4AYBF

Rnap at 3.2ang
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSNRTYTSEDIQKIIDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
total genus 13
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4aybF02
2Y0SF 4AYBF 3HKZF 2PMZF 2WB1F 2WAQF
chains in the Genus database with same CATH superfamily
2W9BA 4CGZA 2FMPA 2I9GA 1X2IA 4UAUA 1X6JA 1UA1A 1OUQA 1BPEA 5KG0A 4IR1A 5AK4A 1ZQQA 3SD7A 2WB1C 3D6JA 7ICOA 7ICMA 3RR7A 3TQ1A 3TAPA 2DF4B 2K8AA 4F93B 5AI8A 5KFBA 1ZQIA 3HKZC 1ZQBA 4FS2A 5AK3A 2ZIUA 3H8JA 2FE9A 1JXEA 3KD3A 1PVRA 1CRXA 4F4YA 3H4DA 3V7JA 3AEVA 2H3FA 3H8WA 5A0LA 2FMSA 2ISOA 4TQSA 4M6WA 3GFKB 1N5XA 1RYSA 1ZETA 1X9XA 2PFNA 5AHXA 1NK7A 3B9JA 1T4GA 1U49A 2JRZA 4JMUA 3SV4A 1DK3A 3UXOA 3T79A 1KFDA 1NK0A 9ICXA 1PUZA 2KIVA 4JV2A 2ZG6A 5J2FA 4UB2A 3F2DA 3C23A 1AROP 4QZIA 5J8YA 5L1LA 3N7SC 5J0WA 1KFSA 4UBCA 4YFKA 4DFKA 4UB3A 3SZ2A 4M9HA 5DG9A 1ZQMA 5DLFA 4FZLA 2A1JA 2AH5A 2G08A 4UAVA 5J8YC 1QCKA 1NJWA 2YX8A 3QUQA 1LVHA 2H5XA 2FMQA 1L3SA 2WF6A 2BDPA 3TACB 2BPGA 2BDUA 1Z00A 2Y1JA 2Q4TA 4F8RA 2W9BB 4CE6A 3IDWA 4NXZA 4J9SA 4KLTA 4OJOA 4KLUA 3H4BA 4DLGA 3WKDA 2NRVA 4PL1A 3V6JA 5JUMA 3HP6A 5L1KA 1ZQYA 5ALIA 5DB7A 5J2HA 3CW2C 2FLPA 2RLTA 3K75D 3M6ZA 4KLEA 4GXIA 3ISDA 1WUDA 5DG8A 4EYIB 3LVWA 4O3NA 1S5LU 5CP2A 3TFRA 3SMVA 4NY8A 7ICLA 1ZQVA 4NLGA 2HVIA 2W3RA 5DG7A 2ZIUB 3NGDA 2F1HA 3TADA 4US8A 4Y2TA 1HUOA 5KL1B 5ALVA 3MR6A 2ESEA 2Y0SF 4XQ8A 4AYBC 3JPPA 4ELUA 1ZQPA 2KMDA 5JRTA 2MA1A 3QU4A 3OJUA 2K4HA 2K8BB 1X40A 4F50A 7ICJA 4KLIA 1L7PA 2CRXA 3IG8A 9ICUA 4J9QA 1D9DA 3HRDD 2B21A 2H3QA 3M8SA 5EE3A 2Y1IA 4J9PA 1TE2A 4I2AA 5KFYA 3KHLA 5KT6A 4CNQA 2XC9A 5F9LA 4ELTA 3Q8LA 4RNMA 2F2AB 3NASA 2OXOA 5ALUA 4ELVA 5ALLA 2NRXA 2KJ5A 7ICQA 4I2JA 5KFCA 4K4GA 3PR4A 5ALZA 5KFRA 2LPEA 4GLXA 5ALFA 4QZBA 3N7PD 2P66A 3NS1A 2EQYA 1UT8A 4DL3A 1DGSA 2A1JB 4Y2XA 1ZOLA 5HNKA 4EX7A 4DO9A 2JV3A 5EWEA 1U9LA 4R64A 1Z1BA 3NVYA 3I1YA 2VIXA 4U7CA 1XU4A 1Z00B 3RBDA 3D2QA 8ICEA 2NV3A 1L7MA 1XNSA 4DL7A 1S0OA 2KJ8A 3SENA 5KTQA 1SKWA 4J9LA 5J0RA 4JUZA 3GIMA 3MGIA 1N5WA 3T5HA 3PMNA 4EEYA 9ICQA 4FBTA 3AMZA 3T3FA 4ED6A 1DGJA 3N97B 3Q8QB 3RH4A 4JK1A 2E5SA 1XSPA 9ICCA 1F44A 2NO4A 3H40A 2VA2A 3C2MA 4YMMA 3QEAZ 4DFJA 2WF8A 3C2KA 5ALXA 3LWLA 1X66A 9ICTA 2VJ5A 3RJKA 1CUKA 4G9BA 2HHVA 1L5UA 4QZHA 3FAHA 2IOFA 2FPMA 4YXJA 3GILA 4YD1A 3AQFA 3PW4A 8ICOA 4Z6CA 4BGDA 3E58A 3M8RA 3BDPA 1Y88A 4KLDA 2A1AA 5ALWA 5IILA 5CRXA 2ZUCA 1N48A 2KVCA 4M04A 3MGVA 1S9FA 2BQUA 1DRGA 5K4LA 2KFNA 1FFVA 1ZQLA 4IQTA 1KN5A 3THVA 1LB2B 3MC1A 4CCHA 1HEKA 4BXOA 3LK9A 3MFHA 3JPQA 5KT2A 1XS9D 3F5AA 1VJ5A 1P7DA 4QWDA 2NRZA 2ODGA 4DS5A 7ICHA 3T5KA 3MDAA 2G07A 4Y2YA 2ASJA 3F2CA 3PVXA 2W9CB 4DOBA 1SL0A 3LDAA 3EPIA 2F1JA 1KEJA 2HBMA 3PZPA 4EBDA 5BOMA 2KN7A 4IQUA 4KITB 2QARA 9ICFA 3BQ7A 4QWBA 3JPTA 1PZNA 4C4TA 7ICRA 3ICXA 4UATA 1MC8A 1NI3A 2IOFK 4P4PA 5ALDA 4RPYA 5IINA 2UVRA 4KX5A 2D3DA 4KLHA 4OCZA 7ICFA 4TUPA 5ALEA 4C4RA 1RYRA 4NM2A 2LBOA 3HT3A 4O3PA 2ZJAA 3RAQA 4KLFA 4FE3A 1PVQA 5AI0A 5IIMA 4UASA 4RQ8A 4RQ6A 1ZQHA 3QE9Y 2ASDA 1QSLA 2P35A 4O3OA 4I2HA 1SB3C 2KP7A 4NWIA 8ICXA 3SAFA 1L7OA 5HR7A 1NJXA 1QH9A 4QZCA 4B9NA 2EZYA 2VA8A 2WFAA 7ICGA 7ICNA 2G06A 3B0XA 2RQ5A 3LYSA 4EELA 2JMGA 4DL5A 9ICKA 3PV8A 5L1IA 1TAQA 4M9JA 2C2EA 1BPDA 1QQ7A 2KSOA 2ZUDA 3M9NB 7ICIA 3RJFA 1JUDA 4Y2PA 3IV6A 2Y9TA 1RG6A 2NRWA 5J29A 4BXOB 3N28A 1ZXIA 1J97A 3VC8A 4PHAA 1Z3EB 5KFOA 2HVHA 3ZDCA 2IHMA 5ALOA 5F3XB 2D6FC 2K89A 3GU3A 4PHEA 3BZKA 3AN1A 4R65A 7ICSA 2NYVA 1U4BA 5KFSA 2V9WA 4CF5A 7ICPA 2PI5A 3C2LA 3KBBA 5AM4A 3SR6A 2HHSA 2QARB 2P6RA 2DPJA 5AI5A 4RQ2A 2BHNA 2VANA 3MR3A 2YMPA 2R8GA 3RB6A 2PFOA 4J9MA 3PO4A 2CXYA 5EWFA 3KOOA 4XRHA 3SQIA 5ALQA 5KG1A 3JPOA 5HHIA 2GWSA 5J0QA 4ED3A 4GXKA 4O3QA 2KHQA 2AXTU 2WHEA 4QWCA 2M9NA 1M6YA 4NLNA 3AQEA 3ORYA 8ICAA 2JR5A 3KTQA 4B9UA 3B0YA 2W55A 4UB6U 3MR5A 3EUB2 5D4BA 2QB1A 2W43A 1ZD3A 5HP4A 3UM9A 2IHNA 4ECZA 5KFEA 5AM0A 5JU5A 1A0PA 1UA0A 2N1RA 3PO5A 2E1EA 1JN3A 4J03A 1KBUA 4ACOA 2XVTA 1ZQOA 2JEFA 2G0AA 5CHGA 3JPNA 2W3SA 4USAA 1QSYA 1SXDA 8ICNA 4F92B 5ALMA 1X9MA 2KSOB 3CP8A 5TISU 1SWVA 1LKYB 2XGPA 4K4IA 4YD2A 4A8EA 4MF2A 8ICKA 2KICA 1SGGA 1S10A 4NJ8A 2LMRA 2OHFA 3KKAA 3K1ZA 4RU9A 2HHUA 1LV5A 9ICSA 1K5OA 2KK0A 5J2GA 2JEJA 3EW9A 5J2EA 1SL1A 8ICGA 2DFLA 4I27A 2EAOA 3KKAC 4ZOHC 5AI9A 4DQPA 2HBKA 1O03A 3PW5A 1ZQNA 1K1SA 1A77A 2WF7A 5ALGA 1X9WA 2BCUA 2W7OA 2PMZC 3Q8PB 2C22A 2CN1A 1NK6A 5TZVA 4LVSA 3C5GA 5AKKA 9ICHA 5AKHA 1N2XA 1N63A 3PY8A 3QZ8A 4DSEA 4M47A 4EEKA 2XICA 5KT5A 4HAIA 2WAQC 4NLZA 1VLBA 4FFDA 2UVVA 4Q43A 8ICUA 2ZTEA 2OEHA 1L3VA 3QX7A 2JEIA 2ES6A 3Q8KA 3F5EA 5J2IA 2YMLA 5J0YA 4MFCA 2KTQA 8ICVA 1N56A 2R8KA 4YR2A 3VCBA 2EH9A 3MBYA 3G6YA 3A0BU 2WF9A 4K4HA 5G5GA 4LJXA 3QZ7A 2BZFA 1J2NA 3PW2A 2E8PA 1A6SA 2I1QA 4BX9C 3H0MB 4I2GA 4O5KA 2YN4A 7ICTA 1WG8A 3Q8MA 3RB4A 3T5LA 4DCCA 4QW8A 3UXNA 1SWWA 1KKXA 5J2DA 3OSPA 4Z6FA 2W7PA 4Q8FA 3A0HU 4RQ0A 9ICBA 5CB1A 3UQ0A 2JZBA 4PH5A 3HX0A 1D8BA 2XGQA 5EE0A 5AKGA 3ZDAA 3UQ2A 5B66U 1ZQDA 3Q8SB 1N62A 2L5YA 5IIOA 2Z7JA 3RRGA 2ATLA 4DSLA 2AJQA 1NJZA 2EDUA 4KLJA 3FYHA 3IHQB 3EYZA 3OTQA 4KLSA 4LZDA 3F53A 4RUCA 1ZRNA 5AIAA 3E0FA 3TAQA 1ZQZA 4Y2RA 3H0LB 4F2SA 4DOAA 3BQ1A 3TADC 5BOLA 3PX4A 4NLBA 4NM1A 9ICVA 4Z6EA 3F2BA 2HMXA 4PGYA 2BPCA 1JX4A 4YVZA 1S97A 3ZD8A 4ECVA 1NJYA 1ZD4A 1L8OA 4FS1A 2W04A 2HSZA 5GTIU 4IRCA 5EWGA 4ICAA 5KFJA 4BJQA 2HOIA 4DS4A 4DOCA 5KG4A 3OJSA 2ASLA 5CA7A 3GV5B 5KFAA 4ED8A 4CF4A 3WK7A 8ICLA 5AKLA 7ICEA 5KG3A 1JIHA 2YB4A 4PZOA 3RB0A 1KFTA 2XCAA 3BZCA 3H7IA 3KHGA 2KHVA 1DOQA 4KTQA 1PVPA 1B22A 1Q3UA 1TV9A 3ETLA 5H2FU 4RZRA 3J81j 4ECQA 3C29A 2HDOA 4Z6DA 1RQNA 2GLEA 5AICA 2XIDA 4C4SA 2W9CA 2GO7A 2B0CA 5DQIA 2W8KA 4U6PA 2E1FA 4DWIA 3PR5B 2JZBB 4IQVA 4C8MA 2DL0A 2MAXA 5AKIA 3C28A 4QZ9A 2V4RA 4RNOA 4JV1A 4ECYA 1MSWD 4EBCA 2IOHA 2DPIA 2BQRA 2KG5A 3TARA 4B9SA 4YP3A 4F5OA 1ZQRA 4I2IA 2PXIA 3H8SA 1KSPA 8ICTA 5ALHA 4YR3A 3PSTA 5AKXA 1KW4A 1TK0A 3PMLA 4KLLA 1S76D 2PKEA 5ALSA 2ZTCA 4YR0A 4B6JA 4UAWA 5KT7A 3JPRA 4DF8A 4QIWC 1UHUA 4NLCA 5KFTA 1ZD5A 4Q44A 4KN7A 4CDGA 1ZJMA 1UQVA 4O0IA 2K4EA 1PK1B 1BGXT 1RPLA 3QU7A 4KMUA 4UW9A 4BUGA 5ALNA 4UB1A 1FO4A 4DQQA 2XI9A 4F71A 4BWJA 5CR0A 3FC4A 2ZJ5A 3ZDDA 4P0PA 1D8LA 4OO1J 5B5EU 4F2RA 5KFWA 3LVVA 4RQ4A 5L1JA 3RAXA 4J9RA 5DBBA 3AU2A 2ZXIA 2WB1F 2W8LA 2LM1A 2HI0A 4C8LA 2G09A 1TVAA 3BQ0A 3UXPA 3HJEA 2OM6A 1BPBA 1ZQEA 3AUOA 3GQCA 4B9MA 4P2HA 3HKZF 2E3TA 3QEBZ 1S0VA 4IS7A 2EZZA 4RQ1A 4IRKA 2KKVA 4CRXA 3L5KA 4Y2SA 2KJ9A 3NVZA 5DB6A 4GFJA 3ISCA 5KAFU 1MQ3A 5HHHA 4X5VA 3PSPA 3NUQA 4JWMA 4J9OA 1Z4NA 1T8EA 1JROA 1QLNA 1U45A 4KLMA 4ECWA 3IRUA 2DKZA 2NO5A 4P0QB 4PJ0U 2LYAA 4UQGA 2HCFA 3HW8A 2GH1A 3N4MB 2F77X 2MUTA 3NTUA 4JB3A 4RPZA 4PGQA 4O3RA 5DGBA 1WCNA 1L6NA 1Z4OA 3HILA 4O9MA 9ICWA 3EPGA 2EAPA 3PSFA 4GC6A 2E8MA 3PX6A 2HHQA 2EAMA 5CWRA 5KFLA 2Y0SC 3C1ZA 1FIQA 2IA6A 3AU6A 5KAIU 5DB9A 1SZPA 4C0ZA 1ZQCA 5AM5A 4I2BA 5L1MA 1DXSA 3OGUA 4OJLA 3O0FA 2F44A 1XSLA 5AKEA 4KMOB 4FZNA 1L8LA 2XY7A 3WKCA 1SKRA 8ICCA 2KIWA 2DQNB 1SL2A 3ONNA 1YT3A 4MEXA 5AKYA 4P0PB 4MEYA 4FO6A 1NK4A 5ALKA 8ICIA 4Y2QA 4B9LA 5CEHA 2W11A 5E79U 1LKYA 5AM3A 2GOLA 4RQNA 4C8KA 2R8IA 1ZQFA 5DKWA 2OWOA 5L9XA 4DFMA 1IXRA 1XO0A 5KG6A 2PFPA 2LKYA 3RH5A 1N60A 4DSFA 4GIBA 1RDFA 4F91B 3RJHA 2KEYA 5J2JA 4DQRA 5J2AA 8ICBA 8ICZA 5J0UA 5KFIA 1X6IA 5F9NA 1JALA 2I6XA 4DQIA 2JEGA 3WU2U 8ICJA 5KT4A 4QZAA 4J9KA 4F5PA 4AYBF 4UB5A 4KLGA 4QZEA 4F4KA 4EZ9A 8ICMA 4C7YA 3RRHA 1D9FA 3D2NA 1ZQ1C 4P4OA 2QLTA 4F72A 1NKCA 5KFXA 1COKA 4NL9A 4F5NA 3IG5A 2F8KA 4RQ3A 5J0XA 1A76A 2MUTB 5J0PA 5KFUA 1SV4A 2K8CB 5KFVA 4MFAA 2W9AA 4PHDA 2A3VA 2R8JA 2IMWP 3WKEA 2XCPA 3IN5A 1KQQA 4NV0A 2KZZA 2ISPA 4DLEA 3C1YA 2PFQA 4RPXA 5G5HA 5AKZA 1MA7A 5KFQA 5AK5A 5EE1A 2RHFA 5AKJA 4ECRA 3GZFA 9ICRA 1SV0A 1NOMA 1FEZA 1SKSA 4TURA 1SXEA 2ZIVA 3ISBA 3I76A 5IIIA 2KOBA 3QUCA 3QYPA 2VJ4A 3TKAA 3IP4B 2K60A 1SZHA 1SV0C 3V72A 2AGPA 2WF5A 3MFIA 5KG2A 1DK2A 3H0RB 3FDSA 2XY5A 2BGWA 4OJ6A 1NK9A 5EE9A 4MFFA 1JMSA 3ED5A 5ALJA 2DUYA 3UMBA 2MU2A 2H3ZA 1KTQA 5HMMA 3HPOA 1IG6A 4BWMA 3GIIA 5KNIA 4B9VA 3WKAA 1BPYA 3JPSA 2JXJA 5AI4A 3V6HA 3QUTA 2AQ4A 3RR8A 4UBBA 4YCXA 1BPXA 4QNLA 2BCRA 2JHDA 1ZQTA 4HYKA 4Q45A 2FI1A 5EOZA 3HWTA 5KFPA 1TFRA 1U47A 1S77D 1IM4A 4US9A 4QIWF 3SI8A 5KFHA 3AM9A 1COOA 3MDCA 4YMOA 1BNPA 4DSIA 4RUAA 1EXNA 2ZIXA 4O3SA 2K4IA 4C8NA 3GIKA 4PL2A 5BPCA 2YB1A 4MHVA 4KN4A 2BCQA 4KLQA 2R8HA 4I2EA 2BQ3A 4RQ7A 3G6XA 2HHTA 4ED7A 2KZ3A 3DDHA 4OJPA 3L4PA 8ICFA 3ZD9A 3T5JA 1GO3F 1UPHA 4Y2VA 3KZXA 4KLOA 4DL2A 2KV2A 1S0NA 2EANA 3RBEA 1VDVA 1T3NA 2K4PA 3RB3A 4OJ5A 1QTMA 2ZIWA 5KFZA 2PI4A 3PNCA 1HJPA 1C7YA 1WWVA 5KG7A 2C28A 3CRXA 2B6GA 4C8OA 1RXVA 2LYBA 1V9PA 9ICNA 8ICSA 3KFUF 4RQMA 1YZ6A 3OPXA 1XO1A 4RT3A 2OH2A 3DEEA 2JGAA 2ZIVB 4JV0A 2WTFA 3ALRA 3UPQA 5J2BA 5DDYA 2KKPA 3GV7B 1NZPA 2YMMA 3M1YA 1RQLA 5ALTA 4ED1A 4UAZA 2AGQA 4QZFA 1V85A 3WK8A 8ICWA 4DQSA 2W03A 1V38A 1JI7A 5ALYA 1X9SA 2D8CA 4ECXA 3RFAA 5J2CA 3GIJA 1ZYQA 4O3MA 1KL9A 3SAGA 5KL8B 4YG2A 3I28A 8ICYA 4DF4A 2JH1A 8ICHA 4F4WA 1OXJA 4Y2UA 2NRTA 1XC9A 2QKQA 4DSJA 3U26A 3C21A 1Z19A 1B4FA 1QQ5A 3V6KA 1UCVA 5KFGA 1MQ2A 2AU0A 2LHTA 4DEZA 2I5HA 3R9KA 4NLKA 3ZI4A 3BQTA 3G6VA 4TQRA 4XUSA 1Q46A 4R66A 7ICUA 4QZ8A 1ZRMA 4DL6A 1RYUA 4ECUA 4WJ3B 4XA5A 1BNOA 3UMCA 3OHAA 1PK3A 1RM6C 3E2EA 1PK1A 2F76X 1N61A 2HW3A 2FLLA 4DSKA 2HHXA 2ZIXB 4M6WB 2HHWA 1URJA 2FJ6A 4I2DA 4EYHB 1Z1VA 3MGHA 2RRDA 4IRDA 2VA3A 1TAMA 4F5QA 2JH7A 5KFFA 4G3IA 3N7RC 4M9LA 1Q8KA 4O5EA 2YTUA 2RP5A 7ICVA 2W9MA 5KFDA 1QSSA 2LYHA 1OW5A 3OSNA 3QXGA 3WKBA 1TKDA 5DGAA 4C80A 1WYGA 4E0DA 2BPFA 4CF3A 1TAUA 2FLNA 2E8OA 2ZIWB 3BS5A 4Q8EA 2J6TA 5ALRA 4ED0A 1KRPA 3OHBA 1FFUA 2OYYA 9ICIA 1CI4A 5CJ7A 2RDIA 1TK5A 4I2CA 4Y2JA 5D49A 2XO7A 1MN8A 4QJFB 2RDJA 4QWEA 4B9TA 3SV3A 4ECSA 2BCVA 1U48A 1T3QA 1L3UA 3ZDEA 3Q8RB 2AQ0A 4P0QA 4GC7A 4IC9A 3QU9A 5J2KA 2ZJ8A 5DQHA 4I2FA 1XSNA 4F4ZA 2Q0ZX 1KDHA 4F5RA 4QWAA 5DDMA 4EZ6A 1B43A 3C5FA 1X42A 1O08A 1KLNA 3RJIA 8ICPA 1ZQGA 3H8MA 5J0OA 2KD1A 1J2MA 1NK8A 3RJGA 5AI6A 9ICJA 5AM2A 4PHPA 4FBUA 4J9NA 9ICPA 3NRWA 4IQWA 2R18A 3LWMA 3GV8B 3M9OB 2V4QA 2CPRA 3WK5A 1ZQJA 2YQEA 3NVVA 5KFNA 2UVWA 1ZQKA 2YY6A 3AL0B 2MRLA 4MF8A 4YXMA 4R8UA 9ICMA 2IBKA 5AM1A 5DBCA 4UAYA 2XY6A 2HOQA 3BS5B 5C5JA 2E8NA 4UARA 1ZD2P 4UB8U 3SEIA 1SIJA 4R63A 4UB4A 5GTHU 1ZJNA 1T7PA 4M9GA 2AHOB 8ICRA 4I28A 2AGOA 5AK6A 4DFDA 1NK5A 4YQWA 1ED1A 1TK8A 4QZGA 3M9MB 5IIKA 2G5HB 2ZUBA 2A19A 2G5IB 2FDRA 1NZBA 1UT5A 1WCLA 4C7ZA 1F5SA 3TI0A 1ZQWA 4EX6A 1ZQUA 2J6SA 1ZQAA 5C0YA 1NKEA 2W54A 2PMZF 2Y9UA 5KT3A 4YN4A 4FZMA 3IM1A 4P4MA 9ICGA 3QNMA 3CNHA 5DQGA 2C2RA 2ZXHA 1K1QA 3RJEA 2WAQF 4F4XA 4DFPA 3EZ5A 3KZIU 8ICQA 5DBAA 5KFMA 4TUSA 4OD0A 2ALZA 3SYZA 3RJJA 1ECWA 1Q3VA 3KHRA 3WK6A 3V7KA 3DV9A 3K1RB 4GXJA 4IL6U 1BVSA 5KG5A 3FM9A 7ICKA 3EWAA 2J6UA 2LI6A 4AP9A 4RT2A 3BS7A 4ZH4A 3M7DA 2KVSA 9ICOA 3SAHA 2HOFA 1YZ7A 1XWLA 2QB0A 5FP0A 1C20A 1V97A 2HBLA 9ICEA 2EZXA 1B0XA 3RF9A 4R8UB 4BDPA 3KHHA 2KFZA 2OCEA 3BQ2A 4RNNA 5AIBA 4QW9A 2F3NA 1HIWA 3TFSA 2KNJA 5J0TA 3MR2A 2DBYA 4JWNA 1NKBA 5J0SA 1L3TA 1F0MA 2FPKA 4PGXA 1ZQSA 2HBJA 3RTVA 1D8YA 2VKQA 2BKEA 3NVWA 4PZNA 3L3FX 3PW0A 1JXLA 1RZTA 4M2YA 1AQ6A 1HUZA 1WWUA 3CYMA 3TANA 3QU5A 3M6KA 3NRZA 1RXWA 4M9NA 5IIJA 3V7LA 2H3IA 1S8OA 3ZDBA 2KZMA 3WK9A 4I29A 1JRPA 9ICLA 2O6KA 5DLGA 2LM4A 4QZDA 1CEZA 5HMLA 4RQ5A 2M0NA 5T14A 3RH6A 2UVUA 4O5CA 2F1IA 3K4GA 2P6UA 4LZGA 4KX3A 2BCSA 3QUBA 4NL9C 1L7NA 4EENA 3PW7A 2C2DA 4ECTA 1T94A 1BPZA 4DL4A 1IIPA 5ALPA 2BR0A 4YMNA 2MSNA 2YMQA 4TUQA 1NNLA 3UMGA 2ZTDA 4M0AA 3ETRA 2QB0B 3WK4A 4IR9A 3PX0A 4F3OA 4ED2A 3PSIA 2F8LA 1S0MA 5DB8A 2DGZA 2H3VA 3QU2A 2DWQA 2FPLA 1IV8A 3GDXA 1QQ6A 3S6JA 1ZQXA 5KFKA 9ICAA 3D2SA 1H38A 5HR6A 2DKXA 5D46A 2KE7A 3BJYA 5JTIA 3MABA 4PPXA 4EBEA
chains in the Genus database with same CATH topology
2HMXA 4QNLA 2JHDA 2KVCA 2YX8A 3MGVA 4CGZA 4QIWC 4P0QA 1L6NA 4IC9A 2HBJA 3N7PD 3IG5A 4NWIA 4NLCA 3SAFA 2VKQA 2LHTA 1OUQA 1DRGA 5HR7A 2BDUA 4QIWF 5C0YA 4CDGA 2PMZF 2W04A 3L3FX 2Q4TA 4FZMA 2K4EA 3VCBA 3PSFA 4OJOA 2K8CB 2WB1C 1Z1BA 2G06A 4ICAA 2VIXA 1A0PA 3LYSA 4BUGA 2JMGA 4BJQA 2Y0SC 3CYMA 4U7CA 2A3VA 4PL1A 2HOIA 2ZIXA 2ZXHA 3M6KA 2K4IA 1HEKA 2DF4B 2N1RA 4PL2A 2K8AA 2H3IA 2WAQF 3D2QA 3IN5A 4C0ZA 2E1EA 2YB1A 4NV0A 4WJ3B 2NV3A 3F5AA 3HKZC 1XNSA 1KBUA 2XI9A 3M6ZA 4ACOA 1P7DA 2XVTA 2F76X 4OJLA 3O0FA 1WUDA 2G0AA 2ZIXB 4KMOB 4FZNA 2KD1A 2KJ8A 4P0PA 2M0NA 4OO1J 1A6SA 3LVWA 4OJPA 2ZIUA 1URJA 5T14A 3VC8A 1ECWA 2KIWA 4BX9C 1PVRA 1Q3VA 2YB4A 3H0MB 3SMVA 1MA7A 1CRXA 2DQNB 3LVVA 3CP8A 1GO3F 2RRDA 2G07A 2H3FA 1TAMA 5A0LA 3ONNA 4A8EA 1YT3A 1UPHA 2JH7A 2RHFA 3KZXA 2KHVA 3N7RC 3F2CA 3GZFA 4P0PB 2KICA 4KX3A 2E5SA 2ZIUB 2D6FC 1PVPA 2K89A 2RP5A 3NRWA 2KV2A 3GU3A 2R18A 2ZXIA 2WB1F 1Q3UA 3K1ZA 5KL1B 1F44A 2HBMA 3PZPA 2G09A 1T94A 2Y0SF 4OJ5A 2W7PA 3C29A 2OM6A 2ZIWA 3M7DA 2ZIVA 4AYBC 3SAHA 2GOLA 1IIPA 2CPRA 2HOFA 3CRXA 1D8BA 2XIDA 2KOBA 3HKZF 2LYBA 2MA1A 4JMUA 2VJ4A 3KFUF 3T79A 3IP4B 2HBLA 2VJ5A 1SZHA 2E1FA 2ZG6A 2ZIWB 3OPXA 4U6PA 2OH2A 3DEEA 1XO0A 2Z7JA 2JGAA 2K4HA 2K8BB 2KKVA 2MRLA 2ZIVB 3F2BA 4CRXA 3ICXA 3AL0B 2KJ9A 2HBKA 2LKYA 3ALRA 3F2DA 3IG8A 4GFJA 2CRXA 3H0RB 2OYYA 2KKPA 3C28A 4KX5A 2KEYA 3PSPA 3PSIA 4OJ6A 2F8LA 2W7OA 2HOQA 2PMZC 2H3QA 3NUQA 2CN1A 3RF9A 2DGZA 3N7SC 2H3VA 2H3ZA 2LBOA 3F53A 3SQIA 3AQFA 2W03A 4QJFB 2F2AB 4P0QB 3E0FA 1HIWA 4AYBF 3RFAA 2XICA 4O3MA 2LYAA 2WAQC 2OXOA 3PSTA 4FE3A 5KL8B 3SAGA 2KNJA 3H0LB 1PVQA 2JH1A 1ED1A 3D2SA 2GH1A 2KHQA 4FZLA 5HR6A 2G08A 4NLBA 2F77X 2G5HB 2KJ5A 2G5IB 5CRXA 3F5EA 3AQEA 3D2NA 1Z19A 1ZQ1C 1NZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  4AYB F;  3HKZ F;  2PMZ F;  2WB1 F;  2WAQ F; 
#chains in the Genus database with same CATH topology
 2W9B A;  4CGZ A;  2FMP A;  2I9G A;  1X2I A;  4UAU A;  1X6J A;  1UA1 A;  1OUQ A;  1BPE A;  5KG0 A;  4IR1 A;  5AK4 A;  1ZQQ A;  3SD7 A;  2WB1 C;  3D6J A;  7ICO A;  7ICM A;  3RR7 A;  3TQ1 A;  3TAP A;  2DF4 B;  2K8A A;  4F93 B;  5AI8 A;  5KFB A;  1ZQI A;  3HKZ C;  1ZQB A;  4FS2 A;  5AK3 A;  2ZIU A;  3H8J A;  2FE9 A;  1JXE A;  3KD3 A;  1PVR A;  1CRX A;  4F4Y A;  3H4D A;  3V7J A;  3AEV A;  2H3F A;  3H8W A;  5A0L A;  2FMS A;  2ISO A;  4TQS A;  4M6W A;  3GFK B;  1N5X A;  1RYS A;  1ZET A;  1X9X A;  2PFN A;  5AHX A;  1NK7 A;  3B9J A;  1T4G A;  1U49 A;  2JRZ A;  4JMU A;  3SV4 A;  1DK3 A;  3UXO A;  3T79 A;  1KFD A;  1NK0 A;  9ICX A;  1PUZ A;  2KIV A;  4JV2 A;  2ZG6 A;  5J2F A;  4UB2 A;  3F2D A;  3C23 A;  1ARO P;  4QZI A;  5J8Y A;  5L1L A;  3N7S C;  5J0W A;  1KFS A;  4UBC A;  4YFK A;  4DFK A;  4UB3 A;  3SZ2 A;  4M9H A;  5DG9 A;  1ZQM A;  5DLF A;  4FZL A;  2A1J A;  2AH5 A;  2G08 A;  4UAV A;  5J8Y C;  1QCK A;  1NJW A;  2YX8 A;  3QUQ A;  1LVH A;  2H5X A;  2FMQ A;  1L3S A;  2WF6 A;  2BDP A;  3TAC B;  2BPG A;  2BDU A;  1Z00 A;  2Y1J A;  2Q4T A;  4F8R A;  2W9B B;  4CE6 A;  3IDW A;  4NXZ A;  4J9S A;  4KLT A;  4OJO A;  4KLU A;  3H4B A;  4DLG A;  3WKD A;  2NRV A;  4PL1 A;  3V6J A;  5JUM A;  3HP6 A;  5L1K A;  1ZQY A;  5ALI A;  5DB7 A;  5J2H A;  3CW2 C;  2FLP A;  2RLT A;  3K75 D;  3M6Z A;  4KLE A;  4GXI A;  3ISD A;  1WUD A;  5DG8 A;  4EYI B;  3LVW A;  4O3N A;  1S5L U;  5CP2 A;  3TFR A;  3SMV A;  4NY8 A;  7ICL A;  1ZQV A;  4NLG A;  2HVI A;  2W3R A;  5DG7 A;  2ZIU B;  3NGD A;  2F1H A;  3TAD A;  4US8 A;  4Y2T A;  1HUO A;  5KL1 B;  5ALV A;  3MR6 A;  2ESE A;  2Y0S F;  4XQ8 A;  4AYB C;  3JPP A;  4ELU A;  1ZQP A;  2KMD A;  5JRT A;  2MA1 A;  3QU4 A;  3OJU A;  2K4H A;  2K8B B;  1X40 A;  4F50 A;  7ICJ A;  4KLI A;  1L7P A;  2CRX A;  3IG8 A;  9ICU A;  4J9Q A;  1D9D A;  3HRD D;  2B21 A;  2H3Q A;  3M8S A;  5EE3 A;  2Y1I A;  4J9P A;  1TE2 A;  4I2A A;  5KFY A;  3KHL A;  5KT6 A;  4CNQ A;  2XC9 A;  5F9L A;  4ELT A;  3Q8L A;  4RNM A;  2F2A B;  3NAS A;  2OXO A;  5ALU A;  4ELV A;  5ALL A;  2NRX A;  2KJ5 A;  7ICQ A;  4I2J A;  5KFC A;  4K4G A;  3PR4 A;  5ALZ A;  5KFR A;  2LPE A;  4GLX A;  5ALF A;  4QZB A;  3N7P D;  2P66 A;  3NS1 A;  2EQY A;  1UT8 A;  4DL3 A;  1DGS A;  2A1J B;  4Y2X A;  1ZOL A;  5HNK A;  4EX7 A;  4DO9 A;  2JV3 A;  5EWE A;  1U9L A;  4R64 A;  1Z1B A;  3NVY A;  3I1Y A;  2VIX A;  4U7C A;  1XU4 A;  1Z00 B;  3RBD A;  3D2Q A;  8ICE A;  2NV3 A;  1L7M A;  1XNS A;  4DL7 A;  1S0O A;  2KJ8 A;  3SEN A;  5KTQ A;  1SKW A;  4J9L A;  5J0R A;  4JUZ A;  3GIM A;  3MGI A;  1N5W A;  3T5H A;  3PMN A;  4EEY A;  9ICQ A;  4FBT A;  3AMZ A;  3T3F A;  4ED6 A;  1DGJ A;  3N97 B;  3Q8Q B;  3RH4 A;  4JK1 A;  2E5S A;  1XSP A;  9ICC A;  1F44 A;  2NO4 A;  3H40 A;  2VA2 A;  3C2M A;  4YMM A;  3QEA Z;  4DFJ A;  2WF8 A;  3C2K A;  5ALX A;  3LWL A;  1X66 A;  9ICT A;  2VJ5 A;  3RJK A;  1CUK A;  4G9B A;  2HHV A;  1L5U A;  4QZH A;  3FAH A;  2IOF A;  2FPM A;  4YXJ A;  3GIL A;  4YD1 A;  3AQF A;  3PW4 A;  8ICO A;  4Z6C A;  4BGD A;  3E58 A;  3M8R A;  3BDP A;  1Y88 A;  4KLD A;  2A1A A;  5ALW A;  5IIL A;  5CRX A;  2ZUC A;  1N48 A;  2KVC A;  4M04 A;  3MGV A;  1S9F A;  2BQU A;  1DRG A;  5K4L A;  2KFN A;  1FFV A;  1ZQL A;  4IQT A;  1KN5 A;  3THV A;  1LB2 B;  3MC1 A;  4CCH A;  1HEK A;  4BXO A;  3LK9 A;  3MFH A;  3JPQ A;  5KT2 A;  1XS9 D;  3F5A A;  1VJ5 A;  1P7D A;  4QWD A;  2NRZ A;  2ODG A;  4DS5 A;  7ICH A;  3T5K A;  3MDA A;  2G07 A;  4Y2Y A;  2ASJ A;  3F2C A;  3PVX A;  2W9C B;  4DOB A;  1SL0 A;  3LDA A;  3EPI A;  2F1J A;  1KEJ A;  2HBM A;  3PZP A;  4EBD A;  5BOM A;  2KN7 A;  4IQU A;  4KIT B;  2QAR A;  9ICF A;  3BQ7 A;  4QWB A;  3JPT A;  1PZN A;  4C4T A;  7ICR A;  3ICX A;  4UAT A;  1MC8 A;  1NI3 A;  2IOF K;  4P4P A;  5ALD A;  4RPY A;  5IIN A;  2UVR A;  4KX5 A;  2D3D A;  4KLH A;  4OCZ A;  7ICF A;  4TUP A;  5ALE A;  4C4R A;  1RYR A;  4NM2 A;  2LBO A;  3HT3 A;  4O3P A;  2ZJA A;  3RAQ A;  4KLF A;  4FE3 A;  1PVQ A;  5AI0 A;  5IIM A;  4UAS A;  4RQ8 A;  4RQ6 A;  1ZQH A;  3QE9 Y;  2ASD A;  1QSL A;  2P35 A;  4O3O A;  4I2H A;  1SB3 C;  2KP7 A;  4NWI A;  8ICX A;  3SAF A;  1L7O A;  5HR7 A;  1NJX A;  1QH9 A;  4QZC A;  4B9N A;  2EZY A;  2VA8 A;  2WFA A;  7ICG A;  7ICN A;  2G06 A;  3B0X A;  2RQ5 A;  3LYS A;  4EEL A;  2JMG A;  4DL5 A;  9ICK A;  3PV8 A;  5L1I A;  1TAQ A;  4M9J A;  2C2E A;  1BPD A;  1QQ7 A;  2KSO A;  2ZUD A;  3M9N B;  7ICI A;  3RJF A;  1JUD A;  4Y2P A;  3IV6 A;  2Y9T A;  1RG6 A;  2NRW A;  5J29 A;  4BXO B;  3N28 A;  1ZXI A;  1J97 A;  3VC8 A;  4PHA A;  1Z3E B;  5KFO A;  2HVH A;  3ZDC A;  2IHM A;  5ALO A;  5F3X B;  2D6F C;  2K89 A;  3GU3 A;  4PHE A;  3BZK A;  3AN1 A;  4R65 A;  7ICS A;  2NYV A;  1U4B A;  5KFS A;  2V9W A;  4CF5 A;  7ICP A;  2PI5 A;  3C2L A;  3KBB A;  5AM4 A;  3SR6 A;  2HHS A;  2QAR B;  2P6R A;  2DPJ A;  5AI5 A;  4RQ2 A;  2BHN A;  2VAN A;  3MR3 A;  2YMP A;  2R8G A;  3RB6 A;  2PFO A;  4J9M A;  3PO4 A;  2CXY A;  5EWF A;  3KOO A;  4XRH A;  3SQI A;  5ALQ A;  5KG1 A;  3JPO A;  5HHI A;  2GWS A;  5J0Q A;  4ED3 A;  4GXK A;  4O3Q A;  2KHQ A;  2AXT U;  2WHE A;  4QWC A;  2M9N A;  1M6Y A;  4NLN A;  3AQE A;  3ORY A;  8ICA A;  2JR5 A;  3KTQ A;  4B9U A;  3B0Y A;  2W55 A;  4UB6 U;  3MR5 A;  3EUB 2;  5D4B A;  2QB1 A;  2W43 A;  1ZD3 A;  5HP4 A;  3UM9 A;  2IHN A;  4ECZ A;  5KFE A;  5AM0 A;  5JU5 A;  1A0P A;  1UA0 A;  2N1R A;  3PO5 A;  2E1E A;  1JN3 A;  4J03 A;  1KBU A;  4ACO A;  2XVT A;  1ZQO A;  2JEF A;  2G0A A;  5CHG A;  3JPN A;  2W3S A;  4USA A;  1QSY A;  1SXD A;  8ICN A;  4F92 B;  5ALM A;  1X9M A;  2KSO B;  3CP8 A;  5TIS U;  1SWV A;  1LKY B;  2XGP A;  4K4I A;  4YD2 A;  4A8E A;  4MF2 A;  8ICK A;  2KIC A;  1SGG A;  1S10 A;  4NJ8 A;  2LMR A;  2OHF A;  3KKA A;  3K1Z A;  4RU9 A;  2HHU A;  1LV5 A;  9ICS A;  1K5O A;  2KK0 A;  5J2G A;  2JEJ A;  3EW9 A;  5J2E A;  1SL1 A;  8ICG A;  2DFL A;  4I27 A;  2EAO A;  3KKA C;  4ZOH C;  5AI9 A;  4DQP A;  2HBK A;  1O03 A;  3PW5 A;  1ZQN A;  1K1S A;  1A77 A;  2WF7 A;  5ALG A;  1X9W A;  2BCU A;  2W7O A;  2PMZ C;  3Q8P B;  2C22 A;  2CN1 A;  1NK6 A;  5TZV A;  4LVS A;  3C5G A;  5AKK A;  9ICH A;  5AKH A;  1N2X A;  1N63 A;  3PY8 A;  3QZ8 A;  4DSE A;  4M47 A;  4EEK A;  2XIC A;  5KT5 A;  4HAI A;  2WAQ C;  4NLZ A;  1VLB A;  4FFD A;  2UVV A;  4Q43 A;  8ICU A;  2ZTE A;  2OEH A;  1L3V A;  3QX7 A;  2JEI A;  2ES6 A;  3Q8K A;  3F5E A;  5J2I A;  2YML A;  5J0Y A;  4MFC A;  2KTQ A;  8ICV A;  1N56 A;  2R8K A;  4YR2 A;  3VCB A;  2EH9 A;  3MBY A;  3G6Y A;  3A0B U;  2WF9 A;  4K4H A;  5G5G A;  4LJX A;  3QZ7 A;  2BZF A;  1J2N A;  3PW2 A;  2E8P A;  1A6S A;  2I1Q A;  4BX9 C;  3H0M B;  4I2G A;  4O5K A;  2YN4 A;  7ICT A;  1WG8 A;  3Q8M A;  3RB4 A;  3T5L A;  4DCC A;  4QW8 A;  3UXN A;  1SWW A;  1KKX A;  5J2D A;  3OSP A;  4Z6F A;  2W7P A;  4Q8F A;  3A0H U;  4RQ0 A;  9ICB A;  5CB1 A;  3UQ0 A;  2JZB A;  4PH5 A;  3HX0 A;  1D8B A;  2XGQ A;  5EE0 A;  5AKG A;  3ZDA A;  3UQ2 A;  5B66 U;  1ZQD A;  3Q8S B;  1N62 A;  2L5Y A;  5IIO A;  2Z7J A;  3RRG A;  2ATL A;  4DSL A;  2AJQ A;  1NJZ A;  2EDU A;  4KLJ A;  3FYH A;  3IHQ B;  3EYZ A;  3OTQ A;  4KLS A;  4LZD A;  3F53 A;  4RUC A;  1ZRN A;  5AIA A;  3E0F A;  3TAQ A;  1ZQZ A;  4Y2R A;  3H0L B;  4F2S A;  4DOA A;  3BQ1 A;  3TAD C;  5BOL A;  3PX4 A;  4NLB A;  4NM1 A;  9ICV A;  4Z6E A;  3F2B A;  2HMX A;  4PGY A;  2BPC A;  1JX4 A;  4YVZ A;  1S97 A;  3ZD8 A;  4ECV A;  1NJY A;  1ZD4 A;  1L8O A;  4FS1 A;  2W04 A;  2HSZ A;  5GTI U;  4IRC A;  5EWG A;  4ICA A;  5KFJ A;  4BJQ A;  2HOI A;  4DS4 A;  4DOC A;  5KG4 A;  3OJS A;  2ASL A;  5CA7 A;  3GV5 B;  5KFA A;  4ED8 A;  4CF4 A;  3WK7 A;  8ICL A;  5AKL A;  7ICE A;  5KG3 A;  1JIH A;  2YB4 A;  4PZO A;  3RB0 A;  1KFT A;  2XCA A;  3BZC A;  3H7I A;  3KHG A;  2KHV A;  1DOQ A;  4KTQ A;  1PVP A;  1B22 A;  1Q3U A;  1TV9 A;  3ETL A;  5H2F U;  4RZR A;  3J81 j;  4ECQ A;  3C29 A;  2HDO A;  4Z6D A;  1RQN A;  2GLE A;  5AIC A;  2XID A;  4C4S A;  2W9C A;  2GO7 A;  2B0C A;  5DQI A;  2W8K A;  4U6P A;  2E1F A;  4DWI A;  3PR5 B;  2JZB B;  4IQV A;  4C8M A;  2DL0 A;  2MAX A;  5AKI A;  3C28 A;  4QZ9 A;  2V4R A;  4RNO A;  4JV1 A;  4ECY A;  1MSW D;  4EBC A;  2IOH A;  2DPI A;  2BQR A;  2KG5 A;  3TAR A;  4B9S A;  4YP3 A;  4F5O A;  1ZQR A;  4I2I A;  2PXI A;  3H8S A;  1KSP A;  8ICT A;  5ALH A;  4YR3 A;  3PST A;  5AKX A;  1KW4 A;  1TK0 A;  3PML A;  4KLL A;  1S76 D;  2PKE A;  5ALS A;  2ZTC A;  4YR0 A;  4B6J A;  4UAW A;  5KT7 A;  3JPR A;  4DF8 A;  4QIW C;  1UHU A;  4NLC A;  5KFT A;  1ZD5 A;  4Q44 A;  4KN7 A;  4CDG A;  1ZJM A;  1UQV A;  4O0I A;  2K4E A;  1PK1 B;  1BGX T;  1RPL A;  3QU7 A;  4KMU A;  4UW9 A;  4BUG A;  5ALN A;  4UB1 A;  1FO4 A;  4DQQ A;  2XI9 A;  4F71 A;  4BWJ A;  5CR0 A;  3FC4 A;  2ZJ5 A;  3ZDD A;  4P0P A;  1D8L A;  4OO1 J;  5B5E U;  4F2R A;  5KFW A;  3LVV A;  4RQ4 A;  5L1J A;  3RAX A;  4J9R A;  5DBB A;  3AU2 A;  2ZXI A;  2WB1 F;  2W8L A;  2LM1 A;  2HI0 A;  4C8L A;  2G09 A;  1TVA A;  3BQ0 A;  3UXP A;  3HJE A;  2OM6 A;  1BPB A;  1ZQE A;  3AUO A;  3GQC A;  4B9M A;  4P2H A;  3HKZ F;  2E3T A;  3QEB Z;  1S0V A;  4IS7 A;  2EZZ A;  4RQ1 A;  4IRK A;  2KKV A;  4CRX A;  3L5K A;  4Y2S A;  2KJ9 A;  3NVZ A;  5DB6 A;  4GFJ A;  3ISC A;  5KAF U;  1MQ3 A;  5HHH A;  4X5V A;  3PSP A;  3NUQ A;  4JWM A;  4J9O A;  1Z4N A;  1T8E A;  1JRO A;  1QLN A;  1U45 A;  4KLM A;  4ECW A;  3IRU A;  2DKZ A;  2NO5 A;  4P0Q B;  4PJ0 U;  2LYA A;  4UQG A;  2HCF A;  3HW8 A;  2GH1 A;  3N4M B;  2F77 X;  2MUT A;  3NTU A;  4JB3 A;  4RPZ A;  4PGQ A;  4O3R A;  5DGB A;  1WCN A;  1L6N A;  1Z4O A;  3HIL A;  4O9M A;  9ICW A;  3EPG A;  2EAP A;  3PSF A;  4GC6 A;  2E8M A;  3PX6 A;  2HHQ A;  2EAM A;  5CWR A;  5KFL A;  2Y0S C;  3C1Z A;  1FIQ A;  2IA6 A;  3AU6 A;  5KAI U;  5DB9 A;  1SZP A;  4C0Z A;  1ZQC A;  5AM5 A;  4I2B A;  5L1M A;  1DXS A;  3OGU A;  4OJL A;  3O0F A;  2F44 A;  1XSL A;  5AKE A;  4KMO B;  4FZN A;  1L8L A;  2XY7 A;  3WKC A;  1SKR A;  8ICC A;  2KIW A;  2DQN B;  1SL2 A;  3ONN A;  1YT3 A;  4MEX A;  5AKY A;  4P0P B;  4MEY A;  4FO6 A;  1NK4 A;  5ALK A;  8ICI A;  4Y2Q A;  4B9L A;  5CEH A;  2W11 A;  5E79 U;  1LKY A;  5AM3 A;  2GOL A;  4RQN A;  4C8K A;  2R8I A;  1ZQF A;  5DKW A;  2OWO A;  5L9X A;  4DFM A;  1IXR A;  1XO0 A;  5KG6 A;  2PFP A;  2LKY A;  3RH5 A;  1N60 A;  4DSF A;  4GIB A;  1RDF A;  4F91 B;  3RJH A;  2KEY A;  5J2J A;  4DQR A;  5J2A A;  8ICB A;  8ICZ A;  5J0U A;  5KFI A;  1X6I A;  5F9N A;  1JAL A;  2I6X A;  4DQI A;  2JEG A;  3WU2 U;  8ICJ A;  5KT4 A;  4QZA A;  4J9K A;  4F5P A;  4AYB F;  4UB5 A;  4KLG A;  4QZE A;  4F4K A;  4EZ9 A;  8ICM A;  4C7Y A;  3RRH A;  1D9F A;  3D2N A;  1ZQ1 C;  4P4O A;  2QLT A;  4F72 A;  1NKC A;  5KFX A;  1COK A;  4NL9 A;  4F5N A;  3IG5 A;  2F8K A;  4RQ3 A;  5J0X A;  1A76 A;  2MUT B;  5J0P A;  5KFU A;  1SV4 A;  2K8C B;  5KFV A;  4MFA A;  2W9A A;  4PHD A;  2A3V A;  2R8J A;  2IMW P;  3WKE A;  2XCP A;  3IN5 A;  1KQQ A;  4NV0 A;  2KZZ A;  2ISP A;  4DLE A;  3C1Y A;  2PFQ A;  4RPX A;  5G5H A;  5AKZ A;  1MA7 A;  5KFQ A;  5AK5 A;  5EE1 A;  2RHF A;  5AKJ A;  4ECR A;  3GZF A;  9ICR A;  1SV0 A;  1NOM A;  1FEZ A;  1SKS A;  4TUR A;  1SXE A;  2ZIV A;  3ISB A;  3I76 A;  5III A;  2KOB A;  3QUC A;  3QYP A;  2VJ4 A;  3TKA A;  3IP4 B;  2K60 A;  1SZH A;  1SV0 C;  3V72 A;  2AGP A;  2WF5 A;  3MFI A;  5KG2 A;  1DK2 A;  3H0R B;  3FDS A;  2XY5 A;  2BGW A;  4OJ6 A;  1NK9 A;  5EE9 A;  4MFF A;  1JMS A;  3ED5 A;  5ALJ A;  2DUY A;  3UMB A;  2MU2 A;  2H3Z A;  1KTQ A;  5HMM A;  3HPO A;  1IG6 A;  4BWM A;  3GII A;  5KNI A;  4B9V A;  3WKA A;  1BPY A;  3JPS A;  2JXJ A;  5AI4 A;  3V6H A;  3QUT A;  2AQ4 A;  3RR8 A;  4UBB A;  4YCX A;  1BPX A;  4QNL A;  2BCR A;  2JHD A;  1ZQT A;  4HYK A;  4Q45 A;  2FI1 A;  5EOZ A;  3HWT A;  5KFP A;  1TFR A;  1U47 A;  1S77 D;  1IM4 A;  4US9 A;  4QIW F;  3SI8 A;  5KFH A;  3AM9 A;  1COO A;  3MDC A;  4YMO A;  1BNP A;  4DSI A;  4RUA A;  1EXN A;  2ZIX A;  4O3S A;  2K4I A;  4C8N A;  3GIK A;  4PL2 A;  5BPC A;  2YB1 A;  4MHV A;  4KN4 A;  2BCQ A;  4KLQ A;  2R8H A;  4I2E A;  2BQ3 A;  4RQ7 A;  3G6X A;  2HHT A;  4ED7 A;  2KZ3 A;  3DDH A;  4OJP A;  3L4P A;  8ICF A;  3ZD9 A;  3T5J A;  1GO3 F;  1UPH A;  4Y2V A;  3KZX A;  4KLO A;  4DL2 A;  2KV2 A;  1S0N A;  2EAN A;  3RBE A;  1VDV A;  1T3N A;  2K4P A;  3RB3 A;  4OJ5 A;  1QTM A;  2ZIW A;  5KFZ A;  2PI4 A;  3PNC A;  1HJP A;  1C7Y A;  1WWV A;  5KG7 A;  2C28 A;  3CRX A;  2B6G A;  4C8O A;  1RXV A;  2LYB A;  1V9P A;  9ICN A;  8ICS A;  3KFU F;  4RQM A;  1YZ6 A;  3OPX A;  1XO1 A;  4RT3 A;  2OH2 A;  3DEE A;  2JGA A;  2ZIV B;  4JV0 A;  2WTF A;  3ALR A;  3UPQ A;  5J2B A;  5DDY A;  2KKP A;  3GV7 B;  1NZP A;  2YMM A;  3M1Y A;  1RQL A;  5ALT A;  4ED1 A;  4UAZ A;  2AGQ A;  4QZF A;  1V85 A;  3WK8 A;  8ICW A;  4DQS A;  2W03 A;  1V38 A;  1JI7 A;  5ALY A;  1X9S A;  2D8C A;  4ECX A;  3RFA A;  5J2C A;  3GIJ A;  1ZYQ A;  4O3M A;  1KL9 A;  3SAG A;  5KL8 B;  4YG2 A;  3I28 A;  8ICY A;  4DF4 A;  2JH1 A;  8ICH A;  4F4W A;  1OXJ A;  4Y2U A;  2NRT A;  1XC9 A;  2QKQ A;  4DSJ A;  3U26 A;  3C21 A;  1Z19 A;  1B4F A;  1QQ5 A;  3V6K A;  1UCV A;  5KFG A;  1MQ2 A;  2AU0 A;  2LHT A;  4DEZ A;  2I5H A;  3R9K A;  4NLK A;  3ZI4 A;  3BQT A;  3G6V A;  4TQR A;  4XUS A;  1Q46 A;  4R66 A;  7ICU A;  4QZ8 A;  1ZRM A;  4DL6 A;  1RYU A;  4ECU A;  4WJ3 B;  4XA5 A;  1BNO A;  3UMC A;  3OHA A;  1PK3 A;  1RM6 C;  3E2E A;  1PK1 A;  2F76 X;  1N61 A;  2HW3 A;  2FLL A;  4DSK A;  2HHX A;  2ZIX B;  4M6W B;  2HHW A;  1URJ A;  2FJ6 A;  4I2D A;  4EYH B;  1Z1V A;  3MGH A;  2RRD A;  4IRD A;  2VA3 A;  1TAM A;  4F5Q A;  2JH7 A;  5KFF A;  4G3I A;  3N7R C;  4M9L A;  1Q8K A;  4O5E A;  2YTU A;  2RP5 A;  7ICV A;  2W9M A;  5KFD A;  1QSS A;  2LYH A;  1OW5 A;  3OSN A;  3QXG A;  3WKB A;  1TKD A;  5DGA A;  4C80 A;  1WYG A;  4E0D A;  2BPF A;  4CF3 A;  1TAU A;  2FLN A;  2E8O A;  2ZIW B;  3BS5 A;  4Q8E A;  2J6T A;  5ALR A;  4ED0 A;  1KRP A;  3OHB A;  1FFU A;  2OYY A;  9ICI A;  1CI4 A;  5CJ7 A;  2RDI A;  1TK5 A;  4I2C A;  4Y2J A;  5D49 A;  2XO7 A;  1MN8 A;  4QJF B;  2RDJ A;  4QWE A;  4B9T A;  3SV3 A;  4ECS A;  2BCV A;  1U48 A;  1T3Q A;  1L3U A;  3ZDE A;  3Q8R B;  2AQ0 A;  4P0Q A;  4GC7 A;  4IC9 A;  3QU9 A;  5J2K A;  2ZJ8 A;  5DQH A;  4I2F A;  1XSN A;  4F4Z A;  2Q0Z X;  1KDH A;  4F5R A;  4QWA A;  5DDM A;  4EZ6 A;  1B43 A;  3C5F A;  1X42 A;  1O08 A;  1KLN A;  3RJI A;  8ICP A;  1ZQG A;  3H8M A;  5J0O A;  2KD1 A;  1J2M A;  1NK8 A;  3RJG A;  5AI6 A;  9ICJ A;  5AM2 A;  4PHP A;  4FBU A;  4J9N A;  9ICP A;  3NRW A;  4IQW A;  2R18 A;  3LWM A;  3GV8 B;  3M9O B;  2V4Q A;  2CPR A;  3WK5 A;  1ZQJ A;  2YQE A;  3NVV A;  5KFN A;  2UVW A;  1ZQK A;  2YY6 A;  3AL0 B;  2MRL A;  4MF8 A;  4YXM A;  4R8U A;  9ICM A;  2IBK A;  5AM1 A;  5DBC A;  4UAY A;  2XY6 A;  2HOQ A;  3BS5 B;  5C5J A;  2E8N A;  4UAR A;  1ZD2 P;  4UB8 U;  3SEI A;  1SIJ A;  4R63 A;  4UB4 A;  5GTH U;  1ZJN A;  1T7P A;  4M9G A;  2AHO B;  8ICR A;  4I28 A;  2AGO A;  5AK6 A;  4DFD A;  1NK5 A;  4YQW A;  1ED1 A;  1TK8 A;  4QZG A;  3M9M B;  5IIK A;  2G5H B;  2ZUB A;  2A19 A;  2G5I B;  2FDR A;  1NZB A;  1UT5 A;  1WCL A;  4C7Z A;  1F5S A;  3TI0 A;  1ZQW A;  4EX6 A;  1ZQU A;  2J6S A;  1ZQA A;  5C0Y A;  1NKE A;  2W54 A;  2PMZ F;  2Y9U A;  5KT3 A;  4YN4 A;  4FZM A;  3IM1 A;  4P4M A;  9ICG A;  3QNM A;  3CNH A;  5DQG A;  2C2R A;  2ZXH A;  1K1Q A;  3RJE A;  2WAQ F;  4F4X A;  4DFP A;  3EZ5 A;  3KZI U;  8ICQ A;  5DBA A;  5KFM A;  4TUS A;  4OD0 A;  2ALZ A;  3SYZ A;  3RJJ A;  1ECW A;  1Q3V A;  3KHR A;  3WK6 A;  3V7K A;  3DV9 A;  3K1R B;  4GXJ A;  4IL6 U;  1BVS A;  5KG5 A;  3FM9 A;  7ICK A;  3EWA A;  2J6U A;  2LI6 A;  4AP9 A;  4RT2 A;  3BS7 A;  4ZH4 A;  3M7D A;  2KVS A;  9ICO A;  3SAH A;  2HOF A;  1YZ7 A;  1XWL A;  2QB0 A;  5FP0 A;  1C20 A;  1V97 A;  2HBL A;  9ICE A;  2EZX A;  1B0X A;  3RF9 A;  4R8U B;  4BDP A;  3KHH A;  2KFZ A;  2OCE A;  3BQ2 A;  4RNN A;  5AIB A;  4QW9 A;  2F3N A;  1HIW A;  3TFS A;  2KNJ A;  5J0T A;  3MR2 A;  2DBY A;  4JWN A;  1NKB A;  5J0S A;  1L3T A;  1F0M A;  2FPK A;  4PGX A;  1ZQS A;  2HBJ A;  3RTV A;  1D8Y A;  2VKQ A;  2BKE A;  3NVW A;  4PZN A;  3L3F X;  3PW0 A;  1JXL A;  1RZT A;  4M2Y A;  1AQ6 A;  1HUZ A;  1WWU A;  3CYM A;  3TAN A;  3QU5 A;  3M6K A;  3NRZ A;  1RXW A;  4M9N A;  5IIJ A;  3V7L A;  2H3I A;  1S8O A;  3ZDB A;  2KZM A;  3WK9 A;  4I29 A;  1JRP A;  9ICL A;  2O6K A;  5DLG A;  2LM4 A;  4QZD A;  1CEZ A;  5HML A;  4RQ5 A;  2M0N A;  5T14 A;  3RH6 A;  2UVU A;  4O5C A;  2F1I A;  3K4G A;  2P6U A;  4LZG A;  4KX3 A;  2BCS A;  3QUB A;  4NL9 C;  1L7N A;  4EEN A;  3PW7 A;  2C2D A;  4ECT A;  1T94 A;  1BPZ A;  4DL4 A;  1IIP A;  5ALP A;  2BR0 A;  4YMN A;  2MSN A;  2YMQ A;  4TUQ A;  1NNL A;  3UMG A;  2ZTD A;  4M0A A;  3ETR A;  2QB0 B;  3WK4 A;  4IR9 A;  3PX0 A;  4F3O A;  4ED2 A;  3PSI A;  2F8L A;  1S0M A;  5DB8 A;  2DGZ A;  2H3V A;  3QU2 A;  2DWQ A;  2FPL A;  1IV8 A;  3GDX A;  1QQ6 A;  3S6J A;  1ZQX A;  5KFK A;  9ICA A;  3D2S A;  1H38 A;  5HR6 A;  2DKX A;  5D46 A;  2KE7 A;  3BJY A;  5JTI A;  3MAB A;  4PPX A;  4EBE A; 
#chains in the Genus database with same CATH homology
 2HMX A;  4QNL A;  2JHD A;  2KVC A;  2YX8 A;  3MGV A;  4CGZ A;  4QIW C;  4P0Q A;  1L6N A;  4IC9 A;  2HBJ A;  3N7P D;  3IG5 A;  4NWI A;  4NLC A;  3SAF A;  2VKQ A;  2LHT A;  1OUQ A;  1DRG A;  5HR7 A;  2BDU A;  4QIW F;  5C0Y A;  4CDG A;  2PMZ F;  2W04 A;  3L3F X;  2Q4T A;  4FZM A;  2K4E A;  3VCB A;  3PSF A;  4OJO A;  2K8C B;  2WB1 C;  1Z1B A;  2G06 A;  4ICA A;  2VIX A;  1A0P A;  3LYS A;  4BUG A;  2JMG A;  4BJQ A;  2Y0S C;  3CYM A;  4U7C A;  2A3V A;  4PL1 A;  2HOI A;  2ZIX A;  2ZXH A;  3M6K A;  2K4I A;  1HEK A;  2DF4 B;  2N1R A;  4PL2 A;  2K8A A;  2H3I A;  2WAQ F;  3D2Q A;  3IN5 A;  4C0Z A;  2E1E A;  2YB1 A;  4NV0 A;  4WJ3 B;  2NV3 A;  3F5A A;  3HKZ C;  1XNS A;  1KBU A;  2XI9 A;  3M6Z A;  4ACO A;  1P7D A;  2XVT A;  2F76 X;  4OJL A;  3O0F A;  1WUD A;  2G0A A;  2ZIX B;  4KMO B;  4FZN A;  2KD1 A;  2KJ8 A;  4P0P A;  2M0N A;  4OO1 J;  1A6S A;  3LVW A;  4OJP A;  2ZIU A;  1URJ A;  5T14 A;  3VC8 A;  1ECW A;  2KIW A;  4BX9 C;  1PVR A;  1Q3V A;  2YB4 A;  3H0M B;  3SMV A;  1MA7 A;  1CRX A;  2DQN B;  3LVV A;  3CP8 A;  1GO3 F;  2RRD A;  2G07 A;  2H3F A;  1TAM A;  5A0L A;  3ONN A;  4A8E A;  1YT3 A;  1UPH A;  2JH7 A;  2RHF A;  3KZX A;  2KHV A;  3N7R C;  3F2C A;  3GZF A;  4P0P B;  2KIC A;  4KX3 A;  2E5S A;  2ZIU B;  2D6F C;  1PVP A;  2K89 A;  2RP5 A;  3NRW A;  2KV2 A;  3GU3 A;  2R18 A;  2ZXI A;  2WB1 F;  1Q3U A;  3K1Z A;  5KL1 B;  1F44 A;  2HBM A;  3PZP A;  2G09 A;  1T94 A;  2Y0S F;  4OJ5 A;  2W7P A;  3C29 A;  2OM6 A;  2ZIW A;  3M7D A;  2ZIV A;  4AYB C;  3SAH A;  2GOL A;  1IIP A;  2CPR A;  2HOF A;  3CRX A;  1D8B A;  2XID A;  2KOB A;  3HKZ F;  2LYB A;  2MA1 A;  4JMU A;  2VJ4 A;  3KFU F;  3T79 A;  3IP4 B;  2HBL A;  2VJ5 A;  1SZH A;  2E1F A;  2ZG6 A;  2ZIW B;  3OPX A;  4U6P A;  2OH2 A;  3DEE A;  1XO0 A;  2Z7J A;  2JGA A;  2K4H A;  2K8B B;  2KKV A;  2MRL A;  2ZIV B;  3F2B A;  4CRX A;  3ICX A;  3AL0 B;  2KJ9 A;  2HBK A;  2LKY A;  3ALR A;  3F2D A;  3IG8 A;  4GFJ A;  2CRX A;  3H0R B;  2OYY A;  2KKP A;  3C28 A;  4KX5 A;  2KEY A;  3PSP A;  3PSI A;  4OJ6 A;  2F8L A;  2W7O A;  2HOQ A;  2PMZ C;  2H3Q A;  3NUQ A;  2CN1 A;  3RF9 A;  2DGZ A;  3N7S C;  2H3V A;  2H3Z A;  2LBO A;  3F53 A;  3SQI A;  3AQF A;  2W03 A;  4QJF B;  2F2A B;  4P0Q B;  3E0F A;  1HIW A;  4AYB F;  3RFA A;  2XIC A;  4O3M A;  2LYA A;  2WAQ C;  2OXO A;  3PST A;  4FE3 A;  5KL8 B;  3SAG A;  2KNJ A;  3H0L B;  1PVQ A;  2JH1 A;  1ED1 A;  3D2S A;  2GH1 A;  2KHQ A;  4FZL A;  5HR6 A;  2G08 A;  4NLB A;  2F77 X;  2G5H B;  2KJ5 A;  2G5I B;  5CRX A;  3F5E A;  3AQE A;  3D2N A;  1Z19 A;  1ZQ1 C;  1NZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...