5KAIU

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
total genus 26
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5kaiU01
4UB8U 3A0BU 5B5EU 5TISU 5GTIU 5KAFU 2DUYA 5E79U 5GTHU 2AXTU 4IL6U 3WU2U 4UB6U 3A0HU 5KAIU 4PJ0U 5B66U 1S5LU 3KZIU 5H2FU
chains in the Genus database with same CATH superfamily
5KFIA 3QUBA 2HBKA 2F2AB 1ZJNA 5KFNA 3AMZA 1A76A 1SXDA 5L1LA 1QSSA 4KLUA 2F3NA 4J9KA 2DPIA 2BCRA 4FO6A 2HBLA 4MHVA 5T14A 5JTIA 1SL1A 1BPDA 5L1IA 2H5XA 4NY8A 1XSLA 5AI0A 2MAXA 3K1RB 1N5XA 5KFFA 3N7SC 1N60A 4M6WB 2W9BA 4KX3A 2QB0A 3MR2A 3RTVA 1NZPA 5J8YC 5DGBA 5ALIA 8ICAA 2AQ0A 1ZQAA 4ELUA 2HHTA 2GLEA 1TK8A 2HHXA 3DEEA 3PSFA 5FP0A 4KMUA 5IIJA 4AYBF 3QU9A 2EZXA 3H0LB 1FFUA 1PVRA 4UQGA 4QZAA 2YN4A 4PJ0U 3EYZA 2EAPA 1UA0A 4UBBA 4F50A 1D9FA 5TZVA 4LZGA 3RJKA 1Z1BA 3NUQA 3BZKA 4KLFA 4OJ6A 3E58A 5J29A 1VDVA 4DL5A 2ZIUA 1X6IA 3PW5A 2WF6A 1Z4NA 4YVZA 2HBMA 1K1QA 4R63A 4QJFB 2BHNA 8ICRA 2YB4A 5F9NA 1QH9A 8ICZA 1ZQSA 2IOFK 4I29A 3RJIA 3DDHA 1ZD3A 9ICHA 2JMGA 1NK6A 5HMMA 1SWWA 4M0AA 1YZ7A 3R9KA 1NJZA 2RQ5A 5KFLA 2K4HA 4CCHA 3NVVA 2J6TA 2KG5A 4KLSA 5KL1B 2WF9A 3M8RA 3G6XA 4NJ8A 2BZFA 5J2BA 4P0PA 2DF4B 3KZXA 3WKDA 2W8LA 4KLJA 4DSJA 2DKZA 1RYSA 4OJ5A 1WG8A 4NLGA 2PFOA 3IRUA 2EZZA 5ALXA 2C2DA 2BDPA 4M9HA 5ALVA 2ASLA 1X2IA 2XC9A 1VJ5A 9ICXA 2OM6A 4F8RA 3I1YA 4B9NA 1D8BA 2FJ6A 5KFVA 1JXEA 3PSIA 2AGPA 3GV8B 1XNSA 1X9SA 3CW2C 4O9MA 5J0OA 3PW4A 4RQ6A 5KG0A 4K4IA 2KZMA 7ICLA 1YT3A 1SV0A 3LVVA 4BUGA 2VA8A 2C22A 4Q44A 2FMQA 2KHQA 3PW2A 1L7NA 5DKWA 9ICCA 3Q8PB 2BCSA 2Y0SC 1S76D 4ECUA 1Z4OA 5DB9A 4PHDA 5J2JA 2WAQF 4G9BA 1WWVA 3JPQA 2I1QA 3TANA 3T5KA 5HR6A 4QWEA 3KZIU 2YMLA 2FPLA 3PO4A 4ELVA 4M9JA 4GXIA 4DL2A 5KG1A 2HSZA 5DB8A 3GIJA 5KFOA 5AKJA 5CWRA 4O3MA 3PSTA 4UB4A 4J9QA 3RJGA 2A1AA 7ICPA 1J2NA 4XQ8A 5DB6A 3V7KA 3V72A 3PV8A 4J9PA 4O3OA 1X9WA 4ZH4A 1N5WA 4J9NA 5AKZA 2HHWA 2ASDA 9ICEA 4DFPA 3ONNA 4FZNA 3SYZA 1A6SA 1MA7A 1P7DA 2Y9UA 2K4PA 2ES6A 4KN4A 3JPPA 4C80A 1ECWA 2PFPA 4JV1A 2EZYA 3EW9A 4IRCA 5AM0A 2NO4A 4LJXA 2K4EA 1NK5A 2KVSA 3A0HU 5ALLA 1DGSA 3PX4A 4KLDA 2ZIVB 2ZTEA 5CB1A 1Z00A 3G6YA 5J2HA 2FMPA 1KL9A 2XICA 3PMNA 4QZ9A 4B9SA 3F5AA 2M9NA 1JRPA 1RYUA 4MFCA 1K5OA 4B9UA 2WAQC 4PGQA 3C1ZA 1VLBA 2UVWA 4UAVA 3ZDDA 3WKCA 4I2FA 4M9NA 1XWLA 2DUYA 4IL6U 5HMLA 4AYBC 1XO1A 4TUSA 3GFKB 1ZETA 3Q8MA 5AKYA 3UMBA 1ZQBA 1S0OA 1ZQRA 2EH9A 3PY8A 4DFKA 1MQ2A 5IIKA 4K4HA 4UW9A 1PVPA 3M7DA 1XSNA 8ICNA 3Q8LA 4DLEA 4O3SA 8ICSA 8ICLA 4ED0A 1ZRMA 4M04A 3TQ1A 2GO7A 5ALEA 3ISBA 5DLFA 1XSPA 4YCXA 1N62A 3EZ5A 4I2DA 4YXJA 5D4BA 4TUQA 1MN8A 4RQ2A 3Q8SB 1JI7A 4RT3A 4QWDA 3HWTA 3BQ2A 4KLLA 3WK8A 2HHVA 5AI5A 4B9MA 1C20A 4IQTA 3N4MB 3M9MB 7ICQA 3GV7B 7ICNA 3SMVA 5AKEA 3Q8QB 5KG4A 2IMWP 1WCNA 3KHRA 2YX8A 2WF7A 5KG6A 1RYRA 1NKBA 4RT2A 1S0NA 3V6KA 1UHUA 1T7PA 1ZQNA 2EDUA 3NASA 4NL9A 2K8CB 5CR0A 3RAXA 4Y2QA 2EQYA 4YN4A 3WK6A 3RB0A 3MGHA 4J9RA 2CRXA 1XO0A 3MR5A 3QU7A 1KQQA 1UCVA 4ECVA 2UVUA 2WHEA 3LDAA 3LK9A 7ICUA 3L3FX 4RQ4A 4C4TA 1DGJA 2IOHA 2KHVA 2HHUA 1YZ6A 2D8CA 1BPYA 1ZOLA 1ZQLA 3SV3A 3J81j 4KTQA 2W03A 5KFZA 1XU4A 9ICTA 2I6XA 3LWMA 3KBBA 8ICEA 2LYHA 4Y2XA 4R66A 4F5RA 4CF4A 1ZJMA 3FC4A 4BDPA 2MSNA 5CP2A 2XIDA 3AQEA 5ALSA 5KFGA 5ALUA 2HOFA 3D2NA 2YY6A 1BNOA 1NJXA 2DWQA 5AK6A 3TFSA 2WB1F 2W43A 4M2YA 1J97A 4NWIA 2JEFA 4NLBA 4WJ3B 4GXJA 5AI4A 5ALNA 4F3OA 2WF8A 4MF8A 2AGQA 4KITB 3ZDCA 3FAHA 1U45A 1HJPA 1CEZA 1CUKA 1TAQA 3RR7A 5EWGA 1S77D 2BPGA 4JV0A 4FBUA 4PPXA 4USAA 2KJ8A 2ESEA 8ICVA 2XY6A 3VC8A 1A0PA 3UQ2A 4RQ3A 2UVVA 2KSOA 2PMZC 3TARA 3WK4A 4B9TA 9ICPA 4JB3A 4Q8EA 1FFVA 1UPHA 2EANA 5HR7A 1X9MA 2AHOB 5ALQA 2KP7A 2KOBA 1ZQTA 4ECWA 2H3IA 3QYPA 4XA5A 1Z1VA 3MGVA 9ICOA 4F5OA 4EZ6A 4ECZA 3JPTA 1IV8A 4GC7A 4C8NA 3ZI4A 4ECTA 3NVZA 1UT5A 3T5JA 2BQUA 4M6WA 3CNHA 2KICA 4U6PA 4DL6A 3H8WA 4TQSA 2R8IA 1NK0A 2PI4A 4O5KA 4ED2A 4BGDA 4IS7A 7ICOA 1TFRA 3TAPA 2P66A 1QQ5A 3OHBA 4MFAA 4DWIA 4YXMA 5KFHA 2FE9A 2C2EA 5ALFA 3QU4A 3B9JA 3H4BA 1PK1B 3RJHA 1UT8A 1X40A 5J2AA 2ZJAA 4F71A 5KT4A 1ZQZA 4F4ZA 1B43A 4ICAA 2VIXA 1NK7A 3AN1A 4ED1A 4YD1A 3SEIA 1KBUA 4CNQA 4KLEA 7ICHA 2ZXHA 9ICJA 4Q8FA 4ECYA 2JHDA 1PVQA 1ZQKA 4DOAA 3RH6A 4CGZA 2QLTA 3JPNA 3SZ2A 4KN7A 2G5HB 2G09A 4F93B 1WUDA 2W7PA 2I5HA 1WCLA 5DG9A 2BCUA 1NNLA 4NV0A 5KFMA 5KFRA 4NXZA 4C4RA 3M6ZA 4DO9A 4QZGA 4ECSA 5AM4A 1RPLA 4Q43A 3K4GA 3UMGA 2EAOA 1Q3VA 5AM5A 2B21A 4UB6U 4IC9A 4QIWC 2K8BB 5AKKA 4FBTA 5DLGA 3RF9A 5CHGA 4Y2TA 4C8OA 4Z6DA 5L1KA 4F92B 3EPGA 2ZJ5A 2LPEA 2E8NA 2G08A 5ALHA 5ALDA 2R8GA 4DQIA 3RH4A 4M9LA 1ZQVA 1IXRA 2Q4TA 2NRZA 5J2KA 1ZQQA 1NK8A 5ALGA 2PI5A 2WTFA 3M1YA 4DL3A 3OHAA 4FS2A 2K89A 3AUOA 4UB3A 4O3PA 4KLHA 3N7RC 2DFLA 1TAUA 4QZIA 4ED6A 2CXYA 1QQ6A 5GTHU 5EWEA 5EWFA 9ICAA 1SZHA 4DQPA 3H0RB 4UB1A 5HP4A 3HRDD 5JRTA 4QWAA 2ZXIA 5C5JA 5KTQA 3TKAA 2HHQA 2HVHA 3T5LA 2MA1A 3WKBA 1MC8A 1SKWA 4RQ7A 1JX4A 1TVAA 4Z6CA 2WFAA 5J0XA 5DG8A 2J6SA 1FEZA 2XGQA 2RHFA 2D6FC 1WWUA 3BQ7A 3ICXA 4OO1J 5KFPA 1COOA 1SKRA 1ZYQA 4O5EA 4J9SA 1CRXA 2VA2A 3T5HA 4C8LA 3OJSA 1U47A 4FZMA 2YMMA 2ZG6A 3AQFA 4MEXA 8ICPA 1TK0A 3THVA 7ICJA 4I27A 3TFRA 2OEHA 4UAUA 3MR3A 2E1EA 3WK7A 3TADA 2V9WA 5G5GA 3KHHA 5AKXA 5K4LA 4P0QB 2MRLA 4DSLA 5KFYA 2BPCA 5D46A 9ICQA 1JN3A 5KT3A 1KSPA 3GILA 3UXNA 5L1JA 4JUZA 2ZIWB 4EEKA 5AK5A 4ED8A 7ICKA 2IBKA 1RZTA 4IR1A 2JGAA 4UB5A 2ZTDA 1A77A 2BCVA 2KZZA 3D6JA 2ZTCA 2H3ZA 7ICTA 4C0ZA 4FZLA 1ZQEA 5GTIU 4EYHB 3PO5A 4J9MA 4OCZA 1COKA 1DOQA 3S6JA 4ECRA 1NK4A 4B9VA 2DBYA 5J0YA 5J0UA 4ECQA 1D9DA 5AI6A 1PK3A 2G5IB 4PHEA 3TAQA 3JPOA 1SWVA 1U48A 3NS1A 3HILA 5KFDA 7ICSA 2VJ5A 5AKIA 2OHFA 5IILA 1ZD2P 3UXOA 4DEZA 9ICUA 2HOQA 4QZCA 3V6HA 3SI8A 4IQVA 3SAGA 2W3RA 5AIBA 3D2SA 5AICA 1JIHA 3JPRA 4YG2A 2KJ9A 2YMQA 5BOLA 3QEAZ 5KG3A 5L9XA 4G3IA 3QUTA 2KN7A 2R18A 8ICHA 5EE0A 7ICGA 5DQGA 4J9LA 3OTQA 2H3QA 3WK5A 5B5EU 3SD7A 4Y2YA 1URJA 1B4FA 5ALWA 2OXOA 4F72A 1L8LA 4LVSA 4J03A 3NTUA 4NLKA 1IG6A 9ICGA 3PR5B 4PL2A 4BXOA 2BGWA 1DXSA 3M9OB 2V4QA 1L7MA 3WKAA 5HHIA 1ZQIA 2HCFA 5DDMA 3RJFA 4DSEA 1ZQYA 1S0MA 4RQNA 4F91B 4KLMA 1V9PA 2LMRA 1DK2A 4YP3A 4DOBA 1LVHA 2ASJA 3BDPA 2E8PA 4GXKA 5KFXA 3LVWA 5KT2A 3CRXA 2F1IA 1ZD4A 2KEYA 1ZXIA 4QZ8A 4F4KA 2JEIA 2KIVA 4F5PA 3RJJA 3RRHA 3H4DA 2OH2A 1XS9D 2EAMA 4C7YA 4IRDA 3GV5B 5AM3A 5DBBA 4BX9C 1TE2A 1L3SA 1HEKA 3FM9A 2P6UA 5C0YA 3KKAA 3V6JA 3FYHA 4DFMA 3HJEA 4DS5A 2DGZA 4P0QA 1RM6C 2XY5A 1BPEA 1BPZA 3QUCA 1MSWD 4YR0A 1ZD5A 3AU6A 3ISDA 8ICKA 4IQUA 4DSIA 4DF8A 1ED1A 1JROA 2QARB 2A1JA 1N63A 1D8LA 2KV2A 1PK1A 4TQRA 4M47A 1IM4A 2GWSA 3IG8A 1ZQJA 1ZQPA 3C21A 5ALJA 1KTQA 1ZQHA 4GIBA 2W3SA 1AROP 2C2RA 3SENA 4BWJA 4C8MA 4M9GA 7ICIA 4O3QA 4CF5A 4QZDA 2HW3A 3WU2U 4YQWA 2JH7A 8ICOA 3BS5B 3MC1A 4DFDA 2CN1A 3C1YA 4KLQA 2PFNA 5TISU 2R8HA 5J0RA 5KL8B 3ZD9A 5L1MA 3SV4A 1QLNA 2KKVA 2MU2A 5DQIA 4JWNA 3E2EA 1KFDA 1L6NA 4I2IA 3BS5A 3ISCA 1KRPA 4EEYA 3QZ8A 5KFKA 4QW8A 2VJ4A 2JH1A 3HP6A 1HIWA 3QEBZ 1N61A 1S97A 4NLNA 2N1RA 2FLLA 2Q0ZX 5H2FU 3UXPA 3O0FA 3QX7A 4QWCA 8ICBA 7ICMA 2KSOB 5CRXA 9ICLA 9ICRA 2W9MA 3PMLA 4CRXA 2K4IA 3MDCA 1F44A 3V7LA 2RDJA 2LI6A 3GDXA 4C8KA 3N97B 4F5NA 1L7OA 4RUCA 1C7YA 2XVTA 5KFUA 4BXOB 4I28A 8ICJA 1ZQXA 1KLNA 4EX7A 5J2DA 1DK3A 3JPSA 1CI4A 4PHPA 2XY7A 2HVIA 2BPFA 4CDGA 8ICWA 3UQ0A 4JV2A 1ZQWA 1EXNA 4PH5A 1GO3F 9ICVA 8ICMA 4BJQA 4QNLA 4QIWF 2PFQA 4RPZA 3PNCA 1H38A 1BPBA 4UARA 3L5KA 2BKEA 2FLNA 4XUSA 2W9CB 1ZQOA 2UVRA 2G07A 5J2FA 3B0XA 3E0FA 5ALMA 4EX6A 1O03A 2FI1A 3Q8RB 2WF5A 1V97A 2LKYA 4GC6A 5D49A 2M0NA 5AM1A 2Y0SF 3QU5A 1OXJA 4KLTA 3FDSA 4QZFA 5J8YA 5AKHA 2W9CA 4I2BA 3KD3A 1LV5A 3CP8A 4O5CA 2AU0A 2NRWA 3C2MA 5CJ7A 2J6UA 2NV3A 1X66A 3F5EA 4YMNA 2A1JB 4Y2JA 7ICFA 4RNMA 3C2LA 4B6JA 4J9OA 2HOIA 4DSKA 1M6YA 1KKXA 2W04A 3G6VA 5KFJA 2MUTA 3NGDA 2OYYA 3QXGA 4QZEA 4RQ5A 1B0XA 1SIJA 4EBCA 1V38A 1RXVA 5EE9A 8ICIA 4DQRA 7ICRA 4P4OA 1Q46A 4RQMA 1UA1A 4AP9A 2ALZA 3NVWA 2F76X 2ODGA 1Z00B 2CPRA 4UATA 3H40A 2MUTB 5DG7A 1PZNA 3PX6A 1MQ3A 3N28A 2AXTU 4EELA 1FIQA 3BQTA 5DB7A 3Q8KA 4RUAA 4P4MA 3PZPA 1RG6A 4NLCA 8ICGA 3HT3A 1SXEA 1N2XA 3NRWA 4Y2PA 5ALPA 4US9A 4UAWA 5KFTA 2JRZA 3ORYA 1T8EA 2BR0A 1JXLA 3MFIA 3MGIA 2A3VA 3ETLA 2W11A 3WK9A 1T94A 3MFHA 2D3DA 1JMSA 2R8JA 3OSPA 3EPIA 4QW9A 5J0TA 2IOFA 2K60A 4NM2A 3ZDAA 2PMZF 1S8OA 1OW5A 1ZRNA 3C5FA 1LB2B 4IR9A 2KVCA 5KT6A 2DKXA 4UASA 2XCAA 4Q45A 5AI8A 3SR6A 3ZDEA 4C4SA 2ZUDA 2YMPA 3GIKA 3OSNA 1X6JA 1L3TA 4ECXA 1UQVA 4F4YA 1NJWA 4YR2A 3L4PA 1SKSA 2QARA 3T3FA 1LKYA 5KFQA 2KE7A 3QZ7A 1O08A 1TV9A 3TI0A 1SL2A 5AIAA 1S5LU 2LM4A 3IG5A 5EE3A 4ED3A 8ICUA 2GH1A 2F8KA 3RH5A 1XC9A 3NVYA 4ZOHC 2VKQA 5IIIA 2F77X 2ZIWA 1Y88A 2ZIUB 4DCCA 5ALRA 2JEGA 4TURA 5ALOA 4OJOA 1D8YA 4YFKA 4F5QA 4MF2A 4YMOA 4UAZA 3C28A 4O3NA 4RQ0A 3V7JA 4XRHA 2Y1IA 8ICTA 4JMUA 4PZNA 1QQ7A 2HI0A 5KAIU 2KZ3A 1Q3UA 2PKEA 2ISPA 2QB1A 2BQ3A 4DFJA 3RB3A 2RRDA 3BQ0A 4F2RA 1T3NA 2FMSA 5ALTA 2FPKA 2LHTA 2H3VA 2YB1A 3ED5A 3EWAA 3PSPA 4UB2A 2XGPA 4B9LA 2AH5A 4UB8U 2Y1JA 1U9LA 5KFBA 2ZIXA 2C28A 1Z19A 7ICEA 4HAIA 1X9XA 4E0DA 3K75D 4I2JA 5KG5A 4NM1A 2KJ5A 5HNKA 4P0PB 3RR8A 1TKDA 2FDRA 4EENA 1S0VA 3AM9A 4EBEA 5AKLA 5J2EA 9ICMA 3TACB 3GQCA 3PW0A 1V85A 3KHGA 4O3RA 9ICBA 3I28A 4RQ8A 2ZIXB 2B0CA 1T4GA 1KDHA 5HHHA 3F2BA 4Y2UA 4I2GA 4MFFA 4FS1A 2L5YA 2ISOA 4DSFA 4KLIA 2LBOA 3CYMA 3KHLA 3MABA 2W8KA 3BS7A 4U7CA 2XCPA 2LM1A 3H7IA 4FE3A 4HYKA 2KTQA 1BVSA 2KNJA 3RJEA 3HKZC 2VA3A 4DL7A 1TK5A 1ZQFA 9ICWA 1F0MA 4KLGA 3F2CA 1BGXT 2W7OA 5BOMA 5AK4A 3AEVA 5B66U 2LYBA 5JU5A 3F2DA 4P2HA 4YMMA 4JK1A 5DBCA 4UBCA 1HUOA 2GOLA 8ICXA 2FPMA 2AJQA 1PUZA 5F3XB 1BNPA 4RNNA 3H0MB 4Z6EA 3RRGA 4K4GA 4RQ1A 1B22A 2JEJA 2JZBB 4ACOA 3RB4A 2F1JA 1DRGA 5KG7A 1JALA 5J2GA 4TUPA 1QSLA 3D2QA 9ICNA 3F53A 4LZDA 4RNOA 4FFDA 1ZQDA 4DS4A 1K1SA 2ZUCA 1SV4A 4C7ZA 2V4RA 3N7PD 3IDWA 2IHNA 3B0YA 2KD1A 8ICQA 2AQ4A 4F4XA 3GIIA 3K1ZA 3M9NB 4O0IA 4PZOA 3MDAA 5J0QA 2Y9TA 5J0WA 4I2AA 4OJLA 1RQNA 1N48A 3UMCA 3GIMA 1RQLA 3RFAA 3HPOA 9ICSA 5DBAA 3PX0A 4QZBA 2E8MA 4RZRA 5ALZA 3WKEA 4YR3A 1KEJA 2NYVA 4R64A 4MEYA 5KT7A 1KFTA 1L5UA 2F1HA 3IV6A 1L3VA 4EBDA 4Z6FA 5KFAA 3M8SA 2XI9A 5J0SA 2QB0B 3GZFA 5KFEA 4QWBA 4NL9C 8ICCA 4A8EA 4NLZA 2BDUA 3QU2A 5CEHA 4PL1A 1ZQMA 9ICIA 4CF3A 3PVXA 1JUDA 3ALRA 3KKAC 4ED7A 4R65A 3TADC 2PXIA 4F4WA 3BZCA 3KFUF 1KFSA 9ICKA 1SL0A 5DGAA 5IIOA 5IINA 5DDYA 1SB3C 1NI3A 1ZQCA 4KX5A 4QZHA 8ICFA 3IN5A 3BJYA 3BQ1A 3H8JA 4I2CA 2KKPA 2ZIVA 4EYIB 1WYGA 3MR6A 1NKCA 1KN5A 3A0BU 1RXWA 3OGUA 1OUQA 4IQWA 7ICVA 1F5SA 3HW8A 1NKEA 5J2CA 3LYSA 1QTMA 1QSYA 1RDFA 5AK3A 3KOOA 4OD0A 2ATLA 4EZ9A 2P6RA 2DPJA 3RBEA 2BCQA 2XO7A 2E8OA 1J2MA 4F2SA 3C5GA 1U49A 3SAFA 5J0PA 1NK9A 2Z7JA 2KK0A 5F9LA 3QUQA 5KFWA 5ALYA 4RPYA 2JV3A 4PGXA 3PR4A 2RDIA 3SQIA 2JZBA 3M6KA 4KMOB 3C23A 4DOCA 4DL4A 4GFJA 2ZJ8A 5KT5A 2K8AA 5KFSA 2YTUA 2IHMA 5G5HA 3ZD8A 5E79U 2KFZA 1NJYA 4I2HA 3QE9Y 2NRVA 2HMXA 5AM2A 2E3TA 1N56A 2E1FA 1BPXA 3HKZF 2DQNB 2WB1C 5DQHA 2E5SA 3U26A 4DF4A 4RPXA 2O6KA 2B6GA 2JR5A 1S9FA 5EOZA 8ICYA 1L8OA 3RB6A 3C2KA 2VANA 2HBJA 4PHAA 2W55A 1Z3EB 5KG2A 2DL0A 2FLPA 2W9BB 2IA6A 1SGGA 5EE1A 3LWLA 2YQEA 3T79A 1SZPA 3AU2A 2QKQA 1NOMA 5AHXA 3PW7A 3H8SA 3GU3A 4OJPA 4BWMA 1HUZA 4CE6A 1X42A 1KW4A 3KTQA 4DLGA 2RP5A 2HHSA 2F44A 1ZQGA 3UM9A 1AQ6A 2P35A 5ALKA 5J2IA 3ETRA 1FO4A 4ELTA 1Q8KA 1IIPA 1ZQUA 2BQRA 2NRTA 4PGYA 4US8A 2KFNA 2W9AA 3IM1A 2OCEA 5A0LA 3UPQA 4KLOA 2NRXA 3SAHA 2KIWA 4Y2SA 4YD2A 2W54A 3HX0A 2NO5A 5AKGA 2RLTA 4I2EA 3ZDBA 2KMDA 4JWMA 4R8UB 1L7PA 3OPXA 1T3QA 1S10A 2LYAA 5KAFU 4Y2VA 2G06A 2I9GA 5BPCA 3DV9A 3MBYA 2ZUBA 3VCBA 2G0AA 4P4PA 5IIMA 2F8LA 5KNIA 3OJUA 1TAMA 5JUMA 4DQSA 3RAQA 1NZBA 3QNMA 3AL0B 4R8UA 4IRKA 1ZQ1C 4GLXA 4RU9A 2H3FA 5AI9A 4Y2RA 2HDOA 1U4BA 2R8KA 3H8MA 3IP4B 1SV0C 1LKYB 4DQQA 3EUB2 4X5VA 2AGOA 1L3UA 2A19A 5CA7A 3NRZA 9ICFA 1QCKA 3C29A 5KFCA 2JXJA 2OWOA 3RBDA 3I76A 3IHQB 4UAYA
chains in the Genus database with same CATH topology
4UB8U 3A0BU 5B5EU 5TISU 5GTIU 5KAFU 2DUYA 5E79U 5GTHU 2AXTU 4IL6U 3WU2U 4UB6U 3A0HU 5KAIU 4PJ0U 5B66U 1S5LU 3KZIU 5H2FU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  3A0B U;  5B5E U;  5TIS U;  5GTI U;  5KAF U;  2DUY A;  5E79 U;  5GTH U;  2AXT U;  4IL6 U;  3WU2 U;  4UB6 U;  3A0H U;  5KAI U;  4PJ0 U;  5B66 U;  1S5L U;  3KZI U;  5H2F U; 
#chains in the Genus database with same CATH topology
 5KFI A;  3QUB A;  2HBK A;  2F2A B;  1ZJN A;  5KFN A;  3AMZ A;  1A76 A;  1SXD A;  5L1L A;  1QSS A;  4KLU A;  2F3N A;  4J9K A;  2DPI A;  2BCR A;  4FO6 A;  2HBL A;  4MHV A;  5T14 A;  5JTI A;  1SL1 A;  1BPD A;  5L1I A;  2H5X A;  4NY8 A;  1XSL A;  5AI0 A;  2MAX A;  3K1R B;  1N5X A;  5KFF A;  3N7S C;  1N60 A;  4M6W B;  2W9B A;  4KX3 A;  2QB0 A;  3MR2 A;  3RTV A;  1NZP A;  5J8Y C;  5DGB A;  5ALI A;  8ICA A;  2AQ0 A;  1ZQA A;  4ELU A;  2HHT A;  2GLE A;  1TK8 A;  2HHX A;  3DEE A;  3PSF A;  5FP0 A;  4KMU A;  5IIJ A;  4AYB F;  3QU9 A;  2EZX A;  3H0L B;  1FFU A;  1PVR A;  4UQG A;  4QZA A;  2YN4 A;  4PJ0 U;  3EYZ A;  2EAP A;  1UA0 A;  4UBB A;  4F50 A;  1D9F A;  5TZV A;  4LZG A;  3RJK A;  1Z1B A;  3NUQ A;  3BZK A;  4KLF A;  4OJ6 A;  3E58 A;  5J29 A;  1VDV A;  4DL5 A;  2ZIU A;  1X6I A;  3PW5 A;  2WF6 A;  1Z4N A;  4YVZ A;  2HBM A;  1K1Q A;  4R63 A;  4QJF B;  2BHN A;  8ICR A;  2YB4 A;  5F9N A;  1QH9 A;  8ICZ A;  1ZQS A;  2IOF K;  4I29 A;  3RJI A;  3DDH A;  1ZD3 A;  9ICH A;  2JMG A;  1NK6 A;  5HMM A;  1SWW A;  4M0A A;  1YZ7 A;  3R9K A;  1NJZ A;  2RQ5 A;  5KFL A;  2K4H A;  4CCH A;  3NVV A;  2J6T A;  2KG5 A;  4KLS A;  5KL1 B;  2WF9 A;  3M8R A;  3G6X A;  4NJ8 A;  2BZF A;  5J2B A;  4P0P A;  2DF4 B;  3KZX A;  3WKD A;  2W8L A;  4KLJ A;  4DSJ A;  2DKZ A;  1RYS A;  4OJ5 A;  1WG8 A;  4NLG A;  2PFO A;  3IRU A;  2EZZ A;  5ALX A;  2C2D A;  2BDP A;  4M9H A;  5ALV A;  2ASL A;  1X2I A;  2XC9 A;  1VJ5 A;  9ICX A;  2OM6 A;  4F8R A;  3I1Y A;  4B9N A;  1D8B A;  2FJ6 A;  5KFV A;  1JXE A;  3PSI A;  2AGP A;  3GV8 B;  1XNS A;  1X9S A;  3CW2 C;  4O9M A;  5J0O A;  3PW4 A;  4RQ6 A;  5KG0 A;  4K4I A;  2KZM A;  7ICL A;  1YT3 A;  1SV0 A;  3LVV A;  4BUG A;  2VA8 A;  2C22 A;  4Q44 A;  2FMQ A;  2KHQ A;  3PW2 A;  1L7N A;  5DKW A;  9ICC A;  3Q8P B;  2BCS A;  2Y0S C;  1S76 D;  4ECU A;  1Z4O A;  5DB9 A;  4PHD A;  5J2J A;  2WAQ F;  4G9B A;  1WWV A;  3JPQ A;  2I1Q A;  3TAN A;  3T5K A;  5HR6 A;  4QWE A;  3KZI U;  2YML A;  2FPL A;  3PO4 A;  4ELV A;  4M9J A;  4GXI A;  4DL2 A;  5KG1 A;  2HSZ A;  5DB8 A;  3GIJ A;  5KFO A;  5AKJ A;  5CWR A;  4O3M A;  3PST A;  4UB4 A;  4J9Q A;  3RJG A;  2A1A A;  7ICP A;  1J2N A;  4XQ8 A;  5DB6 A;  3V7K A;  3V72 A;  3PV8 A;  4J9P A;  4O3O A;  1X9W A;  4ZH4 A;  1N5W A;  4J9N A;  5AKZ A;  2HHW A;  2ASD A;  9ICE A;  4DFP A;  3ONN A;  4FZN A;  3SYZ A;  1A6S A;  1MA7 A;  1P7D A;  2Y9U A;  2K4P A;  2ES6 A;  4KN4 A;  3JPP A;  4C80 A;  1ECW A;  2PFP A;  4JV1 A;  2EZY A;  3EW9 A;  4IRC A;  5AM0 A;  2NO4 A;  4LJX A;  2K4E A;  1NK5 A;  2KVS A;  3A0H U;  5ALL A;  1DGS A;  3PX4 A;  4KLD A;  2ZIV B;  2ZTE A;  5CB1 A;  1Z00 A;  3G6Y A;  5J2H A;  2FMP A;  1KL9 A;  2XIC A;  3PMN A;  4QZ9 A;  4B9S A;  3F5A A;  2M9N A;  1JRP A;  1RYU A;  4MFC A;  1K5O A;  4B9U A;  2WAQ C;  4PGQ A;  3C1Z A;  1VLB A;  2UVW A;  4UAV A;  3ZDD A;  3WKC A;  4I2F A;  4M9N A;  1XWL A;  2DUY A;  4IL6 U;  5HML A;  4AYB C;  1XO1 A;  4TUS A;  3GFK B;  1ZET A;  3Q8M A;  5AKY A;  3UMB A;  1ZQB A;  1S0O A;  1ZQR A;  2EH9 A;  3PY8 A;  4DFK A;  1MQ2 A;  5IIK A;  4K4H A;  4UW9 A;  1PVP A;  3M7D A;  1XSN A;  8ICN A;  3Q8L A;  4DLE A;  4O3S A;  8ICS A;  8ICL A;  4ED0 A;  1ZRM A;  4M04 A;  3TQ1 A;  2GO7 A;  5ALE A;  3ISB A;  5DLF A;  1XSP A;  4YCX A;  1N62 A;  3EZ5 A;  4I2D A;  4YXJ A;  5D4B A;  4TUQ A;  1MN8 A;  4RQ2 A;  3Q8S B;  1JI7 A;  4RT3 A;  4QWD A;  3HWT A;  3BQ2 A;  4KLL A;  3WK8 A;  2HHV A;  5AI5 A;  4B9M A;  1C20 A;  4IQT A;  3N4M B;  3M9M B;  7ICQ A;  3GV7 B;  7ICN A;  3SMV A;  5AKE A;  3Q8Q B;  5KG4 A;  2IMW P;  1WCN A;  3KHR A;  2YX8 A;  2WF7 A;  5KG6 A;  1RYR A;  1NKB A;  4RT2 A;  1S0N A;  3V6K A;  1UHU A;  1T7P A;  1ZQN A;  2EDU A;  3NAS A;  4NL9 A;  2K8C B;  5CR0 A;  3RAX A;  4Y2Q A;  2EQY A;  4YN4 A;  3WK6 A;  3RB0 A;  3MGH A;  4J9R A;  2CRX A;  1XO0 A;  3MR5 A;  3QU7 A;  1KQQ A;  1UCV A;  4ECV A;  2UVU A;  2WHE A;  3LDA A;  3LK9 A;  7ICU A;  3L3F X;  4RQ4 A;  4C4T A;  1DGJ A;  2IOH A;  2KHV A;  2HHU A;  1YZ6 A;  2D8C A;  1BPY A;  1ZOL A;  1ZQL A;  3SV3 A;  3J81 j;  4KTQ A;  2W03 A;  5KFZ A;  1XU4 A;  9ICT A;  2I6X A;  3LWM A;  3KBB A;  8ICE A;  2LYH A;  4Y2X A;  4R66 A;  4F5R A;  4CF4 A;  1ZJM A;  3FC4 A;  4BDP A;  2MSN A;  5CP2 A;  2XID A;  3AQE A;  5ALS A;  5KFG A;  5ALU A;  2HOF A;  3D2N A;  2YY6 A;  1BNO A;  1NJX A;  2DWQ A;  5AK6 A;  3TFS A;  2WB1 F;  2W43 A;  4M2Y A;  1J97 A;  4NWI A;  2JEF A;  4NLB A;  4WJ3 B;  4GXJ A;  5AI4 A;  5ALN A;  4F3O A;  2WF8 A;  4MF8 A;  2AGQ A;  4KIT B;  3ZDC A;  3FAH A;  1U45 A;  1HJP A;  1CEZ A;  1CUK A;  1TAQ A;  3RR7 A;  5EWG A;  1S77 D;  2BPG A;  4JV0 A;  4FBU A;  4PPX A;  4USA A;  2KJ8 A;  2ESE A;  8ICV A;  2XY6 A;  3VC8 A;  1A0P A;  3UQ2 A;  4RQ3 A;  2UVV A;  2KSO A;  2PMZ C;  3TAR A;  3WK4 A;  4B9T A;  9ICP A;  4JB3 A;  4Q8E A;  1FFV A;  1UPH A;  2EAN A;  5HR7 A;  1X9M A;  2AHO B;  5ALQ A;  2KP7 A;  2KOB A;  1ZQT A;  4ECW A;  2H3I A;  3QYP A;  4XA5 A;  1Z1V A;  3MGV A;  9ICO A;  4F5O A;  4EZ6 A;  4ECZ A;  3JPT A;  1IV8 A;  4GC7 A;  4C8N A;  3ZI4 A;  4ECT A;  3NVZ A;  1UT5 A;  3T5J A;  2BQU A;  4M6W A;  3CNH A;  2KIC A;  4U6P A;  4DL6 A;  3H8W A;  4TQS A;  2R8I A;  1NK0 A;  2PI4 A;  4O5K A;  4ED2 A;  4BGD A;  4IS7 A;  7ICO A;  1TFR A;  3TAP A;  2P66 A;  1QQ5 A;  3OHB A;  4MFA A;  4DWI A;  4YXM A;  5KFH A;  2FE9 A;  2C2E A;  5ALF A;  3QU4 A;  3B9J A;  3H4B A;  1PK1 B;  3RJH A;  1UT8 A;  1X40 A;  5J2A A;  2ZJA A;  4F71 A;  5KT4 A;  1ZQZ A;  4F4Z A;  1B43 A;  4ICA A;  2VIX A;  1NK7 A;  3AN1 A;  4ED1 A;  4YD1 A;  3SEI A;  1KBU A;  4CNQ A;  4KLE A;  7ICH A;  2ZXH A;  9ICJ A;  4Q8F A;  4ECY A;  2JHD A;  1PVQ A;  1ZQK A;  4DOA A;  3RH6 A;  4CGZ A;  2QLT A;  3JPN A;  3SZ2 A;  4KN7 A;  2G5H B;  2G09 A;  4F93 B;  1WUD A;  2W7P A;  2I5H A;  1WCL A;  5DG9 A;  2BCU A;  1NNL A;  4NV0 A;  5KFM A;  5KFR A;  4NXZ A;  4C4R A;  3M6Z A;  4DO9 A;  4QZG A;  4ECS A;  5AM4 A;  1RPL A;  4Q43 A;  3K4G A;  3UMG A;  2EAO A;  1Q3V A;  5AM5 A;  2B21 A;  4UB6 U;  4IC9 A;  4QIW C;  2K8B B;  5AKK A;  4FBT A;  5DLG A;  3RF9 A;  5CHG A;  4Y2T A;  4C8O A;  4Z6D A;  5L1K A;  4F92 B;  3EPG A;  2ZJ5 A;  2LPE A;  2E8N A;  2G08 A;  5ALH A;  5ALD A;  2R8G A;  4DQI A;  3RH4 A;  4M9L A;  1ZQV A;  1IXR A;  2Q4T A;  2NRZ A;  5J2K A;  1ZQQ A;  1NK8 A;  5ALG A;  2PI5 A;  2WTF A;  3M1Y A;  4DL3 A;  3OHA A;  4FS2 A;  2K89 A;  3AUO A;  4UB3 A;  4O3P A;  4KLH A;  3N7R C;  2DFL A;  1TAU A;  4QZI A;  4ED6 A;  2CXY A;  1QQ6 A;  5GTH U;  5EWE A;  5EWF A;  9ICA A;  1SZH A;  4DQP A;  3H0R B;  4UB1 A;  5HP4 A;  3HRD D;  5JRT A;  4QWA A;  2ZXI A;  5C5J A;  5KTQ A;  3TKA A;  2HHQ A;  2HVH A;  3T5L A;  2MA1 A;  3WKB A;  1MC8 A;  1SKW A;  4RQ7 A;  1JX4 A;  1TVA A;  4Z6C A;  2WFA A;  5J0X A;  5DG8 A;  2J6S A;  1FEZ A;  2XGQ A;  2RHF A;  2D6F C;  1WWU A;  3BQ7 A;  3ICX A;  4OO1 J;  5KFP A;  1COO A;  1SKR A;  1ZYQ A;  4O5E A;  4J9S A;  1CRX A;  2VA2 A;  3T5H A;  4C8L A;  3OJS A;  1U47 A;  4FZM A;  2YMM A;  2ZG6 A;  3AQF A;  4MEX A;  8ICP A;  1TK0 A;  3THV A;  7ICJ A;  4I27 A;  3TFR A;  2OEH A;  4UAU A;  3MR3 A;  2E1E A;  3WK7 A;  3TAD A;  2V9W A;  5G5G A;  3KHH A;  5AKX A;  5K4L A;  4P0Q B;  2MRL A;  4DSL A;  5KFY A;  2BPC A;  5D46 A;  9ICQ A;  1JN3 A;  5KT3 A;  1KSP A;  3GIL A;  3UXN A;  5L1J A;  4JUZ A;  2ZIW B;  4EEK A;  5AK5 A;  4ED8 A;  7ICK A;  2IBK A;  1RZT A;  4IR1 A;  2JGA A;  4UB5 A;  2ZTD A;  1A77 A;  2BCV A;  2KZZ A;  3D6J A;  2ZTC A;  2H3Z A;  7ICT A;  4C0Z A;  4FZL A;  1ZQE A;  5GTI U;  4EYH B;  3PO5 A;  4J9M A;  4OCZ A;  1COK A;  1DOQ A;  3S6J A;  4ECR A;  1NK4 A;  4B9V A;  2DBY A;  5J0Y A;  5J0U A;  4ECQ A;  1D9D A;  5AI6 A;  1PK3 A;  2G5I B;  4PHE A;  3TAQ A;  3JPO A;  1SWV A;  1U48 A;  3NS1 A;  3HIL A;  5KFD A;  7ICS A;  2VJ5 A;  5AKI A;  2OHF A;  5IIL A;  1ZD2 P;  3UXO A;  4DEZ A;  9ICU A;  2HOQ A;  4QZC A;  3V6H A;  3SI8 A;  4IQV A;  3SAG A;  2W3R A;  5AIB A;  3D2S A;  5AIC A;  1JIH A;  3JPR A;  4YG2 A;  2KJ9 A;  2YMQ A;  5BOL A;  3QEA Z;  5KG3 A;  5L9X A;  4G3I A;  3QUT A;  2KN7 A;  2R18 A;  8ICH A;  5EE0 A;  7ICG A;  5DQG A;  4J9L A;  3OTQ A;  2H3Q A;  3WK5 A;  5B5E U;  3SD7 A;  4Y2Y A;  1URJ A;  1B4F A;  5ALW A;  2OXO A;  4F72 A;  1L8L A;  4LVS A;  4J03 A;  3NTU A;  4NLK A;  1IG6 A;  9ICG A;  3PR5 B;  4PL2 A;  4BXO A;  2BGW A;  1DXS A;  3M9O B;  2V4Q A;  1L7M A;  3WKA A;  5HHI A;  1ZQI A;  2HCF A;  5DDM A;  3RJF A;  4DSE A;  1ZQY A;  1S0M A;  4RQN A;  4F91 B;  4KLM A;  1V9P A;  2LMR A;  1DK2 A;  4YP3 A;  4DOB A;  1LVH A;  2ASJ A;  3BDP A;  2E8P A;  4GXK A;  5KFX A;  3LVW A;  5KT2 A;  3CRX A;  2F1I A;  1ZD4 A;  2KEY A;  1ZXI A;  4QZ8 A;  4F4K A;  2JEI A;  2KIV A;  4F5P A;  3RJJ A;  3RRH A;  3H4D A;  2OH2 A;  1XS9 D;  2EAM A;  4C7Y A;  4IRD A;  3GV5 B;  5AM3 A;  5DBB A;  4BX9 C;  1TE2 A;  1L3S A;  1HEK A;  3FM9 A;  2P6U A;  5C0Y A;  3KKA A;  3V6J A;  3FYH A;  4DFM A;  3HJE A;  4DS5 A;  2DGZ A;  4P0Q A;  1RM6 C;  2XY5 A;  1BPE A;  1BPZ A;  3QUC A;  1MSW D;  4YR0 A;  1ZD5 A;  3AU6 A;  3ISD A;  8ICK A;  4IQU A;  4DSI A;  4DF8 A;  1ED1 A;  1JRO A;  2QAR B;  2A1J A;  1N63 A;  1D8L A;  2KV2 A;  1PK1 A;  4TQR A;  4M47 A;  1IM4 A;  2GWS A;  3IG8 A;  1ZQJ A;  1ZQP A;  3C21 A;  5ALJ A;  1KTQ A;  1ZQH A;  4GIB A;  2W3S A;  1ARO P;  2C2R A;  3SEN A;  4BWJ A;  4C8M A;  4M9G A;  7ICI A;  4O3Q A;  4CF5 A;  4QZD A;  2HW3 A;  3WU2 U;  4YQW A;  2JH7 A;  8ICO A;  3BS5 B;  3MC1 A;  4DFD A;  2CN1 A;  3C1Y A;  4KLQ A;  2PFN A;  5TIS U;  2R8H A;  5J0R A;  5KL8 B;  3ZD9 A;  5L1M A;  3SV4 A;  1QLN A;  2KKV A;  2MU2 A;  5DQI A;  4JWN A;  3E2E A;  1KFD A;  1L6N A;  4I2I A;  3BS5 A;  3ISC A;  1KRP A;  4EEY A;  3QZ8 A;  5KFK A;  4QW8 A;  2VJ4 A;  2JH1 A;  3HP6 A;  1HIW A;  3QEB Z;  1N61 A;  1S97 A;  4NLN A;  2N1R A;  2FLL A;  2Q0Z X;  5H2F U;  3UXP A;  3O0F A;  3QX7 A;  4QWC A;  8ICB A;  7ICM A;  2KSO B;  5CRX A;  9ICL A;  9ICR A;  2W9M A;  3PML A;  4CRX A;  2K4I A;  3MDC A;  1F44 A;  3V7L A;  2RDJ A;  2LI6 A;  3GDX A;  4C8K A;  3N97 B;  4F5N A;  1L7O A;  4RUC A;  1C7Y A;  2XVT A;  5KFU A;  4BXO B;  4I28 A;  8ICJ A;  1ZQX A;  1KLN A;  4EX7 A;  5J2D A;  1DK3 A;  3JPS A;  1CI4 A;  4PHP A;  2XY7 A;  2HVI A;  2BPF A;  4CDG A;  8ICW A;  3UQ0 A;  4JV2 A;  1ZQW A;  1EXN A;  4PH5 A;  1GO3 F;  9ICV A;  8ICM A;  4BJQ A;  4QNL A;  4QIW F;  2PFQ A;  4RPZ A;  3PNC A;  1H38 A;  1BPB A;  4UAR A;  3L5K A;  2BKE A;  2FLN A;  4XUS A;  2W9C B;  1ZQO A;  2UVR A;  2G07 A;  5J2F A;  3B0X A;  3E0F A;  5ALM A;  4EX6 A;  1O03 A;  2FI1 A;  3Q8R B;  2WF5 A;  1V97 A;  2LKY A;  4GC6 A;  5D49 A;  2M0N A;  5AM1 A;  2Y0S F;  3QU5 A;  1OXJ A;  4KLT A;  3FDS A;  4QZF A;  5J8Y A;  5AKH A;  2W9C A;  4I2B A;  3KD3 A;  1LV5 A;  3CP8 A;  4O5C A;  2AU0 A;  2NRW A;  3C2M A;  5CJ7 A;  2J6U A;  2NV3 A;  1X66 A;  3F5E A;  4YMN A;  2A1J B;  4Y2J A;  7ICF A;  4RNM A;  3C2L A;  4B6J A;  4J9O A;  2HOI A;  4DSK A;  1M6Y A;  1KKX A;  2W04 A;  3G6V A;  5KFJ A;  2MUT A;  3NGD A;  2OYY A;  3QXG A;  4QZE A;  4RQ5 A;  1B0X A;  1SIJ A;  4EBC A;  1V38 A;  1RXV A;  5EE9 A;  8ICI A;  4DQR A;  7ICR A;  4P4O A;  1Q46 A;  4RQM A;  1UA1 A;  4AP9 A;  2ALZ A;  3NVW A;  2F76 X;  2ODG A;  1Z00 B;  2CPR A;  4UAT A;  3H40 A;  2MUT B;  5DG7 A;  1PZN A;  3PX6 A;  1MQ3 A;  3N28 A;  2AXT U;  4EEL A;  1FIQ A;  3BQT A;  5DB7 A;  3Q8K A;  4RUA A;  4P4M A;  3PZP A;  1RG6 A;  4NLC A;  8ICG A;  3HT3 A;  1SXE A;  1N2X A;  3NRW A;  4Y2P A;  5ALP A;  4US9 A;  4UAW A;  5KFT A;  2JRZ A;  3ORY A;  1T8E A;  2BR0 A;  1JXL A;  3MFI A;  3MGI A;  2A3V A;  3ETL A;  2W11 A;  3WK9 A;  1T94 A;  3MFH A;  2D3D A;  1JMS A;  2R8J A;  3OSP A;  3EPI A;  4QW9 A;  5J0T A;  2IOF A;  2K60 A;  4NM2 A;  3ZDA A;  2PMZ F;  1S8O A;  1OW5 A;  1ZRN A;  3C5F A;  1LB2 B;  4IR9 A;  2KVC A;  5KT6 A;  2DKX A;  4UAS A;  2XCA A;  4Q45 A;  5AI8 A;  3SR6 A;  3ZDE A;  4C4S A;  2ZUD A;  2YMP A;  3GIK A;  3OSN A;  1X6J A;  1L3T A;  4ECX A;  1UQV A;  4F4Y A;  1NJW A;  4YR2 A;  3L4P A;  1SKS A;  2QAR A;  3T3F A;  1LKY A;  5KFQ A;  2KE7 A;  3QZ7 A;  1O08 A;  1TV9 A;  3TI0 A;  1SL2 A;  5AIA A;  1S5L U;  2LM4 A;  3IG5 A;  5EE3 A;  4ED3 A;  8ICU A;  2GH1 A;  2F8K A;  3RH5 A;  1XC9 A;  3NVY A;  4ZOH C;  2VKQ A;  5III A;  2F77 X;  2ZIW A;  1Y88 A;  2ZIU B;  4DCC A;  5ALR A;  2JEG A;  4TUR A;  5ALO A;  4OJO A;  1D8Y A;  4YFK A;  4F5Q A;  4MF2 A;  4YMO A;  4UAZ A;  3C28 A;  4O3N A;  4RQ0 A;  3V7J A;  4XRH A;  2Y1I A;  8ICT A;  4JMU A;  4PZN A;  1QQ7 A;  2HI0 A;  5KAI U;  2KZ3 A;  1Q3U A;  2PKE A;  2ISP A;  2QB1 A;  2BQ3 A;  4DFJ A;  3RB3 A;  2RRD A;  3BQ0 A;  4F2R A;  1T3N A;  2FMS A;  5ALT A;  2FPK A;  2LHT A;  2H3V A;  2YB1 A;  3ED5 A;  3EWA A;  3PSP A;  4UB2 A;  2XGP A;  4B9L A;  2AH5 A;  4UB8 U;  2Y1J A;  1U9L A;  5KFB A;  2ZIX A;  2C28 A;  1Z19 A;  7ICE A;  4HAI A;  1X9X A;  4E0D A;  3K75 D;  4I2J A;  5KG5 A;  4NM1 A;  2KJ5 A;  5HNK A;  4P0P B;  3RR8 A;  1TKD A;  2FDR A;  4EEN A;  1S0V A;  3AM9 A;  4EBE A;  5AKL A;  5J2E A;  9ICM A;  3TAC B;  3GQC A;  3PW0 A;  1V85 A;  3KHG A;  4O3R A;  9ICB A;  3I28 A;  4RQ8 A;  2ZIX B;  2B0C A;  1T4G A;  1KDH A;  5HHH A;  3F2B A;  4Y2U A;  4I2G A;  4MFF A;  4FS1 A;  2L5Y A;  2ISO A;  4DSF A;  4KLI A;  2LBO A;  3CYM A;  3KHL A;  3MAB A;  2W8K A;  3BS7 A;  4U7C A;  2XCP A;  2LM1 A;  3H7I A;  4FE3 A;  4HYK A;  2KTQ A;  1BVS A;  2KNJ A;  3RJE A;  3HKZ C;  2VA3 A;  4DL7 A;  1TK5 A;  1ZQF A;  9ICW A;  1F0M A;  4KLG A;  3F2C A;  1BGX T;  2W7O A;  5BOM A;  5AK4 A;  3AEV A;  5B66 U;  2LYB A;  5JU5 A;  3F2D A;  4P2H A;  4YMM A;  4JK1 A;  5DBC A;  4UBC A;  1HUO A;  2GOL A;  8ICX A;  2FPM A;  2AJQ A;  1PUZ A;  5F3X B;  1BNP A;  4RNN A;  3H0M B;  4Z6E A;  3RRG A;  4K4G A;  4RQ1 A;  1B22 A;  2JEJ A;  2JZB B;  4ACO A;  3RB4 A;  2F1J A;  1DRG A;  5KG7 A;  1JAL A;  5J2G A;  4TUP A;  1QSL A;  3D2Q A;  9ICN A;  3F53 A;  4LZD A;  4RNO A;  4FFD A;  1ZQD A;  4DS4 A;  1K1S A;  2ZUC A;  1SV4 A;  4C7Z A;  2V4R A;  3N7P D;  3IDW A;  2IHN A;  3B0Y A;  2KD1 A;  8ICQ A;  2AQ4 A;  4F4X A;  3GII A;  3K1Z A;  3M9N B;  4O0I A;  4PZO A;  3MDA A;  5J0Q A;  2Y9T A;  5J0W A;  4I2A A;  4OJL A;  1RQN A;  1N48 A;  3UMC A;  3GIM A;  1RQL A;  3RFA A;  3HPO A;  9ICS A;  5DBA A;  3PX0 A;  4QZB A;  2E8M A;  4RZR A;  5ALZ A;  3WKE A;  4YR3 A;  1KEJ A;  2NYV A;  4R64 A;  4MEY A;  5KT7 A;  1KFT A;  1L5U A;  2F1H A;  3IV6 A;  1L3V A;  4EBD A;  4Z6F A;  5KFA A;  3M8S A;  2XI9 A;  5J0S A;  2QB0 B;  3GZF A;  5KFE A;  4QWB A;  4NL9 C;  8ICC A;  4A8E A;  4NLZ A;  2BDU A;  3QU2 A;  5CEH A;  4PL1 A;  1ZQM A;  9ICI A;  4CF3 A;  3PVX A;  1JUD A;  3ALR A;  3KKA C;  4ED7 A;  4R65 A;  3TAD C;  2PXI A;  4F4W A;  3BZC A;  3KFU F;  1KFS A;  9ICK A;  1SL0 A;  5DGA A;  5IIO A;  5IIN A;  5DDY A;  1SB3 C;  1NI3 A;  1ZQC A;  4KX5 A;  4QZH A;  8ICF A;  3IN5 A;  3BJY A;  3BQ1 A;  3H8J A;  4I2C A;  2KKP A;  2ZIV A;  4EYI B;  1WYG A;  3MR6 A;  1NKC A;  1KN5 A;  3A0B U;  1RXW A;  3OGU A;  1OUQ A;  4IQW A;  7ICV A;  1F5S A;  3HW8 A;  1NKE A;  5J2C A;  3LYS A;  1QTM A;  1QSY A;  1RDF A;  5AK3 A;  3KOO A;  4OD0 A;  2ATL A;  4EZ9 A;  2P6R A;  2DPJ A;  3RBE A;  2BCQ A;  2XO7 A;  2E8O A;  1J2M A;  4F2S A;  3C5G A;  1U49 A;  3SAF A;  5J0P A;  1NK9 A;  2Z7J A;  2KK0 A;  5F9L A;  3QUQ A;  5KFW A;  5ALY A;  4RPY A;  2JV3 A;  4PGX A;  3PR4 A;  2RDI A;  3SQI A;  2JZB A;  3M6K A;  4KMO B;  3C23 A;  4DOC A;  4DL4 A;  4GFJ A;  2ZJ8 A;  5KT5 A;  2K8A A;  5KFS A;  2YTU A;  2IHM A;  5G5H A;  3ZD8 A;  5E79 U;  2KFZ A;  1NJY A;  4I2H A;  3QE9 Y;  2NRV A;  2HMX A;  5AM2 A;  2E3T A;  1N56 A;  2E1F A;  1BPX A;  3HKZ F;  2DQN B;  2WB1 C;  5DQH A;  2E5S A;  3U26 A;  4DF4 A;  4RPX A;  2O6K A;  2B6G A;  2JR5 A;  1S9F A;  5EOZ A;  8ICY A;  1L8O A;  3RB6 A;  3C2K A;  2VAN A;  2HBJ A;  4PHA A;  2W55 A;  1Z3E B;  5KG2 A;  2DL0 A;  2FLP A;  2W9B B;  2IA6 A;  1SGG A;  5EE1 A;  3LWL A;  2YQE A;  3T79 A;  1SZP A;  3AU2 A;  2QKQ A;  1NOM A;  5AHX A;  3PW7 A;  3H8S A;  3GU3 A;  4OJP A;  4BWM A;  1HUZ A;  4CE6 A;  1X42 A;  1KW4 A;  3KTQ A;  4DLG A;  2RP5 A;  2HHS A;  2F44 A;  1ZQG A;  3UM9 A;  1AQ6 A;  2P35 A;  5ALK A;  5J2I A;  3ETR A;  1FO4 A;  4ELT A;  1Q8K A;  1IIP A;  1ZQU A;  2BQR A;  2NRT A;  4PGY A;  4US8 A;  2KFN A;  2W9A A;  3IM1 A;  2OCE A;  5A0L A;  3UPQ A;  4KLO A;  2NRX A;  3SAH A;  2KIW A;  4Y2S A;  4YD2 A;  2W54 A;  3HX0 A;  2NO5 A;  5AKG A;  2RLT A;  4I2E A;  3ZDB A;  2KMD A;  4JWM A;  4R8U B;  1L7P A;  3OPX A;  1T3Q A;  1S10 A;  2LYA A;  5KAF U;  4Y2V A;  2G06 A;  2I9G A;  5BPC A;  3DV9 A;  3MBY A;  2ZUB A;  3VCB A;  2G0A A;  4P4P A;  5IIM A;  2F8L A;  5KNI A;  3OJU A;  1TAM A;  5JUM A;  4DQS A;  3RAQ A;  1NZB A;  3QNM A;  3AL0 B;  4R8U A;  4IRK A;  1ZQ1 C;  4GLX A;  4RU9 A;  2H3F A;  5AI9 A;  4Y2R A;  2HDO A;  1U4B A;  2R8K A;  3H8M A;  3IP4 B;  1SV0 C;  1LKY B;  4DQQ A;  3EUB 2;  4X5V A;  2AGO A;  1L3U A;  2A19 A;  5CA7 A;  3NRZ A;  9ICF A;  1QCK A;  3C29 A;  5KFC A;  2JXJ A;  2OWO A;  3RBD A;  3I76 A;  3IHQ B;  4UAY A; 
#chains in the Genus database with same CATH homology
 4UB8 U;  3A0B U;  5B5E U;  5TIS U;  5GTI U;  5KAF U;  2DUY A;  5E79 U;  5GTH U;  2AXT U;  4IL6 U;  3WU2 U;  4UB6 U;  3A0H U;  5KAI U;  4PJ0 U;  5B66 U;  1S5L U;  3KZI U;  5H2F U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...