5KAIU

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 26
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5kaiU01
3A0BU 3KZIU 5H2FU 5B66U 3A0HU 4PJ0U 5KAFU 5E79U 5TISU 2AXTU 5GTHU 1S5LU 5GTIU 4UB8U 2DUYA 3WU2U 4IL6U 5KAIU 4UB6U 5B5EU
chains in the Genus database with same CATH superfamily
1L3SA 2MUTA 4YD2A 3OJSA 3MDCA 1S77D 3ED5A 3TADA 1MN8A 2JEFA 5IIKA 4U7CA 4B9SA 4I29A 1KN5A 3C23A 4RPYA 4ELUA 4RQ0A 2H3IA 3QE9Y 4GFJA 1ZJNA 1JROA 1ZQUA 2NO4A 3CYMA 2AGPA 5ALIA 2ZUBA 4QW9A 3BS5A 3IDWA 5ALZA 9ICCA 3KBBA 1ZQKA 2BPCA 2QKQA 3ZDAA 4RQ6A 4YVZA 2R8GA 1NOMA 4MFCA 3TANA 2WHEA 5ALNA 2R8JA 4PGXA 2OHFA 2IOFK 1DGSA 4FE3A 4F71A 1Q3VA 3WU2U 2LM1A 3SR6A 3RFAA 2C22A 1ZQGA 2EZXA 5J8YA 4MHVA 1Q8KA 2ZIVB 1PVPA 4EX6A 3LVWA 4QZBA 4KN4A 4AYBC 3NVVA 1S0OA 8ICJA 1HJPA 3BDPA 4DWIA 2KMDA 2JMGA 1NK7A 5ALFA 4R8UA 3WKAA 3H8JA 5J2KA 4YMOA 4U6PA 4EBDA 1C7YA 3SD7A 2ASLA 3VCBA 1SB3C 3QUQA 3PMNA 4O3PA 2KIVA 4UAYA 2YMPA 8ICYA 4OJLA 3FM9A 4F5RA 1OW5A 2K8BB 5KTQA 2HDOA 1ZOLA 5JUMA 4GXKA 1PUZA 5AKXA 2KP7A 1DXSA 4R65A 4NM2A 2HCFA 2K4EA 4Q44A 2PI4A 4C4TA 3KOOA 4Y2TA 3PSIA 1ZD5A 2IOFA 4HYKA 2ZUDA 1Z4NA 1WUDA 3PW0A 2OM6A 1IG6A 5J0XA 1ZD2P 5J0OA 2DFLA 3WKEA 3RBEA 2YMLA 1UHUA 3HILA 4JWNA 5ALXA 2J6UA 5HR7A 4C8OA 1RZTA 1NZPA 4IQWA 4EEKA 1IIPA 1AROP 3SENA 3RBDA 3F5EA 4YXJA 2W9MA 4KLDA 1XSPA 4FS1A 7ICRA 3MGIA 3QX7A 2AGQA 4ECZA 2LBOA 3RJGA 4RQMA 3NS1A 4O3QA 4QZAA 4UARA 5KG0A 3IRUA 5TZVA 1ZRMA 2BQUA 2AQ0A 3UPQA 5AK3A 2KZZA 2RQ5A 4DLGA 2FMQA 1YT3A 4RU9A 2PMZC 2KICA 3TI0A 3RJIA 2MRLA 3FYHA 1ZRNA 2HVHA 5AKJA 1F5SA 2OXOA 4BGDA 3IN5A 3TADC 3DV9A 4ED7A 4OJ5A 9ICJA 4DO9A 8ICAA 4BUGA 1FEZA 4TURA 3JPRA 5ALRA 5ALUA 2ZIXB 4FZMA 1S76D 4UB4A 3HPOA 2FMSA 2EH9A 3JPTA 1KFTA 2ZTEA 2GLEA 4M47A 1L3VA 4RQ3A 1X2IA 1M6YA 5KFQA 3B0YA 1SGGA 1JUDA 7ICSA 4NWIA 4ECRA 3Q8QB 2FMPA 3RJEA 4I2HA 5J8YC 4F3OA 4DQPA 4ECTA 5CHGA 5AKEA 1KLNA 2HHTA 2RDJA 1A6SA 5ALSA 5KG3A 2W9BB 1DGJA 4BDPA 3JPQA 2ZJAA 1FO4A 2V4RA 2W7PA 1KRPA 3IV6A 1RXWA 2HSZA 4ED8A 8ICPA 1CRXA 2AU0A 2NRZA 3SEIA 3EW9A 3WK7A 4EBEA 3QU4A 4RQ1A 1X9WA 1IV8A 2AXTU 2GOLA 2MSNA 8ICLA 9ICQA 4Y2XA 2LHTA 2RP5A 1N56A 4KN7A 4J9OA 3Q8RB 2GWSA 2ZXHA 4J9RA 1Z1BA 9ICSA 5J2HA 4HAIA 5AKHA 2HOQA 4NLBA 4IRKA 2W9CB 4MFAA 5AKZA 1U45A 3ISBA 1VJ5A 2WF5A 2LPEA 4B9MA 2ZIUB 3NVWA 5DDYA 4PHAA 3HKZF 2VJ4A 5EE9A 4LZDA 3JPOA 2W54A 1DOQA 3ZDEA 1B4FA 3ZDCA 5DQHA 1T3QA 3SQIA 4ECYA 5GTHU 3GIJA 3AUOA 1U49A 2XI9A 4FFDA 5AI4A 4F93B 4OCZA 4RNNA 1EXNA 2P6RA 1JN3A 2F76X 4J9LA 4B9LA 3KHHA 1U48A 1COOA 5TISU 2JEGA 4O9MA 1UPHA 5AM4A 2VANA 3WK5A 5AM3A 1L8LA 2HOFA 1LKYB 2R18A 1S10A 3S6JA 2PXIA 1S9FA 4UBCA 1TAQA 2KSOB 2LYAA 2W3RA 2KJ5A 4O5CA 9ICUA 1BVSA 3PY8A 2PFOA 3UMCA 2JZBA 4GLXA 1UA1A 1JIHA 9ICXA 3AU2A 3RJJA 5ALWA 1S0NA 5AKKA 4F5NA 1QCKA 2RRDA 1C20A 4F5PA 4PL2A 3J81j 1O03A 4F4ZA 3L3FX 1J2NA 5ALVA 5J0PA 2XCAA 4YXMA 2Y9TA 2Z7JA 2XGPA 4US8A 1QQ6A 2ESEA 1FFUA 3QU7A 4USAA 1BPEA 5KFDA 4DS5A 4IQTA 4QWBA 1SZPA 5DG8A 1Q3UA 3D2QA 2BPFA 8ICHA 1XO1A 5AI6A 1Z19A 2ZUCA 1T94A 1XSLA 3B9JA 1Q46A 2E1FA 2E5SA 3OSPA 2G09A 4EZ9A 1Z3EB 4BJQA 5EE1A 2KJ8A 1ZQDA 5J0YA 2JHDA 5F9NA 4RNOA 3PW2A 3H8WA 4PPXA 3MR6A 5G5GA 2IMWP 3PX6A 2Y0SC 4F8RA 2BQRA 5KT3A 2Y1JA 1KW4A 2A3VA 3T5KA 2WAQF 4JV2A 4RQ2A 3F2DA 9ICMA 5AIBA 8ICUA 1S0MA 3M9OB 4I2DA 2JGAA 2JV3A 2LM4A 4OJ6A 3RTVA 4ICAA 5CA7A 1N62A 4UB5A 1ZQRA 1XWLA 4B9VA 2XCPA 4JB3A 3TKAA 8ICZA 2WF8A 1ZQLA 4M9JA 1X66A 4ED0A 4K4GA 4G3IA 5J2BA 3TFSA 4QZFA 1TKDA 4DSKA 3C21A 2NRXA 4G9BA 4UBBA 4ECSA 4QW8A 2H3ZA 8ICVA 3V6HA 3SV4A 2HHVA 7ICFA 4RQ4A 2KZMA 5AIAA 5CP2A 3KHRA 2CPRA 1U9LA 3E0FA 5AI9A 2GH1A 1N5XA 5KFYA 1NJYA 1JXLA 1ZQHA 3MC1A 2Q4TA 1IM4A 4CF5A 1TE2A 1PK1B 2WF6A 1DK3A 3PSFA 2G5HB 2KEYA 3H8SA 5DG7A 3IG5A 3SZ2A 4J03A 1TK0A 1A0PA 5GTIU 3IM1A 3E2EA 1YZ7A 2F1JA 1ZQZA 4YCXA 4B6JA 4DL6A 2KFZA 5AK5A 2CXYA 1LB2B 4DFKA 5KAIU 4OD0A 2BHNA 3UXNA 4QZHA 1TV9A 3TFRA 1L3TA 3NVZA 2ZTDA 1ZQEA 3RR8A 3T79A 8ICGA 1V9PA 4BXOB 5B66U 4F5QA 2YN4A 7ICOA 3IG8A 4C8KA 4O3NA 1F44A 1JMSA 1QQ5A 2MUTB 2BCSA 1SKWA 5KFFA 1ZQNA 3ZDBA 3L4PA 1X9MA 1N61A 5DG9A 4IR9A 4Z6EA 4ZOHC 2HMXA 4M9HA 3PO5A 1ED1A 1UQVA 3C2MA 4EX7A 2KG5A 5AI5A 4DL4A 4PHEA 5AI0A 2A19A 4YFKA 3BS5B 4Y2YA 2EAOA 7ICTA 4KX3A 2W03A 5ALLA 2I5HA 4R63A 2HBKA 5F9LA 4UAZA 1KBUA 2LI6A 3RF9A 2AGOA 2JH7A 5B5EU 3A0BU 4BWJA 2AH5A 1JX4A 4F4KA 9ICLA 2A1AA 1N48A 1KFSA 1K1SA 1D9DA 4BWMA 4KLHA 5DB9A 4EENA 5L1JA 3LK9A 1L7PA 1ZD4A 4QWAA 1UT8A 1NJXA 2C2RA 4M0AA 4YQWA 2IHMA 4EZ6A 3KFUF 3AQFA 4R8UB 5CR0A 4F92B 8ICKA 3KHLA 2RDIA 5J2EA 5AICA 5DGBA 3MDAA 2XICA 1XNSA 9ICNA 9ICIA 1JI7A 4QWDA 1SXEA 3TARA 2E1EA 4CRXA 1UA0A 2H5XA 4FS2A 5HP4A 4QZ8A 5IIIA 1SL1A 3ISCA 1COKA 3B0XA 2P66A 2KKPA 2XVTA 3LVVA 3V6KA 2PKEA 3MR3A 3HRDD 4RQ8A 1ZQSA 5HMMA 4NLGA 2DF4B 4Z6FA 3QNMA 1YZ6A 5A0LA 3BJYA 4ECVA 2HHWA 3U26A 5EOZA 3RJHA 4ED6A 3Q8KA 4F4YA 2KHQA 2PMZF 2VA8A 3CRXA 8ICTA 4DQQA 3QEAZ 3WK4A 2HHXA 5ALMA 2JH1A 5KFKA 4GXJA 4B9NA 1RYSA 4UAVA 2HHSA 8ICMA 2F77X 2VA2A 3MBYA 4ED1A 4KLJA 4Y2VA 2JEIA 1URJA 3GV7B 2J6TA 2K4IA 1NKCA 4AP9A 2DBYA 2ZIWA 4Y2SA 8ICFA 2R8KA 4KLUA 8ICWA 3IHQB 5KFMA 4FZLA 3KHGA 2YB4A 4TUQA 1QLNA 1RM6C 3C1ZA 3G6XA 5EE3A 5KFLA 5KFTA 5KG1A 3LDAA 4IQVA 4I2JA 4DS4A 1VDVA 4M04A 3EWAA 4DL2A 5KFAA 1XO0A 2I9GA 5ALJA 2E8NA 4F5OA 7ICPA 1L7MA 3PSPA 5DB8A 4DCCA 4KLTA 5AKIA 3LYSA 3MR2A 7ICLA 9ICEA 9ICHA 2G5IB 4FO6A 2F44A 3I1YA 2JR5A 5KG5A 1J2MA 4NJ8A 7ICGA 3I28A 2KNJA 1AQ6A 3ETLA 2DKZA 1B43A 4K4HA 2KE7A 2WB1C 8ICCA 1S5LU 4PL1A 4CF4A 4DQRA 2JEJA 2ES6A 4KLEA 4TQSA 1CEZA 3V6JA 2EANA 3KKAC 1JALA 5ALHA 3SMVA 1J97A 4P0QB 4I2CA 1Z1VA 4R66A 5EWEA 4YMMA 3VC8A 3DEEA 3Q8PB 3Q8LA 2K8CB 4Y2PA 5HHHA 2FLPA 1UT5A 3OHBA 3C28A 3M1YA 2P6UA 5F3XB 4RUAA 1ZQYA 2LMRA 9ICGA 3C1YA 9ICFA 3M8SA 4ECXA 3THVA 4UAUA 5ALYA 9ICVA 1OUQA 2AHOB 2XY5A 2FPLA 3V7KA 2WF7A 5DB6A 4PZOA 4UB3A 5L1KA 1MQ3A 4PH5A 1JRPA 2H3FA 4P0QA 2OCEA 1V38A 5KG2A 2G0AA 1ZQXA 3MGVA 4PGQA 4DL3A 2W3SA 1KKXA 4RPZA 4BX9C 4K4IA 4J9SA 2BQ3A 5FP0A 3MR5A 1KL9A 5ALOA 2XO7A 1X9SA 4O3SA 5DQIA 3WKDA 2IHNA 5HHIA 1LVHA 2Q0ZX 2ATLA 3MFHA 1D8LA 4KLIA 4WJ3B 3OGUA 1SKSA 4DL5A 3PZPA 2YX8A 4EYIB 1WCLA 3T3FA 3GFKB 3R9KA 1GO3F 4IRCA 1U47A 2K8AA 4C8NA 1WG8A 5KL1B 4KLSA 3OHAA 3Q8SB 1ZQFA 2UVUA 3SI8A 1PVRA 3AN1A 1ZQAA 5BPCA 2E8PA 5AHXA 1K1QA 2DL0A 2OEHA 3KTQA 4C8LA 4RQ5A 1SL2A 5H2FU 3GIKA 1KEJA 3QXGA 1RPLA 4NM1A 1KDHA 3SYZA 1S0VA 2D8CA 2JZBB 5JTIA 2WFAA 2BCRA 2F8KA 5KFWA 3V7JA 4FZNA 2FE9A 3H0LB 3ETRA 3AQEA 1NK0A 2K60A 3FDSA 2KV2A 5ALPA 7ICHA 4KLMA 3L5KA 3UQ2A 3HX0A 2QARA 4PJ0U 3PW4A 2PI5A 2FPKA 3T5HA 3LWLA 7ICVA 4QIWF 1ZQPA 2BCVA 4Q8EA 2NRVA 3EZ5A 3RR7A 2NRWA 2W8KA 1NJZA 2CN1A 3NRWA 1SXDA 1XS9D 1A77A 4JK1A 2DPIA 1DRGA 4MF2A 4I2AA 8ICEA 4DFDA 4DOAA 2QB1A 5DLGA 2K4HA 5C5JA 3CNHA 2Y0SF 1N5WA 4ECWA 1ZQCA 9ICAA 3SAFA 4IR1A 2ALZA 1BPXA 1WWUA 2F3NA 1SWWA 4QZDA 4Q45A 4RT3A 3D6JA 2W55A 2H3QA 3BZKA 3H0MB 3PW5A 2H3VA 2HBLA 3BQTA 7ICQA 2EQYA 4I2EA 2YQEA 2BR0A 3CP8A 4KLLA 3UQ0A 3ORYA 2Y1IA 4C8MA 1NKBA 4PHDA 5AM0A 1NNLA 3FC4A 5CEHA 3BQ0A 1BNPA 5L1MA 3ZD8A 4QZ9A 1TVAA 4ED3A 1L8OA 4J9NA 4ED2A 3QUBA 3NGDA 4LJXA 3SV3A 1ZQ1C 4ELVA 4M6WA 3RAQA 3V72A 5KFHA 4YR0A 1KSPA 2LYHA 1PK3A 7ICUA 2HI0A 2I1QA 2B21A 1QTMA 4Q8FA 2ZXIA 2OH2A 2EAMA 5AKLA 2UVWA 2MU2A 3TACB 1MC8A 2LYBA 4RUCA 3PSTA 4US9A 4DOBA 3F5AA 4NLNA 2AJQA 4NY8A 1T8EA 4MEYA 5EWFA 3WK6A 7ICIA 4F2RA 3T5LA 1U4BA 5DQGA 2FLNA 5KFZA 3M9MB 4CGZA 4P4MA 3PNCA 4NLKA 4IRDA 1BPBA 3H0RB 5KFRA 4TQRA 1L7OA 3V7LA 1B0XA 1IXRA 4EELA 1FIQA 2W9AA 1H38A 4J9MA 5HR6A 2W7OA 9ICTA 2V4QA 4Y2QA 3ZDDA 4IL6U 4B9TA 2W04A 2ZG6A 4LZGA 2NRTA 3EPIA 4KX5A 3RJKA 9ICRA 5KFVA 1F0MA 5J2IA 3C5FA 3TAQA 5ALKA 3D2NA 5KFNA 5CB1A 5EWGA 4DQIA 3EPGA 1ZXIA 4CNQA 1RQLA 2IOHA 1N60A 3K4GA 2IBKA 2OWOA 4QNLA 1SWVA 4NL9C 9ICWA 4EEYA 5AM5A 3EYZA 3HWTA 4C4RA 3PW7A 1MQ2A 1KQQA 3N28A 1KFDA 2XIDA 2QB0B 4OJOA 2HBMA 1TAUA 4UW9A 3NASA 4P4PA 8ICNA 2PFNA 3RAXA 1A76A 4ECQA 2XY6A 4RQ7A 4YN4A 1BPYA 3OJUA 1SV0C 3PVXA 2YY6A 3GV8B 1S97A 3F2CA 1D8BA 3WK8A 3C2KA 2VIXA 2VA3A 5KG4A 4TUSA 4AYBF 5AK4A 4J9QA 4F4XA 3AU6A 2N1RA 4JMUA 1NK4A 3T5JA 2QB0A 3Q8MA 2R8HA 5J0QA 5J2DA 2W11A 1RQNA 2RHFA 4GXIA 2W43A 1ZQQA 5AKYA 1ZQTA 5L1LA 2D3DA 4I27A 3SAHA 1NK6A 3KKAA 1NZBA 1ZQVA 3F2BA 2ZJ8A 1TK8A 1HEKA 4EBCA 4J9PA 2BZFA 4NLZA 1T3NA 3OSNA 4I2FA 1RG6A 5L1IA 1T7PA 4YMNA 4DFMA 3KZIU 3PMLA 2BKEA 5CRXA 4RZRA 3C29A 5DBCA 1OXJA 2Y9UA 4M9LA 4DOCA 2ASDA 5HMLA 5DLFA 4FBUA 2A1JA 3JPPA 1FFVA 2QLTA 4RQNA 1WYGA 5IIMA 2EDUA 3M7DA 2BCUA 2F1IA 2ZJ5A 4Y2UA 2UVRA 4O0IA 2FJ6A 3H7IA 3UMBA 2BCQA 3D2SA 1Z4OA 2NV3A 2ZIWB 3N7SC 3G6VA 4QZEA 2ISPA 2FDRA 3FAHA 1NK8A 2E3TA 5KFXA 2L5YA 1TK5A 8ICQA 1X6JA 5J2AA 5KFOA 1CUKA 5DB7A 3MABA 1WWVA 1ZETA 3GU3A 2NO5A 3ONNA 3N97B 2WB1F 1ZQJA 1SKRA 3QUCA 3ISDA 5DDMA 2BPGA 2E8OA 2KIWA 3K75D 1DK2A 3A0HU 2HOIA 5KL8B 3GZFA 1HUZA 2NYVA 9ICKA 3HT3A 2ZIVA 3GV5B 1X40A 4ECUA 2R8IA 2KKVA 3MFIA 8ICSA 4C80A 2M9NA 5G5HA 5J2CA 3RRGA 2JXJA 2F2AB 4UASA 4A8EA 4QWEA 3RB0A 3UM9A 2BDUA 3KZXA 3F53A 4IS7A 4PHPA 5J2GA 3PR5B 4KLQA 4UQGA 4YR3A 3I76A 2DQNB 1QSYA 3G6YA 2GO7A 2DKXA 4UB8U 4P4OA 2VJ5A 2C2EA 1SZHA 2PFPA 1K5OA 1ZQWA 5D4BA 3BQ1A 2C28A 4I2GA 2EZYA 2C2DA 4CCHA 2IA6A 2HHQA 3AMZA 4MEXA 5ALTA 3WKBA 4OO1J 1XC9A 4O3OA 3QU2A 5DBAA 2DUYA 5AKGA 4P0PB 5KG7A 4XA5A 3ICXA 3SAGA 3WKCA 2D6FC 2W8LA 1T4GA 5KT4A 7ICKA 3NUQA 1PZNA 2KTQA 3OPXA 5D46A 4CDGA 2PFQA 3K1ZA 3QUTA 2O6KA 4O5EA 4F91B 4ELTA 2YB1A 1ZD3A 5IIJA 5JU5A 5C0YA 3HJEA 2CRXA 3PX0A 4DF4A 4P0PA 3MGHA 3ZI4A 1LV5A 4XRHA 8ICBA 4MFFA 1SIJA 4M9GA 5KFSA 3WK9A 3QZ8A 1RYRA 5KFJA 4XUSA 4QZCA 3E58A 4M9NA 4E0DA 3HP6A 2KVSA 1JXEA 3PV8A 4JWMA 5ALDA 4YG2A 3RJFA 2I6XA 2ZIXA 9ICBA 3H8MA 1XSNA 3AEVA 2BGWA 4YR2A 4RT2A 4X5VA 4DLEA 3BS7A 8ICIA 2KFNA 3PR4A 5KG6A 3M8RA 4DSEA 1HIWA 3RH5A 3DDHA 4F72A 3ZD9A 3JPSA 5J2FA 5AI8A 4DL7A 1BNOA 2B6GA 5KFBA 5J0SA 2DPJA 1X42A 4F50A 3K1RB 2E8MA 1S8OA 3O0FA 1VLBA 2QARB 4Q43A 2YMMA 3UMGA 3H40A 3AL0B 4I2IA 2W9BA 5KFCA 2G07A 2YMQA 5AM2A 1NI3A 1Y88A 4C7YA 2G08A 4KITB 1ZQBA 3M9NB 3UXPA 3RH4A 2FI1A 4CE6A 4Z6CA 3UXOA 3AM9A 3LWMA 3H4DA 4GC7A 4M2YA 4JV1A 1B22A 4DSIA 1N2XA 5J0TA 3KD3A 5KFEA 2WTFA 4NV0A 4KMOB 1NK5A 4DQSA 1ZYQA 2KHVA 3CW2C 5J2JA 4R64A 2UVVA 4GC6A 3NVYA 2W9CA 8ICRA 5L9XA 4NL9A 1BPDA 4IC9A 4LVSA 5KT5A 4NXZA 3H4BA 1MA7A 4UAWA 2FPMA 3PX4A 2ZIUA 3IP4B 4MF8A 3OTQA 5HNKA 2RLTA 1L7NA 1L5UA 3N7RC 5T14A 4O3MA 3GIMA 4Y2RA 2G06A 4TUPA 4B9UA 4M6WB 2HVIA 4DSJA 3QU5A 4NLCA 1BPZA 2YTUA 1SV0A 5BOLA 2VKQA 2KOBA 2OYYA 1BGXT 4KLFA 2BDPA 3C5GA 5D49A 3HKZC 4RNMA 1ZQMA 1WCNA 1ZQOA 2ASJA 5DGAA 2ISOA 5IILA 1L3UA 3TAPA 4RPXA 2DGZA 3C2LA 5AK6A 4Y2JA 5KFPA 3RB6A 1LKYA 8ICOA 4DEZA 2KZ3A 3QEBZ 3NRZA 5IIOA 3BQ2A 9ICPA 2K89A 2KSOA 2M0NA 1NJWA 5DKWA 2KK0A 5ALGA 5KFGA 3N4MB 4UB2A 2LKYA 5CWRA 5K4LA 2EZZA 4I28A 3QZ7A 5JRTA 4UATA 4Z6DA 1P7DA 2KD1A 1SV4A 2V9WA 4QJFB 2K4PA 5BOMA 3JPNA 2HBJA 4QZIA 4QIWC 5J29A 5J0RA 3RH6A 5J0WA 5ALEA 1RXVA 1NK9A 2MA1A 3ALRA 5DBBA 4FBTA 3M6ZA 3EUB2 3BZCA 1QH9A 1D8YA 1RDFA 4PZNA 3GILA 2F1HA 2ZTCA 2FLLA 9ICOA 3RB3A 5IINA 1ECWA 4KTQA 5KAFU 4CF3A 4DSLA 2P35A 2EAPA 1TFRA 1ZQIA 7ICMA 1TAMA 1ZJMA 2WF9A 3BQ7A 5AM1A 2B0CA 4DFPA 1V97A 4QZGA 1QSSA 4QWCA 2MAXA 1QSLA 4DFJA 4C7ZA 1X9XA 3GDXA 1Z00B 3RRHA 5KT7A 4O5KA 2XGQA 1N63A 2HHUA 1MSWD 1D9FA 3N7PD 4XQ8A 3GIIA 3M6KA 3HW8A 3PO4A 7ICNA 4IQUA 1HUOA 2KN7A 1SL0A 5KNIA 2AQ4A 4DSFA 5E79U 1RYUA 4GIBA 7ICEA 1O08A 4YD1A 1L6NA 1CI4A 4ZH4A 3GQCA 4EYHB 2JRZA 2WAQC 2F8LA 1Z00A 4PGYA 5J0UA 3QYPA 5KT6A 2ODGA 4UB1A 5KFIA 4JUZA 3NTUA 4KLGA 4KMUA 2KJ9A 4I2BA 1PK1A 4OJPA 4C4SA 8ICXA 4KLOA 4JV0A 3TQ1A 2KVCA 2XY7A 1QQ7A 4UB6U 1UCVA 4C0ZA 5CJ7A 5KFUA 4O3RA 1X6IA 4F4WA 4ACOA 4DF8A 3RB4A 1NKEA 2DWQA 4YP3A 3QU9A 2XC9A 4J9KA 1KTQA 2A1JB 7ICJA 5EE0A 1PVQA 4BXOA 5KT2A 2J6SA 4F2SA 2HW3A 1V85A 1XU4A 5ALQA 4P2HA
chains in the Genus database with same CATH topology
3A0BU 3KZIU 5H2FU 5B66U 3A0HU 4PJ0U 5KAFU 5E79U 5TISU 2AXTU 5GTHU 1S5LU 5GTIU 4UB8U 2DUYA 3WU2U 4IL6U 5KAIU 4UB6U 5B5EU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B U;  3KZI U;  5H2F U;  5B66 U;  3A0H U;  4PJ0 U;  5KAF U;  5E79 U;  5TIS U;  2AXT U;  5GTH U;  1S5L U;  5GTI U;  4UB8 U;  2DUY A;  3WU2 U;  4IL6 U;  5KAI U;  4UB6 U;  5B5E U; 
#chains in the Genus database with same CATH topology
 1L3S A;  2MUT A;  4YD2 A;  3OJS A;  3MDC A;  1S77 D;  3ED5 A;  3TAD A;  1MN8 A;  2JEF A;  5IIK A;  4U7C A;  4B9S A;  4I29 A;  1KN5 A;  3C23 A;  4RPY A;  4ELU A;  4RQ0 A;  2H3I A;  3QE9 Y;  4GFJ A;  1ZJN A;  1JRO A;  1ZQU A;  2NO4 A;  3CYM A;  2AGP A;  5ALI A;  2ZUB A;  4QW9 A;  3BS5 A;  3IDW A;  5ALZ A;  9ICC A;  3KBB A;  1ZQK A;  2BPC A;  2QKQ A;  3ZDA A;  4RQ6 A;  4YVZ A;  2R8G A;  1NOM A;  4MFC A;  3TAN A;  2WHE A;  5ALN A;  2R8J A;  4PGX A;  2OHF A;  2IOF K;  1DGS A;  4FE3 A;  4F71 A;  1Q3V A;  3WU2 U;  2LM1 A;  3SR6 A;  3RFA A;  2C22 A;  1ZQG A;  2EZX A;  5J8Y A;  4MHV A;  1Q8K A;  2ZIV B;  1PVP A;  4EX6 A;  3LVW A;  4QZB A;  4KN4 A;  4AYB C;  3NVV A;  1S0O A;  8ICJ A;  1HJP A;  3BDP A;  4DWI A;  2KMD A;  2JMG A;  1NK7 A;  5ALF A;  4R8U A;  3WKA A;  3H8J A;  5J2K A;  4YMO A;  4U6P A;  4EBD A;  1C7Y A;  3SD7 A;  2ASL A;  3VCB A;  1SB3 C;  3QUQ A;  3PMN A;  4O3P A;  2KIV A;  4UAY A;  2YMP A;  8ICY A;  4OJL A;  3FM9 A;  4F5R A;  1OW5 A;  2K8B B;  5KTQ A;  2HDO A;  1ZOL A;  5JUM A;  4GXK A;  1PUZ A;  5AKX A;  2KP7 A;  1DXS A;  4R65 A;  4NM2 A;  2HCF A;  2K4E A;  4Q44 A;  2PI4 A;  4C4T A;  3KOO A;  4Y2T A;  3PSI A;  1ZD5 A;  2IOF A;  4HYK A;  2ZUD A;  1Z4N A;  1WUD A;  3PW0 A;  2OM6 A;  1IG6 A;  5J0X A;  1ZD2 P;  5J0O A;  2DFL A;  3WKE A;  3RBE A;  2YML A;  1UHU A;  3HIL A;  4JWN A;  5ALX A;  2J6U A;  5HR7 A;  4C8O A;  1RZT A;  1NZP A;  4IQW A;  4EEK A;  1IIP A;  1ARO P;  3SEN A;  3RBD A;  3F5E A;  4YXJ A;  2W9M A;  4KLD A;  1XSP A;  4FS1 A;  7ICR A;  3MGI A;  3QX7 A;  2AGQ A;  4ECZ A;  2LBO A;  3RJG A;  4RQM A;  3NS1 A;  4O3Q A;  4QZA A;  4UAR A;  5KG0 A;  3IRU A;  5TZV A;  1ZRM A;  2BQU A;  2AQ0 A;  3UPQ A;  5AK3 A;  2KZZ A;  2RQ5 A;  4DLG A;  2FMQ A;  1YT3 A;  4RU9 A;  2PMZ C;  2KIC A;  3TI0 A;  3RJI A;  2MRL A;  3FYH A;  1ZRN A;  2HVH A;  5AKJ A;  1F5S A;  2OXO A;  4BGD A;  3IN5 A;  3TAD C;  3DV9 A;  4ED7 A;  4OJ5 A;  9ICJ A;  4DO9 A;  8ICA A;  4BUG A;  1FEZ A;  4TUR A;  3JPR A;  5ALR A;  5ALU A;  2ZIX B;  4FZM A;  1S76 D;  4UB4 A;  3HPO A;  2FMS A;  2EH9 A;  3JPT A;  1KFT A;  2ZTE A;  2GLE A;  4M47 A;  1L3V A;  4RQ3 A;  1X2I A;  1M6Y A;  5KFQ A;  3B0Y A;  1SGG A;  1JUD A;  7ICS A;  4NWI A;  4ECR A;  3Q8Q B;  2FMP A;  3RJE A;  4I2H A;  5J8Y C;  4F3O A;  4DQP A;  4ECT A;  5CHG A;  5AKE A;  1KLN A;  2HHT A;  2RDJ A;  1A6S A;  5ALS A;  5KG3 A;  2W9B B;  1DGJ A;  4BDP A;  3JPQ A;  2ZJA A;  1FO4 A;  2V4R A;  2W7P A;  1KRP A;  3IV6 A;  1RXW A;  2HSZ A;  4ED8 A;  8ICP A;  1CRX A;  2AU0 A;  2NRZ A;  3SEI A;  3EW9 A;  3WK7 A;  4EBE A;  3QU4 A;  4RQ1 A;  1X9W A;  1IV8 A;  2AXT U;  2GOL A;  2MSN A;  8ICL A;  9ICQ A;  4Y2X A;  2LHT A;  2RP5 A;  1N56 A;  4KN7 A;  4J9O A;  3Q8R B;  2GWS A;  2ZXH A;  4J9R A;  1Z1B A;  9ICS A;  5J2H A;  4HAI A;  5AKH A;  2HOQ A;  4NLB A;  4IRK A;  2W9C B;  4MFA A;  5AKZ A;  1U45 A;  3ISB A;  1VJ5 A;  2WF5 A;  2LPE A;  4B9M A;  2ZIU B;  3NVW A;  5DDY A;  4PHA A;  3HKZ F;  2VJ4 A;  5EE9 A;  4LZD A;  3JPO A;  2W54 A;  1DOQ A;  3ZDE A;  1B4F A;  3ZDC A;  5DQH A;  1T3Q A;  3SQI A;  4ECY A;  5GTH U;  3GIJ A;  3AUO A;  1U49 A;  2XI9 A;  4FFD A;  5AI4 A;  4F93 B;  4OCZ A;  4RNN A;  1EXN A;  2P6R A;  1JN3 A;  2F76 X;  4J9L A;  4B9L A;  3KHH A;  1U48 A;  1COO A;  5TIS U;  2JEG A;  4O9M A;  1UPH A;  5AM4 A;  2VAN A;  3WK5 A;  5AM3 A;  1L8L A;  2HOF A;  1LKY B;  2R18 A;  1S10 A;  3S6J A;  2PXI A;  1S9F A;  4UBC A;  1TAQ A;  2KSO B;  2LYA A;  2W3R A;  2KJ5 A;  4O5C A;  9ICU A;  1BVS A;  3PY8 A;  2PFO A;  3UMC A;  2JZB A;  4GLX A;  1UA1 A;  1JIH A;  9ICX A;  3AU2 A;  3RJJ A;  5ALW A;  1S0N A;  5AKK A;  4F5N A;  1QCK A;  2RRD A;  1C20 A;  4F5P A;  4PL2 A;  3J81 j;  1O03 A;  4F4Z A;  3L3F X;  1J2N A;  5ALV A;  5J0P A;  2XCA A;  4YXM A;  2Y9T A;  2Z7J A;  2XGP A;  4US8 A;  1QQ6 A;  2ESE A;  1FFU A;  3QU7 A;  4USA A;  1BPE A;  5KFD A;  4DS5 A;  4IQT A;  4QWB A;  1SZP A;  5DG8 A;  1Q3U A;  3D2Q A;  2BPF A;  8ICH A;  1XO1 A;  5AI6 A;  1Z19 A;  2ZUC A;  1T94 A;  1XSL A;  3B9J A;  1Q46 A;  2E1F A;  2E5S A;  3OSP A;  2G09 A;  4EZ9 A;  1Z3E B;  4BJQ A;  5EE1 A;  2KJ8 A;  1ZQD A;  5J0Y A;  2JHD A;  5F9N A;  4RNO A;  3PW2 A;  3H8W A;  4PPX A;  3MR6 A;  5G5G A;  2IMW P;  3PX6 A;  2Y0S C;  4F8R A;  2BQR A;  5KT3 A;  2Y1J A;  1KW4 A;  2A3V A;  3T5K A;  2WAQ F;  4JV2 A;  4RQ2 A;  3F2D A;  9ICM A;  5AIB A;  8ICU A;  1S0M A;  3M9O B;  4I2D A;  2JGA A;  2JV3 A;  2LM4 A;  4OJ6 A;  3RTV A;  4ICA A;  5CA7 A;  1N62 A;  4UB5 A;  1ZQR A;  1XWL A;  4B9V A;  2XCP A;  4JB3 A;  3TKA A;  8ICZ A;  2WF8 A;  1ZQL A;  4M9J A;  1X66 A;  4ED0 A;  4K4G A;  4G3I A;  5J2B A;  3TFS A;  4QZF A;  1TKD A;  4DSK A;  3C21 A;  2NRX A;  4G9B A;  4UBB A;  4ECS A;  4QW8 A;  2H3Z A;  8ICV A;  3V6H A;  3SV4 A;  2HHV A;  7ICF A;  4RQ4 A;  2KZM A;  5AIA A;  5CP2 A;  3KHR A;  2CPR A;  1U9L A;  3E0F A;  5AI9 A;  2GH1 A;  1N5X A;  5KFY A;  1NJY A;  1JXL A;  1ZQH A;  3MC1 A;  2Q4T A;  1IM4 A;  4CF5 A;  1TE2 A;  1PK1 B;  2WF6 A;  1DK3 A;  3PSF A;  2G5H B;  2KEY A;  3H8S A;  5DG7 A;  3IG5 A;  3SZ2 A;  4J03 A;  1TK0 A;  1A0P A;  5GTI U;  3IM1 A;  3E2E A;  1YZ7 A;  2F1J A;  1ZQZ A;  4YCX A;  4B6J A;  4DL6 A;  2KFZ A;  5AK5 A;  2CXY A;  1LB2 B;  4DFK A;  5KAI U;  4OD0 A;  2BHN A;  3UXN A;  4QZH A;  1TV9 A;  3TFR A;  1L3T A;  3NVZ A;  2ZTD A;  1ZQE A;  3RR8 A;  3T79 A;  8ICG A;  1V9P A;  4BXO B;  5B66 U;  4F5Q A;  2YN4 A;  7ICO A;  3IG8 A;  4C8K A;  4O3N A;  1F44 A;  1JMS A;  1QQ5 A;  2MUT B;  2BCS A;  1SKW A;  5KFF A;  1ZQN A;  3ZDB A;  3L4P A;  1X9M A;  1N61 A;  5DG9 A;  4IR9 A;  4Z6E A;  4ZOH C;  2HMX A;  4M9H A;  3PO5 A;  1ED1 A;  1UQV A;  3C2M A;  4EX7 A;  2KG5 A;  5AI5 A;  4DL4 A;  4PHE A;  5AI0 A;  2A19 A;  4YFK A;  3BS5 B;  4Y2Y A;  2EAO A;  7ICT A;  4KX3 A;  2W03 A;  5ALL A;  2I5H A;  4R63 A;  2HBK A;  5F9L A;  4UAZ A;  1KBU A;  2LI6 A;  3RF9 A;  2AGO A;  2JH7 A;  5B5E U;  3A0B U;  4BWJ A;  2AH5 A;  1JX4 A;  4F4K A;  9ICL A;  2A1A A;  1N48 A;  1KFS A;  1K1S A;  1D9D A;  4BWM A;  4KLH A;  5DB9 A;  4EEN A;  5L1J A;  3LK9 A;  1L7P A;  1ZD4 A;  4QWA A;  1UT8 A;  1NJX A;  2C2R A;  4M0A A;  4YQW A;  2IHM A;  4EZ6 A;  3KFU F;  3AQF A;  4R8U B;  5CR0 A;  4F92 B;  8ICK A;  3KHL A;  2RDI A;  5J2E A;  5AIC A;  5DGB A;  3MDA A;  2XIC A;  1XNS A;  9ICN A;  9ICI A;  1JI7 A;  4QWD A;  1SXE A;  3TAR A;  2E1E A;  4CRX A;  1UA0 A;  2H5X A;  4FS2 A;  5HP4 A;  4QZ8 A;  5III A;  1SL1 A;  3ISC A;  1COK A;  3B0X A;  2P66 A;  2KKP A;  2XVT A;  3LVV A;  3V6K A;  2PKE A;  3MR3 A;  3HRD D;  4RQ8 A;  1ZQS A;  5HMM A;  4NLG A;  2DF4 B;  4Z6F A;  3QNM A;  1YZ6 A;  5A0L A;  3BJY A;  4ECV A;  2HHW A;  3U26 A;  5EOZ A;  3RJH A;  4ED6 A;  3Q8K A;  4F4Y A;  2KHQ A;  2PMZ F;  2VA8 A;  3CRX A;  8ICT A;  4DQQ A;  3QEA Z;  3WK4 A;  2HHX A;  5ALM A;  2JH1 A;  5KFK A;  4GXJ A;  4B9N A;  1RYS A;  4UAV A;  2HHS A;  8ICM A;  2F77 X;  2VA2 A;  3MBY A;  4ED1 A;  4KLJ A;  4Y2V A;  2JEI A;  1URJ A;  3GV7 B;  2J6T A;  2K4I A;  1NKC A;  4AP9 A;  2DBY A;  2ZIW A;  4Y2S A;  8ICF A;  2R8K A;  4KLU A;  8ICW A;  3IHQ B;  5KFM A;  4FZL A;  3KHG A;  2YB4 A;  4TUQ A;  1QLN A;  1RM6 C;  3C1Z A;  3G6X A;  5EE3 A;  5KFL A;  5KFT A;  5KG1 A;  3LDA A;  4IQV A;  4I2J A;  4DS4 A;  1VDV A;  4M04 A;  3EWA A;  4DL2 A;  5KFA A;  1XO0 A;  2I9G A;  5ALJ A;  2E8N A;  4F5O A;  7ICP A;  1L7M A;  3PSP A;  5DB8 A;  4DCC A;  4KLT A;  5AKI A;  3LYS A;  3MR2 A;  7ICL A;  9ICE A;  9ICH A;  2G5I B;  4FO6 A;  2F44 A;  3I1Y A;  2JR5 A;  5KG5 A;  1J2M A;  4NJ8 A;  7ICG A;  3I28 A;  2KNJ A;  1AQ6 A;  3ETL A;  2DKZ A;  1B43 A;  4K4H A;  2KE7 A;  2WB1 C;  8ICC A;  1S5L U;  4PL1 A;  4CF4 A;  4DQR A;  2JEJ A;  2ES6 A;  4KLE A;  4TQS A;  1CEZ A;  3V6J A;  2EAN A;  3KKA C;  1JAL A;  5ALH A;  3SMV A;  1J97 A;  4P0Q B;  4I2C A;  1Z1V A;  4R66 A;  5EWE A;  4YMM A;  3VC8 A;  3DEE A;  3Q8P B;  3Q8L A;  2K8C B;  4Y2P A;  5HHH A;  2FLP A;  1UT5 A;  3OHB A;  3C28 A;  3M1Y A;  2P6U A;  5F3X B;  4RUA A;  1ZQY A;  2LMR A;  9ICG A;  3C1Y A;  9ICF A;  3M8S A;  4ECX A;  3THV A;  4UAU A;  5ALY A;  9ICV A;  1OUQ A;  2AHO B;  2XY5 A;  2FPL A;  3V7K A;  2WF7 A;  5DB6 A;  4PZO A;  4UB3 A;  5L1K A;  1MQ3 A;  4PH5 A;  1JRP A;  2H3F A;  4P0Q A;  2OCE A;  1V38 A;  5KG2 A;  2G0A A;  1ZQX A;  3MGV A;  4PGQ A;  4DL3 A;  2W3S A;  1KKX A;  4RPZ A;  4BX9 C;  4K4I A;  4J9S A;  2BQ3 A;  5FP0 A;  3MR5 A;  1KL9 A;  5ALO A;  2XO7 A;  1X9S A;  4O3S A;  5DQI A;  3WKD A;  2IHN A;  5HHI A;  1LVH A;  2Q0Z X;  2ATL A;  3MFH A;  1D8L A;  4KLI A;  4WJ3 B;  3OGU A;  1SKS A;  4DL5 A;  3PZP A;  2YX8 A;  4EYI B;  1WCL A;  3T3F A;  3GFK B;  3R9K A;  1GO3 F;  4IRC A;  1U47 A;  2K8A A;  4C8N A;  1WG8 A;  5KL1 B;  4KLS A;  3OHA A;  3Q8S B;  1ZQF A;  2UVU A;  3SI8 A;  1PVR A;  3AN1 A;  1ZQA A;  5BPC A;  2E8P A;  5AHX A;  1K1Q A;  2DL0 A;  2OEH A;  3KTQ A;  4C8L A;  4RQ5 A;  1SL2 A;  5H2F U;  3GIK A;  1KEJ A;  3QXG A;  1RPL A;  4NM1 A;  1KDH A;  3SYZ A;  1S0V A;  2D8C A;  2JZB B;  5JTI A;  2WFA A;  2BCR A;  2F8K A;  5KFW A;  3V7J A;  4FZN A;  2FE9 A;  3H0L B;  3ETR A;  3AQE A;  1NK0 A;  2K60 A;  3FDS A;  2KV2 A;  5ALP A;  7ICH A;  4KLM A;  3L5K A;  3UQ2 A;  3HX0 A;  2QAR A;  4PJ0 U;  3PW4 A;  2PI5 A;  2FPK A;  3T5H A;  3LWL A;  7ICV A;  4QIW F;  1ZQP A;  2BCV A;  4Q8E A;  2NRV A;  3EZ5 A;  3RR7 A;  2NRW A;  2W8K A;  1NJZ A;  2CN1 A;  3NRW A;  1SXD A;  1XS9 D;  1A77 A;  4JK1 A;  2DPI A;  1DRG A;  4MF2 A;  4I2A A;  8ICE A;  4DFD A;  4DOA A;  2QB1 A;  5DLG A;  2K4H A;  5C5J A;  3CNH A;  2Y0S F;  1N5W A;  4ECW A;  1ZQC A;  9ICA A;  3SAF A;  4IR1 A;  2ALZ A;  1BPX A;  1WWU A;  2F3N A;  1SWW A;  4QZD A;  4Q45 A;  4RT3 A;  3D6J A;  2W55 A;  2H3Q A;  3BZK A;  3H0M B;  3PW5 A;  2H3V A;  2HBL A;  3BQT A;  7ICQ A;  2EQY A;  4I2E A;  2YQE A;  2BR0 A;  3CP8 A;  4KLL A;  3UQ0 A;  3ORY A;  2Y1I A;  4C8M A;  1NKB A;  4PHD A;  5AM0 A;  1NNL A;  3FC4 A;  5CEH A;  3BQ0 A;  1BNP A;  5L1M A;  3ZD8 A;  4QZ9 A;  1TVA A;  4ED3 A;  1L8O A;  4J9N A;  4ED2 A;  3QUB A;  3NGD A;  4LJX A;  3SV3 A;  1ZQ1 C;  4ELV A;  4M6W A;  3RAQ A;  3V72 A;  5KFH A;  4YR0 A;  1KSP A;  2LYH A;  1PK3 A;  7ICU A;  2HI0 A;  2I1Q A;  2B21 A;  1QTM A;  4Q8F A;  2ZXI A;  2OH2 A;  2EAM A;  5AKL A;  2UVW A;  2MU2 A;  3TAC B;  1MC8 A;  2LYB A;  4RUC A;  3PST A;  4US9 A;  4DOB A;  3F5A A;  4NLN A;  2AJQ A;  4NY8 A;  1T8E A;  4MEY A;  5EWF A;  3WK6 A;  7ICI A;  4F2R A;  3T5L A;  1U4B A;  5DQG A;  2FLN A;  5KFZ A;  3M9M B;  4CGZ A;  4P4M A;  3PNC A;  4NLK A;  4IRD A;  1BPB A;  3H0R B;  5KFR A;  4TQR A;  1L7O A;  3V7L A;  1B0X A;  1IXR A;  4EEL A;  1FIQ A;  2W9A A;  1H38 A;  4J9M A;  5HR6 A;  2W7O A;  9ICT A;  2V4Q A;  4Y2Q A;  3ZDD A;  4IL6 U;  4B9T A;  2W04 A;  2ZG6 A;  4LZG A;  2NRT A;  3EPI A;  4KX5 A;  3RJK A;  9ICR A;  5KFV A;  1F0M A;  5J2I A;  3C5F A;  3TAQ A;  5ALK A;  3D2N A;  5KFN A;  5CB1 A;  5EWG A;  4DQI A;  3EPG A;  1ZXI A;  4CNQ A;  1RQL A;  2IOH A;  1N60 A;  3K4G A;  2IBK A;  2OWO A;  4QNL A;  1SWV A;  4NL9 C;  9ICW A;  4EEY A;  5AM5 A;  3EYZ A;  3HWT A;  4C4R A;  3PW7 A;  1MQ2 A;  1KQQ A;  3N28 A;  1KFD A;  2XID A;  2QB0 B;  4OJO A;  2HBM A;  1TAU A;  4UW9 A;  3NAS A;  4P4P A;  8ICN A;  2PFN A;  3RAX A;  1A76 A;  4ECQ A;  2XY6 A;  4RQ7 A;  4YN4 A;  1BPY A;  3OJU A;  1SV0 C;  3PVX A;  2YY6 A;  3GV8 B;  1S97 A;  3F2C A;  1D8B A;  3WK8 A;  3C2K A;  2VIX A;  2VA3 A;  5KG4 A;  4TUS A;  4AYB F;  5AK4 A;  4J9Q A;  4F4X A;  3AU6 A;  2N1R A;  4JMU A;  1NK4 A;  3T5J A;  2QB0 A;  3Q8M A;  2R8H A;  5J0Q A;  5J2D A;  2W11 A;  1RQN A;  2RHF A;  4GXI A;  2W43 A;  1ZQQ A;  5AKY A;  1ZQT A;  5L1L A;  2D3D A;  4I27 A;  3SAH A;  1NK6 A;  3KKA A;  1NZB A;  1ZQV A;  3F2B A;  2ZJ8 A;  1TK8 A;  1HEK A;  4EBC A;  4J9P A;  2BZF A;  4NLZ A;  1T3N A;  3OSN A;  4I2F A;  1RG6 A;  5L1I A;  1T7P A;  4YMN A;  4DFM A;  3KZI U;  3PML A;  2BKE A;  5CRX A;  4RZR A;  3C29 A;  5DBC A;  1OXJ A;  2Y9U A;  4M9L A;  4DOC A;  2ASD A;  5HML A;  5DLF A;  4FBU A;  2A1J A;  3JPP A;  1FFV A;  2QLT A;  4RQN A;  1WYG A;  5IIM A;  2EDU A;  3M7D A;  2BCU A;  2F1I A;  2ZJ5 A;  4Y2U A;  2UVR A;  4O0I A;  2FJ6 A;  3H7I A;  3UMB A;  2BCQ A;  3D2S A;  1Z4O A;  2NV3 A;  2ZIW B;  3N7S C;  3G6V A;  4QZE A;  2ISP A;  2FDR A;  3FAH A;  1NK8 A;  2E3T A;  5KFX A;  2L5Y A;  1TK5 A;  8ICQ A;  1X6J A;  5J2A A;  5KFO A;  1CUK A;  5DB7 A;  3MAB A;  1WWV A;  1ZET A;  3GU3 A;  2NO5 A;  3ONN A;  3N97 B;  2WB1 F;  1ZQJ A;  1SKR A;  3QUC A;  3ISD A;  5DDM A;  2BPG A;  2E8O A;  2KIW A;  3K75 D;  1DK2 A;  3A0H U;  2HOI A;  5KL8 B;  3GZF A;  1HUZ A;  2NYV A;  9ICK A;  3HT3 A;  2ZIV A;  3GV5 B;  1X40 A;  4ECU A;  2R8I A;  2KKV A;  3MFI A;  8ICS A;  4C80 A;  2M9N A;  5G5H A;  5J2C A;  3RRG A;  2JXJ A;  2F2A B;  4UAS A;  4A8E A;  4QWE A;  3RB0 A;  3UM9 A;  2BDU A;  3KZX A;  3F53 A;  4IS7 A;  4PHP A;  5J2G A;  3PR5 B;  4KLQ A;  4UQG A;  4YR3 A;  3I76 A;  2DQN B;  1QSY A;  3G6Y A;  2GO7 A;  2DKX A;  4UB8 U;  4P4O A;  2VJ5 A;  2C2E A;  1SZH A;  2PFP A;  1K5O A;  1ZQW A;  5D4B A;  3BQ1 A;  2C28 A;  4I2G A;  2EZY A;  2C2D A;  4CCH A;  2IA6 A;  2HHQ A;  3AMZ A;  4MEX A;  5ALT A;  3WKB A;  4OO1 J;  1XC9 A;  4O3O A;  3QU2 A;  5DBA A;  2DUY A;  5AKG A;  4P0P B;  5KG7 A;  4XA5 A;  3ICX A;  3SAG A;  3WKC A;  2D6F C;  2W8L A;  1T4G A;  5KT4 A;  7ICK A;  3NUQ A;  1PZN A;  2KTQ A;  3OPX A;  5D46 A;  4CDG A;  2PFQ A;  3K1Z A;  3QUT A;  2O6K A;  4O5E A;  4F91 B;  4ELT A;  2YB1 A;  1ZD3 A;  5IIJ A;  5JU5 A;  5C0Y A;  3HJE A;  2CRX A;  3PX0 A;  4DF4 A;  4P0P A;  3MGH A;  3ZI4 A;  1LV5 A;  4XRH A;  8ICB A;  4MFF A;  1SIJ A;  4M9G A;  5KFS A;  3WK9 A;  3QZ8 A;  1RYR A;  5KFJ A;  4XUS A;  4QZC A;  3E58 A;  4M9N A;  4E0D A;  3HP6 A;  2KVS A;  1JXE A;  3PV8 A;  4JWM A;  5ALD A;  4YG2 A;  3RJF A;  2I6X A;  2ZIX A;  9ICB A;  3H8M A;  1XSN A;  3AEV A;  2BGW A;  4YR2 A;  4RT2 A;  4X5V A;  4DLE A;  3BS7 A;  8ICI A;  2KFN A;  3PR4 A;  5KG6 A;  3M8R A;  4DSE A;  1HIW A;  3RH5 A;  3DDH A;  4F72 A;  3ZD9 A;  3JPS A;  5J2F A;  5AI8 A;  4DL7 A;  1BNO A;  2B6G A;  5KFB A;  5J0S A;  2DPJ A;  1X42 A;  4F50 A;  3K1R B;  2E8M A;  1S8O A;  3O0F A;  1VLB A;  2QAR B;  4Q43 A;  2YMM A;  3UMG A;  3H40 A;  3AL0 B;  4I2I A;  2W9B A;  5KFC A;  2G07 A;  2YMQ A;  5AM2 A;  1NI3 A;  1Y88 A;  4C7Y A;  2G08 A;  4KIT B;  1ZQB A;  3M9N B;  3UXP A;  3RH4 A;  2FI1 A;  4CE6 A;  4Z6C A;  3UXO A;  3AM9 A;  3LWM A;  3H4D A;  4GC7 A;  4M2Y A;  4JV1 A;  1B22 A;  4DSI A;  1N2X A;  5J0T A;  3KD3 A;  5KFE A;  2WTF A;  4NV0 A;  4KMO B;  1NK5 A;  4DQS A;  1ZYQ A;  2KHV A;  3CW2 C;  5J2J A;  4R64 A;  2UVV A;  4GC6 A;  3NVY A;  2W9C A;  8ICR A;  5L9X A;  4NL9 A;  1BPD A;  4IC9 A;  4LVS A;  5KT5 A;  4NXZ A;  3H4B A;  1MA7 A;  4UAW A;  2FPM A;  3PX4 A;  2ZIU A;  3IP4 B;  4MF8 A;  3OTQ A;  5HNK A;  2RLT A;  1L7N A;  1L5U A;  3N7R C;  5T14 A;  4O3M A;  3GIM A;  4Y2R A;  2G06 A;  4TUP A;  4B9U A;  4M6W B;  2HVI A;  4DSJ A;  3QU5 A;  4NLC A;  1BPZ A;  2YTU A;  1SV0 A;  5BOL A;  2VKQ A;  2KOB A;  2OYY A;  1BGX T;  4KLF A;  2BDP A;  3C5G A;  5D49 A;  3HKZ C;  4RNM A;  1ZQM A;  1WCN A;  1ZQO A;  2ASJ A;  5DGA A;  2ISO A;  5IIL A;  1L3U A;  3TAP A;  4RPX A;  2DGZ A;  3C2L A;  5AK6 A;  4Y2J A;  5KFP A;  3RB6 A;  1LKY A;  8ICO A;  4DEZ A;  2KZ3 A;  3QEB Z;  3NRZ A;  5IIO A;  3BQ2 A;  9ICP A;  2K89 A;  2KSO A;  2M0N A;  1NJW A;  5DKW A;  2KK0 A;  5ALG A;  5KFG A;  3N4M B;  4UB2 A;  2LKY A;  5CWR A;  5K4L A;  2EZZ A;  4I28 A;  3QZ7 A;  5JRT A;  4UAT A;  4Z6D A;  1P7D A;  2KD1 A;  1SV4 A;  2V9W A;  4QJF B;  2K4P A;  5BOM A;  3JPN A;  2HBJ A;  4QZI A;  4QIW C;  5J29 A;  5J0R A;  3RH6 A;  5J0W A;  5ALE A;  1RXV A;  1NK9 A;  2MA1 A;  3ALR A;  5DBB A;  4FBT A;  3M6Z A;  3EUB 2;  3BZC A;  1QH9 A;  1D8Y A;  1RDF A;  4PZN A;  3GIL A;  2F1H A;  2ZTC A;  2FLL A;  9ICO A;  3RB3 A;  5IIN A;  1ECW A;  4KTQ A;  5KAF U;  4CF3 A;  4DSL A;  2P35 A;  2EAP A;  1TFR A;  1ZQI A;  7ICM A;  1TAM A;  1ZJM A;  2WF9 A;  3BQ7 A;  5AM1 A;  2B0C A;  4DFP A;  1V97 A;  4QZG A;  1QSS A;  4QWC A;  2MAX A;  1QSL A;  4DFJ A;  4C7Z A;  1X9X A;  3GDX A;  1Z00 B;  3RRH A;  5KT7 A;  4O5K A;  2XGQ A;  1N63 A;  2HHU A;  1MSW D;  1D9F A;  3N7P D;  4XQ8 A;  3GII A;  3M6K A;  3HW8 A;  3PO4 A;  7ICN A;  4IQU A;  1HUO A;  2KN7 A;  1SL0 A;  5KNI A;  2AQ4 A;  4DSF A;  5E79 U;  1RYU A;  4GIB A;  7ICE A;  1O08 A;  4YD1 A;  1L6N A;  1CI4 A;  4ZH4 A;  3GQC A;  4EYH B;  2JRZ A;  2WAQ C;  2F8L A;  1Z00 A;  4PGY A;  5J0U A;  3QYP A;  5KT6 A;  2ODG A;  4UB1 A;  5KFI A;  4JUZ A;  3NTU A;  4KLG A;  4KMU A;  2KJ9 A;  4I2B A;  1PK1 A;  4OJP A;  4C4S A;  8ICX A;  4KLO A;  4JV0 A;  3TQ1 A;  2KVC A;  2XY7 A;  1QQ7 A;  4UB6 U;  1UCV A;  4C0Z A;  5CJ7 A;  5KFU A;  4O3R A;  1X6I A;  4F4W A;  4ACO A;  4DF8 A;  3RB4 A;  1NKE A;  2DWQ A;  4YP3 A;  3QU9 A;  2XC9 A;  4J9K A;  1KTQ A;  2A1J B;  7ICJ A;  5EE0 A;  1PVQ A;  4BXO A;  5KT2 A;  2J6S A;  4F2S A;  2HW3 A;  1V85 A;  1XU4 A;  5ALQ A;  4P2H A; 
#chains in the Genus database with same CATH homology
 3A0B U;  3KZI U;  5H2F U;  5B66 U;  3A0H U;  4PJ0 U;  5KAF U;  5E79 U;  5TIS U;  2AXT U;  5GTH U;  1S5L U;  5GTI U;  4UB8 U;  2DUY A;  3WU2 U;  4IL6 U;  5KAI U;  4UB6 U;  5B5E U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...