2KD1A

Solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
MEPSKLSYGEYLESWFNTKRHSVGIQTAKVLKGYLNSRIIPSLGNIKLAKLTSLHMQNYVNSLRDEGLKRGTIEKIIKVIRNSLEHAIDLELITKNVAAKTKLPKADKEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA integration/recombination/invertion protein
publication title Solution NMR Structure of the Integrase-Like Domain from Bacillus cereus Ordered Locus BC_1272. Northeast Structural Genomics Consortium Target BcR268F.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
total genus 37
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kd1A00
4CRXA 1Z1BA 1DRGA 2A3VA 3LYSA 1Q3VA 1P7DA 2HOIA 2KIWA 2KD1A 1KBUA 2HOFA 2KEYA 3MGVA 1PVPA 3CRXA 1F44A 2KHVA 3C28A 1A0PA 1Q3UA 1MA7A 1XO0A 2KHQA 2KOBA 2KKPA 3NRWA 1NZBA 2KJ8A 2KJ5A 1PVRA 1PVQA 4ACOA 1Z19A 1XNSA 2KKVA 5CRXA 1OUQA 1CRXA 2KJ9A 4A8EA 3C29A 2OXOA 2CRXA
chains in the Genus database with same CATH superfamily
4TQRA 3D2SA 5ALGA 3UXOA 4IRDA 3E0FA 3UMCA 3PSFA 3C28A 4LZDA 5AK5A 2KICA 3CW2C 4Y2PA 2IOFA 5DBAA 4NXZA 2D6FC 5HNKA 3M8RA 1ZQYA 2QB0A 4EBDA 8ICSA 1UA0A 2LYHA 5DB9A 2BGWA 1ZQPA 2JEJA 1ZQOA 3SENA 4KX5A 4AYBF 3TAPA 4KLQA 3NS1A 4I2BA 8ICOA 3AQFA 3K75D 2XICA 1FEZA 1BGXT 2AH5A 3WK8A 2OEHA 2R18A 2ZUDA 2PI4A 4DS4A 2RQ5A 5AM2A 5KT3A 2VA8A 3EYZA 3AM9A 2HMXA 2KD1A 4C4RA 4BX9C 2ES6A 2XCPA 4BUGA 5H2FU 3RB4A 2ATLA 2W9CA 1ZQJA 2DFLA 1KN5A 4F2RA 2WB1C 3C29A 1T94A 4F3OA 3KOOA 2DGZA 4QWEA 3BQ1A 3T5LA 2LI6A 3H8JA 3QE9Y 4JV2A 3RAQA 4QZIA 5KG1A 4F5RA 4JV0A 3KHRA 4F4YA 3BQTA 1B0XA 3RR8A 5ALRA 3UQ2A 3GV5B 2HHQA 2O6KA 5AIAA 4KLGA 3M9MB 3V6JA 5KG2A 4DSKA 3G6XA 2DKZA 3TI0A 1ZQWA 3C21A 4I2DA 5ALDA 4GLXA 2MSNA 1WWUA 5CEHA 3HJEA 4UBCA 3LWMA 3N7SC 2Y0SC 3EUB2 5AIBA 2XY6A 7ICMA 1SV0C 4B9NA 2D8CA 1EXNA 5D4BA 2M9NA 8ICKA 2K8CB 5KFLA 2W55A 1L7OA 2MUTA 2V9WA 1NK6A 4DQIA 2AJQA 4YD2A 3SV3A 2IOFK 4P0PA 4YMOA 4UB2A 4EX6A 4KLDA 5ALIA 3OTQA 3GIKA 3OPXA 4G9BA 1RYRA 1X6JA 4RQ4A 4Y2RA 1NOMA 4NM1A 4NJ8A 1L8LA 1ZQXA 3BQ2A 3FDSA 3MR3A 8ICRA 1UT5A 3IHQB 4EZ6A 9ICHA 3B0XA 1QQ6A 3DV9A 4MHVA 2WAQC 2KFZA 1T3QA 1KFDA 2VA2A 4QW8A 2PKEA 2ZG6A 4EZ9A 1X6IA 1N2XA 2JH1A 2YY6A 3HKZC 4F4XA 1IM4A 2HVHA 2HHWA 3OSNA 2M0NA 1P7DA 2OHFA 5KG4A 7ICPA 5AI8A 8ICPA 4KX3A 2A1AA 4PZNA 1UQVA 3RJFA 8ICUA 2ASJA 1X9WA 4I2AA 1S0MA 5EWEA 3SEIA 2W9MA 3EWAA 3RR7A 1ZQRA 3EPGA 4FE3A 4IC9A 2J6UA 2K4EA 1SKWA 3BS5B 5J8YC 4C8KA 7ICKA 3MABA 1ZRMA 2WF8A 4PGXA 4DLEA 7ICQA 4RQMA 1RG6A 3SAHA 1S77D 4NL9A 2ZIWA 5KFNA 4B6JA 3H4DA 3QUQA 4Q45A 4ECSA 4LVSA 4A8EA 4NLZA 3TADC 2KZMA 3WK4A 4Q8EA 2Y9UA 4J9QA 4EBEA 1UPHA 5ALKA 1ZD4A 1KBUA 3DDHA 2G5IB 3GIIA 3RBEA 5HMLA 3FM9A 1N60A 1UCVA 4ED6A 1NK7A 2IA6A 3PSTA 1BVSA 4IL6U 5L1LA 3PX6A 5CHGA 3MR6A 4QZAA 4QWDA 1BPEA 3MC1A 3CYMA 5AKIA 2NRVA 1NZPA 4ECVA 1X42A 2VA3A 3JPNA 3RH6A 9ICMA 2DPIA 5AKEA 2B6GA 4O5KA 4ECQA 5KFYA 5TZVA 4KLFA 2KOBA 1SZPA 2F77X 2YMQA 2W11A 1JALA 4B9LA 2KG5A 1LVHA 1ZOLA 2ZIUB 9ICTA 5HHHA 2EH9A 4K4IA 4CF5A 5KT4A 4KN7A 4ELTA 1TAMA 9ICSA 2I1QA 2EAPA 9ICJA 4QW9A 3B9JA 2FPKA 5KFOA 3RBDA 2DUYA 2PMZF 1KSPA 3PV8A 3PX0A 1QSLA 2W9BB 3UQ0A 4FBUA 8ICFA 3V6HA 4J9KA 1ECWA 3N28A 3FYHA 3JPPA 3ZD9A 3MBYA 3IP4B 3S6JA 4G3IA 9ICQA 1KFTA 1B22A 9ICOA 5J8YA 3H7IA 3RJGA 2B21A 2QARA 4NLGA 5ALWA 4ELVA 4UATA 4RQ1A 3NRZA 3LWLA 4EEYA 2L5YA 5J2AA 5CA7A 1SKSA 5KFBA 2ESEA 3J81j 1ZQCA 9ICCA 3A0BU 3PX4A 3GDXA 2YMLA 4RQ0A 3E2EA 3RRHA 4B9MA 1L8OA 2LM1A 2NRTA 4E0DA 3M6ZA 1FFVA 4C8NA 7ICLA 3UMBA 2R8KA 1ZRNA 2BCUA 2WHEA 3Q8SB 1NKCA 3C2LA 3QU5A 3AN1A 1XU4A 3CNHA 1S76D 4ED8A 2ZXHA 2C2DA 2YB1A 2W54A 3N7RC 1X40A 3T5KA 3M1YA 3PMLA 4BGDA 5DG7A 5HR7A 5DQGA 3KZXA 1ZQAA 3MFIA 4AYBC 4Y2UA 2HOQA 5IIOA 5KFPA 4Y2QA 1MQ2A 5J0RA 3HRDD 1UA1A 5J29A 4CGZA 2K89A 1TK8A 2CPRA 5KFWA 3CRXA 2ZIVB 2AQ4A 4C8OA 1T7PA 9ICBA 7ICOA 4I29A 1KKXA 2EAMA 4QZCA 4PHDA 4M9LA 4FO6A 4B9SA 2OYYA 5ALXA 4MF2A 5HP4A 4UAYA 3PO5A 9ICVA 3Q8RB 3L5KA 4OJ5A 4DQPA 4RUCA 3C2MA 5KFVA 1ZQEA 3MDAA 8ICAA 5D49A 4ACOA 9ICXA 2EQYA 2R8HA 4TUSA 2HBLA 4UB8U 3Q8KA 1Z4OA 5ALNA 1H38A 3NVVA 2JEIA 5L1IA 2ALZA 4DF4A 1NZBA 4IRKA 5DG8A 3RB0A 3ZD8A 2KV2A 2KVCA 4Z6DA 2PFOA 3UM9A 3AEVA 4DFDA 3PR4A 3D2NA 5EOZA 8ICCA 4USAA 2ZIXB 1JN3A 3JPTA 1KLNA 4F4WA 4BXOA 1V38A 2F76X 4R8UA 4C80A 3K1ZA 5T14A 4KLHA 2VANA 2J6SA 4Z6EA 3C1YA 1D8YA 9ICIA 1Z00A 3F53A 3NASA 3PVXA 7ICRA 2XGPA 5DBCA 2EAOA 3HT3A 4DOCA 3PZPA 4F5PA 4C7ZA 3PW5A 1BNPA 5DQHA 4BJQA 4DQRA 4YXJA 4UARA 4QZEA 2QB0B 4XQ8A 5F9LA 4DFPA 1NK9A 4KLEA 7ICTA 4ED3A 1QSSA 3Q8QB 3IDWA 1ZETA 4FS1A 4YN4A 5DQIA 4F5QA 4PZOA 4RUAA 3ONNA 5AM3A 4M0AA 2BKEA 2XIDA 3H8SA 2HHTA 2HSZA 1N62A 3BZCA 1YT3A 1RQLA 3RTVA 4JMUA 3GV8B 4C8LA 2F1JA 4JB3A 4J9SA 4NLKA 2FI1A 5KT7A 2Y1IA 4F4KA 4XUSA 1SKRA 4B9VA 5AKLA 4ECYA 2KVSA 2XVTA 3RAXA 4AP9A 5AKXA 2W9CB 5F9NA 3RH5A 2F3NA 2VJ5A 5AI0A 2FMQA 2H5XA 3TACB 2BZFA 2FJ6A 1S97A 4IQVA 3WKDA 2XY5A 2JV3A 5ALPA 4RQ8A 2RP5A 1L5UA 2FPLA 4MEXA 5J2EA 5KFZA 1ZD2P 1ZD3A 2G06A 4PPXA 4P4OA 5GTHU 1RM6C 8ICJA 2JEFA 2E8MA 3RJKA 2YX8A 4YR3A 2GOLA 1A76A 5L1JA 3QU2A 2E8PA 1IXRA 1RPLA 1ZQIA 4F8RA 4NM2A 3WKEA 1XSPA 1KRPA 4C4SA 2Z7JA 3TAQA 1QH9A 4YXMA 2NYVA 5AK6A 4ED0A 1BPYA 3R9KA 8ICEA 3U26A 1QLNA 4HYKA 1WWVA 2C2EA 4QZHA 4YP3A 4XA5A 2KHQA 4Q8FA 2KKPA 3VCBA 4DWIA 2K4HA 9ICUA 1ZQGA 4C8MA 8ICYA 1RQNA 5BOLA 4DL2A 1UT8A 2LYBA 4MFFA 1Z3EB 4RT2A 3WK7A 1N5WA 1KTQA 4DLGA 4F50A 7ICJA 2CRXA 1LV5A 2BDUA 2MUTB 3ORYA 3JPOA 2G0AA 3TKAA 2BPGA 5CWRA 4K4HA 1PK1A 3KHLA 4DSLA 4P0PB 4DOAA 2HBKA 2ISPA 2IBKA 8ICLA 1OXJA 1NI3A 4DEZA 1QSYA 4DO9A 4NL9C 3I28A 4DQSA 2ZUBA 3BJYA 4CRXA 3GFKB 2XGQA 4ECXA 1Z1BA 3CP8A 1TKDA 2RLTA 4Y2JA 4YR0A 3KD3A 3QUBA 4UAVA 4I2CA 5DGAA 1N48A 1M6YA 1WYGA 1U47A 1ZQBA 2KJ8A 3KKAA 3UMGA 4YQWA 5DLFA 1HUZA 4QZ9A 1IIPA 5EE3A 2RRDA 1ZQKA 1HEKA 1WCLA 1LB2B 2H3FA 1FIQA 4O3MA 1ZQMA 1TAQA 5KAFU 5AKYA 2UVWA 3ZDBA 4QWBA 3NTUA 4O0IA 1SWVA 2ZJ5A 1N63A 5CJ7A 1KQQA 2VKQA 1S8OA 3WK5A 2FMPA 4DL7A 2HVIA 1S5LU 4RPYA 1ZQQA 2NRZA 4ECRA 3AU2A 4FS2A 1RXVA 2HOIA 3BQ7A 3ZDEA 3SD7A 2ZJ8A 1VLBA 2XC9A 1YZ6A 4C4TA 1O03A 2BPCA 4YCXA 1L7NA 4NLBA 2YQEA 4KLOA 3GILA 4TQSA 1DGSA 5KT2A 8ICTA 4FZNA 3NVYA 1SL1A 4O3NA 1SZHA 2Q0ZX 5ALEA 5HMMA 2KIVA 2H3VA 5J2DA 4OCZA 1J97A 3BS7A 1WCNA 4ECZA 4O3PA 1PUZA 5KAIU 2KMDA 2ZIWB 5B5EU 1KFSA 2FLNA 4YMMA 3V6KA 4J9RA 3UPQA 8ICXA 4PH5A 5AM5A 2W43A 4KLIA 1Z19A 3IG5A 2AGOA 1S10A 2A1JA 4DSEA 1XS9D 3EPIA 1L7MA 2EZZA 4YMNA 5IIJA 3PNCA 4P0QA 2MU2A 2XI9A 5G5GA 5J2JA 4C0ZA 5ALFA 1BPBA 1N61A 1MA7A 3HPOA 4DFJA 4UAZA 4RZRA 4KITB 4Q43A 1A6SA 3KZIU 1SIJA 3H4BA 4J9OA 3GU3A 4RQ7A 4ED2A 3LYSA 5JTIA 4RT3A 1L6NA 4PHEA 5KFEA 2J6TA 9ICPA 3FAHA 1B4FA 1U49A 1Z1VA 1VJ5A 8ICHA 2KJ5A 3UXNA 2JH7A 2E3TA 1PVQA 4Z6FA 5ALYA 5KNIA 3ZDAA 2P35A 4RPXA 5DBBA 4O5CA 3QUCA 4YVZA 7ICSA 1XC9A 4CCHA 3F5EA 3T5HA 3WK6A 4F4ZA 1L3TA 2HI0A 4RQ5A 3IG8A 1X66A 1ZQTA 3LDAA 3T3FA 2EZYA 4M04A 5AICA 2V4QA 3OHAA 4F5NA 2OM6A 2Y0SF 4Z6CA 5ALMA 1JRPA 5KG3A 4OJ6A 4O3OA 1BPXA 1U9LA 2HBJA 3V7KA 4I2EA 1JI7A 2QARB 1K5OA 3H0MB 4CNQA 7ICFA 4I28A 5KFHA 1JMSA 3PW4A 4QZBA 1ZQVA 1FFUA 2UVRA 5KFCA 2Y9TA 5AM1A 4Y2TA 3ZI4A 2NO4A 5J0WA 1U4BA 3TFSA 4RQ2A 2UVVA 3QEBZ 3ZDCA 5KFGA 5CR0A 3JPRA 5IINA 3O0FA 4OJLA 5J0QA 4ECWA 2PFQA 4QZDA 1BPDA 2KEYA 5KFRA 3EZ5A 2WAQF 2KHVA 2JZBB 1SXDA 4KLJA 3QU4A 1K1SA 5KFMA 3QXGA 1J2MA 4ICAA 3H8WA 4GIBA 1ZYQA 1XNSA 1Y88A 4QZFA 3HKZF 4RQ6A 1B43A 2E5SA 3HWTA 1NK0A 2PI5A 4US8A 3QUTA 4ED1A 1U48A 2C28A 4EYHB 3QNMA 5ALTA 7ICIA 3G6VA 2UVUA 3THVA 2G08A 3GQCA 4YR2A 2PFPA 5DG9A 2JRZA 5AI6A 1CUKA 3H0LB 1RDFA 3N7PD 3ED5A 3Q8PB 5D46A 1UHUA 2GWSA 1A0PA 4Y2SA 3PY8A 1N5XA 4QIWF 4C7YA 1X9MA 4IQTA 2WF9A 3UXPA 3F2DA 2PXIA 1KW4A 4XRHA 3ISBA 2HHSA 2Y1JA 1ZQ1C 4NWIA 2QLTA 2MRLA 3PW0A 2KTQA 4OJOA 2R8JA 5KFXA 4O9MA 1QCKA 4F91B 2CN1A 3SI8A 1SWWA 1D9DA 9ICAA 3M7DA 3NUQA 1XSLA 1S0VA 1V97A 5KT6A 1SB3C 1V85A 1A77A 2DL0A 4JUZA 1NJWA 2YN4A 3IV6A 1L3SA 4Y2VA 2E1EA 4KTQA 5L1KA 5CRXA 1TVAA 3V7LA 3SYZA 4BXOB 4JWNA 1IG6A 4RU9A 4R8UB 3PR5B 3F2BA 3Q8MA 4RQNA 5KT5A 3BDPA 3ISCA 1Z00B 4ECUA 2G09A 5AM0A 2A19A 4YG2A 1TK5A 2F8KA 1J2NA 3TQ1A 4DFMA 1COOA 3ICXA 4I27A 2FDRA 1V9PA 2HOFA 1LKYA 1S0OA 2NV3A 2IHMA 4LJXA 2EZXA 4QZ8A 1ZQDA 4DQQA 2C22A 4KLTA 1AROP 3EW9A 4J9MA 4UQGA 8ICGA 2KSOA 1KEJA 4EEKA 3V72A 4KN4A 2KJ9A 2LKYA 4TURA 2OCEA 7ICVA 5EE0A 4PHPA 2OH2A 2JR5A 5A0LA 4P2HA 5JU5A 4FFDA 2ZTCA 3SQIA 4KLMA 2KIWA 1COKA 2VIXA 3K1RB 2R8IA 2WF7A 4NV0A 3SR6A 2NRXA 1WG8A 1ZXIA 5ALLA 2WF5A 3ETRA 3F2CA 2DBYA 5J0PA 4QWAA 4O3SA 4KLLA 3AUOA 4CE6A 1C7YA 1ZQSA 2DF4B 3KHGA 3NRWA 3T5JA 2W04A 3HW8A 2F1IA 1SL2A 5ALJA 3OHBA 3KKAC 3SAGA 3M6KA 2QKQA 3C23A 4M9NA 1ZQLA 4M2YA 4BDPA 4KMOB 3SV4A 1D8LA 4M6WA 2W3SA 1NK4A 2G5HB 5B66U 2ZJAA 1OW5A 4X5VA 1FO4A 2G07A 5AK3A 1BPZA 1DGJA 1JROA 4UW9A 5KTQA 1SXEA 3I76A 1ZQUA 2V4RA 5AI5A 2P66A 1JUDA 4MFCA 4I2JA 1HIWA 2H3QA 2JMGA 3QU7A 5DLGA 4OO1J 1CEZA 7ICEA 4DSFA 1YZ7A 3C5FA 2W9AA 2W7OA 1JXLA 5KFUA 2ZTDA 1PK1B 2FPMA 2EANA 2YB4A 4GXIA 2ASDA 4J9PA 1JX4A 1ZQZA 4DS5A 4HAIA 5G5HA 5FP0A 1Q46A 2BQRA 4QZGA 3KHHA 4EELA 4FZMA 5EE9A 1SV4A 1NJXA 5AI9A 3VC8A 4MFAA 1DOQA 5DDYA 3D6JA 2KE7A 1NKEA 4U6PA 4GC7A 5KFIA 4NY8A 4OD0A 4R63A 2HCFA 2AHOB 2KZ3A 4MEYA 5IIKA 1Q3UA 1HUOA 1D9FA 3GIMA 2FLPA 4IQUA 4QWCA 2BQUA 1QTMA 7ICHA 2XO7A 8ICVA 2WF6A 1IV8A 1MC8A 4IR9A 3OGUA 4R64A 8ICIA 4DF8A 4PL2A 5J0SA 5DB6A 4ED7A 4UB5A 3T79A 3RJHA 1TE2A 1QQ5A 4LZGA 3RF9A 2JHDA 1L3UA 3TANA 4US9A 4DFKA 5J2HA 8ICZA 2B0CA 5AI4A 5IIMA 2BDPA 2AGPA 5KG5A 2ZTEA 7ICUA 5AKJA 2K8BB 4O3QA 2FLLA 4KMUA 2I6XA 2PMZC 4DSIA 5KG7A 1SGGA 3LVWA 3H0RB 9ICEA 2AXTU 2QB1A 2P6UA 4DL4A 1U45A 5ALQA 4DOBA 1SL0A 3SAFA 5J2IA 2LPEA 3MR5A 4DL5A 3OJSA 2FMSA 3C1ZA 2LHTA 3RJIA 3MGVA 3M9OB 4F5OA 3ETLA 4F93B 2KK0A 3RJJA 2A1JB 5KG0A 2MA1A 2RHFA 5ALOA 9ICNA 4P0QB 2YTUA 5J2CA 5J0OA 3MGIA 1JXEA 8ICQA 2HW3A 1NNLA 2DPJA 1TFRA 2JXJA 4JK1A 4IQWA 2WFAA 4GXJA 3QZ7A 3AL0B 3QYPA 9ICFA 8ICMA 2IOHA 2HHUA 4ZOHC 4B9TA 3IRUA 1XO1A 1WUDA 2BHNA 1T4GA 2W8KA 5HHIA 1ZD5A 4DL6A 4ELUA 4O5EA 2HHXA 9ICKA 3RFAA 5EE1A 1PVRA 5J2BA 2YMMA 3HP6A 3BQ0A 1Z4NA 2ZXIA 4QNLA 1DXSA 2KN7A 4M9GA 3M9NB 3LK9A 4GFJA 3QX7A 1NK8A 4UASA 4CDGA 4QIWC 4F92B 4RNNA 4RPZA 2XCAA 4J9NA 5KFSA 2WB1F 5CP2A 4BWMA 2F44A 2LYAA 3JPQA 3MDCA 4UB4A 4IR1A 4PGQA 1SV0A 1URJA 2YMPA 4JWMA 3SMVA 4FZLA 4ZH4A 3SZ2A 5AHXA 4K4GA 3WKAA 3Q8LA 3MFHA 4IS7A 1Q8KA 2C2RA 2BCRA 5DKWA 2ASLA 3BS5A 3MR2A 1L3VA 4BWJA 1O08A 5KFAA 1MN8A 2AGQA 3KBBA 2MAXA 3KTQA 3WK9A 1X9XA 4MF8A 5KFKA 5C5JA 4UB1A 4DSJA 1RYSA 4YFKA 5ALSA 4PL1A 5L1MA 5J0UA 2I5HA 4FBTA 1DRGA 2OWOA 2JGAA 5AKHA 2N1RA 1NJZA 3B0YA 2VJ4A 2NO5A 1K1QA 1XO0A 1NKBA 4EENA 1RZTA 1F0MA 1AQ6A 5DGBA 4Y2XA 2W3RA 4UAUA 2GH1A 4UB6U 5E79U 2E8OA 1T3NA 3LVVA 4TUQA 1QQ7A 2D3DA 2EDUA 3ZDDA 5J0YA 1RYUA 3WKBA 4J9LA 3M8SA 2P6RA 5J0TA 2GLEA 2F1HA 2RDJA 1BNOA 1C20A 4O3RA 2DWQA 3D2QA 7ICNA 1MQ3A 4GXKA 3KFUF 4Q44A 1ZQFA 5JRTA 3I1YA 2FE9A 1KDHA 5F3XB 2ISOA 4PHAA 3WKCA 5KL1B 3K4GA 1L7PA 2HDOA 2ZIUA 5JUMA 3QEAZ 3PO4A 4UAWA 1X2IA 2BR0A 1TK0A 4OJPA 1F44A 3L3FX 3HX0A 2AQ0A 3ISDA 4PJ0U 4I2IA 4PGYA 2H3ZA 3F5AA 4ECTA 1CRXA 2GO7A 2Q4TA 4YD1A 1X9SA 2W9BA 4CF3A 5CB1A 5ALZA 1CI4A 4QJFB 4RNOA 4NLCA 2KNJA 3TADA 3TARA 2KFNA 4U7CA 5KFDA 4KLUA 5HR6A 2KKVA 4TUPA 2JEGA 4GC6A 5ALUA 3TFRA 3RJEA 1XWLA 2F8LA 5DB8A 2ODGA 4J03A 1PZNA 1S0NA 3AMZA 1RXWA 4I2FA 3H40A 2IHNA 3PSIA 2IMWP 4JV1A 3MGHA 5IILA 2JZBA 2BCSA 3PMNA 1ZJNA 3C2KA 1XSNA 1TAUA 5BOMA 2W7PA 5KFQA 3NGDA 3NVWA 4M9HA 2NRWA 3L4PA 1NK5A 4M9JA 3WU2U 9ICRA 3GV7B 5AKKA 5AM4A 5K4LA 5C0YA 5BPCA 2ZUCA 3BZKA 4I2HA 2HHVA 4P4PA 2W03A 4R66A 4EBCA 4P4MA 1ZQHA 1LKYB 4DCCA 4B9UA 5EWFA 4NLNA 2K4PA 3AQEA 4RQ3A 5KFJA 5TISU 8ICWA 5ALVA 5DB7A 2KSOB 3RB3A 5KG6A 2ZIVA 4F2SA 2BCVA 2XY7A 5KL8B 2K8AA 2LMRA 5KFFA 1JIHA 2H3IA 1OUQA 2CXYA 1T8EA 2DKXA 2OXOA 3PW2A 2A3VA 1Q3VA 3C5GA 2AU0A 5ALHA 1N56A 2K4IA 5J2FA 1PVPA 2K60A 1VDVA 2E1FA 3RRGA 3IN5A 4DL3A 2R8GA 1PK3A 3PSPA 3QZ8A 1S9FA 2KP7A 5GTIU 4EYIB 1NJYA 4UB3A 5J0XA 8ICNA 5AKZA 4I2GA 4CF4A 9ICLA 8ICBA 3HILA 3QU9A 2LM4A 5J2GA 1ED1A 4M47A 3IM1A 3NVZA 3DEEA 1DK3A 1HJPA 2BCQA 4IRCA 7ICGA 2PFNA 4UBBA 9ICGA 4RNMA 2I9GA 1GO3F 1KL9A 3OSPA 2LBOA 2BQ3A 2HBMA 3V7JA 2KZZA 2F2AB 3E58A 5J2KA 3GIJA 3H8MA 5AKGA 9ICWA 5KFTA 4R65A 5L9XA 1ZQNA 5EWGA 4M6WB 3ALRA 3RH4A 2ZIXA 4KLSA 4Y2YA 3OJUA 3PW7A 1D8BA 2W8LA 4WJ3B 3FC4A 3G6YA 4F71A 2BPFA 3AU6A 3N97B 5IIIA 1TV9A 5DDMA 2DQNB 4F72A 2WTFA 3RB6A 5AK4A 1MSWD 4EX7A 2E8NA 3A0HU 3N4MB 1ZJMA 1F5SA 3GZFA 3JPSA 2RDIA 1DK2A
chains in the Genus database with same CATH topology
2Z7JA 5KL1B 4CDGA 3HKZF 4CGZA 3D2SA 4QIWC 2ZIUA 1TAMA 2K89A 2CPRA 2K8BB 2HOIA 3AQEA 4BJQA 2E5SA 3E0FA 2HOFA 3CRXA 4KX3A 3F5EA 2NV3A 2ZIVB 2PMZC 2WB1F 4OJPA 3PSFA 1F44A 3C28A 1HIWA 5HR7A 2KHQA 3LVWA 3L3FX 2KICA 2KKPA 3H0RB 3VCBA 2K4HA 4NLBA 2LYAA 2D6FC 3IG8A 3N7SC 2H3QA 2ZIVA 2Y0SC 2H3ZA 2JMGA 3F5AA 5KL8B 2PMZF 2K8AA 1URJA 4OO1J 2LYBA 4FE3A 2OYYA 2H3IA 4FZNA 4IC9A 4FZLA 3SMVA 3SAFA 1OUQA 2KJ9A 1CRXA 2K4EA 2LKYA 3ONNA 2W7OA 2G08A 1SZHA 2XIDA 2OXOA 2Q4TA 2CRXA 2OH2A 2H3VA 2OM6A 2Y0SF 2BDUA 2A3VA 1Q3VA 3H0LB 1ECWA 1YT3A 5A0LA 4KX5A 2K4IA 4AYBF 3SQIA 2KIWA 2K8CB 2LHTA 2YB4A 3N7PD 4JMUA 2G0AA 3MGVA 1PVPA 2ZIWB 3SAHA 4OJ5A 4OJ6A 1A0PA 2E1FA 2VIXA 3IP4B 3AQFA 2HBJA 4QJFB 3IN5A 4NLCA 2KNJA 4QIWF 2XICA 4P0PB 2ZIWA 3PSPA 2HBKA 2MA1A 2RHFA 3F2DA 4ACOA 4U7CA 3H0MB 1Z19A 4FZMA 3IG5A 4NV0A 5HR6A 2R18A 2KKVA 3VC8A 4P0PA 4P0QB 4A8EA 1ZQ1C 4NWIA 2HBLA 4PL1A 2MRLA 4U6PA 4CRXA 1Z1BA 3OPXA 4OJOA 1DRGA 3CP8A 2JGAA 2XVTA 2F8LA 4P0QA 1UPHA 3F2CA 2HMXA 2CN1A 2KD1A 2N1RA 1KBUA 2XI9A 2G5IB 4C0ZA 2VJ4A 4BX9C 1ED1A 1Q3UA 4BUGA 1MA7A 3DEEA 3M7DA 3NUQA 1XO0A 2DF4B 2VJ5A 3PSIA 3NRWA 1NZBA 2KJ8A 1A6SA 2W04A 3PSTA 1GO3F 1IIPA 2KV2A 2KVCA 3GU3A 3AL0B 2LBOA 2GH1A 2HBMA 2E1EA 2RRDA 5CRXA 3M6ZA 1HEKA 2WB1C 3D2NA 3C29A 2RP5A 3SAGA 1T94A 2F2AB 2H3FA 2WAQC 3M6KA 3LVVA 2ZIXB 3CYMA 4O3MA 3F2BA 3O0FA 3LYSA 4OJLA 4PL2A 2W7PA 1WUDA 1L6NA 2DGZA 3ALRA 3T79A 2KEYA 2F76X 2G06A 2ZIXA 1D8BA 4KMOB 2ZXHA 2WAQF 2KHVA 2YB1A 3K1ZA 3N7RC 2G09A 5T14A 2KOBA 4WJ3B 2VKQA 2YX8A 2ZG6A 3D2QA 2G5HB 2GOLA 3RF9A 2JHDA 2DQNB 2KJ5A 3RFAA 2F77X 3KZXA 3KFUF 5C0YA 4ICAA 2JH1A 2JH7A 3F53A 3HKZC 1PVQA 1PVRA 4AYBC 2G07A 2HOQA 2ZXIA 4QNLA 2ZIUB 1XNSA 2W03A 3GZFA 4GFJA 2M0NA 3ICXA 1P7DA 3PZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRX A;  1Z1B A;  1DRG A;  2A3V A;  3LYS A;  1Q3V A;  1P7D A;  2HOI A;  2KIW A;  2KD1 A;  1KBU A;  2HOF A;  2KEY A;  3MGV A;  1PVP A;  3CRX A;  1F44 A;  2KHV A;  3C28 A;  1A0P A;  1Q3U A;  1MA7 A;  1XO0 A;  2KHQ A;  2KOB A;  2KKP A;  3NRW A;  1NZB A;  2KJ8 A;  2KJ5 A;  1PVR A;  1PVQ A;  4ACO A;  1Z19 A;  1XNS A;  2KKV A;  5CRX A;  1OUQ A;  1CRX A;  2KJ9 A;  4A8E A;  3C29 A;  2OXO A;  2CRX A; 
#chains in the Genus database with same CATH topology
 4TQR A;  3D2S A;  5ALG A;  3UXO A;  4IRD A;  3E0F A;  3UMC A;  3PSF A;  3C28 A;  4LZD A;  5AK5 A;  2KIC A;  3CW2 C;  4Y2P A;  2IOF A;  5DBA A;  4NXZ A;  2D6F C;  5HNK A;  3M8R A;  1ZQY A;  2QB0 A;  4EBD A;  8ICS A;  1UA0 A;  2LYH A;  5DB9 A;  2BGW A;  1ZQP A;  2JEJ A;  1ZQO A;  3SEN A;  4KX5 A;  4AYB F;  3TAP A;  4KLQ A;  3NS1 A;  4I2B A;  8ICO A;  3AQF A;  3K75 D;  2XIC A;  1FEZ A;  1BGX T;  2AH5 A;  3WK8 A;  2OEH A;  2R18 A;  2ZUD A;  2PI4 A;  4DS4 A;  2RQ5 A;  5AM2 A;  5KT3 A;  2VA8 A;  3EYZ A;  3AM9 A;  2HMX A;  2KD1 A;  4C4R A;  4BX9 C;  2ES6 A;  2XCP A;  4BUG A;  5H2F U;  3RB4 A;  2ATL A;  2W9C A;  1ZQJ A;  2DFL A;  1KN5 A;  4F2R A;  2WB1 C;  3C29 A;  1T94 A;  4F3O A;  3KOO A;  2DGZ A;  4QWE A;  3BQ1 A;  3T5L A;  2LI6 A;  3H8J A;  3QE9 Y;  4JV2 A;  3RAQ A;  4QZI A;  5KG1 A;  4F5R A;  4JV0 A;  3KHR A;  4F4Y A;  3BQT A;  1B0X A;  3RR8 A;  5ALR A;  3UQ2 A;  3GV5 B;  2HHQ A;  2O6K A;  5AIA A;  4KLG A;  3M9M B;  3V6J A;  5KG2 A;  4DSK A;  3G6X A;  2DKZ A;  3TI0 A;  1ZQW A;  3C21 A;  4I2D A;  5ALD A;  4GLX A;  2MSN A;  1WWU A;  5CEH A;  3HJE A;  4UBC A;  3LWM A;  3N7S C;  2Y0S C;  3EUB 2;  5AIB A;  2XY6 A;  7ICM A;  1SV0 C;  4B9N A;  2D8C A;  1EXN A;  5D4B A;  2M9N A;  8ICK A;  2K8C B;  5KFL A;  2W55 A;  1L7O A;  2MUT A;  2V9W A;  1NK6 A;  4DQI A;  2AJQ A;  4YD2 A;  3SV3 A;  2IOF K;  4P0P A;  4YMO A;  4UB2 A;  4EX6 A;  4KLD A;  5ALI A;  3OTQ A;  3GIK A;  3OPX A;  4G9B A;  1RYR A;  1X6J A;  4RQ4 A;  4Y2R A;  1NOM A;  4NM1 A;  4NJ8 A;  1L8L A;  1ZQX A;  3BQ2 A;  3FDS A;  3MR3 A;  8ICR A;  1UT5 A;  3IHQ B;  4EZ6 A;  9ICH A;  3B0X A;  1QQ6 A;  3DV9 A;  4MHV A;  2WAQ C;  2KFZ A;  1T3Q A;  1KFD A;  2VA2 A;  4QW8 A;  2PKE A;  2ZG6 A;  4EZ9 A;  1X6I A;  1N2X A;  2JH1 A;  2YY6 A;  3HKZ C;  4F4X A;  1IM4 A;  2HVH A;  2HHW A;  3OSN A;  2M0N A;  1P7D A;  2OHF A;  5KG4 A;  7ICP A;  5AI8 A;  8ICP A;  4KX3 A;  2A1A A;  4PZN A;  1UQV A;  3RJF A;  8ICU A;  2ASJ A;  1X9W A;  4I2A A;  1S0M A;  5EWE A;  3SEI A;  2W9M A;  3EWA A;  3RR7 A;  1ZQR A;  3EPG A;  4FE3 A;  4IC9 A;  2J6U A;  2K4E A;  1SKW A;  3BS5 B;  5J8Y C;  4C8K A;  7ICK A;  3MAB A;  1ZRM A;  2WF8 A;  4PGX A;  4DLE A;  7ICQ A;  4RQM A;  1RG6 A;  3SAH A;  1S77 D;  4NL9 A;  2ZIW A;  5KFN A;  4B6J A;  3H4D A;  3QUQ A;  4Q45 A;  4ECS A;  4LVS A;  4A8E A;  4NLZ A;  3TAD C;  2KZM A;  3WK4 A;  4Q8E A;  2Y9U A;  4J9Q A;  4EBE A;  1UPH A;  5ALK A;  1ZD4 A;  1KBU A;  3DDH A;  2G5I B;  3GII A;  3RBE A;  5HML A;  3FM9 A;  1N60 A;  1UCV A;  4ED6 A;  1NK7 A;  2IA6 A;  3PST A;  1BVS A;  4IL6 U;  5L1L A;  3PX6 A;  5CHG A;  3MR6 A;  4QZA A;  4QWD A;  1BPE A;  3MC1 A;  3CYM A;  5AKI A;  2NRV A;  1NZP A;  4ECV A;  1X42 A;  2VA3 A;  3JPN A;  3RH6 A;  9ICM A;  2DPI A;  5AKE A;  2B6G A;  4O5K A;  4ECQ A;  5KFY A;  5TZV A;  4KLF A;  2KOB A;  1SZP A;  2F77 X;  2YMQ A;  2W11 A;  1JAL A;  4B9L A;  2KG5 A;  1LVH A;  1ZOL A;  2ZIU B;  9ICT A;  5HHH A;  2EH9 A;  4K4I A;  4CF5 A;  5KT4 A;  4KN7 A;  4ELT A;  1TAM A;  9ICS A;  2I1Q A;  2EAP A;  9ICJ A;  4QW9 A;  3B9J A;  2FPK A;  5KFO A;  3RBD A;  2DUY A;  2PMZ F;  1KSP A;  3PV8 A;  3PX0 A;  1QSL A;  2W9B B;  3UQ0 A;  4FBU A;  8ICF A;  3V6H A;  4J9K A;  1ECW A;  3N28 A;  3FYH A;  3JPP A;  3ZD9 A;  3MBY A;  3IP4 B;  3S6J A;  4G3I A;  9ICQ A;  1KFT A;  1B22 A;  9ICO A;  5J8Y A;  3H7I A;  3RJG A;  2B21 A;  2QAR A;  4NLG A;  5ALW A;  4ELV A;  4UAT A;  4RQ1 A;  3NRZ A;  3LWL A;  4EEY A;  2L5Y A;  5J2A A;  5CA7 A;  1SKS A;  5KFB A;  2ESE A;  3J81 j;  1ZQC A;  9ICC A;  3A0B U;  3PX4 A;  3GDX A;  2YML A;  4RQ0 A;  3E2E A;  3RRH A;  4B9M A;  1L8O A;  2LM1 A;  2NRT A;  4E0D A;  3M6Z A;  1FFV A;  4C8N A;  7ICL A;  3UMB A;  2R8K A;  1ZRN A;  2BCU A;  2WHE A;  3Q8S B;  1NKC A;  3C2L A;  3QU5 A;  3AN1 A;  1XU4 A;  3CNH A;  1S76 D;  4ED8 A;  2ZXH A;  2C2D A;  2YB1 A;  2W54 A;  3N7R C;  1X40 A;  3T5K A;  3M1Y A;  3PML A;  4BGD A;  5DG7 A;  5HR7 A;  5DQG A;  3KZX A;  1ZQA A;  3MFI A;  4AYB C;  4Y2U A;  2HOQ A;  5IIO A;  5KFP A;  4Y2Q A;  1MQ2 A;  5J0R A;  3HRD D;  1UA1 A;  5J29 A;  4CGZ A;  2K89 A;  1TK8 A;  2CPR A;  5KFW A;  3CRX A;  2ZIV B;  2AQ4 A;  4C8O A;  1T7P A;  9ICB A;  7ICO A;  4I29 A;  1KKX A;  2EAM A;  4QZC A;  4PHD A;  4M9L A;  4FO6 A;  4B9S A;  2OYY A;  5ALX A;  4MF2 A;  5HP4 A;  4UAY A;  3PO5 A;  9ICV A;  3Q8R B;  3L5K A;  4OJ5 A;  4DQP A;  4RUC A;  3C2M A;  5KFV A;  1ZQE A;  3MDA A;  8ICA A;  5D49 A;  4ACO A;  9ICX A;  2EQY A;  2R8H A;  4TUS A;  2HBL A;  4UB8 U;  3Q8K A;  1Z4O A;  5ALN A;  1H38 A;  3NVV A;  2JEI A;  5L1I A;  2ALZ A;  4DF4 A;  1NZB A;  4IRK A;  5DG8 A;  3RB0 A;  3ZD8 A;  2KV2 A;  2KVC A;  4Z6D A;  2PFO A;  3UM9 A;  3AEV A;  4DFD A;  3PR4 A;  3D2N A;  5EOZ A;  8ICC A;  4USA A;  2ZIX B;  1JN3 A;  3JPT A;  1KLN A;  4F4W A;  4BXO A;  1V38 A;  2F76 X;  4R8U A;  4C80 A;  3K1Z A;  5T14 A;  4KLH A;  2VAN A;  2J6S A;  4Z6E A;  3C1Y A;  1D8Y A;  9ICI A;  1Z00 A;  3F53 A;  3NAS A;  3PVX A;  7ICR A;  2XGP A;  5DBC A;  2EAO A;  3HT3 A;  4DOC A;  3PZP A;  4F5P A;  4C7Z A;  3PW5 A;  1BNP A;  5DQH A;  4BJQ A;  4DQR A;  4YXJ A;  4UAR A;  4QZE A;  2QB0 B;  4XQ8 A;  5F9L A;  4DFP A;  1NK9 A;  4KLE A;  7ICT A;  4ED3 A;  1QSS A;  3Q8Q B;  3IDW A;  1ZET A;  4FS1 A;  4YN4 A;  5DQI A;  4F5Q A;  4PZO A;  4RUA A;  3ONN A;  5AM3 A;  4M0A A;  2BKE A;  2XID A;  3H8S A;  2HHT A;  2HSZ A;  1N62 A;  3BZC A;  1YT3 A;  1RQL A;  3RTV A;  4JMU A;  3GV8 B;  4C8L A;  2F1J A;  4JB3 A;  4J9S A;  4NLK A;  2FI1 A;  5KT7 A;  2Y1I A;  4F4K A;  4XUS A;  1SKR A;  4B9V A;  5AKL A;  4ECY A;  2KVS A;  2XVT A;  3RAX A;  4AP9 A;  5AKX A;  2W9C B;  5F9N A;  3RH5 A;  2F3N A;  2VJ5 A;  5AI0 A;  2FMQ A;  2H5X A;  3TAC B;  2BZF A;  2FJ6 A;  1S97 A;  4IQV A;  3WKD A;  2XY5 A;  2JV3 A;  5ALP A;  4RQ8 A;  2RP5 A;  1L5U A;  2FPL A;  4MEX A;  5J2E A;  5KFZ A;  1ZD2 P;  1ZD3 A;  2G06 A;  4PPX A;  4P4O A;  5GTH U;  1RM6 C;  8ICJ A;  2JEF A;  2E8M A;  3RJK A;  2YX8 A;  4YR3 A;  2GOL A;  1A76 A;  5L1J A;  3QU2 A;  2E8P A;  1IXR A;  1RPL A;  1ZQI A;  4F8R A;  4NM2 A;  3WKE A;  1XSP A;  1KRP A;  4C4S A;  2Z7J A;  3TAQ A;  1QH9 A;  4YXM A;  2NYV A;  5AK6 A;  4ED0 A;  1BPY A;  3R9K A;  8ICE A;  3U26 A;  1QLN A;  4HYK A;  1WWV A;  2C2E A;  4QZH A;  4YP3 A;  4XA5 A;  2KHQ A;  4Q8F A;  2KKP A;  3VCB A;  4DWI A;  2K4H A;  9ICU A;  1ZQG A;  4C8M A;  8ICY A;  1RQN A;  5BOL A;  4DL2 A;  1UT8 A;  2LYB A;  4MFF A;  1Z3E B;  4RT2 A;  3WK7 A;  1N5W A;  1KTQ A;  4DLG A;  4F50 A;  7ICJ A;  2CRX A;  1LV5 A;  2BDU A;  2MUT B;  3ORY A;  3JPO A;  2G0A A;  3TKA A;  2BPG A;  5CWR A;  4K4H A;  1PK1 A;  3KHL A;  4DSL A;  4P0P B;  4DOA A;  2HBK A;  2ISP A;  2IBK A;  8ICL A;  1OXJ A;  1NI3 A;  4DEZ A;  1QSY A;  4DO9 A;  4NL9 C;  3I28 A;  4DQS A;  2ZUB A;  3BJY A;  4CRX A;  3GFK B;  2XGQ A;  4ECX A;  1Z1B A;  3CP8 A;  1TKD A;  2RLT A;  4Y2J A;  4YR0 A;  3KD3 A;  3QUB A;  4UAV A;  4I2C A;  5DGA A;  1N48 A;  1M6Y A;  1WYG A;  1U47 A;  1ZQB A;  2KJ8 A;  3KKA A;  3UMG A;  4YQW A;  5DLF A;  1HUZ A;  4QZ9 A;  1IIP A;  5EE3 A;  2RRD A;  1ZQK A;  1HEK A;  1WCL A;  1LB2 B;  2H3F A;  1FIQ A;  4O3M A;  1ZQM A;  1TAQ A;  5KAF U;  5AKY A;  2UVW A;  3ZDB A;  4QWB A;  3NTU A;  4O0I A;  1SWV A;  2ZJ5 A;  1N63 A;  5CJ7 A;  1KQQ A;  2VKQ A;  1S8O A;  3WK5 A;  2FMP A;  4DL7 A;  2HVI A;  1S5L U;  4RPY A;  1ZQQ A;  2NRZ A;  4ECR A;  3AU2 A;  4FS2 A;  1RXV A;  2HOI A;  3BQ7 A;  3ZDE A;  3SD7 A;  2ZJ8 A;  1VLB A;  2XC9 A;  1YZ6 A;  4C4T A;  1O03 A;  2BPC A;  4YCX A;  1L7N A;  4NLB A;  2YQE A;  4KLO A;  3GIL A;  4TQS A;  1DGS A;  5KT2 A;  8ICT A;  4FZN A;  3NVY A;  1SL1 A;  4O3N A;  1SZH A;  2Q0Z X;  5ALE A;  5HMM A;  2KIV A;  2H3V A;  5J2D A;  4OCZ A;  1J97 A;  3BS7 A;  1WCN A;  4ECZ A;  4O3P A;  1PUZ A;  5KAI U;  2KMD A;  2ZIW B;  5B5E U;  1KFS A;  2FLN A;  4YMM A;  3V6K A;  4J9R A;  3UPQ A;  8ICX A;  4PH5 A;  5AM5 A;  2W43 A;  4KLI A;  1Z19 A;  3IG5 A;  2AGO A;  1S10 A;  2A1J A;  4DSE A;  1XS9 D;  3EPI A;  1L7M A;  2EZZ A;  4YMN A;  5IIJ A;  3PNC A;  4P0Q A;  2MU2 A;  2XI9 A;  5G5G A;  5J2J A;  4C0Z A;  5ALF A;  1BPB A;  1N61 A;  1MA7 A;  3HPO A;  4DFJ A;  4UAZ A;  4RZR A;  4KIT B;  4Q43 A;  1A6S A;  3KZI U;  1SIJ A;  3H4B A;  4J9O A;  3GU3 A;  4RQ7 A;  4ED2 A;  3LYS A;  5JTI A;  4RT3 A;  1L6N A;  4PHE A;  5KFE A;  2J6T A;  9ICP A;  3FAH A;  1B4F A;  1U49 A;  1Z1V A;  1VJ5 A;  8ICH A;  2KJ5 A;  3UXN A;  2JH7 A;  2E3T A;  1PVQ A;  4Z6F A;  5ALY A;  5KNI A;  3ZDA A;  2P35 A;  4RPX A;  5DBB A;  4O5C A;  3QUC A;  4YVZ A;  7ICS A;  1XC9 A;  4CCH A;  3F5E A;  3T5H A;  3WK6 A;  4F4Z A;  1L3T A;  2HI0 A;  4RQ5 A;  3IG8 A;  1X66 A;  1ZQT A;  3LDA A;  3T3F A;  2EZY A;  4M04 A;  5AIC A;  2V4Q A;  3OHA A;  4F5N A;  2OM6 A;  2Y0S F;  4Z6C A;  5ALM A;  1JRP A;  5KG3 A;  4OJ6 A;  4O3O A;  1BPX A;  1U9L A;  2HBJ A;  3V7K A;  4I2E A;  1JI7 A;  2QAR B;  1K5O A;  3H0M B;  4CNQ A;  7ICF A;  4I28 A;  5KFH A;  1JMS A;  3PW4 A;  4QZB A;  1ZQV A;  1FFU A;  2UVR A;  5KFC A;  2Y9T A;  5AM1 A;  4Y2T A;  3ZI4 A;  2NO4 A;  5J0W A;  1U4B A;  3TFS A;  4RQ2 A;  2UVV A;  3QEB Z;  3ZDC A;  5KFG A;  5CR0 A;  3JPR A;  5IIN A;  3O0F A;  4OJL A;  5J0Q A;  4ECW A;  2PFQ A;  4QZD A;  1BPD A;  2KEY A;  5KFR A;  3EZ5 A;  2WAQ F;  2KHV A;  2JZB B;  1SXD A;  4KLJ A;  3QU4 A;  1K1S A;  5KFM A;  3QXG A;  1J2M A;  4ICA A;  3H8W A;  4GIB A;  1ZYQ A;  1XNS A;  1Y88 A;  4QZF A;  3HKZ F;  4RQ6 A;  1B43 A;  2E5S A;  3HWT A;  1NK0 A;  2PI5 A;  4US8 A;  3QUT A;  4ED1 A;  1U48 A;  2C28 A;  4EYH B;  3QNM A;  5ALT A;  7ICI A;  3G6V A;  2UVU A;  3THV A;  2G08 A;  3GQC A;  4YR2 A;  2PFP A;  5DG9 A;  2JRZ A;  5AI6 A;  1CUK A;  3H0L B;  1RDF A;  3N7P D;  3ED5 A;  3Q8P B;  5D46 A;  1UHU A;  2GWS A;  1A0P A;  4Y2S A;  3PY8 A;  1N5X A;  4QIW F;  4C7Y A;  1X9M A;  4IQT A;  2WF9 A;  3UXP A;  3F2D A;  2PXI A;  1KW4 A;  4XRH A;  3ISB A;  2HHS A;  2Y1J A;  1ZQ1 C;  4NWI A;  2QLT A;  2MRL A;  3PW0 A;  2KTQ A;  4OJO A;  2R8J A;  5KFX A;  4O9M A;  1QCK A;  4F91 B;  2CN1 A;  3SI8 A;  1SWW A;  1D9D A;  9ICA A;  3M7D A;  3NUQ A;  1XSL A;  1S0V A;  1V97 A;  5KT6 A;  1SB3 C;  1V85 A;  1A77 A;  2DL0 A;  4JUZ A;  1NJW A;  2YN4 A;  3IV6 A;  1L3S A;  4Y2V A;  2E1E A;  4KTQ A;  5L1K A;  5CRX A;  1TVA A;  3V7L A;  3SYZ A;  4BXO B;  4JWN A;  1IG6 A;  4RU9 A;  4R8U B;  3PR5 B;  3F2B A;  3Q8M A;  4RQN A;  5KT5 A;  3BDP A;  3ISC A;  1Z00 B;  4ECU A;  2G09 A;  5AM0 A;  2A19 A;  4YG2 A;  1TK5 A;  2F8K A;  1J2N A;  3TQ1 A;  4DFM A;  1COO A;  3ICX A;  4I27 A;  2FDR A;  1V9P A;  2HOF A;  1LKY A;  1S0O A;  2NV3 A;  2IHM A;  4LJX A;  2EZX A;  4QZ8 A;  1ZQD A;  4DQQ A;  2C22 A;  4KLT A;  1ARO P;  3EW9 A;  4J9M A;  4UQG A;  8ICG A;  2KSO A;  1KEJ A;  4EEK A;  3V72 A;  4KN4 A;  2KJ9 A;  2LKY A;  4TUR A;  2OCE A;  7ICV A;  5EE0 A;  4PHP A;  2OH2 A;  2JR5 A;  5A0L A;  4P2H A;  5JU5 A;  4FFD A;  2ZTC A;  3SQI A;  4KLM A;  2KIW A;  1COK A;  2VIX A;  3K1R B;  2R8I A;  2WF7 A;  4NV0 A;  3SR6 A;  2NRX A;  1WG8 A;  1ZXI A;  5ALL A;  2WF5 A;  3ETR A;  3F2C A;  2DBY A;  5J0P A;  4QWA A;  4O3S A;  4KLL A;  3AUO A;  4CE6 A;  1C7Y A;  1ZQS A;  2DF4 B;  3KHG A;  3NRW A;  3T5J A;  2W04 A;  3HW8 A;  2F1I A;  1SL2 A;  5ALJ A;  3OHB A;  3KKA C;  3SAG A;  3M6K A;  2QKQ A;  3C23 A;  4M9N A;  1ZQL A;  4M2Y A;  4BDP A;  4KMO B;  3SV4 A;  1D8L A;  4M6W A;  2W3S A;  1NK4 A;  2G5H B;  5B66 U;  2ZJA A;  1OW5 A;  4X5V A;  1FO4 A;  2G07 A;  5AK3 A;  1BPZ A;  1DGJ A;  1JRO A;  4UW9 A;  5KTQ A;  1SXE A;  3I76 A;  1ZQU A;  2V4R A;  5AI5 A;  2P66 A;  1JUD A;  4MFC A;  4I2J A;  1HIW A;  2H3Q A;  2JMG A;  3QU7 A;  5DLG A;  4OO1 J;  1CEZ A;  7ICE A;  4DSF A;  1YZ7 A;  3C5F A;  2W9A A;  2W7O A;  1JXL A;  5KFU A;  2ZTD A;  1PK1 B;  2FPM A;  2EAN A;  2YB4 A;  4GXI A;  2ASD A;  4J9P A;  1JX4 A;  1ZQZ A;  4DS5 A;  4HAI A;  5G5H A;  5FP0 A;  1Q46 A;  2BQR A;  4QZG A;  3KHH A;  4EEL A;  4FZM A;  5EE9 A;  1SV4 A;  1NJX A;  5AI9 A;  3VC8 A;  4MFA A;  1DOQ A;  5DDY A;  3D6J A;  2KE7 A;  1NKE A;  4U6P A;  4GC7 A;  5KFI A;  4NY8 A;  4OD0 A;  4R63 A;  2HCF A;  2AHO B;  2KZ3 A;  4MEY A;  5IIK A;  1Q3U A;  1HUO A;  1D9F A;  3GIM A;  2FLP A;  4IQU A;  4QWC A;  2BQU A;  1QTM A;  7ICH A;  2XO7 A;  8ICV A;  2WF6 A;  1IV8 A;  1MC8 A;  4IR9 A;  3OGU A;  4R64 A;  8ICI A;  4DF8 A;  4PL2 A;  5J0S A;  5DB6 A;  4ED7 A;  4UB5 A;  3T79 A;  3RJH A;  1TE2 A;  1QQ5 A;  4LZG A;  3RF9 A;  2JHD A;  1L3U A;  3TAN A;  4US9 A;  4DFK A;  5J2H A;  8ICZ A;  2B0C A;  5AI4 A;  5IIM A;  2BDP A;  2AGP A;  5KG5 A;  2ZTE A;  7ICU A;  5AKJ A;  2K8B B;  4O3Q A;  2FLL A;  4KMU A;  2I6X A;  2PMZ C;  4DSI A;  5KG7 A;  1SGG A;  3LVW A;  3H0R B;  9ICE A;  2AXT U;  2QB1 A;  2P6U A;  4DL4 A;  1U45 A;  5ALQ A;  4DOB A;  1SL0 A;  3SAF A;  5J2I A;  2LPE A;  3MR5 A;  4DL5 A;  3OJS A;  2FMS A;  3C1Z A;  2LHT A;  3RJI A;  3MGV A;  3M9O B;  4F5O A;  3ETL A;  4F93 B;  2KK0 A;  3RJJ A;  2A1J B;  5KG0 A;  2MA1 A;  2RHF A;  5ALO A;  9ICN A;  4P0Q B;  2YTU A;  5J2C A;  5J0O A;  3MGI A;  1JXE A;  8ICQ A;  2HW3 A;  1NNL A;  2DPJ A;  1TFR A;  2JXJ A;  4JK1 A;  4IQW A;  2WFA A;  4GXJ A;  3QZ7 A;  3AL0 B;  3QYP A;  9ICF A;  8ICM A;  2IOH A;  2HHU A;  4ZOH C;  4B9T A;  3IRU A;  1XO1 A;  1WUD A;  2BHN A;  1T4G A;  2W8K A;  5HHI A;  1ZD5 A;  4DL6 A;  4ELU A;  4O5E A;  2HHX A;  9ICK A;  3RFA A;  5EE1 A;  1PVR A;  5J2B A;  2YMM A;  3HP6 A;  3BQ0 A;  1Z4N A;  2ZXI A;  4QNL A;  1DXS A;  2KN7 A;  4M9G A;  3M9N B;  3LK9 A;  4GFJ A;  3QX7 A;  1NK8 A;  4UAS A;  4CDG A;  4QIW C;  4F92 B;  4RNN A;  4RPZ A;  2XCA A;  4J9N A;  5KFS A;  2WB1 F;  5CP2 A;  4BWM A;  2F44 A;  2LYA A;  3JPQ A;  3MDC A;  4UB4 A;  4IR1 A;  4PGQ A;  1SV0 A;  1URJ A;  2YMP A;  4JWM A;  3SMV A;  4FZL A;  4ZH4 A;  3SZ2 A;  5AHX A;  4K4G A;  3WKA A;  3Q8L A;  3MFH A;  4IS7 A;  1Q8K A;  2C2R A;  2BCR A;  5DKW A;  2ASL A;  3BS5 A;  3MR2 A;  1L3V A;  4BWJ A;  1O08 A;  5KFA A;  1MN8 A;  2AGQ A;  3KBB A;  2MAX A;  3KTQ A;  3WK9 A;  1X9X A;  4MF8 A;  5KFK A;  5C5J A;  4UB1 A;  4DSJ A;  1RYS A;  4YFK A;  5ALS A;  4PL1 A;  5L1M A;  5J0U A;  2I5H A;  4FBT A;  1DRG A;  2OWO A;  2JGA A;  5AKH A;  2N1R A;  1NJZ A;  3B0Y A;  2VJ4 A;  2NO5 A;  1K1Q A;  1XO0 A;  1NKB A;  4EEN A;  1RZT A;  1F0M A;  1AQ6 A;  5DGB A;  4Y2X A;  2W3R A;  4UAU A;  2GH1 A;  4UB6 U;  5E79 U;  2E8O A;  1T3N A;  3LVV A;  4TUQ A;  1QQ7 A;  2D3D A;  2EDU A;  3ZDD A;  5J0Y A;  1RYU A;  3WKB A;  4J9L A;  3M8S A;  2P6R A;  5J0T A;  2GLE A;  2F1H A;  2RDJ A;  1BNO A;  1C20 A;  4O3R A;  2DWQ A;  3D2Q A;  7ICN A;  1MQ3 A;  4GXK A;  3KFU F;  4Q44 A;  1ZQF A;  5JRT A;  3I1Y A;  2FE9 A;  1KDH A;  5F3X B;  2ISO A;  4PHA A;  3WKC A;  5KL1 B;  3K4G A;  1L7P A;  2HDO A;  2ZIU A;  5JUM A;  3QEA Z;  3PO4 A;  4UAW A;  1X2I A;  2BR0 A;  1TK0 A;  4OJP A;  1F44 A;  3L3F X;  3HX0 A;  2AQ0 A;  3ISD A;  4PJ0 U;  4I2I A;  4PGY A;  2H3Z A;  3F5A A;  4ECT A;  1CRX A;  2GO7 A;  2Q4T A;  4YD1 A;  1X9S A;  2W9B A;  4CF3 A;  5CB1 A;  5ALZ A;  1CI4 A;  4QJF B;  4RNO A;  4NLC A;  2KNJ A;  3TAD A;  3TAR A;  2KFN A;  4U7C A;  5KFD A;  4KLU A;  5HR6 A;  2KKV A;  4TUP A;  2JEG A;  4GC6 A;  5ALU A;  3TFR A;  3RJE A;  1XWL A;  2F8L A;  5DB8 A;  2ODG A;  4J03 A;  1PZN A;  1S0N A;  3AMZ A;  1RXW A;  4I2F A;  3H40 A;  2IHN A;  3PSI A;  2IMW P;  4JV1 A;  3MGH A;  5IIL A;  2JZB A;  2BCS A;  3PMN A;  1ZJN A;  3C2K A;  1XSN A;  1TAU A;  5BOM A;  2W7P A;  5KFQ A;  3NGD A;  3NVW A;  4M9H A;  2NRW A;  3L4P A;  1NK5 A;  4M9J A;  3WU2 U;  9ICR A;  3GV7 B;  5AKK A;  5AM4 A;  5K4L A;  5C0Y A;  5BPC A;  2ZUC A;  3BZK A;  4I2H A;  2HHV A;  4P4P A;  2W03 A;  4R66 A;  4EBC A;  4P4M A;  1ZQH A;  1LKY B;  4DCC A;  4B9U A;  5EWF A;  4NLN A;  2K4P A;  3AQE A;  4RQ3 A;  5KFJ A;  5TIS U;  8ICW A;  5ALV A;  5DB7 A;  2KSO B;  3RB3 A;  5KG6 A;  2ZIV A;  4F2S A;  2BCV A;  2XY7 A;  5KL8 B;  2K8A A;  2LMR A;  5KFF A;  1JIH A;  2H3I A;  1OUQ A;  2CXY A;  1T8E A;  2DKX A;  2OXO A;  3PW2 A;  2A3V A;  1Q3V A;  3C5G A;  2AU0 A;  5ALH A;  1N56 A;  2K4I A;  5J2F A;  1PVP A;  2K60 A;  1VDV A;  2E1F A;  3RRG A;  3IN5 A;  4DL3 A;  2R8G A;  1PK3 A;  3PSP A;  3QZ8 A;  1S9F A;  2KP7 A;  5GTI U;  4EYI B;  1NJY A;  4UB3 A;  5J0X A;  8ICN A;  5AKZ A;  4I2G A;  4CF4 A;  9ICL A;  8ICB A;  3HIL A;  3QU9 A;  2LM4 A;  5J2G A;  1ED1 A;  4M47 A;  3IM1 A;  3NVZ A;  3DEE A;  1DK3 A;  1HJP A;  2BCQ A;  4IRC A;  7ICG A;  2PFN A;  4UBB A;  9ICG A;  4RNM A;  2I9G A;  1GO3 F;  1KL9 A;  3OSP A;  2LBO A;  2BQ3 A;  2HBM A;  3V7J A;  2KZZ A;  2F2A B;  3E58 A;  5J2K A;  3GIJ A;  3H8M A;  5AKG A;  9ICW A;  5KFT A;  4R65 A;  5L9X A;  1ZQN A;  5EWG A;  4M6W B;  3ALR A;  3RH4 A;  2ZIX A;  4KLS A;  4Y2Y A;  3OJU A;  3PW7 A;  1D8B A;  2W8L A;  4WJ3 B;  3FC4 A;  3G6Y A;  4F71 A;  2BPF A;  3AU6 A;  3N97 B;  5III A;  1TV9 A;  5DDM A;  2DQN B;  4F72 A;  2WTF A;  3RB6 A;  5AK4 A;  1MSW D;  4EX7 A;  2E8N A;  3A0H U;  3N4M B;  1ZJM A;  1F5S A;  3GZF A;  3JPS A;  2RDI A;  1DK2 A; 
#chains in the Genus database with same CATH homology
 2Z7J A;  5KL1 B;  4CDG A;  3HKZ F;  4CGZ A;  3D2S A;  4QIW C;  2ZIU A;  1TAM A;  2K89 A;  2CPR A;  2K8B B;  2HOI A;  3AQE A;  4BJQ A;  2E5S A;  3E0F A;  2HOF A;  3CRX A;  4KX3 A;  3F5E A;  2NV3 A;  2ZIV B;  2PMZ C;  2WB1 F;  4OJP A;  3PSF A;  1F44 A;  3C28 A;  1HIW A;  5HR7 A;  2KHQ A;  3LVW A;  3L3F X;  2KIC A;  2KKP A;  3H0R B;  3VCB A;  2K4H A;  4NLB A;  2LYA A;  2D6F C;  3IG8 A;  3N7S C;  2H3Q A;  2ZIV A;  2Y0S C;  2H3Z A;  2JMG A;  3F5A A;  5KL8 B;  2PMZ F;  2K8A A;  1URJ A;  4OO1 J;  2LYB A;  4FE3 A;  2OYY A;  2H3I A;  4FZN A;  4IC9 A;  4FZL A;  3SMV A;  3SAF A;  1OUQ A;  2KJ9 A;  1CRX A;  2K4E A;  2LKY A;  3ONN A;  2W7O A;  2G08 A;  1SZH A;  2XID A;  2OXO A;  2Q4T A;  2CRX A;  2OH2 A;  2H3V A;  2OM6 A;  2Y0S F;  2BDU A;  2A3V A;  1Q3V A;  3H0L B;  1ECW A;  1YT3 A;  5A0L A;  4KX5 A;  2K4I A;  4AYB F;  3SQI A;  2KIW A;  2K8C B;  2LHT A;  2YB4 A;  3N7P D;  4JMU A;  2G0A A;  3MGV A;  1PVP A;  2ZIW B;  3SAH A;  4OJ5 A;  4OJ6 A;  1A0P A;  2E1F A;  2VIX A;  3IP4 B;  3AQF A;  2HBJ A;  4QJF B;  3IN5 A;  4NLC A;  2KNJ A;  4QIW F;  2XIC A;  4P0P B;  2ZIW A;  3PSP A;  2HBK A;  2MA1 A;  2RHF A;  3F2D A;  4ACO A;  4U7C A;  3H0M B;  1Z19 A;  4FZM A;  3IG5 A;  4NV0 A;  5HR6 A;  2R18 A;  2KKV A;  3VC8 A;  4P0P A;  4P0Q B;  4A8E A;  1ZQ1 C;  4NWI A;  2HBL A;  4PL1 A;  2MRL A;  4U6P A;  4CRX A;  1Z1B A;  3OPX A;  4OJO A;  1DRG A;  3CP8 A;  2JGA A;  2XVT A;  2F8L A;  4P0Q A;  1UPH A;  3F2C A;  2HMX A;  2CN1 A;  2KD1 A;  2N1R A;  1KBU A;  2XI9 A;  2G5I B;  4C0Z A;  2VJ4 A;  4BX9 C;  1ED1 A;  1Q3U A;  4BUG A;  1MA7 A;  3DEE A;  3M7D A;  3NUQ A;  1XO0 A;  2DF4 B;  2VJ5 A;  3PSI A;  3NRW A;  1NZB A;  2KJ8 A;  1A6S A;  2W04 A;  3PST A;  1GO3 F;  1IIP A;  2KV2 A;  2KVC A;  3GU3 A;  3AL0 B;  2LBO A;  2GH1 A;  2HBM A;  2E1E A;  2RRD A;  5CRX A;  3M6Z A;  1HEK A;  2WB1 C;  3D2N A;  3C29 A;  2RP5 A;  3SAG A;  1T94 A;  2F2A B;  2H3F A;  2WAQ C;  3M6K A;  3LVV A;  2ZIX B;  3CYM A;  4O3M A;  3F2B A;  3O0F A;  3LYS A;  4OJL A;  4PL2 A;  2W7P A;  1WUD A;  1L6N A;  2DGZ A;  3ALR A;  3T79 A;  2KEY A;  2F76 X;  2G06 A;  2ZIX A;  1D8B A;  4KMO B;  2ZXH A;  2WAQ F;  2KHV A;  2YB1 A;  3K1Z A;  3N7R C;  2G09 A;  5T14 A;  2KOB A;  4WJ3 B;  2VKQ A;  2YX8 A;  2ZG6 A;  3D2Q A;  2G5H B;  2GOL A;  3RF9 A;  2JHD A;  2DQN B;  2KJ5 A;  3RFA A;  2F77 X;  3KZX A;  3KFU F;  5C0Y A;  4ICA A;  2JH1 A;  2JH7 A;  3F53 A;  3HKZ C;  1PVQ A;  1PVR A;  4AYB C;  2G07 A;  2HOQ A;  2ZXI A;  4QNL A;  2ZIU B;  1XNS A;  2W03 A;  3GZF A;  4GFJ A;  2M0N A;  3ICX A;  1P7D A;  3PZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...