1Q46A

Crystal structure of the eif2 alpha subunit from saccharomyces cerevisia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
b'TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords translation initiation factor 2 alpha subunit
publication title The crystal structure of the N-terminal region of the alpha subunit of translation initiation factor 2 (eIF2alpha) from Saccharomyces cerevisiae provides a view of the loop containing serine 51, the target of the eIF2alpha-specific kinases.
pubmed doi rcsb
molecule tags Translation
total genus 54
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1q46A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q46A01
1N36Q 1BVSA 1Y14B 4A3KH 2WB1E 1VQ5A 1XNRQ 1VQGA 2VQFL 1K83H 2UXCQ 4DV2Q 1MJCA 2R6GA 4BBRH 2PI2A 4C3HH 4P75A 1GM5A 2A1AA 2KCMA 4X62L 1VQOA 1X54A 4LF5L 2K52A 3M4PA 4GKJQ 2K5VA 4AYBE 1I50H 1WCMH 4QGUA 4LF4Q 4LFAL 1YHBA 3NBHB 4QJFA 4WJ4A 3S1NH 2C35B 4A3BG 3RN5A 1X3FA 4OO1I 4LFBQ 2PQAA 1PH8A 2MO1A 3RLFA 1XPUA 4DR3L 2KBNA 4DPGA 4KHZA 4PZ7A 4OX9Q 3GD7A 4KHPL 2QGQA 3J80i 5BR8L 3G6EA 1SN8A 4YHHL 1PA6A 4POGA 1SE8A 3NELA 4QIWE 2CFMA 2ZM6L 4HJ7A 4A3EH 1K9MC 4DV1Q 4A3LG 4JI3L 1GD7A 1EIFA 4ME3A 2IX0A 3CPFA 4X64Q 4YCWA 2OTJA 4UPAA 3HOWG 3F2DA 1I94Q 5IYBH 1W3SA 1X55A 2Q2IA 3ER0A 5FLMH 1XPRA 1C7YA 5LMNL 4B3RQ 1HNZL 1N34L 5C3EH 3EBEA 3TS0A 4MNOA 3T1HL 4P72A 1VQ7A 3AFPA 1KQSA 3J7A5 1MKHA 3AYHB 5IP9G 4HIMA 4GOPB 1J5EL 3BZCA 4Y52H 2MFIA 5FJ8H 3S1RH 5IYCG 3CCMA 2ZJRA 5IT9c 2HHHQ 3GTQH 1PVOA 3HKZG 4JI6Q 1VQAA 2YV5A 2CWAA 1XMOL 3NENA 2YYZA 4DUYQ 3CCLA 2JA8G 3PIPA 1HNWQ 1QUQB 1PH4A 4LF7Q 1CUKA 3I4MH 2LSSA 4DR6L 4A3IG 4DV5Q 1N9WA 4UP7A 3HOYH 3L0OA 1NTGA 2VQEL 1IBKQ 2K50A 1NMGA 4DR5L 4BXXG 3A0JA 4DR7Q 2JA6G 5C0XJ 2DGYA 4X6AH 2KENA 1YIJA 1VQ9A 2A19A 3JC66 3S14H 4DR4L 2F4VQ 1P16A 3PUYA 4BY1G 3ZJYC 3HKZE 1QVGA 4GN5A 1UE1A 4DV0Q 1RL2A 4X65L 3I4NH 1VS0A 1YJ9A 2R93H 1TWCH 3OW2A 3E9HA 1LYLA 1CKMA 4QL5A 4R4QA 3CMEA 3U4ZA 3RN2A 1IBML 1J6QA 4PG3A 4R4OA 3WWVA 4Y7NH 3B6YA 1OXUA 3KF8B 3H3VH 1PH9A 1L2FA 4DV7L 1PYSB 1OXXK 4GS3A 1QVFA 1VQKA 4NXMQ 2V1CC 2IX1A 4OO1G 2Y0SG 1IBLQ 3GTGH 3RLOA 2MO0A 3J7ZC 5H1SE 3AFQA 4GN4B 5M5WH 1C9OA 1TWFH 1MIUA 1Q86C 1EQRA 3U50C 1PFSA 1CSQA 1Z9FA 3U4VA 4B3SQ 1YITA 4L5RC 3STBD 1A62A 1VCIA 1FJGQ 1QVCA 2I5LX 2VW9A 2YU9H 1C0AA 1CSPA 1GO3E 1Y1VG 1EIYB 1S40A 1HNXQ 2I0QA 1VQBA 3S1QH 1B8AA 2B63G 2KHJA 4JC0A 4R4IA 3F2BA 4A3LH 4IFDJ 4LFCQ 4LF9L 1YBYA 2Y0SE 4A3JG 1I3QH 3ULPA 4DAYB 2RCNA 4FDBA 4DV4Q 3AQQA 3HOWH 5GAEC 4MTNA 4X66Q 4JI8Q 1JJ2A 1VQMA 2D0OA 3NEMA 1JJCB 2L15A 1WJJA 1OTCA 1QUQA 4OWWB 3TRZA 1IZ6A 4POFA 1N36L 1K8GA 2VL6A 5IP9H 1XNRL 4GOPC 4GNXB 3KLWA 4YCUA 1HR0Q 3CQZH 4DV2L 2UXCL 4P73A 5IYCH 3K8AA 3KFUA 5M3FG 1S72A 2F52A 2JJQA 4WJ3M 1X65A 3J81i 2LXKA 4IFDI 4GKJL 3EN2A 2JA8H 4C2MH 3S1MH 2OCEA 4LF4L 2K14A 5IYDG 2ZJQA 3HOVH 3GO5A 5LMUQ 1DGSA 1Q12A 4A3IH 4A93G 4DK3C 3PO2G 2Q2HA 3L2PA 4LFBL 1D8LA 2IY5B 2HIXA 2K4KA 4IOCA 3PUVA 1HZBA 2UUBQ 4OX9L 2JA6H 5C4JH 2UU9Q 3GTOH 4DK6C 1KIXA 2UXDL 2NVXH 2NVTH 2Q2UA 4A4IA 3OYYA 1U0LA 1Q46A 4DV1L 4TVAB 3RZDH 1M90C 4BY1H 3CCQA 3CF5A 2R92G 5JJIA 3I2ZA 5C44G 1JJGA 3PUZA 2OTLA 4NXNQ 3FHWA 2WFWA 5C0XG 1KRTA 1I94L 2R7DA 4JBMA 4B3RL 3S24A 1AH9A 3KF6B 4JI2Q 4DR2L 1A63A 2NN6G 1HH2P 2UXBQ 4AQYQ 3HOZH 1G51A 2RF4A 1E1TA 1B70B 2HHHL 1E3PA 1PH2A 4JI6L 1XMQL 1XNQQ 3UDIA 1UE5A 5JEAJ 4A76A 1X3GA 3A5ZB 1GVPA 4DUYL 1EUJA 1PHJA 3PO3G 3H0GG 5ELOA 2JA7G 1KRSA 4LF7L 2JK8A 4LF8Q 1HNWL 4LNQA 4HIOA 4OXPA 4DV5L 3S16H 1YI2A 1IBKL 4DR7L 1VQDA 2R7ZG 4GN3B 3BU2A 2NVQH 3G71A 1ASYA 4JBJA 4DR1Q 1UE7A 3CC2A 4JYAQ 3J81j 1BKBA 3E9IA 3F1ZA 2B63H 5M5YH 2F4VL 2IHEA 2ATWA 2OWOA 4A3FG 3I7FA 1PV4A 1KAWA 2BA0A 4C3IH 1P8LA 3CP0A 4GNXA 4A3JH 1PH1A 1K8AC 3CAMA 1VQEA 3TEHB 4DV0L 1A8VA 4UP8A 1X6OA 1CKNB 2Z6KC 3TREA 3UE0A 4C3JH 1VQNA 4MZ9A 2BH2A 1Y1WG 5EAYA 5BR8Q 1YVCA 4JOIC 4IFDG 1EWIA 1Z47A 3GTMH 1BBUA 4P71A 4JI3Q 4JI1Q 2I5HA 3K7UC 2CCZA 2HT1A 4GNXC 4NXML 2D62A 5DLQE 1YEZA 3SGIA 1NY4A 4YY3Q 5IWAQ 3JAMc 1Q1BA 3KDFB 1ASZA 1HZ9A 3CC7A 1TWAH 3PIOA 4JI5Q 4A75A 1O7IA 5HY6A 3GDEA 3HOXG 2E2HH 5GROA 4B3SL 1XJVA 4BA2I 2EIFA 4LF6Q 5IYDH 4AIMA 1N32Q 1D7QA 2BA1A 4HIDA 1FJGL 1L1OB 4A93H 3PO2H 3MXNB 1FGUA 1E7ZA 2DUDA 2I5MX 2N3SA 2YTXA 3STBC 4K0KQ 5ELNA 1HNXL 5GQOA 1YHAA 5JJKA 3MEFA 3PCOB 4LFCL 1UE6A 2R92H 5J3BA 4DUZQ 5C44H 3KOJA 3CCSA 4DV4L 3I56A 1YNXA 1E24A 4BBSG 2VQEQ 4A3BH 4X66L 1SMXA 2PMZE 4JV5Q 3PUWA 3HOUG 3S17H 4KLKA 4LUZA 4JI0L 1FL0A 3F8TA 4IOAA 5IE8A 1VQ8A 2CKZB 3DLLA 2VZAA 3UDGA 1WI5A 4GOPA 4APVA 5M3MG 1HR0L 4QQBX 3ULLA 2PQAB 2ALYB 4O2DA 3OTOQ 1CKOA 5IYBG 1G6PA 2BH8A 3RLNA 1MJEA 3CCJA 3I55A 1TXYA 5C3EG 4DV3Q 4H02A 2VNUD 4DAMA 2UXDQ 2OQKA 3PO3H 2JA7H 2JQOA 2MNAA 2UUAQ 4LW1A 5IP7G 4B3TQ 1G291 4RMFA 4DV6Q 2QEXA 1RIPA 4R4CA 3J81c 4L5QA 1X3EA 4GLXA 3BJUA 5JEAG 2N49A 4IO9A 2UUBL 1LTLA 5AJ3Q 2UU9L 2AHOB 3K80C 5GAHC 4HJ8A 2ES2A 2AKWB 2AMCB 4HJAA 1V1QA 2UUCQ 1Q8KA 3PGZA 1SRUA 3W1BA 4A3FH 1EYGA 4R1JA 4TQUS 3S15H 2GVAA 3M4OH 1OXTA 4NXNL 4EX5A 1HJPA 2NZOA 1NE3A 3UE1A 4A3CG 4R4TA 3CCVA 3D0FA 4LWCA 4BXXH 1Y1WH 1KC8C 4UY8C 4IPHA 1NMFA 1FVIA 4JI2L 1AE2A 1YZ7A 3A5UA 1OXSC 3PV0A 2UXBL 3PF4A 3HFZB 3CW2C 1L1OA 1VQLA 2YTVA 1UEBA 4BA1I 2N8NA 4X64L 2EQSA 4JG2A 3G4SA 1XNQL 1KHIA 3J80c 3CCRA 4JBWA 2KCTA 2NVYH 4B3MQ 1AE3A 2E5LQ 4LUOA 4LF8L 3HOXH 2JA5G 3T1YQ 4JBKA 4L5SA 2ZTCA 1N8RC 3S2DH 1L1OC 2XGTA 2WP8J 2HIVA 1NJIC 4JI7Q 3TS2A 3GTPH 4DR1L 4JI4Q 4GKKQ 1N33Q 2KHIA 1KD1C 2VUMG 4JYAL 5K36G 2E2IH 1EFWA 3GTLH 2WAQG 1JMCA 1QZHA 4IJHA 1WYDA 1L0WA 2PNHA 3PF5A 2AWOA 5M5XH 2VQFQ 3M4QA 4XIGS 4BBSH 4BY7G 5GADC 2Z6KA 1PH3A 1KXLA 2H5XA 1SFOH 1JE5A 4JOIA 4X62Q 2OQ0A 3HOUH 1Y1VH 4A3MG 4LF5Q 3G48A 2ZTEA 3K0XA 4JI1L 3PUXA 1GKHA 1K73C 4O0AA 4LFAQ 3DM3A 1B7YB 1U5KA 4YWKA 5M3MH 2K5NA 3RNUA 4YY3L 1YJWA 5E7NA 3Q8DA 5IWAL 3M3YH 5C4XG 4A3GG 2RHQB 2WAQE 2B29A 4L5TA 4DR3Q 4XTCS 1H95A 3CCEA 1XTDA 3HKSA 4JI5L 3W5OA 4HJ9A 1IL2A 3RR5A 3M9BA 1HZAA 4KHPQ 4OONA 4DR2Q 4YHHQ 2IT1A 4JCVE 4LF6L 2ZM6Q 1N32L 5JJLA 5IP7H 3CD6A 3CMAA 2MQHA 3D31A 1LUZA 1YZ6A 2LXJA 2AWNA 2PI2E 3I4OA 5HGQA 1XMQQ 3ERSX 4GLAC 4K0KL 1IBLL 4YCVA 3KJOA 2ZJPA 5M3FH 4HJ5A 4YWMA 2K75A 4RG1A 3E0EA 4DNIA 4EQ5A 3FKIG 1X56A 5LMNQ 1PH6A 1N34Q 1HNZQ 1T9HA 2E2JH 3T1HQ 2E8GA 1VQFA 2ID0A 3L7ZC 5LMNW 4DUZL 1TWHH 3HOVG 3S2HH 3EIVA 4A3KG 1JB7A 3CXCA 3M7NA 1I5FA 2XTIA 4PMWA 1J5EQ 1VQPA 4BBRG 4JV5L 1HZCA 3KYHC 4A3CH 3K81C 1M1KC 1PH5A 4KI0A 2JA9A 2K5HA 4NB3A 3KF6A 1S3OA 1XMOQ 1BBWA 4PZ6A 1WCMG 3H3VI 2ZTDA 2GN5A 3BZKA 4YWLA 1R9TH 4LUVA 4DR6Q 3OTOL 1SLJA 3IRBA 1YHQA 3CC4A 4IJLA 3ULJA 2A8VA 4DR5Q 4DV3L 4JI8L 2N78A 3JAMi 4DKAC 1JT8A 1A0IA 3RZOH 1K3RA 3CCUA 4A3EG 3HOZG 2UUAL 4B3TL 3ICEA 4DR4Q 2JEAI 2JA5H 5C0XI 1V9PA 4DV6L 1YJNA 1Q7YC 2GVBA 1Q81C 4IPDA 4X65Q 3W1GA 5AJ3L 2CQOA 5FLMG 4IPGA 4HIKA 2VUMH 1WOCA 2NN6I 2B3GA 3K7AH 3PSIA 1EQQA 1IBMQ 2UUCL 3M85A 3H0GH 4OWXB 1E22A 5LMUL 3UDXA 2CWPA 1NBWA 5FJ8G 4DV7Q 1V43A 1LM0A 3GTJH 4AH6A 4BY7H 1CKNA 1IYJB 5FLXc 2R7ZH 1PYBA 1SR3A 1SROA 5GAGC 3KJPA 2R7FA 3CPWA 2JE6I 4PZ8A 4OWTB 1OXVA 4P74A 1E1OA 4J15A 3TQYA 5IY0A 4A3MH 4IPCA 1EOVA 3I4MG 1Q1EA 1VQ4A 5C4XH 3UDFA 3HOYG 3FP9A 1KL9A 2FXQA 4QY7A 4UP9A 3F2CA 4A3GH 2EXDA 2WB1G 3KDFA 4B3ML 4JI0Q 1VQIA 2E5LL 1X9NA 1UWVA 2RHSB 2QA4A 2JEBI 2F3IA 1WFQA 3VDYA 1Q82C 1XPOA 1PH7A 2VS1A 1VQJA 3T1YL 2Q2TA 1I6HH 4LF9Q 4AQYL 4ALPA 2Z0SA 1VQHA 1QZGA 1VQCA 4GLVB 4AYBG 3I4NG 4JI7L 1HR0W 1TWGH 4JI4L 4GKKL 2R93G 3AEVA 2ASBA 2YTYA 3LGJA 1N33L 2NZHA 3H15A 2VY3A 1W2BA 1VQ6A 3GTKH 2IHFA 4A3DG 2D0PA 3U58A 1K0RA 2HQLA 4A3DH 3FKIH 3A74A 4NPSA 1IXRA
chains in the Genus database with same CATH superfamily
2W8KA 1EEFD 1B9MA 1HTPA 1JQYD 3M1YA 1STEA 1N36Q 3UQ0A 3N97B 2E2IB 5AKXA 4PMCA 3GTLB 2XCAA 3KOOA 1K83H 2UXCQ 4BBRH 3SV3A 2R6GA 1ZRNA 3VA5A 3WDNA 1AP0A 4P75A 1GM5A 4R63A 1ZQKA 1C4QA 5IGDA 1VMCA 2HCFA 4OJ5A 1PUZA 4TRDA 1SWVA 1WTRA 1NZBA 3M4PA 2K5VA 3PQIA 5EWGA 3VR6A 4AYBE 4LF4Q 4LFAL 1H9MA 2PNRC 4RQ2A 3PR5B 3S1NH 1PK3A 2KOLA 3VYRA 4LFBQ 2PQAA 3RLFA 2RSOA 4DR3L 3BS7A 1ZQSA 3RUZA 3CKIB 1K5OA 4OX9Q 2IWHA 5M3MB 2QGQA 5BR8L 3G6EA 4YHHL 5JVH3 1SE8A 4QIWE 2ZM6L 3BYYB 4A3LG 1RD9D 1UA0A 4MHVA 1X66A 2UVUA 2IX0A 2BPCA 5K4LA 4XYQA 2OTJA 1DRGA 1O78A 5AI5A 3F2DA 3HOWG 2B6GA 3NGDA 3V96A 9ICCA 9ICOA 2OEOA 4LMQD 1W3SA 2Q2IA 2LBOA 3ISBA 5FLMH 4Y2UA 5C3EH 4F2RA 5DB8A 2WHEA 3NVYA 3J7A5 1MKHA 2HOQA 4NDXA 4GOPB 2F3NA 1PFBA 2IMWP 1D5MC 2E2JB 5IT9c 2KKPA 4Y2SA 1K1SA 3HKZG 2PFQA 2YV5A 2ZIWB 1S4ZA 3RB3A 1SYCA 1HQMC 2CWAA 5T1IA 5G3LF 4F8MA 3CCLA 3ZYYX 2EDUA 3PIPA 4DLGA 1PH4A 4DR6L 5KG4A 5AKZA 5HMLA 2C2EA 5KFBA 4QWCA 3PO5A 2GH1A 1EYCA 4XQNA 2HI0A 2R3ZA 1SXTA 1EY7A 1NMGA 3QUTA 3MGVA 1MQ3A 2K50A 3D2QA 1VQ9A 2KSOA 3Q8PB 2ZUCA 3JC66 3S14H 2CW0D 1EY5A 2C2RA 2F4VQ 5AK6A 5CC4A 1XO1A 1SYGA 4F71A 3HKZE 4FF4A 3KKAA 4NLKA 5K5PA 1IKMA 5AKKA 2C5CA 4DV0Q 1RL2A 4X65L 9ICXA 2X69A 1LV5A 1LYLA 1CKMA 4QL5A 3U4ZA 1Z3EB 1LACA 1QJOA 2KHQA 1QB5D 5EGTA 2NV3A 1L2FA 1KFTA 1NK7A 1OXXK 1QVFA 3DUZA 4NXMQ 2WB1F 4G7OC 5KG2A 1NK4A 3RLOA 4WJWA 2ATLA 3AFQA 1J97A 1MHWC 3LDAA 2BQUA 2H1EA 9ICHA 1Q86C 1TS5A 2B8GA 4KK7A 4RZRA 2JZBB 5KRUA 2WKCA 4L5RC 4J9LA 8ICEA 1V8QA 4HSPA 3VR2A 3WOFA 3STBD 1A62A 1VCIA 2JGAA 4B6JA 4DAVA 1FJGQ 4ZCKA 1QVCA 2I5LX 3RMHA 2YU9H 1NNXA 3RJGA 2DF4B 4BX9C 5KFDA 4ED0A 2Y1IA 1CSPA 1Y1VG 3S1QH 1VQBA 3TAQA 4NLZA 1F77A 2F76X 3KBGA 2ZXPA 4R4IA 4YMMA 2ZIUB 4LF9L 4A3JG 3ORYA 4DAYB 1LT3D 2A3VA 5G5GA 4QZIA 3UXNA 4FDBA 5B66U 1X40A 4MTNA 1UHUA 2JRZA 1ZQAA 3RBDA 3TP7A 1IKLA 2D0OA 4H13C 3SK6A 2R8HA 1QUQA 4Z6CA 3TRZA 1FIQA 1SAPA 3D2SA 4POFA 3G6XA 4RUAA 5IP9H 2G07A 2XY7A 1CM9A 1YT3A 4YCUA 1HR0Q 4JV2A 2F0GA 3NE5B 4DV2L 3FKIB 5ALYA 3K8AA 5C4ZA 5J29A 2PMZB 2C2DA 3P75A 2JJQA 1S72A 4WJ3M 1TU2B 3AQEA 2KFZA 2PYKA 3BYTB 1K83B 2JA8H 4C2MH 4BBRB 2ZJQA 1FGBD 5C6AA 1VDVA 1ZJNA 1DGSA 2KEYA 4A3IH 2YX8A 2Q2HA 3D6CA 4RQ8A 1SNDA 3QX7A 4IOCA 2QB0A 1LTRD 2VJ5A 3TI0A 8ICHA 1CHQD 1HZBA 2P35A 4B9MA 2EOTA 3S1NB 3AL0B 5CV8A 1SKWA 4GXIA 3NTHA 1U0LA 1EWHA 5JJIA 4BY1H 5CR0A 3CF5A 3B9JA 1PRTF 3CP8A 5AM2A 2WFWA 1RYUA 3KK7A 2EZZA 3HOZB 1XSNA 2R7DA 4I28A 4NL9C 1WUDA 4B9XA 1R4PB 5JU5A 3V6HA 4B9SA 4F5PA 2OEHA 4DR2L 4QMGA 1IIPA 2KMDA 3VYUA 1DXSA 2OH2A 1S77D 5ALUA 3SDZA 1KDAA 4FF2A 2WAQC 4I2FA 2KNJA 4BUGA 3J81L 4X5VA 3A5ZB 2XNAC 3H0GG 2F2AB 1R4QB 4LF7L 1N48A 2JK8A 4TQRA 1MSWD 1HNWL 1X3PA 4DV5L 1E2VA 2A1JB 3O0FA 4DR7L 3NUQA 1QSYA 4QWAA 4GN3B 2NVQH 5ALFA 5L1LA 1ZD3A 4ED1A 3J81j 4EZ9A 1BKBA 3E9IA 5EQ0A 3T5LA 2B63H 3RR7A 4C7YA 3RJKA 1PH1A 1P8LA 3E0FA 2Y0SF 3S14B 2XIDA 4I2IA 2OHFA 5J0PA 4DS4A 1DOQA 7ICKA 2MUYA 2RBMA 3BQ0A 4UP8A 3TREA 2BH2A 3UI2A 9ICQA 3OWFA 1G91A 1PZNA 2G08A 4Y2PA 4XUSA 4JI1Q 1BGXT 1T3QA 3K7UC 3QNMA 1A3UA 3W3AA 5EBCA 4DF8A 4GNXC 1SZHA 4ZAIA 2HT1A 3M6ZA 3A8KE 2EQYA 1B44D 2BDNA 4V0BA 5J2IA 1QCKA 1SKRA 4HTHA 2XVTA 3JAMc 3KDFB 2DJFC 4ECWA 1PRTD 3HOXG 4ULLA 1DXMA 4Y2XA 5AICA 2K6AA 3BS5B 2E2HH 2EIFA 3I3CA 4M1UB 4M8AA 4LF6Q 2PFOA 4A93H 2P6RA 3WK9A 2DUDA 2N3SA 3CHBD 5ALXA 2KZ3A 2E76C 1N60A 5I9OA 5GQOA 2EXZA 5KNDA 2DBYA 2EYHA 2KJ5A 3MEFA 3GDXA 3RD4A 1MGSA 2YU9B 4O3RA 2F3WA 3TQ1A 3JPQA 1SNCA 4J9OA 2F8LA 3N7SC 1ZYRC 3KOJA 3CCSA 3C2LA 5C0XH 3SK4A 2R8KA 4JV5Q 4YG2A 5ALQA 3HW8A 2DUYA 3S17H 3F8TA 5BPCA 2MPMA 5EBDA 4EYHB 3DEEA 3L4PA 3A54A 1D7QA 2K7VA 1MSHA 1WTPA 1WI5A 5FLXE 3PX6A 1Z4OA 3UM9A 2HHWA 5M3MG 1BNZA 4FZMA 2H3QA 1E2ZA 4DL7A 2X6GA 1X9WA 4KLUA 3ND9A 3CCJA 4H02A 5KFZA 4F5OA 1ZQRA 1JCKB 1TS3A 2V9WA 2ZXIA 3ZI4A 2MNAA 5IP7G 1SB3C 3MXGA 4HAIA 1G291 4RMFA 1RIPA 1RM6C 7ICJA 1YNJD 3J81c 4GLXA 4NLNA 1COKA 1X3EA 4C2MB 3WK8A 2UUBL 2JA8B 1LTLA 1Q90A 5IILA 2ZT9C 2BDOA 3QR8A 4A3IB 1BQQT 4CDFC 4HJAA 2AMCB 3QU9A 3T51B 2K5DA 5KG7A 1SRUA 5C4HA 5J0WA 3TACB 2AQ4A 1I6VC 3S15H 1OXTA 2HVIA 1LABA 4NXNL 5AKHA 4EBDA 4DL5A 1HJPA 4EGVA 4M9HA 2IW3A 4BY1B 3D0FA 5DM73 3NTKA 3H09A 3ED5A 2MSNA 4UY8C 4NV0A 4Q45A 1X32A 1AE2A 4UASA 3EPGA 3OMGA 3Q22A 1KDHA 4RQ7A 4DNRB 5C3XA 4I2GA 4Q8FA 2K4HA 3URYA 1VQLA 1RF2D 4RT2A 1X6JA 2G09A 2JHDA 3WKAA 2EH9A 1VLBA 2W03A 1Q3UA 4XDXA 2KCTA 1KRPA 1AE3A 2MJ8A 5FO9B 4LUOA 2LYHA 5HMMA 2W9CB 5JJZA 8ICQA 1II3A 3T5KA 1OXJA 3V2TA 5AKYA 3S2DH 1KTQA 1L1OC 4FXKC 5CYUA 4KN4C 1KNEA 4JI4Q 4XQJA 5AM1A 1KD1C 5K36G 4F5NA 3EQLC 4F87A 3TANA 2NVQB 4IJHA 1B4FA 4RHRA 4MF8A 1NKBA 3D3RA 5M5XH 4QZFA 1UA1A 3ITPA 3LX0A 2B63B 5ALSA 1M6YA 1NK9A 2Z6KA 2CH4W 5IGFA 1KXLA 2H5XA 2QKQA 2SDFA 4X62Q 4RGMA 1HXYD 1Y1VH 1OW5A 3G48A 1GO3F 2ZTEA 5BN5A 1IYVA 3KD3A 1K73C 4O0AA 2IBKA 4EQPA 4HMJA 1RTNA 2F03A 5IWAL 5FOBB 1EU3A 2B29A 3BVMA 4CKBA 4ZQ3A 1H95A 1XYIA 3W5OA 3QU5A 2I6XA 3M9BA 4YMOA 3RTVA 2AQ1B 3ZDEA 1N32L 1NJWA 2HBMA 7ICVA 4KX3A 3JPSA 1K28A 4LAAA 4R65A 4O3MA 3X3MA 2M9NA 2AWNA 4K0KL 1TS2A 5HGQA 2CXYA 1SDFA 4KLFA 2E2HB 2EDGA 4YCVA 1HA6A 1DOLA 5KFYA 2M9VA 3SI8A 4A93B 2BQ3A 5LMNQ 3FKIG 3HOVG 2E8GA 5KFSA 3L7ZC 1TWHH 3R93A 1JMSA 4ECZA 2F0PA 1QQ5A 3AM9A 3CXCA 4PMWA 2E2DC 1IHZA 4BBRG 1ICFB 1FD7D 2YMQA 2YN4A 1ZQ1C 1YNNC 3KYHC 4N8X1 4A3CH 4KI0A 4YIJA 1XSPA 4ELUA 5ALJA 2GN5A 2F0UA 3IV6A 1DZ1A 3SEBA 3S17B 1QCBD 1DJRD 2KA7A 1UCVA 1JR0D 1KEJA 2KK0A 1SLJA 3IRBA 3U9OA 2EANA 7ICEA 4RAUC 4DV3L 8ICVA 1A0IA 5ALKA 1SJED 4I2BA 5J39A 3HOZG 2UUAL 4B3TL 4DR4Q 4C8OA 3F5EA 1PFNA 1YJNA 3OHBA 4ZUIA 3KKAC 2K4IA 4K4GA 4QJFB 2L5TA 4RCNA 2KV2A 1KABA 1QE6A 2HHVA 4RQNA 3PX0A 3K6OA 3P20A 5D3IB 5FLMG 4IPGA 4EENA 4LK1C 1SE4A 3K7AH 3PSIA 3ZD9A 3NBIA 3H0GH 4OWXB 3KZIU 3HKZB 5LMUL 3UDXA 1ED1A 4DL6A 1NBWA 2FHTA 1LM0A 4KTAA 1NJZA 8ICTA 1Q3LA 1PYBA 3KJPA 3S15B 2FI1A 4QWDA 4KKUA 2HHUA 4OEMB 3TQYA 2LS01 5IY0A 2MU2A 3SE0A 5TSSA 1RPLA 4BXOB 2KKVA 4DO9A 1SNQA 1KW4A 5C4XH 4DSLA 5D3DA 4IUTA 3E6ZX 4UP9A 1F2MA 1UT8A 2HCCA 5IIKA 2XRSD 4JI0Q 1X9NA 1XSLA 1PH7A 1TKDA 1PYWD 2F3IA 2JEBI 4EX7A 3EPIA 3OOCA 1WD0A 1LTBD 1L7MA 4AQYL 2K8BB 4Z6FA 8ICKA 1SZPA 4ALPA 1VQHA 1QZGA 4RQMA 4OGQC 3MXNA 1TWGH 3V7KA 1MN8A 1U9LA 4QZAA 9ICAA 5DNFA 4OO1J 2SEBD 3CRXA 3SK8A 3TSSA 1W2BA 1VQ6A 3GTKH 4HR7B 3S2DB 1N56A 4ZRZA 1IYUA 4R9WA 3X3NA 4PGYA 4M6WA 3BG3A 4A3KH 3V72A 2WF7A 1AROP 1V85A 4QUCA 5C4XB 1Z19A 9ICTA 2F1HA 4PL2A 2VKQA 1XNSA 2MUTB 4C3HH 2QLTA 1HCZA 3UXPA 2A1AA 2HOFA 3DXJC 3C2MA 3VR4A 1VQOA 1TIID 5M5XB 1IV8A 3SHLA 5J2AA 1GUOA 3MEHA 4FE3A 2KJ9A 1A76A 5KYLA 5JVG3 1J2NA 3UMGA 2C35B 4FF1A 4A3BG 1Y1VB 2RDJA 4DXGA 4YD2A 1ZQBA 1FNUA 1XPUA 1QOHA 4OIJA 1N2XA 4DPGA 2D6FC 4KHZA 2QARA 3PW0A 1ESFA 1UUPA 3GD7A 5EKKA 4KHPL 2ISPA 1SN8A 2CFMA 4HJ7A 4DV1Q 4OJOA 1GD7A 4KLEA 2FMQA 1EIFA 1Z4NA 4UATA 1LTGD 1U48A 1M8AA 1STYA 2NRXA 3MGHA 3BDPA 4RH6A 4UPAA 5KFVA 2TSSA 3GILA 1I94Q 4JB3A 4U673 1RZTA 3FPPA 4B3RQ 1HNZL 1N34L 1T94A 5DG7A 3D4RA 4J9KA 4P72A 1B0XA 3Q24A 3TADA 4M0AA 1A2UA 2J6UA 3AYHB 5IP9G 4GIBA 1DYQA 5BN4A 1HUZA 3BZCA 2MFIA 3S1RH 3CCMA 4USAA 2HHHQ 2YMPA 2RP5A 4DGZA 4ME3A 1TWHB 1AZPA 4P2CB 5KG6A 2CQAA 2HQEA 2D5DA 1NKCA 1XMOL 3NENA 1Z00A 2JA8G 1GUSA 3K4GA 1O80A 1BCPF 1CUKA 1CZWA 2LSSA 3I4MH 2O5JC 4A3IG 1WTOA 3RH4A 2NYZD 1N9WA 1L0YB 2K33A 4UP7A 3M8SA 2KD1A 3HT3A 4RQ1A 2VA2A 3N7PD 2VQEL 3HOYH 4DR5L 5AKIA 3A0JA 1ZQIA 3MWYW 5C0XJ 4Y2QA 4X6AH 1YIJA 3J80L 3R2TA 3QUCA 2KIVA 2W9BB 4BY1G 3ZJYC 4X3TA 9ICWA 8ICGA 1EY8A 3JPRA 4UB8U 4QZEA 2PI4A 4RQ3A 3PSTA 4GN5A 1CI4A 4CF5A 1EY0A 3I4NH 4Y2JA 1GHKA 3MDCA 2R93H 1H38A 1TWCH 2SNSA 3EW9A 2I1QA 4DQRA 3CMEA 4DQIA 2ZXOA 2RHFA 2F0MA 4Y7NH 5KT7A 5KT4A 3MABA 9ICUA 3KF8B 5DAUA 1PH9A 3T3FA 7ICGA 2WACA 4DV7L 3H8MA 4GS3A 3K7AB 5ALEA 3QOJA 2QW7A 4IQWA 2AQ2B 2WAQB 4OO1G 5CP2A 3ZD8A 3H0GB 3L3OC 4B08A 1IBLQ 3GTGH 5H1SE 4O3PA 2E74C 4GN4B 5M5WH 1C9OA 5EOZA 1MIUA 5AKJA 4K6DA 3U4VA 5FO8B 3N28A 5GTIU 4AYBF 1PFMA 3W2DA 1SYEA 2HHTA 3EYZA 2VW9A 4PHAA 1C0AA 5AHXA 5DBAA 2R8GA 5AK4A 2I0QA 1EIYB 4DL2A 1HNXQ 1ZQEA 4OJLA 1B8AA 2B63G 4ECQA 1STGA 2KHJA 2KJXA 3LNNA 4JC0A 1V1OA 2HMXA 2Q0ZX 4LFCQ 4IFDJ 4QIWF 1YBYA 2FJ2A 1SGGA 4QZ8A 1DOMA 5J8YA 4TSSA 2RCNA 1A0PA 4DEZA 3RRGA 1J9OA 3HZXA 7ICHA 3QB3A 4F91B 4FS1A 2UVWA 3S6JA 5F3XB 1BCPD 3O13A 4J8QA 4CDEC 2JEIA 3NEMA 4FO6A 1L3UA 3H7IA 1WJJA 1L7PA 1STBA 4TUQA 5CA7A 1TWGB 3MAQA 3C21A 1N36L 1D8YA 3SMVA 1V1PB 3BQ2A 4GNXB 1RCVD 2HDMA 3GTKB 2UXCL 1QNKA 4P73A 3NVVA 5IYCH 1LTAD 5M3FG 2FJ6A 1LT4D 3J81i 5ALRA 2BCQA 2LXKA 4A3KB 4C4TA 1T3NA 1QNUA 1S5DD 4R8UA 2F0VA 4DFAA 4I2DA 3S1MH 2OCEA 1EU4A 2K14A 3RFAA 4C3HB 5LL6X 4LF4L 3HOVH 1PMRA 3R9KA 5JRTA 1F9PA 4A93G 4DK3C 3KBBA 5EE3A 3Q8SB 2FMCA 1MC8A 4LFBL 2IY5B 3BDCA 3UMBA 1WYGA 3NK9A 3P7JA 1B2TA 2KHVA 3HOYB 4OX9L 2JA6H 5C4JH 3GTOH 3QZ8A 4QF4A 2LM4A 1KIXA 3K75D 2NVXH 7ICSA 1BO0A 3OYYA 2DL0A 2KFNA 1JB3A 5E4WC 1ZQJA 2FLNA 2A6ED 3HKZF 4UB3A 1ZJMA 5FK9C 1WTXA 2KEEA 3PX4A 5C0XG 2AGOA 3PW4A 3SZ2A 4R8IA 5EKIA 4MEXA 4JBMA 1S5ED 1G2SA 3SAGA 4HAEA 4UB1A 5CBAE 3SAFA 2ZIXA 1RG6A 2LPEA 4P0PB 2X6LA 1KLNA 1HH2P 2UXBQ 4NXZA 3HOZH 2W9MA 1LV9A 1T4GA 1UT5A 2RF4A 4F4KA 2F0LA 5AI8A 4O42A 2F0TA 2PPBC 3QO2A 1XNQQ 3KLSA 5DBBA 1KFSA 4CNQA 3AUOA 4IL6U 5E79U 1ZXTA 1EUJA 3S1RB 4LVSA 5J2BA 3DV9A 1KRSA 2QEJC 4C8LA 2HHSA 3RJFA 1DONA 1I4HA 2KHSA 2XGQA 1COOA 5J1ZA 2W7PA 2DPJA 5TISU 3PSFA 3SV4A 1PVPA 4IQVA 5KNIA 1FNVA 5AI9A 3BU2A 1ASYA 3I4MB 4DR1Q 1DM0B 4JYAQ 1Y88A 5HNKA 3F1ZA 3GV8B 2F4VL 5M5YH 5IT9E 2IHEA 2F77X 2OWOA 1ML0D 2ATWA 1B9NA 3I7FA 3R8BA 3H0LB 5KFIA 4EYIB 1PTOF 2CW0C 4X3SA 1K8AC 5EE9A 3CAMA 3BQTA 4QZCA 4ECXA 3TEHB 4DV0L 2XWBB 2NZ1D 4WORA 8ICYA 1VQNA 2HDOA 2Z6KC 4FBTA 3HWTA 9ICNA 1I4PA 3GV6A 3UE0A 5BR8Q 1YVCA 4IFDG 3I4NB 3G6YA 3H6MA 4RCOA 1BBUA 4C4RA 2R93B 1TWCB 2HBKA 2I5HA 3FAHA 3C5FA 4PMBA 4QW8A 4PZOA 3C29A 4NXML 2D62A 1YEZA 4YY3Q 3RRHA 4FNFA 1PZKD 4UBBA 1Q1BA 3A56A 4Y7NB 1D1KA 2QF7A 2NYVA 1BOSA 9ICIA 1HZ9A 1L3SA 2WIIB 2YB1A 2N55A 3RAQA 4PH5A 4DN4M 3S9WA 4BA2I 2K60A 1NZPA 2VB2X 3GTGB 2JEFA 3NBHA 3K1ZA 4KKTA 4RPXA 4PV1C 4AIMA 4HIDA 1L1OB 5M5WB 1FJGL 4F92B 2N88A 2E8PA 1LB2B 2QCPX 3J7AF 3PO2H 1MA7A 1E7ZA 2RSNA 3STBC 2L1BA 1LT5D 2AUKA 3TZUA 4ZLTF 7ICOA 1D9FA 1SV0A 1ZQQA 2NO5A 2KZMA 5J3BA 5C44H 5EPJA 2D3DA 4DUZQ 4RA8A 5I6WA 5EPLA 3V7LA 1E24A 3NTIA 3I56A 5ALMA 4A3BH 4H0LC 4YVZA 2FPLA 1D5ZC 1B3QA 4CDDC 4ZYSA 4KLKA 4FBUA 1FL0A 3RBEA 2C28A 4Z6DA 3FDTA 1HUNA 1VQ8A 4XYOA 5KFTA 3NUCA 2VZAA 2CVRA 1A77A 4APVA 1JICA 1HR0L 1EQVA 2AGQA 3GIKA 2PQAB 3MXPA 4IUVA 4O2DA 4QZ9A 5C5MA 3OTOQ 3RB4A 3SEIA 1MJEA 3BDOA 4IZ8A 1PTOD 1ZQOA 4RGNA 3M9OB 1B1ZA 4UQGA 2VNUD 3OPOA 2OQKA 3PO3H 4KLIA 1ZQDA 2RLTA 2JA7H 4M47A 1A3VA 2PO4A 3NQIA 3MFHA 5KNBA 5J0QA 4R4CA 2K32A 5KNCA 3S1MB 5DGAA 4IO9A 4WJ3B 1NJYA 5AJ3Q 2F0OA 4V190 3HOVB 5J2HA 4XQ8A 1JOKA 4EBCA 4JPBW 3V05A 2ES2A 3IKJA 4ECRA 1V1QA 1EZ6A 2JEGA 2UUCQ 3HILA 1Q8KA 4P0QA 4KD4A 4JK1C 1EYGA 2G5IB 1U49A 2P66A 5C4JB 2KEDA 2JA6B 2GVAA 1K3BC 5J2KA 3L9AX 3GTOB 2NVXB 2NZOA 9ICGA 3KLRA 2LKVA 1NE3A 4A3CG 3V6KA 3EFXD 4K8IA 4O5EA 9ICVA 1Y1WH 3NWSA 5ALPA 1NMFA 2XGPA 3BS5A 4B9LA 3A5UA 5ALZA 3GP7A 1D2BA 3NXWA 3HFZB 3I4LA 3CYMA 1Z1VA 4JV0A 3IN5A 1LLRD 1NAPA 2CHBD 2YTVA 4BA1I 1WTWA 3THVA 2A6HD 2EQSA 2L9HA 4X64L 3PW5A 1JOQA 2HD3A 1KHIA 1WCLA 3CCRA 5ALNA 4F7XA 4U6PA 1TV9A 2KSOB 2NVYH 3T16A 5AM5A 2OM6A 1QLNA 4K8JA 4B3MQ 3MHBA 3VYSA 3C3LA 1KLGD 3T1YQ 4L5SA 2KJ8A 1SL2A 1X2IA 4DQSA 2DPIA 4RNMA 2A68D 2XGTA 2FMMA 2BCUA 3RF9A 4MTKA 2HIVA 4F88A 4JI7Q 1GXDC 1HEKA 3GTPH 2E75C 5BOLA 4OO1H 5IGBA 1SNOA 4HN7A 4ECUA 2L4NA 4K6LA 2DQNB 2IPKD 2AU0A 5FLXL 3G6JB 4ZH4A 2WAQG 1SMYD 3A8IE 1WYDA 2HVHA 3I28A 4Y2RA 2FDRA 1LTID 2PNHA 2R61A 2K04A 4PGQA 2B2WA 5J0OA 5M9OA 2VQFQ 5M5YB 4B9NA 4XIGS 5GADC 1J2MA 3N7RC 5EWEA 1LTSD 3UPQA 4DA2A 4JOIA 1SFOH 2F8KA 1XWLA 4LF5Q 2W04A 4ED6A 3K0XA 5CV9A 4DLEA 4JI1L 1LKYA 2Z4HA 5IGEA 2EYMA 2PZTA 4FYDA 1B7YB 4YWKA 3RNUA 1YJWA 2K5NA 2GOLA 1W6JA 3M3YH 1ZOLA 1WG8A 3Q8DA 4EEYA 5C4XG 4DAPA 2RHQB 2WAQE 5I9PA 3EVQA 1KLUD 3D8GA 1XTDA 3HKSA 3CCEA 1IL2A 1EIGA 1HZAA 2KUMA 4OONA 2DNCA 4DR2Q 3M7GA 1NR4A 4LF6L 1X9XA 1PRTC 3VYTA 4ELTA 3H40A 4CJ1B 2ES6A 2W3RA 5JJLA 1A6XA 3GIJA 3CMAA 3D31A 2G06A 2QILA 3I4OA 5KFAA 3E3XA 4FZLA 3KJOA 3RJIA 5M3FH 3L5KA 1WTHA 4P2HA 3A55A 3PO2B 4RG1A 3E0EA 2EYPA 1PH6A 3JAME 3T1HQ 3S2HH 2XRQD 3TADC 3FC4A 5AFWA 5DB6A 1EXNA 4OHJA 4A3KG 4M2YA 1AW7A 1I5FA 1WWUA 2DKXA 4F50A 4DFJA 1J5EQ 3QWNA 4C3HG 3PIO3 4JV5L 1M1KC 4NLBA 2ASLA 1NK0A 4MIUA 5C44B 5DG8A 2K5HA 4NB3A 4PHPA 5KTQA 3KF6A 4FF3A 4PZ6A 1AEXA 4A3BB 3H3VI 5ELEA 4DL3A 5DBCA 2ZTDA 2FLPA 4EZ6A 5ALHA 4LUVA 1WTQA 4MFCA 2JMGA 1C48A 3BJYA 1N5WA 1O7LA 4KKSA 2QB0B 1YHQA 4IJLA 5F2DA 2WINB 4JI8L 4CJ2C 3H8JA 4JUZA 3CCUA 2Y0SC 2JA5H 4HCSA 1V9PA 5C0XI 1ZQNA 3TDQA 1Q7YC 4FXGC 2GVBA 1NR2A 3PO3B 1Q81C 2JA7B 9ICSA 1SXDA 1VF7A 1T5EA 5E1FA 3W1GA 1F2YA 3C1YA 1YNJC 3LVVA 4G4KA 2F1IA 1WOCA 2B3GA 2L12A 4FVMA 5L1JA 3ZDAA 1IBMQ 3T79A 3M85A 4L6TB 3QG1A 1E22A 2ZIVA 4IRKA 5A2QE 3GTJH 9ICJA 2WF8A 4BY7H 1CKNA 1H9SA 2K05A 4I2EA 3M7DA 4F72A 2HW3A 1SR3A 5GAGC 4F4XA 5FLXc 4PZ8A 2GA4B 3K58A 1AZQA 5B5EU 3DM1A 4IPCA 4A3GH 2KICA 4QZDA 3I4MG 1Q1EA 4P4OA 1FR3A 1Y1WB 4DWIA 3OJSA 1EIHA 3HOYG 4IALA 2SNMA 4Y2YA 1HUMA 1KL9A 1JWMD 3E58A 2FXQA 3HPOA 1JE4A 5DQGA 1JROA 4Y2TA 1FNWA 3DHQA 5D14A 2KIWA 4EELA 1VQIA 5AIBA 2UVVA 1UQVA 3I73A 4O3QA 2KN7A 2RVLA 3HG9A 2EYJA 1FFVA 2VS1A 1RXVA 1L5UA 9ICRA 3TN2A 4IFDH 1I6HH 3GU3A 4O3NA 5FKAC 2NVYB 2Z0SA 4KJNA 5J8YC 2ZJ8A 3I4NG 1HR0W 2BE5C 3ND8A 4FO2A 4JI4L 2YY6A 2R93G 2YTYA 2YB4A 3GQCA 3T13A 3H15A 2VY3A 3U9SA 1ZQWA 3IG5A 3H0MB 2IHMA 3D6WA 2D0PA 4K4HA 4N9TA 2HQLA 4A3DH 4NPSA 1IXRA 3GTPB 2V4QA 1NK5A 2W43A 1Y14B 1VQ5A 1XNRQ 4JVZA 3H8WA 1VQGA 1BBXC 4RNNA 1MJCA 1JIHA 1HIWA 2OXPA 2K1BA 3NTUA 4X62L 2KCMA 1X54A 2BDPA 1ECWA 3AMZA 4UBCA 2F4IA 4UAUA 2K52A 3K0YA 4GKJQ 4GXJA 1I50H 1WCMH 4O5CA 1YHBA 3EROA 4MFAA 4QJFA 1SFOB 3LYSA 2AQ3B 5KFMA 1AQ6A 4WJ4A 4ECVA 4NLGA 5KFNA 1PH8A 2YTUA 5DQHA 2K8CB 7ICFA 8ICNA 2I9GA 2MO1A 2KBNA 1ZYQA 1KAAA 4PZ7A 2F1MA 3RH6A 3J80i 2PMZF 3VR3A 1PA6A 3M3YB 4POGA 2UXDQ 3NELA 1HUOA 1RKNA 3T4AC 4C7ZA 4JI3L 2Z9HA 4KMUA 2B2YA 1LO5D 5IODA 4YCWA 2DGZA 2E3TA 2FPKA 4BWMA 3D4WA 1C7YA 1S9FA 1X55A 3ER0A 1S0OA 3IFDA 2FFKB 3OIQA 5LMNL 1XPRA 5KFWA 5ALWA 1EZ8A 4MNOA 3CNHA 2H3ZA 4M9LA 2W8LA 4ZUJA 4HIMA 2F0JA 2E1FA 5M3FB 2YMLA 2C22A 4Y52H 3KHGA 3RAXA 1B3AA 5IYCG 2ZJRA 3S2HB 3RJEA 2M00A 4KY7A 4JI6Q 1VQAA 1X6IA 2MAXA 3A0BU 4IUNA 2ZJAA 5J0SA 4C3JH 4DUYQ 1TK0A 1B53A 2JV3A 4UAVA 3MR2A 3L0OA 1NTGA 4DNTB 5HHHA 1IBKQ 1F9QA 2JA6G 2DGYA 2K89A 2A19A 3KHLA 3WK5A 5DGBA 4R8NA 5DKWA 4DR4L 3CRLC 4F93B 3PUYA 4K2KA 2LKYA 4KLTA 8ICCA 1QVGA 4IUUA 1CT1D 2J4XA 3TARA 1UE1A 2A69D 2PW5A 2IL8A 3MR3A 2MUTA 5J0UA 1VS0A 4KN7A 4KLGA 4UARA 2JA5B 2LY7A 3IL8A 3PW2A 3RN2A 5KFPA 1SJHD 4WFN3 2B39A 5D46A 5L9XA 3B6YA 4ABNA 8ICBA 1OXUA 5JUMA 1PLFA 1VQKA 2W11A 4QZHA 4Q43A 8ICPA 3WK6A 3F5AA 2IX1A 2G5DA 1SNPA 2KVCA 3H4DA 1Z1BA 4EQNA 3J7ZC 4YXJA 4XXEA 4FZNA 1MSGA 1TWFH 4O9MA 3PY8A 1EQRA 3GTJB 3SVMA 2GWSA 1PFSA 1CSQA 2NRVA 5CV6A 4B3SQ 1YITA 4BY7B 3NHHA 5T1GA 2B2VA 1PK1A 1KNAA 4C8KA 4QZBA 5DEHA 1FFUA 1GO3E 4O5KA 4M9JA 4O3SA 4MHEA 2OF1A 4GC6A 4EVOA 1F0MA 3F2BA 1MQ2A 4A3GB 2ESEA 5AI4A 1SL1A 2FE9A 2F0QA 3ULPA 1ZQUA 4LZGA 2FLLA 4DV4Q 4PHEA 4P4MA 2Y9TA 3MA2B 4ID6A 5AK3A 5GAEC 2EY5A 4X66Q 1C20A 5KFRA 2HSZA 1I6HB 4K2LA 5KEEA 1VMPA 4R64A 3NWTA 1K0SA 2EAPA 2L15A 8ICAA 4IQUA 5IIIA 1TAMA 2BGWA 3OJUA 8ICMA 4OIKA 1K8GA 1ICWA 3KLWA 4XT3B 3CQZH 4A3DB 2F0DA 2OT2A 1A15A 2F0SA 5KFCA 3NRZA 1X65A 3QJYA 2HDLA 3PO4A 1BR9A 1K8OA 4KLJA 3GO5A 2QKIC 1Q12A 4O1NA 5LMUQ 3PO2G 1UAPA 1URJA 4CCHA 3L2PA 5KT3A 1Q3VA 2K4KA 3PUVA 1I50B 1WCMB 5D65A 1ZQCA 3UQ2A 2UU9Q 3CRKC 4N8FA 1ZEQX 1O03A 1QWYA 5BN3A 5G5HA 1RJTA 4B9UA 4A4IA 1Q46A 4DV1L 4TVAB 1M90C 4Q5VA 1TE2A 1SYBA 3CCQA 5C44G 1JJGA 2DJGC 4MFFA 3V7JA 4K4IA 5NUCA 2OTLA 2BDUA 4UAYA 3FHWA 3HGBA 4IR9A 1Z7TA 5KGUA 1I94L 4BS9A 4NMZA 1TAUA 3JPTA 4B3RL 3S24A 2Y9UA 3HRZC 2EYLA 1BDOA 1AH9A 4JI2Q 1A63A 4KLQA 3SENA 4ILWA 1HQRD 4AQYQ 4UAWA 4G9BA 1ZQGA 4NY8A 5CMDA 4TQSA 2XO7A 1E1TA 4JWMA 1B70B 1EY4A 4YCXA 2HHHL 1XMQL 4ECTA 1JWSD 4TKOB 1NUCA 4XQQA 4A76A 3T5HA 1X3GA 3IHQB 4DXFA 7ICUA 3OMCA 3PO3G 2JA7G 4LF8Q 3FPUB 3MR5A 4LNQA 2A73B 4Y2VA 1KDCA 3S16H 4JWNA 4HCEA 5KT2A 9ICKA 2R7ZG 3G71A 4JBJA 3WKEA 2V4RA 4C56C 3C5GA 2JYOA 4ED8A 2XCPA 2RDFA 4C3IH 1V1PA 4GNXA 3NVWA 1BPYA 1HTLD 5ALDA 1VQEA 1MD2D 2B2WC 1S5LU 2XICA 1Y1WG 5EAYA 4C80A 4JOIC 4ZOHC 4DF4A 2D8CA 1D8BA 1EWIA 4NWIA 3OHAA 1DK2A 2CCZA 4TUPA 4I2HA 5DLQE 1NY4A 3KUPA 2BCRA 3EUB2 2RDGA 1ASZA 1TWAH 3PIOA 4JI5Q 1LVHA 5AKGA 3TAPA 7ICIA 1EEID 1O7IA 4A75A 1FEZA 1ZQVA 5IYDH 5DLFA 4YN4A 5D49A 2ZG6A 4YR2A 1HFGA 1TWFB 3H0RB 2FMPA 3MXNB 1FGUA 3D6JA 1CA5A 1BUVT 1BPEA 5CWRA 5ELNA 1HNXL 1YHAA 3TP5A 4C1NI 1ZD5A 5JOBA 3OGUA 4P0PA 1DGJA 2JXJA 2BCSA 1ZQMA 4K5WA 1UE6A 4LFCL 2R92H 1ZXIA 2NO4A 5A0LA 4IR1A 1W6KA 1IG6A 3T56B 4KLSA 4YMNA 1EY9A 2VQEQ 2DFLA 3SR6A 1SMXA 1VF5C 4QUFA 3VCBA 2LYBA 3AU7A 1F5SA 5ALGA 1QG7A 3OWEB 4I7AA 4LUZA 4IOAA 1BCPC 1GJXA 4FXDA 4CRXA 1ET9A 2O5IC 2E1EA 3ZDBA 2CKZB 3DLLA 3UDGA 4KITB 5GTHU 1XXGA 2NN6H 2BCVA 1ILQA 4GOPA 1U4BA 1JORA 4YXMA 1G6ZA 4QQBX 3ULLA 2LMCB 4F5RA 4PHDA 2BQRA 2Z4IA 5A35A 1G6PA 5IYBG 2BR0A 3DDHA 8ICUA 4DOBA 3RLNA 5IT9L 3I90A 3I55A 2P6UA 2QARB 2ZIWA 3IRUA 1TXYA 3KFUF 3K5NA 3CQZB 4DAMA 2JP1A 3GV3A 3IG8A 1Y8NB 4FFDA 1PRTB 4LW1A 5DDYA 1IW7C 2EVBA 2VA8A 2XY5A 1U4MA 4DV6Q 3DMUA 2QEXA 2ODGA 4L5QA 3BJUA 5KFQA 4IURA 3HP3A 4KTQA 2AHOB 3C1FA 3K80C 3IM1A 4DK0A 3Q23A 5HR6A 3AU6A 2AKWB 4BJQA 1HFNA 3QOLA 4ED7A 1U45A 4A3FH 3W1BA 2LYAA 4ED2A 3BS1A 4JMUA 4R1JA 2K28A 3I70A 1J8IA 1ZRMA 2EZYA 4EX5A 7ICRA 1ENCA 2RRDA 2A6EC 3CCVA 4LWCA 1KC8C 2ASJA 1FVIA 4AYBC 1G2TA 3Q8QB 3PMFA 1XTCD 3HS0C 4RUCA 3PV0A 2UXBL 3BQ7A 1L1OA 1KDBA 4DCCA 4KN4A 3H8SA 1IL8A 2PW7A 2RKSA 1XNQL 3G4SA 2ZUDA 5ALOA 3J80c 4UB2A 3Q8MA 4FP5D 3H3VC 4KJOA 4JBWA 2ISOA 4M9GA 2E5LQ 1UEAB 4QIWC 2JZBA 2CRXA 1PVQA 2Y0SB 3HEJA 1X42A 1ZQYA 3MR6A 1QH9A 1ZQHA 8ICIA 1TKWB 2JA5G 4JBKA 2F3VA 3A7LA 3TS2A 5DDMA 4DR1L 2Q4TA 4GKKQ 3MFYA 1CQVA 1N33Q 1U9RA 2KHIA 4JYAL 5T14A 2RQ5A 1UNSA 1DK3A 2K8AA 3H94A 3S16B 3QEAZ 1N5XA 1ZD2P 5CGKA 1JMCA 3GV5B 1CK1A 2K4EA 4DSKA 3NP8A 2ZIUA 3OHXC 3PF5A 2VJ4A 4DAYA 3E5SA 2I46A 2PZWA 3I72A 2NB0A 3C46A 4BBSH 3MFIA 4ECYA 3EWAA 4BY7G 4C3IB 1PH3A 3MBYA 2JSOA 2F0WA 2NRZA 3HOUH 4C8NA 1GUTA 2UVRA 4C4SA 3MTSA 1ZQFA 5I6YA 5EKLA 4K14A 3ICXA 1X9SA 1GKHA 4KLHA 4LFAQ 4G7HC 4J9PA 2W7OA 4WRDA 1U5KA 1BXTA 4YY3L 5E7NA 2ZXHA 5JTIA 1HA5A 4A3GG 3MDAA 3TFSA 2IJ0A 4DR3Q 4L5TA 3HRDD 2PFNA 3MZ5A 5ELFA 3RR5A 3H91A 2KP7A 4U7CA 1NI3A 2LHTA 2IT1A 3OW7A 4YHHQ 3LVWA 3GV7B 2ZM6Q 3JPPA 1Q8IA 4N9PA 3HKZC 2B2YC 7ICLA 1X3QA 4KMUC 1TWAB 5J0YA 2Q8RE 2MQHA 4UAIA 1L3TA 8ICOA 1LUZA 1K1QA 2RCFA 5AI0A 5J2GA 3ERSX 4EQOA 5C3WA 5JEAH 1RDFA 3DEPA 4L63B 2ZJPA 5EE1A 4HJ5A 2PKEA 3GTQH 4DNIA 5KG5A 4A3DG 3ICEA 5KG1A 1KSPA 2WFAA 2ID0A 4DUZL 3C2KA 3EIVA 4ELVA 1RDPD 1KBUA 1SEBD 3SR1A 5CBEE 3M7NA 2H3IA 2IHNA 2WV6D 4IQTA 1VQPA 3M9MB 2NUCA 1RXWA 2R92B 1GUGA 1RQLA 1PH5A 4BGDA 1H9RA 1DOKA 2QDLA 1ZQZA 3KLSX 4R8UB 4IRCA 1S3OA 4RKBA 1BBWA 2F0FA 1WCMG 1SKSA 4KV6A 4RGOS 1P7DA 3BZKA 2BCOA 3DEOA 4YWLA 1R9TH 2JH7A 3QIAA 4DR6Q 3ETRA 4DFDA 3OTQA 3G7LA 2HBJA 1U4LA 3U26A 3OTOL 2NWGA 1JALA 4I2JA 4OELB 5ELBA 3NPPA 4DKAC 3K5OA 1QSSA 3SXHA 1JT8A 3ZDCA 1A2TA 4RQ4A 3RZOH 3GZFA 1PTOC 5JPNC 1S5FD 1BNOA 1S76D 1KFDA 5AK5A 1ZD4A 5D4BA 2A1JA 2YQEA 2F1JA 3UMCA 2B2TA 3R3OA 3I8ZA 4NM2A 4IPDA 3E2EA 4X65Q 4KN7C 2EY2A 1ONLA 5AJ3L 1EL0A 4DSJA 2CQOA 1ZKOA 2JN4A 2VUMH 1GOZA 4CF4A 9ICLA 1EQQA 1KN5A 2UUCL 2ZIXB 2E8MA 4C8MA 3T5JA 2ICEC 2VXWA 1ZETA 5AKLA 4XA5A 4NP5A 4ODGA 1CA6A 5ELDA 4F4WA 1RQNA 9ICPA 1RHPA 5AKEA 2CWPA 2F0EA 5IOCA 2BHNA 2PI5A 1XU4A 4A3FB 1IYJB 2R7ZH 3K5MA 2L11A 3CPWA 1GUWA 4TURA 5KYIA 5LHY1 2Q8TA 4P74A 4A3MH 1E1OA 3I76A 1RYRA 1EOVA 1BPXA 5J2CA 4RNOA 5KFJA 1G8ZD 2B2UA 2B2VC 5FO7B 5G3LD 2WB1C 3MXUA 5KFKA 1VQ4A 3UDFA 4C3JG 3FP9A 3F2CA 3ISCA 5F9NA 2WF9A 3JAML 4KLOA 1T7PA 1S5BD 2A6HC 2WB1G 2WAQF 3KDFA 3K5LA 4B3ML 1Y8PB 4CBVA 8ICFA 2RHSB 1Q82C 1LT6D 4ZK9B 5TZVA 1WFQA 2KVMA 1VQJA 2RDHA 2NRWA 4OCZA 4YD1A 2I07B 3T1YL 2Q2TA 4LF9Q 2LMRA 4QW9A 2XI9A 5KAFU 3JPNA 1VQCA 2ICIA 4GLVB 1ENFA 3ONAB 4JI7L 2L55A 2A68C 4QB4A 3AEVA 5CJ7A 3LGJA 4E6IA 2NZHA 1SE3A 4GFJA 1K0RA 4NM1A 3A74A 5L1MA 1TFRA 2EY6A 5CRXA 1ET6A 1E0BA 1BVSA 1SMYC 3WKDA 2EJFC 3IDWA 2WB1E 1BF4A 2VQFL 3BVZA 4DV2Q 1FO4A 1F9SA 2PI2A 2IOHA 1TY0A 5ELCA 1F44A 3QYPA 3KTQA 1I4GA 3D4DA 4YP3A 4LF5L 1EOTA 5LL6S 4BWGB 4BBSB 3TFRA 4DSEA 4UHVA 3K1RB 3F53A 4QGUA 1RYSA 3NBHB 8ICXA 2XWJB 3JPOA 3HOUB 3M4YA 4OO1I 1AN8A 1GHJA 1X3FA 1TR5A 4J9QA 3RN5A 3VC8A 3Q8LA 1JC7A 1O08A 5DB9A 4OJPA 2WTFA 3H4BA 1K8MA 4IQZA 1TAQA 1U4RA 3RH5A 5IGGA 1JRPA 3G6VA 4A3EH 1K9MC 5A2QL 4DSIA 1HHVA 5BOMA 2BZFA 5C3EB 3CPFA 4X64Q 4ME5A 3VR5A 4B9WA 2DN8A 2HOIA 5IYBH 3I91A 5ALVA 2JXMB 4E0DA 3EBEA 3TS0A 3T1HL 5C5JA 1VQ7A 4KLMA 2TMPA 3AFPA 1KQSA 5AM3A 4OD0A 1ESRA 1J5EL 3PMLA 5FJ8H 4DQPA 3GTQB 2K03A 3QU2A 3C28A 2BPFA 1PVOA 1TVXA 4G7ZC 1I4XA 2EE1A 2IX3A 4XT1B 3PNCA 2J6TA 3ZDDA 4CKCA 1D1IA 4DK1A 5AM0A 2YYZA 1HNWQ 2EZXA 5KT6A 1QUQB 4LF7Q 5DM63 2PFPA 2F0IA 4F3OA 2PCFB 4DV5Q 3M8RA 2XSCA 2IOFK 4DR7Q 1KQQA 4BXXG 4UDUC 1R9TB 1JN3A 2KENA 4M04A 1JOOA 1ZQTA 8ICJA 3UXOA 1EYAA 1P16A 3LWUA 5J0TA 5CV4A 4P0QB 1F9RA 5J2DA 2W9CA 2EY1A 2Z1CA 5JAVA 2H3FA 4RQ6A 2BOSA 3KHRA 3MFGA 1XX8A 3RZOB 4F5QA 5EPKA 4KLLA 2K4PA 1WCNA 1YJ9A 4B9VA 1TT2A 4LZDA 3E9HA 4Q0FA 3OW2A 4R4QA 3GIMA 3BVGA 4JV1A 2E5SA 4DOAA 1PZJD 1IBML 1J6QA 4PG3A 4R4OA 3WWVA 5CEHA 2K01A 5J2FA 1L7NA 3H3VH 2VUMB 1PYSB 1TK8A 2EJMA 3C23A 2IA6A 3SAHA 2AQ0A 2V1CC 4CDGA 2Y0SG 3EJIA 3OSOA 2MO0A 4RQ0A 5C5LA 1SL0A 3IAYA 4RFBA 4DU9A 1F2LA 4QWBA 3U50C 1Z9FA 1STHA 3KBXA 4S3SA 4KX5A 3S1QB 2R7ZB 4UW9A 1B50A 2DKZA 4KMOB 4A3MB 1NK6A 2VB3X 1JUDA 5I4DA 1Y8OB 1S40A 3C1EA 1C8CA 3J81E 3SYZA 5AM4A 1ZYRD 2KG5A 4C3IG 4A3LH 2Y0SE 2QB1A 1I3QH 5J0XA 3SK5A 5J2EA 5CV5A 4CKEA 3TP6A 3AQQA 3HOWH 9ICEA 2CPRA 3QXGA 1FYCA 5EJWA 1WVLA 4F4ZA 5KFXA 4JI8Q 1JJ2A 2AXTU 1VQMA 2PXIA 1JJCB 1WD1A 2MA1A 1OTCA 3WOEA 4OJ6A 7ICQA 2D9UA 4OWWB 3NRWA 1IZ6A 2EYFA 2B8FA 1LKYB 2VL6A 3NSWA 4TUSA 1XNRL 4GOPC 2G9DA 1XS9D 1BPDA 4EBEA 4FS2A 3KFUA 5KG3A 2F52A 3LWEA 4IFDI 3GQBA 5JPMC 7ICNA 2RA4A 3EA6A 3EN2A 4GKJL 1DD2A 3BQ1A 3AN1A 2PQEA 5DQIA 5DB7A 2XC9A 3NQTA 5IYDG 2NBFA 1EFID 2LI6A 1NJXA 1D8LA 2HIXA 2Z6BA 1S0VA 4RT3A 9ICFA 4J1MA 5IINA 2UUBQ 5IIOA 3PSPA 5L1KA 4DK6C 2HCIA 2UXDL 3OIPA 1Y69U 1STAA 1CI3M 2NVTH 2Q2UA 3V6JA 4PGXA 3RZDH 3GFKB 2R92G 4Q8EA 2KTQA 5ALLA 3I2ZA 5HGTA 4I2CA 1X9MA 4NKLA 4K5XA 4J9MA 1RTOA 3PUZA 4NXNQ 1I4RA 2SOBA 4P4PA 4KY6A 5HR7A 5E4XA 1KRTA 1MBYA 4A3EB 2VA3A 1BCPB 5J22A 1D5XC 3KF6B 4US8A 1OUQA 1TY2A 2JR5A 2NN6G 4IC9A 2BE5D 3DWQA 1G51A 1L6NA 5CHGA 2H4OA 1PTOH 4RWSC 2FMSA 3ETLA 3N4MB 4MF2A 1E3PA 1PH2A 2KZZA 5IGCA 4JI6L 1EQTA 1CQFA 3UDIA 1UE5A 3MVVA 5JEAJ 1GVPA 4DUYL 5EE0A 2DY7A 4J9SA 4CGZA 5ELOA 3K59A 1PHJA 3J7AV 2Z7JA 4HIOA 4LJXA 4BXOA 4J03A 4OXPA 4ECSA 4DL4A 1V38A 5KFLA 1SNMA 3NASA 4PZNA 1SYDA 2XIWA 1VQDA 1YI2A 1IBKL 3FRPB 4CGYB 1N62A 2PZUA 4I2AA 1UE7A 3CC2A 1ENAA 3SQIA 1ZQPA 8ICZA 2W55A 5KFGA 2WKDA 3F2UA 5HURA 4A3FG 3NVZA 1KAWA 2BA0A 1T8EA 3CP0A 4DQQA 1PV4A 5IIMA 2ZIVB 5IIFA 4A3JH 4DFKA 1KKXA 1D6EC 3M6KA 1WTVA 1SV4A 2GO7A 1S97A 1ZQXA 3Q8KA 1QSLA 1A8VA 3QUBA 4PL1A 1CKNB 1H9SB 4I29A 1L0XB 1SBBB 1X6OA 1OO9B 2A69C 4MZ9A 3PIP3 4U68A 4KY5A 4AYBB 4DS5A 3Q6SA 4JW0A 3QZ7A 1Z47A 3GTMH 4P71A 4JI3Q 4NW2A 2OXOA 2LFNA 2ASDA 4J9RA 3SGIA 3IFTA 2KCCA 5IWAQ 8ICSA 5KFFA 4ED3A 3C2PA 2PMZC 4EEKA 2ALZA 2EYOA 4PPXA 2DWQA 1QILA 3CC7A 4GZYC 4QIWB 4C0ZA 5HY6A 3AQFA 3GDEA 4C1NK 5GROA 4B3SL 8ICLA 1VJ5A 5KFUA 1XJVA 3QE9Y 1N32Q 3MC1A 2BA1A 1EY6A 1PDQA 1BPBA 1O7ZA 3J7YW 1S10A 2YTXA 2I5MX 1S0NA 4K0KQ 3PW7A 1B22A 4LJZC 1CRXA 5EWFA 5JJKA 2DY8A 3PCOB 3KHHA 2R18A 3FMCA 2E8OA 2WF5A 4EX6A 2J6SA 4QCLA 1VDZA 1NSNS 1TK5A 1YNND 3RR8A 4DV4L 1S0MA 1YNXA 4Z6EA 2OYYA 4BBSG 4X66L 4UB6U 1PVRA 2PMZE 4HEDA 2D2CC 5KIXA 3PUWA 1I3QB 1LTTD 2AUJD 4JI0L 3HOUG 3AB9A 4IUPA 5IE8A 3HOWB 3FDSA 3L3FX 4CJ0B 4PQXA 4J6HA 2B0CA 2A5HA 4H44C 1SV0C 3PZPA 3E0JA 2ALYB 4IS7A 1CKOA 3WKBA 2BH8A 4QNLA 3LK9A 4DV3Q 5C3EG 2EPBA 4I27A 5AI6A 3HP6A 5CV7A 4JK1A 1N63A 1A3TA 5E3FA 2JQOA 3NS1A 5ISRA 2IOFA 2UUAQ 5KFHA 4B3TQ 1JXLA 1HPCA 4I65A 2VANA 1NOMA 2R8JA 4UAZA 4HYKA 4MEYA 2B2TC 5IIJA 1EWCA 1L7OA 4KLDA 5JEAG 2N49A 3LWMA 3M9NB 4GC7A 2UU9L 3A8JE 3ISDA 5GAHC 4HJ8A 2FINB 4X3UA 3RB0A 4Z9CB 1L3VA 1QQ7A 2W9BA 2YMMA 2BKEA 3PGZA 1STNA 1XWEA 1AFPA 4R66A 4TQUS 3M4OH 1HRJA 3ONNA 1KTKA 2NVTB 2XN9C 4OL7A 3RZDB 1TS4A 3UE1A 3RB6A 1M4VA 4R4TA 4NL9A 3FVQA 4BXXH 1SWWA 3AU2A 4F2SA 1QQ6A 1B4OA 4IPHA 4JI2L 1WWVA 5KAIU 4RQ5A 2AGPA 1YZ7A 1OXSC 1B43A 5CB1A 3PF4A 1BPZA 3KF8A 3CW2C 3KZXA 2HHQA 2B2UC 4ACOA 1UEBA 2N8NA 1H9JA 4QWEA 4RPZA 4JG2A 2P5ZX 2HBLA 4ZKCB 3B0YA 1NKEA 8ICRA 3TKAA 3VA7A 2KOBA 1PTOB 2KECA 4LF8L 3HOXH 1SSOA 3DWPA 4J9NA 3D2NA 4DSFA 4NJ8A 3DWAA 2ZTCA 4F8RA 9ICMA 1N8RC 7ICPA 2JH1A 4F4YA 3SD7A 2WP8J 2G9HD 2GLEA 1NJIC 3WK4A 1O7YA 4O0IA 4YQWA 2VUMG 5L37A 2E2IH 1EFWA 3GTLH 5DG9A 2L5YA 3IP4B 1QZHA 1L0WA 3Q8RB 2AWOA 1PZID 1GUNA 1RODA 4RHSA 2A74C 3M4QA 1EYDA 3OSPA 1SYFA 3PV8A 4A3JB 1D9DA 5ALIA 1JE5A 2LM1A 2EJGC 2O2LD 2OQ0A 5I2YA 2EAOA 2N1RA 5DLGA 4DFPA 4A3MG 4Q44A 3OPXA 3TBIB 3PUXA 4C3JB 3CU7A 3QUQA 3DM3A 1T5XD 2O6KA 4PJ0U 1CHPD 1PK1B 2MHVA 2WB1B 4KD3A 5M3MH 2E8NA 3C1ZA 2Y1JA 3GTMB 2J0TD 4XRHA 2AH5A 2CH4A 4PNYA 4K5VA 4XTCS 1CFMA 2W54A 2L0CA 4JI5L 4HJ9A 3PVXA 3GIIA 1IM4A 5KL1B 1PXUA 3A7AB 4KHPQ 4H7BA 5H2FU 2KE7A 4YFKA 4JCVE 2O4XA 3QU4A 4B9TA 5IP7H 1ZQLA 5KFEA 3CD6A 1TVAA 5J0RA 1Z6HA 2HHXA 3EZ5A 1YZ6A 2LXJA 4I7ZC 2PI2E 1XMQQ 3A0HU 4GLAC 2EAMA 2NRTA 1IBLL 2G5HB 2G0AA 3Q0AA 1I4QA 1L8OA 4YWMA 2K75A 5F9LA 7ICMA 4UB4A 4EQ5A 1HNZQ 4QZGA 1X56A 2ZUBA 3OSNA 1UPHA 3HX0A 1T9HA 3BDLA 1N34Q 1VQFA 5LMNW 2E2JH 4CDCC 3MGIA 2JEJA 4G3IA 2ZXRA 1E2WA 1JB7A 3K57A 3FM9A 4BWJA 2XTIA 5J2JA 4NLCA 4HSVA 1HZCA 1MI2A 3RJHA 3K81C 2C9OA 4IRDA 2NTSA 2J7ZA 2JA9A 3TMEA 3WU2U 3PR4A 3TP8A 1QTMA 1XMOQ 5COYA 3LWLA 4A8EA 5L1IA 5HP4A 3N6RA 1CEZA 2XY6A 4M6WB 4CF3A 3FYHA 2Q8IB 5KT5A 4BDPA 5CR3A 4ICAA 2KCNA 3CC4A 2BPGA 2F0NA 3ULJA 2A8VA 4DR5Q 1SE2A 2N78A 3JAMi 3MC0B 5C0YA 2WF6A 3QEBZ 1K3RA 4A3EG 2JEAI 2KQ3A 1NCVA 3WKCA 3PMNA 3WK7A 8ICWA 4DV6L 3QU7A 4YR3A 2MGSA 4O3OA 3T53B 2RQXA 5I2XA 4HMIA 4DOCA 4GXKA 5KG0A 2MP1A 2NTTA 2HUGA 4YR0A 4RGTA 9ICBA 3BZDB 2F0KA 4HIKA 5K36H 1ILPA 2NN6I 4X3KA 1XO0A 2VIXA 5KFOA 1JX4A 4KHVA 1NNLA 4CE6A 1A6SA 5FP0A 4IUQA 4DFMA 2EZVA 5FJ8G 4M9NA 4DV7Q 1V43A 4RPYA 1V97A 4AH6A 2F44A 1SROA 4G57A 3M4OB 1JXEA 1H9KA 1TQOA 4UB5A 5KL8B 1JWUD 1U4PA 2JE6I 2R7FA 1OXVA 4OWTB 4IN3A 4J15A 5ALTA 2FPMA 1CTMA 1F2ZA 2DNEA 2W3SA 5AIAA 5CORA 1CZGA 1S8OA 3AMUA 4RU9A 2AJQA 3P1HA 1SIJA 4CHTB 3HJEA 3N52A 4QY7A 1SXEA 1U47A 1NK8A 2ZJ5A 2EXDA 2V4DA 1N61A 2XVSA 4L8JA 4MN3A 1BNPA 4ZKBB 1UWVA 2QA4A 2E5LL 3VDYA 4US9A 4DF7A 3FEWX 1DCZA 1XPOA 1Z00B 2MRLA 3ALRA 3R2IA 2W9AA 2KVSA 1JI7A 3B0XA 2M2LA 3TZDA 4AYBG 1L8LA 2ENBA 2Z8LA 1XC9A 3ERQA 3HOXB 3I1YA 4GKKL 2B21A 2M0NA 2ASBA 2CN1A 1N33L 7ICTA 2IHFA 2K5QA 2QDBA 2F0HA 4RKLA 3U58A 1IW7D 3RJJA 1S5CD 3FKIH 4AP9A 2RDIA 3J80E 2H3VA 5HHIA 2K5WA 2R8IA
chains in the Genus database with same CATH topology
1N36Q 1BVSA 1Y14B 4A3KH 2WB1E 1VQ5A 1XNRQ 1VQGA 2VQFL 1K83H 2UXCQ 4DV2Q 1MJCA 2R6GA 4BBRH 2PI2A 4C3HH 4P75A 1GM5A 2A1AA 2KCMA 4X62L 1VQOA 1X54A 4LF5L 2K52A 3M4PA 4GKJQ 2K5VA 4AYBE 1I50H 1WCMH 4QGUA 4LF4Q 4LFAL 1YHBA 3NBHB 4QJFA 4WJ4A 3S1NH 2C35B 4A3BG 3RN5A 1X3FA 4OO1I 4LFBQ 2PQAA 1PH8A 2MO1A 3RLFA 1XPUA 4DR3L 2KBNA 4DPGA 4KHZA 4PZ7A 4OX9Q 3GD7A 4KHPL 2QGQA 3J80i 5BR8L 3G6EA 1SN8A 4YHHL 1PA6A 4POGA 1SE8A 3NELA 4QIWE 2CFMA 2ZM6L 4HJ7A 4A3EH 1K9MC 4DV1Q 4A3LG 4JI3L 1GD7A 1EIFA 4ME3A 2IX0A 3CPFA 4X64Q 4YCWA 2OTJA 4UPAA 3HOWG 3F2DA 1I94Q 5IYBH 1W3SA 1X55A 2Q2IA 3ER0A 5FLMH 1XPRA 1C7YA 5LMNL 4B3RQ 1HNZL 1N34L 5C3EH 3EBEA 3TS0A 4MNOA 3T1HL 4P72A 1VQ7A 3AFPA 1KQSA 3J7A5 1MKHA 3AYHB 5IP9G 4HIMA 4GOPB 1J5EL 3BZCA 4Y52H 2MFIA 5FJ8H 3S1RH 5IYCG 3CCMA 2ZJRA 5IT9c 2HHHQ 3GTQH 1PVOA 3HKZG 4JI6Q 1VQAA 2YV5A 2CWAA 1XMOL 3NENA 2YYZA 4DUYQ 3CCLA 2JA8G 3PIPA 1HNWQ 1QUQB 1PH4A 4LF7Q 1CUKA 3I4MH 2LSSA 4DR6L 4A3IG 4DV5Q 1N9WA 4UP7A 3HOYH 3L0OA 1NTGA 2VQEL 1IBKQ 2K50A 1NMGA 4DR5L 4BXXG 3A0JA 4DR7Q 2JA6G 5C0XJ 2DGYA 4X6AH 2KENA 1YIJA 1VQ9A 2A19A 3JC66 3S14H 4DR4L 2F4VQ 1P16A 3PUYA 4BY1G 3ZJYC 3HKZE 1QVGA 4GN5A 1UE1A 4DV0Q 1RL2A 4X65L 3I4NH 1VS0A 1YJ9A 2R93H 1TWCH 3OW2A 3E9HA 1LYLA 1CKMA 4QL5A 4R4QA 3CMEA 3U4ZA 3RN2A 1IBML 1J6QA 4PG3A 4R4OA 3WWVA 4Y7NH 3B6YA 1OXUA 3KF8B 3H3VH 1PH9A 1L2FA 4DV7L 1PYSB 1OXXK 4GS3A 1QVFA 1VQKA 4NXMQ 2V1CC 2IX1A 4OO1G 2Y0SG 1IBLQ 3GTGH 3RLOA 2MO0A 3J7ZC 5H1SE 3AFQA 4GN4B 5M5WH 1C9OA 1TWFH 1MIUA 1Q86C 1EQRA 3U50C 1PFSA 1CSQA 1Z9FA 3U4VA 4B3SQ 1YITA 4L5RC 3STBD 1A62A 1VCIA 1FJGQ 1QVCA 2I5LX 2VW9A 2YU9H 1C0AA 1CSPA 1GO3E 1Y1VG 1EIYB 1S40A 1HNXQ 2I0QA 1VQBA 3S1QH 1B8AA 2B63G 2KHJA 4JC0A 4R4IA 3F2BA 4A3LH 4IFDJ 4LFCQ 4LF9L 1YBYA 2Y0SE 4A3JG 1I3QH 3ULPA 4DAYB 2RCNA 4FDBA 4DV4Q 3AQQA 3HOWH 5GAEC 4MTNA 4X66Q 4JI8Q 1JJ2A 1VQMA 2D0OA 3NEMA 1JJCB 2L15A 1WJJA 1OTCA 1QUQA 4OWWB 3TRZA 1IZ6A 4POFA 1N36L 1K8GA 2VL6A 5IP9H 1XNRL 4GOPC 4GNXB 3KLWA 4YCUA 1HR0Q 3CQZH 4DV2L 2UXCL 4P73A 5IYCH 3K8AA 3KFUA 5M3FG 1S72A 2F52A 2JJQA 4WJ3M 1X65A 3J81i 2LXKA 4IFDI 4GKJL 3EN2A 2JA8H 4C2MH 3S1MH 2OCEA 4LF4L 2K14A 5IYDG 2ZJQA 3HOVH 3GO5A 5LMUQ 1DGSA 1Q12A 4A3IH 4A93G 4DK3C 3PO2G 2Q2HA 3L2PA 4LFBL 1D8LA 2IY5B 2HIXA 2K4KA 4IOCA 3PUVA 1HZBA 2UUBQ 4OX9L 2JA6H 5C4JH 2UU9Q 3GTOH 4DK6C 1KIXA 2UXDL 2NVXH 2NVTH 2Q2UA 4A4IA 3OYYA 1U0LA 1Q46A 4DV1L 4TVAB 3RZDH 1M90C 4BY1H 3CCQA 3CF5A 2R92G 5JJIA 3I2ZA 5C44G 1JJGA 3PUZA 2OTLA 4NXNQ 3FHWA 2WFWA 5C0XG 1KRTA 1I94L 2R7DA 4JBMA 4B3RL 3S24A 1AH9A 3KF6B 4JI2Q 4DR2L 1A63A 2NN6G 1HH2P 2UXBQ 4AQYQ 3HOZH 1G51A 2RF4A 1E1TA 1B70B 2HHHL 1E3PA 1PH2A 4JI6L 1XMQL 1XNQQ 3UDIA 1UE5A 5JEAJ 4A76A 1X3GA 3A5ZB 1GVPA 4DUYL 1EUJA 1PHJA 3PO3G 3H0GG 5ELOA 2JA7G 1KRSA 4LF7L 2JK8A 4LF8Q 1HNWL 4LNQA 4HIOA 4OXPA 4DV5L 3S16H 1YI2A 1IBKL 4DR7L 1VQDA 2R7ZG 4GN3B 3BU2A 2NVQH 3G71A 1ASYA 4JBJA 4DR1Q 1UE7A 3CC2A 4JYAQ 3J81j 1BKBA 3E9IA 3F1ZA 2B63H 5M5YH 2F4VL 2IHEA 2ATWA 2OWOA 4A3FG 3I7FA 1PV4A 1KAWA 2BA0A 4C3IH 1P8LA 3CP0A 4GNXA 4A3JH 1PH1A 1K8AC 3CAMA 1VQEA 3TEHB 4DV0L 1A8VA 4UP8A 1X6OA 1CKNB 2Z6KC 3TREA 3UE0A 4C3JH 1VQNA 4MZ9A 2BH2A 1Y1WG 5EAYA 5BR8Q 1YVCA 4JOIC 4IFDG 1EWIA 1Z47A 3GTMH 1BBUA 4P71A 4JI3Q 4JI1Q 2I5HA 3K7UC 2CCZA 2HT1A 4GNXC 4NXML 2D62A 5DLQE 1YEZA 3SGIA 1NY4A 4YY3Q 5IWAQ 3JAMc 1Q1BA 3KDFB 1ASZA 1HZ9A 3CC7A 1TWAH 3PIOA 4JI5Q 4A75A 1O7IA 5HY6A 3GDEA 3HOXG 2E2HH 5GROA 4B3SL 1XJVA 4BA2I 2EIFA 4LF6Q 5IYDH 4AIMA 1N32Q 1D7QA 2BA1A 4HIDA 1FJGL 1L1OB 4A93H 3PO2H 3MXNB 1FGUA 1E7ZA 2DUDA 2I5MX 2N3SA 2YTXA 3STBC 4K0KQ 5ELNA 1HNXL 5GQOA 1YHAA 5JJKA 3MEFA 3PCOB 4LFCL 1UE6A 2R92H 5J3BA 4DUZQ 5C44H 3KOJA 3CCSA 4DV4L 3I56A 1YNXA 1E24A 4BBSG 2VQEQ 4A3BH 4X66L 1SMXA 2PMZE 4JV5Q 3PUWA 3HOUG 3S17H 4KLKA 4LUZA 4JI0L 1FL0A 3F8TA 4IOAA 5IE8A 1VQ8A 2CKZB 3DLLA 2VZAA 3UDGA 1WI5A 4GOPA 4APVA 5M3MG 1HR0L 4QQBX 3ULLA 2PQAB 2ALYB 4O2DA 3OTOQ 1CKOA 5IYBG 1G6PA 2BH8A 3RLNA 1MJEA 3CCJA 3I55A 1TXYA 5C3EG 4DV3Q 4H02A 2VNUD 4DAMA 2UXDQ 2OQKA 3PO3H 2JA7H 2JQOA 2MNAA 2UUAQ 4LW1A 5IP7G 4B3TQ 1G291 4RMFA 4DV6Q 2QEXA 1RIPA 4R4CA 3J81c 4L5QA 1X3EA 4GLXA 3BJUA 5JEAG 2N49A 4IO9A 2UUBL 1LTLA 5AJ3Q 2UU9L 2AHOB 3K80C 5GAHC 4HJ8A 2ES2A 2AKWB 2AMCB 4HJAA 1V1QA 2UUCQ 1Q8KA 3PGZA 1SRUA 3W1BA 4A3FH 1EYGA 4R1JA 4TQUS 3S15H 2GVAA 3M4OH 1OXTA 4NXNL 4EX5A 1HJPA 2NZOA 1NE3A 3UE1A 4A3CG 4R4TA 3CCVA 3D0FA 4LWCA 4BXXH 1Y1WH 1KC8C 4UY8C 4IPHA 1NMFA 1FVIA 4JI2L 1AE2A 1YZ7A 3A5UA 1OXSC 3PV0A 2UXBL 3PF4A 3HFZB 3CW2C 1L1OA 1VQLA 2YTVA 1UEBA 4BA1I 2N8NA 4X64L 2EQSA 4JG2A 3G4SA 1XNQL 1KHIA 3J80c 3CCRA 4JBWA 2KCTA 2NVYH 4B3MQ 1AE3A 2E5LQ 4LUOA 4LF8L 3HOXH 2JA5G 3T1YQ 4JBKA 4L5SA 2ZTCA 1N8RC 3S2DH 1L1OC 2XGTA 2WP8J 2HIVA 1NJIC 4JI7Q 3TS2A 3GTPH 4DR1L 4JI4Q 4GKKQ 1N33Q 2KHIA 1KD1C 2VUMG 4JYAL 5K36G 2E2IH 1EFWA 3GTLH 2WAQG 1JMCA 1QZHA 4IJHA 1WYDA 1L0WA 2PNHA 3PF5A 2AWOA 5M5XH 2VQFQ 3M4QA 4XIGS 4BBSH 4BY7G 5GADC 2Z6KA 1PH3A 1KXLA 2H5XA 1SFOH 1JE5A 4JOIA 4X62Q 2OQ0A 3HOUH 1Y1VH 4A3MG 4LF5Q 3G48A 2ZTEA 3K0XA 4JI1L 3PUXA 1GKHA 1K73C 4O0AA 4LFAQ 3DM3A 1B7YB 1U5KA 4YWKA 5M3MH 2K5NA 3RNUA 4YY3L 1YJWA 5E7NA 3Q8DA 5IWAL 3M3YH 5C4XG 4A3GG 2RHQB 2WAQE 2B29A 4L5TA 4DR3Q 4XTCS 1H95A 3CCEA 1XTDA 3HKSA 4JI5L 3W5OA 4HJ9A 1IL2A 3RR5A 3M9BA 1HZAA 4KHPQ 4OONA 4DR2Q 4YHHQ 2IT1A 4JCVE 4LF6L 2ZM6Q 1N32L 5JJLA 5IP7H 3CD6A 3CMAA 2MQHA 3D31A 1LUZA 1YZ6A 2LXJA 2AWNA 2PI2E 3I4OA 5HGQA 1XMQQ 3ERSX 4GLAC 4K0KL 1IBLL 4YCVA 3KJOA 2ZJPA 5M3FH 4HJ5A 4YWMA 2K75A 4RG1A 3E0EA 4DNIA 4EQ5A 3FKIG 1X56A 5LMNQ 1PH6A 1N34Q 1HNZQ 1T9HA 2E2JH 3T1HQ 2E8GA 1VQFA 2ID0A 3L7ZC 5LMNW 4DUZL 1TWHH 3HOVG 3S2HH 3EIVA 4A3KG 1JB7A 3CXCA 3M7NA 1I5FA 2XTIA 4PMWA 1J5EQ 1VQPA 4BBRG 4JV5L 1HZCA 3KYHC 4A3CH 3K81C 1M1KC 1PH5A 4KI0A 2JA9A 2K5HA 4NB3A 3KF6A 1S3OA 1XMOQ 1BBWA 4PZ6A 1WCMG 3H3VI 2ZTDA 2GN5A 3BZKA 4YWLA 1R9TH 4LUVA 4DR6Q 3OTOL 1SLJA 3IRBA 1YHQA 3CC4A 4IJLA 3ULJA 2A8VA 4DR5Q 4DV3L 4JI8L 2N78A 3JAMi 4DKAC 1JT8A 1A0IA 3RZOH 1K3RA 3CCUA 4A3EG 3HOZG 2UUAL 4B3TL 3ICEA 4DR4Q 2JEAI 2JA5H 5C0XI 1V9PA 4DV6L 1YJNA 1Q7YC 2GVBA 1Q81C 4IPDA 4X65Q 3W1GA 5AJ3L 2CQOA 5FLMG 4IPGA 4HIKA 2VUMH 1WOCA 2NN6I 2B3GA 3K7AH 3PSIA 1EQQA 1IBMQ 2UUCL 3M85A 3H0GH 4OWXB 1E22A 5LMUL 3UDXA 2CWPA 1NBWA 5FJ8G 4DV7Q 1V43A 1LM0A 3GTJH 4AH6A