2KD1A

Solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
MEPSKLSYGEYLESWFNTKRHSVGIQTAKVLKGYLNSRIIPSLGNIKLAKLTSLHMQNYVNSLRDEGLKRGTIEKIIKVIRNSLEHAIDLELITKNVAAKTKLPKADKEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords DNA integration/recombination/invertion protein
publication title Solution NMR Structure of the Integrase-Like Domain from Bacillus cereus Ordered Locus BC_1272. Northeast Structural Genomics Consortium Target BcR268F.
rcsb
source organism Bacillus cereus atcc 14579
total genus 37
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kd1A00
1DRGA 3MGVA 1NZBA 1PVPA 1F44A 1Z1BA 4ACOA 5CRXA 2KHVA 1P7DA 2HOFA 3CRXA 3C28A 2OXOA 1Q3UA 1XNSA 2KJ8A 1PVRA 3C29A 2CRXA 2KIWA 3NRWA 1Q3VA 4A8EA 1PVQA 3LYSA 2HOIA 2KD1A 2KHQA 1A0PA 2KJ5A 2KKVA 1KBUA 1CRXA 2A3VA 4CRXA 1MA7A 2KOBA 2KKPA 1OUQA 1XO0A 2KEYA 1Z19A 2KJ9A
chains in the Genus database with same CATH superfamily
3H40A 2V9WA 3AU2A 9ICWA 4O5CA 3Q8PB 2MA1A 3PR5B 2HHVA 4GIBA 4Q8EA 1LKYB 4UB4A 1L8OA 2N1RA 9ICEA 1BVSA 4MF8A 4GC6A 4KLJA 4YR0A 3RRGA 2DBYA 5GTHU 1JXEA 4PHAA 2RDJA 2ODGA 3KZIU 2GH1A 3IHQB 4M2YA 7ICMA 4O5KA 3C1YA 2R8JA 4NV0A 2W8KA 4WJ3B 5T14A 3KHLA 4PJ0U 3RJJA 1SWVA 3K75D 2H3ZA 2KOBA 3PR4A 1ZRNA 5KFDA 2F2AB 4CF5A 3CP8A 4B9LA 1K5OA 4US9A 5ALMA 4ECRA 4G3IA 1TAUA 4I2DA 4RU9A 4QZCA 4BXOA 2LPEA 5ALFA 4ZH4A 3C29A 3NVVA 1NK7A 2AGQA 3TQ1A 1RQNA 4Y2YA 1AROP 4EZ9A 4F3OA 4NLGA 1J2NA 2I5HA 2C28A 2Y9UA 3V72A 1B4FA 3SAHA 3DV9A 1X9MA 3RJFA 5EE1A 2XY7A 9ICBA 3SAFA 3N28A 3SZ2A 3SD7A 1QQ7A 2KFZA 5H2FU 2ATLA 1XNSA 5ALSA 4R8UA 1HJPA 5G5GA 3B9JA 1VJ5A 4ED1A 2ISPA 4JV1A 4F4YA 4DQRA 1XO0A 3LVVA 1N2XA 1D8LA 2YMLA 5J0PA 5AM5A 4EENA 2XICA 3ZDBA 3C1ZA 3SENA 2BPGA 2OEHA 2I1QA 5KG4A 4C4SA 2KTQA 5TZVA 4XRHA 4CF4A 4ED7A 5K4LA 9ICVA 4OJ5A 5DBAA 2HHSA 5KFHA 1Q3VA 2K4IA 4YR2A 4ED6A 3AQFA 5KAIU 3V6JA 4MEYA 1UA0A 2QARB 4XUSA 2ZJ8A 3RJGA 2Y9TA 4NM2A 1JIHA 4ACOA 4IRCA 1QLNA 3RBDA 3ETLA 2G0AA 3T5JA 2PXIA 1BNOA 4ZOHC 1HIWA 3RR8A 1CI4A 4QZEA 3OGUA 5DQHA 1BPYA 5CB1A 3PSIA 1Z19A 4EZ6A 2PFOA 4DLEA 4LVSA 1O03A 7ICEA 3HX0A 2ASJA 4Z6FA 1PVPA 2MU2A 1F44A 1VLBA 3GIIA 1LV5A 1ZD3A 4I29A 4F2SA 5CEHA 2AU0A 1SXEA 2FPLA 1IIPA 1Q8KA 2I6XA 3HW8A 2KN7A 3HILA 3RH6A 1ZQTA 2ZJAA 5ALHA 1ZOLA 3QU2A 3PW5A 2Y1JA 1ZXIA 2W7OA 3ZD8A 1F0MA 1L3UA 1J2MA 4NL9A 4JV2A 2B6GA 4U7CA 4QWAA 4KLIA 2GOLA 5KFYA 3AUOA 2W7PA 2KIWA 5JU5A 5J0SA 2ZXIA 4I2CA 2IOFK 5EE9A 1XS9D 7ICHA 4DLGA 3UMGA 3HJEA 4UAWA 2PI4A 2ZTDA 3MGHA 1N61A 2UVVA 4USAA 2ZIUA 4QZ9A 3WKEA 3I1YA 4KLMA 2R8IA 4TUSA 9ICHA 3M9OB 2HOIA 1ZQGA 2NRZA 3KKAA 3QYPA 2E3TA 2LYAA 7ICQA 2BCUA 3BQTA 3JPPA 3DDHA 2WB1F 8ICNA 3CW2C 9ICNA 4ECSA 4O0IA 4UBBA 1FFVA 3HKZF 2NV3A 2CN1A 2HI0A 1C20A 2H3FA 3HPOA 5ALQA 2M9NA 4TUPA 2XI9A 3GU3A 4F2RA 2W9CB 1KFSA 1NK8A 3QZ7A 3NS1A 3SI8A 2W9AA 8ICQA 4F4ZA 1WYGA 8ICPA 3RB0A 1S8OA 4M9GA 3M1YA 1MQ2A 4RQ8A 4F5RA 4PHEA 4J9RA 1NK0A 1CRXA 4B9UA 4UB5A 4RQ7A 2WF9A 5AK6A 1MA7A 4OCZA 3L3FX 5L1KA 1RXWA 1U9LA 4G9BA 2MAXA 4YQWA 1NKEA 4RUCA 2BPFA 4RQ1A 8ICHA 2FLNA 3M6KA 7ICJA 4RPXA 5ALOA 1B0XA 2HBLA 5AKKA 4DQIA 7ICNA 4RNNA 5DQGA 5J2KA 1S77D 2WB1C 3RAXA 7ICPA 8ICOA 5AHXA 2KK0A 3HKZC 3DEEA 4RNOA 5EWFA 4YCXA 2XVTA 2QB0A 7ICIA 3NRWA 2FMQA 5KFIA 3QX7A 4F92B 4K4HA 1VDVA 5KT6A 4C7YA 2YQEA 5AICA 2O6KA 2K89A 2EZYA 4FO6A 3EYZA 2BGWA 2HBKA 4IS7A 4DSIA 3ISCA 4IL6U 2W54A 3AM9A 2WTFA 3NRZA 4JB3A 2A1JB 3T5KA 2EZXA 4B6JA 4QIWC 4BX9C 4GXKA 2HVHA 4C8OA 3IP4B 2Q0ZX 2NRXA 5J2HA 4NL9C 2XC9A 3UQ0A 2M0NA 2R8HA 5EOZA 3LWMA 4CDGA 3TANA 5EWGA 4YFKA 1RG6A 2LM4A 2LM1A 3H0LB 1OXJA 4I2GA 3NVYA 4YMNA 1UT8A 5IIIA 4FS2A 4J9SA 4F4XA 3LDAA 4DWIA 4QWDA 1V97A 1NKBA 3C2KA 9ICAA 2OM6A 3D2SA 5KFGA 2IOHA 1SV4A 1IG6A 5KL8B 2HOFA 8ICFA 1X2IA 2DGZA 5KFOA 3QEAZ 5D46A 3WK8A 2NRWA 3OJSA 1KL9A 5AKIA 3WK6A 2HVIA 5ALIA 2DKXA 4KN7A 5AKYA 2NYVA 2YB4A 9ICIA 5KL1B 3PX6A 3BQ0A 1L3TA 1U45A 4Y2XA 2KZ3A 4M9JA 3ZD9A 1ZQOA 2IHNA 2KSOA 3SV3A 2W3RA 3BQ7A 4I2HA 8ICKA 5AM3A 1NK6A 4BJQA 2C2RA 1Z00A 3ED5A 1MQ3A 3RFAA 2J6SA 5DB7A 3E58A 2JH7A 4KTQA 3L4PA 4O3MA 3TAPA 5BOLA 5AI9A 1KTQA 5J0YA 3MC1A 1NJWA 5CRXA 2MSNA 5AM1A 5L1IA 4Q43A 4I2AA 3H8SA 1D9DA 2V4RA 2XGPA 1ZJNA 2P66A 5HP4A 5HR6A 3T5LA 4J9MA 1JI7A 3BS5B 5KFAA 4EX7A 3RF9A 1BPEA 1XSLA 2DPIA 3FC4A 2KFNA 3KBBA 4P4PA 3IV6A 4F4WA 2ALZA 5AKGA 3TFSA 1UT5A 4QNLA 4DL4A 5AK3A 3RH5A 2Y1IA 4XQ8A 3KOOA 3N7RC 1ZQUA 5L1MA 2ESEA 2E8NA 3K4GA 4J9NA 1QTMA 5KFWA 4O3RA 2ES6A 1D8YA 3QE9Y 3D2QA 3V6HA 4EBEA 4KLQA 5KFJA 2OCEA 4RQ2A 3N4MB 1KW4A 1RXVA 1KFTA 3VCBA 4P0PB 5DBCA 3HT3A 3QXGA 3F2DA 3V7KA 5D4BA 4KX5A 4DSJA 3WKBA 2EH9A 2W9MA 2K8AA 2BR0A 3SMVA 4ED8A 1L8LA 1JXLA 4PZOA 5F3XB 5KT5A 1XSPA 2ZIXB 3F2BA 1COKA 3WK9A 1NOMA 5J0XA 1BPZA 4NJ8A 1WCNA 2KD1A 2JZBA 4MF2A 3C2LA 2NRTA 3RBEA 1BGXT 5AM4A 1J97A 1B22A 2JZBB 2IMWP 5DB9A 2K4EA 2VIXA 4PHPA 4QWEA 2KHQA 2PFQA 5AM0A 1MC8A 5CA7A 2F1JA 2YX8A 1SL0A 1ZQLA 2PFPA 3RJEA 3TACB 2ZTEA 4CCHA 4KLOA 8ICGA 4IQUA 2J6UA 2CPRA 4CGZA 2LMRA 1X9XA 3SV4A 4C4TA 4CF3A 3TARA 7ICFA 3GV7B 2PMZC 3ZDEA 5IIOA 1ZQAA 5F9LA 4OD0A 5ALXA 3B0XA 3F5EA 4M9HA 2XGQA 4QZGA 2DF4B 4DL7A 4UQGA 2F44A 2KZMA 4MHVA 3PO4A 2F77X 4IR1A 4A8EA 1X9WA 2OWOA 4P2HA 4QZIA 5KAFU 1KDHA 2KKPA 4GXIA 3MR3A 1S97A 8ICUA 4BXOB 1QCKA 1O08A 3QEBZ 2OH2A 1NK4A 4QZDA 3CNHA 3WK4A 4QWBA 9ICSA 2KE7A 2W8LA 2GO7A 4C8NA 3T3FA 5C0YA 4Q45A 1Q3UA 2DFLA 1UHUA 4ED3A 4C4RA 1RYUA 4PL1A 2XO7A 4R8UB 4Y2UA 2KJ9A 4RNMA 3F53A 3GZFA 4KLDA 2DWQA 4UW9A 4M9NA 2Y0SF 5ALKA 4F5PA 2BQUA 4KLTA 4KITB 5KFRA 4RUAA 4C0ZA 9ICFA 4DFKA 5KFVA 3UMBA 4EEKA 4ECZA 3LK9A 1ZQCA 3MR5A 2JEIA 4ELUA 2HCFA 3C21A 2AXTU 5EWEA 3MR6A 2KG5A 5L9XA 1S5LU 1NI3A 4RQNA 4RQ6A 1TV9A 2P35A 3KHRA 5IIMA 1L3SA 4E0DA 1N5WA 4RPZA 4IRDA 2WAQF 5GTIU 4J03A 3V6KA 5J2CA 2MRLA 2AGPA 5KG0A 3K1RB 1RM6C 2FLLA 5J8YC 1TKDA 3WKAA 2PKEA 3QU9A 4RQ4A 5AKJA 4UB6U 3QUCA 4EBCA 4I28A 4AP9A 2BZFA 2IA6A 4O5EA 3QUTA 2KP7A 4P0QA 5J2JA 1ZQZA 3IM1A 4BGDA 5JRTA 2FDRA 1ECWA 2Y0SC 1JUDA 1TE2A 2ZUCA 1ZD4A 3H8MA 1TAQA 4Y2RA 3H0MB 2IHMA 8ICZA 1RQLA 2VKQA 5ALZA 2WFAA 1PK1A 4CRXA 1T7PA 1KBUA 5A0LA 4CE6A 2JEJA 2BHNA 3RB3A 3ONNA 2G07A 4NY8A 1B43A 2EAMA 1L7PA 3QNMA 1N48A 4O3SA 4QZ8A 5ALTA 4ECQA 3H0RB 3GV5B 2AQ0A 5KFBA 2WAQC 4DFPA 2ZG6A 3PZPA 3ZI4A 2YMQA 2ZIUB 3RTVA 5DDYA 3KTQA 2JV3A 3D2NA 5DLGA 1UQVA 3TFRA 3BZKA 2A1AA 1DOQA 1HUOA 4IRKA 4O3NA 1QH9A 1V38A 2XY6A 3QU4A 5J2EA 2YB1A 1DK3A 3H4DA 2W04A 4QZBA 2F76X 3UXOA 4RQ0A 4NLKA 1TK8A 3OHAA 5D49A 1NK9A 2QB1A 2BPCA 1KKXA 2DKZA 3JPTA 2W43A 4IR9A 2MUTA 4YMMA 4B9TA 1RYRA 3S6JA 4B9NA 2W9BA 1KQQA 2OHFA 2G06A 1NK5A 2HHWA 5HHIA 2LKYA 4QIWF 5KFNA 3C23A 2VANA 2FMPA 5CWRA 4C7ZA 5IIKA 3KHGA 1T3QA 2JEGA 1C7YA 4Q8FA 3VC8A 1TAMA 1BPXA 5DG8A 1U48A 1A76A 4FZNA 3RRHA 1BNPA 3ZDDA 2AH5A 5AK5A 2K60A 4UB3A 3RJKA 2P6RA 3ZDAA 4GC7A 4O3PA 3OSNA 3GQCA 3T79A 4DL5A 1HUZA 2AJQA 1SIJA 1SXDA 3QUQA 4UAUA 2ASDA 2KMDA 2ZIVA 2XIDA 3N7SC 3NVZA 4ELVA 1SV0C 2YY6A 5ALJA 4F5QA 4EBDA 2ZIVB 2K8CB 2VA8A 2A19A 2PI5A 5ALEA 5AKZA 4UAYA 2QB0B 5DLFA 3ICXA 1JROA 1M6YA 4PL2A 3N97B 4F71A 1RZTA 1Z4NA 3ALRA 1WG8A 4JUZA 1A6SA 2EAOA 2JRZA 3RAQA 5B5EU 4IQWA 1DRGA 4KN4A 4DQSA 4PH5A 2F1IA 4DOBA 2AHOB 2B0CA 1JMSA 5KT7A 1NJZA 3MFIA 4DL3A 2E1EA 5J2BA 4RPYA 4GFJA 5AI6A 4FBTA 5KFTA 5KG7A 3KD3A 2D6FC 3T5HA 1L7NA 1Z3EB 4TURA 2EZZA 1WWUA 3ZDCA 9ICPA 1D9FA 4Y2PA 3PW7A 5KT3A 5ALLA 9ICJA 2CXYA 1X6IA 3R9KA 4F50A 4FBUA 3LYSA 1SL1A 3NUQA 2VJ4A 2ZXHA 3RB4A 4I2BA 1ZQBA 5JUMA 3BQ1A 3PX0A 7ICTA 4FZLA 3JPNA 3FM9A 3TI0A 2F8KA 1ZQNA 2HHTA 4KLEA 2ZUBA 3PMNA 3MABA 5KFMA 9ICRA 7ICOA 3JPSA 2H3QA 4ED2A 4F5NA 3EPGA 4UB1A 3HRDD 2HBMA 5KFPA 4C8LA 3RR7A 1Z4OA 1SWWA 3FAHA 5KFSA 3Q8LA 4YP3A 1LB2B 5ALGA 4DSKA 2JXJA 2YN4A 3TADC 4DQPA 3OTQA 1N62A 3D6JA 1ZQ1C 2KSOB 5DG9A 2E8MA 4Q44A 4PPXA 8ICJA 3PNCA 3N7PD 4DOCA 5KG5A 1UPHA 1Z00B 4Y2SA 4DSEA 3CRXA 2R18A 2RDIA 2K4HA 2E1FA 1L6NA 3LVWA 1FO4A 4JMUA 5DG7A 1YT3A 1K1SA 3WK5A 1T3NA 4AYBC 3UQ2A 2ZIWA 4GXJA 5KFCA 2WHEA 5L1JA 1TVAA 1ZQJA 8ICLA 2UVWA 2DL0A 5J2GA 4YXMA 5E79U 4PGQA 3IG8A 4LZDA 4EEYA 4R66A 1ZQMA 2HOQA 1P7DA 2FPKA 2RRDA 3BS7A 2JHDA 3KZXA 2E8OA 2Z7JA 3PO5A 4XA5A 2BDPA 2IOFA 3C5FA 2D8CA 3G6YA 4YN4A 2AGOA 4R63A 5DDMA 2YTUA 5KFZA 1ZQXA 2B21A 1S10A 1COOA 5HNKA 4F5OA 3H8JA 4ECTA 3IG5A 2CRXA 4LZGA 4EELA 4JWMA 1PUZA 1JALA 3MDCA 7ICLA 3M9NB 5J0QA 5CHGA 2H3VA 2P6UA 5AK4A 1N63A 5AM2A 1KEJA 1XC9A 5CJ7A 2G08A 2FMSA 1H38A 2PMZF 5JTIA 4ELTA 5ALVA 3KFUF 3AN1A 4Z6EA 2IBKA 1EXNA 5L1LA 2BKEA 5J8YA 2Q4TA 4UBCA 4B9MA 1KRPA 2EAPA 3OPXA 2EANA 2DQNB 4DO9A 4J9PA 8ICTA 2GLEA 1U47A 1V9PA 5DBBA 4HAIA 5DGBA 3RJIA 9ICXA 4OJ6A 3F2CA 1NKCA 4I27A 7ICVA 1FFUA 2KKVA 3H8WA 1KSPA 2A3VA 3AL0B 2E5SA 2JMGA 4FZMA 5DKWA 2VJ5A 4C80A 9ICQA 2WF8A 1LKYA 4CNQA 3QUBA 1K1QA 4NLNA 3GIKA 3BQ2A 5ALUA 5AKHA 1IXRA 2KHVA 4UARA 4F4KA 4UASA 4RQ3A 3EPIA 2C22A 4Y2JA 3UM9A 4YD1A 1MSWD 2G5IB 1X9SA 4C8KA 5KFEA 1SZPA 2KNJA 3PV8A 3M7DA 3E2EA 2BCQA 3PY8A 3UXPA 4UB2A 8ICSA 4DSLA 4DL6A 5ALWA 4QW8A 3PMLA 3GILA 4KLFA 1N60A 2F8LA 5J2AA 7ICGA 5EE0A 3OHBA 5AI4A 2R8GA 2DPJA 1AQ6A 1QQ6A 2BQRA 3Q8RB 2QLTA 4DFJA 1ZQSA 3AEVA 3HP6A 4EYHB 4JWNA 4RT2A 2K8BB 2BCSA 3GIJA 1BPDA 1CEZA 5IIJA 2PFNA 9ICTA 4Y2QA 4QW9A 4OJPA 5KFXA 4EYIB 5DGAA 3U26A 2KIVA 5CP2A 4RT3A 4KLGA 3RB6A 8ICYA 1ZETA 2ZTCA 9ICOA 5J0UA 1QSSA 2NRVA 2UVUA 1SL2A 4LJXA 1DGJA 3EWAA 5AI8A 4ICAA 1ZD5A 4DS5A 1L7MA 8ICVA 1KN5A 3PW0A 9ICGA 1RPLA 2EQYA 7ICKA 2KEYA 5J29A 5DQIA 3K1ZA 5ALPA 3PW2A 2J6TA 1SZHA 1ZQVA 2YMMA 4OJOA 3LWLA 5C5JA 5ALRA 1DK2A 1UA1A 5AI5A 5J2IA 4ECWA 2QARA 5KT2A 4DQQA 2VA2A 8ICRA 4UB8U 3PSTA 4EX6A 2WF7A 1SV0A 2D3DA 8ICCA 1NZPA 1JX4A 3G6VA 3J81j 5J0OA 1N56A 2JR5A 2UVRA 4MFAA 1UCVA 1XO1A 4F91B 2V4QA 1A77A 4RQMA 4PGYA 1QQ5A 2VA3A 3GV8B 3V7LA 3I76A 1SKSA 2JH1A 9ICLA 3IN5A 4ECUA 1DXSA 2W03A 4BDPA 3BZCA 2AQ4A 4Y2VA 5ALNA 3PX4A 4R64A 1X42A 2C2DA 1X6JA 5FP0A 2OXOA 2YMPA 2KJ8A 1PZNA 3NVWA 4DF8A 2K4PA 3AU6A 4P0QB 2HSZA 3A0BU 3FYHA 1KLNA 3C2MA 4TUQA 3I28A 2F3NA 2LYBA 3NGDA 3THVA 2H3IA 1ZQRA 3PSFA 1XU4A 3B0YA 3MGVA 3SYZA 1PK1B 4NLBA 1Z1BA 3V7JA 3QU5A 1F5SA 4M0AA 4M9LA 5KG1A 5KG3A 3EUB2 3NASA 4M47A 1PVQA 4YR3A 4B9VA 7ICUA 2HMXA 5HMLA 2KVCA 1ZQIA 5HHHA 1FEZA 4F93B 1ZJMA 4QJFB 1FIQA 1LVHA 4OO1J 2E8PA 4IQVA 1ZQWA 4KX3A 1ZQEA 2DUYA 1X40A 2WF5A 4DSFA 5KG6A 4DFDA 4DCCA 1OUQA 1IM4A 2RQ5A 3MDAA 4K4IA 4JK1A 4DEZA 1ED1A 2FE9A 3MBYA 5F9NA 2LYHA 5HR7A 2RP5A 4M04A 3TADA 1KFDA 5KT4A 3IDWA 3ORYA 3Q8MA 5KFUA 1SB3C 4P4OA 3ISDA 2W9CA 2GWSA 3OJUA 1IV8A 4QZAA 5KFQA 4ECYA 3BDPA 4MFFA 1JRPA 4NLCA 2ZUDA 2MUTB 2C2EA 2XCPA 5J2FA 4JV0A 1X66A 3EZ5A 4KMOB 3WU2U 3L5KA 2W9BB 4NM1A 5IINA 1ZD2P 4KLUA 1RDFA 9ICCA 5J0RA 2W55A 4MEXA 1SGGA 1T4GA 1A0PA 4PGXA 3JPQA 8ICWA 1ZQKA 4YVZA 4OJLA 4US8A 4DF4A 1ZQPA 4UAVA 1S0MA 3AMZA 3FDSA 8ICAA 4QZHA 3UXNA 4HYKA 2LHTA 8ICIA 2EDUA 1Q46A 2JEFA 2ZJ5A 2FLPA 4YD2A 3GDXA 1RYSA 4DL2A 5AIAA 8ICMA 3NTUA 2HDOA 4FFDA 4IC9A 4YG2A 1S0NA 3C5GA 3SAGA 3TKAA 4DS4A 5J2DA 2G5HB 2KVSA 1U4BA 3GFKB 3CYMA 3C28A 5KFLA 4BWJA 4FS1A 9ICMA 3GIMA 3PSPA 3RJHA 2R8KA 4U6PA 5G5HA 4IQTA 5KTQA 4QZFA 2JGAA 5IILA 5DB6A 3WKCA 1BPBA 3AQEA 4O3QA 5DB8A 1TFRA 2A1JA 1GO3F 2ISOA 1D8BA 2BCRA 1U49A 5BPCA 4NXZA 4Z6CA 2XY5A 3ISBA 3IRUA 4UATA 2BDUA 1ZRMA 2F1HA 4Y2TA 1Z1VA 1XWLA 2NO4A 4KLSA 1S0OA 3A0HU 2WF6A 4BUGA 4AYBF 4TQRA 1ZQYA 4KLLA 5KFKA 1T8EA 1PK3A 5ALDA 4F8RA 1NZBA 3Q8SB 5J0TA 1V85A 9ICKA 1SKRA 3M6ZA 1OW5A 1ZQHA 3MFHA 1MN8A 2KZZA 1NJXA 5EE3A 5TISU 4QWCA 3TAQA 3KHHA 3HWTA 2KICA 4PZNA 2OYYA 3WKDA 4TQSA 4O3OA 2LI6A 3KKAC 1QSYA 4J9QA 3SEIA 1YZ7A 4F72A 4J9OA 5ALYA 4KMUA 1N5XA 1ZYQA 5KG2A 4I2EA 5AKEA 1S9FA 5AIBA 3ETRA 1CUKA 3QZ8A 1SKWA 1DGSA 2H5XA 3PW4A 3JPRA 7ICSA 4C8MA 5AKXA 2KJ5A 2KV2A 4P4MA 9ICUA 2FJ6A 3PVXA 3UPQA 2HHQA 8ICBA 4I2IA 7ICRA 2RHFA 2ZIWB 1Y88A 2HW3A 1WWVA 5B66U 2ASLA 2BQ3A 3BS5A 5AKLA 3Q8QB 1NJYA 2I9GA 1QSLA 3UMCA 2QKQA 2W3SA 3MR2A 3OSPA 4RZRA 3H4BA 3RH4A 3SQIA 2BCVA 1S76D 4PHDA 1URJA 4ECXA 1XSNA 2G09A 5CR0A 1HEKA 2HBJA 2HHUA 4NWIA 3F5AA 2L5YA 4R65A 4MFCA 2RLTA 1WCLA 4J9LA 4FE3A 8ICXA 4M6WA 3WK7A 1L3VA 3BJYA 4KLHA 4ED0A 1L7OA 4Z6DA 1T94A 4YMOA 4M6WB 4DFMA 4P0PA 3M8RA 2FPMA 4UAZA 1PVRA 8ICEA 2NO5A 3JPOA 1WUDA 1ZQQA 3Q8KA 2W11A 3G6XA 4YXJA 4O9MA 4BWMA 2ZIXA 4RQ5A 5HMMA 1ZQDA 3M8SA 4ECVA 1TK5A 2XCAA 2HHXA 3EW9A 4J9KA 2FI1A 1ZQFA 1TK0A 5AI0A 5KFFA 5BOMA 3H7IA 4I2FA 4DOAA 4NLZA 1NNLA 1YZ6A 3SR6A 1JN3A 3MGIA 4GLXA 3E0FA 3M9MB 4I2JA 3QU7A 4K4GA 3O0FA 5J0WA 5KNIA 4X5VA 4B9SA 2LBOA 1S0VA 1L5UA
chains in the Genus database with same CATH topology
1D8BA 1ED1A 2XICA 1ECWA 3HKZC 5HR7A 2K8AA 2Y0SC 2RP5A 3SMVA 3VC8A 1TAMA 2YB4A 3DEEA 2RHFA 5C0YA 5KL1B 2ZIUA 2ZIWB 2F8LA 2ZIXB 1Q3UA 4FZNA 2MA1A 3H0MB 3F2BA 2BDUA 2XVTA 3IG5A 4OJ5A 2CRXA 3NRWA 2VKQA 1Q3VA 2HOIA 2K4IA 3LYSA 2KD1A 3NUQA 4CRXA 2N1RA 2VJ4A 2ZXHA 1KBUA 3T79A 2JH1A 4BJQA 5A0LA 4NLCA 2LYAA 3AQFA 3IN5A 4FZLA 4PL1A 2W03A 3RFAA 4BUGA 4AYBF 3ONNA 2H3VA 2KJ9A 2WB1F 2G07A 3SQIA 3F53A 2JH7A 3GZFA 2K8BB 4O3MA 2ZIVA 2K89A 4KMOB 2G08A 1NZBA 2PMZF 1URJA 2XIDA 4ACOA 2G09A 3N7SC 2HBKA 5CRXA 2GH1A 3HKZF 1HEKA 2H3QA 2HBJA 2OXOA 2Y0SF 4NWIA 3F5AA 2G0AA 2KJ8A 3KFUF 2NV3A 2CN1A 4NV0A 2K4EA 2HBMA 2VIXA 4WJ3B 3H0RB 2Q4TA 5T14A 1HIWA 4OJPA 4P0QB 2WAQC 4QIWC 2ZG6A 2ZIVB 4FE3A 2KHQA 1A0PA 2H3FA 4BX9C 2K8CB 4C0ZA 3M6ZA 3PZPA 3IP4B 2H3ZA 2KOBA 4OJLA 2ZIUB 2YX8A 2LYBA 2F2AB 3OPXA 2H3IA 2XI9A 2M0NA 3GU3A 3PSIA 2DQNB 1Z19A 1ZQ1C 3PSFA 3CP8A 5HR6A 2KICA 4CDGA 3MGVA 2LHTA 1T94A 3N7PD 4NLBA 1PVPA 1F44A 2OYYA 3ICXA 3RF9A 1Z1BA 4P0PA 3D2NA 1UPHA 3CRXA 3H0LB 2R18A 4PL2A 2K4HA 2E1FA 1L6NA 3LVWA 1PVRA 4ICAA 3C29A 4OJ6A 3F2CA 1WUDA 3ALRA 4JMUA 2CPRA 1YT3A 1PVQA 4CGZA 1CRXA 1IIPA 2KKVA 2HMXA 4AYBC 2A3VA 1MA7A 1A6SA 3AL0B 2ZIWA 3L3FX 2WAQF 4IC9A 4QNLA 2E5SA 2KVCA 2JMGA 2ZIXA 2YB1A 4FZMA 2VJ5A 2KEYA 3SAHA 3SAGA 2PMZC 3K1ZA 3N7RC 2OM6A 2MRLA 3D2SA 1SZHA 2G5HB 2W7OA 4OJOA 2W04A 1DRGA 3IG8A 2F76X 3SAFA 3F5EA 4QJFB 4U7CA 4OO1J 2KHVA 3M6KA 2HOQA 5KL8B 1P7DA 2GOLA 3CYMA 3C28A 2HOFA 2DGZA 2DF4B 4KX3A 1XNSA 2HBLA 2RRDA 3D2QA 2JHDA 3KZXA 3PSPA 2W7PA 2KIWA 2F77X 2G5IB 3E0FA 2E1EA 4A8EA 2Z7JA 2ZXIA 2KJ5A 2KV2A 3O0FA 4U6PA 4GFJA 2KKPA 2WB1C 3PSTA 2KNJA 3VCBA 1XO0A 2G06A 2JGAA 1OUQA 4P0PB 3LVVA 2LKYA 3M7DA 4QIWF 3F2DA 2D6FC 4KX5A 2LBOA 3AQEA 2OH2A 4P0QA 1GO3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DRG A;  3MGV A;  1NZB A;  1PVP A;  1F44 A;  1Z1B A;  4ACO A;  5CRX A;  2KHV A;  1P7D A;  2HOF A;  3CRX A;  3C28 A;  2OXO A;  1Q3U A;  1XNS A;  2KJ8 A;  1PVR A;  3C29 A;  2CRX A;  2KIW A;  3NRW A;  1Q3V A;  4A8E A;  1PVQ A;  3LYS A;  2HOI A;  2KD1 A;  2KHQ A;  1A0P A;  2KJ5 A;  2KKV A;  1KBU A;  1CRX A;  2A3V A;  4CRX A;  1MA7 A;  2KOB A;  2KKP A;  1OUQ A;  1XO0 A;  2KEY A;  1Z19 A;  2KJ9 A; 
#chains in the Genus database with same CATH topology
 3H40 A;  2V9W A;  3AU2 A;  9ICW A;  4O5C A;  3Q8P B;  2MA1 A;  3PR5 B;  2HHV A;  4GIB A;  4Q8E A;  1LKY B;  4UB4 A;  1L8O A;  2N1R A;  9ICE A;  1BVS A;  4MF8 A;  4GC6 A;  4KLJ A;  4YR0 A;  3RRG A;  2DBY A;  5GTH U;  1JXE A;  4PHA A;  2RDJ A;  2ODG A;  3KZI U;  2GH1 A;  3IHQ B;  4M2Y A;  7ICM A;  4O5K A;  3C1Y A;  2R8J A;  4NV0 A;  2W8K A;  4WJ3 B;  5T14 A;  3KHL A;  4PJ0 U;  3RJJ A;  1SWV A;  3K75 D;  2H3Z A;  2KOB A;  3PR4 A;  1ZRN A;  5KFD A;  2F2A B;  4CF5 A;  3CP8 A;  4B9L A;  1K5O A;  4US9 A;  5ALM A;  4ECR A;  4G3I A;  1TAU A;  4I2D A;  4RU9 A;  4QZC A;  4BXO A;  2LPE A;  5ALF A;  4ZH4 A;  3C29 A;  3NVV A;  1NK7 A;  2AGQ A;  3TQ1 A;  1RQN A;  4Y2Y A;  1ARO P;  4EZ9 A;  4F3O A;  4NLG A;  1J2N A;  2I5H A;  2C28 A;  2Y9U A;  3V72 A;  1B4F A;  3SAH A;  3DV9 A;  1X9M A;  3RJF A;  5EE1 A;  2XY7 A;  9ICB A;  3SAF A;  3N28 A;  3SZ2 A;  3SD7 A;  1QQ7 A;  2KFZ A;  5H2F U;  2ATL A;  1XNS A;  5ALS A;  4R8U A;  1HJP A;  5G5G A;  3B9J A;  1VJ5 A;  4ED1 A;  2ISP A;  4JV1 A;  4F4Y A;  4DQR A;  1XO0 A;  3LVV A;  1N2X A;  1D8L A;  2YML A;  5J0P A;  5AM5 A;  4EEN A;  2XIC A;  3ZDB A;  3C1Z A;  3SEN A;  2BPG A;  2OEH A;  2I1Q A;  5KG4 A;  4C4S A;  2KTQ A;  5TZV A;  4XRH A;  4CF4 A;  4ED7 A;  5K4L A;  9ICV A;  4OJ5 A;  5DBA A;  2HHS A;  5KFH A;  1Q3V A;  2K4I A;  4YR2 A;  4ED6 A;  3AQF A;  5KAI U;  3V6J A;  4MEY A;  1UA0 A;  2QAR B;  4XUS A;  2ZJ8 A;  3RJG A;  2Y9T A;  4NM2 A;  1JIH A;  4ACO A;  4IRC A;  1QLN A;  3RBD A;  3ETL A;  2G0A A;  3T5J A;  2PXI A;  1BNO A;  4ZOH C;  1HIW A;  3RR8 A;  1CI4 A;  4QZE A;  3OGU A;  5DQH A;  1BPY A;  5CB1 A;  3PSI A;  1Z19 A;  4EZ6 A;  2PFO A;  4DLE A;  4LVS A;  1O03 A;  7ICE A;  3HX0 A;  2ASJ A;  4Z6F A;  1PVP A;  2MU2 A;  1F44 A;  1VLB A;  3GII A;  1LV5 A;  1ZD3 A;  4I29 A;  4F2S A;  5CEH A;  2AU0 A;  1SXE A;  2FPL A;  1IIP A;  1Q8K A;  2I6X A;  3HW8 A;  2KN7 A;  3HIL A;  3RH6 A;  1ZQT A;  2ZJA A;  5ALH A;  1ZOL A;  3QU2 A;  3PW5 A;  2Y1J A;  1ZXI A;  2W7O A;  3ZD8 A;  1F0M A;  1L3U A;  1J2M A;  4NL9 A;  4JV2 A;  2B6G A;  4U7C A;  4QWA A;  4KLI A;  2GOL A;  5KFY A;  3AUO A;  2W7P A;  2KIW A;  5JU5 A;  5J0S A;  2ZXI A;  4I2C A;  2IOF K;  5EE9 A;  1XS9 D;  7ICH A;  4DLG A;  3UMG A;  3HJE A;  4UAW A;  2PI4 A;  2ZTD A;  3MGH A;  1N61 A;  2UVV A;  4USA A;  2ZIU A;  4QZ9 A;  3WKE A;  3I1Y A;  4KLM A;  2R8I A;  4TUS A;  9ICH A;  3M9O B;  2HOI A;  1ZQG A;  2NRZ A;  3KKA A;  3QYP A;  2E3T A;  2LYA A;  7ICQ A;  2BCU A;  3BQT A;  3JPP A;  3DDH A;  2WB1 F;  8ICN A;  3CW2 C;  9ICN A;  4ECS A;  4O0I A;  4UBB A;  1FFV A;  3HKZ F;  2NV3 A;  2CN1 A;  2HI0 A;  1C20 A;  2H3F A;  3HPO A;  5ALQ A;  2M9N A;  4TUP A;  2XI9 A;  3GU3 A;  4F2R A;  2W9C B;  1KFS A;  1NK8 A;  3QZ7 A;  3NS1 A;  3SI8 A;  2W9A A;  8ICQ A;  4F4Z A;  1WYG A;  8ICP A;  3RB0 A;  1S8O A;  4M9G A;  3M1Y A;  1MQ2 A;  4RQ8 A;  4F5R A;  4PHE A;  4J9R A;  1NK0 A;  1CRX A;  4B9U A;  4UB5 A;  4RQ7 A;  2WF9 A;  5AK6 A;  1MA7 A;  4OCZ A;  3L3F X;  5L1K A;  1RXW A;  1U9L A;  4G9B A;  2MAX A;  4YQW A;  1NKE A;  4RUC A;  2BPF A;  4RQ1 A;  8ICH A;  2FLN A;  3M6K A;  7ICJ A;  4RPX A;  5ALO A;  1B0X A;  2HBL A;  5AKK A;  4DQI A;  7ICN A;  4RNN A;  5DQG A;  5J2K A;  1S77 D;  2WB1 C;  3RAX A;  7ICP A;  8ICO A;  5AHX A;  2KK0 A;  3HKZ C;  3DEE A;  4RNO A;  5EWF A;  4YCX A;  2XVT A;  2QB0 A;  7ICI A;  3NRW A;  2FMQ A;  5KFI A;  3QX7 A;  4F92 B;  4K4H A;  1VDV A;  5KT6 A;  4C7Y A;  2YQE A;  5AIC A;  2O6K A;  2K89 A;  2EZY A;  4FO6 A;  3EYZ A;  2BGW A;  2HBK A;  4IS7 A;  4DSI A;  3ISC A;  4IL6 U;  2W54 A;  3AM9 A;  2WTF A;  3NRZ A;  4JB3 A;  2A1J B;  3T5K A;  2EZX A;  4B6J A;  4QIW C;  4BX9 C;  4GXK A;  2HVH A;  4C8O A;  3IP4 B;  2Q0Z X;  2NRX A;  5J2H A;  4NL9 C;  2XC9 A;  3UQ0 A;  2M0N A;  2R8H A;  5EOZ A;  3LWM A;  4CDG A;  3TAN A;  5EWG A;  4YFK A;  1RG6 A;  2LM4 A;  2LM1 A;  3H0L B;  1OXJ A;  4I2G A;  3NVY A;  4YMN A;  1UT8 A;  5III A;  4FS2 A;  4J9S A;  4F4X A;  3LDA A;  4DWI A;  4QWD A;  1V97 A;  1NKB A;  3C2K A;  9ICA A;  2OM6 A;  3D2S A;  5KFG A;  2IOH A;  1SV4 A;  1IG6 A;  5KL8 B;  2HOF A;  8ICF A;  1X2I A;  2DGZ A;  5KFO A;  3QEA Z;  5D46 A;  3WK8 A;  2NRW A;  3OJS A;  1KL9 A;  5AKI A;  3WK6 A;  2HVI A;  5ALI A;  2DKX A;  4KN7 A;  5AKY A;  2NYV A;  2YB4 A;  9ICI A;  5KL1 B;  3PX6 A;  3BQ0 A;  1L3T A;  1U45 A;  4Y2X A;  2KZ3 A;  4M9J A;  3ZD9 A;  1ZQO A;  2IHN A;  2KSO A;  3SV3 A;  2W3R A;  3BQ7 A;  4I2H A;  8ICK A;  5AM3 A;  1NK6 A;  4BJQ A;  2C2R A;  1Z00 A;  3ED5 A;  1MQ3 A;  3RFA A;  2J6S A;  5DB7 A;  3E58 A;  2JH7 A;  4KTQ A;  3L4P A;  4O3M A;  3TAP A;  5BOL A;  5AI9 A;  1KTQ A;  5J0Y A;  3MC1 A;  1NJW A;  5CRX A;  2MSN A;  5AM1 A;  5L1I A;  4Q43 A;  4I2A A;  3H8S A;  1D9D A;  2V4R A;  2XGP A;  1ZJN A;  2P66 A;  5HP4 A;  5HR6 A;  3T5L A;  4J9M A;  1JI7 A;  3BS5 B;  5KFA A;  4EX7 A;  3RF9 A;  1BPE A;  1XSL A;  2DPI A;  3FC4 A;  2KFN A;  3KBB A;  4P4P A;  3IV6 A;  4F4W A;  2ALZ A;  5AKG A;  3TFS A;  1UT5 A;  4QNL A;  4DL4 A;  5AK3 A;  3RH5 A;  2Y1I A;  4XQ8 A;  3KOO A;  3N7R C;  1ZQU A;  5L1M A;  2ESE A;  2E8N A;  3K4G A;  4J9N A;  1QTM A;  5KFW A;  4O3R A;  2ES6 A;  1D8Y A;  3QE9 Y;  3D2Q A;  3V6H A;  4EBE A;  4KLQ A;  5KFJ A;  2OCE A;  4RQ2 A;  3N4M B;  1KW4 A;  1RXV A;  1KFT A;  3VCB A;  4P0P B;  5DBC A;  3HT3 A;  3QXG A;  3F2D A;  3V7K A;  5D4B A;  4KX5 A;  4DSJ A;  3WKB A;  2EH9 A;  2W9M A;  2K8A A;  2BR0 A;  3SMV A;  4ED8 A;  1L8L A;  1JXL A;  4PZO A;  5F3X B;  5KT5 A;  1XSP A;  2ZIX B;  3F2B A;  1COK A;  3WK9 A;  1NOM A;  5J0X A;  1BPZ A;  4NJ8 A;  1WCN A;  2KD1 A;  2JZB A;  4MF2 A;  3C2L A;  2NRT A;  3RBE A;  1BGX T;  5AM4 A;  1J97 A;  1B22 A;  2JZB B;  2IMW P;  5DB9 A;  2K4E A;  2VIX A;  4PHP A;  4QWE A;  2KHQ A;  2PFQ A;  5AM0 A;  1MC8 A;  5CA7 A;  2F1J A;  2YX8 A;  1SL0 A;  1ZQL A;  2PFP A;  3RJE A;  3TAC B;  2ZTE A;  4CCH A;  4KLO A;  8ICG A;  4IQU A;  2J6U A;  2CPR A;  4CGZ A;  2LMR A;  1X9X A;  3SV4 A;  4C4T A;  4CF3 A;  3TAR A;  7ICF A;  3GV7 B;  2PMZ C;  3ZDE A;  5IIO A;  1ZQA A;  5F9L A;  4OD0 A;  5ALX A;  3B0X A;  3F5E A;  4M9H A;  2XGQ A;  4QZG A;  2DF4 B;  4DL7 A;  4UQG A;  2F44 A;  2KZM A;  4MHV A;  3PO4 A;  2F77 X;  4IR1 A;  4A8E A;  1X9W A;  2OWO A;  4P2H A;  4QZI A;  5KAF U;  1KDH A;  2KKP A;  4GXI A;  3MR3 A;  1S97 A;  8ICU A;  4BXO B;  1QCK A;  1O08 A;  3QEB Z;  2OH2 A;  1NK4 A;  4QZD A;  3CNH A;  3WK4 A;  4QWB A;  9ICS A;  2KE7 A;  2W8L A;  2GO7 A;  4C8N A;  3T3F A;  5C0Y A;  4Q45 A;  1Q3U A;  2DFL A;  1UHU A;  4ED3 A;  4C4R A;  1RYU A;  4PL1 A;  2XO7 A;  4R8U B;  4Y2U A;  2KJ9 A;  4RNM A;  3F53 A;  3GZF A;  4KLD A;  2DWQ A;  4UW9 A;  4M9N A;  2Y0S F;  5ALK A;  4F5P A;  2BQU A;  4KLT A;  4KIT B;  5KFR A;  4RUA A;  4C0Z A;  9ICF A;  4DFK A;  5KFV A;  3UMB A;  4EEK A;  4ECZ A;  3LK9 A;  1ZQC A;  3MR5 A;  2JEI A;  4ELU A;  2HCF A;  3C21 A;  2AXT U;  5EWE A;  3MR6 A;  2KG5 A;  5L9X A;  1S5L U;  1NI3 A;  4RQN A;  4RQ6 A;  1TV9 A;  2P35 A;  3KHR A;  5IIM A;  1L3S A;  4E0D A;  1N5W A;  4RPZ A;  4IRD A;  2WAQ F;  5GTI U;  4J03 A;  3V6K A;  5J2C A;  2MRL A;  2AGP A;  5KG0 A;  3K1R B;  1RM6 C;  2FLL A;  5J8Y C;  1TKD A;  3WKA A;  2PKE A;  3QU9 A;  4RQ4 A;  5AKJ A;  4UB6 U;  3QUC A;  4EBC A;  4I28 A;  4AP9 A;  2BZF A;  2IA6 A;  4O5E A;  3QUT A;  2KP7 A;  4P0Q A;  5J2J A;  1ZQZ A;  3IM1 A;  4BGD A;  5JRT A;  2FDR A;  1ECW A;  2Y0S C;  1JUD A;  1TE2 A;  2ZUC A;  1ZD4 A;  3H8M A;  1TAQ A;  4Y2R A;  3H0M B;  2IHM A;  8ICZ A;  1RQL A;  2VKQ A;  5ALZ A;  2WFA A;  1PK1 A;  4CRX A;  1T7P A;  1KBU A;  5A0L A;  4CE6 A;  2JEJ A;  2BHN A;  3RB3 A;  3ONN A;  2G07 A;  4NY8 A;  1B43 A;  2EAM A;  1L7P A;  3QNM A;  1N48 A;  4O3S A;  4QZ8 A;  5ALT A;  4ECQ A;  3H0R B;  3GV5 B;  2AQ0 A;  5KFB A;  2WAQ C;  4DFP A;  2ZG6 A;  3PZP A;  3ZI4 A;  2YMQ A;  2ZIU B;  3RTV A;  5DDY A;  3KTQ A;  2JV3 A;  3D2N A;  5DLG A;  1UQV A;  3TFR A;  3BZK A;  2A1A A;  1DOQ A;  1HUO A;  4IRK A;  4O3N A;  1QH9 A;  1V38 A;  2XY6 A;  3QU4 A;  5J2E A;  2YB1 A;  1DK3 A;  3H4D A;  2W04 A;  4QZB A;  2F76 X;  3UXO A;  4RQ0 A;  4NLK A;  1TK8 A;  3OHA A;  5D49 A;  1NK9 A;  2QB1 A;  2BPC A;  1KKX A;  2DKZ A;  3JPT A;  2W43 A;  4IR9 A;  2MUT A;  4YMM A;  4B9T A;  1RYR A;  3S6J A;  4B9N A;  2W9B A;  1KQQ A;  2OHF A;  2G06 A;  1NK5 A;  2HHW A;  5HHI A;  2LKY A;  4QIW F;  5KFN A;  3C23 A;  2VAN A;  2FMP A;  5CWR A;  4C7Z A;  5IIK A;  3KHG A;  1T3Q A;  2JEG A;  1C7Y A;  4Q8F A;  3VC8 A;  1TAM A;  1BPX A;  5DG8 A;  1U48 A;  1A76 A;  4FZN A;  3RRH A;  1BNP A;  3ZDD A;  2AH5 A;  5AK5 A;  2K60 A;  4UB3 A;  3RJK A;  2P6R A;  3ZDA A;  4GC7 A;  4O3P A;  3OSN A;  3GQC A;  3T79 A;  4DL5 A;  1HUZ A;  2AJQ A;  1SIJ A;  1SXD A;  3QUQ A;  4UAU A;  2ASD A;  2KMD A;  2ZIV A;  2XID A;  3N7S C;  3NVZ A;  4ELV A;  1SV0 C;  2YY6 A;  5ALJ A;  4F5Q A;  4EBD A;  2ZIV B;  2K8C B;  2VA8 A;  2A19 A;  2PI5 A;  5ALE A;  5AKZ A;  4UAY A;  2QB0 B;  5DLF A;  3ICX A;  1JRO A;  1M6Y A;  4PL2 A;  3N97 B;  4F71 A;  1RZT A;  1Z4N A;  3ALR A;  1WG8 A;  4JUZ A;  1A6S A;  2EAO A;  2JRZ A;  3RAQ A;  5B5E U;  4IQW A;  1DRG A;  4KN4 A;  4DQS A;  4PH5 A;  2F1I A;  4DOB A;  2AHO B;  2B0C A;  1JMS A;  5KT7 A;  1NJZ A;  3MFI A;  4DL3 A;  2E1E A;  5J2B A;  4RPY A;  4GFJ A;  5AI6 A;  4FBT A;  5KFT A;  5KG7 A;  3KD3 A;  2D6F C;  3T5H A;  1L7N A;  1Z3E B;  4TUR A;  2EZZ A;  1WWU A;  3ZDC A;  9ICP A;  1D9F A;  4Y2P A;  3PW7 A;  5KT3 A;  5ALL A;  9ICJ A;  2CXY A;  1X6I A;  3R9K A;  4F50 A;  4FBU A;  3LYS A;  1SL1 A;  3NUQ A;  2VJ4 A;  2ZXH A;  3RB4 A;  4I2B A;  1ZQB A;  5JUM A;  3BQ1 A;  3PX0 A;  7ICT A;  4FZL A;  3JPN A;  3FM9 A;  3TI0 A;  2F8K A;  1ZQN A;  2HHT A;  4KLE A;  2ZUB A;  3PMN A;  3MAB A;  5KFM A;  9ICR A;  7ICO A;  3JPS A;  2H3Q A;  4ED2 A;  4F5N A;  3EPG A;  4UB1 A;  3HRD D;  2HBM A;  5KFP A;  4C8L A;  3RR7 A;  1Z4O A;  1SWW A;  3FAH A;  5KFS A;  3Q8L A;  4YP3 A;  1LB2 B;  5ALG A;  4DSK A;  2JXJ A;  2YN4 A;  3TAD C;  4DQP A;  3OTQ A;  1N62 A;  3D6J A;  1ZQ1 C;  2KSO B;  5DG9 A;  2E8M A;  4Q44 A;  4PPX A;  8ICJ A;  3PNC A;  3N7P D;  4DOC A;  5KG5 A;  1UPH A;  1Z00 B;  4Y2S A;  4DSE A;  3CRX A;  2R18 A;  2RDI A;  2K4H A;  2E1F A;  1L6N A;  3LVW A;  1FO4 A;  4JMU A;  5DG7 A;  1YT3 A;  1K1S A;  3WK5 A;  1T3N A;  4AYB C;  3UQ2 A;  2ZIW A;  4GXJ A;  5KFC A;  2WHE A;  5L1J A;  1TVA A;  1ZQJ A;  8ICL A;  2UVW A;  2DL0 A;  5J2G A;  4YXM A;  5E79 U;  4PGQ A;  3IG8 A;  4LZD A;  4EEY A;  4R66 A;  1ZQM A;  2HOQ A;  1P7D A;  2FPK A;  2RRD A;  3BS7 A;  2JHD A;  3KZX A;  2E8O A;  2Z7J A;  3PO5 A;  4XA5 A;  2BDP A;  2IOF A;  3C5F A;  2D8C A;  3G6Y A;  4YN4 A;  2AGO A;  4R63 A;  5DDM A;  2YTU A;  5KFZ A;  1ZQX A;  2B21 A;  1S10 A;  1COO A;  5HNK A;  4F5O A;  3H8J A;  4ECT A;  3IG5 A;  2CRX A;  4LZG A;  4EEL A;  4JWM A;  1PUZ A;  1JAL A;  3MDC A;  7ICL A;  3M9N B;  5J0Q A;  5CHG A;  2H3V A;  2P6U A;  5AK4 A;  1N63 A;  5AM2 A;  1KEJ A;  1XC9 A;  5CJ7 A;  2G08 A;  2FMS A;  1H38 A;  2PMZ F;  5JTI A;  4ELT A;  5ALV A;  3KFU F;  3AN1 A;  4Z6E A;  2IBK A;  1EXN A;  5L1L A;  2BKE A;  5J8Y A;  2Q4T A;  4UBC A;  4B9M A;  1KRP A;  2EAP A;  3OPX A;  2EAN A;  2DQN B;  4DO9 A;  4J9P A;  8ICT A;  2GLE A;  1U47 A;  1V9P A;  5DBB A;  4HAI A;  5DGB A;  3RJI A;  9ICX A;  4OJ6 A;  3F2C A;  1NKC A;  4I27 A;  7ICV A;  1FFU A;  2KKV A;  3H8W A;  1KSP A;  2A3V A;  3AL0 B;  2E5S A;  2JMG A;  4FZM A;  5DKW A;  2VJ5 A;  4C80 A;  9ICQ A;  2WF8 A;  1LKY A;  4CNQ A;  3QUB A;  1K1Q A;  4NLN A;  3GIK A;  3BQ2 A;  5ALU A;  5AKH A;  1IXR A;  2KHV A;  4UAR A;  4F4K A;  4UAS A;  4RQ3 A;  3EPI A;  2C22 A;  4Y2J A;  3UM9 A;  4YD1 A;  1MSW D;  2G5I B;  1X9S A;  4C8K A;  5KFE A;  1SZP A;  2KNJ A;  3PV8 A;  3M7D A;  3E2E A;  2BCQ A;  3PY8 A;  3UXP A;  4UB2 A;  8ICS A;  4DSL A;  4DL6 A;  5ALW A;  4QW8 A;  3PML A;  3GIL A;  4KLF A;  1N60 A;  2F8L A;  5J2A A;  7ICG A;  5EE0 A;  3OHB A;  5AI4 A;  2R8G A;  2DPJ A;  1AQ6 A;  1QQ6 A;  2BQR A;  3Q8R B;  2QLT A;  4DFJ A;  1ZQS A;  3AEV A;  3HP6 A;  4EYH B;  4JWN A;  4RT2 A;  2K8B B;  2BCS A;  3GIJ A;  1BPD A;  1CEZ A;  5IIJ A;  2PFN A;  9ICT A;  4Y2Q A;  4QW9 A;  4OJP A;  5KFX A;  4EYI B;  5DGA A;  3U26 A;  2KIV A;  5CP2 A;  4RT3 A;  4KLG A;  3RB6 A;  8ICY A;  1ZET A;  2ZTC A;  9ICO A;  5J0U A;  1QSS A;  2NRV A;  2UVU A;  1SL2 A;  4LJX A;  1DGJ A;  3EWA A;  5AI8 A;  4ICA A;  1ZD5 A;  4DS5 A;  1L7M A;  8ICV A;  1KN5 A;  3PW0 A;  9ICG A;  1RPL A;  2EQY A;  7ICK A;  2KEY A;  5J29 A;  5DQI A;  3K1Z A;  5ALP A;  3PW2 A;  2J6T A;  1SZH A;  1ZQV A;  2YMM A;  4OJO A;  3LWL A;  5C5J A;  5ALR A;  1DK2 A;  1UA1 A;  5AI5 A;  5J2I A;  4ECW A;  2QAR A;  5KT2 A;  4DQQ A;  2VA2 A;  8ICR A;  4UB8 U;  3PST A;  4EX6 A;  2WF7 A;  1SV0 A;  2D3D A;  8ICC A;  1NZP A;  1JX4 A;  3G6V A;  3J81 j;  5J0O A;  1N56 A;  2JR5 A;  2UVR A;  4MFA A;  1UCV A;  1XO1 A;  4F91 B;  2V4Q A;  1A77 A;  4RQM A;  4PGY A;  1QQ5 A;  2VA3 A;  3GV8 B;  3V7L A;  3I76 A;  1SKS A;  2JH1 A;  9ICL A;  3IN5 A;  4ECU A;  1DXS A;  2W03 A;  4BDP A;  3BZC A;  2AQ4 A;  4Y2V A;  5ALN A;  3PX4 A;  4R64 A;  1X42 A;  2C2D A;  1X6J A;  5FP0 A;  2OXO A;  2YMP A;  2KJ8 A;  1PZN A;  3NVW A;  4DF8 A;  2K4P A;  3AU6 A;  4P0Q B;  2HSZ A;  3A0B U;  3FYH A;  1KLN A;  3C2M A;  4TUQ A;  3I28 A;  2F3N A;  2LYB A;  3NGD A;  3THV A;  2H3I A;  1ZQR A;  3PSF A;  1XU4 A;  3B0Y A;  3MGV A;  3SYZ A;  1PK1 B;  4NLB A;  1Z1B A;  3V7J A;  3QU5 A;  1F5S A;  4M0A A;  4M9L A;  5KG1 A;  5KG3 A;  3EUB 2;  3NAS A;  4M47 A;  1PVQ A;  4YR3 A;  4B9V A;  7ICU A;  2HMX A;  5HML A;  2KVC A;  1ZQI A;  5HHH A;  1FEZ A;  4F93 B;  1ZJM A;  4QJF B;  1FIQ A;  1LVH A;  4OO1 J;  2E8P A;  4IQV A;  1ZQW A;  4KX3 A;  1ZQE A;  2DUY A;  1X40 A;  2WF5 A;  4DSF A;  5KG6 A;  4DFD A;  4DCC A;  1OUQ A;  1IM4 A;  2RQ5 A;  3MDA A;  4K4I A;  4JK1 A;  4DEZ A;  1ED1 A;  2FE9 A;  3MBY A;  5F9N A;  2LYH A;  5HR7 A;  2RP5 A;  4M04 A;  3TAD A;  1KFD A;  5KT4 A;  3IDW A;  3ORY A;  3Q8M A;  5KFU A;  1SB3 C;  4P4O A;  3ISD A;  2W9C A;  2GWS A;  3OJU A;  1IV8 A;  4QZA A;  5KFQ A;  4ECY A;  3BDP A;  4MFF A;  1JRP A;  4NLC A;  2ZUD A;  2MUT B;  2C2E A;  2XCP A;  5J2F A;  4JV0 A;  1X66 A;  3EZ5 A;  4KMO B;  3WU2 U;  3L5K A;  2W9B B;  4NM1 A;  5IIN A;  1ZD2 P;  4KLU A;  1RDF A;  9ICC A;  5J0R A;  2W55 A;  4MEX A;  1SGG A;  1T4G A;  1A0P A;  4PGX A;  3JPQ A;  8ICW A;  1ZQK A;  4YVZ A;  4OJL A;  4US8 A;  4DF4 A;  1ZQP A;  4UAV A;  1S0M A;  3AMZ A;  3FDS A;  8ICA A;  4QZH A;  3UXN A;  4HYK A;  2LHT A;  8ICI A;  2EDU A;  1Q46 A;  2JEF A;  2ZJ5 A;  2FLP A;  4YD2 A;  3GDX A;  1RYS A;  4DL2 A;  5AIA A;  8ICM A;  3NTU A;  2HDO A;  4FFD A;  4IC9 A;  4YG2 A;  1S0N A;  3C5G A;  3SAG A;  3TKA A;  4DS4 A;  5J2D A;  2G5H B;  2KVS A;  1U4B A;  3GFK B;  3CYM A;  3C28 A;  5KFL A;  4BWJ A;  4FS1 A;  9ICM A;  3GIM A;  3PSP A;  3RJH A;  2R8K A;  4U6P A;  5G5H A;  4IQT A;  5KTQ A;  4QZF A;  2JGA A;  5IIL A;  5DB6 A;  3WKC A;  1BPB A;  3AQE A;  4O3Q A;  5DB8 A;  1TFR A;  2A1J A;  1GO3 F;  2ISO A;  1D8B A;  2BCR A;  1U49 A;  5BPC A;  4NXZ A;  4Z6C A;  2XY5 A;  3ISB A;  3IRU A;  4UAT A;  2BDU A;  1ZRM A;  2F1H A;  4Y2T A;  1Z1V A;  1XWL A;  2NO4 A;  4KLS A;  1S0O A;  3A0H U;  2WF6 A;  4BUG A;  4AYB F;  4TQR A;  1ZQY A;  4KLL A;  5KFK A;  1T8E A;  1PK3 A;  5ALD A;  4F8R A;  1NZB A;  3Q8S B;  5J0T A;  1V85 A;  9ICK A;  1SKR A;  3M6Z A;  1OW5 A;  1ZQH A;  3MFH A;  1MN8 A;  2KZZ A;  1NJX A;  5EE3 A;  5TIS U;  4QWC A;  3TAQ A;  3KHH A;  3HWT A;  2KIC A;  4PZN A;  2OYY A;  3WKD A;  4TQS A;  4O3O A;  2LI6 A;  3KKA C;  1QSY A;  4J9Q A;  3SEI A;  1YZ7 A;  4F72 A;  4J9O A;  5ALY A;  4KMU A;  1N5X A;  1ZYQ A;  5KG2 A;  4I2E A;  5AKE A;  1S9F A;  5AIB A;  3ETR A;  1CUK A;  3QZ8 A;  1SKW A;  1DGS A;  2H5X A;  3PW4 A;  3JPR A;  7ICS A;  4C8M A;  5AKX A;  2KJ5 A;  2KV2 A;  4P4M A;  9ICU A;  2FJ6 A;  3PVX A;  3UPQ A;  2HHQ A;  8ICB A;  4I2I A;  7ICR A;  2RHF A;  2ZIW B;  1Y88 A;  2HW3 A;  1WWV A;  5B66 U;  2ASL A;  2BQ3 A;  3BS5 A;  5AKL A;  3Q8Q B;  1NJY A;  2I9G A;  1QSL A;  3UMC A;  2QKQ A;  2W3S A;  3MR2 A;  3OSP A;  4RZR A;  3H4B A;  3RH4 A;  3SQI A;  2BCV A;  1S76 D;  4PHD A;  1URJ A;  4ECX A;  1XSN A;  2G09 A;  5CR0 A;  1HEK A;  2HBJ A;  2HHU A;  4NWI A;  3F5A A;  2L5Y A;  4R65 A;  4MFC A;  2RLT A;  1WCL A;  4J9L A;  4FE3 A;  8ICX A;  4M6W A;  3WK7 A;  1L3V A;  3BJY A;  4KLH A;  4ED0 A;  1L7O A;  4Z6D A;  1T94 A;  4YMO A;  4M6W B;  4DFM A;  4P0P A;  3M8R A;  2FPM A;  4UAZ A;  1PVR A;  8ICE A;  2NO5 A;  3JPO A;  1WUD A;  1ZQQ A;  3Q8K A;  2W11 A;  3G6X A;  4YXJ A;  4O9M A;  4BWM A;  2ZIX A;  4RQ5 A;  5HMM A;  1ZQD A;  3M8S A;  4ECV A;  1TK5 A;  2XCA A;  2HHX A;  3EW9 A;  4J9K A;  2FI1 A;  1ZQF A;  1TK0 A;  5AI0 A;  5KFF A;  5BOM A;  3H7I A;  4I2F A;  4DOA A;  4NLZ A;  1NNL A;  1YZ6 A;  3SR6 A;  1JN3 A;  3MGI A;  4GLX A;  3E0F A;  3M9M B;  4I2J A;  3QU7 A;  4K4G A;  3O0F A;  5J0W A;  5KNI A;  4X5V A;  4B9S A;  2LBO A;  1S0V A;  1L5U A; 
#chains in the Genus database with same CATH homology
 1D8B A;  1ED1 A;  2XIC A;  1ECW A;  3HKZ C;  5HR7 A;  2K8A A;  2Y0S C;  2RP5 A;  3SMV A;  3VC8 A;  1TAM A;  2YB4 A;  3DEE A;  2RHF A;  5C0Y A;  5KL1 B;  2ZIU A;  2ZIW B;  2F8L A;  2ZIX B;  1Q3U A;  4FZN A;  2MA1 A;  3H0M B;  3F2B A;  2BDU A;  2XVT A;  3IG5 A;  4OJ5 A;  2CRX A;  3NRW A;  2VKQ A;  1Q3V A;  2HOI A;  2K4I A;  3LYS A;  2KD1 A;  3NUQ A;  4CRX A;  2N1R A;  2VJ4 A;  2ZXH A;  1KBU A;  3T79 A;  2JH1 A;  4BJQ A;  5A0L A;  4NLC A;  2LYA A;  3AQF A;  3IN5 A;  4FZL A;  4PL1 A;  2W03 A;  3RFA A;  4BUG A;  4AYB F;  3ONN A;  2H3V A;  2KJ9 A;  2WB1 F;  2G07 A;  3SQI A;  3F53 A;  2JH7 A;  3GZF A;  2K8B B;  4O3M A;  2ZIV A;  2K89 A;  4KMO B;  2G08 A;  1NZB A;  2PMZ F;  1URJ A;  2XID A;  4ACO A;  2G09 A;  3N7S C;  2HBK A;  5CRX A;  2GH1 A;  3HKZ F;  1HEK A;  2H3Q A;  2HBJ A;  2OXO A;  2Y0S F;  4NWI A;  3F5A A;  2G0A A;  2KJ8 A;  3KFU F;  2NV3 A;  2CN1 A;  4NV0 A;  2K4E A;  2HBM A;  2VIX A;  4WJ3 B;  3H0R B;  2Q4T A;  5T14 A;  1HIW A;  4OJP A;  4P0Q B;  2WAQ C;  4QIW C;  2ZG6 A;  2ZIV B;  4FE3 A;  2KHQ A;  1A0P A;  2H3F A;  4BX9 C;  2K8C B;  4C0Z A;  3M6Z A;  3PZP A;  3IP4 B;  2H3Z A;  2KOB A;  4OJL A;  2ZIU B;  2YX8 A;  2LYB A;  2F2A B;  3OPX A;  2H3I A;  2XI9 A;  2M0N A;  3GU3 A;  3PSI A;  2DQN B;  1Z19 A;  1ZQ1 C;  3PSF A;  3CP8 A;  5HR6 A;  2KIC A;  4CDG A;  3MGV A;  2LHT A;  1T94 A;  3N7P D;  4NLB A;  1PVP A;  1F44 A;  2OYY A;  3ICX A;  3RF9 A;  1Z1B A;  4P0P A;  3D2N A;  1UPH A;  3CRX A;  3H0L B;  2R18 A;  4PL2 A;  2K4H A;  2E1F A;  1L6N A;  3LVW A;  1PVR A;  4ICA A;  3C29 A;  4OJ6 A;  3F2C A;  1WUD A;  3ALR A;  4JMU A;  2CPR A;  1YT3 A;  1PVQ A;  4CGZ A;  1CRX A;  1IIP A;  2KKV A;  2HMX A;  4AYB C;  2A3V A;  1MA7 A;  1A6S A;  3AL0 B;  2ZIW A;  3L3F X;  2WAQ F;  4IC9 A;  4QNL A;  2E5S A;  2KVC A;  2JMG A;  2ZIX A;  2YB1 A;  4FZM A;  2VJ5 A;  2KEY A;  3SAH A;  3SAG A;  2PMZ C;  3K1Z A;  3N7R C;  2OM6 A;  2MRL A;  3D2S A;  1SZH A;  2G5H B;  2W7O A;  4OJO A;  2W04 A;  1DRG A;  3IG8 A;  2F76 X;  3SAF A;  3F5E A;  4QJF B;  4U7C A;  4OO1 J;  2KHV A;  3M6K A;  2HOQ A;  5KL8 B;  1P7D A;  2GOL A;  3CYM A;  3C28 A;  2HOF A;  2DGZ A;  2DF4 B;  4KX3 A;  1XNS A;  2HBL A;  2RRD A;  3D2Q A;  2JHD A;  3KZX A;  3PSP A;  2W7P A;  2KIW A;  2F77 X;  2G5I B;  3E0F A;  2E1E A;  4A8E A;  2Z7J A;  2ZXI A;  2KJ5 A;  2KV2 A;  3O0F A;  4U6P A;  4GFJ A;  2KKP A;  2WB1 C;  3PST A;  2KNJ A;  3VCB A;  1XO0 A;  2G06 A;  2JGA A;  1OUQ A;  4P0P B;  3LVV A;  2LKY A;  3M7D A;  4QIW F;  3F2D A;  2D6F C;  4KX5 A;  2LBO A;  3AQE A;  2OH2 A;  4P0Q A;  1GO3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...