5KAIU

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
b'ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 26
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5kaiU01
3A0BU 5B66U 5KAFU 3A0HU 5B5EU 5KAIU 4PJ0U 5TISU 3KZIU 2AXTU 4IL6U 5H2FU 3WU2U 5GTHU 5GTIU 1S5LU 2DUYA 5E79U 4UB6U 4UB8U
chains in the Genus database with same CATH superfamily
4ECVA 3QE9Y 2MSNA 2ZXHA 1WWVA 1S76D 1LKYA 5KFWA 3ISDA 1JRPA 4DF4A 3Q8QB 4RQ4A 1ZRMA 1NK7A 4YG2A 2HBJA 1XU4A 3OTQA 4KMOB 3G6XA 2RRDA 4US9A 1WCNA 1HIWA 1P7DA 3H8MA 1XC9A 3H4DA 4K4GA 4CCHA 1HUOA 1CEZA 3SI8A 3SZ2A 4B6JA 2HBLA 1NJXA 3FC4A 3TQ1A 1CI4A 2F44A 4YFKA 4JWNA 3NTUA 2QB1A 7ICGA 2NRVA 4RQ7A 2W04A 3C21A 3S6JA 1BNOA 5CR0A 3HW8A 3V6JA 3IN5A 3H8WA 7ICPA 5J0SA 4M2YA 3RJKA 2HI0A 2F1HA 1L7MA 2BKEA 4BWMA 4PH5A 8ICRA 2NRZA 8ICGA 5HNKA 1ZQQA 4O3MA 3IRUA 4IRDA 4IR9A 4HYKA 3U26A 2BCRA 1S5LU 3RJIA 3WKDA 3T3FA 1XSLA 3MGHA 1CRXA 1ZQYA 8ICMA 3V7JA 5EWEA 1RZTA 3N97B 1UCVA 2AU0A 5KAIU 3NVVA 3EYZA 3LWMA 7ICKA 3E58A 2DL0A 4RPZA 5AM3A 2CN1A 2YQEA 4AYBF 4AP9A 2A19A 4O3PA 3N7SC 4OJ5A 2K89A 2WFAA 2Y9UA 5KT3A 4TURA 2QLTA 5K4LA 3FAHA 3V7KA 2G07A 4NL9A 4DL3A 2HOQA 3Q8PB 5KFOA 4UQGA 2XICA 4E0DA 3NVWA 3WKBA 5TZVA 2MUTB 2XY5A 2AQ0A 1XSPA 4PPXA 3QUQA 8ICQA 3FDSA 2EQYA 2BPCA 4G3IA 4Q8EA 4UB6U 5KFRA 4Z6DA 5DG7A 4DL2A 4NLKA 4J9PA 4QZEA 4UBBA 2HCFA 2JR5A 3NGDA 1F5SA 5KG5A 5J2HA 2RDJA 5DLFA 5DDMA 4PHDA 4IR1A 3NASA 3QEAZ 1B4FA 4YMMA 3HX0A 1RYRA 2NV3A 5CHGA 5J29A 4AYBC 4KLSA 4DQSA 4UAWA 4ED1A 3M9MB 2XY7A 4ECSA 1MA7A 1Z4OA 2VJ4A 5G5HA 2PFOA 3BS5A 4Z6FA 1ZQRA 8ICFA 2JHDA 5DGAA 4F5OA 2KZMA 5EE1A 2EZXA 2ZIVA 1NK6A 2ZIWA 4J9KA 9ICKA 4BXOB 4QZAA 2MAXA 2DQNB 4JV0A 4PJ0U 2GLEA 1BPDA 3G6VA 2LPEA 5J2IA 3AQFA 1LV5A 2IBKA 4O9MA 4G9BA 2JH1A 4EYIB 4I2BA 3KHHA 1ZQCA 2V4RA 1IG6A 1L7PA 4J9LA 1OUQA 4KLGA 3A0HU 1L3TA 3LDAA 1L7NA 1UQVA 4CF3A 4EYHB 4UBCA 2F8KA 4J9QA 2BDUA 3BS7A 3Q8RB 3PX6A 4C7YA 2WF7A 1SL0A 2RLTA 1L3UA 2LBOA 1S0VA 1TE2A 4DS4A 4ICAA 1D9DA 5KL1B 3PR4A 5AI8A 3KKAC 4EELA 1L3VA 3UMBA 1RQLA 3WK9A 2KKPA 3SAGA 3THVA 4ECTA 5C0YA 3M7DA 3AUOA 9ICQA 4EBDA 2Y1IA 4TQSA 8ICLA 4UB4A 2Q0ZX 3KHGA 1RPLA 2YY6A 3IG5A 1NKCA 5AKJA 2BCSA 3Q8MA 1PK1B 1T7PA 1BPBA 1ZQGA 2KV2A 7ICSA 2FE9A 1SKSA 1X42A 5D46A 5AKYA 4QZCA 2AGOA 4RU9A 1X2IA 4NXZA 4BGDA 3SYZA 2JV3A 1MC8A 8ICUA 2FI1A 4EEYA 1SIJA 3AU2A 1N60A 3BZKA 1OW5A 4GLXA 3UQ2A 2MRLA 5DLGA 3IM1A 5KG6A 2KZZA 1COKA 4I27A 2Y1JA 5KFEA 3GQCA 2K8BB 4J9RA 1ZD2P 4PL2A 4DOCA 4ECYA 5IIIA 2ZXIA 1N61A 1L6NA 2Y0SF 1KSPA 1KQQA 4YD1A 2DKXA 2QKQA 4C8OA 2EAMA 2UVWA 1SWVA 2A1AA 2E1EA 2KE7A 4MHVA 5ALGA 2F76X 3GU3A 1L7OA 1Z00B 1L5UA 4M9HA 1ZQMA 4ZH4A 2A1JB 3RH6A 2MUTA 5B66U 3D6JA 4C8KA 3KTQA 1IIPA 5J0XA 3BQ0A 4I2FA 5ALRA 1NK9A 8ICBA 8ICHA 4P4PA 2UVUA 2I9GA 3V72A 5BOMA 5KNIA 3TAPA 1NJZA 3SD7A 4NLNA 2PFPA 1QQ5A 2FPKA 1XSNA 3PY8A 3B9JA 2YB4A 5AK4A 1A77A 1V85A 3SV3A 2I1QA 2Y0SC 3M8RA 5DDYA 3IP4B 2R8JA 5ALDA 4TUQA 4M04A 5AI4A 1YZ7A 2W03A 5KT2A 4DFPA 3GIIA 3DEEA 3EW9A 2L5YA 4KMUA 2YX8A 3L5KA 5JRTA 9ICXA 4DEZA 1SXDA 4P2HA 2PI4A 2H3VA 2FMSA 1ZQWA 5AM0A 4C8LA 3RAQA 5F3XB 4RQ6A 1Q46A 1U49A 4BXOA 5KFQA 1KFTA 1TKDA 2HHWA 1ZD4A 3NRWA 3OPXA 1ZD3A 2D3DA 1COOA 4KITB 2BGWA 2LI6A 3B0YA 2ASDA 7ICMA 3D2NA 4P4MA 3NUQA 5KFUA 3RJHA 3F2DA 4P0QB 1WYGA 4FS2A 5ALPA 2NRXA 9ICWA 2HOIA 1ZQSA 9ICTA 1JXLA 5HHIA 2XO7A 2WB1F 1TAMA 3QUBA 2EAOA 2R18A 4GC7A 4F4YA 2BCVA 2KN7A 2AH5A 1N62A 4QIWF 3WK6A 2G06A 4Y2JA 2OCEA 2XCAA 5ALHA 3UM9A 2C2EA 3PX0A 1XO0A 2F77X 2YTUA 2H3IA 1B0XA 1XS9D 1N2XA 2AXTU 3RBEA 3C2KA 3IDWA 1ED1A 1UHUA 1HJPA 2H5XA 4UARA 3F2BA 9ICLA 3MR6A 4RQNA 9ICHA 1PK1A 1ZQLA 2OWOA 4B9MA 3DV9A 2D6FC 4JUZA 3MABA 5JUMA 3EPIA 3RFAA 2B0CA 5ALSA 5AK6A 4JMUA 2NYVA 2WB1C 3JPQA 4M6WB 1VDVA 8ICYA 1QSLA 1JROA 9ICFA 3HRDD 1TAQA 3OSNA 5AM1A 4J03A 4B9NA 2KMDA 4QIWC 5J0YA 2DFLA 4U6PA 4OJLA 2ZUCA 2ATLA 5KFDA 1PVPA 4DQPA 1QQ6A 4I2EA 5KG4A 3TFSA 3M9OB 3TKAA 1L3SA 2WF6A 4ECWA 3ICXA 2RQ5A 4EZ6A 1RQNA 5ALLA 1ZJNA 4YMNA 4GFJA 4M9JA 4RUCA 1S9FA 4F93B 1Z00A 2XVTA 3GV5B 5AHXA 1IXRA 3GIJA 4DO9A 4NLBA 2A1JA 4OJ6A 1ZQXA 2RP5A 2VJ5A 3AN1A 9ICAA 3JPOA 2ASLA 3QU7A 2NRTA 3I1YA 5KFSA 4DS5A 5KFTA 2K4PA 3GDXA 1X9MA 1RDFA 4GXJA 4F92B 4EENA 1QH9A 4I2JA 4IQVA 4NLZA 1JN3A 2JZBB 1NJWA 2LM4A 5AKKA 3NVYA 2C2DA 4DL5A 1Q3UA 1TAUA 3GFKB 4RZRA 2W7OA 4NY8A 1ZQDA 1ZQPA 1ZQFA 4PHAA 1PVQA 5KFIA 1XWLA 2Z7JA 3ZD9A 3SAHA 2K60A 4RQMA 1BPZA 1DRGA 3D2SA 2W3RA 5KAFU 5IIJA 1C20A 5KT7A 4DSFA 1NKBA 4UAYA 1T4GA 8ICSA 1H38A 2A3VA 5GTHU 4MEXA 4KLLA 1NK4A 4F5QA 1PUZA 4C8MA 2OYYA 4MF2A 2K4EA 4I2HA 5J0WA 2RDIA 2K8AA 1UPHA 5J0QA 3EPGA 3QU2A 4YMOA 3WKEA 3C1YA 5KFLA 3BDPA 2HHXA 1RG6A 1S0MA 1BPXA 3L3FX 4Q43A 2E1FA 5J2JA 5GTIU 5KFYA 1MSWD 4QZIA 1WCLA 5E79U 1ZQIA 3I28A 5KFBA 3C2MA 5KL8B 4O5CA 2EZZA 4KX5A 7ICLA 2HMXA 1V38A 3MBYA 2H3QA 5KFCA 4KLIA 8ICPA 4P0PB 4P0QA 5KFVA 1RYSA 5KT4A 2W43A 2C2RA 1Y88A 1TFRA 3TI0A 3BQ7A 3QEBZ 4O0IA 9ICUA 2PXIA 4F4ZA 1VJ5A 4XUSA 4XRHA 1JMSA 2Y9TA 1ZQBA 2ZTCA 2FMPA 3ZDAA 3M1YA 4RT3A 2DBYA 1T94A 3MDCA 2OXOA 1JUDA 4B9VA 3RB4A 5DBBA 3UXOA 4YR2A 2ES6A 4C4TA 1X9SA 3QUCA 1JI7A 4NL9C 4Y2YA 4Y2RA 3N4MB 9ICGA 3RR8A 1U4BA 4OJOA 5CEHA 1GO3F 4DOBA 3F2CA 4QWEA 2R8IA 4ED6A 9ICCA 1T8EA 3ISBA 4ELVA 5HHHA 4EX6A 4Y2QA 3HWTA 4MFAA 2BCQA 4I2DA 7ICQA 3PO4A 1BPYA 4KLJA 2VA8A 4RPXA 2JH7A 1J2MA 4FFDA 1FFUA 1ZQTA 1B43A 4ED0A 5CRXA 3C1ZA 2ZJAA 4M6WA 4I2IA 4Q44A 4QW8A 5EE0A 5DG8A 3TADC 4C80A 5J2AA 2PI5A 8ICJA 2F1JA 4FZNA 2GOLA 2J6SA 4O3RA 3BQ1A 1S10A 7ICRA 1NK8A 5KFXA 3QU4A 4IQTA 3RB3A 4RT2A 2P35A 4QWBA 4I2GA 5AM4A 3SV4A 1ZYQA 2NO4A 4QZ9A 4DQQA 3KKAA 4GIBA 2XI9A 3LVVA 2WF5A 1S8OA 5J8YC 2FMQA 1JIHA 5IIKA 1BGXT 4Y2UA 1TVAA 1KW4A 5IINA 2EDUA 4EBEA 4UB3A 2XC9A 2KKVA 3ETRA 3E2EA 5J0UA 2YMQA 3C23A 1TK0A 5L1KA 4QNLA 1FEZA 1K1QA 1AQ6A 1KFSA 1V9PA 2JZBA 4DFMA 3E0FA 4MFCA 1MQ3A 1VLBA 3PSPA 3N7PD 3HKZF 4I2AA 2FLNA 3QZ7A 3SAFA 4C4RA 9ICSA 3TANA 4JK1A 5ALZA 3N7RC 2W3SA 4DL4A 4PGXA 3CRXA 4F4XA 1K1SA 1SZPA 1UT8A 1QQ7A 3ONNA 3PSTA 3H0MB 3H0RB 3CYMA 5KT5A 1RXWA 5J2BA 4RQ8A 4QWDA 5ALQA 4DFKA 1DGJA 3PW7A 4PZNA 8ICKA 5KG7A 4IQUA 1KLNA 3I76A 2HBMA 3K4GA 2G5IB 2KNJA 1ZJMA 1JALA 1PZNA 4NWIA 1OXJA 3K1RB 3NRZA 2OM6A 2HVHA 5DQGA 1XNSA 2VANA 3CNHA 1L8LA 3RJFA 3HKZC 4B9LA 2F1IA 4DOAA 3AQEA 8ICVA 4Z6CA 2HBKA 5CA7A 1QSSA 1LVHA 1KDHA 4CDGA 1ZQOA 4P0PA 3FM9A 2BR0A 2NO5A 2QARB 9ICJA 1D8BA 2CPRA 3RRHA 3ED5A 5TISU 2M0NA 3KZIU 4M9GA 3RRGA 3OJSA 4P4OA 2WHEA 3T79A 2KTQA 3LYSA 1RXVA 5KG3A 2KHVA 4RNOA 1UA1A 4DLGA 1DOQA 5ALEA 2F3NA 8ICZA 1WWUA 4LZGA 3M9NB 3PW2A 3HJEA 1XO1A 4DL6A 2KOBA 5FP0A 3JPTA 3R9KA 3CW2C 4LJXA 2PKEA 4DSEA 4DSKA 4RNMA 3UQ0A 1X9XA 2YMMA 5HR7A 1B22A 2KJ8A 3Q8SB 3T5KA 5D4BA 4XQ8A 2XGQA 3BJYA 1ZQZA 2C28A 3QYPA 2P6RA 4ED7A 4GC6A 1N5XA 4JV2A 4PHPA 2I5HA 2B6GA 4Y2TA 4TUPA 2JEGA 1S77D 4HAIA 4YVZA 4UAUA 4MFFA 4C4SA 5G5GA 2W55A 1DXSA 4QZBA 2J6UA 3TAQA 2WF8A 3MDAA 4Q45A 3GILA 4OO1J 1D9FA 3VCBA 3EUB2 2AHOB 4F2SA 7ICEA 3GV8B 4ED8A 3A0BU 3WK5A 2PMZF 2XCPA 1QCKA 4QZHA 5DQIA 2W9AA 7ICFA 4QWAA 1A0PA 2BQ3A 3ETLA 3WKCA 2UVVA 2KD1A 5DQHA 1DK2A 1NI3A 4KLMA 2DPJA 7ICOA 5J0PA 3WK7A 2DUYA 5HR6A 3SEIA 4J9SA 4IRCA 5KG0A 2ASJA 2M9NA 3HPOA 2KIVA 5JU5A 4O3OA 1NJYA 1UT5A 4ECRA 9ICNA 3LK9A 1C7YA 3DDHA 4LVSA 1BNPA 2ZTEA 5ALUA 3H8SA 4QJFB 4M47A 1X66A 2BQUA 4F71A 2PFNA 2HW3A 2MU2A 1JX4A 5AKHA 4RQ1A 2DWQA 1U47A 4UB8U 1RM6C 2W8LA 3WK8A 2LYBA 3IHQB 2FDRA 2K4IA 3HILA 2PMZC 5CJ7A 3SR6A 3MFIA 5AM2A 1Z1VA 4ZOHC 4I2CA 5L1IA 4DQRA 3V6KA 4Y2VA 4UB5A 2AQ4A 3F5EA 2EANA 3QNMA 1DGSA 5J2FA 5AIAA 1M6YA 3QXGA 1IM4A 1KN5A 3JPRA 1Z3EB 2GWSA 3QU9A 2P6UA 4O3SA 2QB0B 1KKXA 3AMZA 4RPYA 8ICEA 3QUTA 2LYHA 3RBDA 1Z1BA 4UB1A 1SGGA 3N28A 2KG5A 2E8PA 2FPMA 4ECUA 2AJQA 4EBCA 1MQ2A 3QX7A 2IA6A 3KD3A 4KLOA 3RTVA 2E5SA 3OGUA 5BPCA 1CUKA 2E8NA 2YB1A 4O3QA 3O0FA 1S0NA 4YD2A 1SV0C 4DLEA 1X9WA 2BCUA 1PVRA 4UAVA 3H40A 2E8OA 2CRXA 7ICNA 3BZCA 4EZ9A 1U9LA 3WU2U 1URJA 2OEHA 4CGZA 2W8KA 2QARA 2DKZA 2OH2A 3C29A 4O5EA 1NNLA 2IOFK 9ICEA 2K8CB 5EE3A 2UVRA 5HP4A 2BDPA 2KSOB 3B0XA 2FLLA 2E3TA 2IOHA 2AGPA 4K4HA 2ZIXB 5L1JA 1U45A 1Q3VA 1FO4A 2P66A 2R8GA 1SXEA 5IIOA 5AK5A 5KT6A 4OJPA 2H3ZA 5ALMA 2HOFA 5ALTA 3F5AA 4F5RA 4RUAA 2VIXA 1SKWA 1ZQNA 2O6KA 1FFVA 3PW4A 5AKXA 4NLCA 2HSZA 5KFFA 4F2RA 1FIQA 3HP6A 1ZQAA 2KEYA 2DGZA 5D49A 7ICIA 2E8MA 3OSPA 5KFNA 2G0AA 4JB3A 1SZHA 3V7LA 5F9NA 3RJJA 1NOMA 2OHFA 3C5FA 4DSJA 4KLEA 2WAQF 5JTIA 4Q8FA 4U7CA 3RJGA 4C7ZA 4NLGA 4DSLA 1N48A 5J0TA 2LM1A 1JXEA 3ZI4A 4O5KA 4KN7A 5L1LA 5DBCA 4B9SA 5CWRA 1ZD5A 3M6KA 2KK0A 1PK3A 4NM1A 2G5HB 4UATA 4J9NA 9ICRA 2ESEA 4RQ0A 3PMLA 3RH4A 3IG8A 4PZOA 4F4WA 3L4PA 5AICA 2G09A 3OHAA 4BJQA 4R8UB 4PGYA 4QW9A 3KHRA 5F9LA 5ALFA 2K4HA 4FS1A 4DWIA 4F5NA 2BHNA 3Q8LA 3MGIA 4Y2SA 4NM2A 1ZQHA 4RQ5A 5ALJA 4F4KA 2WAQC 8ICTA 4C0ZA 3H0LB 4IS7A 3H4BA 3SQIA 8ICIA 3BQ2A 3RF9A 2JRZA 5IILA 5KFGA 5KFKA 2ZJ5A 3PV8A 2KP7A 1F44A 7ICHA 1SWWA 4MEYA 1D8YA 5DB6A 4R64A 3OJUA 3AM9A 2V9WA 4TUSA 4XA5A 9ICPA 3GIKA 3ISCA 2EAPA 3GZFA 2W9BB 8ICOA 1DK3A 5AKLA 3TADA 3OHBA 2JEFA 3LVWA 3ZDEA 1S0OA 4I28A 1K5OA 4YP3A 1KBUA 5EWGA 2QB0A 4ECQA 3TFRA 4BX9C 3EWAA 5ALVA 2HHSA 3KBBA 4UAZA 3AL0B 4IL6U 4K4IA 2YMPA 3ZD8A 3ZDDA 1A6SA 3RB6A 3ZDBA 4ECZA 3D2QA 4OD0A 5J2CA 3ZDCA 5KFAA 2F2AB 3M6ZA 2C22A 8ICWA 2R8HA 4R63A 5J8YA 5KFZA 3H8JA 4USAA 4KTQA 3J81j 2AGQA 3HT3A 2FLPA 3UMGA 3QZ8A 1O03A 2BZFA 5AI0A 2FPLA 5KTQA 3SMVA 4YXJA 5EOZA 4YN4A 2LKYA 2IHNA 1Z4NA 4X5VA 1O08A 5ALOA 2W9CB 5J2GA 4B9TA 2JMGA 3M8SA 3MR3A 1NZPA 5T14A 1KL9A 5H2FU 1QLNA 3C5GA 3RH5A 1AROP 1ZETA 2B21A 2ISOA 2KSOA 2KZ3A 4EX7A 3MGVA 4RQ2A 4KX3A 4IRKA 4FZLA 5AI9A 2ZIXA 4KLUA 3UXPA 2GH1A 1T3NA 3UPQA 5B5EU 3LWLA 3PMNA 3JPPA 7ICUA 1L8OA 1A76A 2HHUA 3GV7B 3PW0A 1J97A 2LMRA 3KZXA 1RYUA 1NKEA 1YT3A 5DB7A 4M9NA 5J2DA 1ZQ1C 1J2NA 4KN4A 2YMLA 1N63A 1ZOLA 2WTFA 5AKGA 4R66A 1TK8A 2LYAA 9ICOA 4LZDA 5HMLA 5ALNA 3RB0A 7ICTA 4F72A 1X6JA 5DKWA 3MR2A 4F8RA 1KTQA 5KFMA 4ED3A 1S97A 2NRWA 2ISPA 1EXNA 4YXMA 3WK4A 2ZIUB 4YQWA 2W9MA 2HVIA 5DG9A 1WG8A 3F53A 5IIMA 2KHQA 3C28A 3JPNA 1Q8KA 3UMCA 4IQWA 8ICAA 2VKQA 5L1MA 1ZRNA 1TK5A 1ZQEA 3AEVA 4M9LA 1HEKA 4KLQA 3TARA 2EH9A 3JPSA 2KIWA 3PR5B 4DSIA 4B9UA 2V4QA 1X6IA 2JGAA 5AI5A 3PSFA 1UA0A 2KFZA 5BOLA 3MC1A 2Q4TA 2CXYA 5J0RA 2D8CA 5ALXA 1F0MA 4R8UA 1ECWA 4C8NA 5J2EA 1TV9A 2ZUDA 2ZJ8A 3NS1A 2KICA 3MR5A 4IC9A 5ALWA 1LKYB 1SKRA 1YZ6A 3AU6A 3IV6A 5EWFA 3RR7A 3CP8A 3K1ZA 3ORYA 4OCZA 4DFDA 4YR3A 1X40A 2BQRA 5AM5A 3V6HA 2VA2A 4DF8A 1D8LA 2KVSA 2ZG6A 2N1RA 4UW9A 4PL1A 1BVSA 5KG1A 2GO7A 4I29A 5AK3A 2ZUBA 1KEJA 4QZDA 2KJ9A 7ICVA 1SB3C 1NK5A 3WKAA 4F3OA 2HHVA 4J9MA 4EEKA 3ALRA 3RAXA 2W9BA 4ACOA 2KJ5A 4DQIA 1SL1A 4O3NA 2F8LA 1ZQUA 8ICCA 2PFQA 4ED2A 3PX4A 1T3QA 2BPGA 4ELUA 4QZ8A 1Z19A 5C5JA 4CRXA 4NJ8A 1IV8A 3PO5A 3KHLA 4CNQA 2MA1A 4Z6EA 2YN4A 5A0LA 3EZ5A 2DPIA 3PSIA 4BDPA 3SENA 3PNCA 4FE3A 4FZMA 3T5HA 5AI6A 4BUGA 5AIBA 3C2LA 4KLTA 1BPEA 2DF4B 5J0OA 4DFJA 3NVZA 1ZQJA 1QTMA 1QSYA 3T5LA 4PGQA 2ALZA 2JEJA 4YR0A 2IMWP 5DB8A 4DCCA 2W54A 5CP2A 5DGBA 4GXKA 8ICNA 3PZPA 5DB9A 4UB2A 4KLFA 4QZGA 2KVCA 4PHEA 2W9CA 4GXIA 5CB1A 4BWJA 7ICJA 5AKIA 1SV4A 3MFHA 2ZTDA 2BPFA 5J2KA 1N56A 4CE6A 4Y2PA 9ICVA 1KRPA 2FJ6A 2HDOA 4KLDA 3G6YA 3TACB 4QZFA 3QU5A 5AKEA 4M0AA 3KOOA 5HMMA 2R8KA 9ICBA 1ZQKA 5KFPA 5EE9A 1ZXIA 2H3FA 5KFJA 3PVXA 4WJ3B 5ALIA 3VC8A 4F5PA 2WF9A 4ECXA 2ODGA 1SL2A 4F50A 5AKZA 2XIDA 4TQRA 4FBUA 4MF8A 4J9OA 2VA3A 4RNNA 4CF5A 2HHTA 3BS5B 4FO6A 4FBTA 4R65A 2XGPA 2W7PA 1HUZA 2ZIUA 5ALKA 2I6XA 2ZIVB 3PW5A 3UXNA 2XY6A 2ZIWB 3T5JA 2J6TA 1SV0A 4DL7A 4A8EA 2EZYA 4QWCA 2JEIA 2G08A 2HHQA 1MN8A 3GIMA 5L9XA 1U48A 2IHMA 3H7IA 4CF4A 4F91B 3KFUF 2KFNA 4KLHA 2W11A 2IOFA 4UASA 2RHFA 1KFDA 9ICIA 3BQTA 4JWMA 4JV1A 8ICXA 1NZBA 4YCXA 1V97A 4ELTA 1ZQVA 5KG2A 5DBAA 4US8A 4NV0A 2JXJA 3FYHA 9ICMA 1N5WA 5ALYA 1WUDA 2LHTA 4RQ3A 3Q8KA 3RJEA 1LB2B 4Y2XA 3K75D 1NK0A 5KFHA
chains in the Genus database with same CATH topology
3A0BU 5B66U 5KAFU 3A0HU 5B5EU 5KAIU 4PJ0U 5TISU 3KZIU 2AXTU 4IL6U 5H2FU 3WU2U 5GTHU 5GTIU 1S5LU 2DUYA 5E79U 4UB6U 4UB8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B U;  5B66 U;  5KAF U;  3A0H U;  5B5E U;  5KAI U;  4PJ0 U;  5TIS U;  3KZI U;  2AXT U;  4IL6 U;  5H2F U;  3WU2 U;  5GTH U;  5GTI U;  1S5L U;  2DUY A;  5E79 U;  4UB6 U;  4UB8 U; 
#chains in the Genus database with same CATH topology
 4ECV A;  3QE9 Y;  2MSN A;  2ZXH A;  1WWV A;  1S76 D;  1LKY A;  5KFW A;  3ISD A;  1JRP A;  4DF4 A;  3Q8Q B;  4RQ4 A;  1ZRM A;  1NK7 A;  4YG2 A;  2HBJ A;  1XU4 A;  3OTQ A;  4KMO B;  3G6X A;  2RRD A;  4US9 A;  1WCN A;  1HIW A;  1P7D A;  3H8M A;  1XC9 A;  3H4D A;  4K4G A;  4CCH A;  1HUO A;  1CEZ A;  3SI8 A;  3SZ2 A;  4B6J A;  2HBL A;  1NJX A;  3FC4 A;  3TQ1 A;  1CI4 A;  2F44 A;  4YFK A;  4JWN A;  3NTU A;  2QB1 A;  7ICG A;  2NRV A;  4RQ7 A;  2W04 A;  3C21 A;  3S6J A;  1BNO A;  5CR0 A;  3HW8 A;  3V6J A;  3IN5 A;  3H8W A;  7ICP A;  5J0S A;  4M2Y A;  3RJK A;  2HI0 A;  2F1H A;  1L7M A;  2BKE A;  4BWM A;  4PH5 A;  8ICR A;  2NRZ A;  8ICG A;  5HNK A;  1ZQQ A;  4O3M A;  3IRU A;  4IRD A;  4IR9 A;  4HYK A;  3U26 A;  2BCR A;  1S5L U;  3RJI A;  3WKD A;  3T3F A;  1XSL A;  3MGH A;  1CRX A;  1ZQY A;  8ICM A;  3V7J A;  5EWE A;  1RZT A;  3N97 B;  1UCV A;  2AU0 A;  5KAI U;  3NVV A;  3EYZ A;  3LWM A;  7ICK A;  3E58 A;  2DL0 A;  4RPZ A;  5AM3 A;  2CN1 A;  2YQE A;  4AYB F;  4AP9 A;  2A19 A;  4O3P A;  3N7S C;  4OJ5 A;  2K89 A;  2WFA A;  2Y9U A;  5KT3 A;  4TUR A;  2QLT A;  5K4L A;  3FAH A;  3V7K A;  2G07 A;  4NL9 A;  4DL3 A;  2HOQ A;  3Q8P B;  5KFO A;  4UQG A;  2XIC A;  4E0D A;  3NVW A;  3WKB A;  5TZV A;  2MUT B;  2XY5 A;  2AQ0 A;  1XSP A;  4PPX A;  3QUQ A;  8ICQ A;  3FDS A;  2EQY A;  2BPC A;  4G3I A;  4Q8E A;  4UB6 U;  5KFR A;  4Z6D A;  5DG7 A;  4DL2 A;  4NLK A;  4J9P A;  4QZE A;  4UBB A;  2HCF A;  2JR5 A;  3NGD A;  1F5S A;  5KG5 A;  5J2H A;  2RDJ A;  5DLF A;  5DDM A;  4PHD A;  4IR1 A;  3NAS A;  3QEA Z;  1B4F A;  4YMM A;  3HX0 A;  1RYR A;  2NV3 A;  5CHG A;  5J29 A;  4AYB C;  4KLS A;  4DQS A;  4UAW A;  4ED1 A;  3M9M B;  2XY7 A;  4ECS A;  1MA7 A;  1Z4O A;  2VJ4 A;  5G5H A;  2PFO A;  3BS5 A;  4Z6F A;  1ZQR A;  8ICF A;  2JHD A;  5DGA A;  4F5O A;  2KZM A;  5EE1 A;  2EZX A;  2ZIV A;  1NK6 A;  2ZIW A;  4J9K A;  9ICK A;  4BXO B;  4QZA A;  2MAX A;  2DQN B;  4JV0 A;  4PJ0 U;  2GLE A;  1BPD A;  3G6V A;  2LPE A;  5J2I A;  3AQF A;  1LV5 A;  2IBK A;  4O9M A;  4G9B A;  2JH1 A;  4EYI B;  4I2B A;  3KHH A;  1ZQC A;  2V4R A;  1IG6 A;  1L7P A;  4J9L A;  1OUQ A;  4KLG A;  3A0H U;  1L3T A;  3LDA A;  1L7N A;  1UQV A;  4CF3 A;  4EYH B;  4UBC A;  2F8K A;  4J9Q A;  2BDU A;  3BS7 A;  3Q8R B;  3PX6 A;  4C7Y A;  2WF7 A;  1SL0 A;  2RLT A;  1L3U A;  2LBO A;  1S0V A;  1TE2 A;  4DS4 A;  4ICA A;  1D9D A;  5KL1 B;  3PR4 A;  5AI8 A;  3KKA C;  4EEL A;  1L3V A;  3UMB A;  1RQL A;  3WK9 A;  2KKP A;  3SAG A;  3THV A;  4ECT A;  5C0Y A;  3M7D A;  3AUO A;  9ICQ A;  4EBD A;  2Y1I A;  4TQS A;  8ICL A;  4UB4 A;  2Q0Z X;  3KHG A;  1RPL A;  2YY6 A;  3IG5 A;  1NKC A;  5AKJ A;  2BCS A;  3Q8M A;  1PK1 B;  1T7P A;  1BPB A;  1ZQG A;  2KV2 A;  7ICS A;  2FE9 A;  1SKS A;  1X42 A;  5D46 A;  5AKY A;  4QZC A;  2AGO A;  4RU9 A;  1X2I A;  4NXZ A;  4BGD A;  3SYZ A;  2JV3 A;  1MC8 A;  8ICU A;  2FI1 A;  4EEY A;  1SIJ A;  3AU2 A;  1N60 A;  3BZK A;  1OW5 A;  4GLX A;  3UQ2 A;  2MRL A;  5DLG A;  3IM1 A;  5KG6 A;  2KZZ A;  1COK A;  4I27 A;  2Y1J A;  5KFE A;  3GQC A;  2K8B B;  4J9R A;  1ZD2 P;  4PL2 A;  4DOC A;  4ECY A;  5III A;  2ZXI A;  1N61 A;  1L6N A;  2Y0S F;  1KSP A;  1KQQ A;  4YD1 A;  2DKX A;  2QKQ A;  4C8O A;  2EAM A;  2UVW A;  1SWV A;  2A1A A;  2E1E A;  2KE7 A;  4MHV A;  5ALG A;  2F76 X;  3GU3 A;  1L7O A;  1Z00 B;  1L5U A;  4M9H A;  1ZQM A;  4ZH4 A;  2A1J B;  3RH6 A;  2MUT A;  5B66 U;  3D6J A;  4C8K A;  3KTQ A;  1IIP A;  5J0X A;  3BQ0 A;  4I2F A;  5ALR A;  1NK9 A;  8ICB A;  8ICH A;  4P4P A;  2UVU A;  2I9G A;  3V72 A;  5BOM A;  5KNI A;  3TAP A;  1NJZ A;  3SD7 A;  4NLN A;  2PFP A;  1QQ5 A;  2FPK A;  1XSN A;  3PY8 A;  3B9J A;  2YB4 A;  5AK4 A;  1A77 A;  1V85 A;  3SV3 A;  2I1Q A;  2Y0S C;  3M8R A;  5DDY A;  3IP4 B;  2R8J A;  5ALD A;  4TUQ A;  4M04 A;  5AI4 A;  1YZ7 A;  2W03 A;  5KT2 A;  4DFP A;  3GII A;  3DEE A;  3EW9 A;  2L5Y A;  4KMU A;  2YX8 A;  3L5K A;  5JRT A;  9ICX A;  4DEZ A;  1SXD A;  4P2H A;  2PI4 A;  2H3V A;  2FMS A;  1ZQW A;  5AM0 A;  4C8L A;  3RAQ A;  5F3X B;  4RQ6 A;  1Q46 A;  1U49 A;  4BXO A;  5KFQ A;  1KFT A;  1TKD A;  2HHW A;  1ZD4 A;  3NRW A;  3OPX A;  1ZD3 A;  2D3D A;  1COO A;  4KIT B;  2BGW A;  2LI6 A;  3B0Y A;  2ASD A;  7ICM A;  3D2N A;  4P4M A;  3NUQ A;  5KFU A;  3RJH A;  3F2D A;  4P0Q B;  1WYG A;  4FS2 A;  5ALP A;  2NRX A;  9ICW A;  2HOI A;  1ZQS A;  9ICT A;  1JXL A;  5HHI A;  2XO7 A;  2WB1 F;  1TAM A;  3QUB A;  2EAO A;  2R18 A;  4GC7 A;  4F4Y A;  2BCV A;  2KN7 A;  2AH5 A;  1N62 A;  4QIW F;  3WK6 A;  2G06 A;  4Y2J A;  2OCE A;  2XCA A;  5ALH A;  3UM9 A;  2C2E A;  3PX0 A;  1XO0 A;  2F77 X;  2YTU A;  2H3I A;  1B0X A;  1XS9 D;  1N2X A;  2AXT U;  3RBE A;  3C2K A;  3IDW A;  1ED1 A;  1UHU A;  1HJP A;  2H5X A;  4UAR A;  3F2B A;  9ICL A;  3MR6 A;  4RQN A;  9ICH A;  1PK1 A;  1ZQL A;  2OWO A;  4B9M A;  3DV9 A;  2D6F C;  4JUZ A;  3MAB A;  5JUM A;  3EPI A;  3RFA A;  2B0C A;  5ALS A;  5AK6 A;  4JMU A;  2NYV A;  2WB1 C;  3JPQ A;  4M6W B;  1VDV A;  8ICY A;  1QSL A;  1JRO A;  9ICF A;  3HRD D;  1TAQ A;  3OSN A;  5AM1 A;  4J03 A;  4B9N A;  2KMD A;  4QIW C;  5J0Y A;  2DFL A;  4U6P A;  4OJL A;  2ZUC A;  2ATL A;  5KFD A;  1PVP A;  4DQP A;  1QQ6 A;  4I2E A;  5KG4 A;  3TFS A;  3M9O B;  3TKA A;  1L3S A;  2WF6 A;  4ECW A;  3ICX A;  2RQ5 A;  4EZ6 A;  1RQN A;  5ALL A;  1ZJN A;  4YMN A;  4GFJ A;  4M9J A;  4RUC A;  1S9F A;  4F93 B;  1Z00 A;  2XVT A;  3GV5 B;  5AHX A;  1IXR A;  3GIJ A;  4DO9 A;  4NLB A;  2A1J A;  4OJ6 A;  1ZQX A;  2RP5 A;  2VJ5 A;  3AN1 A;  9ICA A;  3JPO A;  2ASL A;  3QU7 A;  2NRT A;  3I1Y A;  5KFS A;  4DS5 A;  5KFT A;  2K4P A;  3GDX A;  1X9M A;  1RDF A;  4GXJ A;  4F92 B;  4EEN A;  1QH9 A;  4I2J A;  4IQV A;  4NLZ A;  1JN3 A;  2JZB B;  1NJW A;  2LM4 A;  5AKK A;  3NVY A;  2C2D A;  4DL5 A;  1Q3U A;  1TAU A;  3GFK B;  4RZR A;  2W7O A;  4NY8 A;  1ZQD A;  1ZQP A;  1ZQF A;  4PHA A;  1PVQ A;  5KFI A;  1XWL A;  2Z7J A;  3ZD9 A;  3SAH A;  2K60 A;  4RQM A;  1BPZ A;  1DRG A;  3D2S A;  2W3R A;  5KAF U;  5IIJ A;  1C20 A;  5KT7 A;  4DSF A;  1NKB A;  4UAY A;  1T4G A;  8ICS A;  1H38 A;  2A3V A;  5GTH U;  4MEX A;  4KLL A;  1NK4 A;  4F5Q A;  1PUZ A;  4C8M A;  2OYY A;  4MF2 A;  2K4E A;  4I2H A;  5J0W A;  2RDI A;  2K8A A;  1UPH A;  5J0Q A;  3EPG A;  3QU2 A;  4YMO A;  3WKE A;  3C1Y A;  5KFL A;  3BDP A;  2HHX A;  1RG6 A;  1S0M A;  1BPX A;  3L3F X;  4Q43 A;  2E1F A;  5J2J A;  5GTI U;  5KFY A;  1MSW D;  4QZI A;  1WCL A;  5E79 U;  1ZQI A;  3I28 A;  5KFB A;  3C2M A;  5KL8 B;  4O5C A;  2EZZ A;  4KX5 A;  7ICL A;  2HMX A;  1V38 A;  3MBY A;  2H3Q A;  5KFC A;  4KLI A;  8ICP A;  4P0P B;  4P0Q A;  5KFV A;  1RYS A;  5KT4 A;  2W43 A;  2C2R A;  1Y88 A;  1TFR A;  3TI0 A;  3BQ7 A;  3QEB Z;  4O0I A;  9ICU A;  2PXI A;  4F4Z A;  1VJ5 A;  4XUS A;  4XRH A;  1JMS A;  2Y9T A;  1ZQB A;  2ZTC A;  2FMP A;  3ZDA A;  3M1Y A;  4RT3 A;  2DBY A;  1T94 A;  3MDC A;  2OXO A;  1JUD A;  4B9V A;  3RB4 A;  5DBB A;  3UXO A;  4YR2 A;  2ES6 A;  4C4T A;  1X9S A;  3QUC A;  1JI7 A;  4NL9 C;  4Y2Y A;  4Y2R A;  3N4M B;  9ICG A;  3RR8 A;  1U4B A;  4OJO A;  5CEH A;  1GO3 F;  4DOB A;  3F2C A;  4QWE A;  2R8I A;  4ED6 A;  9ICC A;  1T8E A;  3ISB A;  4ELV A;  5HHH A;  4EX6 A;  4Y2Q A;  3HWT A;  4MFA A;  2BCQ A;  4I2D A;  7ICQ A;  3PO4 A;  1BPY A;  4KLJ A;  2VA8 A;  4RPX A;  2JH7 A;  1J2M A;  4FFD A;  1FFU A;  1ZQT A;  1B43 A;  4ED0 A;  5CRX A;  3C1Z A;  2ZJA A;  4M6W A;  4I2I A;  4Q44 A;  4QW8 A;  5EE0 A;  5DG8 A;  3TAD C;  4C80 A;  5J2A A;  2PI5 A;  8ICJ A;  2F1J A;  4FZN A;  2GOL A;  2J6S A;  4O3R A;  3BQ1 A;  1S10 A;  7ICR A;  1NK8 A;  5KFX A;  3QU4 A;  4IQT A;  3RB3 A;  4RT2 A;  2P35 A;  4QWB A;  4I2G A;  5AM4 A;  3SV4 A;  1ZYQ A;  2NO4 A;  4QZ9 A;  4DQQ A;  3KKA A;  4GIB A;  2XI9 A;  3LVV A;  2WF5 A;  1S8O A;  5J8Y C;  2FMQ A;  1JIH A;  5IIK A;  1BGX T;  4Y2U A;  1TVA A;  1KW4 A;  5IIN A;  2EDU A;  4EBE A;  4UB3 A;  2XC9 A;  2KKV A;  3ETR A;  3E2E A;  5J0U A;  2YMQ A;  3C23 A;  1TK0 A;  5L1K A;  4QNL A;  1FEZ A;  1K1Q A;  1AQ6 A;  1KFS A;  1V9P A;  2JZB A;  4DFM A;  3E0F A;  4MFC A;  1MQ3 A;  1VLB A;  3PSP A;  3N7P D;  3HKZ F;  4I2A A;  2FLN A;  3QZ7 A;  3SAF A;  4C4R A;  9ICS A;  3TAN A;  4JK1 A;  5ALZ A;  3N7R C;  2W3S A;  4DL4 A;  4PGX A;  3CRX A;  4F4X A;  1K1S A;  1SZP A;  1UT8 A;  1QQ7 A;  3ONN A;  3PST A;  3H0M B;  3H0R B;  3CYM A;  5KT5 A;  1RXW A;  5J2B A;  4RQ8 A;  4QWD A;  5ALQ A;  4DFK A;  1DGJ A;  3PW7 A;  4PZN A;  8ICK A;  5KG7 A;  4IQU A;  1KLN A;  3I76 A;  2HBM A;  3K4G A;  2G5I B;  2KNJ A;  1ZJM A;  1JAL A;  1PZN A;  4NWI A;  1OXJ A;  3K1R B;  3NRZ A;  2OM6 A;  2HVH A;  5DQG A;  1XNS A;  2VAN A;  3CNH A;  1L8L A;  3RJF A;  3HKZ C;  4B9L A;  2F1I A;  4DOA A;  3AQE A;  8ICV A;  4Z6C A;  2HBK A;  5CA7 A;  1QSS A;  1LVH A;  1KDH A;  4CDG A;  1ZQO A;  4P0P A;  3FM9 A;  2BR0 A;  2NO5 A;  2QAR B;  9ICJ A;  1D8B A;  2CPR A;  3RRH A;  3ED5 A;  5TIS U;  2M0N A;  3KZI U;  4M9G A;  3RRG A;  3OJS A;  4P4O A;  2WHE A;  3T79 A;  2KTQ A;  3LYS A;  1RXV A;  5KG3 A;  2KHV A;  4RNO A;  1UA1 A;  4DLG A;  1DOQ A;  5ALE A;  2F3N A;  8ICZ A;  1WWU A;  4LZG A;  3M9N B;  3PW2 A;  3HJE A;  1XO1 A;  4DL6 A;  2KOB A;  5FP0 A;  3JPT A;  3R9K A;  3CW2 C;  4LJX A;  2PKE A;  4DSE A;  4DSK A;  4RNM A;  3UQ0 A;  1X9X A;  2YMM A;  5HR7 A;  1B22 A;  2KJ8 A;  3Q8S B;  3T5K A;  5D4B A;  4XQ8 A;  2XGQ A;  3BJY A;  1ZQZ A;  2C28 A;  3QYP A;  2P6R A;  4ED7 A;  4GC6 A;  1N5X A;  4JV2 A;  4PHP A;  2I5H A;  2B6G A;  4Y2T A;  4TUP A;  2JEG A;  1S77 D;  4HAI A;  4YVZ A;  4UAU A;  4MFF A;  4C4S A;  5G5G A;  2W55 A;  1DXS A;  4QZB A;  2J6U A;  3TAQ A;  2WF8 A;  3MDA A;  4Q45 A;  3GIL A;  4OO1 J;  1D9F A;  3VCB A;  3EUB 2;  2AHO B;  4F2S A;  7ICE A;  3GV8 B;  4ED8 A;  3A0B U;  3WK5 A;  2PMZ F;  2XCP A;  1QCK A;  4QZH A;  5DQI A;  2W9A A;  7ICF A;  4QWA A;  1A0P A;  2BQ3 A;  3ETL A;  3WKC A;  2UVV A;  2KD1 A;  5DQH A;  1DK2 A;  1NI3 A;  4KLM A;  2DPJ A;  7ICO A;  5J0P A;  3WK7 A;  2DUY A;  5HR6 A;  3SEI A;  4J9S A;  4IRC A;  5KG0 A;  2ASJ A;  2M9N A;  3HPO A;  2KIV A;  5JU5 A;  4O3O A;  1NJY A;  1UT5 A;  4ECR A;  9ICN A;  3LK9 A;  1C7Y A;  3DDH A;  4LVS A;  1BNP A;  2ZTE A;  5ALU A;  3H8S A;  4QJF B;  4M47 A;  1X66 A;  2BQU A;  4F71 A;  2PFN A;  2HW3 A;  2MU2 A;  1JX4 A;  5AKH A;  4RQ1 A;  2DWQ A;  1U47 A;  4UB8 U;  1RM6 C;  2W8L A;  3WK8 A;  2LYB A;  3IHQ B;  2FDR A;  2K4I A;  3HIL A;  2PMZ C;  5CJ7 A;  3SR6 A;  3MFI A;  5AM2 A;  1Z1V A;  4ZOH C;  4I2C A;  5L1I A;  4DQR A;  3V6K A;  4Y2V A;  4UB5 A;  2AQ4 A;  3F5E A;  2EAN A;  3QNM A;  1DGS A;  5J2F A;  5AIA A;  1M6Y A;  3QXG A;  1IM4 A;  1KN5 A;  3JPR A;  1Z3E B;  2GWS A;  3QU9 A;  2P6U A;  4O3S A;  2QB0 B;  1KKX A;  3AMZ A;  4RPY A;  8ICE A;  3QUT A;  2LYH A;  3RBD A;  1Z1B A;  4UB1 A;  1SGG A;  3N28 A;  2KG5 A;  2E8P A;  2FPM A;  4ECU A;  2AJQ A;  4EBC A;  1MQ2 A;  3QX7 A;  2IA6 A;  3KD3 A;  4KLO A;  3RTV A;  2E5S A;  3OGU A;  5BPC A;  1CUK A;  2E8N A;  2YB1 A;  4O3Q A;  3O0F A;  1S0N A;  4YD2 A;  1SV0 C;  4DLE A;  1X9W A;  2BCU A;  1PVR A;  4UAV A;  3H40 A;  2E8O A;  2CRX A;  7ICN A;  3BZC A;  4EZ9 A;  1U9L A;  3WU2 U;  1URJ A;  2OEH A;  4CGZ A;  2W8K A;  2QAR A;  2DKZ A;  2OH2 A;  3C29 A;  4O5E A;  1NNL A;  2IOF K;  9ICE A;  2K8C B;  5EE3 A;  2UVR A;  5HP4 A;  2BDP A;  2KSO B;  3B0X A;  2FLL A;  2E3T A;  2IOH A;  2AGP A;  4K4H A;  2ZIX B;  5L1J A;  1U45 A;  1Q3V A;  1FO4 A;  2P66 A;  2R8G A;  1SXE A;  5IIO A;  5AK5 A;  5KT6 A;  4OJP A;  2H3Z A;  5ALM A;  2HOF A;  5ALT A;  3F5A A;  4F5R A;  4RUA A;  2VIX A;  1SKW A;  1ZQN A;  2O6K A;  1FFV A;  3PW4 A;  5AKX A;  4NLC A;  2HSZ A;  5KFF A;  4F2R A;  1FIQ A;  3HP6 A;  1ZQA A;  2KEY A;  2DGZ A;  5D49 A;  7ICI A;  2E8M A;  3OSP A;  5KFN A;  2G0A A;  4JB3 A;  1SZH A;  3V7L A;  5F9N A;  3RJJ A;  1NOM A;  2OHF A;  3C5F A;  4DSJ A;  4KLE A;  2WAQ F;  5JTI A;  4Q8F A;  4U7C A;  3RJG A;  4C7Z A;  4NLG A;  4DSL A;  1N48 A;  5J0T A;  2LM1 A;  1JXE A;  3ZI4 A;  4O5K A;  4KN7 A;  5L1L A;  5DBC A;  4B9S A;  5CWR A;  1ZD5 A;  3M6K A;  2KK0 A;  1PK3 A;  4NM1 A;  2G5H B;  4UAT A;  4J9N A;  9ICR A;  2ESE A;  4RQ0 A;  3PML A;  3RH4 A;  3IG8 A;  4PZO A;  4F4W A;  3L4P A;  5AIC A;  2G09 A;  3OHA A;  4BJQ A;  4R8U B;  4PGY A;  4QW9 A;  3KHR A;  5F9L A;  5ALF A;  2K4H A;  4FS1 A;  4DWI A;  4F5N A;  2BHN A;  3Q8L A;  3MGI A;  4Y2S A;  4NM2 A;  1ZQH A;  4RQ5 A;  5ALJ A;  4F4K A;  2WAQ C;  8ICT A;  4C0Z A;  3H0L B;  4IS7 A;  3H4B A;  3SQI A;  8ICI A;  3BQ2 A;  3RF9 A;  2JRZ A;  5IIL A;  5KFG A;  5KFK A;  2ZJ5 A;  3PV8 A;  2KP7 A;  1F44 A;  7ICH A;  1SWW A;  4MEY A;  1D8Y A;  5DB6 A;  4R64 A;  3OJU A;  3AM9 A;  2V9W A;  4TUS A;  4XA5 A;  9ICP A;  3GIK A;  3ISC A;  2EAP A;  3GZF A;  2W9B B;  8ICO A;  1DK3 A;  5AKL A;  3TAD A;  3OHB A;  2JEF A;  3LVW A;  3ZDE A;  1S0O A;  4I28 A;  1K5O A;  4YP3 A;  1KBU A;  5EWG A;  2QB0 A;  4ECQ A;  3TFR A;  4BX9 C;  3EWA A;  5ALV A;  2HHS A;  3KBB A;  4UAZ A;  3AL0 B;  4IL6 U;  4K4I A;  2YMP A;  3ZD8 A;  3ZDD A;  1A6S A;  3RB6 A;  3ZDB A;  4ECZ A;  3D2Q A;  4OD0 A;  5J2C A;  3ZDC A;  5KFA A;  2F2A B;  3M6Z A;  2C22 A;  8ICW A;  2R8H A;  4R63 A;  5J8Y A;  5KFZ A;  3H8J A;  4USA A;  4KTQ A;  3J81 j;  2AGQ A;  3HT3 A;  2FLP A;  3UMG A;  3QZ8 A;  1O03 A;  2BZF A;  5AI0 A;  2FPL A;  5KTQ A;  3SMV A;  4YXJ A;  5EOZ A;  4YN4 A;  2LKY A;  2IHN A;  1Z4N A;  4X5V A;  1O08 A;  5ALO A;  2W9C B;  5J2G A;  4B9T A;  2JMG A;  3M8S A;  3MR3 A;  1NZP A;  5T14 A;  1KL9 A;  5H2F U;  1QLN A;  3C5G A;  3RH5 A;  1ARO P;  1ZET A;  2B21 A;  2ISO A;  2KSO A;  2KZ3 A;  4EX7 A;  3MGV A;  4RQ2 A;  4KX3 A;  4IRK A;  4FZL A;  5AI9 A;  2ZIX A;  4KLU A;  3UXP A;  2GH1 A;  1T3N A;  3UPQ A;  5B5E U;  3LWL A;  3PMN A;  3JPP A;  7ICU A;  1L8O A;  1A76 A;  2HHU A;  3GV7 B;  3PW0 A;  1J97 A;  2LMR A;  3KZX A;  1RYU A;  1NKE A;  1YT3 A;  5DB7 A;  4M9N A;  5J2D A;  1ZQ1 C;  1J2N A;  4KN4 A;  2YML A;  1N63 A;  1ZOL A;  2WTF A;  5AKG A;  4R66 A;  1TK8 A;  2LYA A;  9ICO A;  4LZD A;  5HML A;  5ALN A;  3RB0 A;  7ICT A;  4F72 A;  1X6J A;  5DKW A;  3MR2 A;  4F8R A;  1KTQ A;  5KFM A;  4ED3 A;  1S97 A;  2NRW A;  2ISP A;  1EXN A;  4YXM A;  3WK4 A;  2ZIU B;  4YQW A;  2W9M A;  2HVI A;  5DG9 A;  1WG8 A;  3F53 A;  5IIM A;  2KHQ A;  3C28 A;  3JPN A;  1Q8K A;  3UMC A;  4IQW A;  8ICA A;  2VKQ A;  5L1M A;  1ZRN A;  1TK5 A;  1ZQE A;  3AEV A;  4M9L A;  1HEK A;  4KLQ A;  3TAR A;  2EH9 A;  3JPS A;  2KIW A;  3PR5 B;  4DSI A;  4B9U A;  2V4Q A;  1X6I A;  2JGA A;  5AI5 A;  3PSF A;  1UA0 A;  2KFZ A;  5BOL A;  3MC1 A;  2Q4T A;  2CXY A;  5J0R A;  2D8C A;  5ALX A;  1F0M A;  4R8U A;  1ECW A;  4C8N A;  5J2E A;  1TV9 A;  2ZUD A;  2ZJ8 A;  3NS1 A;  2KIC A;  3MR5 A;  4IC9 A;  5ALW A;  1LKY B;  1SKR A;  1YZ6 A;  3AU6 A;  3IV6 A;  5EWF A;  3RR7 A;  3CP8 A;  3K1Z A;  3ORY A;  4OCZ A;  4DFD A;  4YR3 A;  1X40 A;  2BQR A;  5AM5 A;  3V6H A;  2VA2 A;  4DF8 A;  1D8L A;  2KVS A;  2ZG6 A;  2N1R A;  4UW9 A;  4PL1 A;  1BVS A;  5KG1 A;  2GO7 A;  4I29 A;  5AK3 A;  2ZUB A;  1KEJ A;  4QZD A;  2KJ9 A;  7ICV A;  1SB3 C;  1NK5 A;  3WKA A;  4F3O A;  2HHV A;  4J9M A;  4EEK A;  3ALR A;  3RAX A;  2W9B A;  4ACO A;  2KJ5 A;  4DQI A;  1SL1 A;  4O3N A;  2F8L A;  1ZQU A;  8ICC A;  2PFQ A;  4ED2 A;  3PX4 A;  1T3Q A;  2BPG A;  4ELU A;  4QZ8 A;  1Z19 A;  5C5J A;  4CRX A;  4NJ8 A;  1IV8 A;  3PO5 A;  3KHL A;  4CNQ A;  2MA1 A;  4Z6E A;  2YN4 A;  5A0L A;  3EZ5 A;  2DPI A;  3PSI A;  4BDP A;  3SEN A;  3PNC A;  4FE3 A;  4FZM A;  3T5H A;  5AI6 A;  4BUG A;  5AIB A;  3C2L A;  4KLT A;  1BPE A;  2DF4 B;  5J0O A;  4DFJ A;  3NVZ A;  1ZQJ A;  1QTM A;  1QSY A;  3T5L A;  4PGQ A;  2ALZ A;  2JEJ A;  4YR0 A;  2IMW P;  5DB8 A;  4DCC A;  2W54 A;  5CP2 A;  5DGB A;  4GXK A;  8ICN A;  3PZP A;  5DB9 A;  4UB2 A;  4KLF A;  4QZG A;  2KVC A;  4PHE A;  2W9C A;  4GXI A;  5CB1 A;  4BWJ A;  7ICJ A;  5AKI A;  1SV4 A;  3MFH A;  2ZTD A;  2BPF A;  5J2K A;  1N56 A;  4CE6 A;  4Y2P A;  9ICV A;  1KRP A;  2FJ6 A;  2HDO A;  4KLD A;  3G6Y A;  3TAC B;  4QZF A;  3QU5 A;  5AKE A;  4M0A A;  3KOO A;  5HMM A;  2R8K A;  9ICB A;  1ZQK A;  5KFP A;  5EE9 A;  1ZXI A;  2H3F A;  5KFJ A;  3PVX A;  4WJ3 B;  5ALI A;  3VC8 A;  4F5P A;  2WF9 A;  4ECX A;  2ODG A;  1SL2 A;  4F50 A;  5AKZ A;  2XID A;  4TQR A;  4FBU A;  4MF8 A;  4J9O A;  2VA3 A;  4RNN A;  4CF5 A;  2HHT A;  3BS5 B;  4FO6 A;  4FBT A;  4R65 A;  2XGP A;  2W7P A;  1HUZ A;  2ZIU A;  5ALK A;  2I6X A;  2ZIV B;  3PW5 A;  3UXN A;  2XY6 A;  2ZIW B;  3T5J A;  2J6T A;  1SV0 A;  4DL7 A;  4A8E A;  2EZY A;  4QWC A;  2JEI A;  2G08 A;  2HHQ A;  1MN8 A;  3GIM A;  5L9X A;  1U48 A;  2IHM A;  3H7I A;  4CF4 A;  4F91 B;  3KFU F;  2KFN A;  4KLH A;  2W11 A;  2IOF A;  4UAS A;  2RHF A;  1KFD A;  9ICI A;  3BQT A;  4JWM A;  4JV1 A;  8ICX A;  1NZB A;  4YCX A;  1V97 A;  4ELT A;  1ZQV A;  5KG2 A;  5DBA A;  4US8 A;  4NV0 A;  2JXJ A;  3FYH A;  9ICM A;  1N5W A;  5ALY A;  1WUD A;  2LHT A;  4RQ3 A;  3Q8K A;  3RJE A;  1LB2 B;  4Y2X A;  3K75 D;  1NK0 A;  5KFH A; 
#chains in the Genus database with same CATH homology
 3A0B U;  5B66 U;  5KAF U;  3A0H U;  5B5E U;  5KAI U;  4PJ0 U;  5TIS U;  3KZI U;  2AXT U;  4IL6 U;  5H2F U;  3WU2 U;  5GTH U;  5GTI U;  1S5L U;  2DUY A;  5E79 U;  4UB6 U;  4UB8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...