1Q46A

Crystal structure of the eif2 alpha subunit from saccharomyces cerevisia
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords translation initiation factor 2 alpha subunit
publication title The crystal structure of the N-terminal region of the alpha subunit of translation initiation factor 2 (eIF2alpha) from Saccharomyces cerevisiae provides a view of the loop containing serine 51, the target of the eIF2alpha-specific kinases.
pubmed doi rcsb
total genus 54
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 1q46A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q46A01
4GNXB 1SRUA 4LF5Q 1OXUA 3GTGH 2NVYH 3S1QH 2KHJA 1X55A 4HJAA 1JJCB 3L7ZC 2IHEA 2VL6A 3UDFA 2IY5B 3GDEA 1NJIC 3HOZH 5GQOA 2VUMG 1YJ9A 4R1JA 3RR5A 2JA6H 1SLJA 1PFSA 4A3KG 1HNWQ 2YV5A 3H0GG 1NTGA 3W5OA 4JBWA 2F52A 1N36L 1YEZA 2HIXA 2PI2E 2XGTA 2VZAA 1K3RA 3CP0A 4A3MG 1KIXA 1VQKA 3K80C 3J81j 4B3MQ 4BXXH 5DLQE 4IFDI 4B3SQ 4PG3A 2QGQA 2UUBQ 5M3MH 5LMUL 4IFDG 1GVPA 1QUQA 5C44H 3W1GA 1CUKA 3S16H 2KENA 3UDIA 3CPWA 3PSIA 4JV5L 1HNXL 2JK8A 4P72A 1XJVA 2NZHA 1VQDA 1KRSA 1JB7A 3AFQA 4P73A 1IBKQ 4POFA 4ME3A 2R7FA 5GROA 1SR3A 5C4XG 1B8AA 2JA8G 4JI4L 3PIPA 1L0WA 4X64Q 3STBD 1HR0Q 4KLKA 3HOXG 1XPUA 3I4NG 4DV6L 1N34L 5C0XG 4YCWA 4DR5Q 2WAQG 3W1BA 1L1OB 4JBJA 4HJ9A 4ALPA 4UY8C 4A93H 2AHOB 1K83H 2K75A 4UP9A 3PUVA 4GLAC 3I4MG 4P75A 3TEHB 1HZBA 1X6OA 4BA2I 4DR6L 2JE6I 3KDFB 2CCZA 3JAMc 3J80c 4DV1L 3RLNA 5IWAQ 3IRBA 2PQAA 3UE0A 4X66Q 3T1YL 2I5LX 5IP7H 3PO3H 1D8LA 2YYZA 2E2JH 3K8AA 4GKKQ 4EQ5A 1W2BA 3U58A 2A1AA 2UU9L 1X3EA 4LUZA 1Q12A 3CXCA 1EYGA 4DV0Q 1Y1VH 2Z6KA 1XMOL 5JJKA 4AYBG 2H5XA 2JJQA 3CCJA 5IP9H 1IBLL 1VQLA 2Q2TA 1VQ6A 1YHBA 2BA1A 4QL5A 1B7YB 1OXVA 3CQZH 1IYJB 4DR1L 1HNZQ 3FP9A 4LF4L 4LFBQ 3VDYA 3GTMH 2MO0A 2ZJPA 4GN5A 1VQIA 1YJWA 5JEAG 3S2HH 2F3IA 4DR2L 1YHAA 4RG1A 4AQYL 1LTLA 5AJ3L 4HJ5A 4GOPA 1VQBA 2DGYA 4O2DA 4OONA 1UE1A 3U4ZA 3EBEA 3ERSX 4A3BG 1KQSA 1EWIA 4QGUA 5IYBH 4DR7Q 5BR8L 4GNXC 1UE5A 3PUYA 1S40A 1HNXQ 4JV5Q 4IOCA 2Z0SA 4JCVE 4A3EH 2KBNA 2OCEA 1P8LA 2DUDA 2UXBL 1GM5A 3J81i 4R4QA 4Y52H 4QQBX 1V1QA 3H3VH 4PMWA 4A3GH 3CC7A 2K5NA 3M4QA 4DK6C 3A5ZB 1N8RC 3F2DA 4APVA 4DV5Q 1LM0A 1VS0A 1Q86C 4DR3Q 1VQ9A 3S15H 1Q46A 4DV6Q 1N34Q 1N32Q 1IZ6A 1J6QA 4X65L 1V43A 5ELOA 5IY0A 4MZ9A 1Z47A 4J15A 1VQGA 4HIKA 3CCLA 2N8NA 1Q7YC 1QVCA 3RLOA 4NXNQ 4P71A 3M3YH 2VS1A 4LF9L 3TRZA 4NXMQ 4DR6Q 4LFAL 3KJOA 3F2BA 3OW2A 2Q2IA 3UE1A 4JI8L 1R9TH 3HOWG 4DV1Q 4HIOA 1TWHH 4YY3L 4HJ8A 1G291 3UDGA 3OTOL 3G6EA 3GO5A 3ZJYC 4A3FH 2UXDL 3BU2A 1QUQB 3H15A 3T1YQ 4DAMA 4PZ8A 1GD7A 1G51A 2YTXA 2N3SA 3S24A 3AYHB 4JI1L 4GN3B 3FHWA 1EFWA 3Q8DA 1VQ8A 2UUAQ 1UEBA 5LMNQ 4GKJL 4A3IH 4JOIC 1Q81C 2JA9A 4L5RC 2ZJRA 5C3EH 4A3CH 1L1OC 4LUOA 1K73C 2VQFL 1SE8A 4DV7Q 1IBLQ 1H95A 1S3OA 2AWNA 1KL9A 2VQEL 4LF4Q 1OXSC 4JI0L 1WCMH 1VQEA 4GLXA 2I0QA 3HOZG 4A75A 1B70B 4YHHL 1NY4A 4BY1H 4LUVA 1VCIA 2E5LL 5AJ3Q 4DUYL 1EOVA 2JA6G 1XNQL 4UP7A 2XTIA 4LF7L 2UUCL 2YTVA 1PV4A 2R6GA 2RHQB 1KXLA 3KYHC 2R7ZH 3CC2A 1KAWA 3HOYG 2B3GA 4DV2L 1P16A 2FXQA 3S1RH 2UXBQ 2PQAB 5JJIA 4C2MH 3FKIG 5M3MG 3J81c 5FLMH 1TWCH 1J5EL 3GTOH 5J3BA 3E9HA 3BJUA 1WYDA 3PO2H 2IT1A 5IYDH 3CCQA 1A8VA 2WB1E 4X65Q 1YZ6A 1OXTA 4R4CA 4UP8A 2K5HA 4YCVA 5E7NA 2ES2A 2MO1A 3CCRA 1PH5A 4L5TA 2L15A 3RNUA 1YNXA 1XMQL 2ASBA 2Y0SE 1Y14B 4C3JH 4O0AA 4GLVB 4LF9Q 5C0XJ 2IX0A 2A19A 4QJFA 4A93G 4GOPB 4JYAL 4HIMA 1Z9FA 3RLFA 4K0KL 2ZJQA 4A3LH 3OTOQ 2K50A 1XNRL 1JJ2A 4JI3Q 3M4PA 2NN6I 2F4VQ 1BVSA 1FVIA 2NN6G 3RZDH 4X6AH 2ALYB 2RF4A 1I50H 3H0GH 4OWTB 2R93G 1YZ7A 4GKJQ 1RL2A 4BBRG 1W3SA 4DAYB 3NELA 1EQQA 4A3DG 2VQFQ 2LXJA 5IP7G 1A0IA 3HOUH 3SGIA 3GTKH 3PO3G 4OO1I 4B3TL 1D7QA 1SMXA 1I94L 4JI5L 3I7FA 4DKAC 1SROA 3KF8B 1Y1VG 4YHHQ 3J7ZC 4GS3A 3KFUA 3KF6A 1HJPA 1JE5A 4DUYQ 1PH1A 4A76A 1PH9A 2RHSB 1XNQQ 4IPGA 1VQJA 2K14A 2AWOA 3GTJH 4GNXA 1CSQA 3CCSA 3I4NH 4JI7L 3CD6A 4OWWB 4JI2L 5FJ8H 5GAGC 1U0LA 3CPFA 4DV2Q 4BBSH 3M85A 1MIUA 4IJLA 1EUJA 2V1CC 4BA1I 3G4SA 1BKBA 1CKNB 3I4OA 1N36Q 4C3IH 3PUXA 5IYBG 4IPCA 2R92H 3TQYA 4MTNA 4OX9L 3HKZE 5LMUQ 1I3QH 4LF6L 1ASZA 2MFIA 1NE3A 3H3VI 3NBHB 3CC4A 4YCUA 1N33L 3S2DH 3G71A 4LW1A 1A63A 1DGSA 5IYCH 3F2CA 1HR0W 4A3GG 1VQAA 1C9OA 2D0PA 3GTLH 4B3RL 1X54A 2E2IH 1MJCA 4GN4B 2WAQE 2WP8J 5GAHC 5H1SE 1WOCA 4IPDA 2NVXH 2OTLA 1VQNA 3F8TA 3I55A 2QEXA 4JYAQ 1XPOA 3MEFA 4JI4Q 2ZTCA 3CW2C 3MXNB 1X65A 3G48A 1VQ7A 3S1NH 1AH9A 1JT8A 4Y7NH 1TWGH 1N9WA 1VQCA 5EAYA 5M3FH 4DPGA 1U5KA 4POGA 2NZOA 4JG2A 4JOIA 1VQOA 4KHPL 1Q8KA 3PIOA 2QA4A 1GO3E 1VQ5A 3S14H 1L1OA 2N78A 5ELNA 3LGJA 2YTYA 3E0EA 1KRTA 1RIPA 2JA5G 2ID0A 1I94Q 4C3HH 2BH2A 4JI5Q 3K0XA 2Q2HA 4QY7A 4A3IG 3TS2A 3GTQH 1AE2A 1C0AA 4NB3A 1QVFA 5C3EG 3UDXA 4X62L 3ER0A 4GOPC 1JMCA 2UU9Q 2UUBL 4A3CG 5HY6A 3EN2A 2I5MX 4JBMA 3HOVH 1E24A 3PGZA 1XMOQ 4YWMA 4BY7H 1FGUA 1WCMG 2AMCB 3WWVA 4JI2Q 3A74A 2PMZE 1SN8A 2GVBA 4BY1G 1O7IA 3AFPA 1IBKL 2K4KA 4JI6L 2WB1G 4DR1Q 1VQPA 1UE7A 3I2ZA 1BBWA 2OTJA 1PA6A 2R7DA 4DR2Q 3CMEA 2Y0SG 4AQYQ 2CKZB 1VQ4A 1HR0L 3DLLA 3PCOB 2GN5A 3L2PA 4YWKA 4PZ6A 4LF6Q 3HOWH 5BR8Q 1EIFA 4DUZL 1N33Q 3L0OA 3U50C 3S1MH 5FLMG 2Q2UA 2CWAA 4P74A 1E7ZA 4BXXG 3HFZB 1UWVA 2JQOA 3U4VA 1MJEA 3PO2G 4A3JH 5IYDG 1Q1EA 1Y1WH 1XPRA 1ASYA 2IX1A 4IFDJ 2VNUD 1YVCA 2JEAI 2ZTEA 3BZKA 1X56A 5C44G 3CMAA 1QZHA 2B63H 5JJLA 3TS0A 1WI5A 3CF5A 1AE3A 4X66L 2A8VA 1HZ9A 2KCMA 1WJJA 4R4TA 4GKKL 2NVTH 2JA7H 4EX5A 2BH8A 5GAEC 1KD1C 1A62A 3RN5A 1NMFA 1YBYA 4DV0L 4DV4L 4A3LG 4R4IA 4KHPQ 2VY3A 1E1OA 3TREA 1IBML 1E22A 3F1ZA 2HIVA 3K81C 4JC0A 4LFAQ 4HIDA 2LXKA 4JI8Q 1YIJA 4R4OA 1HNZL 4YY3Q 4LFBL 2VUMH 1PHJA 1WFQA 5LMNW 3M4OH 2UXDQ 1K8AC 3CCVA 3HKSA 3HOYH 1I5FA 4AIMA 4X62Q 1OTCA 4JI1Q 4A3KH 1YJNA 3FKIH 3HOUG 3AEVA 4DV3L 4A3MH 1GKHA 2BA0A 4DR7L 4H02A 2E8GA 1OXXK 1PH7A 2KHIA 3JC66 1S72A 4WJ4A 1E3PA 1CKOA 5HGQA 3HKZG 4JI6Q 2VQEQ 4JI0Q 4OO1G 2MQHA 4DNIA 1C7YA 4NPSA 3ULJA 3STBC 2E5LQ 4FDBA 5C0XI 4DV5L 2CFMA 1EIYB 4DR3L 2RCNA 3DM3A 5IP9G 5FJ8G 1I6HH 4LF7Q 1N32L 3NENA 2UUCQ 2C35B 5C4XH 1KC8C 4IOAA 1EQRA 3D0FA 2JA8H 4DR4L 2GVAA 5JEAJ 3HOXH 4DUZQ 1HZCA 2CWPA 1FL0A 2EQSA 1X9NA 4MNOA 2R92G 4YWLA 4NXNL 5M5WH 4NXML 3PF5A 4KI0A 5GADC 2R93H 1IXRA 2JEBI 2N49A 5IT9c 1PH3A 1J5EQ 4BBRH 4XTCS 3I4MH 1G6PA 1NMGA 2ZM6L 4UPAA 4A3EG 4A3DH 1HH2P 5IYCG 1Q1BA 2LSSA 2I5HA 1Q82C 1PYBA 1QZGA 1M90C 1NBWA 2HHHL 4BBSG 4TVAB 3ULLA 4LFCL 1XMQQ 5LMNL 1LYLA 4DV4Q 2UUAL 3ICEA 2K52A 1M1KC 1LUZA 2D62A 4JBKA 1IBMQ 2UXCL 4IO9A 4DV7L 3RZOH 2WFWA 2ATWA 2OWOA 4LF8L 1FJGL 3T1HL 1VQFA 4K0KQ 4PZ7A 4LWCA 4AH6A 4XIGS 5C4JH 2VW9A 5M3FG 4L5SA 1XNRQ 1HZAA 3M9BA 1L2FA 1VQMA 4LF5L 2NVQH 1K9MC 3D31A 4OXPA 3M7NA 3KLWA 3CCMA 2OQ0A 4OWXB 4KHZA 4DV3Q 3K7AH 4A3FG 2Z6KC 4RMFA 1CKMA 1MKHA 2EIFA 3PUWA 4A4IA 5FLXc 3NEMA 3CAMA 4B3TQ 4A3BH 1PH8A 3PF4A 1TWFH 1HNWL 3GTPH 3B6YA 1PH6A 3BZCA 3HOVG 3PUZA 4QIWE 4AYBE 2B29A 1PH4A 1PVOA 1K0RA 3KDFA 1TXYA 4B3ML 4BY7G 2YU9H 4B3SL 1KHIA 1X3GA 3OYYA 2D0OA 2IHFA 1PH2A 3AQQA 3RN2A 4DK3C 3KOJA 3KJPA 3J7A5 4DR4Q 1YI2A 2KCTA 2PNHA 3E9IA 3K7UC 2AKWB 2OQKA 4JI7Q 2HT1A 4L5QA 3ULPA 1JJGA 3A0JA 1CSPA 3PV0A 3EIVA 4HJ7A 2ZTDA 1SFOH 1T9HA 1YITA 4X64L 3I56A 2ZM6Q 1K8GA 2R7ZG 4JI3L 4OX9Q 1QVGA 2F4VL 3CCUA 2E2HH 2CQOA 4DR5L 1CKNA 1PYSB 1UE6A 1VQHA 4A3JG 1E1TA 1Y1WG 1YHQA 4IPHA 2MNAA 3CCEA 2HHHQ 2JA5H 1X3FA 4LFCQ 4LNQA 2B63G 4IJHA 1IL2A 5IE8A 4B3RQ 4TQUS 3J80i 3JAMi 2UXCQ 3GD7A 1V9PA 1XTDA 2EXDA 1TWAH 2K5VA 2PI2A 3KF6B 5M5YH 4LF8Q 3T1HQ 1FJGQ 2JA7G 1BBUA 5M5XH 4WJ3M 5IWAL 5K36G 2HQLA 3S17H 3A5UA
chains in the Genus database with same CATH superfamily
3AUOA 4NLZA 3GTGH 2EYLA 3S1QH 1T3QA 4HJAA 4BBSB 2WAQB 4O9MA 1JJCB 2EY6A 2IHEA 1NJIC 3HOZH 3MXNA 5EBDA 4NL9C 2K4EA 1YJ9A 3IFDA 4C3IB 2J4XA 2ASJA 4R1JA 2JA6H 3TQ1A 5DQHA 2XO7A 4QW9A 5AM5A 2CH4W 5ALFA 2FPMA 1I3QB 4YN4A 1PFSA 1DK3A 4UASA 4A3KG 3MGVA 1B4FA 2F52A 3S2DB 5E4WC 2D8CA 3J81j 3RFAA 3EPIA 1H9RA 2AGOA 4PG3A 2UUBQ 1A2TA 4IFDG 2KEYA 2NUCA 3PVXA 4F5RA 1S0NA 3SK5A 3UDIA 3G7LA 2F1MA 3HKZF 4DFDA 4B9LA 5DG9A 1ZD5A 2K8AA 4BDPA 4P73A 2JH1A 2DNCA 5FOBB 3OIPA 3W3AA 1XU4A 4DCCA 2M9NA 5GROA 1COOA 5ALDA 1X9MA 1PFMA 5IOCA 5C4XG 1B8AA 7ICIA 3ORYA 4JI4L 1L0WA 4KLKA 3E2EA 3BYTB 3G6YA 2ODGA 4KN4A 4I2FA 3R8BA 3V96A 1L1OB 4JBJA 5J0PA 1XXGA 4HJ9A 1EEFD 2AHOB 5KTQA 4ALPA 4BXOB 3U9OA 1TS2A 3MZ5A 1SZPA 4UP9A 4RHRA 4C8LA 2OEOA 3I4MG 3OSOA 3BQ0A 3TEHB 5KFZA 3TFRA 1SNCA 4K6LA 4BA2I 4DR6L 1FYCA 2EYMA 2H3FA 1ZQGA 2HHQA 2F0MA 4ICAA 2BQUA 2XIWA 2EYPA 1S0VA 3JAMc 4MFFA 1LACA 1ZQUA 5J0SA 3DEPA 3RLNA 1BCPB 4HCEA 1TS3A 1T8EA 1BR9A 5IP7H 2R8KA 1B43A 1D8LA 4GKKQ 2K60A 2KQ3A 2LI6A 4HSPA 2NRZA 3SAHA 1NK6A 3CXCA 4I7ZC 3O13A 2OXPA 3MFHA 1EYGA 1RYSA 3MC1A 1Y1VH 1JX4A 4IR1A 3T16A 1UEAB 4XQQA 2H5XA 4RPXA 5CORA 1BPDA 2Q2TA 1LKYB 5IP9H 5J2IA 4J9LA 2O2LD 3MVVA 3SEBA 5M9OA 1IBLL 2DY8A 1VQ6A 1SYDA 1NZPA 1KQQA 1IYJB 3ICXA 3FP9A 1CI4A 4FO2A 4LFBQ 2XY5A 2I6XA 1ZRNA 2KP7A 3S1MB 4DR2L 4EX6A 2XY7A 4PV1C 5ALIA 2C2RA 4DFPA 1VQBA 1UE1A 4O2DA 3U4ZA 4A3JB 3ERSX 1KQSA 4Y2VA 3N28A 1B9MA 1EWIA 1WG8A 5IYBH 4GNXC 2B63B 3PUYA 1S40A 3TAQA 4P0QB 2KJXA 4ZRZA 4Y2RA 4G7ZC 1P8LA 1TVAA 1D5XC 2F0PA 4H44C 4MHEA 1BCPF 2XRQD 9ICPA 4DK6C 1W6KA 3M4QA 4C7YA 2PI5A 4QZCA 1STGA 2QARB 5EE0A 2N55A 4DV5Q 2ZJ5A 3C28A 4B9VA 1VS0A 2HQLA 2O4XA 1IL8A 4DV6Q 1N34Q 3S15H 1J6QA 3BVMA 3WOFA 4J9RA 1HHVA 2F0JA 4OJLA 2W8LA 4F4XA 3M4OB 4I29A 1KKXA 2IW3A 3D2NA 4DQIA 2N8NA 2Z4HA 4NXNQ 3TBIB 5G5GA 1BPZA 1TKWB 2RSNA 5ALYA 3OW2A 3MBYA 1XSLA 4KLTA 2Q2IA 3FKIB 4JI8L 2KSOA 4DV1Q 4FF2A 3JPRA 1Y8OB 3HOWG 2W9BB 2QKQA 3A55A 3GO5A 5EE3A 2UXDL 4DF8A 2F0GA 4O3RA 3T1YQ 4WJ3B 2L4NA 4PZ8A 2YTXA 2N3SA 1GUSA 1GHKA 3E0JA 3S24A 8ICJA 1KTQA 3FHWA 1EFWA 3Q8DA 7ICMA 2BCRA 5LMNQ 4NL9A 7ICGA 4L63B 3V6HA 5E1FA 3T13A 2Y9TA 2JA9A 5DQIA 3LWLA 2G9HD 3NPPA 3MR3A 3PX6A 2LYBA 4LJXA 5HHHA 3DWPA 1S3OA 1FNVA 1TS4A 1KL9A 2SNSA 3SE0A 4EVOA 4JI0L 4LF4Q 2PFQA 1KSPA 1ZYQA 5F3XB 4B9UA 4GLXA 1SKSA 2KEDA 2I0QA 4N9PA 3QNMA 9ICOA 1B70B 3HOXB 3HOZG 1NY4A 4BY1H 3BQTA 2RRDA 1J97A 3UQ2A 4YR0A 5AJ3Q 1ZQRA 2ZIUB 1EOVA 4DUYL 2JA6G 4K8IA 1CHQD 5M5WB 1I6VC 1DOKA 2WF7A 2XCAA 2UUCL 3H0MB 5AIBA 2RDGA 1QB5D 3H8WA 2YTVA 4IC9A 3K6OA 2RHQB 1KXLA 3KYHC 2R7ZH 3T53B 3VR6A 2AH5A 1ZQOA 5J0QA 1S5BD 2B8FA 9ICSA 4FZLA 1STBA 2PZUA 3EROA 4FS2A 1EEID 3GTOH 3RH5A 1XC9A 3BJUA 3PO2H 2IT1A 2DBYA 3T5KA 2GLEA 5J0YA 4QZDA 4JW0A 5KEEA 4ELVA 3H94A 2MSNA 1O7YA 3IP4B 1FD7D 5ALVA 1CA5A 3CCRA 5AKYA 5GTIU 5KT7A 5I9PA 3Q22A 2X6GA 1TKDA 2Y0SE 2B2VC 1Y14B 4LF9Q 1EIHA 4Z6EA 2BPFA 3QU2A 1CK1A 1Q3LA 3ONNA 1WTHA 8ICMA 2RDFA 1IYUA 2ZJQA 1D5MC 1H9MA 1RODA 1EWCA 4JI3Q 3M4PA 1W6JA 5AI0A 2W9MA 1BVSA 1O03A 2LYHA 4J9KA 9ICFA 2K6AA 3WKCA 1FVIA 3RZDH 1AFPA 4IR9A 2ALYB 1RXVA 1QCBD 5AI9A 1TWFB 1D8YA 4QWEA 4DAYB 1SXDA 5KT4A 5FP0A 1EQQA 2KHSA 4A3DG 5J22A 1JB3A 2KCNA 2LXJA 5IP7G 2VQFQ 5IIIA 3HOUH 1DGJA 3GTKH 4O5EA 4OO1I 1I94L 5DB8A 1UUPA 4JI5L 4HTHA 4OHJA 1CHPD 4NKLA 4P2CB 5HR7A 4TUQA 1Y1VG 3KFUA 4EYHB 3RB0A 3KF6A 2W9CA 4RCNA 5KG0A 4A76A 4OO1H 2K14A 1SJHD 2L5TA 4GNXA 1SFOB 2BR0A 3M8SA 1L3TA 7ICTA 1JOQA 4NLNA 2ESEA 3CCSA 1G91A 3JPPA 4OWWB 1ZOLA 2B2WC 2B2YC 5FJ8H 1CZGA 3CPFA 1VJ5A 4RQ8A 3B0XA 1ML0D 5DBBA 3GZFA 1EUJA 2V1CC 3TP5A 4BA1I 4US9A 5BN5A 1OW5A 3G4SA 3I4OA 1TR5A 4B9WA 2DN8A 5IYBG 2G08A 2R92H 1QILA 4F8RA 2O6KA 1Q90A 3MR6A 3D2SA 3HKZE 3EWAA 4LF6L 1JUDA 5J0RA 1RDPD 3J81L 1CQVA 1HUNA 4YCUA 1N33L 5JAVA 3G71A 1DGSA 1EY8A 2L1BA 4M6WA 4PNYA 2DFLA 2D0PA 2KJ9A 2NVYB 2N88A 4C56C 2RVLA 4K6DA 4KX5A 2WAQE 2OHFA 3KHGA 2BQRA 2I9GA 1R4PB 2WP8J 3SI8A 2Z6BA 3M9MB 3I55A 2NVXH 1DONA 1B3QA 3C1FA 1KNAA 3MEFA 4JI4Q 3IRUA 2X6LA 4K2LA 3MXNB 2E2DC 4TUPA 3G48A 1VQ7A 3SZ2A 1HQRD 1QG7A 4J9QA 3S1NH 1AH9A 1JT8A 2DWQA 4Y7NH 1JXLA 4JK1C 5M3FH 1BQQT 2NZOA 2VJ5A 1Q8KA 4QNLA 3RBEA 5KFTA 3PIOA 4O3NA 4ED6A 1IW7C 4DS5A 1HRJA 3LVWA 3LGJA 1TFRA 1KAAA 4HSVA 1KFTA 2KEEA 2NTTA 3KD3A 4I2IA 4DAVA 4QIWC 3M7DA 4AYBC 4DF4A 1EWHA 1RIPA 2ID0A 4KK7A 3JPOA 1KRTA 4ECSA 4C3HH 2BH2A 1SYGA 3S16B 2NV3A 3V7KA 5KG1A 4TUSA 2HOIA 2KUMA 3N6RA 5ALMA 3K5MA 9ICEA 1QQ6A 3CKIB 4JBMA 3K75D 1SL1A 5CGKA 1BBXC 3KBXA 3PGZA 5DB6A 1FGUA 3W2DA 3WWVA 1L7NA 2C2EA 4UB3A 2K32A 3A74A 4BY1G 2UVWA 4YXJA 3AFPA 3BDOA 4TRDA 2WB1G 1X9SA 3PR4A 3J7AV 3BS5B 1K83B 2B21A 3VCBA 4DR2Q 4R64A 1HR0L 1VQ4A 4CF5A 4YR3A 4PZ6A 4RQNA 4U7CA 3Q8RB 3SR1A 5FLXE 4K14A 4ED8A 2K01A 4BJQA 4M47A 4KTAA 3K5NA 2YX8A 2Q2UA 2B2VA 3I70A 4BXXG 5CB1A 3HFZB 2R8HA 2Z1CA 3PO2G 3PO3B 3TAPA 1XPRA 2IX1A 1TAQA 5AI8A 4XRHA 2ZTEA 4UAYA 2C22A 2ZUCA 4B9NA 4KKSA 5AKGA 5C44G 4ID6A 3N97B 1WI5A 1J2MA 1TE2A 3CF5A 1ZXIA 1HZ9A 2KCMA 5DB7A 1U4PA 1IYVA 1WJJA 3RH6A 2VA2A 5JOBA 4CJ0B 3ND9A 1JOKA 2JA7H 4R9WA 3RJGA 3GTMB 4B9SA 4C8OA 2TSSA 2Q8RE 4K2KA 1SWVA 1E1OA 5CV9A 3TREA 2NYVA 1IBML 2L0CA 3MR2A 1D1IA 2HIVA 4JC0A 4HIDA 4JI8Q 1VMPA 2QKIC 4R4OA 3I72A 5DLFA 2VUMH 3SENA 2UXDQ 1A76A 1K8AC 5HNKA 4FO6A 1GUWA 2BCUA 4DA2A 2JP1A 4PMBA 1IKMA 4AIMA 3PMFA 5LL6S 1KDAA 3QUQA 4X62Q 2QB0A 1O08A 3HOUG 3D2QA 1SE3A 2F0UA 4ECVA 3C2MA 4A3MH 3MEHA 4DR7L 4H02A 4A3GB 1OXXK 2B2WA 2KHIA 2K8BB 1Z4OA 3JC66 2DKXA 3H4DA 3QEAZ 1II3A 1QCKA 4Q0FA 5J2KA 4JI0Q 2OT2A 4Q8FA 4DNIA 2ZUDA 4OO1G 2F2AB 3IL8A 4NPSA 4CJ1B 4J8QA 2WKCA 8ICLA 1NUCA 3STBC 5ELEA 5C0XI 5ELBA 1CM9A 5ALRA 2ISOA 4UATA 3DM3A 4X3TA 5FJ8G 3C3LA 4F4YA 1AW7A 2UUCQ 2C35B 3QOJA 3D0FA 1JOOA 1TWHB 9ICVA 1QNKA 2M9VA 1HZCA 4DUZQ 1HFNA 3BDLA 5CR3A 1X9NA 4DL5A 4MNOA 1EY0A 1UA0A 2R92G 5CV6A 1EY7A 4NXML 4DQQA 5IILA 1F2ZA 2K04A 2JA5B 1IXRA 5EE1A 3EYZA 5IT9c 5KT3A 2LBOA 4UB4A 2ZM6L 3DHQA 2Y1JA 2JV3A 1HH2P 1LT4D 5IIMA 9ICAA 1Q1BA 2I5HA 3V6JA 4JK1A 5J2AA 5M5YB 3KHRA 2BZFA 1L0YB 4M9GA 2GO7A 4F5NA 1WCMB 2VB3X 2K52A 1M1KC 1LUZA 2D62A 1X42A 1TT2A 5KL8B 3RZOH 1K28A 2WFWA 1S5LU 2ATWA 3NVWA 3IHQB 5M3FG 3LX0A 2D6FC 2NVQH 1VQMA 4UB2A 5E79U 2W3RA 4X5VA 3OMGA 3S1RB 3KLWA 4XT3B 1EYAA 5HR6A 1XX8A 3E0FA 4DV3Q 2ZJAA 2KMDA 1FNWA 2L55A 1NI3A 1U47A 5KFSA 1PTOF 4RMFA 2CHBD 5E4XA 5CJ7A 1IW7D 4C3HG 4DFJA 5KYIA 2IJ0A 2ZJ8A 4I2BA 7ICQA 4R63A 3NEMA 3M9NB 1KBUA 4OIKA 5L1KA 2YMLA 5KFRA 1VQ9A 1QQ5A 4NLGA 3CRXA 1S97A 3I8ZA 1PH6A 4YQWA 3RBDA 2BDPA 3NSWA 5KFWA 2FDRA 4M9JA 1TXYA 2ASDA 5EKLA 3DEOA 4P2HA 1X3GA 1N48A 4F2RA 4RGNA 2D0OA 4F4ZA 1IKLA 1PH2A 4MEYA 1EU3A 4B9MA 3KOJA 4ABNA 3KJPA 2G07A 2ZXIA 3IV6A 1KTKA 2PNHA 2K4IA 3E9IA 3K7UC 2HT1A 1PLFA 4A8EA 4L5QA 3A0JA 2YY6A 1CQFA 4O3MA 3C23A 3GV6A 5KNIA 1LKYA 2H4OA 3I56A 4ECXA 1FO4A 3OWEB 5IGGA 2LKVA 3OPOA 1K8GA 1SE4A 1PTOH 1F9SA 1KFDA 4RPZA 2A3VA 3A56A 4DR5L 1QVGA 2FI1A 1UE6A 2JA5H 2QEJC 3D4RA 5DLGA 2H3ZA 4AP9A 4IPHA 2E5SA 4LNQA 1SXEA 4Y2JA 4R8IA 5CEHA 5HP4A 4C80A 2JYOA 3R93A 3L3OC 3HT3A 4GC6A 3NBHA 2KJ8A 4FZNA 2Z7JA 1PVQA 3KF6B 1TWAH 3Q8PB 2W9CB 5KIXA 5M5YH 1WVLA 2JA7G 3GTJB 4WJ3M 5KFPA 2FMSA 3A8KE 3S17H 4C1NI 8ICTA 4GNXB 4NLKA 5CP2A 3C2KA 4NXZA 1RYUA 3FPPA 3TI0A 3TN2A 4HYKA 1Q3VA 5D4BA 1LB2B 4QZBA 8ICOA 2HSZA 1WWVA 1U4BA 1SNMA 3ETLA 3GDEA 2VUMG 2MUTA 2EJGC 1Q8IA 3AMUA 4K4GA 1PK3A 1H9SA 2NZ1D 4MF2A 1SLJA 1MSHA 9ICGA 1MN8A 2YV5A 3H0GG 1NTGA 1LT5D 4CHTB 2XGTA 4A3MG 2VZAA 1K3RA 1VQKA 5BOMA 3H8MA 1RJTA 4FF1A 4DL6A 5DLQE 2DJFC 4DNRB 5CBEE 2V4RA 4B3SQ 4IFDI 4M6WB 1GVPA 1M8AA 3W1GA 2HUGA 3KOOA 2KTQA 9ICNA 1LLRD 4RQ4A 3CPWA 2A6EC 1CI3M 2F8KA 2NZHA 2PNRC 4JV2A 3TKAA 5CV5A 5KNBA 4POFA 4ME3A 4ZYSA 1KLNA 1N60A 1B2TA 5AKEA 4C8NA 1V1PA 2YB1A 4X64Q 3STBD 1HR0Q 1XPUA 3I4NG 3R2IA 3MDAA 2YMQA 5ALTA 4DV6L 4EX7A 5C0XG 4RWSC 1N34L 1PVPA 4A93H 2F0VA 1PDQA 3T4AC 1RDFA 4Q44A 4GLAC 2GWSA 3GTQB 4P75A 2LHTA 2NN6H 1X6OA 3ZDDA 2NO4A 2GA4B 3QUBA 1XO0A 1BPYA 2JE6I 3EJIA 4ZH4A 3N7SC 1ZQPA 5K5PA 3SVMA 3KDFB 2BCSA 2CCZA 4DV1L 3HOVB 1GO3F 4LVSA 1SXTA 2FINB 3UE0A 3T1YL 2V4QA 1WD1A 2DPIA 3RJJA 4ZKBB 2EJFC 2OEHA 1ENFA 3U58A 1XWEA 8ICPA 4KD4A 1W2BA 3QUTA 5BPCA 4B9TA 4ILWA 2LS01 5JJKA 4FXDA 2JJQA 3CCJA 1WTWA 4QL5A 3WOEA 1B7YB 5KFXA 2QDLA 4CNQA 3CQZH 4EQNA 4LF4L 1D5ZC 3HOWB 5AM3A 4EZ9A 2F0NA 2MO0A 1ZQAA 1YJWA 1SYCA 2KK0A 4JV1A 1A3UA 4RG1A 4AQYL 4HJ5A 4UAUA 2JGAA 5AJ3L 2PZTA 3KZXA 1S77D 3A0HU 1Y1WB 2VIXA 4QGUA 1FFVA 4DR7Q 1I4PA 1ZQMA 1UE5A 4JV5Q 5J2FA 3RRGA 4JCVE 4CKBA 2F1HA 2OCEA 1F0MA 2DUDA 2FHTA 2BPGA 3J81i 8ICKA 1GUOA 4R4QA 4Y52H 4PMCA 1GJXA 4F4WA 2HMXA 5KYLA 4O3SA 4RQ3A 5DQGA 1V1QA 2EZYA 3N7PD 3CC7A 2K5NA 1K1QA 3A5ZB 5J8YC 2KN7A 2BKEA 2VA8A 4APVA 3IG8A 2KKVA 3NVVA 3M4YA 2PZWA 2XVTA 1V43A 3OMCA 4X3UA 3RMHA 1SE2A 3PSTA 1ZYRC 1J8IA 3N7RC 5IGFA 1PK1A 4J15A 2HHWA 4IALA 1LTBD 1VQGA 4UB5A 4ZCKA 1HPCA 4HIKA 1QVCA 5I6YA 5AK6A 4GFJA 1ZQFA 2I07B 1Q7YC 4LF9L 2HHUA 4NXMQ 1AQ6A 3TRZA 3F2BA 2NYZD 1AEXA 4PGQA 4Z6FA 1G291 2W7OA 2F44A 2VKQA 2KJ5A 3AQFA 3BU2A 4RUAA 3H15A 3UM9A 1QSLA 5KFEA 1M4VA 3FMCA 3MR5A 5ALJA 2AGQA 2KNJA 1QSSA 4F5OA 1ICFB 3J80L 2WF9A 3WKEA 2H3QA 3WK8A 2KOLA 2AJQA 3FPUB 4LUOA 2VQFL 3EVQA 2HOQA 4M04A 3M7GA 1SV0C 4ZUJA 5HGTA 5CR0A 4FF4A 2JA8B 4DOCA 2UVRA 4DNTB 4RPYA 5AKZA 2L12A 4K4IA 4PPXA 5AI6A 1BNZA 4LF7L 2HD3A 3S9WA 2R6GA 2XIDA 1E2VA 1X3PA 1NJXA 1UAPA 4RGOS 3OPXA 1YNJC 3G6JB 1KAWA 1MI2A 3HOYG 4A3DB 2WINB 2VA3A 1QNUA 2FXQA 2UXBQ 2NRWA 2PQAB 4R8UA 1PRTC 3H8JA 1NK0A 1J5EL 5L1JA 1K3BC 2FJ2A 3MAQA 4QW8A 2F3VA 5J0OA 3Q8SB 2KD1A 4QWDA 3NWSA 3JPNA 2LMCB 3PMNA 4X65Q 5E7NA 2K5HA 2RQ5A 1U9LA 4UB1A 2KG5A 3A0BU 4QIWB 4L5TA 4AYBB 4DU9A 1YNXA 1XMQL 2BGWA 2ASBA 2DGZA 4MN3A 2HDMA 1U49A 1BNOA 2DY7A 3C1EA 4O0AA 4C3JH 2JHDA 4QF4A 2P5ZX 5IIJA 4EGVA 3K59A 8ICEA 2MPMA 2HBJA 2VXWA 3HZXA 1QE6A 4A93G 2AU0A 4HIMA 2PKEA 2J6TA 1Z9FA 4A3LH 2F77X 9ICKA 2F0WA 2PO4A 3PIO3 2WAQF 2E1EA 4O42A 4IS7A 1ZQWA 3BS5A 2NN6G 4A3BB 2B2UC 5ALPA 1F9PA 2K5WA 4X6AH 4OWTB 9ICRA 2R93G 3ITPA 4CDEC 1ZQZA 3GTPB 5B5EU 3T79A 1WTOA 4BBRG 2XICA 4GKJQ 3QU9A 3K58A 2IMWP 3SGIA 3TZUA 1Z4NA 3F5EA 1SMXA 3DUZA 3WU2U 3D4DA 2RSOA 3I7FA 1SROA 2ICEC 4IRCA 3J7ZC 3SAGA 1Z1VA 3GP7A 4K5XA 1PH1A 2F1IA 4TKOB 2RHSB 4IPGA 3SYZA 4O0IA 4KHVA 8ICHA 5EWEA 2AWOA 4LMQD 2XGQA 1CSQA 1JALA 4OGQC 1EL0A 3CD6A 3C2PA 4EENA 3LNNA 3T5HA 9ICJA 2HQEA 5GAGC 4DV2Q 4DSIA 3KK7A 4MHVA 4BBSH 1MIUA 1L3UA 1DOQA 1RCVD 4KTQA 3WK9A 1N5WA 3PMLA 3BQ2A 4KLJA 4CGZA 4C3IH 5J8YA 4RGMA 2JH7A 1JI7A 2NRVA 3M8RA 4IUNA 3K5OA 1VF5C 4MTNA 5FK9C 4DGZA 4QZIA 2HCIA 2PI4A 2SEBD 1I3QH 2KE7A 4QZEA 5ALOA 1CZWA 5EQ0A 3NBHB 3CC4A 3J7YW 3S2DH 4LW1A 5KNCA 3OHAA 5IYCH 7ICSA 3M6ZA 1C9OA 3ZYYX 4DWIA 4NM1A 5KG4A 3B0YA 1MJCA 2B0CA 2XSCA 3E3XA 1WOCA 4IPDA 3DM1A 4DXGA 4JYAQ 4XYOA 3IG5A 1PXUA 3UQ0A 1X65A 2WKDA 5KFJA 4KJNA 2MUTB 1GOZA 1N9WA 1HTLD 1H9SB 2W03A 1U5KA 1NK8A 1KEJA 4JG2A 1QOHA 1GO3E 2XVSA 4E6IA 3RJIA 4KLHA 2YTYA 1NOMA 2X69A 3C21A 5ALQA 5KFAA 1FEZA 2K05A 1NKEA 3E0EA 4WRDA 5CV4A 5T1GA 4DSFA 2RDHA 3NQTA 5M3MB 2BDUA 1SV0A 1TAUA 3ZDBA 3MDCA 3NRZA 4ED1A 2Q2HA 5T14A 1S8OA 1PYWD 3C1YA 5DGAA 4GXIA 4DQSA 1E2WA 3NXWA 4X62L 3ER0A 4GOPC 5DG7A 2ALZA 1QVFA 5DEHA 3PY8A 3EN2A 1A3TA 1E24A 1F2MA 1X3QA 2HDLA 1TIID 4EELA 7ICNA 4YWMA 3PIP3 1FGBD 4MIUA 1NCVA 1V1PB 2ICIA 3EQLC 1O7IA 3D4WA 1IBKL 2K4KA 3HPOA 4YVZA 4ELUA 2VJ4A 1VQPA 1UE7A 4N8X1 3X3MA 1BBWA 4Q8EA 2QDBA 5JPNC 3HS0C 3I3CA 2R7DA 1TVXA 2B8GA 3CMEA 2Y0SG 4AQYQ 5LL6X 4F8MA 3PCOB 4TQSA 5KFGA 4YWKA 2AQ0A 5L37A 4U673 1OO9B 3GILA 4DUZL 3U50C 5DDYA 1YNJD 3S1MH 4UAVA 3UMGA 2KZMA 3HGBA 4P74A 3PSPA 5D14A 1UWVA 1MJEA 4A3JH 3C5GA 2E2JB 5AK3A 1PRTD 3NTHA 4YR2A 2MUYA 2B63H 1X56A 1L3SA 4DK0A 1SZHA 4FYDA 4CDCC 3H0LB 4DO9A 1KLGD 1YNNC 4X66L 2ENBA 1LTSD 4I2HA 4KKTA 1D1KA 4RQ0A 4R4TA 3BYYB 4C3JG 2B2UA 5CC4A 1JXEA 4QCLA 2KIVA 3IM1A 2EVBA 2BDOA 4DV0L 5IIKA 8ICQA 1S5FD 5I4DA 4A3LG 4KHPQ 2G9DA 3S2HB 4OELB 1E2ZA 4RQ6A 1E22A 3F1ZA 1CFMA 3D8GA 2LPEA 3AL0B 4KY5A 9ICUA 3RJFA 4XXEA 3M4OH 2NWGA 1O78A 2F0TA 3HKSA 3IKJA 5C3XA 1I5FA 3ZDEA 1FFUA 3SV3A 4RA8A 1OTCA 3GIMA 5KT2A 3FKIH 4G4KA 3AEVA 1FNUA 1KNEA 4DV3L 4QWBA 3K57A 2EAPA 4C4RA 3L9AX 3C5FA 5FKAC 2GH1A 3VYUA 5I9OA 4M0AA 1S72A 5BN3A 3HRDD 5KFKA 2AUJD 5HGQA 3HKZG 5J0XA 1B0XA 1C7YA 1DOMA 3H8SA 2EZZA 4YMOA 5EJWA 1GXDC 2FPKA 3M3YB 1PK1B 4RNMA 3UPQA 1F2YA 2CFMA 2NBFA 2RCNA 5IP9G 3URYA 1EIYB 4LF7Q 5IT9E 3NTKA 4I2EA 4IOAA 1R9TB 1YT3A 5KFLA 2DL0A 2GVAA 5JEAJ 3HOXH 1Y8PB 3AU7A 4RT2A 1EQTA 3VA5A 5J0UA 1LABA 5M5WH 3J81E 3PF5A 4QWCA 4CRXA 1GUGA 3C29A 3D6WA 5GADC 2N49A 2JEBI 1PH3A 1J5EQ 3EUB2 1HUZA 3N52A 4A3IB 1NMGA 4UPAA 1A77A 1SNDA 4ELTA 3QO2A 5AKIA 5C3EB 5IYCG 4CF4A 1CEZA 1PYBA 4RQ7A 1EZ8A 4R8NA 1QZGA 1NBWA 3TP8A 5ALHA 8ICWA 1XMQQ 4DV4Q 4NWIA 4XA5A 2ZT9C 3ICEA 4CDDC 4JBKA 1RTOA 4USAA 7ICFA 4NLBA 4XT1B 2XC9A 4DV7L 4IO9A 1SV4A 1EY4A 4YMMA 2ZXHA 3FM9A 2OWOA 3WDNA 1RTNA 4CE6A 5NUCA 3UI2A 4XIGS 4RNNA 2VW9A 3PO4A 4QUFA 4DSEA 4BUGA 1L2FA 4PQXA 4UDUC 5EKKA 5EPJA 3D31A 2FMCA 1BPBA 2OQ0A 3M6KA 4RQ2A 4C2MB 4RFBA 4DL2A 1JWUD 4R8UB 2WHEA 1TWCB 2Z6KC 5DM63 5EWFA 1WYGA 2Z8LA 1QQ7A 4WFN3 3CAMA 2HCCA 5KFYA 3TANA 2KVSA 1TWFH 3PF4A 2KZ3A 1T4GA 5J0TA 3ZD9A 3B6YA 3BZCA 4QIWE 3BVZA 4AYBE 2B29A 1PH4A 1ZQQA 5CBAE 4RQMA 4F87A 3KDFA 2HDOA 4B3SL 1T5EA 1XO1A 1O80A 2K4HA 2IHFA 4G3IA 4GC7A 1B1ZA 4Q5VA 3RN2A 4LZGA 4DR4Q 1YI2A 2F0IA 2EJMA 4DF7A 2OQKA 3BS7A 1K5OA 3QX7A 3K1ZA 3TFSA 3QXGA 4RH6A 1JJGA 3OSNA 1CSPA 4I2AA 1ZEQX 3A8JE 5D65A 2ZTDA 3H0GB 1SFOH 1MC8A 1SIJA 1T9HA 4F71A 4ZKCB 3H40A 4ED2A 1EZ6A 4X64L 2R7ZG 3RB4A 4KLIA 2BE5C 4I65A 3KHHA 4ED7A 2CQOA 5DAUA 3NUCA 1PYSB 1C4QA 5KG6A 1E1TA 4A3JG 4M9NA 1X3FA 1Y8NB 5H2FU 2B63G 5KFFA 4UARA 1ZQBA 3NP8A 1AZPA 1ZJMA 2PYKA 2WFAA 4P4OA 4XUSA 2BCOA 3J80i 2UXCQ 1GHJA 4ZAIA 1N63A 1BNPA 2F0FA 2PI2A 1FJGQ 2E8NA 5DB9A 3T1HQ 1B50A 1NKBA 1YNND 3I4NB 1SRUA 3JPTA 2NVYH 2FLPA 1D8BA 3P7JA 9ICBA 9ICWA 1HUMA 2IY5B 3NQIA 5GQOA 3QU5A 1L5UA 2QF7A 4RCOA 1RPLA 1N62A 1Z00A 5KFBA 3RR5A 1VDZA 5AI5A 3FYHA 3RJKA 1J9OA 3H4BA 1S9FA 3ISCA 1C8CA 3OTQA 4PHDA 4B08A 1HNWQ 1PZNA 2XNAC 3W5OA 2G5IB 1N36L 1S4ZA 1YEZA 4GXJA 4FBUA 2Z4IA 3BDPA 5KT5A 2WB1C 3VYTA 5FLXL 4A3EB 2PXIA 4B3MQ 7ICPA 5I2YA 2OXOA 3FC4A 5DBAA 4QZFA 5LMUL 3WK5A 4P4PA 3EFXD 1CUKA 1B44D 3S16H 2JR5A 4RHSA 3PSIA 1DM0B 4JV5L 1A3VA 4JVZA 5BN4A 1XJVA 2B2YA 5C5MA 3NGDA 1KRSA 5AICA 1I4GA 1IBKQ 2FPLA 3U9SA 4V190 1A0PA 2K5DA 5KFUA 2R7FA 1JN3A 1TWGB 2ZG6A 7ICUA 4DFKA 1SR3A 1R4QB 1ZD2P 3PIPA 1HXYD 3HOXG 3S14B 5CWRA 2PQEA 4DSJA 5DM73 3W1BA 4UY8C 4OJOA 2B6GA 5AM1A 3QUCA 4A3FB 1K83H 3DMUA 5ALSA 3KUPA 3TSSA 2W55A 3KHLA 1HFGA 2R8JA 4RNOA 1HZBA 2IOHA 3NBIA 2J6UA 2J0TD 5FO9B 2EOTA 3KLSX 4DN4M 1XSPA 1JWMD 8ICCA 1X66A 5IWAQ 4KX3A 2RA4A 2PQAA 1UA1A 5J2BA 1JWSD 4X66Q 5A2QL 4BY7B 3PO3H 4NLCA 5J0WA 2YYZA 1PZKD 2EAOA 5CHGA 1SAPA 2UU9L 4I28A 1X3EA 4LUZA 1Q12A 4DV0Q 4PHAA 3G6VA 1PRTB 2Z6KA 2BHNA 2KVCA 4C0ZA 3T3FA 1LO5D 5AM4A 3RJHA 4U68A 2F03A 1VQLA 2BA1A 1EOTA 1KW4A 1NR4A 2EQYA 2K8CB 3VDYA 3GTMH 1L8LA 4XQ8A 2RKSA 1VQIA 2F3IA 1TK0A 2WIIB 1LTLA 5GTHU 1T94A 2XCPA 2A73B 2GOLA 2HW3A 2JSOA 3OHBA 3AB9A 5DDMA 4CJ2C 5BR8L 4XQJA 1I4RA 1HNXQ 4DOAA 2Z0SA 4A3EH 1WTPA 1L7MA 5L1LA 2YB4A 1I4QA 3ZDAA 1A15A 3H0RB 1U4LA 1NK4A 2UXBL 1GM5A 3HX0A 4O3QA 3MFIA 7ICRA 2K4PA 1QJOA 4FP5D 1COKA 1EXNA 2NVTB 3H3VH 2K89A 1EY5A 3KTQA 4PMWA 4A3GH 2RHFA 1MBYA 3F2DA 1LM0A 4ZQ3A 1LTID 1Q46A 2Y9UA 4HMJA 3SK4A 4YG2A 4X65L 5JTIA 4DEZA 1Z1BA 1PRTF 1BGXT 1XSNA 1EQVA 5ELOA 4QWAA 4KLLA 1H9JA 2KICA 2ZUBA 4R66A 1NJZA 3CCLA 1JC7A 4P71A 3HOYB 4LFAL 2HVHA 4A3KB 3QG1A 1I50B 3UE1A 5IGBA 4I2JA 5DKWA 1TWHH 4HIOA 4CDFC 4A3FH 3ZJYC 4RKBA 4Y2UA 1MSWD 3RH4A 9ICXA 1QUQB 1BPEA 2MP1A 1PFBA 2KCCA 2BE5D 9ICMA 4EQOA 5ALWA 3CHBD 1JIHA 2RP5A 4C4SA 5AKLA 3AYHB 1ZQHA 2M0NA 4GN3B 3JAML 1VQ8A 1H38A 4GKJL 1UEBA 3Q8KA 1RZTA 2H1EA 2J7ZA 4OIJA 1Q81C 4F4KA 2DJGC 4FS1A 3OJSA 1CT1D 1SE8A 4DV7Q 1H95A 5ELDA 3L3FX 5AKHA 8ICVA 7ICEA 1I6HB 1TU2B 1RHPA 5C4XB 1WCMH 5ALNA 5JU5A 1P7DA 2KECA 3GIIA 3I91A 3RF9A 4DQRA 4Z9CB 2XN9C 1TY0A 1WD0A 3MABA 3NVYA 4UP7A 2XTIA 2XY6A 2R93B 4WJWA 4FVMA 2XI9A 1V97A 4DS4A 1XS9D 3I4MB 2QILA 4YFKA 3CC2A 2B3GA 4DV2L 1JRPA 1SL2A 2KZZA 1P16A 3S1RH 5J2EA 3QWNA 5JJIA 5AM0A 4Y2TA 1NZBA 3GIKA 1SKRA 2KHVA 1ZETA 2FMPA 2K28A 3J81c 3Q0AA 3RR7A 3SDZA 5J3BA 3E9HA 8ICSA 3DXJC 4ED0A 5KG2A 2I46A 3ND8A 3CCQA 2R3ZA 1WTXA 2HI0A 4Q45A 1YZ6A 4UP8A 4YCVA 2ES2A 1B9NA 2MO1A 3BVGA 3K4GA 3C2LA 5IIFA 5KNDA 5C4JB 1ZQJA 2OH2A 3NE5B 2F0HA 3KFUF 4DL4A 4BWJA 9ICHA 3SK6A 3ONAB 5C0XJ 2IX0A 3GQBA 3CP8A 2A19A 5B66U 4GOPB 4JYAL 3ZD8A 3K7AB 3F5AA 2MAXA 3OTOQ 1F9RA 1ZQLA 1JJ2A 4KLSA 1UNSA 2NN6I 3P1HA 1U4RA 5L9XA 3FDTA 2JZBA 5KFQA 3QU4A 4G9BA 1I50H 3X3NA 2P35A 2JXMB 1KN5A 1YZ7A 1U45A 1RL2A 3DWAA 2PPBC 1W3SA 3TADC 3H6MA 2F0LA 1ZQIA 1V85A 2F76X 1A0IA 3EW9A 4IUPA 2YU9B 3PO3G 4B3TL 2KIWA 2AGPA 3QZ7A 4J9NA 4Z6CA 3SAFA 2RDJA 1O7LA 2E8OA 1BDOA 4YHHQ 4GS3A 4NY8A 2RDIA 1PH9A 3KBGA 1XNQQ 5DG8A 4G7OC 3GTJH 2PFNA 2YMMA 3KKAC 1RXWA 1TQOA 5KL1B 4ECWA 1U0LA 2E2HB 2DPJA 1KFSA 4M1UB 3BQ1A 3SQIA 2CPRA 5EE9A 1N36Q 1XTCD 3A7LA 1QSYA 5EBCA 1UQVA 2LYAA 2M2LA 3IFTA 5ALKA 1H9KA 1WTRA 2YN4A 1LV5A 4DL7A 1IHZA 3UMBA 3PW0A 5LMUQ 3H09A 2MFIA 1NE3A 3GV8B 5M5XB 4J6HA 1A63A 1NK9A 4A3GG 3F2CA 2AXTU 3PW7A 4KLDA 4B9XA 3GTGB 4IRDA 3S1QB 1X54A 4O5CA 1VQNA 2EAMA 3GDXA 3I28A 4ME5A 5H1SE 1N2XA 4DOBA 3F8TA 2QEXA 4Z6DA 3HOZB 5J2DA 1XPOA 1L6NA 1F2LA 1Z19A 2ZTCA 3HJEA 5ALUA 3CW2C 4BX9C 4ECYA 4Y2SA 3ZDCA 2EYHA 4PHPA 1ET6A 4DAPA 2JA6B 4KKUA 4R65A 3TDQA 1Z00B 4BWMA 3MA2B 5EAYA 4CKEA 2EY2A 2FMMA 4DPGA 1SJED 4POGA 1VQOA 4KHPL 2QA4A 3BG3A 1KDHA 2IHNA 3J80E 3MFYA 3HILA 2F0KA 1EU4A 2JA5G 4RT3A 3GU3A 4F5QA 4JB3A 4NP5A 4IQVA 2NRTA 2R8GA 4X3SA 3GTQH 1AE2A 4NB3A 1HCZA 1ENCA 5DNFA 3E6ZX 2KOBA 1MGSA 5ALGA 1T5XD 1BPXA 2UU9Q 2I5MX 3HOVH 2EZXA 2PMZC 1LV9A 5JJZA 1BF4A 1WCMG 4IQTA 1TV9A 2SOBA 4JI2Q 2PMZE 1SN8A 4IUUA 4KN7C 2EYFA 2EPBA 5F9NA 3BJYA 1XNSA 3AM9A 2OTJA 4Y2PA 5G5HA 4DFMA 1PA6A 1T7PA 2A69C 3VR5A 2Q8TA 2A68C 3L2PA 2KHQA 1Z6HA 3HOWH 1X6JA 2C5CA 5BR8Q 1EIFA 3UXOA 1L7PA 3RRHA 3Q8QB 4YIJA 2CWAA 5JRTA 3OHXC 3WK4A 4DSLA 1E7ZA 3MHBA 2JQOA 3HRZC 1Y1WH 1Q1EA 4IFDJ 1ASYA 3PX4A 4UAZA 2VNUD 3U26A 2OF1A 2JEAI 3CMAA 3I4LA 1QZHA 4Q43A 3MFGA 2W7PA 1Y1VB 3TS0A 1PTOC 1DJRD 2HBMA 2A8VA 3NTUA 5AI4A 4RU9A 2IPKD 3LDAA 4MEXA 2CH4A 4F5PA 4QZHA 1C48A 2K5QA 2A6ED 5GAEC 3RN5A 5K36H 1YBYA 4DV4L 2CXYA 3K0YA 3TADA 2VY3A 5FO8B 3K81C 1E0BA 4LFAQ 3BS1A 3T51B 1PVRA 2LXKA 3A54A 1YIJA 1HNZL 2R18A 4OD0A 3UXPA 3Q8LA 1PHJA 1DZ1A 3WKAA 5LMNW 4KLQA 5C5LA 3CCVA 7ICOA 5KAFU 1QWYA 5IINA 2AQ4A 4EQPA 4UBCA 2W3SA 3DEEA 1ZQCA 2B2TC 4I2CA 1LT6D 2BA0A 5EPLA 2CW0C 4F7XA 1PH7A 2ZXOA 3KKAA 1HTPA 1OXJA 3S15B 9ICIA 1E3PA 1UPHA 4JI6Q 3D6JA 4EEKA 2MQHA 4DLGA 4OEMB 1T3NA 5T1IA 2LFNA 3TARA 2Q0ZX 1RF2D 3OWFA 3ULJA 4UBBA 2EXZA 1SNQA 4FDBA 2QW7A 3WK7A 3GTLH 4DR3L 3KBBA 3V7JA 4F91B 1N32L 2IA6A 4QIWF 4AYBF 3NENA 2FMQA 1KC8C 5C0YA 4EYIB 1EQRA 2JA8H 2PFOA 4DR4L 1G2TA 5KG5A 5TZVA 2CWPA 1X9WA 1B4OA 3TMEA 4BWGB 2EH9A 2I1QA 2R8IA 1WWUA 4PZNA 1UT5A 5JPMC 4QZAA 4MFCA 1G8ZD 1ZQTA 3E58A 3SXHA 4A3DH 2F8LA 2E75C 1ED1A 2SDFA 2W9AA 1PZJD 1Q82C 3EZ5A 2H3VA 1M90C 3BQ7A 9ICCA 3OGUA 4FXGC 3CRKC 2UUAL 2ZIWA 2BCVA 1LYLA 3VR3A 4BY1B 1RG6A 4YXMA 2UXCL 2WB1B 1FJGL 3T1HL 5KFDA 4ED3A 2E8PA 4LWCA 4PZ7A 4L5SA 3M9BA 4JUZA 2R7ZB 5ALXA 2KFZA 1L3VA 3M7NA 1Y88A 1RQNA 1ZYRD 4TURA 1B53A 3CCMA 5AKXA 3QR8A 4KHZA 4RGTA 1OUQA 5JEAH 4DQPA 3GTOB 2BQ3A 4U6PA 4C4TA 1CKMA 2IL8A 2BOSA 4A4IA 3PO2B 4KN7A 4KV6A 1NK7A 1HA6A 4US8A 4B3TQ 4A3BH 3DDHA 4O3PA 5C44B 2ATLA 4QB4A 5J1ZA 1HNWL 3GTPH 5TISU 5L1IA 3FVQA 3HOVG 3SR6A 4J9PA 2D3DA 1SYFA 1PVOA 5G3LD 4B3ML 4HR7B 5DBCA 4XYQA 9ICTA 3AQQA 3KF8A 4WORA 3J7A5 4I2DA 4IL6U 2JN4A 2KCTA 3VR2A 4KY7A 4LZDA 2WB1F 4IQWA 2PW7A 2F0SA 3PV0A 3RZDB 3EIVA 2HVIA 4HJ7A 4OJPA 4UW9A 1KLUD 2RCFA 1SMYC 4MFAA 3K1RB 2JZBB 5DGBA 1MD2D 3T5LA 1SYEA 2A69D 3K5LA 1HIWA 2F4VL 2A68D 5D46A 1CKNA 3HOUB 3GV7B 3GTKB 4P4MA 3PR5B 3NWTA 1Y1WG 4KD3A 5IT9L 2MNAA 3CCEA 3L5KA 1WTVA 2HHHQ 4LFCQ 4F93B 2LM1A 5KFHA 3RB3A 2XRSD 4P0PA 2V4DA 5ALEA 1X32A 2IHMA 4O5KA 4TQUS 2G09A 5IE8A 3JAMi 5IGCA 3SV4A 4LF8Q 1JORA 5IWAL 5F9LA 5K36G 1PTOD 2K7VA 4IUVA 1STHA 4UHVA 4B6JA 4LF5Q 4NV0A 4PZOA 1OXUA 4DK1A 2KHJA 1X55A 1K8OA 3L7ZC 5AFWA 3RJEA 2KVMA 2NO5A 2VL6A 3UDFA 4I27A 1JROA 2B2TA 3OSPA 2BCQA 5JUMA 4I2GA 2UVVA 1LTRD 5CV8A 2R92B 3JPSA 2K33A 3ALRA 3KLRA 4FBTA 3V7LA 2EE1A 2FFKB 1X6IA 4JBWA 3P75A 4FF3A 3CP0A 3AU6A 2HIXA 2PI2E 5A0LA 5CA7A 1N5XA 1BOSA 3K80C 4BXXH 1ET9A 1IV8A 1NKCA 4DL3A 3AU2A 2QGQA 3GTLB 2RBMA 2E2IB 5M3MH 2MA1A 3QU7A 1QUQA 5AK5A 5C44H 5HMMA 2Y0SC 2P66A 2KENA 4JWNA 5AM2A 2NVXB 2CW0D 1DOLA 4HN7A 4RAUC 1HNXL 2E76C 2JK8A 3L4PA 4P72A 1VQDA 4H7BA 2IBKA 7ICVA 2JEIA 1JB7A 3AFQA 3S1NB 3FRPB 5I2XA 4L6TB 4Y7NB 1SSOA 1IIPA 3C1ZA 1JR0D 5M3FB 1LT3D 4CCHA 1ILPA 4TQRA 3HWTA 2LM4A 2JA8G 3HEJA 1XWLA 4H0LC 1ZQEA 5C4HA 1L0XB 3PQIA 4YCWA 4BBSG 2WAQG 4ZUIA 3P20A 3HW8A 1ZJNA 4F3OA 4C3HB 2K75A 3LWUA 1SBBB 1STNA 3PUVA 4C3IG 2EDUA 3F2UA 1EY9A 5COYA 1F5SA 2MHVA 4PGXA 1ZKOA 2PW5A 3J80c 3EA6A 2JMGA 3IRBA 2JEGA 1NK5A 2LKYA 2I5LX 4PJ0U 4EBEA 4EZ6A 2L9HA 4FZMA 4MTKA 1A6XA 2TMPA 2E2JH 3K8AA 2DQNB 1HQMC 4EQ5A 1PUZA 2A1AA 4J9OA 1SEBD 4XDXA 1SYBA 4ULLA 2KV2A 1SDFA 2YTUA 1XMOL 4UQGA 4AYBG 3GIJA 1ICWA 1SNPA 5EWGA 1PZID 2ZIXA 1D9FA 2V9WA 1U4MA 1YHBA 1OXVA 4DR1L 1HNZQ 3V6KA 2WACA 2XWBB 3LWEA 2ZJPA 4O3OA 4GN5A 3SD7A 1SNOA 5JEAG 1X2IA 3HKZC 3S2HH 4KLGA 1YHAA 1M6YA 4GOPA 5KG3A 4OJ6A 2DGYA 1ZRMA 2EY1A 4OONA 1L8OA 3EBEA 1X40A 3EPGA 1ZQNA 4A3BG 1S5ED 2K1BA 2EANA 4IOCA 2WAQC 1DXMA 3V2TA 2KBNA 1V1OA 3WKBA 4N9TA 4QQBX 2NRXA 2JA7B 1ZQDA 1SB3C 1NSNS 2IOFA 3CU7A 1N8RC 3SEIA 2AQ1B 2F3NA 1Q86C 2CVRA 4DR3Q 1RD9D 1N32Q 1IZ6A 2HHXA 4C8KA 2W8KA 4F88A 1NJYA 5IY0A 2VUMB 3O0FA 4MZ9A 5AIAA 3R9KA 1Z47A 2A5HA 4K5WA 2WF8A 2JRZA 1FIQA 2YQEA 3VR4A 4YP3A 3RLOA 3CNHA 3M3YH 3HP3A 2O5JC 2VS1A 4DR6Q 4J9MA 5JVH3 1EIGA 3TZDA 3KJOA 3AMZA 5AK4A 5KFIA 4ZOHC 3SMVA 1CRXA 1R9TH 1SMYD 3NVZA 4YY3L 4HJ8A 3UDGA 1LTTD 3OTOL 3G6EA 4A3MB 1SWWA 3QJYA 1AZQA 1KDBA 4DAMA 1GD7A 1G51A 5F2DA 3MWYW 2LY7A 3PW5A 8ICUA 4JI1L 4F92B 2F0EA 4DLEA 3FEWX 1NR2A 4HMIA 4X3KA 2UUAQ 8ICAA 4A3IH 5D3IB 2ISPA 4JOIC 1G6ZA 4L5RC 2ZJRA 5C3EH 4A3CH 1L1OC 1QLNA 4Y2XA 3VC8A 1K73C 3MGIA 1IBLQ 1DXSA 4KY6A 2AWNA 2L5YA 4HAIA 2VQEL 1OXSC 2WV6D 2Q8IB 4RQ5A 1IG6A 4I7AA 1S5DD 1VQEA 1HUOA 4BS9A 2JEJA 3QZ8A 4A75A 4FFDA 5D49A 4YHHL 5J2GA 4LUVA 4RUCA 4NDXA 2YMPA 2A1JA 4Y2QA 1VCIA 5C6AA 2E5LL 5BOLA 2CN1A 2PCFB 1XNQL 2F4IA 4ACOA 4YD2A 1BCPC 2D9UA 1PV4A 3UMCA 2AQ3B 1FR3A 3C46A 2XWJB 2DNEA 8ICRA 1D6EC 3THVA 3IAYA 2FE9A 3ISBA 3OIQA 4QZ9A 2G5HB 1G2SA 3FKIG 4PHEA 4C2MH 5M3MG 1MQ3A 4HCSA 4PL2A 1TWCH 5FLMH 2CRXA 1JCKB 1N61A 2G06A 1WYDA 3G6XA 4ZLTF 5HURA 1Y69U 5IYDH 2ZIWB 5EGTA 1A8VA 4K8JA 1URJA 2ZIVA 3KZIU 4F72A 4OO1J 1OXTA 2WB1E 4R4CA 3RZOB 3PX0A 5KFOA 1PH5A 3QOLA 3H7IA 2L15A 3RNUA 4TSSA 1TAMA 3NASA 2NVQB 4RQ1A 1DCZA 5LHY1 2LMRA 1V38A 4GLVB 4KMUC 1JICA 1F44A 3GQCA 4QJFA 2E74C 4S3SA 3JPQA 4K0KL 4F50A 3RLFA 1CTMA 8ICNA 2K03A 2K50A 1XNRL 1D9DA 2PMZB 1A2UA 2BDNA 2F4VQ 4QMGA 4JPBW 5I6WA 8ICBA 1ECWA 4KLOA 3QIAA 3PSFA 2VANA 2RF4A 2ES6A 4M9LA 3H0GH 3LWMA 4OL7A 3GV5B 3RTVA 5A2QE 3TP6A 3NELA 2HOFA 5E3FA 1DRGA 1MA7A 5TSSA 4Y2YA 2KKPA 3N4MB 2A6HC 1D7QA 2HCFA 3VYRA 1SL0A 5J2HA 4J9SA 3ED5A 4DKAC 1V8QA 5C5JA 1UT8A 3KF8B 3F53A 1HJPA 1JE5A 4M8AA 4JWMA 4DUYQ 8ICZA 5J39A 4IRKA 1VQJA 5CMDA 4G57A 5JVG3 4EBDA 4K4HA 3PNCA 2CQAA 2RQXA 3DWQA 4JI7L 3I4NH 4JI2L 2KSOB 4GXKA 5C0XH 1PTOB 5G3LF 3M85A 4IJLA 4ODGA 4KMOB 5J2CA 1ESRA 1KABA 2FJ6A 2P6RA 2OYYA 1BKBA 1CKNB 1B22A 2PMZF 3LYSA 1STEA 3I1YA 4IQUA 2E3TA 4YD1A 1MQ2A 2HHTA 1MSGA 3PUXA 4IPCA 3TQYA 5ISRA 1TK5A 4MF8A 3PV8A 4PGYA 3RB6A 4L8JA 4LAAA 4DFAA 4OX9L 2A74C 4P0PB 2XGPA 3WK6A 3T56B 1ZD3A 1RQLA 1TWAB 1ZQ1C 3A8IE 2D5DA 1ASZA 3H3VI 3AQEA 3FAHA 5KGUA 3S17B 1HR0W 5CV7A 2F3WA 3QEBZ 3ZI4A 1VQAA 4IUQA 3AN1A 4B3RL 4KLEA 4GN4B 1EY6A 5KG7A 2OTLA 1CA6A 1DD2A 4FXKC 4HAEA 2OM6A 4RZRA 1J2NA 4C8MA 2F0QA 1AP0A 1ZQXA 1EYDA 4O1NA 4KLFA 5J2JA 2EYOA 5KFMA 1F77A 1UCVA 2R61A 4CGYB 3VA7A 4G7HC 1S10A 2FLLA 2ZXPA 5CYUA 1Z3EB 1TWGH 4CF3A 1VQCA 2C9OA 3QB3A 2IWHA 2Z9HA 5HHIA 1VDVA 5AHXA 3MC0B 2P6UA 3UXNA 4JOIA 3QE9Y 7ICJA 1STYA 3ERQA 4K5VA 1VQ5A 3S14H 1LTAD 1L1OA 2N78A 3R3OA 7ICLA 4IQZA 5ELNA 3Q23A 8ICFA 3JAME 4BXOA 3WKDA 4C1NK 5L1MA 3I76A 3T5JA 1Z7TA 5K4LA 2SNMA 1I94Q 8ICIA 5KRUA 4JI5Q 3K0XA 1N56A 3PW4A 4QY7A 1A6SA 4A3IG 3TS2A 1XYIA 1C0AA 1SKWA 4UAWA 1TK8A 3UDXA 3MGHA 5C3EG 1JMCA 4A3CG 8ICXA 2UUBL 1I4XA 4ZK9B 5HY6A 3NK9A 1XMOQ 3M9OB 4CKCA 4LK1C 4BY7H 2AMCB 4IUTA 2IX3A 1KRPA 2GVBA 4DXFA 3I73A 1WTQA 1WCLA 2DF4B 3GV3A 4JI6L 4DR1Q 2O5IC 4A93B 2WF5A 3I2ZA 1ONLA 2HHVA 1NNXA 5J29A 2W43A 2H3IA 1JQYD 2CKZB 1C20A 3PO5A 1HA5A 3DLLA 2GN5A 2QB1A 4LF6Q 1BCPD 1NAPA 2M00A 1PMRA 2NTSA 1BXTA 4BBRB 3QYPA 1U48A 2EY5A 3L0OA 1N33Q 5FLMG 3NTIA 4NW2A 1JE4A 2L11A 3U4VA 2HBLA 4KMUA 5IYDG 1TS5A 5KAIU 1ZD4A 1YVCA 4ECTA 4P0QA 4J1MA 3BZKA 2Y1IA 4UAIA 9ICQA 3Q24A 1WCNA 3H91A 3R2TA 5JJLA 3VYSA 4E0DA 1AE3A 3V05A 3I90A 1I4HA 1ZQKA 4KLUA 4JV0A 4YCXA 8ICGA 3PW2A 2PFPA 4KJOA 4M9HA 2NVTH 4GKKL 5IGDA 2MRLA 2BH8A 3CQZB 5EKIA 4EX5A 2ZIXB 2QARA 1A62A 2B39A 1KD1C 1NMFA 1STAA 3NUQA 3IDWA 3IN5A 2J6SA 3NRWA 1KDCA 1ENAA 2D2CC 4R4IA 3DV9A 2W11A 5EPKA 3RAQA 1BO0A 3NS1A 1K0SA 4NJ8A 4F2SA 4M2YA 5A35A 1EFID 1BUVT 2QCPX 1VMCA 4YY3Q 2MU2A 1WFQA 4LFBL 3LK9A 4ECUA 4DSKA 2G5DA 4KLMA 2F0OA 2VB2X 3HOYH 3D6CA 5KFNA 4DR5Q 2W9BA 3PZPA 4JI1Q 4A3KH 1YJNA 3J7AF 3S6JA 3OOCA 1GKHA 1GUTA 3KLSA 2MGSA 2E8GA 3E5SA 1QH9A 3Q8MA 5KFCA 4WJ4A 4IFDH 1JMSA 1CKOA 2Q4TA 5FO7B 2VQEQ 2A6HD 2W54A 5ELFA 4NMZA 3HG9A 1U9RA 1L7OA 3GFKB 1KIXA 4C7ZA 4BGDA 1MHWC 2E5LQ 3M1YA 4DV5L 1I6HH 5AKKA 2AUKA 2RLTA 2IOFK 5C4XH 1RKNA 8ICYA 5IIOA 2E2IH 3A7AB 4EEYA 7ICHA 2F0DA 1UHUA 2ZIUA 1FL0A 5KFVA 2EQSA 9ICLA 1K1SA 4YWLA 4NXNL 3TP7A 1X9XA 3BDCA 3ETRA 1WUDA 5ALLA 4NM2A 4KI0A 5IODA 2R93H 1S5CD 1ZQSA 4BBRH 2UVUA 4XTCS 4ECQA 3I4MH 1G6PA 3RD4A 4A3EG 4IN3A 3NHHA 2LSSA 4KN4C 4CBVA 1K8MA 2KFNA 2F1JA 2HHHL 4TVAB 4QZGA 1RYRA 4LFCL 3ULLA 3RUZA 5LMNL 4OCZA 1Q3UA 2DKZA 4OJ5A 7ICKA 2WTFA 3MXPA 3RAXA 4ECRA 5IGEA 1ZXTA 1IBMQ 4FNFA 4LJZC 2ASLA 2N1RA 2A1JB 4YMNA 3MXGA 4LF8L 4K0KQ 1VQFA 5ALZA 1DK2A 4AH6A 5C4JH 1XNRQ 1O7ZA 4EBCA 2Y0SB 4HEDA 1ZQYA 4PL1A 1HZAA 4LF5L 3V72A 2ZXRA 4N8FA 2AQ2B 3SK8A 1K9MC 2EDGA 4OXPA 4J03A 4CDGA 4XQNA 1NNLA 4OWXB 3Q6SA 2WF6A 5AKJA 3K7AH 1AN8A 4GIBA 2QLTA 2EYJA 4A3FG 2DUYA 1MKHA 3RR8A 2EIFA 3PUWA 2KA7A 5FLXc 1D2BA 4UB8U 2FLNA 3MXUA 1PFNA 3D3RA 3MTSA 1QTMA 1PH8A 2W04A 4DAYA 1TY2A 3CYMA 2ZIVB 1RM6C 3ISDA 3BZDB 2E8MA 1B3AA 3PUZA 2HHSA 5C4ZA 1LVHA 1DYQA 1K0RA 4BY7G 2YU9H 1KHIA 1ZQVA 5EOZA 3OYYA 4IZ8A 4C3JB 4JMUA 1EYCA 4DK3C 2C28A 4QUCA 4JI7Q 4QJFB 1S0OA 2AKWB 2BPCA 5KT6A 4UB6U 3LVVA 5D3DA 4FE3A 3ULPA 1VLBA 4IURA 4QZ8A 4PH5A 3H3VC 5HMLA 3CRLC 3B9JA 5GAHC 2Y0SF 2QB0B 2HBKA 2JXJA 2ZM6Q 1YITA 5ELCA 4JI3L 2EZVA 3TACB 2C2DA 4OX9Q 1ESFA 3CCUA 5CRXA 2E2HH 1GUNA 4ECZA 1VF7A 1VQHA 1YHQA 3OJUA 4H13C 4RKLA 1HEKA 1SGGA 2NB0A 2G0AA 3HP6A 4KITB 4IJHA 1LTGD 3SHLA 1IL2A 1S76D 4V0BA 2JEFA 4B3RQ 4GZYC 3OW7A 3HKZB 1ILQA 1IM4A 3GD7A 1V9PA 1XTDA 1NJWA 2EXDA 3FDSA 2K5VA 1F9QA 1BBUA 5M5XH 1S0MA 5C3WA 2MJ8A 3A5UA 1AROP 2E1FA
chains in the Genus database with same CATH topology
4GNXB 1SRUA 4LF5Q 1OXUA 3GTGH 2NVYH 3S1QH 2KHJA 1X55A 4HJAA 1JJCB 3L7ZC 2IHEA 2VL6A 3UDFA 2IY5B 3GDEA 1NJIC 3HOZH 5GQOA 2VUMG 1YJ9A 4R1JA 3RR5A 2JA6H 1SLJA 1PFSA 4A3KG 1HNWQ 2YV5A 3H0GG 1NTGA 3W5OA 4JBWA 2F52A 1N36L 1YEZA 2HIXA 2PI2E 2XGTA 2VZAA 1K3RA 3CP0A 4A3MG 1KIXA 1VQKA 3K80C 3J81j 4B3MQ 4BXXH 5DLQE 4IFDI 4B3SQ 4PG3A 2QGQA 2UUBQ 5M3MH 5LMUL 4IFDG 1GVPA 1QUQA 5C44H 3W1GA 1CUKA 3S16H 2KENA 3UDIA 3CPWA 3PSIA 4JV5L 1HNXL 2JK8A 4P72A 1XJVA 2NZHA 1VQDA 1KRSA 1JB7A 3AFQA 4P73A 1IBKQ 4POFA 4ME3A 2R7FA 5GROA 1SR3A 5C4XG 1B8AA 2JA8G 4JI4L 3PIPA 1L0WA 4X64Q 3STBD 1HR0Q 4KLKA 3HOXG 1XPUA 3I4NG 4DV6L 1N34L 5C0XG 4YCWA 4DR5Q 2WAQG 3W1BA 1L1OB 4JBJA 4HJ9A 4ALPA 4UY8C 4A93H 2AHOB 1K83H 2K75A 4UP9A 3PUVA 4GLAC 3I4MG 4P75A 3TEHB 1HZBA 1X6OA 4BA2I 4DR6L 2JE6I 3KDFB 2CCZA 3JAMc 3J80c 4DV1L 3RLNA 5IWAQ 3IRBA 2PQAA 3UE0A 4X66Q 3T1YL 2I5LX 5IP7H 3PO3H 1D8LA 2YYZA 2E2JH 3K8AA 4GKKQ 4EQ5A 1W2BA 3U58A 2A1AA 2UU9L 1X3EA 4LUZA 1Q12A 3CXCA 1EYGA 4DV0Q 1Y1VH 2Z6KA 1XMOL 5JJKA 4AYBG 2H5XA 2JJQA 3CCJA 5IP9H 1IBLL 1VQLA 2Q2TA 1VQ6A 1YHBA 2BA1A 4QL5A 1B7YB 1OXVA 3CQZH 1IYJB 4DR1L 1HNZQ 3FP9A 4LF4L 4LFBQ 3VDYA 3GTMH 2MO0A 2ZJPA 4GN5A 1VQIA 1YJWA 5JEAG 3S2HH 2F3IA 4DR2L 1YHAA 4RG1A 4AQYL 1LTLA 5AJ3L 4HJ5A 4GOPA 1VQBA 2DGYA 4O2DA 4OONA 1UE1A 3U4ZA 3EBEA 3ERSX 4A3BG 1KQSA 1EWIA 4QGUA 5IYBH 4DR7Q 5BR8L 4GNXC 1UE5A 3PUYA 1S40A 1HNXQ 4JV5Q 4IOCA 2Z0SA 4JCVE 4A3EH 2KBNA 2OCEA 1P8LA 2DUDA 2UXBL 1GM5A 3J81i 4R4QA 4Y52H 4QQBX 1V1QA 3H3VH 4PMWA 4A3GH 3CC7A 2K5NA 3M4QA 4DK6C 3A5ZB 1N8RC 3F2DA 4APVA 4DV5Q 1LM0A 1VS0A 1Q86C 4DR3Q 1VQ9A 3S15H 1Q46A 4DV6Q 1N34Q 1N32Q 1IZ6A 1J6QA 4X65L 1V43A 5ELOA 5IY0A 4MZ9A 1Z47A 4J15A 1VQGA 4HIKA 3CCLA 2N8NA 1Q7YC 1QVCA 3RLOA 4NXNQ 4P71A 3M3YH 2VS1A 4LF9L 3TRZA 4NXMQ 4DR6Q 4LFAL 3KJOA 3F2BA 3OW2A 2Q2IA 3UE1A 4JI8L 1R9TH 3HOWG 4DV1Q 4HIOA 1TWHH 4YY3L 4HJ8A 1G291 3UDGA 3OTOL 3G6EA 3GO5A 3ZJYC 4A3FH 2UXDL 3BU2A 1QUQB 3H15A 3T1YQ 4DAMA 4PZ8A 1GD7A 1G51A 2YTXA 2N3SA 3S24A 3AYHB 4JI1L 4GN3B 3FHWA 1EFWA 3Q8DA 1VQ8A 2UUAQ 1UEBA 5LMNQ 4GKJL 4A3IH 4JOIC 1Q81C 2JA9A 4L5RC 2ZJRA 5C3EH 4A3CH 1L1OC 4LUOA 1K73C 2VQFL 1SE8A 4DV7Q 1IBLQ 1H95A 1S3OA 2AWNA 1KL9A 2VQEL 4LF4Q 1OXSC 4JI0L 1WCMH 1VQEA 4GLXA 2I0QA 3HOZG 4A75A 1B70B 4YHHL 1NY4A 4BY1H 4LUVA 1VCIA 2E5LL 5AJ3Q 4DUYL 1EOVA 2JA6G 1XNQL 4UP7A 2XTIA 4LF7L 2UUCL 2YTVA 1PV4A 2R6GA 2RHQB 1KXLA 3KYHC 2R7ZH 3CC2A 1KAWA 3HOYG 2B3GA 4DV2L 1P16A 2FXQA 3S1RH 2UXBQ 2PQAB 5JJIA 4C2MH 3FKIG 5M3MG 3J81c 5FLMH 1TWCH 1J5EL 3GTOH 5J3BA 3E9HA 3BJUA 1WYDA 3PO2H 2IT1A 5IYDH 3CCQA 1A8VA 2WB1E 4X65Q 1YZ6A 1OXTA 4R4CA 4UP8A 2K5HA 4YCVA 5E7NA 2ES2A 2MO1A 3CCRA 1PH5A 4L5TA 2L15A 3RNUA 1YNXA 1XMQL 2ASBA 2Y0SE 1Y14B 4C3JH 4O0AA 4GLVB 4LF9Q 5C0XJ 2IX0A 2A19A 4QJFA 4A93G 4GOPB 4JYAL 4HIMA 1Z9FA 3RLFA 4K0KL 2ZJQA 4A3LH 3OTOQ 2K50A 1XNRL 1JJ2A 4JI3Q 3M4PA 2NN6I 2F4VQ 1BVSA 1FVIA 2NN6G 3RZDH 4X6AH 2ALYB 2RF4A 1I50H 3H0GH 4OWTB 2R93G 1YZ7A 4GKJQ 1RL2A 4BBRG 1W3SA 4DAYB 3NELA 1EQQA 4A3DG 2VQFQ 2LXJA 5IP7G 1A0IA 3HOUH 3SGIA 3GTKH 3PO3G 4OO1I 4B3TL 1D7QA 1SMXA 1I94L 4JI5L 3I7FA 4DKAC 1SROA 3KF8B 1Y1VG 4YHHQ 3J7ZC 4GS3A 3KFUA 3KF6A 1HJPA 1JE5A 4DUYQ 1PH1A 4A76A 1PH9A 2RHSB 1XNQQ 4IPGA 1VQJA 2K14A 2AWOA 3GTJH 4GNXA 1CSQA 3CCSA 3I4NH 4JI7L 3CD6A 4OWWB 4JI2L 5FJ8H 5GAGC 1U0LA 3CPFA 4DV2Q 4BBSH 3M85A 1MIUA 4IJLA 1EUJA 2V1CC 4BA1I 3G4SA 1BKBA 1CKNB 3I4OA 1N36Q 4C3IH 3PUXA 5IYBG 4IPCA 2R92H 3TQYA 4MTNA 4OX9L 3HKZE 5LMUQ 1I3QH 4LF6L 1ASZA 2MFIA 1NE3A 3H3VI 3NBHB 3CC4A 4YCUA 1N33L 3S2DH 3G71A 4LW1A 1A63A 1DGSA 5IYCH 3F2CA 1HR0W 4A3GG 1VQAA 1C9OA 2D0PA 3GTLH 4B3RL 1X54A 2E2IH 1MJCA 4GN4B 2WAQE 2WP8J 5GAHC 5H1SE 1WOCA 4IPDA 2NVXH 2OTLA 1VQNA 3F8TA 3I55A 2QEXA 4JYAQ 1XPOA 3MEFA 4JI4Q 2ZTCA 3CW2C 3MXNB 1X65A 3G48A 1VQ7A 3S1NH 1AH9A 1JT8A 4Y7NH 1TWGH 1N9WA 1VQCA 5EAYA 5M3FH 4DPGA 1U5KA 4POGA 2NZOA 4JG2A 4JOIA 1VQOA 4KHPL 1Q8KA 3PIOA 2QA4A 1GO3E 1VQ5A 3S14H 1L1OA 2N78A 5ELNA 3LGJA 2YTYA 3E0EA 1KRTA 1RIPA 2JA5G 2ID0A 1I94Q 4C3HH 2BH2A 4JI5Q 3K0XA 2Q2HA 4QY7A 4A3IG 3TS2A 3GTQH 1AE2A 1C0AA 4NB3A 1QVFA 5C3EG 3UDXA 4X62L 3ER0A 4GOPC 1JMCA 2UU9Q 2UUBL 4A3CG 5HY6A 3EN2A 2I5MX 4JBMA 3HOVH 1E24A 3PGZA 1XMOQ 4YWMA 4BY7H 1FGUA 1WCMG 2AMCB 3WWVA 4JI2Q 3A74A 2PMZE 1SN8A 2GVBA 4BY1G 1O7IA 3AFPA 1IBKL 2K4KA 4JI6L 2WB1G 4DR1Q 1VQPA 1UE7A 3I2ZA 1BBWA 2OTJA 1PA6A 2R7DA 4DR2Q 3CMEA 2Y0SG 4AQYQ 2CKZB 1VQ4A 1HR0L 3DLLA 3PCOB 2GN5A 3L2PA 4YWKA 4PZ6A 4LF6Q 3HOWH 5BR8Q 1EIFA 4DUZL 1N33Q 3L0OA 3U50C 3S1MH 5FLMG 2Q2UA 2CWAA 4P74A 1E7ZA 4BXXG 3HFZB 1UWVA 2JQOA 3U4VA 1MJEA 3PO2G 4A3JH 5IYDG 1Q1EA 1Y1WH 1XPRA 1ASYA 2IX1A 4IFDJ 2VNUD 1YVCA 2JEAI 2ZTEA 3BZKA 1X56A 5C44G 3CMAA 1QZHA 2B63H 5JJLA 3TS0A 1WI5A 3CF5A 1AE3A 4X66L 2A8VA 1HZ9A 2KCMA 1WJJA 4R4TA 4GKKL 2NVTH 2JA7H 4EX5A 2BH8A 5GAEC 1KD1C 1A62A 3RN5A 1NMFA 1YBYA 4DV0L 4DV4L 4A3LG 4R4IA 4KHPQ 2VY3A 1E1OA 3TREA 1IBML 1E22A 3F1ZA 2HIVA 3K81C 4JC0A 4LFAQ 4HIDA 2LXKA 4JI8Q 1YIJA 4R4OA 1HNZL 4YY3Q 4LFBL 2VUMH 1PHJA 1WFQA 5LMNW 3M4OH 2UXDQ 1K8AC 3CCVA 3HKSA 3HOYH 1I5FA 4AIMA 4X62Q 1OTCA 4JI1Q 4A3KH 1YJNA 3FKIH 3HOUG 3AEVA 4DV3L 4A3MH 1GKHA 2BA0A 4DR7L 4H02A 2E8GA 1OXXK 1PH7A 2KHIA 3JC66 1S72A 4WJ4A 1E3PA 1CKOA 5HGQA 3HKZG 4JI6Q 2VQEQ 4JI0Q 4OO1G 2MQHA 4DNIA 1C7YA 4NPSA 3ULJA 3STBC 2E5LQ 4FDBA 5C0XI 4DV5L 2CFMA 1EIYB 4DR3L 2RCNA 3DM3A 5IP9G 5FJ8G 1I6HH 4LF7Q 1N32L 3NENA 2UUCQ 2C35B 5C4XH 1KC8C 4IOAA 1EQRA 3D0FA 2JA8H 4DR4L 2GVAA 5JEAJ 3HOXH 4DUZQ 1HZCA 2CWPA 1FL0A 2EQSA 1X9NA 4MNOA 2R92G 4YWLA 4NXNL 5M5WH 4NXML 3PF5A 4KI0A 5GADC 2R93H 1IXRA 2JEBI 2N49A 5IT9c 1PH3A 1J5EQ 4BBRH 4XTCS 3I4MH 1G6PA 1NMGA 2ZM6L 4UPAA 4A3EG 4A3DH 1HH2P 5IYCG 1Q1BA 2LSSA 2I5HA 1Q82C 1PYBA 1QZGA 1M90C 1NBWA 2HHHL 4BBSG 4TVAB 3ULLA 4LFCL 1XMQQ 5LMNL 1LYLA 4DV4Q 2UUAL 3ICEA 2K52A 1M1KC 1LUZA 2D62A 4JBKA 1IBMQ 2UXCL 4IO9A 4DV7L 3RZOH 2WFWA 2ATWA 2OWOA 4LF8L 1FJGL 3T1HL 1VQFA 4K0KQ 4PZ7A 4LWCA 4AH6A 4XIGS 5C4JH 2VW9A 5M3FG 4L5SA 1XNRQ 1HZAA 3M9BA 1L2FA 1VQMA 4LF5L 2NVQH 1K9MC 3D31A 4OXPA 3M7NA 3KLWA 3CCMA 2OQ0A 4OWXB 4KHZA 4DV3Q 3K7AH 4A3FG 2Z6KC 4RMFA 1CKMA 1MKHA 2EIFA 3PUWA 4A4IA 5FLXc 3NEMA 3CAMA 4B3TQ 4A3BH 1PH8A 3PF4A 1TWFH 1HNWL 3GTPH 3B6YA 1PH6A 3BZCA 3HOVG 3PUZA 4QIWE 4AYBE 2B29A 1PH4A 1PVOA 1K0RA 3KDFA