2WB1F

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
b'SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2wb1F02
2Y0SF 4AYBF 2WAQF 2WB1F 3HKZF 2PMZF
chains in the Genus database with same CATH superfamily
3IG8A 5KG5A 2GLEA 1TK5A 1N60A 3GILA 5DLGA 4YCXA 4ECXA 1M6YA 2DFLA 3AL0B 3MABA 2W7PA 1B4FA 3H8WA 3M6ZA 4DOBA 4M6WB 5J0RA 1D8LA 4TQSA 4ECVA 1S8OA 1DGJA 1DGSA 2FE9A 2JGAA 3WKCA 2FPMA 2MUTA 4DL2A 5CP2A 1L3UA 2M0NA 1ZQBA 2WFAA 5DDYA 4YP3A 3F5EA 3KBBA 1FFVA 1COKA 2Z7JA 4UB6U 4IQWA 2KOBA 3ZD8A 5J2FA 5J29A 3ORYA 5ALMA 5DDMA 4BX9C 3BQ7A 4XQ8A 4I2IA 5JRTA 1SV4A 3Q8SB 1COOA 4CF5A 3SAGA 3BZKA 1L3VA 1L7MA 1ZQNA 3C21A 1SL0A 2F3NA 1L7PA 1NJYA 1NK6A 4FZMA 3RB6A 2BZFA 4M9GA 1YZ6A 1XU4A 4UB5A 3WK5A 1XO1A 4J9SA 5KFEA 1DOQA 4MFCA 4KLUA 2UVVA 3PVXA 2HBJA 4YQWA 1TK0A 4IQTA 3GIMA 1J97A 4RUAA 1Z1VA 1Z3EB 5J0YA 4F92B 1GO3F 4FS2A 1BVSA 3G6YA 2A1JA 1ZQZA 4X5VA 4RQ0A 4FBUA 2KSOA 1D8BA 4I2DA 4MF2A 1BGXT 2BCQA 3QU7A 1SKRA 3PSTA 2ZTEA 2Y1JA 4GLXA 3JPPA 3I28A 2ASJA 5HHHA 4YFKA 5KG0A 4HYKA 2EZYA 1FFUA 4KN4A 2W8KA 5KFWA 4DSFA 5KFXA 3IN5A 3HRDD 3PV8A 2KNJA 1QSLA 4M0AA 3H4DA 3NTUA 5DB9A 2F1HA 1ZQFA 3FC4A 1KSPA 4DQQA 4C0ZA 4J9OA 8ICQA 4Y2VA 2KE7A 1KFTA 2YMPA 1WG8A 2P66A 4UATA 4UAYA 4QW8A 4M9JA 3O0FA 3PW7A 7ICJA 3CNHA 7ICVA 3G6XA 2C2DA 4EZ9A 4DQSA 1U47A 5AM0A 5F9LA 3H0LB 1WWVA 9ICLA 2E1EA 3RJEA 2BDPA 3H7IA 2P6UA 9ICRA 4NLGA 1KDHA 2PMZF 4PZOA 3TKAA 4U6PA 4FBTA 4Q8FA 3LYSA 5EE1A 1URJA 2PMZC 1UT8A 4YD2A 2W03A 5ALOA 4WJ3B 4PGYA 8ICJA 2VIXA 4I2CA 4DOAA 3V6HA 3SZ2A 4DSIA 3Q8LA 2J6TA 2FJ6A 3RB0A 4ECTA 5AKLA 9ICIA 2P6RA 3N7PD 4C4RA 4AYBF 2AQ4A 4IRKA 1MN8A 2HDOA 5DG8A 4DLEA 1QTMA 3FAHA 3IG5A 5DBCA 4AYBC 3WK4A 1U4BA 2HBMA 4F5NA 3PX0A 1J2MA 4KITB 1WUDA 1X6JA 2YB4A 3TANA 2Y9UA 2K4PA 4DFJA 2YY6A 4ED1A 2L5YA 3CRXA 5ALJA 1L8OA 7ICEA 4PPXA 3QUQA 2F77X 2A1AA 2ZIXB 4F4KA 3F2BA 4G9BA 3CYMA 2W9MA 3QU2A 3T79A 1ZQ1C 3H4BA 1SL2A 5IIKA 4ACOA 4CDGA 2ZTCA 5ALUA 4DL4A 5AKHA 4CCHA 4Y2YA 3EPGA 2BCSA 2HHUA 2E8OA 1K1QA 3BJYA 5AM4A 5ALHA 2ZXIA 1NJXA 2LYHA 2IOHA 1QSSA 3IHQB 4EBCA 1TV9A 3SAHA 3C2LA 3M8RA 1VLBA 4F72A 5J0PA 3PX4A 8ICKA 1RYSA 5EWFA 4KLQA 2ZUCA 4J9LA 4C8KA 2VA8A 4RPZA 4JMUA 4EYHB 3MDCA 2XY7A 2XGPA 1NI3A 2DPIA 4B9NA 4F4YA 3RH5A 4BXOA 2FDRA 5C0YA 4ELTA 4F5QA 4F3OA 8ICMA 5AKZA 3ISDA 5KL8B 2XY5A 2IA6A 5AICA 3LVVA 2FMPA 4US8A 4KLLA 1LKYA 2FI1A 2AGOA 4GIBA 4M9HA 2KFZA 2EAOA 3V6KA 1ZQQA 2RQ5A 4B6JA 3SQIA 4CF3A 4K4IA 3SI8A 2W9CB 3MR6A 2HI0A 4C4TA 1N61A 1PK1B 1XSPA 1ZQSA 2G0AA 5KFQA 2BPCA 4UB1A 3BQ0A 3PR4A 3D2SA 2DL0A 1EXNA 1D9DA 2H3IA 3Q8QB 5IIOA 3RBDA 2K4EA 4DO9A 2VANA 2R18A 5ALZA 5ALQA 4RT2A 4P0QA 3RB3A 4B9LA 3T5KA 3UMGA 5CB1A 2E8MA 3HW8A 1Y88A 2EANA 2EZXA 9ICFA 2W9BB 1S0OA 1D9FA 3T3FA 7ICQA 2D6FC 2HHVA 1V38A 1Z1BA 3GIJA 5IINA 2C28A 5ALGA 4IRDA 4LZGA 5AM2A 1XSLA 1SIJA 5KG6A 3T5LA 4OJ5A 1S0VA 2PFNA 3RBEA 2DF4B 5AM3A 2V4RA 5KG1A 5IIJA 2YQEA 4O3NA 2G07A 3ALRA 4R8UB 4PGXA 3SV3A 4CE6A 3M9OB 3MGVA 5KFRA 3F2DA 3NVYA 4Q8EA 1KL9A 1BPEA 3IV6A 2AHOB 5DGAA 3T5JA 1L3TA 4YXJA 4UB4A 2IMWP 5KFIA 5BOLA 3JPSA 5BOMA 2ZIWB 4UW9A 3C29A 1N5XA 3M7DA 5KFHA 1UCVA 5DBBA 2J6SA 5AKGA 3RTVA 1TAUA 2LI6A 5HMMA 4NL9A 3MGHA 3F5AA 1SWVA 1RZTA 4PL2A 5J2IA 4C7YA 2W8LA 1RXWA 4F5PA 4TUSA 4RQ5A 4UBBA 2KP7A 3OSPA 3GQCA 2WF8A 4J9NA 3PW5A 4DLGA 3BZCA 1KLNA 4KLHA 2XICA 4IC9A 1K5OA 5AI6A 3HWTA 4UASA 4C8MA 5AIBA 2BPGA 5G5GA 2ATLA 8ICEA 2K4HA 2KN7A 5J0SA 3N28A 1FIQA 3K4GA 1DK3A 3TARA 4O0IA 3GIIA 4EEKA 3JPQA 4C8OA 2V4QA 1KFDA 1C20A 2LKYA 4F71A 4UAZA 1X40A 2NO4A 4UB2A 2KHVA 5AK5A 3TAPA 2NRWA 1NK7A 2ZIUB 5TISU 3NVVA 2RDJA 1SGGA 1CRXA 1P7DA 5KT3A 3QE9Y 1MSWD 1KBUA 5J2HA 2HHXA 2N1RA 4R66A 4ED3A 3KOOA 5ALRA 4QZ9A 2D3DA 1U49A 5J0UA 5ALYA 1ZQHA 8ICWA 2KZMA 5AI8A 3ZI4A 1AQ6A 3C1YA 1N48A 3IP4B 2FLLA 2PKEA 3EWAA 3QYPA 4NWIA 5KFTA 1F44A 4I2BA 3OHBA 1TK8A 4ED7A 5DG7A 3UMCA 1VDVA 2I1QA 2IOFK 3UXPA 4BUGA 1DRGA 4YMMA 5J2DA 5AKIA 1XS9D 1NKBA 1A76A 1ZQMA 4KLGA 5DQIA 1B43A 2BCVA 4O5KA 4UB3A 8ICRA 1Q3UA 2GWSA 2CN1A 4JB3A 3MR5A 4I27A 5AI4A 2Y1IA 5EE0A 2XIDA 4F8RA 3IDWA 3NVZA 3U26A 2G5HB 5D49A 4C80A 3HILA 1QQ6A 5KFPA 1PVRA 2QARA 5L1JA 2F8KA 4BWMA 3D6JA 2MU2A 2B0CA 1T8EA 2EQYA 2AXTU 2H3VA 3QU4A 3JPNA 3KHLA 2AJQA 4KLJA 4F5OA 3OPXA 3UQ0A 3ONNA 2HCFA 2W04A 3D2NA 2H3QA 1NK5A 1ZQIA 2FLPA 5H2FU 1UPHA 3QU5A 4O5EA 4M04A 2PXIA 4Y2RA 3EW9A 1BPZA 3BQ2A 4ECSA 5AKJA 1KTQA 3N7RC 4RQ3A 3AEVA 2RRDA 3QEAZ 1IM4A 3OSNA 4B9MA 4F2SA 1WYGA 5DBAA 4JV0A 1IV8A 2QB0B 5ALEA 2QKQA 1ZD2P 3ZD9A 4BDPA 5AI5A 4M6WA 4ED0A 3J81j 3PSFA 4ZOHC 4DS4A 3K75D 2G08A 3TAQA 4CGZA 4C8LA 2C2EA 8ICBA 1ZQDA 1T3QA 2BQUA 5HHIA 8ICPA 5DGBA 4DFDA 2XVTA 1Z4NA 2LYAA 1J2NA 1KFSA 5ALKA 5KNIA 1S97A 3THVA 3QZ8A 4P4MA 1L6NA 2JHDA 3WKAA 4J03A 2QB1A 1QSYA 4LZDA 5KFDA 2EZZA 2RP5A 4KTQA 3WU2U 4F4XA 3RH4A 3FDSA 2ZUBA 4R64A 3E2EA 1AROP 3C1ZA 3WK9A 2R8GA 4C4SA 1DK2A 3H40A 5A0LA 2YN4A 2HBLA 3QUBA 4Q45A 4A8EA 4Z6DA 1N56A 2XCPA 2W55A 1Z4OA 1PVQA 3DEEA 4CRXA 4OJLA 4Q43A 3RR8A 1N2XA 3BQTA 3UM9A 3RFAA 2HSZA 1WCNA 1SKSA 2Q0ZX 1B0XA 3M6KA 1S0NA 1RQNA 2BKEA 3CP8A 1NK4A 2C2RA 4RQ4A 2BDUA 3DDHA 1T7PA 2AH5A 8ICVA 9ICPA 9ICXA 1ZRNA 3MR3A 5L1IA 1ZQCA 4YVZA 1U45A 4CF4A 2E1FA 2WF5A 8ICGA 1LVHA 5DB6A 2OXOA 1KRPA 5T14A 2KHQA 3N7SC 4F93B 2RHFA 1NKCA 1V97A 4YD1A 3MFIA 4YG2A 4PZNA 2BPFA 4IL6U 1TKDA 5KFMA 1KKXA 8ICYA 4C8NA 2VA2A 2GO7A 3NRZA 4OJ6A 5DG9A 2NRXA 4ECUA 1ZQUA 2YMQA 7ICPA 5AM1A 4UAWA 1SZPA 4Y2PA 5AM5A 1Q3VA 3F53A 2KKVA 4F50A 3RJFA 3M9MB 2EH9A 4I2HA 2I5HA 2R8IA 2UVUA 4P0PB 4RU9A 3E58A 3CW2C 4J9RA 8ICLA 4QIWF 4F4ZA 5HR7A 5KFAA 4RPYA 1SZHA 2W54A 4QIWC 4PHPA 3C2MA 2HOQA 1ZQWA 1NZPA 2OCEA 2AU0A 4M9LA 4RQNA 9ICEA 7ICMA 4O3PA 1XSNA 2W3RA 1ZQEA 5DKWA 3MFHA 1JMSA 5ALWA 1JALA 1RG6A 1Q46A 8ICCA 4DL6A 2KJ5A 3TACB 3WKEA 3TFRA 3OHAA 4DSJA 3HJEA 1SV0A 5ALFA 3UXNA 5HNKA 4DSEA 7ICRA 9ICHA 5ALDA 4UAVA 3RRGA 1X66A 4ED8A 1ZQLA 4QWAA 4O3SA 4NLZA 5KAFU 5DB8A 2KJ9A 2WF7A 4NJ8A 5EWEA 3GIKA 4FS1A 2PI4A 3QZ7A 3K1ZA 2OWOA 3F2CA 4DSLA 3QX7A 2H5XA 4KLFA 7ICKA 5JUMA 4EYIB 3PSIA 2F1IA 2ZIXA 1XWLA 2MRLA 5J0XA 4QWCA 5F9NA 3PO5A 5DQGA 1NJWA 1SV0C 4ELUA 5IIIA 3V7JA 4M2YA 2RLTA 1QLNA 4KN7A 1NKEA 4P0QB 4PGQA 2ZTDA 1ZQPA 5ALPA 4DQRA 3ZDDA 1SWWA 4DFPA 4GC6A 2V9WA 9ICAA 2ZG6A 3ISCA 2FLNA 2LBOA 2HHWA 2QLTA 1H38A 1S0MA 4YR3A 2AQ0A 5FP0A 2JMGA 4RPXA 2KZZA 1S9FA 2MAXA 4MEXA 4O9MA 5KFFA 2PFQA 3TQ1A 1NK8A 4O3OA 1TAQA 3AM9A 4JWMA 3GV8B 1KW4A 3E0FA 4OJPA 4PHDA 4I2AA 1Z00A 1N63A 3KZXA 2ZIVB 2WAQF 3GDXA 4B9SA 4YR2A 4IQVA 5J0WA 2H3ZA 3M8SA 1JUDA 5TZVA 2WAQC 3ZDCA 5BPCA 4C7ZA 4QW9A 1RPLA 3C2KA 1HIWA 3FYHA 4EELA 5ALIA 5CA7A 1ZQGA 4KX5A 8ICNA 1ZQRA 3VC8A 4I29A 3V7LA 2B21A 2W9CA 4DFMA 5J0TA 1PK1A 2YB1A 3K1RB 4QZHA 1U48A 3IRUA 2VKQA 3WK6A 3C23A 9ICUA 3SAFA 5CWRA 3GV7B 3L3FX 7ICNA 2D8CA 2JZBA 5KT6A 3MBYA 4ECZA 1MQ3A 3V6JA 2LMRA 1JXEA 3MR2A 4YR0A 3WKDA 3GV5B 1CUKA 4ECRA 2BHNA 2OEHA 2PI5A 2XI9A 2I9GA 3AMZA 1VJ5A 2W9BA 4AP9A 2K60A 2F1JA 2FMSA 4PHEA 4ECYA 2NRZA 2KVSA 4US9A 1RXVA 8ICTA 2MA1A 4Y2QA 9ICMA 5J2JA 4J9PA 3SENA 2UVWA 4G3IA 2ZUDA 2A3VA 1NK9A 2M9NA 5D4BA 4MHVA 3Q8KA 4NL9C 2YMMA 4P2HA 5KFNA 8ICIA 1ZQAA 4I2JA 3RR7A 2ISOA 3AQEA 2ALZA 1ED1A 2EAMA 3L4PA 4QZDA 2ASDA 3V72A 1PZNA 2HVIA 8ICOA 3TI0A 3BS5B 1UA0A 2W43A 3AU2A 3PO4A 2ZIWA 4QWBA 2VA3A 3ED5A 1BPBA 5AKKA 4K4HA 1V85A 1MA7A 2JRZA 4IS7A 3BDPA 1TAMA 5KL1B 1MQ2A 4NM1A 4Y2XA 3JPRA 4B9VA 5ALVA 1S10A 4ECWA 1DXSA 1X42A 2KEYA 1JXLA 4U7CA 2J6UA 1Q8KA 3ZDAA 4DCCA 2WF9A 5J2BA 1UT5A 2E5SA 3OJSA 1C7YA 5AK6A 3KTQA 2HHTA 2JXJA 4GXKA 5AKYA 4FZNA 5ALTA 3NVWA 1JI7A 1UQVA 2IOFA 2HBKA 2FPLA 5J2EA 1ZD5A 2KJ8A 1WCLA 2IHNA 2XC9A 1ZOLA 4IQUA 2A19A 2MUTB 9ICWA 2OYYA 4TUPA 1RDFA 7ICLA 1ZQOA 4NXZA 5KT4A 4R65A 4DQPA 4QZGA 1OW5A 1X9XA 4QWEA 4RT3A 3KHRA 1PUZA 5EE9A 4YN4A 5J8YA 3IM1A 1IIPA 1HEKA 4J9MA 4NV0A 5K4LA 1ZJMA 4I2FA 8ICUA 1ZQVA 3RJJA 1T3NA 2PFPA 4I2GA 5KG2A 4DF8A 3HKZF 1S77D 2KKPA 2HOIA 3M9NB 3HKZC 5KAIU 4KMUA 4UQGA 3SD7A 1JROA 2W9AA 2KK0A 5KFBA 4XUSA 2LHTA 3C28A 2ASLA 2JEIA 5J8YC 2BGWA 2F76X 2VJ5A 4P4OA 1JX4A 1FO4A 5J0QA 2C22A 5ALLA 9ICTA 1S76D 3QUTA 4EBDA 1KEJA 1NJZA 1X2IA 2FPKA 3HPOA 3UQ2A 2UVRA 5KG4A 2F44A 4FZLA 2DPJA 4ICAA 5ALNA 4FO6A 2WHEA 4KX3A 4IR1A 1F0MA 4QZ8A 5KT5A 2BCRA 4XA5A 2OH2A 4QZFA 3VCBA 1QCKA 1U9LA 4NLKA 2G5IB 2A1JB 2KICA 3KZIU 2F8LA 2KSOB 4YXMA 2JEGA 5C5JA 4R63A 7ICTA 3HX0A 1V9PA 5CEHA 5KG7A 3PSPA 2KMDA 1RYRA 2YTUA 4HAIA 2JV3A 2K4IA 4J9QA 4RNMA 2XCAA 1QQ7A 5KFOA 2JEFA 8ICFA 1FEZA 4RNOA 1TFRA 4Q44A 4J9KA 4OD0A 3UMBA 3HT3A 3D2QA 1L7NA 2B6GA 3QU9A 4RQMA 1D8YA 4DL3A 2IBKA 4DL7A 3GZFA 3Q8RB 4M47A 4ED2A 5EOZA 3LDAA 2KIWA 4FFDA 2BQRA 3GU3A 1ZRMA 4KLIA 4JK1A 4NLCA 3PZPA 2QB0A 5AKXA 4NLNA 9ICCA 2P35A 3PMNA 4USAA 4YMNA 1ZETA 2CPRA 4IRCA 3KFUF 4DQIA 2NYVA 1RM6C 9ICSA 4RQ1A 3Q8MA 1ZD4A 5AI9A 3A0BU 2WB1F 7ICGA 4KLMA 2KD1A 2KG5A 3C5FA 2WB1C 5ALXA 2K8BB 1JN3A 5DLFA 3KHGA 2HHSA 1ECWA 4BWJA 4TUQA 3JPTA 4RQ6A 2HVHA 4Y2UA 4B9UA 1ZJNA 2HHQA 4UB8U 3PW0A 1L5UA 2EAPA 3H0MB 2MSNA 2ZXHA 4PJ0U 5DQHA 3GFKB 3QEBZ 1A0PA 2DQNB 2DWQA 2JR5A 5JTIA 2PFOA 1BPDA 4LVSA 2AGPA 2KV2A 4M9NA 4I2EA 3H0RB 3RJKA 4PL1A 4NY8A 4Y2TA 3RJIA 4F2RA 3SR6A 5KFGA 2ZJ8A 5KT7A 3EUB2 4O3RA 5J2AA 4F5RA 4ED6A 3UXOA 1SB3C 4OCZA 8ICHA 1X9SA 3NS1A 2F2AB 4Z6EA 4JWNA 4BJQA 2K8AA 5AK3A 4O5CA 3H8JA 4EENA 4YMOA 1X9MA 1YT3A 1ZQJA 3BS7A 8ICZA 1KN5A 4RNNA 9ICVA 5AI0A 2BQ3A 1RQLA 4I28A 4EBEA 5J0OA 3OJUA 5KTQA 5J2GA 1TE2A 4NM2A 2BR0A 2NO5A 4KLSA 1X6IA 4RZRA 5CRXA 4MEYA 2LPEA 5KFUA 3RH6A 1TVAA 5CR0A 2BCUA 3RJGA 3B9JA 4BXOB 4EEYA 5AIAA 2ODGA 1A77A 3T5HA 3SYZA 1OXJA 3H8MA 1SKWA 2WF6A 3KD3A 4EX7A 4O3QA 1LKYB 4Y2SA 2WTFA 4QJFB 4MFAA 2K8CB 9ICBA 3AQFA 1NZBA 5G5HA 4CNQA 4OJOA 4DF4A 3Q8PB 3TFSA 4P0PA 5B66U 5CJ7A 1NNLA 2H3FA 4OO1J 4XRHA 4KLTA 3ZDEA 3B0XA 1UA1A 2HMXA 4JUZA 2AGQA 2KIVA 4F91B 2HOFA 4DFKA 3PR5B 4DL5A 2OHFA 1WWUA 1Z00B 3RAQA 2DBYA 3AUOA 2JH1A 3AN1A 4UAUA 2ZJ5A 5L9XA 3WK7A 2E3TA 1SL1A 4MFFA 3SV4A 4QNLA 3ZDBA 5KFZA 2DUYA 4KLOA 4DWIA 4JV2A 1BNPA 5EWGA 1IG6A 8ICXA 1S5LU 3QNMA 2XO7A 2G09A 1L3SA 4RQ2A 2JEJA 5HP4A 7ICOA 4QZEA 3UPQA 4EX6A 9ICJA 2LM4A 4K4GA 2JZBB 7ICSA 1ZQXA 4DSKA 2R8JA 2RDIA 1XNSA 4KMOB 2DGZA 5AHXA 1XC9A 3PW2A 3PW4A 3KKAA 1BPYA 3RJHA 3ETLA 3RRHA 2FMQA 1T4GA 5KFLA 3PX6A 3WK8A 3NASA 4GXIA 1O08A 2NV3A 1ZD3A 2YMLA 5D46A 4GC7A 4ELVA 3RAXA 4QZIA 4QZBA 2E8NA 3LWLA 5IILA 2I6XA 5L1LA 3ETRA 2KZ3A 5EE3A 4DOCA 1PK3A 1ZYQA 2ES6A 4ZH4A 1QQ5A 5KFVA 1NOMA 3SEIA 4DEZA 4KLDA 3WKBA 1O03A 5HR6A 4UARA 3OGUA 3EPIA 3KKAC 3S6JA 7ICFA 4QWDA 4FE3A 2Y9TA 2DKZA 5J2KA 2G06A 3N4MB 5AKEA 8ICAA 2LYBA 9ICQA 3BQ1A 3I76A 2DKXA 3RF9A 5E79U 3I1YA 3MGIA 2ISPA 5KFJA 2ZIVA 5KFCA 4IR9A 4BGDA 2R8KA 1ZQTA 1RYUA 4RQ8A 2KTQA 1ZXIA 2GOLA 3N97B 1NK0A 3DV9A 1Z19A 2NRVA 3M1YA 5JU5A 3JPOA 7ICUA 4GFJA 4NLBA 3L5KA 1N5WA 3PNCA 3PY8A 4O3MA 5GTIU 3QUCA 2HW3A 3NUQA 2E8PA 4DS5A 4MF8A 1K1SA 4TURA 5AK4A 4Z6FA 1YZ7A 4UBCA 1UHUA 3LVWA 1JRPA 1B22A 3LWMA 4GXJA 4B9TA 4R8UA 2ESEA 1PVPA 3MDAA 5CHGA 7ICHA 1BNOA 3ICXA 5KFYA 4LJXA 1SXEA 1ZQKA 2CRXA 5GTHU 4KLEA 8ICSA 3C5GA 3NGDA 2W7OA 3PMLA 2GH1A 4E0DA 4RUCA 3SMVA 9ICNA 3KHHA 3H8SA 3FM9A 1MC8A 4JV1A 9ICGA 2KVCA 4QZCA 5L1KA 2W3SA 4Y2JA 5KFSA 1A6SA 3ISBA 5DB7A 2K89A 9ICOA 1IXRA 3EYZA 2YX8A 5HMLA 1OUQA 1L7OA 1T94A 5KFKA 3LK9A 4PHAA 1CEZA 1HJPA 1LV5A 1KQQA 2IHMA 2R8HA 2JH7A 1SXDA 4PH5A 1BPXA 1N62A 5J2CA 2VJ4A 3NRWA 1QH9A 4Z6CA 5ALSA 3EZ5A 2ZJAA 2XGQA 1ZQYA 3G6VA 3R9KA 3TADA 2W11A 5KT2A 3QXGA 3AU6A 2LM1A 4TQRA 1HUOA 3MC1A 9ICKA 2QARB 5B5EU 3BS5A 5L1MA 1HUZA 4F4WA 7ICIA 2Y0SF 4ECQA 3A0HU 4EZ6A 1LB2B 2ZIUA 2Q4TA 4QZAA 4P4PA 2Y0SC 2O6KA 4RQ7A 3OTQA 3TADC 3HP6A 1X9WA 2CXYA 3V7KA 2EDUA 1CI4A 3B0YA 5KG3A 5F3XB 2NRTA 2XY6A 1F5SA 5IIMA 2OM6A 1XO0A 1JIHA 2KFNA 1L8LA 3RB4A
chains in the Genus database with same CATH topology
3PSFA 2K8BB 3M7DA 2KJ9A 3IG8A 2CRXA 4NWIA 1F44A 1GO3F 2YB1A 2OXOA 1ECWA 5T14A 1XNSA 2KHQA 3N7SC 2DGZA 4KMOB 4FZLA 2VKQA 2G08A 2RHFA 4ICAA 3N7PD 3SAFA 4AYBF 2W7OA 2KEYA 3K1ZA 4KX3A 2GH1A 3F5AA 3L3FX 4U7CA 3F2CA 2W7PA 3SMVA 4CGZA 3AL0B 1D8BA 3M6ZA 4PL2A 3IG5A 3H0MB 2OH2A 4AYBC 2ZXHA 3PSIA 2ZIXA 2MRLA 2NV3A 4BUGA 3VCBA 2KVCA 1DRGA 4QJFB 2E5SA 1A0PA 3PSTA 2DQNB 2HBMA 2G5IB 2K8CB 2KICA 2G0AA 1A6SA 1WUDA 2XVTA 2YB4A 2F8LA 3AQFA 1NZBA 4OJOA 2LYAA 3CRXA 2XICA 4OJ6A 2JGAA 4IC9A 2F77X 2K89A 1Q3UA 3D2SA 4P0QB 2CN1A 4FZNA 2ZIXB 1L6NA 2H3IA 2JHDA 2YX8A 2KV2A 3F2BA 2XI9A 2HBKA 3CYMA 1T94A 2M0NA 3H0RB 1OUQA 4P0PA 1Q3VA 3IN5A 5HR6A 2H3FA 3F53A 2K4EA 2XIDA 2KNJA 4PL1A 3PSPA 4OO1J 2K4HA 2KJ8A 2R18A 2JH7A 3F5EA 2RP5A 2KKVA 3T79A 1ZQ1C 4FE3A 4P0QA 2G5HB 4ACOA 4CDGA 2G06A 2K4IA 2HMXA 2ZG6A 2LYBA 2VJ4A 3NRWA 2LBOA 1PVRA 4C0ZA 2OYYA 2Z7JA 2MA1A 2HOFA 4P0PB 3RF9A 2KOBA 2JMGA 2F2AB 5A0LA 2LKYA 3D2QA 4QIWF 2H3VA 4BJQA 4BX9C 2HBLA 2A3VA 2D6FC 2ZIVA 3O0FA 5HR7A 2KHVA 2K8AA 3OPXA 1SZHA 4A8EA 1Z1BA 2ZXIA 3ONNA 1IIPA 1HEKA 4QIWC 3SAGA 2W04A 3D2NA 1PVQA 2H3QA 2HOQA 2JH1A 3E0FA 2GOLA 3DEEA 3GZFA 4NV0A 1YT3A 4CRXA 2ZIUB 2KIWA 4OJLA 4OJPA 1Z19A 4FZMA 3GU3A 3SAHA 3H0LB 1UPHA 3AQEA 3RFAA 1ED1A 3KZXA 2ZIVB 2WAQF 4GFJA 4OJ5A 1P7DA 1CRXA 3HKZF 4NLBA 2E1EA 2KKPA 4NLCA 3PZPA 4QNLA 2HOIA 2DF4B 2H3ZA 2Y0SF 3M6KA 4O3MA 2ZIUA 1KBUA 4JMUA 3NUQA 2WAQC 2Q4TA 2G07A 3ALRA 3CP8A 2PMZF 3HKZC 3N7RC 1HIWA 2N1RA 2Y0SC 2ZIWA 2RRDA 4U6PA 2HBJA 3MGVA 3LYSA 2BDUA 2CPRA 2G09A 3F2DA 3LVWA 2KJ5A 1URJA 2PMZC 3KFUF 5C0YA 2LHTA 1MA7A 3C28A 2W03A 4WJ3B 2WB1F 2F76X 2VJ5A 2VIXA 4KX5A 1PVPA 5KL8B 3VC8A 5CRXA 2KD1A 1TAMA 5KL1B 3SQIA 2OM6A 3ICXA 3LVVA 1XO0A 2WB1C 2ZIWB 3IP4B 3C29A 2E1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  4AYB F;  2WAQ F;  2WB1 F;  3HKZ F;  2PMZ F; 
#chains in the Genus database with same CATH topology
 3IG8 A;  5KG5 A;  2GLE A;  1TK5 A;  1N60 A;  3GIL A;  5DLG A;  4YCX A;  4ECX A;  1M6Y A;  2DFL A;  3AL0 B;  3MAB A;  2W7P A;  1B4F A;  3H8W A;  3M6Z A;  4DOB A;  4M6W B;  5J0R A;  1D8L A;  4TQS A;  4ECV A;  1S8O A;  1DGJ A;  1DGS A;  2FE9 A;  2JGA A;  3WKC A;  2FPM A;  2MUT A;  4DL2 A;  5CP2 A;  1L3U A;  2M0N A;  1ZQB A;  2WFA A;  5DDY A;  4YP3 A;  3F5E A;  3KBB A;  1FFV A;  1COK A;  2Z7J A;  4UB6 U;  4IQW A;  2KOB A;  3ZD8 A;  5J2F A;  5J29 A;  3ORY A;  5ALM A;  5DDM A;  4BX9 C;  3BQ7 A;  4XQ8 A;  4I2I A;  5JRT A;  1SV4 A;  3Q8S B;  1COO A;  4CF5 A;  3SAG A;  3BZK A;  1L3V A;  1L7M A;  1ZQN A;  3C21 A;  1SL0 A;  2F3N A;  1L7P A;  1NJY A;  1NK6 A;  4FZM A;  3RB6 A;  2BZF A;  4M9G A;  1YZ6 A;  1XU4 A;  4UB5 A;  3WK5 A;  1XO1 A;  4J9S A;  5KFE A;  1DOQ A;  4MFC A;  4KLU A;  2UVV A;  3PVX A;  2HBJ A;  4YQW A;  1TK0 A;  4IQT A;  3GIM A;  1J97 A;  4RUA A;  1Z1V A;  1Z3E B;  5J0Y A;  4F92 B;  1GO3 F;  4FS2 A;  1BVS A;  3G6Y A;  2A1J A;  1ZQZ A;  4X5V A;  4RQ0 A;  4FBU A;  2KSO A;  1D8B A;  4I2D A;  4MF2 A;  1BGX T;  2BCQ A;  3QU7 A;  1SKR A;  3PST A;  2ZTE A;  2Y1J A;  4GLX A;  3JPP A;  3I28 A;  2ASJ A;  5HHH A;  4YFK A;  5KG0 A;  4HYK A;  2EZY A;  1FFU A;  4KN4 A;  2W8K A;  5KFW A;  4DSF A;  5KFX A;  3IN5 A;  3HRD D;  3PV8 A;  2KNJ A;  1QSL A;  4M0A A;  3H4D A;  3NTU A;  5DB9 A;  2F1H A;  1ZQF A;  3FC4 A;  1KSP A;  4DQQ A;  4C0Z A;  4J9O A;  8ICQ A;  4Y2V A;  2KE7 A;  1KFT A;  2YMP A;  1WG8 A;  2P66 A;  4UAT A;  4UAY A;  4QW8 A;  4M9J A;  3O0F A;  3PW7 A;  7ICJ A;  3CNH A;  7ICV A;  3G6X A;  2C2D A;  4EZ9 A;  4DQS A;  1U47 A;  5AM0 A;  5F9L A;  3H0L B;  1WWV A;  9ICL A;  2E1E A;  3RJE A;  2BDP A;  3H7I A;  2P6U A;  9ICR A;  4NLG A;  1KDH A;  2PMZ F;  4PZO A;  3TKA A;  4U6P A;  4FBT A;  4Q8F A;  3LYS A;  5EE1 A;  1URJ A;  2PMZ C;  1UT8 A;  4YD2 A;  2W03 A;  5ALO A;  4WJ3 B;  4PGY A;  8ICJ A;  2VIX A;  4I2C A;  4DOA A;  3V6H A;  3SZ2 A;  4DSI A;  3Q8L A;  2J6T A;  2FJ6 A;  3RB0 A;  4ECT A;  5AKL A;  9ICI A;  2P6R A;  3N7P D;  4C4R A;  4AYB F;  2AQ4 A;  4IRK A;  1MN8 A;  2HDO A;  5DG8 A;  4DLE A;  1QTM A;  3FAH A;  3IG5 A;  5DBC A;  4AYB C;  3WK4 A;  1U4B A;  2HBM A;  4F5N A;  3PX0 A;  1J2M A;  4KIT B;  1WUD A;  1X6J A;  2YB4 A;  3TAN A;  2Y9U A;  2K4P A;  4DFJ A;  2YY6 A;  4ED1 A;  2L5Y A;  3CRX A;  5ALJ A;  1L8O A;  7ICE A;  4PPX A;  3QUQ A;  2F77 X;  2A1A A;  2ZIX B;  4F4K A;  3F2B A;  4G9B A;  3CYM A;  2W9M A;  3QU2 A;  3T79 A;  1ZQ1 C;  3H4B A;  1SL2 A;  5IIK A;  4ACO A;  4CDG A;  2ZTC A;  5ALU A;  4DL4 A;  5AKH A;  4CCH A;  4Y2Y A;  3EPG A;  2BCS A;  2HHU A;  2E8O A;  1K1Q A;  3BJY A;  5AM4 A;  5ALH A;  2ZXI A;  1NJX A;  2LYH A;  2IOH A;  1QSS A;  3IHQ B;  4EBC A;  1TV9 A;  3SAH A;  3C2L A;  3M8R A;  1VLB A;  4F72 A;  5J0P A;  3PX4 A;  8ICK A;  1RYS A;  5EWF A;  4KLQ A;  2ZUC A;  4J9L A;  4C8K A;  2VA8 A;  4RPZ A;  4JMU A;  4EYH B;  3MDC A;  2XY7 A;  2XGP A;  1NI3 A;  2DPI A;  4B9N A;  4F4Y A;  3RH5 A;  4BXO A;  2FDR A;  5C0Y A;  4ELT A;  4F5Q A;  4F3O A;  8ICM A;  5AKZ A;  3ISD A;  5KL8 B;  2XY5 A;  2IA6 A;  5AIC A;  3LVV A;  2FMP A;  4US8 A;  4KLL A;  1LKY A;  2FI1 A;  2AGO A;  4GIB A;  4M9H A;  2KFZ A;  2EAO A;  3V6K A;  1ZQQ A;  2RQ5 A;  4B6J A;  3SQI A;  4CF3 A;  4K4I A;  3SI8 A;  2W9C B;  3MR6 A;  2HI0 A;  4C4T A;  1N61 A;  1PK1 B;  1XSP A;  1ZQS A;  2G0A A;  5KFQ A;  2BPC A;  4UB1 A;  3BQ0 A;  3PR4 A;  3D2S A;  2DL0 A;  1EXN A;  1D9D A;  2H3I A;  3Q8Q B;  5IIO A;  3RBD A;  2K4E A;  4DO9 A;  2VAN A;  2R18 A;  5ALZ A;  5ALQ A;  4RT2 A;  4P0Q A;  3RB3 A;  4B9L A;  3T5K A;  3UMG A;  5CB1 A;  2E8M A;  3HW8 A;  1Y88 A;  2EAN A;  2EZX A;  9ICF A;  2W9B B;  1S0O A;  1D9F A;  3T3F A;  7ICQ A;  2D6F C;  2HHV A;  1V38 A;  1Z1B A;  3GIJ A;  5IIN A;  2C28 A;  5ALG A;  4IRD A;  4LZG A;  5AM2 A;  1XSL A;  1SIJ A;  5KG6 A;  3T5L A;  4OJ5 A;  1S0V A;  2PFN A;  3RBE A;  2DF4 B;  5AM3 A;  2V4R A;  5KG1 A;  5IIJ A;  2YQE A;  4O3N A;  2G07 A;  3ALR A;  4R8U B;  4PGX A;  3SV3 A;  4CE6 A;  3M9O B;  3MGV A;  5KFR A;  3F2D A;  3NVY A;  4Q8E A;  1KL9 A;  1BPE A;  3IV6 A;  2AHO B;  5DGA A;  3T5J A;  1L3T A;  4YXJ A;  4UB4 A;  2IMW P;  5KFI A;  5BOL A;  3JPS A;  5BOM A;  2ZIW B;  4UW9 A;  3C29 A;  1N5X A;  3M7D A;  5KFH A;  1UCV A;  5DBB A;  2J6S A;  5AKG A;  3RTV A;  1TAU A;  2LI6 A;  5HMM A;  4NL9 A;  3MGH A;  3F5A A;  1SWV A;  1RZT A;  4PL2 A;  5J2I A;  4C7Y A;  2W8L A;  1RXW A;  4F5P A;  4TUS A;  4RQ5 A;  4UBB A;  2KP7 A;  3OSP A;  3GQC A;  2WF8 A;  4J9N A;  3PW5 A;  4DLG A;  3BZC A;  1KLN A;  4KLH A;  2XIC A;  4IC9 A;  1K5O A;  5AI6 A;  3HWT A;  4UAS A;  4C8M A;  5AIB A;  2BPG A;  5G5G A;  2ATL A;  8ICE A;  2K4H A;  2KN7 A;  5J0S A;  3N28 A;  1FIQ A;  3K4G A;  1DK3 A;  3TAR A;  4O0I A;  3GII A;  4EEK A;  3JPQ A;  4C8O A;  2V4Q A;  1KFD A;  1C20 A;  2LKY A;  4F71 A;  4UAZ A;  1X40 A;  2NO4 A;  4UB2 A;  2KHV A;  5AK5 A;  3TAP A;  2NRW A;  1NK7 A;  2ZIU B;  5TIS U;  3NVV A;  2RDJ A;  1SGG A;  1CRX A;  1P7D A;  5KT3 A;  3QE9 Y;  1MSW D;  1KBU A;  5J2H A;  2HHX A;  2N1R A;  4R66 A;  4ED3 A;  3KOO A;  5ALR A;  4QZ9 A;  2D3D A;  1U49 A;  5J0U A;  5ALY A;  1ZQH A;  8ICW A;  2KZM A;  5AI8 A;  3ZI4 A;  1AQ6 A;  3C1Y A;  1N48 A;  3IP4 B;  2FLL A;  2PKE A;  3EWA A;  3QYP A;  4NWI A;  5KFT A;  1F44 A;  4I2B A;  3OHB A;  1TK8 A;  4ED7 A;  5DG7 A;  3UMC A;  1VDV A;  2I1Q A;  2IOF K;  3UXP A;  4BUG A;  1DRG A;  4YMM A;  5J2D A;  5AKI A;  1XS9 D;  1NKB A;  1A76 A;  1ZQM A;  4KLG A;  5DQI A;  1B43 A;  2BCV A;  4O5K A;  4UB3 A;  8ICR A;  1Q3U A;  2GWS A;  2CN1 A;  4JB3 A;  3MR5 A;  4I27 A;  5AI4 A;  2Y1I A;  5EE0 A;  2XID A;  4F8R A;  3IDW A;  3NVZ A;  3U26 A;  2G5H B;  5D49 A;  4C80 A;  3HIL A;  1QQ6 A;  5KFP A;  1PVR A;  2QAR A;  5L1J A;  2F8K A;  4BWM A;  3D6J A;  2MU2 A;  2B0C A;  1T8E A;  2EQY A;  2AXT U;  2H3V A;  3QU4 A;  3JPN A;  3KHL A;  2AJQ A;  4KLJ A;  4F5O A;  3OPX A;  3UQ0 A;  3ONN A;  2HCF A;  2W04 A;  3D2N A;  2H3Q A;  1NK5 A;  1ZQI A;  2FLP A;  5H2F U;  1UPH A;  3QU5 A;  4O5E A;  4M04 A;  2PXI A;  4Y2R A;  3EW9 A;  1BPZ A;  3BQ2 A;  4ECS A;  5AKJ A;  1KTQ A;  3N7R C;  4RQ3 A;  3AEV A;  2RRD A;  3QEA Z;  1IM4 A;  3OSN A;  4B9M A;  4F2S A;  1WYG A;  5DBA A;  4JV0 A;  1IV8 A;  2QB0 B;  5ALE A;  2QKQ A;  1ZD2 P;  3ZD9 A;  4BDP A;  5AI5 A;  4M6W A;  4ED0 A;  3J81 j;  3PSF A;  4ZOH C;  4DS4 A;  3K75 D;  2G08 A;  3TAQ A;  4CGZ A;  4C8L A;  2C2E A;  8ICB A;  1ZQD A;  1T3Q A;  2BQU A;  5HHI A;  8ICP A;  5DGB A;  4DFD A;  2XVT A;  1Z4N A;  2LYA A;  1J2N A;  1KFS A;  5ALK A;  5KNI A;  1S97 A;  3THV A;  3QZ8 A;  4P4M A;  1L6N A;  2JHD A;  3WKA A;  4J03 A;  2QB1 A;  1QSY A;  4LZD A;  5KFD A;  2EZZ A;  2RP5 A;  4KTQ A;  3WU2 U;  4F4X A;  3RH4 A;  3FDS A;  2ZUB A;  4R64 A;  3E2E A;  1ARO P;  3C1Z A;  3WK9 A;  2R8G A;  4C4S A;  1DK2 A;  3H40 A;  5A0L A;  2YN4 A;  2HBL A;  3QUB A;  4Q45 A;  4A8E A;  4Z6D A;  1N56 A;  2XCP A;  2W55 A;  1Z4O A;  1PVQ A;  3DEE A;  4CRX A;  4OJL A;  4Q43 A;  3RR8 A;  1N2X A;  3BQT A;  3UM9 A;  3RFA A;  2HSZ A;  1WCN A;  1SKS A;  2Q0Z X;  1B0X A;  3M6K A;  1S0N A;  1RQN A;  2BKE A;  3CP8 A;  1NK4 A;  2C2R A;  4RQ4 A;  2BDU A;  3DDH A;  1T7P A;  2AH5 A;  8ICV A;  9ICP A;  9ICX A;  1ZRN A;  3MR3 A;  5L1I A;  1ZQC A;  4YVZ A;  1U45 A;  4CF4 A;  2E1F A;  2WF5 A;  8ICG A;  1LVH A;  5DB6 A;  2OXO A;  1KRP A;  5T14 A;  2KHQ A;  3N7S C;  4F93 B;  2RHF A;  1NKC A;  1V97 A;  4YD1 A;  3MFI A;  4YG2 A;  4PZN A;  2BPF A;  4IL6 U;  1TKD A;  5KFM A;  1KKX A;  8ICY A;  4C8N A;  2VA2 A;  2GO7 A;  3NRZ A;  4OJ6 A;  5DG9 A;  2NRX A;  4ECU A;  1ZQU A;  2YMQ A;  7ICP A;  5AM1 A;  4UAW A;  1SZP A;  4Y2P A;  5AM5 A;  1Q3V A;  3F53 A;  2KKV A;  4F50 A;  3RJF A;  3M9M B;  2EH9 A;  4I2H A;  2I5H A;  2R8I A;  2UVU A;  4P0P B;  4RU9 A;  3E58 A;  3CW2 C;  4J9R A;  8ICL A;  4QIW F;  4F4Z A;  5HR7 A;  5KFA A;  4RPY A;  1SZH A;  2W54 A;  4QIW C;  4PHP A;  3C2M A;  2HOQ A;  1ZQW A;  1NZP A;  2OCE A;  2AU0 A;  4M9L A;  4RQN A;  9ICE A;  7ICM A;  4O3P A;  1XSN A;  2W3R A;  1ZQE A;  5DKW A;  3MFH A;  1JMS A;  5ALW A;  1JAL A;  1RG6 A;  1Q46 A;  8ICC A;  4DL6 A;  2KJ5 A;  3TAC B;  3WKE A;  3TFR A;  3OHA A;  4DSJ A;  3HJE A;  1SV0 A;  5ALF A;  3UXN A;  5HNK A;  4DSE A;  7ICR A;  9ICH A;  5ALD A;  4UAV A;  3RRG A;  1X66 A;  4ED8 A;  1ZQL A;  4QWA A;  4O3S A;  4NLZ A;  5KAF U;  5DB8 A;  2KJ9 A;  2WF7 A;  4NJ8 A;  5EWE A;  3GIK A;  4FS1 A;  2PI4 A;  3QZ7 A;  3K1Z A;  2OWO A;  3F2C A;  4DSL A;  3QX7 A;  2H5X A;  4KLF A;  7ICK A;  5JUM A;  4EYI B;  3PSI A;  2F1I A;  2ZIX A;  1XWL A;  2MRL A;  5J0X A;  4QWC A;  5F9N A;  3PO5 A;  5DQG A;  1NJW A;  1SV0 C;  4ELU A;  5III A;  3V7J A;  4M2Y A;  2RLT A;  1QLN A;  4KN7 A;  1NKE A;  4P0Q B;  4PGQ A;  2ZTD A;  1ZQP A;  5ALP A;  4DQR A;  3ZDD A;  1SWW A;  4DFP A;  4GC6 A;  2V9W A;  9ICA A;  2ZG6 A;  3ISC A;  2FLN A;  2LBO A;  2HHW A;  2QLT A;  1H38 A;  1S0M A;  4YR3 A;  2AQ0 A;  5FP0 A;  2JMG A;  4RPX A;  2KZZ A;  1S9F A;  2MAX A;  4MEX A;  4O9M A;  5KFF A;  2PFQ A;  3TQ1 A;  1NK8 A;  4O3O A;  1TAQ A;  3AM9 A;  4JWM A;  3GV8 B;  1KW4 A;  3E0F A;  4OJP A;  4PHD A;  4I2A A;  1Z00 A;  1N63 A;  3KZX A;  2ZIV B;  2WAQ F;  3GDX A;  4B9S A;  4YR2 A;  4IQV A;  5J0W A;  2H3Z A;  3M8S A;  1JUD A;  5TZV A;  2WAQ C;  3ZDC A;  5BPC A;  4C7Z A;  4QW9 A;  1RPL A;  3C2K A;  1HIW A;  3FYH A;  4EEL A;  5ALI A;  5CA7 A;  1ZQG A;  4KX5 A;  8ICN A;  1ZQR A;  3VC8 A;  4I29 A;  3V7L A;  2B21 A;  2W9C A;  4DFM A;  5J0T A;  1PK1 A;  2YB1 A;  3K1R B;  4QZH A;  1U48 A;  3IRU A;  2VKQ A;  3WK6 A;  3C23 A;  9ICU A;  3SAF A;  5CWR A;  3GV7 B;  3L3F X;  7ICN A;  2D8C A;  2JZB A;  5KT6 A;  3MBY A;  4ECZ A;  1MQ3 A;  3V6J A;  2LMR A;  1JXE A;  3MR2 A;  4YR0 A;  3WKD A;  3GV5 B;  1CUK A;  4ECR A;  2BHN A;  2OEH A;  2PI5 A;  2XI9 A;  2I9G A;  3AMZ A;  1VJ5 A;  2W9B A;  4AP9 A;  2K60 A;  2F1J A;  2FMS A;  4PHE A;  4ECY A;  2NRZ A;  2KVS A;  4US9 A;  1RXV A;  8ICT A;  2MA1 A;  4Y2Q A;  9ICM A;  5J2J A;  4J9P A;  3SEN A;  2UVW A;  4G3I A;  2ZUD A;  2A3V A;  1NK9 A;  2M9N A;  5D4B A;  4MHV A;  3Q8K A;  4NL9 C;  2YMM A;  4P2H A;  5KFN A;  8ICI A;  1ZQA A;  4I2J A;  3RR7 A;  2ISO A;  3AQE A;  2ALZ A;  1ED1 A;  2EAM A;  3L4P A;  4QZD A;  2ASD A;  3V72 A;  1PZN A;  2HVI A;  8ICO A;  3TI0 A;  3BS5 B;  1UA0 A;  2W43 A;  3AU2 A;  3PO4 A;  2ZIW A;  4QWB A;  2VA3 A;  3ED5 A;  1BPB A;  5AKK A;  4K4H A;  1V85 A;  1MA7 A;  2JRZ A;  4IS7 A;  3BDP A;  1TAM A;  5KL1 B;  1MQ2 A;  4NM1 A;  4Y2X A;  3JPR A;  4B9V A;  5ALV A;  1S10 A;  4ECW A;  1DXS A;  1X42 A;  2KEY A;  1JXL A;  4U7C A;  2J6U A;  1Q8K A;  3ZDA A;  4DCC A;  2WF9 A;  5J2B A;  1UT5 A;  2E5S A;  3OJS A;  1C7Y A;  5AK6 A;  3KTQ A;  2HHT A;  2JXJ A;  4GXK A;  5AKY A;  4FZN A;  5ALT A;  3NVW A;  1JI7 A;  1UQV A;  2IOF A;  2HBK A;  2FPL A;  5J2E A;  1ZD5 A;  2KJ8 A;  1WCL A;  2IHN A;  2XC9 A;  1ZOL A;  4IQU A;  2A19 A;  2MUT B;  9ICW A;  2OYY A;  4TUP A;  1RDF A;  7ICL A;  1ZQO A;  4NXZ A;  5KT4 A;  4R65 A;  4DQP A;  4QZG A;  1OW5 A;  1X9X A;  4QWE A;  4RT3 A;  3KHR A;  1PUZ A;  5EE9 A;  4YN4 A;  5J8Y A;  3IM1 A;  1IIP A;  1HEK A;  4J9M A;  4NV0 A;  5K4L A;  1ZJM A;  4I2F A;  8ICU A;  1ZQV A;  3RJJ A;  1T3N A;  2PFP A;  4I2G A;  5KG2 A;  4DF8 A;  3HKZ F;  1S77 D;  2KKP A;  2HOI A;  3M9N B;  3HKZ C;  5KAI U;  4KMU A;  4UQG A;  3SD7 A;  1JRO A;  2W9A A;  2KK0 A;  5KFB A;  4XUS A;  2LHT A;  3C28 A;  2ASL A;  2JEI A;  5J8Y C;  2BGW A;  2F76 X;  2VJ5 A;  4P4O A;  1JX4 A;  1FO4 A;  5J0Q A;  2C22 A;  5ALL A;  9ICT A;  1S76 D;  3QUT A;  4EBD A;  1KEJ A;  1NJZ A;  1X2I A;  2FPK A;  3HPO A;  3UQ2 A;  2UVR A;  5KG4 A;  2F44 A;  4FZL A;  2DPJ A;  4ICA A;  5ALN A;  4FO6 A;  2WHE A;  4KX3 A;  4IR1 A;  1F0M A;  4QZ8 A;  5KT5 A;  2BCR A;  4XA5 A;  2OH2 A;  4QZF A;  3VCB A;  1QCK A;  1U9L A;  4NLK A;  2G5I B;  2A1J B;  2KIC A;  3KZI U;  2F8L A;  2KSO B;  4YXM A;  2JEG A;  5C5J A;  4R63 A;  7ICT A;  3HX0 A;  1V9P A;  5CEH A;  5KG7 A;  3PSP A;  2KMD A;  1RYR A;  2YTU A;  4HAI A;  2JV3 A;  2K4I A;  4J9Q A;  4RNM A;  2XCA A;  1QQ7 A;  5KFO A;  2JEF A;  8ICF A;  1FEZ A;  4RNO A;  1TFR A;  4Q44 A;  4J9K A;  4OD0 A;  3UMB A;  3HT3 A;  3D2Q A;  1L7N A;  2B6G A;  3QU9 A;  4RQM A;  1D8Y A;  4DL3 A;  2IBK A;  4DL7 A;  3GZF A;  3Q8R B;  4M47 A;  4ED2 A;  5EOZ A;  3LDA A;  2KIW A;  4FFD A;  2BQR A;  3GU3 A;  1ZRM A;  4KLI A;  4JK1 A;  4NLC A;  3PZP A;  2QB0 A;  5AKX A;  4NLN A;  9ICC A;  2P35 A;  3PMN A;  4USA A;  4YMN A;  1ZET A;  2CPR A;  4IRC A;  3KFU F;  4DQI A;  2NYV A;  1RM6 C;  9ICS A;  4RQ1 A;  3Q8M A;  1ZD4 A;  5AI9 A;  3A0B U;  2WB1 F;  7ICG A;  4KLM A;  2KD1 A;  2KG5 A;  3C5F A;  2WB1 C;  5ALX A;  2K8B B;  1JN3 A;  5DLF A;  3KHG A;  2HHS A;  1ECW A;  4BWJ A;  4TUQ A;  3JPT A;  4RQ6 A;  2HVH A;  4Y2U A;  4B9U A;  1ZJN A;  2HHQ A;  4UB8 U;  3PW0 A;  1L5U A;  2EAP A;  3H0M B;  2MSN A;  2ZXH A;  4PJ0 U;  5DQH A;  3GFK B;  3QEB Z;  1A0P A;  2DQN B;  2DWQ A;  2JR5 A;  5JTI A;  2PFO A;  1BPD A;  4LVS A;  2AGP A;  2KV2 A;  4M9N A;  4I2E A;  3H0R B;  3RJK A;  4PL1 A;  4NY8 A;  4Y2T A;  3RJI A;  4F2R A;  3SR6 A;  5KFG A;  2ZJ8 A;  5KT7 A;  3EUB 2;  4O3R A;  5J2A A;  4F5R A;  4ED6 A;  3UXO A;  1SB3 C;  4OCZ A;  8ICH A;  1X9S A;  3NS1 A;  2F2A B;  4Z6E A;  4JWN A;  4BJQ A;  2K8A A;  5AK3 A;  4O5C A;  3H8J A;  4EEN A;  4YMO A;  1X9M A;  1YT3 A;  1ZQJ A;  3BS7 A;  8ICZ A;  1KN5 A;  4RNN A;  9ICV A;  5AI0 A;  2BQ3 A;  1RQL A;  4I28 A;  4EBE A;  5J0O A;  3OJU A;  5KTQ A;  5J2G A;  1TE2 A;  4NM2 A;  2BR0 A;  2NO5 A;  4KLS A;  1X6I A;  4RZR A;  5CRX A;  4MEY A;  2LPE A;  5KFU A;  3RH6 A;  1TVA A;  5CR0 A;  2BCU A;  3RJG A;  3B9J A;  4BXO B;  4EEY A;  5AIA A;  2ODG A;  1A77 A;  3T5H A;  3SYZ A;  1OXJ A;  3H8M A;  1SKW A;  2WF6 A;  3KD3 A;  4EX7 A;  4O3Q A;  1LKY B;  4Y2S A;  2WTF A;  4QJF B;  4MFA A;  2K8C B;  9ICB A;  3AQF A;  1NZB A;  5G5H A;  4CNQ A;  4OJO A;  4DF4 A;  3Q8P B;  3TFS A;  4P0P A;  5B66 U;  5CJ7 A;  1NNL A;  2H3F A;  4OO1 J;  4XRH A;  4KLT A;  3ZDE A;  3B0X A;  1UA1 A;  2HMX A;  4JUZ A;  2AGQ A;  2KIV A;  4F91 B;  2HOF A;  4DFK A;  3PR5 B;  4DL5 A;  2OHF A;  1WWU A;  1Z00 B;  3RAQ A;  2DBY A;  3AUO A;  2JH1 A;  3AN1 A;  4UAU A;  2ZJ5 A;  5L9X A;  3WK7 A;  2E3T A;  1SL1 A;  4MFF A;  3SV4 A;  4QNL A;  3ZDB A;  5KFZ A;  2DUY A;  4KLO A;  4DWI A;  4JV2 A;  1BNP A;  5EWG A;  1IG6 A;  8ICX A;  1S5L U;  3QNM A;  2XO7 A;  2G09 A;  1L3S A;  4RQ2 A;  2JEJ A;  5HP4 A;  7ICO A;  4QZE A;  3UPQ A;  4EX6 A;  9ICJ A;  2LM4 A;  4K4G A;  2JZB B;  7ICS A;  1ZQX A;  4DSK A;  2R8J A;  2RDI A;  1XNS A;  4KMO B;  2DGZ A;  5AHX A;  1XC9 A;  3PW2 A;  3PW4 A;  3KKA A;  1BPY A;  3RJH A;  3ETL A;  3RRH A;  2FMQ A;  1T4G A;  5KFL A;  3PX6 A;  3WK8 A;  3NAS A;  4GXI A;  1O08 A;  2NV3 A;  1ZD3 A;  2YML A;  5D46 A;  4GC7 A;  4ELV A;  3RAX A;  4QZI A;  4QZB A;  2E8N A;  3LWL A;  5IIL A;  2I6X A;  5L1L A;  3ETR A;  2KZ3 A;  5EE3 A;  4DOC A;  1PK3 A;  1ZYQ A;  2ES6 A;  4ZH4 A;  1QQ5 A;  5KFV A;  1NOM A;  3SEI A;  4DEZ A;  4KLD A;  3WKB A;  1O03 A;  5HR6 A;  4UAR A;  3OGU A;  3EPI A;  3KKA C;  3S6J A;  7ICF A;  4QWD A;  4FE3 A;  2Y9T A;  2DKZ A;  5J2K A;  2G06 A;  3N4M B;  5AKE A;  8ICA A;  2LYB A;  9ICQ A;  3BQ1 A;  3I76 A;  2DKX A;  3RF9 A;  5E79 U;  3I1Y A;  3MGI A;  2ISP A;  5KFJ A;  2ZIV A;  5KFC A;  4IR9 A;  4BGD A;  2R8K A;  1ZQT A;  1RYU A;  4RQ8 A;  2KTQ A;  1ZXI A;  2GOL A;  3N97 B;  1NK0 A;  3DV9 A;  1Z19 A;  2NRV A;  3M1Y A;  5JU5 A;  3JPO A;  7ICU A;  4GFJ A;  4NLB A;  3L5K A;  1N5W A;  3PNC A;  3PY8 A;  4O3M A;  5GTI U;  3QUC A;  2HW3 A;  3NUQ A;  2E8P A;  4DS5 A;  4MF8 A;  1K1S A;  4TUR A;  5AK4 A;  4Z6F A;  1YZ7 A;  4UBC A;  1UHU A;  3LVW A;  1JRP A;  1B22 A;  3LWM A;  4GXJ A;  4B9T A;  4R8U A;  2ESE A;  1PVP A;  3MDA A;  5CHG A;  7ICH A;  1BNO A;  3ICX A;  5KFY A;  4LJX A;  1SXE A;  1ZQK A;  2CRX A;  5GTH U;  4KLE A;  8ICS A;  3C5G A;  3NGD A;  2W7O A;  3PML A;  2GH1 A;  4E0D A;  4RUC A;  3SMV A;  9ICN A;  3KHH A;  3H8S A;  3FM9 A;  1MC8 A;  4JV1 A;  9ICG A;  2KVC A;  4QZC A;  5L1K A;  2W3S A;  4Y2J A;  5KFS A;  1A6S A;  3ISB A;  5DB7 A;  2K89 A;  9ICO A;  1IXR A;  3EYZ A;  2YX8 A;  5HML A;  1OUQ A;  1L7O A;  1T94 A;  5KFK A;  3LK9 A;  4PHA A;  1CEZ A;  1HJP A;  1LV5 A;  1KQQ A;  2IHM A;  2R8H A;  2JH7 A;  1SXD A;  4PH5 A;  1BPX A;  1N62 A;  5J2C A;  2VJ4 A;  3NRW A;  1QH9 A;  4Z6C A;  5ALS A;  3EZ5 A;  2ZJA A;  2XGQ A;  1ZQY A;  3G6V A;  3R9K A;  3TAD A;  2W11 A;  5KT2 A;  3QXG A;  3AU6 A;  2LM1 A;  4TQR A;  1HUO A;  3MC1 A;  9ICK A;  2QAR B;  5B5E U;  3BS5 A;  5L1M A;  1HUZ A;  4F4W A;  7ICI A;  2Y0S F;  4ECQ A;  3A0H U;  4EZ6 A;  1LB2 B;  2ZIU A;  2Q4T A;  4QZA A;  4P4P A;  2Y0S C;  2O6K A;  4RQ7 A;  3OTQ A;  3TAD C;  3HP6 A;  1X9W A;  2CXY A;  3V7K A;  2EDU A;  1CI4 A;  3B0Y A;  5KG3 A;  5F3X B;  2NRT A;  2XY6 A;  1F5S A;  5IIM A;  2OM6 A;  1XO0 A;  1JIH A;  2KFN A;  1L8L A;  3RB4 A; 
#chains in the Genus database with same CATH homology
 3PSF A;  2K8B B;  3M7D A;  2KJ9 A;  3IG8 A;  2CRX A;  4NWI A;  1F44 A;  1GO3 F;  2YB1 A;  2OXO A;  1ECW A;  5T14 A;  1XNS A;  2KHQ A;  3N7S C;  2DGZ A;  4KMO B;  4FZL A;  2VKQ A;  2G08 A;  2RHF A;  4ICA A;  3N7P D;  3SAF A;  4AYB F;  2W7O A;  2KEY A;  3K1Z A;  4KX3 A;  2GH1 A;  3F5A A;  3L3F X;  4U7C A;  3F2C A;  2W7P A;  3SMV A;  4CGZ A;  3AL0 B;  1D8B A;  3M6Z A;  4PL2 A;  3IG5 A;  3H0M B;  2OH2 A;  4AYB C;  2ZXH A;  3PSI A;  2ZIX A;  2MRL A;  2NV3 A;  4BUG A;  3VCB A;  2KVC A;  1DRG A;  4QJF B;  2E5S A;  1A0P A;  3PST A;  2DQN B;  2HBM A;  2G5I B;  2K8C B;  2KIC A;  2G0A A;  1A6S A;  1WUD A;  2XVT A;  2YB4 A;  2F8L A;  3AQF A;  1NZB A;  4OJO A;  2LYA A;  3CRX A;  2XIC A;  4OJ6 A;  2JGA A;  4IC9 A;  2F77 X;  2K89 A;  1Q3U A;  3D2S A;  4P0Q B;  2CN1 A;  4FZN A;  2ZIX B;  1L6N A;  2H3I A;  2JHD A;  2YX8 A;  2KV2 A;  3F2B A;  2XI9 A;  2HBK A;  3CYM A;  1T94 A;  2M0N A;  3H0R B;  1OUQ A;  4P0P A;  1Q3V A;  3IN5 A;  5HR6 A;  2H3F A;  3F53 A;  2K4E A;  2XID A;  2KNJ A;  4PL1 A;  3PSP A;  4OO1 J;  2K4H A;  2KJ8 A;  2R18 A;  2JH7 A;  3F5E A;  2RP5 A;  2KKV A;  3T79 A;  1ZQ1 C;  4FE3 A;  4P0Q A;  2G5H B;  4ACO A;  4CDG A;  2G06 A;  2K4I A;  2HMX A;  2ZG6 A;  2LYB A;  2VJ4 A;  3NRW A;  2LBO A;  1PVR A;  4C0Z A;  2OYY A;  2Z7J A;  2MA1 A;  2HOF A;  4P0P B;  3RF9 A;  2KOB A;  2JMG A;  2F2A B;  5A0L A;  2LKY A;  3D2Q A;  4QIW F;  2H3V A;  4BJQ A;  4BX9 C;  2HBL A;  2A3V A;  2D6F C;  2ZIV A;  3O0F A;  5HR7 A;  2KHV A;  2K8A A;  3OPX A;  1SZH A;  4A8E A;  1Z1B A;  2ZXI A;  3ONN A;  1IIP A;  1HEK A;  4QIW C;  3SAG A;  2W04 A;  3D2N A;  1PVQ A;  2H3Q A;  2HOQ A;  2JH1 A;  3E0F A;  2GOL A;  3DEE A;  3GZF A;  4NV0 A;  1YT3 A;  4CRX A;  2ZIU B;  2KIW A;  4OJL A;  4OJP A;  1Z19 A;  4FZM A;  3GU3 A;  3SAH A;  3H0L B;  1UPH A;  3AQE A;  3RFA A;  1ED1 A;  3KZX A;  2ZIV B;  2WAQ F;  4GFJ A;  4OJ5 A;  1P7D A;  1CRX A;  3HKZ F;  4NLB A;  2E1E A;  2KKP A;  4NLC A;  3PZP A;  4QNL A;  2HOI A;  2DF4 B;  2H3Z A;  2Y0S F;  3M6K A;  4O3M A;  2ZIU A;  1KBU A;  4JMU A;  3NUQ A;  2WAQ C;  2Q4T A;  2G07 A;  3ALR A;  3CP8 A;  2PMZ F;  3HKZ C;  3N7R C;  1HIW A;  2N1R A;  2Y0S C;  2ZIW A;  2RRD A;  4U6P A;  2HBJ A;  3MGV A;  3LYS A;  2BDU A;  2CPR A;  2G09 A;  3F2D A;  3LVW A;  2KJ5 A;  1URJ A;  2PMZ C;  3KFU F;  5C0Y A;  2LHT A;  1MA7 A;  3C28 A;  2W03 A;  4WJ3 B;  2WB1 F;  2F76 X;  2VJ5 A;  2VIX A;  4KX5 A;  1PVP A;  5KL8 B;  3VC8 A;  5CRX A;  2KD1 A;  1TAM A;  5KL1 B;  3SQI A;  2OM6 A;  3ICX A;  3LVV A;  1XO0 A;  2WB1 C;  2ZIW B;  3IP4 B;  3C29 A;  2E1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...