3BQTA

Crystal structure of a protein of unknown function from listeria monocytogenes, tetragonal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
NLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein of unknown function from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes str. 4b f2365
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 25
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bqtA00
1PZNA 2C2EA 3THVA 5KFKA 4ECRA 3LK9A 5KT4A 3HX0A 4O3OA 4EEYA 1L3TA 1KLNA 2VA2A 1ZQAA 2KZMA 3PW5A 2PFOA 4EBCA 4EZ6A 2B21A 3C23A 1S0OA 5DDMA 8ICZA 4RQ0A 4RNOA 2OWOA 1IXRA 4RUAA 4O3NA 5HMMA 4B9MA 3GFKB 2PFPA 4ELVA 4UBBA 4F4KA 1Z3EB 1NKBA 9ICIA 4PPXA 2HHXA 4J9LA 4HYKA 3PV8A 4TUPA 1X9WA 8ICGA 7ICIA 4F92B 1TV9A 1QSYA 1U49A 1NK6A 5J0PA 9ICFA 2BCSA 1SL0A 1K1SA 3GIJA 4DL7A 2I1QA 1L5UA 4RQ8A 4TQSA 3Q8MA 2ZJAA 1NK4A 2IHNA 8ICRA 4RPXA 9ICHA 4YFKA 4KLOA 4ECTA 2UVVA 4MFAA 2HHQA 1NK7A 3ORYA 3KHHA 4ED6A 4ED1A 5DLGA 3BJYA 3PR5B 1RYRA 2RDJA 3RJEA 3T5HA 3H8SA 3AU6A 3T3FA 1N56A 5KFZA 3SZ2A 1B22A 4BGDA 5HNKA 4JV0A 2KFZA 5DGAA 3KTQA 1ZQWA 4MF2A 3H8JA 3PMLA 3M8SA 4YMNA 3H40A 2IHMA 5DB9A 4F4YA 4KLMA 2JEGA 4RNNA 1BPZA 4XRHA 4YR0A 5KG0A 3EPIA 5IIOA 4DOCA 1KSPA 4M2YA 1JIHA 4DOBA 2C2DA 2BCQA 2XCAA 1S0MA 1SKWA 1LB2B 2AJQA 5KFNA 1ZQPA 4NLGA 4QZGA 3OSPA 3MR6A 1ZQCA 4YP3A 4J9RA 2VA3A 3MDAA 5JUMA 3HW8A 1RXVA 2ZUBA 3RJFA 4M0AA 7ICLA 3SI8A 2BCUA 1DGSA 2W8LA 4M9JA 7ICNA 3C2KA 1UA1A 1S77D 4I2BA 4O5EA 4O3PA 1S10A 3K75D 3T5LA 3SV3A 1XSNA 1ZQJA 1ZQMA 2JEIA 3KHGA 4RPZA 3M9OB 3EW9A 4GXIA 5KG4A 3HT3A 4GC7A 4UB5A 2Y1JA 3RAQA 3T5JA 1JXEA 2NRVA 4O3RA 2MAXA 2ASJA 5BOLA 5L1IA 4JK1A 3H7IA 5EWGA 5J0SA 5J2DA 3GQCA 1NKCA 4NLKA 2NRWA 4ECUA 7ICTA 2J6SA 2PXIA 4I2FA 5KFWA 4FS1A 1S0NA 3ZDEA 3LWLA 2Q0ZX 4TURA 4RQ6A 1HJPA 3NTUA 1K1QA 5CA7A 2DPIA 1ZJMA 5IIKA 4QWAA 4JV1A 4LVSA 2R8HA 5DQHA 3Q8RB 9ICWA 4GLXA 5BOMA 1LV5A 4IRCA 2ASDA 2BPGA 2IMWP 4EBEA 3K4GA 4DL2A 4ED3A 5DG9A 1RPLA 1D9DA 8ICXA 4IQWA 5DB6A 2ZUCA 2XY7A 4DFPA 3T5KA 4QWEA 7ICOA 2V4RA 1NJYA 3FDSA 5J0WA 9ICPA 2P6RA 1ZQSA 1D9FA 5KG1A 4KTQA 1XS9D 4KLLA 5KFBA 1L3SA 4M6WB 4NM2A 1ZQQA 1NK5A 1NK0A 4ELUA 8ICPA 2W9CA 7ICFA 2JEFA 2F1IA 4QZCA 5CR0A 8ICJA 4GXKA 5IIMA 4KLUA 3RAXA 1NKEA 4IQUA 3PVXA 3MDCA 1T4GA 1V9PA 5L1JA 4F5NA 2AGPA 5KG6A 1T8EA 1N48A 1QTMA 1RZTA 3C2MA 4F5OA 2PFQA 1B43A 5D4BA 3M9NB 4F91B 2ZTCA 4TQRA 1SKSA 3C1ZA 1MQ3A 2BHNA 4DL3A 1ZQKA 4J9SA 4KN7A 3MBYA 1JX4A 4YMMA 4F2RA 2ZJ5A 5D46A 5KFVA 3JPOA 4JUZA 4QZAA 4DFMA 5KTQA 4UBCA 3RRHA 4LZDA 2FPKA 4M9LA 5J0YA 8ICYA 4C8LA 5KFHA 3QE9Y 4P4MA 5KFOA 4F4WA 4DQPA 4Z6CA 1ZQIA 1TAUA 9ICQA 1KTQA 1ZQOA 1ZQGA 2XC9A 1ZQRA 1TFRA 2FMQA 4B9NA 1ZQFA 5IIIA 4YCXA 4BXOB 3B0XA 4QWDA 4TUQA 3V7LA 3H4DA 4F93B 2ZTEA 3MGIA 2BQ3A 4YR3A 4YR2A 4DS5A 1U47A 2BGWA 4I2AA 5EWFA 4F5RA 9ICCA 3QZ8A 2RDIA 2W9BA 9ICOA 3OHBA 4C8MA 5L9XA 3MFIA 4DLEA 4DS4A 2AQ0A 3Q8SB 1KFTA 4I27A 2JZBA 4DLGA 3RTVA 3SV4A 2AGQA 2HHSA 2KFNA 4NXZA 2WTFA 4KLJA 3MGHA 3PO5A 3RBDA 2W9CB 5KT3A 5J0TA 1XC9A 4ED7A 1L3VA 2HVHA 2GWSA 5KFGA 3RH6A 5KFYA 2ZTDA 4KLFA 4Z6FA 4DSEA 3GIKA 4IQTA 1H38A 5F9NA 4ED8A 3SYZA 1COOA 4KMUA 4DEZA 3JPPA 2R8JA 1JN3A 5KG3A 4FS2A 2UVWA 4ECZA 2P6UA 2JZBB 2FLLA 2XY6A 2Y1IA 1TAQA 5KG5A 4DQRA 4J9KA 1DOQA 3EPGA 3JPQA 8ICMA 9ICKA 3JPNA 5L1LA 4JWMA 2UVRA 4DWIA 2JEJA 4YMOA 4O3QA 3G6VA 4TUSA 3B0YA 3OSNA 5J0UA 1U45A 3UXNA 4RUCA 4R66A 5CP2A 7ICMA 1XSLA 4P2HA 4Z6DA 3RJHA 1Z00A 1S9FA 4P4OA 1KEJA 2I9GA 4I2HA 5KFMA 4YD2A 1XU4A 4UB1A 3MFHA 2HW3A 4F50A 2W9MA 3TFSA 4DQIA 3Q8PB 8ICQA 9ICLA 3NGDA 1UT5A 3PY8A 4O3SA 7ICKA 4ECSA 3BQ0A 3ISCA 4FO6A 1QLNA 4M6WA 3TFRA 1NK8A 1MQ2A 3ZD9A 3PX4A 1BGXT 4KLGA 5J2IA 5DB7A 3V7JA 1X9MA 1XSPA 9ICVA 4I28A 3C5GA 4MEXA 9ICEA 3M8RA 3TAQA 2HHTA 4QZIA 3QEBZ 5KT6A 4DF4A 9ICBA 2XY5A 7ICSA 1X9SA 2BCRA 4KLHA 7ICVA 4GXJA 2MUTA 1TK5A 3RB4A 5J2CA 7ICHA 1QSLA 3N97B 4G3IA 5IINA 3AUOA 2A1JA 3TI0A 5J0OA 2FLPA 5CB1A 4MF8A 2KN7A 5J2HA 4DSJA 4I2CA 4IR9A 3ZDAA 1S0VA 1SKRA 4EYHB 4EBDA 4DFKA 1JXLA 2HHUA 5IIJA 5KFLA 1HUZA 3BDPA 1C7YA 4PH5A 4RQ4A 8ICVA 3HWTA 3EZ5A 3ISBA 5IILA 2PFNA 4YVZA 4M9NA 5EWEA 4F4ZA 1ZETA 4J9QA 4PHDA 3G6YA 4JV2A 1XO1A 4UAYA 5KFAA 4KLIA 4R63A 1Z00B 4KLDA 4Q8EA 2F1JA 1A77A 5EOZA 2R8KA 8ICFA 4M04A 4P4PA 4BXOA 5J2GA 4IQVA 3AU2A 1BPXA 4K4HA 4Q44A 4K4GA 4J9MA 3RJIA 4PHAA 4RPYA 5J2KA 4DL4A 4B9LA 1U4BA 2W9BB 3EWAA 4YG2A 1UT8A 4XA5A 5J0QA 1MC8A 5C5JA 2ZJ8A 4ZH4A 3BQ2A 3TANA 8ICOA 5DDYA 2XCPA 3PNCA 2BDPA 4E0DA 8ICEA 3UQ2A 4J9PA 5KT7A 3KHLA 4RQ7A 4IRDA 1KDHA 8ICTA 8ICAA 4I2JA 4B9VA 8ICCA 3C1YA 3JPSA 4MEYA 4B9UA 4R65A 7ICUA 4J9OA 8ICHA 4PGYA 4RZRA 2KZZA 1SZPA 2BKEA 4BWMA 1ZQVA 1Y88A 3MABA 2XO7A 3UPQA 4Q8FA 4YXJA 4QZ8A 2P66A 1KFDA 4QW9A 5L1KA 2FMPA 3Q8QB 1WCLA 4DL5A 1WCNA 4FBTA 1BPYA 1MSWD 5KG7A 1UA0A 4F2SA 2UVUA 4KLQA 5DG7A 4DL6A 3ISDA 3PX0A 4I2EA 5J0XA 3RR8A 5J2FA 7ICGA 1IM4A 4I2DA 4RQ3A 1RYSA 1T3NA 3RH4A 5J0RA 3GV8B 2FLNA 5KFDA 3ZDDA 3GIMA 4LZGA 7ICPA 8ICUA 4FBUA 3FYHA 2ASLA 2NRTA 4QZDA 4ECVA 2C2RA 4KLTA 3GILA 1ZQXA 1ZQZA 4BWJA 4O5CA 5KT5A 4RQ5A 3G6XA 3PW7A 4O9MA 4R8UA 5KT2A 3KHRA 1ZQLA 5KFQA 1NK9A 3HPOA 3GV7B 1TK8A 3Q8LA 1JMSA 5KG2A 2C28A 2W9AA 1TVAA 1NJZA 3UXOA 1BPBA 1ZQYA 2PI5A 4QZEA 1KFSA 1A76A 2BQUA 4DO9A 9ICTA 3HP6A 1NJXA 3RRGA 3ZD8A 5D49A 1X2IA 2F1HA 9ICUA 4ECQA 4F5PA 2FPMA 5TZVA 5F9LA 3GDXA 9ICAA 4M9HA 3QZ7A 4MFFA 3Q8KA 9ICJA 8ICNA 3V6HA 2VANA 4UQGA 4M9GA 4Q45A 5DQIA 3M9MB 2ISOA 4NLNA 4QZBA 1ZYQA 4DFJA 4KLSA 1ZQBA 4RT2A 1U9LA 3OJUA 2M9NA 4DSIA 4ELTA 2A1JB 4DSFA 3PO4A 2PI4A 9ICSA 3RB3A 5KFCA 4I2IA 5HHIA 4YN4A 8ICKA 5J2BA 4UAZA 3GIIA 5KFUA 4KITB 2IBKA 5DQGA 1NOMA 3BQTA 4Z6EA 4IRKA 4C8KA 1TK0A 4KN4A 1ZQDA 2XGPA 2FMSA 2KTQA 5KFXA 4NLZA 1BPEA 1TKDA 3PW4A 1QSSA 3RB6A 2ISPA 9ICGA 3IHQB 2BR0A 3OJSA 5KFRA 4ED2A 3H8WA 8ICLA 4YD1A 2W8KA 4RQ2A 7ICRA 5HHHA 5KFEA 4QZHA 4Q43A 4O0IA 4R64A 4RQ1A 3N4MB 4KLEA 4ECXA 5KFPA 3GV5B 2HHWA 1RXWA 3RJJA 5KFIA 3UXPA 2NRXA 3TQ1A 1ZQNA 1CUKA 3JPTA 3V7KA 5DLFA 2AQ4A 4O5KA 4DSKA 1SL1A 5KFTA 4UB2A 2HVIA 7ICEA 9ICXA 9ICNA 5KFJA 4GC6A 2V9WA 1KRPA 4CCHA 4C8NA 3RH5A 8ICBA 2J6UA 4I29A 2H5XA 3JPRA 2BPFA 7ICJA 4RNMA 4K4IA 5CWRA 8ICIA 1D8YA 4DSLA 4F5QA 3LDAA 4ED0A 3BQ1A 4PGXA 3EYZA 4F8RA 3MR2A 1EXNA 3C2LA 2ALZA 4QZ9A 3OHAA 4UB4A 2IA6A 3OGUA 4ECYA 2AU0A 4YQWA 2BQRA 3RJGA 2BCVA 3UQ0A 1ZQHA 5DBCA 4C8OA 4EZ9A 1CEZA 3TAPA 2VA8A 4F3OA 1BVSA 3RBEA 4DQSA 3RB0A 3PMNA 4JWNA 2AGOA 2LYHA 5DG8A 2C22A 4PGQA 5DB8A 2R8GA 5J29A 4BDPA 1D8LA 4NY8A 4PHEA 3MR3A 2KZ3A 5J2JA 5HMLA 1NJWA 1T7PA 4UB3A 2NRZA 2FPLA 4R8UB 3RJKA 2MUTB 2J6TA 8ICWA 4I2GA 1L3UA 4PHPA 3C21A 4NM1A 3PX6A 3V6KA 4DF8A 1BPDA 2R8IA 4ECWA 1U48A 3ZDCA 8ICSA 2BPCA 4XQ8A 5J2EA 5KFSA 3PW2A 1SL2A 5KFFA 5DBBA 1ZQTA 2ZUDA 1ZQUA 2XGQA 5HP4A 2DFLA 5CHGA 3ZDBA 9ICMA 4IR1A 3QEAZ 5DBAA 4DQQA 3E2EA 3PW0A 5BPCA 4X5VA 4B9SA 2DPJA 4YXMA 3PR4A 3LWMA 3ETLA 1HUOA 1AROP 4QWBA 5DGBA 4MFCA 4QWCA 2HHVA 2V4QA 3H4BA 4F4XA 4B9TA 4M47A 1S76D 3IM1A 9ICRA 1XWLA 4XUSA 3C5FA 3V6JA 2ATLA 4QZFA 5DKWA 5CJ7A 4DOAA 4UAWA 1S97A 5J2AA 4RT3A 1ZQEA 3TARA 3RR7A 4EYIB 3V72A 3MR5A 4QW8A 1ZJNA 4J9NA 4RU9A 7ICQA
chains in the Genus database with same CATH superfamily
5KFKA 4ECRA 4EEYA 4O3OA 3PW5A 5G5HA 5DDMA 4RQ0A 4RNOA 3GFKB 1Q8KA 2KE7A 2W43A 2EDUA 3I28A 1PVPA 2F77X 8ICGA 2E5SA 2ZIVB 3TADA 1U49A 1NK6A 9ICFA 1SL0A 1K1SA 4DL7A 4TQSA 4KLOA 4ECTA 3ORYA 1RYRA 2KIWA 3T3FA 3OTQA 5KFZA 1B22A 5HNKA 1VDVA 1ZQWA 3CRXA 3H8JA 5DB9A 1BPZA 4XRHA 4M2YA 2BCQA 1SKWA 2VA3A 2K4PA 3S6JA 5JUMA 3HW8A 7ICLA 3WK6A 2W8LA 3WKAA 2G08A 7ICNA 3QUQA 3C2KA 1UA1A 4O5EA 1ZQJA 3M6ZA 1PVQA 4GXIA 5JU5A 4UAVA 2MAXA 1NKCA 4Y2RA 2N1RA 3NASA 3U26A 4TURA 4Y2QA 2B6GA 4JV1A 4LVSA 9ICWA 4GLXA 2ZIUA 2BPGA 1HEKA 4ED3A 3QU4A 1RPLA 5KAIU 1D9DA 4IQWA 5G5GA 5DB6A 2XY7A 7ICOA 3T5KA 2V4RA 1NJYA 5AI0A 4KLLA 1L3SA 7ICFA 2JEFA 2LM4A 3ONNA 5IIMA 1RQNA 4IQUA 2VIXA 4F5NA 1V97A 1B43A 4UAUA 4F91B 3SAFA 4TQRA 2JMGA 1D8BA 3MBYA 1LKYA 4YMMA 3D6JA 1X66A 5D46A 2HI0A 4OJLA 5TISU 4DFMA 4PZOA 2FJ6A 2FPKA 4GIBA 1YT3A 4C8LA 2Y9TA 3QE9Y 4F4WA 4UATA 3WK5A 4BUGA 4B9NA 1L7PA 2JXJA 2JRZA 5IIIA 3H4DA 2BQ3A 3QZ8A 2HHSA 4NXZA 1DRGA 3VC8A 3RF9A 2HVHA 5KT3A 1L3VA 2GWSA 3MC1A 2OEHA 2ZIWB 2F2AB 4CNQA 4Z6FA 4DSEA 1SWVA 2DF4B 1JN3A 3KZIU 2BDUA 2P6UA 3HRDD 2FLLA 4DQRA 4AYBC 1V85A 8ICMA 3JPQA 2WHEA 9ICKA 3JPNA 4EENA 5L1LA 2UVRA 5ALPA 2JEJA 2H3VA 4TUSA 3B0YA 1X9XA 5AM4A 4R66A 5CP2A 2KSOA 2ZXHA 4P4OA 5KFMA 4YD2A 3MFHA 8ICQA 3NGDA 1UT5A 4O3SA 2E1EA 2W7OA 4M6WA 3TFRA 1NK8A 3ZD9A 2LM1A 5DB7A 1YZ6A 3M8RA 9ICBA 3AN1A 4DF4A 2ES6A 3RB4A 5J2CA 5KL8B 5AM2A 3N97B 1HIWA 2KSOB 5AM0A 5J2HA 4DSJA 4I2CA 1SKRA 4EYHB 2VKQA 3AM9A 2HHUA 3ED5A 2KNJA 5IIJA 5KFLA 4PH5A 4RQ4A 5KNIA 3EZ5A 4F4ZA 2K4EA 4J9QA 1FFUA 5CRXA 2KP7A 4CF4A 1A77A 2WB1F 4UASA 8ICFA 3F5AA 4PL1A 4M04A 4P4PA 4BXOA 4WJ3B 5J2GA 4K4HA 1BPXA 4Y2JA 3HKZC 2ZJ8A 4ZH4A 4EX6A 3BQ2A 1Q3VA 2ZG6A 2KVCA 4E0DA 8ICAA 8ICHA 7ICUA 2KZZA 3F5EA 1SZPA 5ALLA 3MABA 3UPQA 4Q8FA 2D8CA 2P66A 1WCNA 3FM9A 1MSWD 1UA0A 2HBLA 2MU2A 4C4SA 4DL6A 4I2EA 5J0XA 3RR8A 3NS1A 3SEIA 3CW2C 4RQ3A 5J8YC 7ICPA 5J0RA 3GV8B 3ZDDA 3GIMA 4LZGA 4FBUA 2ASLA 3KOOA 4ECVA 1ZQXA 4BWJA 2Q4TA 3A0HU 3G6XA 4O9MA 2LI6A 3DEEA 1WWUA 5EE1A 5ALHA 3Q8LA 1JMSA 1BPBA 1ZQYA 1JUDA 5AKZA 4QZEA 1KFSA 1A76A 9ICTA 1NJXA 2R18A 4EX7A 5ALJA 3ZD8A 3QUBA 5D49A 9ICUA 5F3XB 3QZ7A 3NVYA 3Q8KA 8ICNA 3TACB 5AK3A 1KN5A 4DFJA 2K8CB 3LVVA 2A1JB 2XICA 5HHIA 3WKDA 4UAZA 3GIIA 5KFUA 1NOMA 5K4LA 4IRKA 1NI3A 1A0PA 5EE0A 1TK0A 2XGPA 3QYPA 1BPEA 1PK3A 9ICGA 3IHQB 3UMGA 2BR0A 4GFJA 5KFRA 8ICLA 3H8WA 3AQFA 7ICRA 5HHHA 5KFEA 4LJXA 4UW9A 4Q43A 4KLEA 1RXWA 3RJJA 2H3FA 3UXPA 5EE9A 3TQ1A 1ZQNA 3F2DA 5DLFA 2AQ4A 9ICXA 2NO5A 5KFJA 3M6KA 1L6NA 2H5XA 3JPRA 4DSLA 4PGXA 1PK1A 4F8RA 1EXNA 1KBUA 4ECYA 4YQWA 3K1ZA 5AK5A 5DBCA 1X6IA 1B0XA 4C8OA 3GU3A 2YB1A 3TAPA 1BVSA 1IG6A 3PMNA 2C22A 5DB8A 3PSIA 2H3ZA 1T7PA 4Y2YA 2G5HB 2MUTB 2J6TA 2KV2A 4I2GA 1ZRMA 4DF8A 3CP8A 3ZDCA 2BPCA 2W3RA 1SL2A 5KFFA 5DBBA 2ZUDA 5HP4A 2IOFK 3E2EA 2KIVA 4YXMA 1HUOA 1AROP 2HHVA 4B9TA 9ICRA 2ZXIA 1S97A 3AEVA 1SWWA 3V72A 3C29A 3MR5A 5B66U 1ZJNA 4J9NA 3HILA 2KMDA 4NLKA 1L3TA 5KT4A 3HX0A 1KLNA 2KZMA 4C80A 5ALVA 4EZ6A 2B21A 1S0OA 1B4FA 3DV9A 4RUAA 4O3NA 4B9MA 1OXJA 2QB0B 2PFPA 4ELVA 4PJ0U 1NKBA 9ICIA 4PPXA 4J9LA 3PV8A 4F92B 1TV9A 1QSYA 4USAA 1Z4OA 4NWIA 2KD1A 2IOFA 4RQ8A 3SR6A 4MFAA 2HHQA 1Z4NA 1NK7A 5AI8A 5DLGA 3PR5B 3BQ7A 2RDJA 3KBBA 4AP9A 3AU6A 5JRTA 1N56A 3SZ2A 1IV8A 5DGAA 3KTQA 4MF2A 3PMLA 2JEGA 4OCZA 5AI9A 4YR0A 1JIHA 2XCAA 2AJQA 4QNLA 1ZQPA 8ICEA 3OSPA 3R9KA 3MR6A 4YP3A 4J9RA 1RXVA 2ZUBA 3RJFA 4M0AA 1DGSA 4NLCA 2DUYA 1S77D 4I2BA 3T5LA 3KHGA 3M9OB 3EW9A 5KG4A 2GOLA 4UB5A 2Y1JA 3RAQA 1JXEA 2ASJA 5L1IA 3AQEA 5J0SA 2NRWA 1N5WA 5AICA 4FS1A 1S0NA 3PSPA 1RQLA 5CA7A 1FEZA 1DXSA 2R8HA 3Q8RB 2ASDA 2VJ5A 3K4GA 3F2CA 4QWEA 2P6RA 3WKCA 1XS9D 4CGZA 1NZBA 1L7OA 2DQNB 4ELUA 2W11A 4AYBF 4GXKA 2E8OA 4KLUA 3MGVA 1T4GA 1O08A 1N48A 1QTMA 3T79A 1RZTA 4F5OA 2PFQA 5D4BA 2JGAA 2OM6A 4EEKA 1SKSA 2BHNA 1ZQKA 4J9SA 4JUZA 4EELA 4UBCA 3AMZA 4LZDA 8ICYA 1DGJA 1ZQOA 2FMQA 1ZRNA 3B0XA 2ZIWA 2ZTEA 4YR3A 1U47A 2BGWA 9ICCA 5EWFA 2RDIA 1SIJA 1N2XA 3NRWA 4DS4A 4I27A 4RQNA 5JTIA 2W9CB 5J0TA 1SV0C 4UB6U 1KQQA 4KLFA 4ED8A 1JI7A 4KMUA 4DEZA 3JPPA 1F5SA 2R8JA 5T14A 2L5YA 3N7PD 2K89A 2WB1C 4DWIA 2EAMA 3OSNA 5AK4A 4CE6A 5J0UA 1U45A 3UXNA 7ICMA 3H0LB 4Z6DA 2G0AA 1Z00A 4OD0A 2BZFA 1KEJA 2I9GA 2HW3A 2W9MA 3Q8PB 3H8MA 1YZ7A 4ECSA 1QLNA 2EAOA 1J2NA 1MQ2A 1MA7A 5J2IA 5GTHU 3V7JA 1XSPA 4OO1J 3QX7A 1RG6A 3TAQA 3QEBZ 5KT6A 5E79U 2XY5A 2KKPA 2FLPA 5J0OA 1L7NA 3IG8A 2KN7A 3ZI4A 3SD7A 1HUZA 1C7YA 8ICVA 3HWTA 1KW4A 3ISBA 2AHOB 2G09A 4M9NA 1ZETA 4PHDA 1XO1A 4UAYA 5KFAA 1Z00B 4Q8EA 2KICA 5EOZA 2W03A 1LVHA 4K4GA 4J9MA 5J2KA 4DL4A 2W9BB 3N7RC 1N62A 3TANA 2NYVA 2G07A 1BNOA 8ICOA 5DDYA 2K8AA 2BDPA 5KT7A 8ICCA 3NRZA 3JPSA 1NZPA 2JH7A 4RZRA 2WF6A 1ZQVA 2XO7A 2ZIUB 1KFDA 5L1KA 1RDFA 1WCLA 1DK3A 1XO0A 4F2SA 2UVUA 1A6SA 2QKQA 5C0YA 4KX3A 3ISDA 1RYSA 5KFDA 8ICUA 1ZD3A 4QZDA 4KLTA 1JRPA 4O5CA 4R8UA 5KFQA 5AIAA 1TVAA 1NJZA 2JH1A 2PI5A 1LKYB 1N60A 2BQUA 3HP6A 3K1RB 2A19A 5ALTA 2F1HA 4ECQA 3GDXA 3I1YA 9ICJA 2YB4A 2YQEA 3V6HA 4M9GA 4Q45A 2Y9UA 1ZQBA 4RT2A 4DSIA 2WF7A 2PI4A 5KFCA 5J2BA 4OJPA 5DQGA 4P0QB 2QARB 5FP0A 1TKDA 3D2QA 1PK1B 4YD1A 2W8KA 4RQ2A 4CDGA 4QZHA 4O0IA 5KFPA 3GV5B 2HHWA 1WWVA 1CUKA 2WAQF 3JPTA 4P0PB 1SL1A 2HVIA 3BS5B 4Y2TA 4MHVA 4PZNA 4CCHA 2J6UA 3WK7A 1Q46A 7ICJA 1UHUA 1D8YA 4F5QA 1X42A 3BQ1A 3EYZA 2E8NA 3H0MB 4QZ9A 4UB4A 3KZXA 3OGUA 4C4TA 2BCVA 3UQ0A 1ZQHA 2CPRA 2KHVA 2VA8A 3M7DA 4DQSA 1RYUA 4JWNA 2AGOA 4FZLA 5ALNA 5AKLA 2HOQA 4UB3A 2NRZA 2FPLA 4R8UB 3H0RB 8ICWA 2HBMA 1L3UA 4NM1A 3QNMA 2R8IA 4XQ8A 5J2EA 3PW2A 1ZQUA 4PL2A 1ZD2P 3QEAZ 3NVZA 4OJ5A 2WF9A 2YMPA 5BPCA 4X5VA 4B9SA 2EZZA 3LWMA 2KKVA 3ETLA 4MFCA 2K4HA 3H4BA 1S76D 3IM1A 4XUSA 3C5FA 4M47A 1ZQEA 2KG5A 5ALGA 1PZNA 2C2EA 3LK9A 4EBCA 3E58A 2WFAA 2WF8A 1IXRA 4F4KA 1O03A 2HHXA 4HYKA 4TUPA 7ICIA 5AKEA 2DKZA 5AKJA 2BCSA 3GIJA 1L5UA 1X6JA 3Q8MA 2ZJAA 4RPXA 2LYBA 4ZOHC 3KHHA 4ED6A 2RQ5A 2YMLA 3T5HA 3H8SA 1S5LU 4BGDA 5ALEA 2KFZA 3NVWA 2EH9A 2IHMA 4NL9A 4DOCA 4DOBA 1S0MA 1XNSA 5KFNA 4NLGA 4QZGA 1K5OA 3SI8A 2FI1A 4ICAA 4O3PA 1S10A 3K75D 1ZQMA 4FZNA 2NRVA 4O3RA 3L4PA 2A1AA 3H7IA 5J2DA 2XVTA 2JV3A 4FZMA 2PXIA 4I2FA 1QH9A 1HJPA 3NTUA 1K1QA 1ZJMA 4QWAA 2PMZC 5DQHA 1LV5A 2Z7JA 2IMWP 4EBEA 4G9BA 5KAFU 5DG9A 5AKYA 8ICXA 4B6JA 9ICPA 5J0WA 1ZQSA 1D9FA 5KG1A 4KTQA 5KFBA 4M6WB 1NK0A 2W9CA 3O0FA 4QZCA 5CR0A 8ICJA 5AKXA 4NV0A 4OJOA 2W54A 4HAIA 3MDCA 1T8EA 5L1JA 5KG6A 2Y0SF 2W04A 1VJ5A 2MRLA 2ZTCA 3J81j 3IRUA 1MQ3A 4DL3A 1JX4A 1ECWA 5KFVA 5ALWA 3JPOA 4QZAA 2OXOA 4JMUA 5KFHA 2E8PA 2YTUA 4Z6CA 1ZQIA 4DQPA 9ICQA 1ZQRA 2LYAA 2XC9A 3NVVA 1ZQFA 1L7MA 4YCXA 4BXOB 4QWDA 4TUQA 4KMOB 1N63A 4F93B 3MGIA 1SXEA 4BJQA 4DS5A 4F5RA 2W9BA 9ICOA 2CXYA 4C8MA 4DLEA 2AQ0A 1KFTA 2JZBA 4DLGA 2KFNA 3PSFA 3MGHA 5AK6A 3F2BA 1XC9A 4ED7A 2AXTU 1SV4A 5KFGA 1H38A 1SXDA 2F8KA 3E0FA 4U7CA 1COOA 4ECZA 1J2MA 2F44A 2XY6A 2FE9A 5KG5A 4J9KA 3KD3A 4JWMA 4O3QA 3G6VA 2I6XA 2EANA 1Q3UA 3VCBA 5AI5A 1XSLA 3RJHA 5KL1B 1XU4A 3ETRA 4C7YA 1RM6C 3TFSA 4DQIA 2DL0A 5AIBA 3PY8A 2A3VA 7ICKA 2NV3A 1ZXIA 2JHDA 1MN8A 3PX4A 1BGXT 2EZYA 1WUDA 2QB0A 4A8EA 5CEHA 2F3NA 2WF5A 3C5GA 4MEXA 9ICEA 4QZIA 2DGZA 2E1FA 5AKKA 1TK5A 7ICHA 1QSLA 2LPEA 4G3IA 5IINA 3AUOA 2A1JA 3TI0A 5CB1A 4MF8A 4EBDA 4DFKA 4FE3A 4NL9C 1SB3C 5B5EU 3BDPA 1OUQA 5IILA 2PFNA 4YVZA 4KLIA 2F1JA 2K8BB 3WKEA 2R8KA 4KX5A 1AQ6A 4DFDA 1N5XA 3EUB2 4Q44A 3RJIA 4B9LA 3EWAA 4XA5A 2KEYA 3UQ2A 3GZFA 3KHLA 4IRDA 2E8MA 1KDHA 8ICTA 4I2JA 4J9OA 2BKEA 2HSZA 3HJEA 4QW9A 2FMPA 1BPYA 2G06A 1UPHA 5DG7A 3PX0A 2KK0A 3D2SA 4I2DA 3IG5A 3RH4A 1FIQA 2WAQC 3FYHA 2LBOA 2C2RA 3GILA 3QUTA 5KT5A 4RQ5A 1WG8A 3KHRA 1NK9A 3GV7B 1TK8A 5KG2A 1QCKA 1FFVA 4ACOA 2DKXA 4DO9A 1JROA 3RRGA 4F5PA 5F9LA 9ICAA 4M9HA 2VANA 4UQGA 5AKGA 5DQIA 2ISOA 4QZBA 4KLSA 2I5HA 3KKAA 1U9LA 2OH2A 2M9NA 3WK8A 4IC9A 4I2IA 4YN4A 1CRXA 1DK2A 5EE3A 2KJ8A 3WK9A 4KN4A 2FMSA 2DBYA 3SAHA 2KTQA 1QSSA 3CNHA 3OJSA 1ZQ1C 4RQ1A 3N4MB 3FC4A 4ECXA 5KFIA 2NRXA 2O6KA 5ALKA 2LHTA 4O5KA 1L8LA 5KFTA 4UB2A 9ICNA 1KRPA 4C8NA 8ICBA 3PSTA 5ALIA 2BPFA 4K4IA 8ICIA 2HBJA 3LDAA 2ZIXB 3MR2A 4Y2VA 2YN4A 3RJGA 2AU0A 1FO4A 4EZ9A 1CEZA 3RB0A 2LYHA 5DG8A 2R8GA 4BDPA 5J29A 4NY8A 3CYMA 2GO7A 4PHEA 2KZ3A 3MR3A 5J2JA 1L8OA 2AH5A 1NNLA 2YX8A 3RJKA 5HR7A 3C21A 3IN5A 3PX6A 1BPDA 1U48A 4ECWA 8ICSA 5KFSA 1ZQTA 5AHXA 5AM3A 2XGQA 3UM9A 2D3DA 5CHGA 9ICMA 4IR1A 5DBAA 4FFDA 2DPJA 2HCFA 1SV0A 5DGBA 4QWCA 4RQMA 3V6JA 3BZKA 5DKWA 5CJ7A 4QZFA 4UAWA 3RR7A 4RT3A 3TARA 3QU7A 2LKYA 2W7PA 1TAMA 2YY6A 4QW8A 1M6YA 4RU9A 7ICQA 3THVA 2KJ5A 3WU2U 2VA2A 1ZQAA 2PFOA 3C23A 8ICZA 2OWOA 5AKIA 5HMMA 4US8A 4P0QA 4UBBA 1Z3EB 2PMZF 1X9WA 2OCEA 5J0PA 2I1QA 4JB3A 2IHNA 8ICRA 9ICHA 1NK4A 4YFKA 1ED1A 2UVVA 1TE2A 4ED1A 4QIWC 3BJYA 3RJEA 5ALQA 5AI4A 4JV0A 3IV6A 1ZD5A 4F72A 3WK4A 3ALRA 3M8SA 4YMNA 3H40A 4F4YA 2KVSA 2Y0SC 4RNNA 4KLMA 1KSPA 2JR5A 3L3FX 2FDRA 5KG0A 5IIOA 5ALFA 3EPIA 2C2DA 1LB2B 1ZQCA 3MDAA 2BCUA 3NUQA 5AM5A 4M9JA 2GLEA 2E3TA 3SV3A 1XSNA 1JALA 2JEIA 4RPZA 4NLBA 3HT3A 4GC7A 3T5JA 5BOLA 4JK1A 5EWGA 3GQCA 4IL6U 4ECUA 7ICTA 2J6SA 5KFWA 3ZDEA 3LWLA 2Q0ZX 1QQ6A 4RQ6A 2DPIA 5IIKA 1C20A 5BOMA 2RRDA 4IRCA 4DL2A 2ZUCA 4DFPA 3FDSA 3SMVA 1URJA 2IOHA 1WYGA 4NJ8A 4C0ZA 1ZQQA 4NM2A 1NK5A 8ICPA 1J97A 2F1IA 1IIPA 2RLTA 2K60A 3RAXA 1NKEA 3PVXA 1V9PA 3D2NA 2AGPA 3C2MA 4US9A 3UMCA 3M9NB 2W3SA 5ALOA 3C1ZA 1QQ7A 3SENA 4KN7A 3TADC 4F2RA 2ZJ5A 2HOFA 5KTQA 3RRHA 4M9LA 5J0YA 4P4MA 5KFOA 4BX9C 1TAUA 5AM1A 1KTQA 2P35A 1ZQGA 4CF3A 1TFRA 2HBKA 3V7LA 3M1YA 2ODGA 3N28A 4YR2A 4I2AA 1COKA 3OHBA 5L9XA 3MFIA 3Q8SB 3RTVA 3SV4A 2AGQA 2WTFA 4KLJA 2LMRA 3PO5A 3RBDA 2XI9A 3RH6A 2HMXA 3IP4B 5KFYA 2ZTDA 3GIKA 2QLTA 4IQTA 5F9NA 3SYZA 5KG3A 4FS2A 2UVWA 2JZBB 2Y1IA 1TAQA 2NO4A 1DOQA 3EPGA 1SGGA 2HOIA 1PUZA 4YMOA 3BZCA 4RUCA 4O3MA 4P2HA 3QU9A 1S9FA 2OHFA 4I2HA 4UB1A 2DWQA 3B9JA 4F50A 9ICLA 2VJ4A 3BQ0A 3ISCA 4FO6A 3L5KA 4KLGA 1X9MA 3OPXA 3SAGA 9ICVA 3QXGA 4I28A 2HHTA 3A0BU 7ICSA 1X9SA 2BCRA 4KLHA 7ICVA 4GXJA 2MUTA 5A0LA 2D6FC 1KKXA 1S0VA 5ALUA 4IR9A 3ZDAA 1JXLA 1Z1VA 4Y2SA 1N61A 2OYYA 4Y2PA 2EZXA 3C28A 2K4IA 2F8LA 5EWEA 3G6YA 4J03A 4JV2A 3DDHA 4R63A 4KLDA 4IS7A 2EQYA 4IQVA 3AU2A 1BNPA 4U6PA 3KKAC 3BS5A 4PHAA 4RPYA 1P7DA 3TKAA 1U4BA 4YG2A 1UT8A 5J0QA 1MC8A 5C5JA 2RHFA 4C7ZA 2KOBA 1UCVA 2XCPA 1CI4A 3PNCA 3FAHA 4OJ6A 4J9PA 1T94A 2H3QA 2HDOA 4RQ7A 1F44A 4B9VA 3C1YA 3RFAA 4MEYA 4B9UA 4R65A 4PGYA 3AL0B 1OW5A 4P0PA 4BWMA 1Y88A 2MSNA 4DCCA 4YXJA 4QZ8A 1Z19A 1VLBA 3Q8QB 4DL5A 2W55A 2GH1A 4FBTA 5ALXA 5ALSA 2RP5A 5KG7A 4KLQA 1KL9A 3PZPA 4CRXA 5J2FA 7ICGA 1IM4A 1T3NA 2FLNA 2F76X 2QARA 2NRTA 1ZQZA 3QU2A 2XIDA 3UMBA 3PW7A 2ESEA 5KT2A 1ZQLA 4QJFB 3HPOA 2C28A 2W9AA 5H2FU 3UXOA 1GO3F 3KFUF 1SZHA 1X2IA 1ZD4A 2FPMA 5TZVA 4MFFA 3SQIA 3M9MB 4NLNA 1ZYQA 3HKZF 3OJUA 2ZIVA 4ELTA 4DSFA 3PO4A 5ALRA 2CRXA 9ICSA 5GTIU 3RB3A 2MA1A 8ICKA 3F53A 4KITB 2IBKA 3BQTA 4Z6EA 4C8KA 1ZQDA 3BS7A 2KHQA 5KFXA 4NLZA 2ISPA 3PW4A 2ZIXA 3RB6A 4CF5A 4ED2A 4R64A 5L1MA 1ZOLA 1QQ5A 3V7KA 4DSKA 7ICEA 4GC6A 2V9WA 3RH5A 3LYSA 5ALZA 1X40A 4I29A 1V38A 4RNMA 4UARA 5CWRA 3QUCA 4ED0A 2M0NA 2B0CA 3ICXA 4F71A 1UQVA 3C2LA 2ALZA 3OHAA 2IA6A 1S8OA 2PKEA 2BQRA 5HR6A 1Z1BA 3IDWA 4F3OA 4UB8U 3RBEA 4PGQA 2YMMA 1D8LA 5HMLA 1NJWA 1F0MA 5ALMA 1T3QA 2QB1A 4QIWF 3LVWA 4PHPA 3V6KA 5ALYA 2DFLA 3ZDBA 5ALDA 4DQQA 2KJ9A 3PW0A 5J8YA 4Y2UA 5AI6A 4C4RA 3PR4A 4QWBA 2YMQA 2V4QA 4F4XA 2H3IA 2EAPA 3WKBA 5AKHA 3N7SC 2G5IB 1XWLA 3QU5A 2ATLA 4Y2XA 4DOAA 5J2AA 3I76A 4EYIB 2CN1A 1PVRA
chains in the Genus database with same CATH topology
1PZNA 2C2EA 3THVA 5KFKA 4ECRA 3LK9A 5KT4A 3HX0A 4O3OA 4EEYA 1L3TA 1KLNA 2VA2A 1ZQAA 2KZMA 3PW5A 2PFOA 4EBCA 4EZ6A 2B21A 3C23A 1S0OA 5DDMA 8ICZA 4RQ0A 4RNOA 2OWOA 1IXRA 4RUAA 4O3NA 5HMMA 4B9MA 3GFKB 2PFPA 4ELVA 4UBBA 4F4KA 1Z3EB 1NKBA 9ICIA 4PPXA 2HHXA 4J9LA 4HYKA 3PV8A 4TUPA 1X9WA 8ICGA 7ICIA 4F92B 1TV9A 1QSYA 1U49A 1NK6A 5J0PA 9ICFA 2BCSA 1SL0A 1K1SA 3GIJA 4DL7A 2I1QA 1L5UA 4RQ8A 4TQSA 3Q8MA 2ZJAA 1NK4A 2IHNA 8ICRA 4RPXA 9ICHA 4YFKA 4KLOA 4ECTA 2UVVA 4MFAA 2HHQA 1NK7A 3ORYA 3KHHA 4ED6A 4ED1A 5DLGA 3BJYA 3PR5B 1RYRA 2RDJA 3RJEA 3T5HA 3H8SA 3AU6A 3T3FA 1N56A 5KFZA 3SZ2A 1B22A 4BGDA 5HNKA 4JV0A 2KFZA 5DGAA 3KTQA 1ZQWA 4MF2A 3H8JA 3PMLA 3M8SA 4YMNA 3H40A 2IHMA 5DB9A 4F4YA 4KLMA 2JEGA 4RNNA 1BPZA 4XRHA 4YR0A 5KG0A 3EPIA 5IIOA 4DOCA 1KSPA 4M2YA 1JIHA 4DOBA 2C2DA 2BCQA 2XCAA 1S0MA 1SKWA 1LB2B 2AJQA 5KFNA 1ZQPA 4NLGA 4QZGA 3OSPA 3MR6A 1ZQCA 4YP3A 4J9RA 2VA3A 3MDAA 5JUMA 3HW8A 1RXVA 2ZUBA 3RJFA 4M0AA 7ICLA 3SI8A 2BCUA 1DGSA 2W8LA 4M9JA 7ICNA 3C2KA 1UA1A 1S77D 4I2BA 4O5EA 4O3PA 1S10A 3K75D 3T5LA 3SV3A 1XSNA 1ZQJA 1ZQMA 2JEIA 3KHGA 4RPZA 3M9OB 3EW9A 4GXIA 5KG4A 3HT3A 4GC7A 4UB5A 2Y1JA 3RAQA 3T5JA 1JXEA 2NRVA 4O3RA 2MAXA 2ASJA 5BOLA 5L1IA 4JK1A 3H7IA 5EWGA 5J0SA 5J2DA 3GQCA 1NKCA 4NLKA 2NRWA 4ECUA 7ICTA 2J6SA 2PXIA 4I2FA 5KFWA 4FS1A 1S0NA 3ZDEA 3LWLA 2Q0ZX 4TURA 4RQ6A 1HJPA 3NTUA 1K1QA 5CA7A 2DPIA 1ZJMA 5IIKA 4QWAA 4JV1A 4LVSA 2R8HA 5DQHA 3Q8RB 9ICWA 4GLXA 5BOMA 1LV5A 4IRCA 2ASDA 2BPGA 2IMWP 4EBEA 3K4GA 4DL2A 4ED3A 5DG9A 1RPLA 1D9DA 8ICXA 4IQWA 5DB6A 2ZUCA 2XY7A 4DFPA 3T5KA 4QWEA 7ICOA 2V4RA 1NJYA 3FDSA 5J0WA 9ICPA 2P6RA 1ZQSA 1D9FA 5KG1A 4KTQA 1XS9D 4KLLA 5KFBA 1L3SA 4M6WB 4NM2A 1ZQQA 1NK5A 1NK0A 4ELUA 8ICPA 2W9CA 7ICFA 2JEFA 2F1IA 4QZCA 5CR0A 8ICJA 4GXKA 5IIMA 4KLUA 3RAXA 1NKEA 4IQUA 3PVXA 3MDCA 1T4GA 1V9PA 5L1JA 4F5NA 2AGPA 5KG6A 1T8EA 1N48A 1QTMA 1RZTA 3C2MA 4F5OA 2PFQA 1B43A 5D4BA 3M9NB 4F91B 2ZTCA 4TQRA 1SKSA 3C1ZA 1MQ3A 2BHNA 4DL3A 1ZQKA 4J9SA 4KN7A 3MBYA 1JX4A 4YMMA 4F2RA 2ZJ5A 5D46A 5KFVA 3JPOA 4JUZA 4QZAA 4DFMA 5KTQA 4UBCA 3RRHA 4LZDA 2FPKA 4M9LA 5J0YA 8ICYA 4C8LA 5KFHA 3QE9Y 4P4MA 5KFOA 4F4WA 4DQPA 4Z6CA 1ZQIA 1TAUA 9ICQA 1KTQA 1ZQOA 1ZQGA 2XC9A 1ZQRA 1TFRA 2FMQA 4B9NA 1ZQFA 5IIIA 4YCXA 4BXOB 3B0XA 4QWDA 4TUQA 3V7LA 3H4DA 4F93B 2ZTEA 3MGIA 2BQ3A 4YR3A 4YR2A 4DS5A 1U47A 2BGWA 4I2AA 5EWFA 4F5RA 9ICCA 3QZ8A 2RDIA 2W9BA 9ICOA 3OHBA 4C8MA 5L9XA 3MFIA 4DLEA 4DS4A 2AQ0A 3Q8SB 1KFTA 4I27A 2JZBA 4DLGA 3RTVA 3SV4A 2AGQA 2HHSA 2KFNA 4NXZA 2WTFA 4KLJA 3MGHA 3PO5A 3RBDA 2W9CB 5KT3A 5J0TA 1XC9A 4ED7A 1L3VA 2HVHA 2GWSA 5KFGA 3RH6A 5KFYA 2ZTDA 4KLFA 4Z6FA 4DSEA 3GIKA 4IQTA 1H38A 5F9NA 4ED8A 3SYZA 1COOA 4KMUA 4DEZA 3JPPA 2R8JA 1JN3A 5KG3A 4FS2A 2UVWA 4ECZA 2P6UA 2JZBB 2FLLA 2XY6A 2Y1IA 1TAQA 5KG5A 4DQRA 4J9KA 1DOQA 3EPGA 3JPQA 8ICMA 9ICKA 3JPNA 5L1LA 4JWMA 2UVRA 4DWIA 2JEJA 4YMOA 4O3QA 3G6VA 4TUSA 3B0YA 3OSNA 5J0UA 1U45A 3UXNA 4RUCA 4R66A 5CP2A 7ICMA 1XSLA 4P2HA 4Z6DA 3RJHA 1Z00A 1S9FA 4P4OA 1KEJA 2I9GA 4I2HA 5KFMA 4YD2A 1XU4A 4UB1A 3MFHA 2HW3A 4F50A 2W9MA 3TFSA 4DQIA 3Q8PB 8ICQA 9ICLA 3NGDA 1UT5A 3PY8A 4O3SA 7ICKA 4ECSA 3BQ0A 3ISCA 4FO6A 1QLNA 4M6WA 3TFRA 1NK8A 1MQ2A 3ZD9A 3PX4A 1BGXT 4KLGA 5J2IA 5DB7A 3V7JA 1X9MA 1XSPA 9ICVA 4I28A 3C5GA 4MEXA 9ICEA 3M8RA 3TAQA 2HHTA 4QZIA 3QEBZ 5KT6A 4DF4A 9ICBA 2XY5A 7ICSA 1X9SA 2BCRA 4KLHA 7ICVA 4GXJA 2MUTA 1TK5A 3RB4A 5J2CA 7ICHA 1QSLA 3N97B 4G3IA 5IINA 3AUOA 2A1JA 3TI0A 5J0OA 2FLPA 5CB1A 4MF8A 2KN7A 5J2HA 4DSJA 4I2CA 4IR9A 3ZDAA 1S0VA 1SKRA 4EYHB 4EBDA 4DFKA 1JXLA 2HHUA 5IIJA 5KFLA 1HUZA 3BDPA 1C7YA 4PH5A 4RQ4A 8ICVA 3HWTA 3EZ5A 3ISBA 5IILA 2PFNA 4YVZA 4M9NA 5EWEA 4F4ZA 1ZETA 4J9QA 4PHDA 3G6YA 4JV2A 1XO1A 4UAYA 5KFAA 4KLIA 4R63A 1Z00B 4KLDA 4Q8EA 2F1JA 1A77A 5EOZA 2R8KA 8ICFA 4M04A 4P4PA 4BXOA 5J2GA 4IQVA 3AU2A 1BPXA 4K4HA 4Q44A 4K4GA 4J9MA 3RJIA 4PHAA 4RPYA 5J2KA 4DL4A 4B9LA 1U4BA 2W9BB 3EWAA 4YG2A 1UT8A 4XA5A 5J0QA 1MC8A 5C5JA 2ZJ8A 4ZH4A 3BQ2A 3TANA 8ICOA 5DDYA 2XCPA 3PNCA 2BDPA 4E0DA 8ICEA 3UQ2A 4J9PA 5KT7A 3KHLA 4RQ7A 4IRDA 1KDHA 8ICTA 8ICAA 4I2JA 4B9VA 8ICCA 3C1YA 3JPSA 4MEYA 4B9UA 4R65A 7ICUA 4J9OA 8ICHA 4PGYA 4RZRA 2KZZA 1SZPA 2BKEA 4BWMA 1ZQVA 1Y88A 3MABA 2XO7A 3UPQA 4Q8FA 4YXJA 4QZ8A 2P66A 1KFDA 4QW9A 5L1KA 2FMPA 3Q8QB 1WCLA 4DL5A 1WCNA 4FBTA 1BPYA 1MSWD 5KG7A 1UA0A 4F2SA 2UVUA 4KLQA 5DG7A 4DL6A 3ISDA 3PX0A 4I2EA 5J0XA 3RR8A 5J2FA 7ICGA 1IM4A 4I2DA 4RQ3A 1RYSA 1T3NA 3RH4A 5J0RA 3GV8B 2FLNA 5KFDA 3ZDDA 3GIMA 4LZGA 7ICPA 8ICUA 4FBUA 3FYHA 2ASLA 2NRTA 4QZDA 4ECVA 2C2RA 4KLTA 3GILA 1ZQXA 1ZQZA 4BWJA 4O5CA 5KT5A 4RQ5A 3G6XA 3PW7A 4O9MA 4R8UA 5KT2A 3KHRA 1ZQLA 5KFQA 1NK9A 3HPOA 3GV7B 1TK8A 3Q8LA 1JMSA 5KG2A 2C28A 2W9AA 1TVAA 1NJZA 3UXOA 1BPBA 1ZQYA 2PI5A 4QZEA 1KFSA 1A76A 2BQUA 4DO9A 9ICTA 3HP6A 1NJXA 3RRGA 3ZD8A 5D49A 1X2IA 2F1HA 9ICUA 4ECQA 4F5PA 2FPMA 5TZVA 5F9LA 3GDXA 9ICAA 4M9HA 3QZ7A 4MFFA 3Q8KA 9ICJA 8ICNA 3V6HA 2VANA 4UQGA 4M9GA 4Q45A 5DQIA 3M9MB 2ISOA 4NLNA 4QZBA 1ZYQA 4DFJA 4KLSA 1ZQBA 4RT2A 1U9LA 3OJUA 2M9NA 4DSIA 4ELTA 2A1JB 4DSFA 3PO4A 2PI4A 9ICSA 3RB3A 5KFCA 4I2IA 5HHIA 4YN4A 8ICKA 5J2BA 4UAZA 3GIIA 5KFUA 4KITB 2IBKA 5DQGA 1NOMA 3BQTA 4Z6EA 4IRKA 4C8KA 1TK0A 4KN4A 1ZQDA 2XGPA 2FMSA 2KTQA 5KFXA 4NLZA 1BPEA 1TKDA 3PW4A 1QSSA 3RB6A 2ISPA 9ICGA 3IHQB 2BR0A 3OJSA 5KFRA 4ED2A 3H8WA 8ICLA 4YD1A 2W8KA 4RQ2A 7ICRA 5HHHA 5KFEA 4QZHA 4Q43A 4O0IA 4R64A 4RQ1A 3N4MB 4KLEA 4ECXA 5KFPA 3GV5B 2HHWA 1RXWA 3RJJA 5KFIA 3UXPA 2NRXA 3TQ1A 1ZQNA 1CUKA 3JPTA 3V7KA 5DLFA 2AQ4A 4O5KA 4DSKA 1SL1A 5KFTA 4UB2A 2HVIA 7ICEA 9ICXA 9ICNA 5KFJA 4GC6A 2V9WA 1KRPA 4CCHA 4C8NA 3RH5A 8ICBA 2J6UA 4I29A 2H5XA 3JPRA 2BPFA 7ICJA 4RNMA 4K4IA 5CWRA 8ICIA 1D8YA 4DSLA 4F5QA 3LDAA 4ED0A 3BQ1A 4PGXA 3EYZA 4F8RA 3MR2A 1EXNA 3C2LA 2ALZA 4QZ9A 3OHAA 4UB4A 2IA6A 3OGUA 4ECYA 2AU0A 4YQWA 2BQRA 3RJGA 2BCVA 3UQ0A 1ZQHA 5DBCA 4C8OA 4EZ9A 1CEZA 3TAPA 2VA8A 4F3OA 1BVSA 3RBEA 4DQSA 3RB0A 3PMNA 4JWNA 2AGOA 2LYHA 5DG8A 2C22A 4PGQA 5DB8A 2R8GA 5J29A 4BDPA 1D8LA 4NY8A 4PHEA 3MR3A 2KZ3A 5J2JA 5HMLA 1NJWA 1T7PA 4UB3A 2NRZA 2FPLA 4R8UB 3RJKA 2MUTB 2J6TA 8ICWA 4I2GA 1L3UA 4PHPA 3C21A 4NM1A 3PX6A 3V6KA 4DF8A 1BPDA 2R8IA 4ECWA 1U48A 3ZDCA 8ICSA 2BPCA 4XQ8A 5J2EA 5KFSA 3PW2A 1SL2A 5KFFA 5DBBA 1ZQTA 2ZUDA 1ZQUA 2XGQA 5HP4A 2DFLA 5CHGA 3ZDBA 9ICMA 4IR1A 3QEAZ 5DBAA 4DQQA 3E2EA 3PW0A 5BPCA 4X5VA 4B9SA 2DPJA 4YXMA 3PR4A 3LWMA 3ETLA 1HUOA 1AROP 4QWBA 5DGBA 4MFCA 4QWCA 2HHVA 2V4QA 3H4BA 4F4XA 4B9TA 4M47A 1S76D 3IM1A 9ICRA 1XWLA 4XUSA 3C5FA 3V6JA 2ATLA 4QZFA 5DKWA 5CJ7A 4DOAA 4UAWA 1S97A 5J2AA 4RT3A 1ZQEA 3TARA 3RR7A 4EYIB 3V72A 3MR5A 4QW8A 1ZJNA 4J9NA 4RU9A 7ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZN A;  2C2E A;  3THV A;  5KFK A;  4ECR A;  3LK9 A;  5KT4 A;  3HX0 A;  4O3O A;  4EEY A;  1L3T A;  1KLN A;  2VA2 A;  1ZQA A;  2KZM A;  3PW5 A;  2PFO A;  4EBC A;  4EZ6 A;  2B21 A;  3C23 A;  1S0O A;  5DDM A;  8ICZ A;  4RQ0 A;  4RNO A;  2OWO A;  1IXR A;  4RUA A;  4O3N A;  5HMM A;  4B9M A;  3GFK B;  2PFP A;  4ELV A;  4UBB A;  4F4K A;  1Z3E B;  1NKB A;  9ICI A;  4PPX A;  2HHX A;  4J9L A;  4HYK A;  3PV8 A;  4TUP A;  1X9W A;  8ICG A;  7ICI A;  4F92 B;  1TV9 A;  1QSY A;  1U49 A;  1NK6 A;  5J0P A;  9ICF A;  2BCS A;  1SL0 A;  1K1S A;  3GIJ A;  4DL7 A;  2I1Q A;  1L5U A;  4RQ8 A;  4TQS A;  3Q8M A;  2ZJA A;  1NK4 A;  2IHN A;  8ICR A;  4RPX A;  9ICH A;  4YFK A;  4KLO A;  4ECT A;  2UVV A;  4MFA A;  2HHQ A;  1NK7 A;  3ORY A;  3KHH A;  4ED6 A;  4ED1 A;  5DLG A;  3BJY A;  3PR5 B;  1RYR A;  2RDJ A;  3RJE A;  3T5H A;  3H8S A;  3AU6 A;  3T3F A;  1N56 A;  5KFZ A;  3SZ2 A;  1B22 A;  4BGD A;  5HNK A;  4JV0 A;  2KFZ A;  5DGA A;  3KTQ A;  1ZQW A;  4MF2 A;  3H8J A;  3PML A;  3M8S A;  4YMN A;  3H40 A;  2IHM A;  5DB9 A;  4F4Y A;  4KLM A;  2JEG A;  4RNN A;  1BPZ A;  4XRH A;  4YR0 A;  5KG0 A;  3EPI A;  5IIO A;  4DOC A;  1KSP A;  4M2Y A;  1JIH A;  4DOB A;  2C2D A;  2BCQ A;  2XCA A;  1S0M A;  1SKW A;  1LB2 B;  2AJQ A;  5KFN A;  1ZQP A;  4NLG A;  4QZG A;  3OSP A;  3MR6 A;  1ZQC A;  4YP3 A;  4J9R A;  2VA3 A;  3MDA A;  5JUM A;  3HW8 A;  1RXV A;  2ZUB A;  3RJF A;  4M0A A;  7ICL A;  3SI8 A;  2BCU A;  1DGS A;  2W8L A;  4M9J A;  7ICN A;  3C2K A;  1UA1 A;  1S77 D;  4I2B A;  4O5E A;  4O3P A;  1S10 A;  3K75 D;  3T5L A;  3SV3 A;  1XSN A;  1ZQJ A;  1ZQM A;  2JEI A;  3KHG A;  4RPZ A;  3M9O B;  3EW9 A;  4GXI A;  5KG4 A;  3HT3 A;  4GC7 A;  4UB5 A;  2Y1J A;  3RAQ A;  3T5J A;  1JXE A;  2NRV A;  4O3R A;  2MAX A;  2ASJ A;  5BOL A;  5L1I A;  4JK1 A;  3H7I A;  5EWG A;  5J0S A;  5J2D A;  3GQC A;  1NKC A;  4NLK A;  2NRW A;  4ECU A;  7ICT A;  2J6S A;  2PXI A;  4I2F A;  5KFW A;  4FS1 A;  1S0N A;  3ZDE A;  3LWL A;  2Q0Z X;  4TUR A;  4RQ6 A;  1HJP A;  3NTU A;  1K1Q A;  5CA7 A;  2DPI A;  1ZJM A;  5IIK A;  4QWA A;  4JV1 A;  4LVS A;  2R8H A;  5DQH A;  3Q8R B;  9ICW A;  4GLX A;  5BOM A;  1LV5 A;  4IRC A;  2ASD A;  2BPG A;  2IMW P;  4EBE A;  3K4G A;  4DL2 A;  4ED3 A;  5DG9 A;  1RPL A;  1D9D A;  8ICX A;  4IQW A;  5DB6 A;  2ZUC A;  2XY7 A;  4DFP A;  3T5K A;  4QWE A;  7ICO A;  2V4R A;  1NJY A;  3FDS A;  5J0W A;  9ICP A;  2P6R A;  1ZQS A;  1D9F A;  5KG1 A;  4KTQ A;  1XS9 D;  4KLL A;  5KFB A;  1L3S A;  4M6W B;  4NM2 A;  1ZQQ A;  1NK5 A;  1NK0 A;  4ELU A;  8ICP A;  2W9C A;  7ICF A;  2JEF A;  2F1I A;  4QZC A;  5CR0 A;  8ICJ A;  4GXK A;  5IIM A;  4KLU A;  3RAX A;  1NKE A;  4IQU A;  3PVX A;  3MDC A;  1T4G A;  1V9P A;  5L1J A;  4F5N A;  2AGP A;  5KG6 A;  1T8E A;  1N48 A;  1QTM A;  1RZT A;  3C2M A;  4F5O A;  2PFQ A;  1B43 A;  5D4B A;  3M9N B;  4F91 B;  2ZTC A;  4TQR A;  1SKS A;  3C1Z A;  1MQ3 A;  2BHN A;  4DL3 A;  1ZQK A;  4J9S A;  4KN7 A;  3MBY A;  1JX4 A;  4YMM A;  4F2R A;  2ZJ5 A;  5D46 A;  5KFV A;  3JPO A;  4JUZ A;  4QZA A;  4DFM A;  5KTQ A;  4UBC A;  3RRH A;  4LZD A;  2FPK A;  4M9L A;  5J0Y A;  8ICY A;  4C8L A;  5KFH A;  3QE9 Y;  4P4M A;  5KFO A;  4F4W A;  4DQP A;  4Z6C A;  1ZQI A;  1TAU A;  9ICQ A;  1KTQ A;  1ZQO A;  1ZQG A;  2XC9 A;  1ZQR A;  1TFR A;  2FMQ A;  4B9N A;  1ZQF A;  5III A;  4YCX A;  4BXO B;  3B0X A;  4QWD A;  4TUQ A;  3V7L A;  3H4D A;  4F93 B;  2ZTE A;  3MGI A;  2BQ3 A;  4YR3 A;  4YR2 A;  4DS5 A;  1U47 A;  2BGW A;  4I2A A;  5EWF A;  4F5R A;  9ICC A;  3QZ8 A;  2RDI A;  2W9B A;  9ICO A;  3OHB A;  4C8M A;  5L9X A;  3MFI A;  4DLE A;  4DS4 A;  2AQ0 A;  3Q8S B;  1KFT A;  4I27 A;  2JZB A;  4DLG A;  3RTV A;  3SV4 A;  2AGQ A;  2HHS A;  2KFN A;  4NXZ A;  2WTF A;  4KLJ A;  3MGH A;  3PO5 A;  3RBD A;  2W9C B;  5KT3 A;  5J0T A;  1XC9 A;  4ED7 A;  1L3V A;  2HVH A;  2GWS A;  5KFG A;  3RH6 A;  5KFY A;  2ZTD A;  4KLF A;  4Z6F A;  4DSE A;  3GIK A;  4IQT A;  1H38 A;  5F9N A;  4ED8 A;  3SYZ A;  1COO A;  4KMU A;  4DEZ A;  3JPP A;  2R8J A;  1JN3 A;  5KG3 A;  4FS2 A;  2UVW A;  4ECZ A;  2P6U A;  2JZB B;  2FLL A;  2XY6 A;  2Y1I A;  1TAQ A;  5KG5 A;  4DQR A;  4J9K A;  1DOQ A;  3EPG A;  3JPQ A;  8ICM A;  9ICK A;  3JPN A;  5L1L A;  4JWM A;  2UVR A;  4DWI A;  2JEJ A;  4YMO A;  4O3Q A;  3G6V A;  4TUS A;  3B0Y A;  3OSN A;  5J0U A;  1U45 A;  3UXN A;  4RUC A;  4R66 A;  5CP2 A;  7ICM A;  1XSL A;  4P2H A;  4Z6D A;  3RJH A;  1Z00 A;  1S9F A;  4P4O A;  1KEJ A;  2I9G A;  4I2H A;  5KFM A;  4YD2 A;  1XU4 A;  4UB1 A;  3MFH A;  2HW3 A;  4F50 A;  2W9M A;  3TFS A;  4DQI A;  3Q8P B;  8ICQ A;  9ICL A;  3NGD A;  1UT5 A;  3PY8 A;  4O3S A;  7ICK A;  4ECS A;  3BQ0 A;  3ISC A;  4FO6 A;  1QLN A;  4M6W A;  3TFR A;  1NK8 A;  1MQ2 A;  3ZD9 A;  3PX4 A;  1BGX T;  4KLG A;  5J2I A;  5DB7 A;  3V7J A;  1X9M A;  1XSP A;  9ICV A;  4I28 A;  3C5G A;  4MEX A;  9ICE A;  3M8R A;  3TAQ A;  2HHT A;  4QZI A;  3QEB Z;  5KT6 A;  4DF4 A;  9ICB A;  2XY5 A;  7ICS A;  1X9S A;  2BCR A;  4KLH A;  7ICV A;  4GXJ A;  2MUT A;  1TK5 A;  3RB4 A;  5J2C A;  7ICH A;  1QSL A;  3N97 B;  4G3I A;  5IIN A;  3AUO A;  2A1J A;  3TI0 A;  5J0O A;  2FLP A;  5CB1 A;  4MF8 A;  2KN7 A;  5J2H A;  4DSJ A;  4I2C A;  4IR9 A;  3ZDA A;  1S0V A;  1SKR A;  4EYH B;  4EBD A;  4DFK A;  1JXL A;  2HHU A;  5IIJ A;  5KFL A;  1HUZ A;  3BDP A;  1C7Y A;  4PH5 A;  4RQ4 A;  8ICV A;  3HWT A;  3EZ5 A;  3ISB A;  5IIL A;  2PFN A;  4YVZ A;  4M9N A;  5EWE A;  4F4Z A;  1ZET A;  4J9Q A;  4PHD A;  3G6Y A;  4JV2 A;  1XO1 A;  4UAY A;  5KFA A;  4KLI A;  4R63 A;  1Z00 B;  4KLD A;  4Q8E A;  2F1J A;  1A77 A;  5EOZ A;  2R8K A;  8ICF A;  4M04 A;  4P4P A;  4BXO A;  5J2G A;  4IQV A;  3AU2 A;  1BPX A;  4K4H A;  4Q44 A;  4K4G A;  4J9M A;  3RJI A;  4PHA A;  4RPY A;  5J2K A;  4DL4 A;  4B9L A;  1U4B A;  2W9B B;  3EWA A;  4YG2 A;  1UT8 A;  4XA5 A;  5J0Q A;  1MC8 A;  5C5J A;  2ZJ8 A;  4ZH4 A;  3BQ2 A;  3TAN A;  8ICO A;  5DDY A;  2XCP A;  3PNC A;  2BDP A;  4E0D A;  8ICE A;  3UQ2 A;  4J9P A;  5KT7 A;  3KHL A;  4RQ7 A;  4IRD A;  1KDH A;  8ICT A;  8ICA A;  4I2J A;  4B9V A;  8ICC A;  3C1Y A;  3JPS A;  4MEY A;  4B9U A;  4R65 A;  7ICU A;  4J9O A;  8ICH A;  4PGY A;  4RZR A;  2KZZ A;  1SZP A;  2BKE A;  4BWM A;  1ZQV A;  1Y88 A;  3MAB A;  2XO7 A;  3UPQ A;  4Q8F A;  4YXJ A;  4QZ8 A;  2P66 A;  1KFD A;  4QW9 A;  5L1K A;  2FMP A;  3Q8Q B;  1WCL A;  4DL5 A;  1WCN A;  4FBT A;  1BPY A;  1MSW D;  5KG7 A;  1UA0 A;  4F2S A;  2UVU A;  4KLQ A;  5DG7 A;  4DL6 A;  3ISD A;  3PX0 A;  4I2E A;  5J0X A;  3RR8 A;  5J2F A;  7ICG A;  1IM4 A;  4I2D A;  4RQ3 A;  1RYS A;  1T3N A;  3RH4 A;  5J0R A;  3GV8 B;  2FLN A;  5KFD A;  3ZDD A;  3GIM A;  4LZG A;  7ICP A;  8ICU A;  4FBU A;  3FYH A;  2ASL A;  2NRT A;  4QZD A;  4ECV A;  2C2R A;  4KLT A;  3GIL A;  1ZQX A;  1ZQZ A;  4BWJ A;  4O5C A;  5KT5 A;  4RQ5 A;  3G6X A;  3PW7 A;  4O9M A;  4R8U A;  5KT2 A;  3KHR A;  1ZQL A;  5KFQ A;  1NK9 A;  3HPO A;  3GV7 B;  1TK8 A;  3Q8L A;  1JMS A;  5KG2 A;  2C28 A;  2W9A A;  1TVA A;  1NJZ A;  3UXO A;  1BPB A;  1ZQY A;  2PI5 A;  4QZE A;  1KFS A;  1A76 A;  2BQU A;  4DO9 A;  9ICT A;  3HP6 A;  1NJX A;  3RRG A;  3ZD8 A;  5D49 A;  1X2I A;  2F1H A;  9ICU A;  4ECQ A;  4F5P A;  2FPM A;  5TZV A;  5F9L A;  3GDX A;  9ICA A;  4M9H A;  3QZ7 A;  4MFF A;  3Q8K A;  9ICJ A;  8ICN A;  3V6H A;  2VAN A;  4UQG A;  4M9G A;  4Q45 A;  5DQI A;  3M9M B;  2ISO A;  4NLN A;  4QZB A;  1ZYQ A;  4DFJ A;  4KLS A;  1ZQB A;  4RT2 A;  1U9L A;  3OJU A;  2M9N A;  4DSI A;  4ELT A;  2A1J B;  4DSF A;  3PO4 A;  2PI4 A;  9ICS A;  3RB3 A;  5KFC A;  4I2I A;  5HHI A;  4YN4 A;  8ICK A;  5J2B A;  4UAZ A;  3GII A;  5KFU A;  4KIT B;  2IBK A;  5DQG A;  1NOM A;  3BQT A;  4Z6E A;  4IRK A;  4C8K A;  1TK0 A;  4KN4 A;  1ZQD A;  2XGP A;  2FMS A;  2KTQ A;  5KFX A;  4NLZ A;  1BPE A;  1TKD A;  3PW4 A;  1QSS A;  3RB6 A;  2ISP A;  9ICG A;  3IHQ B;  2BR0 A;  3OJS A;  5KFR A;  4ED2 A;  3H8W A;  8ICL A;  4YD1 A;  2W8K A;  4RQ2 A;  7ICR A;  5HHH A;  5KFE A;  4QZH A;  4Q43 A;  4O0I A;  4R64 A;  4RQ1 A;  3N4M B;  4KLE A;  4ECX A;  5KFP A;  3GV5 B;  2HHW A;  1RXW A;  3RJJ A;  5KFI A;  3UXP A;  2NRX A;  3TQ1 A;  1ZQN A;  1CUK A;  3JPT A;  3V7K A;  5DLF A;  2AQ4 A;  4O5K A;  4DSK A;  1SL1 A;  5KFT A;  4UB2 A;  2HVI A;  7ICE A;  9ICX A;  9ICN A;  5KFJ A;  4GC6 A;  2V9W A;  1KRP A;  4CCH A;  4C8N A;  3RH5 A;  8ICB A;  2J6U A;  4I29 A;  2H5X A;  3JPR A;  2BPF A;  7ICJ A;  4RNM A;  4K4I A;  5CWR A;  8ICI A;  1D8Y A;  4DSL A;  4F5Q A;  3LDA A;  4ED0 A;  3BQ1 A;  4PGX A;  3EYZ A;  4F8R A;  3MR2 A;  1EXN A;  3C2L A;  2ALZ A;  4QZ9 A;  3OHA A;  4UB4 A;  2IA6 A;  3OGU A;  4ECY A;  2AU0 A;  4YQW A;  2BQR A;  3RJG A;  2BCV A;  3UQ0 A;  1ZQH A;  5DBC A;  4C8O A;  4EZ9 A;  1CEZ A;  3TAP A;  2VA8 A;  4F3O A;  1BVS A;  3RBE A;  4DQS A;  3RB0 A;  3PMN A;  4JWN A;  2AGO A;  2LYH A;  5DG8 A;  2C22 A;  4PGQ A;  5DB8 A;  2R8G A;  5J29 A;  4BDP A;  1D8L A;  4NY8 A;  4PHE A;  3MR3 A;  2KZ3 A;  5J2J A;  5HML A;  1NJW A;  1T7P A;  4UB3 A;  2NRZ A;  2FPL A;  4R8U B;  3RJK A;  2MUT B;  2J6T A;  8ICW A;  4I2G A;  1L3U A;  4PHP A;  3C21 A;  4NM1 A;  3PX6 A;  3V6K A;  4DF8 A;  1BPD A;  2R8I A;  4ECW A;  1U48 A;  3ZDC A;  8ICS A;  2BPC A;  4XQ8 A;  5J2E A;  5KFS A;  3PW2 A;  1SL2 A;  5KFF A;  5DBB A;  1ZQT A;  2ZUD A;  1ZQU A;  2XGQ A;  5HP4 A;  2DFL A;  5CHG A;  3ZDB A;  9ICM A;  4IR1 A;  3QEA Z;  5DBA A;  4DQQ A;  3E2E A;  3PW0 A;  5BPC A;  4X5V A;  4B9S A;  2DPJ A;  4YXM A;  3PR4 A;  3LWM A;  3ETL A;  1HUO A;  1ARO P;  4QWB A;  5DGB A;  4MFC A;  4QWC A;  2HHV A;  2V4Q A;  3H4B A;  4F4X A;  4B9T A;  4M47 A;  1S76 D;  3IM1 A;  9ICR A;  1XWL A;  4XUS A;  3C5F A;  3V6J A;  2ATL A;  4QZF A;  5DKW A;  5CJ7 A;  4DOA A;  4UAW A;  1S97 A;  5J2A A;  4RT3 A;  1ZQE A;  3TAR A;  3RR7 A;  4EYI B;  3V72 A;  3MR5 A;  4QW8 A;  1ZJN A;  4J9N A;  4RU9 A;  7ICQ A; 
#chains in the Genus database with same CATH topology
 5KFK A;  4ECR A;  4EEY A;  4O3O A;  3PW5 A;  5G5H A;  5DDM A;  4RQ0 A;  4RNO A;  3GFK B;  1Q8K A;  2KE7 A;  2W43 A;  2EDU A;  3I28 A;  1PVP A;  2F77 X;  8ICG A;  2E5S A;  2ZIV B;  3TAD A;  1U49 A;  1NK6 A;  9ICF A;  1SL0 A;  1K1S A;  4DL7 A;  4TQS A;  4KLO A;  4ECT A;  3ORY A;  1RYR A;  2KIW A;  3T3F A;  3OTQ A;  5KFZ A;  1B22 A;  5HNK A;  1VDV A;  1ZQW A;  3CRX A;  3H8J A;  5DB9 A;  1BPZ A;  4XRH A;  4M2Y A;  2BCQ A;  1SKW A;  2VA3 A;  2K4P A;  3S6J A;  5JUM A;  3HW8 A;  7ICL A;  3WK6 A;  2W8L A;  3WKA A;  2G08 A;  7ICN A;  3QUQ A;  3C2K A;  1UA1 A;  4O5E A;  1ZQJ A;  3M6Z A;  1PVQ A;  4GXI A;  5JU5 A;  4UAV A;  2MAX A;  1NKC A;  4Y2R A;  2N1R A;  3NAS A;  3U26 A;  4TUR A;  4Y2Q A;  2B6G A;  4JV1 A;  4LVS A;  9ICW A;  4GLX A;  2ZIU A;  2BPG A;  1HEK A;  4ED3 A;  3QU4 A;  1RPL A;  5KAI U;  1D9D A;  4IQW A;  5G5G A;  5DB6 A;  2XY7 A;  7ICO A;  3T5K A;  2V4R A;  1NJY A;  5AI0 A;  4KLL A;  1L3S A;  7ICF A;  2JEF A;  2LM4 A;  3ONN A;  5IIM A;  1RQN A;  4IQU A;  2VIX A;  4F5N A;  1V97 A;  1B43 A;  4UAU A;  4F91 B;  3SAF A;  4TQR A;  2JMG A;  1D8B A;  3MBY A;  1LKY A;  4YMM A;  3D6J A;  1X66 A;  5D46 A;  2HI0 A;  4OJL A;  5TIS U;  4DFM A;  4PZO A;  2FJ6 A;  2FPK A;  4GIB A;  1YT3 A;  4C8L A;  2Y9T A;  3QE9 Y;  4F4W A;  4UAT A;  3WK5 A;  4BUG A;  4B9N A;  1L7P A;  2JXJ A;  2JRZ A;  5III A;  3H4D A;  2BQ3 A;  3QZ8 A;  2HHS A;  4NXZ A;  1DRG A;  3VC8 A;  3RF9 A;  2HVH A;  5KT3 A;  1L3V A;  2GWS A;  3MC1 A;  2OEH A;  2ZIW B;  2F2A B;  4CNQ A;  4Z6F A;  4DSE A;  1SWV A;  2DF4 B;  1JN3 A;  3KZI U;  2BDU A;  2P6U A;  3HRD D;  2FLL A;  4DQR A;  4AYB C;  1V85 A;  8ICM A;  3JPQ A;  2WHE A;  9ICK A;  3JPN A;  4EEN A;  5L1L A;  2UVR A;  5ALP A;  2JEJ A;  2H3V A;  4TUS A;  3B0Y A;  1X9X A;  5AM4 A;  4R66 A;  5CP2 A;  2KSO A;  2ZXH A;  4P4O A;  5KFM A;  4YD2 A;  3MFH A;  8ICQ A;  3NGD A;  1UT5 A;  4O3S A;  2E1E A;  2W7O A;  4M6W A;  3TFR A;  1NK8 A;  3ZD9 A;  2LM1 A;  5DB7 A;  1YZ6 A;  3M8R A;  9ICB A;  3AN1 A;  4DF4 A;  2ES6 A;  3RB4 A;  5J2C A;  5KL8 B;  5AM2 A;  3N97 B;  1HIW A;  2KSO B;  5AM0 A;  5J2H A;  4DSJ A;  4I2C A;  1SKR A;  4EYH B;  2VKQ A;  3AM9 A;  2HHU A;  3ED5 A;  2KNJ A;  5IIJ A;  5KFL A;  4PH5 A;  4RQ4 A;  5KNI A;  3EZ5 A;  4F4Z A;  2K4E A;  4J9Q A;  1FFU A;  5CRX A;  2KP7 A;  4CF4 A;  1A77 A;  2WB1 F;  4UAS A;  8ICF A;  3F5A A;  4PL1 A;  4M04 A;  4P4P A;  4BXO A;  4WJ3 B;  5J2G A;  4K4H A;  1BPX A;  4Y2J A;  3HKZ C;  2ZJ8 A;  4ZH4 A;  4EX6 A;  3BQ2 A;  1Q3V A;  2ZG6 A;  2KVC A;  4E0D A;  8ICA A;  8ICH A;  7ICU A;  2KZZ A;  3F5E A;  1SZP A;  5ALL A;  3MAB A;  3UPQ A;  4Q8F A;  2D8C A;  2P66 A;  1WCN A;  3FM9 A;  1MSW D;  1UA0 A;  2HBL A;  2MU2 A;  4C4S A;  4DL6 A;  4I2E A;  5J0X A;  3RR8 A;  3NS1 A;  3SEI A;  3CW2 C;  4RQ3 A;  5J8Y C;  7ICP A;  5J0R A;  3GV8 B;  3ZDD A;  3GIM A;  4LZG A;  4FBU A;  2ASL A;  3KOO A;  4ECV A;  1ZQX A;  4BWJ A;  2Q4T A;  3A0H U;  3G6X A;  4O9M A;  2LI6 A;  3DEE A;  1WWU A;  5EE1 A;  5ALH A;  3Q8L A;  1JMS A;  1BPB A;  1ZQY A;  1JUD A;  5AKZ A;  4QZE A;  1KFS A;  1A76 A;  9ICT A;  1NJX A;  2R18 A;  4EX7 A;  5ALJ A;  3ZD8 A;  3QUB A;  5D49 A;  9ICU A;  5F3X B;  3QZ7 A;  3NVY A;  3Q8K A;  8ICN A;  3TAC B;  5AK3 A;  1KN5 A;  4DFJ A;  2K8C B;  3LVV A;  2A1J B;  2XIC A;  5HHI A;  3WKD A;  4UAZ A;  3GII A;  5KFU A;  1NOM A;  5K4L A;  4IRK A;  1NI3 A;  1A0P A;  5EE0 A;  1TK0 A;  2XGP A;  3QYP A;  1BPE A;  1PK3 A;  9ICG A;  3IHQ B;  3UMG A;  2BR0 A;  4GFJ A;  5KFR A;  8ICL A;  3H8W A;  3AQF A;  7ICR A;  5HHH A;  5KFE A;  4LJX A;  4UW9 A;  4Q43 A;  4KLE A;  1RXW A;  3RJJ A;  2H3F A;  3UXP A;  5EE9 A;  3TQ1 A;  1ZQN A;  3F2D A;  5DLF A;  2AQ4 A;  9ICX A;  2NO5 A;  5KFJ A;  3M6K A;  1L6N A;  2H5X A;  3JPR A;  4DSL A;  4PGX A;  1PK1 A;  4F8R A;  1EXN A;  1KBU A;  4ECY A;  4YQW A;  3K1Z A;  5AK5 A;  5DBC A;  1X6I A;  1B0X A;  4C8O A;  3GU3 A;  2YB1 A;  3TAP A;  1BVS A;  1IG6 A;  3PMN A;  2C22 A;  5DB8 A;  3PSI A;  2H3Z A;  1T7P A;  4Y2Y A;  2G5H B;  2MUT B;  2J6T A;  2KV2 A;  4I2G A;  1ZRM A;  4DF8 A;  3CP8 A;  3ZDC A;  2BPC A;  2W3R A;  1SL2 A;  5KFF A;  5DBB A;  2ZUD A;  5HP4 A;  2IOF K;  3E2E A;  2KIV A;  4YXM A;  1HUO A;  1ARO P;  2HHV A;  4B9T A;  9ICR A;  2ZXI A;  1S97 A;  3AEV A;  1SWW A;  3V72 A;  3C29 A;  3MR5 A;  5B66 U;  1ZJN A;  4J9N A;  3HIL A;  2KMD A;  4NLK A;  1L3T A;  5KT4 A;  3HX0 A;  1KLN A;  2KZM A;  4C80 A;  5ALV A;  4EZ6 A;  2B21 A;  1S0O A;  1B4F A;  3DV9 A;  4RUA A;  4O3N A;  4B9M A;  1OXJ A;  2QB0 B;  2PFP A;  4ELV A;  4PJ0 U;  1NKB A;  9ICI A;  4PPX A;  4J9L A;  3PV8 A;  4F92 B;  1TV9 A;  1QSY A;  4USA A;  1Z4O A;  4NWI A;  2KD1 A;  2IOF A;  4RQ8 A;  3SR6 A;  4MFA A;  2HHQ A;  1Z4N A;  1NK7 A;  5AI8 A;  5DLG A;  3PR5 B;  3BQ7 A;  2RDJ A;  3KBB A;  4AP9 A;  3AU6 A;  5JRT A;  1N56 A;  3SZ2 A;  1IV8 A;  5DGA A;  3KTQ A;  4MF2 A;  3PML A;  2JEG A;  4OCZ A;  5AI9 A;  4YR0 A;  1JIH A;  2XCA A;  2AJQ A;  4QNL A;  1ZQP A;  8ICE A;  3OSP A;  3R9K A;  3MR6 A;  4YP3 A;  4J9R A;  1RXV A;  2ZUB A;  3RJF A;  4M0A A;  1DGS A;  4NLC A;  2DUY A;  1S77 D;  4I2B A;  3T5L A;  3KHG A;  3M9O B;  3EW9 A;  5KG4 A;  2GOL A;  4UB5 A;  2Y1J A;  3RAQ A;  1JXE A;  2ASJ A;  5L1I A;  3AQE A;  5J0S A;  2NRW A;  1N5W A;  5AIC A;  4FS1 A;  1S0N A;  3PSP A;  1RQL A;  5CA7 A;  1FEZ A;  1DXS A;  2R8H A;  3Q8R B;  2ASD A;  2VJ5 A;  3K4G A;  3F2C A;  4QWE A;  2P6R A;  3WKC A;  1XS9 D;  4CGZ A;  1NZB A;  1L7O A;  2DQN B;  4ELU A;  2W11 A;  4AYB F;  4GXK A;  2E8O A;  4KLU A;  3MGV A;  1T4G A;  1O08 A;  1N48 A;  1QTM A;  3T79 A;  1RZT A;  4F5O A;  2PFQ A;  5D4B A;  2JGA A;  2OM6 A;  4EEK A;  1SKS A;  2BHN A;  1ZQK A;  4J9S A;  4JUZ A;  4EEL A;  4UBC A;  3AMZ A;  4LZD A;  8ICY A;  1DGJ A;  1ZQO A;  2FMQ A;  1ZRN A;  3B0X A;  2ZIW A;  2ZTE A;  4YR3 A;  1U47 A;  2BGW A;  9ICC A;  5EWF A;  2RDI A;  1SIJ A;  1N2X A;  3NRW A;  4DS4 A;  4I27 A;  4RQN A;  5JTI A;  2W9C B;  5J0T A;  1SV0 C;  4UB6 U;  1KQQ A;  4KLF A;  4ED8 A;  1JI7 A;  4KMU A;  4DEZ A;  3JPP A;  1F5S A;  2R8J A;  5T14 A;  2L5Y A;  3N7P D;  2K89 A;  2WB1 C;  4DWI A;  2EAM A;  3OSN A;  5AK4 A;  4CE6 A;  5J0U A;  1U45 A;  3UXN A;  7ICM A;  3H0L B;  4Z6D A;  2G0A A;  1Z00 A;  4OD0 A;  2BZF A;  1KEJ A;  2I9G A;  2HW3 A;  2W9M A;  3Q8P B;  3H8M A;  1YZ7 A;  4ECS A;  1QLN A;  2EAO A;  1J2N A;  1MQ2 A;  1MA7 A;  5J2I A;  5GTH U;  3V7J A;  1XSP A;  4OO1 J;  3QX7 A;  1RG6 A;  3TAQ A;  3QEB Z;  5KT6 A;  5E79 U;  2XY5 A;  2KKP A;  2FLP A;  5J0O A;  1L7N A;  3IG8 A;  2KN7 A;  3ZI4 A;  3SD7 A;  1HUZ A;  1C7Y A;  8ICV A;  3HWT A;  1KW4 A;  3ISB A;  2AHO B;  2G09 A;  4M9N A;  1ZET A;  4PHD A;  1XO1 A;  4UAY A;  5KFA A;  1Z00 B;  4Q8E A;  2KIC A;  5EOZ A;  2W03 A;  1LVH A;  4K4G A;  4J9M A;  5J2K A;  4DL4 A;  2W9B B;  3N7R C;  1N62 A;  3TAN A;  2NYV A;  2G07 A;  1BNO A;  8ICO A;  5DDY A;  2K8A A;  2BDP A;  5KT7 A;  8ICC A;  3NRZ A;  3JPS A;  1NZP A;  2JH7 A;  4RZR A;  2WF6 A;  1ZQV A;  2XO7 A;  2ZIU B;  1KFD A;  5L1K A;  1RDF A;  1WCL A;  1DK3 A;  1XO0 A;  4F2S A;  2UVU A;  1A6S A;  2QKQ A;  5C0Y A;  4KX3 A;  3ISD A;  1RYS A;  5KFD A;  8ICU A;  1ZD3 A;  4QZD A;  4KLT A;  1JRP A;  4O5C A;  4R8U A;  5KFQ A;  5AIA A;  1TVA A;  1NJZ A;  2JH1 A;  2PI5 A;  1LKY B;  1N60 A;  2BQU A;  3HP6 A;  3K1R B;  2A19 A;  5ALT A;  2F1H A;  4ECQ A;  3GDX A;  3I1Y A;  9ICJ A;  2YB4 A;  2YQE A;  3V6H A;  4M9G A;  4Q45 A;  2Y9U A;  1ZQB A;  4RT2 A;  4DSI A;  2WF7 A;  2PI4 A;  5KFC A;  5J2B A;  4OJP A;  5DQG A;  4P0Q B;  2QAR B;  5FP0 A;  1TKD A;  3D2Q A;  1PK1 B;  4YD1 A;  2W8K A;  4RQ2 A;  4CDG A;  4QZH A;  4O0I A;  5KFP A;  3GV5 B;  2HHW A;  1WWV A;  1CUK A;  2WAQ F;  3JPT A;  4P0P B;  1SL1 A;  2HVI A;  3BS5 B;  4Y2T A;  4MHV A;  4PZN A;  4CCH A;  2J6U A;  3WK7 A;  1Q46 A;  7ICJ A;  1UHU A;  1D8Y A;  4F5Q A;  1X42 A;  3BQ1 A;  3EYZ A;  2E8N A;  3H0M B;  4QZ9 A;  4UB4 A;  3KZX A;  3OGU A;  4C4T A;  2BCV A;  3UQ0 A;  1ZQH A;  2CPR A;  2KHV A;  2VA8 A;  3M7D A;  4DQS A;  1RYU A;  4JWN A;  2AGO A;  4FZL A;  5ALN A;  5AKL A;  2HOQ A;  4UB3 A;  2NRZ A;  2FPL A;  4R8U B;  3H0R B;  8ICW A;  2HBM A;  1L3U A;  4NM1 A;  3QNM A;  2R8I A;  4XQ8 A;  5J2E A;  3PW2 A;  1ZQU A;  4PL2 A;  1ZD2 P;  3QEA Z;  3NVZ A;  4OJ5 A;  2WF9 A;  2YMP A;  5BPC A;  4X5V A;  4B9S A;  2EZZ A;  3LWM A;  2KKV A;  3ETL A;  4MFC A;  2K4H A;  3H4B A;  1S76 D;  3IM1 A;  4XUS A;  3C5F A;  4M47 A;  1ZQE A;  2KG5 A;  5ALG A;  1PZN A;  2C2E A;  3LK9 A;  4EBC A;  3E58 A;  2WFA A;  2WF8 A;  1IXR A;  4F4K A;  1O03 A;  2HHX A;  4HYK A;  4TUP A;  7ICI A;  5AKE A;  2DKZ A;  5AKJ A;  2BCS A;  3GIJ A;  1L5U A;  1X6J A;  3Q8M A;  2ZJA A;  4RPX A;  2LYB A;  4ZOH C;  3KHH A;  4ED6 A;  2RQ5 A;  2YML A;  3T5H A;  3H8S A;  1S5L U;  4BGD A;  5ALE A;  2KFZ A;  3NVW A;  2EH9 A;  2IHM A;  4NL9 A;  4DOC A;  4DOB A;  1S0M A;  1XNS A;  5KFN A;  4NLG A;  4QZG A;  1K5O A;  3SI8 A;  2FI1 A;  4ICA A;  4O3P A;  1S10 A;  3K75 D;  1ZQM A;  4FZN A;  2NRV A;  4O3R A;  3L4P A;  2A1A A;  3H7I A;  5J2D A;  2XVT A;  2JV3 A;  4FZM A;  2PXI A;  4I2F A;  1QH9 A;  1HJP A;  3NTU A;  1K1Q A;  1ZJM A;  4QWA A;  2PMZ C;  5DQH A;  1LV5 A;  2Z7J A;  2IMW P;  4EBE A;  4G9B A;  5KAF U;  5DG9 A;  5AKY A;  8ICX A;  4B6J A;  9ICP A;  5J0W A;  1ZQS A;  1D9F A;  5KG1 A;  4KTQ A;  5KFB A;  4M6W B;  1NK0 A;  2W9C A;  3O0F A;  4QZC A;  5CR0 A;  8ICJ A;  5AKX A;  4NV0 A;  4OJO A;  2W54 A;  4HAI A;  3MDC A;  1T8E A;  5L1J A;  5KG6 A;  2Y0S F;  2W04 A;  1VJ5 A;  2MRL A;  2ZTC A;  3J81 j;  3IRU A;  1MQ3 A;  4DL3 A;  1JX4 A;  1ECW A;  5KFV A;  5ALW A;  3JPO A;  4QZA A;  2OXO A;  4JMU A;  5KFH A;  2E8P A;  2YTU A;  4Z6C A;  1ZQI A;  4DQP A;  9ICQ A;  1ZQR A;  2LYA A;  2XC9 A;  3NVV A;  1ZQF A;  1L7M A;  4YCX A;  4BXO B;  4QWD A;  4TUQ A;  4KMO B;  1N63 A;  4F93 B;  3MGI A;  1SXE A;  4BJQ A;  4DS5 A;  4F5R A;  2W9B A;  9ICO A;  2CXY A;  4C8M A;  4DLE A;  2AQ0 A;  1KFT A;  2JZB A;  4DLG A;  2KFN A;  3PSF A;  3MGH A;  5AK6 A;  3F2B A;  1XC9 A;  4ED7 A;  2AXT U;  1SV4 A;  5KFG A;  1H38 A;  1SXD A;  2F8K A;  3E0F A;  4U7C A;  1COO A;  4ECZ A;  1J2M A;  2F44 A;  2XY6 A;  2FE9 A;  5KG5 A;  4J9K A;  3KD3 A;  4JWM A;  4O3Q A;  3G6V A;  2I6X A;  2EAN A;  1Q3U A;  3VCB A;  5AI5 A;  1XSL A;  3RJH A;  5KL1 B;  1XU4 A;  3ETR A;  4C7Y A;  1RM6 C;  3TFS A;  4DQI A;  2DL0 A;  5AIB A;  3PY8 A;  2A3V A;  7ICK A;  2NV3 A;  1ZXI A;  2JHD A;  1MN8 A;  3PX4 A;  1BGX T;  2EZY A;  1WUD A;  2QB0 A;  4A8E A;  5CEH A;  2F3N A;  2WF5 A;  3C5G A;  4MEX A;  9ICE A;  4QZI A;  2DGZ A;  2E1F A;  5AKK A;  1TK5 A;  7ICH A;  1QSL A;  2LPE A;  4G3I A;  5IIN A;  3AUO A;  2A1J A;  3TI0 A;  5CB1 A;  4MF8 A;  4EBD A;  4DFK A;  4FE3 A;  4NL9 C;  1SB3 C;  5B5E U;  3BDP A;  1OUQ A;  5IIL A;  2PFN A;  4YVZ A;  4KLI A;  2F1J A;  2K8B B;  3WKE A;  2R8K A;  4KX5 A;  1AQ6 A;  4DFD A;  1N5X A;  3EUB 2;  4Q44 A;  3RJI A;  4B9L A;  3EWA A;  4XA5 A;  2KEY A;  3UQ2 A;  3GZF A;  3KHL A;  4IRD A;  2E8M A;  1KDH A;  8ICT A;  4I2J A;  4J9O A;  2BKE A;  2HSZ A;  3HJE A;  4QW9 A;  2FMP A;  1BPY A;  2G06 A;  1UPH A;  5DG7 A;  3PX0 A;  2KK0 A;  3D2S A;  4I2D A;  3IG5 A;  3RH4 A;  1FIQ A;  2WAQ C;  3FYH A;  2LBO A;  2C2R A;  3GIL A;  3QUT A;  5KT5 A;  4RQ5 A;  1WG8 A;  3KHR A;  1NK9 A;  3GV7 B;  1TK8 A;  5KG2 A;  1QCK A;  1FFV A;  4ACO A;  2DKX A;  4DO9 A;  1JRO A;  3RRG A;  4F5P A;  5F9L A;  9ICA A;  4M9H A;  2VAN A;  4UQG A;  5AKG A;  5DQI A;  2ISO A;  4QZB A;  4KLS A;  2I5H A;  3KKA A;  1U9L A;  2OH2 A;  2M9N A;  3WK8 A;  4IC9 A;  4I2I A;  4YN4 A;  1CRX A;  1DK2 A;  5EE3 A;  2KJ8 A;  3WK9 A;  4KN4 A;  2FMS A;  2DBY A;  3SAH A;  2KTQ A;  1QSS A;  3CNH A;  3OJS A;  1ZQ1 C;  4RQ1 A;  3N4M B;  3FC4 A;  4ECX A;  5KFI A;  2NRX A;  2O6K A;  5ALK A;  2LHT A;  4O5K A;  1L8L A;  5KFT A;  4UB2 A;  9ICN A;  1KRP A;  4C8N A;  8ICB A;  3PST A;  5ALI A;  2BPF A;  4K4I A;  8ICI A;  2HBJ A;  3LDA A;  2ZIX B;  3MR2 A;  4Y2V A;  2YN4 A;  3RJG A;  2AU0 A;  1FO4 A;  4EZ9 A;  1CEZ A;  3RB0 A;  2LYH A;  5DG8 A;  2R8G A;  4BDP A;  5J29 A;  4NY8 A;  3CYM A;  2GO7 A;  4PHE A;  2KZ3 A;  3MR3 A;  5J2J A;  1L8O A;  2AH5 A;  1NNL A;  2YX8 A;  3RJK A;  5HR7 A;  3C21 A;  3IN5 A;  3PX6 A;  1BPD A;  1U48 A;  4ECW A;  8ICS A;  5KFS A;  1ZQT A;  5AHX A;  5AM3 A;  2XGQ A;  3UM9 A;  2D3D A;  5CHG A;  9ICM A;  4IR1 A;  5DBA A;  4FFD A;  2DPJ A;  2HCF A;  1SV0 A;  5DGB A;  4QWC A;  4RQM A;  3V6J A;  3BZK A;  5DKW A;  5CJ7 A;  4QZF A;  4UAW A;  3RR7 A;  4RT3 A;  3TAR A;  3QU7 A;  2LKY A;  2W7P A;  1TAM A;  2YY6 A;  4QW8 A;  1M6Y A;  4RU9 A;  7ICQ A;  3THV A;  2KJ5 A;  3WU2 U;  2VA2 A;  1ZQA A;  2PFO A;  3C23 A;  8ICZ A;  2OWO A;  5AKI A;  5HMM A;  4US8 A;  4P0Q A;  4UBB A;  1Z3E B;  2PMZ F;  1X9W A;  2OCE A;  5J0P A;  2I1Q A;  4JB3 A;  2IHN A;  8ICR A;  9ICH A;  1NK4 A;  4YFK A;  1ED1 A;  2UVV A;  1TE2 A;  4ED1 A;  4QIW C;  3BJY A;  3RJE A;  5ALQ A;  5AI4 A;  4JV0 A;  3IV6 A;  1ZD5 A;  4F72 A;  3WK4 A;  3ALR A;  3M8S A;  4YMN A;  3H40 A;  4F4Y A;  2KVS A;  2Y0S C;  4RNN A;  4KLM A;  1KSP A;  2JR5 A;  3L3F X;  2FDR A;  5KG0 A;  5IIO A;  5ALF A;  3EPI A;  2C2D A;  1LB2 B;  1ZQC A;  3MDA A;  2BCU A;  3NUQ A;  5AM5 A;  4M9J A;  2GLE A;  2E3T A;  3SV3 A;  1XSN A;  1JAL A;  2JEI A;  4RPZ A;  4NLB A;  3HT3 A;  4GC7 A;  3T5J A;  5BOL A;  4JK1 A;  5EWG A;  3GQC A;  4IL6 U;  4ECU A;  7ICT A;  2J6S A;  5KFW A;  3ZDE A;  3LWL A;  2Q0Z X;  1QQ6 A;  4RQ6 A;  2DPI A;  5IIK A;  1C20 A;  5BOM A;  2RRD A;  4IRC A;  4DL2 A;  2ZUC A;  4DFP A;  3FDS A;  3SMV A;  1URJ A;  2IOH A;  1WYG A;  4NJ8 A;  4C0Z A;  1ZQQ A;  4NM2 A;  1NK5 A;  8ICP A;  1J97 A;  2F1I A;  1IIP A;  2RLT A;  2K60 A;  3RAX A;  1NKE A;  3PVX A;  1V9P A;  3D2N A;  2AGP A;  3C2M A;  4US9 A;  3UMC A;  3M9N B;  2W3S A;  5ALO A;  3C1Z A;  1QQ7 A;  3SEN A;  4KN7 A;  3TAD C;  4F2R A;  2ZJ5 A;  2HOF A;  5KTQ A;  3RRH A;  4M9L A;  5J0Y A;  4P4M A;  5KFO A;  4BX9 C;  1TAU A;  5AM1 A;  1KTQ A;  2P35 A;  1ZQG A;  4CF3 A;  1TFR A;  2HBK A;  3V7L A;  3M1Y A;  2ODG A;  3N28 A;  4YR2 A;  4I2A A;  1COK A;  3OHB A;  5L9X A;  3MFI A;  3Q8S B;  3RTV A;  3SV4 A;  2AGQ A;  2WTF A;  4KLJ A;  2LMR A;  3PO5 A;  3RBD A;  2XI9 A;  3RH6 A;  2HMX A;  3IP4 B;  5KFY A;  2ZTD A;  3GIK A;  2QLT A;  4IQT A;  5F9N A;  3SYZ A;  5KG3 A;  4FS2 A;  2UVW A;  2JZB B;  2Y1I A;  1TAQ A;  2NO4 A;  1DOQ A;  3EPG A;  1SGG A;  2HOI A;  1PUZ A;  4YMO A;  3BZC A;  4RUC A;  4O3M A;  4P2H A;  3QU9 A;  1S9F A;  2OHF A;  4I2H A;  4UB1 A;  2DWQ A;  3B9J A;  4F50 A;  9ICL A;  2VJ4 A;  3BQ0 A;  3ISC A;  4FO6 A;  3L5K A;  4KLG A;  1X9M A;  3OPX A;  3SAG A;  9ICV A;  3QXG A;  4I28 A;  2HHT A;  3A0B U;  7ICS A;  1X9S A;  2BCR A;  4KLH A;  7ICV A;  4GXJ A;  2MUT A;  5A0L A;  2D6F C;  1KKX A;  1S0V A;  5ALU A;  4IR9 A;  3ZDA A;  1JXL A;  1Z1V A;  4Y2S A;  1N61 A;  2OYY A;  4Y2P A;  2EZX A;  3C28 A;  2K4I A;  2F8L A;  5EWE A;  3G6Y A;  4J03 A;  4JV2 A;  3DDH A;  4R63 A;  4KLD A;  4IS7 A;  2EQY A;  4IQV A;  3AU2 A;  1BNP A;  4U6P A;  3KKA C;  3BS5 A;  4PHA A;  4RPY A;  1P7D A;  3TKA A;  1U4B A;  4YG2 A;  1UT8 A;  5J0Q A;  1MC8 A;  5C5J A;  2RHF A;  4C7Z A;  2KOB A;  1UCV A;  2XCP A;  1CI4 A;  3PNC A;  3FAH A;  4OJ6 A;  4J9P A;  1T94 A;  2H3Q A;  2HDO A;  4RQ7 A;  1F44 A;  4B9V A;  3C1Y A;  3RFA A;  4MEY A;  4B9U A;  4R65 A;  4PGY A;  3AL0 B;  1OW5 A;  4P0P A;  4BWM A;  1Y88 A;  2MSN A;  4DCC A;  4YXJ A;  4QZ8 A;  1Z19 A;  1VLB A;  3Q8Q B;  4DL5 A;  2W55 A;  2GH1 A;  4FBT A;  5ALX A;  5ALS A;  2RP5 A;  5KG7 A;  4KLQ A;  1KL9 A;  3PZP A;  4CRX A;  5J2F A;  7ICG A;  1IM4 A;  1T3N A;  2FLN A;  2F76 X;  2QAR A;  2NRT A;  1ZQZ A;  3QU2 A;  2XID A;  3UMB A;  3PW7 A;  2ESE A;  5KT2 A;  1ZQL A;  4QJF B;  3HPO A;  2C28 A;  2W9A A;  5H2F U;  3UXO A;  1GO3 F;  3KFU F;  1SZH A;  1X2I A;  1ZD4 A;  2FPM A;  5TZV A;  4MFF A;  3SQI A;  3M9M B;  4NLN A;  1ZYQ A;  3HKZ F;  3OJU A;  2ZIV A;  4ELT A;  4DSF A;  3PO4 A;  5ALR A;  2CRX A;  9ICS A;  5GTI U;  3RB3 A;  2MA1 A;  8ICK A;  3F53 A;  4KIT B;  2IBK A;  3BQT A;  4Z6E A;  4C8K A;  1ZQD A;  3BS7 A;  2KHQ A;  5KFX A;  4NLZ A;  2ISP A;  3PW4 A;  2ZIX A;  3RB6 A;  4CF5 A;  4ED2 A;  4R64 A;  5L1M A;  1ZOL A;  1QQ5 A;  3V7K A;  4DSK A;  7ICE A;  4GC6 A;  2V9W A;  3RH5 A;  3LYS A;  5ALZ A;  1X40 A;  4I29 A;  1V38 A;  4RNM A;  4UAR A;  5CWR A;  3QUC A;  4ED0 A;  2M0N A;  2B0C A;  3ICX A;  4F71 A;  1UQV A;  3C2L A;  2ALZ A;  3OHA A;  2IA6 A;  1S8O A;  2PKE A;  2BQR A;  5HR6 A;  1Z1B A;  3IDW A;  4F3O A;  4UB8 U;  3RBE A;  4PGQ A;  2YMM A;  1D8L A;  5HML A;  1NJW A;  1F0M A;  5ALM A;  1T3Q A;  2QB1 A;  4QIW F;  3LVW A;  4PHP A;  3V6K A;  5ALY A;  2DFL A;  3ZDB A;  5ALD A;  4DQQ A;  2KJ9 A;  3PW0 A;  5J8Y A;  4Y2U A;  5AI6 A;  4C4R A;  3PR4 A;  4QWB A;  2YMQ A;  2V4Q A;  4F4X A;  2H3I A;  2EAP A;  3WKB A;  5AKH A;  3N7S C;  2G5I B;  1XWL A;  3QU5 A;  2ATL A;  4Y2X A;  4DOA A;  5J2A A;  3I76 A;  4EYI B;  2CN1 A;  1PVR A; 
#chains in the Genus database with same CATH homology
 1PZN A;  2C2E A;  3THV A;  5KFK A;  4ECR A;  3LK9 A;  5KT4 A;  3HX0 A;  4O3O A;  4EEY A;  1L3T A;  1KLN A;  2VA2 A;  1ZQA A;  2KZM A;  3PW5 A;  2PFO A;  4EBC A;  4EZ6 A;  2B21 A;  3C23 A;  1S0O A;  5DDM A;  8ICZ A;  4RQ0 A;  4RNO A;  2OWO A;  1IXR A;  4RUA A;  4O3N A;  5HMM A;  4B9M A;  3GFK B;  2PFP A;  4ELV A;  4UBB A;  4F4K A;  1Z3E B;  1NKB A;  9ICI A;  4PPX A;  2HHX A;  4J9L A;  4HYK A;  3PV8 A;  4TUP A;  1X9W A;  8ICG A;  7ICI A;  4F92 B;  1TV9 A;  1QSY A;  1U49 A;  1NK6 A;  5J0P A;  9ICF A;  2BCS A;  1SL0 A;  1K1S A;  3GIJ A;  4DL7 A;  2I1Q A;  1L5U A;  4RQ8 A;  4TQS A;  3Q8M A;  2ZJA A;  1NK4 A;  2IHN A;  8ICR A;  4RPX A;  9ICH A;  4YFK A;  4KLO A;  4ECT A;  2UVV A;  4MFA A;  2HHQ A;  1NK7 A;  3ORY A;  3KHH A;  4ED6 A;  4ED1 A;  5DLG A;  3BJY A;  3PR5 B;  1RYR A;  2RDJ A;  3RJE A;  3T5H A;  3H8S A;  3AU6 A;  3T3F A;  1N56 A;  5KFZ A;  3SZ2 A;  1B22 A;  4BGD A;  5HNK A;  4JV0 A;  2KFZ A;  5DGA A;  3KTQ A;  1ZQW A;  4MF2 A;  3H8J A;  3PML A;  3M8S A;  4YMN A;  3H40 A;  2IHM A;  5DB9 A;  4F4Y A;  4KLM A;  2JEG A;  4RNN A;  1BPZ A;  4XRH A;  4YR0 A;  5KG0 A;  3EPI A;  5IIO A;  4DOC A;  1KSP A;  4M2Y A;  1JIH A;  4DOB A;  2C2D A;  2BCQ A;  2XCA A;  1S0M A;  1SKW A;  1LB2 B;  2AJQ A;  5KFN A;  1ZQP A;  4NLG A;  4QZG A;  3OSP A;  3MR6 A;  1ZQC A;  4YP3 A;  4J9R A;  2VA3 A;  3MDA A;  5JUM A;  3HW8 A;  1RXV A;  2ZUB A;  3RJF A;  4M0A A;  7ICL A;  3SI8 A;  2BCU A;  1DGS A;  2W8L A;  4M9J A;  7ICN A;  3C2K A;  1UA1 A;  1S77 D;  4I2B A;  4O5E A;  4O3P A;  1S10 A;  3K75 D;  3T5L A;  3SV3 A;  1XSN A;  1ZQJ A;  1ZQM A;  2JEI A;  3KHG A;  4RPZ A;  3M9O B;  3EW9 A;  4GXI A;  5KG4 A;  3HT3 A;  4GC7 A;  4UB5 A;  2Y1J A;  3RAQ A;  3T5J A;  1JXE A;  2NRV A;  4O3R A;  2MAX A;  2ASJ A;  5BOL A;  5L1I A;  4JK1 A;  3H7I A;  5EWG A;  5J0S A;  5J2D A;  3GQC A;  1NKC A;  4NLK A;  2NRW A;  4ECU A;  7ICT A;  2J6S A;  2PXI A;  4I2F A;  5KFW A;  4FS1 A;  1S0N A;  3ZDE A;  3LWL A;  2Q0Z X;  4TUR A;  4RQ6 A;  1HJP A;  3NTU A;  1K1Q A;  5CA7 A;  2DPI A;  1ZJM A;  5IIK A;  4QWA A;  4JV1 A;  4LVS A;  2R8H A;  5DQH A;  3Q8R B;  9ICW A;  4GLX A;  5BOM A;  1LV5 A;  4IRC A;  2ASD A;  2BPG A;  2IMW P;  4EBE A;  3K4G A;  4DL2 A;  4ED3 A;  5DG9 A;  1RPL A;  1D9D A;  8ICX A;  4IQW A;  5DB6 A;  2ZUC A;  2XY7 A;  4DFP A;  3T5K A;  4QWE A;  7ICO A;  2V4R A;  1NJY A;  3FDS A;  5J0W A;  9ICP A;  2P6R A;  1ZQS A;  1D9F A;  5KG1 A;  4KTQ A;  1XS9 D;  4KLL A;  5KFB A;  1L3S A;  4M6W B;  4NM2 A;  1ZQQ A;  1NK5 A;  1NK0 A;  4ELU A;  8ICP A;  2W9C A;  7ICF A;  2JEF A;  2F1I A;  4QZC A;  5CR0 A;  8ICJ A;  4GXK A;  5IIM A;  4KLU A;  3RAX A;  1NKE A;  4IQU A;  3PVX A;  3MDC A;  1T4G A;  1V9P A;  5L1J A;  4F5N A;  2AGP A;  5KG6 A;  1T8E A;  1N48 A;  1QTM A;  1RZT A;  3C2M A;  4F5O A;  2PFQ A;  1B43 A;  5D4B A;  3M9N B;  4F91 B;  2ZTC A;  4TQR A;  1SKS A;  3C1Z A;  1MQ3 A;  2BHN A;  4DL3 A;  1ZQK A;  4J9S A;  4KN7 A;  3MBY A;  1JX4 A;  4YMM A;  4F2R A;  2ZJ5 A;  5D46 A;  5KFV A;  3JPO A;  4JUZ A;  4QZA A;  4DFM A;  5KTQ A;  4UBC A;  3RRH A;  4LZD A;  2FPK A;  4M9L A;  5J0Y A;  8ICY A;  4C8L A;  5KFH A;  3QE9 Y;  4P4M A;  5KFO A;  4F4W A;  4DQP A;  4Z6C A;  1ZQI A;  1TAU A;  9ICQ A;  1KTQ A;  1ZQO A;  1ZQG A;  2XC9 A;  1ZQR A;  1TFR A;  2FMQ A;  4B9N A;  1ZQF A;  5III A;  4YCX A;  4BXO B;  3B0X A;  4QWD A;  4TUQ A;  3V7L A;  3H4D A;  4F93 B;  2ZTE A;  3MGI A;  2BQ3 A;  4YR3 A;  4YR2 A;  4DS5 A;  1U47 A;  2BGW A;  4I2A A;  5EWF A;  4F5R A;  9ICC A;  3QZ8 A;  2RDI A;  2W9B A;  9ICO A;  3OHB A;  4C8M A;  5L9X A;  3MFI A;  4DLE A;  4DS4 A;  2AQ0 A;  3Q8S B;  1KFT A;  4I27 A;  2JZB A;  4DLG A;  3RTV A;  3SV4 A;  2AGQ A;  2HHS A;  2KFN A;  4NXZ A;  2WTF A;  4KLJ A;  3MGH A;  3PO5 A;  3RBD A;  2W9C B;  5KT3 A;  5J0T A;  1XC9 A;  4ED7 A;  1L3V A;  2HVH A;  2GWS A;  5KFG A;  3RH6 A;  5KFY A;  2ZTD A;  4KLF A;  4Z6F A;  4DSE A;  3GIK A;  4IQT A;  1H38 A;  5F9N A;  4ED8 A;  3SYZ A;  1COO A;  4KMU A;  4DEZ A;  3JPP A;  2R8J A;  1JN3 A;  5KG3 A;  4FS2 A;  2UVW A;  4ECZ A;  2P6U A;  2JZB B;  2FLL A;  2XY6 A;  2Y1I A;  1TAQ A;  5KG5 A;  4DQR A;  4J9K A;  1DOQ A;  3EPG A;  3JPQ A;  8ICM A;  9ICK A;  3JPN A;  5L1L A;  4JWM A;  2UVR A;  4DWI A;  2JEJ A;  4YMO A;  4O3Q A;  3G6V A;  4TUS A;  3B0Y A;  3OSN A;  5J0U A;  1U45 A;  3UXN A;  4RUC A;  4R66 A;  5CP2 A;  7ICM A;  1XSL A;  4P2H A;  4Z6D A;  3RJH A;  1Z00 A;  1S9F A;  4P4O A;  1KEJ A;  2I9G A;  4I2H A;  5KFM A;  4YD2 A;  1XU4 A;  4UB1 A;  3MFH A;  2HW3 A;  4F50 A;  2W9M A;  3TFS A;  4DQI A;  3Q8P B;  8ICQ A;  9ICL A;  3NGD A;  1UT5 A;  3PY8 A;  4O3S A;  7ICK A;  4ECS A;  3BQ0 A;  3ISC A;  4FO6 A;  1QLN A;  4M6W A;  3TFR A;  1NK8 A;  1MQ2 A;  3ZD9 A;  3PX4 A;  1BGX T;  4KLG A;  5J2I A;  5DB7 A;  3V7J A;  1X9M A;  1XSP A;  9ICV A;  4I28 A;  3C5G A;  4MEX A;  9ICE A;  3M8R A;  3TAQ A;  2HHT A;  4QZI A;  3QEB Z;  5KT6 A;  4DF4 A;  9ICB A;  2XY5 A;  7ICS A;  1X9S A;  2BCR A;  4KLH A;  7ICV A;  4GXJ A;  2MUT A;  1TK5 A;  3RB4 A;  5J2C A;  7ICH A;  1QSL A;  3N97 B;  4G3I A;  5IIN A;  3AUO A;  2A1J A;  3TI0 A;  5J0O A;  2FLP A;  5CB1 A;  4MF8 A;  2KN7 A;  5J2H A;  4DSJ A;  4I2C A;  4IR9 A;  3ZDA A;  1S0V A;  1SKR A;  4EYH B;  4EBD A;  4DFK A;  1JXL A;  2HHU A;  5IIJ A;  5KFL A;  1HUZ A;  3BDP A;  1C7Y A;  4PH5 A;  4RQ4 A;  8ICV A;  3HWT A;  3EZ5 A;  3ISB A;  5IIL A;  2PFN A;  4YVZ A;  4M9N A;  5EWE A;  4F4Z A;  1ZET A;  4J9Q A;  4PHD A;  3G6Y A;  4JV2 A;  1XO1 A;  4UAY A;  5KFA A;  4KLI A;  4R63 A;  1Z00 B;  4KLD A;  4Q8E A;  2F1J A;  1A77 A;  5EOZ A;  2R8K A;  8ICF A;  4M04 A;  4P4P A;  4BXO A;  5J2G A;  4IQV A;  3AU2 A;  1BPX A;  4K4H A;  4Q44 A;  4K4G A;  4J9M A;  3RJI A;  4PHA A;  4RPY A;  5J2K A;  4DL4 A;  4B9L A;  1U4B A;  2W9B B;  3EWA A;  4YG2 A;  1UT8 A;  4XA5 A;  5J0Q A;  1MC8 A;  5C5J A;  2ZJ8 A;  4ZH4 A;  3BQ2 A;  3TAN A;  8ICO A;  5DDY A;  2XCP A;  3PNC A;  2BDP A;  4E0D A;  8ICE A;  3UQ2 A;  4J9P A;  5KT7 A;  3KHL A;  4RQ7 A;  4IRD A;  1KDH A;  8ICT A;  8ICA A;  4I2J A;  4B9V A;  8ICC A;  3C1Y A;  3JPS A;  4MEY A;  4B9U A;  4R65 A;  7ICU A;  4J9O A;  8ICH A;  4PGY A;  4RZR A;  2KZZ A;  1SZP A;  2BKE A;  4BWM A;  1ZQV A;  1Y88 A;  3MAB A;  2XO7 A;  3UPQ A;  4Q8F A;  4YXJ A;  4QZ8 A;  2P66 A;  1KFD A;  4QW9 A;  5L1K A;  2FMP A;  3Q8Q B;  1WCL A;  4DL5 A;  1WCN A;  4FBT A;  1BPY A;  1MSW D;  5KG7 A;  1UA0 A;  4F2S A;  2UVU A;  4KLQ A;  5DG7 A;  4DL6 A;  3ISD A;  3PX0 A;  4I2E A;  5J0X A;  3RR8 A;  5J2F A;  7ICG A;  1IM4 A;  4I2D A;  4RQ3 A;  1RYS A;  1T3N A;  3RH4 A;  5J0R A;  3GV8 B;  2FLN A;  5KFD A;  3ZDD A;  3GIM A;  4LZG A;  7ICP A;  8ICU A;  4FBU A;  3FYH A;  2ASL A;  2NRT A;  4QZD A;  4ECV A;  2C2R A;  4KLT A;  3GIL A;  1ZQX A;  1ZQZ A;  4BWJ A;  4O5C A;  5KT5 A;  4RQ5 A;  3G6X A;  3PW7 A;  4O9M A;  4R8U A;  5KT2 A;  3KHR A;  1ZQL A;  5KFQ A;  1NK9 A;  3HPO A;  3GV7 B;  1TK8 A;  3Q8L A;  1JMS A;  5KG2 A;  2C28 A;  2W9A A;  1TVA A;  1NJZ A;  3UXO A;  1BPB A;  1ZQY A;  2PI5 A;  4QZE A;  1KFS A;  1A76 A;  2BQU A;  4DO9 A;  9ICT A;  3HP6 A;  1NJX A;  3RRG A;  3ZD8 A;  5D49 A;  1X2I A;  2F1H A;  9ICU A;  4ECQ A;  4F5P A;  2FPM A;  5TZV A;  5F9L A;  3GDX A;  9ICA A;  4M9H A;  3QZ7 A;  4MFF A;  3Q8K A;  9ICJ A;  8ICN A;  3V6H A;  2VAN A;  4UQG A;  4M9G A;  4Q45 A;  5DQI A;  3M9M B;  2ISO A;  4NLN A;  4QZB A;  1ZYQ A;  4DFJ A;  4KLS A;  1ZQB A;  4RT2 A;  1U9L A;  3OJU A;  2M9N A;  4DSI A;  4ELT A;  2A1J B;  4DSF A;  3PO4 A;  2PI4 A;  9ICS A;  3RB3 A;  5KFC A;  4I2I A;  5HHI A;  4YN4 A;  8ICK A;  5J2B A;  4UAZ A;  3GII A;  5KFU A;  4KIT B;  2IBK A;  5DQG A;  1NOM A;  3BQT A;  4Z6E A;  4IRK A;  4C8K A;  1TK0 A;  4KN4 A;  1ZQD A;  2XGP A;  2FMS A;  2KTQ A;  5KFX A;  4NLZ A;  1BPE A;  1TKD A;  3PW4 A;  1QSS A;  3RB6 A;  2ISP A;  9ICG A;  3IHQ B;  2BR0 A;  3OJS A;  5KFR A;  4ED2 A;  3H8W A;  8ICL A;  4YD1 A;  2W8K A;  4RQ2 A;  7ICR A;  5HHH A;  5KFE A;  4QZH A;  4Q43 A;  4O0I A;  4R64 A;  4RQ1 A;  3N4M B;  4KLE A;  4ECX A;  5KFP A;  3GV5 B;  2HHW A;  1RXW A;  3RJJ A;  5KFI A;  3UXP A;  2NRX A;  3TQ1 A;  1ZQN A;  1CUK A;  3JPT A;  3V7K A;  5DLF A;  2AQ4 A;  4O5K A;  4DSK A;  1SL1 A;  5KFT A;  4UB2 A;  2HVI A;  7ICE A;  9ICX A;  9ICN A;  5KFJ A;  4GC6 A;  2V9W A;  1KRP A;  4CCH A;  4C8N A;  3RH5 A;  8ICB A;  2J6U A;  4I29 A;  2H5X A;  3JPR A;  2BPF A;  7ICJ A;  4RNM A;  4K4I A;  5CWR A;  8ICI A;  1D8Y A;  4DSL A;  4F5Q A;  3LDA A;  4ED0 A;  3BQ1 A;  4PGX A;  3EYZ A;  4F8R A;  3MR2 A;  1EXN A;  3C2L A;  2ALZ A;  4QZ9 A;  3OHA A;  4UB4 A;  2IA6 A;  3OGU A;  4ECY A;  2AU0 A;  4YQW A;  2BQR A;  3RJG A;  2BCV A;  3UQ0 A;  1ZQH A;  5DBC A;  4C8O A;  4EZ9 A;  1CEZ A;  3TAP A;  2VA8 A;  4F3O A;  1BVS A;  3RBE A;  4DQS A;  3RB0 A;  3PMN A;  4JWN A;  2AGO A;  2LYH A;  5DG8 A;  2C22 A;  4PGQ A;  5DB8 A;  2R8G A;  5J29 A;  4BDP A;  1D8L A;  4NY8 A;  4PHE A;  3MR3 A;  2KZ3 A;  5J2J A;  5HML A;  1NJW A;  1T7P A;  4UB3 A;  2NRZ A;  2FPL A;  4R8U B;  3RJK A;  2MUT B;  2J6T A;  8ICW A;  4I2G A;  1L3U A;  4PHP A;  3C21 A;  4NM1 A;  3PX6 A;  3V6K A;  4DF8 A;  1BPD A;  2R8I A;  4ECW A;  1U48 A;  3ZDC A;  8ICS A;  2BPC A;  4XQ8 A;  5J2E A;  5KFS A;  3PW2 A;  1SL2 A;  5KFF A;  5DBB A;  1ZQT A;  2ZUD A;  1ZQU A;  2XGQ A;  5HP4 A;  2DFL A;  5CHG A;  3ZDB A;  9ICM A;  4IR1 A;  3QEA Z;  5DBA A;  4DQQ A;  3E2E A;  3PW0 A;  5BPC A;  4X5V A;  4B9S A;  2DPJ A;  4YXM A;  3PR4 A;  3LWM A;  3ETL A;  1HUO A;  1ARO P;  4QWB A;  5DGB A;  4MFC A;  4QWC A;  2HHV A;  2V4Q A;  3H4B A;  4F4X A;  4B9T A;  4M47 A;  1S76 D;  3IM1 A;  9ICR A;  1XWL A;  4XUS A;  3C5F A;  3V6J A;  2ATL A;  4QZF A;  5DKW A;  5CJ7 A;  4DOA A;  4UAW A;  1S97 A;  5J2A A;  4RT3 A;  1ZQE A;  3TAR A;  3RR7 A;  4EYI B;  3V72 A;  3MR5 A;  4QW8 A;  1ZJN A;  4J9N A;  4RU9 A;  7ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...