3BQTA

Crystal structure of a protein of unknown function from listeria monocytogenes, tetragonal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
NLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b f2365
molecule tags Structural genomics, unknown function
total genus 25
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bqtA00
3OJUA 4F4KA 7ICHA 4DSJA 4CCHA 1AROP 1ZQDA 3OSPA 4DSEA 4NM1A 2R8IA 4YG2A 1S0MA 5IIMA 3G6VA 3LK9A 1S97A 4DF4A 8ICBA 3GFKB 3OHBA 5KFPA 1S0OA 2Y1JA 1EXNA 3HT3A 2ZUBA 4PHPA 1QSSA 3PMNA 5J2CA 2FLLA 7ICVA 4KITB 2BR0A 2ISOA 4KLFA 3QZ8A 5L1IA 4DLGA 4QZDA 3MR6A 1XSNA 8ICYA 3RH6A 3GILA 1TK5A 4R8UB 5J2EA 4M9NA 3EPGA 1X9WA 3GV5B 4ED6A 7ICNA 4UB4A 3EYZA 5KFJA 4EBEA 3ZDAA 4YXJA 2W9BA 3LDAA 5JUMA 4EZ9A 4K4GA 5KG5A 2KZMA 3GIJA 1SL0A 7ICTA 4PPXA 4RZRA 4RPXA 3H40A 8ICVA 1UT8A 4Q44A 1NK0A 4JUZA 4KLGA 9ICSA 4M9JA 1SKSA 1IM4A 4DFJA 1ZQRA 1XO1A 3MABA 4YMMA 5CA7A 4I2DA 4ECZA 5HHHA 3HW8A 2IBKA 3OSNA 5J2IA 4I28A 1ZQTA 3K4GA 2F1HA 1DGSA 2RDIA 3KHLA 2W9AA 2XO7A 4RNNA 4KN4A 5J0OA 3BJYA 1U49A 1ZQAA 4J9KA 2XCAA 3AUOA 3PW0A 4F3OA 1NOMA 3EW9A 1JXEA 4F91B 5CWRA 3GDXA 4DF8A 1ZQYA 3ZDCA 5J2DA 3MR5A 4Z6DA 3M9OB 5J0YA 4RQ2A 4B9MA 4X5VA 3RBDA 5KT4A 3V6JA 5KT5A 1NK4A 1N56A 1ZQIA 1XWLA 4I2FA 4UBBA 2PFOA 4KN7A 4DL7A 3OGUA 2BCQA 4I2GA 2W9MA 3GIIA 3RR8A 1ZQXA 4RQ3A 5DDMA 4GXIA 2IMWP 1HJPA 1NKEA 4MFAA 2V4QA 2C22A 5J2JA 9ICQA 4J9SA 3RB3A 1NJWA 4ELVA 3AU6A 4QZBA 4J9QA 4GC7A 7ICPA 7ICMA 4F50A 5KFVA 4F4YA 3QEBZ 2JZBB 2R8HA 5EWGA 4DFPA 4DFMA 9ICGA 4RT3A 3OHAA 3MDCA 1KRPA 5L1JA 4IRKA 5J2KA 2KFNA 4IQUA 1NK9A 3AU2A 4YMOA 2WTFA 2B21A 1SL2A 5CJ7A 2RDJA 1L5UA 1XSPA 1S77D 1HUZA 3ISBA 3PV8A 3KHGA 3RBEA 5KT3A 4F2RA 8ICXA 5IINA 7ICOA 4LVSA 3PW4A 3MGIA 3RRHA 4QZFA 2KZ3A 4M9LA 2PI4A 4YCXA 2ZTDA 4ECTA 5KFHA 2HW3A 2HHSA 8ICAA 5KFNA 3M8RA 2W8KA 2IHNA 4RQ1A 1KFTA 9ICHA 5DDYA 3MGHA 5KTQA 5DQGA 5J0SA 8ICWA 2DPIA 4JWMA 1QLNA 4QZEA 1BPBA 5KT2A 1ZETA 4YMNA 5F9NA 4JWNA 4ZH4A 4G3IA 2VA8A 3OJSA 1RXVA 5KFFA 9ICIA 4DFKA 3RJKA 8ICLA 5DB6A 2FMSA 3THVA 1NJXA 3RJEA 1N48A 1ZJMA 4M47A 8ICGA 5J0RA 3ISCA 4M9HA 3RB4A 1NKCA 3FYHA 7ICGA 3PR5B 3ORYA 3QE9Y 1RYRA 1SKRA 3C5FA 1ZQVA 1K1SA 5KFAA 1Z00A 4B9VA 3PX0A 3H7IA 2V4RA 4IQVA 3C2LA 4BWMA 3JPNA 2F1IA 4GC6A 4KTQA 4Z6FA 4JK1A 3HPOA 2HHUA 4RNOA 3GV7B 2AGOA 4RUCA 1S10A 1ZQNA 3RJHA 4E0DA 4O5KA 4PGQA 4ECSA 5EWFA 5DGAA 4BGDA 1T7PA 1CEZA 5CHGA 1A76A 4MF8A 1Y88A 1ZYQA 2J6SA 2FLNA 1TFRA 4Q45A 7ICSA 4I2HA 1T8EA 5KFKA 1ZQBA 2C28A 1NJYA 4PGXA 2XY6A 2R8JA 1HUOA 4JV2A 4QZCA 4R63A 3GIMA 5DB8A 4ECXA 1BPEA 1UT5A 3ZD9A 2W8LA 4DOBA 2NRZA 2ALZA 3H8SA 1BPZA 1ZQEA 4M2YA 4QZ8A 2ATLA 5KG6A 3GV8B 4DOCA 5CB1A 7ICJA 3PX4A 2BHNA 2HVHA 5J0QA 1NKBA 3PNCA 1D9FA 3PW2A 4DL4A 1ZQSA 1ZQKA 3SV4A 2R8KA 2F1JA 5HMLA 4M04A 1T4GA 9ICXA 2PFPA 3UXOA 4DSIA 4KLQA 3B0XA 1T3NA 2ZUCA 3MR3A 4I2IA 2W9BB 1TKDA 2R8GA 9ICWA 3SI8A 8ICCA 1WCLA 3RTVA 4YD2A 4UAZA 2BCRA 4B9TA 1U4BA 2FPKA 1NJZA 5TZVA 8ICPA 3N97B 4KMUA 1U47A 3SV3A 4DSLA 3PO5A 2V9WA 2HHVA 2J6TA 4QW9A 3FDSA 4QZAA 3Q8RB 4O9MA 4I2CA 4YVZA 4J9LA 9ICJA 2XCPA 2NRVA 4BXOA 2C2RA 1U48A 3V7JA 3RR7A 4RPZA 3PMLA 2BQ3A 2KFZA 3ZDBA 4RQ4A 3H8WA 4XUSA 4UAYA 2BCUA 5KG1A 5KG7A 3M9NB 5HHIA 4YR0A 4EYHB 1ZQMA 8ICJA 8ICNA 5DGBA 3ETLA 5BOMA 3MFHA 3C1ZA 4J9RA 5DG9A 1U45A 2HVIA 1RZTA 5DBBA 5IILA 4M9GA 4ECRA 8ICHA 8ICMA 4RPYA 1A77A 4O5EA 2FPMA 4ECQA 3C2KA 4UB1A 5KG0A 5J2GA 4DQPA 3TANA 1S9FA 1TV9A 3GQCA 1S0NA 4ELUA 4YR2A 5KT7A 3PVXA 4I2BA 4RU9A 9ICEA 3M9MB 1D9DA 2VA2A 5J29A 1SL1A 4ED7A 3Q8QB 4EBDA 3PX6A 2I9GA 3PW7A 4O3SA 5EOZA 1H38A 4GLXA 1ZQHA 2FMPA 1D8LA 2ISPA 4NLGA 5KFIA 8ICKA 5BPCA 4KLDA 4RUAA 2IA6A 2LYHA 1TK0A 4Q8FA 3T5JA 1NK5A 2KTQA 3LWLA 3NTUA 4MEYA 2P6UA 4PH5A 4F4WA 3Q8MA 5IIIA 1QSYA 4YR3A 4GXKA 4NLNA 3EWAA 2XC9A 1KFDA 2XY7A 4YP3A 2HHXA 7ICIA 5DKWA 5IIJA 3G6YA 1RXWA 4PHDA 4NY8A 3TFRA 5KFRA 4DL3A 5KFYA 2UVRA 4B9NA 4B9SA 2HHWA 5CP2A 4NLKA 2HHQA 2XGQA 1RPLA 4C8KA 2BGWA 4C8NA 4Q8EA 4J9PA 1L3UA 7ICLA 2FPLA 2IHMA 5CR0A 4MFCA 5KFDA 4DS4A 3BQ2A 5KFOA 4KLLA 4RT2A 5KFZA 3H8JA 4IRCA 4RQ7A 1JN3A 4QWEA 3MR2A 2BQUA 4UBCA 4C8LA 1S0VA 4ECWA 1MQ3A 3HX0A 4O3RA 9ICBA 4YQWA 1B22A 2ZTEA 4GXJA 3GIKA 5KFWA 4F4XA 4IQWA 3JPPA 2BDPA 5HMMA 4PHAA 1XSLA 3PY8A 4UAWA 8ICZA 3IHQB 2UVVA 4JV1A 1Z00B 4Z6EA 4O0IA 1ZQLA 4ECYA 3RB6A 3TAQA 3UQ2A 3V7LA 4O3QA 1ZQGA 4ECVA 3RRGA 4UB3A 1V9PA 3MBYA 3UPQA 3PW5A 1UA0A 5J2HA 5L1KA 1KEJA 4UB5A 4F5NA 3RH5A 5J0PA 4O3NA 9ICCA 4M6WB 5DQIA 4RQ5A 5KFEA 4TQSA 4F5PA 2AGQA 2OWOA 4I2AA 5KFXA 9ICNA 7ICRA 4DO9A 1JX4A 3TQ1A 3SYZA 4B9LA 2JEIA 2JEGA 1CUKA 1X9MA 9ICRA 1K1QA 5J2FA 3BQTA 1MC8A 2W9CA 1NK6A 1ZQQA 4DL6A 2BPFA 7ICKA 2XY5A 1LV5A 2PFNA 4NLZA 4QZ9A 1QTMA 1Z3EB 5BOLA 1XS9D 3RJGA 3PR4A 4DEZA 8ICRA 1ZJNA 4BDPA 4TUSA 3C23A 3EZ5A 4IR9A 5KFQA 3NGDA 4QZHA 3TARA 1XU4A 1L3TA 3ZDDA 3V6HA 4EBCA 3MDAA 3QZ7A 2NRTA 3M8SA 3ZDEA 2C2DA 1L3VA 2AQ0A 1U9LA 4XA5A 2HHTA 3PO4A 9ICLA 2J6UA 4Z6CA 4R66A 1RYSA 2AQ4A 4MFFA 2MUTA 2ZJAA 4ED0A 4RQ6A 3QEAZ 1BGXT 4R64A 3ISDA 5KG2A 5KG3A 1UA1A 2P66A 8ICFA 8ICUA 4IR1A 2AJQA 4MF2A 5DBCA 1PZNA 3RJIA 4KLOA 2NRXA 2Y1IA 4DQQA 4QWAA 2BCSA 5D4BA 5C5JA 4DSKA 4I2JA 8ICOA 2PXIA 1IXRA 3H4BA 4NM2A 4KLTA 4DLEA 8ICIA 2A1JA 4BXOB 3V72A 3ZD8A 3KTQA 4F92B 4BWJA 9ICUA 4DL2A 1C7YA 3K75D 4J9OA 4F5QA 4JV0A 5DB7A 4I27A 4ELTA 1KLNA 9ICPA 4C8OA 5KFLA 4O5CA 2PI5A 2DFLA 9ICKA 8ICQA 4J9NA 4KLMA 5KFGA 1XC9A 2JEFA 4FO6A 5KFUA 4F93B 2BPCA 1TAQA 4TQRA 3V7KA 4DQSA 3RH4A 3TAPA 4IRDA 3E2EA 4KLUA 3BQ0A 4YFKA 4YN4A 5KFMA 8ICEA 2I1QA 2ZJ5A 3C21A 3HP6A 4R8UA 3LWMA 1MQ2A 1ZQWA 4DL5A 2ASDA 5J0UA 5DB9A 4KLSA 4ED2A 5EWEA 3RAQA 2VANA 2MAXA 3KHRA 2Q0ZX 3RB0A 2DPJA 1BPYA 4PHEA 4Q43A 1TK8A 4DQIA 3JPRA 4EEYA 1NK7A 7ICUA 4KLEA 2KN7A 4IQTA 5IIKA 5DQHA 5L1LA 4F5OA 1ZQCA 2KZZA 3BDPA 3HWTA 4ED3A 5IIOA 4FS2A 1JXLA 4F2SA 2BQRA 3RJFA 5J0WA 4ED8A 2JEJA 4YXMA 5J0TA 3N4MB 3KHHA 1COOA 3JPTA 2ASJA 4ED1A 4O3OA 4KLHA 2ZTCA 4R65A 4YD1A 5HNKA 4RQ8A 1BPDA 2PFQA 5KFCA 1ZQZA 7ICQA 1JIHA 3H4DA 4DWIA 4M0AA 4XQ8A 4TUQA 2VA3A 4K4HA 3G6XA 4DS5A 2AU0A 2ASLA 4P2HA 4K4IA 1X2IA 4RQ0A 4DOAA 3Q8KA 2C2EA 4QWDA 4PGYA 3SZ2A 2FLPA 4EYIB 3T3FA 5DLGA 3C2MA 5DG7A 3RJJA 1BPXA 5DG8A 1ZQPA 4KLJA 7ICEA 5L9XA 2NRWA 2AGPA 5F9LA 4HYKA 5D49A 4F8RA 4EZ6A 3JPOA 3UXPA 3UQ0A 2BPGA 1ZQFA 2ZJ8A 4QZGA 1KSPA 3Q8LA 5KFBA 1KFSA 2JZBA 3B0YA 4RNMA 4UB2A 1ZQOA 2UVWA 1X9SA 3TFSA 4LZGA 1B43A 3MFIA 4P4PA 1BVSA 8ICTA 4NXZA 1ZQUA 4FBUA 3UXNA 4QWCA 1MSWD 5KG4A 2BCVA 4P4OA 3EPIA 5HP4A 4FS1A 2W9CB 4J9MA 3V6KA 2GWSA 4I2EA 4QZIA 3JPSA 5KFSA 5D46A 4KLIA 1KDHA 1LB2B 4MEXA 2H5XA 4DSFA 9ICOA 3TI0A 9ICFA 5DBAA 3T5LA 3RAXA 4TUPA 5KT6A 5KFTA 1KTQA 3IM1A 4LZDA 7ICFA 2BKEA 3C5GA 1D8YA 4FBTA 4DQRA 8ICSA 1DOQA 3T5KA 9ICVA 4F5RA 1SKWA 3T5HA 1QSLA 1L3SA 3Q8PB 1JMSA 2XGPA 2MUTB 1NK8A 1TVAA 4ECUA 4P4MA 1S76D 3BQ1A 3JPQA 3C1YA 3Q8SB 2M9NA 5DLFA 4TURA 5J0XA 4M6WA 9ICMA 4F4ZA 4XRHA 5J2AA 9ICTA 2FMQA 1TAUA 9ICAA 4B9UA 4O3PA 4UQGA 5J2BA 4QWBA 2ZUDA 1WCNA 4I29A 2A1JB 2UVUA 4QW8A 1ZQJA 2P6RA 1SZPA 4C8MA
chains in the Genus database with same CATH superfamily
5ALPA 4DSJA 1AROP 2YN4A 2JRZA 1N2XA 1S0MA 3I1YA 3LK9A 1YZ7A 4C0ZA 3OHBA 5KFPA 3UMCA 1EXNA 2Y1JA 1ED1A 3PMNA 5J2CA 3AM9A 5AKGA 4KITB 3QZ8A 4GIBA 1TK5A 2WF7A 3GV5B 4UB4A 3EYZA 2JHDA 3GIJA 7ICTA 8ICVA 1NK0A 4M9JA 1C20A 1IM4A 4DFJA 1XO1A 4YMMA 3HW8A 1NZBA 4I28A 2XO7A 4C7ZA 2XCAA 3PW0A 1JXEA 2HBLA 5CWRA 4QIWC 4RQNA 2E8PA 1ZQYA 3MR5A 4JB3A 2VJ5A 4X5VA 4KN7A 2M0NA 2HBJA 3FM9A 2IMWP 5AKYA 4MFAA 3RB3A 3AU6A 4GC7A 3M6KA 2HBMA 2G09A 3LVVA 3OHAA 3MGVA 5J2KA 2KFNA 4IQUA 2O6KA 2WTFA 2B21A 1S77D 2K4HA 3RBEA 3KHGA 2K4IA 4LVSA 2PI4A 4YCXA 3CW2C 2HW3A 1SV4A 8ICAA 5KFNA 3M8RA 4RQ1A 1KFTA 2HOQA 5DQGA 5J0SA 8ICWA 1QLNA 4G3IA 4ZH4A 4DFKA 2LKYA 8ICLA 3THVA 1NJXA 2RHFA 3ISCA 4M9HA 1NKCA 3DEEA 2G06A 4UATA 1FIQA 1SKRA 2KICA 1T3QA 3H7IA 3C2LA 4GC6A 3SAHA 4RNOA 4IC9A 2KIWA 3RJHA 3S6JA 4E0DA 4O5KA 2EQYA 4ECSA 1Q46A 2DL0A 3MC1A 1CEZA 5CHGA 1A76A 1Y88A 2J6SA 4Q45A 5AM2A 5KFKA 1ZQBA 1KW4A 2XY6A 2R8JA 2KJ5A 2NV3A 4JV2A 4R63A 1RQNA 3GIMA 4ECXA 1UT5A 4FE3A 4C7YA 1BPZA 1O03A 3H8SA 2ATLA 7ICJA 5CB1A 1NKBA 5ALDA 3ZI4A 4BJQA 1ZQSA 1ZQKA 2K4EA 3SV4A 2F1JA 4M04A 2YX8A 3QU4A 4KLQA 1OUQA 1J97A 2W9BB 3SI8A 3RTVA 3PO5A 2HHVA 3IG8A 4QZAA 3Q8RB 4YVZA 2XCPA 4BXOA 2DKZA 2NO4A 1X6IA 4UAVA 3H8WA 4XUSA 4UAYA 5AK4A 5KG7A 5KG1A 3M9NB 1ZQMA 1RG6A 8ICNA 4CNQA 1COKA 4Y2JA 5BOMA 4J9RA 2A19A 4M9GA 4RPYA 5AKJA 3GQCA 4YR2A 2LHTA 1SL1A 2P35A 1JI7A 5KFIA 8ICKA 2W03A 5CRXA 1NK5A 4UB6U 4AYBF 1QSYA 4PH5A 2H3IA 4F4WA 3Q8MA 4YR3A 1PK3A 1RXWA 3WK9A 4NY8A 4PHDA 3KD3A 2UVRA 5CP2A 2Y0SF 3H0RB 1KL9A 2HHQA 4C8NA 1L3UA 2FPLA 5CR0A 3BQ2A 4KLLA 4RT2A 1JUDA 1JN3A 5AKHA 4ECWA 5EE0A 4O3RA 3U26A 4GXJA 2BDPA 2Y9TA 4JV1A 3QNMA 1Z00B 4Z6EA 2JMGA 3IP4B 2QARA 2H3VA 4O3QA 4ECVA 5J2HA 5ALIA 5L1KA 3RH5A 5J0PA 4M6WB 2ZIXB 5KFEA 4I2AA 3VC8A 2JEGA 4DFDA 1K1QA 1ZQQA 2W9CA 1PK1B 1B4FA 1QTMA 2DGZA 2A1AA 2QB0B 1VLBA 8ICRA 1L7NA 3C23A 1QCKA 5KFQA 1XU4A 4EBCA 2NRTA 4FZNA 1SWWA 1L3VA 2AQ0A 4XA5A 1ZXIA 2KHVA 4Z6CA 4R66A 3UMGA 1ZD2P 4R64A 2WF6A 4IR1A 2H3QA 1PZNA 3GZFA 2K8AA 2Y1IA 5HR6A 4QWAA 5D4BA 1FEZA 4I2JA 4AYBC 2PXIA 1IXRA 4NM2A 4KLTA 5AK3A 1SWVA 3KTQA 2Y0SC 4DCCA 2DFLA 1V85A 2EZYA 4HAIA 3DV9A 1S8OA 2BPCA 4DQSA 3V7KA 3TAPA 3E2EA 3A0HU 3KBBA 2I1QA 3C21A 4O3MA 4DL5A 2VANA 3KHRA 4EEKA 2Q0ZX 5AKKA 3RB0A 4DQIA 1TK8A 1NK7A 5DQHA 5IIOA 2JXJA 2JEJA 3N4MB 5B5EU 1HIWA 1COOA 4O3OA 4BX9C 5KFCA 2AHOB 4IS7A 7ICQA 4CF5A 2XVTA 3H4DA 4P2HA 4RQ0A 4QWDA 4WJ3B 3RJJA 4KLJA 5DG8A 3H0MB 3CRXA 2NRWA 2AGPA 5F9LA 4HYKA 4F8RA 4Y2VA 1WWVA 5KFBA 3NVYA 4OJPA 2UVWA 1X9SA 3MFIA 4P4PA 1BVSA 4QWCA 1L7PA 2F3NA 3PSTA 4FZMA 3V6KA 3JPSA 5KFSA 5D46A 4ACOA 2EAPA 1KDHA 2H5XA 3SAGA 5DBAA 1QH9A 4OD0A 5KFTA 1RDFA 3C29A 4DQRA 8ICSA 1DOQA 2GLEA 3T5KA 9ICVA 1QSLA 1L3SA 5HR7A 1IV8A 2MUTB 1TVAA 1S76D 3BQ1A 4TURA 3OTQA 4F4ZA 5J2AA 1UCVA 2LYBA 2FMQA 1TAUA 2KIVA 1WCNA 2F2AB 3VCBA 4OO1J 4QW8A 2P6RA 1SZPA 3OJUA 4F4KA 7ICHA 4CCHA 1ZQDA 3OSPA 1L7OA 4FFDA 5IIMA 1S97A 4DF4A 3MR6A 1XSNA 2JH1A 5ALXA 4A8EA 3GILA 4P0PB 4R8UB 4M9NA 5GTIU 2K8BB 4K4GA 4YXJA 2W9BA 3LDAA 5JUMA 1KBUA 2KZMA 3NASA 4PPXA 5KL1B 2DKXA 5ALHA 4RZRA 3H40A 1UT8A 2IOFA 4KLGA 1ZRMA 5CA7A 1Q8KA 5J8YC 2IBKA 3SAFA 3BZCA 5J2IA 4C4TA 4EX6A 1U49A 4RNNA 4KN4A 2W3SA 2HDOA 4NLBA 4US8A 5ALEA 4DF8A 5AHXA 5J2DA 4B9MA 4RQ2A 3RBDA 1NK4A 3V6JA 1XWLA 4UBBA 1OXJA 1UHUA 4PZOA 1DRGA 2BCQA 4U6PA 4I2GA 3GIIA 5DDMA 2C22A 5J2JA 2OHFA 3IV6A 1XO0A 4Y2XA 1NJWA 2ZIUB 4J9QA 3AL0B 7ICMA 1JRPA 4F4YA 1X66A 2R8HA 4RT3A 3FAHA 5L1JA 2WF5A 2YMLA 1NK9A 5AIAA 2G5IB 5AKZA 4GFJA 5AI9A 1WWUA 2QKQA 8ICXA 3PW4A 3MGIA 4ECTA 1L6NA 9ICHA 5DDYA 3MGHA 5KTQA 4JWMA 2CPRA 5KT2A 1ZETA 4JWNA 2VA8A 3OJSA 5KFFA 5J8YA 1PVRA 8ICGA 1N48A 5J0RA 4QIWF 3FYHA 7ICGA 3PR5B 3QE9Y 1RYRA 1K1SA 5KFAA 1Z00A 4B9VA 4IQVA 4BWMA 1L8OA 2LPEA 4KTQA 3HPOA 2AGOA 1S10A 1ZQNA 1DK3A 2XIDA 5EWFA 3M1YA 5DGAA 1CRXA 2ZIXA 2DQNB 2WB1F 1ZYQA 1YT3A 7ICSA 1T8EA 2KJ9A 4UB8U 1PK1A 2QB0A 5AK6A 5DB8A 2W8LA 2OCEA 4QZ8A 5KG6A 2HVHA 4EENA 3PNCA 3PW2A 1SV0C 5ALSA 1JROA 5HMLA 3ICXA 2PFPA 3SQIA 3PZPA 1TKDA 9ICWA 2R8GA 8ICCA 5AKEA 4YD2A 4UAZA 2YB4A 4Y2TA 3N97B 2E5SA 3SV3A 2V9WA 2J6TA 4QW9A 4O9MA 4I2CA 3J81j 2NRVA 4EELA 1S5LU 2BQ3A 2HOIA 2YQEA 2KFZA 1AQ6A 2IOFK 3MFHA 1FFVA 2HVIA 5AM0A 4QJFB 4EX7A 4O5EA 2FPMA 1IG6A 1TV9A 1S9FA 2WF9A 5F3XB 9ICEA 1IIPA 3B9JA 5J29A 2I9GA 3PW7A 4O3SA 3ED5A 4GLXA 2ISPA 3PSIA 2CRXA 2IA6A 2LYHA 2WB1C 1TK0A 4Q8FA 3QU7A 3T5JA 3LWLA 1RYUA 1SV0A 4GXKA 4NLNA 1KFDA 2HHXA 3TFRA 5KFRA 1V38A 4B9NA 3F2DA 4NLKA 1RPLA 2EAOA 3WK6A 3WU2U 4Q8EA 2D6FC 2K89A 2OYYA 2IHMA 5KFDA 4P0QB 5E79U 5KFZA 3H8JA 4IRCA 4RQ7A 2KKPA 2BQUA 1S0VA 2I5HA 1MQ3A 3HX0A 2E8MA 2Q4TA 5AICA 3JPPA 4PHAA 3PY8A 2UVVA 5ALJA 1Z1BA 3HILA 4G9BA 3N28A 1ZQGA 3PW5A 3MBYA 3QUQA 2RP5A 4OCZA 4F5PA 2AGQA 1XNSA 7ICRA 2RQ5A 2HOFA 1CUKA 1X9MA 5J2FA 7ICKA 1MC8A 1NK6A 4DL6A 3BQ7A 1LV5A 4NLZA 5BOLA 3PR4A 1ZJNA 4BDPA 3LVWA 3EZ5A 3TARA 3V6HA 1N60A 3M8SA 3ZDEA 1U9LA 2MRLA 4Y2SA 2J6UA 3E58A 2MUTA 4ED0A 3QEAZ 2MU2A 1BGXT 3ISDA 2AH5A 5KG2A 2P66A 2AXTU 2AJQA 4KLOA 2KD1A 2NRXA 2BCSA 2W43A 3WKBA 8ICOA 3BS5B 8ICIA 9ICUA 2ZIVB 4DL2A 3QUBA 4I27A 4ELTA 2FJ6A 9ICKA 5ALOA 8ICQA 4J9NA 4KLMA 1XC9A 4FO6A 1TAQA 3RH4A 4PZNA 4YFKA 4YN4A 4P0PA 4R8UA 3LWMA 4ED2A 2MAXA 5AI5A 2HMXA 4PHEA 3JPRA 4OJOA 3NVVA 2XICA 1ZQCA 3BDPA 3HWTA 4FS2A 2BQRA 3RJFA 3AQEA 4YXMA 2ES6A 3QYPA 1BPDA 1T94A 3N7PD 4M0AA 2YTUA 5B66U 5JU5A 4K4HA 3G6XA 4K4IA 2FI1A 2DWQA 3KZIU 4PGYA 1KN5A 3C2MA 5DG7A 1ZD4A 2WHEA 2ZIUA 3TFSA 1B43A 2WAQF 5ALUA 3AN1A 3KKAC 4FBUA 2ZXHA 2B6GA 3NRWA 3HJEA 1K5OA 3D2QA 4FZLA 4CRXA 4B6JA 5AI4A 3RAXA 3WK5A 1LKYB 1NZPA 1RM6C 2BKEA 3C5GA 1D8YA 5AI6A 5ALVA 1SKWA 2NO5A 2KP7A 3Q8PB 1JMSA 4ECUA 3CYMA 2VIXA 2M9NA 3D2SA 5J0XA 4XRHA 9ICTA 1OW5A 4B9UA 4UQGA 5J2BA 4QWBA 2XI9A 5G5HA 2A1JB 5AIBA 8ICBA 3F53A 3HT3A 1WYGA 3LYSA 2FLLA 7ICVA 2BR0A 1FO4A 4DLGA 3KKAA 8ICYA 3RH6A 3KOOA 1X9WA 7ICNA 4MHVA 4EBEA 4EZ9A 4LJXA 3QUTA 4Y2PA 2KVCA 4RPXA 9ICSA 4Q44A 4JUZA 3UMBA 2WAQC 1SKSA 1ZQRA 3MABA 4ECZA 2HI0A 3K4GA 2F1HA 2G0AA 5AM4A 3KFUF 2RDIA 2W9AA 2DBYA 3BJYA 1ZQAA 4F3OA 1NOMA 3EW9A 1MA7A 4F91B 3GDXA 2FE9A 3H0LB 3QX7A 4Z6DA 1ZQIA 4I2FA 2W9MA 3RR8A 1ZQXA 4RQ3A 4GXIA 1HJPA 2G5HB 2JGAA 2V4QA 4C4SA 9ICQA 4J9SA 3TKAA 4CF4A 2KHQA 1N5XA 4QZBA 7ICPA 1Q3UA 4F50A 5KFVA 5EWGA 9ICGA 4NLCA 2W7PA 4IRKA 4NL9C 3AU2A 1L5UA 5CJ7A 2RDJA 1HUZA 3PV8A 5KT3A 5ALYA 1N62A 4F2RA 5KL8B 5IINA 2PMZC 7ICOA 4QZFA 4M9LA 1NI3A 2ZTDA 5KFHA 2W8KA 2KV2A 2DPIA 4P0QA 1BPBA 4JMUA 3RJKA 3RJEA 5ALMA 2EZXA 3C5FA 5ALZA 3PX0A 2V4RA 2ZG6A 5ALNA 3BS7A 3JPNA 1ZQ1C 3GV7B 1YZ6A 4BGDA 1T7PA 4PL1A 2EAMA 2FLNA 1TFRA 4I2HA 2LBOA 5FP0A 2CN1A 4RQMA 4QZCA 1RQLA 5EE9A 3SD7A 1BPEA 3ZD9A 4DOBA 5EE1A 3WKEA 2BHNA 5J0QA 4NL9A 1D9FA 2KSOB 5ALFA 1WUDA 1QQ7A 4DL4A 5G5GA 2ZIWB 9ICXA 1T3NA 3MR3A 1URJA 2HBKA 4B9TA 1U4BA 2FPKA 8ICPA 5TZVA 1SGGA 4KMUA 1U47A 4DSLA 3BS5A 2HCFA 9ICJA 3WK7A 4OJ6A 3V7JA 3RR7A 2ZIVA 3HRDD 1F5SA 1X6JA 2G07A 2QB1A 3ZDBA 4RQ4A 4KX3A 2K4PA 3PSPA 5HHIA 4YR0A 2KNJA 3ETLA 5DG9A 3A0BU 1U45A 1D8BA 2LMRA 5DBBA 1CI4A 5IILA 4ZOHC 8ICHA 8ICMA 3PSFA 4J03A 1A77A 2DUYA 4DQPA 2HSZA 3TANA 2YB1A 4ELUA 5KT7A 2WF8A 3M9MB 1D9DA 2VA2A 4ED7A 1ZD3A 4EBDA 2BDUA 5EOZA 3QUCA 1ZQHA 2FMPA 1D8LA 1ZRNA 1GO3F 2DF4B 2EANA 5BPCA 4RUAA 2R18A 4ICAA 3R9KA 2KTQA 4MEYA 2P6UA 3M7DA 3IRUA 3EWAA 4OJ5A 5EE3A 4YP3A 2W7OA 5DKWA 4DL3A 1SXDA 2HHWA 4B9SA 5A0LA 2XGQA 5TISU 4C8KA 2BGWA 4UASA 4KMOB 4J9PA 1L7MA 4MFCA 2OEHA 2VJ4A 5KFOA 3M6ZA 3MR2A 1A6SA 5ALTA 9ICBA 1B22A 2ZTEA 3GIKA 5KFWA 4IQWA 5AI8A 3F2BA 4O0IA 4OJLA 1ZQLA 4ECYA 3TAQA 3UQ2A 3RRGA 4UB3A 1V9PA 1X40A 1UA0A 4F5NA 1KEJA 1ZOLA 5DQIA 4TQSA 2OWOA 5KFXA 2BZFA 4DO9A 2JEIA 4B9LA 3AMZA 9ICRA 2BPFA 4PJ0U 2PFNA 3K1RB 3E0FA 5AM3A 4QZ9A 4US9A 1XS9D 3RJGA 3O0FA 2YY6A 4IR9A 4QZHA 1LKYA 1L3TA 2EZZA 3MDAA 3KZXA 1WG8A 2W54A 1RYSA 2AQ4A 4RQ6A 2KG5A 5KG3A 8ICFA 8ICUA 4MF2A 5DBCA 4DQQA 4DSKA 5H2FU 1L8LA 1Z1VA 4DLEA 2A1JA 3V72A 3ZD8A 4F92B 1C7YA 5AK5A 3K75D 4J9OA 4F5QA 4JV0A 3GU3A 5DB7A 1KLNA 5KFLA 4O5CA 1JALA 3L3FX 2JEFA 2ESEA 4F93B 3BQ0A 5CEHA 5KFMA 2ZJ5A 4UW9A 1PVPA 1M6YA 2KOBA 1MQ2A 2ASDA 5J0UA 2EH9A 5EWEA 3RAQA 1QQ6A 2DPJA 3AQFA 4EEYA 1KKXA 2LYAA 2KN7A 5AKIA 5KAIU 3H8MA 4ED3A 4F2SA 1X9XA 4F72A 5J0WA 3KHHA 5JRTA 3JPTA 2ASJA 4ED1A 4CGZA 1N61A 2ODGA 4CF3A 2ZTCA 4YD1A 5HNKA 4RQ8A 5AKLA 2GH1A 1ZQZA 1JIHA 1N5WA 3QU5A 4DWIA 4XQ8A 4TUQA 2QLTA 2ASLA 2G08A 2YMPA 3T3FA 1BPXA 1ZQPA 7ICEA 2IOHA 5L9XA 5D49A 3AEVA 4NWIA 3L4PA 4EZ6A 3JPOA 3DDHA 3UXPA 3UQ0A 2BPGA 2ZJ8A 2MSNA 1Z4NA 4QZGA 4RNMA 4UB2A 2RLTA 4NXZA 1ZQUA 2KE7A 1PVQA 1MSWD 1BNPA 5KG4A 4UARA 2F76X 2GO7A 4FS1A 4J9MA 1SIJA 4KLIA 4MEXA 1ZD5A 4DSFA 3CNHA 3CP8A 4TUPA 4KX5A 1KTQA 3IM1A 7ICFA 4FBTA 3IDWA 4C4RA 5ALQA 1NK8A 4P4MA 3JPQA 1SXEA 5K4LA 5ALWA 3Q8SB 5AM1A 2I6XA 2F8KA 2VKQA 9ICAA 4O3PA 2N1RA 2ZUDA 4I29A 4IL6U 1ZQJA 4C8MA 1DK2A 3F5AA 4DSEA 4NM1A 2R8IA 3D2NA 1J2MA 4YG2A 3D6JA 1J2NA 2CXYA 3G6VA 3GFKB 1S0OA 2ZUBA 4PHPA 1QSSA 4KLFA 2KSOA 2ISOA 2ZIWA 5L1IA 4QZDA 3RF9A 5J2EA 3EPGA 4ED6A 5KFJA 3ZDAA 5KG5A 3L5KA 1SL0A 1TAMA 2YMMA 3QU2A 3QXGA 3SENA 4Y2RA 5ALKA 1N63A 4I2DA 5HHHA 4F71A 3OSNA 1ZQTA 2E1FA 1DGSA 3KHLA 2WFAA 3UM9A 4AP9A 5J0OA 4J9KA 3AUOA 1DXSA 3NVWA 1V97A 3ZDCA 3M9OB 5J0YA 2JR5A 5KT4A 5KT5A 1N56A 2PFOA 4DL7A 3OGUA 1NKEA 2ZXIA 2F44A 4ELVA 3NUQA 2RRDA 3QEBZ 2JZBB 4DFPA 4DFMA 1Z4OA 5GTHU 3MDCA 1KRPA 4YMOA 1SL2A 1XSPA 4QNLA 3ISBA 2KK0A 3F5EA 3RRHA 1NNLA 2KZ3A 2HHSA 3SR6A 2IHNA 1BNOA 3NVZA 3WKCA 4QZEA 1A0PA 4YMNA 5F9NA 9ICIA 1RXVA 5DB6A 2FMSA 4M47A 1ZJMA 1VJ5A 3WKDA 3RB4A 3ORYA 4Y2UA 3C28A 1ZQVA 2K60A 5JTIA 1VDVA 3N7SC 5AI0A 2F1IA 2YMQA 4Z6FA 4JK1A 2HHUA 5ALLA 4RUCA 2A3VA 5ALRA 4PGQA 2F77X 2FDRA 4MF8A 3WK4A 3RFAA 2C28A 1NJYA 4PGXA 1HUOA 1O08A 1ZQEA 1QQ5A 4M2YA 2ALZA 2NRZA 2L5YA 3GV8B 4DOCA 2PMZF 3PX4A 1Z19A 4C80A 2R8KA 1T4GA 3UXOA 4DSIA 3B0XA 2W55A 3IG5A 2ZUCA 4I2IA 1WCLA 2BCRA 1SB3C 1NJZA 2MA1A 2KJ8A 2W04A 1B0XA 1UQVA 2B0CA 3FDSA 4J9LA 2C2RA 1U48A 3HKZF 2NYVA 1FFUA 4RPZA 3PMLA 3F2CA 2BCUA 2D8CA 4EYHB 8ICJA 3WKAA 3EUB2 5DGBA 3N7RC 3C1ZA 1HEKA 4PL2A 1RZTA 4ECRA 4ECQA 3C2KA 4UB1A 5KG0A 5J2GA 4CDGA 1S0NA 3PVXA 4I2BA 3SMVA 4RU9A 3Q8QB 3PX6A 2D3DA 1F44A 1H38A 5T14A 4NLGA 2KEYA 2H3ZA 1SZHA 4KLDA 3BZKA 2PKEA 2Z7JA 3NTUA 5IIIA 1TE2A 1KQQA 2XC9A 2XY7A 4U7CA 7ICIA 5ALGA 5IIJA 3G6YA 5KFYA 3I76A 2LM4A 1P7DA 5L1MA 5KNIA 7ICLA 3K1ZA 4DS4A 3WK8A 4QWEA 4UBCA 4C8LA 4YQWA 4F4XA 5HMMA 1XSLA 4UAWA 8ICZA 3IHQB 5AM5A 3RB6A 3V7LA 3UPQA 4UB5A 2E3TA 4O3NA 9ICCA 3HKZC 4RQ5A 3ALRA 9ICNA 1JX4A 3TQ1A 3SYZA 3BQTA 2XY5A 1Z3EB 4DEZA 1DGJA 1F0MA 4TUSA 1UPHA 3NGDA 3ZDDA 1LVHA 3QZ7A 9ICLA 2C2DA 2HHTA 3PO4A 4NJ8A 4MFFA 2ZJAA 3I28A 4BUGA 1UA1A 1PUZA 3RJIA 2E8OA 5C5JA 3OPXA 3H4BA 4BXOB 2H3FA 4BWJA 2OM6A 3IN5A 9ICPA 4C8OA 2PI5A 5KFGA 5KFUA 4TQRA 4IRDA 4KLUA 1Q3VA 5AKXA 1X42A 8ICEA 3HP6A 4Y2QA 1ZQWA 2LM1A 5DB9A 1ECWA 4KLSA 2E1EA 2EDUA 1BPYA 3NS1A 4Q43A 7ICUA 4KLEA 4IQTA 5IIKA 4Y2YA 5L1LA 4F5OA 2KZZA 1JXLA 4ED8A 5J0TA 3TADC 4KLHA 4R65A 2GOLA 3SEIA 2PFQA 2KMDA 2VA3A 4DS5A 2AU0A 3ONNA 2OXOA 1X2IA 4DOAA 3Q8KA 2C2EA 3SZ2A 2FLPA 4EYIB 2W3RA 5DLGA 5KAFU 4CE6A 3T79A 2Y9UA 3FC4A 4USAA 1ZQFA 1KSPA 3Q8LA 1KFSA 2JZBA 2W11A 2KVSA 3B0YA 1ZQOA 2OH2A 2QARB 4LZGA 8ICTA 3UXNA 1MN8A 3NRZA 2BCVA 4P4OA 2LI6A 3EPIA 5HP4A 2W9CB 2GWSA 4I2EA 4QZIA 2F8LA 1LB2B 2E8NA 5C0YA 9ICOA 3TACB 3TI0A 9ICFA 3T5LA 3ETRA 4NV0A 5KT6A 4LZDA 2KKVA 2K8CB 4F5RA 3T5HA 3QU9A 3TADA 2XGPA 3C1YA 5DLFA 4M6WA 9ICMA 2JV3A 4UAUA 2JH7A 2UVUA
chains in the Genus database with same CATH topology
3OJUA 4F4KA 7ICHA 4DSJA 4CCHA 1AROP 1ZQDA 3OSPA 4DSEA 4NM1A 2R8IA 4YG2A 1S0MA 5IIMA 3G6VA 3LK9A 1S97A 4DF4A 8ICBA 3GFKB 3OHBA 5KFPA 1S0OA 2Y1JA 1EXNA 3HT3A 2ZUBA 4PHPA 1QSSA 3PMNA 5J2CA 2FLLA 7ICVA 4KITB 2BR0A 2ISOA 4KLFA 3QZ8A 5L1IA 4DLGA 4QZDA 3MR6A 1XSNA 8ICYA 3RH6A 3GILA 1TK5A 4R8UB 5J2EA 4M9NA 3EPGA 1X9WA 3GV5B 4ED6A 7ICNA 4UB4A 3EYZA 5KFJA 4EBEA 3ZDAA 4YXJA 2W9BA 3LDAA 5JUMA 4EZ9A 4K4GA 5KG5A 2KZMA 3GIJA 1SL0A 7ICTA 4PPXA 4RZRA 4RPXA 3H40A 8ICVA 1UT8A 4Q44A 1NK0A 4JUZA 4KLGA 9ICSA 4M9JA 1SKSA 1IM4A 4DFJA 1ZQRA 1XO1A 3MABA 4YMMA 5CA7A 4I2DA 4ECZA 5HHHA 3HW8A 2IBKA 3OSNA 5J2IA 4I28A 1ZQTA 3K4GA 2F1HA 1DGSA 2RDIA 3KHLA 2W9AA 2XO7A 4RNNA 4KN4A 5J0OA 3BJYA 1U49A 1ZQAA 4J9KA 2XCAA 3AUOA 3PW0A 4F3OA 1NOMA 3EW9A 1JXEA 4F91B 5CWRA 3GDXA 4DF8A 1ZQYA 3ZDCA 5J2DA 3MR5A 4Z6DA 3M9OB 5J0YA 4RQ2A 4B9MA 4X5VA 3RBDA 5KT4A 3V6JA 5KT5A 1NK4A 1N56A 1ZQIA 1XWLA 4I2FA 4UBBA 2PFOA 4KN7A 4DL7A 3OGUA 2BCQA 4I2GA 2W9MA 3GIIA 3RR8A 1ZQXA 4RQ3A 5DDMA 4GXIA 2IMWP 1HJPA 1NKEA 4MFAA 2V4QA 2C22A 5J2JA 9ICQA 4J9SA 3RB3A 1NJWA 4ELVA 3AU6A 4QZBA 4J9QA 4GC7A 7ICPA 7ICMA 4F50A 5KFVA 4F4YA 3QEBZ 2JZBB 2R8HA 5EWGA 4DFPA 4DFMA 9ICGA 4RT3A 3OHAA 3MDCA 1KRPA 5L1JA 4IRKA 5J2KA 2KFNA 4IQUA 1NK9A 3AU2A 4YMOA 2WTFA 2B21A 1SL2A 5CJ7A 2RDJA 1L5UA 1XSPA 1S77D 1HUZA 3ISBA 3PV8A 3KHGA 3RBEA 5KT3A 4F2RA 8ICXA 5IINA 7ICOA 4LVSA 3PW4A 3MGIA 3RRHA 4QZFA 2KZ3A 4M9LA 2PI4A 4YCXA 2ZTDA 4ECTA 5KFHA 2HW3A 2HHSA 8ICAA 5KFNA 3M8RA 2W8KA 2IHNA 4RQ1A 1KFTA 9ICHA 5DDYA 3MGHA 5KTQA 5DQGA 5J0SA 8ICWA 2DPIA 4JWMA 1QLNA 4QZEA 1BPBA 5KT2A 1ZETA 4YMNA 5F9NA 4JWNA 4ZH4A 4G3IA 2VA8A 3OJSA 1RXVA 5KFFA 9ICIA 4DFKA 3RJKA 8ICLA 5DB6A 2FMSA 3THVA 1NJXA 3RJEA 1N48A 1ZJMA 4M47A 8ICGA 5J0RA 3ISCA 4M9HA 3RB4A 1NKCA 3FYHA 7ICGA 3PR5B 3ORYA 3QE9Y 1RYRA 1SKRA 3C5FA 1ZQVA 1K1SA 5KFAA 1Z00A 4B9VA 3PX0A 3H7IA 2V4RA 4IQVA 3C2LA 4BWMA 3JPNA 2F1IA 4GC6A 4KTQA 4Z6FA 4JK1A 3HPOA 2HHUA 4RNOA 3GV7B 2AGOA 4RUCA 1S10A 1ZQNA 3RJHA 4E0DA 4O5KA 4PGQA 4ECSA 5EWFA 5DGAA 4BGDA 1T7PA 1CEZA 5CHGA 1A76A 4MF8A 1Y88A 1ZYQA 2J6SA 2FLNA 1TFRA 4Q45A 7ICSA 4I2HA 1T8EA 5KFKA 1ZQBA 2C28A 1NJYA 4PGXA 2XY6A 2R8JA 1HUOA 4JV2A 4QZCA 4R63A 3GIMA 5DB8A 4ECXA 1BPEA 1UT5A 3ZD9A 2W8LA 4DOBA 2NRZA 2ALZA 3H8SA 1BPZA 1ZQEA 4M2YA 4QZ8A 2ATLA 5KG6A 3GV8B 4DOCA 5CB1A 7ICJA 3PX4A 2BHNA 2HVHA 5J0QA 1NKBA 3PNCA 1D9FA 3PW2A 4DL4A 1ZQSA 1ZQKA 3SV4A 2R8KA 2F1JA 5HMLA 4M04A 1T4GA 9ICXA 2PFPA 3UXOA 4DSIA 4KLQA 3B0XA 1T3NA 2ZUCA 3MR3A 4I2IA 2W9BB 1TKDA 2R8GA 9ICWA 3SI8A 8ICCA 1WCLA 3RTVA 4YD2A 4UAZA 2BCRA 4B9TA 1U4BA 2FPKA 1NJZA 5TZVA 8ICPA 3N97B 4KMUA 1U47A 3SV3A 4DSLA 3PO5A 2V9WA 2HHVA 2J6TA 4QW9A 3FDSA 4QZAA 3Q8RB 4O9MA 4I2CA 4YVZA 4J9LA 9ICJA 2XCPA 2NRVA 4BXOA 2C2RA 1U48A 3V7JA 3RR7A 4RPZA 3PMLA 2BQ3A 2KFZA 3ZDBA 4RQ4A 3H8WA 4XUSA 4UAYA 2BCUA 5KG1A 5KG7A 3M9NB 5HHIA 4YR0A 4EYHB 1ZQMA 8ICJA 8ICNA 5DGBA 3ETLA 5BOMA 3MFHA 3C1ZA 4J9RA 5DG9A 1U45A 2HVIA 1RZTA 5DBBA 5IILA 4M9GA 4ECRA 8ICHA 8ICMA 4RPYA 1A77A 4O5EA 2FPMA 4ECQA 3C2KA 4UB1A 5KG0A 5J2GA 4DQPA 3TANA 1S9FA 1TV9A 3GQCA 1S0NA 4ELUA 4YR2A 5KT7A 3PVXA 4I2BA 4RU9A 9ICEA 3M9MB 1D9DA 2VA2A 5J29A 1SL1A 4ED7A 3Q8QB 4EBDA 3PX6A 2I9GA 3PW7A 4O3SA 5EOZA 1H38A 4GLXA 1ZQHA 2FMPA 1D8LA 2ISPA 4NLGA 5KFIA 8ICKA 5BPCA 4KLDA 4RUAA 2IA6A 2LYHA 1TK0A 4Q8FA 3T5JA 1NK5A 2KTQA 3LWLA 3NTUA 4MEYA 2P6UA 4PH5A 4F4WA 3Q8MA 5IIIA 1QSYA 4YR3A 4GXKA 4NLNA 3EWAA 2XC9A 1KFDA 2XY7A 4YP3A 2HHXA 7ICIA 5DKWA 5IIJA 3G6YA 1RXWA 4PHDA 4NY8A 3TFRA 5KFRA 4DL3A 5KFYA 2UVRA 4B9NA 4B9SA 2HHWA 5CP2A 4NLKA 2HHQA 2XGQA 1RPLA 4C8KA 2BGWA 4C8NA 4Q8EA 4J9PA 1L3UA 7ICLA 2FPLA 2IHMA 5CR0A 4MFCA 5KFDA 4DS4A 3BQ2A 5KFOA 4KLLA 4RT2A 5KFZA 3H8JA 4IRCA 4RQ7A 1JN3A 4QWEA 3MR2A 2BQUA 4UBCA 4C8LA 1S0VA 4ECWA 1MQ3A 3HX0A 4O3RA 9ICBA 4YQWA 1B22A 2ZTEA 4GXJA 3GIKA 5KFWA 4F4XA 4IQWA 3JPPA 2BDPA 5HMMA 4PHAA 1XSLA 3PY8A 4UAWA 8ICZA 3IHQB 2UVVA 4JV1A 1Z00B 4Z6EA 4O0IA 1ZQLA 4ECYA 3RB6A 3TAQA 3UQ2A 3V7LA 4O3QA 1ZQGA 4ECVA 3RRGA 4UB3A 1V9PA 3MBYA 3UPQA 3PW5A 1UA0A 5J2HA 5L1KA 1KEJA 4UB5A 4F5NA 3RH5A 5J0PA 4O3NA 9ICCA 4M6WB 5DQIA 4RQ5A 5KFEA 4TQSA 4F5PA 2AGQA 2OWOA 4I2AA 5KFXA 9ICNA 7ICRA 4DO9A 1JX4A 3TQ1A 3SYZA 4B9LA 2JEIA 2JEGA 1CUKA 1X9MA 9ICRA 1K1QA 5J2FA 3BQTA 1MC8A 2W9CA 1NK6A 1ZQQA 4DL6A 2BPFA 7ICKA 2XY5A 1LV5A 2PFNA 4NLZA 4QZ9A 1QTMA 1Z3EB 5BOLA 1XS9D 3RJGA 3PR4A 4DEZA 8ICRA 1ZJNA 4BDPA 4TUSA 3C23A 3EZ5A 4IR9A 5KFQA 3NGDA 4QZHA 3TARA 1XU4A 1L3TA 3ZDDA 3V6HA 4EBCA 3MDAA 3QZ7A 2NRTA 3M8SA 3ZDEA 2C2DA 1L3VA 2AQ0A 1U9LA 4XA5A 2HHTA 3PO4A 9ICLA 2J6UA 4Z6CA 4R66A 1RYSA 2AQ4A 4MFFA 2MUTA 2ZJAA 4ED0A 4RQ6A 3QEAZ 1BGXT 4R64A 3ISDA 5KG2A 5KG3A 1UA1A 2P66A 8ICFA 8ICUA 4IR1A 2AJQA 4MF2A 5DBCA 1PZNA 3RJIA 4KLOA 2NRXA 2Y1IA 4DQQA 4QWAA 2BCSA 5D4BA 5C5JA 4DSKA 4I2JA 8ICOA 2PXIA 1IXRA 3H4BA 4NM2A 4KLTA 4DLEA 8ICIA 2A1JA 4BXOB 3V72A 3ZD8A 3KTQA 4F92B 4BWJA 9ICUA 4DL2A 1C7YA 3K75D 4J9OA 4F5QA 4JV0A 5DB7A 4I27A 4ELTA 1KLNA 9ICPA 4C8OA 5KFLA 4O5CA 2PI5A 2DFLA 9ICKA 8ICQA 4J9NA 4KLMA 5KFGA 1XC9A 2JEFA 4FO6A 5KFUA 4F93B 2BPCA 1TAQA 4TQRA 3V7KA 4DQSA 3RH4A 3TAPA 4IRDA 3E2EA 4KLUA 3BQ0A 4YFKA 4YN4A 5KFMA 8ICEA 2I1QA 2ZJ5A 3C21A 3HP6A 4R8UA 3LWMA 1MQ2A 1ZQWA 4DL5A 2ASDA 5J0UA 5DB9A 4KLSA 4ED2A 5EWEA 3RAQA 2VANA 2MAXA 3KHRA 2Q0ZX 3RB0A 2DPJA 1BPYA 4PHEA 4Q43A 1TK8A 4DQIA 3JPRA 4EEYA 1NK7A 7ICUA 4KLEA 2KN7A 4IQTA 5IIKA 5DQHA 5L1LA 4F5OA 1ZQCA 2KZZA 3BDPA 3HWTA 4ED3A 5IIOA 4FS2A 1JXLA 4F2SA 2BQRA 3RJFA 5J0WA 4ED8A 2JEJA 4YXMA 5J0TA 3N4MB 3KHHA 1COOA 3JPTA 2ASJA 4ED1A 4O3OA 4KLHA 2ZTCA 4R65A 4YD1A 5HNKA 4RQ8A 1BPDA 2PFQA 5KFCA 1ZQZA 7ICQA 1JIHA 3H4DA 4DWIA 4M0AA 4XQ8A 4TUQA 2VA3A 4K4HA 3G6XA 4DS5A 2AU0A 2ASLA 4P2HA 4K4IA 1X2IA 4RQ0A 4DOAA 3Q8KA 2C2EA 4QWDA 4PGYA 3SZ2A 2FLPA 4EYIB 3T3FA 5DLGA 3C2MA 5DG7A 3RJJA 1BPXA 5DG8A 1ZQPA 4KLJA 7ICEA 5L9XA 2NRWA 2AGPA 5F9LA 4HYKA 5D49A 4F8RA 4EZ6A 3JPOA 3UXPA 3UQ0A 2BPGA 1ZQFA 2ZJ8A 4QZGA 1KSPA 3Q8LA 5KFBA 1KFSA 2JZBA 3B0YA 4RNMA 4UB2A 1ZQOA 2UVWA 1X9SA 3TFSA 4LZGA 1B43A 3MFIA 4P4PA 1BVSA 8ICTA 4NXZA 1ZQUA 4FBUA 3UXNA 4QWCA 1MSWD 5KG4A 2BCVA 4P4OA 3EPIA 5HP4A 4FS1A 2W9CB 4J9MA 3V6KA 2GWSA 4I2EA 4QZIA 3JPSA 5KFSA 5D46A 4KLIA 1KDHA 1LB2B 4MEXA 2H5XA 4DSFA 9ICOA 3TI0A 9ICFA 5DBAA 3T5LA 3RAXA 4TUPA 5KT6A 5KFTA 1KTQA 3IM1A 4LZDA 7ICFA 2BKEA 3C5GA 1D8YA 4FBTA 4DQRA 8ICSA 1DOQA 3T5KA 9ICVA 4F5RA 1SKWA 3T5HA 1QSLA 1L3SA 3Q8PB 1JMSA 2XGPA 2MUTB 1NK8A 1TVAA 4ECUA 4P4MA 1S76D 3BQ1A 3JPQA 3C1YA 3Q8SB 2M9NA 5DLFA 4TURA 5J0XA 4M6WA 9ICMA 4F4ZA 4XRHA 5J2AA 9ICTA 2FMQA 1TAUA 9ICAA 4B9UA 4O3PA 4UQGA 5J2BA 4QWBA 2ZUDA 1WCNA 4I29A 2A1JB 2UVUA 4QW8A 1ZQJA 2P6RA 1SZPA 4C8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJU A;  4F4K A;  7ICH A;  4DSJ A;  4CCH A;  1ARO P;  1ZQD A;  3OSP A;  4DSE A;  4NM1 A;  2R8I A;  4YG2 A;  1S0M A;  5IIM A;  3G6V A;  3LK9 A;  1S97 A;  4DF4 A;  8ICB A;  3GFK B;  3OHB A;  5KFP A;  1S0O A;  2Y1J A;  1EXN A;  3HT3 A;  2ZUB A;  4PHP A;  1QSS A;  3PMN A;  5J2C A;  2FLL A;  7ICV A;  4KIT B;  2BR0 A;  2ISO A;  4KLF A;  3QZ8 A;  5L1I A;  4DLG A;  4QZD A;  3MR6 A;  1XSN A;  8ICY A;  3RH6 A;  3GIL A;  1TK5 A;  4R8U B;  5J2E A;  4M9N A;  3EPG A;  1X9W A;  3GV5 B;  4ED6 A;  7ICN A;  4UB4 A;  3EYZ A;  5KFJ A;  4EBE A;  3ZDA A;  4YXJ A;  2W9B A;  3LDA A;  5JUM A;  4EZ9 A;  4K4G A;  5KG5 A;  2KZM A;  3GIJ A;  1SL0 A;  7ICT A;  4PPX A;  4RZR A;  4RPX A;  3H40 A;  8ICV A;  1UT8 A;  4Q44 A;  1NK0 A;  4JUZ A;  4KLG A;  9ICS A;  4M9J A;  1SKS A;  1IM4 A;  4DFJ A;  1ZQR A;  1XO1 A;  3MAB A;  4YMM A;  5CA7 A;  4I2D A;  4ECZ A;  5HHH A;  3HW8 A;  2IBK A;  3OSN A;  5J2I A;  4I28 A;  1ZQT A;  3K4G A;  2F1H A;  1DGS A;  2RDI A;  3KHL A;  2W9A A;  2XO7 A;  4RNN A;  4KN4 A;  5J0O A;  3BJY A;  1U49 A;  1ZQA A;  4J9K A;  2XCA A;  3AUO A;  3PW0 A;  4F3O A;  1NOM A;  3EW9 A;  1JXE A;  4F91 B;  5CWR A;  3GDX A;  4DF8 A;  1ZQY A;  3ZDC A;  5J2D A;  3MR5 A;  4Z6D A;  3M9O B;  5J0Y A;  4RQ2 A;  4B9M A;  4X5V A;  3RBD A;  5KT4 A;  3V6J A;  5KT5 A;  1NK4 A;  1N56 A;  1ZQI A;  1XWL A;  4I2F A;  4UBB A;  2PFO A;  4KN7 A;  4DL7 A;  3OGU A;  2BCQ A;  4I2G A;  2W9M A;  3GII A;  3RR8 A;  1ZQX A;  4RQ3 A;  5DDM A;  4GXI A;  2IMW P;  1HJP A;  1NKE A;  4MFA A;  2V4Q A;  2C22 A;  5J2J A;  9ICQ A;  4J9S A;  3RB3 A;  1NJW A;  4ELV A;  3AU6 A;  4QZB A;  4J9Q A;  4GC7 A;  7ICP A;  7ICM A;  4F50 A;  5KFV A;  4F4Y A;  3QEB Z;  2JZB B;  2R8H A;  5EWG A;  4DFP A;  4DFM A;  9ICG A;  4RT3 A;  3OHA A;  3MDC A;  1KRP A;  5L1J A;  4IRK A;  5J2K A;  2KFN A;  4IQU A;  1NK9 A;  3AU2 A;  4YMO A;  2WTF A;  2B21 A;  1SL2 A;  5CJ7 A;  2RDJ A;  1L5U A;  1XSP A;  1S77 D;  1HUZ A;  3ISB A;  3PV8 A;  3KHG A;  3RBE A;  5KT3 A;  4F2R A;  8ICX A;  5IIN A;  7ICO A;  4LVS A;  3PW4 A;  3MGI A;  3RRH A;  4QZF A;  2KZ3 A;  4M9L A;  2PI4 A;  4YCX A;  2ZTD A;  4ECT A;  5KFH A;  2HW3 A;  2HHS A;  8ICA A;  5KFN A;  3M8R A;  2W8K A;  2IHN A;  4RQ1 A;  1KFT A;  9ICH A;  5DDY A;  3MGH A;  5KTQ A;  5DQG A;  5J0S A;  8ICW A;  2DPI A;  4JWM A;  1QLN A;  4QZE A;  1BPB A;  5KT2 A;  1ZET A;  4YMN A;  5F9N A;  4JWN A;  4ZH4 A;  4G3I A;  2VA8 A;  3OJS A;  1RXV A;  5KFF A;  9ICI A;  4DFK A;  3RJK A;  8ICL A;  5DB6 A;  2FMS A;  3THV A;  1NJX A;  3RJE A;  1N48 A;  1ZJM A;  4M47 A;  8ICG A;  5J0R A;  3ISC A;  4M9H A;  3RB4 A;  1NKC A;  3FYH A;  7ICG A;  3PR5 B;  3ORY A;  3QE9 Y;  1RYR A;  1SKR A;  3C5F A;  1ZQV A;  1K1S A;  5KFA A;  1Z00 A;  4B9V A;  3PX0 A;  3H7I A;  2V4R A;  4IQV A;  3C2L A;  4BWM A;  3JPN A;  2F1I A;  4GC6 A;  4KTQ A;  4Z6F A;  4JK1 A;  3HPO A;  2HHU A;  4RNO A;  3GV7 B;  2AGO A;  4RUC A;  1S10 A;  1ZQN A;  3RJH A;  4E0D A;  4O5K A;  4PGQ A;  4ECS A;  5EWF A;  5DGA A;  4BGD A;  1T7P A;  1CEZ A;  5CHG A;  1A76 A;  4MF8 A;  1Y88 A;  1ZYQ A;  2J6S A;  2FLN A;  1TFR A;  4Q45 A;  7ICS A;  4I2H A;  1T8E A;  5KFK A;  1ZQB A;  2C28 A;  1NJY A;  4PGX A;  2XY6 A;  2R8J A;  1HUO A;  4JV2 A;  4QZC A;  4R63 A;  3GIM A;  5DB8 A;  4ECX A;  1BPE A;  1UT5 A;  3ZD9 A;  2W8L A;  4DOB A;  2NRZ A;  2ALZ A;  3H8S A;  1BPZ A;  1ZQE A;  4M2Y A;  4QZ8 A;  2ATL A;  5KG6 A;  3GV8 B;  4DOC A;  5CB1 A;  7ICJ A;  3PX4 A;  2BHN A;  2HVH A;  5J0Q A;  1NKB A;  3PNC A;  1D9F A;  3PW2 A;  4DL4 A;  1ZQS A;  1ZQK A;  3SV4 A;  2R8K A;  2F1J A;  5HML A;  4M04 A;  1T4G A;  9ICX A;  2PFP A;  3UXO A;  4DSI A;  4KLQ A;  3B0X A;  1T3N A;  2ZUC A;  3MR3 A;  4I2I A;  2W9B B;  1TKD A;  2R8G A;  9ICW A;  3SI8 A;  8ICC A;  1WCL A;  3RTV A;  4YD2 A;  4UAZ A;  2BCR A;  4B9T A;  1U4B A;  2FPK A;  1NJZ A;  5TZV A;  8ICP A;  3N97 B;  4KMU A;  1U47 A;  3SV3 A;  4DSL A;  3PO5 A;  2V9W A;  2HHV A;  2J6T A;  4QW9 A;  3FDS A;  4QZA A;  3Q8R B;  4O9M A;  4I2C A;  4YVZ A;  4J9L A;  9ICJ A;  2XCP A;  2NRV A;  4BXO A;  2C2R A;  1U48 A;  3V7J A;  3RR7 A;  4RPZ A;  3PML A;  2BQ3 A;  2KFZ A;  3ZDB A;  4RQ4 A;  3H8W A;  4XUS A;  4UAY A;  2BCU A;  5KG1 A;  5KG7 A;  3M9N B;  5HHI A;  4YR0 A;  4EYH B;  1ZQM A;  8ICJ A;  8ICN A;  5DGB A;  3ETL A;  5BOM A;  3MFH A;  3C1Z A;  4J9R A;  5DG9 A;  1U45 A;  2HVI A;  1RZT A;  5DBB A;  5IIL A;  4M9G A;  4ECR A;  8ICH A;  8ICM A;  4RPY A;  1A77 A;  4O5E A;  2FPM A;  4ECQ A;  3C2K A;  4UB1 A;  5KG0 A;  5J2G A;  4DQP A;  3TAN A;  1S9F A;  1TV9 A;  3GQC A;  1S0N A;  4ELU A;  4YR2 A;  5KT7 A;  3PVX A;  4I2B A;  4RU9 A;  9ICE A;  3M9M B;  1D9D A;  2VA2 A;  5J29 A;  1SL1 A;  4ED7 A;  3Q8Q B;  4EBD A;  3PX6 A;  2I9G A;  3PW7 A;  4O3S A;  5EOZ A;  1H38 A;  4GLX A;  1ZQH A;  2FMP A;  1D8L A;  2ISP A;  4NLG A;  5KFI A;  8ICK A;  5BPC A;  4KLD A;  4RUA A;  2IA6 A;  2LYH A;  1TK0 A;  4Q8F A;  3T5J A;  1NK5 A;  2KTQ A;  3LWL A;  3NTU A;  4MEY A;  2P6U A;  4PH5 A;  4F4W A;  3Q8M A;  5III A;  1QSY A;  4YR3 A;  4GXK A;  4NLN A;  3EWA A;  2XC9 A;  1KFD A;  2XY7 A;  4YP3 A;  2HHX A;  7ICI A;  5DKW A;  5IIJ A;  3G6Y A;  1RXW A;  4PHD A;  4NY8 A;  3TFR A;  5KFR A;  4DL3 A;  5KFY A;  2UVR A;  4B9N A;  4B9S A;  2HHW A;  5CP2 A;  4NLK A;  2HHQ A;  2XGQ A;  1RPL A;  4C8K A;  2BGW A;  4C8N A;  4Q8E A;  4J9P A;  1L3U A;  7ICL A;  2FPL A;  2IHM A;  5CR0 A;  4MFC A;  5KFD A;  4DS4 A;  3BQ2 A;  5KFO A;  4KLL A;  4RT2 A;  5KFZ A;  3H8J A;  4IRC A;  4RQ7 A;  1JN3 A;  4QWE A;  3MR2 A;  2BQU A;  4UBC A;  4C8L A;  1S0V A;  4ECW A;  1MQ3 A;  3HX0 A;  4O3R A;  9ICB A;  4YQW A;  1B22 A;  2ZTE A;  4GXJ A;  3GIK A;  5KFW A;  4F4X A;  4IQW A;  3JPP A;  2BDP A;  5HMM A;  4PHA A;  1XSL A;  3PY8 A;  4UAW A;  8ICZ A;  3IHQ B;  2UVV A;  4JV1 A;  1Z00 B;  4Z6E A;  4O0I A;  1ZQL A;  4ECY A;  3RB6 A;  3TAQ A;  3UQ2 A;  3V7L A;  4O3Q A;  1ZQG A;  4ECV A;  3RRG A;  4UB3 A;  1V9P A;  3MBY A;  3UPQ A;  3PW5 A;  1UA0 A;  5J2H A;  5L1K A;  1KEJ A;  4UB5 A;  4F5N A;  3RH5 A;  5J0P A;  4O3N A;  9ICC A;  4M6W B;  5DQI A;  4RQ5 A;  5KFE A;  4TQS A;  4F5P A;  2AGQ A;  2OWO A;  4I2A A;  5KFX A;  9ICN A;  7ICR A;  4DO9 A;  1JX4 A;  3TQ1 A;  3SYZ A;  4B9L A;  2JEI A;  2JEG A;  1CUK A;  1X9M A;  9ICR A;  1K1Q A;  5J2F A;  3BQT A;  1MC8 A;  2W9C A;  1NK6 A;  1ZQQ A;  4DL6 A;  2BPF A;  7ICK A;  2XY5 A;  1LV5 A;  2PFN A;  4NLZ A;  4QZ9 A;  1QTM A;  1Z3E B;  5BOL A;  1XS9 D;  3RJG A;  3PR4 A;  4DEZ A;  8ICR A;  1ZJN A;  4BDP A;  4TUS A;  3C23 A;  3EZ5 A;  4IR9 A;  5KFQ A;  3NGD A;  4QZH A;  3TAR A;  1XU4 A;  1L3T A;  3ZDD A;  3V6H A;  4EBC A;  3MDA A;  3QZ7 A;  2NRT A;  3M8S A;  3ZDE A;  2C2D A;  1L3V A;  2AQ0 A;  1U9L A;  4XA5 A;  2HHT A;  3PO4 A;  9ICL A;  2J6U A;  4Z6C A;  4R66 A;  1RYS A;  2AQ4 A;  4MFF A;  2MUT A;  2ZJA A;  4ED0 A;  4RQ6 A;  3QEA Z;  1BGX T;  4R64 A;  3ISD A;  5KG2 A;  5KG3 A;  1UA1 A;  2P66 A;  8ICF A;  8ICU A;  4IR1 A;  2AJQ A;  4MF2 A;  5DBC A;  1PZN A;  3RJI A;  4KLO A;  2NRX A;  2Y1I A;  4DQQ A;  4QWA A;  2BCS A;  5D4B A;  5C5J A;  4DSK A;  4I2J A;  8ICO A;  2PXI A;  1IXR A;  3H4B A;  4NM2 A;  4KLT A;  4DLE A;  8ICI A;  2A1J A;  4BXO B;  3V72 A;  3ZD8 A;  3KTQ A;  4F92 B;  4BWJ A;  9ICU A;  4DL2 A;  1C7Y A;  3K75 D;  4J9O A;  4F5Q A;  4JV0 A;  5DB7 A;  4I27 A;  4ELT A;  1KLN A;  9ICP A;  4C8O A;  5KFL A;  4O5C A;  2PI5 A;  2DFL A;  9ICK A;  8ICQ A;  4J9N A;  4KLM A;  5KFG A;  1XC9 A;  2JEF A;  4FO6 A;  5KFU A;  4F93 B;  2BPC A;  1TAQ A;  4TQR A;  3V7K A;  4DQS A;  3RH4 A;  3TAP A;  4IRD A;  3E2E A;  4KLU A;  3BQ0 A;  4YFK A;  4YN4 A;  5KFM A;  8ICE A;  2I1Q A;  2ZJ5 A;  3C21 A;  3HP6 A;  4R8U A;  3LWM A;  1MQ2 A;  1ZQW A;  4DL5 A;  2ASD A;  5J0U A;  5DB9 A;  4KLS A;  4ED2 A;  5EWE A;  3RAQ A;  2VAN A;  2MAX A;  3KHR A;  2Q0Z X;  3RB0 A;  2DPJ A;  1BPY A;  4PHE A;  4Q43 A;  1TK8 A;  4DQI A;  3JPR A;  4EEY A;  1NK7 A;  7ICU A;  4KLE A;  2KN7 A;  4IQT A;  5IIK A;  5DQH A;  5L1L A;  4F5O A;  1ZQC A;  2KZZ A;  3BDP A;  3HWT A;  4ED3 A;  5IIO A;  4FS2 A;  1JXL A;  4F2S A;  2BQR A;  3RJF A;  5J0W A;  4ED8 A;  2JEJ A;  4YXM A;  5J0T A;  3N4M B;  3KHH A;  1COO A;  3JPT A;  2ASJ A;  4ED1 A;  4O3O A;  4KLH A;  2ZTC A;  4R65 A;  4YD1 A;  5HNK A;  4RQ8 A;  1BPD A;  2PFQ A;  5KFC A;  1ZQZ A;  7ICQ A;  1JIH A;  3H4D A;  4DWI A;  4M0A A;  4XQ8 A;  4TUQ A;  2VA3 A;  4K4H A;  3G6X A;  4DS5 A;  2AU0 A;  2ASL A;  4P2H A;  4K4I A;  1X2I A;  4RQ0 A;  4DOA A;  3Q8K A;  2C2E A;  4QWD A;  4PGY A;  3SZ2 A;  2FLP A;  4EYI B;  3T3F A;  5DLG A;  3C2M A;  5DG7 A;  3RJJ A;  1BPX A;  5DG8 A;  1ZQP A;  4KLJ A;  7ICE A;  5L9X A;  2NRW A;  2AGP A;  5F9L A;  4HYK A;  5D49 A;  4F8R A;  4EZ6 A;  3JPO A;  3UXP A;  3UQ0 A;  2BPG A;  1ZQF A;  2ZJ8 A;  4QZG A;  1KSP A;  3Q8L A;  5KFB A;  1KFS A;  2JZB A;  3B0Y A;  4RNM A;  4UB2 A;  1ZQO A;  2UVW A;  1X9S A;  3TFS A;  4LZG A;  1B43 A;  3MFI A;  4P4P A;  1BVS A;  8ICT A;  4NXZ A;  1ZQU A;  4FBU A;  3UXN A;  4QWC A;  1MSW D;  5KG4 A;  2BCV A;  4P4O A;  3EPI A;  5HP4 A;  4FS1 A;  2W9C B;  4J9M A;  3V6K A;  2GWS A;  4I2E A;  4QZI A;  3JPS A;  5KFS A;  5D46 A;  4KLI A;  1KDH A;  1LB2 B;  4MEX A;  2H5X A;  4DSF A;  9ICO A;  3TI0 A;  9ICF A;  5DBA A;  3T5L A;  3RAX A;  4TUP A;  5KT6 A;  5KFT A;  1KTQ A;  3IM1 A;  4LZD A;  7ICF A;  2BKE A;  3C5G A;  1D8Y A;  4FBT A;  4DQR A;  8ICS A;  1DOQ A;  3T5K A;  9ICV A;  4F5R A;  1SKW A;  3T5H A;  1QSL A;  1L3S A;  3Q8P B;  1JMS A;  2XGP A;  2MUT B;  1NK8 A;  1TVA A;  4ECU A;  4P4M A;  1S76 D;  3BQ1 A;  3JPQ A;  3C1Y A;  3Q8S B;  2M9N A;  5DLF A;  4TUR A;  5J0X A;  4M6W A;  9ICM A;  4F4Z A;  4XRH A;  5J2A A;  9ICT A;  2FMQ A;  1TAU A;  9ICA A;  4B9U A;  4O3P A;  4UQG A;  5J2B A;  4QWB A;  2ZUD A;  1WCN A;  4I29 A;  2A1J B;  2UVU A;  4QW8 A;  1ZQJ A;  2P6R A;  1SZP A;  4C8M A; 
#chains in the Genus database with same CATH topology
 5ALP A;  4DSJ A;  1ARO P;  2YN4 A;  2JRZ A;  1N2X A;  1S0M A;  3I1Y A;  3LK9 A;  1YZ7 A;  4C0Z A;  3OHB A;  5KFP A;  3UMC A;  1EXN A;  2Y1J A;  1ED1 A;  3PMN A;  5J2C A;  3AM9 A;  5AKG A;  4KIT B;  3QZ8 A;  4GIB A;  1TK5 A;  2WF7 A;  3GV5 B;  4UB4 A;  3EYZ A;  2JHD A;  3GIJ A;  7ICT A;  8ICV A;  1NK0 A;  4M9J A;  1C20 A;  1IM4 A;  4DFJ A;  1XO1 A;  4YMM A;  3HW8 A;  1NZB A;  4I28 A;  2XO7 A;  4C7Z A;  2XCA A;  3PW0 A;  1JXE A;  2HBL A;  5CWR A;  4QIW C;  4RQN A;  2E8P A;  1ZQY A;  3MR5 A;  4JB3 A;  2VJ5 A;  4X5V A;  4KN7 A;  2M0N A;  2HBJ A;  3FM9 A;  2IMW P;  5AKY A;  4MFA A;  3RB3 A;  3AU6 A;  4GC7 A;  3M6K A;  2HBM A;  2G09 A;  3LVV A;  3OHA A;  3MGV A;  5J2K A;  2KFN A;  4IQU A;  2O6K A;  2WTF A;  2B21 A;  1S77 D;  2K4H A;  3RBE A;  3KHG A;  2K4I A;  4LVS A;  2PI4 A;  4YCX A;  3CW2 C;  2HW3 A;  1SV4 A;  8ICA A;  5KFN A;  3M8R A;  4RQ1 A;  1KFT A;  2HOQ A;  5DQG A;  5J0S A;  8ICW A;  1QLN A;  4G3I A;  4ZH4 A;  4DFK A;  2LKY A;  8ICL A;  3THV A;  1NJX A;  2RHF A;  3ISC A;  4M9H A;  1NKC A;  3DEE A;  2G06 A;  4UAT A;  1FIQ A;  1SKR A;  2KIC A;  1T3Q A;  3H7I A;  3C2L A;  4GC6 A;  3SAH A;  4RNO A;  4IC9 A;  2KIW A;  3RJH A;  3S6J A;  4E0D A;  4O5K A;  2EQY A;  4ECS A;  1Q46 A;  2DL0 A;  3MC1 A;  1CEZ A;  5CHG A;  1A76 A;  1Y88 A;  2J6S A;  4Q45 A;  5AM2 A;  5KFK A;  1ZQB A;  1KW4 A;  2XY6 A;  2R8J A;  2KJ5 A;  2NV3 A;  4JV2 A;  4R63 A;  1RQN A;  3GIM A;  4ECX A;  1UT5 A;  4FE3 A;  4C7Y A;  1BPZ A;  1O03 A;  3H8S A;  2ATL A;  7ICJ A;  5CB1 A;  1NKB A;  5ALD A;  3ZI4 A;  4BJQ A;  1ZQS A;  1ZQK A;  2K4E A;  3SV4 A;  2F1J A;  4M04 A;  2YX8 A;  3QU4 A;  4KLQ A;  1OUQ A;  1J97 A;  2W9B B;  3SI8 A;  3RTV A;  3PO5 A;  2HHV A;  3IG8 A;  4QZA A;  3Q8R B;  4YVZ A;  2XCP A;  4BXO A;  2DKZ A;  2NO4 A;  1X6I A;  4UAV A;  3H8W A;  4XUS A;  4UAY A;  5AK4 A;  5KG7 A;  5KG1 A;  3M9N B;  1ZQM A;  1RG6 A;  8ICN A;  4CNQ A;  1COK A;  4Y2J A;  5BOM A;  4J9R A;  2A19 A;  4M9G A;  4RPY A;  5AKJ A;  3GQC A;  4YR2 A;  2LHT A;  1SL1 A;  2P35 A;  1JI7 A;  5KFI A;  8ICK A;  2W03 A;  5CRX A;  1NK5 A;  4UB6 U;  4AYB F;  1QSY A;  4PH5 A;  2H3I A;  4F4W A;  3Q8M A;  4YR3 A;  1PK3 A;  1RXW A;  3WK9 A;  4NY8 A;  4PHD A;  3KD3 A;  2UVR A;  5CP2 A;  2Y0S F;  3H0R B;  1KL9 A;  2HHQ A;  4C8N A;  1L3U A;  2FPL A;  5CR0 A;  3BQ2 A;  4KLL A;  4RT2 A;  1JUD A;  1JN3 A;  5AKH A;  4ECW A;  5EE0 A;  4O3R A;  3U26 A;  4GXJ A;  2BDP A;  2Y9T A;  4JV1 A;  3QNM A;  1Z00 B;  4Z6E A;  2JMG A;  3IP4 B;  2QAR A;  2H3V A;  4O3Q A;  4ECV A;  5J2H A;  5ALI A;  5L1K A;  3RH5 A;  5J0P A;  4M6W B;  2ZIX B;  5KFE A;  4I2A A;  3VC8 A;  2JEG A;  4DFD A;  1K1Q A;  1ZQQ A;  2W9C A;  1PK1 B;  1B4F A;  1QTM A;  2DGZ A;  2A1A A;  2QB0 B;  1VLB A;  8ICR A;  1L7N A;  3C23 A;  1QCK A;  5KFQ A;  1XU4 A;  4EBC A;  2NRT A;  4FZN A;  1SWW A;  1L3V A;  2AQ0 A;  4XA5 A;  1ZXI A;  2KHV A;  4Z6C A;  4R66 A;  3UMG A;  1ZD2 P;  4R64 A;  2WF6 A;  4IR1 A;  2H3Q A;  1PZN A;  3GZF A;  2K8A A;  2Y1I A;  5HR6 A;  4QWA A;  5D4B A;  1FEZ A;  4I2J A;  4AYB C;  2PXI A;  1IXR A;  4NM2 A;  4KLT A;  5AK3 A;  1SWV A;  3KTQ A;  2Y0S C;  4DCC A;  2DFL A;  1V85 A;  2EZY A;  4HAI A;  3DV9 A;  1S8O A;  2BPC A;  4DQS A;  3V7K A;  3TAP A;  3E2E A;  3A0H U;  3KBB A;  2I1Q A;  3C21 A;  4O3M A;  4DL5 A;  2VAN A;  3KHR A;  4EEK A;  2Q0Z X;  5AKK A;  3RB0 A;  4DQI A;  1TK8 A;  1NK7 A;  5DQH A;  5IIO A;  2JXJ A;  2JEJ A;  3N4M B;  5B5E U;  1HIW A;  1COO A;  4O3O A;  4BX9 C;  5KFC A;  2AHO B;  4IS7 A;  7ICQ A;  4CF5 A;  2XVT A;  3H4D A;  4P2H A;  4RQ0 A;  4QWD A;  4WJ3 B;  3RJJ A;  4KLJ A;  5DG8 A;  3H0M B;  3CRX A;  2NRW A;  2AGP A;  5F9L A;  4HYK A;  4F8R A;  4Y2V A;  1WWV A;  5KFB A;  3NVY A;  4OJP A;  2UVW A;  1X9S A;  3MFI A;  4P4P A;  1BVS A;  4QWC A;  1L7P A;  2F3N A;  3PST A;  4FZM A;  3V6K A;  3JPS A;  5KFS A;  5D46 A;  4ACO A;  2EAP A;  1KDH A;  2H5X A;  3SAG A;  5DBA A;  1QH9 A;  4OD0 A;  5KFT A;  1RDF A;  3C29 A;  4DQR A;  8ICS A;  1DOQ A;  2GLE A;  3T5K A;  9ICV A;  1QSL A;  1L3S A;  5HR7 A;  1IV8 A;  2MUT B;  1TVA A;  1S76 D;  3BQ1 A;  4TUR A;  3OTQ A;  4F4Z A;  5J2A A;  1UCV A;  2LYB A;  2FMQ A;  1TAU A;  2KIV A;  1WCN A;  2F2A B;  3VCB A;  4OO1 J;  4QW8 A;  2P6R A;  1SZP A;  3OJU A;  4F4K A;  7ICH A;  4CCH A;  1ZQD A;  3OSP A;  1L7O A;  4FFD A;  5IIM A;  1S97 A;  4DF4 A;  3MR6 A;  1XSN A;  2JH1 A;  5ALX A;  4A8E A;  3GIL A;  4P0P B;  4R8U B;  4M9N A;  5GTI U;  2K8B B;  4K4G A;  4YXJ A;  2W9B A;  3LDA A;  5JUM A;  1KBU A;  2KZM A;  3NAS A;  4PPX A;  5KL1 B;  2DKX A;  5ALH A;  4RZR A;  3H40 A;  1UT8 A;  2IOF A;  4KLG A;  1ZRM A;  5CA7 A;  1Q8K A;  5J8Y C;  2IBK A;  3SAF A;  3BZC A;  5J2I A;  4C4T A;  4EX6 A;  1U49 A;  4RNN A;  4KN4 A;  2W3S A;  2HDO A;  4NLB A;  4US8 A;  5ALE A;  4DF8 A;  5AHX A;  5J2D A;  4B9M A;  4RQ2 A;  3RBD A;  1NK4 A;  3V6J A;  1XWL A;  4UBB A;  1OXJ A;  1UHU A;  4PZO A;  1DRG A;  2BCQ A;  4U6P A;  4I2G A;  3GII A;  5DDM A;  2C22 A;  5J2J A;  2OHF A;  3IV6 A;  1XO0 A;  4Y2X A;  1NJW A;  2ZIU B;  4J9Q A;  3AL0 B;  7ICM A;  1JRP A;  4F4Y A;  1X66 A;  2R8H A;  4RT3 A;  3FAH A;  5L1J A;  2WF5 A;  2YML A;  1NK9 A;  5AIA A;  2G5I B;  5AKZ A;  4GFJ A;  5AI9 A;  1WWU A;  2QKQ A;  8ICX A;  3PW4 A;  3MGI A;  4ECT A;  1L6N A;  9ICH A;  5DDY A;  3MGH A;  5KTQ A;  4JWM A;  2CPR A;  5KT2 A;  1ZET A;  4JWN A;  2VA8 A;  3OJS A;  5KFF A;  5J8Y A;  1PVR A;  8ICG A;  1N48 A;  5J0R A;  4QIW F;  3FYH A;  7ICG A;  3PR5 B;  3QE9 Y;  1RYR A;  1K1S A;  5KFA A;  1Z00 A;  4B9V A;  4IQV A;  4BWM A;  1L8O A;  2LPE A;  4KTQ A;  3HPO A;  2AGO A;  1S10 A;  1ZQN A;  1DK3 A;  2XID A;  5EWF A;  3M1Y A;  5DGA A;  1CRX A;  2ZIX A;  2DQN B;  2WB1 F;  1ZYQ A;  1YT3 A;  7ICS A;  1T8E A;  2KJ9 A;  4UB8 U;  1PK1 A;  2QB0 A;  5AK6 A;  5DB8 A;  2W8L A;  2OCE A;  4QZ8 A;  5KG6 A;  2HVH A;  4EEN A;  3PNC A;  3PW2 A;  1SV0 C;  5ALS A;  1JRO A;  5HML A;  3ICX A;  2PFP A;  3SQI A;  3PZP A;  1TKD A;  9ICW A;  2R8G A;  8ICC A;  5AKE A;  4YD2 A;  4UAZ A;  2YB4 A;  4Y2T A;  3N97 B;  2E5S A;  3SV3 A;  2V9W A;  2J6T A;  4QW9 A;  4O9M A;  4I2C A;  3J81 j;  2NRV A;  4EEL A;  1S5L U;  2BQ3 A;  2HOI A;  2YQE A;  2KFZ A;  1AQ6 A;  2IOF K;  3MFH A;  1FFV A;  2HVI A;  5AM0 A;  4QJF B;  4EX7 A;  4O5E A;  2FPM A;  1IG6 A;  1TV9 A;  1S9F A;  2WF9 A;  5F3X B;  9ICE A;  1IIP A;  3B9J A;  5J29 A;  2I9G A;  3PW7 A;  4O3S A;  3ED5 A;  4GLX A;  2ISP A;  3PSI A;  2CRX A;  2IA6 A;  2LYH A;  2WB1 C;  1TK0 A;  4Q8F A;  3QU7 A;  3T5J A;  3LWL A;  1RYU A;  1SV0 A;  4GXK A;  4NLN A;  1KFD A;  2HHX A;  3TFR A;  5KFR A;  1V38 A;  4B9N A;  3F2D A;  4NLK A;  1RPL A;  2EAO A;  3WK6 A;  3WU2 U;  4Q8E A;  2D6F C;  2K89 A;  2OYY A;  2IHM A;  5KFD A;  4P0Q B;  5E79 U;  5KFZ A;  3H8J A;  4IRC A;  4RQ7 A;  2KKP A;  2BQU A;  1S0V A;  2I5H A;  1MQ3 A;  3HX0 A;  2E8M A;  2Q4T A;  5AIC A;  3JPP A;  4PHA A;  3PY8 A;  2UVV A;  5ALJ A;  1Z1B A;  3HIL A;  4G9B A;  3N28 A;  1ZQG A;  3PW5 A;  3MBY A;  3QUQ A;  2RP5 A;  4OCZ A;  4F5P A;  2AGQ A;  1XNS A;  7ICR A;  2RQ5 A;  2HOF A;  1CUK A;  1X9M A;  5J2F A;  7ICK A;  1MC8 A;  1NK6 A;  4DL6 A;  3BQ7 A;  1LV5 A;  4NLZ A;  5BOL A;  3PR4 A;  1ZJN A;  4BDP A;  3LVW A;  3EZ5 A;  3TAR A;  3V6H A;  1N60 A;  3M8S A;  3ZDE A;  1U9L A;  2MRL A;  4Y2S A;  2J6U A;  3E58 A;  2MUT A;  4ED0 A;  3QEA Z;  2MU2 A;  1BGX T;  3ISD A;  2AH5 A;  5KG2 A;  2P66 A;  2AXT U;  2AJQ A;  4KLO A;  2KD1 A;  2NRX A;  2BCS A;  2W43 A;  3WKB A;  8ICO A;  3BS5 B;  8ICI A;  9ICU A;  2ZIV B;  4DL2 A;  3QUB A;  4I27 A;  4ELT A;  2FJ6 A;  9ICK A;  5ALO A;  8ICQ A;  4J9N A;  4KLM A;  1XC9 A;  4FO6 A;  1TAQ A;  3RH4 A;  4PZN A;  4YFK A;  4YN4 A;  4P0P A;  4R8U A;  3LWM A;  4ED2 A;  2MAX A;  5AI5 A;  2HMX A;  4PHE A;  3JPR A;  4OJO A;  3NVV A;  2XIC A;  1ZQC A;  3BDP A;  3HWT A;  4FS2 A;  2BQR A;  3RJF A;  3AQE A;  4YXM A;  2ES6 A;  3QYP A;  1BPD A;  1T94 A;  3N7P D;  4M0A A;  2YTU A;  5B66 U;  5JU5 A;  4K4H A;  3G6X A;  4K4I A;  2FI1 A;  2DWQ A;  3KZI U;  4PGY A;  1KN5 A;  3C2M A;  5DG7 A;  1ZD4 A;  2WHE A;  2ZIU A;  3TFS A;  1B43 A;  2WAQ F;  5ALU A;  3AN1 A;  3KKA C;  4FBU A;  2ZXH A;  2B6G A;  3NRW A;  3HJE A;  1K5O A;  3D2Q A;  4FZL A;  4CRX A;  4B6J A;  5AI4 A;  3RAX A;  3WK5 A;  1LKY B;  1NZP A;  1RM6 C;  2BKE A;  3C5G A;  1D8Y A;  5AI6 A;  5ALV A;  1SKW A;  2NO5 A;  2KP7 A;  3Q8P B;  1JMS A;  4ECU A;  3CYM A;  2VIX A;  2M9N A;  3D2S A;  5J0X A;  4XRH A;  9ICT A;  1OW5 A;  4B9U A;  4UQG A;  5J2B A;  4QWB A;  2XI9 A;  5G5H A;  2A1J B;  5AIB A;  8ICB A;  3F53 A;  3HT3 A;  1WYG A;  3LYS A;  2FLL A;  7ICV A;  2BR0 A;  1FO4 A;  4DLG A;  3KKA A;  8ICY A;  3RH6 A;  3KOO A;  1X9W A;  7ICN A;  4MHV A;  4EBE A;  4EZ9 A;  4LJX A;  3QUT A;  4Y2P A;  2KVC A;  4RPX A;  9ICS A;  4Q44 A;  4JUZ A;  3UMB A;  2WAQ C;  1SKS A;  1ZQR A;  3MAB A;  4ECZ A;  2HI0 A;  3K4G A;  2F1H A;  2G0A A;  5AM4 A;  3KFU F;  2RDI A;  2W9A A;  2DBY A;  3BJY A;  1ZQA A;  4F3O A;  1NOM A;  3EW9 A;  1MA7 A;  4F91 B;  3GDX A;  2FE9 A;  3H0L B;  3QX7 A;  4Z6D A;  1ZQI A;  4I2F A;  2W9M A;  3RR8 A;  1ZQX A;  4RQ3 A;  4GXI A;  1HJP A;  2G5H B;  2JGA A;  2V4Q A;  4C4S A;  9ICQ A;  4J9S A;  3TKA A;  4CF4 A;  2KHQ A;  1N5X A;  4QZB A;  7ICP A;  1Q3U A;  4F50 A;  5KFV A;  5EWG A;  9ICG A;  4NLC A;  2W7P A;  4IRK A;  4NL9 C;  3AU2 A;  1L5U A;  5CJ7 A;  2RDJ A;  1HUZ A;  3PV8 A;  5KT3 A;  5ALY A;  1N62 A;  4F2R A;  5KL8 B;  5IIN A;  2PMZ C;  7ICO A;  4QZF A;  4M9L A;  1NI3 A;  2ZTD A;  5KFH A;  2W8K A;  2KV2 A;  2DPI A;  4P0Q A;  1BPB A;  4JMU A;  3RJK A;  3RJE A;  5ALM A;  2EZX A;  3C5F A;  5ALZ A;  3PX0 A;  2V4R A;  2ZG6 A;  5ALN A;  3BS7 A;  3JPN A;  1ZQ1 C;  3GV7 B;  1YZ6 A;  4BGD A;  1T7P A;  4PL1 A;  2EAM A;  2FLN A;  1TFR A;  4I2H A;  2LBO A;  5FP0 A;  2CN1 A;  4RQM A;  4QZC A;  1RQL A;  5EE9 A;  3SD7 A;  1BPE A;  3ZD9 A;  4DOB A;  5EE1 A;  3WKE A;  2BHN A;  5J0Q A;  4NL9 A;  1D9F A;  2KSO B;  5ALF A;  1WUD A;  1QQ7 A;  4DL4 A;  5G5G A;  2ZIW B;  9ICX A;  1T3N A;  3MR3 A;  1URJ A;  2HBK A;  4B9T A;  1U4B A;  2FPK A;  8ICP A;  5TZV A;  1SGG A;  4KMU A;  1U47 A;  4DSL A;  3BS5 A;  2HCF A;  9ICJ A;  3WK7 A;  4OJ6 A;  3V7J A;  3RR7 A;  2ZIV A;  3HRD D;  1F5S A;  1X6J A;  2G07 A;  2QB1 A;  3ZDB A;  4RQ4 A;  4KX3 A;  2K4P A;  3PSP A;  5HHI A;  4YR0 A;  2KNJ A;  3ETL A;  5DG9 A;  3A0B U;  1U45 A;  1D8B A;  2LMR A;  5DBB A;  1CI4 A;  5IIL A;  4ZOH C;  8ICH A;  8ICM A;  3PSF A;  4J03 A;  1A77 A;  2DUY A;  4DQP A;  2HSZ A;  3TAN A;  2YB1 A;  4ELU A;  5KT7 A;  2WF8 A;  3M9M B;  1D9D A;  2VA2 A;  4ED7 A;  1ZD3 A;  4EBD A;  2BDU A;  5EOZ A;  3QUC A;  1ZQH A;  2FMP A;  1D8L A;  1ZRN A;  1GO3 F;  2DF4 B;  2EAN A;  5BPC A;  4RUA A;  2R18 A;  4ICA A;  3R9K A;  2KTQ A;  4MEY A;  2P6U A;  3M7D A;  3IRU A;  3EWA A;  4OJ5 A;  5EE3 A;  4YP3 A;  2W7O A;  5DKW A;  4DL3 A;  1SXD A;  2HHW A;  4B9S A;  5A0L A;  2XGQ A;  5TIS U;  4C8K A;  2BGW A;  4UAS A;  4KMO B;  4J9P A;  1L7M A;  4MFC A;  2OEH A;  2VJ4 A;  5KFO A;  3M6Z A;  3MR2 A;  1A6S A;  5ALT A;  9ICB A;  1B22 A;  2ZTE A;  3GIK A;  5KFW A;  4IQW A;  5AI8 A;  3F2B A;  4O0I A;  4OJL A;  1ZQL A;  4ECY A;  3TAQ A;  3UQ2 A;  3RRG A;  4UB3 A;  1V9P A;  1X40 A;  1UA0 A;  4F5N A;  1KEJ A;  1ZOL A;  5DQI A;  4TQS A;  2OWO A;  5KFX A;  2BZF A;  4DO9 A;  2JEI A;  4B9L A;  3AMZ A;  9ICR A;  2BPF A;  4PJ0 U;  2PFN A;  3K1R B;  3E0F A;  5AM3 A;  4QZ9 A;  4US9 A;  1XS9 D;  3RJG A;  3O0F A;  2YY6 A;  4IR9 A;  4QZH A;  1LKY A;  1L3T A;  2EZZ A;  3MDA A;  3KZX A;  1WG8 A;  2W54 A;  1RYS A;  2AQ4 A;  4RQ6 A;  2KG5 A;  5KG3 A;  8ICF A;  8ICU A;  4MF2 A;  5DBC A;  4DQQ A;  4DSK A;  5H2F U;  1L8L A;  1Z1V A;  4DLE A;  2A1J A;  3V72 A;  3ZD8 A;  4F92 B;  1C7Y A;  5AK5 A;  3K75 D;  4J9O A;  4F5Q A;  4JV0 A;  3GU3 A;  5DB7 A;  1KLN A;  5KFL A;  4O5C A;  1JAL A;  3L3F X;  2JEF A;  2ESE A;  4F93 B;  3BQ0 A;  5CEH A;  5KFM A;  2ZJ5 A;  4UW9 A;  1PVP A;  1M6Y A;  2KOB A;  1MQ2 A;  2ASD A;  5J0U A;  2EH9 A;  5EWE A;  3RAQ A;  1QQ6 A;  2DPJ A;  3AQF A;  4EEY A;  1KKX A;  2LYA A;  2KN7 A;  5AKI A;  5KAI U;  3H8M A;  4ED3 A;  4F2S A;  1X9X A;  4F72 A;  5J0W A;  3KHH A;  5JRT A;  3JPT A;  2ASJ A;  4ED1 A;  4CGZ A;  1N61 A;  2ODG A;  4CF3 A;  2ZTC A;  4YD1 A;  5HNK A;  4RQ8 A;  5AKL A;  2GH1 A;  1ZQZ A;  1JIH A;  1N5W A;  3QU5 A;  4DWI A;  4XQ8 A;  4TUQ A;  2QLT A;  2ASL A;  2G08 A;  2YMP A;  3T3F A;  1BPX A;  1ZQP A;  7ICE A;  2IOH A;  5L9X A;  5D49 A;  3AEV A;  4NWI A;  3L4P A;  4EZ6 A;  3JPO A;  3DDH A;  3UXP A;  3UQ0 A;  2BPG A;  2ZJ8 A;  2MSN A;  1Z4N A;  4QZG A;  4RNM A;  4UB2 A;  2RLT A;  4NXZ A;  1ZQU A;  2KE7 A;  1PVQ A;  1MSW D;  1BNP A;  5KG4 A;  4UAR A;  2F76 X;  2GO7 A;  4FS1 A;  4J9M A;  1SIJ A;  4KLI A;  4MEX A;  1ZD5 A;  4DSF A;  3CNH A;  3CP8 A;  4TUP A;  4KX5 A;  1KTQ A;  3IM1 A;  7ICF A;  4FBT A;  3IDW A;  4C4R A;  5ALQ A;  1NK8 A;  4P4M A;  3JPQ A;  1SXE A;  5K4L A;  5ALW A;  3Q8S B;  5AM1 A;  2I6X A;  2F8K A;  2VKQ A;  9ICA A;  4O3P A;  2N1R A;  2ZUD A;  4I29 A;  4IL6 U;  1ZQJ A;  4C8M A;  1DK2 A;  3F5A A;  4DSE A;  4NM1 A;  2R8I A;  3D2N A;  1J2M A;  4YG2 A;  3D6J A;  1J2N A;  2CXY A;  3G6V A;  3GFK B;  1S0O A;  2ZUB A;  4PHP A;  1QSS A;  4KLF A;  2KSO A;  2ISO A;  2ZIW A;  5L1I A;  4QZD A;  3RF9 A;  5J2E A;  3EPG A;  4ED6 A;  5KFJ A;  3ZDA A;  5KG5 A;  3L5K A;  1SL0 A;  1TAM A;  2YMM A;  3QU2 A;  3QXG A;  3SEN A;  4Y2R A;  5ALK A;  1N63 A;  4I2D A;  5HHH A;  4F71 A;  3OSN A;  1ZQT A;  2E1F A;  1DGS A;  3KHL A;  2WFA A;  3UM9 A;  4AP9 A;  5J0O A;  4J9K A;  3AUO A;  1DXS A;  3NVW A;  1V97 A;  3ZDC A;  3M9O B;  5J0Y A;  2JR5 A;  5KT4 A;  5KT5 A;  1N56 A;  2PFO A;  4DL7 A;  3OGU A;  1NKE A;  2ZXI A;  2F44 A;  4ELV A;  3NUQ A;  2RRD A;  3QEB Z;  2JZB B;  4DFP A;  4DFM A;  1Z4O A;  5GTH U;  3MDC A;  1KRP A;  4YMO A;  1SL2 A;  1XSP A;  4QNL A;  3ISB A;  2KK0 A;  3F5E A;  3RRH A;  1NNL A;  2KZ3 A;  2HHS A;  3SR6 A;  2IHN A;  1BNO A;  3NVZ A;  3WKC A;  4QZE A;  1A0P A;  4YMN A;  5F9N A;  9ICI A;  1RXV A;  5DB6 A;  2FMS A;  4M47 A;  1ZJM A;  1VJ5 A;  3WKD A;  3RB4 A;  3ORY A;  4Y2U A;  3C28 A;  1ZQV A;  2K60 A;  5JTI A;  1VDV A;  3N7S C;  5AI0 A;  2F1I A;  2YMQ A;  4Z6F A;  4JK1 A;  2HHU A;  5ALL A;  4RUC A;  2A3V A;  5ALR A;  4PGQ A;  2F77 X;  2FDR A;  4MF8 A;  3WK4 A;  3RFA A;  2C28 A;  1NJY A;  4PGX A;  1HUO A;  1O08 A;  1ZQE A;  1QQ5 A;  4M2Y A;  2ALZ A;  2NRZ A;  2L5Y A;  3GV8 B;  4DOC A;  2PMZ F;  3PX4 A;  1Z19 A;  4C80 A;  2R8K A;  1T4G A;  3UXO A;  4DSI A;  3B0X A;  2W55 A;  3IG5 A;  2ZUC A;  4I2I A;  1WCL A;  2BCR A;  1SB3 C;  1NJZ A;  2MA1 A;  2KJ8 A;  2W04 A;  1B0X A;  1UQV A;  2B0C A;  3FDS A;  4J9L A;  2C2R A;  1U48 A;  3HKZ F;  2NYV A;  1FFU A;  4RPZ A;  3PML A;  3F2C A;  2BCU A;  2D8C A;  4EYH B;  8ICJ A;  3WKA A;  3EUB 2;  5DGB A;  3N7R C;  3C1Z A;  1HEK A;  4PL2 A;  1RZT A;  4ECR A;  4ECQ A;  3C2K A;  4UB1 A;  5KG0 A;  5J2G A;  4CDG A;  1S0N A;  3PVX A;  4I2B A;  3SMV A;  4RU9 A;  3Q8Q B;  3PX6 A;  2D3D A;  1F44 A;  1H38 A;  5T14 A;  4NLG A;  2KEY A;  2H3Z A;  1SZH A;  4KLD A;  3BZK A;  2PKE A;  2Z7J A;  3NTU A;  5III A;  1TE2 A;  1KQQ A;  2XC9 A;  2XY7 A;  4U7C A;  7ICI A;  5ALG A;  5IIJ A;  3G6Y A;  5KFY A;  3I76 A;  2LM4 A;  1P7D A;  5L1M A;  5KNI A;  7ICL A;  3K1Z A;  4DS4 A;  3WK8 A;  4QWE A;  4UBC A;  4C8L A;  4YQW A;  4F4X A;  5HMM A;  1XSL A;  4UAW A;  8ICZ A;  3IHQ B;  5AM5 A;  3RB6 A;  3V7L A;  3UPQ A;  4UB5 A;  2E3T A;  4O3N A;  9ICC A;  3HKZ C;  4RQ5 A;  3ALR A;  9ICN A;  1JX4 A;  3TQ1 A;  3SYZ A;  3BQT A;  2XY5 A;  1Z3E B;  4DEZ A;  1DGJ A;  1F0M A;  4TUS A;  1UPH A;  3NGD A;  3ZDD A;  1LVH A;  3QZ7 A;  9ICL A;  2C2D A;  2HHT A;  3PO4 A;  4NJ8 A;  4MFF A;  2ZJA A;  3I28 A;  4BUG A;  1UA1 A;  1PUZ A;  3RJI A;  2E8O A;  5C5J A;  3OPX A;  3H4B A;  4BXO B;  2H3F A;  4BWJ A;  2OM6 A;  3IN5 A;  9ICP A;  4C8O A;  2PI5 A;  5KFG A;  5KFU A;  4TQR A;  4IRD A;  4KLU A;  1Q3V A;  5AKX A;  1X42 A;  8ICE A;  3HP6 A;  4Y2Q A;  1ZQW A;  2LM1 A;  5DB9 A;  1ECW A;  4KLS A;  2E1E A;  2EDU A;  1BPY A;  3NS1 A;  4Q43 A;  7ICU A;  4KLE A;  4IQT A;  5IIK A;  4Y2Y A;  5L1L A;  4F5O A;  2KZZ A;  1JXL A;  4ED8 A;  5J0T A;  3TAD C;  4KLH A;  4R65 A;  2GOL A;  3SEI A;  2PFQ A;  2KMD A;  2VA3 A;  4DS5 A;  2AU0 A;  3ONN A;  2OXO A;  1X2I A;  4DOA A;  3Q8K A;  2C2E A;  3SZ2 A;  2FLP A;  4EYI B;  2W3R A;  5DLG A;  5KAF U;  4CE6 A;  3T79 A;  2Y9U A;  3FC4 A;  4USA A;  1ZQF A;  1KSP A;  3Q8L A;  1KFS A;  2JZB A;  2W11 A;  2KVS A;  3B0Y A;  1ZQO A;  2OH2 A;  2QAR B;  4LZG A;  8ICT A;  3UXN A;  1MN8 A;  3NRZ A;  2BCV A;  4P4O A;  2LI6 A;  3EPI A;  5HP4 A;  2W9C B;  2GWS A;  4I2E A;  4QZI A;  2F8L A;  1LB2 B;  2E8N A;  5C0Y A;  9ICO A;  3TAC B;  3TI0 A;  9ICF A;  3T5L A;  3ETR A;  4NV0 A;  5KT6 A;  4LZD A;  2KKV A;  2K8C B;  4F5R A;  3T5H A;  3QU9 A;  3TAD A;  2XGP A;  3C1Y A;  5DLF A;  4M6W A;  9ICM A;  2JV3 A;  4UAU A;  2JH7 A;  2UVU A; 
#chains in the Genus database with same CATH homology
 3OJU A;  4F4K A;  7ICH A;  4DSJ A;  4CCH A;  1ARO P;  1ZQD A;  3OSP A;  4DSE A;  4NM1 A;  2R8I A;  4YG2 A;  1S0M A;  5IIM A;  3G6V A;  3LK9 A;  1S97 A;  4DF4 A;  8ICB A;  3GFK B;  3OHB A;  5KFP A;  1S0O A;  2Y1J A;  1EXN A;  3HT3 A;  2ZUB A;  4PHP A;  1QSS A;  3PMN A;  5J2C A;  2FLL A;  7ICV A;  4KIT B;  2BR0 A;  2ISO A;  4KLF A;  3QZ8 A;  5L1I A;  4DLG A;  4QZD A;  3MR6 A;  1XSN A;  8ICY A;  3RH6 A;  3GIL A;  1TK5 A;  4R8U B;  5J2E A;  4M9N A;  3EPG A;  1X9W A;  3GV5 B;  4ED6 A;  7ICN A;  4UB4 A;  3EYZ A;  5KFJ A;  4EBE A;  3ZDA A;  4YXJ A;  2W9B A;  3LDA A;  5JUM A;  4EZ9 A;  4K4G A;  5KG5 A;  2KZM A;  3GIJ A;  1SL0 A;  7ICT A;  4PPX A;  4RZR A;  4RPX A;  3H40 A;  8ICV A;  1UT8 A;  4Q44 A;  1NK0 A;  4JUZ A;  4KLG A;  9ICS A;  4M9J A;  1SKS A;  1IM4 A;  4DFJ A;  1ZQR A;  1XO1 A;  3MAB A;  4YMM A;  5CA7 A;  4I2D A;  4ECZ A;  5HHH A;  3HW8 A;  2IBK A;  3OSN A;  5J2I A;  4I28 A;  1ZQT A;  3K4G A;  2F1H A;  1DGS A;  2RDI A;  3KHL A;  2W9A A;  2XO7 A;  4RNN A;  4KN4 A;  5J0O A;  3BJY A;  1U49 A;  1ZQA A;  4J9K A;  2XCA A;  3AUO A;  3PW0 A;  4F3O A;  1NOM A;  3EW9 A;  1JXE A;  4F91 B;  5CWR A;  3GDX A;  4DF8 A;  1ZQY A;  3ZDC A;  5J2D A;  3MR5 A;  4Z6D A;  3M9O B;  5J0Y A;  4RQ2 A;  4B9M A;  4X5V A;  3RBD A;  5KT4 A;  3V6J A;  5KT5 A;  1NK4 A;  1N56 A;  1ZQI A;  1XWL A;  4I2F A;  4UBB A;  2PFO A;  4KN7 A;  4DL7 A;  3OGU A;  2BCQ A;  4I2G A;  2W9M A;  3GII A;  3RR8 A;  1ZQX A;  4RQ3 A;  5DDM A;  4GXI A;  2IMW P;  1HJP A;  1NKE A;  4MFA A;  2V4Q A;  2C22 A;  5J2J A;  9ICQ A;  4J9S A;  3RB3 A;  1NJW A;  4ELV A;  3AU6 A;  4QZB A;  4J9Q A;  4GC7 A;  7ICP A;  7ICM A;  4F50 A;  5KFV A;  4F4Y A;  3QEB Z;  2JZB B;  2R8H A;  5EWG A;  4DFP A;  4DFM A;  9ICG A;  4RT3 A;  3OHA A;  3MDC A;  1KRP A;  5L1J A;  4IRK A;  5J2K A;  2KFN A;  4IQU A;  1NK9 A;  3AU2 A;  4YMO A;  2WTF A;  2B21 A;  1SL2 A;  5CJ7 A;  2RDJ A;  1L5U A;  1XSP A;  1S77 D;  1HUZ A;  3ISB A;  3PV8 A;  3KHG A;  3RBE A;  5KT3 A;  4F2R A;  8ICX A;  5IIN A;  7ICO A;  4LVS A;  3PW4 A;  3MGI A;  3RRH A;  4QZF A;  2KZ3 A;  4M9L A;  2PI4 A;  4YCX A;  2ZTD A;  4ECT A;  5KFH A;  2HW3 A;  2HHS A;  8ICA A;  5KFN A;  3M8R A;  2W8K A;  2IHN A;  4RQ1 A;  1KFT A;  9ICH A;  5DDY A;  3MGH A;  5KTQ A;  5DQG A;  5J0S A;  8ICW A;  2DPI A;  4JWM A;  1QLN A;  4QZE A;  1BPB A;  5KT2 A;  1ZET A;  4YMN A;  5F9N A;  4JWN A;  4ZH4 A;  4G3I A;  2VA8 A;  3OJS A;  1RXV A;  5KFF A;  9ICI A;  4DFK A;  3RJK A;  8ICL A;  5DB6 A;  2FMS A;  3THV A;  1NJX A;  3RJE A;  1N48 A;  1ZJM A;  4M47 A;  8ICG A;  5J0R A;  3ISC A;  4M9H A;  3RB4 A;  1NKC A;  3FYH A;  7ICG A;  3PR5 B;  3ORY A;  3QE9 Y;  1RYR A;  1SKR A;  3C5F A;  1ZQV A;  1K1S A;  5KFA A;  1Z00 A;  4B9V A;  3PX0 A;  3H7I A;  2V4R A;  4IQV A;  3C2L A;  4BWM A;  3JPN A;  2F1I A;  4GC6 A;  4KTQ A;  4Z6F A;  4JK1 A;  3HPO A;  2HHU A;  4RNO A;  3GV7 B;  2AGO A;  4RUC A;  1S10 A;  1ZQN A;  3RJH A;  4E0D A;  4O5K A;  4PGQ A;  4ECS A;  5EWF A;  5DGA A;  4BGD A;  1T7P A;  1CEZ A;  5CHG A;  1A76 A;  4MF8 A;  1Y88 A;  1ZYQ A;  2J6S A;  2FLN A;  1TFR A;  4Q45 A;  7ICS A;  4I2H A;  1T8E A;  5KFK A;  1ZQB A;  2C28 A;  1NJY A;  4PGX A;  2XY6 A;  2R8J A;  1HUO A;  4JV2 A;  4QZC A;  4R63 A;  3GIM A;  5DB8 A;  4ECX A;  1BPE A;  1UT5 A;  3ZD9 A;  2W8L A;  4DOB A;  2NRZ A;  2ALZ A;  3H8S A;  1BPZ A;  1ZQE A;  4M2Y A;  4QZ8 A;  2ATL A;  5KG6 A;  3GV8 B;  4DOC A;  5CB1 A;  7ICJ A;  3PX4 A;  2BHN A;  2HVH A;  5J0Q A;  1NKB A;  3PNC A;  1D9F A;  3PW2 A;  4DL4 A;  1ZQS A;  1ZQK A;  3SV4 A;  2R8K A;  2F1J A;  5HML A;  4M04 A;  1T4G A;  9ICX A;  2PFP A;  3UXO A;  4DSI A;  4KLQ A;  3B0X A;  1T3N A;  2ZUC A;  3MR3 A;  4I2I A;  2W9B B;  1TKD A;  2R8G A;  9ICW A;  3SI8 A;  8ICC A;  1WCL A;  3RTV A;  4YD2 A;  4UAZ A;  2BCR A;  4B9T A;  1U4B A;  2FPK A;  1NJZ A;  5TZV A;  8ICP A;  3N97 B;  4KMU A;  1U47 A;  3SV3 A;  4DSL A;  3PO5 A;  2V9W A;  2HHV A;  2J6T A;  4QW9 A;  3FDS A;  4QZA A;  3Q8R B;  4O9M A;  4I2C A;  4YVZ A;  4J9L A;  9ICJ A;  2XCP A;  2NRV A;  4BXO A;  2C2R A;  1U48 A;  3V7J A;  3RR7 A;  4RPZ A;  3PML A;  2BQ3 A;  2KFZ A;  3ZDB A;  4RQ4 A;  3H8W A;  4XUS A;  4UAY A;  2BCU A;  5KG1 A;  5KG7 A;  3M9N B;  5HHI A;  4YR0 A;  4EYH B;  1ZQM A;  8ICJ A;  8ICN A;  5DGB A;  3ETL A;  5BOM A;  3MFH A;  3C1Z A;  4J9R A;  5DG9 A;  1U45 A;  2HVI A;  1RZT A;  5DBB A;  5IIL A;  4M9G A;  4ECR A;  8ICH A;  8ICM A;  4RPY A;  1A77 A;  4O5E A;  2FPM A;  4ECQ A;  3C2K A;  4UB1 A;  5KG0 A;  5J2G A;  4DQP A;  3TAN A;  1S9F A;  1TV9 A;  3GQC A;  1S0N A;  4ELU A;  4YR2 A;  5KT7 A;  3PVX A;  4I2B A;  4RU9 A;  9ICE A;  3M9M B;  1D9D A;  2VA2 A;  5J29 A;  1SL1 A;  4ED7 A;  3Q8Q B;  4EBD A;  3PX6 A;  2I9G A;  3PW7 A;  4O3S A;  5EOZ A;  1H38 A;  4GLX A;  1ZQH A;  2FMP A;  1D8L A;  2ISP A;  4NLG A;  5KFI A;  8ICK A;  5BPC A;  4KLD A;  4RUA A;  2IA6 A;  2LYH A;  1TK0 A;  4Q8F A;  3T5J A;  1NK5 A;  2KTQ A;  3LWL A;  3NTU A;  4MEY A;  2P6U A;  4PH5 A;  4F4W A;  3Q8M A;  5III A;  1QSY A;  4YR3 A;  4GXK A;  4NLN A;  3EWA A;  2XC9 A;  1KFD A;  2XY7 A;  4YP3 A;  2HHX A;  7ICI A;  5DKW A;  5IIJ A;  3G6Y A;  1RXW A;  4PHD A;  4NY8 A;  3TFR A;  5KFR A;  4DL3 A;  5KFY A;  2UVR A;  4B9N A;  4B9S A;  2HHW A;  5CP2 A;  4NLK A;  2HHQ A;  2XGQ A;  1RPL A;  4C8K A;  2BGW A;  4C8N A;  4Q8E A;  4J9P A;  1L3U A;  7ICL A;  2FPL A;  2IHM A;  5CR0 A;  4MFC A;  5KFD A;  4DS4 A;  3BQ2 A;  5KFO A;  4KLL A;  4RT2 A;  5KFZ A;  3H8J A;  4IRC A;  4RQ7 A;  1JN3 A;  4QWE A;  3MR2 A;  2BQU A;  4UBC A;  4C8L A;  1S0V A;  4ECW A;  1MQ3 A;  3HX0 A;  4O3R A;  9ICB A;  4YQW A;  1B22 A;  2ZTE A;  4GXJ A;  3GIK A;  5KFW A;  4F4X A;  4IQW A;  3JPP A;  2BDP A;  5HMM A;  4PHA A;  1XSL A;  3PY8 A;  4UAW A;  8ICZ A;  3IHQ B;  2UVV A;  4JV1 A;  1Z00 B;  4Z6E A;  4O0I A;  1ZQL A;  4ECY A;  3RB6 A;  3TAQ A;  3UQ2 A;  3V7L A;  4O3Q A;  1ZQG A;  4ECV A;  3RRG A;  4UB3 A;  1V9P A;  3MBY A;  3UPQ A;  3PW5 A;  1UA0 A;  5J2H A;  5L1K A;  1KEJ A;  4UB5 A;  4F5N A;  3RH5 A;  5J0P A;  4O3N A;  9ICC A;  4M6W B;  5DQI A;  4RQ5 A;  5KFE A;  4TQS A;  4F5P A;  2AGQ A;  2OWO A;  4I2A A;  5KFX A;  9ICN A;  7ICR A;  4DO9 A;  1JX4 A;  3TQ1 A;  3SYZ A;  4B9L A;  2JEI A;  2JEG A;  1CUK A;  1X9M A;  9ICR A;  1K1Q A;  5J2F A;  3BQT A;  1MC8 A;  2W9C A;  1NK6 A;  1ZQQ A;  4DL6 A;  2BPF A;  7ICK A;  2XY5 A;  1LV5 A;  2PFN A;  4NLZ A;  4QZ9 A;  1QTM A;  1Z3E B;  5BOL A;  1XS9 D;  3RJG A;  3PR4 A;  4DEZ A;  8ICR A;  1ZJN A;  4BDP A;  4TUS A;  3C23 A;  3EZ5 A;  4IR9 A;  5KFQ A;  3NGD A;  4QZH A;  3TAR A;  1XU4 A;  1L3T A;  3ZDD A;  3V6H A;  4EBC A;  3MDA A;  3QZ7 A;  2NRT A;  3M8S A;  3ZDE A;  2C2D A;  1L3V A;  2AQ0 A;  1U9L A;  4XA5 A;  2HHT A;  3PO4 A;  9ICL A;  2J6U A;  4Z6C A;  4R66 A;  1RYS A;  2AQ4 A;  4MFF A;  2MUT A;  2ZJA A;  4ED0 A;  4RQ6 A;  3QEA Z;  1BGX T;  4R64 A;  3ISD A;  5KG2 A;  5KG3 A;  1UA1 A;  2P66 A;  8ICF A;  8ICU A;  4IR1 A;  2AJQ A;  4MF2 A;  5DBC A;  1PZN A;  3RJI A;  4KLO A;  2NRX A;  2Y1I A;  4DQQ A;  4QWA A;  2BCS A;  5D4B A;  5C5J A;  4DSK A;  4I2J A;  8ICO A;  2PXI A;  1IXR A;  3H4B A;  4NM2 A;  4KLT A;  4DLE A;  8ICI A;  2A1J A;  4BXO B;  3V72 A;  3ZD8 A;  3KTQ A;  4F92 B;  4BWJ A;  9ICU A;  4DL2 A;  1C7Y A;  3K75 D;  4J9O A;  4F5Q A;  4JV0 A;  5DB7 A;  4I27 A;  4ELT A;  1KLN A;  9ICP A;  4C8O A;  5KFL A;  4O5C A;  2PI5 A;  2DFL A;  9ICK A;  8ICQ A;  4J9N A;  4KLM A;  5KFG A;  1XC9 A;  2JEF A;  4FO6 A;  5KFU A;  4F93 B;  2BPC A;  1TAQ A;  4TQR A;  3V7K A;  4DQS A;  3RH4 A;  3TAP A;  4IRD A;  3E2E A;  4KLU A;  3BQ0 A;  4YFK A;  4YN4 A;  5KFM A;  8ICE A;  2I1Q A;  2ZJ5 A;  3C21 A;  3HP6 A;  4R8U A;  3LWM A;  1MQ2 A;  1ZQW A;  4DL5 A;  2ASD A;  5J0U A;  5DB9 A;  4KLS A;  4ED2 A;  5EWE A;  3RAQ A;  2VAN A;  2MAX A;  3KHR A;  2Q0Z X;  3RB0 A;  2DPJ A;  1BPY A;  4PHE A;  4Q43 A;  1TK8 A;  4DQI A;  3JPR A;  4EEY A;  1NK7 A;  7ICU A;  4KLE A;  2KN7 A;  4IQT A;  5IIK A;  5DQH A;  5L1L A;  4F5O A;  1ZQC A;  2KZZ A;  3BDP A;  3HWT A;  4ED3 A;  5IIO A;  4FS2 A;  1JXL A;  4F2S A;  2BQR A;  3RJF A;  5J0W A;  4ED8 A;  2JEJ A;  4YXM A;  5J0T A;  3N4M B;  3KHH A;  1COO A;  3JPT A;  2ASJ A;  4ED1 A;  4O3O A;  4KLH A;  2ZTC A;  4R65 A;  4YD1 A;  5HNK A;  4RQ8 A;  1BPD A;  2PFQ A;  5KFC A;  1ZQZ A;  7ICQ A;  1JIH A;  3H4D A;  4DWI A;  4M0A A;  4XQ8 A;  4TUQ A;  2VA3 A;  4K4H A;  3G6X A;  4DS5 A;  2AU0 A;  2ASL A;  4P2H A;  4K4I A;  1X2I A;  4RQ0 A;  4DOA A;  3Q8K A;  2C2E A;  4QWD A;  4PGY A;  3SZ2 A;  2FLP A;  4EYI B;  3T3F A;  5DLG A;  3C2M A;  5DG7 A;  3RJJ A;  1BPX A;  5DG8 A;  1ZQP A;  4KLJ A;  7ICE A;  5L9X A;  2NRW A;  2AGP A;  5F9L A;  4HYK A;  5D49 A;  4F8R A;  4EZ6 A;  3JPO A;  3UXP A;  3UQ0 A;  2BPG A;  1ZQF A;  2ZJ8 A;  4QZG A;  1KSP A;  3Q8L A;  5KFB A;  1KFS A;  2JZB A;  3B0Y A;  4RNM A;  4UB2 A;  1ZQO A;  2UVW A;  1X9S A;  3TFS A;  4LZG A;  1B43 A;  3MFI A;  4P4P A;  1BVS A;  8ICT A;  4NXZ A;  1ZQU A;  4FBU A;  3UXN A;  4QWC A;  1MSW D;  5KG4 A;  2BCV A;  4P4O A;  3EPI A;  5HP4 A;  4FS1 A;  2W9C B;  4J9M A;  3V6K A;  2GWS A;  4I2E A;  4QZI A;  3JPS A;  5KFS A;  5D46 A;  4KLI A;  1KDH A;  1LB2 B;  4MEX A;  2H5X A;  4DSF A;  9ICO A;  3TI0 A;  9ICF A;  5DBA A;  3T5L A;  3RAX A;  4TUP A;  5KT6 A;  5KFT A;  1KTQ A;  3IM1 A;  4LZD A;  7ICF A;  2BKE A;  3C5G A;  1D8Y A;  4FBT A;  4DQR A;  8ICS A;  1DOQ A;  3T5K A;  9ICV A;  4F5R A;  1SKW A;  3T5H A;  1QSL A;  1L3S A;  3Q8P B;  1JMS A;  2XGP A;  2MUT B;  1NK8 A;  1TVA A;  4ECU A;  4P4M A;  1S76 D;  3BQ1 A;  3JPQ A;  3C1Y A;  3Q8S B;  2M9N A;  5DLF A;  4TUR A;  5J0X A;  4M6W A;  9ICM A;  4F4Z A;  4XRH A;  5J2A A;  9ICT A;  2FMQ A;  1TAU A;  9ICA A;  4B9U A;  4O3P A;  4UQG A;  5J2B A;  4QWB A;  2ZUD A;  1WCN A;  4I29 A;  2A1J B;  2UVU A;  4QW8 A;  1ZQJ A;  2P6R A;  1SZP A;  4C8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...