5KAIU

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 26
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5kaiU01
3KZIU 5TISU 5GTIU 5GTHU 1S5LU 4IL6U 2DUYA 5KAIU 5KAFU 4PJ0U 5B5EU 2AXTU 3A0HU 4UB6U 5H2FU 3A0BU 5B66U 5E79U 4UB8U 3WU2U
chains in the Genus database with same CATH superfamily
1TK0A 4UARA 4F4YA 3PNCA 1NOMA 9ICMA 1PUZA 3H8WA 3U26A 1O03A 3H40A 4EYHB 4R65A 2WB1F 3NVYA 3HRDD 5IILA 2W8KA 1QSYA 5ALEA 3IP4B 3PW0A 3AQEA 2WTFA 4KLTA 3SAHA 5KFHA 2VKQA 5AICA 2RRDA 4J9OA 4UB8U 3KTQA 2LYHA 4KLIA 2WF9A 3GV8B 2DGZA 7ICKA 3B9JA 2F3NA 2LPEA 7ICMA 2LKYA 4EBCA 3ZDCA 1K1SA 1SL2A 2EZXA 1D8LA 2YB4A 1NJZA 4M9NA 2A1JB 1U47A 4FZNA 1S5LU 4PHPA 1U4BA 3OJUA 5AKJA 3NVZA 3ZDBA 5AM5A 2I1QA 4UB5A 1X6JA 3N4MB 3RB0A 2WF6A 2A19A 2BQ3A 2C22A 4DFJA 7ICSA 4QIWF 5TISU 5CR0A 4DSKA 2G5IB 5AM3A 1J2MA 3RJIA 4UAZA 1LV5A 3BS5A 2FLNA 1ZJMA 4NLCA 2ZXHA 1ZQNA 4USAA 4EBDA 1JX4A 1BVSA 2IOHA 1KFDA 1Z1VA 1S0VA 2XC9A 4M9GA 5KFVA 3ZI4A 4OD0A 4ED3A 2KFZA 2VJ4A 1L6NA 2YQEA 3CRXA 2OM6A 1ZYQA 1SXEA 1CUKA 1ZRMA 5J2AA 2MRLA 5DQGA 2PFOA 3JPOA 1SKSA 4QZFA 4DEZA 8ICZA 1NK9A 2HW3A 4J9PA 4YFKA 2WF7A 2F2AB 2W3RA 4XRHA 2KSOB 1WCLA 2Q0ZX 4RNMA 2W9AA 3WK5A 5JU5A 4EEYA 8ICKA 3QYPA 3VCBA 5F3XB 4M6WB 4I2JA 1ZQTA 4F4ZA 4E0DA 2CPRA 1JROA 2KJ9A 4US8A 4DO9A 4ELTA 3F53A 2NRXA 2HBMA 1N48A 1SXDA 4QZAA 3PO4A 3WKAA 5DB7A 1KTQA 1N5WA 2K8BB 2KEYA 1X9WA 4JV1A 4EX7A 2W3SA 1NJXA 3L3FX 2XGPA 1Z00A 4PHDA 4XQ8A 2BCQA 4Q8EA 3KFUF 2KZZA 1YZ6A 3PSPA 3HILA 5KT5A 4WJ3B 4ED8A 2NYVA 1ZRNA 2HMXA 5ALQA 2E8OA 1N62A 1L7NA 4NV0A 5AM1A 3LDAA 3WK4A 1H38A 5C5JA 4F2RA 3DEEA 5KG6A 2R8IA 4EX6A 2YTUA 4QW8A 3AU6A 1SGGA 2G0AA 3LWMA 5L1IA 2UVVA 1CEZA 3R9KA 5ALJA 3V7KA 3MC1A 4M04A 4P4OA 4U6PA 3EPIA 2KOBA 4M2YA 7ICNA 1B43A 2BDPA 4O3QA 1X42A 2LI6A 4BGDA 4ECQA 4MFAA 3QUCA 1WCNA 4C8KA 3QU4A 3RFAA 5J0OA 5KFUA 5KG1A 5AKEA 3C29A 2PXIA 5J2EA 2BPGA 1T94A 2KICA 3MR5A 5AKGA 4DS5A 2OCEA 1M6YA 4JB3A 2DPIA 2ZTDA 5EWFA 1T3NA 2GWSA 4DQSA 4DFPA 3ONNA 2ZIVB 4UB2A 1URJA 5KL1B 2NRVA 4P0PB 1XSNA 3H0LB 1A0PA 4F93B 1X40A 3MFIA 2XY6A 5D49A 3V6JA 4MF2A 3RBDA 3WKCA 4Y2SA 4RUAA 2PFNA 4RQ0A 1ZQGA 2FPKA 1DGSA 2NRTA 4DWIA 1MQ2A 3TARA 1SIJA 2QB0B 2R8JA 4PL1A 5KFWA 5KFDA 3E58A 2JH7A 2KSOA 4M9HA 4K4HA 4DF4A 1JXLA 2W9CB 5KG0A 4RU9A 5AKYA 3QEAZ 1HEKA 1EXNA 9ICHA 3MGVA 4BUGA 2NRZA 4M6WA 5HMLA 1T8EA 3AQFA 4QWAA 3PX0A 1ZQDA 2ISOA 4ZOHC 4YD2A 4B9VA 1Z1BA 1L3UA 2FMPA 4ECSA 1KEJA 1ZQXA 1DK2A 8ICHA 3KZIU 1C20A 1QQ5A 4RPYA 1TAMA 3SENA 4JWNA 2WB1C 9ICFA 4X5VA 3CNHA 1BPXA 2HI0A 5AK6A 4BWJA 1HUOA 1A76A 4QWEA 4CDGA 3WK8A 3M9MB 3HT3A 4NL9C 8ICSA 2ZXIA 1Q46A 3PW2A 1RDFA 4P0QA 3RRGA 4NM1A 2HHUA 1K5OA 1SKRA 4JV0A 3N97B 2D6FC 1Z19A 4KN7A 3PSTA 5CA7A 1Q3VA 2XY5A 3NRWA 4FO6A 2F1HA 4LVSA 2BQRA 2KHQA 4UB3A 4DLGA 3NASA 4DSIA 4EYIB 3T5KA 4KLUA 3JPRA 4P2HA 4KLJA 4UAYA 4P0PA 4B9LA 2UVUA 4EEKA 4FFDA 1UQVA 2E5SA 1HUZA 4DOCA 1TE2A 4QIWC 2ASJA 1J2NA 5DDMA 4EZ6A 3AN1A 4LZDA 1QH9A 7ICIA 5ALHA 5KTQA 5KFBA 1SKWA 1QSSA 5KFIA 3Q8KA 3OHAA 1ZQLA 3AL0B 4PZNA 1L8LA 1CI4A 1V38A 2QARB 3KD3A 3UXOA 3MGHA 2OYYA 1SV4A 1QQ6A 5KFXA 3AM9A 2OEHA 1ZOLA 3FYHA 5GTHU 2KP7A 4KLMA 4PJ0U 4RQ1A 1UT5A 4ECVA 1BGXT 5B5EU 2PKEA 2GLEA 5KFLA 1T7PA 4B9MA 3NTUA 4NL9A 2VA3A 4IRDA 5J2DA 3RTVA 3AMZA 2E3TA 1L3SA 5J2CA 4J9QA 2BZFA 7ICUA 1KW4A 4C8MA 3TADC 2Y1JA 3LVWA 2XCPA 3GFKB 5KG7A 4F92B 2HVIA 7ICRA 3NS1A 4TQSA 2BR0A 7ICLA 4ECRA 4B9UA 3PX6A 3RBEA 4F4KA 1P7DA 2HBJA 1ZD5A 2WHEA 3MR6A 5J0PA 1UT8A 2EANA 4DSEA 1BPZA 5DGBA 9ICOA 4UAWA 3AU2A 5IIIA 1NK5A 8ICPA 3KZXA 2W03A 2KKVA 2IA6A 5J2IA 3DV9A 3HP6A 3H8MA 9ICPA 3WKBA 5ALXA 2FMQA 1ZQUA 3GIMA 2IBKA 4MEYA 1KKXA 1FO4A 1TK5A 2KIVA 4I2CA 4JK1A 3HKZC 4OJ5A 2BQUA 1JMSA 1FFUA 1V85A 3IG5A 1N2XA 3PX4A 1MSWD 4RQ8A 5AI6A 4R64A 3BS5B 4I2IA 3C2MA 4XA5A 3BQ0A 3C21A 5ALOA 2MU2A 1LB2B 3AEVA 3TADA 1RZTA 4RT2A 1JIHA 2AXTU 1ZXIA 2OH2A 2EQYA 3H4BA 4ELVA 3QE9Y 1ZQWA 4ECWA 5KFJA 4IL6U 1KFTA 5KFMA 5KFKA 2R8GA 3JPTA 5CWRA 1S76D 2AGQA 3VC8A 3Q8QB 5E79U 2RHFA 4ZH4A 3CP8A 4GC7A 1B22A 5EWEA 3K1RB 3Q8PB 9ICNA 1NK4A 2AQ0A 1KSPA 3QUTA 4DL3A 5AM2A 2W7OA 2IOFK 2E8MA 1X2IA 2AQ4A 1SWWA 4RPZA 3RF9A 1N56A 4JV2A 2ZIWB 2HHQA 4DQQA 3WK7A 3D2NA 3UMGA 1L3TA 5IINA 2C28A 4ED1A 1NKBA 1IM4A 1Z00B 3H8SA 4DL2A 3A0HU 2KN7A 2G5HB 4YVZA 2I9GA 1T4GA 4DSJA 5J2FA 1SZPA 3QX7A 2NV3A 4RQ6A 3BQTA 3KBBA 1IXRA 1XC9A 2ASDA 5J2GA 4DCCA 1NI3A 4GXIA 2E1FA 4M9JA 4UAVA 1Z4NA 2K89A 1COOA 4GLXA 2Z7JA 3ISBA 5A0LA 5KFRA 9ICCA 1V97A 4Y2TA 2GOLA 4UBBA 4O3OA 2ATLA 1KQQA 1PVPA 1OUQA 1ZQ1C 4U7CA 4JWMA 7ICFA 1BPBA 2GH1A 5BOLA 3PO5A 5L1KA 2KE7A 4DL6A 1ZQIA 2DF4B 5J8YC 3PMNA 4KLQA 4KN4A 4ELUA 4G9BA 5K4LA 2XICA 4Y2RA 3JPNA 1PK3A 7ICJA 9ICRA 2ZJ8A 2ZIXA 4ED2A 1LVHA 2HOQA 9ICWA 1XO1A 2J6UA 1ED1A 3F2BA 4I2HA 8ICAA 3IDWA 3WK6A 2XVTA 1XSPA 4I2FA 5AI5A 3QU5A 5KNIA 3TFSA 2B6GA 5DB6A 2KVCA 3B0YA 2I5HA 1ZD3A 3GV7B 1DGJA 5T14A 1XU4A 2ZJ5A 5AI8A 4RQ5A 1MQ3A 2H3FA 4F50A 1S0NA 1HJPA 1A6SA 3T5HA 2ZIWA 1XO0A 2CRXA 2WF8A 5AKHA 3TAPA 2BDUA 3SR6A 3IV6A 2EDUA 5EWGA 2VANA 5H2FU 3QZ7A 2KTQA 2MUTA 1LKYB 4PGYA 2VA2A 4O9MA 3ICXA 5ALSA 3SAFA 1X6IA 4JMUA 5KFGA 3IRUA 5HHIA 3V6HA 4ED7A 1XWLA 5G5GA 3V7JA 4ECUA 4BDPA 4IRCA 3I1YA 2AU0A 4P0QB 4QZDA 4QNLA 5J0YA 4ECTA 1NZBA 5J8YA 3M6KA 4DFKA 2DL0A 1IIPA 4F5OA 9ICLA 1S10A 3GZFA 1N63A 3EYZA 2JR5A 1AQ6A 5AKXA 1L7OA 2KG5A 8ICUA 3DDHA 2P6UA 4EELA 4IRKA 5CJ7A 2LBOA 3GIJA 2LMRA 1S8OA 3PZPA 2ASLA 5KFSA 1O08A 2C2RA 5AK3A 2AHOB 1SZHA 1QSLA 2QB1A 4FBTA 2K4PA 2B21A 4AYBF 5CB1A 1D8YA 3MR3A 1JUDA 4YR2A 3PV8A 1ECWA 3UQ2A 9ICVA 3G6YA 1S0MA 4ACOA 4O5EA 2AGOA 3IG8A 1KDHA 8ICFA 4QZ9A 1FFVA 3FDSA 1NNLA 2KK0A 2EAMA 5KG5A 1NZPA 2G08A 2HHWA 1Y88A 2BPCA 2YN4A 4QZ8A 2JZBA 1JALA 4RQ4A 1ZQQA 2E8NA 4M0AA 4C80A 3GDXA 2P66A 3F2CA 2W9BB 2LYBA 4UBCA 4NLGA 3BQ7A 2EZZA 3BZKA 4PZOA 5ALDA 2H3IA 5HHHA 3E2EA 2DKZA 3SD7A 1BPEA 5IIOA 3T5LA 5DBBA 3UPQA 3GU3A 4GXKA 3ZD9A 5KG4A 3CW2C 2MA1A 1DXSA 3L4PA 3EW9A 5B66U 1U9LA 1Q8KA 2JEFA 2I6XA 2JEGA 5AK4A 4I27A 3RB6A 2BHNA 4GIBA 4A8EA 2EAPA 3F2DA 1OXJA 4MHVA 3I28A 5AI9A 2W9MA 2OWOA 2JEIA 1TFRA 2M0NA 3MABA 5J2JA 1BPDA 2ISPA 4IS7A 4J9NA 2DQNB 8ICXA 1PVRA 2NO5A 5KFPA 2G09A 1LKYA 2JHDA 5J0TA 4HAIA 5L1LA 2IOFA 5AM4A 5KFOA 4F5PA 2KKPA 4O3MA 1RM6C 2EH9A 3Q8RB 5F9LA 7ICQA 3IN5A 4Y2JA 3BJYA 2W04A 4O3SA 4KLFA 5J0XA 3PW5A 3FAHA 1ZQBA 4ECXA 1DOQA 4YN4A 1NKEA 4NLBA 3F5AA 1CRXA 5AM0A 4IQWA 5CEHA 4Y2YA 9ICAA 1TAQA 4YP3A 4BX9C 5HP4A 4PL2A 5KFNA 4ECYA 4J9LA 5HR6A 5G5HA 2CXYA 4C4TA 4O5CA 1L7PA 3WK9A 3HWTA 8ICYA 3E0FA 8ICRA 2YMQA 2R18A 1JXEA 2J6TA 2YB1A 1KFSA 4Z6EA 3KOOA 2W11A 1S9FA 4RQ2A 4KLLA 3FC4A 1ZQJA 1PZNA 1NJWA 5GTIU 4DL5A 3WKEA 2YY6A 4NLZA 3ISDA 2LHTA 4YXJA 3RAXA 2ZUCA 2XIDA 5AK5A 5KT2A 4DSLA 5ALKA 2CN1A 2W9BA 2H3VA 4KLGA 2KZ3A 3KHGA 4LZGA 3GIIA 8ICJA 4PGXA 2BCSA 3HW8A 8ICOA 1ZQYA 3TKAA 5DG7A 3C23A 1RYSA 3NGDA 2V4RA 1QQ7A 4I2BA 4BXOA 3SAGA 3D2QA 4F4WA 3ETRA 5KT4A 2KD1A 3EZ5A 1UPHA 4C7ZA 3PSIA 3MR2A 2K4EA 5ALWA 4UB1A 1ZQCA 3ETLA 2M9NA 3SYZA 3JPPA 3LK9A 4IR9A 3OTQA 1VLBA 2ZIUB 5JTIA 2EAOA 4O5KA 2KNJA 3H0RB 3TQ1A 4I2EA 5JRTA 1IG6A 1RYUA 3PW7A 3QEBZ 4F2SA 2W8LA 3RB3A 3UM9A 3K4GA 1VDVA 8ICNA 2K8AA 5L1MA 1KL9A 1NK6A 1MA7A 1C7YA 4C0ZA 1COKA 8ICIA 9ICQA 4C8NA 2DKXA 4RNNA 1DRGA 3HJEA 1RG6A 4QZGA 4I29A 9ICKA 4B6JA 2QKQA 1PVQA 2Y0SF 4QWCA 2H3QA 2F1IA 3QZ8A 5DQIA 4OJLA 4YD1A 3M1YA 4Y2XA 1F5SA 4FS1A 4F71A 3ISCA 1V9PA 4KLDA 1B4FA 1XNSA 2OHFA 1A77A 3KHLA 3TACB 1UHUA 4IQTA 2JGAA 3MBYA 1OW5A 3SV3A 1RXWA 1QTMA 3QUBA 2Q4TA 3C1YA 7ICPA 3C5GA 3BZCA 3T5JA 5ALNA 1ZQEA 2WAQF 4US9A 2KMDA 2P6RA 4RQMA 4K4GA 1ZD4A 4F72A 4OJPA 3KHHA 3FM9A 4NJ8A 2XY7A 4YR0A 2HSZA 5FP0A 2J6SA 4J9MA 1TK8A 4RQ3A 2HHTA 4C4RA 1N61A 2W43A 4RQ7A 2ZIXB 4TURA 2YX8A 2P35A 4GFJA 3V72A 3RH6A 3F5EA 1ZJNA 3OGUA 5AIAA 2BCRA 2XCAA 4TUSA 4I2AA 3QNMA 4KLOA 3SZ2A 4F5RA 1N60A 3UQ0A 4DS4A 4FE3A 1K1QA 4KTQA 3ZDDA 2VA8A 3WKDA 4QZCA 3GILA 2MAXA 1D9FA 1NJYA 3RJKA 1ZQZA 3QUQA 2F44A 4UB4A 3A0BU 1ZQKA 2KJ5A 5J0SA 2ZIUA 2HVHA 1ZQOA 4NLKA 1L8OA 2F77X 7ICHA 2PFPA 1NKCA 2A1AA 5KG3A 2JMGA 3QXGA 5L9XA 4M9LA 3PMLA 1KRPA 5ALYA 5IIJA 5KFYA 4QZEA 4YQWA 5L1JA 5ALPA 4MFFA 2PI4A 2FE9A 4DQIA 3BQ1A 2MUTB 2ES6A 2LYAA 3M9NB 4P4PA 3ALRA 4RQNA 3BDPA 4CGZA 1NK8A 3M6ZA 2ZTEA 4O3NA 3UMCA 3ZD8A 4PGQA 4YCXA 1SL1A 1PK1B 2PFQA 2R8KA 4ECZA 4CNQA 3H4DA 2XGQA 3D2SA 3PR4A 3LVVA 1WWVA 1FEZA 2K60A 5D46A 2ESEA 4EZ9A 4FS2A 2HBLA 1AROP 4ED0A 1RQNA 1FIQA 4FBUA 5ALFA 3C2LA 5ALLA 4KLEA 9ICGA 3N7PD 2C2EA 5J0WA 1XSLA 2PMZF 4C4SA 3HX0A 1KBUA 4XUSA 3RAQA 5KAFU 4QJFB 4C8LA 3KKAC 2D8CA 2HHXA 4UASA 2KHVA 3KHRA 4FZMA 3N7RC 3OJSA 2Y1IA 2JZBB 2ZTCA 4OO1J 2ODGA 5BOMA 4NM2A 2K4HA 1JN3A 3SMVA 1TKDA 5C0YA 1NK0A 4UATA 3M7DA 9ICXA 4DF8A 3PY8A 5EE3A 4YMOA 7ICOA 1TVAA 2IHMA 4QZIA 2ZJAA 2F1JA 3OPXA 4NWIA 3S6JA 2RDJA 5J2HA 4DFDA 3TANA 3IHQB 4Z6CA 4RZRA 5DBAA 4B9SA 3RJEA 4CE6A 4Z6FA 5D4BA 1L7MA 1ZQFA 2HOFA 1Z4OA 4F4XA 4KMUA 2AGPA 5ALVA 8ICTA 3J81j 5EE0A 8ICMA 3O0FA 2RLTA 5KFAA 1S97A 3OSNA 4GC6A 4YG2A 5AKLA 4QW9A 2IHNA 2KVSA 3QU9A 4EBEA 3RRHA 4DLEA 3G6VA 3UXNA 4PPXA 3NUQA 3MDAA 5CHGA 1PK1A 2H5XA 1X9SA 3M8RA 1JRPA 4FZLA 3KKAA 1Q3UA 5KFTA 3OSPA 2A1JA 4R8UB 2HBKA 1UA1A 5KFFA 2DWQA 2FI1A 2NO4A 5J2BA 4I28A 2Y0SC 1QLNA 5KAIU 1RXVA 2HDOA 4YMMA 9ICUA 3HKZF 5DB9A 4YMNA 3BQ2A 5ALRA 4F8RA 4NY8A 2FJ6A 5KT3A 5J0QA 3NVVA 3K1ZA 4CF3A 3EUB2 2ZUDA 3MDCA 9ICIA 5AIBA 5KT6A 2AH5A 4OJ6A 4MFCA 2LM4A 4Q8FA 1IV8A 5DG9A 2LM1A 5ALMA 1GO3F 5HMMA 3ORYA 2WAQC 3M9OB 2FPMA 3SI8A 4C7YA 1X9MA 4KX5A 3HPOA 3RJHA 5KL8B 1ZQMA 4J9SA 2KJ8A 4QWDA 5ALTA 1QCKA 2VIXA 2A3VA 4F5NA 5IIKA 1KLNA 3IM1A 3RH5A 2W7PA 3Q8MA 9ICJA 1UCVA 4CRXA 4JUZA 2G07A 1TV9A 5TZVA 2V4QA 1BNPA 1T3QA 5ALUA 4PH5A 4Q43A 1U45A 2FDRA 4J9RA 2AJQA 4DFMA 1MC8A 3JPSA 4BXOB 5AI4A 9ICTA 4F5QA 1MN8A 3PSFA 3AUOA 1WYGA 3CYMA 4OJOA 3RH4A 5KFCA 4DSFA 2B0CA 3EPGA 4YXMA 3UXPA 2JEJA 7ICGA 3T3FA 4F91B 3PR5B 4YR3A 2L5YA 3OHBA 5AI0A 1ZQAA 2UVRA 4TUPA 7ICVA 3MFHA 2F76X 1SWVA 2W55A 2FLLA 2D3DA 4KITB 2HHVA 4KX3A 2BCUA 1BNOA 3GQCA 5EOZA 2VJ5A 2GO7A 5CP2A 1RQLA 2WF5A 5EE9A 4K4IA 1RPLA 4R8UA 1YZ7A 4TQRA 1B0XA 2JXJA 2K8CB 2HOIA 4RUCA 4BWMA 2YMPA 7ICEA 1SV0C 2HCFA 4ED6A 5DG8A 4J03A 8ICLA 3TI0A 3RJJA 3L5KA 1DK3A 2RQ5A 1WG8A 8ICBA 4DL7A 4DQRA 1BPYA 2E1EA 5KFEA 5DDYA 1UA0A 8ICVA 3BS7A 5HR7A 5ALZA 4KMOB 9ICSA 1ZQSA 2DPJA 2XI9A 3H8JA 2E8PA 8ICEA 2ZIVA 1JI7A 1WUDA 2MSNA 1YT3A 2K4IA 2KV2A 5DGAA 2FLPA 4GXJA 5ALIA 4R63A 2ZG6A 2F8LA 2ZUBA 4IQUA 3QU7A 5HNKA 4M47A 3JPQA 4QWBA 2C2DA 4IR1A 3LYSA 3PVXA 5AKZA 3I76A 2PMZC 2Y9TA 4DL4A 2QB0A 1L3VA 3C28A 2V9WA 5AKKA 4C8OA 2QLTA 3G6XA 3NRZA 2RDIA 2W9CA 3SV4A 4DQPA 1U48A 3K75D 2F8KA 2BCVA 3WU2U 1TAUA 4B9NA 5EE1A 2YMMA 2H3ZA 3EWAA 2R8HA 4HYKA 1KN5A 4Q44A 4J9KA 3TFRA 2IMWP 2KZMA 5DKWA 3GIKA 4BJQA 4Y2QA 9ICBA 1SV0A 4OCZA 1X9XA 2DBYA 4UAUA 1X66A 1HIWA 1ZQRA 1F44A 5DLGA 1SB3C 8ICCA 3RJGA 1SL0A 5DLFA 3N28A 2JV3A 4Q45A 2N1RA 5AHXA 4MEXA 1Z3EB 3C1ZA 3RB4A 4TUQA 2FMSA 3C2KA 3MGIA 2YMLA 3THVA 2BGWA 4PHEA 2KFNA 1F0MA 4AP9A 3SEIA 3D6JA 4RPXA 3GV5B 2UVWA 4Y2PA 2DUYA 3ED5A 4I2GA 4CCHA 1ZQPA 4KLHA 4B9TA 3NVWA 5KG2A 1RYRA 5JUMA 2XO7A 4IQVA 4P4MA 2KIWA 4Y2UA 3QU2A 2G06A 4G3IA 5BPCA 7ICTA 2WFAA 4DOBA 4UQGA 4IC9A 2JH1A 3V7LA 5J0RA 4PHAA 5KT7A 5IIMA 4RT3A 1U49A 1S77D 1L5UA 2PI5A 2OXOA 1ZQVA 2BPFA 3RR8A 4NXZA 4RNOA 4UB6U 1WWUA 2ALZA 5KFZA 1J97A 5AKIA 4DOAA 3C5FA 2HHSA 8ICWA 3M8SA 4AYBC 4QZBA 2RP5A 2NRWA 5DBCA 4CF4A 5J0UA 1VJ5A 4NLNA 1ZETA 5F9NA 5DQHA 3H7IA 2W54A 3N7SC 3PW4A 1ZD2P 3UMBA 4MF8A 3Q8SB 8ICQA 5DB8A 3TAQA 4KLSA 2EZYA 2Y9UA 2QARA 4O3RA 3T79A 2DFLA 3B0XA 8ICGA 3H0MB 2FPLA 4R66A 4UW9A 4O3PA 1N5XA 5ALGA 4EENA 3Q8LA 3RJFA 5J29A 4F3OA 2O6KA 3ZDEA 1S0OA 2JRZA 4CF5A 4I2DA 5CRXA 3RR7A 1XS9D 2BKEA 1NK7A 4Z6DA 3ZDAA 4ICAA 4Y2VA 5J2KA 9ICEA 4QZHA 3V6KA 3SQIA 4O0IA 4LJXA 3LWLA 1D9DA 1D8BA 5KFQA 1ZQHA
chains in the Genus database with same CATH topology
3KZIU 5TISU 5GTIU 5GTHU 1S5LU 4IL6U 2DUYA 5KAIU 5KAFU 4PJ0U 5B5EU 2AXTU 3A0HU 4UB6U 5H2FU 3A0BU 5B66U 5E79U 4UB8U 3WU2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI U;  5TIS U;  5GTI U;  5GTH U;  1S5L U;  4IL6 U;  2DUY A;  5KAI U;  5KAF U;  4PJ0 U;  5B5E U;  2AXT U;  3A0H U;  4UB6 U;  5H2F U;  3A0B U;  5B66 U;  5E79 U;  4UB8 U;  3WU2 U; 
#chains in the Genus database with same CATH topology
 1TK0 A;  4UAR A;  4F4Y A;  3PNC A;  1NOM A;  9ICM A;  1PUZ A;  3H8W A;  3U26 A;  1O03 A;  3H40 A;  4EYH B;  4R65 A;  2WB1 F;  3NVY A;  3HRD D;  5IIL A;  2W8K A;  1QSY A;  5ALE A;  3IP4 B;  3PW0 A;  3AQE A;  2WTF A;  4KLT A;  3SAH A;  5KFH A;  2VKQ A;  5AIC A;  2RRD A;  4J9O A;  4UB8 U;  3KTQ A;  2LYH A;  4KLI A;  2WF9 A;  3GV8 B;  2DGZ A;  7ICK A;  3B9J A;  2F3N A;  2LPE A;  7ICM A;  2LKY A;  4EBC A;  3ZDC A;  1K1S A;  1SL2 A;  2EZX A;  1D8L A;  2YB4 A;  1NJZ A;  4M9N A;  2A1J B;  1U47 A;  4FZN A;  1S5L U;  4PHP A;  1U4B A;  3OJU A;  5AKJ A;  3NVZ A;  3ZDB A;  5AM5 A;  2I1Q A;  4UB5 A;  1X6J A;  3N4M B;  3RB0 A;  2WF6 A;  2A19 A;  2BQ3 A;  2C22 A;  4DFJ A;  7ICS A;  4QIW F;  5TIS U;  5CR0 A;  4DSK A;  2G5I B;  5AM3 A;  1J2M A;  3RJI A;  4UAZ A;  1LV5 A;  3BS5 A;  2FLN A;  1ZJM A;  4NLC A;  2ZXH A;  1ZQN A;  4USA A;  4EBD A;  1JX4 A;  1BVS A;  2IOH A;  1KFD A;  1Z1V A;  1S0V A;  2XC9 A;  4M9G A;  5KFV A;  3ZI4 A;  4OD0 A;  4ED3 A;  2KFZ A;  2VJ4 A;  1L6N A;  2YQE A;  3CRX A;  2OM6 A;  1ZYQ A;  1SXE A;  1CUK A;  1ZRM A;  5J2A A;  2MRL A;  5DQG A;  2PFO A;  3JPO A;  1SKS A;  4QZF A;  4DEZ A;  8ICZ A;  1NK9 A;  2HW3 A;  4J9P A;  4YFK A;  2WF7 A;  2F2A B;  2W3R A;  4XRH A;  2KSO B;  1WCL A;  2Q0Z X;  4RNM A;  2W9A A;  3WK5 A;  5JU5 A;  4EEY A;  8ICK A;  3QYP A;  3VCB A;  5F3X B;  4M6W B;  4I2J A;  1ZQT A;  4F4Z A;  4E0D A;  2CPR A;  1JRO A;  2KJ9 A;  4US8 A;  4DO9 A;  4ELT A;  3F53 A;  2NRX A;  2HBM A;  1N48 A;  1SXD A;  4QZA A;  3PO4 A;  3WKA A;  5DB7 A;  1KTQ A;  1N5W A;  2K8B B;  2KEY A;  1X9W A;  4JV1 A;  4EX7 A;  2W3S A;  1NJX A;  3L3F X;  2XGP A;  1Z00 A;  4PHD A;  4XQ8 A;  2BCQ A;  4Q8E A;  3KFU F;  2KZZ A;  1YZ6 A;  3PSP A;  3HIL A;  5KT5 A;  4WJ3 B;  4ED8 A;  2NYV A;  1ZRN A;  2HMX A;  5ALQ A;  2E8O A;  1N62 A;  1L7N A;  4NV0 A;  5AM1 A;  3LDA A;  3WK4 A;  1H38 A;  5C5J A;  4F2R A;  3DEE A;  5KG6 A;  2R8I A;  4EX6 A;  2YTU A;  4QW8 A;  3AU6 A;  1SGG A;  2G0A A;  3LWM A;  5L1I A;  2UVV A;  1CEZ A;  3R9K A;  5ALJ A;  3V7K A;  3MC1 A;  4M04 A;  4P4O A;  4U6P A;  3EPI A;  2KOB A;  4M2Y A;  7ICN A;  1B43 A;  2BDP A;  4O3Q A;  1X42 A;  2LI6 A;  4BGD A;  4ECQ A;  4MFA A;  3QUC A;  1WCN A;  4C8K A;  3QU4 A;  3RFA A;  5J0O A;  5KFU A;  5KG1 A;  5AKE A;  3C29 A;  2PXI A;  5J2E A;  2BPG A;  1T94 A;  2KIC A;  3MR5 A;  5AKG A;  4DS5 A;  2OCE A;  1M6Y A;  4JB3 A;  2DPI A;  2ZTD A;  5EWF A;  1T3N A;  2GWS A;  4DQS A;  4DFP A;  3ONN A;  2ZIV B;  4UB2 A;  1URJ A;  5KL1 B;  2NRV A;  4P0P B;  1XSN A;  3H0L B;  1A0P A;  4F93 B;  1X40 A;  3MFI A;  2XY6 A;  5D49 A;  3V6J A;  4MF2 A;  3RBD A;  3WKC A;  4Y2S A;  4RUA A;  2PFN A;  4RQ0 A;  1ZQG A;  2FPK A;  1DGS A;  2NRT A;  4DWI A;  1MQ2 A;  3TAR A;  1SIJ A;  2QB0 B;  2R8J A;  4PL1 A;  5KFW A;  5KFD A;  3E58 A;  2JH7 A;  2KSO A;  4M9H A;  4K4H A;  4DF4 A;  1JXL A;  2W9C B;  5KG0 A;  4RU9 A;  5AKY A;  3QEA Z;  1HEK A;  1EXN A;  9ICH A;  3MGV A;  4BUG A;  2NRZ A;  4M6W A;  5HML A;  1T8E A;  3AQF A;  4QWA A;  3PX0 A;  1ZQD A;  2ISO A;  4ZOH C;  4YD2 A;  4B9V A;  1Z1B A;  1L3U A;  2FMP A;  4ECS A;  1KEJ A;  1ZQX A;  1DK2 A;  8ICH A;  3KZI U;  1C20 A;  1QQ5 A;  4RPY A;  1TAM A;  3SEN A;  4JWN A;  2WB1 C;  9ICF A;  4X5V A;  3CNH A;  1BPX A;  2HI0 A;  5AK6 A;  4BWJ A;  1HUO A;  1A76 A;  4QWE A;  4CDG A;  3WK8 A;  3M9M B;  3HT3 A;  4NL9 C;  8ICS A;  2ZXI A;  1Q46 A;  3PW2 A;  1RDF A;  4P0Q A;  3RRG A;  4NM1 A;  2HHU A;  1K5O A;  1SKR A;  4JV0 A;  3N97 B;  2D6F C;  1Z19 A;  4KN7 A;  3PST A;  5CA7 A;  1Q3V A;  2XY5 A;  3NRW A;  4FO6 A;  2F1H A;  4LVS A;  2BQR A;  2KHQ A;  4UB3 A;  4DLG A;  3NAS A;  4DSI A;  4EYI B;  3T5K A;  4KLU A;  3JPR A;  4P2H A;  4KLJ A;  4UAY A;  4P0P A;  4B9L A;  2UVU A;  4EEK A;  4FFD A;  1UQV A;  2E5S A;  1HUZ A;  4DOC A;  1TE2 A;  4QIW C;  2ASJ A;  1J2N A;  5DDM A;  4EZ6 A;  3AN1 A;  4LZD A;  1QH9 A;  7ICI A;  5ALH A;  5KTQ A;  5KFB A;  1SKW A;  1QSS A;  5KFI A;  3Q8K A;  3OHA A;  1ZQL A;  3AL0 B;  4PZN A;  1L8L A;  1CI4 A;  1V38 A;  2QAR B;  3KD3 A;  3UXO A;  3MGH A;  2OYY A;  1SV4 A;  1QQ6 A;  5KFX A;  3AM9 A;  2OEH A;  1ZOL A;  3FYH A;  5GTH U;  2KP7 A;  4KLM A;  4PJ0 U;  4RQ1 A;  1UT5 A;  4ECV A;  1BGX T;  5B5E U;  2PKE A;  2GLE A;  5KFL A;  1T7P A;  4B9M A;  3NTU A;  4NL9 A;  2VA3 A;  4IRD A;  5J2D A;  3RTV A;  3AMZ A;  2E3T A;  1L3S A;  5J2C A;  4J9Q A;  2BZF A;  7ICU A;  1KW4 A;  4C8M A;  3TAD C;  2Y1J A;  3LVW A;  2XCP A;  3GFK B;  5KG7 A;  4F92 B;  2HVI A;  7ICR A;  3NS1 A;  4TQS A;  2BR0 A;  7ICL A;  4ECR A;  4B9U A;  3PX6 A;  3RBE A;  4F4K A;  1P7D A;  2HBJ A;  1ZD5 A;  2WHE A;  3MR6 A;  5J0P A;  1UT8 A;  2EAN A;  4DSE A;  1BPZ A;  5DGB A;  9ICO A;  4UAW A;  3AU2 A;  5III A;  1NK5 A;  8ICP A;  3KZX A;  2W03 A;  2KKV A;  2IA6 A;  5J2I A;  3DV9 A;  3HP6 A;  3H8M A;  9ICP A;  3WKB A;  5ALX A;  2FMQ A;  1ZQU A;  3GIM A;  2IBK A;  4MEY A;  1KKX A;  1FO4 A;  1TK5 A;  2KIV A;  4I2C A;  4JK1 A;  3HKZ C;  4OJ5 A;  2BQU A;  1JMS A;  1FFU A;  1V85 A;  3IG5 A;  1N2X A;  3PX4 A;  1MSW D;  4RQ8 A;  5AI6 A;  4R64 A;  3BS5 B;  4I2I A;  3C2M A;  4XA5 A;  3BQ0 A;  3C21 A;  5ALO A;  2MU2 A;  1LB2 B;  3AEV A;  3TAD A;  1RZT A;  4RT2 A;  1JIH A;  2AXT U;  1ZXI A;  2OH2 A;  2EQY A;  3H4B A;  4ELV A;  3QE9 Y;  1ZQW A;  4ECW A;  5KFJ A;  4IL6 U;  1KFT A;  5KFM A;  5KFK A;  2R8G A;  3JPT A;  5CWR A;  1S76 D;  2AGQ A;  3VC8 A;  3Q8Q B;  5E79 U;  2RHF A;  4ZH4 A;  3CP8 A;  4GC7 A;  1B22 A;  5EWE A;  3K1R B;  3Q8P B;  9ICN A;  1NK4 A;  2AQ0 A;  1KSP A;  3QUT A;  4DL3 A;  5AM2 A;  2W7O A;  2IOF K;  2E8M A;  1X2I A;  2AQ4 A;  1SWW A;  4RPZ A;  3RF9 A;  1N56 A;  4JV2 A;  2ZIW B;  2HHQ A;  4DQQ A;  3WK7 A;  3D2N A;  3UMG A;  1L3T A;  5IIN A;  2C28 A;  4ED1 A;  1NKB A;  1IM4 A;  1Z00 B;  3H8S A;  4DL2 A;  3A0H U;  2KN7 A;  2G5H B;  4YVZ A;  2I9G A;  1T4G A;  4DSJ A;  5J2F A;  1SZP A;  3QX7 A;  2NV3 A;  4RQ6 A;  3BQT A;  3KBB A;  1IXR A;  1XC9 A;  2ASD A;  5J2G A;  4DCC A;  1NI3 A;  4GXI A;  2E1F A;  4M9J A;  4UAV A;  1Z4N A;  2K89 A;  1COO A;  4GLX A;  2Z7J A;  3ISB A;  5A0L A;  5KFR A;  9ICC A;  1V97 A;  4Y2T A;  2GOL A;  4UBB A;  4O3O A;  2ATL A;  1KQQ A;  1PVP A;  1OUQ A;  1ZQ1 C;  4U7C A;  4JWM A;  7ICF A;  1BPB A;  2GH1 A;  5BOL A;  3PO5 A;  5L1K A;  2KE7 A;  4DL6 A;  1ZQI A;  2DF4 B;  5J8Y C;  3PMN A;  4KLQ A;  4KN4 A;  4ELU A;  4G9B A;  5K4L A;  2XIC A;  4Y2R A;  3JPN A;  1PK3 A;  7ICJ A;  9ICR A;  2ZJ8 A;  2ZIX A;  4ED2 A;  1LVH A;  2HOQ A;  9ICW A;  1XO1 A;  2J6U A;  1ED1 A;  3F2B A;  4I2H A;  8ICA A;  3IDW A;  3WK6 A;  2XVT A;  1XSP A;  4I2F A;  5AI5 A;  3QU5 A;  5KNI A;  3TFS A;  2B6G A;  5DB6 A;  2KVC A;  3B0Y A;  2I5H A;  1ZD3 A;  3GV7 B;  1DGJ A;  5T14 A;  1XU4 A;  2ZJ5 A;  5AI8 A;  4RQ5 A;  1MQ3 A;  2H3F A;  4F50 A;  1S0N A;  1HJP A;  1A6S A;  3T5H A;  2ZIW A;  1XO0 A;  2CRX A;  2WF8 A;  5AKH A;  3TAP A;  2BDU A;  3SR6 A;  3IV6 A;  2EDU A;  5EWG A;  2VAN A;  5H2F U;  3QZ7 A;  2KTQ A;  2MUT A;  1LKY B;  4PGY A;  2VA2 A;  4O9M A;  3ICX A;  5ALS A;  3SAF A;  1X6I A;  4JMU A;  5KFG A;  3IRU A;  5HHI A;  3V6H A;  4ED7 A;  1XWL A;  5G5G A;  3V7J A;  4ECU A;  4BDP A;  4IRC A;  3I1Y A;  2AU0 A;  4P0Q B;  4QZD A;  4QNL A;  5J0Y A;  4ECT A;  1NZB A;  5J8Y A;  3M6K A;  4DFK A;  2DL0 A;  1IIP A;  4F5O A;  9ICL A;  1S10 A;  3GZF A;  1N63 A;  3EYZ A;  2JR5 A;  1AQ6 A;  5AKX A;  1L7O A;  2KG5 A;  8ICU A;  3DDH A;  2P6U A;  4EEL A;  4IRK A;  5CJ7 A;  2LBO A;  3GIJ A;  2LMR A;  1S8O A;  3PZP A;  2ASL A;  5KFS A;  1O08 A;  2C2R A;  5AK3 A;  2AHO B;  1SZH A;  1QSL A;  2QB1 A;  4FBT A;  2K4P A;  2B21 A;  4AYB F;  5CB1 A;  1D8Y A;  3MR3 A;  1JUD A;  4YR2 A;  3PV8 A;  1ECW A;  3UQ2 A;  9ICV A;  3G6Y A;  1S0M A;  4ACO A;  4O5E A;  2AGO A;  3IG8 A;  1KDH A;  8ICF A;  4QZ9 A;  1FFV A;  3FDS A;  1NNL A;  2KK0 A;  2EAM A;  5KG5 A;  1NZP A;  2G08 A;  2HHW A;  1Y88 A;  2BPC A;  2YN4 A;  4QZ8 A;  2JZB A;  1JAL A;  4RQ4 A;  1ZQQ A;  2E8N A;  4M0A A;  4C80 A;  3GDX A;  2P66 A;  3F2C A;  2W9B B;  2LYB A;  4UBC A;  4NLG A;  3BQ7 A;  2EZZ A;  3BZK A;  4PZO A;  5ALD A;  2H3I A;  5HHH A;  3E2E A;  2DKZ A;  3SD7 A;  1BPE A;  5IIO A;  3T5L A;  5DBB A;  3UPQ A;  3GU3 A;  4GXK A;  3ZD9 A;  5KG4 A;  3CW2 C;  2MA1 A;  1DXS A;  3L4P A;  3EW9 A;  5B66 U;  1U9L A;  1Q8K A;  2JEF A;  2I6X A;  2JEG A;  5AK4 A;  4I27 A;  3RB6 A;  2BHN A;  4GIB A;  4A8E A;  2EAP A;  3F2D A;  1OXJ A;  4MHV A;  3I28 A;  5AI9 A;  2W9M A;  2OWO A;  2JEI A;  1TFR A;  2M0N A;  3MAB A;  5J2J A;  1BPD A;  2ISP A;  4IS7 A;  4J9N A;  2DQN B;  8ICX A;  1PVR A;  2NO5 A;  5KFP A;  2G09 A;  1LKY A;  2JHD A;  5J0T A;  4HAI A;  5L1L A;  2IOF A;  5AM4 A;  5KFO A;  4F5P A;  2KKP A;  4O3M A;  1RM6 C;  2EH9 A;  3Q8R B;  5F9L A;  7ICQ A;  3IN5 A;  4Y2J A;  3BJY A;  2W04 A;  4O3S A;  4KLF A;  5J0X A;  3PW5 A;  3FAH A;  1ZQB A;  4ECX A;  1DOQ A;  4YN4 A;  1NKE A;  4NLB A;  3F5A A;  1CRX A;  5AM0 A;  4IQW A;  5CEH A;  4Y2Y A;  9ICA A;  1TAQ A;  4YP3 A;  4BX9 C;  5HP4 A;  4PL2 A;  5KFN A;  4ECY A;  4J9L A;  5HR6 A;  5G5H A;  2CXY A;  4C4T A;  4O5C A;  1L7P A;  3WK9 A;  3HWT A;  8ICY A;  3E0F A;  8ICR A;  2YMQ A;  2R18 A;  1JXE A;  2J6T A;  2YB1 A;  1KFS A;  4Z6E A;  3KOO A;  2W11 A;  1S9F A;  4RQ2 A;  4KLL A;  3FC4 A;  1ZQJ A;  1PZN A;  1NJW A;  5GTI U;  4DL5 A;  3WKE A;  2YY6 A;  4NLZ A;  3ISD A;  2LHT A;  4YXJ A;  3RAX A;  2ZUC A;  2XID A;  5AK5 A;  5KT2 A;  4DSL A;  5ALK A;  2CN1 A;  2W9B A;  2H3V A;  4KLG A;  2KZ3 A;  3KHG A;  4LZG A;  3GII A;  8ICJ A;  4PGX A;  2BCS A;  3HW8 A;  8ICO A;  1ZQY A;  3TKA A;  5DG7 A;  3C23 A;  1RYS A;  3NGD A;  2V4R A;  1QQ7 A;  4I2B A;  4BXO A;  3SAG A;  3D2Q A;  4F4W A;  3ETR A;  5KT4 A;  2KD1 A;  3EZ5 A;  1UPH A;  4C7Z A;  3PSI A;  3MR2 A;  2K4E A;  5ALW A;  4UB1 A;  1ZQC A;  3ETL A;  2M9N A;  3SYZ A;  3JPP A;  3LK9 A;  4IR9 A;  3OTQ A;  1VLB A;  2ZIU B;  5JTI A;  2EAO A;  4O5K A;  2KNJ A;  3H0R B;  3TQ1 A;  4I2E A;  5JRT A;  1IG6 A;  1RYU A;  3PW7 A;  3QEB Z;  4F2S A;  2W8L A;  3RB3 A;  3UM9 A;  3K4G A;  1VDV A;  8ICN A;  2K8A A;  5L1M A;  1KL9 A;  1NK6 A;  1MA7 A;  1C7Y A;  4C0Z A;  1COK A;  8ICI A;  9ICQ A;  4C8N A;  2DKX A;  4RNN A;  1DRG A;  3HJE A;  1RG6 A;  4QZG A;  4I29 A;  9ICK A;  4B6J A;  2QKQ A;  1PVQ A;  2Y0S F;  4QWC A;  2H3Q A;  2F1I A;  3QZ8 A;  5DQI A;  4OJL A;  4YD1 A;  3M1Y A;  4Y2X A;  1F5S A;  4FS1 A;  4F71 A;  3ISC A;  1V9P A;  4KLD A;  1B4F A;  1XNS A;  2OHF A;  1A77 A;  3KHL A;  3TAC B;  1UHU A;  4IQT A;  2JGA A;  3MBY A;  1OW5 A;  3SV3 A;  1RXW A;  1QTM A;  3QUB A;  2Q4T A;  3C1Y A;  7ICP A;  3C5G A;  3BZC A;  3T5J A;  5ALN A;  1ZQE A;  2WAQ F;  4US9 A;  2KMD A;  2P6R A;  4RQM A;  4K4G A;  1ZD4 A;  4F72 A;  4OJP A;  3KHH A;  3FM9 A;  4NJ8 A;  2XY7 A;  4YR0 A;  2HSZ A;  5FP0 A;  2J6S A;  4J9M A;  1TK8 A;  4RQ3 A;  2HHT A;  4C4R A;  1N61 A;  2W43 A;  4RQ7 A;  2ZIX B;  4TUR A;  2YX8 A;  2P35 A;  4GFJ A;  3V72 A;  3RH6 A;  3F5E A;  1ZJN A;  3OGU A;  5AIA A;  2BCR A;  2XCA A;  4TUS A;  4I2A A;  3QNM A;  4KLO A;  3SZ2 A;  4F5R A;  1N60 A;  3UQ0 A;  4DS4 A;  4FE3 A;  1K1Q A;  4KTQ A;  3ZDD A;  2VA8 A;  3WKD A;  4QZC A;  3GIL A;  2MAX A;  1D9F A;  1NJY A;  3RJK A;  1ZQZ A;  3QUQ A;  2F44 A;  4UB4 A;  3A0B U;  1ZQK A;  2KJ5 A;  5J0S A;  2ZIU A;  2HVH A;  1ZQO A;  4NLK A;  1L8O A;  2F77 X;  7ICH A;  2PFP A;  1NKC A;  2A1A A;  5KG3 A;  2JMG A;  3QXG A;  5L9X A;  4M9L A;  3PML A;  1KRP A;  5ALY A;  5IIJ A;  5KFY A;  4QZE A;  4YQW A;  5L1J A;  5ALP A;  4MFF A;  2PI4 A;  2FE9 A;  4DQI A;  3BQ1 A;  2MUT B;  2ES6 A;  2LYA A;  3M9N B;  4P4P A;  3ALR A;  4RQN A;  3BDP A;  4CGZ A;  1NK8 A;  3M6Z A;  2ZTE A;  4O3N A;  3UMC A;  3ZD8 A;  4PGQ A;  4YCX A;  1SL1 A;  1PK1 B;  2PFQ A;  2R8K A;  4ECZ A;  4CNQ A;  3H4D A;  2XGQ A;  3D2S A;  3PR4 A;  3LVV A;  1WWV A;  1FEZ A;  2K60 A;  5D46 A;  2ESE A;  4EZ9 A;  4FS2 A;  2HBL A;  1ARO P;  4ED0 A;  1RQN A;  1FIQ A;  4FBU A;  5ALF A;  3C2L A;  5ALL A;  4KLE A;  9ICG A;  3N7P D;  2C2E A;  5J0W A;  1XSL A;  2PMZ F;  4C4S A;  3HX0 A;  1KBU A;  4XUS A;  3RAQ A;  5KAF U;  4QJF B;  4C8L A;  3KKA C;  2D8C A;  2HHX A;  4UAS A;  2KHV A;  3KHR A;  4FZM A;  3N7R C;  3OJS A;  2Y1I A;  2JZB B;  2ZTC A;  4OO1 J;  2ODG A;  5BOM A;  4NM2 A;  2K4H A;  1JN3 A;  3SMV A;  1TKD A;  5C0Y A;  1NK0 A;  4UAT A;  3M7D A;  9ICX A;  4DF8 A;  3PY8 A;  5EE3 A;  4YMO A;  7ICO A;  1TVA A;  2IHM A;  4QZI A;  2ZJA A;  2F1J A;  3OPX A;  4NWI A;  3S6J A;  2RDJ A;  5J2H A;  4DFD A;  3TAN A;  3IHQ B;  4Z6C A;  4RZR A;  5DBA A;  4B9S A;  3RJE A;  4CE6 A;  4Z6F A;  5D4B A;  1L7M A;  1ZQF A;  2HOF A;  1Z4O A;  4F4X A;  4KMU A;  2AGP A;  5ALV A;  8ICT A;  3J81 j;  5EE0 A;  8ICM A;  3O0F A;  2RLT A;  5KFA A;  1S97 A;  3OSN A;  4GC6 A;  4YG2 A;  5AKL A;  4QW9 A;  2IHN A;  2KVS A;  3QU9 A;  4EBE A;  3RRH A;  4DLE A;  3G6V A;  3UXN A;  4PPX A;  3NUQ A;  3MDA A;  5CHG A;  1PK1 A;  2H5X A;  1X9S A;  3M8R A;  1JRP A;  4FZL A;  3KKA A;  1Q3U A;  5KFT A;  3OSP A;  2A1J A;  4R8U B;  2HBK A;  1UA1 A;  5KFF A;  2DWQ A;  2FI1 A;  2NO4 A;  5J2B A;  4I28 A;  2Y0S C;  1QLN A;  5KAI U;  1RXV A;  2HDO A;  4YMM A;  9ICU A;  3HKZ F;  5DB9 A;  4YMN A;  3BQ2 A;  5ALR A;  4F8R A;  4NY8 A;  2FJ6 A;  5KT3 A;  5J0Q A;  3NVV A;  3K1Z A;  4CF3 A;  3EUB 2;  2ZUD A;  3MDC A;  9ICI A;  5AIB A;  5KT6 A;  2AH5 A;  4OJ6 A;  4MFC A;  2LM4 A;  4Q8F A;  1IV8 A;  5DG9 A;  2LM1 A;  5ALM A;  1GO3 F;  5HMM A;  3ORY A;  2WAQ C;  3M9O B;  2FPM A;  3SI8 A;  4C7Y A;  1X9M A;  4KX5 A;  3HPO A;  3RJH A;  5KL8 B;  1ZQM A;  4J9S A;  2KJ8 A;  4QWD A;  5ALT A;  1QCK A;  2VIX A;  2A3V A;  4F5N A;  5IIK A;  1KLN A;  3IM1 A;  3RH5 A;  2W7P A;  3Q8M A;  9ICJ A;  1UCV A;  4CRX A;  4JUZ A;  2G07 A;  1TV9 A;  5TZV A;  2V4Q A;  1BNP A;  1T3Q A;  5ALU A;  4PH5 A;  4Q43 A;  1U45 A;  2FDR A;  4J9R A;  2AJQ A;  4DFM A;  1MC8 A;  3JPS A;  4BXO B;  5AI4 A;  9ICT A;  4F5Q A;  1MN8 A;  3PSF A;  3AUO A;  1WYG A;  3CYM A;  4OJO A;  3RH4 A;  5KFC A;  4DSF A;  2B0C A;  3EPG A;  4YXM A;  3UXP A;  2JEJ A;  7ICG A;  3T3F A;  4F91 B;  3PR5 B;  4YR3 A;  2L5Y A;  3OHB A;  5AI0 A;  1ZQA A;  2UVR A;  4TUP A;  7ICV A;  3MFH A;  2F76 X;  1SWV A;  2W55 A;  2FLL A;  2D3D A;  4KIT B;  2HHV A;  4KX3 A;  2BCU A;  1BNO A;  3GQC A;  5EOZ A;  2VJ5 A;  2GO7 A;  5CP2 A;  1RQL A;  2WF5 A;  5EE9 A;  4K4I A;  1RPL A;  4R8U A;  1YZ7 A;  4TQR A;  1B0X A;  2JXJ A;  2K8C B;  2HOI A;  4RUC A;  4BWM A;  2YMP A;  7ICE A;  1SV0 C;  2HCF A;  4ED6 A;  5DG8 A;  4J03 A;  8ICL A;  3TI0 A;  3RJJ A;  3L5K A;  1DK3 A;  2RQ5 A;  1WG8 A;  8ICB A;  4DL7 A;  4DQR A;  1BPY A;  2E1E A;  5KFE A;  5DDY A;  1UA0 A;  8ICV A;  3BS7 A;  5HR7 A;  5ALZ A;  4KMO B;  9ICS A;  1ZQS A;  2DPJ A;  2XI9 A;  3H8J A;  2E8P A;  8ICE A;  2ZIV A;  1JI7 A;  1WUD A;  2MSN A;  1YT3 A;  2K4I A;  2KV2 A;  5DGA A;  2FLP A;  4GXJ A;  5ALI A;  4R63 A;  2ZG6 A;  2F8L A;  2ZUB A;  4IQU A;  3QU7 A;  5HNK A;  4M47 A;  3JPQ A;  4QWB A;  2C2D A;  4IR1 A;  3LYS A;  3PVX A;  5AKZ A;  3I76 A;  2PMZ C;  2Y9T A;  4DL4 A;  2QB0 A;  1L3V A;  3C28 A;  2V9W A;  5AKK A;  4C8O A;  2QLT A;  3G6X A;  3NRZ A;  2RDI A;  2W9C A;  3SV4 A;  4DQP A;  1U48 A;  3K75 D;  2F8K A;  2BCV A;  3WU2 U;  1TAU A;  4B9N A;  5EE1 A;  2YMM A;  2H3Z A;  3EWA A;  2R8H A;  4HYK A;  1KN5 A;  4Q44 A;  4J9K A;  3TFR A;  2IMW P;  2KZM A;  5DKW A;  3GIK A;  4BJQ A;  4Y2Q A;  9ICB A;  1SV0 A;  4OCZ A;  1X9X A;  2DBY A;  4UAU A;  1X66 A;  1HIW A;  1ZQR A;  1F44 A;  5DLG A;  1SB3 C;  8ICC A;  3RJG A;  1SL0 A;  5DLF A;  3N28 A;  2JV3 A;  4Q45 A;  2N1R A;  5AHX A;  4MEX A;  1Z3E B;  3C1Z A;  3RB4 A;  4TUQ A;  2FMS A;  3C2K A;  3MGI A;  2YML A;  3THV A;  2BGW A;  4PHE A;  2KFN A;  1F0M A;  4AP9 A;  3SEI A;  3D6J A;  4RPX A;  3GV5 B;  2UVW A;  4Y2P A;  2DUY A;  3ED5 A;  4I2G A;  4CCH A;  1ZQP A;  4KLH A;  4B9T A;  3NVW A;  5KG2 A;  1RYR A;  5JUM A;  2XO7 A;  4IQV A;  4P4M A;  2KIW A;  4Y2U A;  3QU2 A;  2G06 A;  4G3I A;  5BPC A;  7ICT A;  2WFA A;  4DOB A;  4UQG A;  4IC9 A;  2JH1 A;  3V7L A;  5J0R A;  4PHA A;  5KT7 A;  5IIM A;  4RT3 A;  1U49 A;  1S77 D;  1L5U A;  2PI5 A;  2OXO A;  1ZQV A;  2BPF A;  3RR8 A;  4NXZ A;  4RNO A;  4UB6 U;  1WWU A;  2ALZ A;  5KFZ A;  1J97 A;  5AKI A;  4DOA A;  3C5F A;  2HHS A;  8ICW A;  3M8S A;  4AYB C;  4QZB A;  2RP5 A;  2NRW A;  5DBC A;  4CF4 A;  5J0U A;  1VJ5 A;  4NLN A;  1ZET A;  5F9N A;  5DQH A;  3H7I A;  2W54 A;  3N7S C;  3PW4 A;  1ZD2 P;  3UMB A;  4MF8 A;  3Q8S B;  8ICQ A;  5DB8 A;  3TAQ A;  4KLS A;  2EZY A;  2Y9U A;  2QAR A;  4O3R A;  3T79 A;  2DFL A;  3B0X A;  8ICG A;  3H0M B;  2FPL A;  4R66 A;  4UW9 A;  4O3P A;  1N5X A;  5ALG A;  4EEN A;  3Q8L A;  3RJF A;  5J29 A;  4F3O A;  2O6K A;  3ZDE A;  1S0O A;  2JRZ A;  4CF5 A;  4I2D A;  5CRX A;  3RR7 A;  1XS9 D;  2BKE A;  1NK7 A;  4Z6D A;  3ZDA A;  4ICA A;  4Y2V A;  5J2K A;  9ICE A;  4QZH A;  3V6K A;  3SQI A;  4O0I A;  4LJX A;  3LWL A;  1D9D A;  1D8B A;  5KFQ A;  1ZQH A; 
#chains in the Genus database with same CATH homology
 3KZI U;  5TIS U;  5GTI U;  5GTH U;  1S5L U;  4IL6 U;  2DUY A;  5KAI U;  5KAF U;  4PJ0 U;  5B5E U;  2AXT U;  3A0H U;  4UB6 U;  5H2F U;  3A0B U;  5B66 U;  5E79 U;  4UB8 U;  3WU2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...