5GTHU

Native xfel structure of photosystem ii (dark dataset)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
total genus 29
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gthU01
4IL6U 5KAFU 5TISU 5B5EU 4PJ0U 5E79U 3WU2U 5H2FU 5GTHU 2DUYA 1S5LU 5KAIU 2AXTU 4UB8U 3A0BU 5B66U 4UB6U 3KZIU 3A0HU 5GTIU
chains in the Genus database with same CATH superfamily
3GV7B 2F2AB 3J81j 4UQGA 2W55A 3HILA 1L7MA 1N5XA 2JV3A 5KT7A 3TFRA 3KD3A 3BZCA 2EAPA 1ZETA 4FO6A 3QZ7A 2WAQF 1NK7A 2PMZC 4Y2QA 2HHVA 1S10A 4QWEA 5B66U 2D8CA 5FP0A 8ICAA 2D3DA 3RJGA 4RT2A 5KG4A 5DQGA 1DGSA 4KLFA 3JPQA 1QTMA 1L3UA 2KVCA 2C2DA 4NJ8A 2KZZA 7ICQA 3HRDD 2IOFK 3ISBA 4F5NA 2QB0A 4PHPA 3TARA 1SXEA 4F71A 2KN7A 3N7SC 4DEZA 1OUQA 2K4IA 1IXRA 4I2IA 2GOLA 2RDIA 5KNIA 7ICIA 2W11A 4AYBC 5J0YA 4QJFB 7ICGA 2QB1A 3LWMA 4DOCA 2PFOA 1CI4A 4KLLA 1SGGA 4PHEA 5DGAA 5H2FU 1X2IA 2NV3A 2OM6A 2K89A 4KLSA 2FJ6A 4OJ6A 3PW0A 4I2FA 3B0XA 5L9XA 4ED3A 1SL0A 3HX0A 1NK0A 4YMMA 1N63A 2Y1IA 2EZYA 3OPXA 1UA1A 2LKYA 3Q8SB 3Q8MA 3QU9A 2W03A 2MUTB 5J0UA 5J0WA 5KFKA 2JEGA 2IHMA 1AROP 4WJ3B 3V6KA 4NY8A 8ICUA 1U47A 5AKXA 1X9MA 4JMUA 5CRXA 2WFAA 4Z6CA 2EAMA 1NK5A 1L8OA 2FMPA 2G08A 2YMLA 3MDAA 2F44A 3WK9A 1KSPA 2P66A 4MHVA 4DL6A 5ALJA 1BPBA 3THVA 4Y2XA 5T14A 2AJQA 4M6WA 4M9NA 2HHTA 3WK5A 1WG8A 3L3FX 2J6SA 5AKZA 1LKYA 3UQ2A 3KOOA 4LVSA 5DB9A 8ICIA 2JZBB 2KJ9A 4NM2A 4IRKA 5J2BA 4PGQA 3BQ7A 5KG3A 4F4WA 2P6UA 4C7ZA 4RPYA 1VLBA 5AIAA 1NK4A 4YR3A 1M6YA 4C8OA 3N97B 3C1ZA 2IOHA 1KN5A 3PMLA 2KG5A 3M8SA 3RJHA 5KFCA 4NLZA 5J0QA 1ZQMA 1BPZA 3VCBA 2KFNA 4YCXA 5HHIA 4O3QA 3UMBA 3UXOA 8ICLA 3Q8QB 2BCUA 3GQCA 7ICUA 3HW8A 4TUPA 3M9MB 5JUMA 1UQVA 5KFBA 5L1LA 3V7JA 3ZDEA 2BR0A 1Z4NA 4Y2RA 4QZHA 1S8OA 1SZHA 2YY6A 4YQWA 1RG6A 2XIDA 4RQ3A 1IIPA 3AM9A 1JUDA 3H4BA 2ZXHA 3IM1A 3V6HA 5ALFA 1KFTA 2ISOA 3MFHA 1KDHA 3IG5A 2K4PA 2HBMA 4YXMA 3PSPA 1NJZA 4QZIA 2KEYA 5ALSA 3IP4B 1XC9A 2Q0ZX 2PMZF 4RNMA 2E1EA 2FMQA 1X9XA 4F50A 3KZXA 3JPSA 1D9FA 3N4MB 4BGDA 2YMQA 4RQ7A 5KG5A 4Z6DA 2G5IB 4C8KA 4I27A 1WCLA 3TADC 1NKBA 2BPCA 2XGPA 1SV4A 2Y9TA 3MR2A 2W7OA 3PY8A 1SWWA 3TQ1A 4USAA 1F44A 2NO5A 3IRUA 2KTQA 1PK3A 3WKDA 4M9LA 1ZQFA 5KFFA 1UT5A 5KFAA 2MAXA 4B9VA 3Q8LA 9ICHA 4IQVA 4C0ZA 3SYZA 2NRTA 4ECWA 3QUQA 3MGVA 4KN4A 2UVWA 3PO4A 2VANA 2UVRA 4TUQA 5DLFA 1ZQZA 2PFNA 5IIOA 1ZQDA 4U6PA 2HHXA 5CEHA 5DBAA 5KL1B 4UAUA 3Q8KA 3RB4A 2BQRA 2NRVA 2ZJ8A 1XNSA 4ECVA 1N2XA 4F93B 2R8GA 2C22A 2B6GA 2ZJAA 2W04A 3LYSA 2F77X 5CA7A 3BZKA 4DSFA 1HUOA 2KJ5A 1XWLA 2C2RA 4F5PA 5AICA 1V38A 4F72A 1L3SA 8ICRA 1ZQSA 7ICJA 1SWVA 3N28A 4IC9A 1SL1A 5ALKA 2H3FA 1SKRA 2A1JB 4RQMA 3NRZA 1Q46A 2ODGA 2JEJA 1KEJA 1AQ6A 4QWBA 4J9PA 2W9CA 4Y2JA 3ZDBA 3AQFA 5DKWA 5L1IA 2KKVA 3AL0B 3GILA 4QWAA 1YZ6A 1SL2A 2W7PA 4KITB 2ASLA 3NVVA 3NASA 5AM5A 1RYSA 4NV0A 4M04A 1ZQLA 8ICJA 2LI6A 3RFAA 1NJYA 4J9LA 2XY6A 2PI5A 1D9DA 1ZQHA 3N7PD 5DB7A 1A6SA 2V9WA 4PH5A 4UB3A 1QQ5A 2K4EA 2ZG6A 4ECQA 4DSIA 3OGUA 5IIKA 5L1KA 1ZD3A 8ICSA 4IQUA 5J2IA 7ICKA 5AI5A 3T5LA 3PW5A 2WF9A 2EZXA 3KBBA 4KMUA 2FI1A 4J9MA 2BDPA 2ZIUA 4ECSA 2JEIA 1RDFA 2W9AA 3QU4A 5AK6A 2E8NA 4NLKA 1A0PA 4UATA 2MU2A 2YMMA 3BS5B 1ZQBA 4GIBA 7ICVA 3PZPA 2VA3A 1ZQGA 1KL9A 1RM6C 3GIMA 1NK8A 2I5HA 4J9RA 4ZH4A 8ICMA 1KRPA 4DL4A 3M9NB 4DCCA 5ALZA 2G0AA 1ZJNA 1BNPA 2LMRA 5L1JA 4EBDA 2VJ5A 1V9PA 3CP8A 5KFQA 2A19A 3NVYA 2KZ3A 4PHAA 3TANA 3RH4A 3RRHA 4O5KA 1URJA 3I76A 4RZRA 2OYYA 4CGZA 2UVVA 2MUTA 3MGIA 5AM1A 1ZQUA 4J03A 1ZRMA 1S0VA 4ED7A 1PUZA 5DBCA 4HAIA 5L1MA 3M8RA 4EENA 2JEFA 1YZ7A 1OXJA 2YN4A 1RXWA 1ZQEA 3F2BA 1WYGA 5HR7A 4EBEA 3RB3A 4GXJA 2B0CA 4TQSA 1PZNA 2GWSA 5ALOA 3RB6A 3SI8A 2IHNA 5DBBA 4MF2A 2AU0A 1DOQA 4XA5A 3EYZA 4IQTA 3QU5A 5ALVA 2W3SA 1B0XA 4DSKA 2VJ4A 2QARB 3H0RB 2KJ8A 2BPFA 4QZBA 5GTHU 3UQ0A 4YD2A 5TZVA 2VA2A 4JB3A 4FBTA 1PK1B 4YMOA 5IILA 4UB8U 2ZXIA 5DG8A 4KLIA 2KHQA 4FZNA 2ZTCA 9ICOA 4FZLA 5JU5A 1CRXA 5EOZA 1ZQXA 1PVRA 4DQSA 9ICAA 3N7RC 3RR7A 1S76D 3OJUA 3ICXA 3L5KA 4AYBF 1RQLA 2YB1A 1BGXT 5KG2A 8ICCA 3GIJA 1Z1BA 4R8UB 2G06A 1ZQQA 9ICBA 4I2CA 1RYUA 3PV8A 3ZD8A 1Q8KA 5CWRA 3TAPA 4DS4A 3ZDDA 5AKGA 1QQ6A 5K4LA 4B9MA 5J2CA 2E8PA 3K1RB 1ZQAA 2HOQA 1B43A 2EH9A 3RJKA 3WKCA 3RF9A 1ZJMA 2AGOA 4Y2YA 2DKZA 2ZIVB 4C8NA 4NLBA 2ZIXA 4KLTA 3C2MA 4P4PA 4UAWA 4QZ8A 3KHRA 1NI3A 2K60A 5KT4A 1PVPA 4F4ZA 4RPZA 2L5YA 4Y2VA 2DGZA 1TE2A 4RQ1A 2Y9UA 4QWCA 1B22A 5A0LA 3JPNA 1EXNA 1O08A 3QEBZ 4NLGA 7ICHA 3WKAA 2BDUA 1KFDA 3NUQA 2YMPA 1V97A 3VC8A 2FE9A 2ZUDA 2BKEA 4Q8EA 4RQ0A 2JGAA 3MFIA 4C8MA 1JALA 8ICZA 3HP6A 3T3FA 3AQEA 1L7OA 1SV0A 4Y2UA 3WK8A 1S0NA 4F5RA 2K4HA 2RP5A 4NWIA 2DF4B 2YQEA 3M1YA 4UAVA 4J9NA 4C4SA 3RB0A 2V4QA 1P7DA 5EE1A 3B0YA 1T94A 2FPKA 3AEVA 3H7IA 1TK5A 2MA1A 1NJWA 4KLGA 3ISCA 4RNNA 3KHHA 4F5OA 3LVVA 2KK0A 2F1IA 7ICSA 3M6ZA 4CF4A 4BDPA 5AK3A 4ED6A 4B9SA 4KX3A 1N62A 4PHDA 3F5AA 1B4FA 2CPRA 3C21A 3MGHA 5HR6A 2KOBA 3OSPA 8ICKA 3CRXA 2LM4A 5IINA 4YR2A 3SD7A 3UM9A 5KFNA 2J6UA 4O3OA 2DFLA 8ICVA 1KKXA 4RQ5A 3EPIA 3ORYA 3IN5A 3JPTA 2A1AA 4DLEA 9ICCA 2N1RA 3SAGA 2KIVA 3H8WA 4DSJA 5KFMA 3MR5A 5ALMA 5D4BA 4JV2A 3H8SA 1ZQNA 3KKAC 5KFOA 2NRZA 1COKA 9ICIA 3IV6A 3QYPA 1XSPA 4P2HA 3H8MA 3WKBA 1ZD2P 5IIJA 2HSZA 3PSTA 1UPHA 2A3VA 2KKPA 4X5VA 3QU7A 3G6VA 5KFDA 1L5UA 2ZIUB 4R8UA 3BQ2A 5KFVA 1X6JA 3TFSA 2DL0A 2XCPA 1HEKA 5TISU 1ZQ1C 8ICEA 3HKZF 3C2LA 3GV5B 4GXIA 1MN8A 1VDVA 3BS5A 2JH1A 2BCRA 3FM9A 3PR4A 2QLTA 2ZIWA 1QLNA 4M0AA 4O0IA 1TVAA 3QXGA 4TQRA 5DQIA 1NJXA 4B9NA 3CYMA 2PFPA 3V72A 5AKEA 4IRCA 3HJEA 5HNKA 5ALNA 1YT3A 4GLXA 5J2AA 2VA8A 2I6XA 1JX4A 3RBDA 1ZQVA 2D6FC 3SQIA 3ED5A 5EWFA 4F4KA 5F9LA 4DF8A 1FO4A 5BOLA 4PZNA 2NO4A 4MFFA 5KFYA 3FYHA 5JTIA 2F8LA 4EEKA 5KT3A 3GU3A 3SMVA 2W8KA 4Q44A 3KZIU 9ICWA 2XICA 3H4DA 3D2NA 2DWQA 1X9WA 5ALIA 5KT5A 2LYHA 3C1YA 3H0MB 5ALDA 2F76X 2DBYA 5ALYA 1JXEA 2W9BB 3C5FA 3HWTA 2J6TA 4Q45A 1HIWA 4JV1A 4F2SA 4PL1A 2EZZA 1U9LA 3S6JA 9ICEA 3SV3A 1JRPA 4PL2A 5KG0A 2KVSA 4P4MA 2BQUA 4CNQA 1Z00A 2M9NA 4BJQA 1JN3A 3RR8A 5KL8B 3IG8A 5J2GA 3RBEA 8ICWA 4MEXA 3GV8B 8ICXA 1WCNA 1ZRNA 3A0HU 1SKSA 5KFIA 1RZTA 4ICAA 3SAHA 9ICXA 3H40A 1BPDA 2A1JA 4RQ4A 3ZD9A 2PI4A 5CJ7A 4P0QA 1JI7A 1D8BA 3NVZA 4RQ2A 1MA7A 2AHOB 4OD0A 3KHGA 3V6JA 2W9MA 3T5JA 1MC8A 5AIBA 4DFMA 4DQIA 4IRDA 5AM4A 4IL6U 3K75D 5KFLA 4US9A 2KP7A 4O9MA 3SAFA 4EYHB 4U7CA 3IHQB 1WWUA 9ICTA 4UASA 5AI0A 2RHFA 2I9GA 3NRWA 1L7NA 4Z6FA 4KLQA 4ECRA 5G5GA 1GO3F 3MBYA 4ECXA 4FZMA 1BPXA 2AH5A 2E5SA 2ASDA 7ICRA 3FC4A 4I2JA 4J9QA 1X6IA 5KFXA 4C4TA 2NRXA 2KD1A 4QW8A 5DDMA 5J29A 3TADA 4B9TA 4GXKA 3Q8PB 3T5KA 3K1ZA 1V85A 3RAXA 4EZ9A 2C28A 4QWDA 1ZQTA 3QZ8A 4DSEA 2QKQA 2DPJA 3M9OB 2ZIWB 2HW3A 4F3OA 2ESEA 5AKIA 3UMCA 4JWMA 3O0FA 4MEYA 3BDPA 1JIHA 1TAQA 3PO5A 1NKCA 4ECYA 4LZGA 2XO7A 1RQNA 3WK7A 4P0PA 3RJEA 1U45A 5ALGA 2AGPA 1TV9A 2KHVA 4UB4A 4E0DA 1C7YA 4RQNA 3TACB 4J9SA 4RUCA 9ICKA 3D6JA 4KTQA 2FMSA 1CEZA 4FE3A 5E79U 4ECUA 4Q8FA 4US8A 4G3IA 5J2JA 4EZ6A 2ZUCA 4Y2PA 1SZPA 3AUOA 3GIIA 4F8RA 3BQ1A 2H3QA 2HBLA 2K8AA 3C23A 3E0FA 1HUZA 1BNOA 2FLNA 4J9OA 3PW7A 1T8EA 2RQ5A 4PZOA 5DB8A 1S0MA 4YR0A 4DQQA 1X40A 4FFDA 7ICMA 1OW5A 2G07A 5EE0A 1DGJA 4KLMA 4RQ8A 1J2MA 2ALZA 4R66A 3RAQA 4ECZA 5CR0A 2ISPA 4DFDA 2QARA 2HHSA 1ZQRA 2NYVA 4OO1J 1L3TA 2AGQA 1Z00B 3BJYA 3RH5A 4LJXA 2FLLA 1BPYA 2E8MA 4Z6EA 2R8IA 3BS7A 4EYIB 2VKQA 4EX7A 4FS1A 4R64A 4GFJA 2WF6A 3RJIA 2KMDA 2EANA 4QZ9A 2C2EA 4NLNA 2WF7A 3AU6A 5ALXA 2LPEA 2BCVA 2LM1A 2JXJA 2IOFA 3SZ2A 3KHLA 5ALQA 5EWGA 4P0QB 2ZTEA 3TAQA 1XSNA 3PVXA 4KLOA 3PX4A 4DFJA 5AM3A 4DSLA 2G09A 2KSOA 4P4OA 3BQ0A 2W8LA 3M6KA 3ISDA 5KFJA 1XS9D 3QU2A 3D2SA 3QX7A 8ICTA 2CXYA 2W3RA 1KBUA 2F1JA 1BVSA 3IDWA 3UPQA 1ZYQA 4Y2SA 5C0YA 3EUB2 5IIMA 4M47A 3NS1A 4QZCA 3Q8RB 1MQ2A 2PKEA 1QSYA 3LWLA 2MSNA 3UXNA 4QNLA 2E1FA 2DPIA 1NK6A 5AK5A 1X42A 3GDXA 2LYBA 4NLCA 3MR3A 4DO9A 2RRDA 2AXTU 2HCFA 5ALHA 4DL2A 4LZDA 5KTQA 4TUSA 3AMZA 1ZQPA 9ICSA 4UAZA 2WB1F 8ICPA 1S9FA 2WF5A 3QE9Y 2W54A 7ICPA 9ICNA 4Y2TA 3EPGA 8ICNA 1T4GA 3NTUA 2ATLA 2BCSA 2HHUA 1XSLA 3PX6A 4I28A 2P35A 5G5HA 4UARA 1ZXIA 4I2AA 3EW9A 1A77A 2CRXA 2KIWA 2Y0SC 4EX6A 2F3NA 1FEZA 2ASJA 1D8YA 3OJSA 7ICLA 1XU4A 9ICJA 1IG6A 2HOFA 4KMOB 8ICOA 4DS5A 4I29A 3C2KA 1FIQA 3RTVA 1COOA 3CW2C 1L8LA 2HBKA 2GO7A 3ZDCA 3SV4A 1TKDA 5EWEA 5BOMA 2HBJA 1K5OA 4DF4A 1SV0C 9ICFA 1D8LA 1ZD4A 5ALRA 3HPOA 4BWJA 4QZFA 5D49A 2HMXA 5DDYA 3LDAA 2ES6A 4UBCA 5ALPA 1DXSA 4M6WB 3OTQA 1KTQA 4BXOA 1LKYB 1ZQOA 9ICUA 4OJOA 2OEHA 4IS7A 1SIJA 5KG6A 2F8KA 8ICYA 3MABA 3V7LA 4R65A 3SENA 2ZIVA 1SXDA 5KFWA 2ZIXB 2R8HA 2M0NA 4ELTA 5C5JA 1S5LU 5AI8A 2BCQA 4RT3A 4R63A 1ZD5A 3MR6A 1KLNA 4DFPA 4O5CA 2GH1A 5HP4A 4ECTA 2EDUA 2KZMA 1KFSA 3FDSA 5KFEA 1ZQKA 3I28A 3DDHA 3JPPA 5KFHA 1SB3C 4YD1A 1IM4A 4NXZA 3C5GA 5B5EU 4KLEA 3SR6A 1DRGA 2YX8A 1K1QA 5J2EA 4O3PA 1QSSA 1VJ5A 4O3NA 4FS2A 3ONNA 4UB5A 3R9KA 4ACOA 3ZDAA 2Z7JA 5J2KA 2OH2A 7ICFA 1J2NA 4MFCA 4P0PB 7ICEA 4F4YA 4M9HA 1SKWA 1ED1A 2H5XA 2R8JA 4CE6A 4C4RA 1Y88A 5AKKA 2HHQA 4CF5A 1FFVA 5DGBA 2K8BB 3JPRA 1TAMA 1Z19A 4ED2A 1Z4OA 4RQ6A 5AKYA 2H3VA 4KLHA 3FAHA 5ALEA 3F53A 1X9SA 2DKXA 3U26A 1ECWA 1WUDA 2R18A 2ZUBA 3RJJA 3M7DA 4BX9C 2BHNA 3H0LB 4MF8A 2XY5A 4C8LA 4YFKA 5KG7A 2FLPA 4DOBA 2DUYA 5KFZA 2JRZA 4QIWF 3OHAA 2VIXA 1F5SA 2HHWA 2WTFA 2KFZA 2CN1A 3PR5B 4DWIA 5J8YA 1ZQYA 1N56A 1WWVA 2G5HB 5AKJA 2OCEA 1TK0A 1JXLA 1ZQJA 9ICRA 5EE9A 4PGYA 4UB6U 1FFUA 2ZJ5A 1BPEA 1N61A 5J2HA 1KW4A 2WAQC 2BZFA 3B9JA 4I2EA 4GC6A 2PFQA 1CUKA 1PVQA 9ICQA 5J0RA 4C80A 1N60A 4FBUA 1ZQIA 2B21A 3QUBA 3OSNA 5CP2A 4K4HA 5HMMA 4GC7A 2XCAA 4CDGA 4K4IA 9ICVA 1UHUA 4M9JA 1Z3EB 1MQ3A 5KT2A 1K1SA 2W43A 2YB4A 8ICFA 4ED1A 1DK2A 3ALRA 2GLEA 2EAOA 4RU9A 1NNLA 5ALTA 4YN4A 4HYKA 2KSOB 1N48A 2WHEA 4YMNA 1F0MA 4NL9C 3GIKA 4CRXA 1Q3VA 7ICOA 2XGQA 5KFRA 3PNCA 4XQ8A 4OJLA 5KAFU 5HHHA 1TAUA 2K8CB 4A8EA 2H3IA 3JPOA 4XUSA 4RPXA 4JK1A 4K4GA 4TURA 1U48A 4I2BA 3H8JA 4PJ0U 3GFKB 5J0OA 4UB2A 5EE3A 1H38A 3D2QA 4EBCA 4PPXA 2Y0SF 1ZQCA 1UA0A 4O3MA 4DQRA 1JROA 3KFUF 5KFUA 3AN1A 4NL9A 3T5HA 1RPLA 3F2DA 1QQ7A 1QCKA 4DL7A 2H3ZA 2DQNB 1QSLA 4KLDA 2QB0B 4IQWA 4ELVA 2E3TA 4QZDA 5J0TA 3PX0A 2WB1C 3DEEA 2LYAA 5JRTA 2WF8A 1UT8A 5KT6A 4EEYA 2V4RA 4QZGA 2FPMA 2KE7A 2W9BA 3RRGA 3QEAZ 9ICPA 2OHFA 4OJPA 5AK4A 4MFAA 5AKLA 4I2DA 2IBKA 4BUGA 4B9LA 2JR5A 4DLGA 1U4BA 5IIIA 3BQTA 3RH6A 5DG9A 4ED8A 3UXPA 5ALUA 4C7YA 2JH7A 3OHBA 1TFRA 5J2FA 5KFTA 1Z1VA 3WKEA 5AKHA 4O5EA 5J2DA 2Y1JA 4IR1A 3MDCA 4M9GA 2IMWP 4RNOA 3C29A 3G6YA 3PW4A 2EQYA 3HKZC 1L6NA 1HJPA 5KAIU 2W9CB 2LBOA 3EWAA 3E2EA 5DG7A 1LV5A 2OWOA 1UCVA 2HVHA 4BXOB 5AM0A 4BWMA 2BGWA 3NVWA 1LVHA 3GZFA 4JV0A 2XY7A 3QNMA 5BPCA 2I1QA 3HT3A 3PSIA 2AQ4A 5DB6A 1IV8A 2NRWA 4DOAA 7ICTA 1RYRA 3KKAA 3EZ5A 1U49A 2R8KA 1N5WA 2HVIA 4UAYA 4QW9A 1L3VA 4UB1A 8ICQA 2P6RA 1KQQA 1C20A 3L4PA 4M2YA 4PGXA 1JMSA 4CCHA 1DK3A 2BPGA 2HOIA 4DFKA 2LHTA 4F2RA 3UMGA 4F91B 5ALWA 4ZOHC 2FPLA 3V7KA 2BQ3A 1MSWD 3F5EA 3A0BU 4CF3A 2UVUA 1NOMA 2Q4TA 2YTUA 2E8OA 4XRHA 4IR9A 5KG1A 7ICNA 4DL5A 4F4XA 1L7PA 3NGDA 4YP3A 1LB2B 1NZBA 4B6JA 5GTIU 8ICBA 3ETRA 3PW2A 3T79A 9ICGA 1S77D 4OJ5A 4QZEA 1T7PA 4YG2A 2PXIA 2KICA 4KX5A 4Q43A 5F9NA 2AQ0A 3WK6A 3C28A 4QIWC 2KV2A 4I2GA 1XO1A 4UBBA 1X66A 3ETLA 4NM1A 5AI9A 1ZOLA 5D46A 5AI4A 3QUCA 2RLTA 3K4GA 2IA6A 5CHGA 1QH9A 4KN7A 5J8YC 1XO0A 4O3RA 1S97A 3WK4A 3LK9A 4J9KA 4F92B 4RUAA 2HDOA 3RJFA 5AM2A 2F1HA 3PSFA 3TKAA 4YXJA 5J0PA 2XC9A 3SEIA 5AI6A 1NKEA 4O3SA 1A76A 8ICHA 4ED0A 1NK9A 1Q3UA 9ICLA 5DQHA 1RXVA 4OCZA 1S0OA 4DL3A 3TI0A 2MRLA 2ZTDA 5J0XA 3PMNA 5DLGA 4JWNA 5CB1A 4KLJA 2JZBA 3AU2A 1O03A 2KNJA 5AHXA 1T3NA 5ALLA 1PK1A 4DQPA 3I1YA 4ELUA 1T3QA 2XI9A 2FDRA 4G9BA 4UW9A 1NZPA 2XVTA 4KLUA 2OXOA 2HI0A 3CNHA 3ZI4A 4F5QA 1J97A 5KFPA 1ZQWA 8ICGA 5F3XB 4AP9A 5KFSA 3MC1A 3E58A 9ICMA 2JMGA 3WU2U 4B9UA 3G6XA 3F2CA 2JHDA 5HMLA 5KFGA 3LVWA 5J0SA 4I2HA 3DV9A 4JUZA 2O6KA 1TK8A 2RDJA 4QZAA 3KTQA 4YVZA 3QUTA 4EELA
chains in the Genus database with same CATH topology
4IL6U 5KAFU 5TISU 5B5EU 4PJ0U 5E79U 3WU2U 5H2FU 5GTHU 2DUYA 1S5LU 5KAIU 2AXTU 4UB8U 3A0BU 5B66U 4UB6U 3KZIU 3A0HU 5GTIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 U;  5KAF U;  5TIS U;  5B5E U;  4PJ0 U;  5E79 U;  3WU2 U;  5H2F U;  5GTH U;  2DUY A;  1S5L U;  5KAI U;  2AXT U;  4UB8 U;  3A0B U;  5B66 U;  4UB6 U;  3KZI U;  3A0H U;  5GTI U; 
#chains in the Genus database with same CATH topology
 3GV7 B;  2F2A B;  3J81 j;  4UQG A;  2W55 A;  3HIL A;  1L7M A;  1N5X A;  2JV3 A;  5KT7 A;  3TFR A;  3KD3 A;  3BZC A;  2EAP A;  1ZET A;  4FO6 A;  3QZ7 A;  2WAQ F;  1NK7 A;  2PMZ C;  4Y2Q A;  2HHV A;  1S10 A;  4QWE A;  5B66 U;  2D8C A;  5FP0 A;  8ICA A;  2D3D A;  3RJG A;  4RT2 A;  5KG4 A;  5DQG A;  1DGS A;  4KLF A;  3JPQ A;  1QTM A;  1L3U A;  2KVC A;  2C2D A;  4NJ8 A;  2KZZ A;  7ICQ A;  3HRD D;  2IOF K;  3ISB A;  4F5N A;  2QB0 A;  4PHP A;  3TAR A;  1SXE A;  4F71 A;  2KN7 A;  3N7S C;  4DEZ A;  1OUQ A;  2K4I A;  1IXR A;  4I2I A;  2GOL A;  2RDI A;  5KNI A;  7ICI A;  2W11 A;  4AYB C;  5J0Y A;  4QJF B;  7ICG A;  2QB1 A;  3LWM A;  4DOC A;  2PFO A;  1CI4 A;  4KLL A;  1SGG A;  4PHE A;  5DGA A;  5H2F U;  1X2I A;  2NV3 A;  2OM6 A;  2K89 A;  4KLS A;  2FJ6 A;  4OJ6 A;  3PW0 A;  4I2F A;  3B0X A;  5L9X A;  4ED3 A;  1SL0 A;  3HX0 A;  1NK0 A;  4YMM A;  1N63 A;  2Y1I A;  2EZY A;  3OPX A;  1UA1 A;  2LKY A;  3Q8S B;  3Q8M A;  3QU9 A;  2W03 A;  2MUT B;  5J0U A;  5J0W A;  5KFK A;  2JEG A;  2IHM A;  1ARO P;  4WJ3 B;  3V6K A;  4NY8 A;  8ICU A;  1U47 A;  5AKX A;  1X9M A;  4JMU A;  5CRX A;  2WFA A;  4Z6C A;  2EAM A;  1NK5 A;  1L8O A;  2FMP A;  2G08 A;  2YML A;  3MDA A;  2F44 A;  3WK9 A;  1KSP A;  2P66 A;  4MHV A;  4DL6 A;  5ALJ A;  1BPB A;  3THV A;  4Y2X A;  5T14 A;  2AJQ A;  4M6W A;  4M9N A;  2HHT A;  3WK5 A;  1WG8 A;  3L3F X;  2J6S A;  5AKZ A;  1LKY A;  3UQ2 A;  3KOO A;  4LVS A;  5DB9 A;  8ICI A;  2JZB B;  2KJ9 A;  4NM2 A;  4IRK A;  5J2B A;  4PGQ A;  3BQ7 A;  5KG3 A;  4F4W A;  2P6U A;  4C7Z A;  4RPY A;  1VLB A;  5AIA A;  1NK4 A;  4YR3 A;  1M6Y A;  4C8O A;  3N97 B;  3C1Z A;  2IOH A;  1KN5 A;  3PML A;  2KG5 A;  3M8S A;  3RJH A;  5KFC A;  4NLZ A;  5J0Q A;  1ZQM A;  1BPZ A;  3VCB A;  2KFN A;  4YCX A;  5HHI A;  4O3Q A;  3UMB A;  3UXO A;  8ICL A;  3Q8Q B;  2BCU A;  3GQC A;  7ICU A;  3HW8 A;  4TUP A;  3M9M B;  5JUM A;  1UQV A;  5KFB A;  5L1L A;  3V7J A;  3ZDE A;  2BR0 A;  1Z4N A;  4Y2R A;  4QZH A;  1S8O A;  1SZH A;  2YY6 A;  4YQW A;  1RG6 A;  2XID A;  4RQ3 A;  1IIP A;  3AM9 A;  1JUD A;  3H4B A;  2ZXH A;  3IM1 A;  3V6H A;  5ALF A;  1KFT A;  2ISO A;  3MFH A;  1KDH A;  3IG5 A;  2K4P A;  2HBM A;  4YXM A;  3PSP A;  1NJZ A;  4QZI A;  2KEY A;  5ALS A;  3IP4 B;  1XC9 A;  2Q0Z X;  2PMZ F;  4RNM A;  2E1E A;  2FMQ A;  1X9X A;  4F50 A;  3KZX A;  3JPS A;  1D9F A;  3N4M B;  4BGD A;  2YMQ A;  4RQ7 A;  5KG5 A;  4Z6D A;  2G5I B;  4C8K A;  4I27 A;  1WCL A;  3TAD C;  1NKB A;  2BPC A;  2XGP A;  1SV4 A;  2Y9T A;  3MR2 A;  2W7O A;  3PY8 A;  1SWW A;  3TQ1 A;  4USA A;  1F44 A;  2NO5 A;  3IRU A;  2KTQ A;  1PK3 A;  3WKD A;  4M9L A;  1ZQF A;  5KFF A;  1UT5 A;  5KFA A;  2MAX A;  4B9V A;  3Q8L A;  9ICH A;  4IQV A;  4C0Z A;  3SYZ A;  2NRT A;  4ECW A;  3QUQ A;  3MGV A;  4KN4 A;  2UVW A;  3PO4 A;  2VAN A;  2UVR A;  4TUQ A;  5DLF A;  1ZQZ A;  2PFN A;  5IIO A;  1ZQD A;  4U6P A;  2HHX A;  5CEH A;  5DBA A;  5KL1 B;  4UAU A;  3Q8K A;  3RB4 A;  2BQR A;  2NRV A;  2ZJ8 A;  1XNS A;  4ECV A;  1N2X A;  4F93 B;  2R8G A;  2C22 A;  2B6G A;  2ZJA A;  2W04 A;  3LYS A;  2F77 X;  5CA7 A;  3BZK A;  4DSF A;  1HUO A;  2KJ5 A;  1XWL A;  2C2R A;  4F5P A;  5AIC A;  1V38 A;  4F72 A;  1L3S A;  8ICR A;  1ZQS A;  7ICJ A;  1SWV A;  3N28 A;  4IC9 A;  1SL1 A;  5ALK A;  2H3F A;  1SKR A;  2A1J B;  4RQM A;  3NRZ A;  1Q46 A;  2ODG A;  2JEJ A;  1KEJ A;  1AQ6 A;  4QWB A;  4J9P A;  2W9C A;  4Y2J A;  3ZDB A;  3AQF A;  5DKW A;  5L1I A;  2KKV A;  3AL0 B;  3GIL A;  4QWA A;  1YZ6 A;  1SL2 A;  2W7P A;  4KIT B;  2ASL A;  3NVV A;  3NAS A;  5AM5 A;  1RYS A;  4NV0 A;  4M04 A;  1ZQL A;  8ICJ A;  2LI6 A;  3RFA A;  1NJY A;  4J9L A;  2XY6 A;  2PI5 A;  1D9D A;  1ZQH A;  3N7P D;  5DB7 A;  1A6S A;  2V9W A;  4PH5 A;  4UB3 A;  1QQ5 A;  2K4E A;  2ZG6 A;  4ECQ A;  4DSI A;  3OGU A;  5IIK A;  5L1K A;  1ZD3 A;  8ICS A;  4IQU A;  5J2I A;  7ICK A;  5AI5 A;  3T5L A;  3PW5 A;  2WF9 A;  2EZX A;  3KBB A;  4KMU A;  2FI1 A;  4J9M A;  2BDP A;  2ZIU A;  4ECS A;  2JEI A;  1RDF A;  2W9A A;  3QU4 A;  5AK6 A;  2E8N A;  4NLK A;  1A0P A;  4UAT A;  2MU2 A;  2YMM A;  3BS5 B;  1ZQB A;  4GIB A;  7ICV A;  3PZP A;  2VA3 A;  1ZQG A;  1KL9 A;  1RM6 C;  3GIM A;  1NK8 A;  2I5H A;  4J9R A;  4ZH4 A;  8ICM A;  1KRP A;  4DL4 A;  3M9N B;  4DCC A;  5ALZ A;  2G0A A;  1ZJN A;  1BNP A;  2LMR A;  5L1J A;  4EBD A;  2VJ5 A;  1V9P A;  3CP8 A;  5KFQ A;  2A19 A;  3NVY A;  2KZ3 A;  4PHA A;  3TAN A;  3RH4 A;  3RRH A;  4O5K A;  1URJ A;  3I76 A;  4RZR A;  2OYY A;  4CGZ A;  2UVV A;  2MUT A;  3MGI A;  5AM1 A;  1ZQU A;  4J03 A;  1ZRM A;  1S0V A;  4ED7 A;  1PUZ A;  5DBC A;  4HAI A;  5L1M A;  3M8R A;  4EEN A;  2JEF A;  1YZ7 A;  1OXJ A;  2YN4 A;  1RXW A;  1ZQE A;  3F2B A;  1WYG A;  5HR7 A;  4EBE A;  3RB3 A;  4GXJ A;  2B0C A;  4TQS A;  1PZN A;  2GWS A;  5ALO A;  3RB6 A;  3SI8 A;  2IHN A;  5DBB A;  4MF2 A;  2AU0 A;  1DOQ A;  4XA5 A;  3EYZ A;  4IQT A;  3QU5 A;  5ALV A;  2W3S A;  1B0X A;  4DSK A;  2VJ4 A;  2QAR B;  3H0R B;  2KJ8 A;  2BPF A;  4QZB A;  5GTH U;  3UQ0 A;  4YD2 A;  5TZV A;  2VA2 A;  4JB3 A;  4FBT A;  1PK1 B;  4YMO A;  5IIL A;  4UB8 U;  2ZXI A;  5DG8 A;  4KLI A;  2KHQ A;  4FZN A;  2ZTC A;  9ICO A;  4FZL A;  5JU5 A;  1CRX A;  5EOZ A;  1ZQX A;  1PVR A;  4DQS A;  9ICA A;  3N7R C;  3RR7 A;  1S76 D;  3OJU A;  3ICX A;  3L5K A;  4AYB F;  1RQL A;  2YB1 A;  1BGX T;  5KG2 A;  8ICC A;  3GIJ A;  1Z1B A;  4R8U B;  2G06 A;  1ZQQ A;  9ICB A;  4I2C A;  1RYU A;  3PV8 A;  3ZD8 A;  1Q8K A;  5CWR A;  3TAP A;  4DS4 A;  3ZDD A;  5AKG A;  1QQ6 A;  5K4L A;  4B9M A;  5J2C A;  2E8P A;  3K1R B;  1ZQA A;  2HOQ A;  1B43 A;  2EH9 A;  3RJK A;  3WKC A;  3RF9 A;  1ZJM A;  2AGO A;  4Y2Y A;  2DKZ A;  2ZIV B;  4C8N A;  4NLB A;  2ZIX A;  4KLT A;  3C2M A;  4P4P A;  4UAW A;  4QZ8 A;  3KHR A;  1NI3 A;  2K60 A;  5KT4 A;  1PVP A;  4F4Z A;  4RPZ A;  2L5Y A;  4Y2V A;  2DGZ A;  1TE2 A;  4RQ1 A;  2Y9U A;  4QWC A;  1B22 A;  5A0L A;  3JPN A;  1EXN A;  1O08 A;  3QEB Z;  4NLG A;  7ICH A;  3WKA A;  2BDU A;  1KFD A;  3NUQ A;  2YMP A;  1V97 A;  3VC8 A;  2FE9 A;  2ZUD A;  2BKE A;  4Q8E A;  4RQ0 A;  2JGA A;  3MFI A;  4C8M A;  1JAL A;  8ICZ A;  3HP6 A;  3T3F A;  3AQE A;  1L7O A;  1SV0 A;  4Y2U A;  3WK8 A;  1S0N A;  4F5R A;  2K4H A;  2RP5 A;  4NWI A;  2DF4 B;  2YQE A;  3M1Y A;  4UAV A;  4J9N A;  4C4S A;  3RB0 A;  2V4Q A;  1P7D A;  5EE1 A;  3B0Y A;  1T94 A;  2FPK A;  3AEV A;  3H7I A;  1TK5 A;  2MA1 A;  1NJW A;  4KLG A;  3ISC A;  4RNN A;  3KHH A;  4F5O A;  3LVV A;  2KK0 A;  2F1I A;  7ICS A;  3M6Z A;  4CF4 A;  4BDP A;  5AK3 A;  4ED6 A;  4B9S A;  4KX3 A;  1N62 A;  4PHD A;  3F5A A;  1B4F A;  2CPR A;  3C21 A;  3MGH A;  5HR6 A;  2KOB A;  3OSP A;  8ICK A;  3CRX A;  2LM4 A;  5IIN A;  4YR2 A;  3SD7 A;  3UM9 A;  5KFN A;  2J6U A;  4O3O A;  2DFL A;  8ICV A;  1KKX A;  4RQ5 A;  3EPI A;  3ORY A;  3IN5 A;  3JPT A;  2A1A A;  4DLE A;  9ICC A;  2N1R A;  3SAG A;  2KIV A;  3H8W A;  4DSJ A;  5KFM A;  3MR5 A;  5ALM A;  5D4B A;  4JV2 A;  3H8S A;  1ZQN A;  3KKA C;  5KFO A;  2NRZ A;  1COK A;  9ICI A;  3IV6 A;  3QYP A;  1XSP A;  4P2H A;  3H8M A;  3WKB A;  1ZD2 P;  5IIJ A;  2HSZ A;  3PST A;  1UPH A;  2A3V A;  2KKP A;  4X5V A;  3QU7 A;  3G6V A;  5KFD A;  1L5U A;  2ZIU B;  4R8U A;  3BQ2 A;  5KFV A;  1X6J A;  3TFS A;  2DL0 A;  2XCP A;  1HEK A;  5TIS U;  1ZQ1 C;  8ICE A;  3HKZ F;  3C2L A;  3GV5 B;  4GXI A;  1MN8 A;  1VDV A;  3BS5 A;  2JH1 A;  2BCR A;  3FM9 A;  3PR4 A;  2QLT A;  2ZIW A;  1QLN A;  4M0A A;  4O0I A;  1TVA A;  3QXG A;  4TQR A;  5DQI A;  1NJX A;  4B9N A;  3CYM A;  2PFP A;  3V72 A;  5AKE A;  4IRC A;  3HJE A;  5HNK A;  5ALN A;  1YT3 A;  4GLX A;  5J2A A;  2VA8 A;  2I6X A;  1JX4 A;  3RBD A;  1ZQV A;  2D6F C;  3SQI A;  3ED5 A;  5EWF A;  4F4K A;  5F9L A;  4DF8 A;  1FO4 A;  5BOL A;  4PZN A;  2NO4 A;  4MFF A;  5KFY A;  3FYH A;  5JTI A;  2F8L A;  4EEK A;  5KT3 A;  3GU3 A;  3SMV A;  2W8K A;  4Q44 A;  3KZI U;  9ICW A;  2XIC A;  3H4D A;  3D2N A;  2DWQ A;  1X9W A;  5ALI A;  5KT5 A;  2LYH A;  3C1Y A;  3H0M B;  5ALD A;  2F76 X;  2DBY A;  5ALY A;  1JXE A;  2W9B B;  3C5F A;  3HWT A;  2J6T A;  4Q45 A;  1HIW A;  4JV1 A;  4F2S A;  4PL1 A;  2EZZ A;  1U9L A;  3S6J A;  9ICE A;  3SV3 A;  1JRP A;  4PL2 A;  5KG0 A;  2KVS A;  4P4M A;  2BQU A;  4CNQ A;  1Z00 A;  2M9N A;  4BJQ A;  1JN3 A;  3RR8 A;  5KL8 B;  3IG8 A;  5J2G A;  3RBE A;  8ICW A;  4MEX A;  3GV8 B;  8ICX A;  1WCN A;  1ZRN A;  3A0H U;  1SKS A;  5KFI A;  1RZT A;  4ICA A;  3SAH A;  9ICX A;  3H40 A;  1BPD A;  2A1J A;  4RQ4 A;  3ZD9 A;  2PI4 A;  5CJ7 A;  4P0Q A;  1JI7 A;  1D8B A;  3NVZ A;  4RQ2 A;  1MA7 A;  2AHO B;  4OD0 A;  3KHG A;  3V6J A;  2W9M A;  3T5J A;  1MC8 A;  5AIB A;  4DFM A;  4DQI A;  4IRD A;  5AM4 A;  4IL6 U;  3K75 D;  5KFL A;  4US9 A;  2KP7 A;  4O9M A;  3SAF A;  4EYH B;  4U7C A;  3IHQ B;  1WWU A;  9ICT A;  4UAS A;  5AI0 A;  2RHF A;  2I9G A;  3NRW A;  1L7N A;  4Z6F A;  4KLQ A;  4ECR A;  5G5G A;  1GO3 F;  3MBY A;  4ECX A;  4FZM A;  1BPX A;  2AH5 A;  2E5S A;  2ASD A;  7ICR A;  3FC4 A;  4I2J A;  4J9Q A;  1X6I A;  5KFX A;  4C4T A;  2NRX A;  2KD1 A;  4QW8 A;  5DDM A;  5J29 A;  3TAD A;  4B9T A;  4GXK A;  3Q8P B;  3T5K A;  3K1Z A;  1V85 A;  3RAX A;  4EZ9 A;  2C28 A;  4QWD A;  1ZQT A;  3QZ8 A;  4DSE A;  2QKQ A;  2DPJ A;  3M9O B;  2ZIW B;  2HW3 A;  4F3O A;  2ESE A;  5AKI A;  3UMC A;  4JWM A;  3O0F A;  4MEY A;  3BDP A;  1JIH A;  1TAQ A;  3PO5 A;  1NKC A;  4ECY A;  4LZG A;  2XO7 A;  1RQN A;  3WK7 A;  4P0P A;  3RJE A;  1U45 A;  5ALG A;  2AGP A;  1TV9 A;  2KHV A;  4UB4 A;  4E0D A;  1C7Y A;  4RQN A;  3TAC B;  4J9S A;  4RUC A;  9ICK A;  3D6J A;  4KTQ A;  2FMS A;  1CEZ A;  4FE3 A;  5E79 U;  4ECU A;  4Q8F A;  4US8 A;  4G3I A;  5J2J A;  4EZ6 A;  2ZUC A;  4Y2P A;  1SZP A;  3AUO A;  3GII A;  4F8R A;  3BQ1 A;  2H3Q A;  2HBL A;  2K8A A;  3C23 A;  3E0F A;  1HUZ A;  1BNO A;  2FLN A;  4J9O A;  3PW7 A;  1T8E A;  2RQ5 A;  4PZO A;  5DB8 A;  1S0M A;  4YR0 A;  4DQQ A;  1X40 A;  4FFD A;  7ICM A;  1OW5 A;  2G07 A;  5EE0 A;  1DGJ A;  4KLM A;  4RQ8 A;  1J2M A;  2ALZ A;  4R66 A;  3RAQ A;  4ECZ A;  5CR0 A;  2ISP A;  4DFD A;  2QAR A;  2HHS A;  1ZQR A;  2NYV A;  4OO1 J;  1L3T A;  2AGQ A;  1Z00 B;  3BJY A;  3RH5 A;  4LJX A;  2FLL A;  1BPY A;  2E8M A;  4Z6E A;  2R8I A;  3BS7 A;  4EYI B;  2VKQ A;  4EX7 A;  4FS1 A;  4R64 A;  4GFJ A;  2WF6 A;  3RJI A;  2KMD A;  2EAN A;  4QZ9 A;  2C2E A;  4NLN A;  2WF7 A;  3AU6 A;  5ALX A;  2LPE A;  2BCV A;  2LM1 A;  2JXJ A;  2IOF A;  3SZ2 A;  3KHL A;  5ALQ A;  5EWG A;  4P0Q B;  2ZTE A;  3TAQ A;  1XSN A;  3PVX A;  4KLO A;  3PX4 A;  4DFJ A;  5AM3 A;  4DSL A;  2G09 A;  2KSO A;  4P4O A;  3BQ0 A;  2W8L A;  3M6K A;  3ISD A;  5KFJ A;  1XS9 D;  3QU2 A;  3D2S A;  3QX7 A;  8ICT A;  2CXY A;  2W3R A;  1KBU A;  2F1J A;  1BVS A;  3IDW A;  3UPQ A;  1ZYQ A;  4Y2S A;  5C0Y A;  3EUB 2;  5IIM A;  4M47 A;  3NS1 A;  4QZC A;  3Q8R B;  1MQ2 A;  2PKE A;  1QSY A;  3LWL A;  2MSN A;  3UXN A;  4QNL A;  2E1F A;  2DPI A;  1NK6 A;  5AK5 A;  1X42 A;  3GDX A;  2LYB A;  4NLC A;  3MR3 A;  4DO9 A;  2RRD A;  2AXT U;  2HCF A;  5ALH A;  4DL2 A;  4LZD A;  5KTQ A;  4TUS A;  3AMZ A;  1ZQP A;  9ICS A;  4UAZ A;  2WB1 F;  8ICP A;  1S9F A;  2WF5 A;  3QE9 Y;  2W54 A;  7ICP A;  9ICN A;  4Y2T A;  3EPG A;  8ICN A;  1T4G A;  3NTU A;  2ATL A;  2BCS A;  2HHU A;  1XSL A;  3PX6 A;  4I28 A;  2P35 A;  5G5H A;  4UAR A;  1ZXI A;  4I2A A;  3EW9 A;  1A77 A;  2CRX A;  2KIW A;  2Y0S C;  4EX6 A;  2F3N A;  1FEZ A;  2ASJ A;  1D8Y A;  3OJS A;  7ICL A;  1XU4 A;  9ICJ A;  1IG6 A;  2HOF A;  4KMO B;  8ICO A;  4DS5 A;  4I29 A;  3C2K A;  1FIQ A;  3RTV A;  1COO A;  3CW2 C;  1L8L A;  2HBK A;  2GO7 A;  3ZDC A;  3SV4 A;  1TKD A;  5EWE A;  5BOM A;  2HBJ A;  1K5O A;  4DF4 A;  1SV0 C;  9ICF A;  1D8L A;  1ZD4 A;  5ALR A;  3HPO A;  4BWJ A;  4QZF A;  5D49 A;  2HMX A;  5DDY A;  3LDA A;  2ES6 A;  4UBC A;  5ALP A;  1DXS A;  4M6W B;  3OTQ A;  1KTQ A;  4BXO A;  1LKY B;  1ZQO A;  9ICU A;  4OJO A;  2OEH A;  4IS7 A;  1SIJ A;  5KG6 A;  2F8K A;  8ICY A;  3MAB A;  3V7L A;  4R65 A;  3SEN A;  2ZIV A;  1SXD A;  5KFW A;  2ZIX B;  2R8H A;  2M0N A;  4ELT A;  5C5J A;  1S5L U;  5AI8 A;  2BCQ A;  4RT3 A;  4R63 A;  1ZD5 A;  3MR6 A;  1KLN A;  4DFP A;  4O5C A;  2GH1 A;  5HP4 A;  4ECT A;  2EDU A;  2KZM A;  1KFS A;  3FDS A;  5KFE A;  1ZQK A;  3I28 A;  3DDH A;  3JPP A;  5KFH A;  1SB3 C;  4YD1 A;  1IM4 A;  4NXZ A;  3C5G A;  5B5E U;  4KLE A;  3SR6 A;  1DRG A;  2YX8 A;  1K1Q A;  5J2E A;  4O3P A;  1QSS A;  1VJ5 A;  4O3N A;  4FS2 A;  3ONN A;  4UB5 A;  3R9K A;  4ACO A;  3ZDA A;  2Z7J A;  5J2K A;  2OH2 A;  7ICF A;  1J2N A;  4MFC A;  4P0P B;  7ICE A;  4F4Y A;  4M9H A;  1SKW A;  1ED1 A;  2H5X A;  2R8J A;  4CE6 A;  4C4R A;  1Y88 A;  5AKK A;  2HHQ A;  4CF5 A;  1FFV A;  5DGB A;  2K8B B;  3JPR A;  1TAM A;  1Z19 A;  4ED2 A;  1Z4O A;  4RQ6 A;  5AKY A;  2H3V A;  4KLH A;  3FAH A;  5ALE A;  3F53 A;  1X9S A;  2DKX A;  3U26 A;  1ECW A;  1WUD A;  2R18 A;  2ZUB A;  3RJJ A;  3M7D A;  4BX9 C;  2BHN A;  3H0L B;  4MF8 A;  2XY5 A;  4C8L A;  4YFK A;  5KG7 A;  2FLP A;  4DOB A;  2DUY A;  5KFZ A;  2JRZ A;  4QIW F;  3OHA A;  2VIX A;  1F5S A;  2HHW A;  2WTF A;  2KFZ A;  2CN1 A;  3PR5 B;  4DWI A;  5J8Y A;  1ZQY A;  1N56 A;  1WWV A;  2G5H B;  5AKJ A;  2OCE A;  1TK0 A;  1JXL A;  1ZQJ A;  9ICR A;  5EE9 A;  4PGY A;  4UB6 U;  1FFU A;  2ZJ5 A;  1BPE A;  1N61 A;  5J2H A;  1KW4 A;  2WAQ C;  2BZF A;  3B9J A;  4I2E A;  4GC6 A;  2PFQ A;  1CUK A;  1PVQ A;  9ICQ A;  5J0R A;  4C80 A;  1N60 A;  4FBU A;  1ZQI A;  2B21 A;  3QUB A;  3OSN A;  5CP2 A;  4K4H A;  5HMM A;  4GC7 A;  2XCA A;  4CDG A;  4K4I A;  9ICV A;  1UHU A;  4M9J A;  1Z3E B;  1MQ3 A;  5KT2 A;  1K1S A;  2W43 A;  2YB4 A;  8ICF A;  4ED1 A;  1DK2 A;  3ALR A;  2GLE A;  2EAO A;  4RU9 A;  1NNL A;  5ALT A;  4YN4 A;  4HYK A;  2KSO B;  1N48 A;  2WHE A;  4YMN A;  1F0M A;  4NL9 C;  3GIK A;  4CRX A;  1Q3V A;  7ICO A;  2XGQ A;  5KFR A;  3PNC A;  4XQ8 A;  4OJL A;  5KAF U;  5HHH A;  1TAU A;  2K8C B;  4A8E A;  2H3I A;  3JPO A;  4XUS A;  4RPX A;  4JK1 A;  4K4G A;  4TUR A;  1U48 A;  4I2B A;  3H8J A;  4PJ0 U;  3GFK B;  5J0O A;  4UB2 A;  5EE3 A;  1H38 A;  3D2Q A;  4EBC A;  4PPX A;  2Y0S F;  1ZQC A;  1UA0 A;  4O3M A;  4DQR A;  1JRO A;  3KFU F;  5KFU A;  3AN1 A;  4NL9 A;  3T5H A;  1RPL A;  3F2D A;  1QQ7 A;  1QCK A;  4DL7 A;  2H3Z A;  2DQN B;  1QSL A;  4KLD A;  2QB0 B;  4IQW A;  4ELV A;  2E3T A;  4QZD A;  5J0T A;  3PX0 A;  2WB1 C;  3DEE A;  2LYA A;  5JRT A;  2WF8 A;  1UT8 A;  5KT6 A;  4EEY A;  2V4R A;  4QZG A;  2FPM A;  2KE7 A;  2W9B A;  3RRG A;  3QEA Z;  9ICP A;  2OHF A;  4OJP A;  5AK4 A;  4MFA A;  5AKL A;  4I2D A;  2IBK A;  4BUG A;  4B9L A;  2JR5 A;  4DLG A;  1U4B A;  5III A;  3BQT A;  3RH6 A;  5DG9 A;  4ED8 A;  3UXP A;  5ALU A;  4C7Y A;  2JH7 A;  3OHB A;  1TFR A;  5J2F A;  5KFT A;  1Z1V A;  3WKE A;  5AKH A;  4O5E A;  5J2D A;  2Y1J A;  4IR1 A;  3MDC A;  4M9G A;  2IMW P;  4RNO A;  3C29 A;  3G6Y A;  3PW4 A;  2EQY A;  3HKZ C;  1L6N A;  1HJP A;  5KAI U;  2W9C B;  2LBO A;  3EWA A;  3E2E A;  5DG7 A;  1LV5 A;  2OWO A;  1UCV A;  2HVH A;  4BXO B;  5AM0 A;  4BWM A;  2BGW A;  3NVW A;  1LVH A;  3GZF A;  4JV0 A;  2XY7 A;  3QNM A;  5BPC A;  2I1Q A;  3HT3 A;  3PSI A;  2AQ4 A;  5DB6 A;  1IV8 A;  2NRW A;  4DOA A;  7ICT A;  1RYR A;  3KKA A;  3EZ5 A;  1U49 A;  2R8K A;  1N5W A;  2HVI A;  4UAY A;  4QW9 A;  1L3V A;  4UB1 A;  8ICQ A;  2P6R A;  1KQQ A;  1C20 A;  3L4P A;  4M2Y A;  4PGX A;  1JMS A;  4CCH A;  1DK3 A;  2BPG A;  2HOI A;  4DFK A;  2LHT A;  4F2R A;  3UMG A;  4F91 B;  5ALW A;  4ZOH C;  2FPL A;  3V7K A;  2BQ3 A;  1MSW D;  3F5E A;  3A0B U;  4CF3 A;  2UVU A;  1NOM A;  2Q4T A;  2YTU A;  2E8O A;  4XRH A;  4IR9 A;  5KG1 A;  7ICN A;  4DL5 A;  4F4X A;  1L7P A;  3NGD A;  4YP3 A;  1LB2 B;  1NZB A;  4B6J A;  5GTI U;  8ICB A;  3ETR A;  3PW2 A;  3T79 A;  9ICG A;  1S77 D;  4OJ5 A;  4QZE A;  1T7P A;  4YG2 A;  2PXI A;  2KIC A;  4KX5 A;  4Q43 A;  5F9N A;  2AQ0 A;  3WK6 A;  3C28 A;  4QIW C;  2KV2 A;  4I2G A;  1XO1 A;  4UBB A;  1X66 A;  3ETL A;  4NM1 A;  5AI9 A;  1ZOL A;  5D46 A;  5AI4 A;  3QUC A;  2RLT A;  3K4G A;  2IA6 A;  5CHG A;  1QH9 A;  4KN7 A;  5J8Y C;  1XO0 A;  4O3R A;  1S97 A;  3WK4 A;  3LK9 A;  4J9K A;  4F92 B;  4RUA A;  2HDO A;  3RJF A;  5AM2 A;  2F1H A;  3PSF A;  3TKA A;  4YXJ A;  5J0P A;  2XC9 A;  3SEI A;  5AI6 A;  1NKE A;  4O3S A;  1A76 A;  8ICH A;  4ED0 A;  1NK9 A;  1Q3U A;  9ICL A;  5DQH A;  1RXV A;  4OCZ A;  1S0O A;  4DL3 A;  3TI0 A;  2MRL A;  2ZTD A;  5J0X A;  3PMN A;  5DLG A;  4JWN A;  5CB1 A;  4KLJ A;  2JZB A;  3AU2 A;  1O03 A;  2KNJ A;  5AHX A;  1T3N A;  5ALL A;  1PK1 A;  4DQP A;  3I1Y A;  4ELU A;  1T3Q A;  2XI9 A;  2FDR A;  4G9B A;  4UW9 A;  1NZP A;  2XVT A;  4KLU A;  2OXO A;  2HI0 A;  3CNH A;  3ZI4 A;  4F5Q A;  1J97 A;  5KFP A;  1ZQW A;  8ICG A;  5F3X B;  4AP9 A;  5KFS A;  3MC1 A;  3E58 A;  9ICM A;  2JMG A;  3WU2 U;  4B9U A;  3G6X A;  3F2C A;  2JHD A;  5HML A;  5KFG A;  3LVW A;  5J0S A;  4I2H A;  3DV9 A;  4JUZ A;  2O6K A;  1TK8 A;  2RDJ A;  4QZA A;  3KTQ A;  4YVZ A;  3QUT A;  4EEL A; 
#chains in the Genus database with same CATH homology
 4IL6 U;  5KAF U;  5TIS U;  5B5E U;  4PJ0 U;  5E79 U;  3WU2 U;  5H2F U;  5GTH U;  2DUY A;  1S5L U;  5KAI U;  2AXT U;  4UB8 U;  3A0B U;  5B66 U;  4UB6 U;  3KZI U;  3A0H U;  5GTI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...