5GTHU

Native xfel structure of photosystem ii (dark dataset)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 29
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gthU01
5KAFU 3A0HU 5KAIU 3KZIU 4UB6U 5GTHU 4IL6U 5B5EU 4PJ0U 2DUYA 4UB8U 2AXTU 3WU2U 5B66U 5E79U 5H2FU 5GTIU 3A0BU 5TISU 1S5LU
chains in the Genus database with same CATH superfamily
2ISPA 5AKIA 5J0TA 5BOMA 4UB6U 4CF4A 1T7PA 1B0XA 2FPKA 3JPSA 3KKAA 2KIVA 2EAPA 5CJ7A 5DGAA 1S0VA 2JZBB 2F3NA 3JPOA 4QWEA 1J97A 5J2EA 3EW9A 2EAMA 1HIWA 3ISCA 1RM6C 3SAHA 4RQ8A 3FYHA 2WF8A 2IHNA 1N2XA 4NXZA 4YFKA 1L6NA 9ICCA 2JMGA 1RDFA 3B0XA 5GTIU 2EZXA 4UB4A 4FO6A 3WK5A 3D2NA 3C29A 1WCNA 3LK9A 5KFNA 3QEBZ 5DBAA 1P7DA 5DG9A 2BCRA 3PSIA 5AK5A 5AK3A 2ZXHA 4NL9A 3F2CA 4O3MA 4ED2A 5KT4A 3I76A 4RPZA 1O03A 2NRWA 5KFQA 5J0PA 1ZQBA 5KAFU 2P6UA 3TAQA 3ZDAA 2I6XA 4GIBA 5ALYA 3PO5A 2PMZC 4EX6A 1IXRA 5EE3A 8ICHA 2JRZA 9ICEA 4YD1A 2W8KA 2BR0A 1ED1A 4DSLA 2AHOB 5D46A 4ECSA 1WG8A 2E3TA 5FP0A 3KHHA 2K8BB 4KLUA 1ZQXA 4Y2JA 3LWMA 1QSLA 2R8KA 3JPTA 3CRXA 5ALHA 1ECWA 4C0ZA 2RP5A 3K1ZA 2R18A 3UXOA 1Z4OA 2KZ3A 3I1YA 1T3NA 1NKEA 1RYRA 2KKVA 3IDWA 5KFOA 9ICOA 2JEJA 4KLJA 2V4RA 1NI3A 1URJA 4DSIA 3MGVA 3ED5A 4BXOA 3RH4A 4YR3A 8ICVA 8ICTA 2VA8A 4Y2SA 1ZQTA 2EAOA 2LYHA 1KW4A 2XY6A 4QZHA 8ICQA 3PSPA 4B9TA 3Q8KA 1ZQOA 4KX5A 1BPXA 2RQ5A 3HW8A 5CR0A 3GV5B 4KLFA 1VJ5A 4PL2A 4FZMA 4DQPA 3QUTA 4ED8A 3RJHA 2J6SA 3EPGA 4J9PA 5ALMA 4FZLA 1KN5A 1MQ3A 1X2IA 2M9NA 5KG2A 1JMSA 4C4SA 1ZQLA 1NK9A 1K5OA 5J2AA 4ICAA 3ORYA 3H4DA 2IBKA 4J9KA 4Z6EA 2C2RA 1B4FA 2FI1A 1FEZA 5KT5A 2L5YA 4M6WA 4MEXA 4Q8FA 2NO4A 2A19A 1WYGA 4NLGA 3BS5B 1UT8A 1ZQYA 2N1RA 1S8OA 5AM2A 3KFUF 4DSEA 5ALNA 3OTQA 2VJ5A 4TUPA 5G5HA 7ICJA 3PMLA 2BQRA 1BNOA 5DQGA 1A6SA 4NLKA 2MU2A 5AI6A 4EBEA 4IRKA 5L9XA 2W9AA 5J2DA 3AU2A 5DLGA 3F2BA 3WKBA 1S5LU 5J8YA 5KFBA 5J2GA 1ZQGA 3N7RC 4ZH4A 4FZNA 4ELTA 9ICSA 4OCZA 2YN4A 5CEHA 4TUSA 4I2AA 1VDVA 5C0YA 5KT7A 2BGWA 2DUYA 3EZ5A 4DL7A 5CA7A 3MFHA 1SKSA 5J29A 5KT3A 4IR1A 2FMQA 4RQ0A 4F5OA 5KFPA 2K4EA 2IOFK 2KK0A 2R8IA 5ALJA 4I2EA 5KTQA 4QWDA 1SZHA 4F5RA 2RLTA 3RAXA 5J0QA 5K4LA 4Y2UA 5AI5A 2PI4A 2M0NA 3UMCA 1PVQA 3ZDBA 5AKKA 5AI8A 2HSZA 4CE6A 5KFEA 5AHXA 3C21A 3AQEA 4M2YA 2B6GA 2IOHA 2V9WA 5ALOA 1SKRA 2WB1F 2E5SA 4BUGA 5A0LA 4K4GA 1SV4A 5DDYA 4LJXA 3MDCA 1A0PA 2ZUCA 3ETRA 5CHGA 3OSPA 2MUTB 4O3QA 4F3OA 4DS5A 2ZTCA 2OCEA 5J2HA 5AIBA 4P4OA 1LV5A 4K4IA 2LMRA 4AYBC 2UVVA 3NVZA 4KLIA 2IOFA 1SXEA 4DWIA 2D6FC 2V4QA 1ZQRA 2IA6A 3EYZA 2JEGA 4JK1A 3C1YA 3QU9A 9ICJA 5J0WA 4MFCA 7ICLA 2KVSA 5KL1B 4B9NA 4KLTA 1NK8A 1PVRA 7ICEA 4ECTA 3GIJA 3RJFA 3DV9A 3PV8A 3T5LA 1HJPA 4PHPA 4RQ2A 4IQUA 1ZQAA 3OJSA 4K4HA 4F91B 4DL2A 4NM1A 1RZTA 3RTVA 3F53A 4DLEA 4E0DA 2WHEA 2HOIA 1RYUA 4BX9C 2BCUA 4J9NA 2YTUA 2HHSA 1JUDA 1N48A 4O3OA 1TAQA 2DKZA 1NKBA 4P4MA 4EZ6A 1NK6A 5CRXA 1KFTA 3NGDA 4LZGA 2W03A 1DOQA 4FFDA 2F2AB 3BZCA 3AMZA 2HBLA 2CRXA 4RQMA 3IM1A 7ICGA 2E1EA 4J9MA 5AM0A 3DDHA 2PMZF 3C23A 3SAGA 2I9GA 2AGQA 3V6HA 2H3FA 4B9SA 4IQWA 1ZQSA 4M9GA 1ZYQA 3SEIA 1RXVA 3GIIA 7ICVA 2FJ6A 1U4BA 4P0PB 1BGXT 8ICLA 4QZGA 2RHFA 7ICHA 4DLGA 4LZDA 1L7OA 3PR4A 4C4TA 5DBBA 3RH6A 3HKZC 4ECXA 3RB0A 3RR8A 2FE9A 4UBBA 1XO1A 4WJ3B 2IHMA 4NLCA 1DRGA 3WKDA 2UVRA 4Q45A 4DFDA 3PY8A 3B0YA 4DQSA 1S0OA 5F9LA 4UB8U 3SAFA 2DPIA 1XWLA 4YQWA 3N28A 1N63A 3THVA 2ASJA 4RQ5A 3Q8LA 3BQ7A 2WF9A 3QZ8A 3RJGA 4RU9A 4KN7A 3K75D 3GIKA 3SQIA 3GV7B 3M6ZA 4M9LA 3RR7A 3V7KA 4FS2A 5DG7A 1U48A 2JEIA 1QTMA 1OXJA 4QZDA 4O3RA 8ICUA 1ZQDA 4DFPA 5BOLA 1ZQEA 2QLTA 3ZI4A 4YD2A 5HNKA 4OJPA 4F4ZA 4GC6A 5DQHA 2BQ3A 2XY5A 4KLMA 2NO5A 2OM6A 3GZFA 4JV0A 4YG2A 3BDPA 3JPPA 3H0RB 2JGAA 1IM4A 4GFJA 5D4BA 3FAHA 4RQ6A 3E58A 2EDUA 4I2DA 3CP8A 1ZD2P 4UAZA 1XS9D 1N56A 1KSPA 1N62A 1Z00B 5ALPA 2KZZA 4NLBA 1X6JA 4J9OA 4YXMA 2R8GA 3GIMA 3IP4B 3N97B 1L7MA 2XGQA 4B9UA 3H0MB 3RB4A 5DKWA 5J2BA 5KFFA 2HHWA 5ALZA 3U26A 4O3PA 2F1JA 4OD0A 4PZNA 5AKZA 4I2BA 3WKEA 5JTIA 4AP9A 2EZZA 3UXPA 1BNPA 1X9WA 5DQIA 4C4RA 3Q8PB 2CN1A 1YZ6A 2KSOA 4Z6CA 3TADA 3TFRA 2C28A 3G6YA 2F44A 1GO3F 2O6KA 4FS1A 2F77X 3QU4A 4DL3A 4F50A 5KG7A 2BCSA 2NRTA 3H4BA 3C2KA 1NK5A 4C8KA 1L3VA 2F8LA 3T5JA 3QEAZ 2ZIXB 3MBYA 2KFZA 5JUMA 2YY6A 7ICNA 5D49A 1ZJMA 1Z00A 5KFXA 5KNIA 1NKCA 5AKYA 3H7IA 1Q46A 1T4GA 3M9NB 3TANA 3MFIA 3IG5A 4YR2A 1S97A 2ZIWB 2OEHA 5L1KA 4RUAA 1KDHA 4ECRA 8ICPA 2FPMA 5EE9A 4F5PA 2HCFA 1ZQVA 3B9JA 4O9MA 1FO4A 5ALIA 2BCVA 2JZBA 4TUQA 1FIQA 4YMNA 4EBDA 2Y9TA 4EBCA 1NK0A 4I2CA 3UM9A 4F5NA 2KZMA 3H8MA 4F72A 1H38A 4AYBF 5DB8A 4J9RA 3NRWA 2KP7A 4PGYA 1L3UA 3NUQA 2H3IA 1COOA 3AQFA 4Y2VA 3PNCA 2FLPA 1C20A 3PW2A 9ICPA 3T3FA 2HBKA 1RQLA 4YCXA 3ZD9A 1SGGA 5AI4A 5KG3A 1LKYB 2HHVA 4FE3A 5HP4A 2BPFA 5J0SA 5KFGA 1NK7A 4YMMA 1CRXA 3E0FA 4QZCA 8ICJA 2AJQA 2BCQA 4TURA 2NV3A 4DF4A 2ZIWA 1X9MA 9ICWA 2W43A 3VCBA 5J2FA 4NM2A 2K8AA 1U9LA 2EZYA 4M47A 1BPBA 4R66A 2P66A 3M9OB 1T8EA 4KITB 3ETLA 2BQUA 2G5HB 3M8RA 4NLNA 3OGUA 2YX8A 1KEJA 2I5HA 3TQ1A 1SL1A 5KT2A 2W3SA 4IS7A 5ALSA 4C7ZA 2F1HA 3TFSA 5IINA 2CXYA 5EWEA 1LB2B 4P4PA 3QYPA 5EE0A 1QCKA 4F4YA 1MA7A 5F9NA 5L1JA 1UPHA 1ZQCA 3PW7A 5AICA 2BDPA 3D2QA 4ECYA 5DB6A 4P2HA 4YR0A 1B43A 1YT3A 2W9MA 3L3FX 2AGPA 4KLDA 3PW4A 1TV9A 2KJ9A 4QZ8A 2W54A 4IRDA 4GXKA 2ZIVB 4UARA 3RBDA 1Z3EB 3V6KA 2KHQA 8ICXA 3GV8B 5KG0A 1L8OA 3QUQA 2AU0A 5ALEA 3T79A 4QZBA 3MGIA 2QB0B 1SV0C 3V72A 1HUZA 4BDPA 4UB5A 2HHXA 2OYYA 2YMPA 3VC8A 3KOOA 1RXWA 3EUB2 5C5JA 3H0LB 3HKZF 4RT3A 3RBEA 1KFDA 2PFOA 3GILA 4EEKA 1Y88A 1U45A 7ICIA 1QH9A 3QU5A 1HUOA 3PZPA 3N4MB 4HAIA 4CCHA 8ICEA 3PX6A 2KN7A 1Q3VA 4RNOA 5KAIU 2HI0A 3PX0A 4EX7A 1ZQKA 4CDGA 4QJFB 4YMOA 1V85A 2R8HA 4Y2RA 3M7DA 3PO4A 4HYKA 4EYHB 4GXIA 2ZIVA 2WF6A 2XO7A 2XCPA 3M6KA 1XSPA 4O5EA 5KG1A 3UMGA 4Y2YA 4G9BA 9ICQA 5ALGA 2DF4B 2A3VA 3BS5A 4YXJA 3C5FA 2VANA 4RQ7A 1L7NA 3C28A 4US9A 2H3QA 2ES6A 4RPXA 7ICRA 2XI9A 3SR6A 2GOLA 2LPEA 2YMMA 3WK7A 5IIMA 5EWFA 1V38A 4R8UB 4EEYA 1X40A 4Y2TA 1V97A 2HOQA 3SYZA 1AQ6A 4C80A 2HBJA 4I2IA 1DGSA 2MA1A 1AROP 1JRPA 5KFWA 2G5IB 3QE9Y 4KLHA 3D2SA 4J9SA 1IIPA 3WK4A 4TQSA 3UPQA 3UQ2A 9ICBA 3PX4A 4RUCA 5KFHA 9ICNA 3RJEA 2PXIA 4O5CA 2LBOA 1NJZA 2W11A 8ICGA 2HDOA 1PK1B 4ED1A 1ZD4A 3KHLA 4NWIA 1OW5A 1NZPA 3SZ2A 3KHRA 5H2FU 3ZD8A 4J9LA 2HVIA 3DEEA 3IRUA 1BPEA 3RJIA 2FDRA 4QIWC 5ALRA 4R8UA 5KL8B 2QARB 4LVSA 4IQTA 1BPZA 4O3NA 2LI6A 4A8EA 1L3TA 1HEKA 5AM5A 3Q8QB 3K1RB 9ICIA 3NVVA 2KJ5A 2R8JA 2W9CB 3RAQA 7ICSA 3QNMA 1K1SA 1ZD3A 2W3RA 2MUTA 2W55A 5GTHU 3UMBA 4F5QA 4P0QB 9ICFA 3ISBA 2RDIA 3BS7A 2ESEA 4B9MA 3RJKA 3SI8A 1TKDA 2ZJ5A 5DB7A 2KNJA 4PZOA 3HT3A 4ELVA 3FC4A 2DGZA 4JB3A 5AKGA 4X5VA 4JWNA 3F2DA 1UQVA 4TQRA 4M9HA 5BPCA 3JPNA 1QQ7A 5AIAA 2G06A 1KTQA 5J0UA 2DKXA 9ICVA 1XSLA 5AM3A 2YB1A 4C8OA 2KIWA 2QARA 5DG8A 3M9MB 4IC9A 1SZPA 2JXJA 2K60A 3F5AA 1S0NA 4KLEA 1CEZA 3G6XA 1COKA 2FPLA 1TAMA 3AUOA 1XSNA 3HWTA 2VIXA 2C22A 2HHTA 1X66A 4MFAA 2W9CA 4JV1A 3LVWA 4OJLA 2F8KA 2W04A 4YN4A 4KLSA 3GU3A 4DQQA 2ISOA 5JU5A 1T94A 1RPLA 8ICOA 4I2GA 3CW2C 4KMOB 5L1LA 2AH5A 3OPXA 2ALZA 1UCVA 4I27A 4O3SA 3T5HA 2H3ZA 1CUKA 1K1QA 5AM4A 2ZG6A 2KICA 9ICAA 2ZJAA 3QX7A 7ICQA 3H8SA 7ICKA 4I2HA 4FBUA 1Z1BA 3MGHA 3T5KA 1RYSA 4F2SA 3MDAA 4CF5A 4ZOHC 5G5GA 1ZQWA 3WU2U 3QU2A 5AKLA 1ZQHA 8ICRA 4ELUA 4BWJA 2ODGA 5DGBA 1RG6A 2ZIUB 1SWWA 3HJEA 9ICXA 4RQ4A 5IILA 7ICMA 4UAWA 5KFDA 3ZDDA 4Z6DA 4R64A 2KEYA 3C5GA 3S6JA 5DDMA 2C2DA 8ICYA 3NTUA 3BQ2A 1UHUA 1JI7A 2Y0SC 1IG6A 4NL9C 1DGJA 2DFLA 2W9BB 5EWGA 2D8CA 1X9XA 2K89A 3SV4A 3RJJA 4P0PA 5ALUA 5EE1A 4DL6A 1QQ6A 3JPRA 4DSJA 4DF8A 4C8MA 4M9JA 3LYSA 2HHQA 1ZXIA 4DFMA 2E8NA 4F4XA 4UQGA 3BQ0A 4DSFA 3RB3A 5KFMA 2ZUBA 4JMUA 4DS4A 3AEVA 2AQ0A 2MSNA 2JH1A 3A0BU 1LVHA 2ZXIA 2HW3A 4EELA 4F93B 4PGQA 2YMLA 5KFJA 7ICPA 4DO9A 3M8SA 1FFVA 3G6VA 8ICSA 2HMXA 2AXTU 3KBBA 3PVXA 3IV6A 2RDJA 3CYMA 3OHAA 2ZUDA 5AKHA 3HPOA 3MR6A 2KTQA 3C1ZA 1DXSA 2LYAA 4USAA 5AKXA 5IIOA 1MC8A 4GXJA 8ICZA 4I29A 4RT2A 3IHQB 3L5KA 5IIJA 4PGXA 3RRGA 1D8YA 5DBCA 1N60A 4J9QA 1F0MA 5E79U 3GQCA 1Q3UA 3WKAA 4RNMA 2E1FA 2XICA 3M1YA 1BVSA 1U47A 5T14A 4B9LA 5EOZA 1WWVA 1KBUA 4IL6U 2BKEA 2QKQA 5B5EU 5KFLA 1J2NA 3MC1A 1L8LA 4DQIA 4B9VA 4G3IA 1ZJNA 5J2CA 7ICTA 1TE2A 1ZD5A 3FM9A 3RB6A 1TK0A 3L4PA 4I2FA 1ZQZA 2Q0ZX 5KT6A 2Z7JA 3BQ1A 2DL0A 1F44A 4UB3A 8ICIA 3WK8A 3HP6A 1BPYA 2JH7A 4US8A 2XGPA 4Y2QA 5J0OA 1L3SA 2VA2A 5ALVA 4UB2A 4O0IA 4J03A 3QU7A 2D3DA 2MRLA 5DB9A 2ZJ8A 2G0AA 5HMLA 1QQ5A 2NRXA 3C2MA 1QSYA 2KOBA 2DPJA 4QWAA 4ED6A 2BPCA 1NZBA 3K4GA 4EENA 8ICMA 4PL1A 3Q8MA 1NOMA 4QNLA 5AI0A 3AL0B 4Y2PA 4C7YA 1MSWD 1L7PA 3LVVA 4BXOB 1D8BA 4ED0A 1ZQNA 1D9FA 4NV0A 2J6TA 5J8YC 3PW5A 2F1IA 2UVWA 5HR6A 4I2JA 8ICAA 3KD3A 2WAQC 1ZQUA 2ZIXA 1L5UA 2NRVA 3E2EA 4KLOA 4QIWF 1UA0A 5ALLA 4XA5A 4UATA 3SMVA 4PHDA 2IMWP 2W8LA 3WK6A 1TFRA 2OHFA 2W7OA 2FMSA 4F92B 4ECVA 2EH9A 2BHNA 1Z1VA 4QZIA 3QUCA 1N61A 1DK2A 4EYIB 1BPDA 3SD7A 1ZQQA 1S77D 9ICTA 2G08A 5KG6A 3KHGA 4OO1J 5CWRA 2JEFA 1ZQFA 4F2RA 4I28A 2J6UA 5AI9A 1QLNA 4O5KA 1IV8A 4OJOA 4MF2A 4QW8A 2JV3A 2BDUA 3WK9A 3LWLA 4RQNA 5L1MA 4R63A 4U6PA 3ISDA 3AU6A 2UVUA 4M6WB 2F76X 2DBYA 1JXLA 4JWMA 2OH2A 2G09A 1LKYA 4UBCA 1C7YA 2YB4A 2B0CA 5J0YA 1A77A 5AK4A 1U49A 4B6JA 2JR5A 1SL0A 4DQRA 9ICKA 1V9PA 4QZ9A 4QZEA 4M9NA 3TKAA 2AGOA 1ZQJA 4R65A 3ZDCA 2W7PA 4MF8A 5KFVA 2Y1JA 1KRPA 4F8RA 4UAVA 3OJUA 3Q8SB 2P35A 4PHAA 5KFYA 2XC9A 5KFKA 4RPYA 5ALFA 2I1QA 3NASA 4ECZA 2VA3A 1D9DA 5KFUA 4DFJA 9ICLA 2K4PA 5IIKA 4DOAA 3F5EA 4MEYA 3MR3A 1J2MA 4CF3A 2KV2A 1JX4A 3OHBA 2ZTEA 4RQ1A 4EZ9A 2H5XA 1NK4A 3J81j 2H3VA 2P6RA 4MHVA 3RH5A 5KFAA 3IG8A 5AM1A 1CI4A 2MAXA 4QZAA 1S10A 4M0AA 3QXGA 2Y0SF 1ZQ1C 3N7SC 4OJ5A 3AM9A 1KLNA 3SV3A 1EXNA 4CRXA 1TVAA 2WTFA 9ICUA 3ALRA 2QB0A 4Z6FA 3MR5A 2GWSA 4UB1A 3UQ0A 2PFQA 1JN3A 3ICXA 2XCAA 5F3XB 3ZDEA 4DCCA 4GC7A 3HILA 4XUSA 5AKJA 1TK8A 1PUZA 2YQEA 5CB1A 1JXEA 3Q8RB 2KMDA 2E8OA 5ALXA 3RFAA 4ACOA 1ZRNA 2PFPA 3IN5A 4PPXA 1TAUA 5HHHA 3PR5B 3EPIA 4DL5A 1KKXA 3H8JA 4UAUA 5HR7A 1XC9A 4QW9A 3RF9A 5DLFA 4GLXA 4QWBA 3AN1A 1JALA 2BPGA 4QZFA 1S76D 1DK3A 1ZQPA 2A1JB 2RRDA 1Z19A 4IRCA 5J0RA 4KLLA 4U7CA 3GDXA 2K8CB 2FMPA 3GFKB 5J2IA 2LKYA 5KFCA 9ICHA 3CNHA 1S9FA 2YMQA 2GLEA 4ED3A 1YZ7A 2K4IA 2AQ4A 5JRTA 4KMUA 1NJXA 1XO0A 2KG5A 7ICOA 2BZFA 1QSSA 2LYBA 2GO7A 4JV2A 2LM4A 2XY7A 5KFRA 3BQTA 3N7PD 1SIJA 2NYVA 3QUBA 2LHTA 2LM1A 2HHUA 1TK5A 1PK3A 1SV0A 2Y9UA 1XU4A 3V7JA 4QWCA 3KZIU 2VJ4A 2ASLA 1M6YA 3RRHA 1WWUA 1OUQA 2EQYA 2E8PA 2KVCA 2VKQA 1UA1A 1S0MA 2CPRA 5L1IA 2FLLA 4YP3A 4KN4A 4F4KA 3EWAA 1SWVA 3R9KA 4C8NA 1SB3C 2A1JA 1PK1A 3MABA 4RZRA 5KG5A 3O0FA 5J2KA 2KKPA 4Q43A 4DSKA 4KLGA 8ICNA 1B22A 7ICUA 9ICMA 4BJQA 4ECQA 4BWMA 1JIHA 1N5WA 3V7LA 4XRHA 3TACB 2ATLA 4Y2XA 3PMNA 1FFUA 3BZKA 3TAPA 5ALKA 4F71A 2KE7A 2DWQA 1Q8KA 3JPQA 1RQNA 5KG4A 4YVZA 4UASA 5KFSA 2FLNA 2G07A 4PH5A 2KFNA 3QZ7A 2DQNB 4NJ8A 4RNNA 4CGZA 3WKCA 8ICFA 4DOBA 2GH1A 2WF7A 1MQ2A 1Z4NA 2WAQF 1A76A 3NVYA 4DOCA 4MFFA 3KKAC 2JHDA 5KFIA 1SXDA 3ONNA 2Q4TA 1ZETA 5B66U 4P0QA 2QB1A 3TADC 4C8LA 3UXNA 1ZQMA 1PZNA 3MR2A 2KHVA 5ALWA 2A1AA 1NJYA 3BJYA 4BGDA 3PW0A 1X42A 1ZQIA 2HBMA 2OXOA 3C2LA 4PHEA 1MN8A 8ICBA 3KTQA 1X6IA 5HMMA 4JUZA 2HOFA 1VLBA 3TARA 2C2EA 5HHIA 2PFNA 3I28A 4Q8EA 2PI5A 1KQQA 4DEZA 4ED7A 2WF5A 5AKEA 1KL9A 2WFAA 4F4WA 1UT5A 4XQ8A 1ZOLA 3H8WA 2EANA 2ASDA 4PJ0U 2XIDA 5TZVA 4Q44A 5ALDA 3FDSA 4KLQA 2B21A 4CNQA 5KFTA 5TISU 1WUDA 2OWOA 2Y1IA 2KD1A 3A0HU 3PSTA 9ICRA 1T3QA 1F5SA 1SKWA 5KFZA 5ALTA 4RQ3A 2NRZA 4ECWA 3V6JA 3D6JA 1X9SA 4M04A 4KX3A 4KTQA 3H40A 2KJ8A 8ICCA 4UAYA 3TI0A 4IQVA 5CP2A 3HX0A 1D8LA 1PVPA 5AK6A 5IIIA 4DFKA 2XVTA 4FBTA 2ZIUA 1JROA 3NS1A 3PSFA 4DL4A 9ICGA 5ALQA 1N5XA 5J2JA 2KSOB 1NJWA 1XNSA 5J0XA 7ICFA 1SL2A 2WB1C 1O08A 1KFSA 2W9BA 1NNLA 4NLZA 8ICWA 2ZTDA 3NVWA 2E8MA 4ECUA 4IR9A 3LDAA 4NY8A 8ICKA 2PKEA 3NRZA 4OJ6A 3SENA 1WCLA 3KZXA 3HRDD 1ZRMA 2HVHA 4UW9A 2K4HA 3OSNA
chains in the Genus database with same CATH topology
5KAFU 3A0HU 5KAIU 3KZIU 4UB6U 5GTHU 4IL6U 5B5EU 4PJ0U 2DUYA 4UB8U 2AXTU 3WU2U 5B66U 5E79U 5H2FU 5GTIU 3A0BU 5TISU 1S5LU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF U;  3A0H U;  5KAI U;  3KZI U;  4UB6 U;  5GTH U;  4IL6 U;  5B5E U;  4PJ0 U;  2DUY A;  4UB8 U;  2AXT U;  3WU2 U;  5B66 U;  5E79 U;  5H2F U;  5GTI U;  3A0B U;  5TIS U;  1S5L U; 
#chains in the Genus database with same CATH topology
 2ISP A;  5AKI A;  5J0T A;  5BOM A;  4UB6 U;  4CF4 A;  1T7P A;  1B0X A;  2FPK A;  3JPS A;  3KKA A;  2KIV A;  2EAP A;  5CJ7 A;  5DGA A;  1S0V A;  2JZB B;  2F3N A;  3JPO A;  4QWE A;  1J97 A;  5J2E A;  3EW9 A;  2EAM A;  1HIW A;  3ISC A;  1RM6 C;  3SAH A;  4RQ8 A;  3FYH A;  2WF8 A;  2IHN A;  1N2X A;  4NXZ A;  4YFK A;  1L6N A;  9ICC A;  2JMG A;  1RDF A;  3B0X A;  5GTI U;  2EZX A;  4UB4 A;  4FO6 A;  3WK5 A;  3D2N A;  3C29 A;  1WCN A;  3LK9 A;  5KFN A;  3QEB Z;  5DBA A;  1P7D A;  5DG9 A;  2BCR A;  3PSI A;  5AK5 A;  5AK3 A;  2ZXH A;  4NL9 A;  3F2C A;  4O3M A;  4ED2 A;  5KT4 A;  3I76 A;  4RPZ A;  1O03 A;  2NRW A;  5KFQ A;  5J0P A;  1ZQB A;  5KAF U;  2P6U A;  3TAQ A;  3ZDA A;  2I6X A;  4GIB A;  5ALY A;  3PO5 A;  2PMZ C;  4EX6 A;  1IXR A;  5EE3 A;  8ICH A;  2JRZ A;  9ICE A;  4YD1 A;  2W8K A;  2BR0 A;  1ED1 A;  4DSL A;  2AHO B;  5D46 A;  4ECS A;  1WG8 A;  2E3T A;  5FP0 A;  3KHH A;  2K8B B;  4KLU A;  1ZQX A;  4Y2J A;  3LWM A;  1QSL A;  2R8K A;  3JPT A;  3CRX A;  5ALH A;  1ECW A;  4C0Z A;  2RP5 A;  3K1Z A;  2R18 A;  3UXO A;  1Z4O A;  2KZ3 A;  3I1Y A;  1T3N A;  1NKE A;  1RYR A;  2KKV A;  3IDW A;  5KFO A;  9ICO A;  2JEJ A;  4KLJ A;  2V4R A;  1NI3 A;  1URJ A;  4DSI A;  3MGV A;  3ED5 A;  4BXO A;  3RH4 A;  4YR3 A;  8ICV A;  8ICT A;  2VA8 A;  4Y2S A;  1ZQT A;  2EAO A;  2LYH A;  1KW4 A;  2XY6 A;  4QZH A;  8ICQ A;  3PSP A;  4B9T A;  3Q8K A;  1ZQO A;  4KX5 A;  1BPX A;  2RQ5 A;  3HW8 A;  5CR0 A;  3GV5 B;  4KLF A;  1VJ5 A;  4PL2 A;  4FZM A;  4DQP A;  3QUT A;  4ED8 A;  3RJH A;  2J6S A;  3EPG A;  4J9P A;  5ALM A;  4FZL A;  1KN5 A;  1MQ3 A;  1X2I A;  2M9N A;  5KG2 A;  1JMS A;  4C4S A;  1ZQL A;  1NK9 A;  1K5O A;  5J2A A;  4ICA A;  3ORY A;  3H4D A;  2IBK A;  4J9K A;  4Z6E A;  2C2R A;  1B4F A;  2FI1 A;  1FEZ A;  5KT5 A;  2L5Y A;  4M6W A;  4MEX A;  4Q8F A;  2NO4 A;  2A19 A;  1WYG A;  4NLG A;  3BS5 B;  1UT8 A;  1ZQY A;  2N1R A;  1S8O A;  5AM2 A;  3KFU F;  4DSE A;  5ALN A;  3OTQ A;  2VJ5 A;  4TUP A;  5G5H A;  7ICJ A;  3PML A;  2BQR A;  1BNO A;  5DQG A;  1A6S A;  4NLK A;  2MU2 A;  5AI6 A;  4EBE A;  4IRK A;  5L9X A;  2W9A A;  5J2D A;  3AU2 A;  5DLG A;  3F2B A;  3WKB A;  1S5L U;  5J8Y A;  5KFB A;  5J2G A;  1ZQG A;  3N7R C;  4ZH4 A;  4FZN A;  4ELT A;  9ICS A;  4OCZ A;  2YN4 A;  5CEH A;  4TUS A;  4I2A A;  1VDV A;  5C0Y A;  5KT7 A;  2BGW A;  2DUY A;  3EZ5 A;  4DL7 A;  5CA7 A;  3MFH A;  1SKS A;  5J29 A;  5KT3 A;  4IR1 A;  2FMQ A;  4RQ0 A;  4F5O A;  5KFP A;  2K4E A;  2IOF K;  2KK0 A;  2R8I A;  5ALJ A;  4I2E A;  5KTQ A;  4QWD A;  1SZH A;  4F5R A;  2RLT A;  3RAX A;  5J0Q A;  5K4L A;  4Y2U A;  5AI5 A;  2PI4 A;  2M0N A;  3UMC A;  1PVQ A;  3ZDB A;  5AKK A;  5AI8 A;  2HSZ A;  4CE6 A;  5KFE A;  5AHX A;  3C21 A;  3AQE A;  4M2Y A;  2B6G A;  2IOH A;  2V9W A;  5ALO A;  1SKR A;  2WB1 F;  2E5S A;  4BUG A;  5A0L A;  4K4G A;  1SV4 A;  5DDY A;  4LJX A;  3MDC A;  1A0P A;  2ZUC A;  3ETR A;  5CHG A;  3OSP A;  2MUT B;  4O3Q A;  4F3O A;  4DS5 A;  2ZTC A;  2OCE A;  5J2H A;  5AIB A;  4P4O A;  1LV5 A;  4K4I A;  2LMR A;  4AYB C;  2UVV A;  3NVZ A;  4KLI A;  2IOF A;  1SXE A;  4DWI A;  2D6F C;  2V4Q A;  1ZQR A;  2IA6 A;  3EYZ A;  2JEG A;  4JK1 A;  3C1Y A;  3QU9 A;  9ICJ A;  5J0W A;  4MFC A;  7ICL A;  2KVS A;  5KL1 B;  4B9N A;  4KLT A;  1NK8 A;  1PVR A;  7ICE A;  4ECT A;  3GIJ A;  3RJF A;  3DV9 A;  3PV8 A;  3T5L A;  1HJP A;  4PHP A;  4RQ2 A;  4IQU A;  1ZQA A;  3OJS A;  4K4H A;  4F91 B;  4DL2 A;  4NM1 A;  1RZT A;  3RTV A;  3F53 A;  4DLE A;  4E0D A;  2WHE A;  2HOI A;  1RYU A;  4BX9 C;  2BCU A;  4J9N A;  2YTU A;  2HHS A;  1JUD A;  1N48 A;  4O3O A;  1TAQ A;  2DKZ A;  1NKB A;  4P4M A;  4EZ6 A;  1NK6 A;  5CRX A;  1KFT A;  3NGD A;  4LZG A;  2W03 A;  1DOQ A;  4FFD A;  2F2A B;  3BZC A;  3AMZ A;  2HBL A;  2CRX A;  4RQM A;  3IM1 A;  7ICG A;  2E1E A;  4J9M A;  5AM0 A;  3DDH A;  2PMZ F;  3C23 A;  3SAG A;  2I9G A;  2AGQ A;  3V6H A;  2H3F A;  4B9S A;  4IQW A;  1ZQS A;  4M9G A;  1ZYQ A;  3SEI A;  1RXV A;  3GII A;  7ICV A;  2FJ6 A;  1U4B A;  4P0P B;  1BGX T;  8ICL A;  4QZG A;  2RHF A;  7ICH A;  4DLG A;  4LZD A;  1L7O A;  3PR4 A;  4C4T A;  5DBB A;  3RH6 A;  3HKZ C;  4ECX A;  3RB0 A;  3RR8 A;  2FE9 A;  4UBB A;  1XO1 A;  4WJ3 B;  2IHM A;  4NLC A;  1DRG A;  3WKD A;  2UVR A;  4Q45 A;  4DFD A;  3PY8 A;  3B0Y A;  4DQS A;  1S0O A;  5F9L A;  4UB8 U;  3SAF A;  2DPI A;  1XWL A;  4YQW A;  3N28 A;  1N63 A;  3THV A;  2ASJ A;  4RQ5 A;  3Q8L A;  3BQ7 A;  2WF9 A;  3QZ8 A;  3RJG A;  4RU9 A;  4KN7 A;  3K75 D;  3GIK A;  3SQI A;  3GV7 B;  3M6Z A;  4M9L A;  3RR7 A;  3V7K A;  4FS2 A;  5DG7 A;  1U48 A;  2JEI A;  1QTM A;  1OXJ A;  4QZD A;  4O3R A;  8ICU A;  1ZQD A;  4DFP A;  5BOL A;  1ZQE A;  2QLT A;  3ZI4 A;  4YD2 A;  5HNK A;  4OJP A;  4F4Z A;  4GC6 A;  5DQH A;  2BQ3 A;  2XY5 A;  4KLM A;  2NO5 A;  2OM6 A;  3GZF A;  4JV0 A;  4YG2 A;  3BDP A;  3JPP A;  3H0R B;  2JGA A;  1IM4 A;  4GFJ A;  5D4B A;  3FAH A;  4RQ6 A;  3E58 A;  2EDU A;  4I2D A;  3CP8 A;  1ZD2 P;  4UAZ A;  1XS9 D;  1N56 A;  1KSP A;  1N62 A;  1Z00 B;  5ALP A;  2KZZ A;  4NLB A;  1X6J A;  4J9O A;  4YXM A;  2R8G A;  3GIM A;  3IP4 B;  3N97 B;  1L7M A;  2XGQ A;  4B9U A;  3H0M B;  3RB4 A;  5DKW A;  5J2B A;  5KFF A;  2HHW A;  5ALZ A;  3U26 A;  4O3P A;  2F1J A;  4OD0 A;  4PZN A;  5AKZ A;  4I2B A;  3WKE A;  5JTI A;  4AP9 A;  2EZZ A;  3UXP A;  1BNP A;  1X9W A;  5DQI A;  4C4R A;  3Q8P B;  2CN1 A;  1YZ6 A;  2KSO A;  4Z6C A;  3TAD A;  3TFR A;  2C28 A;  3G6Y A;  2F44 A;  1GO3 F;  2O6K A;  4FS1 A;  2F77 X;  3QU4 A;  4DL3 A;  4F50 A;  5KG7 A;  2BCS A;  2NRT A;  3H4B A;  3C2K A;  1NK5 A;  4C8K A;  1L3V A;  2F8L A;  3T5J A;  3QEA Z;  2ZIX B;  3MBY A;  2KFZ A;  5JUM A;  2YY6 A;  7ICN A;  5D49 A;  1ZJM A;  1Z00 A;  5KFX A;  5KNI A;  1NKC A;  5AKY A;  3H7I A;  1Q46 A;  1T4G A;  3M9N B;  3TAN A;  3MFI A;  3IG5 A;  4YR2 A;  1S97 A;  2ZIW B;  2OEH A;  5L1K A;  4RUA A;  1KDH A;  4ECR A;  8ICP A;  2FPM A;  5EE9 A;  4F5P A;  2HCF A;  1ZQV A;  3B9J A;  4O9M A;  1FO4 A;  5ALI A;  2BCV A;  2JZB A;  4TUQ A;  1FIQ A;  4YMN A;  4EBD A;  2Y9T A;  4EBC A;  1NK0 A;  4I2C A;  3UM9 A;  4F5N A;  2KZM A;  3H8M A;  4F72 A;  1H38 A;  4AYB F;  5DB8 A;  4J9R A;  3NRW A;  2KP7 A;  4PGY A;  1L3U A;  3NUQ A;  2H3I A;  1COO A;  3AQF A;  4Y2V A;  3PNC A;  2FLP A;  1C20 A;  3PW2 A;  9ICP A;  3T3F A;  2HBK A;  1RQL A;  4YCX A;  3ZD9 A;  1SGG A;  5AI4 A;  5KG3 A;  1LKY B;  2HHV A;  4FE3 A;  5HP4 A;  2BPF A;  5J0S A;  5KFG A;  1NK7 A;  4YMM A;  1CRX A;  3E0F A;  4QZC A;  8ICJ A;  2AJQ A;  2BCQ A;  4TUR A;  2NV3 A;  4DF4 A;  2ZIW A;  1X9M A;  9ICW A;  2W43 A;  3VCB A;  5J2F A;  4NM2 A;  2K8A A;  1U9L A;  2EZY A;  4M47 A;  1BPB A;  4R66 A;  2P66 A;  3M9O B;  1T8E A;  4KIT B;  3ETL A;  2BQU A;  2G5H B;  3M8R A;  4NLN A;  3OGU A;  2YX8 A;  1KEJ A;  2I5H A;  3TQ1 A;  1SL1 A;  5KT2 A;  2W3S A;  4IS7 A;  5ALS A;  4C7Z A;  2F1H A;  3TFS A;  5IIN A;  2CXY A;  5EWE A;  1LB2 B;  4P4P A;  3QYP A;  5EE0 A;  1QCK A;  4F4Y A;  1MA7 A;  5F9N A;  5L1J A;  1UPH A;  1ZQC A;  3PW7 A;  5AIC A;  2BDP A;  3D2Q A;  4ECY A;  5DB6 A;  4P2H A;  4YR0 A;  1B43 A;  1YT3 A;  2W9M A;  3L3F X;  2AGP A;  4KLD A;  3PW4 A;  1TV9 A;  2KJ9 A;  4QZ8 A;  2W54 A;  4IRD A;  4GXK A;  2ZIV B;  4UAR A;  3RBD A;  1Z3E B;  3V6K A;  2KHQ A;  8ICX A;  3GV8 B;  5KG0 A;  1L8O A;  3QUQ A;  2AU0 A;  5ALE A;  3T79 A;  4QZB A;  3MGI A;  2QB0 B;  1SV0 C;  3V72 A;  1HUZ A;  4BDP A;  4UB5 A;  2HHX A;  2OYY A;  2YMP A;  3VC8 A;  3KOO A;  1RXW A;  3EUB 2;  5C5J A;  3H0L B;  3HKZ F;  4RT3 A;  3RBE A;  1KFD A;  2PFO A;  3GIL A;  4EEK A;  1Y88 A;  1U45 A;  7ICI A;  1QH9 A;  3QU5 A;  1HUO A;  3PZP A;  3N4M B;  4HAI A;  4CCH A;  8ICE A;  3PX6 A;  2KN7 A;  1Q3V A;  4RNO A;  5KAI U;  2HI0 A;  3PX0 A;  4EX7 A;  1ZQK A;  4CDG A;  4QJF B;  4YMO A;  1V85 A;  2R8H A;  4Y2R A;  3M7D A;  3PO4 A;  4HYK A;  4EYH B;  4GXI A;  2ZIV A;  2WF6 A;  2XO7 A;  2XCP A;  3M6K A;  1XSP A;  4O5E A;  5KG1 A;  3UMG A;  4Y2Y A;  4G9B A;  9ICQ A;  5ALG A;  2DF4 B;  2A3V A;  3BS5 A;  4YXJ A;  3C5F A;  2VAN A;  4RQ7 A;  1L7N A;  3C28 A;  4US9 A;  2H3Q A;  2ES6 A;  4RPX A;  7ICR A;  2XI9 A;  3SR6 A;  2GOL A;  2LPE A;  2YMM A;  3WK7 A;  5IIM A;  5EWF A;  1V38 A;  4R8U B;  4EEY A;  1X40 A;  4Y2T A;  1V97 A;  2HOQ A;  3SYZ A;  1AQ6 A;  4C80 A;  2HBJ A;  4I2I A;  1DGS A;  2MA1 A;  1ARO P;  1JRP A;  5KFW A;  2G5I B;  3QE9 Y;  4KLH A;  3D2S A;  4J9S A;  1IIP A;  3WK4 A;  4TQS A;  3UPQ A;  3UQ2 A;  9ICB A;  3PX4 A;  4RUC A;  5KFH A;  9ICN A;  3RJE A;  2PXI A;  4O5C A;  2LBO A;  1NJZ A;  2W11 A;  8ICG A;  2HDO A;  1PK1 B;  4ED1 A;  1ZD4 A;  3KHL A;  4NWI A;  1OW5 A;  1NZP A;  3SZ2 A;  3KHR A;  5H2F U;  3ZD8 A;  4J9L A;  2HVI A;  3DEE A;  3IRU A;  1BPE A;  3RJI A;  2FDR A;  4QIW C;  5ALR A;  4R8U A;  5KL8 B;  2QAR B;  4LVS A;  4IQT A;  1BPZ A;  4O3N A;  2LI6 A;  4A8E A;  1L3T A;  1HEK A;  5AM5 A;  3Q8Q B;  3K1R B;  9ICI A;  3NVV A;  2KJ5 A;  2R8J A;  2W9C B;  3RAQ A;  7ICS A;  3QNM A;  1K1S A;  1ZD3 A;  2W3R A;  2MUT A;  2W55 A;  5GTH U;  3UMB A;  4F5Q A;  4P0Q B;  9ICF A;  3ISB A;  2RDI A;  3BS7 A;  2ESE A;  4B9M A;  3RJK A;  3SI8 A;  1TKD A;  2ZJ5 A;  5DB7 A;  2KNJ A;  4PZO A;  3HT3 A;  4ELV A;  3FC4 A;  2DGZ A;  4JB3 A;  5AKG A;  4X5V A;  4JWN A;  3F2D A;  1UQV A;  4TQR A;  4M9H A;  5BPC A;  3JPN A;  1QQ7 A;  5AIA A;  2G06 A;  1KTQ A;  5J0U A;  2DKX A;  9ICV A;  1XSL A;  5AM3 A;  2YB1 A;  4C8O A;  2KIW A;  2QAR A;  5DG8 A;  3M9M B;  4IC9 A;  1SZP A;  2JXJ A;  2K60 A;  3F5A A;  1S0N A;  4KLE A;  1CEZ A;  3G6X A;  1COK A;  2FPL A;  1TAM A;  3AUO A;  1XSN A;  3HWT A;  2VIX A;  2C22 A;  2HHT A;  1X66 A;  4MFA A;  2W9C A;  4JV1 A;  3LVW A;  4OJL A;  2F8K A;  2W04 A;  4YN4 A;  4KLS A;  3GU3 A;  4DQQ A;  2ISO A;  5JU5 A;  1T94 A;  1RPL A;  8ICO A;  4I2G A;  3CW2 C;  4KMO B;  5L1L A;  2AH5 A;  3OPX A;  2ALZ A;  1UCV A;  4I27 A;  4O3S A;  3T5H A;  2H3Z A;  1CUK A;  1K1Q A;  5AM4 A;  2ZG6 A;  2KIC A;  9ICA A;  2ZJA A;  3QX7 A;  7ICQ A;  3H8S A;  7ICK A;  4I2H A;  4FBU A;  1Z1B A;  3MGH A;  3T5K A;  1RYS A;  4F2S A;  3MDA A;  4CF5 A;  4ZOH C;  5G5G A;  1ZQW A;  3WU2 U;  3QU2 A;  5AKL A;  1ZQH A;  8ICR A;  4ELU A;  4BWJ A;  2ODG A;  5DGB A;  1RG6 A;  2ZIU B;  1SWW A;  3HJE A;  9ICX A;  4RQ4 A;  5IIL A;  7ICM A;  4UAW A;  5KFD A;  3ZDD A;  4Z6D A;  4R64 A;  2KEY A;  3C5G A;  3S6J A;  5DDM A;  2C2D A;  8ICY A;  3NTU A;  3BQ2 A;  1UHU A;  1JI7 A;  2Y0S C;  1IG6 A;  4NL9 C;  1DGJ A;  2DFL A;  2W9B B;  5EWG A;  2D8C A;  1X9X A;  2K89 A;  3SV4 A;  3RJJ A;  4P0P A;  5ALU A;  5EE1 A;  4DL6 A;  1QQ6 A;  3JPR A;  4DSJ A;  4DF8 A;  4C8M A;  4M9J A;  3LYS A;  2HHQ A;  1ZXI A;  4DFM A;  2E8N A;  4F4X A;  4UQG A;  3BQ0 A;  4DSF A;  3RB3 A;  5KFM A;  2ZUB A;  4JMU A;  4DS4 A;  3AEV A;  2AQ0 A;  2MSN A;  2JH1 A;  3A0B U;  1LVH A;  2ZXI A;  2HW3 A;  4EEL A;  4F93 B;  4PGQ A;  2YML A;  5KFJ A;  7ICP A;  4DO9 A;  3M8S A;  1FFV A;  3G6V A;  8ICS A;  2HMX A;  2AXT U;  3KBB A;  3PVX A;  3IV6 A;  2RDJ A;  3CYM A;  3OHA A;  2ZUD A;  5AKH A;  3HPO A;  3MR6 A;  2KTQ A;  3C1Z A;  1DXS A;  2LYA A;  4USA A;  5AKX A;  5IIO A;  1MC8 A;  4GXJ A;  8ICZ A;  4I29 A;  4RT2 A;  3IHQ B;  3L5K A;  5IIJ A;  4PGX A;  3RRG A;  1D8Y A;  5DBC A;  1N60 A;  4J9Q A;  1F0M A;  5E79 U;  3GQC A;  1Q3U A;  3WKA A;  4RNM A;  2E1F A;  2XIC A;  3M1Y A;  1BVS A;  1U47 A;  5T14 A;  4B9L A;  5EOZ A;  1WWV A;  1KBU A;  4IL6 U;  2BKE A;  2QKQ A;  5B5E U;  5KFL A;  1J2N A;  3MC1 A;  1L8L A;  4DQI A;  4B9V A;  4G3I A;  1ZJN A;  5J2C A;  7ICT A;  1TE2 A;  1ZD5 A;  3FM9 A;  3RB6 A;  1TK0 A;  3L4P A;  4I2F A;  1ZQZ A;  2Q0Z X;  5KT6 A;  2Z7J A;  3BQ1 A;  2DL0 A;  1F44 A;  4UB3 A;  8ICI A;  3WK8 A;  3HP6 A;  1BPY A;  2JH7 A;  4US8 A;  2XGP A;  4Y2Q A;  5J0O A;  1L3S A;  2VA2 A;  5ALV A;  4UB2 A;  4O0I A;  4J03 A;  3QU7 A;  2D3D A;  2MRL A;  5DB9 A;  2ZJ8 A;  2G0A A;  5HML A;  1QQ5 A;  2NRX A;  3C2M A;  1QSY A;  2KOB A;  2DPJ A;  4QWA A;  4ED6 A;  2BPC A;  1NZB A;  3K4G A;  4EEN A;  8ICM A;  4PL1 A;  3Q8M A;  1NOM A;  4QNL A;  5AI0 A;  3AL0 B;  4Y2P A;  4C7Y A;  1MSW D;  1L7P A;  3LVV A;  4BXO B;  1D8B A;  4ED0 A;  1ZQN A;  1D9F A;  4NV0 A;  2J6T A;  5J8Y C;  3PW5 A;  2F1I A;  2UVW A;  5HR6 A;  4I2J A;  8ICA A;  3KD3 A;  2WAQ C;  1ZQU A;  2ZIX A;  1L5U A;  2NRV A;  3E2E A;  4KLO A;  4QIW F;  1UA0 A;  5ALL A;  4XA5 A;  4UAT A;  3SMV A;  4PHD A;  2IMW P;  2W8L A;  3WK6 A;  1TFR A;  2OHF A;  2W7O A;  2FMS A;  4F92 B;  4ECV A;  2EH9 A;  2BHN A;  1Z1V A;  4QZI A;  3QUC A;  1N61 A;  1DK2 A;  4EYI B;  1BPD A;  3SD7 A;  1ZQQ A;  1S77 D;  9ICT A;  2G08 A;  5KG6 A;  3KHG A;  4OO1 J;  5CWR A;  2JEF A;  1ZQF A;  4F2R A;  4I28 A;  2J6U A;  5AI9 A;  1QLN A;  4O5K A;  1IV8 A;  4OJO A;  4MF2 A;  4QW8 A;  2JV3 A;  2BDU A;  3WK9 A;  3LWL A;  4RQN A;  5L1M A;  4R63 A;  4U6P A;  3ISD A;  3AU6 A;  2UVU A;  4M6W B;  2F76 X;  2DBY A;  1JXL A;  4JWM A;  2OH2 A;  2G09 A;  1LKY A;  4UBC A;  1C7Y A;  2YB4 A;  2B0C A;  5J0Y A;  1A77 A;  5AK4 A;  1U49 A;  4B6J A;  2JR5 A;  1SL0 A;  4DQR A;  9ICK A;  1V9P A;  4QZ9 A;  4QZE A;  4M9N A;  3TKA A;  2AGO A;  1ZQJ A;  4R65 A;  3ZDC A;  2W7P A;  4MF8 A;  5KFV A;  2Y1J A;  1KRP A;  4F8R A;  4UAV A;  3OJU A;  3Q8S B;  2P35 A;  4PHA A;  5KFY A;  2XC9 A;  5KFK A;  4RPY A;  5ALF A;  2I1Q A;  3NAS A;  4ECZ A;  2VA3 A;  1D9D A;  5KFU A;  4DFJ A;  9ICL A;  2K4P A;  5IIK A;  4DOA A;  3F5E A;  4MEY A;  3MR3 A;  1J2M A;  4CF3 A;  2KV2 A;  1JX4 A;  3OHB A;  2ZTE A;  4RQ1 A;  4EZ9 A;  2H5X A;  1NK4 A;  3J81 j;  2H3V A;  2P6R A;  4MHV A;  3RH5 A;  5KFA A;  3IG8 A;  5AM1 A;  1CI4 A;  2MAX A;  4QZA A;  1S10 A;  4M0A A;  3QXG A;  2Y0S F;  1ZQ1 C;  3N7S C;  4OJ5 A;  3AM9 A;  1KLN A;  3SV3 A;  1EXN A;  4CRX A;  1TVA A;  2WTF A;  9ICU A;  3ALR A;  2QB0 A;  4Z6F A;  3MR5 A;  2GWS A;  4UB1 A;  3UQ0 A;  2PFQ A;  1JN3 A;  3ICX A;  2XCA A;  5F3X B;  3ZDE A;  4DCC A;  4GC7 A;  3HIL A;  4XUS A;  5AKJ A;  1TK8 A;  1PUZ A;  2YQE A;  5CB1 A;  1JXE A;  3Q8R B;  2KMD A;  2E8O A;  5ALX A;  3RFA A;  4ACO A;  1ZRN A;  2PFP A;  3IN5 A;  4PPX A;  1TAU A;  5HHH A;  3PR5 B;  3EPI A;  4DL5 A;  1KKX A;  3H8J A;  4UAU A;  5HR7 A;  1XC9 A;  4QW9 A;  3RF9 A;  5DLF A;  4GLX A;  4QWB A;  3AN1 A;  1JAL A;  2BPG A;  4QZF A;  1S76 D;  1DK3 A;  1ZQP A;  2A1J B;  2RRD A;  1Z19 A;  4IRC A;  5J0R A;  4KLL A;  4U7C A;  3GDX A;  2K8C B;  2FMP A;  3GFK B;  5J2I A;  2LKY A;  5KFC A;  9ICH A;  3CNH A;  1S9F A;  2YMQ A;  2GLE A;  4ED3 A;  1YZ7 A;  2K4I A;  2AQ4 A;  5JRT A;  4KMU A;  1NJX A;  1XO0 A;  2KG5 A;  7ICO A;  2BZF A;  1QSS A;  2LYB A;  2GO7 A;  4JV2 A;  2LM4 A;  2XY7 A;  5KFR A;  3BQT A;  3N7P D;  1SIJ A;  2NYV A;  3QUB A;  2LHT A;  2LM1 A;  2HHU A;  1TK5 A;  1PK3 A;  1SV0 A;  2Y9U A;  1XU4 A;  3V7J A;  4QWC A;  3KZI U;  2VJ4 A;  2ASL A;  1M6Y A;  3RRH A;  1WWU A;  1OUQ A;  2EQY A;  2E8P A;  2KVC A;  2VKQ A;  1UA1 A;  1S0M A;  2CPR A;  5L1I A;  2FLL A;  4YP3 A;  4KN4 A;  4F4K A;  3EWA A;  1SWV A;  3R9K A;  4C8N A;  1SB3 C;  2A1J A;  1PK1 A;  3MAB A;  4RZR A;  5KG5 A;  3O0F A;  5J2K A;  2KKP A;  4Q43 A;  4DSK A;  4KLG A;  8ICN A;  1B22 A;  7ICU A;  9ICM A;  4BJQ A;  4ECQ A;  4BWM A;  1JIH A;  1N5W A;  3V7L A;  4XRH A;  3TAC B;  2ATL A;  4Y2X A;  3PMN A;  1FFU A;  3BZK A;  3TAP A;  5ALK A;  4F71 A;  2KE7 A;  2DWQ A;  1Q8K A;  3JPQ A;  1RQN A;  5KG4 A;  4YVZ A;  4UAS A;  5KFS A;  2FLN A;  2G07 A;  4PH5 A;  2KFN A;  3QZ7 A;  2DQN B;  4NJ8 A;  4RNN A;  4CGZ A;  3WKC A;  8ICF A;  4DOB A;  2GH1 A;  2WF7 A;  1MQ2 A;  1Z4N A;  2WAQ F;  1A76 A;  3NVY A;  4DOC A;  4MFF A;  3KKA C;  2JHD A;  5KFI A;  1SXD A;  3ONN A;  2Q4T A;  1ZET A;  5B66 U;  4P0Q A;  2QB1 A;  3TAD C;  4C8L A;  3UXN A;  1ZQM A;  1PZN A;  3MR2 A;  2KHV A;  5ALW A;  2A1A A;  1NJY A;  3BJY A;  4BGD A;  3PW0 A;  1X42 A;  1ZQI A;  2HBM A;  2OXO A;  3C2L A;  4PHE A;  1MN8 A;  8ICB A;  3KTQ A;  1X6I A;  5HMM A;  4JUZ A;  2HOF A;  1VLB A;  3TAR A;  2C2E A;  5HHI A;  2PFN A;  3I28 A;  4Q8E A;  2PI5 A;  1KQQ A;  4DEZ A;  4ED7 A;  2WF5 A;  5AKE A;  1KL9 A;  2WFA A;  4F4W A;  1UT5 A;  4XQ8 A;  1ZOL A;  3H8W A;  2EAN A;  2ASD A;  4PJ0 U;  2XID A;  5TZV A;  4Q44 A;  5ALD A;  3FDS A;  4KLQ A;  2B21 A;  4CNQ A;  5KFT A;  5TIS U;  1WUD A;  2OWO A;  2Y1I A;  2KD1 A;  3A0H U;  3PST A;  9ICR A;  1T3Q A;  1F5S A;  1SKW A;  5KFZ A;  5ALT A;  4RQ3 A;  2NRZ A;  4ECW A;  3V6J A;  3D6J A;  1X9S A;  4M04 A;  4KX3 A;  4KTQ A;  3H40 A;  2KJ8 A;  8ICC A;  4UAY A;  3TI0 A;  4IQV A;  5CP2 A;  3HX0 A;  1D8L A;  1PVP A;  5AK6 A;  5III A;  4DFK A;  2XVT A;  4FBT A;  2ZIU A;  1JRO A;  3NS1 A;  3PSF A;  4DL4 A;  9ICG A;  5ALQ A;  1N5X A;  5J2J A;  2KSO B;  1NJW A;  1XNS A;  5J0X A;  7ICF A;  1SL2 A;  2WB1 C;  1O08 A;  1KFS A;  2W9B A;  1NNL A;  4NLZ A;  8ICW A;  2ZTD A;  3NVW A;  2E8M A;  4ECU A;  4IR9 A;  3LDA A;  4NY8 A;  8ICK A;  2PKE A;  3NRZ A;  4OJ6 A;  3SEN A;  1WCL A;  3KZX A;  3HRD D;  1ZRM A;  2HVH A;  4UW9 A;  2K4H A;  3OSN A; 
#chains in the Genus database with same CATH homology
 5KAF U;  3A0H U;  5KAI U;  3KZI U;  4UB6 U;  5GTH U;  4IL6 U;  5B5E U;  4PJ0 U;  2DUY A;  4UB8 U;  2AXT U;  3WU2 U;  5B66 U;  5E79 U;  5H2F U;  5GTI U;  3A0B U;  5TIS U;  1S5L U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...