2HI0A

Crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
240
structure length
240
Chain Sequence
b'GMKYKAAIFDMDGTILDTSADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGVVVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFKPYYADHCQIKTGPFPGILDLMKNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFDFALGEKSGIRRKPAPDMTSECVKVLGVPRDKCVYIGDSEIDIQTARNSEMDEIAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phosphoglycolate phosphatase
publication title Crystal structure of putative phosphoglycolate phosphatase (YP_619066.1) from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 at 1.51 A resolution
rcsb
source organism Lactobacillus delbrueckii
molecule tags Hydrolase
total genus 89
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hi0A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hi0A01
1TJ5A 3WKEA 4Y2UA 2IYEA 3BA6A 3I76A 3DDHA 5ALKA 1RMTA 1RPZA 2IA5A 4UU1A 5IT0A 1ZS9A 4KN8A 5E0OA 2WF9A 3ZU6A 4UW9A 4EZEA 3KD3A 3L1UA 3E81A 1L8OA 1XPJA 3W5CA 5ALHA 1O08A 5A3SA 4BX2A 5AK3A 1RRCA 4Y2RA 2C88A 5AVUA 2B8EA 2G07A 4IG4A 4DFDA 5AM2A 3NUQA 4Y2YA 5AKIA 2ZBDA 1Z4NA 2YMQA 4Y2QA 5AICA 2AUTA 4MUMA 1T9ZA 1YJ5A 3B9RA 1XVIA 3WGVA 4KYTA 3R4CA 5ALOA 2YJ4A 3IJ5A 2B30A 3QLEA 3R09A 2EATA 3L7YA 3EF1A 1LTQA 3VAYA 5ALWA 3BWVA 3ZVNA 3CZ4A 1SWVA 1Z5GA 2CN1A 2YFYA 3OCVA 4OD0A 1L6RA 3FPSA 3IB6A 4ZEWA 4CF5A 2I7DA 4EENA 3ZTWA 2YJ3A 5ALQA 4YCMA 4Y2VA 4BEWA 4IFTA 2YJ6A 1RQLA 3J7TA 5ALNA 3DNPA 1L7MA 2Q5EA 3W5BA 3QYPA 4BNDA 3OCZA 4KX5A 3QNMA 4QJBA 4YIKA 4KNVA 1QQ7A 2RAVA 4BX3A 2EAUA 5AW1A 2WFAA 1YV9A 4BKMA 3WGUA 3ZVLA 1TJ4A 2EARA 3A1DA 3EF0A 2GMWA 4BX0A 1L7NA 3QXGA 1K1EA 1Z4IA 2AGVA 4KX3A 2WM8A 3OCXA 3N28A 3N8GA 4HGNA 3U7FB 4JB3A 4XE5A 3R9KA 5AVYA 4C4SA 3ET5A 4O8CA 3HLTA 1Q91A 3WK9A 2P11A 1RLTA 3OCWA 1RDFA 1RKVA 5AVQA 5AW4A 4RESA 4XPZA 4UAVA 3QU9A 2B0CA 3L0BA 2HO4A 5AVSA 5AKEA 4RETA 1RLMA 4OHFA 3KDPA 2ZBEA 2FPRA 3AR4A 2I34A 1L7OA 3SF0A 3WK8A 2JAUA 4UM7A 1SWWA 5AM5A 1ZD4A 4PNHA 3PGVA 1WVIA 3AR5A 4DW8A 1RMQA 3E8MA 4YCLA 1RKQA 3PCTA 4FFDA 1KYTA 5AKHA 3SMVA 5AVWA 1YMQA 3AR7A 2B1RA 2P27A 5ALYA 2GHQA 3L8HA 1O03A 2Q4RA 2GFHA 3UMGA 4Y2SA 5AI9A 1J97A 4DCCA 4HGRA 1Z88A 5ALXA 5ALRA 1QQ6A 2FPUA 1Z4LA 2MU2A 5AK6A 1VFPA 3OPXA 5ALZA 5AHXA 4CNQA 3SD7A 2FI1A 4G9BA 2JAOA 3MPOA 2I33A 3DV9A 2C4NA 1J8DA 2WF8A 3L8GA 4Y2PA 5AW7A 5AI5A 1RQNA 4NV0A 3ZWDA 4GIBA 3I28A 2HF2A 1Y8AA 5AW8A 3OCUA 4BEVA 5AW6A 4YCNA 3U7GA 5AVXA 4EX6A 1Z4PX 5AW9A 4F71A 3B8EA 3U13A 4J03A 3K1ZA 3QU5A 4XOUA 3KOOA 2P9JA 1EK1A 4EX7A 2YMPA 3QU7A 2NO5A 2P69A 2W11A 5ALMA 4HGQA 3ED5A 1F5SA 2PKEA 5AW2A 5ALIA 4BYGA 3ZX5A 3WKBA 4ZEVA 3A1EA 3L0CA 2HDOA 1U2TA 5ALFA 3NALA 5FP0A 1Z5UA 4BNDB 1MH9A 4UM5A 2CFRA 3U19A 3IRUA 3WKAA 4YGYA 4L6CA 5A3RA 4Y2TA 3L8FA 3AR8A 2D2VA 4J2TA 3NIWA 4Y3UA 3ZUPA 3W5AA 2YMLA 4G63A 3OTQA 3OCYA 3E84A 4QQFA 4OCZA 3UMBA 3PGLA 3MC1A 1WR8A 2GHTA 5AVTA 3KBBA 2NYVA 3RF6A 4C4TA 1WZCA 2WF5A 2PR7A 5ALTA 5AKYA 4DWOA 3ZTYA 4I9FA 4UATA 1IWOA 2GO7A 3RFUA 4YIHA 4HAIA 5AI6A 4UMDA 5AKZA 2AH5A 3U7EB 3UMCA 2IOFK 1N8NA 2C8KA 3CNHA 2HHLA 1RMYA 2R8YA 3P96A 2FEAA 1NNLA 3AR2A 3I1YA 2HI0A 4OFZA 4BBJA 5AM3A 5AIBA 3SHQA 5JJBA 3QUQA 1Z4OA 4NFLA 3B9BA 5ALJA 3ESRA 4HGPA 5AVRA 2G0AA 1T5SA 3ZWKA 3AR9A 5AW3A 5AKKA 5AIAA 4HGOA 4JDPA 1Z4QA 2HF7A 2WF6A 1S8OA 1CQZA 3AR6A 5ALLA 3QU2A 2HEGA 3ET4A 1LVHA 3L5KA 2ZBFA 2NO4A 2R8EA 2W43A 2C9MA 2FDRA 2HCFA 3QU4A 3QUBA 3HYCA 1Z4KA 5AM0A 3F9RA 2G06A 3MMZA 2YY6A 1CR6A 4E88A 2HX1A 5AKLA 5ALPA 3AR3A 3NANA 4YH1A 1U02A 3FZQA 1XP5A 1AQ6A 2OYCA 1QH9A 5AK5A 2I6XA 4H1WA 3D6JA 2YBDA 2WHEA 4C4RA 1U7OA 2JAWA 3WK4A 4L57A 3QGMA 4NWIA 1ZJJA 2B82A 5AM4A 3WK5A 2MU1A 4UARA 3DAOA 2BY4A 3W5DA 3QX7A 5ALUA 5AI4A 1S2OA 2CFSA 5AKXA 1FEZA 5AW0A 2RBKA 3UM9A 3FPBA 1YNSA 1RC8A 1VJRA 5IS2A 2PQ0A 3ZX4A 4F72A 2YJ5A 3ZI4A 1Z4MA 2R8ZA 3M1YA 2DQSA 2OM6A 4L6AA 2OBBA 2W4MA 3TLMA 4UASA 3PDWA 4MWOA 2X4DA 3EWIA 4NAVA 3SKYA 1TA0A 2JGAA 3N07A 1L7PA 3KZXA 5AVVA 5ALEA 4UMVA 1TE2A 1RKUA 3ESQA 4EELA 2I54A 3S6JA 2R8XA 2QLTA 2FUEA 5AKJA 3M9LA 5ALGA 4HYTA 1U2SA 4ZEXA 3NRJA 5A3QA 1YDFA 2VKQA 3WK6A 5AK4A 3WKCA 2ODAA 3I6BA 3L0YA 2MSNA 2BDEA 1QQ5A 4UMEA 2G1AA 2FUCA 5ALSA 1U7PA 3N5KA 1ZRNA 5ALDA 4Y2JA 5IT4A 1JUDA 4CE6A 4UAUA 1TJ3A 1QYIA 5AW5A 3WKDA 2OA0A 2I55A 5AM1A 1EK2A 3FM9A 3QUCA 4AP9A 4XQ0A 3E58A 4CF4A 2O2XA 2YMMA 5AI8A 1SU4A 2QYHA 2ZOSA 4EEKA 2ZXEA 5AVZA 2HOQA 2IOFA 3EPRA 2FPSA 5AI0A 3SKXA 3WK7A 3GYGA 2RARA 4AS3A 4GXTA 2O9JA 4B6JA 3N1UA 3FVVA 1PW5A 2HSZA 5AKGA 3U7HB 2IOHA 1WPGA 1L8LA 2AMYA 4CF3A 4KNWA 1X42A 2CFTA 3L1VA 2G80A 1Q92A 1ZD3A 3QUTA 3A1CA 2YN4A 1N9KA 3A3YA 4I9GA 2ZBGA 1NF2A 3ONNA 4FE3A 1ZRMA 2WF7A 4UMFA 4Y2XA 1ZD5A 2B1QA 3ZVMA 2G09A 5ALVA 2G08A 2B8JA 5AESA 3L8EA 4UU0A 2C8LA 1ZOLA 3FGOA 3KC2A 1VJ5A 3U26A 2Q4TA 2FPXA 4AS2A 2FPWA 1NRWA 1Z4JA 1RLOA 3SLRA 3MN1A 3NAMA 1ZD2P 3ZW7A 2BDUA 2ZG6A 2JARA 2RB5A 1T5TA 3NASA 4NABA 1YS9A 4FYPA 5T41A
chains in the Genus database with same CATH superfamily
1K1QA 2AK3A 1BFUA 4QRDA 5DH9A 3BF8A 1ZS9A 5JAPA 3WFJA 1Z00B 2XX3A 1E6EA 4EA7A 3E81A 4YO7A 2VOEA 5DNEA 4KQCA 4MFFA 4A8JA 1JIKA 3RVQA 2F8LA 4W1QA 4LF8B 4CL3A 2SNIE 3OQBA 3IL2A 4YRSA 4YPOA 3DBRB 1MF7A 3JAMA 1VCHA 1PV1A 2BJWA 2AX3A 2ONKA 3KEMA 3K30A 1U2ZA 5CD1A 5LIRA 3G17A 1W35A 1O97D 2A94A 2IXDA 2PU7A 1E7YA 3M34A 1NLZA 3DKIA 4B80A 4O5AA 2DLDA 1X3SA 3SNHA 2PXIA 1SXEA 2RCNA 1LY1A 3FTQA 2QOEA 3UCFA 3RYIA 1DCFA 2GJKA 1Q91A 3TCXB 4D0LB 3TMKA 2HRZA 1POXA 4PZ0A 2O2ZA 2WINI 2DFVA 4GBED 2WTAA 4ZHQB 4I5EA 5FO1A 6ABPA 3DVRX 1M33A 1W9HA 2C5GA 4Y18A 3N5CA 3ZQ6A 4UAJA 3F73A 3KOYA 1I5OA 4DOCA 5J63A 1ZJMA 1K9VF 4ZAWA 1P81A 1B8UA 1RQRA 2CYCA 1OKKD 1N6IA 2QSUA 2ZRCA 3SAGA 2NU8B 4RT2A 2IYQA 4XGNA 1BDJA 1TYAE 1QOQB 4TWAA 4F5OA 1Q19A 4LY0A 1EBFA 2H4HA 1LLQA 2A1UA 3T3PB 5EIXA 3BZUA 3V8PA 1SVOA 1E1QA 3JAWA 1E89A 2GYYA 5CMLA 2X2PA 1EFHA 4YQWA 5A7GA 4NL9A 1ORDA 3TLZA 1TF2A 2PR7A 3AF2A 5THXA 3WR5A 3SIRA 4YRQA 2JAPA 4AL4A 4BJ5A 4DMFA 3VZQA 1A2OA 2Y9MB 2HCBA 3OLYA 2BP7B 2IYUA 1QRRA 1XJWA 3H9EO 4YMVA 2OGTA 4BNXA 3KTAB 4QBHA 1UP6A 3RUPA 3SS7X 1CUEA 3GUHA 1PL7A 3ESDA 1Q0HA 1Z8HA 4EUEA 1K5GA 4HOYA 4JJ7A 2WIJA 1ED1A 1FIUA 3FZQA 5E0KB 5CHYA 4M55A 3OECA 2VSNA 1U0RA 4U4AA 2R00C 2NN3C 3JPPA 3OF3A 1GQFA 2FLNA 3AVOA 2OZVA 2GTPA 4NU6A 5H80A 1OLXB 3Q41A 4YHBA 1XFAA 4NM1A 4JJ4A 3UM9A 5GVRA 5CGZA 2ZVDA 3P2KA 2JIZA 2E1EA 4FFOA 5KJCA 3C45A 4M7PA 5GTHU 5BQOA 4U7DA 1IXRC 3REGA 1PNQA 3BQMB 4NDAA 1TQ4A 3KXDA 4HMQA 2JD2A 1J99A 1TE2A 2VXBA 1HT1E 2EVWX 4FCCA 4IZ6A 1TAGA 3PSHA 1M34A 4R40A 3H9JA 4L4UA 4LV5B 4QGBA 2MOKA 5KT3A 3GFBA 3QZ8A 3UT5A 4KWHA 1TJ3A 2AZ4A 3VR5A 3QG1A 5KPJA 3MUNA 3BMXA 1L5MA 4RY0A 4K3UA 4TVSA 4UVDA 4IWXA 4BNYA 2PRKA 5JJLA 1NW5A 4IICA 4XI9A 3DDUA 5I7VA 1XJ0A 3LDGA 3MS7A 2WM3A 1DAHA 3CBQA 4LWPA 4Y30A 3UMVA 2JI4A 1ODFA 1H4QA 1ZD5A 4CKYA 4LJ7A 3AF3A 2NT4A 2CV0A 3GGJA 4BO9A 3IPYA 3OT5A 2FAXA 4K9MA 1HSOA 4BCDA 3OFND 2VT6A 3PEEA 1UT5A 3MGCA 3NVMB 3PNKA 4ME6A 1YZUA 5JS8A 1K97A 1VC2A 5BVGA 5FO0A 2WRZA 9ATCA 1GPLA 1TVEA 2YRFA 4PGFA 7GPBA 3E2PA 2G07A 1SG0A 2ARKA 2I62A 3W5JA 1C1XA 3ER8A 2FSGA 1UJ2A 5KAMA 4AT1A 2HADA 4F2PA 3VBCA 3B85A 2WYUA 2IZOA 1XZ8A 2R1TB 4D9BA 1B42A 2L5YA 2FMHA 5H3CA 2HTEA 3PB3A 3WLTA 2O2IA 4MKGA 1FYVA 3T4UA 1KQ3A 4YAFA 4IQ8A 1KJZA 3QW4B 4Z9XA 1QH1B 2Q46A 1L7MA 1JAXA 4NJEB 3W5BA 4A3SA 3C6BA 1HOXA 4MUBA 4Y9SA 3KUDA 1XAIA 3KHUA 4QHSA 1E2LA 4H7PA 4N7BA 4EB6A 5BV1A 5KFKA 1RZRD 3ETJA 2ZRIA 2H59A 2GZHA 5AKEA 3BIOA 3K70C 3TBHA 2P40A 2IHBA 1T9KA 2HQBA 1L7OA 5K8LA 4JWNA 2CB9A 2D5AA 4P53A 3AJDA 3FTPA 5HF5A 2O1EA 4RBNA 3AKEA 3W9YA 3UMGA 4DCCA 1RHMA 1EA7A 3A6JA 1PQUA 1PWHA 4X97A 2BTQB 2ATLA 1M74A 2B69A 5AUNB 1LJ8A 1VLJA 3ICEA 2XQVA 2JI7A 5CD9A 1U7XA 1KY2A 3UXEA 3FDJA 4KR0A 3LCJA 1VHWA 1WXGA 4OHYA 1TO2E 2I6UA 4KFUA 2PUEA 4XQ9A 2W6IA 5J4HA 2D54A 2GNOA 1HYGA 4GZ3A 1AHIA 2ZDHA 4H3HB 3NIFB 3NALA 1HLDA 4ZT3A 4A6XA 2G1JA 4UHBA 4A8TA 4MTCA 4QU8A 3VC1A 4Y3UA 8ICKA 1HZZA 3Q6MA 5EWMB 3V2GA 1D4ZA 3RVLA 1HURA 2ZT5A 4PPNA 3KS9A 1DAEA 2XMSA 4ETWA 4D5GA 2HW3A 1T13A 4A2QA 1QBGA 1ZQJA 1UFOA 2I9KA 3IJPA 2WWRA 2P5YA 4YQYA 1RMYA 4A0HA 4EVIA 1NWHA 2X14A 4BGVA 3JVDA 5G0SA 2IHKA 1OMOA 2EP5A 3O8CA 2NNLD 3MDCA 1KEPA 2C82A 4M6WB 3DDCA 5ER6A 3KELA 1UBHS 1L5YA 1EQUA 3C5HA 1ABEA 2R8EA 3HMKA 2Y4NA 4BJHB 4DIEA 2WM9B 5LZ5A 2QLLA 3F6CA 3LX5A 3FI9A 4R8RA 2R6R1 3FSEA 7ICQA 1E8MA 4FCWA 3PTZA 4M8SA 3IILA 4M60A 3ORFA 4CDRA 1BHO1 4BZZA 4OHCA 5CR0A 4AY4A 2VH2A 3R41A 2BFOA 5LQUA 3GZ4A 3KNZA 1FTGA 1APBA 3I8SA 5KVVA 1KO4A 1UPXA 1U8FO 5AW0A 2QXYA 3MR5A 3K6SA 3M2TA 5FPYA 3F6BX 3G8YA 2RGAA 4H1UA 4RK1A 2EKQA 4Q4AB 4MWOA 4HAYA 4HEJA 4DL7A 2XUJA 3F46A 4AFNA 3Q88A 3JVVA 4KODA 3TBFA 2QLTA 2PD3A 1O3YA 4EHFA 1K6JA 2LBOA 2A4MA 1U7PA 1KVQA 1KSPA 5LU9A 1MOPA 4PZEA 2VP6A 3FHCB 5LLSA 4L0DA 1DRKA 4GXTA 3BMQB 3F3KA 3Q2IA 5J0WA 2E2WA 1T10A 4WVLA 3T54A 1Q92A 4NH0A 1EVLA 3TEFA 3CZ5A 4PO3X 2JJMA 1YNOA 1FRZA 4YHHB 1C3OA 4OSPA 3MQFA 1C9NA 3IQDB 2KB0A 4R9UC 4YLGA 4IEIA 3FN4A 3ZV7A 4UOEA 1S2DA 3UC9A 2DMRA 2ZSFA 1YR2A 4O02B 2RB5A 2QQEA 4LOJA 2J09A 1PTKA 4P0PB 1PTJC 2M1XA 4ZA2A 1JSLA 3NVZA 2NVOA 1U4NA 4D3DA 3C70A 1CYEA 4G1CA 2NOAA 4Z1OA 4PFSA 4QASA 3H9QA 4TL7A 1X1QA 5G0WA 2VZ9A 1W6UA 3TM4A 3NWOA 4CVNA 3C4QA 2QW0X 5D3ZA 5AKIA 2PAAA 5JAOA 3WP0A 4Q16A 1E6KA 3C24A 4LMPA 1MABA 5CW2A 2RONA 4LV8B 3QKSA 1AG9A 3UT0A 4MW4A 4RCZA 4HF7A 1IQUA 5IARA 4KO2S 4QUBA 3MIIA 1VA5A 4UAZA 3KEQA 3TPFA 2O4CA 4MV0A 3AIMA 5G1NA 4WLUA 3T7CA 4MUNA 5F73A 3NO4A 1E4EA 3IODA 4I46A 1X2EA 2EARA 4E51A 2Q0XA 4N12A 4A15A 4G8JA 5JSYA 3RCBA 4CIBA 1WAMA 2VRNA 2DKFA 1CR0A 4MEAA 2B7CA 3QVTA 5EL0A 1QIHA 3CNOA 3M6IA 3QPVA 3NVWA 4NCXA 3O4FA 2IV2X 5FEUA 5KWEA 3VR0A 1REQB 2QVBA 5AJYA 2BEKA 1AHNA 4V0OA 3RFCA 4NKRA 2QMZA 2DOKA 3NG1A 3JPSA 1NUUA 4D8TA 2NRZA 1MC5A 1PX0A 1AY0A 1W88A 2C7GA 3O0TA 2I33A 5KVQA 3IBGA 3J81k 3WMFA 3CB2A 1PAUA 3AETA 4H6VA 1UMBB 4JMLA 3OPYB 3GLKA 4YD2A 1MQAA 4MS4A 3AFGA 1EZZA 3H2IA 1EHIA 4KLTA 1ILEA 2WM2A 3OKPA 5BNFA 4B40A 3O03A 1AKVA 4RULA 1D6MA 3L0CA 3D6MA 2C7VA 4EAAA 4PGYA 5KYUB 3AR8A 1TI7A 2IODA 3PQ8A 4TTJA 5H82A 1QFSA 5FWDA 2Y9PB 3UCXA 1NDHA 1OXXK 4JOBA 2G36A 3DXXA 4BWVA 1CUBA 4HGYA 1WR8A 1T0HB 1A8SA 3O4RA 4NICA 3STWA 2H48A 2PWZA 2LKYA 4HWOA 5BWOA 4RL6A 2EIXA 4G0YA 1NRXA 1GILA 4QTZA 5KWSA 3N86A 3U1TA 4HMPA 1VKHA 5BOSA 1HDOA 5AKKA 3OQMA 3VYSB 4DLSA 4C21A 5E3IA 5HJ2A 2BEVA 4LTNA 5AT1A 4CCYA 2DTDA 1A69A 1OJLA 4G5YA 2Q5LA 3AKYA 4NZZA 2C2DA 1T4BA 4B82A 5CVUA 2QGZA 3OEED 1LPPA 1C9EA 3NW9A 3K15A 5FV7A 3GD7A 3JYOA 2BEWB 4PSKA 4RHEA 4QPDA 3W1EA 4FXPA 4AXBA 4F3YA 3HDYA 2REXB 4K4IA 3JZAA 1QCYA 2HSEA 2IW1A 4EJMA 4L4RA 3Q98A 3OMXA 4KAXA 1QRUA 3GEMA 3WO0A 4EUNA 3SV4A 1JVNA 4UUBA 4L6AA 3EBOA 3EYAA 5FBWB 3AO0B 2R97A 5HHTA 9ICFA 3BJIC 1U0HC 1OA1A 4OJNA 1CJUC 4RJIA 2RRDA 4RHUA 4P98A 4ZI3A 1X70A 3TBKA 4RQ1A 1WKCA 4I2FA 1NNEA 1U7ZA 4POOA 2OCIA 7ICTA 5JYBA 2H3IA 2I55A 3M6WA 2YZKA 4PYRA 4YRTA 2R2AA 2FFJA 4OA5A 1H2AS 2VEOA 2RARA 1LK5A 1KU6A 2C7QA 2X2OA 4PZCA 4EY6A 5B2ZA 3CGGA 5DLGA 3C6XA 4IRMA 3OUZA 1BD3A 2WKWA 3H1PA 3HJCA 4MV3A 3ZG6A 4QPCA 3SIPA 4FOOA 4FGJA 3GLVA 3DUFA 5JXWA 3WIBA 2NXWA 1ZBQA 3K73O 2WJ6A 1RPAA 3OESA 3A31A 1I4EB 2F90A 1CI4A 3R4VA 2P6NA 1Z3CA 4J91A 3RC8A 1R8JA 5B57C 4Z8YA 1IIPA 3F9IA 1SMKA 1C20A 5DNDA 2RGBA 1R16A 2EQBA 3HGTA 1EQ2A 5EXSA 2PFGA 2VKTA 3HU2A 1VMIA 3UXPA 3FPSA 3QBDA 1W34A 4XUGB 5KYKA 2BVNA 1MC1A 4TN5A 4B35A 5T14A 3AMVA 3GLSA 1B00A 2P2SA 4G36A 5DPMA 4DRXB 1EK5A 4TKUA 3OHSX 1NW8A 2Z2ZA 4AUNA 4RDXA 1T9AA 2HQOA 2CL0X 5HNKA 4MULA 4AQDA 4WCFB 3K4GA 4BYMA 2MJLA 2QAGC 2PL5A 3QPBA 3T7KA 5B6PA 1SAYA 2ZYIA 3H11A 2HRCA 4IHJA 2QNRA 4JENA 2WB1C 4KREA 2PD4A 5C5IA 3HB7A 3B13B 4JUAA 1WVIA 2C98A 1TECE 4MA4A 1D8BA 1CX9B 2E5FA 2H54A 1QM5A 4KCGA 1L3CA 2P27A 4KXLA 1VL5A 2FPOA 4HVAA 4HN4B 4WKCA 2XE4A 4MUKA 3DXZA 1QQ6A 4KQWA 2JZBB 3OPXA 4HEA6 3GGDA 4Y7DA 5BPHA 2ZJ6A 2JBAB 4BVHA 3GRAA 3I2YX 5DYGA 3EFBA 1P5ZB 5ERGB 1V38A 4GX2A 5IVDA 1KXZA 1T5IA 1Y63A 4GF5A 4F5EA 4JP1A 3HX0A 3P0FA 3H3FA 4PAMA 2J6IA 1G3IA 4ZODA 4C3ZA 3UJ7A 3JQAD 4OKNA 3DT8A 4GPAA 5CT6A 1T0PA 4IMPA 4I4TA 4PAGA 4QEDA 1Z07A 3TI0A 1WCNA 1GADO 3VGPA 1JAYA 1J0XO 4MLCA 5BWLA 2L18A 3BEOA 3GP3A 4R1NA 4TWRA 1L5HA 4Q39A 3GEIA 3FCAA 1URJA 2O6LA 1D5CA 5C32A 1CS4C 4F7DA 3ZC3A 4XAQA 2BYTA 3FB4A 3LC7O 4Q02A 3LF1A 4GQIA 5TPWA 2AJBA 1VB3A 3B9BA 1AUOA 3CG4A 3DTVD 4JZKA 2WE8A 1IBCA 1TM1E 3FE2A 5ES4B 3EXAA 1KU0A 2FMKA 3TWOA 3IESA 1Y6JA 5C7IO 4IFEA 4YAWA 2GBLC 5CFNA 2HHUA 1RLIA 2WJ4A 1XZBA 1J8YF 3DL0A 2FMQA 4YH1A 1C7ZA 4IXTA 1Y3IA 2I1QA 2QT9A 1XL1A 4BQSA 4EVRA 1CS0B 4AYBC 1OLSA 1XNGA 4AKGA 1UDRA 2BMDA 1QYRA 2OFWA 4S12A 4I3GA 4N5DA 4XJXA 5CG1A 4I4CA 3H9CA 1I0IA 3LNTA 4HQFA 3VQTA 4R1QA 1Z34A 2WSSA 5KTRA 2QB0A 1PR6A 4PC3A 1DOAA 4D92A 1RADA 2RHFA 1F2TA 5E4FA 1THZA 4KH1A 4MIEA 3IQWA 1BG6A 4TPKA 5B2EA 4LF5B 1KSHA 2DUNA 1G5IA 2CEKA 2WSIA 2OO7A 4A6EA 3OQIB 1JG1A 4MRAA 3EUWA 4HN9A 5MN4A 2W48A 2ZTCA 2FR1A 3JRWA 3SX4A 3BQNB 4D99A 5ADWA 3S44A 5TRTA 1JYSA 1G63A 1SRRA 2HWKA 4ZIRA 2XQKA 3VO8A 3IAS6 1ML4A 4OV6B 4EZBA 3RRZA 5EHZA 2KK0A 1CRWG 2E21A 1XTQA 4CF3A 2CFTA 3VDRA 2KNJA 1BRMA 3IP6A 2WJIA 3FKSA 1K6EA 1HNWB 5HS4A 2F59A 3WNCA 3OA0A 3LKDA 5LYJF 1NQVA 2UZ3A 1M1NB 2SKDA 3RFXA 4TYWA 3IPXA 4F60A 2VQ6A 5LKAA 1E2JA 2PUDA 4R3UC 1LB1B 1T5HX 5LLTA 4OIMA 3HY4A 4NU0A 4RMNA 3ZDQA 1V8PA 5EFZA 2LRHA 1K63A 4IIJF 2X4GA 1DDOA 2AE2A 4G6ZA 4RPXA 4JC0A 4KN8A 1UM8A 3SPXA 1YMUA 2C3MA 3L79A 3L7BA 2DECA 2B7LA 4RY2A 4ZU1X 2O7VA 2W93A 5LYYA 5T64A 3F53A 1XQ1A 2NV3A 5KG2A 1AN9A 1LDEA 4GBMA 3FWZA 1JXQA 4E32A 4P3NA 4IRXA 2R8IA 4XIGS 4LMRA 2O7SA 1R6UA 2EZ8A 4MMXB 1EDOA 3E1GA 3H0LB 4JLJA 1QZUA 4L0MA 3HL0A 1JV2B 5A4FS 3GILA 1MRSA 3G8AA 3Q3GE 4I3HA 4MI1A 4KQGA 3SNKA 2R7KA 5ITZA 3FNEA 1MOZA 2A3RA 3OT4A 3ZZNA 4YNBA 1PFKA 1S0VA 3GFKB 4OXQA 4NNOA 3GAZA 5EFOA 4TMVA 5IAJA 5D8DA 1S6YA 3GBPA 3OZEA 3VRHA 2QN1A 3HB1A 1JG3A 1N6PA 2GPSA 2HDWA 2D0IA 4Q3KA 2X0DA 1XHEA 2W70A 3R7FA 3ZWAA 1UEIA 4BGUA 4XWTA 5DWVA 3ZN2A 2GBGA 3Q87B 1D9XA 9ICKA 8ICBA 2GK3A 1KI6B 5JOQA 2MWMA 4TKZA 2XW6A 1WB9A 3GQBA 3AEUA 5A6SA 5G4KA 3X3HA 4MHSA 4FT2A 2IPAB 4ECVA 1KBOA 3TQFA 3FOZA 4N39A 3FA2A 4OSEA 3CUUA 4XYEA 2CLHB 1YL7A 5JNSA 3T3MB 5CNIA 4DGSA 1MP0A 4PTYA 5TR9A 2XOKD 4FI3C 3GV7B 1V45E 1N2OA 3PCXA 4S05A 1UFVA 3UENA 5BSWA 2J7KA 2GAFA 1TK5A 1GU7A 1W1WA 5I7RA 3PFHA 4D8WA 1QJCA 1I2AA 3GUCA 4IDQA 1YRYE 5HKLA 2CJWA 3HCOA 2FPMA 3G82C 4Y0AA 2X4LA 2ES6A 1EVJA 1MEJA 4C3OB 1FU7A 2IHZA 4CCAA 2RGRA 4U9HS 3VDXA 3WYAA 5TQ2A 2M32A 2WWXA 2X9GA 5KEIA 4TROA 2PLRA 1A6SA 3OZRA 4XCQA 1N5JA 3L4PA 4A2PA 4R71A 2FSFA 5TSDA 1DAOA 1UMDA 1GYPA 4GMKA 3SJCA 1A04A 2WTEA 2CHVA 5J0RA 1GGJA 2QLFA 3O7MA 3RRHA 4QDZA 3QZUA 4MUHA 4R1TA 5TGTA 1UDAA 3EPLA 2B37A 2ZRHA 2DUMA 5T4FA 5HR6A 2WAAA 4NPAA 3SGLA 3WK4A 2IE8A 2F8SA 4J6FA 5FUVA 1HJPA 5JRZA 4AN0A 3NBQA 5IIKA 3V5NA 1RLJA 2BM0A 4L74A 2IY9A 4JJEA 1JTEA 1P72A 1PJQA 3X1JA 1Q3TA 2QNBA 3FPBA 2VHCA 1ML3A 5ADVA 2C2BA 1G9TA 2DPMA 5FTJA 1MSWD 2C42A 3TLMA 4NEGA 3NKLA 3Q3CA 1RLUA 1ZMTA 2I2XB 4EQZA 3ZNPA 3FNHA 4F3NA 1O95A 4JT4A 2JGFA 4C7JA 2R6FA 4ZDKA 3AN1A 4IOJA 2Q0HA 1NK8A 3A10A 3H0RB 4D9FA 1IC6A 1GAEO 4DVJA 3L7IA 2ISQA 1ZUNA 4ALMA 2KZMA 4EI2A 3N70A 2A3NA 3ZWPA 2XEDA 4E5UA 3SKXA 4A91A 1QKIA 3OQ6A 4S24A 4NXNB 5D7NA 4X1IA 4KW7A 1ES9A 4O4LB 2I22A 4YN4A 5DVZA 2PWBA 2R44A 2C2ZA 1KYXA 2C9OA 2NXEA 1I7PA 2WF7A 3H5VA 4RDHA 2DCUA 2NZUG 3B9QA 1R5OA 4FKZA 3TF5A 2YASA 3FKJA 4ZCIA 1R0LA 3MNFA 4IH9A 4O8ZA 5J4VA 1PUIA 3DMTC 4QPPA 2WTMA 3F3SA 5HZGA 3DPIA 5J58A 1CDEA 4B74A 4TQRA 1OI3A 3AEVA 1NUSA 3MGIA 3SJAA 4NZMA 5EZ6B 3ZDFA 4E0DA 1R3DA 1ZK0A 4HAWA 3L6CA 2BHSA 5E4TA 1KJYA 4EO4A 1NK0A 4QJ3A 3M6ZA 2JEFA 3CZ4A 1VL1A 1E9RA 2BFCB 3LDUA 2P41A 4PAWA 1W0JD 5KCZA 3D8BA 4MV5A 3H9BA 1NXOA 4ZMBA 2REQA 3B60A 4EWLA 3ECCA 1L5QA 2B35A 3RJTA 1SBQA 1N2CB 3R3WA 2Q9AA 5IRCD 2H85A 4BO4A 4M8IA 1R2QA 4BHTA 3E3MA 3F7TA 4X90A 4ED2A 3PHCA 3LLVA 1QZXA 2E89A 2PMZC 5T5QA 2AFRA 2XY4A 3ILHA 2QD1A 2WQ6A 4BVKA 4UZEA 1VJ0A 4PXYA 4R84A 1FVOA 4PHTA 2LPEA 3BKWA 3AVWA 3P52A 3G79A 1DBRA 2O2CA 3LCCA 3FHTA 1VKZA 4F93B 3VUFA 1MQ3A 1O97C 2JLWA 2WAQC 2QJWA 1WUTA 1LV8A 2XWQA 3SMQA 2BZSA 1SJ9A 3V1KA 1ZM7A 4EHIA 2JL1A 1Z0ZA 1CY1A 4ZAGA 5AI5A 2A0XA 1P4GA 1BO6A 2R6GA 5AW6A 3IDZA 1XPOA 1TD1A 1C30B 3RTAA 1QBKC 4O33A 5JXJA 5C4GB 2IDZA 3QU5A 4RPHA 3TAQA 3IVXA 2I2DA 4K6OA 1GGVA 3IR5A 2P69A 2M6KA 3LBHA 4GGPA 1EFKA 4DEZA 5LDHA 3BYZA 2Q27A 4TXHA 1MH9A 2I76A 5JAIA 1PF7E 1NY6A 5DP1A 2DKZA 4I6JA 1JBKA 1GHTA 4LF4B 3GMIA 3LUGA 5KTPA 3V33A 1I1NA 1QF6A 2O8BB 1Z0JA 3CLUD 3NP9A 2G1UA 4JDUA 3DR3A 1CXZA 4WH0A 3PNCA 1NGSA 4PG7A 5IVKA 4F91B 1PCXA 5JAQA 3EVEA 4MAFA 1EGAA 1EI9A 4QVGA 4R54A 4J0KA 2XAUA 3HWTA 3QVVA 4C8LA 4A1FA 1KC3A 1NA5A 4PQFA 1U98A 3Q8RB 3D2SA 4Z54A 4QEKA 3R2JA 2DP4E 1R27A 3QWHA 4ZVMA 3P0HA 4TLCA 4UDNA 4FZ5A 5TPZA 4TRJA 2D1FA 1HRKA 5F7JA 1K6MA 2YBDA 4C4RA 1LPBB 5DISB 1FS5A 2PFOA 1KZ6A 1HNZB 3M6XA 2H3ZA 5LP1A 5ALUA 3VPDA 1L7EA 1CETA 4IDHA 4JLNA 4LJ8A 4JEIA 1AK1A 4DABA 3SXJA 5LWQA 2PMDA 3UQ0A 3EE6A 3SDSA 3HILA 1J4AA 4QU0A 3ZW9A 2PKXA 4UHKA 1C9YA 1OT5A 3KQVA 1OZGA 1BNCA 3TQRA 3WMGA 4LGCA 3MTGA 4DQKA 3VZRA 3B1FA 2VT3A 3WGHA 2P9CA 4K0KB 2GBIA 1GPKA 2G4VA 1N25A 1YJBA 3KJEA 4YA6A 4AP9A 1P6UA 5DMHA 2GPJA 4OJ6A 1EGQA 1FQOA 4CHTA 3LPDA 5J2TF 1BCSA 3WK7A 5DYTA 2EQYA 1QP4A 1LW7A 3LLSA 1VE9A 3S2IA 3UICA 7ICEA 1BHJA 4ZVSA 1MX9A 1DJMA 4Q6WA 2YN4A 1N9KA 4FE3A 3AP3A 1ID1A 1KJ9A 4PX2A 4ZAVA 4TVKA 3H5IA 1WE2A 2VDPB 2NPFA 1SHKA 4FE4A 3W05A 2SCUA 5HQ3A 1NK4A 1EX1A 5COQA 5JZVA 3HYTA 3JPQA 3PW7A 4AY5A 1AM4D 3DD1A 5CHGA 1EUYA 3X1ZA 2OHIA 5B1HA 1FVHA 2C88A 3UHFA 3NUQA 1TVCA 3L40A 3S68A 3VPSA 1YZKA 3DUWA 1YJ5A 1BWSA 2ZS7A 3GNQA 2EZXA 1DAIA 3OAAA 4C43A 5LUAA 1IZ8A 1K8ZB 5ALWA 4IJ5A 1EBUA 3MR6A 1HEUA 2OK7A 3N2GB 1UPHA 2JEOA 1IBLB 3L7CA 5A04A 2XYPA 1VMAA 2VQEB 1Z5WA 5KNDD 5DOVA 1XTKA 2FE1A 5CFOA 3D4IA 4RVUA 5CLLA 4KUGA 1Y1RA 1YV9A 5LZ7A 4GKJB 4C1BA 1X9MA 4P35A 3PO5A 4CCWA 3MOGA 5JSHA 1SKYB 2PGDA 5TLSA 4L76A 3FRJA 5C8YA 3T1YB 2X0IA 1WHSB 3LS2A 1JFVA 2HFKA 2OLEA 4GFDA 4F2HA 3E9CA 3GLTA 3GLFB 2G9ZA 1NXPA 2QU8A 4WASA 4DNFA 4EMUA 1A8HA 1E5QA 3GEEA 1KFBB 4F1JA 5JCZA 1VIAA 2ZVJA 4U8HA 4K03A 3IRVA 1IONA 2QEQA 2JZOA 3MQ4A 2PZBA 4I9NA 1T2NA 5D5PA 2OHFA 2AN9A 3SI8A 1K4KA 4C14A 4RZSA 1Z6TA 5JVDF 5KKAA 1AF4A 3D2NA 3NX4A 2Z3VA 3AEQB 5KTQA 1O6FA 3W79A 1RQPA 5GJBA 1ZGGA 2P9JA 4OSOA 4YJKA 4O9MA 3JX9A 4RCVA 4KQMA 2W11A 4S0XA 4YROA 1DIGA 1QLNA 5B30A 1V4BA 3P32A 1XPRA 4LRSB 1A9YA 3QKUA 3PX6A 5EAIA 3GH1A 1O89A 3CPHA 3JRNA 2RK4A 2IUTA 2BUBA 5IIIA 4IGKA 3K0HA 2W9CB 3H84A 4L9SA 6LDHA 3VUEA 3ZDDA 3T0GA 5BYBA 2OZLB 3E0XA 3U2QA 1YQDA 1G6Q1 4I8XA 5DW0A 2GPWA 1NR5A 3WHKA 3LFTA 4D7AA 4FX2A 4XDHA 4PJ0U 2H0QA 1CUVA 1OGJA 3C1YA 5I9TA 2ZIGA 1NJWA 5JCJD 1CR2A 3MILA 1FFWA 4IIEA 1R15A 4EO9A 3QU4A 1EQAA 5KJFA 1G16A 3TK1A 4CR6A 1J2RA 3WYFA 1FP4B 1E3LA 3N59A 1XCJA 4HDAA 3A4TA 2O2YA 1BPZA 2O4UX 3LGXA 5DTIA 2ATVA 2A33A 4G4JA 1EFAA 4BX8A 3AZPA 3HJFA 4Y0NA 3AY6A 2DFNA 2CWDA 3PQ6A 1VM6A 3FFTA 4D3SA 3N07A 5PGMA 5AVVA 2OHGA 2IEIA 1YUMA 2E6KA 2FUEA 3RWBA 1J39A 3DBRA 1AGPA 1NRJB 1GNVA 2O05A 1BRTA 3R0QA 3O73A 4L0QA 2H1RA 1M7BA 1RKXA 2IY8A 5EWJA 1E60A 3ZDYB 2NMVA 2RGDA 5LQSA 3RRXA 2QP3A 4M38A 2NPIA 2AWOA 2IU0A 2OV4A 4OFWA 5AI8A 3AM5A 5GGXA 3E7XA 1R8SA 4V0ME 4G4SO 4K8OA 3S55A 1DO2A 2OV2A 3V1LA 4GOND 3I9LA 3K5PA 5GQSA 5DYWA 4OBWA 3V8BA 4YPVA 1HEIA 3LT1A 1LLCA 1L8AA 3ZU2A 2P1ZA 3L5OA 4BO7A 1T24A 3KC2A 4XDGA 4ZHQA 4ZV4A 3G5AA 4LTMA 1V8FA 1HIWA 3DAHA 3UPDA 1JU4A 3CLRD 1GSOA 3L77A 4KUEA 3X2SA 2WOOA 1RMTA 4FZNA 1G18A 3LXRA 3I9FA 3QBEA 2DR0A 4M9LA 2BCEA 3EOBI 4GT1A 5EHIA 1UZMA 2IUUA 4R8KA 3FNGA 3NGMA 1NJSA 3VTAA 1DRUA 2ZE8A 5FNVF 4MYUA 2MUTB 4DOAA 4HMOA 2FN9A 1GXSA 4D45A 3FZGA 1A96A 1FYWA 4ND8B 3PR4A 5E1BA 3UWOA 5KL1B 2OQ2A 1N5LA 3DT9A 1NE2A 4HFRA 4A8HA 3PCRB 1TK0A 1KDRA 1TPZA 3RAPR 1B26A 2ZANA 4ACBA 4ZDIA 3OZAA 1V2GA 4TMWA 5BUCA 1XSLA 4X66B 1K06A 3RBXA 5ECGC 3WGQA 4PH5A 4J7XA 3LVRE 1YBVA 3NT5A 3AOEC 3W8EA 4GC9A 2HLDA 2W2MA 2DWQA 1VECA 3OUUA 1SBTA 1G9XA 2JFWA 5BNWA 1IY1A 2BP7A 4FFDA 3KTAA 4ARSA 3PWKA 1TEZA 3CV3A 3OZGA 3VHXB 3HTXA 2IIPA 1NYRA 5B7PA 3GG9A 3A3NA 1IVYA 3L7MA 5K2OA 4Z99A 4EW6A 5AK6A 1YDHA 4WBSA 3IHWA 1NASA 5B5SA 2OAGA 2IYWA 1JR3A 5EG5A 4YR2A 2G4CA 4C4ZA 3UPTA 1NAIA 1GM5A 3PW4A 1OLXA 5AOBA 1BDIA 3CLHA 2FHSA 5CCBA 3X1YA 4MVXA 1QCDA 3H40A 1CRQA 1ENOA 3KJIA 3EIWA 3PXCX 1TAUA 4II2A 3ADOA 5HBGA 2QD3A 3Q2KA 5A9SB 3HYSA 4Z4FA 4FFSA 1PZNA 3GJ3A 3UZUA 1JSCA 3H97A 2ZYAA 2GM4A 2E1PA 4FIZA 2AOVA 1XAGA 2Q9UA 4TL8A 2ZR9A 3QMVA 3BXEA 5LJIA 5FYDA 5IIOA 2Z2KA 2A19A 1Z33A 3Q1LA 2W9XA 2PKYX 1MB4A 1VIVA 1WSDA 5GAJA 3JPTA 1ZUD1 1IY0A 3DV0B 1PP4A 4X5OA 2IHVA 4FFWA 2VVTA 1OBFO 2DE0X 1AQ6A 1JB9A 4PPGA 3PYMA 2OO5A 3LUFA 1IK6A 3X2FA 1HSZA 3AHHA 5FL7D 3OCJA 4QUGA 3ETHA 1NAHA 4V0LA 3S0JA 2WG1A 4BO0A 2W4MA 1Q7BA 2Q21A 4F4YA 1F12A 3K0BA 1L7PA 1YRBA 2ZYVX 1J2TA 1UZLA 3TH5A 4NYMR 4TS9A 4LOAA 5JY1A 1AZLA 3VVMA 1OXMA 1S8FA 1WVMA 5HS6A 2B3TA 3AV0B 1UKZA 3STHA 2QZZA 3G2HA 2IWRA 4B0PA 3LUBA 1D6JA 2ICAA 4ALKA 1Y9JA 3IH5A 1FSFA 3DHYA 3UB3A 2W4IA 1L1EA 4UDXX 3RAGA 4ZQIA 1COWA 4KSCA 5AI0A 1HDEA 3W2IA 3WSTA 1KZHA 3HLYA 4KBYA 3JQGB 2WVAA 1G2PA 4O2BB 4CMCA 3RJEA 4M46A 1HE4A 2ZUFA 2R8PA 4L3VA 4OQNA 2A9JA 5J0QA 1FA9A 4GWKA 3IUEA 4E94A 2Y2UA 4Z5XA 2QL5A 2ISCA 4LFAB 4INJA 3MWYW 1WUIS 1T1SA 1RYZA 3TG8A 2CLMB 4WLNA 5IT0A 3DAGA 1ZMBA 3WDMA 5KZMB 1EDZA 2YDYA 3NNDA 1YDWA 1UBCA 3D8HA 1IXYA 1I1OA 2JHAA 3AGQA 2BTQA 3E5NA 4WOJA 3KKEA 2BQ3A 3TADA 2R65A 5KNLA 2BUAA 3FX2A 4X91A 2YJ4A 3IJ5A 4DQXA 3WZLA 1ZQPA 1ORVA 3E3NA 3TS1A 5F4BA 5TMBA 1I9GA 4Q3AA 2VAXA 3CBGA 4RVHA 3OCVA 3IB6A 4M0EA 2O5EA 4QW9A 4A5OA 2E8MA 2V6JA 1UADA 5CP8A 4MSUA 4OHMA 1JHPA 3LUHA 1C8KA 3RQIA 1K7SN 2QN3A 5KCMA 3KUKA 4YIKA 5KFFA 3VJLA 2BCSA 4AMGA 2WFAA 3O9ZA 1AA9A 4JWKA 1WEHA 5EWMA 1DWOA 4RM3A 4WA7A 2WU4A 5AFSA 4PRKA 1UKBA 1NZJA 4H1HA 3T1NA 4TWJA 1IB0A 5JQGF 2PUTA 3ZHTA 5GJCA 3C7TA 1H4TA 1PWEA 4HDMB 2G7ZA 3HJGA 4OKSA 4BTEA 4CM9A 2GPAA 3EQ2A 4LJ4A 3GDXA 4M6WA 3R6LA 3S7TA 2CL5A 3I0MA 3SE7A 1Y7LA 4BV8A 2DSTA 4GX0A 4JQOA 4OGLA 2Q49A 3KWMA 2OLJA 2FN3A 5KTSA 1V9LA 4PYMA 1V71A 1EUDB 4Y2PA 1FMTA 3UK0A 1Y81A 4NV0A 1I6MA 1ODKA 2P62A 1TOAA 4I2JA 2NTNA 2JA1A 4DOMA 2RH5A 4CKEB 1DKRA 1KKUA 3ZHCA 4XM2A 4YV2A 3ICOA 3DZBA 1K27A 4PR0A 4MZXA 7ICIA 2VP0A 1MZPA 2XQJA 2QENA 1K5PA 1QIGA 3GFVA 1I0ZA 4Q4AA 4J0CA 4FNGA 4FUTA 3GFTA 3V6LA 3GN2A 5LMCA 2FXIA 3PNLA 3GD5A 1IN5A 5WRFA 1QZTA 3GIMA 1IAVA 5IASA 4WXEA 4KAAA 4OJLA 5E2IA 2IH4A 1GKLA 4FWIB 3IT0A 3ZJUA 3EUAA 3EWNA 1X87A 4YJ2B 4OHUA 2ORIA 3BMQA 3M4NA 3F4KA 3NB0A 2QYOA 2JVJA 2VTBA 4D96A 4O4IB 3H17A 4WW0A 3EW7A 1MO3A 4XXHA 3VKUA 3FVRA 3A28A 3MCWA 1TEHA 1FYEA 3DQPA 3HXOA 4XRGA 2AFIB 4RL4A 2K7FA 2Z43A 4P0PA 3WLSA 1Z5NA 2AKYA 4F2RA 5CWRA 1JLKA 1OX4B 4IXWA 2ZITA 1KAHA 4WXPA 2FOXA 5LBTA 4JP8A 2P0EA 3RLIA 1MGOA 3G6YA 1JIQA 1C3EA 3MYRA 2EANA 2K4MA 1MAHA 2X19A 2GH1A 3P19A 3TXYA 2W2OA 1UWVA 5KNCH 3PD0A 5LP6F 4I6EA 3WU2U 2MSNA 2ZETA 3OFVA 4OLHA 4X6LA 4B47A 4F84A 3H8JA 5HKOA 3GBVA 4MYCA 4DGQA 1BS2A 2KMDA 1ZD8A 3FTEA 4OEHA 8ATCA 5BPFA 3VM6A 3U9SA 4ZT6A 3L0IB 4KN7A 2NSHA 4AG5A 4RK0A 1CB0A 1Q7TA 1EXWA 3GRFA 1E0JA 2MINA 3NOXA 1PJBA 4UDYX 2R7AA 1U6JA 4YACA 2FWPA 4R1SA 1GNSA 2VLIA 2FPWA 3REQB 2QVCA 3JPWA 1GJRA 3DF7A 1JLSA 1DEXA 2FZKA 4UM8B 5FTWA 3KTDA 1REQA 4UM9D 2ZEJA 4RM2A 2MSDB 3QPUA 3NHAA 4HYYA 1U2GA 2VP3A 1CQXA 1CUFA 2HAEA 3FNQA 5IYZF 1FDSA 2BI4A 1M2JA 2YHBA 4U1RA 2PPLA 2YWFA 1I5EA 4CV3A 2ECQA 2BKVA 2Q8PA 3OQHA 1UBGA 3KO8A 4BNFA 5KC8A 3HUUA 5FLYA 3OQOA 2WT4A 2R25B 2DX7A 3STVA 3UV6A 4ECAA 4AQ7A 3A9SA 1W9MA 1ZH2A 3N8HA 5KQPA 2X1MA 4EJ0A 1XAHA 4R2JA 4FIDA 2CN1A 1NHGA 3R75A 2V74B 1UC8A 5M34A 4AZ0B 2H51A 2YCBA 4DKJA 2LNDA 5KYUA 4K81B 2NXJA 4BQPA 5EUMA 4RPKA 4QX6A 1XVUA 3GPIA 2IX3A 3EXIB 3GH3A 3U7FB 3K0EA 1P1JA 1SUEA 4GLOA 4X7RA 5EWLB 3BS5B 3BSFA 3PIIA 1YL6A 2YX1A 3EWSA 4TYMA 4RMGA 2GEBA 3IBTA 2BLLA 1GZ7A 4R9SA 4DCJA 4LZAA 2NXNA 3KB6A 2W22A 2ZRJA 2FX2A 4LVSA 4ND5A 4MGZR 4TM7A 1PJ8A 3T06B 3DEFA 3MTBA 3HYLA 1SG6A 1J24A 1BIFA 4QW8A 3ITEA 3TFOA 1Y88A 4KKVA 1P91A 4HLNA 2W6CX 1V4VA 2DQYA 5DNAA 4UTXA 1KYWA 2RI1A 3GJSA 3KEOA 1XMOB 3E05A 2BEWA 2O20A 3D4OA 2BHRA 2C2KA 1DKOA 1K5HA 2RKOA 4M1OA 4H7HA 5FFNA 2IS4A 1Z45A 2ZRMA 5THKA 3KZNA 2B36A 2IPNA 4CIAA 4J9SA 3PPXA 2FR8C 1YJXA 1Y3BE 4EX7A 1UKCA 4ZCQA 2FVYA 3L46A 2Q3FA 2YV3A 1WWKA 4FJ2A 3OPMA 2XVMA 2EJUA 4O1MA 3RSFA 2M6LA 1T6YA 3CR7A 3F8SA 3GAAA 4WVFA 2HU2A 1OIXA 1WY7A 1XSEA 2E6UX 4U2GA 4ZZ0A 2NQ2C 4C0XA 2PJDA 1W85A 1Q5PA 1CF2O 4D4LA 2TS1A 2XZDA 3HFRA 1NR1A 3K1TA 1H1LB 1YVPA 3EA4A 4MGYR 1ZQHA 1WX1A 1VL6A 4I50F 3AR2A 2G88A 3GX1A 3ZY5A 3KU1A 1HEKA 4QFDA 5K4HA 1UP7A 1S2MA 1BXGB 3LX4A 5F2OA 3X44A 2EH9A 3ASVA 1ZIXA 4GOJA 4FBMA 2JIOA 3W4KA 1F3OA 3LY7A 3CRVA 1QK3A 3OPQA 2BDPA 2PFNA 1TZKA 1FDOA 3JQ9A 4QBGB 4A03A 3M49A 1B8NA 3V7LA 4M8KA 5BSGA 5KI6A 4OQEA 4YV7A 2QRZA 3QE0A 3AYZB 5HJ5A 1GA6A 3MBIA 2C0PA 2Y1IA 4Z9FA 2ZWPA 2X76A 1UFKA 2AFHB 3A6KA 4MR8B 3LX6A 3H2JA 5JMPA 5JQWA 4A6DA 3U40A 2I4OA 2W7OA 3ICPA 2L42A 2HA5A 5AKJA 4CR7A 2WVGA 2CCJA 2ODAA 3RFAA 3FTFA 4P9NA 4FFMA 2H5JA 4XM1A 4DCVA 4BUZA 1YBHA 2VA8A 4L4XA 3FCEA 1X66A 3KFXA 3B3AA 5MFZA 4OMCA 4QIHA 2Y68A 3UXYA 4DRXA 4EHNA 4X1YB 1ZRHA 5HZKA 1IK4A 4UZSA 3VFDA 4MHVA 5C7LO 1O94A 2IK8A 2W2LD 3RBAA 2HSZA 4XIJA 2VRWA 4MW7A 1XB2A 2EGUA 2CWWA 3RB6A 2A84A 5JZ9A 3V8NA 4B43A 4ZKDA 3FUTA 2Q2WA 1XRPA 2OGWA 1QRDA 5KT6A 1AUXA 1F8YA 4M86A 1CDZA 3T5AA 2GCNA 2O8DB 4JJGA 1E92A 3W2FA 3SWWA 1VIDA 1YCGA 2RGNA 3MWFA 2EBHX 4CV1A 5FI1B 2WTNA 3QELB 3IPAA 4QZGA 1WO8A 4MV6A 1YCDA 2FMFA 5JTTA 3OA2A 2PRSA 3ALRA 2VS1A 2JZBA 1UXGA 4LOHA 721PA 1OI2A 2QM3A 2AUTA 2FRDA 1BFKA 1Z9BA 1N32B 2JBAA 4IQWA 1E66A 3CVWA 3BK2A 1QV6A 1FTYA 2GAOA 1TTTA 4FEYA 2ZWVA 1I3MA 1M1YE 3SS9X 2RHHA 3AVTA 1F0MA 3R7LA 4F9EA 2UVWA 4RVOA 5E95A 3C98A 3KT0A 1U3WA 3W77A 5DCYA 3R7BA 4KR7A 3TTSA 3NHLA 3ANTA 3RRYA 3H5AA 1V8BA 4IG9A 4ZHSA 2G1KA 4HQLA 4UAVA 3ESCA 1P19A 2FEWB 1R50A 4U9UA 3MJTA 5DQIA 1NUAA 2BSAA 2YYSA 3Q3JB 4Y6SA 3JYHA 3NDRA 3V7NA 2FUG1 4E14A 3RARA 2Q4RA 1JQLB 3UH0A 1VRCA 1V11A 1R0KA 1Z88A 2ONZA 1USKA 1Q8KA 5EQJB 5AWFC 1LSOA 2XGGA 2IZ1A 4CEIB 2X7XA 4QQKA 1QGOA 4OA8A 4W6QA 4UPVA 3OSUA 3S99A 1MJ5A 4ZJPA 1CS0A 1IG3A 5J2AA 1AHPA 5KNBH 5KSZA 5K4LA 4KQ2A 3OJ0A 2DHQA 4H4EA 4I2NA 2VO1A 1Y3DE 4J7CA 5FP0A 1E94E 4ZO6A 3P2YA 4LA4A 1UK9A 3T9BA 3NIWA 2F48A 1J5EB 2F1OA 4P81A 1SY7A 2XYRA 2ZAMA 3EUEA 4O29A 1JJ7A 1YZGA 1ZR4A 4LSWA 1CEZA 3OQIA 2A9QA 1Z5VA 3H1EA 1WZCA 1RXCA 3OF5A 3QPCA 4RC9A 5EOVA 4KLSA 1W2WB 3T12A 2JLZA 3ZCXA 4BBJA 2MSWA 2TMDA 3FF1A 5HDQA 1DQYA 1QIDA 1IVSA 1GFWA 3QVGB 4ZRDA 1NZFA 1XTRA 1ZH4A 4LHVA 4PAQA 2CZCA 3I01M 2DPJA 4YRJA 6AT1A 4KSYA 1S8OA 3RKRA 5J2GA 1M1NA 1R10A 2DGDA 2QW8A 3AB8A 1J0EA 4P4UA 2RJ3A 1QUFA 3STYA 5KBYA 4ILEA 1LDBA 1HFKA 4DDTA 4UUOA 5TT1A 1Z36A 5TIIA 5KX5B 2QKQA 1TMYA 4LHYA 4OI0A 3GT0A 3WG9A 4BMYA 3UFXB 1I1HA 1DVRA 2CFSA 3QPAA 3CZQA 3CLUC 1G20E 2A9KA 3PHLA 2NACA 4PVCA 3JQRA 3BAZA 1E0KA 2A1AA 2GYUA 4IL5A 1Z4MA 1EFVB 2QUKA 3URMA 3W4IA 4C7XA 1DPGA 1KC1A 4DWVA 3KZXA 4NCBA 4WBXC 2RHRA 5FFMA 4G0ZA 1HO3A 2LZ0A 3A32A 5CA0F 3WKCA 2OWDA 4FMDF 1YR6A 4G0WA 3G9ZA 3MIZA 1PR1A 3SKVA 3QSGA 4TTPA 4IHAA 1WZUA 3CLTD 1XVVA 5K51A 2LE0A 3DOFA 1KO8A 5HRCA 5FYQA 3KJXA 2M2IA 1BVRA 2IYTA 3V3KA 4NARA 1GNPA 4KV9A 2VQ3A 3MTIA 3IKJA 3OGUA 2H1IA 1D5WA 4K9PA 4B6JA 3IV9A 4X63A 3T99A 1SXJE 4CNBA 3KQQA 1UKAA 4O4HF 4ZOCA 1JFRA 3T15A 1NX9A 2V1UA 1JPVA 5DXFA 1V95A 1WD5A 1M2HA 4YASA 1SKAA 1W30A 4HHEA 4JOCA 4TVOA 2J3QA 1QPBA 7ICPA 2F00A 3BMCB 3N0RA 4DUPA 3FRHA 2V54A 5JSZB 4CF6A 1XXLA 2P78A 4EPTA 4XYMA 3KSUA 4PN3A 5E0OA 1UM9B 3KLNA 5SZIA 4EPXA 4QECA 1TK2A 4R8LA 1O08A 3I2IA 4X64B 3AU6A 1BA3A 5EJ2A 2XYGA 3M6LA 1Z2CA 3DLPX 1YDMA 1KI6A 1PJSA 1H42A 3SAJA 1NBMD 1MA7A 3A1UA 2W90A 4G86A 1ZA2A 3V6HA 2QRVB 4MJXA 5HG0A 3WY9A 1BOFA 1H5QA 4GRDA 3CZPA 4UHCA 3MWJA 4B9MA 1OWMA 2P7IA 3NJ8A 1STOA 5KC9A 3V6KA 1LRJA 5DM2A 2XCIA 4B4UA 1WETA 3KWFA 1X38A 4BLSA 4BNKA 2Q1YA 3BCRA 3LIIA 4MHTA 1HDIA 5DLEA 1D4AA 2GPTA 1Z6QA 4MI9A 5CXXA 4HNGA 3HBAA 1PU2A 2NRTA 2GRUA 2N3ZA 2E49A 3VC8A 4DNQA 1QTNA 3MTJA 3KR2A 4NLGA 4U7HA 5IABA 2Q6LA 4OBXA 4OHFA 4DIDA 3JSAA 2HF8A 2ZBEA 1YK0A 4WZZA 1ZM4A 2C84A 1PNOA 1NNUA 2W0SA 5IIMA 1YHYA 4S1NA 1X9SA 1I01A 1YS6A 2G04A 2CVFA 5CCDA 5TJ9A 3KZKA 4NLCA 2J6TA 1PUZA 1CUKA 2BGMA 3BXHA 1A9OA 4C8OA 3PNQA 3CXRA 4FEAA 3I2GA 1AO0A 4F50A 1SKBA 4TOIA 2LBPA 1TV9A 4QU9A 5TQVA 4CNQA 5T67A 3JW8A 4L5JA 4LRWA 1OFUA 4F1WA 4HQ6A 3IAFA 1BS1A 4COKA 4O3MA 5JLJA 1M0WA 3KB8A 4UUMA 4NFYA 3BERA 2P2DA 4Q3DA 3A6ZA 2NP6A 3PKJA 2H16A 4PC7A 4KIUA 3WB0A 4ATNA 4M1MA 2C1EA 3HUTA 1WTCA 2A7QA 2VR1A 3W7AA 4DQLA 1QVVA 4EZIA 4XQCA 4OCZA 1DTWA 4LISA 3AVPA 9ICRA 3T7JA 1U9IC 3ZIAA 4NZ9A 3TLJA 3ZWOA 1XHFA 3VDMA 2GCEA 3CW2A 1ESDA 2WFZA 1U9LA 1E1KA 1QNFA 4DC0A 3SYRA 2XCRB 1GQQA 4J9PA 4DFPA 1T5SA 1G64A 2OMKA 2PIDA 4BTLA 4NULA 1CQZA 5FUQA 5EE5B 2PUWA 3D7LA 3HXMA 1ONNA 5JO0A 3K05A 4TTVA 4EF5A 4NOMA 1D03A 3BGIA 5FHQA 1L7BA 3LP6A 1WB6A 4Q4HA 1ISHA 1ZDMA 1FTWA 9ICCA 5TDHA 4BV9A 1FFGA 7ICGA 2WB1F 2AQ8A 3EFHA 1TC1A 5EA2A 3MJHA 2Z56A 3EJ6A 4RH3A 4GGOA 1QE5A 3PEFA 421PA 3V7KA 3SE0A 3A11A 3RSSA 3CKKA 5HUJA 2VH1A 5KWIA 2Q4OA 3WJ1A 2CL7X 1GL3A 3ZNNA 2E4UA 3ZNOA 2NO9A 1T8SA 1T3LA 1J5PA 1WZEA 2BFCA 2B78A 3SJ7A 5B4UA 4JA2A 1H3NA 4Q66C 5B36A 4LXIA 4EKNB 4MIOA 5BSKA 4CEHB 2VZEA 1HQDA 3D2LA 1ACJA 3WQRA 3HN7A 4MARA 3C23A 3DNMA 4NF2A 1WPGA 3QSYA 4AWAA 5B7NA 1Q0UA 2PGLA 2I7VA 4JP2A 4F8RA 2X8LA 3O95A 3C8ZA 1CR1A 2W2VA 4MOWA 3U26A 2ZT7A 4N82A 4GX1A 2JZCA 4MMYB 2VANA 1S97A 1XN1A 2RG1A 3UJBA 3AHGA 4LCBA 3L92A 3V8RA 2EGGA 3TE7A 3A3PA 2Z2JA 1MCZA 4B6GA 5C18A 2CNWA 2H4WA 3DC7A 4V1CA 5FH9A 4YJGB 2TMKA 5FA8A 2Y77A 3TSZA 1DDIA 3NAQA 2CNBA 3WWCA 4TLMB 3R4CA 1E5XA 1OBCA 1KP9A 1C30A 1P2FA 1EVKA 4FK8A 1NC3A 4F45A 1F0KA 4UCWA 3OIGA 1G8MA 3PY8A 2XCSB 4XEUA 2JGIA 4RD6A 4B3SB 5GIPE 4LYDA 4MUJA 4KN4A 1ZISA 3ABRB 3HO8A 1E1QD 4PGAA 2XMQA 1C4KA 3M9OB 2P9BA 2Z1MA 2XIDA 3QKWA 5DM70 2WJVA 4G5QA 2FP4A 3UJ3X 3IURA 1NVBA 1KJNA 4U7PB 1GOTA 1NBOA 4LXUA 1J2UA 4EEZA 2FRXA 2HLDD 3AR4A 2IHTA 1SWWA 4F21A 1AVTA 3R5SA 3ND6A 4S35A 3RS0A 2K6GA 3ZD7A 3NS7A 3UOGA 4FZLA 3DZDA 2HA4A 1GTVA 1ZICA 3THOA 4YDHB 5KVCA 2ZYDA 5JMWA 4RU9A 3GZNB 1ZI9A 5CR9A 1UBJS 1G42A 1TF7A 7REQA 4E33A 2K2WA 2JIZD 3KL2A 2O0HA 2X23A 4UBCA 3VAAA 2ZRNA 1E3QA 1PVPA 1IG6A 1L7RA 3CA8A 4BYGA 3GVHA 4AC9A 4WNAB 3JQ7B 4EBBA 4ID9A 2ODNA 4I2BA 2V1XA 2VBCA 2PNJA 2J3KA 4IIDA 3UBMA 2ZJBA 2FLVA 3KKKA 4C6HA 1GTRA 3NT4A 1WB5A 3L1JA 1AQIA 3V4LA 4C7ZA 3U6BA 4Q9KA 2A3VA 4JAVC 4EAQA 3ZUGA 2RMKA 3C3DA 3VR5D 4C4YA 1TZ2A 1LPOA 2O5RA 1E69A 2DTEA 2FEAA 4TMZA 1Y9EA 4GH5A 5JZMA 3K0KA 1EWTA 1P4JA 1SHJA 2E82A 2OBXA 2ZRKA 3DZ8A 1P45A 3EXFA 2ZRDA 4FYKA 1HYBA 1QWOA 1A8IA 1W7AA 2AFVA 3AF6A 4AYTA 4KO1S 3BD9A 4OKIA 2AD1A 1C7JA 3EPGA 2PSEA 1NK9A 1OFTA 4ZYLA 5ISMA 2H7YA 4N3AA 3C6MA 1YZNA 3MR3A 4I2GA 4KLEA 4MW1A 2WP8J 3DAFA 3EIXA 2M9NA 2G72A 5ELLA 1QSYA 5TARA 2IU4A 2B82A 3HPQA 3FG9A 1ESEA 2XMGA 3H1BA 3C6QA 1KWKA 4YI3A 4ZT4A 4YMTA 2X3UA 3HACA 4JVSB 2LIVA 2QTFA 2CLOB 3P71T 1T5OA 3O31A 5KFSA 4E5NA 1N9GB 5LMUB 3IALA 2KLHA 5EZSA 3F2DA 3ADPA 1YTLA 4C6SA 3DTTA 2FH5B 2OE2A 2R9VA 1N8KA 2HLNA 3N2GA 1T2CA 4OLFA 4WLEA 3CF2A 4E4YA 2QR3A 2QYHA 5CA7A 3USES 2WWFA 4X8LA 1QIFA 1L3VA 4HVCA 4F3CA 2OHVA 3EXEB 1LNZA 3GVIA 3V1YA 2ZKLA 2J9GA 4BFXA 4V39A 2HXYA 2PWPA 5HYVA 3A1SA 4YAGA 1CC1S 4FI3F 4DR6B 4OY3A 1MOSA 1X6IA 1TQHA 3GLFA 2UAGA 1ILWA 1OY1A 2DZDA 1JXMA 2ZDQA 3T9DA 1R3UA 1USUA 1JXAA 1V16B 3DFUA 2PY6A 2VXCA 4ADSG 4L9AA 1LWOA 4CWAA 3TKYA 1FCJA 5BWBA 1SUWA 3ZXSA 2OBYA 4OI2A 1OW5A 2H9YA 4LY9A 3X1XA 2ZJYA 4CTNA 5TF4A 1IEQA 4N0EA 1U8ZA 3WGYA 4LNUB 3B9RA 2IZZA 4DBLC 3V7UA 2QJOA 1L5VA 4FS8A 4TXMA 2F17A 5DRTA 4Q1CA 3AEQA 3W34A 2JBWA 3HPOA 1HE5A 2ERXA 1W4BA 2W6ID 3GLHA 2ZUSA 4FHCA 4O5OA 2LM4A 1BDMA 3UUGA 1KZ1A 1I30A 1PG5A 4B31A 5K6AA 3WYDA 1M2KA 2GSWA 1YVRA 3SOPA 1AK2A 2WHPA 3QXGA 3LRTA 5EHNA 3ZK7A 3DBVO 3OCXA 4TSRA 2W9CA 2HLPA 4K0RA 2JD1A 4BS9A 3D6TB 2MCFA 3WK9A 5HZMA 1XUOA 1CUIA 1MH1A 1M6NA 2OZLA 4TKLA 2VWHA 4EM6A 4H31A 3AL0B 4AJPA 4UM7A 1Z68A 4WY5A 5DKFA 8ICAA 2RDIA 3BIJA 1V37A 1OZ0A 4DLAA 1XX6A 2JEIA 1C3JA 5ULLA 4Y2SA 5AI9A 3UAZA 3O7WA 7ICFA 2FZWA 1MVLA 4PGGA 3TLEA 4M0DA 4H4DA 5H2FU 2ZW9A 2VXOA 1LSUA 2I7TA 3NPAA 3GPCA 3K0FB 4RANA 1JJBA 2JAOA 3E3AA 4UNIA 1FP4A 1MEOA 1I7NA 3HB5X 2VAPA 1H3EA 5G3ZA 4M7WA 1Z00A 4UEOA 4PAOA 5JXGA 3GUZA 2YOGA 3TX2A 4IXMA 3WKBA 3O1HB 3T9EA 3ZY4A 1SUDA 1N2SA 4YVZA 4WAUA 3BJZA 4WOPA 2G6BA 1PV4A 5DFAA 3FVWA 3I1JA 3VPHA 4L1KA 1KGDA 4CLDA 3UMBA 2YB1A 5HA5A 1QIMA 1ZQMA 5DG8A 2YKGA 2OUIA 3ODPA 2QRJA 4W8GA 1Z19A 1YT5A 2H1LA 5FNZA 1P1KA 2W6OA 3MRVA 1QV7A 2G0AA 1DDGA 2Z1NA 4LGYA 2E37A 1B41A 3DOJA 1E0DA 3A05A 3CIOA 4AJKA 2VXYA 1E9SA 5JWRA 2CVHA 1RPJA 5ILQA 3TXAA 3UGTA 3DGFC 3RSGA 1G6OA 3VVBA 1QX3A 2PMZF 1QDUA 2HBLA 2NZJA 1VE3A 2WJYA 4OJMX 4I29A 5AKXA 1TNDA 2QD4A 3QHQA 3ABSB 1SC6A 1LDYA 3FCSB 1PL6A 3SM3A 3DDWA 5EMLA 5DX8A 4ONEA 2NU8A 2GR9A 3CH5A 1N2XA 5HIKA 1PW7A 2WAQF 1WKBA 3L07A 2PMEA 1OV4A 3W2GA 5KAFU 1H85A 3UA3A 2V3CC 3ZQJA 3SQDA 5L95A 2PCJA 4ND8A 2ODQA 1JSZA 3WLMA 1S01A 3IUBA 1KI9A 4CUJA 1FY2A 5EE0A 3W3ZB 4KPUB 5HKKA 5JXHA 5K9ZA 1WNTA 1MZVA 4FBLA 2J45A 3ZCUA 4ES6A 1U5BB 4B32A 4S2UA 3DZJA 4L9WA 3Q0IA 1G19A 2ZJAA 1XRQA 2R68A 4RZRA 5FWXB 4KMRA 4WRRA 3R3XA 4PXSA 2UUCB 2AQ4A 1GQ2A 1GCIA 2O1XA 4AS2A 2ZPAA 3ZW7A 4NDNE 5H0IA 3WLLA 2RAPA 4GZ6A 4DM4A 1UMCB 2BMWA 1UPUA 3DAYA 1N8TA 3LF2A 3OE1A 4WWHA 3VKGA 8ICGA 3Q8PB 3DQQA 3G2OA 3BD8A 1IXSB 4ZWNA 1YJQA 4GPTA 4UHHA 4BVGA 3KKLA 2MAXA 2H92A 3OOHA 1P5FA 3TZHA 1MHTA 2GAJA 3I0ZA 1GITA 1N5WA 2HHQA 3H4MA 3L4BC 3RE1A 3EASA 1ODTC 2PUAA 1YI0A 3BRWA 1XF9A 2PKCA 4BV2A 5DBFA 5CH5A 4JT8A 1M6VB 3VJRA 1G291 3RRBA 2Q5EA 1TPYA 4HDRB 1RAAA 5K3EA 4L85A 3I09A 3OY7A 3ZHVA 1RWKA 1CFJA 4W5QA 4PQGA 5A9SA 4QZ8A 3V80A 4HXFB 2HK9A 4H1VA 1V85A 4MIKA 1KSJA 2JHFA 1PNRA 2LDBA 3SJUA 2JH8A 4P7FA 2I34A 5G5GA 4LECA 2C77A 4BNVA 5F9HA 2RLTA 4OOFA 1QCCA 4L7QA 4PRZA 4CMGA 1XALA 3JZMA 2XB8A 4PZLA 2V0GA 1PGJA 1ZL2A 3NRBA 3CNNA 2RC5A 4WIAA 3VR4H 3JSXA 3DV0A 5A5EA 1V8OA 3ZWMA 1MIHA 1UBNA 3VR6H 3BH6A 4N4AA 2J3EA 1P7PA 3HCRA 3OM8A 2XNCA 1QTRA 2XVAA 3LVQE 9ABPA 2V8OA 4MQUA 1KBQA 4MWSA 2VATA 4P0QB 1DJOA 4ZVOA 4Z9BA 4JLUA 4ETMA 4JUZA 2EEPA 2JJQA 3L7AA 3AQEA 1QVRA 2E8NA 4FWTA 1PR2A 4B46A 3L84A 4PYIA 3B7PA 4EP1A 2R1TA 4G37A 1IZ9A 2I3ZA 2XUDA 4C30A 2UVUA 4W8OA 1PKEA 3MSXA 3QKRB 4BQIA 3H9UA 1YZ3A 1KZYC 5ALTA 1EESA 1F7VA 2QF7A 1OWLA 1QH1A 2AJTA 4NJEA 2PTGA 3GDGA 3VZSA 2C8KA 2ZPUA 5HCIA 4FHZA 1G21E 2Q4BA 2OXCA 2XZOA 3TW6A 2ZIWB 3RYHB 3PTAA 1DCMA 2HXSA 1AZWA 4UU7A 4YFVA 3RIHA 4ZJYA 2XT6A 3ZQKA 4B4VA 3JQGA 4O2BA 1M1ZA 3MUFA 4PZDA 3LL4A 4OHBA 2FWJA 5KYGA 4OLJA 4DCGA 1Y33E 1W581 3I9V6 4EFKA 1K7XB 1JZSA 4P84A 1L5ZA 1Q1NA 5FOTA 1EWRA 3LGSA 4JBNA 4BUCA 2A1IA 2G67A 2EWVA 2RGYA 3DZIA 1Y7TA 2ZIEA 5ICSA 3VOSA 2HHTA 3WQSB 3RI3A 2RB4A 2PIAA 4P82A 3ZH2A 3PRHA 2CZQA 4CQLB 3SZRA 2O0KA 3W9SA 3HEBA 3SI7A 2QG4A 3ZXUB 2W0MA 1TKDA 1ZETA 2GUWA 3RU2A 1XZKA 5EHXA 1I14A 3T52A 3RR8A 5CDFA 4RH1A 2YVAA 3IVAA 3Q72A 5AQ1A 3TOXA 4HNTA 4AO7A 3HC7A 1VI5A 3D4NA 1KARA 3QEKA 3ONDA 1WSAA 1BWPA 2B8TA 3F74A 1U28C 4Z86A 3V1NA 1IRXA 2VPYA 3H2ZA 3K0SA 1PJZA 2HMVA 1A0OA 1IM2A 3DLIA 3LK7A 2I99A 3D6HA 2EU8A 3UUFA 4Q9IA 3I58A 4DM3A 5ILOA 1ATIA 1O94D 4MW0A 2ZUCA 2NNWB 4GM0A 3I23A 3ZY2A 3QJYA 2DM6A 1RWPA 3V2UA 1TM7E 3E18A 1E3EA 4EPRA 1Z37A 4FZRA 1G7TA 1MKYA 3NYIA 5F3RA 1GWNA 3EQZA 4NIMA 5FFFA 4HDMA 3TSWA 1JMKC 2X6TA 3W3AH 5K03A 4JYPA 2RJNA 1GDHA 2IV7A 5FA6A 2AKAB 1H93A 1U7HA 3GGGA 3CRW1 5K2MA 1OYOA 1X2IA 4IJKA 4LJ5A 1PJTA 3DLBA 5FUBA 4JI5B 3UOWA 3CZMA 2EL7A 1QO0A 4HXEB 4QZBA 2JLRA 2CV1A 1QSLA 4KQJA 4Q7JB 3O75A 1OXBB 3HA3A 4KWCA 4RQ8A 2NZYA 4DJJA 5HQJA 4LPSA 1EUDA 2VBGA 4GMDA 4E5SA 1BS9A 3ZGNA 1Y5NA 5LUBA 2ZSHA 3ZVNA 4CKEA 1QRSA 1PR5A 2FW7A 1AIPA 2W3SA 3MGBA 4BFYA 1NVAA 5B4VA 4N5NA 1U49A 2AK2A 5DG7A 5L4NA 3CE9A 1X8JA 4KX5A 5A9TA 4J0GA 2GGSA 2V3WA 4LK2A 4QLOA 3A6GA 2VEDA 1DIHA 2AB0A 5COBA 5B37A 4KLLA 4DZTA 2ETXA 1B4DA 1XAJA 5I4BA 1EFDN 1J8MF 2OQRA 3MA0A 4YBZA 4IVPA 5E79U 2XRMA 2XUHA 2JFUA 1FU8A 2FPRA 4YJ2A 2CYBA 4G5XA 3E3OA 3KFLA 1GYQA 5A1JA 1VMDA 4MDHA 2HSGA 4OHWA 1K98A 1V97A 1FLVA 3EZLA 1XD8A 2AXNA 4OUDB 4YT2A 5KINB 3AHCA 5LCXA 1O9HA 3C4JA 3K9FC 4NU5A 4O4IA 3JD3A 1WBBA 3DF9A 4C0SA 1XQWA 3T79A 2E9SA 2EAPA 4F5ZA 4X54A 1BDHA 1JKJB 3TPCA 1GLGA 2GLXA 4KLNA 3UJDA 1OX4A 1U80A 4RAQA 2LKCA 3T5PA 3M81A 2WSSD 1XXHE 1Q7RA 2F67A 3G23A 4W5OA 4KHPB 2YC2C 1J0BA 1QPZA 2ZSKA 3GCWA 8ICLA 4TMYA 3FF4A 4GPBA 3CTMA 3S2YA 2W8LA 3OMLA 4JK3A 2JR5A 1P31A 3IBFA 3TIXB 5AKYA 4AURA 3BK1A 4RD3A 1X94A 4DIMA 4UPDA 2QUAA 4G0MA 4A0QA 2HWWA 3ZCQA 3I42A 1GKUB 4DQ0A 3G8CA 3FOBA 2OUKA 5HW0A 4FBUA 1A5AB 3E82A 1TZJA 2O2HA 1PX2A 3C6KA 3SZOA 4X61A 3FKSD 2BBOA 2H5LA 1UJCA 5LVAA 4JOQA 1E9FA 1NOKA 2XNJA 5LPNA 5A4MS 1DJQA 5K0LA 5JAUA 3LUPA 2HJHA 4DXDA 2P66A 1VZ2A 4OX9Y 1XDBA 1U0TA 1XTUA 3A2LA 2GRJA 3VZBA 1NW4A 1TK3A 4RD0A 4ZK6A 4IWYA 2VJ4A 2YZMA 2OLKA 3K7EA 4X3CA 2I2AA 3Q3VA 2GM3A 4JA0A 2ET6A 3JQBC 5LJLA 1L8XA 1TEVA 4JP3A 3KVRA 3LIPA 2GM9A 4L16A 3UKOA 1K6IA 1FQJA 5I9BA 3ABZA 3BHJA 4LWQA 4LDQA 2QTVB 2B1GA 4XTCS 1UMBA 3OPYA 5EIAA 3N76A 1ZCBA 2FZGA 1G38A 2GEKA 2ZUBA 1P9OA 2AMFA 2G1AA 8ICTA 2D2FA 1NW9B 3GJ7A 4AO8A 1YA4A 3KSRA 3NVDA 5ED0A 5F3DA 1VTKA 1U1CA 3VHQA 1BDBA 3CWQA 4L78A 3HJUA 5REQB 3IM1A 4AS3A 5IAGA 3ROTA 3CCFA 3M9WA 4NENB 4I99A 621PA 3EXIA 3KKOA 2C2EA 3W78A 3U7JA 4CLHA 4KOEC 5EWLA 3CX4A 4PHPA 4QQRA 3BS5A 1GU1A 1JHYA 3TM5A 1SB3C 2XOEA 1LJUA 5AESA 2O2JA 1AROP 4Y6QA 4A0SA 3SLRA 2QPAA 5JH7F 2FJUA 4IHKA 3WBBA 1ZD2P 3WNBA 5IKPA 3D0KA 2CUZA 1XWWA 3CLTC 3W1WA 4ZTUB 1HDZA 1A7JA 2C9DA 4ER5A 4USAA 3FZYA 1WMEA 4Y2YA 4PXAA 3TRFA 1NF8A 1TAQA 2W2NA 4IUDS 3PC2A 1KY3A 4L8WB 4H6XA 4BBAA 1GAXA 1JAZA 4ZARA 4NU8X 4M0PA 4S1PA 1C14A 1PT5A 5EVCA 4U2DA 4FKBA 2VN8A 3K31A 5DM60 2XUIA 1IYZA 2DBQA 3WGIA 3PC3A 1T9DA 4YJ3F 4WDQA 2Q8NA 1VPTA 1AHHA 2LKDA 1YR1A 2PDAA 3DVSX 4KPGA 3CT6A 1S2GA 1UF9A 4BMZA 4DSEA 1A4RA 2H3VA 3L0BA 4DDKA 3CRMA 3IKTA 1ZCJA 4UE2A 1QQAA 2YXEA 5BQXA 4UEKA 2DLCX 1CIJA 4G25A 3KVNA 1BOOA 2VJLA 2FFAA 3VZPA 5KDLA 4C0KA 3KCNA 4QM7A 2JLAA 3LDAA 1DBWA 2DPHA 1LSJA 4UQOA 1XNRB 1WB4A 4CL2A 4BL5A 1UOEA 5IJ0B 1F3LA 5KSYA 3I39X 2IWHA 4EHBA 3F6EX 1G3UA 5CJPA 2WR8A 3O38A 1U0GA 3EGOA 1U0JA 3BZKA 2H18A 3VISA 2YQ5A 2ASLA 1BEUB 4DV6B 3UHJA 3EIHA 4NXZA 2JMGA 2XIQA 4GD3Q 3LY9A 3AKCA 2X8JB 3DE3X 2AFHA 4DLPA 4MR8A 1W76A 5KTNA 3PWTA 2ALJA 1O95D 4FGZA 1TAHA 4WLVA 3TTTA 2VTVA 1LZLA 1ZUWA 3AEXA 3RG2A 5FCDA 4BGDA 3C5FA 1B8OA 2C8VA 3HRIA 3MTAA 3ZIAD 5AHRA 1WHTB 3U3JA 2YS6A 4UMDA 4EG8A 3UB4A 4JI2B 4E7PA 4IDBA 4X1YA 1WQ1R 1SKQA 2SHKA 5AVRA 1JKMA 2DPYA 4WCFA 3V9AA 1SBCA 3FBTA 4D9HA 1UJ4A 2WF6A 3Q1KA 2M6RA 5JDIA 4ISCA 5EMNA 4C0LA 1PEAA 3DP9A 4LNHA 1W5EA 3BGSA 3Q8WA 1QAQA 2JIPA 1SL1A 1KHHA 4RS3A 5ECYA 1V1MB 2XJ9A 1UFRA 4QC2A 1UMKA 3K9WA 1JEAA 3WYBA 3E7FA 4JYCA 1FRQA 4I55F 3QELA 1GPYA 5AQEA 2BTOA 4EVQA 3RVNA 1VKNA 1RRMA 5L1LA 4KO8A 4RHFA 1NX6A 5ABPA 4YMUA 4PV7A 3HGMA 3LLUA 4AG6A 8ICIA 4BP3A 5EJ9A 1T2VA 3UXNA 3BGWA 5F9LA 2IYZA 2J0SA 4J6EA 3T41A 1FFVA 4BNMA 2AWNA 4RYLA 5DB4A 5BW6B 2XTAA 4GKVA 2LIPA 4O5EA 2VTEA 4HCJA 2UVQA 2NUTB 3FMOB 2BPGA 5HVNA 3RUDA 4XWOA 5IT4A 5A62A 1RKBA 2W9MA 4IH4A 4MQMA 2ZXEA 2HOQA 2Y1XA 4QXRA 3C3PA 1RRGA 1H2XA 4HLDA 3C8DA 2ZUUA 4MCAA 3B6KA 4TL6A 4V2IA 4A8JC 2GA8A 2XA2A 2QMHA 4CM4B 1CSEE 1ZQRA 4OJ5A 1H6CA 4ZCLA 3HB9A 4Y8VA 1JEJA 3L04A 3N8IA 4MS1B 3AF5A 1SB8A 1PJLA 3C39A 1JR6A 1MU0A 4FHFA 4KLFA 5EZYF 3H3JA 1W6RA 2WG2A 4CU2A 2C4KA 2XNKA 4UU1A 3DWIA 5G0VA 3ZE8A 5G02A 4DZZA 3O8QB 1MJGM 2PT5A 2FWMX 1N56A 4IQGA 1AKWA 2AXEA 5LQKA 4EBDA 1IHOA 4JXXA 5IIJA 1KH1A 2IVFA 3W5HA 1TZBA 1IOWA 4EW1A 2G4LA 2PMWB 1RI5A 4QWBA 3LYUA 4HRAA 4DCTA 1MRNA 1KR5A 1DC3A 4M9SA 4OD0A 2R8BA 4RTOA 2PFPA 3G0HA 2EFEB 4IBOA 4DLRA 4H77A 5GZ3A 3Q6IA 2BE9A 1MENA 5HUQA 1KJIA 1D09A 3DSRA 2YIMA 2QXTA 4GVLA 3B6ZA 4I2AA 2GMWA 1OCEA 1XEWX 1USGA 3GQCA 2WJPA 3IKLA 1JDSA 2DWOA 1XWIA 5CYFA 1EYZA 5TS2A 2N1BA 5EJ8A 4Z6CA 3PP8A 1ZH8A 4TUYF 3QVGA 4E12A 1NNSA 3HS3A 5TGZA 4K4GA 3PQCA 4IOKA 1VG0B 1N1DA 1UC4B 2I78A 3L6EA 3CPEA 1U8TA 3FCXA 4ZN6A 3PX0A 2ZXHA 4YP0A 4NL9C 3ZU5A 1H9BA 5TPZD 4B4WA 2B9EA 4AJJA 1FFXB 2EYQA 2J46A 4JBWA 3DE6X 4AJLA 2GXAA 3NH6A 5DLQC 1V5WA 4GIBA 3WQQA 1T1JA 4E2FA 4HSEA 5KX5A 4AZ3B 4IL6U 3UFXA 3OJUA 2VHXA 2BPOA 1Z0UA 2WMOB 3IXLA 1WP9A 1E9CA 1EFVA 3K8OE 4RFLA 4LHWA 3UNXA 3GRRA 2R84A 3ST7A 2WMYA 2XTMA 4QJIA 4DBVO 5DHAA 4UBIA 2XZPA 4MPDA 3KBBA 1HL7A 1Z2NX 4D26A 2GS9A 1WU7A 3E53A 4RIIA 3F3YA 1ABBA 1ZJZA 3M2PA 3TE6A 1VYHA 2X8AA 4OM7A 5G4LA 1EE1A 4N5LA 5CCEA 1IY8A 4Q1VA 3LHKA 3QRWA 1L3TA 4IJQA 3L7DA 3PFKA 3UAGA 3G5TA 4OF4A 4E6PA 3NM5A 2MYNA 1FTSA 3S28A 2ZZMA 4J29A 1W5FA 4R05A 3IB3A 3ZCSA 3ONEA 4AJ9A 1E3SA 4DJEC 2I9GA 4HH1A 4DO9A 4K1LA 3IEXA 5BV7A 3F8WA 1KDVA 5HJEA 3HG7A 2HCTA 2OYCA 1XMPA 4E46A 1Z0IA 3BMCA 1H1TA 1GUFA 4ZRMA 2FY8A 5EKUA 3C97A 3T7IA 4GO1A 5JSZA 5TZVA 1JNXX 4AKHA 1UM9A 3IDFA 1NXVA 2CK3A 1BSVA 3GPBA 2RJOA 4DUZB 3PXAA 4FONA 4BWFB 3SFVA 3E23A 3WRWA 1NKVA 5K0NA 4AP6A 1Z15A 4MYTA 4P7BA 2WD8A 3NTVA 3FAKA 2H1WA 2J9FB 5BQPA 5INTA 3OAAD 2RIPA 2I3GA 2QRVA 2I9PA 3BXOA 4ZREA 3AESB 3PRJA 5JJ5A 1EDEA 1BZYA 4FQ7A 2LYHA 2CBXA 3OD5A 4I2IA 1GG8A 1OF1A 4ZVKA 4WCVA 1S5PA 3AEZA 3IJRA 4U5QA 1ZQ1A 3GVPA 4WACA 1FDIA 4JASB 3C28A 4UBLA