2HI0A

Crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
240
structure length
240
Chain Sequence
GMKYKAAIFDMDGTILDTSADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGVVVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFKPYYADHCQIKTGPFPGILDLMKNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFDFALGEKSGIRRKPAPDMTSECVKVLGVPRDKCVYIGDSEIDIQTARNSEMDEIAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phosphoglycolate phosphatase
publication title Crystal structure of putative phosphoglycolate phosphatase (YP_619066.1) from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 at 1.51 A resolution
rcsb
source organism Lactobacillus delbrueckii
molecule tags Hydrolase
total genus 89
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hi0A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hi0A01
5ALRA 2NYVA 3BA6A 2PR7A 3P96A 1IWOA 4FE3A 4Y2TA 3WK9A 2IOFK 2B30A 2YJ5A 4E88A 1KYTA 4KX3A 3QUCA 5AVSA 4QJBA 1Q92A 1YV9A 1L8OA 2R8ZA 3NRJA 4UU0A 1L7PA 3OCUA 5ALSA 4BEVA 1EK2A 4UMEA 3QLEA 2YMQA 4CF5A 2C9MA 3OCWA 2BDUA 5AW1A 3NASA 1T5TA 1ZD4A 3PDWA 1ZRNA 5AKZA 2G06A 5AK6A 5AKIA 2YY6A 3L8HA 3QU7A 4IFTA 1WPGA 4BNDB 5AKHA 5ALKA 3WKDA 1XP5A 3ZX4A 3QU5A 1Z4MA 2QYHA 4HYTA 3AR2A 2HDOA 2WM8A 5A3SA 4UASA 1VJRA 3R09A 4YH1A 4MWOA 4UMVA 2R8YA 5AI9A 4RESA 1QQ6A 5AI4A 3QYPA 5ALQA 2D2VA 5ALZA 3ZTWA 4OHFA 1XVIA 5AHXA 4YGYA 1WVIA 5ALIA 4Y3UA 3OCVA 1VFPA 1LVHA 4B6JA 5ALMA 5JJBA 1RPZA 1L7MA 5AKEA 1YS9A 4NABA 2ZBDA 4KX5A 1Z4JA 3EF0A 4FYPA 1WR8A 3TLMA 5AKJA 3AR7A 2PQ0A 5AW9A 2MSNA 3ET4A 4J03A 2HSZA 4C4RA 4I9GA 3W5CA 3ZVNA 4HGPA 2G1AA 1EK1A 2FUCA 4EELA 2FPWA 3NUQA 1TE2A 3NIWA 1Z4OA 4BEWA 2B1RA 1ZJJA 3SMVA 1ZS9A 5ALPA 1RQLA 4Y2UA 1QYIA 1T9ZA 3M9LA 3QUQA 2R8EA 1AQ6A 3U13A 4C4TA 4C4SA 2GO7A 4Y2RA 2QLTA 2BY4A 2AMYA 2WF5A 2C8KA 4DCCA 5ALYA 4DFDA 5FP0A 1RMYA 5AK3A 2B8JA 3VAYA 4ZEVA 3MC1A 4OD0A 1T5SA 2ZBEA 4YIHA 4UAUA 1LTQA 2EATA 2R8XA 3N28A 4BYGA 5A3QA 1TA0A 4HAIA 3UM9A 1Z88A 2YJ4A 4JDPA 3UMBA 2GFHA 3L1VA 3L7YA 1U2TA 2JAOA 1RDFA 3E81A 5ALTA 3U26A 1N9KA 3A1EA 3B8EA 3DDHA 2YMMA 3WKEA 4OCZA 1YDFA 3A1DA 2P69A 4NAVA 4UU1A 4BBJA 3IJ5A 3I1YA 3MN1A 4BX0A 3KZXA 2Q4TA 1RKUA 3RF6A 2W4MA 4YCLA 4HGOA 1Z5UA 3ZI4A 5AW7A 3OTQA 3NAMA 3MMZA 3L5KA 2WF7A 5IT4A 5ALWA 1U7PA 4UAVA 2ZXEA 1Z5GA 3SHQA 3WK5A 3KDPA 3WK7A 3R4CA 5AK5A 4ZEXA 5AW0A 2WF9A 4YCMA 1Z4NA 3PCTA 4UARA 2PKEA 3W5AA 2FDRA 3ZVLA 1JUDA 2HF7A 2EARA 3AR8A 1F5SA 3S6JA 1L8LA 3U7GA 3SD7A 5AW8A 1L7NA 1CQZA 5AW5A 3KBBA 3GYGA 4BX3A 3F9RA 5AI6A 1RKVA 1FEZA 2HEGA 2Q5EA 1QQ7A 1ZD2P 1RMQA 1X42A 3QU4A 2DQSA 2IYEA 5ALXA 2ODAA 5AM5A 3WKCA 2RARA 4YCNA 2HX1A 3ESQA 3EWIA 1U7OA 3BWVA 2HO4A 2X4DA 5AM2A 5AM0A 3QU9A 2FPRA 3QX7A 3U19A 5AW6A 5ALHA 5AESA 4IG4A 3ESRA 2O2XA 3QNMA 5ALFA 3ZW7A 3D6JA 1Y8AA 1SWWA 1RLTA 2GHQA 2C8LA 1YNSA 4Y2JA 3OCZA 2G09A 4KNVA 3UMGA 2GMWA 3QU2A 4KN8A 3OCXA 5ALJA 2Q4RA 4NV0A 3AR4A 4L6AA 1Z4PX 5ALUA 3ZX5A 4H1WA 4G9BA 4KNWA 3ZTYA 2WF6A 3B9RA 1QH9A 4F72A 3WK4A 3IB6A 5AKYA 2YFYA 2ZBGA 5AVTA 4HGQA 3HLTA 2CN1A 2I33A 4UM7A 4Y2VA 3L0CA 3WGUA 3RFUA 3ZWDA 5T41A 4UM5A 4XE5A 2C88A 3OPXA 2B0CA 2VKQA 2FI1A 1U02A 2RB5A 4NWIA 4GIBA 1J97A 3AR5A 1RC8A 4I9FA 4Y2PA 5AIAA 3W5DA 5AVYA 1TJ4A 2P9JA 3L8GA 4Y2XA 2YMLA 4UW9A 4EX7A 1CR6A 1ZRMA 2G80A 3FZQA 2JARA 3FGOA 4Y2QA 3DV9A 5ALOA 2BDEA 2WFAA 4AP9A 3CZ4A 1VJ5A 5AI5A 3ZU6A 3FPBA 4EENA 1O08A 5ALNA 3N1UA 3FVVA 1NF2A 1RLMA 4BX2A 3U7EB 5IT0A 4F71A 5ALVA 4JB3A 3IRUA 4HGNA 2OYCA 2OBBA 3L0BA 2B1QA 2O9JA 5A3RA 4RETA 1NNLA 3WKAA 2RAVA 2HI0A 1S2OA 5AVZA 2G0AA 4XPZA 1ZOLA 4GXTA 5AVXA 4AS2A 4FFDA 5IS2A 3KOOA 2YBDA 1RMTA 2ZG6A 4J2TA 1TJ5A 2IOFA 3SLRA 1S8OA 4QQFA 4AS3A 4DWOA 3FPSA 3ZUPA 3QUBA 1XPJA 4UATA 2G07A 2JAWA 3N5KA 3UMCA 4OFZA 2G08A 4PNHA 1YMQA 2GHTA 2I54A 2I34A 4Y2YA 5AM3A 1SWVA 5AK4A 1WZCA 3HYCA 5AVUA 4CF4A 5AIBA 1O03A 3L0YA 3I76A 5AVRA 4KYTA 2P27A 2MU1A 3AR9A 4NFLA 3KD3A 5AICA 4L57A 1SU4A 3L8EA 5AKXA 4Y2SA 5AM1A 2YJ6A 4EZEA 4ZEWA 3EPRA 4CE6A 3M1YA 3J7TA 4MUMA 5ALDA 2OA0A 4O8CA 5AM4A 5E0OA 1QQ5A 4YIKA 2FPXA 2FPSA 2ZBFA 2EAUA 1N8NA 2I55A 5ALLA 3B9BA 3WKBA 3WK6A 3WGVA 2I6XA 2MU2A 1RRCA 3SKXA 1Z4LA 2OM6A 4G63A 5AKLA 2HOQA 3L8FA 4L6CA 4DW8A 2IA5A 3SKYA 2AUTA 5AVWA 2B82A 3PGLA 3U7HB 5AKGA 3I6BA 2B8EA 2C4NA 5AI8A 1ZD5A 3AR3A 3I28A 3WK8A 3A1CA 4BNDA 5ALGA 1ZD3A 5AVVA 3OCYA 3QXGA 1YJ5A 3U7FB 2JGAA 3W5BA 3SF0A 5ALEA 4EEKA 2FUEA 2IOHA 3QGMA 5AW2A 5AKKA 3MPOA 2CFSA 4EX6A 3R9KA 1U2SA 2NO4A 2WF8A 1RLOA 2I7DA 3N8GA 1L7OA 3NALA 2FPUA 3E84A 2YN4A 2AGVA 2W43A 3ED5A 2JAUA 3ZVMA 2CFRA 1TJ3A 3E58A 1Z4IA 1J8DA 2CFTA 1Z4QA 1PW5A 1MH9A 3ZWKA 3ONNA 2FEAA 3E8MA 3CNHA 3QUTA 3PGVA 3FM9A 1RKQA 1NRWA 3KC2A 2HCFA 3NANA 5AW3A 2WHEA 3L1UA 4CNQA 3EF1A 1K1EA 3A3YA 5AW4A 2HHLA 4XOUA 3K1ZA 4HGRA 1L6RA 5AVQA 2YJ3A 3AR6A 3DNPA 4BKMA 2RBKA 2YMPA 1Q91A 5AI0A 3DAOA 2P11A 4CF3A 2W11A 2HF2A 3ET5A 2ZOSA 1RQNA 3N07A 4XQ0A 2NO5A 1Z4KA 4UMDA 2AH5A 4UMFA
chains in the Genus database with same CATH superfamily
4MRMB 3IDQA 4EYGA 1P7YA 2VTDA 1UKVY 2BMDA 1KI6A 4F56A 2BHSA 4R8RA 2C2GA 3QLEA 3B5EA 1ZEJA 2ZIUA 2C9MA 2IUUA 1DAPA 4XVHA 4QXOA 3PDWA 3C1YA 2JEGA 4UE2A 4DV3B 1YS7A 4L02A 4FBTA 4QDKA 5F4ZA 1E1QD 3LYSA 1P4GA 3WMRA 5AJXA 4F86A 2G8LA 4GHWA 5L7WA 4R31A 5CPFA 1PJSA 3SYTA 4JT9A 1BHO1 1E6CA 3ZW8A 4AVYA 2BZGA 3JVDA 3THXA 1ITZA 2GLXA 3HDQA 2B34A 4NFSA 1RYUA 2C92A 1NXOA 3LV8A 2HBKA 4O3FA 1ULAA 2NU6B 3BERA 2M0NA 5JXWA 1ORHA 2WE7A 9ICBA 4C4OA 1VIMA 3PFFA 3N2GB 1JIIA 3IPAA 1X1TA 2R3SA 4EFMA 2I91A 1ZK0A 4F4DA 2JATA 2VZEA 5CFRA 2GO7A 2ZJYA 2VJQA 1FUUA 1ZNQO 2YHIA 3EZ9A 1T6BY 3U5TA 1TVKB 4NOKA 3IBFA 3TB4A 3W4JA 4JJ4A 1RHQA 3BXPA 4ZWNA 4F38A 3U6BA 2ZBVA 4RORA 4KXVA 1TAMA 4N7RA 4QBKA 1KZ9A 2WR8A 3E81A 3BPSA 2C61A 1N7GA 4EBCA 3TI7A 3ASUA 3E82A 4O5KA 4RK5A 1BEEA 2VP4A 2FLPA 5AVOA 1TYEB 2TMYA 1B73A 3FNRA 4LV6A 3FPLA 4C01A 3AU8A 1QZ3A 2LDBA 3VFDA 4Z9XA 3FNEA 1TIBA 1PR0A 1NQOA 5AW8A 2GR9A 3HSYA 4F4CA 4ZYVA 5KTKA 5J0SA 4Q3EA 4TKUA 1OU0A 3OT5A 2IDKA 1W34A 2WI8A 1YRBA 4LF4B 3GHHA 3C98A 1AQYA 1QIEA 3F67A 3H9CA 2G9QA 1NJ8A 2Y0CA 3P9PA 3L0DA 4O4JF 1ZQNA 3HILA 4KYVA 4NNPA 2PD6A 2V96A 3DS8A 4HAYA 4JXJA 1QORA 2WF6A 4NJEB 421PA 1OV6A 4Z8XA 2ZUDA 1TCCA 1ZVJA 1A9SA 4F3NA 2E5SA 3FTDA 4TT3A 4GIBA 1ORWA 4JENA 1Z75A 1JHUA 1T8SA 4MUHA 1YHYA 5EJ9A 4DIKA 3MILA 2H08A 3LVQE 3O2SB 3L8GA 2PT9A 5IBPA 1AC5A 2IHUA 4U6PA 1FS5A 2REBA 5FNZA 5TR9A 2GJ9A 1G5QA 3GO4A 5CK5A 5CJ2A 1X7WA 2OXTA 1NMYA 1LBQA 1EFVA 2HGSA 2DRIA 5JVDA 2DERA 2X86A 2D13A 4EI2A 3NCTA 2NLOA 3TSYA 3UJCA 4KQMA 4BOYA 2RH5A 2CNNA 1QK5A 2CHGA 5BUQA 1BPDA 4UE6A 5IS2A 1QPZA 2AN9A 2JK0A 3O93A 3KQNA 3RVQA 3BF7A 3IO3A 4RA9A 1A5ZA 3IX7A 3V4PB 2GCNA 4PG8A 3LP5A 5JY1A 4OSOA 5I7AA 4TS4A 1ZGHA 4R51A 4M9LA 3UK1A 2RHOA 3FIUA 1QP0A 2HREA 2O57A 4N18A 1LRJA 4TMYA 5IX8A 2FPMA 1PNOA 3SEQA 1C9KA 3W5UA 2VSXA 1JRPA 3VAAA 3MAJA 4YMVA 3EHEA 3T54A 2Y66A 2H1LA 4RMIA 5GZ6A 3HH8A 4DCOA 5B1HA 3Q3VA 4PZZA 2Q28A 1OGIA 4D74A 1U3TA 3QW4B 3SNHA 2O7QA 1AA9A 1E63A 3X1WA 4JI1B 1UANA 3RO7A 4DSEA 2WM2A 4J76A 4PGYA 2ZBRA 1WUHS 4DDVA 5CXQA 3SXPA 1V39A 2A1IA 1E1QA 2JGFA 1NQ5A 3GX1A 4IUCS 2E5FA 3GZTB 5KG4A 5JSZB 3FOAA 2OV6A 3KEFA 4Q7QA 2BHTA 3TEMA 3T0GA 4Q34A 1IWOA 1P4JA 2IIVA 1XRLA 2X40A 3LQ4A 4GF5A 2FZEA 1Q92A 1EQ2A 1WE2A 3IJRA 3HKDB 4TYPA 2JZCA 4DTIA 1GG8A 3WJAA 3G82C 3F7OA 5CCXA 4DRZA 4PG5A 2COKA 4GYYA 3K15A 1SVOA 5KQMA 13PKA 1QOQB 4QOEA 1W2GA 2OBFA 1JALA 2K4HA 4R1SA 3ZX4A 4LHZA 5LMNB 1IOVA 5T4BA 3MSCA 1I6KA 4DC9A 2XZOA 2E7ZA 4JWKA 3FI0A 4KLNA 2QMEA 4RKYA 4Y9TA 1CRLA 1WF3A 4ED6A 5HFAA 4O3OA 4EDFA 5KVQA 1S1CA 3EIFA 4YO8A 1ODFA 5IHPA 2I65A 1UKAA 3UK2A 4BB6A 2IS1A 1AF7A 3BD6A 3Q1KA 4CYMA 1WCXA 2HKIA 4IGEA 4ALLA 3IELA 4X65B 1YASA 3BXFA 4B9SA 2I71A 4HMOA 3RT7A 5IVDA 3BAFA 3ZE9A 5LCXA 4RVSA 4Q3DA 1QDUA 3CUVA 1H9CA 2P9FA 3DEEA 3JYHA 2WNSA 1MOZA 5IH3A 2AIRA 4AN0A 4EYOA 1R3UA 1GM5A 1VKNA 5LZ5A 1N1EA 1JE1A 1ZK3A 2VIXA 4GR5A 4NF2A 2ORIA 4BWFB 3WRYC 3LHSA 5ELLA 2IHMA 3IDAA 1Z5UA 3PX6A 3LOUA 1GFWA 1NJWA 2ZIAA 3V1UA 4AIRA 4YCCA 2CXPA 1Q0PA 4WVLA 2JHFA 1ZJYA 3B85A 5E4YA 2BCVA 5J0UA 3PSFA 3O8QB 3ZVLA 4QYSA 1WU8A 2D0OB 2WT4A 4NU8X 3CUKA 2IW3A 1RMQA 3A6EA 4FYKA 1D2MA 4YRNA 3ORQA 3SBEA 5TARA 2GBIA 1LA2A 4IDBA 5LDDC 5AM0A 2E4XA 4Q9JA 3E22A 5IK2D 2OCIA 1V85A 2G72A 4WFIA 3ESRA 1RWPA 2A5GA 5EQFA 3WLPA 4A1OA 4N3AA 4PFJA 3VV3A 2WYUA 3TG2A 1N77A 2P4SA 4KJXA 3T3HA 2IYSA 3K9FC 1DPFA 4C0SA 3ENNA 5ULLA 4PEVA 1YMVA 3C74A 2CNWD 1JQLB 1SK8A 1SOUA 1QDLB 5CXXA 4NWIA 2V6BA 1PJQA 4OJ6A 4RQ3A 5LQAA 1YB4A 1NXQA 4X92A 3BS5B 2AOUA 1NZJA 1MA7A 2C03A 4I2IA 5D4BA 3M82A 4YP9A 1WU7A 3VUFA 1VMDA 1DAHA 3GRFA 4BNUA 1ZH0A 2R00C 2GASA 1S10A 1SHKA 1IJFA 1NU6A 4PLWA 4RF3A 2FZKA 4WOCA 5FOXA 1ZP6A 4F1KA 3M3PA 1CYEA 3GFVA 1KQGA 4L1KA 1XTIA 3OHPA 3LQYA 1SWVA 1P4SA 4GP6A 4Y8VA 1Z7GA 3AB7A 2H7VA 2QTRA 2UZ4A 2P5TB 3TZLA 1PT6A 2OXOA 1I3MA 4YQYA 1ZM7A 3ROEA 4C4XA 3PGXA 2XXAB 4ATNA 4EYIB 4TL7A 2Q3CA 5H68A 1TUEA 1N5RA 4I1PA 3MJCA 1JX6A 1ZZGA 2QW8A 5CHEA 2NADA 4CM4A 3AR3A 3A06A 2GF0A 1G5HA 2C9DA 1WP4A 1Z0SA 3RBZA 2EKPA 3NALA 2NRTA 3NOOA 3P2YA 3IAFA 3VXKA 1JWLA 1KOFA 3TVDA 2H2WA 4R1QA 5FR2A 1A8QA 4J0IA 4UBKA 2IEBA 3JQFA 3WYFA 4ZQCB 1UK9A 2IS4A 1I1NA 2B9EA 3OF3A 2CLFB 4RPKA 4TSFD 3CVXA 3AF6A 3GGPA 3GK3A 3NTUA 1F8YA 4YNBA 4MVCA 1R6VA 3OBBA 3F6CA 2WLSA 5L6LB 1WMAA 1CY7A 1M34E 4RD6A 2RK3A 4P98A 3OKPA 1FXUA 1XRJA 4XFKA 2HO5A 2P9BA 4OKSA 1B6SA 3RTCA 4JKYA 3W34A 4G36A 4EG3A 4DL5A 4Q6WA 3K0FB 3R40A 3TDNA 3GJSA 4RDCA 4R9SA 1QCCA 1XU7A 2R8BA 1MIHA 2IL1A 1HEKA 4U63A 1G20A 3OLYA 1V1RA 3OQIA 3H9UA 2EW1A 4KKXB 2WM8A 3AVPA 4LFAB 1I2CA 2JLBA 1KEKA 1H42A 3R7DA 4AJ2A 3U3JA 1XNRB 2JDID 3T8YA 4POOA 3UXYA 3DONA 5AJVB 5AWFC 3EGEA 1A4RA 3ANTA 4V1CA 4MRPA 1TF5A 2QRNA 1MENA 3K9LA 2AC4A 3LUJA 4HDQB 2C78A 5JG7A 1VCNA 2YXLA 4NZOA 5F12A 3WXBA 4JA2A 5CM9C 3SPXA 4YRLA 4MV9A 5A05A 3C7TA 4B79A 3H0EA 1N7HA 4G89A 1BVUA 5L7YA 2B5VA 1W93A 1R4AA 5EQTA 2I7TA 2Z6VA 3OESA 2Z1MA 2J8ZA 2JAOA 4DSUA 3U26A 4L8WB 4PF1A 4N0EA 1Y8RB 3O3CA 4R9VA 2GF2A 4PRKA 2B5WA 5DULA 2KZ3A 4XA5A 5IK2A 4A8HA 3OE1A 4QJ3A 4D4HA 4Q3BA 4QGGA 4IDCA 1G8PA 2JI4A 5G4KA 1JH8A 2FX3A 1M6YA 3STWA 2P6MA 2L69A 4FCCA 3WGKA 4BQPA 3I6IA 4R1MA 2GBPA 1VJDA 2BFFB 2GM9A 5B3JC 2JF0A 2CNWA 4E2ZA 1T36A 4K0RA 2XGOA 5I9MA 2AFHE 1M1NB 2C2BA 3PR5B 2W6CX 4KDCA 1CCWA 3KYBA 4O2BF 1RIFA 3WS7A 3LCVB 3E1GA 1ZI6A 3TB6A 3D6JA 1NHWA 4JUDX 3OA2A 5EESA 1SZPA 1OCEA 4H7IA 3RB4A 4G5YA 1KVUA 5JQGF 4RNCA 3O03A 4LZLA 4Q7MB 2IEGA 2OO7A 1EMDA 2QM0A 4PXAA 1RM6C 5JTTA 4CMCA 2ZI4A 1J0XO 2XV1A 4B47A 1PJ3A 3KG2A 4X1YB 4BNMA 4AX8A 2G9RA 4LKOA 4RY8A 2EW8A 2FZLA 2Z4RA 4RSRA 3D7NA 1JDTA 1RS0A 1ML3A 1E18A 2DWCA 1G6OA 2RC6A 1KYYA 2H7XA 3CH4B 1SNYA 3TQCA 4KWEA 3SQMA 4YY3B 1G4HA 3A3NA 3BD9A 3W1EA 4HCJA 2HCBA 3B7GA 2FZGA 4HH1A 2JKVA 3ZY4A 3QKRB 3M9OB 1LC3A 1SQ0A 4A5SA 4C6HA 2QN1A 4TTJA 4LPSA 1BMFD 1I4EB 2HT1A 4TS9A 2WD7B 2NXEA 1PLLA 3TTWA 4DYDA 3TAXA 2XUJA 1JG3A 4RUKA 2BZSA 3DUFB 5FH9A 3VOBA 5GM1A 3W8RA 1C41A 2VTBA 3OP1A 1Z8HA 2XCAA 4RK1A 4E03A 4ZEWA 2V7BA 5J8YC 2PXAA 4DPLA 4CTOA 1JXOA 2J30A 2ZBFA 2J45A 3LUBA 1OLUB 2W6PA 3UGTA 3SZOA 4YR9A 4LHWA 1P60A 4TSFA 5HIIA 1JQ3A 3ABOB 2BKAA 4FM9A 4MH0R 3ZHYA 4AJHA 1UM9B 1MTZA 4UNRA 4TYNA 3LG2A 2J6UA 4MI6A 2QZJA 2OGUA 4CEHB 3F96A 1BWSA 3H13A 5IXJA 3EFEA 1ZGAA 2QOEA 1R0ZA 4LVOA 4Z7OB 4G23A 5EXPA 2ENUA 4EJFA 2AMLA 4PG6A 1QG0A 2AD5A 4F1WA 4A2QA 2XE8A 3KJZA 2WSLA 1NXXA 3NH6A 5SY9A 4QT0A 3WFIA 2SECE 5I4IA 1ZGZA 3KZ1E 1U2ZA 4NOMA 2QMZA 4FR0A 4OL9A 3OC6A 4MMXB 3KFVA 4EECA 3W2FA 1TIKA 2R1TB 4LW8A 2JDIA 1GTVA 2CHEA 4PHEA 4LHEA 3OLXA 3GLIE 1SC1A 3ISDA 2VSYA 4DIBA 5FUVA 3C2QA 4A6DA 4NARA 2D1RA 2C8JA 1Z6ZA 2DTEA 1SXDA 1R50A 4JH0A 4LSWA 4H7FA 2HMYB 1OTHA 1WVIA 4FX5A 2BBTA 3QXXA 4F4IA 1J0AA 3N74A 4BO9A 4PM4A 2AFRA 4Z4HA 2C2KA 6ADHA 3ZHSA 1IHXA 2UVPB 3K4HA 4DXAA 1V7ZA 2GN4A 2CD7A 3KKQA 4ESEA 1YKSA 2XTMA 3RIHA 1RLJA 5J5VA 1KJIA 3RJEA 5H81A 1HFKA 5F9HA 4GI2A 2GM5A 2UZ1B 3JWEA 5ENZA 3ENKA 3LY9A 3K16A 1ZQEA 3G9QA 3ICEA 4M55A 1DAFA 2D54A 1QKJA 4JB8A 1PV4A 1ENZA 2SCUA 3PIRA 2C8KA 1CJBA 4HX5A 4QOIA 1DQNA 5LYJB 5LXTA 1DG9A 1M1YE 3NVDA 1X2BA 2BKVA 2OGTA 5A6SA 1QHIA 5LP6F 1L5HB 1GO3F 3KZXA 3EPIA 3R23A 2FF7A 3WWDA 1TQ2A 2ONZA 3RUFA 3KQUA 2ASJA 4RIFA 4DREA 1VA4A 1ZESA 2HCJB 4LY0A 3TRKA 4PQGA 2NVUA 2BVNA 4LE2A 3SD7A 4XOIA 3PX2A 4WZBB 5K0TA 4HBGA 3UMRA 3NYQA 2LM4A 2IYNA 1QGED 4OAOA 1NIJA 1SIWA 4G67A 5E4TA 1R6UA 4EB3A 1R18A 2BGNA 1ZH6A 4FE7A 1UJMA 3O95A 1BPEA 3FRJA 1FYEA 3EWIA 2C0CA 1IQRA 3ND9A 3A1VA 1TD9A 1OXXK 4C20A 4RU1A 3U56A 3CLUD 3BUSA 3IIIA 3RBVA 4ZCPA 3E9MA 1BE8A 3C3DA 1K3TA 1T9GS 1VPVA 2CD9A 5DGDA 2Q4RA 4LCEA 1I13A 4RELA 1G7TA 2Z8YM 4LG1A 3MAGA 2HOIA 3GJ6A 3SM3A 1R12A 4R98A 4MFAA 1ODTC 3UH0A 2YV5A 5J2AA 2VDWA 2MUTB 4ENPA 4V2UA 2PX8A 2A1JB 3PF8A 2VAXA 2P6OA 1P9RA 4IEEA 1BMFA 4YJDA 4ZQFA 4A8EA 4XYMA 2JCSA 3H97A 3HEBA 1CZHA 5LUAA 2UZ3A 4MUAA 3ZLBA 3FPBA 1NVDA 3S1AA 2YWHA 4DFPA 4DHWA 4YRZA 1VM6A 4B4VA 1JXQA 3JPQA 2QIPA 4DLTA 2OFXA 1SEVA 4F1JA 3TQ1A 5JNLA 5FO1A 3RH0A 4UNPA 2OLEA 3U1TA 2I3DA 3H1GA 4AS3A 4CTKA 5CD9A 2NAFA 4OFZA 4MR7A 2WK1A 4LHVA 3NP7A 2QRPA 3GVCA 4F96A 1EHYA 4RM3A 2FRXA 2HK9A 1WXIA 4NE2A 4NFLA 4LNUB 5BNZA 4EZEA 3PR4A 5C5CA 4JLDA 5H5JA 2X5JO 1PR3A 1RQGA 3Q7RA 3WLRA 4IRCA 4HAXA 3RRFA 1OIXA 5JYEA 7MDHA 1JNYA 5KVAA 3HBNA 2BBWA 1YVDA 5FFNA 5KKAA 4K9KA 2BE7A 1F4PA 3MPOA 1WCV1 3PU6A 5KDLA 2CCGA 5LUBA 4X64B 3Q7SA 2XGQA 1EEXB 2R96A 3WAJA 2BCEA 3RYTC 5MF6A 4UU8A 3M7DA 1VLVA 4R0NA 1EFUA 3ZWKA 4IVNA 3E5HA 4J7AA 3KXIA 3Q0IA 4XDZA 5AXBA 4IJMA 4UHFA 4KUGA 3WX0A 3JZDA 3OOJA 2NN3C 1NTRA 4RKWA 3DAOA 3GARA 3LCRA 2GETA 2A3NA 1SBTA 2PX2A 2IX9A 1YOVB 2J87A 1EVJA 2J31A 2B1GA 1X9HA 3EGVA 3G6YA 2WJ6A 1D4OA 2VUTA 5DHTA 1L7PA 2CZCA 1URPA 2PSSA 4PX2A 2NTEA 1JILA 1K7EB 4DV6B 5BNFA 4DABA 5A62A 3UNXA 2JEZA 3Q4GA 5FPPA 1XDUA 4V0RA 3RWOA 5GONB 5EP1A 3AKZA 1QFSA 3UHJA 3EGIA 2I6FA 3GN1A 3PENA 3NHBA 4DS5A 4YGYA 2HC9A 1IHPA 4P3OA 1RM4A 1RPZA 2IGBA 1Y1LA 3GDHA 4J7XA 4KWCA 4XH9B 4H08A 4YECA 3T3EA 3O8NA 4J03A 4HGPA 1V3VA 8ICXA 2XYRA 4LUCA 3QTTA 5KTYA 4RPLA 3CNOA 3ADKA 2QL6A 3RVBA 2XMPA 5L45A 5T4HA 3H83A 1R15A 2OO3A 1Y6FA 2VR1A 2QLTA 4CL0A 4YRRA 5A7FA 5JE8A 4CR8A 4C0LA 3KKKA 2HFKA 2UDPA 4PL2A 1GU1A 2WINI 4LZZA 3OJXA 3PXEA 1QF7A 1UUFA 3AF2A 4FOTA 3VU9B 2VHUA 1O5OA 3FE2A 3K9CA 3UUGA 2NUAB 3FMOB 1MAUA 1CUDA 1JEJA 3QFTA 1IJBA 5JBNA 1U7PA 1L5GB 1JFLA 4AUMA 4B43A 4ACOA 4DIFA 4DMHA 1LLDA 4QVGA 2DWOA 1PF7E 2VTEA 5CA0B 3VJRA 4B17A 4R6WA 1F2UB 3LECA 4TVKA 4KQ6A 4R7GA 1ILEA 3ZGVA 1DGSA 3FPHA 1DAIA 1XCBA 4DSZA 2O8DB 4CGYA 4BY9E 2PR2A 1ETHA 4CKEB 1NKSA 4YDQA 2Q9UA 3OE4A 5KC9A 4WQMA 4UHHA 2HPAA 3WRXA 4ZYYA 5JLAA 1QE3A 4Y0VA 4PWYA 4YRPA 4BJ5A 1PV1A 3EEYA 2R6FA 3REGA 2B6NA 2BFNA 2MYPA 4GI7A 2FSUA 4UHCA 1XT6A 4GQIA 4FHDA 4YJHA 2HSGA 3OLQA 1G8GA 3I9LA 4UB1A 2OB1A 3SWWA 4OQYA 2PT5A 3QKIA 2Y6UA 1VG1A 4PHHA 4GI1A 6LDHA 1RJWA 1DAEA 3NDPA 5KFJA 2BHLA 1M2JA 3IVAA 1JXMA 4OIMA 2HBRA 4XRHA 1ZGJA 3SHWA 1Y4SA 1TXGA 2BRUC 1WCWA 4HZGA 3AQIA 4E08A 3A10A 2HIGA 2RGWA 2BV3A 1S8OA 2O8BA 1VSBA 4ZOCA 3ULKA 2ZBUA 3RJ9A 2PCJA 5G41A 1Q84A 1HFEL 3GGDA 2ZSAA 3IQXA 2FWRA 3P0HA 1SIUA 2PV0A 1AB6A 3TNDA 1D6SA 4WKPA 1KJWA 2ZSHA 3W8EA 1Y8QA 1T94A 5FKJA 5E1DA 3M4XA 1WW8A 1NBMD 3KTAB 3CX7A 4MRVA 3QFCA 4QULA 1ZSYA 3GJYA 3KV3O 1DTEA 2ANCA 1QIFA 3R2JA 4GNKA 2AS0A 4RZUA 4U02A 5I8WA 3THVA 3FPKA 4I19A 1PRYA 3ETHA 4LPKA 3D0QA 4QU5A 2J6CA 3GIJA 3MWDA 2D0DA 1PI3A 1TLTA 2FSVA 1T5OA 2XBMA 2J6IA 2VDMB 3EXEB 1JLHA 5D86A 1KERA 2ACVA 2VNKA 2G4CA 5HGJA 5JYBA 3RABA 1I0IA 5HE9A 4KMOA 1BAPA 2HPVA 2ZJAA 4AJKA 2C2RA 1SHJA 5L4NA 2PKQO 3VAZA 1L5FA 1QAMA 2NYVA 3C0KA 1NJ5A 4DMKA 1BROA 5U4XA 9ICXA 4O63O 1X6VA 2VEOA 1Z7WA 2P0AA 1M34A 1QH0A 5L3VA 1Y1KE 4QU0A 1UDAA 1U0OC 4K6HA 4DIUA 4NCXA 4DPMA 3CLSC 1SQ6A 3W78A 4GKKB 5ALKA 3AKCA 1AM4D 4QOHA 2GB4A 1Z5NA 3TLBA 3BQ1A 4KQFA 2UVRA 1GTJ1 2ZRLA 3IIMA 1NRXA 3LTEA 2GAAA 5KPDA 2ZE6A 1X1BA 5LMZA 4PSCA 3PPWA 4P4PA 4B35A 3BH0A 1KKLA 1LI5A 3B6ZA 2ZITA 3FYUB 1DDGA 3R0JA 5CVTA 4YXFA 4CKXA 1HDCA 4LXYA 3CLTC 1SOVA 3QUQA 8ICHA 3AJEA 3DCNA 3NHWA 3EGOA 2D6FC 4D9BA 4RTLA 3UWMA 3I5UA 1WKBA 2K2QB 4Q02A 5JNUA 5EJMA 3U40A 2BH9A 1Y7LA 1Z6AA 5C35A 5JZMA 4XSVA 3SJBA 2HBYA 1DAKA 1U0NA 1UINA 2JD1A 3E9CA 1OXUA 2A3RA 1GKUB 2Y2VA 3G6WA 4RSGA 1I94B 1OX5A 3INRA 2VH2A 2RD2A 2QX6A 4FYWA 5DXFA 5A3VA 3AKDA 1TZCA 4BGEA 2O7NA 5WRFA 1IUOA 1TGYA 3S6JA 4TLEA 3GFRA 3LNTA 3I8XA 5K8JB 2H3ZA 1ODJA 3L8DA 4X41A 3QVTA 2K4IA 1TYAE 1WXHA 4U5QA 2PSHA 4NYMQ 3LFTA 4HFMA 3U19A 4A0QA 1RXEA 1E96A 3FNHA 2UUBB 2AFHA 2B98A 3VNSA 5JD4A 4RD2A 1TPZA 4DMGA 1EXDA 5IF3A 2G09A 1G5IA 2AV6A 5KFLA 3LYAA 4I2DA 1ZISA 2OD9A 2RDMA 3QH4A 4V0QA 1IONA 4U2KA 1QYVA 4DA6A 3MGIA 4I5GA 2CXSA 5ICCA 1A7JA 1A71A 1U2GC 4WBSA 2O2CA 5HP4A 2ID4A 2W2KA 3U7JA 4DLXA 3PC8C 2ZZMA 1U2PA 3HJUA 4NCNA 1NBHA 2ZRKA 4BMXA 5U9CA 1AKMA 2PSFA 2OMKA 2CUKA 3UHPA 2ZYVX 3BSFA 3DAPA 4D9GA 5FTKA 4YN3A 2AVNA 2FWPA 3GWGA 5KG2A 2F1IA 1PR6A 3GWZA 3OFJA 3B53X 4WLOA 2WTMA 2C1ZA 2WIKA 3VVLA 3V6LA 3PO5A 3BAZA 4BFWA 1VPDA 1Q7RA 2W48A 3I72A 4N9QA 4KMRA 1JZSA 4C4AA 4GXTA 4DDTA 1NBMA 4PLHA 5DSZA 2EBFX 1NW7A 5DU2A 4FXOA 2PGJA 2HMTA 1K6EA 2J9YB 2AYYA 1XU9A 3KAPA 4JI5B 3HYTA 4O9MA 1ZITA 3LCJA 2Y1CA 4MLDA 3CPJB 1KI8A 2EP8A 4AUKA 1A4IA 3WA7A 1N2CB 5JMTA 1OFVA 2OGSA 5JC8A 5EMKA 8ICPA 1YWGO 2X41A 3F6YA 1W59A 3D6TB 1Y3BE 4ZCTA 2ZQ5A 1ZQ9A 3VC3A 1RI4A 1ZD3A 4MR9A 1CY1A 1GYRA 3USES 5BN4B 4HJRA 3JAMA 5HRAA 3V5NA 4GE3A 4AY6A 2AZMA 4ZHSA 4YRAA 3M6VA 3K6KA 4M2YA 1TYZA 5A03A 1IBLB 1ULSA 2YIVX 3INYA 4FMPA 2PG3A 3HA2A 4QW9A 4F5EA 4DBZA 1D07A 2KK0A 4Q4HB 2UYCA 3HY6A 3V1LA 4BUZA 4HF7A 4RZ3A 2NG1A 3DOHA 1F8XA 1RJEA 2Q5OA 2Z09A 1MHPA 1OH6A 3A3OA 5KFPA 4M7RA 1ZU5A 4J90A 4QGBA 3PDCA 2R65A 3DTVB 2BEVA 2GWRA 4KPGA 2D7DA 3P0FA 3PB3A 2P67A 2D5BA 2PUTA 4KAXA 1TA9A 1P1JA 4CKCA 3TZCA 3ZTTA 1X87A 3GLIA 5E9WA 4PAQA 1QMGA 1AHIA 1YHZA 1BJRE 3IGFA 2UXDB 3NT4A 4G0QA 3ZLTA 1M66A 2V4UA 3SQDA 4QFCA 1HT0A 1CUBA 1ZUD1 2AXNA 4NPAA 2F8MA 2IDJA 3H7IA 4LXXA 4JI3B 2NXNA 5DTQA 2QQEA 1A98A 3LPLA 1TL7C 3HJBA 2GJ4A 3DOOA 4ZO4A 3RRHA 2EJVA 3QPDA 3L43A 1KGSA 3NC0C 1YAJA 4FMBB 1OLSB 5TX7A 3SZLA 1CVIA 3OKCA 2Z6AA 2ZR9A 3KHLA 4EBDA 4RMNA 2GPYA 2GF9A 1MEEA 1E2BA 5KFRA 1FU8A 3EQ9A 3OZIA 4PZDA 1J2EA 3GPCA 3DV2A 2IY9A 1Y3FE 2I1VB 4LTMA 2PIAA 2HGZA 2VHTA 1X8KA 2X77A 3W3ZB 4XGRA 3V48A 3T7KA 1E0SA 2ZJ8A 4WIAA 3LPMA 3NT2A 3DXZA 3C3YA 1N0VC 4U6QA 1Y4AE 2GWHA 1TQDA 2NT3A 2RJNA 1CUFA 3OQJA 3R4VA 3K0AA 1OASA 5EJ4A 2O3TA 4UD6A 4ON9A 2JGLA 4DPKA 5FWXB 1KJ8A 3E8SA 3AVXA 2JV3A 5HK8A 4FP9A 4F4KA 1ZAKA 5L3QA 1ZFNA 5IAJA 5KT2A 4M0AA 1GSIA 5FI3A 2W2VA 4DDKA 4I1IA 1TO2E 4I2NA 5IARA 1IUKA 4JLPA 3FLBA 2QMYA 2GN1A 5FXMA 4FK8A 3D1VA 4XCVA 3VPHA 1Y80A 3ZWBA 4U0JA 3JZAA 3QA9A 5BMVF 2GHQA 3JQBC 4ERXA 1ZM3A 2RIPA 5IBRA 2WU1A 4L5BA 4IIEA 2PBZA 3LI2A 2JAPA 4ZK2A 4TXNA 1FFXB 4BO4A 3CF4A 1YR8A 3LSTA 3IUBA 2WTXA 2PKYX 3AEUB 4DR5B 3C2MA 3N7UA 1KZYC 3ITNA 1Z3CA 3F46A 4JYPA 3FF4A 4Z3KA 4GLJA 3AJAA 4WLEA 4EB6A 3EAFA 1NPTO 1RAHA 1OB5A 1C3JA 3IHTA 1RHMA 4LBWA 3P9RA 4MVJI 4DLBA 2YOHA 5CNIA 3H4VA 4G1FA 3EOBI 2JFXA 1ST2A 4TTVA 2XI9A 3MTDA 3L0SA 3MMPA 4RJJA 5GZ3A 3UANA 5AJYA 4JYZA 3PJGA 3WVNA 4GWLA 4LAFA 1RIIA 2EX0A 1KDPA 1H0KA 3FUTA 4K88A 4H1TA 3FNBA 5E7JA 1T3NA 3O2NA 5KT7A 1X1AA 2Z8ZA 1XTVA 1LRLA 1HDGO 3TQIA 3KD3A 3KZMA 3H18A 5K0BA 1PYDA 2GERA 1GPBA 2DLCX 4RU9A 5IILA 2WPNA 4K6OA 2IHJA 3KHSA 1SCUB 4OXIA 4Y1GA 4K9OA 2KSOB 1WUYA 3MINB 4LFBB 2I8AA 2I6SA 1BRMA 1RRCA 4GMKA 3SKXA 4OLAA 3GMSA 5I4KA 3C7DB 1K3FA 1PJRA 4IJ6A 5JSKA 5D3ZA 1E6KA 1GGFA 2I2BA 4P34A 4QYXA 4TV9B 3CSDA 4YHHB 2IOHA 5DLEA 3VU3A 3DEHA 5D46A 3UF0A 2A0XA 4UULA 3PTZA 2C83A 3QPVA 2EJWA 1RLUA 3D3EA 4MJ3A 1BKSB 1RKQA 4NPHA 3T3IA 2WYWA 2V97A 2BCSA 1NVEA 3ISJA 5F7XA 5EZQA 4BRZA 1XAIA 2I9PA 4BKMA 3L05A 3HX0A 3OY7A 2P35A 3BL8A 2RHCA 3NPMA 5TPWB 3CA8A 1J09A 2FXIA 5JR3A 5BO5A 4RLQA 3HQ4O 4KITB 2DBVO 3Q11A 4PIPA 4IIVA 1FDWA 1CRZA 1RYDA 3UHAA 4DL6A 1N2SA 4HAVA 5LDHA 2PK3A 1HE4A 4URHA 4MW6A 1JVSA 5LP1A 4IRMA 5C0OE 5DYYA 5FBVB 1J2YA 1G6KA 2HSJA 3G1UA 3P9XA 1PR5A 1RTKA 2D3WA 4RHFA 2VJCA 4KK4A 3KLBA 1FTYA 4CM8A 4D8UA 1EGMB 3ICWA 1SBQA 3KLNA 3U62A 4WLVA 4EMBA 3O47A 5AKEA 3OD1A 3MUEA 3HKZF 3KPWA 2QS9A 1GOTA 2W04A 2ISSD 5G5HA 3O31A 3CO5A 5G4LA 3CM0A 2HJGA 4WBNF 1T1RA 4YPVA 3O75A 1S0OA 2B4KA 4TKVA 3JR7A 4CM5A 2GYUA 4C4TA 3MRVA 3CEMA 2DFDA 3GV0A 3EZXA 1LDYA 3BT7A 4ZYUA 3DZHA 3HP6A 1KZ1A 4IWYA 5IUNC 1N6RA 3OLWA 2ZAIA 3NRCA 1V37A 3CW2A 2OHXA 5G0UA 4NBNA 2ZIGA 1I3NA 1X0XA 2LCIA 1U2TA 1FVXA 3AUTA 2ECOA 3D4LA 1Z0DA 5CLIA 4LDPA 2WNIA 4WFQA 2IEIA 4BX0A 2NQTA 2WAQF 3VDNB 3WAGA 3LZDA 4OK5A 4I4TF 5LZ9A 1DQYA 4X95A 5FI5A 2IYWA 4MJLA 2DH5A 3CGWA 1E3QA 3MIIA 3LP6A 2VSQA 1MC5A 4AXBA 1UKCA 1ZR2A 1P1HA 4FD3A 4UB8U 1W19A 3QFRA 2QBYB 4RIEA 2QB0B 3EY4A 2RARA 4XUCA 1G21A 3W8FA 4S05A 4RQ1A 3PQFA 3KXKA 3NOXA 3ENZA 5HW0A 1WG8A 1XMPA 4YRKA 3UMGA 2G9UA 4BB9A 2NZUG 3G8YA 4UJ5A 5TPZD 4I8DA 1TX4B 1CFJA 3IQFA 4OXNA 3WMFA 4JQOA 4DR7B 4OX9Y 2PX5A 2NV3A 1XCPA 4CHGA 2E0IA 4C6TB 3BFPA 1UP6A 2JFNA 2COEA 3KALA 2G0TA 4HZUB 4D9JA 2A67A 4PSVA 2QD1A 3Q41A 4HLUA 4Y2PA 3HJTA 1TQ6A 5SZKB 1P9OA 1IM5A 2XCUA 3VR4D 4KLCA 1GA4A 2O50A 4XGIA 1WY5A 3GOHA 4CGZA 3E9QA 1UZLA 2OC4A 3R9XB 5M5BA 1QLJA 3E0QA 3KL4A 5G0TA 4X94A 1BS9A 2H6EA 1TPYA 3MGBA 3BL5A 1CUAA 2YHSA 4ND7A 3MW8A 2XDWA 4DWOA 3IHKA 1ZK4A 4B9EA 3RIMA 4D02A 1XVTA 4EHDA 5H3LA 1ZH2A 3HU5A 5T14A 2F62A 3FJ1A 2PCLA 4LYYA 1I33A 4BCCA 3HLKA 2XGPA 3M8SA 4BUGA 2I55A 4R5MA 4M7WA 4QEDA 1ZXLA 2OFOA 2XT6A 3NORA 1V2HE 2A19A 3G17A 3PGLA 3WMXA 4EH1A 3NKVA 5EAIA 4MTLA 3DSRA 2W98A 4RV9A 4WJ3B 2H3IA 2V9CA 4ZGWA 2V98A 1WRBA 2D1YA 1L5YA 2IKSA 3QVJA 3VPGA 4R64A 3V32A 3B1YA 2J5QA 1CRQA 1KYWA 4Q7LA 2FSIA 4L28A 1TKAA 3A3YA 4UD2A 3PPVA 4HLNA 3EZLA 2V7EA 2F3RA 3J81k 4P82A 2OBXA 1W2HA 4EG1A 4JY7A 3LDUA 3C5CA 5HDBB 2FHPA 2ZRAA 2IT1A 4A92A 4O4JB 2GN9A 1CWUA 2EC5A 4KLGA 1BFDA 4PS0A 4ZT4A 3O38A 3RYIB 5FEUA 3UJ7A 1CUHA 2WWTA 3IBYA 10MHA 4X8OA 2RHRA 3GFTA 3PKJA 4G5GA 1JEYB 1J0BA 4UTRA 4TXLA 2CMFA 3KUUA 3SHVA 3ZG6A 1WPGA 2GEUA 4RFLA 2WIGA 1RRVA 2OXRA 1W36B 1MTOA 2GSDA 4POAA 1VG9B 3SBOA 2PZMA 3VR4H 5JY6A 3OM9A 1E2LA 5KFNA 3EF0A 5DHRA 3AESA 4EEYA 1IYZA 3RYHA 3NUQA 1XCJA 4QUKA 2W3SA 1QMPA 3SU8A 4LJ7A 4DUZB 2AFIB 1U4SA 4YJKA 4Q1DA 4C0BA 1BS2A 4KXQA 3HKCA 5ENVA 3WE7A 4DSKA 4AMZA 1X38A 2PTHA 4QZAA 3AZOA 1RYEA 3WISA 4FBMA 4F6LA 3UAWA 3NHKA 2OZLA 3QEBZ 1C2TA 2VF5X 3E2IA 1CUIA 4MLZA 5KFHA 4C43A 4E2XA 3AVOA 5EQJB 3ROXA 3UT5A 1GCUA 3PT5A 4U5XA 4Q01A 5FNVF 3JALA 3OAAD 3F3SA 1G2QA 5J58A 2R6CA 3VNRA 2X0DA 3BK1A 2P69A 5IINA 4OI4A 4BKPA 1E77A 2YY7A 3EMVA 2RC5A 1TVAA 2BGTA 4RMHA 2OV3A 3RUCA 1YT5A 1HSOA 2HXGA 1KZ6A 4QPCA 3DXFA 3DLBA 5TPZA 3EASA 1ILWA 3W0LB 5F9NA 4DR2B 4LJAA 3I6MA 3PXDA 3IEMA 4RZRA 4RUAA 1ID1A 2ODQA 3THWA 3L7IA 3OKFA 3RAQA 4FUQA 3EMDA 1QKKA 5E6UB 1AY0A 4ND8B 3OJCA 4WVFA 1Q1NA 5IMBA 2E9SA 3OZTA 1IK6A 3GRPA 1YNSA 3VR4A 3CZPA 4H6PA 2BKXA 1SL2A 2WHYA 1HE2A 3ZCRA 4NY8A 1G5PA 2C58A 3ZGOA 2EQYA 4RK7A 4AO6A 3GRVA 3E9RA 2GCGA 3ANLA 2OCBA 2C5FA 1U02A 2RB5A 5IYZA 5I7EA 2CBXA 1AKEA 4XX0B 4WX2B 5JZ9A 1MG5A 4TL8A 5AJTA 3FD8A 3FB1A 4DMRA 1XDBA 4ECTA 3GLHB 4PVDA 4F71A 1NK6A 2V0CA 4ZREA 5JSFA 2KKPA 2JMGA 1FRVA 1PSZA 1D2NA 2QQ0A 3WSVA 5F3XB 1NRJB 3O8DA 4YDHB 3RBDA 1DT5A 4PPQA 4ZVTA 3B2QA 3WHPA 3ZWNA 1HQDA 4QXPA 3VVMA 2MT9A 3IUSA 1NUHA 5D84A 2ZPTX 1T2VA 1MB3A 4O3MA 3EZGA 4EFLA 3OFSA 1GV1A 3VPXA 4G2NA 2X3UA 4O5AA 3WLFA 1YBVA 3GCZA 4OMDA 1KVQA 1YZYA 3R7WA 3E70C 2ECFA 4R0VA 2FU5C 3OQ1A 3W6PA 4LJRA 3TE7A 3QVGA 4BLVA 3RKUA 2IIBA 2RCNA 2LCFA 3ISBA 4QATA 2VXBA 3FUWA 1Z4LA 3K8ZA 3FHCB 3OA0A 4DW8A 5ESWA 3UATA 3CKMA 3ANYB 3H4IA 3WFJA 4D80A 1CLUA 3W5BA 1BN6A 4EEKA 1EU1A 4KVAA 3R9IA 1NVFA 3N2NA 3L93A 1EPUA 1Z2PX 1GGEA 1JIUA 4H15A 1J8DA 1V48A 3JPTA 3RNOA 1OYOA 3BORA 3DVAA 2QUZA 1SXJC 5IZCA 3WLLA 5D1NA 3PDIB 1BHJA 5AW4A 5LD2B 4GXRA 1KVTA 1KIAA 1ZCBA 1YL6A 2QY6A 1Z36A 4KE7A 2AG5A 3T5TA 4O29A 1P61B 1HR0B 3NYRA 3WNBA 2OO5C 2GVZC 3AWDA 1NP6A 1N57A 1QFYA 4PR0A 4BGVA 1ZJ5A 4PZUA 3LOQA 2XVZA 2EBUA 3CR8A 3NIDB 3N2ZB 1Z47A 4RK6A 1AXEA 1D4AA 5BV1A 3I2KA 3DBLB 1ISHA 3ER9A 3QKTA 5P8WA 3KSAC 3L79A 2Q5HA 5KUTA 2ISQA 3QU5A 3AV0B 3FR7A 3U4HA 4UASA 2NSYA 3DT8A 3RR8A 1DIHA 1DZIA 1ESNA 2F55A 2HA0A 1WB4A 1Y7PA 2IFTA 3IMGA 2X4LA 2IHKA 1UDCA 2IE8A 3N0TA 4V03A 5CFMA 5HCNA 3A1SA 2I99A 2N47A 4TOIA 4PLVA 4ZI5A 3OX1A 1FFBA 1E4EA 3OAAA 5CU7A 2O6HA 1YHNA 1DMSA 3QIAA 2YCBA 3PJDA 2Z2IA 4I81A 4MKRA 2ALJA 3J81j 3KHUA 1UBUS 3R3HA 3AHDA 4J16C 4JEHA 1W76A 1RXVA 3WBBA 3V6HA 1VPLA 3BZWA 1S2DA 4O3PA 4ZT2A 3LHKA 2FMFA 2Y6VA 3L1VA 5J2BA 1ZXBA 2A9PA 4HEJA 4R3WA 4JL6A 2K5UA 3W6OA 2ZTMA 4KPEC 3I1YA 1LLCA 2OXCA 3ZE7A 4HGOA 2R9VA 3NGXA 1DL5A 4MV3A 4QRIA 3DE6X 5ALWA 5IDQA 4IDOA 3KDPA 5B7NA 4D0RA 2QW0X 5K0JA 3LL4A 1ENYA 5HQ3B 2HBJA 1B76A 4II3A 3BMNB 4ECYA 3BREA 1K1SA 3NVMB 5KIAA 3KELA 3CXRA 4F0JA 4YYZA 4DZRA 1GGNA 2GTPA 2J08A 3IV6A 3G89A 4G41A 3E5RA 4HTFB 1Q50A 3KS9A 2PWAA 3K92A 2WTEA 4PZ0A 3FJYA 4QWDA 4DBLC 2YIDA 3N2EA 3EMKA 2R87A 4UM9D 4I1VA 2NO9A 4K03A 1DKNA 2YFYA 5CVEA 5AVTA 5EJAA 5KWSA 1T91A 2BSXA 4MMZB 1GQSA 2XQVA 4RAOA 4C7OB 3EW9A 2DHQA 5TQ0A 3KR2A 3CX6A 5DG8A 3G2QA 2IYOA 2PQ2A 1NZPA 4CIAA 1PGOA 4MQUA 5BN1A 1WKCA 1J4AA 1ABBA 2JBAA 4P83A 4D5GA 8ICSA 4LDZA 2A92A 3FDSA 3OWHA 1V4NA 4RJTA 3Q3IA 4CM7A 3N0RA 3P27A 2GCOA 2H54A 2YQEA 2COUA 3VM6A 2XQIA 1J99A 1UJ6A 2YB4A 4A3SA 1S4QA 1Y9AA 3NZEA 3BK2A 1JR3E 3WLTA 5DRTA 8ICCA 4XVCA 3A6PC 1VI2A 1E3DA 3BD8A 4RA6B 3VVBA 3N5KA 3LCCA 1P6XA 2IS6A 1JW9B 5DHSA 1AD2A 1C1DB 3N0WA 2G82A 4NENA 3EG9B 4JUZA 3FR8A 4J0EA 5FA5A 3CH5A 3SQXA 2QN8A 3W9YA 3A6GA 5BRAA 1R8XA 3KQYA 3DXXA 3T5CA 1T0BA 3FGZA 1WWKA 2G71A 2B2XA 3LZCA 3R3JA 3C5WP 1UF9A 5HIAA 3QX8A 3N7TA 3K09A 4EBEA 3ABIA 4YCAA 2ECQA 7ICTA 1X1EA 4GYKA 2PI5A 5A6VA 4O4LF 1COOA 1Z56C 4MEYA 3SAFA 1L7EA 1YA8A 4G0YA 3M70A 3PE6A 1ZQMA 1SB8A 3HCEA 2BN4A 2PX4A 1VPEA 2WUFA 3L5OA 5DBOA 3EGCA 3TDKA 2BTQA 1T3ZA 3LQRA 5A2GA 3AVYA 5HJEA 3KETA 4O2BB 2HRDA 1SBHA 4JC4A 3T5BA 3PUXA 5A0FA 3HU1A 1Z38A 3B6EA 5LZ7A 3MB5A 1OQAA 2WP0A 2P4HX 3N8HA 2I6TA 2X8WA 3TKLA 1BTOA 2ZBPA 3D7SA 5GPBA 2HH9A 3ANSA 3NJ4A 3NRJA 1JL3A 4YRMA 5J1SB 2GEVA 5JQGB 2KJ9A 5KO2A 4AUEA 4TRRA 3N70A 1XLTA 1AVTA 2EW2A 2GTIA 1EE1A 3BBLA 1FFEA 4E5DA 8ICIA 5LNK6 3KNZA 5BSVA 4MV1A 5KYWA 1EJ2A 3X2SA 3SICE 4MUJA 3GNLA 5KMGB 4MKGA 4ZDIA 2QUJA 3VHXA 1Z62A 2ZU0C 3ZJ5A 3DOJA 4QXQA 1N0WA 2RGBA 4D4GA 4CU2A 3TSCA 2MSWA 1CPYA 4YS6A 2C7GA 2H4XA 4AO7A 2REQB 2FY8A 2XWJI 4HOYA 3V46A 1O6BA 1QHGA 2OILA 4NYJQ 3VU0A 4WLNA 3WDMA 5EXEA 1JPVA 3KJEA 2WU0A 2R86A 3EXHB 2KW5A 5KYUB 3KEOA 3H1FA 4X5OA 4JBXA 1EVLA 5HZMA 3EBPA 3EOAI 4R1UA 2O8FA 3M2TA 1L5WA 3U2QA 4TL9A 2BPGA 1DADA 5LOVA 3OE5A 2PWZA 1X6JA 1W46A 2IHNA 3HU2A 1BQEA 4XKJA 1HNWB 5GVRA 1MNAA 4G86A 9ICVA 1NVVR 2Z5VA 5B3AA 1ZQSA 4H59A 4KQ2A 2ODAA 4YCXA 1T9AA 2VQ6A 1NUUA 4EPYA 1KKUA 1N61A 2CVZA 1FBTA 5LDGA 4WJZA 4GMFA 1LBSA 3MMSA 3NT5A 5KJ6A 4FBLA 5C8XA 3PX3A 4DVJA 1U63A 2G63A 4KXYA 5E3HA 5AR1A 2ZYDA 1V2GA 3IHWA 1BW9A 6GPBA 4P3KA 3HL0A 4YMSA 3ZBPA 5C1PA 2W00A 4E94A 5L9AA 4R66A 3CLHA 5JRTA 1XA3A 4U2CA 1WSAA 3OCCA 2PUBA 1PBNA 3FZQA 3HY4A 3RWBA 4AP9A 3MB8A 2BELA 4DSLA 4JWMA 2O1XA 1JI7A 3GLTA 4ILEA 4IS2A 3JWPA 2HMVA 3QKWA 1QYCA 5KL1B 3OUZA 5EZYF 3EEQA 1FSGA 2WJVA 3R3WA 4NFYA 5DCWA 1FDRA 1TK2A 3LPNA 3A7EA 4K87A 3WDSA 1BD3A 2QTVA 2F1KA 5HJ5A 5K3BA 5E3IA 2ZREA 4IIDA 1JKMA 3QM1A 2ZULA 2PSDA 3BDVA 1FDSA 3TZBA 3OUUA 3ORYA 3AL3A 5G3YA 4E09A 5BSMA 2O5EA 5DNYB 2FPXA 4DCMA 2O2HA 2VK4A 3G0BA 3VKGA 1V1JA 1YRWA 3BE4A 3PC7A 1KKMA 5LP6B 3JATB 2A14A 5ERXA 1DVRA 4Q3NA 2YX8A 4OK3A 5AVWA 3WQQA 2ODWA 3MGAA 5EFOA 3WL5A 2CVPA 2JGJA 4ZGGA 1O0BA 1NJSA 3DCIA 5EP3A 3WNQA 4G07A 3PL5A 1JA1A 4OHXA 3K8YA 4LRXA 3JQFC 4N8SA 3KQVA 1H4TA 2HTEA 3LO8A 1QRSA 1ORIA 1EA5A 4HEHA 4F46A 3KC2A 3LHFA 1MJFA 2MJLA 4Q1FA 4DLPA 4KQWA 2CBGA 4EKNB 5P21A 3VKFA 2VDNB 1SJ9A 4ZCQA 2A84A 3NWEA 4BZZA 4JI8B 2R7KA 3DLCA 3NGLA 1T6NA 3S28A 1EX7A 4BO0A 1PJCA 1NIPA 3VDRA 2J5RA 1Y1PA 5DB4A 3AG6A 4FGUA 4AS1A 4UU0A 4IDPA 1P5FA 5A1JA 1MW8X 1T24A 1WVGA 3KQSA 2AZXA 4LYDA 1H0HA 4YV7A 1K0UA 1B8UA 4A91A 5F2EA 4GC6A 4O3NA 4YMGA 4YMTA 2AVDA 4E5MA 3D4OA 3EVBA 4P2BA 2ZQZA 3NDRA 4BEBA 1NJ2A 1WL8A 1EQAA 1OLOA 4ZRNA 9ICQA 1YT3A 3L7CA 2JIOA 3F74A 1T8WA 1C8KA 4C4RA 1COZA 4I50A 3T1NA 1L4YA 2J9FA 3ACCA 2CW5A 5EXXA 1NJXA 3KTFA 1AOXA 4HYKA 3INGA 2P2SA 4BFVA 3TW8B 3CUUA 4NJMB 5K3FA 1QYIA 2Z5FA 4PPFA 3VBCA 1JKJB 3CEJA 2PAAA 4Y2RA 3KAJA 2VKTA 3KEGA 3T5DA 5IKXA 2CE2X 4RT3A 1Q0HA 2HWWA 1TA0A 3EPLA 2IEYA 1EUCB 3PNLA 1TM4E 2DXIA 2Q21A 4AQDA 2ILVA 4XRRA 1NYQA 2KJ8A 1NXVA 4XCQA 2DTXA 4EKGA 3RS8A 2CYAA 5KSWB 2XJ9A 2G83A 3RF6A 2W4MA 3G7SA 1RQXA 3A9VA 1P9LA 3BF8A 2EVWX 3AVUA 1U2EA 3UK6A 2FDRA 2I4MA 1XJQA 2V7TA 1EZZA 5DE3A 1ZL2A 4UB5A 5IVHA 2C3MA 2H1HA 4RKFA 3R3XA 2WM9B 3H9GA 2QLLA 1T2UA 5KAPA 3RAFC 3RYCB 3CY6A 3EXIA 4OB6A 1U28C 2FKAA 4D25A 1J0CA 3PLAE 3BXZA 1NJGA 4F2RA 1RAFA 5MN5A 2B94A 3Q5EA 5E1BA 2E4UA 2OT3B 2PL5A 3FPEA 4UVGA 4B5KA 4X1KA 1EWVA 3T6KA 3I2JA 1V11B 4ED2A 3G5UA 2W7PA 4OV6B 4TTSA 4G0WA 4MQEA 4BLSA 2ENWA 3Q9UA 5DB8A 2AOTA 1YZUA 1SKWA 4ISBA 2PUJA 2LIVA 4XGKA 3U3ZA 4XFJA 3PFIA 3G79A 4U0KA 4CI0B 4MW7A 4ZOLF 5F76A 4M1EA 3QA3E 2C5LA 3JD2A 2O8EB 2DH6A 3UN1A 1FX0A 3RFCA 2P5YA 4ESVA 2RDJA 4AF8A 3KB6A 3PBKA 3QTLA 4Z7QB 3WYAA 1SU7A 3FOBA 3UV3A 4GLLA 3FOEC 2NO1A 4CIXA 5IT9A 3C2LA 1KVRA 5KOHB 3QJGA 621PA 2PS3A 3CBQA 4Q4AA 5J0YA 4YC7A 5AP9A 3SLRA 1LLFA 3LCMA 4Y9RA 1BA2A 4FJ2A 1VMKA 2F77X 1LBIA 3PQ5A 2WHXA 3HWX1 4XDGA 5FT9A 1XCMA 2YYYA 3HACA 3S29A 2JH3A 3PXBA 5JO0A 3T7SA 4KXWA 3FCCA 3AM4A 5CAEA 3KSDO 2AEJA 4ECQA 4CMKA 1JV2B 2WAAA 4Y2SA 1ISMA 3W05A 1UA0A 1T3QA 1ZJMA 5GAJA 1PD1A 3L7JA 5SV2A 4L2IB 1YQUA 1D8AA 1Z2AA 5T3UA 3ODGA 1V26A 4YP7A 4WINA 2GPJA 1L7AA 4QAQA 2WIFA 5COBA 5FUMA 1WB9A 4HDMB 4AD8A 1QQBA 2Q3DA 4M0CA 1U9LA 1S2NA 4YJFB 2HTFA 4EX6A 3DF7A 3K9GA 4IXWA 3EYZA 1KMQA 2A78A 1OPXA 3KFLA 1M7GA 4KGDA 5J4YA 1L4MA 2AG6A 5CNMA 1JDBB 5KU7A 1GEGA 5IJ0A 1EXVA 4KN7A 4WKOA 4JYAB 4WCFA 1DK3A 2OUIA 2PYDA 4CKBB 2R11A 2EFYA 2R97A 3SAHA 5KYXB 3R9WA 3DNPA 3I2FA 4C5AA 1ZOIA 1ZSNA 1CS0B 2JHCA 4FWIB 1KQQA 3P4YA 3GAAA 5IBQA 3HWWA 3TNLA 3GA5A 4C5CA 5FJJA 1S97A 3LWBA 3PKZA 3TJMA 1NVBA 3BDAA 3GNSA 3OCUA 5JTIA 2QD2A 1F2DA 1Q46A 3HBMA 4MV8A 4H17A 4FN5A 3QLVA 2SKEA 5FX2A 1AKQA 1R1DA 2GXSA 2XGMA 1LX6A 3AY3A 5JYCA 1L3VA 2VP6A 5PNTA 4FHCA 4I4LA 3M9MB 1QO0D 4U2FA 4UCFA 3T7EA 4QTZA 1LPNA 4FYPA 4BNXA 3WIEA 1GTL1 2BFCA 1DX4A 4IKEA 1NONA 5AW9A 2HHTA 3QE2A 2O7RA 2VJYA 1G8AA 4EELA 2ERYA 1Q15A 4L4UA 3WGGA 3IPXA 4P7JA 5JYDA 1P2VA 2GZSA 3SG0A 1Z4OA 2HB6A 4DJFC 5IVIA 3HO1A 1N6HA 4HWKA 2G4LA 4BPBA 1EVZA 2HDHA 3KQTA 1E8MA 1KTQA 3F5AA 3WL8A 4QYIB 3NKLA 4QDZA 4TKLA 4XQ8A 1MW9X 4RQ2A 2Q8NA 3P9ZA 4OBBA 4J3NA 1F0NA 3N28A 2ZTCA 3E7PA 4ZDJA 1C50A 3IE1A 4NYIQ 1C1YA 3V80A 2VPWA 2V4ZA 3F47A 4ZD6A 3NRWA 5CFNA 1TB4A 4J0FA 1OFHA 5KFEA 2B4TO 3QWAA 1Z4NA 5F5XA 4PYKA 4UB4A 4IHAA 5DASA 3M4YA 4P1ZA 4GPZA 2YWXA 1U8YA 1DIAA 4UOQA 1NP7A 2GJKA 2P6RA 3WKCA 2IU3A 5F7OA 3Q40A 4O0IA 2XR1A 2BUAA 3AEZA 4JLJA 3DZIA 4O2AF 1V97A 1REQB 3GJ0A 1KSPA 4ZQHA 4GKBA 3QF7A 3SX4A 3TACB 5H9VA 3PCRB 3L2OB 4L5CA 3RROA 4K0KB 4Q93A 5EA2A 1CIPA 3WGMA 4B4KA 2IV3A 3RH4A 2GWSA 4IL6U 2C5AA 3CYFA 1AK1A 3BHNA 3B48A 1E3WB 1W2WB 5TMPA 5A9SA 1ZQZA 2UVVA 4JT4A 4EB0A 1LPBB 4FOLA 5ICSA 1HTBA 4X7PA 4JAVC 2CL6X 1ZINA 4ETNA 8ATCA 2R2AA 2AW3A 4FE4A 4EQZA 4JQSA 3QVOA 2VPZA 4J91A 3HCCA 4KQKA 1VJCA 3R76A 1O97D 8AT1A 2G70A 2NRWA 5LB4A 3HXMA 1F0PA 1WHTA 2J0EA 1X7ZB 3HGMA 2PXHA 4KPUA 2JAWA 4MW1A 3T52A 4V0SA 3BHIA 2BEUB 4PYJA 3NM4A 4RDIA 4HAUA 2D0PB 4J0DA 3M9NB 2A7XA 1ORVA 2BP7A 5TQ2B 4Q3OA 1N25A 4RLHA 3KWMA 3I6ZA 5LQMA 3M7IA 1H1LB 4DWJA 2ACEA 2M2IA 3CE9A 3O4FA 1Z45A 1T43A 4TRJA 1V45E 2JGDB 4D1YA 5EKXA 5HF9A 4D3YA 4AP6A 3GG9A 1Z6YA 1IPHA 3KVOA 2QN6A 5AVKA 3PUWA 1A1SA 2BFDA 4DF4A 2Q0SA 2ZYGA 1WETA 1K7XB 1ZD5A 1QIIA 3I28A 2EKDA 2ZUUA 3A26A 2Q0XA 1UEIA 1JDNA 3LUCA 4PHGA 4BNVA 1E2JA 3FSGA 3HYNA 1TUBB 2LI6A 4QGHA 2FPPB 3GLFB 4KWIA 2IYXA 4ZQBA 2PD3A 1Q16A 3KT0A 4BNGA 4WY8A 2JZBA 4P33A 3KVYA 3SIXA 3K6SB 3KJNA 1C5KA 3DLIA 2YMPA 5AUQA 3OZGA 1ZH8A 3NDJA 4N0PA 4G2TA 3AGPA 2PQMA 3A4LA 1Z6QA 6REQA 3ET5A 3L4PA 2FF5A 2ZK7A 1SUSA 1SCQA 1M1YA 4P4SB 1QO0A 3T94A 2YJ5A 2ONYA 4WN9A 4P5DA 5JCPA 5F98A 3HS3A 1GTZA 3EC7A 3PLNA 3KFXA 5FWAA 2LGJA 4QUEA 1C30A 3PP8A 2EFGA 4ZPXA 2PRJA 3TUIC 1A0PA 5YASA 2PZ8A 2AUMA 4K9DA 5FFMA 1IMJA 5TMEA 1R6DA 2OV4A 2N1RA 1B8OA 4EGSA 4W8OA 2P7IA 3LQ1A 3A25A 3AFNA 4MR8B 3BFVA 4WZ6A 1F2TB 2QSYA 4PTLA 1VCMA 4YCBA 2REOA 5C18A 1T2NA 4YJ2F 3ZDDA 1BXZA 1DLJA 2X5NA 3DHNA 1ZJWA 3E53A 2O14A 2XNJA 4B9NA 4LF9B 1QU2A 3V7FA 3MJTA 3NWPA 1XWLA 2WC1A 4I55F 1ABEA 3BOSA 4N7MA 3K1AA 1RI3A 1AQLA 2XNHA 4QELA 4E31A 4QBIA 1CR1A 4R2XA 5E95A 1ZEMA 2IELA 2GDJA 4E32A 3GEGA 5JSHA 4J1TC 3CLUC 1U2DA 1D2CA 3MTQA 1KDHA 1YB1A 2JZOA 5JJCA 3OJWA 4YCLA 1S5PA 2PU5A 4EL0A 1TZJA 3RVSA 1CFZA 2D8AA 4IIFA 3P0RA 1CUUA 4XDHA 2NWQA 1D03A 3AR8A 4JOCA 1BDMA 3JAKB 1CV2A 1XO1A 3SC3A 4DJDC 4IQ8A 3JRXA 1HZZA 1AX9A 2A1UB 2RI6A 3LWZA 4EVSA 1JDUA 3WRXC 2H4FA 2EOAA 4H6XA 3NQ41 5EQDA 2BONA 2VJ4A 1L3SA 3EIEA 2Q1TA 3VISA 1N2HA 2JCXA 3DKIA 1PW7A 3S1SA 1T3HA 1UZUA 4ARCA 3U48A 4QX6A 3NU1A 5HIMA 2AZDA 1B23P 5I9TA 3D6FA 3RJGA 3K2BA 5CIQA 1OVGA 1ZUNA 2G6BA 1AE1A 3PD0A 3I9OA 4FIDA 4OHBA 1OILA 2C88A 2Z98A 1EDEA 5D7NA 2IHZA 1JU9A 5IUKC 1V9PA 4ENSA 5IT5A 3O74A 3HEAA 1U9JA 3UJ8A 4L16A 2PKWA 1NYTA 6ABPA 5ELMA 5J2TA 3E18A 1WNTA 3C8ZA 1YDWA 5SZJA 5IM4F 1C0LA 3KYIB 3T5LA 2OFFA 4BFSA 2ZKIA 2QR5A 5KFAA 4KV7A 2L17A 1SVNA 1SG9A 5JCJA 1TVEA 2TS1A 5DDMA 3JW8A 1PGQA 4I9HA 1RRFA 4UBMA 4C8NA 4K8RB 3RR7A 2QRVB 1IV8A 1WDWB 2OQIA 1IXRC 4I4CA 4OHPA 3ISCA 4P35A 3C21A 2P9QA 4TUSA 1S7GA 4BX8A 4IZOA 4UUBA 5FADA 2LKYA 2Q7XA 4MUKA 4YREA 5FTMA 3I76A 3BYZA 4ZV9A 1IVNA 3UWOA 2X8JA 1IDN1 1SH7A 3HCWA 1QBGA 2Z57A 1SMKA 5A5FA 5FEMA 2ZRJA 3OPMA 4KQ1A 4LDNA 1FDIA 3H6HA 1YZ6A 3G2JA 2RRDA 2VXYA 1DBPA 3NHZA 1JQBA 3H17A 3TL2A 5AKLA 1R7RA 3LKDA 2JEFA 2HRBA 4IYRA 1E4OA 2OUKA 2PLAA 3U7IA 1KR5A 1XVAA 1ECWA 1VYTA 1QIDA 3NNDA 2ICAA 3QUSA 3JQ8A 4OU4A 2CY0A 1OVMA 2NSJA 2W43A 3GGCA 4ZVKA 4TLAA 4CVNA 3ZY5A 3PQCA 4HQFA 3FM9A 1BPBA 3L02A 4BP1A 1LDGA 1U7XA 2XJ4A 2EGHA 2WOJA 2NTVA 4GSKA 2V55B 2ZETA 1MVNA 5DGCA 4R6XA 2ATLA 2OCAA 4JI7B 3UMYA 1UXOA 3FDJA 2E4WA 4B3IA 4EYSA 2HQBA 2JRCA 5BMVB 4PRYA 2C20A 4TUYA 4DV7B 5JXJA 3H8WA 4JV0A 2NUPA 2R8OA 3EOZA 3KQMA 2AKEA 4REOA 5HUJA 1B4DA 4DA7A 2RGEA 1GU7A 3VC7A 5IKOA 2FEOA 2DAPA 1Q44A 1VL2A 1DLIA 5GJBA 4IO0A 2QD5A 3SJAA 1UBRS 3FDZB 2CLIB 1HEUA 2W93A 3KKAA 2OHIA 2ZB7A 4FEYA 1X6IA 4C04A 3I6YA 1ZM9A 1YQ9A 3HTXA 2O1WA 1IM4A 2NQ8A 2REXB 1ZUHA 3MR2A 4NS1A 4UZSA 1R27A 2YIJA 2X0RA 5K6AA 1QO7A 4L0CA 5C53B 4UHJA 5CXUA 4MPDA 1MXFA 1ZBQA 5DRYA 3DM9B 5IWAB 1YJ8A 1ZQTA 4GM1A 3RB6A 1WQ4A 1TU4A 2XUGA 2HA7A 9ATCA 3JPNA 1KTVA 1UC9A 4NCHA 2PL1A 4FYIA 4KODA 2DQYA 3CRMA 1GJRA 5DZSA 2BMFA 1K06A 4GLFA 4Z2YA 4I5FA 5BPHA 3QPWA 4L6IA 1GKIA 1EFLA 1GR1A 4FBGA 2O6LA 1IG6A 1T15A 3NB0A 4M1ZA 3WYDA 3H5OA 4KW7A 1IN7A 1DC3A 3RTVA 3D8HA 2N75A 4NHOA 3ZZNA 1KEEA 1YKGA 3F49S 4ARZB 1HA3A 4OH7A 1HYEA 3QLUC 3BWEA 5SYNA 4DWIA 1F5SA 3KTQA 3HZZA 1XJCA 1R0WA 5LIRA 1IXSB 1FFCA 4UHEA 4PHFA 1Y3HA 5F7JA 5KNIA 1L5NA 3EW7A 1D6MA 4CLRB 1G5RA 3B1FA 1Z28A 3H19A 1KWGA 2XMGA 4Y2HA 2H7CA 3ASYA 3OCZA 1R5BA 1GZ3A 4BLUA 4XJXA 3BX1A 3MJSA 2GUWA 1W73A 5ALUA 3WLOA 4R7ZA 1UOQA 4H1WA 3KZKA 3GJTA 4AZ0A 1M9NA 1AMOA 3HKEB 4MHVA 3RRGA 2CT8A 2CCJA 2FQXA 1KY3A 1YB7A 1Z5ZA 3VR3D 2WT9A 3TFOA 3LT5A 4WZZA 2F3UA 1NL3A 2XCPA 1FUEA 4KB5A 4MWSA 2JI8A 1D4FA 1JQKA 1P1BA 1SHLA 1XHLA 4F5PA 3Q1LA 1FQKA 5JUWA 2LV8A 5ANRB 1T2EA 3FVVA 4YAJA 3RHSA 4MGZR 1DCTA 3FWNA 4IG9A 4CM1A 2X2EA 3NVYA 1GZUA 1KP3A 3LT4A 1PHRA 1FUYB 3Q8MA 3K1JA 4HXGA 1ZYQA 5KFXA 4Q4DA 3QHAA 4IXNA 4MV5A 3FTPA 4B7ZA 5IRCD 5BOLA 4LIPD 3D59A 2KE7A 4BKUA 4HDKB 2R44A 4CIBA 1KZHA 4WBNB 1PVOA 4U7GA 2XDYA 2PZEA 1LK5A 1WZCA 2J9RA 1KFKB 2H9YA 1ES9A 1FRQA 3AQFA 1JMYA 4YK7A 2WSBA 2HJSA 5KFOA 3OIYA 4Z4FA 1Q3UA 2RHGB 3JPWA 3DDWA 5KWIA 4IQWA 1KYXA 3KVRA 3I39X 3J7TA 4EWLA 3AI7A 1GZHB 5EUCA 3DEIA 4C7MA 3OHAA 3U4IA 521PA 3VYVA 1H2AS 1UOOA 1NR1A 4GOOD 4Q48A 2EJBA 3ZEAA 3E3NA 3HVIA 2O7SA 2A5LA 1KO8A 2X42A 3L8YA 2OY0A 4G3IA 3LDHA 1S3SA 2DF8A 4KLUA 1XZQA 4G4SO 4I4TB 2ZYWX 4M4SA 2CFTA 4ZKDA 1JNXX 2H7YA 4YRCA 2VT3A 4QBFA 2DWPA 1N36B 3B89A 3IOBA 4R8LA 1U5BB 4US1R 1DJOA 3AINA 4HGRA 5GOTA 4A03A 2E1PA 3AYZB 4X24A 4QICA 3D3NA 2IITA 1Y34E 4ZAWA 3R7NA 2P6UA 4ONEA 3QMVA 2H4ZA 4P4LA 3TGPA 1NVUQ 1QF9A 3PVXA 4DA8A 4WA8A 3B0YA 3LVBA 1N62A 1Z5VA 1C7RA 4DE5A 1Q2UA 1V9LA 4NK5A 1EDOA 1H2YA 1I3OA 5KVSA 1Z0IA 4L15A 3VDXA 4EYHB 1M54A 5A2QA 5DEIA 1CEZA 3R3UA 4U2GA 3MRXA 2GXQA 2PX3A 3LWDA 4LWQA 3RM3A 3DT6A 3VH3A 5EXTA 2DYKA 3KJHA 1QONA 3AW8A 3EUFA 1UHUA 2KSQA 4D0NA 4JR1A 1LQTA 2VJNA 4R1TA 5ERGB 4J9OA 4HEA6 4YBRA 5JS2A 4YR0A 4NBLA 3OX4A 2FUNB 4CHTA 3KHRA 4GL4A 1FFYA 3QZ7A 4P58A 2I5HA 3SYNA 3UH1A 3K6JA 2VUHB 2PXXA 5FB3A 4FKMA 3ETNA 4ZCSA 1KDTA 4WECA 1FIQA 4RTPA 1UR5A 2ESRA 4UAUA 3IV7A 3JWGA 4MGYR 3UM9A 2KBFA 1BMDA 3G0IA 3MK31 2ZUWA 2PHZA 1PEAA 1I01A 2UZ0A 4RHXA 5C8YF 3C29A 1GCAA 2ZRHA 2OCYC 3QPCA 2NV2B 2PFPA 4XR4A 2QTWB 3T61A 2YYZA 1WTAA 3PNBA 4ND6A 1W49A 4L4YA 5HFJA 1SA0A 4KLJA 4F7DA 4K4GA 3SN6A 1RYNA 4XLTA 2JI6A 3PF9A 5A4AA 3CUTA 4DIMA 2XB8A 1DV1A 3JQ9A 4JEMA 4Q3AA 3N59A 4C0WA 3R7SA 2P75A 5BYAA 3ODPA 5E3JA 3VR3A 2G4VA 3ZV3A 1E0KA 1HT1E 2QUIA 3H6KA 3HWSA 1HG1A 3V7WA 8ICNA 3ZDRA 1SGGA 3GXBA 4Y2JA 1G3RA 5CFQA 3TLAA 1NW8A 4CL2A 2XCLA 3G85A 5CFPA 1Z4PX 3UFXA 5B36A 1YRQA 3TBHA 4MUEA 2IHVA 3CMMA 5BYKA 3C4JA 5M04A 1QWSA 3MEQA 1KMHA 2EZXA 1L5MA 2JHAA 3BHJA 1L5QA 1Y88A 1F1JA 2VKQA 2ZJFA 2I4TA 4CV3A 1A96A 1UQVA 3KT8A 3SZ3A 1NVXQ 2ZCVA 2P8JA 5DGBA 1O08A 1ZY2A 2D62A 1JBEA 2X7HA 4MS1B 4F84A 1HDYA 4E7OA 5EGSA 3TBKA 4RXMA 3NETA 4H1VA 2WG1A 1I7PA 5BQXA 1R4MA 3N3BC 3G8BA 3ZUPA 3WSWA 4CXMA 4RS3A 4HDSB 1JAXA 5DLYA 1LQUA 4PY2A 3H0CA 1GZDA 2QI9F 4BMCA 2B8TA 2C4KA 3NXKA 1YVRA 5JAPA 2VBGA 1TUGA 1OFIA 3H3XA 4WDRA 4Q3LA 3NOQA 3GIMA 3VO9A 4AAYA 5GGYA 1UBFA 2PZFA 2Z58A 5A3JA 1M0SA 5FNVB 3CPEA 3QZUA 4ARSA 5CD1A 3ZVRA 2JD2A 2OE2A 4LHYA 2BF4A 3KPUA 3KQPA 4XTCS 3GH1A 2QTTA 3AVVA 5KOJA 1Z2NX 4IHJF 4M1YA 4N76A 3IDFA 1NNUA 4M87A 1MV5A 5C3UA 4MEXA 3TRHA 3QUTA 1KVSA 3E2MA 3LX4A 4YTEA 2ZM5A 3FJOA 2AR0A 1EBBA 4O5OA 3OKAA 2QYSA 4TQRA 3HNPA 4L0MA 4LOAA 5JCXA 3K0BA 1UXGA 5H3CA 3C3KA 1G55A 2JC3A 3ND8A 4MA5A 1FYVA 2IXBA 1T0UA 1DBQA 1HDZA 1H38A 3ANMA 2A8YA 1PDWA 3ZZ1A 4ZHQA 4IDGA 3NO4A 3WI7A 2VAVA 3BE6A 3STXA 5EIAA 1I4OA 1E2DA 5GVSA 4AKSA 4D3XA 2BEWB 4EARA 3BDIA 1XYVA 3SHTA 3EF3A 1VRWA 4YP5A 1YFLA 1K5PA 4LBVA 1XR3A 3AJDA 5ALQA 2GCPA 3W6ZA 3OCVA 4B6JA 2DKNA 4G5XA 1PVQA 1YS9A 4G0ZA 2OAGA 3UVEA 2ORED 2HSZA 3WP1B 1RZUA 3PNOA 2HFJA 2QG9A 1TM7E 3WICA 3DE7X 2I8CA 4Y2UA 1W88A 2X15A 4K26A 1GGVA 1D2AA 2GNAA 3C48A 5GADl 2QP4A 4OAQA 3X0DA 5LB2A 3I9NA 3W79A 4LK3A 2H1RA 3FCOA 4G01B 3DKPA 2VNHA 2PIDA 5ELXA 3RUHA 1MAAA 2AMJA 1B41A 5GJVC 3H9QA 1GG5A 4GX5A 4CEJA 3FCXA 4C0AC 4HY3A 2DFVA 3BA1A 4QTXA 3UHOA 6YASA 2FWJA 4JROA 3ZD7A 4BMSA 1SUPA 2DSTA 4HRVA 1QSLA 3DDOA 2G7MC 1OYVA 1RI2A 4UQLA 4NCKA 1TAQA 3JV7A 3DBRA 1GCOA 3C3AA 4Q1BA 1RCFA 4M49A 4Z9AA 7ICRA 1NXPA 3TECE 3LUGA 3STVA 1UMBA 2VJDA 3K30A 5I7OA 5TE9A 2IYUA 3R5TA 2DKZA 1VE9A 3EFOB 5CBPB 2OK8A 4MV7A 3OCXA 2BFWA 2B1JA 4L6AA 3RANA 3B1KA 4E5SA 4QUHA 3F53A 4BNHA 3D4PA 2OQ2A 3EGDA 2Q5IA 3NBKA 5BN5A 3F73A 3GFBA 3ZZ0A 2V58A 1FFWA 1VGRA 5BV0A 1XXHB 4FDAA 3UG6A 5JRJA 3VZQA 2FPIA 5CX1B 3T4XA 1U6JA 4E1VA 3I53A 1IE3A 3BM5A 3BWCA 3ON5A 4TVSA 1QHYA 2IGTA 3QWIA 4UXJA 4YONB 3L1HA 1D8TA 3GLSA 3PW4A 3N0XA 1A4UA 3LFUA 1NK0A 3HB0A 3S7ZA 3H11A 1OI7A 5LLTA 4A26A 5CA1A 4WRRA 4URWR 1XU4A 4G0XA 4B1FA 5ADHA 4M22A 2RHBA 3I58A 3BCSA 2FKNA 1RT9A 1FK8A 3DOUA 5HRCA 3KX2A 1ORDA 4JJZA 4GLBA 1XRQA 1NK8A 4PZCA 2WW8A 2I2CA 4PO1A 5TISU 2E37A 1ZQXA 1L7XA 3GIIA 5ED4A 4BRUA 1UBGA 1ZDMA 4RWEA 1LWOA 3TARA 4PSKA 3RCBA 4GZ3A 3KM0A 2PUFA 2Y1OA 3I6BA 5ALGA 3GVHA 3LUAA 1PZHA 2CJWA 4MP3A 1JX4A 2Q3EA 1GT6A 3OT4A 4AUNA 1G66A 1B16A 4JJ8A 5JIBA 1BCRA 1TO6A 5FBZA 3JAWA 5EWJB 4GMHA 4TUQA 1X3LA 5INTA 2Z9CA 3CZ5A 3HO6A 3RE1A 4PAMA 3EUWA 1UMDB 5JLJA 3DE2X 3QK7A 4GKVA 4D56A 4ETIA 4O4HA 4MDFA 4LC9A 3DL2A 3HZOA 1IQPA 2XX3A 5EIBD 2HN9A 2VK2A 3H0RB 1OLXA 2PS1A 1AGXA 3V4OA 1IN5A 4R2JA 2KLHA 4JBLA 1FP6A 3L4JA 2QTMA 3WWYA 5D3MA 2PGLA 4QREA 4UMEA 4AZTA 4RQ4A 3LPDA 3ZWPA 3B78A 4JMUA 2ZWIA 4WK0B 2E85A 4M9CA 1XRSB 2MSEB 1E1KA 4DO9A 3JQDA 1KRHA 3WV5A 4DOAA 4RK4A 1U2QA 1DAMA 4Y7CA 2QG6A 1KH3A 2ZYIA 1ZKMA 2VWPA 1GZ6A 2PLRA 2PS0A 2QX7A 1X94A 3UWKA 2ZM6B 3DKVA 5JADA 4X62B 4A0SA 4FW8A 4GRDA 4NAHA 1E7QA 3G0GA 5BQPA 4ER5A 4W5HA 4C7VA 4D4IA 2DB3A 2OGWA 5EIOA 1NOKA 1KLNA 2NW6A 2BI8A 1CQJA 3LKVA 2CV1A 4B33A 4M88A 5FOSA 1L5RA 3EBLA 2HQOA 1D8LA 1PJLA 3AP1A 4WA7A 1OC4A 1IIPA 1YI0A 3JVEA 5L3ZA 2QGFA 4K2AA 2PX0A 1JU4A 4I2VA 2JFHA 3KIPA 4QXRA 1US8B 1KEZA 3U3OA 4HLQB 5KVVA 1B8PA 4LFCB 3SSAA 4H18A 4F45A 3THYB 4LOHA 3BTSA 5L3SA 4BE9A 2FZCA 5F3RA 4FTWA 3UK0A 1OZGA 5KJCA 4TROA 1XTPA 5B12A 2XCRB 1M67A 2D4HA 3A1EA 1P7VA 3TGLA 5CB1A 3K70B 3NVAA 3A4TA 1AGYA 2YBEA 3MUNA 4RQAA 5F7ZA 4UBJA 1RKUA 2FSSA 3KYCA 1O8BA 1OXMA 1FA9A 4E21A 4U2DA 1TAUA 5IN4A 2OV2A 1WZ2A 5EFZA 4O4LB 4CI9A 4ECAA 1DC6A 3GYGA 4IOKA 2IXEA 2UYQA 2O1SA 4DM3A 3UWSA 5KSOA 1U7UA 1B26A 4HYEA 4D81A 2WD8A 4QEKA 3T7DA 3JSAA 1CJTC 1N34B