2WB1F

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
total genus 13
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2wb1F02
2WB1F 2WAQF 2PMZF 4AYBF 3HKZF 2Y0SF
chains in the Genus database with same CATH superfamily
1ZYQA 1SWVA 3ALRA 3S6JA 1ZQJA 2HBKA 3MR5A 5KFKA 1QQ6A 2N1RA 2F76X 1ZQUA 2VANA 1N5XA 4KLSA 3WK9A 3OPXA 4DFPA 1T8EA 7ICNA 1RQLA 4DF8A 3SEIA 1TK8A 5HMLA 5IILA 5ALJA 2Q4TA 2BDUA 2WAQF 5AKZA 3QZ8A 1S0VA 2BCSA 2HW3A 3KHRA 2HDOA 3GU3A 4QZGA 4NLCA 3NVYA 5DG9A 2Y9UA 2YMQA 1HEKA 5EE0A 1OXJA 1FEZA 4ECVA 3RJGA 5ALKA 3OSPA 2GWSA 3OGUA 2JZBB 9ICRA 4KLIA 2LYHA 5KTQA 2RP5A 3HWTA 5EE1A 3PW5A 3KBBA 4F2SA 2UVWA 4J9LA 2WAQC 3DV9A 2W55A 5KFXA 4HYKA 3NVZA 3ZDCA 4O3QA 4M47A 5C5JA 2HSZA 2BKEA 2BZFA 4OJLA 4IRKA 7ICHA 1U47A 5HHHA 4RUCA 9ICMA 4NL9A 1TV9A 1SZPA 5IIJA 1JRPA 2H3FA 3F2CA 3QX7A 3AQEA 3E58A 4KLHA 3THVA 2XO7A 2W04A 4OD0A 3J81j 4JV1A 4FZMA 4MEYA 5CHGA 1PUZA 1XC9A 1SKSA 5CJ7A 5DKWA 2JZBA 3DEEA 9ICQA 1ZQCA 5ALEA 4IQVA 4UAZA 3NS1A 2BQ3A 4M04A 3ETRA 3QE9Y 1QH9A 3SAHA 4YP3A 2FDRA 4YD2A 5BOLA 4RT2A 4QZDA 3NVWA 4LZGA 3EZ5A 4TUQA 3MFIA 4ELTA 1K1QA 4KX3A 1ZD2P 4J9RA 4YR3A 5AK4A 4F71A 4J9SA 5L1LA 4Y2QA 4M9LA 4U7CA 2YB4A 2RQ5A 2DUYA 3ZDBA 3VCBA 4RQ4A 1RQNA 3V7LA 2EANA 2QB0B 4F50A 4M2YA 4DOCA 5AIAA 2XVTA 2KE7A 1T7PA 2HOQA 1U4BA 5DLFA 1NJWA 4OJ6A 2Y0SF 3LWLA 3GILA 5ALMA 2YMLA 2VA2A 3AN1A 1Q46A 4IQTA 3Q8RB 3M8RA 1WCLA 2MAXA 3PV8A 2G07A 2R8IA 5AK3A 2IOHA 3M8SA 4OO1J 3ZDDA 1SWWA 5J2FA 3N28A 3H0LB 2I9GA 1ZQYA 1UT8A 8ICNA 1MQ3A 3MDCA 2H3IA 2HBJA 2QB0A 2Y0SC 3M7DA 1PVPA 4Y2PA 3RBDA 2BQRA 4RQMA 2ZTCA 5KT6A 3NRZA 3JPTA 2HHXA 3D6JA 4UB8U 2QLTA 3OJUA 5J0PA 3L3FX 2KOBA 1Z00B 4ACOA 4F4KA 3QU7A 4PPXA 3HP6A 2AXTU 4F5PA 3H4DA 5F9LA 4KLJA 3BS7A 5ALSA 4OCZA 4DSFA 5AI5A 4DFKA 5KFRA 4RPXA 3IHQB 3WK4A 3K1RB 5KG2A 5KT7A 4FS2A 9ICSA 3KOOA 3IDWA 3EPIA 7ICIA 4UAYA 2C2RA 1ZQVA 4EELA 1Z4NA 5KFQA 5D49A 1WCNA 4BJQA 2RHFA 5HP4A 3EYZA 3SV3A 2W9MA 4ED6A 1S76D 2C2EA 1X9MA 2O6KA 1X66A 2FMSA 3PR4A 3O0FA 4PHDA 1A77A 1Z00A 4M6WB 1VLBA 3QXGA 3V6JA 4JB3A 4NXZA 3L5KA 2BQUA 1T94A 2KZ3A 1NKEA 1ZQPA 1N56A 1HIWA 5ALWA 3C28A 3MBYA 3QEBZ 4Y2JA 2D8CA 4YQWA 5IINA 2FPMA 1U48A 3WK8A 5J2CA 1BPZA 4ED1A 2HOIA 2IMWP 2EZXA 3EW9A 1SL2A 3IG8A 3JPOA 2F1JA 1S5LU 1BNOA 2XIDA 1KDHA 3KHLA 1RDFA 2MUTB 3QU2A 3TQ1A 2KKVA 5F3XB 3H8MA 1ZD5A 2G5IB 3M9NB 5KFTA 2ALZA 4R8UB 2K4PA 4A8EA 4ECWA 4M6WA 5G5GA 2NRWA 4ECYA 4BWJA 1X6JA 2Z7JA 4QZHA 4TUPA 2W9AA 4XUSA 3LWMA 5DBBA 3V7KA 4P4OA 5DBCA 4CE6A 8ICAA 4DQIA 4MF8A 2YX8A 1N2XA 1RXWA 5KAIU 1MA7A 3RH4A 5J0QA 4ECSA 2V9WA 3QZ7A 5ALHA 1ZJNA 2ZIWB 2MUTA 4R66A 2DBYA 3RAXA 4I2BA 4Y2XA 4J9KA 2PKEA 2BCUA 2D6FC 4K4GA 4R8UA 4B9NA 3EPGA 2KG5A 5C0YA 1L3UA 4QWDA 2KSOB 1X2IA 1BVSA 2DPJA 4PJ0U 1KFDA 1KLNA 3G6VA 1YZ7A 4PHPA 9ICFA 4J03A 4Q8EA 2A19A 9ICBA 2BGWA 3LK9A 1ZQDA 3B0XA 5HR6A 7ICEA 1QSSA 4K4HA 5AIBA 5J2AA 5AI9A 2HHWA 5L1IA 4EENA 2PFPA 2ZIWA 4NLGA 4MFCA 2H5XA 4UBBA 4GC6A 4XA5A 5H2FU 2LI6A 2I6XA 2EZZA 1NZPA 2QB1A 4DSLA 3KFUF 2KSOA 4NLBA 1SIJA 4DFDA 2XI9A 4QZ8A 4P2HA 3HILA 1AQ6A 4I2JA 1X6IA 2C22A 2F8KA 2UVVA 2JEJA 1L8LA 2LYAA 1LV5A 2EQYA 5EWFA 4UAUA 2WB1C 4FS1A 3BQTA 4QJFB 1L3VA 4DQQA 2JR5A 4C8NA 2D3DA 1DRGA 2R8KA 2LKYA 1ZETA 4DQRA 4RNMA 4UARA 5DGBA 4P4PA 2ZUDA 3RF9A 4F8RA 4MHVA 1KN5A 4UAWA 5IIMA 3OJSA 1FFVA 3TI0A 4EBCA 1NK0A 2VA8A 3IV6A 1HJPA 2JEGA 9ICLA 3KTQA 4I2CA 3WKCA 3FDSA 2IHNA 2HI0A 5KFYA 4EYHB 1KFTA 2E1EA 2ODGA 5J2IA 2ATLA 8ICYA 3IN5A 1DOQA 3KZXA 5DDYA 3AM9A 5AI0A 4UB2A 3QU9A 8ICTA 2W7OA 1B0XA 9ICKA 2AGPA 5JRTA 4IS7A 4I27A 1DGJA 4NWIA 1QQ7A 2OHFA 1RM6C 5KAFU 1B22A 8ICWA 2PI5A 2BPFA 3BZCA 3D2SA 4C7ZA 4F4XA 2K8BB 1L7OA 3KHGA 9ICWA 2NYVA 4ECTA 1XO1A 4EBEA 4KLGA 4RQ0A 2EDUA 4NY8A 3TAPA 5DG8A 2HVIA 5AKLA 3QYPA 2W9BB 2ZUBA 3QUCA 3RR7A 1ZQLA 2EH9A 1F44A 3WKBA 3QEAZ 1S97A 3F5EA 5J0TA 1JN3A 4DFMA 1OW5A 5J0SA 1URJA 2BCQA 4Q43A 1IV8A 5KFFA 2KKPA 3T79A 4Z6FA 2DGZA 2CXYA 5KG5A 1D8YA 3RJIA 1KSPA 9ICAA 1YZ6A 4F4ZA 1SL0A 1O08A 4RPYA 3WK6A 3M9OB 5DBAA 2HBMA 4DWIA 5J2HA 2HCFA 2YMPA 5J29A 2W43A 4E0DA 8ICSA 1KL9A 1F0MA 5KFJA 2K4HA 1PVQA 4UQGA 1SV4A 2BHNA 2ZIXA 4UB5A 3JPRA 4DL4A 5KG1A 4CF5A 3PMNA 1SV0A 4BX9C 4ED7A 3LYSA 4DO9A 4F5RA 1RYSA 2JH7A 2XY5A 5DQHA 5FP0A 4I2FA 2QARB 4C80A 2KNJA 4WJ3B 3BQ2A 1XS9D 4YMNA 1XU4A 1RYUA 1IM4A 1MQ2A 8ICQA 2FMQA 4EEYA 1ZRNA 3SZ2A 3HW8A 3N7SC 4QZBA 4B9TA 2ZUCA 4IRCA 1ECWA 3E0FA 5DDMA 2J6TA 1GO3F 1ZQAA 2ASDA 1ZXIA 4C4SA 2JXJA 2W03A 2KJ8A 2KJ9A 4X5VA 5DQGA 4TQSA 1T3NA 3SMVA 4DQSA 4QWCA 4NLZA 5ALFA 1A0PA 2OCEA 5AI4A 1L7NA 3RJKA 4GIBA 1RYRA 4KTQA 1JXLA 5J0OA 2XGQA 4O3NA 4ECXA 1KQQA 4C8KA 4YVZA 5AKGA 1TAMA 8ICFA 3AU6A 3SAFA 1TE2A 2Y9TA 2YY6A 4I2AA 3WKDA 4C8MA 3PW0A 3RAQA 4K4IA 4KLTA 1B4FA 2HHSA 1ZQOA 2E5SA 1D9FA 2W3SA 1COOA 2LBOA 2W7PA 3RTVA 4EZ9A 2KP7A 3B0YA 3QNMA 4EZ6A 2E8PA 9ICGA 2E8NA 5J0XA 3N97B 3C2MA 1NKBA 4Z6EA 4UB4A 4Y2YA 7ICMA 4ED3A 1ZQRA 1N61A 3RH5A 4I29A 1CI4A 1BPEA 1JXEA 2KD1A 1N60A 4BDPA 2HHTA 2YTUA 3F53A 5KFEA 3SR6A 5DB6A 2R8JA 1WWUA 4UASA 2F1HA 5EE3A 4O3RA 3ZDAA 1JX4A 5ALZA 1HUZA 3HPOA 1ZQFA 9ICCA 2GH1A 8ICCA 4KLQA 3TADA 1JUDA 5JUMA 4YMMA 1B43A 1CRXA 4F3OA 1WWVA 2PFQA 3IM1A 1JMSA 1DGSA 3GIMA 4QIWF 5EWGA 5J0YA 3CW2C 3M6ZA 1L7MA 2OXOA 3C29A 1L6NA 3UXPA 2ISOA 3MFHA 4KLOA 2OWOA 4GXJA 4Q44A 3UXNA 2Y1JA 2F1IA 9ICUA 5AK6A 5CB1A 5J2KA 5KG3A 1JALA 5KFHA 7ICRA 3M1YA 1MC8A 1TKDA 3H8SA 1NJZA 3V72A 1RXVA 3G6XA 4ED0A 5EE9A 2KZMA 3NRWA 3UQ0A 1EXNA 3GV8B 2EAOA 5AM0A 1VDVA 2UVRA 1DK3A 3Q8LA 2ZXIA 1JROA 4QIWC 3JPQA 2PI4A 2F2AB 1S8OA 1X40A 3UMBA 3WK7A 1IG6A 2LMRA 2A3VA 2FLPA 2FI1A 4RNOA 2RLTA 3Q8KA 4EX7A 3T5JA 2HHUA 3Q8MA 4JUZA 1DK2A 4F5OA 4QWAA 3RH6A 1UQVA 4BWMA 3RFAA 3ED5A 9ICJA 7ICOA 4J9MA 1QSLA 2K4IA 5B5EU 2DWQA 4Q45A 1ZQHA 4DLEA 3C2LA 1F5SA 2LYBA 5DB8A 2G06A 1FFUA 4JV0A 5CA7A 5J0WA 4F4YA 1XNSA 5AI8A 5KFLA 2E3TA 2R18A 4C4TA 2BDPA 3U26A 5KFIA 2K4EA 2E1FA 2HBLA 2KTQA 3H7IA 2JMGA 2AQ0A 8ICEA 3PW7A 1BGXT 1ZD4A 3H8WA 1FO4A 1ZQMA 1M6YA 9ICTA 2VIXA 2LHTA 2VKQA 4MFAA 2KFNA 5AM5A 3V6HA 5DQIA 2B21A 4U6PA 2NO5A 1ZQBA 5D46A 1TAQA 3PSIA 5J8YA 4DSIA 3NTUA 3TKAA 2KMDA 3VC8A 4ECUA 5ALXA 3SV4A 1S9FA 1IIPA 5T14A 3RB0A 5J2GA 5KFAA 2H3ZA 2XC9A 1L5UA 4LJXA 1XSLA 5G5HA 3FYHA 4Y2TA 1X42A 3LVWA 3QU4A 2FE9A 3F2DA 2FLLA 1KEJA 2K60A 4UAVA 4C4RA 2ZJ5A 3PR5B 2KICA 4FZNA 7ICPA 5HMMA 4EBDA 5TISU 2WF7A 4US8A 4ZH4A 9ICIA 1XO0A 5EOZA 4KMUA 2ZIUB 4DLGA 7ICTA 3BS5B 5BPCA 4PL2A 3AL0B 3LDAA 5ALYA 2V4QA 1NK4A 5AM2A 3QUQA 2A1AA 4ED8A 1NKCA 3RRGA 2VJ4A 2IOFA 1NK8A 5KG0A 3K4GA 3ETLA 1T4GA 3DDHA 4Y2SA 1ZQZA 1SKWA 1V97A 2MA1A 4QNLA 4J9PA 5L1JA 1N63A 5ALTA 3K75D 1QTMA 2ESEA 1NK5A 4IRDA 2KZZA 4R65A 5AKHA 3RBEA 4FE3A 2KHVA 4MEXA 2NRXA 4KMOB 3GV7B 2CN1A 3H8JA 2ES6A 2W54A 4DEZA 8ICPA 2JEIA 3GDXA 4AYBF 1TK5A 3QUTA 2ZIUA 4CF3A 9ICXA 5KFVA 3BS5A 2EAPA 2DFLA 4DSEA 4ZOHC 1P7DA 1C20A 4DL2A 1UHUA 2ISPA 2VJ5A 4O3PA 9ICPA 1Z4OA 2DPIA 4EX6A 2W8KA 3ICXA 1ZQWA 3ZDEA 5KFMA 3HJEA 2BCVA 3FM9A 5ALPA 3MGHA 3TACB 1UT5A 2DF4B 4KLEA 4J9NA 2ZTEA 2WF8A 4FO6A 4M9HA 4Y2UA 2PXIA 5KT2A 4Y2VA 4KN7A 5AM1A 2BR0A 4RQ5A 2EAMA 5ALRA 5ALOA 1L3SA 3EUB2 3KKAC 4DL5A 3BJYA 4QZFA 4EYIB 2HMXA 3T5HA 3PVXA 4DL7A 1SL1A 1UA1A 2W11A 4RQ2A 3GV5B 4RQ3A 4XQ8A 8ICOA 2JRZA 3L4PA 3NUQA 3WK5A 1S10A 1J97A 2LPEA 1Z3EB 2WFAA 3KD3A 4B6JA 4C8LA 5AKKA 2A1JB 3N7PD 2XY7A 4DSJA 2R8HA 2NRTA 1ED1A 3ISDA 3A0HU 1J2NA 4GXKA 3G6YA 4BXOB 2ZTDA 1NK9A 1QLNA 5KT3A 3PO5A 2CPRA 1ZQSA 2YB1A 5F9NA 1BPBA 2KEYA 3PW4A 1C7YA 2P6RA 3BQ1A 4DOAA 4M9NA 2KN7A 5ALIA 2P35A 1UA0A 1X9WA 3C2KA 1OUQA 3JPSA 3RJFA 4O5EA 2NO4A 1Q8KA 2HVHA 3E2EA 1LVHA 5BOMA 2A1JA 3PZPA 4CDGA 2PMZF 2CRXA 5HR7A 4DS5A 1WYGA 4F4WA 1K1SA 4YCXA 2PFNA 1N62A 3MR2A 3RB3A 4NLKA 4TQRA 2FPKA 2ZJ8A 2BCRA 2B6GA 4BXOA 2BPGA 4RZRA 8ICVA 3WKAA 3I1YA 4YR2A 3IRUA 2AH5A 1HUOA 3M6KA 4Q8FA 2HOFA 3CP8A 3UMCA 5B66U 5HHIA 4B9SA 1CEZA 5CR0A 5ALUA 1ZQKA 2MRLA 8ICRA 3PX0A 3UXOA 1ZQ1C 2F3NA 1SV0C 3CYMA 4UB1A 2W9BA 1S0OA 4CRXA 3MGVA 4RQNA 4B9LA 2FJ6A 3NVVA 4PGQA 2GLEA 4ED2A 1DXSA 1BPDA 2JV3A 3GFKB 2DQNB 2DKXA 4GC7A 2J6SA 4R63A 4UB6U 5KFCA 4UB3A 4P0PB 1N5WA 3TFRA 2Q0ZX 1T3QA 2YQEA 4I2HA 1KRPA 2WF6A 4IR1A 4KX5A 4J9QA 5CP2A 1TFRA 3AQFA 4IL6U 5J0UA 7ICSA 1SKRA 1RPLA 4F5NA 1TVAA 9ICHA 5KFPA 5AICA 3CNHA 4YN4A 3B9JA 2ASJA 2E8OA 4FZLA 4PGXA 2IHMA 4O3SA 5GTIU 1UCVA 4QWBA 4NLNA 4CNQA 4F91B 4J9OA 3PMLA 1NJYA 5IIKA 2LM4A 8ICXA 2QARA 3UQ2A 8ICMA 3C5GA 4F92B 4IQUA 5ALDA 4NL9C 1KFSA 4YMOA 1YT3A 3RJEA 4P0PA 2BPCA 3Q8PB 2M0NA 3V7JA 2YMMA 5KFNA 3IP4B 2K8CB 3C5FA 2EZYA 4B9MA 4DCCA 3GQCA 5KT5A 3H40A 2WHEA 4M9GA 4PHEA 2KFZA 9ICNA 3F5AA 2WF9A 4Z6DA 3ISCA 4OJ5A 1H38A 2DL0A 4Z6CA 5KFWA 3BQ7A 3K1ZA 7ICGA 3JPPA 4KLLA 4B9UA 3MABA 4XRHA 1ZD3A 2B0CA 4JWMA 1NOMA 4RNNA 2L5YA 3PX4A 7ICUA 2Y1IA 5JTIA 4P0QB 3T5LA 2F44A 3ZD8A 4KLUA 2K8AA 5AM4A 1N48A 3Q8SB 1TAUA 4RQ6A 3BQ0A 1PVRA 4MF2A 1SZHA 9ICOA 2G08A 3Q8QB 5KFGA 4QW8A 1KKXA 1Y88A 3C1ZA 4ELVA 3TADC 3I76A 2P66A 2QKQA 4DQPA 1PZNA 9ICEA 2AHOB 1L8OA 2ZIVB 1D8LA 5KL8B 8ICZA 5GTHU 3N7RC 7ICLA 5JU5A 1NJXA 5J2JA 5DB9A 2P6UA 1MSWD 3TFSA 1Q3UA 2OEHA 1VJ5A 3MR6A 1ZQGA 2FLNA 4P0QA 8ICIA 2J6UA 4CF4A 3QUBA 4QZEA 5D4BA 5KG4A 1LKYB 1A76A 4DL6A 4O5CA 2G0AA 8ICBA 3MR3A 2KVCA 3MGIA 2OH2A 1PK3A 3HKZF 5ALVA 3RRHA 2ZIVA 2PFOA 3MC1A 1S77D 2W3RA 5A0LA 1XSNA 8ICLA 2MU2A 5IIIA 3FAHA 2OM6A 5L9XA 5AKJA 5KFDA 5L1MA 2UVUA 4BGDA 3PX6A 4ECRA 2IA6A 2FPLA 2JHDA 4FFDA 1L7PA 2ZG6A 1V85A 2OYYA 2KJ5A 1UPHA 4YD1A 4DOBA 5AK5A 1NZBA 4ECQA 5AKYA 5KNIA 1LKYA 3HKZC 1FIQA 5J2DA 3OHBA 2M9NA 4UATA 4DF4A 7ICKA 5AKIA 5ALLA 5IIOA 4JMUA 3IG5A 2W9CB 3AU2A 3NASA 4KITB 4KN4A 4YG2A 1IXRA 3SENA 1JIHA 2XCPA 2GOLA 1NNLA 1ZQIA 1RZTA 3ZD9A 3OTQA 3GIJA 4C7YA 4US9A 4FBTA 4NJ8A 4RQ1A 2NV3A 4LVSA 4M9JA 5KT4A 4TURA 3ONNA 1SB3C 2I5HA 5HNKA 2F77X 3ISBA 4IQWA 4RU9A 4B9VA 2YN4A 4EEKA 2XGPA 4FBUA 4PL1A 2KIVA 7ICQA 3UM9A 5J8YC 1ZQXA 1KBUA 3WKEA 3I28A 1JI7A 1SGGA 5ALGA 4O0IA 4PHAA 4O3OA 9ICVA 2LM1A 1K5OA 4F2RA 1ZQTA 1BNPA 4NM1A 2W9CA 4PGYA 3BZKA 3F2BA 1RG6A 4JWNA 4RQ8A 2F8LA 4NV0A 3TANA 2JGAA 3NGDA 2AGQA 4UW9A 5EWEA 4C0ZA 4DL3A 4QZAA 4MFFA 5AM3A 4DS4A 4G9BA 5E79U 5J2BA 3AUOA 4IR9A 1Z19A 3H0MB 1D9DA 3FC4A 3TAQA 2W8LA 8ICKA 7ICFA 1S0NA 3PO4A 2C2DA 4USAA 5AKXA 3AEVA 4JK1A 3PY8A 2AJQA 3SI8A 1WUDA 5KG6A 5AHXA 5KFZA 2K89A 4LZDA 5DB7A 2JEFA 2HHQA 4KLMA 3RR8A 4CGZA 2VA3A 7ICJA 1PK1B 1WG8A 3H4BA 2JH1A 8ICJA 1LB2B 3QU5A 5KFSA 1L3TA 4QZCA 3M9MB 4F5QA 5CWRA 4ICAA 1ZQEA 4CCHA 4YR0A 3N4MB 3R9KA 1ZOLA 3GIIA 4G3IA 1O03A 1TK0A 3GIKA 1J2MA 1U9LA 1NK7A 3ORYA 3D2NA 1MN8A 3C1YA 2GO7A 2KIWA 4F72A 5KFOA 4AYBC 4YFKA 4O3MA 4I2GA 4M0AA 1AROP 5AI6A 1X9SA 2WB1F 2XICA 3HRDD 4ELUA 4F93B 3C21A 2ZXHA 8ICUA 2RDIA 1PK1A 3HT3A 5CEHA 4KLFA 4TUSA 1SXEA 2KHQA 5TZVA 3UMGA 5ALQA 2NRVA 4OJPA 1A6SA 4GXIA 2XCAA 2H3VA 4YXJA 1U45A 5AKEA 2KK0A 4O9MA 2R8GA 3WU2U 3RJJA 3SD7A 1QCKA 3TARA 4RQ7A 4GLXA 3EWAA 1ZQQA 4QWEA 2H3QA 1Q3VA 3D2QA 2XY6A 3C23A 3KKAA 8ICHA 4DSKA 4RT3A 2RDJA 4QW9A 4P4MA 2AGOA 1XSPA 1KTQA 2KV2A 1BPXA 3SQIA 2RRDA 3T3FA 5KFUA 1KW4A 4I2EA 5KG7A 2I1QA 1QQ5A 3RB4A 2IBKA 1NI3A 2IOFK 2MSNA 3HX0A 4RPZA 4OJOA 3CRXA 3AMZA 2V4RA 3OSNA 1ZQNA 2G09A 1X9XA 4RUAA 3BDPA 3LVVA 4ECZA 3RJHA 4DFJA 4KLDA 4PH5A 1S0MA 4QZ9A 5L1KA 4Y2RA 2AU0A 1COKA 3KHHA 2G5HB 3PSPA 8ICGA 5KL1B 1NK6A 5ALNA 3T5KA 4AP9A 3KZIU 1CUKA 3A0BU 4NM2A 4C8OA 4I2DA 5DG7A 2KVSA 4O5KA 2NRZA 1ZRMA 3UPQA 2ZIXB 2ASLA 3PSFA 1ZJMA 1SXDA 2E8MA 4HAIA 3PW2A 5K4LA 4JV2A 1Z1VA 3RB6A 3SAGA 1U49A 3GZFA 3PNCA 3JPNA 4I28A 5DGAA 2PMZC 3MDAA 1XWLA 2HHVA 4QZIA 5CRXA 3H0RB 3OHAA 1V38A 1Z1BA 1QSYA 2WTFA 2FMPA 4IC9A 5J0RA 7ICVA 1D8BA 2AQ4A 4PZOA 4UBCA 4YXMA 3ZI4A 4BUGA 5J2EA 3PSTA 5KFBA 3SYZA 1V9PA 4R64A 2C28A 2ZJAA 4I2IA 5DLGA 3V6KA 1BPYA 2WF5A 2DKZA 4GFJA 4PZNA
chains in the Genus database with same CATH topology
2VJ5A 1URJA 3DEEA 3VC8A 2KV2A 3ALRA 4FZLA 3SQIA 2RRDA 2ZIVB 2NV3A 3NRWA 1IIPA 2Z7JA 2HBKA 4CGZA 5T14A 3ONNA 2KKPA 2LYAA 3ICXA 5KL8B 3T79A 2N1RA 2F77X 2F76X 2DGZA 3N7RC 3PZPA 4CDGA 2WB1C 2H3ZA 3SAHA 4PL1A 4QJFB 2JH1A 2YX8A 2E5SA 2PMZF 3OPXA 4OJOA 2CRXA 2ZXIA 3CRXA 2HBMA 1Q3UA 4QIWC 5HR7A 1MA7A 3LVWA 1DRGA 2DF4B 2LKYA 2LBOA 2G09A 2F2AB 2W7PA 3F2DA 4ICAA 4KX3A 1KBUA 4P0QA 2K4HA 1PVQA 3LVVA 2A3VA 2Q4TA 3RF9A 1YT3A 2BDUA 2WAQF 4P0PA 4U7CA 2YB4A 2ZIXA 2KICA 2M0NA 2ZIWB 3GU3A 3IP4B 2K8CB 3VCBA 4FZNA 4BJQA 2RHFA 4BX9C 3LYSA 4NLCA 3D2NA 3M6KA 2XVTA 2D6FC 1XO0A 2G0AA 2G5HB 3F2BA 2ZIUB 2HOFA 1HEKA 3CP8A 2JH7A 3PSPA 3F5AA 5C0YA 2HMXA 4PL2A 3AL0B 2E1EA 2HOQA 2KIWA 2KVCA 3O0FA 3RFAA 5KL1B 4OJ5A 2F8LA 2OH2A 2KNJA 2KD1A 4AYBC 4NV0A 4WJ3B 4O3MA 3HKZF 2JGAA 2MRLA 2K4IA 2Y0SF 4OJ6A 3IN5A 3KZXA 1ZQ1C 2VJ4A 2ZIVA 2WB1F 3K1ZA 3C29A 1L6NA 3F53A 2XICA 3NUQA 1T94A 5A0LA 2LYBA 2RP5A 2ZIXB 2W7OA 2ZXHA 2G06A 3PSFA 3CYMA 1HIWA 4C0ZA 2WAQC 4CRXA 3MGVA 4NWIA 3C28A 5HR6A 2KHQA 2OM6A 1XNSA 4OJPA 2G07A 3N7SC 2MA1A 3N7PD 3SAGA 4QNLA 1A6SA 1ECWA 2R18A 3E0FA 3GZFA 4OO1J 1GO3F 4OJLA 2H3VA 2DQNB 2JHDA 2GH1A 1Z19A 3H0MB 2HOIA 2K4EA 3D2SA 4FE3A 2KHVA 2E1FA 2HBLA 3H0LB 2K8BB 2ZG6A 2PMZC 2W03A 2OYYA 2JMGA 1UPHA 2KJ8A 2KJ5A 2KJ9A 3H0RB 4KMOB 1ED1A 1Z1BA 4P0QB 5CRXA 2CN1A 2K8AA 1NZBA 3IG8A 1CRXA 2ZIWA 4IC9A 3SMVA 2H3FA 2H3IA 3F2CA 2HBJA 3AQEA 4P0PB 1D8BA 3HKZC 2XIDA 2Y0SC 3M7DA 1PVPA 1A0PA 3M6ZA 4QIWF 1PVRA 2CPRA 4BUGA 2H3QA 2YB1A 3D2QA 2OXOA 1Q3VA 4AYBF 3PSTA 4KX5A 2KEYA 2KKVA 2VIXA 2LHTA 2VKQA 2ZIUA 3IG5A 4JMUA 2W04A 1SZHA 2G5IB 4FZMA 3AQFA 2G08A 1F44A 4U6PA 1WUDA 1P7DA 3KFUF 4NLBA 4A8EA 3F5EA 2K89A 3L3FX 2XI9A 1TAMA 3PSIA 2GOLA 2KOBA 1OUQA 4ACOA 4GFJA 3SAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 F;  2WAQ F;  2PMZ F;  4AYB F;  3HKZ F;  2Y0S F; 
#chains in the Genus database with same CATH topology
 1ZYQ A;  1SWV A;  3ALR A;  3S6J A;  1ZQJ A;  2HBK A;  3MR5 A;  5KFK A;  1QQ6 A;  2N1R A;  2F76 X;  1ZQU A;  2VAN A;  1N5X A;  4KLS A;  3WK9 A;  3OPX A;  4DFP A;  1T8E A;  7ICN A;  1RQL A;  4DF8 A;  3SEI A;  1TK8 A;  5HML A;  5IIL A;  5ALJ A;  2Q4T A;  2BDU A;  2WAQ F;  5AKZ A;  3QZ8 A;  1S0V A;  2BCS A;  2HW3 A;  3KHR A;  2HDO A;  3GU3 A;  4QZG A;  4NLC A;  3NVY A;  5DG9 A;  2Y9U A;  2YMQ A;  1HEK A;  5EE0 A;  1OXJ A;  1FEZ A;  4ECV A;  3RJG A;  5ALK A;  3OSP A;  2GWS A;  3OGU A;  2JZB B;  9ICR A;  4KLI A;  2LYH A;  5KTQ A;  2RP5 A;  3HWT A;  5EE1 A;  3PW5 A;  3KBB A;  4F2S A;  2UVW A;  4J9L A;  2WAQ C;  3DV9 A;  2W55 A;  5KFX A;  4HYK A;  3NVZ A;  3ZDC A;  4O3Q A;  4M47 A;  5C5J A;  2HSZ A;  2BKE A;  2BZF A;  4OJL A;  4IRK A;  7ICH A;  1U47 A;  5HHH A;  4RUC A;  9ICM A;  4NL9 A;  1TV9 A;  1SZP A;  5IIJ A;  1JRP A;  2H3F A;  3F2C A;  3QX7 A;  3AQE A;  3E58 A;  4KLH A;  3THV A;  2XO7 A;  2W04 A;  4OD0 A;  3J81 j;  4JV1 A;  4FZM A;  4MEY A;  5CHG A;  1PUZ A;  1XC9 A;  1SKS A;  5CJ7 A;  5DKW A;  2JZB A;  3DEE A;  9ICQ A;  1ZQC A;  5ALE A;  4IQV A;  4UAZ A;  3NS1 A;  2BQ3 A;  4M04 A;  3ETR A;  3QE9 Y;  1QH9 A;  3SAH A;  4YP3 A;  2FDR A;  4YD2 A;  5BOL A;  4RT2 A;  4QZD A;  3NVW A;  4LZG A;  3EZ5 A;  4TUQ A;  3MFI A;  4ELT A;  1K1Q A;  4KX3 A;  1ZD2 P;  4J9R A;  4YR3 A;  5AK4 A;  4F71 A;  4J9S A;  5L1L A;  4Y2Q A;  4M9L A;  4U7C A;  2YB4 A;  2RQ5 A;  2DUY A;  3ZDB A;  3VCB A;  4RQ4 A;  1RQN A;  3V7L A;  2EAN A;  2QB0 B;  4F50 A;  4M2Y A;  4DOC A;  5AIA A;  2XVT A;  2KE7 A;  1T7P A;  2HOQ A;  1U4B A;  5DLF A;  1NJW A;  4OJ6 A;  2Y0S F;  3LWL A;  3GIL A;  5ALM A;  2YML A;  2VA2 A;  3AN1 A;  1Q46 A;  4IQT A;  3Q8R B;  3M8R A;  1WCL A;  2MAX A;  3PV8 A;  2G07 A;  2R8I A;  5AK3 A;  2IOH A;  3M8S A;  4OO1 J;  3ZDD A;  1SWW A;  5J2F A;  3N28 A;  3H0L B;  2I9G A;  1ZQY A;  1UT8 A;  8ICN A;  1MQ3 A;  3MDC A;  2H3I A;  2HBJ A;  2QB0 A;  2Y0S C;  3M7D A;  1PVP A;  4Y2P A;  3RBD A;  2BQR A;  4RQM A;  2ZTC A;  5KT6 A;  3NRZ A;  3JPT A;  2HHX A;  3D6J A;  4UB8 U;  2QLT A;  3OJU A;  5J0P A;  3L3F X;  2KOB A;  1Z00 B;  4ACO A;  4F4K A;  3QU7 A;  4PPX A;  3HP6 A;  2AXT U;  4F5P A;  3H4D A;  5F9L A;  4KLJ A;  3BS7 A;  5ALS A;  4OCZ A;  4DSF A;  5AI5 A;  4DFK A;  5KFR A;  4RPX A;  3IHQ B;  3WK4 A;  3K1R B;  5KG2 A;  5KT7 A;  4FS2 A;  9ICS A;  3KOO A;  3IDW A;  3EPI A;  7ICI A;  4UAY A;  2C2R A;  1ZQV A;  4EEL A;  1Z4N A;  5KFQ A;  5D49 A;  1WCN A;  4BJQ A;  2RHF A;  5HP4 A;  3EYZ A;  3SV3 A;  2W9M A;  4ED6 A;  1S76 D;  2C2E A;  1X9M A;  2O6K A;  1X66 A;  2FMS A;  3PR4 A;  3O0F A;  4PHD A;  1A77 A;  1Z00 A;  4M6W B;  1VLB A;  3QXG A;  3V6J A;  4JB3 A;  4NXZ A;  3L5K A;  2BQU A;  1T94 A;  2KZ3 A;  1NKE A;  1ZQP A;  1N56 A;  1HIW A;  5ALW A;  3C28 A;  3MBY A;  3QEB Z;  4Y2J A;  2D8C A;  4YQW A;  5IIN A;  2FPM A;  1U48 A;  3WK8 A;  5J2C A;  1BPZ A;  4ED1 A;  2HOI A;  2IMW P;  2EZX A;  3EW9 A;  1SL2 A;  3IG8 A;  3JPO A;  2F1J A;  1S5L U;  1BNO A;  2XID A;  1KDH A;  3KHL A;  1RDF A;  2MUT B;  3QU2 A;  3TQ1 A;  2KKV A;  5F3X B;  3H8M A;  1ZD5 A;  2G5I B;  3M9N B;  5KFT A;  2ALZ A;  4R8U B;  2K4P A;  4A8E A;  4ECW A;  4M6W A;  5G5G A;  2NRW A;  4ECY A;  4BWJ A;  1X6J A;  2Z7J A;  4QZH A;  4TUP A;  2W9A A;  4XUS A;  3LWM A;  5DBB A;  3V7K A;  4P4O A;  5DBC A;  4CE6 A;  8ICA A;  4DQI A;  4MF8 A;  2YX8 A;  1N2X A;  1RXW A;  5KAI U;  1MA7 A;  3RH4 A;  5J0Q A;  4ECS A;  2V9W A;  3QZ7 A;  5ALH A;  1ZJN A;  2ZIW B;  2MUT A;  4R66 A;  2DBY A;  3RAX A;  4I2B A;  4Y2X A;  4J9K A;  2PKE A;  2BCU A;  2D6F C;  4K4G A;  4R8U A;  4B9N A;  3EPG A;  2KG5 A;  5C0Y A;  1L3U A;  4QWD A;  2KSO B;  1X2I A;  1BVS A;  2DPJ A;  4PJ0 U;  1KFD A;  1KLN A;  3G6V A;  1YZ7 A;  4PHP A;  9ICF A;  4J03 A;  4Q8E A;  2A19 A;  9ICB A;  2BGW A;  3LK9 A;  1ZQD A;  3B0X A;  5HR6 A;  7ICE A;  1QSS A;  4K4H A;  5AIB A;  5J2A A;  5AI9 A;  2HHW A;  5L1I A;  4EEN A;  2PFP A;  2ZIW A;  4NLG A;  4MFC A;  2H5X A;  4UBB A;  4GC6 A;  4XA5 A;  5H2F U;  2LI6 A;  2I6X A;  2EZZ A;  1NZP A;  2QB1 A;  4DSL A;  3KFU F;  2KSO A;  4NLB A;  1SIJ A;  4DFD A;  2XI9 A;  4QZ8 A;  4P2H A;  3HIL A;  1AQ6 A;  4I2J A;  1X6I A;  2C22 A;  2F8K A;  2UVV A;  2JEJ A;  1L8L A;  2LYA A;  1LV5 A;  2EQY A;  5EWF A;  4UAU A;  2WB1 C;  4FS1 A;  3BQT A;  4QJF B;  1L3V A;  4DQQ A;  2JR5 A;  4C8N A;  2D3D A;  1DRG A;  2R8K A;  2LKY A;  1ZET A;  4DQR A;  4RNM A;  4UAR A;  5DGB A;  4P4P A;  2ZUD A;  3RF9 A;  4F8R A;  4MHV A;  1KN5 A;  4UAW A;  5IIM A;  3OJS A;  1FFV A;  3TI0 A;  4EBC A;  1NK0 A;  2VA8 A;  3IV6 A;  1HJP A;  2JEG A;  9ICL A;  3KTQ A;  4I2C A;  3WKC A;  3FDS A;  2IHN A;  2HI0 A;  5KFY A;  4EYH B;  1KFT A;  2E1E A;  2ODG A;  5J2I A;  2ATL A;  8ICY A;  3IN5 A;  1DOQ A;  3KZX A;  5DDY A;  3AM9 A;  5AI0 A;  4UB2 A;  3QU9 A;  8ICT A;  2W7O A;  1B0X A;  9ICK A;  2AGP A;  5JRT A;  4IS7 A;  4I27 A;  1DGJ A;  4NWI A;  1QQ7 A;  2OHF A;  1RM6 C;  5KAF U;  1B22 A;  8ICW A;  2PI5 A;  2BPF A;  3BZC A;  3D2S A;  4C7Z A;  4F4X A;  2K8B B;  1L7O A;  3KHG A;  9ICW A;  2NYV A;  4ECT A;  1XO1 A;  4EBE A;  4KLG A;  4RQ0 A;  2EDU A;  4NY8 A;  3TAP A;  5DG8 A;  2HVI A;  5AKL A;  3QYP A;  2W9B B;  2ZUB A;  3QUC A;  3RR7 A;  1ZQL A;  2EH9 A;  1F44 A;  3WKB A;  3QEA Z;  1S97 A;  3F5E A;  5J0T A;  1JN3 A;  4DFM A;  1OW5 A;  5J0S A;  1URJ A;  2BCQ A;  4Q43 A;  1IV8 A;  5KFF A;  2KKP A;  3T79 A;  4Z6F A;  2DGZ A;  2CXY A;  5KG5 A;  1D8Y A;  3RJI A;  1KSP A;  9ICA A;  1YZ6 A;  4F4Z A;  1SL0 A;  1O08 A;  4RPY A;  3WK6 A;  3M9O B;  5DBA A;  2HBM A;  4DWI A;  5J2H A;  2HCF A;  2YMP A;  5J29 A;  2W43 A;  4E0D A;  8ICS A;  1KL9 A;  1F0M A;  5KFJ A;  2K4H A;  1PVQ A;  4UQG A;  1SV4 A;  2BHN A;  2ZIX A;  4UB5 A;  3JPR A;  4DL4 A;  5KG1 A;  4CF5 A;  3PMN A;  1SV0 A;  4BX9 C;  4ED7 A;  3LYS A;  4DO9 A;  4F5R A;  1RYS A;  2JH7 A;  2XY5 A;  5DQH A;  5FP0 A;  4I2F A;  2QAR B;  4C80 A;  2KNJ A;  4WJ3 B;  3BQ2 A;  1XS9 D;  4YMN A;  1XU4 A;  1RYU A;  1IM4 A;  1MQ2 A;  8ICQ A;  2FMQ A;  4EEY A;  1ZRN A;  3SZ2 A;  3HW8 A;  3N7S C;  4QZB A;  4B9T A;  2ZUC A;  4IRC A;  1ECW A;  3E0F A;  5DDM A;  2J6T A;  1GO3 F;  1ZQA A;  2ASD A;  1ZXI A;  4C4S A;  2JXJ A;  2W03 A;  2KJ8 A;  2KJ9 A;  4X5V A;  5DQG A;  4TQS A;  1T3N A;  3SMV A;  4DQS A;  4QWC A;  4NLZ A;  5ALF A;  1A0P A;  2OCE A;  5AI4 A;  1L7N A;  3RJK A;  4GIB A;  1RYR A;  4KTQ A;  1JXL A;  5J0O A;  2XGQ A;  4O3N A;  4ECX A;  1KQQ A;  4C8K A;  4YVZ A;  5AKG A;  1TAM A;  8ICF A;  3AU6 A;  3SAF A;  1TE2 A;  2Y9T A;  2YY6 A;  4I2A A;  3WKD A;  4C8M A;  3PW0 A;  3RAQ A;  4K4I A;  4KLT A;  1B4F A;  2HHS A;  1ZQO A;  2E5S A;  1D9F A;  2W3S A;  1COO A;  2LBO A;  2W7P A;  3RTV A;  4EZ9 A;  2KP7 A;  3B0Y A;  3QNM A;  4EZ6 A;  2E8P A;  9ICG A;  2E8N A;  5J0X A;  3N97 B;  3C2M A;  1NKB A;  4Z6E A;  4UB4 A;  4Y2Y A;  7ICM A;  4ED3 A;  1ZQR A;  1N61 A;  3RH5 A;  4I29 A;  1CI4 A;  1BPE A;  1JXE A;  2KD1 A;  1N60 A;  4BDP A;  2HHT A;  2YTU A;  3F53 A;  5KFE A;  3SR6 A;  5DB6 A;  2R8J A;  1WWU A;  4UAS A;  2F1H A;  5EE3 A;  4O3R A;  3ZDA A;  1JX4 A;  5ALZ A;  1HUZ A;  3HPO A;  1ZQF A;  9ICC A;  2GH1 A;  8ICC A;  4KLQ A;  3TAD A;  1JUD A;  5JUM A;  4YMM A;  1B43 A;  1CRX A;  4F3O A;  1WWV A;  2PFQ A;  3IM1 A;  1JMS A;  1DGS A;  3GIM A;  4QIW F;  5EWG A;  5J0Y A;  3CW2 C;  3M6Z A;  1L7M A;  2OXO A;  3C29 A;  1L6N A;  3UXP A;  2ISO A;  3MFH A;  4KLO A;  2OWO A;  4GXJ A;  4Q44 A;  3UXN A;  2Y1J A;  2F1I A;  9ICU A;  5AK6 A;  5CB1 A;  5J2K A;  5KG3 A;  1JAL A;  5KFH A;  7ICR A;  3M1Y A;  1MC8 A;  1TKD A;  3H8S A;  1NJZ A;  3V72 A;  1RXV A;  3G6X A;  4ED0 A;  5EE9 A;  2KZM A;  3NRW A;  3UQ0 A;  1EXN A;  3GV8 B;  2EAO A;  5AM0 A;  1VDV A;  2UVR A;  1DK3 A;  3Q8L A;  2ZXI A;  1JRO A;  4QIW C;  3JPQ A;  2PI4 A;  2F2A B;  1S8O A;  1X40 A;  3UMB A;  3WK7 A;  1IG6 A;  2LMR A;  2A3V A;  2FLP A;  2FI1 A;  4RNO A;  2RLT A;  3Q8K A;  4EX7 A;  3T5J A;  2HHU A;  3Q8M A;  4JUZ A;  1DK2 A;  4F5O A;  4QWA A;  3RH6 A;  1UQV A;  4BWM A;  3RFA A;  3ED5 A;  9ICJ A;  7ICO A;  4J9M A;  1QSL A;  2K4I A;  5B5E U;  2DWQ A;  4Q45 A;  1ZQH A;  4DLE A;  3C2L A;  1F5S A;  2LYB A;  5DB8 A;  2G06 A;  1FFU A;  4JV0 A;  5CA7 A;  5J0W A;  4F4Y A;  1XNS A;  5AI8 A;  5KFL A;  2E3T A;  2R18 A;  4C4T A;  2BDP A;  3U26 A;  5KFI A;  2K4E A;  2E1F A;  2HBL A;  2KTQ A;  3H7I A;  2JMG A;  2AQ0 A;  8ICE A;  3PW7 A;  1BGX T;  1ZD4 A;  3H8W A;  1FO4 A;  1ZQM A;  1M6Y A;  9ICT A;  2VIX A;  2LHT A;  2VKQ A;  4MFA A;  2KFN A;  5AM5 A;  3V6H A;  5DQI A;  2B21 A;  4U6P A;  2NO5 A;  1ZQB A;  5D46 A;  1TAQ A;  3PSI A;  5J8Y A;  4DSI A;  3NTU A;  3TKA A;  2KMD A;  3VC8 A;  4ECU A;  5ALX A;  3SV4 A;  1S9F A;  1IIP A;  5T14 A;  3RB0 A;  5J2G A;  5KFA A;  2H3Z A;  2XC9 A;  1L5U A;  4LJX A;  1XSL A;  5G5H A;  3FYH A;  4Y2T A;  1X42 A;  3LVW A;  3QU4 A;  2FE9 A;  3F2D A;  2FLL A;  1KEJ A;  2K60 A;  4UAV A;  4C4R A;  2ZJ5 A;  3PR5 B;  2KIC A;  4FZN A;  7ICP A;  5HMM A;  4EBD A;  5TIS U;  2WF7 A;  4US8 A;  4ZH4 A;  9ICI A;  1XO0 A;  5EOZ A;  4KMU A;  2ZIU B;  4DLG A;  7ICT A;  3BS5 B;  5BPC A;  4PL2 A;  3AL0 B;  3LDA A;  5ALY A;  2V4Q A;  1NK4 A;  5AM2 A;  3QUQ A;  2A1A A;  4ED8 A;  1NKC A;  3RRG A;  2VJ4 A;  2IOF A;  1NK8 A;  5KG0 A;  3K4G A;  3ETL A;  1T4G A;  3DDH A;  4Y2S A;  1ZQZ A;  1SKW A;  1V97 A;  2MA1 A;  4QNL A;  4J9P A;  5L1J A;  1N63 A;  5ALT A;  3K75 D;  1QTM A;  2ESE A;  1NK5 A;  4IRD A;  2KZZ A;  4R65 A;  5AKH A;  3RBE A;  4FE3 A;  2KHV A;  4MEX A;  2NRX A;  4KMO B;  3GV7 B;  2CN1 A;  3H8J A;  2ES6 A;  2W54 A;  4DEZ A;  8ICP A;  2JEI A;  3GDX A;  4AYB F;  1TK5 A;  3QUT A;  2ZIU A;  4CF3 A;  9ICX A;  5KFV A;  3BS5 A;  2EAP A;  2DFL A;  4DSE A;  4ZOH C;  1P7D A;  1C20 A;  4DL2 A;  1UHU A;  2ISP A;  2VJ5 A;  4O3P A;  9ICP A;  1Z4O A;  2DPI A;  4EX6 A;  2W8K A;  3ICX A;  1ZQW A;  3ZDE A;  5KFM A;  3HJE A;  2BCV A;  3FM9 A;  5ALP A;  3MGH A;  3TAC B;  1UT5 A;  2DF4 B;  4KLE A;  4J9N A;  2ZTE A;  2WF8 A;  4FO6 A;  4M9H A;  4Y2U A;  2PXI A;  5KT2 A;  4Y2V A;  4KN7 A;  5AM1 A;  2BR0 A;  4RQ5 A;  2EAM A;  5ALR A;  5ALO A;  1L3S A;  3EUB 2;  3KKA C;  4DL5 A;  3BJY A;  4QZF A;  4EYI B;  2HMX A;  3T5H A;  3PVX A;  4DL7 A;  1SL1 A;  1UA1 A;  2W11 A;  4RQ2 A;  3GV5 B;  4RQ3 A;  4XQ8 A;  8ICO A;  2JRZ A;  3L4P A;  3NUQ A;  3WK5 A;  1S10 A;  1J97 A;  2LPE A;  1Z3E B;  2WFA A;  3KD3 A;  4B6J A;  4C8L A;  5AKK A;  2A1J B;  3N7P D;  2XY7 A;  4DSJ A;  2R8H A;  2NRT A;  1ED1 A;  3ISD A;  3A0H U;  1J2N A;  4GXK A;  3G6Y A;  4BXO B;  2ZTD A;  1NK9 A;  1QLN A;  5KT3 A;  3PO5 A;  2CPR A;  1ZQS A;  2YB1 A;  5F9N A;  1BPB A;  2KEY A;  3PW4 A;  1C7Y A;  2P6R A;  3BQ1 A;  4DOA A;  4M9N A;  2KN7 A;  5ALI A;  2P35 A;  1UA0 A;  1X9W A;  3C2K A;  1OUQ A;  3JPS A;  3RJF A;  4O5E A;  2NO4 A;  1Q8K A;  2HVH A;  3E2E A;  1LVH A;  5BOM A;  2A1J A;  3PZP A;  4CDG A;  2PMZ F;  2CRX A;  5HR7 A;  4DS5 A;  1WYG A;  4F4W A;  1K1S A;  4YCX A;  2PFN A;  1N62 A;  3MR2 A;  3RB3 A;  4NLK A;  4TQR A;  2FPK A;  2ZJ8 A;  2BCR A;  2B6G A;  4BXO A;  2BPG A;  4RZR A;  8ICV A;  3WKA A;  3I1Y A;  4YR2 A;  3IRU A;  2AH5 A;  1HUO A;  3M6K A;  4Q8F A;  2HOF A;  3CP8 A;  3UMC A;  5B66 U;  5HHI A;  4B9S A;  1CEZ A;  5CR0 A;  5ALU A;  1ZQK A;  2MRL A;  8ICR A;  3PX0 A;  3UXO A;  1ZQ1 C;  2F3N A;  1SV0 C;  3CYM A;  4UB1 A;  2W9B A;  1S0O A;  4CRX A;  3MGV A;  4RQN A;  4B9L A;  2FJ6 A;  3NVV A;  4PGQ A;  2GLE A;  4ED2 A;  1DXS A;  1BPD A;  2JV3 A;  3GFK B;  2DQN B;  2DKX A;  4GC7 A;  2J6S A;  4R63 A;  4UB6 U;  5KFC A;  4UB3 A;  4P0P B;  1N5W A;  3TFR A;  2Q0Z X;  1T3Q A;  2YQE A;  4I2H A;  1KRP A;  2WF6 A;  4IR1 A;  4KX5 A;  4J9Q A;  5CP2 A;  1TFR A;  3AQF A;  4IL6 U;  5J0U A;  7ICS A;  1SKR A;  1RPL A;  4F5N A;  1TVA A;  9ICH A;  5KFP A;  5AIC A;  3CNH A;  4YN4 A;  3B9J A;  2ASJ A;  2E8O A;  4FZL A;  4PGX A;  2IHM A;  4O3S A;  5GTI U;  1UCV A;  4QWB A;  4NLN A;  4CNQ A;  4F91 B;  4J9O A;  3PML A;  1NJY A;  5IIK A;  2LM4 A;  8ICX A;  2QAR A;  3UQ2 A;  8ICM A;  3C5G A;  4F92 B;  4IQU A;  5ALD A;  4NL9 C;  1KFS A;  4YMO A;  1YT3 A;  3RJE A;  4P0P A;  2BPC A;  3Q8P B;  2M0N A;  3V7J A;  2YMM A;  5KFN A;  3IP4 B;  2K8C B;  3C5F A;  2EZY A;  4B9M A;  4DCC A;  3GQC A;  5KT5 A;  3H40 A;  2WHE A;  4M9G A;  4PHE A;  2KFZ A;  9ICN A;  3F5A A;  2WF9 A;  4Z6D A;  3ISC A;  4OJ5 A;  1H38 A;  2DL0 A;  4Z6C A;  5KFW A;  3BQ7 A;  3K1Z A;  7ICG A;  3JPP A;  4KLL A;  4B9U A;  3MAB A;  4XRH A;  1ZD3 A;  2B0C A;  4JWM A;  1NOM A;  4RNN A;  2L5Y A;  3PX4 A;  7ICU A;  2Y1I A;  5JTI A;  4P0Q B;  3T5L A;  2F44 A;  3ZD8 A;  4KLU A;  2K8A A;  5AM4 A;  1N48 A;  3Q8S B;  1TAU A;  4RQ6 A;  3BQ0 A;  1PVR A;  4MF2 A;  1SZH A;  9ICO A;  2G08 A;  3Q8Q B;  5KFG A;  4QW8 A;  1KKX A;  1Y88 A;  3C1Z A;  4ELV A;  3TAD C;  3I76 A;  2P66 A;  2QKQ A;  4DQP A;  1PZN A;  9ICE A;  2AHO B;  1L8O A;  2ZIV B;  1D8L A;  5KL8 B;  8ICZ A;  5GTH U;  3N7R C;  7ICL A;  5JU5 A;  1NJX A;  5J2J A;  5DB9 A;  2P6U A;  1MSW D;  3TFS A;  1Q3U A;  2OEH A;  1VJ5 A;  3MR6 A;  1ZQG A;  2FLN A;  4P0Q A;  8ICI A;  2J6U A;  4CF4 A;  3QUB A;  4QZE A;  5D4B A;  5KG4 A;  1LKY B;  1A76 A;  4DL6 A;  4O5C A;  2G0A A;  8ICB A;  3MR3 A;  2KVC A;  3MGI A;  2OH2 A;  1PK3 A;  3HKZ F;  5ALV A;  3RRH A;  2ZIV A;  2PFO A;  3MC1 A;  1S77 D;  2W3R A;  5A0L A;  1XSN A;  8ICL A;  2MU2 A;  5III A;  3FAH A;  2OM6 A;  5L9X A;  5AKJ A;  5KFD A;  5L1M A;  2UVU A;  4BGD A;  3PX6 A;  4ECR A;  2IA6 A;  2FPL A;  2JHD A;  4FFD A;  1L7P A;  2ZG6 A;  1V85 A;  2OYY A;  2KJ5 A;  1UPH A;  4YD1 A;  4DOB A;  5AK5 A;  1NZB A;  4ECQ A;  5AKY A;  5KNI A;  1LKY A;  3HKZ C;  1FIQ A;  5J2D A;  3OHB A;  2M9N A;  4UAT A;  4DF4 A;  7ICK A;  5AKI A;  5ALL A;  5IIO A;  4JMU A;  3IG5 A;  2W9C B;  3AU2 A;  3NAS A;  4KIT B;  4KN4 A;  4YG2 A;  1IXR A;  3SEN A;  1JIH A;  2XCP A;  2GOL A;  1NNL A;  1ZQI A;  1RZT A;  3ZD9 A;  3OTQ A;  3GIJ A;  4C7Y A;  4US9 A;  4FBT A;  4NJ8 A;  4RQ1 A;  2NV3 A;  4LVS A;  4M9J A;  5KT4 A;  4TUR A;  3ONN A;  1SB3 C;  2I5H A;  5HNK A;  2F77 X;  3ISB A;  4IQW A;  4RU9 A;  4B9V A;  2YN4 A;  4EEK A;  2XGP A;  4FBU A;  4PL1 A;  2KIV A;  7ICQ A;  3UM9 A;  5J8Y C;  1ZQX A;  1KBU A;  3WKE A;  3I28 A;  1JI7 A;  1SGG A;  5ALG A;  4O0I A;  4PHA A;  4O3O A;  9ICV A;  2LM1 A;  1K5O A;  4F2R A;  1ZQT A;  1BNP A;  4NM1 A;  2W9C A;  4PGY A;  3BZK A;  3F2B A;  1RG6 A;  4JWN A;  4RQ8 A;  2F8L A;  4NV0 A;  3TAN A;  2JGA A;  3NGD A;  2AGQ A;  4UW9 A;  5EWE A;  4C0Z A;  4DL3 A;  4QZA A;  4MFF A;  5AM3 A;  4DS4 A;  4G9B A;  5E79 U;  5J2B A;  3AUO A;  4IR9 A;  1Z19 A;  3H0M B;  1D9D A;  3FC4 A;  3TAQ A;  2W8L A;  8ICK A;  7ICF A;  1S0N A;  3PO4 A;  2C2D A;  4USA A;  5AKX A;  3AEV A;  4JK1 A;  3PY8 A;  2AJQ A;  3SI8 A;  1WUD A;  5KG6 A;  5AHX A;  5KFZ A;  2K89 A;  4LZD A;  5DB7 A;  2JEF A;  2HHQ A;  4KLM A;  3RR8 A;  4CGZ A;  2VA3 A;  7ICJ A;  1PK1 B;  1WG8 A;  3H4B A;  2JH1 A;  8ICJ A;  1LB2 B;  3QU5 A;  5KFS A;  1L3T A;  4QZC A;  3M9M B;  4F5Q A;  5CWR A;  4ICA A;  1ZQE A;  4CCH A;  4YR0 A;  3N4M B;  3R9K A;  1ZOL A;  3GII A;  4G3I A;  1O03 A;  1TK0 A;  3GIK A;  1J2M A;  1U9L A;  1NK7 A;  3ORY A;  3D2N A;  1MN8 A;  3C1Y A;  2GO7 A;  2KIW A;  4F72 A;  5KFO A;  4AYB C;  4YFK A;  4O3M A;  4I2G A;  4M0A A;  1ARO P;  5AI6 A;  1X9S A;  2WB1 F;  2XIC A;  3HRD D;  4ELU A;  4F93 B;  3C21 A;  2ZXH A;  8ICU A;  2RDI A;  1PK1 A;  3HT3 A;  5CEH A;  4KLF A;  4TUS A;  1SXE A;  2KHQ A;  5TZV A;  3UMG A;  5ALQ A;  2NRV A;  4OJP A;  1A6S A;  4GXI A;  2XCA A;  2H3V A;  4YXJ A;  1U45 A;  5AKE A;  2KK0 A;  4O9M A;  2R8G A;  3WU2 U;  3RJJ A;  3SD7 A;  1QCK A;  3TAR A;  4RQ7 A;  4GLX A;  3EWA A;  1ZQQ A;  4QWE A;  2H3Q A;  1Q3V A;  3D2Q A;  2XY6 A;  3C23 A;  3KKA A;  8ICH A;  4DSK A;  4RT3 A;  2RDJ A;  4QW9 A;  4P4M A;  2AGO A;  1XSP A;  1KTQ A;  2KV2 A;  1BPX A;  3SQI A;  2RRD A;  3T3F A;  5KFU A;  1KW4 A;  4I2E A;  5KG7 A;  2I1Q A;  1QQ5 A;  3RB4 A;  2IBK A;  1NI3 A;  2IOF K;  2MSN A;  3HX0 A;  4RPZ A;  4OJO A;  3CRX A;  3AMZ A;  2V4R A;  3OSN A;  1ZQN A;  2G09 A;  1X9X A;  4RUA A;  3BDP A;  3LVV A;  4ECZ A;  3RJH A;  4DFJ A;  4KLD A;  4PH5 A;  1S0M A;  4QZ9 A;  5L1K A;  4Y2R A;  2AU0 A;  1COK A;  3KHH A;  2G5H B;  3PSP A;  8ICG A;  5KL1 B;  1NK6 A;  5ALN A;  3T5K A;  4AP9 A;  3KZI U;  1CUK A;  3A0B U;  4NM2 A;  4C8O A;  4I2D A;  5DG7 A;  2KVS A;  4O5K A;  2NRZ A;  1ZRM A;  3UPQ A;  2ZIX B;  2ASL A;  3PSF A;  1ZJM A;  1SXD A;  2E8M A;  4HAI A;  3PW2 A;  5K4L A;  4JV2 A;  1Z1V A;  3RB6 A;  3SAG A;  1U49 A;  3GZF A;  3PNC A;  3JPN A;  4I28 A;  5DGA A;  2PMZ C;  3MDA A;  1XWL A;  2HHV A;  4QZI A;  5CRX A;  3H0R B;  3OHA A;  1V38 A;  1Z1B A;  1QSY A;  2WTF A;  2FMP A;  4IC9 A;  5J0R A;  7ICV A;  1D8B A;  2AQ4 A;  4PZO A;  4UBC A;  4YXM A;  3ZI4 A;  4BUG A;  5J2E A;  3PST A;  5KFB A;  3SYZ A;  1V9P A;  4R64 A;  2C28 A;  2ZJA A;  4I2I A;  5DLG A;  3V6K A;  1BPY A;  2WF5 A;  2DKZ A;  4GFJ A;  4PZN A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  1URJ A;  3DEE A;  3VC8 A;  2KV2 A;  3ALR A;  4FZL A;  3SQI A;  2RRD A;  2ZIV B;  2NV3 A;  3NRW A;  1IIP A;  2Z7J A;  2HBK A;  4CGZ A;  5T14 A;  3ONN A;  2KKP A;  2LYA A;  3ICX A;  5KL8 B;  3T79 A;  2N1R A;  2F77 X;  2F76 X;  2DGZ A;  3N7R C;  3PZP A;  4CDG A;  2WB1 C;  2H3Z A;  3SAH A;  4PL1 A;  4QJF B;  2JH1 A;  2YX8 A;  2E5S A;  2PMZ F;  3OPX A;  4OJO A;  2CRX A;  2ZXI A;  3CRX A;  2HBM A;  1Q3U A;  4QIW C;  5HR7 A;  1MA7 A;  3LVW A;  1DRG A;  2DF4 B;  2LKY A;  2LBO A;  2G09 A;  2F2A B;  2W7P A;  3F2D A;  4ICA A;  4KX3 A;  1KBU A;  4P0Q A;  2K4H A;  1PVQ A;  3LVV A;  2A3V A;  2Q4T A;  3RF9 A;  1YT3 A;  2BDU A;  2WAQ F;  4P0P A;  4U7C A;  2YB4 A;  2ZIX A;  2KIC A;  2M0N A;  2ZIW B;  3GU3 A;  3IP4 B;  2K8C B;  3VCB A;  4FZN A;  4BJQ A;  2RHF A;  4BX9 C;  3LYS A;  4NLC A;  3D2N A;  3M6K A;  2XVT A;  2D6F C;  1XO0 A;  2G0A A;  2G5H B;  3F2B A;  2ZIU B;  2HOF A;  1HEK A;  3CP8 A;  2JH7 A;  3PSP A;  3F5A A;  5C0Y A;  2HMX A;  4PL2 A;  3AL0 B;  2E1E A;  2HOQ A;  2KIW A;  2KVC A;  3O0F A;  3RFA A;  5KL1 B;  4OJ5 A;  2F8L A;  2OH2 A;  2KNJ A;  2KD1 A;  4AYB C;  4NV0 A;  4WJ3 B;  4O3M A;  3HKZ F;  2JGA A;  2MRL A;  2K4I A;  2Y0S F;  4OJ6 A;  3IN5 A;  3KZX A;  1ZQ1 C;  2VJ4 A;  2ZIV A;  2WB1 F;  3K1Z A;  3C29 A;  1L6N A;  3F53 A;  2XIC A;  3NUQ A;  1T94 A;  5A0L A;  2LYB A;  2RP5 A;  2ZIX B;  2W7O A;  2ZXH A;  2G06 A;  3PSF A;  3CYM A;  1HIW A;  4C0Z A;  2WAQ C;  4CRX A;  3MGV A;  4NWI A;  3C28 A;  5HR6 A;  2KHQ A;  2OM6 A;  1XNS A;  4OJP A;  2G07 A;  3N7S C;  2MA1 A;  3N7P D;  3SAG A;  4QNL A;  1A6S A;  1ECW A;  2R18 A;  3E0F A;  3GZF A;  4OO1 J;  1GO3 F;  4OJL A;  2H3V A;  2DQN B;  2JHD A;  2GH1 A;  1Z19 A;  3H0M B;  2HOI A;  2K4E A;  3D2S A;  4FE3 A;  2KHV A;  2E1F A;  2HBL A;  3H0L B;  2K8B B;  2ZG6 A;  2PMZ C;  2W03 A;  2OYY A;  2JMG A;  1UPH A;  2KJ8 A;  2KJ5 A;  2KJ9 A;  3H0R B;  4KMO B;  1ED1 A;  1Z1B A;  4P0Q B;  5CRX A;  2CN1 A;  2K8A A;  1NZB A;  3IG8 A;  1CRX A;  2ZIW A;  4IC9 A;  3SMV A;  2H3F A;  2H3I A;  3F2C A;  2HBJ A;  3AQE A;  4P0P B;  1D8B A;  3HKZ C;  2XID A;  2Y0S C;  3M7D A;  1PVP A;  1A0P A;  3M6Z A;  4QIW F;  1PVR A;  2CPR A;  4BUG A;  2H3Q A;  2YB1 A;  3D2Q A;  2OXO A;  1Q3V A;  4AYB F;  3PST A;  4KX5 A;  2KEY A;  2KKV A;  2VIX A;  2LHT A;  2VKQ A;  2ZIU A;  3IG5 A;  4JMU A;  2W04 A;  1SZH A;  2G5I B;  4FZM A;  3AQF A;  2G08 A;  1F44 A;  4U6P A;  1WUD A;  1P7D A;  3KFU F;  4NLB A;  4A8E A;  3F5E A;  2K89 A;  3L3F X;  2XI9 A;  1TAM A;  3PSI A;  2GOL A;  2KOB A;  1OUQ A;  4ACO A;  4GFJ A;  3SAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...