3BQTA

Crystal structure of a protein of unknown function from listeria monocytogenes, tetragonal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
NLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein of unknown function from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b f2365
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 25
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bqtA00
4P4MA 4IRDA 2BPCA 3ZD8A 3RJHA 2W9BA 3ZDCA 3RB0A 3K4GA 1Z00B 4QZAA 4XRHA 5J0YA 3BQ1A 2XCAA 1ZQEA 4EZ6A 3M8RA 4YCXA 2XGPA 5KFCA 2FMSA 8ICKA 1NJWA 3C5FA 2KZMA 1T4GA 5KFAA 4K4GA 3RH6A 1KTQA 4Z6CA 3GIIA 2Q0ZX 3AUOA 3PX6A 3QEAZ 1NK9A 4O3NA 4QW9A 3BQ2A 2J6SA 3PO4A 2HVIA 5J0UA 3RTVA 1XSPA 1ZQYA 1RPLA 3C2KA 1BPDA 1CUKA 1T3NA 2P6UA 3V7JA 5KFKA 2UVWA 1RZTA 4KLEA 4DO9A 4F4ZA 4YMOA 1QSLA 3H8JA 4ED8A 3JPOA 4F4KA 4IQTA 2BCUA 3HW8A 2W9MA 3OHBA 4PHDA 1TKDA 4F5OA 2HHXA 4RNNA 4KN7A 1JXLA 4JV2A 5KFZA 4YXJA 4UB1A 4DWIA 2PI4A 4EEYA 3H4DA 2JEIA 4PGXA 3KHRA 3BQ0A 2KFNA 3IM1A 5DB7A 5CJ7A 1IM4A 1BGXT 3BDPA 3PX0A 1X9MA 4KLUA 3RH4A 5J0SA 1KRPA 4GLXA 3UXPA 2P66A 3MFHA 4KLDA 1TAQA 1ZQXA 2AGPA 4RQ1A 5J2GA 1TK5A 2ZUDA 2NRXA 2ZJ8A 3GV7B 3EPGA 5DGAA 4F5QA 4DFMA 1ZQNA 3T5HA 4O3QA 4KMUA 3Q8MA 4J9RA 3V7LA 2HHUA 4YMMA 1HUZA 3SV3A 5KFLA 3HT3A 3N4MB 4KLTA 4RPZA 3B0YA 4DL2A 4NLKA 4TUPA 2LYHA 7ICEA 5KG1A 3Q8KA 2AQ4A 2PFNA 9ICVA 3T3FA 4IQUA 5F9NA 3B0XA 2F1IA 4UBCA 5IIMA 4BXOB 4DSIA 4FS1A 4UB4A 4GC6A 4M47A 4EBCA 4P2HA 4KLLA 3TANA 7ICPA 4QW8A 4DSKA 2BCQA 5DDYA 5IILA 5HMLA 1TVAA 2ZJAA 9ICMA 8ICJA 4F8RA 4YXMA 2AGQA 3RJGA 4M9JA 4R66A 3ISCA 2V9WA 3GV8B 5KFQA 3MBYA 2ASLA 4QZBA 4KLJA 2MUTB 2NRVA 2W9CB 2BQUA 1HJPA 2C2RA 3PV8A 5IIIA 4ECSA 4ZH4A 1MQ2A 1B22A 4DQRA 1BPBA 4JV0A 2VANA 1K1QA 5EOZA 4O3PA 4EBEA 1RYRA 2DPJA 1ZQWA 5KFIA 3LWLA 3UQ2A 4KLQA 2W8LA 8ICOA 9ICUA 3PMNA 4B9MA 8ICRA 8ICCA 2NRWA 2PI5A 4RT2A 5D49A 8ICEA 2ZTEA 5BOLA 1S0OA 9ICWA 4F5PA 1S0MA 1NOMA 3TFRA 7ICJA 4DF4A 1KFDA 2V4RA 3RB3A 4DSJA 5TZVA 4ECUA 3RRGA 4KLGA 8ICLA 5KT2A 7ICRA 4J9NA 1JX4A 4YFKA 3Q8PB 3T5KA 4GXJA 5HP4A 4DQIA 3M8SA 3RJKA 5J0OA 1ZQSA 2P6RA 3C5GA 1H38A 4YQWA 1C7YA 2MUTA 5KFEA 5BPCA 2W9CA 2VA2A 9ICOA 4M04A 3LDAA 3C2LA 3RJEA 1NJXA 5CB1A 2AU0A 4RQ4A 4TUQA 1NKBA 5KFBA 1V9PA 5J2AA 3ISDA 3TAPA 4F5NA 4ED1A 3GILA 1AROP 4TQSA 5KFOA 4DOAA 3T5JA 2R8JA 1XU4A 2BPGA 3GFKB 7ICMA 4BDPA 3SYZA 4DQQA 4RU9A 3GDXA 2MAXA 3JPPA 4UAYA 2UVUA 5J2FA 5J0WA 4M9GA 1NK0A 2XY6A 4UB2A 4RPYA 5KFXA 3MR3A 1U48A 4MFFA 4C8MA 4TURA 4NLNA 4TQRA 4J9SA 8ICHA 2F1JA 3JPQA 3RJIA 4DL3A 3H8SA 4DLEA 4DEZA 4ED0A 2IHMA 3OSNA 2BCSA 3EZ5A 4RUAA 4ECZA 1A77A 1XSLA 5DG9A 4R64A 1X9SA 4QZ9A 3JPNA 4YD1A 8ICXA 4F2SA 4NLZA 3H7IA 4KLSA 2HHSA 4I28A 5DLGA 3UQ0A 2FLNA 2VA8A 1Z3EB 8ICUA 3PVXA 3EPIA 2ZUBA 5DGBA 1JIHA 5EWEA 1TFRA 8ICTA 3MR6A 3KHGA 2HVHA 5J2CA 9ICSA 3SZ2A 1BPEA 3C2MA 1D9DA 5DBCA 8ICGA 4MF2A 1TK0A 3MDAA 3JPTA 4XQ8A 1ZQJA 5DG7A 1RXVA 1KEJA 1N48A 3JPSA 3H8WA 4UAWA 4C8LA 5DG8A 1D9FA 4I2DA 3RB6A 4DOCA 4F91B 3RB4A 1XWLA 5IIOA 2ALZA 8ICMA 3V6JA 5KT4A 2FMPA 1U9LA 2HW3A 1X2IA 2KZZA 1LB2B 5J2EA 5DBAA 4QZEA 4IQVA 1UT8A 3MR2A 3GIJA 3PX4A 3EYZA 3C21A 3M9MB 5L1JA 2I9GA 4KLOA 3Q8SB 2UVVA 4KLMA 7ICIA 1N56A 2Y1IA 4YMNA 4O5CA 2BCVA 3G6YA 2VA3A 1U47A 4I2AA 4I2IA 4YVZA 5L1LA 4B9TA 4QZDA 4BWMA 3MFIA 4YG2A 4DFPA 4X5VA 4DF8A 1SKRA 7ICFA 3MDCA 5IINA 3OHAA 5IIKA 2ISOA 4UBBA 3FYHA 1MQ3A 4O3RA 2IMWP 4F4YA 2XY7A 3C1ZA 3MABA 3PY8A 4Q8EA 4JK1A 4ED2A 4O5EA 4LZDA 5J0PA 7ICTA 9ICBA 9ICGA 1IXRA 2IA6A 9ICKA 4C8NA 3RBEA 5J0XA 1U49A 4MEXA 1S77D 2W9AA 1KDHA 7ICLA 5J0RA 4Q45A 3QEBZ 4I2JA 4KLHA 3ORYA 5DDMA 4MEYA 4RZRA 4MFAA 4DL6A 1RXWA 4I2GA 5J2BA 2HHTA 7ICHA 4UQGA 1UA1A 3HWTA 5CA7A 2C28A 1S0NA 1ZQPA 1TAUA 2F1HA 2PFQA 4DSEA 1SL1A 8ICAA 1JN3A 1COOA 1QTMA 1SKWA 1QSSA 4ELVA 3PW5A 5DB6A 5D46A 1ZJNA 4UB3A 4Q44A 3KTQA 4I2FA 4DLGA 1ZQTA 4O5KA 4QZGA 3QE9Y 3RJFA 1ZQHA 3MGHA 4NXZA 1JMSA 3GV5B 1U45A 4FO6A 9ICEA 4YN4A 1ZQAA 3IHQB 2FPKA 4PHAA 2W8KA 2FLPA 4QWEA 1U4BA 4ECXA 5F9LA 1SKSA 4F4WA 3SI8A 2BQRA 1KFSA 4ED7A 4M9LA 3OSPA 1NK5A 9ICAA 3RAQA 3RR7A 1SL2A 5C5JA 2BPFA 5IIJA 5HMMA 1ZYQA 4YR0A 4NY8A 1B43A 3BQTA 2KZ3A 4J9LA 4QZ8A 4P4PA 2BGWA 2PXIA 4RQ8A 2PFOA 3PW4A 3NGDA 4J9KA 2C2DA 1ZQGA 4ELTA 4R63A 2BQ3A 1X9WA 3THVA 1ZQMA 4IRKA 2PFPA 1EXNA 5EWFA 8ICYA 2ZJ5A 4PHEA 4F4XA 9ICRA 3E2EA 5HHHA 5EWGA 3C1YA 2FLLA 4YR2A 2ZTCA 3UXOA 3ETLA 4PHPA 3GIKA 3K75D 2BR0A 3ZDDA 9ICJA 4F50A 4DS5A 2NRZA 4JUZA 3PW2A 9ICQA 1K1SA 5KTQA 1BVSA 4YR3A 1D8YA 2OWOA 4RQ7A 5J0TA 4LVSA 4FBTA 3PR5B 1L3TA 1HUOA 4M6WA 3M9OB 5KFYA 4QWBA 4O9MA 4ED6A 4R8UA 1KLNA 1T7PA 2AJQA 8ICWA 4RNOA 2BKEA 4GC7A 5L1IA 4DS4A 4IRCA 4ECQA 4BXOA 4I29A 9ICFA 5J2DA 1A76A 4RPXA 4QZHA 3GIMA 1NK7A 2HHVA 5DLFA 3BJYA 4B9LA 1RYSA 1PZNA 5J2IA 4NM2A 3G6VA 9ICCA 1QSYA 9ICLA 4GXIA 4K4IA 3AU2A 2KTQA 3PW7A 2C22A 4RT3A 5KFHA 4JWNA 4DQPA 3PO5A 1S10A 1KSPA 3RJJA 4BWJA 1NJZA 4DL4A 4KTQA 4O3SA 4I2EA 1QLNA 4QWDA 8ICFA 5KT6A 9ICPA 4FS2A 5J2HA 2JEFA 2HHQA 1WCLA 7ICVA 4HYKA 2JEJA 1CEZA 2KN7A 4DQSA 1S0VA 4PGYA 2A1JA 3HX0A 5KFTA 2WTFA 3OJSA 2IHNA 5HHIA 2ASJA 2JZBA 1ZQIA 4QWCA 3RR8A 4I2BA 4YP3A 4MFCA 7ICKA 7ICUA 7ICOA 5J2KA 3ISBA 4F3OA 2JEGA 5L9XA 3N97B 2ZUCA 4DL7A 3PR4A 3RH5A 4EYIB 5KG4A 3TARA 2XO7A 4ELUA 3ZDBA 3G6XA 4RUCA 3LWMA 3TQ1A 4KLIA 5DQGA 5KFGA 1ZQKA 1ZQDA 4PH5A 4G3IA 4B9UA 1ZETA 3RRHA 8ICNA 4ECRA 3V7KA 2R8IA 5DB9A 5KFDA 4IQWA 7ICQA 4XA5A 4O0IA 1BPYA 4RNMA 1L3VA 1NKEA 4I2HA 4DSFA 1XS9D 3V6KA 1ZJMA 3V6HA 2XGQA 3RAXA 2Y1JA 4XUSA 1UA0A 4C8OA 4BGDA 8ICIA 5KFUA 5BOMA 1TK8A 1L5UA 4LZGA 3ZDAA 4J9MA 4M6WB 2V4QA 7ICNA 3C23A 1NK8A 5KFPA 4ECVA 1XSNA 1WCNA 2JZBB 2R8HA 1XC9A 3NTUA 4KN4A 5KG5A 4JWMA 4IR9A 1SL0A 9ICTA 2BDPA 4M0AA 1MC8A 5KG3A 4Z6DA 1S97A 9ICNA 4Z6EA 4Z6FA 4J9PA 2RDIA 4B9VA 5CR0A 5KFMA 4ED3A 3AU6A 3TAQA 2DPIA 2R8KA 4P4OA 7ICSA 3H40A 9ICXA 3QZ8A 1NK4A 4DOBA 4GXKA 5KFVA 4RQ0A 2FPLA 4CCHA 4EBDA 5KFWA 4ECYA 1NJYA 4KITB 4F2RA 1Y88A 3QZ7A 1BPZA 1ZQRA 5DBBA 5HNKA 1ZQZA 2B21A 3PMLA 4F93B 5KT5A 3HPOA 4ECWA 4KLFA 3JPRA 2KFZA 3UPQA 2FPMA 1ZQBA 1JXEA 4UB5A 4Q43A 3LK9A 8ICVA 2AQ0A 4QZFA 4Q8FA 3KHHA 7ICGA 1T8EA 9ICHA 1SZPA 1BPXA 5J29A 3Q8LA 2J6TA 2J6UA 1KFTA 3UXNA 1Z00A 3ZD9A 5KT3A 3TI0A 4RQ3A 3T5LA 3ZDEA 3PNCA 4E0DA 4UAZA 2UVRA 2C2EA 1ZQOA 5DB8A 2GWSA 1NKCA 3PW0A 5KFJA 4DFJA 4O3OA 5KT7A 4RQ2A 3M9NB 4K4HA 4QZIA 5DQIA 4R8UB 9ICIA 5KFSA 3FDSA 2NRTA 4R65A 8ICZA 1L3UA 3GQCA 2AGOA 2R8GA 5J2JA 5KFRA 5KFNA 4I2CA 1XO1A 2W9BB 3TFSA 8ICPA 1MSWD 5CHGA 4QWAA 4EZ9A 4I27A 5CP2A 2XC9A 3KHLA 3OJUA 4J9QA 5KG0A 3H4BA 3OGUA 3EW9A 3V72A 4PGQA 4M2YA 1ZQVA 2BHNA 2RDJA 5KG7A 4B9SA 2I1QA 5JUMA 4PPXA 3EWAA 8ICSA 2XY5A 8ICQA 5J0QA 1NK6A 2H5XA 4QZCA 1D8LA 4F92B 3HP6A 4F5RA 1ZQLA 1ZQQA 4B9NA 2HHWA 2DFLA 2XCPA 2IBKA 3Q8QB 4RQ6A 5DKWA 1DOQA 2ZTDA 5CWRA 4TUSA 1S9FA 1UT5A 1ZQUA 1DGSA 4DFKA 2FMQA 1LV5A 5L1KA 3SV4A 5D4BA 4RQ5A 1S76D 1TV9A 4MF8A 5KFFA 4IR1A 5DQHA 4C8KA 4DL5A 4JV1A 4J9OA 4EYHB 3RBDA 2A1JB 2ASDA 4FBUA 4DSLA 4M9NA 1ZQCA 4NM1A 2ISPA 4ECTA 3MR5A 3MGIA 4M9HA 4NLGA 2M9NA 5KG6A 1L3SA 2ATLA 4YD2A 8ICBA 1ZQFA 2BCRA 3Q8RB 5KG2A
chains in the Genus database with same CATH superfamily
4P4MA 4IRDA 2BPCA 2PKEA 3ZD8A 3RJHA 3TADA 1QCKA 4QZAA 4UARA 2XCAA 3AQFA 2XGPA 4GFJA 4NL9A 3PX6A 3PO4A 1YZ6A 1K5OA 3RTVA 1ZQYA 1BPDA 1T3NA 3V7JA 4P0PB 1RZTA 4US8A 2RLTA 5AKKA 3H8JA 4ED8A 3QU5A 3JPOA 3M1YA 4IQTA 2KHQA 2ZXHA 3HW8A 2W9MA 4FFDA 4PHDA 1B0XA 4DWIA 3MC1A 2PI4A 2VJ4A 3BQ0A 1BGXT 5J0SA 1KRPA 3UXPA 3CRXA 1TAQA 1ZQXA 1DXSA 1TK5A 2ZJ8A 4O3QA 4J9RA 2FJ6A 2H3QA 2HDOA 5B66U 2WFAA 2HHUA 4YMMA 4RPZA 2LYHA 3Q8KA 2AQ4A 3WK7A 4IQUA 5F9NA 4UBCA 2NYVA 2OEHA 4DSIA 4A8EA 4KLLA 4Y2UA 2G08A 2E8PA 2ZJAA 9ICMA 4F8RA 4Y2YA 4KLJA 4ECSA 1VDVA 2KJ8A 1MQ2A 1B22A 4JV0A 1SB3C 2VANA 1QQ7A 4CF5A 2VJ5A 3PMNA 5ALIA 4B9MA 8ICRA 8ICCA 1A0PA 1MA7A 2ZTEA 5BOLA 1S0OA 9ICWA 2F77X 2CPRA 4F5PA 1S0MA 4KLGA 5AK4A 3RRGA 8ICLA 5AM0A 4Y2PA 3M8SA 3RJKA 3C5GA 4YQWA 1C7YA 2MUTA 5KFEA 2W9CA 5AM2A 3C2LA 4C4RA 3RJEA 4Y2JA 1NJXA 2AU0A 2OH2A 5KFBA 1V9PA 4U7CA 3ISDA 1N5XA 3GILA 1S8OA 1AROP 4TQSA 7ICMA 4BDPA 4UAYA 2UVUA 4UB2A 5KFXA 3M7DA 4NJ8A 4WJ3B 4TURA 2ZG6A 4NLNA 2F1JA 1SIJA 3I76A 2F8KA 2K8BB 4ED0A 3EZ5A 1A77A 1JUDA 5DG9A 4QZ9A 5KL8B 3CNHA 3WK4A 1O08A 5EWEA 8ICTA 4UAVA 3MR6A 5J2CA 1BPEA 3C2MA 1ZOLA 3JPTA 1ZQJA 5DG7A 1Z1VA 3JPSA 3H8WA 3RB4A 5AM3A 2ALZA 2DGZA 1SWVA 5KAFU 4QIWC 1J2NA 1VLBA 5DBAA 3GIJA 3M9MB 5L1JA 3Q8SB 4KLMA 4EEKA 2Y1IA 1KBUA 2VA3A 2KSOA 2RHFA 1PUZA 3FM9A 2W43A 3AMZA 3MDCA 5AIAA 1Z4OA 2ISOA 2EQYA 3FYHA 3C1ZA 2JGAA 2WF5A 4O5EA 5G5GA 7ICTA 2Z7JA 2IA6A 9ICKA 2JR5A 7ICLA 3HJEA 4Y2RA 4Q45A 2WF9A 4KLHA 4RZRA 4NV0A 1IV8A 4I2GA 4UQGA 4G9BA 3HWTA 2JXJA 3BS5A 2F1HA 2PFQA 1SL1A 1JN3A 1QSSA 3UMCA 3PSIA 4O5KA 4QZGA 4FZLA 4NXZA 2CN1A 4F71A 1RDFA 4PHAA 4QWEA 2KP7A 5AHXA 1U4BA 4ECXA 2BQRA 1KFSA 5ALVA 3OSPA 9ICAA 1SL2A 3IV6A 5IIJA 4NY8A 1SGGA 1B43A 2KZ3A 2Y9UA 3IG8A 3PW4A 4ELTA 4R63A 1X9WA 1ZQMA 8ICYA 4PHEA 9ICRA 3E2EA 5HHHA 3I1YA 2E5SA 2ZTCA 2F8LA 3ZDDA 3D2QA 4DS5A 2NRZA 9ICQA 2KEYA 1K1SA 2RP5A 2OWOA 4RQ7A 2H3FA 5J0TA 4LVSA 2FE9A 1HUOA 4M6WA 4O9MA 4R8UA 1T7PA 4CF3A 9ICFA 5J2DA 4QZHA 3GIMA 5DLFA 3BJYA 4B9LA 9ICLA 4NM2A 9ICCA 4GXIA 4CNQA 1RG6A 2MRLA 2KTQA 1NZPA 3PO5A 1KSPA 1KKXA 4FS2A 1KN5A 4PJ0U 1SV0C 2ASJA 1ZQIA 3RR8A 3ONNA 2ZUCA 2KHVA 3RH5A 4EYIB 5KG4A 4ELUA 3ZDBA 4RUCA 3RF9A 5KFGA 1ZQKA 5ALGA 4G3IA 2KD1A 8ICNA 4ECRA 2AH5A 2R8IA 3IN5A 4RNMA 1L3VA 5ALNA 3QU9A 5AKGA 2XGQA 2Y1JA 1UA0A 1F0MA 5BOMA 1TK8A 3ZDAA 2YX8A 3F2DA 1NK8A 1XSNA 5ALRA 4PL1A 4Y2VA 3AEVA 4JWMA 4Z6DA 4ACOA 1S97A 4Z6FA 1N61A 5CR0A 2DPIA 7ICSA 4P4OA 4RQ0A 4EBDA 2HOFA 4ECYA 1NJYA 4KITB 1BPZA 1ZQRA 2LPEA 4IC9A 2AQ0A 3QXGA 4QZFA 1WYGA 1T8EA 1SZPA 1KFTA 2FDRA 4OJ5A 4E0DA 2C2EA 5DB8A 2GWSA 1N2XA 5AK5A 5KT7A 3M9NB 2W7PA 3AL0B 2RRDA 1YT3A 3PZPA 2AGOA 3L5KA 5J2JA 5KFRA 3F5AA 5KFNA 4I2CA 3TFSA 3RFAA 1CI4A 2QLTA 3N7SC 1VJ5A 5KG0A 3H4BA 1ZQVA 5A0LA 3EWAA 3NVVA 1PK1A 1D8LA 2XCPA 2IBKA 4RQ6A 5DKWA 1DOQA 4TUSA 2FMQA 1ZQUA 1DGSA 2NV3A 2ZIVA 3SV4A 1UCVA 1DRGA 4IR1A 5DQHA 4EYHB 5HR6A 3KD3A 2JHDA 5AI8A 5KG6A 2ATLA 3LVWA 5KG2A 1RM6C 4USAA 4EZ6A 1ZQEA 3OTQA 3M8RA 2PMZC 2W3SA 3QYPA 1L7MA 1T4GA 3RH6A 1X42A 1KTQA 2Q0ZX 3WK6A 4O3NA 2J6SA 5J0UA 1WWVA 1XSPA 2LI6A 3C2KA 1CUKA 2UVWA 3F2BA 4KLEA 2L5YA 4F4KA 1SWWA 4F5OA 4RNNA 4KN7A 1JXLA 4YXJA 4UB1A 2JEIA 2KFNA 3SR6A 3BDPA 1X9MA 3RH4A 2P66A 2W55A 3MFHA 2AGPA 2NRXA 3GV7B 4F5QA 1B4FA 4KMUA 1FEZA 2ZIWA 3BS7A 5AM4A 3V7LA 3QUBA 3HT3A 3N4MB 3B0YA 2XI9A 2PFNA 3T3FA 5IIMA 4BXOB 3B0XA 1OUQA 4M47A 4DSKA 4C0ZA 2AGQA 2V9WA 3H0RB 3GV8B 5KFQA 2BQUA 3PV8A 1FIQA 5EOZA 1SV0A 1K1QA 4O3PA 2K60A 3LWLA 2NRWA 1RYUA 5D49A 8ICEA 7ICJA 1KFDA 3RB3A 4ECUA 3UM9A 5KT2A 7ICRA 2KK0A 3T5KA 3ZI4A 2W03A 2P6RA 4C8LA 1ZQSA 1H38A 2KVSA 1DGJA 9ICOA 4M04A 3LDAA 2HSZA 4RQ4A 2K4IA 1J97A 1X6JA 5J2AA 3TAPA 4DOAA 3T5JA 5J8YC 5J2FA 4M9GA 1NK0A 2XY6A 4RPYA 4NL9C 4FE3A 2LMRA 8ICHA 3RJIA 4DL3A 1UPHA 5JU5A 5ALFA 3OSNA 2IOFK 1LKYB 2IOFA 1XSLA 5E79U 4F2SA 2EH9A 4I28A 4ICAA 3SAFA 3NRWA 3PSPA 2ZUBA 2HVHA 5EE9A 9ICSA 3SZ2A 2G0AA 1TK0A 3MDAA 1N48A 4UAWA 1D9FA 3RB6A 4DOCA 4PZOA 5IIOA 2OXOA 4KX5A 5CRXA 2FMPA 1V85A 2KZZA 3MR2A 2I9GA 4KLOA 1N56A 4YMNA 2HBKA 4I2AA 4I2IA 5L1LA 4B9TA 1SXDA 3U26A 4X5VA 4DF8A 3GU3A 4UBBA 4O3RA 4AP9A 2ODGA 2XY7A 3MABA 4JK1A 2HMXA 1JRPA 5J0PA 9ICBA 2LM1A 9ICGA 3ETRA 4F72A 4MEXA 3QEBZ 4I2JA 4MFAA 2HHTA 4DL6A 4OO1J 1ZQPA 4OJLA 1COOA 1SKWA 3QU4A 5D46A 4UB3A 3KTQA 1RQLA 1ZQHA 2WB1F 3FC4A 2G09A 9ICEA 4YN4A 1KQQA 1ZQAA 2FLPA 1WWUA 2D6FC 4F4WA 3SI8A 5HMMA 4YR0A 5EE1A 4QZ8A 1LKYA 2HCFA 5EE0A 3NASA 2G5IB 4J9KA 2CXYA 5AKIA 3THVA 2PFPA 5EWFA 2F76X 2XIDA 4F4XA 2YMQA 3C1YA 3R9KA 9ICJA 3F2CA 3PW2A 3QU7A 1A6SA 5KTQA 3BQ7A 4YR3A 4NLBA 2HBMA 3PSTA 1XNSA 1UQVA 3M9OB 4ED6A 8ICWA 4UATA 4GC7A 5L1IA 4I29A 2OYYA 1A76A 2YB1A 2Y9TA 5ALSA 5J2IA 1BNOA 3G6VA 4C7ZA 2KVCA 3HKZF 3QNMA 3PW7A 3TKAA 2MA1A 4DQPA 4OD0A 1S10A 1NJZA 3E58A 2BZFA 2R18A 5L1MA 2H3IA 2JEFA 2KJ5A 7ICVA 2JEJA 2KN7A 3WKAA 3HX0A 2I6XA 2KE7A 5ALZA 5H2FU 2E8NA 4MFCA 4I2BA 5J2KA 2JEGA 2KSOB 1ZRNA 2XO7A 2K8AA 5DQGA 4PH5A 1X6IA 3IG5A 3RRHA 2EAOA 5DB9A 3F53A 4XA5A 1NKEA 1XS9D 3V6HA 3RAXA 8ICIA 2D8CA 5KFUA 4BX9C 4EENA 2DF4B 1L5UA 4LZGA 4J9MA 4Y2SA 5F3XB 2O6KA 1WCNA 2R8HA 3MGVA 2F3NA 3NVWA 1NI3A 1SL0A 5KG3A 2ZIUB 3AU6A 4ED3A 3TAQA 2R8KA 3DEEA 2W54A 4DOBA 3NVZA 2FPLA 5ALEA 1Y88A 3QZ7A 1QQ5A 5DBBA 5HNKA 1ZQZA 2B21A 5KT5A 3QUCA 3UPQA 3CP8A 4UB5A 2IOHA 3PSFA 3N28A 3UMBA 2YMMA 2WF7A 3IP4B 3E0FA 3KHHA 1BPXA 3SAHA 5ALWA 3Q8LA 2QKQA 1BNPA 1X40A 3ZDEA 3PNCA 1SZHA 4JB3A 3BZKA 4EELA 4DFJA 4R8UB 3FDSA 3GQCA 3C28A 1XO1A 2W9BB 4RQMA 1L7OA 1MSWD 5CHGA 4BJQA 3KHLA 3OJUA 1L8OA 3EW9A 3CYMA 2BHNA 2LHTA 4PPXA 8ICSA 2XY5A 8ICQA 4QZCA 3HP6A 1ZQQA 4Y2XA 2HHWA 3SQIA 3Q8QB 2ZTDA 5CWRA 1S9FA 4DFKA 1LV5A 5L1KA 4CDGA 5D4BA 3BS5B 1Z4NA 2WAQC 1N60A 4JV1A 4J9OA 2ASDA 1Q3VA 4FBUA 1ZQCA 4NM1A 2ISPA 5ALXA 3MR5A 3MGIA 4M9HA 4NLGA 2M9NA 1L3SA 5AKYA 8ICBA 1ZQFA 2BCRA 3Q8RB 1XO0A 2ZIXB 4AYBC 3ZDCA 3K4GA 1Z00B 3S6JA 4XRHA 3BQ1A 4YCXA 2Y0SF 2FMSA 5J8YA 8ICKA 2KZMA 2GO7A 4K4GA 1SXEA 3GIIA 3QEAZ 2VIXA 3H0LB 3BQ2A 1RPLA 2WF6A 2P6UA 3QUQA 4F4ZA 4YMOA 1QSLA 2KMDA 3OHBA 5JRTA 1TKDA 4JV2A 2DWQA 4PGXA 3KHRA 1OW5A 3IM1A 3NS1A 5DB7A 1IM4A 3LVVA 4KLUA 3PX0A 2KV2A 4GLXA 4KLDA 3SD7A 4RQ1A 2ZUDA 5DGAA 2QARA 4DFMA 1ZQNA 2XICA 1HUZA 3SV3A 5ALHA 5KFLA 2KKVA 4NLKA 7ICEA 5AI6A 5AM1A 9ICVA 2F1IA 4PL2A 4US9A 4GC6A 4P2HA 5DDYA 3WKEA 8ICJA 4EX6A 4YXMA 4R66A 3ISCA 3T79A 5AM5A 2NRVA 1HJPA 1Z1BA 3BZCA 5ALTA 5ALJA 2H3ZA 3F5EA 1FFUA 5ALOA 4DQRA 4FZNA 2BDUA 2DPJA 1ZQWA 5ALYA 5KFIA 3UQ2A 4KLQA 2W8LA 4UW9A 8ICOA 2PI5A 2B6GA 4KMOB 1NOMA 2V4RA 4DSJA 1OXJA 3GZFA 4YFKA 3Q8PB 4GXJA 3NRZA 4DFDA 3D2NA 5J0OA 5BPCA 2VA2A 2LYBA 5K4LA 4RQNA 3B9JA 1NKBA 1HIWA 4F5NA 4ED1A 1ZD2P 4AYBF 4DQQA 4Y2TA 4RU9A 3GDXA 5J0WA 1FO4A 1U48A 4MFFA 4TQRA 4J9SA 1QH9A 5CEHA 2A1AA 3JPQA 2WHEA 3H8SA 4C80A 2IHMA 2N1RA 2BCSA 4DCCA 4RUAA 1LVHA 2ESEA 4R64A 1X9SA 4NLZA 3H7IA 4KLSA 2HBJA 3UQ0A 2FLNA 1Z3EB 3PVXA 3EPIA 5DGBA 3KHGA 4MF2A 4XQ8A 1RXVA 3EUB2 1QQ6A 3N7RC 3AN1A 4I2DA 4F91B 8ICMA 4IL6U 1X2IA 1LB2B 5J2EA 4QZEA 1UT8A 1URJA 2UVVA 1COKA 4O5CA 1KL9A 5ALQA 3G6YA 1U47A 2KOBA 2W11A 4YVZA 4QZDA 3MFIA 3QUTA 4YG2A 1SKRA 7ICFA 5IINA 3OHAA 1MQ3A 2IMWP 1PVRA 3PY8A 4LZDA 5FP0A 1IXRA 5JTIA 1U49A 3RBEA 1S77D 2W9AA 1KDHA 5AICA 1PK1B 3ORYA 4Y2QA 4MEYA 3IDWA 5DDMA 1RXWA 1PVPA 7ICHA 3KOOA 3WKBA 1TAUA 1QTMA 1PVQA 2ZIVB 3PW5A 2KNJA 4Q44A 4I2FA 4DLGA 4FZMA 1TE2A 3QE9Y 2EDUA 3RJFA 2K8CB 2DQNB 3MGHA 1L7NA 1JMSA 3GV5B 1U45A 4FO6A 3IHQB 2HI0A 5AKHA 2W8KA 3CW2C 5F9LA 5AKLA 4M9LA 3RAQA 5C5JA 2BPFA 1ZYQA 2B0CA 3BQTA 1ZD4A 4P4PA 2PXIA 5ALLA 2Q4TA 4RQ8A 1GO3F 3NGDA 2C2DA 3C29A 2BQ3A 1N5WA 1EXNA 4CGZA 2LKYA 5EWGA 2FLLA 4YR2A 3UXOA 2LBOA 1NZBA 3K75D 2BR0A 4FBTA 1L3TA 2E1FA 1ZD5A 4LJXA 5ALMA 4RNOA 2CRXA 4DS4A 4IRCA 4ECQA 4RPXA 2HHVA 1NK7A 3WK5A 3OPXA 1RYSA 5ALDA 1QSYA 4K4IA 2C22A 4RT3A 5KFHA 2JH1A 4JWNA 4DL4A 4O3SA 1QLNA 4QWDA 5KT6A 4UAUA 2YQEA 2KIWA 2HHQA 1WCLA 2WF8A 4HYKA 1CEZA 4DQSA 1S0VA 4PGYA 5KFTA 2WTFA 1O03A 2JZBA 4QWCA 7ICKA 1J2MA 3ISBA 5L9XA 3N97B 3TARA 3KKAA 3TQ1A 1ZD3A 4B9UA 2DL0A 1ZETA 1TAMA 3VCBA 4QIWF 5KFDA 4I2HA 4O0IA 1F44A 4C8OA 4XUSA 4BGDA 5AK3A 5B5EU 1T94A 5ALPA 7ICNA 3NVYA 3C23A 2QB1A 5KFPA 4ECVA 4P0PA 5AI0A 2GLEA 5KG5A 5TISU 1DK3A 9ICTA 4M0AA 3WK9A 1AQ6A 4PZNA 5GTIU 4J9PA 2RDIA 5KFMA 2VKQA 1M6YA 5KFVA 2AXTU 4CCHA 2JH7A 5KFWA 1JROA 1RQNA 5AKJA 2GOLA 4OCZA 4MHVA 3PMLA 3HPOA 4ECWA 2KFZA 1ZQBA 3SENA 3LK9A 8ICVA 7ICGA 2J6UA 3UXNA 4P0QA 4RQ3A 3HILA 4GIBA 4KX3A 3WKDA 1MN8A 1NKCA 3PW0A 5KFJA 2EANA 4K4HA 4QZIA 5KFSA 4R65A 2NRTA 8ICZA 1L6NA 4J03A 1ECWA 8ICPA 4QWAA 2ZIXA 5CP2A 1Q8KA 2XC9A 5KAIU 2RDJA 2HBLA 5JUMA 2K89A 2XVTA 2E8OA 5J0QA 1NK6A 2H5XA 3L4PA 4F92B 1ZQLA 1S5LU 3A0HU 2NO4A 3AQEA 1S76D 4MF8A 5KFFA 1N62A 4DL5A 3RBDA 4DSLA 4HAIA 2G06A 2QB0A 4ECTA 5HR7A 4NWIA 2EZXA 5AKZA 1NNLA 2F44A 1JALA 2W9BA 4JMUA 3RB0A 5J0YA 4P0QB 1X66A 2LYAA 5KFCA 1NJWA 3C5FA 2HOQA 3M6ZA 5KFAA 1X9XA 4Z6CA 3AUOA 2HVIA 2EAPA 1NK9A 4QW9A 2EAMA 1KW4A 2W04A 2E1EA 5KFKA 4DO9A 2BCUA 2HHXA 4BUGA 5KFZA 1CRXA 2JRZA 4EEYA 4UASA 3H4DA 1IG6A 5CJ7A 3H8MA 3ICXA 2DKXA 5J2GA 3D2SA 3EPGA 3T5HA 3WKCA 3Q8MA 5C0YA 2DUYA 1FFVA 4KLTA 4DL2A 4TUPA 5KG1A 2OM6A 3L3FX 4FS1A 4UB4A 2Y0SC 4EBCA 2DKZA 3TANA 7ICPA 4QW8A 2BCQA 5AKXA 5HMLA 5IILA 1TVAA 3SAGA 3RJGA 4M9JA 3MBYA 2ASLA 4QZBA 2MUTB 2W9CB 4NLCA 2YB4A 2C2RA 5IIIA 4ZH4A 1N63A 1BPBA 4EBEA 3I28A 1RYRA 9ICUA 3KKAC 4RT2A 4QJFB 5EE3A 3TFRA 1Q46A 4DF4A 5TZVA 2F2AB 3QX7A 4J9NA 1JX4A 2M0NA 3K1ZA 5HP4A 4DQIA 2HOIA 2OHFA 5AI9A 3VC8A 5CB1A 4QNLA 1C20A 4TUQA 5AIBA 5KFOA 2R8JA 1XU4A 2BPGA 3GFKB 3SYZA 2NO5A 5ALUA 2MAXA 3JPPA 1WUDA 2D3DA 3MR3A 4C8MA 3J81j 5T14A 5AI4A 2KKPA 4DLEA 4DEZA 2YMPA 4ECZA 2E8MA 1ZRMA 3JPNA 4YD1A 5G5HA 8ICXA 2HHSA 1IIPA 5DLGA 2FI1A 1ZXIA 2EZZA 2VA8A 4U6PA 8ICUA 1JIHA 1TFRA 5KNIA 4C4SA 1D9DA 5DBCA 8ICGA 2YN4A 1KEJA 2JMGA 5DG8A 5KL1B 1XWLA 3DV9A 3V6JA 4CF4A 5KT4A 1U9LA 2HW3A 4B6JA 4IQVA 2W7OA 3PX4A 3EYZA 3C21A 7ICIA 1D8BA 1JI7A 3N7PD 2BCVA 2G07A 4BWMA 4DFPA 3WU2U 5ALKA 2P35A 5IIKA 3KZIU 2YMLA 4F4YA 1PK3A 4Q8EA 4ED2A 1V97A 2ZIWB 4OJOA 4CRXA 2OCEA 4C8NA 5J0XA 5J0RA 2H3VA 1L8LA 5J2BA 1UA1A 5CA7A 2C28A 1S0NA 4CE6A 4DSEA 8ICAA 4ELVA 2K4EA 1ZJNA 5DB6A 2KIVA 1ZQTA 2GH1A 2W3RA 3ED5A 3KZXA 4UB6U 2FPKA 1HEKA 4C7YA 2KICA 1SKSA 1DK2A 4ED7A 1NK5A 3RR7A 1Z19A 3M6KA 2YY6A 4J9LA 3TACB 2BGWA 2PFOA 3ALRA 1ZQGA 4IRKA 3NUQA 2ZJ5A 3DDHA 3WK8A 3ETLA 4PHPA 3GIKA 4F50A 4JUZA 1YZ7A 1BVSA 1D8YA 3PR5B 2A19A 5KFYA 4QWBA 4ZOHC 1KLNA 2AJQA 2ZXIA 2ES6A 2BKEA 4BXOA 3UMGA 1Q3UA 1PZNA 2YTUA 3FAHA 3H0MB 3AU2A 3K1RB 3RJJA 4BWJA 4KTQA 1ED1A 4I2EA 8ICFA 2KJ9A 9ICPA 5J2HA 3HKZC 1T3QA 2A1JA 2IHNA 3OJSA 5HHIA 4EX7A 4YP3A 7ICUA 7ICOA 4F3OA 1F5SA 4DL7A 3PR4A 2JV3A 3G6XA 3LWMA 4KLIA 1ZQDA 1L7PA 3V7KA 2EZYA 4IQWA 3KFUF 7ICQA 2RQ5A 1BPYA 3TADC 4DSFA 3V6KA 1ZJMA 2MSNA 2K4PA 2I5HA 4M6WB 5AI5A 2V4QA 2JZBB 1XC9A 3NTUA 4KN4A 2AHOB 4IR9A 2BDPA 1MC8A 9ICNA 4Z6EA 1UHUA 3O0FA 4B9VA 4IS7A 3H40A 9ICXA 3QZ8A 1NK4A 4GXKA 3HRDD 2QARB 2LM4A 5AK6A 4C4TA 1SV4A 4F2RA 4F93B 4KLFA 3JPRA 2FPMA 2PMZF 1JXEA 4Q43A 4Q8FA 2QB0B 2WAQF 9ICHA 5J29A 2J6TA 3ZD9A 1Z00A 4OJ6A 5KT3A 3TI0A 3T5LA 1V38A 4UAZA 2UVRA 1ZQOA 2ZIUA 3A0BU 4O3OA 3QU2A 5GTHU 4RQ2A 5DQIA 9ICIA 1L3UA 3AM9A 4UB8U 2R8GA 4EZ9A 4OJPA 4I27A 3IRUA 3D6JA 4J9QA 2WB1C 3V72A 3OGUA 4M2YA 4PGQA 2KG5A 5KG7A 4B9SA 3SMVA 2I1QA 3LYSA 2E3TA 2G5HB 3SEIA 4F5RA 4B9NA 2DFLA 1P7DA 2A3VA 1ZQ1C 2K4HA 2DBYA 1UT5A 1WG8A 5AKEA 4RQ5A 1TV9A 4C8KA 2A1JB 4M9NA 2MU2A 4YD2A 4O3MA 3KBBA
chains in the Genus database with same CATH topology
4P4MA 4IRDA 2BPCA 3ZD8A 3RJHA 2W9BA 3ZDCA 3RB0A 3K4GA 1Z00B 4QZAA 4XRHA 5J0YA 3BQ1A 2XCAA 1ZQEA 4EZ6A 3M8RA 4YCXA 2XGPA 5KFCA 2FMSA 8ICKA 1NJWA 3C5FA 2KZMA 1T4GA 5KFAA 4K4GA 3RH6A 1KTQA 4Z6CA 3GIIA 2Q0ZX 3AUOA 3PX6A 3QEAZ 1NK9A 4O3NA 4QW9A 3BQ2A 2J6SA 3PO4A 2HVIA 5J0UA 3RTVA 1XSPA 1ZQYA 1RPLA 3C2KA 1BPDA 1CUKA 1T3NA 2P6UA 3V7JA 5KFKA 2UVWA 1RZTA 4KLEA 4DO9A 4F4ZA 4YMOA 1QSLA 3H8JA 4ED8A 3JPOA 4F4KA 4IQTA 2BCUA 3HW8A 2W9MA 3OHBA 4PHDA 1TKDA 4F5OA 2HHXA 4RNNA 4KN7A 1JXLA 4JV2A 5KFZA 4YXJA 4UB1A 4DWIA 2PI4A 4EEYA 3H4DA 2JEIA 4PGXA 3KHRA 3BQ0A 2KFNA 3IM1A 5DB7A 5CJ7A 1IM4A 1BGXT 3BDPA 3PX0A 1X9MA 4KLUA 3RH4A 5J0SA 1KRPA 4GLXA 3UXPA 2P66A 3MFHA 4KLDA 1TAQA 1ZQXA 2AGPA 4RQ1A 5J2GA 1TK5A 2ZUDA 2NRXA 2ZJ8A 3GV7B 3EPGA 5DGAA 4F5QA 4DFMA 1ZQNA 3T5HA 4O3QA 4KMUA 3Q8MA 4J9RA 3V7LA 2HHUA 4YMMA 1HUZA 3SV3A 5KFLA 3HT3A 3N4MB 4KLTA 4RPZA 3B0YA 4DL2A 4NLKA 4TUPA 2LYHA 7ICEA 5KG1A 3Q8KA 2AQ4A 2PFNA 9ICVA 3T3FA 4IQUA 5F9NA 3B0XA 2F1IA 4UBCA 5IIMA 4BXOB 4DSIA 4FS1A 4UB4A 4GC6A 4M47A 4EBCA 4P2HA 4KLLA 3TANA 7ICPA 4QW8A 4DSKA 2BCQA 5DDYA 5IILA 5HMLA 1TVAA 2ZJAA 9ICMA 8ICJA 4F8RA 4YXMA 2AGQA 3RJGA 4M9JA 4R66A 3ISCA 2V9WA 3GV8B 5KFQA 3MBYA 2ASLA 4QZBA 4KLJA 2MUTB 2NRVA 2W9CB 2BQUA 1HJPA 2C2RA 3PV8A 5IIIA 4ECSA 4ZH4A 1MQ2A 1B22A 4DQRA 1BPBA 4JV0A 2VANA 1K1QA 5EOZA 4O3PA 4EBEA 1RYRA 2DPJA 1ZQWA 5KFIA 3LWLA 3UQ2A 4KLQA 2W8LA 8ICOA 9ICUA 3PMNA 4B9MA 8ICRA 8ICCA 2NRWA 2PI5A 4RT2A 5D49A 8ICEA 2ZTEA 5BOLA 1S0OA 9ICWA 4F5PA 1S0MA 1NOMA 3TFRA 7ICJA 4DF4A 1KFDA 2V4RA 3RB3A 4DSJA 5TZVA 4ECUA 3RRGA 4KLGA 8ICLA 5KT2A 7ICRA 4J9NA 1JX4A 4YFKA 3Q8PB 3T5KA 4GXJA 5HP4A 4DQIA 3M8SA 3RJKA 5J0OA 1ZQSA 2P6RA 3C5GA 1H38A 4YQWA 1C7YA 2MUTA 5KFEA 5BPCA 2W9CA 2VA2A 9ICOA 4M04A 3LDAA 3C2LA 3RJEA 1NJXA 5CB1A 2AU0A 4RQ4A 4TUQA 1NKBA 5KFBA 1V9PA 5J2AA 3ISDA 3TAPA 4F5NA 4ED1A 3GILA 1AROP 4TQSA 5KFOA 4DOAA 3T5JA 2R8JA 1XU4A 2BPGA 3GFKB 7ICMA 4BDPA 3SYZA 4DQQA 4RU9A 3GDXA 2MAXA 3JPPA 4UAYA 2UVUA 5J2FA 5J0WA 4M9GA 1NK0A 2XY6A 4UB2A 4RPYA 5KFXA 3MR3A 1U48A 4MFFA 4C8MA 4TURA 4NLNA 4TQRA 4J9SA 8ICHA 2F1JA 3JPQA 3RJIA 4DL3A 3H8SA 4DLEA 4DEZA 4ED0A 2IHMA 3OSNA 2BCSA 3EZ5A 4RUAA 4ECZA 1A77A 1XSLA 5DG9A 4R64A 1X9SA 4QZ9A 3JPNA 4YD1A 8ICXA 4F2SA 4NLZA 3H7IA 4KLSA 2HHSA 4I28A 5DLGA 3UQ0A 2FLNA 2VA8A 1Z3EB 8ICUA 3PVXA 3EPIA 2ZUBA 5DGBA 1JIHA 5EWEA 1TFRA 8ICTA 3MR6A 3KHGA 2HVHA 5J2CA 9ICSA 3SZ2A 1BPEA 3C2MA 1D9DA 5DBCA 8ICGA 4MF2A 1TK0A 3MDAA 3JPTA 4XQ8A 1ZQJA 5DG7A 1RXVA 1KEJA 1N48A 3JPSA 3H8WA 4UAWA 4C8LA 5DG8A 1D9FA 4I2DA 3RB6A 4DOCA 4F91B 3RB4A 1XWLA 5IIOA 2ALZA 8ICMA 3V6JA 5KT4A 2FMPA 1U9LA 2HW3A 1X2IA 2KZZA 1LB2B 5J2EA 5DBAA 4QZEA 4IQVA 1UT8A 3MR2A 3GIJA 3PX4A 3EYZA 3C21A 3M9MB 5L1JA 2I9GA 4KLOA 3Q8SB 2UVVA 4KLMA 7ICIA 1N56A 2Y1IA 4YMNA 4O5CA 2BCVA 3G6YA 2VA3A 1U47A 4I2AA 4I2IA 4YVZA 5L1LA 4B9TA 4QZDA 4BWMA 3MFIA 4YG2A 4DFPA 4X5VA 4DF8A 1SKRA 7ICFA 3MDCA 5IINA 3OHAA 5IIKA 2ISOA 4UBBA 3FYHA 1MQ3A 4O3RA 2IMWP 4F4YA 2XY7A 3C1ZA 3MABA 3PY8A 4Q8EA 4JK1A 4ED2A 4O5EA 4LZDA 5J0PA 7ICTA 9ICBA 9ICGA 1IXRA 2IA6A 9ICKA 4C8NA 3RBEA 5J0XA 1U49A 4MEXA 1S77D 2W9AA 1KDHA 7ICLA 5J0RA 4Q45A 3QEBZ 4I2JA 4KLHA 3ORYA 5DDMA 4MEYA 4RZRA 4MFAA 4DL6A 1RXWA 4I2GA 5J2BA 2HHTA 7ICHA 4UQGA 1UA1A 3HWTA 5CA7A 2C28A 1S0NA 1ZQPA 1TAUA 2F1HA 2PFQA 4DSEA 1SL1A 8ICAA 1JN3A 1COOA 1QTMA 1SKWA 1QSSA 4ELVA 3PW5A 5DB6A 5D46A 1ZJNA 4UB3A 4Q44A 3KTQA 4I2FA 4DLGA 1ZQTA 4O5KA 4QZGA 3QE9Y 3RJFA 1ZQHA 3MGHA 4NXZA 1JMSA 3GV5B 1U45A 4FO6A 9ICEA 4YN4A 1ZQAA 3IHQB 2FPKA 4PHAA 2W8KA 2FLPA 4QWEA 1U4BA 4ECXA 5F9LA 1SKSA 4F4WA 3SI8A 2BQRA 1KFSA 4ED7A 4M9LA 3OSPA 1NK5A 9ICAA 3RAQA 3RR7A 1SL2A 5C5JA 2BPFA 5IIJA 5HMMA 1ZYQA 4YR0A 4NY8A 1B43A 3BQTA 2KZ3A 4J9LA 4QZ8A 4P4PA 2BGWA 2PXIA 4RQ8A 2PFOA 3PW4A 3NGDA 4J9KA 2C2DA 1ZQGA 4ELTA 4R63A 2BQ3A 1X9WA 3THVA 1ZQMA 4IRKA 2PFPA 1EXNA 5EWFA 8ICYA 2ZJ5A 4PHEA 4F4XA 9ICRA 3E2EA 5HHHA 5EWGA 3C1YA 2FLLA 4YR2A 2ZTCA 3UXOA 3ETLA 4PHPA 3GIKA 3K75D 2BR0A 3ZDDA 9ICJA 4F50A 4DS5A 2NRZA 4JUZA 3PW2A 9ICQA 1K1SA 5KTQA 1BVSA 4YR3A 1D8YA 2OWOA 4RQ7A 5J0TA 4LVSA 4FBTA 3PR5B 1L3TA 1HUOA 4M6WA 3M9OB 5KFYA 4QWBA 4O9MA 4ED6A 4R8UA 1KLNA 1T7PA 2AJQA 8ICWA 4RNOA 2BKEA 4GC7A 5L1IA 4DS4A 4IRCA 4ECQA 4BXOA 4I29A 9ICFA 5J2DA 1A76A 4RPXA 4QZHA 3GIMA 1NK7A 2HHVA 5DLFA 3BJYA 4B9LA 1RYSA 1PZNA 5J2IA 4NM2A 3G6VA 9ICCA 1QSYA 9ICLA 4GXIA 4K4IA 3AU2A 2KTQA 3PW7A 2C22A 4RT3A 5KFHA 4JWNA 4DQPA 3PO5A 1S10A 1KSPA 3RJJA 4BWJA 1NJZA 4DL4A 4KTQA 4O3SA 4I2EA 1QLNA 4QWDA 8ICFA 5KT6A 9ICPA 4FS2A 5J2HA 2JEFA 2HHQA 1WCLA 7ICVA 4HYKA 2JEJA 1CEZA 2KN7A 4DQSA 1S0VA 4PGYA 2A1JA 3HX0A 5KFTA 2WTFA 3OJSA 2IHNA 5HHIA 2ASJA 2JZBA 1ZQIA 4QWCA 3RR8A 4I2BA 4YP3A 4MFCA 7ICKA 7ICUA 7ICOA 5J2KA 3ISBA 4F3OA 2JEGA 5L9XA 3N97B 2ZUCA 4DL7A 3PR4A 3RH5A 4EYIB 5KG4A 3TARA 2XO7A 4ELUA 3ZDBA 3G6XA 4RUCA 3LWMA 3TQ1A 4KLIA 5DQGA 5KFGA 1ZQKA 1ZQDA 4PH5A 4G3IA 4B9UA 1ZETA 3RRHA 8ICNA 4ECRA 3V7KA 2R8IA 5DB9A 5KFDA 4IQWA 7ICQA 4XA5A 4O0IA 1BPYA 4RNMA 1L3VA 1NKEA 4I2HA 4DSFA 1XS9D 3V6KA 1ZJMA 3V6HA 2XGQA 3RAXA 2Y1JA 4XUSA 1UA0A 4C8OA 4BGDA 8ICIA 5KFUA 5BOMA 1TK8A 1L5UA 4LZGA 3ZDAA 4J9MA 4M6WB 2V4QA 7ICNA 3C23A 1NK8A 5KFPA 4ECVA 1XSNA 1WCNA 2JZBB 2R8HA 1XC9A 3NTUA 4KN4A 5KG5A 4JWMA 4IR9A 1SL0A 9ICTA 2BDPA 4M0AA 1MC8A 5KG3A 4Z6DA 1S97A 9ICNA 4Z6EA 4Z6FA 4J9PA 2RDIA 4B9VA 5CR0A 5KFMA 4ED3A 3AU6A 3TAQA 2DPIA 2R8KA 4P4OA 7ICSA 3H40A 9ICXA 3QZ8A 1NK4A 4DOBA 4GXKA 5KFVA 4RQ0A 2FPLA 4CCHA 4EBDA 5KFWA 4ECYA 1NJYA 4KITB 4F2RA 1Y88A 3QZ7A 1BPZA 1ZQRA 5DBBA 5HNKA 1ZQZA 2B21A 3PMLA 4F93B 5KT5A 3HPOA 4ECWA 4KLFA 3JPRA 2KFZA 3UPQA 2FPMA 1ZQBA 1JXEA 4UB5A 4Q43A 3LK9A 8ICVA 2AQ0A 4QZFA 4Q8FA 3KHHA 7ICGA 1T8EA 9ICHA 1SZPA 1BPXA 5J29A 3Q8LA 2J6TA 2J6UA 1KFTA 3UXNA 1Z00A 3ZD9A 5KT3A 3TI0A 4RQ3A 3T5LA 3ZDEA 3PNCA 4E0DA 4UAZA 2UVRA 2C2EA 1ZQOA 5DB8A 2GWSA 1NKCA 3PW0A 5KFJA 4DFJA 4O3OA 5KT7A 4RQ2A 3M9NB 4K4HA 4QZIA 5DQIA 4R8UB 9ICIA 5KFSA 3FDSA 2NRTA 4R65A 8ICZA 1L3UA 3GQCA 2AGOA 2R8GA 5J2JA 5KFRA 5KFNA 4I2CA 1XO1A 2W9BB 3TFSA 8ICPA 1MSWD 5CHGA 4QWAA 4EZ9A 4I27A 5CP2A 2XC9A 3KHLA 3OJUA 4J9QA 5KG0A 3H4BA 3OGUA 3EW9A 3V72A 4PGQA 4M2YA 1ZQVA 2BHNA 2RDJA 5KG7A 4B9SA 2I1QA 5JUMA 4PPXA 3EWAA 8ICSA 2XY5A 8ICQA 5J0QA 1NK6A 2H5XA 4QZCA 1D8LA 4F92B 3HP6A 4F5RA 1ZQLA 1ZQQA 4B9NA 2HHWA 2DFLA 2XCPA 2IBKA 3Q8QB 4RQ6A 5DKWA 1DOQA 2ZTDA 5CWRA 4TUSA 1S9FA 1UT5A 1ZQUA 1DGSA 4DFKA 2FMQA 1LV5A 5L1KA 3SV4A 5D4BA 4RQ5A 1S76D 1TV9A 4MF8A 5KFFA 4IR1A 5DQHA 4C8KA 4DL5A 4JV1A 4J9OA 4EYHB 3RBDA 2A1JB 2ASDA 4FBUA 4DSLA 4M9NA 1ZQCA 4NM1A 2ISPA 4ECTA 3MR5A 3MGIA 4M9HA 4NLGA 2M9NA 5KG6A 1L3SA 2ATLA 4YD2A 8ICBA 1ZQFA 2BCRA 3Q8RB 5KG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4M A;  4IRD A;  2BPC A;  3ZD8 A;  3RJH A;  2W9B A;  3ZDC A;  3RB0 A;  3K4G A;  1Z00 B;  4QZA A;  4XRH A;  5J0Y A;  3BQ1 A;  2XCA A;  1ZQE A;  4EZ6 A;  3M8R A;  4YCX A;  2XGP A;  5KFC A;  2FMS A;  8ICK A;  1NJW A;  3C5F A;  2KZM A;  1T4G A;  5KFA A;  4K4G A;  3RH6 A;  1KTQ A;  4Z6C A;  3GII A;  2Q0Z X;  3AUO A;  3PX6 A;  3QEA Z;  1NK9 A;  4O3N A;  4QW9 A;  3BQ2 A;  2J6S A;  3PO4 A;  2HVI A;  5J0U A;  3RTV A;  1XSP A;  1ZQY A;  1RPL A;  3C2K A;  1BPD A;  1CUK A;  1T3N A;  2P6U A;  3V7J A;  5KFK A;  2UVW A;  1RZT A;  4KLE A;  4DO9 A;  4F4Z A;  4YMO A;  1QSL A;  3H8J A;  4ED8 A;  3JPO A;  4F4K A;  4IQT A;  2BCU A;  3HW8 A;  2W9M A;  3OHB A;  4PHD A;  1TKD A;  4F5O A;  2HHX A;  4RNN A;  4KN7 A;  1JXL A;  4JV2 A;  5KFZ A;  4YXJ A;  4UB1 A;  4DWI A;  2PI4 A;  4EEY A;  3H4D A;  2JEI A;  4PGX A;  3KHR A;  3BQ0 A;  2KFN A;  3IM1 A;  5DB7 A;  5CJ7 A;  1IM4 A;  1BGX T;  3BDP A;  3PX0 A;  1X9M A;  4KLU A;  3RH4 A;  5J0S A;  1KRP A;  4GLX A;  3UXP A;  2P66 A;  3MFH A;  4KLD A;  1TAQ A;  1ZQX A;  2AGP A;  4RQ1 A;  5J2G A;  1TK5 A;  2ZUD A;  2NRX A;  2ZJ8 A;  3GV7 B;  3EPG A;  5DGA A;  4F5Q A;  4DFM A;  1ZQN A;  3T5H A;  4O3Q A;  4KMU A;  3Q8M A;  4J9R A;  3V7L A;  2HHU A;  4YMM A;  1HUZ A;  3SV3 A;  5KFL A;  3HT3 A;  3N4M B;  4KLT A;  4RPZ A;  3B0Y A;  4DL2 A;  4NLK A;  4TUP A;  2LYH A;  7ICE A;  5KG1 A;  3Q8K A;  2AQ4 A;  2PFN A;  9ICV A;  3T3F A;  4IQU A;  5F9N A;  3B0X A;  2F1I A;  4UBC A;  5IIM A;  4BXO B;  4DSI A;  4FS1 A;  4UB4 A;  4GC6 A;  4M47 A;  4EBC A;  4P2H A;  4KLL A;  3TAN A;  7ICP A;  4QW8 A;  4DSK A;  2BCQ A;  5DDY A;  5IIL A;  5HML A;  1TVA A;  2ZJA A;  9ICM A;  8ICJ A;  4F8R A;  4YXM A;  2AGQ A;  3RJG A;  4M9J A;  4R66 A;  3ISC A;  2V9W A;  3GV8 B;  5KFQ A;  3MBY A;  2ASL A;  4QZB A;  4KLJ A;  2MUT B;  2NRV A;  2W9C B;  2BQU A;  1HJP A;  2C2R A;  3PV8 A;  5III A;  4ECS A;  4ZH4 A;  1MQ2 A;  1B22 A;  4DQR A;  1BPB A;  4JV0 A;  2VAN A;  1K1Q A;  5EOZ A;  4O3P A;  4EBE A;  1RYR A;  2DPJ A;  1ZQW A;  5KFI A;  3LWL A;  3UQ2 A;  4KLQ A;  2W8L A;  8ICO A;  9ICU A;  3PMN A;  4B9M A;  8ICR A;  8ICC A;  2NRW A;  2PI5 A;  4RT2 A;  5D49 A;  8ICE A;  2ZTE A;  5BOL A;  1S0O A;  9ICW A;  4F5P A;  1S0M A;  1NOM A;  3TFR A;  7ICJ A;  4DF4 A;  1KFD A;  2V4R A;  3RB3 A;  4DSJ A;  5TZV A;  4ECU A;  3RRG A;  4KLG A;  8ICL A;  5KT2 A;  7ICR A;  4J9N A;  1JX4 A;  4YFK A;  3Q8P B;  3T5K A;  4GXJ A;  5HP4 A;  4DQI A;  3M8S A;  3RJK A;  5J0O A;  1ZQS A;  2P6R A;  3C5G A;  1H38 A;  4YQW A;  1C7Y A;  2MUT A;  5KFE A;  5BPC A;  2W9C A;  2VA2 A;  9ICO A;  4M04 A;  3LDA A;  3C2L A;  3RJE A;  1NJX A;  5CB1 A;  2AU0 A;  4RQ4 A;  4TUQ A;  1NKB A;  5KFB A;  1V9P A;  5J2A A;  3ISD A;  3TAP A;  4F5N A;  4ED1 A;  3GIL A;  1ARO P;  4TQS A;  5KFO A;  4DOA A;  3T5J A;  2R8J A;  1XU4 A;  2BPG A;  3GFK B;  7ICM A;  4BDP A;  3SYZ A;  4DQQ A;  4RU9 A;  3GDX A;  2MAX A;  3JPP A;  4UAY A;  2UVU A;  5J2F A;  5J0W A;  4M9G A;  1NK0 A;  2XY6 A;  4UB2 A;  4RPY A;  5KFX A;  3MR3 A;  1U48 A;  4MFF A;  4C8M A;  4TUR A;  4NLN A;  4TQR A;  4J9S A;  8ICH A;  2F1J A;  3JPQ A;  3RJI A;  4DL3 A;  3H8S A;  4DLE A;  4DEZ A;  4ED0 A;  2IHM A;  3OSN A;  2BCS A;  3EZ5 A;  4RUA A;  4ECZ A;  1A77 A;  1XSL A;  5DG9 A;  4R64 A;  1X9S A;  4QZ9 A;  3JPN A;  4YD1 A;  8ICX A;  4F2S A;  4NLZ A;  3H7I A;  4KLS A;  2HHS A;  4I28 A;  5DLG A;  3UQ0 A;  2FLN A;  2VA8 A;  1Z3E B;  8ICU A;  3PVX A;  3EPI A;  2ZUB A;  5DGB A;  1JIH A;  5EWE A;  1TFR A;  8ICT A;  3MR6 A;  3KHG A;  2HVH A;  5J2C A;  9ICS A;  3SZ2 A;  1BPE A;  3C2M A;  1D9D A;  5DBC A;  8ICG A;  4MF2 A;  1TK0 A;  3MDA A;  3JPT A;  4XQ8 A;  1ZQJ A;  5DG7 A;  1RXV A;  1KEJ A;  1N48 A;  3JPS A;  3H8W A;  4UAW A;  4C8L A;  5DG8 A;  1D9F A;  4I2D A;  3RB6 A;  4DOC A;  4F91 B;  3RB4 A;  1XWL A;  5IIO A;  2ALZ A;  8ICM A;  3V6J A;  5KT4 A;  2FMP A;  1U9L A;  2HW3 A;  1X2I A;  2KZZ A;  1LB2 B;  5J2E A;  5DBA A;  4QZE A;  4IQV A;  1UT8 A;  3MR2 A;  3GIJ A;  3PX4 A;  3EYZ A;  3C21 A;  3M9M B;  5L1J A;  2I9G A;  4KLO A;  3Q8S B;  2UVV A;  4KLM A;  7ICI A;  1N56 A;  2Y1I A;  4YMN A;  4O5C A;  2BCV A;  3G6Y A;  2VA3 A;  1U47 A;  4I2A A;  4I2I A;  4YVZ A;  5L1L A;  4B9T A;  4QZD A;  4BWM A;  3MFI A;  4YG2 A;  4DFP A;  4X5V A;  4DF8 A;  1SKR A;  7ICF A;  3MDC A;  5IIN A;  3OHA A;  5IIK A;  2ISO A;  4UBB A;  3FYH A;  1MQ3 A;  4O3R A;  2IMW P;  4F4Y A;  2XY7 A;  3C1Z A;  3MAB A;  3PY8 A;  4Q8E A;  4JK1 A;  4ED2 A;  4O5E A;  4LZD A;  5J0P A;  7ICT A;  9ICB A;  9ICG A;  1IXR A;  2IA6 A;  9ICK A;  4C8N A;  3RBE A;  5J0X A;  1U49 A;  4MEX A;  1S77 D;  2W9A A;  1KDH A;  7ICL A;  5J0R A;  4Q45 A;  3QEB Z;  4I2J A;  4KLH A;  3ORY A;  5DDM A;  4MEY A;  4RZR A;  4MFA A;  4DL6 A;  1RXW A;  4I2G A;  5J2B A;  2HHT A;  7ICH A;  4UQG A;  1UA1 A;  3HWT A;  5CA7 A;  2C28 A;  1S0N A;  1ZQP A;  1TAU A;  2F1H A;  2PFQ A;  4DSE A;  1SL1 A;  8ICA A;  1JN3 A;  1COO A;  1QTM A;  1SKW A;  1QSS A;  4ELV A;  3PW5 A;  5DB6 A;  5D46 A;  1ZJN A;  4UB3 A;  4Q44 A;  3KTQ A;  4I2F A;  4DLG A;  1ZQT A;  4O5K A;  4QZG A;  3QE9 Y;  3RJF A;  1ZQH A;  3MGH A;  4NXZ A;  1JMS A;  3GV5 B;  1U45 A;  4FO6 A;  9ICE A;  4YN4 A;  1ZQA A;  3IHQ B;  2FPK A;  4PHA A;  2W8K A;  2FLP A;  4QWE A;  1U4B A;  4ECX A;  5F9L A;  1SKS A;  4F4W A;  3SI8 A;  2BQR A;  1KFS A;  4ED7 A;  4M9L A;  3OSP A;  1NK5 A;  9ICA A;  3RAQ A;  3RR7 A;  1SL2 A;  5C5J A;  2BPF A;  5IIJ A;  5HMM A;  1ZYQ A;  4YR0 A;  4NY8 A;  1B43 A;  3BQT A;  2KZ3 A;  4J9L A;  4QZ8 A;  4P4P A;  2BGW A;  2PXI A;  4RQ8 A;  2PFO A;  3PW4 A;  3NGD A;  4J9K A;  2C2D A;  1ZQG A;  4ELT A;  4R63 A;  2BQ3 A;  1X9W A;  3THV A;  1ZQM A;  4IRK A;  2PFP A;  1EXN A;  5EWF A;  8ICY A;  2ZJ5 A;  4PHE A;  4F4X A;  9ICR A;  3E2E A;  5HHH A;  5EWG A;  3C1Y A;  2FLL A;  4YR2 A;  2ZTC A;  3UXO A;  3ETL A;  4PHP A;  3GIK A;  3K75 D;  2BR0 A;  3ZDD A;  9ICJ A;  4F50 A;  4DS5 A;  2NRZ A;  4JUZ A;  3PW2 A;  9ICQ A;  1K1S A;  5KTQ A;  1BVS A;  4YR3 A;  1D8Y A;  2OWO A;  4RQ7 A;  5J0T A;  4LVS A;  4FBT A;  3PR5 B;  1L3T A;  1HUO A;  4M6W A;  3M9O B;  5KFY A;  4QWB A;  4O9M A;  4ED6 A;  4R8U A;  1KLN A;  1T7P A;  2AJQ A;  8ICW A;  4RNO A;  2BKE A;  4GC7 A;  5L1I A;  4DS4 A;  4IRC A;  4ECQ A;  4BXO A;  4I29 A;  9ICF A;  5J2D A;  1A76 A;  4RPX A;  4QZH A;  3GIM A;  1NK7 A;  2HHV A;  5DLF A;  3BJY A;  4B9L A;  1RYS A;  1PZN A;  5J2I A;  4NM2 A;  3G6V A;  9ICC A;  1QSY A;  9ICL A;  4GXI A;  4K4I A;  3AU2 A;  2KTQ A;  3PW7 A;  2C22 A;  4RT3 A;  5KFH A;  4JWN A;  4DQP A;  3PO5 A;  1S10 A;  1KSP A;  3RJJ A;  4BWJ A;  1NJZ A;  4DL4 A;  4KTQ A;  4O3S A;  4I2E A;  1QLN A;  4QWD A;  8ICF A;  5KT6 A;  9ICP A;  4FS2 A;  5J2H A;  2JEF A;  2HHQ A;  1WCL A;  7ICV A;  4HYK A;  2JEJ A;  1CEZ A;  2KN7 A;  4DQS A;  1S0V A;  4PGY A;  2A1J A;  3HX0 A;  5KFT A;  2WTF A;  3OJS A;  2IHN A;  5HHI A;  2ASJ A;  2JZB A;  1ZQI A;  4QWC A;  3RR8 A;  4I2B A;  4YP3 A;  4MFC A;  7ICK A;  7ICU A;  7ICO A;  5J2K A;  3ISB A;  4F3O A;  2JEG A;  5L9X A;  3N97 B;  2ZUC A;  4DL7 A;  3PR4 A;  3RH5 A;  4EYI B;  5KG4 A;  3TAR A;  2XO7 A;  4ELU A;  3ZDB A;  3G6X A;  4RUC A;  3LWM A;  3TQ1 A;  4KLI A;  5DQG A;  5KFG A;  1ZQK A;  1ZQD A;  4PH5 A;  4G3I A;  4B9U A;  1ZET A;  3RRH A;  8ICN A;  4ECR A;  3V7K A;  2R8I A;  5DB9 A;  5KFD A;  4IQW A;  7ICQ A;  4XA5 A;  4O0I A;  1BPY A;  4RNM A;  1L3V A;  1NKE A;  4I2H A;  4DSF A;  1XS9 D;  3V6K A;  1ZJM A;  3V6H A;  2XGQ A;  3RAX A;  2Y1J A;  4XUS A;  1UA0 A;  4C8O A;  4BGD A;  8ICI A;  5KFU A;  5BOM A;  1TK8 A;  1L5U A;  4LZG A;  3ZDA A;  4J9M A;  4M6W B;  2V4Q A;  7ICN A;  3C23 A;  1NK8 A;  5KFP A;  4ECV A;  1XSN A;  1WCN A;  2JZB B;  2R8H A;  1XC9 A;  3NTU A;  4KN4 A;  5KG5 A;  4JWM A;  4IR9 A;  1SL0 A;  9ICT A;  2BDP A;  4M0A A;  1MC8 A;  5KG3 A;  4Z6D A;  1S97 A;  9ICN A;  4Z6E A;  4Z6F A;  4J9P A;  2RDI A;  4B9V A;  5CR0 A;  5KFM A;  4ED3 A;  3AU6 A;  3TAQ A;  2DPI A;  2R8K A;  4P4O A;  7ICS A;  3H40 A;  9ICX A;  3QZ8 A;  1NK4 A;  4DOB A;  4GXK A;  5KFV A;  4RQ0 A;  2FPL A;  4CCH A;  4EBD A;  5KFW A;  4ECY A;  1NJY A;  4KIT B;  4F2R A;  1Y88 A;  3QZ7 A;  1BPZ A;  1ZQR A;  5DBB A;  5HNK A;  1ZQZ A;  2B21 A;  3PML A;  4F93 B;  5KT5 A;  3HPO A;  4ECW A;  4KLF A;  3JPR A;  2KFZ A;  3UPQ A;  2FPM A;  1ZQB A;  1JXE A;  4UB5 A;  4Q43 A;  3LK9 A;  8ICV A;  2AQ0 A;  4QZF A;  4Q8F A;  3KHH A;  7ICG A;  1T8E A;  9ICH A;  1SZP A;  1BPX A;  5J29 A;  3Q8L A;  2J6T A;  2J6U A;  1KFT A;  3UXN A;  1Z00 A;  3ZD9 A;  5KT3 A;  3TI0 A;  4RQ3 A;  3T5L A;  3ZDE A;  3PNC A;  4E0D A;  4UAZ A;  2UVR A;  2C2E A;  1ZQO A;  5DB8 A;  2GWS A;  1NKC A;  3PW0 A;  5KFJ A;  4DFJ A;  4O3O A;  5KT7 A;  4RQ2 A;  3M9N B;  4K4H A;  4QZI A;  5DQI A;  4R8U B;  9ICI A;  5KFS A;  3FDS A;  2NRT A;  4R65 A;  8ICZ A;  1L3U A;  3GQC A;  2AGO A;  2R8G A;  5J2J A;  5KFR A;  5KFN A;  4I2C A;  1XO1 A;  2W9B B;  3TFS A;  8ICP A;  1MSW D;  5CHG A;  4QWA A;  4EZ9 A;  4I27 A;  5CP2 A;  2XC9 A;  3KHL A;  3OJU A;  4J9Q A;  5KG0 A;  3H4B A;  3OGU A;  3EW9 A;  3V72 A;  4PGQ A;  4M2Y A;  1ZQV A;  2BHN A;  2RDJ A;  5KG7 A;  4B9S A;  2I1Q A;  5JUM A;  4PPX A;  3EWA A;  8ICS A;  2XY5 A;  8ICQ A;  5J0Q A;  1NK6 A;  2H5X A;  4QZC A;  1D8L A;  4F92 B;  3HP6 A;  4F5R A;  1ZQL A;  1ZQQ A;  4B9N A;  2HHW A;  2DFL A;  2XCP A;  2IBK A;  3Q8Q B;  4RQ6 A;  5DKW A;  1DOQ A;  2ZTD A;  5CWR A;  4TUS A;  1S9F A;  1UT5 A;  1ZQU A;  1DGS A;  4DFK A;  2FMQ A;  1LV5 A;  5L1K A;  3SV4 A;  5D4B A;  4RQ5 A;  1S76 D;  1TV9 A;  4MF8 A;  5KFF A;  4IR1 A;  5DQH A;  4C8K A;  4DL5 A;  4JV1 A;  4J9O A;  4EYH B;  3RBD A;  2A1J B;  2ASD A;  4FBU A;  4DSL A;  4M9N A;  1ZQC A;  4NM1 A;  2ISP A;  4ECT A;  3MR5 A;  3MGI A;  4M9H A;  4NLG A;  2M9N A;  5KG6 A;  1L3S A;  2ATL A;  4YD2 A;  8ICB A;  1ZQF A;  2BCR A;  3Q8R B;  5KG2 A; 
#chains in the Genus database with same CATH topology
 4P4M A;  4IRD A;  2BPC A;  2PKE A;  3ZD8 A;  3RJH A;  3TAD A;  1QCK A;  4QZA A;  4UAR A;  2XCA A;  3AQF A;  2XGP A;  4GFJ A;  4NL9 A;  3PX6 A;  3PO4 A;  1YZ6 A;  1K5O A;  3RTV A;  1ZQY A;  1BPD A;  1T3N A;  3V7J A;  4P0P B;  1RZT A;  4US8 A;  2RLT A;  5AKK A;  3H8J A;  4ED8 A;  3QU5 A;  3JPO A;  3M1Y A;  4IQT A;  2KHQ A;  2ZXH A;  3HW8 A;  2W9M A;  4FFD A;  4PHD A;  1B0X A;  4DWI A;  3MC1 A;  2PI4 A;  2VJ4 A;  3BQ0 A;  1BGX T;  5J0S A;  1KRP A;  3UXP A;  3CRX A;  1TAQ A;  1ZQX A;  1DXS A;  1TK5 A;  2ZJ8 A;  4O3Q A;  4J9R A;  2FJ6 A;  2H3Q A;  2HDO A;  5B66 U;  2WFA A;  2HHU A;  4YMM A;  4RPZ A;  2LYH A;  3Q8K A;  2AQ4 A;  3WK7 A;  4IQU A;  5F9N A;  4UBC A;  2NYV A;  2OEH A;  4DSI A;  4A8E A;  4KLL A;  4Y2U A;  2G08 A;  2E8P A;  2ZJA A;  9ICM A;  4F8R A;  4Y2Y A;  4KLJ A;  4ECS A;  1VDV A;  2KJ8 A;  1MQ2 A;  1B22 A;  4JV0 A;  1SB3 C;  2VAN A;  1QQ7 A;  4CF5 A;  2VJ5 A;  3PMN A;  5ALI A;  4B9M A;  8ICR A;  8ICC A;  1A0P A;  1MA7 A;  2ZTE A;  5BOL A;  1S0O A;  9ICW A;  2F77 X;  2CPR A;  4F5P A;  1S0M A;  4KLG A;  5AK4 A;  3RRG A;  8ICL A;  5AM0 A;  4Y2P A;  3M8S A;  3RJK A;  3C5G A;  4YQW A;  1C7Y A;  2MUT A;  5KFE A;  2W9C A;  5AM2 A;  3C2L A;  4C4R A;  3RJE A;  4Y2J A;  1NJX A;  2AU0 A;  2OH2 A;  5KFB A;  1V9P A;  4U7C A;  3ISD A;  1N5X A;  3GIL A;  1S8O A;  1ARO P;  4TQS A;  7ICM A;  4BDP A;  4UAY A;  2UVU A;  4UB2 A;  5KFX A;  3M7D A;  4NJ8 A;  4WJ3 B;  4TUR A;  2ZG6 A;  4NLN A;  2F1J A;  1SIJ A;  3I76 A;  2F8K A;  2K8B B;  4ED0 A;  3EZ5 A;  1A77 A;  1JUD A;  5DG9 A;  4QZ9 A;  5KL8 B;  3CNH A;  3WK4 A;  1O08 A;  5EWE A;  8ICT A;  4UAV A;  3MR6 A;  5J2C A;  1BPE A;  3C2M A;  1ZOL A;  3JPT A;  1ZQJ A;  5DG7 A;  1Z1V A;  3JPS A;  3H8W A;  3RB4 A;  5AM3 A;  2ALZ A;  2DGZ A;  1SWV A;  5KAF U;  4QIW C;  1J2N A;  1VLB A;  5DBA A;  3GIJ A;  3M9M B;  5L1J A;  3Q8S B;  4KLM A;  4EEK A;  2Y1I A;  1KBU A;  2VA3 A;  2KSO A;  2RHF A;  1PUZ A;  3FM9 A;  2W43 A;  3AMZ A;  3MDC A;  5AIA A;  1Z4O A;  2ISO A;  2EQY A;  3FYH A;  3C1Z A;  2JGA A;  2WF5 A;  4O5E A;  5G5G A;  7ICT A;  2Z7J A;  2IA6 A;  9ICK A;  2JR5 A;  7ICL A;  3HJE A;  4Y2R A;  4Q45 A;  2WF9 A;  4KLH A;  4RZR A;  4NV0 A;  1IV8 A;  4I2G A;  4UQG A;  4G9B A;  3HWT A;  2JXJ A;  3BS5 A;  2F1H A;  2PFQ A;  1SL1 A;  1JN3 A;  1QSS A;  3UMC A;  3PSI A;  4O5K A;  4QZG A;  4FZL A;  4NXZ A;  2CN1 A;  4F71 A;  1RDF A;  4PHA A;  4QWE A;  2KP7 A;  5AHX A;  1U4B A;  4ECX A;  2BQR A;  1KFS A;  5ALV A;  3OSP A;  9ICA A;  1SL2 A;  3IV6 A;  5IIJ A;  4NY8 A;  1SGG A;  1B43 A;  2KZ3 A;  2Y9U A;  3IG8 A;  3PW4 A;  4ELT A;  4R63 A;  1X9W A;  1ZQM A;  8ICY A;  4PHE A;  9ICR A;  3E2E A;  5HHH A;  3I1Y A;  2E5S A;  2ZTC A;  2F8L A;  3ZDD A;  3D2Q A;  4DS5 A;  2NRZ A;  9ICQ A;  2KEY A;  1K1S A;  2RP5 A;  2OWO A;  4RQ7 A;  2H3F A;  5J0T A;  4LVS A;  2FE9 A;  1HUO A;  4M6W A;  4O9M A;  4R8U A;  1T7P A;  4CF3 A;  9ICF A;  5J2D A;  4QZH A;  3GIM A;  5DLF A;  3BJY A;  4B9L A;  9ICL A;  4NM2 A;  9ICC A;  4GXI A;  4CNQ A;  1RG6 A;  2MRL A;  2KTQ A;  1NZP A;  3PO5 A;  1KSP A;  1KKX A;  4FS2 A;  1KN5 A;  4PJ0 U;  1SV0 C;  2ASJ A;  1ZQI A;  3RR8 A;  3ONN A;  2ZUC A;  2KHV A;  3RH5 A;  4EYI B;  5KG4 A;  4ELU A;  3ZDB A;  4RUC A;  3RF9 A;  5KFG A;  1ZQK A;  5ALG A;  4G3I A;  2KD1 A;  8ICN A;  4ECR A;  2AH5 A;  2R8I A;  3IN5 A;  4RNM A;  1L3V A;  5ALN A;  3QU9 A;  5AKG A;  2XGQ A;  2Y1J A;  1UA0 A;  1F0M A;  5BOM A;  1TK8 A;  3ZDA A;  2YX8 A;  3F2D A;  1NK8 A;  1XSN A;  5ALR A;  4PL1 A;  4Y2V A;  3AEV A;  4JWM A;  4Z6D A;  4ACO A;  1S97 A;  4Z6F A;  1N61 A;  5CR0 A;  2DPI A;  7ICS A;  4P4O A;  4RQ0 A;  4EBD A;  2HOF A;  4ECY A;  1NJY A;  4KIT B;  1BPZ A;  1ZQR A;  2LPE A;  4IC9 A;  2AQ0 A;  3QXG A;  4QZF A;  1WYG A;  1T8E A;  1SZP A;  1KFT A;  2FDR A;  4OJ5 A;  4E0D A;  2C2E A;  5DB8 A;  2GWS A;  1N2X A;  5AK5 A;  5KT7 A;  3M9N B;  2W7P A;  3AL0 B;  2RRD A;  1YT3 A;  3PZP A;  2AGO A;  3L5K A;  5J2J A;  5KFR A;  3F5A A;  5KFN A;  4I2C A;  3TFS A;  3RFA A;  1CI4 A;  2QLT A;  3N7S C;  1VJ5 A;  5KG0 A;  3H4B A;  1ZQV A;  5A0L A;  3EWA A;  3NVV A;  1PK1 A;  1D8L A;  2XCP A;  2IBK A;  4RQ6 A;  5DKW A;  1DOQ A;  4TUS A;  2FMQ A;  1ZQU A;  1DGS A;  2NV3 A;  2ZIV A;  3SV4 A;  1UCV A;  1DRG A;  4IR1 A;  5DQH A;  4EYH B;  5HR6 A;  3KD3 A;  2JHD A;  5AI8 A;  5KG6 A;  2ATL A;  3LVW A;  5KG2 A;  1RM6 C;  4USA A;  4EZ6 A;  1ZQE A;  3OTQ A;  3M8R A;  2PMZ C;  2W3S A;  3QYP A;  1L7M A;  1T4G A;  3RH6 A;  1X42 A;  1KTQ A;  2Q0Z X;  3WK6 A;  4O3N A;  2J6S A;  5J0U A;  1WWV A;  1XSP A;  2LI6 A;  3C2K A;  1CUK A;  2UVW A;  3F2B A;  4KLE A;  2L5Y A;  4F4K A;  1SWW A;  4F5O A;  4RNN A;  4KN7 A;  1JXL A;  4YXJ A;  4UB1 A;  2JEI A;  2KFN A;  3SR6 A;  3BDP A;  1X9M A;  3RH4 A;  2P66 A;  2W55 A;  3MFH A;  2AGP A;  2NRX A;  3GV7 B;  4F5Q A;  1B4F A;  4KMU A;  1FEZ A;  2ZIW A;  3BS7 A;  5AM4 A;  3V7L A;  3QUB A;  3HT3 A;  3N4M B;  3B0Y A;  2XI9 A;  2PFN A;  3T3F A;  5IIM A;  4BXO B;  3B0X A;  1OUQ A;  4M47 A;  4DSK A;  4C0Z A;  2AGQ A;  2V9W A;  3H0R B;  3GV8 B;  5KFQ A;  2BQU A;  3PV8 A;  1FIQ A;  5EOZ A;  1SV0 A;  1K1Q A;  4O3P A;  2K60 A;  3LWL A;  2NRW A;  1RYU A;  5D49 A;  8ICE A;  7ICJ A;  1KFD A;  3RB3 A;  4ECU A;  3UM9 A;  5KT2 A;  7ICR A;  2KK0 A;  3T5K A;  3ZI4 A;  2W03 A;  2P6R A;  4C8L A;  1ZQS A;  1H38 A;  2KVS A;  1DGJ A;  9ICO A;  4M04 A;  3LDA A;  2HSZ A;  4RQ4 A;  2K4I A;  1J97 A;  1X6J A;  5J2A A;  3TAP A;  4DOA A;  3T5J A;  5J8Y C;  5J2F A;  4M9G A;  1NK0 A;  2XY6 A;  4RPY A;  4NL9 C;  4FE3 A;  2LMR A;  8ICH A;  3RJI A;  4DL3 A;  1UPH A;  5JU5 A;  5ALF A;  3OSN A;  2IOF K;  1LKY B;  2IOF A;  1XSL A;  5E79 U;  4F2S A;  2EH9 A;  4I28 A;  4ICA A;  3SAF A;  3NRW A;  3PSP A;  2ZUB A;  2HVH A;  5EE9 A;  9ICS A;  3SZ2 A;  2G0A A;  1TK0 A;  3MDA A;  1N48 A;  4UAW A;  1D9F A;  3RB6 A;  4DOC A;  4PZO A;  5IIO A;  2OXO A;  4KX5 A;  5CRX A;  2FMP A;  1V85 A;  2KZZ A;  3MR2 A;  2I9G A;  4KLO A;  1N56 A;  4YMN A;  2HBK A;  4I2A A;  4I2I A;  5L1L A;  4B9T A;  1SXD A;  3U26 A;  4X5V A;  4DF8 A;  3GU3 A;  4UBB A;  4O3R A;  4AP9 A;  2ODG A;  2XY7 A;  3MAB A;  4JK1 A;  2HMX A;  1JRP A;  5J0P A;  9ICB A;  2LM1 A;  9ICG A;  3ETR A;  4F72 A;  4MEX A;  3QEB Z;  4I2J A;  4MFA A;  2HHT A;  4DL6 A;  4OO1 J;  1ZQP A;  4OJL A;  1COO A;  1SKW A;  3QU4 A;  5D46 A;  4UB3 A;  3KTQ A;  1RQL A;  1ZQH A;  2WB1 F;  3FC4 A;  2G09 A;  9ICE A;  4YN4 A;  1KQQ A;  1ZQA A;  2FLP A;  1WWU A;  2D6F C;  4F4W A;  3SI8 A;  5HMM A;  4YR0 A;  5EE1 A;  4QZ8 A;  1LKY A;  2HCF A;  5EE0 A;  3NAS A;  2G5I B;  4J9K A;  2CXY A;  5AKI A;  3THV A;  2PFP A;  5EWF A;  2F76 X;  2XID A;  4F4X A;  2YMQ A;  3C1Y A;  3R9K A;  9ICJ A;  3F2C A;  3PW2 A;  3QU7 A;  1A6S A;  5KTQ A;  3BQ7 A;  4YR3 A;  4NLB A;  2HBM A;  3PST A;  1XNS A;  1UQV A;  3M9O B;  4ED6 A;  8ICW A;  4UAT A;  4GC7 A;  5L1I A;  4I29 A;  2OYY A;  1A76 A;  2YB1 A;  2Y9T A;  5ALS A;  5J2I A;  1BNO A;  3G6V A;  4C7Z A;  2KVC A;  3HKZ F;  3QNM A;  3PW7 A;  3TKA A;  2MA1 A;  4DQP A;  4OD0 A;  1S10 A;  1NJZ A;  3E58 A;  2BZF A;  2R18 A;  5L1M A;  2H3I A;  2JEF A;  2KJ5 A;  7ICV A;  2JEJ A;  2KN7 A;  3WKA A;  3HX0 A;  2I6X A;  2KE7 A;  5ALZ A;  5H2F U;  2E8N A;  4MFC A;  4I2B A;  5J2K A;  2JEG A;  2KSO B;  1ZRN A;  2XO7 A;  2K8A A;  5DQG A;  4PH5 A;  1X6I A;  3IG5 A;  3RRH A;  2EAO A;  5DB9 A;  3F53 A;  4XA5 A;  1NKE A;  1XS9 D;  3V6H A;  3RAX A;  8ICI A;  2D8C A;  5KFU A;  4BX9 C;  4EEN A;  2DF4 B;  1L5U A;  4LZG A;  4J9M A;  4Y2S A;  5F3X B;  2O6K A;  1WCN A;  2R8H A;  3MGV A;  2F3N A;  3NVW A;  1NI3 A;  1SL0 A;  5KG3 A;  2ZIU B;  3AU6 A;  4ED3 A;  3TAQ A;  2R8K A;  3DEE A;  2W54 A;  4DOB A;  3NVZ A;  2FPL A;  5ALE A;  1Y88 A;  3QZ7 A;  1QQ5 A;  5DBB A;  5HNK A;  1ZQZ A;  2B21 A;  5KT5 A;  3QUC A;  3UPQ A;  3CP8 A;  4UB5 A;  2IOH A;  3PSF A;  3N28 A;  3UMB A;  2YMM A;  2WF7 A;  3IP4 B;  3E0F A;  3KHH A;  1BPX A;  3SAH A;  5ALW A;  3Q8L A;  2QKQ A;  1BNP A;  1X40 A;  3ZDE A;  3PNC A;  1SZH A;  4JB3 A;  3BZK A;  4EEL A;  4DFJ A;  4R8U B;  3FDS A;  3GQC A;  3C28 A;  1XO1 A;  2W9B B;  4RQM A;  1L7O A;  1MSW D;  5CHG A;  4BJQ A;  3KHL A;  3OJU A;  1L8O A;  3EW9 A;  3CYM A;  2BHN A;  2LHT A;  4PPX A;  8ICS A;  2XY5 A;  8ICQ A;  4QZC A;  3HP6 A;  1ZQQ A;  4Y2X A;  2HHW A;  3SQI A;  3Q8Q B;  2ZTD A;  5CWR A;  1S9F A;  4DFK A;  1LV5 A;  5L1K A;  4CDG A;  5D4B A;  3BS5 B;  1Z4N A;  2WAQ C;  1N60 A;  4JV1 A;  4J9O A;  2ASD A;  1Q3V A;  4FBU A;  1ZQC A;  4NM1 A;  2ISP A;  5ALX A;  3MR5 A;  3MGI A;  4M9H A;  4NLG A;  2M9N A;  1L3S A;  5AKY A;  8ICB A;  1ZQF A;  2BCR A;  3Q8R B;  1XO0 A;  2ZIX B;  4AYB C;  3ZDC A;  3K4G A;  1Z00 B;  3S6J A;  4XRH A;  3BQ1 A;  4YCX A;  2Y0S F;  2FMS A;  5J8Y A;  8ICK A;  2KZM A;  2GO7 A;  4K4G A;  1SXE A;  3GII A;  3QEA Z;  2VIX A;  3H0L B;  3BQ2 A;  1RPL A;  2WF6 A;  2P6U A;  3QUQ A;  4F4Z A;  4YMO A;  1QSL A;  2KMD A;  3OHB A;  5JRT A;  1TKD A;  4JV2 A;  2DWQ A;  4PGX A;  3KHR A;  1OW5 A;  3IM1 A;  3NS1 A;  5DB7 A;  1IM4 A;  3LVV A;  4KLU A;  3PX0 A;  2KV2 A;  4GLX A;  4KLD A;  3SD7 A;  4RQ1 A;  2ZUD A;  5DGA A;  2QAR A;  4DFM A;  1ZQN A;  2XIC A;  1HUZ A;  3SV3 A;  5ALH A;  5KFL A;  2KKV A;  4NLK A;  7ICE A;  5AI6 A;  5AM1 A;  9ICV A;  2F1I A;  4PL2 A;  4US9 A;  4GC6 A;  4P2H A;  5DDY A;  3WKE A;  8ICJ A;  4EX6 A;  4YXM A;  4R66 A;  3ISC A;  3T79 A;  5AM5 A;  2NRV A;  1HJP A;  1Z1B A;  3BZC A;  5ALT A;  5ALJ A;  2H3Z A;  3F5E A;  1FFU A;  5ALO A;  4DQR A;  4FZN A;  2BDU A;  2DPJ A;  1ZQW A;  5ALY A;  5KFI A;  3UQ2 A;  4KLQ A;  2W8L A;  4UW9 A;  8ICO A;  2PI5 A;  2B6G A;  4KMO B;  1NOM A;  2V4R A;  4DSJ A;  1OXJ A;  3GZF A;  4YFK A;  3Q8P B;  4GXJ A;  3NRZ A;  4DFD A;  3D2N A;  5J0O A;  5BPC A;  2VA2 A;  2LYB A;  5K4L A;  4RQN A;  3B9J A;  1NKB A;  1HIW A;  4F5N A;  4ED1 A;  1ZD2 P;  4AYB F;  4DQQ A;  4Y2T A;  4RU9 A;  3GDX A;  5J0W A;  1FO4 A;  1U48 A;  4MFF A;  4TQR A;  4J9S A;  1QH9 A;  5CEH A;  2A1A A;  3JPQ A;  2WHE A;  3H8S A;  4C80 A;  2IHM A;  2N1R A;  2BCS A;  4DCC A;  4RUA A;  1LVH A;  2ESE A;  4R64 A;  1X9S A;  4NLZ A;  3H7I A;  4KLS A;  2HBJ A;  3UQ0 A;  2FLN A;  1Z3E B;  3PVX A;  3EPI A;  5DGB A;  3KHG A;  4MF2 A;  4XQ8 A;  1RXV A;  3EUB 2;  1QQ6 A;  3N7R C;  3AN1 A;  4I2D A;  4F91 B;  8ICM A;  4IL6 U;  1X2I A;  1LB2 B;  5J2E A;  4QZE A;  1UT8 A;  1URJ A;  2UVV A;  1COK A;  4O5C A;  1KL9 A;  5ALQ A;  3G6Y A;  1U47 A;  2KOB A;  2W11 A;  4YVZ A;  4QZD A;  3MFI A;  3QUT A;  4YG2 A;  1SKR A;  7ICF A;  5IIN A;  3OHA A;  1MQ3 A;  2IMW P;  1PVR A;  3PY8 A;  4LZD A;  5FP0 A;  1IXR A;  5JTI A;  1U49 A;  3RBE A;  1S77 D;  2W9A A;  1KDH A;  5AIC A;  1PK1 B;  3ORY A;  4Y2Q A;  4MEY A;  3IDW A;  5DDM A;  1RXW A;  1PVP A;  7ICH A;  3KOO A;  3WKB A;  1TAU A;  1QTM A;  1PVQ A;  2ZIV B;  3PW5 A;  2KNJ A;  4Q44 A;  4I2F A;  4DLG A;  4FZM A;  1TE2 A;  3QE9 Y;  2EDU A;  3RJF A;  2K8C B;  2DQN B;  3MGH A;  1L7N A;  1JMS A;  3GV5 B;  1U45 A;  4FO6 A;  3IHQ B;  2HI0 A;  5AKH A;  2W8K A;  3CW2 C;  5F9L A;  5AKL A;  4M9L A;  3RAQ A;  5C5J A;  2BPF A;  1ZYQ A;  2B0C A;  3BQT A;  1ZD4 A;  4P4P A;  2PXI A;  5ALL A;  2Q4T A;  4RQ8 A;  1GO3 F;  3NGD A;  2C2D A;  3C29 A;  2BQ3 A;  1N5W A;  1EXN A;  4CGZ A;  2LKY A;  5EWG A;  2FLL A;  4YR2 A;  3UXO A;  2LBO A;  1NZB A;  3K75 D;  2BR0 A;  4FBT A;  1L3T A;  2E1F A;  1ZD5 A;  4LJX A;  5ALM A;  4RNO A;  2CRX A;  4DS4 A;  4IRC A;  4ECQ A;  4RPX A;  2HHV A;  1NK7 A;  3WK5 A;  3OPX A;  1RYS A;  5ALD A;  1QSY A;  4K4I A;  2C22 A;  4RT3 A;  5KFH A;  2JH1 A;  4JWN A;  4DL4 A;  4O3S A;  1QLN A;  4QWD A;  5KT6 A;  4UAU A;  2YQE A;  2KIW A;  2HHQ A;  1WCL A;  2WF8 A;  4HYK A;  1CEZ A;  4DQS A;  1S0V A;  4PGY A;  5KFT A;  2WTF A;  1O03 A;  2JZB A;  4QWC A;  7ICK A;  1J2M A;  3ISB A;  5L9X A;  3N97 B;  3TAR A;  3KKA A;  3TQ1 A;  1ZD3 A;  4B9U A;  2DL0 A;  1ZET A;  1TAM A;  3VCB A;  4QIW F;  5KFD A;  4I2H A;  4O0I A;  1F44 A;  4C8O A;  4XUS A;  4BGD A;  5AK3 A;  5B5E U;  1T94 A;  5ALP A;  7ICN A;  3NVY A;  3C23 A;  2QB1 A;  5KFP A;  4ECV A;  4P0P A;  5AI0 A;  2GLE A;  5KG5 A;  5TIS U;  1DK3 A;  9ICT A;  4M0A A;  3WK9 A;  1AQ6 A;  4PZN A;  5GTI U;  4J9P A;  2RDI A;  5KFM A;  2VKQ A;  1M6Y A;  5KFV A;  2AXT U;  4CCH A;  2JH7 A;  5KFW A;  1JRO A;  1RQN A;  5AKJ A;  2GOL A;  4OCZ A;  4MHV A;  3PML A;  3HPO A;  4ECW A;  2KFZ A;  1ZQB A;  3SEN A;  3LK9 A;  8ICV A;  7ICG A;  2J6U A;  3UXN A;  4P0Q A;  4RQ3 A;  3HIL A;  4GIB A;  4KX3 A;  3WKD A;  1MN8 A;  1NKC A;  3PW0 A;  5KFJ A;  2EAN A;  4K4H A;  4QZI A;  5KFS A;  4R65 A;  2NRT A;  8ICZ A;  1L6N A;  4J03 A;  1ECW A;  8ICP A;  4QWA A;  2ZIX A;  5CP2 A;  1Q8K A;  2XC9 A;  5KAI U;  2RDJ A;  2HBL A;  5JUM A;  2K89 A;  2XVT A;  2E8O A;  5J0Q A;  1NK6 A;  2H5X A;  3L4P A;  4F92 B;  1ZQL A;  1S5L U;  3A0H U;  2NO4 A;  3AQE A;  1S76 D;  4MF8 A;  5KFF A;  1N62 A;  4DL5 A;  3RBD A;  4DSL A;  4HAI A;  2G06 A;  2QB0 A;  4ECT A;  5HR7 A;  4NWI A;  2EZX A;  5AKZ A;  1NNL A;  2F44 A;  1JAL A;  2W9B A;  4JMU A;  3RB0 A;  5J0Y A;  4P0Q B;  1X66 A;  2LYA A;  5KFC A;  1NJW A;  3C5F A;  2HOQ A;  3M6Z A;  5KFA A;  1X9X A;  4Z6C A;  3AUO A;  2HVI A;  2EAP A;  1NK9 A;  4QW9 A;  2EAM A;  1KW4 A;  2W04 A;  2E1E A;  5KFK A;  4DO9 A;  2BCU A;  2HHX A;  4BUG A;  5KFZ A;  1CRX A;  2JRZ A;  4EEY A;  4UAS A;  3H4D A;  1IG6 A;  5CJ7 A;  3H8M A;  3ICX A;  2DKX A;  5J2G A;  3D2S A;  3EPG A;  3T5H A;  3WKC A;  3Q8M A;  5C0Y A;  2DUY A;  1FFV A;  4KLT A;  4DL2 A;  4TUP A;  5KG1 A;  2OM6 A;  3L3F X;  4FS1 A;  4UB4 A;  2Y0S C;  4EBC A;  2DKZ A;  3TAN A;  7ICP A;  4QW8 A;  2BCQ A;  5AKX A;  5HML A;  5IIL A;  1TVA A;  3SAG A;  3RJG A;  4M9J A;  3MBY A;  2ASL A;  4QZB A;  2MUT B;  2W9C B;  4NLC A;  2YB4 A;  2C2R A;  5III A;  4ZH4 A;  1N63 A;  1BPB A;  4EBE A;  3I28 A;  1RYR A;  9ICU A;  3KKA C;  4RT2 A;  4QJF B;  5EE3 A;  3TFR A;  1Q46 A;  4DF4 A;  5TZV A;  2F2A B;  3QX7 A;  4J9N A;  1JX4 A;  2M0N A;  3K1Z A;  5HP4 A;  4DQI A;  2HOI A;  2OHF A;  5AI9 A;  3VC8 A;  5CB1 A;  4QNL A;  1C20 A;  4TUQ A;  5AIB A;  5KFO A;  2R8J A;  1XU4 A;  2BPG A;  3GFK B;  3SYZ A;  2NO5 A;  5ALU A;  2MAX A;  3JPP A;  1WUD A;  2D3D A;  3MR3 A;  4C8M A;  3J81 j;  5T14 A;  5AI4 A;  2KKP A;  4DLE A;  4DEZ A;  2YMP A;  4ECZ A;  2E8M A;  1ZRM A;  3JPN A;  4YD1 A;  5G5H A;  8ICX A;  2HHS A;  1IIP A;  5DLG A;  2FI1 A;  1ZXI A;  2EZZ A;  2VA8 A;  4U6P A;  8ICU A;  1JIH A;  1TFR A;  5KNI A;  4C4S A;  1D9D A;  5DBC A;  8ICG A;  2YN4 A;  1KEJ A;  2JMG A;  5DG8 A;  5KL1 B;  1XWL A;  3DV9 A;  3V6J A;  4CF4 A;  5KT4 A;  1U9L A;  2HW3 A;  4B6J A;  4IQV A;  2W7O A;  3PX4 A;  3EYZ A;  3C21 A;  7ICI A;  1D8B A;  1JI7 A;  3N7P D;  2BCV A;  2G07 A;  4BWM A;  4DFP A;  3WU2 U;  5ALK A;  2P35 A;  5IIK A;  3KZI U;  2YML A;  4F4Y A;  1PK3 A;  4Q8E A;  4ED2 A;  1V97 A;  2ZIW B;  4OJO A;  4CRX A;  2OCE A;  4C8N A;  5J0X A;  5J0R A;  2H3V A;  1L8L A;  5J2B A;  1UA1 A;  5CA7 A;  2C28 A;  1S0N A;  4CE6 A;  4DSE A;  8ICA A;  4ELV A;  2K4E A;  1ZJN A;  5DB6 A;  2KIV A;  1ZQT A;  2GH1 A;  2W3R A;  3ED5 A;  3KZX A;  4UB6 U;  2FPK A;  1HEK A;  4C7Y A;  2KIC A;  1SKS A;  1DK2 A;  4ED7 A;  1NK5 A;  3RR7 A;  1Z19 A;  3M6K A;  2YY6 A;  4J9L A;  3TAC B;  2BGW A;  2PFO A;  3ALR A;  1ZQG A;  4IRK A;  3NUQ A;  2ZJ5 A;  3DDH A;  3WK8 A;  3ETL A;  4PHP A;  3GIK A;  4F50 A;  4JUZ A;  1YZ7 A;  1BVS A;  1D8Y A;  3PR5 B;  2A19 A;  5KFY A;  4QWB A;  4ZOH C;  1KLN A;  2AJQ A;  2ZXI A;  2ES6 A;  2BKE A;  4BXO A;  3UMG A;  1Q3U A;  1PZN A;  2YTU A;  3FAH A;  3H0M B;  3AU2 A;  3K1R B;  3RJJ A;  4BWJ A;  4KTQ A;  1ED1 A;  4I2E A;  8ICF A;  2KJ9 A;  9ICP A;  5J2H A;  3HKZ C;  1T3Q A;  2A1J A;  2IHN A;  3OJS A;  5HHI A;  4EX7 A;  4YP3 A;  7ICU A;  7ICO A;  4F3O A;  1F5S A;  4DL7 A;  3PR4 A;  2JV3 A;  3G6X A;  3LWM A;  4KLI A;  1ZQD A;  1L7P A;  3V7K A;  2EZY A;  4IQW A;  3KFU F;  7ICQ A;  2RQ5 A;  1BPY A;  3TAD C;  4DSF A;  3V6K A;  1ZJM A;  2MSN A;  2K4P A;  2I5H A;  4M6W B;  5AI5 A;  2V4Q A;  2JZB B;  1XC9 A;  3NTU A;  4KN4 A;  2AHO B;  4IR9 A;  2BDP A;  1MC8 A;  9ICN A;  4Z6E A;  1UHU A;  3O0F A;  4B9V A;  4IS7 A;  3H40 A;  9ICX A;  3QZ8 A;  1NK4 A;  4GXK A;  3HRD D;  2QAR B;  2LM4 A;  5AK6 A;  4C4T A;  1SV4 A;  4F2R A;  4F93 B;  4KLF A;  3JPR A;  2FPM A;  2PMZ F;  1JXE A;  4Q43 A;  4Q8F A;  2QB0 B;  2WAQ F;  9ICH A;  5J29 A;  2J6T A;  3ZD9 A;  1Z00 A;  4OJ6 A;  5KT3 A;  3TI0 A;  3T5L A;  1V38 A;  4UAZ A;  2UVR A;  1ZQO A;  2ZIU A;  3A0B U;  4O3O A;  3QU2 A;  5GTH U;  4RQ2 A;  5DQI A;  9ICI A;  1L3U A;  3AM9 A;  4UB8 U;  2R8G A;  4EZ9 A;  4OJP A;  4I27 A;  3IRU A;  3D6J A;  4J9Q A;  2WB1 C;  3V72 A;  3OGU A;  4M2Y A;  4PGQ A;  2KG5 A;  5KG7 A;  4B9S A;  3SMV A;  2I1Q A;  3LYS A;  2E3T A;  2G5H B;  3SEI A;  4F5R A;  4B9N A;  2DFL A;  1P7D A;  2A3V A;  1ZQ1 C;  2K4H A;  2DBY A;  1UT5 A;  1WG8 A;  5AKE A;  4RQ5 A;  1TV9 A;  4C8K A;  2A1J B;  4M9N A;  2MU2 A;  4YD2 A;  4O3M A;  3KBB A; 
#chains in the Genus database with same CATH homology
 4P4M A;  4IRD A;  2BPC A;  3ZD8 A;  3RJH A;  2W9B A;  3ZDC A;  3RB0 A;  3K4G A;  1Z00 B;  4QZA A;  4XRH A;  5J0Y A;  3BQ1 A;  2XCA A;  1ZQE A;  4EZ6 A;  3M8R A;  4YCX A;  2XGP A;  5KFC A;  2FMS A;  8ICK A;  1NJW A;  3C5F A;  2KZM A;  1T4G A;  5KFA A;  4K4G A;  3RH6 A;  1KTQ A;  4Z6C A;  3GII A;  2Q0Z X;  3AUO A;  3PX6 A;  3QEA Z;  1NK9 A;  4O3N A;  4QW9 A;  3BQ2 A;  2J6S A;  3PO4 A;  2HVI A;  5J0U A;  3RTV A;  1XSP A;  1ZQY A;  1RPL A;  3C2K A;  1BPD A;  1CUK A;  1T3N A;  2P6U A;  3V7J A;  5KFK A;  2UVW A;  1RZT A;  4KLE A;  4DO9 A;  4F4Z A;  4YMO A;  1QSL A;  3H8J A;  4ED8 A;  3JPO A;  4F4K A;  4IQT A;  2BCU A;  3HW8 A;  2W9M A;  3OHB A;  4PHD A;  1TKD A;  4F5O A;  2HHX A;  4RNN A;  4KN7 A;  1JXL A;  4JV2 A;  5KFZ A;  4YXJ A;  4UB1 A;  4DWI A;  2PI4 A;  4EEY A;  3H4D A;  2JEI A;  4PGX A;  3KHR A;  3BQ0 A;  2KFN A;  3IM1 A;  5DB7 A;  5CJ7 A;  1IM4 A;  1BGX T;  3BDP A;  3PX0 A;  1X9M A;  4KLU A;  3RH4 A;  5J0S A;  1KRP A;  4GLX A;  3UXP A;  2P66 A;  3MFH A;  4KLD A;  1TAQ A;  1ZQX A;  2AGP A;  4RQ1 A;  5J2G A;  1TK5 A;  2ZUD A;  2NRX A;  2ZJ8 A;  3GV7 B;  3EPG A;  5DGA A;  4F5Q A;  4DFM A;  1ZQN A;  3T5H A;  4O3Q A;  4KMU A;  3Q8M A;  4J9R A;  3V7L A;  2HHU A;  4YMM A;  1HUZ A;  3SV3 A;  5KFL A;  3HT3 A;  3N4M B;  4KLT A;  4RPZ A;  3B0Y A;  4DL2 A;  4NLK A;  4TUP A;  2LYH A;  7ICE A;  5KG1 A;  3Q8K A;  2AQ4 A;  2PFN A;  9ICV A;  3T3F A;  4IQU A;  5F9N A;  3B0X A;  2F1I A;  4UBC A;  5IIM A;  4BXO B;  4DSI A;  4FS1 A;  4UB4 A;  4GC6 A;  4M47 A;  4EBC A;  4P2H A;  4KLL A;  3TAN A;  7ICP A;  4QW8 A;  4DSK A;  2BCQ A;  5DDY A;  5IIL A;  5HML A;  1TVA A;  2ZJA A;  9ICM A;  8ICJ A;  4F8R A;  4YXM A;  2AGQ A;  3RJG A;  4M9J A;  4R66 A;  3ISC A;  2V9W A;  3GV8 B;  5KFQ A;  3MBY A;  2ASL A;  4QZB A;  4KLJ A;  2MUT B;  2NRV A;  2W9C B;  2BQU A;  1HJP A;  2C2R A;  3PV8 A;  5III A;  4ECS A;  4ZH4 A;  1MQ2 A;  1B22 A;  4DQR A;  1BPB A;  4JV0 A;  2VAN A;  1K1Q A;  5EOZ A;  4O3P A;  4EBE A;  1RYR A;  2DPJ A;  1ZQW A;  5KFI A;  3LWL A;  3UQ2 A;  4KLQ A;  2W8L A;  8ICO A;  9ICU A;  3PMN A;  4B9M A;  8ICR A;  8ICC A;  2NRW A;  2PI5 A;  4RT2 A;  5D49 A;  8ICE A;  2ZTE A;  5BOL A;  1S0O A;  9ICW A;  4F5P A;  1S0M A;  1NOM A;  3TFR A;  7ICJ A;  4DF4 A;  1KFD A;  2V4R A;  3RB3 A;  4DSJ A;  5TZV A;  4ECU A;  3RRG A;  4KLG A;  8ICL A;  5KT2 A;  7ICR A;  4J9N A;  1JX4 A;  4YFK A;  3Q8P B;  3T5K A;  4GXJ A;  5HP4 A;  4DQI A;  3M8S A;  3RJK A;  5J0O A;  1ZQS A;  2P6R A;  3C5G A;  1H38 A;  4YQW A;  1C7Y A;  2MUT A;  5KFE A;  5BPC A;  2W9C A;  2VA2 A;  9ICO A;  4M04 A;  3LDA A;  3C2L A;  3RJE A;  1NJX A;  5CB1 A;  2AU0 A;  4RQ4 A;  4TUQ A;  1NKB A;  5KFB A;  1V9P A;  5J2A A;  3ISD A;  3TAP A;  4F5N A;  4ED1 A;  3GIL A;  1ARO P;  4TQS A;  5KFO A;  4DOA A;  3T5J A;  2R8J A;  1XU4 A;  2BPG A;  3GFK B;  7ICM A;  4BDP A;  3SYZ A;  4DQQ A;  4RU9 A;  3GDX A;  2MAX A;  3JPP A;  4UAY A;  2UVU A;  5J2F A;  5J0W A;  4M9G A;  1NK0 A;  2XY6 A;  4UB2 A;  4RPY A;  5KFX A;  3MR3 A;  1U48 A;  4MFF A;  4C8M A;  4TUR A;  4NLN A;  4TQR A;  4J9S A;  8ICH A;  2F1J A;  3JPQ A;  3RJI A;  4DL3 A;  3H8S A;  4DLE A;  4DEZ A;  4ED0 A;  2IHM A;  3OSN A;  2BCS A;  3EZ5 A;  4RUA A;  4ECZ A;  1A77 A;  1XSL A;  5DG9 A;  4R64 A;  1X9S A;  4QZ9 A;  3JPN A;  4YD1 A;  8ICX A;  4F2S A;  4NLZ A;  3H7I A;  4KLS A;  2HHS A;  4I28 A;  5DLG A;  3UQ0 A;  2FLN A;  2VA8 A;  1Z3E B;  8ICU A;  3PVX A;  3EPI A;  2ZUB A;  5DGB A;  1JIH A;  5EWE A;  1TFR A;  8ICT A;  3MR6 A;  3KHG A;  2HVH A;  5J2C A;  9ICS A;  3SZ2 A;  1BPE A;  3C2M A;  1D9D A;  5DBC A;  8ICG A;  4MF2 A;  1TK0 A;  3MDA A;  3JPT A;  4XQ8 A;  1ZQJ A;  5DG7 A;  1RXV A;  1KEJ A;  1N48 A;  3JPS A;  3H8W A;  4UAW A;  4C8L A;  5DG8 A;  1D9F A;  4I2D A;  3RB6 A;  4DOC A;  4F91 B;  3RB4 A;  1XWL A;  5IIO A;  2ALZ A;  8ICM A;  3V6J A;  5KT4 A;  2FMP A;  1U9L A;  2HW3 A;  1X2I A;  2KZZ A;  1LB2 B;  5J2E A;  5DBA A;  4QZE A;  4IQV A;  1UT8 A;  3MR2 A;  3GIJ A;  3PX4 A;  3EYZ A;  3C21 A;  3M9M B;  5L1J A;  2I9G A;  4KLO A;  3Q8S B;  2UVV A;  4KLM A;  7ICI A;  1N56 A;  2Y1I A;  4YMN A;  4O5C A;  2BCV A;  3G6Y A;  2VA3 A;  1U47 A;  4I2A A;  4I2I A;  4YVZ A;  5L1L A;  4B9T A;  4QZD A;  4BWM A;  3MFI A;  4YG2 A;  4DFP A;  4X5V A;  4DF8 A;  1SKR A;  7ICF A;  3MDC A;  5IIN A;  3OHA A;  5IIK A;  2ISO A;  4UBB A;  3FYH A;  1MQ3 A;  4O3R A;  2IMW P;  4F4Y A;  2XY7 A;  3C1Z A;  3MAB A;  3PY8 A;  4Q8E A;  4JK1 A;  4ED2 A;  4O5E A;  4LZD A;  5J0P A;  7ICT A;  9ICB A;  9ICG A;  1IXR A;  2IA6 A;  9ICK A;  4C8N A;  3RBE A;  5J0X A;  1U49 A;  4MEX A;  1S77 D;  2W9A A;  1KDH A;  7ICL A;  5J0R A;  4Q45 A;  3QEB Z;  4I2J A;  4KLH A;  3ORY A;  5DDM A;  4MEY A;  4RZR A;  4MFA A;  4DL6 A;  1RXW A;  4I2G A;  5J2B A;  2HHT A;  7ICH A;  4UQG A;  1UA1 A;  3HWT A;  5CA7 A;  2C28 A;  1S0N A;  1ZQP A;  1TAU A;  2F1H A;  2PFQ A;  4DSE A;  1SL1 A;  8ICA A;  1JN3 A;  1COO A;  1QTM A;  1SKW A;  1QSS A;  4ELV A;  3PW5 A;  5DB6 A;  5D46 A;  1ZJN A;  4UB3 A;  4Q44 A;  3KTQ A;  4I2F A;  4DLG A;  1ZQT A;  4O5K A;  4QZG A;  3QE9 Y;  3RJF A;  1ZQH A;  3MGH A;  4NXZ A;  1JMS A;  3GV5 B;  1U45 A;  4FO6 A;  9ICE A;  4YN4 A;  1ZQA A;  3IHQ B;  2FPK A;  4PHA A;  2W8K A;  2FLP A;  4QWE A;  1U4B A;  4ECX A;  5F9L A;  1SKS A;  4F4W A;  3SI8 A;  2BQR A;  1KFS A;  4ED7 A;  4M9L A;  3OSP A;  1NK5 A;  9ICA A;  3RAQ A;  3RR7 A;  1SL2 A;  5C5J A;  2BPF A;  5IIJ A;  5HMM A;  1ZYQ A;  4YR0 A;  4NY8 A;  1B43 A;  3BQT A;  2KZ3 A;  4J9L A;  4QZ8 A;  4P4P A;  2BGW A;  2PXI A;  4RQ8 A;  2PFO A;  3PW4 A;  3NGD A;  4J9K A;  2C2D A;  1ZQG A;  4ELT A;  4R63 A;  2BQ3 A;  1X9W A;  3THV A;  1ZQM A;  4IRK A;  2PFP A;  1EXN A;  5EWF A;  8ICY A;  2ZJ5 A;  4PHE A;  4F4X A;  9ICR A;  3E2E A;  5HHH A;  5EWG A;  3C1Y A;  2FLL A;  4YR2 A;  2ZTC A;  3UXO A;  3ETL A;  4PHP A;  3GIK A;  3K75 D;  2BR0 A;  3ZDD A;  9ICJ A;  4F50 A;  4DS5 A;  2NRZ A;  4JUZ A;  3PW2 A;  9ICQ A;  1K1S A;  5KTQ A;  1BVS A;  4YR3 A;  1D8Y A;  2OWO A;  4RQ7 A;  5J0T A;  4LVS A;  4FBT A;  3PR5 B;  1L3T A;  1HUO A;  4M6W A;  3M9O B;  5KFY A;  4QWB A;  4O9M A;  4ED6 A;  4R8U A;  1KLN A;  1T7P A;  2AJQ A;  8ICW A;  4RNO A;  2BKE A;  4GC7 A;  5L1I A;  4DS4 A;  4IRC A;  4ECQ A;  4BXO A;  4I29 A;  9ICF A;  5J2D A;  1A76 A;  4RPX A;  4QZH A;  3GIM A;  1NK7 A;  2HHV A;  5DLF A;  3BJY A;  4B9L A;  1RYS A;  1PZN A;  5J2I A;  4NM2 A;  3G6V A;  9ICC A;  1QSY A;  9ICL A;  4GXI A;  4K4I A;  3AU2 A;  2KTQ A;  3PW7 A;  2C22 A;  4RT3 A;  5KFH A;  4JWN A;  4DQP A;  3PO5 A;  1S10 A;  1KSP A;  3RJJ A;  4BWJ A;  1NJZ A;  4DL4 A;  4KTQ A;  4O3S A;  4I2E A;  1QLN A;  4QWD A;  8ICF A;  5KT6 A;  9ICP A;  4FS2 A;  5J2H A;  2JEF A;  2HHQ A;  1WCL A;  7ICV A;  4HYK A;  2JEJ A;  1CEZ A;  2KN7 A;  4DQS A;  1S0V A;  4PGY A;  2A1J A;  3HX0 A;  5KFT A;  2WTF A;  3OJS A;  2IHN A;  5HHI A;  2ASJ A;  2JZB A;  1ZQI A;  4QWC A;  3RR8 A;  4I2B A;  4YP3 A;  4MFC A;  7ICK A;  7ICU A;  7ICO A;  5J2K A;  3ISB A;  4F3O A;  2JEG A;  5L9X A;  3N97 B;  2ZUC A;  4DL7 A;  3PR4 A;  3RH5 A;  4EYI B;  5KG4 A;  3TAR A;  2XO7 A;  4ELU A;  3ZDB A;  3G6X A;  4RUC A;  3LWM A;  3TQ1 A;  4KLI A;  5DQG A;  5KFG A;  1ZQK A;  1ZQD A;  4PH5 A;  4G3I A;  4B9U A;  1ZET A;  3RRH A;  8ICN A;  4ECR A;  3V7K A;  2R8I A;  5DB9 A;  5KFD A;  4IQW A;  7ICQ A;  4XA5 A;  4O0I A;  1BPY A;  4RNM A;  1L3V A;  1NKE A;  4I2H A;  4DSF A;  1XS9 D;  3V6K A;  1ZJM A;  3V6H A;  2XGQ A;  3RAX A;  2Y1J A;  4XUS A;  1UA0 A;  4C8O A;  4BGD A;  8ICI A;  5KFU A;  5BOM A;  1TK8 A;  1L5U A;  4LZG A;  3ZDA A;  4J9M A;  4M6W B;  2V4Q A;  7ICN A;  3C23 A;  1NK8 A;  5KFP A;  4ECV A;  1XSN A;  1WCN A;  2JZB B;  2R8H A;  1XC9 A;  3NTU A;  4KN4 A;  5KG5 A;  4JWM A;  4IR9 A;  1SL0 A;  9ICT A;  2BDP A;  4M0A A;  1MC8 A;  5KG3 A;  4Z6D A;  1S97 A;  9ICN A;  4Z6E A;  4Z6F A;  4J9P A;  2RDI A;  4B9V A;  5CR0 A;  5KFM A;  4ED3 A;  3AU6 A;  3TAQ A;  2DPI A;  2R8K A;  4P4O A;  7ICS A;  3H40 A;  9ICX A;  3QZ8 A;  1NK4 A;  4DOB A;  4GXK A;  5KFV A;  4RQ0 A;  2FPL A;  4CCH A;  4EBD A;  5KFW A;  4ECY A;  1NJY A;  4KIT B;  4F2R A;  1Y88 A;  3QZ7 A;  1BPZ A;  1ZQR A;  5DBB A;  5HNK A;  1ZQZ A;  2B21 A;  3PML A;  4F93 B;  5KT5 A;  3HPO A;  4ECW A;  4KLF A;  3JPR A;  2KFZ A;  3UPQ A;  2FPM A;  1ZQB A;  1JXE A;  4UB5 A;  4Q43 A;  3LK9 A;  8ICV A;  2AQ0 A;  4QZF A;  4Q8F A;  3KHH A;  7ICG A;  1T8E A;  9ICH A;  1SZP A;  1BPX A;  5J29 A;  3Q8L A;  2J6T A;  2J6U A;  1KFT A;  3UXN A;  1Z00 A;  3ZD9 A;  5KT3 A;  3TI0 A;  4RQ3 A;  3T5L A;  3ZDE A;  3PNC A;  4E0D A;  4UAZ A;  2UVR A;  2C2E A;  1ZQO A;  5DB8 A;  2GWS A;  1NKC A;  3PW0 A;  5KFJ A;  4DFJ A;  4O3O A;  5KT7 A;  4RQ2 A;  3M9N B;  4K4H A;  4QZI A;  5DQI A;  4R8U B;  9ICI A;  5KFS A;  3FDS A;  2NRT A;  4R65 A;  8ICZ A;  1L3U A;  3GQC A;  2AGO A;  2R8G A;  5J2J A;  5KFR A;  5KFN A;  4I2C A;  1XO1 A;  2W9B B;  3TFS A;  8ICP A;  1MSW D;  5CHG A;  4QWA A;  4EZ9 A;  4I27 A;  5CP2 A;  2XC9 A;  3KHL A;  3OJU A;  4J9Q A;  5KG0 A;  3H4B A;  3OGU A;  3EW9 A;  3V72 A;  4PGQ A;  4M2Y A;  1ZQV A;  2BHN A;  2RDJ A;  5KG7 A;  4B9S A;  2I1Q A;  5JUM A;  4PPX A;  3EWA A;  8ICS A;  2XY5 A;  8ICQ A;  5J0Q A;  1NK6 A;  2H5X A;  4QZC A;  1D8L A;  4F92 B;  3HP6 A;  4F5R A;  1ZQL A;  1ZQQ A;  4B9N A;  2HHW A;  2DFL A;  2XCP A;  2IBK A;  3Q8Q B;  4RQ6 A;  5DKW A;  1DOQ A;  2ZTD A;  5CWR A;  4TUS A;  1S9F A;  1UT5 A;  1ZQU A;  1DGS A;  4DFK A;  2FMQ A;  1LV5 A;  5L1K A;  3SV4 A;  5D4B A;  4RQ5 A;  1S76 D;  1TV9 A;  4MF8 A;  5KFF A;  4IR1 A;  5DQH A;  4C8K A;  4DL5 A;  4JV1 A;  4J9O A;  4EYH B;  3RBD A;  2A1J B;  2ASD A;  4FBU A;  4DSL A;  4M9N A;  1ZQC A;  4NM1 A;  2ISP A;  4ECT A;  3MR5 A;  3MGI A;  4M9H A;  4NLG A;  2M9N A;  5KG6 A;  1L3S A;  2ATL A;  4YD2 A;  8ICB A;  1ZQF A;  2BCR A;  3Q8R B;  5KG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...