2KD1A

Solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
b'MEPSKLSYGEYLESWFNTKRHSVGIQTAKVLKGYLNSRIIPSLGNIKLAKLTSLHMQNYVNSLRDEGLKRGTIEKIIKVIRNSLEHAIDLELITKNVAAKTKLPKADKEELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA integration/recombination/invertion protein
publication title Solution NMR Structure of the Integrase-Like Domain from Bacillus cereus Ordered Locus BC_1272. Northeast Structural Genomics Consortium Target BcR268F.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
total genus 37
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kd1A00
1Q3UA 1P7DA 1KBUA 3C29A 3C28A 1PVRA 1PVPA 2KKPA 1PVQA 3CRXA 1A0PA 1NZBA 2KOBA 2KIWA 1XO0A 1MA7A 3MGVA 4CRXA 3NRWA 2KJ9A 4A8EA 2KJ5A 2HOIA 4ACOA 1Q3VA 1CRXA 2OXOA 1F44A 2KD1A 2CRXA 2KHQA 2KHVA 2KEYA 2KKVA 2KJ8A 1XNSA 5CRXA 1Z1BA 1OUQA 2HOFA 2A3VA 1Z19A 1DRGA 3LYSA
chains in the Genus database with same CATH superfamily
4TUQA 5A0LA 1XSPA 3OPXA 4Q8FA 2PMZF 3H0LB 1J2NA 4OO1J 4ED0A 1FO4A 8ICAA 4KLOA 2DFLA 1VDVA 2AQ4A 4USAA 1BNPA 3Q8RB 4C80A 2ZG6A 2KSOA 2FMQA 3UMGA 7ICRA 4IQTA 2F1HA 4OJ6A 2KKPA 2W3SA 2LHTA 4CDGA 2BCQA 3HWTA 1Z3EB 2ODGA 1L7NA 2I6XA 4I29A 5ALHA 2HHQA 4RZRA 3OSPA 3RJKA 4KLLA 3IN5A 3TFSA 1ZQBA 2HI0A 5BPCA 3N7RC 4QWDA 4IS7A 2KKVA 2W3RA 4ZH4A 1L3UA 3HJEA 5KL1B 2FLNA 5J2BA 3SV4A 1N48A 2W7OA 3B9JA 3M9OB 4YR0A 2FJ6A 2E3TA 4QZIA 4F4XA 4C0ZA 2HBJA 1SB3C 4P4PA 3F2BA 4DS5A 2CXYA 4MFFA 3A0HU 3Q8LA 2WB1C 4ICAA 1SKSA 3J81j 4O9MA 3L4PA 7ICTA 4B9MA 5L9XA 3RJFA 4ECSA 1A76A 2ZUDA 4ZOHC 4J9MA 4FZMA 5KFCA 3IRUA 3D2NA 2PI4A 2HDOA 3WKDA 4F4KA 3RAXA 2NRZA 3MDAA 3N7PD 2JRZA 3PY8A 5ALOA 2G07A 2BPCA 1HEKA 2MRLA 4EBEA 3ZI4A 3H40A 3IM1A 5JUMA 2W11A 3H8MA 4NL9A 5ALNA 1ZQWA 2W7PA 5KAIU 4US9A 2ZJ5A 1NOMA 2Y0SF 4UAUA 4B9SA 4RQ8A 4B9UA 2V4RA 8ICUA 1LKYB 3KKAA 4EELA 2KVSA 4MF2A 3H4BA 3C2KA 7ICPA 4QZHA 8ICNA 4PPXA 2K4EA 4Q44A 3F2DA 5KFZA 3HT3A 4DSFA 5EE1A 4ECRA 4I2GA 3DEEA 1Q46A 4YFKA 5HMLA 3PW2A 1O03A 1RXWA 2ASLA 1V85A 4Q8EA 2HHSA 3GILA 2HOFA 1ZYQA 2ZIWA 1TK5A 5HHHA 3FM9A 3PX0A 1TAUA 1ZQPA 3C5GA 2K8CB 1COOA 2BHNA 3S6JA 3TADC 3RBEA 1LVHA 4EYIB 4Y2VA 1U49A 2KZZA 1IIPA 1CI4A 2FLPA 4M9NA 4QZGA 4FFDA 4AYBC 1L3VA 2KJ8A 2WAQF 4U7CA 4ECUA 1SV0C 4ECYA 2OEHA 4O5KA 3SAFA 4O3MA 1T4GA 5KT7A 2XCPA 1ZQCA 2KOBA 1ZQMA 2K4HA 1HJPA 1S10A 1Z00A 3KHHA 3UQ0A 3PMNA 1ZQIA 5E79U 2KK0A 4UARA 7ICQA 2F2AB 3RB0A 9ICPA 2OYYA 8ICYA 1LKYA 4YCXA 4NLNA 7ICNA 2BQRA 1Z1VA 7ICUA 8ICHA 4UB4A 4PHEA 2E8PA 2OM6A 3SQIA 1JUDA 1VLBA 4KLQA 2KJ5A 4Z6CA 4QWAA 2RHFA 4DL5A 2MUTA 5J0XA 1DRGA 2G09A 2FE9A 2H3QA 3CP8A 3PR4A 7ICHA 3CW2C 5HHIA 5TISU 8ICXA 1YZ6A 2K8AA 1MSWD 4P2HA 3ZDDA 5D49A 2F1JA 1S77D 5IILA 1DGJA 2XGPA 3SENA 4DSLA 8ICQA 9ICLA 4GXIA 2ZIUB 4ECVA 3V6JA 4F2RA 4HAIA 4DQSA 3FAHA 4ED6A 3PO4A 2QB0B 3QUTA 3CYMA 7ICVA 4EX6A 2RDJA 4RQ5A 4M47A 5CR0A 5J2AA 2DKZA 4F4ZA 2NYVA 4BUGA 2B21A 1MQ3A 1HIWA 2BCSA 1L3TA 3Q8SB 2E8OA 4CE6A 4DWIA 5KG2A 5EE0A 5KT4A 3UXNA 4GC7A 4QIWF 2D3DA 1NJWA 5DG7A 1BVSA 1DGSA 1ZQSA 1SZHA 3OJSA 3RJHA 3THVA 2RRDA 1ZRMA 4B9TA 2DKXA 1SL2A 4LVSA 1RXVA 4Y2TA 4YR3A 2Y1IA 4KLIA 4PGYA 4MHVA 5ALQA 4QWEA 1UHUA 5AM3A 4R65A 3RRGA 8ICJA 3K4GA 3WK4A 3AU6A 4YMOA 1ZQLA 3KHLA 3G6VA 2VA2A 2YB4A 2ES6A 3QX7A 4JV1A 4F72A 2LM4A 5DB7A 8ICGA 2E8MA 4B9VA 1ZQJA 3T79A 4C4SA 1WCNA 1ZOLA 3C28A 3WKCA 2QARB 5AKJA 1PVRA 4GXKA 3I28A 4ED1A 2K4IA 4F93B 2I5HA 2ZTDA 3UMBA 1S97A 5KT6A 1D8BA 1T3NA 3OHBA 1N60A 4J9NA 2ZXHA 3H8JA 3C5FA 2BR0A 3T5JA 3PSIA 4UB5A 3Q8MA 3V72A 1XSLA 4RUAA 3T3FA 4F92B 4BXOB 2VKQA 5KFNA 4KX5A 4F91B 4CF4A 1M6YA 2JEFA 4PHAA 4YP3A 4TUPA 1XO0A 3N7SC 1O08A 3UXOA 1ZQKA 1UT5A 4CGZA 5KG0A 5IIMA 3D6JA 1JALA 2KIVA 3V6HA 4UAVA 3RH5A 3T5KA 8ICIA 3AQEA 4QZBA 3IHQB 2E1FA 2ZUBA 2K60A 4OJ5A 4JUZA 9ICHA 4YD2A 3RJEA 2EZXA 5HMMA 4RPZA 3T5HA 5KFSA 1OUQA 3QUQA 4DQIA 1WCLA 2ZIXA 8ICLA 9ICUA 2KVCA 2PXIA 4C8LA 4FZNA 1SZPA 3TQ1A 3BQ0A 2PFQA 4RQ3A 2W9BB 1WG8A 1S0VA 3AEVA 3ETRA 2EAOA 3TARA 3JPSA 3LYSA 1LB2B 5ALLA 4PJ0U 3QXGA 3IDWA 4YVZA 4Y2XA 3GIJA 2NO4A 3F5AA 5AKGA 2HHVA 3RRHA 4NXZA 1X9XA 2XO7A 1KFTA 5AKZA 4I2EA 4JWNA 1CRXA 1IV8A 3PO5A 3G6XA 2F8KA 1N5XA 5AM1A 4I2IA 3MGHA 2JEJA 4IQWA 2ZIVB 2G0AA 5KFHA 9ICTA 1N62A 4NLGA 4FZLA 3AMZA 4DL4A 1U45A 5KFKA 1SV4A 2MU2A 4RNOA 4RQ6A 4FS1A 1ZJNA 5EWFA 1B4FA 4RNNA 3RBDA 4UAWA 1WWVA 2KV2A 3GFKB 1L3SA 4FBUA 1ZXIA 2IMWP 3NVWA 1YZ7A 4DSEA 2E1EA 3UQ2A 2KZMA 4B6JA 4YR2A 1RQLA 1EXNA 5AKYA 1WYGA 4M0AA 4ED7A 1ZJMA 4F50A 5KFOA 3IG5A 4EEKA 1UCVA 2C2EA 5AK3A 3RJJA 4I2AA 1T3QA 3C2MA 4GXJA 3SMVA 3LWLA 2MSNA 2W9BA 5ALVA 4FS2A 2ALZA 4P0QB 2JHDA 2YQEA 4YD1A 3UPQA 2FMSA 5ALYA 3EWAA 4X5VA 5ALZA 4QWBA 4KLEA 3PR5B 5J0PA 2I1QA 3HPOA 1Q3UA 1C20A 3NRZA 3OJUA 3PX4A 2XY5A 5KFLA 3WK9A 2H3ZA 1UT8A 5J8YC 2AXTU 5J0QA 2F44A 4C8KA 3C23A 2IOHA 5DKWA 4ELTA 5IINA 4R66A 3M1YA 2KEYA 1XNSA 2ASJA 4G3IA 3BZCA 2AGPA 9ICVA 1K1SA 1AROP 3BQ7A 1XSNA 1SGGA 1TFRA 2G5IB 1ZQGA 2KMDA 4B9NA 1ZQYA 4KLUA 5ALTA 2H3IA 1L7PA 3QU9A 3N4MB 5J0WA 4RQ2A 4M9HA 4PHDA 2KFNA 3RJGA 2DL0A 3KD3A 1NJYA 3VCBA 1L7OA 9ICXA 4P0PB 2IOFA 1JI7A 4CRXA 4YQWA 1T94A 1QSLA 2GLEA 1BNOA 2W54A 5J0YA 4ECZA 5KG5A 4PZNA 1JXEA 2Q4TA 2UVVA 3SAGA 1KKXA 2XGQA 4UB8U 2HVIA 3ZDEA 3QUBA 5AK5A 3MR3A 4M04A 4I2CA 1T8EA 4QW9A 8ICTA 2ZTEA 3GV8B 1N5WA 3ICXA 1P7DA 1ZQ1C 3ZD8A 3V6KA 4DQPA 1ZQZA 4DOCA 2P35A 4NLBA 3H0MB 5F3XB 4UW9A 2JEGA 4F5PA 1QSSA 1NK0A 2HOQA 4RU9A 4I2DA 4I28A 4UQGA 3JPNA 1V97A 2ZUCA 2FPMA 5TZVA 5J0SA 2H5XA 1ZD2P 3N28A 3A0BU 4BWMA 3PW4A 8ICKA 5J0TA 4YXMA 4UB6U 2ISOA 1ZETA 1BGXT 2BCUA 4NWIA 5IIIA 5KFVA 4ACOA 4JV0A 3AQFA 2FPKA 5ALSA 2GH1A 5AKHA 4HYKA 3TANA 2NRWA 3D2SA 2DQNB 5DQIA 2KN7A 1ECWA 2EZZA 3SYZA 2PMZC 4BDPA 3NUQA 3C21A 3QU2A 1BPEA 2W04A 1XU4A 1X6JA 1D8YA 4BWJA 3E58A 1KEJA 3M9MB 5EE3A 3HILA 5BOMA 2YX8A 2A1JB 1BPDA 2KFZA 4UATA 3MR6A 5CWRA 1PK3A 3O0FA 5KT3A 1COKA 2WF9A 3NVYA 3EYZA 4R63A 1TAMA 2OHFA 4EBDA 2HBMA 4C8OA 3TADA 3U26A 3I1YA 2KG5A 4FE3A 3C1ZA 3ZDCA 5ALRA 5L1IA 1MC8A 1L5UA 2KIWA 4RQ0A 1HUOA 2M0NA 4ECQA 4IR9A 1WWUA 3IV6A 5AM2A 1NKCA 7ICGA 3ED5A 2VA3A 3PNCA 4M6WB 5ALIA 2W43A 3C1YA 3HRDD 5JRTA 5HR7A 4QZEA 1N56A 3LVWA 2HBLA 3JPPA 4BX9C 4M9GA 2LI6A 1K5OA 5B66U 3M8RA 2A19A 1WUDA 5KFAA 4UASA 4ELUA 2BDUA 2KD1A 2R8IA 4RT2A 4M9JA 2D8CA 5AK4A 1U47A 1X6IA 4E0DA 4ED2A 3GZFA 2LYBA 4LZGA 3PW0A 4I2HA 2AJQA 2JR5A 4KLHA 3GIKA 4O0IA 1FIQA 2HSZA 2GWSA 1L7MA 1Y88A 4LZDA 8ICFA 2OXOA 2KHQA 3HW8A 5DGAA 3H7IA 3E0FA 1KDHA 8ICEA 5EWGA 4QZFA 2A1JA 3GU3A 4KLFA 1PVQA 3ISCA 3KHGA 3GV5B 2Y0SC 4YN4A 4PGQA 4MF8A 3NGDA 2EAPA 5HNKA 2ISPA 4OJPA 1J97A 1IG6A 3E2EA 4M9LA 4UBCA 5KFBA 1JX4A 2H3FA 3MABA 3RH4A 1ZQNA 5ALFA 4F5NA 1NZPA 7ICSA 4U6PA 3MFIA 4M6WA 3PSTA 2XI9A 5CP2A 2EDUA 4Y2QA 1KTQA 1MQ2A 4QW8A 1RG6A 4KMUA 2IBKA 5C5JA 3RAQA 1UA0A 2HBKA 4IQUA 2W9MA 4DFKA 2F8LA 5F9NA 4QZDA 4O3OA 3SV3A 3MFHA 2K4PA 4ED8A 4O3SA 3MC1A 1B0XA 4C8NA 1N61A 1SXEA 2ZIUA 1XC9A 1PK1B 1ZQRA 1UPHA 2O6KA 4DL2A 4JK1A 4DF4A 1IXRA 4DFDA 2WAQC 4F5RA 3EZ5A 2QB0A 2K89A 3PX6A 5DG9A 3NVVA 3M6ZA 3PSPA 3AUOA 5DB8A 3AN1A 4J03A 4JWMA 1RYSA 2DWQA 9ICRA 3R9KA 1B22A 2RLTA 8ICSA 3QYPA 3V7JA 1KN5A 4I2FA 2EH9A 2I9GA 3T5LA 1CUKA 4DF8A 5KFPA 5DQHA 5KFEA 4NJ8A 2BCRA 1RQNA 2W9AA 1NKEA 2A3VA 3NTUA 3V7LA 4F5OA 2JEIA 2UVRA 5AK6A 1XO1A 2W9CB 3HX0A 2W8LA 1L8LA 3SEIA 1IM4A 5J2CA 2NRVA 2AU0A 1DK3A 3JPOA 1T7PA 4KITB 1OXJA 5AKXA 2YMLA 4DLGA 3LWMA 2DBYA 4K4IA 5KT2A 2Z7JA 2HVHA 2C28A 1F5SA 2LYHA 1ZQXA 5IIKA 3MR2A 5JU5A 1TV9A 4J9SA 3RFAA 2JXJA 1MA7A 5L1LA 2XY6A 2NV3A 2R18A 8ICMA 7ICIA 4NM2A 1SKWA 1X66A 5ALUA 2HW3A 2LM1A 9ICMA 1PK1A 3PW7A 3M6KA 5CJ7A 4CCHA 4PL1A 1BPZA 3F5EA 5FP0A 1S9FA 1D9DA 3PW5A 5AKIA 3WK8A 5DGBA 1GO3F 5DG8A 4J9QA 2P6UA 2WTFA 2QARA 5KFFA 3KZIU 4RPXA 5D4BA 1Z4OA 5DBCA 1TE2A 4UBBA 2AQ0A 5ALEA 1JMSA 2KTQA 3H0RB 2HHWA 4R64A 4Z6DA 9ICQA 3VC8A 3Q8QB 1SL1A 4Y2RA 3N97B 4GC6A 5G5HA 4QIWC 4CNQA 4BXOA 3NRWA 4KLTA 9ICFA 1RZTA 4FBTA 3DV9A 4BJQA 9ICEA 4QZCA 2D6FC 4DL7A 1ZQOA 2KE7A 5L1KA 1ZQFA 1NZBA 2J6UA 3ISDA 3TFRA 4B9LA 1U4BA 2R8HA 1NK9A 5AI9A 4GLXA 3TACB 2W03A 2Y9TA 2BZFA 2YMMA 4RQMA 1SKRA 3NS1A 5KFMA 1D8LA 4XUSA 3RB4A 2XIDA 5KG7A 2QLTA 2FDRA 1ZQVA 5KFQA 1TK0A 3QU7A 5AI6A 5L1MA 2C2DA 4OCZA 8ICRA 5EWEA 3FYHA 1URJA 5DLFA 1FFUA 8ICBA 2JGAA 3WK5A 4J9OA 2FPLA 3H8WA 3BQ2A 4O3NA 4I2JA 2ZJAA 3RB3A 4F4WA 2RQ5A 1NNLA 4G9BA 1KFSA 1KLNA 4P4MA 2LKYA 2AH5A 3IG8A 1X9WA 4IL6U 4ECWA 4XRHA 5KNIA 2Y1JA 1C7YA 4EZ6A 1XS9D 4JV2A 2PI5A 2C22A 1DK2A 2VJ5A 1X42A 1J2MA 3TI0A 2MA1A 3LK9A 5KG3A 2KICA 4EENA 2FI1A 9ICCA 2VA8A 3L3FX 4GIBA 1SIJA 2MAXA 2QB1A 2HCFA 2HHXA 2ZIVA 1S0NA 1HUZA 2JZBB 4A8EA 4DS4A 7ICMA 5AI8A 3RF9A 1B43A 3OHAA 5C0YA 1ZQHA 4KMOB 4PZOA 4J9KA 2IOFK 3QNMA 4DQRA 3RTVA 4KTQA 2L5YA 4NM1A 2WHEA 2NO5A 4IRKA 2F1IA 1ZQUA 2LYAA 5K4LA 2IHNA 3TAQA 1N2XA 4ECTA 9ICSA 9ICGA 3WU2U 5J0RA 2CN1A 1S76D 3Q8KA 4IQVA 3GQCA 5J8YA 4Q45A 3MR5A 2AGOA 4GFJA 2W8KA 2BQ3A 4PH5A 2J6TA 4P0QA 2ZIWB 1ZD3A 4NL9C 3QUCA 4KX3A 2Q0ZX 2G06A 4Y2UA 1S5LU 5AI5A 2DF4B 5AKEA 2VJ4A 2F3NA 2KZ3A 5AIBA 3KKAC 3GIMA 5AICA 3BZKA 1U9LA 1YT3A 2XCAA 3C29A 2LMRA 3NASA 5KL8B 5ALPA 4DFMA 7ICLA 4QNLA 3LDAA 1NJZA 1KSPA 2C2RA 3K1ZA 5CA7A 2JZBA 4UB1A 2ZJ8A 1QCKA 2V9WA 4KLJA 3AM9A 3F2CA 5JTIA 3EW9A 1Z00B 1BPXA 3WKBA 3F53A 4EBCA 2J6SA 1FEZA 3ZDAA 1Q8KA 4JMUA 5J2IA 2AGQA 9ICOA 1RDFA 1KFDA 1KQQA 2XVTA 2E8NA 3BQ1A 4MEXA 1NK5A 4Z6EA 3GIIA 2PFOA 5J29A 2RP5A 2GOLA 5AIAA 4R8UB 2B0CA 7ICFA 4DFPA 4DOAA 3JPQA 3B0XA 4DQQA 3OTQA 4UB2A 1JXLA 2MUTB 3M8SA 4DSIA 5KAFU 1QQ5A 2KJ9A 4YXJA 5L1JA 2VANA 2DUYA 4FO6A 4P0PA 2KHVA 1PUZA 3HP6A 3QEAZ 4DEZA 3ZDBA 5DDYA 1D9FA 3OGUA 5GTHU 1ED1A 3EPIA 5KFXA 4MFCA 5DDMA 3ALRA 5J2HA 2XY7A 4C8MA 3QEBZ 4Y2YA 3LVVA 1SWVA 1NK8A 8ICZA 2ZTCA 5AI0A 1BPYA 3NVZA 5J2FA 2HOIA 3PSFA 3G6YA 3KTQA 3PMLA 1JIHA 1V9PA 1TKDA 5ALJA 3BQTA 3SI8A 3AL0B 4NLCA 1L6NA 1A77A 2DPJA 2R8JA 4M2YA 4EZ9A 1AQ6A 5ALWA 4WJ3B 5IIOA 2DPIA 1A6SA 4F71A 5DBAA 4DO9A 2PFPA 2DGZA 4DL3A 1SV0A 3L5KA 4TQSA 4QJFB 4Y2SA 5DBBA 4O5EA 5GTIU 2W55A 2BCVA 2P6RA 3MDCA 1JRPA 1V38A 5HR6A 1N63A 5J2JA 1ZQQA 4KLDA 4IRDA 2LPEA 4BGDA 2FLLA 4R8UA 4NY8A 7ICJA 4O3PA 2QKQA 5J2KA 4DCCA 4C7YA 1RYRA 3C2LA 4EX7A 3QE9Y 4DOBA 5AM4A 5T14A 1QTMA 2FMPA 4KLGA 1PZNA 2G5HB 5AKLA 2HHTA 1KRPA 2YMQA 4TUSA 5DLGA 4QWCA 4DL6A 5EE9A 3SD7A 1NJXA 1RM6C 5KG4A 3FC4A 4ELVA 8ICPA 5KFTA 5AM0A 3MBYA 1X9SA 3BS7A 4RQ4A 3HKZF 3BS5B 5KG1A 3V7KA 1NK7A 1NK6A 4Y2JA 4LJXA 4UAZA 5DB6A 3QU5A 4K4HA 4RQ1A 1TAQA 3GV7B 2H3VA 1Z4NA 5KFRA 1NI3A 8ICOA 4C4TA 4AP9A 4C7ZA 2JV3A 1L8OA 4EYHB 4DLEA 3UMCA 5KFYA 4PHPA 4EEYA 4YMNA 4DSKA 3IP4B 1FFVA 2G08A 4K4GA 3QU4A 3AU2A 3SZ2A 3K75D 1QSYA 2EQYA 5CEHA 9ICAA 2ZXIA 2OWOA 2WF8A 4YG2A 3RJIA 4QZ9A 1JROA 4J9PA 1SXDA 2BPFA 1QQ7A 3EPGA 5ALMA 2JH1A 2AHOB 4Q43A 4RQNA 4KLSA 1SL0A 1SWWA 8ICVA 4RQ7A 1X2IA 5EOZA 9ICBA 1F0MA 2RDIA 3UXPA 1NK4A 1DOQA 5J2EA 4QZ8A 3SAHA 1ZQEA 5KFJA 2NRXA 4OD0A 5ALKA 4YMMA 1BPBA 9ICJA 5J0OA 3M9NB 2F77X 5ALDA 3RH6A 5AI4A 1KL9A 1CEZA 4OJOA 1H38A 4OJLA 5KTQA 4DSJA 9ICKA 2BGWA 3SR6A 1TVAA 3WKAA 5HP4A 5H2FU 2K8BB 3BS5A 1Z19A 3QZ7A 1S8OA 2B6GA 2BQUA 3H4DA 3CRXA 2NRTA 5DQGA 2P66A 4F5QA 4J9RA 2PKEA 7ICKA 2ZIXB 1Q3VA 3K1RB 1ZQAA 2XICA 2CRXA 1LV5A 3RR8A 5CRXA 2OH2A 3RR7A 5KFWA 3ONNA 2GO7A 5KFDA 5AKKA 5IIJA 5ALXA 5KG6A 3KHRA 2YMPA 2YTUA 3H8SA 1KW4A 2CPRA 1QH9A 4O5CA 2YY6A 4I2BA 9ICNA 1TK8A 3ORYA 8ICCA 3KOOA 4RPYA 4ECXA 9ICWA 1MN8A 1JN3A 5J0UA 4F3OA 2Y9UA 5DB9A 4MFAA 4C4RA 1KBUA 3FDSA 1RPLA 3TAPA 4O3QA 3I76A 1U48A 3OSNA 1F44A 2JMGA 4RNMA 4RUCA 4IRCA 1K1QA 1NKBA 1Z1BA 3M7DA 2BKEA 2BDPA 2VIXA 4O3RA 2OCEA 4US8A 1S0OA 2XC9A 1A0PA 3HKZC 1UQVA 2LBOA 2R8GA 7ICEA 1RYUA 1S0MA 3ETLA 3GDXA 4JB3A 3TKAA 2WF6A 2WF7A 2EANA 1VJ5A 5KFGA 1UA1A 3BDPA 5AM5A 4RT3A 4NV0A 4Z6FA 4DFJA 3KZXA 4TURA 2WB1F 2UVUA 4XQ8A 4J9LA 4UB3A 2JH7A 1ZQTA 1ZRNA 4NLZA 3JPRA 9ICIA 2R8KA 2EZYA 2IA6A 1XWLA 3JPTA 5KT5A 2W9CA 4KN4A 4NLKA 3QZ8A 4MEYA 4PL2A 3WK7A 2N1RA 2KP7A 5KFUA 2WFAA 5CHGA 2IHMA 2F76X 3PZPA 2HHUA 4CF5A 4QZAA 4XA5A 4UAYA 2KSOB 5G5GA 3BJYA 3ISBA 5CB1A 2V4QA 2ESEA 1ZD5A 5J2GA 4PGXA 2M9NA 2E5SA 5KFIA 4F4YA 4Y2PA 3PV8A 2HMXA 3CNHA 3D2QA 3Q8PB 2WF5A 5J2DA 7ICOA 1ZQDA 5AHXA 1X9MA 3MGVA 2KNJA 2ATLA 2UVWA 2YN4A 5F9LA 4P4OA 4F8RA 4IR1A 3B0YA 3WKEA 2PFNA 2BPGA 8ICWA 3KBBA 4KN7A 5BOLA 3PVXA 3KFUF 3UM9A 5D46A 1PVPA 4ED3A 3WK6A 5B5EU 2YB1A 4TQRA 3DDHA 5ALGA 4KLMA 4F2SA 2A1AA 4CF3A 1QLNA 1DXSA 3ZD9A 1QQ6A 2ASDA 2EAMA 4I27A 4AYBF 1X40A 3RB6A 3MGIA 1OW5A 3EUB2 4IC9A 1ZD4A
chains in the Genus database with same CATH topology
2RP5A 2E1EA 2GOLA 2JH7A 2PMZC 3GU3A 3VCBA 4OJ5A 5A0LA 1PVQA 3NUQA 3OPXA 3CRXA 4P0PB 1NZBA 2PMZF 2W7PA 2Y0SC 3H0LB 2W04A 4OO1J 2OM6A 2Y0SF 3HKZF 4OJPA 3SQIA 4CRXA 2KJ9A 2LYAA 2ZIXB 2KJ5A 1T94A 1Q3VA 2XICA 2CRXA 2W03A 2RHFA 3IG5A 4P0PA 2KHVA 2YX8A 5C0YA 2H3FA 5CRXA 1OUQA 2OH2A 2H3VA 2ZG6A 3O0FA 1DRGA 2CN1A 2G09A 4PL2A 3SMVA 2Q4TA 2ZIXA 3ONNA 1ED1A 2N1RA 2K4EA 1TAMA 2H3QA 2XIDA 3CP8A 2HBMA 4GFJA 2Z7JA 3F2DA 4P0QB 2JHDA 2KVCA 3SAGA 3ALRA 4U6PA 4OJ6A 2KKPA 2K8AA 2LHTA 4CDGA 3PSTA 2XI9A 4FE3A 4FZNA 3LVVA 2F76X 3RFAA 2KIWA 3PZPA 2CPRA 1MA7A 2M0NA 1URJA 2NV3A 3IP4B 2R18A 2ZIWB 4P0QA 3IN5A 2G08A 3DEEA 4KX3A 2JGAA 2HOIA 3PSFA 2G06A 2YB4A 3N7RC 2KKVA 2DF4B 2VJ4A 2ZXIA 3M6KA 2HOFA 3AL0B 5KL1B 4NLCA 1L6NA 2ZIUB 2HBKA 2ZIWA 4PL1A 2E5SA 2W7OA 2F8LA 3F5EA 3ICXA 3LYSA 3T79A 1Q3UA 1YT3A 5HR7A 1P7DA 1KBUA 3C29A 3C28A 1PVRA 2HMXA 2K8CB 1ZQ1C 2HBLA 3D2QA 3LVWA 5KL8B 4BX9C 4WJ3B 2H3ZA 2JH1A 3CYMA 3F5AA 1A6SA 2K4IA 1GO3F 4C0ZA 2ZIUA 2HBJA 1WUDA 3MGVA 1IIPA 1UPHA 4QNLA 4NLBA 2LKYA 1D8BA 3H0MB 3IG8A 2BDUA 1CRXA 2DGZA 2ZXHA 3F2BA 2KNJA 2KD1A 2JMGA 4AYBC 1F44A 2WAQC 2K89A 4QJFB 3PSIA 2KEYA 2KJ8A 2WB1C 3SAHA 4ICAA 1XNSA 2WAQF 4U7CA 2HOQA 1Z1BA 3K1ZA 3M6ZA 3PSPA 4BUGA 2VJ5A 3M7DA 2ZIVB 2G0AA 2MA1A 2VKQA 4KX5A 2VIXA 3F2CA 2KICA 3GZFA 3H0RB 1HIWA 2G5IB 3SAFA 2LYBA 4O3MA 1PVPA 4FZMA 4FZLA 3VC8A 3KFUF 1A0PA 2F77X 3D2NA 3F53A 3HKZC 2KOBA 3L3FX 2LBOA 5HR6A 2YB1A 1XO0A 3N7SC 2ZIVA 4QIWC 2K4HA 4JMUA 2H3IA 3N7PD 3NRWA 4NWIA 4OJOA 4A8EA 4QIWF 4CGZA 4ACOA 3AQFA 4OJLA 2OXOA 2XVTA 2KHQA 2KV2A 2F2AB 1SZHA 3RF9A 2GH1A 4BJQA 5T14A 3AQEA 4NV0A 4AYBF 2K8BB 2D6FC 3D2SA 2G5HB 1Z19A 2A3VA 2G07A 3E0FA 3KZXA 1HEKA 2DQNB 2WB1F 2OYYA 4KMOB 2RRDA 2MRLA 2E1FA 1ECWA 4IC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3U A;  1P7D A;  1KBU A;  3C29 A;  3C28 A;  1PVR A;  1PVP A;  2KKP A;  1PVQ A;  3CRX A;  1A0P A;  1NZB A;  2KOB A;  2KIW A;  1XO0 A;  1MA7 A;  3MGV A;  4CRX A;  3NRW A;  2KJ9 A;  4A8E A;  2KJ5 A;  2HOI A;  4ACO A;  1Q3V A;  1CRX A;  2OXO A;  1F44 A;  2KD1 A;  2CRX A;  2KHQ A;  2KHV A;  2KEY A;  2KKV A;  2KJ8 A;  1XNS A;  5CRX A;  1Z1B A;  1OUQ A;  2HOF A;  2A3V A;  1Z19 A;  1DRG A;  3LYS A; 
#chains in the Genus database with same CATH topology
 4TUQ A;  5A0L A;  1XSP A;  3OPX A;  4Q8F A;  2PMZ F;  3H0L B;  1J2N A;  4OO1 J;  4ED0 A;  1FO4 A;  8ICA A;  4KLO A;  2DFL A;  1VDV A;  2AQ4 A;  4USA A;  1BNP A;  3Q8R B;  4C80 A;  2ZG6 A;  2KSO A;  2FMQ A;  3UMG A;  7ICR A;  4IQT A;  2F1H A;  4OJ6 A;  2KKP A;  2W3S A;  2LHT A;  4CDG A;  2BCQ A;  3HWT A;  1Z3E B;  2ODG A;  1L7N A;  2I6X A;  4I29 A;  5ALH A;  2HHQ A;  4RZR A;  3OSP A;  3RJK A;  4KLL A;  3IN5 A;  3TFS A;  1ZQB A;  2HI0 A;  5BPC A;  3N7R C;  4QWD A;  4IS7 A;  2KKV A;  2W3R A;  4ZH4 A;  1L3U A;  3HJE A;  5KL1 B;  2FLN A;  5J2B A;  3SV4 A;  1N48 A;  2W7O A;  3B9J A;  3M9O B;  4YR0 A;  2FJ6 A;  2E3T A;  4QZI A;  4F4X A;  4C0Z A;  2HBJ A;  1SB3 C;  4P4P A;  3F2B A;  4DS5 A;  2CXY A;  4MFF A;  3A0H U;  3Q8L A;  2WB1 C;  4ICA A;  1SKS A;  3J81 j;  4O9M A;  3L4P A;  7ICT A;  4B9M A;  5L9X A;  3RJF A;  4ECS A;  1A76 A;  2ZUD A;  4ZOH C;  4J9M A;  4FZM A;  5KFC A;  3IRU A;  3D2N A;  2PI4 A;  2HDO A;  3WKD A;  4F4K A;  3RAX A;  2NRZ A;  3MDA A;  3N7P D;  2JRZ A;  3PY8 A;  5ALO A;  2G07 A;  2BPC A;  1HEK A;  2MRL A;  4EBE A;  3ZI4 A;  3H40 A;  3IM1 A;  5JUM A;  2W11 A;  3H8M A;  4NL9 A;  5ALN A;  1ZQW A;  2W7P A;  5KAI U;  4US9 A;  2ZJ5 A;  1NOM A;  2Y0S F;  4UAU A;  4B9S A;  4RQ8 A;  4B9U A;  2V4R A;  8ICU A;  1LKY B;  3KKA A;  4EEL A;  2KVS A;  4MF2 A;  3H4B A;  3C2K A;  7ICP A;  4QZH A;  8ICN A;  4PPX A;  2K4E A;  4Q44 A;  3F2D A;  5KFZ A;  3HT3 A;  4DSF A;  5EE1 A;  4ECR A;  4I2G A;  3DEE A;  1Q46 A;  4YFK A;  5HML A;  3PW2 A;  1O03 A;  1RXW A;  2ASL A;  1V85 A;  4Q8E A;  2HHS A;  3GIL A;  2HOF A;  1ZYQ A;  2ZIW A;  1TK5 A;  5HHH A;  3FM9 A;  3PX0 A;  1TAU A;  1ZQP A;  3C5G A;  2K8C B;  1COO A;  2BHN A;  3S6J A;  3TAD C;  3RBE A;  1LVH A;  4EYI B;  4Y2V A;  1U49 A;  2KZZ A;  1IIP A;  1CI4 A;  2FLP A;  4M9N A;  4QZG A;  4FFD A;  4AYB C;  1L3V A;  2KJ8 A;  2WAQ F;  4U7C A;  4ECU A;  1SV0 C;  4ECY A;  2OEH A;  4O5K A;  3SAF A;  4O3M A;  1T4G A;  5KT7 A;  2XCP A;  1ZQC A;  2KOB A;  1ZQM A;  2K4H A;  1HJP A;  1S10 A;  1Z00 A;  3KHH A;  3UQ0 A;  3PMN A;  1ZQI A;  5E79 U;  2KK0 A;  4UAR A;  7ICQ A;  2F2A B;  3RB0 A;  9ICP A;  2OYY A;  8ICY A;  1LKY A;  4YCX A;  4NLN A;  7ICN A;  2BQR A;  1Z1V A;  7ICU A;  8ICH A;  4UB4 A;  4PHE A;  2E8P A;  2OM6 A;  3SQI A;  1JUD A;  1VLB A;  4KLQ A;  2KJ5 A;  4Z6C A;  4QWA A;  2RHF A;  4DL5 A;  2MUT A;  5J0X A;  1DRG A;  2G09 A;  2FE9 A;  2H3Q A;  3CP8 A;  3PR4 A;  7ICH A;  3CW2 C;  5HHI A;  5TIS U;  8ICX A;  1YZ6 A;  2K8A A;  1MSW D;  4P2H A;  3ZDD A;  5D49 A;  2F1J A;  1S77 D;  5IIL A;  1DGJ A;  2XGP A;  3SEN A;  4DSL A;  8ICQ A;  9ICL A;  4GXI A;  2ZIU B;  4ECV A;  3V6J A;  4F2R A;  4HAI A;  4DQS A;  3FAH A;  4ED6 A;  3PO4 A;  2QB0 B;  3QUT A;  3CYM A;  7ICV A;  4EX6 A;  2RDJ A;  4RQ5 A;  4M47 A;  5CR0 A;  5J2A A;  2DKZ A;  4F4Z A;  2NYV A;  4BUG A;  2B21 A;  1MQ3 A;  1HIW A;  2BCS A;  1L3T A;  3Q8S B;  2E8O A;  4CE6 A;  4DWI A;  5KG2 A;  5EE0 A;  5KT4 A;  3UXN A;  4GC7 A;  4QIW F;  2D3D A;  1NJW A;  5DG7 A;  1BVS A;  1DGS A;  1ZQS A;  1SZH A;  3OJS A;  3RJH A;  3THV A;  2RRD A;  1ZRM A;  4B9T A;  2DKX A;  1SL2 A;  4LVS A;  1RXV A;  4Y2T A;  4YR3 A;  2Y1I A;  4KLI A;  4PGY A;  4MHV A;  5ALQ A;  4QWE A;  1UHU A;  5AM3 A;  4R65 A;  3RRG A;  8ICJ A;  3K4G A;  3WK4 A;  3AU6 A;  4YMO A;  1ZQL A;  3KHL A;  3G6V A;  2VA2 A;  2YB4 A;  2ES6 A;  3QX7 A;  4JV1 A;  4F72 A;  2LM4 A;  5DB7 A;  8ICG A;  2E8M A;  4B9V A;  1ZQJ A;  3T79 A;  4C4S A;  1WCN A;  1ZOL A;  3C28 A;  3WKC A;  2QAR B;  5AKJ A;  1PVR A;  4GXK A;  3I28 A;  4ED1 A;  2K4I A;  4F93 B;  2I5H A;  2ZTD A;  3UMB A;  1S97 A;  5KT6 A;  1D8B A;  1T3N A;  3OHB A;  1N60 A;  4J9N A;  2ZXH A;  3H8J A;  3C5F A;  2BR0 A;  3T5J A;  3PSI A;  4UB5 A;  3Q8M A;  3V72 A;  1XSL A;  4RUA A;  3T3F A;  4F92 B;  4BXO B;  2VKQ A;  5KFN A;  4KX5 A;  4F91 B;  4CF4 A;  1M6Y A;  2JEF A;  4PHA A;  4YP3 A;  4TUP A;  1XO0 A;  3N7S C;  1O08 A;  3UXO A;  1ZQK A;  1UT5 A;  4CGZ A;  5KG0 A;  5IIM A;  3D6J A;  1JAL A;  2KIV A;  3V6H A;  4UAV A;  3RH5 A;  3T5K A;  8ICI A;  3AQE A;  4QZB A;  3IHQ B;  2E1F A;  2ZUB A;  2K60 A;  4OJ5 A;  4JUZ A;  9ICH A;  4YD2 A;  3RJE A;  2EZX A;  5HMM A;  4RPZ A;  3T5H A;  5KFS A;  1OUQ A;  3QUQ A;  4DQI A;  1WCL A;  2ZIX A;  8ICL A;  9ICU A;  2KVC A;  2PXI A;  4C8L A;  4FZN A;  1SZP A;  3TQ1 A;  3BQ0 A;  2PFQ A;  4RQ3 A;  2W9B B;  1WG8 A;  1S0V A;  3AEV A;  3ETR A;  2EAO A;  3TAR A;  3JPS A;  3LYS A;  1LB2 B;  5ALL A;  4PJ0 U;  3QXG A;  3IDW A;  4YVZ A;  4Y2X A;  3GIJ A;  2NO4 A;  3F5A A;  5AKG A;  2HHV A;  3RRH A;  4NXZ A;  1X9X A;  2XO7 A;  1KFT A;  5AKZ A;  4I2E A;  4JWN A;  1CRX A;  1IV8 A;  3PO5 A;  3G6X A;  2F8K A;  1N5X A;  5AM1 A;  4I2I A;  3MGH A;  2JEJ A;  4IQW A;  2ZIV B;  2G0A A;  5KFH A;  9ICT A;  1N62 A;  4NLG A;  4FZL A;  3AMZ A;  4DL4 A;  1U45 A;  5KFK A;  1SV4 A;  2MU2 A;  4RNO A;  4RQ6 A;  4FS1 A;  1ZJN A;  5EWF A;  1B4F A;  4RNN A;  3RBD A;  4UAW A;  1WWV A;  2KV2 A;  3GFK B;  1L3S A;  4FBU A;  1ZXI A;  2IMW P;  3NVW A;  1YZ7 A;  4DSE A;  2E1E A;  3UQ2 A;  2KZM A;  4B6J A;  4YR2 A;  1RQL A;  1EXN A;  5AKY A;  1WYG A;  4M0A A;  4ED7 A;  1ZJM A;  4F50 A;  5KFO A;  3IG5 A;  4EEK A;  1UCV A;  2C2E A;  5AK3 A;  3RJJ A;  4I2A A;  1T3Q A;  3C2M A;  4GXJ A;  3SMV A;  3LWL A;  2MSN A;  2W9B A;  5ALV A;  4FS2 A;  2ALZ A;  4P0Q B;  2JHD A;  2YQE A;  4YD1 A;  3UPQ A;  2FMS A;  5ALY A;  3EWA A;  4X5V A;  5ALZ A;  4QWB A;  4KLE A;  3PR5 B;  5J0P A;  2I1Q A;  3HPO A;  1Q3U A;  1C20 A;  3NRZ A;  3OJU A;  3PX4 A;  2XY5 A;  5KFL A;  3WK9 A;  2H3Z A;  1UT8 A;  5J8Y C;  2AXT U;  5J0Q A;  2F44 A;  4C8K A;  3C23 A;  2IOH A;  5DKW A;  4ELT A;  5IIN A;  4R66 A;  3M1Y A;  2KEY A;  1XNS A;  2ASJ A;  4G3I A;  3BZC A;  2AGP A;  9ICV A;  1K1S A;  1ARO P;  3BQ7 A;  1XSN A;  1SGG A;  1TFR A;  2G5I B;  1ZQG A;  2KMD A;  4B9N A;  1ZQY A;  4KLU A;  5ALT A;  2H3I A;  1L7P A;  3QU9 A;  3N4M B;  5J0W A;  4RQ2 A;  4M9H A;  4PHD A;  2KFN A;  3RJG A;  2DL0 A;  3KD3 A;  1NJY A;  3VCB A;  1L7O A;  9ICX A;  4P0P B;  2IOF A;  1JI7 A;  4CRX A;  4YQW A;  1T94 A;  1QSL A;  2GLE A;  1BNO A;  2W54 A;  5J0Y A;  4ECZ A;  5KG5 A;  4PZN A;  1JXE A;  2Q4T A;  2UVV A;  3SAG A;  1KKX A;  2XGQ A;  4UB8 U;  2HVI A;  3ZDE A;  3QUB A;  5AK5 A;  3MR3 A;  4M04 A;  4I2C A;  1T8E A;  4QW9 A;  8ICT A;  2ZTE A;  3GV8 B;  1N5W A;  3ICX A;  1P7D A;  1ZQ1 C;  3ZD8 A;  3V6K A;  4DQP A;  1ZQZ A;  4DOC A;  2P35 A;  4NLB A;  3H0M B;  5F3X B;  4UW9 A;  2JEG A;  4F5P A;  1QSS A;  1NK0 A;  2HOQ A;  4RU9 A;  4I2D A;  4I28 A;  4UQG A;  3JPN A;  1V97 A;  2ZUC A;  2FPM A;  5TZV A;  5J0S A;  2H5X A;  1ZD2 P;  3N28 A;  3A0B U;  4BWM A;  3PW4 A;  8ICK A;  5J0T A;  4YXM A;  4UB6 U;  2ISO A;  1ZET A;  1BGX T;  2BCU A;  4NWI A;  5III A;  5KFV A;  4ACO A;  4JV0 A;  3AQF A;  2FPK A;  5ALS A;  2GH1 A;  5AKH A;  4HYK A;  3TAN A;  2NRW A;  3D2S A;  2DQN B;  5DQI A;  2KN7 A;  1ECW A;  2EZZ A;  3SYZ A;  2PMZ C;  4BDP A;  3NUQ A;  3C21 A;  3QU2 A;  1BPE A;  2W04 A;  1XU4 A;  1X6J A;  1D8Y A;  4BWJ A;  3E58 A;  1KEJ A;  3M9M B;  5EE3 A;  3HIL A;  5BOM A;  2YX8 A;  2A1J B;  1BPD A;  2KFZ A;  4UAT A;  3MR6 A;  5CWR A;  1PK3 A;  3O0F A;  5KT3 A;  1COK A;  2WF9 A;  3NVY A;  3EYZ A;  4R63 A;  1TAM A;  2OHF A;  4EBD A;  2HBM A;  4C8O A;  3TAD A;  3U26 A;  3I1Y A;  2KG5 A;  4FE3 A;  3C1Z A;  3ZDC A;  5ALR A;  5L1I A;  1MC8 A;  1L5U A;  2KIW A;  4RQ0 A;  1HUO A;  2M0N A;  4ECQ A;  4IR9 A;  1WWU A;  3IV6 A;  5AM2 A;  1NKC A;  7ICG A;  3ED5 A;  2VA3 A;  3PNC A;  4M6W B;  5ALI A;  2W43 A;  3C1Y A;  3HRD D;  5JRT A;  5HR7 A;  4QZE A;  1N56 A;  3LVW A;  2HBL A;  3JPP A;  4BX9 C;  4M9G A;  2LI6 A;  1K5O A;  5B66 U;  3M8R A;  2A19 A;  1WUD A;  5KFA A;  4UAS A;  4ELU A;  2BDU A;  2KD1 A;  2R8I A;  4RT2 A;  4M9J A;  2D8C A;  5AK4 A;  1U47 A;  1X6I A;  4E0D A;  4ED2 A;  3GZF A;  2LYB A;  4LZG A;  3PW0 A;  4I2H A;  2AJQ A;  2JR5 A;  4KLH A;  3GIK A;  4O0I A;  1FIQ A;  2HSZ A;  2GWS A;  1L7M A;  1Y88 A;  4LZD A;  8ICF A;  2OXO A;  2KHQ A;  3HW8 A;  5DGA A;  3H7I A;  3E0F A;  1KDH A;  8ICE A;  5EWG A;  4QZF A;  2A1J A;  3GU3 A;  4KLF A;  1PVQ A;  3ISC A;  3KHG A;  3GV5 B;  2Y0S C;  4YN4 A;  4PGQ A;  4MF8 A;  3NGD A;  2EAP A;  5HNK A;  2ISP A;  4OJP A;  1J97 A;  1IG6 A;  3E2E A;  4M9L A;  4UBC A;  5KFB A;  1JX4 A;  2H3F A;  3MAB A;  3RH4 A;  1ZQN A;  5ALF A;  4F5N A;  1NZP A;  7ICS A;  4U6P A;  3MFI A;  4M6W A;  3PST A;  2XI9 A;  5CP2 A;  2EDU A;  4Y2Q A;  1KTQ A;  1MQ2 A;  4QW8 A;  1RG6 A;  4KMU A;  2IBK A;  5C5J A;  3RAQ A;  1UA0 A;  2HBK A;  4IQU A;  2W9M A;  4DFK A;  2F8L A;  5F9N A;  4QZD A;  4O3O A;  3SV3 A;  3MFH A;  2K4P A;  4ED8 A;  4O3S A;  3MC1 A;  1B0X A;  4C8N A;  1N61 A;  1SXE A;  2ZIU A;  1XC9 A;  1PK1 B;  1ZQR A;  1UPH A;  2O6K A;  4DL2 A;  4JK1 A;  4DF4 A;  1IXR A;  4DFD A;  2WAQ C;  4F5R A;  3EZ5 A;  2QB0 A;  2K89 A;  3PX6 A;  5DG9 A;  3NVV A;  3M6Z A;  3PSP A;  3AUO A;  5DB8 A;  3AN1 A;  4J03 A;  4JWM A;  1RYS A;  2DWQ A;  9ICR A;  3R9K A;  1B22 A;  2RLT A;  8ICS A;  3QYP A;  3V7J A;  1KN5 A;  4I2F A;  2EH9 A;  2I9G A;  3T5L A;  1CUK A;  4DF8 A;  5KFP A;  5DQH A;  5KFE A;  4NJ8 A;  2BCR A;  1RQN A;  2W9A A;  1NKE A;  2A3V A;  3NTU A;  3V7L A;  4F5O A;  2JEI A;  2UVR A;  5AK6 A;  1XO1 A;  2W9C B;  3HX0 A;  2W8L A;  1L8L A;  3SEI A;  1IM4 A;  5J2C A;  2NRV A;  2AU0 A;  1DK3 A;  3JPO A;  1T7P A;  4KIT B;  1OXJ A;  5AKX A;  2YML A;  4DLG A;  3LWM A;  2DBY A;  4K4I A;  5KT2 A;  2Z7J A;  2HVH A;  2C28 A;  1F5S A;  2LYH A;  1ZQX A;  5IIK A;  3MR2 A;  5JU5 A;  1TV9 A;  4J9S A;  3RFA A;  2JXJ A;  1MA7 A;  5L1L A;  2XY6 A;  2NV3 A;  2R18 A;  8ICM A;  7ICI A;  4NM2 A;  1SKW A;  1X66 A;  5ALU A;  2HW3 A;  2LM1 A;  9ICM A;  1PK1 A;  3PW7 A;  3M6K A;  5CJ7 A;  4CCH A;  4PL1 A;  1BPZ A;  3F5E A;  5FP0 A;  1S9F A;  1D9D A;  3PW5 A;  5AKI A;  3WK8 A;  5DGB A;  1GO3 F;  5DG8 A;  4J9Q A;  2P6U A;  2WTF A;  2QAR A;  5KFF A;  3KZI U;  4RPX A;  5D4B A;  1Z4O A;  5DBC A;  1TE2 A;  4UBB A;  2AQ0 A;  5ALE A;  1JMS A;  2KTQ A;  3H0R B;  2HHW A;  4R64 A;  4Z6D A;  9ICQ A;  3VC8 A;  3Q8Q B;  1SL1 A;  4Y2R A;  3N97 B;  4GC6 A;  5G5H A;  4QIW C;  4CNQ A;  4BXO A;  3NRW A;  4KLT A;  9ICF A;  1RZT A;  4FBT A;  3DV9 A;  4BJQ A;  9ICE A;  4QZC A;  2D6F C;  4DL7 A;  1ZQO A;  2KE7 A;  5L1K A;  1ZQF A;  1NZB A;  2J6U A;  3ISD A;  3TFR A;  4B9L A;  1U4B A;  2R8H A;  1NK9 A;  5AI9 A;  4GLX A;  3TAC B;  2W03 A;  2Y9T A;  2BZF A;  2YMM A;  4RQM A;  1SKR A;  3NS1 A;  5KFM A;  1D8L A;  4XUS A;  3RB4 A;  2XID A;  5KG7 A;  2QLT A;  2FDR A;  1ZQV A;  5KFQ A;  1TK0 A;  3QU7 A;  5AI6 A;  5L1M A;  2C2D A;  4OCZ A;  8ICR A;  5EWE A;  3FYH A;  1URJ A;  5DLF A;  1FFU A;  8ICB A;  2JGA A;  3WK5 A;  4J9O A;  2FPL A;  3H8W A;  3BQ2 A;  4O3N A;  4I2J A;  2ZJA A;  3RB3 A;  4F4W A;  2RQ5 A;  1NNL A;  4G9B A;  1KFS A;  1KLN A;  4P4M A;  2LKY A;  2AH5 A;  3IG8 A;  1X9W A;  4IL6 U;  4ECW A;  4XRH A;  5KNI A;  2Y1J A;  1C7Y A;  4EZ6 A;  1XS9 D;  4JV2 A;  2PI5 A;  2C22 A;  1DK2 A;  2VJ5 A;  1X42 A;  1J2M A;  3TI0 A;  2MA1 A;  3LK9 A;  5KG3 A;  2KIC A;  4EEN A;  2FI1 A;  9ICC A;  2VA8 A;  3L3F X;  4GIB A;  1SIJ A;  2MAX A;  2QB1 A;  2HCF A;  2HHX A;  2ZIV A;  1S0N A;  1HUZ A;  2JZB B;  4A8E A;  4DS4 A;  7ICM A;  5AI8 A;  3RF9 A;  1B43 A;  3OHA A;  5C0Y A;  1ZQH A;  4KMO B;  4PZO A;  4J9K A;  2IOF K;  3QNM A;  4DQR A;  3RTV A;  4KTQ A;  2L5Y A;  4NM1 A;  2WHE A;  2NO5 A;  4IRK A;  2F1I A;  1ZQU A;  2LYA A;  5K4L A;  2IHN A;  3TAQ A;  1N2X A;  4ECT A;  9ICS A;  9ICG A;  3WU2 U;  5J0R A;  2CN1 A;  1S76 D;  3Q8K A;  4IQV A;  3GQC A;  5J8Y A;  4Q45 A;  3MR5 A;  2AGO A;  4GFJ A;  2W8K A;  2BQ3 A;  4PH5 A;  2J6T A;  4P0Q A;  2ZIW B;  1ZD3 A;  4NL9 C;  3QUC A;  4KX3 A;  2Q0Z X;  2G06 A;  4Y2U A;  1S5L U;  5AI5 A;  2DF4 B;  5AKE A;  2VJ4 A;  2F3N A;  2KZ3 A;  5AIB A;  3KKA C;  3GIM A;  5AIC A;  3BZK A;  1U9L A;  1YT3 A;  2XCA A;  3C29 A;  2LMR A;  3NAS A;  5KL8 B;  5ALP A;  4DFM A;  7ICL A;  4QNL A;  3LDA A;  1NJZ A;  1KSP A;  2C2R A;  3K1Z A;  5CA7 A;  2JZB A;  4UB1 A;  2ZJ8 A;  1QCK A;  2V9W A;  4KLJ A;  3AM9 A;  3F2C A;  5JTI A;  3EW9 A;  1Z00 B;  1BPX A;  3WKB A;  3F53 A;  4EBC A;  2J6S A;  1FEZ A;  3ZDA A;  1Q8K A;  4JMU A;  5J2I A;  2AGQ A;  9ICO A;  1RDF A;  1KFD A;  1KQQ A;  2XVT A;  2E8N A;  3BQ1 A;  4MEX A;  1NK5 A;  4Z6E A;  3GII A;  2PFO A;  5J29 A;  2RP5 A;  2GOL A;  5AIA A;  4R8U B;  2B0C A;  7ICF A;  4DFP A;  4DOA A;  3JPQ A;  3B0X A;  4DQQ A;  3OTQ A;  4UB2 A;  1JXL A;  2MUT B;  3M8S A;  4DSI A;  5KAF U;  1QQ5 A;  2KJ9 A;  4YXJ A;  5L1J A;  2VAN A;  2DUY A;  4FO6 A;  4P0P A;  2KHV A;  1PUZ A;  3HP6 A;  3QEA Z;  4DEZ A;  3ZDB A;  5DDY A;  1D9F A;  3OGU A;  5GTH U;  1ED1 A;  3EPI A;  5KFX A;  4MFC A;  5DDM A;  3ALR A;  5J2H A;  2XY7 A;  4C8M A;  3QEB Z;  4Y2Y A;  3LVV A;  1SWV A;  1NK8 A;  8ICZ A;  2ZTC A;  5AI0 A;  1BPY A;  3NVZ A;  5J2F A;  2HOI A;  3PSF A;  3G6Y A;  3KTQ A;  3PML A;  1JIH A;  1V9P A;  1TKD A;  5ALJ A;  3BQT A;  3SI8 A;  3AL0 B;  4NLC A;  1L6N A;  1A77 A;  2DPJ A;  2R8J A;  4M2Y A;  4EZ9 A;  1AQ6 A;  5ALW A;  4WJ3 B;  5IIO A;  2DPI A;  1A6S A;  4F71 A;  5DBA A;  4DO9 A;  2PFP A;  2DGZ A;  4DL3 A;  1SV0 A;  3L5K A;  4TQS A;  4QJF B;  4Y2S A;  5DBB A;  4O5E A;  5GTI U;  2W55 A;  2BCV A;  2P6R A;  3MDC A;  1JRP A;  1V38 A;  5HR6 A;  1N63 A;  5J2J A;  1ZQQ A;  4KLD A;  4IRD A;  2LPE A;  4BGD A;  2FLL A;  4R8U A;  4NY8 A;  7ICJ A;  4O3P A;  2QKQ A;  5J2K A;  4DCC A;  4C7Y A;  1RYR A;  3C2L A;  4EX7 A;  3QE9 Y;  4DOB A;  5AM4 A;  5T14 A;  1QTM A;  2FMP A;  4KLG A;  1PZN A;  2G5H B;  5AKL A;  2HHT A;  1KRP A;  2YMQ A;  4TUS A;  5DLG A;  4QWC A;  4DL6 A;  5EE9 A;  3SD7 A;  1NJX A;  1RM6 C;  5KG4 A;  3FC4 A;  4ELV A;  8ICP A;  5KFT A;  5AM0 A;  3MBY A;  1X9S A;  3BS7 A;  4RQ4 A;  3HKZ F;  3BS5 B;  5KG1 A;  3V7K A;  1NK7 A;  1NK6 A;  4Y2J A;  4LJX A;  4UAZ A;  5DB6 A;  3QU5 A;  4K4H A;  4RQ1 A;  1TAQ A;  3GV7 B;  2H3V A;  1Z4N A;  5KFR A;  1NI3 A;  8ICO A;  4C4T A;  4AP9 A;  4C7Z A;  2JV3 A;  1L8O A;  4EYH B;  4DLE A;  3UMC A;  5KFY A;  4PHP A;  4EEY A;  4YMN A;  4DSK A;  3IP4 B;  1FFV A;  2G08 A;  4K4G A;  3QU4 A;  3AU2 A;  3SZ2 A;  3K75 D;  1QSY A;  2EQY A;  5CEH A;  9ICA A;  2ZXI A;  2OWO A;  2WF8 A;  4YG2 A;  3RJI A;  4QZ9 A;  1JRO A;  4J9P A;  1SXD A;  2BPF A;  1QQ7 A;  3EPG A;  5ALM A;  2JH1 A;  2AHO B;  4Q43 A;  4RQN A;  4KLS A;  1SL0 A;  1SWW A;  8ICV A;  4RQ7 A;  1X2I A;  5EOZ A;  9ICB A;  1F0M A;  2RDI A;  3UXP A;  1NK4 A;  1DOQ A;  5J2E A;  4QZ8 A;  3SAH A;  1ZQE A;  5KFJ A;  2NRX A;  4OD0 A;  5ALK A;  4YMM A;  1BPB A;  9ICJ A;  5J0O A;  3M9N B;  2F77 X;  5ALD A;  3RH6 A;  5AI4 A;  1KL9 A;  1CEZ A;  4OJO A;  1H38 A;  4OJL A;  5KTQ A;  4DSJ A;  9ICK A;  2BGW A;  3SR6 A;  1TVA A;  3WKA A;  5HP4 A;  5H2F U;  2K8B B;  3BS5 A;  1Z19 A;  3QZ7 A;  1S8O A;  2B6G A;  2BQU A;  3H4D A;  3CRX A;  2NRT A;  5DQG A;  2P66 A;  4F5Q A;  4J9R A;  2PKE A;  7ICK A;  2ZIX B;  1Q3V A;  3K1R B;  1ZQA A;  2XIC A;  2CRX A;  1LV5 A;  3RR8 A;  5CRX A;  2OH2 A;  3RR7 A;  5KFW A;  3ONN A;  2GO7 A;  5KFD A;  5AKK A;  5IIJ A;  5ALX A;  5KG6 A;  3KHR A;  2YMP A;  2YTU A;  3H8S A;  1KW4 A;  2CPR A;  1QH9 A;  4O5C A;  2YY6 A;  4I2B A;  9ICN A;  1TK8 A;  3ORY A;  8ICC A;  3KOO A;  4RPY A;  4ECX A;  9ICW A;  1MN8 A;  1JN3 A;  5J0U A;  4F3O A;  2Y9U A;  5DB9 A;  4MFA A;  4C4R A;  1KBU A;  3FDS A;  1RPL A;  3TAP A;  4O3Q A;  3I76 A;  1U48 A;  3OSN A;  1F44 A;  2JMG A;  4RNM A;  4RUC A;  4IRC A;  1K1Q A;  1NKB A;  1Z1B A;  3M7D A;  2BKE A;  2BDP A;  2VIX A;  4O3R A;  2OCE A;  4US8 A;  1S0O A;  2XC9 A;  1A0P A;  3HKZ C;  1UQV A;  2LBO A;  2R8G A;  7ICE A;  1RYU A;  1S0M A;  3ETL A;  3GDX A;  4JB3 A;  3TKA A;  2WF6 A;  2WF7 A;  2EAN A;  1VJ5 A;  5KFG A;  1UA1 A;  3BDP A;  5AM5 A;  4RT3 A;  4NV0 A;  4Z6F A;  4DFJ A;  3KZX A;  4TUR A;  2WB1 F;  2UVU A;  4XQ8 A;  4J9L A;  4UB3 A;  2JH7 A;  1ZQT A;  1ZRN A;  4NLZ A;  3JPR A;  9ICI A;  2R8K A;  2EZY A;  2IA6 A;  1XWL A;  3JPT A;  5KT5 A;  2W9C A;  4KN4 A;  4NLK A;  3QZ8 A;  4MEY A;  4PL2 A;  3WK7 A;  2N1R A;  2KP7 A;  5KFU A;  2WFA A;  5CHG A;  2IHM A;  2F76 X;  3PZP A;  2HHU A;  4CF5 A;  4QZA A;  4XA5 A;  4UAY A;  2KSO B;  5G5G A;  3BJY A;  3ISB A;  5CB1 A;  2V4Q A;  2ESE A;  1ZD5 A;  5J2G A;  4PGX A;  2M9N A;  2E5S A;  5KFI A;  4F4Y A;  4Y2P A;  3PV8 A;  2HMX A;  3CNH A;  3D2Q A;  3Q8P B;  2WF5 A;  5J2D A;  7ICO A;  1ZQD A;  5AHX A;  1X9M A;  3MGV A;  2KNJ A;  2ATL A;  2UVW A;  2YN4 A;  5F9L A;  4P4O A;  4F8R A;  4IR1 A;  3B0Y A;  3WKE A;  2PFN A;  2BPG A;  8ICW A;  3KBB A;  4KN7 A;  5BOL A;  3PVX A;  3KFU F;  3UM9 A;  5D46 A;  1PVP A;  4ED3 A;  3WK6 A;  5B5E U;  2YB1 A;  4TQR A;  3DDH A;  5ALG A;  4KLM A;  4F2S A;  2A1A A;  4CF3 A;  1QLN A;  1DXS A;  3ZD9 A;  1QQ6 A;  2ASD A;  2EAM A;  4I27 A;  4AYB F;  1X40 A;  3RB6 A;  3MGI A;  1OW5 A;  3EUB 2;  4IC9 A;  1ZD4 A; 
#chains in the Genus database with same CATH homology
 2RP5 A;  2E1E A;  2GOL A;  2JH7 A;  2PMZ C;  3GU3 A;  3VCB A;  4OJ5 A;  5A0L A;  1PVQ A;  3NUQ A;  3OPX A;  3CRX A;  4P0P B;  1NZB A;  2PMZ F;  2W7P A;  2Y0S C;  3H0L B;  2W04 A;  4OO1 J;  2OM6 A;  2Y0S F;  3HKZ F;  4OJP A;  3SQI A;  4CRX A;  2KJ9 A;  2LYA A;  2ZIX B;  2KJ5 A;  1T94 A;  1Q3V A;  2XIC A;  2CRX A;  2W03 A;  2RHF A;  3IG5 A;  4P0P A;  2KHV A;  2YX8 A;  5C0Y A;  2H3F A;  5CRX A;  1OUQ A;  2OH2 A;  2H3V A;  2ZG6 A;  3O0F A;  1DRG A;  2CN1 A;  2G09 A;  4PL2 A;  3SMV A;  2Q4T A;  2ZIX A;  3ONN A;  1ED1 A;  2N1R A;  2K4E A;  1TAM A;  2H3Q A;  2XID A;  3CP8 A;  2HBM A;  4GFJ A;  2Z7J A;  3F2D A;  4P0Q B;  2JHD A;  2KVC A;  3SAG A;  3ALR A;  4U6P A;  4OJ6 A;  2KKP A;  2K8A A;  2LHT A;  4CDG A;  3PST A;  2XI9 A;  4FE3 A;  4FZN A;  3LVV A;  2F76 X;  3RFA A;  2KIW A;  3PZP A;  2CPR A;  1MA7 A;  2M0N A;  1URJ A;  2NV3 A;  3IP4 B;  2R18 A;  2ZIW B;  4P0Q A;  3IN5 A;  2G08 A;  3DEE A;  4KX3 A;  2JGA A;  2HOI A;  3PSF A;  2G06 A;  2YB4 A;  3N7R C;  2KKV A;  2DF4 B;  2VJ4 A;  2ZXI A;  3M6K A;  2HOF A;  3AL0 B;  5KL1 B;  4NLC A;  1L6N A;  2ZIU B;  2HBK A;  2ZIW A;  4PL1 A;  2E5S A;  2W7O A;  2F8L A;  3F5E A;  3ICX A;  3LYS A;  3T79 A;  1Q3U A;  1YT3 A;  5HR7 A;  1P7D A;  1KBU A;  3C29 A;  3C28 A;  1PVR A;  2HMX A;  2K8C B;  1ZQ1 C;  2HBL A;  3D2Q A;  3LVW A;  5KL8 B;  4BX9 C;  4WJ3 B;  2H3Z A;  2JH1 A;  3CYM A;  3F5A A;  1A6S A;  2K4I A;  1GO3 F;  4C0Z A;  2ZIU A;  2HBJ A;  1WUD A;  3MGV A;  1IIP A;  1UPH A;  4QNL A;  4NLB A;  2LKY A;  1D8B A;  3H0M B;  3IG8 A;  2BDU A;  1CRX A;  2DGZ A;  2ZXH A;  3F2B A;  2KNJ A;  2KD1 A;  2JMG A;  4AYB C;  1F44 A;  2WAQ C;  2K89 A;  4QJF B;  3PSI A;  2KEY A;  2KJ8 A;  2WB1 C;  3SAH A;  4ICA A;  1XNS A;  2WAQ F;  4U7C A;  2HOQ A;  1Z1B A;  3K1Z A;  3M6Z A;  3PSP A;  4BUG A;  2VJ5 A;  3M7D A;  2ZIV B;  2G0A A;  2MA1 A;  2VKQ A;  4KX5 A;  2VIX A;  3F2C A;  2KIC A;  3GZF A;  3H0R B;  1HIW A;  2G5I B;  3SAF A;  2LYB A;  4O3M A;  1PVP A;  4FZM A;  4FZL A;  3VC8 A;  3KFU F;  1A0P A;  2F77 X;  3D2N A;  3F53 A;  3HKZ C;  2KOB A;  3L3F X;  2LBO A;  5HR6 A;  2YB1 A;  1XO0 A;  3N7S C;  2ZIV A;  4QIW C;  2K4H A;  4JMU A;  2H3I A;  3N7P D;  3NRW A;  4NWI A;  4OJO A;  4A8E A;  4QIW F;  4CGZ A;  4ACO A;  3AQF A;  4OJL A;  2OXO A;  2XVT A;  2KHQ A;  2KV2 A;  2F2A B;  1SZH A;  3RF9 A;  2GH1 A;  4BJQ A;  5T14 A;  3AQE A;  4NV0 A;  4AYB F;  2K8B B;  2D6F C;  3D2S A;  2G5H B;  1Z19 A;  2A3V A;  2G07 A;  3E0F A;  3KZX A;  1HEK A;  2DQN B;  2WB1 F;  2OYY A;  4KMO B;  2RRD A;  2MRL A;  2E1F A;  1ECW A;  4IC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...