4AYBF

Rnap at 3.2ang
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
105
structure length
105
Chain Sequence
b'SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSNRTYTSEDIQKIIDII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
molecule tags Transferase
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
total genus 13
structure length 105
sequence length 105
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4aybF02
2PMZF 2WAQF 2WB1F 4AYBF 3HKZF 2Y0SF
chains in the Genus database with same CATH superfamily
3RH4A 2UVVA 5DB7A 3TAPA 3QX7A 5J2JA 1TKDA 3Q8RB 4GXJA 3PO4A 4C8LA 4EZ9A 2YY6A 9ICIA 3V72A 3NVVA 2EAOA 2A19A 3F2BA 4PL2A 5L1LA 4JUZA 4WJ3B 4F5QA 4DL7A 2K89A 3N7SC 5DB6A 3FM9A 4RUCA 5J2EA 4TURA 1KEJA 4ECUA 3HKZF 7ICJA 1ZQLA 3RJHA 1XSNA 2JR5A 5DBAA 5AI0A 2OHFA 3BQ7A 5GTIU 2RDIA 5ALTA 2ZTDA 3PW7A 1LB2B 3RB4A 1TAQA 4JMUA 3C2KA 2GO7A 2PKEA 5ALDA 2G06A 5KG1A 4M0AA 4RNMA 2VJ5A 1TK0A 5JUMA 1SV0C 4F4XA 3G6YA 1UA1A 4YR2A 4F92B 3CP8A 4I2AA 2QB0A 2JZBA 2HW3A 3PW0A 1WCLA 1BPBA 4O3RA 3KHLA 2ATLA 4J9SA 3ALRA 2RDJA 3QZ7A 3AM9A 2W9BA 1Z4NA 4J9OA 5B66U 4EEKA 3KHHA 5KAIU 4C8MA 4F50A 4ECWA 5ALIA 5AM3A 2PI5A 1BPZA 2MSNA 3BS5B 2E8NA 1TE2A 1V38A 3IN5A 5HHIA 4YMNA 1QTMA 3FAHA 4G9BA 4FZLA 4OJOA 3TI0A 3H0LB 5D4BA 5KG0A 1NZBA 4BWMA 4U7CA 5AKGA 4DFDA 3MGVA 4F5RA 1JALA 5DLGA 5EWEA 1JN3A 1DGSA 4BJQA 4DEZA 3PZPA 3PX0A 2KHVA 2YX8A 5ALVA 2C2DA 7ICUA 4Q8EA 2JEJA 3ETLA 1KRPA 1T7PA 4C7YA 4JV1A 5DBCA 5HR6A 3UM9A 3EPIA 1A77A 4F4WA 4NM2A 2HHUA 1HUZA 3V7KA 2YMQA 9ICTA 2KIWA 3Q8LA 4Q43A 2Y9UA 4DFPA 4F4KA 4QWAA 2YB4A 2HDOA 3PSIA 5J2IA 3ZDDA 4XA5A 2K4IA 3K4GA 2HOIA 2ZTEA 3RH6A 3EZ5A 4KTQA 1PZNA 2DWQA 9ICSA 5ALUA 4Y2TA 7ICKA 1AROP 3PV8A 3HT3A 5DGBA 3TARA 3UQ0A 9ICAA 3BQTA 2BDUA 4Z6DA 5E79U 2HHTA 4USAA 1LKYB 3RFAA 8ICQA 4KLJA 1F44A 4UB5A 4IC9A 5ALRA 2KOBA 4RQ1A 4R64A 2BKEA 5C0YA 5KT5A 4B9SA 2C28A 2YQEA 4JK1A 1N5XA 2P35A 4DOAA 3RJEA 4NL9A 2KEYA 1IV8A 4IRDA 4KLGA 4MFCA 4UARA 4P0QA 2JGAA 3PSFA 4QWBA 3PW5A 3TAQA 5J2GA 3BQ2A 4J9QA 1KLNA 1ZQSA 4KLUA 1K1QA 3OSPA 2KG5A 2YMLA 5J2BA 3LVVA 1NZPA 2QLTA 2ZUDA 4YD1A 3IV6A 4C4TA 3A0BU 2F1IA 5L9XA 4G3IA 1S10A 1PUZA 1BPXA 1NJZA 4PHEA 2W8KA 2PFNA 4ECZA 4GXKA 2QB1A 4BXOA 4O5KA 1EXNA 1BVSA 5KFTA 4J03A 1M6YA 2KVSA 1S9FA 4QWDA 1S76D 1CRXA 1KL9A 1VDVA 3RH5A 3MR2A 3UPQA 1ZRMA 3OSNA 3BQ1A 2XY7A 4DOBA 4NM1A 5J0UA 3GILA 4KLIA 1WWVA 2Y9TA 3SV3A 9ICOA 1ZQZA 2FLNA 4B9TA 4CNQA 1SKRA 2H3ZA 3L3FX 2MA1A 1XO0A 5J0YA 2KZ3A 1TVAA 3RRGA 3H4DA 2JEGA 3QYPA 1BPDA 3NRZA 4DF8A 4QZAA 4DCCA 1FIQA 2ZXIA 3NVZA 1X6JA 4I2DA 3LWMA 3T5JA 3AEVA 5BOLA 4EBDA 4HYKA 1YZ6A 4O9MA 1RQLA 4O3OA 4Y2SA 2C22A 2PMZC 1ZQWA 5AI6A 4ACOA 5KT3A 3EUB2 2F1JA 3ICXA 4QIWF 5KFIA 2YN4A 4R66A 4FO6A 1ZQPA 2ZTCA 2OXOA 1NK7A 9ICNA 3RAQA 3SAFA 1RDFA 3Q8QB 1O08A 5AKLA 3I76A 4DS5A 1COKA 1DK2A 4MHVA 3PMLA 2G07A 4JV2A 3HRDD 5KFPA 2W04A 4E0DA 7ICPA 2RQ5A 8ICBA 4F3OA 3E2EA 1L8OA 4KLFA 2F8KA 2HBKA 4UB2A 3QZ8A 4UB6U 2P66A 4ECTA 1ECWA 5AKYA 3HW8A 4YD2A 1SB3C 3T5LA 3PY8A 2BCVA 1YZ7A 5BPCA 2H3VA 5KG6A 4F8RA 2VKQA 5EE9A 2RRDA 3SI8A 2K4PA 4KLOA 3GQCA 3C2LA 4Z6FA 4YMMA 4EBCA 2XCAA 5DG9A 1RQNA 2ZIVB 2NRZA 2PMZF 3SENA 4RQ0A 5EE3A 2W03A 4BGDA 5KT7A 4UBCA 1SL1A 4UB4A 5KFUA 1AQ6A 4ED0A 1SXDA 3WKAA 1U47A 4KN7A 4NLBA 3AMZA 7ICHA 4GIBA 2LHTA 5AHXA 3N97B 1OUQA 1Q8KA 2HBLA 1BNPA 5KFVA 5CHGA 2BQUA 3QUTA 4JWNA 5J2AA 4TQRA 2BPFA 1LVHA 3MDCA 2XCPA 1D9DA 4YN4A 4EBEA 4RQ2A 5KFEA 2K4EA 5KFNA 3L4PA 4I27A 3GV8B 4YFKA 2LI6A 3M8RA 2ZUBA 1PVQA 4QZ8A 4PZNA 4F5NA 4MF2A 1RZTA 4I2FA 2WF5A 4F72A 1N5WA 4X5VA 2NRTA 5KFJA 2L5YA 2W8LA 1ZQUA 5J0OA 1V97A 5T14A 4F2SA 4CGZA 2XICA 4PHAA 4I2BA 5F9NA 4CF3A 2AJQA 3QEBZ 1UPHA 1UQVA 1QLNA 4O3QA 3SQIA 4KMOB 1NNLA 2R8GA 5B5EU 3GIJA 8ICCA 4RQ5A 4RQ6A 2WB1F 4AP9A 1T8EA 3T3FA 4RQ3A 2NRXA 4NXZA 2OEHA 1Q3VA 1Z1BA 4J9LA 4CE6A 1ZD5A 4QJFB 4YCXA 3JPSA 2W9BB 1BNOA 2VJ4A 3PX6A 4EYHB 4EEYA 1XSLA 2PXIA 3M8SA 3QU5A 5KFXA 1Y88A 8ICSA 3QXGA 4DFMA 4B9UA 3NVWA 9ICEA 1WYGA 2HCFA 3KZXA 9ICGA 3QUQA 3LVWA 2IHNA 4M9NA 5AI5A 1XC9A 5HMMA 4IL6U 2DBYA 2ISOA 3H7IA 4J9KA 1L3SA 2AQ4A 3AU2A 1Q46A 4KLSA 2JZBB 5KFOA 4Q45A 2FPMA 3EYZA 2HOQA 3SMVA 2EDUA 3KHGA 4C7ZA 5J0TA 1KN5A 4C80A 5L1MA 3B9JA 3UXNA 1ZQCA 4C4RA 5KFWA 2OYYA 1RPLA 1TAMA 2I5HA 4O3NA 4UAVA 4DFKA 2F8LA 1NK0A 1JI7A 2JV3A 1JX4A 1S0VA 3UXPA 2FPKA 1ZD3A 4NLZA 7ICLA 4UASA 1NKEA 3GDXA 1S0MA 4EX6A 4IRKA 4US9A 3SR6A 2KFNA 5KL1B 1BPYA 4LJXA 4NLKA 4EYIB 5KFBA 4RQMA 3SAGA 2JRZA 2LM1A 4LVSA 2J6UA 2HMXA 4TQSA 3MR5A 4CDGA 3TFRA 4NLCA 4O5EA 2D3DA 3WK7A 3GIMA 2K60A 2ES6A 1X40A 2R8HA 2FMPA 3AUOA 2ZIUA 2LBOA 1SZPA 5AK6A 4PGQA 3DV9A 4B9NA 7ICNA 1QQ7A 8ICYA 4OO1J 5IIMA 8ICHA 2GH1A 2KVCA 3WU2U 4RPXA 3ISDA 4F93B 5KG4A 4QW8A 5KFDA 3JPRA 5CB1A 1HUOA 2I6XA 3OGUA 3AQEA 3RR7A 4RNOA 4ECXA 3QU4A 2IOHA 1KSPA 2FI1A 1RXWA 5AKJA 4ELTA 3C21A 3LYSA 4DL4A 3L5KA 4DQRA 4C8KA 4IQUA 4NL9C 2GWSA 4QWCA 4TUSA 2YB1A 3PR5B 2GLEA 2LKYA 3GV5B 5AKKA 3MBYA 2A1JB 2ODGA 4EENA 2P6UA 4XQ8A 5DB8A 1ZJNA 1MN8A 8ICNA 1ZD4A 4IQVA 3ISCA 2P6RA 1ZQDA 2MUTA 1U48A 4M04A 2W9AA 3G6XA 1HJPA 2F44A 2LYBA 4CF4A 1PK3A 4P0QB 1X66A 1Z4OA 4BX9C 1WCNA 2YMMA 2DL0A 5KG7A 5HHHA 2R18A 4FZNA 5CRXA 9ICJA 3OPXA 4ECSA 5L1KA 2DGZA 2EZZA 5CA7A 4QIWC 3NVYA 4DSFA 8ICMA 2E8PA 2K8AA 1SV0A 2E5SA 2WTFA 4DQIA 4KITB 2NV3A 4KN4A 5ALYA 3RJIA 4FZMA 4HAIA 3PVXA 2BCQA 2WB1C 4DL3A 1ZQRA 2FPLA 1P7DA 4DFJA 1ZRNA 2FDRA 5CP2A 5DDMA 2HBJA 4I2JA 4RQ8A 2W3SA 3SYZA 1Q3UA 3BS7A 1LV5A 2KIVA 1UT5A 8ICAA 5IIIA 2BDPA 2A1AA 1RXVA 5IIOA 5KAFU 3CW2C 4MFFA 1KTQA 2UVUA 1URJA 2Q0ZX 4BXOB 1RYRA 5KFGA 4DQQA 2A3VA 4UAYA 2DFLA 7ICTA 5IINA 3C5FA 1BGXT 2F77X 1XS9D 4LZGA 3OHAA 2DQNB 4FS2A 4OCZA 3JPQA 1NOMA 3EW9A 4O3SA 3M9OB 3KFUF 4QZEA 9ICMA 5KG2A 2KK0A 2VANA 2V4RA 5ALMA 3FDSA 5CR0A 4UAWA 3Q8PB 4NV0A 2F1HA 3ZDBA 1QSYA 3C1ZA 4YR0A 9ICPA 3V7JA 3WK9A 4M9HA 1IXRA 3H8MA 9ICXA 3F5AA 2Y0SF 1NI3A 2JHDA 2IBKA 4RT2A 2MRLA 2Y0SC 3DEEA 5J0QA 2DKZA 2K8CB 7ICMA 4PGYA 2KD1A 3Q8MA 3T5KA 2NO4A 2Z7JA 2XC9A 4M9JA 1S0OA 1OXJA 2CXYA 5AIBA 1WG8A 2XI9A 2ZIUB 2KJ9A 4Y2XA 2AGQA 5TZVA 4EZ6A 7ICFA 4F5PA 5AI8A 5KT4A 3TFSA 2KSOA 1KQQA 2W9MA 2D6FC 5AM0A 4PHDA 1TK5A 1NK6A 2VA3A 2KZZA 3TQ1A 4YR3A 3TKAA 4CRXA 4M6WB 4MEXA 5ALFA 4Y2PA 3ED5A 7ICRA 2ZJ8A 1QQ6A 4DLEA 5AKEA 4JV0A 3NASA 3BQ0A 2BHNA 1Z3EB 5AK3A 5J0XA 4ECVA 1Z1VA 3F53A 2FMSA 4QW9A 2JXJA 2E8MA 4F4YA 3Q8SB 3SAHA 8ICFA 5KFLA 2DKXA 5F9LA 1CUKA 4DSJA 1DOQA 3NUQA 5KFYA 2ZIVA 4Z6EA 9ICBA 1B4FA 2FMQA 4OJ5A 4KLLA 5AICA 1V85A 1X2IA 1B0XA 4C8OA 4O3MA 5K4LA 1T3NA 9ICCA 5KFQA 4RZRA 2YTUA 4NJ8A 1PK1A 2YMPA 2XGQA 2JEFA 3PSPA 4RU9A 4DF4A 5KFHA 3G6VA 4DOCA 2BPGA 4PPXA 1KDHA 2OCEA 2NRWA 3NTUA 4QZBA 5J2KA 4RPYA 3GV7B 2ZIWB 2ESEA 1PVRA 1S5LU 1COOA 2F3NA 5F3XB 2ASLA 1V9PA 4QZGA 4GXIA 1JXLA 1TFRA 1SXEA 1YT3A 4Y2QA 3LWLA 2JMGA 4OJPA 5AM5A 8ICKA 4QZCA 4B6JA 4P0PA 5IILA 1L3UA 4Y2UA 5JTIA 4TUPA 1Z19A 2HVHA 3JPOA 5BOMA 5J2HA 1K1SA 1JUDA 2BQRA 3H8JA 2R8KA 5DKWA 1J97A 1XSPA 4OJ6A 1TAUA 4J9MA 5ALXA 3M9MB 2QARA 5ALLA 4YMOA 5L1IA 1QQ5A 1NK5A 1N62A 2OM6A 3QU9A 1XO1A 4KLMA 4JB3A 5ALKA 1Z00B 4O0IA 7ICEA 1UA0A 2G09A 4IQWA 5KG5A 2WHEA 5DG8A 9ICHA 7ICSA 2Y1IA 7ICOA 2LPEA 1ZD2P 1HEKA 4RQNA 1NK9A 4KLQA 5AKIA 1JIHA 3BZKA 1IM4A 1FFUA 1PVPA 2WF6A 4FS1A 1ZQVA 3UMBA 3V7LA 2PFOA 1FO4A 1MQ3A 5KTQA 2WAQC 4UQGA 1S97A 5ALNA 2IMWP 3MGIA 3C28A 4F5OA 1SV4A 3KKAA 1SIJA 2EZXA 1ZQGA 4Y2YA 2W3RA 2GOLA 2BZFA 2HHXA 2QARB 3MDAA 3HILA 1L7PA 3C2MA 2KJ5A 9ICKA 3Q8KA 3D2NA 5KFMA 1JMSA 5HP4A 5ALGA 1RM6C 2DPIA 5AK4A 3RTVA 2EANA 4IR1A 3MFHA 4DSLA 3WKDA 3ETRA 3MGHA 5AI4A 5ALQA 2E3TA 2ZJ5A 3RB3A 3PNCA 3MR6A 2E8OA 3TADA 3ISBA 1K5OA 4UB3A 1X9SA 4ED1A 3VC8A 1ZQQA 1B43A 1RG6A 4PL1A 1F5SA 3KTQA 1SL2A 4MEYA 5DQHA 7ICGA 1WWUA 3TACB 2AH5A 2ZXHA 4A8EA 3PR4A 3M6KA 1D8YA 1IG6A 2EQYA 4YVZA 3OJSA 4ED6A 4RT3A 3M7DA 5D49A 2KE7A 3C5GA 2ZUCA 2DPJA 3K1RB 5G5HA 3KBBA 1J2MA 1U4BA 1ZQOA 3HWTA 5AKXA 3LDAA 2BCRA 2KKPA 4CF5A 4AYBC 1L3TA 1CI4A 3OJUA 5KT6A 2W7PA 4P0PB 9ICWA 1KKXA 4M6WA 3KOOA 7ICVA 1S8OA 2UVRA 3NGDA 2ASJA 3I1YA 4P4MA 2I9GA 2HSZA 5AM1A 2JH7A 4ED8A 3C29A 1L8LA 1NK8A 4KLDA 2I1QA 1XNSA 4GFJA 5DQGA 4J9NA 1N60A 1LKYA 3FYHA 3BZCA 4FBTA 2HHSA 5J2FA 3NS1A 4NWIA 5KFCA 4TUQA 2JH1A 5FP0A 2G0AA 4DQPA 3RR8A 3F2CA 2HHWA 3F2DA 1UCVA 3IP4B 3GFKB 1N63A 1KFSA 1L7OA 3MABA 1L3VA 2QKQA 5EOZA 4BUGA 2XGPA 4P4PA 2LYAA 4I29A 1D8BA 1DGJA 2KFZA 2F2AB 3H8SA 4Y2JA 3EPGA 4F4ZA 1ZQJA 5ALHA 1U45A 2K4HA 2VIXA 3KD3A 1ZQKA 2J6SA 4FBUA 4CCHA 5IIKA 2BR0A 1ZQ1C 1L7MA 3TADC 3H4BA 4M9LA 1KBUA 4KLEA 1SL0A 3S6JA 2C2EA 3IHQB 8ICIA 3KHRA 2E1EA 5CWRA 3WK4A 1TK8A 5HNKA 2KV2A 2WF9A 2O6KA 3F5EA 5KFRA 3THVA 4PGXA 3K75D 8ICVA 3BDPA 3SZ2A 8ICXA 2XY6A 2F76X 2H5XA 4F71A 3QUBA 4OJLA 2KKVA 2FLPA 1SGGA 3H0RB 4R8UB 1S0NA 3QNMA 4K4IA 4YQWA 3T79A 2HBMA 4IQTA 4FFDA 2JEIA 2KP7A 2EH9A 3T5HA 3RAXA 2A1JA 1NKCA 1KFDA 5CJ7A 4UB1A 3WK8A 8ICGA 1ZQAA 4M47A 1ZQFA 3WK6A 2N1RA 3FC4A 4NY8A 5KNIA 1SZHA 5JRTA 3ZDCA 5AKHA 1U9LA 1HIWA 1J2NA 2ZIWA 2DF4B 1N2XA 3GU3A 2BGWA 3RRHA 1SKWA 2XIDA 2G5HB 3VCBA 2XVTA 2WF8A 4DWIA 3IRUA 4DL5A 3SV4A 3C1YA 3WKBA 5KFFA 2KSOB 5AM2A 1MSWD 4OD0A 1A76A 1NK4A 4DQSA 1ZOLA 4I28A 2ZJAA 4YXMA 4LZDA 1ZQYA 1U49A 5ALEA 4RQ4A 3QE9Y 3RJFA 5TISU 3UMGA 4JWMA 4RPZA 3TANA 5EWFA 3H8WA 3D6JA 2E1FA 1X42A 5KFAA 4KX5A 5EE1A 4EX7A 3JPNA 3N7PD 4RNNA 5AI9A 2BPCA 4K4GA 3M6ZA 9ICVA 2K8BB 2C2RA 1MC8A 5J0SA 1C20A 3DDHA 4IR9A 5ALSA 1QH9A 2H3IA 3SD7A 4I2IA 2MAXA 1GO3F 3RF9A 4KX3A 4RQ7A 1NKBA 4ECQA 2CRXA 4GC6A 5J2CA 3RBDA 8ICZA 3D2QA 8ICEA 1N61A 1B22A 2XO7A 3N4MB 4AYBF 2KHQA 2IOFA 5DGAA 2W55A 7ICQA 9ICFA 2HI0A 4DO9A 5AK5A 4DL6A 4M9GA 4UAUA 8ICJA 1SWVA 2FJ6A 3R9KA 1DRGA 4QZDA 2ALZA 3ZDAA 2G08A 3E58A 4Z6CA 3CRXA 3AN1A 5EE0A 3UXOA 3M1YA 2HHQA 4UB8U 3WK5A 4R63A 3JPTA 4QZFA 8ICRA 1JRPA 2B0CA 3H0MB 4ZOHC 5KL8B 3V6JA 3QEAZ 5ALOA 9ICQA 2HVIA 4ECYA 2KNJA 3QU2A 5AIAA 5KG3A 3IDWA 5KFSA 4C4SA 4B9MA 1ZQXA 1BPEA 3CNHA 5ALPA 4QZHA 4GLXA 3N7RC 1O03A 4O3PA 4ELUA 4J9RA 3ONNA 5H2FU 4I2HA 1ZQMA 1A0PA 3ZD9A 2W7OA 4MFAA 1Z00A 3HKZC 3KZIU 3U26A 1L6NA 4RUAA 2R8IA 1S77D 2RLTA 4ED2A 3PW4A 5J2DA 1TV9A 1ZYQA 4PH5A 5KFZA 1QSSA 3GIIA 1NJXA 4DLGA 2HOFA 1JROA 4FE3A 3MC1A 4O5CA 4UBBA 2NRVA 4C0ZA 1SKSA 4XUSA 4BDPA 5DQIA 3RBEA 2FLLA 3PX4A 4F2RA 1DXSA 1KW4A 4M2YA 4YG2A 5KFKA 2FE9A 3RJKA 1FEZA 2WFAA 1PK1B 3D2SA 3GIKA 2WAQF 2DUYA 2ZG6A 1QSLA 2XY5A 9ICLA 4DSKA 4IS7A 4KMUA 2AHOB 2W43A 2LYHA 3ZDEA 1WUDA 3QUCA 4U6PA 4Q8FA 5DDYA 1VJ5A 4UATA 4QZ9A 5J0WA 2AQ0A 2IA6A 4US8A 3MFIA 3CYMA 2NYVA 3IM1A 5J29A 2W11A 3ORYA 1H38A 4NLGA 1X9MA 1X9XA 1C7YA 1A6SA 3JPPA 4QWEA 2EAPA 4KLHA 4MF8A 3SEIA 4GC7A 5DG7A 2CPRA 4ICAA 2BCSA 4J9PA 2KMDA 4ZH4A 1KFTA 2R8JA 1ED1A 3PW2A 3O0FA 1N48A 4I2GA 5JU5A 3RJJA 4KLTA 9ICRA 5ALWA 5DB9A 1UHUA 3RB0A 7ICIA 2V4QA 4K4HA 5EWGA 3HPOA 1ZQBA 3UMCA 2UVWA 2KN7A 5G5GA 2KZMA 4Q44A 3GZFA 2IOFK 5IIJA 4ED7A 1N56A 2Q4TA 1SWWA 3B0YA 1QCKA 3A0HU 5KT2A 1ZXIA 1T94A 2H3FA 2M0NA 5DBBA 1FFVA 1NJYA 4DS4A 4B9LA 2BQ3A 1L7NA 4QZIA 3QU7A 2OH2A 3NRWA 1IIPA 5J8YC 5ALJA 3UQ2A 3J81j 2VA8A 2EAMA 3OHBA 2ASDA 3BS5A 2BCUA 2MU2A 1UT8A 1CEZA 5C5JA 5J0PA 3HX0A 1D8LA 3WKCA 2W9CB 3BJYA 1MQ2A 4F91B 3KKAC 4PJ0U 5CEHA 4C8NA 1NJWA 2ISPA 2WF7A 4YP3A 5HMLA 4ED3A 1ZETA 2ZIXB 2ZIXA 3WKEA 3RJGA 5HR7A 2PFPA 1ZQTA 4YXJA 9ICUA 2KICA 4IRCA 2AGOA 3MR3A 5GTHU 1X6IA 3PO5A 3K1ZA 1OW5A 2W9CA 8ICUA 4PZOA 2D8CA 5ALZA 2AGPA 2OWOA 1ZQEA 3HJEA 3ZD8A 3V6KA 3AU6A 8ICOA 2KTQA 4R8UA 4DSEA 1RYUA 8ICLA 4I2EA 5J0RA 4ECRA 2LM4A 3V6HA 5D46A 3I28A 4I2CA 4BWJA 1RYSA 4P2HA 3B0XA 2QB0B 3IG8A 2W54A 4ELVA 4XRHA 4Y2VA 2H3QA 3AQFA 3C23A 3IG5A 8ICWA 3H40A 4PHPA 1JXEA 1L5UA 2PI4A 4DL2A 3PSTA 2G5IB 2AU0A 1MA7A 4B9VA 4QNLA 5AM4A 1ZJMA 2NO5A 2RP5A 1D9FA 4NLNA 4R65A 1XWLA 5L1JA 1ZQNA 2AXTU 3EWAA 4UAZA 2J6TA 3ZI4A 2PFQA 1XU4A 2V9WA 2HHVA 5DLFA 2M9NA 3LK9A 4EELA 4DSIA 1DK3A 2B6GA 2MUTB 8ICTA 1F0MA 3PMNA 3M9NB 3HP6A 8ICPA 2CN1A 4Y2RA 4UW9A 1T3QA 2RHFA 1VLBA 3N28A 2VA2A 3OTQA 2Y1JA 5J8YA 5AKZA 3AL0B 1ZQIA 1X9WA 1T4GA 3E0FA 2LMRA 3RB6A 2KJ8A 5A0LA 4P4OA 2EZYA 2IHMA 1ZQHA 2B21A
chains in the Genus database with same CATH topology
3N7PD 3KFUF 1NZBA 4U7CA 3C28A 2HOQA 2CPRA 3N7RC 4ICAA 3M6ZA 3SMVA 3MGVA 2K8BB 4O3MA 2F76X 5C0YA 2LYBA 4P0QB 4OJLA 3ONNA 2KKVA 1ED1A 2PMZC 2JH7A 1A0PA 4ACOA 3O0FA 4NV0A 4BX9C 3H0RB 3C29A 2W7OA 3PSPA 2KEYA 2OYYA 4BJQA 4PL2A 2GOLA 3F2BA 2H3IA 3ICXA 4QIWF 3HKZC 2OH2A 3T79A 2HBMA 1XNSA 4WJ3B 4GFJA 3IG8A 1TAMA 1L6NA 2KJ5A 2OXOA 2K4EA 2R18A 4FZNA 3F5AA 2H3QA 2ZIWB 2K89A 3PZPA 3D2NA 2F8LA 3AQFA 3OPXA 2Y0SF 2JGAA 3IG5A 3N7SC 2JHDA 4P0QA 3PSFA 2KHVA 2DGZA 2YX8A 4QIWC 3GZFA 2MRLA 1YT3A 4NWIA 1PVQA 2Y0SC 3DEEA 2K8AA 2K8CB 3HKZF 5CRXA 2Q4TA 2HOFA 1GO3F 2E5SA 2G07A 2JMGA 2KD1A 4FE3A 4OJPA 4KX3A 3RF9A 3PSTA 2G5IB 2CRXA 4P0PA 2N1RA 2W04A 2Z7JA 1MA7A 5KL1B 2JH1A 4C0ZA 4QNLA 3LVVA 1T94A 5HR6A 2NV3A 2RP5A 5T14A 2H3FA 2M0NA 4CGZA 1SZHA 4FZMA 1Z19A 3D2QA 2WB1C 2XICA 2G0AA 3SAGA 1UPHA 2HBKA 4JMUA 2XI9A 3NRWA 4KMOB 4AYBF 3F2CA 3SQIA 1P7DA 1HIWA 2ZIUB 1IIPA 2HMXA 2KJ9A 2KHQA 2ZIWA 2DF4B 3IP4B 3GU3A 3F2DA 2HBJA 4OJ6A 1ECWA 2KIWA 2G06A 4CDGA 2WB1F 2VJ5A 3VC8A 1Q3UA 2XIDA 4NLCA 4PL1A 2G5HB 1Q3VA 1DRGA 4BUGA 3VCBA 2LYAA 2XVTA 2ZIUA 2LBOA 1Z1BA 3D2SA 2F2AB 1D8BA 2G08A 2D6FC 2H3VA 2YB4A 3CRXA 3PSIA 2VKQA 2WAQF 2OM6A 2RRDA 4QJFB 4CRXA 2K4IA 1CRXA 2HOIA 1URJA 2ZG6A 2ZXHA 3CP8A 2K4HA 4A8EA 2VIXA 4OO1J 2VJ4A 2G09A 2GH1A 2KVCA 2ZIVB 3M6KA 4U6PA 1WUDA 4OJ5A 2A3VA 3SAFA 2ZIXB 2PMZF 2ZIXA 1ZQ1C 5HR7A 2CN1A 3H0MB 3AQEA 2W03A 2KICA 1KBUA 2RHFA 3ALRA 2F77X 3CYMA 5KL8B 3KZXA 3M7DA 2DQNB 3AL0B 1HEKA 2H3ZA 2KNJA 3L3FX 3K1ZA 3LVWA 3F53A 2MA1A 3LYSA 2E1EA 1XO0A 1PVRA 3E0FA 2BDUA 1PVPA 4NLBA 3SAHA 2KV2A 3RFAA 2E1FA 2YB1A 2KJ8A 2KKPA 2LHTA 5A0LA 1OUQA 3IN5A 1F44A 2HBLA 3F5EA 4IC9A 2LKYA 4AYBC 4OJOA 4FZLA 2WAQC 4KX5A 1A6SA 2ZXIA 3NUQA 2W7PA 2ZIVA 4P0PB 2KOBA 3H0LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ F;  2WAQ F;  2WB1 F;  4AYB F;  3HKZ F;  2Y0S F; 
#chains in the Genus database with same CATH topology
 3RH4 A;  2UVV A;  5DB7 A;  3TAP A;  3QX7 A;  5J2J A;  1TKD A;  3Q8R B;  4GXJ A;  3PO4 A;  4C8L A;  4EZ9 A;  2YY6 A;  9ICI A;  3V72 A;  3NVV A;  2EAO A;  2A19 A;  3F2B A;  4PL2 A;  5L1L A;  4JUZ A;  4WJ3 B;  4F5Q A;  4DL7 A;  2K89 A;  3N7S C;  5DB6 A;  3FM9 A;  4RUC A;  5J2E A;  4TUR A;  1KEJ A;  4ECU A;  3HKZ F;  7ICJ A;  1ZQL A;  3RJH A;  1XSN A;  2JR5 A;  5DBA A;  5AI0 A;  2OHF A;  3BQ7 A;  5GTI U;  2RDI A;  5ALT A;  2ZTD A;  3PW7 A;  1LB2 B;  3RB4 A;  1TAQ A;  4JMU A;  3C2K A;  2GO7 A;  2PKE A;  5ALD A;  2G06 A;  5KG1 A;  4M0A A;  4RNM A;  2VJ5 A;  1TK0 A;  5JUM A;  1SV0 C;  4F4X A;  3G6Y A;  1UA1 A;  4YR2 A;  4F92 B;  3CP8 A;  4I2A A;  2QB0 A;  2JZB A;  2HW3 A;  3PW0 A;  1WCL A;  1BPB A;  4O3R A;  3KHL A;  2ATL A;  4J9S A;  3ALR A;  2RDJ A;  3QZ7 A;  3AM9 A;  2W9B A;  1Z4N A;  4J9O A;  5B66 U;  4EEK A;  3KHH A;  5KAI U;  4C8M A;  4F50 A;  4ECW A;  5ALI A;  5AM3 A;  2PI5 A;  1BPZ A;  2MSN A;  3BS5 B;  2E8N A;  1TE2 A;  1V38 A;  3IN5 A;  5HHI A;  4YMN A;  1QTM A;  3FAH A;  4G9B A;  4FZL A;  4OJO A;  3TI0 A;  3H0L B;  5D4B A;  5KG0 A;  1NZB A;  4BWM A;  4U7C A;  5AKG A;  4DFD A;  3MGV A;  4F5R A;  1JAL A;  5DLG A;  5EWE A;  1JN3 A;  1DGS A;  4BJQ A;  4DEZ A;  3PZP A;  3PX0 A;  2KHV A;  2YX8 A;  5ALV A;  2C2D A;  7ICU A;  4Q8E A;  2JEJ A;  3ETL A;  1KRP A;  1T7P A;  4C7Y A;  4JV1 A;  5DBC A;  5HR6 A;  3UM9 A;  3EPI A;  1A77 A;  4F4W A;  4NM2 A;  2HHU A;  1HUZ A;  3V7K A;  2YMQ A;  9ICT A;  2KIW A;  3Q8L A;  4Q43 A;  2Y9U A;  4DFP A;  4F4K A;  4QWA A;  2YB4 A;  2HDO A;  3PSI A;  5J2I A;  3ZDD A;  4XA5 A;  2K4I A;  3K4G A;  2HOI A;  2ZTE A;  3RH6 A;  3EZ5 A;  4KTQ A;  1PZN A;  2DWQ A;  9ICS A;  5ALU A;  4Y2T A;  7ICK A;  1ARO P;  3PV8 A;  3HT3 A;  5DGB A;  3TAR A;  3UQ0 A;  9ICA A;  3BQT A;  2BDU A;  4Z6D A;  5E79 U;  2HHT A;  4USA A;  1LKY B;  3RFA A;  8ICQ A;  4KLJ A;  1F44 A;  4UB5 A;  4IC9 A;  5ALR A;  2KOB A;  4RQ1 A;  4R64 A;  2BKE A;  5C0Y A;  5KT5 A;  4B9S A;  2C28 A;  2YQE A;  4JK1 A;  1N5X A;  2P35 A;  4DOA A;  3RJE A;  4NL9 A;  2KEY A;  1IV8 A;  4IRD A;  4KLG A;  4MFC A;  4UAR A;  4P0Q A;  2JGA A;  3PSF A;  4QWB A;  3PW5 A;  3TAQ A;  5J2G A;  3BQ2 A;  4J9Q A;  1KLN A;  1ZQS A;  4KLU A;  1K1Q A;  3OSP A;  2KG5 A;  2YML A;  5J2B A;  3LVV A;  1NZP A;  2QLT A;  2ZUD A;  4YD1 A;  3IV6 A;  4C4T A;  3A0B U;  2F1I A;  5L9X A;  4G3I A;  1S10 A;  1PUZ A;  1BPX A;  1NJZ A;  4PHE A;  2W8K A;  2PFN A;  4ECZ A;  4GXK A;  2QB1 A;  4BXO A;  4O5K A;  1EXN A;  1BVS A;  5KFT A;  4J03 A;  1M6Y A;  2KVS A;  1S9F A;  4QWD A;  1S76 D;  1CRX A;  1KL9 A;  1VDV A;  3RH5 A;  3MR2 A;  3UPQ A;  1ZRM A;  3OSN A;  3BQ1 A;  2XY7 A;  4DOB A;  4NM1 A;  5J0U A;  3GIL A;  4KLI A;  1WWV A;  2Y9T A;  3SV3 A;  9ICO A;  1ZQZ A;  2FLN A;  4B9T A;  4CNQ A;  1SKR A;  2H3Z A;  3L3F X;  2MA1 A;  1XO0 A;  5J0Y A;  2KZ3 A;  1TVA A;  3RRG A;  3H4D A;  2JEG A;  3QYP A;  1BPD A;  3NRZ A;  4DF8 A;  4QZA A;  4DCC A;  1FIQ A;  2ZXI A;  3NVZ A;  1X6J A;  4I2D A;  3LWM A;  3T5J A;  3AEV A;  5BOL A;  4EBD A;  4HYK A;  1YZ6 A;  4O9M A;  1RQL A;  4O3O A;  4Y2S A;  2C22 A;  2PMZ C;  1ZQW A;  5AI6 A;  4ACO A;  5KT3 A;  3EUB 2;  2F1J A;  3ICX A;  4QIW F;  5KFI A;  2YN4 A;  4R66 A;  4FO6 A;  1ZQP A;  2ZTC A;  2OXO A;  1NK7 A;  9ICN A;  3RAQ A;  3SAF A;  1RDF A;  3Q8Q B;  1O08 A;  5AKL A;  3I76 A;  4DS5 A;  1COK A;  1DK2 A;  4MHV A;  3PML A;  2G07 A;  4JV2 A;  3HRD D;  5KFP A;  2W04 A;  4E0D A;  7ICP A;  2RQ5 A;  8ICB A;  4F3O A;  3E2E A;  1L8O A;  4KLF A;  2F8K A;  2HBK A;  4UB2 A;  3QZ8 A;  4UB6 U;  2P66 A;  4ECT A;  1ECW A;  5AKY A;  3HW8 A;  4YD2 A;  1SB3 C;  3T5L A;  3PY8 A;  2BCV A;  1YZ7 A;  5BPC A;  2H3V A;  5KG6 A;  4F8R A;  2VKQ A;  5EE9 A;  2RRD A;  3SI8 A;  2K4P A;  4KLO A;  3GQC A;  3C2L A;  4Z6F A;  4YMM A;  4EBC A;  2XCA A;  5DG9 A;  1RQN A;  2ZIV B;  2NRZ A;  2PMZ F;  3SEN A;  4RQ0 A;  5EE3 A;  2W03 A;  4BGD A;  5KT7 A;  4UBC A;  1SL1 A;  4UB4 A;  5KFU A;  1AQ6 A;  4ED0 A;  1SXD A;  3WKA A;  1U47 A;  4KN7 A;  4NLB A;  3AMZ A;  7ICH A;  4GIB A;  2LHT A;  5AHX A;  3N97 B;  1OUQ A;  1Q8K A;  2HBL A;  1BNP A;  5KFV A;  5CHG A;  2BQU A;  3QUT A;  4JWN A;  5J2A A;  4TQR A;  2BPF A;  1LVH A;  3MDC A;  2XCP A;  1D9D A;  4YN4 A;  4EBE A;  4RQ2 A;  5KFE A;  2K4E A;  5KFN A;  3L4P A;  4I27 A;  3GV8 B;  4YFK A;  2LI6 A;  3M8R A;  2ZUB A;  1PVQ A;  4QZ8 A;  4PZN A;  4F5N A;  4MF2 A;  1RZT A;  4I2F A;  2WF5 A;  4F72 A;  1N5W A;  4X5V A;  2NRT A;  5KFJ A;  2L5Y A;  2W8L A;  1ZQU A;  5J0O A;  1V97 A;  5T14 A;  4F2S A;  4CGZ A;  2XIC A;  4PHA A;  4I2B A;  5F9N A;  4CF3 A;  2AJQ A;  3QEB Z;  1UPH A;  1UQV A;  1QLN A;  4O3Q A;  3SQI A;  4KMO B;  1NNL A;  2R8G A;  5B5E U;  3GIJ A;  8ICC A;  4RQ5 A;  4RQ6 A;  2WB1 F;  4AP9 A;  1T8E A;  3T3F A;  4RQ3 A;  2NRX A;  4NXZ A;  2OEH A;  1Q3V A;  1Z1B A;  4J9L A;  4CE6 A;  1ZD5 A;  4QJF B;  4YCX A;  3JPS A;  2W9B B;  1BNO A;  2VJ4 A;  3PX6 A;  4EYH B;  4EEY A;  1XSL A;  2PXI A;  3M8S A;  3QU5 A;  5KFX A;  1Y88 A;  8ICS A;  3QXG A;  4DFM A;  4B9U A;  3NVW A;  9ICE A;  1WYG A;  2HCF A;  3KZX A;  9ICG A;  3QUQ A;  3LVW A;  2IHN A;  4M9N A;  5AI5 A;  1XC9 A;  5HMM A;  4IL6 U;  2DBY A;  2ISO A;  3H7I A;  4J9K A;  1L3S A;  2AQ4 A;  3AU2 A;  1Q46 A;  4KLS A;  2JZB B;  5KFO A;  4Q45 A;  2FPM A;  3EYZ A;  2HOQ A;  3SMV A;  2EDU A;  3KHG A;  4C7Z A;  5J0T A;  1KN5 A;  4C80 A;  5L1M A;  3B9J A;  3UXN A;  1ZQC A;  4C4R A;  5KFW A;  2OYY A;  1RPL A;  1TAM A;  2I5H A;  4O3N A;  4UAV A;  4DFK A;  2F8L A;  1NK0 A;  1JI7 A;  2JV3 A;  1JX4 A;  1S0V A;  3UXP A;  2FPK A;  1ZD3 A;  4NLZ A;  7ICL A;  4UAS A;  1NKE A;  3GDX A;  1S0M A;  4EX6 A;  4IRK A;  4US9 A;  3SR6 A;  2KFN A;  5KL1 B;  1BPY A;  4LJX A;  4NLK A;  4EYI B;  5KFB A;  4RQM A;  3SAG A;  2JRZ A;  2LM1 A;  4LVS A;  2J6U A;  2HMX A;  4TQS A;  3MR5 A;  4CDG A;  3TFR A;  4NLC A;  4O5E A;  2D3D A;  3WK7 A;  3GIM A;  2K60 A;  2ES6 A;  1X40 A;  2R8H A;  2FMP A;  3AUO A;  2ZIU A;  2LBO A;  1SZP A;  5AK6 A;  4PGQ A;  3DV9 A;  4B9N A;  7ICN A;  1QQ7 A;  8ICY A;  4OO1 J;  5IIM A;  8ICH A;  2GH1 A;  2KVC A;  3WU2 U;  4RPX A;  3ISD A;  4F93 B;  5KG4 A;  4QW8 A;  5KFD A;  3JPR A;  5CB1 A;  1HUO A;  2I6X A;  3OGU A;  3AQE A;  3RR7 A;  4RNO A;  4ECX A;  3QU4 A;  2IOH A;  1KSP A;  2FI1 A;  1RXW A;  5AKJ A;  4ELT A;  3C21 A;  3LYS A;  4DL4 A;  3L5K A;  4DQR A;  4C8K A;  4IQU A;  4NL9 C;  2GWS A;  4QWC A;  4TUS A;  2YB1 A;  3PR5 B;  2GLE A;  2LKY A;  3GV5 B;  5AKK A;  3MBY A;  2A1J B;  2ODG A;  4EEN A;  2P6U A;  4XQ8 A;  5DB8 A;  1ZJN A;  1MN8 A;  8ICN A;  1ZD4 A;  4IQV A;  3ISC A;  2P6R A;  1ZQD A;  2MUT A;  1U48 A;  4M04 A;  2W9A A;  3G6X A;  1HJP A;  2F44 A;  2LYB A;  4CF4 A;  1PK3 A;  4P0Q B;  1X66 A;  1Z4O A;  4BX9 C;  1WCN A;  2YMM A;  2DL0 A;  5KG7 A;  5HHH A;  2R18 A;  4FZN A;  5CRX A;  9ICJ A;  3OPX A;  4ECS A;  5L1K A;  2DGZ A;  2EZZ A;  5CA7 A;  4QIW C;  3NVY A;  4DSF A;  8ICM A;  2E8P A;  2K8A A;  1SV0 A;  2E5S A;  2WTF A;  4DQI A;  4KIT B;  2NV3 A;  4KN4 A;  5ALY A;  3RJI A;  4FZM A;  4HAI A;  3PVX A;  2BCQ A;  2WB1 C;  4DL3 A;  1ZQR A;  2FPL A;  1P7D A;  4DFJ A;  1ZRN A;  2FDR A;  5CP2 A;  5DDM A;  2HBJ A;  4I2J A;  4RQ8 A;  2W3S A;  3SYZ A;  1Q3U A;  3BS7 A;  1LV5 A;  2KIV A;  1UT5 A;  8ICA A;  5III A;  2BDP A;  2A1A A;  1RXV A;  5IIO A;  5KAF U;  3CW2 C;  4MFF A;  1KTQ A;  2UVU A;  1URJ A;  2Q0Z X;  4BXO B;  1RYR A;  5KFG A;  4DQQ A;  2A3V A;  4UAY A;  2DFL A;  7ICT A;  5IIN A;  3C5F A;  1BGX T;  2F77 X;  1XS9 D;  4LZG A;  3OHA A;  2DQN B;  4FS2 A;  4OCZ A;  3JPQ A;  1NOM A;  3EW9 A;  4O3S A;  3M9O B;  3KFU F;  4QZE A;  9ICM A;  5KG2 A;  2KK0 A;  2VAN A;  2V4R A;  5ALM A;  3FDS A;  5CR0 A;  4UAW A;  3Q8P B;  4NV0 A;  2F1H A;  3ZDB A;  1QSY A;  3C1Z A;  4YR0 A;  9ICP A;  3V7J A;  3WK9 A;  4M9H A;  1IXR A;  3H8M A;  9ICX A;  3F5A A;  2Y0S F;  1NI3 A;  2JHD A;  2IBK A;  4RT2 A;  2MRL A;  2Y0S C;  3DEE A;  5J0Q A;  2DKZ A;  2K8C B;  7ICM A;  4PGY A;  2KD1 A;  3Q8M A;  3T5K A;  2NO4 A;  2Z7J A;  2XC9 A;  4M9J A;  1S0O A;  1OXJ A;  2CXY A;  5AIB A;  1WG8 A;  2XI9 A;  2ZIU B;  2KJ9 A;  4Y2X A;  2AGQ A;  5TZV A;  4EZ6 A;  7ICF A;  4F5P A;  5AI8 A;  5KT4 A;  3TFS A;  2KSO A;  1KQQ A;  2W9M A;  2D6F C;  5AM0 A;  4PHD A;  1TK5 A;  1NK6 A;  2VA3 A;  2KZZ A;  3TQ1 A;  4YR3 A;  3TKA A;  4CRX A;  4M6W B;  4MEX A;  5ALF A;  4Y2P A;  3ED5 A;  7ICR A;  2ZJ8 A;  1QQ6 A;  4DLE A;  5AKE A;  4JV0 A;  3NAS A;  3BQ0 A;  2BHN A;  1Z3E B;  5AK3 A;  5J0X A;  4ECV A;  1Z1V A;  3F53 A;  2FMS A;  4QW9 A;  2JXJ A;  2E8M A;  4F4Y A;  3Q8S B;  3SAH A;  8ICF A;  5KFL A;  2DKX A;  5F9L A;  1CUK A;  4DSJ A;  1DOQ A;  3NUQ A;  5KFY A;  2ZIV A;  4Z6E A;  9ICB A;  1B4F A;  2FMQ A;  4OJ5 A;  4KLL A;  5AIC A;  1V85 A;  1X2I A;  1B0X A;  4C8O A;  4O3M A;  5K4L A;  1T3N A;  9ICC A;  5KFQ A;  4RZR A;  2YTU A;  4NJ8 A;  1PK1 A;  2YMP A;  2XGQ A;  2JEF A;  3PSP A;  4RU9 A;  4DF4 A;  5KFH A;  3G6V A;  4DOC A;  2BPG A;  4PPX A;  1KDH A;  2OCE A;  2NRW A;  3NTU A;  4QZB A;  5J2K A;  4RPY A;  3GV7 B;  2ZIW B;  2ESE A;  1PVR A;  1S5L U;  1COO A;  2F3N A;  5F3X B;  2ASL A;  1V9P A;  4QZG A;  4GXI A;  1JXL A;  1TFR A;  1SXE A;  1YT3 A;  4Y2Q A;  3LWL A;  2JMG A;  4OJP A;  5AM5 A;  8ICK A;  4QZC A;  4B6J A;  4P0P A;  5IIL A;  1L3U A;  4Y2U A;  5JTI A;  4TUP A;  1Z19 A;  2HVH A;  3JPO A;  5BOM A;  5J2H A;  1K1S A;  1JUD A;  2BQR A;  3H8J A;  2R8K A;  5DKW A;  1J97 A;  1XSP A;  4OJ6 A;  1TAU A;  4J9M A;  5ALX A;  3M9M B;  2QAR A;  5ALL A;  4YMO A;  5L1I A;  1QQ5 A;  1NK5 A;  1N62 A;  2OM6 A;  3QU9 A;  1XO1 A;  4KLM A;  4JB3 A;  5ALK A;  1Z00 B;  4O0I A;  7ICE A;  1UA0 A;  2G09 A;  4IQW A;  5KG5 A;  2WHE A;  5DG8 A;  9ICH A;  7ICS A;  2Y1I A;  7ICO A;  2LPE A;  1ZD2 P;  1HEK A;  4RQN A;  1NK9 A;  4KLQ A;  5AKI A;  1JIH A;  3BZK A;  1IM4 A;  1FFU A;  1PVP A;  2WF6 A;  4FS1 A;  1ZQV A;  3UMB A;  3V7L A;  2PFO A;  1FO4 A;  1MQ3 A;  5KTQ A;  2WAQ C;  4UQG A;  1S97 A;  5ALN A;  2IMW P;  3MGI A;  3C28 A;  4F5O A;  1SV4 A;  3KKA A;  1SIJ A;  2EZX A;  1ZQG A;  4Y2Y A;  2W3R A;  2GOL A;  2BZF A;  2HHX A;  2QAR B;  3MDA A;  3HIL A;  1L7P A;  3C2M A;  2KJ5 A;  9ICK A;  3Q8K A;  3D2N A;  5KFM A;  1JMS A;  5HP4 A;  5ALG A;  1RM6 C;  2DPI A;  5AK4 A;  3RTV A;  2EAN A;  4IR1 A;  3MFH A;  4DSL A;  3WKD A;  3ETR A;  3MGH A;  5AI4 A;  5ALQ A;  2E3T A;  2ZJ5 A;  3RB3 A;  3PNC A;  3MR6 A;  2E8O A;  3TAD A;  3ISB A;  1K5O A;  4UB3 A;  1X9S A;  4ED1 A;  3VC8 A;  1ZQQ A;  1B43 A;  1RG6 A;  4PL1 A;  1F5S A;  3KTQ A;  1SL2 A;  4MEY A;  5DQH A;  7ICG A;  1WWU A;  3TAC B;  2AH5 A;  2ZXH A;  4A8E A;  3PR4 A;  3M6K A;  1D8Y A;  1IG6 A;  2EQY A;  4YVZ A;  3OJS A;  4ED6 A;  4RT3 A;  3M7D A;  5D49 A;  2KE7 A;  3C5G A;  2ZUC A;  2DPJ A;  3K1R B;  5G5H A;  3KBB A;  1J2M A;  1U4B A;  1ZQO A;  3HWT A;  5AKX A;  3LDA A;  2BCR A;  2KKP A;  4CF5 A;  4AYB C;  1L3T A;  1CI4 A;  3OJU A;  5KT6 A;  2W7P A;  4P0P B;  9ICW A;  1KKX A;  4M6W A;  3KOO A;  7ICV A;  1S8O A;  2UVR A;  3NGD A;  2ASJ A;  3I1Y A;  4P4M A;  2I9G A;  2HSZ A;  5AM1 A;  2JH7 A;  4ED8 A;  3C29 A;  1L8L A;  1NK8 A;  4KLD A;  2I1Q A;  1XNS A;  4GFJ A;  5DQG A;  4J9N A;  1N60 A;  1LKY A;  3FYH A;  3BZC A;  4FBT A;  2HHS A;  5J2F A;  3NS1 A;  4NWI A;  5KFC A;  4TUQ A;  2JH1 A;  5FP0 A;  2G0A A;  4DQP A;  3RR8 A;  3F2C A;  2HHW A;  3F2D A;  1UCV A;  3IP4 B;  3GFK B;  1N63 A;  1KFS A;  1L7O A;  3MAB A;  1L3V A;  2QKQ A;  5EOZ A;  4BUG A;  2XGP A;  4P4P A;  2LYA A;  4I29 A;  1D8B A;  1DGJ A;  2KFZ A;  2F2A B;  3H8S A;  4Y2J A;  3EPG A;  4F4Z A;  1ZQJ A;  5ALH A;  1U45 A;  2K4H A;  2VIX A;  3KD3 A;  1ZQK A;  2J6S A;  4FBU A;  4CCH A;  5IIK A;  2BR0 A;  1ZQ1 C;  1L7M A;  3TAD C;  3H4B A;  4M9L A;  1KBU A;  4KLE A;  1SL0 A;  3S6J A;  2C2E A;  3IHQ B;  8ICI A;  3KHR A;  2E1E A;  5CWR A;  3WK4 A;  1TK8 A;  5HNK A;  2KV2 A;  2WF9 A;  2O6K A;  3F5E A;  5KFR A;  3THV A;  4PGX A;  3K75 D;  8ICV A;  3BDP A;  3SZ2 A;  8ICX A;  2XY6 A;  2F76 X;  2H5X A;  4F71 A;  3QUB A;  4OJL A;  2KKV A;  2FLP A;  1SGG A;  3H0R B;  4R8U B;  1S0N A;  3QNM A;  4K4I A;  4YQW A;  3T79 A;  2HBM A;  4IQT A;  4FFD A;  2JEI A;  2KP7 A;  2EH9 A;  3T5H A;  3RAX A;  2A1J A;  1NKC A;  1KFD A;  5CJ7 A;  4UB1 A;  3WK8 A;  8ICG A;  1ZQA A;  4M47 A;  1ZQF A;  3WK6 A;  2N1R A;  3FC4 A;  4NY8 A;  5KNI A;  1SZH A;  5JRT A;  3ZDC A;  5AKH A;  1U9L A;  1HIW A;  1J2N A;  2ZIW A;  2DF4 B;  1N2X A;  3GU3 A;  2BGW A;  3RRH A;  1SKW A;  2XID A;  2G5H B;  3VCB A;  2XVT A;  2WF8 A;  4DWI A;  3IRU A;  4DL5 A;  3SV4 A;  3C1Y A;  3WKB A;  5KFF A;  2KSO B;  5AM2 A;  1MSW D;  4OD0 A;  1A76 A;  1NK4 A;  4DQS A;  1ZOL A;  4I28 A;  2ZJA A;  4YXM A;  4LZD A;  1ZQY A;  1U49 A;  5ALE A;  4RQ4 A;  3QE9 Y;  3RJF A;  5TIS U;  3UMG A;  4JWM A;  4RPZ A;  3TAN A;  5EWF A;  3H8W A;  3D6J A;  2E1F A;  1X42 A;  5KFA A;  4KX5 A;  5EE1 A;  4EX7 A;  3JPN A;  3N7P D;  4RNN A;  5AI9 A;  2BPC A;  4K4G A;  3M6Z A;  9ICV A;  2K8B B;  2C2R A;  1MC8 A;  5J0S A;  1C20 A;  3DDH A;  4IR9 A;  5ALS A;  1QH9 A;  2H3I A;  3SD7 A;  4I2I A;  2MAX A;  1GO3 F;  3RF9 A;  4KX3 A;  4RQ7 A;  1NKB A;  4ECQ A;  2CRX A;  4GC6 A;  5J2C A;  3RBD A;  8ICZ A;  3D2Q A;  8ICE A;  1N61 A;  1B22 A;  2XO7 A;  3N4M B;  4AYB F;  2KHQ A;  2IOF A;  5DGA A;  2W55 A;  7ICQ A;  9ICF A;  2HI0 A;  4DO9 A;  5AK5 A;  4DL6 A;  4M9G A;  4UAU A;  8ICJ A;  1SWV A;  2FJ6 A;  3R9K A;  1DRG A;  4QZD A;  2ALZ A;  3ZDA A;  2G08 A;  3E58 A;  4Z6C A;  3CRX A;  3AN1 A;  5EE0 A;  3UXO A;  3M1Y A;  2HHQ A;  4UB8 U;  3WK5 A;  4R63 A;  3JPT A;  4QZF A;  8ICR A;  1JRP A;  2B0C A;  3H0M B;  4ZOH C;  5KL8 B;  3V6J A;  3QEA Z;  5ALO A;  9ICQ A;  2HVI A;  4ECY A;  2KNJ A;  3QU2 A;  5AIA A;  5KG3 A;  3IDW A;  5KFS A;  4C4S A;  4B9M A;  1ZQX A;  1BPE A;  3CNH A;  5ALP A;  4QZH A;  4GLX A;  3N7R C;  1O03 A;  4O3P A;  4ELU A;  4J9R A;  3ONN A;  5H2F U;  4I2H A;  1ZQM A;  1A0P A;  3ZD9 A;  2W7O A;  4MFA A;  1Z00 A;  3HKZ C;  3KZI U;  3U26 A;  1L6N A;  4RUA A;  2R8I A;  1S77 D;  2RLT A;  4ED2 A;  3PW4 A;  5J2D A;  1TV9 A;  1ZYQ A;  4PH5 A;  5KFZ A;  1QSS A;  3GII A;  1NJX A;  4DLG A;  2HOF A;  1JRO A;  4FE3 A;  3MC1 A;  4O5C A;  4UBB A;  2NRV A;  4C0Z A;  1SKS A;  4XUS A;  4BDP A;  5DQI A;  3RBE A;  2FLL A;  3PX4 A;  4F2R A;  1DXS A;  1KW4 A;  4M2Y A;  4YG2 A;  5KFK A;  2FE9 A;  3RJK A;  1FEZ A;  2WFA A;  1PK1 B;  3D2S A;  3GIK A;  2WAQ F;  2DUY A;  2ZG6 A;  1QSL A;  2XY5 A;  9ICL A;  4DSK A;  4IS7 A;  4KMU A;  2AHO B;  2W43 A;  2LYH A;  3ZDE A;  1WUD A;  3QUC A;  4U6P A;  4Q8F A;  5DDY A;  1VJ5 A;  4UAT A;  4QZ9 A;  5J0W A;  2AQ0 A;  2IA6 A;  4US8 A;  3MFI A;  3CYM A;  2NYV A;  3IM1 A;  5J29 A;  2W11 A;  3ORY A;  1H38 A;  4NLG A;  1X9M A;  1X9X A;  1C7Y A;  1A6S A;  3JPP A;  4QWE A;  2EAP A;  4KLH A;  4MF8 A;  3SEI A;  4GC7 A;  5DG7 A;  2CPR A;  4ICA A;  2BCS A;  4J9P A;  2KMD A;  4ZH4 A;  1KFT A;  2R8J A;  1ED1 A;  3PW2 A;  3O0F A;  1N48 A;  4I2G A;  5JU5 A;  3RJJ A;  4KLT A;  9ICR A;  5ALW A;  5DB9 A;  1UHU A;  3RB0 A;  7ICI A;  2V4Q A;  4K4H A;  5EWG A;  3HPO A;  1ZQB A;  3UMC A;  2UVW A;  2KN7 A;  5G5G A;  2KZM A;  4Q44 A;  3GZF A;  2IOF K;  5IIJ A;  4ED7 A;  1N56 A;  2Q4T A;  1SWW A;  3B0Y A;  1QCK A;  3A0H U;  5KT2 A;  1ZXI A;  1T94 A;  2H3F A;  2M0N A;  5DBB A;  1FFV A;  1NJY A;  4DS4 A;  4B9L A;  2BQ3 A;  1L7N A;  4QZI A;  3QU7 A;  2OH2 A;  3NRW A;  1IIP A;  5J8Y C;  5ALJ A;  3UQ2 A;  3J81 j;  2VA8 A;  2EAM A;  3OHB A;  2ASD A;  3BS5 A;  2BCU A;  2MU2 A;  1UT8 A;  1CEZ A;  5C5J A;  5J0P A;  3HX0 A;  1D8L A;  3WKC A;  2W9C B;  3BJY A;  1MQ2 A;  4F91 B;  3KKA C;  4PJ0 U;  5CEH A;  4C8N A;  1NJW A;  2ISP A;  2WF7 A;  4YP3 A;  5HML A;  4ED3 A;  1ZET A;  2ZIX B;  2ZIX A;  3WKE A;  3RJG A;  5HR7 A;  2PFP A;  1ZQT A;  4YXJ A;  9ICU A;  2KIC A;  4IRC A;  2AGO A;  3MR3 A;  5GTH U;  1X6I A;  3PO5 A;  3K1Z A;  1OW5 A;  2W9C A;  8ICU A;  4PZO A;  2D8C A;  5ALZ A;  2AGP A;  2OWO A;  1ZQE A;  3HJE A;  3ZD8 A;  3V6K A;  3AU6 A;  8ICO A;  2KTQ A;  4R8U A;  4DSE A;  1RYU A;  8ICL A;  4I2E A;  5J0R A;  4ECR A;  2LM4 A;  3V6H A;  5D46 A;  3I28 A;  4I2C A;  4BWJ A;  1RYS A;  4P2H A;  3B0X A;  2QB0 B;  3IG8 A;  2W54 A;  4ELV A;  4XRH A;  4Y2V A;  2H3Q A;  3AQF A;  3C23 A;  3IG5 A;  8ICW A;  3H40 A;  4PHP A;  1JXE A;  1L5U A;  2PI4 A;  4DL2 A;  3PST A;  2G5I B;  2AU0 A;  1MA7 A;  4B9V A;  4QNL A;  5AM4 A;  1ZJM A;  2NO5 A;  2RP5 A;  1D9F A;  4NLN A;  4R65 A;  1XWL A;  5L1J A;  1ZQN A;  2AXT U;  3EWA A;  4UAZ A;  2J6T A;  3ZI4 A;  2PFQ A;  1XU4 A;  2V9W A;  2HHV A;  5DLF A;  2M9N A;  3LK9 A;  4EEL A;  4DSI A;  1DK3 A;  2B6G A;  2MUT B;  8ICT A;  1F0M A;  3PMN A;  3M9N B;  3HP6 A;  8ICP A;  2CN1 A;  4Y2R A;  4UW9 A;  1T3Q A;  2RHF A;  1VLB A;  3N28 A;  2VA2 A;  3OTQ A;  2Y1J A;  5J8Y A;  5AKZ A;  3AL0 B;  1ZQI A;  1X9W A;  1T4G A;  3E0F A;  2LMR A;  3RB6 A;  2KJ8 A;  5A0L A;  4P4O A;  2EZY A;  2IHM A;  1ZQH A;  2B21 A; 
#chains in the Genus database with same CATH homology
 3N7P D;  3KFU F;  1NZB A;  4U7C A;  3C28 A;  2HOQ A;  2CPR A;  3N7R C;  4ICA A;  3M6Z A;  3SMV A;  3MGV A;  2K8B B;  4O3M A;  2F76 X;  5C0Y A;  2LYB A;  4P0Q B;  4OJL A;  3ONN A;  2KKV A;  1ED1 A;  2PMZ C;  2JH7 A;  1A0P A;  4ACO A;  3O0F A;  4NV0 A;  4BX9 C;  3H0R B;  3C29 A;  2W7O A;  3PSP A;  2KEY A;  2OYY A;  4BJQ A;  4PL2 A;  2GOL A;  3F2B A;  2H3I A;  3ICX A;  4QIW F;  3HKZ C;  2OH2 A;  3T79 A;  2HBM A;  1XNS A;  4WJ3 B;  4GFJ A;  3IG8 A;  1TAM A;  1L6N A;  2KJ5 A;  2OXO A;  2K4E A;  2R18 A;  4FZN A;  3F5A A;  2H3Q A;  2ZIW B;  2K89 A;  3PZP A;  3D2N A;  2F8L A;  3AQF A;  3OPX A;  2Y0S F;  2JGA A;  3IG5 A;  3N7S C;  2JHD A;  4P0Q A;  3PSF A;  2KHV A;  2DGZ A;  2YX8 A;  4QIW C;  3GZF A;  2MRL A;  1YT3 A;  4NWI A;  1PVQ A;  2Y0S C;  3DEE A;  2K8A A;  2K8C B;  3HKZ F;  5CRX A;  2Q4T A;  2HOF A;  1GO3 F;  2E5S A;  2G07 A;  2JMG A;  2KD1 A;  4FE3 A;  4OJP A;  4KX3 A;  3RF9 A;  3PST A;  2G5I B;  2CRX A;  4P0P A;  2N1R A;  2W04 A;  2Z7J A;  1MA7 A;  5KL1 B;  2JH1 A;  4C0Z A;  4QNL A;  3LVV A;  1T94 A;  5HR6 A;  2NV3 A;  2RP5 A;  5T14 A;  2H3F A;  2M0N A;  4CGZ A;  1SZH A;  4FZM A;  1Z19 A;  3D2Q A;  2WB1 C;  2XIC A;  2G0A A;  3SAG A;  1UPH A;  2HBK A;  4JMU A;  2XI9 A;  3NRW A;  4KMO B;  4AYB F;  3F2C A;  3SQI A;  1P7D A;  1HIW A;  2ZIU B;  1IIP A;  2HMX A;  2KJ9 A;  2KHQ A;  2ZIW A;  2DF4 B;  3IP4 B;  3GU3 A;  3F2D A;  2HBJ A;  4OJ6 A;  1ECW A;  2KIW A;  2G06 A;  4CDG A;  2WB1 F;  2VJ5 A;  3VC8 A;  1Q3U A;  2XID A;  4NLC A;  4PL1 A;  2G5H B;  1Q3V A;  1DRG A;  4BUG A;  3VCB A;  2LYA A;  2XVT A;  2ZIU A;  2LBO A;  1Z1B A;  3D2S A;  2F2A B;  1D8B A;  2G08 A;  2D6F C;  2H3V A;  2YB4 A;  3CRX A;  3PSI A;  2VKQ A;  2WAQ F;  2OM6 A;  2RRD A;  4QJF B;  4CRX A;  2K4I A;  1CRX A;  2HOI A;  1URJ A;  2ZG6 A;  2ZXH A;  3CP8 A;  2K4H A;  4A8E A;  2VIX A;  4OO1 J;  2VJ4 A;  2G09 A;  2GH1 A;  2KVC A;  2ZIV B;  3M6K A;  4U6P A;  1WUD A;  4OJ5 A;  2A3V A;  3SAF A;  2ZIX B;  2PMZ F;  2ZIX A;  1ZQ1 C;  5HR7 A;  2CN1 A;  3H0M B;  3AQE A;  2W03 A;  2KIC A;  1KBU A;  2RHF A;  3ALR A;  2F77 X;  3CYM A;  5KL8 B;  3KZX A;  3M7D A;  2DQN B;  3AL0 B;  1HEK A;  2H3Z A;  2KNJ A;  3L3F X;  3K1Z A;  3LVW A;  3F53 A;  2MA1 A;  3LYS A;  2E1E A;  1XO0 A;  1PVR A;  3E0F A;  2BDU A;  1PVP A;  4NLB A;  3SAH A;  2KV2 A;  3RFA A;  2E1F A;  2YB1 A;  2KJ8 A;  2KKP A;  2LHT A;  5A0L A;  1OUQ A;  3IN5 A;  1F44 A;  2HBL A;  3F5E A;  4IC9 A;  2LKY A;  4AYB C;  4OJO A;  4FZL A;  2WAQ C;  4KX5 A;  1A6S A;  2ZXI A;  3NUQ A;  2W7P A;  2ZIV A;  4P0P B;  2KOB A;  3H0L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...