4F2SA

Dna polymerase i large fragment complex 4
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
578
structure length
578
Chain Sequence
b'MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 199
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2sA01
2XHBA 1X9MA 1A76A 4QWEA 4FLYA 4YFUA 4UB2A 4CERA 4FZXC 4F5PA 4KLLA 2AJQA 4YXJA 4DMNA 2VA3A 2ISOA 1S1TA 4FLWA 2JEFA 1BIZA 4HVJA 7ICRA 4RQ1A 3I8DA 1ITGA 5J0RA 1S6PA 3IAYA 1ASUA 4J9RA 3PW5A 3LWLA 2A1RA 1SKSA 2HVIA 2Z1IA 2HHVA 3WNHA 5SWMA 1GOAA 3FDSA 1NKCA 5DBAA 2B21A 5J2DA 2RDIA 1BHLA 3AVHA 3QEXA 1IKYA 4R64A 1V9PA 1U04A 4F3TA 4RQ4A 4PQUA 1XU4A 4FJHA 3C6TA 4QW9A 1XS9D 1TKXA 2P6RA 3V7JA 3NGIA 3AVJA 3FFIA 4LY7A 4FLZA 4PGQA 3TARA 1HJRA 2KN7A 1TVRA 3NBPA 4DOBA 5KT6A 5I42A 3V1RA 4CIGA 2XY8A 2HHUA 3H8SA 3PMLA 1TVAA 2BPFA 4CESA 1NOYA 1U45A 3SCXA 3KHGA 2B4JA 3VN5A 3B6OA 4KO0A 4CE9A 1BCOA 3TAPA 2R8JA 1JLAA 2ZQBA 4FBTA 4M3ZA 2BDPA 1MU2A 4CJQA 3RAQA 3K5NA 3ZSVA 3GFKB 3MEEA 2FBXA 2QKKA 4Q8FA 5J0UA 4O3OA 8ICRA 3WNEA 3QZ8A 4RW8A 3L8BA 2OZSA 1RXWA 1S1UA 4FJ7A 4DOAA 4DTNA 1FKPA 3AVLA 2ASJA 1JLCA 4CEQA 4FM0A 2G8KA 4P2HA 2GBZA 4FM1A 4ECYA 3RR8A 4M9NA 5HMMA 1TKTA 4F5RA 1KEJA 5KG4A 4KLOA 3JYTA 3GIMA 2PXIA 3F9KA 4IFYA 4IG0A 3TAGA 3HX0A 5L1IA 4IDKA 1HNVA 1KCFA 4RZRA 2PI4A 2E6MA 4UBBA 4E3SA 1VSMA 1VSDA 3O4NA 4JWMA 2NRVA 4Q0BA 3Q8SB 3L2WA 1JIHA 2DFFA 3SQ4A 5D49A 2KQ2A 4O5BA 3B0XA 1I3AA 3RTVA 2Y1IA 1ZBIA 9ICLA 4B9VA 3LAMA 3OGUA 3KKRA 4KN4A 2JLEA 3OYMA 4QWAA 8ICMA 2E6LA 8ICHA 2HW3A 3I0SA 3ULDA 4DTSA 4M41A 3FYHA 4Z6FA 2HHTA 4E7JA 3ZDCA 5IILA 3RJKA 2ZTDA 1D5AA 3OSPA 5D4BA 5KFXA 2PZSA 1JLFA 4GC7A 7ICOA 1NOMA 4KI4A 4M04A 3OYFA 3H4DA 3T3FA 4FJ5A 3DLHA 4YD1A 2VG6A 2HMIA 1ZQVA 4HUFA 3ZSRA 5DB9A 5IIIA 4QZFA 2YKNA 1RDAA 3OYLA 5CZ1A 1COOA 3DI6A 3NH1A 3M9NB 4ED1A 9ICHA 4PHEA 3KK3A 2NRTA 3AVBA 2IOCA 4YG2A 1XSPA 4EBDA 4N41A 3U3YA 4GXKA 3OYIA 3THVA 3HW8A 3RMAA 3SZ2A 1J5OA 4O9MA 3MBYA 2DTUA 1YTUA 1VSFA 4DTRA 1RTDA 1LW2A 3C94A 4OPJA 3K4GA 4DU4A 1RTHA 8ICJA 1K6YA 4O3NA 4L8RB 1ZQAA 3PVXA 2F1IA 1XC9A 3LK9A 5J2AA 3TI0A 4ECVA 4AHCA 5DKWA 1ZQJA 3UQ0A 4RNMA 4K8ZA 4YN4A 2V4QA 2BCSA 2FMPA 4MEYA 2FBTA 4BGDA 9ICKA 4DWIA 4C8OA 4ECZA 5CP2A 1S97A 1NK7A 5C25A 4KHQA 3QEIA 1U9LA 1QQCA 1JXBA 3RWUA 4K4GA 2FPMA 3DM2A 2YNFA 9ICEA 3HP6A 5KT7A 1CXUA 1C1BA 4RG8A 2ASLA 2OPRA 3VQPA 2V4RA 2D5RA 3QNNA 3H7IA 2AGQA 4XRHA 4M2YA 4NYFA 3LZJA 3H40A 2OPPA 5DG8A 3TABA 4DOCA 2PYJA 4EZ6A 2A1SA 1ZBHA 7ICTA 2JEJA 2IHNA 2JEIA 4PH5A 5DGBA 4DQIA 3NH2A 1KRPA 2GUIA 3MR3A 4DSEA 5DK5A 1DLOA 4I2EA 3L3VA 2GV9A 4M9GA 3HYFA 5KFVA 3OVNA 4CJ4A 3OYKA 8ICGA 1WSJA 3C1ZA 1ZQMA 2IAJA 5BOMA 4LD0A 1NJWA 4Q45A 1HQEA 1O1WA 1WAFA 5HP4A 5J2CA 3LDSA 2P5GA 2VWKA 1XSLA 4I2DA 1KDHA 1AROP 2B5JA 1RPLA 4XA5A 1FKOA 3ZSXA 4DSKA 4JS4A 3C2KA 1TV6A 3M8PA 1TAQA 9ICQA 4J9QA 3SV4A 4DSIA 8ICPA 3U3GA 4KLDA 4DS5A 4F50A 2FLLA 3SQ0A 3UXOA 5DB6A 1TAUA 2YV0X 4J2AA 1B43A 3WNGA 3NFAA 1XI1A 2W9BA 5T7BA 1DGSA 4FZZA 4CJPA 1T7PA 4JV2A 3TWHA 2BE2A 5CYQA 2BHNA 4RT3A 4KLUA 1ZQOA 1HUZA 5CHGA 3VA3A 2G8HA 4QZBA 4DFJA 1Z00A 4CJVA 2C28A 3GV7B 1TK5A 1YT3A 3LWMA 3VQ4A 4KHSA 2J6TA 4K4IA 3B6PA 3O3GA 4DLGA 5J2FA 4OKEA 4FZYA 3I0RA 1BI4A 2F1JA 1BPDA 3HO1A 9ICOA 1ZQLA 4J9OA 3RJGA 3KLGA 2MUTA 1C0UA 4Z6DA 2YNGA 4RW9A 1SL0A 4Z6EA 1RT6A 2JZBA 2HVHA 2XRIA 1MC8A 2KFZA 2C2DA 4R8UA 2IMWP 3T1AA 2XCAA 3V1OA 7ICLA 1BQMA 3NE6A 4F8RA 3MDAA 3OYHA 4FJNA 4F5NA 3OYNA 1FXXA 4O4GA 4CCHA 4HUGA 4YQWA 2W9BB 3G6XA 4QZHA 4DLEA 1S1VA 4KREA 3OYAA 4B9UA 3QIPA 3M9OB 3LP2A 4I2PA 2OA8A 5D3GA 3BQ2A 5DGAA 1RXVA 4Q43A 3VQCA 7ICSA 5KFLA 1ZBUA 4CGDA 3OSNA 4W5OA 5DB7A 1HYZA 4CHOA 4PWDA 1WSHA 3V1QA 4E0DA 2BGGA 4FJJA 3NH0A 1CXQA 2MUTB 2HHQA 3IG1A 3NDKA 4F4KA 3QLHA 2FLNA 4UB3A 2JZBB 4MF8A 2Z1JA 2BR0A 4DSJA 2NRXA 4TQSA 5J29A 3PW7A 9ICMA 4QZGA 3SUPA 2ATQA 4IRDA 3C5FA 4YVZA 1HPZA 3O3FA 4K4HA 3AO5A 4B9MA 3KLHA 2ZJ5A 4DL5A 1VRUA 3DLGA 2AU0A 3K5OA 2ZUBA 3C23A 1J9AA 4FW2A 4CJFA 4Z4HA 3LZIA 1IKXA 1RT5A 2EX3A 4ED7A 5KT3A 4F4ZA 4YMOA 4QZIA 4CJRA 1TFRA 3NF8A 2BKEA 1NKBA 4CEEA 1WCLA 4TUPA 5KRSA 2X6NA 3P83D 2R8IA 1HYSA 1RCHA 4CHYA 4KLSA 5FROA 3K58A 3VA0A 4FO6A 3K2PA 4CGIA 3T5KA 4RQ6A 1CLQA 1JXEA 4C8KA 3QO9A 4M9HA 4CGFA 1NK5A 7ICKA 1KLMA 4Z0UA 5J2PA 8ICYA 3ZT1A 3E01A 1BPBA 4F2RA 4KTQA 2Z1HA 3OY9A 4PHPA 5CYMA 3A2FA 1Q8IA 3KLEA 8ICZA 4DTMA 1VRTA 4UAYA 5CWRA 2UVWA 4G1QA 3ISDA 4GW6A 4M9JA 4OKKA 3D45A 3ZSZA 2OWOA 1JXLA 4O0JA 2YNHA 1ASWA 1NOZA 3C1YA 5BPCA 5KFNA 7ICVA 2ITGA 3N97B 4QZAA 3T5LA 1IG9A 4B8CA 4ZTJA 1SV5A 5JS2A 5DLFA 3RB6A 3AO1A 2ZTEA 4ZHRA 3HPGA 2NUBA 3E2EA 4OPKA 2WOMA 5KGXA 1TKZA 4ECTA 1KVCA 3BQTA 2GWSA 4TUQA 4MFBA 4O3RA 3VQ8A 2R8GA 4KLEA 2IGIA 3M8SA 3ZDAA 5I3UA 2RN2A 4ZTFA 3PX0A 3NF9A 4UB1A 4B3OA 1TK8A 1MQ3A 1YTAA 7ICHA 4OVLA 4J9MA 4CEFA 4FLVA 1CEZA 3N4MB 4CGGA 1SL2A 1JLQA 1S0MA 4CF1A 1XO1A 2W42A 3C95A 3V72A 3ZSOA 3ZT3A 4I27A 3AVGA 2ZD1A 3EW9A 3PO5A 4ID5A 9ICRA 3V7KA 5KFPA 3ASMA 1HRHA 5J2HA 5DG7A 5SZTA 1SUQA 1IM4A 4X5VA 2W8KA 4KITB 4FJ8A 4LH5A 2R8HA 1U47A 2ZTCA 1N48A 7ICMA 3TANA 3QEPA 4E7IA 4EYIB 2XY7A 4GXJA 3SPZA 3PX6A 4BDYA 2ATLA 1H38A 1BIUA 2YHBA 2AQ0A 2D0CA 4BWMA 3UQ2A 4M47A 1NJYA 3K57A 1HUOA 1ZQKA 8ICNA 4M42A 5J2BA 2FMSA 2VA2A 5KFWA 2RDJA 1JLBA 3KIOA 2KZ3A 5K14A 2PFNA 5J2GA 4XUSA 4CFCA 4MF2A 3O3HA 4I2IA 4F5QA 1ZYQA 3DRRA 1Y97A 1RTIA 4RQ7A 3GV5B 1KLNA 4E7KA 4F4WA 4ELUA 3KJVA 3PW0A 2BQRA 3NF6A 1S9EA 8ICVA 4CHNA 1LW0A 4MEXA 1K1QA 5KRTA 5DG9A 4O3SA 5J2JA 1UT5A 4B9TA 9ICPA 3QIOA 1KVAA 4J9SA 3QINA 3LANA 3SYZA 4OJRA 1IKWA 4I2FA 2ZUDA 1VSKA 3PR4A 5J2MA 4J9KA 4DTXA 3ZSWA 4QOZB 1VK0A 4DEZA 4CK3A 4RPXA 4IKFA 4RPZA 4JV0A 1N6QA 3ZDEA 1U4BA 4I2CA 4NYNA 8ICCA 3V81A 5CZ2A 5J1EA 2FPKA 3PW2A 4H8KA 3SUQA 5D46A 1L3TA 4KTWA 4YFKA 3AVMA 1X9SA 3NGDA 5KG0A 1RDDA 4DG1A 1UOCA 4PGYA 4CF2A 3AA3A 3HPHA 4J9LA 1VSHA 4BXOA 3LAKA 2ZJAA 5KFUA 3JPSA 2PY5A 2BQ3A 1RDCA 7ICNA 2Y1JA 4I9LA 4KLQA 1C7YA 1LB2B 4K8XA 1N56A 3AVIA 1C0TA 4UB5A 2O4GA 5DLGA 4RQ3A 5F9NA 4QWDA 4QWBA 4CECA 1R0AA 8ICIA 2HHWA 4M3YA 4Q8EA 4NCGA 3HSTB 4CFAA 3GILA 4OGEA 2D0AA 4M3RA 3OS2A 3HM9A 3ZDBA 5C24A 5J0OA 1PZNA 1HJPA 2XC9A 5KG5A 8ICLA 5J0SA 3RBDA 4IR9A 4N47A 9ICIA 1B9DA 4AH9A 2JGUA 5J0XA 2XGPA 3QESA 4B9NA 3CQ8A 4BE1A 3Q8QB 1RTJA 3NAEA 5IIJA 4JK1A 1RT1A 3CM5A 3GIIA 5KG1A 3Q8KA 4CIEA 4KRFA 4R66A 3G0ZA 5HMLA 4E89A 4I2AA 3PV8A 3RJFA 2W9CA 4H4OA 4BXOB 2X78A 1WLJA 4M3WA 4RQ2A 1GOBA 1KTQA 3NHGA 4IQTA 5DQGA 4DL3A 1T3NA 2BCVA 4B8AB 2F1HA 2F8SA 3NTUA 4QW8A 1T4GA 4EBEA 4Z4EA 3AU2A 3V6KA 9ICWA 5KFAA 2X6SA 2RPIA 1ZETA 3CM6A 4R5PA 5J0WA 3HP9A 4CFDA 4KB1A 4DQRA 9ICCA 5E41A 4DS4A 4OKJA 2VG7A 1ZBLA 3QEWA 3NGYA 7ICIA 8ICWA 3L2QA 4FLTA 1Z25A 3DMJA 4FVMA 2RKIA 3BQ0A 4H4MA 4RUAA 2Q0ZX 1KFSA 2YKMA 1L5UA 1UT8A 4IQWA 4FJXA 4GLXA 3MECA 3C5GA 3NCIA 4E1NA 1CZBA 2BCRA 2C2RA 5HP1A 2DY4A 2G8UA 4DTPA 4BACA 4I2GA 3AVAA 3KK2A 1Y88A 4ED6A 1JLGA 3KD5E 1B92A 4DQSA 3EYZA 1YVUA 4E7LA 4DFKA 4AILC 3EPGA 1RDBA 4DU1A 4B9SA 4DL4A 4CK1A 1WN7A 3AUOA 2ALZA 1Q9XA 4F5OA 2ASDA 1KFTA 2QKBA 5FDLA 4CEDA 3V7LA 1HYVA 1RBSA 1D8YA 4KLIA 2D0BA 4AHUA 4KMUA 1QTMA 3ZT4A 3MR2A 4FM2A 3C2LA 8ICAA 2HB5A 5KG7A 3OYEA 2QK9A 9ICJA 1TK0A 2ZJ8A 1ZQWA 2J6SA 3OYJA 2IBKA 2ZUCA 4LZGA 2XCPA 1UAXA 9ICTA 1HQUA 5HRRA 3RMDA 4OLAA 3T5JA 4JUZA 4CJEA 1IO2A 4LH4A 1RT4A 4IFVA 4CEOA 1UA1A 5KFOA 2I9GA 2PFQA 1ZQIA 4ZH4A 2BPGA 3QERA 2I5JA 9ICFA 2IA6A 4MFFA 4M3XA 4PA1A 1ZQZA 3SQ1A 4AHTA 4KAZA 3OS0A 3M9MB 4O5EA 1WSGA 3JSMA 4QCLA 4ED3A 1HNIA 5J0PA 3TAMA 3ALYA 3CYMA 4PUOA 5DDYA 1KFDA 3BQ1A 5DBCA 5DQIA 1JX4A 5CY4A 1N5YA 1Q9YA 4BE2A 3HL8A 1BVSA 1KSPA 5J0QA 2B6AA 3F73A 4M9LA 4O44A 5KI6A 4PHDA 4NLZA 3IM1A 4P4OA 4KHUA 4QZCA 1U48A 4DFMA 5HROA 5J0TA 5KG2A 1U49A 4JRPA 5L9XA 4C8LA 2E4LA 1DTQA 1IH7A 4DL7A 5J2NA 4CF0A 4Y1CA 3ZD8A 1DOQA 4KHNA 1C6VA 3IS9A 4NXZA 1Z00B 5JUMA 1NK9A 3HXMA 3DYAA 3V9XA 3ZT2A 4OLBA 3T19A 3AVCA 3V6DA 3ETLA 3AA4A 1ZBFA 3ISNC 4DO9A 4BDPA 4CJKA 1BI4B 1LAVA 4FW1A 3OS1A 1ZQTA 2BPCA 7ICUA 4MQ3A 4KLTA 3PNCA 5IIKA 3RJIA 3AVNA 3RH4A 2Q3SA 2DPJA 4RQ5A 4AHVA 4R8UB 1UWBA 4CGJA 4YMMA 4MFCA 3U6FA 1BGXT 3C21A 2YHAA 5DQHA 5KFYA 3QEAZ 5KFKA 4ELVA 2OYQA 4IRCA 4KLFA 4CJSA 2ZE2A 4ED8A 1NK8A 2P5OA 4F93B 1BPEA 3KTQA 4ECRA 3VQ9A 3RJJA 3ZT0A 1RZTA 1D8LA 4O5CA 3C6UA 1RT2A 1D9DA 3RH6A 3Q8PB 3HVRA 3CFOA 3T5HA 3DLKA 1QLNA 4DTUA 3RB3A 5L1LA 4UAZA 3ZSYA 5CR0A 3ZDDA 4NM1A 4ECWA 4JV1A 3L2VA 2A1JA 4G3IA 2XY5A 1BISA 1RILA 4GMJB 4CF8A 2LSNA 2DFLA 1EETA 4QAGA 3SUNA 3LP1A 5HRPA 1ZQSA 4ELTA 5HLFA 1RT7A 2G8IA 3MXIA 3SV3A 2BQUA 4DL2A 4YXMA 1I39A 5BOLA 4KV8A 4NLGA 1W9HA 1BPXA 4EZ9A 3VQEA 1ZQDA 3LALA 3UXPA 2AQ4A 3OJSA 4ID1A 1XHZA 1SL1A 3JPQA 4TQRA 5JS1A 2I1QA 3VQQA 1S1XA 2HNYA 2AGOA 4RQ8A 1S10A 3OJUA 4P4PA 1ZJMA 4AHRA 3SNNA 4HCCA 2NRWA 4LZDA 4DQQA 1L3SA 3LP0A 5FRMA 1EXQA 5KFDA 1ZQGA 3RRHA 4NM2A 8ICOA 2OZMA 4KKOA 2UVRA 1NK6A 4HTUA 3OYCA 2A1JB 7ICQA 2P6UA 4M3TA 7ICEA 2G8VA 2P1JA 3DLBA 5DB8A 5F9LA 3RH5A 1TKDA 3VQDA 2P66A 4O3PA 2IHMA 3MR5A 4KFBA 1BPZA 3H8JA 1XSNA 4KLGA 1EP4A 4UQGA 1JL1A 1JKHA 1ZQUA 9ICXA 1XHXA 4UBCA 1QSYA 3G10A 4DTOA 4PHAA 8ICEA 3Q8MA 3KKSA 3HPOA 3MEDA 4NLNA 1RNHA 3PMNA 3AVFA 2HNZA 2PYLA 3V6JA 4DFPA 2C2EA 2MAXA 5TZVA 3V4IA 4YNQA 4PY5A 1BCMA 1A5WA 4PGXA 4I2BA 3BDPA 2BCUA 1S0VA 4JS5A 4RPYA 3TQ1A 3HWTA 4M6WA 3S3NA 4CIFA 1B22A 3ISCA 1SKWA 1SKRA 9ICNA 5KFMA 4CEZA 3EY1A 4E7HA 1W0HA 2XGQA 1Z26A 3MFHA 4Z4GA 3GIKA 3PR5B 1F21A 1NK0A 2FBVA 5FRNA 3TAFA 3MXMA 4DQPA 3TAEA 1ZQPA 5KFIA 1C0MA 1T03A 4BDZA 5HHIA 1NJZA 3DOKA 1CZ9A 4RQ0A 4CK2A 1L3VA 4TURA 1WCNA 2PI5A 3ITHA 3QEBZ 5KGWA 1ZQCA 1ZQNA 4UAWA 1RBTA 1LWFA 1L3UA 4RNNA 3KLIA 2J6UA 4OGCA 2BGWA 4C8MA 5CB1A 3OYGA 7ICGA 2PFOA 4JLHA 4Q44A 7ICPA 2LYHA 4CHZA 8ICSA 3H08A 3SPYA 4IBNA 4M6WB 2KTQA 1JN3A 3G6YA 3G6VA 2KFNA 3RMCA 1X2IA 4KB0A 2ETJA 2M9NA 9ICVA 2FC0A 3V9WA 4J9NA 3MFIA 3PX4A 3JPTA 4I2HA 4CEAA 4KLJA 1QSLA 1MSWD 3PO4A 1Z3EB 3L3UA 1NK4A 7ICJA 2KZZA 4JWNA 3QETA 4W5NA 3RB4A 2DFHA 2BANA 3LPUA 3P5JA 4FK0A 3SJJA 5J2EA 3QE9Y 2KZMA 4CHQA 3UPQA 4IR1A 3SUOA 3IHQB 2UVUA 1RBUA 4NCAA 5KG3A 3K59A 3LDAA 5EWEA 5KT2A 2F8TA 1A5XA 4M3UA 1ZQHA 3HT3A 1T05A 4ECXA 5KT5A 4R63A 4RUCA 3L2UA 4FJLA 1TL3A 2DFEA 4CJLA 1B9FA 4KN7A 8ICFA 1QSSA 2W9MA 4QZ8A 1A5VA 4F4XA 1S76D 4GXIA 4C8NA 2W9AA 4FJ9A 3PUFA 4CHPA 3KHLA 2QXFA 4RW7A 4FLXA 8ICXA 4LVSA 3TFSA 9ICGA 1KVBA 4GC6A 2VANA 4UB4A 1S5JA 4KLMA 4YD2A 1S0NA 8ICKA 2YNIA 4IQUA 2H5XA 4IQVA 4DTJA 4M0AA 4QZEA 3V9UA 4IRKA 3JPNA 3ZSQA 4J2DA 5CJ7A 5KFEA 1ZQRA 3RRGA 4EEYA 3S3MA 4FS2A 2IS3A 1UA0A 1ZQFA 4ED2A 4CGHA 1LWCA 4F92B 4I29A 3AO2A 4XIUA 1TL1A 3PW4A 4IG3A 5KFCA 5KTQA 3LP3A 5KFHA 4KTZA 3MABA 3SQ2A 4ECSA 1WAJA 4I9QA 4MFAA 8ICQA 9ICAA 4FYDA 2X74A 4KLHA 3PY8A 4B08A 4Z4FA 3RJHA 3L2RA 1TGOA 3S3OA 3JPRA 3CFPA 4DL6A 3RBEA 4RT2A 4ECQA 2IDOA 3QNOA 3DRSA 3TFRA 1S0OA 4W5RA 3WNFA 5EOZA 3ORYA 3QZ7A 4FS1A 3D0PA 3OYDA 3UIQA 4YCXA 4DSLA 4QZ9A 3DRPA 4FK4A 3AO4A 2W9CB 4I2JA 8ICBA 1K1SA 4Z4CA 1J53A 4J9PA 5HRSA 3GQCA 5DMRA 1JL2A 3HVTA 1LWEA 4NY8A 3MGHA 4Q5VA 4RW6A 3EZ5A 2V9WA 3B0YA 1EKEA 3RJEA 1BL3A 3K75D 5KFQA 3AVKA 4KHYA 4BWJA 4FLUA 4N56A 1VSIA 2XO7A 4HUEA 2VG5A 3UXNA 1EX4A 4B9LA 4FJMA 5KFTA 4KPYA 1A77A 4I28A 2FPLA 2HHSA 1MQ2A 2OPQA 3ZD9A 3BGRA 1ZQBA 3RR7A 4EBCA 1HMVA 4O3QA 9ICUA 4HHTA 4RW4A 3LPTA 1QE1A 4J2BA 3VQ6A 2ISPA 2OPSA 3VQ7A 2F96A 4CJWA 4I2QA 4P4MA 1QHTA 2P51A 1JLEA 2BCQA 1VSJA 1GOCA 1NJXA 1JMSA 5KFJA 4J2EA 1S9FA 4YR2A 4Z4IA 4YP3A 4XQ8A 4QZDA 3SI8A 3AU6A 4Z6CA 4QWCA 4E19A 1REVA 3NGZA 4CJUA 3GIJA 3EPIA 1RYSA 2G8FA 5J2QA 1EXNA 4DSFA 3ISBA 4E1MA 5KT4A 4ED0A 4CEBA 4FK2A 4FBUA 1FK9A 5KFSA 3AA2A 3CFRA 4EP4A 2VA8A 3KK1A 3OHAA 5C42A 4O55A 4CJ5A 4YR3A 1NKEA 2NRZA 4PPXA 3M8RA 4FXDA 4N5SA 4JRQA 2HHXA 1IKVA 1G15A 1S77D 3Q8RB 1RYRA 3C2MA 1D9FA 4GVMA 3K5LA 4NCBA 3MAQA 3RMBA 1LAWA 3VQ5A 1C1CA 3H4BA 4FJIA 4NLKA 1ZJNA 1S9GA 3V9ZA 4AHSA 3S9HA 3MGIA 3KLFA 5J0YA 5EU7A 1RBRA 2PFPA 4F91B 4EYHB 4R65A 1S1WA 3MR6A 4HYKA 3AA5X 1X9WA 2WTFA 5KFRA 1WSEA 4EP5A 4F3OA 1RT3A 3AV9A 2RF2A 1T8EA 3M8QA 9ICSA 3OHBA 1C1AA 4DF4A 4YMNA 2HNDA 3K5MA 5L1KA 4RNOA 3HK2A 3CG7A 4W5QA 3HJFA 4ICLA 3P1GA 2VWJA 2DPIA 1ZQXA 4I7FA 1SZPA 3KHHA 5J2KA 1CUKA 3O4QA 1J54A 1X1PA 4CFBA 4KHWA 5C5JA 8ICTA 5EWGA 1WSIA 3JPOA 2JEGA 5IIMA 4O0IA 3H8WA 2O4IA 4YR0A 3BJYA 3MXJA 3VQBA 5KFGA 3RAXA 2R7YA 5KFZA 2XY6A 3TR8A 3VQAA 5KG6A 3V9SA 5EWFA 2AGPA 4WE1A 2C22A 1S6QA 5DDMA 3GDXA 3DOLA 1BQNA 1WNSA 1WSFA 4CJTA 1ZQEA 3MDCA 4W5TA 2KW4A 4Y1DA 4M45A 3RB0A 4KI6A 5CA7A 5HBMA 3KHRA 1IXRA 3IRXA 3Q8LA 2FMQA 3KD1E 4HCBA 3MEGA 5KFFA 4RU9A 4BE0A 3NF7A 1LV5A 1TV9A 3DLEA 5HHHA 5DBBA 1ZQQA 4DF8A 4N76A 4FJGA 4F4YA 1VSEA 5HRNA 4CJ3A 4LSLA 4CF9A 2G8WA 2IC3A 3ZCMA 4TSXA 8ICUA 1QS4A 2FBYA 5J2IA 4DU3A 3GV8B 3V6HA 4FCYA 3EWAA 1DTTA 4LSNA 4ECUA 9ICBA 4FJKA 1BPYA 3QEVA 2R8KA 3JPPA 1ASVA 5IINA 5KFBA 3DLRA 4TUSA 3AO3A 1XWLA 2W8LA 1RBVA 1ZQYA 3OYBA 3TAQA 1VSLA 2Z1GA 5HNKA 5L1JA 2UVVA 2WONA 3SI6A 4F2SA 2EHGA 2FLPA 5IIOA 4O5KA 7ICFA
chains in the Genus database with same CATH superfamily
2WMMA 1RQ0A 4F25A 5F8NA 5M2UA 1Z19A 2CNOB 4JI8F 1U2CA 1TU0B 1E6YB 2DRAA 4KLLA 5J8YC 1VC0A 1VDVA 4F7VA 4YXJA 4LREA 1OVYA 1X42A 3N79A 4JI6J 2AA4A 5AQIA 7ICRA 3WQTA 2MA1A 3UKUB 4JYAJ 3DLEB 2VUGA 2PKEA 4DR3K 3ZX0A 1NKCA 1U1MA 3OR1A 3F5TA 4PG6A 4K42A 4YHHF 1HBUA 4LSNB 2CJBA 4F3TA 4K4XA 1XU4A 1GLBG 4FJHA 1F0XA 1NAQA 1VJQA 3V7JA 2OTLN 3NGIA 2CQ1A 3BN4A 4BCAA 7FD1A 4WYLA 1NGGA 1VQ4S 2XY8A 3IKMA 3IMXA 3K7RA 2N1RA 5CA5A 3PMLA 2DJWA 1WEYA 2UUCF 2DKXA 1U45A 4DJBA 2AHOB 4KO0A 3TZXA 1JLAA 1QH9A 3GFYA 2KT2A 5AQJA 4RBTA 5AK6A 4UT4A 2PO4A 5AQSA 1OW5A 2FB0A 2A3VA 4U67L 5D6GA 2W04A 2PDAA 2IJRA 1VC6A 2YB4A 4EO6A 2HVDA 8ICRA 1NCLA 3OTEA 4X62J 4ZVQB 2E5LJ 1N54B 4DUZJ 2OIHA 3OR1B 4A5BA 3SLCA 4CEQA 2DY9A 1EJ7L 2BMBA 3RR8A 1O03A 2C2NA 3QU2A 5AQHA 4JP8A 3QT8A 1PKUA 4YDUA 1C0FA 2VASA 3FVYA 4IFYA 2QWMA 2VD3A 1OO0B 2R2RA 3TAGA 2W41A 4IDKA 1CBKA 2PE8A 2CJ9A 2ZXHA 1REGX 1UVJA 4KGVB 5AJ3F 2CDRB 1VSDA 4JWMA 2NRVA 4ZPTR 3Q8SB 3D0HE 3L2WA 2EQYA 1IBMK 1U1OA 2HFUA 3TU5A 3SQ4A 4KO0B 4B1WB 3B0XA 3IBCB 1I3AA 1SXLA 3D2FB 4DV2J 3IFEA 3VESA 3LAMA 3KKRA 1Q86O 1PK3A 3OYMA 4NLTA 3TEHB 1WHYA 1ZTTA 3DNCA 3H20A 4WZMA 3HKWA 2Y0BB 3FYHA 1NMNA 3CCLN 3KLIB 5IILA 5HR6A 3I31A 4AF1A 1JJ2M 5D4BA 5KFXA 2PZSA 2HGMA 4GC7A 1NOMA 3OYFA 1WHXA 1ZM3A 4FJ5A 3C7NA 4DR6F 1COKA 2XS2A 1KS2A 4AT1B 1ZQVA 2WAQC 2CPEA 3ZSRA 2A18A 5D15A 2CPZA 2HURA 1BWFO 1RHUB 3M2RB 1RDAA 1YZ7A 3V2UC 1I94K 5AHXA 4IDKB 3KK3A 2NRTA 4C4TA 1N5WA 1UW9A 4USTA 4N41A 4AE5A 1N62A 2DR5A 2YH1A 2HWHA 4PCQA 3VVUA 3SZ2A 5EE3A 4LQ3A 4O9MA 3O9SA 3VERA 1VSFA 5KAKA 1ATSA 1PIEA 1RJJA 5BN8A 8ICJA 1NPKA 4OQJA 1ZQAA 4BBYA 1IJJA 3GL1A 3F2DA 3TI0A 2UXDJ 4LRAA 2H3EB 3CW2C 4K8ZA 4YN4A 5MAOA 1LK7A 2E1FA 4WIIA 2F8HA 3NOGA 4ECZA 4GKKJ 4JD2B 1KOHA 1VBKA 4F04B 3QEIA 3FRZA 1FI4A 4GKJF 3C7NB 2NPFA 1JXBA 3RWUA 3D6MB 9ICEA 2GOLA 4NWIA 2OXOA 2ZFHA 3N5FA 1BA0A 3V5RA 5ITHA 5KT7A 2MEWA 4JI4F 1C1BA 3I76A 3JTNA 3W3DA 2D5RA 2AYGA 3H7IA 3PSFA 4XRHA 3FEXB 1SQEA 1HWJA 3LZJA 3KK3B 3D1QA 4EZ6A 2A1SA 1ZBHA 3W9JA 5AKEA 1SGGA 5ALYA 2V2QA 3K9JA 4YY3F 4DQIA 3VGUA 3BZQA 1YUWA 2GUIA 3NH2A 4BC5A 5DM6L 4OI2A 1VQKS 2GV9A 5KFVA 2NR0A 4QOTA 1XTZA 4ISFA 3OYKA 1WSJA 3C1ZA 1ZQMA 1LWCB 5BOMA 4LD0A 1NJWA 2HDOA 3QNWB 2P8IA 1HQEA 2QMXA 2QLXA 3LDSA 2P5GA 2DNRA 1LKYA 2DNPA 1UFKA 3CIZA 4CZCA 2A0FB 1ZBTA 1FKOA 3FZHA 1U2VA 3J80Y 4JS4A 3CDWA 3N0VA 2JOQA 2V0NA 3SQ0A 1WEXA 5C10A 3U4LA 1B43A 2B4VA 1SZHA 2CJQA 3NFAA 2QLTA 4OI3A 2ZVSA 5CE3A 1U2FA 4FZZA 2ASYA 1YITN 1VQ8S 2AXTU 4JV2A 1C1BB 5CYQA 3MMAB 2XMUA 2BHNA 4RT3A 2RU3A 4BRDA 3G9CA 3I4HX 2M9KA 5AKLA 4Y2MA 5E26A 3HVTB 2XS5A 5G0RB 4GMKA 1P90A 3O3GA 4DLGA 4OKEA 4JB3A 2QYGA 1C0UA 3RRKA 2WB1F 1N0VC 4Z6DA 2YNGA 3R6LB 3MAHA 4A8OA 3OPXA 2HSTA 2VQFJ 2P9PB 1LKYB 2VU5A 2D3OR 4MYTA 2CH6A 2C2DA 3FBEA 4DV4J 1TAMA 3A1YG 4TNOA 2YX1A 3SSRA 3FFKB 3T1AA 4YB6A 1U2VB 3V1OA 5AKZA 4F8RA 3MDAA 4QR1A 2V34A 4FJNA 2LQJA 1FXXA 3ED5A 2J4RA 4CCHA 4X65K 2CPFA 1H6KX 4I2QB 3CDAA 4DLEA 1S1VA 3GG1A 5B0BA 2G0JA 3QIPA 5H9FK 4UATA 2HBQB 4YB1P 5DGAA 3IBPA 2CKWA 3FAHA 2P9KA 4YEAA 1R8CA 1Q8LA 4CGDA 3OSNA 1GNKA 4NLCA 3UQSA 3SMVA 3A12A 2E1CA 1HYZA 1MN8A 1N0UA 3JSBA 4E0DA 2KLAA 5ETTA 1N32F 4JI2K 3BB5A 1X4FA 5DDOC 4FXWA 5HMXA 5D4LA 2IY5B 2HHQA 3IG1A 4XH1A 3OT9A 1T02A 3UNGC 2DRBA 4DSJA 3TA0A 3PYFA 2NRXA 3SUPA 9ICMA 3D0GE 3LTOA 3C5FA 4U8YA 1UW4A 3AOCA 4GRSA 1AUDA 4YVZA 1B70B 4U95A 2ZJ5A 5DO2A 3HBTA 2RHFA 3C23A 3PRVA 2EC0A 1J9AA 4J37A 2HS4A 3SFGA 1RT5A 1HPMA 2R3VA 1GO3F 4FYVB 1NGAA 5KT3A 4A8QA 3R5CA 2NXNA 2FJ6A 4YMOA 4CJRA 4J8FA 3RW7A 1TFRA 1NKBA 2EFNA 4CI6A 4UF4A 1S1VB 4TUPA 3MMCA 2MQLA 2R7WA 4I68A 1X4BA 2K60A 4CHYA 2MQMA 3K58A 5FROA 4Y2XA 4DPWA 2ZIXA 2P9KB 5F1XA 3SMZA 4CGIA 4UY85 3QO9A 4M9HA 1NK5A 7ICKA 4Z0UA 3ZT1A 2F8LA 3NS6A 2M3DA 4KTQA 4PZNA 4AM6A 2AV5A 3O3LA 4RBVA 8ICZA 4LF9K 3AQPA 5CWRA 2UVWA 2C42A 2B4PA 2HEKA 1FNOA 2ILYA 3WEEA 4ER8A 4M9JA 4GW6A 2M52A 3D45A 3ZSZA 2YNHA 1XERA 2KYXA 2KP7A 1BLUA 1FJGJ 2HI0A 3MUMP 4B3TF 1IG9A 3R5DA 5JS2A 5DLFA 2MKSA 4ZHRA 2WW4A 3E2EA 1RT5B 1IBKK 1TKZA 4ES3A 1KVCA 4QU7A 3NGKA 1RBLA 2R8GA 2J5AA 2LCWA 3Q83A 3M8SA 3ZDAA 3BP8A 2RN2A 1M1KT 4ZTFA 4IH5A 3MMCB 3CJQA 3NF9A 5GMKa 4EHTA 1TK8A 4AL5A 2VODA 2ZH8A 1ZRMA 3L9ZA 4DX6A 2MSNA 1BU6O 4CEFA 1N61A 4FLVA 4HL9A 5DS7A 4CGGA 3SCKE 1JLQA 3ZSOA 3DLLL 3JS9A 2LMRA 1B7YB 2QA4G 5AM5A 3PO5A 1Y3KA 1ZM9A 4WFBQ 4ID5A 3IG8A 2JJ4D 1SUQA 4DV5F 4LF1A 2BUNA 3MTJA 4C7QA 4KITB 2EAPA 5M1OA 4CO4A 4LF6K 1N48A 3WEEB 2L9DA 4ZPDA 1S79A 2YNHB 4GXJA 4EK2A 2RQMA 2LA4A 4J7CA 2ATLA 1ZAVA 1BIUA 2XYPB 3UWTA 2AQ0A 4LBPA 4MTPA 3QJJA 4ZHRB 1FESA 1SV4A 2O8DA 5L46A 1NJYA 2AEMA 3H90A 1TKZB 2M88A 1QAXA 1HUOA 3TPQA 2WBRA 1ZQKA 2VF3A 1WYGA 1PK1A 1EKSA 3W9HA 1ZAWA 1FEHA 5KFWA 5IQ6A 2AIRB 5C0YA 2W2QP 5K14A 2V4JA 5J2GA 2DRDA 2Z2LA 1G4CA 3BF3A 1HNXK 2VJ4A 2MZ1A 1RTIA 2XTJP 1JLQB 3QRQA 3GV5B 1KLNA 4F4WA 4ELUA 2QLBB 2G2YA 4JI3J 5KAFU 2OEJA 4LT6A 2DCLA 2LKYA 2IDEA 2L3MA 4KT0C 4CHNA 4A57A 2UUAJ 1EX8A 2A3ZA 5J2JA 1SUQB 1CJKB 3JQJA 4NASA 4PR6A 4X64F 1KVAA 4J9SA 2O66A 4OJRA 3QGHA 2G2OA 2F4VF 2ZUDA 2CQIA 2EWHA 4J9KA 1XMQF 2GIFA 3ZSWA 4RPXA 4IZ9A 4JV0A 2O8DB 2Q0RA 1U4BA 1IBKJ 2QEXS 4JI7K 1HI1A 2J0SD 1S3XA 4CQ1A 3CCEN 3QGPA 3K8WA 1PK1B 2RJZA 5JVGQ 1FJCA 4UW9A 2R7XA 2MGZA 1L3TA 4KTWA 4YFKA 5K14B 2ZM6K 2V4JB 3NMAA 4LFAK 3NGDA 3LW5C 4AD6A 4IKAA 2ASMA 4JV5F 1WSVA 3UB5A 2RE2A 4DV1K 2O1PA 4AFFA 4BXOA 1KQGB 3LAKA 2ZJAA 4BRMA 4KR0B 2PY5A 2NXEA 2ZUGA 1RDCA 3CC2S 4KLQA 4DR2F 1N36K 3AVIA 1C0TA 4RW8B 5DDQC 2LMIA 2UUBJ 4RQNA 4IS7A 5DLGA 4CECA 2RQ4A 4CLKA 5EN1A 3FNNA 4EI2A 1IQZA 4NCGA 3MN7A 3GZ7A 3OS2A 2D0AA 1Q81O 5C24A 5J0OA 1PZNA 3VQSA 2YI1A 3CMEN 2XC9A 1E4GT 5KG5A 1U0SA 3J80O 5AM3A 1T3QA 5B0FA 9ICIA 1A0PA 4KIAA 3EM1A 3GJRB 1AFIA 3A8EA 5CEHA 3EZUA 3QESA 2HHHK 4WU3A 5CR4A 2HYIB 2D6FC 1RT1A 3QSYB 2MGZB 2ERRA 1TUGB 1HKBA 4KRFA 2FLOA 4E89A 3O8WA 2G0IA 4I2AA 3PV8A 3CJ2A 3C3LA 5D4OA 4H4OA 4PL8A 4BXOB 3C65A 2BVZA 4M3WA 3I33A 3W9IA 4ZK7M 1D1UA 3MCPA 3HZGA 4D3GA 1KTQA 4IQTA 5DQGA 2ZGZA 1T3NA 3DU6A 1C0TB 4B8AB 3IRUA 2F1HA 3HHEA 1FFUA 2G07A 2J8SA 3AU2A 3V6KA 2KHOA 1TR0A 2IRXA 3TYTA 1DFDA 2X6SA 3J8AA 4NA2A 3CD0A 1ZETA 2AX0A 1J2MA 4R5PA 4CFDA 4KB1A 9ICCA 3ZNJ1 5E41A 4CT8A 1RAEB 5C24B 3ATUA 8ICWA 1VI7A 3L2QA 2W7AA 2Y9HA 1Z25A 1C2PA 2YKMA 1L5UA 1UT8A 3O44A 4GLXA 2K4HA 4OLOA 3RJMB 1CZBA 1BOTO 5HP1A 3PIPQ 2G8UA 4DTPA 1J5EJ 5BJRA 3H2UB 2D9PA 2GHPA 3CC7N 4DOZA 4CO3A 2UZAA 4BC7A 2I1RA 4BRNA 1VJWA 4H4OB 1JALA 1BQXA 1B92A 2V51B 5FPMA 5LMNJ 4DFKA 4AILC 4DR4F 1RTHB 1RDBA 3CCZA 4CK1A 1WN7A 4DR5K 1TL5A 4P2SA 1XK8A 2WF9A 1KFTA 2NYVA 1Z4OA 3LF0A 3JQMA 2O8FA 3CCUS 1N2XA 2H3IA 4JK9A 2LP4A 4R5PB 2E44A 2DNNA 3VGLA 2HB5A 3GE1A 3NP5A 5AM0A 1IBLJ 4USHA 1H2TZ 4A48A 5AQYA 2XM3A 3UMBA 4HI2A 2FSKA 3OYJA 2ZUCA 2KU7A 2K4PA 4LZGA 4Y2TA 5GIPA 1UAXA 2YKMB 1R6YA 1WD6A 3T5JA 4MMOA 4CJEA 4LF8J 1UA1A 3JAMY 5KFOA 5HP1B 1W26A 1ZQIA 4ZH4A 1YKWA 1Q78A 1S6UA 1XUPO 1OMSA 4MFFA 1Z4UA 4PA1A 1IR1A 4JBCA 4WF9Q 3ZNUA 5ETKA 3ZZOA 2F9DA 4FWSA 4QCLA 4ED3A 1HNIA 3ONNA 5J0PA 2EZYA 3H6EA 3MGJA 5HQLA 1KFDA 4CNYA 2OMLA 5DQIA 4U7CA 2M8HA 3KVGA 3A8IA 4Y6IA 3P6YC 2O8FB 1A0OB 4M9LA 1TFYA 2OSRA 2H4WB 2KFYA 4KHUA 2KXFA 5GAEU 5IS2A 2ZH9A 4KRWA 4DL7A 4KH5A 2RHKA 3OR2A 3ZT2A 4OLBA 3IWXA 4DKWA 2GAHC 3TEGA 4ES1A 3I4PA 4DR7K 2BPCA 5IIKA 3RJIA 4ANEA 4BRAA 1WDTA 4OYXA 3G71S 3GMGA 1GXLA 3AQFA 3G2XA 2DCUB 2K3KA 1ZOLA 3BSCA 1YX2A 4AHVA 3WQUA 2JRZA 1NGBA 2WVEA 5KFYA 3QEAZ 3A5MC 2YX6A 4K0KJ 3D54A 2YJEA 1R43A 2K4EA 4CJSA 2Q43A 2WFAA 2BUPA 1VQYA 5HL7L 1NK8A 2ZJRL 2EBGA 3KTQA 4ECRA 5BR8J 3VQ9A 3RJJA 3LGNA 1MDUB 2N3OA 4ZCKA 2QX0A 1D8LA 2DF4B 4O5CA 4P7TA 3LP2B 2H5EA 4I2PB 4DV0J 3DDKA 1UCNA 4DTUA 3RB3A 5E79U 2VCPA 4YOTA 3OR2B 4PG5A 2A1JA 1R8PA 1QHAA 3NG8A 3PJ9A 4GMJB 4N77A 4CF8A 2LSNA 2DFLA 4PWDB 3L0QA 2X3DA 4NLWA 2ADCA 4OYMA 5HLFA 2QXLA 3RVCA 1UVIA 2G8IA 4DL2A 4TU7A 4YXMA 1RXOB 2VB6A 3OBYA 3WZ0A 3N6MA 5EE1A 2AQ4A 3OJSA 1HBMA 4ID1A 1T11A 3D2NA 2LQ5A 3QNMA 5EUHA 4KGMA 4P0QA 2DH9A 2AGOA 4RQ8A 2LLZA 1S10A 3WKBA 4DQQA 4C80A 1IQTA 3LP0A 1KQSM 4N8OA 1EXQA 4CZGA 4F4AA 1KP6A 2E7XA 4DUYK 4H4KA 4PAAA 3ENBA 4Y2CA 4KKOA 3FZLA 2UVRA 2RDDA 3OXFA 1NK6A 4HTUA 1KHWA 3OV7A 2CJYB 4U7BA 1FNXH 5AZIA 5AE3A 2A1JB 2G8VA 2P1JA 1OUQA 2RHQB 5F9LA 3VQDA 3BH6B 1ZZFA 4JB8B 3IV6A 3KMSA 4KFBA 1BPZA 4KLGA 1X3NA 1RAFB 2OP5A 4WYWA 2ZH4A 4HHHA 1QSYA 4QIEA 4CTAA 3WKAA 4DTOA 5CABA 4B3MK 4PHAA 3Q8MA 2KIVA 2E7VA 3HPOA 1OXJA 3U7JA 2HNZA 1YIJN 2PYLA 3V6JA 3VTIA 3V4IA 1FDBA 2NUHA 1RHQB 4PY5A 4U67Q 3OBWA 1L8LA 3R8YA 4CD3A 1X4HA 5JMVA 4P0QB 1SH2A 4ZVGA 1S0VA 2JVOA 2B56A 2MKJA 4CM0A 5GAGI 2PFUA 4ACOA 3D2EA 4FSVA 3UFCX 2KJ9A 2VJ5A 4M63A 3PKMA 4B3OB 5KFMA 2IYIA 5K9FA 1W0HA 1A7GE 1PYOB 3EXYA 4KKOB 2M4MA 5ETLA 3MFHA 5FPDA 4FF1A 3VGKA 3PRBA 2XULA 1F21A 2KB2A 4I67A 3AY9A 5AZIB 2DO0A 1UPPA 1N88A 1VQLS 3R3TA 3TAEA 5KFIA 3NAIA 5K8MA 2BV3A 4LBIA 1NJZA 3OBIA 4BR4A 3TJAA 4J91A 3OTBA 3DOKA 4KFBB 3G4SN 2EDUA 3Q86A 5IT9Y 4O8UA 1FDDA 2B8PA 2JL9A 3AJDA 2FJEB 1WKKA 4CTAB 3TQEA 1VQON 1B4SA 3FKBA 2HNZB 3V4IB 3A8YA 1L3UA 5KL1B 3CERA 2BGWA 4EMDA 1N5TA 3KMQA 2GCFA 3MPUB 2RVJA 3MN6A 5AIBA 4Q44A 7ICPA 2GH1A 4CHZA 2E2QA 5F0XA 4OYIA 1JN3A 5FP0A 2KHQA 3VMFB 1SC4B 3RMCA 1X2IA 2OGUA 2ETJA 1AW0A 4J9NA 2FGCA 1FJEB 1EO1A 1XO0A 4O23A 3WK5A 4CEAA 1DGKN 1MSWD 2BA9A 2EFGA 3QETA 4M1KA 4LF4K 1QD1A 3KUHA 3SJJA 2I0XA 2QSWA 2KZMA 1VQPN 4IR1A 3AODA 2UVUA 3GOIA 3QU7A 2DKOB 3GBTA 5KT2A 1A5XA 3CETA 1ZQHA 3HT3A 2CXEA 3M4XA 4ZPAA 1T05A 4M3UA 3RW6A 2HF3A 4ECXA 3AJ1A 2K8AA 4R63A 1WUDA 5J2MB 1TL3A 4E8UA 2DFEA 4CJLA 5A2QY 4Y00A 4CZIA 4JNEA 2V50A 5GIOA 1QSSA 1A5VA 3CDBA 2V52B 3IGVA 4Y2JA 2EK6A 3VALA 4YN3B 1IG6A 2V8PA 4LVSA 2MKIA 1EHWA 2W4PA 3VF4A 3TFSA 1TELA 2LU2A 2FY8A 1KVBA 3THWA 1S4FA 2DL0A 4UB4A 3RUBL 2VFSA 2M0GB 1X4GA 1S0NA 4BR2A 4WPAA 3KUEA 1T95A 2H5XA 6FDRA 4QQBA 2MYFA 3EZWA 3JAMO 4QZEA 2OJ3A 3FE1A 4M94A 3V9UA 4OJGA 4OZ0A 3VEVA 3FMWA 5CJ7A 4DFDA 1SJRA 3KFWX 5B8HA 3VAMA 2B51A 4ZLJA 2O5DA 3LYSA 4FS2A 4CGHA 4Y2UA 4F92B 4YUDA 5DM6Q 4XIUA 1TL1A 4JOUA 3M05A 1UFLA 3LP3A 4CF5A 4KTZA 2HSZA 3MABA 3SQ2A 4I9QA 3GB0A 2X74A 3U02A 5GADP 2OFHX 4ILGB 1XNSA 2G0AA 2J0QD 4BRIA 1SQKA 1FCAA 1SAZA 3TFRA 2Y0SC 3BGLA 3THWB 2Z30B 3UIQA 3D2SA 3SD7A 5AE2A 1XMBA 1WEZA 4G65A 8ICBA 3GPAA 3ONQA 3WC2A 2LKZA 3OTQA 1GX5A 3ZZUA 2K06A 4NY8A 4FZVA 3E9PA 1RCXB 3MGHA 4W4MA 1QQ6A 2Q0UA 3TR5A 2XEXA 4UOCA 4ATNA 4YDUC 1FXRA 1FWPA 2V9WA 1EKEA 3RJEA 3UDVA 3K75D 5AM1A 1UEKA 2GWKA 3S8SA 3HILA 1TL1B 2VG5A 2HOFA 3UXNA 1YZ6A 5KFTA 4WFAQ 1A77A 4I28A 2V7YA 4OX6A 2OPQA 4F26A 1C4CA 4B3RF 1ZQBA 4DV3F 2OANA 3MXHP 4H5TA 2VJVA 4O3QA 4DB3A 3DMJB 3KOOA 4J2BA 1PYSB 2ISPA 1V3SA 1MN7A 1GX6A 3VQ7A 1NLKL 2F96A 3BM7A 2DD8S 3CT9A 1T6DA 3NVZA 2BCQA 1VSJA 1KONA 4PPDA 4DR6J 3IDHA 2KG5A 4PL2A 2DGOA 4MH8A 4MK8A 1QVFM 3WKEA 5KFJA 3HKZC 4CZLA 2Q66A 2CGLA 2FF3B 1UP1A 4J9UE 2A5XA 2A6OA 3NGZA 4CJUA 1HNZF 2L41A 4M95A 1LK5A 2A6AA 3EPIA 3QAUA 1SB3C 3EX7B 4ZVPB 5J2QA 3Q8YA 4CBWA 1YJVA 5IQQA 4JKAA 4H0TB 3QMLA 3AA2A 4EP4A 3LGMA 4C3LA 1Q79A 3SSSA 4K25A 4O55A 2ZHAA 4YR3A 2ZIWA 4PPXA 3BREA 1XMOF 3JTOA 1GT8A 2OPQB 4FXDA 4N5SA 3C15A 4JRQA 3T1HK 1IKVA 1S77D 2ZBQA 1RYRA 2IVYA 1N33J 2R2SA 4LF5J 5CXTA 1D9FA 2Z58B 3K5LA 4RBUA 2RQ5A 3VQ5A 2UU9F 1ZJNA 1FF2A 3MGIA 5F2RA 5D0HA 1TUYA 2DHHA 2ZBCA 3DU5A 4K7QA 3VGTA 5HANA 1V9OA 2WVFA 2PFPA 4EYHB 2ASOA 2V67A 4HYKA 3JTPA 8AT1B 3HVAA 4JI6F 3RYLA 4EEKA 4EP5A 2HRTA 4F3OA 5AICA 4JYAF 1RT3A 3C66A 1KDNA 3PFEA 2HS3A 3M8QA 7AT1B 1QCKA 3OHBA 1N5YB 4DF4A 3K5MA 1NZ8A 4RNOA 3HJFA 1I6JA 2DGTA 2DPIA 3QRRA 3O4WA 3TZWA 4I7FA 1WB9A 1U24A 1DK2A 2ZIWB 3O4QA 3KNAA 2AYMA 3B54A 3C15B 2G06A 1IKVB 3JPOA 2CPJA 4O0IA 2EW9A 2ES6A 2RU9A 1KBRA 2FJDB 4XPEA 4YR0A 4A2AA 4QIFA 4MKYA 3BGFA 1LKZA 3J7YP 4ISGA 3TR8A 3VQAA 2PFDA 4NL9A 2FYXA 2QSFA 1GLLO 1UVMA 4RL1A 1RAGB 1R59O 3FUYA 3ENWA 4WE1A 1S6QA 3I55S 1KN6A 4OYAA 5AKHA 4NXNK 1WNSA 3LA0A 1RAAB 2GVZA 1O08A 4W5TA 2GX8A 4M45A 1SPBP 3IRXA 5AT1B 5LMUJ 5E3AA 4IO9L 2QMUB 3VAHA 3KD1E 2SXLA 1FO4A 1RT3B 2QJ3A 1WTBA 1J27A 3A0IX 3MEGA 3NRWA 2WF8A 2COLA 2I5HA 2NYHA 2DNLA 3M8QB 4X62F 2L9WA 3H5YA 1KN5A 4DUZF 5GMDA 5IT9O 4QNLA 2F44A 5B0AA 4FJGA 3ILJA 1NO8A 4Q2MA 1DAXA 3QGGA 4I7FB 4DR1K 5CRXA 1X6IA 1NHKL 2IC3A 2P9LA 1V38A 3C46A 4JI1J 3GV8B 4JI0J 4FCYA 3EWAA 5AKYA 3N01A 5BRFA 1BPYA 3QEVA 3JPPA 3PHTA 3J7AN 3DLRA 1ED1A 1QAJA 3HZ6A 1XWLA 2Z8QA 2V7ZA 3CJ5A 3LOUA 3ENOA 2XMVA 2WONA 3KXDA 4WE1B 1S6QB 3WK8A 2W6KA 2HG4A 4BRFA 2GVZB 1X9MA 4DV2F 4YFUA 5AFUH 5H9EK 1RT7B 4B1XB 4FZXC 3IRXB 3KWGA 4IC9A 3M6XA 2DVIA 4USWA 3M8YA 3KYLA 3NS7B 1S1TA 4TVAB 1O51A 1P6TA 3ADAC 2CPRA 3I8DA 1ITGA 3PHEA 1ASUA 2X51A 1SKSA 3NS1A 4A8SA 5D4PA 3QPIA 3BPSP 4OJPA 2M7SA 3FDSA 4CO2A 2KDOA 2B21A 2QWLA 1SJ1A 5JTIA 3W1YC 3QEXA 2FDNA 1ZXIA 3TRGA 4PXDA 1SWWA 2IC3B 2P9LB 4KH6A 4JKCA 1V9PA 1K5OA 5AKXA 5A2QO 1W97L 3THYB 3MM7A 2PMHA 3C6TA 2EXUA 4QW9A 3IAM9 1K9MT 2YWEA 2DGUA 2AJ4A 3WK6A 3FFIA 3AVJA 4FLZA 4AYBC 1WI8A 4NYOA 4DOBA 3DAWA 1UZDA 3V1RA 3M32B 1VK8A 3H8SA 2XMAA 4A59A 1TVAA 2BPFA 2W03A 4URSA 3SCXA 2B4JA 3RZAA 4CE9A 1BCOA 2R8JA 3OLAA 2ZQBA 2E8NA 3DXBA 2YKPA 4CJQA 4KHPJ 4CLZA 4NWBA 3JXOA 1WACA 1YGYA 2QKKA 1S1TB 1F5SA 4FZMA 5HI7A 4OX7A 4KH4A 4O3OA 2WAQF 2OEKA 2UXDF 2ZOFA 3WXKA 1SJ3P 2EAOA 4ZOSA 5E84A 3WNEA 3QZ8A 2WZ1A 1D0EA 5AXKA 5M2PA 1B4FA 2HMPA 1B64A 4RKUC 3QXGA 3T1YJ 3PSIA 4KX5A 2Z2MA 4DTNA 3B78A 1Y4ZB 1O6XA 5CYJA 2RILA 3IG5A 2LQBA 4P2HA 2V2KA 2GBZA 4WU2A 4FM1A 4ECYA 4M9NA 5HMMA 4H0PA 4CZFA 3MM7B 2BE9B 1TYQA 4F5RA 4JHDA 5BYQA 2KKPA 1VQ9S 3F9KA 3OXLA 4E98A 3ZX2A 4IG0A 1DXSA 2IM2A 3HX0A 1F3FA 1M90O 4MKBA 1HNVA 3J7ZO 2HGNA 2H5JB 2PI4A 2E6MA 4UBBA 5K5MA 3MM9A 1JIHA 2WBNA 3NMUA 2F63A 2KQ2A 3RTVA 2Y1IA 5IWAJ 3POTB 5CAAA 2G5IB 1IV0A 2EFOA 8ICMA 1X7VA 3P31A 2HW3A 3I0SA 1T44A 2EH9A 2OTJS 2HHTA 1G3OA 4BJQA 3ZDCA 3H5SA 2XMKA 3RJKA 2HFVA 2ZTDA 3OTDA 2MKCA 1D5AA 1JLFA 1F60B 2I8EA 3NVMA 2P9IA 5ALOA 2WW8A 4CDIA 3L7PA 4GV3A 3HHKA 1JXVA 2N7CA 3T3FA 3GZFA 2VG6A 2HMIA 2FZCB 4A5AA 1TYQB 1W2BM 4JHDB 5IIIA 4QZFA 3Q7CA 2YKNA 1CPZA 5DZ7A 5HQ8A 3OYLA 3CDEA 1KC8T 3CQXA 3NH1A 3M9NB 4PHEA 3L4IA 5GTIU 1HNVB 1HKGA 1VQNS 3IP0A 2ZJQQ 3UNYA 1QQ7A 1H2UX 1K44A 3MM9B 5LJVA 3THVA 5T7LA 1X0FA 1VBYA 1HL6A 4ZP7A 2YB1A 1ZA1B 2DTUA 4P75A 4DTRA 3HOSA 3P45B 4NEZA 1XNRJ 3I0SB 4ZVTB 2RNEA 4DV4F 4MLHA 3MM6B 2AKWB 2WFBA 4RNHA 3SIPB 1KD1O 5J2AA 4QS8A 5DKWA 3TUJC 4RNMA 1GH8A 2V4QA 1JLFB 2ODGA 1NK7A 4RWXA 3PM9A 5HQMA 4ZP9A 1QQCA 1CLFA 3MUTP 2HMIB 4CNQA 3MPDA 4LRDA 2YNFA 2O8CA 3HP6A 4U7UK 1WC6A 1Y10A 1CXUA 1HW8A 2YKNB 2ASLA 2V8GA 3QNNA 2CQ0A 2GGPA 3O9UA 4KGKA 3GG4A 3H40A 2OPPA 2PYJA 2Z2ZA 4HI1A 5D78A 4PH5A 2V69A 3H46O 2EEYA 2XYHB 2UUWA 3ICLA 5DK5A 2DNOA 1DLOA 3L3VA 3HYFA 4JKBA 4CJ4A 2RQKA 1YF5L 2VOPA 3CCJN 2IAJA 1OQ3A 3THPA 4AQYK 2NUUG 3R3LA 3H3NO 1WAFA 4DV6K 2WVCA 3QATA 2GELA 3PSPA 4B3SK 2B5JA 2P6TA 4DUTA 1CZAN 1RPLA 1Q5YA 1NM1A 1PBAA 2VFVA 4BR0A 2ZOGA 1TV6A 3M8PA 5FLXU 1TAQA 4J9QA 4DSIA 8ICPA 4F50A 3UXOA 1JNRB 1VHXA 2PAVA 4J2AA 3BO3A 2P9NA 4ILMA 3UD3P 2WTUA 1JCGA 5T7BA 4FE3A 4EIAA 1IR0A 4WZQA 1D4XA 4C6AA 2OUGA 2GWJA 2GGPB 4V19X 1HUZA 3VA3A 2JVRA 2OPPB 4F9OA 4CJVA 2ZZMA 4FFDA 2C28A 3C16A 2KN4A 2EG1A 3O5BA 2Y9UA 3VQ4A 5AQFA 2JNJA 5KPRA 5F0WA 1DLOB 1BI4A 1BPDA 3WT0A 3QWPA 2IAJB 4DV7K 1NDKA 3RJGA 3KLGA 2MUTA 1S4EA 1M5HA 4RW9A 1SL0A 2Q31A 4Z6EA 3CI5A 1T94A 1RT6A 3VOVA 3HRDD 2JZBA 2HVHA 4FYXB 2DO4A 3NWRA 2J9EA 2B5JB 2XNQA 1XBWA 2NS1B 4R8UA 1NDCA 1L7PA 3VF6A 2IMWP 2XCAA 2B9YA 1TV6B 4RW4B 3L09A 3CXCM 1UCVA 3OYHA 4ID8A 4F5NA 3OYNA 1WHVA 1ZOTA 4ENOA 2QA1A 4YQWA 2EG2A 3NOCA 4P73A 2P9NB 5HL7Q 5AFUA 2ZJRQ 3G6XA 1VQ4N 1Q16B 5IT0A 1X4EA 3OYAA 2CGKA 2E1ZA 4B9UA 2Q2RA 2OA8A 1RBAA 1HI0P 4NLSA 1FRLA 4UW2A 4UUXA 3FSXA 3H0MB 7ICSA 5F8IA 3NEKA 1ZBUA 1REVB 4ZJQA 1SIJA 1S6OA 3D7EO 3SAFA 5ALGA 3C16B 1OKJA 2GZOA 2DGZA 4A8FA 5CZXA 5KOWA 3WX4A 3G6ES 1F0MA 1HNWK 5AK3A 5ALWA 2LQ9A 1HWUA 2MUTB 2O8EA 4C11A 3M6GA 4BG9A 1DGJA 4RW9B 4RU2A 2IM1A 1RT6B 3QLHA 4XDCA 4UB3A 4HT5A 1GEHA 2JZBB 2BRLA 4MF8A 4KH1B 2BR0A 2Z1JA 4JI5K 1T9YA 2C3UA 2VH7A 4ES2A 2QL7B 4TQSA 5J29A 2ATQA 2HQFA 4TU8A 1NU0A 4DL5A 2CRLA 1VRUA 2OD4A 1P9QC 1DK3A 1WC3A 1IKXA 2G08A 4K4WA 3LZIA 2EX3A 2BJEA 3NF8A 2BKEA 3KG0A 5F8HA 2X6NA 3P83D 2R8IA 1HYSA 2APOA 2E1MC 2YY3A 4TXSA 1Q4RA 4FO6A 3K2PA 2A1BA 1JRPA 3T5KA 4RQ6A 2PT0A 1TL7A 1DRZA 8ICYA 3O2IA 1BPBA 2QI2A 2UUAF 1V5VA 5E3RA 3CQYA 1FRHA 2D1KA 4IEEA 1XR7A 4C11B 3HSZA 3CCMS 4ICLB 3QLHB 4NO7A 4DTMA 4X66K 4UAYA 4L73A 3FMBA 4FF4A 1FRIA 5D0EA 2YCHA 3H8YA 3MCMA 1JXLA 1ASWA 3ULEB 1HHQA 2CWXA 5BPCA 3N97B 3MMJA 5A0LA 4B8CA 1VRUB 4KBOA 4P6QA 3L7OA 5TISU 1IBKF 3AO1A 4P71A 1RLDA 3HPGA 4U8VA 1IKXB 4WKRA 3TUIC 3AAQA 4ECTA 4CO5A 3NAHA 4W90B 2GWSA 5H1SQ 4MFBA 3B6BA 3VQ8A 2GA7A 4KLEA 5I3UA 3SCLE 3K9KA 3ZTOA 4UB1A 4OV1A 2GO8A 1HYSB 2DHGA 4M5DA 2XB2D 3D0IE 2D69A 4JI8K 2DNZA 3M8ZA 2YQ3A 3TUZC 2F9WA 2OM6A 3HHLA 2W42A 3BKUA 1ZD4A 2ZD1A 2UUBF 2G5HB 3ILIA 3V7KA 1HWKA 1U6FA 5DG7A 2CQDA 4X5VA 4PZOA 4OCZA 4K4UA 3I28A 2AX1A 2JV3A 4LH5A 2R8HA 1U47A 4P2XA 3MD3A 3W66A 4LF7J 4LSLB 1RQNA 3QEPA 5HO4A 3OD2A 4HHUA 3IA0A 3VETA 2D0CA 4YHHK 4BWMA 2KRBA 3LQVA 3D6TB 4OYPA 5AQRA 3K57A 1FO1A 2F9JA 4HLBA 5BREA 2LBOA 4MFBB 8ICNA 4K4YA 2ACYA 4M7YA 4FNIA 2RDJA 3OL9A 1CQMA 2MHEA 1B0VA 1GLDG 3G8SA 3ETMA 3JB9k 5BRDA 1OY9A 4M5DB 2UUCK 1LEOA 3NXZA 4CFCA 4UTGA 1VQKN 4MF2A 4AL7A 1R6VA 4F5QA 1K0TA 3PJWA 2A3JA 3AD8C 4YOYA 4RQ7A 3HHLB 5ALNA 4E7KA 2MJNA 3PW0A 2ZD1B 4WP9A 3NF6A 3MI7X 1S9EA 4FWOA 4MEXA 2HGLA 2ZJPL 2ZNYA 5KRTA 3BQ7A 5DG9A 3CJRA 1UT5A 4B9TA 1SXDA 1QUPA 2Q4TA 2LDYA 3O9QA 3QT7A 2W54A 3WHIA 2HZCA 3GJSB 4FWMA 1RU1A 1VYAA 4DTXA 4QOZB 3LGHA 3M6WA 4DEZA 2E2NA 4UY8O 3G82A 3N6NA 4IKFA 1PC5A 4JI7F 1VQ8N 1N6QA 4CM2A 2F76X 2PMWA 2FHKA 3UVJB 1DQ8A 3V81A 3CTRA 3BR9A 5CZ2A 3D3BJ 4CH1A 5J1EA 2C2MB 4LFAF 4ZPVR 5ADZA 2Q3PA 2OLWA 2KM8C 1X9SA 1RISA 5AJ3K 3QB0A 2MJUA 2FGOA 3CPEA 2J0WA 4FWPA 4CF2A 3AA3A 5LMNF 3ZX3A 2F65A 4OYBA 5KFUA 1NM2A 1UKUA 2GO7A 3O6WA 2BQ3A 1FE0A 3MEEB 1YJ7A 4WCEL 4I9LA 5F8LA 2AJ1A 3BS9A 3OL8A 1QQMA 5ETPA 4H4KC 4WYBA 4WJ3B 4AL6A 4USKA 4NLYA 2HK2A 1R8BA 2KI2A 3MN9A 4RQ3A 4KB7A 2HHWA 3PIOL 1IBLF 2HSEB 1WDDA 2KVIA 4Q8EA 3QIDA 4CFAA 4OGEA 4M3RA 4EX7A 2DIUA 3W2WA 3MPVA 2JWLA 1DQAA 2IM0A 1GMVA 5J0SA 3RBDA 3G82B 5EE0A 4DL0C 4AH9A 1N6QB 1DBDA 4O3MA 3VAKA 2F5GA 1FW6A 4B9NA 4BS2A 4LF8F 4LMZA 3Q8QB 5L38A 5IIJA 4WFNQ 4JK1A 5J1EB 5CHIA 3GIIA 5KG1A 3Q8KA 4NE9C 4A8YA 2VHGA 3G0ZA 1CG2A 4AUKA 1ILYA 2W9CA 4YMEA 5GADU 2VKRA 2AEJA 2RB7A 4DU7A 4GV6A 3KHYA 4RQ2A 2QG9B 2BM0A 4NLVA 2GMJA 4QR0A 4M63C 2FJVA 2BCVA 4C4WA 3FEZA 3NTUA 2XHWA 4QW8A 1EB0A 4CLYA 2F3JA 3WXMB 3Q89A 3R97A 2ZIUA 3CM6A 3KNGA 3HP9A 2ZH3A 2R7VA 4DS4A 2IRUA 3W2WB 4OKJA 2L5YA 4GKJK 5HJYA 3NNHA 2QARB 2E66A 3CCQS 1HBOA 1P27B 1TMJA 3M8WA 2RKIA 1OH6A 4JI4K 1A6SA 4RUAA 2QA4S 3N7SC 4EO8A 2ESEA 1R31A 5C15A 2E2OA 3I5CA 2C3OA 2KIWA 1RWUA 3HCXA 3CGIA 4I2GA 1KWMA 1HLUA 2CVIA 3VEOA 1H1VA 4QS7A 2R2TA 3BBBA 3NKYA 2JFKA 4IOXA 4X4OA 4XDDA 5A8KB 3I8BA 1FXDA 5BPMA 2LVWA 1C0GA 4K0KF 2ALZA 1Q9XA 2OD6A 2QKBA 5FDLA 1HYVA 2QIFA 4NI2A 2VBYA 5BR8F 2D0BA 1WG1A 1XR6A 4AHUA 5ALTA 1NEEA 5EVZA 3PYDA 1AZSA 2KJ8A 1YTYA 1NI3A 3CCTA 5KG7A 3H42A 1Z1VA 2XSJA 1VHIA 4DV0F 1TK0A 1ZQWA 4FZNA 1AXQA 3AAWB 1HQUA 2PA3A 5F41A 2HF4A 4IFVA 3AD9C 4QU6A 2XWXA 3O1WA 4CVNE 2BPGA 3MZIA 1T9VA 1TE2A 1UJ4A 3Q22A 3QU4A 1YJTA 9ICFA 2IA6A 1CI4A 2ZOMA 3C2PA 3SQ1A 3AQOA 1ZC6A 4O5EA 4OHXA 3MR7A 4AYBD 4M5LA 2YBVA 2CWKA 3ALYA 1N34J 3HZEA 4I69A 1RB0A 1R3NA 4MAKA 1VLBA 5JLFA 5DDYA 2DXDA 3ID6A 5FDLB 2DY1A 5CY4A 1JX4A 5M1NA 1OY6A 4FP9A 5KI6A 1FRKA 3R5JB 4PHDA 2V63A 3N7PD 1U48A 5HROA 3RFAA 3HFVA 3QBXA 4BGBA 5KG2A 2CYYA 1U49A 2XSJB 5M2RA 1B3TA 1XQSC 4FOEA 2J9DA 4EUVA 2VPXB 3MAAA 3CC4S 4Y1CA 5FPEA 1SBRA 2A40A 3DEEA 2DHSA 2EAMA 3ZD8A 1HQUB 5DM7Q 2VDIA 4KHNA 1RWNB 2OAUA 5EX0A 4FYWB 4RPFA 1Z00B 4DMZA 5JUMA 3ATVA 1LQ9A 1FDNA 3HXMA 2L08A 4IFVB 3V9XA 1YBAA 2Z7JA 3IMQJ 3AA4A 2KL8A 4DO9A 4BDPA 4CJKA 1LAVA 4A8XA 4A47A 7ICUA 3O0FA 3C8YA 5GAEP 1N32K 2CAJA 2AEFA 4CGZA 4CZMA 4RQ5A 3J7YU 3VZIA 4WQ5A 3M1VA 2DR9A 1UWBA 3U6FA 1BGXT 4LR9A 3C21A 2YHAA 1BQMB 3ZZRA 4FL9A 4FVUA 1UEVA 4KLFA 2WB1C 3ILOA 5F0UA 1GTHA 2P5OA 4PXBA 3H5UA 2F40A 5HROB 3RAMA 2QEXN 1UPHA 5ALPA 4F3QA 3ZT0A 3TWZA 3CJSA 3WBZA 3OUYA 2F3NA 1CS4B 1RT2A 1WKLA 1WC5A 1KQFB 4X4SA 3VCDA 3Q8PB 1LNQA 3CFOA 3MAAB 3R9PA 3DLKA 4HH0A 4B1ZA 1QLNA 5L1LA 4UAZA 4I0WA 3ZSYA 2OYYA 3AJ2A 1VS3A 3GIRA 5CR0A 3ZDDA 3B8AX 4NM1A 2X3GA 4ECWA 1RWPB 2CQ3A 4MO4A 4JV1A 3L2VA 4G3IA 1Q1KA 3S1TA 1BISA 4WXWA 1Q7YO 3CC2N 1I5OB 3CC7S 3D2WA 3OLBA 3LP1A 3O1LA 5AQQA 1ZQSA 1E6YA 2E29A 3NCPA 3T9NA 5DJBA 3MXIA 1JNZB 4PYDA 1L8OA 3P4IA 1F5CA 1RAOA 2ZH2A 1I39A 4KV8A 5BOLA 3NRZA 3UMCA 4IUFA 4BC4A 3PSTA 1W9HA 3AD7C 4ZKAA 4OZ3A 3M1VB 4EZ9A 3VQEA 1UWBB 1ZQDA 2UP1A 4Z94A 2YVSA 1SC3B 2XZTB 3TTCA 3VEWA 3J7Z5 2CNKB 4TQRA 3KLHB 1WKJA 5JS1A 2I1QA 2N82B 3SAGA 2K7JA 2O01C 2K8BB 5LL6d 5F8GA 4YOEA 4HCCA 2Z56B 2CRXA 5ALEA 3HMJG 2MZSA 3BF1A 4B1YB 2JHDA 1ZQGA 2YWGA 1QZ5A 3VZHA 3MCNA 1U8WA 4NM2A 2LEBA 1J97A 4K43A 3DLKB 5EHHA 4HTLA 2VBZA 2AYEA 4UB6U 5GVQA 4NMXA 1Q95G 3SDEA 2HMXA 7ICQA 2P6UA 3OYCA 1K8AT 4M3TA 3SCJE 3NS5A 2RP5A 3N4QA 1FA0A 3RH5A 1TKDA 3ENHA 4CO0A 2P66A 2LPEA 4O3PA 1ZD2P 2IHMA 4I6MA 3LP1B 3WDOA 4RJVA 2XMMA 1EKRA 4PWWA 3G8TA 1NUEA 2MKYA 3G10A 4IWVA 2EVZA 4DV5K 4KV8B 3KKSA 4Q7AA 1DKGD 2GW8A 3BSAA 1HI8A 3IR7B 3MEDA 1RNHA 1FEZA 4DFPA 5TZVA 2PIIA 1BDGA 2AWZA 4PGXA 4I2BA 3BDPA 3MURP 3J7A1 1RLCL 2VKQA 2BCUA 1RAHB 1E3MA 4RPYA 4OX8A 3ZZTA 5B09A 3MCAB 4C48A 3ISCA 1MA9B 1RWOB 1RDUA 1GLCG 3EGVA 1ZS6A 3EY1A 2R7UA 2DPNA 4E7HA 1RKIA 3FZMA 1HA1A 3HI0A 2B9WA 3SDEB 1NK0A 3MXMA 3CJ7A 3HFZB 3LUYA 9ATCB 4BDZA 2I7NA 4I6MB 1CZ9A 4PPZA 3K17A 2DYAA 5CQGA 4PABA 3D2FA 4NL9C 2GFFA 2FHOB 5KGWA 3CCUN 4LFBK 4UAWA 3MEDB 2ATCB 4U7UD 4DN0A 3KLIA 4LVNP 2F4VK 3OW2M 4C8MA 3TVYA 5CB1A 3OYGA 7ICGA 2PFOA 1BNPA 4JLHA 1XMQK 1EAYC 2ZHBA 2UXCJ 1K73O 4Y2VA 2QFIA 1F3VA 4Y2PA 1G99A 2W3RA 5F3TA 4X4PA 3SPYA 3EKSA 1SKUB 4A8KA 2AW0A 3CD6S 3AMZA 4G1IA 4DI6A 4ZLNA 3WKCA 4YOUA 4EFHA 3G6VA 2Y8WA 3TSQA 2A19A 1F44A 3M2RA 3MFIA 3IP4B 1YJNS 3FR0A 4H5WA 3PO4A 1Z3EB 1FEEA 3V4MA 1Q3VA 4LF4F 5KQ8A 1RI7A 7ICJA 2KZZA 3M7VA 2UXBJ 4JV5K 4LQ9A 4JWNA 2DHXA 3RB4A 4ZCIA 8RUCA 1X0PA 4F0KA 2XYGB 1FXLA 1OQ6A 3O80A 3X3UA 4CLWA 4DR2K 2MQPA 1RBUA 1KL9A 1V3ZA 3CO9A 4EENA 3LDAA 4C4SA 2F8TA 4PXEA 4J03A 1MWYA 1N8RT 2B9EA 3PTWA 3TOQA 1WELA 1V5IB 4FJLA 2IOFA 3F2CA 2Y0SF 1HBNB 8ICFA 2GAGC 4DR3J 4F4XA 1S76D 3TACB 4GXIA 4FJ9A 2W55A 3FQKA 5MLCQ 4JD2A 2AZ3A 3KHLA 3OTOK 4JMUA 4FLXA 3GJTB 2E1PA 3IBFB 2RS2A 1JCEA 1WG5A 4KGZB 3MDQA 2HK3A 4GC6A 2DIVA 2Y3YA 3H1VX 1R8AA 1OSCA 5AQZA 3R2DJ 5ELZA 4DTJA 3G71N 2GV1A 5LSLA 5ALUA 4Y2KA 3CCRS 2FZGB 2H3GX 5KFEA 4USUA 1ZQRA 2QO3A 1NNLA 4ZVFA 1PC4A 4NZ0A 3VF0B 3M6VA 2BJ9A 4ED2A 1LWCA 4WFZA 1UMJA 4C3MA 5JMNA 3BEXA 3QU5A 4I29A 2H4YB 3C28A 2CN1A 3PW4A 4NRTA 3U9ZA 4TLRA 4NEYA 5GINA 4M7XA 4TLQA 1RTZA 2E5SA 5KFHA 3HT0A 2LECA 1JCFA 1N33F 1WAJA 4LF5F 4FKYA 5M1FA 2LEAA 8ICQA 1NGEA 2D7SA 1R89A 2BBEA 5EGYA 3CO0P 3FZ2A 3H98A 5A8WA 1XR5A 3PY8A 3RJHA 3HKZF 1WBDA 1TGOA 4CZJA 5ALZA 3H59A 3CFPA 2E5JA 4OO1J 1F5BA 1N5QA 2EKNA 4ECQA 3BV8A 1S7HA 4OZLA 2BW7A 5DRKA 4W5RA 3WNFA 5EOZA 5T41A 2LXIA 3ORYA 3QX7A 3I9ZA 1Z1BA 5AXLA 1FIQA 3MMAA 4YCXA 3LDLA 4QZ9A 1LCUA 3PNIA 1K1SA 2AZ1A 3CCWA 4ZCMA 4M5JA 2VC0A 3P5BP 4PHTX 5DMRA 3CMQA 3HVTA 2DK2A 2V68A 5E7OB 1JL2A 2PMZF 2RIJA 5G0RA 5ALHA 4DR4K 4PKDB 4RW6A 2FQQB 4IQMA 1IBMJ 1E4FT 5KFQA 3AVKA 4KHYA 4BWJA 5EY4A 1K8KA 4N56A 4FLUA 1EX4A 2R9LA 4B9LA 2P9PA 5J1NA 3EJMA 5I3QA 1MWKA 4RLEA 3M6KA 2FPLA 2HQGA 3HM8A 2CQPA 3SEIA 3HOTA 4HHJA 5HJXA 4PYAA 3QRPA 4RTFD 1FTRA 5A8WB 9ICUA 1VR6A 4BROA 4HHTA 3EICA 1QE1A 4CW7B 1PVRA 3HI9A 1KHVA 2OPSA 3OTOJ 1X4AA 3KJFB 3UO0A 4I2QA 4NLUA 4P4MA 2P51A 2F2AB 4JKDA 4OX9K 2D9OA 3FGUA 4ED5A 3UN2A 1NJXA 1JMSA 1Y5LB 4ZA1A 2YWWA 3KK2B 4Z4IA 3J80U 1QTNB 5G5GA 2CQCA 2DNKA 5LMUF 3OFGA 1I94J 2E5GA 2C3PA 3C19A 1YAGA 4OPAA 5AI4A 4OZ1A 3E51A 2LFVA 1N52B 4CO1A 4RX6A 4ZIVA 2F8EX 3VTHA 1QZ6A 2R4FA 1BA1A 5AI8A 3IDWA 4DSFA 3O9TA 4RW6B 3ISBA 4E1MA 2D3ZA 1UVLA 4CEBA 4FK2A 2KNJA 4HDHA 3PDNA 1K8KB 3WU2U 2VA8A 1UJ5A 3KK1A 3WXLA 2GVDA 5C42A 2YQEA 5AQKA 2CPXA 4GVEA 4JI1F 4JI0F 2NRZA 1S99A 1MN9A 3M8RA 4NRUA 4CD1A 3EO3A 2HHXA 3L5KA 1G15A 2YXLA 3AAPA 3FBFA 4OI1A 3C2MA 2B8QA 3R7BB 1QE1B 2UV8A 4NCBA 4GVMA 3OTCA 3H7HB 2ALYB 4G6VB 1VOMA 1U1QA 1HR0K 1LAWA 2OPSB 3H4BA 2O67A 5AXMA 3V9ZA 1RT4B 1SV0A 2QMWA 2ZZTA 3KLFA 5J0YA 5LXRA 1VQLN 5EU7A 3BO4A 1RBRA 4K5SA 1SH0A 3MR6A 4OMFG 4XO0A 1GLFO 2QTDA 3AA5X 3LPEA 1X9WA 2WTFA 5AQOA 5JU5A 3TZYA 1PJ5A 5LL6Z 2RS8A 3EE9A 1S12A 4F36A 1QQOA 3EDRB 1T8EA 1C1AA 1VAZA 4NYPA 2LM1A 4LFCK 5L1KA 3NVVA 5AR0A 3HK2A 3CG7A 4W5QA 4O44B 2KG1A 3KK1B 3P1GA 3KWMA 2QRRA 2GVDB 4YOWA 2VWJA 5C42B 1B0TA 1UZHA 2HVEA 3NNAA 2HBRB 1FRXA 4CFBA 4UOFA 1Z05A 1WSIA 2QB1A 1X9JA 3WXIA 2EZXA 1DTQB 3R27A 4FWNA 1ELOA 2HCFA 5LY3A 2R7YA 1KOOA 5KG6A 3C6HA 2AGPA 3KLFB 3BBCA 4NXNF 3V6DB 2XLKA 3NLCA 3DOLA 5ALDA 1WSFA 5L8RC 1RCOB 3MDCA 4LRFA 4Y1DA 4P7VA 5AE1A 2W25A 3PFOA 4KHPF 4KI6A 5CA7A 2QLJB 4XTTA 3Q8LA 2FMQA 3L6QA 2YWHA 3M1FA 3TA1A 2VPYB 1QM9A 1NHUA 3CD7A 2NV3A 2FHJA 3U1LA 3E1YA 1WWVA 4RU9A 1R7IA 4HR2A 1P8GA 1Q86T 3TA2A 5DBBA 3A3PB 3FEYB 1BMQB 4CYUB 3T1YF 9RUBA 1U25A 3TVKA 1RK8A 2NXUA 3TX0A 3ZI4A 3P8BB 3L4QA 4CJ3A 2K8GA 2MDAA 4NLDA 5I9EB 1NGJA 8ICUA 2FBYA 1DTTA 1YJWS 2EZZA 3QFHA 3NASA 3BYPA 4M8LA 2KVCA 5IT4A 3S7RA 2JWKA 1P8ZA 2B4UA 3DDNA 3MX2A 4X65J 1D8BA 4R0JA 2W8LA 1NB7A 2KD1A 3QSIA 1M5OC 4Y2AA 1T3VA 1HFEL 3H45C 2K7KA 2VYPA 4NXMK 2EHGA 3ENAA 2D41A 3F56A 3ZFVA 3KDOA 3DOLB 1Z1ZA 1HX1A 2XHBA 5H9FJ 4OZNA 4FLYA 4QWEA 5IWAF 2FVRA 4UB2A 2J8AA 2OCEA 3QGIA 3QU9A 4CERA 1SJFA 3HJVA 2CFXA 2AJQA 3T9ZA 2DH8A 3TSPA 1U2RA 3MPYA 2DTJA 2CQHA 2VA3A 2FC9A 3Q2SC 1OPIA 4ICAA 2BJ3A 2ISOA 4YDDB 4YORA 2BXJA 1BIZA 2DNGA 3QJPA 2DNQA 2KV2A 3QUTA 4RQ1A 1WHWA 5J0RA 3FCVA 4B1UB 4J9RA 2CQ2A 3LWLA 2A1RA 2HVIA 2Z1IA 4JI2J 3WNHA 1TTHB 1CJKA 3TO8A 4IO8A 1U1LA 3ZTSA 2ZJPQ 4M5GA 2CH5A 2RDIA 5EXWA 2QWQA 2KHDA 4X4RA 5E2QA 2D3DA 1YXQA 1VK3A 3K2YA 1U04A 1SI9A 1DTTB 1I3OB 2DR8A 1DJ0A 3AGRA 4PQUA 3A5OC 1XS9D 2Q1LA 1TKXA 2B7CB 3SBGA 3DXSX 2YX7A 5EX5A 4LY7A 4CLLA 3TARA 2NSBA 3CCSS 2KN7A 5IC6B 3NBPA 3NNCA 5KT6A 4K8RA 4IOBA 5I42A 1TFWA 4BHQA 1KKXA 1UVNA 2GMHA 2BX6A 3F0NA 3ZC4A 2YKOA 2VGNA 4JKEA 2DT9A 4KAIA 2GLEA 2ITMA 4C1NK 4CESA 1CJTB 2I9SA 3KHGA 5TKYA 2V8HA 3VN5A 2A2DA 3GU0A 3TAPA 3UDEA 3UCZP 1VGYA 1XNRF 4QIWF 4AM7A 1G1XA 3ZSVA 2FBXA 4Q8FA 4H0VB 2KKHA 1C4AA 1IJFB 2ZH7A 5AQUA 4RW8A 2F77X 3L8BA 2OZSA 4JN4A 4FJ7A 2QB0A 1P9YA 3D6RA 5GAHP 5HSPA 4LF9J 3AVLA 2NYIA 2ASJA 1JLCA 1Y64A 3A5NC 2G9OA 1K0VA 2K89A 4C0OC 3CB4A 2CPIA 2FC8A 4PQUB 1TKTA 1TKXB 3MDFA 4F0MA 4KLOA 2PXIA 1ZRNA 3NBPB 5AKGA 5I42B 5L1IA 3L4BC 1KCFA 3PG9A 2ZNZA 3O4NA 2V8VA 1OJ4A 1LXNA 1DRGA 3C14A 2DFFA 4P52A 2JXJA 5D49A 4KHMA 1Y9OA 1ZBIA 4B9VA 4KHRA 2JLEA 1P1TA 3ULDA 4DTSA 4M41A 2HZAA 4Z6FA 2ACMA 4QPXA 1T3OA 2FD2A 2QB0B 2DXEA 3OSPA 1BXNA 1KTVA 3R2CJ 2W2NP 3OXGA 5JVGL 5IV4A 7ICOA 4PKHA 2MLYA 2MRLA 1JLCB 4M04A 2PA8D 4LF6J 3HHLC 3H4DA 3FBBA 4RQMA 3DLHA 3ZZYA 2MZRA 4CNZA 4HTJA 4L72B 4HUFA 1TKTB 2YPZA 4A62A 1TZ0A 1JMTA 2IIRA 1URRA 5HMWA 4CLSA 4ZCLA 1VBXA 3VEYA 4OI6A 2ILZA 5CZ1A 3HVWA 4RCHA 3DI6A 1FX4A 9ICHA 2WB1D 1KVKA 4NOHA 4QJFB 1VIOA 3MD1A 3AVBA 2H51B 2WCXA 2NSCA 4YG2A 1XSPA 3LPYA 4EBDA 1YI2S 1WWUA 1Q53A 2HKEA 2D0PA 3OYIA 4DX7A 5GTHU 3RMAA 3C14B 3S6JA 2E8OA 1FE4A 1Y0HA 5A8RA 1HNXJ 1YTUA 2HLTA 1LW2A 4O5FA 4OHWA 2FIUA 4URQU 4MIBA 4OPJA 3G86A 4DU4A 1RTHA 1K6YA 4L8RB 4O3NA 3EGZA 1XC9A 2F1IA 2QM1A 3LK9A 2ZDPA 3KKAA 4HH1A 4AHCA 1M5VC 1ZQJA 2BCSA 4MEYA 4BGDA 9ICKA 2ZH6A 4DWIA 4GVBA 5CP2A 4KHQA 1L7MA 4A2BA 3MTKA 4IXCA 4CLUA 3DM2A 4CZHA 1S22A 1ZQ1C 3CJTA 5BRHA 4ETZA