1Q46A

Crystal structure of the eif2 alpha subunit from saccharomyces cerevisia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords translation initiation factor 2 alpha subunit
publication title The crystal structure of the N-terminal region of the alpha subunit of translation initiation factor 2 (eIF2alpha) from Saccharomyces cerevisiae provides a view of the loop containing serine 51, the target of the eIF2alpha-specific kinases.
pubmed doi rcsb
molecule tags Translation
total genus 54
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1q46A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q46A01
1PYBA 1TXYA 4POFA 1JJGA 1ASYA 4LF9L 2JA5H 1Z47A 2NVQH 4HIDA 2JEBI 2NVYH 4BA2I 5BR8Q 4DUYQ 3PUWA 3NBHB 4JOIA 4DR7Q 1D8LA 4QQBX 1HNZQ 1O7IA 1K9MC 1VQIA 4IPCA 5EAYA 5M3FG 2JA8G 4TVAB 2PQAA 5J3BA 4DR5L 1SN8A 4A3IH 4C2MH 4DAYB 1VQGA 2NVXH 4NB3A 5H1SE 1CSPA 1VQMA 4JI4Q 3KJOA 1JMCA 2JEAI 1HZCA 3HOXG 1HR0L 3HFZB 2XGTA 1M1KC 4KHPL 4DR6L 2JA8H 3CAMA 2PI2E 2Y0SE 5IYBG 1VQ4A 2ASBA 1K83H 3Q8DA 3KF6A 3B6YA 1SLJA 4NPSA 4EX5A 1W3SA 1Q7YC 1IBKL 2PQAB 2AWOA 1YBYA 4JI7L 1UEBA 4AYBE 5GAEC 3HOXH 1Q1BA 1N36Q 3OTOL 1MIUA 3I55A 2CKZB 5IYBH 4A3MG 4JYAQ 4QIWE 4GNXA 4IFDG 1IBML 1U5KA 3MXNB 1HNXL 4DV0L 4R4CA 4DR2L 1U0LA 2F3IA 3KF6B 5JJLA 3ERSX 3NENA 3PV0A 3S1QH 4C3HH 5BR8L 4DUYL 4LW1A 1HR0W 1QVGA 4QJFA 5C0XI 4DR7L 3GDEA 3KYHC 4B3SQ 3W1BA 4A3MH 1HNZL 4JBMA 3BZKA 3J80i 3CCEA 1VQOA 1D7QA 4IPHA 4YCUA 2VY3A 4OWWB 1BBUA 3CD6A 1VQCA 1X55A 2MQHA 4GNXB 1KQSA 1W2BA 2CCZA 1TWAH 4B3RQ 4JI4L 4JI1Q 1PA6A 4LF4Q 4XTCS 2B29A 1QVFA 4A3JH 3F1ZA 5K36G 2BA1A 2K50A 1IXRA 4JCVE 3GD7A 2OWOA 4DR4Q 3I4OA 4NXMQ 4BY1G 2WFWA 2IX1A 4BBSG 5IWAQ 4L5SA 4GKJQ 1VQAA 1BKBA 1M90C 5C4XG 1TWCH 4A4IA 3CPWA 4DR1Q 2E2JH 3S1MH 5IYCG 2ZTEA 4YCWA 4LFAQ 2YV5A 3G71A 3M3YH 4JYAL 4YWMA 4IJHA 3J81i 3CF5A 2IX0A 3WWVA 1XJVA 3T1YQ 4DV4Q 2V1CC 4BY1H 4BBSH 4A3DG 5M3MH 1PFSA 3D0FA 1AE3A 3ER0A 3K80C 4DV7Q 1KIXA 2ZJRA 5IYCH 1Q81C 4JBJA 4B3SL 2JE6I 3RZOH 4GOPC 5FJ8G 1YHBA 1YEZA 3PSIA 4A3DH 4B3RL 5FLMH 1I50H 2NZHA 4HJ9A 3UE1A 1A63A 1H95A 4UP8A 4RMFA 4JI1L 1GKHA 3K81C 1VQJA 4LUOA 4JI8Q 1CKMA 2VS1A 1OXVA 2HQLA 3STBC 3PIPA 3KJPA 1YIJA 1YITA 2QGQA 4LF4L 4YHHQ 3I4NG 2IHEA 1TWGH 3ICEA 1DGSA 2B3GA 4DR3L 1CKNA 4DR4L 2OQ0A 3CCMA 4NXML 5IWAL 4ALPA 4GKJL 3JC66 2IY5B 3OYYA 1VQLA 3K7UC 1BBWA 4DR1L 2F4VQ 3M4PA 3I4NH 3PO2G 4LFAL 2VNUD 3FKIG 3T1YL 4DV4L 2AWNA 3M4OH 3NELA 3GTOH 4A3GG 4BBRH 1TWHH 2ZTCA 1N34Q 1CKNB 1SE8A 3T1HQ 1VQFA 3E0EA 4DV7L 1Q12A 4AQYL 2E2IH 1G51A 1EQQA 1MKHA 3PO2H 1UE5A 2FXQA 2ID0A 4OX9Q 3L0OA 5AJ3Q 3FKIH 3UDXA 2K14A 4GOPA 4QY7A 5LMNQ 2E2HH 2E5LQ 2QA4A 3TS2A 4A3GH 3CCJA 1N9WA 3I2ZA 2HHHQ 1XMOL 4QL5A 4JI8L 4JI2L 3F8TA 3L2PA 1QUQA 3PUVA 1GVPA 2NN6G 4YHHL 4C3JH 2N49A 3DLLA 3U58A 1IBMQ 1VQNA 2K5VA 3PCOB 3JAMc 3RLFA 3CCVA 3ULLA 3OW2A 2D0OA 2KENA 4DR2Q 4A3LG 1I5FA 1S3OA 2KCMA 3SGIA 4GOPB 1YHQA 1Y14B 3K0XA 4HIOA 1S40A 3KF8B 5GROA 2MFIA 1E1TA 2RHSB 4DNIA 1VS0A 5GAHC 4QGUA 1B7YB 1E3PA 3W1GA 1XMQQ 3S24A 4H02A 2UUBQ 1FGUA 1LUZA 2I5MX 2F4VL 3CC7A 4AH6A 1QUQB 1VQKA 1KXLA 2MNAA 3F2DA 1WCMG 3GTKH 4UPAA 1N34L 1V1QA 4P72A 3S1RH 1A8VA 3T1HL 4HJ5A 4LFCQ 1QVCA 3U4VA 4APVA 1Q82C 1HZBA 5M3FH 2CWPA 2YTVA 2HIXA 4X65Q 1UE1A 2E8GA 4PZ7A 5AJ3L 1K8GA 4OX9L 1WCMH 5C4JH 2E5LL 5LMNL 3TQYA 1PH1A 3TRZA 2HIVA 1IZ6A 1VQ9A 3CC2A 3CCSA 1VQBA 1HZAA 2HHHL 1EOVA 4GN4B 4IPDA 1Y1VG 1KRTA 2I5LX 1EIYB 4HJ7A 4BXXG 1XNQQ 1AE2A 4IJLA 2NVTH 4HIMA 5C3EG 2DUDA 1J5EQ 2YTYA 2R7ZG 3J7A5 2Q2IA 2GN5A 4L5TA 1Y1VH 4GLAC 4HIKA 1XMQL 3CCQA 3H3VI 4BXXH 2UUBL 1NTGA 2Q2HA 3E9IA 1GD7A 3F2CA 2A1AA 5C3EH 1SR3A 4OWTB 5LMNW 2R7ZH 2UXDQ 1VQ5A 2A19A 3S2DH 5GQOA 4LFCL 3BJUA 1I94Q 1NMFA 1L0WA 3M4QA 2NN6I 1V9PA 4GN5A 4X65L 1TWFH 4YCVA 1OTCA 3E9HA 3G6EA 3PF5A 1Y1WG 4DR3Q 4POGA 5HY6A 1XPRA 4OXPA 1V43A 3AFQA 3U4ZA 1PVOA 2CFMA 3EIVA 4LF5Q 4DAMA 4HJAA 1GO3E 2RF4A 1XNQL 3I4MG 1WI5A 2XTIA 1VQEA 2JQOA 3CQZH 1Y1WH 1J5EL 4BY7G 1YJWA 4MZ9A 1ASZA 3KDFA 3UDIA 3HOUG 1YI2A 5C4XH 1PH6A 1IYJB 2LXKA 3FHWA 3RNUA 2VUMG 1P16A 5IY0A 4AQYQ 4YWLA 4R4TA 1CSQA 2CQOA 2IHFA 1E1OA 4J15A 1KC8C 4BY7H 2Z0SA 2UXDL 1WYDA 3TEHB 1C0AA 1A62A 4WJ3M 2LXJA 3G4SA 2ZM6Q 4JBKA 4X64Q 3HOUH 4JI2Q 2VUMH 1HJPA 1UE7A 3KDFB 2OCEA 1EWIA 3RR5A 3CPFA 1I94L 3PIOA 2UUAQ 2CWAA 2F52A 4K0KQ 3RN2A 1KL9A 1FJGL 5FJ8H 2RHQB 4Y52H 1KAWA 1X3FA 2VQFQ 1JB7A 4OO1G 1LM0A 2BA0A 3ULPA 3CCLA 2R7FA 1R9TH 1WOCA 1YHAA 4OWXB 4LF5L 4DPGA 5IYDG 1Q86C 4A3BG 1VQ7A 3DM3A 4GLXA 3BZCA 3GTPH 1N8RC 3ULJA 2BH2A 4P74A 1VQDA 4DK3C 3NEMA 2L15A 2KBNA 5M5XH 5IP7G 2N8NA 3BU2A 1B70B 1X3GA 1YZ6A 4UP7A 5IYDH 1K3RA 4R1JA 1GM5A 4LFBQ 1KHIA 4A3BH 3LGJA 1G291 2OQKA 5IE8A 1QZHA 2ZJQA 2MO1A 3RLOA 4A93G 3RN5A 1OXSC 4B3TQ 3S14H 1RL2A 5IP7H 4JOIC 2N78A 1HH2P 4KLKA 4MTNA 1VQ6A 4GS3A 2ZM6L 1YVCA 4X64L 3HOZG 1OXTA 2B63G 2AMCB 3H3VH 1OXXK 1EIFA 3RLNA 2HT1A 1X56A 4JI5Q 3W5OA 2UUAL 4LF8Q 1E22A 3A0JA 4DV6Q 4K0KL 4P75A 4EQ5A 4A93H 3JAMi 1PV4A 1SROA 2VQFL 5ELOA 1VCIA 2R93G 1PH8A 3FP9A 2B63H 2ZJPA 2WB1E 2PNHA 2K75A 1L1OC 2C35B 2YYZA 1K73C 2ES2A 3AEVA 2JA5G 5GADC 4WJ4A 2MO0A 2VL6A 1XNRQ 2ZTDA 4A3LH 2JJQA 2KCTA 2LSSA 4O0AA 4X62Q 2R93H 3CW2C 4JI3Q 3RZDH 1RIPA 2NZOA 1I3QH 3HOWG 1JE5A 2WAQE 2KHJA 2VZAA 4LFBL 4R4OA 1PYSB 3S1NH 2QEXA 3S2HH 5JEAJ 1NJIC 4LF6Q 2Z6KC 4UY8C 2EIFA 4A3FG 1WJJA 1A0IA 2EXDA 1PH5A 4JV5Q 1N32Q 4B3TL 4R4QA 4OO1I 5DLQE 2UUCQ 1X65A 4JI0Q 3F2BA 3GTMH 1SFOH 1K8AC 3HOWH 3H0GG 3CCUA 1VQHA 4XIGS 2A8VA 2KHIA 4JI5L 4LF8L 4DV6L 1HNWQ 5C0XJ 1JJCB 1HZ9A 2K4KA 1OXUA 3I7FA 4A3FH 5LMUQ 2PMZE 3TS0A 4NXNQ 1Q8KA 1X3EA 4UP9A 3CXCA 4BA1I 4DUZQ 4A75A 3HOYG 3H0GH 4KI0A 4LUVA 4GLVB 2I5HA 4PMWA 3EBEA 4L5RC 4DKAC 1L1OA 3UE0A 2EQSA 4B3MQ 1CUKA 4LWCA 4A3KG 1IBLQ 1XNRL 4X62L 3HOYH 5ELNA 1C9OA 4L5QA 3AFPA 1KRSA 1XTDA 4JI3L 3ZJYC 1XMOQ 1AH9A 2K5NA 4DV1Q 1G6PA 3KOJA 4IOAA 3IRBA 4LF7Q 4MNOA 2YTXA 1FVIA 2UU9Q 4LF6L 1FJGQ 2Z6KA 1PH7A 4HJ8A 3CP0A 1YZ7A 4A3KH 1N32L 4JV5L 2UXBQ 1L1OB 4A76A 4X6AH 1YNXA 2UUCL 2R6GA 3S17H 2K5HA 4JI0L 1X6OA 1SRUA 1MJCA 2D62A 1FL0A 3J80c 3PUXA 4DK6C 4DV2Q 4A3JG 5JJIA 1L2FA 4RG1A 1HNWL 4GN3B 3GTJH 1N33Q 4O2DA 5LMUL 3HOVG 1WFQA 4R4IA 3PGZA 1X54A 4NXNL 4DUZL 1E24A 2AKWB 4TQUS 1LYLA 1NE3A 1QZGA 3PO3G 1NBWA 2H5XA 1KD1C 2Q2UA 1XPUA 4IO9A 3I4MH 3CMAA 3U50C 2WB1G 5M3MG 4B3ML 1IBLL 3HOVH 1BVSA 2GVAA 2JK8A 5GAGC 3J7ZC 4A3EG 1J6QA 3TREA 1X9NA 1N36L 2YU9H 4LNQA 3EN2A 3UDFA 3M85A 4IFDJ 1E7ZA 4IPGA 2UXCQ 5JJKA 4DV1L 5C44G 3A74A 1P8LA 3PO3H 4LF7L 3J81c 3H15A 1PH3A 3K8AA 5E7NA 5M5WH 3HKZG 4DV5Q 2UU9L 4FDBA 5FLMG 3M9BA 1YJNA 4X66Q 2WAQG 3STBD 1VQ8A 4A3CG 2UXBL 4A3EH 1VQPA 3PUZA 3D31A 4P71A 3GTGH 2VW9A 4JBWA 2DGYA 2WP8J 5C44H 2D0PA 3KFUA 4GKKQ 4PG3A 1SMXA 2N3SA 3CCRA 4DV2L 1Q46A 3GTLH 3AQQA 1EUJA 4PZ8A 1JT8A 4JG2A 1PHJA 1CKOA 3HKSA 1N33L 4A3CH 4DV3Q 1EYGA 2GVBA 4JI6Q 1I6HH 4YWKA 3A5UA 4YY3Q 5M5YH 4KHZA 2VQEQ 1B8AA 1NY4A 4ME3A 4IFDI 4JC0A 2RCNA 4OONA 2BH8A 3CMEA 4LF9Q 1YJ9A 2R92G 3PF4A 2Y0SG 2JA7G 5JEAG 4BBRG 4Y7NH 1LTLA 2ALYB 3PUYA 2OTLA 4IOCA 1MJEA 2Q2TA 3UDGA 2R7DA 1Z9FA 1JJ2A 3MEFA 1S72A 2UXCL 4AYBG 2K52A 4DR5Q 1IL2A 1UWVA 3KLWA 2JA6G 1K0RA 4C3IH 4DV5L 2R92H 3A5ZB 5FLXc 1PH9A 2JA7H 2IT1A 4AIMA 3CC4A 3J81j 4X66L 5IP9G 1T9HA 5C0XG 1HR0Q 2I0QA 3S16H 4PZ6A 1XPOA 2AHOB 2PI2A 3L7ZC 2ATWA 3HOZH 4KHPQ 4DR6Q 1EFWA 4GKKL 2JA6H 1PH2A 3S15H 3GTQH 1IBKQ 2JA9A 1UE6A 4LUZA 4JI7Q 5IT9c 5IP9H 5HGQA 1NMGA 3AYHB 4DV3L 3VDYA 1C7YA 2OTJA 3OTOQ 4JI6L 1Q1EA 3G48A 3HKZE 4YY3L 1PH4A 1EQRA 4GNXC 3K7AH 3I56A 2VQEL 3M7NA 4P73A 3GO5A 1HNXQ 4A3IG 4DV0Q
chains in the Genus database with same CATH superfamily
4ED8A 4POFA 4FF4A 3BQTA 1JJGA 4LF9L 1FR3A 2JA5H 4NL9C 2NVYH 4BA2I 5BR8Q 1VLBA 1ZD3A 3I76A 1D8LA 4UARA 1B3AA 1HNZQ 1O7IA 1K9MC 5EAYA 5M3FG 3KUPA 4RT3A 1NNXA 1BPDA 4YMMA 1SV4A 4DSEA 1O03A 4P0PA 2FPMA 2P35A 1XTCD 2QF7A 3UXPA 4DAYB 1ZEQX 8ICGA 3H0LB 1CSPA 5CR3A 4JI4Q 1JMCA 3PMNA 3M9OB 1SB3C 4DWIA 1TR5A 4C3JB 3HOXG 1HR0L 1ZD2P 3B0YA 1ZQDA 1VJ5A 3TARA 1PVQA 2XGTA 2R8HA 7ICLA 9ICVA 4DR6L 3MABA 1KDAA 2PI2E 2Y0SE 5IYBG 1FFVA 2H1EA 5EE3A 3GQCA 3KK7A 3H6MA 4N9PA 3VR4A 5AK4A 1IBKL 2PQAB 5AKHA 3HILA 1HUZA 5J2IA 3L3FX 4IQZA 1UEBA 4HTHA 2XVSA 4AYBE 5M9OA 3HOXH 1A6XA 2RKSA 3LWEA 1TVXA 3I55A 3IL8A 2E75C 4J1MA 2LPEA 5IYBH 4A3MG 3AL0B 4JYAQ 3F2UA 4K2LA 1LV9A 3MXNB 4DV0L 5JVG3 3KOOA 3C28A 3QWNA 3BQ7A 2DNCA 5JJLA 4CKBA 4OEMB 4KV6A 3OGUA 4QJFA 3SHLA 5C0XI 1QVGA 4B3SQ 4A3MH 5AIBA 5C4JB 3BZKA 1BCPD 3K75D 4JBMA 7ICRA 4MTKA 2J0TD 3BS5B 4IPHA 1RXWA 4KD4A 4CGZA 3ISBA 4OWWB 1BBUA 2MQHA 1TWAH 1LVHA 4PJ0U 4EYHB 1TV9A 3RTVA 3KZIU 4KLQA 4Z9CB 2PZWA 2Q8TA 1EY5A 5C6AA 4OJ5A 5CP2A 4LF4Q 1KTKA 4XTCS 1EZ6A 3F1ZA 2ENBA 3GILA 2KV2A 9ICCA 3OMCA 3I4OA 2WFWA 3WK9A 4B9LA 3TZDA 5KFPA 3GV6A 4PGQA 2WF5A 4O3QA 4G57A 1TWCH 3W2DA 1N2XA 2F1MA 1AZQA 5IYCG 5CHGA 2ASDA 4YCWA 4LFAQ 3G71A 3CKIB 2A6HC 4YWMA 4IJHA 3J81i 1T7PA 3S2DB 1XJVA 3T1YQ 5KT4A 5M3MH 3QXGA 3D0FA 1S4ZA 3SENA 2A68C 3SAHA 1NKBA 4IURA 1RODA 5IYCH 4EQPA 1O7LA 4PPXA 4DFJA 3V6KA 3VYSA 4Y2JA 3RBDA 2AH5A 1MQ2A 3E6ZX 3RZOH 4P0QB 4S3SA 1CHQD 5FJ8G 3UMGA 1BQQT 3PSIA 1T4GA 5FLMH 2BDOA 4FXKC 3UE1A 3K6OA 3K81C 1VQJA 4LUOA 2VS1A 1OXVA 2HQLA 3NQIA 1YITA 1Y1WB 3EWAA 3ZYYX 5CMDA 2ZIVA 3SI8A 1PK1A 4TUQA 5EJWA 2PMZC 4UBBA 2F1IA 1CKNA 3CCMA 2ES6A 4CJ1B 4GKJL 4F50A 1VQLA 5AM3A 4DR1L 2AGOA 5JTIA 1ZD4A 3KHRA 2F4VQ 3M4PA 2RLTA 2JEFA 5EPJA 3RB0A 5FKAC 2K4EA 5ALSA 1OO9B 3ERQA 2VUMB 2KECA 2XN9C 5JEAH 1JXEA 5JVH3 4KHVA 4DXGA 2UVWA 1LLRD 4KMUC 1ILPA 1HUNA 4RQMA 1IV8A 5KYLA 1ZQAA 1G51A 1MKHA 4C3JG 3RR7A 2HW3A 3K5OA 4J8QA 5EWEA 4GOPA 2LFNA 3KHGA 4KLOA 3H09A 3X3MA 4EVOA 3GV3A 3UI2A 4DNTB 1V1PB 2QA4A 3CCJA 3TS2A 3PY8A 1FNUA 2CVRA 3PW2A 4ECQA 4QL5A 4H7BA 3PUVA 5DBAA 4IQTA 1OUQA 1GVPA 4QIWF 4C3JH 4YHHL 3U58A 2B2VA 2BCRA 4OO1J 1SE4A 3CCVA 3OW2A 2B2UA 4IS7A 4QZGA 2KENA 3ULLA 3PW0A 1S3OA 4TURA 2CHBD 1S40A 3K0XA 4BUGA 3H40A 5GROA 4DNIA 3K59A 3T3FA 5KT5A 5C4ZA 1KEJA 1FGUA 2LMRA 4AH6A 3BDPA 3HG9A 5DEHA 5KFCA 3F2DA 3A55A 1KXLA 4PHDA 1KN5A 3BDOA 4RWSC 3PSTA 3Q8LA 5J2EA 1U4LA 2B2YA 4UPAA 4DAVA 4RKBA 3T1HL 2I07B 4APVA 4B9XA 3QOLA 1WTXA 2HHTA 1JC7A 4I29A 4ED6A 1S0NA 2E8GA 5AJ3L 1K8GA 1LKYB 3QO2A 5C4JH 8ICEA 3EZ5A 1T5XD 4C8OA 2B63B 3TRZA 1QSSA 1ZQYA 3NUCA 4M2YA 2IMWP 1VQ9A 1VQBA 1EOVA 4JMUA 1JN3A 3LVVA 3EYZA 5COYA 1JALA 2LM4A 1CTMA 4IJLA 5JAVA 1X6IA 2KMDA 3TI0A 1N5XA 4TRDA 3MFHA 2FMMA 1SYFA 2Q2IA 2XIDA 4R63A 5FO8B 3S2HB 5D65A 2FMQA 1TK0A 2IBKA 4HIKA 4DSKA 1QCKA 1XMQL 2G5IB 1ZQWA 3C2LA 3F2CA 2L12A 1SR3A 3GTMB 1HQMC 5LMNW 5D3DA 2WF6A 3HOWB 4YR3A 3S2DH 1F9SA 3G7LA 4B9TA 5AI0A 3LK9A 1NKEA 3OSOA 4IUNA 4ULLA 5LHY1 1VF5C 1L0WA 1UCVA 3ISCA 4BX9C 3M4QA 2KVSA 3E9HA 1SE3A 4DK0A 3G6EA 1NOMA 2V4DA 3PF5A 1Y1WG 2WB1C 3SD7A 1WCNA 1PFNA 2PZUA 3I70A 3P75A 2CFMA 1IHZA 4LF5Q 1FFUA 4MHEA 1AZPA 2ZXRA 2E1EA 1XNQL 1U4PA 1LACA 3WKCA 5KFEA 4RQ2A 1X32A 2L0CA 1Y1WH 1DCZA 5J0SA 1YJWA 1B53A 4DLGA 1D1KA 2DY7A 3D4RA 1EY8A 1BNZA 4NLNA 2BPGA 2LKYA 7ICOA 2EY1A 3FPPA 5F2DA 5CBAE 3RNUA 4DSIA 2VUMG 3MGHA 4QUFA 3AQEA 2IHFA 4EQNA 1E1OA 2MU2A 5IT9L 3UPQA 5A0LA 4ECRA 2Z0SA 1ZQBA 1N5WA 1WYDA 1RM6C 2E1FA 3D6CA 3LYSA 4UAVA 1A62A 2XRSD 1LTSD 2WKCA 4I2EA 4X64Q 1S5CD 4JBKA 4US9A 2VUMH 2ZJ5A 1NZBA 1Y8OB 2OCEA 1E0BA 1EWIA 3GTJB 3K57A 4WFN3 2L5YA 3D4WA 3WU2U 1FJGL 4QWDA 1X9MA 4U6PA 5J0YA 1YNJD 2UVVA 4Y52H 4O5EA 3JPRA 4CF3A 2JEJA 2W8KA 3KD3A 4J9KA 4I2AA 3GP7A 3I4MB 1SNMA 4OWXB 2P6UA 5IGDA 5CV8A 4DPGA 3R8BA 4Q5VA 3TFSA 1ZQUA 1EU3A 2BPFA 2KSOB 1OW5A 2HOFA 4QZEA 5M5YB 3EROA 4NKLA 3U26A 1NK8A 1R4QB 3OHXC 9ICXA 4M1UB 2C2EA 4DF7A 1XXGA 2M9NA 3NVZA 3LNNA 3QG1A 5IT9E 1MGSA 1YZ6A 4F4WA 5J2GA 1HPCA 4UP7A 4JWNA 4XYQA 3GFKB 1MSHA 2DL0A 2KZ3A 1CZGA 1QZHA 4JK1C 4HMIA 4A93G 1B44D 1OXSC 4JOIC 1TKDA 4KLKA 5KL1B 4GS3A 1ZQMA 2WHEA 4P4MA 1MQ3A 3HKZB 2B63G 1N56A 2JZBA 3H3VH 3MHBA 4F88A 2HHUA 1L7OA 1SZPA 5KTQA 8ICMA 1X56A 2WACA 1E22A 4DV6Q 4K0KL 4ZK9B 4MFCA 5KFTA 3AMUA 8ICUA 3TKAA 1U9RA 2J6UA 4A93H 1I6HB 1I4XA 3AB9A 3D6WA 2VQFL 1AQ6A 2K60A 1F9RA 2TSSA 4EYIB 5ELOA 4YVZA 5FOBB 5L1IA 3FP9A 4ECWA 2B63H 3PR5B 1KRPA 3DV9A 5ALWA 4NM2A 1DYQA 4F4KA 2DF4B 2W9AA 3OPXA 2B39A 3G6VA 5EKLA 1L1OC 2G5DA 1BDOA 1K73C 1M8AA 2EXZA 2XIWA 9ICTA 4RT2A 2AQ1B 4C8MA 2JMGA 4WJ4A 2OYYA 2MO0A 1XNRQ 2HHQA 2KCTA 5D49A 2DPJA 5EOZA 2MUTB 4BS9A 3ONNA 2R92B 4M9NA 1RTOA 2F0SA 2X6LA 2HBLA 2A6EC 1XSNA 2KHJA 3HOWG 3S2HH 2DGZA 3JPOA 2QEXA 2JP1A 2XCPA 4IRCA 1L8OA 2OXPA 1EQTA 2EIFA 2OF1A 1A0IA 2JSOA 1N32Q 4IQUA 4JV5Q 4B3TL 4R4QA 1W6KA 3QU4A 4KLDA 2KP7A 4HAEA 1COOA 3GTMH 4KLUA 5I2XA 2PKEA 3S15B 3HOWH 3GIJA 4Z6CA 4EENA 3WK7A 9ICEA 1GUNA 2KHIA 4JI5L 2M9VA 2PZTA 1JJCB 1STGA 5KT3A 3BJYA 4RPXA 4QWCA 9ICIA 3Q24A 4DUZQ 4A75A 3TS0A 4BA1I 4B6JA 2D6FC 2BR0A 1L3TA 3PX4A 4UB3A 1UUPA 4UB8U 3DXJC 1SNOA 4CJ2C 3QE9Y 4LUVA 4GLVB 2I5HA 4F87A 3EBEA 4DKAC 2W8LA 3UE0A 2BE5C 2H3QA 2BHNA 2EQSA 4B3MQ 2Z9HA 1O78A 2JH1A 1MHWC 3EFXD 4J9MA 3D2NA 4YMOA 2R8KA 1C9OA 4FO2A 4L5QA 4M8AA 5ELNA 4JI3L 1HEKA 1QILA 4RHRA 5DNFA 4E0DA 2K5NA 2SNSA 1G6PA 1ONLA 3WDNA 4KTQA 3SEIA 1YNND 2HCCA 4EGVA 4BJQA 2UU9Q 3F53A 4LF6L 1FJGQ 2Z6KA 1PH7A 1Z00A 3C2PA 8ICAA 3LDAA 2XWJB 2F44A 5AM4A 5FK9C 3QOJA 3SXHA 2UUCL 1SMYC 3NBIA 4DSFA 2RA4A 1X6OA 5FP0A 1SRUA 5C5MA 1PRTB 2MJ8A 3D4DA 3OSNA 3RR8A 4HSVA 5CV6A 3GTJH 1JORA 4C56C 3LWUA 3PGZA 4RNMA 2HDOA 4PMCA 2ATLA 4F72A 4YXMA 4NXNL 1ZQPA 1E24A 2AKWB 1LYLA 3CU7A 3N28A 5ALMA 5I6WA 3A54A 2EZXA 2B6GA 1XPUA 2Q2UA 5K4LA 4C3HB 3I4MH 3EQLC 3UQ0A 4J9RA 9ICMA 2FHTA 2MRLA 2QB1A 3IHQB 5G3LD 4OJLA 3A0HU 2NTTA 1M6YA 2YY6A 1N36L 1J6QA 2YMLA 5JJKA 4IPGA 3PMLA 2O2LD 1EFID 4DV1L 5F9LA 3JAML 4LF7L 3MR2A 1PH3A 2KICA 3HKZG 3UMBA 1UA0A 4FDBA 4ED2A 4X3UA 3STBD 1NJYA 5DQGA 4DOAA 3IKJA 1VQ8A 9ICAA 2R18A 3QUBA 3D31A 3PUZA 1C20A 4P71A 1SYGA 8ICTA 1JWMD 1XWEA 4MEYA 3KFUA 4RQ3A 3CCRA 1Q46A 4DV2L 3RH6A 1S0MA 3NVYA 1Q3LA 1D2BA 1ZRMA 4HR7B 4QMGA 4JPBW 4K4IA 1GUTA 4OO1H 4DS4A 2MUYA 1ZQJA 2Z7JA 2QLTA 1I6HH 2E8NA 3H8MA 3C5GA 5M5YH 1KDCA 4UHVA 4BY1B 1DOLA 5G3LF 5BN3A 3NWTA 4G9BA 1ZQKA 3RJKA 1RD9D 2R92G 5L37A 4O5KA 2K1BA 3JAME 3C3LA 4BBRG 7ICSA 1LTLA 2ALYB 3PUYA 1ZETA 1NK6A 4IOCA 3WK6A 2R7DA 3MEFA 1DOMA 4A3DB 2UXCL 2UVRA 1MC8A 2R92H 4DV5L 1TVAA 3A5ZB 3RB3A 3CC4A 1WTWA 1JOQA 4X66L 1VDZA 1ZQNA 1S5LU 1T9HA 2W9MA 3MGIA 4PZ6A 3C5FA 3L7ZC 1DK2A 4I2JA 2DJFC 4RNOA 1DONA 5ALNA 1TWGB 1JROA 4J6HA 4C4TA 4QZCA 1N48A 1PYWD 5DB7A 3T5LA 3NTIA 4ZAIA 4UAUA 3S15H 2JA9A 2FLPA 8ICOA 3NBHA 5KRUA 4OJ6A 1BPXA 1F2MA 3VDYA 3BDCA 5J0PA 4JI6L 4O0IA 3OHBA 4YY3L 2QARA 5GTHU 4P73A 1NZPA 3C1YA 5TISU 3V7KA 4FNFA 1B50A 1CRXA 1ASYA 2EYFA 2F0FA 4Q8FA 1Z47A 3T16A 5CR0A 5D46A 4DUYQ 2W54A 3PO2B 4DR7Q 4JOIA 1J97A 4QQBX 3QU9A 3FKIB 2HD3A 1TS2A 1VQIA 2E2HB 5L1MA 5J3BA 1S10A 1L7MA 4QIWB 4QZIA 1SKRA 5KGUA 2Q4TA 1VQGA 2A69C 5DB9A 1VQMA 4YFKA 1HXYD 3BS1A 4R8UA 2JEAI 2NO5A 1HZCA 1T5EA 5J39A 2EYOA 1LB2B 1RTNA 3HFZB 1D6EC 2BDPA 4KHPL 3CAMA 5EKKA 1G2TA 4B9WA 3KF6A 3GV8B 1U4MA 4NPSA 4EX5A 1W3SA 1D5MC 3ED5A 2AWOA 4JI7L 4KLEA 2QILA 3BVMA 2AQ0A 4P2HA 3QU7A 3OHAA 3N7SC 1Q1BA 1SNQA 1N36Q 1QSLA 2CKZB 3VYRA 5AI6A 4QIWE 2PW5A 4GNXA 2K8CB 4IFDG 1IBML 8ICPA 4HAIA 4FYDA 2KHVA 4Z6EA 3ERSX 2PI4A 3NENA 3PV0A 9ICBA 5M3FB 4C3HH 5BR8L 1ZJNA 4F5QA 4LW1A 1XWLA 1HR0W 2H3ZA 3GDEA 5IGFA 1HNZL 1UEAB 1SYEA 2EZVA 4XT3B 3J80i 5IGCA 1WD1A 4IFDH 1LTGD 5AI9A 4RZRA 4KY6A 2RSNA 1V85A 1WTOA 1TAQA 3J7AV 3CD6A 1HQRD 4B3RQ 2CCZA 3RJIA 2ZIUB 3N97B 3AU6A 2Q8IB 4JI4L 1KTQA 2QKIC 4M6WB 2NVTB 3T5JA 4Q44A 1EY7A 4P2CB 3ITPA 1QVFA 3W3AA 1COKA 3MAQA 5K36G 2K50A 1IXRA 3OOCA 5IODA 2OWOA 1LTBD 4DR4Q 4NXMQ 4BY1G 2RP5A 5T1IA 4ELTA 5IWAQ 4WRDA 5KFXA 1C4QA 1VQAA 1BKBA 1GOZA 5GTIU 5C4XG 2ZIWA 5DQHA 5J2FA 4NY8A 4A4IA 2R7ZB 2EAOA 5KFKA 1LTAD 4JYAL 5DM73 3TFRA 5HMMA 1PVRA 2V1CC 4BY1H 4A3DG 1JRPA 3AU7A 2EYPA 1EZ8A 5KFLA 4DV7Q 3GIMA 1Q8IA 1KIXA 1WD0A 4B3SL 2JE6I 2B2WC 3TACB 5AM0A 2HOIA 4GOPC 2PFOA 2AJQA 1ZXTA 1YEZA 1U47A 4A3DH 2XRQD 4O3PA 4F91B 1T3NA 1U9LA 3RJEA 4LVSA 5KNIA 4MF2A 4RMFA 2NRXA 2B2TA 4DSLA 4F2RA 3S6JA 1JX4A 3HKZF 1QWYA 3BG3A 3N7RC 1YIJA 3PIPA 2HOQA 1LT4D 4LF4L 2B2VC 5ALOA 4QB4A 4QZ9A 1EY0A 2C22A 1TWGH 2B2UC 2F0HA 2EDGA 3DWAA 4HMJA 2B3GA 4Q0FA 3ICEA 3SQIA 3Q8MA 1UAPA 4ALPA 2H3FA 4PHPA 5IIKA 4EZ9A 3OYYA 5AFWA 5J0RA 9ICJA 5C5JA 2XCAA 3PO2G 3M8RA 3M7DA 4TQSA 1JB3A 4LFAL 2EPBA 2DJGC 2KG5A 3FKIG 3T1YL 1ZQOA 3A0BU 4FO6A 1PTOC 3N6RA 2W9BA 2B2YC 4ZCKA 3MFYA 1N34Q 4ECYA 4PMBA 1FNVA 4DA2A 3VCBA 2F0KA 3E0EA 3NASA 2RQ5A 1Q12A 4CKCA 4AQYL 3PO2H 2WF7A 3PO4A 3FKIH 4DO9A 2K14A 3UDXA 2BOSA 4C7YA 1R9TB 2E2HH 3EA6A 5C0YA 1SV0C 4LZGA 2ZT9C 1TE2A 7ICTA 2CW0D 2HHHQ 3L2PA 1QUQA 5J0OA 3ISDA 4BGDA 2NN6G 1NK5A 3E3XA 2F3NA 2N49A 3DLLA 5EKIA 1IBMQ 4C1NI 5BPCA 3B0XA 1PRTD 2K5VA 2EYJA 4DOBA 3RJHA 2D0OA 8ICIA 3GZFA 3URYA 2A1JA 2KCNA 1YT3A 2N88A 1YHQA 4F92B 3D8GA 3ONAB 4A3BB 3BS7A 1VS0A 4UDUC 4XQJA 1B7YB 3V7LA 4OCZA 2UUBQ 2F4VL 2I5MX 2F0WA 4YR2A 1PFMA 5ELCA 1Z4OA 3OJUA 3TQ1A 5IINA 1IW7D 2PMZB 4DS5A 4BXOB 2Z1CA 4LFCQ 1FYCA 5KT2A 1QVCA 1Q3UA 3FM9A 2K89A 7ICGA 4IUQA 2CWPA 4K5VA 4CDEC 5M3FH 1Q82C 1HFNA 1ZYRC 2HIXA 4PZ7A 3VYTA 4X65Q 1AFPA 3IDWA 1XSLA 3NRWA 1PH1A 1KLGD 2K03A 1QQ5A 3CC2A 1ET9A 3CCSA 1NCVA 4X3KA 4GN4B 4YMNA 4IPDA 3EW9A 5DLFA 1A76A 1PRTF 3J81L 4UB2A 4PGYA 3F5AA 4HJ7A 2R93B 5JJZA 4QUCA 2NVTH 4RGMA 3O13A 1SXDA 2YTYA 4IUUA 3RZDB 2R7ZG 2XICA 1GHJA 1HRJA 3WKBA 2F76X 2GN5A 3M4OB 1K5OA 3QNMA 4DFAA 1B22A 4F7XA 4GLAC 4J9QA 2FE9A 3H3VI 2F0TA 5KAFU 2SOBA 1NTGA 7ICVA 3H0MB 9ICWA 5AKEA 1SL2A 2L1BA 4OWTB 1SFOB 2Q0ZX 1QB5D 2R7ZH 1VQ5A 2UXDQ 1HUOA 4FXDA 1II3A 2XC9A 2A19A 2WFAA 2IHMA 3IFDA 2FLNA 4N9TA 5KFIA 1NNLA 2W7OA 3BJUA 1WTRA 2D8CA 1FIQA 2B0CA 3K4GA 2EE1A 1H9SB 4ECXA 1V9PA 3C23A 1VF7A 4YCVA 3K0YA 2AUKA 3J81E 2E2DC 1ZYQA 5DG8A 2K04A 3H0GB 3HEJA 5L1KA 1XPRA 3RB4A 2FINB 2Y9UA 3AFQA 3DM1A 1RJTA 1JXLA 2QB0B 4NM1A 2CQAA 1H9KA 3EIVA 1PVOA 5L9XA 4ICAA 1I4QA 1GO3E 3HOYB 1WI5A 5ALYA 1BR9A 3DMUA 3FMCA 4MZ9A 2BCSA 2ZIXA 1Z00B 3VC8A 4JW0A 5IIOA 4USAA 1YI2A 4CGYB 3AQFA 1IYJB 3FHWA 7ICQA 1P16A 4AQYQ 3AU2A 1JQYD 1AW7A 2CQOA 4Y2RA 2M00A 4ZRZA 4A3KB 1GJXA 5I9OA 2LYAA 3S17B 1FGBD 5KT6A 1Z3EB 2C2RA 1R4PB 1XSPA 3RFAA 3IG5A 1SXTA 1B1ZA 4AP9A 3HW8A 2L4NA 2ZM6Q 3PV8A 1RXVA 4DQIA 4WJ3M 4LZDA 2KZMA 2KEDA 3KDFB 4WJWA 3RR5A 4M9JA 1JWUD 1SYCA 3CPFA 3H94A 2UUAQ 2F52A 9ICHA 3IFTA 4G4KA 5FJ8H 3PSPA 2KQ3A 3BDLA 4GC6A 1S9FA 1U45A 3GIIA 1HIWA 5DB6A 1H9JA 1Q90A 2Y0SC 3CCLA 3L4PA 4KN7A 1R9TH 1JOKA 1QOHA 1WOCA 1YHAA 1ZQXA 4FS1A 4CDDC 4LF5L 3FDSA 5IYDG 3VA5A 2H4OA 4A3BG 1XS9D 2MAXA 4AYBC 4GLXA 2V9WA 5CRXA 3BZCA 3DM3A 4KN4C 2YU9B 1DZ1A 4DCCA 4XQNA 2VA3A 4QZAA 1LTRD 1N8RC 2BH2A 3SMVA 2EJGC 4XA5A 3NEMA 1JUDA 5IP7G 2Z6BA 3QIAA 3Q0AA 2G08A 3BU2A 1X3GA 2E74C 3L5KA 4B9MA 2A5HA 5M5WB 5IYDH 1ZQVA 2WB1B 3T51B 3L9AX 4A3BH 2B2WA 1PTOD 3LGJA 1G291 3R3OA 4JWMA 1RZTA 1L3SA 4RPZA 3S9WA 3K1RB 1RL2A 5C44B 4DF8A 5IP7H 2N78A 1HH2P 1VQ6A 4RU9A 4DXFA 4QW8A 1LT3D 1VDVA 1GUSA 1YVCA 2VXWA 3RH4A 2PFQA 2EH9A 1EIFA 1SSOA 2K32A 5A35A 4EBEA 2YMPA 2K33A 4KKSA 4LF8Q 4RQ8A 5KG7A 3TN2A 1RYSA 3EPGA 4P75A 4EQ5A 2G09A 2E3TA 2YMQA 2K7VA 8ICXA 1PV4A 1A6SA 1SNCA 2LS01 5KFWA 2R93G 1X9XA 2W9CA 4Z6DA 4BWMA 5DLGA 9ICPA 1I4PA 4OL7A 3PX0A 2FDRA 1PH8A 9ICNA 1F5SA 2WB1E 1CI3M 2W03A 3C1ZA 4YD2A 4ODGA 2QW7A 2G5HB 3PZPA 1S0OA 4NP5A 4Y7NB 2C35B 1QCBD 5ALPA 3RB6A 2JHDA 3AEVA 2HBKA 2R93H 3I91A 2JJQA 2LSSA 4X62Q 2QKQA 5AK5A 3GV7B 3RZDH 1PTOF 1SNDA 2NZOA 4C3IB 3Q8RB 4NLGA 9ICSA 4A93B 2VZAA 1PYSB 3HX0A 3KBGA 2Z6KC 4DK1A 2K4HA 2EXDA 4RQ5A 1F0MA 4OO1I 3M8SA 4KX5A 8ICJA 1SV0A 1X65A 4V0BA 4JI0Q 3F2BA 1Z6HA 2K4IA 1SFOH 2JA6B 1K8AC 3GTQB 1ESFA 3H0GG 3CCUA 2BQUA 4DL7A 1KFTA 4PZNA 1EIGA 3FRPB 5C3XA 1O08A 2KJ8A 4KLIA 4DV6L 1WTVA 3RAQA 2HBJA 1HNWQ 1S97A 1HZ9A 2K4KA 1OXUA 3I7FA 3ZDEA 3I73A 4JV1A 2OEOA 4ZYSA 2L11A 3HOYG 2WF9A 4IRKA 1EYCA 3QUCA 1SGGA 4G7OC 1Z7TA 1CQVA 3H0GH 2XY7A 2JEGA 3NWSA 2PW7A 2RVLA 5CORA 1I4HA 5KYIA 2AQ3B 2OHFA 2NVQB 4L5RC 2HUGA 3K5MA 2WINB 3RD4A 8ICQA 1CUKA 4KLFA 4A3KG 2TMPA 3SEBA 1IBLQ 1XNRL 4C80A 3KLSX 2AQ4A 3HOYH 4UB6U 3HOZG 1JICA 2G9DA 4A3IB 3H8SA 1SEBD 2NVXB 2YB1A 3KOJA 4IOAA 2PFPA 1DK3A 1E2ZA 3IRBA 4UB5A 4Y2UA 1STBA 3A8KE 2EZZA 2KN7A 4DAPA 2E8MA 3CP0A 1YZ7A 4A3KH 1N32L 4JV5L 1L1OB 4A76A 2JA8B 1YNXA 7ICPA 3S17H 2K5HA 1KBUA 8ICBA 1MJCA 1QQ7A 4IQVA 5ALGA 2ISOA 1KNAA 2SDFA 4ECUA 3QEAZ 3PUXA 2NV3A 4DK6C 4A3JG 5J2BA 4RG1A 2DKZA 3NSWA 4RQ1A 4G7HC 2J6TA 2GH1A 3HPOA 3WKAA 3OMGA 5CBEE 1N33Q 1WG8A 3GIKA 4DUZL 3A7AB 1NE3A 2A6HD 2NO4A 5ALQA 5ALRA 5ALKA 1DRGA 2WB1G 2IJ0A 4DU9A 4FE3A 2K5DA 2A68D 4B3ML 1MN8A 1BVSA 2GVAA 1U49A 3J7ZC 2R8JA 4LNQA 2YU9H 4F71A 4IFDJ 4ED0A 1WWUA 3M85A 1PK3A 5LL6X 1BGXT 2XO7A 4Y2YA 5C44G 4DGZA 5C3WA 3K8AA 5M5WH 2UU9L 3M9BA 4PV1C 4A3CG 3OIQA 1HUMA 5KNDA 4KD3A 5I2YA 4GFJA 5J2CA 2WP8J 5C44H 1XU4A 2N3SA 4K4GA 1KQQA 5JUMA 4FZMA 3RRHA 2CH4A 2IW3A 1JT8A 3CRKC 4JG2A 5KG3A 3PW4A 1PHJA 1X6JA 1TY2A 4A3CH 4N8X1 3NRZA 3S1MB 2F03A 3M3YB 5CV9A 1RCVD 2GVBA 4US8A 4CBVA 2G07A 4KLJA 3LWLA 2VQEQ 4MN3A 5CC4A 3E0FA 4IFDI 1NY4A 4LJZC 4JC0A 1V8QA 2BH8A 4C3IG 4OELB 2F0UA 4UB4A 1CZWA 1L3UA 5CV4A 5KFMA 4TUSA 2NRZA 2BQ3A 1SDFA 4Y7NH 3PIO3 2B8FA 2OTLA 3NQTA 3UDGA 5KFVA 3PW7A 8ICNA 2F0LA 5EE9A 3E2EA 4DSJA 1I50B 2K52A 4DR5Q 1EXNA 1Z1BA 3VR3A 1EL0A 2JA6G 2XI9A 5KFBA 2BGWA 3OWFA 1XC9A 2EDUA 4C3IH 5DGAA 1PH9A 2E5SA 3C29A 4O42A 4TKOB 3D2SA 2JH7A 2PMZF 5KFOA 5C0XG 1CA5A 2I0QA 2ASLA 2K4PA 2PI2A 2PFNA 4NJ8A 4F5RA 4K14A 2JA6H 4BDPA 4YCXA 1AROP 4ZUJA 3MDAA 2KNJA 3GTQH 4DL6A 1Y88A 2LHTA 4KN4A 5KEEA 1UT5A 5IT9c 1GXDC 4R8IA 4C4SA 2KEEA 3QU2A 3I4NB 3JPSA 1ENCA 3OTOQ 4NLBA 4Q43A 3G48A 1XYIA 4NXZA 3HKZE 5TSSA 3SR6A 7ICEA 2YX8A 4QWBA 2JR5A 1EQRA 4DAYA 3I56A 4GNXC 3GTOB 5J2AA 4NDXA 4I2DA 3FAHA 1B9NA 3GO5A 2KEYA 4HSPA 4BBRB 2YQEA 1TXYA 4A3IG 1HNXQ 2KFZA 1BOSA 1H38A 3TAQA 5KAIU 2NVQH 4KK7A 4HIDA 3AM9A 2KJXA 3PUWA 1SJED 4IN3A 1HHVA 1DXMA 1ZD5A 2KHQA 2JEIA 4V190 2KZZA 1RQLA 2JA8G 1TY0A 3PO5A 4M0AA 2PQAA 4A3IH 1GO3F 2A3VA 1Z19A 4BWGB 4GXJA 2NVXH 4NB3A 1FNWA 3AN1A 1X40A 3V96A 3KJOA 3MWYW 5J1ZA 3EJIA 2XGPA 3Q8PB 1M1KC 2W43A 3MXNA 2RQXA 2JA8H 1E2VA 3ND8A 1VQ4A 5B66U 1CM9A 4Z6FA 3B6YA 1Q7YC 2AQ2B 1DD2A 1YBYA 5AM2A 3QZ7A 4P0PB 3DEEA 2PPBC 2BDUA 3P7JA 3ZDBA 1NK7A 1NK9A 4ED3A 1MIUA 3I72A 3BS5A 1QG7A 1J8IA 3ZD8A 3GTKB 4E6IA 1U5KA 2WKDA 1ZQFA 4F5PA 1L8LA 4CF4A 4QF4A 2O6KA 4Q8EA 2ZXHA 4DL4A 2F0EA 3NTUA 4DUYL 4F3OA 3WK8A 4DL2A 4DR7L 3KYHC 2ZUCA 3T4AC 2E76C 4I27A 3CCEA 1VQOA 1D7QA 1DOQA 4YCUA 1X55A 1W2BA 1EIHA 1DJRD 2WTFA 2B2TC 4JI1Q 3HS0C 2EY2A 1PA6A 1D5XC 2B29A 4QJFB 5KG1A 4KLGA 2BA1A 4P4OA 2Q8RE 4JCVE 3IRUA 1Y1VB 1DGJA 3TAPA 2DFLA 2KK0A 1D8YA 5KG2A 2CPRA 3GV5B 2PO4A 3CPWA 4P0QA 1N63A 2AGQA 3S1MH 3E58A 2ZTEA 1ZKOA 4B08A 3M3YH 2JRZA 1TK5A 1TS5A 4KKTA 2IX0A 3CF5A 2G9HD 4F5NA 4DV4Q 3GQBA 2P6RA 1AE3A 2BZFA 2F0MA 3ER0A 4PZOA 3NHHA 5EPLA 2OT2A 1TWFB 2C5CA 2ZJRA 2WB1F 4JBJA 5IIFA 1K1SA 1MI2A 3KFUF 4C4RA 4B3RL 3QU5A 1I50H 1ZQSA 1STAA 4I65A 3H8WA 4NV0A 5CWRA 3FYHA 4P4PA 1A63A 2NZ1D 1XMOQ 1GKHA 3G6XA 4JI8Q 1CKMA 4ZQ3A 5DKWA 3CQZB 3KJPA 2QGQA 4QWAA 2YMMA 3NXWA 3I4NG 3TDQA 5TZVA 1WYGA 4WORA 1DGSA 1X3QA 3V6HA 4CKEA 3VA7A 4DR3L 1KLUD 4DR4L 4NXML 5C4XB 5IWAL 3JC66 2IY5B 1O7ZA 2LBOA 4QZDA 2JXJA 1MA7A 3V7JA 3K7UC 2R8IA 1BBWA 2R3ZA 3I4NH 2ZXOA 5AM1A 4Y2QA 4NLKA 7ICIA 2MP1A 1ILQA 1V1PA 4PNYA 3SE0A 1TKWB 2N1RA 2NYVA 2ZIVB 2F0JA 1PK1B 2KUMA 4K8JA 5E4WC 2AWNA 3M4OH 3NELA 3GTOH 2K5QA 5KFDA 4BBRH 1ZQGA 1CKNB 1SE8A 4ME5A 5ELBA 2F0IA 4DV7L 4YQWA 4ELUA 1UE5A 1QSYA 5H2FU 8ICKA 4OX9Q 4MFAA 1BBXC 1WTQA 4QY7A 9ICLA 2HHVA 4DL3A 3BZDB 5LMNQ 2E5LQ 1D1IA 1IG6A 4QZHA 4KLLA 1ZQLA 1N9WA 2M0NA 3F8TA 2GO7A 5M5XB 3KZXA 5HGTA 2RDIA 3RMHA 1TU2B 3CYMA 4I2BA 3PCOB 3RLFA 3JAMc 3DHQA 5A2QL 4A3LG 1I5FA 1ZQ1C 1DXSA 2W11A 2KCMA 3SGIA 4GOPB 4HIOA 1L7PA 1BF4A 2NRTA 4IR1A 3UXNA 1E1TA 2A6ED 5GAHC 4QGUA 3J80L 1E3PA 3W1GA 2DN8A 3HP3A 3S24A 4H02A 1LKYA 3S14B 3OPOA 1NUCA 2RDFA 3CC7A 1V97A 8ICCA 3CRXA 3JPQA 1B4OA 1HTPA 4JVZA 1N62A 5KFJA 2ZXIA 3GTKH 3NE5B 1RKNA 4NLCA 2DQNB 2IOFA 1PUZA 3PW5A 4IRDA 1V1QA 1N34L 1A8VA 4HJ5A 4KLHA 3C1EA 3U4VA 4TQRA 4RUCA 5I4DA 9ICGA 1IM4A 3Q6SA 4GZYC 3H0RB 5AI8A 5JRTA 2VIXA 1EEFD 4LJXA 1SNPA 1KLNA 1SBBB 2HIVA 3TQYA 4FFDA 1IZ6A 5BOLA 1LO5D 1K8OA 1F9QA 2HHHL 3SZ2A 1QQ6A 1Y1VG 4RGOS 3BQ1A 1PTOB 2LKVA 5A2QE 3UM9A 1KRTA 1EIYB 2H3IA 3OTQA 2BE5D 5ALLA 4K2KA 5IOCA 2BCUA 8ICVA 3J80E 3SV4A 4BXXG 1Z4NA 2DNEA 3MEHA 2KKPA 4HIMA 4QCLA 1J5EQ 2W7PA 4R9WA 3J7A5 2LMCB 3VR2A 1I3QB 3U9OA 3HRZC 5KFHA 4I2FA 4UW9A 4RQ4A 1C48A 1Y1VH 5ALXA 2F1JA 5DAUA 4WJ3B 2YN4A 3CCQA 2RDJA 4BXXH 4F4ZA 2HCFA 8ICZA 2UUBL 2Q2HA 4PL2A 4UAZA 1GD7A 3I90A 2FMPA 4RFBA 2FMSA 1SMYD 4U7CA 3TBIB 2A73B 1SYDA 5GQOA 1RYRA 4LFCL 4A3FB 1Q3VA 1I94Q 3ETRA 4OHJA 1NMFA 1L5UA 3WK5A 1G8ZD 1BCPC 4GN5A 1TWFH 4X65L 3ALRA 4C7ZA 4DR3Q 2VA2A 4K6DA 4Y2PA 2KOLA 4KN7C 5IGBA 3DDHA 5EGTA 5ALEA 1NSNS 2C2DA 4PHEA 4DAMA 2Y1JA 4HJAA 1ZQRA 3T13A 4HEDA 2KFNA 5FLXL 9ICUA 2RF4A 5K36H 1UHUA 1X66A 2XTIA 3CQZH 3E0JA 5NUCA 1C8CA 4ECSA 3R93A 1ASZA 4C0ZA 1L0XB 5FO9B 3UDIA 2WAQC 2EYMA 5KG6A 2PI5A 2UVUA 5C4XH 2FPLA 2LXKA 4O3OA 2OEHA 3SAGA 2K01A 1SL0A 1CSQA 3HJEA 3T79A 1CK1A 2LY7A 4C8KA 1DOKA 2AXTU 4DOCA 5KFAA 5G5GA 4J15A 2EQYA 2UXDL 1NR4A 4CF5A 5I6YA 1BPBA 1GUWA 2KIVA 3JPPA 5DM63 2VB2X 2PQEA 9ICOA 8ICLA 1X9SA 3R2IA 2CWAA 4I2CA 4HN7A 1J2NA 5BOMA 3RJFA 4OIJA 5C5LA 2RHQB 2F0NA 3AMZA 1KAWA 1JB7A 2QDBA 1S5FD 5E79U 1PDQA 1CA6A 4R66A 3P20A 3HWTA 4N8FA 4CJ0B 3GU3A 1S76D 4KLMA 1QNUA 1ZQIA 1Q86C 3H7IA 3MC1A 5EWFA 5AICA 1PZJD 2W3RA 3ULJA 2KVCA 3MTSA 4P74A 1VQDA 2KJ5A 4DK3C 2L15A 5M5XH 3PO3B 4QZBA 2N8NA 2E8OA 5AKGA 5J0UA 4X3TA 3HP6A 4ABNA 1QE6A 2XVTA 2HQEA 4R1JA 1GM5A 2HCIA 3TP6A 4LFBQ 1KHIA 2K28A 4OIKA 4LK1C 3F5EA 3DEPA 5IE8A 1NR2A 2ZJQA 3TMEA 5BN4A 2MO1A 3S14H 2LYHA 3KF8A 1SYBA 4KLTA 4PL1A 4DFKA 2RDGA 2ZM6L 3V05A 3HRDD 3ICXA 3GTLB 3C46A 3RLNA 3QX7A 2XNAC 2N55A 4RKLA 2HT1A 2O5JC 3W5OA 2UUAL 5ELEA 2IA6A 2MHVA 3A0JA 1XO1A 3ZDAA 4RH6A 4OJOA 2GA4B 2KD1A 1QJOA 1SROA 4CDFC 3RF9A 2MUTA 4DQPA 1JR0D 1IKLA 5K5PA 3WKEA 2ZJPA 2EY5A 3T56B 1CT1D 2NN6H 5KFUA 2BCVA 3J7YW 4GIBA 1F77A 2JZBB 1ENFA 2KHSA 1PTOH 2YYZA 2ES2A 5KFQA 2JA5G 4ELVA 1G2SA 2HVHA 3N7PD 1PZKD 2ZTDA 2GOLA 3N52A 3M4YA 4O0AA 5DBBA 2G0AA 3CW2C 2O4XA 3H4BA 5KT7A 2G06A 3AUOA 1I3QH 3FEWX 2D5DA 2Y0SB 2JA7B 3LX0A 4R4OA 2MSNA 2C9OA 2A69D 2MGSA 1NJIC 5L1LA 1J2MA 4A3FG 3HOZB 2X6GA 2MPMA 5IGEA 1PH5A 1D8BA 4EX6A 4AYBB 3UQ2A 2ZJAA 2F77X 5EE0A 5BN5A 1VQHA 4FBUA 5KL8B 1PZID 4LF8L 3J7AF 1HFGA 2VB3X 5C0XJ 4A3FH 3X3NA 2DY8A 3RBEA 4C1NK 4JV2A 5LMUQ 4UAIA 2PMZE 3K7AB 5HURA 4YXJA 1Q8KA 1O7YA 1A3VA 1X3EA 4UP9A 3CXCA 1E2WA 2VKQA 5AKLA 4KI0A 5J2DA 4PMWA 5ALZA 2XGQA 4FF3A 1EU4A 2WIIB 4LWCA 4FP5D 1Z1VA 4H0LC 4EBCA 4X62L 1TK8A 2JYOA 1PLFA 4NMZA 1KRSA 4C2MB 5HP4A 1D9FA 4XQ8A 1LT6D 2PNHA 1ZOLA 2FJ6A 5HMLA 3TANA 2KVMA 3KLSA 1AH9A 5AKIA 4MNOA 2EYHA 1ZRNA 1B2TA 5J0QA 4HJ8A 3OW7A 2UXBQ 4ACOA 4EBDA 2ICEC 3G6JB 2R6GA 2HHWA 1K83B 4JI0L 1UT8A 3QZ8A 5KG0A 3MR3A 2ASJA 3R2TA 5D3IB 4RCNA 3QEBZ 3KBBA 2RHFA 5DB8A 4KLSA 1L2FA 2D3DA 1HA5A 1M4VA 2L55A 1WUDA 5J0WA 1HNWL 3GDXA 1N60A 2FPKA 4YR0A 4O2DA 1BPYA 4OGQC 3C1FA 3O0FA 3RRGA 7ICNA 2IX3A 1JMSA 5AIAA 3BYTB 3PO3G 2FI1A 4J9OA 1NBWA 1KD1C 3S1QB 4CCHA 4K4HA 2ZG6A 3U50C 3Q8SB 1NKCA 1F2ZA 5M3MG 3BVGA 1IBLL 2YB4A 1K1QA 5E1FA 2EOTA 1WTPA 4FF2A 1KNEA 2OM6A 3EN2A 3NK9A 3UDFA 1E7ZA 2K5WA 3A74A 1P8LA 2KCCA 2HMXA 2DBYA 1D9DA 3PO3H 1L6NA 3J81c 1NJZA 5E7NA 1NK0A 2CRXA 1BNOA 3IP4B 5KNCA 1IKMA 3OSPA 2RSOA 5FLMG 2NWGA 1BCPF 1G91A 1ET6A 3PVXA 1A0PA 2IOFK 4A3JB 5J8YA 4EEYA 2PCFB 3QB3A 4JBWA 4M9GA 1RDPD 2DGYA 2VW9A 4I28A 4GKKQ 3UMCA 2ICIA 2KOBA 4PG3A 4CHTB 4X64L 4ZOHC 3GTLH 4EELA 4PZ8A 3SAFA 1IL8A 2NRVA 4ZLTF 2E2JB 1N33L 1EWHA 1YNJC 5IGGA 4DV3Q 1EYGA 1JE4A 4O3RA 1AN8A 2RBMA 2WAQF 4BBSB 1ZQCA 1ZXIA 3SV3A 2MA1A 3PNCA 3M9NB 1B8AA 2HDMA 2A74C 4ME3A 2RCNA 3PF4A 4LF9Q 1YJ9A 4G7ZC 2Y0SG 2JA7G 5JEAG 5D4BA 4KJOA 1B0XA 2IOHA 3NS1A 3QUTA 2I9GA 1T3QA 1HTLD 4ID6A 4IUVA 4I2IA 1Z9FA 5KNBA 1S72A 4NWIA 5EQ0A 4AYBG 1IL2A 1WTHA 1TFRA 2DWQA 1UWVA 3KLWA 2CN1A 1K0RA 1BPEA 1UQVA 5KFGA 3ORYA 2JA7H 4AIMA 2EJMA 3J81j 2NUCA 5IP9G 4M47A 1HR0Q 3ND9A 4ZKBB 1SL1A 2F4IA 2W3SA 1PVPA 3HOZH 4DR6Q 4R64A 3TP7A 1EFWA 1N61A 2XY5A 3R9KA 1IBKQ 1OXJA 4X5VA 4LUZA 1FO4A 4DQQA 5HGQA 5IP9H 1C7YA 3TP5A 2OTJA 1A2TA 4EQOA 1Q1EA 4IQWA 2VA8A 1CI4A 2QDLA 5KFSA 5J29A 4IL6U 3K7AH 2VQEL 3MR5A 5J0XA 4F5OA 4O3NA 8ICFA 1STYA 8ICHA 2H3VA 8ICSA 3B9JA 1J9OA 4O9MA 1PYBA 3NGDA 1A77A 1TWHB 4DV0Q 1LT5D 3H91A 2C28A 2JEBI 2E2IB 1KFDA 1CEZA 4EX7A 3NBHB 1RPLA 1ZYRD 5L1JA 4IPCA 4TVAB 5J22A 4DR5L 1SN8A 3WOEA 4A3GB 4RPYA 4Y2VA 4J9NA 4C2MH 2QARB 2IHNA 3MBYA 3H4DA 5AI4A 2O5IC 4O1NA 5H1SE 5ELFA 4YIJA 2FJ2A 1EWCA 2KKVA 4CDCC 2F0QA 1URJA 4I2HA 2ASBA 3OJSA 1K83H 2SNMA 3Q8DA 3ZI4A 5I9PA 1SLJA 1A3UA 1IYUA 4I2GA 4L6TB 1IIPA 3PQIA 4I7AA 4FF1A 5GAEC 5FO7B 4L63B 3OTOL 4LMQD 2I1QA 4R8UB 4FZLA 2QCPX 1LV5A 3SYZA 3TZUA 4UB1A 2ZIUA 3MFGA 1F9PA 1HNXL 2BCOA 5IIMA 1XO0A 4DQRA 5DDYA 4RCOA 4R4CA 3S1RB 4HCEA 4DR2L 1U0LA 2F3IA 3KF6B 4M6WA 2ODGA 4NL9A 3S1QH 1TAMA 2OXOA 4DEZA 3HT3A 5KG4A 1WCMB 3W1BA 3ZDCA 1VMPA 4XXEA 1NJXA 2Y9TA 3MVVA 2VY3A 1YNNC 1VQCA 2NYZD 4GNXB 1KQSA 1GUOA 3E5SA 1HA6A 3KKAC 4FXGC 5JPMC 4JUZA 4MF8A 4RQ6A 1CFMA 2EYLA 2ZUDA 3JPTA 2NBFA 4A3JH 3C2KA 3KHLA 3GD7A 1PFBA 4RHSA 2B21A 3M6KA 2IX1A 4BBSG 1L3VA 4L5SA 4GKJQ 4RUAA 1S5BD 4IUTA 1M90C 4U673 1SZHA 2E2JH 5C3EB 4DR1Q 1PZNA 5IILA 2YV5A 4RA8A 1T94A 3WWVA 4BBSH 2KJ9A 1PFSA 2DPIA 5DG7A 3K80C 4IZ8A 3K5NA 1KDBA 1KFSA 3WOFA 2AUJD 2D9UA 1Q81C 1Y69U 2NRWA 1ED1A 2ZIWB 2BKEA 5KIXA 1I6VC 5IIJA 1YHBA 2Z8LA 1STEA 2HVIA 2NZHA 1S8OA 3I8ZA 3A8JE 4ZUIA 2EY6A 4HJ9A 4UP8A 4JI1L 4YP3A 2ALZA 1ZQTA 3STBC 2E8PA 1XX8A 5JOBA 1JWSD 2BCQA 4Y2TA 4YHHQ 3T5KA 1ICWA 2IHEA 3H3VC 4ED7A 4F4XA 1L7NA 2P66A 1SE2A 1A2UA 1XNSA 3NTKA 2OQ0A 4CE6A 3MXGA 9ICFA 3H8JA 4F93B 3LWMA 1ICFB 2IWHA 4QZFA 4F8MA 1F2YA 4RGTA 3SVMA 4BY7B 4GXKA 2EAMA 2VNUD 1ZQZA 4UAWA 4RGNA 3Q23A 5E3FA 3HOUB 5CV7A 1K28A 4XT1B 4DV4L 3THVA 3Q22A 4A3GG 2NTSA 1TWHH 2ZTCA 4A8EA 3T1HQ 1MSWD 1VQFA 1STHA 3BVZA 1CHPD 2Y0SF 1EQQA 2E2IH 2HHSA 3FDTA 2FXQA 2ID0A 4KITB 3K58A 3L0OA 3I4LA 5AJ3Q 3A7LA 3CHBD 3TP8A 4OJPA 4HYKA 2J4XA 3A8IE 3P1HA 2KE7A 2VJ5A 4A3GH 4AYBF 5C0XH 5CB1A 3I2ZA 4KJNA 1XMOL 4JI8L 4JI2L 2W9BB 1Y8NB 3GTPB 2RCFA 2HSZA 3K5LA 1VQNA 2J6SA 4ZKCB 1ZQHA 3OIPA 4DR2Q 4BXOA 3I3CA 2L5TA 1Y14B 2F8LA 3MDCA 3QUQA 4F8RA 3KF8B 3MXPA 2MFIA 2W55A 2RHSB 2V4RA 4FS2A 1XMQQ 2HI0A 3MR6A 3SK4A 3M6ZA 1LUZA 3RUZA 4Q45A 1QUQB 4ILWA 1VQKA 2MNAA 1S0VA 9ICQA 1F2LA 1WCMG 2JN4A 2Y1IA 4FZNA 3OWEB 4KMUA 1RHPA 3C2MA 2A1JB 4P72A 1QNKA 4PQXA 5E4XA 3S1RH 1B9MA 1ESRA 1SJHD 4DF4A 1HZBA 3A56A 3ETLA 1UNSA 3MZ5A 3IAYA 1TS3A 3U9SA 2YTVA 4B9NA 4OX9L 1UE1A 3ZDDA 1WCMH 3D2QA 5LMNL 3SK8A 2E5LL 5KFNA 4RAUC 4I7ZC 1HZAA 5AM5A 3QR8A 4QW9A 2PYKA 5AKXA 3D3RA 4F4YA 2I5LX 1HCZA 4IC9A 4ECVA 1TQOA 1FEZA 1XNQQ 1K0SA 1AE2A 4KMOB 1ZQQA 1O80A 8ICWA 1S5DD 2DUYA 2DUDA 5C3EG 1KKXA 4L5TA 3VYUA 3S1NB 1U48A 4F2SA 4KTAA 3UXOA 1H9SA 1EY9A 3KBXA 3D6JA 3BQ0A 1RQNA 3E9IA 4RNNA 2ZUBA 2A1AA 5C3EH 4IR9A 3DUZA 5G5HA 5EPKA 3M7GA 2QB0A 2K05A 1A15A 5CJ7A 4K8IA 3M9MB 5HNKA 4J9LA 4EEKA 1P7DA 4EZ6A 5KFYA 8ICRA 1LTTD 2NN6I 1RDFA 2ZXPA 3NVVA 3FC4A 2PNRC 5CEHA 4J9PA 3SK6A 1OTCA 5EE1A 1NAPA 5EWGA 1I4RA 4LAAA 4POGA 5HY6A 3IM1A 4HCSA 5ELDA 4DFDA 4OXPA 1V43A 4B9SA 3U4ZA 2LM1A 2VJ4A 2Z4HA 4XYOA 2OH2A 4UATA 4MHVA 3I4MG 5ALHA 3PX6A 1VQEA 2JQOA 3KLRA 5DGBA 3FVQA 4L8JA 1J5EL 3MGVA 3HKZC 4BY7G 3KDFA 3HOUG 1PH6A 3EPIA 4DQSA 5ALIA 1SAPA 5IY0A 3TADC 5KFFA 3V72A 4R4TA 4YWLA 3WK4A 1T8EA 4KY5A 4ED1A 1RYUA 3T5HA 1KC8C 4BY7H 2LI6A 4B9VA 3TEHB 1C0AA 2LXJA 1LTID 3G4SA 3HOUH 8ICYA 3KKAA 3RAXA 1QTMA 2ZIXB 3RJGA 1HJPA 1UE7A 4JI2Q 1I94L 3PIOA 4Y2XA 4YD1A 4K0KQ 5J0TA 2IPKD 3M1YA 1KL9A 3RN2A 2ZJ8A 1JCKB 1NI3A 5J2HA 1X3FA 5T1GA 1JI7A 2VQFQ 4QZ8A 4OO1G 1SKSA 2BDNA 1LM0A 2BA0A 2XSCA 3T53B 3ULPA 2R7FA 3SR1A 2XY6A 4X3SA 3PR4A 3KTQA 3NVWA 5IIIA 1SKWA 1F44A 2JXMB 3EVQA 3HOVB 1VQ7A 2F0OA 3GTPH 1B4FA 4DFMA 4K5XA 2K8BB 1BCPB 2F0PA 4C8LA 2F0DA 2F3WA 2KBNA 3K1ZA 1B70B 4PH5A 1K3RA 4JV0A 1ZQEA 1KABA 1PMRA 4NW2A 2EVBA 1ECWA 3RJJA 5CV5A 4A3EB 2OQKA 5JPNC 2JGAA 3RLOA 3MFIA 4NLZA 3PIP3 3RN5A 4B3TQ 3GTGB 4DN4M 2EANA 4UQGA 3V6JA 4MTNA 4RQ0A 1PXUA 1OXTA 2KA7A 2F8KA 2AMCB 9ICRA 1OXXK 4O3SA 1TIID 2L9HA 4U68A 1G6ZA 4G3IA 2WAQB 4JI5Q 5AHXA 1EYDA 2NB0A 1MD2D 4IUPA 2EAPA 1SWWA 9ICKA 5B5EU 5AI5A 5D14A 2HBMA 4MIUA 1EY4A 5AK6A 4FBTA 3JAMi 1VCIA 3DWQA 4GXIA 1ENAA 1ML0D 1KAAA 2F3VA 3QJYA 5J2JA 2CW0C 3MXUA 5ALUA 2CH4W 1WWVA 3SK5A 5CGKA 1X3PA 4CRXA 7ICUA 2K75A 4R65A 4KX3A 5DBCA 7ICMA 2R8GA 2WV6D 3QYPA 2LYBA 2R61A 1EY6A 1TT2A 5GADC 5EBCA 2GLEA 2VL6A 4A3LH 1PRTC 3CP8A 2F1HA 1KSPA 1DM0B 4H13C 4JI3Q 4DFPA 5KFRA 1RIPA 1WCLA 2FLLA 2RDHA 2W9CB 5KG5A 4DNRB 1H9RA 1JE5A 2WAQE 4M9HA 7ICKA 4LFBL 5ALDA 4C8NA 3S1NH 5JEAJ 4LF6Q 4QWEA 4UY8C 3DWPA 5HR7A 3S16B 5ALTA 1WJJA 4JK1A 4M04A 1H9MA 1STNA 2M2LA 1MSGA 3ZD9A 5DLQE 2UUCQ 2EZYA 1IW7C 4H44C 1QLNA 1TAUA 4YN4A 4XIGS 2KTQA 2A8VA 1D5ZC 1X9WA 5LL6S 3Q8QB 1A3TA 3JPNA 4Y2SA 4O3MA 4B9UA 4CDGA 4NXNQ 5DQIA 1IYVA 5JU5A 4CNQA 4XRHA 1KDHA 4J9SA 2JA5B 1V1OA 3G6YA 1EQVA 2NVYB 1L1OA 1VMCA 2F0VA 4K6LA 5CA7A 4ECTA 4DLEA 1S5ED 1WVLA 4C3HG 4MFFA 1UA1A 3AFPA 1TS4A 1XTDA 4KKUA 4KY7A 3ZJYC 4ZH4A 4DV1Q 3NP8A 7ICHA 4OD0A 5C4HA 1BNPA 4LF7Q 2P5ZX 1W6JA 1EYAA 2YTXA 1FVIA 5AKZA 2V4QA 2BPCA 3I28A 1BO0A 2F2AB 4TUPA 5ALJA 4UBCA 4GC7A 1BUVT 7ICJA 4X6AH 1RG6A 5J8YC 1B43A 5AKJA 2FFKB 3I1YA 2D62A 3BYYB 1FL0A 3J80c 4DV2Q 4JB3A 1QH9A 2YTUA 5KFZA 3MA2B 4R8NA 1NK4A 3HOXB 3C21A 5JJIA 4GN3B 2WF8A 4XQQA 3WKDA 2EJFC 5LMUL 1WFQA 3NUQA 4R4IA 1X54A 1SXEA 4TSSA 3SDZA 3HOVG 1KW4A 3BQ2A 3LVWA 2F0GA 4TQUS 1QZGA 1SWVA 3NTHA 2D2CC 1GHKA 2H5XA 4QNLA 5AK3A 4IO9A 3CMAA 2AU0A 2BQRA 1RF2D 2JV3A 4A3MB 3HOVH 1U4RA 2JK8A 2J7ZA 3HZXA 5GAGC 4A3EG 1X9NA 3TREA 1H95A 2ESEA 3V2TA 2UXCQ 2KSOA 1TWAB 5ALFA 4PGXA 1U4BA 1AEXA 1CQFA 3H15A 3DEOA 4DV5Q 5ALVA 2DKXA 4RQNA 5HR6A 3VR6A 3IN5A 3KHHA 2FMCA 1YJNA 4X66Q 1FD7D 4DL5A 1GUGA 2WAQG 2UXBL 5FLXE 5HHHA 1JIHA 4A3EH 1VQPA 2KIWA 1LABA 2RRDA 1B3QA 3GTGH 1BPZA 3VR5A 3Q8KA 3CNHA 1SIJA 4MEXA 5AKKA 4XDXA 2D0PA 4M9LA 3IG8A 1SMXA 2CXYA 5HHIA 2VANA 3PSFA 3EUB2 7ICFA 1EEID 1EUJA 3AQQA 5EBDA 2X69A 1S77D 1TWCB 2HDLA 2Z4IA 4UASA 4O5CA 1CKOA 3HKSA 3L3OC 2K6AA 4JI6Q 4QIWC 1X42A 5J2KA 4YWKA 3A5UA 4YY3Q 4YG2A 4KHZA 1AP0A 1L0YB 5M3MB 4XUSA 3TADA 4UAYA 2SEBD 4OONA 3NPPA 3CMEA 2IL8A 2K8AA 2HHXA 1NJWA 1JOOA 2AGPA 3RZOB 1MJEA 2Q2TA 5DDMA 1JJ2A 1V38A 5AKYA 2QEJC 5F9NA 4BWJA 4PHAA 3MC0B 1BXTA 1K3BC 3HGBA 1MBYA 1UPHA 4IALA 5FLXc 2IT1A 5DG9A 2GWSA 1ZJMA 2ISPA 3TSSA 2PXIA 3S16H 1EOTA 5CYUA 1XPOA 2AHOB 4J03A 2ATWA 2I6XA 2W04A 4KHPQ 2I46A 4GKKL 5ISRA 4K5WA 1PH2A 1X2IA 1I4GA 1Y8PB 1UE6A 5F3XB 3PMFA 5T14A 4JI7Q 1NMGA 3AYHB 4DV3L 3RH5A 3CRLC 3IV6A 3FPUB 4RQ7A 1PH4A 4FVMA 1K8MA 3M7NA 2B8GA 2XWBB 4ECZA 3N4MB
chains in the Genus database with same CATH topology
1PYBA 1TXYA 4POFA 1JJGA 1ASYA 4LF9L 2JA5H 1Z47A 2NVQH 4HIDA 2JEBI 2NVYH 4BA2I 5BR8Q 4DUYQ 3PUWA 3NBHB 4JOIA 4DR7Q 1D8LA 4QQBX 1HNZQ 1O7IA 1K9MC 1VQIA 4IPCA 5EAYA 5M3FG 2JA8G 4TVAB 2PQAA 5J3BA 4DR5L 1SN8A 4A3IH 4C2MH 4DAYB 1VQGA 2NVXH 4NB3A 5H1SE 1CSPA 1VQMA 4JI4Q 3KJOA 1JMCA 2JEAI 1HZCA 3HOXG 1HR0L 3HFZB 2XGTA 1M1KC 4KHPL 4DR6L 2JA8H 3CAMA 2PI2E 2Y0SE 5IYBG 1VQ4A 2ASBA 1K83H 3Q8DA 3KF6A 3B6YA 1SLJA 4NPSA 4EX5A 1W3SA 1Q7YC 1IBKL 2PQAB 2AWOA 1YBYA 4JI7L 1UEBA 4AYBE 5GAEC 3HOXH 1Q1BA 1N36Q 3OTOL 1MIUA 3I55A 2CKZB 5IYBH 4A3MG 4JYAQ 4QIWE 4GNXA 4IFDG 1IBML 1U5KA 3MXNB 1HNXL 4DV0L 4R4CA 4DR2L 1U0LA 2F3IA 3KF6B 5JJLA 3ERSX 3NENA 3PV0A 3S1QH 4C3HH 5BR8L 4DUYL 4LW1A 1HR0W 1QVGA 4QJFA 5C0XI 4DR7L 3GDEA 3KYHC 4B3SQ 3W1BA 4A3MH 1HNZL 4JBMA 3BZKA 3J80i 3CCEA 1VQOA 1D7QA 4IPHA 4YCUA 2VY3A 4OWWB 1BBUA 3CD6A 1VQCA 1X55A 2MQHA 4GNXB 1KQSA 1W2BA 2CCZA 1TWAH 4B3RQ 4JI4L 4JI1Q 1PA6A 4LF4Q 4XTCS 2B29A 1QVFA 4A3JH 3F1ZA 5K36G 2BA1A 2K50A 1IXRA 4JCVE 3GD7A 2OWOA 4DR4Q 3I4OA 4NXMQ 4BY1G 2WFWA 2IX1A 4BBSG 5IWAQ 4L5SA 4GKJQ 1VQAA 1BKBA 1M90C 5C4XG 1TWCH 4A4IA 3CPWA 4DR1Q 2E2JH 3S1MH 5IYCG 2ZTEA 4YCWA 4LFAQ 2YV5A 3G71A 3M3YH 4JYAL 4YWMA 4IJHA 3J81i 3CF5A 2IX0A 3WWVA 1XJVA 3T1YQ 4DV4Q 2V1CC 4BY1H 4BBSH 4A3DG 5M3MH 1PFSA 3D0FA 1AE3A 3ER0A 3K80C 4DV7Q 1KIXA 2ZJRA 5IYCH 1Q81C 4JBJA 4B3SL 2JE6I 3RZOH 4GOPC 5FJ8G 1YHBA 1YEZA 3PSIA 4A3DH 4B3RL 5FLMH 1I50H 2NZHA 4HJ9A 3UE1A 1A63A 1H95A 4UP8A 4RMFA 4JI1L 1GKHA 3K81C 1VQJA 4LUOA 4JI8Q 1CKMA 2VS1A 1OXVA 2HQLA 3STBC 3PIPA 3KJPA 1YIJA 1YITA 2QGQA 4LF4L 4YHHQ 3I4NG 2IHEA 1TWGH 3ICEA 1DGSA 2B3GA 4DR3L 1CKNA 4DR4L 2OQ0A 3CCMA 4NXML 5IWAL 4ALPA 4GKJL 3JC66 2IY5B 3OYYA 1VQLA 3K7UC 1BBWA 4DR1L 2F4VQ 3M4PA 3I4NH 3PO2G 4LFAL 2VNUD 3FKIG 3T1YL 4DV4L 2AWNA 3M4OH 3NELA 3GTOH 4A3GG 4BBRH 1TWHH 2ZTCA 1N34Q 1CKNB 1SE8A 3T1HQ 1VQFA 3E0EA 4DV7L 1Q12A 4AQYL 2E2IH 1G51A 1EQQA 1MKHA 3PO2H 1UE5A 2FXQA 2ID0A 4OX9Q 3L0OA 5AJ3Q 3FKIH 3UDXA 2K14A 4GOPA 4QY7A 5LMNQ 2E2HH 2E5LQ 2QA4A 3TS2A 4A3GH 3CCJA 1N9WA 3I2ZA 2HHHQ 1XMOL 4QL5A 4JI8L 4JI2L 3F8TA 3L2PA 1QUQA 3PUVA 1GVPA 2NN6G 4YHHL 4C3JH 2N49A 3DLLA 3U58A 1IBMQ 1VQNA 2K5VA 3PCOB 3JAMc 3RLFA 3CCVA 3ULLA 3OW2A 2D0OA 2KENA 4DR2Q 4A3LG 1I5FA 1S3OA 2KCMA 3SGIA 4GOPB 1YHQA 1Y14B 3K0XA 4HIOA 1S40A 3KF8B 5GROA 2MFIA 1E1TA 2RHSB 4DNIA 1VS0A 5GAHC 4QGUA 1B7YB 1E3PA 3W1GA 1XMQQ 3S24A 4H02A 2UUBQ 1FGUA 1LUZA 2I5MX 2F4VL 3CC7A 4AH6A 1QUQB 1VQKA 1KXLA 2MNAA 3F2DA 1WCMG 3GTKH 4UPAA 1N34L 1V1QA 4P72A 3S1RH 1A8VA 3T1HL 4HJ5A 4LFCQ 1QVCA 3U4VA 4APVA 1Q82C 1HZBA 5M3FH 2CWPA 2YTVA 2HIXA 4X65Q 1UE1A 2E8GA 4PZ7A 5AJ3L 1K8GA 4OX9L 1WCMH 5C4JH 2E5LL 5LMNL 3TQYA 1PH1A 3TRZA 2HIVA 1IZ6A 1VQ9A 3CC2A 3CCSA 1VQBA 1HZAA 2HHHL 1EOVA 4GN4B 4IPDA 1Y1VG 1KRTA 2I5LX 1EIYB 4HJ7A 4BXXG 1XNQQ 1AE2A 4IJLA 2NVTH 4HIMA 5C3EG 2DUDA 1J5EQ 2YTYA 2R7ZG 3J7A5 2Q2IA 2GN5A 4L5TA 1Y1VH 4GLAC 4HIKA 1XMQL 3CCQA 3H3VI 4BXXH 2UUBL 1NTGA 2Q2HA 3E9IA 1GD7A 3F2CA 2A1AA 5C3EH 1SR3A 4OWTB 5LMNW 2R7ZH 2UXDQ 1VQ5A 2A19A 3S2DH 5GQOA 4LFCL 3BJUA 1I94Q 1NMFA 1L0WA 3M4QA 2NN6I 1V9PA 4GN5A 4X65L 1TWFH 4YCVA 1OTCA 3E9HA 3G6EA 3PF5A 1Y1WG 4DR3Q 4POGA 5HY6A 1XPRA 4OXPA 1V43A 3AFQA 3U4ZA 1PVOA 2CFMA 3EIVA 4LF5Q 4DAMA 4HJAA 1GO3E 2RF4A 1XNQL 3I4MG 1WI5A 2XTIA 1VQEA 2JQOA 3CQZH 1Y1WH 1J5EL 4BY7G 1YJWA 4MZ9A 1ASZA 3KDFA 3UDIA 3HOUG 1YI2A 5C4XH 1PH6A 1IYJB 2LXKA 3FHWA 3RNUA 2VUMG 1P16A 5IY0A 4AQYQ 4YWLA 4R4TA 1CSQA 2CQOA 2IHFA 1E1OA 4J15A 1KC8C 4BY7H 2Z0SA 2UXDL 1WYDA 3TEHB 1C0AA 1A62A 4WJ3M 2LXJA 3G4SA 2ZM6Q 4JBKA 4X64Q 3HOUH 4JI2Q 2VUMH 1HJPA 1UE7A 3KDFB 2OCEA 1EWIA 3RR5A 3CPFA 1I94L 3PIOA 2UUAQ 2CWAA 2F52A 4K0KQ 3RN2A 1KL9A 1FJGL 5FJ8H 2RHQB 4Y52H 1KAWA 1X3FA 2VQFQ 1JB7A 4OO1G 1LM0A 2BA0A 3ULPA 3CCLA 2R7FA 1R9TH 1WOCA 1YHAA 4OWXB 4LF5L 4DPGA 5IYDG 1Q86C 4A3BG 1VQ7A 3DM3A 4GLXA 3BZCA 3GTPH 1N8RC 3ULJA 2BH2A 4P74A 1VQDA 4DK3C 3NEMA 2L15A 2KBNA 5M5XH 5IP7G 2N8NA 3BU2A 1B70B 1X3GA 1YZ6A 4UP7A 5IYDH 1K3RA 4R1JA 1GM5A 4LFBQ 1KHIA 4A3BH 3LGJA 1G291 2OQKA 5IE8A 1QZHA 2ZJQA 2MO1A 3RLOA 4A93G 3RN5A 1OXSC 4B3TQ 3S14H 1RL2A 5IP7H 4JOIC 2N78A 1HH2P 4KLKA 4MTNA 1VQ6A 4GS3A 2ZM6L 1YVCA 4X64L 3HOZG 1OXTA 2B63G 2AMCB 3H3VH 1OXXK 1EIFA 3RLNA 2HT1A 1X56A 4JI5Q 3W5OA 2UUAL 4LF8Q 1E22A 3A0JA 4DV6Q 4K0KL 4P75A 4EQ5A 4A93H 3JAMi 1PV4A 1SROA 2VQFL 5ELOA 1VCIA 2R93G 1PH8A 3FP9A 2B63H 2ZJPA 2WB1E 2PNHA 2K75A 1L1OC 2C35B 2YYZA 1K73C 2ES2A 3AEVA 2JA5G 5GADC 4WJ4A 2MO0A 2VL6A 1XNRQ 2ZTDA 4A3LH 2JJQA 2KCTA 2LSSA 4O0AA 4X62Q 2R93H 3CW2C 4JI3Q 3RZDH 1RIPA 2NZOA 1I3QH 3HOWG 1JE5A 2WAQE 2KHJA 2VZAA 4LFBL 4R4OA 1PYSB 3S1NH 2QEXA 3S2HH 5JEAJ 1NJIC 4LF6Q 2Z6KC 4UY8C 2EIFA 4A3FG 1WJJA 1A0IA 2EXDA 1PH5A 4JV5Q 1N32Q 4B3TL 4R4QA 4OO1I 5DLQE 2UUCQ 1X65A 4JI0Q 3F2BA 3GTMH 1SFOH 1K8AC 3HOWH 3H0GG 3CCUA 1VQHA 4XIGS 2A8VA 2KHIA 4JI5L 4LF8L 4DV6L 1HNWQ 5C0XJ 1JJCB 1HZ9A 2K4KA 1OXUA 3I7FA 4A3FH 5LMUQ 2PMZE 3TS0A 4NXNQ 1Q8KA 1X3EA 4UP9A 3CXCA 4BA1I 4DUZQ 4A75A 3HOYG 3H0GH 4KI0A 4LUVA 4GLVB 2I5HA 4PMWA 3EBEA 4L5RC 4DKAC 1L1OA 3UE0A 2EQSA 4B3MQ 1CUKA 4LWCA 4A3KG 1IBLQ 1XNRL 4X62L 3HOYH 5ELNA 1C9OA 4L5QA 3AFPA 1KRSA 1XTDA 4JI3L 3ZJYC 1XMOQ 1AH9A 2K5NA 4DV1Q 1G6PA 3KOJA 4IOAA 3IRBA 4LF7Q 4MNOA 2YTXA 1FVIA 2UU9Q 4LF6L 1FJGQ 2Z6KA 1PH7A 4HJ8A 3CP0A 1YZ7A 4A3KH 1N32L 4JV5L 2UXBQ 1L1OB 4A76A 4X6AH 1YNXA 2UUCL 2R6GA 3S17H 2K5HA 4JI0L 1X6OA 1SRUA 1MJCA 2D62A 1FL0A 3J80c 3PUXA 4DK6C 4DV2Q 4A3JG 5JJIA 1L2FA 4RG1A 1HNWL 4GN3B 3GTJH 1N33Q 4O2DA 5LMUL 3HOVG 1WFQA 4R4IA 3PGZA 1X54A 4NXNL 4DUZL 1E24A 2AKWB 4TQUS 1LYLA 1NE3A 1QZGA 3PO3G 1NBWA 2H5XA 1KD1C 2Q2UA 1XPUA 4IO9A 3I4MH 3CMAA 3U50C 2WB1G 5M3MG 4B3ML 1IBLL 3HOVH 1BVSA 2GVAA 2JK8A 5GAGC 3J7ZC 4A3EG 1J6QA 3TREA 1X9NA 1N36L 2YU9H 4LNQA 3EN2A 3UDFA 3M85A 4IFDJ 1E7ZA 4IPGA 2UXCQ 5JJKA 4DV1L 5C44G 3A74A 1P8LA 3PO3H 4LF7L 3J81c 3H15A 1PH3A 3K8AA 5E7NA 5M5WH 3HKZG 4DV5Q 2UU9L 4FDBA 5FLMG 3M9BA 1YJNA 4X66Q 2WAQG 3STBD 1VQ8A 4A3CG 2UXBL 4A3EH 1VQPA 3PUZA 3D31A 4P71A 3GTGH 2VW9A 4JBWA 2DGYA 2WP8J 5C44H 2D0PA 3KFUA 4GKKQ 4PG3A 1SMXA 2N3SA 3CCRA 4DV2L 1Q46A 3GTLH 3AQQA 1EUJA 4PZ8A 1JT8A 4JG2A 1PHJA 1CKOA 3HKSA 1N33L 4A3CH 4DV3Q 1EYGA 2GVBA 4JI6Q 1I6HH 4YWKA 3A5UA 4YY3Q 5M5YH 4KHZA 2VQEQ 1B8AA 1NY4A 4ME3A 4IFDI 4JC0A 2RCNA 4OONA