4AYBF

Rnap at 3.2ang
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSNRTYTSEDIQKIIDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 13
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4aybF02
3HKZF 2WB1F 4AYBF 2Y0SF 2WAQF 2PMZF
chains in the Genus database with same CATH superfamily
3GV7B 3WKDA 1L8LA 1ZQXA 3L3FX 5J0XA 4C8LA 2V4RA 3QU9A 4C8MA 3ZD8A 2JR5A 3PO4A 1NK7A 4CE6A 4P0PA 4KX3A 2KJ8A 4F91B 2KSOB 3M9NB 2JEJA 4I2EA 2K8BB 2ZUDA 1N63A 1N5XA 2W55A 5DG8A 2K4EA 2HCFA 5J0WA 7ICMA 1KFSA 3SEIA 2W9BA 5KT4A 4M9HA 2KD1A 1ZQAA 2W54A 4DSIA 3H40A 3IV6A 2YMQA 3LK9A 7ICEA 2LYAA 3RAQA 1ZQLA 7ICLA 3WK8A 8ICCA 3FAHA 3HX0A 5KT5A 2JZBB 5AKKA 2IOFA 1BPBA 2FPLA 2ZIVA 4UB6U 2RDJA 2G0AA 2BCRA 2DGZA 4DL7A 4QZ8A 3VCBA 1IV8A 4QZCA 2F2AB 2ASLA 4LZGA 2L5YA 3QX7A 4O5CA 5DBAA 4DQRA 2RQ5A 4KLLA 1HJPA 2R8HA 8ICAA 4O5EA 4R65A 5J2JA 1ZQFA 3KTQA 5HMMA 2QB1A 1NK8A 4PL1A 2HMXA 3OPXA 3Q8QB 4CF3A 1ZD3A 4IQUA 5AKLA 2GLEA 3FDSA 5J2DA 2EQYA 4YCXA 1B43A 3I1YA 4NLKA 2RLTA 4DS5A 4QZBA 4I2FA 1Z3EB 5EWGA 2I6XA 5EE9A 4IL6U 3IP4B 3E2EA 3B0XA 4QWBA 4UW9A 4EX7A 3C5GA 2CN1A 8ICVA 2KZ3A 5GTHU 5DBCA 4B9UA 2D6FC 2LYBA 1WCNA 5G5GA 2XY7A 4UARA 4F93B 2LKYA 5C5JA 2W9AA 3RB4A 5KFPA 3KFUF 2RDIA 4DOCA 1XS9D 8ICJA 4O3MA 5J2FA 3M9MB 1S97A 3MDCA 3OSNA 1NK5A 3QU7A 3MR3A 1Z4OA 4UAZA 4PL2A 3I76A 5AM5A 2ZJ8A 4DSEA 1IXRA 4PZOA 2XGQA 2E1EA 3ORYA 1DK3A 4ECWA 9ICOA 2HBJA 7ICOA 5HR6A 1QSLA 1NKBA 1HEKA 2JH7A 4ECVA 3PW4A 2A1JA 7ICSA 3MGIA 1Z00B 2JV3A 1SZPA 5KG2A 3PSPA 5KT2A 4EENA 2ZIXA 2BPFA 5AM0A 4EBCA 2LHTA 1L8OA 4J9SA 5DG7A 2QB0A 3MGHA 1PK1B 3H0MB 4J9LA 4DOBA 2Y0SF 5CB1A 4OJ5A 1H38A 1UPHA 5IIMA 2B0CA 8ICQA 2WFAA 1URJA 2KVSA 4ECXA 4NV0A 1Q3UA 2ZIUA 2N1RA 1S0VA 5DDMA 3AQEA 5AKXA 5CJ7A 4KTQA 1QH9A 4J9OA 3N7SC 1GO3F 1FFVA 2G07A 3PNCA 2QARB 5L1KA 3RR7A 2XO7A 5TISU 2F77X 3HWTA 2DL0A 2DPIA 1TAMA 3M6KA 3WK6A 3NUQA 4MEYA 1ZQEA 2NRXA 3MR6A 4GXIA 4NM2A 2F44A 4O0IA 2ISPA 2K4HA 1SV0C 2BQUA 3QUTA 4QZHA 1OXJA 3WKAA 2F8KA 1V38A 1ZETA 4KLMA 4Y2PA 1NJZA 4PPXA 9ICAA 3OJUA 4DSFA 4YXJA 9ICFA 4DLGA 3Q8MA 4TUPA 3FC4A 4F5QA 1YZ6A 1SL2A 2MA1A 2OHFA 4O3RA 2HVIA 5DQIA 5GTIU 2V9WA 3RFAA 5J0SA 4QW9A 4ECTA 1Z19A 1DOQA 2F76X 4CCHA 2G5IB 2KTQA 2HI0A 3WKCA 1TK0A 1IIPA 2IBKA 2BPCA 3GIJA 1PZNA 4DFDA 4Q8EA 1KBUA 3ONNA 1P7DA 3CRXA 3H8MA 4Q44A 3TAQA 3ED5A 2W11A 1L3UA 5E79U 4R8UA 3EUB2 3EW9A 5AKHA 4Y2TA 1QLNA 5J2EA 1NJYA 3ZD9A 4UB2A 4R64A 3C28A 4IRCA 1MC8A 4LJXA 5KFIA 2IHMA 4KLIA 1KDHA 2KP7A 3CNHA 2FLLA 2ATLA 2KK0A 2BGWA 4JV1A 5KFMA 5AM4A 5DQGA 4C8KA 1S0OA 5IIJA 4DL5A 3NGDA 1F0MA 2UVWA 9ICGA 4DL4A 2DF4B 1LV5A 3AEVA 4CF5A 2H3QA 5KFBA 3G6XA 4BDPA 5L9XA 2PMZF 9ICJA 2E8NA 3BZKA 2HSZA 4EEKA 2P6RA 2H3VA 2ZUCA 4M04A 5ALSA 3TI0A 1DXSA 5AI6A 4DO9A 1SKSA 5KFOA 2B6GA 3ETRA 3JPOA 3EPIA 5ALXA 5KFFA 3JPRA 3WK7A 4OJOA 5J0PA 5KG7A 3DV9A 8ICGA 5IIIA 4I2JA 5HP4A 1TV9A 1ZQSA 2F1JA 5KFJA 1NK4A 2H3FA 4QZFA 4E0DA 3KKAA 2ZG6A 2MU2A 1YZ7A 3QUCA 5KFTA 3F2CA 2PI5A 3PSTA 2KIVA 1ZQNA 2ES6A 3WKBA 3V7LA 5ALGA 3RJJA 3PMNA 1D8LA 1T3NA 4DF4A 2DKZA 1D8BA 3M6ZA 4ED0A 2XC9A 3TADC 5EWFA 4F4WA 5AK4A 3C2MA 3JPTA 1N61A 5AK5A 3B9JA 4FBTA 5AIAA 3UQ0A 2ZUBA 2XCAA 3UXNA 3RJIA 2W8KA 2LM1A 3GILA 1L3TA 1WYGA 5IILA 7ICHA 4OJ6A 4OD0A 4QIWF 2HOFA 2KKPA 1XSPA 1S10A 4QW8A 2W3SA 4O3PA 2C28A 1ZQDA 4Y2YA 2R18A 1ZQZA 3PW2A 1J2MA 4IR9A 2HVHA 2W43A 2IMWP 4KN7A 3M1YA 4DS4A 2KJ9A 4KLFA 2W7PA 2O6KA 4OJLA 4LVSA 4RQ0A 4Q8FA 4YVZA 2BPGA 3AUOA 3Q8LA 4PHDA 2HHQA 2A3VA 5D46A 4U7CA 3MGVA 1X9WA 1L7PA 3C2LA 1QSYA 1DGJA 3LWLA 5EE3A 1TKDA 1JN3A 5F9LA 4J9PA 4M9NA 1S5LU 2YB4A 9ICVA 3DEEA 5ALOA 4B9MA 4R66A 3S6JA 1JMSA 1Q8KA 1ZOLA 2BHNA 5BOLA 3SENA 2PXIA 2DPJA 1X9SA 1KRPA 4I2DA 5ALDA 2E1FA 2HBMA 1A0PA 3C21A 2UVRA 5B5EU 3F53A 4KLHA 4J9QA 1SWWA 2VIXA 4RPYA 3HT3A 5J2BA 2DUYA 1Z4NA 3QZ7A 5KFZA 4RQMA 2WB1C 5G5HA 7ICNA 1RYRA 5J0QA 1A76A 5JU5A 2EZXA 3OGUA 4P4OA 1S0MA 3M8SA 2ZXIA 4KLUA 3SR6A 5FP0A 2KE7A 2CXYA 2XY5A 4NL9A 1F44A 4F4XA 3F5EA 4I2BA 4OCZA 4BWJA 1NKEA 1TAQA 2PMZC 5AIBA 1PVRA 2ZXHA 4O9MA 2J6TA 3EWAA 2DKXA 4M0AA 2WB1F 4O3SA 3RH4A 2HHUA 3SD7A 9ICEA 1JUDA 2R8JA 4YMOA 3OHAA 3PZPA 2H3ZA 3OSPA 1L7OA 1TE2A 4BGDA 4XUSA 1BNOA 4ELTA 2EDUA 5EE0A 4PHEA 3F2BA 4IQVA 1HUZA 3T3FA 1TK8A 5KAIU 4RT2A 4F5OA 2HBKA 2A1AA 2UVVA 1NK6A 5KFKA 2FI1A 1ZQIA 2XGPA 3JPSA 2YMLA 5AM2A 4M9LA 1ZJMA 1MN8A 3MDAA 3PW0A 4Z6EA 5B66U 5CWRA 5D4BA 2W3RA 1UT8A 4HAIA 2JHDA 4RQ8A 1T3QA 5AICA 3RBDA 5JRTA 1ZQBA 3N7RC 4KLSA 1RM6C 4YFKA 4Q45A 5AI5A 1PUZA 5AKEA 3A0BU 4YQWA 1KFTA 3KZIU 2OXOA 4DQPA 3N4MB 5KFNA 3A0HU 3AU2A 3MC1A 1JALA 1ZQPA 3RAXA 4YP3A 2HOIA 3PX4A 4F5RA 2K89A 5AI0A 1N60A 4FS2A 4RNMA 9ICHA 4KITB 4ICAA 2KICA 3HKZF 2JXJA 3QYPA 5J2IA 2P66A 5DQHA 1BPZA 1T8EA 2VA3A 5DGAA 3ZDDA 4KLQA 1X6JA 5IIOA 2OWOA 2KHQA 4ED7A 2XI9A 4C8NA 3ZDBA 1SKRA 3UPQA 3K1ZA 3SV4A 4NXZA 2FLPA 4DOAA 4UB4A 5J2CA 3T5HA 5J29A 5ALYA 5KG6A 1AQ6A 3F2DA 2WF6A 2VJ4A 2C2EA 1ZXIA 4J9RA 3T5JA 2AQ0A 2W9BB 2KMDA 2XVTA 2BQRA 4DL6A 5KT6A 2CPRA 2XICA 3CYMA 4DL3A 4TUSA 4GXJA 4IRKA 2Y1JA 1QQ5A 2VA2A 5KFRA 4HYKA 2D3DA 3N7PD 4NL9C 3K4GA 3C1YA 5A0LA 1C7YA 1ZQKA 1KSPA 4F2RA 3R9KA 1LKYA 1RPLA 4R63A 1ZRMA 4B6JA 5T14A 4DQQA 4Z6DA 3PX0A 4XQ8A 4C7YA 5ALKA 2AXTU 3SI8A 3RJHA 3PR5B 5KFYA 3V6KA 2A19A 2G09A 5ALMA 5KG1A 1MSWD 1O08A 3IM1A 2J6UA 1DGSA 1ZQCA 5DLGA 3TKAA 3ZDAA 4R8UB 2FMQA 2Y9UA 3UXPA 3IDWA 2FPKA 4PGYA 9ICMA 4PHAA 1ZQYA 2ZJAA 5ALTA 3TFSA 1XSLA 4I27A 1CI4A 5KFLA 4XRHA 4DFKA 4J03A 8ICPA 4J9KA 4M9JA 3SAGA 3K75D 2ZIWB 2K4PA 2ZIUB 4KLGA 4FZNA 1ZQ1C 2JRZA 4BJQA 2B21A 5L1MA 9ICPA 4MEXA 1EXNA 2BZFA 1NJXA 3NVWA 5KFXA 3B0YA 2Y1IA 4UB1A 3QU4A 4RZRA 3RRHA 1O03A 2HW3A 4NWIA 4DFJA 3BS5B 5J0UA 4I2IA 1KL9A 5KFSA 1LKYB 2FE9A 2NO4A 3ZDEA 4Z6CA 3WK5A 8ICIA 3MFHA 8ICLA 4P4MA 7ICFA 1RG6A 1Z00A 3BQ2A 4YR3A 2AHOB 2HHXA 1DRGA 4G9BA 1HIWA 2YB1A 4YD2A 2IOHA 4JWNA 1T4GA 2NRTA 2FMSA 1C20A 1RZTA 1XC9A 3RJKA 1X66A 3M7DA 5ALWA 2ZTCA 3QNMA 4QWCA 1S9FA 1BPYA 3HPOA 2WF9A 5J2KA 2XY6A 5DB9A 1NKCA 3V7JA 1X40A 2KZZA 4F2SA 2D8CA 4ED8A 4ECUA 5KTQA 4UAWA 3NS1A 3UM9A 2XCPA 3UMCA 3RJGA 3Q8PB 4ACOA 9ICIA 2OH2A 3RB6A 1XWLA 4DEZA 1XO0A 2GWSA 9ICKA 8ICOA 2MAXA 3BQTA 5DB6A 2BQ3A 2IA6A 2DQNB 4QZEA 1M6YA 1X42A 4UAYA 3T5KA 5AKZA 4RU9A 2OEHA 3GIIA 1HUOA 4DCCA 5KFQA 2JMGA 3SAHA 1CRXA 1SWVA 5KT7A 4RQ2A 4ELVA 4JB3A 3D6JA 5ALLA 5AI9A 3H8WA 3C5FA 1XO1A 4GXKA 4KLEA 2F1IA 1KQQA 5HR7A 4YD1A 5KFWA 3RJFA 2R8KA 4QZGA 4O5KA 4RQ3A 1ZQGA 2EZYA 4K4HA 2I1QA 3AMZA 2DFLA 2UVUA 5AKYA 3TANA 2PFNA 2KOBA 1BGXT 3LVWA 5HMLA 2DBYA 4O3QA 2KN7A 3F5AA 5AI4A 5EE1A 3NVYA 4MFFA 2LYHA 1TK5A 1F5SA 2HDOA 2M9NA 1X6IA 3PMLA 3H8SA 2F8LA 3H7IA 4DL2A 1ZQJA 2P35A 2W9CA 3WKEA 4ED3A 4KMUA 1OUQA 3IG5A 1K1SA 4Y2XA 5IINA 5JTIA 5AKGA 5ALVA 3N97B 4YR2A 1ZD5A 4YG2A 2JEFA 4M47A 2V4QA 2C2DA 4MHVA 2LM4A 4C4TA 4JV2A 2W9MA 1FO4A 1J97A 2LMRA 2Y0SC 9ICCA 3Q8KA 3GV8B 3Q8SB 2LI6A 3KHLA 5L1LA 3MABA 4WJ3B 5AK6A 2BR0A 2W04A 5DBBA 4FFDA 2HBLA 2E8MA 1N2XA 4DLEA 1IM4A 4KLDA 1LB2B 4P0QB 4F4YA 3IN5A 4Z6FA 3V6HA 4ECZA 3D2SA 4J9NA 2LPEA 4UAUA 3HKZC 1U47A 3SQIA 2NO5A 1UT5A 2KJ5A 8ICBA 3KD3A 3KKAC 2BKEA 4OJPA 8ICEA 5ALJA 4TQSA 3H4BA 2KSOA 1U4BA 8ICYA 3L5KA 5J0TA 1XU4A 2Q4TA 5KG0A 1JXLA 2FMPA 1BVSA 5KFAA 3SV3A 1KEJA 2OM6A 4XA5A 4DQIA 4F4ZA 7ICTA 4M6WA 5KG5A 3MFIA 3HRDD 5J8YC 3RRGA 1SGGA 2KG5A 4CNQA 1D9DA 5ALRA 2P6UA 3M8RA 3H0RB 3BS7A 4ECSA 3L4PA 3PVXA 2KNJA 3PSIA 1KLNA 2ZJ5A 4UATA 5C0YA 5KFDA 1RYSA 1CUKA 4Q43A 5J2AA 4B9TA 1KW4A 2MUTB 2VA8A 1SV0A 2R8GA 4Y2RA 4BXOB 1Z1BA 4Y2SA 2PFPA 1ZQTA 8ICWA 4EYHB 2KEYA 3ETLA 4BUGA 1UCVA 4RQ5A 5DLFA 3QUBA 9ICNA 5ALPA 3BQ1A 2Q0ZX 7ICRA 2QARA 2WF5A 4FZMA 4AP9A 4YN4A 2KVCA 3ISDA 3UMGA 1U48A 2PFQA 1SZHA 3H4DA 3RR8A 3HILA 1U9LA 1N62A 2G08A 4YMMA 1FFUA 2F3NA 1Z1VA 3MBYA 2KZMA 4NLGA 1JI7A 4BWMA 1WG8A 2LBOA 2EAPA 1N56A 5CP2A 1PK3A 2C2RA 2GOLA 3TADA 2PI4A 3KZXA 3AL0B 2QB0B 5J0RA 2AGQA 1Q46A 1S8OA 1ZJNA 4EZ9A 3AN1A 3WU2U 2QLTA 3AQFA 5ALIA 1SXEA 2HHWA 4UBBA 4F50A 2KHVA 3TAPA 2JGAA 2E3TA 1RDFA 2WHEA 1ZQOA 3WK9A 3EPGA 5L1JA 4KLOA 4IS7A 3NTUA 5DGBA 3RJEA 3ISBA 5AK3A 1V97A 4PZNA 4TQRA 2C22A 4US9A 1XSNA 4MFCA 5BPCA 3C23A 2Z7JA 4QZAA 3HJEA 2EH9A 3V7KA 2R8IA 3IRUA 3RF9A 4QJFB 2YN4A 2IHNA 4RUAA 1NI3A 3PW7A 1FIQA 1K5OA 2W7OA 5ALUA 1L7NA 4RQ4A 4JMUA 1NJWA 1NK0A 3FM9A 1ZQUA 2NV3A 2VKQA 1MA7A 3C2KA 4LZDA 4B9VA 9ICUA 1NZPA 2KFNA 1L3VA 4IQWA 5HNKA 5J0YA 4FE3A 5KFEA 2VANA 1TVAA 8ICZA 2BCUA 2ZIWA 3JPQA 2HOQA 3FYHA 2IOFK 4I29A 4RT3A 2E8PA 3C1ZA 4QNLA 9ICXA 1ZQVA 4FZLA 4BXOA 1PVQA 8ICFA 4ED1A 2ASJA 3SYZA 3PSFA 2BCVA 4QZ9A 2WAQC 5DG9A 5DB8A 3QU2A 1VJ5A 3ZDCA 2HHTA 4GC7A 4IRDA 1V85A 2GH1A 2NRZA 1S0NA 1VLBA 4ED2A 4CDGA 3GIKA 1K1QA 4UB3A 3RB3A 4AYBF 7ICUA 7ICIA 3V72A 2YX8A 2BCQA 4OO1J 2NYVA 2ZIVB 3T5LA 3GV5B 4DFPA 1TFRA 4GLXA 1RQNA 3E0FA 4C0ZA 4M2YA 5KG4A 2JH1A 4PGXA 4NJ8A 4IR1A 4O3OA 2BCSA 4ELUA 3GZFA 3H0LB 4QIWC 9ICSA 1L6NA 1MQ2A 2WAQF 4GIBA 4MFAA 2MRLA 4YMNA 5CRXA 2EANA 4ZH4A 5DB7A 4RPZA 4O3NA 1B0XA 3MR5A 2FDRA 2PFOA 4RQ7A 4K4GA 5ALQA 1A77A 3GFKB 1COKA 5KAFU 3GU3A 1KTQA 3LVVA 2ALZA 4U6PA 4FS1A 1X9MA 4RQNA 1RXVA 2CRXA 1QQ6A 7ICQA 5BOMA 1B4FA 2K8CB 4C80A 4YXMA 1ZD2P 2YTUA 4CF4A 3IHQB 5EOZA 1N48A 3BJYA 4KX5A 1ZQHA 4NY8A 4I2AA 4QZDA 3KHHA 1UA0A 1Q3VA 1ED1A 1QSSA 4ECQA 3JPNA 3TQ1A 4F5NA 3SAFA 5ALNA 9ICWA 1JX4A 1SXDA 4I2HA 1OW5A 2NRVA 5JUMA 4PJ0U 2AJQA 3NRZA 3GQCA 4RNNA 5DDYA 3G6VA 4I2GA 1LVHA 5ALHA 4RNOA 2AH5A 1RXWA 9ICBA 3BDPA 1BPDA 3UXOA 3OJSA 3NRWA 1SKWA 4KN4A 3C29A 5H2FU 1N5WA 1L7MA 2BDPA 3RH5A 2G06A 4QWDA 4FBUA 3KBBA 4NM1A 1D8YA 3BQ7A 2ASDA 2JEGA 4DFMA 4ZOHC 2AGOA 1COOA 2WF8A 2KKVA 5D49A 4F71A 4RQ6A 4QZIA 3MR2A 4I2CA 1BPXA 2W03A 3NVZA 4TUQA 3QE9Y 4JWMA 1SV4A 3RTVA 2YQEA 2F1HA 4X5VA 2KFZA 5IIKA 3BZCA 4RQ1A 4K4IA 3O0FA 4IC9A 3WK4A 5L1IA 3SZ2A 4UAVA 3DDHA 3TFRA 3NASA 4DF8A 4J9MA 1TAUA 5KNIA 3HP6A 7ICGA 5AHXA 4EYIB 3QXGA 3AM9A 2RHFA 3PX6A 3EYZA 8ICKA 1S76D 1NK9A 2KV2A 4UB5A 4MF8A 4ECRA 2EAOA 5AM3A 3OHBA 5KG3A 3QZ8A 1ECWA 1T7PA 2QKQA 1L3SA 8ICSA 2ESEA 2YMPA 3JPPA 8ICHA 8ICRA 2H5XA 8ICMA 4DQSA 3KOOA 1RQLA 4QWEA 4PGQA 5J8YA 3THVA 4JUZA 2E8OA 4DSLA 2OCEA 4IQTA 8ICUA 4Y2VA 1XNSA 2JZBA 2MSNA 2AU0A 1ZQRA 1MQ3A 5AKIA 2WTFA 3UQ2A 3N28A 4P2HA 2ZIXB 3OTQA 1KFDA 2AGPA 4USAA 2HHSA 2A1JB 3PO5A 2W9CB 1L5UA 1U49A 1B22A 5KT3A 4M9GA 2YY6A 4PHPA 3ZI4A 4RUCA 4BX9C 4P4PA 2ISOA 3LDAA 4A8EA 2AQ4A 9ICLA 1WWVA 3BS5A 4B9LA 3J81j 4P0PB 4Y2UA 4ED6A 4B9SA 3CP8A 4GC6A 4US8A 3I28A 4F4KA 3PY8A 1WCLA 4TURA 3PV8A 4DWIA 3QUQA 3AU6A 5J0OA 1PK1A 5ALZA 1YT3A 1A6SA 4KLTA 4UB8U 4ECYA 3E58A 5CHGA 4EELA 4F8RA 4AYBC 5HHHA 4EBDA 1J2NA 4YR0A 2H3IA 5KFUA 3KHGA 3UMBA 1SB3C 4C4RA 3LWMA 9ICRA 5KFHA 3Q8RB 1T94A 3RB0A 1X2IA 3M9OB 1QQ7A 3PR4A 3TACB 2BDUA 2K8AA 4GFJA 1QTMA 4UBCA 5AM1A 4B9NA 1SIJA 3ICXA 3SMVA 4F92B 5EWEA 1UA1A 3TARA 5KFGA 3D2NA 3ISCA 3QEAZ 1VDVA 2I5HA 3GIMA 4C4SA 4CRXA 2ZTEA 3H8JA 8ICNA 2EAMA 4EEYA 2WF7A 1ZYQA 2JEIA 3ALRA 3QU5A 4QWAA 4EX6A 1CEZA 1RYUA 1V9PA 1WUDA 4NLNA 3IG8A 1KN5A 1NNLA 5KFCA 1QCKA 4NLZA 5F3XB 2W8LA 4EBEA 2J6SA 4JV0A 4F3OA 7ICPA 9ICQA 2EZZA 5KL8B 1BNPA 4JK1A 1NZBA 3HW8A 2FPMA 4NLBA 5CEHA 1ZD4A 1BPEA 5TZVA 5F9NA 3D2QA 4F72A 1JROA 3RBEA 3CW2C 4DSKA 2DWQA 5HHIA 3VC8A 4G3IA 4Y2QA 1SL1A 2FJ6A 5ALEA 1D9FA 2I9GA 2XIDA 2ODGA 8ICXA 9ICTA 2E5SA 4C7ZA 3V6JA 1UQVA 2GO7A 4Y2JA 5KL1B 7ICVA 1IG6A 4CGZA 4FO6A 3G6YA 1ZQQA 5J2GA 8ICTA 3BQ0A 4PH5A 1AROP 1PVPA 2RP5A 1JRPA 4DSJA 3KHRA 5KFVA 5DKWA 2OYYA 4UASA 4P0QA 4RPXA 5K4LA 5J2HA 1Y88A 4C8OA 7ICKA 3GDXA 2K60A 1NOMA 1SL0A 5AKJA 4I28A 3U26A 1JIHA 2FLNA 4NLCA 5CA7A 4M6WB 3QEBZ 3K1RB 2G5HB 1ZQMA 1ZRNA 2KIWA 1U45A 4MF2A 4KMOB 2RRDA 5ALFA 4EZ6A 2PKEA 3PW5A 2ZTDA 3RH6A 2NRWA 2HHVA 1ZQWA 5AI8A 2M0NA 2Y9TA 1JXEA 3T79A 3EZ5A 7ICJA 1WWUA 1DK2A 5CR0A 1FEZA 4KLJA 1UHUA 2YMMA 2MUTA 4UQGA 1S77D 1KKXA 2K4IA 1X9XA 4F5PA 3LYSA 2VJ5A 3NVVA
chains in the Genus database with same CATH topology
2G09A 2G06A 4QJFB 2MRLA 1URJA 5CRXA 2WB1C 1NZBA 2OXOA 4NV0A 1Q3UA 3L3FX 4NLBA 4BX9C 2ZIUA 2N1RA 4A8EA 3AQEA 2KKVA 1Z1BA 3D2QA 4OJ6A 3N7SC 2W7OA 4P0PB 1GO3F 2G07A 2KEYA 2W03A 3IP4B 4QIWF 2HOFA 2HOIA 4ACOA 2KKPA 2Y0SC 2OH2A 4BUGA 2K89A 3CP8A 3VC8A 2ZXIA 4JMUA 2DF4B 2F77X 2R18A 1TAMA 2NV3A 2XIDA 3M6KA 2H3QA 3O0FA 2CN1A 4IC9A 4KX3A 1XO0A 2VKQA 4ICAA 2KICA 1YT3A 2KJ8A 3HKZF 2E5SA 4FZMA 3GU3A 1MA7A 1A6SA 1F44A 2D6FC 2DQNB 2KVCA 3LVVA 3SAGA 3F5EA 2LYBA 3NUQA 4WJ3B 2PMZF 2KJ9A 2ZIWB 2W7PA 1SZHA 5KL1B 2K8BB 4U6PA 2ZIUB 2W04A 4FE3A 4OJLA 4AYBC 2LKYA 4CGZA 2KHQA 2HBLA 4FZNA 1ZQ1C 2G08A 4BJQA 2K4EA 2K4HA 2PMZC 2CRXA 2XI9A 1PVRA 2ZXHA 3KFUF 3K1ZA 2H3VA 2JMGA 2ZIWA 2LBOA 3LYSA 2K8CB 1PVPA 2RP5A 4O3MA 2H3IA 4OJ5A 2HOQA 3SAHA 1CRXA 4P0QB 2KD1A 2WB1F 2A3VA 2GOLA 2RHFA 3IN5A 3F2DA 3D2SA 2VJ4A 4KX5A 4U7CA 3KZXA 2OYYA 3AL0B 1T94A 4QNLA 3MGVA 4FZLA 3HKZC 3PZPA 2LYAA 4P0QA 2H3ZA 3SQIA 4NWIA 4PL2A 2KJ5A 2KV2A 1PVQA 5HR7A 3PSFA 2XVTA 2BDUA 2K8AA 4GFJA 2E1EA 1Q3VA 3F2BA 1ECWA 1ED1A 2MA1A 4OJOA 2WAQC 2CPRA 4OJPA 2ZIVA 3AQFA 3ICXA 3SMVA 2XICA 3CYMA 2G0AA 3SAFA 4NLCA 2DGZA 2KHVA 2HBJA 2HBKA 2G5HB 3VCBA 2GH1A 2KIWA 2F2AB 2JGAA 2YB4A 3D2NA 2H3FA 4KMOB 3RFAA 1HEKA 2JH7A 2RRDA 4CDGA 2Q4TA 1Z19A 4AYBF 3DEEA 2ZG6A 2OM6A 2F76X 4CRXA 1DRGA 4P0PA 2KOBA 2G5IB 1HIWA 2YB1A 3LVWA 3N7PD 1IIPA 2YX8A 3PSPA 5A0LA 3F5AA 4OO1J 3F2CA 3ALRA 3PSTA 2ZIVB 1XNSA 2ZIXA 1KBUA 3C29A 2M0NA 3ONNA 5T14A 1P7DA 3CRXA 3E0FA 4C0ZA 1WUDA 2JHDA 2F8LA 2JH1A 2HMXA 2LHTA 3H0RB 3IG8A 3OPXA 2E1FA 4PL1A 3T79A 3M7DA 2HBMA 2ZIXB 1A0PA 3GZFA 3H0LB 4QIWC 2KNJA 5HR6A 3PSIA 3F53A 2Z7JA 3C28A 3M6ZA 3H0MB 1D8BA 5C0YA 2K4IA 3N7RC 1L6NA 1OUQA 2VIXA 2Y0SF 3NRWA 2WAQF 2VJ5A 3IG5A 1UPHA 5KL8B 3RF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ F;  2WB1 F;  4AYB F;  2Y0S F;  2WAQ F;  2PMZ F; 
#chains in the Genus database with same CATH topology
 3GV7 B;  3WKD A;  1L8L A;  1ZQX A;  3L3F X;  5J0X A;  4C8L A;  2V4R A;  3QU9 A;  4C8M A;  3ZD8 A;  2JR5 A;  3PO4 A;  1NK7 A;  4CE6 A;  4P0P A;  4KX3 A;  2KJ8 A;  4F91 B;  2KSO B;  3M9N B;  2JEJ A;  4I2E A;  2K8B B;  2ZUD A;  1N63 A;  1N5X A;  2W55 A;  5DG8 A;  2K4E A;  2HCF A;  5J0W A;  7ICM A;  1KFS A;  3SEI A;  2W9B A;  5KT4 A;  4M9H A;  2KD1 A;  1ZQA A;  2W54 A;  4DSI A;  3H40 A;  3IV6 A;  2YMQ A;  3LK9 A;  7ICE A;  2LYA A;  3RAQ A;  1ZQL A;  7ICL A;  3WK8 A;  8ICC A;  3FAH A;  3HX0 A;  5KT5 A;  2JZB B;  5AKK A;  2IOF A;  1BPB A;  2FPL A;  2ZIV A;  4UB6 U;  2RDJ A;  2G0A A;  2BCR A;  2DGZ A;  4DL7 A;  4QZ8 A;  3VCB A;  1IV8 A;  4QZC A;  2F2A B;  2ASL A;  4LZG A;  2L5Y A;  3QX7 A;  4O5C A;  5DBA A;  4DQR A;  2RQ5 A;  4KLL A;  1HJP A;  2R8H A;  8ICA A;  4O5E A;  4R65 A;  5J2J A;  1ZQF A;  3KTQ A;  5HMM A;  2QB1 A;  1NK8 A;  4PL1 A;  2HMX A;  3OPX A;  3Q8Q B;  4CF3 A;  1ZD3 A;  4IQU A;  5AKL A;  2GLE A;  3FDS A;  5J2D A;  2EQY A;  4YCX A;  1B43 A;  3I1Y A;  4NLK A;  2RLT A;  4DS5 A;  4QZB A;  4I2F A;  1Z3E B;  5EWG A;  2I6X A;  5EE9 A;  4IL6 U;  3IP4 B;  3E2E A;  3B0X A;  4QWB A;  4UW9 A;  4EX7 A;  3C5G A;  2CN1 A;  8ICV A;  2KZ3 A;  5GTH U;  5DBC A;  4B9U A;  2D6F C;  2LYB A;  1WCN A;  5G5G A;  2XY7 A;  4UAR A;  4F93 B;  2LKY A;  5C5J A;  2W9A A;  3RB4 A;  5KFP A;  3KFU F;  2RDI A;  4DOC A;  1XS9 D;  8ICJ A;  4O3M A;  5J2F A;  3M9M B;  1S97 A;  3MDC A;  3OSN A;  1NK5 A;  3QU7 A;  3MR3 A;  1Z4O A;  4UAZ A;  4PL2 A;  3I76 A;  5AM5 A;  2ZJ8 A;  4DSE A;  1IXR A;  4PZO A;  2XGQ A;  2E1E A;  3ORY A;  1DK3 A;  4ECW A;  9ICO A;  2HBJ A;  7ICO A;  5HR6 A;  1QSL A;  1NKB A;  1HEK A;  2JH7 A;  4ECV A;  3PW4 A;  2A1J A;  7ICS A;  3MGI A;  1Z00 B;  2JV3 A;  1SZP A;  5KG2 A;  3PSP A;  5KT2 A;  4EEN A;  2ZIX A;  2BPF A;  5AM0 A;  4EBC A;  2LHT A;  1L8O A;  4J9S A;  5DG7 A;  2QB0 A;  3MGH A;  1PK1 B;  3H0M B;  4J9L A;  4DOB A;  2Y0S F;  5CB1 A;  4OJ5 A;  1H38 A;  1UPH A;  5IIM A;  2B0C A;  8ICQ A;  2WFA A;  1URJ A;  2KVS A;  4ECX A;  4NV0 A;  1Q3U A;  2ZIU A;  2N1R A;  1S0V A;  5DDM A;  3AQE A;  5AKX A;  5CJ7 A;  4KTQ A;  1QH9 A;  4J9O A;  3N7S C;  1GO3 F;  1FFV A;  2G07 A;  3PNC A;  2QAR B;  5L1K A;  3RR7 A;  2XO7 A;  5TIS U;  2F77 X;  3HWT A;  2DL0 A;  2DPI A;  1TAM A;  3M6K A;  3WK6 A;  3NUQ A;  4MEY A;  1ZQE A;  2NRX A;  3MR6 A;  4GXI A;  4NM2 A;  2F44 A;  4O0I A;  2ISP A;  2K4H A;  1SV0 C;  2BQU A;  3QUT A;  4QZH A;  1OXJ A;  3WKA A;  2F8K A;  1V38 A;  1ZET A;  4KLM A;  4Y2P A;  1NJZ A;  4PPX A;  9ICA A;  3OJU A;  4DSF A;  4YXJ A;  9ICF A;  4DLG A;  3Q8M A;  4TUP A;  3FC4 A;  4F5Q A;  1YZ6 A;  1SL2 A;  2MA1 A;  2OHF A;  4O3R A;  2HVI A;  5DQI A;  5GTI U;  2V9W A;  3RFA A;  5J0S A;  4QW9 A;  4ECT A;  1Z19 A;  1DOQ A;  2F76 X;  4CCH A;  2G5I B;  2KTQ A;  2HI0 A;  3WKC A;  1TK0 A;  1IIP A;  2IBK A;  2BPC A;  3GIJ A;  1PZN A;  4DFD A;  4Q8E A;  1KBU A;  3ONN A;  1P7D A;  3CRX A;  3H8M A;  4Q44 A;  3TAQ A;  3ED5 A;  2W11 A;  1L3U A;  5E79 U;  4R8U A;  3EUB 2;  3EW9 A;  5AKH A;  4Y2T A;  1QLN A;  5J2E A;  1NJY A;  3ZD9 A;  4UB2 A;  4R64 A;  3C28 A;  4IRC A;  1MC8 A;  4LJX A;  5KFI A;  2IHM A;  4KLI A;  1KDH A;  2KP7 A;  3CNH A;  2FLL A;  2ATL A;  2KK0 A;  2BGW A;  4JV1 A;  5KFM A;  5AM4 A;  5DQG A;  4C8K A;  1S0O A;  5IIJ A;  4DL5 A;  3NGD A;  1F0M A;  2UVW A;  9ICG A;  4DL4 A;  2DF4 B;  1LV5 A;  3AEV A;  4CF5 A;  2H3Q A;  5KFB A;  3G6X A;  4BDP A;  5L9X A;  2PMZ F;  9ICJ A;  2E8N A;  3BZK A;  2HSZ A;  4EEK A;  2P6R A;  2H3V A;  2ZUC A;  4M04 A;  5ALS A;  3TI0 A;  1DXS A;  5AI6 A;  4DO9 A;  1SKS A;  5KFO A;  2B6G A;  3ETR A;  3JPO A;  3EPI A;  5ALX A;  5KFF A;  3JPR A;  3WK7 A;  4OJO A;  5J0P A;  5KG7 A;  3DV9 A;  8ICG A;  5III A;  4I2J A;  5HP4 A;  1TV9 A;  1ZQS A;  2F1J A;  5KFJ A;  1NK4 A;  2H3F A;  4QZF A;  4E0D A;  3KKA A;  2ZG6 A;  2MU2 A;  1YZ7 A;  3QUC A;  5KFT A;  3F2C A;  2PI5 A;  3PST A;  2KIV A;  1ZQN A;  2ES6 A;  3WKB A;  3V7L A;  5ALG A;  3RJJ A;  3PMN A;  1D8L A;  1T3N A;  4DF4 A;  2DKZ A;  1D8B A;  3M6Z A;  4ED0 A;  2XC9 A;  3TAD C;  5EWF A;  4F4W A;  5AK4 A;  3C2M A;  3JPT A;  1N61 A;  5AK5 A;  3B9J A;  4FBT A;  5AIA A;  3UQ0 A;  2ZUB A;  2XCA A;  3UXN A;  3RJI A;  2W8K A;  2LM1 A;  3GIL A;  1L3T A;  1WYG A;  5IIL A;  7ICH A;  4OJ6 A;  4OD0 A;  4QIW F;  2HOF A;  2KKP A;  1XSP A;  1S10 A;  4QW8 A;  2W3S A;  4O3P A;  2C28 A;  1ZQD A;  4Y2Y A;  2R18 A;  1ZQZ A;  3PW2 A;  1J2M A;  4IR9 A;  2HVH A;  2W43 A;  2IMW P;  4KN7 A;  3M1Y A;  4DS4 A;  2KJ9 A;  4KLF A;  2W7P A;  2O6K A;  4OJL A;  4LVS A;  4RQ0 A;  4Q8F A;  4YVZ A;  2BPG A;  3AUO A;  3Q8L A;  4PHD A;  2HHQ A;  2A3V A;  5D46 A;  4U7C A;  3MGV A;  1X9W A;  1L7P A;  3C2L A;  1QSY A;  1DGJ A;  3LWL A;  5EE3 A;  1TKD A;  1JN3 A;  5F9L A;  4J9P A;  4M9N A;  1S5L U;  2YB4 A;  9ICV A;  3DEE A;  5ALO A;  4B9M A;  4R66 A;  3S6J A;  1JMS A;  1Q8K A;  1ZOL A;  2BHN A;  5BOL A;  3SEN A;  2PXI A;  2DPJ A;  1X9S A;  1KRP A;  4I2D A;  5ALD A;  2E1F A;  2HBM A;  1A0P A;  3C21 A;  2UVR A;  5B5E U;  3F53 A;  4KLH A;  4J9Q A;  1SWW A;  2VIX A;  4RPY A;  3HT3 A;  5J2B A;  2DUY A;  1Z4N A;  3QZ7 A;  5KFZ A;  4RQM A;  2WB1 C;  5G5H A;  7ICN A;  1RYR A;  5J0Q A;  1A76 A;  5JU5 A;  2EZX A;  3OGU A;  4P4O A;  1S0M A;  3M8S A;  2ZXI A;  4KLU A;  3SR6 A;  5FP0 A;  2KE7 A;  2CXY A;  2XY5 A;  4NL9 A;  1F44 A;  4F4X A;  3F5E A;  4I2B A;  4OCZ A;  4BWJ A;  1NKE A;  1TAQ A;  2PMZ C;  5AIB A;  1PVR A;  2ZXH A;  4O9M A;  2J6T A;  3EWA A;  2DKX A;  4M0A A;  2WB1 F;  4O3S A;  3RH4 A;  2HHU A;  3SD7 A;  9ICE A;  1JUD A;  2R8J A;  4YMO A;  3OHA A;  3PZP A;  2H3Z A;  3OSP A;  1L7O A;  1TE2 A;  4BGD A;  4XUS A;  1BNO A;  4ELT A;  2EDU A;  5EE0 A;  4PHE A;  3F2B A;  4IQV A;  1HUZ A;  3T3F A;  1TK8 A;  5KAI U;  4RT2 A;  4F5O A;  2HBK A;  2A1A A;  2UVV A;  1NK6 A;  5KFK A;  2FI1 A;  1ZQI A;  2XGP A;  3JPS A;  2YML A;  5AM2 A;  4M9L A;  1ZJM A;  1MN8 A;  3MDA A;  3PW0 A;  4Z6E A;  5B66 U;  5CWR A;  5D4B A;  2W3R A;  1UT8 A;  4HAI A;  2JHD A;  4RQ8 A;  1T3Q A;  5AIC A;  3RBD A;  5JRT A;  1ZQB A;  3N7R C;  4KLS A;  1RM6 C;  4YFK A;  4Q45 A;  5AI5 A;  1PUZ A;  5AKE A;  3A0B U;  4YQW A;  1KFT A;  3KZI U;  2OXO A;  4DQP A;  3N4M B;  5KFN A;  3A0H U;  3AU2 A;  3MC1 A;  1JAL A;  1ZQP A;  3RAX A;  4YP3 A;  2HOI A;  3PX4 A;  4F5R A;  2K89 A;  5AI0 A;  1N60 A;  4FS2 A;  4RNM A;  9ICH A;  4KIT B;  4ICA A;  2KIC A;  3HKZ F;  2JXJ A;  3QYP A;  5J2I A;  2P66 A;  5DQH A;  1BPZ A;  1T8E A;  2VA3 A;  5DGA A;  3ZDD A;  4KLQ A;  1X6J A;  5IIO A;  2OWO A;  2KHQ A;  4ED7 A;  2XI9 A;  4C8N A;  3ZDB A;  1SKR A;  3UPQ A;  3K1Z A;  3SV4 A;  4NXZ A;  2FLP A;  4DOA A;  4UB4 A;  5J2C A;  3T5H A;  5J29 A;  5ALY A;  5KG6 A;  1AQ6 A;  3F2D A;  2WF6 A;  2VJ4 A;  2C2E A;  1ZXI A;  4J9R A;  3T5J A;  2AQ0 A;  2W9B B;  2KMD A;  2XVT A;  2BQR A;  4DL6 A;  5KT6 A;  2CPR A;  2XIC A;  3CYM A;  4DL3 A;  4TUS A;  4GXJ A;  4IRK A;  2Y1J A;  1QQ5 A;  2VA2 A;  5KFR A;  4HYK A;  2D3D A;  3N7P D;  4NL9 C;  3K4G A;  3C1Y A;  5A0L A;  1C7Y A;  1ZQK A;  1KSP A;  4F2R A;  3R9K A;  1LKY A;  1RPL A;  4R63 A;  1ZRM A;  4B6J A;  5T14 A;  4DQQ A;  4Z6D A;  3PX0 A;  4XQ8 A;  4C7Y A;  5ALK A;  2AXT U;  3SI8 A;  3RJH A;  3PR5 B;  5KFY A;  3V6K A;  2A19 A;  2G09 A;  5ALM A;  5KG1 A;  1MSW D;  1O08 A;  3IM1 A;  2J6U A;  1DGS A;  1ZQC A;  5DLG A;  3TKA A;  3ZDA A;  4R8U B;  2FMQ A;  2Y9U A;  3UXP A;  3IDW A;  2FPK A;  4PGY A;  9ICM A;  4PHA A;  1ZQY A;  2ZJA A;  5ALT A;  3TFS A;  1XSL A;  4I27 A;  1CI4 A;  5KFL A;  4XRH A;  4DFK A;  4J03 A;  8ICP A;  4J9K A;  4M9J A;  3SAG A;  3K75 D;  2ZIW B;  2K4P A;  2ZIU B;  4KLG A;  4FZN A;  1ZQ1 C;  2JRZ A;  4BJQ A;  2B21 A;  5L1M A;  9ICP A;  4MEX A;  1EXN A;  2BZF A;  1NJX A;  3NVW A;  5KFX A;  3B0Y A;  2Y1I A;  4UB1 A;  3QU4 A;  4RZR A;  3RRH A;  1O03 A;  2HW3 A;  4NWI A;  4DFJ A;  3BS5 B;  5J0U A;  4I2I A;  1KL9 A;  5KFS A;  1LKY B;  2FE9 A;  2NO4 A;  3ZDE A;  4Z6C A;  3WK5 A;  8ICI A;  3MFH A;  8ICL A;  4P4M A;  7ICF A;  1RG6 A;  1Z00 A;  3BQ2 A;  4YR3 A;  2AHO B;  2HHX A;  1DRG A;  4G9B A;  1HIW A;  2YB1 A;  4YD2 A;  2IOH A;  4JWN A;  1T4G A;  2NRT A;  2FMS A;  1C20 A;  1RZT A;  1XC9 A;  3RJK A;  1X66 A;  3M7D A;  5ALW A;  2ZTC A;  3QNM A;  4QWC A;  1S9F A;  1BPY A;  3HPO A;  2WF9 A;  5J2K A;  2XY6 A;  5DB9 A;  1NKC A;  3V7J A;  1X40 A;  2KZZ A;  4F2S A;  2D8C A;  4ED8 A;  4ECU A;  5KTQ A;  4UAW A;  3NS1 A;  3UM9 A;  2XCP A;  3UMC A;  3RJG A;  3Q8P B;  4ACO A;  9ICI A;  2OH2 A;  3RB6 A;  1XWL A;  4DEZ A;  1XO0 A;  2GWS A;  9ICK A;  8ICO A;  2MAX A;  3BQT A;  5DB6 A;  2BQ3 A;  2IA6 A;  2DQN B;  4QZE A;  1M6Y A;  1X42 A;  4UAY A;  3T5K A;  5AKZ A;  4RU9 A;  2OEH A;  3GII A;  1HUO A;  4DCC A;  5KFQ A;  2JMG A;  3SAH A;  1CRX A;  1SWV A;  5KT7 A;  4RQ2 A;  4ELV A;  4JB3 A;  3D6J A;  5ALL A;  5AI9 A;  3H8W A;  3C5F A;  1XO1 A;  4GXK A;  4KLE A;  2F1I A;  1KQQ A;  5HR7 A;  4YD1 A;  5KFW A;  3RJF A;  2R8K A;  4QZG A;  4O5K A;  4RQ3 A;  1ZQG A;  2EZY A;  4K4H A;  2I1Q A;  3AMZ A;  2DFL A;  2UVU A;  5AKY A;  3TAN A;  2PFN A;  2KOB A;  1BGX T;  3LVW A;  5HML A;  2DBY A;  4O3Q A;  2KN7 A;  3F5A A;  5AI4 A;  5EE1 A;  3NVY A;  4MFF A;  2LYH A;  1TK5 A;  1F5S A;  2HDO A;  2M9N A;  1X6I A;  3PML A;  3H8S A;  2F8L A;  3H7I A;  4DL2 A;  1ZQJ A;  2P35 A;  2W9C A;  3WKE A;  4ED3 A;  4KMU A;  1OUQ A;  3IG5 A;  1K1S A;  4Y2X A;  5IIN A;  5JTI A;  5AKG A;  5ALV A;  3N97 B;  4YR2 A;  1ZD5 A;  4YG2 A;  2JEF A;  4M47 A;  2V4Q A;  2C2D A;  4MHV A;  2LM4 A;  4C4T A;  4JV2 A;  2W9M A;  1FO4 A;  1J97 A;  2LMR A;  2Y0S C;  9ICC A;  3Q8K A;  3GV8 B;  3Q8S B;  2LI6 A;  3KHL A;  5L1L A;  3MAB A;  4WJ3 B;  5AK6 A;  2BR0 A;  2W04 A;  5DBB A;  4FFD A;  2HBL A;  2E8M A;  1N2X A;  4DLE A;  1IM4 A;  4KLD A;  1LB2 B;  4P0Q B;  4F4Y A;  3IN5 A;  4Z6F A;  3V6H A;  4ECZ A;  3D2S A;  4J9N A;  2LPE A;  4UAU A;  3HKZ C;  1U47 A;  3SQI A;  2NO5 A;  1UT5 A;  2KJ5 A;  8ICB A;  3KD3 A;  3KKA C;  2BKE A;  4OJP A;  8ICE A;  5ALJ A;  4TQS A;  3H4B A;  2KSO A;  1U4B A;  8ICY A;  3L5K A;  5J0T A;  1XU4 A;  2Q4T A;  5KG0 A;  1JXL A;  2FMP A;  1BVS A;  5KFA A;  3SV3 A;  1KEJ A;  2OM6 A;  4XA5 A;  4DQI A;  4F4Z A;  7ICT A;  4M6W A;  5KG5 A;  3MFI A;  3HRD D;  5J8Y C;  3RRG A;  1SGG A;  2KG5 A;  4CNQ A;  1D9D A;  5ALR A;  2P6U A;  3M8R A;  3H0R B;  3BS7 A;  4ECS A;  3L4P A;  3PVX A;  2KNJ A;  3PSI A;  1KLN A;  2ZJ5 A;  4UAT A;  5C0Y A;  5KFD A;  1RYS A;  1CUK A;  4Q43 A;  5J2A A;  4B9T A;  1KW4 A;  2MUT B;  2VA8 A;  1SV0 A;  2R8G A;  4Y2R A;  4BXO B;  1Z1B A;  4Y2S A;  2PFP A;  1ZQT A;  8ICW A;  4EYH B;  2KEY A;  3ETL A;  4BUG A;  1UCV A;  4RQ5 A;  5DLF A;  3QUB A;  9ICN A;  5ALP A;  3BQ1 A;  2Q0Z X;  7ICR A;  2QAR A;  2WF5 A;  4FZM A;  4AP9 A;  4YN4 A;  2KVC A;  3ISD A;  3UMG A;  1U48 A;  2PFQ A;  1SZH A;  3H4D A;  3RR8 A;  3HIL A;  1U9L A;  1N62 A;  2G08 A;  4YMM A;  1FFU A;  2F3N A;  1Z1V A;  3MBY A;  2KZM A;  4NLG A;  1JI7 A;  4BWM A;  1WG8 A;  2LBO A;  2EAP A;  1N56 A;  5CP2 A;  1PK3 A;  2C2R A;  2GOL A;  3TAD A;  2PI4 A;  3KZX A;  3AL0 B;  2QB0 B;  5J0R A;  2AGQ A;  1Q46 A;  1S8O A;  1ZJN A;  4EZ9 A;  3AN1 A;  3WU2 U;  2QLT A;  3AQF A;  5ALI A;  1SXE A;  2HHW A;  4UBB A;  4F50 A;  2KHV A;  3TAP A;  2JGA A;  2E3T A;  1RDF A;  2WHE A;  1ZQO A;  3WK9 A;  3EPG A;  5L1J A;  4KLO A;  4IS7 A;  3NTU A;  5DGB A;  3RJE A;  3ISB A;  5AK3 A;  1V97 A;  4PZN A;  4TQR A;  2C22 A;  4US9 A;  1XSN A;  4MFC A;  5BPC A;  3C23 A;  2Z7J A;  4QZA A;  3HJE A;  2EH9 A;  3V7K A;  2R8I A;  3IRU A;  3RF9 A;  4QJF B;  2YN4 A;  2IHN A;  4RUA A;  1NI3 A;  3PW7 A;  1FIQ A;  1K5O A;  2W7O A;  5ALU A;  1L7N A;  4RQ4 A;  4JMU A;  1NJW A;  1NK0 A;  3FM9 A;  1ZQU A;  2NV3 A;  2VKQ A;  1MA7 A;  3C2K A;  4LZD A;  4B9V A;  9ICU A;  1NZP A;  2KFN A;  1L3V A;  4IQW A;  5HNK A;  5J0Y A;  4FE3 A;  5KFE A;  2VAN A;  1TVA A;  8ICZ A;  2BCU A;  2ZIW A;  3JPQ A;  2HOQ A;  3FYH A;  2IOF K;  4I29 A;  4RT3 A;  2E8P A;  3C1Z A;  4QNL A;  9ICX A;  1ZQV A;  4FZL A;  4BXO A;  1PVQ A;  8ICF A;  4ED1 A;  2ASJ A;  3SYZ A;  3PSF A;  2BCV A;  4QZ9 A;  2WAQ C;  5DG9 A;  5DB8 A;  3QU2 A;  1VJ5 A;  3ZDC A;  2HHT A;  4GC7 A;  4IRD A;  1V85 A;  2GH1 A;  2NRZ A;  1S0N A;  1VLB A;  4ED2 A;  4CDG A;  3GIK A;  1K1Q A;  4UB3 A;  3RB3 A;  4AYB F;  7ICU A;  7ICI A;  3V72 A;  2YX8 A;  2BCQ A;  4OO1 J;  2NYV A;  2ZIV B;  3T5L A;  3GV5 B;  4DFP A;  1TFR A;  4GLX A;  1RQN A;  3E0F A;  4C0Z A;  4M2Y A;  5KG4 A;  2JH1 A;  4PGX A;  4NJ8 A;  4IR1 A;  4O3O A;  2BCS A;  4ELU A;  3GZF A;  3H0L B;  4QIW C;  9ICS A;  1L6N A;  1MQ2 A;  2WAQ F;  4GIB A;  4MFA A;  2MRL A;  4YMN A;  5CRX A;  2EAN A;  4ZH4 A;  5DB7 A;  4RPZ A;  4O3N A;  1B0X A;  3MR5 A;  2FDR A;  2PFO A;  4RQ7 A;  4K4G A;  5ALQ A;  1A77 A;  3GFK B;  1COK A;  5KAF U;  3GU3 A;  1KTQ A;  3LVV A;  2ALZ A;  4U6P A;  4FS1 A;  1X9M A;  4RQN A;  1RXV A;  2CRX A;  1QQ6 A;  7ICQ A;  5BOM A;  1B4F A;  2K8C B;  4C80 A;  4YXM A;  1ZD2 P;  2YTU A;  4CF4 A;  3IHQ B;  5EOZ A;  1N48 A;  3BJY A;  4KX5 A;  1ZQH A;  4NY8 A;  4I2A A;  4QZD A;  3KHH A;  1UA0 A;  1Q3V A;  1ED1 A;  1QSS A;  4ECQ A;  3JPN A;  3TQ1 A;  4F5N A;  3SAF A;  5ALN A;  9ICW A;  1JX4 A;  1SXD A;  4I2H A;  1OW5 A;  2NRV A;  5JUM A;  4PJ0 U;  2AJQ A;  3NRZ A;  3GQC A;  4RNN A;  5DDY A;  3G6V A;  4I2G A;  1LVH A;  5ALH A;  4RNO A;  2AH5 A;  1RXW A;  9ICB A;  3BDP A;  1BPD A;  3UXO A;  3OJS A;  3NRW A;  1SKW A;  4KN4 A;  3C29 A;  5H2F U;  1N5W A;  1L7M A;  2BDP A;  3RH5 A;  2G06 A;  4QWD A;  4FBU A;  3KBB A;  4NM1 A;  1D8Y A;  3BQ7 A;  2ASD A;  2JEG A;  4DFM A;  4ZOH C;  2AGO A;  1COO A;  2WF8 A;  2KKV A;  5D49 A;  4F71 A;  4RQ6 A;  4QZI A;  3MR2 A;  4I2C A;  1BPX A;  2W03 A;  3NVZ A;  4TUQ A;  3QE9 Y;  4JWM A;  1SV4 A;  3RTV A;  2YQE A;  2F1H A;  4X5V A;  2KFZ A;  5IIK A;  3BZC A;  4RQ1 A;  4K4I A;  3O0F A;  4IC9 A;  3WK4 A;  5L1I A;  3SZ2 A;  4UAV A;  3DDH A;  3TFR A;  3NAS A;  4DF8 A;  4J9M A;  1TAU A;  5KNI A;  3HP6 A;  7ICG A;  5AHX A;  4EYI B;  3QXG A;  3AM9 A;  2RHF A;  3PX6 A;  3EYZ A;  8ICK A;  1S76 D;  1NK9 A;  2KV2 A;  4UB5 A;  4MF8 A;  4ECR A;  2EAO A;  5AM3 A;  3OHB A;  5KG3 A;  3QZ8 A;  1ECW A;  1T7P A;  2QKQ A;  1L3S A;  8ICS A;  2ESE A;  2YMP A;  3JPP A;  8ICH A;  8ICR A;  2H5X A;  8ICM A;  4DQS A;  3KOO A;  1RQL A;  4QWE A;  4PGQ A;  5J8Y A;  3THV A;  4JUZ A;  2E8O A;  4DSL A;  2OCE A;  4IQT A;  8ICU A;  4Y2V A;  1XNS A;  2JZB A;  2MSN A;  2AU0 A;  1ZQR A;  1MQ3 A;  5AKI A;  2WTF A;  3UQ2 A;  3N28 A;  4P2H A;  2ZIX B;  3OTQ A;  1KFD A;  2AGP A;  4USA A;  2HHS A;  2A1J B;  3PO5 A;  2W9C B;  1L5U A;  1U49 A;  1B22 A;  5KT3 A;  4M9G A;  2YY6 A;  4PHP A;  3ZI4 A;  4RUC A;  4BX9 C;  4P4P A;  2ISO A;  3LDA A;  4A8E A;  2AQ4 A;  9ICL A;  1WWV A;  3BS5 A;  4B9L A;  3J81 j;  4P0P B;  4Y2U A;  4ED6 A;  4B9S A;  3CP8 A;  4GC6 A;  4US8 A;  3I28 A;  4F4K A;  3PY8 A;  1WCL A;  4TUR A;  3PV8 A;  4DWI A;  3QUQ A;  3AU6 A;  5J0O A;  1PK1 A;  5ALZ A;  1YT3 A;  1A6S A;  4KLT A;  4UB8 U;  4ECY A;  3E58 A;  5CHG A;  4EEL A;  4F8R A;  4AYB C;  5HHH A;  4EBD A;  1J2N A;  4YR0 A;  2H3I A;  5KFU A;  3KHG A;  3UMB A;  1SB3 C;  4C4R A;  3LWM A;  9ICR A;  5KFH A;  3Q8R B;  1T94 A;  3RB0 A;  1X2I A;  3M9O B;  1QQ7 A;  3PR4 A;  3TAC B;  2BDU A;  2K8A A;  4GFJ A;  1QTM A;  4UBC A;  5AM1 A;  4B9N A;  1SIJ A;  3ICX A;  3SMV A;  4F92 B;  5EWE A;  1UA1 A;  3TAR A;  5KFG A;  3D2N A;  3ISC A;  3QEA Z;  1VDV A;  2I5H A;  3GIM A;  4C4S A;  4CRX A;  2ZTE A;  3H8J A;  8ICN A;  2EAM A;  4EEY A;  2WF7 A;  1ZYQ A;  2JEI A;  3ALR A;  3QU5 A;  4QWA A;  4EX6 A;  1CEZ A;  1RYU A;  1V9P A;  1WUD A;  4NLN A;  3IG8 A;  1KN5 A;  1NNL A;  5KFC A;  1QCK A;  4NLZ A;  5F3X B;  2W8L A;  4EBE A;  2J6S A;  4JV0 A;  4F3O A;  7ICP A;  9ICQ A;  2EZZ A;  5KL8 B;  1BNP A;  4JK1 A;  1NZB A;  3HW8 A;  2FPM A;  4NLB A;  5CEH A;  1ZD4 A;  1BPE A;  5TZV A;  5F9N A;  3D2Q A;  4F72 A;  1JRO A;  3RBE A;  3CW2 C;  4DSK A;  2DWQ A;  5HHI A;  3VC8 A;  4G3I A;  4Y2Q A;  1SL1 A;  2FJ6 A;  5ALE A;  1D9F A;  2I9G A;  2XID A;  2ODG A;  8ICX A;  9ICT A;  2E5S A;  4C7Z A;  3V6J A;  1UQV A;  2GO7 A;  4Y2J A;  5KL1 B;  7ICV A;  1IG6 A;  4CGZ A;  4FO6 A;  3G6Y A;  1ZQQ A;  5J2G A;  8ICT A;  3BQ0 A;  4PH5 A;  1ARO P;  1PVP A;  2RP5 A;  1JRP A;  4DSJ A;  3KHR A;  5KFV A;  5DKW A;  2OYY A;  4UAS A;  4P0Q A;  4RPX A;  5K4L A;  5J2H A;  1Y88 A;  4C8O A;  7ICK A;  3GDX A;  2K60 A;  1NOM A;  1SL0 A;  5AKJ A;  4I28 A;  3U26 A;  1JIH A;  2FLN A;  4NLC A;  5CA7 A;  4M6W B;  3QEB Z;  3K1R B;  2G5H B;  1ZQM A;  1ZRN A;  2KIW A;  1U45 A;  4MF2 A;  4KMO B;  2RRD A;  5ALF A;  4EZ6 A;  2PKE A;  3PW5 A;  2ZTD A;  3RH6 A;  2NRW A;  2HHV A;  1ZQW A;  5AI8 A;  2M0N A;  2Y9T A;  1JXE A;  3T79 A;  3EZ5 A;  7ICJ A;  1WWU A;  1DK2 A;  5CR0 A;  1FEZ A;  4KLJ A;  1UHU A;  2YMM A;  2MUT A;  4UQG A;  1S77 D;  1KKX A;  2K4I A;  1X9X A;  4F5P A;  3LYS A;  2VJ5 A;  3NVV A; 
#chains in the Genus database with same CATH homology
 2G09 A;  2G06 A;  4QJF B;  2MRL A;  1URJ A;  5CRX A;  2WB1 C;  1NZB A;  2OXO A;  4NV0 A;  1Q3U A;  3L3F X;  4NLB A;  4BX9 C;  2ZIU A;  2N1R A;  4A8E A;  3AQE A;  2KKV A;  1Z1B A;  3D2Q A;  4OJ6 A;  3N7S C;  2W7O A;  4P0P B;  1GO3 F;  2G07 A;  2KEY A;  2W03 A;  3IP4 B;  4QIW F;  2HOF A;  2HOI A;  4ACO A;  2KKP A;  2Y0S C;  2OH2 A;  4BUG A;  2K89 A;  3CP8 A;  3VC8 A;  2ZXI A;  4JMU A;  2DF4 B;  2F77 X;  2R18 A;  1TAM A;  2NV3 A;  2XID A;  3M6K A;  2H3Q A;  3O0F A;  2CN1 A;  4IC9 A;  4KX3 A;  1XO0 A;  2VKQ A;  4ICA A;  2KIC A;  1YT3 A;  2KJ8 A;  3HKZ F;  2E5S A;  4FZM A;  3GU3 A;  1MA7 A;  1A6S A;  1F44 A;  2D6F C;  2DQN B;  2KVC A;  3LVV A;  3SAG A;  3F5E A;  2LYB A;  3NUQ A;  4WJ3 B;  2PMZ F;  2KJ9 A;  2ZIW B;  2W7P A;  1SZH A;  5KL1 B;  2K8B B;  4U6P A;  2ZIU B;  2W04 A;  4FE3 A;  4OJL A;  4AYB C;  2LKY A;  4CGZ A;  2KHQ A;  2HBL A;  4FZN A;  1ZQ1 C;  2G08 A;  4BJQ A;  2K4E A;  2K4H A;  2PMZ C;  2CRX A;  2XI9 A;  1PVR A;  2ZXH A;  3KFU F;  3K1Z A;  2H3V A;  2JMG A;  2ZIW A;  2LBO A;  3LYS A;  2K8C B;  1PVP A;  2RP5 A;  4O3M A;  2H3I A;  4OJ5 A;  2HOQ A;  3SAH A;  1CRX A;  4P0Q B;  2KD1 A;  2WB1 F;  2A3V A;  2GOL A;  2RHF A;  3IN5 A;  3F2D A;  3D2S A;  2VJ4 A;  4KX5 A;  4U7C A;  3KZX A;  2OYY A;  3AL0 B;  1T94 A;  4QNL A;  3MGV A;  4FZL A;  3HKZ C;  3PZP A;  2LYA A;  4P0Q A;  2H3Z A;  3SQI A;  4NWI A;  4PL2 A;  2KJ5 A;  2KV2 A;  1PVQ A;  5HR7 A;  3PSF A;  2XVT A;  2BDU A;  2K8A A;  4GFJ A;  2E1E A;  1Q3V A;  3F2B A;  1ECW A;  1ED1 A;  2MA1 A;  4OJO A;  2WAQ C;  2CPR A;  4OJP A;  2ZIV A;  3AQF A;  3ICX A;  3SMV A;  2XIC A;  3CYM A;  2G0A A;  3SAF A;  4NLC A;  2DGZ A;  2KHV A;  2HBJ A;  2HBK A;  2G5H B;  3VCB A;  2GH1 A;  2KIW A;  2F2A B;  2JGA A;  2YB4 A;  3D2N A;  2H3F A;  4KMO B;  3RFA A;  1HEK A;  2JH7 A;  2RRD A;  4CDG A;  2Q4T A;  1Z19 A;  4AYB F;  3DEE A;  2ZG6 A;  2OM6 A;  2F76 X;  4CRX A;  1DRG A;  4P0P A;  2KOB A;  2G5I B;  1HIW A;  2YB1 A;  3LVW A;  3N7P D;  1IIP A;  2YX8 A;  3PSP A;  5A0L A;  3F5A A;  4OO1 J;  3F2C A;  3ALR A;  3PST A;  2ZIV B;  1XNS A;  2ZIX A;  1KBU A;  3C29 A;  2M0N A;  3ONN A;  5T14 A;  1P7D A;  3CRX A;  3E0F A;  4C0Z A;  1WUD A;  2JHD A;  2F8L A;  2JH1 A;  2HMX A;  2LHT A;  3H0R B;  3IG8 A;  3OPX A;  2E1F A;  4PL1 A;  3T79 A;  3M7D A;  2HBM A;  2ZIX B;  1A0P A;  3GZF A;  3H0L B;  4QIW C;  2KNJ A;  5HR6 A;  3PSI A;  3F53 A;  2Z7J A;  3C28 A;  3M6Z A;  3H0M B;  1D8B A;  5C0Y A;  2K4I A;  3N7R C;  1L6N A;  1OUQ A;  2VIX A;  2Y0S F;  3NRW A;  2WAQ F;  2VJ5 A;  3IG5 A;  1UPH A;  5KL8 B;  3RF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...