3BQTA

Crystal structure of a protein of unknown function from listeria monocytogenes, tetragonal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
b'NLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b f2365
molecule tags Structural genomics, unknown function
total genus 25
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bqtA00
4KLOA 8ICXA 1PZNA 1NKBA 4JV0A 2ISPA 5KFWA 2KTQA 8ICYA 4QZ9A 1ZQZA 2IMWP 5KFPA 5EWEA 4YD2A 4DEZA 8ICNA 4NM2A 4DFKA 4DF8A 4O5CA 3RAXA 2BQUA 5KFHA 4QZCA 4O0IA 3MDCA 4KLQA 3HPOA 1RXWA 4R8UA 4KLHA 2ZTDA 5KFIA 5HHHA 1X2IA 5J2IA 4EYHB 3HT3A 3PNCA 3IM1A 4O3RA 5J2EA 2W9BB 2XY7A 8ICCA 2A1JB 9ICOA 5KT6A 3Q8SB 5KG4A 4XRHA 4TQSA 4G3IA 4BWMA 3SV4A 5CA7A 5KFDA 4J9PA 5F9LA 3M9NB 1KLNA 5KG7A 5KFLA 5J2AA 2XY6A 2OWOA 1K1SA 5C5JA 4RUCA 1ZQEA 8ICRA 2R8HA 3PX0A 7ICGA 1ZQSA 3T5LA 2R8JA 5BOLA 1JIHA 3MR5A 2V4RA 1KTQA 4EEYA 3T3FA 4C8LA 3RR8A 2JEFA 4F5OA 4GXJA 3FYHA 2W9MA 5IIOA 2R8GA 8ICZA 2HHWA 4YXMA 3TANA 3ZDDA 4KLSA 2ASLA 2NRZA 1L5UA 4C8OA 2HW3A 9ICWA 2ALZA 4DSEA 3JPSA 3QEBZ 3SYZA 1WCNA 4YP3A 1NJYA 4B9NA 4UB3A 1KFTA 3RH5A 7ICTA 4YG2A 5KFAA 8ICSA 5KFOA 2Q0ZX 5J2DA 3OHBA 4GLXA 3N4MB 1X9SA 4JV1A 7ICKA 4R65A 4MFAA 3Q8PB 1K1QA 2NRXA 2W9AA 3PY8A 4M9JA 2KFZA 9ICPA 2RDJA 5KFZA 3V7JA 3RBDA 3RB3A 3G6YA 2I9GA 1JN3A 1NKCA 2JZBB 1A77A 2UVUA 4J9NA 4ED6A 3AU2A 4MF8A 4DFPA 2BGWA 2PFOA 2AJQA 7ICPA 2BCRA 1TAUA 8ICFA 4Z6CA 3OJUA 3JPRA 4TUQA 4ELTA 1U49A 3ORYA 2DPJA 4CCHA 3PO5A 2LYHA 8ICHA 9ICRA 4I2CA 1XSPA 2KFNA 4UAWA 4F3OA 4F4WA 1KRPA 1XU4A 1H38A 1D9DA 1Y88A 5DLFA 1SKWA 1DGSA 4O5KA 2FLPA 2ZJ5A 1ZQHA 5DG9A 3ZD9A 1TFRA 5KG3A 3RH4A 7ICQA 1HUZA 4ED3A 3TI0A 5KFYA 1C7YA 4YN4A 9ICKA 4M9LA 2W8KA 1KSPA 4IQUA 3RJGA 2VANA 3HWTA 4GXKA 1NJWA 3MR2A 9ICXA 4DL5A 3RBEA 1NJXA 3LWLA 1Z00A 3JPQA 1AROP 3MGIA 2PXIA 2XGQA 1S0MA 2HHVA 8ICLA 5DG8A 3RH6A 3OSPA 4BDPA 1ZQLA 4R8UB 5CWRA 3EZ5A 3ISBA 2BCSA 3ETLA 4O9MA 4M04A 2KZMA 1SZPA 4F92B 3B0XA 5BOMA 4J9QA 3KHHA 3V6JA 2MAXA 2RDIA 8ICMA 4YMMA 3PW2A 4ED7A 4RPYA 4F4KA 7ICJA 3PMNA 3K75D 5DGBA 5DB8A 3PV8A 1MQ3A 2HVIA 4M9NA 3C1YA 2HHTA 2BR0A 4UB1A 4F2SA 3PX6A 2MUTA 3UQ0A 2DFLA 1ZQVA 3V7KA 2GWSA 8ICAA 3GIIA 3GQCA 3MGHA 4QZHA 3RRHA 5IIMA 5DBAA 2Y1JA 5J2GA 4F5PA 3OGUA 3V72A 1JXLA 2HHSA 9ICGA 1IM4A 4K4HA 4YR3A 3LK9A 4RQ7A 4DS5A 4B9LA 2FPLA 5KFJA 7ICMA 4PHAA 3ISDA 1ZQMA 4ECYA 5J0YA 2VA2A 4MFFA 4ECRA 4F5RA 1U9LA 2KZZA 3H40A 4GC6A 4RPZA 1SL2A 3G6VA 5CB1A 4ED0A 1QTMA 2J6UA 7ICIA 1JXEA 3KTQA 5KT3A 1S0VA 5KG0A 3LWMA 5D49A 1ZETA 5DKWA 2P6RA 7ICUA 7ICOA 4YR2A 4DSFA 4I2EA 4YMOA 4RNMA 3G6XA 5KFCA 5IIJA 3EYZA 3UXPA 4K4GA 3GV7B 4RQ2A 3JPPA 3SI8A 2AGOA 4J9KA 4GC7A 5J2BA 4R64A 4DQPA 1ZQXA 4TUSA 4DLEA 3OJSA 3TQ1A 4B9SA 4UBCA 4NLNA 1N56A 1LV5A 5L1IA 8ICIA 3V6KA 1NK8A 1KFSA 4LZGA 2ZUBA 1LB2B 2UVWA 3ZDCA 4QWBA 4UB2A 1SKRA 4B9MA 5HP4A 4KLTA 2NRTA 2F1JA 4F4YA 2W9CA 3MFHA 7ICEA 1T7PA 4YVZA 1Z3EB 1NK0A 7ICRA 4KITB 2UVRA 1D9FA 2VA3A 4KLDA 5IILA 5F9NA 4F4XA 2KZ3A 3Q8KA 2P66A 5KFQA 2AQ4A 3RJEA 1S0OA 4DSKA 4R63A 5KFMA 2PFQA 2BCQA 5KG2A 2DPIA 4NLGA 4F2RA 3TFRA 2IBKA 7ICSA 3RJFA 9ICUA 4C8NA 4EYIB 2XY5A 2VA8A 3M9OB 4DQRA 4YMNA 5KFNA 1XO1A 4ED2A 3JPTA 4M9HA 5D4BA 2BPFA 5KG5A 1B43A 4O3QA 2BCUA 4UAZA 4EBCA 4C8KA 4I29A 1MQ2A 4ED1A 4QW9A 4JK1A 4YXJA 5BPCA 3PMLA 3GIMA 4DOBA 2FPMA 4Z6FA 2XC9A 4ECXA 9ICCA 4JWMA 4UQGA 4F5NA 1ZQRA 4EZ9A 4RT2A 1BPBA 4YQWA 4I27A 8ICPA 1XSNA 4NLZA 2UVVA 4DF4A 2JEGA 4J9SA 4JUZA 5KFXA 2MUTB 4ED8A 1ZJNA 3C2MA 2FLLA 4TQRA 2ASDA 5KFGA 4M47A 3LDAA 5HMLA 4KLIA 5DBBA 5DGAA 4KLFA 4QZDA 4ELUA 5L9XA 3BJYA 4I2FA 4J9LA 5EOZA 4J9OA 3C5GA 3AU6A 2BKEA 9ICMA 9ICHA 5J0WA 4I2BA 3PO4A 1B22A 1S10A 4DL4A 5J0QA 3B0YA 2PFNA 4O3SA 4DSJA 2FMSA 5DB9A 9ICFA 3RAQA 5DDYA 1U45A 5KG1A 2F1HA 4I2HA 5CP2A 3H8SA 3K4GA 4BGDA 4XQ8A 1NKEA 4KLEA 5IINA 1ZQAA 2C2EA 3PVXA 4DQSA 4KLLA 1KFDA 3JPOA 4IRDA 9ICVA 3GIKA 1D8LA 2ZJ8A 4B9VA 2HHQA 5J0RA 4PHPA 4RNOA 1XWLA 2HHXA 3PW4A 3UXNA 2P6UA 3MFIA 5J0OA 3QZ8A 5KFTA 3MBYA 1NK6A 2BCVA 5J0SA 2M9NA 1TKDA 2ZTEA 4ECQA 4XUSA 5CR0A 1CUKA 4IR9A 5KFRA 1ZYQA 1ZQUA 2J6SA 1TK5A 1SL1A 5J0UA 2HVHA 2ZUCA 2AGQA 4J9MA 1BPEA 3H4BA 4RNNA 2FMQA 4KLUA 2C22A 4F8RA 5KFKA 2AGPA 1NK5A 4YFKA 5CHGA 4X5VA 3C2KA 4IQTA 4ECVA 1KEJA 3PW0A 1NK4A 1ZQOA 5DDMA 2BPGA 4KLJA 7ICLA 4RQ4A 3V6HA 4IR1A 5KFBA 1ZQNA 2PFPA 5L1JA 1T8EA 1T4GA 5KT5A 8ICUA 5IIKA 4P4PA 4UBBA 1ZQGA 8ICKA 2H5XA 3EW9A 2IHMA 4QW8A 4P2HA 2R8KA 4RQ0A 4I2DA 3M8SA 4P4MA 4J9RA 2R8IA 3IHQB 4DL7A 4RUAA 4F50A 3RB4A 5DQGA 1BPDA 4IQVA 2PI4A 4YR0A 9ICAA 9ICNA 5J0XA 4KN7A 2ZUDA 4DOAA 1S0NA 3TARA 5L1LA 1XC9A 3ZDBA 2JEJA 1ZQKA 4QWAA 2C2DA 4IQWA 4ECWA 2V9WA 3C2LA 4B9UA 5KFFA 1U4BA 3GILA 5KFSA 2BQ3A 2BHNA 4NXZA 3C1ZA 2WTFA 1SKSA 4ECSA 2XCPA 1L3TA 5DLGA 5EWFA 4LZDA 4F93B 4EBEA 3BDPA 3JPNA 1ZQIA 1UT5A 1XS9D 3BQTA 4TUPA 2IA6A 4QZGA 9ICSA 1BPYA 2AQ0A 3RJJA 3BQ0A 3QEAZ 4LVSA 4MF2A 1DOQA 1COOA 1WCLA 5TZVA 4Q45A 2J6TA 7ICHA 4QWCA 4EBDA 4MEXA 2F1IA 3RJHA 4I2GA 5J2CA 3EWAA 1V9PA 1UA0A 2XGPA 9ICTA 5KFEA 4QZBA 5HHIA 5EWGA 3BQ2A 4GXIA 4DQIA 5KFUA 9ICEA 2B21A 3H8JA 5DB7A 4M0AA 4KMUA 4RZRA 4DWIA 3M8RA 8ICQA 3N97B 4O3OA 3H8WA 4QZEA 3THVA 3RJKA 4UB4A 4DFJA 5DG7A 3TAQA 4IRCA 3FDSA 1MSWD 1RYSA 4KLMA 9ICIA 9ICLA 3PX4A 4F4ZA 3OSNA 5J0PA 4KTQA 5J0TA 3GV5B 4PHEA 1IXRA 9ICBA 1ZQWA 3PW7A 1Z00B 1S97A 3MABA 4O3PA 1BPZA 3UPQA 4BWJA 4BXOA 1ZQTA 4ECUA 8ICWA 4PHDA 4PGXA 3Q8LA 1ZJMA 4R66A 4ELVA 5HMMA 2NRVA 4PPXA 1S77D 2ZJAA 4YCXA 4I2JA 1HUOA 2C2RA 1MC8A 4O3NA 8ICOA 3Q8QB 3ZD8A 5J2JA 4QZ8A 4KN4A 4HYKA 3OHAA 3HX0A 1D8YA 1QSYA 4QZIA 4M6WA 7ICNA 1NK7A 1RXVA 3RB0A 8ICVA 4RPXA 3KHGA 1S76D 1TK0A 1EXNA 3HW8A 1UA1A 5JUMA 2I1QA 4M9GA 4JWNA 1RPLA 3Q8MA 1RYRA 4FS1A 1QSSA 2NRWA 1ZQPA 4O5EA 4KLGA 3NGDA 2KN7A 1ZQQA 2ASJA 4ECTA 3UXOA 9ICQA 5J2HA 3C21A 1UT8A 4RQ3A 2FMPA 4RQ8A 4EZ6A 3MR3A 1KDHA 4MFCA 4PGYA 2ISOA 2IHNA 2FLNA 4B9TA 4FBTA 4I28A 4DS4A 1ZQJA 3M9MB 3KHRA 2ZTCA 1L3SA 4PGQA 2W9BA 3RTVA 4UB5A 4FS2A 4DLGA 3QZ7A 1BPXA 2A1JA 4Q8EA 1BGXT 1ZQCA 3RJIA 4Q43A 3NTUA 5KT7A 4XA5A 4P4OA 5KT2A 3PR5B 3MDAA 1ZQBA 4I2AA 4QZAA 4DL3A 3V7LA 1ZQYA 3C5FA 4DO9A 3RB6A 4DSLA 3T5KA 3H7IA 5DBCA 5HNKA 1BVSA 1U47A 3GIJA 5L1KA 3T5HA 2XO7A 4NM1A 5J2KA 2ATLA 4QWEA 3TAPA 3H4DA 2W9CB 3KHLA 3ZDEA 8ICJA 4Q44A 1ZQFA 5KTQA 4MEYA 4M2YA 1TAQA 7ICVA 4DL6A 4QZFA 4ZH4A 1HJPA 1X9MA 8ICBA 4YD1A 4C8MA 2AU0A 1T3NA 5DB6A 8ICGA 5KT4A 3UQ2A 4NY8A 1TVAA 4DL2A 4FO6A 3RR7A 3PW5A 5KG6A 3E2EA 3GV8B 4F5QA 4UAYA 3C23A 8ICEA 1TK8A 4DQQA 4K4IA 5DQIA 2FPKA 3T5JA 4Q8FA 1NK9A 1L3VA 5J29A 2JEIA 1NJZA 4F91B 2BPCA 4RT3A 4BXOB 5J2FA 4QWDA 2Y1IA 1QSLA 5D46A 8ICTA 3EPGA 3RRGA 4ECZA 4DFMA 1L3UA 1QLNA 4JV2A 3SZ2A 3BQ1A 1ZQDA 5IIIA 2PI5A 2V4QA 2JZBA 4NLKA 2BQRA 1U48A 1SL0A 4FBUA 1JMSA 3GFKB 3AUOA 1S9FA 1NOMA 4TURA 2C28A 7ICFA 1TV9A 3EPIA 1X9WA 4RQ1A 3Q8RB 9ICJA 4M6WB 4RQ6A 4PH5A 4DOCA 4DSIA 1XSLA 1N48A 5DQHA 3TFSA 3GDXA 1CEZA 2BDPA 1A76A 3SV3A 2XCAA 3ISCA 3QE9Y 1JX4A 4IRKA 1RZTA 4RU9A 2HHUA 2W8LA 3ZDAA 3MR6A 3HP6A 4I2IA 4Z6DA 3PR4A 4Z6EA 5CJ7A 5KFVA 4E0DA 4RQ5A
chains in the Genus database with same CATH superfamily
1V38A 1PZNA 3I28A 4QZ9A 4IC9A 4DEZA 8ICNA 4NM2A 4DF8A 3MDCA 1Q3UA 1RXWA 3LYSA 5KFIA 2A1JB 9ICOA 5KT6A 4BWMA 3M9NB 5KG7A 1NZBA 2YMMA 2CXYA 1OXJA 1K1SA 2R8HA 3IP4B 7ICGA 3T5LA 2R8JA 5BOLA 1JIHA 1V97A 2O6KA 1KTQA 5AM0A 2RHFA 4GXJA 3FYHA 3ZDDA 4KLSA 4GIBA 4C8OA 1WCNA 5KFOA 4JV1A 7ICKA 2NRXA 3WU2U 5AI0A 2RDJA 3V7JA 3RB3A 2W11A 4J9NA 2BGWA 1L8OA 1TAUA 3C28A 4Z6CA 3F53A 4ELTA 3AEVA 2LYHA 1PVQA 5AI9A 8ICHA 4MHVA 2KFNA 3I1YA 3WKBA 4UAWA 1D9DA 4O5KA 2ZJ5A 5T14A 3RH4A 2WF9A 7ICQA 3TI0A 4YN4A 4IQUA 3UM9A 3HWTA 3MR2A 3LWLA 2LBOA 3JPQA 4PJ0U 4QIWC 5DG8A 3OSPA 4BDPA 4US8A 3EZ5A 2FE9A 2KZMA 4NL9A 4QIWF 8ICMA 5AKYA 4JB3A 7ICJA 4PL1A 5AM3A 2NO4A 3C1YA 2BR0A 4F2SA 3PX6A 3WK5A 3GIIA 2Y1JA 5J2GA 2RQ5A 1TE2A 2KIVA 1JXLA 1ZOLA 1IM4A 2EQYA 2ZIVA 4C80A 2DGZA 2JH1A 3ISDA 1ZQMA 1J2NA 3QU5A 4UB6U 5J0YA 2VIXA 2WB1F 2YN4A 2P6RA 1YZ7A 7ICUA 3G6XA 3GU3A 3EYZA 3UXPA 4K4GA 4RQ2A 2AGOA 5AIAA 4J9KA 2E8OA 1ZQXA 1QH9A 4UBCA 3H0RB 8ICIA 3V6KA 1KFSA 3ZDCA 1SKRA 2W9CA 1Z3EB 2L5YA 2UVRA 2VA3A 1ZXIA 1OW5A 2KZ3A 4DSKA 4R63A 5KFMA 2BCQA 2IBKA 9ICUA 2XY5A 4DQRA 3PSPA 2PMZF 3GZFA 1RQNA 1RYUA 2K60A 1B43A 5J8YC 2BCUA 4PZOA 2H3IA 2LYBA 1MQ2A 4QW9A 4YXJA 3PMLA 2FPMA 4IS7A 4JWMA 1JALA 1ZQRA 4EZ9A 2MU2A 4DF4A 2JEGA 4ED8A 2FLLA 5KFGA 5HMLA 1COKA 2KK0A 3FM9A 4J9OA 3AU6A 2BKEA 2ZIVB 9ICHA 1DK2A 4LJXA 4I2BA 1B22A 5J0QA 2PFNA 5AKLA 5DB9A 2FMSA 3UMCA 2HBKA 2EZYA 5KG1A 5CP2A 4BGDA 4KLEA 2C2EA 3JPOA 2ZJ8A 1YZ6A 4B9VA 3PW4A 3UXNA 4CGZA 4C7YA 5CR0A 5AKHA 1ZYQA 2J6SA 2HVHA 2AGQA 4J9MA 3D2QA 4RNNA 2HCFA 1L7NA 4F8RA 5KFKA 3NRZA 4NL9C 1NK4A 1S8OA 5EE9A 2HI0A 4RQ4A 1MN8A 2OM6A 5AK5A 8ICKA 2H5XA 2W3RA 2IHMA 5EE0A 4P2HA 3WKCA 2ZXIA 4I2DA 3IHQB 4DL7A 4RUAA 4F50A 5DQGA 2PI4A 1Z4NA 3ZDBA 2EAMA 3F2CA 2HDOA 3PZPA 2KMDA 2BHNA 4NXZA 3C1ZA 4C4TA 2WTFA 5DLGA 4EBEA 4LZDA 4F93B 2LMRA 3A0HU 4TUPA 4B6JA 4QZGA 4OJPA 2DKXA 2J6TA 1COOA 4Q45A 1O03A 1DK3A 5J2CA 3KD3A 2XGPA 4QZBA 4GXIA 5KFUA 9ICEA 3N97B 4O3OA 4DFJA 4KLMA 4KTQA 2GO7A 3PW7A 1Z00B 3M6ZA 1ZRNA 4UASA 2Y9TA 2YB1A 3Q8LA 4R66A 4ELVA 2KVCA 4PPXA 4YCXA 5ALKA 1PVRA 1S5LU 3ZD8A 1P7DA 4HYKA 1D8YA 2KE7A 2JMGA 7ICNA 8ICVA 3L4PA 4RPXA 1S76D 3M1YA 5E79U 4M9GA 1RYRA 1ZQPA 2WHEA 3H8MA 2JXJA 5J2HA 3C21A 2E1EA 4C7ZA 1HEKA 4MFCA 3PSFA 5KL1B 1SV4A 1PUZA 2GLEA 3RTVA 1T3QA 2QKQA 3RJIA 2B0CA 4XA5A 4P4OA 4DL3A 1ZQYA 3AQFA 3RB6A 2LYAA 3ED5A 1BVSA 4NM1A 4NJ8A 4EX7A 4QWEA 2ATLA 3H4DA 2DBYA 3ZDEA 2FI1A 2EAOA 2YMQA 3S6JA 4NV0A 4DL6A 4ZH4A 2KD1A 2K4HA 8ICBA 2AU0A 3TKAA 2W04A 4FO6A 3E2EA 4UAYA 8ICEA 2JHDA 2JEIA 1NJZA 1N5XA 2BPCA 5J2FA 5D46A 3EPGA 1QQ7A 3SZ2A 5IIIA 5ALDA 1SL0A 3KFUF 3GFKB 4TURA 3EPIA 3WK7A 4FZMA 3QUTA 2XCAA 4IRKA 1X42A 4Z6DA 5K4LA 4Z6EA 4UB1A 4E0DA 2CPRA 1SWVA 1NKBA 4CF4A 1ZQZA 5AKKA 3KZIU 3RAXA 5KFHA 4QZCA 5J2IA 3WKDA 2YQEA 3HT3A 4O3RA 5J2EA 2WF5A 8ICCA 2Z7JA 4F71A 4TQSA 4G3IA 2F44A 3SV4A 5KFDA 5AKIA 2OWOA 1UCVA 2DL0A 4UB8U 4F5OA 2HHWA 1ZD2P 2R18A 2HW3A 9ICWA 4DSEA 3QEBZ 4YP3A 4B9NA 1HIWA 8ICSA 5J2DA 3N4MB 2E5SA 4GLXA 1X9SA 4MFAA 1SXEA 3RBDA 3ZI4A 1JN3A 2YTUA 2AJQA 5AKXA 2BCRA 8ICFA 1SXDA 3JPRA 1Q46A 4CCHA 3PO5A 9ICRA 2H3FA 4F4WA 4CF3A 1LKYA 1DGSA 2VKQA 1TFRA 5KG3A 1HUZA 4ED3A 2E8PA 3TACB 1KSPA 2K89A 1JROA 5ALWA 4EX6A 3MGIA 2PXIA 8ICLA 1A6SA 3RH6A 3KZXA 2F77X 3ETLA 4M04A 1SZPA 2GOLA 3MGVA 5BOMA 3IN5A 3KHHA 1D8BA 2MAXA 3PW2A 4ED7A 4RPYA 4F4KA 3K75D 2EDUA 1MQ3A 2HVIA 2Q4TA 3UQ0A 1ZQVA 4P0QA 2F3NA 1SV0C 3KKAC 2KSOA 4AYBC 3MGHA 3GQCA 4F5PA 1AQ6A 2LKYA 2HHSA 9ICGA 4K4HA 4YR3A 1L7PA 4RQ7A 3WK8A 2FPLA 5KFJA 3TADA 4U6PA 4ECYA 4Y2YA 3KOOA 5ALZA 3H40A 5F3XB 3G6VA 5CB1A 1S0VA 3LWMA 5DKWA 3PSTA 4YR2A 4DSFA 4YMOA 3H0LB 4RNMA 5KFCA 3JPPA 5AI8A 5ALOA 4DLEA 4B9SA 4NLNA 4NLCA 5L1IA 1LB2B 3WK9A 2UVWA 3AM9A 4B9MA 2NRTA 2F1JA 2RRDA 2W03A 5ALQA 4YVZA 4US9A 7ICRA 1RG6A 1JUDA 1LKYB 4F4XA 2P66A 2G5HB 3T79A 1S0OA 2PFQA 5KG2A 4NLGA 1PK1B 2JRZA 3BZKA 4YMNA 5KFNA 1XO1A 3JPTA 4M9HA 3AQEA 5KG5A 4JK1A 4ECXA 2HBLA 5AKZA 3M6KA 3QUCA 1BPBA 4YQWA 8ICPA 1IV8A 4NLZA 3ONNA 1ZJNA 3C2MA 4P0QB 4TQRA 2ASDA 5AHXA 3LDAA 4KMOB 2KSOB 4KLIA 5DGAA 5L9XA 3HKZC 5EOZA 3OTQA 1V85A 5ALVA 5ALGA 1S10A 5ALYA 4DL4A 4DSJA 3RAQA 1U45A 2F1HA 3EUB2 3HKZF 4Y2XA 4XQ8A 4CDGA 1ZQAA 3PVXA 4DQSA 4IRDA 9ICVA 4OCZA 5G5HA 3NVVA 2HHQA 5AKEA 3LVVA 5J0RA 1XWLA 1TAMA 1BNOA 3QZ8A 3MBYA 4RQNA 2F8KA 1X6JA 2M9NA 1X66A 2ZTEA 4ECQA 4DFDA 4A8EA 3LVWA 5KFRA 5ALHA 3NVWA 3SENA 2C22A 1KKXA 1NK5A 3PW0A 1KEJA 1FFUA 7ICLA 5KFBA 2PFPA 5L1JA 1T8EA 5IIKA 4P4PA 3EW9A 3OPXA 3WK6A 3NRWA 3M8SA 5ALMA 3RB4A 4IQVA 9ICNA 3J81j 9ICAA 4KN7A 1JI7A 3N7PD 1XC9A 2W7OA 2LPEA 4IQWA 2C2DA 3CW2C 5GTHU 2BQ3A 1UQVA 2XCPA 1L3TA 3BDPA 1Z1BA 3JPNA 1XS9D 3BQTA 3IG5A 2H3QA 2IA6A 4QJFB 9ICSA 2AQ0A 4ACOA 2DKZA 1DOQA 2YMLA 5FP0A 3SEIA 4Y2PA 4EBDA 4MEXA 3RJHA 1UA0A 9ICTA 1LVHA 5HHIA 2LM1A 4DQIA 2B21A 4RZRA 8ICQA 3D6JA 5DG7A 2ZXHA 3F5EA 1RYSA 9ICLA 4F4ZA 1IXRA 9ICBA 1ZQWA 1N60A 3ALRA 3SD7A 1ZD4A 1BPZA 4OJLA 3U26A 1ZQTA 3HRDD 2D8CA 1ZJMA 2ZJAA 1HUOA 2C2RA 1MC8A 1VDVA 4O3NA 1N62A 3OHAA 3HX0A 1NK7A 3RB0A 1EXNA 1UA1A 4PL2A 3E58A 5AM1A 1VLBA 1ZQQA 2ASJA 9ICQA 2FMPA 2YB4A 2IHNA 4EELA 4I28A 4DS4A 3B9JA 1ZQJA 3KHRA 2W9BA 3QZ7A 1ZQCA 3DEEA 2KHVA 2ZIXA 4I2AA 1ZQBA 1M6YA 3V7LA 3SAHA 5AICA 5HNKA 3SAFA 5J2KA 2W9CB 3KBBA 4BUGA 8ICJA 1ZQFA 5KTQA 4MEYA 1TAQA 7ICVA 1X9MA 8ICGA 5KT4A 4NY8A 3RR7A 4DL2A 1QCKA 3PW5A 5KG6A 2OXOA 2JR5A 1TK8A 5DQIA 2RP5A 2FPKA 4Q8FA 5J29A 4Y2UA 4CF5A 3HILA 4RT3A 2Y1IA 1WWUA 3M7DA 3QU9A 4OD0A 1QLNA 4JV2A 2RLTA 3A0BU 1ZQDA 2JZBA 4NLKA 2BQRA 3NVYA 3SAGA 4RQ1A 3Q8RB 1RQLA 2K8BB 4DOCA 5DQHA 3TFSA 3GDXA 1CEZA 3ISCA 3QE9Y 1NI3A 5AIBA 4RU9A 2YMPA 3ZDAA 4I2IA 2YX8A 4KLOA 8ICXA 5ALNA 4Y2JA 4JV0A 2ISPA 4J03A 2IOHA 4CE6A 5KFWA 2KTQA 2KJ5A 5KFPA 5EWEA 1CI4A 2BQUA 4O0IA 4R8UA 4KLHA 5HHHA 1X2IA 4EYHB 3IM1A 2W9BB 2GH1A 5KG4A 2EAPA 2ZIXB 2HOQA 5F9LA 2QB0A 1KLNA 3N28A 5KFLA 2A1AA 2XY6A 5C5JA 1ZQEA 8ICRA 3PX0A 3QNMA 5KL8B 3MR5A 2V4RA 4EEYA 3T3FA 2JEFA 2VJ4A 1ZD5A 3N7SC 1Z19A 5IIOA 2W9MA 2R8GA 4YXMA 3BS7A 3L3FX 2ASLA 2EZZA 3DV9A 1L5UA 2KJ8A 2ALZA 1KFTA 3RH5A 1F44A 7ICTA 4YG2A 2W7PA 5C0YA 2Q0ZX 1QQ5A 3Q8PB 1K1QA 2LI6A 2E8NA 4M9JA 9ICPA 3G6YA 2I9GA 2LM4A 4Y2SA 1NKCA 4UATA 2JZBB 2UVUA 4ED6A 3AU2A 4MF8A 2OHFA 3O0FA 7ICPA 2NYVA 3OJUA 2FDRA 2P35A 2DPJA 4UW9A 1WG8A 2KG5A 4Y2TA 1J97A 5KNIA 4F3OA 1KRPA 1H38A 1RM6C 2FLPA 3CYMA 5KFYA 4M9LA 3RJGA 2VANA 1NJWA 4FE3A 1FO4A 3QYPA 2XGQA 2HHVA 4JMUA 4R8UB 5CWRA 3ISBA 3IG8A 4F92B 1MA7A 4J9QA 3QU7A 2QLTA 2RDIA 3PMNA 2ZIUA 3PV8A 1KQQA 2HHTA 2MUTA 2DFLA 8ICAA 5AI5A 3UMGA 4QZHA 1BNPA 2WAQC 2KIWA 3V72A 2G06A 1NNLA 3LK9A 4DS5A 4B9LA 7ICMA 2VA2A 4MFFA 4ECRA 1U9LA 2B6GA 4GC6A 1SL2A 4ED0A 1QTMA 5D49A 2HSZA 4I2EA 5IIJA 3GV7B 2QB1A 1X9XA 4GC7A 4R64A 4TUSA 3TQ1A 3OJSA 4FZLA 1N56A 2KKVA 2ZUBA 4QWBA 4UB2A 5EE3A 2EANA 7ICEA 3K1RB 4F4YA 3MFHA 1T7PA 4HAIA 1NK0A 4KITB 1D9FA 5AK4A 3Q8KA 5ALTA 2Y9UA 2DPIA 2NO5A 4F2RA 3TFRA 7ICSA 1ED1A 2VA8A 2HBMA 2HOFA 2BPFA 2KP7A 1B4FA 4EBCA 4C8KA 4ED1A 3GIMA 5BPCA 4Z6FA 9ICCA 5HR7A 4RT2A 3F2BA 5TISU 2K4PA 2MSNA 3UMBA 3CRXA 4J9SA 5KFXA 2MUTB 5AI4A 4M47A 2KNJA 4KLFA 4ELUA 4J9LA 3DDHA 2WF8A 3K1ZA 5J0WA 3PO4A 4KX3A 4O3SA 5DDYA 4I2HA 2DF4B 1NKEA 4KLLA 5ALJA 3GIKA 1D8LA 3NVZA 2KOBA 5ALFA 5J0OA 1NK6A 2ZG6A 1ZD3A 1TKDA 1TK5A 1SL1A 1CRXA 1BPEA 4KLUA 2AGPA 2XICA 3I76A 4YFKA 5CHGA 4X5VA 4IQTA 4ECVA 1N2XA 4KLJA 2BPGA 1GO3F 1ZQNA 8ICUA 1T4GA 5KT5A 5EE1A 4UBBA 1ZQGA 2R8KA 4USAA 4P4MA 4J9RA 1BPDA 2Y0SC 5A0LA 5J0XA 2ZUDA 2VJ5A 4DOAA 4AYBF 3IV6A 1S0NA 3TARA 5L1LA 2JEJA 4ICAA 4ECWA 2V9WA 3C2LA 4B9UA 5KFFA 5KFSA 3RFAA 1Q3VA 2Y0SF 4ECSA 5B66U 5EWFA 1ZQIA 3BZCA 4F72A 4OO1J 1BPYA 3RJJA 3BQ0A 4MF2A 1WCLA 5TZVA 7ICHA 2E8MA 2DUYA 5ALIA 2F1IA 4I2GA 1V9PA 5AKJA 3QUQA 3E0FA 3BQ2A 1KBUA 2F2AB 1XO0A 5DB7A 2YY6A 4KMUA 4OJOA 3M8RA 1C20A 4QZEA 3THVA 3RJKA 2D3DA 3TAQA 1MSWD 2I6XA 2F76X 4IRCA 3FDSA 3PX4A 5J0PA 4BJQA 1S97A 4O3PA 2HOIA 4PZNA 4BWJA 4ECUA 4PHDA 4PGXA 3IDWA 3SR6A 2NRVA 1XNSA 2IOFK 4I2JA 2K4IA 5J2JA 5J8YA 4QZ8A 4KN4A 2ZIWA 4QZIA 4M6WA 3KHGA 2AHOB 5JUMA 2I1QA 4NWIA 4UAUA 1FFVA 4O5EA 3VC8A 4KLGA 2KN7A 3PSIA 4ECTA 3UXOA 4GFJA 4RQ8A 1KDHA 4PGYA 2ISOA 2W43A 2JV3A 2FLNA 2ZTCA 2W55A 5JTIA 1K5OA 1BPXA 1ECWA 4Q8EA 1BGXT 3R9KA 1IIPA 4QNLA 5KT7A 1SZHA 3NS1A 5KT2A 2BDUA 3MDAA 1QQ6A 2K8CB 5HR6A 4DSLA 3T5KA 3H7IA 1N63A 2G5IB 2G08A 1U47A 1WYGA 2XO7A 4ZOHC 3TAPA 4CRXA 3KHLA 4Q44A 4FZNA 1HJPA 2FJ6A 4C8MA 5AK3A 3UQ2A 1TVAA 3C23A 4K4IA 2KEYA 3T5JA 5ALUA 3H0MB 1NK9A 1RDFA 2ODGA 1FEZA 3BS5A 1DXSA 1QSLA 3RRGA 1SIJA 4ECZA 1L3UA 2G09A 1ZQ1C 3BQ1A 1JMSA 3AUOA 7ICFA 3TADC 1TV9A 1X9WA 3AL0B 2ZIWB 2WB1C 4M6WB 4RQ6A 4C0ZA 2BDPA 3SV3A 1JX4A 1RZTA 4UAVA 1UPHA 2W8LA 3ETRA 5KFVA 5H2FU 2PKEA 2KVSA 1DRGA 8ICYA 2IMWP 2N1RA 4YD2A 4DFKA 4O5CA 4KLQA 3HPOA 1Z1VA 2ZTDA 3PNCA 2XY7A 5B5EU 3AMZA 1O08A 3Q8SB 4XRHA 2KKPA 5CA7A 2LHTA 4J9PA 2PMZC 4BX9C 5J2AA 3SQIA 4RUCA 1ZQSA 3QXGA 2E3TA 4C8LA 3RR8A 1F5SA 8ICZA 3TANA 4WJ3B 1PVPA 2NRZA 2WF7A 3JPSA 3SYZA 1NJYA 4UB3A 5L1MA 5KFAA 3BS5B 4RQMA 3OHBA 4Y2VA 4R65A 2W9AA 3PY8A 1IG6A 2KFZA 5AM2A 5KFZA 1A77A 4DFPA 2PFOA 3CNHA 4TUQA 2G0AA 1U49A 3ORYA 4I2CA 5G5GA 1XSPA 1XU4A 1Y88A 5DLFA 1SKWA 1ZQHA 5DG9A 3ZD9A 2CRXA 1C7YA 9ICKA 2W8KA 1SWWA 4GXKA 9ICXA 1L6NA 4DL5A 3RBEA 1NJXA 2K8AA 1Z00A 1AROP 1S0MA 1ZQLA 2BCSA 1JRPA 4NLBA 4O9MA 1URJA 2NV3A 3IRUA 2JGAA 3B0XA 3V6JA 4UARA 4YMMA 3SMVA 1NZPA 5DGBA 5DB8A 4M9NA 2DQNB 5AM5A 3V7KA 2GWSA 3MC1A 1L8LA 2H3ZA 4EEKA 5IIMA 3RRHA 5ALPA 5DBAA 1Z4OA 3OGUA 2OEHA 4PHAA 3CP8A 5AM4A 5ALEA 4F5RA 2KZZA 4RPZA 2J6UA 7ICIA 1JXEA 3KTQA 5KT3A 5KG0A 1ZETA 7ICOA 4IL6U 1T94A 2KICA 3SI8A 3AN1A 5KAIU 5J2BA 4DQPA 2I5HA 1LV5A 1NK8A 2OCEA 4LZGA 2IOFA 5CEHA 4KLTA 5HP4A 4G9BA 4KLDA 5IILA 5F9NA 1L7MA 5KFQA 1KL9A 2AQ4A 3RJEA 3RJFA 4C8NA 4EYIB 3M9OB 3HJEA 2JH7A 4ED2A 2WF6A 5D4BA 1WWVA 2D6FC 4O3QA 4UAZA 4I29A 1N61A 2WFAA 4DOBA 2XC9A 4UQGA 4F5NA 4FFDA 4I27A 4C4SA 1XSNA 2UVVA 3QU4A 4JUZA 2MRLA 2BZFA 5DBBA 4QZDA 3BJYA 4I2FA 1F0MA 3C5GA 9ICMA 1N5WA 2AXTU 5ALXA 3B0YA 9ICFA 4Y2RA 1J2MA 2CN1A 2QARA 3H8SA 3K4GA 5IINA 5AK6A 1Q8KA 1KFDA 2XIDA 2KV2A 5ALSA 4PHPA 4RNOA 2HHXA 4P0PA 2K4EA 2ES6A 2P6UA 3MFIA 5KFTA 3VCBA 4C4RA 2BCVA 5J0SA 1L7OA 1OUQA 4XUSA 4IR9A 1CUKA 1ZQUA 1SGGA 4U7CA 4OJ5A 5J0UA 2ZUCA 3H4BA 2KJ9A 5AI6A 2FMQA 2QB0B 1B0XA 4AP9A 5ALRA 3NUQA 3C2KA 1ZQOA 2ESEA 5DDMA 3V6HA 4IR1A 5JRTA 1DGJA 2W54A 4QW8A 4RQ0A 2EH9A 1SV0A 5JU5A 4OJ6A 2R8IA 3KKAA 4YR0A 2A19A 2WAQF 1ZQKA 4QWAA 2EZXA 1U4BA 5KAFU 3GILA 4O3MA 2DWQA 5CRXA 1SKSA 2MA1A 1UT5A 1X40A 2HMXA 3WKAA 3D2NA 3QEAZ 4LVSA 1VJ5A 2H3VA 2A3VA 4DCCA 4QWCA 3EWAA 5KFEA 5EWGA 3H8JA 4M0AA 3QU2A 4DWIA 2QARB 3QX7A 1UHUA 3H8WA 4UB4A 3FC4A 2HBJA 9ICIA 5AKGA 3OSNA 5J0TA 1YT3A 3GV5B 4PHEA 4P0PB 3MABA 3UPQA 3FAHA 4KX5A 4BXOA 8ICWA 3ICXA 5HMMA 2KHQA 3RF9A 1S77D 2G07A 8ICOA 3Q8QB 1QSYA 2ZIUB 1RXVA 1KN5A 1TK0A 3HW8A 4EENA 4JWNA 1RPLA 3Q8MA 2XI9A 4FS1A 1QSSA 2NRWA 5GTIU 3NGDA 1UT8A 4RQ3A 4EZ6A 3MR3A 2W3SA 2XVTA 3D2SA 4B9TA 4FBTA 3NASA 2AH5A 2M0NA 2OH2A 3M9MB 1L3SA 2OYYA 4PGQA 4UB5A 4FS2A 1X6IA 4DLGA 2A1JA 3C29A 4Q43A 3NTUA 3L5KA 3QUBA 3PR5B 4QZAA 1ZRMA 3C5FA 4DO9A 5DBCA 3GIJA 5L1KA 3T5HA 3BQ7A 4M2YA 4QZFA 1FIQA 1PK1A 4YD1A 1PK3A 1T3NA 3N7RC 5DB6A 3GV8B 4F5QA 1KW4A 4DQQA 2E1FA 1L3VA 2F8LA 4CNQA 4F91B 3F2DA 4BXOB 4QWDA 3WK4A 8ICTA 4Y2QA 4DFMA 2PI5A 2V4QA 3F5AA 1U48A 4FBUA 1SB3C 1S9FA 1NOMA 2C28A 5ALLA 1WUDA 9ICJA 4PH5A 4DSIA 1XSLA 1N48A 1A0PA 1A76A 2HHUA 3MR6A 3WKEA 3HP6A 3PR4A 5CJ7A 4RQ5A
chains in the Genus database with same CATH topology
4KLOA 8ICXA 1PZNA 1NKBA 4JV0A 2ISPA 5KFWA 2KTQA 8ICYA 4QZ9A 1ZQZA 2IMWP 5KFPA 5EWEA 4YD2A 4DEZA 8ICNA 4NM2A 4DFKA 4DF8A 4O5CA 3RAXA 2BQUA 5KFHA 4QZCA 4O0IA 3MDCA 4KLQA 3HPOA 1RXWA 4R8UA 4KLHA 2ZTDA 5KFIA 5HHHA 1X2IA 5J2IA 4EYHB 3HT3A 3PNCA 3IM1A 4O3RA 5J2EA 2W9BB 2XY7A 8ICCA 2A1JB 9ICOA 5KT6A 3Q8SB 5KG4A 4XRHA 4TQSA 4G3IA 4BWMA 3SV4A 5CA7A 5KFDA 4J9PA 5F9LA 3M9NB 1KLNA 5KG7A 5KFLA 5J2AA 2XY6A 2OWOA 1K1SA 5C5JA 4RUCA 1ZQEA 8ICRA 2R8HA 3PX0A 7ICGA 1ZQSA 3T5LA 2R8JA 5BOLA 1JIHA 3MR5A 2V4RA 1KTQA 4EEYA 3T3FA 4C8LA 3RR8A 2JEFA 4F5OA 4GXJA 3FYHA 2W9MA 5IIOA 2R8GA 8ICZA 2HHWA 4YXMA 3TANA 3ZDDA 4KLSA 2ASLA 2NRZA 1L5UA 4C8OA 2HW3A 9ICWA 2ALZA 4DSEA 3JPSA 3QEBZ 3SYZA 1WCNA 4YP3A 1NJYA 4B9NA 4UB3A 1KFTA 3RH5A 7ICTA 4YG2A 5KFAA 8ICSA 5KFOA 2Q0ZX 5J2DA 3OHBA 4GLXA 3N4MB 1X9SA 4JV1A 7ICKA 4R65A 4MFAA 3Q8PB 1K1QA 2NRXA 2W9AA 3PY8A 4M9JA 2KFZA 9ICPA 2RDJA 5KFZA 3V7JA 3RBDA 3RB3A 3G6YA 2I9GA 1JN3A 1NKCA 2JZBB 1A77A 2UVUA 4J9NA 4ED6A 3AU2A 4MF8A 4DFPA 2BGWA 2PFOA 2AJQA 7ICPA 2BCRA 1TAUA 8ICFA 4Z6CA 3OJUA 3JPRA 4TUQA 4ELTA 1U49A 3ORYA 2DPJA 4CCHA 3PO5A 2LYHA 8ICHA 9ICRA 4I2CA 1XSPA 2KFNA 4UAWA 4F3OA 4F4WA 1KRPA 1XU4A 1H38A 1D9DA 1Y88A 5DLFA 1SKWA 1DGSA 4O5KA 2FLPA 2ZJ5A 1ZQHA 5DG9A 3ZD9A 1TFRA 5KG3A 3RH4A 7ICQA 1HUZA 4ED3A 3TI0A 5KFYA 1C7YA 4YN4A 9ICKA 4M9LA 2W8KA 1KSPA 4IQUA 3RJGA 2VANA 3HWTA 4GXKA 1NJWA 3MR2A 9ICXA 4DL5A 3RBEA 1NJXA 3LWLA 1Z00A 3JPQA 1AROP 3MGIA 2PXIA 2XGQA 1S0MA 2HHVA 8ICLA 5DG8A 3RH6A 3OSPA 4BDPA 1ZQLA 4R8UB 5CWRA 3EZ5A 3ISBA 2BCSA 3ETLA 4O9MA 4M04A 2KZMA 1SZPA 4F92B 3B0XA 5BOMA 4J9QA 3KHHA 3V6JA 2MAXA 2RDIA 8ICMA 4YMMA 3PW2A 4ED7A 4RPYA 4F4KA 7ICJA 3PMNA 3K75D 5DGBA 5DB8A 3PV8A 1MQ3A 2HVIA 4M9NA 3C1YA 2HHTA 2BR0A 4UB1A 4F2SA 3PX6A 2MUTA 3UQ0A 2DFLA 1ZQVA 3V7KA 2GWSA 8ICAA 3GIIA 3GQCA 3MGHA 4QZHA 3RRHA 5IIMA 5DBAA 2Y1JA 5J2GA 4F5PA 3OGUA 3V72A 1JXLA 2HHSA 9ICGA 1IM4A 4K4HA 4YR3A 3LK9A 4RQ7A 4DS5A 4B9LA 2FPLA 5KFJA 7ICMA 4PHAA 3ISDA 1ZQMA 4ECYA 5J0YA 2VA2A 4MFFA 4ECRA 4F5RA 1U9LA 2KZZA 3H40A 4GC6A 4RPZA 1SL2A 3G6VA 5CB1A 4ED0A 1QTMA 2J6UA 7ICIA 1JXEA 3KTQA 5KT3A 1S0VA 5KG0A 3LWMA 5D49A 1ZETA 5DKWA 2P6RA 7ICUA 7ICOA 4YR2A 4DSFA 4I2EA 4YMOA 4RNMA 3G6XA 5KFCA 5IIJA 3EYZA 3UXPA 4K4GA 3GV7B 4RQ2A 3JPPA 3SI8A 2AGOA 4J9KA 4GC7A 5J2BA 4R64A 4DQPA 1ZQXA 4TUSA 4DLEA 3OJSA 3TQ1A 4B9SA 4UBCA 4NLNA 1N56A 1LV5A 5L1IA 8ICIA 3V6KA 1NK8A 1KFSA 4LZGA 2ZUBA 1LB2B 2UVWA 3ZDCA 4QWBA 4UB2A 1SKRA 4B9MA 5HP4A 4KLTA 2NRTA 2F1JA 4F4YA 2W9CA 3MFHA 7ICEA 1T7PA 4YVZA 1Z3EB 1NK0A 7ICRA 4KITB 2UVRA 1D9FA 2VA3A 4KLDA 5IILA 5F9NA 4F4XA 2KZ3A 3Q8KA 2P66A 5KFQA 2AQ4A 3RJEA 1S0OA 4DSKA 4R63A 5KFMA 2PFQA 2BCQA 5KG2A 2DPIA 4NLGA 4F2RA 3TFRA 2IBKA 7ICSA 3RJFA 9ICUA 4C8NA 4EYIB 2XY5A 2VA8A 3M9OB 4DQRA 4YMNA 5KFNA 1XO1A 4ED2A 3JPTA 4M9HA 5D4BA 2BPFA 5KG5A 1B43A 4O3QA 2BCUA 4UAZA 4EBCA 4C8KA 4I29A 1MQ2A 4ED1A 4QW9A 4JK1A 4YXJA 5BPCA 3PMLA 3GIMA 4DOBA 2FPMA 4Z6FA 2XC9A 4ECXA 9ICCA 4JWMA 4UQGA 4F5NA 1ZQRA 4EZ9A 4RT2A 1BPBA 4YQWA 4I27A 8ICPA 1XSNA 4NLZA 2UVVA 4DF4A 2JEGA 4J9SA 4JUZA 5KFXA 2MUTB 4ED8A 1ZJNA 3C2MA 2FLLA 4TQRA 2ASDA 5KFGA 4M47A 3LDAA 5HMLA 4KLIA 5DBBA 5DGAA 4KLFA 4QZDA 4ELUA 5L9XA 3BJYA 4I2FA 4J9LA 5EOZA 4J9OA 3C5GA 3AU6A 2BKEA 9ICMA 9ICHA 5J0WA 4I2BA 3PO4A 1B22A 1S10A 4DL4A 5J0QA 3B0YA 2PFNA 4O3SA 4DSJA 2FMSA 5DB9A 9ICFA 3RAQA 5DDYA 1U45A 5KG1A 2F1HA 4I2HA 5CP2A 3H8SA 3K4GA 4BGDA 4XQ8A 1NKEA 4KLEA 5IINA 1ZQAA 2C2EA 3PVXA 4DQSA 4KLLA 1KFDA 3JPOA 4IRDA 9ICVA 3GIKA 1D8LA 2ZJ8A 4B9VA 2HHQA 5J0RA 4PHPA 4RNOA 1XWLA 2HHXA 3PW4A 3UXNA 2P6UA 3MFIA 5J0OA 3QZ8A 5KFTA 3MBYA 1NK6A 2BCVA 5J0SA 2M9NA 1TKDA 2ZTEA 4ECQA 4XUSA 5CR0A 1CUKA 4IR9A 5KFRA 1ZYQA 1ZQUA 2J6SA 1TK5A 1SL1A 5J0UA 2HVHA 2ZUCA 2AGQA 4J9MA 1BPEA 3H4BA 4RNNA 2FMQA 4KLUA 2C22A 4F8RA 5KFKA 2AGPA 1NK5A 4YFKA 5CHGA 4X5VA 3C2KA 4IQTA 4ECVA 1KEJA 3PW0A 1NK4A 1ZQOA 5DDMA 2BPGA 4KLJA 7ICLA 4RQ4A 3V6HA 4IR1A 5KFBA 1ZQNA 2PFPA 5L1JA 1T8EA 1T4GA 5KT5A 8ICUA 5IIKA 4P4PA 4UBBA 1ZQGA 8ICKA 2H5XA 3EW9A 2IHMA 4QW8A 4P2HA 2R8KA 4RQ0A 4I2DA 3M8SA 4P4MA 4J9RA 2R8IA 3IHQB 4DL7A 4RUAA 4F50A 3RB4A 5DQGA 1BPDA 4IQVA 2PI4A 4YR0A 9ICAA 9ICNA 5J0XA 4KN7A 2ZUDA 4DOAA 1S0NA 3TARA 5L1LA 1XC9A 3ZDBA 2JEJA 1ZQKA 4QWAA 2C2DA 4IQWA 4ECWA 2V9WA 3C2LA 4B9UA 5KFFA 1U4BA 3GILA 5KFSA 2BQ3A 2BHNA 4NXZA 3C1ZA 2WTFA 1SKSA 4ECSA 2XCPA 1L3TA 5DLGA 5EWFA 4LZDA 4F93B 4EBEA 3BDPA 3JPNA 1ZQIA 1UT5A 1XS9D 3BQTA 4TUPA 2IA6A 4QZGA 9ICSA 1BPYA 2AQ0A 3RJJA 3BQ0A 3QEAZ 4LVSA 4MF2A 1DOQA 1COOA 1WCLA 5TZVA 4Q45A 2J6TA 7ICHA 4QWCA 4EBDA 4MEXA 2F1IA 3RJHA 4I2GA 5J2CA 3EWAA 1V9PA 1UA0A 2XGPA 9ICTA 5KFEA 4QZBA 5HHIA 5EWGA 3BQ2A 4GXIA 4DQIA 5KFUA 9ICEA 2B21A 3H8JA 5DB7A 4M0AA 4KMUA 4RZRA 4DWIA 3M8RA 8ICQA 3N97B 4O3OA 3H8WA 4QZEA 3THVA 3RJKA 4UB4A 4DFJA 5DG7A 3TAQA 4IRCA 3FDSA 1MSWD 1RYSA 4KLMA 9ICIA 9ICLA 3PX4A 4F4ZA 3OSNA 5J0PA 4KTQA 5J0TA 3GV5B 4PHEA 1IXRA 9ICBA 1ZQWA 3PW7A 1Z00B 1S97A 3MABA 4O3PA 1BPZA 3UPQA 4BWJA 4BXOA 1ZQTA 4ECUA 8ICWA 4PHDA 4PGXA 3Q8LA 1ZJMA 4R66A 4ELVA 5HMMA 2NRVA 4PPXA 1S77D 2ZJAA 4YCXA 4I2JA 1HUOA 2C2RA 1MC8A 4O3NA 8ICOA 3Q8QB 3ZD8A 5J2JA 4QZ8A 4KN4A 4HYKA 3OHAA 3HX0A 1D8YA 1QSYA 4QZIA 4M6WA 7ICNA 1NK7A 1RXVA 3RB0A 8ICVA 4RPXA 3KHGA 1S76D 1TK0A 1EXNA 3HW8A 1UA1A 5JUMA 2I1QA 4M9GA 4JWNA 1RPLA 3Q8MA 1RYRA 4FS1A 1QSSA 2NRWA 1ZQPA 4O5EA 4KLGA 3NGDA 2KN7A 1ZQQA 2ASJA 4ECTA 3UXOA 9ICQA 5J2HA 3C21A 1UT8A 4RQ3A 2FMPA 4RQ8A 4EZ6A 3MR3A 1KDHA 4MFCA 4PGYA 2ISOA 2IHNA 2FLNA 4B9TA 4FBTA 4I28A 4DS4A 1ZQJA 3M9MB 3KHRA 2ZTCA 1L3SA 4PGQA 2W9BA 3RTVA 4UB5A 4FS2A 4DLGA 3QZ7A 1BPXA 2A1JA 4Q8EA 1BGXT 1ZQCA 3RJIA 4Q43A 3NTUA 5KT7A 4XA5A 4P4OA 5KT2A 3PR5B 3MDAA 1ZQBA 4I2AA 4QZAA 4DL3A 3V7LA 1ZQYA 3C5FA 4DO9A 3RB6A 4DSLA 3T5KA 3H7IA 5DBCA 5HNKA 1BVSA 1U47A 3GIJA 5L1KA 3T5HA 2XO7A 4NM1A 5J2KA 2ATLA 4QWEA 3TAPA 3H4DA 2W9CB 3KHLA 3ZDEA 8ICJA 4Q44A 1ZQFA 5KTQA 4MEYA 4M2YA 1TAQA 7ICVA 4DL6A 4QZFA 4ZH4A 1HJPA 1X9MA 8ICBA 4YD1A 4C8MA 2AU0A 1T3NA 5DB6A 8ICGA 5KT4A 3UQ2A 4NY8A 1TVAA 4DL2A 4FO6A 3RR7A 3PW5A 5KG6A 3E2EA 3GV8B 4F5QA 4UAYA 3C23A 8ICEA 1TK8A 4DQQA 4K4IA 5DQIA 2FPKA 3T5JA 4Q8FA 1NK9A 1L3VA 5J29A 2JEIA 1NJZA 4F91B 2BPCA 4RT3A 4BXOB 5J2FA 4QWDA 2Y1IA 1QSLA 5D46A 8ICTA 3EPGA 3RRGA 4ECZA 4DFMA 1L3UA 1QLNA 4JV2A 3SZ2A 3BQ1A 1ZQDA 5IIIA 2PI5A 2V4QA 2JZBA 4NLKA 2BQRA 1U48A 1SL0A 4FBUA 1JMSA 3GFKB 3AUOA 1S9FA 1NOMA 4TURA 2C28A 7ICFA 1TV9A 3EPIA 1X9WA 4RQ1A 3Q8RB 9ICJA 4M6WB 4RQ6A 4PH5A 4DOCA 4DSIA 1XSLA 1N48A 5DQHA 3TFSA 3GDXA 1CEZA 2BDPA 1A76A 3SV3A 2XCAA 3ISCA 3QE9Y 1JX4A 4IRKA 1RZTA 4RU9A 2HHUA 2W8LA 3ZDAA 3MR6A 3HP6A 4I2IA 4Z6DA 3PR4A 4Z6EA 5CJ7A 5KFVA 4E0DA 4RQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLO A;  8ICX A;  1PZN A;  1NKB A;  4JV0 A;  2ISP A;  5KFW A;  2KTQ A;  8ICY A;  4QZ9 A;  1ZQZ A;  2IMW P;  5KFP A;  5EWE A;  4YD2 A;  4DEZ A;  8ICN A;  4NM2 A;  4DFK A;  4DF8 A;  4O5C A;  3RAX A;  2BQU A;  5KFH A;  4QZC A;  4O0I A;  3MDC A;  4KLQ A;  3HPO A;  1RXW A;  4R8U A;  4KLH A;  2ZTD A;  5KFI A;  5HHH A;  1X2I A;  5J2I A;  4EYH B;  3HT3 A;  3PNC A;  3IM1 A;  4O3R A;  5J2E A;  2W9B B;  2XY7 A;  8ICC A;  2A1J B;  9ICO A;  5KT6 A;  3Q8S B;  5KG4 A;  4XRH A;  4TQS A;  4G3I A;  4BWM A;  3SV4 A;  5CA7 A;  5KFD A;  4J9P A;  5F9L A;  3M9N B;  1KLN A;  5KG7 A;  5KFL A;  5J2A A;  2XY6 A;  2OWO A;  1K1S A;  5C5J A;  4RUC A;  1ZQE A;  8ICR A;  2R8H A;  3PX0 A;  7ICG A;  1ZQS A;  3T5L A;  2R8J A;  5BOL A;  1JIH A;  3MR5 A;  2V4R A;  1KTQ A;  4EEY A;  3T3F A;  4C8L A;  3RR8 A;  2JEF A;  4F5O A;  4GXJ A;  3FYH A;  2W9M A;  5IIO A;  2R8G A;  8ICZ A;  2HHW A;  4YXM A;  3TAN A;  3ZDD A;  4KLS A;  2ASL A;  2NRZ A;  1L5U A;  4C8O A;  2HW3 A;  9ICW A;  2ALZ A;  4DSE A;  3JPS A;  3QEB Z;  3SYZ A;  1WCN A;  4YP3 A;  1NJY A;  4B9N A;  4UB3 A;  1KFT A;  3RH5 A;  7ICT A;  4YG2 A;  5KFA A;  8ICS A;  5KFO A;  2Q0Z X;  5J2D A;  3OHB A;  4GLX A;  3N4M B;  1X9S A;  4JV1 A;  7ICK A;  4R65 A;  4MFA A;  3Q8P B;  1K1Q A;  2NRX A;  2W9A A;  3PY8 A;  4M9J A;  2KFZ A;  9ICP A;  2RDJ A;  5KFZ A;  3V7J A;  3RBD A;  3RB3 A;  3G6Y A;  2I9G A;  1JN3 A;  1NKC A;  2JZB B;  1A77 A;  2UVU A;  4J9N A;  4ED6 A;  3AU2 A;  4MF8 A;  4DFP A;  2BGW A;  2PFO A;  2AJQ A;  7ICP A;  2BCR A;  1TAU A;  8ICF A;  4Z6C A;  3OJU A;  3JPR A;  4TUQ A;  4ELT A;  1U49 A;  3ORY A;  2DPJ A;  4CCH A;  3PO5 A;  2LYH A;  8ICH A;  9ICR A;  4I2C A;  1XSP A;  2KFN A;  4UAW A;  4F3O A;  4F4W A;  1KRP A;  1XU4 A;  1H38 A;  1D9D A;  1Y88 A;  5DLF A;  1SKW A;  1DGS A;  4O5K A;  2FLP A;  2ZJ5 A;  1ZQH A;  5DG9 A;  3ZD9 A;  1TFR A;  5KG3 A;  3RH4 A;  7ICQ A;  1HUZ A;  4ED3 A;  3TI0 A;  5KFY A;  1C7Y A;  4YN4 A;  9ICK A;  4M9L A;  2W8K A;  1KSP A;  4IQU A;  3RJG A;  2VAN A;  3HWT A;  4GXK A;  1NJW A;  3MR2 A;  9ICX A;  4DL5 A;  3RBE A;  1NJX A;  3LWL A;  1Z00 A;  3JPQ A;  1ARO P;  3MGI A;  2PXI A;  2XGQ A;  1S0M A;  2HHV A;  8ICL A;  5DG8 A;  3RH6 A;  3OSP A;  4BDP A;  1ZQL A;  4R8U B;  5CWR A;  3EZ5 A;  3ISB A;  2BCS A;  3ETL A;  4O9M A;  4M04 A;  2KZM A;  1SZP A;  4F92 B;  3B0X A;  5BOM A;  4J9Q A;  3KHH A;  3V6J A;  2MAX A;  2RDI A;  8ICM A;  4YMM A;  3PW2 A;  4ED7 A;  4RPY A;  4F4K A;  7ICJ A;  3PMN A;  3K75 D;  5DGB A;  5DB8 A;  3PV8 A;  1MQ3 A;  2HVI A;  4M9N A;  3C1Y A;  2HHT A;  2BR0 A;  4UB1 A;  4F2S A;  3PX6 A;  2MUT A;  3UQ0 A;  2DFL A;  1ZQV A;  3V7K A;  2GWS A;  8ICA A;  3GII A;  3GQC A;  3MGH A;  4QZH A;  3RRH A;  5IIM A;  5DBA A;  2Y1J A;  5J2G A;  4F5P A;  3OGU A;  3V72 A;  1JXL A;  2HHS A;  9ICG A;  1IM4 A;  4K4H A;  4YR3 A;  3LK9 A;  4RQ7 A;  4DS5 A;  4B9L A;  2FPL A;  5KFJ A;  7ICM A;  4PHA A;  3ISD A;  1ZQM A;  4ECY A;  5J0Y A;  2VA2 A;  4MFF A;  4ECR A;  4F5R A;  1U9L A;  2KZZ A;  3H40 A;  4GC6 A;  4RPZ A;  1SL2 A;  3G6V A;  5CB1 A;  4ED0 A;  1QTM A;  2J6U A;  7ICI A;  1JXE A;  3KTQ A;  5KT3 A;  1S0V A;  5KG0 A;  3LWM A;  5D49 A;  1ZET A;  5DKW A;  2P6R A;  7ICU A;  7ICO A;  4YR2 A;  4DSF A;  4I2E A;  4YMO A;  4RNM A;  3G6X A;  5KFC A;  5IIJ A;  3EYZ A;  3UXP A;  4K4G A;  3GV7 B;  4RQ2 A;  3JPP A;  3SI8 A;  2AGO A;  4J9K A;  4GC7 A;  5J2B A;  4R64 A;  4DQP A;  1ZQX A;  4TUS A;  4DLE A;  3OJS A;  3TQ1 A;  4B9S A;  4UBC A;  4NLN A;  1N56 A;  1LV5 A;  5L1I A;  8ICI A;  3V6K A;  1NK8 A;  1KFS A;  4LZG A;  2ZUB A;  1LB2 B;  2UVW A;  3ZDC A;  4QWB A;  4UB2 A;  1SKR A;  4B9M A;  5HP4 A;  4KLT A;  2NRT A;  2F1J A;  4F4Y A;  2W9C A;  3MFH A;  7ICE A;  1T7P A;  4YVZ A;  1Z3E B;  1NK0 A;  7ICR A;  4KIT B;  2UVR A;  1D9F A;  2VA3 A;  4KLD A;  5IIL A;  5F9N A;  4F4X A;  2KZ3 A;  3Q8K A;  2P66 A;  5KFQ A;  2AQ4 A;  3RJE A;  1S0O A;  4DSK A;  4R63 A;  5KFM A;  2PFQ A;  2BCQ A;  5KG2 A;  2DPI A;  4NLG A;  4F2R A;  3TFR A;  2IBK A;  7ICS A;  3RJF A;  9ICU A;  4C8N A;  4EYI B;  2XY5 A;  2VA8 A;  3M9O B;  4DQR A;  4YMN A;  5KFN A;  1XO1 A;  4ED2 A;  3JPT A;  4M9H A;  5D4B A;  2BPF A;  5KG5 A;  1B43 A;  4O3Q A;  2BCU A;  4UAZ A;  4EBC A;  4C8K A;  4I29 A;  1MQ2 A;  4ED1 A;  4QW9 A;  4JK1 A;  4YXJ A;  5BPC A;  3PML A;  3GIM A;  4DOB A;  2FPM A;  4Z6F A;  2XC9 A;  4ECX A;  9ICC A;  4JWM A;  4UQG A;  4F5N A;  1ZQR A;  4EZ9 A;  4RT2 A;  1BPB A;  4YQW A;  4I27 A;  8ICP A;  1XSN A;  4NLZ A;  2UVV A;  4DF4 A;  2JEG A;  4J9S A;  4JUZ A;  5KFX A;  2MUT B;  4ED8 A;  1ZJN A;  3C2M A;  2FLL A;  4TQR A;  2ASD A;  5KFG A;  4M47 A;  3LDA A;  5HML A;  4KLI A;  5DBB A;  5DGA A;  4KLF A;  4QZD A;  4ELU A;  5L9X A;  3BJY A;  4I2F A;  4J9L A;  5EOZ A;  4J9O A;  3C5G A;  3AU6 A;  2BKE A;  9ICM A;  9ICH A;  5J0W A;  4I2B A;  3PO4 A;  1B22 A;  1S10 A;  4DL4 A;  5J0Q A;  3B0Y A;  2PFN A;  4O3S A;  4DSJ A;  2FMS A;  5DB9 A;  9ICF A;  3RAQ A;  5DDY A;  1U45 A;  5KG1 A;  2F1H A;  4I2H A;  5CP2 A;  3H8S A;  3K4G A;  4BGD A;  4XQ8 A;  1NKE A;  4KLE A;  5IIN A;  1ZQA A;  2C2E A;  3PVX A;  4DQS A;  4KLL A;  1KFD A;  3JPO A;  4IRD A;  9ICV A;  3GIK A;  1D8L A;  2ZJ8 A;  4B9V A;  2HHQ A;  5J0R A;  4PHP A;  4RNO A;  1XWL A;  2HHX A;  3PW4 A;  3UXN A;  2P6U A;  3MFI A;  5J0O A;  3QZ8 A;  5KFT A;  3MBY A;  1NK6 A;  2BCV A;  5J0S A;  2M9N A;  1TKD A;  2ZTE A;  4ECQ A;  4XUS A;  5CR0 A;  1CUK A;  4IR9 A;  5KFR A;  1ZYQ A;  1ZQU A;  2J6S A;  1TK5 A;  1SL1 A;  5J0U A;  2HVH A;  2ZUC A;  2AGQ A;  4J9M A;  1BPE A;  3H4B A;  4RNN A;  2FMQ A;  4KLU A;  2C22 A;  4F8R A;  5KFK A;  2AGP A;  1NK5 A;  4YFK A;  5CHG A;  4X5V A;  3C2K A;  4IQT A;  4ECV A;  1KEJ A;  3PW0 A;  1NK4 A;  1ZQO A;  5DDM A;  2BPG A;  4KLJ A;  7ICL A;  4RQ4 A;  3V6H A;  4IR1 A;  5KFB A;  1ZQN A;  2PFP A;  5L1J A;  1T8E A;  1T4G A;  5KT5 A;  8ICU A;  5IIK A;  4P4P A;  4UBB A;  1ZQG A;  8ICK A;  2H5X A;  3EW9 A;  2IHM A;  4QW8 A;  4P2H A;  2R8K A;  4RQ0 A;  4I2D A;  3M8S A;  4P4M A;  4J9R A;  2R8I A;  3IHQ B;  4DL7 A;  4RUA A;  4F50 A;  3RB4 A;  5DQG A;  1BPD A;  4IQV A;  2PI4 A;  4YR0 A;  9ICA A;  9ICN A;  5J0X A;  4KN7 A;  2ZUD A;  4DOA A;  1S0N A;  3TAR A;  5L1L A;  1XC9 A;  3ZDB A;  2JEJ A;  1ZQK A;  4QWA A;  2C2D A;  4IQW A;  4ECW A;  2V9W A;  3C2L A;  4B9U A;  5KFF A;  1U4B A;  3GIL A;  5KFS A;  2BQ3 A;  2BHN A;  4NXZ A;  3C1Z A;  2WTF A;  1SKS A;  4ECS A;  2XCP A;  1L3T A;  5DLG A;  5EWF A;  4LZD A;  4F93 B;  4EBE A;  3BDP A;  3JPN A;  1ZQI A;  1UT5 A;  1XS9 D;  3BQT A;  4TUP A;  2IA6 A;  4QZG A;  9ICS A;  1BPY A;  2AQ0 A;  3RJJ A;  3BQ0 A;  3QEA Z;  4LVS A;  4MF2 A;  1DOQ A;  1COO A;  1WCL A;  5TZV A;  4Q45 A;  2J6T A;  7ICH A;  4QWC A;  4EBD A;  4MEX A;  2F1I A;  3RJH A;  4I2G A;  5J2C A;  3EWA A;  1V9P A;  1UA0 A;  2XGP A;  9ICT A;  5KFE A;  4QZB A;  5HHI A;  5EWG A;  3BQ2 A;  4GXI A;  4DQI A;  5KFU A;  9ICE A;  2B21 A;  3H8J A;  5DB7 A;  4M0A A;  4KMU A;  4RZR A;  4DWI A;  3M8R A;  8ICQ A;  3N97 B;  4O3O A;  3H8W A;  4QZE A;  3THV A;  3RJK A;  4UB4 A;  4DFJ A;  5DG7 A;  3TAQ A;  4IRC A;  3FDS A;  1MSW D;  1RYS A;  4KLM A;  9ICI A;  9ICL A;  3PX4 A;  4F4Z A;  3OSN A;  5J0P A;  4KTQ A;  5J0T A;  3GV5 B;  4PHE A;  1IXR A;  9ICB A;  1ZQW A;  3PW7 A;  1Z00 B;  1S97 A;  3MAB A;  4O3P A;  1BPZ A;  3UPQ A;  4BWJ A;  4BXO A;  1ZQT A;  4ECU A;  8ICW A;  4PHD A;  4PGX A;  3Q8L A;  1ZJM A;  4R66 A;  4ELV A;  5HMM A;  2NRV A;  4PPX A;  1S77 D;  2ZJA A;  4YCX A;  4I2J A;  1HUO A;  2C2R A;  1MC8 A;  4O3N A;  8ICO A;  3Q8Q B;  3ZD8 A;  5J2J A;  4QZ8 A;  4KN4 A;  4HYK A;  3OHA A;  3HX0 A;  1D8Y A;  1QSY A;  4QZI A;  4M6W A;  7ICN A;  1NK7 A;  1RXV A;  3RB0 A;  8ICV A;  4RPX A;  3KHG A;  1S76 D;  1TK0 A;  1EXN A;  3HW8 A;  1UA1 A;  5JUM A;  2I1Q A;  4M9G A;  4JWN A;  1RPL A;  3Q8M A;  1RYR A;  4FS1 A;  1QSS A;  2NRW A;  1ZQP A;  4O5E A;  4KLG A;  3NGD A;  2KN7 A;  1ZQQ A;  2ASJ A;  4ECT A;  3UXO A;  9ICQ A;  5J2H A;  3C21 A;  1UT8 A;  4RQ3 A;  2FMP A;  4RQ8 A;  4EZ6 A;  3MR3 A;  1KDH A;  4MFC A;  4PGY A;  2ISO A;  2IHN A;  2FLN A;  4B9T A;  4FBT A;  4I28 A;  4DS4 A;  1ZQJ A;  3M9M B;  3KHR A;  2ZTC A;  1L3S A;  4PGQ A;  2W9B A;  3RTV A;  4UB5 A;  4FS2 A;  4DLG A;  3QZ7 A;  1BPX A;  2A1J A;  4Q8E A;  1BGX T;  1ZQC A;  3RJI A;  4Q43 A;  3NTU A;  5KT7 A;  4XA5 A;  4P4O A;  5KT2 A;  3PR5 B;  3MDA A;  1ZQB A;  4I2A A;  4QZA A;  4DL3 A;  3V7L A;  1ZQY A;  3C5F A;  4DO9 A;  3RB6 A;  4DSL A;  3T5K A;  3H7I A;  5DBC A;  5HNK A;  1BVS A;  1U47 A;  3GIJ A;  5L1K A;  3T5H A;  2XO7 A;  4NM1 A;  5J2K A;  2ATL A;  4QWE A;  3TAP A;  3H4D A;  2W9C B;  3KHL A;  3ZDE A;  8ICJ A;  4Q44 A;  1ZQF A;  5KTQ A;  4MEY A;  4M2Y A;  1TAQ A;  7ICV A;  4DL6 A;  4QZF A;  4ZH4 A;  1HJP A;  1X9M A;  8ICB A;  4YD1 A;  4C8M A;  2AU0 A;  1T3N A;  5DB6 A;  8ICG A;  5KT4 A;  3UQ2 A;  4NY8 A;  1TVA A;  4DL2 A;  4FO6 A;  3RR7 A;  3PW5 A;  5KG6 A;  3E2E A;  3GV8 B;  4F5Q A;  4UAY A;  3C23 A;  8ICE A;  1TK8 A;  4DQQ A;  4K4I A;  5DQI A;  2FPK A;  3T5J A;  4Q8F A;  1NK9 A;  1L3V A;  5J29 A;  2JEI A;  1NJZ A;  4F91 B;  2BPC A;  4RT3 A;  4BXO B;  5J2F A;  4QWD A;  2Y1I A;  1QSL A;  5D46 A;  8ICT A;  3EPG A;  3RRG A;  4ECZ A;  4DFM A;  1L3U A;  1QLN A;  4JV2 A;  3SZ2 A;  3BQ1 A;  1ZQD A;  5III A;  2PI5 A;  2V4Q A;  2JZB A;  4NLK A;  2BQR A;  1U48 A;  1SL0 A;  4FBU A;  1JMS A;  3GFK B;  3AUO A;  1S9F A;  1NOM A;  4TUR A;  2C28 A;  7ICF A;  1TV9 A;  3EPI A;  1X9W A;  4RQ1 A;  3Q8R B;  9ICJ A;  4M6W B;  4RQ6 A;  4PH5 A;  4DOC A;  4DSI A;  1XSL A;  1N48 A;  5DQH A;  3TFS A;  3GDX A;  1CEZ A;  2BDP A;  1A76 A;  3SV3 A;  2XCA A;  3ISC A;  3QE9 Y;  1JX4 A;  4IRK A;  1RZT A;  4RU9 A;  2HHU A;  2W8L A;  3ZDA A;  3MR6 A;  3HP6 A;  4I2I A;  4Z6D A;  3PR4 A;  4Z6E A;  5CJ7 A;  5KFV A;  4E0D A;  4RQ5 A; 
#chains in the Genus database with same CATH topology
 1V38 A;  1PZN A;  3I28 A;  4QZ9 A;  4IC9 A;  4DEZ A;  8ICN A;  4NM2 A;  4DF8 A;  3MDC A;  1Q3U A;  1RXW A;  3LYS A;  5KFI A;  2A1J B;  9ICO A;  5KT6 A;  4BWM A;  3M9N B;  5KG7 A;  1NZB A;  2YMM A;  2CXY A;  1OXJ A;  1K1S A;  2R8H A;  3IP4 B;  7ICG A;  3T5L A;  2R8J A;  5BOL A;  1JIH A;  1V97 A;  2O6K A;  1KTQ A;  5AM0 A;  2RHF A;  4GXJ A;  3FYH A;  3ZDD A;  4KLS A;  4GIB A;  4C8O A;  1WCN A;  5KFO A;  4JV1 A;  7ICK A;  2NRX A;  3WU2 U;  5AI0 A;  2RDJ A;  3V7J A;  3RB3 A;  2W11 A;  4J9N A;  2BGW A;  1L8O A;  1TAU A;  3C28 A;  4Z6C A;  3F53 A;  4ELT A;  3AEV A;  2LYH A;  1PVQ A;  5AI9 A;  8ICH A;  4MHV A;  2KFN A;  3I1Y A;  3WKB A;  4UAW A;  1D9D A;  4O5K A;  2ZJ5 A;  5T14 A;  3RH4 A;  2WF9 A;  7ICQ A;  3TI0 A;  4YN4 A;  4IQU A;  3UM9 A;  3HWT A;  3MR2 A;  3LWL A;  2LBO A;  3JPQ A;  4PJ0 U;  4QIW C;  5DG8 A;  3OSP A;  4BDP A;  4US8 A;  3EZ5 A;  2FE9 A;  2KZM A;  4NL9 A;  4QIW F;  8ICM A;  5AKY A;  4JB3 A;  7ICJ A;  4PL1 A;  5AM3 A;  2NO4 A;  3C1Y A;  2BR0 A;  4F2S A;  3PX6 A;  3WK5 A;  3GII A;  2Y1J A;  5J2G A;  2RQ5 A;  1TE2 A;  2KIV A;  1JXL A;  1ZOL A;  1IM4 A;  2EQY A;  2ZIV A;  4C80 A;  2DGZ A;  2JH1 A;  3ISD A;  1ZQM A;  1J2N A;  3QU5 A;  4UB6 U;  5J0Y A;  2VIX A;  2WB1 F;  2YN4 A;  2P6R A;  1YZ7 A;  7ICU A;  3G6X A;  3GU3 A;  3EYZ A;  3UXP A;  4K4G A;  4RQ2 A;  2AGO A;  5AIA A;  4J9K A;  2E8O A;  1ZQX A;  1QH9 A;  4UBC A;  3H0R B;  8ICI A;  3V6K A;  1KFS A;  3ZDC A;  1SKR A;  2W9C A;  1Z3E B;  2L5Y A;  2UVR A;  2VA3 A;  1ZXI A;  1OW5 A;  2KZ3 A;  4DSK A;  4R63 A;  5KFM A;  2BCQ A;  2IBK A;  9ICU A;  2XY5 A;  4DQR A;  3PSP A;  2PMZ F;  3GZF A;  1RQN A;  1RYU A;  2K60 A;  1B43 A;  5J8Y C;  2BCU A;  4PZO A;  2H3I A;  2LYB A;  1MQ2 A;  4QW9 A;  4YXJ A;  3PML A;  2FPM A;  4IS7 A;  4JWM A;  1JAL A;  1ZQR A;  4EZ9 A;  2MU2 A;  4DF4 A;  2JEG A;  4ED8 A;  2FLL A;  5KFG A;  5HML A;  1COK A;  2KK0 A;  3FM9 A;  4J9O A;  3AU6 A;  2BKE A;  2ZIV B;  9ICH A;  1DK2 A;  4LJX A;  4I2B A;  1B22 A;  5J0Q A;  2PFN A;  5AKL A;  5DB9 A;  2FMS A;  3UMC A;  2HBK A;  2EZY A;  5KG1 A;  5CP2 A;  4BGD A;  4KLE A;  2C2E A;  3JPO A;  2ZJ8 A;  1YZ6 A;  4B9V A;  3PW4 A;  3UXN A;  4CGZ A;  4C7Y A;  5CR0 A;  5AKH A;  1ZYQ A;  2J6S A;  2HVH A;  2AGQ A;  4J9M A;  3D2Q A;  4RNN A;  2HCF A;  1L7N A;  4F8R A;  5KFK A;  3NRZ A;  4NL9 C;  1NK4 A;  1S8O A;  5EE9 A;  2HI0 A;  4RQ4 A;  1MN8 A;  2OM6 A;  5AK5 A;  8ICK A;  2H5X A;  2W3R A;  2IHM A;  5EE0 A;  4P2H A;  3WKC A;  2ZXI A;  4I2D A;  3IHQ B;  4DL7 A;  4RUA A;  4F50 A;  5DQG A;  2PI4 A;  1Z4N A;  3ZDB A;  2EAM A;  3F2C A;  2HDO A;  3PZP A;  2KMD A;  2BHN A;  4NXZ A;  3C1Z A;  4C4T A;  2WTF A;  5DLG A;  4EBE A;  4LZD A;  4F93 B;  2LMR A;  3A0H U;  4TUP A;  4B6J A;  4QZG A;  4OJP A;  2DKX A;  2J6T A;  1COO A;  4Q45 A;  1O03 A;  1DK3 A;  5J2C A;  3KD3 A;  2XGP A;  4QZB A;  4GXI A;  5KFU A;  9ICE A;  3N97 B;  4O3O A;  4DFJ A;  4KLM A;  4KTQ A;  2GO7 A;  3PW7 A;  1Z00 B;  3M6Z A;  1ZRN A;  4UAS A;  2Y9T A;  2YB1 A;  3Q8L A;  4R66 A;  4ELV A;  2KVC A;  4PPX A;  4YCX A;  5ALK A;  1PVR A;  1S5L U;  3ZD8 A;  1P7D A;  4HYK A;  1D8Y A;  2KE7 A;  2JMG A;  7ICN A;  8ICV A;  3L4P A;  4RPX A;  1S76 D;  3M1Y A;  5E79 U;  4M9G A;  1RYR A;  1ZQP A;  2WHE A;  3H8M A;  2JXJ A;  5J2H A;  3C21 A;  2E1E A;  4C7Z A;  1HEK A;  4MFC A;  3PSF A;  5KL1 B;  1SV4 A;  1PUZ A;  2GLE A;  3RTV A;  1T3Q A;  2QKQ A;  3RJI A;  2B0C A;  4XA5 A;  4P4O A;  4DL3 A;  1ZQY A;  3AQF A;  3RB6 A;  2LYA A;  3ED5 A;  1BVS A;  4NM1 A;  4NJ8 A;  4EX7 A;  4QWE A;  2ATL A;  3H4D A;  2DBY A;  3ZDE A;  2FI1 A;  2EAO A;  2YMQ A;  3S6J A;  4NV0 A;  4DL6 A;  4ZH4 A;  2KD1 A;  2K4H A;  8ICB A;  2AU0 A;  3TKA A;  2W04 A;  4FO6 A;  3E2E A;  4UAY A;  8ICE A;  2JHD A;  2JEI A;  1NJZ A;  1N5X A;  2BPC A;  5J2F A;  5D46 A;  3EPG A;  1QQ7 A;  3SZ2 A;  5III A;  5ALD A;  1SL0 A;  3KFU F;  3GFK B;  4TUR A;  3EPI A;  3WK7 A;  4FZM A;  3QUT A;  2XCA A;  4IRK A;  1X42 A;  4Z6D A;  5K4L A;  4Z6E A;  4UB1 A;  4E0D A;  2CPR A;  1SWV A;  1NKB A;  4CF4 A;  1ZQZ A;  5AKK A;  3KZI U;  3RAX A;  5KFH A;  4QZC A;  5J2I A;  3WKD A;  2YQE A;  3HT3 A;  4O3R A;  5J2E A;  2WF5 A;  8ICC A;  2Z7J A;  4F71 A;  4TQS A;  4G3I A;  2F44 A;  3SV4 A;  5KFD A;  5AKI A;  2OWO A;  1UCV A;  2DL0 A;  4UB8 U;  4F5O A;  2HHW A;  1ZD2 P;  2R18 A;  2HW3 A;  9ICW A;  4DSE A;  3QEB Z;  4YP3 A;  4B9N A;  1HIW A;  8ICS A;  5J2D A;  3N4M B;  2E5S A;  4GLX A;  1X9S A;  4MFA A;  1SXE A;  3RBD A;  3ZI4 A;  1JN3 A;  2YTU A;  2AJQ A;  5AKX A;  2BCR A;  8ICF A;  1SXD A;  3JPR A;  1Q46 A;  4CCH A;  3PO5 A;  9ICR A;  2H3F A;  4F4W A;  4CF3 A;  1LKY A;  1DGS A;  2VKQ A;  1TFR A;  5KG3 A;  1HUZ A;  4ED3 A;  2E8P A;  3TAC B;  1KSP A;  2K89 A;  1JRO A;  5ALW A;  4EX6 A;  3MGI A;  2PXI A;  8ICL A;  1A6S A;  3RH6 A;  3KZX A;  2F77 X;  3ETL A;  4M04 A;  1SZP A;  2GOL A;  3MGV A;  5BOM A;  3IN5 A;  3KHH A;  1D8B A;  2MAX A;  3PW2 A;  4ED7 A;  4RPY A;  4F4K A;  3K75 D;  2EDU A;  1MQ3 A;  2HVI A;  2Q4T A;  3UQ0 A;  1ZQV A;  4P0Q A;  2F3N A;  1SV0 C;  3KKA C;  2KSO A;  4AYB C;  3MGH A;  3GQC A;  4F5P A;  1AQ6 A;  2LKY A;  2HHS A;  9ICG A;  4K4H A;  4YR3 A;  1L7P A;  4RQ7 A;  3WK8 A;  2FPL A;  5KFJ A;  3TAD A;  4U6P A;  4ECY A;  4Y2Y A;  3KOO A;  5ALZ A;  3H40 A;  5F3X B;  3G6V A;  5CB1 A;  1S0V A;  3LWM A;  5DKW A;  3PST A;  4YR2 A;  4DSF A;  4YMO A;  3H0L B;  4RNM A;  5KFC A;  3JPP A;  5AI8 A;  5ALO A;  4DLE A;  4B9S A;  4NLN A;  4NLC A;  5L1I A;  1LB2 B;  3WK9 A;  2UVW A;  3AM9 A;  4B9M A;  2NRT A;  2F1J A;  2RRD A;  2W03 A;  5ALQ A;  4YVZ A;  4US9 A;  7ICR A;  1RG6 A;  1JUD A;  1LKY B;  4F4X A;  2P66 A;  2G5H B;  3T79 A;  1S0O A;  2PFQ A;  5KG2 A;  4NLG A;  1PK1 B;  2JRZ A;  3BZK A;  4YMN A;  5KFN A;  1XO1 A;  3JPT A;  4M9H A;  3AQE A;  5KG5 A;  4JK1 A;  4ECX A;  2HBL A;  5AKZ A;  3M6K A;  3QUC A;  1BPB A;  4YQW A;  8ICP A;  1IV8 A;  4NLZ A;  3ONN A;  1ZJN A;  3C2M A;  4P0Q B;  4TQR A;  2ASD A;  5AHX A;  3LDA A;  4KMO B;  2KSO B;  4KLI A;  5DGA A;  5L9X A;  3HKZ C;  5EOZ A;  3OTQ A;  1V85 A;  5ALV A;  5ALG A;  1S10 A;  5ALY A;  4DL4 A;  4DSJ A;  3RAQ A;  1U45 A;  2F1H A;  3EUB 2;  3HKZ F;  4Y2X A;  4XQ8 A;  4CDG A;  1ZQA A;  3PVX A;  4DQS A;  4IRD A;  9ICV A;  4OCZ A;  5G5H A;  3NVV A;  2HHQ A;  5AKE A;  3LVV A;  5J0R A;  1XWL A;  1TAM A;  1BNO A;  3QZ8 A;  3MBY A;  4RQN A;  2F8K A;  1X6J A;  2M9N A;  1X66 A;  2ZTE A;  4ECQ A;  4DFD A;  4A8E A;  3LVW A;  5KFR A;  5ALH A;  3NVW A;  3SEN A;  2C22 A;  1KKX A;  1NK5 A;  3PW0 A;  1KEJ A;  1FFU A;  7ICL A;  5KFB A;  2PFP A;  5L1J A;  1T8E A;  5IIK A;  4P4P A;  3EW9 A;  3OPX A;  3WK6 A;  3NRW A;  3M8S A;  5ALM A;  3RB4 A;  4IQV A;  9ICN A;  3J81 j;  9ICA A;  4KN7 A;  1JI7 A;  3N7P D;  1XC9 A;  2W7O A;  2LPE A;  4IQW A;  2C2D A;  3CW2 C;  5GTH U;  2BQ3 A;  1UQV A;  2XCP A;  1L3T A;  3BDP A;  1Z1B A;  3JPN A;  1XS9 D;  3BQT A;  3IG5 A;  2H3Q A;  2IA6 A;  4QJF B;  9ICS A;  2AQ0 A;  4ACO A;  2DKZ A;  1DOQ A;  2YML A;  5FP0 A;  3SEI A;  4Y2P A;  4EBD A;  4MEX A;  3RJH A;  1UA0 A;  9ICT A;  1LVH A;  5HHI A;  2LM1 A;  4DQI A;  2B21 A;  4RZR A;  8ICQ A;  3D6J A;  5DG7 A;  2ZXH A;  3F5E A;  1RYS A;  9ICL A;  4F4Z A;  1IXR A;  9ICB A;  1ZQW A;  1N60 A;  3ALR A;  3SD7 A;  1ZD4 A;  1BPZ A;  4OJL A;  3U26 A;  1ZQT A;  3HRD D;  2D8C A;  1ZJM A;  2ZJA A;  1HUO A;  2C2R A;  1MC8 A;  1VDV A;  4O3N A;  1N62 A;  3OHA A;  3HX0 A;  1NK7 A;  3RB0 A;  1EXN A;  1UA1 A;  4PL2 A;  3E58 A;  5AM1 A;  1VLB A;  1ZQQ A;  2ASJ A;  9ICQ A;  2FMP A;  2YB4 A;  2IHN A;  4EEL A;  4I28 A;  4DS4 A;  3B9J A;  1ZQJ A;  3KHR A;  2W9B A;  3QZ7 A;  1ZQC A;  3DEE A;  2KHV A;  2ZIX A;  4I2A A;  1ZQB A;  1M6Y A;  3V7L A;  3SAH A;  5AIC A;  5HNK A;  3SAF A;  5J2K A;  2W9C B;  3KBB A;  4BUG A;  8ICJ A;  1ZQF A;  5KTQ A;  4MEY A;  1TAQ A;  7ICV A;  1X9M A;  8ICG A;  5KT4 A;  4NY8 A;  3RR7 A;  4DL2 A;  1QCK A;  3PW5 A;  5KG6 A;  2OXO A;  2JR5 A;  1TK8 A;  5DQI A;  2RP5 A;  2FPK A;  4Q8F A;  5J29 A;  4Y2U A;  4CF5 A;  3HIL A;  4RT3 A;  2Y1I A;  1WWU A;  3M7D A;  3QU9 A;  4OD0 A;  1QLN A;  4JV2 A;  2RLT A;  3A0B U;  1ZQD A;  2JZB A;  4NLK A;  2BQR A;  3NVY A;  3SAG A;  4RQ1 A;  3Q8R B;  1RQL A;  2K8B B;  4DOC A;  5DQH A;  3TFS A;  3GDX A;  1CEZ A;  3ISC A;  3QE9 Y;  1NI3 A;  5AIB A;  4RU9 A;  2YMP A;  3ZDA A;  4I2I A;  2YX8 A;  4KLO A;  8ICX A;  5ALN A;  4Y2J A;  4JV0 A;  2ISP A;  4J03 A;  2IOH A;  4CE6 A;  5KFW A;  2KTQ A;  2KJ5 A;  5KFP A;  5EWE A;  1CI4 A;  2BQU A;  4O0I A;  4R8U A;  4KLH A;  5HHH A;  1X2I A;  4EYH B;  3IM1 A;  2W9B B;  2GH1 A;  5KG4 A;  2EAP A;  2ZIX B;  2HOQ A;  5F9L A;  2QB0 A;  1KLN A;  3N28 A;  5KFL A;  2A1A A;  2XY6 A;  5C5J A;  1ZQE A;  8ICR A;  3PX0 A;  3QNM A;  5KL8 B;  3MR5 A;  2V4R A;  4EEY A;  3T3F A;  2JEF A;  2VJ4 A;  1ZD5 A;  3N7S C;  1Z19 A;  5IIO A;  2W9M A;  2R8G A;  4YXM A;  3BS7 A;  3L3F X;  2ASL A;  2EZZ A;  3DV9 A;  1L5U A;  2KJ8 A;  2ALZ A;  1KFT A;  3RH5 A;  1F44 A;  7ICT A;  4YG2 A;  2W7P A;  5C0Y A;  2Q0Z X;  1QQ5 A;  3Q8P B;  1K1Q A;  2LI6 A;  2E8N A;  4M9J A;  9ICP A;  3G6Y A;  2I9G A;  2LM4 A;  4Y2S A;  1NKC A;  4UAT A;  2JZB B;  2UVU A;  4ED6 A;  3AU2 A;  4MF8 A;  2OHF A;  3O0F A;  7ICP A;  2NYV A;  3OJU A;  2FDR A;  2P35 A;  2DPJ A;  4UW9 A;  1WG8 A;  2KG5 A;  4Y2T A;  1J97 A;  5KNI A;  4F3O A;  1KRP A;  1H38 A;  1RM6 C;  2FLP A;  3CYM A;  5KFY A;  4M9L A;  3RJG A;  2VAN A;  1NJW A;  4FE3 A;  1FO4 A;  3QYP A;  2XGQ A;  2HHV A;  4JMU A;  4R8U B;  5CWR A;  3ISB A;  3IG8 A;  4F92 B;  1MA7 A;  4J9Q A;  3QU7 A;  2QLT A;  2RDI A;  3PMN A;  2ZIU A;  3PV8 A;  1KQQ A;  2HHT A;  2MUT A;  2DFL A;  8ICA A;  5AI5 A;  3UMG A;  4QZH A;  1BNP A;  2WAQ C;  2KIW A;  3V72 A;  2G06 A;  1NNL A;  3LK9 A;  4DS5 A;  4B9L A;  7ICM A;  2VA2 A;  4MFF A;  4ECR A;  1U9L A;  2B6G A;  4GC6 A;  1SL2 A;  4ED0 A;  1QTM A;  5D49 A;  2HSZ A;  4I2E A;  5IIJ A;  3GV7 B;  2QB1 A;  1X9X A;  4GC7 A;  4R64 A;  4TUS A;  3TQ1 A;  3OJS A;  4FZL A;  1N56 A;  2KKV A;  2ZUB A;  4QWB A;  4UB2 A;  5EE3 A;  2EAN A;  7ICE A;  3K1R B;  4F4Y A;  3MFH A;  1T7P A;  4HAI A;  1NK0 A;  4KIT B;  1D9F A;  5AK4 A;  3Q8K A;  5ALT A;  2Y9U A;  2DPI A;  2NO5 A;  4F2R A;  3TFR A;  7ICS A;  1ED1 A;  2VA8 A;  2HBM A;  2HOF A;  2BPF A;  2KP7 A;  1B4F A;  4EBC A;  4C8K A;  4ED1 A;  3GIM A;  5BPC A;  4Z6F A;  9ICC A;  5HR7 A;  4RT2 A;  3F2B A;  5TIS U;  2K4P A;  2MSN A;  3UMB A;  3CRX A;  4J9S A;  5KFX A;  2MUT B;  5AI4 A;  4M47 A;  2KNJ A;  4KLF A;  4ELU A;  4J9L A;  3DDH A;  2WF8 A;  3K1Z A;  5J0W A;  3PO4 A;  4KX3 A;  4O3S A;  5DDY A;  4I2H A;  2DF4 B;  1NKE A;  4KLL A;  5ALJ A;  3GIK A;  1D8L A;  3NVZ A;  2KOB A;  5ALF A;  5J0O A;  1NK6 A;  2ZG6 A;  1ZD3 A;  1TKD A;  1TK5 A;  1SL1 A;  1CRX A;  1BPE A;  4KLU A;  2AGP A;  2XIC A;  3I76 A;  4YFK A;  5CHG A;  4X5V A;  4IQT A;  4ECV A;  1N2X A;  4KLJ A;  2BPG A;  1GO3 F;  1ZQN A;  8ICU A;  1T4G A;  5KT5 A;  5EE1 A;  4UBB A;  1ZQG A;  2R8K A;  4USA A;  4P4M A;  4J9R A;  1BPD A;  2Y0S C;  5A0L A;  5J0X A;  2ZUD A;  2VJ5 A;  4DOA A;  4AYB F;  3IV6 A;  1S0N A;  3TAR A;  5L1L A;  2JEJ A;  4ICA A;  4ECW A;  2V9W A;  3C2L A;  4B9U A;  5KFF A;  5KFS A;  3RFA A;  1Q3V A;  2Y0S F;  4ECS A;  5B66 U;  5EWF A;  1ZQI A;  3BZC A;  4F72 A;  4OO1 J;  1BPY A;  3RJJ A;  3BQ0 A;  4MF2 A;  1WCL A;  5TZV A;  7ICH A;  2E8M A;  2DUY A;  5ALI A;  2F1I A;  4I2G A;  1V9P A;  5AKJ A;  3QUQ A;  3E0F A;  3BQ2 A;  1KBU A;  2F2A B;  1XO0 A;  5DB7 A;  2YY6 A;  4KMU A;  4OJO A;  3M8R A;  1C20 A;  4QZE A;  3THV A;  3RJK A;  2D3D A;  3TAQ A;  1MSW D;  2I6X A;  2F76 X;  4IRC A;  3FDS A;  3PX4 A;  5J0P A;  4BJQ A;  1S97 A;  4O3P A;  2HOI A;  4PZN A;  4BWJ A;  4ECU A;  4PHD A;  4PGX A;  3IDW A;  3SR6 A;  2NRV A;  1XNS A;  2IOF K;  4I2J A;  2K4I A;  5J2J A;  5J8Y A;  4QZ8 A;  4KN4 A;  2ZIW A;  4QZI A;  4M6W A;  3KHG A;  2AHO B;  5JUM A;  2I1Q A;  4NWI A;  4UAU A;  1FFV A;  4O5E A;  3VC8 A;  4KLG A;  2KN7 A;  3PSI A;  4ECT A;  3UXO A;  4GFJ A;  4RQ8 A;  1KDH A;  4PGY A;  2ISO A;  2W43 A;  2JV3 A;  2FLN A;  2ZTC A;  2W55 A;  5JTI A;  1K5O A;  1BPX A;  1ECW A;  4Q8E A;  1BGX T;  3R9K A;  1IIP A;  4QNL A;  5KT7 A;  1SZH A;  3NS1 A;  5KT2 A;  2BDU A;  3MDA A;  1QQ6 A;  2K8C B;  5HR6 A;  4DSL A;  3T5K A;  3H7I A;  1N63 A;  2G5I B;  2G08 A;  1U47 A;  1WYG A;  2XO7 A;  4ZOH C;  3TAP A;  4CRX A;  3KHL A;  4Q44 A;  4FZN A;  1HJP A;  2FJ6 A;  4C8M A;  5AK3 A;  3UQ2 A;  1TVA A;  3C23 A;  4K4I A;  2KEY A;  3T5J A;  5ALU A;  3H0M B;  1NK9 A;  1RDF A;  2ODG A;  1FEZ A;  3BS5 A;  1DXS A;  1QSL A;  3RRG A;  1SIJ A;  4ECZ A;  1L3U A;  2G09 A;  1ZQ1 C;  3BQ1 A;  1JMS A;  3AUO A;  7ICF A;  3TAD C;  1TV9 A;  1X9W A;  3AL0 B;  2ZIW B;  2WB1 C;  4M6W B;  4RQ6 A;  4C0Z A;  2BDP A;  3SV3 A;  1JX4 A;  1RZT A;  4UAV A;  1UPH A;  2W8L A;  3ETR A;  5KFV A;  5H2F U;  2PKE A;  2KVS A;  1DRG A;  8ICY A;  2IMW P;  2N1R A;  4YD2 A;  4DFK A;  4O5C A;  4KLQ A;  3HPO A;  1Z1V A;  2ZTD A;  3PNC A;  2XY7 A;  5B5E U;  3AMZ A;  1O08 A;  3Q8S B;  4XRH A;  2KKP A;  5CA7 A;  2LHT A;  4J9P A;  2PMZ C;  4BX9 C;  5J2A A;  3SQI A;  4RUC A;  1ZQS A;  3QXG A;  2E3T A;  4C8L A;  3RR8 A;  1F5S A;  8ICZ A;  3TAN A;  4WJ3 B;  1PVP A;  2NRZ A;  2WF7 A;  3JPS A;  3SYZ A;  1NJY A;  4UB3 A;  5L1M A;  5KFA A;  3BS5 B;  4RQM A;  3OHB A;  4Y2V A;  4R65 A;  2W9A A;  3PY8 A;  1IG6 A;  2KFZ A;  5AM2 A;  5KFZ A;  1A77 A;  4DFP A;  2PFO A;  3CNH A;  4TUQ A;  2G0A A;  1U49 A;  3ORY A;  4I2C A;  5G5G A;  1XSP A;  1XU4 A;  1Y88 A;  5DLF A;  1SKW A;  1ZQH A;  5DG9 A;  3ZD9 A;  2CRX A;  1C7Y A;  9ICK A;  2W8K A;  1SWW A;  4GXK A;  9ICX A;  1L6N A;  4DL5 A;  3RBE A;  1NJX A;  2K8A A;  1Z00 A;  1ARO P;  1S0M A;  1ZQL A;  2BCS A;  1JRP A;  4NLB A;  4O9M A;  1URJ A;  2NV3 A;  3IRU A;  2JGA A;  3B0X A;  3V6J A;  4UAR A;  4YMM A;  3SMV A;  1NZP A;  5DGB A;  5DB8 A;  4M9N A;  2DQN B;  5AM5 A;  3V7K A;  2GWS A;  3MC1 A;  1L8L A;  2H3Z A;  4EEK A;  5IIM A;  3RRH A;  5ALP A;  5DBA A;  1Z4O A;  3OGU A;  2OEH A;  4PHA A;  3CP8 A;  5AM4 A;  5ALE A;  4F5R A;  2KZZ A;  4RPZ A;  2J6U A;  7ICI A;  1JXE A;  3KTQ A;  5KT3 A;  5KG0 A;  1ZET A;  7ICO A;  4IL6 U;  1T94 A;  2KIC A;  3SI8 A;  3AN1 A;  5KAI U;  5J2B A;  4DQP A;  2I5H A;  1LV5 A;  1NK8 A;  2OCE A;  4LZG A;  2IOF A;  5CEH A;  4KLT A;  5HP4 A;  4G9B A;  4KLD A;  5IIL A;  5F9N A;  1L7M A;  5KFQ A;  1KL9 A;  2AQ4 A;  3RJE A;  3RJF A;  4C8N A;  4EYI B;  3M9O B;  3HJE A;  2JH7 A;  4ED2 A;  2WF6 A;  5D4B A;  1WWV A;  2D6F C;  4O3Q A;  4UAZ A;  4I29 A;  1N61 A;  2WFA A;  4DOB A;  2XC9 A;  4UQG A;  4F5N A;  4FFD A;  4I27 A;  4C4S A;  1XSN A;  2UVV A;  3QU4 A;  4JUZ A;  2MRL A;  2BZF A;  5DBB A;  4QZD A;  3BJY A;  4I2F A;  1F0M A;  3C5G A;  9ICM A;  1N5W A;  2AXT U;  5ALX A;  3B0Y A;  9ICF A;  4Y2R A;  1J2M A;  2CN1 A;  2QAR A;  3H8S A;  3K4G A;  5IIN A;  5AK6 A;  1Q8K A;  1KFD A;  2XID A;  2KV2 A;  5ALS A;  4PHP A;  4RNO A;  2HHX A;  4P0P A;  2K4E A;  2ES6 A;  2P6U A;  3MFI A;  5KFT A;  3VCB A;  4C4R A;  2BCV A;  5J0S A;  1L7O A;  1OUQ A;  4XUS A;  4IR9 A;  1CUK A;  1ZQU A;  1SGG A;  4U7C A;  4OJ5 A;  5J0U A;  2ZUC A;  3H4B A;  2KJ9 A;  5AI6 A;  2FMQ A;  2QB0 B;  1B0X A;  4AP9 A;  5ALR A;  3NUQ A;  3C2K A;  1ZQO A;  2ESE A;  5DDM A;  3V6H A;  4IR1 A;  5JRT A;  1DGJ A;  2W54 A;  4QW8 A;  4RQ0 A;  2EH9 A;  1SV0 A;  5JU5 A;  4OJ6 A;  2R8I A;  3KKA A;  4YR0 A;  2A19 A;  2WAQ F;  1ZQK A;  4QWA A;  2EZX A;  1U4B A;  5KAF U;  3GIL A;  4O3M A;  2DWQ A;  5CRX A;  1SKS A;  2MA1 A;  1UT5 A;  1X40 A;  2HMX A;  3WKA A;  3D2N A;  3QEA Z;  4LVS A;  1VJ5 A;  2H3V A;  2A3V A;  4DCC A;  4QWC A;  3EWA A;  5KFE A;  5EWG A;  3H8J A;  4M0A A;  3QU2 A;  4DWI A;  2QAR B;  3QX7 A;  1UHU A;  3H8W A;  4UB4 A;  3FC4 A;  2HBJ A;  9ICI A;  5AKG A;  3OSN A;  5J0T A;  1YT3 A;  3GV5 B;  4PHE A;  4P0P B;  3MAB A;  3UPQ A;  3FAH A;  4KX5 A;  4BXO A;  8ICW A;  3ICX A;  5HMM A;  2KHQ A;  3RF9 A;  1S77 D;  2G07 A;  8ICO A;  3Q8Q B;  1QSY A;  2ZIU B;  1RXV A;  1KN5 A;  1TK0 A;  3HW8 A;  4EEN A;  4JWN A;  1RPL A;  3Q8M A;  2XI9 A;  4FS1 A;  1QSS A;  2NRW A;  5GTI U;  3NGD A;  1UT8 A;  4RQ3 A;  4EZ6 A;  3MR3 A;  2W3S A;  2XVT A;  3D2S A;  4B9T A;  4FBT A;  3NAS A;  2AH5 A;  2M0N A;  2OH2 A;  3M9M B;  1L3S A;  2OYY A;  4PGQ A;  4UB5 A;  4FS2 A;  1X6I A;  4DLG A;  2A1J A;  3C29 A;  4Q43 A;  3NTU A;  3L5K A;  3QUB A;  3PR5 B;  4QZA A;  1ZRM A;  3C5F A;  4DO9 A;  5DBC A;  3GIJ A;  5L1K A;  3T5H A;  3BQ7 A;  4M2Y A;  4QZF A;  1FIQ A;  1PK1 A;  4YD1 A;  1PK3 A;  1T3N A;  3N7R C;  5DB6 A;  3GV8 B;  4F5Q A;  1KW4 A;  4DQQ A;  2E1F A;  1L3V A;  2F8L A;  4CNQ A;  4F91 B;  3F2D A;  4BXO B;  4QWD A;  3WK4 A;  8ICT A;  4Y2Q A;  4DFM A;  2PI5 A;  2V4Q A;  3F5A A;  1U48 A;  4FBU A;  1SB3 C;  1S9F A;  1NOM A;  2C28 A;  5ALL A;  1WUD A;  9ICJ A;  4PH5 A;  4DSI A;  1XSL A;  1N48 A;  1A0P A;  1A76 A;  2HHU A;  3MR6 A;  3WKE A;  3HP6 A;  3PR4 A;  5CJ7 A;  4RQ5 A; 
#chains in the Genus database with same CATH homology
 4KLO A;  8ICX A;  1PZN A;  1NKB A;  4JV0 A;  2ISP A;  5KFW A;  2KTQ A;  8ICY A;  4QZ9 A;  1ZQZ A;  2IMW P;  5KFP A;  5EWE A;  4YD2 A;  4DEZ A;  8ICN A;  4NM2 A;  4DFK A;  4DF8 A;  4O5C A;  3RAX A;  2BQU A;  5KFH A;  4QZC A;  4O0I A;  3MDC A;  4KLQ A;  3HPO A;  1RXW A;  4R8U A;  4KLH A;  2ZTD A;  5KFI A;  5HHH A;  1X2I A;  5J2I A;  4EYH B;  3HT3 A;  3PNC A;  3IM1 A;  4O3R A;  5J2E A;  2W9B B;  2XY7 A;  8ICC A;  2A1J B;  9ICO A;  5KT6 A;  3Q8S B;  5KG4 A;  4XRH A;  4TQS A;  4G3I A;  4BWM A;  3SV4 A;  5CA7 A;  5KFD A;  4J9P A;  5F9L A;  3M9N B;  1KLN A;  5KG7 A;  5KFL A;  5J2A A;  2XY6 A;  2OWO A;  1K1S A;  5C5J A;  4RUC A;  1ZQE A;  8ICR A;  2R8H A;  3PX0 A;  7ICG A;  1ZQS A;  3T5L A;  2R8J A;  5BOL A;  1JIH A;  3MR5 A;  2V4R A;  1KTQ A;  4EEY A;  3T3F A;  4C8L A;  3RR8 A;  2JEF A;  4F5O A;  4GXJ A;  3FYH A;  2W9M A;  5IIO A;  2R8G A;  8ICZ A;  2HHW A;  4YXM A;  3TAN A;  3ZDD A;  4KLS A;  2ASL A;  2NRZ A;  1L5U A;  4C8O A;  2HW3 A;  9ICW A;  2ALZ A;  4DSE A;  3JPS A;  3QEB Z;  3SYZ A;  1WCN A;  4YP3 A;  1NJY A;  4B9N A;  4UB3 A;  1KFT A;  3RH5 A;  7ICT A;  4YG2 A;  5KFA A;  8ICS A;  5KFO A;  2Q0Z X;  5J2D A;  3OHB A;  4GLX A;  3N4M B;  1X9S A;  4JV1 A;  7ICK A;  4R65 A;  4MFA A;  3Q8P B;  1K1Q A;  2NRX A;  2W9A A;  3PY8 A;  4M9J A;  2KFZ A;  9ICP A;  2RDJ A;  5KFZ A;  3V7J A;  3RBD A;  3RB3 A;  3G6Y A;  2I9G A;  1JN3 A;  1NKC A;  2JZB B;  1A77 A;  2UVU A;  4J9N A;  4ED6 A;  3AU2 A;  4MF8 A;  4DFP A;  2BGW A;  2PFO A;  2AJQ A;  7ICP A;  2BCR A;  1TAU A;  8ICF A;  4Z6C A;  3OJU A;  3JPR A;  4TUQ A;  4ELT A;  1U49 A;  3ORY A;  2DPJ A;  4CCH A;  3PO5 A;  2LYH A;  8ICH A;  9ICR A;  4I2C A;  1XSP A;  2KFN A;  4UAW A;  4F3O A;  4F4W A;  1KRP A;  1XU4 A;  1H38 A;  1D9D A;  1Y88 A;  5DLF A;  1SKW A;  1DGS A;  4O5K A;  2FLP A;  2ZJ5 A;  1ZQH A;  5DG9 A;  3ZD9 A;  1TFR A;  5KG3 A;  3RH4 A;  7ICQ A;  1HUZ A;  4ED3 A;  3TI0 A;  5KFY A;  1C7Y A;  4YN4 A;  9ICK A;  4M9L A;  2W8K A;  1KSP A;  4IQU A;  3RJG A;  2VAN A;  3HWT A;  4GXK A;  1NJW A;  3MR2 A;  9ICX A;  4DL5 A;  3RBE A;  1NJX A;  3LWL A;  1Z00 A;  3JPQ A;  1ARO P;  3MGI A;  2PXI A;  2XGQ A;  1S0M A;  2HHV A;  8ICL A;  5DG8 A;  3RH6 A;  3OSP A;  4BDP A;  1ZQL A;  4R8U B;  5CWR A;  3EZ5 A;  3ISB A;  2BCS A;  3ETL A;  4O9M A;  4M04 A;  2KZM A;  1SZP A;  4F92 B;  3B0X A;  5BOM A;  4J9Q A;  3KHH A;  3V6J A;  2MAX A;  2RDI A;  8ICM A;  4YMM A;  3PW2 A;  4ED7 A;  4RPY A;  4F4K A;  7ICJ A;  3PMN A;  3K75 D;  5DGB A;  5DB8 A;  3PV8 A;  1MQ3 A;  2HVI A;  4M9N A;  3C1Y A;  2HHT A;  2BR0 A;  4UB1 A;  4F2S A;  3PX6 A;  2MUT A;  3UQ0 A;  2DFL A;  1ZQV A;  3V7K A;  2GWS A;  8ICA A;  3GII A;  3GQC A;  3MGH A;  4QZH A;  3RRH A;  5IIM A;  5DBA A;  2Y1J A;  5J2G A;  4F5P A;  3OGU A;  3V72 A;  1JXL A;  2HHS A;  9ICG A;  1IM4 A;  4K4H A;  4YR3 A;  3LK9 A;  4RQ7 A;  4DS5 A;  4B9L A;  2FPL A;  5KFJ A;  7ICM A;  4PHA A;  3ISD A;  1ZQM A;  4ECY A;  5J0Y A;  2VA2 A;  4MFF A;  4ECR A;  4F5R A;  1U9L A;  2KZZ A;  3H40 A;  4GC6 A;  4RPZ A;  1SL2 A;  3G6V A;  5CB1 A;  4ED0 A;  1QTM A;  2J6U A;  7ICI A;  1JXE A;  3KTQ A;  5KT3 A;  1S0V A;  5KG0 A;  3LWM A;  5D49 A;  1ZET A;  5DKW A;  2P6R A;  7ICU A;  7ICO A;  4YR2 A;  4DSF A;  4I2E A;  4YMO A;  4RNM A;  3G6X A;  5KFC A;  5IIJ A;  3EYZ A;  3UXP A;  4K4G A;  3GV7 B;  4RQ2 A;  3JPP A;  3SI8 A;  2AGO A;  4J9K A;  4GC7 A;  5J2B A;  4R64 A;  4DQP A;  1ZQX A;  4TUS A;  4DLE A;  3OJS A;  3TQ1 A;  4B9S A;  4UBC A;  4NLN A;  1N56 A;  1LV5 A;  5L1I A;  8ICI A;  3V6K A;  1NK8 A;  1KFS A;  4LZG A;  2ZUB A;  1LB2 B;  2UVW A;  3ZDC A;  4QWB A;  4UB2 A;  1SKR A;  4B9M A;  5HP4 A;  4KLT A;  2NRT A;  2F1J A;  4F4Y A;  2W9C A;  3MFH A;  7ICE A;  1T7P A;  4YVZ A;  1Z3E B;  1NK0 A;  7ICR A;  4KIT B;  2UVR A;  1D9F A;  2VA3 A;  4KLD A;  5IIL A;  5F9N A;  4F4X A;  2KZ3 A;  3Q8K A;  2P66 A;  5KFQ A;  2AQ4 A;  3RJE A;  1S0O A;  4DSK A;  4R63 A;  5KFM A;  2PFQ A;  2BCQ A;  5KG2 A;  2DPI A;  4NLG A;  4F2R A;  3TFR A;  2IBK A;  7ICS A;  3RJF A;  9ICU A;  4C8N A;  4EYI B;  2XY5 A;  2VA8 A;  3M9O B;  4DQR A;  4YMN A;  5KFN A;  1XO1 A;  4ED2 A;  3JPT A;  4M9H A;  5D4B A;  2BPF A;  5KG5 A;  1B43 A;  4O3Q A;  2BCU A;  4UAZ A;  4EBC A;  4C8K A;  4I29 A;  1MQ2 A;  4ED1 A;  4QW9 A;  4JK1 A;  4YXJ A;  5BPC A;  3PML A;  3GIM A;  4DOB A;  2FPM A;  4Z6F A;  2XC9 A;  4ECX A;  9ICC A;  4JWM A;  4UQG A;  4F5N A;  1ZQR A;  4EZ9 A;  4RT2 A;  1BPB A;  4YQW A;  4I27 A;  8ICP A;  1XSN A;  4NLZ A;  2UVV A;  4DF4 A;  2JEG A;  4J9S A;  4JUZ A;  5KFX A;  2MUT B;  4ED8 A;  1ZJN A;  3C2M A;  2FLL A;  4TQR A;  2ASD A;  5KFG A;  4M47 A;  3LDA A;  5HML A;  4KLI A;  5DBB A;  5DGA A;  4KLF A;  4QZD A;  4ELU A;  5L9X A;  3BJY A;  4I2F A;  4J9L A;  5EOZ A;  4J9O A;  3C5G A;  3AU6 A;  2BKE A;  9ICM A;  9ICH A;  5J0W A;  4I2B A;  3PO4 A;  1B22 A;  1S10 A;  4DL4 A;  5J0Q A;  3B0Y A;  2PFN A;  4O3S A;  4DSJ A;  2FMS A;  5DB9 A;  9ICF A;  3RAQ A;  5DDY A;  1U45 A;  5KG1 A;  2F1H A;  4I2H A;  5CP2 A;  3H8S A;  3K4G A;  4BGD A;  4XQ8 A;  1NKE A;  4KLE A;  5IIN A;  1ZQA A;  2C2E A;  3PVX A;  4DQS A;  4KLL A;  1KFD A;  3JPO A;  4IRD A;  9ICV A;  3GIK A;  1D8L A;  2ZJ8 A;  4B9V A;  2HHQ A;  5J0R A;  4PHP A;  4RNO A;  1XWL A;  2HHX A;  3PW4 A;  3UXN A;  2P6U A;  3MFI A;  5J0O A;  3QZ8 A;  5KFT A;  3MBY A;  1NK6 A;  2BCV A;  5J0S A;  2M9N A;  1TKD A;  2ZTE A;  4ECQ A;  4XUS A;  5CR0 A;  1CUK A;  4IR9 A;  5KFR A;  1ZYQ A;  1ZQU A;  2J6S A;  1TK5 A;  1SL1 A;  5J0U A;  2HVH A;  2ZUC A;  2AGQ A;  4J9M A;  1BPE A;  3H4B A;  4RNN A;  2FMQ A;  4KLU A;  2C22 A;  4F8R A;  5KFK A;  2AGP A;  1NK5 A;  4YFK A;  5CHG A;  4X5V A;  3C2K A;  4IQT A;  4ECV A;  1KEJ A;  3PW0 A;  1NK4 A;  1ZQO A;  5DDM A;  2BPG A;  4KLJ A;  7ICL A;  4RQ4 A;  3V6H A;  4IR1 A;  5KFB A;  1ZQN A;  2PFP A;  5L1J A;  1T8E A;  1T4G A;  5KT5 A;  8ICU A;  5IIK A;  4P4P A;  4UBB A;  1ZQG A;  8ICK A;  2H5X A;  3EW9 A;  2IHM A;  4QW8 A;  4P2H A;  2R8K A;  4RQ0 A;  4I2D A;  3M8S A;  4P4M A;  4J9R A;  2R8I A;  3IHQ B;  4DL7 A;  4RUA A;  4F50 A;  3RB4 A;  5DQG A;  1BPD A;  4IQV A;  2PI4 A;  4YR0 A;  9ICA A;  9ICN A;  5J0X A;  4KN7 A;  2ZUD A;  4DOA A;  1S0N A;  3TAR A;  5L1L A;  1XC9 A;  3ZDB A;  2JEJ A;  1ZQK A;  4QWA A;  2C2D A;  4IQW A;  4ECW A;  2V9W A;  3C2L A;  4B9U A;  5KFF A;  1U4B A;  3GIL A;  5KFS A;  2BQ3 A;  2BHN A;  4NXZ A;  3C1Z A;  2WTF A;  1SKS A;  4ECS A;  2XCP A;  1L3T A;  5DLG A;  5EWF A;  4LZD A;  4F93 B;  4EBE A;  3BDP A;  3JPN A;  1ZQI A;  1UT5 A;  1XS9 D;  3BQT A;  4TUP A;  2IA6 A;  4QZG A;  9ICS A;  1BPY A;  2AQ0 A;  3RJJ A;  3BQ0 A;  3QEA Z;  4LVS A;  4MF2 A;  1DOQ A;  1COO A;  1WCL A;  5TZV A;  4Q45 A;  2J6T A;  7ICH A;  4QWC A;  4EBD A;  4MEX A;  2F1I A;  3RJH A;  4I2G A;  5J2C A;  3EWA A;  1V9P A;  1UA0 A;  2XGP A;  9ICT A;  5KFE A;  4QZB A;  5HHI A;  5EWG A;  3BQ2 A;  4GXI A;  4DQI A;  5KFU A;  9ICE A;  2B21 A;  3H8J A;  5DB7 A;  4M0A A;  4KMU A;  4RZR A;  4DWI A;  3M8R A;  8ICQ A;  3N97 B;  4O3O A;  3H8W A;  4QZE A;  3THV A;  3RJK A;  4UB4 A;  4DFJ A;  5DG7 A;  3TAQ A;  4IRC A;  3FDS A;  1MSW D;  1RYS A;  4KLM A;  9ICI A;  9ICL A;  3PX4 A;  4F4Z A;  3OSN A;  5J0P A;  4KTQ A;  5J0T A;  3GV5 B;  4PHE A;  1IXR A;  9ICB A;  1ZQW A;  3PW7 A;  1Z00 B;  1S97 A;  3MAB A;  4O3P A;  1BPZ A;  3UPQ A;  4BWJ A;  4BXO A;  1ZQT A;  4ECU A;  8ICW A;  4PHD A;  4PGX A;  3Q8L A;  1ZJM A;  4R66 A;  4ELV A;  5HMM A;  2NRV A;  4PPX A;  1S77 D;  2ZJA A;  4YCX A;  4I2J A;  1HUO A;  2C2R A;  1MC8 A;  4O3N A;  8ICO A;  3Q8Q B;  3ZD8 A;  5J2J A;  4QZ8 A;  4KN4 A;  4HYK A;  3OHA A;  3HX0 A;  1D8Y A;  1QSY A;  4QZI A;  4M6W A;  7ICN A;  1NK7 A;  1RXV A;  3RB0 A;  8ICV A;  4RPX A;  3KHG A;  1S76 D;  1TK0 A;  1EXN A;  3HW8 A;  1UA1 A;  5JUM A;  2I1Q A;  4M9G A;  4JWN A;  1RPL A;  3Q8M A;  1RYR A;  4FS1 A;  1QSS A;  2NRW A;  1ZQP A;  4O5E A;  4KLG A;  3NGD A;  2KN7 A;  1ZQQ A;  2ASJ A;  4ECT A;  3UXO A;  9ICQ A;  5J2H A;  3C21 A;  1UT8 A;  4RQ3 A;  2FMP A;  4RQ8 A;  4EZ6 A;  3MR3 A;  1KDH A;  4MFC A;  4PGY A;  2ISO A;  2IHN A;  2FLN A;  4B9T A;  4FBT A;  4I28 A;  4DS4 A;  1ZQJ A;  3M9M B;  3KHR A;  2ZTC A;  1L3S A;  4PGQ A;  2W9B A;  3RTV A;  4UB5 A;  4FS2 A;  4DLG A;  3QZ7 A;  1BPX A;  2A1J A;  4Q8E A;  1BGX T;  1ZQC A;  3RJI A;  4Q43 A;  3NTU A;  5KT7 A;  4XA5 A;  4P4O A;  5KT2 A;  3PR5 B;  3MDA A;  1ZQB A;  4I2A A;  4QZA A;  4DL3 A;  3V7L A;  1ZQY A;  3C5F A;  4DO9 A;  3RB6 A;  4DSL A;  3T5K A;  3H7I A;  5DBC A;  5HNK A;  1BVS A;  1U47 A;  3GIJ A;  5L1K A;  3T5H A;  2XO7 A;  4NM1 A;  5J2K A;  2ATL A;  4QWE A;  3TAP A;  3H4D A;  2W9C B;  3KHL A;  3ZDE A;  8ICJ A;  4Q44 A;  1ZQF A;  5KTQ A;  4MEY A;  4M2Y A;  1TAQ A;  7ICV A;  4DL6 A;  4QZF A;  4ZH4 A;  1HJP A;  1X9M A;  8ICB A;  4YD1 A;  4C8M A;  2AU0 A;  1T3N A;  5DB6 A;  8ICG A;  5KT4 A;  3UQ2 A;  4NY8 A;  1TVA A;  4DL2 A;  4FO6 A;  3RR7 A;  3PW5 A;  5KG6 A;  3E2E A;  3GV8 B;  4F5Q A;  4UAY A;  3C23 A;  8ICE A;  1TK8 A;  4DQQ A;  4K4I A;  5DQI A;  2FPK A;  3T5J A;  4Q8F A;  1NK9 A;  1L3V A;  5J29 A;  2JEI A;  1NJZ A;  4F91 B;  2BPC A;  4RT3 A;  4BXO B;  5J2F A;  4QWD A;  2Y1I A;  1QSL A;  5D46 A;  8ICT A;  3EPG A;  3RRG A;  4ECZ A;  4DFM A;  1L3U A;  1QLN A;  4JV2 A;  3SZ2 A;  3BQ1 A;  1ZQD A;  5III A;  2PI5 A;  2V4Q A;  2JZB A;  4NLK A;  2BQR A;  1U48 A;  1SL0 A;  4FBU A;  1JMS A;  3GFK B;  3AUO A;  1S9F A;  1NOM A;  4TUR A;  2C28 A;  7ICF A;  1TV9 A;  3EPI A;  1X9W A;  4RQ1 A;  3Q8R B;  9ICJ A;  4M6W B;  4RQ6 A;  4PH5 A;  4DOC A;  4DSI A;  1XSL A;  1N48 A;  5DQH A;  3TFS A;  3GDX A;  1CEZ A;  2BDP A;  1A76 A;  3SV3 A;  2XCA A;  3ISC A;  3QE9 Y;  1JX4 A;  4IRK A;  1RZT A;  4RU9 A;  2HHU A;  2W8L A;  3ZDA A;  3MR6 A;  3HP6 A;  4I2I A;  4Z6D A;  3PR4 A;  4Z6E A;  5CJ7 A;  5KFV A;  4E0D A;  4RQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...