2HI0A

Crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
240
structure length
240
Chain Sequence
GMKYKAAIFDMDGTILDTSADLTSALNYAFEQTGHRHDFTVEDIKNFFGSGVVVAVTRALAYEAGSSRESLVAFGTKDEQIPEAVTQTEVNRVLEVFKPYYADHCQIKTGPFPGILDLMKNLRQKGVKLAVVSNKPNEAVQVLVEELFPGSFDFALGEKSGIRRKPAPDMTSECVKVLGVPRDKCVYIGDSEIDIQTARNSEMDEIAVNWGFRSVPFLQKHGATVIVDTAEKLEEAILGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative phosphoglycolate phosphatase
publication title Crystal structure of putative phosphoglycolate phosphatase (YP_619066.1) from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 at 1.51 A resolution
rcsb
source organism Lactobacillus delbrueckii
total genus 89
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hi0A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hi0A01
3WK6A 1CQZA 3WKBA 2R8ZA 1Z4NA 1QYIA 3QU4A 1U2SA 2G06A 4XE5A 2FPSA 5AKEA 3MMZA 3ZVMA 1Z4IA 2HHLA 3CNHA 3W5CA 5AW5A 2C9MA 1L6RA 5AKZA 2YJ3A 1ZRMA 3AR8A 4Y2UA 4F71A 1TJ3A 3MPOA 4J2TA 3RFUA 4UW9A 3NASA 4HGNA 2YFYA 5AVYA 3ESQA 2HF7A 4ZEVA 1TJ5A 3ESRA 1RC8A 1RDFA 2YJ6A 2PR7A 4QQFA 4HGPA 3UMCA 1EK2A 3MN1A 3ZTWA 2FUCA 2GMWA 4YCMA 3W5BA 2NO5A 4YGYA 3IJ5A 5AVVA 1L7OA 4Y2RA 3AR9A 2B8EA 5AVSA 5ALKA 4CE6A 2C88A 2G07A 5JJBA 4BEVA 2I34A 4HGQA 2WM8A 3OPXA 5AIAA 1XPJA 2I7DA 1U7OA 4KX3A 4UARA 4YIHA 4FFDA 1RQLA 3AR7A 5ALZA 3UM9A 2FPXA 3QUCA 2GO7A 5ALJA 3IRUA 3PGVA 2P69A 3AR6A 4DW8A 1Q92A 4UMDA 4BX0A 4BX2A 2W43A 3OCZA 3L0YA 3WKDA 3WKCA 5AK5A 1RLTA 3U13A 3AR4A 4DWOA 3SKYA 4EENA 3TLMA 3L0CA 5ALWA 5ALXA 4Y2XA 4KN8A 2NYVA 1WPGA 2WF9A 5AIBA 4Y2QA 1KYTA 1JUDA 5AKJA 5ALQA 1VJ5A 5A3QA 1LVHA 5ALVA 2R8YA 1AQ6A 4XQ0A 1RKVA 3W5DA 3FGOA 5AW7A 4MUMA 4AS3A 3NANA 4EX6A 1Z4PX 2HO4A 4NAVA 5ALTA 2Q4RA 3ZWDA 4Y2YA 2B1QA 5AI6A 3UMBA 2PKEA 3ZX4A 3DDHA 3FPBA 2RAVA 2O2XA 4UASA 5AVUA 3KDPA 2YJ5A 2AGVA 2JGAA 3U7EB 5AKIA 5IS2A 2YBDA 3WK7A 1ZD3A 3P96A 5AI8A 3U26A 1ZD2P 2C4NA 2AUTA 2B1RA 1RPZA 2R8EA 3WK5A 2YJ4A 3I76A 1ZJJA 5FP0A 3S6JA 1FEZA 2DQSA 1Z88A 3KC2A 3B9RA 1SU4A 4DFDA 3CZ4A 1VFPA 3N8GA 2W11A 4Y2TA 4CF4A 2OM6A 2WFAA 2AH5A 3NAMA 3B9BA 3SMVA 3WK9A 3I1YA 2IOFK 4HGOA 3ED5A 3U7HB 3IB6A 5AVXA 2W4MA 1QH9A 1L8OA 5AESA 5AM2A 5ALIA 1T5SA 2RARA 3R9KA 2Q4TA 3W5AA 5AK4A 2PQ0A 5AVTA 4ZEXA 5AW9A 5ALSA 1T5TA 2YMQA 3DV9A 5ALHA 2HI0A 2G1AA 2JARA 4YH1A 1Z4QA 2Q5EA 3ZI4A 3OCUA 5AVZA 1YJ5A 3L0BA 3L8FA 1Z5GA 5ALEA 2WF5A 4HAIA 1YMQA 1Z4JA 3A3YA 3FM9A 4BX3A 4MWOA 4OD0A 2WF7A 3SKXA 1ZRNA 3QUBA 4Y2PA 3BA6A 1NRWA 2WF6A 3UMGA 2GFHA 2MSNA 2RB5A 3L8GA 4G63A 1YV9A 4YCLA 3J7TA 3WK4A 3R4CA 2IA5A 4KX5A 2I55A 4QJBA 5AW6A 3EF0A 4OFZA 4BEWA 4IG4A 2R8XA 4BBJA 3ZTYA 1O08A 5IT4A 1SWVA 5ALDA 4UAVA 4OCZA 4C4RA 4RETA 3ET5A 1QQ7A 4PNHA 3VAYA 2OBBA 3AR3A 1NF2A 4XOUA 3M9LA 5ALPA 4EZEA 1RLMA 1ZOLA 5AM3A 1N9KA 3QNMA 3L1VA 3ZVNA 3EF1A 1EK1A 1J97A 2QLTA 4BYGA 2FEAA 5ALGA 4UU1A 2X4DA 2G09A 3WK8A 4EX7A 3WKEA 4KYTA 5AW4A 3A1DA 3NRJA 2OYCA 4UAUA 2HOQA 3L1UA 2OA0A 1J8DA 4IFTA 4AS2A 4BNDB 3WGUA 3AR5A 1YDFA 1Z5UA 4H1WA 5AKLA 3OCXA 4UMEA 1YS9A 1RQNA 5AW0A 3MC1A 2HX1A 3QLEA 1LTQA 3B8EA 3N07A 2YN4A 1RMQA 1Y8AA 5AW3A 5AW1A 1WR8A 4Y3UA 3OCVA 5AKKA 1U7PA 4I9FA 1ZD5A 1T9ZA 4CNQA 1YNSA 3E8MA 3FPSA 4CF3A 4EEKA 4XPZA 1XVIA 3ZWKA 1ZS9A 2G80A 3U7FB 1NNLA 3QGMA 2RBKA 4RESA 4BNDA 3SHQA 1Q91A 1L7NA 4OHFA 1QQ5A 2BDEA 5ALRA 1CR6A 2ZOSA 4CF5A 1WZCA 3SLRA 5ALOA 3QU5A 4Y2VA 3FVVA 3U7GA 2WHEA 3KOOA 5AK6A 4Y2SA 5IT0A 5ALYA 3KZXA 4L6CA 1TJ4A 4C4SA 5AVQA 2HSZA 3OCWA 2O9JA 5A3RA 3QUQA 2EAUA 3EWIA 4F72A 4YCNA 2CFRA 2YMLA 4AP9A 1TE2A 2G0AA 2I33A 3N1UA 4NWIA 2P27A 5AVRA 1XP5A 2HCFA 1ZD4A 3NIWA 5AI5A 2MU1A 2MU2A 4JB3A 4UATA 3N5KA 4C4TA 1RMYA 4UM7A 3OTQA 2IOFA 3PDWA 3KBBA 2FPWA 2QYHA 3GYGA 4UM5A 3QU9A 5AICA 1WVIA 3L5KA 2B0CA 3DAOA 4HYTA 2HDOA 4NFLA 4UMVA 3WGVA 2P9JA 4Y2JA 4UU0A 3I6BA 2B82A 2IOHA 4NV0A 1Z4MA 1U02A 1X42A 5ALUA 3E81A 5AHXA 5A3SA 2ZXEA 2YMPA 2YY6A 4L6AA 2G08A 4O8CA 3BWVA 3L7YA 3PCTA 5AKGA 2FUEA 1PW5A 3N28A 3OCYA 3AR2A 3D6JA 3WKAA 3A1CA 2ZG6A 2B8JA 2JAOA 4DCCA 1F5SA 3EPRA 3F9RA 3ET4A 2GHTA 1QQ6A 3QX7A 2C8KA 1U2TA 2C8LA 5AW2A 4GIBA 4FYPA 3K1ZA 1RRCA 1MH9A 1Z4OA 5ALMA 2IYEA 2NO4A 1Z4LA 2CN1A 3QUTA 5ALLA 3HLTA 2ODAA 1RKUA 5AKYA 3ZW7A 3QXGA 3SF0A 2JAUA 1L7PA 2ZBDA 2YMMA 3ZUPA 4UMFA 5AM0A 4KNVA 1TA0A 4JDPA 2B30A 2HF2A 1S8OA 1VJRA 4E88A 1RLOA 2BDUA 5AI4A 4HGRA 2FI1A 4B6JA 2D2VA 3SD7A 5T41A 3NALA 4I9GA 2AMYA 2ZBFA 3ZU6A 2BY4A 1L8LA 2EARA 3E84A 5AI9A 4EELA 3U19A 2I54A 4G9BA 2FDRA 2WF8A 1SWWA 3QU7A 1N8NA 2P11A 1S2OA 5AK3A 3ZX5A 4L57A 3I28A 5AW8A 5ALFA 2HEGA 5AKHA 3PGLA 2EATA 4J03A 5AKXA 3L8EA 2JAWA 4GXTA 5AM5A 5E0OA 3ONNA 4ZEWA 2ZBEA 5ALNA 2FPUA 5AI0A 4NABA 5AM1A 1O03A 4BKMA 1L7MA 4KNWA 1RKQA 1K1EA 2VKQA 3QU2A 5AVWA 2I6XA 5AM4A 2CFTA 3KD3A 2CFSA 2ZBGA 1RMTA 3R09A 3QYPA 1Z4KA 3HYCA 3DNPA 4YIKA 3NUQA 3E58A 3RF6A 3M1YA 2FPRA 3FZQA 3L8HA 2GHQA 1IWOA 3A1EA 3ZVLA 4FE3A
chains in the Genus database with same CATH superfamily
2FF7A 3TL6A 3A14A 4Z6DA 5EJFA 3D0OA 3UVEA 5LUAA 1QZUA 5IDQA 3KR1A 3OPQA 1L3UA 7ICFA 2QG4A 3E1KA 4JLNA 2CCJA 1T4BA 3ANMA 5JZBA 1EWVA 2GZ1A 4C8NA 1AMUA 2CLDX 4G37A 2OGSA 1XMSA 3EWAA 1NVKA 4TMFA 2CUTA 2P6OA 2A57A 1JLLA 2JGEA 1C29B 1IZYA 1PK3A 4TT3D 2BGNA 3H9GA 3X1JA 1E3IA 3KTAB 2PG3A 2IY9A 1OVGA 3OE5A 3IEPA 2RJNA 5TIIA 1TD1A 4UFPA 1Y9JA 1PT9A 3U7IA 1ISIA 4BB5A 2CJPA 1CEQA 4N9QA 5B53A 5A06A 3WKDA 5C5DA 3O3NB 3D3WB 5M04A 5KTQA 4QNNA 1RWKA 1KPHA 4MYTA 1N62A 1A2BA 1WPGA 1KTQA 2WJ6A 2C2DA 3W5DA 5HHHA 1NY6A 2ZPAA 4R83A 4JLJA 1YU6A 4MKHA 3IQIX 4CQJA 3MJVA 4LSGA 2IPLA 1RWVA 2Q5JA 2ZSKA 1Q1ZA 4QTZA 5CDFA 2XOXA 4B79A 5KCMA 1B0ZA 1YDMA 4EJ0A 2OY0A 2JLWA 3PNQA 3DL0A 4B3FX 2QZJA 2MTBA 1PZGA 4DA8A 5F12A 2BKXA 1ZGAA 2FN8A 1AC5A 4AKGA 1PFKA 1QH9A 3STWA 3FXAA 3BSWA 4YJDA 1PK9A 2PZKA 1KEJA 1DEAA 4LHZA 4XSVA 4DLLA 5FEUA 1B6SA 3EQ7A 5EPEA 2GF0A 5E6UA 5E2IA 1NPTO 4HF7A 2ZSFA 3AVXA 1SURA 4FYVA 3UJ9A 4KREA 2NUPA 2AYXA 2BCVA 4GZMA 1Z5OA 4RVCA 3I45A 2W6NA 1G8KA 3HC7A 3PXEA 1RJFA 3ESXA 4RSRA 3TVTA 2AFRA 4IDQA 5ALGA 1KYYA 4UU1A 4YMTA 3TOSA 3E27A 4KQHA 2C2EA 4UEQA 1VSUA 4JI4B 3HM2A 2A1JA 1HLFA 3T9CA 4R2LA 2GTIA 5K0GA 3D7KA 2GM9A 1Z8NA 2WMNB 1H3FA 2QAGB 1KP2A 1OGJA 2PAFA 3PITA 4UBOA 2ISOA 1TK2A 3DC7A 4KYVA 1D0SA 4C0JA 3T5JA 1K5HA 1B74A 2BSAA 4C0LA 2H9YA 1O4WA 1M34A 3KKKA 4QTTB 1MQ2A 2O8NA 3NW9A 1DIAA 3H1EA 5JD6A 3CZ5A 4C8MA 4DABA 1E5XA 3H13A 4QUAA 3ZBQA 1E3WA 5J2DA 4KIFA 4IVNA 4BJHB 4LRQA 4QHSA 3MGCA 3HRDD 1SVOA 3OZBA 4C7KA 1CRPA 4YP0A 1O96B 2DG2A 3T7KA 1KSGA 1L5NA 1XG5A 4DMMA 5HG0A 2RDIA 5GTIU 4CU5A 2YMPA 2E5FA 2CLKB 2E82A 3GJ7A 3NHKA 3I73A 4UEOA 3UG7A 1MO3A 3RB4A 1RI3A 4H18A 4FR2A 3GUVA 8ICXA 2AU0A 1N6PA 4RLHA 2IU3A 4ESHA 2G77B 2WPNA 1DGSA 4CLRB 4GDFA 1XTSA 2CK3A 2VAPA 2PBZA 1XZFA 5UKDA 5AKHA 2VJCA 2DTXA 4MLPA 2M98A 3URKA 3K4HA 4GSYA 1RKQA 2HCBA 1U3CA 4FBLA 2FEOA 5I9SA 4OL9A 3E3NA 1THTA 1TMGE 4URVR 1YIOA 3KV3O 1F0MA 4ZZ0A 4OB8A 2HNKA 3OIUA 4FEAA 3FZYA 1EWYA 3OIWA 4A8JC 5JBQA 1M66A 1LV7A 2W9AA 3ZH9B 1QYRA 2H1VA 4YAOA 3GFKB 4CM5A 2K4PA 1EAMA 4LZLA 4Z4HA 1CUZA 1JMKC 3MWYW 1IUKA 2O06A 3ZWYA 4B44A 1AQLA 3HB5X 3ZHOA 4JC0A 2VT2A 2ST1A 4IWXA 1QPGA 4U7JA 3INNA 4TTPA 2UYGA 1BMTA 3EXEB 4P4GA 1TVCA 3IAFA 1EPUA 2GRJA 3K70D 1MRNA 1GNSA 4DIOA 1SH7A 4GSKA 1COWD 2FLWA 4NV1A 6YASA 3FCSB 3PNCA 3ZY3A 2UU9B 4XFJA 3AIOA 3FW1A 3FNFA 3SICE 5JIBA 2Y67A 1XD9A 1XKLA 4M9JA 3LS2A 4XYLA 4MW5A 4D92A 1E62A 4LJ9A 5IWCA 4ZTBA 5ISMA 5KFRA 4OB6A 4RIEA 1N8SA 4Z0TA 1KP3A 2QRGA 3DDHA 5KG0A 4PINA 3I8OA 1WP4A 2JD1A 3RS5A 1VJCA 1ZWKA 3TOZA 1V5WA 4DCJA 1YBVA 3H99A 5FPKA 3G7SA 2B1RA 4NJEB 4X6XA 4DVJA 5HKBA 3I6QA 3TRHA 4FONA 3ED5A 2GK7A 4O1MA 4Z49A 4ZHQF 4CL2A 1P1IA 3AL3A 1PL7A 2C7GA 4AUMA 4R8UB 5CRIA 3UF0A 3ZEIA 2AQIA 4ND6A 3I04M 3OSZA 2W6CX 3MHTA 1U3TA 2V4QA 4N6GA 1N5XA 5I47A 1XPUA 1S2IA 1ZXXA 4NXZA 4WCFC 4YYEA 3PEVA 3OJLA 1QHYA 4OHMA 4P8RA 4UE2A 3QH4A 2ZI5A 3NEPX 1EHCA 2GRUA 3H1TA 5TXGA 1UA1A 3BS5A 3LPDA 5J2BA 2O2SA 4F6RB 1QP7A 1S9FA 4AURA 1CS0B 3WO0A 5BMVA 3UGTA 4YFKA 3A1VA 1WMFA 3AVUA 1NXVA 2ODBA 3WHLA 2R4TA 2ECKA 4Y2GA 5JXGA 1M2FA 2FZGA 2DGDA 4ECYA 3KOXA 4UPDA 1T2DA 4BAUA 1GAJA 3T3PB 2AFHB 1R5OA 1FFUA 5L1KA 1WUDA 2WB1C 2C00A 2OHOA 4OXQA 4YJ2B 3TJMA 3UMMA 3AM9A 5LWHA 3EE6A 3RAJA 3P9ZA 4CUJA 1OFVA 3SHQA 4DL4A 1E2FA 1Q6ZA 4HQKA 3TIIA 5K4GA 1V3TA 1Y33E 4TYPA 2WHEA 3SYMA 2VPIA 1PSZA 1JR6A 3AUKA 5CFQA 2CFRA 2WUDA 2VHEA 2JFBA 1A2QA 3B1XA 1KQOA 3E7PA 2W6JD 3CCBA 3TSAA 5FOTA 2BPCA 3EIFA 5IJWA 4RL6A 2QYSA 1W5SA 1EQUA 3QWIA 1BTOA 3VU3A 1HE3A 3I9FA 3ZV3A 2JAOA 5BORA 3BAZA 2QX9A 5CVVA 3K4QA 1BKSB 3C6MA 2KM1A 2IYEA 5IEJA 4HAWA 4QYIB 3H5RA 5ESDA 1OH7A 4AJJA 1MEEA 1G8AA 5LYYA 3I61A 4CQLB 1HNNA 5YASA 2P4QA 3SJ7A 4MWDA 5AI4A 1NK5A 5F51A 1K2WA 3SS8A 2E18A 1X6IA 3E84A 1FYVA 5DULA 3ECCA 3IUNA 2R5WA 1CRZA 1UHUA 2XQKA 2IYPA 2FWRA 2BPOA 3LYHA 2JD2A 4UNQA 4RWEA 4WI1A 4QJFB 4N4AA 1N9GB 5KTYA 1CQPA 1JIXA 3CLRC 5J2KA 5ELXA 4RV4A 3OQ1A 1L5RA 3AWIA 4JP1A 2PSJA 3NUQA 1CG6A 4J0DA 5J0OA 2X1HA 5EE5B 1YFZA 4M9QA 1WUTA 3QLVC 3CVOA 5AW5A 3RHFA 4UVHA 1G20E 1T35A 3JW8A 3PSFA 1ULUA 3ZIAD 8ICLA 5CXSA 1ZD8A 1VKRA 1CFJA 2ZI7A 5K51A 3FF4A 1RKXA 5L3VA 1YQTA 4REQA 5HKKA 2CMFA 3D4IA 4LNUA 3H04A 5F9LA 3WGJA 1N36B 3H4TA 5CFRA 4OO1J 4C5CA 4TUYA 4ES6A 5DI3B 4IRUB 3NIDB 3EVCA 4DF3A 3UK7A 3EZ7A 1RHQA 1ESNA 3MCTA 1XHLA 4KYIB 4CODB 1ZYQA 3ZNNA 2ZYDA 4XLZA 4OAOA 1IRXA 3EDOA 3ANLA 1QF9A 1Z63A 3I9V1 1A4RA 1NW9B 2OKCA 3PX0A 2ZXUA 1FJXA 2XMQA 1M6WA 5T64A 4J9KA 1YFLA 1N5KA 3CNBA 5IEBA 3EGWA 3ZJ4A 1ZN9A 2LDXA 2VAWA 4QPJC 5CEHA 3RYIA 1O2DA 1UOPA 4GS5A 5HFJA 2JIPA 4G4JA 2JW5A 4YJ2F 1T6NA 5MF6A 3F8SA 3MMPA 4C88A 4GL4A 3WLRA 2YN2A 2PUAA 3IVGA 3W9SA 1Y8ZA 1QRAA 5EC8A 3O7MA 3QTLA 5BVHA 2YTUA 4QODA 1F51E 5AUPB 3PCXA 3I9JA 4R84A 2JLVA 3LYAA 1ID1A 4LHSA 1O77A 4EEXA 1AGNA 5KQPA 3GW8A 3T3NA 3TLBA 1W8DA 4M0DA 3UHAA 1AS3A 1V47A 5KFEA 3VR5D 1JHYA 3BK2A 3J81j 2FTKE 4M4SA 4DQUA 4ZRMA 1R9JA 2UYOA 3G5TA 4IOJA 1E94E 2PUBA 2HLNA 1XRRA 1V8OA 3T3GA 3QEJA 1T8RA 3PHHA 5TE9A 1UWKA 3MBOA 2WYUA 4MHVA 4UCQA 2WIKA 4O2RA 1NGSA 2V58A 1HEKA 5F64A 2H3FA 4GE0A 2JI6A 1EESA 5IINA 2EL7A 1BRMA 3D81A 1PTJC 2WIBA 4MWZA 4JWMA 2RHFA 4BNDB 2JLXA 3RIXA 1W93A 2GD6A 3I72A 4UMEA 2PXCA 1QIJA 1L4MA 4INJA 5JNLA 4B17A 1IVYA 3SE0A 2H16A 3FB1A 3FMOB 2UZIR 3CPJB 4Y3UA 3KWJA 4I4TB 5KQLA 3UWPA 3EFOA 1WUKS 2MHCA 1TZBA 1HC7A 2QXYA 4HZUA 4TKVA 4C03A 1OBFO 5JISA 2R751 4WHMA 4QFMA 4CQMB 1Y37A 5KG3A 4GKKB 4BQQA 4XKJA 4AJHA 2A86A 1N7HA 5TGZA 4P80A 3O3CA 3JQBA 3H75A 2CNWA 3LLCA 2HHAA 1WCIB 2LHTA 1AUOA 2P27A 3HCOA 4ER3A 3UIEA 4XEHA 2DFNA 1Y1SA 1EVJA 4HO1X 2QYHA 3REGA 4DO9A 2XJ9A 3OJ0A 2O3RA 1I4TD 1K08A 5DV9A 3GRUA 3TQRA 4V38A 3RG2A 2ADMA 3T34A 2V1XA 3OCYA 1BEEA 2O0MA 5J0UA 4CDNA 5BRNA 2ZSJA 1U3WA 1Q1GA 3DAPA 4P31A 1XI2A 3PSAA 2HUPA 1TKDA 2WAAA 4L9AA 4C89A 1GPWB 2O2YA 3CNEA 1FTGA 1MH1A 1ZEMA 1KJNA 1JL3A 2E0IA 5JOQA 3PU6A 4I5DA 4UE6A 2OZPA 3V7UA 1PI3A 1OH5A 4WLOA 1Y9AA 5BSEA 3N87A 1Y0BA 3I5XA 5DLGA 4NHEA 4AJLA 1SQSA 2FRXA 4KACA 4NU0A 5CT4A 3RUCA 2YXPX 5AFSA 1ESMA 4B7XA 1ZHHA 2BFMA 1DOAA 5BWCA 2W7OA 2UAGA 3BXFA 4CUZA 1ZPDA 5BSFA 2EQAA 4ZOLA 2J59A 3VDXA 1JPJA 3MTGA 1US8A 4ALIA 4IPTA 2FW6A 2AX4A 3I30X 5KJ6A 3WR5A 1JH8A 5JFTA 5GZ3A 4BKPA 1ULSA 2FW7A 3AW8A 3QPBA 1FLNA 1VMEA 4W9RA 3ESRA 2EZYA 2GWHA 1P72A 3OOSA 4R9UC 2F1JA 1JHZA 3ZZ1A 3BN3A 4EATA 1I2MA 4HGQA 4J0HA 2XB9A 2DQ4A 4M1MA 4XFKA 1U0RA 4PHAA 1ZJZA 4HN2A 3GZ4A 3LBAA 3CVXA 1V6SA 2ZPUA 2QNIA 4MYSA 2V6BA 4HS4A 3AG5A 1Y3FE 5KYXA 3KYBA 5HMMA 2ZYSA 1XRLA 2EDCA 3DQPA 3T95A 1ZQTA 2WK1A 2YVKA 3DO6A 3DVRX 1P1BA 3B6MA 5D46A 3FOWA 3E3AA 1DQPA 4O3SA 4URFA 4I4TF 4NXMB 5BW6B 3VNSA 5K9ZA 3RHZA 2PGIA 4WK0B 5B1SA 1AKTA 2ZB3A 5F1KA 1XO0A 4US1R 2YJ4A 3SQWA 2EFYA 4IUCS 2F3RA 5EZSA 2IE0A 1H8ED 4QU0A 2ZTLA 2OWEA 4C6TB 3WK9A 4C2TA 3KPYA 3DZBA 3RF9A 1FYDA 1X7ZB 3RAGA 4J1NA 2JCXA 4L8YA 1EIWA 1SCKA 2B9VA 3KLPX 5ITSA 2VYFA 1LLFA 4ZAYA 1RWXA 2J5KA 2O1SA 3H5TA 3SBEA 3Q15C 2Z2ZA 2IP1A 3F8TA 2ZRLA 4ZDIA 1Q0TA 1PL6A 3L0IB 2ICAA 2NU9A 3U81A 3GD7A 2SHKA 3EZLA 3L40A 1U3GA 3LUPA 4ZCLA 1FVHA 3FPKA 3FKSA 4IH4A 5ITWA 1PFGA 3F4BA 1DRVA 3RFCA 5DSZA 5CNIA 1OXSC 2XCTB 4TWBA 2VK8A 4M53A 3AFHA 3LO8A 4EVSA 4DLXA 3FYDA 1SRRA 1YQDA 1PR6A 1A0OA 2R44A 3FSEA 2KVSA 3INGA 3RAFC 2H00A 3QMPA 3RJ5A 4Q00A 1T6XA 1TMYA 3GAZA 1YS9A 3E1SA 1LTQA 3E18A 2PGLA 2RHLA 2PL5A 4E7PA 4KGDA 5IJAA 3LUCA 1OU0A 1DELA 1SZCA 1QMGA 2AI2A 4EPWA 4LWQA 4UOQA 2DB3A 5L6MB 3HILA 7ICUA 3OUUA 4KDEA 1KRHA 3CGGA 1BCRB 1PGQA 3MMSA 2Y9MB 1KKUA 2AG8A 3T94A 4MW2A 3HWWA 1LTHR 3V8PA 3IAUA 2VEOA 4MYRA 4QHYA 1QYXA 3E4DA 2TSYB 3K20A 1PJBA 3TGLA 3MQFA 4R1UA 4DIKA 5DDMA 1JHUA 4RJLA 4JJ4A 2FQYA 2IHVA 4D8XA 2QLMA 3G0CA 1YMVA 2XWBF 3ZCPA 5EZ6B 3OAAA 5DLFA 4CDRA 1VGVA 4GPIB 4H16A 4V0MA 3K0KA 2HF9A 2W6ZA 2JBAA 1QYVA 3VH4A 2CNOA 3ET4A 4JT9A 4LOLA 2KN7A 4WQMA 3CM0A 3L77A 2RHMA 2CV2A 4OI0A 1LNQA 5C2JB 4CGYA 1W46A 1D09A 1GAQA 5KDDA 4ICAA 5DG9A 4MFCA 2ID7A 4G01B 1QJCA 3BMOA 4OQDA 2D62A 1RXCA 4EI8A 3RVDA 4BO4A 2F44A 4OEHA 1XAJA 1KQNA 2XMZA 5KYUB 4OJTA 4U6NA 4EYEA 1PDOA 1YAHA 2G83A 2NU6A 3H0KA 4KNWA 4HK4A 4NAUA 3STUA 3JPTA 3E23A 3Q2IA 4BQIA 1V8PA 4Y9DA 3M1YA 1ODTC 4BL5A 1OCEA 1U3UA 5LC1A 3GY0A 1NBMA 2FPKA 3REFA 2FPSA 4IUYA 4ZVOA 4MVJG 2AYYA 3I5UA 3ZS8A 4EOGA 3SZOA 2IYVA 5E4JA 3HK2A 3E2EA 1YIDA 1Z7EA 3TLCA 4BLRA 1KDOA 1H0RA 3I1FA 3CXUA 2LBOA 2A7QA 1CWUA 1C7QA 2BGLA 4NBTA 3DKIA 1K4YA 2RH4A 3NH9A 1WEHA 4G5XA 4NMXB 3WLIA 4R1PA 4AJPA 3UJ7A 3F3KA 1BJKA 1JH9A 1QRSA 5FI3A 5KEIA 4JQSA 4DC1A 2O2HA 3PQ4A 4BMOB 2WWXA 4E30A 3PZBA 1B14A 3BMQB 4M60A 1V7PC 1H05A 3S55A 1YCFA 5TDHA 1XROA 1ODLA 4IDDA 4C4OA 4R66A 1NAHA 1GTVA 2VPQA 1NKBA 3OLQA 3PFBA 4BJQA 2WJZB 4DCMA 1IL0A 4J2OA 1NV8A 1BH6A 2M1ZA 4DRYA 2EP7A 5AKIA 3FRHA 4R2XA 1E1RA 2QVYX 4NVRA 1A69A 4BLQA 2DHQA 3P2OA 2ZE7A 4ISCA 2A59A 2WOJA 3QE2A 4FPXA 2UVPB 4Z86A 3CJRA 4J49A 4R0VA 3K0FB 1W8IA 5KX5B 1TU3A 1ZJYA 4RH0A 4MEAA 4XVHA 3VISA 1ANKA 1RXVA 3L06A 5HFNA 3RM3A 1GKUB 4PZZA 4II7A 3NFYA 3MWKA 1OGIA 3WRXC 3SXJA 1H9CA 5KOYA 3RYFB 1OLUB 2KE7A 2JDIA 4E11A 3NC4A 5I3ZA 4GU5A 3BHJA 5CVCA 8ICCA 3QPCA 2ZRNA 5BURA 1JAIA 1QZ3A 4V24A 3D8RA 3RS3A 1E2EA 2ZSIA 3UJPA 1SOWA 4TQAA 3ICWA 3D6HA 5MN5A 4S1VA 4II2A 2BTQA 2C2BA 1HK7A 1WXHA 4KFUA 1NKCA 4CCSA 3LDHA 3C85A 2O6LA 1M75A 3HDGA 1U4BA 3BILA 2Y66A 2AIRA 4LJLA 2N3ZA 2XXAB 2ZIZA 1JFTA 3VFDA 2WSYB 1PGNA 2QDXA 4QZEA 1UC5B 2PVPA 1C80A 5I8ZA 3VC2A 3MT0A 4TWJA 1ZXIA 2VNSA 3FHCB 1IM8A 4U9IS 4ZP1A 4JC5A 5A5DA 1P17A 4J9PA 3ELBA 4Q9NA 3W9BA 3FFXA 4JP8A 3GZNB 1RTTA 2IXTA 2WU4A 3G88A 5LQNA 1XNRB 3ZU2A 1LDGA 2D7JA 2J3IA 4B48A 1GG5A 5LDGA 3L04A 1JBEA 3GRKA 4BNFA 3M5WA 2PEZA 4XJXA 4Q21A 4L15A 3DZFA 4QGFA 1WDTA 2MAXA 4ZYLA 3PQDA 3RREA 1XMIA 1GYPA 3EB9A 1EG2A 5CA0A 3VAAA 5KFXA 1QFXA 3KWMA 3GELA 4EK9A 4J4TA 1II0A 3S40A 1I4WA 1JVBA 5KYWB 2ZIWA 4Z9XA 4YS6A 5CFLA 5LCXA 1R0RE 2R1ZA 1DGJA 4LK2A 3H9UA 2OE2A 2GDZA 1TZCA 1GTG1 1E92A 2PMEA 4GWGA 2RGAA 5EWGA 2I54A 1CF2O 3RUDA 4J4HA 2BFNA 5KO2A 3FVQA 4J0JA 1WEKA 3TM5A 5KSPA 2NTYC 2PD3A 4IGKA 1DAEA 4DLZA 4GXTA 4UB8U 1A5TA 1P7WA 2RHTA 2DSTA 5KL1B 1KVTA 3C14C 4GI2A 4PQRA 2WB1F 5DWDA 1QUEA 1GKKA 1ZQWA 3WNQA 1JV2B 3QJ5A 3G2JA 2R7AA 1W4RA 2FN9A 4CCHA 3N53A 1MDBA 1YF3A 5A5EA 2QUKA 4FE3A 3ZD7A 1E6MA 3F1KA 3OURA 1X3LA 4ODIA 2J9FA 4KIUA 5KX5F 2ZP1A 3UEOA 3A28A 2E5SA 4M22A 2YFYA 4HEA1 1XRSB 1XWLA 3A6HA 1KFBB 1UAGA 2HWXA 5EY5B 4YAUA 2FUCA 1LLCA 3RR2A 2O2GA 4MW1A 2NU7B 5EIAA 5AVSA 2R1TB 3W1WA 4TM8A 1E7WA 2ZAYA 1ID8A 3HZHA 1UDXA 3WAKA 7ICIA 5F3RA 2IYSA 4DIFA 4DR1B 3WFJA 1N8TA 1EA7A 3QF4A 4CYMA 1YZTA 1EEXB 4FU0A 1ZH4A 5KKNB 3ICQB 3AU2A 1PWZA 3FMVA 3EQ9A 2VHYA 4FI3C 4I0WB 3ZLTA 1SQ5A 3V4RA 5I6DA 2F1IA 4KO8A 2R68A 1GPLA 4IP0A 1VIDA 4LWPA 3OJSA 1ACJA 5B3JC 2PX8A 2H2HA 4BMZA 1CS4C 2LI6A 5CR0A 3MAAC 1DC4A 2H1CA 2AR7A 1LQUA 1NK4A 3I76A 2IH5A 2J0SA 3S2GA 4IHJB 4WADA 3FE2A 3PFGA 4NZNA 1Y7PA 2E6KA 3TNYA 4U6SA 1QTNA 2G8LA 4MVJH 2HK8A 4BDSA 4ZMSA 1CP3A 1DADA 1SUSA 4I2NA 4LF8B 3WWZA 5J8YC 2XYPA 2GLXA 1XZLA 5CA7A 1A98A 1I2DA 3H5VA 4MVJA 3BRWD 4WZAE 1JIJA 3WHKA 2E8NA 1ZQGA 2J6HA 3NT5A 1GAXA 1HFJA 1ZQCA 3NRWA 5SY9A 4W1QA 1DAGA 3I4LA 2Q27A 4RZXA 3V4LA 1IAQA 5KNCD 1L8XA 3L02A 5C46F 3VC3A 1R10A 4J91A 4M8LA 5J2IA 5IDXA 5DTQA 2QM0A 5LM3A 3HU3A 3ZHBA 3ISJA 1H9AA 1EP9A 3WX0A 4LJXA 3U09A 3NQ41 4LQDA 1YH3A 3TRJA 1P80A 2ATIA 4TZ0A 4P9NA 1B3BA 1B15A 3RVBA 3I6IA 2BKEA 1H2FA 1RD4A 1KEVA 1SY7A 1TO6A 3GNTA 3II6X 4BQNA 2HZ7A 4H31A 1KR2A 3VNAA 3G8BA 4BVBA 3LHFA 2C42A 4PCAA 3TZBA 4Y2SA 1N0HA 4BMPB 3H9EO 3RT9A 1X38A 3M7IA 4FYJA 3ORQA 1P5RA 5D84A 3USZA 2OFFA 4YRKA 2NIPA 1TX4B 4KV7A 3FA2A 4UMVA 2GZ3A 1R0ZA 2GVNA 1X94A 2VXYA 5FUYA 4DR6B 1BNPA 4I6GA 3AI2A 1H6DA 4WOPA 2BRUA 3VGJA 2GI4A 2HBKA 4LJ7A 5B1IA 3V72A 4US9A 1D03A 5JYEA 5BW8A 4PZPA 2W22A 2P9FA 3EW9A 5DHTA 3A9CA 3TI7A 2ZBFA 1C7RA 1X8KA 3WB9A 1RI1A 2PLFA 4X7MA 1RC0A 3DUFA 5JROA 3HCRA 2E48A 3I34X 4DBVO 4QEKA 3PGLA 4EGAA 3EFEA 4IYRA 2GLEA 5IUNC 1UK7A 1D0VA 1PJZA 1S3SA 2JBHA 4F3YA 2OCGA 4FMCB 2PY6A 1U3FA 2H2IA 4XQCA 3INYA 5LQMA 4OX9B 3WIDA 1VPEA 3A1EA 3V4SA 1PS0A 5HWSA 4EYSA 1O6GA 5A1JA 4OREX 1QIKA 1F2TB 3MUEA 3WL4A 2C5AA 4ND5A 3THWB 3NH6A 4TMZA 4QIWF 3HBJA 3NO4A 1M7HA 3BF8A 3C1YA 5KFHA 3PNLA 3EGXA 1JU9A 4EHHA 2GYWA 3VDQA 1I6MA 2ZBPA 4FGWA 4R01A 4MEJA 4UDYX 2JK0A 3KELA 5LXTB 2PCJA 1V25A 1AMNA 2WNSA 3BIXA 4PG4A 1KI8A 4H7PA 1U8CB 4R40A 5KPDA 2OCYC 2WPDD 1U8YA 4X00A 2FJ6A 4ND7A 2JA1A 2QWXA 1OFUX 1G20B 4LJSA 3ITNA 4BY9E 3AB7A 3SJUA 1P8JA 3KSRA 2BCUA 2W9CB 2EG5A 1KK1A 3ITDA 4AMZA 3IQHX 2AOTB 3M89A 3A7DA 3V55A 3ZE2B 2J6SA 3NBXX 3COSA 1UODA 4G4IA 1R4MA 2ABWA 4WFIA 3AVOA 3PFIA 4DL7A 3FVTA 3B51X 3FHLA 1A88A 1SVSA 4J1QA 5K8UA 4TQ9A 2JLSA 4RJIA 2X1LA 3ZYCA 4QUHA 4KQWA 1N77A 3DZKA 1CUHA 1T5IA 4YPVA 4EG7A 4DG5A 1NVVQ 4M49A 3ROTA 4LQLA 4K1XA 4DQKA 2AQKA 3JQAB 1D3AA 5AESA 2VH1A 2JEJA 3WRWA 3V6MA 2XB6A 3HEAA 1ZUNA 3LXUX 1ZITA 2VXBA 5KBYA 2VXCA 1T5HX 2F77X 2BFBA 4I1IA 3ZWQA 4DDKA 3PNSA 1FOEB 3LBFA 1TQDA 4I8XA 2XQIA 3DPSA 1NRWA 3H4IA 2J5RA 4QPZA 1XWFA 3UZUA 3HJAA 4ABYA 2FSHA 2DT5A 4A26A 2HVHA 4TVSA 2CF6A 3QELA 5F33A 4RETA 2UUPA 3EODA 2DBQA 2DF4B 4XM0A 1YBHA 2EANA 121PA 4F2HA 3GN1A 3H11B 1NQWA 3G13A 3QNMA 2FLPA 3OGUA 3N2ZB 2BMAA 4KR0A 5AVJA 1W6UA 1JJVA 1Y9EA 2BGIA 4EF4A 4N1AA 3BJRA 1HKUA 1EFVB 1B6GA 2CBZA 2VJMA 1CUKA 1MNAA 5CTAA 5C9ZA 4ZRNA 3RDPA 1XTTA 4GUDA 4EI7A 2FWMX 5HBGA 1JEQA 3V8RA 2WB2A 2G17A 1NLZA 4OB7A 4DJFC 5C80A 4ZI5A 3BRCA 2R7MA 4YEDA 5BOMA 4YLGA 3PYXA 3VA7A 3M1LA 1QO0A 4UQLA 1Q46A 2A88A 1GD1O 2CFOA 3EXHA 5DX0A 4AN0A 3TLJA 1CB0A 5L7TA 1J25A 4AP9A 4KO4S 2RGNC 3JSXA 4MS3A 3BM5A 5EERA 2C9YA 3ORFA 2C29D 2PWZA 3KBBA 1Q15A 2XI4A 2ZJ5A 3K72B 5DLYA 4YB8A 2XHEA 4DSUA 2F3SA 1K8XB 1MCZA 1UKYA 4L6AA 2A9KA 1DEXA 5LXTF 2PU7A 3M6ZA 4OGKA 1C8LA 2P5SA 1GQFA 2O0KA 5LBUA 3J81A 2EFEB 3HVJA 3GJYA 2GFIA 3DHWC 5F7JA 3VOBA 3UAGA 4IQ4A 2W42A 1SPXA 2Y1WA 2W6OA 1ZQZA 2PPVA 5PNTA 4H6PA 2EV9A 2BEWB 1TD9A 4EYKA 1IHYA 4JROA 5FOUA 3RWOA 4TKZA 3HO6A 1GRRA 5CGQB 3Q3GE 2HR1A 4C0SA 4EITA 4AZWA 5AK3A 2Z8ZA 1PQWA 4EA9A 1L4UA 3P9QA 1MQ3A 5LMCA 3E53A 2ONJA 1KIAA 2V0GA 5BV1A 4BMXA 3OOEA 4XVUA 1ZQEA 2FPUA 1LUAA 3H2SA 5DBGA 1O03A 2Q6OA 3UJBA 1DV2A 3QY0A 3L3BA 3MG9A 3QU2A 2V7VA 4MP6A 3V1UA 4DLPA 3CB2A 1MNQA 3UBTA 5F1YA 2IZ6A 5CXQA 3F5FA 1U7WA 4MYDA 1TQ2A 1IWOA 3AK4A 3NIGB 4JJIA 3RR8A 3IKJA 2BF7A 3KHGA 4C7VA 4DF8A 1VP3A 4F1JA 3MWDB 3MIIA 3RFTA 2QRVB 1KRWA 3KYCA 3LX4A 1AZTA 1IPHA 3AI1A 2GT1A 3M6IA 5KIAA 1DUSA 1M33A 4EVRA 4GM4A 4U2KA 2E7ZA 2C4TA 2I7XA 1QVAA 3PY8A 2XBLA 5FBZA 4DDUA 2JHFA 4QZCA 4XD7D 1NZFA 1BQEA 2Q2WA 4YUYA 3RB0A 4DFKA 2ZB2A 5DEOA 3O4FA 2XE8A 3UCEA 4HDRA 2WA2A 1JNYA 3C3EA 1TZKA 5DTMA 4E21A 2BCQA 5DLPA 4Y67A 1M2VB 1NA5A 1IWBB 2QZ9A 2BH9A 4CM8B 3VR1A 5KQRA 4FDTA 4DCTA 2Z8YM 5B4TA 5B37A 2Z3ZA 2W83A 3OFKA 4JGGA 3UXPA 4F9EA 2PFPA 1JR3D 3ZWCA 4C4PA 1T3GA 2GQ0A 3VR2D 4LJKA 2YWDA 1F8UA 4Q7KA 3KDPA 2ILVA 2A1TS 2IA6A 1LBEA 3ZK8A 4C1BA 2EKBA 3F47A 2VQDA 2EWMA 3LKVA 4PYQA 3TRFA 1HLDA 2ZUWA 3K2QA 8ICJA 1EYZA 2VT7A 1A8IA 3I3SR 5L1LA 1E63A 4EDHA 3O93A 1DK3A 3AETA 4YVFA 4ZHQB 4JSYA 1X7XA 3SFVA 3PYMA 4NBNA 2XWQA 3UKOA 2IXFA 2PQ0A 4HNUA 1M1NA 4J0GA 2CV1A 1RFLA 3DDSA 2HCJB 4MQLA 4EY5A 2C5EA 2PMWB 3M6FA 3CX8A 3PGA1 1Z4JA 8ICVA 3I6YA 3KLMX 3H3FA 2H4JA 3FLBA 4QUKA 3W1EA 4P2BA 3R4CA 5J4VA 2FK8A 1YR3A 1RZVA 1UQTA 3VVBA 3M49A 2QM8A 2EERA 5ETJA 3RS7A 3AMVA 1I51A 2FY8A 5KQSA 4J43A 4I3HA 1SUPA 2NXWA 4JHLA 4KBGA 1WUYA 1K88A 3AYZB 3B6JA 3VSAA 3GQBB 1ZKDA 2BEKA 2QPTA 4GX1A 2G9QA 3G2QA 4UBLA 2PX2A 3CR3C 4A6PA 3MRTA 4QOEA 4NOLA 2RI6A 4DZTA 4DV0B 1VLHA 2MYUA 3U1BA 3ZHVA 4PONA 4KN6A 5K0SA 3BK1A 3P9PA 3T5TA 3DFMA 1D2GA 3U61B 4IWNA 2Y99A 4B8WA 3KPJA 8ICFA 2ZVPX 1UDWA 4DNXA 1IXRA 3UK1A 2BHTA 2GHRA 3EDCA 1JU4A 5M5BA 5KDOA 5FUVA 1U81A 3NV9A 3WIEA 4X91A 1QIEA 3DAGA 5KFOA 5LN1A 3CMCO 4LRYA 4I50F 5FUBA 4J2HA 4DCUA 4ESEA 2GHIA 4DDTA 3ER8A 3SM9A 5DKFA 3NP7A 2ZJ6A 3N2NA 1JXMA 5ICMA 3WU2U 2ZYRA 2ZJ4A 3ENZA 2J41A 1BDMA 4B1FA 4UU0A 1NLFA 4CT5A 4GYKA 5A9TA 1SXQA 4ER5A 4L76A 4PNEA 1HDYA 3RR7A 3G6YA 4U2EA 4FWTA 5A7HA 3EK2A 3Q72A 1IOLA 1KQPA 4HADA 4BE4A 3PB3A 5I7AA 4O25A 1H1DA 2KJ9A 1RI4A 2G3YA 3IPCA 5LZ2A 4NS4A 4HDAA 5JCZA 3KALA 4D4LA 3HN6A 4ZVPA 4F85A 4LFBB 5LZ8A 1C20A 5K6AA 1W36D 3L43A 2UUOA 2Z5GA 3T5DA 2OXIA 1QBGA 2XAUA 2P8JA 3ZGOA 2EOAA 2ZAGA 1MD9A 1OXMA 5ES4B 2O19A 3EA4A 3N8DA 1L1QA 4MKRA 4OSOA 1UC9A 3TZCA 1JEAA 3BH6A 3HO1A 1E79D 3W5HA 3OSUA 3WKBA 4LVSA 3C4JA 4LZNA 4N6NA 4TSFD 2UZ1A 1JDPA 1ZQBA 1V45E 5CLJA 1HTTA 3GEHA 5C7YA 2R2GA 2P4UA 4NBRA 3CVUA 3R5XA 2EW1A 4A73A 5C52B 2HDWA 4DOCA 2VTEA 3PQ2A 1VLLA 4BLVA 5G4KB 1CR0A 4EW2A 4CMEC 2H0RA 3AY6A 3WXBA 3S2UA 1ZVVA 1UZUA 5E9WA 3CUUA 1M2WA 2HOFA 2X22A 3QUCA 2Q4EA 3EC2A 1EFUA 3JZAA 4BX0A 3FBWA 1B43A 5JS6A 5C1IA 4WGFA 3DL4A 4Q18A 1QH0A 4KN8A 2H48A 3LRPA 3OU2A 2GOYA 3M0EA 1XTRA 3OM0A 5KWJA 1KFCB 4MUJA 2KX7A 2JJ2D 3IV9A 2DFTA 3NKLA 1Q1QA 4UTNA 1XK6A 4RF2A 3IOEA 2FKAA 4EG8A 3V7YA 2JGAA 1NW8A 2FLKA 1D9ZA 1E1YA 4U6QA 1UZAA 1VXRA 1TK8A 4RD3A 1NN0A 2I2XB 1HUZA 2CE2X 4S1TA 3EFHA 3EEIA 4DDWA 3T9FA 1CW2B 5LQDA 4JJEA 2VTDA 3TK1A 3AHIA 4JCCA 3Q98A 5KT4A 3P9RA 3PVXA 4J6FA 2EFHB 2EQBA 1JP7A 3CZAA 4KXYA 3MNFA 1Z2EA 5L7WA 1KY4A 3WLMA 1R74A 2Y6UA 3C3CA 3IDWA 3OZDA 3WDKA 4G0NA 3S8EA 4EQ6B 1E2IA 1RYNA 3CO5A 3IJRA 4F92B 1YV9A 5HE8A 3GT3A 5BRAA 5H4GA 2HIGA 1WL8A 4IGFA 3DDUA 3WJ7A 4QU5A 2A33A 2NVUA 3IIMA 1NXQA 2ORVA 5DZSA 4BZPA 4ZVTA 5JNUA 1WY5A 4HS9A 2CMHA 4HNAA 1EM6A 4PLYA 3SOPA 4PYNA 3H65A 1KS9A 1Z3EB 4XD2A 4XUSA 3RB6A 1SXJD 3K4GA 1CIPA 3BWDD 1YTLA 2QTAA 3F97A 3UT0A 2P79A 1CUVA 1GY8A 1IY2A 4JY7A 1Z56C 4ECUA 4HDSA 1WAMA 1KJYA 2P62A 2FR0A 2HQRA 1QS0B 1AG9A 1ONOA 1FIUA 4AJNA 3F53A 1JIVA 3KZIU 1QX4A 2VHCA 5KAFU 2PV7A 4GC5A 2DXIA 1IN5A 4WBXC 1M74A 3BGDA 4X1KA 3FPEA 1M0TA 4IIJA 2D5IA 3IPXA 2MU2A 5EN4A 3O4VA 4TTVA 3JR7A 4M9RA 3ZCSA 3TO5A 2IHYA 3IPYA 1U0FA 3D0QA 5DOVA 2YRWA 3NPAA 2QSUA 3FCCA 1LKYA 1UBJS 4OG2A 1YI8A 1ADBA 3WA6A 3TFQA 3M6VA 2F1KA 2GWRA 1QFYA 3NJ4A 1V37A 5ADVA 5DI9A 3ZWVA 4RVNA 5ALMA 9ICGA 2CSXA 1A8UA 5HF6A 3SF0A 4OXNA 3W05A 3ZUPA 4CIDA 1XHEA 2GAFA 2C1XA 4EB6A 2J3JA 1KKMA 1A50B 1BCSB 1X15A 2R86A 3DZGA 1J5EB 2WKSA 4AZTA 4C7ZA 1JAHA 4O2BB 2XCSB 4IHAA 2LM1A 3MAGA 4II3A 5J2UA 4DPLA 3K0AA 1AXRA 4IL5A 3PEUA 4W8GA 5DLEA 4OU4A 1FFGA 4MKIA 4X1YB 1U0OC 3R9WA 2FWPA 1HURA 3JWGA 5I01A 3DMTA 2PGOA 3FZQA 2GK3A 2IE8A 5F21A 1VA5A 8GPBA 2PRJA 3MXTA 4KXFB 2W2OA 1KTIA 1NURA 3IQXA 2VH2A 1DRJA 2J9ZB 1CJBA 2DF8A 3SC2A 4OHYA 3C1TA 1U2GA 1Z5WA 4E2ZA 3Q1LA 1S7CA 3DXXA 2GMWA 4YRRA 4XYGA 3AR9A 4MA0A 4YYZA 2C2ZA 1AHPA 2LTAA 2JIRA 3R8XA 1RVDA 4IIDA 4JJZA 3HXKA 5PGMA 2KK0A 4P4OA 1C4WA 1JB1A 3DZIA 5KOHB 4M0AA 1R88A 2DUNA 1VHDA 1GDDA 5FTKA 1JQ5A 1E4YA 1W9MA 1NUPA 3BMXA 4IKOA 4XIFA 2Q8NA 2DQNB 1DKPA 3RODA 1Q3VA 2CHGA 4AZSA 2X5NA 5CHYA 5A04A 4F4FA 1GRQA 4M1WA 5IANA 4ECTA 4LYEA 3SOZA 1A9YA 2VDWA 2WMOB 3FCEA 5JI3E 1VJ5A 1DRWA 2H2DA 4NATA 4DILA 4P0QB 4INPA 3GMDA 2DPLA 3RPEA 3UMSA 5J9FA 3SHTA 1D8YA 2VF7A 1RHMA 1ZOOA 3QF7A 4C29A 1QP8A 2NXJA 2ZRCA 4ER6A 4XIGS 4P93A 3T35A 1WHTA 3E03A 1CFZA 4RPIA 1UA0A 3GT0A 2FZ4A 3Q0TA 1A5AB 4K40A 1NQAO 4TXMA 1PV4A 1ED1A 4IO1A 2XUPA 3M4XA 1E64A 1LPPA 3NZEA 2GEJA 1AGPA 5ILQA 3L8DA 3GLGE 5EJ4A 4JR2A 3SY8A 2JZBB 1FFXB 1F3LA 3DH0A 3RVMA 4BKRA 3UN1A 1JEYA 2Y1GA 2VNAA 2CEKA 3IXLA 3DFIA 4ZO4A 2AN5A 5IXSA 5E2AA 4DDVA 3CUVA 2XPCA 2WU1A 1DAHA 2I4NA 1F2UB 2J8ZA 5EXPA 4QBTA 4KXWA 1E32A 3VYVA 2C2OA 5EUBA 1YWGO 3ANYB 3KVNA 2G1PA 2GBLA 2BM1A 4F5QA 2J9YB 1IZ8A 3QHQA 1SBQA 1FNNA 2QD3A 1NRIA 4WZAB 2ZIUB 1PV1A 2VRCA 1WCXA 2Q5LA 1X7YA 1GZ7A 1CUAA 2RK4A 3QKRA 4FZNA 4GC9A 3I1IA 4OK3A 2AEEA 1JN3A 3E0FA 2BMFA 4O2BF 4MCHA 4Z99A 3AUXA 4DEYA 5JAZA 2GAIA 3J80A 2RKOA 4B82A 3Q8PB 1L4LA 2QPAA 2J0VA 4NL4H 2OHFA 3E9NA 1IEQA 2FXIA 3JZMA 4OBXA 5IJ9A 3OTOB 5CCXA 2DEUA 1Z34A 4HWGA 1OLSA 4RZ3A 1E1QA 3FVRA 4N5DA 4C6SA 1YJQA 1ENYA 3HU5A 4LXQA 3IP6A 1GCUA 1LH0A 3GOQA 2NT4A 2E89A 4JGBA 2XQGA 4F11A 3U7QA 2ZXEA 3FSRA 5DNWA 5F5XA 1Q22A 2CLIB 4UB3A 2QE6A 4IIGA 3RBAA 4OLAA 2GAAA 1II8B 1M2KA 2QR2A 4QUEA 4PZ0A 1OWLA 1ZCFA 4I81A 1I10A 2KIVA 5C1DA 3OH8A 4NZ9A 1EVZA 3TLKA 1URPA 4PX3A 2W54A 5ECGC 2ISQA 5F7ZA 3WE7A 1TDJA 2MT9A 2BVNA 4H7IA 4EELA 4LGVA 3SZLA 1MAHA 5D3KA 3KZNA 1JQKA 2EVWX 1QGDA 2HHSA 4R9RA 4J03A 3OICA 1OBVA 1T0JB 1URJA 4R0MA 4QW9A 5IRCD 4JLPA 3T41A 1OXBB 4KZKA 4Q0MA 3K1YA 1BWQA 3RCBA 3ND9A 3DBRA 2YZ7A 3REQB 1ZGCA 1VJ1A 3MTBA 4Q3KA 2I29A 4FQ5A 3HVUA 1FQOA 3FDXA 4CVNA 3O4IA 4HVAA 1V5FA 4F71A 1XZCA 5EXXA 3K6JA 4NFYA 4I2JA 3F71A 4M8IA 1LW7A 4L0CA 4QQFA 4I1OA 3LWBA 3VTKA 4YGYA 2BMEA 2GM4A 4ZVQA 1QHHB 1P5FA 4A91A 2NXEA 2P9QA 4RELA 3CPEA 3DDZX 1KEZA 4ASUA 2KZ3A 1JAXA 2GAOA 5ARDA 1VSVA 5EIBC 5K7SA 3ROGA 3KHSA 5G5GA 2TECE 1GEGA 3Q5EA 2OZKA 4DZRA 5DB9A 1RLUA 5ED4A 4ZO8A 2FOLA 2KD1A 4MPTA 4A0HA 1M2JA 2W98A 5H2FU 1XZAA 3PQ5A 1HGXA 4MLCA 2B69A 5HOEA 3CO0S 4QHTA 2GJ9A 3LOUA 2FUNB 2D6FC 4EY4A 3S81A 5EJ2A 1LBTA 3FPBA 5KFJA 3M9WA 4U0JA 3WGKA 4FD2A 1WDLA 2HIMA 2VH5R 1O94D 5IM5A 3WLEA 2QMOA 4A36A 1W30A 1NJ2A 1QLJA 2G9UA 3OIYA 4MQEB 3LBIA 4QX6A 1SVWA 5K4LA 3P4UA 4JLKA 3EQ2A 4ZCTA 3SYZA 4COKA 1JF8A 5HDBB 4LTNA 3JVIA 4FDLA 4A8JB 3GP8A 3WI7A 3IB6A 2PQ6A 3GFPA 1GCIA 5IWAB 4XEUA 4ZQBA 5JRJA 4FCTA 1WB9A 1XCGB 2X3FA 4EFKA 1H6AA 3JQ7B 2WFMA 1WG8A 1SBCA 2AHOB 2H5IA 4ALJA 1A9ZA 3W8FA 3KOYA 3V4VB 2W2KB 2I6UA 1KZ1A 3NCTA 3SYLA 2XOEA 3I6MA 3VR3A 2G9RA 4KX5A 3ZXSA 4CTNA 5IUKC 5CDUA 3RH6A 3HNOA 5ECYA 1HQYE 3L4BA 4J9NA 1WUJS 1KYQA 2VJKA 3AR3A 2ZRJA 1RT9A 2NXNA 3QVOA 4MEBA 1ZOLA 5DBEX 1UT5A 2W48A 2VA8A 4C0XA 1DUIA 4I3FA 3BXGA 5K01A 3GDWA 2IX3A 2FW8A 4FK8A 4E7OA 4CIXA 3SSNA 3C6QA 4L5CA 4AYXA 2EAMA 2W90A 1H69A 3OC0A 3HT3A 4KXMA 4TOIA 1Z15A 3E7DA 4RF3A 2WT9A 4QUBA 2OLJA 4QKQA 3THOA 1HEYA 2ODEA 2BFDB 1M6EX 4D41A 2VF4X 1OI4A 2O0HA 2I4OA 3DZDA 4B35A 1Y8QB 4YP3A 4CM4A 3UO8B 5DW3A 2Z6VA 4CT4B 5A3RA 3AVPA 5IBQA 3QLUA 1N0VC 2VHZA 5JLAA 2F8SA 3KT3A 1Z0ZA 4E2YA 2OR3A 1YR7A 3ZQ4A 3GPCA 4FW9A 3QNUA 3KQTA 4IF4A 4NL9C 5A4JA 2W2VA 5DHPA 1T3TA 1I24A 2LDBA 4NENB 1GQSA 3VTAA 5EL0A 2G08A 4PHTA 3LD9A 3TQOA 4LISA 3A1CA 3ZCTA 3F9RA 2LPMA 4ITUA 4INAA 3BCUA 4JVLA 1JNXX 4LHWA 1Y5IA 2ZIXA 4B3CA 1KSHA 1VCNA 3RYTC 4BVGA 5HQTA 4CJXA 1ZL2A 3OBBA 2I6GA 3K6RA 5JH7A 1GSOA 3UY4A 3D2AA 4JP2A 4QDOA 4YCCA 3NOXA 1G8FA 1HTWA 5A9SB 2PRIA 1QBKC 4HBZA 4I6EA 4G5RA 2OHVA 4OM7A 5ED0A 4IRMA 3AM4A 5HTOA 5TMDA 1HF3A 2FFAA 1Y1QA 3VH1A 3F7TA 4QUGA 3UOAB 4R2JA 2CV0A 1J99A 2W8BB 1EX7A 1XGKA 3BMNB 2VDRB 4Q4LA 5HF9A 1NP6A 3UB3A 2PLNA 1NMZA 2V9PA 1JQAA 3L8MA 2FMTA 3OWXA 3MK31 1SU6A 2PSEA 3ZDDA 4MIYA 5FXMA 1D7OA 1QQBA 5M2QA 3MT8A 2Y1OA 2H3ZA 4GDMA 5DYGA 2OC4A 1BW9A 2B8NA 4PXYA 2XZOA 5J2AA 3UC9A 3A4LA 5EQTA 4RE5A 1V8ZA 5CD1A 4X92A 3GGDA 2J9XB 1F2DA 4X8MA 2JXJA 5EWFA 2WHYA 2QB0A 1YS2X 4PTLA 4MUGA 1QPZA 1A3CA 2HW8A 5EZYA 3IPLA 1DG3A 3U7JA 2XKBA 5EKXA 5FL7A 2HU8A 4FW8A 4HDKB 4D99A 1LQTA 1OBOA 2HJRA 2EW8A 4C3UA 3FHTA 3KVYA 5KFQA 4EECA 5JBIA 3EVFA 3GA0A 4KQ2A 2JZOA 3GIDA 2I2BA 5ICSA 3D6UA 4U0KA 1YOVB 5KFFA 1RPZA 1GNPA 5SZHB 1ZBQA 2RHHA 1B8OA 4UUNA 5KYYB 4G0PA 4F2PA 4GZLA 1U7ZA 5AK4A 5ALHA 3KQNA 2WV9A 5CG2A 1HDOA 5IMSA 3GH3A 4NEHB 3Q9NA 4XM1A 3KOMA 4AKIA 4L5JA 3ZLJA 1EP1B 1HE4A 4MEYA 2PRKA 2M2IA 5M3BA 3B52X 5ALDA 2DWOA 3T5KA 1Z45A 2RGYA 4KXNA 4C7XA 1EUCA 4JBWA 2K4MA 2XUKA 3PPXA 3OM1A 1GQYA 1E2LA 1EGQA 3MS7A 1NI4B 3N9IA 1KFTA 3CV3A 3GZTB 4BNNA 3W2FA 1S2MA 5LB4A 3GGJA 3PR3A 4UUPA 5EIXA 4WNYA 1Z5NA 3R0IA 3ED1A 4KK3A 4KR2A 2XYGA 2AFIE 2OZEA 4GI3A 4YI3A 2IF2A 4R3UC 3GRVA 4ND4A 1ZO8A 4ESVA 2RK6A 3AEUB 2PZAA 4ZAZA 3KOOA 2ZITA 1ISFA 3KKLA 1DEHA 2H1HA 5KFLA 3GUUA 4DCOA 2YMLA 5IF9A 2L2QA 3HO8A 1RU3A 4E5DA 2FLVA 3UXEA 3H05A 1N7GA 1PQPA 1ZQVA 3I6BA 1CETA 5CM2Z 5ALUA 5DNEA 1GDTA 1AD2A 5KFZA 2BW0A 5CURA 3TG2A 2O05A 1RPNA 3IO3A 1QIGA 2HMTA 2V3VA 4EG1A 1M3SA 1KVSA 1I0IA 3CSSA 2E3JA 5CXXA 4QQ8A 1K7CA 2IKSA 2EFDB 3EULA 4QT0A 4AW9A 4HVTA 5DGTA 2D2VA 2I2AA 3BJIC 4OXYA 4X6UA 5JMWA 1GUFA 2FSUA 2EF0A 4LMRA 4Q66C 1O5IA 2ACVA 4LZJA 5T6BA 5FTNA 3X1ZA 5KDLA 4HI0E 3SYNA 2ID9A 1GNTA 3KEMA 3ESAA 3RKRA 4IJ6A 4GQAA 3HGTA 3W8DA 2JIMA 2OC9A 5LWQA 1E4EA 1GA4A 3RU9A 2H2AA 2GKGA 1IUOA 4NMWA 5LDHA 3HWRA 2I9GA 3GT4A 1M73E 4O6VA 2PFQA 3BX1A 5FJIA 2P2CA 2H4YA 2YNMD 4G2NA 2Q1YA 5CJ2A 2J0UA 4J9QA 5IM4F 4EG3A 3BB4A 3IQGX 4TLDA 3E22A 5BW4A 4E1VA 3KPUA 1IJEA 3H6GA 4MX8A 4YUWA 3O2SB 3DMDA 4IKPA 3UGQA 5E3HA 1EBFA 4IEFB 4OUDA 3RJHA 2JKVA 4S04A 5E9AA 5HJ7A 4C0AC 1K68A 3BOSA 1QVZA 1VG8A 3DXFA 3NFRA 3QTBA 4RTSA 1DAIA 3R7SA 3ZN2A 5IFLA 2BFAA 3W7VA 4JK3A 1XSPA 4X3CA 5EQFA 2HPAA 5GQSA 5J0XA 3TS1A 2H4WA 4BPRA 3DMRA 4O02B 4L8GA 2IU4A 1C2TA 2A4KA 3MT9A 2HPZA 4CM7A 2W55A 1ABEA 4Y98A 4EF6A 2H3VA 4NLZA 8ICUA 1T3SA 1FTSA 2KS6A 1ZD2P 4R68A 3IE1A 1VMAA 2JL1A 2Q7XA 3KC2A 3JPPA 3B3FA 3V42A 3S8MA 4RKWA 1LPAB 1DO2A 1CY4A 4OHBA 3AESA 2G0TA 2BFCB 1C1DA 4IHQA 3CF4G 5REQA 1RM3A 5DYTA 1TADA 4B6GA 1L5HA 2P6NA 1WWVA 1HFEL 3L6RA 4DARA 2Y0PA 4F6LA 2I7TA 1K5DA 4G97A 4KLMA 1Q0UA 1T0HB 4Z6KA 2P65A 5EHNA 2ZJ1A 1QVRA 3O8OB 4GPBA 2XBMA 1HQCA 2ATLA 2CNBA 2QRUA 3OPYA 4WK2B 1P2GA 1EEHA 1N7IA 1XMPA 3W6NA 4BLOA 5JU5A 1D9FA 4IEIA 3TYXA 4UC0A 2WI8A 3ASVA 3PR4A 2FZCA 3C5EA 2KMDA 3EGIA 5KFAA 2XUOA 5JSZB 3QE4A 4RVFA 2YUTA 1U1IA 1YFKA 4DNOA 4ITRC 1G3UA 1KRXA 4WSOA 1PN3A 1NJZA 2GPYA 1BFKA 4INOA 2ZIAA 2VRWA 3QLEA 4ECQA 9ICWA 3NYIA 4K9KA 3PE4A 3U16A 3DNFA 3CA8A 2FRDA 3FPAA 3IH5A 5K6TA 2ZRBA 3UAZA 4WZBA 4ARZA 1I1QB 3I5AA 2I2DA 3OCJA 3TTXA 4FGKA 1EUZA 3V1NA 2ENUA 4U3JB 3R5TA 4MV6A 1R6DA 3GLRA 1CY2A 1VE9A 2REQA 1ND6A 1OXXK 3JATA 2G0AA 3PO4A 2REBA 1CF9A 1PVPA 4BVEA 3U4HA 1I01A 2Z2IA 2VWPA 1U5BB 5CB8A 4DLUA 3AUFA 2WJHA 1GZ6A 2F1HA 3HMQA 2RBGA 4N0PA 3FSGD 3RRNA 2JRCA 3Q8XB 4JJ8A 1PW5A 3AUUA 5T8KA 5BUQA 3UHFA 2BBOA 5EKTA 3HFRA 1RBYA 1CDDA 8ICZA 3R3ZA 3KLOA 3TTUA 4E4TA 4ZEMA 1OUMA 4JR1A 5FBWB 2IRWA 3RFXA 1DKMA 6LDHA 1CQXA 5CT6A 1A27A 2MSWA 3F7MA 3QRWA 1M2HA 4FX5A 3RT1A 3VSCA 4J16C 1H4SA 2YXEA 2LIVA 1W76A 4BGUA 1TUGA 2V5AA 2AR9A 2B7LA 4DT1B 4RTKA 4RNCA 1B8VA 4BX9C 2H1IA 4PPYA 1T0IA 3S4YA 4OY3A 5LPNA 3I9MA 1JRLA 1GPBA 3NHAA 1B76A 5H83A 5CX1A 5D4BA 3HL4A 4DGSA 2ERCA 4NBLA 3G6KA 3PL5A 1YGPA 3DOIA 2XMDA 2IX9A 3JRWA 3M81A 3QVSA 4NLGA 4OL0A 3K5PA 3L6UA 2DWUA 2GRAA 5JS2A 1BHSA 4P0PB 3TAQA 2ESRA 4HKTA 3ZTWA 2M32A 1XQVA 7REQA 1XZBA 2XMCA 1BVHA 3N3BC 4PO3X 1C7JA 4MW6A 4FC7A 1GVNB 4LUCA 3ORYA 3C3KA 3QV2A 1J2MA 3DYVA 2K4EA 4EARA 2RHCA 3SHFA 2J3QA 2F3QA 3TFOA 1V6AA 2VJNA 2VP0A 1D6JA 3K8YA 3UPUA 2EP5A 3DZCA 2WVAA 4XVQA 1Z7GA 2GPAA 4B8ZA 4X84A 3AOGA 4D57A 4LZWA 2BC9A 2GPBA 4B3DA 2I3BA 2WTMA 4GECA 1NV9A 2FMFA 3SSOA 1O87A 1KYTA 1XYGA 5J2CA 5C1BA 4LY9A 3MUOA 4GRAA 2RBEA 3C5FA 1TQ8A 4BP9A 3GFOA 4RU1A 5LR6A 2YX1A 1N6LA 3GIKA 1VPLA 4Z8YA 1S96A 1EXWA 4G1CA 3SI7A 4N82A 3A4IA 1BVRA 3QKSB 3OC6A 3S0JA 1TU4A 5GV7A 3ONDA 2CL5A 3PDJA 5BQOA 1P31A 1MVNA 3QBJA 1A97A 5B57C 5E8JA 2W37A 3E7FA 4D42A 1X8JA 1P0MA 4IZIA 4KVZA 4Q45A 5A4MS 4Q9IA 3A3PA 4TZTA 4H6VA 4CWAA 4DN6A 2FPGB 4JA2A 4RFVA 4ZO9A 1QMPA 2CJXA 3C45A 3SC3A 1SCNE 3VHLB 4S1OA 4OYRA 4ND8A 4DJDC 2AJLI 2WF7A 3QUBA 3T9BA 1MTOA 1R64A 4ECWA 1NU8A 1GPMA 1Y6FA 2G63A 1Z22A 3EF0A 3PMNA 5B5SA 3RFVA 1FDTA 1NRJB 2V9ZA 3ORHA 4JI5B 5IVDA 1U6IA 721PA 3D2NA 1G5IA 3GLGB 2C03A 3NDBB 2BHRA 1N9KA 1KYXA 2NADA 2O0LA 3HKEA 2EKDA 5F2NA 1VC2A 5BYJA 2VATA 2AF4C 1NPDA 3PQ6A 3HCWA 1EFTA 4IFTA 1QG6A 3RJEA 1T43A 2ET6A 2XNKA 1Y6QA 3QFTA 4YUZA 1J8VA 4Z0HO 3BC1A 1X1TA 5BSGA 1I2AA 3MDAA 4MZDA 5J43A 5C5CA 2D5BA 1U7PA 3BGSA 1L5ZA 4TRMA 3MABA 2VJ4A 3OX1A 2J07A 3K09A 1E7QA 1LLUA 4HH0A 3OFSA 4LC1A 1I4OA 5AK6A 4I50B 4YACA 2JIOA 4Z8XA 3AJRA 3OE7A 2NVWA 3VNQA 1V1RB 4Z1MD 4JB3A 5H3CA 4IDPA 2GPTA 5HZKA 3L82B 1W5FA 4ZT4A 4WCDA 1QGAA 5IG2A 7ICQA 4F2SA 1ZQJA 4NZOA 3QEMB 1WF6A 5ICFA 3H4DA 3LFHA 2BZ1A 4YUXA 3QVGA 5DQIA 1RVV1 2KV2A 2H57A 1U0NA 1DAMA 4MAFA 5CYPA 2QRZA 3ZW7A 2JAQA 5FAKA 1F6BA 4M1ZA 2HRQA 2CXTA 2E9SA 3UFXB 5DGBA 4GX5A 2JPDA 3O26A 3WQQA 3NALA 2RSLA 2IIPA 5BNWA 1OU4A 1ODJA 4B81A 4ARUA 3QLTA 2PX0A 1V3UA 1KH3A 3I28A 4WNAB 4MGHA 2FMSA 1VCHA 4P33A 3TEJA 4N8EA 4O5KA 2Y2VA 4RQ3A 3K0EA 3DQZA 3CUKA 2P9ZA 4HNGA 1BFUA 1OIVA 3U56A 1YMUA 2BSQA 2FF5A 3QYPA 5F76A 1CUSA 3GPLA 4Q44A 4HB4A 3IHWA 1XVAA 2I6FA 4Q9JA 4DSOA 2AG0A 4UULA 1NSFA 1BMDA 4NTZA 3FPLA 1UK8A 3F5SA 1JXAA 1D2AA 1XTPA 4Y2UA 4DLGA 1MPTA 4Q7MB 2FWIA 3CH4B 4UQGA 1AQUA 4DLNA 1U2DA 4YAIA 1E2JA 5D6NA 4JMLA 2XUGA 4Z51A 4DEZA 4EYIB 2PI4A 5HJ2A 2O20A 3EIQA 4IJVA 3C7AA 1QGYA 4IXWA 3C3JA 1W581 9ICRA 4B31A 3CKYA 4B2LA 1R3DA 4LOIA 2R96A 3SK0A 1KH2A 1P2FA 4AB1A 4KPEC 7ICPA 1OROA 3E9RA 5JAPA 4NH0A 3A0BU 3T9AA 3K8OE 4EHNA 4ZI3A 2YS7A 5AQEA 4LXIA 4NZPA 1PZEA 1UDAA 4LEIA 2DJIA 3KUCA 2E1EA 1AU9A 1U04A 3SQDA 3MOSA 3DS8A 1EGMB 5CU7A 2FFRA 3ILYA 2R97A 2R9VA 5J58A 2CSUA 3TMAA 1N1GA 1CUWA 3P0EA 1ZOPA 2Q1UA 3E5RA 1PK1B 1O6BA 1PNOA 3CGWA 2UV8A 5KTNA 1V8BA 3DTTA 2Z2JA 1EE9A 3A6KA 5SZKB 1H65A 3BD6A 2FSSA 4F3RA 1KY2A 3CN7A 3BORA 5JXJA 3NTUA 4ZVKA 4Y2TA 3IN5A 4MOWA 3H2ZA 3K96A 2ZROA 1CNEA 1VRVA 4IIXA 3DYIA 4LSWA 2EFGA 3JXEA 2Z9CA 3UH0A 2WLTA 1JQJC 3BICA 4YV1A 3SZ2A 3B1VA 2WICA 4XX0A 2R65A 5TRTA 1VJTA 1R6UA 4OA5A 3DOJA 4YCBA 3FWYA 5FOWA 1LS1A 3HXLA 3FM9A 3PLRA 2R00A 1BPXA 5K3SA 1PLJA 1YQXA 2CXHA 3KSDO 3DVAB 1J22A 2QUHA 1AO3A 1N2IA 3A9RA 2C61A 1PE0A 2ZE5A 3DDCA 3BPSA 2NM0A 3LZ6A 2EBUA 1KC1A 1GITA 3ETHA 4DPMA 1DWQA 1QDLB 1GQOA 1LJ8A 3VAYA 5CHGA 1PUIA 3CCFA 2G4LA 2QVLA 2ZJBA 4H7KA 1VLJA 4WNIA 4XQ8A 2FE9A 2BLNA 3EVNA 3I04A 3A1TA 4F4KA 4HYEA 5F3WB 1V2HE 1DKQA 5C0YA 2VQ6A 4J0EA 1TUBB 3HDHA 3NOOA 4DCNA 2CVQA 4U7HA 1JHOA 2XMRA 1FRQA 2QSJA 4C8OA 4ZAXA 3V8BA 4EEKA 3V4ZA 2EHDA 2ZB8A 2AQ0A 3SKVA 4LX8A 4X90A 1CQJA 1L7NA 3D3JA 1T3LA 4Q3AA 2R85A 4DQIA 2QU8A 2W2QA 1A9XB 4I36A 4KXUA 1NJ5A 1C30A 4H1VA 3CPSA 2KSQA 3HBNA 1PJTA 5FKJA 3ZDYB 4UATA 3PNKA 5HZHA 4IV0A 3R7WA 4IIHA 3T7JA 3QNWA 4PHHA 1BVSA 1BPBA 1PGOA 1U2PA 3D4NA 1G4AE 1DT5A 3T5BA 5EVJA 4EGSA 3OZUA 3WKAA 4C3VA 1FA9A 2I4TA 3R2JA 2BI8A 5JJCA 4S0XA 4N65A 2HL6A 4IWYA 1UQVA 1L5OA 4RXTA 3BD9A 1BS9A 4IMPA 3TLGA 2QUAA 2P2GA 4INZA 4DBZA 4B6JA 4GP9A 2B7BA 4JJAA 1QUFA 1XELA 1NR5A 2ZTUA 4OQLA 5K0TA 1GKLA 2EZZA 2WT4A 3K9BA 5CWRA 3QOFA 2VZ0A 1D4OA 4JJGA 3W3AH 2DBRA 1RI2A 1UOOA 9LDTA 1T3ZA 1E2KA 2QSZA 1JHQA 1TAHA 4M04A 2Y0SC 4NOKA 3RSGA 3U0VA 3OWHA 3EG5A 4E3ZA 4DGQA 1C4KA 3LVWA 1ZK3A 1PS8A 3P5BA 4DEVA 2O2EA 3W4KA 1RE1A 3K31A 3D8TA 4YJHB 3PGKA 1EQAA 3VYTB 4ILKA 4JLAA 1E5DA 1DBPA 4IDNA 3NOVA 4PL2A 3STHA 1Y98A 3VU9A 2FDXA 2XDQB 2QMEA 3IMCA 3LG2A 2AA3A 3PNYA 1G2QA 1FMFA 5DX8A 1EP2B 2OORA 1FTNA 4D4MA 1L7OA 2I34A 3GLKA 4YRPA 5E7QA 4G09A 4URYR 4LOJA 4UTVA 4Q05A 4EKYA 4JOCA 1C1XA 2ZSAA 4D2IA 4ECEA 4L3WA 4OKNA 4X1IA 4HXYA 1ZJMA 3HEMA 3ZZMA 4OAQA 3CRVA 4BFXA 3HRIA 2EZ8A 2OGTA 3P32A 4I1VA 5AHWA 4FI3F 1ECLA 1DTSA 1USUA 1RAAA 4OHKA 3CH5A 2PYZA 3NHJA 5MGNA 3F5EA 1H1LA 5HRAA 3L7KA 3BHIA 4CIAA 1NOMA 3P9CA 2BE9A 4H7JA 4KJXA 4V1CB 4PO8A 4ZT3A 2BFEA 3IPRA 2QE7A 5KFYA 3PX6A 2NT3A 4RANA 3DEZA 2WJGA 4O4JA 3MWJA 5AOBA 3LLSA 2G36A 4PC1A 4HD8A 1P4JA 1YU9A 2V4RA 5A6SB 3LXRA 3GXOA 2QLFA 4BLPA 4LF6B 3NKVA 3A10A 3BJYA 4B84A 3EG9A 1NX9A 2QP4A 3WLTA 4AJKA 1CUCA 4J1TA 4YH1A 2WJIA 4D9KA 2DY0A 3LW8A 3FCOA 1LEHA 3BZUA 4MWOA 4BWJA 1G6HA 1SV0A 4V0NA 2DERA 3ZC3A 4W5QA 2GBFA 1FJHA 2AVNA 4R63A 3IUYA 1V97A 2X5KO 4NJ8A 4I27A 5GGYA 1NVEA 4KITB 2AZTA 5GJCA 1I7DA 5K0JA 1POXA 2O3SA 4X45A 1M5UA 3WISA 1A9RA 1WTAA 2OHIA 2O7VA 5KU1A 3CIOA 3MT7A 2A5GA 3Q7SA 2OVBA 1W6RA 1GN8A 3LF1A 2LE0A 1K9VF 3S2EA 3SHVA 2I65A 3WJAA 1YE3A 4IQ8A 1SGWA 2PWPA 1ZI6A 2X9VA 1ISPA 3I39X 4F4HA 4N18A 1XVIA 4XM2A 3HUFA 5J0TA 3QX9A 2AXEA 2XGOA 2VDUE 5F1OA 4HAZA 1EGAA 3O9MA 4QARA 1UZLA 1LQ2A 4BO9A 1JSCA 4B4KA 3JD3A 1KE1A 4BIIA 5D8DA 2QRJA 3HB7A 3PUYA 4LOAA 2AFIB 1I0LA 3PC6A 1NT2A 4ECRA 4KLUA 2ORIA 4OU5A 5TB5A 3LV8A 1GTRA 1J2YA 3AUYA 4YQZA 4AZ3A 4RPKA 3F3YA 5FBHA 1U5CA 4I2EA 4OGGA 4Q3DA 5B30A 3KSMA 1CVRA 3NNSA 2PJRA 1C14A 1C7FA 3V7WA 2ZIEA 2PO5A 1KQ3A 3RRFA 4JB0A 3HVKA 4BB9A 3JALB 4YMOA 2CXYA 1KP9A 4TYQA 1E58A 3HJBA 3I83A 3UHOA 1TLTA 4UAWA 1KOFA 1IQPA 2AMYA 2BY4A 4RA6B 2XB2A 5CT5A 3G7NA 1UPHA 1Y7LA 2OAQ1 1E3LA 3M3DA 1WUIS 5DK6A 3UT5B 2NO7A 1IULA 3PSPA 4REMA 1UXIA 2OQVA 4C06A 3LVVA 4E5SA 2VCYA 1L7MA 4I6JA 4P4PA 4KWEA 3ANNA 1E2DA 4TVBA 4V0RA 3KAQA 5ADWA 2N0SA 3DNPA 3KVRA 3ES9A 3BIOA 4EG4A 2QL7A 2J6IA 1SVIA 3S5UA 1YBAA 1NHGA 4I2DA 1KI1A 3SU8A 4YRCA 2PWBA 4Z9AA 1ZVKA 2ZQ5A 1IOVA 2G4CA 1THMA 2K60A 4F56A 2MWMA 1VECA 2UDPA 4DB2A 4M0KA 1P0QA 5BVGA 3DTVB 1MENA 1SBZA 3OHPA 4XCQA 5CYFA 3CJTA 3GLFA 2CVPA 2CZCA 3W6OA 2ZE8A 3GP5A 1OPRA 4KN9S 3UWOA 1GARA 4LFAB 2TMYA 1Z0IA 3ZW8A 4KKXB 4Z9FA 4TV8A 3HJTA 1L4GA 1JILA 2I99A 4BKOA 2JI9A 3WGYA 1G8JA 1XZJA 3U62A 5CBPA 2ZWMA 1BGXT 1P5ZB 3ZKWB 1JUDA 4HCJA 3OZCA 1P0FA 2JIBA 1ZESA 5KNDH 1XZMA 4CL0A 1XZPA 2KPOA 4IBOA 4KVFA 1Z6AA 1IPEA 1YB1A 1K7FB 5KNDA 3DKVA 1TJNA 3CLUC 4GC7A 4OJ5A 4B3HA 4MRMB 1SR8A 3UATA 2EH9A 1OHHA 5KFGA 4HPXB 3TSYA 2PFOA 1FYFA 4UHEA 4D8VA 4MUXA 2OOSA 5K3EA 4AS1A 2R7NA 2P75A 2JFOA 2GF2A 2HQ1A 4F06A 1MJGM 1ZUHA 4O2AB 2HXSA 1W0JD 1UJCA 2XCUA 1DI0A 3UGJA 3G9QA 2LVBA 1EFDN 2AXQA 3OOWA 4O4LA 4HAIA 3T1HB 1YZFA 4UE3S 2W04A 3SKXA 3A4MA 1I80A 5SYMA 1BS2A 3WK4A 4WA7A 2R6ZA 5IC6A 1T9AA 1Y3AA 3UPTA 3FNRA 3IEUA 4ZOBA 1CEEA 4QEZA 2R1UA 3LC1O 2WD7B 3ET5A 5JZVA 4ALNA 2ZZNA 2C5HA 3IAM1 2GEUA 1EA5A 2R8OA 5G0WA 4D9MA 2A94A 3GPIA 1B8NA 1JDBC 4F7DA 4QOJA 3HG7A 3D4OA 1MW9X 4WVLA 1CB7A 5J1SB 3HUUA 2Q2OA 4KLOA 5AJUA 2GOLA 3OKCA 3CLSC 3NM6B 4XGRA 5C8XA 3R9XA 4DNPA 5BOSA 4BO3A 3VYWA 1UUFA 5TQ0B 4P53A 4Q24A 5DSXA 3JASB 3LNCA 5CDYA 1BDHA 4Z1OA 3IQZA 1T8YA 3F6YA 4BMNA 2BRUC 3LVQE 3UA3A 2A0KA 2B99A 1A8HA 2IYTA 3EYWA 2BGWA 3N2EA 3ZJVA 5BSMA 2KHZA 4WOKA 5SZJA 3V6JA 4MQMA 3OKFA 3PGXA 2GK6A 3RADC 3ZS9A 4CKBA 4F3NA 1N2JA 3M6UA 3PCTA 1HORA 2YHIA 5BT9A 1UPXA 1E9AA 2CXPA 1J2TA 3U4AA 1RZUA 5HR6A 1M34E 4RF4A 3SX4A 4ZO6A 2IXBA 3UK2A 5K3CA 3VH3A 3EVBA 2OECA 3ONWA 4MP3A 4QOSA 2QBYB 4YY3B 4UNRA 3BTUA 3CY6A 4O0IA 4HTFA 2QG9A 4PCLA 4FD3A 2QM3A 2FEXA 3BEOA 1NRXA 3I4CA 1E2HA 4IH1A 2LPEA 4YP9A 5JSFA 2N1BA 4IR7A 1R8QA 4H08A 5A4KA 3DCYA 3LVBA 1IK6A 3RG8A 1YZKA 4DCVA 3AV0B 2EZ9A 3QE0A 3NRZA 1YB5A 4YRJA 9ICOA 1SKRA 3QFRA 4X61A 4OIMA 3HYCA 5SV2A 3DEIA 3QIAA 4X20B 4DJEC 2JIZD 1KOLA 3ZWOA 4FYKA 2FPRA 4JT2A 4Q03A 1T9HA 3UTCA 3K1TA 3OFND 3D2SA 4FR5A 3UXNA 4LDPA 1WMBA 5DGCA 4WXMA 2PQ2A 1NK6A 3V6LA 4N7BA 3H9BA 3LYSA 4KFCA 3AUAA 2QMHA 4RV9A 4FUTA 3RGGA 2BI7A 3U3JA 1ZQNA 4JAVC 1VIYA 4O2AF 5JJ5A 1U1DA 1ZK2A 4C7OA 1H42A 4QNMA 2IPMA 2IGTA 3L9XA 4RULA 1KZGB 2BEVB 2OLKA 3N2GA 3THXB 3ZXYA 1SZPA 1TNDA 4M99A 2YOHA 2LUOA 3L0OA 4I9UA 4BMDA 4ICIA 4ARVA 5L40A 3L07A 3PW7A 2WZQA 4UUMA 3QMVA 4EI9A 2GN1A 2B2NA 1ULAA 2N75A 3BKXA 2Q5HA 1QZTA 1XLVA 1M1YE 4W8HA 5FOXA 1T5DX 3IUEA 3H1FA 2YJTD 1QR6A 2AFVA 5KT2A 4HGYA 5GVRA 1OWNA 4GAEA 1MABB 1RLTA 4B73A 2YZKA 4FFLA 4GLJA 5HYVA 1K4MA 2XADA 2HA5A 1PIWA 2F3TA 4ZU3A 1Q84A 1S3IA 2PH7A 2PBFA 1DTWA 4CG0A 2HEIA 1FX0B 4XX1A 1T8UA 3C24A 1Y1PA 5GV8A 1G5QA 3QITA 3EZFA 4AJIA 3K0SA 1JIKA 4AECA 3G2LA 3DDOA 4CMIB 1SC3A 2ZT8A 5J2EA 2FEMA 1PUXA 2PUDA 3R6TA 1KQQA 4DFDA 4I14A 1FFYA 4CF4A 2L18A 3GARA 3DW1X 4CGZA 3ABSB 4ZODA 4WESB 1Y3DE 3C43A 4D4KA 2C57A 3PWTA 2R8PA 4HLDA 5JE8A 1R66A 1HIWA 1ZR2A 5IX8A 1G8MA 3DT9A 1F8XA 2EU8A 1UXKA 3AJEA 1RFGE 4G5GA 1Z4QA 4R8LA 3BL5A 5EYPB 3HV0A 1I7PA 2VAXA 4MB2A 3TZKA 3KPVA 4OQNA 4UZFA 3LLUA 1GTZA 2H52A 4WCFB 1KEEA 3L6EA 1G21B 3FTEA 5AW6A 2DPXA 3BVPA 2CLMB 3C6BA 4GPTA 3QXCA 2D2IA 5DN6D 3KXPA 3N0RA 1GCGA 1XRJA 3O4JA 5CIQA 3OI7A 4R6XA 1JTVA 4BP3A 3S1AB 1AB6A 4WJZA 5ELMA 3IUBA 3AU9A 1DAKA 1JYFA 4RLSA 4WN9A 1VIAA 2FPPB 4DL6A 1ZOIA 3AR5A 3PFKA 5KREA 4P86A 1C3VA 1F48A 3EXHC 4D5GA 1SPBS 3ETDA 5G1PA 5H68A 1PNQA 4B7AA 1MN6A 5LZ7A 1NXXA 4YP1A 2ZSBA 4GYYA 3OJUA 4LWZA 2OXRA 1KU6A 4ZZ1A 3DOEA 3AF2A 2C7VA 3L4JA 1N57A 3SNHA 3JRXA 4DSFA 3DD5A 2IODA 5ER6A 1GT91 3C8DA 5T4HA 1OJ7A 1VLBA 2CZQA 3O4RA 2C3OA 2D00A 2HCFA 3MRXA 3NWEA 4MR8B 4L74A 5D7NA 4ECSA 2ZJYA 1UBFA 2FPWA 2EZUA 1HUQA 1C5KA 5B1EA 1OD6A 1AQYA 1C4XA 1YQ9A 2PL3A 4RPHA 5KOIA 3BBPA 2JVIA 1U02A 4Z6FA 1EINA 4EM6A 5I7OA 2DMRA 2VUIB 1X1BA 4M7WA 1YAJA 2IYUA 2ZXHA 4K3UA 4F8EA 3PQ7A 1M54A 1T10A 3HCPA 4BAZA 2YXBA 3MGIA 1HLGA 5DM2A 3ABIA 3LX6A 2ZIVB 2A1AA 1VBMA 1PUJA 2D1SA 3H0MB 1ZRSA 4CFZA 1XC7A 1WABA 3ITEA 3RS0A 4Q34A 2IYYA 1FB5A 4U39A 4IXMA 1XKXA 2B3TA 3S3TA 1LK0A 1WW2A 2YX8A 3I8XA 2Z09A 4RVDA 4H1HA 4OXRA 4K9QA 1TUEA 6CHYA