3TI0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddgtp-dc in closed conformation
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 202
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ti0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ti0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ti0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ti0A01
2G8WA 4ECSA 1B9FA 2JEJA 1UWBA 1BPDA 5KFMA 5FDLA 9ICKA 2VG5A 3ETLA 4CEBA 4F5NA 5HNKA 4DOCA 3C94A 3DLBA 4JK1A 1XS9D 4FJ5A 3RMAA 1AROP 3KK3A 5KFUA 4RQ4A 1HNVA 1ZQXA 5DBCA 5J2MA 3KD1E 2AGQA 7ICKA 3SV4A 5CR0A 4ECTA 3K5NA 3JPQA 2OA8A 3CQ8A 2MUTA 2ASJA 4OLAA 5J2EA 1HMVA 4FK4A 1C1CA 1IXRA 1WSFA 4EBCA 1LW0A 2E4LA 5KG6A 4FLZA 3QNNA 5DQGA 4JRQA 4CEZA 2FPKA 3PW5A 2P1JA 4ED7A 1QTMA 3AO1A 4Q5VA 3M8PA 4RNNA 4I29A 4DS4A 4CGHA 5KFPA 4K4IA 2V9WA 3RBDA 2RDJA 2IGIA 4M3ZA 1T03A 1XHXA 5KFGA 1V9PA 4DTRA 3M8SA 4B8AB 3RJEA 3RJIA 4HHTA 4JUZA 3QZ8A 4PHDA 1KTQA 3K5OA 1A5XA 3OYLA 2D5RA 3SQ2A 4ID1A 1VSKA 3MR3A 3HW8A 4FJ8A 8ICBA 3L3UA 5KGXA 3GIJA 3RMCA 3B6OA 1KCFA 3V9XA 2R8IA 9ICIA 3IRXA 1A77A 1GOAA 3TI0A 1RDBA 4I2QA 3LANA 1Q8IA 3DMJA 4FZXC 4QZHA 4FJ9A 5KG4A 3AU2A 7ICEA 3SV3A 4CK1A 1YT3A 4N5SA 2R8HA 2RKIA 4W5RA 3KLEA 3V7KA 3WNGA 1RXVA 3TWHA 2GBZA 3V9SA 2RPIA 2FBVA 4FLVA 4NYFA 4LSNA 3QIOA 4ECWA 3V1RA 1NJWA 4DEZA 2I1QA 8ICVA 1JXEA 2JEFA 9ICMA 1W9HA 3NF7A 2XHBA 3G6VA 2OWOA 4ED8A 1COOA 7ICGA 5J2NA 1N5YA 4CCHA 9ICSA 2IDOA 3SUPA 4F50A 4YR3A 1XSPA 4CGDA 8ICIA 4GXIA 3N97B 5L1IA 2BQUA 1S9GA 2W9CA 1BVSA 1NK8A 2P6RA 3NH2A 3QE9Y 1MQ3A 3QEBZ 3WNHA 3THVA 4I28A 4I2FA 1ITGA 3L2QA 2Z1IA 3NF8A 9ICBA 5HHIA 4KTZA 3MFHA 4UAZA 4DF8A 3HP9A 2Y1IA 4EEYA 3LAKA 3KLHA 4F4YA 2WOMA 1MU2A 5J2AA 3KHGA 2G8VA 3OS2A 3QERA 4JWMA 4YD1A 4MF2A 5J0YA 1QHTA 4QW8A 4HCCA 3V6DA 3DOLA 4BE2A 3UQ0A 3LALA 3NCIA 2W9AA 4HTUA 2G8FA 3ORYA 2DPIA 3ISNC 4HUEA 4DL7A 3NAEA 1NK6A 1ZQNA 1YTAA 3N4MB 3DRRA 3RJFA 4I2DA 3OYFA 4QZEA 3VN5A 1DTQA 4ECVA 4F92B 1KFTA 5I3UA 8ICCA 9ICWA 4DFPA 5DDYA 4F5OA 1X1PA 1ZBIA 4I2GA 4F2RA 1RBUA 2HNZA 1RTDA 2ASDA 1N48A 2AJQA 4G3IA 4E7KA 3KLGA 4QZIA 2NRXA 3OVNA 5KFLA 2KFNA 5J2JA 1J53A 1ZYQA 3LP3A 4LH5A 1DTTA 4CK3A 1LAVA 4AHSA 4F4ZA 4IRDA 5FRNA 2KFZA 2P5GA 4ZTFA 3MDCA 3PX6A 3MABA 3G10A 3PO5A 4UB3A 4Q45A 1BCMA 5J2GA 4H4MA 4YG2A 4Q43A 1HJPA 3QEIA 1QSLA 1XO1A 2F8TA 4JLHA 3BQ1A 2VG7A 4RPZA 4B9UA 4KLJA 4QZGA 2KZ3A 1S77D 3G0ZA 1S9FA 3GIMA 3C23A 1GOBA 1S6PA 3K5LA 9ICGA 1YVUA 3PW4A 4K4HA 3M8QA 9ICLA 3T1AA 1ZQZA 4E0DA 5KFTA 1HQEA 5KFRA 3LZJA 4GC6A 3T3FA 4EP5A 4I2PA 1RBSA 4CJTA 1XWLA 5KT3A 4DQIA 4ED6A 2YHAA 4O44A 3RB6A 3QO9A 3ZSXA 1WSIA 4MFCA 4DL5A 4EYHB 4QWAA 4W5OA 4BE0A 4B9MA 3SQ1A 3GIIA 4OLBA 1L3SA 8ICNA 3GV7B 5IINA 1RT2A 3U3YA 4IFVA 2Z1HA 1SUQA 7ICRA 3Q8PB 2FC0A 3UIQA 2ISPA 3TARA 1KSPA 4I9QA 2IMWP 4M04A 3QEAZ 3OSNA 4RQ8A 5SZTA 1BCOA 2ATLA 3K57A 1UAXA 2YHBA 9ICCA 1S1TA 2XRIA 5K14A 4NCBA 4ECUA 5CB1A 4KI4A 3LDSA 4DSEA 3ZDCA 3NE6A 5CP2A 2W8KA 3V6JA 3F73A 4BDZA 2D0CA 2JEIA 3OYAA 1ZQKA 4CJFA 3NGIA 5KFXA 4FM0A 1ZQWA 4FJLA 2PI5A 5HMLA 4QWBA 3QZ7A 5IILA 3BQ0A 3AA5X 3MBYA 3V7JA 2R8JA 3NF6A 2Q0ZX 1FK9A 1S6QA 1ZBUA 3PW2A 1LWEA 3L2UA 3L2VA 3VQCA 3TFSA 3VQ7A 3SQ0A 1HNIA 3DI6A 3GV5B 5KT6A 1JLAA 4ELTA 5J0OA 4FVMA 4M45A 4R65A 3AVJA 4FBTA 3LK9A 2ATQA 4TUSA 4FJKA 3KJVA 3RJGA 1I3AA 3EY1A 4ZH4A 1ZQYA 3HXMA 3C5GA 1C7YA 4MFBA 4FJXA 1RYRA 8ICGA 3JPTA 4CHPA 2RDIA 2LYHA 3BJYA 4KLFA 3DLEA 3ZT4A 4G1QA 1NK5A 4N41A 4I2JA 2IAJA 1VK0A 1JL2A 1KVCA 4CJ3A 2NRTA 3MDAA 4RQ2A 5CWRA 4M9HA 4Z4CA 4TUQA 4CEAA 1N56A 4L8RB 3V72A 7ICIA 3VQ9A 4PHPA 3IG1A 4MEYA 4M3TA 3M9NB 1S97A 3ZDAA 4FS2A 4W5TA 1A76A 2KN7A 3OHBA 5KFZA 3MR5A 3AU6A 1BPZA 4DLEA 2PXIA 8ICHA 3C21A 1O1WA 3RR7A 3O3HA 1RBTA 1RTIA 4ECRA 2XY6A 3Q8RB 4M9LA 5KFCA 4E89A 4F5RA 4ED2A 1SL2A 3H40A 1ZQUA 3L8BA 3NGYA 2W42A 4PHAA 3Q8QB 4DLGA 4FS1A 7ICVA 1RT6A 3JPRA 1VSIA 3RRGA 1TL1A 1XC9A 1IH7A 1J5OA 1XHZA 2I5JA 5C25A 2BANA 4RT2A 1ASUA 3OY9A 1RT5A 3K75D 3AO2A 1L3TA 2W9CB 1N6QA 4Q8FA 1KVBA 3ALYA 1NJXA 4EBEA 3V1QA 2B5JA 1T3NA 2JZBB 5L9XA 1T7PA 3QIPA 1ZQPA 3V1OA 3GFKB 1BIUA 4KPYA 5CY4A 4RNOA 1BPXA 4J2AA 2HHVA 4CF8A 1TKZA 5KRTA 3DRSA 1SKSA 3QLHA 4RW4A 5J0QA 2YKNA 4YD2A 1ZQSA 4QZAA 1K1QA 4CJ4A 1EX4A 4LH4A 1S0MA 3HL8A 2X78A 5DBBA 4HUGA 4DU4A 3AVFA 2OYQA 2W8LA 3AA4A 3CFRA 1EXQA 1Z25A 4F2SA 4C8NA 4DTXA 8ICQA 4GW6A 4DSKA 2DFHA 4RG8A 4IR9A 4CJEA 4UB2A 4IG0A 2V4RA 3ASMA 4F91B 4KLUA 3RWUA 4FLYA 3VQEA 4E19A 5DKWA 3LPUA 3SJJA 2C2DA 1F21A 4CIFA 4CEEA 4UAWA 4EBDA 5KT5A 3KHRA 8ICUA 3O3FA 4YR2A 1XSNA 1JMSA 4JS4A 3OYJA 3TABA 4QWDA 3OYEA 1TK8A 4M9GA 5KT2A 2P6UA 2DFFA 4P2HA 3S3OA 1ZQMA 1ZBFA 3SUNA 5KFBA 1JL1A 4XIUA 3NGZA 4DL2A 1L3UA 2FBXA 4B9NA 4E7JA 4QZBA 4B9LA 2ZTCA 4WE1A 5DB7A 1C0MA 3UQ2A 4OGCA 1XI1A 3DLGA 3KK1A 5KT7A 4GXJA 3AO4A 5HLFA 4F3OA 2PFPA 9ICVA 3QEXA 3KHLA 4M3RA 4M0AA 1HQUA 3AVMA 1ZQCA 4IDKA 1WLJA 2ZJAA 1EETA 3VQ4A 2ETJA 4YCXA 4Y1CA 3RH4A 2DFEA 3SQ4A 7ICMA 1BL3A 5EWGA 4N76A 2MUTB 1NKCA 2FLLA 2BCVA 5KG2A 5KFHA 1WNSA 3ZDEA 4FZYA 4DTSA 3ZDBA 2HW3A 4KN7A 3TAGA 5DG7A 1KDHA 3K2PA 2G8HA 1VSHA 4O3QA 2YNGA 4CGJA 1LAWA 1RZTA 3EPGA 2QXFA 3DLHA 3IM1A 4M9JA 1RT3A 3C1ZA 4C8KA 7ICSA 5I42A 3GV8B 1SKWA 5CYMA 4M9NA 3KK2A 3C5FA 1TGOA 4M41A 3VQ8A 1EXNA 3T5LA 4N47A 3HSTB 3LPTA 4PUOA 3HT3A 5KFQA 3AVNA 1JLCA 4RW8A 2BPGA 2FMPA 4RW7A 3OYHA 2GUIA 3K5MA 4Z6CA 1VRTA 4YVZA 4XQ8A 2ZUCA 3TAEA 2BQRA 1X2IA 3MR2A 4YXJA 4FO6A 5BPCA 5HP4A 1U45A 2G8IA 2PFNA 4QW9A 5J2PA 4KLGA 3LP2A 4E7IA 2A1SA 4KHQA 3H8SA 2C2EA 4NLKA 2PYLA 4KLMA 3RBEA 2HHWA 1HUZA 4O5EA 2UVUA 4IQWA 2P51A 3TAFA 2PYJA 4DQRA 4J9NA 4KLSA 2XY7A 2W9BB 3LWLA 1ZJMA 4ECXA 5CA7A 3K58A 4CEDA 1DLOA 2HHTA 3U3GA 4ED3A 4R5PA 3TAQA 1VSDA 1ZQHA 3V9WA 4IRKA 4PA1A 7ICTA 1JLBA 4CJ5A 3QETA 4I2CA 1UT8A 4FLTA 2FMQA 9ICJA 3SPZA 4YNQA 4CJVA 1ZQJA 4I2HA 4CEQA 4DOBA 5DB9A 4KB1A 1ZQIA 1BQMA 4FK2A 4O55A 1FKPA 4KV8A 5KT4A 3S3NA 3RH5A 3MGHA 3CYMA 3BGRA 5KFVA 4DS5A 4KREA 1U9LA 1ZQBA 4JV1A 4LVSA 4KHWA 3AA2A 3KLIA 4OVLA 3AA3A 2R8KA 8ICKA 4HVJA 5EWEA 1U04A 3O4QA 4FLUA 5HRRA 1ZQEA 3NH0A 3ISDA 3GQCA 4XRHA 4NM2A 1U49A 4RQ0A 3OS1A 1BIZA 2X6NA 2HHUA 1S0VA 2NRVA 3RH6A 3ISBA 4M3WA 2HMIA 3K4GA 1TV9A 3TFRA 1WCNA 5J0TA 3DYAA 5J0UA 1T4GA 5C42A 4ED1A 3FYHA 4UB4A 1NK7A 4DQPA 3RR8A 3JPNA 4CEFA 4R8UA 2AQ0A 1WAFA 3HM9A 5FRMA 4IRCA 1WAJA 2G8UA 4XUSA 1B22A 1Z00B 9ICNA 2BGGA 7ICNA 4F5PA 3TAMA 4EZ6A 2EHGA 4Q8EA 3UXNA 3HX0A 3OYMA 4GXKA 4R64A 3GDXA 3DLRA 4Z4HA 3Q8LA 1JIHA 2P5OA 4CFDA 3L2WA 2ITGA 4DO9A 2ALZA 2PFOA 2FLPA 4M42A 1X9WA 2DPJA 4PHEA 7ICOA 3KKSA 4FJIA 1TAQA 4J2EA 4QAGA 4E1MA 4RQ3A 1BQNA 1S1WA 4DTOA 2C2RA 5HROA 4EZ9A 4FW1A 3JPPA 3V6HA 3SYZA 1IKXA 3PMLA 4KKOA 4B08A 4RQ5A 1RYSA 3PW7A 4DL6A 3VQQA 4F3TA 5KFDA 4DSLA 1HRHA 3OYIA 4RUCA 3NH1A 2ZJ5A 4PY5A 1HYSA 1S1XA 1RPLA 3H8JA 3JPOA 8ICRA 4Z4IA 4E1NA 4K8XA 3ZCMA 1T8EA 5KFAA 3CG7A 3PR4A 2DY4A 4R63A 4YP3A 1Z3EB 4PGYA 1BI4A 4BACA 1CXUA 5KFSA 4DQSA 4B3OA 5JS2A 1SKRA 1JXLA 3EYZA 4R66A 1CZBA 8ICLA 5DK5A 1ZQLA 4LZDA 4ECQA 3L3VA 4JRPA 4CF9A 4Z4FA 3LDAA 1NJYA 4O3OA 5KFIA 4OKEA 3SPYA 1KVAA 5J2CA 1J54A 1QSSA 2VWKA 4IG3A 4DSFA 1Z26A 3AVAA 5J2KA 3VQ6A 3MEDA 4Z4GA 2F1HA 2PFQA 5KG5A 3UPQA 2XGQA 4IFYA 4RUAA 4AHCA 1RDCA 5KFFA 4IQUA 4KTQA 4DFKA 2BKEA 3IS9A 3OYKA 2RF2A 3EZ5A 5HBMA 1RBRA 3HP6A 2PI4A 4F8RA 2BCRA 2ZQBA 5HP1A 1RNHA 2OPRA 4RQ6A 3G6YA 4KLOA 9ICTA 7ICUA 4DTJA 4CIGA 3L2RA 8ICXA 1Y88A 5BOMA 4LD0A 1IO2A 1U47A 9ICXA 2BE2A 2VANA 3AVKA 2OPQA 4DU1A 2J6SA 5JS1A 2KQ2A 2LSNA 3DLKA 4KLIA 4F5QA 4I9LA 4KLEA 3ZSOA 1TAUA 4UQGA 4O5CA 1Q9YA 8ICJA 4IR1A 4UAYA 1ZQOA 4O9MA 4DL4A 2JZBA 1NK9A 2FMSA 1Z00A 4DTPA 3Q8SB 4NLNA 8ICPA 3KLFA 1BISA 2VA2A 1WN7A 4TUPA 4CK2A 3ZT1A 3T5JA 2HHQA 8ICFA 1LWCA 1TK5A 3EW9A 2BCSA 3QEPA 4M3XA 1TVAA 1JKHA 5E41A 4I2BA 2Y1JA 1RXWA 4EP4A 4ECYA 4CJLA 2J6UA 4Z6EA 1VRUA 3MFIA 3LZIA 1C0UA 2Q3SA 2BCQA 4M47A 3NBPA 2OZMA 1ZQRA 1CXQA 1WSHA 2E6LA 9ICFA 1T05A 3AV9A 3B6PA 1D5AA 4RQ1A 3C6TA 3IHQB 3ZSRA 1VSMA 3H8WA 3MXJA 1RT1A 4BXOB 2HVHA 3SUQA 4KO0A 4CJQA 2XY8A 4FM1A 4I2IA 1CZ9A 1IM4A 3RAXA 9ICHA 2C22A 4NY8A 3FFIA 4M6WA 1K1SA 3E2EA 5DMRA 8ICAA 4CGGA 3ZSYA 1W0HA 3V9ZA 3M9OB 1DGSA 2AGOA 1D8LA 3CFPA 4YFUA 4AH9A 3OSPA 7ICFA 5EOZA 2OPSA 1B43A 2KW4A 7ICPA 4QZFA 1LW2A 4KMUA 1KRPA 3NTUA 4M2YA 4DL3A 2W9MA 5HHHA 4P4MA 2VG6A 5IIIA 1J9AA 4J9PA 4LZGA 1KLNA 4CJPA 3RRHA 5C5JA 2BPCA 3HPHA 4QZCA 2OZSA 4NYNA 4BDYA 2B4JA 3HWTA 3BQ2A 3C6UA 5IIMA 2HNYA 1G15A 1K6YA 1HYVA 4RW6A 1JX4A 4P4PA 5D49A 3MECA 4NLZA 1QS4A 4Y1DA 3H7IA 1X9MA 3RB4A 4NLGA 4ICLA 3E01A 3AVHA 3KTQA 9ICUA 3LAMA 2VWJA 4CJSA 4IQVA 4BGDA 4ZTJA 3PO4A 2YV0X 4DSJA 1RTHA 1RTJA 1TKTA 4KLDA 4QZ8A 4DMNA 1JLGA 3AO5A 3ISCA 3AVBA 1XU4A 1C0TA 3NHGA 1LB2B 4FLXA 3FDSA 4I2AA 2NRWA 3RMBA 4B9VA 1NK4A 2V4QA 4J2BA 5J2IA 9ICEA 4FJ7A 1D8YA 3VQDA 5DGBA 4QOZB 3PX0A 4GLXA 4F4XA 2XO7A 4E7LA 4F93B 3UXOA 2NRZA 4OKKA 4FLWA 3SI8A 2F1IA 4J9KA 4MFFA 4E3SA 4FJJA 4CFCA 4CFBA 2IHMA 4Z0UA 3TAPA 2H5XA 5DBAA 3RTVA 1FXXA 3I8DA 3TANA 2BGWA 2I9GA 1QSYA 4GVMA 1S10A 2UVVA 1ZBLA 4KTWA 4FK0A 4KLQA 3SUOA 5L1LA 4QWEA 5DQIA 3NDKA 3VA3A 3KIOA 4DU3A 5DLGA 3MXIA 1ZBHA 4J9LA 3KD5E 4KITB 4KHNA 2XCPA 3PUFA 1RDDA 1GOCA 1TKXA 4B9SA 5DB8A 1S76D 3QEWA 2B21A 8ICSA 1S0NA 3HVTA 8ICYA 4AILC 3K59A 8ICMA 5KFWA 2G8KA 3C1YA 3AVCA 3P5JA 4O3RA 2YNHA 4DG1A 1A5WA 2IHNA 3F9KA 4YMOA 3C2LA 3EWAA 5FROA 1KEJA 4Z6DA 3IAYA 3ULDA 1I39A 1IKWA 2ZTDA 1MSWD 5EU7A 4H8KA 2BHNA 1BPYA 5EWFA 3ZSZA 1JXBA 3QNOA 3S9HA 1U4BA 3V6KA 4NCAA 3C2KA 3MGIA 2J6TA 2GV9A 1BPBA 1XSLA 1NOYA 1TL3A 4CJKA 4I27A 5KFEA 2HVIA 4CHZA 3JYTA 3H4BA 4ID5A 1TV6A 4CJWA 1CEZA 4AHVA 5KGWA 5KG0A 4FCYA 4RNMA 1SL0A 2JLEA 8ICWA 4C8OA 1NKBA 1RT4A 3CM6A 2YNIA 1RILA 1B9DA 2IS3A 3M9MB 1QLNA 1C1BA 3T5HA 4O3SA 2DTUA 1HJRA 5KFJA 9ICRA 3ZD8A 4O4GA 5BOLA 4OJRA 1BGXT 2EX3A 4KN4A 4TSXA 8ICOA 3C2MA 3MR6A 3D45A 4CERA 5D3GA 3PW0A 2C28A 4W5QA 1C6VA 5CZ2A 2JGUA 3VQPA 4LSLA 4JS5A 3B0YA 2AGPA 4PGXA 1UOCA 1VSJA 5KG7A 2BDPA 3PNCA 4NXZA 1WSEA 2ZJ8A 1UA1A 2GWSA 3GILA 4FJHA 4FJNA 5J0WA 5DG8A 4CESA 1NK0A 4KHYA 4J9SA 5KFOA 1SV5A 2QKBA 1KFSA 5D46A 5J0PA 5KFKA 4FZZA 3ZSQA 3MEGA 1Q9XA 9ICOA 3DOKA 3Q8MA 3T19A 4LY7A 4F4WA 5L1JA 1JLQA 4CEOA 4TURA 1TVRA 3A2FA 1UT5A 4UBBA 4J9OA 4XA5A 2YKMA 1IG9A 4IBNA 3RJHA 4ZHRA 2FPLA 3NGDA 3V81A 2ZD1A 2KZMA 2XCAA 3O4NA 4J9RA 1BI4B 3U6FA 4RPXA 3ZT2A 3M8RA 1UA0A 5HRSA 4FW2A 3JPSA 4KLLA 4NM1A 4O3NA 4B9TA 3RB3A 3ZT0A 3GIKA 4MFAA 1RBVA 2MAXA 3H4DA 1FKOA 4K8ZA 2RN2A 5IIJA 1ASWA 2UVWA 1WSGA 4FM2A 5J2FA 5L1KA 4DF4A 3P83D 4CIEA 5HMMA 2O4IA 4NCGA 1VSLA 4YXMA 3WNEA 2Z1JA 4IKFA 3TQ1A 2QKKA 4KAZA 4O5BA 4BXOA 3OYNA 4TQSA 4RZRA 2IBKA 4ELVA 4BDPA 1KLMA 2A1RA 5J0SA 3AVGA 1ZQVA 3AO3A 5CZ1A 1BPEA 1WCLA 2X6SA 9ICQA 2AU0A 3PV8A 1HUOA 4KLTA 2F8SA 1NKEA 1ZQAA 7ICQA 4M6WB 2FBTA 1IKYA 2R7YA 4GC7A 2FPMA 4FYDA 2F1JA 1D9DA 1SL1A 2QK9A 1ZQFA 1X9SA 2Z1GA 1SZPA 5CHGA 2WTFA 3T5KA 4YQWA 4R8UB 3HVRA 2BR0A 4ED0A 7ICLA 3OYGA 3NFAA 4H4OA 4KB0A 4DFJA 5J2DA 9ICPA 3VQ5A 3VA0A 3V4IA 5JUMA 3V9UA 2BQ3A 2ASLA 4QZDA 1TFRA 1RT7A 5IIKA 3DM2A 3OHAA 4KFBA 2X74A 1U48A 3I0RA 1S0OA 1YTUA 3AVLA 5CJ7A 1CUKA 2M9NA 3SZ2A 3OJUA 3RB0A 3UXPA 4KI6A 1NJZA 3EPIA 3KKRA 4M3YA 4MQ3A 4JV0A 1ZETA 3QEVA 1PZNA 1MC8A 2NUBA 3RMDA 1QE1A 8ICTA 2R8GA 3OJSA 7ICJA 3HO1A 4CJUA 4UBCA 5DB6A 1NOZA 4YFKA 4CHQA 4ECZA 3RJKA 1EP4A 2KZZA 2B6AA 3HYFA 1TK0A 3B0XA 5HRNA 2D0AA 2AQ4A 3MAQA 4DWIA 3HK2A 3MEEA 1RDAA 4GMJB 3TR8A 5F9LA 4CGIA 2O4GA 3JSMA 4DQQA 3AVIA 3ZDDA 3OYBA 5F9NA 3RAQA 3HPGA 4K4GA 4HYKA 3WNFA 4CECA 4J9MA 3MXMA 4O3PA 4P4OA 2BPFA 3OS0A 2ZE2A 3ZD9A 4OGEA 1Y97A 1ZQDA 2DFLA 3D0PA 4Q44A 4IQTA 1IKVA 4RU9A 4DOAA 3OYCA 4DFMA 2ZUBA 4JWNA 5DQHA 4QWCA 4CF2A 3BQTA 4YN4A 5J29A 1B92A 4J9QA 3PR5B 2HHSA 4AHRA 3OYDA 3H08A 3PY8A 3HPOA 3QESA 3KHHA 4I2EA 4KHSA 3Q8KA 3DRPA 3LP1A 4FJMA 5KTQA 3G6XA 4B8CA 4PH5A 5J2BA 2P66A 4HUFA 2PY5A 2WONA 3V7LA 8ICZA 4FBUA 4C8MA 1JN3A 5DLFA 2OPPA 4PQUA 4CJRA 4I7FA 3LWMA 4AHTA 9ICAA 3PX4A 4KLHA 1S9EA 4N56A 4UB5A 2UVRA 5TZVA 4X5VA 1LV5A 4YMNA 1RCHA 4DTNA 4CF0A 4MEXA 5DGAA 4MF8A 1L3VA 1KFDA 1LWFA 3HJFA 2HB5A 1MQ2A 4C8LA 2HNDA 3PMNA 2ZUDA 3SNNA 4OPKA 2KTQA 2BCUA 2FLNA 2PZSA 2E6MA 4M3UA 4CHNA 3C95A 1DOQA 4F4KA 2YNFA 3CM5A 4CHOA 1ZQTA 1ZQGA 8ICEA 2IA6A 5J0XA 4QZ9A 5CYQA 4CFAA 1JLFA 2D0BA 5J0RA 1A5VA 3ZT3A 1VSFA 4PWDA 2IC3A 1S1VA 4KRFA 1ZJNA 1CLQA 3RJJA 1REVA 5T7BA 3P1GA 4Z4EA 5HRPA 4QCLA 4KHUA 4E7HA 3VQBA 4Q0BA 4BE1A 5KI6A 2VA3A 2W9BA 4ELUA 3BDPA 1BHLA 3LP0A 4JV2A 5DG9A 7ICHA 3PVXA 4W5NA 4O0IA 3SCXA 1JLEA 5KRSA 1L5UA 5KFYA 1C1AA 4J2DA 5IIOA 5J2HA 5J2QA 1HYZA 4OPJA 4RQ7A 2ZTEA 4RT3A 4PPXA 5C24A 4YR0A 5J1EA 2XGPA 1HPZA 4EYIB 4UB1A 4CE9A 4OKJA 1S1UA 4BWJA 4DTMA 3I0SA 5D4BA 2HHXA 1ASVA 3VQAA 3O3GA 1NOMA 2XY5A 2XC9A 3OGUA 4TQRA 4DSIA 4AHUA 1S5JA 5KG1A 2VA8A 2FBYA 2F96A 4RPYA 2A1JA 3QINA 4FXDA 4O0JA 3S3MA 5DDMA 1WSJA 3ITHA 1EKEA 2ISOA 3AUOA 1ZQQA 1VSEA 3CFOA 3ZSWA 4CGFA 4HCBA 4PGQA 3ZSVA 4BWMA 4YMMA 4DTUA 2A1JB 4RW9A 5KG3A 1R0AA 1QQCA 4CHYA 5KFNA 2IOCA 1TKDA 4Z6FA 2JEGA 4O5KA 3SI6A 1H38A 4FJGA 4CF1A 1D9FA 5SWMA 3NF9A
chains in the Genus database with same CATH superfamily
3NXZA 1VBXA 5GMEA 2JC0A 4KHPJ 3J81U 4RW9B 2G1DA 2FF6A 4Y28C 1BPDA 2VG5A 1URNA 4OZNA 4LQ9A 5HNKA 5DM6L 2CPEA 1C0TB 1XS9D 1FFWB 2CWXA 2NRRA 3KK3A 6FD1A 2ZVIA 4P2FA 1HNVA 2DXDA 3SV4A 2XNRA 5HMWA 5J2EA 4RL1A 1GTHA 2VBYA 4WJBA 2BRLA 1HNWF 4WTYA 1WSFA 3FZMA 5LMNJ 4FLZA 3QNNA 4GVLA 4CM2A 2F4VF 1DQ8A 1UW9A 3NRBA 2KKVA 1NAQA 2F5GA 4DUZF 4DS4A 3UR0A 2BV3A 4QU7A 4CGHA 5KFPA 4K4IA 1HKAA 3CCES 5EE1A 3GONA 1Z4UA 4M3ZA 2C2ZB 4B1YB 2DJWA 3RJEA 4EFHA 2HIYA 4HHTA 2AJ2A 2FJEB 2RB7A 2F4VK 2WRMA 1GLFO 3FZHA 3GWCA 2C2NA 2QT7A 4FJ8A 3X1LB 4NLDA 5HMYA 3GIJA 4WFNL 2MKCA 4ED4A 3A0HU 2E1ZA 2M8HA 4I56A 1E6YA 1A77A 2OEKA 1DLOB 4TYBA 1RDBA 1O6XA 2A19A 2KXHA 2NXCA 4FOEA 1QJHA 2VJVA 3QUBA 1ZXOA 3QU9A 7ICEA 3OXGA 4F0HA 1PO6A 2KLAA 2R8HA 1ZRMA 2GQCA 5LJ3Y 2R9LA 4WF9Q 3MM7B 4JYAF 2Q0RA 3Q86A 1I94F 2DY9A 2FBVA 1QY7A 3QUTA 1NSQA 3IDWA 2KVQE 1U0HB 3DCAA 2NV3A 4HH1A 5ETRA 1HQUB 1KBUA 3G6VA 2OWOA 4ED8A 5J2NA 3R8EA 2JH3A 3FEYB 4MMOA 2Q3PA 1NMNA 1F2HA 5F0UA 4WYBA 8ICIA 4GXIA 1PJ6A 3ETOA 3N97B 4P2SA 2V2QA 1TFYA 1S9GA 1BVSA 1WG1A 1MQ3A 5CQGA 3HSDA 4TLQA 4CH7A 3MN9A 5IT9O 3RG6A 1RU1A 2Z1IA 3N79A 2HBLA 3DOLB 4ZPCA 4KTZA 3ONNA 3Q8VA 3N7SC 3B6BA 4W92B 2HEKA 1TL1B 3KHGA 4OQJA 4JWMA 1MWMA 5J0YA 3MMBB 3F44A 4G9ZA 2J76E 4QW8A 1L7OA 5E79U 3V6DA 3GJRB 4BE2A 4NLOA 2QWQA 3FZ2A 2G8FA 3FR0A 1YHQN 1F6TA 1FRJA 4ZIWA 1XR6A 3NAEA 1NK6A 4P2MA 1UHUA 3OYFA 1G1XA 2G5HB 3THXA 1K0VA 2O8CA 4EI2A 1RBUA 1RTDA 2AJQA 2Q66A 3KLGA 5AQUA 1IG8A 4QZIA 2NRXA 3OVNA 2K2PA 5KFLA 4DUYF 1XNQJ 4K7QA 4NA2A 5AQKA 5FD1A 2WF6A 3LP3A 4CK3A 2YWWA 2IDLA 5FRNA 4DX7A 3VPZA 1K73O 2MQPA 2P5GA 3CSKA 2J9DE 4DI6A 2RHFA 2WF9A 2PFDA 2N7YA 4OHXA 2J7KA 4YG2A 3N6LA 1OY8A 5D4PA 1BA1A 4Q43A 4UF4A 1O08A 2BJ3A 4GKJK 2Q4TA 1WF0A 1K8AO 2VG7A 3ZETA 1KKHA 2KZ3A 1KL9A 2RRBA 1HNWK 2QB0A 3AQEA 2HK2A 2LFVA 1EETB 4CGZA 5A2QU 5CD4H 3PW4A 2E88A 2ZZNA 1ZQZA 2CPZA 2VD3A 2AXTU 1GAOA 2VFTA 3BGRB 5KFTA 2A3VA 1QM9A 3MAAA 1I94J 4ZIVA 3LZJA 4GC6A 4EP5A 4CJTA 4DQIA 3KVGA 4ED6A 1BHNA 4H5RA 2V52B 1C0GA 2QTDA 4WYLA 1BD6A 4DL5A 4BE0A 3C0BA 3RSEA 1NDKA 8ATCB 2IY5B 4OLBA 3JXUA 1DARA 1PKUA 1RT2A 3NGRA 5C15A 4LFCF 4PABA 3GDQA 4IFVA 2KHQA 3W0LA 2PBDA 4O44B 3PHEA 3TARA 2IMWP 3OTOF 3BSOA 4DR4F 4ZPVR 2D3DA 3W3SA 3HDSA 4K2XA 1S1TA 2E1RA 4NCBA 4ECUA 4QS9A 2QARB 4YB5A 2W8KA 1BMQB 4BDZA 1FWPA 2D1KA 4FYWB 5FDLB 2QRRA 1ZQKA 1Q3VA 1RB0A 4CJFA 3UWTA 2KJ9A 2LM4A 4JI3F 3QZ7A 4PKDB 2QJ3A 5IILA 3E0FA 3UPFA 5L46A 3MBYA 2R8JA 1N8RT 2FHJA 4I69A 1VQ8N 5AXKA 3S41A 3H46O 2CNLB 2DKZA 3CT9A 2RLTA 1WOPA 2XS7A 4A47A 3TUPA 4J7CA 4UOGA 4XH4A 1JLAA 2DXEA 5J0OA 2P6TA 3KG1A 4H0VB 4ED5A 2Q79A 1OWXA 3NEKA 2DGOA 1J5EK 1ACMB 4DX5A 2YQ3A 2J9DA 3C5GA 4I2QB 1C7YA 1U8SA 4LFBF 3T1HF 4M5IA 3KBBA 5IQ6A 5AJ3J 1WC1A 3W8PA 2IJNA 2HQGA 3ZT4A 2M8DB 2IRXA 1VK0A 3MOZA 1JL2A 2AHOB 4M94A 4WPAA 1Q16B 4M9HA 5D78A 3Q24A 5AKKA 1MMLA 3UN2A 4CEAA 2WB1F 4PHPA 4MEYA 2HVDA 4FS2A 4A8QA 3F56A 4DV5K 5KFZA 2F3NA 1BPZA 2YKPA 4B3MK 3RR7A 3RJMB 3P6YC 2KKHA 5E26A 4IFYB 3O3HA 3LO3A 3SAGA 1HNXF 3Q8RB 1MG7A 2IOFK 2UUAF 1R89A 4ED2A 3FCWA 4IDKB 2DF4B 2AX0A 1NGDA 1VQ6N 5AKEA 4YORA 3FSXA 3Q8QB 4CT8A 3TVKA 5G0RA 1N33K 4FS1A 7ICVA 3HRDD 2XWXA 3HVWA 4DR4K 5EX3A 2GQQA 2K4IA 1RQ0A 3OQ2A 1XHZA 1X4EA 3QBWA 1GFWB 2DNGA 3EUNA 3TAMB 4NB4A 4DR7K 1P1TA 4DDFA 3OY9A 1RT5A 3VALA 1L3TA 2W9CB 1N6QA 3QUCA 3ALYA 3TPQA 1NJXA 1Y5LB 4EBEA 3M2UB 4DV3K 1X6IA 4RW4B 1T3NA 3DDKA 5D4LA 3F53A 5L9XA 1T7PA 3C8YA 1U8WA 1IN0A 2R7UA 3DYAB 2OSRA 1ZQPA 3GFKB 5IT0A 5ALFA 4KPYA 3H0RB 4RW8B 3IBWA 2P9UB 1YRTA 1TKZA 3GJTB 3DRSA 3HZGA 3QLHA 4LF7F 5J0QA 1FT8A 4ZJQA 2F4VJ 4YD2A 5EX0A 2J8SA 4ZLJA 2HKEA 4QZAA 4CJ4A 3EZOA 3AY0A 4H4KA 2W04A 1S0MA 2X78A 5DBBA 4K2JA 5GAEP 2DBBA 3AVFA 2F63A 3P5TL 3TSQA 4QIWD 2MZTA 1S79A 1EXQA 4C8NA 4DTXA 2GJIA 3HKZD 2UXCK 2WAQD 3SMPA 4IOCQ 4RG8A 4RWWA 4F91B 4KLUA 4C0OC 2FZCB 4DL0C 4E19A 2JLFA 5E3PA 4F7VA 3T7ZA 1F21A 1A6SA 4CIFA 1CJVB 1XSNA 4JS4A 2MHNA 4QWDA 1F60B 5F8JA 1TK8A 1UW4A 4M9GA 1LFWA 2E7WA 2GUPA 5RUBA 2P6UA 3LGNA 3WT0A 1IV8A 4P2HA 1JNZB 2DFFA 3SUNA 5ALDA 5KFBA 1B0XA 3J81Y 4DL2A 4DUZJ 4E7JA 4B9LA 4I2PB 4CF5A 3UR3C 4CIOA 4OGCA 2BACA 3DLGA 3Q8YA 2JOQA 4KGVB 5HLFA 3AO4A 9ICVA 4OJOA 4M3RA 2ZJRQ 2RUGA 1EHWA 4Z37A 1EWRA 4M0AA 3O9SA 1PYSB 1WLJA 2DNRA 5IV3A 1OVQA 2PA8D 4K41A 2K8GA 3JYTB 4N76A 5EWGA 3EKSA 2C2KB 4US8A 3SBTA 2BCVA 5KFHA 1WNSA 1G6BA 1F9HA 4DTSA 2HW3A 5DG7A 1XTZA 1VSHA 2YNGA 2I38A 4CGJA 1NGJA 3C1ZA 2YJEA 3TJ9A 4A8FA 5CYMA 4BHQA 3AOAA 4M9NA 3MN7A 4ILMA 1TGOA 2VFUA 3VQ8A 1CS4A 3HT3A 1NGFA 1YJVA 2GHPA 4FOIA 1JLCA 2GHVC 3VESA 2ADCA 3BDEA 3Q0AA 4LF6F 3M8PB 1VRTA 1V38A 4YVZA 2P9LA 2AIRB 1SJ1A 2ZUCA 4PWUA 4PZOA 1Q82O 1S5LU 3TAEA 2XMAA 2HAIA 4PUOB 4YB1P 4NLYA 5BPCA 1Y11A 2G0JA 3CD0A 4KLGA 3QFWA 3LP2A 5GAHU 3MCMA 2PYLA 3JXOA 2JZ5A 1VLBA 5CRXA 4X62F 4KY3A 4WKYA 3ELHA 3L4QA 4DQRA 1ZJMA 4ECXA 4MK7A 5CA7A 2Y0SD 4A2BA 5ALMA 2HHTA 3U3GA 4MJKA 1U2VA 2EFVA 3WEEA 1DRGA 2M9KA 3DMJB 7ICTA 2D3O1 5CHCB 4CJ5A 3W8GA 4CYUB 1JMTA 2RAQA 3VTIA 4HL9A 4ID8A 9ICJA 4IZ9A 1HWIA 4PG7A 4BR4A 4CJVA 4NZ6A 3M4XA 4ANDA 3ZEUB 3X3UA 1VQMS 3SXLA 3TTDA 3UDLA 2V8VA 2P35A 3PSFA 1Q1KA 2WSCC 4KV8A 3S3NA 3RH5A 5CEHA 3MGHA 3MURP 5KFVA 4CLLA 4DS5A 3HZEA 3C2PA 5H1SQ 4KREA 2MDAA 4JV1A 4LVSA 4LUBA 3WK5A 4YUDA 5K5MA 1DGKN 5DZ7A 2E5LF 3ZO7A 2PEBA 1F5AA 4ITSA 4ATNA 4FLUA 1ZQEA 3WKAA 2CG8A 2QLXA 3NH0A 2G9OA 2PEHA 2GV1A 3ATVA 3ISDA 2D41A 2QLBB 2NXNA 1G4CA 1RTIB 1S72S 4RQ0A 3OS1A 2HHUA 2F8KA 2NRVA 2FYXA 3W2VB 2EC2A 4JAXA 4M3WA 3K4GA 1TV9A 3W9JA 3Q2TC 3Q8UA 3QIPB 1WCNA 1NB2A 3LYSA 4CLZA 3QRRA 2KRRA 3K1ZA 4DQPA 4YS2A 4F3QA 2R7WA 4CEFA 3TZYA 5JMNA 4R8UA 2D0PA 4BRGA 4BRHA 1HIWA 5AI4A 5FRMA 4JI8K 4IRCA 2MSNA 2G8UA 5E3CA 3EEQA 1DAXA 2IHR1 4ZP7A 1EARA 1Z00B 4Y2KA 9ICNA 2RRDA 4F5PA 4P6QA 1CLFA 4Q8EA 3R5GA 4WYWA 3E9LA 4R64A 3QSYB 1NSPA 2MY8A 3DLRA 1S7IA 1N0VC 1IBCB 1V5IB 1JIHA 4CFDA 3D2SA 5J1PA 2D0OA 1X9WA 2DPJA 1L6NA 3QT5A 2FUG9 2MSSA 4PHEA 1VK8A 3KKSA 3QNWB 3C6AA 4CO5A 1TAQA 3QT8A 4E1MA 3CETA 3OT9A 2IIRA 1FVQA 1D0EA 3CCVN 4OYPA 4QR2A 4EO6A 2OTLS 2BM1A 3N9UC 1Q0NA 4KKOA 4X62J 4RQ5A 1RYSA 4DL6A 4DSLA 2MZ1A 1R27B 1HRHA 3NH1A 2ZJ5A 1UVKA 4BCAA 1S1XA 1RPLA 4IO9Q 3JPOA 4Z4IA 8ICRA 2KD1A 3ZCMA 1T8EA 4AQYJ 4DR4J 4CTAA 5AQQA 1B64A 4JV5K 5GAEI 2Z2LA 2IBOA 3ZI4A 4WZMA 1RDWX 3C65A 5DK5A 2A6OA 3GR0A 1CC7A 1IV0A 4ECQA 3L3VA 4Z4FA 5BPLA 4YOXA 2VDIA 2R2SA 2B56A 3KK1B 2WVBA 5KFIA 4OKEA 1MLAA 4KYZA 1QSSA 2VWKA 4IG3A 2G5IB 3VQ6A 2GFFA 4BLGA 4PRFA 3MEDA 3MCPA 4Z4GA 4O4RA 4LF8K 3UPQA 4PG5A 2Z56B 4DV4K 2X7IA 3ZTQA 3VQTA 4F25A 3ZZZA 1YBAA 4IQUA 5HANA 2BKEA 3L3CA 3NG8A 3OUYA 3IS9A 2VB6A 3OYKA 2BZFA 1HWLA 2RF2A 1UPHA 1RBRA 2EKYA 3GZFA 3I82A 5DRKA 2ZQBA 5B5EU 4V1Ak 4DV3J 1RNHA 2EZYA 4RQ6A 1YJWN 4ANEA 5AHXA 9ICTA 7ICUA 1XO0A 4C4SA 1MDUB 4CIGA 3L2RA 4ENOA 4A8EA 1LXNA 1HKBA 1IO2A 4Y2UA 2BE2A 3KKAA 4C11B 2B3TB 2OPQA 2J6SA 3D6HB 3NNHA 3ID8A 3DLKA 4Q2MA 1RQLA 9ATCB 1XNRK 4KLEA 1Q9YA 3E1YA 2WCXA 3MPVA 1YQHA 2JZBA 1NK9A 3UKRB 3GYXB 2F9TA 8ICPA 4CP5A 1LWFB 6FDRA 1WN7A 4TUPA 1FVSA 2FI1A 1S1VB 4DFDA 3AFGA 4OX8A 2OFGX 4M5DA 4BC5A 2GJFA 4BS2A 2OXOA 1RI7A 2R3VA 5E3RA 4FZMA 5AR0A 3J81j 5E41A 3GFHA 1RXWA 4OJ1A 4ECYA 1PYOB 1JLFB 3O9TA 2ZXIA 1AXQA 1ZZFA 3J7ZT 1S8OA 1VRUA 5AQOA 1C0UA 1IJJA 4JI2K 2CKWA 3NBPA 2OZMA 4UY8T 2AZ3A 3PRDA 2JXJA 9ICFA 4DV4J 1HJOA 2CYYA 1JLQB 3W65A 4UAVA 1ZM2A 1IVZA 4RO0A 2O8FA 1PILA 3PIOQ 3CJSA 1D5AA 1FFVA 3C6TA 3IHQB 5KNIA 4ZDNA 3ZSRA 3PRVA 4BXOB 2HVHA 3MM9A 4LF7J 1FWKA 2KDOA 3SUQA 5AI8A 1HW8A 4LF9F 2K8CB 2VQEF 2XY8A 3QFHA 4FM1A 1YZ7A 3MTJA 4LFBJ 2YH1A 1RUSA 2PIIA 4S0MA 5HVGA 5DMRA 1OS5A 3E2EA 1LCUA 4LIWA 3ZSYA 2BH1A 1DGSA 2CZ4A 2BXJA 1Q3UA 2YQ1A 7ICFA 5ALSA 5EOZA 4CO4A 2GWJA 1B43A 4P7VA 4QZFA 4RBUA 4KMUA 3NTUA 5F3XB 2ASYA 4CO0A 1XMQK 2HNYB 3QQCD 3OBYA 4DR7J 5LXYA 5LMNF 4B6JA 4KX5A 2A42A 3RRHA 3B9JA 1WHWA 2X51A 5C5JA 2ES6A 2AT1B 1V6HA 4BDYA 1B0TA 4DUTA 4BRDA 3I87A 1VIXA 1W7AA 1G15A 1N34J 4P4PA 3MECA 3PNIA 4Y1DA 3H7IA 1X9MA 1VBKA 4KH5A 4PG4A 1D9AA 1S99A 1HHSA 3E01A 4LVOP 1OXJA 4BGDA 4ZTJA 4NLPA 4KLDA 3BKTA 5EXWA 3KMQA 4DMNA 1JLGA 3ISCA 1R6YA 4A62A 3OXLA 2VBXA 3NHGA 2EAPA 8RUCA 4FLXA 1SC4B 2KB2A 2FVRA 4B9VA 2UUAK 4XDDA 2KHCA 2NRHA 4RLEA 3JSRA 2DHSA 1IBMK 3PZPA 2LEAA 1ZD3A 2E8OA 3VQDA 1SV0C 4QOZB 1GLDG 3PX0A 4GLXA 3GE9A 3SQOP 1OYDA 3UXOA 2VKZG 2DXFA 2EXUA 2F1IA 2OSQA 2B4PA 2IHMA 4Z0UA 4QYZK 1FKAF 5GAEU 2G0AA 2H5XA 1YGYA 2C3MA 3VAHA 3DOKB 3T1YJ 4OO1J 1WKKA 1ZBLA 4IOXA 4RKUC 1WORA 3MN6A 3VA3A 3QAUA 3QRPA 3KIOA 4DU3A 5AKGA 4J9LA 4KITB 4U9RA 1APSA 4FF2A 3QEWA 2E2QA 2B21A 5ETKA 1JJ2M 3J7AP 2VJ4A 3HVTA 2KJ5A 2ZH6A 1J5EF 8ICYA 4AILC 3K59A 5KFWA 1QAXA 3A5NC 3C1YA 2HQ3A 3F9KA 3U1MA 5H9EK 2HOEA 2MKHA 4UOHA 3EWAA 3KOAA 4Z6DA 4I6AA 4MYUA 4IXCA 4RNHA 1TQLA 1IKWA 2I1RA 3DOMB 3Q22A 4DCCA 1V3RA 5J2NB 4H8KA 1BPYA 3ZSZA 4PKIA 5AQZA 1JXBA 3T9ZA 2W4PA 4FYXB 2J0XA 4AM6A 3V6KA 3C2KA 2YBVA 2RHQB 3CXCR 4Y2QA 3H4BA 1IG6A 1M1HA 3NVVA 1UVIA 4AHVA 5KG0A 2H3FA 4RNMA 3BV8A 5FIIA 4ZVQB 2QX0A 2FJXA 3QB0A 1N62A 1EWQA 8ICWA 4I7FB 1RILA 2FB0A 2IS3A 3QATA 2WOMB 4UARA 1QLNA 3CCLS 3T5HA 5AFUH 1DXSA 2DTUA 1HJRA 1S22A 5KFJA 1RTHB 5BOLA 3B82A 4Z7CA 3CC7S 4OJRA 1BGXT 3O9RA 4ANCA 4KN4A 2EX3A 1M90T 4FF1A 3U02A 3CJTA 3PW0A 4W5QA 1I1GA 3VQPA 4LSLA 4YMEA 4EX6A 2AGPA 2W11A 5KG7A 1HIYA 4HH0A 3ENQA 5BPNA 3THXB 1UA1A 4NE9C 4FJNA 4CESA 2DQNB 2WB1D 2D69A 4DCJB 4NLUA 3M7DA 4FPIA 2EK1A 5C24B 4KAIA 4J9SA 2FJWA 4NZ0A 5J0PA 4K0KJ 4FZZA 3CWJA 4BQZA 3NAIA 2IOHA 2KJVA 3B78A 4AUKA 3D2WA 3L9ZA 1RCOB 1LWCB 4BRNA 3U1NA 4J9OA 2MRLA 4AXIA 3NVMA 1IG9A 3H5SA 4EELA 1HI1A 3TR5A 1N2XA 3NGDA 4MKBA 3V81A 2WFBA 1W2BM 2DYAA 1BI4B 4RPXA 3ZT2A 5HRSA 1ZC6A 4Y2SA 4NEZA 2QB0B 2BJDA 3RB3A 3ZT0A 3GIKA 3M8QB 2MAXA 3H4DA 2KYXA 4BQLA 2RN2A 1T05B 3M1VA 3BN4A 3CJQA 5J2FA 5L1KA 4DF4A 2ZDPA 4MIBA 1UL3A 1X42A 2NYIA 2IJFA 3K2YA 2QKKA 1PC5A 1M1GA 3OYNA 1X60A 2VQFK 2XSFA 1N36F 3D2FB 3FGUA 2A1RA 3AVGA 3CDBA 2IFXA 1ZQVA 3AO3A 5CZ1A 2X6SA 4ISFA 4KLTA 1KAYA 1WELA 3ZX3A 1IKYA 3DKDA 3IGVA 3C7NB 3SQGA 3EGZA 1ZQFA 5ADZA 5ALPA 2CQ2A 1SZPA 2WTFA 4R8UB 1Q8BA 4LC9B 7ICLA 4H4OA 2J0SD 3NFAA 4QJVA 5LJ5Y 3V4IA 2A0FB 2BQ3A 2UUCJ 3OFFA 1RT7A 1AFJA 5IIKA 2QARA 4DPOA 2EANA 4ER8A 4PYDA 2WF8A 1S0OA 1T3OA 5CJ7A 1CUKA 4FYVB 2FZGB 2W7PA 1KN6A 1UVLA 3CC4N 4KI6A 3VOVA 1SJFA 1K8KB 2LQ9A 3KKRA 3GU0A 2RE1A 1KAXA 4M3YA 1ZETA 4C9DA 2UYTA 3QEVA 1PZNA 2MKYA 3GJSB 4TU7A 2BOPA 2IOFA 5AQTA 3ZXWA 3WXMB 3GFXA 7ICJA 2CXEA 4ZVSB 2E1EA 3VF6A 2NLWA 5C7PA 4CJUA 3VGTA 5DB6A 1NOZA 2NXEA 1YWXA 2ZF5O 3HHKA 3SFGA 2C3YA 3QRQA 3I4PA 2H51B 3BBFA 5EDWA 2KL8A 4U8YA 1X31C 5BR9A 4P7TA 5ALTA 4FZNA 2D0AA 2AQ4A 1T9UA 5HVHA 3OBIA 4FE3A 4DWIA 2RNEA 2HRUA 1L8LA 1VQLS 2XMMA 5F9LA 4CGIA 2O4GA 4C80A 4KPCA 5IXUA 5I9EB 3OYBA 1BU6O 3RAQA 3CHWA 3D7SB 1C0FA 4CECA 4HYKA 2R7XA 3TEGA 3W7BA 4NXNF 3OS0A 3ILIA 2Y0SF 2DFLA 1IWAA 3DRXA 2HBJA 4CVNE 4RU9A 1VCTA 3PHTA 5BRDA 4KB7A 4BR9A 5FPDA 3NNCA 4ZCLA 2F4FA 3MM7A 4QWCA 4KIAA 3GL1A 3ID6A 3AGRA 3PR5B 2HHSA 1Y10A 2N4CA 4KQZA 3U1LA 3FM9A 1B0VA 3H08A 4FO0A 3QESA 4KHSA 3Q8KA 5AQVA 4F3MA 4DUZK 3LP1A 3U7JA 1NH7A 4UW9A 2W40A 2VH7A 3ED5A 1HLWA 1U1OA 3NMRA 3SR6A 1TAMA 3CIMA 3K89A 1X9XA 3LWMA 5ALOA 2HNDB 2AJ4A 4N56A 3CJ2A 2BW7A 2X1GA 3O4WA 2LHTA 1R3NA 4YMNA 4CF0A 3UVJA 4B3TF 3THTA 4JYAJ 1KFDA 1LWFA 5IZHA 3HJFA 1PUZA 2ZEJA 5ADXH 2GAGC 4NLRA 3S8SA 1RDFA 1NPRA 3P4UB 3SNNA 3EDQB 4TLRA 2BCUA 4Y2VA 1N4LA 2E6MA 3FBEA 4RNFA 4UAUA 4JKBA 4CO2A 5D0GA 2BABA 3LP2B 2JH7A 4JI6F 3A5MC 5ALWA 3ZT3A 2EFNA 4M5MA 2XSJB 3EE3A 3RJJA 1REVA 5HRPA 2E9TA 4QCLA 1U1LA 3WK9A 3I4HX 5I3UB 1QQOA 4BE1A 2HOQA 4ZS6A 2CPYA 4ELUA 3BS9A 4JV2A 2ZXHA 3ZYYX 3IG5A 1HBMA 3POTB 2LEPA 4O0IA 4H5NA 3I55S 2AV5A 1L5UA 2VG7B 3ZETB 1KWMA 1X5PA 3NVKA 3A5LC 3VV2B 4J2DA 4DV2K 5J2HA 1SI9A 3CW2C 4OPJA 3KD3A 4RQ7A 2ZTEA 4G1QB 3T1HJ 1HPZA 2IIHA 2MKSA 1X4FA 4CE9A 3H0PA 4OKJA 3IMQJ 2YXLA 3IR6B 1ASVA 5CCLA 2XC9A 4TQRA 2MKJA 1R8CA 4KO0B 4NMXA 5KG1A 2Q0UA 4Q2LA 3PEJA 2VONA 4FNHA 4RPYA 3RF9A 2RIJA 3M6VA 2DR6A 3IRWP 3ZZUA 4K42A 2MA1A 3S3MA 3ITHA 1WSJA 4RTFD 3F0NA 2YWEA 4YHHF 3UE5A 1CBKA 3ZSWA 5HLFB 1UCNA 1UTAA 1SV0A 3NS5A 1NNLA 1K73T 3I5BA 3H42A 3HMJG 1JWWA 1R0AA 1QQCA 1LEOA 5U47A 1TKDA 4O5KA 3SI6A 3CB4A 3CGIA 4CNZA 3EICA 1D9FA 2KIVA 2ZG6A 2CNOB 2G8WA 4C4RA 4TY8B 3D68A 4FNIA 1OQ3A 3JTNA 1IBLK 3BR9A 3ZZOA 3ZZ0A 3EO3A 5FDLA 3EWGA 9ICKA 4O8UA 5L8RC 1R8AA 2BE9B 2L9NA 2IM2A 3H2VE 5A8KB 4Y0WA 3FEXB 3NKYA 3RMAA 1AROP 3U4LA 2C2OB 3CDAA 5DBCA 3M2UA 5J2MA 4C7ZA 2AGQA 7ICKA 2EDUA 1VMBA 5CR0A 2JHEA 3JPQA 2OA8A 2V2ZA 3SSSA 3KK2B 3W61A 2VF3A 1WBDA 1C1CA 2W7AA 1VQ7S 1LW0A 4OV6A 5DQGA 1GMWA 4JRQA 4CEZA 1RGVA 1HNVB 3PW5A 4YOWA 4ED7A 1ZA2B 3IR5B 1QTMA 4P0PB 2QWOA 2QYGA 1VQ6S 1FA0A 5A2QO 1NJIO 3ILLA 2F44A 1VQOS 3KHYA 2V9WA 1LVHA 4PKHA 3TADC 3PRBA 3CJRA 1PVPA 4A59A 3TA1A 5ALLA 5A6PA 1XHXA 4JEPA 4BRKA 5J2PB 4DTRA 4B8AB 4CZFA 2N82B 3QZ8A 1D8BA 3O80A 4BGBA 2HBKA 1A5XA 3C46A 3OYLA 3M6KA 2QLWA 3MR3A 3G87A 4HI1A 3W62A 1QTNB 3OVSA 3JSMB 2CGKA 4X64K 8ICBA 3L3UA 2V7YA 1KCFA 1IBMJ 1VLOA 3ETRA 4DR2F 4XEIA 2H3QA 9ICIA 3IRXA 2Z4PA 1P90A 4I2QA 4X4UA 4DB3A 2NYVA 3QUQA 3LPYA 3DMJA 5H9EJ 4FZXC 4ILHA 1RLDA 4FJ9A 3I5AA 4H4MB 3E3XA 2F8LA 1NH8A 1KN5A 1TUUA 2QL5B 2EBEA 3SCKE 4NMLA 4N5SA 2AYMA 4IYQA 4LBHA 3TWHA 1S4EA 2FVCA 4CLUA 3WX4A 3V9SA 1N5YB 4FLVA 4ZVRB 3CCEN 1RWNB 4ZVOB 4BG8A 4AP9A 4ECWA 1NJWA 4DEZA 2DNPA 4C0HA 5HN0A 4DOZA 3DXMB 1JXEA 2JEFA 3W9IA 3AA8A 2XHBA 3LM9A 1F5BA 1NHVA 1COOA 4DV0J 4JI6J 2D7SA 9ICSA 1GX5A 3RBZA 2FDNA 4AM7A 1K5OA 5L1IA 1SH2A 2W9CA 1N6QB 1OY6A 3CCMS 1NK8A 2P6RA 2QA2A 3AQOA 3QE9Y 2V67A 3WNHA 1FKPB 4DJBA 3TACB 5KOXA 2QGFB 3THVA 4I28A 4ID5B 4H5VA 2MSTA 4KX3A 3GLJA 2ZIWA 2LXUA 1ITGA 1NO8A 1WOQA 3MD3A 2NZTA 2VKQA 2UXDK 4JOUA 3HP9A 2Y1IA 3PG9A 3LAKA 2FC9A 5J2AA 3A8YA 1YK9A 4MF2A 1UJ5A 1QHTA 4Y2PA 2W41A 4HCCA 1JJCB 3DOLA 3LALA 2UUTA 4JI0F 4HTUA 4FWRA 2A40A 2I7NA 4I6MB 4OJPA 4DL7A 3RUBL 3I0RB 3HF5A 3CCRN 3DRRA 4OYZA 4OZ3A 3RJFA 4WXWA 4QZEA 3N5BA 5HR6A 1KFTA 1YLXA 2W2QP 1RAGB 2D3UA 4DFPA 4WU2A 2MKKA 1X1PA 1S57A 4FVCA 3TO8A 1TTHB 1FDDA 1T0TV 4G3IA 4E7KA 5M1OA 5AK6A 1SV5B 3KZBA 3I6PA 5CYQB 5HJXA 3ET6B 3MUTP 3ILOA 4LH5A 1UPPA 2H5EA 1LAVA 4AHSA 1YITN 2OJ3A 3AM9A 1CVJA 4ZTFA 4K59A 3PX6A 3G10A 5D15A 3TUIC 4UB3A 4Q45A 4JI1F 3HILA 1RHKB 1BCMA 5J2GA 2E9ZA 2QIFA 3THPA 1QSLA 3TKAA 1RAEB 2NUUG 4JYAK 3U8XA 2QTWA 2HWHA 4JLHA 2CJ9A 4L3QA 4B9UA 4NEYA 4KLJA 1P7DA 3GIMA 3PDNA 1QQMA 1J27A 1S6PA 9ICGA 3SD7A 1OSCA 9ICLA 1AYEA 1IBKF 3A4TA 4E0DA 2F9DA 4OZ5A 4IH5A 1RWKB 1HQEA 2MYFA 2DR8A 3O8MA 3HBTA 1P8GA 3FZFA 5BRHA 3T3FA 1RBSA 3VF4A 1XWLA 5KT3A 3UNYA 1VQ4S 3QAEA 2R7VA 2DRBA 3HLUA 2V6AA 4O44A 3RB6A 4FWOA 1UEVA 3KLIB 3IGNA 1HQ2A 4MFCA 2Y1RI 1RT3B 4W5OA 4QWAA 3SQ1A 1S9GB 2GOLA 4MLHA 1CSJA 1CJTA 4F0MA 3GIIA 3KFWX 3O3LA 1FJGK 2M5YA 2Z1HA 1FNMA 3VEVA 4AQYK 1VBZA 2FC0A 3Q8PB 5K20B 1KSPA 2KK0A 4M04A 1FI4A 4US9A 2RS8A 2BJEA 3K57A 1WKLA 3H59A 3IM9A 3VMFB 2D4WA 2XRIA 4DSEA 3QT6A 3ZDCA 1QD1A 2HF4A 3NE6A 1SC6A 5CP2A 5ETVA 3HFKA 3V6JA 5A76A 2JEIA 2HBYB 2CVEA 2CQ1A 1WC5A 3WDOA 2IM0A 1VIOA 3UKRA 1WOSA 4O4GB 2JWNA 1Q81T 1Q18A 1NGGA 2R2UA 2RMLA 3I96A 1WUAA 4EHUA 3PW2A 2W3SA 5KAKA 1S59A 3GG4A 2Q6BA 3H20A 2IPOB 2ZZTA 3VQ7A 3ZTPA 2W6LA 1BY9A 1OQ6A 1PSDA 5D8HB 2YKAA 1JKHB 4DZ6A 4X4PA 5KT6A 5BN8A 1D8ZA 4FVMA 2VC0A 4FBTA 2LMRA 3GBTA 4MKYA 4ZCKA 2DGXA 4NA1A 4TUSA 4UQTA 4JI4K 1I3AA 3QYPA 1HUXA 3E9OA 2FHKA 3DI6B 2XI2A 2CUYA 4QS8A 4XK8C 3UI3A 3MF5A 2LYHA 5DJBA 4DR1K 4KLFA 3HSJA 2DKXA 5A6WA 2Q2RA 4QBUA 3Q83A 2IAJA 1X4DA 4BVPA 1KVCA 3DLJA 4ZLNA 4IJAA 4RQ2A 4Z4CA 1N56A 4L8RB 1XQIA 3V72A 2DNQA 4M3TA 4J9VA 3ZDAA 1BWVA 1ZTWA 2HMPA 1I51B 1VOMA 3EVWA 2U2FA 4ICAA 1FEHA 3C21A 2X1BA 4A8MP 2AP6A 3BSAA 1B4SA 4I68A 3HHLA 5B7WA 1P6TA 4ISGA 3OPKA 3J80U 1RTIA 2XY6A 3LVVA 1A6LA 2AYEA 2CQCA 1SL2A 2NCKL 2D1CA 4OX9K 2PMHA 1GMUA 2W1BA 4RQNA 1RT6A 3KKFA 3C6HA 3JPRA 1PIEA 2XEXA 3O2IA 3OR1A 1VSIA 3RRGA 4LFAF 1L8OA 1AB8A 2V7ZA 2UUBK 1MU2B 5AT1B 5DDOC 4H5TA 4O0NA 4GFJA 3R1HA 2I5JA 3IV6A 2MQNA 4X65F 2ZH4A 4NZ7A 5EN1A 1ASUA 3HTVA 4JI4J 1RAIB 4CZGA 2LKYA 4CZCA 2F1FA 4HWIA 3M8YA 5CYMB 4A48A 1KVJA 2B0CA 4KHPK 2ZOGA 3MM5A 4ACOA 2JZBB 4USJC 3QIPA 5KPZA 3G8QA 4XO0A 1IR0A 3WZ0A 2XMJA 3R6GB 4RNOA 4J2AA 4CF8A 5ETTA 2GS8A 1HBNB 2IC3B 3EZWA 1DURA 5E3AA 3FQKA 1EX4A 1OO0B 2XBPA 3ZFVA 4O8KA 1Q81O 5AZIA 2F7TA 2Q6CA 5F8MA 2UXDF 4DPTA 4ZPTR 3VTHA 4HUGA 4DU4A 2GEMA 4GNIA 5A2QY 3DRSB 2J4RA 1U2CA 5IWAJ 3AA4A 5KAIU 3BP8A 5T7LA 4WJ3B 1RGIA 2W6KA 3SENA 1PG5B 4F36A 2DNMA 3VC8A 8ICQA 4KH1B 2JNJA 1M1KT 1QQ5A 4CJEA 2MPUA 3WKCA 3IP0A 3I9V9 5D77A 3RWUA 1CI4A 1YJRA 1HR0F 4YY3K 3MZIA 2W03A 2IVYA 3KHRA 8ICUA 3O3FA 4YR2A 2QN6B 3OYJA 1H2TZ 4K50A 5M1KA 3AQPA 1VQPS 3TU5A 2X3DA 2R7RA 1FRMA 3I9ZA 4I0WA 4PXBA 3VGSA 1JL1A 3GYNA 4NWBA 4XIUA 4NXMJ 3NGZA 1KD1T 1NEEA 3WHIA 4CH0S 3B4DA 4QZBA 4M5JA 2X1FA 2DGZA 2ZTCA 1ZBSA 5DB7A 3UQ2A 3UKUB 1XI1A 1SC1B 5ALHA 5IT4A 3PSTA 4GIBA 3HHEA 4F3OA 1M5VC 2H3VA 3SAHA 2PFPA 3SQIA 2EK6A 2OTJN 1SJ3P 2E1PA 1OUQA 2FLOA 3E9PA 4K4VA 3AVMA 1RT2B 2ZJAA 2ETJA 1ZXIA 2HGMA 4YCXA 4PG6A 4Y1CA 3GMGA 2B8QA 2FHMA 3SQ4A 2C1EB 2Z58B 4JI7F 2RVJA 1RSCA 3P4IA 1NKCA 3MGVA 3A1YG 2FLLA 1MN9A 2FGCA 1DK2A 1FW6A 2HFOA 4FZYA 2YHWA 3N01A 3TAGA 2NZ4A 2E2OA 2G8HA 4LRFA 4O3QA 1RZTA 1C20A 3SAFA 2Z30B 4C8KA 5I42A 2DBYA 4X4OA 1RTJB 4GV6A 2B5JB 4IO9L 3J7YU 3C5FA 4M41A 1YITS 4DR6K 2OEHA 1K8KA 1EXNA 4W4MA 2VFRA 3T5LA 3A8IA 4N47A 4GO7X 3LPTA 3LH2S 1PCAA 3AVNA 4RW8A 4OL8A 5AK4A 4OYOA 4GVBB 3K5MA 3KOOA 2KIWA 2W7OA 4M5NA 5LJWA 3MEKA 5DDPC 3E58A 4YXJA 3TTFA 2NPFA 1L3KA 4E7IA 1NBWA 3MD1A 1RTDB 3H8SA 1RWWB 1CULB 5G5HA 3HFZB 2HHWA 3IFEA 2XYPB 3M6WA 5LJVA 4O5EA 2UVUA 2P51A 1U24A 2MXYA 3D3BJ 3L4IA 2QSWA 1U02A 3CE8A 2XY7A 2W9BB 3HKWA 2PAVA 1P9YA 2BJ9A 2OHFA 4USWA 1MMNA 2DCUB 3SEOA 5AM2A 3TAQA 1VSDA 1ZQHA 3WC0A 3V9WA 2M0NA 4PA1A 2ITMA 2EFPA 2MZQA 4RUHA 5D4NA 3ZLJA 5G4DA 4I2CA 4FLTA 5AI9A 2H4YB 2RKIB 3SPZA 2F8MA 4YNQA 1ZQJA 4DV7K 4I2HA 2LEBA 2LXFA 2UZAA 4DOBA 4DR5K 4DV6J 4OYWA 4LR7A 4O55A 3CI5A 1FKPA 5KT4A 3M2RB 5GMKa 1C4AA 4G6VB 4QU6A 2OTJS 4DCHA 2VHGA 2YJFA 5F3TA 1WSRA 2ZOFA 2HQIA 3KJNB 3EM1A 4WWSA 3QXGA 4PKGA 3G8SA 1VYAA 3WXKA 5AKLA 2DH7A 5G0RB 4KHWA 1I6JA 1Z1VA 3AA2A 1X3MA 3AA3A 2R8KA 4CLFA 2GQ2A 1V3SA 4HVJA 2YKQA 3ISND 3BH7B 3ZZYA 4H0YB 4MYTA 2FJVA 1MNEA 1FD8A 2HFZA 1RHJB 1VISA 3GQCA 4BGAA 1CJUA 4XRHA 3BEGB 1N60A 2X6NA 3VEXA 1NM2A 1YRXA 2GELA 2GMJA 2N4DA 3NGTA 5AK3A 3ISBA 3NAHA 5LOQA 3P31A 1HD0A 4YOYA 3IBPA 2COLA 4GRSA 5J0UA 1T4GA 1NRKA 4BVOA 2DHAA 1VI7A 3FYHA 4UB4A 2GO7A 3MX2A 3D0IE 2WAQC 1JXVA 3ETMA 2F65A 2PFUA 1WAFA 3HM9A 1WAJA 5AICA 3OHRA 1K9MT 1JLGB 4XUSA 3O1BA 4OCZA 7ICNA 2XTJP 2J5AA 1TP7A 2I8EA 4LRDA 4EZ6A 2E5GA 3SMSA 2CPHA 3JB9k 4Z4HA 5EX5A 3Q8LA 1FDAA 1B0PA 2V50A 4DZDA 2ITGA 1NJIT 4DO9A 3EXCX 4B3TK 1RM6C 2ZC4A 4LJXA 3M2VA 2OD6A 4M42A 3VAMA 3MMVA 2DKOB 7ICOA 4X66J 3EL2A 4QAGA 1X7VA 1X5OA 2LQ8A 1S1WA 5BYQA 2C2RA 2V4JA 2J9EA 4OI1A 1TKZB 1ZM9A 4LF1A 1UMJA 5KQ8A 3BBCA 3HT0A 2AYGA 5GTHU 5AXLA 1N5VA 2XS2A 2GIRA 1TL7A 1M5PC 1S6PB 3IXQA 5LSLA 2YMMA 3AD7C 3Q7BA 3TX0A 4PY5A 3IDHA 3NS1A 2DD8S 3PFOA 4K8XA 5KFAA 3LDPA 1R43A 4PGYA 2CJQA 2UUBJ 3QFUA 1W26A 5KFSA 1VDHA 4ZPDA 3LDOA 1SKRA 2FJ6A 2RP5A 3EYZA 1JXLA 1H2UX 2XG8A 4UOCA 1CZBA 5GIOA 3L95X 8ICLA 1ZQLA 2RQKA 4JRPA 5IV4A 1J2NA 1U6BA 1NJYA 4O3OA 3H2LA 5J2CA 5A0YB 3P96A 2HMXA 4F9OA 5J2KA 2YWFA 3NMUA 3FUYA 4N8NA 3TUJC 3UD4P 4DCOB 2G06A 3LGHA 5KG5A 1SC3B 2XYGB 3QGHA 2KMDA 4WF9L 4IFYA 1U0HA 4Z2XA 3U26A 4RUAA 2O8DB 1HW9A 4AHCA 3D1OA 3PJ9A 5KFFA 3FMWA 2JHDA 2CQ4A 1SQKA 3UN3A 4IQXA 2MEWA 1Y5NB 3ZZRA 4F8RA 5AQRA 4X66K 4P73A 4DV1K 3KMSA 3V4IB 1GX6A 1HMVB 4WFNQ 3MCSA 3ICXA 3MCNA 1TUVA 2HS0A 3PCOB 1EB0A 5E2QA 4LD0A 1CS4B 4UB6U 9ICXA 2P9EA 3LUYA 2YX7A 2YPZA 3G86A 2B43A 5JS1A 3CJ5A 2F2AB 2KQ2A 3VGKA 4C2MA 4KLIA 1TUGB 1QDUB 3FZBA 1PAEX 1VS3A 4F02A 3HFVA 4UQGA 1NBEB 1FFSB 8ICJA 2C3OA 1ZQOA 3OL8A 5THWA 4AYBC 4IOCL 3VENA 1Z00A 4DTPA 2O6KA 3Q8SB 5A8WA 3KLFA 3D1HA 5AE3A 3ZX0A 2M3DA 4KGMA 3T5JA 4PL7A 2XWYA 2YKNB 2D9PA 5DO2A 4Y2CA 3IAM9 4HI2A 2P9NA 1TK5A 3EW9A 5EVZA 5EGYA 1O8BA 3BGFA 5M1QA 4LF8F 1NI3A 3WQUA 1FNXH 2L9DA 4M3XA 2LM1A 4I2BA 2Y1JA 4EP4A 2V9KA 3CCLN 4YY3J 4CJLA 2J6UA 4ZLLA 3LZIA 8AT1B 2Q3SA 3KLGB 3HRGA 3T69A 5GIPA 1YJNN 3SK3A 4ZJLA 1ZQRA 3HD1A 2RE2A 4RJVA 2E6LA 1B99A 4OX9F 3R6MA 1T05A 2ROPA 1M0SA 4C7QA 2XULA 2HRYA 3GR1A 3DDIA 3R5AA 2KG5A 3F2DA 3NY0A 3KYLA 1LQ9A 5H1SV 4KO0A 4A57A 5ALNA 4OMFG 4CJQA 4BC7A 2YNHB 4I2IA 3HI9A 1CZ9A 4B3RF 3GG0A 3NGKA 9ICHA 2ZIVA 1HNXJ 8ICAA 1W0HA 1T3VA 3V9ZA 2AF6A 3FGVA 3CFPA 1TL5A 4GKKJ 3OR1B 3ULEA 2ZITA 4RQMA 2OPSA 4TU8A 2KW4A 4BRLA 7ICPA 4MH8A 2HQCA 1LW2A 1Q5VA 1C2PA 4CF4A 3O6QA 3MAAB 5HHHA 1ZS6A 4P4MA 1SXLA 2VG6A 4J9PA 3DN9A 4LZGA 1JUDA 4CJPA 1TL3B 3CTRA 2BYCA 1VC6A 3C66A 4KHRA 2YQEA 3K5PA 4NYNA 3WKEA 2QWLA 4QIFA 1ITPA 3BQ2A 2HMIB 5IIMA 2ZH8A 1Q82T 1HYVA 4RW6A 1JX4A 3ZTSA 2DHXA 1QS4A 5ETNA 1G7CB 2DNYA 4NLGA 3VAFA 3M32B 2ASOA 1RA7A 4PCQA 5BN9A 4I6MA 9ICUA 2VWJA 4CJSA 1F0XA 3WU2U 2YV0X 1TKTA 1X4GA 5JLHA 3BEXA 3IWXA 2VQFJ 4UB8U 5D0RA 1DTQB 4USIA 4LQ3A 1XU4A 4RUBA 1C0TA 2YMPA 1LB2B 4I2AA 4WQ5C 4AF1A 2V4QA 4ISEA 1KD1O 2UU9F 4FJ7A 1FXRA 3OFHA 4FXVA 2E5LK 1Y0HA 2MLYA 1NG9A 5DGBA 4JI7J 2ZFHA 5DETA 1SPBP 2XO7A 4LRCA 4E7LA 2NRZA 3QGPA 4OKKA 3R97A 5B0AA 2QWNA 3SI8A 2IM1A 1HBMB 3TZWA 4CFBA 3RAMA 1NXIA 1PJ5A 3ENVA 5DBAA 3RTVA 5F0WA 3I8DA 3HZ6A 1WWVA 3R1XA 1VQKN 3PXGa 2BGWA 4GVMA 1QSYA 1Q7YT 4FK0A 4KLQA 1Q7YO 5AKJA 3BF4A 2AW0A 5DQIA 1SGGA 4ZPAA 1BOTO 1WI8A 2CPFA 2F8EX 1U26A 3N28A 1X5SA 1ZBHA 5HO4A 3J7YI 2MJNA 4NA3A 3M6ZA 2XCPA 2FVPA 5LSOA 2E1CA 4B9SA 1RBOB 5F8IA 5F1XA 2CJYB 4IUFA 3MWPA 3PSPA 3C14B 1MA9B 2WHOA 3CCSS 4X4TA 4DR3K 1XN9A 3P5JA 4DG1A 1A5WA 4YMOA 1HNZF 3C2LA 2VGMA 2LXIA 4LF5F 5FROA 1KEJA 3UNGC 1KHWA 1FJEB 4DV5J 3O08A 2OFHX 5EU7A 4ZVFA 3PYDA 5E5NA 3FNNA 4FDFA 2QA1A 3OUYB 3QNOA 3IS9B 4RCHA 1U4BA 3OW2R 3IFRA 1MWKA 3GCWP 2GCFA 2HS4A 2F3JA 1BPBA 2ZIXA 4BX9C 4CJKA 5KFEA 4XPEA 4CHZA 3JYTA 4A8XA 3LDQA 1K47A 4ID5A 1N32K 1CG2A 2M52A 3ENBA 3D0HE 1ZBTA 2VPYB 1RT4A 3RVCA 5J2MB 2YI1A 3DLKB 1URRA 3AODA 3SBGA 3W5ZA 3AQFA 3MMCB 9ICRA 2XSJA 4O4GA 2A2CA 3NLCA 4YB6A 1YZ6A 3EKUA 1PJ7A 1MWZA 1S49A 2ZBPA 2WW8A 8ICOA 3NRWA 3MR6A 3PIOL 4LFCJ 2E2NA 5C42B 5ETSA 1RT5B 1C6VA 4MIWA 2O5DA 3NVZA 2UXCJ 3B0YA 3O9UA 3P5BP 4KHMA 4L3NA 5AM4A 3FKBA 3CCJS 4JI0K 2Z0GA 4WFBL 1J2MA 3UN5A 3BKFA 5DG8A 4FPAA 4LF4J 1YBUA 1NSKL 4PWDB 1ESVA 1FDNA 4KHYA 3D7EO 4R5PB 5KFOA 3D6FB 4JI8J 4C6AA 3DC2A 1TMMA 3LF0A 3QPIA 3NASA 3KFUF 1WWUA 4Y2MA 3ZSQA 5AKYA 5LMNK 4IO1A 3MEGA 2W54A 3Q8MA 1BWEA 1FNOA 3LP0B 2O8CB 5L1JA 2EW9A 4PXCA 3KLVA 2VV5A 1FTCA 5KPTA 2QLTA 3M6GA 2CH5A 3D2EB 3AD8C 2VUGA 4YN3B 4XPCA 2QL9B 1TVRA 3A2FA 3IKMA 4GO5X 2JWKA 3JSBA 2HK3A 2GMHA 2EC0A 5C0YA 2FF3B 5AJ3F 3KZIU 2AKWB 3H5XA 4ZHRA 2VICA 2B9XA 4DU8A 2DHGA 2KT2A 1JK9B 1HNWJ 1A9NB 4BROA 1XR7A 2WW4A 3O4NA 1FERA 1UA0A 3KWMA 4HTIA 1A0OB 4G65A 1CJVA 4DHYA 3TA0A 1CJKA 4MFAA 1FKOA 4NJ8A 3OTBA 2KG1A 5IIJA 4LIRA 4CIEA 4TY8A 3I1YA 5HMMA 4J91A 1XQSC 3D1QA 4QPXA 5HI7A 4NCGA 4YXMA 4IKFA 3UO0A 4NASA 4KAZA 4O5BA 1H7XA 3LP1B 1XNQF 4B9QA 1MA7A 5JICA 2E5SA 4CQ1A 2MB0B 1MROA 3O5BA 4BDPA 1KLMA 3TADA 1KHVA 1VQNS 1VQYA 4CDIA 2JWLA 3PV8A 1T9TA 7ICQA 2FBTA 2R7YA 1C1CB 2BJ1A 2DEIA 2FPMA 2QK9A 2MU2A 4YB7A 2Z1GA 1AQ6A 5CHGA 1NMDA 4YQWA 2DT9A 4WTOB 1GLLO 1XNSA 4DFJA 4WIQA 4ETZA 3VA0A 1I3OB 1VHFA 1K8AT 2GH1A 2G0IA 5ALIA 3V9UA 4QZDA 1TFRA 2WSEC 2DK2A 1HLUA 1SKUB 2YY6A 2KICA 1W2BR 3I0RA 1YTUA 4LSLB 4OLOA 3RB0A 5D6GA 3UXPA 5EY4A 2ESEA 5E7OB 2X3GA 1YJUA 3CCJN 4YDDB 3H3NO 3EPIA 4XTTA 2NLXA 3CULA 3F2CA 4FWSA 3VGLA 3SIPB 3RMDA 2Q97A 4JBCA 3GP9A 1R6VA 1XNRJ 1Q95G 2OGUA 3B4MA 2VQEJ 3HO1A 2ZC3A 3CJ7A 2CNKB 2LYAA 4EO8A 2KN4A 3ET6A 4ETXA 4LF4F 2KZZA 2CVIA 3IM8A 2IVOA 4EK2A 2VPZB 3B0XA 1RWMB 2HZCA 4CBXA 4I67A 2D6FC 5F8NA 3MAQA 3HK2A 2LPEA 4DV4F 1YJ9S 4FP9A 4GMJB 4HHJA 2F40A 4DQQA 2PMZD 3VAGA 3HPGA 1O0PA 4K4GA 4CI0B 5ETPA 3MXMA 3V81B 2HFSA 2BPFA 1WOOA 1GLBG 2CXYA 3G82A 1ZQDA 1V85A 4AYBF 4U7CA 5ALZA 1N5TA 4B3RJ 1SQEA 4OZJA 1FO1A 3WXJA 4JWNA 5AQGA 3KG0A 3TEHB 3BQTA 1KDNA 1M5HA 1HR0J 3ITHB 4BUGA 1VQMN 4U67Q 4AHRA 4EFAC 2CGLA 3PY8A 2HVZA 3MWTA 5ALGA 2EI5A 4NLBA 4QIGA 4FJMA 2J8AA 1WWHA 5J2BA 4IS7A 4HUFA 3K1RB 1BG3A 1TV6B 1QHAA 1RISA 3H5UA 2GIQA 1XMOF 1IKYB 2KG0A 2RF2B 1B7FA 4PQUA 4CJRA 4I7FA 2H48B 4AHTA 3AD9C 4Z7YA 3MN5A 4UB5A 4K5RA 2X1AA 4X5VA 1RCHA 5DGAA 2ZIWB 3AAPA 5AM3A 1VQNN 2ILYA 4UTGA 5ALQA 1DQAA 1VFJA 4CH1A 1MQ2A 1EX8A 3WIUA 3ULHA 2HNDA 2P9KA 2JRSA 3G96A 1IQZA 1O03A 1LK5A 2AZ1A 4W98A 3PMNA 2ZUDA 4LMZA 3OLBA 2MHEA 3D9BA 2PZSA 4M3UA 2PKEA 3OTOK 1DOQA 1T6CA 2U1AA 2QM1A 3CCUS 2JL9A 2LVWA 2CQPA 4P0QA 2XLJA 4QZ9A 1PBUA 4NLQA 2V8HA 5J0RA 1A5VA 5GAHP 1VSFA 1S1VA 4KRFA 1W25A 4Z4EA 3TRGA 4Q0BA 3WK4A 5KI6A 2DITA 2YTUA 2M88A 2VA3A 2W9BA 1DZ5A 1RAAB 4BR2A 3MI7X 1BHLA 7ICHA 4K4ZA 3NOCA 3L7OA 3JQJA 3PVXA 4W5NA 3A3PB 1HPZB 3SCXA 5KRSA 5KFYA 4ERDA 4KRWA 1BWFO 2RU3A 1C1AA 2EPIA 1FXDA 1HHQA 5IIOA 4C0BA 3G71N 5ETOA 2GVZA 5C24A 2ASMA 2AYBA 2CADA 4TKTA 2IAJB 4B1VA 4E1JA 2Y0SC 3PKMA 1SZHA 1H98A 1S1UA 2A18A 4BWJA 1R8PA 3QFPA 5D4BA 4F04B 3DU6A 4MKVA 3IG1B 2XIDA 2HHXA 1M5SA 2QLFB 3VQAA 2FGOA 1NOMA 4AHUA 4V19X 1S5JA 2RH3A 4ZCMA 3A8KA 3QT7A 4JV5J 3THWA 2F96A 2HRTA 4FXDA 4OZ1A 4C98A 2O01C 4EX7A 2P9IA 4OHZA 3WK8A 3FLCO 1HEKA 5IC4B 5AXMA 4WKRA 3CFOA 2ODGA 1RACB 4CGFA 2FXUA 3DXMA 1Q86O 4FVUA 3ZSVA 2A1JB 4ZOSA 3AOBA 1R8BA 2E9RX 1CJUB 1PBAA 3J81O 2DGUA 3UCGA 2YX6A 5BR8F 4OX7A 2ZJRL 4FJGA 4CF1A 4CZHA 5SWMA 3M1VB 2R7TA 3SCIE 4ECSA 1B9FA 2PGCA 2ROGA 3KKAC 1T95A 3AJ2A 3FSIA 5L1MA 2KXFA 2CQ3A 4DOCA 2OTLN 3C6UB 2FY1A 3DLBA 2WF5A 2W4CA 4A5AA 4FJ5A 1PGZA 3ONQA 3BKUA 1NDPA 4RQ4A 2ADBA 1YXQA 1ZQXA 2HBMA 4OFZA 3E01B 3BYPA 3F5AA 4WFZA 4OLAA 1PYTA 4FK4A 3IR7B 3G8TA 2IRYA 1IXRA 2ATCB 4QZVB 5CH7B 4EBCA 4CLSA 2QFIA 2P1JA 2GVDA 2JSXA 4RNNA 4MAKA 3WKBA 5HROB 4LF6J 3D5MA 5AQYA 1IQTA 3PSIA 3RJIA 2QA4G 4JUZA 4PHDA 2VOPA 1NZAA 2CH6A 3K5OA 3NS6A 2NXJA 4USUA 2D5RA 3SQ2A 3FC9A 1RBAA 4ID1A 2KJ8A 1Q79A 2DR5A 3HW8A 1VJWA 3C16B 4IO8A 1XMBA 5KGXA 3RMCA 3B6OA 4L3KA 1Y00A 4UY85 3DU5A 3OR2B 5IM0B 2R8IA 2GWKA 1D4XA 1GOAA 3TI0A 2HHHJ 3H8YA 4M5GA 2W4DA 3GJQB 4QZHA 3M8ZA 2VQFF 4B17A 5LM7E 4Y2JA 2E8NA 3G71S 3AU2A 2E5HA 3SV3A 4A2AA 2VGNA 2RKIA 5B09A 3HVTB 4W5RA 2ZH1A 4PL1A 1RXVA 2GBZA 1ZAVA 1SBRA 2NO4A 4CLPA 3UKUA 4L72B 1R8HA 2B9YA 2DUYA 3J7A1 4LSNA 4FWNA 3QIOA 3R27A 1XIQA 5MLCV 3W63A 5LSRA 3OFGA 8ICVA 2CZVC 1W9HA 9ICMA 1PK3A 2ZE2B 7ICGA 4P10A 1N5YA 2YVSA 2KRBA 4CCHA 3V5RA 1XSPA 2DO4A 1QQNA 3WBZA 3A5OC 4Y6IA 4CI6A 2H4WB 4CZKA 2OPPB 2BQUA 1B70B 2YX4A 1CRXA 1NPKA 2BX6A 3HHLC 3NH2A 5D4OA 3VGVA 3QEBZ 4JHDA 2QEXN 2LQBA 2PDAA 3CD7A 4I2FA 4EGLA 3UVJB 3L2QA 1B7YB 1DQ9A 5HHIA 1JCEA 5FPNA 4UAZA 4DF8A 3M30B 3O1WA 2AJ0A 2K7JA 4EEYA 4F4YA 1GO3F 2WOMA 1MU2A 1AW0A 4DU7A 1Q8KA 3VZIA 5HL7Q 3H7HB 4C4TA 2Y9HA 4YD1A 5K14B 3DRRB 3OL9A 3PEHA 5GAHI 1H74A 1LW0B 1DRZA 4QYZJ 3NCIA 4CLYA 1N32J 1KQSM 2W9AA 1JRPA 3ORYA 4OJ3A 1XMOK 1JI7A 1KP6A 1PAUB 2DNOA 3R2CJ 3ISNC 1YSJA 4DPXA 2BKPA 4ZMMA 3DXKA 3CCZA 4I2DA 4P9SA 1X4BA 3GPAA 3EDRB 3VN5A 2XMTA 1HBUB 4ECVA 4F92B 1MW7A 4ZN3A 5I3UA 4FXWA 3TOQA 3F5EA 4RPFA 2W25A 1SIJA 3KNGA 2ASDA 2F7VA 1LOTB 4OJ6A 1CULA 4PZVA 3W9HA 4RWXA 3VAKA 5ALXA 3NNAA 4U95A 2G0CA 2HOIA 4NX9A 5J2JA 2LDYA 1J53A 1FRHA 2VFVA 2HNZB 1YJNS 5G5GA 2MY7A 1OH5A 1HWJA 1KOOA 4F4ZA 1TYQB 4PWWA 1VK3A 2B4VA 4R0EA 2R2TA 1HNXK 1H73A 3PO5A 1TR0A 2BUNA 2CA9A 2MQLA 1ZA1B 4H4MA 1SB3C 1ATSA 2EWHA 1HJPA 5CD4A 4ILLA 3QEIA 3SJHA 1IBKK 1RJJA 2F8TA 2DH9A 2B51A 3LL3A 1G2EA 5F8HA 3CUNA 3SDEB 4QZGA 2H5JB 1S9FA 4W90B 2LMIA 4C48A 4NXNJ 2KHDA 3JAMU 5AKIA 1BQMB 5C2CA 3K5LA 1Q5YA 1YVUA 3M8QA 4K4HA 3T1AA 1UEUA 1E3MA 5ETLA 1H1VA 4JI5F 1UCVA 5AM0A 1RE1B 4MO5A 2KVSA 4KGKA 1FFGB 4TVAB 2DEJA 2Z2ZA 3I31A