4F2SA

Dna polymerase i large fragment complex 4
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
578
structure length
578
Chain Sequence
MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 199
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2sA01
1S0MA 4CGHA 3CFRA 1T03A 2W42A 4IRDA 1S76D 2ZD1A 2AQ4A 1ZQFA 3QEIA 4FJLA 1RDBA 5IILA 3LP2A 2PY5A 2A1JB 5IIKA 5DB8A 3DLEA 3TAGA 3CFOA 1KCFA 2JEFA 2IAJA 5CR0A 2XRIA 4DTRA 4FJHA 4EBEA 3ISNC 2GBZA 8ICNA 3HP9A 1N5YA 4DTMA 3DRPA 2HMIA 3WNGA 2LYHA 3ULDA 4IBNA 1K1SA 4TURA 4B9VA 4NLKA 2A1RA 4CIGA 3EYZA 3LAKA 1RILA 4P4OA 5KFVA 1ZYQA 4NLNA 1B43A 4BE1A 3V81A 4YR2A 2OPRA 3G6YA 9ICSA 1K6YA 4CJSA 5KFQA 5CJ7A 2HW3A 4CF0A 2ZTDA 4N47A 5J2QA 1RBUA 4DMNA 3M9OB 2F96A 3IRXA 1NJYA 3PR5B 1HUOA 3VA0A 1DTQA 3V9XA 4XUSA 5KG4A 1TV6A 5DDYA 4RW9A 2ITGA 2YV0X 4TQRA 3V6HA 2VWKA 2JZBB 2HNZA 4Y1DA 4I2EA 5HLFA 1VK0A 4FK2A 4PA1A 4AILC 2G8HA 4IKFA 4DTPA 3C2KA 4CJRA 3AV9A 1UOCA 5KFZA 2E6LA 4JUZA 4BE0A 1I39A 4FW1A 4M41A 1NK4A 1RDCA 3JPOA 4CEAA 2HHTA 4HCBA 4Z6FA 3AVLA 4QW8A 4DLGA 4CJVA 3SQ4A 5EU7A 3LP0A 3TAPA 2NRVA 3BJYA 2XCPA 4DTSA 4DTNA 1X1PA 3SQ2A 1KTQA 4C8KA 4YXMA 3GIJA 5KT4A 2BQ3A 1ZQAA 4B9TA 3RMCA 3HJFA 5DLFA 1ZQIA 2XY5A 3HPGA 3LDAA 3I8DA 4KHWA 3RB3A 1JN3A 3I0SA 1NOMA 4O0IA 8ICIA 3TAFA 4H4OA 2WOMA 3EPIA 4C8OA 3LANA 1DOQA 3T19A 3DLHA 3OHAA 1ZQMA 1WAJA 3L2QA 2AGOA 5J2KA 4F4WA 3T1AA 3HWTA 1SL2A 5KFHA 3T5KA 1QE1A 1D8YA 4KFBA 4E7HA 1X9SA 4DU3A 3TWHA 4B8AB 5KRTA 4BDYA 3TAEA 2W9CA 3RB4A 2Z1GA 4CFDA 1ZQXA 3S9HA 8ICPA 3ZDAA 4TQSA 4OPKA 2O4IA 4QZFA 3OYNA 2PI5A 5J2GA 5C42A 1UAXA 4ED0A 2ZQBA 4B9NA 1I3AA 5KFXA 1ASUA 2JLEA 4EYHB 5BOMA 1QHTA 2C2DA 3DLBA 1XHZA 5KFLA 3AVFA 1HYSA 4FM0A 4ID5A 2KW4A 3PO5A 4IR9A 3ZDDA 1BVSA 5DB9A 4O5BA 1TAQA 4KV8A 1HJPA 3OSNA 3JPTA 3TAQA 3C1YA 3HT3A 8ICZA 4ZTJA 3ZSQA 4KHSA 1S1XA 2ASJA 3GV7B 3CFPA 3HX0A 1ZBLA 1V9PA 4Z4HA 1J54A 2C22A 2VANA 7ICVA 3DI6A 3UPQA 1KSPA 3JPQA 5L9XA 1VSKA 3B0XA 5DMRA 1BQNA 2KZMA 4KB1A 5IIJA 4JWNA 8ICUA 4XIUA 3AVHA 2BPFA 4DSFA 1A76A 3QEWA 1U49A 3UXOA 5KG2A 4J9OA 4Z6DA 4KAZA 2FPLA 4CJQA 3A2FA 5D49A 2D0CA 1S1VA 1HYVA 1LW0A 4Z4IA 2C28A 2JEIA 4DU4A 3VQAA 5KFPA 1CEZA 4QCLA 4P2HA 4LZDA 4CJEA 3VN5A 4RQ4A 4CK1A 4DL3A 2A1SA 2FMQA 4HYKA 1W0HA 3RJFA 3LPTA 4KLJA 4X5VA 3OYCA 1WSIA 3AO1A 1QQCA 4K4GA 3FYHA 3Q8LA 2PFPA 5FRNA 1SL0A 8ICSA 1RT4A 1IKYA 4KHYA 3NTUA 2FBVA 4OJRA 3ETLA 4CF2A 3MR3A 4KRFA 7ICSA 4YVZA 3GV8B 4YD1A 1QTMA 3PW5A 4FO6A 2RKIA 2WONA 4BGDA 1H38A 3CQ8A 1XI1A 3PX0A 1ZQJA 4KHQA 4LSNA 5J0QA 4DL7A 3KK2A 4F4XA 4E1MA 3TQ1A 2E4LA 5EOZA 4F3TA 5F9NA 4KLMA 3AA3A 3KK3A 5J1EA 3V72A 5HRSA 3D45A 8ICMA 2FLLA 4FLTA 3HW8A 1U4BA 4ED6A 2VWJA 3RBEA 1SUQA 4RQ1A 3GIMA 3AVCA 2EX3A 1U48A 4IFYA 1DTTA 4ID1A 1IKXA 1A77A 2Y1IA 3H4DA 4JS4A 4KHUA 2I1QA 3RRHA 2F1IA 3MFIA 3KIOA 4HUGA 4GW6A 5FRMA 3RJEA 4O5KA 1CLQA 3Q8SB 1EX4A 1XSPA 3S3OA 1BQMA 2M9NA 5DBCA 3AA5X 5T7BA 4CF1A 1KVBA 4K8ZA 3L3VA 4ZHRA 1VRTA 5C24A 1WLJA 1UA1A 3GIKA 5CA7A 5KGXA 5HP4A 5EWGA 3LDSA 4J2EA 4UAWA 4CJLA 1QS4A 3P83D 5HRPA 2ISOA 1RXVA 1NOYA 4QWAA 1JXBA 1C0TA 2YHBA 3ZT2A 4O5EA 3C6TA 4CECA 3VQ9A 4R8UB 2AU0A 4RT3A 4CJUA 5DG7A 9ICCA 1Z00A 5KFJA 5KFWA 4JRPA 4YMNA 3O3HA 4ECTA 4CF9A 1K1QA 3RH4A 5D4BA 1EXQA 4CFCA 4N5SA 1IKVA 1NK8A 2IGIA 4YMOA 1S0VA 4OLAA 4I2GA 3H8SA 4DSEA 4CEDA 3Q8KA 5J29A 5KG3A 4KI6A 5DBBA 8ICQA 3NE6A 3H8JA 4DS4A 3QIPA 2HHSA 3GILA 1ZQDA 4W5OA 5KT3A 4FJKA 4UAZA 3IM1A 1T05A 2PFQA 1W9HA 4F91B 4QZGA 2VA3A 3PW0A 5KI6A 2I5JA 3RH5A 4ELTA 5DGBA 4DOBA 4CK3A 5CWRA 3K75D 4R8UA 4DSLA 1JMSA 5L1LA 3S3MA 5CZ2A 3WNEA 3K58A 1IO2A 1XC9A 2ZTCA 4PHDA 2P51A 4QZHA 4BE2A 4E7KA 2YHAA 3V9ZA 9ICFA 1T3NA 1ZBFA 2ASLA 3OYAA 4RQ2A 4FZZA 4LH5A 3L3UA 4R5PA 1L3VA 3TI0A 1IKWA 1BIZA 4M47A 4J9RA 7ICEA 3C1ZA 4EP5A 1NJWA 4F50A 3C6UA 4RUCA 1A5XA 4KI4A 1D8LA 3RJIA 4F5NA 4YFKA 1X2IA 1XHXA 5KFMA 3ORYA 3B6OA 2ZE2A 1BHLA 4RQ5A 5HBMA 4CCHA 4E7IA 3ZSXA 3ZSVA 1JLFA 2P6RA 5J2DA 2P1JA 1KLNA 2FBTA 2B21A 2AGQA 4FCYA 3N4MB 4CK2A 3QZ8A 4F5OA 3QLHA 3AO4A 4OGEA 7ICNA 2A1JA 8ICAA 2P66A 3KLHA 3DLKA 4FLVA 3ZT0A 3LP1A 1RBVA 4DTUA 4CFBA 3RJHA 4I2HA 4Q44A 4KHNA 3OYHA 1NK9A 3RTVA 4DFJA 2V4RA 2R8HA 2UVWA 4RUAA 4HCCA 2HHWA 2H5XA 1ZQOA 2ATLA 2BGWA 1N6QA 3H4BA 3BQTA 7ICHA 4KTZA 3OS1A 2B6AA 1LB2B 3SNNA 1TKXA 5IIIA 5J2NA 3SPZA 2W9BB 4MF2A 4GXIA 2BCVA 3L2RA 2W9AA 3HP6A 2IMWP 5HHHA 1QSYA 4CF8A 1O1WA 7ICKA 4CJFA 3NFAA 2NRZA 4KO0A 2J6TA 4FW2A 3AA2A 3NGIA 4CJKA 4O0JA 2BQRA 3MGHA 4CJPA 4MQ3A 4O3OA 7ICPA 1RYRA 2KQ2A 4QZBA 3ITHA 4DQQA 4HUEA 2DFLA 1VSFA 1YT3A 3DOKA 4Q8FA 2BGGA 4J2DA 4BACA 4FS2A 3PMLA 1HQEA 3PX4A 9ICOA 1YVUA 2LSNA 3SI6A 4FJJA 2R8GA 3QEPA 3U3YA 2BKEA 1ZJNA 1SKWA 1NK7A 3PV8A 5KG5A 4DWIA 4IQVA 2QXFA 4R66A 3AVKA 3WNHA 7ICIA 5KGWA 1ZQGA 3HVRA 4J2BA 1A5VA 3ASMA 4DLEA 3PNCA 1BPZA 4AHVA 4TSXA 4ED7A 2ZUBA 2X6NA 4M9NA 4UBCA 3NF6A 3K57A 5J0WA 5J2BA 5DG8A 4HUFA 2W9MA 2NRXA 4I2PA 1WNSA 3M8QA 3KLIA 8ICEA 4M9JA 1DLOA 3K4GA 1TL3A 4FJ7A 4DSKA 3G0ZA 5K14A 8ICOA 1A5WA 2BCQA 4M3RA 4YXJA 4M9HA 3CG7A 2Q3SA 4QZEA 1C7YA 1MC8A 1ZQLA 1BGXT 4EZ6A 4FLXA 4UB4A 2XHBA 8ICWA 1YTAA 3AVMA 3QZ7A 9ICWA 1VRUA 3MXMA 4B9UA 3L8BA 2UVUA 4RPXA 3OYLA 4IQUA 1S9GA 4FBTA 4M0AA 4DFPA 4E1NA 4QZCA 1RXWA 5FDLA 4JV1A 2PYLA 3MEEA 1Z3EB 3MDCA 3C2MA 4G3IA 4Z6EA 4ECXA 4PY5A 1RTJA 4OKEA 4M6WA 4NY8A 4O44A 4FJ5A 3BQ2A 4FZXC 5KT6A 3ZSRA 2DFHA 4YR3A 4C8NA 1RT2A 3NGZA 3UQ0A 2C2EA 4TUSA 4KLGA 3L2UA 4KTQA 4CHYA 4LD0A 3AVNA 4J9PA 5DQHA 1ZQNA 1HJRA 4QWEA 4DTJA 5L1IA 1UT8A 2Q0ZX 3ALYA 5BPCA 5HP1A 5CY4A 1YTUA 4ECQA 5KFIA 8ICLA 2YKNA 3V6DA 3BQ1A 3LPUA 4QZ9A 4F2RA 4FLYA 4FJGA 1DGSA 4AHRA 3UQ2A 4J9NA 2I9GA 1S77D 4ECRA 4PWDA 3OS2A 1BPDA 2G8WA 3H08A 5CYQA 4CHOA 1BISA 4FS1A 1SL1A 9ICBA 2WTFA 1S10A 4E3SA 1Y97A 3MEDA 4PHAA 1LV5A 3OHBA 1HQUA 4YN4A 2D0AA 4OVLA 4W5NA 4RQ7A 3LWMA 3OYMA 8ICHA 4RNNA 3ISDA 3P1GA 2Z1JA 2RPIA 3OYDA 3H8WA 2R8IA 4MEYA 2G8FA 3NF7A 3U6FA 3WNFA 4AHCA 3KHRA 2KFZA 7ICOA 5J2PA 3V9SA 1RTIA 3RRGA 3MR6A 5L1KA 4E0DA 4IQWA 8ICXA 4DTOA 1MQ2A 1VSHA 4I2AA 4M3UA 2IS3A 1RDDA 4M3WA 3OYKA 8ICFA 2FBYA 5KFGA 3M8SA 2FMSA 5CHGA 1U45A 2KN7A 4RNMA 3TFRA 1XU4A 1RYSA 4EP4A 4I2BA 3LZJA 2QKKA 1JXLA 4RQ6A 2FLNA 1CZ9A 5KFCA 1XS9D 2BCRA 1B92A 3C5GA 1NKEA 3C5FA 9ICPA 1D5AA 5KTQA 1KVAA 4JV2A 3E01A 5DLGA 2D5RA 2OZMA 1S0NA 3MXJA 4CGIA 1JLCA 9ICMA 4I27A 5KFDA 3KHLA 1KFSA 4CEZA 1C1AA 4PGQA 1TKZA 7ICTA 1L5UA 1CZBA 5KFUA 1ZQBA 4B9MA 3TANA 4KLHA 1FKOA 2X74A 1CXUA 2X6SA 5IINA 3K59A 4EZ9A 1S6PA 1JLBA 4ECVA 1RBTA 1KRPA 4R64A 4LVSA 2OPQA 4NCBA 1BCMA 5J2HA 1R0AA 2XY8A 1BPBA 1Z00B 3NH2A 1KFTA 1GOCA 4KLLA 3KD5E 4BXOB 2V9WA 4DG1A 2ZJ8A 4O3PA 3HXMA 2FPKA 2VG5A 2HVIA 3QEXA 3PR4A 1REVA 3EY1A 3MR2A 5I3UA 4MEXA 1NKBA 4KN7A 3QNNA 3PVXA 1B9DA 3DM2A 3L2VA 1Q9XA 1B9FA 1TK0A 4GXJA 8ICCA 2KZ3A 3AVJA 1RCHA 3K2PA 1XO1A 5C5JA 2IHMA 1Z25A 4LSLA 4RQ3A 4KLQA 2RF2A 2HHVA 4RT2A 2ASDA 1WSHA 4RG8A 4WE1A 3V1OA 2HNDA 3DMJA 4KKOA 5CB1A 2F8SA 4Q8EA 4TUPA 3PW4A 1WAFA 4I2QA 4MF8A 3IG1A 1Z26A 4IR1A 3NCIA 4KLUA 4YNQA 3NH1A 3PUFA 1L3TA 1JXEA 4IG0A 1S1WA 2BQUA 3KKSA 4CERA 4FLZA 1BL3A 5DG9A 4RPYA 4FLUA 3SUQA 4FM2A 8ICBA 3KK1A 2BCSA 3ZSWA 3ZSZA 2XGQA 4LZGA 4HHTA 3AUOA 3EW9A 3V7JA 3HYFA 2ETJA 4J9QA 1IXRA 4I2IA 2PYJA 3DLRA 4DF8A 4J9SA 2RDJA 3QE9Y 2XY6A 5JS2A 1WCLA 3JSMA 2R8JA 4KLOA 3AVBA 1RBRA 1VSJA 2DFEA 4QZIA 3RAQA 5J0RA 2Y1JA 5JS1A 4FK4A 3OYJA 3PX6A 4CFAA 3DLGA 5SWMA 9ICHA 3PW2A 2FPMA 1U9LA 4PHEA 2QKBA 1BI4A 4CE9A 4I2JA 4ELVA 1TVAA 3VQ7A 1RBSA 5J2IA 5HMMA 1ASVA 2IBKA 4F4ZA 3NHGA 4JLHA 1EP4A 3B0YA 4YCXA 5J0TA 3VQQA 2HHXA 5DQGA 3QO9A 1ZQUA 4YQWA 1NJZA 3QETA 3SYZA 3O3FA 1KDHA 3GQCA 3SUNA 2BANA 1C0MA 3RJGA 5D46A 3V9WA 1ZQHA 4PGXA 4M9GA 4FJNA 3TR8A 1BPYA 2C2RA 3QNOA 4LH4A 4AHTA 4FJMA 3BGRA 3RMDA 3V6KA 1TK5A 5EWFA 1UWBA 1ZETA 1T4GA 4RW6A 4XA5A 3H40A 3PY8A 5J2CA 3L2WA 5D3GA 4UB3A 3VQ5A 1TV9A 2PZSA 4PH5A 4ECUA 2NRWA 3ZT1A 4GXKA 2R8KA 2KZZA 1HNIA 5FROA 3JPNA 4CEQA 2HHQA 1JLAA 4EBCA 4FZYA 4CHNA 3VQDA 3H7IA 4I28A 2ZUCA 4KLDA 1LAVA 3JPRA 3MBYA 2HNYA 4CJ5A 4KLIA 4M45A 3EPGA 4M3YA 4QZAA 3SZ2A 1L3UA 3ZCMA 4R63A 4NM1A 3KD1E 4P4PA 5DB6A 4NLZA 4GMJB 3GV5B 4KREA 3LP3A 3HO1A 4RPZA 3ZT4A 4RZRA 3MEGA 3VQPA 4M3TA 3MR5A 5CYMA 1NOZA 3ZDBA 3C94A 2ZJAA 4CGGA 3IHQB 2D0BA 3TAMA 4FM1A 4E7JA 1KFDA 4N56A 3G10A 1XWLA 5E41A 4PHPA 2ZUDA 3T5JA 1ZBIA 5KG0A 2PFOA 2F1JA 5KFSA 4F5PA 4QZ8A 1BIUA 4DOAA 4NCAA 1FKPA 3FDSA 3ZSYA 3GIIA 4E7LA 3K5NA 4PQUA 4FJ8A 4QWBA 4ELUA 3NDKA 4M3ZA 3RBDA 1SKSA 2IDOA 3C95A 1S9EA 3JPSA 4OKKA 5J0XA 3DRRA 5J0OA 2ZTEA 5J0UA 1J5OA 3OJSA 3KHHA 3JPPA 2E6MA 4J9KA 4CJ3A 4DTXA 1B22A 9ICJA 2Z1IA 2BPGA 4KN4A 1GOBA 3KLGA 1EKEA 4K4HA 2W8KA 2F1HA 4Y1CA 1JLGA 5DKWA 3M9MB 3SV3A 3VQ6A 4I7FA 3OSPA 4GC6A 4ECYA 4O3RA 4CESA 4KITB 3OYBA 5KFOA 1NK5A 4PPXA 2NUBA 4CIFA 5KFTA 3Q8QB 3QINA 4MFBA 4K4IA 3SUPA 2AQ0A 5DGAA 2GUIA 3AVAA 1BCOA 5DDMA 1ZBHA 4Z6CA 4CIEA 4QWCA 2YKMA 3RMBA 3RJJA 5KFNA 3JYTA 1GOAA 2BR0A 2DFFA 4PGYA 4P4MA 4UB1A 4UQGA 4KPYA 9ICLA 1RT1A 4H4MA 3QEAZ 4QOZB 4MFCA 1RT7A 9ICGA 1ZQTA 2DTUA 2R7YA 4YG2A 1D9DA 2XCAA 7ICJA 8ICKA 4FJXA 1JL2A 3KLEA 3OGUA 4F2SA 4GC7A 3G6XA 2BPCA 1AROP 1N48A 7ICLA 4MFFA 3P5JA 4NM2A 2ZJ5A 1S0OA 4CJWA 1S6QA 1F21A 4IDKA 4FLWA 4C8MA 2XGPA 3QESA 4B8CA 4OKJA 2FC0A 4B9SA 5DB7A 4Q5VA 1Q9YA 4J9MA 1NK6A 4I9LA 3OY9A 4F5RA 5J2MA 4ZH4A 4DSIA 2G8IA 4M2YA 7ICGA 3KJVA 3LAMA 4IRKA 9ICXA 5BOLA 4M42A 4QWDA 1LWEA 1J53A 1TGOA 3M8PA 2BCUA 2BHNA 3RH6A 1VSMA 4RW4A 3O4NA 5JUMA 5J2JA 2YNHA 4HTUA 4YFUA 4TUQA 3MGIA 4KLEA 3PMNA 4ED1A 3HM9A 4W5RA 2OPSA 1VSDA 1BI4B 1QSSA 4EEYA 1WSJA 2NRTA 1NJXA 5KG6A 3D0PA 3T3FA 2IHNA 4DSJA 1XSNA 1NKCA 9ICAA 4O4GA 4ECWA 1Q8IA 5KFAA 4QZDA 4JV0A 4UBBA 9ICTA 1IM4A 3QEBZ 3MDAA 1BPXA 3SQ0A 2HVHA 2QK9A 5DK5A 3RR8A 5DQIA 3AU6A 4ED2A 3Q8RB 2G8UA 3AA4A 4I2CA 2XC9A 3EZ5A 4ICLA 1S5JA 5J0PA 4UAYA 1LWFA 4LY7A 1LAWA 3I0RA 1JL1A 4CEOA 1ZQQA 4NYFA 3LWLA 2JEJA 2VG6A 3IAYA 1ZQZA 2FLPA 1UA0A 2PI4A 4CEBA 4F93B 2HHUA 4O3QA 4GVMA 1BPEA 4N76A 4FJ9A 1NK0A 1RT6A 2RDIA 4EYIB 1ITGA 1TL1A 3S3NA 3KKRA 2XO7A 4YR0A 3NH0A 3DOLA 4R65A 2YNGA 4IRCA 1S9FA 3C21A 2DY4A 4H8KA 2P6UA 3V6JA 4O9MA 4Q0BA 3OS0A 1KVCA 1TVRA 4JK1A 1ZQRA 3RJKA 1JLEA 1XSLA 3TFSA 2MAXA 4BWJA 4F8RA 4N41A 4OLBA 5HHIA 3OYFA 4I29A 1SV5A 2MUTA 1L3SA 2Z1HA 3OJUA 2XY7A 1C6VA 3V9UA 4DL6A 4KLSA 2B5JA 4O5CA 1WSFA 4KTWA 4AHUA 3GFKB 4CHQA 4DL5A 1U04A 2PXIA 2KFNA 2VA8A 3KLFA 4UB5A 4DQIA 3AO5A 4I2DA 4RQ0A 9ICNA 5KT2A 3HVTA 1ZQVA 5KFBA 1ZJMA 3AVIA 7ICQA 4CGFA 4Z4GA 4CJ4A 3RAXA 4FYDA 1KLMA 1HMVA 2OZSA 3HK2A 4JRQA 3PW7A 1CXQA 3F73A 1ZQKA 3OYEA 5HNKA 5KG1A 3V7KA 5C25A 4YD2A 5J0SA 3HL8A 2DPJA 3MECA 3AO3A 5KFEA 1J9AA 5KG7A 1LW2A 2FBXA 3IS9A 4Q45A 1RT3A 2JZBA 4DFMA 1JX4A 5KT7A 5J2AA 3C2LA 4O55A 3PO4A 3F9KA 3UXPA 3CYMA 1TKDA 7ICUA 2DPIA 1C0UA 8ICJA 3UIQA 4B3OA 4MFAA 9ICEA 5KFFA 2P5GA 5DBAA 4C8LA 1VSIA 3HSTB 1WCNA 9ICVA 4KB0A 4F4YA 2IA6A 3ZDEA 2BDPA 3BDPA 4K8XA 2VG7A 3NGDA 2F8TA 4L8RB 4QW9A 4I9QA 4DQSA 3DRSA 4RNOA 2BE2A 1HRHA 4PUOA 1ZQCA 5I42A 3LALA 4KMUA 5IIMA 1JLQA 5HRNA 9ICUA 1U47A 3BQ0A 2B4JA 1HYZA 1FK9A 4DFKA 2UVVA 2J6SA 4CEEA 1CUKA 2O4GA 4J9LA 5KFRA 1RTDA 3T5LA 3B6PA 3OYGA 1Y88A 3OYIA 1S1UA 3Q8PB 4DL2A 3MFHA 4Z4FA 3GDXA 1HNVA 2OYQA 1ZBUA 5F9LA 2W9CB 3KTQA 4OGCA 4DQRA 5HMLA 1RT5A 2JGUA 1T8EA 3V1QA 1T7PA 4KLFA 2PFNA 5KFYA 3UXNA 4O3SA 1TKTA 3VQBA 2AJQA 2OA8A 5J0YA 1C1BA 3K5OA 2IOCA 1KEJA 3ZSOA 4NYNA 3LK9A 1LWCA 4E89A 4KLTA 3FFIA 5SZTA 2AGPA 9ICIA 2GWSA 4XQ8A 3AO2A 2P5OA 3QIOA 4J2AA 3O4QA 3ISBA 4FK0A 4F5QA 1IG9A 4I2FA 5TZVA 3KHGA 8ICVA 3M8RA 3CM5A 1SKRA 4ZTFA 4GLXA 8ICRA 1S97A 1HUZA 4NLGA 4BXOA 5HRRA 5L1JA 1WSEA 3RB0A 1G15A 4YMMA 4XRHA 4RU9A 2G8KA 3C23A 1S1TA 1ASWA 2W8LA 8ICGA 4CGJA 5KRSA 4W5TA 3M9NB 1VSEA 1MSWD 4CHZA 1JIHA 4B9LA 4HVJA 1RDAA 2RN2A 2JEGA 4BDPA 1HPZA 4ED8A 3HPOA 1WN7A 3RR7A 3NBPA 1C1CA 4EBDA 3MABA 3SPYA 1MU2A 4AH9A 4UB2A 1RZTA 1RNHA 4Q43A 4RW8A 3LZIA 3SI8A 4CHPA 4CEFA 4FBUA 2YNFA 4FJIA 3K5LA 1EXNA 3VA3A 3MAQA 4RQ8A 1MQ3A 4YP3A 5J2FA 3ZD8A 3DYAA 3RWUA 3VQCA 3SCXA 1UT5A 3G6VA 2X78A 4NCGA 1RPLA 1JKHA 2FMPA 3VQ8A 4W5QA 3MXIA 4B08A 4ED3A 3QEVA 4G1QA 1COOA 4M6WB 1WSGA 4JS5A 1IH7A 3T5HA 2UVRA 4IG3A 3NGYA 5EWEA 7ICFA 3TARA 1EETA 3HPHA 2KTQA 5KT5A 4DS5A 4DU1A 2IC3A 2EHGA 4OPJA 4O3NA 4F92B 2ALZA 2OWOA 4QAGA 4RW7A 4Z4EA 1ZQEA 1N56A 9ICQA 4NXZA 1TFRA 4Z4CA 3O3GA 2ISPA 3VQEA 9ICKA 3RMAA 3K5MA 3OVNA 4E19A 4M3XA 4DQPA 3AU2A 1X9WA 1X9MA 4Z0UA 3NF8A 2ATQA 3THVA 3U3GA 2W9BA 1D9FA 4F3OA 3V7LA 8ICTA 5IIOA 4BWMA 3V1RA 3ZDCA 3NAEA 4FXDA 3QERA 5HROA 3ISCA 4DF4A 2OPPA 1PZNA 8ICYA 2G8VA 2V4QA 3ZT3A 4CGDA 7ICMA 4FVMA 2YNIA 3ZD9A 3V4IA 3TABA 4M9LA 4ECSA 5J2EA 5CZ1A 1ZQYA 3RB6A 3N97B 3CM6A 1SZPA 3E2EA 3SQ1A 2GV9A 7ICRA 3AVGA 4M04A 1RTHA 9ICRA 4CJTA 3SUOA 3NF9A 2VA2A 5KFKA 4DL4A 4DO9A 4F4KA 1ZQPA 3EWAA 4DEZA 2MUTB 4DOCA 3SJJA 1QSLA 3SV4A 1FXXA 2J6UA 3Q8MA 3VQ4A 4JWMA 4ECZA 1QLNA 4BDZA 4AHSA 1TAUA 5CP2A 1ZQSA 1TK8A 4IFVA 4IQTA 1ZQWA 1VSLA 2HB5A
chains in the Genus database with same CATH superfamily
1YBUA 1S0MA 4J91A 3PRVA 5KOWA 5E84A 4WZQA 3CQYA 4BREA 4MKBA 4DR2K 2AQ4A 4X66F 4GY2B 5IIKA 3DLEA 1A6SA 5CHCB 3CFOA 1KCFA 2JEFA 2IAJA 4WFAQ 1HNZF 4YDXA 2GCFA 3ISNC 3I56N 2NYHA 3OTQA 1XMQK 2YX6A 4DTMA 1F60B 3CXCR 4MLEA 2VGNA 1C0TB 1XMOF 1K1SA 5L1MA 1F44A 3LAKA 5FPNA 1YQHA 1NH7A 2W7PA 1ZYQA 2WSEC 5AQOA 1FNOA 3KNGA 4DV6F 3O0FA 5K8MA 3IR7B 3ILJA 9ICSA 2VDIA 3NOGA 4CJSA 3J7YP 5TKWA 3FSYA 4PZOA 1TTHB 1K8KB 4X66J 3NMAA 1WDDA 2A3ZA 3QUQA 2G4BA 1NZPA 2VJ4A 1T02A 2ZTDA 3W0LA 3QGHA 3T1HJ 4QU7A 2C3PA 2CNOB 3M9OB 2VBXA 4IDHA 2AKWB 2VKZG 1NJYA 2F96A 2MLXA 1XQIA 1HL6A 1HUOA 2P9IA 3D6TB 2E2NA 2O8BA 2YB4A 3V9XA 4LSLB 1IM6A 2KHCA 2YV0X 4TQRA 1X31C 1UVLA 4LF9F 2HNZA 1YRUA 2HFVA 4G65A 1N32J 4AILC 1UHUA 3SMPA 2G8HA 3OT9A 5HQ8A 4DTPA 5KFZA 2XI2A 4W98A 2KH9A 2E6LA 2EC2A 4JYAF 2NZTA 2D3ZA 2GOLA 4FW1A 2FLOA 1J2MA 1NK4A 2HNDB 4PQUB 4I6MB 5BN8A 3JPOA 4HCBA 2YNHB 4Z6FA 2JX2A 1ZOTA 1BHNA 3IRUA 5D0EA 2ZJQL 4LR8A 2PO4A 5KQDA 5IV4A 3PDNA 3CCTA 2XVTA 3SQ4A 3LP0A 2H3EB 3BJYA 3VGSA 4Y6IA 1HEKA 5HANA 3SQ2A 3DXSX 3ZETB 3M2VA 4YXMA 2YQEA 2FHOB 4JI3J 5DLFA 2I7NA 2F44A 2OH2A 1JN3A 3CCVN 3EGWB 1GMWA 4FWMA 4O0IA 4CE6A 3VGVA 2XLKA 3VAHA 1DOQA 2D9PA 3C15A 4P2XA 1EWRA 3F2CA 1KONA 1H73A 3EO3A 1KVIA 4DR1K 4PYAA 3T5KA 4HACA 3JS9A 1QE1A 1D8YA 4MAKA 2M5YA 2HI0A 4DU3A 2VPXB 2HGMA 5KRTA 4YEAA 4DV1K 2W9CA 3RB4A 3KK2B 4Z7YA 4LFAJ 3S9HA 5ALKA 3LL3A 3ZDAA 2O4IA 4QZFA 4DHVA 3BSNA 1OXJA 2W7OA 2QWOA 5F41A 3FAHA 4WZMA 2QJ3A 4ED0A 1WBBA 2JLEA 3IP4B 1EB0A 4EYHB 2C2DA 4ZVPB 1HYSA 2GMJA 2KW4A 1N32F 4IR9A 3GIRA 3EZWA 3W5ZA 2HAFA 3O2IA 1IG6A 2LLZA 3OBIA 3DM2B 2QYGA 2V2KA 2AEJA 8ICZA 3ZSQA 1UAWA 1S1XA 2ASJA 3TQEA 4HTIA 1ZBLA 1V9PA 1SCJB 2ZEJA 4CWBA 1J54A 2VOPA 3MCAB 3N01A 3T1HK 5JLHA 4LF4J 1BQNA 2KZMA 4KR0B 3VAFA 5IWAK 1RWNB 1KTVA 4KB1A 4USHA 5IIJA 2P9KA 2QLXA 2XMVA 3HFKA 5B09A 2BPFA 1R8PA 1AW0A 3U8XA 1U49A 3HHLB 1FFGB 2HG4A 2QTWA 4P7VA 2H5EA 4DG1B 2FJBB 2OFHX 1XMQF 1CEZA 2H3ZA 1EHWA 4MHVA 2L48A 3EKSA 2BABA 5LMUJ 4WJBA 2A1SA 1NZBA 3RJFA 2J9EA 3NS6A 2R2RA 3HSZA 1TUYA 3SK3A 2CKWA 4DV4J 2WF6A 1RT4A 1U1RA 4YB6A 4OJRA 2HS0A 3R5DA 4RX6A 2YKPA 4USUA 2KT2A 2HF3A 3FC9A 1FESA 3GV8B 3A8EA 1QTMA 1KBRA 4LF7J 2NUUG 2ZWOA 1H38A 1GH8A 2MQ8A 3PX0A 1NAQA 5J0QA 4DL7A 3KK2A 4ZS6A 2KOBA 1FKPB 4E1MA 3HZ6A 4A8WA 5EOZA 5F9NA 1WC1A 2AHOB 1WBDA 1IBLK 2G0CA 1SB6A 1Y5IB 2FLLA 1S6OA 4FLTA 4QIFA 3HSGA 3MTJA 1HYSB 1SUQA 4ISGA 5IT4A 5B8HA 1BUXA 4MFBB 3W61A 5GIPA 4PG7A 4Y2UA 2Y1IA 4JS4A 4KHUA 1MWZA 5LJVA 4GW6A 4B1UB 3C14A 4O5KA 1H98A 4JHDA 1XSPA 4TU8A 3S3OA 4HT7A 4WFYA 1BQMA 2M9NA 3SQGB 2HOEA 2YNIB 5T7BA 4PAAA 3HOTA 3J7AP 1KVBA 2MHNA 4CT9A 4ZHRA 3L3VA 3C8YA 4NYOA 1TFWA 1K8AT 2ZUGA 4X4RA 4CF4A 5EWGA 5AKXA 4CJLA 1N34K 1ZC6A 5HRPA 2MZRA 2VIXA 2NPIA 4YOYA 2XS5A 3FK4A 4BVPA 4QWAA 2FTRA 2YN4A 2DF4B 1B64A 5JXSA 2YHBA 3W3DA 1HBUB 3VQ9A 3H42A 2ZZTA 3T41A 1NGHA 4L75A 2E5LJ 9ICCA 1VRUB 2IA0A 5DM7Q 2ZIWB 4YMNA 3O3HA 4ECTA 2U1AA 1K1QA 4Y2SA 4CFCA 1IKVA 4YMOA 4I2QB 4I2GA 2CPXA 2Y0SC 3PM9A 4PL8A 3IAM9 1KEKA 3Q8KA 3MEEB 4Z37A 5E7OB 5ALSA 1EQYA 2FE9A 2BUPA 1H74A 3UVJB 2FZGB 4UUXA 2DKOB 1YTYA 4CNZA 4HACB 1P1TA 4FJKA 4UAZA 4L73A 3IM1A 3R7SB 4QS7A 4F91B 1KXPA 4QZGA 1J27A 2WB4A 3KZXA 4JI4J 3U9DA 4DOBA 4A8MP 4OZJA 3J81Y 4R8UA 4C1NK 3I5CA 4PHDA 5A8RA 4PHTX 2YHAA 1T3NA 1WHVA 3BN7A 2CQ2A 3DXKB 1UEUA 2ASLA 4RQ2A 3EUB2 2XZDB 3L3UA 2K8CB 4ES2A 3TI0A 3SR6A 5AFUH 5LM7E 4J9RA 3C1ZA 3H0RB 4N77A 3X3UA 4CNYA 2HS4A 4RUCA 4N8NA 4KB7A 3RJIA 4ZCLA 4YFKA 2P8IA 5KFMA 5CHIA 2MLZA 1Y5NB 3ORYA 3B6OA 4ES3A 5HBMA 3AARA 4BLGA 2DHSA 3D2EA 3ZSXA 3I1YA 4X84A 4PPZA 1S72S 4ZCMA 2B8QA 2NS1B 3OFFA 2B4PA 3EMTA 3FCHA 4OI2A 4FCYA 2LCWA 1F3VA 3CDAA 1L7OA 4FFDA 3QLHA 2F8HA 3T9NA 1IR2A 1M90O 1CJUB 5J2PB 1HD0A 4A62A 4DTUA 4L3KA 4NI2A 4EENA 3O1WA 4QYRA 5C2GA 1MN9A 4Q44A 3NVVA 5DZ7A 4AYBC 3OYHA 1NK9A 3N0VA 2V4RA 4DV4K 2R9LA 1JUDA 4ZVTB 3HJVA 2ATLA 4KTZA 1Y5LB 3C15B 1I3OB 3HRGA 2BCVA 3MM8B 3QFUA 2W9AA 5J8YC 1MN8A 4BUGA 4JB3A 1QSYA 5MLCQ 2ADCA 1O1WA 7ICKA 1KN5A 1XK8A 2WB1F 2X1FA 2J6TA 4CJKA 4P72A 5B0BA 1U02A 4TY9A 4CJPA 3QWUA 1HNXJ 3GE9A 3ITHA 4ITSA 3BBFA 1EETB 3FKBA 3FEXB 1IKVB 4WYLA 3ATVA 2FZKB 1VQMN 3UNGC 1NGCA 4OYZA 2Q6BA 4BRCA 3VGUA 2O1PA 4FWRA 1ZJNA 4IOBA 2MY8A 3K9KA 3DEEA 2VPWB 3PV8A 3QUBA 2ZXIA 4IQVA 2W6LA 1VDVA 3LDQA 2DGVA 2UU9F 3WNHA 4R79A 7ICIA 1Y9OA 1K47A 1ZQGA 3HVRA 2HKEA 3LQVA 2G9OA 2CZ9A 4O4RA 2X6NA 1PAUB 2C2ZB 3WIVA 4LF8F 2HZCA 5TISU 2DHHA 2FVSA 3NMUA 5EX5A 1NDLA 2YKOA 1T9UA 5ALOA 3K57A 5EDWA 1I6JA 2J4RA 2D4WA 4IJAA 5A8WA 4HUFA 3KFWX 3CD0A 2GMHA 1CSJA 1WNSA 3M8QA 3AEVA 3KLIA 3AAQA 2YTCA 1AZSB 1DLOA 4A8XA 1VQLN 3CJQA 1TL3A 1WTFA 4ZPBA 3WBZA 8ICOA 1N0UA 3GSDA 2ZXHA 2RS8A 1GXLA 1NHKL 2VFUA 4C7ZA 2W11A 4F67A 4QNLA 1A6LA 2Q3SA 4NWBA 2VH7A 2VJVA 4JI2K 1T0TV 1Q18A 3HKZC 2F65A 4K0KF 4H0YB 4UB4A 3E1YA 4LIWA 4TYBA 3NWGA 4ZP8A 2G2YA 2Y1RI 1LW0B 1NLKL 3L8BA 1LK7A 4XPCA 4JI5J 2ILZA 4QZCA 3VAKA 1B99A 4O23A 1Z3EB 3OR2B 2E5LF 3MDCA 5AK5A 4G3IA 4BRMA 3VENA 3ENAA 1SVDA 2M9KA 3ZZPA 4NY8A 1YI2S 4O44A 3BQ2A 1QAXA 3ULHA 2VZ9A 1ZM3A 2MY7A 4DN9A 2WVFA 3UQ0A 2HEKA 2C2EA 2KKHA 2M0NA 1SXLA 3L2UA 3CPEA 3CCZA 1KD1T 1YK9A 4ETXA 2IM1A 5DQHA 1ZQNA 4QWEA 4DTJA 5AKLA 5L1IA 3QSYB 4C4TA 1W25A 4K4TA 4CLSA 3R5AA 1EIYB 5HP1A 4OX9K 1YTUA 4ECQA 4U7UK 2BRKA 2H51B 2DNLA 2ZC4A 4AHRA 2X51A 4KPCA 4ECRA 4OIXA 2G8WA 1SL1A 2GWKA 2UV8A 4UB6U 4QYZK 3UKUB 3DC2A 4E3SA 3DHWC 1Y97A 4Z2XA 3MEDA 2DGSA 3OTOJ 4JK9A 4BR2A 1Q78A 3CJRA 3C7NA 2D0AA 1HWKA 2DNPA 3PLAA 1F5BA 4GKKJ 4W5NA 4RQ7A 3OYMA 2PFDA 1JLFB 3TPQA 1ELOA 3F0NA 3S41A 1ED1A 4MEYA 3U6FA 2WF7A 5ALXA 1HR0F 4BROA 2CXYA 1H0HB 4DUYK 4S0MA 3VAGA 4JI6F 1FRMA 4DMZA 1LKYA 3MR6A 2CJ9A 8ICXA 2F7TA 5D15A 4DV0J 4K4YA 3T1YF 1YJNN 1MQ2A 1WELA 2IFXA 4M3WA 1NHVA 1I5OB 2EAPA 5CHGA 1GTEA 1X3MA 1XU4A 4WCEL 3OHRA 4YHHF 1JXLA 4RQ6A 5U47A 2DGZA 2VIHA 1ZBSA 5KFCA 2BCRA 4AD6A 1B92A 3C5GA 2I8EA 2IIRA 3VEVA 3I6PA 2OEHA 3ILIA 4JV2A 3H45C 5DLGA 2D5RA 2UUBK 5CE3A 1O51A 4DR3F 2O01C 2AA4A 3CO9A 1S4EA 4P71A 3K5PA 3MK6A 3AA8A 5D8HB 4FE3A 3EE8A 4I27A 2GO8A 2F76X 3KD3A 4G9BA 3KHLA 4BQZA 4CEZA 1J97A 2MZQA 2WOMB 3UN5A 1R0BG 1N5VA 2D0OA 2J9DE 3CGIA 2ZHAA 1ZQBA 5B0DA 3DJCA 2E7VA 3EGNA 3FZLA 4KLHA 3DGPA 1P90A 2E8MA 4WE1B 4YB7A 1S6PA 2MJNA 1RBTA 2KVQE 4R64A 2RQKA 4BC3A 4NCBA 5J2MB 1W2BR 4KX5A 2KI2A 2XY8A 1BPBA 2IJFA 1KFTA 1GOCA 4DV1J 3KD5E 4BXOB 4IQMA 3IN5A 2ZJ8A 1LVHA 3SJHA 2FPKA 3PR4A 4USWA 3FGVA 3ZNJ1 1NKBA 1RADB 5CABA 3PVXA 4DJBA 4JI0F 3DM2A 4JI1K 1WI6A 2CH5A 2LHTA 8ICCA 4I68A 2KRBA 3AVJA 1ZRNA 1APSA 3WXLA 1OWXA 2IVMA 4KLQA 1RDFA 4FVCA 5ETSA 4DQ8A 2K8GA 1HBOA 3J80Y 1RHUB 4RT2A 2XSFA 1WSHA 4RG8A 3K0SA 3CJTA 3H7HB 1ZM4A 3V1OA 1U0HA 2FJVA 3MCPA 1YZ7A 2W1BA 3DLKB 4I2QA 5G0RA 4BG9A 2E5LK 2E5GA 2CJYB 2YMPA 3A8KA 4Q2MA 3HILA 4Y3CA 2EPIA 5AI8A 5EE9A 4M94A 4F72A 3MN7A 1JXEA 2G2OA 3KKSA 1T6DA 3VR1A 1EJ7L 2EK1A 3FZ2A 3BB5A 4OHZA 3OXLA 4BRFA 4MIAA 1Z4OA 3BSAA 2E1PA 1HHSA 1UZDA 3ZSWA 5JLFA 3SENA 1RU1A 1WG4A 3HT0A 3EW9A 1FJGF 2KG5A 2C1EB 1Q53A 3H6EA 4J9SA 4BC9A 1D4XA 3P6YC 3RG6A 3OTCA 4DV3F 5A8RB 4JYAJ 3MPYA 4V19X 2V8DA 4WFNL 5IWAF 1DGKN 3TA2A 1VSJA 4LQ9A 2DFEA 5J0RA 5JS1A 4FK4A 4BR5A 3N4QA 2XBPA 3DLGA 2FVPA 5BYSA 2FPMA 1U9LA 2QMXA 4QIEA 3BPDA 4PHEA 2ZJPL 3HKWA 5A6WA 2V2ZA 4GO5X 3BBCA 3L3FX 3HHKA 3VQ7A 1RGVA 5J2IA 1RBSA 5HMMA 1ASVA 4CDGA 2K06A 4TYAA 2HHHJ 4ATNA 1UWAA 3B0YA 5ALNA 5DJBA 2HHXA 5DQGA 3QO9A 2ZBQA 2WRMA 2DXEA 4OPAA 4PXBA 1KDHA 2FPHX 3QGIA 3SUNA 2O8BB 4V19S 3OQ2A 5BPLA 4PGXA 1NGEA 3AD7C 2C2RA 2Z7JA 1TR0A 4CZJA 3SMVA 1J5EK 4W92B 1Y7PA 3RMDA 3MPVA 4XA5A 3CMAS 5D3GA 2O8EB 3PG9A 4UB3A 3VQ5A 4A59A 2F4VK 1TV9A 4PH5A 1PG5B 2CQ3A 3ZT1A 2F9TA 1KQKA 4CEQA 2HHQA 1YJVA 4A57A 2UYTA 1E6YB 3VHQA 3ZETA 3KWIA 4I28A 2WVDA 2ZUCA 2F9DA 2KO1A 4CLPA 1WUAA 3RZAA 4CJ5A 3DMJB 5BR8K 3SZ2A 5T41A 3KD1E 4RW8B 1BQXA 4P4PA 9RUBA 3LP2B 5ETTA 1B7YB 1FJEB 5AQQA 5HK4A 3HO1A 3LP3A 2HQ3A 5AJ3J 2W41A 2QKQA 1DKGD 3L7UA 1NOZA 3ZDBA 3L7PA 4CGGA 3TAMA 4FM1A 2O8FA 3J7YU 1S1UB 2Y8YA 3CJ3A 3IR6B 3T5JA 1FX4A 2ZJQQ 1ZBIA 4C80A 5KFSA 4F5PA 3PSTA 2A6MA 1V38A 3ZTOA 1BIUA 3SCLE 5F0UA 3FDSA 3UQSA 3M2UA 3NDKA 3FEZA 3M8PB 3RBDA 2P9PB 5EE1A 3C95A 4OKKA 4WCEQ 5J0XA 1X3NA 3DRRA 2XWXA 4I4BA 5F0WA 3NAIA 1UETA 2R7QA 4LSNB 4NXNF 1H1VA 5JVGL 2YJFA 3KHHA 3JPPA 2PFFB 3MX5A 3QJJA 2Z8QA 1TU0B 4F02A 5A2QY 3DXKA 2QL7B 4K4HA 2W8KA 1UEVA 3MEGB 5ALFA 5DKWA 1N33K 3VQ6A 4P73A 4I7FA 5BR9A 3OSPA 4GC6A 4O3RA 4FWSA 4KE5A 3OYBA 4LF6F 2ZM6F 5KFTA 3F5EA 2HFZA 4CLTA 5C2FA 2PBDA 2AQ0A 3POTA 3QQCD 2CQ1A 2GUIA 3SAGA 5GMDA 3H20A 2HF4A 1ZBHA 1N34J 5IQQA 2DBYA 2QMUB 4LREA 3CCSN 1KAYA 4PGYA 4LRAA 4KPYA 1B4FA 1YIJS 2A5XA 9ICLA 2FY8A 1QQMA 3BP8A 9ICGA 4AT1B 2D1KA 3TOQA 1D9DA 8ICKA 1JMTA 3UW1A 1VQLS 3CB4A 4CD1A 3OGUA 3THXA 3KVGA 5G5GA 3BKFA 1AROP 2OO4A 2YNGB 3P5JA 1W2IA 5AQGA 4FWQA 1MMDA 1S6QA 3TUZC 3JQKA 5D3GB 4B8CA 2O8EA 1ZD2P 1PAEX 3AL0B 2VBWA 4B9SA 2Q1NA 1UWBB 4PR6A 4WK1A 1XJWB 3C16A 3MCNA 5AQIA 4KBOA 4K5SA 3BYPA 4YOUA 4QR0A 4M2YA 3A1YG 4ZVRB 3O3LA 2D3O1 3LAMA 2IVNA 2B0CA 3M8PA 2BCUA 2P9PA 3RH6A 4RW4A 3J8AA 3CCQN 5HVFA 1FNXH 1JB0C 4RKUC 3NP5A 3MGIA 5FPDA 3HVWA 4GVLA 1X4DA 3MPDA 2MQOA 1VSDA 3R5CA 4IO1A 3WT0A 2HBZB 3W2WB 5B08A 2GQQA 1WSJA 2YI1A 4I7FB 3D0PA 2LKZA 3FSIA 3T3FA 3U4LA 3VEOA 4DR3J 2VOOA 5AIAA 1VC5A 2H3VA 5BJRA 3Q83A 1HNZK 1Q8IA 4O0NA 2A1AA 1LQ9A 3OVBA 1T11A 5KFAA 1HWJA 1U0SA 4O44B 3QRQA 2AYEA 3IS9B 3D3CJ 2J7KA 1UPPA 1VQKS 3QEBZ 2JGAA 3CVKA 3MDAA 2I6WA 3FSXA 3I76A 2HVHA 4ZP6A 3RR8A 1X4HA 2G8UA 4I2CA 3VALA 1T9WA 1S4FA 1VOMA 2CPYA 4KJIA 1WG8A 3E9PA 4USAA 2FJAB 2MDAA 3UDEA 1LAWA 2VG7B 4ED4A 1ZQQA 3C46A 3F5TA 2DL0A 3C6AA 4OZ3A 1HR0J 3VCBA 1VHXA 4HI1A 2ZH3A 1UA0A 4CEBA 2HHUA 3GSIA 4FJ9A 1NK0A 3OUYB 4JKHA 1RT6A 4UATA 2VASA 2RDIA 2QEXS 1TL1A 3ZLJA 3P31A 2AYMA 2N82B 1JLQB 3MEDB 4DR6J 1WG1A 3H0MB 2NRHA 3UI3A 3DOLA 1DQAA 1S9FA 3E9OA 3VF6A 2P6UA 3V6JA 2OI2A 3ELHA 1FDDA 1ZXOA 2V67A 2UXDJ 1XSLA 3TFSA 4DR5J 4PJ0U 4F8RA 2COLA 3NCRA 4FNIA 1WSVA 3B4DA 2AJFE 2MUTA 3UE2A 2B7CB 1C6VA 4KLSA 2B5JA 1KQGB 5F3XB 2ZH2A 3THYB 1EQ0A 5C2CA 2ZM6J 3TX0A 4DL5A 2F7VA 5E3QA 2C2MB 3VTHA 2PD1A 1U25A 4BQLA 3GFXA 3K17A 5KT2A 4JKCA 5KFBA 2HOFA 3O4WA 2P9IB 3AVIA 4LRBA 1QHAA 3QAEA 4Z4GA 1PILA 1KLMA 2FC8A 5D0HA 1ZQKA 2HBYB 4DR2F 1HBOB 3OYEA 1NNEA 3DYAB 3I4HX 4YD2A 4NMLA 3VGMA 4DUYJ 2QZ8A 3MECA 3IS9A 1LW2A 2Y0BB 1J9AA 2FBXA 4Q45A 3IAS9 2JZBA 1RWMB 3DRXA 5KT7A 1TV6B 2CQ4A 1YVFA 3CYMA 1TKDA 7ICUA 2DPIA 1C0UA 4FKYA 4CI6A 2CWXA 3PIPL 4OPHA 2DT9A 3WX8A 4B3OA 1PBAA 2JXJA 4NPOA 2P5GA 5KFFA 1VSIA 1VC0A 4BR4A 3HSTB 4KB0A 1ZD5A 1QAJA 3HHEA 3FBBA 2XWYA 3BDPA 5IFMA 2RB7A 5IXUA 2F8TA 1SJ3P 2Z58B 4L8RB 3MDFA 4DQSA 1D8ZA 3DRSA 1FE4A 4LF4F 1J5OB 3JTPA 4O4GB 4J90A 4C0OC 3F41A 3SCIE 1JLQA 4FPAA 5HRNA 9ICUA 3BQ0A 2B4JA 1HYZA 3B54A 5J2NB 4DFKA 2UVVA 2J6SA 1VQSA 4CEEA 3BZQA 4B3SF 1PCAA 3SSRA 3Q86A 4HH0A 3VZHA 1QY7A 2W7AA 1RK8A 3U02A 3QT5A 3OYIA 1U7LA 3DLGB 2IRYA 2L41A 2OAUA 1W97L 3MFHA 2RD5C 3GDXA 2IVYA 1HNVA 3ETOA 2Q36A 3T1YJ 5M1FA 1MWKA 3WDOA 1WKLA 2JNJA 2CGJA 3QWPA 2QWNA 3H1QA 2CFXA 4OGCA 5AT1B 2I2YA 2CZ4A 2QT7A 1T8EA 2JWLA 3V1QA 2G07A 1TKTA 1TL1B 2AJQA 3S1TA 1C4AA 4OHWA 2HVEA 2IOCA 3WEEB 2MKYA 1IBKK 1FF2A 3MF5A 4H5VA 1PK1A 4XQ8A 2WK4A 4BRLA 2P5OA 2CRXA 4I6WA 1TP7A 5F8NA 4I2FA 3KHGA 2WFAA 1FJCA 1SWWA 2OSQA 5KAIU 1S97A 3KWGA 2EZXA 5HRRA 3IG5A 3VMFB 1MN7A 2GS8A 2G8KA 4NB4A 8ICGA 2OELA 4CGJA 4W5TA 3WIUA 3M9NB 2LXIA 2OGUA 3FZHA 1MSWD 4R0EA 4QQBA 4B9LA 4K2JA 2LVWA 3IV6A 2JEGA 1H7XA 3GB0A 4IEIA 1HPZA 1V5IB 2ILYA 4B3OB 3NBPA 4KGKA 3OPKA 2KXHA 3SPYA 1MU2A 2MA1A 4WF9Q 3MX2A 4QIVA 4DHYA 1RZTA 1GLBG 3H2LA 4RW8A 2W2MP 1WHYA 3L3CA 2NPFA 4IEEA 3I0RB 2YNFA 4FJIA 4NA2A 1TL7A 4AFFA 1G1XA 1RM6C 3DYAA 1XNQK 5B66U 3KFUF 2BJ8A 2DPNA 4YOVA 4OX6A 4NCGA 1JCGA 4H4OB 2DKZA 2FMPA 3VQ8A 3M6KA 1ZD4A 4IDKB 2YY3A 2KL8A 2ZKTA 3G82B 2YMLA 2HHPA 4OJHA 1U6BA 4ED3A 3J81j 4JI8F 2IYIA 1EO1A 1ATRA 5B5EU 1IH7A 2E2OA 3MTKA 1S49A 3NGYA 5KAKA 1ITPA 2KM8C 2KJ8A 3AOCA 4DS5A 4MIBA 3EUNA 2NR0A 3DGVA 1R6VA 2HLTA 1AXQA 1ZBTA 4QAGA 3C19A 3EDRB 4Z4CA 2A1BA 1NZ8A 2O8DA 3OPXA 3VQEA 1PVRA 3K5MA 5L46A 3OVNA 4M3XA 2KFYA 5BYQA 1VK8A 3DKDA 1D9FA 4F3OA 2MXYA 3W5XA 4AL6A 8ICTA 3CJ7A 4BWMA 1GT8A 3OFHA 1VR6A 2K4EA 3QERA 4ZN1A 1HMVB 5AQVA 1ZAVA 2OPPA 4NYPA 8ICYA 4ZVEA 2G8VA 3ZT3A 4H5WA 1AUSL 1M90T 2B4UA 3BYRA 5CZ1A 3ENQA 3N97B 3LO3A 2NLWA 4ZN3A 3GCWP 4M04A 2I0XA 3SUOA 4HTLA 4Y2TA 3WK8A 1RT2B 1N5QA 1OVYA 1R3NA 1OJ4A 4RW6B 2UUBJ 3D54A 1U2RA 1Q5YA 2EC0A 4ZPDA 3SJJA 2JVRA 2VC1A 1CZAN 2YNFB 1FDNA 1BWEA 3DXBA 1CJVB 2VQEJ 3IGVA 4JWMA 1T6CA 4PXEA 1QLNA 4BDZA 4AHSA 4JI3F 4IFVA 3OL8A 1ZQWA 1VSLA 2OEKA 2R3VA 2GX8A 2HB5A 1DTQB 3CFRA 1JK9B 3LDPA 4CH1A 2BH1A 2Q79A 3F56A 3NAHA 2ZD1A 2YJEA 3QEIA 1FW6A 4FJLA 1K73T 1COKA 2HIQA 3LP2A 1RDBA 5HJYA 1PKUA 2MMYA 2JWKA 1WWVA 3HX9A 2V68A 5CR0A 3T6BA 2GUPA 2XRIA 1X7VA 1IWAA 3LA0A 2RE1A 4B9QA 3CJ2A 4DR3K 4JOUA 2V9KA 2DH9A 2J76E 2LYHA 4NRTA 5LMUK 4TURA 1VGYA 4B9VA 2ZGYA 3P45B 2A1RA 3TX8A 4CBUA 3EYZA 4JI4K 2QIFA 4P4OA 1LWFB 1P9QC 3IXQA 4C7QA 3V81A 3WZ0A 3WQPA 2DEIA 2YQ1A 3EDQB 2MSSA 2A6OA 1KOOA 4K25A 1V85A 5CJ7A 2HW3A 4BCAA 4ZVOB 2OPQB 2G5IB 3VC8A 3FBFA 1T9VA 3NS1A 5J2QA 1RBUA 4DMNA 3TTCA 1KHVA 4BY9C 3IRXA 2A2DA 1S6QB 1VJ5A 3DNCA 3PR5B 3QU4A 1KQSR 3KOOA 4C0HA 1VQNN 5KPTA 3B9JA 1S59A 2N3OA 3CD6N 1DTQA 3GJRB 4XUSA 1TV6A 3HLUA 4ZPWR 3C16B 3V6HA 2AJ0A 4IS7A 5IT9Y 5HN0A 4I2EA 5HLFA 1VK0A 3TVYA 4PA1A 5AM0A 3CMQA 4IKFA 3C2KA 4CJRA 1UOCA 3AV9A 4DPOA 3D1OA 3CQXA 1FEZA 4CF3A 4BE0A 1IV8A 5AE2A 1U0HB 3M6VA 1RDCA 2UXDK 1ZZNA 4EWTA 4JI6K 4Y2XA 4ALZA 3US5A 4CJVA 4IH5A 4X62F 2A3VA 1GLEG 2DQNB 2HNYB 3TAPA 2XCPA 3CI5A 5LJ5Y 4DTSA 1NGDA 3DRSB 3QLHB 1X42A 5A0LA 3B82A 1KTQA 5KT4A 2BQ3A 1ZQAA 1JLAB 3B4MA 1L3KA 3V6DB 2XY5A 3HPGA 3LDAA 3I8DA 4PG4A 1HKCA 4B3TF 3IBPA 1WJ9A 2G0IA 1NOMA 1ZTTA 1PBUA 4OLOA 3CCRS 4EFHA 4G6VB 2LEBA 1WAJA 3L2QA 5JU5A 4C4RA 3W8PA 1HLWA 4LFCJ 5KFHA 3PKMA 3I31A 4JP8A 5IOLA 2ASPA 5CYMB 1ZPVA 4J9VA 3H59A 3D6MB 2LDYA 1CVJA 3CCEN 1U1KA 1O13A 3TAEA 1ZQXA 1DRGA 8ICPA 5AZJA 1U1MA 1KAXA 4X4PA 2JSXA 2ZQBA 1ASUA 1AQ6A 3KLGB 2WBNA 2CQBA 3L9ZA 2K3IA 1QHTA 3PSFA 4FM0A 4OZ1A 4PL1A 4PPDA 4ID5A 2WF8A 2W43A 4JI5K 1XNRF 1IWGA 3ZDDA 3FCVA 3O9UA 1I94K 2EVZA 4WK3A 3WXJA 4O5BA 1BMQB 1TAQA 5GTHU 3OSNA 3JPTA 2ZE2B 2VQEF 3I4PA 4CLWA 5I4MA 4JI0K 2GIFA 1URJA 3KK1B 1IG8A 3HT3A 4ZTJA 2LEAA 3WXIA 4F4AA 3C66A 3GV7B 3R7NB 2VC0A 2C22A 3NGKA 7ICVA 1Q0NA 3HCXA 2N7YA 3OTBA 3UPQA 2KD1A 2OCEA 1VSKA 5DMRA 1NG9A 4X65K 1NGBA 2FVQA 5T14A 1RT5B 3HHLD 4JWNA 1T9XA 5HMZA 3AVHA 3CCUS 5J8YA 1A76A 4A8QA 1VLOA 4BRDA 3VAMA 3A2FA 1U1LA 2RT3A 2YKNB 3MDQA 3DDHA 1LW0A 2DNZA 2C28A 1RISA 2JEIA 3E66A 1MWQA 1S5ZA 4ZVSB 2GQCA 3PNIA 2ZWPA 3VN5A 4RQ4A 4DL3A 1BA0A 2GJ2A 2P9EA 4CZEA 3BS5A 4ZPAA 2G06A 4NZ0A 3HSDA 5F3ZA 2FJEB 4D3GA 3O08A 4X5VA 5IS2A 2YB1A 1GQEA 4K4GA 3Q8LA 4XPEA 3PEJA 1SB3C 2KJWA 2PDAA 4QS8A 4QJFB 4DR2J 3A8JA 3OTEA 4IOAL 1RT3B 4CF2A 4GKJF 4KRFA 2CPDA 5CEHA 2LYBA 3R3TA 3JTOA 3A5LC 2KP7A 4CZHA 4UB8U 2DWQA 3CP8A 3CQ8A 3UNYA 3WQTA 1RTIB 1ZQJA 4KQZA 4KHQA 1T3QA 1NBWA 3R1LA 3I55N 1CJTA 2AEMA 4Y0FA 3NNCA 1B0XA 2E2PA 1F9HA 3TQ1A 4LUBA 4NXNJ 1FTRA 3AA3A 5HMYA 3T9ZA 3KK3A 3I9V9 4NOHA 5J1EA 1HD1A 3V72A 2RQMA 5HRSA 3DFEA 4TY8B 1YJ9S 3HKZD 2CPFA 4NXNK 3N4WA 2W6KA 1RT6B 4E98A 1VBXA 2A40A 5DRKA 4BGAA 4X4TA 1KP6A 2CG4A 3GIMA 3NRBA 3F53A 1U48A 4A48A 2M88A 4EX6A 4IFYA 1RKJA 1DTTA 1Z1VA 4ID1A 1IKXA 1H2UX 1CI4A 3H4DA 2ZBIA 3MM6A 4H5RA 1G4CA 4XTTA 4HUGA 2CRLA 2OP5A 5GAEI 1NRKA 3T79A 2PEBA 4X62J 4IG3B 4C48A 4OCZA 4LF2A 5AKIA 1QUPA 3JTNA 5G4DA 4CF1A 5ALEA 1VRTA 5C24A 5AQHA 1WLJA 1UA1A 2MB0B 3GIKA 5KGXA 5HP4A 2FGOA 3IBCB 4CO3A 2FZCB 1N5XA 1QS4A 5KL8B 2FUG9 4JD2B 3CD5A 2ATCB 2YBVA 1JXBA 4JI1F 1T3VA 3ZT2A 3BN4A 3C6TA 4RT3A 3JXOA 1Z00A 3H2VE 3Q8YA 5AKZA 2KMDA 4UY8T 1XTZA 3THXB 3WK5A 4I69A 1PJ7A 1UW9A 4ILLA 4CF9A 1YLXA 1R0AB 4YOWA 1DARA 3H8SA 5DM6Q 2H4YB 4PEOA 3E0FA 4WJ3B 5J29A 5KG3A 1IJEB 5DBBA 2FC9A 4IFYB 5HMWA 4EHTA 4NZ7A 1M6YA 3MN5A 3QIPA 5C7PA 2IM2A 2HHSA 3RUBL 2B6GA 1C0GA 4W5OA 5ETLA 4IQXA 3E58A 3E01B 5KI6A 3RH5A 4ELTA 5EOYA 4ILMA 2G2ZA 3CWJA 1XNRJ 4TNOA 3J7A1 4DSLA 5AQUA 1JMSA 1S6PB 3S3MA 3LM2A 4RNFA 1IO2A 2ZIXA 4E7KA 2WW8A 1FHTA 3IBWA 3SBGA 2VWBA 4FZZA 1WEXA 4ZPTR 1L3VA 2DRBA 2LPEA 2F8KA 4CZGA 3CCJN 1KHWA 3CETA 3WK9A 1BOTO 4F50A 4EHUA 4GV9A 4EAHD 3C6UA 4CVNE 5GAHP 5JICA 3CD6S 1U6ZA 2EBEA 3F2BA 3R5BA 1FA0A 3MM6B 3MMCB 1BHLA 5T7LA 4E7IA 3R8YA 3EVOA 5CCLA 4IOCQ 2DNHA 1T05B 4KO0B 2P1JA 3TVKA 4CH7A 1WC3A 5IC4B 2LDIA 4ERDA 3R1HA 4CK2A 5EHHA 3AO4A 1FD2A 4KGXB 1P9YA 3CPWM 2DR7A 8ICAA 2EKNA 2W04A 3QJLA 5AI5A 3KLHA 3DLKA 1HNWF 1NSKL 2E3TA 3QO9B 3IA0A 4GO7X 4OYXA 3GZ7A 2XM3A 4YB1P 5AQKA 1QAIA 2H5JB 4RUHA 1D09B 1Q7YO 2HHWA 5B0FA 5H9EJ 2BGWA 1N6QA 1T95A 3BQTA 7ICHA 5FLXU 4OYMA 2B6AA 2Q43A 1WUDA 3UPFA 5IIIA 2W9BB 4CBWA 4MF2A 4U7CA 2QL5B 3QU2A 1WOPA 1RHRB 2XSJA 1FXDA 2ZUAA 2IMWP 1BNPA 5HHHA 4LRCA 4CF8A 4CRXA 4CJFA 4ZDNA 1HW9A 4M7XA 3NFAA 2EFNA 4KO0A 3AA2A 1WKKA 4O0JA 1V9OA 4NA1A 3MGHA 4MQ3A 2EEYA 7ICPA 3BQ7A 2KQ2A 5DM6L 4QZBA 4JYAK 4HUEA 1WWHA 4OJ1A 3DOKA 2JFDA 2WSCC 4J2DA 4DN0A 2FD2A 1HQEA 4B3RK 1NI3A 3G87A 1RAFB 3PX4A 5HR7A 3RW6A 1YVUA 1FFVA 1JALA 3QEPA 3U3YA 2RMLA 1DEJA 1NK7A 4F36A 1DQ8A 2HBQB 3LF0A 4DWIA 3M05A 3AVKA 1ZH5A 2ZIUB 2EI5A 2E44A 3ZNUA 1NM1A 3EM1A 4TSXA 2GHPA 1XN9A 4YDDB 3NKYA 1YAGA 3NUQA 2I5JB 1TVRB 2DGWA 2FDRA 5J0WA 2W9MA 3EL2A 2XB2D 2JDJA 4A8SA 2EAOA 3CJCA 2I6XA 2XNQA 1VK3A 3CC4N 1ROFA 4GVEA 4CBXA 3VGTA 2Y0SF 2BCQA 4M3RA 2GAHC 3ADAC 4YXJA 2OTLN 4B1WB 1MC8A 3VEZA 4M63A 1BGXT 2CXEA 2VYPA 1YTAA 5M2RA 3QZ7A 1VRUA 1QDUB 3GE1A 5IT0A 4Y65A 1HBNB 4B9UA 2P2CB 1RFQA 5GADP 3ZO7A 4B02A 3J7ZT 3OYLA 4FBTA 2V50A 2WSFC 3CMEN 3MEEA 2EH9A 4FSVA 1WHXA 1ZM2A 4OHVA 3C2MA 3M8QB 1FRXA 4ZCIA 4ECXA 1FIQA 4C2MA 3KLIB 4HT5A 1BA1A 2HWTA 4OKEA 3GG1A 4M6WA 5AQSA 4M5NA 2C3MA 3QU9A 3GYXB 4FZXC 4YR3A 1Q1KA 4C8NA 1RT2A 3BEGB 1FDAA 4UW9A 2E1MC 2CQDA 2RU3A 4Y2QA 2HSZA 4Y2MA 4LD0A 4C4WA 3UR3C 2DD8S 5LSOA 3AVNA 1UT8A 2Q0ZX 5BPCA 4ISEA 1SH2A 1FKAF 1QVGM 5KFIA 8ICLA 2YKNA 3THTA 4RU2A 4BC5A 3V6DA 4KSEB 4QZ9A 4YDUC 2EFVA 4FJGA 4HLBA 1S77D 4PWDA 2ZD1B 4BRPA 1NU0A 2ZH4A 4CYUB 2E7XA 2WTFA 1AFIA 1YJ7A 3J7Z5 1YJUA 2PIIA 2LI6A 4PHAA 3OHBA 3M6WA 4B1VA 5A2QO 2MZJA 8ICHA 2H3GX 3VETA 2XEXA 3WKCA 3CNQP 1LXNA 2D3OR 2HFSA 3P1GA 3EZUA 2RPIA 3M6ZA 4N8OA 1D3WA 2KG1A 5H9EK 3HHNB 3KHRA 3IG8A 2KFZA 3QUTA 5J2PA 4LF1A 3D1HA 1PJ5A 3SIPB 4FXVA 3JAMU 3O1BA 4BS2A 5F3TA 4Q7AA 2UXBK 4RQMA 3QUCA 4IQWA 4MH8A 3FRYA 2HZVA 4DTOA 3DOMB 1SWVA 1VSHA 2HOIA 2IS3A 2HFUA 1RDDA 1AT1B 3R9LA 3BO2A 2FBYA 5KFGA 3M8SA 2FMSA 3U9ZA 1VHIA 2BOAA 2FLNA 1CZ9A 2R7TA 4DPYA 1M5SA 2D0PA 1XS9D 1EARA 1NDPA 2XSJB 4YS2A 3H5YA 9ICPA 1UVIA 1D5AA 4RNHA 3E01A 2A10A 2V8VA 1G2EA 3GLJA 1Y3JA 2OZMA 4JI0J 2W4CA 1CRXA 4QIWD 1F9FA 1JLCA 1REGX 1OUQA 4DPTA 4DV7J 3WQUA 3C14B 3NCPA 1C1AA 1NEEA 1L5UA 2EDUA 1Q81O 5L9NA 2FJXA 4ZCKA 3IUCA 4DV1F 3TANA 1YDLA 4RWWA 1FKOA 2X74A 1CXUA 2PMWA 4HTJA 2GZOA 1FRLA 2AW0A 2CPHA 1BCMA 3IWXA 6AT1B 1Z00B 2BJ9A 3CMAN 3NH2A 2P6TA 4KLLA 3AY9A 2IM0A 2V9WA 4CP5A 4F04B 4OZLA 3F5AA 2JOQA 3P49B 2VG5A 3OL9A 2HVIA 3QEXA 1GLJO 2VL1A 3EY1A 1TAMA 3MR2A 5I3UA 1FRJA 4JBCA 1V97A 4KN7A 3NG8A 3P96A 1B9DA 3O5BA 4OLPA 1VQ8S 4A8KA 2E1YA 4NWIA 4YORA 1L8OA 3HFVA 3QFWA 2HAIA 2ZDPA 2CIMA 3N7RC 2KZ3A 3OFGA 5JMNA 1XO1A 5C5JA 2YWFA 5IV3A 2ZITA 4LSLA 4RQ3A 2AJ4A 2RF2A 2HQIA 3AD9C 4OYOA 5AFUA 3B6BA 3ILLA 1NWKA 2ZJRQ 1HHQA 4YOXA 3P4IA 3DMJA 2J0XA 2J7WA 3TEGA 1DAXA 4CO0A 2F8SA 4TUPA 3PW4A 1WAFA 3IG1A 1Z26A 1PSDA 1CC8A 4LF9K 4OYIA 1V5VA 2B9YA 4KLUA 5GMKa 3E51A 4YNQA 3BREA 1L7PA 1I51B 4IG0A 4B3MJ 2O8FB 3S8SA 4CERA 1X5SA 4FLZA 3CJ5A 4P2MA 2ZBPA 4BR0A 3WK7A 5KQ8A 4FLUA 1SQFA 3FQLA 3SUQA 2EK6A 4NL9C 1F2HA 3DDIA 4FM2A 2RH3A 4C3KA 1PIEA 4LZGA 4KYZA 4F7VA 3WC2A 3V7JA 1H2TZ 1U2VB 2PT0A 3HYFA 4NO7A 4J9QA 4P0PB 2YWKA 3HZGA 4OX7A 4WFAL 1FE0A 1ZQ1C 1M5OC 4C0ZA 4IOAQ 2W40A 3LVWA 2HGLA 4MK7A 1D9AA 1GLCG 1MNEA 3CE8A 1XC3A 5LMNJ 3SXLA 4KLOA 4B3TJ 3GR0A 5CD4H 2RE2A 3AVBA 1RBRA 2QYCA 3KKFA 1Q7LB 2Y1JA 3D4JA 3PX6A 4B3SK 9ICHA 3PW2A 3MM7A 3NNHA 3FMBA 3UB5A 3P5TL 1BI4A 2QKBA 4I2JA 1MG7A 4ELVA 1XEZA 2Z2ZA 5AQFA 3QYYA 3W9IA 2VICA 3G6ES 2JJ4D 3T69A 4JLHA 1XNQJ 3VQQA 1GFWB 4YQWA 1NJZA 3QETA 1QAYA 5F2RA 2IVOA 1C0MA 3HVTB 1JJ2R 4HAIA 5D46A 4QU6A 1BPYA 3HVAA 3BO4A 4OYWA 1MROB 2PA8D 5M1OA 4QR2A 3BGRA 3V6KA 1TK5A 1T4GA 3H40A 4B3MF 4Y28C 2PZSA 1R8HA 3UR0A 1Z4NA 4GXKA 2R8KA 5AK4A 4MKVA 1HNIA 3JPNA 2LA6A 2RSQA 2E20A 2WHOA 4EK2A 4EBCA 4FZYA 4FDFA 4EO6A 2W3RA 3H7IA 3AY0A 1VIOA 3Q7CA 4KLDA 1LAVA 3MBYA 3LP0B 4A4JA 1S1VB 1SPBP 2L9NA 4B1XB 2HRYA 3H2UB 2Y1LB 1VQ7N 3ZCMA 2PMZC 5DB6A 3W65A 3GBTA 5FDLB 4GMJB 3GV5B 4RPZA 2XLIA 4MN4C 2ZJAA 1HPZB 3TSUA 4E7JA 2ZF5O 3G10A 2LQ9A 3B78A 5E41A 2PC6A 4LVNP 3V4IB 2OM6A 1RAIB 2PFOA 1DJ0A 1ILYA 3LGNA 4QZ8A 1ZA1B 4B3MK 2UUCF 3CJAA 4DOAA 3ZSYA 2QXLA 3GIIA 4E7LA 4FJ8A 2HMXA 4QWBA 4M3ZA 2OJ3A 4NEZA 4F71A 4U7BA 4EIAA 2IDOA 5J0OA 2F4FA 3UCGA 2XYPB 1C1BB 4BR7A 9ICJA 2F8EX 4GVBA 4EELA 1GOBA 1FRIA 4IYQA 1HNXK 4NZ6A 1VBYA 3L4QA 2DHXA 5CZXA 4Y1CA 4M5MA 2DR5A 2BE7D 3BKUA 2ZH5A 1K8AO 4HL9A 2QO3A 3IWNC 3CJKA 1YRXA 1NK5A 1Z19A 4PYDA 4MFBA 4Y2JA 2V7YA 1WC4A 5ADZA 1UPMB 5M1NA 5AM1A 2GHVC 2GVDB 1RABB 3FBCA 2EFPA 4C8YA 2QB0B 4HR2A 1X8DA 4Z6CA 2LP4A 3RJJA 3C65A 4OI1A 5AQZA 1DXSA 4LF5F 3IDWA 1YGYA 2DFFA 4RTFD 5H9FK 4UB1A 2CDRB 1OH6A 2DNGA 3UMBA 3QEAZ 2IC3B 4P74A 2QWPA 3DDKA 1YITS 2E88A 1ZQTA 2DTUA 4PRFA 2GMLA 4NYZA 2N4CA 4YG2A 2KRRA 4CQ1A 5FJ4A 3D2FA 2QFJA 3A8YA 3H98A 3UN3A 1C20A 4GC7A 1G6BA 4OJPA 1N48A 1K73O 2G08A 1ACMB 7ICLA 2KKZA 2JZ5A 4FL9A 3L4IA 2KJVA 3Q8UA 3QESA 2XGPA 1Q8BA 1NXIA 3OTOF 3VEYA 2F5GA 3BY5A 1Q9YA 2YX8A 4J9MA 3VEWA 4LJXA 5B0EA 4EX7A 5C42B 4F5RA 1HARA 2DO4A 2RU9A 5D4PA 5CH7B 4DR7F 7ICGA 3U27A 4EI2A 4IRKA 3ZZ0A 4M42A 1LWEA 2MKJA 3M1VA 3QX7A 1TGOA 2QSFA 2RP5A 2BHNA 5JUMA 5J2JA 1N8RO 1YZ6A 1TUVA 4TUQA 4FWKA 2I9SA 3BS9A 4R5PB 4ED1A 1VQKN 3HM9A 4PXCA 2E66A 4AYBD 2OPSA 5LJWA 1OH7A 1QSSA 2LA4A 5GAEU 5J1NA 3MURP 3W60A 3TACB 4M5GA 3GYGA 4JK8A 3SAFA 2UUAF 4DSJA 4F0HA 1XSNA 5C10A 1QVFR 1KQSM 1TYQB 4DPXA 2A42A 4A2BA 2XZTB 3VV2B 3R7BB 4QYZJ 3G25A 3I82A 2JHEA 1KBUA 4BJQA 1UFKA 1K9MO 3BGRB 2CJXB 1UVMA 3FFKB 5K4LA 4LF4K 2HWIA 5LOQA 1BUPA 2P9UB 2QK9A 5DK5A 2NCKL 5C0YA 2QA2A 3TRGA 3VQTA 5LT5A 5LJ3Y 4ICLA 1S5JA 4BRKA 3PKYA 3HSCA 2VQFK 2RRNA 3UCUP 3KJFB 4CEOA 2JEJA 3M4XA 4BRHA 5M2UA 3IAYA 1YHQS 3TWZA 1ZQZA 2B4OA 1PVQA 2DNOA 4GVMA 4O3QA 3CNHA 1LK5A 4EYIB 1ITGA 3R9KA 3A3OB 1SIWB 2ZH8A 2VU5A 3R6GB 3OA9A 1XR5A 3KKRA 1FK9B 2Y9TA 3NH0A 1ZM9A 4FPRA 2RKIB 1OSCA 3TADC 4X62K 1AA1B 4IRCA 1SUQB 1WDTA 2ROGA 5EUHA 5HVGA 4Q0BA 3OS0A 3CCMS 2XMUA 4KGZB 4JK1A 3RJKA 3SDEA 5A8WB 1JLEA 1UP1A 4NLCA 4WFBQ 5FP0A 3M8WA 3EWGA 3N79A 4NLSA 4OLBA 5HHIA 1CJKB 4I29A 4H4MB 3AM9A 4FZVA 2Z1HA 3OJUA 3V9UA 4DL6A 4DV7F 4O5CA 2DXDA 2VBZA 4UTGA 4CHQA 2HBLA 3QT8A 3PCOB 1PYSB 1WF1A 2PXIA 3G6EN 2IOFK 2VV5A 4UZCA 1M5KC 2CN1A 4DQIA 2DGOA 1N33J 4DCJB 2ROEA 3LM9A 4ZA1A 2VKRA 9ATCB 3HVTA 5EN1A 3MWTA 3IFEA 4CJ4A 4FYDA 3M32B 2OZSA 3HK2A 4JV5J 2QN6B 4P52A 4BGBA 4V19J 1CXQA 5KPRA 1O08A 2K2PA 5AXNA 5K8NA 3BO3A 1SZ2A 5C25A 5J0SA 3AO3A 5KFEA 3MUTP 1PUZA 1RT3A 5AXKA 1JX4A 2HRTA 3CIMA 1VRQC 3C2LA 3THPA 4O55A 1OYDA 1HLUA 3UXPA 1E6VA 1X0FA 3E3XA 2MEWA 1F5CA 8ICJA 2ZH9A 3T6JA 3UIQA 2CVEA 4M7YA 1WHWA 4LT6A 2W55A 5BRFA 5BPMA 1YJTA 1RU2A 9ICEA 5EX3A 2CNKB 2J8AA 1N36F 3K7RA 1GX5A 1PJ6A 4F4YA 5AQTA 4JI5F 1K5OA 4K8XA 3AAWB 4KH6A 1LWCB 5HL7Q 1EKSA 2EBGA 4I9QA 4WU2A 2BKPA 3QU5A 3ZZZA 2BE2A 2F1FA 3BKTA 5AQLA 4OHXA 5AM4A 4E2FB 1HIYA 1FK9A 2V94A 2Q0RA 3Q0AA 1ZS6A 4DX7A 4H0PA 3AJDA 1KD1O 2O4GA 3TA1A 2NREA 5KFRA 1PYTA 3MPUB 3B6PA 4LF6J 1X5TA 1BO5O 4URGA 1Y88A 1OQ3A 1QE1B 4CO5A 3Q8PB 4Q2LA 3EE3A 4Z4FA 3UMCA 2F4VJ 3GZFA 4QBUA 1U2CA 2K8AA 1ZBUA 5F9LA 3WX4A 2W9CB 2R7WA 5AKKA 5LMNF 4HI2A 2P9KB 2WONB 3H90A 3MI7X 1T7PA 3UXNA 4O3SA 3PIOL 2NQPA 3H5UA 2CYYA 4JI7K 2OHFA 3FC4A 1QD1A 3GCXP 3EXCX 4HDHA 3LK9A 4NYNA 4L3NA 1SIJA 1O8BA 3FFIA 2AGPA 4P0QA 1W7WA 3AO2A 3OBWA 4J2AA 4F25A 3ISBA 2FJDB 1HJOA 3HI9A 2KSOB 1DT9A 2OTLS 2DGQA 1SI9A 3CM5A 8ICRA 1TKXB 4NLGA 4BXOA 2FGCA 3AQOA 5IC6B 4P2FA 5L1JA 4YMMA 3ZZRA 3C23A 4NLVA 4K41A 3AOBA 4DU8A 1FEEA 1N54B 3CCES 1JWWA 3E9LA 3C7NB 2E5HA 1RDAA 2F8MA 1S7HA 3TU5A 2RN2A 1GO3F 1Q4RA 4BDPA 3Q24A 1RT1B 3G2XA 3RR7A 1AZSA 5FD1A 5AZIB 2Q2RA 3MABA 3L4PA 3AXKA 3OXFA 1WORA 1RNHA 4Q43A 3LZIA 4OYPA 1YSJA 3SI8A 2ASYA 4CDIA 3N7SC 2JWNA 1AFJA 1EXNA 3DRRB 4ANCA 4CLUA 2R2UA 3D7EO 3TP2A 1FERA 4RQ8A 1MQ3A 3MAQA 1NMDA 5J2FA 2CA9A 2E1RA 3VQCA 2BXJA 2X1AA 2FQQB 2HRUA 3I0SB 3CJKB 1ZTWA 4LF9J 3JSBA 4OI3A 4OYBA 3I28A 2QWLA 2RF2B 4M6WB 3K8VA 1F2GA 4JS5A 2QI2A 4AYBF 4Z94A 2UVRA 2OMOA 4P0PA 3KUHA 7ICFA 2WB1D 4PL7A 1YBAA 1ZRMA 1OY6A 4RCHA 5KT5A 1DFDA 4X65F 5K8PA 2QARA 2J0QD 2KV2A 4NI2B 2BA9A 1Z05A 3AJ1A 2BDUA 3TJ8A 1MWMA 2ALZA 5B0AA 2OWOA 4RW7A 3W1YC 2Q3PA 2BV3A 4I6YA 3O3GA 4CTAB 3RMAA 3NEKA 1V6HA 3D0HE 3GL1A 4DQPA 2QWRA 1Z6RA 1OPIA 3QJPA 4MJKA 5ETPA 3GJSB 3NF8A 3THVA 3OLBA 4FWOA 3U3GA 3UD5A 4RLEA 1GMWD 2B43A 4FXWA 2K60A 3NAEA 5MAOA 1VBZA 1XMQJ 4GKJJ 2VB6A 1U1NA 1N2XA 3ENOA 5K20B 3BF3A 4NEYA 3DI6B 5AJ3K 1VRTB 2V4QA 2VFRA 4N7TA 2MQPA 2YNIA 2QG9B 1OY9A 4M9LA 2B9XA 1GLAG 3KJNB 1T9YA 5BN9A 2GFFA 3CM6A 1SZPA 3E2EA 3R5GA 7ICRA 3AVGA 3C6TB 9ICRA 2QC3A 4CJTA 1RQ0A 5KFKA 4CO2A 1EP4B 4MO5A 4DL4A 4DCPB 2DRDA 2BZ2A 4FYWB 3UMGA 2W4PA 1H6KX 4DEZA 4E1JA 1WUUA 5B7WA 1S22A 4MT1A 2P9GA 3MGJA 2J6UA 4CZMA 3VQ4A 2P9LA 1RA6A 1RTJB 5AXMA 1BQMB 4JI3K 2IPOB 4XEIA 4CGHA 5HATA 1T03A 1U1OA 4ILJA 1HUXA 2W42A 5IILA 4US8A 2NYVA 2QB1A 2J8SA 5F8IA 4JEPA 4FZLA 4M5JA 4FJHA 4EBEA 2GBZA 8ICNA 1S3XA 1N5YA 4DV3K 3T1YK 3DRPA 2YX1A 2HMIA 3SLCA 3ULDA 4P75A 4IBNA 4NLKA 1NJIO 1NSPA 4CIGA 4UOHA 2PGCA 2SXLA 1Q81T 2OFGX 1B43A 2HBJA 4BE1A 3ISZA 2I7PA 1H72C 4DCCA 3OTOK 2XTJP 3DDNA 4UY85 3G6YA 1K6YA 2RHQB 4WPAA 4CF0A 3P5BP 3N4PA 5AI0A 1N62A 3EZOA 1RTZA 5DZ6A 4FWLA 1QM9A 1BNOA 1VQPN 4U9RA 2AZ3A 4TXSA 2V8PA 1IBCB 3KG0A 3VA0A 3OR1A 4ILRA 3HBTA 3S01A 2BANB 1S48A 5KG4A 2WAQF 2ZM6K 5DDYA 4RW9A 1X0PA 2VWKA 1KQFB 1P27B 4RBVA 5AQYA 4UF4A 4AP9A 4Y1DA 4FK2A 4PWWA 1GMVA 3MWPA 4KH5A 3QGPA 2AF6A 1N5YB 2ACMA 2H5IB 3HRDD 1I39A 2DXFA 1QVFM 2KHQA 3KXDA 1R6YA 4MYTA 4CEAA 3DU5A 3GFYA 2PN6A 1N34F 2YX7A 2NXCA 5GINA 4B3RF 3BH7B 4QW8A 5DDRC 4DUZF 3QBWA 3N28A 3SSQA 2VUGA 1S1WB 3ONQA 5EU7A 2ZBRA 1K8KA 5ALTA 4CLLA 1FFWB 1QQNA 4DTNA 1Z4UA 2C2KB 4B9TA 3HJFA 1VBKA 2JLFA 4NX9A 3CJ0A 1ZQIA 3K0JA 1W26A 3W9HA 3RB3A 2M7SA 3I0SA 4DR1J 4ID8A 4Y2CA 3DV9A 4CIOA 8ICIA 3MM8A 3VGKA 2Q4TA 3EPIA 4C8OA 5H1SQ 3LANA 1NPRA 3T19A 3DLHA 1KC8O 3M6UA 4JK7A 2AGOA 4IC9A 5J2KA 4Z7CA 4F4WA 4O5FA 3HWTA 2JV3A 3IBFB 1SL2A 1FCAA 4MYUA 2QMWA 1RLDA 5J1EB 4E7HA 1X9SA 4MK9A 3CJ1A 1XERA 3TWHA 3DOKB 3T1HF 3GDQA 4BDYA 4LF7K 1VQ9N 3M2RB 4E8UA 2Z1GA 1FXRA 1BU6O 4LMZA 3ITHB 3AH6A 3W2VB 3RVCA 3OYNA 2PI5A 2J9DA 3K1ZA 1F6TA 3FZKA 2XYGB 3C29A 4B9NA 5KFXA 2IM3A 4WXOA 4AQYK 5BOMA 3NMRA 5AJ3F 4DUZJ 3O44A 5ADXH 3OL7A 4CH0S 4FWNA 2GELA 3CCUN 5IM0B 3M3ZA 1BVSA 2A3JA 5DB9A 3AQEA 1HJPA 2CJAA 4GKKF 1NZAA 2MKSA 3TVZA 3MOJB 3TAQA 3C1YA 3W3SA 3K8WA 1S7IA 1HR0K 2G1DA 3ZTPA 4UQTA 3CFPA 3MR7A 4M5IA 2BMBA 4H4KC 4BG8A 1OIAA 2O66A 3JPQA 2P5VA 4L72B 3FMWA 3J80O 3B0XA 2QA4N 4M5LA 2ZHOA 4TU9A 1FFSB 3VESA 3DGPB 8ICUA 4XIUA 3JSYA 4UZBA 3GMGA 4J9OA 5KG2A 4Z6DA 3KUGA 4KIAA 3ALRA 4G1PA 3M30B 5D49A 1SJFA 2DNYA 2D0CA 1S1VA 1HYVA 3AXMA 5AM5A 4AUKA 4DU4A 5KFPA 4QCLA 3ZTSA 1RUSA 4P2HA 4LZDA 4RW9B 1Q3VA 1ZD3A 2FMQA 4HYKA 1W0HA 4YN3B 3GP9A 1R7IA 4KLJA 1FTCA 2F8LA 2JC0A 4WFNQ 3AO1A 3FYHA 5FRNA 1SL0A 4O3MA 1SXEA 2UXBF 5A2QU 3M5RA 4DPUA 4GMKA 4UUWA 2XIDA 2K89A 1DLOB 1Q7YT 2FBVA 2OD4A 4DZDA 2ZIVA 7ICSA 2BKOA 1UL3A 4YVZA 2AXTU 1UMJA 3CHWA 2MLYA 4I6AA 4DR4F