4F2SA

Dna polymerase i large fragment complex 4
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
578
structure length
578
Chain Sequence
MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 199
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2sA01
2ZTDA 2IS3A 3ZT3A 4WE1A 3O3GA 5KG3A 2YNIA 4RT2A 5KFFA 2HW3A 4RZRA 4E7IA 3RJFA 1WCLA 2PYJA 4Q5VA 2R8GA 3OVNA 3ZT2A 3KLFA 3RR8A 4F5RA 1X2IA 4GVMA 4BE0A 3HPHA 4KTZA 5BOLA 4BXOB 4BDZA 4CHOA 4CHZA 2AU0A 3JSMA 1CEZA 4QZ8A 4IFVA 5DB7A 4Z4CA 3TANA 8ICQA 5JS2A 2G8VA 4CIGA 2C2EA 1C0TA 5L1KA 1BIZA 1NOYA 4YR0A 4M3RA 2PY5A 5HNKA 5DKWA 4KLSA 4QWBA 3RRHA 1IKVA 4FLUA 3M8PA 2VA2A 5KFEA 1XSPA 4K8ZA 3NFAA 4ECZA 1VSLA 2J6UA 1VSKA 3DLHA 2HHSA 5F9LA 3VQPA 1WNSA 4FXDA 1VSHA 1WSHA 1N6QA 4MF2A 1QTMA 4KLQA 4M3ZA 4CK3A 4N41A 8ICYA 2BGWA 1U45A 5DQIA 5DG9A 4OPJA 3M8RA 8ICEA 5D4BA 4DTRA 3MEDA 4FJKA 1J5OA 2EX3A 4QOZB 4TSXA 3NF9A 4FS2A 1RILA 3AVGA 9ICTA 5DLGA 3Q8SB 2BQRA 4W5TA 5J2QA 4LVSA 8ICTA 5J2FA 2KZMA 2IHNA 4IQVA 8ICIA 1FKPA 2IHMA 1RZTA 3QEVA 3MFHA 2FPLA 5KFYA 3RB4A 3MDAA 3ULDA 4RNOA 4YR2A 4DTJA 3V9ZA 3U3YA 4F2SA 4DFPA 1SL2A 1XO1A 2ZJ8A 5J2AA 2JEIA 3LDSA 2AQ0A 2OYQA 4N56A 3O4QA 4DWIA 4PA1A 2XCPA 4ZTJA 1L5UA 4KTWA 4CHYA 2BE2A 4ECXA 3RB3A 5KFRA 2Z1HA 4FJLA 3M9OB 1L3UA 5CYQA 2C2DA 1CZ9A 3RMCA 3OYGA 2XHBA 4FM0A 2ZJ5A 5T7BA 5KFKA 2BPGA 4FJXA 2JGUA 1DGSA 2YHBA 1REVA 3VQQA 1JLBA 9ICMA 4FZXC 2OPQA 2F1IA 4GXJA 3PNCA 2P5GA 5J0XA 1IG9A 4Q44A 7ICUA 3E2EA 9ICGA 4DFKA 4HUEA 2BQ3A 4PY5A 1A76A 2I5JA 3Q8QB 4CEZA 1Z00A 1HRHA 5KFBA 3PV8A 1ZQWA 3MR5A 3ITHA 3ZT4A 3M8SA 8ICFA 4I29A 4CJWA 1ZJMA 4Z6EA 2GUIA 2RN2A 3HPGA 4F92B 1EX4A 2WOMA 1RDAA 1WAJA 4ELVA 1S9FA 2B21A 4F91B 4GXIA 3PVXA 4I2BA 4F4YA 3L2RA 3OS2A 3KJVA 4R64A 4O4GA 1AROP 1RPLA 5CHGA 3HYFA 4KN4A 2YV0X 4L8RB 3SZ2A 1WCNA 5F9NA 7ICSA 4ED1A 3V1RA 4M3WA 5J0PA 4KLEA 4B9TA 4M3YA 3MFIA 5DQHA 3UXOA 9ICXA 3DI6A 1UT8A 9ICUA 3AV9A 3KKRA 3NBPA 5EWEA 4F4XA 4JLHA 4CF2A 3UQ0A 3HXMA 1BPZA 3RJJA 1QSLA 5J2IA 4MFAA 4BE1A 1HYZA 4QZDA 2XO7A 1N5YA 4CJTA 5J2GA 1WSFA 4FZYA 2VWKA 4BACA 3RJEA 5KFWA 3L8BA 1JLCA 5KG5A 4CERA 3SUOA 5J0TA 3AVCA 3OYFA 2P66A 5FRNA 4JV2A 3SQ4A 3V9UA 1BPBA 8ICLA 2DFFA 3Q8PB 1C1CA 1ZQUA 3PW5A 3T5LA 3NE6A 3DYAA 1XSLA 4Z6FA 1ZQXA 2E6MA 4W5OA 1L3SA 1T7PA 4CJEA 1C6VA 4CGDA 1KLMA 1KVBA 4DSEA 4NM2A 4C8LA 4DTOA 7ICVA 3DLKA 4QZHA 1BQNA 5D46A 4KFBA 5KFHA 2OWOA 2OPPA 1NJZA 1BCOA 1S0OA 3B0YA 3AVLA 5DB9A 1B9DA 7ICRA 4RQ6A 4Q8FA 4NLNA 5TZVA 5DDMA 4MEXA 3K5MA 3GDXA 4J9MA 2XGQA 4J9RA 5JS1A 4KB0A 1JMSA 4QCLA 4RQ3A 3ZDDA 3I0RA 4DOAA 5HHIA 5J0QA 1TAUA 1A5VA 4DL3A 4Q0BA 3HX0A 1TFRA 3TI0A 4OLBA 4MEYA 3UPQA 1D5AA 4Z6DA 3T5JA 3I0SA 4PWDA 3PX4A 4RG8A 4I2GA 4H8KA 3PW0A 4GLXA 4IR9A 5HROA 4RQ8A 2F96A 3Q8KA 4IR1A 4ZH4A 1Q8IA 1KCFA 2ZTCA 4B8CA 1TL1A 3H40A 5J2BA 2A1RA 7ICLA 1B92A 5IILA 2P1JA 3JYTA 2DFHA 3RMBA 4E7KA 3TWHA 2ASLA 3LZIA 4I2EA 1MQ2A 4LZGA 1QE1A 1LV5A 8ICHA 4QWDA 4CFDA 4M04A 2Z1IA 3V9XA 1SKSA 5C42A 4CEQA 2XC9A 3LANA 4LH5A 4B8AB 3QEPA 4QW8A 4OVLA 3CFRA 3AA3A 4M9JA 2HHUA 2BCQA 3BQ0A 4CEFA 2ZD1A 3V9SA 1C0UA 4UB4A 4CESA 1IKYA 1RT6A 2MUTA 5L9XA 3BJYA 2BCRA 3ZSZA 2JZBA 3BGRA 1XS9D 9ICPA 4CGJA 4JRQA 1Z00B 3SJJA 1ZQIA 3GV7B 1KFSA 5KFDA 5KFOA 3K2PA 4Y1CA 4JV1A 3VQ9A 3ETLA 4M47A 7ICQA 4OLAA 9ICVA 2RKIA 1NK4A 1RBRA 4I27A 1RYRA 4KHYA 1S0VA 1HUZA 4ID1A 4QZBA 1ZBHA 4CJQA 1J54A 4DQSA 8ICXA 4ECTA 5KFJA 4E3SA 1KSPA 2A1SA 4P4PA 4BDPA 4FJMA 1BHLA 4FJ8A 1GOCA 1ZQOA 4AILC 4FJJA 1EXQA 1ZQLA 1S1WA 4RNMA 3LP3A 1CUKA 3OYMA 4UQGA 4LZDA 4KV8A 4JWMA 1TVAA 2G8HA 2FLLA 3SUQA 2BGGA 2PI4A 2HHTA 3SPYA 3V1QA 2Q3SA 4OKJA 2Y1IA 4GC7A 3EPIA 4FZZA 3Q8LA 4ELUA 3AA5X 2P6RA 2IAJA 3HP6A 3ZSVA 2FBXA 2PFPA 1S0NA 5FROA 2KFNA 4XRHA 2DTUA 4DL4A 5J2HA 4NM1A 4JS5A 3HK2A 3QEWA 4J2DA 4I2HA 2VG5A 3V72A 1S1UA 4KREA 4RQ4A 8ICPA 4P4OA 4I9QA 2W9CB 2AGOA 1BISA 3AVMA 3WNGA 4O9MA 1NKEA 2ZUBA 5C25A 7ICJA 5CJ7A 1TV9A 2NUBA 3K5LA 4C8MA 4FJ7A 5KFVA 2HB5A 1RBSA 3ZDCA 4M42A 1T03A 1VSIA 1MC8A 2F8SA 4F3OA 1NK0A 3OSNA 7ICNA 1C1AA 4X5VA 2NRWA 1S6QA 3DMJA 7ICTA 5KI6A 2ISOA 1I3AA 3IRXA 1BCMA 4HTUA 4LSLA 4IRKA 4K8XA 5J2CA 3TAFA 2FBVA 1H38A 3QEXA 2M9NA 5KFZA 1TK5A 5DK5A 5J0YA 4EYIB 4QW9A 4F4WA 4DMNA 5KG0A 4TURA 2KW4A 3MGHA 4FJNA 3MXMA 4CJUA 1DTTA 2IC3A 1DOQA 4KN7A 4AHUA 4J9NA 3HW8A 4I2JA 4TUPA 2ZUDA 3MXIA 2VG7A 4EBDA 4AHVA 1ZJNA 4I7FA 4PH5A 1XI1A 4KITB 1ASWA 3LZJA 4F5NA 3V7KA 3O4NA 3LWMA 1N56A 4PGYA 3OYKA 4Q8EA 4BWJA 4RW4A 1LB2B 1JXLA 3MAQA 3AO3A 3RH5A 4ED7A 2BQUA 4PHPA 3PY8A 3RJKA 4IFYA 3KD1E 2HHQA 3I8DA 3RWUA 2BCUA 4FJHA 1LAVA 8ICKA 3JPPA 2G8UA 1ZBUA 3HP9A 4RPZA 2BPFA 2W9BA 4N47A 3RBEA 3GIIA 4R5PA 3KD5E 4MF8A 2XY8A 4CJRA 4KHUA 2Q0ZX 1YVUA 1G15A 4YVZA 1ZQMA 4CIFA 4CEBA 2MUTB 4W5RA 4CJVA 1J9AA 3VQ5A 4I2QA 4I2IA 4F4ZA 3FYHA 2JZBB 5J2PA 1S76D 4F5QA 3VQAA 4F5PA 3VQ8A 5EU7A 3G6VA 4YXMA 4EEYA 4B9NA 2E6LA 4B9VA 3L2UA 3DLBA 3ZCMA 4NLGA 4CJ4A 3ZSRA 3KHLA 1JL1A 4FVMA 4RPYA 4FO6A 1IKWA 4CJ5A 8ICWA 3QZ8A 2PI5A 1BQMA 3IAYA 1TK8A 1S1TA 1KLNA 4Z4GA 3KHHA 2DPJA 2VWJA 2XY7A 4FJIA 1XWLA 1NJXA 5FRMA 5KT2A 1HQUA 1HJPA 3VQCA 4I2AA 1BL3A 5SWMA 4O5BA 3K4GA 4YQWA 3C21A 1S9EA 1BIUA 1C0MA 1ZBIA 3DLEA 3D0PA 2BANA 1CLQA 3QETA 3KHRA 1MSWD 3NGYA 4YMOA 5L1JA 3ZSQA 4TQSA 4B9SA 4ECVA 1ZQBA 2MAXA 9ICOA 5KFAA 1EKEA 1PZNA 1ZQKA 3H7IA 1WSIA 3ASMA 3WNFA 4F2RA 4W5QA 9ICKA 3ZSWA 4GC6A 2AQ4A 3F9KA 3NH2A 2V9WA 3QIOA 3AVFA 3FFIA 2JEFA 1FKOA 3NF8A 4ZHRA 3O3FA 4ECQA 4I2PA 1W9HA 1MQ3A 1ITGA 1LAWA 4E89A 3IM1A 5DGBA 3QESA 2UVVA 4F3TA 1TK0A 3HSTB 3H4BA 4Z6CA 1KFDA 2JEJA 3C1ZA 4JS4A 3RR7A 5KT6A 1TKXA 3EW9A 1Z25A 3C94A 3TAGA 4IQTA 7ICIA 4DL5A 4KLUA 4PQUA 2LYHA 2ITGA 4CGFA 1U9LA 1L3TA 3UIQA 5CB1A 2W9MA 4DFJA 2NRVA 4E1NA 4NCGA 4CF0A 4M2YA 4PHEA 4NLZA 4J9KA 3C6UA 1Z3EB 3MDCA 1ZQDA 4XUSA 3OYLA 4RT3A 1ZQFA 1JKHA 3EPGA 1S1XA 4YN4A 3E01A 4AH9A 4CJKA 1J53A 2KTQA 3C23A 9ICJA 3LP0A 4NY8A 1ZQPA 4LD0A 4XQ8A 4O3QA 2RDIA 5J2KA 3SQ1A 2KFZA 4QZEA 2UVWA 9ICFA 2D0CA 3A2FA 5CYMA 5HRPA 4J2EA 4CK1A 4R8UA 4J9QA 8ICUA 1U47A 3AVJA 1ZQGA 5KFSA 3HWTA 4FLTA 2OPRA 3V81A 2DFEA 1BPEA 4KHQA 3P5JA 4I2CA 5HP1A 3B0XA 5C5JA 5KG2A 2YHAA 3JPSA 1ZQAA 2FBTA 4FCYA 3AUOA 1SKWA 2EHGA 3JPTA 1RXVA 4HUGA 3DM2A 4IQWA 1B22A 5EOZA 2B5JA 4YFUA 3V4IA 2F1HA 5KTQA 5CZ2A 1TKTA 3KLGA 4RW6A 1JXBA 2BCSA 4B9UA 2W9BB 4Z4EA 1DTQA 1RNHA 4QWCA 4O44A 3C95A 5L1IA 2V4QA 1Y88A 3DRSA 2WONA 3ZD9A 3RRGA 5KFCA 4RQ2A 2ATQA 1D8LA 4N5SA 1D9FA 4Z4HA 2NRXA 4MFFA 1U49A 3OYAA 4QZAA 4H4OA 2KZZA 3M9NB 4O3OA 3HVRA 8ICMA 1EXNA 1VK0A 3BDPA 4TUQA 3PX0A 3OYBA 2W9CA 2YKNA 1L3VA 4K4HA 3B6PA 2HNDA 2FC0A 4GW6A 1COOA 4CGHA 4TQRA 1RTHA 5HMLA 5K14A 4QAGA 3GILA 1RTDA 4CJFA 4KHSA 1EETA 5HMMA 4J9PA 2BPCA 4YMMA 3NH0A 7ICFA 2KZ3A 2FLPA 3KLEA 1RT4A 4CF8A 1XHZA 4FK0A 4QZIA 5J2EA 4IDKA 3L3UA 4CFAA 3KHGA 4Y1DA 1W0HA 9ICSA 2AJQA 3KK3A 4RPXA 3G6YA 4NLKA 3PW7A 5HRNA 4FW2A 2W8KA 3OS0A 4QWEA 2OA8A 5KFIA 3QIPA 4DS4A 1RT1A 4DTXA 1JXEA 8ICAA 3AVBA 3N97B 4ECRA 4E19A 4CEEA 4KAZA 1X9SA 1NJWA 1ZQHA 4DSFA 3WNHA 5J2DA 3BQ1A 1HYVA 3ORYA 3V7JA 1RT3A 2ZJAA 3SUNA 4M9LA 4ELTA 4DEZA 4HCCA 3PX6A 4DQIA 3UQ2A 3T5HA 2W9AA 2X6SA 3H8WA 3OGUA 2C2RA 2YNFA 3TARA 3ISCA 4CIEA 4J2AA 4AHSA 2D5RA 1S9GA 3OYNA 4CEOA 4RNNA 3LAMA 2KQ2A 2GBZA 4K4GA 5KT4A 8ICOA 3H8JA 3VA0A 4UB5A 3MECA 4KPYA 4ID5A 4C8NA 3QEAZ 2I9GA 3P1GA 3OYDA 4R65A 4P4MA 5DDYA 1BI4A 5L1LA 5IINA 5KRTA 1BPYA 3K5OA 1KTQA 2PFQA 4UB2A 5DG7A 4M3UA 1VSMA 2DY4A 3QZ7A 3GIKA 4KLTA 1HUOA 5DBCA 1VRUA 3AU6A 4DQRA 1RXWA 3PO4A 1QS4A 4KO0A 1NKBA 4EBEA 4DF8A 3OSPA 1GOBA 2VANA 5CZ1A 4F93B 1SZPA 4R8UB 1RT2A 2Z1GA 3VQEA 3FDSA 1SV5A 3QLHA 1NJYA 5HHHA 4KLGA 3NGZA 4RU9A 4FJGA 1JN3A 2G8FA 9ICQA 4MFCA 3MXJA 1ASVA 4PHAA 3C5GA 1TAQA 1YTAA 3K5NA 2FPMA 1F21A 3DLRA 3L2VA 3IG1A 2HNYA 5KG7A 4HVJA 4FLZA 2X6NA 1RBTA 1R0AA 3KIOA 5I42A 1DLOA 5KG4A 4MFBA 4CGIA 1NK5A 1RTJA 4DU4A 4O0IA 1CXUA 4RUCA 3QNOA 4CJLA 4QZFA 4KHNA 3HO1A 3THVA 3AVIA 4CHPA 3OJUA 2RPIA 4E1MA 4Z0UA 4UAZA 1Q9YA 2E4LA 2HMIA 4HYKA 4RQ0A 5J2JA 1ZQSA 1HNVA 4RQ1A 1X9MA 2FMQA 9ICCA 4HHTA 3NGIA 4ED0A 4CK2A 1TV6A 5EWGA 3MBYA 1T3NA 5IIKA 3RB6A 4DTMA 3SQ0A 3ZDAA 1BVSA 3AA4A 3HL8A 2R8IA 3VN5A 3VQBA 3OYHA 1X9WA 4CJ3A 3GQCA 3O3HA 3OYEA 3HT3A 7ICKA 1ZYQA 3K75D 2J6TA 5KFTA 4G3IA 3PMNA 3ZSYA 4RW7A 3MABA 3NCIA 2GV9A 1X1PA 1IM4A 3JPRA 4M3XA 5KRSA 4KI6A 3AO2A 2BKEA 1O1WA 3AU2A 3LALA 1KFTA 5CY4A 2ZQBA 3RH6A 4KLMA 4RW9A 5CP2A 1SKRA 2UVUA 4E7HA 4F8RA 4KTQA 7ICHA 4YFKA 4ED2A 3NH1A 2BHNA 4C8OA 4G1QA 3P83D 3EWAA 9ICAA 4IG3A 4YR3A 3AO4A 3CFOA 4FLXA 3LAKA 4CF9A 1RDCA 4J9OA 1XU4A 3SCXA 4DL7A 5JUMA 3M9MB 8ICNA 1TKZA 2W8LA 3ISBA 4M6WA 1S77D 3MR6A 3OJSA 4CJPA 5KGWA 4F4KA 1ZQJA 5I3UA 4ED6A 2PFNA 3OS1A 4NXZA 3OHBA 4M9NA 4CGGA 1IO2A 4XIUA 3EYZA 1A77A 3KKSA 4KB1A 8ICCA 4TUSA 3CM6A 3S3NA 4KLFA 7ICEA 3MR2A 1K1QA 1UAXA 3S3OA 9ICIA 1JLQA 3K59A 2J6SA 4B9LA 3ISDA 3H4DA 2Y1JA 3C1YA 3DOKA 1S10A 4E7JA 4O55A 4I9LA 3OHAA 1UA0A 1IH7A 4O0JA 4GXKA 5KFGA 1LWEA 1BI4B 4DQQA 2HNZA 3OY9A 1UOCA 2Z1JA 3LDAA 2RF2A 3PUFA 5J2NA 4HCBA 4ECSA 5D49A 9ICLA 3CFPA 4IG0A 2ISPA 4KKOA 1KVCA 3VA3A 3KLIA 1N48A 3C5FA 1RBUA 1S6PA 2XY5A 3PW2A 4M0AA 3DLGA 4EP5A 9ICHA 1U04A 4R66A 3SUPA 3TQ1A 2ALZA 4ED3A 5J0OA 4CJSA 3TFRA 3OYIA 4NCAA 4Z4IA 1ZQNA 9ICBA 2YKMA 3HM9A 4KRFA 2P51A 3SI6A 2PXIA 2ZTEA 1HMVA 1NOMA 3AVKA 4EYHB 5KFPA 3MGIA 1Q9XA 4DLGA 3LP2A 3H08A 1XC9A 1T05A 1FK9A 2AGQA 3ZD8A 3L3VA 3G0ZA 2G8WA 1S97A 4FK4A 4CE9A 4BGDA 4DOBA 3BQTA 3TAEA 3SV4A 1U4BA 3ZSXA 4O5EA 1ZQTA 4YD1A 9ICNA 2XRIA 3QNNA 2G8KA 3LPUA 1NKCA 3EY1A 5KFUA 4CHQA 3ZDBA 1RT5A 3QEIA 4F5OA 8ICVA 3QO9A 1FXXA 1UT5A 1CZBA 2ASDA 5J0WA 1C1BA 3CG7A 4PPXA 3KK2A 3NTUA 1JIHA 2PFOA 3RAQA 2WTFA 5DBBA 9ICRA 8ICRA 3NHGA 3SQ2A 3LP1A 4ECUA 3OYJA 1MU2A 5HRRA 1D8YA 4FLYA 8ICBA 3OYCA 4YG2A 5HRSA 3VQ4A 3MEGA 4EZ9A 4RUAA 8ICJA 4J9SA 1Z26A 3NDKA 8ICSA 1ZQRA 4BE2A 4JRPA 1SL1A 4N76A 2QKKA 2G8IA 4O3RA 3RB0A 2C28A 4FM1A 5DB8A 2R7YA 2OZSA 2DPIA 5CR0A 3NAEA 4IRCA 3TFSA 1JLAA 1JL2A 3DRPA 3T3FA 4ECYA 1WSGA 4DL2A 4P2HA 1EP4A 1ZBFA 3T5KA 3V7LA 1D9DA 3RJGA 9ICEA 3V6DA 3RJIA 4AHRA 1C7YA 2FLNA 4KHWA 4UAYA 3PR5B 1IKXA 4IKFA 2AGPA 4FJ5A 1KDHA 2UVRA 1WN7A 1RYSA 3VQ7A 3VQ6A 1S5JA 7ICPA 4FS1A 3HVTA 3TAMA 2FPKA 7ICOA 4OGEA 1ZQZA 4PGQA 5IIOA 3D45A 8ICZA 4I28A 3SYZA 5DG8A 5BPCA 4DTUA 5IIMA 4Q43A 2XY6A 2BDPA 1QLNA 4UAWA 2I1QA 1WSEA 3KLHA 2F1JA 4ED8A 3UXNA 4ICLA 4M6WB 2ZUCA 4GMJB 3N4MB 2A1JA 1K6YA 2P6UA 3BQ2A 2HVIA 3V6KA 4FM2A 4R63A 2FMPA 1WLJA 3LK9A 3RH4A 4M45A 2IBKA 4DTNA 4RQ5A 3SI8A 4B08A 3K57A 4KI4A 3AO1A 1WAFA 4M3TA 4OJRA 4UB3A 5IIJA 2GWSA 4KLHA 4MQ3A 4CHNA 3CYMA 4O3SA 3L2WA 4PHDA 1XHXA 3AA2A 1WSJA 3RAXA 3JPNA 5DLFA 5E41A 3QE9Y 3GFKB 4CFCA 3EZ5A 3NF6A 5SZTA 1T4GA 4DF4A 3C2MA 5KFLA 1S0MA 1VSDA 1ZQQA 2IDOA 1IXRA 4C8KA 2ASJA 3AVAA 4UBBA 2IOCA 3G6XA 3G10A 1ZQEA 1LW2A 3V1OA 3AO5A 1HNIA 3WNEA 5KFXA 1ZQVA 7ICGA 1TGOA 5KT7A 4DU3A 4DL6A 4CCHA 3LWLA 4DSJA 4FYDA 1HJRA 1S1VA 4KLJA 5EWFA 1NK8A 5DMRA 3QINA 1RBVA 1UWBA 5J0SA 3HPOA 2VG6A 2D0AA 3JPOA 2YNHA 3SPZA 4CEDA 3QERA 2BR0A 2HHWA 4YXJA 3L2QA 1HPZA 3MR3A 3Q8MA 1UA1A 4B9MA 1NK6A 3H8SA 5KFNA 2OZMA 2QK9A 3TAPA 1TVRA 4DG1A 4DTSA 5D3GA 2PZSA 5J29A 3DRRA 4DSKA 3K58A 4O3NA 4YCXA 2BCVA 4JUZA 4KLDA 1BPDA 4CFBA 1YTUA 2RDJA 4K4IA 1Y97A 3SV3A 3V9WA 1I39A 5KGXA 4B3OA 4QWAA 3QEBZ 3PMLA 1YT3A 4JWNA 1BPXA 3MEEA 2F8TA 5J1EA 3KK1A 4CF1A 3RMDA 1SL0A 1ZQCA 1KRPA 4RQ7A 2IGIA 2PYLA 2R8JA 1TKDA 3ZT0A 3S9HA 4FLVA 1RTIA 1LWFA 5KT3A 3ISNC 1A5XA 5BOMA 4YMNA 3TAQA 4J2BA 2R8HA 2HHVA 2NRTA 4YNQA 3F73A 4OKEA 3NF7A 4FK2A 4DOCA 1T8EA 4OGCA 3SNNA 4IQUA 3RJHA 4F50A 2B6AA 3TR8A 2XCAA 4Q45A 3V6HA 1RT7A 3CM5A 3UXPA 5KG1A 4BXOA 3T19A 1GOAA 4PGXA 2JEGA 4YD2A 1JLFA 1KVAA 1LWCA 4EBCA 2QXFA 1U48A 1NOZA 9ICWA 5HBMA 1HQEA 4AHCA 1TL3A 1LW0A 1HYSA 3U3GA 4RW8A 2HHXA 2ZE2A 4FBUA 4NYFA 3ZDEA 5HP4A 2ATLA 3RMAA 3GIMA 4UB1A 2P5OA 2D0BA 2JLEA 3AVNA 3RTVA 1BGXT 4HUFA 4FBTA 3VQDA 4FLWA 1JLEA 2A1JB 4EP4A 4LH4A 1VRTA 4DFMA 3PR4A 1KEJA 4M9GA 4DU1A 3DOLA 4QZCA 4DSLA 5FDLA 5KFMA 1ZQYA 3AVHA 2R8KA 5J0UA 2ETJA 4NCBA 1CXQA 2LSNA 3S3MA 1VSEA 4E7LA 3ZSOA 4DQPA 3V6JA 3U6FA 4KLIA 4FJ9A 4ZTFA 4PUOA 4O5CA 2XGPA 2C22A 3GV5B 4DTPA 5HLFA 4QZGA 1XSNA 4OKKA 2X78A 1QSSA 1JX4A 3C2LA 4Z4FA 2V4RA 2W42A 5CWRA 2FBYA 2YNGA 4OPKA 4DLEA 4KLLA 4H4MA 7ICMA 8ICGA 1K1SA 1ASUA 3IS9A 3M8QA 1NK7A 4EZ6A 5J0RA 5DBAA 3KTQA 3GIJA 4BWMA 1B43A 5KG6A 5C24A 4FW1A 4M9HA 2H5XA 3ZT1A 4LSNA 4JK1A 3Q8RB 3NGDA 3T1AA 4I2FA 3HJFA 1JLGA 1RDDA 1RCHA 1ZETA 3RBDA 3PW4A 4ECWA 5IIIA 1QHTA 1QSYA 4AHTA 2FMSA 4O5KA 3JPQA 3GV8B 3PO5A 4I2DA 4O3PA 5CA7A 4BDYA 4CEAA 5KT5A 1SUQA 2VA8A 1RDBA 3ALYA 4IRDA 2VA3A 2IMWP 2HVHA 2B4JA 1VSFA 4DSIA 3C2KA 5DB6A 4LY7A 5KFQA 4J9LA 1NK9A 5DQGA 2OPSA 2O4IA 2IA6A 4E0DA 3C6TA 1ZBLA 4DO9A 4NYNA 4IBNA 3TABA 4M41A 2DFLA 4DS5A 1A5WA 3LPTA 3IHQB 2KN7A 1QQCA 4QZ9A 5DGAA 1B9FA 4YP3A 4JV0A 4KLOA 2O4GA 1VSJA 5J2MA 4KMUA 4CECA 2QKBA 4XA5A 2X74A 1V9PA 3B6OA 2NRZA 4W5NA 3CQ8A 4UBCA
chains in the Genus database with same CATH superfamily
4H4KC 2BV3A 4YDDB 3QYYA 2YNIA 1L6NA 5FIIA 5DDQC 3D54A 2CH5A 3MEKA 3NY0A 2JVRA 4Q5VA 3UKRB 3RR8A 4M1KA 3W8GA 1X2IA 1WKLA 4GVMA 2O67A 4BE0A 1FCAA 4C0BA 3W64A 4C0HA 4YS2A 4EX6A 1UVKA 4BXOB 3C15B 4CHOA 3OFFA 2AU0A 3JSMA 4QZ8A 1WWUA 1YZ6A 5DB7A 2YJEA 2F9WA 3H0MB 4CM2A 5BN9A 2XMAA 3BGLA 2QSWA 1G2EA 1HQEB 2PY5A 4DR6K 5HNKA 1TL7A 2J0XA 3TRGA 3SQGA 3ATUA 3UN5A 3I9ZA 4CNYA 4BR5A 1E6YA 4JI8J 2L48A 3THXB 3VEYA 5CYJA 5AQUA 1WNSA 4FXDA 2LEBA 1N6QA 4M3ZA 4RR5A 3O5TB 2HMXA 2P9CA 4OPJA 3D6MB 1QVGM 5D4BA 4DTRA 5F8HA 5AI6A 1J5OA 2L9DA 3KK7A 5AI8A 4WFZA 3LPYA 1X0FA 4LVSA 8ICTA 1YJUA 2YMMA 1HNXK 4IQVA 1IV0A 4XPCA 1VC0A 2HFZA 1UTAA 4WFXA 4WJBA 5KFYA 2RUSA 2RIJA 3BY5A 2MKIA 2YKOA 1EKRA 2AWZA 4DTJA 2DCLA 2VZ9A 3WHIA 3OD2A 3JXUA 1N5VA 4DFPA 5AQSA 3VOVA 2B0CA 4GKJK 4QJVA 3G6EN 4YHHK 4N56A 3T1HJ 2HBJA 3FR0A 2RHSB 4ZTJA 3GB0A 2IM0A 4H4MB 3IP0A 1SBRA 2HS3A 1Q5YA 1WUAA 1WG1A 3M8QB 4WK3A 5FJ4A 3HTVA 4ILMA 5KFRA 3BYPA 2Z1HA 3UMGA 3CMEN 2EKNA 1KOOA 2XHBA 3PIOQ 4H0OA 4F26A 2PDAA 5KFKA 1DGSA 4Y2XA 9ICMA 3ZTPA 2I5HA 2EEYA 3K8VA 2OPQA 4GXJA 1N0VC 1XMQF 3QUBA 1IG9A 4ZJLA 4JI6F 4N7TA 1NNDA 2R7WA 1TAMA 1RAHB 3Q8QB 1MMNA 2XHWA 2D3DA 1Z00A 1CZAN 3U9DA 2HOIA 4JEPA 4C3KA 1ZQWA 3DMJB 4AF1A 1DT9A 3VGKA 1GLBG 3M8SA 1R43A 4CJWA 1ZJMA 4K25A 4K4UA 2Y8YA 4QS8A 3L7OA 1NAQA 4BREA 5KAIU 3KBBA 5ETVA 2WK4A 4DV0K 4M7XA 2ZOMA 2WCXA 2U1AA 4C0OC 1U6FA 1WAJA 2PN6A 5U47A 4ELVA 1ZOTA 3C6TB 2VC0A 1WOSA 5L9NA 1HWLA 1RPLA 1GXTA 1WCNA 1ZRMA 4OX7A 5AZJB 1WKKA 2P2CB 4M3WA 5HSPA 5GIPA 2ATCB 4USUA 2D6FC 1UT8A 3AV9A 3NBPA 2FLOA 4KH5A 2GHPA 4CF2A 3ENVA 3UQ0A 3ZO7A 3DAWA 1HBMA 5J2IA 4MFAA 4CQ1A 4QYZJ 1N5YA 2MZRA 2R18A 1H73A 2CPFA 2AXTU 3KLFB 3L8BA 5ALLA 3NS5A 1JLCA 3MMBA 3U1MA 1G3OA 2R2RA 3SUOA 1HWKA 3OYFA 4OYOA 3SQ4A 1W25A 1N33K 4BX9C 2VBZA 4I1TA 3VWSA 3DYAA 1XSLA 1XR6A 5J1NA 2IHR1 4OI3A 4W5OA 1L3SA 3CPEA 3EN9A 1C6VA 2AH5A 2O8DA 4DSEA 4LR7A 1PBAA 4C8LA 1U25A 3DLKA 3B4DA 1N0UA 2E8AA 1E6VB 5BN8A 1S0OA 3B0YA 2W7PA 7ICRA 5KL1B 3MM5A 3GOIA 4CH7A 2Z57B 2DHAA 2K8BB 4JBCA 2NRRA 4UAUA 1Q8BA 2ZWPA 3PHTA 3F44A 5J0QA 2C2ZB 1WTFA 3MM6B 5F8GA 3MEDB 3IKMA 2WBRA 3OL6A 3UPQA 3CC2N 1H98A 1D5AA 4JI7K 4E98A 4IR9A 3T41A 4RQ8A 4ZPCA 1FKPB 2LFVA 2H9ZA 1K9MT 4WKRA 3MGJA 1Q8IA 1FJGK 2ZTCA 5AJ3F 3KWMA 2WAQF 1YJWS 4DDFA 6FDRA 3O08A 4KBOA 3LZIA 4I2EA 2ZKUA 3QSIA 4UOHA 4MLEA 1ZXOA 1MQ2A 3HSGA 4LRAA 4H5NA 3BBFA 3IBWA 4M04A 2HOQA 1HUXA 5M1QA 4AQYK 8AT1B 4LF9J 1JALA 3DHWC 2WF6A 3OFEA 1U1KA 1MLAA 4CEQA 3CCZA 4OX8A 4O8KA 4HI1A 4TYBA 5FLXU 5JJBA 3CCUN 5CYQB 2HZAA 1S12A 4N8OA 4KH0B 4O3MA 2BKNA 4CEFA 1VDVA 1RT6A 2YY3A 2BCRA 4BG9A 2QJ3A 3TX0A 4BUGA 2E1FA 4YOWA 9ICPA 4PKGA 1ZAVA 2I5JB 3UB5A 3KVGA 1I5OB 3SJJA 3Q22A 4YOYA 3NMUA 1VQKS 2ZZNA 3NKYA 4PL2A 4DV6K 1NMEB 5ALDA 4JV1A 3ITHB 3VQ9A 1U6BA 4OLAA 1Q18A 2KJ5A 1FD8A 1VGYA 1SKUB 1HD1A 1NK4A 3D1OA 2QMUB 4B3TK 1GX5A 4ID1A 2FB0A 4LR8A 4BC2A 2CXEA 1JNRB 1SIJA 1X5TA 4CJQA 4TLRA 3VGUA 4O4GB 4ZPWR 1XNQF 1H2TZ 3PIOL 1UCNA 1ZQOA 1YKWA 3PYFA 1Y4ZB 3FBCA 1FI4A 4RNMA 1CUKA 3OYMA 2J4RA 3IMXA 1Q82T 2FLLA 2EZZA 4OJPA 2HRYA 2EWSA 2HHTA 3V1QA 2MJUA 2OCEA 2Q3SA 4OKJA 2GIQA 4JI5F 4GC7A 2CPDA 1RAEB 1EX8A 3N5BA 3HP6A 2C3OA 4R79A 1S0NA 3MCMA 2KFNA 1CS4A 1TU0B 5J1PA 5HJYA 4XRHA 1MROA 4NM1A 3DU5A 4NLOA 5BYSA 1HI0P 5D4NA 3QEWA 3CD6N 1QQOA 4Y2VA 1TL4A 4LREA 4C97A 1NDKA 4K5SA 1RDRA 4RQ4A 8ICPA 3CDUA 2Y0BB 2W9CB 1BQNB 2R2SA 2AGOA 1BISA 3I87A 3O9QA 4KFBB 4IO9Q 5EDWA 3ONQA 5C25A 1NDLA 1TV9A 4DV5K 4K43A 1T11A 3B82A 5AI4A 2FQQB 2CUYA 3W0LA 1B7YB 2HB5A 3IRUA 1LKZA 1VSIA 2F8SA 4F3OA 1Y11A 7ICNA 1CJKA 2IRYA 1J97A 1C1AA 3IDHA 3J80Y 2YPYA 2LA4A 3TUJC 3TZWA 3DMJA 3J80O 7ICTA 4UY85 1RSCA 4Q0BB 2ISOA 1EETB 1I3AA 1BCMA 4HTUA 1R0CB 4F04B 4K8XA 3HLUA 3TAFA 1ZOLA 2M9NA 2ZH2A 3I0SB 5KFZA 3GFZA 5DK5A 5ETQA 4L76A 4EYIB 3ENHA 4F4WA 4DMNA 1PK1A 4J9VA 3D66A 3ZX3A 1HKCA 3MGHA 3JSBA 1DTTA 2OGUA 4AHUA 3CDAA 1KD1T 1TUYA 2ZUDA 3MOJB 2VG7A 4MT1A 4LQ3A 4EBDA 4AFFA 4AHVA 2HIYA 3OTDA 4PH5A 5B0CA 3JYTB 3VVTA 4F5NA 2QFIA 3CIMA 2AP6A 4FWPA 3LWMA 2UUWA 2KB2A 3W1YC 2CRXA 4X66F 1BWEA 3QU7A 2BQUA 4QS9A 3D9BA 4IFYA 2HHQA 3I8DA 5EGYA 1AQ6A 2I9SA 4FJHA 1B99A 1ZM4A 1WDTA 3NGTA 3R2DJ 1ZBUA 5J8YA 1RP5A 3NNAA 4LF7J 1VJQA 1UEUA 4R5PA 1IBLK 3QT5A 4I6MB 2XBPA 3THTA 4DV3K 2WVFA 3IFRA 3HVWA 4CEBA 4W5RA 1J9AA 2QTDA 3VQ5A 5EY4A 1FXDA 3S6EA 1ZH5A 3G9CA 2GHWA 3BGRB 4USAA 3SENA 4QQBA 5EU7A 3K5PA 3R5BA 2HVZA 2KG5A 4JN4A 3WEEA 3L2UA 3UR3C 3DLBA 2BVZA 4NLGA 3C7NB 3NRZA 1T0TV 2MRLA 2QB1A 1WF1A 2CQCA 4NMLA 4P2SA 5E79U 3G82A 1S1TA 2RQCA 3IAYA 4G9ZA 3W9HA 4OX9J 4Z4GA 4NLVA 4DI6A 2GWKA 1YJWN 4CH1A 2EW9A 4DR4J 1XWLA 1UL3A 1YIJS 4NLQA 4AL6A 4TVAB 5SWMA 4YQWA 3OBWA 2OMOA 4Y2RA 3AEVA 3SCKE 1BIUA 3DLEA 1GXLA 4J7CA 1OSDA 5E5NA 3KHRA 5CD4A 3ZSQA 2K4EA 4B9SA 4PG6A 2VQEJ 1CLFA 3OPKA 4P73A 4KV8B 4XEIA 5AKKA 2BJ3A 3WIVA 1WSIA 3A0BU 1FXRA 1BE4A 9ICKA 3ZSWA 2AQ4A 3QIOA 4P0QA 3T6BA 1JNZB 3FFIA 4WKYA 1PAEX 2OELA 2IAJB 1DXSA 4FKXA 3IM1A 3MCAB 4OZ5A 2GGPA 3QESA 4H5WA 1TK0A 4P2FA 3HSTB 1KFDA 2JEJA 2KHOA 1U2RA 3C1ZA 5GIOA 4BRHA 1R3NA 2IJFA 2JGAA 2XS2A 2VG5B 2QYCA 4KLUA 4PQUA 2LYHA 2DH7A 2CQ3A 1S1UB 2IOFA 2Z4PA 5CB1A 3HRDD 3SSSA 2W9MA 2NRVA 2W7AA 2GJFA 4CT8A 4NLZA 3AODA 3C6UA 3MDCA 4L73A 4RT3A 1AUDA 5JICA 3QSYB 3F2CA 5D4PA 3WK4A 3CE8A 4I6YA 3PSFA 2OUGA 1NI3A 4MH8A 1WBDA 2XTJP 3QYPA 1CSJA 2XB2D 1RDWX 2UXCF 4H0YB 3CCWA 1BMQB 1ZQPA 3GONA 1DHMA 1TFWA 2DXFA 3IRXB 4O3QA 4LSLB 2KFZA 1FF2A 2NRHA 2GCFA 3B6BA 3VGMA 3CVKA 1J2VA 1Q7YO 4CZFA 2BJEA 5HRPA 2IC3B 3QWUA 4J2EA 2V9KA 5AM1A 1W97L 4KHQA 3A8EA 2ASPA 4I2CA 1F2GA 1N54B 4JNEA 1HWUA 2KT2A 4IO9L 1ZQAA 4JKDA 2VIXA 3KKAC 3JPTA 1OH6A 2J0QD 1B22A 1S79A 5KTQA 2CN1A 1TKTA 5AE3A 5BR9A 4WK1A 1RXOB 1JXBA 4B9UA 2LP4A 4IOBA 2XYGB 5DDRC 5K8MA 5L1IA 3JQKA 3DXBA 4JYAF 2GTDA 2XSFA 2YN4A 4A8OA 4KSEB 4RQ2A 2ATQA 4DPUA 4PXCA 4MFFA 1X3MA 1CBKA 3OYAA 1XERA 2VC1A 3CXCM 3M9NB 2B9EA 5E33A 2GMLA 3TSQA 2NR0A 1L3KA 4B1UB 3BDPA 1N5QA 4EUVA 4BRQA 4K4VA 4OI4A 4TUQA 2W9CA 5ALWA 3R6LB 1B7FA 2XSJB 1Y9OA 3EE8A 3MDQA 5D8HB 2D3UA 2OANA 3D2EA 2ZNYA 2HNDA 3J7Z5 4ZPBA 1COOA 1BQMB 4TQRA 3NCRA 1WHYA 2D4WA 1UW4A 3MPUB 4M5MA 5GAEU 3GILA 1T9XA 2B8QA 4CJFA 5ETNA 2O8FA 1MNEA 3K0SA 3QXGA 1EETA 2GJ2A 4J9PA 1S9EB 2BPCA 5IWAK 2H3ZA 3NH0A 3BGFA 2KZ3A 1UFWA 3WXJA 4K2XA 3KLEA 4CF8A 4QZIA 2XNRA 4IDKA 3FZ2A 1PJ6A 3L3UA 2QA4S 1TMMA 4NLPA 4MKYA 3CP8A 9ICSA 5HI7A 1I94F 4RPXA 5HRNA 3PW7A 4DR3K 1MMDA 3KWGA 2F7VA 4FW2A 4QWEA 1S6OA 2CGKA 4KGZB 3QIPA 4DS4A 3DLLQ 1QQ6A 3AVBA 2F7TA 2KI2A 5A8KA 4I2PB 4KAZA 1KBUA 5LJWA 3WNHA 3AAWB 3TYTA 4U96A 3NMRA 3LP1B 1PC5A 3ORYA 4DU7A 1RT3A 5ALNA 2W2NP 5AQNA 3OR2B 4HCCA 4LMZA 4A8MP 2EVZA 3UQ2A 3T5HA 4I64A 3TPQA 3OGUA 3TARA 2W40A 1U02A 3CMAS 2AJ0A 3H0PA 2D5RA 2HFSA 2BX6A 3GG1A 4CEOA 3OYNA 3KYLA 5F3TA 3NP5A 1C0FA 8ICOA 4OJ5A 3GLJA 4UB5A 2D41A 3OYDA 1XUPO 1BI4A 5KRTA 3EXYA 1WC0A 2ZHBA 1KTVA 3VHQA 4UB2A 1UVLA 4KLTA 1QM9A 2DNHA 1VRUA 1UW9A 2IY5B 2H5IB 4EBEA 4NLDA 1AW0A 5AM3A 4IC9A 3QU4A 3PJWA 1MA9B 5CYMB 2HS4A 2VANA 1BUXA 3HKZD 1SZPA 5CR4A 1RT2A 2NV3A 1FO4A 3EDQB 2Z1GA 3FDSA 2CKWA 1NJYA 2J7WA 4NXMK 2K4IA 1EQYA 3L4IA 2DNKA 4OX6A 2E5LK 4ZVRB 4OZ3A 1JN3A 1I1GA 4F9OA 3U4LA 4P10A 5HP1B 5EE0A 1NPPA 4PHAA 4Y2UA 2K8AA 5I3PA 2FVPA 4WQ4A 2C2NA 2HF4A 3DLRA 3L2VA 2JFKA 3D1HA 2HNYA 4PZOA 3H0RB 4FLZA 1UEVA 4W98A 3SLCA 1RBTA 3MN6A 3HI0A 2P5VA 5IV4A 2MQ8A 4B3RJ 2NZTA 5KG4A 5D0RA 3V4IB 2R7SA 4ILGB 4CGIA 2UZAA 2DXEA 4A8SA 4O0IA 4O44B 3VAKA 1VQ6S 4CJLA 4J37A 4KHNA 3N28A 4JHDB 4V19X 3D3CJ 3OJUA 2LI6A 4UAZA 5E3QA 1HBOB 5BRFA 4BC7A 1CC7A 2KFYA 1GAOA 3RVCA 1Q7LB 1RBAA 4H4OB 2GUPA 2PO4A 1X9MA 2FMQA 1KQSM 3RAMA 3ZZUA 4ED0A 1XR7A 4AYBD 3MBYA 1T3NA 4DTMA 5D6GA 3PEJA 1TUUA 3VEXA 4JD2B 3VN5A 3OYHA 5ALSA 4USMA 4HACB 4CJ3A 2OMLA 1NU4A 1N60A 1U8WA 3PLAA 4YB6A 3OYEA 3E3XA 2NXNA 4LF6F 1IG6A 3PMNA 5K14B 2M0NA 3MM9B 3ZSYA 1CRXA 1N34F 4F0MA 1RTDB 4RW7A 2BZ2A 2B6GA 2B8PA 1XNQJ 2R42A 1O1WA 1RT4B 4X62K 5FPDA 4QIWD 3VAFA 5CHCB 2ZQBA 4RW9A 4Y2JA 2OEHA 2KKHA 1CJVB 1RAGB 3NH1A 1G6BA 3P83D 9ICAA 3BSCA 3P3DA 3AO4A 4FLXA 4CF9A 4JI5J 4DL7A 5JUMA 8ICNA 1T9YA 1PILA 3RW6A 3BEXA 4B02A 3CJRA 1ZD2P 4DUYK 2L41A 3UNGC 4CGGA 3MMAB 1IO2A 4DPWA 1RWNB 1GFWB 1RQLA 1GMWD 3DRXA 2VGNA 1MDUB 3CM6A 5HAOA 1NZPA 7ICEA 3KJFB 4LRCA 3BBCA 1JQGA 2MSTA 5AM5A 1KW4A 1ULRA 3MAAB 3ISDA 2IJRA 3O9UA 3C1YA 1NM2A 1S9GB 2XHCA 2X1BA 4RWXA 1EWRA 2NQPA 2W11A 1VBXA 3MECB 4ID5B 2WB4A 5AT1B 3MD3A 1UOCA 3LDAA 3W62A 5J2NA 2J76E 4ANDA 3H7HB 3WC2A 3D2FA 1AA1B 1KVCA 4PXEA 3VA3A 3O8WA 5IOLA 2XY5A 3W2VA 2Z2MA 3DLLL 4NYPA 3SUPA 5J0OA 3JB9k 1Q3UA 2QL7B 4K4XA 2LDYA 4CJSA 4CZJA 2QA4N 3TFRA 5LMUK 3KZBA 4R25A 4M5IA 1BG3A 4BRGA 5E0OA 2PA8D 3CIZA 4C3LA 2LM4A 2HQCA 2PXIA 3CERA 5HN0A 3A5MC 5IZHA 1FWPA 4XH4A 1T05A 4MDAA 2IOFK 4P7VA 4X66J 3G0ZA 1B64A 4FK4A 4CE9A 4B9QA 4BGDA 2M5YA 3BQTA 3N5FA 1NGAA 1ZQTA 4D3GA 2XRIA 3IG1B 3H5UA 3QNNA 4ZCIA 1OY6A 1VJWA 3R5GA 2HRUA 3K89A 3HZ6A 2EWHA 1RT5A 4MFBB 1DJ0A 3E9LA 3CMAN 4F5OA 2ZDOA 3ULEA 2X1FA 1F3FA 1CZBA 5J0WA 1C1BA 4PPXA 1JI7A 3NTUA 1HW8A 9ICRA 1JIHA 1W2IA 3UDLA 3ZZTA 1WG4A 4ACOA 3SAFA 2YH1A 3SMSA 3LP1A 4NXNF 1TMJA 1MU2A 2JNJA 2HMIB 3Q2SC 2KKPA 2Z2YB 1OXJA 4K4TA 4M63C 1IBCB 5HRSA 1CULA 3AXKA 4WQ5A 5FLXY 2QIFA 3AGKA 1TV6B 1HR0F 3NDKA 3CCQS 3QAUA 8ICSA 4DHVA 1OYDA 2A2CA 4N77A 4N76A 2CNNB 5A8RB 4OJLA 2C28A 1X4BA 5DB8A 3BF4A 4FM1A 2R7YA 2HS0A 3PG9A 3M2RA 3QJPA 2FJEB 4IRCA 4CBUA 3U8XA 4ZP9A 1JL2A 3AJDA 3DRPA 3T3FA 3J7YP 2B9XA 1A0PA 2E7VA 5F8IA 2FDRA 4P2HA 5GAHU 2DR8A 3ET6A 2F8MA 3V7LA 1D9DA 3JSYA 2UVRA 3MMCB 1WN7A 3VAIA 4U6PA 1S5JA 7ICPA 4A46A 4B3SK 3TAMA 3PKYA 1X0PA 5H9FJ 3D45A 3TW0A 3TTCA 3A8IA 2XZDB 4IG3B 5BPCA 1HX1A 2XY6A 1QLNA 3QUQA 1VQ6N 4FXWA 2DVIA 3LDPA 1HIWA 1X7VA 3HDSA 1VQ7S 1K6YA 2E7WA 4X4OA 2OO4A 4V1Ak 2W04A 1SJ1A 2HVIA 2ZGYA 2DNNA 1QH9A 4FM2A 4R63A 2CYYA 1WLJA 2YHYA 3MM8A 1L8LA 3IMQJ 3M05A 4OLPA 4DPTA 4X64K 5EX3A 4DTNA 4C7YA 1KP6A 4RQ5A 3K57A 4ISEA 4LFAK 5CZXA 4M3TA 5DM7Q 4DU8A 5B0BA 3MMJA 2GWSA 1MN9A 4CHNA 5F0UA 4B3MK 5ALXA 5HL7Q 1N8RO 1PYTA 1PO6A 4PHDA 1G7CB 1R8AA 3CO0P 5E41A 2H3FA 3GFKB 2UXCJ 3MN5A 1S6PB 1T4GA 2LPEA 4UZBA 3KFUF 3DLGB 3NRBA 4GRSA 2VKQA 5K4LA 2V8DA 4UBBA 1ZZFA 1KQKA 2IOCA 1RWXB 3G10A 2YKMB 4CZMA 1N2XA 5KFXA 1ZQVA 2CDRB 3I5CA 3OUYB 3BYRA 4DL6A 3FFKB 3EVOA 1NK8A 4P71A 3QINA 2QLWA 1UWBA 2JRZA 3L6QA 4LUBA 3KDNA 2LBOA 4FWNA 3JPOA 5IQ6A 4X65K 1FK9B 4F25A 2KL8A 2HHWA 4YXJA 4KRWA 4ZPVR 2FC9A 1YVNA 2MGZA 4C7QA 1TQLA 3Q8MA 4B9MA 4NLWA 2UXBK 1WEXA 4Y2PA 2LQBA 3SBTA 3KUHA 1FE4A 2B0GA 1WC1A 3DRRA 3G4SN 5BPMA 4JYAJ 1RCXB 2B4PA 1WJ9A 3KK2B 3EJMA 3AMZA 4FYVB 1P7DA 3FEZA 4JUZA 1BPDA 5LXYA 2RDJA 1Y00A 1YRTA 3T9ZA 5FPNA 4U9RA 1Y97A 4PYDA 3SV3A 3KG4A 3GR1A 3QEBZ 1AFJA 2ZUGA 3PRVA 4BRMA 1U0HB 2YWGA 2E5SA 1SWWA 4JWNA 3CJ1A 1RBOB 5T7LB 1LK5A 3CJ2A 2F8TA 5J1EA 3KK1A 4CF1A 4TU8A 2WC9A 1VQ8S 3M3ZA 3OT9A 4RQ7A 2IGIA 2E2PA 2NSBA 2HFNA 3ZT0A 3Q0AA 1SJQA 2YB4A 3RBXA 3HHLA 2WSEC 1X60A 1GTHA 4USHA 4URQU 1W26A 1Q86O 1A5XA 2DO0A 4YMNA 5CAAA 1FRXA 2P9PA 4J2BA 3FC4A 2M0GB 4BCAA 3P6YC 3HZGA 2QARB 4OKEA 3NF7A 2NPIA 3LDQA 1BNPA 2HURA 1WG8A 1KONA 2F4VF 2CJYB 3Q2TC 2B6AA 3ELHA 2QWPA 2G09A 3RW7A 4NLXA 4C11A 5GAEP 3KFWX 5KG1A 3R7NB 3T19A 4DV7K 1V4SA 1JLFA 4GVBA 3T9NA 4EBCA 2KYZA 2QYGA 5HBMA 4AHCA 1LW0A 4IOCL 4TXSA 1HYSA 1I94J 1U2VB 3U3GA 2PFDA 2I7NA 3ZDEA 1M1GA 2RILA 1GX6A 4UY8O 3QRQA 1WHWA 2NUUG 1AZSA 3SCLE 2ZJQQ 4JOUA 4EWTA 4XPEA 4ICLB 2JDJA 3VGSA 1JLEA 3E1YA 1MG7A 5EX0A 1YF5L 2QL9B 3PR4A 2JWLA 1KEJA 3ENQA 2XVTA 2QTWA 3BSAA 3CETA 5FDLA 1ZQYA 3AVHA 3LDOA 4US9A 2V2ZA 5IC4B 2LSNA 3DXKA 5JVHQ 1X3NA 4E7LA 4JV5F 3VPZA 2DKOB 2QB0A 4ZTFA 2Q2RA 4ES2A 4ENOA 4TYAA 1F5AA 1L7MA 1WWVA 4BR4A 5G5GA 1FNOA 3GV5B 1FRJA 2LQ5A 4JI3K 2NYIA 1VQ5S 1X42A 3MWBA 4OKKA 4H4KA 3C2LA 2B4VA 2POKA 3DRYA 4Z4FA 4IJNA 4DLEA 4RKUC 2GA7A 1K1SA 1Q53A 1ASUA 3NLCA 3EKUA 2WF8A 4C2MA 5I3QA 1RGVA 1Q46A 1LOTB 3KTQA 5BYQA 1W2BR 2BOPA 1FO1A 3PKMA 3QNMA 2G13A 1B43A 2J0SD 4M9HA 1LW2B 1YJRA 5DZ6A 2E1CA 4ZN3A 4P9SA 3VGLA 2WMMA 2JLGA 2A41A 4I2FA 2VG6B 2ZIUA 1VQ7N 2ZH6A 1Q7YT 4ECWA 2YNHB 4U8YA 5F8JA 1RWWB 5IIIA 1QSYA 3SD7A 4O5KA 3M6ZA 4JI2F 1P1LA 3WUHA 5DM7L 2KVSA 1RFQA 2MZJA 4O3PA 1SXEA 1O13A 4KHPF 4DJBA 3UKUA 2AF6A 5HL7L 2E8PA 2G5HB 2MDAA 3CJKA 5D3GB 2B4JA 2HSZA 2RNEA 4UAVA 3THPA 2XMWA 1OQ3A 3VALA 1NK9A 1BDGA 2O4IA 4E0DA 1VQMS 3QB0A 2E1ZA 4NYNA 5A0YA 4DUZF 4FNIA 1WOQA 4NL5A 2XI2A 5JTIA 3MX5A 4QZ9A 2R3VA 2CXYA 4UUWA 4YP3A 4DKWA 2O4GA 4CECA 1LFPA 2QA1A 5HR6A 1MWZA 2F8LA 3IN5A 3B6OA 4UBCA 2QO3A 1F1BB 1BD6A 5AQHA 1OH7A 3GJTB 2I38A 1RTIB 2FZGB 2XLJA 1FFVA 1BO5O 1H6KX 4LF6J 4F3QA 3OVSA 4DQ8A 4F5RA 3OTBA 3ZEUA 3BH7B 3L4PA 4V19J 4K42A 4KTZA 3C19A 5A6WA 3THWA 5BOLA 4MO4A 3CO9A 1CJTA 4CHZA 1K0VA 1CEZA 4IFVA 1VYAA 1U09A 2VJVA 2VL1A 3AARA 4CIGA 9RUBA 1C0TA 1BIZA 3R6MA 5F0XA 5E3RA 5CA5A 5H9EJ 1M0SA 2DNQA 3ID6A 1VBZA 2GLEA 4RW8B 3RRHA 2ZDPA 4A8QA 4FLUA 4V19S 3OUYA 1H74A 1X31C 1LEOA 1XSPA 1LKYA 2YQEA 4NLRA 3AL0B 1R8CA 3FLCO 4ECZA 3WZ0A 2V5HG 1VSLA 1VSKA 1VBKA 5AK3A 1REGX 5F9LA 4IO8A 3H42A 1WSHA 4MF2A 1VRTB 8ICYA 2X1AA 2MY8A 4H0XB 3HHEA 3GYXB 3MWTA 2Z58B 1RILA 2KRRA 3PYEA 9ICTA 4WP8A 4BGAA 4MTPA 1VQ8N 5J2QA 4QIFA 1GLDG 2RHQB 2KZMA 2IHNA 2QX0A 5LMNK 3CJQA 4CYUA 3I6PA 3FK4A 3PCOB 1RA6A 2EDUA 2N1RA 7FDRA 5ALEA 4YY3K 4UOCA 4YR2A 3K1RB 4A2AA 3V9ZA 1U0HA 4I67A 1DFDA 2W3RA 2ZJ8A 1FEHA 2LM1A 5J2AA 2JEIA 4PL7A 5HANA 2OYQA 3O4QA 1ATRA 4CZHA 2XCPA 2E8MA 3GYGA 3UCGA 2MQQA 1VFJA 2YNGB 2J8SA 4CHYA 5AE2A 2A18A 2BE2A 2M88A 3RB3A 2ZJQL 4PABA 2ROEA 1L3UA 1Q4RA 2C2DA 5IM0A 1YAGA 3RMCA 2FJ6A 4BRIA 2NXEA 3OYGA 2ZH3A 1WF0A 4FM0A 2ZJ5A 5T7BA 3SSQA 4BHQA 2BPGA 4FJXA 2JGUA 1REVA 4M7YA 4LF8K 2F1IA 2EPIA 5J0XA 3I4PA 3O6WA 2JV3A 1JLGB 2ZH4A 4H0VB 3LL3A 2O8CA 5JVHL 4HUEA 3WU2U 1SQEA 2GVZB 3ICLA 3SIPB 3TX8A 3U26A 5AQVA 2ZIVA 2HQDA 1HRHA 3J7ZO 3EVWA 3PV8A 3QNWB 5AQGA 5HR7A 5LM7E 5C2DA 2JFDA 1NJIO 3OBIA 3ZT4A 3IP4B 2ZGZA 4Z6EA 1SUQB 3BO3A 3WKEA 2KXHA 3I31A 3C14A 3U1NA 4F92B 1EX4A 2V4JA 4DR6F 1OY8A 3CJSA 2LYBA 2W2PP 4MJKA 1S4EA 4AUKA 4NXNJ 2OPSB 4GXIA 2FE9A 2V68A 4H5RA 3M2VA 5GADU 4C8YA 1HHSA 3OS2A 1VQ5N 4YOUA 4M5DB 3F5TA 5CHGA 4L8RB 3O1WA 7ICSA 4ED1A 3V1RA 1HR0J 1QZ5A 4KLEA 4M8LA 4MKAA 4M3YA 3A4TA 1G1XA 5J2MB 5IS2A 3M1YA 3IWNC 3I1YA 3WK8A 1X4GA 2MQLA 1B4SA 3QDKA 4C4RA 1RLCL 3OFGA 4JLHA 5THWA 1AFIA 5EHHA 2DH9A 4LFCK 2FF3B 1D8ZA 1QSLA 1HYZA 2ZH7A 1BUPA 5J2GA 4RQMA 4A8FA 4BACA 3L9ZA 3RG6A 4PYAA 2D9PA 2OHDA 2P66A 1KHWA 5FRNA 3V9UA 2YWWA 8ICLA 2EKYA 1C1CA 1T9TA 3NE6A 1NB7A 4Z6FA 1YQHA 3QFHA 1T7PA 4CJEA 5CXTA 2CNLB 1KVBA 1R59O 4GKJF 4YN3B 5HVFA 4YHHF 1WACA 4DTOA 5JMVA 1CVJA 4QZHA 1M5HA 2OPPA 1NJZA 1IKVB 1VQ9S 3US5A 3M8PB 1B9DA 1QD1A 2LYAA 5B5EU 3I96A 3K5MA 1HPMA 3GDXA 4J9MA 2XGQA 3O5BA 4KB0A 3HT0A 3CJ7A 3F53A 4RQ3A 1HQ2A 1Q16B 1VQMN 3F9MA 2YKAA 4DOAA 2AD9A 2CZVC 3SXLA 1A5VA 3I55N 4DL3A 2N4CA 3HD1A 3GYNA 2CPJA 2A5XA 3ALRA 2EC0A 1TFRA 3TI0A 3O0FA 1FRIA 4OLBA 2HYIB 2DNMA 3R5AA 3T5JA 4PWDA 2W55A 4I2GA 1WSRA 4KIAA 1T94A 4GLXA 5HROA 1LVHA 3NL0A 2F96A 2DITA 4NPOA 1VI7A 3WQTA 1NDCA 4Z7YA 5E3PA 1EKSA 4B8CA 4AT1B 5J2BA 7ICLA 3QBCA 5IILA 3FZLA 3LM2A 2P1JA 2ZKTA 3QU5A 2ASLA 4Y2SA 3A1YG 2R7TA 4TNOA 4XH5A 2KT5A 2Z56B 4DV0F 3IBPA 3UI3A 1QE1A 2FUG9 3V9XA 2GX9A 2CRLA 2EBGA 5G0RA 2WF7A 2JWNA 3LANA 4LH5A 3S1TA 1S99A 1HHTP 4QR1A 1W7AA 4BRNA 1FWKA 5AZIA 4ZVOB 4KGKA 3BQ0A 1Q78A 4CZCA 1JLBB 3GFYA 2F1FA 4UB4A 1F9EB 4OQJA 1IKYA 2MUTA 5L9XA 3BJYA 4YDUC 3VEZA 2GX8A 4NX9A 2JZBA 2IRUA 1WC6A 1RWMB 2KOBA 5EUHA 4CGJA 3DXMA 3CCRS 4FF2A 3CPWR 1KFSA 3GP9A 4TKTA 5ALJA 5KFDA 2D1KA 2AHOB 4IQXA 4OX9K 4USVA 1V5IB 3EX7B 4DR4K 2U2FA 1N33F 3ETLA 3A5OC 4M47A 4P52A 4JKGB 2BRKA 3CCMS 2HLUA 3HHKA 3LYSA 2XI9A 2VASA 5ETSA 4PG7A 1RBRA 4R0JA 1RYRA 1HL6A 2CGLA 3ETMA 2PE8A 3H2UB 2WOMB 3GSIA 3JTOA 5GTIU 4NZ0A 4ECTA 2RQ4A 1D4XA 4OYMA 4GV9A 2UUCF 4GV6A 4FPIA 2NREA 2KJ9A 1KSPA 4P4PA 2ZUAA 3TZZA 3KJVB 4FJMA 1J2MA 3TVYA 1BHLA 4BC3A 4JK8A 4B17A 1GOCA 2YWFA 1SC3B 1ZQLA 3LP3A 3M30B 2ADCA 3KWIA 1VC6A 2ZH5A 3SUQA 2PI4A 4I6WA 3VCDA 3SPYA 2Z7JA 1HWIA 4A57A 1WG5A 3O6QA 2QMXA 3TEHB 4JI7F 3K17A 3EPIA 4FZZA 4ELUA 4WP9A 3ONNA 2F4VJ 3H20A 5LSRA 4OZNA 2K1RB 2DTUA 2YQ1A 2RVJA 1ZC6A 4JS5A 1IBKK 1WHVA 2IM2A 3SCIE 2UUBF 4DBQA 3GDQA 1KLMB 3P5BP 4TY8A 1SWVA 1FTRA 3UW1A 2QXLA 3IG8A 4WZQA 5CE3A 3WNGA 2YX8A 2P9NB 1V3ZA 4XO0A 3WKAA 5CJ7A 4NWBA 3P38A 2NUBA 2ACYA 3CT9A 2J8AA 1DQ9A 4DX7A 3J7AN 4C8MA 4FJ7A 1O6XA 1FJCA 3BEGB 3GG0A 4WTYA 3SQIA 2MPUA 4M42A 3FZKA 3CCEN 1MC8A 2O8EA 1NK0A 2OTLS 3I0RB 4JAXA 2NRWA 2XMJA 1S6QA 5KI6A 4DX8H 4YOEA 2IIRA 3TTFA 3JS9A 5J2CA 3DC2A 1H38A 3NS7B 3EMTA 2H48B 2QWNA 1TK5A 3T79A 2BMBA 3OTQA 1OQ6A 4LC9B 1D8BA 5RUBA 4TURA 2QW9A 4CJUA 2YX6A 4KN7A 4KT0C 2ZNZA 3G8SA 4DV6F 3MXIA 4GVLA 3U1LA 1TL1B 2G1HA 1TFYA 3CQXA 3HX9A 3IBCB 1H1VA 1SC1B 2WSFC 4B3TF 2ROGA 1OKJA 2VKZG 4BWJA 2BUPA 2E8NA 4RW4A 1LB2B 4FDFA 3MAQA 3AO3A 3ZTSA 4URSA 5A6PA 3PY8A 3RWUA 4RX6A 3Q8VA 4NLYA 1VJ5A 5C42B 2B56A 3DLJA 2G8UA 2BJ7A 3NAIA 2BPFA 2V8HA 2RRBA 3NWRA 1N8RT 1M5OC 2MY7A 3OHRA 1DGKN 3RSEA 4DV4K 4WFBQ 3ZI4A 3G87A 4CNZA 1H2VZ 4MF8A 1VQ9N 4L6V3 3O8MA 1WF2A 3FMWA 2ZD1B 2W41A 4I56A 1ZQMA 3PSPA 2KP7A 5IT0A 4I2QA 4I2IA 2A6MA 2Y8WA 4F4ZA 2VWBA 1S76D 4FFDA 3PHEA 3VQAA 4F5PA 4JI2J 2LEPA 1OY9A 1U1RA 1F3VA 2E6LA 4HH0A 3SQOP 4KHPJ 3ZCMA 3KZIU 3KHLA 1VC5A 5LL6d 2J9DA 4FVMA 2RKIB 5M1OA 1IKWA 4QIGA 2Y3YA 3GE9A 2E1PA 8ICWA 2VBYA 2G06A 2PI5A 1TK8A 2DNOA 2VCPA 2PMZF 1SJ3P 4PKHA 2XY7A 4HTIA 1HQUA 1NO8A 3R5JB 3PRBA 4DUZJ 3C21A 2OEJA 1SJFA 4PL8A 4CD3A 4DV5F 3M4XA 3EDRB 3D0PA 3VV2B 2BANA 2QLJB 4P0PB 1WB9A 2PAVA 3QETA 1MSWD 5E7OB 2DKZA 4PKIA 3CJAA 1K8KB 1S1WB 1L7NA 2DGOA 2MAXA 3NOGA 2CPEA 1EKEA 1PZNA 2FHJD 3NGRA 1L8OA 1X5OA 3H7IA 4BLGA 2NCKL 4RPFA 3ASMA 4BC9A 3VEVA 3FMBA 2V9WA 4EEKA 1NNEA 1RTJB 2AV5A 1FKOA 2HRTA 4ECQA 4FWSA 1F9FA 2Z8QA 3SDEB 1NBWA 2WFBA 3LDNA 1X5PA 4MO5A 4RUHA 4WPAA 1LXNA 1R7IA 3CGIA 1Q86T 1HLUA 2D3OR 4WZMA 3UCUP 2FJWA 2MQOA 4JS4A 1ZTWA 4KYZA 3CCRN 2ZZMA 1S57A 3C94A 1L7OA 1PYSB 2E5GA 7ICIA 3UPFA 4DL5A 1UVNA 3V5RA 1U9LA 3FRZA 1L3TA 1QCKA 4ZIWA 2B4UA 2VB6A 2M3DA 1XR5A 2AEFA 4DFJA 4NCGA 4QPTA 2XM3A 1T6CA 1NLVA 1GNKA 1Z3EB 3OYLA 5E2QA 3KUGA 3LUYA 1NRKA 3QMQA 1S1XA 2PFFB 2AX0A 1IBLF 4AH9A 4CJKA 1T03B 1J53A 4P2XA 4DV3F 3J81j 2PD1A 2HHHF 5M2UA 4NY8A 1HNZK 3KD3A 4YOTA 4UY8T 1V5VA 5ALVA 5J2KA 3LGHA 4F72A 1NNLA 4FZVA 2UVWA 5JXSA 3J80U 3MTKA 3EGVA 5I9EB 4BBYA 1RHJB 4LQ9A 4CK1A 3L0QA 1UCVA 2W6KA 1YBUA 2KK0A 1ZD4A 2P9IB 5KFSA 4PWUA 2IM1A 1BXNA 4I7FB 1EQMA 2OPRA 3V81A 1BPEA 4UZCA 3HKZF 2K89A 2BTFA 1KS2A 3P8BB 4B3RK 2GIFA 5BRDA 2ZFHA 2ROPA 4GFJA 3B0XA 5KG2A 3AXMA 4NA2A 2YHAA 2XO6A 3JPSA 4CTAA 1WOPA 3ULHA 1SKWA 1KEKA 2E7XA 4HUGA 3DM2A 4IQWA 3DGVA 2PIIA 4LBIA 1FEZA 4RW6A 2W9BB 1DTQA 2N3LA 5JLHA 3A13A 3M1VA 4QWCA 1Y88A 3DRSA 2ZWHA 5ALUA 2DY9A 3ZD9A 3FEXB 3PXGa 1D8LA 1D9FA 4Z4HA 1HKGA 2NRXA 3ZTOA 4ZITA 2UU9F 5J2PB 2MQMA 5H1SV 4QZAA 2BM1A 4G1PA 2KZZA 2OTLN 3ZZRA 2RF2B 3HVRA 2RQMA 1FRHA 3OTEA 4A8KA 3TVKA 1EXNA 1VK0A 5ALYA 1H7WA 2HVEA 1RWOB 3PX0A 2NPFA 4EENA 2GV1A 3VTHA 2YKNA 1CJUA 1I6JA 3QUTA 2Z2LA 3BKFA 2W2QP 4ZLLA 1L3VA 3W2WA 4AYBF 4KHMA 2A3VA 4K4HA 1NGGA 4ANEA 1BWVA 4DR6J 2B4OA 3W7BA 4OI6A 1RTHA 4NV0A 2E2NA 3SCJE 1RA7A 3QU2A 1VOMA 2FZCB 4OHYA 4QS7A 1WOOA 1ZAWA 3OTCA 3FVYA 5HMMA 2HGLA 3QGPA 4WFBL 5KAFU 2FIUA 2FLPA 1XHZA 1V9OA 3GJQB 4QJFB 4JI5K 2APOA 3B54A 4OIXA 2KNJA 4L3QA 2G2ZA 3N7SC 1PGZA 4CFAA 3D6TB 4Y1DA 2AJ4A 2YMQA 3AAQA 3J7AP 2RU3A 2DEIA 3KK3A 2W4PA 3VEOA 3CB4A 4QIWF 4LIRA 3OS0A 2OA8A 5CHIA 4BC4A 2OI2A 4NO7A 5KFIA 1DEJA 5E3AA 4DTXA 3UVJA 1JXEA 2QLFB 3T7ZA 2CQIA 9ATCB 4BRAA 2I1RA 3N97B 2YHWA 3G96A 2E1EA 1F0MA 2KHQA 4PJ0U 2XMMA 4ZHRB 2ZXHA 2KV2A 4WJ3B 2MQPA 1QAXA 4OI0A 1X9SA 5F1XA 4N8NA 4QIWC 2IOHA 3W61A 2YJFA 4IJAA 1WI6A 4IWVA 1HYVA 4J9UE 1LQ9A 4LFBK 2QKQA 3V7JA 3DWLA 4M9LA 1O0PA 1TKXB 4DEZA 4I6AA 1NMDA 4M5JA 1Y0HA 2JWKA 4GKJJ 4YHHJ 1F6TA 5ALGA 3ISCA 2FJBB 4AHSA 1FDBA 3NVYA 4ETXA 2DGSA 2HBMA 4ZCKA 4RNNA 4KGXB 2H5JB 3KDOA 4CLSA 1RAJA 2XLKA 4K4GA 4RTFD 4KC5A 4PEOA 4P4MA 5IINA 1WBBA 1JKHB 2BYCA 4NOHA 2GQCA 5M1PA 2PFQA 3D5MA 3E01B 3WIUA 5GAHI 4K4ZA 5A2QY 2VGMA 2W3SA 2DY4A 3LP0B 3FZMA 2XS5A 2KM8B 3H3OB 3C6HA 4LVNP 2AJ2A 3FM9A 2YBVA 1QS4A 1SIZA 1NKBA 4U7BA 4DF8A 2QA2A 2DHSA 1FIQA 3AJ1A 4X66K 4DCOB 1NG9A 4F93B 4R8UB 3C16A 1TUVA 3G8TA 1VLYA 1Y3KA 3FCVA 4CZIA 4DN0A 1QAJA 3NGZA 4FJGA 4IS7A 2P8IA 4HR2A 5L38A 2G8FA 9ICQA 2H3GX 2ZHAA 3MXJA 3W65A 1ASVA 1TAQA 2DGUA 2FPMA 1F21A 3PEHA 1KXPA 5T41A 2LYVA 2RRAA 5KG7A 1LNQA 2KDOA 4JI4K 1R0AA 3KIOA 2EFOA 2B5JB 5I42A 2FJXA 5IWAF 1VK8A 3JQJA 3E9PA 5B7WA 2V2VA 4LJXA 4CRXA 3KLGB 3P39A 4NZ6A 3FRYA 3I33A 1NK5A 1RTJA 2VPYB 1ZBTA 4RUCA 2V8PA 4QZFA 1HD0A 2WONB 4P7TA 3C8YA 4DR3F 2VBWA 3L4QA 3A8JA 2E4LA 3TSPA 2NO4A 1MMLA 3QBWA 4JI1K 3N6LA 5J2JA 1HNVA 3R3TA 3X3UA 1SH2A 3NGIA 4BS2A 1H0HB 4Y2YA 5IIKA 3RB6A 3SQ0A 3ZDAA 3AA4A 1N33J 4FSVA 3R1LA 2P9UA 2J7KA 2A6AA 4CO1A 5CZVA 3O3HA 3J7ZT 3HT3A 7ICKA 2LU2A 1RDUA 1ZYQA 5B0FA 3P31A 2J6TA 4G3IA 1VDHA 2UUCJ 1NJIT 2N82B 4C4TA 2MZ1A 4I0WA 3EE9A 3G25A 3O80A 2VONA 1FT8A 2EFPA 2YWHA 3AU2A 1IJJA 5IC6B 2WAQD 1KFTA 2XS7A 1FEEA 2J7UA 4DV1F 5CP2A 3FZFA 4Z94A 5C10A 4ED2A 3C6AA 2P9IA 2A6OA 4ZA1A 3EWAA 1TTHB 1U2CA 3CFOA 1RDCA 4JI7J 1RT1B 3SCXA 3PZPA 2NS1B 3AA9A 3TA0A 3M9MB 2JSXA 1TKZA 3EZWA 1S77D 1VIOA 3SAHA 2MTLA 4KAIA 1P8GA 3LGNA 1ZQJA 2DF4B 2BM0A 1JWWA 1RB0A 4XIUA 1A77A 4NXMF 3C0BA 2E5LF 4CLTA 2P6TA 3IAM9 2UUBJ 1K1QA 1UAXA 1EHWA 4M5KA 1JLQA 2YNFB 2J6SA 5DJBA 3AD9C 3H4DA 3DOKA 2YVSA 3BZQA 3J81Y 3CD7A 2GO8A 4I9LA 4M63A 5LY3A 4K5RA 3J81O 1YSJA 4QIVA 1C2PA 1NGCA 1UA0A 2XMVA 2DGXA 1LWEA 1UKUA 1BWFO 5ALFA 3IRWP 2BEFA 4FVCA 2RF2A 3PUFA 2B9YA 3CFPA 5D49A 2ISPA 3FQLA 3BO2A 4NEZA 5AM4A 3KLIA 1FDNA 1RBUA 1KHVA 4M0AA 2JMGA 1DURA 4EP5A 9ICHA 2QWLA 4IDHA 4R66A 1Q95G 1UPHA 3TQ1A 1BY9A 1YJ9S 3GTYX 2FHKA 4KO0B 3E66A 4QR2A 5E3CA 9ICBA 2VFRA 3GBTA 2GIRA 2NYVA 3HM9A 4KRFA 4DV6J 1HBUB 2ZTEA 1HMVA 4IH7A 3AVKA 5KFPA 3OVBA 1SV5B 3QLHB 3Q8UA 4NI2B 2HBQB 4DZ6A 1XC9A 4PPDA 3BBBA 3ZZPA 1NHUA 4B3TJ 3R8EA 2AGQA 3L3VA 2G8WA 1CQMA 2FJDB 2W43A 3TKAA 4CBWA 2SXLA 5AXNA 4J03A 4CDGA 4JYAK 3EY1A 4X4PA 1R6VA 2V8GA 1D9AA 3IWLA 3R7SB 3QRRA 3N7RC 4CHQA 3ZDBA 3D0GE 1DLOB 2YY6A 1WC4A 3WK7A 4X62F 2XNQA 1FXXA 1UT5A 2F44A 4FYYB 5IT9Y 5J8YC 3DXSX 3CG7A 5IT9O 4B1ZA 3F41A 5DBBA 8ICRA 1R31A 5DO2A 3Q89A 5HRRA 4NRUA 3ILLA 4DPOA 5KPZA 8ICBA 3LQVA 2EZXA 1UPMB 2VODA 3BS5A 4GVEA 3VQ4A 4EZ9A 4RUAA 2RMLA 1WORA 1FRLA 3MWPA 5KL8B 4KHRA 1SXLA 3ILOA 4DUYF 3LA0A 4CWBA 3FGUA 4DR7K 2AT1B 4OZLA 2H3EB 2HWHA 1T9UA 2RDDA 3VAMA 2OLWA 1KC8O 1SC6A 4EGLA 5C24B 1KAZA 2HG4A 4A8XA 3ILJA 3U27A 2G2OA 5JVGQ 2WHOA 4JKBA 4BRKA 3MM7A 1S4FA 2WB1C 3RFAA 1WHXA 4GKKF 1EP4A 2E9RX 3T5KA 4DV5J 1S72S 3N4WA 3RJGA 9ICEA 1MWQA 1C7YA 1IKXA 1KDHA 5AKLA 1RYSA 3VQ7A 1EJ7L 4MYTA 3POTA 3IGNA 2C3MA 2OD4A 2ZVSA 5A8WB 1J5EK 5IXUA 3BN7A 1WD6A 4G1QB 4I28A 3SYZA 3R9PA 4DTUA 5IIMA 1HBNB 4KGVB 1JCGA 2BDPA 2KKZA 4UAWA 2I1QA 4M5HA 3KLHA 5JRTA 4M94A 1RGIA 1VQPS 2LEAA 2F1JA 2V51B 1WEZA 4F3MA 4M6WB 1R6YA 2A1JA 3L4BC 3U9ZA 5M1NA 5I3UB 2QN6B 3CRXA 2P6UA 5DM6Q 1VRQC 3BQ2A 2W01A 3B8HA 3HCXA 4RBTA 1FVSA 3LVWA 1HHQA 2AA4A 3DJCA 1IQZA 2RB7A 4KI4A 1TE2A 3C2PA 4CJ7A 2XG8A 4BR7A 3R9LA 1BHNA 2JH7A 4KLHA 3I9V9 4WE1B 1WDDA 4MQ3A 2UUAK 4K50A 1A9NB 3CC4S 3VQTA 3ZXWA 1VCTA 3MF5A 4O3SA 1IBLJ 2YMPA 2HNZB 3L2WA 1U24A 1XHXA 3VF0B 4A8WA 4NYZA 4IG0B 2AYGA 3RAXA 4DV3J 1FVQA 2Q36A 4KKOB 2LMIA 2HHHJ 2EFNA 4DV2K 2RE1A 1F60B 4Q2LA 5KFLA 3QGIA 1S0MA 1IXRA 4RCHA 1Z19A 3T1YK 1Q3VA 1U6ZA 3AVAA 1X6JA 4BJQA 2GMHA 3GCXP 3G6XA 2KYXA 3AO5A 3QRPA 1GLAG 3WNEA 5AK5A 1PUZA 3UE5A 7ICGA 4DU3A 2GVDA 4OHXA 1S1VA 1HJRA 4KLJA 2NLXA 3CCJN 2V0NA 1RBVA 1YGYA 2ZJRQ 3HPOA 2O3DA 3SPZA 4CEDA 2GELA 4ED5A 1RKJA 2V2KA 3L2QA 3MCSA 8RUCA 3OL9A 1HPZA 4NB4A 1UA1A 2Y0SD 3QGHA 1M1KO 3H8SA 4YORA 3ISZA 2G0AA 4DHYA 2OZMA 2QK9A 3TAPA 1TVRA 2YB1A 5AKYA 3BM7A 4DG1A 2E1RA 3WT0A 3I56S 3QO9B 2W54A 2Q1LA 2P9KB 4DSKA 1XN9A 4B3SF 4O3NA 1GMVA 2F76X 2V63A 3VF6A 2BCVA 1Z2LA 2ZEJA 2UU9J 4TU9A 2HAIA 2GWJA 4K0KK 4UATA 2DNZA 2MJNA 5KQDA 2ZOFA 2A2DA 1BPXA 2P6SA 2P9LA 3MEGB 1BU6O 1FTCA 3MEEA 4LF6K 2KRBA 3CJCA 2WF9A 1YJ9N 1IM6A 5KOXA 4X4UA 4C4SA 1O03A 2R8HA 3NMAA 1UFKA 4YNQA 2YI1A 4X64F 1JLAB 4FK2A 4WWSA 3UKRA 4F71A 2C1EB 4DOCA 4OGCA 4IQUA 4NE9C 3B9JA 4LFAF 3VETA 2XCAA 1VQLS 2JRSA 2VQFK 3CM5A 2UXDK 3D6FB 3VQSA 4BXOA 1HWJA 2GOLA 3C15A 3CJ0A 1RAFB 3V6DB 3DDHA 4PGXA 4B3MF 2JEGA 4CO2A 3NVWA 3M32B 1UJ6A 3M6XA 1SIWB 3O44A 2HVDA 5JMNA 4WXWA 1HQEA 3HVTB 4JKFA 1QVFR 2IVYA 1OMSA 2PEBA 1FFUA 5HP4A 3THXA 4NL9A 3RMAA 3GIMA 4FXVA 1JMTA 2OAUA 2JLEA 3AVNA 3RTVA 1BGXT 4FBTA 3VQDA 2MKJA 4BRLA 2DUYA 1PKUA 2BRLA 1XK8A 5GADI 2ZBPA 3OLBA 1RWKB 4NRTA 3NS6A 1K47A 3QJJA 5J0UA 4FZNA 2CADA 2D0PA 2ZJPQ 1CXQA 3FBFA 4X65F 2UUTA 1PYOB 3HKWA 5JVGL 5MLCQ 3A0HU 3ZSOA 4ZVPB 3QICA 1RAAB 4DQPA 2Z2ZA 3OLAA 4MHVA 3DI6B 4NJ8A 2ADBA 3N6MA 1FNXH 5BR8K 3U6FA 4FJ9A 1WI8A 2QT7A 4LRBA 4O0NA 3OXFA 1P1TA 2CQ1A 3UR0A 1NCLA 1T9VA 1XSNA 2FDNA 1R8BA 1S72N 4OMFG 1FWLA 2ZC4A 4H4MA 2VJ4A 7ICMA 8ICGA 2IYGA 2E20A 3Q7CA 3M8QA 4CLWA 4RWTA 4Y2MA 2K06A 4FPBA 2CG8A 4EZ6A 4H5VA 5F3XB 2AEMA 3L7UA 2NNWA 5KNIA 3ENOA 1VHXA 5C24A 3G86A 1RACB 5ETKA 2O6KA 1HNIB 5DM6L 2H5XA 3IA0A 1COKA 2MB0B 3ZT1A 2M2BA 3JS6A 3R5CA 2BE7D 3H90A 2F3NA 4K4WA 1VQPN 4UT4A 1RCHA 3RBDA 3IR7B 3PW4A 2FGCA 3WXLA 1KAXA 2FMSA 5ALQA 2GO7A 4OYZA 4BDYA 1O8BA 2RHFA 4RBUA 5IWAJ 3EZOA 3CIPA 4DV7F 2W25A 2VA8A 1RDBA 2XZTB 2M52A 2VA3A 2HVHA 1FXLA 2V52B 4DSIA 3C2KA 3WQUA 1CI4A 4A2BA 4CP5A 4LY7A 4DR3J 1T3OA 3ISND 1ATNA 4ILLA 4J9LA 1TYQB 4DX6A 3CC4N 2IA6A 5AQYA 1RAOA 3C6TA 2IFXA 4DO9A 3H8YA 4EI2A 3L7PA 1U7LA 4CO0A 3ZETB 1YG0A 4B3OB 3LOUA 2EFVA 4M41A 2FTRA 2DFLA 3CC7S 4DS5A 2UV8A 2F4FA 3T69A 3GWCA 4OYXA 2OEMA 5AZJA 3EO3A 3RF9A 1DBDA 1VSJA 4XA5A 3VZIA 4ZPTR 1ESVA 3CQ8A 3ZX0A 2IS3A 2ZJRL 4EFAC 3OV7A 3ZT3A 4WE1A 4C6AA 1LWFB 1U2FA 2ALYB 5KG3A 3GU3A 2F8KA 2ITMA 5KFFA 4E7IA 4CLYA 5AQFA 1WCLA 2PYJA 2R8GA 2XLIA 1YJNS 3KLFA 2XYPB 3A8YA 2NZ4A 2Z0GA 1VHIA 1IBMF 4DR1K 1RT7B 4OZ0A 4AM7A 3MGVA 2VOPA 5M1KA 5D78A 1B0PA 4D3HA 3MUVP 4Z4CA 2AYBA 1RHQB 3QT7A 3TANA 8ICQA 1LWCB 4JI3F 2C2EA 1XQSC 4DV1J 1TL3B 2DHXA 5C2GA 4KLSA 4QWBA 5EOYA 2ZE2B 1E6VA 2FGOA 2VA2A 2OSRA 3W3SA 5KFEA 1H7XA 3I56N 4K8ZA 5C2CA 3NVKA 2J6UA 2QLXA 2HHSA 3RJMB 3VQPA 2KT3A 3J7YU 1F44A 1VSHA 3MUMP 1QTMA 3DDNA 4CK3A 1U45A 4KX3A 3K9KA 3DOLB 1X4FA 3M8RA 3NNCA 4NXMJ 3MM6A 5GINA 3MEDA 3TO8A 2E5LJ 4FJKA 5CRXA 4LF4K 4UTGA 3NF9A 4FS2A 3AVGA 4P6QA 2EAOA 4XK8C 5DLGA 3Q8SB 2R7UA 3NS1A 3TOQA 1KNZA 1FKPA 1RZTA 4QNLA 3QEVA 3NGKA 1XMOF 4B1WB 3N7PD 3SAGA 3HHDA 3MPYA 3RB4A 1JJ4A 4UASA 1Z6RA 1T3VA 2VFVA 1DZ5A 3F5EA 3CDWA 3WXIA 3U3YA 4F2SA 2JX2A 1Q81O 5HLFB 1XO1A 4O8UA 3LDSA 1Q5VA 5DDPC 2VYPA 1VQLN 1KL9A 4DWIA 3SFUA 4Y6IA 3IM9A 1P9YA 3HVAA 1L5UA 4KTWA 4YUDA 2H65B 2VIHA 3CUNA 3IS9B 4ZPDA 4FJLA 4RNFA 3DGPB 2DISA 4PRFA 2YKQA 1JJHA 1VQKN 5CYQA 3VAJA 2E5IA 2RU9A 4O5FA 1R89A 4LSNB 2YHBA 2HMPA 4FZXC 3ZC4A 3D7EO 1W2BM 3PNCA 2P5GA 1WEYA 1DK3A 2ZJPL 7ICUA 3E2EA 9ICGA 5ALZA 2BKOA 4PY5A 4JKHA 1A76A 4DB3A 2I5JA 5AQLA 1FESA 4CEZA 3WXKA 4KJIA 1NUEA 3HSCA 3SJHA 1NPKA 2M8DB 3MR5A 3ITHA 2ACMA 4CLFA 3P4UB 3MCNA 3N4QA 8ICFA 2W24A 5LL6Z 2FHMA 2KJ8A 1YBAA 1OW5A 4JP8A 4OHWA 4X62J 4L74A 5LOQA 2RN2A 1BQXA 3HPGA 1N5TA 5AFUH 2K8CB 1RDAA 4ISGA 3UN3A 3O9SA 4OPHA 1S9FA 2B21A 4ZVHA 4F91B 1AT1B 2Q1NA 3NGSA 1B0XA 1K73O 4I2BA 4F4YA 3M8WA 1AROP 4O4GA 2FJVA 3GU0A 4KN4A 1SCJB 2DBBA 1F2HA 4WXOA 5J0PA 4DUYJ 1SQFA 5DQHA 3LVVA 1ZM3A 3EWGA 3DI6A 1RWUA 3KKRA 1C4AA 2EANA 1ZPWX 3HXMA 2YNIB 3AH6A 3UO0A 1U1LA 2HFOA 4QZDA 1PSDA 2XO7A 1DY3A 3D0IE 4CJTA 1WSFA 4FZYA 5LMNF 2VWKA 5KFWA 4GKKJ 3UD3P 4CERA 3R9KA 1XMQJ 4X4RA 3AA8A 1BPBA 2DFFA 2G0JA 3Q8PB 4JI6J 1ZQUA 4YY3F 3PW5A 3TZXA