4AYBF

Rnap at 3.2ang
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSNRTYTSEDIQKIIDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
total genus 13
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4aybF02
4AYBF 2WAQF 2Y0SF 2WB1F 2PMZF 3HKZF
chains in the Genus database with same CATH superfamily
2V4RA 3ED5A 4C7ZA 5KFNA 2ASLA 3L5KA 2ZIWB 2M0NA 5KT5A 3SV4A 4P0PB 5J0TA 5EWGA 2JEJA 2XY5A 2WHEA 1ZETA 3WK8A 4F4XA 5KG6A 2FDRA 4KX3A 5KFDA 4IR1A 1UCVA 1PUZA 2D6FC 4OO1J 8ICGA 2VKQA 4FZNA 4PJ0U 3SD7A 1QQ5A 1XSPA 1V97A 2W54A 4EENA 1LV5A 5J2GA 2OYYA 1U48A 2HHQA 1RQNA 4DF4A 4F2RA 2FMPA 2ZIXA 3RH5A 1SZHA 3QU5A 3F5EA 3M8RA 4M2YA 3NVVA 4O3QA 5DB6A 1Z4OA 1L5UA 4KLQA 3TI0A 1TK8A 4K4GA 4RUCA 3LWLA 3G6XA 2QARB 2MA1A 2HHWA 4KMOB 2K8AA 3KHGA 5DDYA 2ZJ8A 4F3OA 2HOFA 3EW9A 5J29A 4NM1A 4KLTA 4PGXA 4I2AA 4BWJA 2DPIA 1JALA 4DSFA 5J0WA 2KIVA 4PHEA 4F4WA 3UXPA 4DQQA 3FAHA 4O3OA 1L3UA 3N4MB 1WCNA 4NLGA 4RPZA 9ICVA 2BR0A 4C8OA 2YQEA 2JV3A 3UMCA 4DLGA 4U7CA 1NK8A 3FC4A 4QWDA 3L3FX 4Y2PA 4F5OA 3NUQA 5AM4A 2I1QA 4X5VA 2KJ9A 2W9CA 4EELA 3KZXA 5CRXA 1BNPA 2A1JB 1IG6A 5DKWA 2UVRA 9ICKA 4A8EA 3M6KA 2QB0A 4YD1A 4JV1A 5KFMA 5DQHA 1QQ7A 2EQYA 5KFIA 4C8LA 4CE6A 2KVSA 5DG9A 1ZQFA 9ICTA 4DSKA 3CW2C 8ICEA 3THVA 2XC9A 4UATA 1ZXIA 2KNJA 2LYBA 1SIJA 3K1ZA 3OSPA 8ICQA 5ALLA 1YZ6A 1V38A 5H2FU 4I2HA 2KHVA 2CN1A 1NZPA 1ZQJA 4DWIA 2KVCA 3IG5A 1CRXA 3N7RC 4LVSA 1RPLA 1QSSA 4OJOA 3AQEA 3ETLA 4XRHA 2E1EA 3KOOA 1D9DA 2EAOA 4PL2A 4ECUA 4M0AA 1ZD4A 4RPYA 5JU5A 4EX7A 2VA2A 3ISCA 1T94A 1Z1VA 2M9NA 3PZPA 3QZ8A 3WK4A 3PVXA 4R8UB 4Q44A 4RNNA 3T5HA 1Z3EB 1YT3A 8ICRA 3GDXA 2AJQA 3H0MB 4J03A 5KG0A 3G6YA 1AQ6A 4O9MA 1NNLA 4GC7A 1FFVA 3QE9Y 5ALXA 1J2NA 1SB3C 1T3NA 4IQVA 1C20A 1NKBA 3Q8RB 5AKZA 3PY8A 3QYPA 5ALZA 9ICIA 2G09A 4BWMA 2YTUA 4UB8U 3SAGA 2V4QA 8ICIA 3ZDAA 2LI6A 3M6ZA 4NLNA 2VJ4A 3SAHA 4UB2A 1JROA 4B9NA 2MUTB 3LVWA 1ZQRA 9ICHA 4Q8EA 3OGUA 3RAQA 4QW8A 2VA8A 2HHUA 2JH1A 2FPMA 2RLTA 3HT3A 4ELTA 5CHGA 5KFGA 4QWAA 1NOMA 8ICOA 2ZIUA 2BZFA 5KAIU 1UT8A 2E8MA 2OWOA 1ZQWA 4MFAA 1ZJMA 4QZ9A 3PW2A 3KZIU 5ALRA 2ZIWA 3F2BA 3A0HU 3AQFA 3AUOA 2JEIA 4IRKA 2W9MA 2W8LA 3TAQA 2KN7A 4P0PA 4C8KA 5D4BA 1QQ6A 5KFZA 3K75D 1BPDA 3IHQB 3EWAA 3MGHA 3SI8A 2KFZA 2LYHA 4QWEA 4FS1A 4Z6EA 3N97B 3EPIA 5J2KA 4K4HA 2DWQA 4NLKA 1IV8A 3SR6A 5J0PA 4J9LA 3T3FA 3HJEA 2W8KA 1SKRA 4IL6U 1NK9A 2BDUA 3PSPA 4RQNA 4C8NA 4GIBA 5EWFA 5AI5A 4F5RA 1U45A 4G3IA 2KJ5A 4Z6DA 3U26A 4NWIA 2CPRA 5KG5A 1BVSA 2QARA 1URJA 4QZFA 3ZD8A 2KMDA 5AI8A 3M9OB 3V6KA 1S97A 7ICEA 4JUZA 5ALWA 3PO5A 7ICNA 2DPJA 3HP6A 4BJQA 4M9GA 5EE9A 5KFPA 4J9SA 1NJZA 1SWVA 5AIAA 5KL1B 4J9MA 1S0VA 4YCXA 3IV6A 2RDJA 4F71A 2L5YA 4RT2A 2W11A 4EX6A 3SZ2A 4PGQA 1N56A 5KFEA 1JXLA 2IOFA 2KG5A 1LB2B 2KIWA 2H3IA 4QZ8A 3MR2A 1Q8KA 3AM9A 4OCZA 3TARA 7ICKA 5KFJA 1S5LU 1RYRA 2H3ZA 4CNQA 4YP3A 5IINA 4IQTA 4TQSA 1UQVA 1KSPA 3IN5A 1DK3A 4RQ6A 3EZ5A 3N7SC 3G6VA 1ZQXA 2RP5A 3MC1A 3RRHA 1DOQA 1X9MA 2VIXA 1L3VA 2KV2A 7ICJA 3V6JA 1Z00B 4Y2YA 3QU4A 5KG4A 4F92B 4YXMA 2YMMA 4RNOA 8ICKA 2RHFA 1PVRA 1BGXT 3GIJA 1WG8A 1S0NA 2XIDA 2AXTU 5CR0A 1RG6A 2D3DA 5J0XA 1ZQKA 3BS7A 1TKDA 1LKYB 4I2IA 4KLJA 3RRGA 1PZNA 3A0BU 2W7PA 4DLEA 2E8NA 1ZQUA 3WKDA 3JPTA 1UT5A 4GXIA 3M9NB 4CRXA 9ICAA 1ZQBA 4XUSA 3TFRA 7ICPA 4R8UA 2HHXA 1FFUA 2KD1A 4FO6A 4C8MA 1Q3UA 2K4HA 2HOQA 2KFNA 1X40A 1F44A 1A76A 3Q8LA 4KLFA 9ICXA 3LWMA 7ICOA 2RRDA 1D8YA 4QZIA 4KLUA 2OHFA 4QJFB 4CCHA 4OJ6A 5AKYA 1QTMA 2FI1A 1RM6C 4DL5A 4DF8A 1ZQAA 4I2GA 5L1JA 5ALQA 4NL9A 4OJ5A 3QEAZ 1V85A 1Q46A 3LYSA 5KFRA 2MUTA 2HW3A 3H40A 4CGZA 3RJKA 4M04A 2HBMA 4B9SA 1COOA 4EYHB 9ICFA 2W04A 5J2JA 5B66U 3BQ2A 1QCKA 3PMLA 4KN7A 3LK9A 1PVPA 2XGPA 2BPGA 1JXEA 2W9AA 2YMQA 3AN1A 4MEYA 4KMUA 2ZIVB 2BCRA 1B0XA 2EZZA 4Y2JA 8ICSA 1MN8A 4RPXA 2Y1IA 2BPCA 3ZDEA 1T3QA 3B0YA 2JRZA 4I2BA 2XGQA 2P35A 3SMVA 3BJYA 4QZAA 4J9RA 2NV3A 4Y2VA 4ED7A 4OJLA 3SAFA 2P6RA 4JK1A 4NV0A 3RH6A 1N5XA 5ALIA 1DGSA 4PGYA 5J2BA 4JMUA 2Y9TA 3ETRA 3ZI4A 1TV9A 3M8SA 3NTUA 5ALNA 2HOIA 3C21A 2W7OA 5CEHA 1XO1A 2ISOA 2LMRA 3IP4B 4RQ1A 2KKVA 4UW9A 1NJYA 3WU2U 1SV0A 4R63A 3MFIA 3BQ7A 2ESEA 3PMNA 4KTQA 5DDMA 2FLLA 4IR9A 5L1LA 1KBUA 4IQWA 2JGAA 4DL6A 2FPKA 4ED3A 4KLEA 2JMGA 3Q8PB 4J9NA 3RBDA 5J2HA 2CXYA 1SKWA 4I27A 4QZCA 3OPXA 4DFKA 2NO5A 1ZQHA 3RR7A 4YN4A 2B0CA 5L1IA 1B43A 1SL0A 4BXOA 5ALFA 1S10A 4UBBA 2E8OA 2O6KA 1ZQNA 3QNMA 1ZQCA 3PO4A 4KLSA 4BX9C 4FBTA 1ZD2P 3C1ZA 3KFUF 4MF8A 4RT3A 1L3SA 2YY6A 4C4RA 2KZMA 4KLDA 1HIWA 4G9BA 1K1SA 2VA3A 3WKEA 4J9PA 4R66A 1U4BA 4NY8A 4WJ3B 3SYZA 1PK3A 4B9UA 1VLBA 3NVYA 1DK2A 3AMZA 1WWVA 2H3FA 1NK6A 3ALRA 1UA0A 2XY6A 5GTHU 2KTQA 1PK1B 2P6UA 1Z00A 4GXJA 1JMSA 2W43A 2J6UA 1DGJA 3M1YA 1D8LA 4PZNA 1KTQA 2K4IA 1ZQTA 1WWUA 5DB7A 1N60A 4DQIA 3IM1A 3PSIA 3OHAA 1ZQ1C 1ZQLA 5AIBA 3NGDA 2R8IA 2PFPA 7ICFA 2LYAA 4RUAA 4KLHA 8ICLA 1LKYA 1ZD5A 1ZQPA 5J0QA 2G08A 2LPEA 4UQGA 4HYKA 7ICRA 1ZQQA 4CF3A 4UB3A 2KP7A 4QW9A 5C5JA 2Q4TA 3BQ0A 4UAUA 7ICHA 4EBDA 9ICMA 2AHOB 5J2IA 2B6GA 3E58A 4ECZA 4UARA 5IIIA 2C2RA 5AICA 5KFQA 5C0YA 3CP8A 9ICWA 3F2CA 4EYIB 3RJFA 5ALSA 2EAPA 5KFYA 3JPPA 4YQWA 3GQCA 5AKXA 4F93B 4I2EA 2JEFA 2P66A 4YD2A 8ICMA 4O3MA 1N48A 5KFAA 1S9FA 3FYHA 3ZDDA 2E3TA 1BPBA 2WF6A 2JH7A 2UVUA 3LDAA 4P0QA 4FFDA 3KKAA 2R8GA 4QZGA 1X6IA 3PSTA 3UMBA 4MFFA 1C7YA 3K4GA 1A77A 1JRPA 5E79U 2ZXIA 1T7PA 1RQLA 3GU3A 3HW8A 4Z6CA 3I28A 3GV5B 3OJUA 3H4DA 1BNOA 3MDCA 3JPRA 2ZIVA 4F4YA 3PW4A 4XQ8A 2ZJ5A 2ZG6A 4NM2A 2IBKA 7ICTA 2AGPA 3RJIA 4ED8A 1U9LA 4B9LA 1O03A 2DF4B 2W03A 4UB6U 4UAVA 2PKEA 5KT7A 1K5OA 4IRDA 1U49A 5L1MA 5J0UA 2W3RA 4UB4A 4ACOA 1KLNA 3S6JA 3VCBA 7ICGA 3V72A 2KJ8A 3GZFA 1F5SA 2W55A 4R64A 2DFLA 3EUB2 3JPOA 3RF9A 2R8JA 9ICQA 3QUCA 4LZGA 4TUSA 5J8YA 2R8KA 2G06A 3TADA 5AI9A 7ICLA 4R65A 3H8MA 5ALMA 2H5XA 1TE2A 1O08A 2BCUA 3QXGA 4ELUA 3D6JA 4DOAA 5KG3A 2ZUBA 1NK7A 2QKQA 3V6HA 3KBBA 1MQ3A 3PW5A 3GV8B 3AEVA 4F4KA 1RYSA 2VANA 3QU2A 1KW4A 4PPXA 1TK0A 2JHDA 3V7JA 2CRXA 4QWBA 5CA7A 4YMNA 3TAPA 2ZJAA 4CF4A 4J9OA 2K8BB 2DBYA 2W9BB 5L9XA 4O3RA 3FM9A 2UVVA 3HWTA 1ZD3A 5KT2A 4EZ6A 1ECWA 2NRZA 2HBKA 1S76D 1HUZA 2C22A 2J6SA 4KLLA 4DFDA 5CP2A 2B21A 2HVHA 5AM2A 2HHTA 4IRCA 1PK1A 5HHIA 2HHVA 4ED1A 3L4PA 4YG2A 1Z4NA 4Y2RA 4DSEA 3B0XA 4M9NA 3BQTA 4PZOA 9ICBA 1ED1A 2ZUCA 5KG1A 2FMQA 2FMSA 3LVVA 3WK6A 2YB1A 3BS5B 1SGGA 2PI4A 4DSIA 5AI4A 1T4GA 4M47A 4BUGA 4GLXA 1ZQYA 5HMMA 1ZOLA 4F2SA 4CF5A 4UB1A 1S77D 2K4PA 2BQRA 1BPYA 3CNHA 4DOBA 2F8LA 4XA5A 5AKGA 5DG7A 1L8LA 2FLNA 1VDVA 4RNMA 2F77X 1NK5A 3N28A 3RJJA 4YFKA 4FZMA 1ZQGA 1Z19A 4U6PA 4CDGA 1ZQEA 2EDUA 4NL9C 2A1JA 2EANA 3C23A 3F2DA 5AK5A 2J6TA 1D8BA 5ALTA 5ALPA 5KNIA 5KFVA 1OUQA 4BGDA 4Y2TA 3TFSA 5IIMA 4ECQA 4AYBC 2WAQC 4ED0A 4F91B 4OD0A 2HBLA 5KG7A 3HX0A 1D9FA 2KHQA 3H0LB 4YXJA 1T8EA 3Q8SB 1N5WA 4AP9A 1JIHA 3IDWA 3IRUA 4EEYA 1X9WA 2MSNA 1ZQMA 5J2FA 1J97A 2XVTA 3QEBZ 3H8JA 4QZDA 2ZTEA 3MDAA 5KL8B 4DSJA 4ZOHC 5AI6A 5KFLA 3UXOA 2ATLA 4NLZA 2Z7JA 5J0RA 2NRVA 5DQGA 4NLCA 1JN3A 1KFDA 4YR2A 1QLNA 4LJXA 1NKCA 5EOZA 4EBCA 4RQ4A 1QH9A 3TKAA 1S0OA 2WF8A 4J9KA 1N61A 1SV0C 4PH5A 3QUBA 4ECRA 1XS9D 3T5KA 2WF5A 2FLPA 1X42A 2F76X 2KEYA 2Y0SC 1B22A 1WUDA 4C4TA 3QUQA 2GOLA 4DO9A 2IHMA 3ISBA 4YVZA 3UMGA 1BPXA 2IOFK 1S8OA 1TAQA 5AK4A 4I2DA 3AU2A 4QNLA 4YMMA 4KLGA 4BDPA 4PHPA 3KHLA 2PMZC 2JZBB 4O3PA 1ZRMA 1ZQDA 1IM4A 5TZVA 2Y9UA 7ICQA 2WF9A 4KLMA 2YMPA 2Y1JA 1ZYQA 5JTIA 1LVHA 2W3SA 3DDHA 5KTQA 3RTVA 8ICVA 5AM3A 1CI4A 4RQMA 2LKYA 4J9QA 2ZTDA 2Q0ZX 2A1AA 3NRZA 3EYZA 1XSNA 5J2CA 5ALEA 4M9HA 4UAWA 1UHUA 5J0YA 3V7LA 5ALKA 5IILA 5AI0A 4ECWA 3E2EA 4MFCA 2R18A 1SXEA 1F0MA 5F9NA 3ICXA 3TANA 9ICJA 5DGAA 4JWMA 4Q45A 3CRXA 5KFTA 1KKXA 5KAFU 3BZCA 2VJ5A 3DEEA 2AH5A 3SENA 1ZQIA 3NRWA 5DG8A 3D2NA 2G5HB 3F5AA 2GLEA 3WK9A 2FJ6A 3PX4A 2UVWA 4KLOA 3V7KA 3RB0A 2MU2A 5BPCA 4O5KA 2ZXHA 3M7DA 4TUQA 5AKJA 1KFTA 5AKKA 2F8KA 3BS5A 3I76A 2AGOA 9ICCA 9ICUA 5AKEA 3O0FA 4ECXA 5J2EA 2AGQA 4DQRA 1L7NA 4RZRA 2FE9A 1TAUA 1N2XA 3D2QA 5DBCA 1XU4A 4B9VA 3OSNA 1L7MA 3R9KA 2KICA 9ICLA 2HSZA 2AU0A 5KFUA 1RYUA 1N63A 1L6NA 5DBBA 4GC6A 2IHNA 2PI5A 4TURA 5HMLA 3IG8A 5KFXA 2MAXA 3CYMA 3KKAC 5EE0A 1TVAA 5KT3A 8ICTA 3M9MB 3C28A 8ICHA 4DS4A 4DFPA 1GO3F 3Q8MA 1CEZA 1NJWA 2BCSA 4Q8FA 3QU7A 2F3NA 4ECVA 3N7PD 2ASJA 3OJSA 4NLBA 5KFBA 4F5PA 4Z6FA 4O3NA 2HMXA 4QZEA 3MGIA 5D49A 1KEJA 4F5QA 5D46A 2F44A 4IS7A 1H38A 1QSLA 3HILA 2LHTA 3BZKA 2YX8A 2KSOB 2IOHA 4UB5A 3JPQA 1MC8A 4JWNA 3PR5B 4I2CA 4TQRA 2QLTA 1X9XA 5HR7A 2HI0A 2DL0A 2BKEA 4ZH4A 4AYBF 1NKEA 2EAMA 2RQ5A 2WAQF 3UPQA 2H3QA 3C2MA 2KKPA 2NRWA 3SQIA 2BDPA 5F9LA 3SEIA 5ALHA 5ALYA 2AQ4A 5AM0A 3E0FA 3TACB 5J8YC 4ECTA 2XY7A 4QIWC 2V9WA 8ICBA 2GWSA 5KFOA 4Q43A 3TADC 3H7IA 2OXOA 4DEZA 1DXSA 3WK5A 4KN4A 4RQ0A 3KD3A 3GV7B 3T5JA 4RQ7A 1UA1A 4JV0A 2KZ3A 3H8SA 1RZTA 2OM6A 7ICSA 4JV2A 3MBYA 2NRXA 4ECSA 1X6JA 4UAZA 4ICAA 4O0IA 1FO4A 3MR3A 3GIMA 3VC8A 2R8HA 2QB1A 4QZHA 3JPSA 2JZBA 5L1KA 1XO0A 5KFCA 3J81j 5CWRA 1ZJNA 4O5EA 1TAMA 1Q3VA 3ZD9A 4M9LA 2G0AA 1KRPA 1KFSA 5AM5A 2Y0SF 2NO4A 4I2FA 3NASA 9ICOA 3WKBA 4Y2UA 4P2HA 4QWCA 2OH2A 4USAA 5J2DA 2BHNA 3KTQA 5EE1A 1DRGA 5DBAA 2LM4A 5B5EU 1N62A 5KFFA 2HBJA 5EWEA 2BPFA 1MA7A 5BOMA 4HAIA 4NXZA 3NS1A 2PMZF 3PV8A 2IA6A 2ALZA 9ICPA 1WCLA 2LM1A 1SXDA 1JI7A 1SKSA 3RJEA 2K4EA 4IC9A 2BQUA 3B9JA 5DLFA 3RJHA 1NI3A 3T79A 2ODGA 3H0RB 2KE7A 4UASA 1ZQVA 3MGVA 3C5FA 4P4PA 2XCAA 1NZBA 8ICNA 4NJ8A 5CJ7A 3FDSA 1RXWA 2G5IB 3HKZC 1SWWA 1XWLA 1OW5A 5KT6A 2A3VA 1MSWD 1QSYA 2C28A 2K8CB 4FBUA 5CB1A 1X66A 4I29A 4P4OA 4DFMA 5BOLA 3RH4A 2E5SA 1NK0A 2HDOA 1ZRNA 4US9A 3GIKA 1MQ2A 2WB1C 1X2IA 5ALDA 4UBCA 1L8OA 3HRDD 3TQ1A 5T14A 2FPLA 4FZLA 2PXIA 2XICA 3RB4A 5KFHA 4IQUA 4PL1A 1SV4A 3C5GA 2DQNB 3PX0A 2KZZA 7ICMA 3GFKB 2ZUDA 5IIOA 1XSLA 5AK6A 3RFAA 2EZYA 4M9JA 1HUOA 1M6YA 3PR4A 4RQ8A 5AKHA 4F5NA 3RJGA 4ELVA 2AQ0A 8ICYA 1JX4A 2GH1A 1FEZA 3D2SA 4ECYA 1KDHA 3K1RB 2YMLA 3H8WA 5AHXA 9ICNA 1IXRA 4EBEA 4I2JA 8ICWA 4DL2A 3C2LA 4TUPA 1S0MA 4YMOA 4DQSA 3BQ1A 4DS5A 2ES6A 5ALGA 5ALVA 4RQ5A 4MEXA 4F4ZA 2MRLA 5HHHA 4DCCA 2JXJA 5ALUA 1L7OA 5HP4A 2OEHA 4C7YA 5HNKA 4C80A 7ICUA 2KSOA 3PW7A 2BGWA 1K1QA 2A19A 5A0LA 2C2DA 4M6WB 4FS2A 3C29A 3NVZA 2NRTA 2YB4A 5F3XB 5JUMA 3C1YA 3ZDBA 4PHAA 4C4SA 2D8CA 2JR5A 2BCVA 7ICIA 1A6SA 4E0DA 2BCQA 3WK7A 5IIJA 4ED2A 3RR8A 1XNSA 1EXNA 1SZPA 2F1HA 2IMWP 4BXOB 2K60A 4EEKA 1RDFA 2F2AB 3HPOA 1TFRA 3AU6A 3WKCA 3T5LA 5KG2A 2GO7A 3NVWA 3PSFA 3UM9A 5KFKA 4K4IA 2XI9A 1UPHA 4KLIA 4RQ2A 3I1YA 4DSLA 3H4BA 5DLGA 1L7PA 4Y2XA 3WKAA 2WF7A 2ZIXB 2HVIA 8ICFA 2EZXA 1RXVA 5AM1A 1V9PA 1IIPA 4RQ3A 4UAYA 4O3SA 2KK0A 4MHVA 4DQPA 4QIWF 1JUDA 1CUKA 2K89A 1ZQOA 1OXJA 1WYGA 5ALJA 2LBOA 4DOCA 2EH9A 2F1IA 3ZDCA 3ORYA 3RAXA 1FIQA 2I6XA 5DGBA 2HCFA 3QX7A 5AKLA 2OCEA 3JPNA 1Y88A 2ZTCA 4JB3A 1COKA 5IIKA 3QU9A 1KL9A 4QZBA 4DL3A 2E8PA 4PHDA 5G5GA 8ICXA 8ICZA 2XCPA 4OJPA 1KN5A 4B9TA 1A0PA 5DB8A 4KX5A 2WTFA 4GFJA 2DKXA 2BQ3A 2NYVA 7ICVA 2W9CB 1PVQA 1B4FA 1ZQSA 3BDPA 8ICPA 2G07A 2N1RA 3DV9A 4FE3A 3OTQA 2QB0B 5AK3A 1ZQZA 2H3VA 4DFJA 4KITB 5FP0A 4F8RA 3OHBA 2WFAA 9ICGA 1BPEA 4P4MA 5DQIA 4F72A 3PX6A 8ICAA 3MABA 3F53A 4YR3A 1BPZA 4LZDA 2ISPA 4MF2A 5G5HA 1TK5A 3MR6A 4P0QB 2XO7A 3MR5A 2YN4A 2PFNA 8ICJA 1X9SA 4EZ9A 3PW0A 3Q8KA 2JEGA 1KQQA 1J2MA 3RBEA 2DUYA 4DL4A 3C2KA 1HEKA 3KHRA 5J0OA 3RB3A 1SL2A 2W9BA 1YZ7A 2E1FA 3RB6A 5JRTA 3HKZF 4DL7A 1U47A 3QUTA 2ASDA 2I9GA 1NJXA 1NK4A 5J2AA 2PFOA 3GIIA 5J0SA 5KFSA 2DKZA 8ICUA 4Y2QA 9ICRA 1XC9A 2C2EA 5AKIA 4I28A 5ALOA 4YR0A 9ICEA 2KOBA 1HJPA 5EE3A 2WB1F 5GTIU 3AL0B 4B9MA 2RDIA 4US8A 4RU9A 3MFHA 4ED6A 3PNCA 5HR6A 4F50A 9ICSA 4GXKA 1VJ5A 5K4LA 2DGZA 3QZ7A 3ONNA 3EPGA 2I5HA 3UXNA 3ISDA 3UQ0A 1P7DA 4M6WA 4O5CA 1AROP 1SL1A 5TISU 2PFQA 1Z1BA 1L3TA 5KT4A 3GILA 4Y2SA 3UQ2A 2F1JA 5KFWA 2ZIUB 8ICCA 4B6JA 5DB9A 3SV3A 3KHHA 4C0ZA 3Q8QB 2HHSA
chains in the Genus database with same CATH topology
3M6ZA 2DQNB 2G0AA 3KZXA 2XI9A 2G08A 2HOQA 1UPHA 2K4HA 4NLBA 5KL1B 5KL8B 2Y0SF 1F44A 2ZIWB 2VJ4A 2R18A 5CRXA 3SAHA 2M0NA 2HMXA 2RRDA 2Z7JA 2OH2A 4P0QB 3RFAA 4NLCA 3ICXA 4A8EA 3M6KA 1KBUA 4P0PB 3LVWA 4ACOA 4QJFB 2Q4TA 4OJ6A 3CRXA 4WJ3B 2ZIXB 3VCBA 1ED1A 2JGAA 1DRGA 2KJ8A 2JMGA 2JH1A 3GZFA 1IIPA 2H3IA 2KIWA 2VJ5A 2YB1A 3LVVA 4KX3A 2LHTA 2GH1A 2ZIUA 2YX8A 2HBJA 3DEEA 2D6FC 3D2SA 4OO1J 2KNJA 1HEKA 2LYBA 4QIWF 3RF9A 4BUGA 2VKQA 4FZNA 1MA7A 2E1FA 5C0YA 3CP8A 3NRWA 2H3ZA 3OPXA 3F2CA 2PMZF 3K1ZA 2K89A 3D2NA 3HKZF 2LBOA 2G5HB 2ZIWA 3F2BA 3F5AA 3AQFA 4OJ5A 2F76X 2OYYA 2KEYA 2Y0SC 3LYSA 5HR7A 4P0PA 3IN5A 2F8LA 2G06A 3N7SC 1WUDA 4AYBF 4CGZA 2WAQF 2HBMA 2KHVA 2H3QA 2GOLA 2CN1A 2K4EA 2ZIXA 2ZXHA 4IC9A 2KKPA 2RP5A 3M7DA 2KVCA 4BX9C 3SQIA 3IG5A 2F77X 3T79A 1CRXA 1SZHA 2MRLA 3F5EA 2VIXA 3H0RB 3N7RC 4O3MA 2KV2A 3AQEA 4FZMA 4OJOA 3MGVA 2E1EA 3KFUF 2W04A 3O0FA 1Z19A 2KOBA 4U6PA 4PL2A 4CDGA 4QNLA 2WB1F 3E0FA 1HIWA 2JH7A 1NZBA 3AL0B 4QIWC 2MA1A 1PVPA 3F2DA 5A0LA 2G5IB 4P0QA 2RHFA 1PVRA 1T94A 3PZPA 3D2QA 2PMZC 4KMOB 2ZIVB 3C29A 1D8BA 2XIDA 2OXOA 2K8AA 3HKZC 5HR6A 3PSTA 4OJPA 2KICA 2YB4A 2A3VA 1A0PA 1YT3A 2JHDA 2HOFA 1OUQA 4KX5A 1Q3UA 2CRXA 4GFJA 2H3FA 2K8CB 4AYBC 2BDUA 3PSPA 3ALRA 2WAQC 2ZXIA 2K8BB 2W7PA 3SMVA 2OM6A 2HBLA 3GU3A 1PVQA 2KJ5A 2DGZA 3ONNA 1L6NA 3H0MB 4NWIA 2CPRA 4ICAA 2E5SA 2NV3A 1A6SA 2G07A 4OJLA 3SAFA 4CRXA 2KHQA 2N1RA 4NV0A 2K4IA 4FE3A 3H0LB 1URJA 3IG8A 1P7DA 1XNSA 4JMUA 2H3VA 3CYMA 3VC8A 2WB1C 3PSIA 1ECWA 2HOIA 2ZIVA 2W7OA 2LKYA 2HBKA 1ZQ1C 2F2AB 5T14A 4U7CA 4FZLA 3C28A 1Z1BA 2ZG6A 2G09A 1GO3F 3IP4B 3L3FX 1XO0A 2XICA 2KKVA 3SAGA 3NUQA 2LYAA 2ZIUB 2KD1A 3F53A 4BJQA 2XVTA 2DF4B 2W03A 3PSFA 4PL1A 1TAMA 1Q3VA 3N7PD 2KJ9A 4C0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB F;  2WAQ F;  2Y0S F;  2WB1 F;  2PMZ F;  3HKZ F; 
#chains in the Genus database with same CATH topology
 2V4R A;  3ED5 A;  4C7Z A;  5KFN A;  2ASL A;  3L5K A;  2ZIW B;  2M0N A;  5KT5 A;  3SV4 A;  4P0P B;  5J0T A;  5EWG A;  2JEJ A;  2XY5 A;  2WHE A;  1ZET A;  3WK8 A;  4F4X A;  5KG6 A;  2FDR A;  4KX3 A;  5KFD A;  4IR1 A;  1UCV A;  1PUZ A;  2D6F C;  4OO1 J;  8ICG A;  2VKQ A;  4FZN A;  4PJ0 U;  3SD7 A;  1QQ5 A;  1XSP A;  1V97 A;  2W54 A;  4EEN A;  1LV5 A;  5J2G A;  2OYY A;  1U48 A;  2HHQ A;  1RQN A;  4DF4 A;  4F2R A;  2FMP A;  2ZIX A;  3RH5 A;  1SZH A;  3QU5 A;  3F5E A;  3M8R A;  4M2Y A;  3NVV A;  4O3Q A;  5DB6 A;  1Z4O A;  1L5U A;  4KLQ A;  3TI0 A;  1TK8 A;  4K4G A;  4RUC A;  3LWL A;  3G6X A;  2QAR B;  2MA1 A;  2HHW A;  4KMO B;  2K8A A;  3KHG A;  5DDY A;  2ZJ8 A;  4F3O A;  2HOF A;  3EW9 A;  5J29 A;  4NM1 A;  4KLT A;  4PGX A;  4I2A A;  4BWJ A;  2DPI A;  1JAL A;  4DSF A;  5J0W A;  2KIV A;  4PHE A;  4F4W A;  3UXP A;  4DQQ A;  3FAH A;  4O3O A;  1L3U A;  3N4M B;  1WCN A;  4NLG A;  4RPZ A;  9ICV A;  2BR0 A;  4C8O A;  2YQE A;  2JV3 A;  3UMC A;  4DLG A;  4U7C A;  1NK8 A;  3FC4 A;  4QWD A;  3L3F X;  4Y2P A;  4F5O A;  3NUQ A;  5AM4 A;  2I1Q A;  4X5V A;  2KJ9 A;  2W9C A;  4EEL A;  3KZX A;  5CRX A;  1BNP A;  2A1J B;  1IG6 A;  5DKW A;  2UVR A;  9ICK A;  4A8E A;  3M6K A;  2QB0 A;  4YD1 A;  4JV1 A;  5KFM A;  5DQH A;  1QQ7 A;  2EQY A;  5KFI A;  4C8L A;  4CE6 A;  2KVS A;  5DG9 A;  1ZQF A;  9ICT A;  4DSK A;  3CW2 C;  8ICE A;  3THV A;  2XC9 A;  4UAT A;  1ZXI A;  2KNJ A;  2LYB A;  1SIJ A;  3K1Z A;  3OSP A;  8ICQ A;  5ALL A;  1YZ6 A;  1V38 A;  5H2F U;  4I2H A;  2KHV A;  2CN1 A;  1NZP A;  1ZQJ A;  4DWI A;  2KVC A;  3IG5 A;  1CRX A;  3N7R C;  4LVS A;  1RPL A;  1QSS A;  4OJO A;  3AQE A;  3ETL A;  4XRH A;  2E1E A;  3KOO A;  1D9D A;  2EAO A;  4PL2 A;  4ECU A;  4M0A A;  1ZD4 A;  4RPY A;  5JU5 A;  4EX7 A;  2VA2 A;  3ISC A;  1T94 A;  1Z1V A;  2M9N A;  3PZP A;  3QZ8 A;  3WK4 A;  3PVX A;  4R8U B;  4Q44 A;  4RNN A;  3T5H A;  1Z3E B;  1YT3 A;  8ICR A;  3GDX A;  2AJQ A;  3H0M B;  4J03 A;  5KG0 A;  3G6Y A;  1AQ6 A;  4O9M A;  1NNL A;  4GC7 A;  1FFV A;  3QE9 Y;  5ALX A;  1J2N A;  1SB3 C;  1T3N A;  4IQV A;  1C20 A;  1NKB A;  3Q8R B;  5AKZ A;  3PY8 A;  3QYP A;  5ALZ A;  9ICI A;  2G09 A;  4BWM A;  2YTU A;  4UB8 U;  3SAG A;  2V4Q A;  8ICI A;  3ZDA A;  2LI6 A;  3M6Z A;  4NLN A;  2VJ4 A;  3SAH A;  4UB2 A;  1JRO A;  4B9N A;  2MUT B;  3LVW A;  1ZQR A;  9ICH A;  4Q8E A;  3OGU A;  3RAQ A;  4QW8 A;  2VA8 A;  2HHU A;  2JH1 A;  2FPM A;  2RLT A;  3HT3 A;  4ELT A;  5CHG A;  5KFG A;  4QWA A;  1NOM A;  8ICO A;  2ZIU A;  2BZF A;  5KAI U;  1UT8 A;  2E8M A;  2OWO A;  1ZQW A;  4MFA A;  1ZJM A;  4QZ9 A;  3PW2 A;  3KZI U;  5ALR A;  2ZIW A;  3F2B A;  3A0H U;  3AQF A;  3AUO A;  2JEI A;  4IRK A;  2W9M A;  2W8L A;  3TAQ A;  2KN7 A;  4P0P A;  4C8K A;  5D4B A;  1QQ6 A;  5KFZ A;  3K75 D;  1BPD A;  3IHQ B;  3EWA A;  3MGH A;  3SI8 A;  2KFZ A;  2LYH A;  4QWE A;  4FS1 A;  4Z6E A;  3N97 B;  3EPI A;  5J2K A;  4K4H A;  2DWQ A;  4NLK A;  1IV8 A;  3SR6 A;  5J0P A;  4J9L A;  3T3F A;  3HJE A;  2W8K A;  1SKR A;  4IL6 U;  1NK9 A;  2BDU A;  3PSP A;  4RQN A;  4C8N A;  4GIB A;  5EWF A;  5AI5 A;  4F5R A;  1U45 A;  4G3I A;  2KJ5 A;  4Z6D A;  3U26 A;  4NWI A;  2CPR A;  5KG5 A;  1BVS A;  2QAR A;  1URJ A;  4QZF A;  3ZD8 A;  2KMD A;  5AI8 A;  3M9O B;  3V6K A;  1S97 A;  7ICE A;  4JUZ A;  5ALW A;  3PO5 A;  7ICN A;  2DPJ A;  3HP6 A;  4BJQ A;  4M9G A;  5EE9 A;  5KFP A;  4J9S A;  1NJZ A;  1SWV A;  5AIA A;  5KL1 B;  4J9M A;  1S0V A;  4YCX A;  3IV6 A;  2RDJ A;  4F71 A;  2L5Y A;  4RT2 A;  2W11 A;  4EX6 A;  3SZ2 A;  4PGQ A;  1N56 A;  5KFE A;  1JXL A;  2IOF A;  2KG5 A;  1LB2 B;  2KIW A;  2H3I A;  4QZ8 A;  3MR2 A;  1Q8K A;  3AM9 A;  4OCZ A;  3TAR A;  7ICK A;  5KFJ A;  1S5L U;  1RYR A;  2H3Z A;  4CNQ A;  4YP3 A;  5IIN A;  4IQT A;  4TQS A;  1UQV A;  1KSP A;  3IN5 A;  1DK3 A;  4RQ6 A;  3EZ5 A;  3N7S C;  3G6V A;  1ZQX A;  2RP5 A;  3MC1 A;  3RRH A;  1DOQ A;  1X9M A;  2VIX A;  1L3V A;  2KV2 A;  7ICJ A;  3V6J A;  1Z00 B;  4Y2Y A;  3QU4 A;  5KG4 A;  4F92 B;  4YXM A;  2YMM A;  4RNO A;  8ICK A;  2RHF A;  1PVR A;  1BGX T;  3GIJ A;  1WG8 A;  1S0N A;  2XID A;  2AXT U;  5CR0 A;  1RG6 A;  2D3D A;  5J0X A;  1ZQK A;  3BS7 A;  1TKD A;  1LKY B;  4I2I A;  4KLJ A;  3RRG A;  1PZN A;  3A0B U;  2W7P A;  4DLE A;  2E8N A;  1ZQU A;  3WKD A;  3JPT A;  1UT5 A;  4GXI A;  3M9N B;  4CRX A;  9ICA A;  1ZQB A;  4XUS A;  3TFR A;  7ICP A;  4R8U A;  2HHX A;  1FFU A;  2KD1 A;  4FO6 A;  4C8M A;  1Q3U A;  2K4H A;  2HOQ A;  2KFN A;  1X40 A;  1F44 A;  1A76 A;  3Q8L A;  4KLF A;  9ICX A;  3LWM A;  7ICO A;  2RRD A;  1D8Y A;  4QZI A;  4KLU A;  2OHF A;  4QJF B;  4CCH A;  4OJ6 A;  5AKY A;  1QTM A;  2FI1 A;  1RM6 C;  4DL5 A;  4DF8 A;  1ZQA A;  4I2G A;  5L1J A;  5ALQ A;  4NL9 A;  4OJ5 A;  3QEA Z;  1V85 A;  1Q46 A;  3LYS A;  5KFR A;  2MUT A;  2HW3 A;  3H40 A;  4CGZ A;  3RJK A;  4M04 A;  2HBM A;  4B9S A;  1COO A;  4EYH B;  9ICF A;  2W04 A;  5J2J A;  5B66 U;  3BQ2 A;  1QCK A;  3PML A;  4KN7 A;  3LK9 A;  1PVP A;  2XGP A;  2BPG A;  1JXE A;  2W9A A;  2YMQ A;  3AN1 A;  4MEY A;  4KMU A;  2ZIV B;  2BCR A;  1B0X A;  2EZZ A;  4Y2J A;  8ICS A;  1MN8 A;  4RPX A;  2Y1I A;  2BPC A;  3ZDE A;  1T3Q A;  3B0Y A;  2JRZ A;  4I2B A;  2XGQ A;  2P35 A;  3SMV A;  3BJY A;  4QZA A;  4J9R A;  2NV3 A;  4Y2V A;  4ED7 A;  4OJL A;  3SAF A;  2P6R A;  4JK1 A;  4NV0 A;  3RH6 A;  1N5X A;  5ALI A;  1DGS A;  4PGY A;  5J2B A;  4JMU A;  2Y9T A;  3ETR A;  3ZI4 A;  1TV9 A;  3M8S A;  3NTU A;  5ALN A;  2HOI A;  3C21 A;  2W7O A;  5CEH A;  1XO1 A;  2ISO A;  2LMR A;  3IP4 B;  4RQ1 A;  2KKV A;  4UW9 A;  1NJY A;  3WU2 U;  1SV0 A;  4R63 A;  3MFI A;  3BQ7 A;  2ESE A;  3PMN A;  4KTQ A;  5DDM A;  2FLL A;  4IR9 A;  5L1L A;  1KBU A;  4IQW A;  2JGA A;  4DL6 A;  2FPK A;  4ED3 A;  4KLE A;  2JMG A;  3Q8P B;  4J9N A;  3RBD A;  5J2H A;  2CXY A;  1SKW A;  4I27 A;  4QZC A;  3OPX A;  4DFK A;  2NO5 A;  1ZQH A;  3RR7 A;  4YN4 A;  2B0C A;  5L1I A;  1B43 A;  1SL0 A;  4BXO A;  5ALF A;  1S10 A;  4UBB A;  2E8O A;  2O6K A;  1ZQN A;  3QNM A;  1ZQC A;  3PO4 A;  4KLS A;  4BX9 C;  4FBT A;  1ZD2 P;  3C1Z A;  3KFU F;  4MF8 A;  4RT3 A;  1L3S A;  2YY6 A;  4C4R A;  2KZM A;  4KLD A;  1HIW A;  4G9B A;  1K1S A;  2VA3 A;  3WKE A;  4J9P A;  4R66 A;  1U4B A;  4NY8 A;  4WJ3 B;  3SYZ A;  1PK3 A;  4B9U A;  1VLB A;  3NVY A;  1DK2 A;  3AMZ A;  1WWV A;  2H3F A;  1NK6 A;  3ALR A;  1UA0 A;  2XY6 A;  5GTH U;  2KTQ A;  1PK1 B;  2P6U A;  1Z00 A;  4GXJ A;  1JMS A;  2W43 A;  2J6U A;  1DGJ A;  3M1Y A;  1D8L A;  4PZN A;  1KTQ A;  2K4I A;  1ZQT A;  1WWU A;  5DB7 A;  1N60 A;  4DQI A;  3IM1 A;  3PSI A;  3OHA A;  1ZQ1 C;  1ZQL A;  5AIB A;  3NGD A;  2R8I A;  2PFP A;  7ICF A;  2LYA A;  4RUA A;  4KLH A;  8ICL A;  1LKY A;  1ZD5 A;  1ZQP A;  5J0Q A;  2G08 A;  2LPE A;  4UQG A;  4HYK A;  7ICR A;  1ZQQ A;  4CF3 A;  4UB3 A;  2KP7 A;  4QW9 A;  5C5J A;  2Q4T A;  3BQ0 A;  4UAU A;  7ICH A;  4EBD A;  9ICM A;  2AHO B;  5J2I A;  2B6G A;  3E58 A;  4ECZ A;  4UAR A;  5III A;  2C2R A;  5AIC A;  5KFQ A;  5C0Y A;  3CP8 A;  9ICW A;  3F2C A;  4EYI B;  3RJF A;  5ALS A;  2EAP A;  5KFY A;  3JPP A;  4YQW A;  3GQC A;  5AKX A;  4F93 B;  4I2E A;  2JEF A;  2P66 A;  4YD2 A;  8ICM A;  4O3M A;  1N48 A;  5KFA A;  1S9F A;  3FYH A;  3ZDD A;  2E3T A;  1BPB A;  2WF6 A;  2JH7 A;  2UVU A;  3LDA A;  4P0Q A;  4FFD A;  3KKA A;  2R8G A;  4QZG A;  1X6I A;  3PST A;  3UMB A;  4MFF A;  1C7Y A;  3K4G A;  1A77 A;  1JRP A;  5E79 U;  2ZXI A;  1T7P A;  1RQL A;  3GU3 A;  3HW8 A;  4Z6C A;  3I28 A;  3GV5 B;  3OJU A;  3H4D A;  1BNO A;  3MDC A;  3JPR A;  2ZIV A;  4F4Y A;  3PW4 A;  4XQ8 A;  2ZJ5 A;  2ZG6 A;  4NM2 A;  2IBK A;  7ICT A;  2AGP A;  3RJI A;  4ED8 A;  1U9L A;  4B9L A;  1O03 A;  2DF4 B;  2W03 A;  4UB6 U;  4UAV A;  2PKE A;  5KT7 A;  1K5O A;  4IRD A;  1U49 A;  5L1M A;  5J0U A;  2W3R A;  4UB4 A;  4ACO A;  1KLN A;  3S6J A;  3VCB A;  7ICG A;  3V72 A;  2KJ8 A;  3GZF A;  1F5S A;  2W55 A;  4R64 A;  2DFL A;  3EUB 2;  3JPO A;  3RF9 A;  2R8J A;  9ICQ A;  3QUC A;  4LZG A;  4TUS A;  5J8Y A;  2R8K A;  2G06 A;  3TAD A;  5AI9 A;  7ICL A;  4R65 A;  3H8M A;  5ALM A;  2H5X A;  1TE2 A;  1O08 A;  2BCU A;  3QXG A;  4ELU A;  3D6J A;  4DOA A;  5KG3 A;  2ZUB A;  1NK7 A;  2QKQ A;  3V6H A;  3KBB A;  1MQ3 A;  3PW5 A;  3GV8 B;  3AEV A;  4F4K A;  1RYS A;  2VAN A;  3QU2 A;  1KW4 A;  4PPX A;  1TK0 A;  2JHD A;  3V7J A;  2CRX A;  4QWB A;  5CA7 A;  4YMN A;  3TAP A;  2ZJA A;  4CF4 A;  4J9O A;  2K8B B;  2DBY A;  2W9B B;  5L9X A;  4O3R A;  3FM9 A;  2UVV A;  3HWT A;  1ZD3 A;  5KT2 A;  4EZ6 A;  1ECW A;  2NRZ A;  2HBK A;  1S76 D;  1HUZ A;  2C22 A;  2J6S A;  4KLL A;  4DFD A;  5CP2 A;  2B21 A;  2HVH A;  5AM2 A;  2HHT A;  4IRC A;  1PK1 A;  5HHI A;  2HHV A;  4ED1 A;  3L4P A;  4YG2 A;  1Z4N A;  4Y2R A;  4DSE A;  3B0X A;  4M9N A;  3BQT A;  4PZO A;  9ICB A;  1ED1 A;  2ZUC A;  5KG1 A;  2FMQ A;  2FMS A;  3LVV A;  3WK6 A;  2YB1 A;  3BS5 B;  1SGG A;  2PI4 A;  4DSI A;  5AI4 A;  1T4G A;  4M47 A;  4BUG A;  4GLX A;  1ZQY A;  5HMM A;  1ZOL A;  4F2S A;  4CF5 A;  4UB1 A;  1S77 D;  2K4P A;  2BQR A;  1BPY A;  3CNH A;  4DOB A;  2F8L A;  4XA5 A;  5AKG A;  5DG7 A;  1L8L A;  2FLN A;  1VDV A;  4RNM A;  2F77 X;  1NK5 A;  3N28 A;  3RJJ A;  4YFK A;  4FZM A;  1ZQG A;  1Z19 A;  4U6P A;  4CDG A;  1ZQE A;  2EDU A;  4NL9 C;  2A1J A;  2EAN A;  3C23 A;  3F2D A;  5AK5 A;  2J6T A;  1D8B A;  5ALT A;  5ALP A;  5KNI A;  5KFV A;  1OUQ A;  4BGD A;  4Y2T A;  3TFS A;  5IIM A;  4ECQ A;  4AYB C;  2WAQ C;  4ED0 A;  4F91 B;  4OD0 A;  2HBL A;  5KG7 A;  3HX0 A;  1D9F A;  2KHQ A;  3H0L B;  4YXJ A;  1T8E A;  3Q8S B;  1N5W A;  4AP9 A;  1JIH A;  3IDW A;  3IRU A;  4EEY A;  1X9W A;  2MSN A;  1ZQM A;  5J2F A;  1J97 A;  2XVT A;  3QEB Z;  3H8J A;  4QZD A;  2ZTE A;  3MDA A;  5KL8 B;  4DSJ A;  4ZOH C;  5AI6 A;  5KFL A;  3UXO A;  2ATL A;  4NLZ A;  2Z7J A;  5J0R A;  2NRV A;  5DQG A;  4NLC A;  1JN3 A;  1KFD A;  4YR2 A;  1QLN A;  4LJX A;  1NKC A;  5EOZ A;  4EBC A;  4RQ4 A;  1QH9 A;  3TKA A;  1S0O A;  2WF8 A;  4J9K A;  1N61 A;  1SV0 C;  4PH5 A;  3QUB A;  4ECR A;  1XS9 D;  3T5K A;  2WF5 A;  2FLP A;  1X42 A;  2F76 X;  2KEY A;  2Y0S C;  1B22 A;  1WUD A;  4C4T A;  3QUQ A;  2GOL A;  4DO9 A;  2IHM A;  3ISB A;  4YVZ A;  3UMG A;  1BPX A;  2IOF K;  1S8O A;  1TAQ A;  5AK4 A;  4I2D A;  3AU2 A;  4QNL A;  4YMM A;  4KLG A;  4BDP A;  4PHP A;  3KHL A;  2PMZ C;  2JZB B;  4O3P A;  1ZRM A;  1ZQD A;  1IM4 A;  5TZV A;  2Y9U A;  7ICQ A;  2WF9 A;  4KLM A;  2YMP A;  2Y1J A;  1ZYQ A;  5JTI A;  1LVH A;  2W3S A;  3DDH A;  5KTQ A;  3RTV A;  8ICV A;  5AM3 A;  1CI4 A;  4RQM A;  2LKY A;  4J9Q A;  2ZTD A;  2Q0Z X;  2A1A A;  3NRZ A;  3EYZ A;  1XSN A;  5J2C A;  5ALE A;  4M9H A;  4UAW A;  1UHU A;  5J0Y A;  3V7L A;  5ALK A;  5IIL A;  5AI0 A;  4ECW A;  3E2E A;  4MFC A;  2R18 A;  1SXE A;  1F0M A;  5F9N A;  3ICX A;  3TAN A;  9ICJ A;  5DGA A;  4JWM A;  4Q45 A;  3CRX A;  5KFT A;  1KKX A;  5KAF U;  3BZC A;  2VJ5 A;  3DEE A;  2AH5 A;  3SEN A;  1ZQI A;  3NRW A;  5DG8 A;  3D2N A;  2G5H B;  3F5A A;  2GLE A;  3WK9 A;  2FJ6 A;  3PX4 A;  2UVW A;  4KLO A;  3V7K A;  3RB0 A;  2MU2 A;  5BPC A;  4O5K A;  2ZXH A;  3M7D A;  4TUQ A;  5AKJ A;  1KFT A;  5AKK A;  2F8K A;  3BS5 A;  3I76 A;  2AGO A;  9ICC A;  9ICU A;  5AKE A;  3O0F A;  4ECX A;  5J2E A;  2AGQ A;  4DQR A;  1L7N A;  4RZR A;  2FE9 A;  1TAU A;  1N2X A;  3D2Q A;  5DBC A;  1XU4 A;  4B9V A;  3OSN A;  1L7M A;  3R9K A;  2KIC A;  9ICL A;  2HSZ A;  2AU0 A;  5KFU A;  1RYU A;  1N63 A;  1L6N A;  5DBB A;  4GC6 A;  2IHN A;  2PI5 A;  4TUR A;  5HML A;  3IG8 A;  5KFX A;  2MAX A;  3CYM A;  3KKA C;  5EE0 A;  1TVA A;  5KT3 A;  8ICT A;  3M9M B;  3C28 A;  8ICH A;  4DS4 A;  4DFP A;  1GO3 F;  3Q8M A;  1CEZ A;  1NJW A;  2BCS A;  4Q8F A;  3QU7 A;  2F3N A;  4ECV A;  3N7P D;  2ASJ A;  3OJS A;  4NLB A;  5KFB A;  4F5P A;  4Z6F A;  4O3N A;  2HMX A;  4QZE A;  3MGI A;  5D49 A;  1KEJ A;  4F5Q A;  5D46 A;  2F44 A;  4IS7 A;  1H38 A;  1QSL A;  3HIL A;  2LHT A;  3BZK A;  2YX8 A;  2KSO B;  2IOH A;  4UB5 A;  3JPQ A;  1MC8 A;  4JWN A;  3PR5 B;  4I2C A;  4TQR A;  2QLT A;  1X9X A;  5HR7 A;  2HI0 A;  2DL0 A;  2BKE A;  4ZH4 A;  4AYB F;  1NKE A;  2EAM A;  2RQ5 A;  2WAQ F;  3UPQ A;  2H3Q A;  3C2M A;  2KKP A;  2NRW A;  3SQI A;  2BDP A;  5F9L A;  3SEI A;  5ALH A;  5ALY A;  2AQ4 A;  5AM0 A;  3E0F A;  3TAC B;  5J8Y C;  4ECT A;  2XY7 A;  4QIW C;  2V9W A;  8ICB A;  2GWS A;  5KFO A;  4Q43 A;  3TAD C;  3H7I A;  2OXO A;  4DEZ A;  1DXS A;  3WK5 A;  4KN4 A;  4RQ0 A;  3KD3 A;  3GV7 B;  3T5J A;  4RQ7 A;  1UA1 A;  4JV0 A;  2KZ3 A;  3H8S A;  1RZT A;  2OM6 A;  7ICS A;  4JV2 A;  3MBY A;  2NRX A;  4ECS A;  1X6J A;  4UAZ A;  4ICA A;  4O0I A;  1FO4 A;  3MR3 A;  3GIM A;  3VC8 A;  2R8H A;  2QB1 A;  4QZH A;  3JPS A;  2JZB A;  5L1K A;  1XO0 A;  5KFC A;  3J81 j;  5CWR A;  1ZJN A;  4O5E A;  1TAM A;  1Q3V A;  3ZD9 A;  4M9L A;  2G0A A;  1KRP A;  1KFS A;  5AM5 A;  2Y0S F;  2NO4 A;  4I2F A;  3NAS A;  9ICO A;  3WKB A;  4Y2U A;  4P2H A;  4QWC A;  2OH2 A;  4USA A;  5J2D A;  2BHN A;  3KTQ A;  5EE1 A;  1DRG A;  5DBA A;  2LM4 A;  5B5E U;  1N62 A;  5KFF A;  2HBJ A;  5EWE A;  2BPF A;  1MA7 A;  5BOM A;  4HAI A;  4NXZ A;  3NS1 A;  2PMZ F;  3PV8 A;  2IA6 A;  2ALZ A;  9ICP A;  1WCL A;  2LM1 A;  1SXD A;  1JI7 A;  1SKS A;  3RJE A;  2K4E A;  4IC9 A;  2BQU A;  3B9J A;  5DLF A;  3RJH A;  1NI3 A;  3T79 A;  2ODG A;  3H0R B;  2KE7 A;  4UAS A;  1ZQV A;  3MGV A;  3C5F A;  4P4P A;  2XCA A;  1NZB A;  8ICN A;  4NJ8 A;  5CJ7 A;  3FDS A;  1RXW A;  2G5I B;  3HKZ C;  1SWW A;  1XWL A;  1OW5 A;  5KT6 A;  2A3V A;  1MSW D;  1QSY A;  2C28 A;  2K8C B;  4FBU A;  5CB1 A;  1X66 A;  4I29 A;  4P4O A;  4DFM A;  5BOL A;  3RH4 A;  2E5S A;  1NK0 A;  2HDO A;  1ZRN A;  4US9 A;  3GIK A;  1MQ2 A;  2WB1 C;  1X2I A;  5ALD A;  4UBC A;  1L8O A;  3HRD D;  3TQ1 A;  5T14 A;  2FPL A;  4FZL A;  2PXI A;  2XIC A;  3RB4 A;  5KFH A;  4IQU A;  4PL1 A;  1SV4 A;  3C5G A;  2DQN B;  3PX0 A;  2KZZ A;  7ICM A;  3GFK B;  2ZUD A;  5IIO A;  1XSL A;  5AK6 A;  3RFA A;  2EZY A;  4M9J A;  1HUO A;  1M6Y A;  3PR4 A;  4RQ8 A;  5AKH A;  4F5N A;  3RJG A;  4ELV A;  2AQ0 A;  8ICY A;  1JX4 A;  2GH1 A;  1FEZ A;  3D2S A;  4ECY A;  1KDH A;  3K1R B;  2YML A;  3H8W A;  5AHX A;  9ICN A;  1IXR A;  4EBE A;  4I2J A;  8ICW A;  4DL2 A;  3C2L A;  4TUP A;  1S0M A;  4YMO A;  4DQS A;  3BQ1 A;  4DS5 A;  2ES6 A;  5ALG A;  5ALV A;  4RQ5 A;  4MEX A;  4F4Z A;  2MRL A;  5HHH A;  4DCC A;  2JXJ A;  5ALU A;  1L7O A;  5HP4 A;  2OEH A;  4C7Y A;  5HNK A;  4C80 A;  7ICU A;  2KSO A;  3PW7 A;  2BGW A;  1K1Q A;  2A19 A;  5A0L A;  2C2D A;  4M6W B;  4FS2 A;  3C29 A;  3NVZ A;  2NRT A;  2YB4 A;  5F3X B;  5JUM A;  3C1Y A;  3ZDB A;  4PHA A;  4C4S A;  2D8C A;  2JR5 A;  2BCV A;  7ICI A;  1A6S A;  4E0D A;  2BCQ A;  3WK7 A;  5IIJ A;  4ED2 A;  3RR8 A;  1XNS A;  1EXN A;  1SZP A;  2F1H A;  2IMW P;  4BXO B;  2K60 A;  4EEK A;  1RDF A;  2F2A B;  3HPO A;  1TFR A;  3AU6 A;  3WKC A;  3T5L A;  5KG2 A;  2GO7 A;  3NVW A;  3PSF A;  3UM9 A;  5KFK A;  4K4I A;  2XI9 A;  1UPH A;  4KLI A;  4RQ2 A;  3I1Y A;  4DSL A;  3H4B A;  5DLG A;  1L7P A;  4Y2X A;  3WKA A;  2WF7 A;  2ZIX B;  2HVI A;  8ICF A;  2EZX A;  1RXV A;  5AM1 A;  1V9P A;  1IIP A;  4RQ3 A;  4UAY A;  4O3S A;  2KK0 A;  4MHV A;  4DQP A;  4QIW F;  1JUD A;  1CUK A;  2K89 A;  1ZQO A;  1OXJ A;  1WYG A;  5ALJ A;  2LBO A;  4DOC A;  2EH9 A;  2F1I A;  3ZDC A;  3ORY A;  3RAX A;  1FIQ A;  2I6X A;  5DGB A;  2HCF A;  3QX7 A;  5AKL A;  2OCE A;  3JPN A;  1Y88 A;  2ZTC A;  4JB3 A;  1COK A;  5IIK A;  3QU9 A;  1KL9 A;  4QZB A;  4DL3 A;  2E8P A;  4PHD A;  5G5G A;  8ICX A;  8ICZ A;  2XCP A;  4OJP A;  1KN5 A;  4B9T A;  1A0P A;  5DB8 A;  4KX5 A;  2WTF A;  4GFJ A;  2DKX A;  2BQ3 A;  2NYV A;  7ICV A;  2W9C B;  1PVQ A;  1B4F A;  1ZQS A;  3BDP A;  8ICP A;  2G07 A;  2N1R A;  3DV9 A;  4FE3 A;  3OTQ A;  2QB0 B;  5AK3 A;  1ZQZ A;  2H3V A;  4DFJ A;  4KIT B;  5FP0 A;  4F8R A;  3OHB A;  2WFA A;  9ICG A;  1BPE A;  4P4M A;  5DQI A;  4F72 A;  3PX6 A;  8ICA A;  3MAB A;  3F53 A;  4YR3 A;  1BPZ A;  4LZD A;  2ISP A;  4MF2 A;  5G5H A;  1TK5 A;  3MR6 A;  4P0Q B;  2XO7 A;  3MR5 A;  2YN4 A;  2PFN A;  8ICJ A;  1X9S A;  4EZ9 A;  3PW0 A;  3Q8K A;  2JEG A;  1KQQ A;  1J2M A;  3RBE A;  2DUY A;  4DL4 A;  3C2K A;  1HEK A;  3KHR A;  5J0O A;  3RB3 A;  1SL2 A;  2W9B A;  1YZ7 A;  2E1F A;  3RB6 A;  5JRT A;  3HKZ F;  4DL7 A;  1U47 A;  3QUT A;  2ASD A;  2I9G A;  1NJX A;  1NK4 A;  5J2A A;  2PFO A;  3GII A;  5J0S A;  5KFS A;  2DKZ A;  8ICU A;  4Y2Q A;  9ICR A;  1XC9 A;  2C2E A;  5AKI A;  4I28 A;  5ALO A;  4YR0 A;  9ICE A;  2KOB A;  1HJP A;  5EE3 A;  2WB1 F;  5GTI U;  3AL0 B;  4B9M A;  2RDI A;  4US8 A;  4RU9 A;  3MFH A;  4ED6 A;  3PNC A;  5HR6 A;  4F50 A;  9ICS A;  4GXK A;  1VJ5 A;  5K4L A;  2DGZ A;  3QZ7 A;  3ONN A;  3EPG A;  2I5H A;  3UXN A;  3ISD A;  3UQ0 A;  1P7D A;  4M6W A;  4O5C A;  1ARO P;  1SL1 A;  5TIS U;  2PFQ A;  1Z1B A;  1L3T A;  5KT4 A;  3GIL A;  4Y2S A;  3UQ2 A;  2F1J A;  5KFW A;  2ZIU B;  8ICC A;  4B6J A;  5DB9 A;  3SV3 A;  3KHH A;  4C0Z A;  3Q8Q B;  2HHS A; 
#chains in the Genus database with same CATH homology
 3M6Z A;  2DQN B;  2G0A A;  3KZX A;  2XI9 A;  2G08 A;  2HOQ A;  1UPH A;  2K4H A;  4NLB A;  5KL1 B;  5KL8 B;  2Y0S F;  1F44 A;  2ZIW B;  2VJ4 A;  2R18 A;  5CRX A;  3SAH A;  2M0N A;  2HMX A;  2RRD A;  2Z7J A;  2OH2 A;  4P0Q B;  3RFA A;  4NLC A;  3ICX A;  4A8E A;  3M6K A;  1KBU A;  4P0P B;  3LVW A;  4ACO A;  4QJF B;  2Q4T A;  4OJ6 A;  3CRX A;  4WJ3 B;  2ZIX B;  3VCB A;  1ED1 A;  2JGA A;  1DRG A;  2KJ8 A;  2JMG A;  2JH1 A;  3GZF A;  1IIP A;  2H3I A;  2KIW A;  2VJ5 A;  2YB1 A;  3LVV A;  4KX3 A;  2LHT A;  2GH1 A;  2ZIU A;  2YX8 A;  2HBJ A;  3DEE A;  2D6F C;  3D2S A;  4OO1 J;  2KNJ A;  1HEK A;  2LYB A;  4QIW F;  3RF9 A;  4BUG A;  2VKQ A;  4FZN A;  1MA7 A;  2E1F A;  5C0Y A;  3CP8 A;  3NRW A;  2H3Z A;  3OPX A;  3F2C A;  2PMZ F;  3K1Z A;  2K89 A;  3D2N A;  3HKZ F;  2LBO A;  2G5H B;  2ZIW A;  3F2B A;  3F5A A;  3AQF A;  4OJ5 A;  2F76 X;  2OYY A;  2KEY A;  2Y0S C;  3LYS A;  5HR7 A;  4P0P A;  3IN5 A;  2F8L A;  2G06 A;  3N7S C;  1WUD A;  4AYB F;  4CGZ A;  2WAQ F;  2HBM A;  2KHV A;  2H3Q A;  2GOL A;  2CN1 A;  2K4E A;  2ZIX A;  2ZXH A;  4IC9 A;  2KKP A;  2RP5 A;  3M7D A;  2KVC A;  4BX9 C;  3SQI A;  3IG5 A;  2F77 X;  3T79 A;  1CRX A;  1SZH A;  2MRL A;  3F5E A;  2VIX A;  3H0R B;  3N7R C;  4O3M A;  2KV2 A;  3AQE A;  4FZM A;  4OJO A;  3MGV A;  2E1E A;  3KFU F;  2W04 A;  3O0F A;  1Z19 A;  2KOB A;  4U6P A;  4PL2 A;  4CDG A;  4QNL A;  2WB1 F;  3E0F A;  1HIW A;  2JH7 A;  1NZB A;  3AL0 B;  4QIW C;  2MA1 A;  1PVP A;  3F2D A;  5A0L A;  2G5I B;  4P0Q A;  2RHF A;  1PVR A;  1T94 A;  3PZP A;  3D2Q A;  2PMZ C;  4KMO B;  2ZIV B;  3C29 A;  1D8B A;  2XID A;  2OXO A;  2K8A A;  3HKZ C;  5HR6 A;  3PST A;  4OJP A;  2KIC A;  2YB4 A;  2A3V A;  1A0P A;  1YT3 A;  2JHD A;  2HOF A;  1OUQ A;  4KX5 A;  1Q3U A;  2CRX A;  4GFJ A;  2H3F A;  2K8C B;  4AYB C;  2BDU A;  3PSP A;  3ALR A;  2WAQ C;  2ZXI A;  2K8B B;  2W7P A;  3SMV A;  2OM6 A;  2HBL A;  3GU3 A;  1PVQ A;  2KJ5 A;  2DGZ A;  3ONN A;  1L6N A;  3H0M B;  4NWI A;  2CPR A;  4ICA A;  2E5S A;  2NV3 A;  1A6S A;  2G07 A;  4OJL A;  3SAF A;  4CRX A;  2KHQ A;  2N1R A;  4NV0 A;  2K4I A;  4FE3 A;  3H0L B;  1URJ A;  3IG8 A;  1P7D A;  1XNS A;  4JMU A;  2H3V A;  3CYM A;  3VC8 A;  2WB1 C;  3PSI A;  1ECW A;  2HOI A;  2ZIV A;  2W7O A;  2LKY A;  2HBK A;  1ZQ1 C;  2F2A B;  5T14 A;  4U7C A;  4FZL A;  3C28 A;  1Z1B A;  2ZG6 A;  2G09 A;  1GO3 F;  3IP4 B;  3L3F X;  1XO0 A;  2XIC A;  2KKV A;  3SAG A;  3NUQ A;  2LYA A;  2ZIU B;  2KD1 A;  3F53 A;  4BJQ A;  2XVT A;  2DF4 B;  2W03 A;  3PSF A;  4PL1 A;  1TAM A;  1Q3V A;  3N7P D;  2KJ9 A;  4C0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...