3TI0A

Crystal structure of bacillus dna polymerase i large fragment bound to dna and ddgtp-dc in closed conformation
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
total genus 202
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ti0A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ti0A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ti0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ti0A01
2BKEA 4AHCA 3MR6A 3G0ZA 4Y1CA 2W8LA 3SQ1A 1Q9XA 3NF9A 4FXDA 3QEPA 4AH9A 1EKEA 1U45A 4UAZA 4Z4FA 4HYKA 4F3OA 4IQVA 5HBMA 4F4YA 2IBKA 1WSHA 2QKKA 2F8TA 3DLKA 3GV5B 4FJMA 1TV6A 1T8EA 3IAYA 4I28A 4M3TA 2FLPA 3K5NA 4DQRA 3ZSRA 4GMJB 1S0NA 3C1YA 3L8BA 3SUOA 4J9KA 4O55A 1BVSA 1TV9A 1ZBFA 1B9DA 3HP9A 1IG9A 5J2KA 5KT2A 3K58A 3VA3A 4OJRA 3KIOA 4M3WA 4F4KA 4IRKA 4J2BA 3RWUA 9ICVA 7ICHA 3C95A 4WE1A 2BCVA 4CFDA 3F73A 4JRQA 3RH4A 2Q3SA 3LK9A 5KFNA 3HW8A 4DTXA 3TWHA 5CZ2A 2OZSA 1NK4A 4CEDA 3OYEA 4FBTA 3QETA 1TK5A 5J2AA 4YXJA 3H40A 3UQ2A 1T3NA 1IM4A 2BQRA 4N76A 1BI4B 3U3GA 3OYHA 3KHHA 4OGEA 3TQ1A 1AROP 3ZSVA 4QZAA 2FPMA 4MEXA 4GC7A 4TUSA 1ZQVA 4I2EA 1JLAA 1TVRA 3NGIA 4FJNA 4DFMA 1YT3A 2GV9A 4F8RA 3MDAA 1KVBA 4E7HA 5FDLA 4DMNA 3JYTA 5FRNA 2IHMA 4DSIA 1JXLA 4O5BA 8ICCA 1HJPA 2ASLA 3VQDA 3TAFA 5DB8A 1VSLA 1IKWA 1FK9A 4KREA 3OJUA 2B6AA 5KFHA 4HUFA 3JPNA 3DOLA 5J2QA 3MEDA 4Q44A 2C2RA 4M9GA 5L1KA 4KPYA 2OPRA 1KFDA 4N41A 4KV8A 4KLDA 8ICFA 4ELTA 1KFTA 3QESA 1IXRA 3S3MA 1REVA 3WNFA 1ZETA 3ZCMA 2JZBB 4GXIA 1YTUA 3TABA 3D0PA 4CJQA 3AU6A 1HJRA 3GQCA 1CEZA 3RR8A 2V4RA 3RMDA 1WSJA 4CJ5A 8ICMA 2G8KA 1D9DA 4HUGA 3JPOA 4QWBA 4XRHA 4RQ6A 3UXOA 4RQ7A 2Z1HA 4CHOA 3OVNA 2BCSA 4CF0A 4KI6A 1WNSA 3BDPA 3NE6A 5KFQA 3UXPA 1L3VA 3AA4A 4J9OA 2AGQA 5CYQA 1S5JA 5KFLA 1BQMA 8ICOA 2W9CB 3TARA 1ZQWA 3HXMA 1FXXA 4QAGA 4Z4GA 1RDAA 4HHTA 3BQTA 4O0JA 4J9QA 7ICFA 1F21A 1J54A 2OZMA 4P2HA 9ICBA 3LP3A 4JRPA 3TR8A 2UVWA 4YCXA 4R8UB 3B6PA 1RXWA 1RTJA 4YD1A 1JN3A 5J2GA 1WCNA 3DLRA 5J2JA 4I2HA 2ETJA 3L2WA 4RUAA 3V6JA 5J2MA 4JV2A 3OHBA 5CB1A 2FPKA 5KG0A 5L1JA 4KLSA 4J9NA 5TZVA 3M9NB 1ZQLA 1TL1A 4KLGA 3RJIA 4QZEA 2X74A 4F2SA 4RQ8A 4NYFA 2BCUA 3MECA 1T7PA 4NCAA 2V4QA 4QWCA 4ED2A 3H8SA 4HUEA 2I9GA 1RT3A 1WAFA 5KFIA 1U9LA 3PX6A 5J2EA 3PVXA 4KTZA 2C2EA 1DGSA 4H4OA 3I0RA 2A1RA 3QZ7A 4RT2A 4O9MA 3MXJA 2AJQA 1DTTA 4FW1A 2W42A 4Y1DA 9ICKA 1JXBA 5J0QA 1TFRA 1RNHA 4KLIA 3AA5X 3PV8A 3DI6A 4FJ7A 5KFFA 3IHQB 1SKRA 2FBTA 5DLGA 7ICRA 4DL6A 2JEGA 4GXKA 1RYSA 3L2QA 4I2IA 1K6YA 4YXMA 5KT3A 2VA2A 3I8DA 4FZXC 1ZJMA 2BDPA 4C8MA 1RDCA 2B21A 2HHSA 4PQUA 3CQ8A 4PPXA 3B0YA 4E0DA 1NK8A 3L2UA 4KLEA 4KKOA 1S6PA 1Q8IA 4KHSA 1RBSA 4B9MA 3SV4A 4MEYA 4CEBA 2BPGA 1WSGA 1IKYA 4CGGA 4FJKA 4I2FA 3RJEA 4RQ4A 4B9NA 5HLFA 1RILA 4PHDA 3T1AA 3FFIA 4IFYA 3PR4A 4CEAA 4TURA 4M6WA 4CGHA 4W5RA 1L3UA 4J9RA 3DM2A 4ID5A 5DK5A 1LWCA 4CEFA 4LSNA 1RBVA 2ZUBA 1NJXA 3Q8KA 4DTSA 3JPRA 1NK0A 4Z4CA 4O44A 3TANA 4DQQA 3FYHA 2ZQBA 4RQ2A 3FDSA 2X78A 5EWGA 4F92B 4DOAA 4OGCA 1CXUA 2VWKA 2ZTEA 4QZIA 1N5YA 4DQSA 4CGJA 1LWFA 3QNOA 4RNOA 1ASWA 3DRPA 2LSNA 4E3SA 5KRTA 3HVTA 2PFPA 4F3TA 4G3IA 3KD1E 4FW2A 1RT4A 3KJVA 3VQQA 4QZ8A 3HX0A 4F5PA 4O5EA 7ICOA 4KITB 4F4XA 9ICPA 4FJLA 4UAWA 3C2LA 4CFCA 3VQ4A 4KO0A 3QZ8A 1ZQTA 1NOZA 4UB3A 3RJJA 1TK8A 1NKEA 4IG3A 2ISPA 8ICZA 1UT8A 3ISBA 1WSFA 2IC3A 5D4BA 4N5SA 1ASVA 2FLNA 3OYMA 2DY4A 2BPFA 9ICQA 2D0CA 2PZSA 3LPUA 3M8QA 2ALZA 3V9XA 4R65A 4PUOA 5KI6A 8ICAA 2AQ0A 3OS2A 1S0OA 4I7FA 1K1SA 4KLHA 3MXIA 3RBEA 4I2GA 1NOYA 2B5JA 1BPZA 1DTQA 4ED1A 2P6RA 1ZQPA 3N4MB 3QEXA 1BI4A 4CIGA 3BQ0A 4B08A 4RW9A 2A1JA 1LW0A 4CK1A 2VA3A 5KG1A 1RT2A 3MGIA 2FLLA 1EXNA 4CHPA 1JKHA 3OYCA 1YTAA 3T5KA 1O1WA 5FROA 1NK5A 1TL3A 2JGUA 4KN7A 1J53A 3V9ZA 2FMPA 1GOCA 5J2NA 4JWNA 1HYZA 4QWAA 1HYSA 2V9WA 1DLOA 1VSHA 1QSYA 4DTOA 1IKXA 3PUFA 4Z6CA 3G6VA 4PY5A 5D46A 4DS5A 4CF9A 3U6FA 2D0BA 2HHUA 4ED8A 4UBBA 3BQ1A 1NJYA 1TK0A 4L8RB 2HHXA 2AU0A 4DWIA 4JV0A 3G10A 5KFYA 4YFUA 4FLUA 2YNHA 7ICIA 4YMOA 1B43A 8ICRA 5KFRA 4NLNA 3PNCA 1TAQA 3KKRA 2JZBA 4EYHB 3QE9Y 1CUKA 4H8KA 2G8HA 4NCBA 4DTNA 1K1QA 2XCAA 9ICHA 4MFAA 3N97B 2WONA 2KQ2A 3RAQA 4YMMA 3V1OA 1HUOA 1Z25A 1TVAA 5J0OA 2XRIA 1BQNA 8ICYA 5DQHA 2DPIA 4CJFA 4CJ3A 1BPYA 3NH0A 4LZDA 1H38A 3V1RA 3Q8QB 3QIOA 4TQRA 1XWLA 4NY8A 1S9EA 4PGQA 2HHVA 4BACA 4ED6A 1SL2A 4EYIB 2PFQA 4FJ9A 3MEGA 4JWMA 2BQUA 3QINA 1KVAA 4F5OA 4DS4A 2W9CA 4DEZA 3PMNA 4C8NA 8ICXA 4RU9A 4Z0UA 1HQEA 1KLNA 8ICHA 1RBUA 3JPTA 4CE9A 4J2AA 4DFPA 1UAXA 4OVLA 5CA7A 1JMSA 9ICUA 4DL3A 7ICMA 2VA8A 4B9TA 3KHRA 4B9LA 2YHBA 3THVA 2BCRA 2BCQA 9ICTA 3HYFA 4R8UA 9ICEA 3RJHA 1C1CA 3AVGA 1V9PA 1NJZA 7ICGA 4RT3A 2RDJA 1JL1A 1WSEA 4DL4A 3NGDA 3LDSA 1HNVA 3AVBA 3O4QA 5HRRA 4CIFA 3OYIA 1SL0A 3OGUA 1JIHA 5DMRA 2YKMA 1XSNA 2JEFA 4BGDA 2FBXA 1WCLA 3Q8LA 3Q8RB 4GC6A 4DQPA 3TAMA 1XHZA 2F1IA 1A5WA 3EY1A 2ZJAA 5KG2A 3K75D 1ZQYA 5FRMA 1X9MA 3KKSA 4ECZA 4FLZA 1ITGA 4OKJA 3E2EA 4DU4A 4ECRA 1JLFA 2ASJA 3ZT0A 4DF8A 4YVZA 4FBUA 4UQGA 3AO3A 1BCOA 5J1EA 1ZQJA 3DRRA 5CZ1A 4CJLA 3OS0A 4CJEA 4DL5A 4IDKA 3IRXA 2UVRA 1JL2A 3SQ0A 5KFAA 5KFVA 4DF4A 3WNHA 1FKOA 1S0MA 5KFKA 3SPZA 4O3PA 1NKCA 4G1QA 4JUZA 3RRGA 3O3FA 8ICGA 5KT6A 1VSIA 3S3OA 2PY5A 3HP6A 3L3VA 3AVLA 3OYBA 4ELUA 4O3NA 3M8RA 4OKKA 5KFTA 4E89A 5CP2A 4ECXA 4O3RA 3KLHA 7ICJA 1LAWA 2PYJA 2ZJ8A 2A1JB 2W9BB 3V9SA 4CF8A 2W9AA 4MF2A 3CM6A 5HRNA 4BE0A 3VQ5A 4DTRA 4Z4EA 9ICJA 5KFMA 5HHHA 4P4PA 3P83D 9ICRA 1VSEA 1G15A 1RBTA 4DTUA 5HP1A 3NH1A 3O3HA 5KG5A 3QEBZ 1ZJNA 5J0RA 1ZQMA 1B9FA 2I5JA 2DFLA 1XS9D 4M3YA 3CYMA 4B9VA 2OPQA 3KHLA 1D5AA 3KD5E 1RDBA 4Q8FA 4P4OA 1VSKA 4NM2A 5J2FA 2IDOA 3RH6A 3PX0A 3AVIA 4CJRA 5KRSA 1ZQOA 2XC9A 2FC0A 4K8ZA 2ZUDA 3M9MB 4RZRA 2IMWP 3EWAA 3AO1A 3C21A 2DFFA 5IILA 1KCFA 1QQCA 3E01A 2Z1GA 4FJXA 3M9OB 4DTJA 3DLBA 3RR7A 3RJGA 4M9NA 5KFJA 4CF1A 2VWJA 5DQIA 2O4IA 5J0UA 2EX3A 3C23A 1GOBA 4PGYA 4KB0A 3V7LA 2RN2A 3U3YA 5K14A 5DB7A 2MUTB 5KFOA 3PMLA 4CGIA 5BOLA 1NJWA 7ICQA 2VANA 2BGWA 4FM0A 1BL3A 4IRDA 3PY8A 5EWFA 1IO2A 4YR3A 1FKPA 4R5PA 4KMUA 5J0SA 3ZT1A 4MFBA 2PYLA 2FPLA 3NAEA 3O3GA 3V9WA 3D45A 1L3TA 3DLHA 2OWOA 4C8KA 3AVKA 1RTDA 3LAMA 4DSFA 4O0IA 2Y1JA 1U04A 1ZQGA 1ZQSA 3VQAA 1QE1A 4M3ZA 2ATLA 3RB0A 4FJ8A 4ZHRA 4M45A 4J9MA 2ZTCA 3T19A 5KFSA 1U48A 4IR9A 4J2EA 1NKBA 1MQ2A 1X1PA 2H5XA 4KB1A 1BPBA 1XSPA 4DG1A 4F5RA 5KT7A 3T5JA 4QZBA 2HHWA 5D49A 4FVMA 1MSWD 4KLQA 4CF2A 3KK1A 2NRTA 3PW4A 3VQ9A 2PXIA 2KFNA 3VQPA 3I0SA 1ZQNA 3PW2A 1KRPA 4E7JA 2ZD1A 1BPDA 2E4LA 4CESA 4DO9A 3K2PA 2KZZA 2OA8A 1A5XA 3SUNA 4K4GA 5DQGA 3C5GA 4DFJA 5I42A 1JX4A 4R66A 4ECVA 1TKXA 2AGOA 4RQ5A 2PI5A 4K4HA 1SKWA 5KGXA 5KTQA 4J2DA 3JPQA 4F5QA 3SNNA 3OYKA 2KZ3A 3OHAA 3V72A 4FJJA 4NLKA 3HWTA 5F9NA 3Q8SB 8ICEA 4KN4A 3SZ2A 2R8KA 4LD0A 3MR2A 3C1ZA 1WN7A 1X2IA 5C5JA 5EWEA 3C6TA 4FK0A 3JSMA 4I9LA 3GIKA 2R8GA 1ZBUA 4IR1A 3NGYA 4EZ9A 5CHGA 8ICNA 3RMCA 1S76D 2FMQA 2HVHA 3KHGA 5KFCA 4KLTA 3OY9A 3ZD9A 2DPJA 4UAYA 1LWEA 3LALA 3AU2A 3KLEA 2OPPA 3LP0A 3NDKA 3DLGA 4HCCA 8ICPA 4BE1A 3RMAA 2GBZA 4BE2A 5IIJA 2DFEA 4YR0A 4F4WA 3LP2A 4EBCA 3KLIA 3LDAA 4KLMA 3RB4A 3MBYA 2KN7A 1Y97A 5KFEA 1ZQDA 4O3OA 2Z1IA 3TFRA 3A2FA 1C1AA 2EHGA 2XY5A 1JLBA 2O4GA 4Q0BA 3ULDA 5J0XA 2ZTDA 3OYAA 5SWMA 3RAXA 3RMBA 3L2VA 3ZDEA 9ICAA 3G6XA 1JLQA 5CWRA 1RXVA 1ZBLA 3O4NA 4M42A 1C0TA 4E7IA 4O3QA 5HRSA 4KHWA 4FLWA 1RPLA 3LWLA 2HHQA 1UA1A 1S1VA 1VK0A 3F9KA 3HO1A 5J0TA 1QTMA 3VN5A 3C94A 3ITHA 4DOCA 4BWJA 3EPIA 1U47A 4KLUA 3OS1A 5DB6A 4FO6A 2D5RA 2KW4A 2OYQA 1S97A 3EZ5A 3TAQA 1VRTA 3V7JA 1JLEA 4PHAA 5IIMA 4W5QA 3AO5A 3QEVA 3HL8A 4RQ3A 5E41A 5L9XA 5J2PA 4CERA 4UBCA 1C0MA 4YFKA 4RQ0A 2BHNA 1RTIA 5KFDA 4E1MA 1C1BA 4AHSA 2RDIA 4YMNA 4CJSA 3NF7A 3OYFA 4FJIA 3LPTA 4CHZA 1S6QA 3NF6A 5JS1A 4Z4HA 3WNGA 3GFKB 3NFAA 4FCYA 2ZE2A 5BOMA 4DSLA 3TFSA 3P1GA 4B9SA 3QEIA 3T5HA 4KLOA 4M0AA 5HHIA 3AVJA 4I2BA 4NLZA 4B8AB 2M9NA 1HNIA 3RH5A 1Q9YA 3H4DA 3V6DA 2R8IA 4PWDA 4ZTJA 2P66A 4EBDA 4CJPA 1S77D 4ECSA 1T05A 1N56A 2F96A 2W9BA 3K5OA 1MC8A 5JUMA 3SYZA 7ICNA 1NK9A 1LAVA 5C42A 4BWMA 5IIIA 2YV0X 4B3OA 4QZHA 1BISA 1X9WA 4J9SA 2HVIA 4Z6DA 3LWMA 3RJKA 4I2CA 4E1NA 1XO1A 3V9UA 1SZPA 2NRWA 4XQ8A 9ICSA 8ICKA 1SV5A 1I3AA 4AHRA 4IRCA 1CZBA 4GW6A 2W8KA 1QSSA 2OPSA 4FZZA 2R8HA 1QLNA 4KHNA 3C2KA 4DTMA 5L1IA 4JS4A 1RCHA 4BDPA 4ELVA 3H08A 4HCBA 4CJ4A 1ZQXA 1IH7A 4TQSA 3QLHA 5KFWA 3SPYA 4RW4A 3MEEA 9ICLA 8ICWA 4RPXA 2QXFA 5J2CA 4P4MA 2VG6A 5KG3A 1ZQIA 4H4MA 4PHEA 4I2PA 4DTPA 3CG7A 3MAQA 3SUQA 3LP1A 1VRUA 4JS5A 5HMLA 5IIKA 9ICMA 4I2QA 3HJFA 2RF2A 1QHTA 5J2IA 2FMSA 1T03A 4CHYA 3ZSQA 1D9FA 4F4ZA 2Y1IA 2P5OA 4F93B 4DOBA 1RT7A 3AO2A 1IKVA 1I39A 5J0PA 4FLXA 4M04A 2MUTA 3AVAA 4FZYA 1R0AA 1TKZA 1T4GA 3GV7B 5CYMA 1KEJA 8ICSA 2XGQA 2GWSA 3HPOA 2ISOA 9ICGA 4QOZB 5I3UA 4Z4IA 2IAJA 3OYDA 3QNNA 3P5JA 1QSLA 3GIJA 3ZT4A 2G8FA 3MR3A 1UT5A 1HRHA 3ZSYA 1S1XA 4O5CA 3DYAA 2IS3A 3EPGA 3T3FA 2IA6A 5KFZA 2HMIA 4O3SA 4I2JA 4RW6A 3SV3A 4DSJA 8ICTA 2XO7A 1EP4A 2YHAA 3GV8B 5KFGA 1LW2A 3LAKA 4KRFA 3HM9A 3L3UA 1KLMA 4I2AA 3Q8MA 3K57A 4DL2A 2P51A 3K5MA 1VSMA 5D3GA 5C25A 2FBVA 1RBRA 3OJSA 4I2DA 4Z6FA 1ZQQA 4FK2A 4CEEA 3QERA 5CJ7A 5F9LA 4EEYA 3VQCA 2B4JA 3SI6A 2A1SA 4IFVA 4FJHA 5DG7A 8ICLA 4ID1A 1S10A 1BGXT 4EZ6A 3MFHA 1Y88A 4I29A 2W9MA 1GOAA 4R64A 3VQ8A 4JLHA 4CGDA 4NLGA 3ASMA 4J9PA 3LZJA 3HPHA 2F8SA 1L3SA 4Q8EA 3C2MA 2LYHA 3OSNA 5DG8A 4OPKA 3ISCA 2NUBA 3MGHA 3IG1A 5IINA 3HK2A 3DRSA 1BCMA 1RTHA 4Q43A 4QW8A 4CFAA 3ZD8A 2KZMA 1Z26A 3CFPA 4IQUA 2YNIA 4X5VA 4ECQA 5J2DA 2HW3A 7ICUA 2XCPA 3NHGA 3LZIA 3K5LA 4FM1A 5KG7A 3G6YA 4PH5A 3ZDCA 4M3XA 4RPZA 4JV1A 4ECUA 4YD2A 3V6KA 2HNYA 9ICWA 3PW7A 2F1JA 3MFIA 5J0YA 4KTQA 4RNMA 4M41A 3QO9A 2Z1JA 3TAGA 3QIPA 3S9HA 3NH2A 4E19A 4AHVA 1HQUA 4RUCA 2XY7A 1HUZA 4R63A 4CEZA 1BPEA 3V6HA 2R7YA 3AO4A 5HRPA 2ZJ5A 4RNNA 1J5OA 3ZSXA 3AVFA 4DQIA 2X6NA 4YQWA 4DSEA 2JEIA 2HB5A 1ZQRA 1TAUA 4CCHA 1XHXA 2JLEA 3BQ2A 5HP4A 4ED0A 5SZTA 4FM2A 2WTFA 1CLQA 1RYRA 2G8UA 4OLBA 3KTQA 4F2RA 1S9GA 4ZTFA 2KTQA 4ECWA 1RZTA 3SI8A 4LVSA 4FLYA 3TAEA 4BXOB 5C24A 3K59A 4M9JA 4B8CA 4IKFA 2C22A 4E7KA 3HPGA 5KFXA 4LSLA 2C2DA 3ETLA 1J9AA 1ZBHA 3TI0A 1Z00A 3T5LA 4QZFA 4IQWA 4FYDA 1ZQFA 1KSPA 3QEAZ 4NM1A 5DLFA 5J2BA 3ZSWA 1HYVA 5KT5A 5IIOA 1ZBIA 4CJTA 1WLJA 3VQ7A 5KFUA 3V7KA 5KG4A 2RKIA 5HROA 3C6UA 9ICXA 3L2RA 4DFKA 3GILA 2AQ4A 3H4BA 4JK1A 5HNKA 7ICLA 4FK4A 4GXJA 4PHPA 2R8JA 4EP4A 5JS2A 3VA0A 4LY7A 2NRXA 1A77A 4XUSA 3AVCA 4LH5A 1VSJA 4MQ3A 3AUOA 3KLGA 1ZQHA 4FLVA 2AGPA 3KK3A 4KLFA 4IG0A 3JPSA 4DU3A 2XY6A 4YP3A 4QWEA 1RT5A 3H7IA 2MAXA 3ISDA 4NYNA 2ZUCA 5EOZA 3PO5A 3GIIA 4CK3A 5J0WA 8ICBA 2IOCA 1B92A 4KLLA 4M47A 4MFFA 3AA3A 4J9LA 4YG2A 3RB3A 1WAJA 3V4IA 3GIMA 4KI4A 1KDHA 4UB4A 3AV9A 2HNDA 1DOQA 1LB2B 3RB6A 1S1UA 1W0HA 5DBAA 4EP5A 4QZCA 4F5NA 4W5TA 9ICFA 5DB9A 1KTQA 4EBEA 9ICNA 3H8WA 4IBNA 3ZDBA 5KG6A 2BQ3A 9ICIA 1XU4A 1UOCA 3WNEA 1ZYQA 5L1LA 4MF8A 1JXEA 4M3UA 2VG7A 7ICEA 2BANA 3VQBA 4ECTA 1VSFA 1C7YA 4YR2A 8ICUA 2HNZA 5BPCA 2JEJA 4AILC 2G8VA 1ZQAA 1X9SA 1RDDA 4KTWA 4ED7A 2E6MA 2VG5A 4QWDA 1BPXA 4E7LA 4C8OA 2BPCA 3PO4A 4HVJA 2E6LA 1XSLA 3OSPA 3MXMA 1COOA 1W9HA 2F1HA 1SKSA 2D0AA 4YNQA 5KT4A 2GUIA 2FBYA 3ORYA 4RQ1A 1UWBA 1BHLA 4TUPA 2UVVA 3LANA 2IHNA 5J2HA 1TKDA 3NCIA 3ALYA 4KAZA 4CFBA 1C6VA 1S1TA 4RG8A 3NF8A 3UQ0A 1PZNA 2QK9A 4Q45A 4W5OA 2BR0A 2HHTA 3SQ2A 5DDMA 1A5VA 3EW9A 1SL1A 4UB5A 1EX4A 4CK2A 3ZT3A 4B9UA 2J6UA 3VQ6A 4OPJA 2XGPA 4DU1A 4AHTA 2J6SA 3VQEA 2X6SA 1KVCA 3B0XA 4CJKA 1N6QA 5CR0A 3OYLA 3AA2A 4UB1A 2PFOA 4C8LA 1LV5A 4NXZA 4Z6EA 1BIUA 1S9FA 3NBPA 4N56A 2NRZA 1TKTA 2C28A 2YNGA 5KFBA 3SJJA 3H8JA 4QCLA 5HMMA 1Z00B 5J29A 3CFOA 4CIEA 4OLAA 4FS1A 4GLXA 2YKNA 1ZQEA 3ISNC 1B22A 4Q5VA 4AHUA 2G8WA 1XC9A 2I1QA 1SUQA 3OYGA 4M9LA 9ICCA 3MDCA 4GVMA 3PW5A 4ED3A 1KFSA 1YVUA 3K4GA 3RJFA 1EETA 4M9HA 8ICVA 3PR5B 1TGOA 4RPYA 1ASUA 3NTUA 1HMVA 2YNFA 4CJWA 1NK7A 1U4BA 2DFHA 1JLCA 4FJ5A 4NCGA 4BDYA 7ICPA 3MABA 1CZ9A 4FS2A 1QS4A 2P6UA 1WSIA 5DGBA 4CEQA 4ECYA 1JLGA 4F91B 5KFPA 1ZQCA 4UB2A 1RT6A 4BDZA 2XHBA 2ASDA 4DL7A 1D8YA 7ICKA 4ICLA 3AVMA 4O4GA 4CHNA 3V81A 3TAPA 3OYJA 3BGRA 4QZGA 4QZDA 4F50A 4CJVA 1MU2A 4DSKA 2ATQA 4YN4A 1BIZA 1ZQKA 4O5KA 1NOMA 4QW9A 3ZDDA 3DOKA 4CEOA 2J6TA 1S1WA 9ICOA 4XIUA 5DKWA 4KHUA 4RW8A 4CECA 4CJUA 4DLEA 2QKBA 3M8SA 1VSDA 1RT1A 4MFCA 3SUPA 2UVUA 4FJGA 3S3NA 4KFBA 1U49A 4HTUA 1EXQA 2P1JA 3AVHA 4PGXA 4RW7A 4TUQA 5DBBA 1A76A 1ZQZA 3HSTB 3CFRA 8ICJA 4ZH4A 3SQ4A 2NRVA 4W5NA 3KLFA 3ZSZA 3V1QA 3Q8PB 4I9QA 4XA5A 4K4IA 7ICVA 3AVNA 4IQTA 3DMJA 3C5FA 1S0VA 4TSXA 2PFNA 5DBCA 1L5UA 7ICTA 4CHQA 1CXQA 5DG9A 4LH4A 3KK2A 3MR5A 3UXNA 4K8XA 3B6OA 3ZDAA 3M8PA 4LZGA 5KGWA 1N48A 4DLGA 3PW0A 4KHQA 1MQ3A 4CGFA 2RPIA 3RTVA 3HVRA 4PA1A 4KHYA 2G8IA 1ZQUA 2P5GA 3CM5A 1D8LA 3PX4A 2WOMA 1XI1A 4M2YA 4BXOA 2IGIA 2XY8A 2PI4A 5DDYA 3OYNA 3DLEA 5CY4A 4QZ9A 3JPPA 1ZQBA 4I27A 2ITGA 8ICQA 3ZT2A 3UIQA 1UA0A 8ICIA 4N47A 4OKEA 3IS9A 2BGGA 5EU7A 3NGZA 4KLJA 4M6WB 3UPQA 1C0UA 3RRHA 3BJYA 3QEWA 1NK6A 3ZSOA 7ICSA 5T7BA 4FLTA 1HPZA 5DGAA 2BE2A 2Q0ZX 3IM1A 3EYZA 4M3RA 1Z3EB 2KFZA 3SCXA 3HT3A 2DTUA 3RBDA 3GDXA
chains in the Genus database with same CATH superfamily
5LJWA 1WJ9A 3MCSA 5D0RA 1K8KB 1NZAA 4Y1CA 4NB4A 3GP9A 1Q9XA 3CJAA 3BQ7A 4AH9A 1Q79A 2A41A 4UAZA 2QLFB 5I9EB 1ICEB 1RAFB 1M0SA 4UW9A 3E0FA 1VQNN 4Y3CA 5HAOA 1WSHA 1VHXA 2QKKA 4ETXA 3HRDD 2HHPA 4NZ6A 4JI2F 4YDDB 3BYPA 2QM1A 2GO7A 2F65A 1DEJA 3F2KA 3HRGA 4I28A 2H3ZA 1FXLA 3AOCA 3K5NA 4DQRA 4RBVA 1RBLA 4GMJB 3L8BA 4WQ5A 4HWIA 4O55A 1FI4A 2CJAA 4IJAA 4JI6K 4KO0B 5KOWA 5AKLA 3LO3A 2HSEB 1JALA 1B7YB 3OXLA 4OJRA 4OX9F 4DR2F 3G87A 1XNQJ 2GZOA 2MKJA 3C95A 4WE1A 2BCVA 2QW9A 1TR0A 3A8EA 2LEPA 3M30B 4CFDA 3C7NA 2W2OP 3CJSA 4NEZA 4ZVOB 2Q3SA 1N88A 3SAFA 3HW8A 3DOKB 3KK7A 4I6AA 3TWHA 5CZ2A 3C46A 2QZ8A 4CEDA 5C0YA 2C1EB 1S3XA 4ZCMA 4FBTA 5J2AA 1DTQB 4CI0B 4YXJA 3W7BA 3UQ2A 2KU7A 1IM4A 4OI1A 4N76A 3V5RA 3OYHA 2RHFA 2P35A 2GVDA 5BXIA 4MEXA 4GC7A 4I2EA 4RUHA 1JKHB 4FJNA 1YT3A 3I5BA 2GV9A 4F8RA 5FDLA 3G8SA 1TL3B 1QVGM 5B0FA 8ICCA 1HJPA 1SH0A 3U26A 4A8EA 4K7QA 3TAFA 3OW2R 2ZBIA 3HOSA 3OXGA 4EAHD 5KQDA 1HW8A 2BEFA 3MEDA 4Z2XA 4HHUA 2C2RA 4M9GA 1WEYA 1SJFA 1KFDA 1SPBP 1Y00A 3T6BA 3NGTA 1Z6RA 1ZA2B 4KLDA 4ELTA 3C66A 5D77A 2D41A 1IXRA 5CCMA 3S3MA 1REVA 3TZYA 5ETKA 3F0NA 2E1CA 3NCPA 4FPRA 2VBWA 1YTUA 2KXHA 3QMQA 3W62A 4G9ZA 4OYXA 5TKWA 2WONB 3RR8A 1WSJA 4AUKA 3CDAA 5D0EA 4HUGA 3QWPA 1BQNB 3UN5A 4D3GA 1R8HA 4RQ6A 4CHOA 2BCSA 4CBWA 3BDPA 2Z2YB 1HNZJ 5KFQA 4QIEA 4NMLA 1YQHA 1Q16B 2IYGA 3MEGB 2YHWA 1AUDA 2IVMA 4LRCA 5F3TA 5CYQA 2GCFA 1UAWA 2WW4A 8ICOA 4ZVPB 3TARA 4FYXB 4A8KA 1MLAA 3UD4P 4LF8F 1QDUB 4C4TA 2VFVA 4LFBJ 4B3TJ 2RLTA 4WFAQ 1YI2S 4J9QA 2CG4A 1F21A 4CRJA 4NLPA 1J54A 4P2HA 4DV6K 4IH5A 4A8MP 3V4MA 2WF9A 1XK8A 4KX5A 4A46A 3MC1A 4M5NA 4R8UB 2DRDA 3B6PA 4YD1A 4AE5A 1Q8KA 3DLRA 4NLSA 3QT7A 4FWMA 3V6JA 5IXUA 1FERA 3W2WB 3DXSX 4UOCA 2FPKA 1WUAA 4B3SK 4KLSA 3M9NB 2JHEA 3EUNA 4KLGA 2MPUA 2MMYA 3S6EA 1ZBTA 1ZRNA 4JD2A 2YQ1A 2V4QA 4BGBA 3H8SA 4HUEA 1RT3A 4OFZA 4I6WA 5KFIA 4ZVGA 4Y2AA 2MY8A 3CCJS 1V3ZA 4TU7A 3PVXA 2F40A 2W7PA 4KH1B 2C2EA 1PIEA 4CZIA 3I0RA 3BN7A 5IV3A 7FDRA 3KFUF 2AJQA 1KKXA 1Z19A 4FZLA 1DTTA 4FW1A 5KQ8A 1JXBA 1RNHA 2QA4S 2QX0A 3PV8A 1I1GA 2Y0SF 3IHQB 4DL6A 2QMUB 3UQSA 3NY0A 9RUBA 2DT9A 4LFAK 3L9ZA 3D6TB 2YB4A 5AJ3F 3CDEA 1FIQA 4FWSA 2NYVA 4B02A 1ZJMA 4GKJJ 1N62A 2CNOB 2KT5A 1TUGB 2CPEA 3WC2A 1IKWB 4E0DA 3K7RA 1NK8A 1Q1KA 3OVBA 1V5VA 5AKYA 5J2QB 2F3JA 2GHPA 2HVZA 2BX6A 3SV4A 2BTFA 4PZOA 3IM8A 1LXJA 5C2GA 1WHXA 2ASPA 4FJKA 3SCKE 2XMJA 3A13A 5F0XA 3RJEA 5HLFA 2CH5A 3T1AA 2LPEA 3FCWA 4M6WA 4CGHA 1VIOA 4W5RA 4BRKA 4HI2A 4CEFA 1JB0C 2YI1A 1RBVA 1VOMA 4DR5K 2MEWA 3MM9B 5LL6Z 2PAVA 4O44A 1FFUA 2HFNA 3WXIA 4RQ2A 3PJWA 5IFMA 4IO9L 5EWGA 2YXLA 4I69A 4F92B 3W63A 4XO0A 1QZ5A 4YB7A 2ZDOA 2ZH9A 2IJRA 3QFWA 3KJQB 4OJ6A 4E3SA 2K4HA 1SV4A 5AM1A 3HHKA 4F3TA 3DDIA 4YDUC 3VQQA 4D3HA 1TQLA 4CZFA 1RWNB 1QE1B 2E1AA 2HHHF 1ACMB 4FJLA 4JI1J 3EGVA 2VONA 3VQ4A 4MDBA 1UZDA 2Y1LB 1RTJB 1UPPA 4KO0A 1WD6A 3CCEN 2D4WA 3NWRA 2NXNA 1N32K 1DARA 8ICZA 3WIUA 2MKYA 2FLNA 2E5LK 2D0CA 2PZSA 2ZC4A 4PKGA 1VLYA 3M30A 1OKJA 1E3MA 4R65A 1S5ZA 3KK1B 1P8GA 4NV0A 3I0SB 5D4PA 1Y64A 5A6PA 3RBEA 3WX4A 4I2GA 2O66A 3CULA 3I87A 3MPYA 3ZTRA 4X4QA 1DTQA 3QEXA 3FC9A 2K4EA 3BQ0A 2GO9A 3ZZPA 4CNZA 3GZFA 1TUWA 2P9KB 4OI3A 2YJFA 1LXNA 2P8IA 4CHPA 5HMYA 1JKHA 1OWXA 3PFOA 5FROA 1R8AA 2F8MA 1TL3A 1J2MA 4ZLLA 3V9ZA 3CD0A 1T3QA 5HK4A 4O23A 1HD1A 4M63C 2E1PA 2A3ZA 2XNQA 4GFJA 5JRTA 4H03B 2A3JA 1KC8T 4PY5A 3U6FA 2HHUA 3S01A 1UWAA 3TQEA 2YN4A 4J8FA 3UVJA 3MM6A 3BQ1A 1NJYA 1LWEB 2ZJRL 1UEKA 3KLEB 2HHXA 2MLZA 1Q82T 4DWIA 4JV0A 4C3MA 4A8XA 2BOAA 2X1GA 2EC0A 2W7OA 3B8HA 1B43A 8ICRA 3CO9A 3GJSB 3PNCA 3CCUN 4CZCA 4EYHB 2G8HA 2KYZA 1PAEX 4NCBA 4DTNA 2VIXA 5AQFA 2XCAA 9ICHA 2WONA 3RAQA 5CD4H 3AL0B 1IKYB 5E79U 2BE7D 3Q83A 5LL6d 2V0NA 4NXMF 5J0OA 1BQNA 4RU2A 1JLBB 2DPIA 1VMBA 1BPYA 4CO0A 3HT0A 3NH0A 4IFYB 4LZDA 2OI2A 4PCQA 4TQRA 2VBZA 4DN9A 3P31A 1XWLA 2OFGX 1SIJA 5EE9A 4BACA 4FJ9A 5AKJA 4UOHA 3A5OC 3D3BJ 3MEGA 3QFPA 1VQ7N 5ADXA 5HL7Q 4LSNB 2BQUA 5IM0B 5AE3A 2ZBCA 1RLCL 3PMNA 4C8NA 4RU9A 4LIWA 4Z0UA 3ITHB 8ICHA 2VODA 4J2AA 3VZHA 2EWSA 4ILMA 4X65K 5A8WB 1E6YB 1HLWA 4YOWA 4OVLA 9ICUA 3AY0A 4DL3A 7ICMA 2VQEF 2YHBA 2EFNA 2KRBA 3I5AA 3EDRB 3DU6A 2RILA 4R8UA 9ICEA 2B9EA 4WFYA 1HR0F 3N28A 1JL1A 3DN9A 2DNZA 1EKSA 3SQIA 1WSEA 1RTIB 2QIFA 1MWMA 4ZP7A 5H1SV 4CIFA 3NG8A 3CCLS 1SL0A 3OGUA 2YPZA 3W2WA 1VBKA 2X7IA 2DR5A 1YVNA 4A8OA 5JMVA 4DBQA 4H4KA 1X9MA 3WK6A 3JQMA 3FKBA 4ECRA 3ZT0A 4DF8A 4NPOA 3G4SS 5J1EA 1A0OB 5CZ1A 4C98A 4CJEA 2K1RB 2KG1A 4JI2K 3D1QA 3D2SA 4DF4A 3VETA 4O3PA 1NKCA 3R27A 3N6LA 5KT6A 3CC7N 3HP6A 3L3VA 4ELUA 3W3DA 5CP2A 2KXNB 3KLHA 2PYJA 2ZJ8A 2A1JB 2W9BB 4QR2A 3V9SA 4CF8A 2WHOA 2AXTU 2KM8B 4MF2A 4BE0A 9ATCB 1RWPB 2D3O1 4OX9K 4DR2K 5KFMA 1JI7A 5JXSA 4CLUA 4P4PA 2FZCB 1N33J 5FP0A 3IP4B 1G15A 4J91A 3O3HA 4C0HA 1WC5A 2BH1A 4F36A 4AYBF 2DH9A 4A48A 1SQEA 4M3YA 2HQ3A 4FYVB 3TA2A 1CS4B 1ZQ1C 2UU9J 3M8ZA 2JFKA 3JQJA 4Q8FA 5DS7A 1XBWA 2GMHA 4J9VA 3FZMA 4NM2A 4UB8U 1GMVA 3A5LC 3PX0A 4CJRA 4CH0S 2E7VA 2FC0A 2XC9A 4WCEL 3M9MB 4RZRA 3AO1A 3C21A 2DGOA 3Q2SC 5IILA 1MROB 4BR2A 4C7QA 3MMBB 1EQ0A 4DTJA 4JBCA 3DLBA 5JLFA 3GYGA 3UMBA 1S79A 2PFFB 2OMOA 3IFRA 4CF1A 2O4IA 3QU7A 3FEZA 3C23A 4PGYA 2IIRA 3MM9A 2C2MB 4HVZA 4EU0A 3ULEA 5SUHA 3HSZA 4OHYA 2VV5A 3VHQA 4B3MF 1AT1B 4IRDA 1L7NA 1IO2A 3P5TL 1Q3UA 3PFEA 3MM7B 3QNMA 4LF6F 1ZH5A 3V9WA 4UY85 4FF2A 4C8KA 3AMZA 3LAMA 3CJTA 3US5A 3VQAA 1QE1A 4HLBA 4M3ZA 3QRQA 2EPIA 1FD8A 5DETA 1FDBA 4FJ8A 4B1UB 5J8YA 2B3TB 3T19A 5A0YB 1OVQA 3OTOK 4HDGA 2E9ZA 2G9OA 1MQ2A 4KB1A 1BPBA 3RF9A 2KKZA 4LF8K 3CI5A 4JKBA 4IFVB 2HHWA 1HNWJ 2HWTA 3KK1A 1FX4A 4OJHA 2KFNA 3VQPA 3I0SA 4ZPWR 2XEXA 1OH5A 4LRAA 1ZQNA 1R8CA 2D3DA 2IJNA 1U2CA 2KG5A 2ZIVB 1RHUB 4USWA 2W6LA 2E4LA 1OQ6A 3QUTA 3K2PA 1A5XA 3HD1A 4DFJA 4J9UE 3CCVS 1ZD2P 3BEXA 2P9KA 2Q1LA 1KVKA 2PI5A 4RQ5A 4PRFA 1FKOB 1SKWA 1T9VA 3N6NA 4DZDA 1HIWA 4ICAA 1SIZA 5HR6A 2DNHA 2G08A 3JS9A 3PJXA 2J76E 4F5QA 3VEWA 2JXJA 2DKOB 1JNZB 5ALYA 3I6PA 2D3OR 1O6XA 4KN4A 1GNKA 3SZ2A 4ZP8A 3MR2A 3E66A 2UXDJ 3PYEA 1NZ8A 1X2IA 4P2FA 1RP5A 2OM6A 1VRQC 2R2TA 1QQOA 2VU5A 3PYGA 8AT1B 5EWEA 1VQLN 4FK0A 3T1YF 1ZBUA 4IR1A 3D9BA 4EZ9A 1ZM3A 4EMDA 4H54A 1M5HA 2K8CB 2FMQA 3KHGA 5KFCA 3QAUA 3LM2A 2LQ5A 1LWEA 2IIHA 3LALA 2CQDA 3KLEA 1BWVA 4K0KF 3LP0A 4WZQA 2FTRA 3NDKA 3Q8UA 2CPZA 4OCZA 1TZ0A 5AQIA 3RMAA 3IDHA 5IIJA 1KP6A 5ALNA 4EBCA 2OPQB 3ENOA 1R89A 4KLMA 3MBYA 1NPRA 2VJ4A 3WBZA 2KVCA 1HQUB 3Q7CA 2Z1IA 3ZZ0A 4FWPA 3CE8A 3ICLA 1SJQA 2XY5A 1JLBA 2CGKA 3H8YA 5HMXA 3SQOP 4OJ5A 4CYUB 2RQ4A 1V5IB 3OHRA 5AJ3K 1TAMA 1WKLA 1UEVA 2R7XA 2DGWA 3M32B 5CEHA 1RXVA 4CLFA 3O4NA 4M42A 2CPYA 2YWGA 3GFZA 4UW2A 5IM0A 1XR5A 2B9WA 2HHQA 3QQCD 5AK6A 2QSFA 4CLYA 2WC9A 3ITHA 4DOCA 4BWJA 1X0PA 4UZBA 3W0LA 4KLUA 1E6YA 2OYQA 2R7WA 2AW0A 2EH9A 4MLHA 3V7JA 5EE3A 1P6TA 2UXBJ 5IIMA 1FE0A 3TTFA 1UVKA 2BRLA 3G86A 5L9XA 1RBOB 2HDOA 3W9JA 2DNQA 2BKNA 4H0YB 4YFKA 4WJ3B 1RTIA 4W98A 2D6FC 4CJSA 3OYFA 1VDHA 5HJYA 4I64A 4OLOA 1T3OA 2XMAA 1LOUA 4EHUA 1IR1A 2W54A 3NS6A 1CC7A 4FO0A 4U6PA 2JX2A 4JI4F 2FVRA 3HFVA 5AKZA 2QC3A 4YY3J 3D6FB 3L4PA 3TFSA 4B9SA 3CCZA 2CUYA 4KLOA 2K1RA 4UUXA 2YJEA 4I2BA 2AP6A 4B8AB 4IG0B 3MPDA 2M7SA 4M5GA 1YIJN 2ZD1B 3FR0A 1BO5O 2HHHK 2P66A 4EBDA 3OFEA 1S77D 2CPRA 2Q3PA 1DKGD 5I42B 4ECSA 4JI5K 3I4HX 1U7LA 3PSPA 2W9BA 2OUGA 2FXUA 1NK9A 3X3UA 3ID8A 4NJ8A 3A8JA 4F3QA 5ALMA 1VQ6S 1BISA 1X9WA 4MT1A 2OTLS 2KD1A 4AQYJ 2OTJS 1S1UB 3H3NO 4PPZA 4E1NA 3W66A 2JGAA 2NRWA 5GMKa 1GLJO 3FSYA 9ICSA 2VZ9A 1SV5A 1RWUA 2KKHA 2FJXA 1XMQK 4GW6A 3AFGA 2GHWA 2XB2D 1RU2A 2R8HA 1QLNA 2YMPA 3VEZA 3UCUP 3C6TB 2FSJA 2IPOB 1NRKA 5IC6B 1CS4A 4KC5A 5GADU 1B64A 2XMWA 4GKKF 4CJ4A 2CXEA 1UW4A 2OHDA 3QT6A 1OQ3A 3TJ9A 3OTQA 4P4MA 5KG3A 4PHEA 1MROA 4CIOA 2RHKA 3PACA 3MAQA 3QJJA 1S5LU 2FY8A 3MMBA 5HMLA 4PPDA 3HHNB 3ZI4A 3VGKA 3O6WA 2A3VA 3B4MA 1DGKN 4Z94A 2W2NP 1X3MA 2Q1NA 3P39A 1QHTA 3D2NA 3MTKA 2FMSA 3EXYA 4B3RF 2GV1A 5FPMA 5B66U 3L5KA 4F4ZA 2P5OA 3AGKA 2HKEA 4RUBA 1I39A 3AO2A 3B4DA 3BEGB 3J81j 5J0PA 4FXVA 4FZYA 1R0AA 3H25A 2OMLA 5B0BA 1N4LA 4XH1A 4IOAL 1GT8A 3QWUA 2OEHA 4JI0J 2JC1A 2ISOA 3MM7A 4F9OA 1B0PA 3OYDA 2DGZA 2OXOA 2P9GA 1FE4A 4H0TB 2I5HA 2AJ4A 3GU0A 2XI2A 2KV2A 4EUVA 3UN3A 4DV3F 4BRDA 3UCGA 1GXUA 4NXMK 3NBPB 5AXNA 3SV3A 2AYBA 4DSJA 2BBEA 2LI6A 2ROEA 2P9SA 3CCQN 3L3UA 2XMMA 4DL2A 4I1TA 1VSMA 3BZQA 2A2DA 2P9EA 3RGIA 2FBVA 5AZIA 3JQKA 1RBRA 5JVGQ 4CF3A 1LCUA 4Z6FA 4FK2A 4CEEA 3QERA 2Q6CA 4IO9Q 4CGZA 2E44A 4EEYA 2B4JA 4IFVA 1HNXJ 1PVQA 3J7A1 4WK1A 2MLYA 3CDBA 3UWTA 2AMCB 2QEXS 2ZIVA 3VGMA 1N34K 4CLPA 3LZJA 3HPHA 1Y5NB 4Q8EA 1HR0K 1F0MA 5DG8A 3NS7B 1E6VB 3BKTA 3IG1A 5GTHU 4U95A 5AKKA 4O4GB 1SIWB 3SCIE 1RFQA 2WBMA 4OYZA 3OBWA 4QW8A 1CSJA 1R0BG 2KZMA 1RK8A 5AI9A 3CFPA 4X5VA 4X66J 4USVA 1VQON 1U6ZA 5J2DA 3H59A 4DKWA 3KWGA 2XCPA 1DURA 3DFEA 2ZBRA 3VGVA 4DR6J 3TZWA 3M05A 5DZ7A 3C2PA 5KG7A 3HHDA 1C0FA 4PH5A 1RTZA 4OI2A 1RA6A 4JV1A 4EX7A 5AI6A 3VMFB 2GIFA 3AD9C 2XI9A 2XLKA 2CZVC 4KSEB 4JK9A 1X4BA 1PO6A 1ULRA 3IA0A 4RNMA 2CADA 3ZO7A 5AI8A 2VB6A 3QLHB 4TVAB 1NJIT 4L76A 1HQUA 4OL8A 2O8DB 1ZBSA 3UMGA 3SK3A 3SMSA 3TEHB 3K8VA 1S8OA 4CZHA 3V6HA 5HRPA 2ZJ5A 4OJGA 1JJ2R 1U2RA 4CYUA 1CZAN 4FKYA 3THXB 4CCHA 3CJ2A 1Q7YO 1B70B 3M32A 4ED4A 4ED0A 3J7YU 2ZJRQ 2Y0SC 5AFUH 2MSTA 4LREA 3VR1A 2IM0A 2WOMB 2OLWA 4ECWA 3TAEA 4HI1A 1ZPWX 4LBIA 2KI2A 3K59A 1YITN 2Y3YA 4GMKA 3O1BA 3P3DA 2G09A 1UP1A 2C2DA 1B7FA 2IAJB 5ALUA 1X5SA 4PHTX 5HVFA 4NMXA 4FYDA 3RG6A 2ZH2A 3CJ1A 3T1HJ 3QEAZ 2BM0A 3EE9A 1ELOA 4LF4J 2CPDA 5KT5A 1NMEB 1P90A 2P6TA 5IIOA 1ZBIA 1HPZB 3KDNA 3NRZA 2QV6A 3VQ7A 1FRMA 4MK7A 1UVJA 4IXCA 2RU9A 1EKRA 1EP4B 1RDRA 4DCPB 2KIVA 3CDWA 1L7MA 2LEAA 3GILA 4JK1A 1OS5A 4WF9Q 4P9SA 5C25B 4FK4A 4PJ0U 4PHPA 4OQJA 2VFUA 1V3RA 1HUXA 1U25A 4QIVA 4LF6K 2NRXA 1NNDA 3AUOA 3KLGA 4FLVA 2KOBA 4IG0A 3I9ZA 3LGMA 4QWEA 1PYOB 4NYNA 1FHTA 2K8BB 2FHKA 2ZUCA 5E84A 5KNIA 3M2UB 4UQTA 2FGOA 5J0WA 1SXEA 5AE2A 2IOCA 3JS6A 2EKNA 4IC9A 4HAIA 1ED1A 4UB4A 5JICA 4N8NA 1XMOF 1DOQA 4W4MA 4GVLA 4YHHJ 1S1UA 4WPAA 3CC2S 2N3LA 3VCDA 2BVZA 2NS1B 5C2FA 2XMKA 3ZDBA 2BQ3A 2Y0SD 1XU4A 4ES1A 4P2SA 4YUDA 3U1LA 4MF8A 4M3UA 7ICEA 2DNNA 4TKTA 1L3KA 1L7PA 1BNPA 3O0FA 2VGMA 1FO1A 5K8NA 5BPCA 1KWMA 4OZ3A 2CNLB 1X9SA 1WG1A 4OZJA 5G5HA 1RDDA 4ENOA 1H2UX 4Y2TA 4KTWA 2MZTA 4QJVA 1DY3A 2NREA 5AXKA 2NLWA 2DNPA 2UUCF 4E7LA 1G3OA 3TR5A 2NXUA 3R5AA 3CMES 4HVJA 1VQMS 2BXJA 3ZZUA 5F2RA 1W9HA 4DV7F 1GLDG 3JYTB 5KT4A 3GYXB 3GDQA 4JI6J 4RQ1A 1UWBA 3T1YK 2D69A 4USAA 1FK9B 1B4FA 2IM2A 3WIVA 5BPLA 1BUXA 3L4BC 4EFHA 4XAKA 2XQCA 2CQHA 5C12A 4K0KK 4QS9A 3D68A 1PZNA 2C42A 2BR0A 4DR1K 2MB0B 3IG5A 3LUYA 4TY8A 1IBCB 2JNJA 1T94A 3EW9A 4CK2A 3M6UA 4ZVUB 1NDPA 2OO4A 2PSZA 5ALDA 2XGPA 4DU1A 2QWMA 1DBDA 3HZEA 1N52B 2BW2A 1KVCA 1VQSA 2OFHX 5CR0A 3OYLA 4LF9K 2PFOA 1DRGA 4C8LA 1LV5A 4Z6EA 1WG8A 4OX8A 1YK9A 3NBPA 4USMA 1TKTA 4RKUC 4OLAA 1Z00B 4GNIA 5ALJA 3ISNC 1N8RT 2KH9A 4UZCA 2B9YA 1DRZA 2ZBQA 4M9LA 1ESVA 2Q97A 2E5GA 2IVOA 4MLEA 3MDCA 1AB8A 1H3DA 4HHJA 3G6EN 1EETA 2C3MA 3OD2A 1BQMB 1F5CA 1URNA 1TGOA 1ASUA 3PIOQ 2GJFA 3NTUA 2RKIB 1P9QC 4M5MA 2V2VA 4BY9C 3LDNA 4NXNJ 3HILA 2VGNA 2P6UA 1WSIA 5ALPA 1VLOA 3TJ8A 1DK3A 2YWEA 2HMPA 4UASA 3SFUA 4MYUA 4WTYA 2YTUA 2W3SA 1ZQCA 3K5PA 3KK3B 3J7Z5 1E6VA 4KRWA 2XHBA 2ASDA 2RVJA 1D8YA 7ICKA 4O4GA 3ULHA 4QZGA 2DITA 1VQ4N 4CJVA 4F50A 4UUWA 4KHPJ 1ZOTA 2FY1A 4ERDA 1TL1B 1AYEA 3C19A 4YN4A 5GTIU 2DGXA 1R7IA 2I2YA 3G25A 2YWWA 4Y34A 5E3RA 4JI4K 4CEOA 5J1PA 2J6TA 1J2VA 4OX6A 3CCWA 2AV5A 3MI7X 4DPWA 1YX2A 4FJGA 3NASA 5B0CA 2E5SA 2LMRA 2QA1A 4K5RA 2Y1RI 5T7LB 5DBBA 1EHWA 3NCQA 4DV6J 1A76A 1XR7A 4DR3F 2I1RA 4B1XB 1EWQA 8ICJA 2DHGA 4ZH4A 1XNRJ 3CETA 2NRVA 1HBNB 3Q8PB 2VQFJ 4AM7A 1PKUA 3TUZC 1WHYA 3GJQB 2O8DA 2WBNA 4TSXA 1S4EA 3ISND 1L5UA 7ICTA 4CHQA 1CXQA 5DG9A 4LH4A 3T6JA 2R7RA 4YOEA 2UZAA 2MRLA 2D9OA 4LZGA 4B3SJ 2BDUA 2XICA 3GR0A 4DLGA 3WC0A 3THXA 1H74A 1KR4A 2VPYB 2PE8A 4B9QA 3HVRA 4PQUB 2GJ2A 1N5VA 1YJWS 2DR6A 4BX9C 4G65A 2HRYA 2VHGA 4DN0A 4GKKK 2WOMA 1S6PB 1XI1A 1BWEA 5LSRA 2XY8A 3CHWA 2P6SA 2YBVA 2FJEB 1VQPS 3JTOA 5GAGU 2V7YA 5CY4A 4QZ9A 2H3EB 3TZZA 3KZIU 4CDIA 2QSWA 3QGPA 1DT9A 8ICQA 5DO2A 3ZT2A 3FUYA 8ICIA 4N47A 3FFIB 1UVLA 2QB0A 2BGGA 3Q2TC 4A62A 3RRHA 3DJCA 3EZWA 3DM2B 2BM1A 2H3FA 4KBOA 4B3RK 5IWAF 4K5SA 4P0QB 1HPZA 2Q0ZX 3IM1A 3EYZA 3AH6A 4KAIA 2YNGB 2KFZA 1PJ7A 1FVSA 2D74B 2BKEA 4LFAJ 4Y65A 2ZIWB 2KJWA 3DC2A 3NVKA 3G0ZA 5AM3A 2EZXA 3WDOA 1YHQN 1B0VA 2J4RA 1PJ6A 4MKYA 3NF9A 3ZTSA 4KHRA 1GO3F 2QLWA 2IVNA 4HYKA 4PABA 1QQ5A 3VERA 1N5YB 5KPTA 1LWFB 4F4YA 3NGSA 2ZHBA 2IBKA 3PTWA 1HA1A 2E20A 1VQ8N 2Y0BB 4DV3K 4IWVA 3SEOA 2K06A 1NM2A 2IA0A 2WFAA 4FJMA 1TV6A 1RHQB 3GB0A 2CQGA 2RHQB 1FTRA 2QMXA 5D4LA 4ZA1A 3S8SA 2D3UA 2FLPA 4CDGA 3ZSRA 4JYAJ 3M2UA 1S0NA 1SC4B 1K9MO 4J9KA 2VJUA 1JLGB 2HOQA 3AEVA 1ZBFA 1UHUA 4DPOA 1SVDA 1D9AA 2F3NA 3O80A 1Y7PA 3H5XA 4IRKA 1RE1B 3RWUA 3F5AA 4CF4A 3GCWP 1VQ5N 3RRKA 4OIXA 4KE5A 3N0VA 3M8QB 2HI0A 2HEKA 4JRQA 5AE1A 3A12A 4PUOB 4ANDA 3RH4A 3WHIA 4P6QA 1ZD4A 2P9UB 3LK9A 2AJ1A 2PIIA 2K7KA 4ZJOA 3EGNA 1NK4A 2ERRA 3OYEA 2OCEA 3QETA 1UJ4A 4DV2F 2J9DE 4UF4A 3UDLA 2BQRA 2LKYA 3FEYB 3CVKA 1C20A 3BB5A 4RW9B 3LDLA 2PN6A 1LW0B 2KNJA 1BWFO 3FMBA 1AROP 5FPDA 3ZSVA 2UUWA 4TUSA 4WFBL 1RHRB 3IO1A 1TVRA 3VAHA 3VAJA 1NGAA 4DFMA 2W3RA 1FFGB 3MDAA 2PGCA 1NGHA 4E7HA 4DMNA 3JYTA 5FRNA 2IHMA 1F2GA 4O5BA 4O8KA 1HYSB 1U6BA 1FK9A 2N4DA 2ZIUB 3OJUA 2IBOA 4X62J 2FJAB 2NCKL 3WK9A 3DOLA 2DHXA 1FRJA 4AD6A 3UO0A 3AXKA 4N41A 2F9DA 1KQSM 1E4GT 1R27B 4R0JA 2YNHB 1SKUB 3GLJA 1SB6A 2JZBB 4PAAA 5AM4A 4PG8A 4YMEA 2CRLA 3TABA 3Q0AA 2ZOFA 4DV1J 2F7VA 1HJRA 3VAIA 2N3OA 2LQBA 4CJ5A 4RPFA 2IDEA 3H3OB 2VUGA 4R0EA 4FPBA 3UXOA 3OVNA 2KJ9A 1WDDA 2EFQA 1RWOB 2RB7A 2R9LA 3GG0A 2WBRA 2XSJA 4J9OA 3ELHA 1S5JA 1T9UA 1X40A 5KFLA 1BQMA 2LCWA 2P9CA 2X3DA 3HXMA 1FXXA 4MH8A 1SZ2A 4QAGA 1RDAA 4O0JA 3NUQA 1MWQA 3SXLA 2ZNYA 3FZFA 3F2BA 3OVSA 4JRPA 3OLAA 2E2OA 5AIAA 4JI7J 1P1LA 3DRYA 5M2RA 1YG0A 4OV1A 5I3QA 4NLYA 2H1YA 1JN3A 3RSEB 3TSUA 3JB9k 5CH7B 1RKJA 2JWLA 1OSCA 3L2WA 2G06A 2GEMA 1WI8A 4JV2A 3VGTA 2KE7A 1VAZA 5AQRA 4J9NA 5TZVA 1U6FA 1TL1A 3RJIA 3SCJE 1U09A 3ONQA 1HJOA 3VWSA 1M5PC 2FF3B 4V19S 1VBZA 4F2SA 4RQ8A 1SC1B 3D7SB 2AHOB 3WXLA 4QS8A 4QWCA 1JLFB 1RSCA 2F44A 3N7RC 3CCRN 3PX6A 4LRDA 3IRXB 5J2EA 4X65J 3OL9A 2E8AA 4KTZA 3FFKB 1XIQA 5T7LA 1I6JA 1A9NB 2KN4A 4FF4A 5FPEA 3R9KA 4WFXA 4G1IA 2OD6A 1O51A 4IO1A 1WHWA 2ZUGA 1VJWA 3SD7A 2EFVA 4CO2A 2IOHA 3MK6A 1XO0A 1RG6A 1XMOK 3ZXWA 3O6QA 3AA5X 2B4OA 5A8RA 2A18A 1X9XA 4WIIA 1KVJA 4JHDB 1URJA 4FJ7A 1SKRA 4NI2A 2GNKA 3N5BA 2K8GA 4GXKA 2AKWB 3KKAA 3L2QA 2DRAA 1K6YA 4YXMA 2P2CB 3I8DA 2MYFA 3NMRA 2HHSA 1CG2A 4PQUA 4IL6U 2FDNA 2PMHA 3MR7A 4FDFA 4ALZA 3L2UA 4DV0J 4KLEA 4KGXB 4PL1A 1S6PA 4NZ0A 4JI2J 2N82B 2EC2A 1KQGB 1KKHA 4CZLA 1BXNA 1G2EA 5AXLA 3GYNA 3E01B 1RILA 4PHDA 3FFIA 4BCAA 4CEAA 4TURA 5E2QA 1UTAA 2YKPA 2NRRA 4PG6A 2UP1A 3K0SA 3DM2A 2HOFA 4P0QA 2MZSA 4CZEA 2ZUBA 4DTSA 4K4YA 4OX9J 5BYSA 5LMUJ 5AQKA 1RQNA 2MTLA 2Z58B 4DHYA 3KKAC 5ALOA 3EVMA 2NO5A 1X4GA 3P6YC 1JQGA 2YX7A 2E1FA 2ZM6F 3FYHA 2ZQBA 2VIHA 3FDSA 2VC0A 1FKPB 4YOYA 4K8RA 3MGJA 1QVFM 1XQSC 4DOAA 4DPUA 1CXUA 4OJOA 1Y3KA 2VWKA 2ZTEA 1QUPA 1N5YA 4DQSA 4ZVRB 2HIYA 1MMDA 1LWFA 4CGJA 4H5NA 4OX7A 5GAGP 2EI5A 3UPFA 2LSNA 2RT3A 4BRNA 1P1TA 5KRTA 2PFPA 4G3IA 1CJUB 2DUYA 3CJ4A 2Z2MA 3HX0A 1TL4A 1NU0A 2M9KA 4F5PA 3CQXA 3R6MA 3VGSA 2KEYA 2ITMA 1Q0NA 4OZ0A 5B0EA 2EBGA 3QZ8A 4CLWA 4NLUA 2ATCB 3RJJA 2YWHA 1ATSA 1PG5B 1UT8A 2X3GA 5D4BA 3CJ3A 2YX1A 4Y2JA 3TTDA 3LPUA 3M8QA 1O03A 2O5DA 2FQQB 3EGWB 1HNZF 4PUOA 4ZVFA 5KI6A 3OS2A 3FAHA 2P9UA 3QYPA 1RHJB 4I7FA 3MXIA 5AM2A 2LVWA 4MKAA 2R7UA 3G82B 5GMDA 4DZ6A 3O8WA 1ZQPA 2Q2RA 4FNHA 1Z1VA 4RW9A 1TKXB 2VFRA 4B3TF 3NOGA 1LW0A 2VA3A 4C23A 5KG1A 4QIGA 4DCCA 3AQOA 4BJQA 3MGIA 1DQ8A 1EXNA 4MTPA 2MU2A 2YX6A 3T5KA 1O1WA 1V4SA 1NK5A 2OHFA 2DBYA 2ZHAA 2FMPA 5AKGA 4S0MA 1HYSA 3JSMB 2ZH5A 4KQZA 1IKXA 2ZIUA 2LU2A 3G6VA 1LKYB 4DS5A 4PXCA 4UBBA 4YOUA 1M1KO 1WKKA 3BDEA 1WWVA 3G10A 2NUUG 3LVVA 4YFUA 4DR3K 1YJNN 2YNHA 4Y6IA 5I3PA 3LP2B 5F41A 3A0BU 3FGUA 3AJ1A 1RKIA 3ETOA 3KKRA 2JZBA 3QE9Y 4EENA 2NZ4A 4MFAA 3N97B 4WTOB 2WVCA 4LJXA 2KQ2A 3V1OA 2BRKA 3ISZA 2OAUA 4CWBA 5CAAA 8ICYA 5DQHA 1D8ZA 4HHHA 5ALIA 3QU4A 5DM6L 2V8VA 1DZ5A 1H38A 4DR7F 1B4SA 2V8DA 2NQPA 3PZPA 3CF5Q 1X9JA 1C0TB 1S4FA 3HSDA 2KG0A 1KVAA 2XWXA 4WFAL 1UFLA 2F9WA 2FIUA 2HWHA 1VQ8S 3JPTA 4CE9A 4O3MA 2RIJA 2CDRB 2HF3A 1MMLA 4RBTA 2XYPB 1S72S 3UE5A 1UAXA 3HSJA 1VRTB 4USHA 1M6YA 2VA8A 3KHRA 4B9TA 4B9LA 1SAZA 3CMQA 3THVA 1Y3JA 2PMZC 1SB3C 1F60B 2LP4A 3DRPB 4BREA 2AJFE 4ZVQB 3RSEA 2FJDB 4BBYA 1NJZA 4K4WA 4RT3A 4ZPAA 5MLCV 2GWJA 3KJVB 1RT4B 2BJDA 4DL4A 5IWAK 1DQ9A 4F02A 4ZOHC 3AVBA 5HRRA 3OYIA 2XZDB 4X4PA 2HFUA 5DMRA 4E1JA 2JEFA 4BGDA 1NM1A 1WCLA 3Q8LA 1N5SA 2FD2A 4Z7CA 1S6QB 3FJ2A 1A5WA 3EY1A 2ZJAA 3MMVA 4A8SA 1ZQYA 4GY2B 3PKMA 4C8YA 3MCMA 3E2EA 4DU4A 2ZE2B 3RW7A 1JLFA 2ASJA 4HT7A 4FBUA 4HACA 1WOOA 5EX0A 5TKYA 3IRXA 2CPHA 4MJKA 4BC2A 5KFKA 4NLQA 2WVBA 2MQPA 2FVSA 1VQKS 2LU1A 4NLXA 3V6DB 1VSIA 3S3OA 2PY5A 5BR8F 5AI4A 5EY4A 2DF4B 4J7CA 5KFTA 4OKKA 4E89A 4ECXA 2DNOA 1T9TA 3CT9A 3KMQA 3MTJA 1S7IA 5L1MA 3LVWA 1WF0A 5C42B 2XMVA 4JHDA 3L7UA 3W65A 5K8MA 1UVIA 2RAQA 9ICJA 1TUUA 1APSA 4JNEA 9ICRA 5T14A 5IOLA 4CLZA 1RBTA 1HWKA 3QEBZ 4TXSA 1CLFA 3J7AP 3I28A 3N5FA 3SR6A 1ZQMA 2FGCA 2KT3A 4LR7A 3CYMA 3FQLA 4B9VA 5GVQA 3CJKB 1Q95G 2FZGB 3KHLA 3FGVA 4DUYJ 1D5AA 2L3MA 4Z37A 4FVUA 2ALYB 3J81Y 4RW4B 2I9SA 1FTCA 1VQ9S 2NLXA 4ZJQA 1KCFA 4MDAA 4H4MB 1NSPA 1QQCA 3E01A 2HHHJ 1Q78A 2RSQA 4AF1A 2XG8A 2E88A 5ETOA 4BQZA 3RJGA 2RF2B 5KFJA 5IQQA 2VWJA 2RU3A 1T03B 4BRIA 5TISU 1P27B 2V2KA 4NX9A 4Y0FA 2E1EA 5ALWA 3U3YA 5B08A 4ITSA 1WG5A 1KD1O 1XNSA 5DB7A 2OJ3A 4CGIA 1L8OA 3G71S 1NJWA 1RAGB 2VANA 4HEA9 1T44A 1KC8O 1FKPA 4KMUA 5J0SA 2YPYA 5I3UB 3WK8A 2FJ6A 3K1ZA 3H98A 3VAFA 3WK5A 4OYPA 5F0WA 1ZAXA 3B9JA 1HQEB 3R2CJ 3IWXA 2LQJA 1QQNA 3DLLL 2JH7A 3M6KA 3AVKA 4C0OC 1CJUA 2KHVA 5ETPA 2Y1JA 1U04A 3MMCB 1ZQGA 2E5JA 3BKUA 3QGGA 1RAEB 2HMIB 1IV8A 2DK2A 4L3KA 2V51B 2WUSA 2ATLA 2X1FA 3O1WA 3RB0A 2OANA 2L5YA 1HHQA 4FF3A 2LHTA 3M3ZA 1X6JA 4XDDA 3TADA 4IR9A 3NNCA 3OTCA 2VPXB 4PXEA 1WI6A 1IN0A 1WHVA 2H5XA 1S59A 1XSPA 2DQNB 4WP3A 4WYBA 4FVMA 5D49A 1OXJA 5D8HB 3VQ9A 4H5RA 3ZTPA 4F25A 3PW2A 1Y4ZB 3DU5A 4E7JA 1SQKA 1F5BA 4ILLA 2HLUA 3GFXA 3G82A 4CE6A 4BG9A 3DXMB 2OA8A 1U2VB 4FZMA 4B1WB 2JLGA 3PDNA 4R66A 1TKXA 4ILRA 4IDKB 5A8KB 3WUHA 4NXMJ 4LR9A 4K4HA 1QQMA 4K4XA 5ALLA 5KTQA 5MAOA 4EK2A 5GADI 1HWJA 2QJ3A 3OHAA 3HWTA 3W9HA 3Q8SB 3SMPA 3DEEA 1U1QA 4LD0A 3C1ZA 1WN7A 2VPWB 3X1LB 2KHDA 1RAIB 1A0PA 2QI2A 3TADC 5C5JA 4OJPA 1CVJA 3JSMA 4CLSA 1WG4A 5CHGA 1LKYA 5B7WA 8ICNA 2VKQA 3RMCA 3ENVA 2QFIA 2X1BA 1BA0A 2W40A 2WB1C 3JAMY 2DPJA 5A6WA 5AM5A 1OPIA 1KN5A 1GLAG 4BRGA 1MNEA 4ZK7M 2DIVA 4HCCA 3HMJG 5EUHA 1HW9A 2I5JB 2VQEJ 2DFEA 1Z4UA 6FDRA 4F4WA 3LP2A 2LM1A 4NLOA 2JRSA 1J97A 2K3IA 3LDAA 3RBZA 3AAWB 4OYOA 3QIPB 5AQWA 1YDLA 1Y97A 5GIPA 3OPKA 4EWTA 3TFRA 1C1AA 3HULA 2CJBA 2Z0GA 2CKWA 3ULDA 2ZTDA 4L73A 2F4VJ 3L2VA 3ZDEA 3KDOA 3BF1A 5CWRA 2A6OA 2O8FB 1C0TA 4WFZA 4E7IA 5M1KA 3CJ7A 4KHWA 4FLWA 4NRTA 1RPLA 1JNRB 1WORA 1S1VA 3BS7A 1VK0A 3F9KA 1XNQK 3Q89A 1GTHA 1N33F 4X4UA 4IEEA 2DCUB 4QIFA 3GJRB 3W8PA 5C7PA 1T9XA 1K9MT 4FO6A 5FD1A 1QD1A 2D5RA 1S97A 1ECWA 1SC3B 2DO4A 1VRTA 4OO1J 4Y2YA 1FEEA 3VEOA 5B8HA 3U7JA 5AI0A 3OL7A 3HL8A 2QO3A 4K42A 1RGIA 3KG1A 4NWIA 3CMAN 4RQ0A 3D2WA 1NSKL 2CNKB 1D8BA 5F0UA 2EEYA 5KOXA 3NNAA 4BLGA 3FCHA 2RDIA 2AA4A 4V19J 4RWTA 3K2YA 3OPXA 4FJIA 3J81U 3NS5A 1HFEL 3C6UB 3TVYA 5F8MA 3BREA 1S6QA 4CH1A 3A3NB 2W55A 2LYVA 1TYQB 3NF6A 1HI0P 3O9TA 3KOAA 2WB1D 1AQ6A 2EWHA 3H90A 3CD6N 4GVBB 2ZE2A 2KO1A 1Q5YA 3QEIA 3T5HA 3MAAB 2OKQA 3H6EA 2KK0A 2M88A 1Q86T 4OPAA 5HHIA 5F1XA 4ZLJA 3AVJA 3SQGB 3ATUA 2XS7A 1TUVA 1S99A 3G9CA 3BGLA 1HNIA 3BGUA 4JK7A 3H4DA 4CH7A 3V6DA 2KVIA 1HHTP 4ZTJA 3D7EO 2FSNA 3QICA 4U7UK 3V4IB 1N56A 4BS2A 1MC8A 5JUMA 2DTJA 5AQYA 5C42A 1QZ6A 5IIIA 4C97A 3L4IA 3LWMA 4I2CA 3V9UA 1SZPA 3VAMA 2H65B 2XHCA 1DGJA 3UW1A 4PG5A 5ETLA 4DJBA 1HNZK 4KX3A 4B3MJ 5D0GA 4WBFA 4ZITA 1PAUB 4QYZJ 2IVYA 3L7PA 2E7WA 4CI6A 3ZX2A 4JS4A 1RCHA 3GFHA 3HI0A 4TQSA 4WIQA 3SPYA 4RW4A 2OPPB 4LFBK 1WDTA 1HNWF 4B3TK 4L3QA 2VG5B 2WZ1A 5B5EU 2DBBA 2MQLA 3TTCA 5J2CA 3J7YI 3A8KA 3CCSN 1K5OA 2KHCA 4H4MA 2KDOA 1H6KX 4CO1A 2MQ8A 1WOQA 4DV5F 3DV9A 4NA1A 3AA8A 4U8YA 4JS5A 3R5DA 3WEEB 1Z4NA 1FRHA 4Y2CA 3HJFA 2CJQA 2RF2A 2EBEA 5KL8B 4M5KA 1SV0A 1T03A 1PYTA 4Y2UA 1OYDA 1V4TA 1T95A 1XR6A 4F93B 4UB6U 4J90A 2HURA 3THTA 2CJ9A 4FLXA 3AVAA 2GS8A 3OL8A 1M1GA 1J5EJ 1SWVA 4PG4A 3R7SB 5AQPA 4PYDA 2R7VA 2O8BB 1Z1ZA 1KEJA 2GWSA 5LMNF 3R5BA 5I3UA 2DGUA 4ZIWA 2W4PA 3R5GA 3MM5B 2YTCA 3ILLA 2R3VA 2D0OA 2FC8A 3ZT4A 1UT5A 3IR6B 2CWKA 3PKYA 2GW8A 3Q7BA 1X5OA 3ZSYA 2UUBJ 1C2PA 5EXWA 3EPGA 2B51A 3T3FA 1U2FA 3MMCA 4Q2LA 1SBRA 4O3SA 2HMIA 3JAMU 2EFOA 3O44A 4DR7K 3GV8B 1SQGA 3CCTA 5KFGA 3ICXA 1LW2A 2ZDPA 4WYWA 2LA4A 2FJBB 1SUQB 5H9EJ 1KW4A 3K57A 1SV0C 2P51A 1C4AA 2UXCF 2LDIA 3T1YJ 3OW2M 3TZXA 4CNYA 4I2DA 3G96A 2Q66A 2W25A 1CPZA 4MIWA 3VQCA 3SI6A 2YNFB 8ICLA 4ID1A 2LYAA 4EZ6A 1Z1BA 2PC6A 3R1XA 4X4TA 4A8QA 2W9MA 1IR2A 2LECA 2R18A 2H48B 2H4WB 3DXMA 4NLGA 1VQYA 1U2VA 5BRDA 3UCZP 4J9PA 3MOJB 4US8A 3BR9A 2HF4A 4OPKA 1RT6B 5A8KA 4TN2A 2NUBA 3EE8A 4F4AA 1NGJA 4FOEA 3HK2A 1R43A 2BZ2A 3V81B 2X1AA 1HBUB 4M1KA 1MU2B 2UXBF 2IM1A 3ZD8A 4MO5A 5M1FA 3DDNA 1OIAA 3A5NC 3HTVA 1W7AA 2HGNA 1S1WB 3R3LA 3DKDA 4ZKAA 1I3OB 3K5LA 4RW8B 3KNGA 4GO5X 2AWZA 1FD2A 4IO8A 4I0WA 3VF2A 1D4XA 4OHZA 4TU9A 3TUPA 5CABA 3QPIA 4M3XA 1WEXA 2GTDA 3CRXA 2I38A 2MGZB 2JDJA 4KTQA 5BPMA 4M41A 4JKGB 3NKYA 4YB5A 5BR8K 4OYWA 2RNEA 3TAGA 3IP0A 3QIPA 3S9HA 3NH2A 3GJTB 4E19A 1R6YA 1IV0A 4U9RA 3DMJB 2HSZA 2XY7A 1HUZA 3W8GA 1CJKB 2D3ZA 3IMXA 2VG6B 1NSAA 4YOXA 2ZNZA 3LP1B 4RNNA 2HOIA 3AVFA 3BKFA 4JI1K 4YQWA 2HB5A 1ZQRA 2A19A 3DDKA 2XLIA 4KR0B 2HFOA 2O8FA 5LY3A 5HP4A 3LQVA 2IM3A 3C16B 2LDYA 3F41A 1CLQA 1X0FA 2G8UA 4AQYF 5JVHQ 3PSFA 5ETNA 4ZTFA 1FWKA 5D4NA 2FVPA 4LVSA 1RCXB 2LEBA 1VK8A 3LTOA 5AQXA 5EGYA 1HBMA 4K50A 2V94A 3EZUA 5CQGA 1Y5IB 3DLEB 2C22A 1LFWA 1NNEA 3ETLA 2GUPA 1J9AA 4ER8A 1ZBHA 2AZ1A 1YGYA 1ZQFA 4MAKA 2XSFA 3C0BA 4F0MA 4A5AA 5DM6Q 4HKQA 3W5ZA 3OTOF 1HYVA 1OH6A 1Q5VA 1WLJA 4IQMA 5KFUA 3CC4N 1N54B 3SAHA 3Q8YA 2QWOA 3C65A 4DX6A 3HVAA 3C6UA 1LK7A 9ICXA 4IZ9A 4DFKA 3QGHA 2AQ4A 2AEJA 3H4BA 1KLMB 1TYQA 7ICLA 2I8EA 4QQBA 3RUBL 4GXJA 3Q8VA 5ALSA 2R8JA 5JJBA 3R5CA 5JS2A 5H2FU 3BN4A 1FJGJ 4GVBA 1J6ZA 5ALXA 1WC6A 4F72A 1A77A 1EJ7L 4GKKJ 5HBMB 4LH5A 2IVFB 2LXIA 3MAAA 2RDDA 4CO5A 2AGPA 3ADAC 3SQGA 4C8ZA 3M5RA 3D3CJ 3H42A 1WC0A 3CCMS 3NL0A 1HLUA 2MAXA 1KQSR 1D1UA 3HJEA 3I4PA 4RWWA 3MPVA 5DDRC 1B92A 4KLLA 2KKVA 4MFFA 3K8WA 5B09A 3V4IA 3MX2A 3R6GB 2MKIA 1CQMA 2XVTA 2K3KA 1LB2B 3B8AX 2CDQA 1M1KT 4W5TA 3B54A 1R6VA 2V34A 3BSCA 3OUYB 1Y5LB 2H9ZA 4DPXA 4EI2A 2HG4A 2FHMA 1QAYA 3BPDA 4H0OA 2KP7A 3PHEA 4R25A 3VQBA 2UUAF 1C7YA 1D09B 1K73T 3HHLB 2W2PP 4UARA 5D4OA 4DV3J 3I56N 3THYB 1REGX 4ED7A 3HOTA 2DXFA 2VG5A 2E6MA 1WBDA 3PYDA 2MSSA 2FHJA 2GQQA 2E6LA 3GG4A 1G7CB 2BACA 1SKSA 2D0AA 1QUVA 5AQGA 2FBYA 5GAGI 1SH3A 4TUPA 4JI8J 2Z8QA 2QYCA 5E33A 4USJC 4NA2A 4ETZA 4DCOB 2UVVA 1FESA 3LANA 1AUSL 3D2FB 5J2HA 1TKDA 3NWGA 2B6AB 3ALYA 3CJ8A 1C6VA 8ATCB 4KGZB 5AHXA 2DIUA 3AD8C 4CLLA 2FDRA 4FSVA 2Q4TA 3GPAA 4Q45A 2WSFC 2VWBA 4YDUA 3QGIA 5FLXY 2ZGZA 1OH8A 1BE4A 3MM5A 2DO0A 3D0HE 2KFYA 1RA7A 2J6SA 3VQEA 2JH1A 2ODGA 4EFAC 4CJKA 3O08A 5C24B 3TUJC 1P8ZA 2P9PA 1PSDA 4UB1A 3AA2A 1RDFA 3I55N 1ZTWA 1SXDA 4C48A 1JMTA 2HBJA 2MKHA 1S9FA 3VF0B 3A8IA 5KFBA 1NJIO 4DR4F 3HI9A 4GIBA 1ZQEA 2PD1A 1B22A 3GWCA 4PZVA 2ZC3A 2G8WA 2EZYA 2H5IB 1K8KA 2WFBA 2KIWA 5JVGL 1SUQA 1M1HA 3OYGA 1X4DA 4OD0A 1RQ0A 2M52A 3KBBA 4GVMA 3WKDA 4ED3A 4U7UD 3VEVA 3P8BB 3MWBA 2XS5A 3PR5B 2JVOA 4P7TA 4TLRA 3IUCA 1N33K 2YNFA 4HH1A 4BROA 5CE3A 4FJ5A 4BDYA 4HTJA 4LVOP 4FS2A 1QS4A 1B99A 3H2UB 3WQTA 3DLLQ 4PKIA 2CA9A 2UU9K 4I6YA 1KAYA 1KDNA 2NSBA 5CA5A 2AEMA 3K1RB 1U0SA 4JI5F 3AAQA 1RT6A 2PEBA 4Q7AA 1GMWA 3AQPA 5CZVA 4M63A 3AVMA 3QX7A 2YCHA 4CHNA 4FPIA 3V81A 3TAPA 2DY1A 3OYJA 5J2MB 1IUJA 1G4CA 1HBUA 2DR9A 2XM3A 1MU2A 2RS2A 3ILIA 1IBLF 1YZ6A 1XMQF 3AJ2A 2GLEA 2HYIB 1QCKA 4O5KA 3T1HF 1GLCG 3DOKA 1S1WA 9ICOA 3MECB 2VKRA 4XIUA 5DKWA 3MDFA 4RW8A 2HQDA 3GCXP 4RJVA 3EWGA 4N7TA 3SUPA 2UVUA 4QOTA 3S3NA 4P2MA 4JMUA 2CH6A 4W90B 2P1JA 1TMJA 4ZPDA 2MGZA 2VG7B 2G0AA 1QVFR 4NLDA 3GE1A 3E9OA 2GMLA 2GJIA 4JKGA 3V1QA 4OJLA 3NVMA 3KNAA 4I9QA 2FHJD 7ICVA 3DMJA 3C5FA 5AFUA 1S0VA 1KD1T 5DBCA 2P9LB 4K8XA 3QATA 3ZDAA 3NAHA 1OH7A 2OSRA 4AXJA 3Q24A 2B56A 3RTVA 5M1QA 4PA1A 3O3LA 4KHYA 1ZQUA 4YHHF 4FWKA 5HN0A 1ZRMA 1KQQA 3A5MC 1FWPA 3M1VB 3PX4A 1HWLA 2Z57B 3LH2S 5H1SQ 4M2YA 5DDYA 4WP8A 1HNWK 3DLEA 2H3GX 4QR1A 2DNYA 1D0EA 3KWMA 3KMSA 4DV5K 2ITGA 2CXYA 4B1YB 2ZBPA 4OZ1A 3S1TA 4XDCA 2C3PA 3PLAA 3BJYA 4ID5B 1NK6A 2XTJP 2AZ3A 1YJ9N 1X4EA 2E5IA 4JKAA 2VH7A 3EUB2 4WF9L 3SCXA 2HQFA 3GDXA 1UETA 3NS1A 4AHCA 1KL9A 2HRUA 3TP2A 1VQNS 4PYAA 2HS4A 3L95X 3LGHA 2UXDK 3LDOA 1AW0A 1PC5A 1EARA 1ZAVA 3QEPA 5LMNK 1U45A 3MMAB 4Z4FA 4F3OA 4IQVA 2V2QA 1N34F 5HBMA 1W2IA 2W41A 2LQ8A 3TX8A 2F8TA 3CP8A 2O01C 3HVTB 4KH5A 5AT1B 2UUCJ 4C0BA 1T8EA 2ADBA 1MN9A 4M3TA 1VR6A 4WP9A 3CXCM 3ENAA 1GMWD 2W04A 2UUTA 3LOUA 5G0RB 4DV7J 3QUQA 4IH6A 5AQSA 2EFGA 3C8YA 1TV9A 5DDOC 2UXCK 4PL8A 1FXRA 4RLEA 3HP9A 1Q8BA 1IG9A 5FLXU 2HGLA 3WXJA 4ISGA 1EAYC 4WFNQ 1YBUA 4IG3B 3VA3A 3U4LA 1NZPA 2IC3B 1N8RO 3KIOA 3LM9A 5K8OA 3R9LA 3OUYA 7ICHA 4JI3J 3CO0P 3ALRA 1ZC6A 2XS2A 3D66A 4DTXA 5K4LA 3IBFB 2OZSA 2XZTB 3HHLA 3KFWX 4FWLA 1T3NA 1BI4B 3CJCA 2L08A 3U3GA 3JXUA 5D15A 2XHWA 4RW7B 4ZLPA 3ENWA 1RT2B 4X64J 1ZQVA 2UXBK 5EE0A 3NGIA 1O8BA 2BKOA 1YLXA 1N5QA 4URSA 4DSIA 1JXLA 1GX6A 2ASLA 4NOHA 5DB8A 2E3TA 1IKWA 1DLOB 3D2FA 1YJUA 1O5JA 2B6AA 3PXGa 3I1YA 3JPNA 5J2QA 5L1KA 5BR9A 1RZMA 2F8LA 2DNRA 1OPZA 2PA3A 2BUNA 2HRTA 2E1YA 8ICFA 1KFTA 4KPCA 3D6RA 3WNFA 5C15A 3HHLC 1ZETA 2A10A 4OMFG 1R59O 4M94A 3D0PA 3GL1A 4CJQA 2Y9TA 3HSGA 2G1DA 3OTDA 3GQCA 2V4RA 1A7GE 3J81O 5CHCB 3P4IA 2G8KA 3I32A 4TLQA 3JPOA 1RM6C 4ZMMA 5K8PA 4QWBA 3NGUA 4XRHA 4CO3A 5K9FA 1XNRF 2DHAA 1Q46A 4KI6A 2VQFF 3CUNA 1S9EB 1VYAA 3IG8A 5F8NA 1L3VA 4WKYA 1IJEB 3PIOL 3AA4A 2GHVC 2GQ2A 2J5AA 2AGQA 2BE2B 2VPZB 1X8DA 1BQXA 4AQYK 1N2XA 3FBEA 2B0GA 1VK3A 4CP5A 1ZQWA 5CHIA 3H8MA 2CZ4A 4XH5A 2VBYA 3M6GA 1Q81T 3M7DA 2Z7JA 1X4FA 2G0JA 4IDHA 4HHTA 4Z4GA 1RWKB 3S41A 1X42A 3BQTA 5I4MA 4NLBA 3D2EB 3LP3A 4JV5J 3KKFA 1HKGA 2QTWA 4CD1A 1LNQA 1TFWA 3L0QA 1XQIA 4YCXA 1C1CB 1RTJA 1YI2N 2WW8A 1R0CB 5J2JA 4I2HA 3KZXA 4RUAA 1FJ7A 2E1ZA 5J2MA 4OJ3A 2NR0A 2YKMB 2DKZA 1IR0A 5ALFA 4HTIA 3F5TA 3CPWM 1URRA 4EEKA 3CW2C 2X74A 3EN9A 3MECA 1T7PA 3NP5A 3UKRB 2FZKB 4G1PA 2Z30B 4UY8T 2JV3A 3DRRB 2KL8A 2IVPA 4LF1A 3HHLD 2E5HA 1DGSA 2ZGYA 4JI0K 3QU9A 2A1RA 5HMWA 4RT2A 4G1QB 4O9MA 3MXJA 4M7YA 1WC4A 1QHAA 4IQXA 4Y1DA 2O3DA 3CCJN 1OY8A 1VHFA 3D0GE 5AK5A 4NA3A 5IWAJ 1V38A 1NSQA 4NEYA 2P9LA 5CZXA 4V19X 1S6OA 4QU7A 3K9KA 5KFFA 2FBTA 5E7OB 2N7CA 3KYLA 4DPTA 3U1NA 4OHXA 1RWXB 4I2IA 2ZUAA 1IJFB 5KT3A 4WK3A 2QA4N 2M4MA 2VA2A 3DWLA 3DLJA 2ASOA 4FZXC 2ZIXB 5D6GA 2QARB 2B21A 4AFFA 4DR1F 1T6DA 3CQ8A 2UUAK 2H54B 1COKA 3P4UB 1F9HA 1FW6A 1NB7A 3M8YA 4C4RA 3VCBA 1Q8IA 4KHSA 2Y9UA 4BUGA 2JWKA 2IHR1 3JAMO 1TFYA 4CEBA 1WSGA 3PM9A 4LF9F 1KN6A 1IKYA 4CGGA 4I2FA 3SENA 4RQ4A 4B9NA 5DZ6A 1RQLA 4IFYA 4OHWA 2KLAA 4LBPA 4J9RA 1ITPA 4ID5A 5DK5A 1HQ2A 2M5YA 1LEOA 4DUZJ 2PA8D 4LSNA 4EO6A 2ZJPL 5AIBA 3JPRA 3GSIA 2CQIA 3TANA 3ZZTA 5K14B 2CQ2A 3ONNA 4M95A 1FFSB 2EW9A 2Q0UA 5A8WA 2X78A 3C29A 3R1HA 2L41A 4QNLA 2YX4A 3ZX3A 2V2ZA 4R5PB 4OGCA 4LVNP 3MMAA 4OZ2A 5CYQB 3FBCA 2EK1A 5THWA 2UV8A 4QZIA 4DV2J 2OEMA 4X62F