3TI0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddgtp-dc in closed conformation
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 202
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ti0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ti0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ti0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ti0A01
4RW8A 1T8EA 4QWDA 4UB5A 3SCXA 3OSPA 4ELUA 4F4YA 4O5CA 4PA1A 2I5JA 8ICSA 2HHTA 7ICFA 4CJEA 2ZTDA 4YXJA 4PGYA 1T7PA 1JLFA 2BCUA 4UAZA 1JXEA 3NF7A 3KD5E 7ICOA 2FPLA 4UBCA 3K5MA 1EX4A 4E1NA 4H4OA 1FKOA 4B9TA 3L2WA 3RB6A 3O4QA 4YXMA 1F21A 1XU4A 3MFHA 1RYSA 1VSLA 4P4MA 1KVCA 1CLQA 5JUMA 4G1QA 4J2DA 3NHGA 1SKRA 5HBMA 2X6NA 5DDMA 3E2EA 1SL0A 2XHBA 2W8LA 3MXJA 3ZT0A 4YG2A 3C6UA 4Z0UA 8ICLA 3SI6A 3TR8A 3SQ1A 4UB2A 3ZDBA 1NJZA 2R8GA 1ASWA 1ZQLA 3H4BA 3KJVA 8ICFA 4LD0A 3NGIA 5DQIA 1JL2A 1C0MA 4IQVA 4KTWA 9ICAA 3OS2A 3GV8B 4Z6EA 2W8KA 1RTJA 1SZPA 1KFTA 3C21A 2BCSA 1D9DA 2AQ0A 4CJPA 4M41A 3TANA 4RNOA 3KLGA 4FK2A 5DQHA 2KZ3A 3JPOA 3ORYA 4NLKA 2P5GA 4RNNA 3V4IA 5EWGA 3RR7A 1BL3A 4CK1A 2FPKA 1MQ2A 2V4QA 1WSEA 4M9GA 1K1QA 4FBTA 4PPXA 3ISDA 4EBDA 3SNNA 4FLVA 3H8WA 3SV4A 4FJ9A 5CP2A 2VWKA 3MEEA 5KRSA 4XIUA 4FLWA 2YV0X 2HVHA 2HNDA 1NOMA 2ETJA 3V7JA 1QLNA 3CG7A 1JIHA 5DQGA 8ICHA 1BQNA 2OA8A 1RZTA 3KTQA 5KFYA 9ICXA 4ECVA 4I2EA 3NGDA 4R65A 1ZQQA 3MFIA 3VQ6A 2HHWA 4G3IA 3HP6A 3OJSA 3OYBA 5K14A 5J29A 1J5OA 3LAMA 4IRCA 3CM6A 3QZ7A 5KFPA 1MQ3A 4DTXA 1SL2A 1DOQA 3OYAA 5HHHA 3V9XA 2DFLA 4YR3A 2FLLA 3ZSRA 2R8KA 5L1IA 2FBVA 4QOZB 1ZBLA 4J9MA 1VRUA 4NCBA 3QESA 3KHHA 3I8DA 4Q43A 4M0AA 3C23A 3QINA 4N5SA 3ZT3A 1ZQMA 3KK3A 2HMIA 5JS1A 2ZTEA 3JPNA 2NRVA 8ICNA 4JRQA 4J2EA 1LAWA 4DFPA 3PR5B 2ATQA 2I1QA 4KI6A 3EPGA 5KG4A 3ULDA 4ZHRA 3MR6A 5J2BA 5DGAA 2WONA 2IGIA 4FJIA 1S0MA 3TAQA 2PZSA 3RJEA 4Q8EA 1D8YA 4DU1A 2IS3A 1ZBIA 3CQ8A 4PWDA 3QEBZ 2ISPA 2M9NA 2WTFA 2YHAA 1JLCA 4BGDA 3TABA 3V9SA 3PW5A 3KHLA 4Q8FA 2W9CB 3ALYA 5KGWA 3RMBA 3C5GA 4B9NA 4N41A 3JPSA 1IKXA 3MR3A 4YD1A 4FZZA 4EP5A 3BQ0A 2F1HA 2P6UA 3B6PA 1YTAA 3ZDAA 4HUGA 3D0PA 9ICCA 4Q0BA 1RILA 3SI8A 5J2CA 4MFCA 5HMMA 9ICBA 4DQPA 5KFLA 1LB2B 3SQ0A 2UVVA 3OYFA 3LP2A 3CFRA 5J0YA 9ICRA 4I2DA 4MFBA 4F4XA 3F9KA 2VA2A 3DOKA 2IDOA 4LSLA 3VQQA 8ICOA 3QEWA 4CF8A 1TKTA 4M3ZA 4KHSA 4UQGA 4CF9A 1BI4B 4CJ3A 5EWEA 4M3TA 1B43A 1TVAA 4F50A 1WSJA 4F5NA 5FDLA 8ICIA 5KFQA 3T3FA 1ZETA 4YFUA 2UVRA 2GWSA 4H8KA 4B8AB 1RT2A 3S9HA 3TFSA 4O4GA 3NAEA 4C8KA 4QCLA 4MEXA 1FK9A 3NF6A 4ED7A 4DOAA 2DPJA 2X74A 2ITGA 3QIPA 5J2JA 1U45A 2KZZA 3BJYA 1JLAA 2OPPA 1BPEA 4DL7A 3RH6A 4QZ8A 2YKNA 4NY8A 5EWFA 4CJKA 4C8LA 4CFCA 2YNGA 4CEAA 1HJRA 4I2CA 3V1RA 1QSYA 1RTDA 1KRPA 3ISCA 4DG1A 1RXVA 1XS9D 3B6OA 3C95A 4IFYA 5T7BA 1XWLA 4ED6A 4KRFA 1IO2A 4EYHB 1N6QA 4DTOA 3AVIA 2IMWP 4CE9A 1DLOA 3OYLA 3L2QA 4ECZA 1LW0A 3AV9A 3AVNA 4CESA 1KSPA 4PUOA 5KFAA 3PVXA 4M45A 5D46A 4JRPA 4B9VA 4KMUA 3LWMA 2OPRA 3UXNA 1ZQTA 1XHZA 4Y1CA 1J9AA 3LZIA 1ZQBA 1ZQYA 4TUPA 5J2IA 1GOAA 1Z00B 4F2RA 2VWJA 5KFGA 4W5NA 5HLFA 3CM5A 4QWEA 3C1YA 5CHGA 4LH5A 4KLJA 4ZTFA 2YNFA 3K58A 2QKBA 4IG3A 3IG1A 3AVJA 4F5OA 4QWAA 3BQTA 5J0WA 4TURA 3K75D 4TUQA 4KLEA 2EHGA 5DDYA 1XHXA 2JEIA 2BQUA 4DLGA 3BQ2A 5J2FA 1WNSA 1ZQDA 1HYZA 3QETA 3U3GA 9ICKA 3QNNA 3BGRA 2UVUA 4J9LA 2E6LA 4KAZA 9ICGA 2BKEA 1IXRA 5HMLA 3KD1E 1NK4A 1ZQFA 1YVUA 4CHQA 1ZQIA 3OYHA 4CGHA 3IM1A 3RWUA 2RDIA 5CY4A 4CK3A 1B22A 5FRNA 4CJQA 1L3SA 3KIOA 2C28A 4O3NA 1IG9A 3OYJA 1JXBA 2P51A 4Z6FA 2ZTCA 4K8XA 2YNHA 3H4DA 2BQRA 3JPTA 4CGIA 5KT6A 4M9LA 2XY8A 1BCMA 3NTUA 2BR0A 3B0YA 3RB3A 4DFJA 2Z1JA 3DLHA 4DL2A 1VSDA 1S1UA 4YR0A 1S5JA 1NKCA 3OY9A 1Q9YA 3PW4A 4FCYA 3TWHA 3RB0A 2XGPA 1S9FA 4B08A 4EP4A 4BDPA 2P66A 3VQCA 2G8FA 3OSNA 3V72A 1L3TA 2HHQA 4KB1A 7ICEA 3PW7A 1HUOA 3VQ9A 3EW9A 4DQQA 2NRWA 4C8MA 3B0XA 1J53A 4HHTA 3SPZA 3EY1A 4WE1A 4E89A 4I28A 1UWBA 5J2HA 4DU3A 4YFKA 1ZQVA 1K1SA 4F4KA 2KW4A 2X6SA 2JLEA 1UT8A 4R8UB 5SWMA 4N76A 4Z6CA 2GBZA 5CJ7A 3U3YA 4RPXA 4H4MA 3NH2A 3IRXA 4FM1A 1JLGA 1ZBUA 1H38A 4RW4A 2VG6A 4W5RA 4O3SA 1HQUA 1A5WA 3RJFA 3VA3A 3JPQA 1A76A 3LP0A 2Z1GA 4FLZA 1NJWA 4RQ3A 3EWAA 1U48A 3K2PA 3NH0A 2B5JA 3AVKA 3WNEA 2ASJA 2DY4A 5KFJA 4IRKA 7ICUA 1ZQRA 1BPBA 4CJLA 1EXQA 2E6MA 1D8LA 4KHQA 1FKPA 5CA7A 3QEIA 3HT3A 4J9QA 3ZD8A 2KFZA 1RT6A 4QWCA 5DLGA 3MR5A 5DBBA 2O4IA 2YNIA 1WSFA 4CEQA 3NE6A 2XCPA 4DL3A 1KDHA 3VN5A 4AHCA 4OPJA 3ITHA 4DL4A 2O4GA 4UB3A 3VQBA 2W9MA 1BQMA 5TZVA 3QZ8A 1T05A 3PX0A 7ICIA 1UAXA 2C2EA 3N97B 3DLRA 4DSEA 5BOLA 4HCCA 9ICOA 4CFDA 4Q44A 5KGXA 1VSIA 2OYQA 4AHUA 5BOMA 4OLBA 3FDSA 2RPIA 2NRXA 5IILA 1S1WA 1LW2A 3O4NA 4E19A 3AVAA 1NJXA 2PI4A 4Q5VA 1A5VA 4M42A 3QEVA 4FJNA 5CB1A 3HL8A 3OYCA 3RMAA 3OYKA 3S3OA 4AHSA 8ICUA 1TAQA 4RUCA 5DG8A 4QW8A 4B9SA 4M3YA 4ECXA 4E3SA 2E4LA 1T03A 4O0JA 1A5XA 4M3UA 5KTQA 2AU0A 2XCAA 3RRGA 3MR2A 8ICYA 1U04A 3SUOA 8ICAA 2JZBB 8ICVA 1BISA 2FPMA 1B9FA 5FRMA 1AROP 1LWCA 1CXQA 4TQSA 4BXOA 3OYIA 3OHAA 1ZQZA 2X78A 4N47A 4QAGA 8ICRA 4M3WA 1ITGA 5J0UA 5KFFA 5KI6A 2WOMA 4KHNA 1QSSA 4F5RA 3LDAA 4IR1A 1ZQEA 5KFTA 1C6VA 5KFVA 1U4BA 1RDCA 2G8IA 4HYKA 1T3NA 1S9EA 5KFRA 5D4BA 2JEGA 1BHLA 3OYNA 1ZQAA 4B9MA 1S6QA 1ZQCA 1KLNA 1C7YA 4AILC 3NF9A 3RMDA 3ZSXA 1X9WA 3Q8MA 4JS5A 4YMNA 2GV9A 4FVMA 5KFKA 2RDJA 1RT3A 1KFSA 3UXPA 4R5PA 4JLHA 4NCGA 3Q8QB 1TV9A 1COOA 2D0CA 1ZQOA 2BPCA 5HP4A 2FBTA 3V7LA 1ZQGA 1EETA 4UAWA 1RBSA 4GVMA 3V9ZA 4J9SA 3SQ2A 4X5VA 4DSIA 3LAKA 1B92A 2G8WA 7ICKA 2W9AA 4QZDA 1DTTA 5KG1A 2Z1HA 4PHEA 3DI6A 4BWMA 4R64A 2FBXA 4FJHA 4FXDA 3LWLA 4KTQA 4CEBA 2PFQA 4IKFA 4K8ZA 4QZCA 4IQTA 1WAJA 3ZSZA 1EP4A 3ZDCA 4CFAA 2XC9A 3GDXA 5DG9A 4O3OA 3OS1A 3AVMA 4RQ7A 2BPGA 1ZQWA 4I2BA 3SV3A 3PX6A 4DOCA 4PY5A 4O3PA 5DB7A 4FS2A 1KVAA 1KVBA 4K4IA 3LP3A 4O55A 3KKRA 4MQ3A 4DQSA 4XQ8A 1BCOA 1ZQHA 2IHNA 5C24A 4CJSA 5KT5A 4CERA 4DTRA 9ICUA 1JMSA 2R8JA 2FMPA 5HRPA 4PQUA 2PI5A 4XA5A 3S3NA 3Q8RB 4GLXA 4IQUA 5KT2A 4PHDA 1Z26A 1S6PA 4M04A 4OKJA 4JS4A 4CGGA 4QZAA 4FBUA 5DLFA 1DGSA 1BPZA 4ED1A 4DTUA 2BCQA 4DL6A 3AVGA 3Q8SB 4CHNA 7ICHA 4ID5A 1X9MA 2HNZA 3H7IA 2IA6A 3AO1A 4M6WA 4OKEA 4HUEA 3V6JA 2BE2A 3RRHA 3OJUA 1J54A 5KFNA 4EBEA 3KKSA 4FZXC 3TARA 4OJRA 3DM2A 3T1AA 5F9NA 2RF2A 5KFWA 2KZMA 1WSHA 5KFUA 2Q3SA 1SKSA 3CFOA 3DLEA 4DSJA 1SKWA 4RQ1A 4CJ4A 5KFHA 3RJGA 3GV5B 4NYFA 1S1TA 3O3FA 4UB1A 3ISBA 2DFHA 1NKBA 3C5FA 3DRPA 3KLEA 3HXMA 7ICRA 2W9BB 2XY5A 4C8NA 1HNIA 1I39A 1VK0A 5J2QA 3EYZA 3AU6A 4DOBA 2MAXA 4AHRA 2V9WA 4M3RA 2XGQA 4DSKA 1X2IA 1G15A 2KQ2A 4CJTA 5KG6A 1ZQKA 3DRRA 3VA0A 4FW2A 2PFPA 5DGBA 4EZ9A 9ICSA 1T4GA 3IAYA 2F96A 4ECQA 3MGIA 1VSEA 4O9MA 2ZQBA 3HVTA 4Z4EA 4DL5A 1L3VA 1Y88A 4FM0A 3TAPA 3BDPA 4FZYA 3K59A 3AA4A 5HHIA 7ICSA 1KFDA 5KFXA 1RPLA 3MAQA 2P5OA 2DPIA 3Q8KA 4LH4A 1ZQUA 4J9OA 2ISOA 2FBYA 1HQEA 2C2RA 3ASMA 1VSKA 9ICHA 4NM1A 3GILA 2P6RA 4MFFA 4I2PA 3S3MA 5DG7A 1VSHA 5D49A 1KTQA 2VANA 4YMMA 1U47A 4KREA 4RZRA 3NCIA 1SV5A 3TI0A 4DO9A 1C0TA 3AVBA 1D5AA 1YTUA 1WCNA 1TK5A 3IHQB 4NXZA 3G0ZA 1O1WA 4JV1A 1IM4A 3OGUA 4KLFA 4RQ6A 1IKYA 1UT5A 4I9QA 3DOLA 3OYMA 3C2LA 9ICVA 2AGOA 1S97A 1C1AA 2W42A 4RT2A 4W5OA 4YCXA 3MXMA 4OGEA 3DRSA 1JKHA 4M9JA 5FROA 5SZTA 2F1JA 3PY8A 3GQCA 3UQ2A 4TQRA 4KLDA 4RQ0A 1KEJA 2D5RA 2IBKA 5C25A 3AVCA 4IDKA 5HNKA 3OVNA 2G8VA 3I0RA 4FJ7A 4F91B 4YR2A 2AJQA 3Q8PB 2LSNA 4QZBA 4OKKA 4QZGA 4RW9A 2PFOA 2IOCA 3RMCA 1Q8IA 1VSJA 2A1JB 7ICTA 4ECWA 4DTNA 9ICIA 2AQ4A 3HX0A 2G8KA 2OZSA 2Q0ZX 2FMSA 3K5OA 3MGHA 1TKZA 3TAEA 5IIIA 3SUNA 4M2YA 9ICWA 4ZH4A 3SUPA 5DB8A 4Z4FA 4FO6A 3NH1A 2R7YA 5JS2A 2HHSA 5DBCA 5DMRA 1UA0A 4PH5A 4PGXA 8ICEA 4ED3A 1WSGA 3U6FA 3OYGA 8ICKA 4HCBA 1TKXA 3AUOA 2IHMA 1DTQA 3AO3A 4F5PA 1XSLA 4FLXA 1RCHA 4CF2A 1JN3A 4I2IA 2KN7A 4M9HA 4ECUA 3QEPA 4J9NA 4RPZA 3MEGA 3K5LA 2Y1JA 2AGPA 4B9UA 2NUBA 4CHPA 4BE0A 3JSMA 4XUSA 3KLFA 4JK1A 5J0RA 3RR8A 2BGGA 1TVRA 3VQDA 4JUZA 2JGUA 1NK6A 4KITB 3V9WA 1XI1A 5J1EA 3P83D 3H40A 4JWNA 8ICJA 2A1SA 3QEXA 4E7KA 2W9CA 3CYMA 2PYJA 3QO9A 1VSFA 1NJYA 3RJKA 4I2FA 2HVIA 4IBNA 4IFVA 1IKVA 3AA2A 1KCFA 5KFDA 1VSMA 3VQ5A 1RBVA 3PO4A 2DFEA 2OPSA 3L3VA 1C1BA 4ECYA 4QW9A 2B21A 1RDBA 3SQ4A 3OHBA 3JYTA 3HW8A 4ELVA 4FJJA 4KLHA 2OZMA 2D0AA 3UQ0A 5KFMA 4EYIB 2KFNA 3C1ZA 4PGQA 3TFRA 1CUKA 4IR9A 3NGZA 1REVA 3DLKA 4YN4A 4BE2A 2ZUBA 4FLUA 4FW1A 1BI4A 1HRHA 4E7IA 1ZQPA 2W9BA 1HYVA 1RBTA 4ZTJA 3OYDA 4F92B 4BDZA 3TAGA 1RXWA 3WNGA 4R63A 4NLGA 1LV5A 1FXXA 3HO1A 3LDSA 3T5KA 1RNHA 4OVLA 2J6TA 1ZQSA 4CJUA 1MSWD 4KO0A 3SJJA 4Z4CA 4R66A 2ZJAA 4CF1A 7ICJA 4M9NA 2ATLA 3HYFA 4NYNA 1TL3A 3ZT4A 4NLZA 5CYQA 1WN7A 1IKWA 3QEAZ 4C8OA 5CR0A 5KFBA 2QXFA 2GUIA 3G6XA 4O44A 4YMOA 4RG8A 9ICNA 4FK0A 5IIOA 4BWJA 4I29A 1QS4A 3GFKB 4E0DA 2BHNA 1WCLA 3THVA 4M47A 3MBYA 3PR4A 2XY7A 8ICCA 1Q9XA 4CFBA 3GIJA 2HHXA 4DTPA 5J2MA 5IIJA 1BPDA 4JV0A 1BPXA 2HHVA 2BCRA 1ASVA 3KK2A 4LZGA 2FC0A 4DU4A 4IQWA 3ZSQA 3P5JA 3C94A 1D9FA 7ICPA 4CCHA 9ICFA 3C2MA 2DTUA 5KG3A 4ECTA 3QE9Y 1JLEA 1BIZA 1NK0A 4KLSA 3M8PA 3LALA 1TFRA 3HPHA 1Z00A 3V9UA 4CEDA 1TK0A 2JEFA 4GC7A 4CEOA 4RT3A 3H08A 5KG5A 4ED8A 3RAXA 1RT7A 5KT4A 4P4PA 3LANA 4E7JA 3K4GA 1GOBA 1RYRA 1HJPA 1XO1A 2RN2A 2D0BA 3V1QA 2QK9A 4UB4A 3WNHA 4ED2A 1MC8A 4RNMA 3RJHA 3O3HA 4YQWA 3GIIA 2HB5A 4LSNA 5HROA 1N48A 1NKEA 3ZSOA 4CHZA 5J0SA 1RT1A 3AVFA 1NK5A 5CWRA 2HNYA 3QLHA 4OGCA 3HM9A 4I2GA 4RQ4A 3KHRA 4B9LA 3HPOA 4KLGA 5CYMA 4Y1DA 4HUFA 3MABA 4KLIA 4O5EA 3PX4A 4W5QA 4J2BA 3MDAA 5HP1A 2A1JA 4CECA 2UVWA 1QSLA 4J9RA 3KLIA 3ETLA 5KG2A 5I42A 5IIKA 1S1VA 1RT5A 2BANA 5KFCA 4RQ5A 3HK2A 3M8QA 5KT3A 3WNFA 3K5NA 3NF8A 2ZJ5A 4KHYA 3KHGA 3C6TA 4UBBA 4ECSA 5KFZA 4Z4HA 4Z6DA 2IAJA 4GMJB 5KT7A 1XSNA 1KLMA 3SYZA 3RAQA 1Z3EB 1BVSA 1TV6A 5KG0A 3GIKA 4P2HA 4FS1A 2VG5A 2BDPA 4LZDA 2ZD1A 4KLOA 5J2GA 1SL1A 2AGQA 5J2AA 2LYHA 4KLMA 4KHUA 2PY5A 4OPKA 3M9NB 4ICLA 3T5LA 2FMQA 4KLLA 8ICGA 1EKEA 4DLEA 3RJJA 1TKDA 1UA1A 8ICBA 1ZBFA 3T5HA 4K4GA 4QWBA 3ZT2A 3RBDA 4CJVA 9ICTA 3UXOA 4KTZA 1GOCA 4CGFA 4CIGA 5DKWA 2ASDA 3GIMA 4GXIA 3M8RA 2J6UA 2F8TA 2ALZA 4F4WA 3ZCMA 2PFNA 4R8UA 2B6AA 2NRTA 1HPZA 3O3GA 5J2NA 3LZJA 5IINA 5EU7A 1BIUA 2Y1IA 1XC9A 4ID1A 4BDYA 8ICXA 5J0TA 1HNVA 9ICLA 4DSLA 4HTUA 3RH4A 2DFFA 5KG7A 4HVJA 5J2EA 3LPTA 3AU2A 1RBRA 4RW7A 4RPYA 4NCAA 5BPCA 3PMNA 4CGDA 1RDDA 4QZFA 1JX4A 4CIFA 1RTIA 4RW6A 1CZBA 1S0NA 1S0VA 4QZIA 3H8SA 4GC6A 4KFBA 3Q8LA 3G10A 3LPUA 2C2DA 2HHUA 3AA3A 3M8SA 2MUTB 4I2AA 4TSXA 3V6KA 1S1XA 3V6DA 3ZSYA 1LWFA 4O3RA 3QERA 1RBUA 4J2AA 3G6VA 2C22A 4CK2A 3ZSVA 2PXIA 4JV2A 3DMJA 8ICWA 3VQEA 4KLQA 3M9OB 1S76D 3AO5A 1L3UA 3ZD9A 5KFIA 5DBAA 5DB6A 4ED0A 4RUAA 2KTQA 9ICEA 1C1CA 1S10A 4DEZA 3T5JA 4FK4A 4ELTA 7ICMA 8ICPA 4FM2A 1W9HA 3SUQA 3AVLA 1NK9A 4ECRA 1BPYA 2HW3A 3JPRA 3PO5A 2G8UA 8ICMA 3M9MB 5E41A 3LK9A 4CEFA 4AHTA 4YP3A 3A2FA 4RQ2A 4KB0A 4QZ9A 1ZBHA 3FYHA 4DS4A 1U49A 4M3XA 4FLTA 2XY6A 5J0PA 1R0AA 2H5XA 4I2HA 4CEEA 4IRDA 5J0QA 3TAMA 1BGXT 2R8HA 3PW0A 4IG0A 5D3GA 2ASLA 3RJIA 4L8RB 2VG7A 2B4JA 3UIQA 4UAYA 4EBCA 1WSIA 1B9DA 5L1JA 3N4MB 5DK5A 2JZBA 4PHPA 1S77D 2OPQA 2RKIA 2R8IA 3ZDEA 4F8RA 1WLJA 3NBPA 4KN4A 4DTJA 4FJXA 3E01A 5J0XA 3SZ2A 4DFKA 1SUQA 1N56A 4KHWA 3MEDA 5C5JA 4OLAA 4RU9A 4MF2A 4O0IA 5KRTA 3HSTB 2YKMA 4FJGA 4KN7A 1U9LA 4YD2A 4I9LA 3OYEA 4KPYA 2VA3A 3JPPA 4F3TA 1QE1A 4YVZA 3L3UA 3DLGA 2F8SA 4GXJA 4EEYA 4DWIA 4MEYA 1EXNA 7ICNA 1NOZA 1Y97A 7ICLA 3F73A 1JXLA 4Q45A 1YT3A 3MXIA 3V81A 3OS0A 3L2UA 2XO7A 9ICMA 4E7HA 2VA8A 4RQ8A 1S9GA 3V7KA 3AO4A 1Z25A 1MU2A 4O3QA 3G6YA 3EPIA 4DTSA 3KLHA 4AHVA 1ZQXA 7ICQA 3AO2A 3K57A 4FJMA 1HYSA 2ZUCA 2G8HA 4E7LA 4DFMA 1VRTA 4LY7A 3HP9A 4CF0A 4DQRA 4CHOA 2QKKA 3P1GA 1K6YA 3MECA 3HPGA 4AH9A 4W5TA 3RB4A 4BXOB 4FJKA 1PZNA 3GV7B 1A77A 5L1LA 4MFAA 4BACA 3V6HA 5IIMA 4DS5A 4GW6A 1TK8A 4I2JA 1X9SA 4O5BA 1UOCA 3CFPA 2I9GA 4B3OA 4EZ6A 4Z4GA 5L1KA 4O5KA 2JEJA 1ZQJA 3NDKA 1LWEA 2IC3A 4P4OA 1CXUA 5EOZA 3L2VA 1IH7A 3NFAA 1L5UA 2BCVA 3TQ1A 1JLBA 9ICJA 5L9XA 5J2PA 1RTHA 4QZEA 1TGOA 3BQ1A 4E1MA 3UPQA 1XSPA 2BPFA 3PUFA 3I0SA 4YNQA 4TUSA 4KV8A 1QQCA 1TAUA 2NRZA 5J0OA 1HUZA 4FJ5A 4DMNA 1WAFA 3MDCA 5F9LA 1C0UA 4DTMA 2MUTA 3AA5X 4BE1A 1LAVA 4NLNA 3AVHA 3SPYA 3HWTA 1RDAA 4J9KA 1JL1A 4CIEA 4I27A 2P1JA 3DYAA 4NM2A 2A1RA 5J2KA 3IS9A 4CGJA 1ZJNA 1W0HA 1QTMA 3PMLA 5J2DA 3PV8A 3RH5A 4K4HA 4F4ZA 2OWOA 1S0OA 4DF4A 3VQ4A 4CJWA 4JWMA 3ISNC 3ZDDA 1ASUA 2ZE2A 4F2SA 5KFEA 3NGYA 3ZSWA 5CZ2A 3L8BA 1ZYQA 4B8CA 1TL1A 3ZT1A 4F5QA 3TAFA 2F1IA 1JLQA 4CJ5A 5HRSA 4FYDA 3L2RA 8ICQA 5KFSA 3V1OA 1V9PA 4DQIA 4FJLA 3QIOA 4Z4IA 4KLTA 3QNOA 4F3OA 1I3AA 1N5YA 2EX3A 1RT4A 1NOYA 4J9PA 3LP1A 1ZQNA 4FJ8A 9ICPA 1NK7A 1QHTA 4KI4A 2V4RA 3KK1A 4PHAA 3C2KA 4N56A 8ICTA 1CEZA 7ICVA 4I7FA 2PYLA 4GXKA 3D45A 2Z1IA 2YHBA 3PW2A 2BGWA 4CEZA 4DSFA 2ZJ8A 4MF8A 5DB9A 2BQ3A 3T19A 1ZJMA 5KFOA 5C42A 2J6SA 8ICZA 3PNCA 1HMVA 3VQPA 3VQ8A 3HJFA 3RTVA 7ICGA 2ZUDA 5HRRA 2FLNA 3VQAA 1NK8A 4CHYA 2XRIA 3DLBA 3EZ5A 4XRHA 4KLUA 4QZHA 3H8JA 4CJFA 1CZ9A 5HRNA 5I3UA 4M6WB 1X1PA 5CZ1A 4F93B 2FLPA 4KKOA 3HVRA 3RBEA 3FFIA 4FLYA 4LVSA 9ICQA 4DF8A 3VQ7A 4I2QA 4CJRA
chains in the Genus database with same CATH superfamily
4RW8A 2K3KA 5CD4H 3SCXA 1HNWK 2ILZA 4F4YA 3H0LB 1LXNA 1XR6A 4O5CA 1ZD5A 2I5JA 2FJWA 2IIHA 5LMUF 2ZTDA 5GAHU 1RCXB 1WSRA 1T7PA 3E0FA 3DRPB 1B0PA 1UFWA 4K8RA 2P9GA 1NO8A 2B3TB 3D2WA 1SQEA 2WZ1A 1UEVA 5A76A 1OUQA 2D41A 1EX4A 2M4MA 2CADA 4JI0K 1NMEB 4B9TA 3L2WA 1CJUB 3DDNA 3DRRB 4GV3A 3SCLE 3D0GE 3SSRA 1VSLA 2UUCF 2HQGA 3ETRA 1Q3VA 4G1QA 3NHGA 2Y8YA 1SKRA 2F8HA 3GU3A 4OI2A 3HVTB 1XC3A 1WHXA 1PBUA 4WKYA 3FVYA 5K8MA 3IDWA 1OYEA 3DJCA 4H03B 3C6UA 3UW1A 5ALVA 1FJGF 3SI6A 1K73T 3SQ1A 2HRTA 4UB2A 1V97A 2YWKA 1ASWA 1ZQLA 4I2PB 5D4OA 4LD0A 2IYGA 4DV7F 1C0MA 3THPA 4YS2A 5AQZA 2CDQA 4PUOB 3CCWA 5T7LB 4ILGB 2CPJA 2QSWA 2CVIA 5HQ8A 5H9EJ 2AQ0A 1YI2N 5KAFU 3SR6A 1N88A 4KHRA 2D3ZA 2ERRA 2F9TA 4M41A 2J0SD 4RNOA 2GFFA 3FEYB 5GAEU 4DR1J 1ZS6A 2OI2A 2ZH2A 1MN7A 3FBFA 4NZ6A 3MWTA 3ORYA 2WF7A 5HVHA 2VQFK 4NLKA 1Y5LB 4RNNA 2GGPA 3KWMA 2XWYA 4NX9A 3A8JA 4M7YA 3DRSB 1YZ6A 3ULHA 5HLFB 4ISEA 1CSJA 2V4QA 1WSEA 5ETKA 4ZIVA 3JTNA 1HBNA 3ISDA 1QH9A 2EFQA 4K4WA 2NS1B 2YX7A 2RSQA 4B3RJ 3QXGA 3SV4A 4ZITA 2NXNA 4GVBB 3EVWA 4FJ9A 1YX2A 5D4LA 5AM0A 1AFIA 2YV0X 1CQNA 2HVHA 2OEMA 1NOMA 3OTCA 1WG8A 2HIYA 4JI1J 2OA8A 2H5IB 1RZTA 3KTQA 3AJDA 2DGVA 5KFYA 9ICXA 2F4VJ 2ZEJA 4LFBJ 1D3WA 1ZQQA 4UOHA 4G3IA 1N34F 3DLLL 4NLBA 3ZO7A 2CQ3A 1X4DA 3AOCA 5K14A 5J29A 4WK1A 1T9VA 2R18A 1SL2A 3OYAA 1P27B 4Y34A 4KPCA 2FLLA 5L1IA 2YWHA 4DZDA 1F9HA 4C7QA 4J9MA 1VRUA 3KHHA 3ZT3A 2M8DB 2G5HB 2NRVA 3EKUA 4OI6A 2B56A 3PR5B 5IS2A 2JLFA 4Y65A 1FNOA 4OYMA 1RKIA 3CJ4A 4CH7A 3SAGA 1CQMA 3KKAC 4D3HA 2ZM6F 3MR6A 4F26A 5DGAA 2BTFA 2WONA 5IQ6A 4DR7K 4C0HA 2CPYA 2J9EA 3KFWX 4FYVB 1FD8A 2XYGB 4DU1A 2LLZA 3CQ8A 2WSEC 2HSZA 3TEHB 1UVJA 4C1NI 2O6KA 3ZX3A 1JLCA 2CJBA 3TABA 2WAQD 4Q8FA 3ALYA 4B9NA 2DGSA 4CQ1A 1V4TA 2DPNA 2P6UA 1LVHA 2IVYA 1RILA 3SI8A 4DU8A 2ILYA 3JYTB 3BKFA 4B3SK 2VG6B 2DKOB 3M30B 5DJBA 3A5OC 4NZ7A 2R7WA 2V69A 3CFRA 5J0YA 4I2DA 1N36K 4OYBA 4MFBA 4F4XA 1O6XA 3DOKA 3QDKA 4LSLA 1NGJA 3D54A 4ILRA 3R9LA 3QEWA 4UQGA 4B1VA 3PRDA 4CJ3A 5EWEA 4GKJJ 2RJZA 1Q8LA 1VRQC 5FDLA 1IBLK 5KFQA 3T3FA 2EG2A 3P38A 4ZCKA 2E8MA 1RT2A 2YKOA 3D6MB 1ATNA 1G1XA 3NF6A 4LRBA 1RCOB 2VJVA 3QIPA 1U45A 3MMCA 2GHVC 3ITHB 2BJ8A 1PYSB 4I64A 4WIIA 4NY8A 4EFHA 2XTJP 3DEEA 4A46A 2YNGA 4CEAA 2W55A 1T05B 3I56N 2F5GA 1AZSB 3C3LA 2ZH3A 4C4WA 1QSYA 2HGMA 2RMLA 1KRPA 1XS9D 5A0YA 4IFYA 4M5LA 1HWLA 2Q79A 1XWLA 5LL6Z 2RQ4A 4KRFA 3OQ2A 4EIAA 4EYHB 2WUSA 1NDKA 1S1WB 2R2SA 4DR2K 3CMEN 2X3GA 1L7MA 3I55N 2GIQA 5J2MB 5HSPA 3HVWA 5LMNK 2M0GB 2K8BB 1KSPA 3KK2B 3D6FB 1U6FA 5ALLA 4M45A 3PJ9A 3JQJA 5LT5A 5C2DA 2Y9TA 4B9VA 4J90A 4KMUA 4X4TA 3MUVP 3VQSA 3H5SA 2D1KA 4WFAQ 1J9AA 4CWBA 1ZQYA 4TUPA 5D15A 1RBOB 4IS7A 4K4SA 5IWAF 1MMDA 2BJ7A 1SZ2A 4B17A 4UTGA 1L6NA 1HLWA 4LH5A 4KLJA 5HOOA 4YHHF 2YNFA 1G99A 3K58A 1VQ9S 2QKBA 2E1AA 1EX8A 2EBGA 1LNQA 3R3LA 2FZGB 1Y64A 3BQTA 2XMJA 1P1LA 5BXIA 2XQCA 4A5BA 4NYZA 2JEIA 4FDFA 3CPWR 4DLGA 5CCMA 3BQ2A 3RZAA 2E1PA 2DRDA 1LFWA 4CTAA 1Z19A 5F0UA 3QNNA 2UVUA 4XPCA 9ICGA 1XNRF 1KQSR 1S1VB 4UY85 1MMLA 5HMLA 2CZ9A 2DYAA 3VZHA 3CCJS 4K4XA 3GLJA 1A0OB 4RNHA 1ZQFA 4FYXB 4CGHA 1Q95G 2GVZB 4ZP7A 1B22A 5C12A 3KIOA 4U67Q 1TUUA 4O3NA 1N4LA 3MMBB 3MTJA 4NCGB 2DHGA 3CJAA 5AQMA 2ZG6A 3L09A 3NLCA 3VAKA 1ZA1B 4M9LA 3I5BA 1WEZA 3F5TA 2VF3A 2HDOA 3RB3A 3ENAA 3L7UA 3DLHA 1ZC6A 4DL2A 3ZZZA 1NKCA 3OY9A 1Q9YA 3PW4A 5K8OA 4QU7A 1S9FA 1I1GA 4QR1A 3V72A 2QLJB 2EPIA 3NGKA 4ZP9A 1J53A 1RTZA 4HHTA 1Z1ZA 3T9NA 4E89A 1NGFA 2FD2A 4DU3A 4YFKA 5DETA 3GZFA 5K9FA 1XK8A 2IVMA 2KW4A 2JLEA 4I6MB 2F8MA 2LECA 4Z6CA 1NGAA 5JMNA 2XZWA 5CJ7A 5J2NB 5GMDA 3C6HA 3CF5L 2H3IA 3MCSA 4QYZK 1YRTA 1A7GE 2DR6A 1RA6A 2VBYA 1ZBUA 4O23A 5LJVA 1VQKN 4K5RA 4W5RA 4O3SA 4PWWA 2HCFA 3RJFA 1N5TA 2CQ2A 2QW9A 4FLZA 1NJWA 5H9FJ 5FPEA 5A0LA 2PEHA 3D28A 2HBMA 3AVKA 3CMQA 2L9NA 2KMDA 4Y2AA 1RTIB 3NKYA 1QY7A 3I28A 3OXGA 2CG8A 3M8YA 3C15B 4PAAA 4CJLA 1FRJA 1BA0A 3ICLA 3Q8UA 1D8LA 4FF4A 1RJJA 3UE2A 4J9QA 5ETMA 1WELA 2R3VA 2KJ9A 2F8LA 4EI2A 1S1XB 2ODGA 3V6DB 4F0MA 1V3SA 3NE6A 2XCPA 4AHCA 2F76X 2OEKA 2OKQA 5E3CA 4DL4A 4UB3A 4BG8A 4IQMA 3D6RA 5TZVA 2G9OA 3QZ8A 3PX0A 3N97B 2DKXA 4DSEA 4JKAA 4HCCA 4CFDA 5KGXA 5BOMA 3BM7A 1SJ3P 4DJBA 4KHPF 3CI5A 4OYZA 2PFDA 2VFRA 2AJ1A 3O4NA 4UOCA 4NXMJ 2C42A 4IZ9A 3HLUA 1KQKA 1HNIB 1VHFA 3P39A 1Y3JA 1PC5A 2APOA 2R42A 3RVCA 3S3OA 8ICUA 4C3LA 1R8HA 5AI0A 3UO0A 4Y0FA 1TFYA 4RUCA 4X65F 2ZWPA 1OQ6A 2A5XA 4QW8A 2NZTA 1S72N 2BVZA 3TAMB 2VQEF 2COLA 1SI9A 2W4PA 4EWTA 1LKYA 4M3UA 4AF1A 5KTQA 3QMLA 2XCAA 2WW8A 3O2IA 2BZFA 3FRZA 2JXJA 4M5GA 4LF4K 4DV0J 4KT0C 2P9SB 4TQSA 3PKMA 4ZJLA 1ZQZA 4EO8A 2DHSA 1U1PA 2VKRA 4M3WA 2ZH5A 3VCDA 5KFFA 1SBRA 5KI6A 5AR0A 3J7AN 1QSSA 4F5RA 3ZZTA 1UW9A 2AJ4A 1HR0K 4HYKA 1T3NA 2AEJA 1S9EA 4L3KA 5KFRA 4FPRA 2QSFA 2NYVA 4B9MA 1EQ0A 5ETTA 5J8YC 2ADBA 4RCHA 3PJWA 1VQOS 3TZYA 3DLGB 5D77A 3RMDA 5GMEA 5ALRA 3NGSA 3GIRA 3AT1B 4ZLPA 4JI2J 4JS5A 2ZHOA 2RDJA 3IMQJ 4X66K 2QFJA 1SGGA 1COOA 1VJ5A 4EK2A 1VBKA 3R1XA 2BPCA 1QDUB 2KXHA 1RACB 4FPIA 3V7LA 4BR7A 4JI5F 2P9NA 3Q2SC 3QU7A 3JAMU 4YOWA 2G09A 4GVMA 3T1HF 4ANDA 2ASMA 4PG6A 1HNZJ 1B92A 1R6YA 4PCQA 3OPKA 5KG1A 3IM9A 2Z1HA 3THXB 3LOUA 3LWLA 4CEBA 3D68A 1XMQK 1N5WA 4QZCA 4IQTA 3ZSZA 1OPZA 3ZDCA 3O9SA 2QLBB 4P2FA 3AVMA 2PD1A 3G82A 1SS6A 5HO4A 4B1UB 3SV3A 4DOCA 4B3TF 1MN8A 1QQ7A 4X62K 3MM9B 1GX5A 4MQ3A 3CGIA 3QRRA 4XQ8A 2GTDA 2H48B 2H3GX 1BCOA 1ZQHA 3VENA 3F2DA 5E26A 1RTHB 2DHAA 2KHQA 2HK3A 4PJ0U 2VPXB 3HT0A 4EFAC 5GINA 3Q8RB 1QQ5A 3DXKB 3I0SB 2A6OA 4KGXB 3Q24A 1KOOA 4IQUA 1YITN 3OFEA 4PHDA 1MWZA 3CCUN 4JKCA 2MKHA 4M04A 1GX6A 2J4RA 1UPMB 4JS4A 2V8HA 1PKUA 4ED1A 4AM6A 5ITHA 4U8YA 3RJMB 3Q8SB 2WB4A 7ICHA 3UCGA 1DBDA 4LFCJ 3H7IA 2ESEA 2RQCA 2HOIA 4M6WA 4CW7B 2XMWA 3WKDA 4PYDA 3V6JA 1U02A 4JI8F 2ZF5O 1ZRMA 3PJXA 2QG9B 4PL8A 4M7XA 2ZJRL 2F9JA 2K8GA 2RF2A 4LRAA 2Q3SA 2HS3A 5AKEA 2W2PP 2HOEA 2CH5A 3AY9A 4RQ1A 2KT3A 2KHOA 1DK2A 3O6QA 3F56A 3SFGA 3RJGA 2CYYA 4DFDA 4XDDA 1IXKA 4NYFA 1CC8A 2IVNA 2DFHA 3QGIA 2DVIA 1VQLN 2OMOA 2DNZA 4LSZB 2W9BB 2HYIB 4C8NA 2EG1A 5K8PA 1FDDA 2BBEA 1RXOB 3ATUA 1KTVA 2XMAA 4BC2A 2WAQF 3B82A 4AHRA 3ENQA 4DSKA 3DGPA 4EMDA 1ZQKA 1UKUA 3MM6B 5C42B 3RBZA 2PFPA 2Q3PA 4IWVA 1HMVB 2UXCK 1KQFB 5DGBA 1T4GA 3VEOA 3IAYA 3CCEN 2F96A 1M5PC 1VSEA 4F7VA 1MA9B 2GNKA 4OJPA 4CM2A 3J7YU 1QZ5A 3AA4A 3C6AA 5KFXA 1YHQS 1RPLA 3X3UA 2NQPA 4MYTA 2KFYA 4PEOA 5I3UB 4MJKA 5GAHI 4JKGA 1NMDA 3L5KA 4M63C 3G6ES 2EBEA 1KTQA 3FFIB 3CXCM 2MJUA 4RZRA 1KKHA 1URRA 1SV5A 4I2QB 2Z4PA 4DO9A 2F8KA 2POKA 1D5AA 1BWFO 1WCNA 3J7ZO 4MLEA 4IOAL 3JTPA 1O1WA 2MMYA 1W2BM 3ZTOA 4HHUA 3BQ7A 2I5JB 2AV5A 2I6XA 1OH6A 1UT5A 2RHFA 1W7WA 2V6AA 5M2RA 3SD7A 3C2LA 1CJVA 2AGOA 3OYMA 2W42A 1X5SA 4W5OA 2EQYA 3CIPA 3MXMA 3MCOA 2WHOA 3HSDA 3MMVA 4K4UA 3FQKA 2VC0A 2EVZA 2AZ1A 3PY8A 4OL8A 4QS7A 5KQDA 4DUYJ 3CVKA 4KLDA 4HDGA 4RQ0A 3ZTPA 2R7VA 1U0SA 4ZPTR 1ED1A 4IDHA 2IBKA 4WJBA 3OXLA 2A40A 1VQ8S 4G1QB 5ALOA 1CZAN 4DV7K 4YR2A 1EQMA 5B8HA 4OKKA 1RWXB 1RP5A 4QZGA 3THYA 1WUDA 3RMCA 1JQGA 2LPEA 3MPVA 3C6UB 3QJPA 4CZEA 5GAEI 9ICIA 3D0IE 2G8KA 2OZSA 5AICA 3PACA 4OI1A 2BANB 4V19S 2F4FA 3MGHA 1TKZA 1B70B 3MTKA 1VQSA 2AYBA 3CCRS 2EFOA 4OYPA 2NXCA 3I56S 3ZTQA 4PL7A 3NH1A 4BX9C 4E98A 4JI7F 2HHSA 1U8WA 2IAJB 4ED3A 1WSGA 2Z57B 3OYGA 8ICKA 1YVNA 4ZPWR 4MKVA 1FRLA 2IHMA 4RUBA 4NLSA 3EM1A 2ZD1B 5LSLA 3O0FA 4JI3J 2JMGA 3VPZA 4NMXA 3I55S 3GZ7A 3H5XA 1JN3A 3NOCA 4DV2F 4MAKA 3M05A 2BDUA 3N7PD 3GTYX 3HVAA 5HR7A 5FP0A 1HBNB 1X31C 4XUSA 4F4AA 3MK6A 4K4YA 3TOQA 3AB2B 4YN3B 2R4FA 2QARA 2NSCA 4JUZA 1LXJA 3LDPA 4F36A 3HULA 3QBWA 2G1HA 3QFWA 2PYJA 3JQKA 3X1LB 3QO9A 3AAWB 4FF1A 3GB0A 3QIDA 3DN9A 3RJKA 2B6AB 1HWJA 1V3ZA 5A8RA 4KX3A 1DURA 3ICXA 4URSA 3A0IX 3VQ5A 3B78A 3V5RA 1JCGA 1ZBSA 2DFEA 2OPSA 5K14B 3F2BA 4QW9A 7FDRA 2FY8A 4KLHA 4P75A 2D0AA 3UQ0A 2XHCA 3M32A 4OI3A 3IFRA 2M8HA 4DR6F 2QIFA 4J37A 2KFNA 3C1ZA 1CUKA 3K9JA 1FT8A 1REVA 3DLKA 3GG1A 4BE2A 2UP1A 1VRUB 5DRKA 3G8TA 2R2TA 2ZUBA 4I0WA 1FERA 1HRHA 2UXBK 1I51B 4F92B 3WNGA 4R63A 3AJ2A 1TE2A 1GLDG 3VF6A 2D74B 4JI6J 2J6TA 4WFZA 2WONB 1IN0A 1MSWD 2MQMA 3DAWA 4Z4CA 3I76A 2U2FA 3CCSS 1K8AT 3PRVA 3FQLA 4BG9A 4ZK7M 1TL3A 3ZT4A 4NLZA 3M2VB 1WN7A 1IKWA 1JLCB 4EX6A 4Y2QA 2Q31A 3H3OB 4ANCA 3W63A 1SV4A 9ICNA 4OX8A 2ZH8A 3OW2M 3SBTA 2FDNA 4DV3J 5AKKA 3R2DJ 4LF5F 4X2BA 4RUHA 4X4UA 2BHNA 4NV0A 3ISND 2HRYA 1HUXA 2BM1A 2LFVA 3SXLA 5AQGA 3K5PA 2GX8A 2XY7A 2HHXA 5DS7A 4WFBL 2M0NA 4RPFA 4Y2MA 1BPXA 5E3QA 2J9DE 5IXUA 3C94A 1D9FA 5DM6Q 4CCHA 1K0TA 3C2MA 4MFBB 3FBCA 4DCOB 2YJFA 2EEYA 1VQNS 3RW6A 1IQTA 3AA9A 3DOKB 1BIZA 1NK0A 2O8DA 4LSLB 3MCAB 4K0KF 3HPHA 2R7XA 1Z00A 3V9UA 4DUZJ 1TK0A 4FZVA 3Q89A 1WYGA 3CO9A 2C3MA 5FDLB 2OO4A 4URGA 4B3RF 3J81j 5KT4A 3CC7N 3VTHA 3FK4A 2UXDK 4E7JA 1GOBA 1BHNA 3SQGA 4U7UK 4CYUB 1RWNB 4B3SJ 2QK9A 2FIUA 2E9ZA 3WNHA 3DCAA 4RNMA 3IDHA 3O3HA 2UUBK 3GIIA 2ZIWB 4LSNA 1YJWN 1GMUA 1I94K 4K50A 2CNNB 2FJEB 3ZSOA 3MMCB 5J0SA 2F4VF 4MHVA 3PSIA 4ZPCA 2RNEA 4LFBF 5CWRA 1RAAB 2I9SA 5AQUA 3HPOA 4ZCIA 3KUEA 2IDLA 4Y1DA 3MABA 1LKZA 1QAIA 3MDAA 5HP1A 1T9XA 3CJKA 4E1JA 2DH8A 1IR2A 2UVWA 2KVQE 1QSLA 5I42A 5IIKA 2ZHAA 2QWPA 3R6MA 1IBLJ 4RQ5A 1RDWX 1TUYA 1RHMB 3HK2A 2CPRA 5KT3A 3Q7BA 3GR1A 3BS5A 4J7CA 1PO6A 3L0QA 3R6LB 1F5SA 2H5EA 3C6TA 3HJVA 4OZ5A 4ECSA 1W97L 4UY8O 2C2MB 5AQQA 4BRIA 2YB1A 4USIA 3HSZA 2YHYA 4K7QA 1XSNA 2NPIA 4BC7A 3HDSA 3CETA 3BO2A 1T44A 3NVVA 1BVSA 3GIKA 4P2HA 1Q8KA 1CJKA 4FS1A 2VG5A 5ETRA 4LZDA 4QIEA 4C8ZA 4P74A 3KLHB 3GFXA 1B4SA 2YKAA 5BYQA 1P9QC 2LYHA 2KHDA 3MM5A 4LFAJ 1B64A 3M9NB 2YMLA 8ICGA 4DR2J 3IA0A 1TKDA 5AKGA 5IC4B 7FD1A 5LMNJ 2QFIA 3RBDA 3HBTA 9ICTA 3TJAA 5KOWA 4CIGA 4JKFA 1KD1O 4LR9A 2E5LK 1FEEA 5L39A 4JHDA 4IH5A 3Q7CA 4L74A 3M8RA 1VJWA 4E8UA 2F8TA 4HVZA 3AA8A 3KXDA 4LVNP 2EW9A 4F4WA 1DQ8A 2PFNA 4CTAB 4R8UA 2NRTA 2ASYA 4NA3A 3O3GA 2IC3B 5JVGQ 3V4MA 5JVHQ 4KJIA 2V4JA 5J0TA 4QU6A 2FHJD 3RH4A 5J2PB 4C6AA 4B1YB 5KG7A 1P7DA 3LPTA 2J76E 5E3PA 1RBRA 3PMNA 5F2RA 1JX4A 4CIFA 4O4RA 3MMAA 1X60A 4QZIA 2V2VA 1OH5A 4KFBA 1C0UB 2W4DA 3F0NA 1XTZA 1OH7A 1VJQA 3AA3A 1IBMK 2E5HA 5KPRA 1NGEA 2QE5A 3PYDA 1IJFB 2BRLA 4G1IA 3E9LA 2D9OA 1RAEB 2W2MP 3BN4A 1IV8A 4NL9A 4USAA 2N7CA 3G6VA 5ALXA 2LMRA 2AX1A 3VQEA 3UWTA 4LF8J 3M9OB 2VKQA 1S76D 3BUZB 1TL1B 3AO5A 4WCEL 1O0PA 5DB6A 3D1OA 3AQFA 4RUAA 2AZ3A 2MHNA 1C1CA 3ID8A 1HWKA 4FK4A 4ELTA 1ITPA 7ICMA 1VDVA 8ICPA 1W9HA 3NEKA 3I5CA 1NK9A 3FGUA 1R31A 3NNCA 2YHXA 2IM1A 2VFUA 4ILHA 2RAQA 1E4GT 3NMAA 4CEFA 4ZIWA 4AHTA 4YP3A 3FYHA 1U49A 2OTJS 3KVGA 5J0PA 1H0HB 1R0AA 2H5XA 1Y7PA 1WB9A 3PW0A 3D2EA 5D3GA 3EMTA 2WF8A 1JJ2R 2N4DA 2KRBA 3UIQA 4UAYA 1K8KA 4EX7A 4RWTA 4QYZJ 1H1VA 2JZBA 3D2FA 4L6V3 4GO5X 3QYYA 2QA2A 1WLJA 3TX0A 4FSVA 4OHWA 3C14A 3NBPA 3ZZRA 2U1AA 5J0XA 1N56A 4RBUA 3CCUS 4OLAA 6AT1B 3CCMN 5CHCB 3JS6A 1Y9OA 4JKDA 1IR0A 3Q22A 1DT9A 2O5DA 3OYEA 2WB1C 2VA3A 3HD1A 1GT8A 4OJOA 3NVZA 4ZJQA 4F3TA 1QE1A 1MLAA 1T9TA 2F1FA 1DEJA 5GVQA 4GXJA 1SC4B 4BR5A 4DWIA 4MEYA 4GVLA 4NL5A 7ICLA 4WTYA 3W8GA 3IV6A 1YT3A 3MXIA 4MH8A 3V81A 3MHYA 3GJQB 3ILIA 3GYGA 5JJBA 1OY9A 3H1VX 4RQ8A 2ZZNA 5I4MA 4KYZA 3C65A 1U2VA 1VQ7S 1HBMA 5ADXH 2AJ0A 4DTSA 2F9DA 1JJ4A 5EY4A 1ZQXA 2KJ5A 3K8VA 3A8EA 5AK6A 2D1CA 5IT9O 3I82A 4FNIA 3FZHA 4UF4A 4BC5A 4CNQA 4E7LA 1VS3A 1VRTA 4LY7A 5AFUA 3HP9A 1SV0A 1UVMA 2E5JA 3P1GA 5CCLA 4WYLA 3D2QA 3MECA 4W5TA 1QUPA 1PGZA 1IWAA 3F5AA 2J7WA 2EFPA 3W64A 2XLJA 2JC1A 4FJKA 5L1LA 5IIMA 4OX9K 5ALHA 3CCES 2VFVA 4GY2B 4I2JA 2KNJA 1X9SA 4YB7A 4O5BA 1UOCA 2JVOA 2I9GA 2QTDA 2NXUA 3U1LA 1S9EB 2QTWA 1RWUA 4O5KA 1KC8T 1ZQJA 4DV6K 5MLCV 5AK5A 4MK8A 1LWEA 3FSIA 4P4OA 4JI5K 4K4VA 2XNQA 1JJHA 5EOZA 5EXWA 4ICAA 3HFZB 2WVFA 1KVIA 4CH1A 4LT6A 4TXSA 1YJ9S 3ZX2A 3TA2A 1JLBA 5L9XA 3BH6B 3BYPA 1VQPN 4CZKA 4O8KA 4OLPA 4Z37A 2P9IA 1ZOLA 4DB3A 4LRFA 2BPFA 4LF6F 2HHHK 1RDUA 4FJ5A 4DMNA 1WAFA 3PIOQ 1KQSM 2VYPA 4KGMA 1LEOA 4LF9K 2WVCA 2E8AA 1I5OB 4DTMA 4BE1A 1M5HA 3HWTA 1RDAA 2VPWB 5IT9Y 3DYAA 4NM2A 3HOTA 2JHDA 2E8PA 5J2KA 3IS9A 4CGJA 1DQAA 4NRUA 2L9DA 1Q78A 3PMLA 3RH5A 3CUNA 4F4ZA 4DX5A 4DF4A 4X66J 3VQ4A 4CJWA 4KY3A 3ZDDA 3GG0A 5DO2A 3GL1A 4F2SA 3HHDA 1NGBA 2BYCA 3G82B 3NGYA 1FRIA 2IVFB 2PO4A 5CZ2A 3L8BA 3TAFA 3WXIA 3UFCX 5HRSA 3L2RA 3S1TA 2XZDB 5KFSA 3V1OA 1Q7YO 2YH0A 4FJLA 4DL0C 3R1LA 4F3OA 1I3AA 3M6ZA 1N5YA 3QU4A 4J9PA 2GJ2A 3LP1A 5M1OA 1NK7A 1QHTA 2WW4A 4ZPBA 4FWOA 3KK1A 2CXYA 4N56A 4I7FA 3T9ZA 3I6PA 2Z1IA 3SDEA 2CRXA 2YHBA 4DV5K 4I68A 2HQCA 4CEZA 4DSFA 2ZJ8A 4JEPA 2BQ3A 2B0CA 2RRAA 4UQTA 4ZN3A 5ETSA 8RUCA 4H5RA 2ZUDA 3BSAA 3VQAA 2RLTA 1NBEB 3DLBA 2XRIA 4NLVA 3EZ5A 3P5BP 1UEKA 1RWOB 2L48A 4B6JA 4QZHA 1SJ1A 2XMTA 3G4SN 4P7TA 4M6WB 2DIUA 3SCJE 4BBYA 1FWPA 4TY8A 3F44A 3PIPQ 1PJ7A 4KKOA 2I8EA 2KK0A 5AK3A 2ZC3A 5A2QU 5ALFA 5DDOC 1NU0A 3RGIA 4DF8A 4CRXA 3TP2A 4CJRA 2RS2A 1FFWB 1L7OA 4UZBA 4JV5J 1T8EA 3TR5A 3LP2B 2E29A 2V52B 3OSPA 3GYNA 1VISA 2O8EA 4GVEA 4JI4K 3IFEA 4M5NA 3KKAA 3O1LA 4GKKK 1WC5A 4YXJA 3JSYA 1AA1B 1NB7A 1GAOA 1JLFA 5C2GA 4KBOA 1E4FT 5CABA 3TZXA 1QVGM 5CAAA 4CBUA 2FPLA 4RBTA 3J7YI 3DLJA 3D6HB 1Q86O 1IJEB 2LYVA 2XLIA 2EAOA 3MZIA 1DKGD 3O4QA 3A13A 4CZGA 4UAUA 1RYSA 4UUWA 5AKXA 5HJXA 2MLXA 3VAFA 4P4MA 1CLQA 2Q36A 1XNSA 4J2DA 1JLAB 2FJVA 2CGKA 3NRZA 5DDMA 3A3NB 3E2EA 2NNWA 2MYFA 1SL0A 1WDDA 2XHBA 1RBAA 3PHEA 4DV4F 2VZ9A 1Q81T 2FLOA 4YG2A 4Z0UA 3N28A 4C8YA 5T41A 4DXLA 1RWVB 2XG8A 1QQNA 2B51A 3ZDBA 2ZVSA 4JKGB 5B66U 1NJZA 4X4RA 2R8GA 4ED5A 1N6QB 3H4BA 3KJVA 4RQMA 5AQWA 4JMUA 3PEHA 4FWRA 2ZZTA 4DPUA 9ICAA 3OS2A 2E7VA 2ZIXA 1SZPA 2UXCJ 2YXLA 4BRLA 1KFTA 1T9UA 3EGNA 2MZSA 3KLGA 5DQHA 1WC1A 5AQXA 3UE5A 1KN6A 1HI8A 1CJVB 5EWGA 3NUQA 3W2VA 2WMMA 2F9WA 2XM3A 2G1DA 2RP5A 4KAIA 1KXPA 1K1QA 1SQGA 5C7PA 1U0HA 2H5JB 4JK9A 4EGLA 4EBDA 3NS1A 3ZX0A 3WIVA 4Y2CA 3AN1A 4NA2A 2I5HA 3WBZA 3O5BA 5KRSA 3WEEA 4XIUA 4FLWA 2ZDOA 2HK2A 2HNDA 5EOYA 4IO8A 2GH1A 2ETJA 2ZJQQ 2OJ3A 1N0VC 3EL2A 1MROA 5AQTA 3OR2B 1BQNA 1HX1A 1RAGB 1K9MO 3IKMA 1PSDA 1RE1B 2VUGA 4DX7A 1NDPA 4YOVA 2HS4A 2A2CA 1FE0A 2W03A 1CBKA 4ECVA 5A6PA 2JWKA 2CDRB 3MFIA 4WJ3B 4YY3F 3VQ6A 1U8SA 2HHWA 2P6TA 2XI9A 4DCPB 2KG5A 4HI2A 4RWWA 3WK6A 4IRCA 3CM6A 1MQ3A 5HHHA 4PRFA 3U4LA 2DFLA 3CJRA 2G0AA 3VHQA 1DHMA 1N8RT 3N5BA 4BRMA 4X64K 4O0NA 2FBVA 4QOZB 3WHIA 3ENVA 1ZBLA 2JH1A 1VI7A 5C2CA 4AL7A 3QESA 5JRTA 4EELA 3I8DA 3C23A 3KK3A 1SWWA 4N5SA 1ZQMA 2HMIA 3ZZOA 2IFXA 1PAEX 2QL7B 4DFPA 2VBXA 2ATQA 2YWFA 1UZHA 2QT7A 1JRPA 4CE6A 1NGIA 3R97A 4BRNA 5KG4A 3ULDA 2DNKA 5J2BA 2JOQA 4IO9Q 2IGIA 4FJIA 1S0MA 5F8LA 1Q3UA 1R27B 2PZSA 4FO0A 5K5MA 3VGVA 3MR7A 3NRBA 2M9NA 1P1TA 3LA0A 1FFGB 2WTFA 4FPBA 4UB8U 1YWXA 3KHLA 3G86A 3QO9B 4YD1A 2V68A 3M1VA 4FZZA 2F1HA 1FWKA 1NGCA 5A8RB 4UOFA 3Q86A 2EK6A 4ILMA 2FB0A 4ER8A 2ROPA 5J2CA 2OPSB 3QGPA 4MFCA 4K41A 2YX4A 1DXSA 3KUHA 3CCQS 3O8WA 4KSEB 3SQ0A 4YOXA 2MSTA 3M32B 4IJNA 3OYFA 3HOSA 2RQMA 4QR0A 3NRWA 4CT9A 1FFVA 1REVB 3DLKB 2VA2A 1E6VA 1OH8A 1Q4RA 3F5EA 3VQQA 4CF8A 4M3ZA 4OD0A 4KHSA 4RQNA 5BR9A 3IAM9 3M7VA 2ZJPL 1TVAA 2GJIA 2HFUA 3ET6A 1RI7A 1ZETA 1NH7A 3H90A 4H8KA 4B8AB 1RT6B 3S9HA 3NMUA 4CM0A 2VOOA 4A8WA 1M1KT 1WF2A 5JVGL 4ERDA 1TL3B 2PN6A 5J2JA 2OPPA 2HKEA 2BJ9A 5JVHL 4DL7A 3RH6A 3NGRA 5H9EK 1IKWB 5AM5A 3M6GA 2DB1A 4QZ8A 1RM6C 2YKNA 2A1AA 4C8LA 4CFCA 4DR1K 3B9JA 1HJRA 4I2CA 1WOSA 4JI0F 3LDOA 3N4QA 2UXBJ 3KZXA 1RXVA 2AEMA 4USJC 3P4UB 3MXHP 3O8MA 2LKYA 2KKZA 1IO2A 4CO4A 1K5OA 4DTOA 4FXVA 2IMWP 1EZZB 2AJ2A 1TAMA 1MG7A 3M6VA 1NPPA 3AVNA 2RS8A 4PUOA 3F2CA 5T7LA 2MQLA 5E7OB 4UARA 2MB0B 5AQIA 3UXNA 3OR1A 4QS9A 4Y1CA 4IJAA 3LVVA 2NYIA 3LZIA 1ZQBA 2QMWA 4RO0A 2BZ2A 2DY9A 2PMZC 4JI1K 5F3TA 1CJTA 1Z00B 4F2RA 3O5TB 4WKRA 3JAMO 1H2UX 4FF2A 3QFPA 3EGVA 5HLFA 4OV1A 4BREA 4QWEA 3M8WA 3SQGB 3W1YC 1F9EB 2IOHA 3AVJA 4F5OA 3D7SB 4QWAA 4LSNB 1XMOK 5J0WA 3K75D 2VQFF 1AUSL 2XULA 4DI6A 4KLEA 1O03A 3FM9A 3KNGA 3MEKA 1J2NA 4TU8A 2VCPA 3QETA 1WF0A 3MN7A 3U3GA 5HP1B 3QUQA 1UFLA 3ID6A 2E6LA 2IM2A 5I42B 2BKEA 4QPTA 4M95A 4JP8A 4OZ2A 2RDDA 1NK4A 1R8BA 4QJVA 3IM1A 3RWUA 4JKBA 1NJIT 1X40A 2HSTA 2DTJA 2UUBJ 2XI3A 3HCXA 2LKZA 4YMEA 1L3SA 2O1PA 4CJQA 4R5PB 3WK7A 2GMHA 2WHEA 2YQ1A 2P51A 3ZXWA 3JTOA 2KRRA 2YNHA 1CJKB 5KT6A 2VG5B 2XYHB 4WXOA 3GWCA 1IBCB 2VWBA 5GAGU 3QGHA 3B0YA 4XTTA 1WBDA 1VSDA 5AKYA 2XI2A 3JAMY 4CT8A 2VODA 1T02A 2WBNA 3E9OA 1RDRA 2XGPA 3O9TA 2YJEA 4BDPA 3VQCA 1UW4A 3MX2A 2LQ8A 4KB1A 2ZH1A 1HUOA 3MOZA 3EW9A 3B6BA 2LEAA 2A3ZA 2NRWA 4USTA 3H25A 4JHDB 3DU5A 4ISFA 2XS5A 2C1EB 2JLGA 4GKJK 2X6SA 1YIJS 1X4BA 2F7VA 4R8UB 4DR7F 4QZVB 4US9A 2HQDA 1NDLA 4H4MA 2KIVA 2VIXA 4AYBC 4NEZA 3IP4B 5KOXA 4RW4A 2VG6A 5C24B 3OTQA 2V4JB 3A0HU 3M30A 3CMAN 2EAPA 4CO2A 3IXQA 4RQ3A 3EWAA 5BRFA 4Z2XA 3S6JA 4JAXA 3K2PA 1UVNA 3NH0A 2AYEA 3OA9A 2E5LJ 4UB6U 2B5JA 2H9ZA 4CLYA 4PZVA 5ETVA 2DY4A 3I31A 1S8OA 2B6GA 4GIBA 2V34A 1MA7A 3MMAB 4B3SF 3P31A 1ZQRA 1BPBA 4LF7K 2LXIA 4KHQA 1WOPA 1FKPA 3HT3A 3QAEA 5THWA 3ZD8A 1N36F 2JFDA 4QWCA 3EVOA 2P9KB 2YNIA 2HNZB 2Z56B 4DL3A 1J5EJ 2LA4A 3ITHA 1JNZB 1W25A 3WK9A 2DNOA 3B54A 2PA3A 2XEXA 3BKUA 4ZVSB 2JR5A 4A8OA 3RSEA 1RB0A 4BS2A 3WX4A 1GK8A 1T05A 3DM2B 3BEGB 1IBLF 2C2EA 2D0OA 2DR7A 1RQLA 1GQEA 1NGHA 3LDNA 2BJDA 3CJ5A 4KH5A 5BOLA 4Q44A 4AHUA 4B1XB 1JK9B 5ETOA 4JYAK 1UQVA 5IILA 5E79U 1S1WA 2V2ZA 1NM1A 1F5AA 4YB5A 4E19A 1YUWA 4Q5VA 3W60A 4M42A 4BRFA 4FJNA 3BP8A 3RMAA 3OYKA 1MDUB 1TAQA 2PFFB 1R0AB 2OD4A 2DQNB 4DR2F 2HRUA 4B9SA 1AW0A 1D8ZA 3P6YC 3D2EB 5D3GB 1UVLA 4P10A 3FBEA 4E3SA 1KR4A 1T03A 1A5XA 1ZXOA 5LMNF 1K8KB 2VJ4A 5B0GA 3RRGA 3MR2A 8ICYA 4FYYB 1U04A 3KKFA 2JZBB 8ICVA 2GC8A 1BISA 2LHTA 5F8JA 3D2FB 4OZNA 3AD7C 4QOTA 1AROP 1JB0C 1FX2A 3C14B 1OQ3A 3NBPB 4BXOA 3OYIA 2X78A 4N47A 4WF9L 4LQ9A 1AT1B 1XNQK 2WOMA 4KHNA 3LDAA 4IR1A 1ZQEA 1U25A 2JWNA 1U4BA 2G8IA 1X9XA 5ALKA 3UDVA 3OPXA 2JVRA 2P9PA 1K0VA 2JEGA 1BHLA 4ENOA 3G4SS 5IQQA 4RKUC 4HLBA 1ZQCA 4A57A 2DGUA 2KG1A 2ZOMA 4X4VA 4DMZA 4EENA 4MK9A 2XS7A 5CHIA 3P96A 3NF9A 2M88A 4CLPA 2YTCA 1Q5VA 2VPYB 3Q8MA 3T79A 1CC7A 2AIRB 3V81B 5KFKA 4A8XA 1KFSA 3ONQA 1AXQA 4JLHA 4NCGA 1UHUA 1TV9A 2LVWA 2D0CA 1ZQOA 3IN5A 3CDAA 4IYQA 3I32A 3TTCA 4FVCA 4UAWA 1QVFR 1HBMB 1T6CA 2YWWA 3BY5A 4J9SA 3SQ2A 4X5VA 3QGGA 5ETQA 4F0KA 2G8WA 7ICKA 1EHWA 1DTTA 4LF1A 1F1BB 4DCJB 4PHEA 1P90A 4JBCA 3CRXA 1VRTB 3ENWA 2KKVA 2LQJA 2RRBA 3N4WA 2LDYA 4NLCA 1V5VA 2Y9HA 4KTQA 2MQ8A 2FJBB 2MKKA 5JLHA 2G08A 1MMNA 4M94A 2ZDPA 1WAJA 3W5YA 1U1KA 2B9WA 3TKAA 1EP4A 1M90T 2FZKB 3GDXA 4O3OA 2B9EA 3WDOA 2BUNA 3H7HB 5I9EB 4RQ7A 3RUBL 1ZQWA 4I2BA 3D1QA 1CRXA 4I6MA 2HBRB 4FS2A 1KVBA 2NXEA 1LWEB 4LRCA 4LR7A 2MQOA 1YQHA 3J80O 3OL8A 1G4CA 4DTRA 5D6GA 3AAQA 3CQXA 2FJXA 3UNYA 2PT0A 1JMSA 4P2MA 3WIUA 1X3MA 3VF4A 2R8JA 1NGGA 5CZXA 4M5HA 3OFGA 1TUGB 3UR0A 4OX9J 2PI5A 3MEGB 4XA5A 2P9IB 1VMBA 1X5PA 2F8EX 2ZBIA 1XBWA 1OVYA 1IUJA 2ZXHA 4ZVEA 4A8EA 2QB0A 3AOAA 5KT2A 1ZRNA 1B3TA 4DPWA 1TVRB 3SBMA 1T95A 4DX8H 2MY8A 3P3DA 1DGKN 4HAIA 3U1NA 2UYTA 4DL6A 4NXMK 4CHNA 3IS9B 1X9MA 1YJRA 1B7YB 3D7EO 1RABB 3HF5A 4QYRA 4ZCLA 3FSYA 2BE2A 3NNAA 3OJUA 2E2QA 4JKHA 4X84A 2DR9A 5KFNA 1C1BB 3KKSA 2HHHJ 5K8NA 1SKSA 2W4CA 3IMXA 4FKYA 1SKWA 4O5FA 4CJ4A 4F71A 4ZVTB 1ESVA 5KFHA 1NMNA 1S5LU 3CC4S 1TMJA 2QM1A 1N0UA 4MLHA 1S1TA 3O3FA 3TSUA 1SZHA 4UB1A 3ISBA 5GIOA 3EKSA 1U1LA 1NKBA 3C5FA 3KLEA 4DV0K 2YMMA 4BRGA 2HFVA 1HNIA 1I39A 3KK1B 4Y2RA 3PYGA 3VGKA 3J80Y 4I7FB 4U7UD 4UT4A 3AU6A 2KH9A 1HL6A 1VBZA 4CJ7A 1FDBA 2MTLA 2V9WA 1QQMA 4M3RA 1X2IA 5RUBA 2KQ2A 1JWWA 5KG6A 4CJTA 1IBKK 2KI2A 5AI8A 1VIXA 5K20B 2QLWA 5BPMA 3H0PA 3G87A 4EZ9A 9ICSA 1FW6A 3T1YJ 3VAMA 1FEZA 3MGIA 4DL5A 1L3VA 4FM0A 2E8NA 2RUGA 2YY6A 2G13A 4CLSA 2QZ8A 7ICSA 4M8LA 4NXNJ 1X4GA 3I33A 4LH4A 1ZM4A 4JI2K 1ZQUA 2LBOA 1KN5A 3EGZA 5AJ3K 2FBYA 2B4VA 1S48A 1S6UA 1EKRA 4TY8B 2C2RA 4KKOB 3R7BB 1HIWA 1RHJB 4A5AA 3MGVA 3NCIA 4RNFA 1HNZK 2KD1A 4LF4F 2KJWA 3IHQB 4NXZA 4GFJA 5B08A 3G0ZA 3W5XA 4TU9A 1IM4A 4ZJOA 3MN9A 2CN1A 3CW2C 1GMVA 2WVBA 4X4OA 4M5MA 2KHCA 3FZBA 3DOLA 4F02A 2LM1A 2XMMA 1BA1A 1JLFB 2VH7A 2XMUA 3UN5A 3GFYA 3DGVA 4OZ1A 5ALZA 1HR0F 4FVUA 1JKHA 4M9JA 5FROA 5SZTA 2E1RA 3ZNUA 2DBYA 3BGFA 4TQRA 3VEVA 3TEGA 1LOUA 2BE7D 5FPMA 2JGAA 2OMLA 3CF5Q 1A6SA 1F3FA 1WOQA 2WFAA 5C25A 2DO0A 5HNKA 5HI7A 3OVNA 2G8VA 1RT1B 3ETOA 1WNEA 1ZM9A 5EHHA 2AJQA 4QZBA 4X66F 3A0BU 2EZYA 3THXA 2IOCA 2ZWHA 3HKWA 3MD1A 1Q8IA 2NLWA 2O8BA 2A1JB 7ICTA 3QUTA 4ECWA 4DTNA 3HHLC 1KVJA 3KLIB 3HX0A 3O44A 2LA6A 1RT5B 2FMSA 1U2CA 3L7PA 4B1WB 1FJ7A 5KPTA 3KJVB 3M8QB 3HJEA 2WB1D 2QJ3A 2D69A 5I3QA 3WC2A 5FD1A 5DB8A 4FO6A 3UN3A 2R7YA 3ISZA 3D0HE 5DMRA 1XMQF 4PH5A 4PGXA 1H2TZ 3EVMA 4IH7A 1WSVA 3ZTRA 1YK9A 3KLGB 4ZVQB 2UU9J 1DTQA 1NRKA 1XSLA 4LFCK 2WSCC 2KN7A 3VWSA 4M9HA 1M0SA 3W2VB 3FMBA 4RPZA 3K5LA 4ICLB 2AGPA 2NUBA 4X62F 4CHPA 2Q2RA 1RHKB 1PVQA 3HFKA 4TLQA 3JSMA 3OTEA 5J0RA 3LDQA 2LDIA 3VQDA 1O08A 4ANEA 1VQ4S 2E20A 4KITB 1XI1A 3K1RB 2EFGA 3H40A 3CSKA 3P83D 4JWNA 2HNDB 3QEXA 2YY3A 3CYMA 4YDUC 1MROB 1BQNB 2C3UA 4MT1A 1SWVA 1NJYA 4IBNA 1IKVA 1WC4A 2GHPA 3AA2A 2F63A 2FZCB 4JV5F 5KFDA 1VSMA 2ES6A 3PKYA 1RBVA 4JB8B 3L3VA 2DNRA 2V9KA 4EAHD 3HW8A 4PG8A 2OZMA 5KFMA 4BR0A 2YKQA 2AW0A 1QAJA 3LF0A 2YN4A 3RAMA 3L4QA 4IR9A 4P0QB 4Q2MA 4BQLA 4YN4A 2OM6A 4Q2LA 2KEYA 3NASA 4FLUA 3KK3B 1HI0P 2HMIB 3QNWB 4U9RA 1WG5A 2ZBRA 2W9BA 1OO0B 3TAGA 1RXWA 3AD8C 4BR4A 3LDSA 3Q8YA 3U9ZA 1ZQSA 3BO3A 3MM6A 3SJJA 2ZJAA 1OYDA 4M9NA 2W2NP 2ATLA 1LWFB 1XR5A 1X4FA 3HX9A 4F25A 4L73A 5CYQA 4XH4A 2MSSA 4X64J 2PIIA 3W2WA 2QLTA 4C8OA 1WJ9A 2KVSA 5IC6B 4P6QA 5KFBA 4NA1A 2DNGA 2HLUA 4J9VA 4YMOA 2AMCB 4FK0A 1KAXA 2D0PA 4F9OA 2Y8WA 4FPAA 5IIOA 2Z8QA 3GFKB 3M1VB 4E0DA 1WCLA 1SV0C 3HHKA 4H0XB 4CF3A 2UXCF 2QN6B 4M47A 4G6VB 3DU6A 1YZ7A 4RR5A 4DUYK 3AEVA 3KBBA 2MZQA 2DGWA 4IUFA 4CVNE 4JV0A 1ASVA 2FC0A 1KWMA 4DV1J 1NNDA 3P5JA 2DTUA 4BRAA 5KG3A 2W54A 4IL6U 1M1GA 2QA1A 3QE9Y 1E6VB 2UUAJ 2HWTA 2DNLA 5B0BA 3EEQA 1TFRA 2A6AA 2HMPA 3BO4A 2YBVA 3CMAS 3CJ8A 4GC7A 4RT3A 3H08A 3SSQA 2FTRA 1EJ7L 1N5VA 3ET6B 5JU5A 1RT7A 1NEEA 2GJFA 1RYUA 4OYOA 1HJPA 2P8IA 4Y2TA 4UB4A 4ED2A 3CDBA 4CZCA 4YQWA 3EZWA 2HB5A 5AQRA 4C3MA 1N48A 1NKEA 2HF4A 2OPPB 1AYEA 5U47A 3AVFA 1NK5A 4P0PA 1JXVA 2MGZB 2YKNB 3HM9A 4RQ4A 3KHRA 3W9JA 1UJ4A 1XJWB 3CB4A 2NO4A 2E7XA 3VR1A 3PX4A 4J2BA 4DPYA 4JI3K 4OO1J 4J9RA 2K4IA 1FO4A 2KIWA 4XH5A 4USVA 2BANA 2B9YA 2F65A 3WNFA 5EX5A 3NF8A 2ZJ5A 3OT9A 2KT2A 3KHGA 1EO1A 2E3TA 5CE3A 2ZH6A 3M6XA 5KFZA 2IDEA 3AQEA 4WZMA 2GEMA 2IAJA 2AXTU 4GMJB 4N8NA 5LMUJ 3OR1B 3JXOA 1HBUB 1Z3EB 1TV6A 2BM0A 1FFSB 4AP9A 2CZ4A 2P9CA 2GUPA 1SJRA 1WUAA 2ZD1A 1CJTB 2ZJRQ 1NSKL 3OVAA 3L9ZA 2I7NA 5J2AA 4WFNL 4P52A 1HYSB 2KKHA 4KHUA 2PY5A 4OPKA 5TISU 4KLLA 3IBCB 3OLAA 2XYPB 8ICBA 3MF5A 2UUCJ 2WAQC 2DH9A 4M5KA 3T5HA 1RGIA 4QWBA 3ZT2A 5A8WB 4CJVA 1COKA 4JN4A 2G2YA 4KTZA 1GOCA 4AM7A 1PAUB 1NLVA 4G9ZA 5DKWA 2ASDA 3K89A 2J6UA 5AI4A 1FJGJ 3IWXA 3BF4A 3ZCMA 5KL1B 2W7AA 3L4IA 5AE2A 2B6AA 3MPWA 5ALTA 3W66A 3LZJA 3GJSB 5EU7A 2Y1IA 4JI6K 5GAGI 1RSCA 4BVOA 4BDYA 3C16A 1Z4UA 4DSLA 2DFFA 1NI3A 2OSQA 1XMOJ 4WTOB 5J2EA 2VD3A 3AU2A 1NDCA 1R0BG 4RW7A 4NCAA 4A47A 4N77A 3NVYA 2YNHB 3BREA 4CI6A 5F8HA 4RW6A 4BCAA 1T11A 4DV3K 4PL2A 1U26A 3LTOA 4GC6A 2Z2MA 3Q8LA 4YDDB 3LPUA 2KJVA 2HHUA 3CJ0A 3M8SA 2MUTB 2CQIA 4OQJA 1U2RA 1YHQN 1BWVA 4IOAQ 5M1FA 2D3OR 1TFWA 3QJLA 5H1SQ 1N63A 1XQSC 1N33K 3QERA 1RBUA 4J2AA 2ZOFA 4NLYA 3DXMA 2KM8B 3M2VA 2UXBF 2MKYA 3G6EN 3ZSVA 3A4TA 1HI1A 4JV2A 1YXQA 2PAVA 4KLQA 4X4NA 2CPXA 3EXYA 2IVOA 5D78A 5A2QO 3ZD9A 3L3CA 4I67A 4DUZK 1N34J 9ICEA 1S10A 2NCKL 2OELA 3U1MA 3C7NA 4UW2A 1RWWB 4H4MB 1OW5A 2KN4A 3A5LC 3SUQA 4H5TA 3GE9A 1LK7A 4WYBA 4RW4B 2L3MA 2H65B 3PO5A 2PGCA 3M1YA 2FGOA 4NPOA 2HQ3A 1PJ5A 1HARA 3A2FA 1SIZA 3M6KA 4Y00A 2J9DA 4K5SA 4X4PA 2K4HA 2B5JB 3W3DA 3R9KA 4KH0B 3KJQB 1FDNA 2VBZA 4MIWA 5J0QA 1VQ8N 3FUYA 4ZOSA 2ZM6J 1NCLA 4H5NA 2KLAA 2NUUG 4F04B 1WI8A 5L1JA 3N4MB 1FKPB 4PHPA 1NXIA 4MIAA 2D3O1 4CYUA 4PR6A 2R9LA 2ZGYA 1FEHA 5FJ4A 5D4PA 2HVZA 2N3OA 2YNIB 2ZUGA 4USWA 5GADP 2ZIWA 3FMWA 3TO8A 4FJXA 2GMLA 5AQNA 4DFKA 4KHWA 1J2MA 3MEDA 5C5JA 1YF5L 5AQYA 2QWRA 4RU9A 4O0IA 3RSEB 3CCRN 2YKMA 4NASA 4PQAA 3O1WA 2QX0A 1YKWA 4I9LA 2QL9B 2V5HG 2UXDF 2PMHA 3L95X 4Y6IA 2YPZA 3G96A 2LU2A 5A2QY 4LFAK 4LF7J 2UUBF 3PNIA 1OY8A 4YVZA 1I94F 2F8SA 2L41A 2RRDA 4J9UE 1EXNA 1V9OA 5BR8K 4DUTA 1U1QA 2XO7A 3UPFA 3DWLA 2K2PA 2V0NA 3AFGA 1S49A 5AKIA 2M3DA 1WTBA 3UD5A 1XMBA 3V7KA 1FO1A 1MU2A 4F67A 3EPIA 3R27A 4OJGA 3KLHA 1YJNS 1WKLA 2X1FA 3DXSX 1YJTA 4DR3K 1T03B 3K57A 4FJMA 1TZ0A 3BSCA 4NLWA 4JYAJ 3LGMA 4DQRA 3QJJA 4CHOA 1K6YA 4Z94A 4WQ5A 2V2QA 3DHXA 3HKZD 4BXOB 2HHPA 2ZUAA 3IP0A 1A77A 5M1PA 4BACA 1JNRB 5AQVA 3NVKA 2JDJA 3VEWA 2WOMB 5F41A 3DKDA 4HT5A 2XICA 1REGX 2DNYA 3VTIA 3QUBA 2VDHA 4B3OA 4X4QA 5HL7L 2ZKUA 4DR5K 3DHWC 2J8SA 2P9PB 4EUVA 3NDKA 2DEIA 2BE9B 1OPIA 3EZOA 2IC3A 3PSTA 4MO5A 2ZKTA 3LYSA 4I69A 2WF9A 5EN1A 3CPEA 3OTOK 3L2VA 4GV9A 2E5LF 1L5UA 3CJ3A 2DGOA 4LIWA 3LL3A 3TQ1A 2CJQA 3H20A 5IV4A 5J2PA 1H3DA 1Y10A 1D1UA 4QZEA 1TR0A 1Q82O 1RHQB 1EB0A 5DDPC 1XNQJ 4LF8K 1RBLA 4P2SA 3CCSN 3AAPA 3G25A 4TUSA 5CQGA 1QQCA 1TAUA 2NRZA 5J0OA 2A0FB 4PZOA 4CF5A 3MDCA 5F9LA 4WFBQ 4NO7A 1C0UA 1DTTB 1TYQA 4RL1A 5ALDA 5KL8B 2WB1F 4J9KA 1JL1A 4G9BA 4RJVA 4I27A 1FXRA 1VYAA 2A1RA 1F0XA 1MWYA 1S59A 2P9LB 1PVPA 3K7RA 3PV8A 3EUNA 2OWOA 1EP4B 1VHXA 4JWMA 5KPZA 5CZVA 2ZE2A 2XLKA 2JHEA 4OX7A 5KFEA 2MKIA 5IM0B 4KGVB 5CEHA 1ZYQA 1TL1A 1IBMF 3ZT1A 1H7WA 1KVKA 3R7SB 4BRDA 4CJ5A 1V9PA 3OTBA 1VQNN 3BEXA 3QIOA 3QPIA 4KLTA 5T14A 1EWQA 3KZBA 3KNAA 1N52B 3SMZA 3NL0A 1O51A 2EH9A 2NUHA 4PHAA 8ICTA 1YLXA 7ICVA 1ZD3A 3EICA 1NHVA 1YSJA 3KMQA 3D45A 4V19J 5E33A 2BGWA 1NSQA 3OL7A 1XUPO 2QB0B 2J6SA 2WK4A 3PNCA 1ELOA 3RTVA 3RFAA 4FP9A 1SXLA 2KP7A 2FLNA 1NK8A 4AL5A 4ZS6A 5DZ7A 4XRHA 2V51B 4CNZA 5EE1A 2H3EB 3EUB2 2AYMA 1XEZA 3K0SA 3QMQA 4PXBA 2BE2B 4F93B 5AXNA 3PEJA 2R7QA 2IM3A 1RHRB 3RBEA 4KX5A 4FLYA 4K4TA 1KAZA 4QWDA 1ATRA 4UB5A 1K73O 1TQLA 4ELUA 4AYBD 3N9UC 4PA1A 1S1TB 8ICSA 3RU0A 4NYPA 7ICFA 3ZZ0A 1PBAA 5AM4A 2BCUA 3KLEB 1LCUA 4FE3A 2IBOA 2CH6A 4UAZA 3NF7A 3KD5E 2OXOA 2H54B 5DZ6A 3BZQA 2Q43A 4E1NA 1FKOA 2DGZA 3TU5A 2B4UA 1SC3B 2OYYA 3IBWA 3RB6A 4YXMA 3IR5B 1XU4A 3MFHA 4O4GB 1FK9B 5L46A 4CRJA 1F0MA 1KVCA 3ZETB 2BH1A 1WBBA 2BJ1A 3W61A 2WF6A 3OFFA 4MKYA 2X6NA 2GOLA 4XDCA 3T41A 2NYHA 4R79A 2JRSA 3S41A 3MXJA 3ZZUA 3ZEUB 3ZT0A 3NGTA 5HQLA 4DG1B 5ALGA 3TR8A 2RQKA 3C46A 4DKWA 3MAHA 5AHXA 3LQVA 3PFEA 3EDQB 2KVCA 8ICFA 1IBKJ 4CO3A 3I4PA 3MAAB 2BRKA 1CPZA 2KM8C 4Z6EA 4KHPJ 5LSOA 2W8KA 3WC0A 2DWQA 3GJTB 3C21A 1F2GA 3KJNB 1D9DA 4J5OA 1VQ6S 1LQ9A 2R2RA 4CJPA 2MSNA 1DRGA 3GFZA 3C8YA 4JD2A 1JJCB 3EE9A 4OX9F 2KKPA 4NLOA 5EE9A 3DOLB 2Y0BB 4KH4A 3I1YA 4FWLA 4WCEQ 5AJ3J 1BL3A 2RVJA 3CQYA 2G06A 1JKHB 3TSPA 2FPKA 2RHQB 3BZKA 3VCBA 4DV6F 1HNXK 4A8KA 3W0LA 1GLCG 2DGXA 4R0JA 2HWIA 5B0CA 4ZP6A 2VQEJ 2K7JA 2GV1A 4C0ZA 1SJFA 1VAZA 4LRDA 5C25B 3Q83A 4KR0B 3POTA 1SH0A 2CQCA 5FPNA 3V7JA 3CG7A 1JIHA 5DQGA 8ICHA 2IIRA 2HHHF 2O8BB 3JXUA 4BUGA 1HHQA 2W6KA 2HURA 4MDAA 4TKTA 1PG5B 1GMWA 3HP6A 4DOZA 1MW7A 3SFUA 3MX5A 3LAMA 4D3GA 1QVFM 4LF9F 3QZ7A 1MWQA 3T69A 1HBOA 4DTXA 3K1ZA 1R3NA 1DOQA 3NGUA 2CPHA 3HI9A 4ETXA 4MKAA 4ITSA 5CH7B 3TYTA 3A3PB 3LPEA 4K2XA 3GU0A 2OTJN 2F3NA 3U02A 3WZ0A 3I9ZA 2DCUB 4Q43A 1F44A 4M0AA 1H73A 1FTCA 1ZTTA 3LM2A 1DTQB 4JRQA 1ILYA 4J2EA 3CJSA 2VC1A 3H0MB 2I1QA 3N7SC 3Q0AA 2DNHA 2DGQA 3EX7B 2LU1A 4UZCA 4KI6A 3EPGA 2UZAA 4ZHRA 3S6EA 3T1HJ 1VIOA 2G07A 3JSMB 1UMJA 4JV5K 4Y2VA 3TAQA 3BDEA 3M5RA 4Q8EA 1D8YA 3N79A 4U95A 4LBPA 4AXJA 5ALEA 5ALWA 2DY1A 2B8QA 2AHOB 5MAOA 3QEBZ 2ISPA 1ZBIA 2BMBA 2UV8G 3GOIA 3V9SA 3PW5A 1HEKA 1Y3KA 3RMBA 5KGWA 3UMCA 4N41A 4DV5F 3TZZA 4EP5A 3BQ0A 5CD4A 1U6BA 3B6PA 1IKVB 3GR0A 3WKAA 3ZDAA 4HUGA 9ICCA 4QBUA 3T7ZA 3R5DA 2W1BA 5HMMA 5FLXO 1WHVA 2ACMA 2M5YA 3B4DA 1PK1B 1LB2B 2UVVA 1Q8BA 3EN9A 3LP2A 2Q66A 3US5A 2KOBA 2Y0SC 5HATA 3F9KA 3IG8A