1Q46A

Crystal structure of the eif2 alpha subunit from saccharomyces cerevisia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the N-terminal region of the alpha subunit of translation initiation factor 2 (eIF2alpha) from Saccharomyces cerevisiae provides a view of the loop containing serine 51, the target of the eIF2alpha-specific kinases.
pubmed doi rcsb
molecule tags Translation
molecule keywords translation initiation factor 2 alpha subunit
total genus 54
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1q46A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q46A01
4OONA 1NY4A 1EYGA 1C7YA 4R4QA 4NXML 1IBLL 1MIUA 3PUVA 1OXSC 5C0XI 2QEXA 4HIOA 3F8TA 1KXLA 1Q1BA 3K81C 4LW1A 4IPGA 1N8RC 2UUAL 4BBSG 4LF9Q 3CQZH 5C44G 1XMQQ 2KCTA 3M4OH 2OTLA 1HR0Q 2K75A 4PZ6A 2E8GA 1K0RA 1UE5A 2K4KA 1YJNA 1PHJA 2UXCL 4DV4Q 2OCEA 2JA8H 1SN8A 3GDEA 5E7NA 3PO2H 2I5HA 3MEFA 2ZM6Q 1KAWA 4QL5A 3WWVA 3J80i 4DUYL 4A93G 1GVPA 2AKWB 3J7A5 1EQRA 1X65A 3H3VI 3KFUA 3S24A 1OTCA 2ZTEA 2C35B 3GTMH 1X3GA 4DV7L 4JI2Q 1XMOL 5IP7G 3BZCA 2GN5A 4PG3A 1Q1EA 4YCVA 4DV6Q 1FJGQ 4HJ9A 4YHHQ 4A3FH 1N36Q 5IYDG 5IYCH 4JBKA 5C4XH 3H0GH 3T1HQ 1Q86C 3A5ZB 4DV1L 4OWXB 1NTGA 2IT1A 4JI3Q 4OX9Q 2Z6KC 4HJ7A 1EQQA 3GTGH 1VQKA 3CW2C 3CCEA 2WB1E 1OXTA 3U4ZA 4A3JG 4GN5A 2K50A 4IO9A 4R4IA 3S1NH 1U0LA 3CXCA 5C3EH 1HH2P 2UU9L 3G48A 4A3EG 1VS0A 3Q8DA 1L1OC 4LF6L 4RMFA 2BA0A 4GNXA 5IYBG 3L2PA 4L5RC 1CKNB 3CD6A 2UXDQ 1HZBA 4DV5L 4JBMA 2E2HH 4YCWA 2B63H 3W1BA 2NVTH 3I4NH 1PYSB 4A3KG 4ALPA 4QQBX 4IJLA 1YVCA 1E24A 1GD7A 1XMQL 1OXXK 1VQ5A 1VQLA 1XJVA 2ZJRA 4OO1I 2A1AA 3CCSA 4BY7H 2UXCQ 5JJKA 4LF7L 3ULJA 3KF6B 1ASZA 2WB1G 2VS1A 1X54A 4DV3Q 4LF4L 1VQJA 4JG2A 2JA5G 3HOUG 3RZDH 5IYBH 1LTLA 1S72A 1G291 2AWNA 1HZ9A 3AFQA 4LUVA 3GTLH 2Z6KA 1I50H 1VQCA 1VQMA 3I4OA 3K7AH 3EN2A 2VUMH 2NN6I 3J80c 1VCIA 2N3SA 4JI4Q 1BVSA 2RHSB 4X6AH 3HOXG 5JJIA 4DV6L 1JJ2A 1FJGL 4DPGA 3I4MH 2I5LX 2OWOA 3EBEA 3M7NA 3T1HL 3ERSX 3JAMc 4JOIC 4DV1Q 1HNWL 4JI3L 2HIVA 3PGZA 4DR2L 4OX9L 3GTKH 3I56A 1M90C 1RL2A 4R4OA 2NZHA 2V1CC 4P72A 4DR7L 1D7QA 4MNOA 3VDYA 5BR8Q 1KHIA 3PCOB 4JI8L 5IP7H 4TVAB 3CPWA 4WJ3M 1JMCA 2UU9Q 2HQLA 2E5LQ 1CSPA 1QZHA 1NMGA 3GTOH 4C2MH 4YWKA 5M3MG 1X9NA 4LF6Q 4TQUS 1QVFA 4IPCA 5EAYA 4O2DA 1CUKA 3NBHB 4B3RQ 3B6YA 4KHPL 2XTIA 2YYZA 1M1KC 2MO0A 1B7YB 2UUBQ 2JA6H 1L1OA 1E7ZA 3GO5A 3I7FA 4HIDA 4A3MG 3NELA 4IPDA 1E3PA 3TEHB 2CQOA 1TWCH 2K5VA 4DR4L 4A3CH 3RLNA 4DAMA 4DV0Q 4JV5L 3STBD 1N32Q 2WAQG 2UUCL 4LFCQ 3GTPH 4LF7Q 4BY1H 4IFDI 2LSSA 4DV3L 3S1QH 1LUZA 2N78A 4JI1L 2VW9A 1Z47A 1GM5A 4LF4Q 2R93G 1GO3E 3CC4A 1H95A 3I4MG 1SMXA 3GD7A 4KI0A 3BJUA 5IE8A 4X66L 4APVA 4BBRH 4Y7NH 2VQFL 3CP0A 1P16A 4X64Q 5M3FH 1TWAH 4GN3B 4AQYQ 1YITA 1QZGA 1WOCA 2Q2TA 4A3BG 1TXYA 4JI4L 4LF8Q 3UE0A 1PH4A 4L5QA 2PNHA 1CKMA 4LFBQ 1EUJA 4C3JH 3AQQA 3OTOL 1SLJA 4DR3L 2JA5H 2VNUD 2HHHQ 2BA1A 2OQKA 1UE1A 3PUZA 3M85A 3PF4A 4A3BH 1VQPA 1U5KA 1IZ6A 5ELNA 1JE5A 2BH8A 3RN5A 4DR7Q 3U50C 3K0XA 3JAMi 4GKJQ 2KCMA 4HJ5A 1SROA 2R7FA 4DK6C 1SRUA 3D31A 2WP8J 2E5LL 1Q8KA 4KHZA 2F52A 3AYHB 2VY3A 5GAEC 1UE6A 2MFIA 1YJWA 4LFAL 5IY0A 2R7DA 1PV4A 4BY7G 4IFDG 4ME3A 2ZTCA 2PQAB 3M4QA 3K7UC 1EWIA 4IPHA 1I6HH 1TWFH 4AYBE 1N33L 4JI6Q 2JEBI 2ATWA 5JJLA 4GS3A 4DR1L 5H1SE 1C0AA 4DV0L 4JV5Q 1K9MC 5IWAL 2JE6I 2F4VQ 4K0KL 1RIPA 2AWOA 1VQ8A 2GVAA 1VQ4A 1VQ6A 4OXPA 1MJEA 2Q2UA 3HOWG 5C4XG 1A62A 4IJHA 4NXNQ 1KRTA 3K8AA 1XPOA 1WCMG 2H5XA 4AQYL 3L0OA 4LF5Q 4NB3A 1NMFA 2JQOA 1O7IA 3G4SA 2YV5A 4LF8L 4XIGS 1IYJB 4LFBL 5J3BA 1VQDA 3TREA 1L1OB 1X3EA 1UEBA 2VL6A 1HNZL 3M3YH 1I94L 5M5YH 2AHOB 1AH9A 3PO3G 3OW2A 1PH5A 4IFDJ 3DLLA 1N34L 2Y0SE 3A74A 5M3FG 3DM3A 1J5EQ 4A3LH 1IBKL 2MNAA 4B3SL 1VQNA 4X62L 1K73C 3S15H 1V1QA 2ASBA 5LMNL 1G6PA 2XGTA 1X56A 4O0AA 4BY1G 1JJGA 1S40A 2Q2IA 3E9IA 4JBJA 1QUQB 2I5MX 5FJ8H 2IX1A 3TS2A 1Q81C 4JYAL 4OWTB 4YY3L 2CCZA 4B3TL 4GKKQ 4A3CG 3H15A 1Y1VG 4WJ4A 3UE1A 3LGJA 2HT1A 5GQOA 3AFPA 2L15A 4YWMA 3T1YQ 1CKNA 2E2IH 2JA7G 4P75A 4XTCS 3HOZH 1ASYA 1BBWA 4JI6L 4JI5Q 3JC66 1L0WA 1XNQL 2R92G 4NPSA 5IP9G 3S1MH 4X65L 1KL9A 1JT8A 1VQ9A 3FHWA 2I0QA 4DR6Q 2DUDA 2UUAQ 4NXMQ 4R4TA 4C3HH 4GLXA 3CPFA 4A3EH 4A3DH 2MO1A 1A8VA 3F1ZA 4NXNL 1WI5A 2DGYA 3SGIA 4B3MQ 1QVCA 2QGQA 4JI7L 4LF5L 1FVIA 3TQYA 4A3JH 1XPRA 2Y0SG 1EFWA 2YTYA 3BU2A 2ES2A 2K14A 4KLKA 4DUYQ 2VZAA 2ZTDA 4DNIA 3FKIH 5GAGC 2ZM6L 5LMNW 1KRSA 1PH1A 1HNZQ 1JJCB 1MKHA 3S2HH 2PI2A 1XMOQ 4JI2L 2CWAA 3AEVA 1PH6A 1FL0A 4YHHL 5GAHC 4DV7Q 1Q46A 3ULLA 3S14H 1V9PA 4PZ8A 1IBKQ 4B3SQ 2IHEA 3G71A 1VQFA 4UY8C 2MQHA 1K8AC 4A3DG 4PZ7A 2D0PA 2JJQA 2R92H 3S16H 4QIWE 4EX5A 3PO2G 3J81j 1C9OA 3KDFA 4DAYB 5JEAG 3CCVA 5C0XJ 3CC2A 3STBC 2JA8G 3J81i 4JYAQ 4YY3Q 4B3TQ 3RZOH 4GKKL 3CF5A 4POFA 3U58A 4UP9A 1B70B 1D8LA 3RN2A 5C44H 3IRBA 4BBRG 4HIMA 5LMUL 3T1YL 1PH7A 1XNRQ 4BBSH 1X3FA 5FJ8G 1EOVA 1Z9FA 2EXDA 4DV2L 3KLWA 1PYBA 4FDBA 3I4NG 3J81c 1WJJA 2FXQA 1YZ7A 3CCJA 3CCRA 1YEZA 4DR5Q 1XNQQ 5GROA 5AJ3L 4A3GG 1YZ6A 3L7ZC 4X65Q 2QA4A 1SFOH 1HNXQ 2UXBL 3HOVG 3PIPA 1A0IA 3NEMA 1SE8A 3PV0A 4DR6L 1AE3A 4QJFA 5C3EG 1P8LA 3F2BA 4BA1I 3CCMA 4OO1G 4A3MH 2NZOA 2JA9A 3KF6A 3KF8B 3KJOA 3RNUA 4A3IH 2JA6G 4B3ML 4JI7Q 3F2CA 4LNQA 2R93H 1HJPA 2NVQH 4JCVE 1VQ7A 2IHFA 2VQEL 3PUWA 1K83H 2R7ZG 3H0GG 4DUZL 5M3MH 2N8NA 1E1OA 5IYDH 2ID0A 2B29A 1I5FA 4QY7A 1YJ9A 3BZKA 2K5HA 3K80C 4YCUA 3S2DH 3KJPA 2B3GA 2NVYH 1A63A 4AYBG 3HOWH 2EQSA 1GKHA 2RF4A 1WFQA 4JI0Q 4GLAC 1HNWQ 3M9BA 3H3VH 2R6GA 4A76A 4P73A 1VQIA 1XPUA 1QVGA 2PQAA 3UDFA 2HIXA 2PMZE 2LXJA 4DR2Q 1W2BA 1SR3A 3CMAA 3M4PA 1PFSA 3ER0A 1B8AA 3PF5A 1EIYB 4IOCA 5FLMG 3ICEA 3CAMA 5FLXc 3RLFA 3CCLA 5BR8L 1X55A 2KHJA 5LMUQ 1PH9A 4JI8Q 1XNRL 3KYHC 1PH3A 4DV2Q 3HOUH 1FGUA 2IY5B 4B3RL 4R4CA 4R1JA 3RLOA 5DLQE 4DR5L 1PVOA 5C4JH 3FKIG 2UUBL 2EIFA 5AJ3Q 4YWLA 2UXBQ 5IT9c 4MZ9A 4RG1A 1HNXL 4KHPQ 5GADC 4AH6A 1S3OA 5FLMH 4GNXB 1YNXA 2KBNA 1PH2A 3A5UA 1N32L 2D62A 3TS0A 1YHAA 4LFCL 5M5XH 2UUCQ 2B63G 4DR4Q 4GLVB 1JB7A 5ELOA 2ALYB 4JI1Q 1G51A 4L5SA 4MTNA 2RHQB 2CWPA 1J6QA 2GVBA 1KD1C 2VQEQ 4POGA 1KIXA 3CCUA 4DUZQ 2JEAI 1E1TA 4L5TA 3UDGA 4X64L 3D0FA 1BBUA 1TWGH 1VQGA 2N49A 4UPAA 4GOPB 3UDXA 1HZAA 2RCNA 4GNXC 1E22A 4X66Q 2VQFQ 2OTJA 3HOZG 3I2ZA 4EQ5A 3OTOQ 2IX0A 3U4VA 1Y1WH 1MJCA 3NENA 1IBML 4JI0L 3HOVH 2LXKA 3HOYH 3HOYG 2R7ZH 4A3GH 2K52A 3I55A 4DR3Q 4H02A 1TWHH 3GTJH 2HHHL 3S1RH 1L2FA 1QUQA 1IL2A 2A8VA 4UP7A 2ZJQA 4A3IG 4GKJL 4HIKA 1Q82C 1K3RA 2BH2A 1UE7A 4AIMA 1Q7YC 4JBWA 2YTVA 3E9HA 3HKZG 3ULPA 1R9TH 3FP9A 2E2JH 1Q12A 1DGSA 4IOAA 3MXNB 5IYCG 1KQSA 4Y52H 4A3FG 2A19A 1UWVA 3HFZB 1BKBA 4J15A 2WFWA 2F3IA 5JEAJ 4QGUA 2NVXH 3J7ZC 4LFAQ 1W3SA 1NE3A 3G6EA 1VQHA 1N33Q 3PUXA 1EIFA 4A75A 3UDIA 3GTQH 3W1GA 4DR1Q 1WCMH 1AE2A 1CKOA 4A93H 2NN6G 5K36G 4GOPC 3PUYA 2F4VL 4K0KQ 4PMWA 3A0JA 5HGQA 3E0EA 1IBLQ 3HOXH 4HJAA 5IWAQ 2K5NA 1X6OA 2KENA 1YI2A 4C3IH 4JOIA 3RR5A 3ZJYC 5M5WH 4LF9L 2VUMG 3F2DA 1HR0L 1T9HA 1YHBA 4DKAC 4BXXH 4DV4L 1Y14B 2AMCB 1VQBA 2ZJPA 1PH8A 4UP8A 4LUZA 1CSQA 1LYLA 5C0XG 4OWWB 3S17H 2PI2E 1IBMQ 2YU9H 1I94Q 1Y1WG 2Z0SA 3HKSA 1YHQA 1OXVA 2Q2HA 4GN4B 1I3QH 3W5OA 3CCQA 1XTDA 3EIVA 4HJ8A 1J5EL 1IXRA 4JC0A 1V43A 4X62Q 4A3KH 1YBYA 2JA7H 3CMEA 1OXUA 1KC8C 1N36L 1N34Q 2WAQE 2YTXA 3PSIA 5LMNQ 1K8GA 4BA2I 1VQOA 1HZCA 5HY6A 4A4IA 2JK8A 2CKZB 4GOPA 1PA6A 4LWCA 5IP9H 1WYDA 3PIOA 1HR0W 2KHIA 1NBWA 4BXXG 4P71A 3TRZA 3KDFB 1NJIC 2CFMA 4A3LG 4P74A 1VQAA 4JI5L 4DK3C 3OYYA 2OQ0A 1Y1VH 1VQEA 3CC7A 1YIJA 3KOJA 1LM0A 3PO3H 3HKZE 1N9WA 2D0OA 2UXDL 4LUOA 4DV5Q
chains in the Genus database with same CATH superfamily
1SYGA 4DQPA 1C7YA 4ZUIA 3EYZA 3FDSA 4F5QA 2BPGA 2FLPA 1BOSA 1LTSD 1Q8IA 2PQEA 2QEXA 4HIOA 1Q1BA 2R8KA 4LW1A 1N8RC 2UUAL 4DAVA 2GO7A 1B44D 4BBSG 1R4PB 3AB9A 2Y0SC 1XMQQ 2KCTA 2OTLA 3OGUA 2EY1A 3PW2A 1K0RA 2KZZA 4FBUA 1RG6A 4C8NA 1TK0A 5G3LD 1SN8A 2BCVA 1LTID 4C8OA 4RT3A 1RYUA 3PO2H 2KHSA 1TS4A 4QL5A 4C8KA 2XO7A 4FFDA 5IIOA 1BBXC 2D5DA 3H3VC 3KFUA 1Z00A 2NVTB 1T94A 5C5LA 4IR9A 2O6KA 1B0XA 1NZPA 1U49A 1ZQTA 2HD3A 3GTMH 4YFKA 1ZYRC 2WAQC 4Y2QA 3FVQA 4JI2Q 2V4RA 3THVA 4IQWA 1UA0A 1HQMC 2EZVA 2DN8A 4HJ9A 3QUTA 4IQTA 5C0YA 5IYCH 4JBKA 4UBBA 2KNJA 5K4LA 1Z6HA 1Y8NB 4QZGA 3T1HQ 4DV1L 1BDOA 4C7YA 2BE5D 4OJLA 3C21A 5L37A 2HOQA 4OX9Q 2D2CC 3CCEA 2WB1E 5L1KA 1OXTA 3U4ZA 3URYA 5ALGA 1RZTA 1HPCA 4C3JB 5DDYA 3WKBA 1JC7A 4NY8A 2P5ZX 3QE9Y 3S1NH 1DOQA 4QCLA 5ELBA 4DQIA 2YMMA 1HH2P 1KABA 1MN8A 3HS0C 1DK2A 4A3EG 1A76A 4QWBA 4U673 2K8BB 3G6YA 1ENFA 1I4QA 2BA0A 2R8IA 4K5WA 5EE3A 4L5RC 3L2PA 3CD6A 2XCPA 1CKNB 1TE2A 5EWEA 4BUGA 1HZBA 4RA8A 2E2HH 5J2EA 5CBEE 4C3JG 2E1FA 4ZKBB 3OSNA 1PYSB 3RAXA 4EYIB 2RSOA 1ZRMA 5AICA 5JAVA 1RXVA 5J0RA 2CN1A 1ZQLA 1SNCA 3NTIA 2RDJA 4Q45A 1CK1A 4C8MA 2RDHA 2A1AA 4BY7H 3H7IA 1D5MC 4Y2UA 3KF6B 2A73B 3I73A 2WB1G 2J6UA 2JA6B 1VQJA 5IT9L 2IWHA 4NL9A 1DCZA 1G291 4KLOA 3NTHA 4Y2YA 4LJZC 2KHQA 4HYKA 2I6XA 3HZXA 1DM0B 1GUOA 4EENA 2AGQA 1LV9A 5KAIU 1FJGL 4LK1C 2WFAA 5KAFU 3OMCA 3EBEA 1C8CA 3SI8A 4JOIC 4O0IA 1TIID 3JAMc 4X3KA 5JPNC 1QQ7A 3OHBA 4KTAA 1YNNC 3A0HU 5JVG3 2IL8A 1D7QA 4MNOA 3SD7A 3VDYA 2QB1A 1DD2A 3PCOB 3JPPA 3WKDA 4JI8L 1LKYB 3NUCA 4TVAB 2G5IB 5J2HA 1XWEA 2HQLA 4UW9A 2VJ4A 3PVXA 4C2MH 2W11A 2ZUBA 4TQUS 1NZBA 4NLNA 5J1ZA 3M1YA 3B6YA 2RKSA 3R2IA 2QDLA 3IFTA 4GC6A 5DQHA 4Y2VA 1KTQA 5J2JA 4RT2A 1GUGA 2KVSA 2W7OA 1IW7C 3GO5A 5KNCA 3TP8A 4WJ3B 1E3PA 1HQRD 3TEHB 2CQOA 1TWCH 5DKWA 2IJ0A 4DR4L 4A3CH 4OO1J 1JR0D 2B2YA 1RYRA 4KKTA 1N32Q 2UUCL 1PTOC 2KJ5A 3OPOA 3GTPH 4B9WA 4BY1H 2HMXA 1UCVA 2NV3A 4RQ3A 1HUZA 1LUZA 3P1HA 4C3IB 4DV3L 3VR4A 1WTOA 3S1QH 2R93G 2H3FA 2ATLA 3HOZB 3DWQA 4Z6FA 1FYCA 4BXOB 5G3LF 2B2UC 4APVA 2PO4A 4DS5A 2ZJ8A 3ED5A 1ZQWA 1WOCA 3DEEA 5KFWA 4A3BG 4LF8Q 1PZKD 3UE0A 1QJOA 1PZNA 1PH4A 1FR3A 3IG5A 3PZPA 1URJA 5KT6A 1STHA 3OTOL 1PTOF 3AQQA 1SLJA 4DR3L 2JA5H 4J9PA 5AIBA 3DM1A 4RU9A 4K2KA 2BA1A 3CQZB 2OQKA 1UE1A 5ALEA 3C28A 2RHFA 3M7GA 3PUZA 3M85A 2JA8B 5AI0A 3B9JA 1KLGD 3VC8A 3U50C 3JAMi 4DR7Q 2HCCA 3AQFA 2K05A 2R7FA 4R8NA 5CV6A 3DV9A 1N56A 5GAEC 4CDEC 1KN5A 2MFIA 4TUQA 5KFEA 3TADA 2R7DA 3C1ZA 5AFWA 3O0FA 2ZTCA 4ELVA 4Q8EA 2MHVA 4PZNA 1S0NA 3WK6A 4HR7B 4X5VA 1I6HH 1EWIA 1Z4OA 1TWFH 4EBEA 5CHGA 1ESRA 2R7ZB 1S5ED 4JI6Q 5JJLA 1B53A 2C2EA 4GS3A 4DR1L 4M9HA 4FO6A 3PW7A 4JV5Q 1SL0A 1HA5A 2RDFA 3QU2A 1K9MC 1X66A 7ICGA 1RIPA 2AWOA 5HR7A 4KN4C 4ZK9B 1N63A 3HOWG 2JZBB 4ILWA 1K1QA 2WAQF 2YTUA 3WK5A 2EYJA 3T51B 4ED3A 2JEJA 3C5GA 7ICSA 3CYMA 5CR3A 4LF5Q 2K60A 3ERQA 4EGVA 2JQOA 1D9DA 2F3VA 4U68A 4HMJA 3KHRA 2K33A 1CEZA 2HDMA 4UAWA 4RGNA 3MFGA 1L1OB 1A77A 5AM1A 1XSNA 8ICOA 2VL6A 2W7PA 1HNZL 5M5YH 2AHOB 1WTPA 5DG9A 1AH9A 2WB1B 3BQTA 4OO1H 1KNAA 4KX5A 1N34L 2H3VA 3QZ7A 1H9SB 2Y0SE 3M9MB 4KLEA 9ICRA 3F53A 1ZQFA 3QG1A 1IBKL 1N62A 2ASBA 5CV8A 3TFRA 5LMNL 1G6PA 3P75A 1X56A 1JJGA 1S40A 4JBJA 1ENAA 2IX1A 1QUQB 2R8GA 4NLKA 1U48A 1N60A 2CW0D 3MEHA 4BWGB 1DOKA 1Q90A 4UAIA 2HT1A 1ZQPA 1PRTD 1MSHA 3M8SA 5HGTA 4KLIA 1FNWA 3HOZH 1VDVA 4RQ0A 2D3DA 2PFOA 4MFAA 1XNSA 4XUSA 3TACB 2E5SA 1L0WA 3ICXA 1I6VC 3V6KA 1WTVA 4BY1B 1U4MA 5IP9G 1FIQA 5FP0A 2L12A 2MP1A 3DHQA 3TMEA 3S1MH 5DBBA 3GQCA 4KLHA 4GFJA 2P35A 1EXNA 3LWEA 4JB3A 2W8LA 5EWGA 7ICMA 4NXMQ 1T4GA 4A8EA 1U4LA 4DL4A 3CPFA 4O3MA 2MO1A 3RB0A 2DGYA 3KFUF 2IBKA 1STYA 3MXGA 4KKSA 5K5PA 1TKWB 3J81L 1S9FA 5IGFA 1CT1D 2OM6A 3AL0B 1ZQEA 3M9OB 4RQ8A 2YTYA 1ZQXA 5KFAA 4Y2JA 1EWHA 3BU2A 4C3IG 3IDWA 1NK9A 2NRVA 1KSPA 2ZTDA 1JRPA 4IL6U 3GIJA 3UMGA 2DKXA 1D9FA 2MRLA 4OCZA 1F5SA 1JJCB 1NJYA 1TWGB 3S2HH 2PI2A 1XMOQ 4IUQA 3Q8MA 2WTFA 4B9UA 4RH6A 4MEXA 4YHHL 1Q46A 1WTHA 1V9PA 2OEOA 2HCFA 3RH6A 2IHEA 1VQFA 3RJJA 3RAQA 4JV2A 1FEZA 2CXYA 2Q4TA 4PZ7A 5IIFA 2E75C 3ONNA 3PO2G 2K6AA 2XC9A 1SNPA 1RXWA 3MFYA 3STBC 2G9DA 4KV6A 4C4TA 4ECRA 2Z7JA 2XIWA 2ZXOA 1X6JA 2E8MA 1JQYD 3KLSX 1SYEA 4BBRG 1PH7A 1SEBD 5FJ8G 5KFSA 1ZD5A 1SKWA 4FDBA 2D6FC 3CCJA 1XNQQ 1YEZA 3KBXA 2HBKA 2K32A 2I9GA 3Q23A 4XQ8A 1SFOH 3T5LA 3SV3A 1NJZA 4DR6L 1SE8A 2EDUA 5IIIA 2LY7A 2SNSA 3NPPA 2K5DA 2GWSA 4NW2A 5EKIA 5CC4A 5C3EG 1ZQNA 2G9HD 5M5XB 5EWFA 2KVMA 4A3MH 4ICAA 5KFZA 3E6ZX 1SAPA 1QNUA 3RNUA 4A3IH 3F2CA 1HJPA 3SR1A 3SAGA 2CW0C 2C2DA 2WKCA 2Q0ZX 4NDXA 2VQEL 4RAUC 1ET9A 2B29A 1I5FA 4QY7A 4DGZA 4QUFA 3K1ZA 1YJ9A 1IHZA 5A0LA 3OPXA 2KMDA 4J9OA 3K80C 5J0YA 2FI1A 4KLFA 4YCUA 1BUVT 2B3GA 2NVYH 1A63A 4XXEA 2AQ4A 3FYHA 3EWAA 4NLCA 3JPTA 1GKHA 4HN7A 1JORA 1Z1BA 4GLAC 3N97B 9ICAA 1ZYRD 4A3DB 1NK7A 1QOHA 3NQIA 3MXUA 2Z1CA 1SE2A 5AKXA 3LK9A 1CTMA 1VQIA 5JEAH 2K89A 4G9BA 2RP5A 4DR2Q 3D2QA 3Q8LA 4DL6A 3CMAA 5KNBA 2I07B 2BDOA 1M4VA 3T5HA 2RA4A 3CCLA 2LHTA 4F4YA 3RB4A 1XNRL 2IHMA 1MSGA 4RQ4A 1H9SA 1LT3D 4R4CA 5DLQE 2F0OA 2NO5A 1ML0D 1QH9A 5IT9c 4KHPQ 4Y2RA 5DB6A 1VLBA 2ZUDA 1H9JA 3A7AB 3GQBA 2W9AA 2CRXA 4WJWA 5GADC 3J7AF 1L0XB 1S3OA 4GNXB 2RLTA 4EBCA 1CI4A 4ECZA 7ICOA 3BS1A 3JPOA 2KBNA 1PH2A 3A5UA 2ASLA 2KKVA 1GXDC 5HMLA 4LFCL 1IYVA 4K4GA 3S1RB 4H7BA 4UBCA 3RD4A 1WD0A 4JI1Q 2PYKA 1G51A 4L5SA 1N36Q 3M6ZA 2CHBD 4POGA 1G91A 2AQ2B 1Z00B 1TS3A 1BBUA 1TWGH 3S2HB 2KEDA 4A3BB 1X40A 1COOA 1E22A 4BWMA 2QW7A 3HOZG 3I2ZA 2Y0SB 3N6RA 4CBVA 4F3OA 5KIXA 4RUCA 4O3SA 5E3FA 2C2RA 2WF9A 3UI2A 2JMGA 8ICVA 1STAA 5HHHA 3HOVH 3HOYG 3ND8A 1ZQCA 3WK7A 2K52A 3I28A 3QZ8A 5DNFA 4DL7A 1IL2A 4B9XA 2ZIWB 4HIKA 1Q82C 4TRDA 2BH2A 5KEEA 2RQXA 1NJWA 5ALWA 1BCPC 4QW9A 4GXIA 2MA1A 1I4GA 1STGA 1H38A 3G7LA 3SE0A 5IYCG 5AI9A 1WVLA 1GHKA 3HFZB 4P2HA 1SJHD 1TS2A 1JE4A 1ZQMA 4HAIA 4LFAQ 5EE0A 9ICFA 4F71A 5C3XA 3PUXA 2LYHA 4QZ8A 3UDIA 4FF1A 3I4NB 2F0QA 4P2CB 2CPRA 2NN6G 1PVPA 1DGJA 4XQNA 4F5PA 2EQYA 3PNCA 4A3FB 3E0EA 4P4MA 1RDPD 5KFHA 5KFUA 1D1IA 4C1NI 2G06A 3IKJA 3HKZF 4IRDA 1UNSA 3RUZA 4C3IH 7ICPA 4LF9L 3M4OB 5EBCA 1GHJA 3C1YA 3E0JA 4FE3A 4DAPA 1HR0L 1T9HA 1X3QA 3A8JE 4ZAIA 4C4SA 1Y14B 4MFFA 3DXJC 3A56A 1UEAB 4UP8A 2YB1A 5C3EB 3E58A 3HRDD 2ICEC 4F5OA 3HILA 1EIGA 2Z0SA 3HGBA 8ICGA 1PRTB 2N55A 3W5OA 5CR0A 3CCQA 4M6WB 4BJQA 2DL0A 1V1OA 1J5EL 4CF3A 3NASA 4CDGA 1QG7A 1IXRA 3TZDA 4A3KH 3B0XA 4EYHB 1KC8C 3N7PD 2C28A 3PSPA 3OHAA 1JWMD 2W9CB 1VQOA 2NTTA 4A4IA 4OJ6A 4YQWA 5B66U 2JK8A 4C4RA 2Y0SF 5J0XA 5LL6S 3PIOA 1IW7D 1I6HB 4NM1A 3S1QB 1WTWA 2ZIXA 7ICTA 1SYDA 1T7PA 2C9OA 2NBFA 3OYYA 2OQ0A 1O08A 4USAA 1LTRD 3HT3A 2DJGC 3EVQA 1EU4A 3SHLA 4RGOS 2VA8A 2KD1A 3BVGA 4CHTB 2JEAI 4QNLA 4O5EA 1NY4A 1STBA 1EYGA 2O5IC 4PMCA 5ALNA 2Z8LA 5ALXA 5T1GA 1RQLA 1QCBD 1E2VA 4I28A 3ETRA 2HBMA 2RCFA 3K81C 3JAML 3CQZH 5E79U 5C44G 5I6WA 4QZAA 2BDNA 3M4OH 4BY7B 2K75A 1GUTA 1TK8A 3H40A 4RQ1A 8ICZA 2K4KA 2UXCL 3CRLC 2LYBA 2OCEA 2NO4A 1BNZA 5C4JB 4DS4A 4K5XA 9ICOA 5E7NA 4E6IA 2A68D 3MEFA 2ZM6Q 1KAWA 3WWVA 3GIKA 4N9TA 3J7A5 1X65A 2JHDA 7ICLA 1B4OA 2KZMA 1QVFA 5KFNA 2F0JA 3FDTA 1V1PA 5HP4A 3HWTA 1HTLD 5IP7G 2LM1A 1O80A 2RVLA 2F0GA 4YCVA 1LTBD 3FM9A 4F50A 4R64A 1MSWD 3G6JB 5LHY1 2KSOB 4OWXB 4JI3Q 1K28A 4A93B 4HJ7A 1HHVA 4PHAA 1S5DD 4B9MA 4IC9A 1YNJC 2G08A 1FFUA 4CJ0B 9ICMA 4IO9A 2A6HD 1QTMA 4R4IA 5JPMC 1RPLA 3T79A 1PYWD 1NK6A 3CXCA 3FMCA 3VYUA 3HX0A 2UU9L 2JSOA 5KNIA 2DJFC 3H94A 2E76C 4RMFA 4TQRA 4BBRB 4GNXA 5J2IA 4O1NA 5I9PA 4OJOA 2Y1JA 7ICKA 3TP5A 2UXDQ 4IQZA 3I4NH 1LTTD 1X2IA 3GV3A 3W1BA 1HXYD 5DBCA 4GIBA 3LNNA 2NVTH 4ALPA 1RF2D 1Z7TA 4P0PB 1E24A 1ZQOA 3V7KA 3QU7A 5DB8A 1SNOA 4HTHA 4PZOA 1VQ5A 8ICRA 3W2DA 2F4IA 2ZJRA 1CQVA 1UQVA 3D4WA 1XJVA 4CRXA 5DB7A 3CCSA 1JT8A 3MWYW 3ULJA 3U9SA 4S3SA 1WWVA 3Q6SA 2F1JA 2BCRA 4LF4L 3AU6A 3HOUG 3VR6A 5FLXE 2PFQA 1GUWA 4ECUA 2K4EA 4JPBW 5J2AA 4OIKA 4LUVA 4DSEA 1I50H 1VQMA 4RWSC 4C8LA 3I4OA 3MC0B 3EN2A 4RQ2A 4KLLA 2VUMH 5CP2A 1QB5D 2NN6I 4M1UB 2EJFC 3H4BA 3OSPA 1L3TA 1EQVA 2RHSB 4JI4Q 4X6AH 1LKYA 3HOXG 1SGGA 4DV6L 4GZYC 4K14A 5CRXA 3X3MA 5DQGA 2OWOA 4HSVA 2KOLA 2FJ6A 5K36H 3RZDB 1XSPA 2HIVA 1A2TA 2JA7B 3GTKH 2F1MA 5KG2A 3NP8A 5E4XA 3I56A 5J2KA 4RPXA 4R4OA 4EQPA 3H09A 2AGPA 2V1CC 2E2HB 1Q3VA 7ICRA 1SYFA 2E3TA 5KG5A 3HOXB 3CPWA 1UA1A 1JMCA 3ORYA 4WJ3M 2G09A 2E5LQ 1NMGA 2HUGA 1I50B 5M3MG 2QEJC 2YQEA 2EYLA 3SK8A 1X9NA 4LF6Q 3LVWA 4GXKA 4O2DA 5EAYA 1SB3C 2LM4A 2IOHA 2JRZA 3NBHB 5J0UA 5J39A 2P66A 2YYZA 3OIQA 1M1KC 4B3RQ 2MO0A 3BQ7A 1B7YB 3V6JA 3ISCA 1E7ZA 3I7FA 4HIDA 1RJTA 1HUOA 2B2WC 2V4QA 3TBIB 4DXFA 3QUBA 1WCLA 3QOLA 1S4ZA 5KFLA 3RLNA 2WAQG 4K6DA 9ICSA 2KICA 4M2YA 4LF7Q 2EYFA 2LSSA 4DO9A 1XU4A 1SV0C 5BN3A 2IX3A 4DSFA 1Z47A 2VW9A 5ALKA 3CC4A 3K75D 1SMXA 8ICAA 1LT6D 5D3DA 5NUCA 2V9WA 4X66L 4BBRH 4X64Q 1TWAH 1X32A 2F3NA 3GP7A 1KTKA 4OHJA 2OT2A 5KT3A 4WORA 5C4ZA 2YB4A 1TXYA 3HOYB 3QU9A 2EH9A 4RKLA 3HEJA 2QB0A 5DG7A 4DQSA 2BQUA 1JROA 5EE9A 4ZRZA 1XS9D 4RNNA 2F0HA 1MHWC 2N88A 3S17B 4ZYSA 3WOFA 5I2YA 1ZQVA 3PF4A 3UPQA 2HI0A 1XWLA 1IZ6A 5ELNA 5I4DA 3RN5A 5I6YA 4JV1A 1Q3UA 3KKAC 1ZQKA 4GKJQ 4HJ5A 3A8KE 4O3PA 2XIDA 1LB2B 2DF4B 1SRUA 2WP8J 1Q8KA 3TKAA 3S2DB 2B21A 4PGXA 4V0BA 1EZ6A 4ID6A 1S97A 1LABA 2F52A 4KHZA 5AI4A 1UE6A 2KIVA 5ALYA 1SE4A 2KFZA 1KEJA 4RQ7A 3TI0A 1Z19A 5IY0A 3JPRA 1PV4A 4IFDG 4YMNA 3GZFA 1KDAA 3H8SA 4RCNA 4Z6CA 4ECQA 4PPXA 4JV0A 2E1EA 3CRXA 1N33L 5CYUA 1NK0A 1ZQIA 4KY7A 1X9XA 3ND9A 2H4OA 2ASDA 5H1SE 2OF1A 4DV0L 3V6HA 4MEYA 2JE6I 4K0KL 1J97A 2ISOA 1TR5A 1VQ4A 2K8CB 2KUMA 2Q2UA 1AW7A 5C4XG 2L55A 4IJHA 5FLXL 4PHDA 4NXNQ 2ZXIA 3K8AA 5CV5A 2A6EC 2MUTA 3RF9A 5KFIA 4C56C 4AQYL 5I2XA 3IV6A 1NMFA 1QSYA 1O7IA 2B6GA 1BCPF 3EPGA 4CDFC 3L4PA 2P6UA 7ICNA 1B43A 2PZTA 2YV5A 4XIGS 3S1MB 1IYJB 4LFBL 1SE3A 1VQDA 2EAOA 3RFAA 3PR5B 1ZJNA 1I94L 5J0QA 5EOZA 4HMIA 3PO3G 4LZGA 3HP3A 3I70A 1Y1WB 4KLDA 1PH5A 4IFDJ 3DLLA 1PTOD 2HHWA 2XVTA 4B3SL 1QQ5A 1VQNA 3HP6A 1K73C 3T56B 4IUTA 1GUSA 4CKEA 3MR3A 1WTQA 3WOEA 4BY1G 4O0AA 1N5WA 2B2VC 4BXOA 3D3RA 4R66A 4CGZA 4LAAA 4NLGA 5E1FA 5KG0A 1MA7A 1SMYC 4OWTB 3I91A 3UMBA 2Q8IB 4YY3L 1Q81C 2CCZA 4B3TL 4JVZA 3UE1A 3LGJA 4QF4A 2L15A 2E2IH 2ODGA 4XTCS 1ASYA 4FVMA 3RJEA 1EY9A 1SL2A 3JPQA 4I2BA 1R4QB 4XYQA 4JW0A 4NPSA 5L9XA 4X65L 1KL9A 5J2BA 3M7DA 5TZVA 2I0QA 1TAUA 1NK4A 2X6LA 4R4TA 3GV8B 4C3HH 4J9LA 3RZOB 3UXOA 4A3DH 3OTQA 1A8VA 3F1ZA 1BPXA 2O5JC 2NRZA 4BGDA 3SGIA 1QVCA 4YR3A 4TKOB 2MPMA 3CNHA 2M0NA 4G57A 1S0OA 3K5MA 4Y2SA 2C22A 2Y0SG 4MFCA 2K14A 4KLKA 4DUYQ 5D49A 3NVWA 2VZAA 1S0MA 2B2TC 4DEZA 2F0UA 2BOSA 2W04A 4J9QA 1PH1A 4KJOA 1V8QA 4CF4A 3NTUA 4F72A 1DXSA 1ZD3A 1JWSD 3AEVA 4XT1B 4RZRA 4IFDH 1O7YA 4I29A 3RJHA 4I2JA 3Q8KA 1SYBA 1SV0A 2MGSA 1LTAD 1AEXA 2HHUA 2JR5A 2D0PA 2JJQA 2R92H 3S16H 2B0CA 4KLTA 3J81j 3KDFA 4NMZA 1SFOB 3CC2A 4J9MA 4R8UB 3IN5A 3N4MB 2NRWA 2JA8G 3HOVB 4UASA 4JYAQ 4GKKL 4A3EB 4OEMB 1B70B 5KFQA 3RN2A 5C44H 3IRBA 4HIMA 3T1YL 2UVWA 5AKKA 5C5JA 1Y69U 1X3FA 5EKLA 4BBSH 2SDFA 1RTOA 3KLWA 5DDMA 4F4ZA 1WJJA 1DOMA 1YZ7A 1TWHB 3CCRA 1K8MA 3GTJB 2KCNA 3LX0A 1COKA 4WRDA 5AJ3L 4A3GG 3L7ZC 3IRUA 2QA4A 5ELCA 2WHEA 2JN4A 2DBYA 4UAZA 2JH1A 5IIKA 3BJYA 8ICFA 1P8LA 2FINB 2NZ1D 4BA1I 4KMUA 5KFCA 2A69D 4OO1G 3MGHA 4DQRA 2JA9A 4F5NA 3KF6A 1JCKB 3KF8B 2DFLA 2PI5A 1KKXA 5DEHA 3KJOA 2DUYA 4B3ML 4JI7Q 5J8YC 4F4XA 1BF4A 2EANA 3D6WA 1MQ3A 3E5SA 4JCVE 1VQ7A 5AM0A 1PK3A 3TZUA 4DSJA 2OXPA 2Z4HA 4J8QA 4DUZL 3WK4A 5L1JA 4M9LA 1S8OA 3TAPA 2ID0A 5CA7A 3L3OC 2I1QA 3SYZA 1FO4A 3KJPA 4L6TB 1M6YA 1BQQT 4EEYA 2EQSA 5ALUA 1PVQA 4JI0Q 3SEIA 1HNWQ 1JXLA 3M9BA 5ALTA 2CVRA 3KLSA 5FO9B 4UAUA 2ZJ5A 4TURA 1BCPB 2EY2A 1EOTA 3R93A 1XPUA 1QVGA 3NTKA 3FKIB 1D1KA 3UDFA 2PMZE 2XY5A 2B8GA 4ED0A 3KOOA 3GFKB 5KFFA 1PFSA 3Q8QB 3NWTA 4Y2PA 1EZ8A 4FBTA 5LMUQ 4O3QA 9ICUA 4JI8Q 1PH9A 3KYHC 4F88A 1VMCA 4XQJA 2KTQA 4DV2Q 1PH3A 4HCEA 2N1RA 1F9QA 3RLOA 4FZNA 4DR5L 3FKIG 3FAHA 4IURA 2EIFA 2UUBL 1EIHA 4YWLA 2UXBQ 4M9JA 4DLEA 1HNXL 2F8KA 3BS7A 1F77A 4KTQA 1SXDA 1STNA 4CF5A 4AH6A 3M3YB 3T5JA 2BGWA 5C44B 4ABNA 2IMWP 1YHAA 5M5XH 4A3MB 2B63G 5DG8A 1ZQDA 4DR4Q 5J0TA 5ELOA 2ALYB 3RTVA 2CWPA 2GVBA 2NUCA 2V4DA 3CCUA 2FMQA 3JAME 1F9PA 3RB3A 1E1TA 9ICIA 1RD9D 3UDGA 3S16B 2R92B 1JALA 4YVZA 1HZAA 2RCNA 4PL2A 4GNXC 2F44A 3VR5A 2OTJA 2B2VA 3SDZA 8ICBA 8ICTA 1SMYD 2EY6A 2J7ZA 4ZQ3A 4H0LC 1SJED 2IX0A 3GDXA 1MJCA 2HQEA 1F2LA 1IBML 1ECWA 1W6JA 3Q24A 2LXKA 4I2DA 4RNOA 2B2UA 2LKVA 4M8AA 3I55A 4DR3Q 1UPHA 3BYYB 1SZPA 1TWHH 3GTJH 1FD7D 5EJWA 4IZ8A 3RBDA 2WKDA 4UP7A 3S1NB 3CU7A 4Q44A 1DYQA 1UE7A 2A1JA 2YTVA 3HKZG 5FKAC 1R9TH 5J0PA 4FF3A 4FF4A 1XYIA 1DGSA 3HKZC 4IOAA 4O3OA 5DLFA 3MABA 2EYHA 2A19A 1UWVA 1EYAA 1J8IA 2WFWA 9ICWA 3H0LB 2O4XA 3NSWA 5ELFA 1ZQGA 2NVXH 4B9TA 4N8FA 5L1IA 2ISPA 4NV0A 3ITPA 1ZQUA 4DSLA 1EQTA 3ZDEA 1WCMH 3NRWA 4I7ZC 4A93H 3M4YA 4X3SA 3QO2A 2F4VL 2RQ5A 2ZIVB 4J9NA 4U7CA 1KDBA 3I90A 3RR8A 4P4OA 4CDCC 1EFID 3RMHA 1IBLQ 5DGAA 1EYDA 2FMCA 4I2CA 2K5NA 4GXJA 4KLGA 1X6OA 4UB4A 5FK9C 2JA5B 1NJXA 4K4IA 4JOIA 5KFPA 1EY7A 4K8JA 1AZPA 4B08A 3HOWB 4NLZA 3F2DA 3EFXD 4QZDA 1PK1A 2JEGA 4BXXH 3ETLA 3UQ0A 1CI3M 1EY4A 3U26A 9ICJA 1L5UA 4KN4A 2AMCB 1HTPA 1LYLA 1BXTA 2BCSA 4R63A 1WTRA 3DUZA 4YCXA 1NCVA 3BS5A 5AKEA 2VANA 4X3UA 4F91B 4CJ1B 3IAYA 5G5HA 1CA5A 5DLGA 3GTPB 3S9WA 1XTDA 1QNKA 2W9MA 3WU2U 1D8BA 4JC0A 4X62Q 1YBYA 2JA7H 2K4HA 3CMEA 4OL7A 1N34Q 1K8GA 4IUNA 2WAQE 4C80A 2YTXA 1ZD4A 2ZXPA 4BA2I 1A6XA 3GTOB 2GH1A 3FC4A 1HZCA 1WYGA 5HY6A 3VYTA 3ISDA 3QOJA 5BOMA 3MGVA 5AK6A 3BG3A 5C0XH 4LWCA 3K5LA 1HR0W 1IKMA 2E8OA 3KLRA 4DCCA 1NBWA 4P4PA 1LTGD 3O13A 1IKLA 2K7VA 4P71A 3KDFB 4EBDA 5AHXA 4ECXA 4Q0FA 3L9AX 3SK6A 1VQAA 4JI5L 1U4PA 2BCQA 1Y1VH 3GV6A 2UVUA 3CC7A 3IG8A 2UVVA 1LM0A 2OHFA 2M9VA 3H8WA 3H0MB 1UUPA 3QU4A 2RBMA 4OONA 1KFDA 2J6TA 4R4QA 1KW4A 3AUOA 5C0XI 1V38A 4EX6A 3F8TA 1KXLA 2ZIXB 3OW7A 4QZEA 5JTIA 1T5EA 2GLEA 4EZ9A 3EROA 3MA2B 5KTQA 4IPGA 4TUPA 2OH2A 4G3IA 4ZCKA 1UE5A 4YR2A 4DV4Q 9ICTA 4FP5D 4EX7A 3RB6A 1X9MA 3KF8A 1QWYA 2MSNA 2L1BA 4A93G 2P6RA 3H3VI 2QILA 3SENA 4J9RA 4M6WA 4YD1A 3CP8A 9ICQA 5KFDA 2A69C 1OTCA 2XI9A 2KJ8A 4DK1A 1X3GA 4DV7L 1XMOL 1CHPD 3PV8A 3BZCA 5AM2A 5KT7A 1TK5A 2GN5A 1FJGQ 2W9CA 1ED1A 4ODGA 1J2MA 2BHNA 4YHHQ 5IYDG 4JWMA 4A3FH 5KG7A 8ICMA 2NWGA 3GV5B 1JOQA 3A5ZB 4DU9A 4JWNA 3D4DA 3QX7A 5IINA 8ICQA 5C6AA 1WTXA 1EQQA 5J0SA 1VQKA 4UARA 5T14A 4A3JG 1RODA 4I2AA 2R3ZA 4GN5A 2K01A 4PMBA 1L7OA 3G6VA 1U0LA 3NVZA 3BDPA 3M9NB 1PTOH 1XXGA 5J22A 1VS0A 1Q3LA 3Q8DA 1L1OC 4A3GB 3AM9A 4HEDA 8ICKA 4DNTB 5ALJA 4EELA 1CFMA 7ICEA 4LVSA 5DQIA 4DV5L 2M2LA 4JBMA 8ICUA 2B63H 4QQBX 4IJLA 1SKSA 4RNMA 2FPKA 4ED7A 1GD7A 1XMQL 1FNUA 1WCMB 5GTIU 4DSIA 2AXTU 2NYZD 3Q0AA 1U45A 2HVHA 4ECYA 1T8EA 2B2WA 2XY7A 1X54A 2BDPA 2VB2X 2VS1A 4DV3Q 1SNQA 2DNEA 4JG2A 4NM2A 3ALRA 1MBYA 5IYBH 3RZDH 1S72A 3QWNA 1B2TA 4ED8A 2AWNA 4KLQA 1VJ5A 4C2MB 2QARB 5GTHU 1VF7A 3K7AH 2HDLA 5KG1A 1VCIA 1B9MA 2N3SA 1BVSA 4Y2TA 1QQ6A 3V05A 3CKIB 1ZD2P 2VUMB 2RRDA 2ZG6A 1AQ6A 2QB0B 5H2FU 4BWJA 2K03A 2PZWA 2PXIA 1WG8A 1SBBB 3QU5A 1Y1VB 4FXDA 1O7LA 3RJIA 3KUPA 1RHPA 1RTNA 3T1HL 4ZOHC 4DV1Q 4OX9L 2WF8A 4Z6EA 1Z1VA 2EAMA 5ALVA 5J2DA 5IIMA 4QB4A 3ZDBA 3J80E 4RQNA 1M90C 2JP1A 1RL2A 3I76A 1S5BD 2L5YA 4DR7L 1HA6A 3IHQB 5BR8Q 5IP7H 1MGSA 3VA7A 4YR0A 5ALRA 2JYOA 1QZHA 3LWLA 3GTOH 1ESFA 4YWKA 4KN7C 4UB6U 3DWPA 1CRXA 1XX8A 2XTIA 2H3ZA 5ISRA 2FDRA 1PMRA 4MF8A 2YX8A 5KFGA 2YU9B 2JA6H 3NXWA 4CE6A 3GIMA 4WFN3 2QF7A 3NELA 4IPDA 2NVXB 8ICPA 1H9KA 2K5VA 4ULLA 1LVHA 3NVVA 4N8X1 2KSOA 2C5CA 2W3RA 4DAMA 5M3MB 4DL5A 4JV5L 5BN4A 1S5LU 4LFCQ 2HHQA 2A1JB 3H91A 4CKBA 2LFNA 2BCUA 2HBLA 3BVZA 3E3XA 3J81E 3KBBA 3VCBA 3IM1A 8ICJA 2J0TD 2N78A 3V72A 2X6GA 4JI1L 1GM5A 3I4MG 3NWSA 3GD7A 1OW5A 5EKKA 5TSSA 3V96A 3BJUA 2KOBA 2VQFL 4Y7NH 5M3FH 1YITA 1P16A 7ICQA 1ZXTA 3LWMA 4GN3B 1AZQA 2BPCA 1TY0A 1ZOLA 2DY7A 2Q2TA 1BPDA 2KQ3A 2F1HA 1TVAA 4L5QA 3I3CA 4PJ0U 1IL8A 1CKMA 1X3PA 1HFGA 3K5OA 4C3JH 1RKNA 2JXMB 2VNUD 2A74C 3N7SC 8ICCA 4A3IB 2DKZA 5DGBA 4UQGA 1GOZA 2HHHQ 4R8UA 3QB3A 2VB3X 5B5EU 2ENBA 2LMRA 2K04A 3SK4A 2NRTA 5FOBB 1VQPA 1TT2A 1WD1A 1U5KA 1Z3EB 7ICJA 1TAMA 3LYSA 9ICLA 8ICIA 1HIWA 1JE5A 2BH8A 4M47A 2KCMA 3MXNA 1SROA 3X3NA 1KRPA 1K83B 3Q22A 3D31A 4FNFA 1D5ZC 3V2TA 1G6ZA 1G2SA 3RRGA 1R9TB 3B0YA 2ZIUB 3AYHB 4FS1A 1T5XD 3WDNA 3LDAA 1L8LA 2E8NA 4M0AA 1JX4A 1YJWA 2W3SA 2FJ2A 5EGTA 4ZKCB 3N7RC 3R3OA 4ME3A 3T13A 2PKEA 1MQ2A 2PQAB 3M4QA 4IUVA 5DM63 3K5NA 3K7UC 4IPHA 3UMCA 2B8FA 2ZIUA 1X9SA 1I4HA 2A5HA 3SV4A 2JA6G 2ICIA 1IM4A 1ZETA 4ED1A 2KJ9A 5KL1B 1AFPA 3HW8A 1C0AA 3DEOA 4DA2A 8ICWA 4J03A 3D2NA 5IWAL 5D46A 3MR5A 1VQ8A 2GVAA 1VQ6A 1NI3A 4OXPA 4KLJA 1A62A 5ELDA 4QWAA 3E0FA 1I3QB 2KE7A 5CGKA 1XPOA 2HDOA 4FXGC 5FO7B 2H5XA 3L0OA 2A68C 4NB3A 1X42A 1KLNA 3OMGA 1PVRA 5KGUA 4LF8L 3KKAA 3H4DA 1PRTF 5J3BA 2FHTA 1X3EA 1UEBA 2HW3A 3M3YH 3TP7A 5M5WB 5L1MA 1BNPA 2YN4A 3OW2A 4DFDA 1AN8A 3C1EA 1DK3A 5E4WC 4MTKA 4I2FA 5BOLA 4R65A 5CV7A 5M3FG 4FXKC 1J5EQ 2WV6D 2MNAA 4A3LH 4R9WA 2HVIA 1E0BA 4OJPA 1LACA 3NK9A 2AJQA 1A3TA 4PGYA 1KBUA 4YXJA 2Q2IA 1K3BC 4RPYA 1I4PA 5FJ8H 2LYAA 2AQ3B 1BCPD 2EY5A 3TSSA 1ZQ1C 5IIJA 4F4KA 2VA3A 2E2DC 2K5WA 4FO2A 4WJ4A 1NNLA 2EE1A 4JMUA 1FNVA 5GQOA 5D3IB 3E2EA 2NTSA 4YWMA 1CKNA 4ELTA 2AUKA 4P75A 2JA7G 4XRHA 3K0YA 1A2UA 5IGGA 1BBWA 3FPPA 4JI6L 3JC66 2W03A 1XNQL 2R92G 3D2SA 4QWDA 2PW5A 5AM3A 3KZIU 1N48A 3VR2A 4YD2A 1VQ9A 5J8YA 3FHWA 4DR6Q 5FO8B 4UB5A 2R8HA 5JJZA 5KFOA 1NR4A 3MAQA 2UUAQ 1TV9A 4A3EH 3HRZC 2EJGC 1WI5A 1EL0A 3ZD9A 1JN3A 4LF5L 1WWUA 8ICHA 5AI5A 3MBYA 2NB0A 3TQYA 1W6KA 3BDCA 4A3JH 4RFBA 2ES2A 3F2UA 3S15B 1BNOA 2LBOA 5HNKA 5GAGC 2ZM6L 2BR0A 3FRPB 2ESEA 1HNZQ 4TUSA 1MKHA 2EOTA 5CMDA 1C48A 1NOMA 5KFTA 4JI2L 4Z9CB 1SYCA 2R93B 1PH6A 3BVMA 2EYOA 3FEWX 5GAHC 3ULLA 3S14H 4PZ8A 3N28A 1IBKQ 4UY8C 3G71A 3NGDA 1QSLA 2HHSA 5KL8B 1ZQHA 4QIWE 3MR2A 5C5MA 4FZLA 5KFYA 2Y9UA 1AROP 4DLGA 5EPJA 5KG6A 3AMUA 5AKIA 3A55A 1ZYQA 1IIPA 4J6HA 3J81i 2F2AB 3BS5B 3DDHA 3RZOH 3K7AB 4QWCA 5IGCA 4FF2A 1SL1A 2AGOA 1TKDA 1XNRQ 1S0VA 1EOVA 1Z9FA 1IG6A 3C46A 1PYBA 3I4NG 3J81c 4V190 2F0LA 3GILA 2FXQA 1WCNA 1G8ZD 5DAUA 5GROA 1L7MA 4DFKA 3PQIA 3HOVG 5HMMA 1QSSA 2QKQA 2KEYA 1B22A 1Y8PB 3NEMA 3PV0A 3PIPA 3ISBA 2KCCA 4YN4A 3UXPA 2K4IA 2NZOA 5IT9E 4RHSA 3T53B 4LNQA 4GC7A 3V7LA 2F0PA 1RCVD 2O2LD 2R7ZG 2KP7A 5IILA 4DK0A 4RCOA 1N61A 2OXOA 2M00A 3UXNA 1F2ZA 4F7XA 3F5AA 3EA6A 3BQ1A 3IFDA 5I9OA 4ZUJA 4K8IA 5KFBA 2QDBA 3S2DH 3J7AV 1SKRA 1ZQSA 1JI7A 3D4RA 4B9SA 3QUCA 1UAPA 3L5KA 3RH5A 3OSOA 1UHUA 5ELEA 5CV9A 1A3UA 4IN3A 4AYBG 2YMLA 1F2MA 4H13C 3HOWH 1BR9A 5AKJA 3QEAZ 2RF4A 3CHBD 2XWBB 3SMVA 4ME5A 2PW7A 2R6GA 1M8AA 4P73A 5IODA 2TMPA 2E2IB 1ICFB 1V85A 2W8KA 2XRSD 4DF8A 2DPIA 9ICNA 1SR3A 4MN3A 3ER0A 2GOLA 8ICNA 1CM9A 3PF5A 2XY6A 4XT3B 4K2LA 1Z4NA 4K6LA 4IOCA 2BQ3A 1EIYB 3CAMA 3RLFA 3NE5B 2L0CA 1X55A 2K5QA 2KHJA 4UB1A 3K1RB 5CORA 2IOFK 3HOUH 1NUCA 5D4BA 2FLNA 4UATA 1GUNA 1S5CD 4ED2A 1HUNA 2HHXA 4CGYB 4MZ9A 1PFBA 3MXPA 3MTSA 4CKCA 1NKCA 4CDDC 4DQQA 1PZID 1DXMA 2WAQB 2BE5C 1N32L 1PRTC 2D62A 2F0WA 2LS01 2UUCQ 5ALMA 1YNJD 4E0DA 4GLVB 1JB7A 3S14B 1BPYA 4MTNA 5EPKA 2VQEQ 1KIXA 3IP4B 1GO3F 3PSTA 5AKGA 1TWFB 4YMMA 2N49A 4UPAA 3PR4A 3V7JA 4GOPB 3UDXA 2NRXA 3AQEA 3RJFA 3A54A 4UB8U 8ICXA 4QZCA 4X66Q 1L3SA 1DRGA 5KT5A 1SXTA 4DOAA 4L63B 5AKYA 4XA5A 4J1MA 4US8A 3OTOQ 3U4VA 1ZQZA 4A3JB 4Q43A 1VDZA 1AP0A 4F92B 5HHIA 3PIO3 3HOYH 1ILPA 1Y8OB 1TU2B 4H02A 4G7ZC 1CA6A 5LL6X 4RGMA 1JXEA 1L2FA 1QUQA 2A8VA 4A3IG 3QXGA 3GTLB 3KHHA 2KN7A 2VXWA 5AIAA 1K3RA 4KD3A 3UQ2A 4AIMA 2UVRA 4YG2A 4JBWA 4RQ5A 1EEFD 1JIHA 4XDXA 3ULPA 1Q12A 4L8JA 1CZWA 3MXNB 2J6SA 4DFMA 2ZIWA 1KQSA 4Y52H 3SAFA 4P0QA 5J0WA 4A3FG 3PW5A 4EVOA 2F3IA 4DOCA 5EPLA 4QGUA 5CEHA 3J7ZC 4IALA 3A0BU 1VQHA 4A75A 2FMSA 3GTQH 2M9NA 1EY6A 4DR1Q 1X9WA 3TARA 2IHNA 1SNMA 5K36G 2KIWA 1TS5A 4GOPC 5G5GA 4PMWA 2KHVA 3SQIA 1YT3A 2EPBA 5JU5A 3A0JA 3T16A 5HGQA 2GA4B 3HOXH 1TWCB 3NHHA 2KENA 1HCZA 1TWAB 2L11A 3NVYA 3D8GA 3RR5A 4OD0A 5M5WH 2VUMG 3GTMB 4B6JA 4ECSA 4EQOA 1B3AA 4OJ5A 2XGQA 2KKPA 3MC1A 4TQSA 4DKAC 4H44C 3GTGB 2H3IA 5J2CA 2SOBA 2AQ1B 4KX3A 5AKLA 4QZ9A 1ET6A 1B3QA 1CSQA 2JH7A 3H0GB 1KLUD 4LUZA 5C0XG 4KMUC 3K59A 4CNQA 1X6IA 4OWWB 2PI2E 5M5YB 2YU9H 5KFKA 3HKSA 4MF2A 1YHQA 1BPZA 1OXVA 2Q2HA 1I3QH 3PX4A 3GV7B 4P0QB 4HJ8A 9ICXA 1ZQRA 1NNXA 1XO1A 3ONAB 2Z6BA 4A3DG 4ZLTF 2EVBA 3VR3A 5IGBA 5LMNQ 3OWFA 1FFVA 5ALZA 4ECTA 4IUUA 1E2WA 3PO5A 3NRZA 3TANA 2EZZA 1EY0A 1WUDA 1L7NA 4I2IA 4YMOA 5IP9H 3K57A 1PA6A 4QJFB 1UT8A 2EJMA 5J29A 4I65A 8ICSA 4NXZA 4R8IA 4BXXG 3TRZA 1F9RA 4DN4M 1NJIC 4BBSB 2R8JA 2CFMA 5KRUA 4A3LG 1LT5D 4P74A 1L6NA 9ICVA 4DK3C 1O03A 9ICCA 1PDQA 5ALOA 1YIJA 3RJGA 5L1LA 3HKZE 4RQMA 2UXDL 4LUOA 4NXML 5KG4A 9ICEA 1MIUA 1NAPA 1OXSC 3PUVA 4NLBA 3PMNA 2B2TA 1U9RA 3QYPA 4LF9Q 1IBLL 3K6OA 3TAQA 4G7OC 2JGAA 1HR0Q 2EAPA 4PZ6A 2E8GA 3TN2A 1U4BA 1YJNA 1PHJA 4NWIA 4IFDI 2JA8H 3EW9A 3GDEA 4PHPA 3Q8PB 1ICWA 2I5HA 4KY6A 1PXUA 5DM73 3KHGA 3J80i 2AU0A 2F0FA 4DUYL 1GVPA 2AKWB 9ICGA 2RDIA 1EQRA 2B63B 5DBAA 3S24A 1CHQD 4AP9A 2ZTEA 4US9A 2C35B 3Q8SB 3S6JA 4PG3A 1Q1EA 3OOCA 4DV6Q 3SAHA 3C3LA 4QW8A 2ZUCA 3PMFA 5C4XH 2F03A 3H0GH 1Q86C 1KDHA 1SWVA 4I2HA 1NTGA 2IT1A 2Z6KC 3A8IE 3GTGH 3BDOA 3CW2C 2KZ3A 2DPJA 3ZDDA 1ENCA 7ICHA 2K50A 2R61A 3PIP3 5C4HA 1A3VA 5A2QE 5C3EH 4IS7A 2MUYA 3C2LA 2KV2A 2W9BB 3G48A 1Y88A 4EQNA 3IL8A 2F76X 2F0VA 4BS9A 3C29A 1H9RA 1SIJA 4LF6L 2NYVA 4G4KA 4P0PA 3PW0A 3OJSA 1H9MA 4IRKA 1V1PB 2MUTB 4F2RA 5IYBG 2E2JB 2SEBD 3MR6A 1KFTA 4YCWA 5BN5A 4YP3A 4A3KG 1HUMA 1J2NA 5C4XB 5KT4A 2VIXA 2Y1IA 2J4XA 9ICPA 1YVCA 3RRHA 2B39A 1FGBD 3C2MA 4OELB 1OXXK 2PMZF 1VQLA 1F0MA 1HFNA 2H1EA 4OO1I 2UXCQ 5JJKA 4DXGA 3K4GA 5J0OA 4LF7L 1ASZA 3PO3B 3P7JA 2CH4A 1QCKA 2JA5G 5C3WA 3KD3A 1NSNS 1A0PA 1LTLA 2LMCB 4KKUA 4A3KB 5BPCA 1EY5A 1HZ9A 3AFQA 5EBDA 3GTLH 2SNMA 2I46A 2LI6A 1VQCA 2Z6KA 3BYTB 3QR8A 1ZRNA 4TSSA 3D6CA 1PFMA 3W3AA 2F0MA 3J80c 2XCAA 2XRQD 2PMZC 5JJIA 1LO5D 1JJ2A 4DPGA 3I4MH 4JK1A 4EEKA 2I5LX 2Z9HA 3M7NA 2KECA 3ERSX 2NN6H 4UHVA 1HNWL 3OIPA 4JI3L 3PGZA 4DR2L 3RR7A 2Z4IA 2BKEA 1EYCA 1HRJA 1JWUD 2VA2A 9ICKA 2JZBA 3L3FX 3PY8A 2WB1F 2D8CA 1F2YA 2NZHA 4P72A 2KFNA 2JXJA 1KHIA 1CZGA 4C3HG 2UU9Q 3ZYYX 1L3UA 1CSPA 1EEID 3MDAA 1XTCD 4DFJA 1V97A 1VMPA 4N9PA 2WINB 3I8ZA 2XN9C 2G5HB 1PLFA 1VF5C 4IPCA 4KLSA 1CUKA 4KHPL 5CB1A 2CH4W 1IV8A 2F0IA 1XSLA 2UUBQ 4IQVA 4KITB 3G6XA 1L1OA 4A3MG 5CBAE 1I4XA 2KEEA 4QMGA 2WB1C 2WF5A 3NBHA 3H0RB 1K1SA 4DV0Q 5KYIA 1L0YB 3DEPA 5TISU 3STBD 4ZH4A 4OIJA 3MDCA 5KFXA 2A6ED 3T5KA 5HR6A 4LF4Q 4KLUA 1GO3E 9ICBA 1H95A 5ALHA 4DFPA 3C2PA 4KI0A 4FS2A 1XO0A 2ASJA 5IE8A 4ECVA 4K4HA 3RJKA 3AMZA 3CP0A 2H3QA 4UB2A 3HPOA 4AQYQ 2VJ5A 1A6SA 1QZGA 1U4RA 1S77D 3BQ2A 1JUDA 4KD4A 5HURA 2VKQA 2EYMA 2IW3A 4XYOA 4JI4L 3C5FA 4C7ZA 2PNHA 5AKZA 3I4LA 4LFBQ 2NVQB 1EUJA 5F2DA 5JOBA 3C2KA 4LJXA 3TDQA 3PO2B 1L7PA 2KG5A 3EUB2 4KY5A 4A3BH 5JUMA 2YMQA 2TSSA 1G2TA 1OUQA 3OJUA 4BX9C 3K0XA 3GTQB 3EZ5A 4U6PA 1ZKOA 1QE6A 3KHLA 3NQTA 9ICHA 4IRCA 4ELUA 4DK6C 5KFVA 4NP5A 3TFSA 3BQ0A 3NBIA 2E5LL 4PGQA 1ZQAA 4NKLA 3HKZB 4I27A 3I72A 2VY3A 3T4AC 2QARA 2YY6A 5CJ7A 2PMZB 1KAAA 4LFAL 3ZD8A 4BY7G 2LKYA 1DJRD 3MGIA 4QZBA 3EQLC 1E2ZA 1B1ZA 1F9SA 1NR2A 4AYBE 4KN7A 5CV4A 2A6HC 2JEBI 4PV1C 3WK9A 3SVMA 2ATWA 4K5VA 4KLMA 5F9LA 2IPKD 2RDGA 1GJXA 2KVCA 3C1FA 4QUCA 4QIWB 2F4VQ 2JV3A 2JEFA 3H8JA 3WKAA 2F0DA 3K58A 1MJEA 1PFNA 2D9UA 3QEBZ 5IGDA 3AN1A 1RYSA 1ZXIA 1KRTA 4G7HC 3PMLA 3PW4A 1OXJA 1WCMG 5ALSA 4B9NA 2F0TA 3QIAA 2QKIC 2G07A 1CQFA 2KJXA 5D14A 3G4SA 3JPNA 1D2BA 1RDFA 5ALIA 1BO0A 2L5TA 2K8AA 5A35A 1O7ZA 3TREA 4XQQA 1K0SA 2YMPA 2HOFA 3A74A 3DM3A 2ZIVA 8ICYA 4YXMA 2BZFA 1II3A 1KFSA 1JOKA 1EU3A 4DFAA 5KNDA 3QJYA 3LWUA 4X62L 2JEIA 1JB3A 1V1QA 3S15H 4CJ2C 2XGTA 4KJNA 2HBJA 1QLNA 1QILA 2WIIB 3NUQA 2FMMA 3EPIA 2FPLA 2I5MX 3E9IA 2FE9A 4UB3A 3TS2A 4JYAL 4DF4A 4GKKQ 4F87A 4O5KA 4A3CG 4O5CA 3H15A 1Y1VG 3SK5A 1MD2D 1NK8A 3AFPA 1SSOA 2R18A 3T1YQ 4UAVA 1U9LA 1ZQBA 3GIIA 2CQAA 4M9NA 4Y2XA 4PHEA 4JI5Q 1B9NA 3TADC 2ALZA 5JVH3 4LMQD 2W9BA 3ZI4A 4B9VA 4ECWA 1RM6C 2G0AA 4Z6DA 4ACOA 3PX6A 3QNMA 2DUDA 4GLXA 3R9KA 2XWJB 5EQ0A 4NXNL 3HG9A 3A7LA 5J2FA 4Q5VA 4B3MQ 4JI7L 2QGQA 2DNCA 1FVIA 5ALDA 4RPZA 8ICEA 3OHXC 1XPRA 1EFWA 3F5EA 1L3VA 2XVSA 5DB9A 2EDGA 2K1BA 1BPEA 4PH5A 3VYSA 1A15A 1PK1B 4DNIA 3FKIH 5COYA 5LMNW 1P7DA 1KRSA 3MVVA 3M8RA 3T3FA 1SDFA 4MHEA 4Q8FA 3MFIA 2CWAA 1FL0A 1JMSA 4HAEA 4DV7Q 2OEHA 4B3SQ 4CCHA 4NJ8A 3GU3A 3AU7A 2MQHA 1K8AC 1RQNA 3BZDB 5AKHA 3MZ5A 4EX5A 4UDUC 1C9OA 4DAYB 5JEAG 3CCVA 1SWWA 5CWRA 1PZJD 1S5FD 2KA7A 4HCSA 5C0XJ 3ZDAA 4F93B 2F0SA 3LVVA 5M9OA 1TFRA 4QZHA 4POFA 4YY3Q 3CF5A 4B3TQ 2Y9TA 4AYBC 3AU2A 4MHVA 4UP9A 3U58A 1D8LA 1EY8A 3ICEA 4RGTA 1LLRD 5LMUL 1DONA 2IA6A 4C0ZA 2EXDA 5AK3A 4DV2L 3SEBA 2IOFA 4DR5Q 4IQUA 2MU2A 2W54A 4BDPA 8ICLA 5F3XB 1YZ6A 4KMOB 4X65Q 2UXBL 1HNXQ 4QZFA 1C20A 2E8PA 2DWQA 2L4NA 4MIUA 1A0IA 5AM4A 1AE3A 4QJFA 3F2BA 3CCMA 1D8YA 4NL9C 2XNAC 4F4WA 2PNRC 4O3NA 4EZ6A 4O42A 1ZEQX 3PSFA 3M6KA 1OO9B 2R93H 2NVQH 2IHFA 2EYPA 1K83H 3PUWA 3H0GG 5M3MH 2N8NA 4I2GA 1E1OA 5IYDH 2ZT9C 4RKBA 3KZXA 7ICIA 2F3WA 2QCPX 4JK1C 3CRKC 1HEKA 3BZKA 4QZIA 2K5HA 3HOUB 5AI8A 1D6EC 3H6MA 2A3VA 1O78A 1SZHA 5AM5A 5EE1A 1ZQJA 4YIJA 3BDLA 3NS1A 3VA5A 1WFQA 2LPEA 2XGPA 3H3VH 4KHVA 7ICFA 1ONLA 5ALFA 4A76A 2DQNB 2X69A 2PPBC 5A2QL 2HHVA 5KT2A 2PQAA 2KK0A 2HIXA 4DNRB 5ALLA 2LXJA 3SXHA 1W2BA 4Y7NB 5M3FB 3M4PA 2ES6A 2PCFB 3Q8RB 2BPFA 1B8AA 3N52A 5AI6A 5FLMG 5FLXc 2EXZA 3KK7A 4AYBB 4DF7A 5BR8L 1SV4A 1U47A 3HJEA 4X3TA 4C1NK 1FGUA 2IY5B 4B3RL 4C3HB 3WK8A 4R1JA 1PVOA 1DZ1A 2PZUA 2MAXA 3MFHA 5C4JH 2WF7A 3KBGA 5AJ3Q 1ZQQA 4RG1A 2F77X 3DMUA 3J7YW 1B50A 3VYRA 1BPBA 3C23A 5F9NA 4I7AA 4OGQC 4RQ6A 5FLMH 4JUZA 4RHRA 1TAQA 1YNXA 1DOLA 3WKEA 1TVXA 3TQ1A 3OWEB 3TS0A 2ZXHA 2PFPA 4J9SA 2DY8A 3I4MB 4QIWF 2RHQB 1J6QA 4HSPA 1KD1C 4DUZQ 4L5TA 4PL1A 3D0FA 1VQGA 2ZJAA 4X64L 1T3NA 7ICUA 4DL3A 4B9LA 3H8MA 2B2YC 2FPMA 2VQFQ 1D5XC 1K8OA 1L8OA 2F1IA 1C4QA 4LZDA 4EQ5A 2E74C 3FPUB 1STEA 1Y1WH 3RH4A 3NENA 4JI0L 4QIWC 4FYDA 2R7ZH 4A3GH 3DWAA 4DWIA 2HHHL 3RBEA 3S1RH 5JRTA 3MHBA 3UM9A 3QUQA 2FLLA 1NKBA 2ZJQA 4GKJL 4O9MA 4F5RA 1N5XA 2EZYA 1UT5A 1Q7YC 5KFJA 4F8RA 1MI2A 3E9HA 1KNEA 2E2JH 3KTQA 3FP9A 5IOCA 1BGXT 4DOBA 5KFRA 3WKCA 5J2GA 2F8LA 4UAYA 1LV5A 4M9GA 4M04A 1B4FA 1BKBA 2FFKB 3R8BA 4J15A 4KK7A 5JEAJ 1KDCA 2AUJD 1PUZA 2AH5A 1W3SA 1NE3A 2F0KA 3G6EA 1N33Q 2BQRA 1EIFA 4I2EA 5AK5A 2HHTA 3I1YA 4DL2A 1S76D 2QLTA 3W1GA 1K5OA 1AE2A 1CKOA 1N2XA 3PUYA 4K0KQ 1NK5A 1JICA 4PQXA 2BCOA 3SZ2A 1TY2A 4IUPA 2EZXA 5IWAQ 4HJAA 4QWEA 1YI2A 1PTOB 3ZJYC 5KYLA 5KFMA 2W43A 1S10A 1T3QA 1ILQA 1TQOA 1YHBA 2NVYB 4DV4L 1VQBA 2ZJPA 1PH8A 5ALPA 2Q8RE 1ZQYA 1JOOA 5KG3A 1EWCA 2MJ8A 2FMPA 1IBMQ 3S17H 2RSNA 4O3RA 1I4RA 1Y1WG 2XICA 2L9HA 1I94Q 1YNND 4AYBF 5T1IA 3D6JA 3ZDCA 3PO4A 1SXEA 2PI4A 4F2SA 2XSCA 4GN4B 1MC8A 2WF6A 2F0NA 2HCIA 7ICVA 2PFNA 3P20A 5IGEA 2W55A 1IYUA 4F8MA 3EIVA 3SR6A 5D65A 2BDUA 3PX0A 1V43A 3U9OA 4FZMA 2OYYA 1F44A 3R2TA 4DSKA 1OXUA 1N36L 3JPSA 3PSIA 5AK4A 4RUAA 3TP6A 1SNDA 4IR1A 2ZXRA 1J9OA 2CKZB 2G5DA 4GOPA 2Q8TA 1WYDA 1LT4D 1ZJMA 2F0EA 2KHIA 3GTKB 1NKEA 2AQ0A 2WACA 4DAYA 3J80L 2DGZA 5ALQA 1KQQA 4J9KA 2K28A 1VQEA 4PNYA 3EJIA 2K4PA 2HOIA 4ED6A 3KOJA 3PO3H 1XC9A 1N9WA 2D0OA 2HSZA 4DV5Q
chains in the Genus database with same CATH topology
4OONA 1NY4A 1EYGA 1C7YA 4R4QA 4NXML 1IBLL 1MIUA 3PUVA 1OXSC 5C0XI 2QEXA 4HIOA 3F8TA 1KXLA 1Q1BA 3K81C 4LW1A 4IPGA 1N8RC 2UUAL 4BBSG 4LF9Q 3CQZH 5C44G 1XMQQ 2KCTA 3M4OH 2OTLA 1HR0Q 2K75A 4PZ6A 2E8GA 1K0RA 1UE5A 2K4KA 1YJNA 1PHJA 2UXCL 4DV4Q 2OCEA 2JA8H 1SN8A 3GDEA 5E7NA 3PO2H 2I5HA 3MEFA 2ZM6Q 1KAWA 4QL5A 3WWVA 3J80i 4DUYL 4A93G 1GVPA 2AKWB 3J7A5 1EQRA 1X65A 3H3VI 3KFUA 3S24A 1OTCA 2ZTEA 2C35B 3GTMH 1X3GA 4DV7L 4JI2Q 1XMOL 5IP7G 3BZCA 2GN5A 4PG3A 1Q1EA 4YCVA 4DV6Q 1FJGQ 4HJ9A 4YHHQ 4A3FH 1N36Q 5IYDG 5IYCH 4JBKA 5C4XH 3H0GH 3T1HQ 1Q86C 3A5ZB 4DV1L 4OWXB 1NTGA 2IT1A 4JI3Q 4OX9Q 2Z6KC 4HJ7A 1EQQA 3GTGH 1VQKA 3CW2C 3CCEA 2WB1E 1OXTA 3U4ZA 4A3JG 4GN5A 2K50A 4IO9A 4R4IA 3S1NH 1U0LA 3CXCA 5C3EH 1HH2P 2UU9L 3G48A 4A3EG 1VS0A 3Q8DA 1L1OC 4LF6L 4RMFA 2BA0A 4GNXA 5IYBG 3L2PA 4L5RC 1CKNB 3CD6A 2UXDQ 1HZBA 4DV5L 4JBMA 2E2HH 4YCWA 2B63H 3W1BA 2NVTH 3I4NH 1PYSB 4A3KG 4ALPA 4QQBX 4IJLA 1YVCA 1E24A 1GD7A 1XMQL 1OXXK 1VQ5A 1VQLA 1XJVA 2ZJRA 4OO1I 2A1AA 3CCSA 4BY7H 2UXCQ 5JJKA 4LF7L 3ULJA 3KF6B 1ASZA 2WB1G 2VS1A 1X54A 4DV3Q 4LF4L 1VQJA 4JG2A 2JA5G 3HOUG 3RZDH 5IYBH 1LTLA 1S72A 1G291 2AWNA 1HZ9A 3AFQA 4LUVA 3GTLH 2Z6KA 1I50H 1VQCA 1VQMA 3I4OA 3K7AH 3EN2A 2VUMH 2NN6I 3J80c 1VCIA 2N3SA 4JI4Q 1BVSA 2RHSB 4X6AH 3HOXG 5JJIA 4DV6L 1JJ2A 1FJGL 4DPGA 3I4MH 2I5LX 2OWOA 3EBEA 3M7NA 3T1HL 3ERSX 3JAMc 4JOIC 4DV1Q 1HNWL 4JI3L 2HIVA 3PGZA 4DR2L 4OX9L 3GTKH 3I56A 1M90C 1RL2A 4R4OA 2NZHA 2V1CC 4P72A 4DR7L 1D7QA 4MNOA 3VDYA 5BR8Q 1KHIA 3PCOB 4JI8L 5IP7H 4TVAB 3CPWA 4WJ3M 1JMCA 2UU9Q 2HQLA 2E5LQ 1CSPA 1QZHA 1NMGA 3GTOH 4C2MH 4YWKA 5M3MG 1X9NA 4LF6Q 4TQUS 1QVFA 4IPCA 5EAYA 4O2DA 1CUKA 3NBHB 4B3RQ 3B6YA 4KHPL 2XTIA 2YYZA 1M1KC 2MO0A 1B7YB 2UUBQ 2JA6H 1L1OA 1E7ZA 3GO5A 3I7FA 4HIDA 4A3MG 3NELA 4IPDA 1E3PA 3TEHB 2CQOA 1TWCH 2K5VA 4DR4L 4A3CH 3RLNA 4DAMA 4DV0Q 4JV5L 3STBD 1N32Q 2WAQG 2UUCL 4LFCQ 3GTPH 4LF7Q 4BY1H 4IFDI 2LSSA 4DV3L 3S1QH 1LUZA 2N78A 4JI1L 2VW9A 1Z47A 1GM5A 4LF4Q 2R93G 1GO3E 3CC4A 1H95A 3I4MG 1SMXA 3GD7A 4KI0A 3BJUA 5IE8A 4X66L 4APVA 4BBRH 4Y7NH 2VQFL 3CP0A 1P16A 4X64Q 5M3FH 1TWAH 4GN3B 4AQYQ 1YITA 1QZGA 1WOCA 2Q2TA 4A3BG 1TXYA 4JI4L 4LF8Q 3UE0A 1PH4A 4L5QA 2PNHA 1CKMA 4LFBQ 1EUJA 4C3JH 3AQQA 3OTOL 1SLJA 4DR3L 2JA5H 2VNUD 2HHHQ 2BA1A 2OQKA 1UE1A 3PUZA 3M85A 3PF4A 4A3BH 1VQPA 1U5KA 1IZ6A 5ELNA 1JE5A 2BH8A 3RN5A 4DR7Q 3U50C 3K0XA 3JAMi 4GKJQ 2KCMA 4HJ5A 1SROA 2R7FA 4DK6C 1SRUA 3D31A 2WP8J 2E5LL 1Q8KA 4KHZA 2F52A 3AYHB 2VY3A 5GAEC 1UE6A 2MFIA 1YJWA 4LFAL 5IY0A 2R7DA 1PV4A 4BY7G 4IFDG 4ME3A 2ZTCA 2PQAB 3M4QA 3K7UC 1EWIA 4IPHA 1I6HH 1TWFH 4AYBE 1N33L 4JI6Q 2JEBI 2ATWA 5JJLA 4GS3A 4DR1L 5H1SE 1C0AA 4DV0L 4JV5Q 1K9MC 5IWAL 2JE6I 2F4VQ 4K0KL 1RIPA 2AWOA 1VQ8A 2GVAA 1VQ4A 1VQ6A 4OXPA 1MJEA 2Q2UA 3HOWG 5C4XG 1A62A 4IJHA 4NXNQ 1KRTA 3K8AA 1XPOA 1WCMG 2H5XA 4AQYL 3L0OA 4LF5Q 4NB3A 1NMFA 2JQOA 1O7IA 3G4SA 2YV5A 4LF8L 4XIGS 1IYJB 4LFBL 5J3BA 1VQDA 3TREA 1L1OB 1X3EA 1UEBA 2VL6A 1HNZL 3M3YH 1I94L 5M5YH 2AHOB 1AH9A 3PO3G 3OW2A 1PH5A 4IFDJ 3DLLA 1N34L 2Y0SE 3A74A 5M3FG 3DM3A 1J5EQ 4A3LH 1IBKL 2MNAA 4B3SL 1VQNA 4X62L 1K73C 3S15H 1V1QA 2ASBA 5LMNL 1G6PA 2XGTA 1X56A 4O0AA 4BY1G 1JJGA 1S40A 2Q2IA 3E9IA 4JBJA 1QUQB 2I5MX 5FJ8H 2IX1A 3TS2A 1Q81C 4JYAL 4OWTB 4YY3L 2CCZA 4B3TL 4GKKQ 4A3CG 3H15A 1Y1VG 4WJ4A 3UE1A 3LGJA 2HT1A 5GQOA 3AFPA 2L15A 4YWMA 3T1YQ 1CKNA 2E2IH 2JA7G 4P75A 4XTCS 3HOZH 1ASYA 1BBWA 4JI6L 4JI5Q 3JC66 1L0WA 1XNQL 2R92G 4NPSA 5IP9G 3S1MH 4X65L 1KL9A 1JT8A 1VQ9A 3FHWA 2I0QA 4DR6Q 2DUDA 2UUAQ 4NXMQ 4R4TA 4C3HH 4GLXA 3CPFA 4A3EH 4A3DH 2MO1A 1A8VA 3F1ZA 4NXNL 1WI5A 2DGYA 3SGIA 4B3MQ 1QVCA 2QGQA 4JI7L 4LF5L 1FVIA 3TQYA 4A3JH 1XPRA 2Y0SG 1EFWA 2YTYA 3BU2A 2ES2A 2K14A 4KLKA 4DUYQ 2VZAA 2ZTDA 4DNIA 3FKIH 5GAGC 2ZM6L 5LMNW 1KRSA 1PH1A 1HNZQ 1JJCB 1MKHA 3S2HH 2PI2A 1XMOQ 4JI2L 2CWAA 3AEVA 1PH6A 1FL0A 4YHHL 5GAHC 4DV7Q 1Q46A 3ULLA 3S14H 1V9PA 4PZ8A 1IBKQ 4B3SQ 2IHEA 3G71A 1VQFA 4UY8C 2MQHA 1K8AC 4A3DG 4PZ7A 2D0PA 2JJQA 2R92H 3S16H 4QIWE 4EX5A 3PO2G 3J81j 1C9OA 3KDFA 4DAYB 5JEAG 3CCVA 5C0XJ 3CC2A 3STBC 2JA8G 3J81i 4JYAQ 4YY3Q 4B3TQ 3RZOH 4GKKL 3CF5A 4POFA 3U58A 4UP9A 1B70B 1D8LA 3RN2A 5C44H 3IRBA 4BBRG 4HIMA 5LMUL 3T1YL 1PH7A 1XNRQ 4BBSH 1X3FA 5FJ8G 1EOVA 1Z9FA 2EXDA 4DV2L 3KLWA 1PYBA 4FDBA 3I4NG 3J81c 1WJJA 2FXQA 1YZ7A 3CCJA 3CCRA 1YEZA 4DR5Q 1XNQQ 5GROA 5AJ3L 4A3GG 1YZ6A 3L7ZC 4X65Q 2QA4A 1SFOH 1HNXQ 2UXBL 3HOVG 3PIPA 1A0IA 3NEMA 1SE8A 3PV0A 4DR6L 1AE3A 4QJFA 5C3EG 1P8LA 3F2BA 4BA1I 3CCMA 4OO1G 4A3MH 2NZOA 2JA9A 3KF6A 3KF8B 3KJOA 3RNUA 4A3IH 2JA6G 4B3ML 4JI7Q 3F2CA 4LNQA 2R93H 1HJPA 2NVQH 4JCVE 1VQ7A 2IHFA 2VQEL 3PUWA 1K83H 2R7ZG 3H0GG 4DUZL 5M3MH 2N8NA 1E1OA 5IYDH 2ID0A 2B29A 1I5FA 4QY7A 1YJ9A 3BZKA 2K5HA 3K80C 4YCUA 3S2DH 3KJPA 2B3GA 2NVYH 1A63A 4AYBG 3HOWH 2EQSA 1GKHA 2RF4A 1WFQA 4JI0Q 4GLAC 1HNWQ 3M9BA 3H3VH 2R6GA 4A76A 4P73A 1VQIA 1XPUA 1QVGA 2PQAA 3UDFA 2HIXA 2PMZE 2LXJA 4DR2Q 1W2BA 1SR3A 3CMAA 3M4PA 1PFSA 3ER0A 1B8AA 3PF5A 1EIYB 4IOCA 5FLMG 3ICEA 3CAMA 5FLXc 3RLFA 3CCLA 5BR8L 1X55A 2KHJA 5LMUQ 1PH9A 4JI8Q 1XNRL 3KYHC 1PH3A 4DV2Q 3HOUH 1FGUA 2IY5B 4B3RL 4R4CA 4R1JA 3RLOA 5DLQE 4DR5L 1PVOA 5C4JH 3FKIG 2UUBL 2EIFA 5AJ3Q 4YWLA 2UXBQ 5IT9c 4MZ9A 4RG1A 1HNXL 4KHPQ 5GADC 4AH6A 1S3OA 5FLMH 4GNXB 1YNXA 2KBNA 1PH2A 3A5UA 1N32L 2D62A 3TS0A 1YHAA 4LFCL 5M5XH 2UUCQ 2B63G 4DR4Q 4GLVB 1JB7A 5ELOA 2ALYB 4JI1Q 1G51A 4L5SA 4MTNA 2RHQB 2CWPA 1J6QA 2GVBA 1KD1C 2VQEQ 4POGA 1KIXA 3CCUA 4DUZQ 2JEAI 1E1TA 4L5TA 3UDGA 4X64L 3D0FA 1BBUA 1TWGH 1VQGA 2N49A 4UPAA 4GOPB 3UDXA 1HZAA 2RCNA 4GNXC 1E22A 4X66Q 2VQFQ 2OTJA 3HOZG 3I2ZA 4EQ5A 3OTOQ 2IX0A 3U4VA 1Y1WH 1MJCA 3NENA 1IBML 4JI0L 3HOVH 2LXKA 3HOYH 3HOYG 2R7ZH 4A3GH 2K52A 3I55A 4DR3Q 4H02A 1TWHH 3GTJH 2HHHL 3S1RH 1L2FA 1QUQA 1IL2A 2A8VA 4UP7A 2ZJQA 4A3IG 4GKJL 4HIKA 1Q82C 1K3RA 2BH2A 1UE7A 4AIMA 1Q7YC 4JBWA 2YTVA 3E9HA 3HKZG 3ULPA 1R9TH 3FP9A 2E2JH 1Q12A 1DGSA 4IOAA 3MXNB 5IYCG 1KQSA 4Y52H 4A3FG 2A19A 1UWVA 3HFZB 1BKBA 4J15A 2WFWA 2F3IA 5JEAJ 4QGUA 2NVXH 3J7ZC 4LFAQ 1W3SA 1NE3A 3G6EA 1VQHA 1N33Q 3PUXA 1EIFA 4A75A 3UDIA 3GTQH 3W1GA 4DR1Q 1WCMH 1AE2A 1CKOA 4A93H 2NN6G 5K36G 4GOPC 3PUYA 2F4VL 4K0KQ 4PMWA 3A0JA 5HGQA 3E0EA 1IBLQ 3HOXH 4HJAA 5IWAQ 2K5NA 1X6OA 2KENA 1YI2A 4C3IH 4JOIA 3RR5A 3ZJYC 5M5WH