2KD1A

Solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
MEPSKLSYGEYLESWFNTKRHSVGIQTAKVLKGYLNSRIIPSLGNIKLAKLTSLHMQNYVNSLRDEGLKRGTIEKIIKVIRNSLEHAIDLELITKNVAAKTKLPKADKEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the Integrase-Like Domain from Bacillus cereus Ordered Locus BC_1272. Northeast Structural Genomics Consortium Target BcR268F.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
molecule keywords DNA integration/recombination/invertion protein
total genus 37
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kd1A00
2KKVA 1MA7A 4CRXA 3C28A 2KKPA 1P7DA 1KBUA 3LYSA 1PVQA 1F44A 2KOBA 3NRWA 1Q3VA 2OXOA 1Z19A 2KIWA 4ACOA 1NZBA 2KJ9A 1A0PA 2KHQA 2CRXA 2HOIA 1CRXA 2A3VA 2HOFA 2KEYA 1Z1BA 2KHVA 4A8EA 5CRXA 3CRXA 1PVPA 2KD1A 2KJ8A 1XNSA 1OUQA 1DRGA 3C29A 1XO0A 3MGVA 1Q3UA 1PVRA 2KJ5A
chains in the Genus database with same CATH superfamily
2A1JB 3H0MB 3QUQA 3F53A 1L3UA 2OCEA 1A77A 4WJ3B 3SD7A 4EX7A 2W9BB 2HBJA 2PFOA 3PSIA 3PSTA 5AKGA 4QZ9A 4R65A 2JEIA 1UA1A 2VA2A 5ALHA 2J6TA 5KFXA 5ALNA 2G08A 4NLKA 3N28A 4UBBA 3B0XA 2AHOB 3KHHA 1NK9A 1SV4A 8ICYA 5ALIA 4OCZA 1SZHA 5KAFU 5IINA 4LVSA 2W54A 1ZQLA 3V6KA 4RUAA 4DO9A 3QUTA 4Y2SA 8ICPA 9ICXA 3ISCA 4KN4A 1KRPA 4MHVA 4R63A 1ZQAA 4NLZA 5KFHA 1U4BA 4KLSA 5KFZA 1J2NA 3K1RB 3LK9A 5AI9A 4QWAA 3BZCA 2D3DA 3KKAC 5ALUA 4KX3A 1SIJA 7ICTA 5ALMA 2F1JA 4C4RA 3KZIU 4O3RA 5HNKA 2OYYA 1V97A 2EAOA 1TAUA 1RQNA 4QZGA 4DQIA 1L3TA 1N2XA 2I5HA 5KFVA 2R8GA 3NVZA 2ZIWB 1TK5A 4CDGA 3WK9A 1F44A 1SWWA 1FO4A 3IP4B 3R9KA 4US8A 3GIJA 5IIMA 4HAIA 5AKJA 5AHXA 1TK8A 1TAQA 5AM2A 1SL0A 1KW4A 4UB2A 1T94A 1SL1A 3TACB 2VJ5A 4DSLA 3OJSA 1N63A 1VJ5A 5JTIA 2XGPA 2ZXHA 1Z1BA 3RB4A 3MR6A 9ICUA 4F2RA 4MEYA 4R66A 5EWFA 2AJQA 5AIAA 3PW2A 2AGPA 3F2DA 2NV3A 5KFTA 4IR1A 3SEIA 3SI8A 2HMXA 1L3VA 2BKEA 4IL6U 4KN7A 5DDYA 3V7JA 3HWTA 5KG7A 2Y0SC 1S0VA 9ICJA 7ICVA 3WU2U 1S77D 3BQ2A 2Y0SF 1SKRA 1BPYA 3QXGA 1RYSA 2H5XA 2F1IA 2LMRA 3OTQA 5CB1A 5DB6A 1WCLA 1ZQMA 4ZH4A 4EZ9A 4RQ1A 8ICJA 4F72A 3BDPA 4ED7A 4EX6A 2C22A 2PI4A 1ZQYA 4PL2A 1KLNA 2JEFA 5GTHU 4BX9C 1Z3EB 5ALZA 1DOQA 3I76A 5J2FA 3SENA 2HDOA 4JV1A 3SAGA 3IV6A 4Y2QA 2ES6A 2G09A 5D46A 1QLNA 3VC8A 5ALDA 1COOA 1V85A 4I2AA 2EAPA 2UVRA 4RQ6A 3WKCA 2W8LA 4BXOB 3SQIA 3RH5A 2P6UA 2BPCA 4UAYA 4IRKA 3HKZF 1X6JA 1L7NA 2XCAA 4ELTA 2LYAA 3ETLA 3F2BA 4DWIA 4F4WA 4IQTA 2XGQA 4GXIA 3UM9A 3F5AA 1UQVA 3ZD9A 3GIIA 4R8UB 3PR4A 4UAZA 4JWMA 1WG8A 1ZQVA 2JGAA 2KICA 4EELA 5DBAA 1NI3A 3QU9A 9ICBA 3AM9A 3WKBA 3QZ8A 4C8KA 5HMLA 4CNQA 5JRTA 3GDXA 4RNOA 2BZFA 4PH5A 1C20A 4DSFA 5CHGA 3AQEA 3C5GA 2OH2A 1Z1VA 5KG3A 1MN8A 3IHQB 4QWDA 1S0MA 1WYGA 1DK2A 4UATA 2P66A 4DQSA 5TZVA 3UPQA 3WK5A 5IIIA 1X9SA 1JMSA 1S10A 8ICCA 3BS5B 3MBYA 5KFEA 4DSIA 2CN1A 1T7PA 2BHNA 2YMPA 4B9TA 1U48A 5L1JA 5DG8A 1MQ3A 1RG6A 9ICCA 4GIBA 2FMPA 1TV9A 5AKKA 5ALOA 5L9XA 5KL8B 1NJYA 3BS7A 1PZNA 9ICPA 5AI0A 3RB0A 3G6XA 2KZMA 3T5HA 2BGWA 4KLDA 3PSFA 3KZXA 1XWLA 5ALFA 4QZFA 1OW5A 5J2HA 4JK1A 3PSPA 4M47A 4PJ0U 3AU2A 4C7YA 2I6XA 2KTQA 3WKEA 5L1KA 1QSSA 5KFLA 1T3QA 1L3SA 9ICFA 4CF3A 3QU7A 3LWMA 4YR0A 1DGJA 2W3RA 4RT2A 5KFYA 1AQ6A 3C1ZA 2YB4A 9ICLA 5J29A 4KLGA 1RDFA 4BDPA 1V38A 1LV5A 4PZNA 2HOQA 4XRHA 2WAQF 2ZIUB 1K1QA 2QARA 1X66A 2HHVA 4Y2PA 8ICVA 1TFRA 3H4DA 4DFMA 9ICHA 1AROP 2UVUA 1X6IA 2HI0A 3EZ5A 4KLOA 1ZQFA 3M7DA 2DKZA 4NY8A 1IV8A 5ALGA 5KFQA 1GO3F 5KG6A 3T3FA 2XI9A 9ICSA 4C4TA 5AK6A 4EYIB 2ZJ5A 7ICOA 1ZJMA 4TQSA 4RQNA 5J0PA 4FZLA 5AKIA 2WF6A 4US9A 3CW2C 2ZIXB 5DBBA 1HJPA 3HW8A 2FE9A 5KFGA 1N48A 1QQ7A 5J2JA 4YCXA 4ICAA 1BPZA 4TQRA 3BQ0A 1Y88A 2XY5A 4BWMA 3B9JA 2OHFA 3DV9A 8ICTA 4P0PB 1NZBA 1JN3A 4Y2XA 4TURA 1MA7A 4C8MA 2KKPA 3E0FA 3C21A 3JPRA 1ZQEA 4B6JA 2W04A 2EZYA 3ICXA 8ICEA 2E8NA 3KKAA 4QZHA 4DL6A 1J97A 4Y2TA 2Q4TA 4MF2A 4RZRA 2A19A 3OHAA 4J9OA 2BCUA 2MAXA 3BZKA 4XUSA 3LYSA 4DS4A 4DQRA 2JEJA 2ALZA 1Q8KA 3H8JA 2CPRA 5DQGA 4ED3A 2A3VA 4I29A 5DBCA 3M6ZA 3Q8MA 4OJPA 4QIWF 1KEJA 9ICMA 2ESEA 3MABA 8ICMA 1NKEA 2GO7A 3I1YA 1KTQA 1CUKA 3WK8A 4I2FA 2PKEA 3UXPA 4QZ8A 3KBBA 5KL1B 2JHDA 4O3NA 1XSLA 2QKQA 2PI5A 2BQUA 5J8YC 4QNLA 2AU0A 3JPNA 4M6WB 4ECYA 1L7PA 5BPCA 3EWAA 4KLQA 5DDMA 4F4KA 5AM1A 2RDJA 1U49A 1NK7A 1M6YA 4DL7A 5KG4A 3RJIA 4O0IA 2E1FA 2DGZA 2E1EA 3ORYA 3CNHA 3TAQA 2OXOA 1JX4A 4LZGA 2KV2A 3CYMA 7ICKA 2HBKA 2DBYA 3QYPA 3TANA 4MFFA 2ISOA 1S8OA 3BQ7A 4UB1A 5IILA 5EE1A 1BPDA 3RR8A 4Z6EA 1PVPA 3S6JA 3SZ2A 2I1QA 7ICUA 5AKHA 5CJ7A 2HHSA 1F5SA 2KG5A 5KT7A 4M04A 2K8AA 4ED8A 2OEHA 1S97A 5AI5A 2E8PA 1WWVA 2JH7A 4UAWA 3NUQA 4DOCA 4FFDA 5KFUA 2P6RA 3RR7A 1B43A 4AYBC 1PK1A 1YZ6A 3OGUA 3EYZA 2VA8A 1ZQSA 2W3SA 2QB0B 2LKYA 2H3IA 4DLGA 1SV0C 2HHTA 8ICNA 1U47A 4Z6CA 5J0SA 4UW9A 5CWRA 2ZIVA 3E58A 1ZOLA 4XA5A 1L5UA 9ICAA 2HHWA 1F0MA 2LM4A 3M1YA 3F5EA 3GILA 4O3OA 7ICJA 3NVVA 2IOFK 4I2HA 1OUQA 4I2JA 1SL2A 3SAFA 4O3QA 3OPXA 3N7PD 4DQPA 3IM1A 2XY7A 1NKBA 4YG2A 9ICKA 2JR5A 3JPSA 2D6FC 2K8BB 2JXJA 2ZIXA 2EZZA 2AQ0A 5AI4A 5L1LA 4I27A 4CF5A 4K4GA 2WF7A 3OSPA 2CXYA 1PK3A 5HMMA 4RQ3A 5FP0A 4B9MA 3M6KA 2FLNA 4ECXA 1SWVA 7ICMA 3PVXA 1B4FA 3NRWA 3PW7A 2YN4A 3G6VA 5K4LA 3D2QA 1KFSA 2UVVA 2F44A 5BOMA 1LB2B 3V72A 4RPXA 2FPLA 1DRGA 1K5OA 2G06A 2VA3A 4J9KA 1L7MA 5ALJA 3MFHA 3E2EA 1ZQOA 4QZEA 3HKZC 4KLLA 3N97B 1TKDA 2Y9TA 1RQLA 2JZBB 2KZZA 5KFNA 1JUDA 4M9LA 7ICIA 4RNMA 2KHVA 4J9NA 2EH9A 2PFNA 2ZTDA 2UVWA 4LJXA 2FDRA 5KT2A 1ED1A 4Y2RA 3NGDA 1U9LA 5F3XB 1X9WA 4KLJA 3T5LA 3O0FA 4M9NA 3ISDA 1UPHA 2QARB 3K1ZA 5HP4A 3ED5A 2NRTA 1X9XA 1IXRA 4I2CA 4F3OA 2KJ5A 1NNLA 2WF9A 5DLFA 1T8EA 4YXJA 4J9LA 4RNNA 4O5KA 2FJ6A 4O3PA 5JU5A 5J0QA 3T5JA 3WK7A 2EDUA 3MR2A 1WUDA 4FBTA 1IG6A 5AKZA 4OJ5A 3PO5A 4DEZA 2YMMA 5AM5A 2VANA 4B9VA 4Z6DA 3RJJA 2K4PA 2XCPA 1S0NA 1RXVA 3PX0A 2KE7A 2EQYA 5KT3A 2LBOA 5J2DA 1ZQNA 4DSEA 4M9HA 5L1MA 5AI6A 3NTUA 2NYVA 7ICFA 1QQ6A 1L8LA 5ALYA 4B9NA 4DL5A 1ZQXA 3NVWA 1N62A 2L5YA 8ICFA 2KP7A 4R64A 2Y9UA 3UMCA 2VIXA 4GLXA 3H0LB 1EXNA 2R8KA 4QZBA 3M8SA 1H38A 4PZOA 5KFOA 2HOIA 1TK0A 4EYHB 5KT5A 5AI8A 2IA6A 4F5QA 3PZPA 4EBDA 4IS7A 8ICSA 2QB0A 3ZDDA 4RQ5A 4RT3A 5KTQA 4DFKA 3RF9A 2E3TA 1UT5A 3U26A 4UB8U 2W9AA 5DB7A 2G5IB 2BCRA 3Q8KA 4UB4A 4YMMA 2DWQA 4HYKA 1TVAA 1CRXA 2HOFA 9ICTA 1ZETA 2HVIA 2RLTA 5EE9A 1HIWA 2WTFA 4C0ZA 3FM9A 4TUSA 2FMQA 4ZOHC 5KNIA 4DSJA 8ICBA 4EEYA 2K89A 5AM4A 4ECUA 1ZD3A 2A1JA 2B0CA 1LVHA 2BPGA 1FFUA 1Z4NA 3RRHA 2M0NA 3HRDD 3PR5B 4DL3A 7ICLA 4YR2A 5KG0A 4TUPA 5IIJA 3BQ1A 1ZQUA 1OXJA 4J9PA 3IG5A 4F5PA 1JRPA 4YVZA 2ZIUA 5C0YA 4G9BA 2ZUBA 4C4SA 3RJHA 4FZNA 3M9MB 2AQ4A 2ZUDA 4J03A 1NK6A 2HHUA 5T14A 4PHEA 3DDHA 3WKDA 4J9SA 1QSYA 2AGOA 9ICWA 3PX6A 1T3NA 3SMVA 4PGXA 2BR0A 2BCQA 5KFCA 5KFIA 2LI6A 3NRZA 4C80A 5F9NA 3C5FA 2YB1A 1UA0A 1KQQA 3RJGA 2JEGA 4ECTA 4ECRA 3PO4A 2ZUCA 3QEAZ 3HX0A 4O3MA 1P7DA 1K1SA 3QUCA 1TAMA 5HHIA 1WCNA 2JH1A 1B0XA 5AK3A 3TADA 2K4IA 1QH9A 1NKCA 2F2AB 2CRXA 2FMSA 2ZTEA 4JWNA 4DS5A 7ICGA 1XO1A 3RAQA 4YXMA 1ECWA 3KHGA 2V4QA 2OWOA 9ICEA 1COKA 2I9GA 8ICKA 1CEZA 3L5KA 5KT4A 4DCCA 3F2CA 3TFRA 3PW4A 4RQ7A 3UMBA 3MC1A 3OHBA 3UXOA 2BPFA 1XC9A 1ZXIA 4Y2VA 1ZQKA 2B21A 1UT8A 3NS1A 2FLPA 1KFTA 5ALRA 4NL9C 3JPTA 5KAIU 2FPKA 5J2BA 1S76D 5ALKA 2A1AA 1D9DA 1O03A 2KZ3A 5J0OA 5CRXA 4UASA 3NVYA 4RQ0A 4R8UA 5DLGA 2FI1A 3BJYA 7ICRA 4TUQA 3G6YA 4NV0A 3RH4A 4O9MA 3RB6A 2HVHA 3EPIA 1MQ2A 5IIOA 7ICEA 3RH6A 2J6SA 5EWGA 2DFLA 4C8LA 4RPZA 3AL0B 2W8KA 4YR3A 3GFKB 3TQ1A 4ED6A 4F4XA 2C2RA 2C2DA 5AKXA 1WWUA 4EEKA 5J2AA 3MR3A 5DGBA 1YT3A 3MGHA 2DF4B 4YMNA 2ASJA 4OD0A 8ICLA 2ATLA 2W7OA 3LVVA 3PY8A 3IRUA 2J6UA 4CGZA 8ICOA 1PVRA 1Q46A 3UQ2A 2NO4A 3THVA 1RZTA 1ZQQA 1Q3VA 4YD1A 4QWCA 3GIMA 3EW9A 3SV3A 2E8OA 3K4GA 2KN7A 4KMOB 4QW9A 1L7OA 1JALA 3MGVA 1NOMA 3QU5A 5HR6A 3HPOA 4KLIA 4FZMA 1DK3A 4NLCA 4F91B 2W7PA 1D8YA 1KL9A 2ZXIA 2DUYA 3A0BU 2M9NA 2HBLA 2PXIA 4J9RA 2R18A 7ICSA 7ICPA 2KVCA 2GWSA 1D8BA 1FIQA 1NZPA 1JROA 4UARA 4YP3A 1N56A 3JPPA 3TKAA 3GIKA 3TARA 8ICXA 2ZIVB 2F77X 2HHQA 3C23A 5EE3A 1N5XA 2N1RA 4GFJA 2KNJA 4F92B 2MRLA 8ICAA 1D8LA 5KG2A 2NRWA 4UAVA 2ZTCA 3QU2A 1ZQDA 4P2HA 1ZQIA 3OJUA 1HEKA 4M0AA 5EOZA 3ONNA 1A0PA 1TE2A 4FS1A 3DEEA 3IG8A 5DQIA 3HILA 5J2KA 2KMDA 1ZD5A 3TADC 1BPBA 2IHNA 3CRXA 4ECVA 3C2LA 1JXLA 2RQ5A 2LM1A 3Q8SB 4DQQA 2KKVA 2XC9A 3MDAA 4DF4A 4DFJA 2W55A 3SV4A 2MU2A 4KLMA 4AYBF 3MR5A 2K4HA 4DL4A 4JMUA 4K4IA 1NK8A 2PMZC 5KFPA 1ZQWA 2G5HB 8ICHA 2BDUA 5AK5A 5J0TA 4C8NA 1IIPA 3ISBA 2EANA 3Q8LA 7ICHA 5DG9A 4GC7A 1CI4A 1N60A 5G5HA 1RYUA 3ZD8A 3LWLA 3GQCA 1Z19A 1FFVA 9ICGA 2OM6A 4YQWA 1Z00A 4M2YA 4U6PA 1ZQPA 4F5OA 5HHHA 4Q43A 4DFPA 5TISU 4B9SA 4MEXA 2WF8A 5AK4A 2MA1A 3SR6A 5DB8A 4KLUA 1PVQA 2E5SA 4C8OA 4Q45A 4QZAA 4F4ZA 5ALWA 1QSLA 4KX5A 4DL2A 4BUGA 3GV7B 2YTUA 4F5NA 4J9MA 4CF4A 1ZQZA 4GXJA 5HR7A 3ZDEA 4U7CA 4RQ4A 1ZQCA 4F4YA 4JUZA 2XY6A 4P0QA 1JI7A 2KOBA 4QW8A 2W03A 4JB3A 2DL0A 4K4HA 2K8CB 2Y1IA 2ASLA 1RXWA 3RJFA 2H3VA 2ZIWA 2F3NA 5EWEA 1RPLA 3UXNA 8ICWA 3J81j 2KD1A 2KJ8A 5E79U 5J2GA 1NK5A 3H4BA 4FBUA 2KSOB 2ODGA 2PFPA 1ZRMA 4AP9A 2DPIA 1MSWD 3N4MB 4QZIA 9ICQA 5DKWA 4F2SA 3QZ7A 1NJXA 3KHLA 3K75D 4X5VA 2BDPA 4Q8EA 2F8KA 3RAXA 1V9PA 2W9MA 3TAPA 3M9NB 5J0XA 4EBEA 5ALLA 4JV2A 1X40A 2NRXA 4F8RA 4I2EA 1ZQTA 1XNSA 4NM2A 4DOBA 1QQ5A 2YQEA 5D4BA 4Z6FA 1XSPA 1PK1B 1XU4A 1URJA 4I28A 8ICZA 4KTQA 1BPXA 1MC8A 2ZJAA 3RB3A 9ICRA 2HW3A 4PHAA 3QUBA 2F8LA 2WB1C 4Y2JA 2FPMA 2LHTA 1S5LU 3AMZA 3KFUF 3D2NA 3V6HA 1NK0A 3RJKA 2PMZF 5B5EU 1DGSA 4OJLA 4F71A 4UBCA 4JV0A 5DG7A 2KVSA 1QTMA 4RQ8A 4NWIA 2W43A 1NJWA 2KFZA 5ALQA 2RHFA 9ICNA 1BNOA 3HJEA 1BPEA 1S9FA 4PPXA 4C7ZA 2K4EA 2VKQA 3ZI4A 2BCVA 1L8OA 3IN5A 4IC9A 3A0HU 5J0YA 3MGIA 4M6WA 1VDVA 3IDWA 4DSKA 5KFKA 4P4PA 5KFFA 2KHQA 3UMGA 5KFSA 2MUTA 5AIBA 3JPOA 3EUB2 1ZD4A 1HUOA 2V4RA 1BGXT 4IRDA 4BJQA 2HHXA 2NO5A 4KITB 2R8HA 3SYZA 3H7IA 4O5CA 4RUCA 3FYHA 2C2EA 5DGAA 3KHRA 3ZDBA 2IOHA 4ELVA 5BOLA 4QJFB 4CE6A 4G3IA 3LDAA 3OSNA 3TI0A 1X9MA 2G07A 3M8RA 3HT3A 9ICIA 3KTQA 5KFDA 4ECZA 8ICGA 1N5WA 3V7KA 2Y1JA 4IQVA 4MF8A 2BQRA 4NLGA 4P0PA 1A76A 3H8MA 4I2BA 1SGGA 4KLHA 7ICQA 3WK6A 4QZCA 3D6JA 4UAUA 1Z4OA 1Z00B 5A0LA 3GU3A 5AM0A 2IOFA 3V7LA 4ED0A 2KIWA 3JPQA 3SAHA 4BWJA 1SXEA 3N7RC 2IBKA 4O3SA 4F93B 8ICQA 4BXOA 2WFAA 5J0WA 2LPEA 1X2IA 4IR9A 2VJ4A 4P4OA 1ZRNA 1UCVA 3L3FX 3Q8RB 4CRXA 4B9LA 5F9LA 5EE0A 1KKXA 1SKWA 3CP8A 3H8WA 5J2CA 4KLTA 4MFAA 5KFAA 1ZYQA 1J2MA 2ZJ8A 4RPYA 3PNCA 4Y2YA 5KG5A 4ECQA 3PV8A 1ZQ1C 1BVSA 1SB3C 3C2MA 2D8CA 3ZDCA 3PX4A 2GOLA 2KIVA 2XICA 4KLEA 2Q0ZX 1ZD2P 5KFRA 2W9BA 1RYRA 1HUZA 2AGQA 4QIWC 1SZPA 2KJ9A 2YMQA 2RRDA 4DLEA 5CR0A 4F50A 3ZDAA 2KFNA 4NLNA 4OJOA 5AKYA 4ECSA 2Z7JA 4NM1A 2WF5A 2IHMA 4RQ2A 5KFJA 4O5EA 3AN1A 4LZDA 4NXZA 1N61A 1O08A 2ISPA 4GC6A 2F1HA 4PGQA 3GV5B 1XS9D 1ZQBA 1LKYA 3VCBA 4KLFA 2BCSA 1SXDA 2H3ZA 3QE9Y 3BS5A 2ASDA 2R8JA 3C28A 2MSNA 2F76X 2JMGA 3QNMA 1A6SA 9ICOA 3TFSA 3N7SC 4NJ8A 4M9GA 3PMLA 5KFBA 1ZQRA 2GH1A 2W9CA 5AM3A 2AH5A 3QX7A 3LVWA 5B66U 3Q8PB 4ECWA 1VLBA 3B0YA 4USAA 4EBCA 3QEBZ 4PL1A 5ALVA 2B6GA 3FC4A 2DQNB 4PGYA 2YMLA 8ICUA 2WHEA 1JXEA 2XO7A 9ICVA 5KG1A 5ALPA 3H0RB 1ZQGA 2FLLA 3C29A 5CA7A 1IM4A 3ALRA 1XSNA 4YD2A 2P35A 4NL9A 5DQHA 4UB6U 4Q44A 4KMUA 4YN4A 1JIHA 1KBUA 2R8IA 3EPGA 5CEHA 4DOAA 5AKEA 4P0QB 4I2DA 4MFCA 1RM6C 5ALXA 4RU9A 4Q8FA 1X42A 2K60A 2W11A 4B9UA 1Q3UA 4EZ6A 2DPJA 4IQUA 3T79A 5AICA 2ZG6A 3H40A 1ZQJA 3KOOA 3RFAA 5JUMA 4QWBA 5CP2A 3Q8QB 4M9JA 2WB1F 1ZJNA 2HCFA 2JV3A 3AQFA 3QU4A 4FS2A 1KDHA 2JRZA 3M9OB 3GV8B 4DF8A 4J9QA 2MUTB 3AU6A 1SV0A 5AKLA 4P4MA 2EAMA 2RP5A 3I28A 3L4PA 2H3QA 5G5GA 3RBEA 3V6JA 1KN5A 8ICRA 2YX8A 3H8SA 5GTIU 4QZDA 5ALEA 2IMWP 2QB1A 2NRVA 5ALSA 4CCHA 1SKSA 1T4GA 1UHUA 2G0AA 3MDCA 2JZBA 7ICNA 2DKXA 4EENA 5IIKA 2YY6A 4OJ6A 5J2IA 4GXKA 3KD3A 5C5JA 1FEZA 1D9FA 2EZXA 2RDIA 3PMNA 4Y2UA 5KT6A 5KFMA 4A8EA 3UQ0A 2GLEA 2XVTA 3T5KA 1B22A 3PW5A 4UB3A 4ED2A 3C1YA 2AXTU 5J2EA 2HBMA 2LYBA 1KSPA 3GZFA 3RBDA 3RTVA 5L1IA 5DB9A 1U45A 2QLTA 4ELUA 4OO1J 3C2KA 2V9WA 4NLBA 2BQ3A 3FDSA 5KFWA 5J8YA 1ZQHA 4YFKA 2W9CB 3WKAA 2C28A 5ALTA 4XQ8A 4PHDA 3ETRA 4E0DA 4UB5A 2NRZA 3RJEA 5J0UA 4BGDA 4YMOA 3WK4A 1KFDA 1NJZA 4QWEA 4DFDA 4FE3A 5J0RA 2PFQA 1BNPA 2O6KA 2XIDA 4ED1A 5D49A 3AUOA 3AEVA 4I2IA 3RRGA 5H2FU 4FO6A 3PW0A 2H3FA 1LKYB 2KSOA 1NK4A 3MFIA 4I2GA 4RQMA 2E8MA 4F5RA 2HSZA 1C7YA 4PHPA 1L6NA 3HP6A 2WAQC 3D2SA 3FAHA 1YZ7A 4ACOA 2KK0A 3BQTA 4UQGA 2LYHA 1PUZA 4IRCA 1S0OA 3NASA 8ICIA 4IQWA 1XO0A 2KEYA 1DXSA 1QCKA
chains in the Genus database with same CATH topology
3H0MB 1T94A 3F53A 3RF9A 4U7CA 4OJ6A 4PL1A 1ED1A 2ZIVA 1HEKA 3L3FX 4CRXA 4WJ3B 4O3MA 1P7DA 1YT3A 3LYSA 3HKZF 4P0QA 2KOBA 2VJ5A 3ONNA 2W03A 2DF4B 2G5IB 1TAMA 3CP8A 2CPRA 2JH1A 2DQNB 2HBJA 2K8CB 2LYAA 1A0PA 3F5EA 2H3VA 2ZIWA 2KHQA 3PSIA 2K4IA 3PSTA 3O0FA 2F2AB 3DEEA 2CRXA 3F2BA 3IG8A 1CRXA 2ZXHA 2A3VA 2HOFA 1Z1BA 1UPHA 2YB4A 3M6ZA 4A8EA 2W7OA 3H0RB 3LVVA 4OJPA 4QIWF 3K1ZA 2XVTA 3CRXA 2G08A 2KD1A 2KJ8A 1OUQA 3F5AA 3C29A 3SAFA 3ALRA 1HIWA 4CGZA 2HOQA 3OPXA 2WAQF 1ZQ1C 2ZIUB 3N7PD 1ECWA 2KJ5A 1PVRA 2KKVA 2HBMA 4C0ZA 2GOLA 2JGAA 2KICA 2LYBA 4BJQA 3F2DA 2XICA 1SZHA 3GZFA 4IC9A 4AYBF 1KBUA 2NV3A 5KL1B 2JHDA 3F2CA 2D6FC 1Q3VA 2K8BB 4P0QB 4QIWC 2K4HA 4JMUA 2ZIXA 4QNLA 2KJ9A 3M7DA 2PMZC 2K89A 4OO1J 2G5HB 2RRDA 1GO3F 1WUDA 4NLBA 2HMXA 2BDUA 4KMOB 4OJ5A 2XI9A 4QJFB 1XNSA 2M0NA 4OJOA 1IIPA 3MGVA 2Z7JA 2Y0SC 1Q3UA 3AQEA 2OH2A 3T79A 5HR6A 2G07A 3M6KA 2ZG6A 4FZLA 2E1FA 2DGZA 2Y0SF 2E1EA 4FZMA 4NLCA 2ZIXB 2W7PA 1URJA 2LBOA 3NRWA 3RFAA 2OXOA 4FE3A 1Z19A 2ZXIA 2WB1F 2XIDA 2KV2A 4ICAA 3IG5A 2HBLA 2OM6A 3CYMA 3D2QA 4KX3A 2HBKA 3AQFA 2R18A 2F8LA 2WB1C 2LHTA 2ZIUA 4U6PA 4P0PA 5CRXA 5C0YA 1PVPA 2H3FA 2KVCA 2CN1A 2OYYA 1DRGA 3KFUF 3D2NA 1D8BA 2G06A 3VCBA 4FZNA 4P0PB 2H3ZA 1NZBA 5A0LA 2PMZF 2K8AA 4PL2A 5T14A 4OJLA 2VIXA 1L6NA 3GU3A 2MA1A 2ZIWB 5KL8B 3H0LB 2WAQC 4BX9C 1MA7A 2JH7A 4CDGA 2KKPA 2RP5A 3NUQA 3C28A 4NV0A 1PVQA 3D2SA 1F44A 3E0FA 2E5SA 2F76X 2H3QA 2JMGA 3PSFA 2KIWA 4ACOA 3KZXA 3SAGA 3IP4B 2YX8A 1A6SA 3HKZC 4NWIA 3SMVA 3SAHA 3AL0B 2G09A 3N7SC 2ZIVB 2F77X 4KX5A 4AYBC 2HOIA 2VJ4A 2W04A 3N7RC 2N1RA 2RHFA 4GFJA 3ICXA 3VC8A 3PZPA 4BUGA 2KNJA 2MRLA 2LKYA 3PSPA 2K4EA 2GH1A 2VKQA 1XO0A 2H3IA 2G0AA 5HR7A 2YB1A 2KEYA 3IN5A 3LVWA 3SQIA 2Q4TA 2KHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKV A;  1MA7 A;  4CRX A;  3C28 A;  2KKP A;  1P7D A;  1KBU A;  3LYS A;  1PVQ A;  1F44 A;  2KOB A;  3NRW A;  1Q3V A;  2OXO A;  1Z19 A;  2KIW A;  4ACO A;  1NZB A;  2KJ9 A;  1A0P A;  2KHQ A;  2CRX A;  2HOI A;  1CRX A;  2A3V A;  2HOF A;  2KEY A;  1Z1B A;  2KHV A;  4A8E A;  5CRX A;  3CRX A;  1PVP A;  2KD1 A;  2KJ8 A;  1XNS A;  1OUQ A;  1DRG A;  3C29 A;  1XO0 A;  3MGV A;  1Q3U A;  1PVR A;  2KJ5 A; 
#chains in the Genus database with same CATH topology
 2A1J B;  3H0M B;  3QUQ A;  3F53 A;  1L3U A;  2OCE A;  1A77 A;  4WJ3 B;  3SD7 A;  4EX7 A;  2W9B B;  2HBJ A;  2PFO A;  3PSI A;  3PST A;  5AKG A;  4QZ9 A;  4R65 A;  2JEI A;  1UA1 A;  2VA2 A;  5ALH A;  2J6T A;  5KFX A;  5ALN A;  2G08 A;  4NLK A;  3N28 A;  4UBB A;  3B0X A;  2AHO B;  3KHH A;  1NK9 A;  1SV4 A;  8ICY A;  5ALI A;  4OCZ A;  1SZH A;  5KAF U;  5IIN A;  4LVS A;  2W54 A;  1ZQL A;  3V6K A;  4RUA A;  4DO9 A;  3QUT A;  4Y2S A;  8ICP A;  9ICX A;  3ISC A;  4KN4 A;  1KRP A;  4MHV A;  4R63 A;  1ZQA A;  4NLZ A;  5KFH A;  1U4B A;  4KLS A;  5KFZ A;  1J2N A;  3K1R B;  3LK9 A;  5AI9 A;  4QWA A;  3BZC A;  2D3D A;  3KKA C;  5ALU A;  4KX3 A;  1SIJ A;  7ICT A;  5ALM A;  2F1J A;  4C4R A;  3KZI U;  4O3R A;  5HNK A;  2OYY A;  1V97 A;  2EAO A;  1TAU A;  1RQN A;  4QZG A;  4DQI A;  1L3T A;  1N2X A;  2I5H A;  5KFV A;  2R8G A;  3NVZ A;  2ZIW B;  1TK5 A;  4CDG A;  3WK9 A;  1F44 A;  1SWW A;  1FO4 A;  3IP4 B;  3R9K A;  4US8 A;  3GIJ A;  5IIM A;  4HAI A;  5AKJ A;  5AHX A;  1TK8 A;  1TAQ A;  5AM2 A;  1SL0 A;  1KW4 A;  4UB2 A;  1T94 A;  1SL1 A;  3TAC B;  2VJ5 A;  4DSL A;  3OJS A;  1N63 A;  1VJ5 A;  5JTI A;  2XGP A;  2ZXH A;  1Z1B A;  3RB4 A;  3MR6 A;  9ICU A;  4F2R A;  4MEY A;  4R66 A;  5EWF A;  2AJQ A;  5AIA A;  3PW2 A;  2AGP A;  3F2D A;  2NV3 A;  5KFT A;  4IR1 A;  3SEI A;  3SI8 A;  2HMX A;  1L3V A;  2BKE A;  4IL6 U;  4KN7 A;  5DDY A;  3V7J A;  3HWT A;  5KG7 A;  2Y0S C;  1S0V A;  9ICJ A;  7ICV A;  3WU2 U;  1S77 D;  3BQ2 A;  2Y0S F;  1SKR A;  1BPY A;  3QXG A;  1RYS A;  2H5X A;  2F1I A;  2LMR A;  3OTQ A;  5CB1 A;  5DB6 A;  1WCL A;  1ZQM A;  4ZH4 A;  4EZ9 A;  4RQ1 A;  8ICJ A;  4F72 A;  3BDP A;  4ED7 A;  4EX6 A;  2C22 A;  2PI4 A;  1ZQY A;  4PL2 A;  1KLN A;  2JEF A;  5GTH U;  4BX9 C;  1Z3E B;  5ALZ A;  1DOQ A;  3I76 A;  5J2F A;  3SEN A;  2HDO A;  4JV1 A;  3SAG A;  3IV6 A;  4Y2Q A;  2ES6 A;  2G09 A;  5D46 A;  1QLN A;  3VC8 A;  5ALD A;  1COO A;  1V85 A;  4I2A A;  2EAP A;  2UVR A;  4RQ6 A;  3WKC A;  2W8L A;  4BXO B;  3SQI A;  3RH5 A;  2P6U A;  2BPC A;  4UAY A;  4IRK A;  3HKZ F;  1X6J A;  1L7N A;  2XCA A;  4ELT A;  2LYA A;  3ETL A;  3F2B A;  4DWI A;  4F4W A;  4IQT A;  2XGQ A;  4GXI A;  3UM9 A;  3F5A A;  1UQV A;  3ZD9 A;  3GII A;  4R8U B;  3PR4 A;  4UAZ A;  4JWM A;  1WG8 A;  1ZQV A;  2JGA A;  2KIC A;  4EEL A;  5DBA A;  1NI3 A;  3QU9 A;  9ICB A;  3AM9 A;  3WKB A;  3QZ8 A;  4C8K A;  5HML A;  4CNQ A;  5JRT A;  3GDX A;  4RNO A;  2BZF A;  4PH5 A;  1C20 A;  4DSF A;  5CHG A;  3AQE A;  3C5G A;  2OH2 A;  1Z1V A;  5KG3 A;  1MN8 A;  3IHQ B;  4QWD A;  1S0M A;  1WYG A;  1DK2 A;  4UAT A;  2P66 A;  4DQS A;  5TZV A;  3UPQ A;  3WK5 A;  5III A;  1X9S A;  1JMS A;  1S10 A;  8ICC A;  3BS5 B;  3MBY A;  5KFE A;  4DSI A;  2CN1 A;  1T7P A;  2BHN A;  2YMP A;  4B9T A;  1U48 A;  5L1J A;  5DG8 A;  1MQ3 A;  1RG6 A;  9ICC A;  4GIB A;  2FMP A;  1TV9 A;  5AKK A;  5ALO A;  5L9X A;  5KL8 B;  1NJY A;  3BS7 A;  1PZN A;  9ICP A;  5AI0 A;  3RB0 A;  3G6X A;  2KZM A;  3T5H A;  2BGW A;  4KLD A;  3PSF A;  3KZX A;  1XWL A;  5ALF A;  4QZF A;  1OW5 A;  5J2H A;  4JK1 A;  3PSP A;  4M47 A;  4PJ0 U;  3AU2 A;  4C7Y A;  2I6X A;  2KTQ A;  3WKE A;  5L1K A;  1QSS A;  5KFL A;  1T3Q A;  1L3S A;  9ICF A;  4CF3 A;  3QU7 A;  3LWM A;  4YR0 A;  1DGJ A;  2W3R A;  4RT2 A;  5KFY A;  1AQ6 A;  3C1Z A;  2YB4 A;  9ICL A;  5J29 A;  4KLG A;  1RDF A;  4BDP A;  1V38 A;  1LV5 A;  4PZN A;  2HOQ A;  4XRH A;  2WAQ F;  2ZIU B;  1K1Q A;  2QAR A;  1X66 A;  2HHV A;  4Y2P A;  8ICV A;  1TFR A;  3H4D A;  4DFM A;  9ICH A;  1ARO P;  2UVU A;  1X6I A;  2HI0 A;  3EZ5 A;  4KLO A;  1ZQF A;  3M7D A;  2DKZ A;  4NY8 A;  1IV8 A;  5ALG A;  5KFQ A;  1GO3 F;  5KG6 A;  3T3F A;  2XI9 A;  9ICS A;  4C4T A;  5AK6 A;  4EYI B;  2ZJ5 A;  7ICO A;  1ZJM A;  4TQS A;  4RQN A;  5J0P A;  4FZL A;  5AKI A;  2WF6 A;  4US9 A;  3CW2 C;  2ZIX B;  5DBB A;  1HJP A;  3HW8 A;  2FE9 A;  5KFG A;  1N48 A;  1QQ7 A;  5J2J A;  4YCX A;  4ICA A;  1BPZ A;  4TQR A;  3BQ0 A;  1Y88 A;  2XY5 A;  4BWM A;  3B9J A;  2OHF A;  3DV9 A;  8ICT A;  4P0P B;  1NZB A;  1JN3 A;  4Y2X A;  4TUR A;  1MA7 A;  4C8M A;  2KKP A;  3E0F A;  3C21 A;  3JPR A;  1ZQE A;  4B6J A;  2W04 A;  2EZY A;  3ICX A;  8ICE A;  2E8N A;  3KKA A;  4QZH A;  4DL6 A;  1J97 A;  4Y2T A;  2Q4T A;  4MF2 A;  4RZR A;  2A19 A;  3OHA A;  4J9O A;  2BCU A;  2MAX A;  3BZK A;  4XUS A;  3LYS A;  4DS4 A;  4DQR A;  2JEJ A;  2ALZ A;  1Q8K A;  3H8J A;  2CPR A;  5DQG A;  4ED3 A;  2A3V A;  4I29 A;  5DBC A;  3M6Z A;  3Q8M A;  4OJP A;  4QIW F;  1KEJ A;  9ICM A;  2ESE A;  3MAB A;  8ICM A;  1NKE A;  2GO7 A;  3I1Y A;  1KTQ A;  1CUK A;  3WK8 A;  4I2F A;  2PKE A;  3UXP A;  4QZ8 A;  3KBB A;  5KL1 B;  2JHD A;  4O3N A;  1XSL A;  2QKQ A;  2PI5 A;  2BQU A;  5J8Y C;  4QNL A;  2AU0 A;  3JPN A;  4M6W B;  4ECY A;  1L7P A;  5BPC A;  3EWA A;  4KLQ A;  5DDM A;  4F4K A;  5AM1 A;  2RDJ A;  1U49 A;  1NK7 A;  1M6Y A;  4DL7 A;  5KG4 A;  3RJI A;  4O0I A;  2E1F A;  2DGZ A;  2E1E A;  3ORY A;  3CNH A;  3TAQ A;  2OXO A;  1JX4 A;  4LZG A;  2KV2 A;  3CYM A;  7ICK A;  2HBK A;  2DBY A;  3QYP A;  3TAN A;  4MFF A;  2ISO A;  1S8O A;  3BQ7 A;  4UB1 A;  5IIL A;  5EE1 A;  1BPD A;  3RR8 A;  4Z6E A;  1PVP A;  3S6J A;  3SZ2 A;  2I1Q A;  7ICU A;  5AKH A;  5CJ7 A;  2HHS A;  1F5S A;  2KG5 A;  5KT7 A;  4M04 A;  2K8A A;  4ED8 A;  2OEH A;  1S97 A;  5AI5 A;  2E8P A;  1WWV A;  2JH7 A;  4UAW A;  3NUQ A;  4DOC A;  4FFD A;  5KFU A;  2P6R A;  3RR7 A;  1B43 A;  4AYB C;  1PK1 A;  1YZ6 A;  3OGU A;  3EYZ A;  2VA8 A;  1ZQS A;  2W3S A;  2QB0 B;  2LKY A;  2H3I A;  4DLG A;  1SV0 C;  2HHT A;  8ICN A;  1U47 A;  4Z6C A;  5J0S A;  4UW9 A;  5CWR A;  2ZIV A;  3E58 A;  1ZOL A;  4XA5 A;  1L5U A;  9ICA A;  2HHW A;  1F0M A;  2LM4 A;  3M1Y A;  3F5E A;  3GIL A;  4O3O A;  7ICJ A;  3NVV A;  2IOF K;  4I2H A;  1OUQ A;  4I2J A;  1SL2 A;  3SAF A;  4O3Q A;  3OPX A;  3N7P D;  4DQP A;  3IM1 A;  2XY7 A;  1NKB A;  4YG2 A;  9ICK A;  2JR5 A;  3JPS A;  2D6F C;  2K8B B;  2JXJ A;  2ZIX A;  2EZZ A;  2AQ0 A;  5AI4 A;  5L1L A;  4I27 A;  4CF5 A;  4K4G A;  2WF7 A;  3OSP A;  2CXY A;  1PK3 A;  5HMM A;  4RQ3 A;  5FP0 A;  4B9M A;  3M6K A;  2FLN A;  4ECX A;  1SWV A;  7ICM A;  3PVX A;  1B4F A;  3NRW A;  3PW7 A;  2YN4 A;  3G6V A;  5K4L A;  3D2Q A;  1KFS A;  2UVV A;  2F44 A;  5BOM A;  1LB2 B;  3V72 A;  4RPX A;  2FPL A;  1DRG A;  1K5O A;  2G06 A;  2VA3 A;  4J9K A;  1L7M A;  5ALJ A;  3MFH A;  3E2E A;  1ZQO A;  4QZE A;  3HKZ C;  4KLL A;  3N97 B;  1TKD A;  2Y9T A;  1RQL A;  2JZB B;  2KZZ A;  5KFN A;  1JUD A;  4M9L A;  7ICI A;  4RNM A;  2KHV A;  4J9N A;  2EH9 A;  2PFN A;  2ZTD A;  2UVW A;  4LJX A;  2FDR A;  5KT2 A;  1ED1 A;  4Y2R A;  3NGD A;  1U9L A;  5F3X B;  1X9W A;  4KLJ A;  3T5L A;  3O0F A;  4M9N A;  3ISD A;  1UPH A;  2QAR B;  3K1Z A;  5HP4 A;  3ED5 A;  2NRT A;  1X9X A;  1IXR A;  4I2C A;  4F3O A;  2KJ5 A;  1NNL A;  2WF9 A;  5DLF A;  1T8E A;  4YXJ A;  4J9L A;  4RNN A;  4O5K A;  2FJ6 A;  4O3P A;  5JU5 A;  5J0Q A;  3T5J A;  3WK7 A;  2EDU A;  3MR2 A;  1WUD A;  4FBT A;  1IG6 A;  5AKZ A;  4OJ5 A;  3PO5 A;  4DEZ A;  2YMM A;  5AM5 A;  2VAN A;  4B9V A;  4Z6D A;  3RJJ A;  2K4P A;  2XCP A;  1S0N A;  1RXV A;  3PX0 A;  2KE7 A;  2EQY A;  5KT3 A;  2LBO A;  5J2D A;  1ZQN A;  4DSE A;  4M9H A;  5L1M A;  5AI6 A;  3NTU A;  2NYV A;  7ICF A;  1QQ6 A;  1L8L A;  5ALY A;  4B9N A;  4DL5 A;  1ZQX A;  3NVW A;  1N62 A;  2L5Y A;  8ICF A;  2KP7 A;  4R64 A;  2Y9U A;  3UMC A;  2VIX A;  4GLX A;  3H0L B;  1EXN A;  2R8K A;  4QZB A;  3M8S A;  1H38 A;  4PZO A;  5KFO A;  2HOI A;  1TK0 A;  4EYH B;  5KT5 A;  5AI8 A;  2IA6 A;  4F5Q A;  3PZP A;  4EBD A;  4IS7 A;  8ICS A;  2QB0 A;  3ZDD A;  4RQ5 A;  4RT3 A;  5KTQ A;  4DFK A;  3RF9 A;  2E3T A;  1UT5 A;  3U26 A;  4UB8 U;  2W9A A;  5DB7 A;  2G5I B;  2BCR A;  3Q8K A;  4UB4 A;  4YMM A;  2DWQ A;  4HYK A;  1TVA A;  1CRX A;  2HOF A;  9ICT A;  1ZET A;  2HVI A;  2RLT A;  5EE9 A;  1HIW A;  2WTF A;  4C0Z A;  3FM9 A;  4TUS A;  2FMQ A;  4ZOH C;  5KNI A;  4DSJ A;  8ICB A;  4EEY A;  2K89 A;  5AM4 A;  4ECU A;  1ZD3 A;  2A1J A;  2B0C A;  1LVH A;  2BPG A;  1FFU A;  1Z4N A;  3RRH A;  2M0N A;  3HRD D;  3PR5 B;  4DL3 A;  7ICL A;  4YR2 A;  5KG0 A;  4TUP A;  5IIJ A;  3BQ1 A;  1ZQU A;  1OXJ A;  4J9P A;  3IG5 A;  4F5P A;  1JRP A;  4YVZ A;  2ZIU A;  5C0Y A;  4G9B A;  2ZUB A;  4C4S A;  3RJH A;  4FZN A;  3M9M B;  2AQ4 A;  2ZUD A;  4J03 A;  1NK6 A;  2HHU A;  5T14 A;  4PHE A;  3DDH A;  3WKD A;  4J9S A;  1QSY A;  2AGO A;  9ICW A;  3PX6 A;  1T3N A;  3SMV A;  4PGX A;  2BR0 A;  2BCQ A;  5KFC A;  5KFI A;  2LI6 A;  3NRZ A;  4C80 A;  5F9N A;  3C5F A;  2YB1 A;  1UA0 A;  1KQQ A;  3RJG A;  2JEG A;  4ECT A;  4ECR A;  3PO4 A;  2ZUC A;  3QEA Z;  3HX0 A;  4O3M A;  1P7D A;  1K1S A;  3QUC A;  1TAM A;  5HHI A;  1WCN A;  2JH1 A;  1B0X A;  5AK3 A;  3TAD A;  2K4I A;  1QH9 A;  1NKC A;  2F2A B;  2CRX A;  2FMS A;  2ZTE A;  4JWN A;  4DS5 A;  7ICG A;  1XO1 A;  3RAQ A;  4YXM A;  1ECW A;  3KHG A;  2V4Q A;  2OWO A;  9ICE A;  1COK A;  2I9G A;  8ICK A;  1CEZ A;  3L5K A;  5KT4 A;  4DCC A;  3F2C A;  3TFR A;  3PW4 A;  4RQ7 A;  3UMB A;  3MC1 A;  3OHB A;  3UXO A;  2BPF A;  1XC9 A;  1ZXI A;  4Y2V A;  1ZQK A;  2B21 A;  1UT8 A;  3NS1 A;  2FLP A;  1KFT A;  5ALR A;  4NL9 C;  3JPT A;  5KAI U;  2FPK A;  5J2B A;  1S76 D;  5ALK A;  2A1A A;  1D9D A;  1O03 A;  2KZ3 A;  5J0O A;  5CRX A;  4UAS A;  3NVY A;  4RQ0 A;  4R8U A;  5DLG A;  2FI1 A;  3BJY A;  7ICR A;  4TUQ A;  3G6Y A;  4NV0 A;  3RH4 A;  4O9M A;  3RB6 A;  2HVH A;  3EPI A;  1MQ2 A;  5IIO A;  7ICE A;  3RH6 A;  2J6S A;  5EWG A;  2DFL A;  4C8L A;  4RPZ A;  3AL0 B;  2W8K A;  4YR3 A;  3GFK B;  3TQ1 A;  4ED6 A;  4F4X A;  2C2R A;  2C2D A;  5AKX A;  1WWU A;  4EEK A;  5J2A A;  3MR3 A;  5DGB A;  1YT3 A;  3MGH A;  2DF4 B;  4YMN A;  2ASJ A;  4OD0 A;  8ICL A;  2ATL A;  2W7O A;  3LVV A;  3PY8 A;  3IRU A;  2J6U A;  4CGZ A;  8ICO A;  1PVR A;  1Q46 A;  3UQ2 A;  2NO4 A;  3THV A;  1RZT A;  1ZQQ A;  1Q3V A;  4YD1 A;  4QWC A;  3GIM A;  3EW9 A;  3SV3 A;  2E8O A;  3K4G A;  2KN7 A;  4KMO B;  4QW9 A;  1L7O A;  1JAL A;  3MGV A;  1NOM A;  3QU5 A;  5HR6 A;  3HPO A;  4KLI A;  4FZM A;  1DK3 A;  4NLC A;  4F91 B;  2W7P A;  1D8Y A;  1KL9 A;  2ZXI A;  2DUY A;  3A0B U;  2M9N A;  2HBL A;  2PXI A;  4J9R A;  2R18 A;  7ICS A;  7ICP A;  2KVC A;  2GWS A;  1D8B A;  1FIQ A;  1NZP A;  1JRO A;  4UAR A;  4YP3 A;  1N56 A;  3JPP A;  3TKA A;  3GIK A;  3TAR A;  8ICX A;  2ZIV B;  2F77 X;  2HHQ A;  3C23 A;  5EE3 A;  1N5X A;  2N1R A;  4GFJ A;  2KNJ A;  4F92 B;  2MRL A;  8ICA A;  1D8L A;  5KG2 A;  2NRW A;  4UAV A;  2ZTC A;  3QU2 A;  1ZQD A;  4P2H A;  1ZQI A;  3OJU A;  1HEK A;  4M0A A;  5EOZ A;  3ONN A;  1A0P A;  1TE2 A;  4FS1 A;  3DEE A;  3IG8 A;  5DQI A;  3HIL A;  5J2K A;  2KMD A;  1ZD5 A;  3TAD C;  1BPB A;  2IHN A;  3CRX A;  4ECV A;  3C2L A;  1JXL A;  2RQ5 A;  2LM1 A;  3Q8S B;  4DQQ A;  2KKV A;  2XC9 A;  3MDA A;  4DF4 A;  4DFJ A;  2W55 A;  3SV4 A;  2MU2 A;  4KLM A;  4AYB F;  3MR5 A;  2K4H A;  4DL4 A;  4JMU A;  4K4I A;  1NK8 A;  2PMZ C;  5KFP A;  1ZQW A;  2G5H B;  8ICH A;  2BDU A;  5AK5 A;  5J0T A;  4C8N A;  1IIP A;  3ISB A;  2EAN A;  3Q8L A;  7ICH A;  5DG9 A;  4GC7 A;  1CI4 A;  1N60 A;  5G5H A;  1RYU A;  3ZD8 A;  3LWL A;  3GQC A;  1Z19 A;  1FFV A;  9ICG A;  2OM6 A;  4YQW A;  1Z00 A;  4M2Y A;  4U6P A;  1ZQP A;  4F5O A;  5HHH A;  4Q43 A;  4DFP A;  5TIS U;  4B9S A;  4MEX A;  2WF8 A;  5AK4 A;  2MA1 A;  3SR6 A;  5DB8 A;  4KLU A;  1PVQ A;  2E5S A;  4C8O A;  4Q45 A;  4QZA A;  4F4Z A;  5ALW A;  1QSL A;  4KX5 A;  4DL2 A;  4BUG A;  3GV7 B;  2YTU A;  4F5N A;  4J9M A;  4CF4 A;  1ZQZ A;  4GXJ A;  5HR7 A;  3ZDE A;  4U7C A;  4RQ4 A;  1ZQC A;  4F4Y A;  4JUZ A;  2XY6 A;  4P0Q A;  1JI7 A;  2KOB A;  4QW8 A;  2W03 A;  4JB3 A;  2DL0 A;  4K4H A;  2K8C B;  2Y1I A;  2ASL A;  1RXW A;  3RJF A;  2H3V A;  2ZIW A;  2F3N A;  5EWE A;  1RPL A;  3UXN A;  8ICW A;  3J81 j;  2KD1 A;  2KJ8 A;  5E79 U;  5J2G A;  1NK5 A;  3H4B A;  4FBU A;  2KSO B;  2ODG A;  2PFP A;  1ZRM A;  4AP9 A;  2DPI A;  1MSW D;  3N4M B;  4QZI A;  9ICQ A;  5DKW A;  4F2S A;  3QZ7 A;  1NJX A;  3KHL A;  3K75 D;  4X5V A;  2BDP A;  4Q8E A;  2F8K A;  3RAX A;  1V9P A;  2W9M A;  3TAP A;  3M9N B;  5J0X A;  4EBE A;  5ALL A;  4JV2 A;  1X40 A;  2NRX A;  4F8R A;  4I2E A;  1ZQT A;  1XNS A;  4NM2 A;  4DOB A;  1QQ5 A;  2YQE A;  5D4B A;  4Z6F A;  1XSP A;  1PK1 B;  1XU4 A;  1URJ A;  4I28 A;  8ICZ A;  4KTQ A;  1BPX A;  1MC8 A;  2ZJA A;  3RB3 A;  9ICR A;  2HW3 A;  4PHA A;  3QUB A;  2F8L A;  2WB1 C;  4Y2J A;  2FPM A;  2LHT A;  1S5L U;  3AMZ A;  3KFU F;  3D2N A;  3V6H A;  1NK0 A;  3RJK A;  2PMZ F;  5B5E U;  1DGS A;  4OJL A;  4F71 A;  4UBC A;  4JV0 A;  5DG7 A;  2KVS A;  1QTM A;  4RQ8 A;  4NWI A;  2W43 A;  1NJW A;  2KFZ A;  5ALQ A;  2RHF A;  9ICN A;  1BNO A;  3HJE A;  1BPE A;  1S9F A;  4PPX A;  4C7Z A;  2K4E A;  2VKQ A;  3ZI4 A;  2BCV A;  1L8O A;  3IN5 A;  4IC9 A;  3A0H U;  5J0Y A;  3MGI A;  4M6W A;  1VDV A;  3IDW A;  4DSK A;  5KFK A;  4P4P A;  5KFF A;  2KHQ A;  3UMG A;  5KFS A;  2MUT A;  5AIB A;  3JPO A;  3EUB 2;  1ZD4 A;  1HUO A;  2V4R A;  1BGX T;  4IRD A;  4BJQ A;  2HHX A;  2NO5 A;  4KIT B;  2R8H A;  3SYZ A;  3H7I A;  4O5C A;  4RUC A;  3FYH A;  2C2E A;  5DGA A;  3KHR A;  3ZDB A;  2IOH A;  4ELV A;  5BOL A;  4QJF B;  4CE6 A;  4G3I A;  3LDA A;  3OSN A;  3TI0 A;  1X9M A;  2G07 A;  3M8R A;  3HT3 A;  9ICI A;  3KTQ A;  5KFD A;  4ECZ A;  8ICG A;  1N5W A;  3V7K A;  2Y1J A;  4IQV A;  4MF8 A;  2BQR A;  4NLG A;  4P0P A;  1A76 A;  3H8M A;  4I2B A;  1SGG A;  4KLH A;  7ICQ A;  3WK6 A;  4QZC A;  3D6J A;  4UAU A;  1Z4O A;  1Z00 B;  5A0L A;  3GU3 A;  5AM0 A;  2IOF A;  3V7L A;  4ED0 A;  2KIW A;  3JPQ A;  3SAH A;  4BWJ A;  1SXE A;  3N7R C;  2IBK A;  4O3S A;  4F93 B;  8ICQ A;  4BXO A;  2WFA A;  5J0W A;  2LPE A;  1X2I A;  4IR9 A;  2VJ4 A;  4P4O A;  1ZRN A;  1UCV A;  3L3F X;  3Q8R B;  4CRX A;  4B9L A;  5F9L A;  5EE0 A;  1KKX A;  1SKW A;  3CP8 A;  3H8W A;  5J2C A;  4KLT A;  4MFA A;  5KFA A;  1ZYQ A;  1J2M A;  2ZJ8 A;  4RPY A;  3PNC A;  4Y2Y A;  5KG5 A;  4ECQ A;  3PV8 A;  1ZQ1 C;  1BVS A;  1SB3 C;  3C2M A;  2D8C A;  3ZDC A;  3PX4 A;  2GOL A;  2KIV A;  2XIC A;  4KLE A;  2Q0Z X;  1ZD2 P;  5KFR A;  2W9B A;  1RYR A;  1HUZ A;  2AGQ A;  4QIW C;  1SZP A;  2KJ9 A;  2YMQ A;  2RRD A;  4DLE A;  5CR0 A;  4F50 A;  3ZDA A;  2KFN A;  4NLN A;  4OJO A;  5AKY A;  4ECS A;  2Z7J A;  4NM1 A;  2WF5 A;  2IHM A;  4RQ2 A;  5KFJ A;  4O5E A;  3AN1 A;  4LZD A;  4NXZ A;  1N61 A;  1O08 A;  2ISP A;  4GC6 A;  2F1H A;  4PGQ A;  3GV5 B;  1XS9 D;  1ZQB A;  1LKY A;  3VCB A;  4KLF A;  2BCS A;  1SXD A;  2H3Z A;  3QE9 Y;  3BS5 A;  2ASD A;  2R8J A;  3C28 A;  2MSN A;  2F76 X;  2JMG A;  3QNM A;  1A6S A;  9ICO A;  3TFS A;  3N7S C;  4NJ8 A;  4M9G A;  3PML A;  5KFB A;  1ZQR A;  2GH1 A;  2W9C A;  5AM3 A;  2AH5 A;  3QX7 A;  3LVW A;  5B66 U;  3Q8P B;  4ECW A;  1VLB A;  3B0Y A;  4USA A;  4EBC A;  3QEB Z;  4PL1 A;  5ALV A;  2B6G A;  3FC4 A;  2DQN B;  4PGY A;  2YML A;  8ICU A;  2WHE A;  1JXE A;  2XO7 A;  9ICV A;  5KG1 A;  5ALP A;  3H0R B;  1ZQG A;  2FLL A;  3C29 A;  5CA7 A;  1IM4 A;  3ALR A;  1XSN A;  4YD2 A;  2P35 A;  4NL9 A;  5DQH A;  4UB6 U;  4Q44 A;  4KMU A;  4YN4 A;  1JIH A;  1KBU A;  2R8I A;  3EPG A;  5CEH A;  4DOA A;  5AKE A;  4P0Q B;  4I2D A;  4MFC A;  1RM6 C;  5ALX A;  4RU9 A;  4Q8F A;  1X42 A;  2K60 A;  2W11 A;  4B9U A;  1Q3U A;  4EZ6 A;  2DPJ A;  4IQU A;  3T79 A;  5AIC A;  2ZG6 A;  3H40 A;  1ZQJ A;  3KOO A;  3RFA A;  5JUM A;  4QWB A;  5CP2 A;  3Q8Q B;  4M9J A;  2WB1 F;  1ZJN A;  2HCF A;  2JV3 A;  3AQF A;  3QU4 A;  4FS2 A;  1KDH A;  2JRZ A;  3M9O B;  3GV8 B;  4DF8 A;  4J9Q A;  2MUT B;  3AU6 A;  1SV0 A;  5AKL A;  4P4M A;  2EAM A;  2RP5 A;  3I28 A;  3L4P A;  2H3Q A;  5G5G A;  3RBE A;  3V6J A;  1KN5 A;  8ICR A;  2YX8 A;  3H8S A;  5GTI U;  4QZD A;  5ALE A;  2IMW P;  2QB1 A;  2NRV A;  5ALS A;  4CCH A;  1SKS A;  1T4G A;  1UHU A;  2G0A A;  3MDC A;  2JZB A;  7ICN A;  2DKX A;  4EEN A;  5IIK A;  2YY6 A;  4OJ6 A;  5J2I A;  4GXK A;  3KD3 A;  5C5J A;  1FEZ A;  1D9F A;  2EZX A;  2RDI A;  3PMN A;  4Y2U A;  5KT6 A;  5KFM A;  4A8E A;  3UQ0 A;  2GLE A;  2XVT A;  3T5K A;  1B22 A;  3PW5 A;  4UB3 A;  4ED2 A;  3C1Y A;  2AXT U;  5J2E A;  2HBM A;  2LYB A;  1KSP A;  3GZF A;  3RBD A;  3RTV A;  5L1I A;  5DB9 A;  1U45 A;  2QLT A;  4ELU A;  4OO1 J;  3C2K A;  2V9W A;  4NLB A;  2BQ3 A;  3FDS A;  5KFW A;  5J8Y A;  1ZQH A;  4YFK A;  2W9C B;  3WKA A;  2C28 A;  5ALT A;  4XQ8 A;  4PHD A;  3ETR A;  4E0D A;  4UB5 A;  2NRZ A;  3RJE A;  5J0U A;  4BGD A;  4YMO A;  3WK4 A;  1KFD A;  1NJZ A;  4QWE A;  4DFD A;  4FE3 A;  5J0R A;  2PFQ A;  1BNP A;  2O6K A;  2XID A;  4ED1 A;  5D49 A;  3AUO A;  3AEV A;  4I2I A;  3RRG A;  5H2F U;  4FO6 A;  3PW0 A;  2H3F A;  1LKY B;  2KSO A;  1NK4 A;  3MFI A;  4I2G A;  4RQM A;  2E8M A;  4F5R A;  2HSZ A;  1C7Y A;  4PHP A;  1L6N A;  3HP6 A;  2WAQ C;  3D2S A;  3FAH A;  1YZ7 A;  4ACO A;  2KK0 A;  3BQT A;  4UQG A;  2LYH A;  1PUZ A;  4IRC A;  1S0O A;  3NAS A;  8ICI A;  4IQW A;  1XO0 A;  2KEY A;  1DXS A;  1QCK A; 
#chains in the Genus database with same CATH homology
 3H0M B;  1T94 A;  3F53 A;  3RF9 A;  4U7C A;  4OJ6 A;  4PL1 A;  1ED1 A;  2ZIV A;  1HEK A;  3L3F X;  4CRX A;  4WJ3 B;  4O3M A;  1P7D A;  1YT3 A;  3LYS A;  3HKZ F;  4P0Q A;  2KOB A;  2VJ5 A;  3ONN A;  2W03 A;  2DF4 B;  2G5I B;  1TAM A;  3CP8 A;  2CPR A;  2JH1 A;  2DQN B;  2HBJ A;  2K8C B;  2LYA A;  1A0P A;  3F5E A;  2H3V A;  2ZIW A;  2KHQ A;  3PSI A;  2K4I A;  3PST A;  3O0F A;  2F2A B;  3DEE A;  2CRX A;  3F2B A;  3IG8 A;  1CRX A;  2ZXH A;  2A3V A;  2HOF A;  1Z1B A;  1UPH A;  2YB4 A;  3M6Z A;  4A8E A;  2W7O A;  3H0R B;  3LVV A;  4OJP A;  4QIW F;  3K1Z A;  2XVT A;  3CRX A;  2G08 A;  2KD1 A;  2KJ8 A;  1OUQ A;  3F5A A;  3C29 A;  3SAF A;  3ALR A;  1HIW A;  4CGZ A;  2HOQ A;  3OPX A;  2WAQ F;  1ZQ1 C;  2ZIU B;  3N7P D;  1ECW A;  2KJ5 A;  1PVR A;  2KKV A;  2HBM A;  4C0Z A;  2GOL A;  2JGA A;  2KIC A;  2LYB A;  4BJQ A;  3F2D A;  2XIC A;  1SZH A;  3GZF A;  4IC9 A;  4AYB F;  1KBU A;  2NV3 A;  5KL1 B;  2JHD A;  3F2C A;  2D6F C;  1Q3V A;  2K8B B;  4P0Q B;  4QIW C;  2K4H A;  4JMU A;  2ZIX A;  4QNL A;  2KJ9 A;  3M7D A;  2PMZ C;  2K89 A;  4OO1 J;  2G5H B;  2RRD A;  1GO3 F;  1WUD A;  4NLB A;  2HMX A;  2BDU A;  4KMO B;  4OJ5 A;  2XI9 A;  4QJF B;  1XNS A;  2M0N A;  4OJO A;  1IIP A;  3MGV A;  2Z7J A;  2Y0S C;  1Q3U A;  3AQE A;  2OH2 A;  3T79 A;  5HR6 A;  2G07 A;  3M6K A;  2ZG6 A;  4FZL A;  2E1F A;  2DGZ A;  2Y0S F;  2E1E A;  4FZM A;  4NLC A;  2ZIX B;  2W7P A;  1URJ A;  2LBO A;  3NRW A;  3RFA A;  2OXO A;  4FE3 A;  1Z19 A;  2ZXI A;  2WB1 F;  2XID A;  2KV2 A;  4ICA A;  3IG5 A;  2HBL A;  2OM6 A;  3CYM A;  3D2Q A;  4KX3 A;  2HBK A;  3AQF A;  2R18 A;  2F8L A;  2WB1 C;  2LHT A;  2ZIU A;  4U6P A;  4P0P A;  5CRX A;  5C0Y A;  1PVP A;  2H3F A;  2KVC A;  2CN1 A;  2OYY A;  1DRG A;  3KFU F;  3D2N A;  1D8B A;  2G06 A;  3VCB A;  4FZN A;  4P0P B;  2H3Z A;  1NZB A;  5A0L A;  2PMZ F;  2K8A A;  4PL2 A;  5T14 A;  4OJL A;  2VIX A;  1L6N A;  3GU3 A;  2MA1 A;  2ZIW B;  5KL8 B;  3H0L B;  2WAQ C;  4BX9 C;  1MA7 A;  2JH7 A;  4CDG A;  2KKP A;  2RP5 A;  3NUQ A;  3C28 A;  4NV0 A;  1PVQ A;  3D2S A;  1F44 A;  3E0F A;  2E5S A;  2F76 X;  2H3Q A;  2JMG A;  3PSF A;  2KIW A;  4ACO A;  3KZX A;  3SAG A;  3IP4 B;  2YX8 A;  1A6S A;  3HKZ C;  4NWI A;  3SMV A;  3SAH A;  3AL0 B;  2G09 A;  3N7S C;  2ZIV B;  2F77 X;  4KX5 A;  4AYB C;  2HOI A;  2VJ4 A;  2W04 A;  3N7R C;  2N1R A;  2RHF A;  4GFJ A;  3ICX A;  3VC8 A;  3PZP A;  4BUG A;  2KNJ A;  2MRL A;  2LKY A;  3PSP A;  2K4E A;  2GH1 A;  2VKQ A;  1XO0 A;  2H3I A;  2G0A A;  5HR7 A;  2YB1 A;  2KEY A;  3IN5 A;  3LVW A;  3SQI A;  2Q4T A;  2KHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...