4F2SA

Dna polymerase i large fragment complex 4
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
578
structure length
578
Chain Sequence
MAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 199
structure length 578
sequence length 578
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f2sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4f2sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f2sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4f2sA01
4JWMA 4M3WA 8ICAA 1S6PA 3QETA 2XY8A 4KTWA 4DFKA 2UVRA 5BOMA 1ZYQA 4NY8A 3DLHA 2FBVA 5L1JA 1A5VA 2YV0X 4R5PA 4O5EA 5DLGA 3A2FA 2PFQA 2ZTEA 1BISA 4CF2A 2V9WA 4PH5A 3I0SA 3V81A 2Z1HA 4CK2A 4FK4A 2KFZA 3KLFA 3QEAZ 1TKZA 2M9NA 1RBVA 5KT3A 1Z26A 5J2KA 1TVAA 7ICJA 3EWAA 4ECRA 5KT4A 9ICKA 1S77D 2BQUA 3TABA 2V4QA 4E1NA 2HNZA 4QZ9A 3MR2A 3L3UA 4RQ0A 3KLEA 3RH6A 5EWEA 4TSXA 4OJRA 1JIHA 3KD1E 1HRHA 3TR8A 4DEZA 3QINA 4BWMA 4CJUA 5DMRA 7ICQA 3NF6A 4ED2A 3V6DA 3G6XA 2AQ0A 5HROA 5HP4A 4QZEA 1SL2A 4FJGA 4DLGA 1U04A 4CK3A 4XUSA 1TV6A 4PQUA 1KFDA 3T5HA 4CEQA 3U6FA 4DQQA 1K6YA 3RWUA 5KFEA 5J0QA 2JEJA 4E1MA 3K5OA 5KFOA 3RJKA 4IRDA 1IO2A 4O55A 3NDKA 3T5KA 4B3OA 4ZTJA 4B08A 3KLGA 3S9HA 4IRCA 3QZ7A 3QZ8A 4AHCA 4O3NA 3AA4A 4MQ3A 1Y88A 1N56A 4NM2A 5KI6A 2UVWA 8ICCA 3ZD8A 1KFTA 3PVXA 4J9MA 1ZQGA 3AVGA 4OGEA 4KI6A 5J0XA 2NRTA 9ICLA 2FBTA 3BQ2A 3THVA 1VSFA 2KQ2A 3FFIA 1K1SA 4RW4A 1LV5A 4XA5A 1VSDA 3SQ0A 1LB2B 3AVLA 3HJFA 4R64A 3AU2A 3RR7A 4UB3A 1TK0A 4HTUA 4BXOA 3SZ2A 4F5NA 3P1GA 1WCNA 1S1WA 2JLEA 3OHAA 2P66A 1COOA 1NK9A 1HMVA 1LWEA 4XIUA 2FMSA 2RKIA 2O4GA 2FBYA 4QZFA 2AU0A 2OZMA 1RT6A 4PUOA 4CJRA 4RPZA 4M9NA 5CZ1A 3OYCA 1JX4A 4KN7A 4UB2A 2E4LA 1HJRA 4DTPA 5IIKA 5EWGA 3PW2A 3H7IA 2ZTCA 1ZETA 1JKHA 1DLOA 7ICFA 1CUKA 2WTFA 3SQ4A 5L1IA 4HUEA 4KLMA 4K8ZA 2BPFA 1ITGA 4QW8A 4I2PA 5KFZA 4DU1A 1BIUA 1EP4A 3MXJA 4W5OA 2I1QA 1Q9XA 4PHDA 1HQUA 4Q5VA 3TAFA 3Q8LA 2VANA 4W5TA 4I2AA 4YD1A 1BQNA 1L5UA 1JN3A 3K5NA 4JUZA 4M9LA 4I28A 9ICIA 1JLCA 2H5XA 4QOZB 4KLOA 4IR1A 1S9EA 3PW7A 7ICNA 5KTQA 1IKVA 3QNNA 1EX4A 2OPPA 1U4BA 1ASUA 1L3TA 1TFRA 1RBSA 4GXJA 2F1JA 5J2BA 2BCQA 5SZTA 2ZQBA 3C6TA 2JZBB 1ZQHA 1D5AA 2QXFA 3K5MA 2IC3A 1NKCA 4F92B 1RYRA 4E3SA 4DU3A 1ASVA 3BQ0A 4N47A 4AILC 3NH2A 4NLGA 4EBEA 7ICSA 1SKWA 4FJ7A 2ZTDA 4PHPA 4M6WB 5KFMA 1B43A 4HUFA 5KFYA 3HSTB 5KFNA 4DFPA 1WSJA 4YD2A 4E0DA 5KFKA 3HL8A 5KFIA 1ZBUA 4KLSA 4Z0UA 3LP1A 3O3HA 4TUSA 5KT6A 3V1OA 4DQPA 3HPOA 9ICRA 4CF8A 5DGBA 4CFDA 2W9CA 3AVNA 1NK0A 3SUNA 1S97A 1S0NA 1JMSA 4RW8A 4Z4FA 4FXDA 2HB5A 3ISCA 5HRSA 3LK9A 4QWAA 4DO9A 5K14A 3D45A 2C2EA 2C28A 1S1VA 9ICOA 3SUPA 2D0BA 1KEJA 4N76A 3O3FA 2BCRA 1YTAA 3QERA 2NRWA 5CP2A 3ZSRA 4YFKA 3RMDA 3Q8RB 4J9OA 9ICBA 4M41A 3VQCA 4N5SA 3CYMA 2FBXA 4UAZA 3KTQA 1VSEA 3BDPA 1JL1A 4Y1CA 4RPYA 3MFIA 4RQ6A 4I2CA 4O9MA 1L3VA 7ICGA 2AJQA 1HYZA 4GMJB 4Y1DA 4BACA 3V6JA 2ZUDA 3LAMA 4F91B 4DWIA 4JK1A 4Z4HA 4RPXA 4GVMA 1ZQSA 3CFPA 4ED7A 1FK9A 4KHQA 1TGOA 4P2HA 5KFWA 1KVCA 1S1UA 3ZT2A 3ITHA 4FLXA 4FVMA 3KKRA 1H38A 5J0YA 1BPXA 2IHMA 3ZSXA 1XSNA 3M9MB 4O3OA 4B9LA 2V4RA 4UAYA 5FROA 4CHOA 1IKYA 3C23A 4Q0BA 1JL2A 4ED6A 1QE1A 1RT1A 3ZDBA 2Q3SA 4FM0A 1VSMA 4E7IA 1T3NA 4DTJA 1A77A 2C2RA 4DTMA 2F1HA 4J9PA 1EKEA 4E7JA 3GQCA 3NF8A 5KFQA 3H4DA 8ICTA 4H8KA 4CEEA 2C2DA 2DFFA 4GC7A 9ICCA 2RF2A 3AVAA 4KB1A 3ZCMA 2OPQA 3AO3A 2EHGA 2FPMA 2PFOA 4KITB 3OS2A 3B0XA 2ISPA 5HRNA 1XWLA 3PO5A 3NGZA 2FPLA 5DQIA 3K57A 4Z4GA 2XCPA 1QSSA 4M04A 8ICBA 2XO7A 1MU2A 3HP6A 3OYBA 1X2IA 1I39A 3ULDA 3QLHA 2E6MA 2KZ3A 2O4IA 9ICAA 3RBEA 4CHPA 3OS1A 9ICPA 3L2RA 1UA0A 4Z4IA 4DOAA 4KHWA 1L3UA 3P5JA 3H08A 4CEOA 3L2QA 4Z4EA 4FBUA 3RRGA 3FYHA 4NLZA 1U45A 1C7YA 4PY5A 1NK5A 1SKSA 3CFOA 2G8WA 1C1AA 2ZJ5A 1ZQJA 3L3VA 4P4PA 4J9KA 4DS4A 5CA7A 4CGHA 4YR0A 4KHYA 3DRPA 4FLVA 3SUOA 3DRSA 3ZDCA 1KVBA 4CEFA 4DSEA 4DSLA 1VRUA 4ECZA 3JPOA 2IBKA 5KFLA 2KFNA 1D8YA 4O5CA 8ICJA 4I2HA 4M9HA 2XC9A 3MECA 7ICHA 4CJEA 2HMIA 2IA6A 5DGAA 4K4IA 1HQEA 4IFVA 3AU6A 1UT5A 4MFBA 5J1EA 3M8SA 1B9FA 4QZHA 4OPJA 5I42A 1I3AA 3MGHA 5DB9A 3KHHA 5DKWA 1SUQA 3V72A 1ZQWA 3AO5A 4KKOA 3G6YA 4KI4A 2RDJA 4DOCA 1RYSA 1C0UA 4HUGA 3KK2A 4MFCA 3GIJA 3N4MB 4M42A 5F9NA 4FZXC 4O5KA 1ZQTA 4C8MA 5J0OA 5KG1A 4RUAA 1UT8A 3V4IA 4KLQA 4CJ5A 5J2CA 3SPZA 2QK9A 1XSLA 1TVRA 4CECA 1NJWA 3DLRA 3H40A 3HK2A 3M9NB 4IDKA 2Z1JA 3KKSA 4CGIA 4F4ZA 4LZGA 4K8XA 9ICJA 5J2NA 3ETLA 3MGIA 4J2AA 2P5GA 4ED1A 1QQCA 5J2DA 1QS4A 4FJXA 4QW9A 3CM6A 4FJLA 5CZ2A 4PA1A 5HLFA 2FLLA 4UB4A 8ICLA 1FXXA 4CCHA 3P83D 5KFSA 1J53A 5SWMA 4NM1A 2OZSA 3NE6A 1JLQA 4I2DA 3GIMA 8ICZA 5CYQA 4HYKA 2PFNA 1J5OA 1KLNA 2HNYA 2A1JA 4YG2A 4L8RB 3SYZA 1U47A 1NK6A 1IH7A 8ICRA 3VQ7A 4CFAA 4CHQA 1RDCA 5EU7A 3NAEA 3G6VA 4EZ6A 1X9WA 4CJSA 4CEDA 2OPSA 1RT7A 5J0WA 3UXNA 1VSJA 5KG4A 1XHXA 2RN2A 3K59A 4DU4A 1ZQYA 1BPDA 3RAQA 3HP9A 3GV8B 2W9BA 1KCFA 2BKEA 3TFSA 8ICVA 5D3GA 2PYLA 3VQQA 4MFFA 3K75D 1EXQA 1YTUA 2BPCA 3GIKA 4ECVA 2R8HA 3LALA 4KLHA 2FMPA 2JEGA 3OYEA 1K1QA 3OYKA 4M3UA 3UXPA 4O3PA 3MEGA 4RQ8A 3MEEA 4DL7A 3HM9A 3ISBA 1YVUA 2GUIA 1R0AA 2R8GA 4Z6DA 3KK3A 4KV8A 3GV7B 3VQ9A 3Q8MA 2VA2A 1TKTA 4ED8A 3DOKA 4KFBA 1TV9A 3OSPA 2D0CA 5HNKA 1ZQQA 3OGUA 8ICNA 2KW4A 3I0RA 3RBDA 3QEVA 4FJIA 5C24A 4KB0A 4DS5A 4LH4A 4K4GA 1UA1A 4G3IA 1SV5A 3NBPA 5IILA 1Z3EB 2HVIA 2Y1IA 1BPBA 3GILA 3QESA 5CHGA 1SKRA 4FW2A 4GC6A 3MEDA 1ZQPA 1Y97A 2P1JA 2HHSA 1NOZA 2HNDA 1HUZA 4I2FA 3M8RA 1Z25A 4IKFA 2XCAA 2J6SA 4BE0A 2G8HA 2PI4A 1T03A 3NGYA 4F4XA 4GXIA 1CZBA 2OYQA 4J9SA 5KGXA 4CGGA 5D46A 5KGWA 7ICRA 4KHSA 5E41A 2HHXA 2YNIA 3VA0A 3V9UA 2HHVA 2R8IA 1MC8A 4CEZA 3IHQB 3T19A 3ALYA 4KAZA 1J54A 4F4WA 5KFHA 4O4GA 3AV9A 2FLPA 2GBZA 4DTOA 4PPXA 3SI8A 1RXVA 3V6KA 4B9UA 3CM5A 4KRFA 3VQ4A 4TQRA 2F8SA 4QZAA 4ELTA 5IIJA 2DFHA 4FLZA 4KPYA 4P4OA 4QZCA 5L1LA 4FZZA 1BI4B 2ETJA 1IG9A 3QIPA 3VN5A 4IRKA 3RJHA 3RMAA 1S9GA 5KG2A 3T5JA 4RQ3A 3EPIA 1JLFA 4R8UA 2LSNA 4BDZA 4YP3A 3MXIA 2IOCA 4FK2A 1U9LA 9ICGA 3KHGA 3RAXA 3TANA 1T4GA 2MUTA 3ZSOA 4KLTA 5J2JA 1DTTA 4EP4A 4CHYA 2PZSA 7ICVA 4ID1A 1JXEA 2QKKA 3L2WA 1GOAA 1XO1A 4FLWA 7ICKA 1C0TA 3EYZA 5CWRA 5HMMA 3WNEA 3B0YA 1RXWA 1RNHA 3MFHA 4F93B 5KFVA 3PUFA 1NK7A 3BJYA 1S5JA 4MEYA 8ICHA 4DQRA 4EZ9A 4EEYA 4JV1A 1RTIA 1DGSA 4QZ8A 2HW3A 2ALZA 1MQ3A 4M3XA 3PX0A 3KHLA 1LW0A 3T1AA 3HYFA 4DQSA 2FPKA 3CQ8A 5DK5A 2ZD1A 2G8UA 3KLHA 3DLKA 1GOBA 3M8PA 4R66A 3SPYA 4JWNA 3DMJA 5KFCA 3MDAA 4NLKA 2A1SA 3AVKA 1NKEA 4UB5A 4CJKA 1ZQZA 4DQIA 2FLNA 2PY5A 1WCLA 5DB8A 3KJVA 4FJ9A 3OYHA 2XY7A 3KHRA 4IQUA 4E7LA 4DSFA 1S1TA 4ECQA 3AA3A 3LWMA 4OKEA 5L1KA 4LVSA 4HHTA 1RBTA 3MABA 3RH5A 2XY5A 1RT3A 2KN7A 5DDMA 5J0RA 3LDSA 3B6PA 3C2MA 4YR2A 4DFMA 1WLJA 4YVZA 1BQMA 1C6VA 2B21A 3VQ8A 4KLFA 4BXOB 1HUOA 1T8EA 2B5JA 1S1XA 3OYGA 4ECSA 1V9PA 3HVRA 2AGPA 1B9DA 3V7JA 2BE2A 4F4KA 4DFJA 4W5QA 9ICEA 4FLUA 4FM2A 4AH9A 2OA8A 4DG1A 3LWLA 1ZQDA 4EP5A 5CJ7A 3AO4A 5BPCA 4I7FA 1RDAA 3PR4A 4IG3A 4FLTA 4C8NA 3Q8KA 1TAQA 4LY7A 3TAQA 3WNHA 4ECTA 5J2GA 2IMWP 3SQ2A 1WSGA 3QEIA 7ICEA 1W9HA 2UVVA 3OJSA 4CIEA 3JYTA 4R65A 1S0OA 4C8OA 5KFGA 2Z1GA 1LW2A 2HHWA 1NKBA 4AHUA 1XS9D 4ECUA 3NH0A 2R8JA 4RQ7A 3OS0A 4YFUA 3VQPA 2DTUA 2FC0A 3V9ZA 3LPUA 5L9XA 3L2UA 4CF9A 4F2SA 2JEIA 1VSKA 4ZH4A 4CIGA 4UQGA 5I3UA 5KFUA 2VA3A 3OYJA 5FRMA 3SV3A 4OKKA 3K2PA 3PW5A 1RBRA 1S76D 3RTVA 5J0TA 3PW0A 4P4MA 2YNHA 2W8LA 1TK8A 5DDYA 4FJJA 4F5PA 4M3RA 9ICUA 3RR8A 4YN4A 3V9XA 4XQ8A 2ATQA 4LH5A 5KFDA 5KRSA 3MR5A 4I27A 2ZJAA 4E89A 3AUOA 3AVCA 3QEWA 2NRZA 3V9WA 3DLEA 4M9JA 1JLGA 1HJPA 1A5WA 2GWSA 4ECYA 7ICLA 3LZJA 4N56A 1JLBA 4QZDA 1ZQBA 5KG6A 1S10A 1JXBA 3V1QA 5IINA 4FK0A 8ICMA 1XHZA 4C8KA 1U49A 2BHNA 4RNNA 4RU9A 4AHRA 4FJ5A 2W9CB 3KIOA 2D5RA 1BPEA 3RMBA 2W42A 5DLFA 4Z6FA 4F50A 3V7KA 5IIIA 1JXLA 3ZT0A 4DMNA 4Q45A 9ICWA 4OKJA 4KLEA 3OYNA 4Z6EA 8ICEA 4DSJA 1BHLA 4RW6A 2IDOA 4CE9A 4M3ZA 3VA3A 1RTJA 1CXQA 5JS1A 4KTQA 2BR0A 4FBTA 3K4GA 1UOCA 4Q43A 4NCGA 3I8DA 3DYAA 2ASJA 5KT5A 2BPGA 2EX3A 1QLNA 1N5YA 2YHBA 2G8KA 4W5RA 4HCCA 1RPLA 4M47A 3HX0A 4I2JA 2KTQA 3TI0A 4J9RA 3JPTA 1NOMA 1T7PA 3GDXA 4KTZA 1CZ9A 4OLBA 1SZPA 4PGYA 3E01A 4ELUA 3M8QA 3C5GA 3BGRA 3LP3A 3SCXA 3Q8QB 1Z00A 4RQ1A 3LP2A 5EWFA 2XGPA 3HPHA 3AA5X 4OPKA 3OYIA 3G10A 1WSEA 4FJHA 2A1RA 4CHZA 4EYHB 2BCSA 4RQ5A 1QSYA 4F8RA 4CESA 2W8KA 4PGQA 1C1CA 1TK5A 1DOQA 4NXZA 4MF2A 2HVHA 3PY8A 4DL4A 1ZJMA 1ASWA 5FDLA 1IM4A 4M45A 3AVFA 4FJNA 3BQTA 1ZBIA 3KLIA 5CY4A 5F9LA 4LSNA 4I2QA 4DTSA 1TKXA 4QCLA 2J6TA 2P51A 3NF9A 1D8LA 3NHGA 4FO6A 3PNCA 5DG7A 1ZQMA 4IFYA 1QHTA 2VG5A 4DOBA 5KFTA 4QZIA 4E19A 3OHBA 4H4MA 1QSLA 2AGOA 2I9GA 2UVUA 8ICFA 4AHVA 1ZBFA 2ZUBA 2YKMA 2YKNA 4O0IA 4PHAA 3V1RA 8ICKA 4F5QA 4F3TA 2PYJA 1X9MA 3RMCA 4JLHA 4UB1A 1Q8IA 3AA2A 4LSLA 1U48A 4KLGA 7ICMA 4M3TA 4FW1A 3JPSA 3AVHA 1JLAA 4YXMA 3LZIA 7ICUA 3SNNA 1ZQVA 1BVSA 2RPIA 1S6QA 2VA8A 2JGUA 1NK4A 3PW4A 4PHEA 2J6UA 4XRHA 1BCMA 3QEPA 2JZBA 1N6QA 4YNQA 3ZD9A 3L2VA 2IGIA 3NGDA 3ZSVA 4O0JA 5DBCA 3NFAA 9ICMA 5CB1A 8ICSA 2BCVA 3JPQA 4RT2A 3DM2A 4IG0A 4QZBA 4I9LA 3ZT1A 3TAMA 4Z4CA 9ICQA 4PWDA 4DL3A 3IM1A 4Z6CA 4FJ8A 4RUCA 4M6WA 2LYHA 4UAWA 3Q8SB 1LAVA 3QNOA 1VSHA 3RJIA 3T3FA 1WN7A 3MR3A 2G8FA 7ICPA 1BIZA 2R7YA 4QAGA 9ICNA 4F5OA 3OYLA 4OGCA 3ZT3A 5KFPA 3F9KA 1RCHA 5J2AA 2B6AA 5D4BA 4CF0A 1BL3A 4IQTA 2RDIA 5KG0A 3TQ1A 2DPIA 5HP1A 4UBBA 3ZT4A 3S3NA 3TFRA 4RZRA 2ISOA 4AHTA 3LAKA 3VQ6A 3T5LA 3DRRA 4M0AA 2QKBA 1NK8A 3PV8A 5KG5A 4O44A 3EY1A 1ZQEA 3C6UA 1ZQIA 4E7HA 4JS4A 4M9GA 3RB6A 2DPJA 4LZDA 4YMOA 3TARA 2XY6A 1Z00B 3AO1A 1ZJNA 3AO2A 3RJEA 2GV9A 5JUMA 1IXRA 3PX4A 4KLUA 4QWEA 4B9VA 4CF1A 3EZ5A 5IIOA 4I2BA 2W9AA 4CFBA 3C1YA 4IBNA 4RW7A 4HVJA 3UQ0A 4J2BA 3BQ1A 3AVBA 4CHNA 2X78A 2PXIA 2X74A 1ZQFA 3WNFA 3OSNA 4B9MA 4DF4A 1G15A 1MSWD 1CXUA 3MBYA 1KFSA 5J2PA 1RTDA 4M2YA 1RT5A 3GV5B 4O3RA 1CLQA 5J0UA 3V7LA 5JS2A 1SL1A 5KFRA 4ZTFA 3UIQA 3VQEA 4AHSA 2PI5A 4CJFA 3SUQA 3S3OA 1BCOA 4RT3A 2F96A 4RQ2A 4KLIA 2AQ4A 2IAJA 3C1ZA 2OPRA 2A1JB 4NLNA 1LWCA 4CJWA 4J2DA 1XI1A 4NCAA 1WSHA 4CJLA 4J9LA 4Q44A 2KZMA 1HPZA 2IHNA 2BGWA 3RJGA 1FKOA 3E2EA 3V9SA 1W0HA 2YNFA 1BGXT 3ISDA 1ZBHA 1TL3A 4J9QA 4ED0A 3DLGA 4DTRA 4O3SA 4HCBA 2W9BB 3LDAA 4ECXA 1WAFA 3KK1A 4FLYA 3SV4A 5C42A 3WNGA 1UWBA 4LD0A 1JLEA 5CR0A 1ZQXA 4WE1A 1ZQLA 4IR9A 1XC9A 2HHQA 5DBAA 3PMLA 4Q8EA 3U3GA 3UXOA 4YMNA 1BPZA 4FM1A 3G0ZA 4ED3A 4F4YA 2E6LA 1VK0A 1ZQCA 8ICWA 4TURA 1O1WA 1N48A 3ZSZA 5DG9A 4CEAA 4FZYA 4TUQA 4B8AB 4IQVA 3CG7A 1NJZA 2VWKA 1VSIA 3SI6A 4FJKA 4C8LA 1TAUA 3O3GA 3RRHA 3JSMA 4FS2A 3HPGA 1FKPA 1S9FA 4TQSA 4H4OA 5J0PA 3V6HA 1RBUA 1YT3A 1REVA 1T05A 3K58A 4MFAA 9ICHA 1RTHA 4KMUA 4IQWA 4JRQA 5DB7A 4DL5A 3C94A 1TL1A 1L3SA 5T7BA 4GW6A 1WSFA 4M3YA 4NYNA 3C5FA 2MAXA 3AVIA 4ICLA 4I9QA 3O4NA 2P6UA 3NTUA 3PMNA 3RB3A 1KVAA 1ZQAA 2JEFA 5HBMA 3ZDAA 1IKWA 3GFKB 4YXJA 4BDPA 2ASLA 2ZE2A 5D49A 4CIFA 5FRNA 2XRIA 5IIMA 4F2RA 1A5XA 5J2QA 4E7KA 4B9NA 5KRTA 4JV0A 3LP0A 3NCIA 1X9SA 4KN4A 3JPRA 5KFXA 3N97B 1DTQA 2VG6A 5HMLA 2BDPA 4EBCA 1S0VA 7ICTA 2KZZA 4FYDA 4B8CA 5J2FA 1IKXA 4BDYA 4JV2A 5CYMA 1HNVA 3VQBA 3Q8PB 1B92A 4CJ3A 3K5LA 3GIIA 3H8JA 2D0AA 2PFPA 2F1IA 1LWFA 4CJQA 2Z1IA 2C22A 5DB6A 3IAYA 5EOZA 2XGQA 1CEZA 1WAJA 4YCXA 4MEXA 1X1PA 1A76A 2P5OA 1QTMA 1KLMA 2DFEA 5C25A 4R8UB 4I29A 2BANA 3OY9A 3CFRA 5KG3A 4CK1A 3LANA 1VRTA 4N41A 3OJUA 3H4BA 4DF8A 2P6RA 4KLDA 3OYAA 3RJFA 2MUTB 4KO0A 3VQAA 2HHUA 1EETA 5DBBA 1B22A 3S3MA 4FCYA 3QEXA 4DTNA 3NF7A 9ICVA 2BQ3A 2OWOA 3ORYA 3HW8A 9ICTA 4DTUA 4J2EA 4RNMA 1KTQA 1Q9YA 2G8VA 4CERA 2G8IA 4BGDA 3JPNA 4X5VA 4ECWA 4Q8FA 3TWHA 3C2KA 4DSKA 4QZGA 3L8BA 3EW9A 3HXMA 3RB0A 5KFJA 3JPPA 1RILA 3LPTA 5HHIA 4QWCA 2F8TA 3RJJA 4I2IA 2IS3A 5DQHA 8ICUA 2X6SA 3ASMA 5KT2A 3DOLA 1RZTA 3C95A 3ZSQA 4ZHRA 4CEBA 5TZVA 3O4QA 1ZQNA 2X6NA 3QE9Y 4F3OA 2VG7A 3ZSYA 3OYFA 9ICFA 1F21A 5KT7A 1WNSA 4JS5A 4B9SA 4CJPA 4FJMA 1PZNA 3PR5B 1S0MA 1ZQUA 2BGGA 2NRXA 4NCBA 4K4HA 3IRXA 5DQGA 5HRRA 3PO4A 2Y1JA 7ICIA 4JRPA 4GXKA 3HT3A 1BPYA 3H8SA 2DFLA 8ICXA 1RDDA 3SJJA 4DL6A 3MXMA 4RNOA 2ASDA 1RT4A 2Q0ZX 4TUPA 5BOLA 4FS1A 3UQ2A 1NJYA 4YMMA 4J9NA 1XU4A 1KSPA 3OYMA 1WSIA 5KG7A 4BE1A 1GOCA 4KHUA 3TAPA 3QO9A 4RW9A 4CJ4A 2WONA 4ELVA 1HNIA 5J2HA 2FMQA 5HRPA 5KFBA 3NH1A 3NGIA 3VQDA 3FDSA 5DG8A 2NRVA 1MQ2A 1NJXA 1D9DA 4KLJA 4NYFA 8ICOA 5J2IA 2ATLA 1AROP 8ICYA 4BE2A 4QWDA 3ISNC 4OLAA 2XHBA 3U3YA 4UBCA 3MR6A 4R63A 4KHNA 3HO1A 4EYIB 2ITGA 4CGJA 1NOYA 5KFFA 3EPGA 5J2MA 1J9AA 1C1BA 3F73A 2B4JA 8ICIA 4CGDA 4QWBA 3QIOA 3DLBA 1ZQOA 2YNGA 4CFCA 2VWJA 3RH4A 3MDCA 3QEBZ 2NUBA 2W9MA 4G1QA 2R8KA 4DSIA 4RQ4A 2DY4A 1C0MA 1KDHA 3SQ1A 1TKDA 3H8WA 2YHAA 4MF8A 2ZJ8A 3IS9A 4B9TA 1EXNA 4YQWA 1KRPA 3B6OA 3ZSWA 3UPQA 3VQ5A 4GLXA 5J0SA 4CJTA 8ICQA 3AVMA 8ICPA 2ZUCA 3MAQA 4RG8A 1HYSA 3OVNA 2BCUA 3D0PA 3OYDA 3TAEA 1LAWA 4OVLA 5J2EA 3TAGA 4CJVA 1SL0A 5KFAA 4DTXA 4DL2A 4F5RA 3C2LA 1D9FA 3DI6A 1ZBLA 1RDBA 5C5JA 4DLEA 1ZQKA 3AVJA 3IG1A 9ICSA 5HHHA 2I5JA 5J29A 9ICXA 3ZDDA 4KLLA 4O5BA 4BWJA 4I2EA 1BI4A 4CGFA 3KD5E 2AGQA 7ICOA 3RB4A 2WOMA 3M9OB 4KREA 2BQRA 1HYVA 1VSLA 4O3QA 4ID5A 4YR3A 3HVTA 4I2GA 4EBDA 3PX6A 3ZDEA 2HHTA 1RT2A 1UAXA 4PGXA 3HWTA 1XSPA 8ICGA 3C21A 4W5NA 1ZQRA
chains in the Genus database with same CATH superfamily
3S7RA 4OZ1A 1JLBB 2HQFA 1R59O 2UVRA 2QWNA 2F40A 2GO9A 3T6BA 1L8OA 3DLHA 1FIQA 1X42A 5L1JA 1F2HA 3KHYA 1K47A 3MN7A 1RHUB 2RUSA 1BISA 2LMRA 3CC7N 3V81A 5M1NA 4FK4A 1RAAB 3E66A 1KEKA 3QEAZ 2M9NA 3M6ZA 2MGZA 4I6MA 5D0GA 1XNQK 2Z7JA 3EWAA 3BGUA 1JJCB 2BQUA 4ILLA 4LFBJ 4HHUA 2GZOA 3ATVA 4ZJLA 1UCNA 1M5HA 1PBUA 4GMKA 3RH6A 4F02A 3R6LB 4RLEA 3TR8A 1FRJA 3HHLA 3DXMB 2E1MC 3G6XA 2K4EA 5HP4A 1SL2A 1RTJB 2IM0A 2ERRA 4K43A 3H5XA 1GLJO 3CCQS 1KFDA 4CEQA 4DQQA 4PG6A 1K6YA 3RWUA 3CEDA 4E1MA 3DYAB 3O08A 5KFOA 1UETA 1FWKA 4ZTJA 3KMQA 5AI5A 1RAGB 1OY9A 4DV1J 4K4ZA 3DLJA 2XULA 4AHCA 1OW5A 3D7EO 3OUYB 1Y88A 4NM2A 5E3RA 2UVWA 2GLEA 1KBUA 3O6QA 4J9MA 3AVGA 5AQQA 3SCKE 2OCEA 3D54A 2G2ZA 4KI6A 5ALWA 2ZIXB 3AFGA 3BQ2A 3WC0A 2CNOB 2XMWA 3FFIA 4BRPA 1K1SA 1ZAXA 5A0YA 2J7UA 4BRHA 1B99A 4YDXA 3SQ0A 3C46A 3BS5B 4R64A 4JB3A 2YWWA 1VQPS 4HL9A 3F44A 4UB3A 1TK0A 5EUHA 4BXOA 3SZ2A 3QIDA 2ZJPL 1VCTA 1S1WA 2JLEA 3RSEA 3B78A 3VAHA 1HMVA 2ZWOA 2FMSA 4YOYA 1U0SA 5AM5A 3E1YA 2IVFB 2OZMA 1RT6A 1M6YA 2DGVA 2GVDB 4CJRA 3JQKA 2APOA 3OYCA 3KLIB 4UB2A 1TKXB 4K8RA 4W92B 4HH1A 2WTUA 3QT7A 3PW2A 3EKUA 1ZETA 1JKHA 4PXDA 7ICFA 2WTFA 2Z2LA 5EX5A 1ZOTA 3KUGA 5EGYA 1IV0A 1GMVA 3DDKA 4K8ZA 4ZDNA 3GSIA 1FNXH 4NL9A 4I1TA 4H4MB 5HOOA 1NNEA 4I2PA 5KFZA 3K17A 3PRDA 1ZAWA 3EE8A 3R5GA 2VBWA 2WK4A 4PHDA 2WVEA 3UCZP 2A40A 2NXJA 3IR5B 4OX9K 3HVAA 4W5TA 4YD1A 1BQNA 2W40A 4KHPF 2WF8A 1TFWA 3K5NA 4OIXA 1JLCA 1V85A 3M8YA 2BZ2A 3D6HB 3TTFA 4CLSA 4BR0A 4WP8A 1Y3JA 1N32F 3R27A 4XPEA 1FJEB 4R5PB 2WFBA 3TYTA 3M5RA 4JI3J 3NOGA 3D2QA 3VAJA 1ASUA 3CMAN 2XI2A 2F1JA 3RF9A 3IWLA 4M5GA 2BUPA 1XMQJ 1N6QB 2UU9F 3C6TA 2XICA 5AE2A 2QXFA 3H90A 1IBMF 1PVRA 2IIRA 1BUPA 2N7CA 1LEOA 4JYAF 4WTOB 3H46O 1N33K 4NLGA 5LSRA 7ICSA 2E1AA 3A12A 2KVSA 4K0KF 4WZMA 2OANA 1S59A 4MHVA 3OQ2A 1NZ8A 1B43A 4HUFA 5KFYA 5KFNA 3OR1A 4USJC 3TZYA 2BW2A 2LP4A 5GMEA 2A3JA 3O8MA 1HD1A 3P39A 4H5RA 4JK8A 2VPYB 1ZS6A 3GR1A 3KYLA 4CF8A 1YRXA 4OYZA 4DV7J 1X66A 3SUNA 1S0NA 2VFSA 1SJ3P 3CQYA 3DRRB 5JVGL 3BB5A 2RVJA 4LVNP 3NOCA 4Z4FA 4O44B 3FBFA 2VIXA 1VC0A 2NSBA 1JJ4A 3LK9A 5HRSA 4DO9A 5K14A 4D3GA 9ICOA 2MKHA 1RWMB 2AEMA 1JCGA 2HQGA 2QLBB 5EE0A 2KKZA 1KEJA 3O3FA 4GKKF 3QERA 1GMUA 1FRHA 4IL6U 4YUDA 3ZSRA 3NS7B 4YFKA 3WQPA 3Q8RB 4B3SK 4J9OA 3W3SA 4M41A 3ZTPA 2VFUA 2QB0A 2XBPA 2GIRA 2VASA 3AXMA 3BDPA 4KH0B 2HF3A 5M1FA 4ZLPA 3AM9A 5J2PB 3FZLA 5AQOA 1HYZA 2RMLA 1YGYA 3NNCA 1KBRA 3MMVA 4YHHF 3J80U 3IBPA 2DGSA 2GW8A 1JUDA 5EY4A 4RPXA 3TZZA 1DLOB 3W2VA 3G2XA 1KVCA 3ZT2A 2CXYA 2FE9A 1LOTB 1H38A 2IHMA 2ZH7A 4EFAC 1E4FT 3M9MB 1QQ5A 3HX9A 4M5DA 3EDRB 3GIRA 1BXNA 4UAYA 4CHOA 1DT9A 2IDEA 3C23A 2ZIUB 4PWWA 4DUTA 4Q0BA 3MM8B 4Y2RA 2IVNA 1QE1A 1RT1A 4ANEA 2Q3SA 4FM0A 2MY8A 3IWXA 4DTJA 2Z0GA 2O8DA 2GVZB 2C2RA 4YEAA 3ZLJA 2EDUA 2NUHA 4ZCIA 4E7JA 3CD5A 3WK4A 1NRKA 3CIMA 1QVGM 5KFQA 3IG8A 3A8EA 4QPXA 4CEEA 3KK1B 3AQFA 4GC7A 2RF2A 1UWBB 2HBZB 4WE1B 5A6PA 1P8ZA 1Q53A 5F0WA 1RZMA 3PO5A 5K8NA 2F8KA 4EAHD 5DQIA 3K57A 2XCPA 8ICBA 2GA7A 2XMMA 5LJ3Y 1OVQA 3DXBA 4QIWD 1YI2N 1I39A 1Q7LB 2MQLA 2X51A 1O5JA 2W25A 3QLHA 3GFXA 2YVSA 4QIWF 2EBEA 2EKNA 3F0NA 1BU6O 5EE1A 2WFAA 1XNSA 4CZFA 2KV2A 2HGLA 3VEYA 1GO3F 4J7CA 2DNLA 3L2RA 2YWHA 3JSMB 1SXDA 4DOAA 5GAGU 3H42A 4CEOA 2G06A 1HR0F 3DHXA 4FBUA 2B9XA 3RRGA 3JTNA 5BJRA 3FYHA 3LDOA 3CC2S 4NLZA 4PY5A 4X4QA 1T05B 5KPTA 2G8WA 3UM9A 1ZQJA 4R0JA 2HVZA 4DU7A 2AEJA 4KH5A 4FWQA 5ALDA 4J9KA 4DS4A 3QJLA 2GNKA 4YR0A 4KHYA 1HX1A 4ICLB 4FLVA 3SUOA 1SBRA 4F26A 1RHJB 4CEFA 3AY9A 5GTHU 3M7VA 3O9TA 3AJ2A 2KP7A 5HBMB 4HEA9 2IBKA 3BPSP 1D8YA 4O5CA 2RU9A 2HMIA 3PSFA 4K4IA 3NASA 1PJ6A 5JLFA 1UT5A 3GJQB 2SXLA 3H5SA 4QZHA 2UUBK 1WF1A 4QYZK 2LVWA 3DU6A 4BRMA 1ZQWA 5DM6Q 1NZPA 3AO5A 3G6YA 1HNVB 1VQSA 3R2CJ 2D9OA 1TL7A 4BHQA 2IJRA 2XTJP 4DOCA 1C0UA 4C0OC 3LM2A 1Q3UA 1GTHA 1K8AT 3GIJA 2WF6A 4JI1J 5HVHA 3C2PA 4C8MA 2DD8S 4RNHA 4RUAA 1I1GA 3I5BA 4PPZA 2BX6A 4X65J 1QAXA 2CGJA 2BANB 2LXIA 1UPMB 2RRAA 2MLYA 5IT4A 1C20A 5AE3A 3M9NB 4HTIA 2Z1JA 4PL2A 4CGIA 1EETB 4K8XA 3GG4A 2NYHA 4ZKAA 3ETLA 2M4MA 2KJVA 2NR0A 4B02A 5ALPA 4ED1A 1QQCA 5J2DA 2QWQA 4WKYA 3VWSA 1UCVA 4QW9A 3ILJA 2H3ZA 3CM6A 3VPZA 5CZ2A 3O5TB 3RU0A 5K8OA 4U67L 4UB4A 4X62J 4KX5A 8ICLA 1MWYA 1MW7A 4CCHA 2IA0A 2ADCA 3CCTA 4JI2F 5KFSA 3TPQA 2CQCA 3UDVA 2OZSA 1JLQA 3GIMA 3PIOL 3DV9A 3DOLB 5CYQA 3SCIE 4HYKA 3PFOA 3R7BB 5E3PA 2VG7B 1J5OA 3GYXB 1MN9A 4HTJA 4ILGB 4X4PA 3SYZA 5ALFA 1F2GA 1OY8A 4QR1A 1IH7A 8ICRA 2VCPA 3N4PA 3VQ7A 4CFAA 4CHQA 2IIHA 5EU7A 4P0QA 3ONNA 1JNRB 3PSPA 1NGDA 4RL1A 3IXQA 4LF8F 1N0VC 4CEDA 4IOAL 1RT7A 3K59A 3UXNA 1ZQYA 1Q5VA 3KNGA 1VGYA 3J8AA 1YBTA 4LBHA 2KSOA 2DNRA 2CIMA 1ZA2B 4ZVOB 2W7OA 2PYLA 3VQQA 1WWVA 1X9XA 5ADXA 1YTUA 3TSQA 4ECVA 3LALA 5F8NA 2JEGA 3M2UB 4WU2A 3UXPA 1NEEA 2ROEA 2Z4PA 3MOJB 4RQ8A 3QO9B 4RW9B 1P27B 3HKZD 1HNIB 2R8GA 3KK3A 4XH4A 2AX0A 2PMZC 4MO5A 3HKZF 3GV7B 4CLPA 4IEIA 4L73A 1M1HA 2BE9B 4DR3K 2EFGA 4CVNE 2OFHX 3L09A 2VA2A 1T44A 4BRIA 3VGSA 3ZZPA 1PC4A 4LFCJ 4EU0A 5HNKA 3QRQA 1HW9A 5J2MB 3OGUA 2KW4A 4MKBA 4DS5A 1N5SA 3M2VA 4FDFA 2AYMA 4G3IA 2E8AA 1DZ5A 4JV5K 4OPAA 2N4DA 3PFEA 3GILA 4A61A 3QESA 5HQLA 4Y2PA 1SKRA 5FD1A 3DN9A 3OR2B 3KJFB 1RWOB 4GVLA 1Y97A 3OD2A 3UN3A 1M1GA 3WXLA 1EARA 2HS0A 4DV5F 1BO5O 4DV3K 2F4VJ 2WB4A 1HBMA 5F8IA 3VGUA 3WK7A 5E3QA 1OQ3A 4WFBQ 4GXIA 5GINA 2ESEA 2OYQA 4JKGB 2DBYA 3CCJS 4QPTA 4J9SA 5HANA 4CGGA 3RZAA 5D46A 2FGOA 1TUWA 2ZIWA 4TLRA 3VA0A 3CO9A 2YKAA 3V9UA 3TADA 2R8IA 3A8KA 3FK4A 4GKJF 4CEZA 3IHQB 4G65A 4BREA 1J54A 5CABA 3DI6B 2ZOMA 3QQCD 3SI8A 3HFZB 4B9UA 1FVSA 2F8SA 3PYDA 3IG5A 2DFHA 1N5TA 3KG0A 2HOFA 2UXDF 1VBYA 4TNOA 4C4TA 4ID5B 4WP3A 4PG4A 4FXVA 3QIPA 1R8CA 3RJHA 2X1GA 2H5EA 4R8UA 1Q81O 1KVJA 2DY1A 2NXCA 9ICGA 4CLTA 3E9LA 2E5LF 1S6PB 4KLTA 1U1MA 4EP4A 4LFBK 2M7SA 1WKJA 3L2WA 3MM7A 1C0TA 2P5VA 5EOYA 3EYZA 1YIJS 3B0YA 1RXWA 1RNHA 1LFPA 2V2VA 3GTYX 5HJXA 4FWRA 4YOUA 3ELHA 1MROB 1NK7A 3M1YA 3I0SB 5J1NA 3KLFB 4EZ9A 4F3QA 1TKZB 2GOLA 4F71A 2MJUA 4U7UK 4CJ7A 1DGSA 1WC3A 2ZJRL 2ALZA 4KH4A 1MQ3A 3PX0A 1OJ4A 1F0XA 3KHLA 1LW0A 1RDFA 4MLEA 2Q1NA 5B7WA 1DGJA 4DV1K 4IC9A 1QM9A 4ZPWR 5JU5A 3LM9A 4BUGA 4U7CA 4BRQA 5MLCV 3OLAA 1CJKB 4C7ZA 4Y0WA 5B0BA 2D74B 1SKUB 2PA3A 2LM1A 5HROB 2L9WA 1ICEB 4R66A 3SPYA 4A8EA 5M1OA 4J9UE 1TV6B 4PQUB 2FZGB 1L7MA 2VGNA 2A1SA 3AVKA 1WBDA 3HJVA 2ACYA 4X4RA 1FD8A 3HKWA 4AUKA 2VICA 3KZBA 3M30A 1QCKA 4WWSA 4RJVA 3EXCX 4NOHA 2MHEA 1IN0A 2M3DA 3JQMA 2EI5A 5IM0B 2LM4A 3NVVA 1S1TA 3I96A 4ECQA 4PKGA 2EK1A 3F41A 3TUZC 4LF5J 2D3ZA 2XI9A 3PCOB 1RBTA 3RH5A 2XY5A 4CRXA 2LPEA 1E3MA 4N77A 2H3FA 5AQJA 3LDSA 4DMZA 3FGUA 4YOEA 4YR2A 4HWIA 4YVZA 1WLJA 1BQMA 2XYHB 1C6VA 3R5AA 4LRDA 4KLFA 2QSFA 2FHOB 1FA0A 1U02A 2CG8A 1H2TZ 1Q1KA 4ECSA 1XR6A 2RKIB 3NWRA 3O1LA 3FCHA 2O01C 4WFXA 3V7JA 2BE2A 3L0QA 4W5QA 9ICEA 3OVBA 3OVAA 4XK8C 1ZQDA 4EP5A 4ZP9A 5BPCA 1RDAA 3CDUA 3C28A 1QTNB 4FLTA 1R6YA 1SIWB 4LSZB 3HULA 3UD4P 1H72C 2FY1A 2BYCA 4FF1A 4LY7A 3TAQA 5J2GA 2IMWP 2V50A 2PBDA 2L41A 1ZRMA 5AQRA 2HLUA 3TVKA 1G1XA 1W9HA 3U26A 2O67A 4OHXA 4JI3K 3JYTA 1FEHA 2UUTA 4WIQA 2HHWA 1XMQK 2H48B 3IRUA 3CCQN 4NWBA 5D4LA 3ZZTA 3HHNB 4DUYJ 4USMA 2MQQA 3MPDA 2FUG9 4USIA 4TXSA 3L2UA 4C1NI 4CF9A 3QAUA 1VSKA 4OHVA 5AIBA 5LMUJ 5BN9A 1PUZA 2UUCF 5I3UA 2DO0A 2H4WB 5ALVA 1LK5A 1IKVB 2VA3A 2OPPB 1YJVA 2K3KA 4OKKA 4IDHA 3CNHA 1S76D 1AB8A 3NCRA 5D4OA 4M5KA 1KL9A 3PW0A 2YMPA 4P4MA 1AA1B 2XLKA 2OSQA 1HHQA 1R0CB 2I2YA 4FJJA 2VGMA 3IBWA 3UW1A 2E8MA 5KRSA 1MMDA 3MR5A 4AL5A 3AAWB 4X66F 1VQPN 4I27A 5HR6A 2B0GA 4DV7K 3Q7CA 1Y5LB 1R7IA 1JLGA 3WKAA 3MD3A 3M3ZA 2HQCA 4H5VA 2GWSA 2ZDPA 1IBCB 3OTCA 2DF4B 1RCOB 3C6AA 2KH9A 4IEEA 2LQ8A 3OXGA 4I64A 2NPFA 3CCZA 1G2EA 2R7QA 3LP1B 1K73T 4C8KA 2BHNA 4NI2B 4EMDA 2F65A 3R6MA 5ELZA 2H3VA 1VQ7S 5DLFA 5AQYA 2CQDA 4L76A 5LL6Z 4P0PB 2R7UA 2JWLA 4OJPA 4Q45A 4CGZA 2W41A 1S1VB 4JKDA 4NLTA 4OJ1A 2AT1B 1VJ5A 3HFKA 5AFUA 4CZKA 2P9GA 3CB4A 2ILYA 4NEYA 4ATNA 2CNLB 2YY6A 1ECWA 4KHRA 3AN1A 1IBKJ 1HBOB 5AXLA 2EX3A 2YHBA 2NREA 4DB3A 3HX0A 1LWXA 4I2JA 4WP9A 5IQ6A 4J9RA 1NOMA 1FK9B 1R6VA 3ENQA 2KM8B 4LF7F 4OLBA 1S1UB 4JD2B 3ITHB 1JI7A 3MGVA 4PGYA 1BWVA 4ELUA 1HKGA 4YORA 4JI7J 5AFUH 5AKKA 1N0UA 3Q8QB 2OUGA 3AQOA 1Z00A 2C2NA 1N88A 1YJ7A 1V4SA 5EWFA 1NB2A 4OCZA 1H74A 2FJXA 1Q18A 4PAAA 3AA5X 1PO6A 4OPKA 3OYIA 3WX4A 1N36F 3QFUA 4BC3A 3B8HA 1KWMA 4ANCA 4A8QA 2P9PA 3FCWA 1VQOS 1RP5A 4I0WA 3OTBA 4CESA 1U2VB 2W8KA 3MX5A 2YXLA 4PGQA 1RK8A 1Q95G 4JI6F 1HWUA 4MIWA 3Q23A 4QR2A 1X7VA 1UEKA 3WIVA 5HVFA 4K4WA 4DL4A 3AXKA 4AE5A 3BQTA 5CY4A 4I2QA 4QCLA 3I28A 3FUYA 1SC3B 1WJ9A 3D66A 1ZQMA 4NLUA 4C4SA 2VKZG 1BHNA 5A8RB 3A0IX 5KFTA 1WF0A 3T7ZA 5AZJA 4QZIA 1WI8A 3BP8A 1V5IB 2I9GA 3ZZ0A 1ZBFA 3ETMA 4JKFA 4PHAA 4GFJA 3V1RA 8ICKA 4DPYA 1QZ6A 4JLHA 1OVYA 2P9KA 5IV4A 3AA2A 1PIEA 5ADZA 3BY5A 4KLGA 3MOZA 2YX1A 4L75A 3JPSA 3UMGA 1SIZA 2LU1A 3SNNA 2E7VA 3A4TA 3MM9B 3G8TA 4PHEA 5AI0A 3D6FB 1RAFB 5AQFA 2JZBA 2ZBIA 5F2RA 2EC2A 1CLFA 5DBCA 3NFAA 1KAYA 1Q86O 4WF9L 4FPAA 2HIYA 2BCVA 3JPQA 4RT2A 1ZM4A 2DVIA 4W98A 4H5NA 4JI1K 5L8RC 1RHRB 2D0OA 4HR2A 2JRSA 1HQEB 4IFVB 1SJ1A 3H2LA 3W61A 3O80A 1UPPA 4MFBB 1JJ2M 4R25A 4RUCA 4M6WA 5I42B 3OFGA 2LYHA 3Q8SB 1LAVA 4X65K 1VSHA 3RJIA 3FZ2A 3GU0A 3NS6A 1O03A 2R7YA 2ZOFA 3CXCR 1ZD4A 4L3KA 4AT1B 9ICNA 4F5OA 2CPRA 3F9KA 1VQYA 1RCHA 1PAEX 3OFEA 5D4BA 3TQ1A 2DPIA 1H7WA 3S3NA 3M32A 4ZVPB 1YKWA 2Y3YA 2ISOA 2BMBA 5C2CA 4LF9F 2XMUA 3T5LA 2BEFA 4CYUB 3E3XA 4M0AA 3W3DA 2QKBA 4LF4F 2KHDA 4WBFA 3U4LA 1T9YA 2F7TA 4NXMJ 3HRGA 4X62K 4E7HA 3NUQA 2E1RA 5DDQC 4JS4A 2G09A 1S5LU 1QQMA 4KT0C 5JUMA 1IXRA 1OXJA 3J81O 2GWJA 4WFZA 2VQFF 2G4BA 3EZ5A 2XSJB 4P75A 2VPXB 4Y2AA 4OO1J 1Y7PA 1A0OB 2X74A 3MEKA 3CC2N 3C14B 3D2NA 2VC0A 3UR3C 1RWUA 5HLFB 2DCLA 3OSNA 4B9MA 1KFSA 3EICA 1CXUA 2WW8A 3W5XA 3I4PA 3GV5B 2JNJA 2IOFA 3SSRA 4B6JA 2CGKA 1OQ6A 3CJQA 3EGVA 3CCVS 4KJIA 4LJXA 3GZFA 3NXZA 3CMES 3TWZA 3SUQA 5HI7A 4KLIA 5GIOA 1GXLA 2OPRA 4NLNA 3VGLA 1XNQF 1XI1A 2C2KB 1VAZA 3KVGA 2LKYA 2IHNA 4X2BA 4ZIVA 2DGXA 2G07A 2PMZD 2YNFA 4IH6A 1KR4A 4ED0A 5M2UA 4RWWA 4L3QA 4O8UA 1VMBA 1ZQ1C 2PMZF 3KWMA 2W9BB 4NLPA 2RHFA 1H73A 3LDAA 1ZD3A 4ECXA 4DR7J 4ETXA 1WAFA 3CPWR 3SV4A 3IFRA 4LD0A 2LKZA 1JLEA 3CIPA 2M9KA 2FJEB 4LFCK 1RAOA 3ZETB 1XC9A 2HHQA 4Q8EA 4BVPA 1BPZA 2DXDA 3MEGB 2DEJA 1VK0A 4AP9A 1WD6A 3ZSZA 5DG9A 2QX0A 4TUQA 3MAAB 2XZTB 3WK6A 1OMSA 4X4NA 1SC6A 1NJZA 1OSDA 4LVOP 3VERA 3PKYA 3L7PA 4DX7A 1TKTB 3K1RB 3HD2A 1JJHA 1T9TA 2R3VA 1WACA 2N7YA 2F4VK 3RRHA 2KNJA 4FN5A 5D0RA 5C24B 1FKPA 1PC5A 4CLFA 1H2UX 2BACA 3H2VE 3PYGA 4DKWA 4M5IA 3IO1A 4B1UB 3DRXA 3J7AP 4TKTA 1SGGA 1NDCA 2N3OA 3OL8A 1U2CA 2ZKTA 3FGVA 3GBTA 3D68A 1WSFA 4O3MA 3C19A 2MAXA 1HNWJ 1NGGA 5DJBA 2P6UA 3PMNA 1KVAA 5THWA 2JEFA 1OWXA 3FSXA 2DTJA 1QQ6A 2JH1A 2ASLA 1WG1A 2Z8QA 2XRIA 2LDYA 1KDNA 2WSCC 4HVZA 4J5OA 3QFPA 2KICA 3LP0A 2YNIB 3HZGA 3O4WA 4KN4A 3JPRA 2EG2A 4Y2SA 2CNKB 3ULEA 2KZZA 4FYDA 3NS1A 2GIFA 1IKXA 4BRAA 4W4MA 1X6IA 1XMOF 4UARA 4OX9F 2O3DA 3EM1A 3H8JA 3G8QA 2PFPA 2Z30B 1FX4A 4LR7A 3KJNB 4CLKA 3VTIA 1FWLA 1HBUA 4YCXA 3EGNA 1UTAA 3IKMA 3IA0A 2NZ4A 1A76A 2P5OA 1KLMA 1X60A 4OZJA 3NG8A 1S9GB 4DPOA 1EWRA 3LANA 1YDLA 5ALMA 1KD1T 1IWAA 3H0LB 3RJFA 5AQGA 4KO0A 2Q43A 2A3VA 3MHYA 2E1PA 3EXYA 2CPEA 2HBKA 1N33F 3MMCA 1HIYA 2IVPA 3DXKA 2E1ZA 3CCMS 4U7BA 1VS3A 1VR6A 2P9LA 3C2KA 3HHLC 4QZGA 3LGMA 3EW9A 3RB0A 5KFJA 1RTIB 1NHKL 2AF6A 1RILA 3LPTA 3HF5A 4QWCA 3RJJA 5LXYA 1Q0NA 2IS3A 5DQHA 3NVWA 1M90O 8ICUA 3I6PA 3OBIA 5KT2A 2EZZA 4ZHRA 5TZVA 2QARB 3KLHB 1YBAA 1M5VC 2X6NA 3OYFA 3DLKB 9ICFA 4FWMA 3D6TB 1F21A 4X4VA 1WNSA 3VTHA 4LF5K 4B9SA 2FPHX 1Q7YO 1HL6A 5AQVA 5L39A 3NVMA 1CULA 2DY9A 1R27B 1PZNA 5C2DA 2Z2YB 3VETA 2BGGA 2NRXA 4NCBA 4ZPVR 3F5AA 5DQGA 4XO0A 3HT3A 2DFLA 4B3SF 3KJVB 4H4OB 3MXMA 4CF5A 3GP9A 1S5ZA 2V4JB 4ZVUB 3MUMP 1RT4A 3SMZA 2KD1A 4TUPA 1GT8A 3V2UC 5RUBA 4C3LA 2CQPA 2XO6A 1UVLA 4MAKA 3QJJA 1RT3B 1TL1B 2QWPA 1WSIA 4BE1A 3SSSA 3CPEA 2V52B 2FJWA 4PZOA 2KJ5A 3MMAB 1VYAA 5ETKA 3ZTQA 5KFBA 2POKA 3K9KA 1MQ2A 1NJXA 4KLJA 3W9HA 3FZFA 1VJQA 1AROP 8ICYA 4BE2A 4DX5A 5BXIA 2RE1A 2KJWA 2XHBA 4LQ9A 4CBUA 4Y00A 3FEYB 1B0XA 4UBCA 1QAIA 3TTDA 3TSUA 4CGJA 1YIJN 3EPGA 1GEHA 4X84A 5LL6d 1J9AA 4KH6A 3F73A 3G96A 4I7FB 2MPUA 1CG2A 3TOQA 4CFCA 3RH4A 3WKCA 1Q79A 4UY8T 4DUYK 3QEBZ 2NUBA 1HKAA 2W9MA 2GMLA 4XPCA 4JI4J 4RQ4A 3LL3A 4WU3A 5LMUK 2GCFA 2YHAA 3DWLA 5JMNA 3HM8A 2QWLA 4OX6A 3ZSWA 3SMSA 3HZ6A 2V8HA 8ICQA 5ALRA 2ZUCA 1HYSA 3DLLQ 3OVNA 2BCUA 1PCAA 2HK2A 4OVLA 3TZXA 1NGFA 1H7XA 4E98A 3TAGA 3EEQA 2GVDA 2IRXA 2HBLA 5A2QO 1EB0A 1XJWB 3R7SB 3C2LA 5AQKA 4BGBA 4LBIA 1ZBLA 1RDBA 4DLEA 2KKHA 2VB6A 3IG1A 9ICSA 2ZH5A 2MKSA 3SDEA 5J29A 1W26A 3KD5E 4Y2YA 3CC4S 2YPZA 2WOMA 4KREA 2LQ5A 1YRUA 2ZBQA 3ENWA 1NZBA 4ES2A 3FM9A 2KHOA 1TUVA 2OEHA 2CPFA 3HVTA 1L8LA 3D1HA 4EBDA 3PX6A 3ZDEA 1RG6A 5ETSA 3PEJA 3VF0B 3M6XA 4PABA 4JHDB 2JHEA 3C21A 4W5NA 1JXVA 4M3WA 8ICAA 4A8SA 3EL2A 2AYBA 2XY8A 2A1BA 5BOMA 3R2DJ 2VZ9A 4K4YA 2VD3A 3OW2R 4V1Ak 4R5PA 3NS5A 4OFZA 3M1VA 1EO1A 4K4UA 3J81U 1I94J 1EKSA 4CF2A 4PH5A 2UUBF 1FWPA 3QMQA 5HMZA 4CK2A 1U1PA 4ID8A 1RBVA 4URSA 5KT3A 1S72S 1IBKK 1Z26A 1TVAA 3QFHA 4AYBF 1X4GA 5KT4A 9ICKA 5K4LA 1XC3A 4E1NA 1R0BG 4QZ9A 3MR2A 1W2IA 3KLEA 4BGAA 4TSXA 2EWHA 4JOUA 1JIHA 7ICQA 1S6OA 2V2ZA 2IFXA 2AQ0A 4FJGA 2GGPB 4XUSA 2R7TA 1N60A 4JI7K 2E1YA 3J7ZO 5J0QA 1NLVA 3RJKA 1KHVA 1VK8A 1IO2A 4O55A 3NDKA 3M4XA 4BCAA 4B08A 4OZ0A 3BS7A 1N5YB 1BOTO 3KLGA 3UMCA 1VIOA 3P49B 4O3NA 1N56A 3QGPA 4CZJA 2V68A 3C0BA 3UDLA 4ITSA 3PVXA 4IXCA 2HFNA 3B4MA 2WF7A 1F9EB 5J0XA 9ICLA 2DUYA 3E01B 4FWSA 1GLAG 2GMJA 3THVA 4FF3A 1ULRA 3S8SA 2KQ2A 2MZSA 1LV5A 3KDNA 4Z2XA 1TAMA 4IO1A 4ZIWA 1VSDA 4JN4A 5G5HA 3AU2A 3CJ4A 1ZBTA 4HTUA 5C0YA 2YMMA 4FWOA 4F5NA 2GJIA 2D8CA 3NL0A 3OHAA 5DZ7A 2P66A 3F2CA 3UKUB 1LKYB 1LWEA 1SJRA 2FBYA 4IOBA 1C1CB 3NLCA 4PUOA 1QVFR 5DM6L 1NSKL 5FDLB 1CRXA 2DRAA 2IYGA 2E4LA 2I38A 4DX6A 4DTPA 4C8YA 5EWGA 1VQ7N 7FD1A 4RNFA 3H7IA 1Y4ZB 1WC1A 1DLOA 4CLWA 4IFYB 3FMBA 2CDRB 1D1UA 3FQKA 1YJRA 2VG5B 1WC6A 3UQSA 3SQ4A 4HUEA 4KLMA 2RJZA 3AQEA 2BPFA 4D3HA 5FPDA 4QW8A 5CD4A 2GO8A 4WFAQ 1YF5L 5CE3A 2LQBA 4OI1A 2YKMB 2RE2A 1HQUA 4UAVA 1U8SA 4Q5VA 3Q8LA 1ZZFA 5B5EU 2RNEA 1NJIO 3CJ7A 4LSLB 1M5OC 2P9NA 2WUSA 4M9LA 4I28A 4NLOA 1YXQA 4UQTA 2H5XA 2CQ1A 3DDIA 3CJ1A 4DR3F 1JLAB 1GLBG 4KLOA 4IR1A 2K2PA 2CZ9A 1S9EA 4FPIA 3AMZA 1B4FA 2F3NA 3DOMA 1U4BA 4A57A 1L3TA 1TFRA 1NMNA 5SZTA 1OYDA 3FEXB 2ZQBA 2BM1A 1EHWA 5CD4H 3VC8A 5BN8A 4JV5F 4NWIA 1RCXB 5EXWA 2IC3A 4C1NK 2WB1F 2CQ2A 4J90A 2HVEA 2I7PA 2PAVA 1RYRA 3WKBA 2PEHA 2X3DA 3M8ZA 4IG0B 4NEZA 1ASVA 1VIXA 3BQ0A 2W03A 4N47A 1VQNS 4KBIA 3NH2A 2KJ9A 5AZIB 4PWDB 3NY0A 4U96A 3JS9A 4F0MA 3M8WA 4H03B 1GXTA 4EIAA 4DV3F 1IBLJ 1VQON 5KFMA 1ACMB 3I9ZA 4NXMK 4DJBA 2H54B 2J7WA 3HSTB 3PXGa 2I1RA 3HL8A 3R1HA 3R9PA 1ZBUA 4KLSA 4Y2MA 2E5SA 2L08A 1ZRNA 2VODA 1UEVA 2B6AB 1NBWA 1QQ7A 2W01A 4EWTA 1PBAA 2YQ1A 4NJ8A 5DGBA 2W9CA 3AVNA 1LXJA 3CCSS 5ALXA 1C0FA 3UKRB 1JMSA 4RW8A 1MWKA 3HJEA 4FXDA 3A8YA 2V94A 4QWAA 3PLAA 3SUPA 2KXFA 4U9RA 2JH3A 2ZEJA 1AUDA 4N76A 2NRWA 1RHQB 5CP2A 3RMDA 3TA0A 1QAJA 9ICBA 1T9XA 3B6BA 3VQCA 5BYQA 4N5SA 2A6OA 4B9QA 3WK9A 2CG4A 3WXKA 1HWJA 1LOUA 2YQEA 2KFYA 1VSEA 1YWXA 1T11A 3D0HE 4PKDB 3C29A 3QU7A 1W2BM 4I2CA 4O9MA 4OYWA 3FAHA 1GLLO 2CQ4A 3ZX2A 4LFBF 2KIWA 2LHTA 4BACA 2CQHA 5D0EA 4JAXA 1J5EJ 4F91B 3W63A 2W43A 2HRTA 3SBTA 3SEOA 4IO9Q 4GVMA 1FDNA 3CFPA 4ED7A 3QWPA 4P2HA 4A8KA 4WQ4C 2K60A 4FVMA 2Z56B 3CDBA 3BN4A 4DR7K 2F8LA 2BUNA 4B9LA 2V4RA 1U2RA 5FROA 4MO4A 2F9DA 4WFBL 4TN2A 1FKOB 2W4CA 2W6LA 3ZDBA 3K5PA 3C15B 2KE7A 1T3NA 3NMAA 5B8HA 4DTMA 1Y10A 2O8EB 2F1HA 2HS3A 1EKEA 2QLWA 3GQCA 2C42A 1HD0A 3NF8A 2B8QA 8ICTA 2DNPA 2OKQA 1YX2A 9ICCA 5ETNA 2JX2A 4KB1A 3POTB 4WYLA 3AO3A 2FPMA 2PFOA 3MM6B 2O8FA 3P96A 2ISPA 3J7A1 5HRNA 4ZLJA 4J37A 1FE4A 3I87A 4TY8A 1F1BB 3BUZB 2KHCA 1X2IA 4WK3A 3FC4A 3NVKA 2OD6A 1HNWK 4P6QA 4ZITA 5LMNJ 2IRUA 4QR0A 1KKXA 3NGUA 2OP5A 4RBVA 4HHJA 2MLXA 3L2QA 3T6JA 4RQNA 4ZVHA 4X64J 3GJTB 2PN6A 2WVDA 2IVMA 1REVB 1RTHB 1KN5A 4GV9A 2UXBJ 1C1AA 2E1CA 1CJVA 2RLTA 3W9JA 4P4PA 3JTOA 2WW4A 3CCVN 2E8NA 5A2QU 3CMEN 3ZDCA 1NPKA 1FXRA 1CS4B 3IP0A 4DSEA 4DSLA 1UPHA 1VRUA 4ECZA 2UUWA 4CO1A 5KFLA 3DGVA 2XLJA 1AQ6A 4BBYA 2QKQA 3MCNA 4CJEA 5J2QB 5DGAA 5T14A 3S01A 1MN8A 3UE2A 3VEOA 4OLOA 5A8WB 5J1EA 1DTQB 1B9FA 4JI3F 4C7QA 1I3AA 5B66U 1I51B 1XMQF 3V72A 5AQTA 5ALKA 3QAEA 2OH2A 4OI0A 4KKOA 2W7PA 2I0XA 1C4AA 2KKVA 4YDDB 4ZCLA 3W2WB 1MN7A 2R7WA 1RYSA 2P6TA 1K8KA 3EUNA 2W6KA 2KVIA 1LWFB 3R8YA 4M42A 2QMXA 4ISEA 1N32J 4O5KA 3H0MB 5KL1B 3MPUB 1ZZNA 1BNPA 1PAUB 3QWUA 4KLQA 2FY8A 5J2CA 2D3O1 5C25B 3MN5A 4NLXA 3HTVA 4CECA 1J27A 3DLRA 1C4CA 2EFVA 1VRTB 1I3OB 3K0SA 3BN7A 5D6GA 3KKSA 2ITMA 3RFAA 5E0OA 5AR0A 4LZGA 2K1RB 9ICJA 2E2PA 2HZAA 2FF3B 2P5GA 5KL8B 4UUWA 5F8JA 1E6VB 3SENA 3SD7A 5B0FA 1T3OA 3JAMO 4DU8A 2Q0UA 4PA1A 3HMJG 2RU3A 2FLLA 2MZTA 4OX7A 2V9KA 1QQOA 5SWMA 2FXUA 4M5JA 2IOHA 2BJ9A 4YDUC 3G87A 1NLKL 2A18A 1FHTA 2RHKA 2HNYA 3P5BP 3E9PA 3IAS9 2F9TA 4DX8H 3LPEA 3AD8C 2D3DA 2E5GA 3NAEA 3CMQA 4EZ6A 2DISA 1W7WA 2OPSA 2R2UA 4DU4A 3KKAC 1XHXA 1BPDA 3RAQA 4KGKA 1RE1B 1A9NB 4OJOA 1FJGJ 3CVKA 1TP7A 2VQEJ 3RJMB 2CQGA 1VBXA 4MFFA 2F8EX 3K75D 4C11A 2QI2A 3LPYA 2BPCA 3GIKA 3TUJC 5T7LA 3D9BA 4BC4A 1SCJB 2R2RA 3OYKA 2XSFA 1C2PA 3UE5A 2X1AA 2CDQA 3MEEA 4FZNA 2WONB 3A5MC 1M90T 3C7NA 2DRDA 1YVUA 1R0AA 4H0XB 4KV8A 1UMJA 4JI4K 2HBJA 3VMFB 4OMFG 1AXQA 5HMWA 4C80A 1U1LA 1K5OA 1S6UA 3OPKA 3CDAA 3DOKA 4KFBA 1TV9A 3OSPA 5C10A 4FJIA 5CZXA 4PZNA 1RWNB 3MCSA 1AFIA 3CCMN 1SV5A 4USAA 4KX3A 3NBPA 5IILA 2HVIA 3GCWP 2Y1IA 2QEXN 3L95X 1QQNA 2YCHA 4G1QB 1ZQPA 2NXEA 2HRYA 3JSBA 3KK2B 5KOXA 2HNDA 3QUTA 1RWWB 4CTAA 2O5DA 2CPYA 4IKFA 2KG0A 2EPIA 2XCAA 2CZVC 4WXOA 2RAQA 2YTUA 1CI4A 3TX8A 3SBGA 3NGYA 4F4XA 3QGHA 3CIZA 1CZBA 5JVHQ 2YN4A 1ITPA 1YI2S 2QFJA 1FO1A 1RWKB 4ED4A 2W24A 4KHSA 2W04A 5CHCB 2O8CB 3MD1A 4JK7A 2HHVA 1VLYA 2FHJD 1BWFO 3ALYA 4KAZA 2C3OA 4DPWA 2JL9A 4O4GA 2B51A 2GELA 3AV9A 2GBZA 1FEEA 3ICLA 3HSJA 1P1TA 1NGAA 4TQRA 4QZAA 2C2MB 5IIJA 4FLZA 3TJ8A 4P4OA 5L1LA 4H0YB 3AJDA 4QZVB 2K4PA 1AFJA 4DV6J 4O8KA 4OL8A 5GAHU 3VN5A 2DNHA 1KONA 1MMNA 1I94K 4PRFA 2JVRA 5KG2A 1RT2B 4JI0J 2HSEB 3T5JA 4RQ3A 2LSNA 2IOCA 4FK2A 3EJMA 1U9LA 4MJKA 3N79A 4B1VA 4C8ZA 3RAXA 1R8HA 3TANA 2ZITA 1NG9A 3O5BA 3R5JB 3ZSOA 4U8YA 7ICVA 4ID1A 4J9VA 1JXEA 5FPEA 4P52A 4US8A 1GOAA 2BJDA 2OD4A 5CWRA 4JI1F 5HMMA 1BG3A 4M1KA 3WNEA 5F8HA 1VQKS 4F93B 3SAHA 3A3NB 3BJYA 1S5JA 4MEYA 8ICHA 2RIJA 4X65F 3V81B 4OI3A 1FTRA 2A2DA 4EEYA 4JV1A 2HW3A 2MGZB 4I6MB 2B4OA 5EHHA 3OFHA 3G82A 2PDAA 4DQSA 2KT2A 4RCHA 5LSLA 2G8UA 4DV0J 1G4CA 5CRXA 3M8PA 1XR5A 3CTRA 3ZZOA 5KFCA 3MDAA 1G7CB 3PNIA 4X62F 4O4RA 4ZVRB 5LT5A 2AP1A 2CGLA 1ZQZA 3FBBA 5AQWA 4NLVA 4DQIA 3VF6A 3N9UC 3I0RB 4Y2IA 4RUHA 1WCLA 3KHRA 5HQ8A 1ZXIA 4E7LA 2ZVIA 4WK1A 3AA3A 1K8AO 1BD6A 3LWMA 1X5SA 3OBYA 2EVZA 2X3GA 5L1MA 4MKAA 3CC4N 1TL4A 3MABA 4Y2KA 3FFIB 1IUJA 5A0YB 3ETOA 2YWGA 2CN1A 2KN7A 5DDMA 1N8RO 4DR6J 2LYVA 4MMOA 5G0RA 2BBEA 2FDRA 3VQ8A 4BXOB 4C6AA 3THXA 3IM9A 1LK7A 2FC8A 4FKXA 1S1WB 3RSEB 3L7UA 2AP6A 2B5JA 1HMVB 3OYGA 1VQMS 3NVYA 3EGWB 3HVRA 4NXNJ 2FJDB 2AGPA 3NP5A 1T3QA 1HJOA 1RT6B 3N28A 2EWSA 3IRWP 4AH9A 3LWLA 3R8EA 5CJ7A 4OYXA 5AM2A 1MA9B 3CT9A 2P9IA 4C8NA 1DURA 1JKHB 1S72N 1TAQA 4Z7CA 3EE3A 3MDQA 3MCAB 3WNHA 2H5IB 1PK3A 3SQ2A 1BQXA 4M7XA 5CCLA 5SUHA 2KK0A 5ETVA 1S22A 4I2PB 4BC9A 1PG5B 1WHVA 4LRFA 3BR9A 3DEEA 4LFCF 1W97L 1U1NA 4CIEA 3ZFVA 2B56A 4NZ7A 1NKBA 1HWIA 2J76E 2K7JA 3KXDA 4AHUA 2DHHA 3OL9A 1VHFA 3K8WA 4ISGA 3M6WA 3NH0A 2R8JA 4RQ7A 1BQNB 3OS0A 4A8WA 3VQPA 2DTUA 4FF2A 4US9A 3LPUA 5FJ4A 3E9OA 4F2SA 2JEIA 2ZXIA 1N62A 2DH9A 2Q2RA 5BPLA 2PEBA 2ZVSA 4UQGA 2AYGA 3CETA 3SCJE 3BBFA 5FRMA 3RUBL 2R7RA 1DAXA 2F4VF 1IBLK 3LF0A 1X9JA 1HNZJ 3RTVA 3C6TB 5A8RA 3D1QA 2W8LA 1TK8A 4GO7X 2ZGYA 1LQ9A 4ZCKA 2G0CA 2FIUA 4CRJA 5AKXA 4XQ8A 4P2FA 1VISA 2AKWB 5AXMA 1F9FA 1SJQA 3AVCA 1X5TA 2NRZA 1VQ8S 3V9WA 3DLEA 4M9JA 1HJPA 2VFRA 3MN6A 3Q24A 4ECYA 1F5SA 1WOSA 5ALIA 3LZJA 3OR1B 1RSCA 3QBWA 3QUBA 5KG6A 1S10A 4RWXA 1BUXA 5GMKa 4WCEQ 4FK0A 8ICMA 4HH0A 3OTDA 1U49A 2KVQE 2CRLA 1S8OA 3Q2SC 4FJ5A 4TU9A 1BPEA 3RMBA 3DGPA 2W42A 4FFDA 3RVCA 4P2XA 3VAKA 1ZBSA 3AOAA 1ROFA 5IOLA 2XI3A 3JAMU 4L3NA 4DI6A 5LJWA 2K3IA 2IY5B 5K14B 4OKJA 2C3MA 4KLEA 2UXDJ 2A0FB 1J5EK 4IJAA 2OEJA 3OYNA 4Z6EA 4DSJA 4ED5A 4K5RA 4RW6A 3VA3A 2HFVA 2OLWA 1YJNS 3MX2A 2OTLN 5JS1A 4Q7AA 2QB0B 2L48A 1EZZB 2NS1B 4FBTA 1PJ7A 3W0LA 1S1XB 4WZQA 3LDPA 4NCGA 4F4AA 1SQKA 1DK3A 2ASJA 2BPGA 2BZFA 1X4CA 1RWVB 2P9UA 2N3LA 4NZ0A 2ZNYA 1RPLA 1MWZA 3CULA 2V7ZA 1PVPA 4C97A 1X6JA 5DDRC 4V19S 2E9ZA 1URRA 3UVJA 2YX6A 3W2VB 2KXHA 5ALUA 1SZPA 2MQNA 2YWFA 4ERDA 2FGCA 1UVIA 3C5GA 1KVKA 3V4MA 4M5DB 1BNOA 4RQ1A 1VQNN 3LP2A 1R8AA 2GTDA 1X4BA 4ES1A 3VVTA 3LDNA 4FKYA 1XNRJ 3VOVA 4Q0BB 5F1XA 1XTZA 4HLBA 1QE1B 1EAYC 1RT1B 3G10A 2B9EA 1N5XA 2A1RA 4CDGA 1WYGA 2BCSA 3ADAC 4RQ5A 2O8DB 4F8RA 4UOFA 2ZJQQ 2JDJA 4LF5F 2DHXA 4WYBA 1DOQA 4NXZA 1HEKA 3PY8A 1SJ4P 2RF2B 4QQBA 4M45A 4FJNA 1XERA 4WPAA 5F9LA 4LSNA 5M2PA 5LMNK 4DTSA 2GX8A 5ALSA 2P51A 3CCSN 4DR5J 1FRXA 1LKZA 3NHGA 1FDAA 3DAWA 3DHWC 3VALA 2B8PA 1S3XA 4X64K 4DOBA 4OHZA 1SI9A 3OL6A 2UXCJ 4H0VB 2MHNA 2LA4A 4UZBA 2UXBK 2UVUA 4MH8A 3HSDA 3QLHB 3I82A 2YKNA 1N54B 4O0IA 4K5SA 5A6WA 3I76A 4DPXA 1X9MA 3NRBA 3VESA 3RMCA 3PYEA 5F3XB 3UWTA 4HI1A 5BPNA 1VOMA 2Y8WA 7ICMA 3TUIC 4M3TA 3N7RC 4U95A 3AVHA 4BRGA 3LZIA 4MK7A 4IJNA 2YMLA 1ZQVA 4NA1A 4Z94A 2VA8A 1ZM2A 3IAM9 2JGUA 1L7OA 1NK4A 2ZZMA 1OKJA 2OGUA 4XH1A 2J6UA 4XRHA 4YB1P 3ZD9A 3W8GA 3SAGA 1YZ7A 2IGIA 2J0SD 1ATRA 3ZSVA 4CO2A 3QDKA 2GWKA 1KAXA 4DQ8A 4DUYF 4ZPBA 3PJ9A 1F3VA 4URQU 2ZHAA 8ICSA 3DM2A 4QZBA 3NEKA 3TAMA 4CH0S 4Z4CA 5L9NA 2HMIB 1N32K 2NRRA 1RBOB 5LMUF 2KHQA 4DL3A 2RT3A 1Q8LA 3IM1A 3GZ7A 1KOHA 2I6XA 4CO3A 2EFQA 1D9AA 4FJ8A 1VHXA 2R7SA 3HHKA 2G8FA 1BIZA 1Q5YA 4NO7A 2GJ2A 5E3CA 4K4VA 3N4QA 4OGCA 1TL7B 5KFPA 1URJA 4CF0A 3IDHA 1C0UB 5HP1A 3LW5C 4UBBA 2JSXA 2QC3A 2YMQA 2MKJA 4PJ0U 3QNWB 3JTPA 4CO5A 4H5WA 2RSQA 2E9RX 3C6UA 4YOWA 3M8QB 3KLVA 3KWIA 3BGRB 3RB6A 2DPJA 4LZDA 4YMOA 2HFOA 2CPDA 1ZJNA 3AO2A 3RJEA 4NASA 5AKEA 5IQQA 3JB9k 3VHQA 4B9VA 4CF1A 4ILRA 4I2BA 2W9AA 1UKUA 4NLDA 3C1YA 4RW7A 4HVJA 4Y2VA 3BQ1A 3AVBA 3VF2A 3UFCX 3CO0P 2PA8D 1MSWD 3K0JA 1HBNA 3WQTA 1BC6A 4MKVA 4RPFA 1RTDA 4F3MA 2RQMA 1RT5A 1K9MT 1Y00A 2G5IB 2E8PA 2HZCA 4C0HA 4O3RA 1CLQA 2OELA 5J0UA 3V7LA 2HLTA 3O9QA 2NUUG 2CAJA 3VQEA 1JLQB 3GPAA 2EZYA 5AJ3J 4C23A 1FJGK 5CYQB 2I5HA 2GO7A 2Q1LA 3S3OA 2DL0A 1BCOA 2VQEK 3C16A 4RT3A 1XQSC 2HGMA 1Z1BA 1VK3A 5DZ6A 2CJXB 2IAJA 1B7FA 1IBKF 4CJWA 1WSHA 2D7SA 1UFLA 2E9TA 1X31C 4BC5A 1FE0A 3QSYB 4OD0A 1HPZA 4P0QB 4UZCA 2BGWA 4B3RF 3DLLL 3D2EA 2CWXA 3V9SA 3BZCA 3GDQA 3D2SA 2K89A 3FR0A 1ZBHA 3CPWM 1TL3A 3LTOA 5CCMA 1RT7B 3DLGA 4DDFA 1T3VA 1B70B 4DTRA 1F60B 4HCBA 2CADA 1A7GE 1K73O 2DRBA 2KSOB 2ZM6J 3AA8A 3ET6B 3U7JA 4FLYA 5C42A 2J9DA 4JI7F 4C48A 1ZQXA 2GQ2A 1QJHA 1ZQLA 2AA4A 1O0PA 4ILMA 3KK7A 1U24A 3PMLA 1L7PA 3OHRA 2Y1RI 1BA1A 2RS2A 4YMNA 1KTVA 4FM1A 3A3OB 3TRGA 3G0ZA 2QARA 4M5MA 4F4YA 4HT7A 8ICWA 3THYA 2AD9A 4TURA 2HQIA 1O1WA 1N48A 4CEAA 3VZIA 3KK3B 4H4KC 1Y64A 1OPIA 2MB0B 5E2QA 2ALYB 3CG7A 4FVUA 2PO4A 1VSIA 2WBNA 3SI6A 4FJKA 2KYXA 3CCUN 4CWBA 2C2ZB 1UFKA 3O3GA 3VGVA 1ED1A 2IVYA 4FS2A 1HW8A 3M2VB 5C7PA 4TQSA 1XN9A 2QRRA 4H4OA 2FVRA 3V6HA 2F9WA 1Q82T 1UZDA 1RBUA 4JI5J 5HSPA 3CCWA 2FJBB 4M5NA 3MWBA 3X3UA 3HI0A 4JRQA 3MPYA 2E20A 2D1KA 2QSWA 1TL1A 1L3SA 5T7BA 1M5SA 2FHJA 4I6YA 3UD3P 4G9ZA 3O4NA 4P73A 4LQ3A 3NTUA 2ZKUA 2VH7A 3RB3A 1ZQAA 2OM6A 3BPDA 1HBMB 3EVOA 5JICA 4Y3CA 1IKWA 3B9JA 4YXJA 4ES3A 4BDPA 5FIIA 4PXEA 1RXOB 2ZE2A 3MF5A 2K8BB 3FNNA 4LRCA 2RRDA 3BYRA 1NSQA 1A5XA 3L3FX 3TVYA 5K8PA 4JKCA 4XH5A 4E7KA 4DV6K 2ZIWB 3TVZA 4JV0A 1DXSA 4A2BA 1X9SA 2VG6A 5ETPA 2DJWA 5HVGA 2R9LA 2BDPA 2GC8A 4EBCA 4JI0K 5ALNA 5IC6B 4B8CA 3N01A 4JV2A 3AD9C 5CYMA 3AEVA 8RUCA 2HHHJ 2E5JA 2VDHA 1VJWA 4K4XA 4F0KA 3G8SA 1B92A 4CJ3A 2N1RA 1RJJA 3ENAA 3GIIA 3K5LA 3HRDD 1WSRA 2R7OA 2D0AA 1CC7A 5D4PA 1MWQA 3IAYA 2XGQA 1WB9A 1X1PA 3H3OB 1QTMA 3QIPB 1JRPA 2QL7B 2ZC4A 1VQLS 4GVEA 2XZDB 4R8UB 2RB7A 4EO6A 3CFRA 4JB8B 3BZQA 2VFVA 2A6MA 2P6RA 2CNNB 3QEXA 3ID8A 2FSJA 9ICVA 1RKJA 1KP6A 3MM7B 3BV8A 3AARA 2HWIA 3HW8A 4DV0K 4DTUA 4S0MA 4J2EA 4CERA 2G8IA 5E5NA 1ZM9A 5GAEI 4NXMF 4FWNA 2LQ9A 3L8BA 2G1HA 2NXUA 2MSSA 3JPPA 2RHSB 2M52A 1X0FA 1LW0B 1OYEA 4I2IA 4AQYJ 4BRCA 2D9PA 4IH7A 4XDDA 1RHKB 2C3UA 3EVWA 1RACB 5AI4A 3OLBA 3L4PA 4WFAL 5ALJA 4JS5A 3CD0A 3D2FA 3QBXA 4P71A 4H0OA 2EC0A 1IR2A 2RHQB 3CGIA 4DR6K 1ZQUA 1WSVA 3CJTA 2FC9A 3IRXA 3M30B 2B0CA 3RYLA 3PO4A 4KIAA 2CQ0A 3E51A 8ICXA 1PJ5A 2MU2A 3AL0B 1MMLA 4RNOA 1K0TA 4NL5A 5B09A 2V63A 3NCQA 2ASDA 2YTCA 4NXNK 4DCOB 3HILA 5AQUA 1N63A 4LF6J 5IC4B 4FYVB 2AJFE 5FLXY 3MUTP 4AL7A 5KAKA 4DN9A 2IM1A 5KG7A 2DQNB 3QUQA 2ASOA 4KHUA 3TAPA 1UL3A 2ZF5O 5J2HA 2K4IA 1BQMB 5HRPA 3NGIA 3FDSA 1D9DA 1E4GT 5JXSA 2ATLA 4LT6A 4QWDA 2KLAA 2OAUA 3ISNC 3FSYA 4DR7F 2ZBPA 5GMDA 1TUUA 4KHNA 2ZIVA 2NO5A 3BSAA 3HHEA 2BE2B 2ITGA 1X5OA 1T94A 5AQZA 5KFFA 1VQKN 2ZGZA 1C1BA 4ZPTR 1XMBA 3DLBA 4BS2A 2W2OP 3GWCA 3D67A 3SSQA 3NAHA 4WXWA 2XZWA 2XMJA 1X4AA 2R8KA 1C0MA 5B0AA 4YY3J 8ATCB 3Q22A 1H0HB 4KQZA 4A8FA 3IS9A 3PHEA 4B9TA 1Y5NB 1EXNA 4YQWA 1KRPA 2DO4A 2EFPA 3UPQA 3B6OA 3VQ5A 3JYTB 4GLXA 4PHTX 3FRZA 1T9UA 1HNZK 1N8RT 2RILA 3U02A 3JSYA 4FL9A 3D0PA 4UT4A 5HQMA 2QMWA 4FXWA 3WUHA 1F5BA 2DITA 3OXLA 1SL0A 4Y2QA 5KFAA 1FO4A 1ZPVA 1WHYA 5I3UB 1HNWF 2UV8A 2JR5A 4JKHA 2HK3A 2HWHA 2HWTA 1WC4A 5GVQA 2DHGA 2WVBA 3MR7A 5GAEP 2FJVA 2J9DE 2I5JA 4ILHA 3S41A 4IO9L 1HI8A 2CFXA 1RAJA 2V8GA 1BI4A 3B4DA 4CGFA 5EDWA 5C12A 7ICOA 1WOQA 5EX3A 2BQRA 1HYVA 4O3QA 4YR3A 3O3LA 4I2GA 5LOQA 2HHTA 4NLRA 4R0EA 5HL7Q 4QIGA 3H1VX 1IJJA 2CPXA 1OH5A 3HWTA 1XSPA 2P9SA 3QU4A 4F25A 1YHQS 1VQMN 2B7BB 1FERA 1UZHA 1DBDA 4JWMA 2OSRA 3QETA 4KTWA 2PE8A 4DFKA 4FO0A 2F8MA 1U26A 2UXDK 2KEYA 4NY8A 4WQ4A 3F2KA 2JFKA 2DHAA 1FFSB 1NO8A 1WKLA 1WUAA 1E6YA 2YV0X 4O5EA 2QL9B 2MTLA 2QO3A 3HLUA 2OJ3A 3A2FA 2QTDA 2ZTEA 4PXBA 4PL8A 5T41A 4JMUA 2V9WA 2DH7A 2G0JA 2Z1HA 2DNMA 1XMOJ 2G2YA 2EKYA 2LEPA 5J2KA 2P35A 7ICJA 4ECRA 2C1EB 1S77D 3TABA 2V4QA 3CJCA 5AQHA 2HNZA 3PJWA 4BLGA 4XDCA 3L3UA 1NI3A 3HHDA 3KD1E 1HRHA 4DEZA 4FPRA 4BWMA 2WC9A 5IFMA 4ED2A 4EEKA 3V6DA 2MLZA 2FZKB 4QZEA 4DLGA 1U04A 1CJTA 1X3NA 2Z2ZA 3CP8A 2XMVA 2D41A 5KFEA 3U1MA 2BKOA 3K5OA 1JJ2R 3O0FA 2GMHA 1LXNA 2B7CB 2JOQA 4B3OA 4IRCA 4FZVA 2GHWA 1XNRK 2D0PA 3QZ7A 3F5EA 3QZ8A 2WF5A 3AA4A 5ADXH 4EHTA 8ICCA 5B08A 2YNGB 1AZSA 1UJ6A 2IMOA 4ZJOA 1FJ7A 1ZQGA 3UD5A 2NRTA 3R1LA 2FBTA 4BROA 2L9DA 1V6HA 4Z37A 1MDUB 4RW4A 1Z2LA 3MMBA 3FKBA 3HJFA 2MXYA 3IP4B 5ALOA 1HNXJ 1VQ8N 5BYSA 4DR5K 3RR7A 1KD1O 2VONA 2ZZTA 3P1GA 3EUB2 1UQVA 1WCNA 2KDOA 4MTPA 1WELA 3GG0A 4K59A 1COOA 1NK9A 2KN4A 2V6AA 2P9PB 2UXCK 1U6FA 2H3QA 2GHPA 3NVZA 4X4SA 5GADI 2H3GX 2YHWA 2NXNA 2CPHA 4KRWA 3GE9A 4RPZA 5CZ1A 1JX4A 5GIPA 4I2QB 1HJRA 4NE9C 1WG5A 3D2WA 1VRQC 5IIKA 1SV0C 1D8BA 3I31A 2WVCA 3UCGA 1CUKA 5TKYA 4UOCA 5L1IA 5AZJB 4A8OA 2IRYA 3AQPA 3ALRA 1EP4A 1Q9XA 5L46A 2YJFA 5HJYA 1TYQA 2NYVA 3JSRA 1X4EA 4KE5A 3TAFA 1YJNN 4L72B 2P9KB 2BE7D 5CXTA 2MSNA 3THTA 3LGHA 5E3AA 1L5UA 4KR0B 1JN3A 4JUZA 4HI2A 4AXJA 4JI4F 4BRDA 3ZEUB 3FQLA 3KUEA 3MCOA 1SVDA 3QB0A 7AT1B 1N5VA 1WHWA 2QLXA 2JZBB 3N0VA 1ZQHA 3KFUF 1D5AA 3L3CA 1KQSR 4C9DA 1PILA 3K5MA 4YMEA 4EENA 2YX4A 5AKGA 4EX7A 4EBEA 2JMGA 1SKWA 2ZTDA 1VBKA 1GQEA 1SAZA 3ONQA 4F67A 4KYZA 4CNQA 1V5VA 2VV5A 4PHPA 4M6WB 3K9JA 4DFPA 2WZ1A 4JBCA 4YD2A 2BH1A 1GX5A 2MEWA 3L9ZA 4YDUA 4FWKA 4Z0UA 4BG8A 3FC9A 1V3ZA 4LIRA 3O3HA 4TUSA 3HVWA 2QLTA 4OJ5A 3ZX0A 3V1OA 2V7YA 4DQPA 3LH2S 2OI2A 4UY8O 3M32B 3RW7A 4CFDA 3NRZA 1NK0A