3TI0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddgtp-dc in closed conformation
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 202
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ti0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ti0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ti0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ti0A01
1JKHA 3U6FA 1DOQA 4CJUA 3KD1E 4NLKA 4QZHA 4LZDA 1U47A 3S3OA 4O3NA 4K4GA 5CZ1A 2AGQA 4I2FA 4RUCA 5L1KA 5TZVA 1AROP 2IMWP 4CJEA 5IILA 4UAWA 3PW2A 2RDIA 3AA3A 4F5NA 4FO6A 2KZMA 3HVTA 4Z6EA 8ICRA 7ICGA 4O55A 5HLFA 2R8JA 3AVCA 1L3SA 2KZ3A 5DG8A 3SCXA 2I9GA 4PGQA 4ZTJA 2D0BA 1RXWA 4GW6A 2GV9A 2D5RA 2BGGA 1ZQBA 2W8LA 4DOCA 1FXXA 4FLVA 3MR2A 4K4IA 3QEPA 3T5JA 3C95A 3KHLA 1S1TA 2YNFA 4C8KA 3C94A 4CIGA 3H8WA 4Q8FA 1ASWA 4CGGA 7ICSA 3OYGA 4CF0A 4DF4A 2HHQA 1XSNA 4QZGA 3ZT1A 9ICKA 3V6HA 4ECQA 1HRHA 4Q8EA 2FPKA 4Z4IA 2KW4A 2VA2A 4LSLA 3B6PA 4QWBA 4M3TA 4EYHB 3UQ2A 1XU4A 1T8EA 3KLHA 4B3OA 4CF9A 3LDSA 4ECZA 2I5JA 4JRPA 3OYEA 7ICQA 1D9DA 5KFMA 1TVAA 4Z4GA 1S97A 4MF8A 3DM2A 2D0CA 3SQ1A 1SL2A 4RQ3A 2IHMA 4IRDA 5JUMA 4IFVA 4AHUA 7ICVA 4IR1A 3SPZA 1S6PA 2NRVA 4LD0A 4DTOA 1W9HA 1RYRA 2FMPA 3TR8A 3T1AA 2G8FA 4I2GA 3VQ6A 5CYMA 9ICNA 3QERA 9ICXA 3AVHA 1S0MA 4O3PA 4PHDA 1QE1A 4N76A 2ALZA 4E3SA 3RAQA 3V7LA 2XY5A 4BXOA 3SYZA 1CZ9A 1JIHA 5I3UA 4QW8A 1HYVA 3TWHA 2BQRA 4F8RA 4KB1A 8ICZA 2ETJA 4NLZA 5KFUA 3VQ5A 1S9GA 3OJUA 1KRPA 4I7FA 3F73A 3CQ8A 1S0VA 3LP1A 3OYCA 3NGZA 3CYMA 4ID1A 1BVSA 3Q8MA 3UXNA 1NOZA 2PFQA 1EP4A 4CK1A 3JPNA 8ICLA 3NDKA 2P6RA 1KVCA 4ELTA 2KFNA 5DMRA 3GILA 2MAXA 5J2MA 4B9NA 2OYQA 3SNNA 2M9NA 3HPOA 1TKTA 4CIEA 1U04A 1WNSA 3WNGA 2DTUA 5KFBA 3LZIA 3PY8A 1BI4B 4M2YA 4YXMA 4WE1A 3OHBA 5HMMA 1TL1A 2X6NA 2YNGA 2Z1GA 3RRHA 4MFCA 4KTWA 2HNYA 4FK4A 5J2HA 4DO9A 1CEZA 3WNFA 2IBKA 1BPYA 1YTUA 2G8HA 2PFPA 4AHRA 4PGXA 5KFZA 1NK9A 4CHQA 3OYAA 4XA5A 4ECVA 3ZD8A 4RPYA 1NJWA 5KG7A 2J6UA 4KITB 5KFRA 4DTSA 4NLNA 4DQSA 2W42A 3NAEA 4RQ7A 3KTQA 5C5JA 4FZXC 3RJEA 1DTQA 4F93B 1RT4A 4DTMA 1YTAA 3PO4A 2D0AA 5HRSA 2Z1JA 2B6AA 3VQ4A 3F9KA 2XCAA 3FYHA 4G3IA 1C0UA 4Q5VA 1KDHA 4ED7A 1S0OA 4PQUA 9ICWA 1EX4A 3NF9A 4RNNA 9ICCA 3SV4A 4DQRA 1Q9YA 8ICFA 4MFBA 1VSHA 8ICYA 3HVRA 2OPSA 3M8PA 4ECRA 4OPKA 3PO5A 8ICIA 4RQ1A 3RRGA 1L3TA 4CJLA 4DFPA 4YMOA 3AA5X 4TUQA 4FW2A 5DB6A 1NKEA 4CESA 3AVMA 4M9HA 4CFDA 2PFNA 5J2QA 5KFNA 4QWCA 4JK1A 3AO2A 4M42A 1ZQXA 4CE9A 4EP4A 4R8UB 4MEXA 3FFIA 2ASDA 1LAWA 4RU9A 4BE1A 2ASJA 4YXJA 2B4JA 3PW7A 3RBDA 1YVUA 2ISOA 4QZAA 5J2EA 2KFZA 2LSNA 4GVMA 2FMSA 4Z4CA 1JXLA 4YD1A 4RQ4A 3VQBA 2BHNA 2BCVA 3AVKA 1EXQA 3Q8RB 3K5MA 3AO3A 4R8UA 3ZDEA 3D45A 4JV2A 5CA7A 1N6QA 4DTPA 5J0YA 3BQ0A 3MDAA 5KFKA 2NRZA 4IR9A 4KAZA 4BXOB 3SQ4A 4CJWA 5KGXA 4M6WB 3T5KA 3RJGA 4YFUA 2AQ4A 1MQ2A 4J9QA 2XGPA 3ZSQA 2P66A 4FBUA 1JLQA 1S6QA 5KG1A 4Y1CA 3LPUA 3ZDAA 3ZDDA 2PFOA 4IBNA 2IC3A 1KCFA 1JXEA 1Z00B 5C25A 4DOAA 4XQ8A 2P5OA 3QO9A 3N4MB 4LVSA 4Z0UA 5IIIA 1U48A 2VA8A 4CGDA 3L2UA 1V9PA 4BACA 2YKNA 5KG4A 3LAKA 2BCUA 1I39A 2HVHA 4KTQA 1XS9D 4R5PA 2XCPA 4N5SA 2RDJA 3TAFA 5IIOA 4KLHA 3NGYA 4AILC 1ZYQA 1UT8A 2IHNA 3ZSVA 7ICEA 4CJ3A 4YR0A 5D3GA 3PUFA 1IKVA 4DSIA 4B08A 8ICEA 4DSKA 5J0RA 4F4XA 4CHNA 2W9BB 2EHGA 3RJKA 3RB4A 1WSEA 2Z1HA 4PHAA 1C1BA 4DS4A 4M41A 5J2KA 3RJHA 5DG9A 3V6JA 1SZPA 9ICFA 4J9OA 1B43A 1BIZA 3UIQA 1JL1A 3S3MA 2QKKA 2YKMA 2HHTA 3OYIA 4FLXA 4KLMA 3OYBA 1JL2A 2EX3A 1ZQCA 2BGWA 1BQNA 1U49A 4H4MA 1HNIA 4CEQA 3JPOA 3KK1A 4R66A 5J2NA 4E7JA 3HX0A 3BGRA 2E6MA 3DMJA 1T3NA 3OGUA 2PXIA 5SWMA 4HUGA 4O44A 3ZT0A 2PI5A 4Z4EA 3AO4A 3OHAA 3OS1A 4KLFA 1NK4A 2A1JA 3GIIA 4ELUA 1KFTA 5I42A 1ZBHA 2KN7A 5J2PA 4FJIA 5CYQA 4ED0A 4CIFA 1T03A 4PHPA 1BQMA 9ICMA 4RQ5A 5J29A 3AVNA 1TVRA 4CJTA 5L9XA 4FJNA 1TV9A 4KLTA 2OA8A 1LWCA 4LH4A 5KFXA 3C1ZA 4GXIA 1ZBUA 1WAJA 3HJFA 2V4RA 1SKSA 3GV8B 1EXNA 4F91B 4G1QA 5DBCA 1R0AA 1RTDA 9ICJA 4ZHRA 3AVIA 1DTTA 4DTNA 2HHXA 4HYKA 3NF7A 8ICCA 4Z4FA 4B9TA 3JPSA 3AO1A 3N97B 7ICIA 4UB3A 4I27A 2XY8A 3HPGA 8ICXA 3KHGA 3V6DA 4DQPA 5D49A 3O3GA 1UT5A 2JZBA 3HP9A 1L3UA 4Q0BA 4ED3A 1SL1A 4ED8A 8ICAA 4OJRA 4X5VA 3NGIA 4PY5A 4M45A 3ISBA 2AU0A 1BPBA 2X78A 3PR5B 1JLFA 4I2PA 5C24A 4M6WA 4M04A 3WNEA 3OYFA 3RR8A 4DLEA 3TQ1A 5CR0A 4IFYA 4CF2A 3OSPA 3PX4A 1HNVA 4DTUA 4YCXA 4DSFA 4FXDA 1A5VA 1JXBA 1CLQA 1TL3A 4KHYA 3QEAZ 2IGIA 4BE0A 3FDSA 3QEWA 4E0DA 4DQQA 4J9MA 1RNHA 5KG0A 3DLRA 4IG3A 1TV6A 4BE2A 1XSLA 3MGHA 4ECXA 1X9MA 2V4QA 4FLWA 1ZQYA 1ZJMA 3V7JA 3RJIA 3PV8A 3VQEA 3ISNC 1ZQIA 5K14A 1JLCA 2B5JA 3Q8KA 1N5YA 3K5OA 2IDOA 1S76D 4ICLA 2DFFA 4FVMA 3C2KA 3ITHA 5J2JA 4AHTA 4MF2A 1ZBFA 3VQPA 4HVJA 4YMNA 3QE9Y 2BCQA 4DFKA 2ATQA 4OGEA 9ICAA 4QAGA 4GC7A 1LB2B 3P83D 2ASLA 2VG6A 4EBEA 1BPZA 1SUQA 1VSIA 2P6UA 1KSPA 3AVBA 4BDYA 2WTFA 2F1IA 2G8VA 1GOCA 2C2RA 4NY8A 2YHBA 1RT6A 3MEEA 3RH4A 3V9ZA 5DB9A 4IDKA 3OYHA 3DOLA 3C6UA 3V7KA 5HP4A 8ICHA 5DB8A 2B21A 2W9MA 3DI6A 4KLGA 1WSGA 2HB5A 2R8KA 2FLNA 4ED1A 3Q8QB 3M8RA 1HYZA 3MR6A 1ZBLA 4CF1A 5HRRA 5KT6A 4RNOA 3KLFA 3P5JA 4CEZA 3E01A 3LPTA 1DGSA 2A1JB 5DDMA 1D8LA 4OLBA 3QEIA 3HSTB 4CK2A 1RT7A 4RT2A 2UVVA 1RT2A 3QESA 3LP0A 1ZQGA 4YP3A 1ZQOA 5KT4A 3NE6A 3CFRA 1RDAA 1HQUA 4DL3A 4M3WA 5J0OA 2P5GA 3M8QA 3DLEA 2NRTA 2BPGA 5HMLA 3OYNA 1NK5A 3TAMA 1K1QA 4O0IA 3HPHA 4I2DA 1RILA 3QETA 3TANA 1NJZA 2R8GA 4CJPA 3SUOA 3JPPA 4XIUA 1X2IA 4AHVA 5DQGA 3G10A 1VSFA 3ZCMA 5KFTA 3V1RA 1ZQMA 4CJSA 2KTQA 3SI8A 3GIJA 2ZTEA 3OYJA 3CM5A 3NFAA 4EP5A 3QIPA 3H8JA 3HM9A 3MDCA 4DSJA 1UWBA 3KK3A 4F50A 9ICLA 9ICTA 4PA1A 2JZBB 1ZQLA 1ZQDA 4RW9A 4O5CA 4KN7A 2DFLA 3MR3A 4KFBA 3OYKA 3Q8LA 3K4GA 4M47A 3AVJA 1XI1A 3O4QA 4YMMA 2OPRA 3EPIA 4EZ6A 3ZSYA 1VRTA 4JWNA 3TABA 1HJRA 4EBCA 1S1UA 1C7YA 3V9UA 4C8MA 1S9FA 5DQIA 2HNZA 3LP3A 4QZFA 1ZQZA 4HTUA 3ZSZA 1N56A 5J0QA 5J0PA 4PHEA 2FC0A 4LSNA 4P4MA 1NOMA 3LP2A 1Q9XA 2VG5A 3DLGA 4F4ZA 1NJXA 4CJVA 3L2RA 3IHQB 2A1RA 1C1CA 7ICJA 2JEIA 1XWLA 4QZBA 1ZQHA 2JGUA 5FRMA 4BWMA 7ICUA 1LW2A 4JLHA 4CEFA 4FZZA 3RJFA 1TAUA 4F4WA 3BJYA 4P4OA 4JV0A 1T05A 4KHQA 1RT5A 2AQ0A 3C2LA 3VN5A 1XHZA 3L2VA 3KJVA 4DTRA 4NM1A 5EWFA 1LWEA 2ATLA 2UVRA 3H7IA 2J6TA 3OYDA 3DRSA 1X1PA 3QEVA 3PW5A 3V9WA 3AVFA 3T19A 3VA0A 3HT3A 3DLKA 3LAMA 3C23A 5KRTA 4HHTA 4KHUA 3SI6A 1CUKA 4FJ5A 3TARA 1ZQQA 9ICPA 3UPQA 4O4GA 4M3YA 2F8SA 4KLSA 7ICLA 5HRPA 4CERA 3ZSRA 3H40A 4KRFA 1TK5A 3VQCA 3I0RA 4DF8A 3ALYA 2PZSA 4TUPA 5CP2A 8ICQA 3D0PA 1MU2A 4CEDA 4CFCA 4FJGA 4M0AA 4O5KA 4E1MA 3K57A 3NH2A 5DQHA 1T4GA 4Q45A 4K4HA 5CHGA 2F1HA 5E41A 1JX4A 2XY6A 4F2RA 2BQ3A 2ZE2A 4B9VA 5C42A 4BDPA 4YD2A 3H4DA 1T7PA 4GC6A 3EYZA 4QWAA 1Z26A 4PUOA 1NK6A 3EZ5A 4EYIB 1A77A 1BISA 4N47A 5J0XA 3AA2A 3KK2A 2PYJA 2G8UA 4O0JA 3M9OB 3GIMA 4OKKA 3PVXA 4KTZA 4QZEA 1QQCA 1S9EA 4M3XA 2BPFA 1ASUA 3KKSA 4RW4A 1S77D 1B92A 5IIJA 4I2JA 1XSPA 2YNIA 1WSJA 3HP6A 4RPXA 1D5AA 3IRXA 2C28A 4DOBA 3KKRA 4NM2A 3KLEA 3C6TA 1ZQVA 1VSDA 4F2SA 1KLMA 4ECWA 1RBUA 3GDXA 4TSXA 5KT5A 4LY7A 3LALA 4CGJA 4FLYA 4C8OA 4MFFA 4E7IA 4B9UA 1Z00A 1BIUA 4I2HA 4F5PA 4YG2A 4J2DA 5EOZA 1UAXA 4YR3A 1XC9A 3ZT4A 4CEEA 4UAYA 1J53A 1VK0A 4ECYA 4I2QA 2W9AA 2I1QA 1CZBA 3NHGA 3WNHA 4F5RA 4DTXA 9ICSA 1XO1A 4HUEA 4IG0A 2MUTB 3PX0A 4R64A 2RPIA 4KV8A 1NK0A 4GXKA 1H38A 3BQ2A 8ICOA 1Y97A 3C5FA 5L1LA 3UXPA 3ZDCA 4CGIA 4AH9A 4FJ7A 3MXJA 1IKWA 3JPTA 2YHAA 2IA6A 1HYSA 4DU4A 1D8YA 4ZH4A 2KZZA 3MABA 3I8DA 3SUQA 4RW8A 3U3GA 3TAPA 4FW1A 2O4GA 4FJKA 3CFPA 3RBEA 5HROA 3B6OA 4UB2A 4J2BA 1S0NA 2BQUA 3V72A 7ICTA 2HHSA 3MFIA 1FK9A 2QXFA 4OVLA 4DS5A 3MBYA 2RN2A 3JSMA 4OKJA 2VANA 1QHTA 3A2FA 3M9MB 5JS1A 3NBPA 4KB0A 2OPQA 3LK9A 4JRQA 2ZJAA 1IO2A 1C6VA 3PMNA 3NH0A 5J2GA 2QKBA 4N41A 4KLQA 3RH5A 3SZ2A 4FS1A 4DEZA 3GFKB 4FK2A 1U45A 5KFGA 1BPXA 1B9FA 2C22A 4H8KA 4GLXA 2Q3SA 2BCSA 5DBAA 9ICGA 8ICPA 3IM1A 4H4OA 5IIMA 1RBSA 2XO7A 4M9JA 4IKFA 4IQTA 8ICSA 5J2DA 4O3OA 3SPYA 4RNMA 3AV9A 4J9PA 4FJHA 4J9KA 3ZT3A 4QZCA 2XHBA 1JMSA 4DL7A 1HQEA 1WSHA 2A1SA 3AVLA 1L5UA 5D4BA 1RZTA 4CGFA 3VQ8A 3HXMA 4CEBA 1HMVA 5JS2A 4Q44A 4W5TA 4EEYA 2PYLA 5CWRA 4DFMA 2NRWA 4UB5A 4NYNA 2QK9A 4QOZB 2J6SA 2JLEA 1VSEA 4O3QA 5DB7A 4QCLA 4UB4A 1IM4A 5L1IA 1K6YA 5SZTA 3DLBA 3EW9A 2GWSA 3MECA 3H8SA 3HW8A 1S5JA 3L3UA 3KIOA 4C8LA 2F1JA 4YQWA 5F9LA 1ZQPA 4P4PA 4HCCA 4B9MA 5HRNA 4M3ZA 2G8KA 4BGDA 5HNKA 2E4LA 7ICOA 1A76A 1LW0A 5KFIA 1IG9A 3EPGA 4PGYA 3QZ7A 2F96A 4O3RA 2DY4A 1RT1A 1RYSA 3DRRA 7ICNA 4AHCA 2W9CA 1WAFA 3KD5E 2F8TA 4DFJA 2FPMA 4FBTA 1Q8IA 3H08A 2VG7A 8ICTA 4CHZA 2DFEA 4ECUA 8ICJA 1MC8A 4Y1DA 2FBVA 4O9MA 4M3UA 2RKIA 1VSKA 5KFQA 2FLPA 4DG1A 3UXOA 3V1QA 1KFSA 3VQ9A 4TQRA 4R65A 1U9LA 3HL8A 5DBBA 2BCRA 2IOCA 4RUAA 3G0ZA 3LANA 5J0WA 4NCAA 4W5OA 1WSFA 3RTVA 2E6LA 3B0YA 2W9CB 1WLJA 4FM0A 5J0TA 5KT7A 2FBYA 3C5GA 4J2AA 1WCLA 2DFHA 1NK7A 3MEGA 1MQ3A 4RZRA 1RDBA 3IS9A 2VWKA 1DLOA 1RCHA 7ICKA 2VWJA 4B8CA 4IRKA 4MFAA 2FLLA 1RBRA 3UQ0A 3CG7A 1GOBA 3NCIA 7ICFA 4UBCA 2XGQA 4CJ4A 4M9LA 4QW9A 2X74A 5DGAA 1QS4A 1RBVA 3M8SA 3PNCA 4KLLA 3NF8A 3RJJA 9ICVA 2AGPA 4DL6A 4Z6FA 3OSNA 9ICEA 1I3AA 2PY5A 4J2EA 4E7HA 4FM2A 4TURA 3RMBA 1F21A 5DLGA 5HP1A 1IH7A 2RF2A 3G6VA 1O1WA 5KFPA 3HO1A 5KFAA 3RB3A 3RAXA 2PI4A 4TUSA 4RPZA 1NK8A 1NKBA 3I0SA 3SQ2A 3QIOA 1KLNA 3TAQA 3RB0A 4E7KA 3RR7A 4XRHA 5HHIA 4I2BA 2XC9A 3QNOA 3VA3A 4N56A 3T5HA 4OGCA 4F3OA 1BI4A 4FJ9A 1C1AA 4FLZA 5KFCA 4RQ0A 4LZGA 3NH1A 4FLTA 2KQ2A 9ICRA 1KEJA 1RTIA 5IIKA 2BPCA 3GV5B 5J2IA 1TFRA 4J9NA 2DPIA 2HNDA 4F5QA 3GQCA 4KN4A 2V9WA 4KHSA 2ZUBA 1JLEA 2BKEA 2X6SA 1D9FA 4DL4A 4CJ5A 4CECA 4B9SA 1NOYA 1BPEA 3OS2A 4FJMA 5EWEA 2HHVA 2P1JA 5EU7A 4FJXA 5KG2A 4JS5A 2Z1IA 3DRPA 3DOKA 1IKXA 4CHPA 1HPZA 4PWDA 2FBXA 4EBDA 4UBBA 1REVA 4I28A 1J5OA 8ICBA 1FKOA 4KHWA 4RQ2A 4DMNA 5J0UA 3SV3A 3TI0A 3V9SA 4FLUA 1SV5A 1CXQA 2XY7A 3BDPA 1TK0A 2NRXA 5KRSA 3ISCA 2ZD1A 4PPXA 2HHWA 3OJSA 3JPQA 3BQ1A 1U4BA 3SQ0A 1TKXA 3RH6A 4DL2A 3PX6A 1K1SA 1UA1A 4P2HA 3QLHA 1L3VA 1EKEA 3K5LA 1ZQUA 4F4YA 5KG6A 3C1YA 4CEAA 2FMQA 1X9SA 1NKCA 2ZJ8A 3VQDA 5HHHA 4CFBA 9ICOA 2R8IA 1NJYA 3ZD9A 5J2CA 1RTHA 3TFRA 5IINA 1Y88A 4UAZA 1MSWD 4CF8A 1RTJA 3SUPA 1S1VA 4M3RA 1C0MA 3H4BA 2OZMA 2HMIA 4NLGA 5DG7A 1Z25A 4RQ6A 2C2DA 3MAQA 1ZQTA 3RWUA 4F92B 5HBMA 1RT3A 1RPLA 4ELVA 1A5WA 3C2MA 5FROA 3LWMA 1JN3A 4FJJA 3T5LA 4E1NA 4FJLA 1COOA 2HVIA 2UVWA 4I9LA 3M9NB 3MXIA 4Z4HA 3B0XA 4O3SA 2OPPA 3V9XA 9ICIA 5FRNA 4KKOA 3V6KA 3IAYA 4CFAA 3Q8SB 4DTJA 4YN4A 3L3VA 1TK8A 3NF6A 4IQVA 1EETA 4I9QA 2VA3A 4ECSA 4K8ZA 4FK0A 3HK2A 1S10A 1TAQA 1ZJNA 1ZETA 3VQAA 5KFEA 4GMJB 3RB6A 2C2EA 1BCOA 5J2FA 4CCHA 2XRIA 2ZTCA 1Z3EB 4DSEA 4KLDA 3L2WA 4FS2A 4KLOA 4CK3A 3ULDA 3THVA 4RT3A 2JEGA 3AO5A 4CJQA 3ORYA 4QWDA 3TFSA 1SKRA 4KLUA 4RG8A 2Q0ZX 3AA4A 1ZBIA 2LYHA 3ZSWA 2ZUDA 3MFHA 3QINA 4KLJA 3ASMA 1WCNA 5BPCA 4FM1A 3EWAA 3IG1A 4I2IA 4B8AB 1QLNA 1TGOA 4FZYA 3OYLA 2BR0A 2H5XA 4DQIA 1BL3A 1G15A 8ICGA 2NUBA 5BOLA 8ICMA 1ZQNA 2JEFA 1PZNA 5T7BA 3C21A 1J54A 2R7YA 2JEJA 4PH5A 3RMAA 1ZQAA 3PR4A 3V1OA 2ITGA 1LV5A 5DDYA 4J9SA 1ZQJA 3JYTA 1KVAA 3ZDBA 1LAVA 4KMUA 4JS4A 3L2QA 1JLBA 5KGWA 3LDAA 4Z6CA 4DL5A 1QTMA 1X9WA 1RDDA 1ZQWA 3K5NA 4FCYA 2W8KA 1ZQRA 5KFVA 5KT3A 5DK5A 4E89A 5L1JA 3V81A 4Z6DA 1SL0A 2UVUA 4CJFA 2R8HA 4F4KA 3AVAA 4OLAA 3PMLA 8ICVA 4F3TA 2OZSA 4RQ8A 1WSIA 5KT2A 3Q8PB 1HJPA 4I2CA 4CJKA 1QSLA 1W0HA 4XUSA 4KO0A 2OWOA 2BANA 3ETLA 4M9NA 5CB1A 5KFWA 3ISDA 1TKDA 3EY1A 3MR5A 4MEYA 2ZUCA 1LWFA 4HCBA 4AHSA 5DGBA 3VQ7A 2ZJ5A 9ICUA 4M9GA 4FYDA 5J1EA 3U3YA 5J2AA 5KTQA 4W5QA 3MGIA 4DLGA 3O4NA 3OY9A 4KPYA 1JLGA 1QSYA 9ICQA 3KLGA 4YNQA 4HUFA 1FKPA 1RXVA 8ICWA 4NCGA 3TAEA 1RDCA 4ED6A 3KLIA 3L8BA 3K2PA 5CZ2A 1N48A 4DU1A 4R63A 4ED2A 1CXUA 1QSSA 4KLEA 3RMDA 3OVNA 2YV0X 3QZ8A 4ZTFA 3NGDA 2HHUA 4OKEA 1B22A 5FDLA 2DPJA 1S1XA 2WOMA 3V4IA 3ZSXA 3PW0A 3LZJA 1BHLA 3AVGA 4I2EA 4CHYA 9ICBA 4EZ9A 1KFDA 4BWJA 4QZ9A 3QEBZ 3QNNA 1C0TA 4J9RA 4MQ3A 3VQQA 2IS3A 5KFDA 4JV1A 4DU3A 3PW4A 4F5OA 2BDPA 4JUZA 1KVBA 3E2EA 5KG5A 3LWLA 4DSLA 4YR2A 3ZSOA 1UA0A 5KFYA 4KHNA 1KTQA 3DYAA 4CHOA 4K8XA 5D46A 2WONA 9ICHA 2G8IA 3TAGA 4JWMA 5J0SA 5KFLA 3P1GA 5KFSA 2ZQBA 2FPLA 3SUNA 3QEXA 3CFOA 1BGXT 1IKYA 2AGOA 4QZIA 3AUOA 3MXMA 1ZQSA 4W5NA 4NYFA 5F9NA 4KREA 3KHHA 4TQSA 2W9BA 5KFFA 4IRCA 2GUIA 4NXZA 3RMCA 3NTUA 1B9DA 2IAJA 2YNHA 1A5XA 2ZTDA 7ICHA 4NCBA 3S3NA 5DKWA 1GOAA 2MUTA 4I2AA 3O3FA 4I29A 1VSMA 3K58A 2P51A 4KI4A 4BDZA 4FJ8A 4C8NA 5KG3A 7ICPA 3MEDA 5DLFA 1BPDA 1VSJA 2O4IA 3AU2A 5CJ7A 1VSLA 4E19A 3BQTA 4KLIA 1S1WA 1ZQKA 1YT3A 1SKWA 5KI6A 8ICUA 4KI6A 5KFHA 3ZT2A 3KHRA 4QZDA 4IQUA 3OYMA 3SJJA 4QZ8A 4OPJA 3AU6A 7ICMA 1ITGA 3K75D 3JPRA 1ZQFA 4LH5A 3DLHA 4O5EA 4E7LA 3GV7B 2Y1JA 3T3FA 4DWIA 2AJQA 4YVZA 4RW6A 1TKZA 1RBTA 3OS0A 1XHXA 5CY4A 3HWTA 4CGHA 1ASVA 1WN7A 2Y1IA 8ICKA 4GXJA 2HW3A 2FBTA 4B9LA 5KFOA 5KFJA 4Q43A 1J9AA 2GBZA 7ICRA 1HUZA 4QWEA 3HYFA 2BE2A 4L8RB 3GIKA 4CEOA 1JLAA 3K59A 1BCMA 4J9LA 3CM6A 4ID5A 4RW7A 3G6XA 3G6YA 5EWGA 4ECTA 4UQGA 2G8WA 1ZQEA 1UOCA 4W5RA 4CJRA 5J2BA 4YFKA 3S9HA 2ISPA 8ICNA 1IXRA 1HUOA 5BOMA 4UB1A 1VRUA 3O3HA 4IQWA 4O5BA
chains in the Genus database with same CATH superfamily
4NLDA 5D8HB 2VGNA 2QB1A 1KC8T 3GJTB 1N33K 3IGVA 4WIQA 4QZHA 2J8SA 1U47A 4RW7B 5E84A 3WXJA 3OUYB 4I2FA 5L1KA 2BRLA 3LPEA 5TZVA 5LSLA 3I32A 5IILA 4UAWA 1WG4A 2RDIA 4B3RK 3CCQN 4DR6K 2ZJQL 2VWBA 2KZMA 1RWVB 2PBDA 1KQSR 1OVYA 3SFGA 5AI9A 7ICGA 2V4JB 3SAHA 1X4EA 1O03A 5HLFA 3AVCA 4TY8B 3CTRA 3W2WA 5DG8A 4JB3A 1XJWB 4IG3B 5LMUJ 3SCXA 3J7ZO 2I9GA 5L39A 4DPTA 3CC7S 1OH5A 3MX5A 2D5RA 4Q2LA 4HH1A 2MLXA 4DOCA 1FXXA 1IKYB 3SXLA 1IIPA 3KHLA 3FSYA 2YNFA 3CJ4A 2BUNA 3W3DA 3QNMA 3W0LA 4Q8FA 4US9A 4PG7A 1ASWA 2D3ZA 5D6GA 4BS2A 5SUHA 5IT9Y 4BC5A 2HHQA 4P2FA 1N88A 5AI0A 2PFUA 4LF8F 3V6HA 1JCFA 4ECQA 3O80A 2DXEA 2VA2A 4LSLA 2HQGA 4M3TA 2VG6B 3QRRA 4J8FA 1XU4A 2PAVA 4ZA1A 3OTDA 5ETSA 2W43A 4KH4A 4ECZA 2I5JA 5F0WA 2FHJA 3MMAB 3UR3C 3OYEA 4JRPA 1EX8A 1D9DA 2UUWA 3FGUA 4DR6J 1S97A 1SH0A 4U67Q 1YTYA 2BRKA 4ZJLA 4RQ3A 4DCPB 2IHMA 3T1HF 1WBDA 3R7NB 1QD1A 5LMUK 2NRVA 4LD0A 1S9GB 3EKSA 1A0PA 2YTCA 4ZVPB 4FSVA 2FMPA 2F8KA 2KG0A 1SJ1A 4WFBL 3T1AA 2HAFA 2JLGA 2CNOB 3UVJA 4A4JA 4WF9L 1EP4B 3CC4S 9ICNA 3QERA 4M5DA 2DO4A 4KX5A 4PHDA 2I7NA 1VGYA 4IEIA 2GHPA 3F5TA 2LPEA 3N4QA 4BXOA 3QU9A 1RT3B 5I3UA 1YJ7A 1HYVA 3D2WA 8ICZA 2VOPA 2ETJA 3VQ5A 3OJUA 4I7FA 1N32K 1S0VA 3MMVA 3CYMA 4ID1A 3QB0A 2PFQA 3JPNA 2IC3B 3MMCB 3EMTA 4IOXA 2E1CA 2FHJD 4DPUA 2I1RA 5DMRA 4HT5A 4TNOA 5ALRA 3HPOA 4CIEA 5E5NA 2W41A 2DTUA 2MZQA 4M2YA 1TFYA 4I6AA 2MJNA 2F2AB 1WKKA 1TL1A 2YNGA 4K4SA 2X6NA 4Y2MA 4OI3A 1FWKA 4MFCA 1NLVA 2MZ1A 2HNYA 4EO6A 6FD1A 1FX4A 1CEZA 4Y2KA 4A8EA 3CCUN 1T6DA 1BPYA 2G8HA 3CJKA 4CHQA 5EE0A 3NXZA 3KKFA 1N62A 2KYZA 3ZD8A 1NJWA 3NCQA 3IDHA 4DTSA 1N34F 3RSEB 4NLNA 3OXGA 4DQSA 4QIEA 2ZBCA 1MROA 1PC4A 2MJUA 2FIUA 3FK4A 3UR0A 1XMOF 3CJCA 4B3MF 3NAEA 4LFBJ 4DV3K 3KTQA 4HDGA 5IM0A 3W9IA 5C5JA 4FZXC 3ED5A 1Q4RA 2ZGZA 4F93B 3HFVA 1ZM3A 4BY9C 5EE3A 2EBEA 1ZZFA 4A2AA 3R27A 1B64A 3F9KA 3CC7N 3H0RB 4YY3J 4FVUA 4FWMA 3LM2A 4PQUA 1EX4A 2EZZA 2D9PA 9ICCA 3IP0A 1WORA 8RUCA 8ICFA 5AKIA 2ZIVA 3HVRA 3JYTB 3R7SB 4B1XB 2UUCK 4WFBQ 2G5HB 1ED1A 2E5HA 4OPKA 3PO5A 2HFVA 2B9XA 1YVFA 1J97A 3MM7B 3PTWA 3RRGA 2XYGB 1UKUA 1NM2A 1L3TA 4XTTA 4WCEL 1LWXA 4CJLA 7FD1A 3KHYA 3OR2A 2BJ9A 3ZZPA 1NKEA 4QS7A 4USWA 1ZD5A 2PFNA 4DUYK 3P6YC 5AXLA 5J2QA 4QWCA 3Q8YA 4LRDA 4M42A 3CPEA 4CE9A 3NS5A 4MEXA 3S01A 4DX6A 3LPYA 2I38A 1WHWA 2V2ZA 4RU9A 2BANB 1Y3KA 3M7DA 4OJ3A 4YXJA 1TR0A 1CVJA 3CMAS 3BO4A 3PW7A 3RBDA 1YVUA 2J0SD 2OO4A 4H4KA 4PG4A 1SKUB 3TSPA 1NNDA 3OW2R 3FZFA 5AFUH 3IV6A 4Z4CA 4IQXA 2CQBA 1JXLA 2RQMA 4RQ4A 1EXQA 5MAOA 3V6DB 3A5NC 4R8UA 3ZDEA 3D45A 2HPUA 5J0YA 4Q0BB 2HZAA 2UUAJ 2NRZA 4RCHA 1LFPA 1SV0C 4BXOB 2AV5A 4M6WB 5CZVA 3U26A 2VZ9A 2B0GA 2CWKA 1Y00A 3E3XA 2C3OA 1TMMA 3AY9A 2IVMA 2N3LA 4J9QA 2P66A 3BZQA 2ODGA 3M8ZA 3MTKA 4Y1CA 5KG1A 5M2UA 4IBNA 2VODA 2M2BA 1KCFA 1RCXB 4M5JA 4MO5A 5KPZA 1XR5A 3CCRS 3TUJC 1AZSA 1R6VA 1NH8A 4L6V3 4JI4F 3S6EA 2UXBF 4H0VB 2GC8A 5E0OA 3N0VA 1A6LA 2D3UA 4EO8A 2JRZA 3UDEA 4CGDA 4WTYA 3NVKA 4BACA 1RWOB 4FE3A 2BCUA 5IWAJ 1I39A 4JI7K 3U4LA 3H7HB 2RDJA 2WW8A 4KV8B 5IIOA 2OTJN 4KLHA 1LCUA 2DVIA 3NUQA 4HACA 3ZSVA 1U0HA 3TEHB 5C7PA 2CQCA 2E7XA 1WF1A 4UAVA 3G82A 4DSIA 4B08A 4EUVA 4LF2A 4DX5A 1C1BA 3N5BA 5BRHA 3D54A 4RNHA 3MOJB 2I5HA 2XNQA 1W2BR 5E26A 2VKQA 1B43A 1FESA 2JJ4D 2R7OA 2A6AA 3S3MA 2YKMA 2LCWA 4FLXA 2VQEF 3OYBA 2ZKTA 4C2MA 1ZQCA 3CD7A 2BGWA 4IOAQ 1BQNA 2BJ1A 1HFEL 3SEOA 4JI5J 3W64A 1KTVA 1OY9A 4CQ1A 4CEQA 1WUAA 3SSRA 4UZCA 1IKVB 2FSJA 3KK1A 3D1QA 4RO0A 4R66A 3THXB 5J2NA 2HEKA 2K8AA 4DV4J 3SQIA 4DHVA 2E6MA 3CJAA 1AQ6A 3DMJA 1T3NA 4F67A 1WOSA 4O44A 1HD0A 2IY5B 2QI2A 5KPTA 4KGZB 3AO4A 3ZTPA 4X66K 4XH1A 4B1UB 2HBZB 2A41A 3OS1A 3GIIA 4QR2A 5DDPC 1J6ZA 4ELUA 3VVTA 5I42A 2KN7A 3CSKA 3THYA 3US5A 4C97A 5CYQA 4LF9K 4PHPA 2EK1A 2PO4A 4PZVA 1RT2B 1TVRA 1ZM4A 4KPCA 1NGAA 2DRBA 2W7PA 5L9XA 4FJNA 3EUB2 4FXWA 4W4MA 5D15A 2D1KA 4LH4A 1IQZA 3C1ZA 2HGMA 3WXKA 1KP6A 2K1RA 5L38A 1ZBUA 3SBGA 4PABA 1EXNA 3IM8A 4WXWA 2DNYA 3D66A 2P9NA 4JI0K 1RTDA 1HWJA 1UVKA 2CG4A 2KH9A 4EFHA 3NF7A 5T14A 4B9TA 4USVA 2HIYA 7ICIA 1QTNB 2XY8A 3B4MA 3OXLA 3V6DA 5D49A 2I6XA 1HR0J 2GIQA 2W2NP 1L3UA 4Q0BA 1SL1A 4B3SJ 8ICAA 4OJRA 3NGIA 4M45A 2IOHA 3PR5B 3TADC 5AQPA 4H5VA 3OYFA 2GQ2A 4DV3J 1DTTB 4IFYA 2CJKA 5AQSA 4PAAA 3IFEA 2NSBA 4FZMA 3OFEA 3WIUA 2JRSA 3UKRB 4OZ3A 5ALZA 4Y28C 3MOZA 4BE0A 2IIRA 3QO9B 2LQJA 1KVJA 1RA7A 5C10A 1RNHA 4BE2A 1TV6A 5JVGQ 1VQLS 1XSLA 3E51A 1C1CB 2MA1A 3TVYA 3UI3A 4LR7A 1X9MA 1OUQA 3FJ2A 2UUBF 2FD2A 4FLWA 4A57A 4HACB 1SQFA 1HNVB 3NWGA 3ZEUB 2HFUA 4FZLA 2IDOA 2Z2MA 2V51B 1HR0K 2GO8A 3PEHA 4AHTA 4MF2A 4HEA9 4RL1A 3QE9Y 2A5XA 4QAGA 1FTCA 4Y2JA 2A3VA 4CNQA 1LB2B 2BACA 3GJSB 4DV7K 1VJQA 1BPZA 1VSIA 2V2KA 4AE5A 1CC8A 2HFNA 2DNZA 3OTCA 3B78A 4BDYA 2FUG9 1ZD3A 1G7CB 5ELZA 3QSYB 4RBTA 1HL6A 3THXA 3V9ZA 1WC3A 3DOLA 2RHFA 3IWLA 2W9MA 3DMJB 2ROEA 3HSZA 2VYPA 1BC6A 2YH1A 3B54A 4ED1A 1ESVA 1HYZA 4BG9A 1HBMB 3PRBA 3MM9A 4RNOA 5BREA 3O3LA 4CEZA 1CJKB 3MPDA 2KG1A 4FF4A 1QM9A 5F0UA 4ISGA 2F40A 4JYAJ 2IM2A 3LPTA 4YDUC 3H6EA 2ROPA 1D8LA 1R0CB 4CE6A 4OYMA 1Q5VA 2P9KA 3RRKA 1RDRA 1LKYA 1U1LA 1NJIT 1VRQC 2WB1F 3M1FA 1RT2A 3KNGA 2BJ8A 3QESA 1ZQGA 1HKBA 3OFHA 2MY7A 3H1QA 1R6YA 2EEYA 3ENVA 2FGOA 1RDAA 4DL3A 2MKJA 1PK1B 3EICA 5CD4A 4F36A 3HSDA 3GP9A 2XQCA 1N8RT 2G2ZA 2GVDB 1CS4B 4A2BA 1LOUA 3HPHA 1Q1KA 3QETA 3I31A 3ZZ0A 4DR5F 2V8PA 4NV0A 4V19J 1YBTA 5F0XA 2AD9A 5F3XB 3IAS9 4XIUA 1VSFA 3D0IE 1AB8A 2DKOB 1ZQMA 2WVDA 3KDOA 2F8HA 4CJSA 4K7QA 3LH2S 3CCLS 3OYJA 2NZTA 3NFAA 3QIPA 3HM9A 3TJ9A 4F50A 4NEYA 9ICLA 3DLEB 5LXYA 4PA1A 3CF5Q 5TKYA 1GLDG 2GHVC 4LSNB 2JZBB 3DNCA 4Q2MA 4FP9A 5J1PA 3LP2B 3CC2N 3FC4A 4IUFA 5A0YA 1B4FA 1OVQA 3GL1A 2CNKB 4M47A 2HVEA 3D7EO 4YMMA 4K8RA 3ZSYA 4AQYK 1C7YA 1KXPA 4C8MA 3VF6A 1RT5B 3C3LA 3Q89A 3LP3A 1ZQZA 5HANA 3ZSZA 2DXDA 1N56A 2XMWA 5J0QA 4PHEA 4MH8A 1W26A 5KOXA 1IJFB 2CPIA 4CJVA 3T69A 2A1RA 3SCJE 2B6AB 3VOVA 1LW2A 3TRGA 3GONA 1L8LA 1FFSB 3RJFA 4FZZA 2RQ5A 4F4WA 4P4OA 3HULA 4U95A 3UM9A 2HNZB 2B5JB 3FMWA 2I5JB 3VN5A 5G4DA 3WX8A 2K7KA 3KJVA 4DTRA 5JICA 2YWWA 2J6TA 2LYBA 3R5CA 3PW5A 1U8WA 2VG5B 3VA0A 3LAMA 5B08A 2DITA 4BBYA 3TARA 4NXMJ 3A12A 2QN6B 3UPQA 4LRCA 4O4GA 3NLCA 4OIXA 1Q5YA 4C3LA 2GVZA 2F8SA 1OXJA 1RWWB 4CT8A 4KRFA 4CO5A 3I0RA 4RPFA 4DF8A 4RR5A 4LF6K 7AT1B 2PA3A 3P8BB 4WP3A 1L7NA 1ZS6A 3FFIB 1FJCA 4FYVB 4M0AA 4BGAA 2IHR1 3TTFA 2G13A 1Q79A 3NH2A 3AOAA 3C6UB 4MKVA 1FDBA 3DLKB 1JX4A 1WC4A 4CGZA 4C3MA 2XY6A 2BQ3A 2OEHA 1Q46A 4BDPA 2DGWA 4YD2A 3H4DA 1T7PA 3Q8VA 4PUOA 4Y2CA 4EYIB 4JI6J 4QOTA 5J0XA 1BISA 3AA2A 3KK2A 4A62A 1FIQA 2G8UA 4OKKA 3GIMA 3PVXA 3NGRA 5GADP 4JI3F 3D1OA 1RK8A 2G4BA 2HFSA 3KKSA 5IIJA 1REGX 4I2JA 2YNIA 3NRWA 2C28A 1WF2A 3C2PA 3KKRA 5JXSA 3KLEA 5JJBA 3MZIA 1ZQVA 2BW2A 2W2PP 4K42A 3R9KA 4DR3K 2ZWOA 5ALYA 4TSXA 3H3NO 5GAGI 3LALA 3LGHA 4LFBK 4C8OA 1Q86O 4PWUA 5EX0A 1Z00A 1BIUA 3MK6A 1X42A 4YG2A 4J2DA 1IBMK 1UAXA 3I96A 4YR3A 1B7YB 3V5RA 4UAYA 1VK0A 1HI8A 4M5HA 3WUHA 1CZBA 3QU5A 3IBWA 5DS7A 4QQBA 2QEXS 4IG0A 1Q3UA 2QLJB 1E6YA 4GXKA 3BSCA 5IM0B 3BQ2A 3WK9A 8ICOA 3G96A 1VQ6S 2N4DA 5L1LA 3UXPA 4CGIA 3P49B 1PAUB 3HHLD 3CC2S 1SI9A 1PAEX 4DUTA 2OEKA 2YHAA 5ADXH 2B8PA 3WBZA 4DU4A 2OPRB 2KZZA 1MA7A 3CJ7A 3JQKA 3U3GA 4R79A 2O4GA 4QBUA 4UB2A 4ETZA 4J2BA 1VQOS 2BQUA 4U7CA 3VAMA 4YDXA 4DR3J 2A3JA 5A8WA 1IBKJ 3BGUA 4OVLA 4CRJA 4DS5A 2V2QA 1QHTA 3A2FA 1PIEA 1IBKK 3CPWR 3OR2B 2VGMA 3TJAA 3BR8A 2A40A 3I8BA 3DOMB 4DB3A 4Y2TA 4KB0A 1LW2B 2DIUA 3HJVA 4JRQA 1IO2A 2EW9A 4RKUC 4HLBA 4RW8B 1DK2A 3CQYA 3FAHA 4AYBC 4DEZA 4CZCA 3GFKB 1UETA 2FB0A 1E6VA 3C16A 5KFGA 3DKDA 2C22A 2UXCK 2Q3SA 4MYUA 4ZLPA 1F5SA 4UUXA 4BC3A 4UOFA 5HL7L 3NGKA 2V6AA 5ETVA 3RAMA 1RABB 5HVGA 1L3KA 1RBSA 1SJRA 5JU5A 4M9JA 4JOUA 1K8KB 1HBNA 4O3OA 1OIAA 4MLHA 1RQLA 3TKAA 4J9PA 3VGTA 3JAMO 3P45B 2XHBA 1VQ9N 1WSHA 2KVCA 4JI1F 3I56S 1HPMA 1RZTA 3WXLA 3EN9A 4CEBA 3JTPA 2P6TA 1WC1A 3C6AA 5BR8J 4G1QB 3W5YA 4W5TA 3CCJN 2PYLA 2YX4A 2A2CA 3CMQA 4DFMA 3SBMA 1URNA 3FUYA 1BD6A 5KPRA 4Y2PA 5C12A 2QFJA 4QOZB 5LJWA 3T6JA 2JLEA 1VSEA 1X5OA 4O3QA 4MKYA 2KN4A 2QLXA 1V3SA 4UB4A 4DR2K 3PYFA 1YZ7A 1HQEB 5L1IA 2NXCA 3OR1A 1FE0A 3DLBA 2GWSA 2HS3A 2NLWA 2AYGA 4GY2B 3KVGA 2H3VA 4YQWA 3SDEB 4P4PA 4HCCA 3HHEA 5EE9A 1QVFR 5HRNA 2G8KA 4TU8A 4BGDA 3D5MA 2KDOA 3Q24A 1WOPA 2QL7B 1VQLN 2ZH5A 3CJ9A 3KWMA 4EHUA 2MQPA 3QT5A 1H0HB 5GADU 1OJ4A 2AJ1A 3DRRA 7ICNA 4AHCA 3W2VB 4BHQA 2ZWPA 2ZD1B 1EIYB 2VG7A 2A3ZA 2MRLA 5FIIA 2YX6A 4ENOA 8ICTA 3IWNC 3E0FA 2OMLA 1WEZA 4ECUA 1GXLA 5LSOA 2ACMA 3FCVA 5DDRC 1S4FA 4KGKA 2FBVA 4O9MA 1K9MO 3NS6A 1T02A 4P0PB 2FLPA 1K73O 4TQRA 2E1FA 2G06A 5DBBA 2F3NA 4YY3F 1RT1B 4AUKA 1XNQJ 4W5OA 3BF1A 1B4SA 2E6LA 1OQ3A 4PG5A 4CZJA 3MM8B 1S59A 2W9CB 4ED5A 2QZ8A 3C5GA 4N7TA 1H2VZ 4RZRA 2A10A 4JI0F 1QUVA 2CQGA 2QT7A 3OT9A 2WMMA 2P9SA 4IRKA 3ENWA 3UQ0A 4ZKAA 4LFCJ 2PEHA 4FWKA 3AXKA 4M5LA 4L75A 2Y3YA 1VQ8S 3H8MA 2VASA 5DGAA 1QS4A 3M8SA 4DV1J 2XI2A 5AQRA 3RJJA 9ICVA 1NU4A 3OBWA 1RHUB 1HNXK 3OSNA 4DV1K 2MLZA 5BRFA 1JJ2R 1HJOA 4IDHA 3DOMA 4FM2A 2YKAA 2UU9F 3PIPQ 4X65J 1F21A 4YN3B 3BF4A 2E20A 4CF5A 1KKHA 2F7VA 4NLOA 4LF5K 2VPYB 4IOCQ 3J80Y 2K4HA 1E6VB 3C16B 4KHRA 3O44A 5ETKA 1UEUA 1X3MA 3M1VB 5AFUA 5KFAA 2ZJQQ 1B3TA 4DQ8A 1NG9A 1JWWA 1FVSA 5BPMA 2OD6A 3RB0A 5AZIA 4ZP9A 2WAQC 4N77A 4I2BA 1RFQA 1RQNA 3F5AA 4RNFA 1FRHA 2NXUA 1HBNB 4DR1J 1IJEB 4G65A 2DHGA 5C2CA 1CRXA 4OHZA 4F3OA 1BI4A 2D9OA 4OL8A 3BBCA 1HBOA 4IQMA 4M8LA 2NYHA 4RQ0A 4NL5A 1UPMB 1Z4UA 4WJBA 4FLTA 2KQ2A 1SC3B 3HVTB 3QBCA 5CA5A 4HTLA 2HNDA 3PYDA 2V9WA 1L7OA 3CD6S 3CDAA 2ZUBA 3A3PB 2XHWA 3B82A 3HT0A 2BKEA 3UN2A 2X6SA 1D9FA 3ISZA 3DU5A 1YLXA 4OZ1A 4NXNF 4CECA 4KYZA 3UFCX 2W4PA 4YY3K 1AT1B 4FJMA 5EWEA 1BWEA 2P1JA 2RP5A 3M6UA 1FKAF 3JS6A 1F0XA 1XMQK 2QWOA 3OTEA 2WC9A 1CULA 1VBKA 1AFIA 1N4LA 3SENA 3KOOA 4BQZA 1IBLF 3BEXA 2FBXA 4ZK7M 1HLUA 1S3XA 4A47A 4CJ7A 1J5OA 1RB0A 2NXJA 5J8YC 2VKZG 5IV3A 3RFAA 2DEJA 4EK2A 4FLUA 1CXQA 2MKCA 4EFAC 1KQKA 4JI8J 4MFBB 5KRSA 2ZD1A 3OJSA 3JPQA 3SQ0A 1HWUA 1TTHB 4DL2A 2GCFA 2HWIA 4ITSA 2CKWA 3UMGA 1H7WA 3QLHA 3PG9A 1EKEA 1ZQUA 2ZC3A 2QB0A 3HI9A 5CH7B 4MKAA 4AM7A 2O8FA 2VQFK 2ZJ8A 5HHHA 3CEDA 1PKUA 2L08A 4ANDA 5AQNA 1RTHA 5DZ7A 3J7ZT 1Y88A 4QR1A 2ZM6K 1MSWD 4CF8A 1RKIA 3R3TA 2WVFA 1S1VA 3VPZA 3M1YA 4M3RA 3H4BA 5HQLA 3OV7A 2HMIA 5AXMA 1PVQA 1C0FA 5DG7A 1YDLA 4RQ6A 2C2DA 4OYAA 4EX6A 5GVQA 1NHVA 1U2FA 3UW1A 1A5WA 4FF2A 2YMQA 4AD6A 1H74A 4KE5A 4BVOA 4FJLA 5AKJA 2OTLS 2OSQA 3B0XA 1SZ2A 3TSQA 2JWKA 1H3DA 2BZ2A 3M6GA 3IWXA 5FRNA 1OO0B 3BS9A 4N8OA 3QJJA 4CFAA 2FF3B 2BM0A 2CPXA 1P8ZA 2OHFA 4ZPBA 3NF6A 3PIPL 1NGFA 4GVBA 3M32B 3MHYA 4RX6A 4MIBA 2HIQA 3HVAA 2XS2A 1PK1A 1HW9A 1RHMB 3H5SA 4KH6A 3TZYA 3CO9A 2ZDOA 3RB6A 1BCOA 5J2FA 2HMXA 1U2VB 2V0NA 1U6BA 6FDRA 4X64K 4WWSA 2E1EA 3ULDA 3THVA 4KHPK 4DV2J 2L3MA 4CJQA 3SQOP 4M5MA 4CD3A 1K5OA 1ZM2A 4KLUA 1SIWB 2Q0ZX 3TWZA 2LYHA 3IP4B 1ZBIA 2PFFB 1U1OA 2WB1C 3ADAC 2P9LA 3MAHA 4ZPWR 4JKAA 2N4CA 3HD1A 2BR0A 3PDNA 3CJ3A 3OL7A 4LJXA 8ICGA 2UXCF 8ICMA 4JI0J 5K4LA 2JEFA 4JI5K 4JHDB 2FY8A 4CO4A 2ZBPA 4ZVGA 4KB7A 5T7BA 2Z7JA 1NGIA 1URJA 1FRKA 5AQWA 3D6FB 1KL9A 3RMAA 4BCAA 4OFZA 2ITGA 1LV5A 5DDYA 1ZQJA 2E29A 4NASA 8ATCB 5IT4A 3ETRA 1X5TA 3ZDBA 4GO5X 1PUZA 1JALA 2BM1A 2R9LA 3BEGB 4JS4A 2EAOA 3MXHP 3L2QA 2V9KA 1HNIB 2B8QA 1Q3VA 4I68A 3AJ1A 1QTMA 1FRIA 1RDDA 1DZ5A 4FCYA 4IJNA 3NKYA 5KT3A 1FJGF 4LF4F 2YY6A 5D4NA 1G99A 3V81A 1SL0A 3VEZA 4CJFA 2H51B 2VPWB 1PYSB 1HARA 2W6KA 1OYDA 2KT2A 4KC5A 4OLAA 5TISU 3PMLA 2ASYA 5D4LA 3HRGA 4G9BA 3Q8PB 2VDHA 1QSLA 3V2UC 2DKZA 2AMCB 1FRXA 5B5EU 4FZVA 5CB1A 3ISDA 2B56A 3VQTA 2MKSA 4MEYA 2XWXA 3ZO7A 2QB0B 5DGBA 9ICUA 2WOMB 5B0EA 4LR8A 4MDBA 2HCFA 2WHEA 4CZMA 3MGIA 5IS2A 4DLGA 2O8DA 3O4NA 2XSJA 2AXTU 1GLJO 2Z2LA 5C2DA 9ICQA 2GWKA 1MWZA 4ED6A 4LF1A 3MDFA 3ZLJA 3IUCA 4KO0B 1N48A 4DUZF 2MGZB 3WC2A 4NE9C 3GE9A 5DDQC 4ZTFA 5FDLA 2DPJA 1S57A 3HSGA 4Y2RA 3Q7CA 5C42B 4ACOA 1O6XA 4EZ9A 9ICBA 5AQXA 2HSZA 3QEBZ 3QT6A 5H1SQ 3FRZA 4NI2B 3KK2B 3N4PA 2NO5A 2CFXA 2IS3A 1BY9A 5KFDA 1S72S 2ATCB 4PXEA 1O51A 3LWLA 1RDFA 3W3SA 5KFYA 3C15B 3SSQA 4GVEA 4OZ5A 4OX9J 1BA1A 4MT1A 3C6TB 4YOVA 3KUGA 2JC0A 3SUNA 3CFOA 2DIVA 2HZCA 2Y8YA 4CT9A 4UZBA 1BNOA 2W6LA 3VESA 5CABA 1ZQSA 1BDGA 4I6WA 4W5NA 4ZIVA 2RS2A 3KHHA 2D74B 4CDIA 4TQSA 2FI1A 5KFFA 1YJ9S 2V5HG 1FJGK 2C1EB 2OP5A 2IAJA 2ASPA 4HTJA 1ZBSA 1FDDA 1GOAA 3NEKA 1VSMA 5GIPA 2R2UA 4HR2A 4BDZA 2HS0A 5KG3A 7ICPA 3MEDA 4OJOA 2CQ2A 2QX0A 3TVZA 4KLIA 3S41A 2E88A 1SH3A 5F8LA 3BGOP 2CJBA 5EY4A 1YT3A 2QE5A 4JHDA 2J0WA 5AKHA 2H3EB 4NXMF 4QZDA 1XO0A 3OXFA 4LBPA 3MWBA 4DR5K 2PDAA 4OPJA 3AU6A 7ICMA 4E8UA 4DR5J 3CDEA 4CO1A 2CGKA 3MPYA 1KVKA 5M1PA 1TP7A 1U2CA 1OPIA 4E7LA 3GV7B 3JTOA 4FYXB 2XZDB 2DNHA 5LOQA 3T3FA 1NB2A 4DWIA 2UXCJ 4RW6A 4I6MA 3IS9B 3QPIA 3THPA 2HOFA 4CGHA 1H7XA 1PBUA 2ZH6A 1ASVA 2Y1IA 1SS6A 1V38A 2X1BA 5HATA 1I51B 3M30B 4JD2B 2FBTA 2FSKA 1L6NA 4Q43A 3AL0B 1Y3JA 2GBZA 2Q4TA 2GELA 3KWGA 2HF4A 4CEOA 5C15A 1JLAA 1XNRK 2G07A 1RT7B 1TKZB 2W01A 2ILZA 3POTA 1R8PA 1NSKL 2HHHK 3DXSX 4ATNA 2G8WA 3EKUA 1H2UX 2IPOB 3B8AX 1T9TA 4PL7A 2LQ8A 3GWCA 4L72B 5BOMA 3NS1A 4IQWA 4O5BA 4WBFA 4AXIA 5HLFB 2NPFA 3UPFA 3HBTA 3KD1E 4WKYA 4LVOP 2BUPA 5CZ1A 1J2MA 3M4XA 3N6MA 1AROP 3BN7A 4IO8A 4CJEA 2CG8A 2HOEA 3PW2A 2UXBJ 4KJIA 2G0JA 3MR7A 2RD5C 4FO6A 1GX6A 4GKKF 3M8WA 3O1WA 4O55A 4IEEA 1L3SA 4OZ2A 4ZTJA 2D0BA 2QTWA 4MKBA 4GW6A 3CGIA 1UVNA 4QPXA 3VEWA 2W8LA 2YHYA 4FLVA 1ZOLA 2KIWA 4K4IA 1C20A 3QEPA 1CJUA 3T5JA 3C95A 3MMAA 1S1TA 2XS7A 1NMNA 2VJUA 3CHWA 3UMBA 4CGGA 4WFYA 3KNAA 4DV4F 2NSCA 3G2XA 2V4JA 1OY8A 4X4PA 3DGPA 5EX5A 2DHHA 2LEBA 2FPKA 3N6LA 3WKDA 3CCLN 3OTOF 4DR3F 2IVYA 4U8VA 2M88A 3KLHA 1HNZK 4PZNA 3QWUA 4M5DB 1TVAA 4Z4GA 3GOIA 2E1MC 4MF8A 2H5IB 4DV5K 1SL2A 4EHTA 4AHUA 7ICVA 3P38A 3LTOA 1KQSM 4IR1A 5B0DA 1HW8A 3OTQA 4D3GA 1A6SA 3O8WA 4ZPAA 1Q7YT 3AAWB 4JK9A 4PEOA 2WF6A 4DR4J 2M70A 4CH7A 3R2DJ 2LEAA 2VUGA 1N5XA 2DBBA 4BQLA 4N76A 1QE1A 3BPDA 2F9TA 3HKWA 2NR0A 3RAQA 3X3UA 2I6WA 4O4RA 4LFAF 1CJTB 5ALQA 3HKZF 4PR6A 4ILMA 4QW8A 3H2VE 3TWHA 4H5WA 5IQ6A 1Y7PA 5ALVA 1TL1B 3EDRB 1KRPA 2R42A 3F73A 4DR1K 2X3DA 3UXNA 2HG4A 2OPPB 1EP4A 4FL9A 5A0LA 5M1NA 4UAUA 2CA9A 1ZA2B 2P6RA 5E3CA 4ELTA 1MWYA 4LF4K 2KFNA 3C28A 3CD5A 4MN4C 3D2NA 3OBIA 5J2MA 1HHQA 4A8MP 3SNNA 3ZYYX 2RU9A 1TKTA 3Q8UA 1VQNN 5KFBA 3PY8A 1BI4B 1TUWA 4GNIA 3IXQA 1P1LA 3QRPA 4FWSA 2E44A 4A59A 2E5LJ 2HBRB 1BWVA 3JS9A 4DO9A 1SCJB 2VONA 4H4KC 1UEVA 4RLEA 4OPHA 5GTIU 3D9BA 3O4WA 3JTNA 2YWHA 4AHRA 2BH1A 1JRPA 1ZC6A 3R5JB 2J7WA 1F5CA 3BKFA 4LC9B 4XA5A 4OX7A 3QT8A 2DNLA 5HVFA 2E9TA 5KG7A 1PVRA 3I82A 2J6UA 4NLUA 5KFRA 4H0XB 4B1ZA 2JNJA 3Q23A 5BJRA 1DXSA 1IXKA 2FZKB 2C2KB 2W42A 2ZIVB 1RWNB 4ZLLA 4RQ7A 1ZXIA 3I5AA 3RJEA 2DR6A 1RT4A 1FERA 4JP8A 4R0EA 1SAZA 1CULB 3MCSA 3K17A 5TKWA 2IM3A 4DV6F 4J91A 3FYHA 4G3IA 1VQ7N 3ZZZA 2QIFA 3UN3A 5CCLA 2CJ9A 4ED7A 1M1GA 1S0OA 1LOTB 9ICWA 9RUBA 4RNNA 2L48A 4JI2K 3IR5B 4DQRA 1Q9YA 1FI4A 4MFBA 5AQQA 3M8PA 3OLAA 3P3DA 2VHGA 1G6BA 2E5LK 4X84A 8ICIA 3SR6A 5B8HA 3JSMB 4DFPA 2H4YB 4YMOA 3AGKA 5ETOA 5JVGL 5DB6A 1VOMA 4KBIA 5AQKA 2O8FB 4LF7F 1X5SA 2JWNA 1IV8A 3AVMA 3UQSA 3M6ZA 4A48A 4F4AA 2WSCC 1RTHB 3QDKA 5GMDA 2RHQB 2Y8WA 4JK1A 3NMAA 3THWB 3I0RB 1ZQXA 4EP4A 1WI8A 4R8UB 1V5IB 1X60A 4DR6F 2W04A 2ASDA 3L4QA 5I3PA 1LAWA 4RTFD 5GMKa 1U1QA 2B4JA 2POKA 2HHHJ 5D4PA 1HHTP 2GNKA 4P72A 2ISOA 2WCXA 3TA0A 4QZAA 3QYPA 1K8AT 3NGSA 2MKHA 2C2MB 2E1RA 4DHYA 2FMSA 3DAWA 4WTOB 2ZHBA 2QLTA 4YD1A 5ALJA 2BCVA 4FN5A 3NVMA 3WK5A 2DR5A 4JI7J 3AVKA 2DK2A 1GX5A 1VLOA 1E4FT 4JV2A 5CHIA 4DR2J 1N6QA 1SC6A 1GLAG 3MDAA 4OZNA 1T9VA 4IR9A 5IT9U 3VCDA 4DN9A 4C9DA 3SQ4A 2EI5A 2ZIXA 3HZGA 4I1TA 2DGZA 3J7YU 1P6TA 2C2ZB 4U96A 3T5KA 2YX1A 2AQ4A 2P2CB 1GEHA 3R6LB 1PBAA 1U0HB 1S6QA 1RUSA 3LPUA 2KVQE 4DV0K 3ZDDA 2PFOA 4F72A 2AJFE 4PJ0U 2ZXIA 3R8YA 1JXEA 3I1YA 2MSNA 1HNXF 5F41A 3WEEB 1XR6A 3D0HE 4LQ9A 2BXJA 4DCCA 1K47A 1U48A 1TKTB 3L2UA 1V9PA 1F1BB 3I9ZA 3LAKA 2JH1A 1VQNS 2KKVA 1CI4A 2HVHA 1XS9D 2UU9K 2XCPA 4N5SA 4DR4F 3TAFA 1S5LU 1UT8A 1ZYQA 1ZPVA 4WPAA 2QMWA 2LA6A 2ZUAA 3W63A 1A9NB 1YF5L 3AHPA 2MYFA 2LXIA 7ICEA 4YR0A 1CJVA 3PM9A 1IKVA 8ICEA 4IO1A 4DSKA 4MDAA 1YJUA 4F4XA 2Y9UA 1RHKB 2P9GA 2EHGA 4URGA 3RB4A 1WSEA 1FWPA 4UOGA 4DS4A 3DU6A 1QY7A 3RJHA 3EEQA 3RW6A 1SZPA 9ICFA 2RKIB 1ZXOA 3O5TB 4BR4A 2IVPA 2QKKA 3DGVA 4R5PB 2JHDA 2B43A 4C0HA 5AJ3J 1JL2A 1F9EB 4HI1A 3CF5L 4C4SA 3QFWA 2F9WA 4RWXA 4Z37A 4CVNE 1HNIA 2O8EA 2KI2A 5FD1A 3RJMB 2DBYA 4AM6A 3G82B 2V7YA 2Q97A 3VV2B 4BLGA 4NO7A 1Y4ZB 4NB4A 2IYIA 1VQ7S 4HUGA 2KL8A 4FPBA 2PI5A 4LRBA 3FR0A 1SIJA 1X9XA 2XWYA 2YMMA 3KLFB 4FWPA 1KC8O 3O9RA 2F44A 1UW9A 1S5ZA 2NO4A 2DKXA 1NK4A 2A1JA 4XAKA 4WCEQ 2MLYA 1ZBHA 2V69A 2EC0A 2Z30B 4A8WA 1IR0A 4CIFA 4LFAJ 1T03A 5AKZA 1BQMA 9ICMA 4RQ5A 4IZ9A 2A6MA 2O8DB 4BRCA 3NVWA 3M8QB 2OA8A 1IM6A 1LWCA 2VH7A 4PWWA 3N7SC 2P6SA 4DR7F 4JK8A 2RLTA 4GXIA 2GS8A 2EK6A 2W7AA 2MGZA 1SJ3P 2B6GA 1SKSA 1GXUA 1FJEB 1FCAA 4F91B 4G1QA 5I42B 1R0AA 4WFAL 4ZHRA 2VBZA 2HOIA 1N0VC 3AVIA 1DTTA 1FWLA 3ZI4A 4IFYB 2FJXA 4DU7A 3AXMA 4Z4FA 2IDLA 4UB3A 4I27A 2CDQA 1UWBB 1RDUA 2VJ4A 1RGVA 4DQPA 5IZHA 4OJLA 4USAA 4XPCA 1GXTA 3WHIA 3HP9A 2E8NA 2ZGYA 1ULRA 3E8OA 2JHEA 1QQOA 4PY5A 3ISBA 2GO7A 1OW5A 3EWGA 3CUNA 4I2PA 2FE9A 4M04A 4H0PA 3G8SA 1M5SA 4ISEA 4OX9F 2KJ9A 4DLEA 2HF3A 2G2OA 3HHDA 4QU7A 4JKFA 1BMQB 3DLLQ 1HNVA 3AD7C 3CNQP 3KG0A 4IS7A 1N5YB 1YVNA 4ZVUB 4FZNA 1OS5A 2RJZA 4FXDA 3F2DA 4HHHA 1CLQA 1DT9A 3QEAZ 4F0KA 4PCQA 2A2DA 3FKBA 3QEWA 3CNHA 3QYYA 1DK3A 1QVFM 3G9CA 4DCOB 1C2PA 5KG0A 1AXQA 4YB6A 5AQFA 3I55S 1EZZB 2KXHA 3P5BP 1HLWA 5C24B 3T7ZA 4ECXA 3J81Y 3W65A 2GW8A 1WUDA 1ZQYA 3V7JA 3RJIA 2C3YA 3VQEA 3ZX2A 3BDEA 1CJVB 2EZYA 1Z19A 5ALTA 3C2KA 3ITHA 1M5KC 5E3QA 2R7SA 1ZBFA 4BRHA 4C0ZA 4NLYA 2FTRA 4YMNA 4NEZA 2BCQA 4US8A 2VD3A 3O9TA 9ICAA 1GFWB 3T1HJ 4FKXA 4GFJA 1HUXA 4L73A 3KJNB 2ZH2A 1Y10A 2BA9A 2VG6A 3AJDA 1YHQN 2RB7A 2P6UA 2L9WA 4PHTX 1JJHA 2I8EA 1W25A 3AVBA 2WTFA 2E5SA 4MIAA 3MEEA 1HHSA 4RW6B 4I6MB 2FXUA 5DB9A 3W1YC 3V7KA 3FEYB 5DB8A 3GTYX 3F9MA 4OJ1A 4DX8H 1RYUA 1ZBLA 3Q2TC 5KT6A 1S12A 3QGGA 5AQMA 3DCAA 5AIBA 3FCWA 2E2PA 3CCQS 1Z05A 2A1JB 3CULA 1FXLA 3GZ7A 4DR7J 1T3VA 3E9PA 4CZHA 5J2PB 1N36J 4CK2A 2FYXA 2HQ3A 4IDKB 1RLCL 3FBCA 3LP0A 4KH1B 4YP3A 1WHYA 2FVQA 4BJQA 1F60B 2XVTA 3NAHA 3CMEN 4DV0J 4AQYJ 4M3WA 5J0OA 3M8QA 2NRTA 2MZTA 5HMLA 5G5HA 4H0OA 3TAMA 3ZETA 3TANA 2R8GA 4CJPA 3MD3A 3W62A 3EJMA 3QQCD 4DJBA 3SUOA 2GO9A 2KM8C 1X2IA 3OA9A 2C3UA 4AHVA 3UKUA 4P0QB 2KTQA 3OVSA 5CHCB 2LECA 3CM5A 4BR5A 2E5GA 3MDCA 2FLOA 3C19A 1UWBA 1K44A 3VAGA 1ZQDA 4NWBA 4FOEA 1IBKF 4RW9A 4O5CA 2VFUA 3C14B 1CC7A 3FZBA 1BNPA 4KFBA 3OYKA 3K4GA 4CLZA 4K4VA 3TUZC 3CJ0A 3UCZP 4NJ8A 3L4PA 2LBOA 1S1UA 2KLAA 2V52B 1S9FA 1T05B 3OTOJ 2ZH8A 1CJUB 2EFPA 4YB5A 5J0PA 1M1KO 3C8YA 3DRXA 4J90A 4P4MA 5D78A 4M94A 3EXCX 2GAHC 3LP2A 1Q9XA 2B9YA 1NJXA 3I5CA 3L2RA 2IFXA 7ICUA 2OPQB 1N5VA 2AWZA 2KVSA 3V4MA 1TAUA 2AA4A 1DRGA 4FYWB 1U09A 1RT5A 3C2LA 1Q95G 3DXMB 3GG1A 5E7OB 3TZWA 2KOBA 3C65A 4NM1A 1LWEA 5H9EK 3DRSA 1X1PA 3QEVA 3V9WA 3F2CA 4MTPA 2G9OA 5KRTA 4CO0A 3HI0A 1O5JA 2RUGA 3VVUA 4YB7A 2F8EX 3UDVA 2WF5A 4M3YA 4JYAF 4HTIA 1RDWX 5HRPA 4CERA 1V97A 2WSFC 3VQCA 4ANEA 3IDWA 1CZAN 3ALYA 2PZSA 2B7CB 5A6WA 1SC1B 5CP2A 8ICQA 4CEDA 4CFCA 4TYAA 4E1MA 3K57A 1U1NA 3OQ2A 1KD1O 1CJTA 4CLLA 3LW5C 3MDQA 2BKPA 4F2RA 2W4CA 3FVYA 4GC6A 3EYZA 3GU0A 3EZ5A 3WQUA 2KICA 2G2YA 4KGXB 1YRTA 1S6OA 3JQJA 5IC6B 5CZXA 4M3XA 1T9XA 4CO2A 4RW4A 1F3VA 4KAIA 4UW9A 3C29A 3QFPA 1BLUA 1G3OA 4NXNJ 3B8HA 1D5AA 2AP6A 4DOBA 4NM2A 4IYQA 4IG0B 2CQ0A 4WE1B 1KLMA 4ECWA 2MZRA 4OV6A 1K9MT 1UHUA 4PUOB 1TE2A 5KT5A 1PGZA 1VQKN 3GJQB 4LY7A 1U25A 2KRBA 4E7IA 2E66A 2QRRA 4JKDA 5EOZA 4CEEA 2RMLA 3D2EA 2I9SA 3AT1B 4LF7K 2A19A 4I2QA 2I1QA 4DTXA 9ICSA 4YOWA 2E7WA 4A8SA 5KNIA 4NLWA 2F1FA 4R64A 3IGNA 4KV8A 2RPIA 2NV3A 1H38A 1UJ5A 1FK9B 3W8GA 1KQQA 1Y97A 2FVSA 4B3MJ 3C5FA 2VL1A 4X4TA 3ZDCA 1BWFO 2E8PA 2DNRA 3MXJA 3C14A 1IKWA 2DEIA 1RBLA 1VI7A 1ECWA 1YI2S 5GAGU 2IA6A 4W90B 3V81B 3LGMA 3IRUA 2Q6CA 1D8YA 3MABA 2D8CA 3SUQA 2PE8A 3DN9A 3CFPA 3B6OA 2YKMB 1MWMA 3TNVA 1S0NA 4IWVA 2ROGA 1R8HA 4YHHJ 2KHCA 4H5TA 2QWRA 1OQ6A 3MBYA 4ETXA 2LM4A 1SIZA 3JSMA 4GKKK 2CUYA 3KK1B 2YTUA 4YHHK 1XMQF 3H0PA 3ATVA 4H4OB 2QWNA 1VHIA 1ZAVA 4A5AA 2V68A 3PMNA 2NUUG 5ETTA 2QKBA 3J7AP 2RUSA 4KLQA 4QR0A 4X64J 4PYAA 4FK2A 4F71A 1RJJA 3U9DA 1U45A 2JGAA 4RWWA 3VC8A 4H8KA 3F53A 2BCSA 3VCBA 5DBAA 4C3KA 3NG8A 1Q82T 2DR8A 8ICPA 2CZ4A 4AQYF 1VQMN 4ID5B 4M1KA 3KK7A 5IIMA 5HSPA 2BKNA 2XO7A 3ZZOA 4IKFA 4IQTA 4USUA 2Q31A 3SPYA 4RNMA 3AV9A 2CPRA 4J9KA 4K5RA 1HNWK 1KN5A 4DL7A 1HQEA 2VIHA 2A1SA 4AP9A 1EKRA 1U7LA 3GZFA 1L5UA 1JUDA 1D9AA 3OVAA 2UUCF 1N0UA 3SDEA 1HNZF 4N8NA 2W11A 1WHXA 3U7JA 5JS2A 5B66U 5CWRA 1JLEB 1I1GA 4A5BA 1N34K 2GWJA 1X5PA 4WQ4C 2Y0SF 4UB5A 1XMOK 1V4SA 1NNLA 2ZE2B 4NYNA 2RHSB 5IT9O 2J6SA 3FQLA 1N34J 2WBMA 2FJVA 4JI3J 1IM4A 1X4FA 5DZ6A 2XMMA 1YKWA 3H8SA 1S5JA 1WACA 3KIOA 5F9LA 1ZQPA 4OMFG 3I9V9 4B9MA 2FJEB 4F9OA 2RQ4A 2E4LA 7ICOA 1IG9A 4L3KA 1F5AA 1RQ0A 3PSIA 2DY4A 1RT1A 1RYSA 1TFWA 1DAXA 2GUPA 5AM2A 1HNWJ 1WEYA 4DFJA 3UKRA 5AJ3K 4FBTA 4DL0C 2LYAA 1WOQA 4E2FB 3H08A 4WIIA 5JLFA 4CHZA 2CQPA 2DFEA 4HKQA 4LF6J 1UWAA 3NMUA 4RUHA 8ICJA 4K2XA 2BVZA 1HNXJ 4M3UA 2RKIA 1RGIA 5KFQA 2QSFA 3LO3A 2XSFA 5AK4A 2PSZA 3VZIA 3TA2A 2Y1RI 1GQEA 2BCRA 3LANA 2AEJA 3HILA 1JJCB 2ES6A 2EFQA 1WSFA 1JI7A 5AKLA 4URSA 2E5IA 1GTHA 4JI3K 1T6CA 5I4MA 3HOSA 1WLJA 2W54A 5DM7Q 3NRZA 3K0SA 2IRUA 2KM8B 2PKEA 1COKA 2FBYA 1WCLA 1T0TV 1MQ3A 4IOBA 2VWKA 1RCHA 3VGLA 2DHAA 1FEZA 2K06A 3CCSS 2VWJA 2DR7A 3MF5A 1XR7A 4B8CA 4M7YA 4MFAA 2FLLA 1RBRA 2RF2B 1VLYA 1FRMA 2QA1A 4UBCA 4JI7F 3H46O 2E8OA 4M9LA 2X74A 1RBVA 1Q0NA 4DUYJ 3E9OA 3CVKA 3PNCA 4KLLA 1JQGA 3MM8A 4UTGA 2F4VJ 5F8HA 3W9JA 3QNWB 2PY5A 2VBYA 2BJ3A 3A8EA 3GR1A 4J2EA 3PFEA 4E7HA 3DOLB 4PKGA 2P9SB 1IH7A 5BYQA 2FDNA 3WKAA 3BH7B 2LYVA 3QWPA 1O1WA 3LP1B 3K5PA 2M7SA 5F8IA 2AP1A 3RB3A 4RPZA 1JKHB 5KOWA 1UCVA 3R5DA 1WC0A 1RM6C 3QIOA 3TAQA 1V3ZA 4E7KA 3RR7A 3H5XA 4ZHRB 3QNOA 1B70B 3VA3A 4OI4A 3T5HA 4G1IA 5GAHP 1C1AA 4BR2A 5KFCA 4LZGA 4B02A 3K1RB 3OPKA 1KEJA 3GV5B 3ALRA 2GVDA 1TFRA 4J9NA 2DPIA 3GQCA 4E1JA 4LREA 5IV4A 1Q7LB 1F3FA 3U02A 3IFRA 4NYZA 5AZIB 4DUZJ 2DL0A 3CT9A 3ZX3A 2Y0SD 2G1DA 2V8DA 4B6JA 2CGLA 3RU0A 2DTJA 4CJ5A 2OANA 1HIWA 3OBYA 3LA0A 4B9SA 3ONQA 1VQ9S 3QIPB 3OS2A 3MCNA 2Q1LA 2DRAA 4FJXA 2VPZB 5KG2A 4JS5A 2Z1IA 1T95A 3WK4A 2HFOA 1HPZA 4JKEA 1GK8A 4EBDA 1QH9A 4I28A 4ZLJA 1LW0B 1EB0A 2QEXN 4USIA 5HJYA 4RQ2A 1HIYA 4EI2A 4P2XA 2KE7A 3VAKA 1SJQA 2XY7A 2CPEA 3ISCA 2EKNA 4MK7A 3BQ1A 2QWPA 4NPOA 2YXLA 1NZBA 3RH6A 3PX6A 3AOBA 2XNRA 1L3VA 3KOAA 2OFHX 3U1NA 3K5LA 2YHXA 3T1YJ 5KG6A 3C1YA 2MTLA 2E8AA 1REVB 4DG1B 3GYXB 2FMQA 1X9SA 5HI7A 5IOLA 1XNQK 9ICOA 1VS3A 5AKGA 1VQON 5IINA 2D7SA 3VAHA 1FD2A 4GKJF 2RSQA 3OW2M 1RTJA 3SUPA 1RACB 4H5NA 3S1TA 2FVCA 4BRAA 1FO1A 2OZMA 2W2QP 1TKXB 2KHQA 2CGJA 2UUBJ 3S6JA 3D2SA 1N33F 4U6PA 1ZQTA 4O3MA 3M32A 3CCSN 4CLYA 4ELVA 4LIRA 4IH6A 4LF9J 1RAAB 3BBBA 1DEJA 5FROA 1FNMA 2ZFHA 2UVWA 4I9LA 3MXIA 2HRUA 4F3MA 3VF4A 3GG0A 1FFGB 2CRLA 1UVJA 3TUPA 4Y2XA 4O8UA 4KKOA 3FCHA 2MQQA 4DTJA 1MU2B 3C7NA 1YJ9N 4NZ6A 1TK8A 5LM7E 5B7WA 1XMOJ 2DRDA 5LL6Z 2VC0A 3LP0B 1EETA 3PRVA 1Y64A 4K4TA 2WONB 2LMRA 4JV5J 3U8XA 4FK0A 3KLVA 4UATA 3HK2A 1S10A 1TAQA 1ZETA 3VQAA 5KFEA 1WC6A 2C2EA 2ZOMA 2J7KA 2ZTCA 2UU9J 2XM3A 2X51A 4PXDA 1Z3EB 3IA0A 1HQ2A 1EKSA 3L2WA 1JB0C 2Q1NA 1YSJA 1Y5IB 4QYZK 4CK3A 5K9FA 1L7MA 5KL1B 2JEGA 3K8VA 1RKJA 2F4VF 4Y65A 2NUHA 3SD7A 3ORYA 2COLA 4FWQA 2UUBK 2YPZA 5CEHA 3TFSA 1SKRA 5GIOA 3AA4A 1WTFA 3VENA 3ASMA 1HNZJ 4CZKA 3A0IX 4LFCF 1TGOA 3WK6A 2ZH9A 2CAJA 4DQIA 3GFZA 3MI7X 1B0VA 4DV5J 3WZ0A 2P9UA 4FFDA 4ZVTB 3ZFVA 2EZXA 4DKWA 2WF9A 2R2SA 5FLXO 1PZNA 4P9SA 5DDOC 4QS9A 1E3MA 1C1BB 2CPYA 2IM0A 2Q36A 2HAIA 1DHMA 2JEJA 4PYDA 2YY3A 3HVWA 1ZQAA 3V1OA 4Q7AA 3O1LA 3G4SN 2YHWA 3M6XA 3J80U 1KVAA 1RAJA 1BHNA 1SXEA 1JLBA 5KGWA 3LDAA 4OI2A 1RADB 5LXRA 3EE9A 4AYBF 2W8KA 3SMPA 5KFVA 5DK5A 4E89A 2RRAA 4QYZJ 2XICA 1DJ0A 2V2VA 3SCIE 4O23A 3QU7A 2UVUA 3H3OB 2G09A 4BREA 2GIFA 3TZXA 3Q22A 1LKZA 1J27A 3PEJA 2EAPA 5H9FJ 4F4KA 2HRYA 3AVAA 3MM6A 2DGUA 4F3TA 2NYIA 5HMYA 1HKGA 5KT2A 3TADA 1HJPA 4I2CA 4CJKA 4XUSA 4HT7A 3TVKA 4DV7J 1KD1T 2KJ8A 2OWOA 4M9NA 3PACA 1XMBA 2R7RA 3BKTA 1TKDA 3NY0A 2U1AA 3WXMB 4I4BA 3L3CA 4ZN3A 3FSIA 5ETPA 4BGBA 3VQ7A 5FPEA 3GCXP 2ZJ5A 4HWIA 4M9GA 4FYDA 5KTQA 4W5QA 1OY6A 2H9ZA 4CDGA 1Q82O 2WTUA 2ZIWB 4DDFA 4NZ0A 2D4WA 1QSYA 1ZTWA 2HVDA 4U7UD 4HUFA 1FKPA 1RXVA 1V4TA 4LIWA 3L8BA 2VDIA 4QZVB 4PKDB 3HKZC 5CZ2A 4LQ3A 3EGNA 3QRQA 4DXLA 2ZH3A 5EX3A 3M6KA 1QSSA 4MK8A 2O6KA 3QZ8A 3J7YI 5F8JA 3HTVA 1GMVA 3B9JA 1UEKA 3G8TA 4IJAA 5EDWA 4ZS6A 4LF9F 4BR7A 1S1XA 4FXVA 4K25A 1YJTA 3OUYA 3EM1A 2D0PA 3PW0A 5A8RB 3ZSXA 4EX7A 2R2RA 3EL2A 4K4ZA 2F3JA 3NWRA 1BOTO 3QNNA 4DV6J 1T94A 1RU1A 2HQCA 5CD4H 1FDNA 4F5OA 2MQNA 3E2EA 4DSLA 2KKZA 2GHWA 1UA0A 4TY8A 4F0HA 5EGYA 2Y9HA 3QXGA 1KDNA 2R7TA 4HH0A 1YBUA 4FWOA 4K8XA 2WONA 1MWQA 2G8IA 3TAGA 3D6HB 4BC9A 2G0AA 5KFSA 2ZQBA 2VICA 3P96A 1IKYA 1NDLA 3ZZTA 4BRIA 3FMBA 2ERRA 5F9NA 1FW6A 3OR1B 4WZMA 2CQDA 1VC5A 2JH3A 3RUBL 5ALFA 1PILA 3PJWA 1KQGB 2GUIA 3RMCA 1B9DA 1N60A 4ZP6A 1M1KT 1V9OA 1OSDA 2YNHA 1OWXA 2DCUB 2WBNA 1ZZNA 4K4WA 2J4RA 1PCAA 2J9DE 3S3NA 1VJ5A 2DNMA 3IG1B 5ETNA 1GLFO 1ZTTA 4K4YA 5DLFA 1BPDA 2O4IA 3AU2A 3ZZYA 3UE5A 2DGXA 1ZQKA 4OJHA 2QA2A 1R7IA 4DOZA 2LMIA 3IMQJ 5KFHA 2UYTA 3FE1A 2LKYA 3ZT2A 1GT8A 3KHRA 4IFVB 1SWWA 3VMFB 1XNRJ 5DM6Q 4EELA 1RWMB 3DJCA 1S6UA 4AFFA 3K75D 1WC5A 1ZQFA 3N9UC 3T79A 1VK8A 2ZZNA 2K8CB 4Y00A 3DLHA 1QZ5A 1JLBB 4WXOA 2H3GX 3A3NB 3CCVN 2Y1JA 5D0HA 1S1WB 3W5ZA 4KHPF 1RBTA 2HURA 3OS0A 3I55N 5CY4A 3HWTA 2IRYA 2WW4A 4ES1A 2J9CA 3T9NA 4IXCA 4CBWA 1WN7A 5I3UB 8AT1B 1HBMA 3MM9B 4WU2A 3D28A 1MMLA 3WK8A 5KFOA 5KFJA 3T1YF 2L41A 7ICRA 1HUZA 5G0RB 4QIFA 3HYFA 2G1HA 2VC1A 4JI5F 4UASA 1VQSA 3QFHA 4ID5A 3A8JA 5AR0A 1JXVA 1P9YA 1N52B 1NMDA 3KFWX 2MQOA 4L3NA 4G1PA 1F9FA 1G1XA 1VC0A 1YZ6A 1UOCA 4CJRA 2UUTA 4W5RA 3QBWA 4ZCLA 1LK7A 4YFKA 4PQAA 4NLQA 1IXRA 5AK3A 3M30A 5H9EJ 1VRUA 3O3HA 2HQFA 4NLTA 3JAMU 3CXCR 4G6VB 4USKA 4UUWA 4CJUA 1S8OA 1WWHA 2G08A 3FNNA 1QAYA 2J5AA 5AXKA 1HWLA 3UWTA 2AGQA 3SCKE 4RUCA 3W9HA 3VGUA 3BY5A 2IOFK 4ILRA 3SCLE 2IMWP 4P73A 3CCWA 3KDNA 3GMGA 4ZCMA 5K20B 3VEYA 1S1TB 4TYBA 3AA3A 2KK0A 1H98A 4XDDA 4F5NA 4Y6IA 1G2EA 3HVTA 4X4UA 4Z6EA 8ICRA 2KKHA 4B1WB 2K4PA 4PL2A 4CZEA 2MXYA 2R8JA 4BUGA 4OLPA 3IMXA 4WFXA 2KZ3A 2YBVA 3KMSA 2FC8A 1PJ6A 4PGQA 2DT9A 2AZ3A 2G5IB 5EVZA 1Y9OA 5AI8A 1X6JA 2BGGA 2QW9A 4C0BA 1Q86T 2PA8D 4OYOA 1D0EA 2CDRB 1VQ8N 4JBCA 4FOIA 5JTIA 3CIPA 3CC4N 1XQSC 4ZITA 3C94A 4CD1A 3ITHB 5BN9A 3KD3A 5GTHU 3AD9C 1XSNA 3MPWA 4JKBA 4O0NA 4B1VA 1X4GA 4B3SK 1HRHA 1TL5A 3RW7A 4Z4IA 4QWBA 4CLSA 1FKOB 5ALUA 4CTAB 1NPPA 1F9HA 4EYHB 1NM1A 2B0CA 3JXOA 3UQ2A 4P74A 1VK3A 4JKGA 1T8EA 1NGCA 4LVNP 4B3OA 2KJVA 2L9NA 3P4UB 4CF9A 5DM7L 3LDSA 5L9NA 2SXLA 3R3LA 2LU1A 3DHWC 2E1ZA 5KFMA 3A1YG 4BR0A 1IBLJ 3DM2A 3CJQA 1WUUA 4K0KJ 4LR9A 3KJFB 3I28A 1BE4A 3K89A 2F4VK 5JUMA 3QGPA 4IFVA 4MLEA 3R1HA 1IBLK 4Y2QA 1VQ5S 1TUGB 2ALYB 1U6FA 2DGSA 2P9PA 1ZPWX 4XK8C 2UUCJ 1W9HA 4WYBA 4B3MK 2M9KA 1NJIO 3VQ6A 1RXOB 3DRYA 2ADBA 1WG1A 5CYMA 3PIOQ 3U1LA 3TTCA 1S0MA 4HL9A 4O3PA 4KGMA 2ALZA 2MY8A 4E3SA 1F6TA 2J76E 3TW0A 3SYZA 1JIHA 2H5EA 2UZAA 2HWTA 2PFDA 4KB1A 4NLZA 5KFUA 1Z2LA 3DDNA 4CNZA 2KIVA 3LP1A 1QCKA 4Z7YA 3TAMB 2FSNA 5G0RA 2PMZD 4EIAA 4CK1A 8ICLA 1N36F 3NDKA 1PC5A 4NX9A 2HQDA 1R8AA 5BYRA 3EDQB 3UKUB 5ALMA 3GILA 2EFOA 2MAXA 2JSXA 4B9NA 2YNIB 2OYQA 2FHOB 3HRDD 1S79A 1U04A 3WNGA 2YKNB 2IVOA 3BF3A 1YXQA 4YXMA 4NRUA 1KAYA 4YS2A 2RAQA 2Z1GA 2XI9A 2GTDA 4WFNQ 3D67A 4FK4A 1X0FA 1D4XA 2GAGC 3MN7A 2UUAK 2R4FA 3KZIU 1YJRA 3WNFA 2KT5A