4AYBF

Rnap at 3.2ang
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
b'SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSNRTYTSEDIQKIIDII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
total genus 13
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4aybF02
2Y0SF 3HKZF 2WB1F 2PMZF 4AYBF 2WAQF
chains in the Genus database with same CATH superfamily
2W55A 3WKEA 1ZQLA 1JXLA 4Y2QA 8ICIA 5KFUA 1SL2A 3KFUF 5AK5A 5AM3A 5AKYA 5J0XA 3SR6A 4M2YA 4MFFA 4OJ5A 3IV6A 2P6UA 1FFVA 4R66A 2ZTEA 4IQVA 2P66A 4UB5A 3U26A 2GWSA 1LB2B 1MSWD 4O3SA 2HHXA 2BPGA 4DOBA 4NV0A 5D49A 3D2SA 5AKEA 1ZQDA 2VKQA 1ZQTA 3EW9A 3SV3A 5KFMA 3T3FA 3C29A 2BDPA 4RQMA 2HHSA 1SV4A 3WK4A 1RYSA 4F4WA 1AROP 3C5FA 1NK9A 3BS5A 4QZAA 4YMNA 1RXWA 1LVHA 2HHQA 2QB0A 3JPQA 3BS5B 4O0IA 3AQEA 2C2DA 4F5OA 5KNIA 3EPGA 1UPHA 2L5YA 4Z6DA 2KN7A 4UB3A 2EANA 2KE7A 2KOBA 2FMSA 4KLJA 2MRLA 4F5PA 4ECXA 3WKBA 4B9TA 3JPOA 3RAXA 1S5LU 5AKHA 1V38A 2BKEA 3ORYA 1QQ7A 1NK7A 4F4ZA 2LBOA 8ICSA 4RQ1A 4RPYA 2Y1JA 4F2SA 4QWEA 5ALKA 1A76A 2W54A 5ALMA 1BPBA 2Y0SC 1UHUA 1U45A 2BPFA 2XY6A 2XY7A 5J2HA 5A0LA 1DXSA 1A0PA 5J0OA 2AGOA 1BGXT 5AKLA 1JALA 4DF4A 3M9NB 3MR3A 4X5VA 3WKDA 3PR5B 4UARA 3MC1A 3KHRA 2BCUA 4EENA 4TQSA 5KG7A 3F2DA 4MF2A 3VCBA 4KLHA 4Z6EA 1J2NA 3GV8B 5J8YC 3C28A 1ZJNA 2NO4A 3HILA 2E1FA 2H3VA 4PL1A 1BVSA 4I2FA 3Q8RB 2R8GA 3MGHA 4RPZA 2M9NA 1SL1A 3IM1A 2ZXIA 2J6TA 4QZ8A 4C7ZA 2H3ZA 4K4IA 3M6KA 2DBYA 5AM4A 1ZQPA 3ZD9A 5J2FA 2JV3A 3GFKB 5DG7A 1FEZA 3GV7B 3H0RB 4C7YA 5EE0A 4ECVA 1BPYA 2KFNA 2DL0A 3PZPA 4FO6A 3H4BA 3QU4A 1X40A 3BJYA 4MEXA 5KL8B 4ELVA 3ED5A 1RYUA 1TKDA 8ICBA 4OJOA 3L4PA 1WWUA 5CHGA 3C2LA 3RR7A 3WKAA 3M8RA 3DV9A 1YZ7A 2LM1A 2XI9A 2VJ5A 3F2BA 3PNCA 2K4HA 4M9LA 4C8KA 2W7PA 1PVRA 1KKXA 4HAIA 2KZ3A 7ICIA 2B0CA 4IR9A 1BNPA 5CA7A 3Q8SB 3IG5A 2YY6A 3KBBA 2ZUCA 1KQQA 2OWOA 5EE1A 2DKXA 1NZPA 3FDSA 4LVSA 9ICAA 9ICKA 1ZQBA 2FPMA 2J6UA 2HDOA 2DFLA 4JWNA 3HW8A 3CRXA 4NL9C 2HCFA 1SV0C 5KT2A 8ICUA 4U6PA 4RT3A 4M9HA 5KG2A 5ALLA 1TK0A 3HWTA 5AI8A 5DLGA 2RDJA 3PSIA 4YD1A 5KFBA 5AK4A 9ICVA 1B4FA 5KTQA 3B9JA 1Z00A 4QZCA 1RPLA 3PW4A 1N63A 3H0MB 2UVUA 4EYIB 3KTQA 5ALGA 2HOIA 1Z00B 3A0HU 3HT3A 3DEEA 1ZQIA 5KFWA 3JPRA 3PSTA 1ZETA 2WHEA 3JPSA 4UQGA 1VJ5A 2KJ8A 1S10A 2EZXA 4PHAA 4R8UB 2WB1C 2KHVA 4ED2A 2RLTA 5EE3A 2W43A 4ECUA 5AKGA 1ZRMA 2DF4B 1ZRNA 5KFIA 4KLQA 4OCZA 4GXIA 4EZ9A 5J0TA 4C4RA 3JPNA 3HRDD 5CR0A 3J81j 8ICJA 9ICHA 3G6VA 9ICTA 4QW8A 3NGDA 2JEGA 5E79U 5J0RA 4FZNA 3IRUA 4QIWF 4Q45A 3Q8LA 1QSLA 4YN4A 1U49A 2JMGA 1C20A 2OXOA 8ICKA 1RG6A 1BPDA 1O03A 5DQIA 2RQ5A 3RB4A 3H40A 4Z6CA 4DFJA 4C4SA 1L3VA 4FBTA 3V6KA 1X9SA 2LMRA 4P0QB 4RNOA 2OYYA 5J0QA 2Y9UA 1URJA 5DB9A 2W9CA 2G0AA 5BOMA 2EZYA 4M0AA 1SIJA 2EDUA 5AK6A 2W9CB 1TAUA 3DDHA 1N56A 4UAUA 1OUQA 4MFAA 5AIAA 5G5HA 3RJHA 5CB1A 1JRPA 1JROA 3PSPA 1ZQGA 1UCVA 4BXOA 3ISBA 4CF5A 2E8PA 4DSLA 2HBKA 4UB2A 3H8SA 2NRVA 5AI4A 4IQUA 3V6HA 4O3QA 4M6WB 8ICXA 4EX7A 2P6RA 2KKVA 5C0YA 3TI0A 4F4YA 2NRZA 3ZDCA 2MUTA 3WU2U 2MA1A 2W7OA 2F77X 1SWWA 5AI5A 1ZD3A 9ICXA 4FS2A 3TADC 5L1IA 1Q8KA 1LKYA 2KSOA 1VLBA 4DOCA 4Y2SA 9ICNA 5J2GA 4RQ7A 5EOZA 3Q8PB 3FYHA 1U4BA 5CRXA 4QJFB 4O3PA 2JHDA 4RQNA 1L8LA 3QE9Y 4P2HA 5AHXA 2K4IA 1L3UA 2F76X 4QZEA 4I2HA 1KN5A 4JV1A 1TVAA 5HR6A 4IRDA 3LVVA 2VA2A 4F4XA 5DDMA 2KKPA 2BR0A 2H3QA 2JH7A 4B9LA 5KG4A 2ASJA 3OGUA 4DFMA 2JEFA 4QW9A 8ICTA 4M9NA 2A1AA 4F5QA 3H8MA 4KN4A 4EBEA 3ZD8A 1N60A 2R18A 3MABA 8ICWA 4FZLA 1SXDA 4ED8A 9ICGA 1KL9A 4YXMA 4O5CA 2WB1F 1HEKA 3SAHA 2D3DA 2NYVA 4DF8A 1S8OA 3ONNA 4Y2PA 2XO7A 5KG5A 4ACOA 3QEAZ 3SMVA 2HOFA 1N5WA 1WCNA 2W3RA 1DRGA 4US8A 1NJZA 3HPOA 4C8OA 4F3OA 2K4EA 2Z7JA 3Q8KA 2BHNA 2ZG6A 1ZQHA 5KT7A 1N2XA 2PFQA 3RR8A 1BPZA 1H38A 2HBLA 4TUSA 2VA3A 2BQUA 1X9MA 1JIHA 2Y1IA 1S77D 3LWLA 1VDVA 4DSIA 2M0NA 4Q44A 3M9MB 5J2IA 4B9NA 9ICCA 4UATA 4P4OA 2E3TA 3LVWA 5KFFA 8ICQA 3KHGA 3PX4A 1ZXIA 2R8JA 2YMPA 2ZJ5A 4JB3A 4P0PA 3FAHA 4NLKA 3ISCA 3BQ1A 1NJWA 1T94A 3FM9A 2AJQA 1QSYA 3SD7A 5AI9A 3SQIA 3JPTA 1MC8A 3B0YA 5KFAA 3OSNA 4FBUA 5J2AA 2LM4A 3SYZA 5KAFU 3V7JA 5H2FU 5KT4A 1B22A 3SAFA 2XGPA 4C8NA 2F1HA 1SB3C 3L3FX 1U48A 5KFPA 3PW0A 5KFYA 1KSPA 4JV2A 2OCEA 8ICMA 3QU7A 1BPXA 1NNLA 3PVXA 3OHBA 7ICJA 3D6JA 2JZBA 4KX5A 4PGQA 1ZD5A 1XO1A 2R8HA 4ELTA 1AQ6A 3HKZF 2Y9TA 2JZBB 4PHPA 3NS1A 2F44A 2AU0A 5L1LA 4O3NA 2IMWP 4RPXA 2YX8A 2BQ3A 1O08A 2K8BB 4B9UA 5ALQA 4DS5A 5DG8A 3CYMA 3RB3A 3QUTA 3NVZA 4ED1A 3EZ5A 3BS7A 1L8OA 3N7SC 2QB1A 2QB0B 2KHQA 3M1YA 4F72A 1TK5A 1L7MA 2NV3A 1MQ2A 2FPLA 1QH9A 4KITB 3EUB2 1RYRA 2WTFA 2QARA 5F3XB 3GU3A 9ICUA 3QUBA 5BPCA 5CWRA 2WF8A 5J8YA 1XS9D 4PJ0U 4IQTA 3F53A 2ZJAA 2KFZA 1U9LA 1KDHA 4YR2A 2B21A 4IS7A 4I27A 3GIIA 2NO5A 1OW5A 3KKAC 4ED3A 1WYGA 2FE9A 4QZIA 2G5IB 4F5NA 3UQ0A 4F93B 3PV8A 2W9BA 5L1MA 4ECZA 5CJ7A 4RQ0A 3M7DA 4BUGA 4C0ZA 5J2JA 2XCAA 8ICYA 1KFSA 4J9RA 2G09A 5J0YA 2C22A 2G07A 4KLTA 3LWMA 8ICHA 1FO4A 4OO1J 2FLNA 4DFDA 4GXKA 1SGGA 4EZ6A 4IR1A 2ODGA 2MSNA 4I2BA 1B43A 1L3TA 2NRWA 2V4RA 3KOOA 2OEHA 2N1RA 2G5HB 4B9SA 4C8LA 3QX7A 1J2MA 2Q0ZX 1L5UA 2I5HA 1MQ3A 3MDCA 4O9MA 4YG2A 2YB4A 2W8LA 4KLDA 1JXEA 1UQVA 2KMDA 5EE9A 4PH5A 2QLTA 1S0VA 2V9WA 3UXPA 5EWEA 5KFQA 3I1YA 5HR7A 3UPQA 4LZDA 3PR4A 3NUQA 4PZNA 7ICHA 5DBAA 4B9MA 3TFRA 1IXRA 3GZFA 3F5EA 4CRXA 1ZQXA 3UXNA 1U47A 4EBDA 1KFDA 4NLCA 4NL9A 1SV0A 3TACB 4CDGA 3M6ZA 4PL2A 3PMLA 1D8BA 4G9BA 7ICNA 2VIXA 4YQWA 8ICFA 4AYBC 3NVYA 5T14A 2LKYA 4BWJA 2HOQA 2KICA 2DPIA 7ICUA 2HW3A 3QNMA 9ICOA 2EZZA 4Q8EA 4F8RA 3BQ0A 9ICFA 4DLGA 2WF7A 2XY5A 4KLLA 3M8SA 5ALEA 3K1RB 4YD2A 1Z1BA 2K89A 2IA6A 3BQ2A 2JR5A 1COOA 4KLFA 1X6IA 3K4GA 3NASA 2XVTA 3EYZA 9ICQA 8ICVA 2OM6A 4YP3A 3RJJA 1HUOA 1NOMA 1D9DA 3KZXA 1ZQMA 2UVWA 5ALWA 4KX3A 3NRWA 4I29A 3UMCA 3OSPA 5JTIA 4DSFA 4WJ3B 3WK5A 3WK6A 5J2EA 7ICSA 4K4HA 1T8EA 3BDPA 2P35A 4KLMA 3PX0A 4J9QA 2ZJ8A 5AI0A 2R8KA 2W3SA 1Y88A 4YFKA 2IOHA 2RHFA 4DQSA 3Q8QB 1LV5A 3WK7A 3RBDA 3MBYA 4TURA 1WCLA 1XWLA 5KFJA 1HUZA 4KLIA 1PVPA 4OJPA 2J6SA 2ASLA 4ED0A 2G06A 3LYSA 4YMMA 1NKEA 9ICBA 2HSZA 2Y0SF 5IIKA 2RRDA 7ICMA 2E5SA 7ICRA 3M9OB 3TAQA 2AXTU 4DFPA 1L7NA 2JRZA 5IILA 5IINA 1XSPA 1HIWA 4AP9A 4O5EA 9ICRA 4FE3A 2W03A 3IG8A 4DSEA 2FI1A 3QZ8A 3QXGA 2EAMA 1F0MA 3RBEA 4ICAA 2KK0A 4RQ3A 2ZIXA 5AM5A 2EQYA 3N7PD 5JU5A 4KMUA 2ZIXB 4RT2A 2LYAA 1L6NA 1MN8A 1PUZA 4F92B 4LJXA 9ICSA 2C28A 1ZQKA 5ALOA 3T5JA 3H8WA 4J9NA 4UBCA 1K5OA 5KG0A 3C2KA 1B0XA 1UT8A 4PGYA 1C7YA 1QLNA 4M9JA 2V4QA 8ICAA 3N97B 3I28A 3TADA 2WAQC 2ALZA 2RDIA 9ICLA 4B9VA 2RP5A 3C1YA 3NTUA 2F8KA 3RJIA 2BCQA 4QZBA 3THVA 5BOLA 3AM9A 4KTQA 5D46A 5HHHA 4UAWA 9ICJA 1KFTA 4BXOB 1JN3A 3PY8A 1M6YA 4ECQA 3V6JA 3MFHA 3IHQB 5AKKA 2BCSA 4DL3A 4KLUA 5D4BA 3SV4A 3ICXA 3ZDBA 4O5KA 1X9WA 2AQ0A 5KT3A 4J9MA 1SKWA 4KLOA 4ECWA 2FPKA 5CEHA 4UW9A 3ISDA 4JWMA 4IQWA 2MUTB 5KFSA 5KG3A 2I9GA 3PW5A 2R8IA 5AICA 1LKYB 1YT3A 3SENA 5F9NA 2F1JA 2DWQA 2KSOB 2VANA 2HVHA 3N7RC 8ICGA 1TFRA 3ZDAA 3NVWA 5ALIA 5AKZA 3S6JA 5IIMA 4US9A 4OJLA 4QWAA 1TAQA 5ALPA 4DEZA 1D8LA 3CW2C 2JEJA 1XNSA 5FP0A 1Z19A 3GV5B 1L3SA 4MEYA 2WFAA 3C2MA 1WG8A 3N28A 4F50A 5KFNA 2H3IA 5ALZA 4GLXA 5JRTA 2NRXA 5J0SA 5ALRA 1PK1A 3E58A 2VJ4A 4CGZA 5EWGA 5KG1A 4JUZA 2A3VA 3A0BU 5KFVA 2WF5A 2CXYA 5KFDA 4DLEA 4JK1A 1K1SA 3G6XA 3E2EA 4LZGA 3RH6A 2OH2A 1NJXA 4C8MA 3H0LB 3ZDDA 4I28A 1ED1A 1TV9A 4FZMA 4NM1A 1ZQCA 2IOFA 5AKJA 3SEIA 2ES6A 2KIWA 3NRZA 3AU6A 5DGAA 3KHHA 4QZGA 2YMMA 3F2CA 4GC6A 1ZQ1C 1UA1A 4NLGA 1S76D 4ZH4A 2VA8A 4YCXA 3BQTA 4DCCA 4Y2YA 2CPRA 3D2QA 1NKCA 5AM1A 3CP8A 2AQ4A 1NK5A 4CF4A 1QSSA 3EPIA 4MF8A 4I2CA 2GH1A 3T79A 4PZOA 4ECRA 2DUYA 2A1JA 1IM4A 3C23A 1YZ6A 5KL1B 4YR3A 1P7DA 4IRCA 3RJGA 3SZ2A 2PMZC 1NI3A 1DGJA 5J2CA 4FFDA 1Q3VA 1A77A 3MFIA 4TQRA 9ICPA 1RDFA 4J9SA 2PKEA 5G5GA 7ICLA 4JV0A 3QUCA 1SWVA 1XO0A 4PHDA 2KVCA 2IBKA 5C5JA 1J97A 2KIVA 5J2DA 3RB6A 3RFAA 4ECTA 4GIBA 4Z6FA 2F3NA 3QU2A 1X2IA 2ISPA 4P0PB 5IIOA 1JUDA 5IIIA 4A8EA 3UM9A 2K4PA 4J9KA 2DQNB 3HX0A 2XGQA 3RJKA 5TZVA 2AH5A 2KD1A 4YXJA 3KHLA 4F71A 3T5KA 4GC7A 2E8MA 3N4MB 3SAGA 4QWBA 3AUOA 2W8KA 1ZQFA 3RH5A 4I2AA 3AEVA 7ICFA 3T5HA 1X66A 2LHTA 5L1KA 2AGPA 5J29A 4Y2UA 4F91B 3HJEA 3TKAA 3CNHA 3SI8A 4UAVA 2Q4TA 2W11A 5KFTA 4RQ6A 5GTIU 3QZ7A 7ICGA 4IC9A 1CRXA 4MHVA 1T3NA 3ZI4A 3RTVA 1COKA 5ALYA 1S9FA 4Y2RA 3KKAA 1QCKA 4J03A 1ZQOA 2FJ6A 1WWVA 2WF9A 3PO5A 5ALJA 4GXJA 1ZD2P 1S0NA 3TAPA 4J9PA 4NXZA 2IOFK 3WK9A 4RQ5A 3LDAA 3V72A 4I2EA 2E8NA 5DQHA 4I2DA 3TARA 3TANA 2KTQA 2QARB 2D8CA 5CP2A 2KEYA 1ZQVA 3PW2A 4UASA 2ZUBA 3PSFA 4NJ8A 2MAXA 1KTQA 1XSLA 5DB6A 5KFGA 4PGXA 3MR6A 1CUKA 3OHAA 4QWCA 1ZQUA 1TK8A 1ZQEA 4EBCA 1IG6A 2GOLA 5AKXA 4XUSA 5B66U 5ALTA 5HMMA 5L1JA 2W9BB 4UBBA 3H8JA 2DGZA 7ICPA 4RUAA 4O3MA 4M04A 4DSJA 2PI4A 3QU9A 1EXNA 4DWIA 4KMOB 5GTHU 2LYBA 4CNQA 3IP4B 8ICZA 2ZIVA 1ZJMA 2YMLA 1ZOLA 5KT5A 3JPPA 4QIWC 4RUCA 2ZIVB 4DL5A 3R9KA 4USAA 2DPJA 4CF3A 1FFUA 4M47A 4UB1A 1NK0A 1SL0A 5DB7A 8ICRA 4YMOA 4C80A 3MR2A 3ZDEA 1CI4A 4OD0A 2YMQA 2PMZF 2JXJA 4QZDA 3I76A 4DS4A 4U7CA 2JH1A 2YQEA 4ECYA 3K1ZA 1S0OA 4MFCA 1ZQRA 3AL0B 5ALUA 4QZHA 1N5XA 4QZ9A 4CCHA 2KZMA 1V97A 4F2RA 2PFPA 1T4GA 3MGVA 4I2GA 7ICOA 9ICIA 3UMGA 1T3QA 1N62A 1K1QA 3AMZA 5ALNA 1QQ5A 5HHIA 2GO7A 3V7LA 4BX9C 1ZD4A 3C1ZA 3PX6A 2DKZA 4TUQA 3IDWA 1Z4OA 3TQ1A 1UT5A 2HVIA 3RJEA 1JX4A 2CN1A 3QUQA 1L7PA 1T7PA 3GILA 1A6SA 2O6KA 2FMQA 1X9XA 2HHVA 1DK2A 1SZHA 1S0MA 5JUMA 4CE6A 3F5AA 3RH4A 2B6GA 3HP6A 4HYKA 3OJSA 4E0DA 8ICPA 4ED7A 2NRTA 4QNLA 1NZBA 3TFSA 4UB4A 1ZYQA 1KLNA 1V9PA 2W04A 2PI5A 2EH9A 1KBUA 5HNKA 1GO3F 2BGWA 2ATLA 2JGAA 4DQQA 3E0FA 1ZQAA 3GQCA 3LK9A 3RB0A 4DL4A 2HHUA 5B5EU 3Q8MA 2JEIA 5J0PA 5HP4A 3GIMA 1MA7A 5ALXA 4RQ4A 1SKSA 4DSKA 1F5SA 1Q3UA 2IHNA 1RZTA 2ISOA 5DBCA 1IV8A 5K4LA 2QKQA 4XA5A 5ALDA 1UA0A 5ALVA 2FMPA 2C2RA 3UMBA 4XRHA 4RU9A 4DO9A 4DOAA 1NK4A 2BDUA 2LPEA 2F2AB 5HMLA 5AIBA 3FC4A 3G6YA 4NLNA 4R8UA 3ETRA 5AKIA 1TAMA 1ZQZA 4YVZA 2YTUA 5KFEA 3MR5A 1D9FA 2XC9A 8ICNA 2KG5A 2AHOB 2K60A 4FS1A 1CEZA 4DL7A 3H4DA 2PFOA 4KLSA 2W9MA 1ZQJA 4GFJA 4EEKA 2W9AA 2XIDA 3VC8A 1L7OA 4IL6U 3QU5A 5KFHA 5KFRA 5DG9A 2K8AA 1ZQSA 5J2KA 2KJ5A 2GLEA 2E1EA 3PW7A 1IIPA 3AN1A 2KP7A 1XSNA 4KLGA 2I1QA 5F9LA 2YB1A 2K8CB 1TE2A 2ASDA 2KNJA 4TUPA 5AI6A 3WKCA 2H5XA 3MDAA 4Y2XA 7ICKA 3WK8A 4P0QA 1ZQQA 3OPXA 4C4TA 1NKBA 4DL6A 1JI7A 5AM0A 3PMNA 1SXEA 2ZUDA 3NVVA 1KW4A 1ECWA 3RRHA 9ICWA 4Q8FA 2HHTA 2XCPA 3V7KA 4EYHB 2KVSA 8ICEA 5AK3A 1KRPA 7ICEA 5ALHA 4PPXA 5TISU 5IIJA 3GDXA 1WUDA 1D8YA 4NY8A 1BNOA 3O0FA 7ICQA 4M6WA 2PXIA 3PO4A 4JMUA 4P4MA 4ELUA 2HI0A 2FLLA 4NM2A 1QQ6A 4AYBF 4F5RA 5KG6A 4BJQA 1HJPA 4ECSA 1V85A 2YN4A 4R65A 2F1IA 2KZZA 2PFNA 2LI6A 4I2JA 2BCRA 4YR0A 2EAPA 2MU2A 5J0WA 2KV2A 2I6XA 1DGSA 5DQGA 4NLBA 3HKZC 2WF6A 2OHFA 5KFOA 5KFCA 2BQRA 2HHWA 1SKRA 2HBJA 3C21A 3AQFA 2FDRA 2ESEA 2BCVA 4IRKA 5DBBA 3H7IA 2F8LA 2ZTCA 3MGIA 4DQPA 1RQLA 2UVVA 5DGBA 4O3RA 2BZFA 8ICCA 4KN7A 2G08A 4RQ8A 3ETLA 4Y2TA 1PZNA 4K4GA 4XQ8A 3C5GA 3RAQA 4RNMA 1DK3A 2H3FA 1N61A 2IHMA 5KFZA 4OJ6A 1NJYA 4P4PA 1F44A 3L5KA 1JMSA 1PK1B 5DDYA 5AM2A 2CRXA 4R64A 4I2IA 1RXVA 1S97A 7ICVA 4ED6A 4O3OA 1FIQA 5ALSA 3GIJA 1BPEA 2ZIUA 4RQ2A 3GIKA 2FLPA 3RJFA 4Y2VA 1QTMA 1XC9A 2ZIUB 5KFXA 2D6FC 8ICOA 2ZXHA 1NK8A 4J9OA 2KJ9A 1Z4NA 2HBMA 2UVRA 5DKWA 3AU2A 2A19A 1X6JA 1RM6C 4EX6A 1N48A 4DQRA 4UB8U 2HMXA 4UAZA 4UB6U 1ZQYA 2ZIWA 1SZPA 2AGQA 4QZFA 4BDPA 3BZCA 1XU4A 1PK3A 2ZIWB 3IN5A 3B0XA 4J9LA 4ZOHC 1Q46A 5DLFA 9ICEA 5DB8A 5J0UA 9ICMA 3RRGA 2E8OA 1KEJA 2ZTDA 4F4KA 2BPCA 1ZQWA 3BZKA 4EEYA 2LYHA 1Z3EB 1OXJA 2A1JB 1PVQA 5EWFA 3K75D 4DFKA 4M9GA 2C2EA 4BWMA 4DQIA 1ZQNA 4EELA 3UQ2A 3RF9A 5KFKA 2EAOA 4DL2A 1NK6A 8ICLA 3KZIU 4KLEA 1DOQA 3ALRA 4B6JA 3QYPA 5KAIU 4NLZA 3QEBZ 1Z1VA 2WAQF 3OJUA 3KD3A 4NWIA 4QWDA 4Y2JA 5ALFA 4Q43A 5L9XA 4PHEA 7ICTA 2XICA 3T5LA 4RZRA 5KFLA 1RQNA 1X42A 4R63A 4BGDA 4G3IA 3EWAA 3BQ7A 5KT6A 3OTQA 4UAYA 5J2BA 3UXOA 3D2NA 4RNNA
chains in the Genus database with same CATH topology
4QIWF 3NUQA 2F76X 2CPRA 2M0NA 3D2QA 5A0LA 2G06A 1ECWA 3LYSA 2ZIUB 4IC9A 1CRXA 2JMGA 3CP8A 3GU3A 2D6FC 1A0PA 2Y0SF 2ZXHA 2RRDA 2OXOA 5HR6A 3KFUF 3IG5A 2PMZF 3GZFA 3LVVA 2E5SA 3F5EA 1MA7A 4CRXA 2KJ9A 4U7CA 3LVWA 2HBMA 2JH1A 2GH1A 2KKPA 3T79A 4NLCA 3K1ZA 3AL0B 1YT3A 4OJ5A 2H3QA 3F53A 2JH7A 4CDGA 3N7RC 4OJPA 3F2DA 1HIWA 2HMXA 3M6ZA 1Q3UA 5KL1B 3MGVA 4PL2A 3VCBA 4P0PA 1P7DA 1WUDA 1D8BA 4P0QB 4FE3A 1T94A 2W03A 2ZIWA 3IG8A 3O0FA 2VIXA 2PMZC 2OYYA 4AYBC 3CRXA 3C28A 1URJA 2LKYA 4NV0A 2G0AA 4OJLA 4JMUA 2E1FA 4ICAA 5T14A 3SQIA 2G5IB 1Q3VA 2ZIWB 3IN5A 1XNSA 2HOQA 3D2SA 2H3VA 2KICA 2ZIXA 2BDUA 4PL1A 2VKQA 4U6PA 1Z19A 4BX9C 2F2AB 4AYBF 3C29A 3N7PD 3E0FA 4BJQA 1OUQA 3PSIA 1XO0A 1TAMA 2ZIXB 3M7DA 4BUGA 2KVCA 2ZXIA 2LYAA 1L6NA 2KEYA 4C0ZA 3PSPA 1Z1BA 2K89A 2R18A 3SAFA 2H3ZA 2CN1A 3D2NA 3RFAA 3L3FX 4FZLA 2H3IA 3M6KA 2KV2A 3PSFA 3H0MB 2G09A 2HOIA 2XVTA 2WB1F 1PVQA 1A6SA 1HEKA 2G07A 3SAHA 3DEEA 2HBKA 2OM6A 4P0PB 4NLBA 2VJ4A 3HKZC 4CGZA 3H0RB 4OO1J 3AQEA 3PSTA 4A8EA 3KZXA 1SZHA 2HBJA 4KX5A 2DQNB 4GFJA 3AQFA 3ONNA 3PZPA 2GOLA 2XIDA 3HKZF 3VC8A 4KX3A 3NRWA 3F5AA 4ACOA 2A3VA 1UPHA 2KKVA 5C0YA 2KD1A 3RF9A 5HR7A 2F8LA 1PVPA 2WAQC 3SMVA 4WJ3B 2K8AA 3SAGA 2KJ8A 2DGZA 2KOBA 2RP5A 3ALRA 2HOFA 2G08A 2WB1C 2KJ5A 5KL8B 2KHVA 2E1EA 2MRLA 1IIPA 2WAQF 4O3MA 2MA1A 4NWIA 2W7OA 2F77X 4OJOA 2YX8A 4QNLA 1NZBA 1DRGA 2N1RA 2G5HB 2K8BB 2H3FA 2YB1A 4KMOB 4OJ6A 3CYMA 2K4EA 2K8CB 2W04A 2XICA 2DF4B 2LHTA 2LYBA 2Z7JA 1F44A 2OH2A 2ZG6A 2KNJA 3H0LB 1ED1A 3IP4B 2XI9A 3N7SC 4FZMA 2LBOA 2RHFA 2CRXA 2VJ5A 3F2BA 2HBLA 2KHQA 2YB4A 2K4HA 4P0QA 1KBUA 2ZIVA 2KIWA 5CRXA 1GO3F 4QJFB 3OPXA 2JHDA 2NV3A 4QIWC 2W7PA 1PVRA 3ICXA 3F2CA 2Q4TA 2JGAA 1ZQ1C 2K4IA 2ZIUA 2ZIVB 4FZNA 2Y0SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  3HKZ F;  2WB1 F;  2PMZ F;  4AYB F;  2WAQ F; 
#chains in the Genus database with same CATH topology
 2W55 A;  3WKE A;  1ZQL A;  1JXL A;  4Y2Q A;  8ICI A;  5KFU A;  1SL2 A;  3KFU F;  5AK5 A;  5AM3 A;  5AKY A;  5J0X A;  3SR6 A;  4M2Y A;  4MFF A;  4OJ5 A;  3IV6 A;  2P6U A;  1FFV A;  4R66 A;  2ZTE A;  4IQV A;  2P66 A;  4UB5 A;  3U26 A;  2GWS A;  1LB2 B;  1MSW D;  4O3S A;  2HHX A;  2BPG A;  4DOB A;  4NV0 A;  5D49 A;  3D2S A;  5AKE A;  1ZQD A;  2VKQ A;  1ZQT A;  3EW9 A;  3SV3 A;  5KFM A;  3T3F A;  3C29 A;  2BDP A;  4RQM A;  2HHS A;  1SV4 A;  3WK4 A;  1RYS A;  4F4W A;  1ARO P;  3C5F A;  1NK9 A;  3BS5 A;  4QZA A;  4YMN A;  1RXW A;  1LVH A;  2HHQ A;  2QB0 A;  3JPQ A;  3BS5 B;  4O0I A;  3AQE A;  2C2D A;  4F5O A;  5KNI A;  3EPG A;  1UPH A;  2L5Y A;  4Z6D A;  2KN7 A;  4UB3 A;  2EAN A;  2KE7 A;  2KOB A;  2FMS A;  4KLJ A;  2MRL A;  4F5P A;  4ECX A;  3WKB A;  4B9T A;  3JPO A;  3RAX A;  1S5L U;  5AKH A;  1V38 A;  2BKE A;  3ORY A;  1QQ7 A;  1NK7 A;  4F4Z A;  2LBO A;  8ICS A;  4RQ1 A;  4RPY A;  2Y1J A;  4F2S A;  4QWE A;  5ALK A;  1A76 A;  2W54 A;  5ALM A;  1BPB A;  2Y0S C;  1UHU A;  1U45 A;  2BPF A;  2XY6 A;  2XY7 A;  5J2H A;  5A0L A;  1DXS A;  1A0P A;  5J0O A;  2AGO A;  1BGX T;  5AKL A;  1JAL A;  4DF4 A;  3M9N B;  3MR3 A;  4X5V A;  3WKD A;  3PR5 B;  4UAR A;  3MC1 A;  3KHR A;  2BCU A;  4EEN A;  4TQS A;  5KG7 A;  3F2D A;  4MF2 A;  3VCB A;  4KLH A;  4Z6E A;  1J2N A;  3GV8 B;  5J8Y C;  3C28 A;  1ZJN A;  2NO4 A;  3HIL A;  2E1F A;  2H3V A;  4PL1 A;  1BVS A;  4I2F A;  3Q8R B;  2R8G A;  3MGH A;  4RPZ A;  2M9N A;  1SL1 A;  3IM1 A;  2ZXI A;  2J6T A;  4QZ8 A;  4C7Z A;  2H3Z A;  4K4I A;  3M6K A;  2DBY A;  5AM4 A;  1ZQP A;  3ZD9 A;  5J2F A;  2JV3 A;  3GFK B;  5DG7 A;  1FEZ A;  3GV7 B;  3H0R B;  4C7Y A;  5EE0 A;  4ECV A;  1BPY A;  2KFN A;  2DL0 A;  3PZP A;  4FO6 A;  3H4B A;  3QU4 A;  1X40 A;  3BJY A;  4MEX A;  5KL8 B;  4ELV A;  3ED5 A;  1RYU A;  1TKD A;  8ICB A;  4OJO A;  3L4P A;  1WWU A;  5CHG A;  3C2L A;  3RR7 A;  3WKA A;  3M8R A;  3DV9 A;  1YZ7 A;  2LM1 A;  2XI9 A;  2VJ5 A;  3F2B A;  3PNC A;  2K4H A;  4M9L A;  4C8K A;  2W7P A;  1PVR A;  1KKX A;  4HAI A;  2KZ3 A;  7ICI A;  2B0C A;  4IR9 A;  1BNP A;  5CA7 A;  3Q8S B;  3IG5 A;  2YY6 A;  3KBB A;  2ZUC A;  1KQQ A;  2OWO A;  5EE1 A;  2DKX A;  1NZP A;  3FDS A;  4LVS A;  9ICA A;  9ICK A;  1ZQB A;  2FPM A;  2J6U A;  2HDO A;  2DFL A;  4JWN A;  3HW8 A;  3CRX A;  4NL9 C;  2HCF A;  1SV0 C;  5KT2 A;  8ICU A;  4U6P A;  4RT3 A;  4M9H A;  5KG2 A;  5ALL A;  1TK0 A;  3HWT A;  5AI8 A;  5DLG A;  2RDJ A;  3PSI A;  4YD1 A;  5KFB A;  5AK4 A;  9ICV A;  1B4F A;  5KTQ A;  3B9J A;  1Z00 A;  4QZC A;  1RPL A;  3PW4 A;  1N63 A;  3H0M B;  2UVU A;  4EYI B;  3KTQ A;  5ALG A;  2HOI A;  1Z00 B;  3A0H U;  3HT3 A;  3DEE A;  1ZQI A;  5KFW A;  3JPR A;  3PST A;  1ZET A;  2WHE A;  3JPS A;  4UQG A;  1VJ5 A;  2KJ8 A;  1S10 A;  2EZX A;  4PHA A;  4R8U B;  2WB1 C;  2KHV A;  4ED2 A;  2RLT A;  5EE3 A;  2W43 A;  4ECU A;  5AKG A;  1ZRM A;  2DF4 B;  1ZRN A;  5KFI A;  4KLQ A;  4OCZ A;  4GXI A;  4EZ9 A;  5J0T A;  4C4R A;  3JPN A;  3HRD D;  5CR0 A;  3J81 j;  8ICJ A;  9ICH A;  3G6V A;  9ICT A;  4QW8 A;  3NGD A;  2JEG A;  5E79 U;  5J0R A;  4FZN A;  3IRU A;  4QIW F;  4Q45 A;  3Q8L A;  1QSL A;  4YN4 A;  1U49 A;  2JMG A;  1C20 A;  2OXO A;  8ICK A;  1RG6 A;  1BPD A;  1O03 A;  5DQI A;  2RQ5 A;  3RB4 A;  3H40 A;  4Z6C A;  4DFJ A;  4C4S A;  1L3V A;  4FBT A;  3V6K A;  1X9S A;  2LMR A;  4P0Q B;  4RNO A;  2OYY A;  5J0Q A;  2Y9U A;  1URJ A;  5DB9 A;  2W9C A;  2G0A A;  5BOM A;  2EZY A;  4M0A A;  1SIJ A;  2EDU A;  5AK6 A;  2W9C B;  1TAU A;  3DDH A;  1N56 A;  4UAU A;  1OUQ A;  4MFA A;  5AIA A;  5G5H A;  3RJH A;  5CB1 A;  1JRP A;  1JRO A;  3PSP A;  1ZQG A;  1UCV A;  4BXO A;  3ISB A;  4CF5 A;  2E8P A;  4DSL A;  2HBK A;  4UB2 A;  3H8S A;  2NRV A;  5AI4 A;  4IQU A;  3V6H A;  4O3Q A;  4M6W B;  8ICX A;  4EX7 A;  2P6R A;  2KKV A;  5C0Y A;  3TI0 A;  4F4Y A;  2NRZ A;  3ZDC A;  2MUT A;  3WU2 U;  2MA1 A;  2W7O A;  2F77 X;  1SWW A;  5AI5 A;  1ZD3 A;  9ICX A;  4FS2 A;  3TAD C;  5L1I A;  1Q8K A;  1LKY A;  2KSO A;  1VLB A;  4DOC A;  4Y2S A;  9ICN A;  5J2G A;  4RQ7 A;  5EOZ A;  3Q8P B;  3FYH A;  1U4B A;  5CRX A;  4QJF B;  4O3P A;  2JHD A;  4RQN A;  1L8L A;  3QE9 Y;  4P2H A;  5AHX A;  2K4I A;  1L3U A;  2F76 X;  4QZE A;  4I2H A;  1KN5 A;  4JV1 A;  1TVA A;  5HR6 A;  4IRD A;  3LVV A;  2VA2 A;  4F4X A;  5DDM A;  2KKP A;  2BR0 A;  2H3Q A;  2JH7 A;  4B9L A;  5KG4 A;  2ASJ A;  3OGU A;  4DFM A;  2JEF A;  4QW9 A;  8ICT A;  4M9N A;  2A1A A;  4F5Q A;  3H8M A;  4KN4 A;  4EBE A;  3ZD8 A;  1N60 A;  2R18 A;  3MAB A;  8ICW A;  4FZL A;  1SXD A;  4ED8 A;  9ICG A;  1KL9 A;  4YXM A;  4O5C A;  2WB1 F;  1HEK A;  3SAH A;  2D3D A;  2NYV A;  4DF8 A;  1S8O A;  3ONN A;  4Y2P A;  2XO7 A;  5KG5 A;  4ACO A;  3QEA Z;  3SMV A;  2HOF A;  1N5W A;  1WCN A;  2W3R A;  1DRG A;  4US8 A;  1NJZ A;  3HPO A;  4C8O A;  4F3O A;  2K4E A;  2Z7J A;  3Q8K A;  2BHN A;  2ZG6 A;  1ZQH A;  5KT7 A;  1N2X A;  2PFQ A;  3RR8 A;  1BPZ A;  1H38 A;  2HBL A;  4TUS A;  2VA3 A;  2BQU A;  1X9M A;  1JIH A;  2Y1I A;  1S77 D;  3LWL A;  1VDV A;  4DSI A;  2M0N A;  4Q44 A;  3M9M B;  5J2I A;  4B9N A;  9ICC A;  4UAT A;  4P4O A;  2E3T A;  3LVW A;  5KFF A;  8ICQ A;  3KHG A;  3PX4 A;  1ZXI A;  2R8J A;  2YMP A;  2ZJ5 A;  4JB3 A;  4P0P A;  3FAH A;  4NLK A;  3ISC A;  3BQ1 A;  1NJW A;  1T94 A;  3FM9 A;  2AJQ A;  1QSY A;  3SD7 A;  5AI9 A;  3SQI A;  3JPT A;  1MC8 A;  3B0Y A;  5KFA A;  3OSN A;  4FBU A;  5J2A A;  2LM4 A;  3SYZ A;  5KAF U;  3V7J A;  5H2F U;  5KT4 A;  1B22 A;  3SAF A;  2XGP A;  4C8N A;  2F1H A;  1SB3 C;  3L3F X;  1U48 A;  5KFP A;  3PW0 A;  5KFY A;  1KSP A;  4JV2 A;  2OCE A;  8ICM A;  3QU7 A;  1BPX A;  1NNL A;  3PVX A;  3OHB A;  7ICJ A;  3D6J A;  2JZB A;  4KX5 A;  4PGQ A;  1ZD5 A;  1XO1 A;  2R8H A;  4ELT A;  1AQ6 A;  3HKZ F;  2Y9T A;  2JZB B;  4PHP A;  3NS1 A;  2F44 A;  2AU0 A;  5L1L A;  4O3N A;  2IMW P;  4RPX A;  2YX8 A;  2BQ3 A;  1O08 A;  2K8B B;  4B9U A;  5ALQ A;  4DS5 A;  5DG8 A;  3CYM A;  3RB3 A;  3QUT A;  3NVZ A;  4ED1 A;  3EZ5 A;  3BS7 A;  1L8O A;  3N7S C;  2QB1 A;  2QB0 B;  2KHQ A;  3M1Y A;  4F72 A;  1TK5 A;  1L7M A;  2NV3 A;  1MQ2 A;  2FPL A;  1QH9 A;  4KIT B;  3EUB 2;  1RYR A;  2WTF A;  2QAR A;  5F3X B;  3GU3 A;  9ICU A;  3QUB A;  5BPC A;  5CWR A;  2WF8 A;  5J8Y A;  1XS9 D;  4PJ0 U;  4IQT A;  3F53 A;  2ZJA A;  2KFZ A;  1U9L A;  1KDH A;  4YR2 A;  2B21 A;  4IS7 A;  4I27 A;  3GII A;  2NO5 A;  1OW5 A;  3KKA C;  4ED3 A;  1WYG A;  2FE9 A;  4QZI A;  2G5I B;  4F5N A;  3UQ0 A;  4F93 B;  3PV8 A;  2W9B A;  5L1M A;  4ECZ A;  5CJ7 A;  4RQ0 A;  3M7D A;  4BUG A;  4C0Z A;  5J2J A;  2XCA A;  8ICY A;  1KFS A;  4J9R A;  2G09 A;  5J0Y A;  2C22 A;  2G07 A;  4KLT A;  3LWM A;  8ICH A;  1FO4 A;  4OO1 J;  2FLN A;  4DFD A;  4GXK A;  1SGG A;  4EZ6 A;  4IR1 A;  2ODG A;  2MSN A;  4I2B A;  1B43 A;  1L3T A;  2NRW A;  2V4R A;  3KOO A;  2OEH A;  2N1R A;  2G5H B;  4B9S A;  4C8L A;  3QX7 A;  1J2M A;  2Q0Z X;  1L5U A;  2I5H A;  1MQ3 A;  3MDC A;  4O9M A;  4YG2 A;  2YB4 A;  2W8L A;  4KLD A;  1JXE A;  1UQV A;  2KMD A;  5EE9 A;  4PH5 A;  2QLT A;  1S0V A;  2V9W A;  3UXP A;  5EWE A;  5KFQ A;  3I1Y A;  5HR7 A;  3UPQ A;  4LZD A;  3PR4 A;  3NUQ A;  4PZN A;  7ICH A;  5DBA A;  4B9M A;  3TFR A;  1IXR A;  3GZF A;  3F5E A;  4CRX A;  1ZQX A;  3UXN A;  1U47 A;  4EBD A;  1KFD A;  4NLC A;  4NL9 A;  1SV0 A;  3TAC B;  4CDG A;  3M6Z A;  4PL2 A;  3PML A;  1D8B A;  4G9B A;  7ICN A;  2VIX A;  4YQW A;  8ICF A;  4AYB C;  3NVY A;  5T14 A;  2LKY A;  4BWJ A;  2HOQ A;  2KIC A;  2DPI A;  7ICU A;  2HW3 A;  3QNM A;  9ICO A;  2EZZ A;  4Q8E A;  4F8R A;  3BQ0 A;  9ICF A;  4DLG A;  2WF7 A;  2XY5 A;  4KLL A;  3M8S A;  5ALE A;  3K1R B;  4YD2 A;  1Z1B A;  2K89 A;  2IA6 A;  3BQ2 A;  2JR5 A;  1COO A;  4KLF A;  1X6I A;  3K4G A;  3NAS A;  2XVT A;  3EYZ A;  9ICQ A;  8ICV A;  2OM6 A;  4YP3 A;  3RJJ A;  1HUO A;  1NOM A;  1D9D A;  3KZX A;  1ZQM A;  2UVW A;  5ALW A;  4KX3 A;  3NRW A;  4I29 A;  3UMC A;  3OSP A;  5JTI A;  4DSF A;  4WJ3 B;  3WK5 A;  3WK6 A;  5J2E A;  7ICS A;  4K4H A;  1T8E A;  3BDP A;  2P35 A;  4KLM A;  3PX0 A;  4J9Q A;  2ZJ8 A;  5AI0 A;  2R8K A;  2W3S A;  1Y88 A;  4YFK A;  2IOH A;  2RHF A;  4DQS A;  3Q8Q B;  1LV5 A;  3WK7 A;  3RBD A;  3MBY A;  4TUR A;  1WCL A;  1XWL A;  5KFJ A;  1HUZ A;  4KLI A;  1PVP A;  4OJP A;  2J6S A;  2ASL A;  4ED0 A;  2G06 A;  3LYS A;  4YMM A;  1NKE A;  9ICB A;  2HSZ A;  2Y0S F;  5IIK A;  2RRD A;  7ICM A;  2E5S A;  7ICR A;  3M9O B;  3TAQ A;  2AXT U;  4DFP A;  1L7N A;  2JRZ A;  5IIL A;  5IIN A;  1XSP A;  1HIW A;  4AP9 A;  4O5E A;  9ICR A;  4FE3 A;  2W03 A;  3IG8 A;  4DSE A;  2FI1 A;  3QZ8 A;  3QXG A;  2EAM A;  1F0M A;  3RBE A;  4ICA A;  2KK0 A;  4RQ3 A;  2ZIX A;  5AM5 A;  2EQY A;  3N7P D;  5JU5 A;  4KMU A;  2ZIX B;  4RT2 A;  2LYA A;  1L6N A;  1MN8 A;  1PUZ A;  4F92 B;  4LJX A;  9ICS A;  2C28 A;  1ZQK A;  5ALO A;  3T5J A;  3H8W A;  4J9N A;  4UBC A;  1K5O A;  5KG0 A;  3C2K A;  1B0X A;  1UT8 A;  4PGY A;  1C7Y A;  1QLN A;  4M9J A;  2V4Q A;  8ICA A;  3N97 B;  3I28 A;  3TAD A;  2WAQ C;  2ALZ A;  2RDI A;  9ICL A;  4B9V A;  2RP5 A;  3C1Y A;  3NTU A;  2F8K A;  3RJI A;  2BCQ A;  4QZB A;  3THV A;  5BOL A;  3AM9 A;  4KTQ A;  5D46 A;  5HHH A;  4UAW A;  9ICJ A;  1KFT A;  4BXO B;  1JN3 A;  3PY8 A;  1M6Y A;  4ECQ A;  3V6J A;  3MFH A;  3IHQ B;  5AKK A;  2BCS A;  4DL3 A;  4KLU A;  5D4B A;  3SV4 A;  3ICX A;  3ZDB A;  4O5K A;  1X9W A;  2AQ0 A;  5KT3 A;  4J9M A;  1SKW A;  4KLO A;  4ECW A;  2FPK A;  5CEH A;  4UW9 A;  3ISD A;  4JWM A;  4IQW A;  2MUT B;  5KFS A;  5KG3 A;  2I9G A;  3PW5 A;  2R8I A;  5AIC A;  1LKY B;  1YT3 A;  3SEN A;  5F9N A;  2F1J A;  2DWQ A;  2KSO B;  2VAN A;  2HVH A;  3N7R C;  8ICG A;  1TFR A;  3ZDA A;  3NVW A;  5ALI A;  5AKZ A;  3S6J A;  5IIM A;  4US9 A;  4OJL A;  4QWA A;  1TAQ A;  5ALP A;  4DEZ A;  1D8L A;  3CW2 C;  2JEJ A;  1XNS A;  5FP0 A;  1Z19 A;  3GV5 B;  1L3S A;  4MEY A;  2WFA A;  3C2M A;  1WG8 A;  3N28 A;  4F50 A;  5KFN A;  2H3I A;  5ALZ A;  4GLX A;  5JRT A;  2NRX A;  5J0S A;  5ALR A;  1PK1 A;  3E58 A;  2VJ4 A;  4CGZ A;  5EWG A;  5KG1 A;  4JUZ A;  2A3V A;  3A0B U;  5KFV A;  2WF5 A;  2CXY A;  5KFD A;  4DLE A;  4JK1 A;  1K1S A;  3G6X A;  3E2E A;  4LZG A;  3RH6 A;  2OH2 A;  1NJX A;  4C8M A;  3H0L B;  3ZDD A;  4I28 A;  1ED1 A;  1TV9 A;  4FZM A;  4NM1 A;  1ZQC A;  2IOF A;  5AKJ A;  3SEI A;  2ES6 A;  2KIW A;  3NRZ A;  3AU6 A;  5DGA A;  3KHH A;  4QZG A;  2YMM A;  3F2C A;  4GC6 A;  1ZQ1 C;  1UA1 A;  4NLG A;  1S76 D;  4ZH4 A;  2VA8 A;  4YCX A;  3BQT A;  4DCC A;  4Y2Y A;  2CPR A;  3D2Q A;  1NKC A;  5AM1 A;  3CP8 A;  2AQ4 A;  1NK5 A;  4CF4 A;  1QSS A;  3EPI A;  4MF8 A;  4I2C A;  2GH1 A;  3T79 A;  4PZO A;  4ECR A;  2DUY A;  2A1J A;  1IM4 A;  3C23 A;  1YZ6 A;  5KL1 B;  4YR3 A;  1P7D A;  4IRC A;  3RJG A;  3SZ2 A;  2PMZ C;  1NI3 A;  1DGJ A;  5J2C A;  4FFD A;  1Q3V A;  1A77 A;  3MFI A;  4TQR A;  9ICP A;  1RDF A;  4J9S A;  2PKE A;  5G5G A;  7ICL A;  4JV0 A;  3QUC A;  1SWV A;  1XO0 A;  4PHD A;  2KVC A;  2IBK A;  5C5J A;  1J97 A;  2KIV A;  5J2D A;  3RB6 A;  3RFA A;  4ECT A;  4GIB A;  4Z6F A;  2F3N A;  3QU2 A;  1X2I A;  2ISP A;  4P0P B;  5IIO A;  1JUD A;  5III A;  4A8E A;  3UM9 A;  2K4P A;  4J9K A;  2DQN B;  3HX0 A;  2XGQ A;  3RJK A;  5TZV A;  2AH5 A;  2KD1 A;  4YXJ A;  3KHL A;  4F71 A;  3T5K A;  4GC7 A;  2E8M A;  3N4M B;  3SAG A;  4QWB A;  3AUO A;  2W8K A;  1ZQF A;  3RH5 A;  4I2A A;  3AEV A;  7ICF A;  3T5H A;  1X66 A;  2LHT A;  5L1K A;  2AGP A;  5J29 A;  4Y2U A;  4F91 B;  3HJE A;  3TKA A;  3CNH A;  3SI8 A;  4UAV A;  2Q4T A;  2W11 A;  5KFT A;  4RQ6 A;  5GTI U;  3QZ7 A;  7ICG A;  4IC9 A;  1CRX A;  4MHV A;  1T3N A;  3ZI4 A;  3RTV A;  1COK A;  5ALY A;  1S9F A;  4Y2R A;  3KKA A;  1QCK A;  4J03 A;  1ZQO A;  2FJ6 A;  1WWV A;  2WF9 A;  3PO5 A;  5ALJ A;  4GXJ A;  1ZD2 P;  1S0N A;  3TAP A;  4J9P A;  4NXZ A;  2IOF K;  3WK9 A;  4RQ5 A;  3LDA A;  3V72 A;  4I2E A;  2E8N A;  5DQH A;  4I2D A;  3TAR A;  3TAN A;  2KTQ A;  2QAR B;  2D8C A;  5CP2 A;  2KEY A;  1ZQV A;  3PW2 A;  4UAS A;  2ZUB A;  3PSF A;  4NJ8 A;  2MAX A;  1KTQ A;  1XSL A;  5DB6 A;  5KFG A;  4PGX A;  3MR6 A;  1CUK A;  3OHA A;  4QWC A;  1ZQU A;  1TK8 A;  1ZQE A;  4EBC A;  1IG6 A;  2GOL A;  5AKX A;  4XUS A;  5B66 U;  5ALT A;  5HMM A;  5L1J A;  2W9B B;  4UBB A;  3H8J A;  2DGZ A;  7ICP A;  4RUA A;  4O3M A;  4M04 A;  4DSJ A;  2PI4 A;  3QU9 A;  1EXN A;  4DWI A;  4KMO B;  5GTH U;  2LYB A;  4CNQ A;  3IP4 B;  8ICZ A;  2ZIV A;  1ZJM A;  2YML A;  1ZOL A;  5KT5 A;  3JPP A;  4QIW C;  4RUC A;  2ZIV B;  4DL5 A;  3R9K A;  4USA A;  2DPJ A;  4CF3 A;  1FFU A;  4M47 A;  4UB1 A;  1NK0 A;  1SL0 A;  5DB7 A;  8ICR A;  4YMO A;  4C80 A;  3MR2 A;  3ZDE A;  1CI4 A;  4OD0 A;  2YMQ A;  2PMZ F;  2JXJ A;  4QZD A;  3I76 A;  4DS4 A;  4U7C A;  2JH1 A;  2YQE A;  4ECY A;  3K1Z A;  1S0O A;  4MFC A;  1ZQR A;  3AL0 B;  5ALU A;  4QZH A;  1N5X A;  4QZ9 A;  4CCH A;  2KZM A;  1V97 A;  4F2R A;  2PFP A;  1T4G A;  3MGV A;  4I2G A;  7ICO A;  9ICI A;  3UMG A;  1T3Q A;  1N62 A;  1K1Q A;  3AMZ A;  5ALN A;  1QQ5 A;  5HHI A;  2GO7 A;  3V7L A;  4BX9 C;  1ZD4 A;  3C1Z A;  3PX6 A;  2DKZ A;  4TUQ A;  3IDW A;  1Z4O A;  3TQ1 A;  1UT5 A;  2HVI A;  3RJE A;  1JX4 A;  2CN1 A;  3QUQ A;  1L7P A;  1T7P A;  3GIL A;  1A6S A;  2O6K A;  2FMQ A;  1X9X A;  2HHV A;  1DK2 A;  1SZH A;  1S0M A;  5JUM A;  4CE6 A;  3F5A A;  3RH4 A;  2B6G A;  3HP6 A;  4HYK A;  3OJS A;  4E0D A;  8ICP A;  4ED7 A;  2NRT A;  4QNL A;  1NZB A;  3TFS A;  4UB4 A;  1ZYQ A;  1KLN A;  1V9P A;  2W04 A;  2PI5 A;  2EH9 A;  1KBU A;  5HNK A;  1GO3 F;  2BGW A;  2ATL A;  2JGA A;  4DQQ A;  3E0F A;  1ZQA A;  3GQC A;  3LK9 A;  3RB0 A;  4DL4 A;  2HHU A;  5B5E U;  3Q8M A;  2JEI A;  5J0P A;  5HP4 A;  3GIM A;  1MA7 A;  5ALX A;  4RQ4 A;  1SKS A;  4DSK A;  1F5S A;  1Q3U A;  2IHN A;  1RZT A;  2ISO A;  5DBC A;  1IV8 A;  5K4L A;  2QKQ A;  4XA5 A;  5ALD A;  1UA0 A;  5ALV A;  2FMP A;  2C2R A;  3UMB A;  4XRH A;  4RU9 A;  4DO9 A;  4DOA A;  1NK4 A;  2BDU A;  2LPE A;  2F2A B;  5HML A;  5AIB A;  3FC4 A;  3G6Y A;  4NLN A;  4R8U A;  3ETR A;  5AKI A;  1TAM A;  1ZQZ A;  4YVZ A;  2YTU A;  5KFE A;  3MR5 A;  1D9F A;  2XC9 A;  8ICN A;  2KG5 A;  2AHO B;  2K60 A;  4FS1 A;  1CEZ A;  4DL7 A;  3H4D A;  2PFO A;  4KLS A;  2W9M A;  1ZQJ A;  4GFJ A;  4EEK A;  2W9A A;  2XID A;  3VC8 A;  1L7O A;  4IL6 U;  3QU5 A;  5KFH A;  5KFR A;  5DG9 A;  2K8A A;  1ZQS A;  5J2K A;  2KJ5 A;  2GLE A;  2E1E A;  3PW7 A;  1IIP A;  3AN1 A;  2KP7 A;  1XSN A;  4KLG A;  2I1Q A;  5F9L A;  2YB1 A;  2K8C B;  1TE2 A;  2ASD A;  2KNJ A;  4TUP A;  5AI6 A;  3WKC A;  2H5X A;  3MDA A;  4Y2X A;  7ICK A;  3WK8 A;  4P0Q A;  1ZQQ A;  3OPX A;  4C4T A;  1NKB A;  4DL6 A;  1JI7 A;  5AM0 A;  3PMN A;  1SXE A;  2ZUD A;  3NVV A;  1KW4 A;  1ECW A;  3RRH A;  9ICW A;  4Q8F A;  2HHT A;  2XCP A;  3V7K A;  4EYH B;  2KVS A;  8ICE A;  5AK3 A;  1KRP A;  7ICE A;  5ALH A;  4PPX A;  5TIS U;  5IIJ A;  3GDX A;  1WUD A;  1D8Y A;  4NY8 A;  1BNO A;  3O0F A;  7ICQ A;  4M6W A;  2PXI A;  3PO4 A;  4JMU A;  4P4M A;  4ELU A;  2HI0 A;  2FLL A;  4NM2 A;  1QQ6 A;  4AYB F;  4F5R A;  5KG6 A;  4BJQ A;  1HJP A;  4ECS A;  1V85 A;  2YN4 A;  4R65 A;  2F1I A;  2KZZ A;  2PFN A;  2LI6 A;  4I2J A;  2BCR A;  4YR0 A;  2EAP A;  2MU2 A;  5J0W A;  2KV2 A;  2I6X A;  1DGS A;  5DQG A;  4NLB A;  3HKZ C;  2WF6 A;  2OHF A;  5KFO A;  5KFC A;  2BQR A;  2HHW A;  1SKR A;  2HBJ A;  3C21 A;  3AQF A;  2FDR A;  2ESE A;  2BCV A;  4IRK A;  5DBB A;  3H7I A;  2F8L A;  2ZTC A;  3MGI A;  4DQP A;  1RQL A;  2UVV A;  5DGB A;  4O3R A;  2BZF A;  8ICC A;  4KN7 A;  2G08 A;  4RQ8 A;  3ETL A;  4Y2T A;  1PZN A;  4K4G A;  4XQ8 A;  3C5G A;  3RAQ A;  4RNM A;  1DK3 A;  2H3F A;  1N61 A;  2IHM A;  5KFZ A;  4OJ6 A;  1NJY A;  4P4P A;  1F44 A;  3L5K A;  1JMS A;  1PK1 B;  5DDY A;  5AM2 A;  2CRX A;  4R64 A;  4I2I A;  1RXV A;  1S97 A;  7ICV A;  4ED6 A;  4O3O A;  1FIQ A;  5ALS A;  3GIJ A;  1BPE A;  2ZIU A;  4RQ2 A;  3GIK A;  2FLP A;  3RJF A;  4Y2V A;  1QTM A;  1XC9 A;  2ZIU B;  5KFX A;  2D6F C;  8ICO A;  2ZXH A;  1NK8 A;  4J9O A;  2KJ9 A;  1Z4N A;  2HBM A;  2UVR A;  5DKW A;  3AU2 A;  2A19 A;  1X6J A;  1RM6 C;  4EX6 A;  1N48 A;  4DQR A;  4UB8 U;  2HMX A;  4UAZ A;  4UB6 U;  1ZQY A;  2ZIW A;  1SZP A;  2AGQ A;  4QZF A;  4BDP A;  3BZC A;  1XU4 A;  1PK3 A;  2ZIW B;  3IN5 A;  3B0X A;  4J9L A;  4ZOH C;  1Q46 A;  5DLF A;  9ICE A;  5DB8 A;  5J0U A;  9ICM A;  3RRG A;  2E8O A;  1KEJ A;  2ZTD A;  4F4K A;  2BPC A;  1ZQW A;  3BZK A;  4EEY A;  2LYH A;  1Z3E B;  1OXJ A;  2A1J B;  1PVQ A;  5EWF A;  3K75 D;  4DFK A;  4M9G A;  2C2E A;  4BWM A;  4DQI A;  1ZQN A;  4EEL A;  3UQ2 A;  3RF9 A;  5KFK A;  2EAO A;  4DL2 A;  1NK6 A;  8ICL A;  3KZI U;  4KLE A;  1DOQ A;  3ALR A;  4B6J A;  3QYP A;  5KAI U;  4NLZ A;  3QEB Z;  1Z1V A;  2WAQ F;  3OJU A;  3KD3 A;  4NWI A;  4QWD A;  4Y2J A;  5ALF A;  4Q43 A;  5L9X A;  4PHE A;  7ICT A;  2XIC A;  3T5L A;  4RZR A;  5KFL A;  1RQN A;  1X42 A;  4R63 A;  4BGD A;  4G3I A;  3EWA A;  3BQ7 A;  5KT6 A;  3OTQ A;  4UAY A;  5J2B A;  3UXO A;  3D2N A;  4RNN A; 
#chains in the Genus database with same CATH homology
 4QIW F;  3NUQ A;  2F76 X;  2CPR A;  2M0N A;  3D2Q A;  5A0L A;  2G06 A;  1ECW A;  3LYS A;  2ZIU B;  4IC9 A;  1CRX A;  2JMG A;  3CP8 A;  3GU3 A;  2D6F C;  1A0P A;  2Y0S F;  2ZXH A;  2RRD A;  2OXO A;  5HR6 A;  3KFU F;  3IG5 A;  2PMZ F;  3GZF A;  3LVV A;  2E5S A;  3F5E A;  1MA7 A;  4CRX A;  2KJ9 A;  4U7C A;  3LVW A;  2HBM A;  2JH1 A;  2GH1 A;  2KKP A;  3T79 A;  4NLC A;  3K1Z A;  3AL0 B;  1YT3 A;  4OJ5 A;  2H3Q A;  3F53 A;  2JH7 A;  4CDG A;  3N7R C;  4OJP A;  3F2D A;  1HIW A;  2HMX A;  3M6Z A;  1Q3U A;  5KL1 B;  3MGV A;  4PL2 A;  3VCB A;  4P0P A;  1P7D A;  1WUD A;  1D8B A;  4P0Q B;  4FE3 A;  1T94 A;  2W03 A;  2ZIW A;  3IG8 A;  3O0F A;  2VIX A;  2PMZ C;  2OYY A;  4AYB C;  3CRX A;  3C28 A;  1URJ A;  2LKY A;  4NV0 A;  2G0A A;  4OJL A;  4JMU A;  2E1F A;  4ICA A;  5T14 A;  3SQI A;  2G5I B;  1Q3V A;  2ZIW B;  3IN5 A;  1XNS A;  2HOQ A;  3D2S A;  2H3V A;  2KIC A;  2ZIX A;  2BDU A;  4PL1 A;  2VKQ A;  4U6P A;  1Z19 A;  4BX9 C;  2F2A B;  4AYB F;  3C29 A;  3N7P D;  3E0F A;  4BJQ A;  1OUQ A;  3PSI A;  1XO0 A;  1TAM A;  2ZIX B;  3M7D A;  4BUG A;  2KVC A;  2ZXI A;  2LYA A;  1L6N A;  2KEY A;  4C0Z A;  3PSP A;  1Z1B A;  2K89 A;  2R18 A;  3SAF A;  2H3Z A;  2CN1 A;  3D2N A;  3RFA A;  3L3F X;  4FZL A;  2H3I A;  3M6K A;  2KV2 A;  3PSF A;  3H0M B;  2G09 A;  2HOI A;  2XVT A;  2WB1 F;  1PVQ A;  1A6S A;  1HEK A;  2G07 A;  3SAH A;  3DEE A;  2HBK A;  2OM6 A;  4P0P B;  4NLB A;  2VJ4 A;  3HKZ C;  4CGZ A;  3H0R B;  4OO1 J;  3AQE A;  3PST A;  4A8E A;  3KZX A;  1SZH A;  2HBJ A;  4KX5 A;  2DQN B;  4GFJ A;  3AQF A;  3ONN A;  3PZP A;  2GOL A;  2XID A;  3HKZ F;  3VC8 A;  4KX3 A;  3NRW A;  3F5A A;  4ACO A;  2A3V A;  1UPH A;  2KKV A;  5C0Y A;  2KD1 A;  3RF9 A;  5HR7 A;  2F8L A;  1PVP A;  2WAQ C;  3SMV A;  4WJ3 B;  2K8A A;  3SAG A;  2KJ8 A;  2DGZ A;  2KOB A;  2RP5 A;  3ALR A;  2HOF A;  2G08 A;  2WB1 C;  2KJ5 A;  5KL8 B;  2KHV A;  2E1E A;  2MRL A;  1IIP A;  2WAQ F;  4O3M A;  2MA1 A;  4NWI A;  2W7O A;  2F77 X;  4OJO A;  2YX8 A;  4QNL A;  1NZB A;  1DRG A;  2N1R A;  2G5H B;  2K8B B;  2H3F A;  2YB1 A;  4KMO B;  4OJ6 A;  3CYM A;  2K4E A;  2K8C B;  2W04 A;  2XIC A;  2DF4 B;  2LHT A;  2LYB A;  2Z7J A;  1F44 A;  2OH2 A;  2ZG6 A;  2KNJ A;  3H0L B;  1ED1 A;  3IP4 B;  2XI9 A;  3N7S C;  4FZM A;  2LBO A;  2RHF A;  2CRX A;  2VJ5 A;  3F2B A;  2HBL A;  2KHQ A;  2YB4 A;  2K4H A;  4P0Q A;  1KBU A;  2ZIV A;  2KIW A;  5CRX A;  1GO3 F;  4QJF B;  3OPX A;  2JHD A;  2NV3 A;  4QIW C;  2W7P A;  1PVR A;  3ICX A;  3F2C A;  2Q4T A;  2JGA A;  1ZQ1 C;  2K4I A;  2ZIU A;  2ZIV B;  4FZN A;  2Y0S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...