 2OQKA 4JYAL 5BR8L 1LTLA 5LMNW 5DLQE 4BBRG 1VQBA 5LMNL 2RF4A 1FGUA 3I4NG 2KHIA 4R4CA 4NPSA 3TREA 4A3IH 4R4TA 2AHOB 2H5XA 1XPOA 4DAYB 1MJEA 4L5SA 1Z47A 3HOVG 2Z6KA 4DV6L 3HOWG 4OWXB 1D8LA 3U50C 2AKWB 4NXMQ 2UXDQ 2BA1A 5GAHC 3PO2H 4A3BG 5IY0A 1Q1EA 3UE0A 2JA5G 3CC7A 1K0RA 2MO0A 2R92H 1N33L 1E22A 2ALYB 3NBHB 5M3MH 2YTVA 3J7ZC 2Q2UA 4OO1G 1UE7A 4HIMA 1SMXA 4A3GG 4A75A 2PNHA 1YEZA 3KF6B 5FLMG 1Q8KA 2VS1A 4LFAL 4A3CG 2MQHA 2E8GA 4JI2L 2VY3A 4XIGS 3T1HL 4LF4L 2NVYH 3BZKA 4BY7G 1Y1WG 2R7FA 2R7ZG 3Q8DA 2Q2IA 2JE6I 2OQ0A 2F4VQ 4GNXC 4DR2Q 2JEAI 1RIPA 1KRSA 2JA9A 1PH3A 2VUMH 5JJKA 3STBC 2E5LQ 4IOCA 3I2ZA 1YIJA 1C7YA 4JYAQ 4LF5L 4IFDJ 1JJGA 4K0KL 4DR5Q 3K81C 3CCEA 1B7YB 4GN3B 4IPCA 2F3IA 4BY1G 4GNXA 3HFZB 4A4IA 2IHEA 3K0XA 3AFPA 3DM3A 1Q86C 1IBLL 5GAEC 4JI2Q 3L0OA 1QZGA 1JMCA 1BKBA 1PH9A 3J81c 4BBSH 3CMEA 5IYDG 4YCUA 3CCLA 4LF6L 2Y0SE 2LSSA 1A8VA 5IYBH 4OONA 4JI5L 5IP7G 5M3FH 2VQEL 1HZCA 1MJCA 1OXSC 4WJ3M 1GKHA 4GKJL 4L5RC 4NXNL 1HNXL 3UDGA 1X54A 4JBKA 1AH9A 3AFQA 4BBRH 3M7NA 5M5WH 1QUQA 2R6GA 4DR4Q 1LYLA 3SGIA 5C0XJ 1TXYA 3CPFA 3AEVA 2JJQA 3ER0A 3U4VA 1UEBA 3CD6A 1QVGA 2DUDA 2Z0SA 4X64L 3PUWA 4BBSG 5EAYA 4B3TQ 3AYHB 1B8AA 4BA1I 1NY4A 1EYGA 1HH2P 4O2DA 4PZ7A 3K80C 1N36Q 1I50H 1GO3E 4LF7L 4UY8C 2N78A 3KFUA 1IXRA 2EXDA 3CF5A 1HR0W 3MXNB 2CKZB 2R92G 1TWAH 4JC0A 4DR7Q 3GTPH 1CKNB 3K7UC 2QA4A 2HIVA 3F2BA 1HZBA 2JA8G 1N33Q 1PYBA 5IP9H 1L1OB 1WCMG 3FKIH 3KOJA 1MIUA 2VW9A 4IPDA 2XGTA 4DR1Q 2ASBA 3PO3G 1HNWL 4GLXA 3S2HH 3J81j 1FJGL 4NXML 3S2DH 3S1QH 3HOZG 3I4OA 1E24A 5GAGC 3S17H 1HZAA 2ZTEA 1X9NA 3AQQA 2RCNA 1XMOL 1J6QA 3OTOL 4R4OA 4X65L 2EQSA 2I5MX 2PQAA 1IZ6A 4X62L 3H15A 1QUQB 4B3RL 3J80c 4LNQA 3S1MH 4YHHQ 1H95A 4IO9A 4DR1L 1VQDA 3CXCA 4JI1Q 3I56A 4B3SQ 1OXVA 1L1OC 4TQUS 2UXBL 4GOPA 1IBLQ 1CKOA 4BY7H 1YZ7A 2K4KA 4RMFA 1HZ9A 1X3EA 4O0AA 5IYBG 3GD7A 4AQYL 1CSPA 1W2BA 4DK3C 1EIFA 1VQ5A 2WB1G 4UP9A 1X6OA 3NENA 1BBUA 3I4MG 1CKNA 2KCTA 3PSIA 3DLLA 4WJ4A 1NE3A 3OTOQ 4P72A 1E1TA 3T1YQ 1VQ7A 1VQ6A 5FLXc 1A0IA 4R4QA 1SROA 1GVPA 4A3FH 4BA2I 1EQRA 1KL9A 1R9TH 1VQJA 4QL5A 2HHHQ 4BY1H 4X6AH 3TS0A 1LUZA 2B3GA 3G4SA 1KQSA 2ZJRA 4XTCS 4DR4L 1V1QA 3UE1A 1X3FA 1SR3A 1TWFH 1UWVA 4IOAA 1YZ6A 2GVBA 1J5EQ 1SFOH 4UP7A 1VQ8A 1VQ9A 3HOXH 4LF4Q 4DR7L 1YJWA 2K14A 3HOUH 1IBKQ 4JI4Q 3RZDH 2R93H 4DKAC 5M5YH 2WFWA 3F8TA 1TWHH 2JA6H 4QIWE 4DV1L 1PH2A 4JI1L 4B3SL 4PZ6A 2AMCB 1S72A 4LFCQ 4DV4Q 5FLMH 1QZHA 1PH8A 1KD1C 3BU2A 4LF8L 4ME3A 1VQOA 1IL2A 1HJPA 5ELOA 1K9MC 4JI7Q 2PI2E 1E7ZA 5HY6A 5K36G 5M5XH 2CFMA 2ZJPA 1XTDA 3GDEA 1M1KC 4A93H 2WB1E 4YWKA 2OTJA 3FHWA 1IYJB 3S15H 1N32Q 4DR6Q 1K73C 4JOIA 3RR5A 4DV7Q 4GNXB 3W5OA 1PH6A 3OYYA 4GN4B 2HHHL 1KC8C 2YTXA 4QGUA 4DV0Q 5C0XI 4X66Q 1CSQA 3H0GH 5IYCG 4A3IG 1RL2A 2VNUD 2IY5B 4NXNQ 4A3EH 4DR2L 2RHQB 4P75A 2E2IH 2VL6A 1P8LA 2L15A 2N49A 4IPGA 1XNRL 1OTCA 4A3BH 1UE6A 2UXBQ 2DGYA 3W1GA 4A3DG 1UE1A 5IWAL 3I4MH 4DUZL 3OW2A 1WYDA 4YY3L 3GTKH 4C2MH 5GADC 1KAWA 4LW1A 3W1BA 4A3MG 3LGJA 4DK6C 3S14H 5IP9G 3E9HA 3KDFB 3J80i 1C9OA 5AJ3Q 1Q1BA 4A3CH 1VQFA 3KJOA 2D62A 2NN6I 3ICEA 3NELA 2YV5A 5M3FG 2KENA 4POFA 3G6EA 1YHQA 4X65Q 4JBJA 1JJ2A 4UP8A 4HIKA 4HIOA 4IFDI 1PH5A 4L5TA 3KYHC 1A62A 4QQBX 1ASYA 2ID0A 1GM5A 4LF9L 5JEAG 3HOXG 2V1CC 1D7QA 2K50A 3GTJH 1PH1A 2VQEQ 2CCZA 1HNWQ 1CKMA 1VS0A 3KF6A 4HJ8A 5C3EG 1U0LA 3M85A 2UUBQ 1IBML 1Q12A 2UU9Q 1YJNA 4A3MH 3F1ZA 4R4IA 1B70B 1LM0A 4HJAA 1YHBA 3F2CA 4NB3A 1I5FA 1G51A 3K8AA 3PUYA 5IYDH 3HKZG 1DGSA 1HNZL 4LF7Q 1OXTA 3PO2G 3UDIA 1IBMQ 1KXLA 1E1OA 5C44G 2QEXA 1I94Q 3HKSA 4DV5L 1XNQQ 1VQMA 2JA7G 3PUZA 4KLKA 1NMGA 2MO1A 4KHPL 3G48A 3CCJA