4F2SA

Dna polymerase i large fragment complex 4
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
578
structure length
578
Chain Sequence
MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 199
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2sA01
3EWAA 3HPGA 3OVNA 1ZJMA 2RN2A 2NRXA 3G10A 7ICJA 5KG1A 2XCAA 2H5XA 4KITB 9ICTA 3VQEA 4O3NA 3H4DA 2F8TA 1KEJA 3ZSOA 1RILA 3AO1A 5IIKA 1RXVA 4LD0A 5KT2A 1XU4A 2X78A 5J0WA 1EXQA 3TARA 4KN7A 8ICBA 3SQ2A 3NF7A 3VN5A 3AU6A 4F3TA 5F9LA 3JPQA 3DRRA 1RPLA 4G3IA 4W5NA 3AVGA 2ZUDA 4YMOA 1A77A 4TUPA 1XC9A 1UA1A 3MEEA 2NRZA 1ZQFA 1VSHA 1JXEA 2BDPA 4FLVA 3GV5B 3DLBA 4P2HA 3S3MA 4DLEA 4IRKA 1RTDA 2PI4A 3VQQA 4CFDA 2XC9A 4QCLA 4J9QA 8ICCA 3MABA 3T3FA 2IHMA 1S76D 4B9UA 3HYFA 3ZT2A 1X9WA 2GUIA 2O4IA 3SUNA 4C8KA 3HO1A 9ICJA 3TFSA 4ID5A 4CJUA 3LP2A 1T4GA 5KT5A 4LZGA 1C0MA 3PY8A 1Z26A 3ETLA 2OPRA 1NKBA 3KTQA 1HYZA 5J2DA 1JIHA 4HTUA 9ICXA 2ASLA 4OLBA 4AHRA 1IKVA 4GXIA 3OS2A 3IAYA 4E7HA 1WNSA 4GC7A 5C42A 4CIFA 3MR5A 3IHQB 3UQ0A 4DS4A 1RT6A 4DTNA 4QW8A 1NK5A 2WTFA 4F4KA 5CYQA 3IG1A 3CFPA 4QWCA 5KG2A 2BQ3A 4DU3A 4DF8A 1QLNA 3U3GA 2BCRA 4ZTFA 9ICGA 3M9NB 4RNMA 3QIOA 4F93B 5KFXA 3K75D 3ZDCA 4RQ4A 5KFSA 4I2DA 4HUEA 3TAEA 2P5OA 4FXDA 8ICKA 1RTJA 4BDYA 1WCLA 3NF8A 4O3SA 9ICWA 4YNQA 1BL3A 2ETJA 4OKKA 2ISOA 5FROA 2IS3A 3JPPA 3C1ZA 5DB9A 2MUTA 1Z25A 3B0YA 2HHUA 2VA3A 3OYCA 2IAJA 5KFTA 2VA2A 4I2AA 3HVTA 2W9BA 4FLZA 9ICPA 3DLGA 4FLWA 5IIIA 4MEYA 4RT3A 4Q44A 4O0IA 4J9SA 4B9NA 2UVUA 3S3NA 2XGQA 4MFFA 2BPGA 2WONA 1Q9YA 2JGUA 5J1EA 4OPJA 5KFUA 3SQ0A 3H8SA 3NBPA 5KT3A 4QZBA 5KT6A 2PFOA 3LAKA 4QWDA 8ICXA 1ZQJA 1BPYA 3QEIA 3RRHA 4RW7A 4FLYA 1MQ3A 2FPMA 1D9FA 3UXNA 1BVSA 1JL2A 1GOAA 2HNDA 4FJNA 3L2VA 5DLFA 1JLFA 4LH5A 4B9VA 4KFBA 2HNZA 4CEOA 3CG7A 4F5QA 1CXUA 1ZQZA 4BGDA 3GILA 3VQ6A 4FCYA 3G6XA 1C6VA 3O3GA 2RDJA 3OYAA 2HHQA 2R8IA 1JX4A 3TAQA 5CYMA 4HUGA 1KLNA 5J2FA 3JYTA 4B9MA 4DO9A 1UT8A 1KFSA 4J2EA 5DQHA 1LV5A 3VA0A 4XIUA 4JS5A 1ZBUA 2FC0A 3ZD9A 3HJFA 4FW2A 3N97B 1VSJA 2KFNA 4CJ5A 2ZTEA 4Q8EA 3GDXA 4M0AA 4JK1A 4DQRA 4PGYA 2ISPA 5DDYA 4OGCA 1MU2A 4YR3A 2G8HA 3K58A 5J2IA 4TURA 4CJPA 2J6SA 4CEBA 2LSNA 2D0CA 4R65A 2ZJ8A 3DLKA 3PUFA 8ICLA 1HUOA 3A2FA 3AO3A 5DB6A 1QTMA 2XO7A 3I8DA 3GQCA 3QEBZ 3PNCA 1ZBLA 2HHVA 3JPTA 2D0AA 5C5JA 1XI1A 2GWSA 2R8GA 3EW9A 4J2BA 7ICMA 3QEWA 3RB3A 4KLSA 3NF9A 2BGWA 4Z4HA 5KT4A 4E0DA 4DU4A 2HHWA 1QE1A 4YFKA 1L3VA 1V9PA 4OPKA 4Z4EA 1HYVA 2RKIA 5J2EA 5KRSA 1SKSA 4PGXA 4DSEA 4R66A 2P66A 2AGQA 4LSLA 5KG0A 3HP6A 3QZ8A 2O4GA 2G8KA 4DL7A 4CEFA 2KW4A 3O3HA 9ICKA 2ZD1A 5HMLA 1LB2B 1HNIA 1VSIA 4Z4CA 1C1AA 5KFDA 3VQ4A 4CGHA 2JEGA 4K4HA 3SV4A 4RQ2A 1JLBA 4OLAA 1S6PA 5T7BA 4HUFA 1W0HA 1WSFA 5J29A 3TI0A 1FKOA 4JV2A 3RJKA 2ALZA 1BQMA 3OS1A 1IKXA 2YNHA 1IH7A 3VA3A 4Q8FA 2GBZA 2JZBA 1SKWA 4I29A 8ICQA 3SI6A 4RQ1A 1IO2A 1J9AA 4BWMA 2F96A 4CF1A 3RMAA 4XRHA 3DOKA 4FJXA 3K5OA 3PX0A 1ZQTA 4QAGA 1BIZA 3LP0A 5L1KA 4FJGA 1RT3A 5DB7A 4FJMA 3OYFA 2XRIA 2ZQBA 4KTQA 4FW1A 3RBDA 2E4LA 1ZQVA 5HLFA 3UQ2A 7ICRA 3ZCMA 1DGSA 4IQTA 3TABA 3GFKB 1ZETA 3RWUA 4KLHA 4O3QA 3NCIA 5KFGA 1ZQKA 2PZSA 3H8JA 4CGFA 2KZ3A 4Z4IA 4BXOB 3NDKA 3L2RA 4PH5A 3NAEA 9ICFA 1DTTA 2ASDA 4YR2A 3LK9A 2DFFA 4FS2A 4MFCA 1L5UA 3DRPA 4UAYA 3TFRA 1RT5A 3LANA 1ZQOA 3ITHA 9ICAA 3JPSA 2JEFA 2HNYA 4E7IA 1UWBA 4FZXC 3AA5X 2R8JA 2BR0A 5IILA 2ZE2A 2PFNA 3H8WA 2VA8A 1RDAA 3AUOA 4DEZA 1RCHA 3NE6A 2NUBA 3OYIA 2V4RA 2P6UA 5L1JA 2Q3SA 3C23A 4AHTA 2OZMA 4FK4A 4DFPA 3DMJA 4FK2A 4MFAA 4MF8A 3HPOA 5HP4A 4HCBA 5L1IA 1RDBA 3LP1A 2NRWA 4B9SA 1LWEA 3NH2A 1S0NA 4CHPA 4PHPA 4ECSA 1HMVA 3K5LA 1XHXA 1RTHA 1TKDA 4KLGA 1S0OA 4CGGA 8ICNA 2BCUA 4Q45A 1EKEA 4B9LA 2G8WA 1XSPA 5CY4A 3T5KA 1TL1A 4DSIA 3NGIA 4YN4A 5J0QA 3UIQA 7ICHA 4ZTJA 3MR3A 4LVSA 3M9OB 1BI4B 2Z1GA 2P1JA 3LDSA 2F8SA 2UVVA 3TANA 3K59A 5FDLA 3RMCA 4H4MA 4E89A 3MECA 2G8IA 2J6UA 1COOA 4J9PA 4OVLA 5HRPA 5J0PA 5J0RA 3O3FA 4DL3A 2BANA 1DTQA 4KLDA 5IIOA 3LZJA 1S97A 3CQ8A 1Q8IA 3CFRA 3ULDA 2PI5A 1ZQWA 4DS5A 3MAQA 4R8UA 3O4NA 3L8BA 3I0RA 3TQ1A 3RH6A 4DTMA 2XHBA 1JLEA 4RQ8A 4XUSA 5KFAA 4F4XA 2BKEA 4BDPA 4KLEA 4KB1A 5J2QA 4L8RB 1L3TA 8ICRA 1RBRA 4O55A 2HHXA 3PW2A 1RBSA 2KTQA 1MC8A 5HRSA 1Z00A 4KN4A 2UVRA 4UAZA 1NOYA 4YD1A 3M8QA 4FVMA 3P1GA 4FBTA 3RAXA 4ED0A 4RPYA 2ATQA 4CJQA 1HPZA 4JWMA 5FRNA 1TL3A 2AQ4A 3AV9A 4TQSA 3FDSA 4CF8A 4AHUA 1S0MA 3G6YA 3V81A 5J2AA 5D49A 2JLEA 4KLMA 3GIKA 4MFBA 3PR4A 2FBVA 5DBAA 3OYGA 1ZQIA 2WOMA 3K5NA 3NGYA 1NJZA 4FM0A 4DMNA 5DMRA 4F3OA 3ZT3A 1UT5A 4YR0A 1ZQSA 4QWAA 1CEZA 1VSEA 3BGRA 4CEQA 1KVCA 4FM1A 4KI4A 5BPCA 3K2PA 3KLEA 3OY9A 3Q8KA 3ISBA 3B0XA 4RW9A 4ID1A 3PW5A 3WNFA 4CHNA 3QIPA 4O5KA 3Q8PB 2VG7A 3Q8QB 3H7IA 9ICLA 3VQ5A 4QW9A 3WNEA 1NK4A 3LWMA 4QWEA 4UB3A 2R7YA 1QHTA 4GW6A 1ASUA 5FRMA 5EWEA 5KFPA 2YNFA 2FPLA 3CM6A 2BCQA 3RJGA 3PV8A 1JL1A 3OYHA 2PXIA 4F4YA 3C5GA 3AVMA 3QEAZ 4XQ8A 2OZSA 4PGQA 3ZD8A 3D45A 5J2MA 4DTUA 5F9NA 2FPKA 4OJRA 4M47A 1ZQBA 3SPYA 4FJHA 2B6AA 3C2KA 4FLTA 3U3YA 3T19A 5DBBA 4BE1A 1WCNA 4DL6A 4JS4A 3NGZA 1SZPA 5D46A 3GIMA 1HUZA 1U48A 4PQUA 4Z6FA 3ISCA 4F5OA 2PFQA 4DQPA 3RH5A 4M2YA 4N5SA 5DBCA 5KG4A 1T05A 3ZDAA 3DLHA 4GC6A 2VWJA 4TUSA 3V4IA 4CHQA 4ECWA 1XS9D 5J0TA 1IM4A 1NK0A 4G1QA 4EP4A 4DL2A 4F5RA 4XA5A 1TAUA 3UXOA 3ZT0A 3AU2A 3VQ7A 4I2CA 4OGEA 2OPQA 3MFHA 1BPBA 5DQGA 1I39A 3C2LA 2KZZA 1T3NA 4CF2A 1G15A 4IFYA 4J2AA 4QZHA 4E19A 7ICOA 3PO5A 3PX6A 4ED1A 4DG1A 3AO4A 1TK5A 1QSYA 2FMPA 4CK3A 3AO2A 5C25A 1Z3EB 3MGHA 1XO1A 1ZQLA 8ICGA 3EPIA 4ECXA 3Q8MA 2DFHA 5KG3A 4CJVA 1X2IA 4F50A 3LP3A 2F1IA 4UBCA 4NM1A 1U49A 4IRCA 5KG6A 2YNGA 5TZVA 5KFKA 4NCGA 2QKBA 1QQCA 3BQ0A 7ICQA 5C24A 3C6TA 4DL5A 2QXFA 5K14A 5HRRA 3VQBA 5D4BA 4KB0A 3V7LA 4DTSA 4CERA 4IDKA 4JUZA 4QZDA 3MDAA 2DFEA 4QZAA 5HHIA 5J0YA 4Z6CA 2VG5A 1FXXA 4NYNA 3AA4A 1SKRA 3ZSRA 4FZZA 4BACA 4CEAA 3MFIA 2W8LA 4J9OA 4R8UB 5KFEA 4AH9A 1YT3A 3C1YA 1JMSA 4J9LA 4HHTA 3NGDA 3JPOA 4RUCA 4DSLA 3QNNA 4RQ0A 5D3GA 3HXMA 5KFOA 4CF0A 2EX3A 9ICOA 4QZEA 4F4WA 5HNKA 4X5VA 1BPZA 4M04A 3RTVA 3WNHA 4IG0A 2KZMA 4O5CA 1YVUA 2AJQA 4I7FA 2G8VA 4FZYA 4CESA 4Z0UA 4JRQA 1ZQGA 3TAGA 1I3AA 9ICUA 5CP2A 5EWGA 4NLKA 4FM2A 3KLIA 2QK9A 9ICEA 1ZBFA 1T03A 4F2SA 2GV9A 7ICUA 5I3UA 3VQCA 4ELVA 5J2KA 1RXWA 1RNHA 2IHNA 2I5JA 1S0VA 2W9BB 3KKRA 2IBKA 2HMIA 3ZSQA 4W5QA 7ICIA 3PVXA 3PW7A 3AVKA 3V9SA 3DM2A 4IR1A 5J2NA 4QZ8A 1JLGA 1TAQA 3D0PA 4O3OA 3SZ2A 3JPNA 5EWFA 1ZYQA 3TWHA 4QZGA 5KGWA 3V7KA 5KFWA 4PHAA 4FJIA 2BE2A 3HSTB 1XSLA 1S9GA 1RT2A 3MGIA 2W9CB 1L3SA 2C22A 1XSNA 3TAFA 2FMQA 4GLXA 5HHHA 4CIEA 4IBNA 4KLFA 4M41A 5J2BA 3HM9A 2FBXA 4HVJA 3VQDA 1S9FA 5KTQA 1EXNA 3RB6A 1TKZA 2I1QA 1ZQCA 2DPIA 3V6HA 2FLNA 4DTRA 2DTUA 1A5WA 3MXMA 1U47A 3OS0A 1ZBIA 4RW6A 1HQEA 3ZT4A 4O5EA 1WSHA 3MR2A 8ICIA 3HW8A 3ASMA 4UAWA 3Q8RB 4NYFA 3RBEA 4ECZA 3FYHA 4NY8A 2B5JA 3KLFA 3ZSYA 1DOQA 4QZ9A 4RPZA 3BQ2A 4F8RA 4ED6A 1VK0A 5KFMA 2W42A 3KK2A 1SL1A 3B6PA 4M42A 2A1RA 2Y1JA 2W9MA 1X9MA 4CCHA 3LPTA 2AQ0A 3HK2A 3ZSVA 1KSPA 2A1JB 2JEIA 2C2RA 2F1JA 7ICTA 1TV9A 3CM5A 4ED8A 2VG6A 4I2PA 4RG8A 4CJSA 4ELTA 4OKEA 2BCSA 5KFJA 1LAWA 1MSWD 4PUOA 4CHYA 3RJHA 3V1OA 4PPXA 3C94A 3EY1A 1VRTA 3KHHA 3OYBA 3OYMA 1ZQUA 4RU9A 1C1CA 3C2MA 2YKNA 5J2GA 3RJEA 1ZQPA 4I2BA 1C7YA 1C0TA 5SZTA 5HROA 1QSSA 4RQ7A 1ZQYA 5I42A 3JPRA 4DTJA 1QSLA 3KD1E 3SJJA 5KFHA 4FJKA 3OYEA 4O5BA 1B9DA 4I2QA 4ECVA 1WSJA 4YFUA 4KLTA 3E01A 5KFNA 4EZ9A 3CYMA 5CJ7A 3OJSA 2XY5A 3ISDA 3LDAA 2E6LA 4RW4A 1FKPA 2ZUBA 1S9EA 1D8YA 4TUQA 3O4QA 3HX0A 4DU1A 4I2HA 9ICIA 1NKEA 4YVZA 1RDDA 3LALA 2ATLA 1ZQQA 4W5RA 1VSLA 7ICNA 3OYJA 4B3OA 1EP4A 4ZH4A 7ICEA 4CJFA 3ZDEA 3V6KA 1HQUA 4PHEA 3MXJA 1RT7A 5CB1A 2RDIA 4JV1A 2Q0ZX 2C28A 4CGJA 2P6RA 3F73A 2KN7A 7ICKA 4N41A 8ICHA 4EBEA 3ZSWA 4NCBA 1VSDA 4JRPA 3PX4A 1FK9A 3ZSZA 1NK7A 4P4MA 2DY4A 4KV8A 4I2FA 1WSGA 5J2JA 7ICGA 4ECQA 5KFRA 5CWRA 1PZNA 5BOLA 3RJFA 1WLJA 4E7KA 4DOBA 3MXIA 3BQ1A 4DL4A 1R0AA 4DOAA 2IGIA 4IQWA 1ZQXA 4ECYA 2XCPA 3TAPA 1IXRA 4KLUA 4Z4GA 1ZQDA 1CZBA 1VSFA 1WSIA 5DG9A 3KLHA 4Q43A 2ZJAA 5KT7A 8ICPA 3EPGA 4BXOA 4M9GA 4M9JA 2NRVA 3KK3A 8ICVA 4KREA 2E6MA 1NJWA 5J0OA 1AROP 4P4PA 4EP5A 4Z4FA 4LH4A 1K1QA 1BCMA 4ECRA 1WAJA 4NLGA 4JWNA 3BJYA 4P4OA 3DLEA 1WSEA 4DWIA 1RBUA 1TVRA 4F2RA 4K4IA 5JUMA 4YXMA 1IKYA 4N76A 4DSKA 3AO5A 4MQ3A 2ZUCA 2D5RA 4O4GA 3TR8A 3HWTA 4Y1DA 1ZBHA 3KHRA 4QZFA 2KFZA 1JKHA 1CUKA 4W5TA 4E7JA 5EOZA 3OYNA 4ZHRA 4EBCA 3OSNA 4DFMA 4M6WA 3M9MB 3THVA 4IRDA 1D9DA 2UVWA 1F21A 2PYLA 1ZQAA 1KFDA 2X74A 3KD5E 4ED3A 3KKSA 4DFKA 9ICSA 1Y88A 3KJVA 3LZIA 1A5XA 5KFYA 3P5JA 3M8PA 2ZTCA 3H08A 4F5PA 4H4OA 4KO0A 3SQ4A 4I28A 4FLXA 4EBDA 4DOCA 9ICVA 1U04A 4IQVA 3QO9A 3RB0A 3AVNA 1KLMA 4IQUA 4GXJA 4M3XA 2DPJA 4M3RA 3SUQA 3L2WA 3T5HA 1ZQEA 1BPDA 2MUTB 3KLGA 4M3YA 1WAFA 1SL0A 4YMMA 4RQ6A 1RBVA 3BDPA 1BI4A 4I2GA 1N5YA 4UB2A 3GIJA 4F5NA 1BCOA 1HNVA 4C8MA 3DRSA 1HRHA 3S3OA 4KI6A 3L3VA 2G8FA 1TK8A 3RB4A 3H4BA 1EETA 4RNOA 1D8LA 3V7JA 1H38A 1U4BA 3C5FA 5DG7A 4M3UA 1KRPA 4CFBA 4FK0A 4PY5A 1S6QA 4DQQA 3Q8SB 1ITGA 3HL8A 4YD2A 1NJYA 8ICFA 4YP3A 8ICEA 2OPPA 5KRTA 2NRTA 5J0UA 1T8EA 1L3UA 9ICHA 3C95A 4FJLA 2V9WA 2IC3A 4RZRA 4IFVA 3VQPA 4RW8A 3NH0A 1RT1A 3OYLA 1VSKA 1UA0A 2A1SA 3LPUA 1MQ2A 4NXZA 1RZTA 3OYDA 1NK6A 4FBUA 4E1MA 5HMMA 3Q8LA 1C0UA 5CHGA 1JXLA 4N56A 1W9HA 2ZJ5A 3RJIA 5KI6A 3N4MB 1YTAA 4FLUA 1KDHA 4N47A 1N56A 1LW2A 3V1RA 2XY8A 4CJ3A 1QS4A 2ITGA 2EHGA 3F9KA 4RT2A 3C21A 1S1UA 2V4QA 4KTZA 4C8OA 5DLGA 1JLCA 4PA1A 3AVLA 5KG7A 3QESA 4M9HA 4O9MA 1ZQRA 2AGPA 2OWOA 4RQ5A 4UBBA 1BPXA 4DLGA 4M3TA 2R8KA 4K8ZA 1N48A 9ICQA 3HVRA 3C6UA 3K4GA 3S9HA 2PFPA 7ICVA 4CJLA 2B4JA 3SCXA 2FBYA 4CJEA 4F4ZA 3M8SA 1HYSA 3AA3A 3V9XA 4JV0A 2X6NA 1BQNA 1J53A 4E1NA 1JN3A 3K57A 2ZTDA 4Q5VA 2P5GA 1TV6A 4JLHA 4J2DA 4CEZA 1U45A 3AVHA 4PHDA 5CZ2A 2M9NA 3IS9A 5HBMA 4C8NA 3EYZA 3HP9A 4CIGA 3I0SA 1TVAA 9ICNA 2IMWP 2YV0X 3E2EA 3ISNC 3SQ1A 3ALYA 4KKOA 5EU7A 5SWMA 4E3SA 5IIMA 5KFZA 1RDCA 2P51A 1KVAA 4M9LA 2R8HA 3TAMA 8ICSA 5J2CA 4CJ4A 5KFQA 2C2DA 4AHVA 1B9FA 3OGUA 4EYHB 2VWKA 1TKTA 4KLOA 4Y1CA 4UQGA 1LW0A 4YMNA 5L9XA 4MEXA 3V9ZA 1Z00B 4EEYA 3H40A 1ZQHA 1LAVA 4F92B 1KVBA 1UOCA 3WNGA 2HB5A 4IG3A 3DI6A 5KG5A 1GOBA 3SI8A 2KQ2A 4QZIA 2YNIA 2W8KA 4TQRA 4BWJA 1VRUA 4FO6A 3L3UA 3KHGA 4CJTA 2JZBB 4DQSA 1X9SA 3SUPA 3VQ8A 4HYKA 4ED2A 4DQIA 4HCCA 4M6WB 1S10A 4B8AB 4KMUA 4YG2A 9ICMA 4CHOA 1GOCA 4YXJA 5KFIA 2FMSA 3SUOA 2BHNA 5IINA 2BQUA 5KFCA 4B8CA 5DG8A 4K4GA 4UB1A 8ICOA 1XHZA 3DOLA 1BISA 3U6FA 4M3WA 5DKWA 3KHLA 5DK5A 4KLJA 1RTIA 4KHQA 4FYDA 4RQ3A 3OSPA 2W9CA 2OYQA 1ZQMA 4M45A 4RNNA 2XGPA 4KTWA 3K5MA 2FLPA 4M9NA 1J54A 4EZ6A 4KLIA 1JLAA 4ED7A 8ICZA 3RMDA 3RJJA 4KHSA 3T5JA 1J5OA 4CEEA 1CXQA 1RYRA 1KFTA 4DTPA 1K6YA 5DQIA 3ZT1A 3M8RA 4CFCA 3V9WA 4LY7A 1NOMA 3IM1A 3FFIA 3RAQA 7ICPA 4ICLA 3G6VA 3OYKA 3PMNA 2RF2A 5KFLA 4J9NA 3PMLA 1XWLA 4BE0A 3QE9Y 4CK2A 3ORYA 2B21A 4RUAA 2DFLA 3AVFA 4CGDA 5E41A 1BIUA 8ICWA 2A1JA 3DLRA 1LWFA 3QLHA 4CJWA 1IKWA 4CGIA 3MBYA 3EZ5A 8ICTA 4GXKA 3BQTA 3SNNA 2XY6A 3NH1A 4YCXA 1VSMA 9ICCA 1A76A 4KRFA 3T1AA 3RH4A 4AILC 2XY7A 2JEJA 1ZJNA 1N6QA 4IR9A 3PW0A 1TK0A 4I2EA 7ICLA 1ASVA 5CR0A 3NHGA 3RMBA 1IG9A 3QEXA 1REVA 4NLNA 3L2UA 1Q9XA 5J2PA 3V72A 4TSXA 3QZ7A 4KAZA 4FJJA 2ASJA 3SPZA 4KHYA 2QKKA 4R5PA 4DSJA 1O1WA 3QEVA 3RR7A 3V1QA 1S1WA 4LSNA 1HJPA 4CE9A 8ICYA 4WE1A 4R63A 1SUQA 1ZQNA 5KFVA 8ICJA 4J9RA 1UAXA 3L2QA 3KIOA 1BHLA 3OHAA 5DB8A 2IDOA 3HT3A 4ELUA 4Q0BA 1A5VA 3GIIA 1K1SA 2AU0A 4I2IA 4B08A 4MF2A 3AVJA 3G0ZA 1ASWA 3RR8A 2OPSA 2YHAA 4GVMA 3VQ9A 4DTXA 5JS1A 2C2EA 5L1LA 4PWDA 3ZDDA 7ICFA 1CZ9A 1DLOA 1JXBA 5HRNA 4UB4A 5KGXA 1NK9A 4GMJB 8ICMA 4AHCA 1SV5A 2YKMA 4W5OA 2X6SA 3OHBA 4KLLA 4CJKA 4DSFA 3PO4A 2HW3A 1JLQA 1B43A 3NTUA 8ICAA 4K8XA 1S77D 5BOMA 4NM2A 4Z6DA 3AVBA 3B6OA 1S5JA 3MEGA 3CFOA 4C8LA 4IKFA 2J6TA 1WN7A 4I9QA 2YHBA 5DDMA 4CJRA 1D5AA 1CLQA 3NF6A 1SL2A 2D0BA 4O44A 1S1XA 4CEDA 3ZSXA 4QOZB 8ICUA 2OA8A 3HPHA 4FJ7A 4B9TA 3AVIA 4DTOA 2W9AA 3QNOA 4KHNA 3JSMA 5J0XA 1TGOA 4FJ9A 4E7LA 9ICRA 5KFFA 4NLZA 3V9UA 1NK8A 2HVIA 1Y97A 3ZDBA 4M3ZA 2BPCA 1S1TA 3V6JA 1RT4A 3UPQA 4J9MA 1BGXT 4LZDA 2BQRA 2HHSA 2PY5A 4BDZA 3DYAA 5KFBA 3QERA 2F1HA 4CECA 5DGAA 1S1VA 4YQWA 4FJ5A 5J0SA 5J2HA 1NKCA 3KK1A 4QWBA 4RPXA 2Z1IA 1NJXA 3MR6A 3GV8B 1EX4A 1KCFA 3QETA 3AA2A 3AVCA 4CF9A 4F91B 2MAXA 4UB5A 2HVHA 3LWLA 4O0JA 2BGGA 1B92A 2FBTA 4I2JA 2I9GA 1TKXA 3RRGA 5HP1A 5IIJA 2Y1IA 2Z1JA 4KPYA 2G8UA 1X1PA 1LWCA 4CHZA 2FLLA 3IRXA 3UXPA 2VANA 5CA7A 2IA6A 4CK1A 1YTUA 4O3PA 1B22A 4J9KA 5JS2A 4NCAA 4CFAA 2PYJA 3PW4A 3VQAA 1HJRA 1TFRA 1RYSA 1U9LA 3P83D 3SV3A 4O3RA 5DGBA 4BE2A 3GV7B 1NOZA 2AGOA 4FS1A 4Z6EA 3SYZA 3V6DA 4I9LA 3NFAA 3PR5B 3QEPA 4KHUA 3MEDA 9ICBA 3MDCA 4KHWA 2Z1HA 4OKJA 2BPFA 4AHSA 2LYHA 3QINA 4DFJA 4H8KA 2HHTA 1KTQA 1RBTA 4DF4A 2BCVA 1T7PA 4I27A 4ECTA 4KLQA 2RPIA 3T5LA 3LAMA 1BPEA 4FJ8A 4QZCA 7ICSA 5CZ1A 1C1BA 4ECUA 2IOCA 3AVAA 3OJUA 4R64A 4EYIB
chains in the Genus database with same CATH superfamily
2ZH3A 5BN8A 3OVNA 2A3JA 2EFOA 5IWAJ 1VQ4N 1MNEA 1URNA 2GELA 4ISGA 2C3MA 3QAEA 2HCFA 4B3MK 5KG1A 2QL7B 2H5XA 3T1YK 4KITB 2GCFA 3VQEA 5IM0A 1RKIA 2DEJA 1GLEG 3VEYA 3J7Z5 2BOPA 1OQ3A 3M2RA 3DFEA 2M7SA 4B3TF 1XU4A 2X78A 5J0WA 4J9UE 2WW8A 3SQ2A 1LNQA 1U26A 3C6HA 1PGZA 2KHQA 5F9LA 3JPQA 1RPLA 2G2YA 2MJNA 4K4TA 4RUBA 2OP5A 2E66A 3HKZD 4TUPA 2HIQA 3MEEA 1ZQFA 4U9RA 5EXWA 3CCQN 5KOXA 1PK1B 1SB6A 2DISA 4OI4A 4P2HA 4E98A 2ACYA 4USKA 2W3RA 1GXUA 2KMDA 2XC9A 4QCLA 2OD6A 1BUXA 1YIJS 1VC6A 1S72S 1OWXA 1S76D 1ACMB 4B9UA 3E01B 2GQCA 3NCRA 2R2TA 1M1HA 5ETLA 4C8KA 9ICJA 1S1UB 5FDLB 5KT5A 3PY8A 4ES2A 2ZIXA 1S6PB 2D3ZA 1YJNS 1VQ5S 1SZ2A 3PG9A 5J2DA 1S59A 4NXNJ 1HD0A 1IKVA 1DKGD 4Z7CA 2R2RA 4GXIA 4ZVRB 4ZPTR 4B9QA 3IAYA 1WNSA 3FMWA 5C42A 2QXLA 3TSPA 2ZKUA 1U0SA 4HT5A 2Y9TA 3G4SN 1RT6A 1NK5A 3LDPA 1IXKA 5D0RA 1PVPA 5CYQA 2DPNA 1JRPA 4BREA 3O44A 3CFPA 3JSMB 4L74A 1QLNA 3U3GA 4ZTFA 3M9NB 3QIOA 4F93B 2AZ3A 1R31A 3W65A 3K75D 2Q6CA 5KFSA 4FXDA 2DHAA 4HUEA 3PZPA 1DGKN 1NDPA 3WZ0A 1X31C 3FEYB 4YNQA 4CYUB 2DXDA 4BRPA 1Y0HA 1OYEA 3M2VB 1D4XA 2ISOA 3E66A 5FROA 2BKOA 1VDHA 4DX8H 1XMOK 2VJUA 3KLGB 1Z25A 4GKJJ 1V85A 1SIZA 4FLZA 9ICPA 4JV5K 4O0IA 4MEYA 4RT3A 4KJIA 4J9SA 3VETA 2XGQA 3HSDA 3AXMA 4CLWA 2JGUA 4AQYF 4OPJA 3SQ0A 4ANEA 2GVDA 1ZZNA 3NBPA 5KT3A 4QZBA 1YJNN 4QWDA 1HKAA 1C0FA 1ZQJA 1MWYA 4X4RA 2CNKB 4OL8A 4FLYA 5LL6d 2FPMA 3UXNA 4DUZF 3H25A 3MD3A 5DLFA 3GZFA 1QVFM 4B9VA 3TP2A 4ZPWR 4CEOA 1ZAVA 1FXLA 3QFWA 3QIPB 4IS7A 1IKYB 1C6VA 3O3GA 2RDJA 1ZZFA 2EZXA 3MF5A 2R8IA 2QLJB 3TAQA 5CYMA 4HUGA 3MPWA 5J2FA 2LXIA 4IOCL 2W24A 2YKAA 1E6YA 3IR6B 3PRDA 4J2EA 4QIFA 3C16B 1LV5A 3N9UC 5GVQA 1B70B 3NMAA 1N52B 2FC0A 4PL2A 1TYQB 3NS5A 2AX0A 3CETA 3BF3A 3J81O 2ZTEA 2BJ1A 4M0AA 1YWXA 5JLFA 1IV0A 2GZOA 3I5AA 4PG7A 3D2FA 2HZAA 3O5BA 3K58A 2EC2A 1RHRB 5LMNF 3T1HJ 3U26A 4IEEA 2FJBB 3PUFA 8ICLA 2YX1A 5HQ8A 5LJWA 1S6OA 3C65A 4H4MB 2E20A 3AO3A 3H5YA 5EOYA 3LF0A 4WJBA 3R1LA 2RF2B 3GQCA 4A8EA 1SJ4P 2HHVA 3UKUA 3JPTA 1JJ2M 1XI1A 2GWSA 1C4CA 1DTQB 1SJ1A 4ETXA 5C10A 3EW9A 1N5YB 3ENVA 4KLSA 4ZP8A 4A4JA 4Z4HA 3FEZA 3MPUB 5D0HA 3C0BA 1OH7A 1F0XA 2LYVA 2RKIA 2XLJA 3F53A 1FRKA 4I56A 3PIPL 3QUBA 4ZLLA 2O4GA 2G8KA 1R89A 2E29A 4RWXA 1KL9A 2H3GX 4LJXA 4XPCA 2Q66A 3ZZUA 3GOIA 3VERA 4YOEA 2QI2A 4M63A 3AAWB 1ZOLA 1HNIA 2LQ8A 3O4WA 2HS0A 3ELHA 1JUDA 1LQ9A 3FBCA 3OLBA 3I55N 1ZM9A 1FW6A 3HILA 1GTEA 3VEWA 4OLAA 3R7BB 5T7BA 1WSFA 5J29A 4CNQA 1FKOA 3LUYA 3CCVS 2QGFB 1NGAA 1BNPA 3WXIA 3A5OC 3MN9A 2BKNA 2RRNA 1YITS 4A8SA 1SC4B 1SKWA 4E8UA 5D6GA 1CC7A 3SI6A 3QUQA 1JLBB 3U9ZA 3O1BA 4RQ1A 3JTPA 2AYEA 1J9AA 2JRSA 5C42B 4PZNA 4XRHA 2YKMB 3K5OA 5CEHA 4J9VA 2JWKA 2RB7A 3U02A 4AP9A 4O44B 2E8AA 1Z4NA 1RAHB 4OLPA 1N8RO 1DQ8A 3CMAN 5L1KA 4CGZA 4C48A 3MM9A 4CRXA 2AJFE 1BDGA 1GLDG 4A8XA 1HWLA 3E0FA 5EX3A 1F2GA 1V4SA 3AJ1A 4KLHA 3FZBA 4NMLA 2OSRA 5KFGA 3A5MC 2Z8QA 3T9NA 3H8JA 1F5SA 4Z4IA 3NDKA 3N79A 2YMQA 2F5GA 9ICFA 1DTTA 3LK9A 4TYBA 2DFFA 3O9TA 3DDHA 4CTAA 1VLOA 2GWKA 2V0NA 3H98A 2KM8C 2ZBCA 3IFRA 3D1OA 1WDTA 3MCPA 3BEXA 3Q2TC 3S01A 4FZXC 1KDNA 4PXEA 1RI7A 3UCGA 2R7UA 2JLGA 5IILA 1YSJA 4YHHK 3R3TA 4JP8A 2KG5A 5AKEA 2W7PA 3D3CJ 3H8WA 4EI2A 4JI3K 4CBUA 3CC4N 2Q97A 2JJ4D 1XQIA 1RCHA 2EAPA 1IG6A 2HGNA 1N60A 4DX7A 5L1JA 4C0OC 5ETVA 4AHTA 1WKKA 3EUNA 4DFPA 4K4ZA 1PJ7A 3CJ3A 2UUCF 4DV6K 3CJ7A 4MFAA 4MF8A 4HTLA 4F7VA 3MDFA 3NH2A 1NB2A 1U0HA 3MCNA 1HMVA 3K5LA 2VASA 3F5TA 4LRFA 2VUGA 3HHLA 4FWLA 5HR7A 1P8GA 3FNNA 1XHXA 3GG4A 1TKDA 4KLGA 1CJUA 3BZQA 2N1RA 3Q86A 4JKFA 2B9XA 4B9LA 5HOOA 2G8WA 2C42A 4AQYJ 1UJ4A 3CJQA 1TL1A 4UASA 2CVIA 4YN4A 4ZTJA 3LW5C 2DGOA 3MEDB 3BO4A 4FF2A 3CJ4A 2DIVA 3SR6A 4C2MA 5FDLA 3RMCA 3JQMA 5MLCQ 1SIJA 2QA4S 3CNHA 4J9PA 2WFAA 5J0RA 3O3FA 5M1NA 2BANA 1DTQA 5IIOA 3RSEA 4UW9A 1IKVB 5IV3A 1RLDA 5DS7A 4HACA 3OVBA 4ILRA 3ULDA 1MMLA 1PG5B 3RH6A 4R0EA 1JLEA 2O66A 4RR5A 1T6CA 5A76A 4TU7A 4XPEA 4H4KA 5CYQB 4F4XA 4KB1A 4DV2K 2DB1A 5DJBA 1UVMA 4L8RB 2KXNB 1RXOB 3TUJC 2RUGA 4Y2KA 4NLPA 4WP8A 2KTQA 1MC8A 1NMDA 3NVVA 3U4LA 5HMXA 1RU1A 3H1QA 4UAZA 4LF4K 4YD1A 3DDKA 3M8QA 2DEIA 4CYUA 4FVMA 4NV0A 1EZZB 2MZRA 4FBTA 3RAXA 4RPYA 3X1LB 1F5AA 3W8GA 5HMWA 2YHWA 1HPZA 2C3YA 3VAIA 4TQSA 3FDSA 4ZP7A 1RQNA 2FQQB 2GQQA 2R9LA 4AHUA 4XH1A 2FY8A 2G06A 2RQMA 1EX8A 4ZDNA 2P9KB 4KR0B 5ETSA 4KLMA 4BBYA 3OR2B 3I6PA 4ZN3A 2QMUB 5J1NA 4FM0A 3THWA 3FCHA 4QPXA 2EANA 2I5JB 4K5SA 1B7YB 1Z6RA 1CEZA 2BRKA 3BGRA 2KHDA 3K2PA 3EO3A 4FZMA 2PD1A 3FBBA 1HR0K 1HIYA 1MMDA 4CHNA 2VPWB 3QIPA 4U8YA 4OYXA 3ENBA 4ZP9A 5AIAA 4MK8A 2GUPA 1FK9B 3OUYA 3VQ5A 4QW9A 2WB1C 1LXJA 3MM9B 2J4RA 3NOGA 2I1RA 3U7JA 2R3VA 4YOUA 3DXMB 3IN5A 4JHDB 4K42A 2DCUB 3P49B 4EWTA 1HPMA 1OYDA 3OYHA 1KD1O 2DYAA 1ZA2B 2HFVA 3CC7N 4OJ3A 1AXQA 1S22A 1O13A 3D45A 1Q8KA 2E1YA 3MR7A 4LF9K 4OJRA 4M47A 1ZQBA 2OKQA 4FJHA 2B6AA 3HKZC 2FTRA 2QFIA 3C3LA 1XMQF 1VRUB 1JALA 2R7SA 4JS4A 3V4IB 1G3OA 3NGZA 1SZPA 1S6QB 1VHXA 2HHPA 4C97A 4RBTA 4C8ZA 3HBTA 3O8MA 5M2RA 2GOLA 1VI7A 3ZTRA 4O4GB 2FYXA 4AM7A 5DBCA 4WKRA 3WUHA 2RHQB 5AE2A 1FF2A 2X1AA 2E2QA 4GC6A 3QT6A 2VWJA 3IBPA 4FPRA 2V52B 1L8OA 4OJPA 1IM4A 4G1QA 2ZHOA 2VGMA 3AMZA 2BJEA 3MFHA 3GL1A 2KZZA 1I39A 4CF2A 4IFYA 2DNQA 2F44A 3HHKA 3OBYA 1WG4A 3A8IA 5I42B 4M5GA 4I6WA 1TMMA 4DG1A 4OX8A 2FMPA 5CCLA 3PRBA 3AO2A 1Z3EB 3LPEA 2YPYA 2PFDA 1XO1A 3KXDA 1FRHA 8ICGA 3C6UB 2KI2A 5KG3A 1X2IA 4FWMA 4UBCA 3VAGA 1RBAA 5KAFU 4MO4A 3N4QA 5TZVA 5KFKA 2QZ8A 4IC9A 1HUXA 2MDAA 3MUVP 1SH3A 2YMLA 1EARA 4TY9A 2UU9J 4KB0A 3VC8A 3V7LA 3QT7A 2K1RB 4QZDA 3MDAA 2ZIXB 4E1JA 2DFEA 1TR0A 3ZSRA 2XEXA 3AD8C 4BACA 2CDQA 1BXNA 2CPHA 2PA8D 4J9OA 2XULA 2R7QA 4ZJOA 3VR1A 5KFEA 3N6NA 2E7VA 3C1YA 1GMUA 2QWMA 4D3GA 5DM7L 1ZD3A 3JPOA 4RUCA 5AXNA 1XNQJ 2ZIVA 3TKAA 1BMQB 3OXFA 1HLWA 1X4AA 5KFOA 3KZBA 4RKUC 4Z37A 2N82B 4M04A 2HDOA 6FDRA 4O5CA 2DXFA 2AJQA 1RHUB 2ZIWB 2K4PA 4Z0UA 2UXCK 1RAOA 2FJDB 4BRMA 3KJQB 9ICUA 2PEBA 2BOAA 1DY3A 1TL4A 1DRZA 1ZBFA 1NGIA 3D66A 7ICUA 5I3UA 1R8PA 3O8WA 5E3PA 2I5JA 1F9FA 2RIJA 4OJ6A 4CJ7A 3WK8A 4OPAA 3SFGA 4V1Ak 3WT0A 3DGPB 4W5QA 4IO8A 3CCJN 3PVXA 3GLJA 3AVKA 3P38A 2K7JA 4OZ3A 3TEHB 3DM2A 1OY6A 2IPOB 2V50A 5J2NA 1JLGA 3ZTQA 2D9PA 4DCPB 1RU2A 3SZ2A 1H0HB 4JYAF 1NHKL 4DCCA 5ALMA 2ZC3A 1CSJA 3TWHA 2D4WA 5GMDA 5KFWA 4P73A 4JYAK 3J81U 3CJ8A 3AQEA 1S9GA 4CLFA 2W43A 1L3SA 1S7HA 1XSNA 4DFDA 2FMQA 1Y5LB 2GJFA 1R3NA 4KLFA 2ZJRQ 3HM9A 1Q0NA 2Y0BB 3VQDA 3AD7C 5GAHI 5H9EJ 1IBMJ 2FLNA 2OHDA 1P1TA 3C16A 3HRDD 4NLTA 4Y2CA 3MCSA 3SSQA 2UXCJ 4M95A 2LU1A 1ZBIA 1EQYA 1W7WA 4HEA9 1V5IB 2E1PA 2YBVA 1K9MT 3HW8A 2B4VA 4QIWC 2EKNA 4UAWA 5BYRA 3RBEA 3GE1A 1RAFB 3KYLA 5AI8A 2B5JA 3P45B 1GEHA 3ZSYA 4KO0B 4QYZK 3SIPB 2K4IA 1FX4A 3LTOA 4ED6A 5KFMA 2X7IA 1RZMA 1N0VC 5AZJB 4CNYA 4FNHA 4NXMJ 4PEOA 1X9MA 4FF3A 2XZDB 1P6TA 4LFCK 3DRPB 2A1JB 2JEIA 3MN7A 2LMRA 3L3FX 3I9ZA 1HHSA 2WVFA 5C12A 3ZEUA 2K06A 3U9DA 4ELTA 2GEMA 3T6BA 3PRVA 5KFJA 4KAIA 2KN4A 3MUTP 4L3NA 1MSWD 4CD3A 4CHYA 5AICA 5EVZA 3D2SA 3EY1A 2ZH7A 3OYBA 3DCAA 1SKUB 1C1CA 3C2MA 1FERA 1Z05A 2ES6A 1ZQPA 2HNYB 4I2BA 4M5NA 1WC1A 4C4WA 2QA4G 4EENA 5AQVA 5HROA 5SZTA 4OV6A 1QSSA 3OR1A 4RQ7A 3GJRB 3R9PA 3M4XA 2ATCB 1QSLA 4DTJA 3GR0A 1HBMB 3NXZA 1JNZB 2YMPA 4DV6F 3SJJA 3IRXB 4IFYB 4X66J 4YB1P 3CMES 3OYEA 4K41A 4DG1B 2AF6A 1U1MA 4C7YA 2IHR1 1IQZA 1RT1B 5AK4A 5AKHA 4EZ9A 1X5SA 4LF1A 2ILYA 3DLJA 3OJSA 3ISDA 5ALIA 5GMEA 1LW2B 3TX0A 1LWEB 2W7AA 3QMLA 3L7OA 2ZUBA 3V6DB 3HX0A 4YVZA 2L5YA 2ATLA 5AE1A 2CGLA 1PVQA 3ULHA 1D1UA 1PCAA 2MQMA 4DZDA 3QU7A 4X66F 4CLKA 1O08A 3KKAC 2RLTA 1RT7A 2IDLA 5ETQA 2P6RA 5K5MA 2KN7A 4ZPBA 4JI0F 4BHQA 2IVMA 2IBOA 1VK8A 3MWBA 4LF4F 3SLCA 4WQ5A 3DLKB 2Q3PA 1X3MA 4UOGA 1FK9A 4M5LA 1BQNB 2QA1A 5IC4B 2DY4A 5H1SQ 7ICGA 2JL9A 5ETKA 3EUB2 2E8NA 5AKKA 2YY3A 2DNLA 4UOHA 4DOBA 3C19A 4NXNK 4UB8U 4BRDA 3MXIA 3CDBA 2I5HA 4NZ0A 1NLVA 4L76A 2IGIA 4DV7J 4PKGA 4NXMF 1ZXIA 4USWA 2OLWA 3FCWA 2J0QD 2XMKA 4BC7A 1ZQDA 1FEEA 5D0GA 2F4VK 1TL3B 1S1TB 4N8OA 2O6KA 2RKIB 2GHPA 4X64J 3JSYA 5GMKa 4Q43A 2ASMA 1EKSA 5KT7A 4US9A 3EPGA 2G4BA 2NRVA 8ICVA 3NL0A 2XI9A 1YVNA 2E6MA 5BR9A 1A9NB 5J0OA 3DXKB 4P4PA 5H9EK 4LH4A 2CXEA 3BSAA 4JKGB 1U1KA 3TEGA 3RW6A 4JKHA 3CJKA 1IBMF 3CGIA 3TADC 4P4OA 3DLEA 4MT1A 2WCXA 5JUMA 2LKYA 4YXMA 1N88A 1IKYA 1S79A 4F25A 4DSKA 5AQLA 3QNMA 5K8MA 4MQ3A 2V9KA 4USJC 5C0YA 3WIUA 3FSYA 3BBFA 1BA1A 3KHRA 2GWJA 4W5TA 1Q7LB 1PBUA 1NGDA 1E6VB 4ZHRA 5AHXA 4DFMA 3SD7A 4NLDA 4CIOA 4K2XA 2DNGA 3L5KA 3THVA 1D9DA 2VG7B 1ZQAA 2F8LA 2YH0A 1I94J 2OTLS 3KJVA 3LZIA 3OT9A 4RO0A 1KAZA 3P5JA 1LVHA 2ZTCA 5ETTA 2EH9A 3H08A 4H4OA 4KO0A 2RRDA 3SQ4A 4FLXA 2I38A 3CCTA 2PFFB 3QO9A 1WDDA 3AVNA 2MLXA 4NLWA 1N5QA 1KLMA 3UQSA 1GTHA 3SUQA 1A6LA 1JLAB 2CIMA 3EN9A 3UKUB 1VCTA 2PO4A 1T11A 3Q23A 4NI2B 5ALXA 1FFUA 3TZWA 2E1EA 5F8GA 1GH8A 2HGLA 1N5YA 3GIJA 3AN1A 3DRSA 1P9YA 1T9VA 2GHVC 3OPKA 3S3OA 4X4NA 4RTFD 2V7YA 1VQ7N 2B4PA 3V7JA 4Y65A 3G4SS 4CFBA 4PY5A 2BMBA 2WF8A 2EBEA 2LXFA 3H0RB 3D6HB 4DR1J 3TUIC 3AL0B 2FLOA 5HANA 3B78A 3VGKA 3NRBA 4BQZA 2DIUA 2NRTA 2CG8A 4P72A 4BUGA 3ZC4A 3TA1A 3I4PA 3OR1B 4IFVA 3NH0A 1ILYA 3MM6A 3OYLA 2A1SA 3LPUA 2HBMA 2JV3A 4NXZA 1FTRA 5GAHP 5G4DA 3OYDA 1N6QB 3S8SA 3Q8LA 1TE2A 1RQLA 1VGYA 2C2ZB 2ZIWA 5CHGA 2XI3A 3D6RA 2ZHAA 2QLXA 4PG8A 1NAQA 3RJIA 3N4MB 3VAKA 2AEMA 2R4FA 1BWEA 4FLUA 4C8YA 3R9LA 2F9TA 1QAIA 4JKAA 4KC5A 1LW2A 4RBVA 2YHXA 2XY8A 2C2OB 1SCJB 5B0BA 4CJ3A 1QS4A 2EHGA 1T3OA 1S1UA 2V4QA 1SGGA 3QRRA 5BR8K 5DLGA 2KG1A 1JLCA 4PA1A 2DY1A 3AVLA 3QESA 3M5RA 4O9MA 2F3NA 4B6JA 2EK1A 5K8PA 2ZIUB 4DV3J 1BPXA 4LBPA 3SBMA 2H3EB 2UXDJ 3BO2A 1UVNA 4U6PA 1GLJO 1N48A 2VV5A 9ICQA 4FZVA 3M1FA 3W7BA 3HMJG 2HAIA 2PFPA 7ICVA 4LFCJ 2HFOA 1T95A 2B51A 2FI1A 1G4CA 4ILMA 2FBYA 2KSOA 1SV5B 2PEHA 4ALZA 4OX9F 5H1SV 1WUAA 2AJ1A 4LSZB 1JN3A 1E4FT 3D4JA 1VQ4S 1O8BA 3AAQA 4CEZA 2YQ3A 1QCKA 5IC6B 4JAXA 1X4GA 3HULA 2M9NA 3WXKA 3EYZA 3HP9A 2DO0A 1FO1A 3I0SA 2GVZA 4A46A 3HD2A 3TUPA 3ISNC 2KFYA 1AUSL 4KKOA 3K17A 1KNZA 4E3SA 5IIMA 4C1NK 4LSLB 4H03B 2BBEA 5AFUH 3EVOA 2XMAA 3M8YA 5JRTA 1RACB 3FR0A 1ZPVA 1CJKB 1DBDA 2ZD1B 2LQBA 2N3OA 5B0DA 1B9FA 4BC9A 3KHYA 4Y1CA 1HD1A 2BW7A 2GVDB 1H73A 4H0TB 5HATA 4JYAJ 1LW0A 2NYVA 4JI7F 5L9XA 4FVUA 2QC3A 2P9CA 3DLEB 4YDXA 5F0WA 4MJKA 1RCXB 5ALGA 1KONA 1ZQHA 5GAGP 4LF8F 4F92B 1TL7A 1JK9B 3SI8A 1M5PC 5HQLA 1N36K 5ALTA 1TKTB 4HH0A 1K8AO 1UZDA 2YNIA 1VMBA 1VRUA 4FO6A 2HPUA 3L3UA 3KHGA 1QVGM 4DQSA 3VQ8A 4DQIA 4KMUA 4WQ5C 2GMLA 4QR0A 2H54B 2AMCB 4PKDB 1FJ7A 4DL0C 5KFCA 1CJUB 5DG8A 2RUSA 2VQEK 4K4GA 3CMQA 4DR6J 1FXDA 4K25A 2KVSA 4M3WA 5DKWA 3KHLA 4YEAA 4LF5K 5E26A 1Q79A 2KT2A 2LXUA 1VQ8S 4LQ9A 3ZTPA 3K5MA 1KWMA 1VQNS 2RU9A 4IEIA 4NYZA 1J54A 4EZ6A 3RMDA 1V6HA 3DOLB 5SUHA 1J5OA 5HMZA 1CXQA 3G86A 1KFTA 3MMCB 5MAOA 4CFCA 3V9WA 3TVKA 2AXTU 2W6LA 3UKRB 1XBWA 3ZX0A 3RAQA 3CTRA 3UDCA 3WXMB 3OYKA 3PMNA 1UMJA 2RF2A 3R97A 3PMLA 1AYEA 1FDDA 3QBXA 3UE5A 4BE0A 3QE9Y 3ORYA 2CG4A 2AJ0A 4U67L 3D0HE 3NNCA 4FSVA 3A8JA 4DDFA 2OFGX 2V34A 2F8KA 1GMWD 4DUYK 8ICWA 3D3BJ 2E9TA 5AE3A 1LWFA 2OJ3A 1IR0A 3NGKA 2DNMA 3N5BA 5BR8J 3B4MA 3MBYA 3EKUA 3EZ5A 2N3LA 2XMUA 2CGKA 4UOCA 1DEJA 4CDGA 3ETRA 2B9EA 1UW4A 3VF0B 3NH1A 4IFVB 3W5XA 5AQOA 4YCXA 2X1FA 5ALJA 3I82A 5LMUF 4AILC 1ZJNA 2CJQA 3QT8A 1TK0A 3QJJA 3RMBA 1IG9A 4Z2XA 2BJ8A 1A0PA 2GJIA 4Y2UA 1BC6A 1Q9XA 3V72A 1HQ2A 2P9LB 5AM2A 3LH2S 4WKYA 2K8BB 1D8BA 3RBXA 1JCFA 1YRTA 4KHYA 1H2UX 4DSJA 5CYMB 3RR7A 1SJRA 5KL8B 3VALA 5DZ7A 1HW8A 5AIBA 4WE1A 4X66K 3ZI4A 2IOFK 1ZQNA 1UAXA 3CF5Q 2KHOA 4A8KA 2IDOA 3WHIA 2ZVIA 4IO9L 4ZMMA 4PRFA 2EPIA 2WB1F 2H5JB 1FNOA 1CZ9A 1JXBA 4UB4A 4OI1A 4IOXA 3JTOA 2YKMA 4X65F 5H9FJ 2YX4A 4DSFA 4IOBA 4KGKA 3P4IA 2LFVA 3NTUA 4YUDA 4XAKA 2KVQE 3B6OA 5BRDA 1BA0A 3CJ5A 5D77A 1M6YA 1LKYB 5DDMA 2ADBA 2LYAA 4YS2A 4IKAA 5FPNA 3HI0A 5D4OA 1SL2A 1X60A 1YGYA 3B54A 1FD2A 4QOZB 3PEHA 1IWAA 1YG0A 3CDWA 1U2VA 3QNOA 4KHNA 1RFQA 1TGOA 4OIXA 4FN5A 2ZWHA 1O6XA 2MKKA 1NK8A 2NXJA 3UPQA 2B5JB 1LW0B 2HHSA 2Z56B 1YKWA 4BDZA 2JH1A 1CC8A 4DR2J 4M7YA 5J0SA 4J5OA 1RK8A 1JJHA 4BVPA 1YJVA 2YNIB 1K0VA 4WPAA 2Z1IA 2G0JA 4OYZA 1Y7PA 1V5VA 2ADCA 3MN6A 1UWAA 1NNLA 3T9ZA 1NPRA 8AT1B 4R0JA 3AA2A 5T7LA 1HWKA 2UZAA 2CJYB 1YJ9N 3KK1B 5H2FU 2O8EB 3NBPB 4CF5A 4UB5A 3NWRA 4L75A 1CZAN 4GIBA 3ULEB 5CAAA 2YI1A 2R42A 2VONA 4KT0C 3MMVA 4C4RA 1R8HA 1C0TB 1K9MO 3OVSA 1LWCA 3NAHA 4AD6A 1RDWX 4JI7K 4ZP6A 5CA7A 4LR8A 4JNEA 4UARA 3J81j 1Q3VA 2WBNA 1J5OB 2M5YA 3SCKE 2XQCA 3PW4A 1HJRA 4Y2PA 3IM9A 2FJAB 3UDLA 3GV7B 2KT3A 5M1PA 2AGOA 3MECB 1BWVA 5IT9Y 3V6DA 3PR5B 2PFUA 3QEPA 1N62A 3ZYYX 1ICEB 4KHUA 9ICBA 4KHWA 4OKJA 2XICA 3NUQA 2CQ0A 2FHMA 3QINA 3F2CA 4DFJA 4H8KA 4IO1A 2O8CB 3W2VB 4CO5A 1T9WA 5TKWA 4TXSA 4ECTA 1F9EB 3I5CA 2E8PA 3VHQA 3W0LA 2RPIA 2FHOB 3L4IA 5CZ1A 2XM3A 4B1UB 2NO5A 2CA9A 4EYIB 3FZFA 3OPXA 4NE9C 5GAGU 3JQKA 2KJ8A 3O08A 1N32K 2NRXA 1GXLA 5E79U 2F8MA 3HM8A 4B3SK 3H4DA 5KL1B 2F8TA 1KEJA 1RILA 4PABA 3AO1A 4TU9A 1D8ZA 4WFBQ 2A1AA 3THPA 1NUEA 2CZ4A 5LSOA 1C1CB 1HMVB 4WE1B 2VB6A 2ZH6A 3AVGA 3W3DA 4YMOA 5F2RA 1U24A 2DR8A 5C7PA 1UA1A 1HBNA 3J80U 4JI8K 2KKVA 3M6XA 1VSHA 5E3QA 2QARA 2KB2A 1RTDA 1NGHA 3QRQA 3VQQA 4CBXA 4OPHA 2UUWA 3NY0A 3T3FA 2IHMA 2GUIA 2XLIA 3NRZA 2MSNA 1ELOA 4OFZA 3HO1A 5A6WA 4CJUA 1DHMA 2FSJA 1ROFA 3R2DJ 3M05A 2KIWA 1LKYA 2OPRA 5CD4A 1BY9A 1HYZA 2DHSA 1JIHA 4HTUA 2VBYA 4OLBA 2AYMA 4B3OB 3OS2A 2G2ZA 4ID5B 1RWNB 4LMZA 1A7GE 4H0YB 4K59A 3IXQA 3MR5A 4A59A 3IHQB 2E44A 3UQ0A 4G65A 2KK0A 3Q7BA 2E5LK 4QW8A 2OCEA 1WHVA 3CCMN 5B5EU 4DU3A 4CE6A 2RS2A 2BCRA 4RNMA 4B1VA 2CQCA 3PSIA 4H4OB 4RQ4A 3BF1A 4I2DA 2VDHA 3L09A 4C98A 3NF8A 5AT1B 2YTUA 1U1PA 1OKJA 3M30B 1PJ5A 4OKKA 1DXSA 4UY8O 1HPZB 3C1ZA 5DB9A 1JB0C 3OYCA 3HVTA 4E2FB 4CH7A 3J7ZO 1SZHA 1Z4UA 3K7RA 5D8HB 4O3MA 1VRTB 4FLWA 2UVUA 4DV5J 4X62J 3EGVA 3E51A 1Q9YA 2H3ZA 4HVZA 5KFUA 1T05B 4F0MA 1PILA 3THWB 5KT6A 1RAEB 8ICXA 4V19X 1BPYA 3RRHA 2ACMA 1YJUA 1GOAA 2HNDA 2BE2B 2XSJB 1JLFA 4LH5A 5B09A 3THYB 4LF6F 3KG0A 2DITA 2HNZA 3VMFB 4FXVA 2B9WA 4F5QA 3UPFA 3UN2A 5DDRC 2F8EX 2QIFA 2PMZC 3BN4A 5FPDA 4FCYA 1UTAA 1N61A 5E5NA 1R8CA 3G6XA 5GADI 3OYAA 2E5HA 3MMJA 3JYTA 2VQEF 3NVWA 4DO9A 1UT8A 5AI5A 4GVBA 2FVSA 3VA0A 2P9UB 4B3RF 3HJFA 1NU0A 2VD3A 3N97B 1VSJA 4DR2K 3UWTA 2KFNA 1QD1A 1HI0P 4BG8A 4Q8EA 5EY4A 2MKJA 3CC7S 2L9DA 3WC0A 4HWIA 3G6ES 4DQRA 2VQFF 3SQOP 4OGCA 2CNOB 4YR3A 2G8HA 5A2QO 3LGMA 4X4SA 5AXMA 5KAKA 4NLYA 5J1PA 3HKWA 3CNQP 2F9JA 3JXUA 2LSNA 2D0CA 3T1HF 1FFWB 3TQEA 2EFQA 3ONNA 3DLKA 4FNIA 3HSCA 3UE2A 1WNEA 1QTMA 3I8DA 1APSA 3DWLA 4CH1A 1C1BB 4U95A 3NGTA 1Q16B 2NZ4A 1WF2A 4J2BA 3IM8A 3RB3A 2BGWA 3FSXA 3GWCA 4E0DA 2P9SA 2VU5A 1E4GT 4YFKA 4GKKK 1LKZA 1F5BA 3BQ7A 4ATNA 2OHFA 2CH5A 1F3FA 2EI5A 4Z4EA 3QXGA 1HYVA 3NGRA 5J2EA 4IXCA 2FGCA 1SKSA 3I5BA 3KLIB 4NYPA 4OI6A 2QV6A 3MWPA 2LQ5A 4LSLA 1XNSA 2CQ1A 3QZ8A 3AJDA 3GYNA 4X65J 3Q22A 1KC8T 4H0XB 1KQKA 4HT7A 2WF5A 1AW0A 1HFEL 2ZD1A 5BRHA 2UUCK 2AD9A 3S1TA 1U2RA 3ZZTA 1VSIA 5AQHA 3ENOA 3PCOB 1SXDA 1C1AA 3VQ4A 4ZVQB 5E84A 5AKZA 2H9ZA 1W0HA 4HUFA 3TI0A 4JV2A 3RJKA 5IXUA 4MYUA 1G2EA 1S8OA 1BQMA 1X4CA 1S57A 5K14B 3NGUA 3PYDA 1IJEB 3HFVA 5KQ8A 2B7BB 3BUZB 1QJHA 2Y1RI 1IO2A 3C14B 5GAGI 1IBLK 2X3GA 1H74A 1FCAA 2HZCA 2F96A 1Q53A 3RMAA 2ZXIA 3IC1A 3GG0A 2DCLA 2OELA 3LDOA 1AT1B 4ED4A 1QAJA 5EE0A 1KLMB 4GFJA 2MQLA 3F2BA 2K8CB 3H1VX 3LP0A 5DB7A 4FJMA 2ZQBA 3J7YI 4KTQA 3SBTA 2E4LA 5HLFA 4UZCA 2KJ9A 1WELA 3KJFB 2F65A 4EGLA 3U27A 1KEKA 3ZCMA 1DGSA 4OX9K 5BR8F 2I7PA 3IV6A 3IDWA 1VK3A 1KQSR 1L8LA 4NXNF 2A5XA 4DV4J 3WXJA 1X5TA 3RWUA 4O3QA 4CGFA 2KZ3A 2HURA 4PH5A 2IVNA 4DUTA 2N4DA 2AH5A 2NR0A 1VQMN 1RT5A 1ZQOA 2ASPA 2K89A 2ZKTA 2GIFA 1X0FA 5AM0A 1TVRB 1KC8O 2BDUA 4BRGA 1RGVA 2R8JA 4DR2F 1WOSA 2XMWA 3I33A 1TUVA 5IZHA 4C0BA 3A3PB 4OZ0A 1WEYA 1VAZA 1RDAA 5HI7A 3DI6B 4DI6A 2JX2A 5C2GA 4DKWA 4DR6F 1DAXA 4K4UA 2HMPA 5E2QA 2P9UA 1V97A 2AKWB 4DV1F 3Q24A 4FK2A 4F3MA 5L1IA 1RDBA 3LP1A 1VRQC 2XTJP 2NRWA 1N34J 5AK6A 4PHPA 1CJTB 2L3MA 3CEDA 4ECSA 2QTWA 3K0JA 3VZIA 2WC9A 1ZXOA 4ZN1A 2ZDPA 3NWGA 4O8UA 4RCHA 4ZCMA 2JNJA 4Q2MA 1NM1A 1MW7A 5E3AA 4O23A 3R8YA 4BC4A 2OFHX 5B08A 1U0HB 1XSPA 5CY4A 2RHKA 5J0QA 1GX6A 4WFYA 3MR3A 1TV6B 3LDSA 1FNXH 3EGWB 1M90T 2UVVA 4A47A 4ICAA 4EX7A 3K59A 2VF3A 2V68A 4H4MA 4E89A 4DV5K 3CMAS 4CVNE 2CZ9A 4OZLA 1COOA 5HRPA 2IJFA 1CLFA 4KLDA 1MN8A 2BJ7A 4UZBA 3CQ8A 5AQNA 2M9KA 4M5KA 2LP4A 1OY8A 1Q8IA 3CFRA 4WIQA 2PI5A 3ETMA 3MAQA 2YKQA 3LDQA 3TQ1A 1RHMB 2V4JA 1HW9A 2PBDA 4RQ8A 3B6BA 4XUSA 3BSNA 5KFAA 1WOPA 2IIRA 4KLEA 4RW8B 2DR5A 2MZ1A 1GMWA 5CZVA 1YITN 4JK8A 8ICRA 1RBRA 2YQ1A 4QZVB 1UCVA 3MGJA 4GO7X 3KLHB 1RBSA 2IDEA 3H6EA 3AT1B 4KN4A 3OD2A 2UVRA 2XS2A 3G6EN 3UMCA 5B0AA 1S99A 3P1GA 3VV2B 1RA6A 4CJQA 4YHHJ 5FRNA 2VIHA 2LLZA 4RPFA 3TUZC 1T3QA 2FJ6A 2CADA 1WORA 4CZEA 2OI2A 2IAJB 3G6YA 1J5EJ 3V81A 2YJFA 5D49A 2W2MP 3CIMA 1R7IA 4MFBA 3PR4A 3FRYA 2FBVA 5DBAA 3OYGA 4M5IA 3VTIA 2YB4A 1Q18A 2QLTA 1N5SA 2NXNA 4YY3J 2WVEA 2M8DB 3BZKA 4MKBA 3ZT3A 3CCWA 4YR0A 4QWAA 3IRWP 2MGZA 3THYA 4KI4A 1NEEA 1FWPA 3KLEA 4OX7A 2LYBA 2WOMB 3Q89A 3P5TL 2P9EA 2O8EA 3MWTA 4KGZB 4C23A 1KR4A 1YBAA 2DXEA 4DR3J 2ROPA 4NASA 2AP1A 3QBWA 3SK3A 3F9MA 3Q8QB 9ICLA 2CJBA 3LWMA 3CDUA 4BR0A 5HLFB 3M6UA 2R7YA 1QHTA 1ASUA 5FRMA 4K7QA 3EZUA 5ALZA 2R7XA 3CM6A 1B99A 4Y3CA 4P2FA 3P3DA 1UAWA 3MMBA 3PV8A 1NZ8A 1HNVB 2PXIA 4F4YA 4ZPCA 2VH7A 3NCQA 2Q36A 3ZX2A 3C5GA 1YQHA 1YJWN 2MLZA 3QEAZ 3KLVA 4JHDA 5G0RA 4WCEQ 2OZSA 2CXYA 3TVZA 5AQJA 5J2MA 4DTUA 3L9ZA 5F9NA 4J8FA 3U3YA 3FSIA 1RABB 3IAS9 3FUYA 3I87A 1WCNA 3FC9A 5AZJA 3F44A 4LF8J 3GIMA 1HUZA 8RUCA 4LRDA 4Z6FA 1I94F 3ISCA 2PFQA 4DQPA 4LBHA 5AQIA 2XB2D 2V7ZA 4N5SA 3N5FA 1LCUA 1YVFA 4HHHA 2HEKA 3RAMA 4FWPA 1W97L 3T79A 4PUOB 4FYYB 3FGUA 1PYSB 1NK0A 3CQXA 4EP4A 3VAJA 1MROA 3ZT0A 3AU2A 3WDOA 5T7LB 2OPQA 4NLXA 1T3NA 2DGSA 2KVIA 4QZHA 4E19A 4ZK7M 5AR0A 1VQPS 4JI2J 5HMYA 3A3NB 1TK5A 1T6DA 1QSYA 4G1QB 2CPXA 3BREA 2A18A 4Z7YA 1KTVA 4EFAC 2DKXA 3GU3A 3O3LA 1ZQLA 3EPIA 4ECXA 8ATCB 4CJVA 2YHYA 2QKQA 3UR0A 3OFGA 1UQVA 2QKBA 3A0BU 4Y2MA 2LEPA 1SS6A 2BKPA 3C6TA 4DL5A 3O9QA 4RWWA 4HH1A 4A8WA 5K14A 5HRRA 4CD1A 4PYAA 4PAAA 3C15B 5TKYA 4DTSA 4LT6A 3GBTA 4JUZA 4TLRA 1VQLS 3I0RB 1S1XB 2IFXA 4NYNA 3AA4A 4DV3F 3UM9A 3A3OB 4FZZA 2HBJA 4AFFA 3PKMA 4OJOA 1CG2A 2CQHA 4AH9A 1YT3A 1GLLO 3D67A 3H0LB 3QPIA 3TJ8A 4DMZA 1J6ZA 3NGDA 1V38A 4IQMA 3T7ZA 2HBQB 1RWMB 4XO0A 4DSLA 3QNNA 1RDUA 2G2OA 4RQ0A 5D3GA 2PMWA 1RM6C 3BBCA 4F4WA 2QTDA 1FFGB 3OTBA 3GJTB 3PIOL 4KH0B 2FY1A 3WNHA 2NUUG 3OLAA 3BBBA 1WBDA 3SAGA 3FGVA 1OH6A 3TAGA 4LFAF 4IOAL 3K2YA 5EWGA 4DB3A 1TL7B 2V5HG 5BYQA 5AQFA 5DDPC 4EHUA 1TMJA 2D41A 4F2SA 2GV9A 3LVVA 3VQCA 2GO7A 1IIPA 2B4UA 1RNHA 2ZM6F 4M94A 4P6QA 4RX6A 2HVDA 3R27A 2XZTB 3QU5A 2IBKA 4YB7A 3S41A 2MGZB 4ZLJA 3PW7A 4JI1F 2NYHA 1L7PA 1NHVA 1XNRF 1CULA 4NYOA 1R59O 1GO3F 4O3OA 4DR7F 3JPNA 3DXKA 5JLHA 5EWFA 2RHSB 4AT1B 4LFAJ 1X4FA 1YJ9S 5ETNA 2WVCA 4K0KJ 4QZGA 2DKZA 2MSTA 1UP1A 2BE2A 1SC6A 2XSJA 3CCUN 4MLHA 5ALOA 2C22A 2BW2A 2WB1D 2IJNA 1KHWA 4WF9L 1CQNA 4M41A 5J2BA 3HRGA 3PKYA 2W4CA 2PIIA 5KTQA 3RB6A 1TKZA 3RGIA 4LF9J 1OPZA 1ZQCA 2VOOA 1MWMA 3ZO7A 2WSCC 1H1VA 3OHRA 4LBIA 4JI8F 1U8WA 3JXOA 4B02A 4DTRA 2JGAA 1KVKA 4A2AA 2DTUA 1T9XA 1UEUA 2Q1LA 4NXMK 4CI6A 2PC6A 2GNKA 5GAEI 1U47A 2EVZA 1HQEA 1OSCA 8ICIA 2BJDA 2ZZNA 4OJ5A 1NDCA 3IDHA 4NYFA 4CO4A 4TKTA 4ECZA 1CJKA 2IM2A 5BRFA 3NMUA 2OTJN 3KLFA 1DOQA 3QSIA 4LFBJ 1VISA 4QZ9A 4RPZA 2KH9A 4C3KA 4IH7A 1XC3A 1YX2A 1SL1A 2EFPA 2A1RA 1Y00A 3NNAA 2HVEA 3T1YF 3LPTA 2AQ0A 3HFZB 1MWKA 1WOOA 1TV9A 2KJ5A 5DDOC 5ETMA 4ED8A 4WIIA 2VG6A 2W2OP 4RG8A 4ANCA 4NRTA 2BCSA 1EIYB 3SQGA 2QB0A 4UY8T 4PUOA 3CO0P 3RJHA 3NOCA 2HQ3A 3Q83A 3IP4B 4PPXA 1VRTA 5FLXY 2P9SB 3FFKB 4RU9A 5JU5A 3DRRB 3RJEA 5M2UA 4NPOA 1NNDA 4BRHA 1HHQA 2ZJPL 1N5XA 1JJCB 2B6GA 3JPRA 4LIWA 1HARA 4BGBA 4ITSA 5KFHA 2ZWPA 3CD0A 3HHLC 4FJKA 1PUZA 3MAAB 2UUAK 4I2QA 4U7UD 1N2XA 4YFUA 1X5PA 2PKEA 4O0NA 3D6FB 4KLTA 4M5MA 5KFNA 3QGIA 2MQQA 2UUAF 4AL5A 5CJ7A 2E1MC 2Z2ZA 2LI6A 2D0PA 1ZTWA 4KBOA 3KJNB 1Q5VA 4LF4J 1S9EA 3CC4S 1G6BA 4ILHA 2VODA 5HVGA 5FPEA 1NPKA 1FDBA 1WF0A 3O4QA 2MMYA 4DU1A 1U1RA 2OH2A 3LALA 2IRXA 4W5RA 4C7QA 1VSLA 3OYJA 2Z4PA 3PLAA 4B3OA 2EDUA 4KX5A 4DV2J 4ZH4A 3R3LA 3P8BB 1A0OB 3TO8A 3M6GA 4CJFA 3W62A 4EUVA 5CQGA 1HQUA 4PPZA 1F44A 1UHUA 3MXJA 3F2KA 4OYBA 4UUWA 2L9NA 3F73A 7ICKA 3AFGA 5JVGQ 1M0SA 4NCBA 1BWFO 2HBKA 1UW9A 3IGVA 3ILLA 2E5LJ 3PFEA 3ZSZA 1NK7A 4KV8A 5J2JA 1QAXA 4ECQA 3NRWA 1Q78A 3CUNA 3F5AA 1HNWF 2OYYA 5GTIU 5BOLA 3HT0A 4MMOA 4K4WA 1R0AA 4FL9A 3HVTB 1WI8A 3DRXA 2VL1A 1F60B 4IQWA 3HJVA 2XCPA 3EE9A 2H5IB 3N0VA 1IXRA 4WZMA 1VSFA 3H5SA 5I3UB 3OTOJ 4FWRA 1R8BA 2EAOA 4WFNQ 2ZH4A 5JVHL 3KWMA 4I69A 8ICPA 4WQ4C 3KK3A 4KREA 2XYHB 1AROP 1HNWK 3DGPA 4DR3K 3RG6A 4DZ6A 1P90A 3L4PA 3MN5A 1WHWA 1ZD4A 1BCMA 1RT5B 5RUBA 3EZOA 3BJYA 1X9XA 1NU4A 4DWIA 1TVRA 3ULEA 2CQBA 2QWNA 3K0SA 3W66A 4IL6U 3CULA 5DETA 3HWTA 2M3DA 3QWUA 2P35A 4Y1DA 4DV0K 2HI0A 3OL8A 3I55S 1CUKA 4QOTA 2FHJA 4NA2A 1VDVA 2MZSA 2NZCA 5A8RA 1JJ4A 2GFFA 3SDEA 2JXJA 3EGNA 4OD0A 3M9MB 4P71A 5M1QA 1IBKF 2UVWA 1PC4A 3VQTA 2X74A 3KD5E 3KKSA 1Y88A 2ASOA 5KFYA 4H0OA 2W7OA 2WB4A 4ZHRB 2OTJS 4F5PA 2D0OA 4CO2A 1TUWA 1IBLF 1RQ0A 1KQSM 4DV0F 4FPIA 1U04A 2ZH9A 1ZD2P 2HHHF 2BX6A 4IQUA 4M3RA 5BN9A 1WG5A 2YN4A 2CQPA 9RUBA 3T5HA 1I5OB 1BPDA 2MUTB 3HSZA 3R7SB 4M3YA 2HLUA 4YMMA 4Y2YA 4RQ6A 4I2GA 3PYGA 2VBXA 5LY3A 3W64A 1WHYA 5LL6Z 1SH2A 2E7WA 3RB4A 3H4BA 4RNOA 3TU5A 1IR2A 2IIHA 4QIEA 1KP6A 4JEPA 4NLRA 4M3UA 2IVYA 3CF5L 1S6QA 2E1AA 1CJVB 4ZA1A 2P9IA 1WI6A 2VFUA 1PO6A 2KU7A 1B0VA 4U7BA 5GAEU 1NGJA 2DGWA 3UVJB 5FJ4A 2JFDA 2GC8A 2C1EB 4KFBB 3IA0A 4USHA 5J0UA 1N36F 1L3UA 2LHTA 1RJJA 1S5ZA 2IC3A 3I28A 4W92B 3VGLA 2N4CA 4PQUB 2JFKA 2EZYA 1X4EA 4QPTA 1UA0A 1EAYC 1X6IA 3KBBA 2GIQA 2HBYB 1U02A 2NXEA 2OIHA 2GMJA 4QS9A 4E1MA 2F2AB 1REVB 4N56A 4QYRA 1A6SA 1S9EB 1AQ6A 2XWYA 1WTBA 2O67A 1Q4RA 3LYSA 1BHNA 5HVFA 2C3OA 3C46A 1C0UB 4RT2A 3C21A 3A13A 1H7XA 5F8NA 5KG7A 4M9HA 1ZQRA 4CO3A 2AGPA 2ZOFA 5AQSA 2DF4B 4ISFA 3MPDA 5LOQA 4M3TA 2R8KA 2OPSB 4CO0A 4LVNP 3H7HB 1FDAA 4CF3A 4K8ZA 1CULB 2NCKL 1HQUB 3K4GA 3HHLD 4I4BA 3S6EA 2CPJA 2EWSA 4NZ6A 1ZTTA 1DK2A 4CJEA 2P9PB 2QL5B 2O8CA 3PJWA 5GIPA 2M0NA 4Q7AA 3B8AX 2XZWA 2VGNA 1S3XA 4E1NA 2CPFA 3D0GE 3K57A 2P5GA 1TV6A 4PJ0U 3D1HA 2IRYA 1U45A 2XBPA 4LFBK 2Q79A 1LFWA 5CZ2A 1RWUA 4IDKB 4ZCKA 1R0AB 1KVJA 4C8NA 4CIGA 3CCEN 1GLCG 1AB8A 3FCVA 4C6AA 3E2EA 3E9LA 3P4UB 4CZGA 2MY7A 2R7RA 3ALYA 5LJ5Y 5SWMA 2HQDA 3PSFA 3Q8YA 3NLCA 4WK3A 1RDCA 3O2IA 2KICA 2F77X 2YCHA 4PCQA 4DR4J 2P51A 1RTJB 2ZFHA 3AB2B 8ICSA 5J2CA 1RYUA 3PXGa 1X9JA 4JI1K 2K60A 4C9DA 2W01A 4MO5A 3FZKA 2CPRA 4EYHB 2EEYA 5B66U 4KLOA 2K2PA 5JMNA 1VQPN 4UQGA 2IOHA 4YMNA 3KFUF 5F8LA 4MEXA 3V9ZA 1Q46A 1HWJA 1S4FA 1Z00B 3DYAB 2VFRA 3H40A 3RUBL 2WF6A 1FX2A 5AK5A 1KVBA 1UOCA 3ZNJ1 3DI6A 5KG5A 4AUKA 5LXYA 2KQ2A 2UXBK 3OTQA 4QZIA 2Y9HA 2W8KA 4TQRA 1JKHB 4BWJA 3PDNA 3ZLJA 1KN5A 2LBOA 2WAQD 3MCMA 4CJTA 2JZBB 1X9SA 5A8RB 4Y0FA 4HYKA 4ED2A 4IOCQ 2DGVA 4CHOA 1YIJN 3D0IE 2V67A 5ADZA 2NXUA 4DR5K 5FP0A 3CCRS 5A0YA 3O1LA 2BHNA 3TZYA 4JI3J 2BE7D 1NGEA 5ALPA 4WP3A 3Q8VA 4UB1A 1HNXK 3U6FA 3DV9A 2GIRA 4KLJA 4KHQA 1FRMA 2YWGA 3SJHA 4RQ3A 2OYQA 3FFIB 1FIQA 2FLPA 2MQPA 3NASA 1F5CA 1YJWS 1FE0A 1J2NA 2EG2A 2BVZA 2QSFA 3D2FB 4NLOA 1TYQA 3RJJA 3CJSA 2D9OA 4BR7A 2LKZA 5HL7L 2LPEA 1RYRA 3ZTOA 5DQIA 1FVSA 1Q82O 3QQCD 1NOMA 3IM1A 1Q8BA 4GVEA 3GSDA 4J9NA 2Z57B 1NZAA 5JXSA 1TTHB 3VGUA 4CK2A 2F7VA 3KNAA 1R6VA 3IBWA 2DFLA 2ZJQQ 5F0XA 1RP5A 1U6ZA 5E41A 1BIUA 4XEIA 2A1JA 3DLRA 2DNZA 4CJWA 5IT0A 2QB1A 3UDEA 3TPQA 3VF6A 4GXKA 4ZS6A 3BQTA 2L48A 1ULRA 2XY6A 3TJ9A 3DHWC 4A8MP 1FJEB 5U47A 1R0CB 1VSMA 9ICCA 5AKYA 2XY7A 3N28A 3RYLA 3PW0A 2AHOB 4I2EA 1ZAXA 5CR0A 2E5LF 2DY9A 1REVA 5D3GB 1CVJA 3MXHP 3L2UA 3B9JA 5J2PA 2ZVSA 4TSXA 4I1TA 1HR0F 5KQDA 1OW5A 1NGFA 4K5RA 4FJJA 2PAVA 1EQMA 2VICA 1UFLA 3SPZA 1HLUA 2QKKA 3PJ9A 1VJ5A 3P39A 5A8WB 1RTZA 2ZH8A 1CI4A 2C3UA 4HKQA 1HJPA 4CE9A 8ICYA 3QX7A 4R63A 3E58A 3VEOA 5ALSA 1S49A 3AQPA 3IWNC 1BHLA 1FKPB 4KHPF 1OPIA 3ZXWA 3HT3A 1A5VA 4CLSA 3GIIA 3CMEN 3BH7B 2MHNA 2AU0A 4I2IA 3AVJA 3G0ZA 5JTIA 2OPSA 2HRUA 1JXVA 4RU2A 4M5DB 2C2EA 4PWDA 1IR1A 4J37A 4RBUA 2G07A 2M4MA 3UR3C 5KGXA 1NK9A 4GMJB 1QQ5A 2PN6A 3WIVA 8ICMA 4AHCA 2KSOB 1SV5A 3CJBA 4W5OA 1FDNA 2X6SA 4CJKA 1DURA 1W2BR 4Y2TA 1ATRA 1G7CB 2HW3A 1WF1A 1K8KA 4Z6DA 4OYWA 4P75A 1ITPA 4BQLA 3MEGA 1QHAA 1ZS6A 2Q6BA 2HGMA 2GJ2A 1HWIA 3NF6A 2IM1A 2GVZB 3NEKA 4F72A 3MM8A 4O44A 1S1XA 4RL1A 1H3DA 3H46O 1VIOA 1VYAA 3HPHA 4FJ7A 1YJRA 4PG5A 4B9TA 3CRXA 3AVIA 3WX4A 2W9AA 2I0XA 3GP9A 2CQ4A 1Z2LA 4ILJA 4BR9A 5KFFA 2KVCA 4DXLA 2BH1A 2HFSA 1HEKA 1Y97A 2DNYA 1XK8A 4M3ZA 1JROA 2BPCA 5LM7E 1Q7YO 1FFSB 4J9MA 4OJHA 5BXIA 5GADP 1WEXA 2A2CA 2H3IA 2NS1B 5DGAA 5THWA 3NS6A 4GKKF 4FJ5A 4TYAA 1WEZA 4NL5A 2G08A 2ESEA 3RU0A 4WFXA 1GFWB 4B1WB 4QWBA 4XDCA 2LQ9A 1J97A 3R5GA 3MR6A 3IBCB 3GV8B 3MTKA 1EX4A 2VG6B 4WWSA 2QWOA 4ZVFA 3NNHA 4NB4A 1AFIA 3EEQA 2WONB 1NNEA 3R6GB 3GR1A 2FZCB 1EHWA 4CZFA 4BY9C 2ZZTA 4A8QA 2MY8A 2XI2A 3HHLB 2KKHA 2ZH1A 3CCJS 3RRGA 3BPDA 5HROB 1MN7A 3BP8A 2IVOA 1X5OA 2G8UA 3CJ1A 4YB5A 3KMQA 1IBKK 3OBIA 2FLLA 4URSA 3IRXA 3UXPA 1K47A 3ZTSA 2IA6A 3VCDA 4CK1A 2J0SD 4Y2AA 1YTUA 1WC0A 4AE5A 5AXLA 2F76X 5ALDA 1CRXA 2V8DA 4ICLB 2PYJA 3ALRA 2CPZA 1KBUA 4DR1K 1RYSA 4PWUA 3L95X 3SV3A 4OZ1A 3BKUA 1VQSA 4BE2A 4ZVGA 5BPLA 4EAHD 3SYZA 1RHKB 4MLEA 5FIIA 1VQOS 3NFAA 4QR2A 1SWVA 1Z1VA 3TTDA 2RAQA 2POKA 2LCWA 3DC2A 3R5AA 3MEDA 3MDCA 1AUDA 2Z1HA 2AJ2A 2O8FB 1NJIT 4H5VA 2LYHA 1HNXF 3C8YA 5MLCV 2ERRA 1RBTA 3W5ZA 4DF4A 2EAMA 1MU2B 5ALKA 3WK7A 1D0EA 3T5LA 1BPEA 2GMHA 5IM0B 4QZCA 3FZLA 7ICSA 3K1RB 3OTCA 1X42A 2XSFA 3BS5A 5BPNA 4R64A 1IG8A 1JCGA 2W2QP 1NM2A 1ZJMA 2RN2A 3VGMA 5HL7Q 3NMRA 3M8QB 7ICJA 4ZLPA 4U8VA 4P9SA 4O3NA 3MDQA 5EE1A 1T0TV 2A3ZA 3ZSOA 5IIKA 1RXVA 4JKDA 4CWBA 1QQ6A 5KT2A 4KPCA 5LMNK 4LR9A 1WWVA 1EXQA 3TARA 3A4TA 4KN7A 8ICBA 1NWKA 2N7YA 2NXCA 3AU6A 5JJBA 3VN5A 1FKAF 3DRRA 1DZ5A 4Q0BB 2FB0A 3VAMA 4W5NA 4I0WA 2CPDA 4PZOA 3V5RA 3O6QA 2ZUDA 2AT1B 2P6SA 3ET6A 1J2VA 3SMPA 1XC9A 1QUVA 4NX9A 2NRZA 3MM5B 4FLVA 1JXEA 2BDPA 4L73A 3S3MA 5B0GA 1Z4OA 2RP5A 4DLEA 4OX6A 4B1YB 3BEGB 2HAFA 4J9QA 8ICCA 3BGRB 3CJCA 2W3SA 3MABA 3NKYA 3HYFA 1NJIO 2YJEA 2O4IA 3A12A 4IWVA 3SUNA 5L9NA 1NO8A 3TFSA 2CWKA 3KFWX 3PYFA 3MEGB 2HKEA 2L41A 1T4GA 4USUA 1RTDB 3WKEA 1U2FA 5LMNJ 3FEXB 1Z26A 3ETLA 1VHIA 4CZJA 2F4VJ 1RT6B 1NKBA 5A0YB 2W1BA 2ZF5O 2E8MA 3DJCA 9ICXA 2NRHA 3BR9A 2QLWA 4AHRA 4F3QA 4B3MJ 3SSRA 4CZHA 4E7HA 4G9BA 4GC7A 4USIA 1UEKA 2ZOMA 3DOKB 3FVYA 4MYTA 5B0FA 1HHTP 4DS4A 3C28A 3DGVA 4DTNA 2DJWA 2WTFA 2FZGB 2DNHA 4F4KA 1ZM4A 4QWCA 2C2KB 1D3WA 1XN9A 2P9NA 2YNFB 9ICGA 1C20A 4B1ZA 1PBAA 4CP5A 3CCSN 4JI3F 8ICKA 1T44A 3FRZA 2L9WA 3KG1A 4AF1A 2ETJA 4KH1B 2KXHA 4HAIA 5HJXA 5I4MA 1LEOA 4LC9B 2IS3A 3JPPA 2V69A 1TFWA 2OEMA 2MUTA 2XMTA 3UD4P 4J03A 2HHUA 2VA3A 1K73T 2IAJA 5KFTA 4I2AA 1UVLA 4X4VA 1W26A 4X4QA 1MG7A 2MXYA 3TAMB 3DRSB 3CJRA 2FPHX 5IIIA 4Q44A 4B9NA 3S3NA 2Y9UA 5GAEP 4MFFA 2BPGA 3H2LA 5AI4A 2WONA 1JCEA 3L3CA 3H8SA 2W54A 2V2VA 1T94A 2DQNB 3TOQA 2CPEA 2PFOA 1VQYA 2UUBF 2YX8A 2DHHA 4V19S 2J7WA 3TSUA 3VPZA 3AXKA 4RW7A 1MQ3A 1D9FA 3BY5A 4QU7A 3OA9A 1BVSA 1JL2A 4BRKA 4KQZA 4YORA 3GFZA 2MPUA 2MB0B 4KFBA 3W5YA 3H2VE 5F8MA 2UXBJ 3FZMA 4BGDA 3VQ6A 1VC0A 4GV9A 1J5EK 2K8GA 1ECWA 5J8YC 4EFHA 3WC2A 2KG0A 2HHQA 1JX4A 4D3HA 2VFSA 3DDNA 1KLNA 1OH8A 5LMUJ 4B9MA 1N33F 4AM6A 1KFSA 2CQ3A 4QBUA 2VFVA 1EKRA 4KH4A 4XIUA 1P27B 2DK2A 3ZD9A 2H1YA 2DR6A 2OEKA 1V3RA 2YWEA 3LP1B 3CPEA 2Y8WA 2HSZA 3FM9A 3GDXA 3DKDA 3CB4A 3W60A 3HZGA 3TNVA 5DDYA 3AEVA 1MU2A 4M5DA 3VVTA 3CO9A 1FJGF 4M63C 4MTPA 3TA0A 3CCMS 5J2IA 2M88A 4FZNA 5AQQA 4CJPA 2J6SA 5DM7Q 4K4XA 4R65A 3M1YA 4B1XB 3M2UA 3D7SB 3G82B 2BACA 2LM1A 1EWQA 4QNLA