5GTHU

Native xfel structure of photosystem ii (dark dataset)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
total genus 29
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gthU01
2DUYA 4UB8U 5KAIU 3WU2U 1S5LU 4IL6U 5E79U 3KZIU 5GTIU 4PJ0U 5KAFU 5B66U 4UB6U 5B5EU 3A0BU 5H2FU 5TISU 2AXTU 5GTHU 3A0HU
chains in the Genus database with same CATH superfamily
4RQMA 1NKBA 3H0MB 4YXMA 2IA6A 2YX8A 2ES6A 4RQ0A 4IRCA 2FPKA 3WKBA 1V9PA 1P7DA 5AI4A 2WHEA 3B0XA 3R9KA 2ASLA 1ZQPA 2E1FA 2CXYA 3TAQA 3HILA 4Y2TA 4KMUA 3HX0A 3QEBZ 5KL8B 1CEZA 4DQQA 2KTQA 2JMGA 1U47A 3I76A 4BXOA 4ECUA 1PK3A 3GIJA 2EAPA 2ZIVB 3AQFA 2W3RA 3UQ2A 3KTQA 9ICSA 4M9HA 4MFAA 2PMZF 4OJ6A 2KK0A 5DGAA 4QW8A 2YMQA 5G5GA 2XGQA 2FMQA 2WAQF 1ZQQA 4DCCA 3QXGA 4YMOA 5KFEA 2KZZA 3MR6A 2XVTA 2LI6A 2FI1A 5KT4A 3IV6A 2VA2A 3NTUA 5KFUA 2VKQA 4PPXA 2KJ9A 4M2YA 3UXNA 5DKWA 5AKXA 5AKYA 4NWIA 8ICIA 2LYHA 4IC9A 3GILA 4TQSA 4QIWC 1FO4A 4CGZA 1QSYA 4MFFA 3Q8PB 2NV3A 5KFIA 4UAYA 5CEHA 3OHAA 3BQ2A 2WFAA 1F44A 3N7RC 4M04A 3OJUA 1V97A 1NOMA 2DL0A 5KG6A 2Y9TA 4NLBA 1SZHA 5AM5A 2KE7A 2WF8A 1S10A 5KFSA 4PL2A 5AM3A 3HKZC 4KLJA 3ISBA 2R8HA 2OHFA 4RUAA 5JUMA 1PK1A 2MU2A 5EWFA 4KN4A 4OJPA 1RXWA 5KFOA 2W11A 5ALQA 2FMPA 3M9OB 4DFJA 1BNOA 1HUZA 5KFNA 3K75D 1RQNA 3QNMA 5J8YA 1RG6A 2M0NA 4Y2QA 2JRZA 1RYRA 1XSNA 3G6VA 4BGDA 2CRXA 4P0PB 4Z6EA 3HPOA 2QARA 5B5EU 3RH5A 1KN5A 3CNHA 3GQCA 5TISU 4GXJA 1CUKA 4FE3A 2ZTDA 8ICHA 3UMCA 4ELVA 2PFNA 4GXKA 1TAMA 3MFIA 4FFDA 3LWMA 3PSPA 1Z4OA 4XUSA 1QTMA 2W55A 4LZGA 3UXPA 2XY5A 3OJSA 2ZUCA 4NL9C 3BQ0A 4F5QA 4MF2A 3MGIA 5ALZA 3UXOA 3EPIA 2LPEA 3ISDA 2AQ0A 4DFKA 5L1LA 4ECQA 5KFRA 1NK0A 2IOHA 2WF9A 2F8KA 3TADC 2KIWA 5KFWA 4RQ7A 5KTQA 3C23A 3WK4A 5B66U 7ICRA 7ICNA 1Z19A 1KTQA 5AM1A 3PX0A 1RYSA 1KDHA 4CCHA 3T79A 3H0RB 3BQTA 3NGDA 1QSSA 2MUTA 3GIKA 4EBDA 4MFCA 5C0YA 3LVWA 2A1AA 1J2MA 1IM4A 4EYHB 3C28A 1U9LA 4BJQA 5KG1A 4F4YA 5H2FU 2V9WA 3PMLA 4DOAA 2RQ5A 4P0QA 3KFUF 3DV9A 1L7MA 4C8KA 5KNIA 9ICUA 3M8SA 4KLGA 7ICVA 2E8NA 2DQNB 1ZQBA 3MGHA 3OGUA 1NK7A 3WK8A 3QUCA 5KFZA 4YXJA 4IL6U 4M9JA 4RQ4A 4UQGA 2KVSA 9ICGA 4UB4A 5GTIU 1T7PA 2HBMA 5EE0A 4OJ5A 3ZDCA 4PZOA 2RLTA 3PX4A 5ALIA 1KSPA 2K8CB 4DSKA 5J0QA 5CJ7A 1JALA 4UAUA 4DSJA 1ZQSA 1HEKA 4B9NA 1L3UA 2W43A 1RQLA 4F93B 4RPYA 4ED0A 1JRPA 5ALYA 1KQQA 1TFRA 4XRHA 2PFPA 1QQ7A 4BDPA 2Y0SF 2MSNA 1NJWA 1NJYA 2ZUBA 2PKEA 5KFBA 4CNQA 5IIOA 2ZJ5A 2OYYA 2HVIA 3NRWA 4DSEA 3HWTA 1L5UA 3IN5A 3C21A 4UATA 4KITB 5ALLA 3ISCA 1GO3F 4ECRA 2RP5A 2IOFA 3NVYA 4C4TA 1N60A 2AXTU 1NNLA 2UVVA 2ZIWB 3OSPA 4UB2A 1QQ6A 4QZEA 3RR8A 1ZQZA 3M1YA 2FLPA 1T3NA 8ICMA 3T5JA 1S0NA 1XS9D 1AROP 4ECZA 2DPJA 2RDIA 3SAFA 3CYMA 2Y1IA 2ATLA 2VIXA 3PR5B 4Y2XA 4M6WA 2KMDA 2HBLA 3T3FA 2OXOA 1WCLA 3QUBA 4MF8A 2XC9A 2RHFA 3IG8A 1S76D 5CWRA 4UBBA 1S8OA 3H40A 2FDRA 4ED8A 3ZDAA 4AP9A 4FBUA 5K4LA 4KLMA 4PHPA 9ICHA 4ELTA 2KV2A 2B21A 5AKIA 1YT3A 1D8YA 1NZBA 2JEJA 1NJZA 2H3ZA 4BXOB 1K5OA 4F4WA 2V4RA 3V7JA 4Z6CA 2C22A 3WKAA 2HOIA 7ICOA 4P4OA 2E5SA 5DBBA 4R66A 2XICA 2H3QA 2KKVA 4CRXA 3NVVA 1D9FA 2QLTA 2BQRA 4Y2SA 2W9CB 4UW9A 5JRTA 4TUQA 2W9BA 1ZJMA 3ZDEA 3VC8A 5AK5A 3F5AA 2WF6A 8ICRA 3AU6A 2JV3A 3WKEA 5DB8A 2NRVA 1Z00A 3QU9A 1Q3UA 1SXEA 1V85A 4QZGA 4KLUA 3N97B 3MDAA 3PY8A 2QB0B 2HMXA 5GTHU 2AQ4A 4DL5A 3RJEA 5J0RA 2ZJAA 3ZI4A 3RBDA 7ICSA 5ALEA 5ALRA 3PSTA 2OCEA 1X9MA 2E8OA 3ZD8A 1NK6A 2NRWA 2WB1C 3C1ZA 3OPXA 5ALWA 3TAPA 4LVSA 4PH5A 2C2RA 1ZQUA 4EX7A 2HDOA 4UB5A 4R64A 1PK1B 4KX3A 5IIMA 4DSLA 4O3NA 1BPDA 4Y2JA 3B9JA 5KFLA 2W3SA 2KG5A 2KHQA 5DB9A 9ICXA 4I2EA 5L1MA 3C5FA 3JPTA 3PSIA 4YG2A 2IHMA 4M9NA 5HHHA 4IQVA 1BGXT 3KD3A 2PFQA 4ICAA 4ED6A 2C2DA 4B9MA 2EZZA 2O6KA 1X9WA 4FO6A 1QH9A 5KFKA 3SYZA 3LDAA 3L5KA 3LK9A 2HOQA 3QE9Y 4ED1A 2F1IA 1SL0A 2KOBA 1ZQXA 2BCUA 8ICQA 4UB3A 4RQ1A 4USAA 2JEFA 2JH7A 1L8OA 5DDMA 5IIKA 4C8OA 5ALJA 3MABA 1CRXA 2A1JB 4FZNA 1RM6C 2YB1A 3K4GA 4EEKA 2BKEA 1KFTA 5AK3A 1KRPA 3ZDDA 2KSOA 2H5XA 3PW5A 3HT3A 1JXEA 1JMSA 4F8RA 4G3IA 2HHUA 1N63A 1S77D 1ZD5A 3QU2A 4RNOA 4YD2A 2BQUA 2BCSA 4I2BA 4QJFB 2Z7JA 5DDYA 4NJ8A 5F9NA 5ALFA 1VLBA 4RQ8A 3ZDBA 2EANA 1UA1A 2MA1A 2F77X 1LB2B 1L3TA 3QYPA 1MC8A 2JGAA 4UB8U 4ECXA 4Q45A 2F44A 4O3PA 2GLEA 3NVWA 4XA5A 4IS7A 4NV0A 5KT3A 1SXDA 4J9RA 4ELUA 4NXZA 2XY6A 5ALXA 1X66A 1KLNA 4KLLA 3RJKA 2H3FA 4U7CA 1WWUA 2EQYA 3GIIA 4IRKA 4YFKA 2PFOA 1FEZA 4RU9A 4DL4A 3SEIA 1S0OA 4JWNA 4YR2A 4FS2A 4P0QB 3H7IA 4I2IA 4C7ZA 4PGQA 3RAQA 4C8MA 3WKCA 5J2CA 1ZQHA 5KFTA 3FYHA 2W9AA 9ICTA 1DK2A 2W03A 3IRUA 2K4PA 4P4PA 4JUZA 1S97A 3RH6A 4QIWF 2NRZA 9ICJA 5AKJA 5EOZA 4M9GA 4EEYA 2VJ4A 5J0TA 4B9LA 5KT2A 1JUDA 3H0LB 4EZ6A 3I1YA 4RZRA 1N56A 4JV2A 3V7KA 5KFGA 5KFXA 2VA3A 2CN1A 3A0BU 2KJ8A 2XCAA 1NK5A 2JH1A 2J6SA 4Y2PA 1BPXA 5CR0A 2WTFA 2KZ3A 1TK0A 3HKZF 7ICEA 3ETLA 3JPOA 1PZNA 7ICGA 4EBCA 1D8LA 1PVQA 4TURA 5AKKA 2YB4A 5DB7A 3C2KA 1D9DA 2KICA 1XO0A 1KFDA 2JZBA 5CHGA 2RDJA 3EYZA 3AU2A 1X2IA 1DXSA 1DGSA 4DFDA 4F2RA 4KLQA 5D46A 2F3NA 5ALSA 4PJ0U 3V72A 4RQ2A 5J2FA 3PV8A 3WKDA 4IQUA 1JROA 3KKAA 4RQ3A 5F9LA 3NASA 3H4BA 7ICUA 4O5EA 5DGBA 4DQSA 3N7PD 4YMMA 1L7PA 2E8MA 2HBJA 5E79U 1L3VA 1N48A 7ICIA 2KNJA 4ECTA 4Y2VA 2NYVA 1ZQGA 3C2MA 3PMNA 2XCPA 3RB6A 2K8AA 4QWEA 5IINA 3JPRA 4F71A 4DO9A 9ICKA 2K4EA 4JV1A 4B6JA 3F2DA 5KT6A 1IV8A 2HHSA 1ZQYA 3PNCA 4I29A 5HP4A 4RNNA 3KHHA 4R8UB 3H8WA 8ICTA 5AIBA 2NRTA 2BHNA 2LYAA 5A0LA 4EELA 4M0AA 5AI6A 1IXRA 1L7OA 1ZQVA 2FPLA 2W9MA 3NVZA 3OTQA 2HHXA 4DL3A 2W9BB 1SKWA 2HVHA 2BCQA 4BWMA 8ICZA 2GH1A 4K4HA 1KW4A 4YP3A 3RRGA 3SI8A 4LJXA 2FLNA 3AUOA 4UBCA 3PR4A 2CPRA 2VANA 2E3TA 2KHVA 1F0MA 4DOCA 5ALDA 5L1IA 4FBTA 2KP7A 1NK9A 1ZQCA 4GXIA 2YY6A 2L5YA 2P6RA 3QEAZ 3GU3A 1X9SA 1S5LU 1HIWA 4M9LA 3E2EA 4YMNA 4Q8FA 5AM4A 4IR1A 5AM2A 3RFAA 4UAVA 3MR5A 1MN8A 3UMGA 4C0ZA 1QQ5A 2XY7A 2ALZA 1SKSA 4Q43A 3CP8A 8ICFA 2HI0A 4DFMA 1C7YA 4KTQA 3BQ1A 1UA0A 3SZ2A 4ED2A 1U45A 2Q0ZX 3PVXA 5ALKA 2YMLA 3H8JA 3TFRA 1RPLA 2AU0A 2P35A 3I28A 8ICVA 3PW2A 4R65A 1MQ3A 1SKRA 5DQGA 1L8LA 4C8NA 4KLDA 1SV4A 4C80A 1X42A 2A19A 8ICBA 4EX6A 2IHNA 1PVRA 3IM1A 8ICGA 2YQEA 5AI9A 1OUQA 1TAUA 3RBEA 3Q8QB 1LKYA 4ZH4A 4ECYA 1MSWD 2GO7A 2EZXA 3ONNA 5AK4A 1ZQIA 2ZIUB 2R8JA 3V6JA 5J2DA 3BDPA 4QWCA 4I27A 1Q46A 1NJXA 3WK5A 2K4HA 1L6NA 2F76X 2FE9A 1Z3EB 2DBYA 3M6KA 5J8YC 2LYBA 2K60A 1X40A 3KBBA 4K4GA 5ALMA 3BS5B 3NRZA 4RNMA 1XSPA 4EBEA 1ZYQA 3V7LA 2ODGA 4TUSA 1ZOLA 3UM9A 2IOFK 1UT8A 1Q3VA 1FFVA 5KFQA 4TUPA 5J2IA 4RQ5A 3WK9A 5IIJA 2Y9UA 1U49A 4US9A 1YZ6A 2ZIVA 4J9KA 1ZQWA 1LVHA 3H4DA 3LYSA 5DG8A 3IHQB 3RB4A 3HJEA 2J6UA 3T5LA 4DL6A 1L3SA 5CA7A 3H8MA 2XO7A 4K4IA 5CB1A 4NLGA 2ZIXB 2HBKA 4RUCA 3PZPA 2G0AA 2W7OA 4I2JA 4C4RA 5J2BA 3GV7B 3MDCA 3AN1A 2BGWA 5ALHA 3SQIA 1JX4A 4EZ9A 5DG9A 3AL0B 1O08A 4BX9C 2ZXIA 5HR6A 1KKXA 2KKPA 1U48A 8ICJA 1BNPA 3MC1A 3MGVA 2F1HA 2GWSA 4B9UA 4RQNA 2Y1JA 1KEJA 5KL1B 2D6FC 4DOBA 1UCVA 5AHXA 1NK8A 1B22A 5ALNA 3HRDD 3SV4A 5KFYA 5J2GA 2Y0SC 2I1QA 4I2AA 2K4IA 4MEYA 3TKAA 2NO4A 3ETRA 3M9MB 8ICYA 3L4PA 4DS5A 3V6KA 3Q8SB 3G6YA 1ED1A 2WB1F 1O03A 5KFDA 4DSFA 1NKCA 4ECSA 3GV8B 1RZTA 2BCVA 2JXJA 4QZHA 4US8A 1T94A 5J2JA 4QWAA 4NLNA 8ICNA 1DK3A 9ICNA 8ICXA 2UVUA 3TFSA 4P0PA 2XI9A 5CRXA 1IG6A 1XU4A 3WU2U 4JV0A 4C4SA 4MEXA 2KN7A 4A8EA 3G6XA 4JWMA 2G08A 1XC9A 1BPBA 3EWAA 5DLFA 2OWOA 1UQVA 2V4QA 1A6SA 3WK7A 3FC4A 3C1YA 4QZ9A 4P4MA 3E58A 5J0WA 2R8IA 2UVRA 1U4BA 5AI8A 2BQ3A 5KT5A 5JU5A 9ICWA 4KLFA 5AK6A 2VA8A 4Z6DA 2I5HA 1ZQOA 1ZRNA 3EZ5A 4JB3A 2RRDA 1T8EA 3KHGA 2PI5A 4F2SA 9ICLA 3BQ7A 2AJQA 3QU5A 1NKEA 4J9QA 2C2EA 2AH5A 3QU7A 1F5SA 1S0MA 2LMRA 5J0YA 1ZD4A 1N5XA 5DBAA 4DLGA 4O3OA 4F5RA 3KHRA 4KLTA 3VCBA 1S9FA 2QKQA 3AMZA 1VDVA 1DRGA 1RYUA 4F4XA 5AKEA 3KHLA 4KLIA 3IP4B 3D6JA 4YR0A 2HOFA 4BWJA 4ZOHC 2FPMA 2B6GA 2QARB 3CW2C 1HJPA 5DLGA 2OM6A 4E0DA 1BVSA 3IDWA 2LHTA 7ICQA 3FAHA 4CF5A 2J6TA 1IIPA 5HMLA 1ZRMA 5ALOA 8ICSA 3ED5A 3RJGA 2YTUA 4AYBC 1Z1BA 9ICIA 4CF4A 4J9LA 5BOMA 3RJFA 2ISPA 4O3MA 3O0FA 4O3RA 2ASDA 2Q4TA 3N7SC 3D2QA 4DF8A 9ICMA 3ALRA 1QCKA 4PL1A 3GV5B 4O3SA 1OW5A 2W8LA 3TACB 4DSIA 2H3IA 3MR3A 5AI0A 5J0SA 4RPXA 1Y88A 3JPQA 2UVWA 3RJHA 3QZ7A 4JK1A 4F50A 4J9NA 3K1RB 4EENA 3QZ8A 5AIAA 2JR5A 2MUTB 4CE6A 1ZQNA 1COKA 1SWWA 2OH2A 4KLHA 1NK4A 1K1SA 3RB0A 5KG5A 4F91B 1X6IA 3MBYA 4NM1A 2OEHA 2ZUDA 4DFPA 3OHBA 4OCZA 2G07A 2W54A 3M6ZA 4TQRA 4YQWA 2AGQA 2D3DA 1PUZA 4QZCA 5CP2A 7ICKA 2ZIWA 1TE2A 3F53A 1B4FA 4RT3A 4FS1A 5J0UA 8ICLA 5EWGA 1ZQKA 3NUQA 5F3XB 4UAWA 4QZDA 3C2LA 4NM2A 9ICAA 4PHDA 4DL2A 4Q44A 3RB3A 4B9VA 1WYGA 2EZYA 1KFSA 2DFLA 4PGYA 1SV0A 4UB6U 5EWEA 3PSFA 1OXJA 4F5PA 5AKZA 3SAHA 1Q8KA 3SV3A 3F2BA 2N1RA 5IIIA 1ZQRA 3RRHA 3E0FA 3OSNA 9ICRA 5HMMA 3KOOA 1WUDA 2XIDA 8ICEA 3RJIA 8ICKA 3M9NB 3CRXA 5AI5A 4NL9A 3EUB2 3EPGA 3HP6A 5J2HA 3Q8KA 3JPNA 1FIQA 2W9CA 3F5EA 2R8KA 3U26A 5D49A 3UQ0A 2W04A 5HHIA 4I2FA 1SL1A 2G09A 1UT5A 3TADA 4O9MA 2BZFA 1ZQJA 2DKZA 5KFPA 3BZCA 3SENA 2PXIA 4ED3A 3AM9A 1N61A 3UMBA 4KN7A 2LKYA 4RPZA 4YCXA 2KD1A 4DF4A 4M6WB 1UPHA 4CF3A 2QB0A 2I6XA 2DF4B 5AKLA 4PGXA 1D8BA 4F5OA 1WG8A 2LM4A 3EW9A 3N28A 3SAGA 4R63A 4KLEA 3F2CA 1AQ6A 4I2DA 2PMZC 2IBKA 3PW7A 4GIBA 2NRXA 5J2EA 4ED7A 2EDUA 9ICVA 1EXNA 5KFCA 3QUTA 2WAQC 1TVAA 4NLCA 3QUQA 4I2GA 4B9TA 5TZVA 1VJ5A 4F92B 3V6HA 8ICCA 4XQ8A 4FZMA 3PO5A 1SWVA 3PO4A 5EE9A 1ZQDA 4KX5A 3C29A 5J2KA 5KG4A 1X6JA 2AGPA 2BDPA 5KFFA 2MAXA 4QZ8A 5KFHA 1RDFA 4P2HA 3D2SA 4Y2UA 3MFHA 3AEVA 5JTIA 1ECWA 2BPGA 1Z00B 1SZPA 4IR9A 1SV0C 1B0XA 4UAZA 4GC7A 1TK8A 2I9GA 4KLSA 4EYIB 5KG3A 3C5GA 5AKHA 4F4KA 2DPIA 4KLOA 3Q8MA 3M7DA 3THVA 2M9NA 5J0XA 4RQ6A 1N5WA 2XGPA 2E8PA 2HHTA 8ICAA 2A1JA 3AQEA 1V38A 2F1JA 2ESEA 1JN3A 3D2NA 2KFZA 2FLLA 4DEZA 5J0PA 4KMOB 5HR7A 2FJ6A 3SD7A 4O0IA 5BOLA 3B0YA 2HW3A 4C7YA 1ZQLA 4I2CA 4LZDA 5BPCA 4B9SA 1SL2A 8ICUA 3S6JA 5DB6A 3MR2A 2WF7A 3IG5A 4DQIA 3KZIU 2AGOA 1KL9A 4MHVA 9ICBA 3WK6A 1ZXIA 3Q8RB 4HAIA 3KKAC 2ISOA 1B43A 5HNKA 4IQWA 5KFVA 8ICWA 3BZKA 5KG7A 2IMWP 3KZXA 5L1KA 4O3QA 1A0PA 1QLNA 1ZQ1C 1A76A 5ALGA 4F4ZA 5EE1A 4OJLA 2A3VA 4J9OA 1A77A 4QZIA 2HHWA 3LVVA 7ICJA 2MRLA 3GFKB 2AHOB 4NLKA 4WJ3B 2KZMA 2KEYA 2KFNA 2WF5A 7ICPA 3FDSA 5KFAA 2KSOB 1BPYA 3TQ1A 2P66A 3BJYA 1KBUA 1TAQA 4DQRA 2LM1A 2BDUA 5AICA 2ZXHA 2QB1A 1T3QA 1N2XA 5J2AA 4YR3A 2ZJ8A 2HHQA 1SB3C 2BPCA 4Y2RA 1WCNA 2ASJA 3K1ZA 7ICHA 3TI0A 4O5CA 2C28A 1L7NA 3GZFA 3N4MB 5G5HA 1FFUA 2R18A 1TK5A 2R8GA 4DQPA 9ICCA 5KAIU 4Z6FA 1ZQEA 4HYKA 2DKXA 2EAOA 3Q8LA 5KT7A 2FMSA 4QZBA 3RR7A 4GLXA 5T14A 3ICXA 2JEGA 1NI3A 1SIJA 2D8CA 4QZAA 3PW0A 3ZD9A 9ICFA 1ZJNA 2EAMA 2ZG6A 1ZETA 8ICOA 2P6UA 2KIVA 3UPQA 5IILA 2YMPA 1H38A 2G06A 2E1EA 1MA7A 1ZQMA 4QW9A 4J03A 3GIMA 5D4BA 9ICPA 2DUYA 3PX6A 9ICOA 4DL7A 4NLZA 3TANA 1T4GA 2EH9A 4GFJA 1BPZA 5AM0A 2JEIA 1Z1VA 1RXVA 1BPEA 1J97A 4RT2A 2PI4A 3JPSA 2K89A 4C8LA 4F3OA 1JI7A 4R8UA 4UB1A 7ICLA 2ZTCA 4PHEA 1ZQAA 2JZBB 4F72A 2HCFA 3RAXA 2YN4A 4FZLA 2YMMA 4U6PA 3RTVA 4PZNA 3RF9A 1TV9A 2W7PA 3JPPA 5KFJA 1J2NA 4DS4A 5ALVA 5L9XA 3A0HU 2G5IB 9ICQA 3PW4A 2VJ5A 4YVZA 8ICPA 1N62A 4I2HA 5KG0A 3ORYA 2H3VA 4ACOA 2KJ5A 4ECVA 5KFMA 2DGZA 4QNLA 4F5NA 1ZQTA 1QSLA 4Y2YA 3T5KA 3FM9A 4AYBF 4J9MA 1C20A 4OO1J 2GOLA 1CI4A 1JXLA 1XO1A 1Z4NA 5J29A 5DG7A 1HUOA 2HSZA 4DLEA 3GDXA 4YD1A 5KG2A 1NZPA 2NO5A 1XSLA 2B0CA 3NS1A 5C5JA 4YN4A 5L1JA 5AKGA 4BUGA 3RH4A 1XWLA 2BCRA 2ZTEA 1ZD3A 4QZFA 4JMUA 2G5HB 3L3FX 1ZQFA 5ALUA 5KAFU 4GC6A 3H8SA 3QU4A 5DQHA 4G9BA 2F2AB 4IQTA 5J0OA 1PVPA 4PHAA 4I28A 3T5HA 1ZD2P 4X5VA 2DWQA 1COOA 2ZIUA 5DBCA 4ECWA 3RJJA 2JHDA 3SMVA 3HW8A 3BS5A 3QX7A 2LBOA 4IRDA 1YZ7A 4NY8A 5FP0A 7ICTA 2BPFA 1JIHA 4O5KA 2K8BB 4OD0A 4DWIA 4OJOA 3BS7A 3LWLA 3TARA 3DDHA 5DQIA 3SR6A 9ICEA 2HHVA 4UASA 1UHUA 1LV5A 2W8KA 1M6YA 5ALTA 1X9XA 3DEEA 3J81j 5ALPA 7ICMA 4QWBA 7ICFA 1S0VA 4M47A 4UARA 2KVCA 2F8LA 1DGJA 4QWDA 4CDGA 4J9SA 2ZIXA 1XNSA 1WWVA 1DOQA 1SGGA 2BR0A 1URJA 5EE3A 1K1QA 4J9PA 1LKYB 3M8RA 1TKDA 1MQ2A 4Q8EA
chains in the Genus database with same CATH topology
2DUYA 4UB8U 5KAIU 3WU2U 1S5LU 4IL6U 5E79U 3KZIU 5GTIU 4PJ0U 5KAFU 5B66U 4UB6U 5B5EU 3A0BU 5H2FU 5TISU 2AXTU 5GTHU 3A0HU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUY A;  4UB8 U;  5KAI U;  3WU2 U;  1S5L U;  4IL6 U;  5E79 U;  3KZI U;  5GTI U;  4PJ0 U;  5KAF U;  5B66 U;  4UB6 U;  5B5E U;  3A0B U;  5H2F U;  5TIS U;  2AXT U;  5GTH U;  3A0H U; 
#chains in the Genus database with same CATH topology
 4RQM A;  1NKB A;  3H0M B;  4YXM A;  2IA6 A;  2YX8 A;  2ES6 A;  4RQ0 A;  4IRC A;  2FPK A;  3WKB A;  1V9P A;  1P7D A;  5AI4 A;  2WHE A;  3B0X A;  3R9K A;  2ASL A;  1ZQP A;  2E1F A;  2CXY A;  3TAQ A;  3HIL A;  4Y2T A;  4KMU A;  3HX0 A;  3QEB Z;  5KL8 B;  1CEZ A;  4DQQ A;  2KTQ A;  2JMG A;  1U47 A;  3I76 A;  4BXO A;  4ECU A;  1PK3 A;  3GIJ A;  2EAP A;  2ZIV B;  3AQF A;  2W3R A;  3UQ2 A;  3KTQ A;  9ICS A;  4M9H A;  4MFA A;  2PMZ F;  4OJ6 A;  2KK0 A;  5DGA A;  4QW8 A;  2YMQ A;  5G5G A;  2XGQ A;  2FMQ A;  2WAQ F;  1ZQQ A;  4DCC A;  3QXG A;  4YMO A;  5KFE A;  2KZZ A;  3MR6 A;  2XVT A;  2LI6 A;  2FI1 A;  5KT4 A;  3IV6 A;  2VA2 A;  3NTU A;  5KFU A;  2VKQ A;  4PPX A;  2KJ9 A;  4M2Y A;  3UXN A;  5DKW A;  5AKX A;  5AKY A;  4NWI A;  8ICI A;  2LYH A;  4IC9 A;  3GIL A;  4TQS A;  4QIW C;  1FO4 A;  4CGZ A;  1QSY A;  4MFF A;  3Q8P B;  2NV3 A;  5KFI A;  4UAY A;  5CEH A;  3OHA A;  3BQ2 A;  2WFA A;  1F44 A;  3N7R C;  4M04 A;  3OJU A;  1V97 A;  1NOM A;  2DL0 A;  5KG6 A;  2Y9T A;  4NLB A;  1SZH A;  5AM5 A;  2KE7 A;  2WF8 A;  1S10 A;  5KFS A;  4PL2 A;  5AM3 A;  3HKZ C;  4KLJ A;  3ISB A;  2R8H A;  2OHF A;  4RUA A;  5JUM A;  1PK1 A;  2MU2 A;  5EWF A;  4KN4 A;  4OJP A;  1RXW A;  5KFO A;  2W11 A;  5ALQ A;  2FMP A;  3M9O B;  4DFJ A;  1BNO A;  1HUZ A;  5KFN A;  3K75 D;  1RQN A;  3QNM A;  5J8Y A;  1RG6 A;  2M0N A;  4Y2Q A;  2JRZ A;  1RYR A;  1XSN A;  3G6V A;  4BGD A;  2CRX A;  4P0P B;  4Z6E A;  3HPO A;  2QAR A;  5B5E U;  3RH5 A;  1KN5 A;  3CNH A;  3GQC A;  5TIS U;  4GXJ A;  1CUK A;  4FE3 A;  2ZTD A;  8ICH A;  3UMC A;  4ELV A;  2PFN A;  4GXK A;  1TAM A;  3MFI A;  4FFD A;  3LWM A;  3PSP A;  1Z4O A;  4XUS A;  1QTM A;  2W55 A;  4LZG A;  3UXP A;  2XY5 A;  3OJS A;  2ZUC A;  4NL9 C;  3BQ0 A;  4F5Q A;  4MF2 A;  3MGI A;  5ALZ A;  3UXO A;  3EPI A;  2LPE A;  3ISD A;  2AQ0 A;  4DFK A;  5L1L A;  4ECQ A;  5KFR A;  1NK0 A;  2IOH A;  2WF9 A;  2F8K A;  3TAD C;  2KIW A;  5KFW A;  4RQ7 A;  5KTQ A;  3C23 A;  3WK4 A;  5B66 U;  7ICR A;  7ICN A;  1Z19 A;  1KTQ A;  5AM1 A;  3PX0 A;  1RYS A;  1KDH A;  4CCH A;  3T79 A;  3H0R B;  3BQT A;  3NGD A;  1QSS A;  2MUT A;  3GIK A;  4EBD A;  4MFC A;  5C0Y A;  3LVW A;  2A1A A;  1J2M A;  1IM4 A;  4EYH B;  3C28 A;  1U9L A;  4BJQ A;  5KG1 A;  4F4Y A;  5H2F U;  2V9W A;  3PML A;  4DOA A;  2RQ5 A;  4P0Q A;  3KFU F;  3DV9 A;  1L7M A;  4C8K A;  5KNI A;  9ICU A;  3M8S A;  4KLG A;  7ICV A;  2E8N A;  2DQN B;  1ZQB A;  3MGH A;  3OGU A;  1NK7 A;  3WK8 A;  3QUC A;  5KFZ A;  4YXJ A;  4IL6 U;  4M9J A;  4RQ4 A;  4UQG A;  2KVS A;  9ICG A;  4UB4 A;  5GTI U;  1T7P A;  2HBM A;  5EE0 A;  4OJ5 A;  3ZDC A;  4PZO A;  2RLT A;  3PX4 A;  5ALI A;  1KSP A;  2K8C B;  4DSK A;  5J0Q A;  5CJ7 A;  1JAL A;  4UAU A;  4DSJ A;  1ZQS A;  1HEK A;  4B9N A;  1L3U A;  2W43 A;  1RQL A;  4F93 B;  4RPY A;  4ED0 A;  1JRP A;  5ALY A;  1KQQ A;  1TFR A;  4XRH A;  2PFP A;  1QQ7 A;  4BDP A;  2Y0S F;  2MSN A;  1NJW A;  1NJY A;  2ZUB A;  2PKE A;  5KFB A;  4CNQ A;  5IIO A;  2ZJ5 A;  2OYY A;  2HVI A;  3NRW A;  4DSE A;  3HWT A;  1L5U A;  3IN5 A;  3C21 A;  4UAT A;  4KIT B;  5ALL A;  3ISC A;  1GO3 F;  4ECR A;  2RP5 A;  2IOF A;  3NVY A;  4C4T A;  1N60 A;  2AXT U;  1NNL A;  2UVV A;  2ZIW B;  3OSP A;  4UB2 A;  1QQ6 A;  4QZE A;  3RR8 A;  1ZQZ A;  3M1Y A;  2FLP A;  1T3N A;  8ICM A;  3T5J A;  1S0N A;  1XS9 D;  1ARO P;  4ECZ A;  2DPJ A;  2RDI A;  3SAF A;  3CYM A;  2Y1I A;  2ATL A;  2VIX A;  3PR5 B;  4Y2X A;  4M6W A;  2KMD A;  2HBL A;  3T3F A;  2OXO A;  1WCL A;  3QUB A;  4MF8 A;  2XC9 A;  2RHF A;  3IG8 A;  1S76 D;  5CWR A;  4UBB A;  1S8O A;  3H40 A;  2FDR A;  4ED8 A;  3ZDA A;  4AP9 A;  4FBU A;  5K4L A;  4KLM A;  4PHP A;  9ICH A;  4ELT A;  2KV2 A;  2B21 A;  5AKI A;  1YT3 A;  1D8Y A;  1NZB A;  2JEJ A;  1NJZ A;  2H3Z A;  4BXO B;  1K5O A;  4F4W A;  2V4R A;  3V7J A;  4Z6C A;  2C22 A;  3WKA A;  2HOI A;  7ICO A;  4P4O A;  2E5S A;  5DBB A;  4R66 A;  2XIC A;  2H3Q A;  2KKV A;  4CRX A;  3NVV A;  1D9F A;  2QLT A;  2BQR A;  4Y2S A;  2W9C B;  4UW9 A;  5JRT A;  4TUQ A;  2W9B A;  1ZJM A;  3ZDE A;  3VC8 A;  5AK5 A;  3F5A A;  2WF6 A;  8ICR A;  3AU6 A;  2JV3 A;  3WKE A;  5DB8 A;  2NRV A;  1Z00 A;  3QU9 A;  1Q3U A;  1SXE A;  1V85 A;  4QZG A;  4KLU A;  3N97 B;  3MDA A;  3PY8 A;  2QB0 B;  2HMX A;  5GTH U;  2AQ4 A;  4DL5 A;  3RJE A;  5J0R A;  2ZJA A;  3ZI4 A;  3RBD A;  7ICS A;  5ALE A;  5ALR A;  3PST A;  2OCE A;  1X9M A;  2E8O A;  3ZD8 A;  1NK6 A;  2NRW A;  2WB1 C;  3C1Z A;  3OPX A;  5ALW A;  3TAP A;  4LVS A;  4PH5 A;  2C2R A;  1ZQU A;  4EX7 A;  2HDO A;  4UB5 A;  4R64 A;  1PK1 B;  4KX3 A;  5IIM A;  4DSL A;  4O3N A;  1BPD A;  4Y2J A;  3B9J A;  5KFL A;  2W3S A;  2KG5 A;  2KHQ A;  5DB9 A;  9ICX A;  4I2E A;  5L1M A;  3C5F A;  3JPT A;  3PSI A;  4YG2 A;  2IHM A;  4M9N A;  5HHH A;  4IQV A;  1BGX T;  3KD3 A;  2PFQ A;  4ICA A;  4ED6 A;  2C2D A;  4B9M A;  2EZZ A;  2O6K A;  1X9W A;  4FO6 A;  1QH9 A;  5KFK A;  3SYZ A;  3LDA A;  3L5K A;  3LK9 A;  2HOQ A;  3QE9 Y;  4ED1 A;  2F1I A;  1SL0 A;  2KOB A;  1ZQX A;  2BCU A;  8ICQ A;  4UB3 A;  4RQ1 A;  4USA A;  2JEF A;  2JH7 A;  1L8O A;  5DDM A;  5IIK A;  4C8O A;  5ALJ A;  3MAB A;  1CRX A;  2A1J B;  4FZN A;  1RM6 C;  2YB1 A;  3K4G A;  4EEK A;  2BKE A;  1KFT A;  5AK3 A;  1KRP A;  3ZDD A;  2KSO A;  2H5X A;  3PW5 A;  3HT3 A;  1JXE A;  1JMS A;  4F8R A;  4G3I A;  2HHU A;  1N63 A;  1S77 D;  1ZD5 A;  3QU2 A;  4RNO A;  4YD2 A;  2BQU A;  2BCS A;  4I2B A;  4QJF B;  2Z7J A;  5DDY A;  4NJ8 A;  5F9N A;  5ALF A;  1VLB A;  4RQ8 A;  3ZDB A;  2EAN A;  1UA1 A;  2MA1 A;  2F77 X;  1LB2 B;  1L3T A;  3QYP A;  1MC8 A;  2JGA A;  4UB8 U;  4ECX A;  4Q45 A;  2F44 A;  4O3P A;  2GLE A;  3NVW A;  4XA5 A;  4IS7 A;  4NV0 A;  5KT3 A;  1SXD A;  4J9R A;  4ELU A;  4NXZ A;  2XY6 A;  5ALX A;  1X66 A;  1KLN A;  4KLL A;  3RJK A;  2H3F A;  4U7C A;  1WWU A;  2EQY A;  3GII A;  4IRK A;  4YFK A;  2PFO A;  1FEZ A;  4RU9 A;  4DL4 A;  3SEI A;  1S0O A;  4JWN A;  4YR2 A;  4FS2 A;  4P0Q B;  3H7I A;  4I2I A;  4C7Z A;  4PGQ A;  3RAQ A;  4C8M A;  3WKC A;  5J2C A;  1ZQH A;  5KFT A;  3FYH A;  2W9A A;  9ICT A;  1DK2 A;  2W03 A;  3IRU A;  2K4P A;  4P4P A;  4JUZ A;  1S97 A;  3RH6 A;  4QIW F;  2NRZ A;  9ICJ A;  5AKJ A;  5EOZ A;  4M9G A;  4EEY A;  2VJ4 A;  5J0T A;  4B9L A;  5KT2 A;  1JUD A;  3H0L B;  4EZ6 A;  3I1Y A;  4RZR A;  1N56 A;  4JV2 A;  3V7K A;  5KFG A;  5KFX A;  2VA3 A;  2CN1 A;  3A0B U;  2KJ8 A;  2XCA A;  1NK5 A;  2JH1 A;  2J6S A;  4Y2P A;  1BPX A;  5CR0 A;  2WTF A;  2KZ3 A;  1TK0 A;  3HKZ F;  7ICE A;  3ETL A;  3JPO A;  1PZN A;  7ICG A;  4EBC A;  1D8L A;  1PVQ A;  4TUR A;  5AKK A;  2YB4 A;  5DB7 A;  3C2K A;  1D9D A;  2KIC A;  1XO0 A;  1KFD A;  2JZB A;  5CHG A;  2RDJ A;  3EYZ A;  3AU2 A;  1X2I A;  1DXS A;  1DGS A;  4DFD A;  4F2R A;  4KLQ A;  5D46 A;  2F3N A;  5ALS A;  4PJ0 U;  3V72 A;  4RQ2 A;  5J2F A;  3PV8 A;  3WKD A;  4IQU A;  1JRO A;  3KKA A;  4RQ3 A;  5F9L A;  3NAS A;  3H4B A;  7ICU A;  4O5E A;  5DGB A;  4DQS A;  3N7P D;  4YMM A;  1L7P A;  2E8M A;  2HBJ A;  5E79 U;  1L3V A;  1N48 A;  7ICI A;  2KNJ A;  4ECT A;  4Y2V A;  2NYV A;  1ZQG A;  3C2M A;  3PMN A;  2XCP A;  3RB6 A;  2K8A A;  4QWE A;  5IIN A;  3JPR A;  4F71 A;  4DO9 A;  9ICK A;  2K4E A;  4JV1 A;  4B6J A;  3F2D A;  5KT6 A;  1IV8 A;  2HHS A;  1ZQY A;  3PNC A;  4I29 A;  5HP4 A;  4RNN A;  3KHH A;  4R8U B;  3H8W A;  8ICT A;  5AIB A;  2NRT A;  2BHN A;  2LYA A;  5A0L A;  4EEL A;  4M0A A;  5AI6 A;  1IXR A;  1L7O A;  1ZQV A;  2FPL A;  2W9M A;  3NVZ A;  3OTQ A;  2HHX A;  4DL3 A;  2W9B B;  1SKW A;  2HVH A;  2BCQ A;  4BWM A;  8ICZ A;  2GH1 A;  4K4H A;  1KW4 A;  4YP3 A;  3RRG A;  3SI8 A;  4LJX A;  2FLN A;  3AUO A;  4UBC A;  3PR4 A;  2CPR A;  2VAN A;  2E3T A;  2KHV A;  1F0M A;  4DOC A;  5ALD A;  5L1I A;  4FBT A;  2KP7 A;  1NK9 A;  1ZQC A;  4GXI A;  2YY6 A;  2L5Y A;  2P6R A;  3QEA Z;  3GU3 A;  1X9S A;  1S5L U;  1HIW A;  4M9L A;  3E2E A;  4YMN A;  4Q8F A;  5AM4 A;  4IR1 A;  5AM2 A;  3RFA A;  4UAV A;  3MR5 A;  1MN8 A;  3UMG A;  4C0Z A;  1QQ5 A;  2XY7 A;  2ALZ A;  1SKS A;  4Q43 A;  3CP8 A;  8ICF A;  2HI0 A;  4DFM A;  1C7Y A;  4KTQ A;  3BQ1 A;  1UA0 A;  3SZ2 A;  4ED2 A;  1U45 A;  2Q0Z X;  3PVX A;  5ALK A;  2YML A;  3H8J A;  3TFR A;  1RPL A;  2AU0 A;  2P35 A;  3I28 A;  8ICV A;  3PW2 A;  4R65 A;  1MQ3 A;  1SKR A;  5DQG A;  1L8L A;  4C8N A;  4KLD A;  1SV4 A;  4C80 A;  1X42 A;  2A19 A;  8ICB A;  4EX6 A;  2IHN A;  1PVR A;  3IM1 A;  8ICG A;  2YQE A;  5AI9 A;  1OUQ A;  1TAU A;  3RBE A;  3Q8Q B;  1LKY A;  4ZH4 A;  4ECY A;  1MSW D;  2GO7 A;  2EZX A;  3ONN A;  5AK4 A;  1ZQI A;  2ZIU B;  2R8J A;  3V6J A;  5J2D A;  3BDP A;  4QWC A;  4I27 A;  1Q46 A;  1NJX A;  3WK5 A;  2K4H A;  1L6N A;  2F76 X;  2FE9 A;  1Z3E B;  2DBY A;  3M6K A;  5J8Y C;  2LYB A;  2K60 A;  1X40 A;  3KBB A;  4K4G A;  5ALM A;  3BS5 B;  3NRZ A;  4RNM A;  1XSP A;  4EBE A;  1ZYQ A;  3V7L A;  2ODG A;  4TUS A;  1ZOL A;  3UM9 A;  2IOF K;  1UT8 A;  1Q3V A;  1FFV A;  5KFQ A;  4TUP A;  5J2I A;  4RQ5 A;  3WK9 A;  5IIJ A;  2Y9U A;  1U49 A;  4US9 A;  1YZ6 A;  2ZIV A;  4J9K A;  1ZQW A;  1LVH A;  3H4D A;  3LYS A;  5DG8 A;  3IHQ B;  3RB4 A;  3HJE A;  2J6U A;  3T5L A;  4DL6 A;  1L3S A;  5CA7 A;  3H8M A;  2XO7 A;  4K4I A;  5CB1 A;  4NLG A;  2ZIX B;  2HBK A;  4RUC A;  3PZP A;  2G0A A;  2W7O A;  4I2J A;  4C4R A;  5J2B A;  3GV7 B;  3MDC A;  3AN1 A;  2BGW A;  5ALH A;  3SQI A;  1JX4 A;  4EZ9 A;  5DG9 A;  3AL0 B;  1O08 A;  4BX9 C;  2ZXI A;  5HR6 A;  1KKX A;  2KKP A;  1U48 A;  8ICJ A;  1BNP A;  3MC1 A;  3MGV A;  2F1H A;  2GWS A;  4B9U A;  4RQN A;  2Y1J A;  1KEJ A;  5KL1 B;  2D6F C;  4DOB A;  1UCV A;  5AHX A;  1NK8 A;  1B22 A;  5ALN A;  3HRD D;  3SV4 A;  5KFY A;  5J2G A;  2Y0S C;  2I1Q A;  4I2A A;  2K4I A;  4MEY A;  3TKA A;  2NO4 A;  3ETR A;  3M9M B;  8ICY A;  3L4P A;  4DS5 A;  3V6K A;  3Q8S B;  3G6Y A;  1ED1 A;  2WB1 F;  1O03 A;  5KFD A;  4DSF A;  1NKC A;  4ECS A;  3GV8 B;  1RZT A;  2BCV A;  2JXJ A;  4QZH A;  4US8 A;  1T94 A;  5J2J A;  4QWA A;  4NLN A;  8ICN A;  1DK3 A;  9ICN A;  8ICX A;  2UVU A;  3TFS A;  4P0P A;  2XI9 A;  5CRX A;  1IG6 A;  1XU4 A;  3WU2 U;  4JV0 A;  4C4S A;  4MEX A;  2KN7 A;  4A8E A;  3G6X A;  4JWM A;  2G08 A;  1XC9 A;  1BPB A;  3EWA A;  5DLF A;  2OWO A;  1UQV A;  2V4Q A;  1A6S A;  3WK7 A;  3FC4 A;  3C1Y A;  4QZ9 A;  4P4M A;  3E58 A;  5J0W A;  2R8I A;  2UVR A;  1U4B A;  5AI8 A;  2BQ3 A;  5KT5 A;  5JU5 A;  9ICW A;  4KLF A;  5AK6 A;  2VA8 A;  4Z6D A;  2I5H A;  1ZQO A;  1ZRN A;  3EZ5 A;  4JB3 A;  2RRD A;  1T8E A;  3KHG A;  2PI5 A;  4F2S A;  9ICL A;  3BQ7 A;  2AJQ A;  3QU5 A;  1NKE A;  4J9Q A;  2C2E A;  2AH5 A;  3QU7 A;  1F5S A;  1S0M A;  2LMR A;  5J0Y A;  1ZD4 A;  1N5X A;  5DBA A;  4DLG A;  4O3O A;  4F5R A;  3KHR A;  4KLT A;  3VCB A;  1S9F A;  2QKQ A;  3AMZ A;  1VDV A;  1DRG A;  1RYU A;  4F4X A;  5AKE A;  3KHL A;  4KLI A;  3IP4 B;  3D6J A;  4YR0 A;  2HOF A;  4BWJ A;  4ZOH C;  2FPM A;  2B6G A;  2QAR B;  3CW2 C;  1HJP A;  5DLG A;  2OM6 A;  4E0D A;  1BVS A;  3IDW A;  2LHT A;  7ICQ A;  3FAH A;  4CF5 A;  2J6T A;  1IIP A;  5HML A;  1ZRM A;  5ALO A;  8ICS A;  3ED5 A;  3RJG A;  2YTU A;  4AYB C;  1Z1B A;  9ICI A;  4CF4 A;  4J9L A;  5BOM A;  3RJF A;  2ISP A;  4O3M A;  3O0F A;  4O3R A;  2ASD A;  2Q4T A;  3N7S C;  3D2Q A;  4DF8 A;  9ICM A;  3ALR A;  1QCK A;  4PL1 A;  3GV5 B;  4O3S A;  1OW5 A;  2W8L A;  3TAC B;  4DSI A;  2H3I A;  3MR3 A;  5AI0 A;  5J0S A;  4RPX A;  1Y88 A;  3JPQ A;  2UVW A;  3RJH A;  3QZ7 A;  4JK1 A;  4F50 A;  4J9N A;  3K1R B;  4EEN A;  3QZ8 A;  5AIA A;  2JR5 A;  2MUT B;  4CE6 A;  1ZQN A;  1COK A;  1SWW A;  2OH2 A;  4KLH A;  1NK4 A;  1K1S A;  3RB0 A;  5KG5 A;  4F91 B;  1X6I A;  3MBY A;  4NM1 A;  2OEH A;  2ZUD A;  4DFP A;  3OHB A;  4OCZ A;  2G07 A;  2W54 A;  3M6Z A;  4TQR A;  4YQW A;  2AGQ A;  2D3D A;  1PUZ A;  4QZC A;  5CP2 A;  7ICK A;  2ZIW A;  1TE2 A;  3F53 A;  1B4F A;  4RT3 A;  4FS1 A;  5J0U A;  8ICL A;  5EWG A;  1ZQK A;  3NUQ A;  5F3X B;  4UAW A;  4QZD A;  3C2L A;  4NM2 A;  9ICA A;  4PHD A;  4DL2 A;  4Q44 A;  3RB3 A;  4B9V A;  1WYG A;  2EZY A;  1KFS A;  2DFL A;  4PGY A;  1SV0 A;  4UB6 U;  5EWE A;  3PSF A;  1OXJ A;  4F5P A;  5AKZ A;  3SAH A;  1Q8K A;  3SV3 A;  3F2B A;  2N1R A;  5III A;  1ZQR A;  3RRH A;  3E0F A;  3OSN A;  9ICR A;  5HMM A;  3KOO A;  1WUD A;  2XID A;  8ICE A;  3RJI A;  8ICK A;  3M9N B;  3CRX A;  5AI5 A;  4NL9 A;  3EUB 2;  3EPG A;  3HP6 A;  5J2H A;  3Q8K A;  3JPN A;  1FIQ A;  2W9C A;  3F5E A;  2R8K A;  3U26 A;  5D49 A;  3UQ0 A;  2W04 A;  5HHI A;  4I2F A;  1SL1 A;  2G09 A;  1UT5 A;  3TAD A;  4O9M A;  2BZF A;  1ZQJ A;  2DKZ A;  5KFP A;  3BZC A;  3SEN A;  2PXI A;  4ED3 A;  3AM9 A;  1N61 A;  3UMB A;  4KN7 A;  2LKY A;  4RPZ A;  4YCX A;  2KD1 A;  4DF4 A;  4M6W B;  1UPH A;  4CF3 A;  2QB0 A;  2I6X A;  2DF4 B;  5AKL A;  4PGX A;  1D8B A;  4F5O A;  1WG8 A;  2LM4 A;  3EW9 A;  3N28 A;  3SAG A;  4R63 A;  4KLE A;  3F2C A;  1AQ6 A;  4I2D A;  2PMZ C;  2IBK A;  3PW7 A;  4GIB A;  2NRX A;  5J2E A;  4ED7 A;  2EDU A;  9ICV A;  1EXN A;  5KFC A;  3QUT A;  2WAQ C;  1TVA A;  4NLC A;  3QUQ A;  4I2G A;  4B9T A;  5TZV A;  1VJ5 A;  4F92 B;  3V6H A;  8ICC A;  4XQ8 A;  4FZM A;  3PO5 A;  1SWV A;  3PO4 A;  5EE9 A;  1ZQD A;  4KX5 A;  3C29 A;  5J2K A;  5KG4 A;  1X6J A;  2AGP A;  2BDP A;  5KFF A;  2MAX A;  4QZ8 A;  5KFH A;  1RDF A;  4P2H A;  3D2S A;  4Y2U A;  3MFH A;  3AEV A;  5JTI A;  1ECW A;  2BPG A;  1Z00 B;  1SZP A;  4IR9 A;  1SV0 C;  1B0X A;  4UAZ A;  4GC7 A;  1TK8 A;  2I9G A;  4KLS A;  4EYI B;  5KG3 A;  3C5G A;  5AKH A;  4F4K A;  2DPI A;  4KLO A;  3Q8M A;  3M7D A;  3THV A;  2M9N A;  5J0X A;  4RQ6 A;  1N5W A;  2XGP A;  2E8P A;  2HHT A;  8ICA A;  2A1J A;  3AQE A;  1V38 A;  2F1J A;  2ESE A;  1JN3 A;  3D2N A;  2KFZ A;  2FLL A;  4DEZ A;  5J0P A;  4KMO B;  5HR7 A;  2FJ6 A;  3SD7 A;  4O0I A;  5BOL A;  3B0Y A;  2HW3 A;  4C7Y A;  1ZQL A;  4I2C A;  4LZD A;  5BPC A;  4B9S A;  1SL2 A;  8ICU A;  3S6J A;  5DB6 A;  3MR2 A;  2WF7 A;  3IG5 A;  4DQI A;  3KZI U;  2AGO A;  1KL9 A;  4MHV A;  9ICB A;  3WK6 A;  1ZXI A;  3Q8R B;  4HAI A;  3KKA C;  2ISO A;  1B43 A;  5HNK A;  4IQW A;  5KFV A;  8ICW A;  3BZK A;  5KG7 A;  2IMW P;  3KZX A;  5L1K A;  4O3Q A;  1A0P A;  1QLN A;  1ZQ1 C;  1A76 A;  5ALG A;  4F4Z A;  5EE1 A;  4OJL A;  2A3V A;  4J9O A;  1A77 A;  4QZI A;  2HHW A;  3LVV A;  7ICJ A;  2MRL A;  3GFK B;  2AHO B;  4NLK A;  4WJ3 B;  2KZM A;  2KEY A;  2KFN A;  2WF5 A;  7ICP A;  3FDS A;  5KFA A;  2KSO B;  1BPY A;  3TQ1 A;  2P66 A;  3BJY A;  1KBU A;  1TAQ A;  4DQR A;  2LM1 A;  2BDU A;  5AIC A;  2ZXH A;  2QB1 A;  1T3Q A;  1N2X A;  5J2A A;  4YR3 A;  2ZJ8 A;  2HHQ A;  1SB3 C;  2BPC A;  4Y2R A;  1WCN A;  2ASJ A;  3K1Z A;  7ICH A;  3TI0 A;  4O5C A;  2C28 A;  1L7N A;  3GZF A;  3N4M B;  5G5H A;  1FFU A;  2R18 A;  1TK5 A;  2R8G A;  4DQP A;  9ICC A;  5KAI U;  4Z6F A;  1ZQE A;  4HYK A;  2DKX A;  2EAO A;  3Q8L A;  5KT7 A;  2FMS A;  4QZB A;  3RR7 A;  4GLX A;  5T14 A;  3ICX A;  2JEG A;  1NI3 A;  1SIJ A;  2D8C A;  4QZA A;  3PW0 A;  3ZD9 A;  9ICF A;  1ZJN A;  2EAM A;  2ZG6 A;  1ZET A;  8ICO A;  2P6U A;  2KIV A;  3UPQ A;  5IIL A;  2YMP A;  1H38 A;  2G06 A;  2E1E A;  1MA7 A;  1ZQM A;  4QW9 A;  4J03 A;  3GIM A;  5D4B A;  9ICP A;  2DUY A;  3PX6 A;  9ICO A;  4DL7 A;  4NLZ A;  3TAN A;  1T4G A;  2EH9 A;  4GFJ A;  1BPZ A;  5AM0 A;  2JEI A;  1Z1V A;  1RXV A;  1BPE A;  1J97 A;  4RT2 A;  2PI4 A;  3JPS A;  2K89 A;  4C8L A;  4F3O A;  1JI7 A;  4R8U A;  4UB1 A;  7ICL A;  2ZTC A;  4PHE A;  1ZQA A;  2JZB B;  4F72 A;  2HCF A;  3RAX A;  2YN4 A;  4FZL A;  2YMM A;  4U6P A;  3RTV A;  4PZN A;  3RF9 A;  1TV9 A;  2W7P A;  3JPP A;  5KFJ A;  1J2N A;  4DS4 A;  5ALV A;  5L9X A;  3A0H U;  2G5I B;  9ICQ A;  3PW4 A;  2VJ5 A;  4YVZ A;  8ICP A;  1N62 A;  4I2H A;  5KG0 A;  3ORY A;  2H3V A;  4ACO A;  2KJ5 A;  4ECV A;  5KFM A;  2DGZ A;  4QNL A;  4F5N A;  1ZQT A;  1QSL A;  4Y2Y A;  3T5K A;  3FM9 A;  4AYB F;  4J9M A;  1C20 A;  4OO1 J;  2GOL A;  1CI4 A;  1JXL A;  1XO1 A;  1Z4N A;  5J29 A;  5DG7 A;  1HUO A;  2HSZ A;  4DLE A;  3GDX A;  4YD1 A;  5KG2 A;  1NZP A;  2NO5 A;  1XSL A;  2B0C A;  3NS1 A;  5C5J A;  4YN4 A;  5L1J A;  5AKG A;  4BUG A;  3RH4 A;  1XWL A;  2BCR A;  2ZTE A;  1ZD3 A;  4QZF A;  4JMU A;  2G5H B;  3L3F X;  1ZQF A;  5ALU A;  5KAF U;  4GC6 A;  3H8S A;  3QU4 A;  5DQH A;  4G9B A;  2F2A B;  4IQT A;  5J0O A;  1PVP A;  4PHA A;  4I28 A;  3T5H A;  1ZD2 P;  4X5V A;  2DWQ A;  1COO A;  2ZIU A;  5DBC A;  4ECW A;  3RJJ A;  2JHD A;  3SMV A;  3HW8 A;  3BS5 A;  3QX7 A;  2LBO A;  4IRD A;  1YZ7 A;  4NY8 A;  5FP0 A;  7ICT A;  2BPF A;  1JIH A;  4O5K A;  2K8B B;  4OD0 A;  4DWI A;  4OJO A;  3BS7 A;  3LWL A;  3TAR A;  3DDH A;  5DQI A;  3SR6 A;  9ICE A;  2HHV A;  4UAS A;  1UHU A;  1LV5 A;  2W8K A;  1M6Y A;  5ALT A;  1X9X A;  3DEE A;  3J81 j;  5ALP A;  7ICM A;  4QWB A;  7ICF A;  1S0V A;  4M47 A;  4UAR A;  2KVC A;  2F8L A;  1DGJ A;  4QWD A;  4CDG A;  4J9S A;  2ZIX A;  1XNS A;  1WWV A;  1DOQ A;  1SGG A;  2BR0 A;  1URJ A;  5EE3 A;  1K1Q A;  4J9P A;  1LKY B;  3M8R A;  1TKD A;  1MQ2 A;  4Q8E A; 
#chains in the Genus database with same CATH homology
 2DUY A;  4UB8 U;  5KAI U;  3WU2 U;  1S5L U;  4IL6 U;  5E79 U;  3KZI U;  5GTI U;  4PJ0 U;  5KAF U;  5B66 U;  4UB6 U;  5B5E U;  3A0B U;  5H2F U;  5TIS U;  2AXT U;  5GTH U;  3A0H U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...