3TI0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddgtp-dc in closed conformation
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 202
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ti0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ti0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ti0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ti0A01
1TV6A 9ICUA 3QEWA 4ELVA 4CCHA 3QLHA 2VG6A 3ALYA 1ZQSA 2FMPA 4I2GA 1QHTA 1J5OA 3EPGA 5KFMA 4NCGA 3EW9A 5FRMA 4I2PA 4NXZA 5KFBA 1RBRA 2KN7A 3VQ7A 1EETA 2OPRA 1KEJA 2DFEA 3SYZA 3RR8A 9ICSA 1HUZA 3PR5B 4O5CA 1HPZA 1VK0A 4CEBA 3ZSQA 1A5XA 3KK2A 4YVZA 1UA0A 7ICVA 3C95A 1S1VA 7ICOA 3H8JA 1TL1A 4IDKA 3V7LA 5KRTA 3OY9A 3HK2A 3IG1A 1RDCA 5J2GA 2FLPA 2XY5A 4ECSA 2AGQA 1ZYQA 1C7YA 1TKTA 3OYIA 4IFYA 1VSEA 4UBBA 2BR0A 4FLVA 3GIMA 2XY6A 3JYTA 4PH5A 2PYJA 2W8LA 4FJ7A 4H4MA 3FDSA 4CGJA 4BXOA 1ZQRA 3Q8PB 3AO3A 4CEAA 4BDPA 5HRSA 4QZDA 2OZMA 1RBTA 1TAUA 1RTDA 4J2AA 9ICLA 2ISOA 4FJKA 2HB5A 5DQHA 4KHSA 1WCNA 1RT1A 3AUOA 4JWMA 3KKRA 3PUFA 2FBYA 1BQNA 3SJJA 1S0OA 5HMLA 2OYQA 3M9MB 4FLWA 1O1WA 4CJ5A 3OYDA 2W9CB 2HNZA 3SI8A 2IGIA 1TK5A 1S5JA 3WNFA 2KW4A 4Q0BA 3GIJA 5EU7A 3PMNA 3Q8SB 4FJ8A 2YNFA 4R8UB 2LYHA 2F1HA 3C6UA 4Q43A 2RDIA 2JGUA 7ICRA 5KT3A 2ZJAA 4CEQA 4J9MA 3IM1A 3UQ0A 2AQ4A 2F1IA 4LH5A 4MEXA 4FK2A 1KVAA 4RNNA 4P4OA 4QWCA 3NGDA 3EYZA 1QLNA 4E3SA 1ZQZA 4J9QA 1A76A 4RNMA 3SI6A 4XIUA 1IXRA 4F3OA 7ICEA 2BQUA 4LZGA 4KI6A 3ZT3A 5DBBA 4DU4A 4N76A 2ITGA 2Z1GA 3KLIA 4O3PA 2DY4A 1WAFA 2IHMA 1XSPA 1ZQXA 4BDZA 9ICAA 1SL1A 3ASMA 4FCYA 2PFOA 3EPIA 3V1RA 4CHYA 3L3UA 4DL6A 2R8JA 3GV5B 2QKBA 3OYKA 4GVMA 3BQ0A 3QESA 1XHXA 4IBNA 4MFAA 4FO6A 3MEGA 4FBUA 9ICIA 4DOAA 1RYSA 1SUQA 4F93B 3JSMA 1J53A 3VQPA 1MC8A 2RDJA 3OYBA 2P5OA 1A5VA 5KFGA 7ICHA 1KSPA 3AA3A 3RMBA 4E1MA 5KFSA 4CHZA 3V9ZA 8ICOA 1NK6A 3SQ1A 2BCQA 1BPEA 4KLHA 3B6OA 3QNOA 4JV0A 1HQUA 4AHUA 3K4GA 4UAYA 2W9CA 4W5QA 5DBCA 4RU9A 9ICGA 2Z1HA 1ZQOA 2MUTA 1B9DA 4KLMA 4M3YA 2DFHA 2YHBA 3HP6A 1SZPA 4B9UA 1NJYA 3SNNA 3ISBA 3QEPA 8ICRA 2HHSA 5KFWA 4QZCA 4DFPA 2D0CA 1C0UA 9ICKA 5DLFA 1ZQBA 1NOZA 2RN2A 3SV4A 3OYMA 2KFZA 1PZNA 5K14A 3KK3A 1YTAA 5J2PA 3LDAA 4J9NA 7ICJA 3OSNA 4FM0A 1QSLA 2RF2A 4B9SA 1NK5A 4EEYA 2ETJA 1S6QA 3TAPA 5JUMA 5DB8A 3D45A 1ZBIA 1ZQHA 3QEAZ 5EWFA 2BGGA 2JEFA 3MAQA 2F8SA 2X78A 2YNHA 3BDPA 1K6YA 2OWOA 4E19A 8ICQA 4FJGA 9ICEA 4E0DA 3MFIA 2DFLA 3RAQA 3G6XA 1TKZA 3CM6A 3KD5E 1S0MA 4RQ2A 4PPXA 3IS9A 4KO0A 2UVVA 2C22A 5CJ7A 2W9AA 4I9QA 4HUGA 3VQDA 4M47A 3PV8A 3CQ8A 1D9DA 2MAXA 4DG1A 1RTIA 3C1YA 4CESA 1S0NA 4KLSA 4RW7A 3RTVA 3AVJA 5EOZA 4M9LA 4YR2A 4M2YA 4DEZA 4MF2A 3RJFA 4O5EA 3VQQA 9ICWA 1S1WA 1IG9A 4PGYA 2W42A 2ASLA 3KLGA 4EBDA 4CHNA 4N41A 3KLFA 3QZ7A 3AVNA 4HCBA 1JLQA 4BE0A 4QAGA 3AA5X 3K5OA 4OVLA 3LP2A 3DLHA 5KG3A 4PUOA 2Q3SA 4Z4IA 4YR3A 4QW8A 3MECA 4C8OA 1NOMA 2ZTCA 3AU6A 1SL0A 1RT4A 3MR3A 3M8QA 2YNGA 2RPIA 4DL3A 1XO1A 4FJMA 4DOCA 5DKWA 3GV8B 1B92A 2UVWA 3P83D 2YNIA 3TI0A 8ICNA 1WCLA 2P1JA 5DGBA 3SQ0A 2A1RA 4ELTA 4CIGA 3TAFA 2UVUA 4GW6A 1S1XA 2I9GA 2C2RA 3DYAA 4J9RA 4IR1A 3K57A 4F5RA 1NKBA 1DGSA 4YD1A 2NUBA 5KG7A 3SQ4A 4F5PA 4KKOA 1ZETA 5CYQA 2E6MA 5KGWA 1D5AA 3NF9A 4TQRA 4E7LA 4E89A 4QZ9A 4CJLA 2BCVA 4H8KA 1BGXT 4RZRA 4DOBA 4CF9A 5J2NA 4KAZA 3V1OA 4BE1A 3DI6A 2XHBA 3TQ1A 1J9AA 1UT8A 1ZBHA 2BDPA 2PFPA 4YMMA 4M3ZA 3RH5A 3K75D 3RR7A 4CGHA 9ICTA 1EX4A 1RDAA 3ISCA 1T05A 1ZQWA 3JPOA 4FLUA 4KLFA 3L2UA 2LSNA 2P51A 4TSXA 3GIIA 4R63A 5KFLA 4J9LA 4IRKA 2KZZA 3KTQA 3WNEA 1NK8A 3AV9A 4DTMA 3C2MA 3LPTA 3NBPA 2NRVA 9ICQA 1ZQPA 4Q8FA 2IAJA 3G6YA 1BPDA 5KT6A 4YP3A 5CZ1A 4E7KA 5J29A 5DB7A 1BPBA 2Z1IA 4O44A 4UQGA 3EZ5A 3IAYA 4KHQA 4KLIA 2B6AA 1ZQFA 1NK0A 4RW8A 5HROA 1XSNA 4FLXA 4CFAA 1TAQA 4DTNA 1LWFA 1U47A 1Z26A 1FKPA 3RJGA 1T4GA 1Q8IA 2AJQA 3QIPA 2IS3A 3OJUA 1L3UA 1T03A 4QCLA 2OPQA 1IKXA 3PX4A 5HRNA 1VSDA 4YFUA 3QEVA 1T7PA 3OHBA 3RRGA 4J2DA 4PHAA 2Q0ZX 3PY8A 7ICGA 4I29A 4LZDA 3ZSOA 1Z00B 3LPUA 4YNQA 3NDKA 4JWNA 4XUSA 2KZ3A 3O4QA 3THVA 5D4BA 2ASDA 4FS2A 4IG3A 4EZ6A 3C21A 3UPQA 1TGOA 4OLBA 3V7KA 4ECUA 3PR4A 1BHLA 3I0SA 4EYIB 1RBVA 4ED2A 4Q45A 1NJWA 7ICLA 5J0YA 2X6SA 3HM9A 3HXMA 4MFBA 1X9SA 3RJEA 4AHSA 1S9GA 2R8HA 3RMAA 4ED1A 3KLEA 4J9OA 3PX0A 2B21A 4EP5A 5KT2A 4CK3A 2G8HA 3MGIA 3RJIA 5J0WA 4O55A 8ICCA 3TARA 5F9LA 3H40A 1RBSA 4M9HA 4IG0A 5SWMA 3V72A 2BPFA 3JPRA 8ICLA 1ZQYA 3H8WA 3O4NA 4ZH4A 1TFRA 2FBTA 2FPKA 4F92B 3L2RA 5CY4A 5KGXA 2QK9A 4M45A 8ICPA 4NYFA 3RBDA 4ELUA 4UAWA 4DQIA 1SV5A 4AILC 3MABA 5DB9A 4O3QA 1EXNA 1ZQCA 1LV5A 2J6SA 3UXPA 2G8FA 3QE9Y 3BQ1A 4NYNA 5IILA 3TAQA 2FPMA 1XSLA 2DPJA 1ZJMA 4B9NA 4FYDA 1EXQA 2QKKA 5HLFA 1MU2A 4HYKA 5DQIA 3PVXA 1WSFA 1Y88A 5KFZA 2G8KA 4JUZA 3LZIA 8ICWA 8ICUA 3M8PA 5KFTA 4M9JA 2KTQA 5IIJA 3QIOA 4GXKA 4B8CA 1CEZA 4O4GA 2R7YA 4F2SA 1GOAA 3RJJA 4XQ8A 5KFKA 4ZHRA 1ZBUA 1MQ3A 3PMLA 1IKWA 5FDLA 3ZSXA 3VQ8A 3VQ6A 5J2MA 2HHWA 1WSIA 1TK0A 4KN4A 4E1NA 4B9MA 4J9SA 2V9WA 4ECQA 2PYLA 4R65A 4YN4A 1ZQJA 1J54A 4E7IA 4F91B 4EP4A 1QS4A 7ICKA 5IIMA 5D3GA 3ISDA 2A1JB 4CEOA 8ICJA 1ZQUA 3VN5A 1ZQKA 1JXBA 4EYHB 4NM1A 4UB4A 3TFSA 2G8UA 3TAEA 3ZDBA 4FK0A 2I1QA 4Z4HA 2M9NA 2VA2A 4FJNA 2FMQA 1WAJA 5L1IA 3H08A 4HCCA 4X5VA 3QINA 4O3RA 4M6WB 4YXJA 1HJRA 1Y97A 3DLBA 3OS2A 1W9HA 3V9WA 4ID1A 2HHTA 1WNSA 3HVTA 5CWRA 2HHUA 3M9OB 5J1EA 4DTXA 8ICSA 4C8MA 4I7FA 2KQ2A 2JEIA 5CB1A 4GC7A 3VQCA 8ICIA 5J2DA 4DFJA 4RT2A 3C6TA 1JX4A 1HQEA 5FRNA 1CLQA 2JEJA 4CHOA 3U6FA 1KCFA 4UBCA 4N5SA 5KFHA 3Q8QB 3AVCA 4QOZB 8ICMA 3GIKA 3EY1A 2OZSA 7ICIA 1WN7A 4Y1DA 4KN7A 4P2HA 4OJRA 5C42A 4K8XA 1HNVA 5DB6A 3B6PA 4M0AA 2BGWA 5D46A 5J0UA 1NK7A 2W9MA 2YKNA 4NLZA 5E41A 1QSSA 4KHNA 2HMIA 5CP2A 1HYVA 4ZTFA 3NFAA 3UXNA 3LALA 4FJIA 4YQWA 1D9FA 4CEEA 2IHNA 1N48A 3L2QA 3NGYA 5KFUA 3ITHA 3MDCA 4F5QA 2BQRA 3DLGA 4NLNA 4DL5A 1S9FA 4O3OA 2GV9A 4O3SA 4W5TA 3ISNC 5J0TA 3OGUA 4R5PA 2ZJ8A 1ZJNA 1RTJA 4FJXA 3CYMA 3MXMA 5J2AA 1C1CA 3AVGA 4CF8A 2FLNA 3V6JA 9ICNA 1NK4A 3WNHA 4M42A 1KFTA 1SKSA 4NCBA 2F8TA 4Z6DA 3DRSA 3B0YA 3DM2A 4KTWA 5KFYA 2XC9A 5DK5A 4MEYA 1C6VA 3Q8KA 2ZE2A 7ICNA 4QZHA 1L3TA 5DQGA 2IA6A 1ITGA 9ICBA 1MSWD 1Q9XA 5JS1A 3AVAA 1UA1A 1S97A 4R8UA 2BANA 4AHCA 2ATLA 4CHQA 4KLQA 1MQ2A 1U4BA 5J2JA 3MXJA 8ICTA 1RBUA 2P66A 5J0XA 4CJPA 3OJSA 2WTFA 5C24A 4RQ5A 4FJ9A 3UXOA 3QO9A 3AO5A 5TZVA 5HRRA 4IRDA 4KB0A 3MFHA 4K4GA 4FBTA 2NRXA 4ED6A 1HUOA 1B9FA 4AH9A 4HUEA 4FXDA 1S77D 1KRPA 4WE1A 1TK8A 4CFDA 1U9LA 1WSEA 2IOCA 4F5NA 4FLZA 3S3NA 4CE9A 2BKEA 4DSIA 5DG7A 4CJRA 2PXIA 1H38A 4KHWA 2DTUA 4QW9A 3RAXA 1SKWA 4Q8EA 3P1GA 3Q8MA 3RJKA 1X9MA 4TUSA 4JRQA 4FW2A 1KVBA 3ZSRA 2ALZA 1WLJA 4DQSA 1BCOA 3VQEA 4N56A 2RKIA 7ICQA 1JL2A 3N4MB 3VA0A 2ZUDA 3S3MA 2O4IA 3RBEA 2EHGA 2A1SA 9ICCA 4RG8A 3U3GA 1UT5A 3QEIA 5J0QA 5JS2A 4DFMA 2VWJA 1RILA 1IO2A 2PFNA 4DSKA 1BPYA 3V6DA 1KLNA 1JN3A 1K1QA 4Z6FA 3KK1A 2ASJA 4DTRA 1WSHA 4YD2A 3LAKA 3C5FA 1ZQGA 4M3UA 2V4RA 4F4KA 5BOLA 4J9PA 5DDMA 1ASVA 4DTUA 4M9GA 4QZEA 4QZBA 4JS4A 5L9XA 3MBYA 3OYFA 2J6UA 4RQ4A 1BQMA 4KV8A 3PW5A 3V1QA 9ICJA 4FS1A 4F8RA 3RB0A 1X1PA 2HNYA 3QEXA 5KFJA 4OPKA 8ICBA 3ZDAA 4GMJB 4DQRA 3NHGA 1JLGA 4BWJA 2JEGA 5KFQA 4ED0A 3D0PA 3GILA 1RTHA 4YR0A 4LSLA 4OGEA 3IHQB 1A77A 4DSLA 1LB2B 4Z4CA 4RPZA 4KLDA 2UVRA 2R8IA 4OPJA 4DO9A 4FJLA 4O9MA 3HT3A 4JK1A 1NOYA 3GV7B 2OA8A 4PHPA 1GOCA 1S0VA 4KFBA 4QWAA 4KRFA 1S76D 4RW9A 3NF6A 4DLEA 1SKRA 5KI6A 4ED7A 3HYFA 1DOQA 1NK9A 4DTPA 4LD0A 4CFBA 5FROA 1ASWA 2KFNA 4CJEA 1SL2A 3BGRA 3QNNA 4IRCA 4CF0A 3K2PA 4BGDA 1I3AA 4DLGA 5KT7A 5EWGA 5KG1A 3G0ZA 4UB1A 4ED3A 5IIIA 4F5OA 2AQ0A 4K8ZA 2BQ3A 2HHXA 4BACA 4B8AB 3GFKB 3KIOA 4C8LA 1JLAA 2VG7A 4RQ0A 3NCIA 4RQ6A 4YCXA 4DF8A 3OYAA 3L3VA 1LWEA 3ZCMA 2YV0X 4AHVA 3QETA 1BPXA 3HP9A 2PZSA 3H4DA 5BPCA 9ICPA 4QWDA 1FK9A 1XC9A 3VQ5A 2G8WA 4PGQA 4RQ8A 3MDAA 3QEBZ 3FYHA 1RNHA 4Q5VA 2HNDA 5KRSA 1BISA 1B43A 4GC6A 3O3GA 1VRUA 5CHGA 1Z3EB 4RNOA 2QXFA 5KG2A 1L3SA 1QQCA 3O3FA 3OS1A 3SPYA 3QERA 2BCRA 1DLOA 4KMUA 2Z1JA 5C25A 4CJSA 1HRHA 1ZQQA 3FFIA 1RXWA 3G10A 4C8NA 7ICPA 1VSMA 4FLTA 1XU4A 2C2EA 5KFIA 4Z6EA 3ZT2A 1I39A 5L1KA 4BDYA 4L8RB 5CR0A 4NLGA 1ZQDA 9ICVA 3C23A 4FVMA 4DL7A 5KT4A 4UB3A 5DBAA 2Y1JA 2B4JA 3SUNA 2IDOA 8ICHA 3T5LA 2JLEA 2AU0A 9ICXA 3LP0A 3T1AA 1RZTA 5J2KA 1RDBA 5CZ2A 5I3UA 2XCPA 3HSTB 1S9EA 2NRWA 3LK9A 2XY7A 3PW0A 4OKEA 4M41A 1KDHA 7ICSA 1FKOA 2YKMA 3KHHA 4QZGA 4YXMA 1JKHA 1TVRA 1N5YA 1JIHA 1Z25A 5KG5A 1QE1A 4FZZA 4KTQA 4MF8A 3AU2A 5J0OA 1JMSA 1AROP 1BPZA 4EZ9A 3WNGA 4DL2A 3C2LA 3V9XA 3SUOA 4F4WA 4BXOB 3KLHA 1KFSA 2F96A 2BE2A 3KHLA 1NJZA 5BOMA 3OHAA 5DGAA 1JLBA 4ECRA 3MR2A 3C2KA 2PI4A 4BE2A 4OKJA 4CEZA 4ED8A 2ZUBA 4CJVA 2BCSA 3BJYA 1S6PA 4F4ZA 3OS0A 4JRPA 2R8KA 1IH7A 9ICFA 4NCAA 4ID5A 3TAGA 2ATQA 3CFPA 5HP4A 3CFOA 4RUCA 3DRRA 4FJJA 4DQQA 2VA3A 2ZTDA 4TURA 5KG0A 2FBXA 1N6QA 5KTQA 1F21A 3DOKA 4DS4A 3V4IA 3RH4A 3N97B 3VA3A 3ULDA 4IR9A 4DSJA 2X6NA 5DG8A 4YMNA 5HBMA 5I42A 4Q44A 3BQTA 2VG5A 1W0HA 1TKDA 4B9VA 4PHDA 3TABA 1L3VA 4DU3A 2NRTA 1NKEA 1D8LA 1B22A 4B08A 1Z00A 4CFCA 3KKSA 3F9KA 3AVIA 4CK2A 2Y1IA 4XA5A 3B0XA 3HX0A 1DTTA 4CECA 5KFOA 4W5NA 5KG6A 4I28A 4O5BA 3C1ZA 3GDXA 1CZBA 1JL1A 7ICFA 3LWMA 1JXEA 4MFFA 3ZDCA 4M04A 3H4BA 2DPIA 4UAZA 4AHTA 3T5KA 4DSFA 2W9BB 3MEDA 3OYEA 4PY5A 4P4PA 9ICRA 3KD1E 1ZQMA 3HJFA 1HYZA 4QWBA 3LWLA 2W8KA 3AA4A 3LZJA 3AO2A 4CF1A 5L1JA 4QZFA 3U3YA 3K5MA 4ECTA 3ORYA 4LSNA 3MR5A 4TQSA 2YHAA 3JPNA 4CGDA 3ZSVA 8ICYA 5DDYA 3OYJA 4Z4EA 1HMVA 2XY8A 3K59A 4TUPA 4CGIA 1CZ9A 2IBKA 3T5JA 3H8SA 1NJXA 1BI4B 4RPXA 2PI5A 1IM4A 1BIUA 3ZSZA 4DTJA 2MUTB 2F1JA 5J2EA 3OVNA 4NLKA 1LWCA 4IFVA 2GWSA 4ECVA 4JV2A 2P6UA 4J9KA 3AA2A 5T7BA 3K5NA 1BVSA 1KLMA 3RJHA 3TR8A 5CA7A 4FK4A 3DLKA 2PY5A 4R66A 1QTMA 4ICLA 4LY7A 3KHGA 2DFFA 4PWDA 2FLLA 2E6LA 3V9UA 4OLAA 4K4HA 4CJWA 2WOMA 3KJVA 4LVSA 3PW2A 4ECXA 4CJTA 5J2IA 2IMWP 4M9NA 8ICGA 4KLJA 4RQ1A 4PA1A 3V7JA 4I2AA 3OYLA 1HJPA 5KFEA 4FJHA 4O0IA 3DMJA 5KFFA 4DSEA 2GBZA 3C5GA 3LP3A 1HNIA 3M8SA 3PW7A 5EWEA 3SUPA 2W9BA 3L2VA 1ZQEA 2ZQBA 3ZT4A 3ZSYA 2A1JA 3ZD9A 5DLGA 1XHZA 1RT5A 1C1BA 4HVJA 1S1UA 1TV9A 1TL3A 4I2IA 3RB6A 3K5LA 1JLEA 4NM2A 1GOBA 4IQUA 4IKFA 1VSLA 4Z0UA 5KFAA 4I2BA 1ZBLA 5L1LA 4M3TA 1UOCA 1CUKA 5IINA 3RRHA 4M6WA 5KFPA 3PO5A 4DS5A 2FPLA 1RT7A 4ECWA 3SV3A 3IRXA 4HUFA 2KZMA 4DMNA 3DRPA 4K4IA 4XRHA 3NGZA 2OPSA 5KFXA 3NF8A 1BI4A 3S9HA 2G8IA 4FZXC 3EWAA 4CIFA 3ZD8A 3HPGA 4FM2A 4KREA 4CEFA 3PO4A 4CEDA 3CG7A 5HRPA 4EBCA 4ECZA 1U04A 2WONA 3T5HA 4FJ5A 4JS5A 4JLHA 1U48A 3HL8A 4KI4A 3DOLA 4GXIA 1A5WA 5CYMA 1EKEA 4EBEA 3SCXA 1ZQLA 4DQPA 1LW0A 4IQWA 4KB1A 4ZTJA 4Y1CA 4E7HA 4HHTA 3LP1A 4YFKA 3JPQA 3S3OA 1CXUA 3C94A 1V9PA 2HW3A 4KHYA 3OSPA 5J2FA 4FZYA 4CERA 3RH6A 2BPGA 1LAWA 4CJ4A 2GUIA 2E4LA 4O3NA 1RT6A 2XCAA 3MR6A 2VA8A 4I2QA 2BPCA 4I2FA 4DU1A 1K1SA 4I2CA 1T8EA 4QZAA 3NH1A 3QZ8A 2NRZA 3RB4A 3VQ4A 3AVBA 4G3IA 2D0AA 3VQAA 3PW4A 1R0AA 3RMDA 7ICUA 8ICKA 4KLUA 3OYGA 3OYNA 3Q8LA 3NF7A 4CF2A 3LDSA 1ZBFA 4JV1A 3LANA 4FLYA 5KT5A 4DWIA 4KLEA 1ASUA 3V81A 1YTUA 1TKXA 4UB2A 3ZSWA 5J0RA 2P6RA 7ICTA 5HMMA 3JPSA 1EP4A 4DTOA 3HO1A 2VANA 1JLCA 2JZBB 4TUQA 1IKVA 3GQCA 1ZQAA 3ETLA 4PQUA 5J0PA 8ICAA 2XGPA 3ZDDA 3E01A 2HVHA 3AO1A 1RCHA 4IQTA 7ICMA 3A2FA 4CJUA 4CJ3A 4BWMA 1RYRA 5SZTA 5J2QA 1JLFA 2FMSA 4UB5A 2VWKA 1UAXA 1C0MA 3M9NB 3TANA 4KLTA 4F4XA 3JPPA 4FM1A 4KLLA 3CM5A 3AVKA 4M3XA 1JXLA 2EX3A 2G8VA 4RT3A 1Q9YA 2ZUCA 1VSFA 1BCMA 1NKCA 3RMCA 8ICFA 2IC3A 2C28A 4CJKA 5C5JA 3HW8A 3V6KA 4KHUA 3AVFA 1FXXA 4KPYA 4Z4FA 3TFRA 1VSIA 3KHRA 1RDDA 4F50A 3G6VA 3NGIA 3H7IA 2C2DA 3HPHA 4KTZA 4AHRA 1U49A 4RPYA 5KG4A 4O5KA 2ZJ5A 1XS9D 4FW1A 3SPZA 1LW2A 4Z4GA 1BIZA 9ICHA 5KFRA 2BCUA 8ICEA 4DFKA 1U45A 3P5JA 3ZT0A 5HHIA 2AGPA 1VSHA 3NTUA 1RT3A 3UQ2A 3L2WA 9ICMA 2OPPA 4GLXA 2V4QA 4R64A 4NY8A 4M3WA 1T3NA 3AVHA 1KFDA 4I27A 1XWLA 5HP1A 2ZD1A 3ZT1A 4DL4A 1VRTA 2D0BA 3DLRA 4RUAA 4O0JA 1QSYA 4I2EA 4IQVA 1VSJA 1N56A 4M3RA 1WSGA 3NH0A 3AVLA 1G15A 4F3TA 4GXJA 2R8GA 1RXVA 3HWTA 4ECYA 4W5RA 3OYHA 2XGQA 4B9LA 3M8RA 3K58A 2JZBA 4RW4A 2B5JA 4RQ7A 5DG9A 5D49A 1TVAA 3TAMA 1BL3A 3O3HA 2HHQA 3Q8RB 4PHEA 4OGCA 4Z6CA 3AO4A 1ZQNA 8ICZA 1KTQA 3CFRA 4I2HA 3VQ9A 5IIKA 3NAEA 5KFDA 8ICXA 2XO7A 4F2RA 4KLOA 2AGOA 2I5JA 1ZQTA 5J2BA 3OYCA 2BHNA 1LAVA 4HTUA 5KFVA 9ICOA 4YMOA 5DMRA 3HPOA 3V9SA 1VSKA 4B9TA 4CJFA 4I2JA 2PFQA 3L8BA 1CXQA 1S1TA 4CGFA 4J2EA 4MFCA 4I2DA 4I9LA 4DTSA 4B3OA 4RW6A 4CHPA 4CGGA 2FC0A 3F73A 4QWEA 4H4OA 4LH4A 1HYSA 2FBVA 4CIEA 3SUQA 4QZIA 1REVA 1C1AA 2XRIA 3PNCA 4N47A 1X9WA 2HHVA 3VQBA 2H5XA 4QZ8A 1RPLA 1X2IA 3ZDEA 1RT2A 3NH2A 4MQ3A 3NE6A 3E2EA 3BQ2A 4C8KA 3V6HA 5HNKA 2ISPA 1UWBA 3I8DA 5J0SA 5J2HA 8ICVA 4CK1A 3MGHA 3RWUA 2ZTEA 3DLEA 3I0RA 1IKYA 3MXIA 3T3FA 2X74A 3SQ2A 1KVCA 1ZQIA 4KLGA 3PX6A 3MEEA 2D5RA 5KFCA 1L5UA 1YVUA 3AVMA 4W5OA 4F4YA 3T19A 3RB3A 4P4MA 2J6TA 4PGXA 4J2BA 4G1QA 3SZ2A 5IIOA 5KFNA 5HHHA 4RQ3A 5J2CA 1ZQVA 3LAMA 5F9NA 1D8YA 1YT3A 4CJQA 1COOA 4YG2A 1WSJA 4OKKA 4DF4A 3UIQA 4KITB 2HVIA 1DTQA 3JPTA 1C0TA 2O4GA 1XI1A 4E7JA 1S10A 3HVRA 2P5GA 3TWHA
chains in the Genus database with same CATH superfamily
9ICUA 2UUWA 3QEWA 2HF4A 2O3DA 2WF7A 1VC0A 3C6TB 2FMPA 4I2GA 4V19X 1QHTA 3OT9A 1JCGA 4BLGA 1UWAA 4YDDB 1QZ6A 4H5RA 4WU2A 1RAIB 3EE9A 5FRMA 1ZZNA 4LBPA 4ITSA 3VQ7A 1H2VZ 1YQHA 4C4WA 1HUZA 3PR5B 1VK0A 3D2EA 1FNOA 2FJEB 3ZSQA 1RKIA 3SD7A 3KDOA 2GTDA 2GVDA 1NGDA 3C95A 1S1VA 4R0JA 3TRGA 1TL1A 3CQYA 5AZIA 4IDKA 2N82B 3V7LA 2WK4A 5KRTA 3WKBA 3FC4A 2W2QP 4NEZA 1WDTA 1RDCA 2W7AA 3VAKA 5J2GA 2FLPA 2XY5A 3PJWA 1T9YA 3KUEA 3H98A 2M8HA 2ES6A 1ZYQA 3F0NA 4UBBA 3DLGB 2BR0A 3CCMN 1W26A 1X4FA 4RR5A 4MH8A 5H9FK 2N3LA 5AKJA 3MEGB 1ULRA 3F2DA 4CGJA 4BXOA 3PIOQ 3Q8PB 3AO3A 3M2VB 2E5LK 2LYBA 3N6MA 2DIUA 4QZDA 5I9EB 1RTJB 2QEXN 2K4HA 3TVZA 3U1MA 2MQQA 4NA1A 2JXJA 1C1CB 1TAUA 1T3VA 1FXLA 2XIDA 2E44A 1NDKA 4A5BA 3QSYB 4K4XA 3CQXA 3HMJG 1DFDA 1BQNA 3BYRA 2OYQA 1Y0HA 1O1WA 4FWQA 5B0AA 3OYDA 3QXGA 1HD1A 2GVZB 3SI8A 1RWVB 3PKMA 1VCTA 4A2BA 5D0RA 2MZRA 1LKYB 2G2ZA 2YNFA 4R8UB 3C6UA 4YHHK 4Q43A 4KHRA 3R5AA 2LXUA 4FPIA 4PAAA 3OTOJ 4GFJA 4USJC 2O8CA 4FK2A 4MEXA 4RNNA 4H5WA 1TL4A 3EYZA 1VQLN 5GADP 2ILYA 1ZQZA 3DLJA 4QS7A 3LL3A 1A76A 3MPUB 1S57A 4XIUA 1IXRA 3SCKE 4WE1B 2E8NA 1EHWA 2JWKA 3ZT3A 5DBBA 1PVRA 5HJXA 1KOOA 3CJKB 1S6QB 2XMAA 3WU2U 2VGNA 4XDDA 3KLIA 2M0GB 2CGLA 3EZWA 2KKZA 3DGPB 2ZHAA 1C20A 1IG8A 1ZQXA 4L76A 4HHHA 1SZ2A 3S6EA 3E9OA 2CN1A 1DGJA 2EZZA 2LM4A 4W92B 3LH2S 4DL6A 4FDFA 1CZAN 4P7VA 2Y9UA 2GA7A 4IBNA 4MFAA 1XIQA 3MEGA 3G4SS 1UVMA 4CO2A 4FBUA 4ZA1A 2F4FA 1K9MT 3T1HK 3J7YP 4F93B 1J53A 3OYBA 1HJOA 1A5VA 1KW4A 5F8IA 4JI1F 1LQ9A 4Y2CA 4E1MA 8ICOA 1OQ3A 3SQ1A 1N61A 1BPEA 4KLHA 3B6OA 3BPSP 3RFAA 4JV0A 4JKGA 1K9MO 1A0PA 4M1KA 4X62J 4AHUA 4UAYA 2OHDA 4CH1A 5CHIA 4FYVB 4RU9A 1K73T 1R0CB 4ZP8A 1LKYA 2CQCA 3HP6A 2BJ3A 5ETQA 1QCKA 3ISBA 3JS6A 3SEIA 2ZOGA 1LXNA 1K73O 4X4VA 4C97A 9ICKA 2LXIA 4B1UB 2HVZA 2MDAA 3QUTA 4LIWA 2RN2A 3KLVA 2KFZA 3ET6A 1SH2A 3L0QA 5KPRA 3D7SB 3LDAA 3UKRA 4ACOA 2CH5A 1KKXA 2HI0A 5ALGA 3NVYA 2FJXA 1QSLA 2CVIA 4XDCA 1VC5A 3Q2SC 3CJKA 1S6QA 5CZXA 3NRBA 5DDOC 3TAPA 2JHDA 2QI2A 5DB8A 2CQGA 1KQSM 1ZQHA 2DRBA 2XS7A 5EWFA 2ZH3A 4WZQA 4HKQA 2Z2LA 2A41A 1YXQA 5AM4A 4DPWA 4FJGA 9ICEA 3O8MA 3G6XA 1RAHB 1S0MA 4RQ2A 1D9DA 1L3KA 4DV4F 5JVHQ 4DG1A 3WX4A 2ZZMA 3C1YA 4CESA 3OL9A 4KLSA 2HYIB 4OJOA 4YOYA 2QYCA 3AVJA 3M3ZA 2GNKA 2VG7B 3TU5A 4YR2A 2IM2A 4M2YA 2F9DA 3GFYA 2R7RA 2DGXA 1RWUA 4I68A 1IG9A 1IG6A 4GVLA 1LWEB 1VQKS 3WT0A 2ASLA 1RJJA 4CHNA 1CS4A 3MAAB 4N41A 1U8SA 3QZ7A 3K5OA 4OVLA 2IPOB 3IMXA 3GR1A 5AQWA 4PUOA 5LY3A 1QVGR 2Q6BA 2UUAF 2MY8A 2X1GA 4YR3A 2ZBQA 3VVUA 5JJBA 4CD3A 3UB5A 3MECA 5LSLA 2XMKA 2ZBPA 3EGVA 2VJUA 2P6SA 5DM7L 1NOMA 2ZTCA 2B6AB 1A7GE 1RT4A 3PYEA 1XO1A 4FJMA 4DOCA 1Q46A 1X4EA 1LOUA 3P83D 2YNIA 3TI0A 4J5OA 5DGBA 4NLRA 5T14A 3H8MA 1UFKA 5E84A 2F7TA 3VEZA 4QIEA 1WHXA 3FLCO 1H6KX 4LF8F 1S1XA 5BR8F 2VQFF 2H3GX 3CCJN 4CLYA 3KDNA 3WQPA 2H51B 1T03B 4KH1B 4DV7K 3NASA 1FT8A 1Q18A 3EEQA 1DGSA 2PFUA 2VFRA 1GLEG 4F5PA 2MKKA 4KKOA 1ZETA 4IOXA 1D5AA 4DV2K 3NF9A 3O44A 2CJBA 2AA4A 2EPIA 4E89A 4IG3B 2WVDA 3SDEA 3PACA 4OZ2A 2NSCA 4XH1A 2G0IA 3PKYA 2BCVA 2MJUA 4H8KA 3OD2A 4RZRA 4DOBA 3ONQA 2YKMB 2KM8B 4BE1A 3TQ1A 1N88A 3KLEB 1XQSC 4M3ZA 1T9VA 3K75D 3CCRS 4LRAA 4KGXB 3QU2A 9ICTA 1NDCA 1X4BA 1EX4A 4IKAA 3ISCA 1T05A 4JN4A 4WU3A 2V68A 4KLFA 2LSNA 3NAHA 2DO0A 3KLHB 4A8QA 2YQ1A 4IRKA 2O8DB 4RCHA 9ICQA 2IAJA 5H9EK 1BPDA 4I6MA 4LJXA 3RAMA 4YP3A 1MWYA 3I33A 1RQ0A 5DB7A 2WVEA 1BPBA 1D09B 1B0TA 4UQGA 2NUUG 4O44A 1U6BA 1M5KC 3IAYA 1WUAA 4KHQA 3VV2B 4KLIA 2MQPA 2B6AA 3MMAA 2AYGA 2RQMA 4DN0A 5HROA 3TVKA 3W9HA 1FTRA 1XSNA 1TAQA 4MO4A 2XLJA 1YJWN 5A2QO 4ZLLA 1UPHA 1N33F 1UTAA 1N6QB 2N3OA 4KRWA 3RJGA 1T4GA 5CD4A 4OHYA 1Q8IA 3F5TA 2JMGA 4MK7A 3EDQB 2UXDF 3EXCX 4FSVA 4WF9L 3UW1A 1T03A 4FYXB 5LSRA 3PX4A 3NKYA 1VSDA 4EENA 1YIJS 2VG5B 4UARA 3D2NA 5DDPC 3PY8A 3LOUA 1RDWX 2QLFB 4ZHRB 2PDAA 5F2RA 1V3SA 3W2VA 2KZ3A 1R8BA 4A8XA 2P9NB 2LQ9A 1QH9A 2LM1A 2ASDA 1RAEB 1F2GA 3RU0A 2K89A 4IG3A 1Z05A 9RUBA 4EZ6A 1DTTB 1TGOA 3V7KA 1XR5A 3NRWA 3ULEA 3PR4A 3IWLA 4EYIB 5M2RA 1RBVA 3M6UA 2KSOB 5J0YA 3KZXA 2HWTA 1FIQA 3VAJA 3LUYA 4AHSA 3VALA 5LL6Z 2R8HA 3KLEA 3PX0A 2IVNA 2HHHJ 3M6VA 2FXUA 2G8HA 1FHTA 3RJIA 5J0WA 3J7ZT 3ILIA 4JI3F 2WSFC 3H40A 1RBSA 2K8AA 3V72A 3MD1A 2UU9J 4Y2VA 1X8DA 2MTLA 5M1OA 4ZH4A 4JK9A 2ZVSA 1CJKB 3NVVA 2O8DA 3MM9B 1TE2A 3WUHA 3J7ZO 4ZS6A 3QBWA 3L2RA 1UJ6A 5KGXA 3M2UB 3VGSA 2DY1A 3MPDA 3I55N 2F8EX 3OXGA 3M1FA 4M45A 5AQOA 4ELUA 4JV5F 2WSEC 3W62A 5AXKA 4UAWA 4DQIA 2QLJB 4AILC 5DB9A 4NO7A 4O3QA 4DR5K 1EXNA 5DETA 4JEPA 5F3ZA 2PEHA 4I7FB 5AJ3J 3GYXB 3B8HA 5IILA 2YWKA 5I3PA 3NGTA 4PABA 2A0FB 1CJUA 3RW6A 4JI4J 3PVXA 2MZQA 1LWCB 2Y9TA 2G8KA 8ICUA 3VF2A 4GV6A 1SKUB 3KWIA 2KTQA 1VQNN 3PYGA 4GXKA 2P35A 1RYUA 2G08A 3WK6A 1GLFO 2AZ1A 4UB6U 1BQXA 2K06A 4ZHRA 3P49B 2KE7A 1G2EA 3T1YJ 4XH5A 5FDLA 4GO5X 2FJVA 4HDHA 3KJVB 3AA8A 3F5EA 1WSIA 1FERA 1U1NA 1D9AA 4QYRA 1TK0A 2POKA 4MIAA 2QWRA 4E1NA 5HATA 1GX6A 2KSOA 2V9WA 3D3CJ 1HKGA 4YN4A 4CNYA 2YX4A 1NNEA 2FJBB 1QS4A 5IIMA 2E7VA 2R7XA 5D3GA 4PXDA 2OI2A 1X3NA 3CP8A 2FGCA 4CEOA 8ICJA 3MR7A 4NM1A 5GVQA 2F65A 3TFSA 2YMLA 3OLAA 3VAIA 4CDIA 4FK0A 2I1QA 2RHSB 4FVCA 4Z4HA 2M9NA 2VA2A 2FMQA 4AQYF 3CC2S 1R6VA 3TACB 4DOZA 4AL7A 1CJKA 3BH7B 2VQEF 3SMPA 1AYEA 4TLQA 4M6WB 4YXJA 2J9CA 3R2CJ 3V9WA 5B0BA 1P9YA 2PA3A 4C8YA 1I94F 3R1LA 1YHQN 5IWAJ 4K2JA 3T9ZA 3MX2A 3R9PA 3CDUA 4I7FA 3CJRA 2JEIA 4K5SA 1GMWA 4JNEA 2ZKTA 2CAJA 4WPAA 1HQEA 2ZZNA 4WQ5A 4QNLA 5FRNA 1CLQA 3UO0A 5IT9Y 4CHOA 2WFBA 3GFXA 3D68A 1XMBA 1VK8A 4N5SA 2C2MB 4JI2F 3Q8QB 4B1ZA 1GT8A 2QL5B 5LJ5Y 2KLAA 2OYYA 2YH0A 3DOLB 2CQHA 4WFBQ 3DXBA 3GIKA 2OZSA 4MDAA 7ICIA 4ATNA 2RU3A 5C42A 4ZDNA 1WF1A 1HNVA 2J5AA 3A8JA 1D8BA 3THXA 2D6FC 3AARA 2W9MA 3CCES 2YKNA 1K44A 5E41A 2M52A 2SXLA 2R2RA 4YY3K 3NFAA 3A4TA 3LALA 1EJ7L 3MCNA 4M5GA 2FJAB 3WKEA 1RT6B 3R27A 5E3PA 4ILMA 2YY3A 1XNRF 5KFUA 5AE1A 3J81j 4F5QA 4WFZA 4NLNA 3Q7BA 3ZZZA 3ISNC 3GCXP 1WI8A 5J0TA 4QJVA 3PTWA 2DBBA 3MXMA 2CPZA 3R6LB 4CT8A 3U8XA 4HH0A 1J2MA 3ZTOA 4CZJA 4MKYA 4CF8A 1TKXB 2Q0UA 1S8OA 2AXTU 3W3DA 5K20B 3WNHA 4AYBF 1H7WA 1F5SA 2XS2A 1ZM2A 1KP6A 3ZZOA 4M42A 3AQFA 5K8NA 1EP4B 3WKAA 2K1RB 4NCBA 4DR1J 4Z6DA 2HHPA 4KTWA 2G0JA 3KKFA 1KL9A 4PQUB 5HVGA 2HF3A 4X66F 4PL8A 4OJHA 2ZE2A 7ICNA 4QZHA 4IJNA 1P1TA 2QT7A 1VBXA 5JS1A 3BGUA 4R79A 4O4RA 4ID8A 2ATLA 2D3O1 3CIPA 4KLQA 1SIJA 5AIAA 1DXSA 3MXJA 1RBUA 4WFAQ 3H5YA 1W2IA 5IT4A 4BG9A 4FJ9A 3UXOA 3AO5A 4HL9A 2ZGZA 4K4GA 4NL5A 4AH9A 4HUEA 4FXDA 5B0DA 1C4AA 5LMUJ 2UXBF 1U9LA 1WSEA 2IOCA 2IOFA 4DSIA 4IOAQ 5ETMA 3OUYA 1NM2A 4WTYA 3RAXA 3WXKA 2EAOA 1LW2B 1NU0A 2MU2A 1W7WA 1SJ1A 1VJ5A 3M4XA 1WG5A 4F0HA 3SEOA 1U0SA 4N56A 4OLOA 4QS9A 2OPPB 2MSTA 2KK0A 1MWQA 3N4MB 2MEWA 3BY5A 2ZUDA 3SLCA 2W4PA 3HHKA 3HX9A 3BO2A 9ICCA 3I9V9 3U3GA 4BREA 3QEIA 4DZ6A 1CI4A 2VWJA 3E9LA 3N79A 2ZH7A 1YJTA 4YUDA 2QXLA 5LT5A 2QWQA 1KLNA 4Z6FA 2C2ZB 3SAHA 4YD2A 4Y0WA 3C5FA 1ZQGA 1AZSA 4X4OA 2B7CB 5BREA 2HBZB 4UW9A 3HHDA 4FF1A 3CNHA 4JS4A 5EHHA 3MBYA 4JI1K 1WOSA 3OYFA 5L46A 1W97L 1APSA 2W01A 1IR2A 4KV8A 2HRYA 4FS1A 1Z2ZA 2MZSA 3IGNA 3RB0A 3C29A 2HNYA 3HSZA 3TA2A 4OPKA 4BWJA 2R7WA 5J8YC 2H9ZA 2K4EA 5KFQA 2RP5A 4CZFA 4YR0A 5A76A 4CO1A 4OGEA 2AD9A 2CPXA 3GSDA 1MN7A 3FGUA 3OR1B 5BRDA 3T69A 5FLXO 3J80Y 2XQCA 4O9MA 3HT3A 2GW8A 4JK1A 2RE2A 2KICA 1S48A 2Y8YA 1GOCA 3CCLN 1N34K 4QWAA 2QW9A 2MKHA 3ZZ0A 3NF6A 3ETRA 2FY8A 1FX4A 2EI5A 3K0JA 4DV1F 3UE5A 5L8RC 2QA4S 4ED7A 3HYFA 1REVB 3ONNA 2AYMA 3BKTA 4LD0A 3FR0A 3QNNA 2W3SA 4DPUA 3FBCA 1IXKA 5KT7A 5EWGA 5AQMA 2LQ8A 1RHJB 3DLEB 2VBWA 1U7LA 1BY9A 5AIBA 3THTA 2IY5B 1HNWJ 1JLAA 3UN5A 3DAWA 4ETZA 3NCIA 4I6AA 4QYZJ 4RQ6A 3L3VA 5JMNA 5A6WA 5E79U 3VQSA 1COKA 3BS5B 4ZCKA 4FZNA 3QETA 2QLBB 4CLLA 1KAXA 2XYHB 4DV4K 3CI5A 1X60A 3Q7CA 2G0AA 5IFMA 2AV5A 3MURP 5GADI 1NXIA 3TKAA 4YOUA 4RQ8A 3MM7A 4DR2K 1RNHA 2A2DA 3AB2B 3NLCA 3U4LA 1U6ZA 1KVJA 2IM3A 4CF4A 1UW9A 3DJCA 3SPYA 2GO9A 2BCRA 1DLOA 5JICA 4KMUA 3TSUA 2CQ1A 4CJSA 3CJ0A 3FFIA 4C8NA 2MSSA 4RTFD 7ICPA 5FLXU 4FLTA 4DUYK 4BDYA 1VQ7N 4DR4F 1HBNB 1I39A 3CCSN 5CR0A 1YRTA 4MKAA 2LQJA 2BJ7A 5LL6d 9ICVA 2WC9A 1O08A 4DL7A 1ZD5A 3BB5A 2IYIA 5DBAA 2Y1JA 2B9EA 1NH8A 2JLEA 1RGIA 3VESA 3EVMA 3LP0A 2OPRB 3NS6A 3PSFA 1RDBA 2XCPA 2R7OA 4K7QA 3KJQB 5AK5A 1HPZB 4WZMA 2QSFA 4A4JA 4CNQA 5K5MA 4OX9K 7ICSA 2HOQA 1ZRNA 2QYGA 4QZGA 4FOEA 2HOIA 1N5YA 3DLLL 1TKTB 4FZZA 1X66A 5J0OA 4AF1A 4EZ9A 3IAS9 1AA1B 3F41A 3V9XA 2GFFA 1KFSA 3MPWA 1VHXA 3ZC4A 5BYSA 5BOMA 3OHAA 3MHYA 3MCSA 2I2YA 1RTDB 4OKJA 2RU9A 2ZUBA 3MWBA 4L73A 2YCHA 1VQ6N 2LECA 2G5IB 4CJVA 2BCSA 5FD1A 1X4AA 4YMEA 4DDFA 3MUVP 4JRPA 4WFYA 2VFVA 1I1GA 1YJ9N 2PKEA 1E6VB 1HFEL 3TAGA 4U8VA 2NREA 2XYPB 3AXKA 1AT1B 5AM1A 1I3OB 4DBQA 2GJ2A 4O8KA 3U1NA 1KQSR 2VA3A 2OKQA 4ZLPA 2RLTA 5KTQA 1F21A 4CLKA 4NLBA 3RH4A 2GHVC 2DKZA 2QA2A 2IRYA 4DSJA 3JTNA 3Q86A 3NXZA 2P9SA 5DG8A 4YMNA 5L1MA 2BJDA 1S5ZA 1N33K 3WKCA 4PHDA 1N5XA 2BOAA 1L3VA 3F53A 3PSTA 1XMOF 4PWDB 2LQBA 4BR2A 1VYAA 3F9KA 2Y1IA 5IOLA 4XA5A 1X7VA 2HLTA 5AK4A 5D4PA 3PEJA 1NU4A 2WF8A 3N6LA 4W5NA 2IVOA 3PSIA 4AT1B 4JI6F 3M8WA 7ICFA 1JXEA 4MFFA 3JSYA 4UAZA 2YQ3A 3D9BA 4DSFA 2W9BB 2ZH4A 4PY5A 4KY3A 1O13A 1RWPB 3AA4A 1ZOLA 1X5SA 3DGVA 4TYBA 4PKIA 2LYVA 4BHQA 4YB7A 4B3MJ 3MR5A 4TQSA 3FZFA 3JPNA 4LFBF 4CGDA 1F5CA 2ZOMA 2DXFA 4B3SK 5ALVA 4URGA 3OYJA 4KHPK 2O67A 1RT7B 3CEDA 5TKYA 4FP9A 5M2PA 3K59A 3WXMB 3H3OB 3DRPB 2PMZC 2FPHX 1RLDA 3I1YA 2IBKA 2IVMA 3H8SA 2OPSB 5AKLA 1NJXA 2QFJA 3D6FB 1BI4B 1QQNA 2W6LA 4J91A 1SBRA 2E8AA 4IEIA 4DV6F 3EZUA 2E1CA 2F1JA 2EWSA 3OVNA 1GFWB 1VQSA 2HFZA 4QQBA 3MZIA 5CYMB 1DK3A 2DUYA 3FCHA 4CZIA 4J9KA 3AA2A 3VF6A 3ZZYA 5T7BA 1BVSA 1KLMA 1WC1A 3RJHA 1VQ8S 5D0GA 2DNGA 4DR3F 4LY7A 5LJVA 4PWDA 2EBEA 4AYBC 4KH4A 4IZ9A 3PW2A 4ECXA 4BQZA 5J2IA 3U9ZA 3FMBA 4I2QB 2HGNA 3V7JA 3ATVA 3PIOL 5KFEA 2DGSA 1QQMA 1BO5O 1PO6A 4DSEA 4P52A 1HNIA 3M8SA 3SUPA 2W9BA 4LF9F 3ZT4A 2A1JA 2CUYA 1KQKA 1ZC6A 3QGGA 4X65F 1RT5A 4HVJA 1S1UA 3VGKA 1TKZB 4K4YA 1TL3A 4O5FA 2HGLA 5J1NA 3UMCA 1UVNA 1FJGJ 1JLEA 2OMLA 1RTIB 3GU0A 2RQ5A 1ZBLA 2MQNA 1F9FA 2EC0A 2B0CA 2AF6A 1RT7A 1YTYA 3SV3A 3CXCM 4HUFA 2KZMA 4DV3J 3M05A 1WG1A 3DRPA 4MT1A 4Y6IA 2OPSA 3KG1A 4K43A 2C3YA 3LP2B 1RWWB 1BI4A 3S9HA 1PK1A 1GO3F 3DDKA 4DV5J 1LFPA 1I94K 2F7VA 4C1NI 5HRPA 2IYGA 4H4KC 2YNGB 4ECZA 1HWLA 2VDHA 3D2QA 4KI4A 2W7PA 1A5WA 3CSKA 5CYMA 3N5BA 1BC6A 1EKEA 1WKJA 4IEEA 2KJ8A 1LW0A 3ZLJA 4ZTJA 4C7QA 4HHTA 2XWYA 4JI2K 4M5DA 1CXUA 4WIQA 2HW3A 2HBYB 1NGBA 4KHYA 3OSPA 5J2FA 4FZYA 3RH6A 3GJRB 3UR3C 3QICA 3A8KA 2ZC4A 2KYXA 5LMNK 2UZAA 4WKYA 3K1RB 4I2QA 4ED5A 2CXEA 1WD6A 2NXCA 1K0VA 4JI7J 4C48A 2ACMA 3A5MC 5AQLA 3RB4A 3VQAA 1FDAA 2DGUA 2LA4A 1M5PC 3RMDA 5J2NB 4A8FA 1XNRK 3OYGA 5IV3A 3Q8LA 3QFUA 4YDUC 2NYIA 4MAKA 3G87A 3SIPB 3VEXA 1CJTB 3LANA 2D69A 4FLYA 4DWIA 1PYOB 1YTUA 4UB2A 2P6RA 3I82A 4AYBD 4USKA 2B4UA 4BROA 1IWAA 3DHXA 1VQPS 5AI8A 2VANA 1JLCA 2PIIA 3GQCA 3F44A 4CZHA 1LXJA 3HRGA 3E8OA 3ZETB 3TAMB 1N54B 3OQ2A 5CYJA 3AOCA 3E01A 4ED4A 3WXJA 7ICMA 5LJWA 2NXJA 3H7HB 2Y0SF 1DQ8A 2VFSA 3GOIA 2FMSA 4BR7A 4UB5A 2VWKA 1C0MA 3TANA 1A6SA 4FM1A 1BNPA 3UD3P 5BJRA 3H0RB 4DFDA 1FFVA 2ZUCA 3SXLA 5ETPA 4CJKA 3IWNC 3O9TA 1RHMB 1FKPB 4KHUA 4KPYA 3TFRA 4X64F 4P2MA 1RDDA 3QWUA 2WBNA 1N62A 2UUAJ 3IG5A 4LF6K 5KG4A 1XJWB 1XNQF 4G1PA 4FW1A 3EM1A 2BCUA 8ICEA 1EWQA 2ZHOA 3ZT0A 3A0IX 2UXBK 5BPLA 4LFCF 4NJ8A 2JHEA 4NL9C 2FY1A 1RADB 3VWSA 1UL3A 2V4QA 1MLAA 4LF8J 3N4QA 5BR8J 2JH7A 4NY8A 2VQFJ 1FF2A 3AVHA 3RBXA 5ETRA 3E9PA 1XWLA 5ETOA 3I56S 4DL4A 1VRTA 3H42A 4HLBA 3QUCA 4LFAJ 1QSYA 1SCJB 4IQVA 3LTOA 3D1QA 1N5VA 3EXYA 3G6ES 2U1AA 2OEKA 1HWIA 3U1LA 2KVIA 4KH5A 1IBKF 2BZFA 1TVAA 3TAMA 1IV0A 5HQLA 3MOZA 1RA6A 3Q8RB 4OGCA 1B7YB 3AO4A 3PCOB 2QMWA 8ICZA 4EO6A 3CFRA 4JBCA 2NQPA 3HKZC 2OTJN 3L7OA 5KFDA 1OSCA 2RE1A 4F2RA 2W6KA 1VBYA 2WW4A 4ZCLA 5J2BA 3F56A 3OYCA 4AFFA 4J8FA 4K4ZA 4YMOA 5DMRA 3HPOA 1XERA 3GJSB 1VQMN 1BA0A 1UEUA 2LFVA 2GGPA 4CJFA 1HBOA 1MU2B 4I2JA 2PFQA 3L8BA 2MRLA 2BKPA 1CXQA 4CGFA 4PR6A 4NV0A 2E2QA 5EVZA 4I2DA 2H54B 3VR1A 3CGIA 3M8PB 2EBGA 4CHPA 2V2VA 4O4GB 1HYSA 4USTA 1BUPA 2PBDA 3OL6A 1E4FT 2GOLA 4XTTA 1R43A 3NVMA 5GINA 4OI4A 1RPLA 1X2IA 3IG1B 5J2MB 4MQ3A 1PYSB 4JI8K 4Y2RA 1Y5IB 2BOPA 5J0SA 8ICVA 3H0LB 2UXDJ 3LF0A 4KSEB 2W43A 2V2ZA 3MXIA 5FPMA 2X74A 2LEPA 1KVCA 2LVWA 3W61A 4DCHA 4DR6F 3PX6A 4FWMA 3MEEA 1V38A 1L5UA 4W5OA 3HVAA 2V51B 2DVIA 2JLFA 2UUBF 1PGZA 4CLWA 2JVOA 2K8GA 5H9FJ 4NXNF 2QWOA 2J6TA 5ELZA 3P39A 4G1QA 3TZYA 3HOSA 2E5LJ 3LDNA 3SZ2A 5C2DA 2ZBIA 5EN1A 2BX6A 4RQ3A 4OI6A 2VONA 2OSQA 1ZQVA 3C16B 1OH7A 1D8YA 1COOA 1RWNB 5L9NA 3W65A 3WIVA 2HNZB 3A8IA 4C11B 4KITB 4CYUB 4KC5A 3CMAN 5CE3A 2FVRA 4FZMA 3B54A 4DJBA 3O9QA 1P90A 4E7JA 2OEJA 1H1VA 3GE9A 2MHNA 2O66A 2RHKA 4GV9A 2HZCA 5J1EB 5B0CA 4OJ1A 3SK3A 1Y5LB 1GXTA 3UR0A 1TV6A 3O08A 4ELVA 2QRRA 3QLHA 4PPZA 2VG6A 2FSJA 4YHHJ 3EPGA 3TA1A 2XMUA 3C46A 3OW2M 3LDOA 1VOMA 4I2PA 4B1VA 4NXZA 1RBRA 3CJ1A 2KN7A 1EZZB 2DBYA 5EE9A 2XO6A 1DT9A 1KVIA 4QIWC 2MGZB 4O5CA 3KJNB 2H48B 2YHYA 1SV0A 3THWB 4A47A 3KK2A 4YVZA 1FRJA 1RWMB 2OCEA 2XNQA 3HTVA 3IG1A 2V7ZA 1WC4A 4IH6A 3UDLA 1NM1A 1C7YA 4U7UD 1T9TA 2I7NA 2FJ6A 2AWZA 2ZIUB 3FBBA 4FLVA 3B4MA 3GIMA 3ZYYX 4K4VA 3JYTA 3JXUA 2W8LA 4FJ7A 4OZ1A 1TFWA 2BA9A 2RDDA 3MCOA 1C0GA 1UAWA 2HAFA 4BDPA 5HRSA 5T41A 1L7NA 2IRUA 2FUG9 2ERRA 2ISOA 2AEMA 4OX7A 1WCNA 1UVIA 4GKKK 4JWMA 4M63A 1S0OA 4ZITA 3M9MB 4FLWA 1QHAA 3IR7B 3IGVA 1LFWA 2W9CB 2HNZA 3JSBA 2V69A 2ZIWA 3MM5A 5M1NA 1TK5A 1S5JA 3WNFA 4Q0BA 4U7BA 2AEFA 2LYHA 2BANB 4TY8B 4DR7J 1ITPA 1ATNA 2P5VA 1ACMB 2YQ0A 4US8A 2YB1A 2FVPA 5KPTA 4J9MA 2VZ9A 3FGVA 2VQEJ 1SIWB 1XEZA 2HZVA 2F1IA 3AJDA 4YS2A 4C0BA 1KVAA 4QWCA 4P4OA 4RL1A 3QO9B 1KXPA 4C23A 5J2PB 5CEHA 2H65B 1RA7A 4RNMA 3SI6A 1Z19A 4F3OA 7ICEA 2VBZA 1FEZA 3MCPA 1UHUA 4KI6A 4HEA9 3AEVA 2EFNA 1QQ7A 3QT8A 3DDNA 3THWA 2Z1GA 1SAZA 3MMJA 3N9UC 4O3PA 3VQTA 3KNGA 2C42A 3TUZC 2R2SA 2IHMA 1T3QA 1U26A 9ICAA 3IBWA 2PE8A 3DN9A 4FCYA 2PFOA 2ZH5A 1KN6A 4JI6K 3QUBA 1FRMA 2R8JA 3GV5B 4JMUA 2ZIUA 3G4SN 2MB0B 3QESA 3T6BA 1XHXA 2CJKA 3VF4A 3PG9A 4RW7B 4DOAA 3HSGA 3ZX0A 2E8PA 2F9WA 1SIZA 2QIFA 2FTRA 1MC8A 2P5OA 3MM8B 5KFGA 3D28A 2DF4B 2ZDOA 2DHXA 3LW5C 3JAMO 3AH6A 4QIVA 3AA3A 3RMBA 5KFSA 3HVWA 3HZEA 1S6UA 1NK6A 5EX0A 4OFZA 2BCQA 4K4WA 4JD2B 3LGNA 3QNOA 2UXCK 5D0EA 1JLQB 2DXDA 5F1XA 5IC6B 2A6OA 4HVZA 2P9PA 2W9CA 2MQ8A 4UY8T 9ICGA 1ZQOA 1ZZFA 4CM2A 2EFPA 2BUPA 4YOVA 2B4VA 1BQMB 2C3UA 1J27A 1BLUA 2VCPA 1RWKB 3QEPA 8ICRA 1GXUA 4UY8O 1JLGB 2ZITA 3ZTSA 5BPMA 5DLFA 3IWXA 4MJKA 3ENWA 1ZQBA 4JI0K 5CCLA 2M0NA 1SS6A 1GEHA 3OYMA 1YTAA 5J2PA 3H46O 1YJRA 4A8OA 1OVYA 3VERA 1FD8A 1NK5A 4EEYA 3L4PA 3NMUA 4RW9B 5JUMA 2P9CA 4YOTA 5EY4A 2OFGX 4DV2J 3QEAZ 4RWXA 1S49A 2ALYB 3MAQA 1NZBA 5F0XA 3MOJB 4W4MA 4E19A 2Z58B 3MFIA 4E0DA 3OPKA 3RAQA 3Q24A 3CM6A 3KD5E 2JLGA 4KO0A 2UVVA 2C22A 3E1YA 4I9QA 1GXLA 1FWLA 3PV8A 3DXMB 5AI0A 4LF9K 4FFDA 1N0VC 1S0NA 2YKOA 1J5EJ 4RW7A 1KS2A 4UF4A 3RTVA 4CVNE 2KHDA 2LU1A 4DEZA 4MF2A 3RJFA 3T7ZA 4Y2MA 4UATA 3VQQA 4TU7A 4FKXA 1XC3A 3MM8A 2WF5A 3KLGA 1SJRA 4EBDA 1RWOB 3BPDA 5JLFA 4WFAL 2ATCB 3AD7C 1JLQA 3AA5X 1F44A 5FPNA 2HFUA 3DLHA 3IM8A 2B56A 2FHKA 2ZH1A 2MA1A 2NCKL 2HNDB 5H9EJ 1GLJO 3CB4A 1RHRB 3OL7A 2C1EB 2A40A 1VQ9S 1B92A 1GTEA 4IOAL 2DWQA 1WUUA 2RSQA 1WCLA 2P1JA 5KL8B 1NGHA 3SQ0A 4ELTA 3WK4A 4FL9A 3TAFA 3VTHA 5H1SV 1LVHA 3FUYA 4RBTA 3VENA 4BCAA 2J76E 1VIXA 1NKBA 4BUGA 3PIPQ 4FVUA 2GWKA 3T79A 2LEBA 4CZEA 3QNWB 2E6MA 4H0OA 2CQDA 1PBAA 2NNWA 4E7LA 4CLZA 4IXCA 5I3UB 3BBFA 1Q8KA 4QZ9A 2G09A 3BN7A 3I0SB 4OZNA 1RFQA 3BEXA 3G8SA 1RG6A 1BGXT 1NEEA 1KAYA 2V0NA 1HNZK 2AYBA 4NMXA 1ZBHA 2EFGA 1CBKA 1F5BA 4BRIA 5L38A 1QE1B 5AM5A 1SC3B 5GAEU 3DXMA 4B3RJ 1RDAA 4FOIA 3JTPA 4R25A 4C3KA 1Y64A 1UCVA 4DV1J 2HBMA 2HRUA 4FLUA 4LMZA 4TSXA 3CW2C 1R3NA 2E7WA 4R63A 3KZIU 5KFLA 4KX5A 4PQAA 2GCFA 4J9LA 2DISA 2XI3A 2KZZA 3AV9A 2Y0SD 2LDIA 1D8ZA 1RHUB 2ASOA 1ILYA 2GWJA 5AXMA 4A59A 4CBXA 1B4SA 4NA2A 1NGGA 1NGEA 2Z1IA 1EQ0A 1ZTWA 3OFGA 4ID5B 2H3IA 1NK0A 3GZ7A 3OVSA 4LF7F 4DR5J 4DTNA 3C14B 3PZPA 1Z26A 3DRRB 1NHVA 4RBUA 3UD4P 3VAGA 3VVTA 3O5BA 4HTIA 2GQQA 3PJXA 3QT7A 2GC8A 2AJQA 3QIPA 1HPMA 3CCZA 1RACB 2G13A 1YBUA 1YIJN 2A2CA 2OPQA 1IKXA 5HBMB 2EFVA 5I42B 3BS9A 4AP9A 3OHBA 4ZVHA 1B7FA 4DUZK 7ICGA 4I69A 3TJ9A 3ZSOA 4X64K 2DNQA 2HHHF 3O4QA 3BF1A 3THVA 1H2TZ 1X9JA 2HCFA 1IJEB 2RRDA 1WHVA 2X7IA 1XN9A 3I0SA 5DRKA 4MYTA 3CXCR 5JXSA 2NPIA 2Z7JA 2X6SA 1SWWA 3NWRA 1YVNA 1HNXK 4MFBA 3MEDB 1R7IA 4M5HA 5ALHA 4EP5A 1IQZA 3N4WA 5KT2A 3OBYA 5BRHA 3IDHA 1J2NA 1ZAXA 8ICCA 1JNZB 3TARA 3C3LA 1ZBSA 2YX6A 5SWMA 1P6TA 4IQMA 1TR0A 3WXIA 2VIHA 5AJ3F 1ZQYA 3DOMB 4LSNB 2FC8A 4CLUA 1KBRA 2V4JA 2FBTA 4PZNA 4ZVOB 3EDRB 2HVEA 5A0YA 3OBIA 4DX5A 2FPKA 4F92B 1NGIA 2QK9A 3GP9A 3ILOA 4IO9Q 5EUHA 8ICPA 3RBDA 5HI7A 2IA0A 4ANDA 3W64A 5ALQA 4KGKA 5C7PA 3ZNUA 1LV5A 4A5AA 3UXPA 4CM0A 4HT5A 4LIRA 2WW8A 2FPMA 5CAAA 5AKXA 1ZJMA 3H2LA 2OJ3A 4A62A 3C14A 2QKKA 3T1YF 5DQIA 2AEJA 1WSFA 1Y88A 1ZRMA 3NL0A 2GLEA 4RLEA 4OD0A 1WSRA 3LZIA 5CQGA 2AP1A 4MO5A 5IIJA 2HBQB 3QDKA 2R4FA 1CEZA 3HM8A 2YHWA 3DLKB 1SGGA 2K7KA 4QIGA 4Y28C 2ZNYA 4ICLB 3BV8A 2HMIB 3SAFA 3ZSXA 1UCNA 1RI7A 4HT7A 1SB3C 1WEXA 3J81O 1RLCL 4OHVA 2DK2A 4FXVA 3W2WB 4BRMA 2Q0RA 2J7UA 4WCEQ 2PFDA 5A2QY 4R65A 1ZQJA 4E7IA 4IOCQ 5AI9A 2DR6A 3CT9A 3J7AN 4EP4A 1XMOJ 1HWUA 4R5PB 2HBKA 4CZMA 3ISDA 4NLUA 3SBMA 1S7HA 3HF5A 5HR7A 2CQ3A 1C1BB 4DX7A 5IWAF 2QEXS 4UB4A 3UCGA 4DR6K 1OY9A 4NPOA 5J8YA 4A48A 4RQNA 1SH0A 1L7MA 1FRHA 4KR0B 1Q7YT 4FJNA 2NUHA 3DOMA 3BKUA 1WAJA 5L1IA 4HCCA 1Y97A 3DLBA 3OS2A 1YJNN 2X1FA 3SBGA 3IRXB 4RUBA 3IKMA 1WNSA 5GADU 1Q7YO 4WTOB 2CYYA 2QJ3A 4Y2KA 3U7JA 4MDBA 3GDQA 2HHUA 4NE9C 3M9OB 5HQ8A 4DTXA 3R9KA 4C8MA 1FDNA 2KQ2A 2CZVC 5TISU 5CB1A 4ZIVA 4DFJA 4RT2A 1FEHA 1JX4A 3KKAA 4QR2A 4MHVA 4AUKA 2RJZA 3AVCA 3EWGA 1HKCA 1EQMA 2OEHA 1WF2A 3D2FA 4OJRA 1VQLS 2Q97A 2MKCA 3HDSA 5KQDA 2DXEA 2E2OA 2V52B 3B6PA 3H6EA 3LP1B 1BDGA 3P96A 2F9JA 2IOFK 5G0RA 1NK7A 2OP5A 4NLZA 3MWTA 1QSSA 4KHNA 2HMIA 3M5RA 2P9KA 1DRZA 1BWEA 3UXNA 3J7YU 4YQWA 1D9FA 2B8PA 2IHNA 2E66A 1N48A 2HWIA 1WHWA 3ITHA 4D3HA 3MDCA 2BQRA 3R6MA 1E6YB 1G99A 4E1JA 2GV9A 4DR1F 4O3SA 1SXLA 2VGMA 4W98A 3R7BB 4ILHA 4R5PA 2ZJ8A 1VQ5N 4FJXA 3CYMA 1GMUA 5J2AA 3BEGB 3LDQA 2VU5A 4CP5A 1AUDA 1CULA 2FLNA 1RABB 2D9PA 1VQ4N 3V6JA 1R31A 2OM6A 4FO0A 1KFTA 1M1KT 1V5IB 2NR0A 3O9UA 1BE4A 3QJPA 2DGQA 1L7PA 2F8TA 3DRSA 3B0YA 3DM2A 4KBIA 2DH7A 2WVCA 3A8EA 3ENQA 1C6VA 1KQFB 3Q8KA 3QATA 5FIIA 2GAHC 2A19A 1L6NA 2Z8QA 5A8WB 5DQGA 3CMQA 1M1KO 3AVAA 1FWPA 1S97A 5HJYA 5LMUF 3OTOK 2FYXA 3JTOA 2XTJP 5F0WA 5ETVA 4MLHA 4CHQA 4JKHA 1IBCB 1P27B 1U4BA 1UZHA 1GX5A 1Q78A 5J0XA 2R7TA 2CPDA 2N7CA 4F71A 3OJSA 2J0QD 5TZVA 5IZHA 5HRRA 2XWXA 2Q66A 2NRXA 1HUOA 1WC6A 2AHOB 2BRKA 5C15A 1SXDA 2YKPA 1RQLA 1TK8A 4PXEA 4NXMJ 3S3NA 4FLZA 4CE9A 4G9BA 5GAGI 4KFBB 3QRPA 3BZCA 1MA7A 2PXIA 4CJRA 1H38A 4KHWA 4Q8EA 3Q8MA 4USAA 3RJKA 2M9KA 5F8JA 1WC0A 3ZSRA 3MAHA 4M5LA 3MM6B 4FWNA 2P9IA 4HR2A 3EL2A 4DQSA 3VQEA 4C4SA 4EWTA 7ICQA 1JL2A 5H2FU 5D78A 3R8YA 4LRCA 1TUGB 1S72N 3RBEA 5HP1B 4GVEA 2CDQA 1UETA 2ZD1B 3I32A 4RG8A 4NLTA 5J0QA 5JS2A 4NLYA 4DFMA 1DHMA 2K3IA 1RILA 4B3TF 2PFNA 4UOFA 4DSKA 1U6FA 1BPYA 2FC9A 3THYB 1RDFA 2ASJA 4X62K 4DTRA 3R5CA 1O51A 2ZM6K 1WG8A 1Q86T 3CJ7A 4M3UA 2B5JB 2V4RA 5BOLA 5DDMA 1ASVA 4M9GA 3PLAA 4QZBA 5L9XA 3R3TA 2HFNA 2J6UA 4JOUA 4BGAA 4P0PA 2EK1A 2P9GA 2L9WA 1Q86O 3DDHA 4DR2J 4NLVA 3PW5A 9ICJA 3KNAA 5BXIA 4CLSA 4OHXA 3H5XA 5FPEA 2O5DA 2ZWHA 5ALMA 5KFJA 4NI2B 3ZDAA 3LM2A 1YITN 4ZJOA 4DQRA 3SQGA 3PYDA 5F0UA 1JUDA 2JEGA 1FWKA 4ED0A 3GILA 4LSLA 3UD5A 4CLFA 3IHQB 3CCJS 4QPXA 1A77A 3FAHA 2BW7A 4DUYJ 2CG4A 1S1TB 4Z4CA 2XMWA 1IV8A 4RPZA 4BRQA 4KLDA 4OPJA 4FPBA 3O9SA 1NNDA 4KYZA 4P0QB 2RAQA 1XO0A 4KFBA 3L4QA 5JRTA 1S76D 3NS5A 1U1RA 4MK8A 3ENOA 2BYCA 4F72A 4H4OB 7FD1A 1HNWF 1SKRA 1ZOTA 2MXYA 1DOQA 1UPMB 2CZ9A 4DTPA 5FROA 3BGRA 4CF0A 1PAEX 1RT2B 1JKHB 3K2PA 4B1WB 4BGDA 1I3AA 4OX9J 1B3TA 2E7XA 4UQTA 5KG1A 2DNOA 2NS1B 3UFCX 2CIMA 4FNIA 3TYTA 4K8ZA 2A3VA 1IKYB 3I4PA 3KIOA 4C8LA 2ZJRQ 2QTDA 2DO4A 4IS7A 1GLLO 3VEWA 3BO4A 4EEKA 2KJWA 4L3NA 3RUBL 3ZCMA 4AHVA 1BPXA 2XI9A 3NMRA 4NYZA 2NPFA 1WBBA 3H4DA 1VLBA 9ICPA 4QWDA 4LRDA 1QTNB 4OZ3A 3CJ5A 4CTAB 2GEMA 4XK8C 2HK2A 1FK9A 1L7OA 2GH1A 5M1PA 3CERA 4ZKAA 4PGQA 4GY2B 1BISA 1DAXA 4RX6A 1VRUA 5KG2A 4BRKA 2YX7A 4E2FB 2HZAA 2O8FB 5BRFA 3DU5A 3PFEA 5MLCV 3P4UB 1HA1A 5C25A 1XBWA 1HRHA 3VOVA 1RXWA 4J9VA 2ZH2A 3POTA 1XU4A 2C2EA 3ZT2A 4L8RB 3GTYX 4KAIA 4KJIA 2B9XA 4KGVB 1OUQA 4A8WA 4DN9A 3KHYA 4CF5A 2QMUB 3NVZA 2IDOA 4DXLA 1B0PA 3T5LA 1OVQA 4P0QA 2R2TA 1TMMA 3T1AA 3FQLA 1RZTA 2HPUA 1KNZA 4LVOP 5CZ2A 1IJJA 3DDIA 1VS3A 3D2EB 4L72B 2NRWA 1HX1A 3LK9A 2XY7A 3EGWB 1GLBG 1N5SA 4M41A 2GVDB 3A13A 3ICLA 4DPXA 1D4XA 5AZIB 1FKOA 4P73A 3I76A 4UUXA 3OTQA 1JKHA 1TVRA 2FVCA 1Z25A 5KG5A 3UPFA 3D5MA 1BPZA 3O5TB 1XR6A 2KJ9A 3Q8UA 4BC3A 4H4KA 2NO5A 3WNGA 3IO1A 3C6HA 3C2LA 4UY85 2BKOA 4BXOB 1M1GA 2NRRA 3EICA 1FO1A 1NJZA 5IT0A 1WTFA 1JLBA 1F6TA 3OLBA 3C2KA 2MKIA 4CEZA 2DT9A 2FDNA 3MTJA 4B3SJ 4CTAA 2IBOA 1S6PA 4F4ZA 4KHPJ 4X4NA 3OS0A 4LBHA 4ZPTR 2A1AA 2GJIA 3HI9A 1BQNB 3A0HU 2DGTA 3CFPA 2RHQB 3EGNA 3MCAB 3CFOA 2I8EA 4ZN3A 1V3RA 1CLFA 2ZTDA 3TUJC 2WAQF 1OYDA 3DOKA 4NEYA 1T95A 5D15A 1RZMA 3N97B 3C6UB 3QSIA 4IR9A 4JI5F 5AQNA 4OHWA 1N8RT 2QL7B 3A3NB 3BQTA 2V50A 1MMDA 4B9VA 3TABA 2O8CB 3QFPA 2FI1A 3P31A 3BKFA 3VHQA 2QARA 1Z00A 2CRLA 3KKSA 1RGVA 1VFJA 5B09A 1GH8A 3AVIA 3BP8A 3TNVA 3WK5A 1N8RO 3DU6A 2DYAA 2X3DA 2IDEA 1CZBA 2XZTB 1V3ZA 3KLIB 4B3MF 4J7CA 1Q7LB 2LMIA 2WF6A 2ZDPA 4DV0J 4EMDA 1T94A 3T5KA 1VAZA 5ALSA 3OYEA 4LF4J 3SCJE 3OV7A 4P4PA 4OZLA 1XQIA 1OKJA 3HJFA 2UU9K 1IM6A 4HHJA 3LWLA 1HL6A 3LYSA 4H0TB 1Y5NB 1X31C 2ZG6A 2IIHA 4CF1A 4QZFA 4K41A 3U3YA 1DRGA 1IR0A 2E5HA 3ZX2A 4ZVTB 4XH4A 2ZWPA 2YHAA 2BUNA 4WJBA 2VD3A 2Y1RI 3FJ2A 3BN4A 2HDOA 2XY8A 4LC9B 1WORA 5AI6A 3W66A 2EANA 1FE4A 1N5QA 5AM0A 4ERDA 1YHQS 4JKGB 4JI4K 1Q5VA 4F04B 3HHLD 4RPXA 2PI5A 2K8CB 3CJ9A 3ZSZA 5CRXA 2RUGA 5AKYA 4NL9A 4NB4A 2QE5A 3PHEA 4IFVA 2K4IA 4PPDA 2EVZA 4JYAF 2P9LA 3LDPA 3IN5A 2BACA 3IR5B 1FJEB 4PYAA 4JV2A 2ITMA 4PKGA 3K5NA 1GLDG 2BJ1A 3QJLA 2GHPA 4OCZA 4WK1A 4FK4A 1WWHA 4M94A 2D3ZA 1QTMA 1U1LA 3KHGA 2DFFA 2W4DA 3ET6B 3TVYA 2E6LA 2LCWA 2XYGB 3V9UA 4K4HA 3UKRB 2ZHBA 4CJWA 3HLUA 1S12A 3IUCA 4C4TA 3QB0A 1N32K 4CJTA 2AX0A 3JSRA 3EUB2 2IMWP 2F4VJ 8ICGA 2C2OB 4C98A 5CH7B 1FJGF 1M1HA 5LMNJ 3QT5A 4X4SA 1NPKA 2H3ZA 1SQFA 3PW7A 5EWEA 3GPAA 3M32A 2B4OA 2EZXA 1SZHA 3ZD9A 2R7QA 3CC4N 3FK4A 4DV3F 3M6WA 4H0YB 4KBOA 3HZ6A 2LKYA 2XEXA 4EAHD 1Q4RA 2XMMA 3RB6A 3K5LA 4NM2A 4DG1B 1VSLA 1CQNA 4F36A 2KHOA 4BRDA 4HI2A 5ALDA 4DV5F 1FO4A 1SC1B 4M3TA 1CUKA 5IINA 5K4LA 5KFPA 4K2XA 3PO5A 1ZD2P 5DO2A 2EZYA 3SENA 3GONA 1G3OA 3W5XA 1Q16B 2KM8C 2KIVA 1CS4B 4DMNA 5ETNA 3SSQA 1O8BA 1HBUB 3QAUA 5ALEA 1NDLA 2LBOA 4PUOB 4FZXC 2BRLA 2G8IA 2I7PA 3EWAA 4CIFA 3ZD8A 4KREA 4O0NA 5ETLA 4U96A 4CEFA 5M1KA 3MECB 4C9DA 3F2KA 3ENBA 2E1ZA 3PYFA 1OY8A 2XG8A 3ISZA 3CULA 1RT4B 1U8WA 2WONA 1U04A 3ZEUB 5ADXA 4FJ5A 4ETXA 3HL8A 2R42A 2YNIB 4GXIA 3B8AX 4P9SA 1NI3A 5AZJA 5DM7Q 1M90T 3SCXA 1WEYA 2FQQB 4JI7F 1S1XB 4Y1CA 1K47A 3O3LA 1D0EA 3S3OA 2HQ3A 3ZZTA 3C94A 1HD0A 4I67A 2XZDB 1X3MA 1HIYA 4GV3A 2YN4A 4EFAC 1OYEA 1LAWA 2YX1A 1WDDA 1M90O 4ZVGA 4EIAA 1HQ2A 4LF6J 2GUIA 2E4LA 4XAKA 4O3NA 4KKOB 3R5BA 2XCAA 1DK2A 3HSCA 2NLXA 2KH9A 2VC1A 5A8KA 2B0GA 3FRYA 1K1SA 4I2CA 1T8EA 1BWVA 3L4IA 3QU5A 3SDEB 3DKDA 3VQ4A 4G3IA 2EWHA 3NEKA 4ZOSA 9ATCB 2PA8D 1NCLA 5DM6L 1PKUA 3BBCA 4USHA 1R0AA 4B1YB 2CA9A 8ICKA 1ZA1B 2VFTA 2XSFA 4KLUA 3OYNA 3J80U 2AIRB 3PDNA 1ZBFA 1Y11A 1FKAF 5KT5A 3UVJB 4KLEA 5IV4A 3V81A 1ASUA 1SQEA 2CPEA 2RMLA 3S1TA 2UUCK 2DH8A 3HFZB 1T05B 1ESVA 4CLTA 2JZBB 1QY7A 2YTCA 2JOQA 3OFHA 3R8EA 3M30B 4PG6A 2JV3A 1ZQAA 3JQKA 3D0IE 5J0PA 3AO1A 2CQ4A 1RCHA 1HR0J 4IQTA 4IO8A 1RHQB 1PIEA 4CJ3A 2KG5A 1TELA 3QMLA 2IAJB 1RYRA 1HBUA 1JLFA 2WB1F 4I6MB 4TNOA 1UAXA 3SCLE 3M9NB 4KLTA 4FKYA 4O44B 2YPYA 2DQNB 2GIRA 3MMAB 4UAVA 5HROB 2R7SA 1Z1BA 2EX3A 2WF9A 2E1AA 1ZPVA 4RT3A 3ZEUA 5LMUK 1W25A 1QQOA 2IC3A 3G82B 1YK9A 1ZXOA 3PJ9A 2BVZA 3HW8A 3GWCA 5AK3A 1IN0A 1FXXA 4RW6B 4IH7A 2W40A 1VSIA 5K8PA 2E5JA 3G6VA 2C2DA 2YBVA 4WP3A 4LSZB 4KTZA 3SFUA 4RPYA 3VTIA 2ZJ5A 2PC6A 4LFAF 4Z4GA 4NX9A 2ZXHA 9ICHA 3CJ4A 5KFRA 1U2VA 2E8MA 5HHIA 4F67A 3W2VB 1SH3A 2AGPA 4O23A 3NTUA 1VQYA 9ICMA 2VDIA 3DWLA 4GLXA 1R8AA 4R64A 2KG0A 4K4UA 3I56N 1G4CA 2KOBA 2IVYA 1RB0A 1MWKA 3ULEB 4I27A 5JTIA 3D0HE 3K8VA 4YB1P 2K8BB 2UV8A 2WHEA 3CJ8A 3DLRA 4RUAA 2BKNA 4NLDA 1OO0B 4I2EA 3E66A 1VSJA 3UVJA 2ZF5O 4RBVA 3RYLA 1WSGA 3W8GA 1HI1A 1CJVA 4GXJA 2GO7A 3DXSX 4ECYA 1S4FA 5A6PA 3OYHA 2XGQA 4B9LA 4NWBA 3K58A 2JZBA 2JGAA 4RW4A 5DG9A 2LYAA 3U9DA 3M30A 1NWKA 3MEKA 4QPTA 3W60A 4Z6CA 2KJ5A 4EELA 1X5PA 4BBYA 1P9QC 3VQ9A 2XLKA 5GAHP 2DR7A 2WUSA 2XO7A 3BR9A 1ZQTA 1EAYC 3CJCA 2QG9B 4BX9C 4ZPVR 2DR8A 3PIPL 2O1PA 2BHNA 1LAVA 2Q36A 5E2QA 3TX0A 3AM9A 3OXFA 2E1FA 1DEJA 3V9SA 1CJUB 1VSKA 3CCSS 4Z94A 1MROA 2QV6A 4TXSA 4BG8A 3ED5A 3G82A 1H73A 1WJ9A 2HS4A 4JKBA 4I9LA 4U8YA 4B3OA 4RW6A 2C3OA 3I9ZA 1V97A 4Y2PA 3L95X 3MTKA 4CGGA 1HI0P 2FC0A 3F73A 3QU9A 3ETOA 4QWEA 1U2FA 5AQVA 4DZDA 4WFNL 1FFWB 4LF7J 5KOWA 4L3KA 1WACA 2DJWA 5FDLB 2H5XA 3CD6N 1YI2N 4HACA 3NH2A 3A5NC 4DCJB 3ULHA 2H5IB 2E5LF 1JB0C 4CK1A 2V94A 5G5GA 1TYQA 3I0RA 4QYZK 3VEYA 4ZPCA 1YAGA 1ZD3A 3GJTB 1ATRA 4HHUA 4LR9A 2D5RA 1OS5A 5KFCA 2WAQC 3H0MB 4EO8A 4JK7A 3M8ZA 5D3GB 5DZ7A 1Y4ZB 1RUSA 1S3XA 4ZVRB 4C3MA 3RB3A 4BRGA 2FZKB 3GIRA 4J2BA 4NZ7A 1M5OC 2H4YB 3GYGA 4ZJLA 3CHWA 2AX1A 3AHPA 4TY9A 2KL8A 5KFNA 1RT1B 1X0FA 5HQMA 1VQ6S 1SB6A 4FYWB 5F9NA 1WB9A 1X6IA 1WSJA 4YHHF 4C3LA 1YJ9S 3NCQA 4GKKJ 4CT9A 2HVIA 3JPTA 1C0TA 3GSIA 5ALRA 3UNYA 1FJ7A 2I6XA 2FDRA 1S10A 1PC4A 3HVRA 2CGJA 5D8HB 4RWTA 4PL1A 3C7NA 5EE1A 4CCHA 2XBPA 2WBRA 3GLJA 2D8CA 3ALYA 3WBZA 1NUEA 1ZQSA 1HQEB 3AXMA 1X9XA 3A5LC 4KH6A 1J5OA 5KFMA 3KG0A 5AQYA 4NCGA 3A12A 3EW9A 1R0BG 4ZMMA 5KFBA 3L7UA 3PM9A 1ZM3A 1Z2LA 5C42B 1KEJA 2DFEA 1NH7A 1EIYB 9ICSA 1HNVB 3L7PA 4NLWA 4LRBA 2A6MA 1K5OA 2G5HB 4A2AA 3THXB 7ICVA 4OYZA 2YKNB 4Y2QA 1A9NB 2P9EA 1ATSA 3OY9A 2I9SA 2AGQA 1Q82T 2VUGA 2CXYA 4IFYA 1VSEA 4HWIA 1QAIA 2WRMA 5FJ4A 2XY6A 3G86A 4PH5A 2I0XA 3DFEA 2HBRB 4IO9L 3QAEA 2VKQA 1U24A 3IFEA 1RK8A 3K9JA 2CG8A 5ALKA 2D3DA 3JSMB 4JHDA 3TTDA 1UKUA 2YTUA 1HBMB 3CVKA 2M3DA 5IXUA 9ICLA 4FJKA 2HB5A 5DQHA 3BM7A 4KT0C 4KHSA 8RUCA 1F0MA 1RT1A 5KOXA 4DR7F 3HRDD 3VAMA 3WK7A 5IC4B 5ALYA 5ALJA 2DL0A 2E9ZA 2FBYA 3CMEN 3AAQA 1KBUA 4Y2IA 4ZPAA 2UXCJ 4MN4C 1OH5A 5F8MA 3G9CA 1UQVA 4JKDA 2ZE2B 4A46A 3SQIA 3SR6A 5EU7A 3PMNA 2WAQD 3Q8SB 5HL7L 1YX2A 2IVFB 5D4NA 4FJ8A 5E5NA 4ES1A 2V2KA 3FEYB 3QIDA 4USIA 2RDIA 7ICRA 3M2RA 5KT3A 1OJ4A 1BA1A 3UQ0A 3S6JA 4FN5A 2CPJA 2VOPA 4ILRA 1W2BM 1AW0A 3T6JA 1YJVA 2KD1A 2J8SA 1QLNA 2KKPA 1FNMA 3KK3B 4WCEL 4J9QA 3M6ZA 4Y2JA 1X5TA 4JI0J 4H54A 3CCUN 2BQUA 4IOCL 3GG0A 4N76A 1TL7A 2M88A 2ITGA 2CQ2A 3DNCA 3QBCA 3OUYB 4ZK7M 1FVQA 1BG3A 3S41A 4QU6A 3WK9A 1N36J 2PMZF 3NOCA 2P9UB 1WAFA 4NLPA 3PRDA 1XSPA 4MKBA 1XMQJ 2J9DE 2YNHB 1SL1A 3EPIA 3V1RA 4CHYA 3L3UA 3ICXA 5C2GA 2IJNA 2YWGA 2QKBA 3IS9B 4GVMA 4C6AA 3FZBA 2QB0A 1KQGB 1FW6A 2OAUA 3FRZA 2NXEA 4CI6A 1MNEA 4V19S 3D4JA 3O2IA 9ICIA 1SUQA 1T6DA 2R7VA 3JSMA 3VF0B 5EX3A 1HBMA 3VQPA 1XUPO 1Q0NA 2RRBA 2HQCA 1V4TA 4QIFA 3V9ZA 3NP5A 1UW4A 1LKZA 2LA6A 3C65A 1AZSB 4QR0A 4ANCA 1U0HB 3KLFB 3N0VA 4C0OC 2HFSA 2EW9A 1JWWA 3CCQS 3LA0A 3K4GA 1RU1A 4LQ3A 3QJJA 1J2VA 4W5QA 4FZLA 4QR1A 3F2BA 3D2SA 3LPEA 4Q7AA 3P6YC 2MUTA 4KLMA 4M3YA 4DU7A 2DFHA 4KV8B 2YHBA 4DV7F 3J7AP 2WHOA 5I3QA 2HNYB 3L5KA 5KFWA 4DFPA 2D0CA 3BZKA 1R89A 5HR6A 2HMXA 3NOGA 4DV2F 2J0WA 2V8VA 2BABA 1VBZA 5K14A 1SI9A 3KK3A 4J9NA 2FSNA 4DHVA 3OSNA 1HKAA 4FM0A 1H74A 5J1PA