5GTHU

Native xfel structure of photosystem ii (dark dataset)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
LVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 29
structure length 96
sequence length 96
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5gthU01
5H2FU 5B66U 3WU2U 3A0BU 5E79U 5KAFU 2AXTU 3A0HU 5GTHU 4IL6U 2DUYA 4UB6U 4PJ0U 3KZIU 5KAIU 4UB8U 5TISU 5GTIU 1S5LU 5B5EU
chains in the Genus database with same CATH superfamily
3NVYA 4F72A 3SAFA 1X9SA 4TUQA 5KFGA 9ICMA 2MAXA 1DGJA 2K4HA 8ICOA 1L8OA 4Y2XA 3V6KA 3E0FA 3RJHA 4ECQA 1QH9A 2LMRA 5KFTA 3NVVA 4I2DA 1RYRA 2KVCA 1XO1A 4HYKA 1GO3F 3CRXA 2FE9A 3L3FX 4F5RA 3TADC 3C29A 3BDPA 9ICFA 3ZI4A 2F77X 4ECSA 1ZQUA 9ICVA 1T3NA 3IRUA 3PV8A 1NI3A 3ETLA 3KHLA 3PNCA 4Q43A 1S8OA 3KD3A 1TKDA 1V9PA 5L1MA 1LV5A 1SZHA 4DFDA 5KFQA 2BGWA 2BDPA 4O3RA 4ICAA 3S6JA 4QZ9A 1BPZA 4C8KA 2E5SA 4UASA 4DF4A 1C20A 3UM9A 2JHDA 1Z1BA 3SENA 4KLHA 4O3QA 4M47A 3H7IA 2WF5A 4O5CA 4J9QA 2QARA 2NO5A 3OHBA 4UARA 3RRHA 3RB6A 3CW2C 2DWQA 5DGAA 2WB1C 3MR6A 3QEBZ 1ZD4A 2WB1F 1M6YA 3KOOA 4KTQA 3T5JA 4NLNA 1SKRA 7ICUA 1S76D 7ICFA 5IILA 5KFLA 4P0QB 1QSLA 4JK1A 2Y9TA 8ICNA 1MN8A 4PHAA 2VA2A 1ZQQA 5AKZA 3PX0A 1BPDA 4CF5A 2YN4A 3F53A 4QZGA 1PK3A 2BKEA 3TAQA 2V4QA 2P66A 4UAYA 4FZLA 1D9DA 1L7PA 4Q8EA 5AM3A 2ASJA 3DDHA 1HIWA 2HOQA 1S77D 8ICZA 2CPRA 4NV0A 3V72A 4ED0A 2GO7A 5BOMA 2YMPA 3WK9A 4EBCA 4US9A 4FE3A 4PL1A 4YR3A 4F93B 2CRXA 3QU9A 3TAPA 1FO4A 1K1QA 4EEKA 5IIKA 4XUSA 2W9CB 3BQ2A 3T5KA 4EBEA 4RPXA 3TI0A 1NK6A 3C1ZA 3MBYA 3C2LA 4CE6A 2F3NA 4C4RA 2JZBB 3QZ7A 5HR6A 2FDRA 1DGSA 5AK3A 2EAPA 5GTIU 1B4FA 2HCFA 2KJ5A 2Q4TA 4FBUA 4C4TA 2KICA 5KG1A 2B21A 4OJOA 1SB3C 2RLTA 5KFIA 3KTQA 3ZDCA 3ETRA 4F5PA 5ALTA 1T7PA 5ALVA 3NGDA 4PJ0U 1Z4NA 4UAZA 1ZQNA 5KFCA 9ICSA 8ICKA 4KLJA 5DDYA 1Z1VA 4NXZA 2ZG6A 3Q8MA 3VC8A 1K1SA 4IQWA 4UAVA 4B6JA 4J9NA 2ASLA 5ALUA 4PL2A 2LYHA 3PO4A 3NRWA 2VJ5A 4P0QA 4I2JA 2E8MA 3AM9A 2XY5A 1NOMA 2KMDA 2KJ8A 5KFDA 1X6IA 1JMSA 4RU9A 7ICJA 4UBBA 4YMOA 4I2AA 3I76A 9ICHA 5FP0A 3RR8A 3AN1A 5AHXA 4RNNA 2ZTDA 5BPCA 1Q3VA 2LM1A 4ED3A 3B0YA 2DF4B 1DK2A 2FLNA 1XU4A 3CNHA 5CJ7A 3EZ5A 3RRGA 2HHVA 9ICCA 4DOBA 1NNLA 1S0MA 2EH9A 3I28A 4I29A 5J0RA 4UAWA 3PW5A 3PZPA 2G5IB 4GXJA 4JB3A 5KFZA 3LWMA 1KDHA 2KZMA 2JR5A 3G6VA 1Y88A 2HBLA 4P4PA 2PFPA 2QB0B 2W7PA 3H0MB 2NYVA 2AQ0A 1AROP 5JU5A 5ALRA 3MR2A 3H8MA 4EX7A 2W9CA 5AK4A 3RAXA 2JH7A 4NLCA 1Z00B 3AU6A 2D6FC 5EWGA 1U9LA 4IQUA 3MDAA 2NRXA 4QZIA 1PVRA 1ZQCA 2JZBA 2C2EA 4Z6DA 3PW4A 2FJ6A 2EQYA 1BPBA 1UT8A 5IIMA 4UW9A 4B9SA 3WK6A 4Y2RA 3AEVA 1KFSA 3HT3A 4QWBA 4DQQA 5CB1A 1X40A 4NWIA 1ZQFA 2KIVA 4Y2QA 4IC9A 2R8HA 4ECTA 2ES6A 2HMXA 2GWSA 3HWTA 5DQHA 5IIJA 2P6UA 3SAGA 4B9LA 1X2IA 3QZ8A 5G5HA 8ICUA 8ICAA 5AKJA 1JALA 3CP8A 1QLNA 3MGIA 4KLQA 4FS2A 5KFOA 3EPIA 4ED1A 4ECRA 3H4DA 1S0NA 3PY8A 1JXLA 4KN7A 3UXOA 4ED2A 9ICIA 2UVRA 4WJ3B 2RHFA 3WK4A 2H3IA 7ICKA 5ALXA 2ZXIA 1KRPA 4QW9A 4DL7A 1SL1A 5L1JA 5J2IA 3K1RB 1N5XA 2M0NA 2FMSA 4F4KA 3OTQA 1JIHA 3QU5A 4JWNA 4KLIA 3OJUA 1XC9A 2KFNA 5DQGA 2KOBA 2LM4A 4KX3A 5J0YA 1SV0C 3LYSA 2WF8A 3QU4A 3Q8KA 3FC4A 2LI6A 4RT3A 3PVXA 2Y1IA 4ED7A 4F4XA 4B9NA 2WF7A 5CHGA 2GOLA 2XVTA 4PPXA 5J0UA 1FIQA 3HX0A 4F4ZA 2PXIA 2M9NA 2YY6A 5ALQA 4NM1A 2F1HA 2QB0A 3M6KA 1NZPA 4ECWA 3R9KA 4RT2A 1ZJMA 2YMQA 5DBBA 7ICOA 5C0YA 2KKPA 1D8BA 2KE7A 2AU0A 3UQ0A 4J9SA 1ZQIA 1COKA 1SKSA 1SGGA 4K4HA 3GILA 1XSNA 3F2BA 2Z7JA 5J2HA 2WAQC 1VLBA 2WAQF 4RPYA 2HDOA 2JEIA 4J9MA 5AKGA 1J97A 2FI1A 3A0HU 4DO9A 2BQRA 2W03A 1X9WA 3HJEA 2IOFK 4P4MA 1T4GA 1NZBA 3K4GA 2DL0A 3KHGA 3MFHA 3MC1A 5J0OA 5AKHA 1D9FA 2CN1A 4JWMA 4O3NA 4US8A 1IM4A 4J03A 5DQIA 4O0IA 1IV8A 2C22A 1MQ2A 3D6JA 1FFUA 3WKEA 2R18A 3GFKB 3QUTA 4RQ3A 8ICLA 3N4MB 9ICGA 2C2RA 4UAUA 4A8EA 3E58A 4M6WB 4QZCA 2HVIA 3UQ2A 3V7LA 2FMPA 5J2FA 3PSIA 4DWIA 2YB4A 3OGUA 4C0ZA 5AIAA 4Q8FA 2OH2A 2MSNA 3WK5A 4DQSA 1UPHA 4PH5A 2DUYA 7ICVA 2ISPA 4FBTA 5KTQA 3PSPA 4IS7A 2NRVA 1B43A 2OHFA 1K5OA 4JV2A 4OO1J 5KG0A 5AM1A 2IA6A 1JRPA 2ZIXB 4RZRA 4CDGA 4R64A 4BGDA 2G0AA 2KHQA 1A6SA 5KAFU 2E3TA 3JPPA 1O03A 4ED8A 1ZXIA 2EZXA 2NRTA 2G09A 2FPLA 4JMUA 2KD1A 2HHWA 4JV1A 4AYBC 3C2MA 3UPQA 1CEZA 5AI6A 4NLKA 3WKAA 2KN7A 4DSLA 2KEYA 3GIMA 3GIJA 1XWLA 1U47A 3M8RA 4DL5A 4PHDA 1ZQTA 4DL2A 1QSSA 2A3VA 3F2CA 3RJEA 4C8LA 1SL2A 4F5NA 4QWCA 2G5HB 3Q8QB 1NK5A 1RXWA 2J6TA 4O3SA 2XCPA 4F8RA 1TAQA 1L3TA 4F4WA 2VANA 4OJPA 3V7JA 1O08A 3PW0A 4X5VA 1RXVA 5HP4A 7ICIA 1WWVA 5ALMA 5CA7A 2H5XA 4DSEA 2DKZA 3MABA 5ALGA 2R8KA 2YB1A 2BR0A 2FLLA 3TQ1A 3MR3A 1LKYA 4USAA 4M9HA 1L7OA 4QWEA 4C7ZA 1U45A 9ICWA 2BHNA 2ESEA 5DB7A 3NASA 3M8SA 2DPJA 8ICJA 4YVZA 8ICVA 1ZRMA 4MF2A 4NLBA 2DGZA 4M6WA 8ICXA 2QLTA 5J0WA 4KLLA 2JRZA 4G9BA 3ZD8A 3BQ1A 5D46A 5KFAA 4LVSA 5KG6A 4ECUA 2MA1A 5KNIA 4F71A 2R8GA 1ZQKA 1Q3UA 1XO0A 2ZIXA 4F5QA 5KFWA 4EX6A 4OD0A 5KFJA 4IQVA 2ATLA 8ICBA 3DV9A 2K8CB 2C28A 4TURA 3MGVA 2W9BB 2DQNB 3T5LA 4DFJA 5B5EU 2I9GA 3D2SA 1X9MA 4Y2TA 2YX8A 4DSJA 3ZD9A 5KT4A 3LVVA 5AKXA 5ALNA 4BX9C 2BCSA 4Z6CA 2F8LA 1KW4A 4J9RA 4Y2JA 2PMZC 5AI4A 2OYYA 4F91B 2PMZF 5T14A 3N28A 2W11A 1L5UA 5DB9A 2MUTB 3JPTA 5G5GA 4NM2A 3RH6A 1L3SA 2BCUA 4J9OA 2JMGA 1OUQA 4KLEA 4F4YA 4ED6A 3OSPA 2EAMA 4YQWA 4C4SA 4IQTA 1DXSA 3H0LB 5EOZA 5JTIA 1ZQ1C 2ZTCA 4EEYA 1RYSA 5KFHA 2HBMA 1P7DA 4IRCA 5AKIA 1UQVA 3N7RC 3C5FA 2VA3A 3WKBA 3NRZA 1U48A 1WYGA 2HOIA 4YXJA 2W8LA 4DSFA 1N48A 3PMNA 3JPQA 1ECWA 2PKEA 3KKAA 2QB1A 9ICKA 3M9OB 7ICMA 2HVHA 4O5EA 3HPOA 4F2SA 2ZUDA 3IP4B 1QCKA 2N1RA 5F3XB 4DQPA 3C5GA 4RQ6A 2F1JA 1PVPA 2VKQA 1F44A 1QSYA 1IIPA 2OCEA 5KG5A 4DS5A 1NJXA 3QNMA 3WU2U 3F5EA 5HMMA 2K8BB 1B0XA 3OPXA 5AM4A 2CXYA 5DLGA 5J2CA 4UB5A 2OEHA 4R65A 2Y0SC 5AI9A 1ZQJA 4IRDA 2NRWA 2Y0SF 4RQ7A 2EAOA 3L5KA 4ECXA 3QUBA 5KT6A 4BJQA 3O0FA 9ICAA 4R8UB 5KT7A 1KEJA 3C21A 3H0RB 2LPEA 5J8YA 5B66U 2KZZA 5TZVA 4PZNA 4F3OA 5AM5A 1QTMA 4KLUA 4RQ2A 3U26A 1JI7A 2LBOA 2W9BA 2GLEA 3BZKA 3HP6A 3BJYA 1L7MA 2B0CA 4C8NA 5DG8A 4K4GA 1DOQA 2HW3A 1S9FA 1QQ6A 1RG6A 1YZ6A 3ZDEA 1RZTA 8ICSA 5J2KA 5J2JA 3UMBA 4QNLA 2OXOA 3OHAA 4Y2PA 3BZCA 5ALHA 2W8KA 4EZ6A 2PFNA 2MUTA 2RP5A 5ALJA 5CWRA 4QZEA 4I2HA 4P2HA 3Q8PB 3ZDAA 8ICEA 4DQIA 4TQRA 1LB2B 3BQ7A 8ICGA 1A77A 2JH1A 2JEGA 4F2RA 2L5YA 3G6XA 4DEZA 3RJKA 2HOFA 3PMLA 3FM9A 5KG7A 1S10A 2EZZA 2B6GA 1PVQA 2F76X 3RAQA 1ZD5A 4M9LA 2HBJA 2I1QA 4KLMA 4RQ0A 1KQQA 1ZQOA 4GC7A 2PI5A 4OJLA 1F5SA 3N97B 1XS9D 4G3IA 1ZQLA 1H38A 2AQ4A 4B9VA 1SWVA 4BWMA 3AQEA 2YTUA 4KMOB 9ICQA 3D2NA 5CP2A 7ICPA 3T3FA 1VDVA 2A19A 3EUB2 1RDFA 1RYUA 3QYPA 2JEJA 2ALZA 2D3DA 5J0SA 3V7KA 1KFDA 5AKEA 2K60A 4UBCA 3RB3A 4M9NA 4QWAA 4R8UA 9ICBA 3TFSA 2DKXA 2MRLA 1N56A 4UQGA 5KFKA 5KL1B 3QUQA 4RUCA 3H40A 1COOA 4GC6A 3RF9A 2IMWP 4O5KA 8ICQA 2ZJAA 3PW2A 2RDJA 7ICEA 4O3PA 3F2DA 2JGAA 1U4BA 3M7DA 2HHXA 4NJ8A 4RQNA 1ZD3A 2E1EA 3SMVA 1S0VA 1S97A 5GTHU 2Y1JA 4Y2SA 4M9JA 4FO6A 3KHHA 5KFUA 2EZYA 3JPOA 1RQLA 5ALWA 2J6UA 1D8LA 1UCVA 4AP9A 4I2EA 3GU3A 2RDIA 1CRXA 4J9PA 1BVSA 4DL4A 4NY8A 2G06A 7ICSA 1NJZA 7ICTA 5EE0A 3GIKA 5HHIA 9ICLA 3LDAA 3EW9A 4DL3A 1ZQRA 1ZQYA 3MR5A 4J9LA 3NVZA 2IOHA 5DBCA 3AQFA 4UB2A 3T5HA 5L9XA 2XY7A 5KG3A 4DFKA 5H2FU 4YMNA 1UA1A 1SWWA 3AU2A 1ZQXA 2KIWA 3PW7A 4E0DA 4DS4A 1PUZA 4TUPA 5KT5A 1L8LA 3SQIA 2HI0A 2ZIUA 5L1IA 1T94A 4QJFB 3SAHA 3BS7A 3SZ2A 1BPEA 1WCNA 3FYHA 3RR7A 9ICOA 3CYMA 1KSPA 1TE2A 1WWUA 3UMCA 1LKYB 4R66A 3THVA 2C2DA 5DBAA 2G08A 1ZQAA 4RNMA 2KNJA 5L1KA 3DEEA 3KHRA 7ICRA 4QW8A 3RBEA 3RJJA 3EWAA 5HNKA 1NKCA 3RB0A 1HUOA 4ZH4A 2R8JA 1SKWA 4DSKA 4ECZA 5CRXA 1FEZA 3PO5A 1QQ7A 2W3SA 5AIBA 4KLSA 1WG8A 3AUOA 1LVHA 4PGXA 5ALEA 5KT3A 1KFTA 2W55A 3OSNA 1MA7A 3H8JA 5AKKA 3M9MB 2ZIVA 4Y2UA 3RH5A 4HAIA 4YR2A 2GH1A 1ZQHA 3ISBA 4U6PA 3SV4A 1YZ7A 4I2BA 5J0QA 3C28A 2W04A 3LWLA 5AKYA 3Q8SB 2AHOB 1SXDA 4F92B 4P4OA 5AI5A 2H3VA 2W43A 7ICLA 2EANA 3QU7A 5EE1A 2KG5A 2LYBA 1C7YA 4QZAA 4M0AA 3HW8A 3IN5A 5CR0A 8ICHA 4I2GA 4JV0A 1Z4OA 3M1YA 1T3QA 3HKZC 3HKZF 3AMZA 1NJWA 1ZOLA 3M9NB 2KHVA 3D2QA 3GV8B 1TK0A 2E8OA 4IR9A 1XSLA 2JXJA 5ALZA 4PGYA 1NKEA 5JRTA 3GIIA 4UB6U 1WUDA 5KAIU 4C80A 4M04A 3BS5A 4M2YA 3I1YA 5JUMA 3N7SC 1JUDA 3PR5B 1RM6C 2ODGA 2BQUA 1X66A 2R8IA 4UATA 2V9WA 4DLGA 3QE9Y 2HHQA 4Z6EA 3MGHA 3TKAA 5A0LA 1BNPA 3RFAA 5J2BA 3UXPA 1X42A 3NTUA 3RH4A 4RQ4A 1RQNA 2W9MA 2ZTEA 1ZQPA 4NLZA 1Z19A 1Q46A 4QZBA 4BDPA 4MEYA 4QZHA 1X9XA 4MF8A 4IRKA 2A1JB 4XQ8A 3J81j 3QX7A 3RJIA 2BCRA 4ELVA 3N7PD 3IG8A 5HMLA 2AXTU 2ZIWA 4OCZA 4QZ8A 1OXJA 1YT3A 5DDMA 4UB1A 2F1IA 2IHNA 1A0PA 4EENA 5TISU 3ORYA 4RUAA 1KBUA 4I2FA 2BPFA 4F50A 4DOCA 2AJQA 3B0XA 9ICJA 8ICFA 2VJ4A 1TK5A 3T79A 4Q44A 3A0BU 4I2CA 2BCQA 1CUKA 4KLDA 3SEIA 1B22A 3WKCA 2WFAA 3ZDBA 3V6JA 2HHSA 1A76A 5KFPA 2KVSA 3IM1A 3C2KA 5EE9A 2WF6A 5KFEA 1PK1B 1EXNA 5ALFA 2DBYA 3PX4A 2I6XA 3F5AA 3SI8A 2KSOB 1BGXT 1UT5A 2AGPA 1ZQMA 4NL9A 4R63A 2KKVA 5KL8B 5DGBA 4YCXA 5HR7A 3IDWA 1L3UA 3SYZA 5DB8A 4YN4A 2F2AB 2XIDA 5L1LA 2XCAA 3GZFA 1L3VA 3H8SA 5HHHA 1NK4A 3QUCA 5J2DA 4PGQA 4DSIA 2K4IA 4IL6U 4KLFA 4OJ6A 4GLXA 9ICXA 3FAHA 5EWFA 2XICA 5J2GA 1PZNA 5J29A 2XGQA 3ZDDA 1ZQDA 3PSFA 2F8KA 5BOLA 4EBDA 4YFKA 3PR4A 2UVVA 1XNSA 2RRDA 2LYAA 5KT2A 1KKXA 1ZQSA 2FPMA 4DFPA 4RQMA 2W3RA 1HEKA 7ICQA 3MDCA 3K75D 3TACB 2BPGA 2XI9A 4LZGA 2F44A 5AK5A 3H4BA 1SIJA 5AK6A 2A1JA 1JXEA 2XGPA 1UA0A 1RPLA 3QXGA 4C7YA 5ALSA 1VJ5A 3GV7B 2XY6A 1S0OA 2AGQA 2ISOA 4UB8U 5KFRA 4KN4A 2D8CA 1NJYA 4XRHA 4B9TA 2ZJ8A 4ECYA 5J2AA 2HHTA 1SXEA 4EYHB 2IBKA 9ICEA 4QIWC 5ALYA 4EZ9A 2K4PA 4QIWF 3JPSA 1NK7A 2AH5A 4ELTA 5AICA 3ISCA 1SZPA 4RQ1A 4Y2VA 4DF8A 2VIXA 5ALPA 1SV4A 4QZFA 2BQ3A 2MU2A 3SR6A 3G6YA 2XO7A 4U7CA 3EPGA 2DFLA 4B9UA 4NL9C 4I2IA 4RPZA 2K89A 3RJGA 4I27A 9ICRA 1JROA 4BXOB 8ICIA 2ZUBA 2KP7A 5KFSA 4YMMA 1PK1A 8ICPA 3JPNA 4MFCA 9ICNA 4CRXA 5AKLA 3H8WA 3KZXA 1TVAA 2E1FA 4YD1A 4DLEA 2KSOA 2OWOA 8ICTA 5KG4A 4DFMA 5IINA 5IIOA 3WKDA 1V38A 5KFNA 2O6KA 1ZETA 3QEAZ 4FFDA 4ACOA 4J9KA 3PX6A 5KFVA 2H3FA 1CI4A 3VCBA 1KTQA 5KFFA 8ICMA 1FFVA 1SV0A 2E8NA 4RNOA 2XC9A 3RB4A 4UB3A 4FZNA 4PHEA 3KKAC 5D4BA 2W7OA 2Y9UA 4TUSA 1DK3A 1F0MA 4F5OA 2PFOA 2RQ5A 4FS1A 1N62A 5AI8A 1J2MA 2H3ZA 3GV5B 1J2NA 8ICRA 3LK9A 4P0PB 2HSZA 2KV2A 2BDUA 3V6HA 3KFUF 9ICUA 2QKQA 2JV3A 4PZOA 4KMUA 2YMMA 4YD2A 2NV3A 3KZIU 3BQTA 2ZIUB 1OW5A 2YMLA 4BUGA 1ZQBA 5EE3A 5K4LA 3IHQB 5C5JA 1QQ5A 5F9NA 2WHEA 5IIIA 4GXIA 5J8YC 3ONNA 4JUZA 5ALIA 4YP3A 2OM6A 1D8YA 2EDUA 4YXMA 3ED5A 3RJFA 1HUZA 1ZYQA 3EYZA 4MFAA 3MFIA 3JPRA 4GXKA 3C23A 3B9JA 5CEHA 2P35A 1N60A 2WTFA 1KL9A 4GFJA 2G07A 4CCHA 5ALOA 1T8EA 5AM2A 2H3QA 4CNQA 3ISDA 4EYIB 4KLTA 4UB4A 4Z6FA 8ICCA 2KZ3A 5E79U 3GQCA 4Y2YA 1TAUA 1Z3EB 2J6SA 3SD7A 2E8PA 5F9LA 2KTQA 3KBBA 3HRDD 1MC8A 1Q8KA 3OJSA 3TFRA 3L4PA 2W9AA 3IG5A 2FLPA 1N63A 4BXOA 4DCCA 2HHUA 3RTVA 1N5WA 2ZIVB 5J0PA 9ICTA 5J0TA 1S5LU 1V97A 1JX4A 3K1ZA 1BPYA 1ZQEA 4LJXA 7ICGA 3WK8A 1ED1A 5DB6A 4DQRA 1L7NA 2BCVA 1ZQGA 1ZQZA 8ICYA 3Q8RB 3PSTA 4IR1A 4C8OA 1JN3A 3SV3A 4C8MA 4FZMA 5KFYA 5DG7A 2Q0ZX 5KG2A 2IOFA 2V4RA 1ZJNA 2I5HA 1NK9A 2K8AA 4RQ8A 3GDXA 2ZUCA 3HILA 4KLOA 1N61A 3NUQA 4P0PA 1Z00A 3UXNA 1L6NA 5KFXA 4K4IA 3UMGA 5KFBA 1NKBA 3AL0B 4DOAA 4KX5A 3BS5B 4RQ5A 1N2XA 2FPKA 3WK7A 1URJA 4DL6A 9ICPA 1KN5A 2PFQA 1X6JA 1BNOA 4OJ5A 3IV6A 4TQSA 2KJ9A 2W54A 1TAMA 3ALRA 4O3MA 3E2EA 1KLNA 5DKWA 1ZQWA 4XA5A 1UHUA 4Q45A 2P6RA 2UVUA 1WCLA 2BZFA 2LKYA 2VA8A 1V85A 2WF9A 4KITB 4B9MA 5KFMA 2A1AA 3NS1A 3RBDA 1ZQVA 3TADA 5AM0A 4PHPA 2PI4A 1MQ3A 3QU2A 4GIBA 8ICWA 4M9GA 3TANA 2DPIA 5ALDA 1MSWD 2ZIWB 1NK8A 4O3OA 3TARA 4MHVA 4CF3A 1U49A 5J2EA 5J0XA 1NK0A 5ALLA 4NLGA 2QARB 4ZOHC 4MEXA 1DRGA 2KFZA 5EWEA 1BPXA 4QZDA 3BQ0A 2IHMA 4EELA 1IG6A 1ZRNA 3FDSA 3Q8LA 2HBKA 1IXRA 5DG9A 1HJPA 1AQ6A 3ICXA 4CF4A 2NRZA 2ZJ5A 5D49A 4O9MA 2ZXHA 2BPCA 2AGOA 1TK8A 4MFFA 1XSPA 4CGZA 2UVWA 7ICNA 4BWJA 4YG2A 2ASDA 3NVWA 1SL0A 2NO4A 5DLFA 1TV9A 4ELUA 3C1YA 2FMQA 2KK0A 2JEFA 5ALKA 4AYBF 4ECVA 1TFRA 2LHTA 1ZD2P 2YQEA 5AI0A 2K4EA 3LVWA 4YR0A 7ICHA 4KLGA 3M6ZA 4QWDA 4LZDA 4I28A
chains in the Genus database with same CATH topology
5H2FU 5B66U 3WU2U 3A0BU 5E79U 5KAFU 2AXTU 3A0HU 5GTHU 4IL6U 2DUYA 4UB6U 4PJ0U 3KZIU 5KAIU 4UB8U 5TISU 5GTIU 1S5LU 5B5EU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F U;  5B66 U;  3WU2 U;  3A0B U;  5E79 U;  5KAF U;  2AXT U;  3A0H U;  5GTH U;  4IL6 U;  2DUY A;  4UB6 U;  4PJ0 U;  3KZI U;  5KAI U;  4UB8 U;  5TIS U;  5GTI U;  1S5L U;  5B5E U; 
#chains in the Genus database with same CATH topology
 3NVY A;  4F72 A;  3SAF A;  1X9S A;  4TUQ A;  5KFG A;  9ICM A;  2MAX A;  1DGJ A;  2K4H A;  8ICO A;  1L8O A;  4Y2X A;  3V6K A;  3E0F A;  3RJH A;  4ECQ A;  1QH9 A;  2LMR A;  5KFT A;  3NVV A;  4I2D A;  1RYR A;  2KVC A;  1XO1 A;  4HYK A;  1GO3 F;  3CRX A;  2FE9 A;  3L3F X;  4F5R A;  3TAD C;  3C29 A;  3BDP A;  9ICF A;  3ZI4 A;  2F77 X;  4ECS A;  1ZQU A;  9ICV A;  1T3N A;  3IRU A;  3PV8 A;  1NI3 A;  3ETL A;  3KHL A;  3PNC A;  4Q43 A;  1S8O A;  3KD3 A;  1TKD A;  1V9P A;  5L1M A;  1LV5 A;  1SZH A;  4DFD A;  5KFQ A;  2BGW A;  2BDP A;  4O3R A;  4ICA A;  3S6J A;  4QZ9 A;  1BPZ A;  4C8K A;  2E5S A;  4UAS A;  4DF4 A;  1C20 A;  3UM9 A;  2JHD A;  1Z1B A;  3SEN A;  4KLH A;  4O3Q A;  4M47 A;  3H7I A;  2WF5 A;  4O5C A;  4J9Q A;  2QAR A;  2NO5 A;  3OHB A;  4UAR A;  3RRH A;  3RB6 A;  3CW2 C;  2DWQ A;  5DGA A;  2WB1 C;  3MR6 A;  3QEB Z;  1ZD4 A;  2WB1 F;  1M6Y A;  3KOO A;  4KTQ A;  3T5J A;  4NLN A;  1SKR A;  7ICU A;  1S76 D;  7ICF A;  5IIL A;  5KFL A;  4P0Q B;  1QSL A;  4JK1 A;  2Y9T A;  8ICN A;  1MN8 A;  4PHA A;  2VA2 A;  1ZQQ A;  5AKZ A;  3PX0 A;  1BPD A;  4CF5 A;  2YN4 A;  3F53 A;  4QZG A;  1PK3 A;  2BKE A;  3TAQ A;  2V4Q A;  2P66 A;  4UAY A;  4FZL A;  1D9D A;  1L7P A;  4Q8E A;  5AM3 A;  2ASJ A;  3DDH A;  1HIW A;  2HOQ A;  1S77 D;  8ICZ A;  2CPR A;  4NV0 A;  3V72 A;  4ED0 A;  2GO7 A;  5BOM A;  2YMP A;  3WK9 A;  4EBC A;  4US9 A;  4FE3 A;  4PL1 A;  4YR3 A;  4F93 B;  2CRX A;  3QU9 A;  3TAP A;  1FO4 A;  1K1Q A;  4EEK A;  5IIK A;  4XUS A;  2W9C B;  3BQ2 A;  3T5K A;  4EBE A;  4RPX A;  3TI0 A;  1NK6 A;  3C1Z A;  3MBY A;  3C2L A;  4CE6 A;  2F3N A;  4C4R A;  2JZB B;  3QZ7 A;  5HR6 A;  2FDR A;  1DGS A;  5AK3 A;  2EAP A;  5GTI U;  1B4F A;  2HCF A;  2KJ5 A;  2Q4T A;  4FBU A;  4C4T A;  2KIC A;  5KG1 A;  2B21 A;  4OJO A;  1SB3 C;  2RLT A;  5KFI A;  3KTQ A;  3ZDC A;  3ETR A;  4F5P A;  5ALT A;  1T7P A;  5ALV A;  3NGD A;  4PJ0 U;  1Z4N A;  4UAZ A;  1ZQN A;  5KFC A;  9ICS A;  8ICK A;  4KLJ A;  5DDY A;  1Z1V A;  4NXZ A;  2ZG6 A;  3Q8M A;  3VC8 A;  1K1S A;  4IQW A;  4UAV A;  4B6J A;  4J9N A;  2ASL A;  5ALU A;  4PL2 A;  2LYH A;  3PO4 A;  3NRW A;  2VJ5 A;  4P0Q A;  4I2J A;  2E8M A;  3AM9 A;  2XY5 A;  1NOM A;  2KMD A;  2KJ8 A;  5KFD A;  1X6I A;  1JMS A;  4RU9 A;  7ICJ A;  4UBB A;  4YMO A;  4I2A A;  3I76 A;  9ICH A;  5FP0 A;  3RR8 A;  3AN1 A;  5AHX A;  4RNN A;  2ZTD A;  5BPC A;  1Q3V A;  2LM1 A;  4ED3 A;  3B0Y A;  2DF4 B;  1DK2 A;  2FLN A;  1XU4 A;  3CNH A;  5CJ7 A;  3EZ5 A;  3RRG A;  2HHV A;  9ICC A;  4DOB A;  1NNL A;  1S0M A;  2EH9 A;  3I28 A;  4I29 A;  5J0R A;  4UAW A;  3PW5 A;  3PZP A;  2G5I B;  4GXJ A;  4JB3 A;  5KFZ A;  3LWM A;  1KDH A;  2KZM A;  2JR5 A;  3G6V A;  1Y88 A;  2HBL A;  4P4P A;  2PFP A;  2QB0 B;  2W7P A;  3H0M B;  2NYV A;  2AQ0 A;  1ARO P;  5JU5 A;  5ALR A;  3MR2 A;  3H8M A;  4EX7 A;  2W9C A;  5AK4 A;  3RAX A;  2JH7 A;  4NLC A;  1Z00 B;  3AU6 A;  2D6F C;  5EWG A;  1U9L A;  4IQU A;  3MDA A;  2NRX A;  4QZI A;  1PVR A;  1ZQC A;  2JZB A;  2C2E A;  4Z6D A;  3PW4 A;  2FJ6 A;  2EQY A;  1BPB A;  1UT8 A;  5IIM A;  4UW9 A;  4B9S A;  3WK6 A;  4Y2R A;  3AEV A;  1KFS A;  3HT3 A;  4QWB A;  4DQQ A;  5CB1 A;  1X40 A;  4NWI A;  1ZQF A;  2KIV A;  4Y2Q A;  4IC9 A;  2R8H A;  4ECT A;  2ES6 A;  2HMX A;  2GWS A;  3HWT A;  5DQH A;  5IIJ A;  2P6U A;  3SAG A;  4B9L A;  1X2I A;  3QZ8 A;  5G5H A;  8ICU A;  8ICA A;  5AKJ A;  1JAL A;  3CP8 A;  1QLN A;  3MGI A;  4KLQ A;  4FS2 A;  5KFO A;  3EPI A;  4ED1 A;  4ECR A;  3H4D A;  1S0N A;  3PY8 A;  1JXL A;  4KN7 A;  3UXO A;  4ED2 A;  9ICI A;  2UVR A;  4WJ3 B;  2RHF A;  3WK4 A;  2H3I A;  7ICK A;  5ALX A;  2ZXI A;  1KRP A;  4QW9 A;  4DL7 A;  1SL1 A;  5L1J A;  5J2I A;  3K1R B;  1N5X A;  2M0N A;  2FMS A;  4F4K A;  3OTQ A;  1JIH A;  3QU5 A;  4JWN A;  4KLI A;  3OJU A;  1XC9 A;  2KFN A;  5DQG A;  2KOB A;  2LM4 A;  4KX3 A;  5J0Y A;  1SV0 C;  3LYS A;  2WF8 A;  3QU4 A;  3Q8K A;  3FC4 A;  2LI6 A;  4RT3 A;  3PVX A;  2Y1I A;  4ED7 A;  4F4X A;  4B9N A;  2WF7 A;  5CHG A;  2GOL A;  2XVT A;  4PPX A;  5J0U A;  1FIQ A;  3HX0 A;  4F4Z A;  2PXI A;  2M9N A;  2YY6 A;  5ALQ A;  4NM1 A;  2F1H A;  2QB0 A;  3M6K A;  1NZP A;  4ECW A;  3R9K A;  4RT2 A;  1ZJM A;  2YMQ A;  5DBB A;  7ICO A;  5C0Y A;  2KKP A;  1D8B A;  2KE7 A;  2AU0 A;  3UQ0 A;  4J9S A;  1ZQI A;  1COK A;  1SKS A;  1SGG A;  4K4H A;  3GIL A;  1XSN A;  3F2B A;  2Z7J A;  5J2H A;  2WAQ C;  1VLB A;  2WAQ F;  4RPY A;  2HDO A;  2JEI A;  4J9M A;  5AKG A;  1J97 A;  2FI1 A;  3A0H U;  4DO9 A;  2BQR A;  2W03 A;  1X9W A;  3HJE A;  2IOF K;  4P4M A;  1T4G A;  1NZB A;  3K4G A;  2DL0 A;  3KHG A;  3MFH A;  3MC1 A;  5J0O A;  5AKH A;  1D9F A;  2CN1 A;  4JWM A;  4O3N A;  4US8 A;  1IM4 A;  4J03 A;  5DQI A;  4O0I A;  1IV8 A;  2C22 A;  1MQ2 A;  3D6J A;  1FFU A;  3WKE A;  2R18 A;  3GFK B;  3QUT A;  4RQ3 A;  8ICL A;  3N4M B;  9ICG A;  2C2R A;  4UAU A;  4A8E A;  3E58 A;  4M6W B;  4QZC A;  2HVI A;  3UQ2 A;  3V7L A;  2FMP A;  5J2F A;  3PSI A;  4DWI A;  2YB4 A;  3OGU A;  4C0Z A;  5AIA A;  4Q8F A;  2OH2 A;  2MSN A;  3WK5 A;  4DQS A;  1UPH A;  4PH5 A;  2DUY A;  7ICV A;  2ISP A;  4FBT A;  5KTQ A;  3PSP A;  4IS7 A;  2NRV A;  1B43 A;  2OHF A;  1K5O A;  4JV2 A;  4OO1 J;  5KG0 A;  5AM1 A;  2IA6 A;  1JRP A;  2ZIX B;  4RZR A;  4CDG A;  4R64 A;  4BGD A;  2G0A A;  2KHQ A;  1A6S A;  5KAF U;  2E3T A;  3JPP A;  1O03 A;  4ED8 A;  1ZXI A;  2EZX A;  2NRT A;  2G09 A;  2FPL A;  4JMU A;  2KD1 A;  2HHW A;  4JV1 A;  4AYB C;  3C2M A;  3UPQ A;  1CEZ A;  5AI6 A;  4NLK A;  3WKA A;  2KN7 A;  4DSL A;  2KEY A;  3GIM A;  3GIJ A;  1XWL A;  1U47 A;  3M8R A;  4DL5 A;  4PHD A;  1ZQT A;  4DL2 A;  1QSS A;  2A3V A;  3F2C A;  3RJE A;  4C8L A;  1SL2 A;  4F5N A;  4QWC A;  2G5H B;  3Q8Q B;  1NK5 A;  1RXW A;  2J6T A;  4O3S A;  2XCP A;  4F8R A;  1TAQ A;  1L3T A;  4F4W A;  2VAN A;  4OJP A;  3V7J A;  1O08 A;  3PW0 A;  4X5V A;  1RXV A;  5HP4 A;  7ICI A;  1WWV A;  5ALM A;  5CA7 A;  2H5X A;  4DSE A;  2DKZ A;  3MAB A;  5ALG A;  2R8K A;  2YB1 A;  2BR0 A;  2FLL A;  3TQ1 A;  3MR3 A;  1LKY A;  4USA A;  4M9H A;  1L7O A;  4QWE A;  4C7Z A;  1U45 A;  9ICW A;  2BHN A;  2ESE A;  5DB7 A;  3NAS A;  3M8S A;  2DPJ A;  8ICJ A;  4YVZ A;  8ICV A;  1ZRM A;  4MF2 A;  4NLB A;  2DGZ A;  4M6W A;  8ICX A;  2QLT A;  5J0W A;  4KLL A;  2JRZ A;  4G9B A;  3ZD8 A;  3BQ1 A;  5D46 A;  5KFA A;  4LVS A;  5KG6 A;  4ECU A;  2MA1 A;  5KNI A;  4F71 A;  2R8G A;  1ZQK A;  1Q3U A;  1XO0 A;  2ZIX A;  4F5Q A;  5KFW A;  4EX6 A;  4OD0 A;  5KFJ A;  4IQV A;  2ATL A;  8ICB A;  3DV9 A;  2K8C B;  2C28 A;  4TUR A;  3MGV A;  2W9B B;  2DQN B;  3T5L A;  4DFJ A;  5B5E U;  2I9G A;  3D2S A;  1X9M A;  4Y2T A;  2YX8 A;  4DSJ A;  3ZD9 A;  5KT4 A;  3LVV A;  5AKX A;  5ALN A;  4BX9 C;  2BCS A;  4Z6C A;  2F8L A;  1KW4 A;  4J9R A;  4Y2J A;  2PMZ C;  5AI4 A;  2OYY A;  4F91 B;  2PMZ F;  5T14 A;  3N28 A;  2W11 A;  1L5U A;  5DB9 A;  2MUT B;  3JPT A;  5G5G A;  4NM2 A;  3RH6 A;  1L3S A;  2BCU A;  4J9O A;  2JMG A;  1OUQ A;  4KLE A;  4F4Y A;  4ED6 A;  3OSP A;  2EAM A;  4YQW A;  4C4S A;  4IQT A;  1DXS A;  3H0L B;  5EOZ A;  5JTI A;  1ZQ1 C;  2ZTC A;  4EEY A;  1RYS A;  5KFH A;  2HBM A;  1P7D A;  4IRC A;  5AKI A;  1UQV A;  3N7R C;  3C5F A;  2VA3 A;  3WKB A;  3NRZ A;  1U48 A;  1WYG A;  2HOI A;  4YXJ A;  2W8L A;  4DSF A;  1N48 A;  3PMN A;  3JPQ A;  1ECW A;  2PKE A;  3KKA A;  2QB1 A;  9ICK A;  3M9O B;  7ICM A;  2HVH A;  4O5E A;  3HPO A;  4F2S A;  2ZUD A;  3IP4 B;  1QCK A;  2N1R A;  5F3X B;  4DQP A;  3C5G A;  4RQ6 A;  2F1J A;  1PVP A;  2VKQ A;  1F44 A;  1QSY A;  1IIP A;  2OCE A;  5KG5 A;  4DS5 A;  1NJX A;  3QNM A;  3WU2 U;  3F5E A;  5HMM A;  2K8B B;  1B0X A;  3OPX A;  5AM4 A;  2CXY A;  5DLG A;  5J2C A;  4UB5 A;  2OEH A;  4R65 A;  2Y0S C;  5AI9 A;  1ZQJ A;  4IRD A;  2NRW A;  2Y0S F;  4RQ7 A;  2EAO A;  3L5K A;  4ECX A;  3QUB A;  5KT6 A;  4BJQ A;  3O0F A;  9ICA A;  4R8U B;  5KT7 A;  1KEJ A;  3C21 A;  3H0R B;  2LPE A;  5J8Y A;  5B66 U;  2KZZ A;  5TZV A;  4PZN A;  4F3O A;  5AM5 A;  1QTM A;  4KLU A;  4RQ2 A;  3U26 A;  1JI7 A;  2LBO A;  2W9B A;  2GLE A;  3BZK A;  3HP6 A;  3BJY A;  1L7M A;  2B0C A;  4C8N A;  5DG8 A;  4K4G A;  1DOQ A;  2HW3 A;  1S9F A;  1QQ6 A;  1RG6 A;  1YZ6 A;  3ZDE A;  1RZT A;  8ICS A;  5J2K A;  5J2J A;  3UMB A;  4QNL A;  2OXO A;  3OHA A;  4Y2P A;  3BZC A;  5ALH A;  2W8K A;  4EZ6 A;  2PFN A;  2MUT A;  2RP5 A;  5ALJ A;  5CWR A;  4QZE A;  4I2H A;  4P2H A;  3Q8P B;  3ZDA A;  8ICE A;  4DQI A;  4TQR A;  1LB2 B;  3BQ7 A;  8ICG A;  1A77 A;  2JH1 A;  2JEG A;  4F2R A;  2L5Y A;  3G6X A;  4DEZ A;  3RJK A;  2HOF A;  3PML A;  3FM9 A;  5KG7 A;  1S10 A;  2EZZ A;  2B6G A;  1PVQ A;  2F76 X;  3RAQ A;  1ZD5 A;  4M9L A;  2HBJ A;  2I1Q A;  4KLM A;  4RQ0 A;  1KQQ A;  1ZQO A;  4GC7 A;  2PI5 A;  4OJL A;  1F5S A;  3N97 B;  1XS9 D;  4G3I A;  1ZQL A;  1H38 A;  2AQ4 A;  4B9V A;  1SWV A;  4BWM A;  3AQE A;  2YTU A;  4KMO B;  9ICQ A;  3D2N A;  5CP2 A;  7ICP A;  3T3F A;  1VDV A;  2A19 A;  3EUB 2;  1RDF A;  1RYU A;  3QYP A;  2JEJ A;  2ALZ A;  2D3D A;  5J0S A;  3V7K A;  1KFD A;  5AKE A;  2K60 A;  4UBC A;  3RB3 A;  4M9N A;  4QWA A;  4R8U A;  9ICB A;  3TFS A;  2DKX A;  2MRL A;  1N56 A;  4UQG A;  5KFK A;  5KL1 B;  3QUQ A;  4RUC A;  3H40 A;  1COO A;  4GC6 A;  3RF9 A;  2IMW P;  4O5K A;  8ICQ A;  2ZJA A;  3PW2 A;  2RDJ A;  7ICE A;  4O3P A;  3F2D A;  2JGA A;  1U4B A;  3M7D A;  2HHX A;  4NJ8 A;  4RQN A;  1ZD3 A;  2E1E A;  3SMV A;  1S0V A;  1S97 A;  5GTH U;  2Y1J A;  4Y2S A;  4M9J A;  4FO6 A;  3KHH A;  5KFU A;  2EZY A;  3JPO A;  1RQL A;  5ALW A;  2J6U A;  1D8L A;  1UCV A;  4AP9 A;  4I2E A;  3GU3 A;  2RDI A;  1CRX A;  4J9P A;  1BVS A;  4DL4 A;  4NY8 A;  2G06 A;  7ICS A;  1NJZ A;  7ICT A;  5EE0 A;  3GIK A;  5HHI A;  9ICL A;  3LDA A;  3EW9 A;  4DL3 A;  1ZQR A;  1ZQY A;  3MR5 A;  4J9L A;  3NVZ A;  2IOH A;  5DBC A;  3AQF A;  4UB2 A;  3T5H A;  5L9X A;  2XY7 A;  5KG3 A;  4DFK A;  5H2F U;  4YMN A;  1UA1 A;  1SWW A;  3AU2 A;  1ZQX A;  2KIW A;  3PW7 A;  4E0D A;  4DS4 A;  1PUZ A;  4TUP A;  5KT5 A;  1L8L A;  3SQI A;  2HI0 A;  2ZIU A;  5L1I A;  1T94 A;  4QJF B;  3SAH A;  3BS7 A;  3SZ2 A;  1BPE A;  1WCN A;  3FYH A;  3RR7 A;  9ICO A;  3CYM A;  1KSP A;  1TE2 A;  1WWU A;  3UMC A;  1LKY B;  4R66 A;  3THV A;  2C2D A;  5DBA A;  2G08 A;  1ZQA A;  4RNM A;  2KNJ A;  5L1K A;  3DEE A;  3KHR A;  7ICR A;  4QW8 A;  3RBE A;  3RJJ A;  3EWA A;  5HNK A;  1NKC A;  3RB0 A;  1HUO A;  4ZH4 A;  2R8J A;  1SKW A;  4DSK A;  4ECZ A;  5CRX A;  1FEZ A;  3PO5 A;  1QQ7 A;  2W3S A;  5AIB A;  4KLS A;  1WG8 A;  3AUO A;  1LVH A;  4PGX A;  5ALE A;  5KT3 A;  1KFT A;  2W55 A;  3OSN A;  1MA7 A;  3H8J A;  5AKK A;  3M9M B;  2ZIV A;  4Y2U A;  3RH5 A;  4HAI A;  4YR2 A;  2GH1 A;  1ZQH A;  3ISB A;  4U6P A;  3SV4 A;  1YZ7 A;  4I2B A;  5J0Q A;  3C28 A;  2W04 A;  3LWL A;  5AKY A;  3Q8S B;  2AHO B;  1SXD A;  4F92 B;  4P4O A;  5AI5 A;  2H3V A;  2W43 A;  7ICL A;  2EAN A;  3QU7 A;  5EE1 A;  2KG5 A;  2LYB A;  1C7Y A;  4QZA A;  4M0A A;  3HW8 A;  3IN5 A;  5CR0 A;  8ICH A;  4I2G A;  4JV0 A;  1Z4O A;  3M1Y A;  1T3Q A;  3HKZ C;  3HKZ F;  3AMZ A;  1NJW A;  1ZOL A;  3M9N B;  2KHV A;  3D2Q A;  3GV8 B;  1TK0 A;  2E8O A;  4IR9 A;  1XSL A;  2JXJ A;  5ALZ A;  4PGY A;  1NKE A;  5JRT A;  3GII A;  4UB6 U;  1WUD A;  5KAI U;  4C80 A;  4M04 A;  3BS5 A;  4M2Y A;  3I1Y A;  5JUM A;  3N7S C;  1JUD A;  3PR5 B;  1RM6 C;  2ODG A;  2BQU A;  1X66 A;  2R8I A;  4UAT A;  2V9W A;  4DLG A;  3QE9 Y;  2HHQ A;  4Z6E A;  3MGH A;  3TKA A;  5A0L A;  1BNP A;  3RFA A;  5J2B A;  3UXP A;  1X42 A;  3NTU A;  3RH4 A;  4RQ4 A;  1RQN A;  2W9M A;  2ZTE A;  1ZQP A;  4NLZ A;  1Z19 A;  1Q46 A;  4QZB A;  4BDP A;  4MEY A;  4QZH A;  1X9X A;  4MF8 A;  4IRK A;  2A1J B;  4XQ8 A;  3J81 j;  3QX7 A;  3RJI A;  2BCR A;  4ELV A;  3N7P D;  3IG8 A;  5HML A;  2AXT U;  2ZIW A;  4OCZ A;  4QZ8 A;  1OXJ A;  1YT3 A;  5DDM A;  4UB1 A;  2F1I A;  2IHN A;  1A0P A;  4EEN A;  5TIS U;  3ORY A;  4RUA A;  1KBU A;  4I2F A;  2BPF A;  4F50 A;  4DOC A;  2AJQ A;  3B0X A;  9ICJ A;  8ICF A;  2VJ4 A;  1TK5 A;  3T79 A;  4Q44 A;  3A0B U;  4I2C A;  2BCQ A;  1CUK A;  4KLD A;  3SEI A;  1B22 A;  3WKC A;  2WFA A;  3ZDB A;  3V6J A;  2HHS A;  1A76 A;  5KFP A;  2KVS A;  3IM1 A;  3C2K A;  5EE9 A;  2WF6 A;  5KFE A;  1PK1 B;  1EXN A;  5ALF A;  2DBY A;  3PX4 A;  2I6X A;  3F5A A;  3SI8 A;  2KSO B;  1BGX T;  1UT5 A;  2AGP A;  1ZQM A;  4NL9 A;  4R63 A;  2KKV A;  5KL8 B;  5DGB A;  4YCX A;  5HR7 A;  3IDW A;  1L3U A;  3SYZ A;  5DB8 A;  4YN4 A;  2F2A B;  2XID A;  5L1L A;  2XCA A;  3GZF A;  1L3V A;  3H8S A;  5HHH A;  1NK4 A;  3QUC A;  5J2D A;  4PGQ A;  4DSI A;  2K4I A;  4IL6 U;  4KLF A;  4OJ6 A;  4GLX A;  9ICX A;  3FAH A;  5EWF A;  2XIC A;  5J2G A;  1PZN A;  5J29 A;  2XGQ A;  3ZDD A;  1ZQD A;  3PSF A;  2F8K A;  5BOL A;  4EBD A;  4YFK A;  3PR4 A;  2UVV A;  1XNS A;  2RRD A;  2LYA A;  5KT2 A;  1KKX A;  1ZQS A;  2FPM A;  4DFP A;  4RQM A;  2W3R A;  1HEK A;  7ICQ A;  3MDC A;  3K75 D;  3TAC B;  2BPG A;  2XI9 A;  4LZG A;  2F44 A;  5AK5 A;  3H4B A;  1SIJ A;  5AK6 A;  2A1J A;  1JXE A;  2XGP A;  1UA0 A;  1RPL A;  3QXG A;  4C7Y A;  5ALS A;  1VJ5 A;  3GV7 B;  2XY6 A;  1S0O A;  2AGQ A;  2ISO A;  4UB8 U;  5KFR A;  4KN4 A;  2D8C A;  1NJY A;  4XRH A;  4B9T A;  2ZJ8 A;  4ECY A;  5J2A A;  2HHT A;  1SXE A;  4EYH B;  2IBK A;  9ICE A;  4QIW C;  5ALY A;  4EZ9 A;  2K4P A;  4QIW F;  3JPS A;  1NK7 A;  2AH5 A;  4ELT A;  5AIC A;  3ISC A;  1SZP A;  4RQ1 A;  4Y2V A;  4DF8 A;  2VIX A;  5ALP A;  1SV4 A;  4QZF A;  2BQ3 A;  2MU2 A;  3SR6 A;  3G6Y A;  2XO7 A;  4U7C A;  3EPG A;  2DFL A;  4B9U A;  4NL9 C;  4I2I A;  4RPZ A;  2K89 A;  3RJG A;  4I27 A;  9ICR A;  1JRO A;  4BXO B;  8ICI A;  2ZUB A;  2KP7 A;  5KFS A;  4YMM A;  1PK1 A;  8ICP A;  3JPN A;  4MFC A;  9ICN A;  4CRX A;  5AKL A;  3H8W A;  3KZX A;  1TVA A;  2E1F A;  4YD1 A;  4DLE A;  2KSO A;  2OWO A;  8ICT A;  5KG4 A;  4DFM A;  5IIN A;  5IIO A;  3WKD A;  1V38 A;  5KFN A;  2O6K A;  1ZET A;  3QEA Z;  4FFD A;  4ACO A;  4J9K A;  3PX6 A;  5KFV A;  2H3F A;  1CI4 A;  3VCB A;  1KTQ A;  5KFF A;  8ICM A;  1FFV A;  1SV0 A;  2E8N A;  4RNO A;  2XC9 A;  3RB4 A;  4UB3 A;  4FZN A;  4PHE A;  3KKA C;  5D4B A;  2W7O A;  2Y9U A;  4TUS A;  1DK3 A;  1F0M A;  4F5O A;  2PFO A;  2RQ5 A;  4FS1 A;  1N62 A;  5AI8 A;  1J2M A;  2H3Z A;  3GV5 B;  1J2N A;  8ICR A;  3LK9 A;  4P0P B;  2HSZ A;  2KV2 A;  2BDU A;  3V6H A;  3KFU F;  9ICU A;  2QKQ A;  2JV3 A;  4PZO A;  4KMU A;  2YMM A;  4YD2 A;  2NV3 A;  3KZI U;  3BQT A;  2ZIU B;  1OW5 A;  2YML A;  4BUG A;  1ZQB A;  5EE3 A;  5K4L A;  3IHQ B;  5C5J A;  1QQ5 A;  5F9N A;  2WHE A;  5III A;  4GXI A;  5J8Y C;  3ONN A;  4JUZ A;  5ALI A;  4YP3 A;  2OM6 A;  1D8Y A;  2EDU A;  4YXM A;  3ED5 A;  3RJF A;  1HUZ A;  1ZYQ A;  3EYZ A;  4MFA A;  3MFI A;  3JPR A;  4GXK A;  3C23 A;  3B9J A;  5CEH A;  2P35 A;  1N60 A;  2WTF A;  1KL9 A;  4GFJ A;  2G07 A;  4CCH A;  5ALO A;  1T8E A;  5AM2 A;  2H3Q A;  4CNQ A;  3ISD A;  4EYI B;  4KLT A;  4UB4 A;  4Z6F A;  8ICC A;  2KZ3 A;  5E79 U;  3GQC A;  4Y2Y A;  1TAU A;  1Z3E B;  2J6S A;  3SD7 A;  2E8P A;  5F9L A;  2KTQ A;  3KBB A;  3HRD D;  1MC8 A;  1Q8K A;  3OJS A;  3TFR A;  3L4P A;  2W9A A;  3IG5 A;  2FLP A;  1N63 A;  4BXO A;  4DCC A;  2HHU A;  3RTV A;  1N5W A;  2ZIV B;  5J0P A;  9ICT A;  5J0T A;  1S5L U;  1V97 A;  1JX4 A;  3K1Z A;  1BPY A;  1ZQE A;  4LJX A;  7ICG A;  3WK8 A;  1ED1 A;  5DB6 A;  4DQR A;  1L7N A;  2BCV A;  1ZQG A;  1ZQZ A;  8ICY A;  3Q8R B;  3PST A;  4IR1 A;  4C8O A;  1JN3 A;  3SV3 A;  4C8M A;  4FZM A;  5KFY A;  5DG7 A;  2Q0Z X;  5KG2 A;  2IOF A;  2V4R A;  1ZJN A;  2I5H A;  1NK9 A;  2K8A A;  4RQ8 A;  3GDX A;  2ZUC A;  3HIL A;  4KLO A;  1N61 A;  3NUQ A;  4P0P A;  1Z00 A;  3UXN A;  1L6N A;  5KFX A;  4K4I A;  3UMG A;  5KFB A;  1NKB A;  3AL0 B;  4DOA A;  4KX5 A;  3BS5 B;  4RQ5 A;  1N2X A;  2FPK A;  3WK7 A;  1URJ A;  4DL6 A;  9ICP A;  1KN5 A;  2PFQ A;  1X6J A;  1BNO A;  4OJ5 A;  3IV6 A;  4TQS A;  2KJ9 A;  2W54 A;  1TAM A;  3ALR A;  4O3M A;  3E2E A;  1KLN A;  5DKW A;  1ZQW A;  4XA5 A;  1UHU A;  4Q45 A;  2P6R A;  2UVU A;  1WCL A;  2BZF A;  2LKY A;  2VA8 A;  1V85 A;  2WF9 A;  4KIT B;  4B9M A;  5KFM A;  2A1A A;  3NS1 A;  3RBD A;  1ZQV A;  3TAD A;  5AM0 A;  4PHP A;  2PI4 A;  1MQ3 A;  3QU2 A;  4GIB A;  8ICW A;  4M9G A;  3TAN A;  2DPI A;  5ALD A;  1MSW D;  2ZIW B;  1NK8 A;  4O3O A;  3TAR A;  4MHV A;  4CF3 A;  1U49 A;  5J2E A;  5J0X A;  1NK0 A;  5ALL A;  4NLG A;  2QAR B;  4ZOH C;  4MEX A;  1DRG A;  2KFZ A;  5EWE A;  1BPX A;  4QZD A;  3BQ0 A;  2IHM A;  4EEL A;  1IG6 A;  1ZRN A;  3FDS A;  3Q8L A;  2HBK A;  1IXR A;  5DG9 A;  1HJP A;  1AQ6 A;  3ICX A;  4CF4 A;  2NRZ A;  2ZJ5 A;  5D49 A;  4O9M A;  2ZXH A;  2BPC A;  2AGO A;  1TK8 A;  4MFF A;  1XSP A;  4CGZ A;  2UVW A;  7ICN A;  4BWJ A;  4YG2 A;  2ASD A;  3NVW A;  1SL0 A;  2NO4 A;  5DLF A;  1TV9 A;  4ELU A;  3C1Y A;  2FMQ A;  2KK0 A;  2JEF A;  5ALK A;  4AYB F;  4ECV A;  1TFR A;  2LHT A;  1ZD2 P;  2YQE A;  5AI0 A;  2K4E A;  3LVW A;  4YR0 A;  7ICH A;  4KLG A;  3M6Z A;  4QWD A;  4LZD A;  4I28 A; 
#chains in the Genus database with same CATH homology
 5H2F U;  5B66 U;  3WU2 U;  3A0B U;  5E79 U;  5KAF U;  2AXT U;  3A0H U;  5GTH U;  4IL6 U;  2DUY A;  4UB6 U;  4PJ0 U;  3KZI U;  5KAI U;  4UB8 U;  5TIS U;  5GTI U;  1S5L U;  5B5E U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...