2KD1A

Solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
b'MEPSKLSYGEYLESWFNTKRHSVGIQTAKVLKGYLNSRIIPSLGNIKLAKLTSLHMQNYVNSLRDEGLKRGTIEKIIKVIRNSLEHAIDLELITKNVAAKTKLPKADKEELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA integration/recombination/invertion protein
molecule tags Structural genomics, unknown function
source organism Bacillus cereus atcc 14579
publication title Solution NMR Structure of the Integrase-Like Domain from Bacillus cereus Ordered Locus BC_1272. Northeast Structural Genomics Consortium Target BcR268F.
rcsb
total genus 37
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kd1A00
3CRXA 2KJ8A 1DRGA 2OXOA 1Q3UA 2KD1A 2KHVA 1PVRA 1PVPA 1KBUA 2KJ9A 1P7DA 1F44A 2A3VA 2KEYA 2HOIA 3C29A 3MGVA 2KKPA 1XO0A 4A8EA 1A0PA 2HOFA 3C28A 1OUQA 2KKVA 1MA7A 2KJ5A 2KOBA 1CRXA 2KHQA 5CRXA 1PVQA 1Q3VA 4ACOA 2KIWA 2CRXA 1Z1BA 1XNSA 1Z19A 3LYSA 3NRWA 4CRXA 1NZBA
chains in the Genus database with same CATH superfamily
2RP5A 3QUCA 4PHAA 5L1LA 3PSPA 2BCRA 3LVWA 2ASJA 3C28A 2RLTA 1ZOLA 4DF4A 3FDSA 3HW8A 2W03A 4UBBA 4QZDA 2ISOA 4KLEA 3QNMA 2Y9TA 4UB1A 2RDJA 2W43A 4G3IA 4ECUA 4QZEA 4PL2A 2HHQA 1NK7A 1X9SA 5AI5A 5F3XB 3H4BA 4USAA 2FMPA 3C5FA 2I1QA 2FMSA 5ALXA 2WFAA 5AK4A 4G9BA 5DDMA 4NWIA 2WAQC 2F76X 1N56A 2JV3A 1ZQWA 5KG0A 4BWMA 2HMXA 3H8SA 1U47A 3MC1A 3WK8A 5KFBA 3M9OB 1KFTA 3QEBZ 3Q8KA 1X6IA 8ICLA 2XGQA 1IV8A 4RQ3A 8ICWA 2QKQA 4GC6A 4UB6U 3D6JA 4ED1A 2LM4A 5AKXA 3WK6A 2IBKA 9ICFA 5D46A 1ZQJA 4C4TA 5DQGA 4JB3A 3C5GA 9ICCA 1HUZA 3EYZA 3WKDA 5KFXA 4UB4A 3MDCA 3ISBA 5KFDA 1D9DA 2I9GA 4YD1A 3M9NB 2KNJA 4RQMA 5J8YC 5J2FA 4QZHA 2W9BA 4R8UB 2IA6A 1JXLA 1ZQRA 2AQ0A 1S8OA 4KX5A 1SL0A 3PMNA 2CN1A 1U4BA 2M0NA 4K4IA 5HMMA 5KFTA 1NZPA 1U49A 4BUGA 1UQVA 5CP2A 9ICUA 2W8KA 2ZJ5A 4RPXA 1Y88A 1NJZA 3F2DA 4I2JA 3C21A 4IRCA 2YN4A 3U26A 3RBDA 2OHFA 4NLZA 9ICIA 1MQ2A 3KHLA 3GILA 5IINA 9ICAA 2A19A 7ICKA 5AI8A 1ED1A 2R8IA 1TVAA 4KLHA 8ICBA 4ED0A 4FBUA 3I28A 1KRPA 9ICXA 5HHHA 2ES6A 3GIKA 2ZIVA 2XCPA 1N62A 2JMGA 3HILA 3PZPA 5KFMA 3C2MA 4LZGA 4UB5A 2AU0A 4JWMA 2WAQF 4Y2TA 4YMNA 4AP9A 3H0RB 5J2DA 5AK5A 5D49A 1ZQBA 9ICJA 4PHPA 4UB3A 4EENA 1HJPA 3ZDDA 2M9NA 1VLBA 1NJYA 3IG8A 4NL9C 1SL1A 3GIIA 2ZJAA 2B6GA 1Z4NA 1PK1B 4HAIA 1WCLA 8ICIA 2XO7A 7ICVA 1LB2B 5D4BA 2AGPA 3JPOA 4NLKA 2D3DA 2KN7A 3KKAA 3UXNA 1ZD4A 5ALVA 4CRXA 3M8SA 1QH9A 4DSLA 4P0QA 1QCKA 2YB4A 3LK9A 3HT3A 4BXOA 2F8KA 4DL2A 4Y2XA 5KFOA 5JRTA 1X9WA 4FZMA 4O3QA 3PSFA 4KLOA 5ALZA 1PUZA 2ZTEA 2ZIUA 3O0FA 2E1FA 4O5CA 4F4WA 3D2NA 1QQ6A 5C5JA 3UPQA 5DDYA 4QW8A 4WJ3B 7ICOA 5KT7A 5KT4A 2IMWP 1ZYQA 2MAXA 1D9FA 3PNCA 5J2IA 3PW2A 3UMBA 1LKYB 5AI9A 4PHDA 2F77X 5L1JA 2KD1A 9ICMA 4F5PA 4M2YA 3PR5B 5ALHA 1S9FA 1WUDA 5EWGA 2BPGA 1DXSA 9ICKA 1S10A 3KZIU 2PXIA 3IDWA 1ZRNA 2YY6A 1K1QA 4BJQA 2VJ5A 2BDPA 3TI0A 5KFUA 4UB8U 3BQTA 5AKGA 1BPBA 5ALRA 1L5UA 1F0MA 1BPEA 4DFMA 3PW0A 5ALOA 2H5XA 5J2GA 3CW2C 1O03A 1L8OA 3UMGA 1JALA 2ALZA 4C8OA 2UVVA 1T8EA 1KKXA 4EBCA 4UAYA 3PW7A 1HEKA 8ICAA 4UBCA 3WKAA 2AGOA 2ZUCA 1X66A 1L7PA 5AM0A 3KKAC 4JK1A 1ZQAA 4QZ8A 3HRDD 4F2RA 2HOQA 5AKZA 2JGAA 1ZQVA 2F1HA 1ZQHA 4ZOHC 4NJ8A 1QLNA 3B0YA 2LBOA 4CNQA 8ICOA 5ALJA 2ODGA 4M9HA 5KFIA 5AICA 2XY6A 2FPMA 1BPZA 5HR7A 1S0OA 3PY8A 1X6JA 3BQ1A 4EZ9A 2G5IB 2KKPA 7ICMA 4JUZA 1S0VA 1RG6A 3SZ2A 1A76A 3E2EA 2R8JA 2GH1A 3IP4B 1HUOA 4EX7A 3PX4A 3AL0B 1L3VA 4QWDA 1U45A 4RUCA 4GC7A 2P35A 2DUYA 2EH9A 4R66A 1JROA 2JEFA 3ONNA 4B9LA 4FE3A 3HPOA 1FFVA 5J0QA 7ICLA 5KFCA 1BNPA 2KSOB 1L8LA 1BVSA 1L7NA 4KLDA 5KFZA 3M8RA 4C0ZA 2BKEA 5ALQA 5J0YA 3F2BA 1DRGA 5B5EU 2IHMA 2QARB 1Q3UA 1A77A 3ALRA 1ZQNA 5J0WA 2V9WA 1KFSA 1BPDA 1XS9D 5TISU 4GIBA 1XSNA 2FPKA 1TK8A 1Q46A 2Q0ZX 2PMZF 5KFNA 1DOQA 4I2FA 1J2MA 2DQNB 4Y2UA 3HKZF 4F2SA 4JWNA 2DBYA 3RH5A 3ED5A 2W04A 1T4GA 1TAMA 4ED6A 1SZPA 3TADC 4J9QA 3H0MB 3PO5A 3GFKB 5KFFA 9ICLA 1V85A 3RB3A 4DQIA 1L3TA 4J9PA 4DSEA 3CP8A 2KHQA 1U48A 2JH1A 1ZD5A 5KG3A 3NVVA 1Z00A 5J0XA 3N7PD 3TFSA 1SXEA 4PZNA 1XSLA 2K8AA 4PGXA 1X9MA 3HP6A 4C8LA 2FLNA 5J2CA 3G6VA 2WB1F 1SXDA 5DG8A 3TAQA 7ICQA 2XICA 4MF8A 4QZFA 1WG8A 1KTQA 2QLTA 3QU7A 4DCCA 3AM9A 4NLGA 4P4MA 4QWAA 3FC4A 1PVPA 5AKEA 1IM4A 4ED8A 2W3SA 4CCHA 2OM6A 5AKLA 4YMOA 1XO1A 1ZQIA 2FI1A 3QUBA 2ZG6A 3RB6A 1T3QA 4O3NA 2OCEA 3RFAA 2F2AB 1ZQGA 1J97A 8ICCA 4KN7A 4OJPA 1K5OA 8ICZA 5IIMA 7ICTA 2XC9A 5IILA 4A8EA 4MHVA 5KT6A 4Q43A 2HVHA 3V6KA 4KLJA 3RJFA 3H4DA 2JR5A 4YN4A 3DEEA 3DDHA 5DG7A 2KZMA 4CDGA 1NKBA 4FO6A 5AI6A 1X9XA 4RNOA 1PVRA 2R8GA 1LV5A 2HBLA 2NO5A 5L1IA 4TUPA 2V4RA 2LHTA 1ZQZA 2B0CA 7ICSA 2DPJA 4ELUA 2MRLA 3WU2U 4MFAA 2XCAA 5AM1A 1ZRMA 2KIVA 5AM3A 3JPPA 3UMCA 3GIJA 2MSNA 2C28A 2BZFA 1B4FA 2W7PA 4B9VA 1Z3EB 3L4PA 1Z1VA 3Q8QB 1N63A 5J2BA 2NRWA 3C2KA 3K1RB 2BGWA 3ZDAA 4RU9A 2EANA 2VA8A 2YMQA 4NXZA 5J0TA 2YMMA 1NK8A 2W9AA 8ICGA 4JV2A 2KOBA 8ICQA 4DOCA 2ZIXB 1VJ5A 1D8BA 5IIKA 2KZ3A 4MEXA 3A0HU 3M6KA 3MR6A 3AMZA 3Q8MA 1JN3A 4KN4A 2EAMA 3NRZA 1IIPA 3IV6A 1ZXIA 5KFAA 3TAPA 2J6UA 2H3QA 4R8UA 1N2XA 1MQ3A 3LYSA 1UA0A 1N61A 4DL5A 2VIXA 2FJ6A 2PMZC 1N5XA 8ICNA 3N7RC 4ECRA 4DQQA 3OHAA 4E0DA 4QW9A 3RJEA 1JI7A 4I2GA 3NS1A 3BDPA 5ALGA 4Z6CA 2ASLA 3V72A 1UCVA 4DOBA 5J2JA 2MUTA 1TV9A 4KLFA 3RAQA 4F92B 4RQ1A 4CF3A 1L3SA 5F9LA 2HCFA 3G6XA 3M1YA 4Y2RA 2BPCA 4CE6A 4LVSA 1XO0A 1KEJA 5ALPA 5H2FU 2KP7A 3SR6A 2G09A 4YXJA 3RJJA 3GQCA 5AIBA 2ZIVB 2W9BB 2CRXA 2W11A 3T5KA 5KAIU 5KFRA 1OW5A 3QU5A 4LJXA 2JXJA 1NJWA 3H8WA 1L7OA 1Z00B 3JPNA 3NGDA 7ICIA 2AH5A 3WK4A 8ICPA 3G6YA 2LI6A 4UATA 2GO7A 3F5AA 2LMRA 2Q4TA 2E1EA 2E8PA 5KAFU 1KN5A 2W55A 2K4EA 3N4MB 2AQ4A 3BJYA 3BZKA 2P66A 1Z19A 1NKCA 5J0OA 3QU9A 4DEZA 4YXMA 1OXJA 2W7OA 1M6YA 2QB1A 3JPTA 7ICHA 2KEYA 1UPHA 2AJQA 3GDXA 4RQ6A 9ICSA 2R8KA 4PJ0U 1ECWA 4IQWA 2D8CA 4M9GA 3NVZA 3BQ7A 4RQ2A 1V38A 4EYHB 1RPLA 1KFDA 3QZ7A 4FS2A 5J2EA 4BGDA 2J6SA 2YQEA 5EOZA 4YMMA 4Z6EA 4M6WB 4NLCA 4IRDA 5J0RA 1H38A 5J0UA 3NASA 3PW4A 1KLNA 4XQ8A 1WWUA 7ICUA 2EAOA 2YX8A 1XC9A 2RQ5A 1SV4A 5DLGA 2KHVA 4KMUA 3MR3A 4O3OA 4F91B 3JPSA 2W3RA 2ZIWA 4RNNA 1QQ7A 5ALMA 1RDFA 5FP0A 3MFIA 4I2CA 4O3PA 4CGZA 3VCBA 4PPXA 1TFRA 4PGQA 4M9NA 2K89A 2FPLA 2NRZA 2H3VA 1YZ7A 3F2CA 3C2LA 4GXJA 2PFQA 2IOFK 3KHRA 1ZQLA 1KW4A 2BPFA 3H0LB 3WK7A 2A1JA 2EAPA 1ZQSA 5BOMA 3M7DA 2V4QA 2K4HA 1SKSA 2KICA 5KT2A 4M9JA 5EE1A 4ECTA 2HOFA 1NOMA 2KKVA 4NLBA 9ICTA 1DGJA 1X2IA 2K8CB 2NRXA 1Q8KA 3SD7A 5KFKA 4DFPA 1NNLA 1S5LU 2PKEA 4K4HA 1XU4A 4Y2VA 1SV0C 1UT5A 9ICWA 1L3UA 4DFKA 4KMOB 1LKYA 2NO4A 3N7SC 1ZQYA 1JXEA 5KL8B 5A0LA 4OCZA 2OH2A 4J9RA 3SMVA 2XI9A 3OSNA 5BOLA 1ZQ1C 4KLSA 4J9OA 5CEHA 4DS4A 1WCNA 2XVTA 4MFFA 9ICBA 4O0IA 3HKZC 2AGQA 4F5QA 5BPCA 5JTIA 3FYHA 3SAFA 4DL4A 4C4RA 4DLGA 4M0AA 2ATLA 2ASDA 2OEHA 3K4GA 4RQ8A 2R8HA 1V9PA 2NYVA 3LDAA 4TURA 1NKEA 3HX0A 2R18A 1NK5A 4NLNA 3TFRA 4ECQA 3EUB2 5DBBA 4KLMA 2ZJ8A 4I2IA 1AROP 5AM5A 2EZZA 1MA7A 4OJOA 5AIAA 3MR2A 2MA1A 2P6UA 3QE9Y 2CPRA 4LZDA 3KFUF 4QNLA 1MSWD 3J81j 3ETRA 3MBYA 4ZH4A 2PFOA 2OWOA 2E8MA 3GV8B 2YB1A 4J9MA 4Q8EA 1YZ6A 5HHIA 2WF7A 2KJ5A 5ALUA 5J2KA 3QUQA 2I6XA 3PW5A 4FFDA 3C1YA 4ECWA 3NVYA 1B0XA 3H8MA 3QXGA 2K4PA 2G0AA 3EW9A 4EEYA 3LWLA 4DL3A 2FLLA 3PV8A 5KG2A 4B9SA 1FIQA 4QZAA 4KLUA 4IQUA 4F71A 3AEVA 3PMLA 4MEYA 8ICUA 2KFNA 1SWVA 3KOOA 2F8LA 3PSTA 4YCXA 3F53A 1CI4A 2KSOA 5AI0A 1L7MA 1NK6A 4K4GA 2O6KA 1RQNA 3QUTA 4F72A 5KFWA 1QQ5A 9ICHA 4F4KA 3BS5A 1D8YA 4Y2QA 1ZD3A 1RQLA 5CR0A 1A6SA 5IIOA 2ZXIA 1S97A 1P7DA 2E8NA 4MFCA 3OPXA 3V6JA 5EE9A 3B0XA 3L5KA 2ZUDA 1TAQA 4EBEA 2L5YA 4F3OA 2PFNA 2VANA 1ZQQA 2GOLA 2WF6A 5ALLA 7ICJA 4F4YA 2ZXHA 1L6NA 2W9MA 3NUQA 3M9MB 5KFLA 4QZ9A 2IOFA 4I29A 4DL6A 2KV2A 1NJXA 4F8RA 2HBJA 7ICNA 5L1KA 2XIDA 3BQ0A 3RRGA 8ICSA 1RXVA 5DQHA 4M6WA 3GV5B 4J9NA 3GZFA 2HI0A 4F5NA 1WWVA 4PHEA 5ALSA 2HBKA 1SKWA 1ZQMA 3T79A 5EWEA 5DLFA 4UAZA 1S0MA 2LPEA 2G07A 5KG4A 4BX9C 3EWAA 1FO4A 4U6PA 1K1SA 9ICPA 3IHQB 5CB1A 4ECVA 4F5OA 3OJSA 1SWWA 5DQIA 8ICFA 4RQ4A 4QWEA 2KFZA 5AKJA 4PH5A 5KTQA 3GU3A 1KQQA 1RZTA 4YFKA 8ICXA 1UT8A 4CF4A 2KJ9A 4UARA 2A1JB 4YQWA 7ICEA 4KX3A 2LYHA 4RQNA 4DL7A 8ICKA 2WHEA 4DSJA 3H7IA 2ZTCA 4ECYA 5KFSA 4DQPA 5ALNA 2DFLA 2A1AA 2Y0SC 4YP3A 4BXOB 4O3RA 3MABA 5KFHA 1S0NA 2EZYA 5AM2A 3NTUA 1YT3A 5HNKA 3LVVA 3SQIA 4I2BA 2JZBA 2WB1C 5C0YA 1UA1A 1MN8A 4QIWC 2WF9A 4KLLA 3UXPA 4C8NA 1T7PA 3QYPA 1KSPA 2JHDA 3T5HA 4QWBA 3BZCA 2DWQA 4Q44A 4B9NA 1EXNA 3ISDA 2F3NA 5KG1A 9ICEA 5DB7A 4UAVA 4TQSA 4XA5A 4Q8FA 1Q3VA 3UXOA 3RH6A 4DS5A 2YTUA 4F5RA 2B21A 1KDHA 1N5WA 1NK9A 4FBTA 4IQVA 2E3TA 5EWFA 3RR7A 7ICGA 2ISPA 1JMSA 1ZQKA 4ELTA 5AK6A 3ZDBA 2LM1A 2BCSA 2C2RA 3UQ2A 4IRKA 1ZQFA 1IXRA 4YVZA 2WF5A 5J0SA 1NK4A 2ZUBA 8ICHA 4GLXA 4J9SA 4P0PB 3TKAA 1JX4A 4MF2A 3JPRA 3TADA 2ZIXA 3H40A 5HR6A 2IOHA 5CJ7A 3V7LA 4RT2A 3GV7B 1S76D 1ZQDA 2Y9UA 5J8YA 2BCUA 3RAXA 1CUKA 4DFDA 4NL9A 4QZGA 4GFJA 3MGIA 3N97B 2GLEA 3SENA 3SV4A 3ZD9A 2BQ3A 5AKHA 4JV0A 3B9JA 2EQYA 4I27A 4GXKA 4OJ6A 3TARA 3BS5B 4FZNA 2H3FA 5KFYA 4ED3A 1C20A 4NY8A 2F44A 1Z4OA 1SGGA 2DKZA 3VC8A 1A0PA 5ALFA 8ICVA 3TACB 4DQRA 4C8KA 5J2HA 1NK0A 4QWCA 2DKXA 5AI4A 3ZDEA 4OO1J 5DG9A 4I2HA 2DL0A 2MUTB 4YR2A 5TZVA 2C2EA 2BDUA 2BR0A 2EDUA 2W54A 2E5SA 4PGYA 3SAGA 3SEIA 8ICJA 5KG6A 5J29A 1GO3F 2FMQA 2KVSA 1XWLA 3V7KA 3KD3A 4R65A 3HJEA 4US9A 5HMLA 3ORYA 4ICAA 5EE0A 4KLIA 5KL1B 4KLGA 4I2DA 5AKYA 4TUQA 4P4OA 3KBBA 5KFGA 4O5EA 3JPQA 3HWTA 2HHXA 4YD2A 1MC8A 2F1IA 5E79U 5KNIA 4ELVA 3QX7A 2PI4A 4IS7A 4OJ5A 2Y0SF 3OGUA 3RBEA 3PR4A 3CYMA 5JUMA 3T5LA 4UW9A 4ED2A 2G08A 1BPYA 1COKA 2HHVA 4QJFB 4J9LA 2ESEA 8ICMA 1ZJNA 3AUOA 1ZQTA 1X40A 4JMUA 3UQ0A 5ALWA 4QIWF 4PL1A 5IIIA 5DBCA 2E8OA 9ICOA 3RRHA 3C1ZA 5DKWA 5KG7A 4RQ0A 4R64A 3THVA 3N28A 5DB6A 3EZ5A 1OUQA 2AHOB 4U7CA 2XY5A 2KIWA 4TQRA 4Y2JA 2BCVA 3V6HA 4IR9A 3Q8LA 2JRZA 3ZDCA 1BNOA 1ZQOA 1F5SA 2FLPA 4B6JA 4YR3A 3FM9A 3PX0A 4X5VA 3C29A 5J0PA 4UASA 2ZIWB 5JU5A 3DV9A 1XSPA 1JRPA 1ZJMA 1BPXA 5KFQA 4EELA 4GXIA 1RYUA 3IM1A 5DB8A 5T14A 4AYBF 2CXYA 3C23A 3SI8A 4US8A 3CRXA 2KJ8A 4F93B 2W8LA 3RB4A 1JIHA 9ICGA 4XUSA 4EEKA 2DF4B 4C8MA 5KT3A 1SIJA 3WK5A 4KLTA 3IG5A 2PFPA 1RYSA 3WKCA 3Q8RB 3E0FA 4M9LA 3D2SA 4IR1A 1HIWA 3SAHA 3ZI4A 4DOAA 3QU2A 2BQUA 1SKRA 2KZZA 9ICNA 2KG5A 3WKEA 3L3FX 3RJKA 2ZIUB 1O08A 4P0PA 2W9CA 5ALKA 4YR0A 3Q8PB 1VDVA 1TK5A 4DQSA 2BQRA 5KT5A 2HSZA 4ECSA 2XGPA 4NM2A 1D8LA 2JEGA 2J6TA 4R63A 2NRTA 4B9MA 3OTQA 1J2NA 3F5EA 4DLEA 2JEIA 3TQ1A 1U9LA 4RNMA 3AQEA 4C80A 2LKYA 3QU4A 1V97A 3K75D 3V7JA 2HDOA 4Y2YA 2RRDA 2HBMA 5EE3A 3T5JA 1KL9A 3ZD8A 4CF5A 4EBDA 4QZIA 2VA3A 1NI3A 1N60A 3SV3A 8ICRA 4M04A 3RJHA 3S6JA 4F4XA 7ICPA 5CA7A 2VA2A 3PX6A 4P2HA 3D2QA 1DK3A 2HOIA 1PZNA 2QB0B 2C22A 2KVCA 2HHWA 1SV0A 3AQFA 2F1JA 3M6ZA 4B9TA 4ACOA 3A0BU 5G5GA 4RT3A 5J2AA 4IC9A 2YMLA 9ICVA 4JV1A 4PZOA 1RXWA 1ZQPA 2IHNA 1N48A 1ZD2P 3UM9A 2XY7A 2FDRA 3KHHA 3CNHA 4XRHA 2N1RA 3PSIA 4RQ5A 2HVIA 1QTMA 3KHGA 1NZBA 1UHUA 1JUDA 2HW3A 4ECXA 3AU6A 2NRVA 4RPYA 2Y1JA 2A3VA 2AXTU 3RTVA 8ICTA 4F50A 4I28A 4FS1A 1QSLA 3FAHA 5CWRA 4DSKA 4O3SA 5KG5A 4RZRA 3IN5A 2OYYA 3ICXA 1BGXT 3QZ8A 3R9KA 4AYBC 1TAUA 5L1MA 5DB9A 2C2DA 3IRUA 1SB3C 2I5HA 5AK3A 2VKQA 4DF8A 1KBUA 3TANA 1LVHA 4RQ7A 3SYZA 2G06A 3BS7A 1DK2A 2P6RA 5G5HA 1XNSA 5KFJA 5ALDA 5B66U 1ZQUA 1QSSA 1ZQEA 2QARA 5GTHU 3WKBA 4NV0A 4O3MA 1FFUA 2UVRA 2RDIA 3I76A 2WTFA 4EZ6A 4UQGA 5AHXA 1CRXA 2HHSA 4TUSA 1TE2A 5F9NA 4O5KA 5KFVA 3PO4A 3OHBA 4DSFA 2HHUA 2KE7A 1C7YA 2EZXA 3MFHA 5KFEA 2OXOA 5L9XA 3OJUA 4Y2SA 4EYIB 4OD0A 5AKIA 1F44A 2Z7JA 5DBAA 2DGZA 5CHGA 4OJLA 4QZBA 3ETLA 4J9KA 3AN1A 3RF9A 2LYAA 4HYKA 4FZLA 2KTQA 1SL2A 5DGBA 3KTQA 5ALIA 3MDAA 2MU2A 4QZCA 2NV3A 3QEAZ 3K1ZA 4DO9A 2HHTA 1SZHA 1ZQCA 2YMPA 5DGAA 4DFJA 4DSIA 4UAUA 4UAWA 2UVWA 8ICEA 4BDPA 4Q45A 5AM4A 4KTQA 4ED7A 2JEJA 3RJGA 4UB2A 2JZBB 4O9MA 4ECZA 4RPZA 1AQ6A 9ICRA 4C4SA 2W9CB 2K4IA 4F4ZA 2BHNA 5CRXA 1RM6C 1S77D 4Y2PA 2KMDA 3NRWA 1CEZA 2UVUA 4Z6FA 2WF8A 3E58A 3MGHA 1X42A 1DGSA 4IL6U 4RUAA 4IQTA 1QSYA 2PI5A 4DWIA 2ZTDA 4C7ZA 1T94A 7ICFA 2RHFA 4M47A 3LWMA 3RH4A 5IIJA 3T3FA 4EX6A 1Z1BA 1COOA 3ISCA 4B9UA 1TKDA 3NVWA 9ICQA 4YG2A 1PK1A 2H3ZA 3EPIA 1URJA 7ICRA 1RYRA 4Z6DA 1ZETA 3KZXA 1FEZA 1ZQXA 2K60A 3MR5A 2JH7A 2QB0A 2VJ4A 1IG6A 2H3IA 3BQ2A 4NM1A 2D6FC 2DPIA 3AU2A 1T3NA 4P4PA 3EPGA 2FE9A 4I2EA 4P0QB 2G5HB 1TK0A 2KK0A 3RB0A 2BCQA 3RR8A 2Y1IA 4KLQA 4C7YA 2K8BB 3WK9A 3Q8SB 3I1YA 3RJIA 3MGVA 1B43A 5ALTA 3H8JA 1WYGA 3GIMA 3OSPA 5ALEA 5KFPA 2GWSA 4I2AA 4KITB 1PVQA 1B22A 2LYBA 5ALYA 5K4LA 5HP4A 8ICYA 5AKKA 3PVXA 5GTIU 1PK3A 4J03A 4BWJA
chains in the Genus database with same CATH topology
2M0NA 4P0QA 2YX8A 2K8AA 2YB4A 3NUQA 1L6NA 4FZNA 2H3FA 2RP5A 4BUGA 5HR7A 3F5EA 2KHVA 2VKQA 1KBUA 3PSPA 4FZMA 2WB1F 3PSFA 3LVWA 2ZIWA 2KV2A 2G5IB 2KKPA 3VC8A 1XO0A 2ZIUA 3AQEA 3O0FA 1A0PA 2LKYA 2G06A 2E1FA 3C28A 2HBJA 3F2DA 1OUQA 1MA7A 3D2NA 2G09A 4CGZA 2K4IA 2XIDA 4OJOA 2W7PA 3VCBA 2RRDA 4WJ3B 2HBMA 5CRXA 2K89A 2ZIVB 4U7CA 1Q3VA 2H3VA 2KIWA 2CRXA 2MA1A 3F2BA 1XNSA 2W03A 2GH1A 2XICA 3IP4B 3NRWA 3GZFA 3F2CA 4OO1J 3AL0B 2CPRA 3KFUF 4QNLA 2HBKA 4PL2A 3H0LB 2F77X 4NV0A 2KD1A 3T79A 4O3MA 2BDUA 1PVPA 1ED1A 3ONNA 3D2QA 2HOIA 3F5AA 3M7DA 2G07A 4FE3A 3C29A 2K4HA 2YB1A 4BX9C 1T94A 2KICA 2E5SA 2Q4TA 2E1EA 2KVCA 2RHFA 2ZIWB 2HOFA 3SAGA 2K4EA 4U6PA 2KKVA 3AQFA 2KJ5A 2OM6A 4NLBA 1GO3F 1WUDA 2KOBA 3M6ZA 1CRXA 2K8CB 4ACOA 2ZIXB 1D8BA 1Z1BA 2ZIVA 1Z19A 2ZG6A 5T14A 4AYBF 4C0ZA 2JMGA 2CN1A 3PZPA 4NWIA 2WAQC 2F76X 3M6KA 2G0AA 3CRXA 4IC9A 3RFAA 2F2AB 2KJ8A 2VJ5A 2WAQF 3GU3A 4KMOB 2OXOA 4BJQA 1IIPA 4ICAA 1Q3UA 1DRGA 2H3ZA 3H0RB 2HMXA 1URJA 3N7SC 2KJ9A 4OJPA 1F44A 2KEYA 2Z7JA 5KL8B 2DF4B 3ALRA 3KZXA 5A0LA 4P0PB 2DGZA 4KX3A 5KL1B 2OH2A 1UPHA 4A8EA 2JH7A 4OJLA 3SMVA 3IG5A 2VJ4A 2XI9A 2H3QA 2F8LA 2PMZF 3PSTA 1ZQ1C 3F53A 2H3IA 3RF9A 2DQNB 3IG8A 2LYAA 3HKZF 2D6FC 2N1RA 2ZIXA 3LYSA 1ECWA 4FZLA 3E0FA 3PSIA 3D2SA 5HR6A 3DEEA 2Y0SC 2XVTA 1NZBA 4P0QB 2ZXHA 2G5HB 4CDGA 2VIXA 1HIWA 2W04A 2PMZC 3SAHA 1TAMA 1HEKA 3HKZC 1YT3A 3N7RC 2W7OA 1A6SA 2K8BB 3LVVA 3H0MB 3SAFA 3SQIA 1PVRA 2ZXIA 2NV3A 2WB1C 4OJ5A 1P7DA 2Y0SF 3L3FX 4GFJA 2A3VA 5C0YA 2ZIUB 3MGVA 3CYMA 3K1ZA 3OPXA 2G08A 4QIWC 4P0PA 2HBLA 4QJFB 2HOQA 2KNJA 1SZHA 2LHTA 3CP8A 2JGAA 4NLCA 2KHQA 2JH1A 1PVQA 2LYBA 4KX5A 2OYYA 3IN5A 2MRLA 3ICXA 4OJ6A 4JMUA 4CRXA 2LBOA 3N7PD 4QIWF 2GOLA 4PL1A 4AYBC 2JHDA 2R18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRX A;  2KJ8 A;  1DRG A;  2OXO A;  1Q3U A;  2KD1 A;  2KHV A;  1PVR A;  1PVP A;  1KBU A;  2KJ9 A;  1P7D A;  1F44 A;  2A3V A;  2KEY A;  2HOI A;  3C29 A;  3MGV A;  2KKP A;  1XO0 A;  4A8E A;  1A0P A;  2HOF A;  3C28 A;  1OUQ A;  2KKV A;  1MA7 A;  2KJ5 A;  2KOB A;  1CRX A;  2KHQ A;  5CRX A;  1PVQ A;  1Q3V A;  4ACO A;  2KIW A;  2CRX A;  1Z1B A;  1XNS A;  1Z19 A;  3LYS A;  3NRW A;  4CRX A;  1NZB A; 
#chains in the Genus database with same CATH topology
 2RP5 A;  3QUC A;  4PHA A;  5L1L A;  3PSP A;  2BCR A;  3LVW A;  2ASJ A;  3C28 A;  2RLT A;  1ZOL A;  4DF4 A;  3FDS A;  3HW8 A;  2W03 A;  4UBB A;  4QZD A;  2ISO A;  4KLE A;  3QNM A;  2Y9T A;  4UB1 A;  2RDJ A;  2W43 A;  4G3I A;  4ECU A;  4QZE A;  4PL2 A;  2HHQ A;  1NK7 A;  1X9S A;  5AI5 A;  5F3X B;  3H4B A;  4USA A;  2FMP A;  3C5F A;  2I1Q A;  2FMS A;  5ALX A;  2WFA A;  5AK4 A;  4G9B A;  5DDM A;  4NWI A;  2WAQ C;  2F76 X;  1N56 A;  2JV3 A;  1ZQW A;  5KG0 A;  4BWM A;  2HMX A;  3H8S A;  1U47 A;  3MC1 A;  3WK8 A;  5KFB A;  3M9O B;  1KFT A;  3QEB Z;  3Q8K A;  1X6I A;  8ICL A;  2XGQ A;  1IV8 A;  4RQ3 A;  8ICW A;  2QKQ A;  4GC6 A;  4UB6 U;  3D6J A;  4ED1 A;  2LM4 A;  5AKX A;  3WK6 A;  2IBK A;  9ICF A;  5D46 A;  1ZQJ A;  4C4T A;  5DQG A;  4JB3 A;  3C5G A;  9ICC A;  1HUZ A;  3EYZ A;  3WKD A;  5KFX A;  4UB4 A;  3MDC A;  3ISB A;  5KFD A;  1D9D A;  2I9G A;  4YD1 A;  3M9N B;  2KNJ A;  4RQM A;  5J8Y C;  5J2F A;  4QZH A;  2W9B A;  4R8U B;  2IA6 A;  1JXL A;  1ZQR A;  2AQ0 A;  1S8O A;  4KX5 A;  1SL0 A;  3PMN A;  2CN1 A;  1U4B A;  2M0N A;  4K4I A;  5HMM A;  5KFT A;  1NZP A;  1U49 A;  4BUG A;  1UQV A;  5CP2 A;  9ICU A;  2W8K A;  2ZJ5 A;  4RPX A;  1Y88 A;  1NJZ A;  3F2D A;  4I2J A;  3C21 A;  4IRC A;  2YN4 A;  3U26 A;  3RBD A;  2OHF A;  4NLZ A;  9ICI A;  1MQ2 A;  3KHL A;  3GIL A;  5IIN A;  9ICA A;  2A19 A;  7ICK A;  5AI8 A;  1ED1 A;  2R8I A;  1TVA A;  4KLH A;  8ICB A;  4ED0 A;  4FBU A;  3I28 A;  1KRP A;  9ICX A;  5HHH A;  2ES6 A;  3GIK A;  2ZIV A;  2XCP A;  1N62 A;  2JMG A;  3HIL A;  3PZP A;  5KFM A;  3C2M A;  4LZG A;  4UB5 A;  2AU0 A;  4JWM A;  2WAQ F;  4Y2T A;  4YMN A;  4AP9 A;  3H0R B;  5J2D A;  5AK5 A;  5D49 A;  1ZQB A;  9ICJ A;  4PHP A;  4UB3 A;  4EEN A;  1HJP A;  3ZDD A;  2M9N A;  1VLB A;  1NJY A;  3IG8 A;  4NL9 C;  1SL1 A;  3GII A;  2ZJA A;  2B6G A;  1Z4N A;  1PK1 B;  4HAI A;  1WCL A;  8ICI A;  2XO7 A;  7ICV A;  1LB2 B;  5D4B A;  2AGP A;  3JPO A;  4NLK A;  2D3D A;  2KN7 A;  3KKA A;  3UXN A;  1ZD4 A;  5ALV A;  4CRX A;  3M8S A;  1QH9 A;  4DSL A;  4P0Q A;  1QCK A;  2YB4 A;  3LK9 A;  3HT3 A;  4BXO A;  2F8K A;  4DL2 A;  4Y2X A;  5KFO A;  5JRT A;  1X9W A;  4FZM A;  4O3Q A;  3PSF A;  4KLO A;  5ALZ A;  1PUZ A;  2ZTE A;  2ZIU A;  3O0F A;  2E1F A;  4O5C A;  4F4W A;  3D2N A;  1QQ6 A;  5C5J A;  3UPQ A;  5DDY A;  4QW8 A;  4WJ3 B;  7ICO A;  5KT7 A;  5KT4 A;  2IMW P;  1ZYQ A;  2MAX A;  1D9F A;  3PNC A;  5J2I A;  3PW2 A;  3UMB A;  1LKY B;  5AI9 A;  4PHD A;  2F77 X;  5L1J A;  2KD1 A;  9ICM A;  4F5P A;  4M2Y A;  3PR5 B;  5ALH A;  1S9F A;  1WUD A;  5EWG A;  2BPG A;  1DXS A;  9ICK A;  1S10 A;  3KZI U;  2PXI A;  3IDW A;  1ZRN A;  2YY6 A;  1K1Q A;  4BJQ A;  2VJ5 A;  2BDP A;  3TI0 A;  5KFU A;  4UB8 U;  3BQT A;  5AKG A;  1BPB A;  5ALR A;  1L5U A;  1F0M A;  1BPE A;  4DFM A;  3PW0 A;  5ALO A;  2H5X A;  5J2G A;  3CW2 C;  1O03 A;  1L8O A;  3UMG A;  1JAL A;  2ALZ A;  4C8O A;  2UVV A;  1T8E A;  1KKX A;  4EBC A;  4UAY A;  3PW7 A;  1HEK A;  8ICA A;  4UBC A;  3WKA A;  2AGO A;  2ZUC A;  1X66 A;  1L7P A;  5AM0 A;  3KKA C;  4JK1 A;  1ZQA A;  4QZ8 A;  3HRD D;  4F2R A;  2HOQ A;  5AKZ A;  2JGA A;  1ZQV A;  2F1H A;  1ZQH A;  4ZOH C;  4NJ8 A;  1QLN A;  3B0Y A;  2LBO A;  4CNQ A;  8ICO A;  5ALJ A;  2ODG A;  4M9H A;  5KFI A;  5AIC A;  2XY6 A;  2FPM A;  1BPZ A;  5HR7 A;  1S0O A;  3PY8 A;  1X6J A;  3BQ1 A;  4EZ9 A;  2G5I B;  2KKP A;  7ICM A;  4JUZ A;  1S0V A;  1RG6 A;  3SZ2 A;  1A76 A;  3E2E A;  2R8J A;  2GH1 A;  3IP4 B;  1HUO A;  4EX7 A;  3PX4 A;  3AL0 B;  1L3V A;  4QWD A;  1U45 A;  4RUC A;  4GC7 A;  2P35 A;  2DUY A;  2EH9 A;  4R66 A;  1JRO A;  2JEF A;  3ONN A;  4B9L A;  4FE3 A;  3HPO A;  1FFV A;  5J0Q A;  7ICL A;  5KFC A;  1BNP A;  2KSO B;  1L8L A;  1BVS A;  1L7N A;  4KLD A;  5KFZ A;  3M8R A;  4C0Z A;  2BKE A;  5ALQ A;  5J0Y A;  3F2B A;  1DRG A;  5B5E U;  2IHM A;  2QAR B;  1Q3U A;  1A77 A;  3ALR A;  1ZQN A;  5J0W A;  2V9W A;  1KFS A;  1BPD A;  1XS9 D;  5TIS U;  4GIB A;  1XSN A;  2FPK A;  1TK8 A;  1Q46 A;  2Q0Z X;  2PMZ F;  5KFN A;  1DOQ A;  4I2F A;  1J2M A;  2DQN B;  4Y2U A;  3HKZ F;  4F2S A;  4JWN A;  2DBY A;  3RH5 A;  3ED5 A;  2W04 A;  1T4G A;  1TAM A;  4ED6 A;  1SZP A;  3TAD C;  4J9Q A;  3H0M B;  3PO5 A;  3GFK B;  5KFF A;  9ICL A;  1V85 A;  3RB3 A;  4DQI A;  1L3T A;  4J9P A;  4DSE A;  3CP8 A;  2KHQ A;  1U48 A;  2JH1 A;  1ZD5 A;  5KG3 A;  3NVV A;  1Z00 A;  5J0X A;  3N7P D;  3TFS A;  1SXE A;  4PZN A;  1XSL A;  2K8A A;  4PGX A;  1X9M A;  3HP6 A;  4C8L A;  2FLN A;  5J2C A;  3G6V A;  2WB1 F;  1SXD A;  5DG8 A;  3TAQ A;  7ICQ A;  2XIC A;  4MF8 A;  4QZF A;  1WG8 A;  1KTQ A;  2QLT A;  3QU7 A;  4DCC A;  3AM9 A;  4NLG A;  4P4M A;  4QWA A;  3FC4 A;  1PVP A;  5AKE A;  1IM4 A;  4ED8 A;  2W3S A;  4CCH A;  2OM6 A;  5AKL A;  4YMO A;  1XO1 A;  1ZQI A;  2FI1 A;  3QUB A;  2ZG6 A;  3RB6 A;  1T3Q A;  4O3N A;  2OCE A;  3RFA A;  2F2A B;  1ZQG A;  1J97 A;  8ICC A;  4KN7 A;  4OJP A;  1K5O A;  8ICZ A;  5IIM A;  7ICT A;  2XC9 A;  5IIL A;  4A8E A;  4MHV A;  5KT6 A;  4Q43 A;  2HVH A;  3V6K A;  4KLJ A;  3RJF A;  3H4D A;  2JR5 A;  4YN4 A;  3DEE A;  3DDH A;  5DG7 A;  2KZM A;  4CDG A;  1NKB A;  4FO6 A;  5AI6 A;  1X9X A;  4RNO A;  1PVR A;  2R8G A;  1LV5 A;  2HBL A;  2NO5 A;  5L1I A;  4TUP A;  2V4R A;  2LHT A;  1ZQZ A;  2B0C A;  7ICS A;  2DPJ A;  4ELU A;  2MRL A;  3WU2 U;  4MFA A;  2XCA A;  5AM1 A;  1ZRM A;  2KIV A;  5AM3 A;  3JPP A;  3UMC A;  3GIJ A;  2MSN A;  2C28 A;  2BZF A;  1B4F A;  2W7P A;  4B9V A;  1Z3E B;  3L4P A;  1Z1V A;  3Q8Q B;  1N63 A;  5J2B A;  2NRW A;  3C2K A;  3K1R B;  2BGW A;  3ZDA A;  4RU9 A;  2EAN A;  2VA8 A;  2YMQ A;  4NXZ A;  5J0T A;  2YMM A;  1NK8 A;  2W9A A;  8ICG A;  4JV2 A;  2KOB A;  8ICQ A;  4DOC A;  2ZIX B;  1VJ5 A;  1D8B A;  5IIK A;  2KZ3 A;  4MEX A;  3A0H U;  3M6K A;  3MR6 A;  3AMZ A;  3Q8M A;  1JN3 A;  4KN4 A;  2EAM A;  3NRZ A;  1IIP A;  3IV6 A;  1ZXI A;  5KFA A;  3TAP A;  2J6U A;  2H3Q A;  4R8U A;  1N2X A;  1MQ3 A;  3LYS A;  1UA0 A;  1N61 A;  4DL5 A;  2VIX A;  2FJ6 A;  2PMZ C;  1N5X A;  8ICN A;  3N7R C;  4ECR A;  4DQQ A;  3OHA A;  4E0D A;  4QW9 A;  3RJE A;  1JI7 A;  4I2G A;  3NS1 A;  3BDP A;  5ALG A;  4Z6C A;  2ASL A;  3V72 A;  1UCV A;  4DOB A;  5J2J A;  2MUT A;  1TV9 A;  4KLF A;  3RAQ A;  4F92 B;  4RQ1 A;  4CF3 A;  1L3S A;  5F9L A;  2HCF A;  3G6X A;  3M1Y A;  4Y2R A;  2BPC A;  4CE6 A;  4LVS A;  1XO0 A;  1KEJ A;  5ALP A;  5H2F U;  2KP7 A;  3SR6 A;  2G09 A;  4YXJ A;  3RJJ A;  3GQC A;  5AIB A;  2ZIV B;  2W9B B;  2CRX A;  2W11 A;  3T5K A;  5KAI U;  5KFR A;  1OW5 A;  3QU5 A;  4LJX A;  2JXJ A;  1NJW A;  3H8W A;  1L7O A;  1Z00 B;  3JPN A;  3NGD A;  7ICI A;  2AH5 A;  3WK4 A;  8ICP A;  3G6Y A;  2LI6 A;  4UAT A;  2GO7 A;  3F5A A;  2LMR A;  2Q4T A;  2E1E A;  2E8P A;  5KAF U;  1KN5 A;  2W55 A;  2K4E A;  3N4M B;  2AQ4 A;  3BJY A;  3BZK A;  2P66 A;  1Z19 A;  1NKC A;  5J0O A;  3QU9 A;  4DEZ A;  4YXM A;  1OXJ A;  2W7O A;  1M6Y A;  2QB1 A;  3JPT A;  7ICH A;  2KEY A;  1UPH A;  2AJQ A;  3GDX A;  4RQ6 A;  9ICS A;  2R8K A;  4PJ0 U;  1ECW A;  4IQW A;  2D8C A;  4M9G A;  3NVZ A;  3BQ7 A;  4RQ2 A;  1V38 A;  4EYH B;  1RPL A;  1KFD A;  3QZ7 A;  4FS2 A;  5J2E A;  4BGD A;  2J6S A;  2YQE A;  5EOZ A;  4YMM A;  4Z6E A;  4M6W B;  4NLC A;  4IRD A;  5J0R A;  1H38 A;  5J0U A;  3NAS A;  3PW4 A;  1KLN A;  4XQ8 A;  1WWU A;  7ICU A;  2EAO A;  2YX8 A;  1XC9 A;  2RQ5 A;  1SV4 A;  5DLG A;  2KHV A;  4KMU A;  3MR3 A;  4O3O A;  4F91 B;  3JPS A;  2W3R A;  2ZIW A;  4RNN A;  1QQ7 A;  5ALM A;  1RDF A;  5FP0 A;  3MFI A;  4I2C A;  4O3P A;  4CGZ A;  3VCB A;  4PPX A;  1TFR A;  4PGQ A;  4M9N A;  2K89 A;  2FPL A;  2NRZ A;  2H3V A;  1YZ7 A;  3F2C A;  3C2L A;  4GXJ A;  2PFQ A;  2IOF K;  3KHR A;  1ZQL A;  1KW4 A;  2BPF A;  3H0L B;  3WK7 A;  2A1J A;  2EAP A;  1ZQS A;  5BOM A;  3M7D A;  2V4Q A;  2K4H A;  1SKS A;  2KIC A;  5KT2 A;  4M9J A;  5EE1 A;  4ECT A;  2HOF A;  1NOM A;  2KKV A;  4NLB A;  9ICT A;  1DGJ A;  1X2I A;  2K8C B;  2NRX A;  1Q8K A;  3SD7 A;  5KFK A;  4DFP A;  1NNL A;  1S5L U;  2PKE A;  4K4H A;  1XU4 A;  4Y2V A;  1SV0 C;  1UT5 A;  9ICW A;  1L3U A;  4DFK A;  4KMO B;  1LKY A;  2NO4 A;  3N7S C;  1ZQY A;  1JXE A;  5KL8 B;  5A0L A;  4OCZ A;  2OH2 A;  4J9R A;  3SMV A;  2XI9 A;  3OSN A;  5BOL A;  1ZQ1 C;  4KLS A;  4J9O A;  5CEH A;  4DS4 A;  1WCN A;  2XVT A;  4MFF A;  9ICB A;  4O0I A;  3HKZ C;  2AGQ A;  4F5Q A;  5BPC A;  5JTI A;  3FYH A;  3SAF A;  4DL4 A;  4C4R A;  4DLG A;  4M0A A;  2ATL A;  2ASD A;  2OEH A;  3K4G A;  4RQ8 A;  2R8H A;  1V9P A;  2NYV A;  3LDA A;  4TUR A;  1NKE A;  3HX0 A;  2R18 A;  1NK5 A;  4NLN A;  3TFR A;  4ECQ A;  3EUB 2;  5DBB A;  4KLM A;  2ZJ8 A;  4I2I A;  1ARO P;  5AM5 A;  2EZZ A;  1MA7 A;  4OJO A;  5AIA A;  3MR2 A;  2MA1 A;  2P6U A;  3QE9 Y;  2CPR A;  4LZD A;  3KFU F;  4QNL A;  1MSW D;  3J81 j;  3ETR A;  3MBY A;  4ZH4 A;  2PFO A;  2OWO A;  2E8M A;  3GV8 B;  2YB1 A;  4J9M A;  4Q8E A;  1YZ6 A;  5HHI A;  2WF7 A;  2KJ5 A;  5ALU A;  5J2K A;  3QUQ A;  2I6X A;  3PW5 A;  4FFD A;  3C1Y A;  4ECW A;  3NVY A;  1B0X A;  3H8M A;  3QXG A;  2K4P A;  2G0A A;  3EW9 A;  4EEY A;  3LWL A;  4DL3 A;  2FLL A;  3PV8 A;  5KG2 A;  4B9S A;  1FIQ A;  4QZA A;  4KLU A;  4IQU A;  4F71 A;  3AEV A;  3PML A;  4MEY A;  8ICU A;  2KFN A;  1SWV A;  3KOO A;  2F8L A;  3PST A;  4YCX A;  3F53 A;  1CI4 A;  2KSO A;  5AI0 A;  1L7M A;  1NK6 A;  4K4G A;  2O6K A;  1RQN A;  3QUT A;  4F72 A;  5KFW A;  1QQ5 A;  9ICH A;  4F4K A;  3BS5 A;  1D8Y A;  4Y2Q A;  1ZD3 A;  1RQL A;  5CR0 A;  1A6S A;  5IIO A;  2ZXI A;  1S97 A;  1P7D A;  2E8N A;  4MFC A;  3OPX A;  3V6J A;  5EE9 A;  3B0X A;  3L5K A;  2ZUD A;  1TAQ A;  4EBE A;  2L5Y A;  4F3O A;  2PFN A;  2VAN A;  1ZQQ A;  2GOL A;  2WF6 A;  5ALL A;  7ICJ A;  4F4Y A;  2ZXH A;  1L6N A;  2W9M A;  3NUQ A;  3M9M B;  5KFL A;  4QZ9 A;  2IOF A;  4I29 A;  4DL6 A;  2KV2 A;  1NJX A;  4F8R A;  2HBJ A;  7ICN A;  5L1K A;  2XID A;  3BQ0 A;  3RRG A;  8ICS A;  1RXV A;  5DQH A;  4M6W A;  3GV5 B;  4J9N A;  3GZF A;  2HI0 A;  4F5N A;  1WWV A;  4PHE A;  5ALS A;  2HBK A;  1SKW A;  1ZQM A;  3T79 A;  5EWE A;  5DLF A;  4UAZ A;  1S0M A;  2LPE A;  2G07 A;  5KG4 A;  4BX9 C;  3EWA A;  1FO4 A;  4U6P A;  1K1S A;  9ICP A;  3IHQ B;  5CB1 A;  4ECV A;  4F5O A;  3OJS A;  1SWW A;  5DQI A;  8ICF A;  4RQ4 A;  4QWE A;  2KFZ A;  5AKJ A;  4PH5 A;  5KTQ A;  3GU3 A;  1KQQ A;  1RZT A;  4YFK A;  8ICX A;  1UT8 A;  4CF4 A;  2KJ9 A;  4UAR A;  2A1J B;  4YQW A;  7ICE A;  4KX3 A;  2LYH A;  4RQN A;  4DL7 A;  8ICK A;  2WHE A;  4DSJ A;  3H7I A;  2ZTC A;  4ECY A;  5KFS A;  4DQP A;  5ALN A;  2DFL A;  2A1A A;  2Y0S C;  4YP3 A;  4BXO B;  4O3R A;  3MAB A;  5KFH A;  1S0N A;  2EZY A;  5AM2 A;  3NTU A;  1YT3 A;  5HNK A;  3LVV A;  3SQI A;  4I2B A;  2JZB A;  2WB1 C;  5C0Y A;  1UA1 A;  1MN8 A;  4QIW C;  2WF9 A;  4KLL A;  3UXP A;  4C8N A;  1T7P A;  3QYP A;  1KSP A;  2JHD A;  3T5H A;  4QWB A;  3BZC A;  2DWQ A;  4Q44 A;  4B9N A;  1EXN A;  3ISD A;  2F3N A;  5KG1 A;  9ICE A;  5DB7 A;  4UAV A;  4TQS A;  4XA5 A;  4Q8F A;  1Q3V A;  3UXO A;  3RH6 A;  4DS5 A;  2YTU A;  4F5R A;  2B21 A;  1KDH A;  1N5W A;  1NK9 A;  4FBT A;  4IQV A;  2E3T A;  5EWF A;  3RR7 A;  7ICG A;  2ISP A;  1JMS A;  1ZQK A;  4ELT A;  5AK6 A;  3ZDB A;  2LM1 A;  2BCS A;  2C2R A;  3UQ2 A;  4IRK A;  1ZQF A;  1IXR A;  4YVZ A;  2WF5 A;  5J0S A;  1NK4 A;  2ZUB A;  8ICH A;  4GLX A;  4J9S A;  4P0P B;  3TKA A;  1JX4 A;  4MF2 A;  3JPR A;  3TAD A;  2ZIX A;  3H40 A;  5HR6 A;  2IOH A;  5CJ7 A;  3V7L A;  4RT2 A;  3GV7 B;  1S76 D;  1ZQD A;  2Y9U A;  5J8Y A;  2BCU A;  3RAX A;  1CUK A;  4DFD A;  4NL9 A;  4QZG A;  4GFJ A;  3MGI A;  3N97 B;  2GLE A;  3SEN A;  3SV4 A;  3ZD9 A;  2BQ3 A;  5AKH A;  4JV0 A;  3B9J A;  2EQY A;  4I27 A;  4GXK A;  4OJ6 A;  3TAR A;  3BS5 B;  4FZN A;  2H3F A;  5KFY A;  4ED3 A;  1C20 A;  4NY8 A;  2F44 A;  1Z4O A;  1SGG A;  2DKZ A;  3VC8 A;  1A0P A;  5ALF A;  8ICV A;  3TAC B;  4DQR A;  4C8K A;  5J2H A;  1NK0 A;  4QWC A;  2DKX A;  5AI4 A;  3ZDE A;  4OO1 J;  5DG9 A;  4I2H A;  2DL0 A;  2MUT B;  4YR2 A;  5TZV A;  2C2E A;  2BDU A;  2BR0 A;  2EDU A;  2W54 A;  2E5S A;  4PGY A;  3SAG A;  3SEI A;  8ICJ A;  5KG6 A;  5J29 A;  1GO3 F;  2FMQ A;  2KVS A;  1XWL A;  3V7K A;  3KD3 A;  4R65 A;  3HJE A;  4US9 A;  5HML A;  3ORY A;  4ICA A;  5EE0 A;  4KLI A;  5KL1 B;  4KLG A;  4I2D A;  5AKY A;  4TUQ A;  4P4O A;  3KBB A;  5KFG A;  4O5E A;  3JPQ A;  3HWT A;  2HHX A;  4YD2 A;  1MC8 A;  2F1I A;  5E79 U;  5KNI A;  4ELV A;  3QX7 A;  2PI4 A;  4IS7 A;  4OJ5 A;  2Y0S F;  3OGU A;  3RBE A;  3PR4 A;  3CYM A;  5JUM A;  3T5L A;  4UW9 A;  4ED2 A;  2G08 A;  1BPY A;  1COK A;  2HHV A;  4QJF B;  4J9L A;  2ESE A;  8ICM A;  1ZJN A;  3AUO A;  1ZQT A;  1X40 A;  4JMU A;  3UQ0 A;  5ALW A;  4QIW F;  4PL1 A;  5III A;  5DBC A;  2E8O A;  9ICO A;  3RRH A;  3C1Z A;  5DKW A;  5KG7 A;  4RQ0 A;  4R64 A;  3THV A;  3N28 A;  5DB6 A;  3EZ5 A;  1OUQ A;  2AHO B;  4U7C A;  2XY5 A;  2KIW A;  4TQR A;  4Y2J A;  2BCV A;  3V6H A;  4IR9 A;  3Q8L A;  2JRZ A;  3ZDC A;  1BNO A;  1ZQO A;  1F5S A;  2FLP A;  4B6J A;  4YR3 A;  3FM9 A;  3PX0 A;  4X5V A;  3C29 A;  5J0P A;  4UAS A;  2ZIW B;  5JU5 A;  3DV9 A;  1XSP A;  1JRP A;  1ZJM A;  1BPX A;  5KFQ A;  4EEL A;  4GXI A;  1RYU A;  3IM1 A;  5DB8 A;  5T14 A;  4AYB F;  2CXY A;  3C23 A;  3SI8 A;  4US8 A;  3CRX A;  2KJ8 A;  4F93 B;  2W8L A;  3RB4 A;  1JIH A;  9ICG A;  4XUS A;  4EEK A;  2DF4 B;  4C8M A;  5KT3 A;  1SIJ A;  3WK5 A;  4KLT A;  3IG5 A;  2PFP A;  1RYS A;  3WKC A;  3Q8R B;  3E0F A;  4M9L A;  3D2S A;  4IR1 A;  1HIW A;  3SAH A;  3ZI4 A;  4DOA A;  3QU2 A;  2BQU A;  1SKR A;  2KZZ A;  9ICN A;  2KG5 A;  3WKE A;  3L3F X;  3RJK A;  2ZIU B;  1O08 A;  4P0P A;  2W9C A;  5ALK A;  4YR0 A;  3Q8P B;  1VDV A;  1TK5 A;  4DQS A;  2BQR A;  5KT5 A;  2HSZ A;  4ECS A;  2XGP A;  4NM2 A;  1D8L A;  2JEG A;  2J6T A;  4R63 A;  2NRT A;  4B9M A;  3OTQ A;  1J2N A;  3F5E A;  4DLE A;  2JEI A;  3TQ1 A;  1U9L A;  4RNM A;  3AQE A;  4C80 A;  2LKY A;  3QU4 A;  1V97 A;  3K75 D;  3V7J A;  2HDO A;  4Y2Y A;  2RRD A;  2HBM A;  5EE3 A;  3T5J A;  1KL9 A;  3ZD8 A;  4CF5 A;  4EBD A;  4QZI A;  2VA3 A;  1NI3 A;  1N60 A;  3SV3 A;  8ICR A;  4M04 A;  3RJH A;  3S6J A;  4F4X A;  7ICP A;  5CA7 A;  2VA2 A;  3PX6 A;  4P2H A;  3D2Q A;  1DK3 A;  2HOI A;  1PZN A;  2QB0 B;  2C22 A;  2KVC A;  2HHW A;  1SV0 A;  3AQF A;  2F1J A;  3M6Z A;  4B9T A;  4ACO A;  3A0B U;  5G5G A;  4RT3 A;  5J2A A;  4IC9 A;  2YML A;  9ICV A;  4JV1 A;  4PZO A;  1RXW A;  1ZQP A;  2IHN A;  1N48 A;  1ZD2 P;  3UM9 A;  2XY7 A;  2FDR A;  3KHH A;  3CNH A;  4XRH A;  2N1R A;  3PSI A;  4RQ5 A;  2HVI A;  1QTM A;  3KHG A;  1NZB A;  1UHU A;  1JUD A;  2HW3 A;  4ECX A;  3AU6 A;  2NRV A;  4RPY A;  2Y1J A;  2A3V A;  2AXT U;  3RTV A;  8ICT A;  4F50 A;  4I28 A;  4FS1 A;  1QSL A;  3FAH A;  5CWR A;  4DSK A;  4O3S A;  5KG5 A;  4RZR A;  3IN5 A;  2OYY A;  3ICX A;  1BGX T;  3QZ8 A;  3R9K A;  4AYB C;  1TAU A;  5L1M A;  5DB9 A;  2C2D A;  3IRU A;  1SB3 C;  2I5H A;  5AK3 A;  2VKQ A;  4DF8 A;  1KBU A;  3TAN A;  1LVH A;  4RQ7 A;  3SYZ A;  2G06 A;  3BS7 A;  1DK2 A;  2P6R A;  5G5H A;  1XNS A;  5KFJ A;  5ALD A;  5B66 U;  1ZQU A;  1QSS A;  1ZQE A;  2QAR A;  5GTH U;  3WKB A;  4NV0 A;  4O3M A;  1FFU A;  2UVR A;  2RDI A;  3I76 A;  2WTF A;  4EZ6 A;  4UQG A;  5AHX A;  1CRX A;  2HHS A;  4TUS A;  1TE2 A;  5F9N A;  4O5K A;  5KFV A;  3PO4 A;  3OHB A;  4DSF A;  2HHU A;  2KE7 A;  1C7Y A;  2EZX A;  3MFH A;  5KFE A;  2OXO A;  5L9X A;  3OJU A;  4Y2S A;  4EYI B;  4OD0 A;  5AKI A;  1F44 A;  2Z7J A;  5DBA A;  2DGZ A;  5CHG A;  4OJL A;  4QZB A;  3ETL A;  4J9K A;  3AN1 A;  3RF9 A;  2LYA A;  4HYK A;  4FZL A;  2KTQ A;  1SL2 A;  5DGB A;  3KTQ A;  5ALI A;  3MDA A;  2MU2 A;  4QZC A;  2NV3 A;  3QEA Z;  3K1Z A;  4DO9 A;  2HHT A;  1SZH A;  1ZQC A;  2YMP A;  5DGA A;  4DFJ A;  4DSI A;  4UAU A;  4UAW A;  2UVW A;  8ICE A;  4BDP A;  4Q45 A;  5AM4 A;  4KTQ A;  4ED7 A;  2JEJ A;  3RJG A;  4UB2 A;  2JZB B;  4O9M A;  4ECZ A;  4RPZ A;  1AQ6 A;  9ICR A;  4C4S A;  2W9C B;  2K4I A;  4F4Z A;  2BHN A;  5CRX A;  1RM6 C;  1S77 D;  4Y2P A;  2KMD A;  3NRW A;  1CEZ A;  2UVU A;  4Z6F A;  2WF8 A;  3E58 A;  3MGH A;  1X42 A;  1DGS A;  4IL6 U;  4RUA A;  4IQT A;  1QSY A;  2PI5 A;  4DWI A;  2ZTD A;  4C7Z A;  1T94 A;  7ICF A;  2RHF A;  4M47 A;  3LWM A;  3RH4 A;  5IIJ A;  3T3F A;  4EX6 A;  1Z1B A;  1COO A;  3ISC A;  4B9U A;  1TKD A;  3NVW A;  9ICQ A;  4YG2 A;  1PK1 A;  2H3Z A;  3EPI A;  1URJ A;  7ICR A;  1RYR A;  4Z6D A;  1ZET A;  3KZX A;  1FEZ A;  1ZQX A;  2K60 A;  3MR5 A;  2JH7 A;  2QB0 A;  2VJ4 A;  1IG6 A;  2H3I A;  3BQ2 A;  4NM1 A;  2D6F C;  2DPI A;  3AU2 A;  1T3N A;  4P4P A;  3EPG A;  2FE9 A;  4I2E A;  4P0Q B;  2G5H B;  1TK0 A;  2KK0 A;  3RB0 A;  2BCQ A;  3RR8 A;  2Y1I A;  4KLQ A;  4C7Y A;  2K8B B;  3WK9 A;  3Q8S B;  3I1Y A;  3RJI A;  3MGV A;  1B43 A;  5ALT A;  3H8J A;  1WYG A;  3GIM A;  3OSP A;  5ALE A;  5KFP A;  2GWS A;  4I2A A;  4KIT B;  1PVQ A;  1B22 A;  2LYB A;  5ALY A;  5K4L A;  5HP4 A;  8ICY A;  5AKK A;  3PVX A;  5GTI U;  1PK3 A;  4J03 A;  4BWJ A; 
#chains in the Genus database with same CATH homology
 2M0N A;  4P0Q A;  2YX8 A;  2K8A A;  2YB4 A;  3NUQ A;  1L6N A;  4FZN A;  2H3F A;  2RP5 A;  4BUG A;  5HR7 A;  3F5E A;  2KHV A;  2VKQ A;  1KBU A;  3PSP A;  4FZM A;  2WB1 F;  3PSF A;  3LVW A;  2ZIW A;  2KV2 A;  2G5I B;  2KKP A;  3VC8 A;  1XO0 A;  2ZIU A;  3AQE A;  3O0F A;  1A0P A;  2LKY A;  2G06 A;  2E1F A;  3C28 A;  2HBJ A;  3F2D A;  1OUQ A;  1MA7 A;  3D2N A;  2G09 A;  4CGZ A;  2K4I A;  2XID A;  4OJO A;  2W7P A;  3VCB A;  2RRD A;  4WJ3 B;  2HBM A;  5CRX A;  2K89 A;  2ZIV B;  4U7C A;  1Q3V A;  2H3V A;  2KIW A;  2CRX A;  2MA1 A;  3F2B A;  1XNS A;  2W03 A;  2GH1 A;  2XIC A;  3IP4 B;  3NRW A;  3GZF A;  3F2C A;  4OO1 J;  3AL0 B;  2CPR A;  3KFU F;  4QNL A;  2HBK A;  4PL2 A;  3H0L B;  2F77 X;  4NV0 A;  2KD1 A;  3T79 A;  4O3M A;  2BDU A;  1PVP A;  1ED1 A;  3ONN A;  3D2Q A;  2HOI A;  3F5A A;  3M7D A;  2G07 A;  4FE3 A;  3C29 A;  2K4H A;  2YB1 A;  4BX9 C;  1T94 A;  2KIC A;  2E5S A;  2Q4T A;  2E1E A;  2KVC A;  2RHF A;  2ZIW B;  2HOF A;  3SAG A;  2K4E A;  4U6P A;  2KKV A;  3AQF A;  2KJ5 A;  2OM6 A;  4NLB A;  1GO3 F;  1WUD A;  2KOB A;  3M6Z A;  1CRX A;  2K8C B;  4ACO A;  2ZIX B;  1D8B A;  1Z1B A;  2ZIV A;  1Z19 A;  2ZG6 A;  5T14 A;  4AYB F;  4C0Z A;  2JMG A;  2CN1 A;  3PZP A;  4NWI A;  2WAQ C;  2F76 X;  3M6K A;  2G0A A;  3CRX A;  4IC9 A;  3RFA A;  2F2A B;  2KJ8 A;  2VJ5 A;  2WAQ F;  3GU3 A;  4KMO B;  2OXO A;  4BJQ A;  1IIP A;  4ICA A;  1Q3U A;  1DRG A;  2H3Z A;  3H0R B;  2HMX A;  1URJ A;  3N7S C;  2KJ9 A;  4OJP A;  1F44 A;  2KEY A;  2Z7J A;  5KL8 B;  2DF4 B;  3ALR A;  3KZX A;  5A0L A;  4P0P B;  2DGZ A;  4KX3 A;  5KL1 B;  2OH2 A;  1UPH A;  4A8E A;  2JH7 A;  4OJL A;  3SMV A;  3IG5 A;  2VJ4 A;  2XI9 A;  2H3Q A;  2F8L A;  2PMZ F;  3PST A;  1ZQ1 C;  3F53 A;  2H3I A;  3RF9 A;  2DQN B;  3IG8 A;  2LYA A;  3HKZ F;  2D6F C;  2N1R A;  2ZIX A;  3LYS A;  1ECW A;  4FZL A;  3E0F A;  3PSI A;  3D2S A;  5HR6 A;  3DEE A;  2Y0S C;  2XVT A;  1NZB A;  4P0Q B;  2ZXH A;  2G5H B;  4CDG A;  2VIX A;  1HIW A;  2W04 A;  2PMZ C;  3SAH A;  1TAM A;  1HEK A;  3HKZ C;  1YT3 A;  3N7R C;  2W7O A;  1A6S A;  2K8B B;  3LVV A;  3H0M B;  3SAF A;  3SQI A;  1PVR A;  2ZXI A;  2NV3 A;  2WB1 C;  4OJ5 A;  1P7D A;  2Y0S F;  3L3F X;  4GFJ A;  2A3V A;  5C0Y A;  2ZIU B;  3MGV A;  3CYM A;  3K1Z A;  3OPX A;  2G08 A;  4QIW C;  4P0P A;  2HBL A;  4QJF B;  2HOQ A;  2KNJ A;  1SZH A;  2LHT A;  3CP8 A;  2JGA A;  4NLC A;  2KHQ A;  2JH1 A;  1PVQ A;  2LYB A;  4KX5 A;  2OYY A;  3IN5 A;  2MRL A;  3ICX A;  4OJ6 A;  4JMU A;  4CRX A;  2LBO A;  3N7P D;  4QIW F;  2GOL A;  4PL1 A;  4AYB C;  2JHD A;  2R18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...