3BQTA

Crystal structure of a protein of unknown function from listeria monocytogenes, tetragonal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
NLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b f2365
total genus 25
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bqtA00
4Z6DA 4F5QA 1KDHA 7ICKA 4KLTA 4KLMA 4MF2A 3UXPA 3HT3A 3GIKA 2ZJ5A 3TARA 4F92B 3LDAA 3IM1A 7ICIA 3MDCA 4JV0A 5J2CA 4DEZA 4IRDA 1TAQA 3GIMA 4QW9A 2V4RA 2B21A 1C7YA 2VA8A 4J9MA 3T5LA 4DWIA 4LVSA 1H38A 4ED7A 4KLFA 3Q8KA 4R64A 3Q8PB 2WTFA 4DSIA 4IR9A 4F5PA 4PGYA 3H8WA 2R8IA 3AU6A 1ZQUA 4GXKA 2VANA 4RPYA 3GIJA 5CA7A 5J2EA 4F4XA 3RB6A 4QWBA 1ZJNA 4B9UA 2P66A 4CCHA 4C8NA 2C22A 1QSYA 2IMWP 5DQGA 1COOA 2XO7A 1AROP 4ECXA 3M9NB 4DQIA 4M0AA 5BOMA 4O5CA 2I1QA 3RRGA 2HHSA 3TANA 3PX6A 2JEFA 4JWNA 4ECSA 4DFKA 8ICRA 4YQWA 2R8HA 1ZQHA 4TURA 1ZQXA 5DGAA 4MFCA 9ICLA 1KFTA 2I9GA 1N48A 4EBEA 4RQ8A 8ICWA 3ISBA 4P4PA 1XS9D 1NK6A 1TK0A 3C5GA 1RPLA 4UAZA 2FLLA 1ZQAA 4QZ9A 4DSKA 5KG6A 1BPEA 4R63A 2NRVA 4EEYA 4PH5A 4P4MA 4M9HA 4DL4A 1PZNA 5KFVA 1RYSA 1U45A 4RUCA 1EXNA 3M9MB 5KG5A 4M6WB 4RT2A 1NOMA 2FMQA 5D4BA 1JX4A 4DL2A 4NLZA 5KFJA 3GFKB 3N97B 2FMSA 5D46A 4NY8A 4I2AA 2W9CB 4I29A 4BDPA 2ZTEA 8ICNA 3BQTA 3BDPA 3PO5A 4RNNA 3RRHA 1ZQPA 4PPXA 1B22A 2R8GA 4O3OA 4R65A 4UBBA 2R8KA 3PX4A 4PHEA 4DSLA 4ED1A 3OJSA 1KRPA 2XC9A 1S0OA 5JUMA 1NK0A 2H5XA 5DB7A 4QWEA 4F5OA 4ECTA 1ZQSA 2UVRA 2XCPA 3QZ7A 3V6KA 3KHGA 3TAQA 1T4GA 4RQ6A 7ICUA 4UB3A 3QEBZ 2J6UA 2KZMA 3JPSA 1MQ3A 3GV5B 2NRXA 4J9PA 3SI8A 4DSEA 2ZUBA 1TKDA 4KLGA 3B0YA 1UA0A 1TVAA 2PFPA 4O3NA 1KLNA 7ICVA 3C1ZA 4ED2A 5DLGA 4UB5A 1NK9A 5J0YA 4EBDA 3C2MA 4EZ6A 2KFZA 4YP3A 4R66A 4IRKA 2ZJAA 1TFRA 3ZDEA 4QZBA 2HHQA 7ICNA 1UT8A 1ZQGA 4BXOB 8ICBA 1NJYA 3EWAA 4J9SA 4I2EA 4DOBA 4UAYA 1ZQWA 1U4BA 3GV8B 9ICJA 4YN4A 2IHMA 2BGWA 1S0NA 2UVVA 5IINA 2AU0A 4YCXA 2LYHA 4ECUA 4JWMA 5J2AA 4GXJA 3PY8A 4YFKA 5CHGA 4Z6FA 4M2YA 3Q8SB 3RH5A 4Q8FA 1ZQCA 1WCLA 4O9MA 2KN7A 4NM1A 4ECQA 2BPGA 4G3IA 3RJKA 5DKWA 2W9BA 4O3QA 4XRHA 2PXIA 3QZ8A 3H4BA 5KFLA 3RH4A 4ELUA 4MF8A 3JPQA 3PNCA 5L1KA 1ZQBA 2FLNA 1S77D 5IIOA 9ICXA 1N56A 1TK8A 3UXOA 5J0QA 5CWRA 2Y1JA 4ZH4A 4QW8A 3ZDDA 5DDYA 4BGDA 5KFBA 3H7IA 4DS4A 3TI0A 3HWTA 5KFUA 4NM2A 2AGOA 5DBCA 5KT4A 2OWOA 1ZQMA 2W9MA 2ZUDA 4PGQA 3V72A 4NLNA 3M9OB 4F4KA 3RB3A 4F91B 2BR0A 4ECWA 2BPCA 5KG0A 3ZD8A 1ZQRA 3PO4A 1S76D 4I2DA 5BPCA 1XC9A 2C28A 2A1JA 4F3OA 2PFNA 4O3SA 4F93B 4QZ8A 4DSJA 4DF8A 4ELVA 3Q8MA 1NJZA 5L9XA 5KT2A 1XU4A 1ZQIA 1X9WA 4LZGA 3PVXA 4RNOA 3UPQA 2AGPA 3OHBA 2BQUA 1L3VA 5CJ7A 2FLPA 4ELTA 8ICJA 2JZBA 7ICEA 2XY7A 4ECYA 4TQSA 3GV7B 4F2RA 4PHPA 3LWLA 4JV2A 9ICRA 5KTQA 1NK4A 1ZQTA 5KFZA 1A76A 4TUQA 4KMUA 4F5NA 4DSFA 4ECVA 9ICQA 3RBEA 3ZDAA 4UB2A 4F8RA 2J6SA 3H8JA 4K4HA 1UT5A 4YXJA 5HHHA 5KT3A 1ZQEA 1KFSA 2HVIA 9ICOA 1XSNA 2ASDA 2W8LA 4I27A 3PMNA 2PFQA 2W9AA 3EYZA 3FDSA 5HMLA 9ICUA 5KFCA 4R8UA 2PI5A 1SKRA 4B9VA 1SL2A 5KFNA 1ZQDA 9ICGA 2AQ0A 2HHUA 2BHNA 3T3FA 5KG7A 5KFMA 4I2JA 3EPGA 1S97A 2C2RA 1X9MA 2IBKA 4JV1A 2XCAA 3RJIA 1LB2B 5KG3A 3PW2A 1MSWD 2ASLA 2KZ3A 4O0IA 1LV5A 4F4YA 1QSLA 4I2BA 8ICEA 5KG4A 1Y88A 5KFHA 4M9JA 3OSPA 1SKWA 4RUAA 8ICGA 3MABA 5IIIA 7ICLA 1XO1A 4I2CA 3T5JA 1RZTA 4YD2A 3GQCA 2FPLA 4J9RA 3JPNA 8ICPA 4KLQA 3MFHA 3V7LA 3BJYA 2ISPA 1JMSA 4YMNA 4RQ5A 2KFNA 4IQUA 4MEXA 4M47A 5KFPA 3N4MB 3TFRA 2F1IA 3PW4A 1K1SA 1U48A 3H40A 3RR8A 2NRZA 4JK1A 2XGQA 5DB6A 2JEIA 2ASJA 8ICUA 4QZEA 5J0UA 4FBTA 4QZGA 3FYHA 4F4ZA 1T3NA 4I2FA 5DBAA 5J2FA 4QZDA 9ICEA 4P4OA 1XWLA 2UVUA 3EW9A 1DOQA 3MR6A 5CB1A 1BGXT 8ICMA 4YD1A 1TAUA 9ICSA 4QWAA 3JPPA 4KLUA 4EYHB 5BOLA 5KFIA 4ED8A 4KLOA 4FS1A 2J6TA 3OSNA 3V7KA 3Q8RB 4E0DA 4MFFA 5DQIA 2AQ4A 1KEJA 3PW7A 5J0WA 3PV8A 3ISDA 5HNKA 4MEYA 4ED6A 3T5KA 8ICCA 4GLXA 2DPIA 4M9LA 4Z6CA 5EWFA 5DB8A 2BQRA 8ICQA 2HVHA 5KT5A 9ICWA 5J2KA 1NJXA 3H8SA 5KFSA 1L3SA 4GC6A 4YXMA 2IA6A 4RNMA 2HHXA 3EZ5A 3QE9Y 1JXEA 2W9BB 5KFGA 4RT3A 3G6XA 4DF4A 3GILA 1Z00A 1ZETA 2FPMA 5KG1A 4YR2A 3HX0A 1NJWA 4DS5A 2BCUA 4JUZA 4DL7A 3B0XA 2JEGA 2FMPA 4I2HA 7ICRA 5HHIA 3MR2A 1NKCA 2BCVA 1KFDA 1L3TA 4O5KA 7ICJA 8ICOA 4RQ3A 4IQWA 4DL5A 3PX0A 4DFMA 3IHQB 4C8MA 3SZ2A 4KLDA 4DL6A 1NKEA 2HHTA 4I2GA 9ICIA 1JIHA 3V7JA 9ICFA 5KFWA 1ZJMA 9ICPA 9ICHA 3ISCA 4UB4A 4YR3A 8ICYA 7ICOA 2ZTDA 4RU9A 1HUOA 1B43A 3MGHA 5L1LA 5KFEA 2KZZA 5J2DA 3KHHA 4TUSA 4O3PA 5L1IA 1BPZA 4B9TA 2A1JB 2BCSA 4B9LA 3UQ2A 1SZPA 4DQRA 3RAQA 2BKEA 5CR0A 2KTQA 4K4IA 3K4GA 3SYZA 5D49A 1SL1A 1RXWA 3RJEA 1T7PA 3MGIA 4I2IA 3PW5A 4UBCA 4YMMA 5J2JA 4TQRA 5J2BA 3UQ0A 3Q8LA 4P2HA 4BWJA 3ZDBA 3QEAZ 5CP2A 4GXIA 2JZBB 1ZQLA 2RDIA 4UB1A 3OJUA 1K1QA 7ICSA 4QZCA 3BQ2A 1ZQVA 3JPRA 4O3RA 7ICQA 1NK5A 7ICHA 3MFIA 2AJQA 3RB4A 4DL3A 4F50A 4XUSA 5KFQA 1BPDA 5J0RA 1JXLA 2M9NA 4X5VA 5TZVA 5DGBA 2BQ3A 4RPXA 2C2EA 3UXNA 5J2GA 4KLSA 2IHNA 2RDJA 4Z6EA 3KHLA 4DOCA 4EBCA 3PMLA 1TV9A 4J9KA 2W8KA 4QWCA 1S0VA 8ICXA 5EOZA 4R8UB 2AGQA 5J2HA 2GWSA 8ICFA 4QZIA 1NK7A 4YG2A 1SKSA 4B9MA 3RR7A 4KLIA 2MUTB 3PR5B 4EZ9A 4DQQA 1ZQZA 5DDMA 5J0SA 4Q45A 3C1YA 5KFTA 3RBDA 3THVA 2VA3A 3C2KA 2MUTA 9ICBA 4ECZA 4K4GA 4FBUA 1L3UA 2DPJA 8ICAA 4XA5A 4FS2A 9ICNA 8ICVA 3MR5A 3RH6A 4YMOA 9ICMA 2NRWA 2XY6A 3RJJA 1IM4A 3KHRA 4DOAA 4YVZA 1D8LA 9ICTA 2Y1IA 4KN7A 1U47A 1XSPA 3E2EA 4PHAA 4MFAA 1S10A 3LK9A 1NKBA 1ZQOA 4Q8EA 1ZQNA 5KT6A 2UVWA 8ICKA 5C5JA 4KITB 3ZDCA 2ATLA 4GC7A 5KT7A 1ZQQA 3KTQA 2HW3A 3Q8QB 4NLGA 3MDAA 2ISOA 5J0XA 5EWEA 5F9LA 1BPBA 2F1JA 8ICLA 1QLNA 2BCRA 2ALZA 3RJGA 1X2IA 3RTVA 2Q0ZX 3BQ0A 4RZRA 3MR3A 4PGXA 1D8YA 5IIKA 3AUOA 4O5EA 1KSPA 3M8SA 1S9FA 3M8RA 4UQGA 3SV4A 2JEJA 2V9WA 4IQTA 3ETLA 1WCNA 2BDPA 1BVSA 3K75D 2HHVA 7ICPA 4XQ8A 1CEZA 8ICTA 9ICVA 3PR4A 4M6WA 4LZDA 3ORYA 4J9LA 4PHDA 2MAXA 3T5HA 9ICAA 4F4WA 4ED3A 9ICCA 3H4DA 7ICTA 1V9PA 3V6HA 1RYRA 2W9CA 5KFDA 3SV3A 1KTQA 3OHAA 4RPZA 4RQ2A 4QWDA 3GIIA 3V6JA 1XSLA 4B9SA 3TFSA 4KTQA 5KG2A 4QZHA 3GDXA 4FO6A 7ICGA 4DLEA 1SL0A 3RJFA 4M9GA 5KFKA 3RJHA 5KFFA 3ZD9A 2C2DA 5IIJA 4TUPA 4ECRA 4DO9A 2XY5A 1L5UA 1Z00B 2P6RA 4B9NA 1ZQKA 4C8KA 4QZAA 4DQSA 1HUZA 2BCQA 4F2SA 4BWMA 1BPXA 5J29A 5DLFA 1A77A 2DFLA 2NRTA 3OGUA 5KFAA 4J9OA 4C8OA 4QZFA 3RB0A 1T8EA 1D9DA 2ZTCA 3HPOA 3C21A 4YR0A 5KFYA 5DBBA 4RQ0A 1X9SA 1MQ2A 2R8JA 5J2IA 5J0OA 4DFJA 9ICKA 5F9NA 3LWMA 1MC8A 5DB9A 5DG7A 3NTUA 1QSSA 1U9LA 5DG8A 4J9QA 5IIMA 1ZQJA 3EPIA 1Z3EB 1QTMA 4BXOA 5EWGA 4DFPA 5J0TA 3HP6A 1D9FA 4J9NA 3JPTA 4ED0A 4EYIB 1JN3A 2PI4A 1UA1A 4RQ7A 8ICIA 8ICSA 2ZJ8A 4UAWA 4HYKA 4KN4A 8ICZA 1RXVA 4M9NA 3C23A 1DGSA 3AU2A 5L1JA 5DG9A 2PFOA 4KLHA 1U49A 3HW8A 8ICHA 4DLGA 1ZQFA 5KFRA 3NGDA 4I28A 4DQPA 3G6YA 3PW0A 3JPOA 2V4QA 4C8LA 2XGPA 7ICMA 4KLLA 4IQVA 4F5RA 5KFXA 3RAXA 5J0PA 7ICFA 4NLKA 1HJPA 2F1HA 2HHWA 1ZQYA 4IR1A 2P6UA 5IILA 3C2LA 4NXZA 1NK8A 2ZUCA 3C5FA 1IXRA 4KLEA 3MBYA 2VA2A 5HMMA 1BPYA 4IRCA 1CUKA 5DQHA 3G6VA 4Q43A 2FPKA 2BPFA 4RQ4A 1ZYQA 5HP4A 1S0MA 4Q44A 3TQ1A 4M04A 4KLJA 1TK5A 3TAPA 3BQ1A 4RQ1A 5KFOA
chains in the Genus database with same CATH superfamily
2F3NA 4Z6DA 4F5QA 1KDHA 7ICKA 4KLTA 4MF2A 3GIKA 1SIJA 2ZG6A 3IM1A 3LDAA 3MDCA 4JV0A 5J2CA 1TAQA 2V4RA 3QU7A 2B21A 1C7YA 1ZRNA 1X42A 5AKXA 3GU3A 1H38A 4KLFA 2KD1A 2WFAA 5GTHU 1QH9A 5J2EA 2G5IB 4B9UA 3IG8A 5AKZA 4C0ZA 4CCHA 1COOA 3QU9A 2BDUA 4ECXA 3NVWA 4M0AA 2I1QA 3T79A 3PX6A 2JEFA 4JWNA 2FDRA 4YQWA 1ZQHA 4TURA 1N48A 2E5SA 3ISBA 4HAIA 2NRVA 3MGVA 3QUQA 4DL4A 1RYSA 2K60A 1U45A 1KL9A 5KG5A 1S5LU 5D4BA 1JX4A 4CF4A 5AM0A 5KFJA 3N97B 5ALEA 3NVVA 4BDPA 2ZTEA 3BQTA 4Y2VA 1ZQPA 1NZBA 2JMGA 2ZIVA 4PHEA 1WUDA 3OJSA 4ED1A 4A8EA 3MC1A 2H5XA 5DB7A 3QZ7A 3DDHA 3V6KA 1T4GA 3OPXA 1MQ3A 3GV5B 4J9PA 3SI8A 2ZUBA 4KLGA 2ZIXB 1JROA 1OW5A 5AKHA 1KLNA 5DLGA 2YX8A 5J0YA 2ZIXA 2WAQC 1P7DA 1TFRA 3ZDEA 1UT8A 1ZQGA 4DOBA 9ICJA 2D3DA 2BGWA 5IINA 4YCXA 1MN8A 5J2AA 1IIPA 1SZHA 3RH5A 1ZQCA 1Z19A 5ALQA 2W9BA 2PXIA 3JPQA 4UW9A 2E3TA 1XO0A 2B0CA 1S77D 2E8PA 1TK8A 3FC4A 4AP9A 3UXOA 5J0QA 4QW8A 3QNMA 5DBCA 5KT4A 2ZUDA 4PGQA 4NLNA 3M9OB 4F4KA 3RB3A 3PO4A 1XC9A 4QZ8A 5JTIA 3QU4A 1AQ6A 3WKBA 1ZQIA 2YB4A 1SXDA 3PSPA 5CJ7A 2FLPA 7ICEA 3N28A 2XY7A 4ECYA 4UARA 3GV7B 4F2RA 9ICRA 1ZQTA 1C20A 3RBEA 3ZDAA 4AYBF 2DF4B 5HHHA 2KP7A 1ZQEA 2HVIA 9ICOA 5KAIU 4U6PA 2HDOA 1XSNA 4NWIA 5GTIU 3PMNA 2W9AA 1SKRA 4UAUA 9ICGA 3T3FA 5KG7A 2KJ5A 3M1YA 1RM6C 2FE9A 4F4YA 4I2BA 2IOFK 3OSPA 1RG6A 7ICLA 1L7OA 3K1ZA 1VLBA 2KIWA 1RZTA 4YD2A 3GQCA 2FPLA 3V7LA 3BJYA 2ISPA 1VJ5A 4UATA 5B66U 2KFNA 5KFPA 1U48A 3H40A 4JK1A 5DB6A 2ASJA 4F4ZA 3FYHA 5DBAA 5J2FA 5B5EU 5CB1A 4YD1A 9ICSA 4KLUA 3A0HU 2ZXIA 5AM3A 4P0PB 5DQIA 8ICCA 2QLTA 2DPIA 2LM4A 1NJXA 3H8SA 5KFSA 4GC6A 2XVTA 4RNMA 3EZ5A 3QE9Y 1JXEA 4OJPA 3WKAA 4Y2SA 1KQQA 2FPMA 5KG1A 3CYMA 4DS5A 2BCUA 4I2HA 3WK6A 2EZYA 7ICRA 2H3FA 5KL8B 1NKCA 2BCVA 1KFDA 1Z1BA 2KKVA 3RFAA 4I2GA 3ISCA 5ALGA 7ICOA 2E1FA 4RU9A 5KFEA 2OEHA 5J2DA 2E1EA 4B9TA 1PVQA 4NJ8A 1SZPA 2KTQA 3RJEA 1T7PA 2KHVA 3MGIA 4UBCA 4ACOA 2KK0A 2QB0B 4YMMA 5CP2A 1ZQLA 2EAOA 2RDIA 4GFJA 3OJUA 1K1QA 2F76X 4QZCA 1NK5A 5ALRA 7ICHA 5ALUA 3S6JA 1JXLA 5KFQA 4BJQA 2HMXA 3EUB2 5DGBA 3C29A 2IHNA 1TV9A 4J9KA 4QWCA 1F0MA 2G07A 4R8UB 2DQNB 1NK7A 4KLIA 4DQQA 1ZQZA 5DDMA 1SWWA 2WF7A 5KFTA 4Y2PA 1L3UA 8ICVA 3RH6A 2NRWA 3KHRA 1XNSA 4YVZA 1D8LA 2Y1IA 3E2EA 3AN1A 4MFAA 3WK8A 3E58A 1ZQNA 5KT6A 2ATLA 5KT7A 3KTQA 3MDAA 8ICLA 2K4EA 5ALSA 3H0MB 3RTVA 2Q0ZX 3CP8A 3BQ0A 4O5EA 1KSPA 5KL1B 4F72A 4Y2YA 2LMRA 2V9WA 7ICPA 5AI5A 1CEZA 8ICTA 9ICVA 1IV8A 3QU5A 9ICAA 1F44A 4ED3A 1V9PA 5KFDA 2CXYA 4ICAA 3L4PA 2YN4A 1O03A 3SR6A 1SL0A 1X6IA 5KFKA 4PZNA 1L5UA 2JEIA 2DL0A 1N61A 1SGGA 1BPXA 1A77A 2NRTA 3OGUA 5KFAA 4J9OA 4QIWC 3UM9A 5KFYA 4DFJA 5J0OA 9ICKA 1TE2A 2RQ5A 4JMUA 2RRDA 4PL2A 5DG8A 1ZQJA 1Z3EB 1QTMA 4BXOA 5EWGA 1URJA 3UMCA 8ICIA 2E8OA 1UA1A 3NUQA 2ESEA 2K4PA 2ZJ8A 1V85A 2AHOB 4HYKA 2DGZA 3L5KA 2EANA 4M9NA 5KNIA 5DG9A 1U49A 3HW8A 5EE0A 4DLGA 2JH7A 7ICMA 5AKKA 4IQVA 4F5RA 2AXTU 2HHWA 3SENA 3KKAA 1NK8A 1IXRA 4OJLA 1RDFA 5ALTA 4NY8A 4RQ1A 1TAUA 3UXPA 2ZJ5A 2RP5A 2MSNA 3SAHA 3KOOA 4J9MA 3T5LA 2K4IA 5AM2A 3Q8KA 2XI9A 2WTFA 3I76A 4F5PA 5AKIA 4PGYA 3N7SC 3FAHA 1NI3A 4RPYA 3GIJA 4F4XA 3PSFA 4P0QB 4C8NA 1QSYA 5DQGA 2XO7A 1N2XA 5BOMA 3RRGA 3SAFA 2HHSA 2E8NA 4DFKA 4Y2UA 8ICRA 2R8HA 1ZQXA 5DGAA 9ICLA 2I9GA 4RQMA 4P4PA 3C5GA 1ZQAA 2ODGA 5KG6A 3UMBA 4KMOB 4EEYA 4PH5A 4M9HA 2EH9A 5ALJA 4M6WB 1NOMA 2FMQA 2YMQA 5D46A 1LKYA 4I2AA 4I29A 8ICNA 3BDPA 3PO5A 4RNNA 3RRHA 4O3OA 1JUDA 1JALA 4DSLA 3KFUF 2VJ5A 1KRPA 4QWEA 1B0XA 5FP0A 2QB1A 4RQ6A 2KICA 1NNLA 2KZMA 2DKXA 1J2MA 2KJ8A 2PFPA 1A6SA 1NK9A 4EZ6A 2KFZA 2GH1A 4CRXA 2PMZC 2ZJAA 4QZBA 4UB8U 3EWAA 4I2EA 1U4BA 4YN4A 2HI0A 1S0NA 3FM9A 3I28A 5EE1A 4GXJA 4QIWF 1PVPA 3PY8A 1X9XA 2DWQA 4Z6FA 2GO7A 2YB1A 3Q8SB 4Q8FA 2BPGA 2W54A 4O3QA 1K5OA 2G5HB 5L1KA 2FLNA 9ICXA 1N56A 2ZIWA 4ZH4A 5KFBA 5KFUA 2LKYA 2AGOA 1DRGA 3QYPA 3TADC 2KSOB 2QKQA 5KG0A 1S76D 4I2DA 4F3OA 5J8YC 2A1JA 5AKGA 2PFNA 4O3SA 4F93B 3LVVA 5AKJA 4DF8A 3Q8MA 2FI1A 2KSOA 5KT2A 1X9WA 1JRPA 3PVXA 4RNOA 2BQUA 1L3VA 3HKZF 4ELTA 3F5EA 2JZBA 4US9A 2EZZA 3WK9A 4JV2A 2O6KA 1A76A 4OD0A 4KMUA 5CEHA 4TUQA 4DSFA 4K4HA 1UT5A 1KFSA 2XICA 2PFQA 3FDSA 2PI5A 2ZXHA 1ZQDA 2AQ0A 1GO3F 2HHUA 4UAVA 5KFMA 4I2JA 2C2RA 4JV1A 3RJIA 1LB2B 4O0IA 1UHUA 2G06A 1LV5A 1QSLA 5KG4A 1Y88A 3CW2C 4RUAA 3H0LB 8ICGA 1SWVA 1XO1A 1L7PA 2ZIVB 3WK4A 2KG5A 1JMSA 2JRZA 3QXGA 4MEXA 3PW4A 2H3QA 2MA1A 3RR8A 2M0NA 2XGQA 8ICUA 2WF8A 4FBTA 4QZGA 4I2FA 4P4OA 1XWLA 4QWAA 3JPPA 5KFIA 1DK3A 5AKLA 4FS1A 1KEJA 1DXSA 2OHFA 4C7YA 4GLXA 1A0PA 3U26A 3LVWA 1L3SA 2W9BB 4RT3A 4DF4A 2IOFA 1ZETA 4YR2A 5H2FU 1NJWA 4OJ5A 2JEGA 2FMPA 4C4TA 1ZD3A 7ICJA 3QUBA 8ICOA 4RQ3A 2W03A 4IQWA 4DL6A 9ICIA 2HHTA 9ICFA 4UB4A 2EDUA 4EENA 2KVCA 5AKEA 3KHHA 4O3PA 5L1IA 3QU2A 5C0YA 3RAQA 4K4IA 3SYZA 5D49A 2A3VA 3PW5A 3Q8LA 4GXIA 7ICSA 2WHEA 3BQ2A 1ZQVA 3JPRA 4O3RA 7ICQA 2Y9UA 5E79U 2AJQA 3LYSA 2KOBA 1BPDA 1V38A 4X5VA 1HIWA 3UXNA 4Z6EA 3KHLA 2LI6A 2OCEA 8ICXA 2LYBA 3BZKA 5EOZA 4C7ZA 5J2HA 4EZ9A 3RBDA 3THVA 4ECZA 2DPJA 4XA5A 4FS2A 1Q3VA 3MR5A 4YMOA 3RJJA 4DOAA 9ICTA 4KN7A 3IRUA 1XSPA 4PHAA 1NKBA 2LBOA 4KITB 3ZDCA 4GC7A 4FZMA 3ONNA 1FO4A 4NLGA 2ISOA 5F3XB 5F9LA 1BPBA 2F1JA 4US8A 1QLNA 3RJGA 3MR3A 4PGXA 1D8YA 5IIKA 3AUOA 1OXJA 1WCNA 3K75D 5JRTA 5EE9A 1N5XA 4LZDA 3IV6A 3ORYA 2MAXA 4EEKA 4F4WA 3AEVA 7ICTA 2NV3A 3V6HA 2W9CA 3GIIA 3TFSA 2P6RA 4B9NA 5IIJA 4TUPA 2XY5A 1J2NA 1SXEA 4C8KA 4QZAA 4DQSA 2BCQA 2D6FC 4BWMA 3ALRA 5J29A 2WAQF 1MA7A 4QZFA 1T8EA 1D9DA 2ZTCA 5L1MA 3C21A 4YR0A 1BNPA 2Y9TA 2R8JA 3LWMA 1MC8A 4IC9A 1CRXA 5IIMA 4MHVA 4OJ6A 3QUTA 4CF3A 4J9NA 2H3VA 2DUYA 4UAWA 2KVSA 3C23A 2E8MA 3NVZA 5L1JA 2PFOA 5ALYA 2WF5A 1UPHA 1T3QA 2F2AB 5ALLA 2WF6A 4C8LA 4KLLA 5KFXA 1HJPA 2F1HA 1ZQYA 4IR1A 3MBYA 2VA2A 1CUKA 4ZOHC 4RQ4A 1TK5A 3TAPA 4DCCA 2JV3A 4KLMA 4F92B 5ALXA 7ICIA 4DEZA 2VA8A 4LVSA 4ED7A 2JR5A 3Q8PB 4Y2QA 4IR9A 2R8IA 4FE3A 1ZQUA 4GXKA 2VANA 5CA7A 3RB6A 1ZJNA 5ALNA 2P66A 2C22A 2IMWP 1AROP 3KBBA 3M9NB 4DQIA 4O5CA 3TANA 4MFCA 4RQ8A 2W11A 1TK0A 4QZ9A 4R63A 4BUGA 3WK7A 4P4MA 1PZNA 4RUCA 2KV2A 3M9MB 2LYAA 4RT2A 5G5GA 4NLZA 4RQNA 3GFKB 5AK5A 2K8CB 4PPXA 3NRZA 1B22A 2R8GA 2A19A 4UBBA 2R8KA 3PX4A 3WKEA 3VC8A 1ZD2P 1NK0A 2MRLA 4F5OA 1ZQSA 4ECTA 2UVRA 2XCPA 1Z4NA 3TAQA 7ICUA 3QEBZ 2F77X 4DSEA 1TKDA 1UA0A 3O0FA 2P35A 2PKEA 4UB5A 4EBDA 3C2MA 1Q3UA 4R66A 4IRKA 7ICNA 2HHQA 2K8BB 4BXOB 5AI0A 8ICBA 1NJYA 4J9SA 5CRXA 2HCFA 3GV8B 2IHMA 5ALVA 2UVVA 2OXOA 2AU0A 2LYHA 4ECUA 2JHDA 3PZPA 4M2YA 2Y0SC 2KN7A 1B4FA 4NM1A 5DKWA 3RH4A 3QZ8A 3H4BA 1ZD5A 2EAPA 2YMLA 4IS7A 2WB1C 2Y1JA 3ZDDA 5DDYA 4DS4A 3KZIU 1F5SA 2F8LA 3TI0A 5AK3A 1ZRMA 4NM2A 2KE7A 5AI8A 5AKYA 2FJ6A 1SV0C 2W9MA 3V72A 4CGZA 3IG5A 2JH1A 4F91B 3ZD8A 1ZQRA 1YZ7A 5BPCA 2C28A 2GLEA 3D2NA 1NJZA 3OHBA 3F53A 1FEZA 4UB6U 2KHQA 4PHPA 1COKA 1KN5A 1NK4A 5KFZA 4F5NA 3BZCA 3ETRA 2YY6A 2J6SA 4YXJA 5KT3A 2W3RA 2R18A 1RQLA 5EE3A 2I6XA 5HMLA 3SQIA 4B9VA 1SL2A 3TADA 2W7OA 5KFNA 4GIBA 2EZXA 5ALMA 2BHNA 5J8YA 3EPGA 2IBKA 1X9MA 1HEKA 1MSWD 3PW2A 2ASLA 4NLCA 8ICEA 1LKYB 2NO4A 3MABA 5TISU 2JXJA 2RLTA 2G08A 3WU2U 3JPNA 1Z1VA 3ZI4A 4KLQA 3MFHA 4YMNA 4RQ5A 3ED5A 3TFRA 1RQNA 2F1IA 4QZEA 5J0UA 1PK1A 1T3NA 9ICEA 3EW9A 3K1RB 1DOQA 3MR6A 8ICMA 1KKXA 5BOLA 5KAFU 1PVRA 2J6TA 3OSNA 5ALHA 3V7KA 3Q8RB 2AQ4A 3PW7A 3PV8A 3AQEA 2Q4TA 5HNKA 4MEYA 4ED6A 3T5KA 4Z6CA 5ALFA 5DB8A 5KT5A 2NO5A 1ECWA 2IA6A 4OO1J 3G6XA 5KFGA 1V97A 1Z00A 3OTQA 3HX0A 4DL7A 3B0XA 1FFVA 5HHIA 2ZIWB 1L3TA 4DL5A 3PX0A 3TACB 4DFMA 3SZ2A 1N60A 1JIHA 1X66A 9ICHA 3N7RC 2Y0SF 8ICYA 5HR7A 1HUOA 1B43A 3WKDA 1Q46A 2ZIUB 3SAGA 1BPZA 2A1JB 2BCSA 4B9LA 2BKEA 4NL9C 3K4GA 1SL1A 1RXWA 2ZIUA 3DEEA 5J2JA 4TQRA 5J2BA 3UQ0A 4BWJA 3QEAZ 2JZBB 3D2SA 4DL3A 3M7DA 4F50A 4XUSA 2HOFA 2BQ3A 4RPXA 4C4RA 3PMLA 2W8KA 3N7PD 2HBJA 2HBLA 2GWSA 5ALKA 4AYBC 8ICFA 4QZIA 4EELA 3RR7A 2MUTB 3UMGA 3PR5B 5J0SA 4NLBA 2VA3A 2MUTA 9ICBA 8ICAA 4FBUA 3BS7A 3M6ZA 4QJFB 2QARB 2XY6A 3RF9A 1IM4A 1U47A 2QARA 5AI9A 2OH2A 4Y2JA 3I1YA 4UASA 2BZFA 2W55A 3LK9A 4Q8EA 2UVWA 8ICKA 1ZQQA 3Q8QB 3AM9A 3SEIA 4PZOA 2BCRA 2ALZA 1L7MA 2HSZA 4RZRA 2CPRA 1S9FA 4UQGA 1X40A 2F8KA 4IQTA 3ETLA 1BVSA 2HHVA 4XQ8A 2KEYA 1D8BA 1VDVA 4PHDA 2K8AA 3T5HA 1CI4A 1SV4A 4RPZA 4QWDA 4B9SA 1XSLA 3GZFA 7ICVA 2CN1A 4QZHA 3NVYA 2I5HA 3GDXA 4FO6A 7ICGA 3RJFA 5K4LA 5AICA 3ZD9A 2C2DA 2HOIA 2AH5A 4C80A 1HUZA 5T14A 3DV9A 2PMZF 3NS1A 4C8OA 5AK6A 3HPOA 4RQ0A 1X9SA 3NTUA 1QSSA 1U9LA 3H8MA 4J9QA 3EPIA 5HR6A 5J0TA 2PI4A 1JN3A 4OCZA 4RQ7A 5AM4A 2MU2A 4KN4A 3AU2A 4KLHA 4PL1A 8ICHA 1ZQFA 5KFRA 3NGDA 1YT3A 3G6YA 1RYUA 3JPOA 1M6YA 3RAXA 5J0PA 7ICFA 4NLKA 2KIVA 2P6UA 2ZUCA 1QQ5A 4KLEA 5HMMA 3G6VA 3BS5B 1ZYQA 5HP4A 2A1AA 3BQ1A 3M6KA 3BS5A 3SD7A 5ALIA 3HT3A 3TARA 2L5YA 3HILA 4IRDA 3BQ7A 4QW9A 3GIMA 1J97A 5AM1A 4DWIA 4DSIA 4R64A 3H8WA 3AU6A 2RHFA 4QWBA 3IP4B 4KX5A 4ECSA 1YZ6A 1KBUA 1KFTA 2NYVA 4EBEA 8ICWA 1XS9D 1NK6A 1RPLA 4UAZA 5AK4A 4DSKA 1BPEA 2K89A 5AHXA 2XIDA 5KFVA 1EXNA 3AL0B 3NRWA 2EAMA 4DL2A 2FMSA 2F44A 2W9CB 4R65A 2YQEA 4JB3A 5ALWA 2W3SA 2XC9A 1S0OA 5A0LA 5JUMA 2HBMA 5ALOA 3KHGA 4UB3A 2J6UA 3JPSA 3F5AA 2NRXA 1JI7A 3B0YA 1TVAA 4O3NA 3C1ZA 4ED2A 1S8OA 2W43A 2VIXA 4YP3A 2HBKA 2YTUA 4FFDA 4P0PA 3AQFA 4UAYA 1ZQWA 2IOHA 1SB3C 4KX3A 4JWMA 3HRDD 3F2DA 3E0FA 4YFKA 1PUZA 4F71A 2G09A 5CHGA 3WKCA 1WCLA 4O9MA 4G3IA 4ECQA 3RJKA 4XRHA 1Z4OA 3CNHA 5KFLA 1QQ6A 4ELUA 4MF8A 3PNCA 4BX9C 1ZQBA 5IIOA 1L7NA 5CWRA 4BGDA 3H7IA 3HWTA 1L6NA 2OM6A 2OWOA 1ZXIA 1ZQMA 4USAA 2BR0A 4ECWA 2DBYA 2BPCA 2LHTA 4DSJA 4ELVA 5L9XA 1XU4A 4O3MA 5JU5A 4LZGA 1L8OA 2QB0A 3UPQA 2AGPA 8ICJA 2LPEA 4TQSA 2W7PA 3ICXA 3LWLA 2JGAA 5KTQA 1FIQA 4ECVA 9ICQA 2VJ4A 4UB2A 4F8RA 3H8JA 3CRXA 3PSTA 2ASDA 2W8LA 4I27A 2WF9A 3H0RB 3EYZA 2EQYA 1SV0A 9ICUA 5KFCA 4R8UA 5ALPA 1N62A 2KMDA 2ES6A 1S97A 4CNQA 2XCAA 4FZLA 5KG3A 2KZ3A 2W04A 1ZOLA 5KFHA 4M9JA 1SKWA 5IIIA 5AIBA 4I2CA 3T5JA 2Z7JA 4PJ0U 4J9RA 3KZXA 2N1RA 8ICPA 3TKAA 2VKQA 3L3FX 3IN5A 4IQUA 5AM5A 4M47A 3N4MB 1K1SA 4U7CA 2NRZA 3D2QA 1QCKA 4QZDA 2UVUA 1BGXT 4EYHB 4CDGA 4ED8A 5ALZA 4KLOA 1WYGA 5G5HA 1L8LA 4E0DA 4MFFA 3QUCA 5J0WA 3ISDA 1DK2A 4M9LA 1UQVA 5EWFA 2BQRA 3B9JA 8ICQA 2HVHA 9ICWA 5J2KA 2CRXA 1NZPA 2HOQA 2HHXA 4YXMA 3GILA 2B6GA 1DGJA 4C4SA 4JUZA 3WK5A 3MR2A 4O5KA 2OYYA 4G9BA 3IHQB 4C8MA 4KLDA 1ZQ1C 1NKEA 3V7JA 5KFWA 1ZJMA 4B6JA 9ICPA 4YR3A 3KD3A 1N63A 2DKZA 2ZTDA 3MGHA 5L1LA 2KZZA 1WWUA 4TUSA 3UQ2A 1FFUA 4DQRA 2KKPA 3A0BU 5CR0A 3R9KA 4I2IA 4IL6U 4P2HA 1UCVA 3ZDBA 4UB1A 1OUQA 4Y2RA 3MFIA 3RB4A 5J0RA 2M9NA 3IDWA 5TZVA 2C2EA 3HKZC 4KLSA 5J2GA 2RDJA 4DOCA 4EBCA 1S0VA 3NASA 2AGQA 5AI6A 4YG2A 1SKSA 2KJ9A 4B9MA 3SMVA 4Q45A 4NL9A 2YMMA 3C1YA 3C2KA 5AI4A 4K4GA 3C28A 2GOLA 9ICNA 9ICMA 1KW4A 4P0QA 3AMZA 4WJ3B 1S10A 1ZQOA 4FZNA 5C5JA 2HW3A 5J0XA 5EWEA 3VCBA 1WWVA 1BNOA 1LVHA 1X2IA 1ED1A 1PK1B 3D6JA 3M8SA 3M8RA 3QX7A 4EX7A 3SV4A 1O08A 2JEJA 2BDPA 4Y2TA 3PR4A 4M6WA 3F2CA 4J9LA 3F2BA 9ICCA 4LJXA 3H4DA 4CE6A 1RYRA 1TAMA 3SV3A 1IG6A 1KTQA 3OHAA 3V6JA 4RQ2A 4KTQA 5KG2A 4CF5A 3J81j 2LM1A 4DLEA 4M9GA 3RJHA 5KFFA 4ECRA 4DO9A 1Z00B 5AIAA 2K4HA 1ZQKA 4F2SA 1QQ7A 4EX6A 2DFLA 5DLFA 3RB0A 3KKAC 5DBBA 2H3ZA 1MQ2A 5J2IA 5F9NA 5DG7A 5DB9A 2YMPA 3PSIA 1T94A 4DFPA 3HJEA 3HP6A 1D9FA 4ED0A 3JPTA 4EYIB 1Q8KA 8ICSA 1PK3A 4NV0A 8ICZA 1RXVA 1DGSA 2H3IA 2KNJA 1N5WA 1X6JA 1ZD4A 2WB1F 4DFDA 1WG8A 4DQPA 4I28A 3PW0A 4Y2XA 2V4QA 2XGPA 5ALDA 4QNLA 4J03A 5IILA 3C2LA 4NXZA 4OJOA 3C5FA 1BPYA 2G0AA 4IRCA 5DQHA 2BPFA 4Q43A 2FPKA 4KLJA 1S0MA 4Q44A 3TQ1A 4M04A 2FLLA 5KFOA 2D8CA
chains in the Genus database with same CATH topology
4Z6DA 4F5QA 1KDHA 7ICKA 4KLTA 4KLMA 4MF2A 3UXPA 3HT3A 3GIKA 2ZJ5A 3TARA 4F92B 3LDAA 3IM1A 7ICIA 3MDCA 4JV0A 5J2CA 4DEZA 4IRDA 1TAQA 3GIMA 4QW9A 2V4RA 2B21A 1C7YA 2VA8A 4J9MA 3T5LA 4DWIA 4LVSA 1H38A 4ED7A 4KLFA 3Q8KA 4R64A 3Q8PB 2WTFA 4DSIA 4IR9A 4F5PA 4PGYA 3H8WA 2R8IA 3AU6A 1ZQUA 4GXKA 2VANA 4RPYA 3GIJA 5CA7A 5J2EA 4F4XA 3RB6A 4QWBA 1ZJNA 4B9UA 2P66A 4CCHA 4C8NA 2C22A 1QSYA 2IMWP 5DQGA 1COOA 2XO7A 1AROP 4ECXA 3M9NB 4DQIA 4M0AA 5BOMA 4O5CA 2I1QA 3RRGA 2HHSA 3TANA 3PX6A 2JEFA 4JWNA 4ECSA 4DFKA 8ICRA 4YQWA 2R8HA 1ZQHA 4TURA 1ZQXA 5DGAA 4MFCA 9ICLA 1KFTA 2I9GA 1N48A 4EBEA 4RQ8A 8ICWA 3ISBA 4P4PA 1XS9D 1NK6A 1TK0A 3C5GA 1RPLA 4UAZA 2FLLA 1ZQAA 4QZ9A 4DSKA 5KG6A 1BPEA 4R63A 2NRVA 4EEYA 4PH5A 4P4MA 4M9HA 4DL4A 1PZNA 5KFVA 1RYSA 1U45A 4RUCA 1EXNA 3M9MB 5KG5A 4M6WB 4RT2A 1NOMA 2FMQA 5D4BA 1JX4A 4DL2A 4NLZA 5KFJA 3GFKB 3N97B 2FMSA 5D46A 4NY8A 4I2AA 2W9CB 4I29A 4BDPA 2ZTEA 8ICNA 3BQTA 3BDPA 3PO5A 4RNNA 3RRHA 1ZQPA 4PPXA 1B22A 2R8GA 4O3OA 4R65A 4UBBA 2R8KA 3PX4A 4PHEA 4DSLA 4ED1A 3OJSA 1KRPA 2XC9A 1S0OA 5JUMA 1NK0A 2H5XA 5DB7A 4QWEA 4F5OA 4ECTA 1ZQSA 2UVRA 2XCPA 3QZ7A 3V6KA 3KHGA 3TAQA 1T4GA 4RQ6A 7ICUA 4UB3A 3QEBZ 2J6UA 2KZMA 3JPSA 1MQ3A 3GV5B 2NRXA 4J9PA 3SI8A 4DSEA 2ZUBA 1TKDA 4KLGA 3B0YA 1UA0A 1TVAA 2PFPA 4O3NA 1KLNA 7ICVA 3C1ZA 4ED2A 5DLGA 4UB5A 1NK9A 5J0YA 4EBDA 3C2MA 4EZ6A 2KFZA 4YP3A 4R66A 4IRKA 2ZJAA 1TFRA 3ZDEA 4QZBA 2HHQA 7ICNA 1UT8A 1ZQGA 4BXOB 8ICBA 1NJYA 3EWAA 4J9SA 4I2EA 4DOBA 4UAYA 1ZQWA 1U4BA 3GV8B 9ICJA 4YN4A 2IHMA 2BGWA 1S0NA 2UVVA 5IINA 2AU0A 4YCXA 2LYHA 4ECUA 4JWMA 5J2AA 4GXJA 3PY8A 4YFKA 5CHGA 4Z6FA 4M2YA 3Q8SB 3RH5A 4Q8FA 1ZQCA 1WCLA 4O9MA 2KN7A 4NM1A 4ECQA 2BPGA 4G3IA 3RJKA 5DKWA 2W9BA 4O3QA 4XRHA 2PXIA 3QZ8A 3H4BA 5KFLA 3RH4A 4ELUA 4MF8A 3JPQA 3PNCA 5L1KA 1ZQBA 2FLNA 1S77D 5IIOA 9ICXA 1N56A 1TK8A 3UXOA 5J0QA 5CWRA 2Y1JA 4ZH4A 4QW8A 3ZDDA 5DDYA 4BGDA 5KFBA 3H7IA 4DS4A 3TI0A 3HWTA 5KFUA 4NM2A 2AGOA 5DBCA 5KT4A 2OWOA 1ZQMA 2W9MA 2ZUDA 4PGQA 3V72A 4NLNA 3M9OB 4F4KA 3RB3A 4F91B 2BR0A 4ECWA 2BPCA 5KG0A 3ZD8A 1ZQRA 3PO4A 1S76D 4I2DA 5BPCA 1XC9A 2C28A 2A1JA 4F3OA 2PFNA 4O3SA 4F93B 4QZ8A 4DSJA 4DF8A 4ELVA 3Q8MA 1NJZA 5L9XA 5KT2A 1XU4A 1ZQIA 1X9WA 4LZGA 3PVXA 4RNOA 3UPQA 2AGPA 3OHBA 2BQUA 1L3VA 5CJ7A 2FLPA 4ELTA 8ICJA 2JZBA 7ICEA 2XY7A 4ECYA 4TQSA 3GV7B 4F2RA 4PHPA 3LWLA 4JV2A 9ICRA 5KTQA 1NK4A 1ZQTA 5KFZA 1A76A 4TUQA 4KMUA 4F5NA 4DSFA 4ECVA 9ICQA 3RBEA 3ZDAA 4UB2A 4F8RA 2J6SA 3H8JA 4K4HA 1UT5A 4YXJA 5HHHA 5KT3A 1ZQEA 1KFSA 2HVIA 9ICOA 1XSNA 2ASDA 2W8LA 4I27A 3PMNA 2PFQA 2W9AA 3EYZA 3FDSA 5HMLA 9ICUA 5KFCA 4R8UA 2PI5A 1SKRA 4B9VA 1SL2A 5KFNA 1ZQDA 9ICGA 2AQ0A 2HHUA 2BHNA 3T3FA 5KG7A 5KFMA 4I2JA 3EPGA 1S97A 2C2RA 1X9MA 2IBKA 4JV1A 2XCAA 3RJIA 1LB2B 5KG3A 3PW2A 1MSWD 2ASLA 2KZ3A 4O0IA 1LV5A 4F4YA 1QSLA 4I2BA 8ICEA 5KG4A 1Y88A 5KFHA 4M9JA 3OSPA 1SKWA 4RUAA 8ICGA 3MABA 5IIIA 7ICLA 1XO1A 4I2CA 3T5JA 1RZTA 4YD2A 3GQCA 2FPLA 4J9RA 3JPNA 8ICPA 4KLQA 3MFHA 3V7LA 3BJYA 2ISPA 1JMSA 4YMNA 4RQ5A 2KFNA 4IQUA 4MEXA 4M47A 5KFPA 3N4MB 3TFRA 2F1IA 3PW4A 1K1SA 1U48A 3H40A 3RR8A 2NRZA 4JK1A 2XGQA 5DB6A 2JEIA 2ASJA 8ICUA 4QZEA 5J0UA 4FBTA 4QZGA 3FYHA 4F4ZA 1T3NA 4I2FA 5DBAA 5J2FA 4QZDA 9ICEA 4P4OA 1XWLA 2UVUA 3EW9A 1DOQA 3MR6A 5CB1A 1BGXT 8ICMA 4YD1A 1TAUA 9ICSA 4QWAA 3JPPA 4KLUA 4EYHB 5BOLA 5KFIA 4ED8A 4KLOA 4FS1A 2J6TA 3OSNA 3V7KA 3Q8RB 4E0DA 4MFFA 5DQIA 2AQ4A 1KEJA 3PW7A 5J0WA 3PV8A 3ISDA 5HNKA 4MEYA 4ED6A 3T5KA 8ICCA 4GLXA 2DPIA 4M9LA 4Z6CA 5EWFA 5DB8A 2BQRA 8ICQA 2HVHA 5KT5A 9ICWA 5J2KA 1NJXA 3H8SA 5KFSA 1L3SA 4GC6A 4YXMA 2IA6A 4RNMA 2HHXA 3EZ5A 3QE9Y 1JXEA 2W9BB 5KFGA 4RT3A 3G6XA 4DF4A 3GILA 1Z00A 1ZETA 2FPMA 5KG1A 4YR2A 3HX0A 1NJWA 4DS5A 2BCUA 4JUZA 4DL7A 3B0XA 2JEGA 2FMPA 4I2HA 7ICRA 5HHIA 3MR2A 1NKCA 2BCVA 1KFDA 1L3TA 4O5KA 7ICJA 8ICOA 4RQ3A 4IQWA 4DL5A 3PX0A 4DFMA 3IHQB 4C8MA 3SZ2A 4KLDA 4DL6A 1NKEA 2HHTA 4I2GA 9ICIA 1JIHA 3V7JA 9ICFA 5KFWA 1ZJMA 9ICPA 9ICHA 3ISCA 4UB4A 4YR3A 8ICYA 7ICOA 2ZTDA 4RU9A 1HUOA 1B43A 3MGHA 5L1LA 5KFEA 2KZZA 5J2DA 3KHHA 4TUSA 4O3PA 5L1IA 1BPZA 4B9TA 2A1JB 2BCSA 4B9LA 3UQ2A 1SZPA 4DQRA 3RAQA 2BKEA 5CR0A 2KTQA 4K4IA 3K4GA 3SYZA 5D49A 1SL1A 1RXWA 3RJEA 1T7PA 3MGIA 4I2IA 3PW5A 4UBCA 4YMMA 5J2JA 4TQRA 5J2BA 3UQ0A 3Q8LA 4P2HA 4BWJA 3ZDBA 3QEAZ 5CP2A 4GXIA 2JZBB 1ZQLA 2RDIA 4UB1A 3OJUA 1K1QA 7ICSA 4QZCA 3BQ2A 1ZQVA 3JPRA 4O3RA 7ICQA 1NK5A 7ICHA 3MFIA 2AJQA 3RB4A 4DL3A 4F50A 4XUSA 5KFQA 1BPDA 5J0RA 1JXLA 2M9NA 4X5VA 5TZVA 5DGBA 2BQ3A 4RPXA 2C2EA 3UXNA 5J2GA 4KLSA 2IHNA 2RDJA 4Z6EA 3KHLA 4DOCA 4EBCA 3PMLA 1TV9A 4J9KA 2W8KA 4QWCA 1S0VA 8ICXA 5EOZA 4R8UB 2AGQA 5J2HA 2GWSA 8ICFA 4QZIA 1NK7A 4YG2A 1SKSA 4B9MA 3RR7A 4KLIA 2MUTB 3PR5B 4EZ9A 4DQQA 1ZQZA 5DDMA 5J0SA 4Q45A 3C1YA 5KFTA 3RBDA 3THVA 2VA3A 3C2KA 2MUTA 9ICBA 4ECZA 4K4GA 4FBUA 1L3UA 2DPJA 8ICAA 4XA5A 4FS2A 9ICNA 8ICVA 3MR5A 3RH6A 4YMOA 9ICMA 2NRWA 2XY6A 3RJJA 1IM4A 3KHRA 4DOAA 4YVZA 1D8LA 9ICTA 2Y1IA 4KN7A 1U47A 1XSPA 3E2EA 4PHAA 4MFAA 1S10A 3LK9A 1NKBA 1ZQOA 4Q8EA 1ZQNA 5KT6A 2UVWA 8ICKA 5C5JA 4KITB 3ZDCA 2ATLA 4GC7A 5KT7A 1ZQQA 3KTQA 2HW3A 3Q8QB 4NLGA 3MDAA 2ISOA 5J0XA 5EWEA 5F9LA 1BPBA 2F1JA 8ICLA 1QLNA 2BCRA 2ALZA 3RJGA 1X2IA 3RTVA 2Q0ZX 3BQ0A 4RZRA 3MR3A 4PGXA 1D8YA 5IIKA 3AUOA 4O5EA 1KSPA 3M8SA 1S9FA 3M8RA 4UQGA 3SV4A 2JEJA 2V9WA 4IQTA 3ETLA 1WCNA 2BDPA 1BVSA 3K75D 2HHVA 7ICPA 4XQ8A 1CEZA 8ICTA 9ICVA 3PR4A 4M6WA 4LZDA 3ORYA 4J9LA 4PHDA 2MAXA 3T5HA 9ICAA 4F4WA 4ED3A 9ICCA 3H4DA 7ICTA 1V9PA 3V6HA 1RYRA 2W9CA 5KFDA 3SV3A 1KTQA 3OHAA 4RPZA 4RQ2A 4QWDA 3GIIA 3V6JA 1XSLA 4B9SA 3TFSA 4KTQA 5KG2A 4QZHA 3GDXA 4FO6A 7ICGA 4DLEA 1SL0A 3RJFA 4M9GA 5KFKA 3RJHA 5KFFA 3ZD9A 2C2DA 5IIJA 4TUPA 4ECRA 4DO9A 2XY5A 1L5UA 1Z00B 2P6RA 4B9NA 1ZQKA 4C8KA 4QZAA 4DQSA 1HUZA 2BCQA 4F2SA 4BWMA 1BPXA 5J29A 5DLFA 1A77A 2DFLA 2NRTA 3OGUA 5KFAA 4J9OA 4C8OA 4QZFA 3RB0A 1T8EA 1D9DA 2ZTCA 3HPOA 3C21A 4YR0A 5KFYA 5DBBA 4RQ0A 1X9SA 1MQ2A 2R8JA 5J2IA 5J0OA 4DFJA 9ICKA 5F9NA 3LWMA 1MC8A 5DB9A 5DG7A 3NTUA 1QSSA 1U9LA 5DG8A 4J9QA 5IIMA 1ZQJA 3EPIA 1Z3EB 1QTMA 4BXOA 5EWGA 4DFPA 5J0TA 3HP6A 1D9FA 4J9NA 3JPTA 4ED0A 4EYIB 1JN3A 2PI4A 1UA1A 4RQ7A 8ICIA 8ICSA 2ZJ8A 4UAWA 4HYKA 4KN4A 8ICZA 1RXVA 4M9NA 3C23A 1DGSA 3AU2A 5L1JA 5DG9A 2PFOA 4KLHA 1U49A 3HW8A 8ICHA 4DLGA 1ZQFA 5KFRA 3NGDA 4I28A 4DQPA 3G6YA 3PW0A 3JPOA 2V4QA 4C8LA 2XGPA 7ICMA 4KLLA 4IQVA 4F5RA 5KFXA 3RAXA 5J0PA 7ICFA 4NLKA 1HJPA 2F1HA 2HHWA 1ZQYA 4IR1A 2P6UA 5IILA 3C2LA 4NXZA 1NK8A 2ZUCA 3C5FA 1IXRA 4KLEA 3MBYA 2VA2A 5HMMA 1BPYA 4IRCA 1CUKA 5DQHA 3G6VA 4Q43A 2FPKA 2BPFA 4RQ4A 1ZYQA 5HP4A 1S0MA 4Q44A 3TQ1A 4M04A 4KLJA 1TK5A 3TAPA 3BQ1A 4RQ1A 5KFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6D A;  4F5Q A;  1KDH A;  7ICK A;  4KLT A;  4KLM A;  4MF2 A;  3UXP A;  3HT3 A;  3GIK A;  2ZJ5 A;  3TAR A;  4F92 B;  3LDA A;  3IM1 A;  7ICI A;  3MDC A;  4JV0 A;  5J2C A;  4DEZ A;  4IRD A;  1TAQ A;  3GIM A;  4QW9 A;  2V4R A;  2B21 A;  1C7Y A;  2VA8 A;  4J9M A;  3T5L A;  4DWI A;  4LVS A;  1H38 A;  4ED7 A;  4KLF A;  3Q8K A;  4R64 A;  3Q8P B;  2WTF A;  4DSI A;  4IR9 A;  4F5P A;  4PGY A;  3H8W A;  2R8I A;  3AU6 A;  1ZQU A;  4GXK A;  2VAN A;  4RPY A;  3GIJ A;  5CA7 A;  5J2E A;  4F4X A;  3RB6 A;  4QWB A;  1ZJN A;  4B9U A;  2P66 A;  4CCH A;  4C8N A;  2C22 A;  1QSY A;  2IMW P;  5DQG A;  1COO A;  2XO7 A;  1ARO P;  4ECX A;  3M9N B;  4DQI A;  4M0A A;  5BOM A;  4O5C A;  2I1Q A;  3RRG A;  2HHS A;  3TAN A;  3PX6 A;  2JEF A;  4JWN A;  4ECS A;  4DFK A;  8ICR A;  4YQW A;  2R8H A;  1ZQH A;  4TUR A;  1ZQX A;  5DGA A;  4MFC A;  9ICL A;  1KFT A;  2I9G A;  1N48 A;  4EBE A;  4RQ8 A;  8ICW A;  3ISB A;  4P4P A;  1XS9 D;  1NK6 A;  1TK0 A;  3C5G A;  1RPL A;  4UAZ A;  2FLL A;  1ZQA A;  4QZ9 A;  4DSK A;  5KG6 A;  1BPE A;  4R63 A;  2NRV A;  4EEY A;  4PH5 A;  4P4M A;  4M9H A;  4DL4 A;  1PZN A;  5KFV A;  1RYS A;  1U45 A;  4RUC A;  1EXN A;  3M9M B;  5KG5 A;  4M6W B;  4RT2 A;  1NOM A;  2FMQ A;  5D4B A;  1JX4 A;  4DL2 A;  4NLZ A;  5KFJ A;  3GFK B;  3N97 B;  2FMS A;  5D46 A;  4NY8 A;  4I2A A;  2W9C B;  4I29 A;  4BDP A;  2ZTE A;  8ICN A;  3BQT A;  3BDP A;  3PO5 A;  4RNN A;  3RRH A;  1ZQP A;  4PPX A;  1B22 A;  2R8G A;  4O3O A;  4R65 A;  4UBB A;  2R8K A;  3PX4 A;  4PHE A;  4DSL A;  4ED1 A;  3OJS A;  1KRP A;  2XC9 A;  1S0O A;  5JUM A;  1NK0 A;  2H5X A;  5DB7 A;  4QWE A;  4F5O A;  4ECT A;  1ZQS A;  2UVR A;  2XCP A;  3QZ7 A;  3V6K A;  3KHG A;  3TAQ A;  1T4G A;  4RQ6 A;  7ICU A;  4UB3 A;  3QEB Z;  2J6U A;  2KZM A;  3JPS A;  1MQ3 A;  3GV5 B;  2NRX A;  4J9P A;  3SI8 A;  4DSE A;  2ZUB A;  1TKD A;  4KLG A;  3B0Y A;  1UA0 A;  1TVA A;  2PFP A;  4O3N A;  1KLN A;  7ICV A;  3C1Z A;  4ED2 A;  5DLG A;  4UB5 A;  1NK9 A;  5J0Y A;  4EBD A;  3C2M A;  4EZ6 A;  2KFZ A;  4YP3 A;  4R66 A;  4IRK A;  2ZJA A;  1TFR A;  3ZDE A;  4QZB A;  2HHQ A;  7ICN A;  1UT8 A;  1ZQG A;  4BXO B;  8ICB A;  1NJY A;  3EWA A;  4J9S A;  4I2E A;  4DOB A;  4UAY A;  1ZQW A;  1U4B A;  3GV8 B;  9ICJ A;  4YN4 A;  2IHM A;  2BGW A;  1S0N A;  2UVV A;  5IIN A;  2AU0 A;  4YCX A;  2LYH A;  4ECU A;  4JWM A;  5J2A A;  4GXJ A;  3PY8 A;  4YFK A;  5CHG A;  4Z6F A;  4M2Y A;  3Q8S B;  3RH5 A;  4Q8F A;  1ZQC A;  1WCL A;  4O9M A;  2KN7 A;  4NM1 A;  4ECQ A;  2BPG A;  4G3I A;  3RJK A;  5DKW A;  2W9B A;  4O3Q A;  4XRH A;  2PXI A;  3QZ8 A;  3H4B A;  5KFL A;  3RH4 A;  4ELU A;  4MF8 A;  3JPQ A;  3PNC A;  5L1K A;  1ZQB A;  2FLN A;  1S77 D;  5IIO A;  9ICX A;  1N56 A;  1TK8 A;  3UXO A;  5J0Q A;  5CWR A;  2Y1J A;  4ZH4 A;  4QW8 A;  3ZDD A;  5DDY A;  4BGD A;  5KFB A;  3H7I A;  4DS4 A;  3TI0 A;  3HWT A;  5KFU A;  4NM2 A;  2AGO A;  5DBC A;  5KT4 A;  2OWO A;  1ZQM A;  2W9M A;  2ZUD A;  4PGQ A;  3V72 A;  4NLN A;  3M9O B;  4F4K A;  3RB3 A;  4F91 B;  2BR0 A;  4ECW A;  2BPC A;  5KG0 A;  3ZD8 A;  1ZQR A;  3PO4 A;  1S76 D;  4I2D A;  5BPC A;  1XC9 A;  2C28 A;  2A1J A;  4F3O A;  2PFN A;  4O3S A;  4F93 B;  4QZ8 A;  4DSJ A;  4DF8 A;  4ELV A;  3Q8M A;  1NJZ A;  5L9X A;  5KT2 A;  1XU4 A;  1ZQI A;  1X9W A;  4LZG A;  3PVX A;  4RNO A;  3UPQ A;  2AGP A;  3OHB A;  2BQU A;  1L3V A;  5CJ7 A;  2FLP A;  4ELT A;  8ICJ A;  2JZB A;  7ICE A;  2XY7 A;  4ECY A;  4TQS A;  3GV7 B;  4F2R A;  4PHP A;  3LWL A;  4JV2 A;  9ICR A;  5KTQ A;  1NK4 A;  1ZQT A;  5KFZ A;  1A76 A;  4TUQ A;  4KMU A;  4F5N A;  4DSF A;  4ECV A;  9ICQ A;  3RBE A;  3ZDA A;  4UB2 A;  4F8R A;  2J6S A;  3H8J A;  4K4H A;  1UT5 A;  4YXJ A;  5HHH A;  5KT3 A;  1ZQE A;  1KFS A;  2HVI A;  9ICO A;  1XSN A;  2ASD A;  2W8L A;  4I27 A;  3PMN A;  2PFQ A;  2W9A A;  3EYZ A;  3FDS A;  5HML A;  9ICU A;  5KFC A;  4R8U A;  2PI5 A;  1SKR A;  4B9V A;  1SL2 A;  5KFN A;  1ZQD A;  9ICG A;  2AQ0 A;  2HHU A;  2BHN A;  3T3F A;  5KG7 A;  5KFM A;  4I2J A;  3EPG A;  1S97 A;  2C2R A;  1X9M A;  2IBK A;  4JV1 A;  2XCA A;  3RJI A;  1LB2 B;  5KG3 A;  3PW2 A;  1MSW D;  2ASL A;  2KZ3 A;  4O0I A;  1LV5 A;  4F4Y A;  1QSL A;  4I2B A;  8ICE A;  5KG4 A;  1Y88 A;  5KFH A;  4M9J A;  3OSP A;  1SKW A;  4RUA A;  8ICG A;  3MAB A;  5III A;  7ICL A;  1XO1 A;  4I2C A;  3T5J A;  1RZT A;  4YD2 A;  3GQC A;  2FPL A;  4J9R A;  3JPN A;  8ICP A;  4KLQ A;  3MFH A;  3V7L A;  3BJY A;  2ISP A;  1JMS A;  4YMN A;  4RQ5 A;  2KFN A;  4IQU A;  4MEX A;  4M47 A;  5KFP A;  3N4M B;  3TFR A;  2F1I A;  3PW4 A;  1K1S A;  1U48 A;  3H40 A;  3RR8 A;  2NRZ A;  4JK1 A;  2XGQ A;  5DB6 A;  2JEI A;  2ASJ A;  8ICU A;  4QZE A;  5J0U A;  4FBT A;  4QZG A;  3FYH A;  4F4Z A;  1T3N A;  4I2F A;  5DBA A;  5J2F A;  4QZD A;  9ICE A;  4P4O A;  1XWL A;  2UVU A;  3EW9 A;  1DOQ A;  3MR6 A;  5CB1 A;  1BGX T;  8ICM A;  4YD1 A;  1TAU A;  9ICS A;  4QWA A;  3JPP A;  4KLU A;  4EYH B;  5BOL A;  5KFI A;  4ED8 A;  4KLO A;  4FS1 A;  2J6T A;  3OSN A;  3V7K A;  3Q8R B;  4E0D A;  4MFF A;  5DQI A;  2AQ4 A;  1KEJ A;  3PW7 A;  5J0W A;  3PV8 A;  3ISD A;  5HNK A;  4MEY A;  4ED6 A;  3T5K A;  8ICC A;  4GLX A;  2DPI A;  4M9L A;  4Z6C A;  5EWF A;  5DB8 A;  2BQR A;  8ICQ A;  2HVH A;  5KT5 A;  9ICW A;  5J2K A;  1NJX A;  3H8S A;  5KFS A;  1L3S A;  4GC6 A;  4YXM A;  2IA6 A;  4RNM A;  2HHX A;  3EZ5 A;  3QE9 Y;  1JXE A;  2W9B B;  5KFG A;  4RT3 A;  3G6X A;  4DF4 A;  3GIL A;  1Z00 A;  1ZET A;  2FPM A;  5KG1 A;  4YR2 A;  3HX0 A;  1NJW A;  4DS5 A;  2BCU A;  4JUZ A;  4DL7 A;  3B0X A;  2JEG A;  2FMP A;  4I2H A;  7ICR A;  5HHI A;  3MR2 A;  1NKC A;  2BCV A;  1KFD A;  1L3T A;  4O5K A;  7ICJ A;  8ICO A;  4RQ3 A;  4IQW A;  4DL5 A;  3PX0 A;  4DFM A;  3IHQ B;  4C8M A;  3SZ2 A;  4KLD A;  4DL6 A;  1NKE A;  2HHT A;  4I2G A;  9ICI A;  1JIH A;  3V7J A;  9ICF A;  5KFW A;  1ZJM A;  9ICP A;  9ICH A;  3ISC A;  4UB4 A;  4YR3 A;  8ICY A;  7ICO A;  2ZTD A;  4RU9 A;  1HUO A;  1B43 A;  3MGH A;  5L1L A;  5KFE A;  2KZZ A;  5J2D A;  3KHH A;  4TUS A;  4O3P A;  5L1I A;  1BPZ A;  4B9T A;  2A1J B;  2BCS A;  4B9L A;  3UQ2 A;  1SZP A;  4DQR A;  3RAQ A;  2BKE A;  5CR0 A;  2KTQ A;  4K4I A;  3K4G A;  3SYZ A;  5D49 A;  1SL1 A;  1RXW A;  3RJE A;  1T7P A;  3MGI A;  4I2I A;  3PW5 A;  4UBC A;  4YMM A;  5J2J A;  4TQR A;  5J2B A;  3UQ0 A;  3Q8L A;  4P2H A;  4BWJ A;  3ZDB A;  3QEA Z;  5CP2 A;  4GXI A;  2JZB B;  1ZQL A;  2RDI A;  4UB1 A;  3OJU A;  1K1Q A;  7ICS A;  4QZC A;  3BQ2 A;  1ZQV A;  3JPR A;  4O3R A;  7ICQ A;  1NK5 A;  7ICH A;  3MFI A;  2AJQ A;  3RB4 A;  4DL3 A;  4F50 A;  4XUS A;  5KFQ A;  1BPD A;  5J0R A;  1JXL A;  2M9N A;  4X5V A;  5TZV A;  5DGB A;  2BQ3 A;  4RPX A;  2C2E A;  3UXN A;  5J2G A;  4KLS A;  2IHN A;  2RDJ A;  4Z6E A;  3KHL A;  4DOC A;  4EBC A;  3PML A;  1TV9 A;  4J9K A;  2W8K A;  4QWC A;  1S0V A;  8ICX A;  5EOZ A;  4R8U B;  2AGQ A;  5J2H A;  2GWS A;  8ICF A;  4QZI A;  1NK7 A;  4YG2 A;  1SKS A;  4B9M A;  3RR7 A;  4KLI A;  2MUT B;  3PR5 B;  4EZ9 A;  4DQQ A;  1ZQZ A;  5DDM A;  5J0S A;  4Q45 A;  3C1Y A;  5KFT A;  3RBD A;  3THV A;  2VA3 A;  3C2K A;  2MUT A;  9ICB A;  4ECZ A;  4K4G A;  4FBU A;  1L3U A;  2DPJ A;  8ICA A;  4XA5 A;  4FS2 A;  9ICN A;  8ICV A;  3MR5 A;  3RH6 A;  4YMO A;  9ICM A;  2NRW A;  2XY6 A;  3RJJ A;  1IM4 A;  3KHR A;  4DOA A;  4YVZ A;  1D8L A;  9ICT A;  2Y1I A;  4KN7 A;  1U47 A;  1XSP A;  3E2E A;  4PHA A;  4MFA A;  1S10 A;  3LK9 A;  1NKB A;  1ZQO A;  4Q8E A;  1ZQN A;  5KT6 A;  2UVW A;  8ICK A;  5C5J A;  4KIT B;  3ZDC A;  2ATL A;  4GC7 A;  5KT7 A;  1ZQQ A;  3KTQ A;  2HW3 A;  3Q8Q B;  4NLG A;  3MDA A;  2ISO A;  5J0X A;  5EWE A;  5F9L A;  1BPB A;  2F1J A;  8ICL A;  1QLN A;  2BCR A;  2ALZ A;  3RJG A;  1X2I A;  3RTV A;  2Q0Z X;  3BQ0 A;  4RZR A;  3MR3 A;  4PGX A;  1D8Y A;  5IIK A;  3AUO A;  4O5E A;  1KSP A;  3M8S A;  1S9F A;  3M8R A;  4UQG A;  3SV4 A;  2JEJ A;  2V9W A;  4IQT A;  3ETL A;  1WCN A;  2BDP A;  1BVS A;  3K75 D;  2HHV A;  7ICP A;  4XQ8 A;  1CEZ A;  8ICT A;  9ICV A;  3PR4 A;  4M6W A;  4LZD A;  3ORY A;  4J9L A;  4PHD A;  2MAX A;  3T5H A;  9ICA A;  4F4W A;  4ED3 A;  9ICC A;  3H4D A;  7ICT A;  1V9P A;  3V6H A;  1RYR A;  2W9C A;  5KFD A;  3SV3 A;  1KTQ A;  3OHA A;  4RPZ A;  4RQ2 A;  4QWD A;  3GII A;  3V6J A;  1XSL A;  4B9S A;  3TFS A;  4KTQ A;  5KG2 A;  4QZH A;  3GDX A;  4FO6 A;  7ICG A;  4DLE A;  1SL0 A;  3RJF A;  4M9G A;  5KFK A;  3RJH A;  5KFF A;  3ZD9 A;  2C2D A;  5IIJ A;  4TUP A;  4ECR A;  4DO9 A;  2XY5 A;  1L5U A;  1Z00 B;  2P6R A;  4B9N A;  1ZQK A;  4C8K A;  4QZA A;  4DQS A;  1HUZ A;  2BCQ A;  4F2S A;  4BWM A;  1BPX A;  5J29 A;  5DLF A;  1A77 A;  2DFL A;  2NRT A;  3OGU A;  5KFA A;  4J9O A;  4C8O A;  4QZF A;  3RB0 A;  1T8E A;  1D9D A;  2ZTC A;  3HPO A;  3C21 A;  4YR0 A;  5KFY A;  5DBB A;  4RQ0 A;  1X9S A;  1MQ2 A;  2R8J A;  5J2I A;  5J0O A;  4DFJ A;  9ICK A;  5F9N A;  3LWM A;  1MC8 A;  5DB9 A;  5DG7 A;  3NTU A;  1QSS A;  1U9L A;  5DG8 A;  4J9Q A;  5IIM A;  1ZQJ A;  3EPI A;  1Z3E B;  1QTM A;  4BXO A;  5EWG A;  4DFP A;  5J0T A;  3HP6 A;  1D9F A;  4J9N A;  3JPT A;  4ED0 A;  4EYI B;  1JN3 A;  2PI4 A;  1UA1 A;  4RQ7 A;  8ICI A;  8ICS A;  2ZJ8 A;  4UAW A;  4HYK A;  4KN4 A;  8ICZ A;  1RXV A;  4M9N A;  3C23 A;  1DGS A;  3AU2 A;  5L1J A;  5DG9 A;  2PFO A;  4KLH A;  1U49 A;  3HW8 A;  8ICH A;  4DLG A;  1ZQF A;  5KFR A;  3NGD A;  4I28 A;  4DQP A;  3G6Y A;  3PW0 A;  3JPO A;  2V4Q A;  4C8L A;  2XGP A;  7ICM A;  4KLL A;  4IQV A;  4F5R A;  5KFX A;  3RAX A;  5J0P A;  7ICF A;  4NLK A;  1HJP A;  2F1H A;  2HHW A;  1ZQY A;  4IR1 A;  2P6U A;  5IIL A;  3C2L A;  4NXZ A;  1NK8 A;  2ZUC A;  3C5F A;  1IXR A;  4KLE A;  3MBY A;  2VA2 A;  5HMM A;  1BPY A;  4IRC A;  1CUK A;  5DQH A;  3G6V A;  4Q43 A;  2FPK A;  2BPF A;  4RQ4 A;  1ZYQ A;  5HP4 A;  1S0M A;  4Q44 A;  3TQ1 A;  4M04 A;  4KLJ A;  1TK5 A;  3TAP A;  3BQ1 A;  4RQ1 A;  5KFO A; 
#chains in the Genus database with same CATH topology
 2F3N A;  4Z6D A;  4F5Q A;  1KDH A;  7ICK A;  4KLT A;  4MF2 A;  3GIK A;  1SIJ A;  2ZG6 A;  3IM1 A;  3LDA A;  3MDC A;  4JV0 A;  5J2C A;  1TAQ A;  2V4R A;  3QU7 A;  2B21 A;  1C7Y A;  1ZRN A;  1X42 A;  5AKX A;  3GU3 A;  1H38 A;  4KLF A;  2KD1 A;  2WFA A;  5GTH U;  1QH9 A;  5J2E A;  2G5I B;  4B9U A;  3IG8 A;  5AKZ A;  4C0Z A;  4CCH A;  1COO A;  3QU9 A;  2BDU A;  4ECX A;  3NVW A;  4M0A A;  2I1Q A;  3T79 A;  3PX6 A;  2JEF A;  4JWN A;  2FDR A;  4YQW A;  1ZQH A;  4TUR A;  1N48 A;  2E5S A;  3ISB A;  4HAI A;  2NRV A;  3MGV A;  3QUQ A;  4DL4 A;  1RYS A;  2K60 A;  1U45 A;  1KL9 A;  5KG5 A;  1S5L U;  5D4B A;  1JX4 A;  4CF4 A;  5AM0 A;  5KFJ A;  3N97 B;  5ALE A;  3NVV A;  4BDP A;  2ZTE A;  3BQT A;  4Y2V A;  1ZQP A;  1NZB A;  2JMG A;  2ZIV A;  4PHE A;  1WUD A;  3OJS A;  4ED1 A;  4A8E A;  3MC1 A;  2H5X A;  5DB7 A;  3QZ7 A;  3DDH A;  3V6K A;  1T4G A;  3OPX A;  1MQ3 A;  3GV5 B;  4J9P A;  3SI8 A;  2ZUB A;  4KLG A;  2ZIX B;  1JRO A;  1OW5 A;  5AKH A;  1KLN A;  5DLG A;  2YX8 A;  5J0Y A;  2ZIX A;  2WAQ C;  1P7D A;  1TFR A;  3ZDE A;  1UT8 A;  1ZQG A;  4DOB A;  9ICJ A;  2D3D A;  2BGW A;  5IIN A;  4YCX A;  1MN8 A;  5J2A A;  1IIP A;  1SZH A;  3RH5 A;  1ZQC A;  1Z19 A;  5ALQ A;  2W9B A;  2PXI A;  3JPQ A;  4UW9 A;  2E3T A;  1XO0 A;  2B0C A;  1S77 D;  2E8P A;  1TK8 A;  3FC4 A;  4AP9 A;  3UXO A;  5J0Q A;  4QW8 A;  3QNM A;  5DBC A;  5KT4 A;  2ZUD A;  4PGQ A;  4NLN A;  3M9O B;  4F4K A;  3RB3 A;  3PO4 A;  1XC9 A;  4QZ8 A;  5JTI A;  3QU4 A;  1AQ6 A;  3WKB A;  1ZQI A;  2YB4 A;  1SXD A;  3PSP A;  5CJ7 A;  2FLP A;  7ICE A;  3N28 A;  2XY7 A;  4ECY A;  4UAR A;  3GV7 B;  4F2R A;  9ICR A;  1ZQT A;  1C20 A;  3RBE A;  3ZDA A;  4AYB F;  2DF4 B;  5HHH A;  2KP7 A;  1ZQE A;  2HVI A;  9ICO A;  5KAI U;  4U6P A;  2HDO A;  1XSN A;  4NWI A;  5GTI U;  3PMN A;  2W9A A;  1SKR A;  4UAU A;  9ICG A;  3T3F A;  5KG7 A;  2KJ5 A;  3M1Y A;  1RM6 C;  2FE9 A;  4F4Y A;  4I2B A;  2IOF K;  3OSP A;  1RG6 A;  7ICL A;  1L7O A;  3K1Z A;  1VLB A;  2KIW A;  1RZT A;  4YD2 A;  3GQC A;  2FPL A;  3V7L A;  3BJY A;  2ISP A;  1VJ5 A;  4UAT A;  5B66 U;  2KFN A;  5KFP A;  1U48 A;  3H40 A;  4JK1 A;  5DB6 A;  2ASJ A;  4F4Z A;  3FYH A;  5DBA A;  5J2F A;  5B5E U;  5CB1 A;  4YD1 A;  9ICS A;  4KLU A;  3A0H U;  2ZXI A;  5AM3 A;  4P0P B;  5DQI A;  8ICC A;  2QLT A;  2DPI A;  2LM4 A;  1NJX A;  3H8S A;  5KFS A;  4GC6 A;  2XVT A;  4RNM A;  3EZ5 A;  3QE9 Y;  1JXE A;  4OJP A;  3WKA A;  4Y2S A;  1KQQ A;  2FPM A;  5KG1 A;  3CYM A;  4DS5 A;  2BCU A;  4I2H A;  3WK6 A;  2EZY A;  7ICR A;  2H3F A;  5KL8 B;  1NKC A;  2BCV A;  1KFD A;  1Z1B A;  2KKV A;  3RFA A;  4I2G A;  3ISC A;  5ALG A;  7ICO A;  2E1F A;  4RU9 A;  5KFE A;  2OEH A;  5J2D A;  2E1E A;  4B9T A;  1PVQ A;  4NJ8 A;  1SZP A;  2KTQ A;  3RJE A;  1T7P A;  2KHV A;  3MGI A;  4UBC A;  4ACO A;  2KK0 A;  2QB0 B;  4YMM A;  5CP2 A;  1ZQL A;  2EAO A;  2RDI A;  4GFJ A;  3OJU A;  1K1Q A;  2F76 X;  4QZC A;  1NK5 A;  5ALR A;  7ICH A;  5ALU A;  3S6J A;  1JXL A;  5KFQ A;  4BJQ A;  2HMX A;  3EUB 2;  5DGB A;  3C29 A;  2IHN A;  1TV9 A;  4J9K A;  4QWC A;  1F0M A;  2G07 A;  4R8U B;  2DQN B;  1NK7 A;  4KLI A;  4DQQ A;  1ZQZ A;  5DDM A;  1SWW A;  2WF7 A;  5KFT A;  4Y2P A;  1L3U A;  8ICV A;  3RH6 A;  2NRW A;  3KHR A;  1XNS A;  4YVZ A;  1D8L A;  2Y1I A;  3E2E A;  3AN1 A;  4MFA A;  3WK8 A;  3E58 A;  1ZQN A;  5KT6 A;  2ATL A;  5KT7 A;  3KTQ A;  3MDA A;  8ICL A;  2K4E A;  5ALS A;  3H0M B;  3RTV A;  2Q0Z X;  3CP8 A;  3BQ0 A;  4O5E A;  1KSP A;  5KL1 B;  4F72 A;  4Y2Y A;  2LMR A;  2V9W A;  7ICP A;  5AI5 A;  1CEZ A;  8ICT A;  9ICV A;  1IV8 A;  3QU5 A;  9ICA A;  1F44 A;  4ED3 A;  1V9P A;  5KFD A;  2CXY A;  4ICA A;  3L4P A;  2YN4 A;  1O03 A;  3SR6 A;  1SL0 A;  1X6I A;  5KFK A;  4PZN A;  1L5U A;  2JEI A;  2DL0 A;  1N61 A;  1SGG A;  1BPX A;  1A77 A;  2NRT A;  3OGU A;  5KFA A;  4J9O A;  4QIW C;  3UM9 A;  5KFY A;  4DFJ A;  5J0O A;  9ICK A;  1TE2 A;  2RQ5 A;  4JMU A;  2RRD A;  4PL2 A;  5DG8 A;  1ZQJ A;  1Z3E B;  1QTM A;  4BXO A;  5EWG A;  1URJ A;  3UMC A;  8ICI A;  2E8O A;  1UA1 A;  3NUQ A;  2ESE A;  2K4P A;  2ZJ8 A;  1V85 A;  2AHO B;  4HYK A;  2DGZ A;  3L5K A;  2EAN A;  4M9N A;  5KNI A;  5DG9 A;  1U49 A;  3HW8 A;  5EE0 A;  4DLG A;  2JH7 A;  7ICM A;  5AKK A;  4IQV A;  4F5R A;  2AXT U;  2HHW A;  3SEN A;  3KKA A;  1NK8 A;  1IXR A;  4OJL A;  1RDF A;  5ALT A;  4NY8 A;  4RQ1 A;  1TAU A;  3UXP A;  2ZJ5 A;  2RP5 A;  2MSN A;  3SAH A;  3KOO A;  4J9M A;  3T5L A;  2K4I A;  5AM2 A;  3Q8K A;  2XI9 A;  2WTF A;  3I76 A;  4F5P A;  5AKI A;  4PGY A;  3N7S C;  3FAH A;  1NI3 A;  4RPY A;  3GIJ A;  4F4X A;  3PSF A;  4P0Q B;  4C8N A;  1QSY A;  5DQG A;  2XO7 A;  1N2X A;  5BOM A;  3RRG A;  3SAF A;  2HHS A;  2E8N A;  4DFK A;  4Y2U A;  8ICR A;  2R8H A;  1ZQX A;  5DGA A;  9ICL A;  2I9G A;  4RQM A;  4P4P A;  3C5G A;  1ZQA A;  2ODG A;  5KG6 A;  3UMB A;  4KMO B;  4EEY A;  4PH5 A;  4M9H A;  2EH9 A;  5ALJ A;  4M6W B;  1NOM A;  2FMQ A;  2YMQ A;  5D46 A;  1LKY A;  4I2A A;  4I29 A;  8ICN A;  3BDP A;  3PO5 A;  4RNN A;  3RRH A;  4O3O A;  1JUD A;  1JAL A;  4DSL A;  3KFU F;  2VJ5 A;  1KRP A;  4QWE A;  1B0X A;  5FP0 A;  2QB1 A;  4RQ6 A;  2KIC A;  1NNL A;  2KZM A;  2DKX A;  1J2M A;  2KJ8 A;  2PFP A;  1A6S A;  1NK9 A;  4EZ6 A;  2KFZ A;  2GH1 A;  4CRX A;  2PMZ C;  2ZJA A;  4QZB A;  4UB8 U;  3EWA A;  4I2E A;  1U4B A;  4YN4 A;  2HI0 A;  1S0N A;  3FM9 A;  3I28 A;  5EE1 A;  4GXJ A;  4QIW F;  1PVP A;  3PY8 A;  1X9X A;  2DWQ A;  4Z6F A;  2GO7 A;  2YB1 A;  3Q8S B;  4Q8F A;  2BPG A;  2W54 A;  4O3Q A;  1K5O A;  2G5H B;  5L1K A;  2FLN A;  9ICX A;  1N56 A;  2ZIW A;  4ZH4 A;  5KFB A;  5KFU A;  2LKY A;  2AGO A;  1DRG A;  3QYP A;  3TAD C;  2KSO B;  2QKQ A;  5KG0 A;  1S76 D;  4I2D A;  4F3O A;  5J8Y C;  2A1J A;  5AKG A;  2PFN A;  4O3S A;  4F93 B;  3LVV A;  5AKJ A;  4DF8 A;  3Q8M A;  2FI1 A;  2KSO A;  5KT2 A;  1X9W A;  1JRP A;  3PVX A;  4RNO A;  2BQU A;  1L3V A;  3HKZ F;  4ELT A;  3F5E A;  2JZB A;  4US9 A;  2EZZ A;  3WK9 A;  4JV2 A;  2O6K A;  1A76 A;  4OD0 A;  4KMU A;  5CEH A;  4TUQ A;  4DSF A;  4K4H A;  1UT5 A;  1KFS A;  2XIC A;  2PFQ A;  3FDS A;  2PI5 A;  2ZXH A;  1ZQD A;  2AQ0 A;  1GO3 F;  2HHU A;  4UAV A;  5KFM A;  4I2J A;  2C2R A;  4JV1 A;  3RJI A;  1LB2 B;  4O0I A;  1UHU A;  2G06 A;  1LV5 A;  1QSL A;  5KG4 A;  1Y88 A;  3CW2 C;  4RUA A;  3H0L B;  8ICG A;  1SWV A;  1XO1 A;  1L7P A;  2ZIV B;  3WK4 A;  2KG5 A;  1JMS A;  2JRZ A;  3QXG A;  4MEX A;  3PW4 A;  2H3Q A;  2MA1 A;  3RR8 A;  2M0N A;  2XGQ A;  8ICU A;  2WF8 A;  4FBT A;  4QZG A;  4I2F A;  4P4O A;  1XWL A;  4QWA A;  3JPP A;  5KFI A;  1DK3 A;  5AKL A;  4FS1 A;  1KEJ A;  1DXS A;  2OHF A;  4C7Y A;  4GLX A;  1A0P A;  3U26 A;  3LVW A;  1L3S A;  2W9B B;  4RT3 A;  4DF4 A;  2IOF A;  1ZET A;  4YR2 A;  5H2F U;  1NJW A;  4OJ5 A;  2JEG A;  2FMP A;  4C4T A;  1ZD3 A;  7ICJ A;  3QUB A;  8ICO A;  4RQ3 A;  2W03 A;  4IQW A;  4DL6 A;  9ICI A;  2HHT A;  9ICF A;  4UB4 A;  2EDU A;  4EEN A;  2KVC A;  5AKE A;  3KHH A;  4O3P A;  5L1I A;  3QU2 A;  5C0Y A;  3RAQ A;  4K4I A;  3SYZ A;  5D49 A;  2A3V A;  3PW5 A;  3Q8L A;  4GXI A;  7ICS A;  2WHE A;  3BQ2 A;  1ZQV A;  3JPR A;  4O3R A;  7ICQ A;  2Y9U A;  5E79 U;  2AJQ A;  3LYS A;  2KOB A;  1BPD A;  1V38 A;  4X5V A;  1HIW A;  3UXN A;  4Z6E A;  3KHL A;  2LI6 A;  2OCE A;  8ICX A;  2LYB A;  3BZK A;  5EOZ A;  4C7Z A;  5J2H A;  4EZ9 A;  3RBD A;  3THV A;  4ECZ A;  2DPJ A;  4XA5 A;  4FS2 A;  1Q3V A;  3MR5 A;  4YMO A;  3RJJ A;  4DOA A;  9ICT A;  4KN7 A;  3IRU A;  1XSP A;  4PHA A;  1NKB A;  2LBO A;  4KIT B;  3ZDC A;  4GC7 A;  4FZM A;  3ONN A;  1FO4 A;  4NLG A;  2ISO A;  5F3X B;  5F9L A;  1BPB A;  2F1J A;  4US8 A;  1QLN A;  3RJG A;  3MR3 A;  4PGX A;  1D8Y A;  5IIK A;  3AUO A;  1OXJ A;  1WCN A;  3K75 D;  5JRT A;  5EE9 A;  1N5X A;  4LZD A;  3IV6 A;  3ORY A;  2MAX A;  4EEK A;  4F4W A;  3AEV A;  7ICT A;  2NV3 A;  3V6H A;  2W9C A;  3GII A;  3TFS A;  2P6R A;  4B9N A;  5IIJ A;  4TUP A;  2XY5 A;  1J2N A;  1SXE A;  4C8K A;  4QZA A;  4DQS A;  2BCQ A;  2D6F C;  4BWM A;  3ALR A;  5J29 A;  2WAQ F;  1MA7 A;  4QZF A;  1T8E A;  1D9D A;  2ZTC A;  5L1M A;  3C21 A;  4YR0 A;  1BNP A;  2Y9T A;  2R8J A;  3LWM A;  1MC8 A;  4IC9 A;  1CRX A;  5IIM A;  4MHV A;  4OJ6 A;  3QUT A;  4CF3 A;  4J9N A;  2H3V A;  2DUY A;  4UAW A;  2KVS A;  3C23 A;  2E8M A;  3NVZ A;  5L1J A;  2PFO A;  5ALY A;  2WF5 A;  1UPH A;  1T3Q A;  2F2A B;  5ALL A;  2WF6 A;  4C8L A;  4KLL A;  5KFX A;  1HJP A;  2F1H A;  1ZQY A;  4IR1 A;  3MBY A;  2VA2 A;  1CUK A;  4ZOH C;  4RQ4 A;  1TK5 A;  3TAP A;  4DCC A;  2JV3 A;  4KLM A;  4F92 B;  5ALX A;  7ICI A;  4DEZ A;  2VA8 A;  4LVS A;  4ED7 A;  2JR5 A;  3Q8P B;  4Y2Q A;  4IR9 A;  2R8I A;  4FE3 A;  1ZQU A;  4GXK A;  2VAN A;  5CA7 A;  3RB6 A;  1ZJN A;  5ALN A;  2P66 A;  2C22 A;  2IMW P;  1ARO P;  3KBB A;  3M9N B;  4DQI A;  4O5C A;  3TAN A;  4MFC A;  4RQ8 A;  2W11 A;  1TK0 A;  4QZ9 A;  4R63 A;  4BUG A;  3WK7 A;  4P4M A;  1PZN A;  4RUC A;  2KV2 A;  3M9M B;  2LYA A;  4RT2 A;  5G5G A;  4NLZ A;  4RQN A;  3GFK B;  5AK5 A;  2K8C B;  4PPX A;  3NRZ A;  1B22 A;  2R8G A;  2A19 A;  4UBB A;  2R8K A;  3PX4 A;  3WKE A;  3VC8 A;  1ZD2 P;  1NK0 A;  2MRL A;  4F5O A;  1ZQS A;  4ECT A;  2UVR A;  2XCP A;  1Z4N A;  3TAQ A;  7ICU A;  3QEB Z;  2F77 X;  4DSE A;  1TKD A;  1UA0 A;  3O0F A;  2P35 A;  2PKE A;  4UB5 A;  4EBD A;  3C2M A;  1Q3U A;  4R66 A;  4IRK A;  7ICN A;  2HHQ A;  2K8B B;  4BXO B;  5AI0 A;  8ICB A;  1NJY A;  4J9S A;  5CRX A;  2HCF A;  3GV8 B;  2IHM A;  5ALV A;  2UVV A;  2OXO A;  2AU0 A;  2LYH A;  4ECU A;  2JHD A;  3PZP A;  4M2Y A;  2Y0S C;  2KN7 A;  1B4F A;  4NM1 A;  5DKW A;  3RH4 A;  3QZ8 A;  3H4B A;  1ZD5 A;  2EAP A;  2YML A;  4IS7 A;  2WB1 C;  2Y1J A;  3ZDD A;  5DDY A;  4DS4 A;  3KZI U;  1F5S A;  2F8L A;  3TI0 A;  5AK3 A;  1ZRM A;  4NM2 A;  2KE7 A;  5AI8 A;  5AKY A;  2FJ6 A;  1SV0 C;  2W9M A;  3V72 A;  4CGZ A;  3IG5 A;  2JH1 A;  4F91 B;  3ZD8 A;  1ZQR A;  1YZ7 A;  5BPC A;  2C28 A;  2GLE A;  3D2N A;  1NJZ A;  3OHB A;  3F53 A;  1FEZ A;  4UB6 U;  2KHQ A;  4PHP A;  1COK A;  1KN5 A;  1NK4 A;  5KFZ A;  4F5N A;  3BZC A;  3ETR A;  2YY6 A;  2J6S A;  4YXJ A;  5KT3 A;  2W3R A;  2R18 A;  1RQL A;  5EE3 A;  2I6X A;  5HML A;  3SQI A;  4B9V A;  1SL2 A;  3TAD A;  2W7O A;  5KFN A;  4GIB A;  2EZX A;  5ALM A;  2BHN A;  5J8Y A;  3EPG A;  2IBK A;  1X9M A;  1HEK A;  1MSW D;  3PW2 A;  2ASL A;  4NLC A;  8ICE A;  1LKY B;  2NO4 A;  3MAB A;  5TIS U;  2JXJ A;  2RLT A;  2G08 A;  3WU2 U;  3JPN A;  1Z1V A;  3ZI4 A;  4KLQ A;  3MFH A;  4YMN A;  4RQ5 A;  3ED5 A;  3TFR A;  1RQN A;  2F1I A;  4QZE A;  5J0U A;  1PK1 A;  1T3N A;  9ICE A;  3EW9 A;  3K1R B;  1DOQ A;  3MR6 A;  8ICM A;  1KKX A;  5BOL A;  5KAF U;  1PVR A;  2J6T A;  3OSN A;  5ALH A;  3V7K A;  3Q8R B;  2AQ4 A;  3PW7 A;  3PV8 A;  3AQE A;  2Q4T A;  5HNK A;  4MEY A;  4ED6 A;  3T5K A;  4Z6C A;  5ALF A;  5DB8 A;  5KT5 A;  2NO5 A;  1ECW A;  2IA6 A;  4OO1 J;  3G6X A;  5KFG A;  1V97 A;  1Z00 A;  3OTQ A;  3HX0 A;  4DL7 A;  3B0X A;  1FFV A;  5HHI A;  2ZIW B;  1L3T A;  4DL5 A;  3PX0 A;  3TAC B;  4DFM A;  3SZ2 A;  1N60 A;  1JIH A;  1X66 A;  9ICH A;  3N7R C;  2Y0S F;  8ICY A;  5HR7 A;  1HUO A;  1B43 A;  3WKD A;  1Q46 A;  2ZIU B;  3SAG A;  1BPZ A;  2A1J B;  2BCS A;  4B9L A;  2BKE A;  4NL9 C;  3K4G A;  1SL1 A;  1RXW A;  2ZIU A;  3DEE A;  5J2J A;  4TQR A;  5J2B A;  3UQ0 A;  4BWJ A;  3QEA Z;  2JZB B;  3D2S A;  4DL3 A;  3M7D A;  4F50 A;  4XUS A;  2HOF A;  2BQ3 A;  4RPX A;  4C4R A;  3PML A;  2W8K A;  3N7P D;  2HBJ A;  2HBL A;  2GWS A;  5ALK A;  4AYB C;  8ICF A;  4QZI A;  4EEL A;  3RR7 A;  2MUT B;  3UMG A;  3PR5 B;  5J0S A;  4NLB A;  2VA3 A;  2MUT A;  9ICB A;  8ICA A;  4FBU A;  3BS7 A;  3M6Z A;  4QJF B;  2QAR B;  2XY6 A;  3RF9 A;  1IM4 A;  1U47 A;  2QAR A;  5AI9 A;  2OH2 A;  4Y2J A;  3I1Y A;  4UAS A;  2BZF A;  2W55 A;  3LK9 A;  4Q8E A;  2UVW A;  8ICK A;  1ZQQ A;  3Q8Q B;  3AM9 A;  3SEI A;  4PZO A;  2BCR A;  2ALZ A;  1L7M A;  2HSZ A;  4RZR A;  2CPR A;  1S9F A;  4UQG A;  1X40 A;  2F8K A;  4IQT A;  3ETL A;  1BVS A;  2HHV A;  4XQ8 A;  2KEY A;  1D8B A;  1VDV A;  4PHD A;  2K8A A;  3T5H A;  1CI4 A;  1SV4 A;  4RPZ A;  4QWD A;  4B9S A;  1XSL A;  3GZF A;  7ICV A;  2CN1 A;  4QZH A;  3NVY A;  2I5H A;  3GDX A;  4FO6 A;  7ICG A;  3RJF A;  5K4L A;  5AIC A;  3ZD9 A;  2C2D A;  2HOI A;  2AH5 A;  4C80 A;  1HUZ A;  5T14 A;  3DV9 A;  2PMZ F;  3NS1 A;  4C8O A;  5AK6 A;  3HPO A;  4RQ0 A;  1X9S A;  3NTU A;  1QSS A;  1U9L A;  3H8M A;  4J9Q A;  3EPI A;  5HR6 A;  5J0T A;  2PI4 A;  1JN3 A;  4OCZ A;  4RQ7 A;  5AM4 A;  2MU2 A;  4KN4 A;  3AU2 A;  4KLH A;  4PL1 A;  8ICH A;  1ZQF A;  5KFR A;  3NGD A;  1YT3 A;  3G6Y A;  1RYU A;  3JPO A;  1M6Y A;  3RAX A;  5J0P A;  7ICF A;  4NLK A;  2KIV A;  2P6U A;  2ZUC A;  1QQ5 A;  4KLE A;  5HMM A;  3G6V A;  3BS5 B;  1ZYQ A;  5HP4 A;  2A1A A;  3BQ1 A;  3M6K A;  3BS5 A;  3SD7 A;  5ALI A;  3HT3 A;  3TAR A;  2L5Y A;  3HIL A;  4IRD A;  3BQ7 A;  4QW9 A;  3GIM A;  1J97 A;  5AM1 A;  4DWI A;  4DSI A;  4R64 A;  3H8W A;  3AU6 A;  2RHF A;  4QWB A;  3IP4 B;  4KX5 A;  4ECS A;  1YZ6 A;  1KBU A;  1KFT A;  2NYV A;  4EBE A;  8ICW A;  1XS9 D;  1NK6 A;  1RPL A;  4UAZ A;  5AK4 A;  4DSK A;  1BPE A;  2K89 A;  5AHX A;  2XID A;  5KFV A;  1EXN A;  3AL0 B;  3NRW A;  2EAM A;  4DL2 A;  2FMS A;  2F44 A;  2W9C B;  4R65 A;  2YQE A;  4JB3 A;  5ALW A;  2W3S A;  2XC9 A;  1S0O A;  5A0L A;  5JUM A;  2HBM A;  5ALO A;  3KHG A;  4UB3 A;  2J6U A;  3JPS A;  3F5A A;  2NRX A;  1JI7 A;  3B0Y A;  1TVA A;  4O3N A;  3C1Z A;  4ED2 A;  1S8O A;  2W43 A;  2VIX A;  4YP3 A;  2HBK A;  2YTU A;  4FFD A;  4P0P A;  3AQF A;  4UAY A;  1ZQW A;  2IOH A;  1SB3 C;  4KX3 A;  4JWM A;  3HRD D;  3F2D A;  3E0F A;  4YFK A;  1PUZ A;  4F71 A;  2G09 A;  5CHG A;  3WKC A;  1WCL A;  4O9M A;  4G3I A;  4ECQ A;  3RJK A;  4XRH A;  1Z4O A;  3CNH A;  5KFL A;  1QQ6 A;  4ELU A;  4MF8 A;  3PNC A;  4BX9 C;  1ZQB A;  5IIO A;  1L7N A;  5CWR A;  4BGD A;  3H7I A;  3HWT A;  1L6N A;  2OM6 A;  2OWO A;  1ZXI A;  1ZQM A;  4USA A;  2BR0 A;  4ECW A;  2DBY A;  2BPC A;  2LHT A;  4DSJ A;  4ELV A;  5L9X A;  1XU4 A;  4O3M A;  5JU5 A;  4LZG A;  1L8O A;  2QB0 A;  3UPQ A;  2AGP A;  8ICJ A;  2LPE A;  4TQS A;  2W7P A;  3ICX A;  3LWL A;  2JGA A;  5KTQ A;  1FIQ A;  4ECV A;  9ICQ A;  2VJ4 A;  4UB2 A;  4F8R A;  3H8J A;  3CRX A;  3PST A;  2ASD A;  2W8L A;  4I27 A;  2WF9 A;  3H0R B;  3EYZ A;  2EQY A;  1SV0 A;  9ICU A;  5KFC A;  4R8U A;  5ALP A;  1N62 A;  2KMD A;  2ES6 A;  1S97 A;  4CNQ A;  2XCA A;  4FZL A;  5KG3 A;  2KZ3 A;  2W04 A;  1ZOL A;  5KFH A;  4M9J A;  1SKW A;  5III A;  5AIB A;  4I2C A;  3T5J A;  2Z7J A;  4PJ0 U;  4J9R A;  3KZX A;  2N1R A;  8ICP A;  3TKA A;  2VKQ A;  3L3F X;  3IN5 A;  4IQU A;  5AM5 A;  4M47 A;  3N4M B;  1K1S A;  4U7C A;  2NRZ A;  3D2Q A;  1QCK A;  4QZD A;  2UVU A;  1BGX T;  4EYH B;  4CDG A;  4ED8 A;  5ALZ A;  4KLO A;  1WYG A;  5G5H A;  1L8L A;  4E0D A;  4MFF A;  3QUC A;  5J0W A;  3ISD A;  1DK2 A;  4M9L A;  1UQV A;  5EWF A;  2BQR A;  3B9J A;  8ICQ A;  2HVH A;  9ICW A;  5J2K A;  2CRX A;  1NZP A;  2HOQ A;  2HHX A;  4YXM A;  3GIL A;  2B6G A;  1DGJ A;  4C4S A;  4JUZ A;  3WK5 A;  3MR2 A;  4O5K A;  2OYY A;  4G9B A;  3IHQ B;  4C8M A;  4KLD A;  1ZQ1 C;  1NKE A;  3V7J A;  5KFW A;  1ZJM A;  4B6J A;  9ICP A;  4YR3 A;  3KD3 A;  1N63 A;  2DKZ A;  2ZTD A;  3MGH A;  5L1L A;  2KZZ A;  1WWU A;  4TUS A;  3UQ2 A;  1FFU A;  4DQR A;  2KKP A;  3A0B U;  5CR0 A;  3R9K A;  4I2I A;  4IL6 U;  4P2H A;  1UCV A;  3ZDB A;  4UB1 A;  1OUQ A;  4Y2R A;  3MFI A;  3RB4 A;  5J0R A;  2M9N A;  3IDW A;  5TZV A;  2C2E A;  3HKZ C;  4KLS A;  5J2G A;  2RDJ A;  4DOC A;  4EBC A;  1S0V A;  3NAS A;  2AGQ A;  5AI6 A;  4YG2 A;  1SKS A;  2KJ9 A;  4B9M A;  3SMV A;  4Q45 A;  4NL9 A;  2YMM A;  3C1Y A;  3C2K A;  5AI4 A;  4K4G A;  3C28 A;  2GOL A;  9ICN A;  9ICM A;  1KW4 A;  4P0Q A;  3AMZ A;  4WJ3 B;  1S10 A;  1ZQO A;  4FZN A;  5C5J A;  2HW3 A;  5J0X A;  5EWE A;  3VCB A;  1WWV A;  1BNO A;  1LVH A;  1X2I A;  1ED1 A;  1PK1 B;  3D6J A;  3M8S A;  3M8R A;  3QX7 A;  4EX7 A;  3SV4 A;  1O08 A;  2JEJ A;  2BDP A;  4Y2T A;  3PR4 A;  4M6W A;  3F2C A;  4J9L A;  3F2B A;  9ICC A;  4LJX A;  3H4D A;  4CE6 A;  1RYR A;  1TAM A;  3SV3 A;  1IG6 A;  1KTQ A;  3OHA A;  3V6J A;  4RQ2 A;  4KTQ A;  5KG2 A;  4CF5 A;  3J81 j;  2LM1 A;  4DLE A;  4M9G A;  3RJH A;  5KFF A;  4ECR A;  4DO9 A;  1Z00 B;  5AIA A;  2K4H A;  1ZQK A;  4F2S A;  1QQ7 A;  4EX6 A;  2DFL A;  5DLF A;  3RB0 A;  3KKA C;  5DBB A;  2H3Z A;  1MQ2 A;  5J2I A;  5F9N A;  5DG7 A;  5DB9 A;  2YMP A;  3PSI A;  1T94 A;  4DFP A;  3HJE A;  3HP6 A;  1D9F A;  4ED0 A;  3JPT A;  4EYI B;  1Q8K A;  8ICS A;  1PK3 A;  4NV0 A;  8ICZ A;  1RXV A;  1DGS A;  2H3I A;  2KNJ A;  1N5W A;  1X6J A;  1ZD4 A;  2WB1 F;  4DFD A;  1WG8 A;  4DQP A;  4I28 A;  3PW0 A;  4Y2X A;  2V4Q A;  2XGP A;  5ALD A;  4QNL A;  4J03 A;  5IIL A;  3C2L A;  4NXZ A;  4OJO A;  3C5F A;  1BPY A;  2G0A A;  4IRC A;  5DQH A;  2BPF A;  4Q43 A;  2FPK A;  4KLJ A;  1S0M A;  4Q44 A;  3TQ1 A;  4M04 A;  2FLL A;  5KFO A;  2D8C A; 
#chains in the Genus database with same CATH homology
 4Z6D A;  4F5Q A;  1KDH A;  7ICK A;  4KLT A;  4KLM A;  4MF2 A;  3UXP A;  3HT3 A;  3GIK A;  2ZJ5 A;  3TAR A;  4F92 B;  3LDA A;  3IM1 A;  7ICI A;  3MDC A;  4JV0 A;  5J2C A;  4DEZ A;  4IRD A;  1TAQ A;  3GIM A;  4QW9 A;  2V4R A;  2B21 A;  1C7Y A;  2VA8 A;  4J9M A;  3T5L A;  4DWI A;  4LVS A;  1H38 A;  4ED7 A;  4KLF A;  3Q8K A;  4R64 A;  3Q8P B;  2WTF A;  4DSI A;  4IR9 A;  4F5P A;  4PGY A;  3H8W A;  2R8I A;  3AU6 A;  1ZQU A;  4GXK A;  2VAN A;  4RPY A;  3GIJ A;  5CA7 A;  5J2E A;  4F4X A;  3RB6 A;  4QWB A;  1ZJN A;  4B9U A;  2P66 A;  4CCH A;  4C8N A;  2C22 A;  1QSY A;  2IMW P;  5DQG A;  1COO A;  2XO7 A;  1ARO P;  4ECX A;  3M9N B;  4DQI A;  4M0A A;  5BOM A;  4O5C A;  2I1Q A;  3RRG A;  2HHS A;  3TAN A;  3PX6 A;  2JEF A;  4JWN A;  4ECS A;  4DFK A;  8ICR A;  4YQW A;  2R8H A;  1ZQH A;  4TUR A;  1ZQX A;  5DGA A;  4MFC A;  9ICL A;  1KFT A;  2I9G A;  1N48 A;  4EBE A;  4RQ8 A;  8ICW A;  3ISB A;  4P4P A;  1XS9 D;  1NK6 A;  1TK0 A;  3C5G A;  1RPL A;  4UAZ A;  2FLL A;  1ZQA A;  4QZ9 A;  4DSK A;  5KG6 A;  1BPE A;  4R63 A;  2NRV A;  4EEY A;  4PH5 A;  4P4M A;  4M9H A;  4DL4 A;  1PZN A;  5KFV A;  1RYS A;  1U45 A;  4RUC A;  1EXN A;  3M9M B;  5KG5 A;  4M6W B;  4RT2 A;  1NOM A;  2FMQ A;  5D4B A;  1JX4 A;  4DL2 A;  4NLZ A;  5KFJ A;  3GFK B;  3N97 B;  2FMS A;  5D46 A;  4NY8 A;  4I2A A;  2W9C B;  4I29 A;  4BDP A;  2ZTE A;  8ICN A;  3BQT A;  3BDP A;  3PO5 A;  4RNN A;  3RRH A;  1ZQP A;  4PPX A;  1B22 A;  2R8G A;  4O3O A;  4R65 A;  4UBB A;  2R8K A;  3PX4 A;  4PHE A;  4DSL A;  4ED1 A;  3OJS A;  1KRP A;  2XC9 A;  1S0O A;  5JUM A;  1NK0 A;  2H5X A;  5DB7 A;  4QWE A;  4F5O A;  4ECT A;  1ZQS A;  2UVR A;  2XCP A;  3QZ7 A;  3V6K A;  3KHG A;  3TAQ A;  1T4G A;  4RQ6 A;  7ICU A;  4UB3 A;  3QEB Z;  2J6U A;  2KZM A;  3JPS A;  1MQ3 A;  3GV5 B;  2NRX A;  4J9P A;  3SI8 A;  4DSE A;  2ZUB A;  1TKD A;  4KLG A;  3B0Y A;  1UA0 A;  1TVA A;  2PFP A;  4O3N A;  1KLN A;  7ICV A;  3C1Z A;  4ED2 A;  5DLG A;  4UB5 A;  1NK9 A;  5J0Y A;  4EBD A;  3C2M A;  4EZ6 A;  2KFZ A;  4YP3 A;  4R66 A;  4IRK A;  2ZJA A;  1TFR A;  3ZDE A;  4QZB A;  2HHQ A;  7ICN A;  1UT8 A;  1ZQG A;  4BXO B;  8ICB A;  1NJY A;  3EWA A;  4J9S A;  4I2E A;  4DOB A;  4UAY A;  1ZQW A;  1U4B A;  3GV8 B;  9ICJ A;  4YN4 A;  2IHM A;  2BGW A;  1S0N A;  2UVV A;  5IIN A;  2AU0 A;  4YCX A;  2LYH A;  4ECU A;  4JWM A;  5J2A A;  4GXJ A;  3PY8 A;  4YFK A;  5CHG A;  4Z6F A;  4M2Y A;  3Q8S B;  3RH5 A;  4Q8F A;  1ZQC A;  1WCL A;  4O9M A;  2KN7 A;  4NM1 A;  4ECQ A;  2BPG A;  4G3I A;  3RJK A;  5DKW A;  2W9B A;  4O3Q A;  4XRH A;  2PXI A;  3QZ8 A;  3H4B A;  5KFL A;  3RH4 A;  4ELU A;  4MF8 A;  3JPQ A;  3PNC A;  5L1K A;  1ZQB A;  2FLN A;  1S77 D;  5IIO A;  9ICX A;  1N56 A;  1TK8 A;  3UXO A;  5J0Q A;  5CWR A;  2Y1J A;  4ZH4 A;  4QW8 A;  3ZDD A;  5DDY A;  4BGD A;  5KFB A;  3H7I A;  4DS4 A;  3TI0 A;  3HWT A;  5KFU A;  4NM2 A;  2AGO A;  5DBC A;  5KT4 A;  2OWO A;  1ZQM A;  2W9M A;  2ZUD A;  4PGQ A;  3V72 A;  4NLN A;  3M9O B;  4F4K A;  3RB3 A;  4F91 B;  2BR0 A;  4ECW A;  2BPC A;  5KG0 A;  3ZD8 A;  1ZQR A;  3PO4 A;  1S76 D;  4I2D A;  5BPC A;  1XC9 A;  2C28 A;  2A1J A;  4F3O A;  2PFN A;  4O3S A;  4F93 B;  4QZ8 A;  4DSJ A;  4DF8 A;  4ELV A;  3Q8M A;  1NJZ A;  5L9X A;  5KT2 A;  1XU4 A;  1ZQI A;  1X9W A;  4LZG A;  3PVX A;  4RNO A;  3UPQ A;  2AGP A;  3OHB A;  2BQU A;  1L3V A;  5CJ7 A;  2FLP A;  4ELT A;  8ICJ A;  2JZB A;  7ICE A;  2XY7 A;  4ECY A;  4TQS A;  3GV7 B;  4F2R A;  4PHP A;  3LWL A;  4JV2 A;  9ICR A;  5KTQ A;  1NK4 A;  1ZQT A;  5KFZ A;  1A76 A;  4TUQ A;  4KMU A;  4F5N A;  4DSF A;  4ECV A;  9ICQ A;  3RBE A;  3ZDA A;  4UB2 A;  4F8R A;  2J6S A;  3H8J A;  4K4H A;  1UT5 A;  4YXJ A;  5HHH A;  5KT3 A;  1ZQE A;  1KFS A;  2HVI A;  9ICO A;  1XSN A;  2ASD A;  2W8L A;  4I27 A;  3PMN A;  2PFQ A;  2W9A A;  3EYZ A;  3FDS A;  5HML A;  9ICU A;  5KFC A;  4R8U A;  2PI5 A;  1SKR A;  4B9V A;  1SL2 A;  5KFN A;  1ZQD A;  9ICG A;  2AQ0 A;  2HHU A;  2BHN A;  3T3F A;  5KG7 A;  5KFM A;  4I2J A;  3EPG A;  1S97 A;  2C2R A;  1X9M A;  2IBK A;  4JV1 A;  2XCA A;  3RJI A;  1LB2 B;  5KG3 A;  3PW2 A;  1MSW D;  2ASL A;  2KZ3 A;  4O0I A;  1LV5 A;  4F4Y A;  1QSL A;  4I2B A;  8ICE A;  5KG4 A;  1Y88 A;  5KFH A;  4M9J A;  3OSP A;  1SKW A;  4RUA A;  8ICG A;  3MAB A;  5III A;  7ICL A;  1XO1 A;  4I2C A;  3T5J A;  1RZT A;  4YD2 A;  3GQC A;  2FPL A;  4J9R A;  3JPN A;  8ICP A;  4KLQ A;  3MFH A;  3V7L A;  3BJY A;  2ISP A;  1JMS A;  4YMN A;  4RQ5 A;  2KFN A;  4IQU A;  4MEX A;  4M47 A;  5KFP A;  3N4M B;  3TFR A;  2F1I A;  3PW4 A;  1K1S A;  1U48 A;  3H40 A;  3RR8 A;  2NRZ A;  4JK1 A;  2XGQ A;  5DB6 A;  2JEI A;  2ASJ A;  8ICU A;  4QZE A;  5J0U A;  4FBT A;  4QZG A;  3FYH A;  4F4Z A;  1T3N A;  4I2F A;  5DBA A;  5J2F A;  4QZD A;  9ICE A;  4P4O A;  1XWL A;  2UVU A;  3EW9 A;  1DOQ A;  3MR6 A;  5CB1 A;  1BGX T;  8ICM A;  4YD1 A;  1TAU A;  9ICS A;  4QWA A;  3JPP A;  4KLU A;  4EYH B;  5BOL A;  5KFI A;  4ED8 A;  4KLO A;  4FS1 A;  2J6T A;  3OSN A;  3V7K A;  3Q8R B;  4E0D A;  4MFF A;  5DQI A;  2AQ4 A;  1KEJ A;  3PW7 A;  5J0W A;  3PV8 A;  3ISD A;  5HNK A;  4MEY A;  4ED6 A;  3T5K A;  8ICC A;  4GLX A;  2DPI A;  4M9L A;  4Z6C A;  5EWF A;  5DB8 A;  2BQR A;  8ICQ A;  2HVH A;  5KT5 A;  9ICW A;  5J2K A;  1NJX A;  3H8S A;  5KFS A;  1L3S A;  4GC6 A;  4YXM A;  2IA6 A;  4RNM A;  2HHX A;  3EZ5 A;  3QE9 Y;  1JXE A;  2W9B B;  5KFG A;  4RT3 A;  3G6X A;  4DF4 A;  3GIL A;  1Z00 A;  1ZET A;  2FPM A;  5KG1 A;  4YR2 A;  3HX0 A;  1NJW A;  4DS5 A;  2BCU A;  4JUZ A;  4DL7 A;  3B0X A;  2JEG A;  2FMP A;  4I2H A;  7ICR A;  5HHI A;  3MR2 A;  1NKC A;  2BCV A;  1KFD A;  1L3T A;  4O5K A;  7ICJ A;  8ICO A;  4RQ3 A;  4IQW A;  4DL5 A;  3PX0 A;  4DFM A;  3IHQ B;  4C8M A;  3SZ2 A;  4KLD A;  4DL6 A;  1NKE A;  2HHT A;  4I2G A;  9ICI A;  1JIH A;  3V7J A;  9ICF A;  5KFW A;  1ZJM A;  9ICP A;  9ICH A;  3ISC A;  4UB4 A;  4YR3 A;  8ICY A;  7ICO A;  2ZTD A;  4RU9 A;  1HUO A;  1B43 A;  3MGH A;  5L1L A;  5KFE A;  2KZZ A;  5J2D A;  3KHH A;  4TUS A;  4O3P A;  5L1I A;  1BPZ A;  4B9T A;  2A1J B;  2BCS A;  4B9L A;  3UQ2 A;  1SZP A;  4DQR A;  3RAQ A;  2BKE A;  5CR0 A;  2KTQ A;  4K4I A;  3K4G A;  3SYZ A;  5D49 A;  1SL1 A;  1RXW A;  3RJE A;  1T7P A;  3MGI A;  4I2I A;  3PW5 A;  4UBC A;  4YMM A;  5J2J A;  4TQR A;  5J2B A;  3UQ0 A;  3Q8L A;  4P2H A;  4BWJ A;  3ZDB A;  3QEA Z;  5CP2 A;  4GXI A;  2JZB B;  1ZQL A;  2RDI A;  4UB1 A;  3OJU A;  1K1Q A;  7ICS A;  4QZC A;  3BQ2 A;  1ZQV A;  3JPR A;  4O3R A;  7ICQ A;  1NK5 A;  7ICH A;  3MFI A;  2AJQ A;  3RB4 A;  4DL3 A;  4F50 A;  4XUS A;  5KFQ A;  1BPD A;  5J0R A;  1JXL A;  2M9N A;  4X5V A;  5TZV A;  5DGB A;  2BQ3 A;  4RPX A;  2C2E A;  3UXN A;  5J2G A;  4KLS A;  2IHN A;  2RDJ A;  4Z6E A;  3KHL A;  4DOC A;  4EBC A;  3PML A;  1TV9 A;  4J9K A;  2W8K A;  4QWC A;  1S0V A;  8ICX A;  5EOZ A;  4R8U B;  2AGQ A;  5J2H A;  2GWS A;  8ICF A;  4QZI A;  1NK7 A;  4YG2 A;  1SKS A;  4B9M A;  3RR7 A;  4KLI A;  2MUT B;  3PR5 B;  4EZ9 A;  4DQQ A;  1ZQZ A;  5DDM A;  5J0S A;  4Q45 A;  3C1Y A;  5KFT A;  3RBD A;  3THV A;  2VA3 A;  3C2K A;  2MUT A;  9ICB A;  4ECZ A;  4K4G A;  4FBU A;  1L3U A;  2DPJ A;  8ICA A;  4XA5 A;  4FS2 A;  9ICN A;  8ICV A;  3MR5 A;  3RH6 A;  4YMO A;  9ICM A;  2NRW A;  2XY6 A;  3RJJ A;  1IM4 A;  3KHR A;  4DOA A;  4YVZ A;  1D8L A;  9ICT A;  2Y1I A;  4KN7 A;  1U47 A;  1XSP A;  3E2E A;  4PHA A;  4MFA A;  1S10 A;  3LK9 A;  1NKB A;  1ZQO A;  4Q8E A;  1ZQN A;  5KT6 A;  2UVW A;  8ICK A;  5C5J A;  4KIT B;  3ZDC A;  2ATL A;  4GC7 A;  5KT7 A;  1ZQQ A;  3KTQ A;  2HW3 A;  3Q8Q B;  4NLG A;  3MDA A;  2ISO A;  5J0X A;  5EWE A;  5F9L A;  1BPB A;  2F1J A;  8ICL A;  1QLN A;  2BCR A;  2ALZ A;  3RJG A;  1X2I A;  3RTV A;  2Q0Z X;  3BQ0 A;  4RZR A;  3MR3 A;  4PGX A;  1D8Y A;  5IIK A;  3AUO A;  4O5E A;  1KSP A;  3M8S A;  1S9F A;  3M8R A;  4UQG A;  3SV4 A;  2JEJ A;  2V9W A;  4IQT A;  3ETL A;  1WCN A;  2BDP A;  1BVS A;  3K75 D;  2HHV A;  7ICP A;  4XQ8 A;  1CEZ A;  8ICT A;  9ICV A;  3PR4 A;  4M6W A;  4LZD A;  3ORY A;  4J9L A;  4PHD A;  2MAX A;  3T5H A;  9ICA A;  4F4W A;  4ED3 A;  9ICC A;  3H4D A;  7ICT A;  1V9P A;  3V6H A;  1RYR A;  2W9C A;  5KFD A;  3SV3 A;  1KTQ A;  3OHA A;  4RPZ A;  4RQ2 A;  4QWD A;  3GII A;  3V6J A;  1XSL A;  4B9S A;  3TFS A;  4KTQ A;  5KG2 A;  4QZH A;  3GDX A;  4FO6 A;  7ICG A;  4DLE A;  1SL0 A;  3RJF A;  4M9G A;  5KFK A;  3RJH A;  5KFF A;  3ZD9 A;  2C2D A;  5IIJ A;  4TUP A;  4ECR A;  4DO9 A;  2XY5 A;  1L5U A;  1Z00 B;  2P6R A;  4B9N A;  1ZQK A;  4C8K A;  4QZA A;  4DQS A;  1HUZ A;  2BCQ A;  4F2S A;  4BWM A;  1BPX A;  5J29 A;  5DLF A;  1A77 A;  2DFL A;  2NRT A;  3OGU A;  5KFA A;  4J9O A;  4C8O A;  4QZF A;  3RB0 A;  1T8E A;  1D9D A;  2ZTC A;  3HPO A;  3C21 A;  4YR0 A;  5KFY A;  5DBB A;  4RQ0 A;  1X9S A;  1MQ2 A;  2R8J A;  5J2I A;  5J0O A;  4DFJ A;  9ICK A;  5F9N A;  3LWM A;  1MC8 A;  5DB9 A;  5DG7 A;  3NTU A;  1QSS A;  1U9L A;  5DG8 A;  4J9Q A;  5IIM A;  1ZQJ A;  3EPI A;  1Z3E B;  1QTM A;  4BXO A;  5EWG A;  4DFP A;  5J0T A;  3HP6 A;  1D9F A;  4J9N A;  3JPT A;  4ED0 A;  4EYI B;  1JN3 A;  2PI4 A;  1UA1 A;  4RQ7 A;  8ICI A;  8ICS A;  2ZJ8 A;  4UAW A;  4HYK A;  4KN4 A;  8ICZ A;  1RXV A;  4M9N A;  3C23 A;  1DGS A;  3AU2 A;  5L1J A;  5DG9 A;  2PFO A;  4KLH A;  1U49 A;  3HW8 A;  8ICH A;  4DLG A;  1ZQF A;  5KFR A;  3NGD A;  4I28 A;  4DQP A;  3G6Y A;  3PW0 A;  3JPO A;  2V4Q A;  4C8L A;  2XGP A;  7ICM A;  4KLL A;  4IQV A;  4F5R A;  5KFX A;  3RAX A;  5J0P A;  7ICF A;  4NLK A;  1HJP A;  2F1H A;  2HHW A;  1ZQY A;  4IR1 A;  2P6U A;  5IIL A;  3C2L A;  4NXZ A;  1NK8 A;  2ZUC A;  3C5F A;  1IXR A;  4KLE A;  3MBY A;  2VA2 A;  5HMM A;  1BPY A;  4IRC A;  1CUK A;  5DQH A;  3G6V A;  4Q43 A;  2FPK A;  2BPF A;  4RQ4 A;  1ZYQ A;  5HP4 A;  1S0M A;  4Q44 A;  3TQ1 A;  4M04 A;  4KLJ A;  1TK5 A;  3TAP A;  3BQ1 A;  4RQ1 A;  5KFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...