2WB1F

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2wb1F02
2Y0SF 2WAQF 2WB1F 3HKZF 2PMZF 4AYBF
chains in the Genus database with same CATH superfamily
9ICLA 4U7CA 1QQ7A 2MUTA 4PZOA 3RAQA 3MR6A 4J9OA 3SQIA 1DK3A 2EH9A 3SR6A 2R8KA 2PKEA 2F1JA 3NRZA 1QQ6A 3LYSA 4DLEA 5KFNA 2YMQA 2HOIA 5BPCA 5J0OA 4EELA 2WF5A 1Z1BA 3QNMA 1UT5A 4KLMA 5ALUA 4UQGA 4TURA 1X6JA 3F2DA 3WKAA 3V6HA 4QZ9A 1J97A 3ZDCA 2GWSA 1WYGA 5B66U 3PSPA 1CRXA 3H8WA 2YY6A 1ZQYA 4YXJA 4MFAA 4DOAA 2E5SA 4F91B 2K89A 4IRDA 2W3RA 3U26A 1U47A 2FLLA 4DSEA 3TAQA 2KJ8A 3FYHA 5KFXA 2NRXA 2VJ5A 8ICBA 4EZ6A 4DSFA 1D8BA 2LI6A 4RQ6A 3ETRA 1ZQXA 3RB3A 4C4RA 3BZKA 5KT6A 4YQWA 8ICIA 2E1EA 1S10A 3TADC 3GV8B 1K1SA 9ICNA 3RJGA 4UARA 5L1IA 3M7DA 4O5EA 4I29A 7ICEA 5AIAA 4XA5A 5DBAA 4KMUA 2AJQA 1MA7A 3KKAC 1NJXA 4KLIA 4DFDA 2C2EA 4Q8EA 1BNPA 1QQ5A 1DRGA 1ZQJA 4RNNA 4F4WA 2F44A 4MF2A 4I2AA 1ZQMA 5KFYA 1TK8A 2CN1A 2PFNA 2HBMA 3K75D 3UMGA 5J2CA 4NJ8A 1SWVA 3K1ZA 4YFKA 2KIVA 5ALGA 5C0YA 2KK0A 2WF8A 5KFAA 4CE6A 4Y2SA 5AI6A 4RPXA 3OPXA 3CP8A 4DOCA 1S0MA 5BOLA 7ICHA 1Z00A 4IL6U 2LPEA 5IINA 1ZQCA 5KFOA 2HSZA 3WK6A 3F53A 1QSYA 2AQ4A 1SKSA 1HJPA 5DLFA 4ECUA 2KFNA 1KEJA 4IQTA 1ZQKA 4F4YA 4QW8A 5J0YA 1N62A 2W03A 2G06A 1WG8A 3NTUA 4OJ6A 2B21A 1SV0A 2WB1C 3PR5B 5KG2A 8ICOA 2KN7A 1XWLA 4ECYA 2H5XA 4FZLA 4RQMA 1KL9A 2JH7A 4HAIA 4UB1A 2JGAA 2BGWA 1KBUA 2KICA 1N63A 1ZQHA 4RNMA 1RXVA 1ZQVA 4XQ8A 5AM2A 4QZ8A 3CRXA 2JEJA 1QCKA 3HKZC 4C7ZA 4QZDA 5KFIA 2JR5A 2AGQA 2HVHA 2Q4TA 4KX3A 3R9KA 2Y0SC 5CHGA 4FS1A 4BXOA 1UCVA 3WKEA 5AICA 5AI4A 5DQHA 4NLBA 2FMPA 3EWAA 3DDHA 4O0IA 2DPIA 4PGXA 2R8GA 2QKQA 2PFPA 2P35A 3F5AA 3KD3A 2W7OA 4YR3A 5T14A 4TQSA 2CPRA 5J2FA 5KFBA 2KTQA 3H0MB 2W7PA 8ICWA 3ORYA 5IIOA 5D49A 5DDMA 1COKA 2OH2A 3L4PA 1S8OA 1ZQPA 1Z3EB 1NK4A 1ZQQA 2W9BA 3ICXA 3EW9A 4CF5A 1SV0C 3RFAA 5ALOA 5KG1A 3HT3A 1XC9A 2HOFA 4ACOA 5J8YC 4ED0A 4ECZA 3RR8A 5AM1A 4NLZA 2A1JA 4QIWC 4ED8A 2XCAA 9ICWA 3KHHA 5KT3A 1DGSA 4PJ0U 2RHFA 7ICIA 5HR6A 5CEHA 4B9UA 2NO4A 2UVVA 1WCNA 4ZOHC 3GU3A 3PSFA 3V7JA 2IHNA 4UB4A 3QZ8A 7ICLA 2WFAA 4DF8A 2ZTEA 3EUB2 1U45A 4P4OA 2VJ4A 3UQ2A 1ZQAA 4M9LA 4JWMA 4ED2A 4Q43A 2KVSA 2Y1IA 3C5GA 3WK5A 3GIIA 2JXJA 4M47A 3PW4A 1PUZA 3ALRA 4EYIB 3PSIA 4M0AA 1Q8KA 1SZHA 2H3QA 4Y2XA 1D8YA 4OJ5A 3RF9A 2AGPA 1P7DA 4ELTA 3C1YA 1KQQA 2DL0A 5HNKA 3NGDA 2FPKA 5ALWA 2MA1A 2H3ZA 5F9NA 4JWNA 3OHAA 3QU4A 4PHDA 2ZIWB 2JV3A 5IIKA 1IXRA 1MN8A 4ECWA 1TE2A 2PMZF 5DBCA 5KFCA 8ICZA 4M04A 1BVSA 5KG3A 4US9A 3D2NA 2E8OA 2EAOA 1RXWA 3MFIA 4PGQA 2LMRA 5AI0A 3QZ7A 4ECXA 5AKGA 4DWIA 5IILA 1JIHA 2W9MA 1SGGA 3GIJA 4NL9A 2MSNA 2DGZA 1Z4NA 3C2MA 1RDFA 2ESEA 3UXOA 3T5LA 7ICVA 4RT3A 3PSTA 9ICAA 3GFKB 4KLOA 2ZUDA 2VIXA 4Y2VA 2NYVA 2KEYA 8ICRA 1NK9A 2BCUA 3NVZA 1M6YA 2KKVA 4NM2A 4I2DA 5J2IA 2K4IA 3QXGA 3C23A 5HMLA 3UQ0A 2JEFA 4K4GA 3RBEA 5CR0A 7ICGA 2XY5A 3SI8A 1SV4A 3AU2A 1YZ7A 4Z6FA 4YD2A 1S77D 2IMWP 3ZD8A 3MDCA 4C80A 3KZIU 2ZIUA 4F93B 4KX5A 4CRXA 3PY8A 3T3FA 2PFQA 9ICIA 3NRWA 5H2FU 4QZEA 2R8HA 2XY7A 2KSOA 4O3OA 4RUAA 5CJ7A 5KNIA 2RQ5A 2I6XA 4C8OA 4M9HA 1KLNA 2RP5A 1Z00B 1RYRA 4Z6EA 5F9LA 5KFQA 2YTUA 5GTIU 3MR3A 5JUMA 1ZRMA 2XC9A 4DFMA 3OJUA 2BPGA 5AKZA 3RRGA 4FBUA 1RG6A 1JI7A 5FP0A 1B43A 1YZ6A 4BJQA 4JB3A 4O3NA 4NL9C 3ZI4A 5ALZA 4J9QA 4KLHA 3E58A 4P2HA 1C7YA 4QZGA 2B0CA 1GO3F 2YMLA 1LVHA 2FLNA 2G09A 2JHDA 4J9LA 1SKWA 3G6XA 4O3QA 5ALEA 3ONNA 3LDAA 5AM0A 4I2BA 3UXPA 3B9JA 1JN3A 3NVVA 3QEAZ 4Y2UA 4R63A 1NK5A 3ZDAA 2M0NA 2K8CB 2Y9UA 3H0LB 1D8LA 3A0HU 1JMSA 5F3XB 4M9GA 4F5NA 4JV2A 4AYBC 1ZQUA 4I2CA 4DOBA 2GLEA 2OCEA 1N5WA 2E1FA 2I9GA 3JPNA 5EWFA 5L1JA 2HBJA 2NO5A 5J0SA 3QU9A 5KFFA 1KSPA 9ICVA 5KG5A 1DXSA 4BXOB 9ICPA 2W9AA 2VKQA 5KFJA 2QARA 9ICBA 7ICMA 5J2HA 4DQSA 1D9FA 4DL7A 1JRPA 2V4RA 9ICKA 4DL4A 2ISPA 5BOMA 1CUKA 3WK9A 1XS9D 4LJXA 2EZZA 3D6JA 4M6WA 2J6TA 2W55A 3N7SC 3V7KA 1MSWD 1V97A 1ZQGA 2KG5A 1BPEA 2PI4A 2N1RA 4RPYA 5IIMA 2BZFA 4B9MA 5KG4A 4O3MA 3F5EA 1NK6A 4J9NA 2K8AA 1UHUA 1IV8A 4EENA 4B9VA 2W9BB 4DL2A 1J2NA 2EANA 5KFMA 2DWQA 4C7YA 2OHFA 4RQ8A 8ICHA 9ICTA 2HOQA 4U6PA 3JPQA 3MFHA 5K4LA 3TACB 3N28A 3TADA 4BUGA 3HX0A 4DCCA 3PX4A 4LZGA 2KHQA 2HHQA 4GXJA 1BPZA 3JPPA 4DFPA 4F5QA 2HHUA 4F4ZA 2JEIA 3V7LA 4OJLA 2EQYA 2BPFA 2KVCA 3HILA 2ZJ8A 4OJPA 1ZD3A 2F3NA 4PHAA 3KKAA 5AKKA 3FM9A 1HUOA 1X40A 2KOBA 2F8LA 1F44A 5KAFU 2HHTA 3TI0A 2ZJ5A 5HMMA 2I5HA 5DB8A 1BNOA 1Z4OA 5E79U 4FZNA 2RRDA 2VA2A 3Q8LA 1VJ5A 4GFJA 1T3QA 3AQFA 3C1ZA 3BQ2A 4B9TA 2W8KA 3LWLA 2EDUA 2YN4A 3C5FA 2J6SA 4I2JA 3TFRA 4EBEA 2KNJA 1NKCA 4MEXA 2F8KA 4C8NA 4IQVA 7ICNA 4P4PA 4QZBA 1N60A 2XO7A 5DLGA 3M1YA 1HEKA 3AQEA 5AI8A 1XU4A 3OSPA 4MFFA 3IN5A 4OO1J 4EEYA 3MABA 3T5JA 3OJSA 1Q3VA 2XGPA 4KN4A 1F5SA 4YXMA 4IRCA 4F2RA 2YQEA 4G9BA 5DGAA 1SKRA 1NZBA 1ZQEA 2ZXHA 3RTVA 2ZUBA 2W11A 2F1IA 2OM6A 5EWEA 1UPHA 3MBYA 1PK1A 4UB6U 5CB1A 1OW5A 1Z19A 5J2DA 4PHPA 1URJA 2ZG6A 4TUSA 1XSLA 3TQ1A 5DQGA 3BDPA 3PX0A 4I2HA 1LKYA 1NK8A 1WWVA 2KP7A 1L7MA 3BQ7A 1ZQLA 2RLTA 4M2YA 4DO9A 1QLNA 3RB6A 5CP2A 2H3IA 4RQ5A 4IR1A 2G08A 4DL5A 3RJFA 4QZHA 3RH5A 3WKBA 3RJKA 2KSOB 8ICEA 2DFLA 4YD1A 2JRZA 3AUOA 5AK5A 5ALJA 4KLUA 1S0NA 2IBKA 9ICGA 1ZQTA 1COOA 2HVIA 8ICLA 1T3NA 8ICCA 3KOOA 3SMVA 3WU2U 5EE1A 2NV3A 2JH1A 4C0ZA 2NRZA 4BWMA 5J8YA 2K4PA 5A0LA 1NK0A 3PNCA 4Y2JA 4PZNA 4FBTA 4Z6DA 2ZIVA 3RJIA 1TKDA 1Z1VA 3H0RB 3I1YA 5GTHU 7ICSA 3RJJA 1WUDA 4PPXA 3PMLA 2FE9A 1X42A 1MC8A 5ALVA 2CXYA 2WAQC 5AI5A 2NRWA 4I2GA 3T79A 4DFKA 3WKDA 1QH9A 8ICKA 4GC6A 1CEZA 4YN4A 3ISDA 2FPLA 5KL8B 4UB2A 3QEBZ 2QB0A 4E0DA 3PR4A 4XRHA 5CA7A 2IOFK 4J9RA 4EYHB 4R64A 5DDYA 3RH6A 4UAUA 5J0XA 4KTQA 2QARB 7ICKA 4YG2A 2WTFA 2XI9A 1S0VA 4NLNA 4UW9A 4DEZA 4Z6CA 2RDJA 5KT7A 3OTQA 3L3FX 3MGVA 4C8LA 2D6FC 1D9DA 3N97B 4M6WB 3GDXA 3Q8SB 5KFSA 8ICAA 2HDOA 1ZQRA 1SZPA 5B5EU 4P0PA 1ZD2P 9ICRA 2WB1F 4P0QA 1AROP 2G5HB 3RB4A 1T8EA 1NI3A 1ZD4A 4DS5A 3SAGA 3C2LA 2XVTA 4QWCA 3LWMA 3ISCA 1SXDA 2ZIXA 4NLKA 3HKZF 3F2BA 3V6KA 4ECQA 2D8CA 1ED1A 4DFJA 2ZTDA 4C8KA 2Y0SF 4DLGA 2Z7JA 3K4GA 2EZYA 1S9FA 3B0XA 2MUTB 5KFKA 4B9NA 2NRVA 3Q8QB 4B9SA 3KHGA 5J2BA 4IS7A 2LKYA 2OEHA 5ALIA 3VC8A 3QE9Y 1RQNA 4CDGA 4ED6A 1V9PA 2GO7A 3TANA 2DKZA 5AKLA 4ECTA 3TAPA 3Q8KA 2ZTCA 1ZYQA 1WWUA 5KG0A 5EE9A 2C2RA 1PK3A 5KFEA 4I27A 1KFDA 4KLGA 4Y2TA 3RRHA 2BQUA 4F92B 2ZJAA 4MEYA 3M9OB 1H38A 3Q8RB 2NRTA 5DB7A 2BQRA 2K4HA 3ISBA 4RQ7A 1UA1A 3BQ0A 1QTMA 1ZOLA 3HW8A 4AP9A 2FMSA 2KFZA 5KG6A 3E0FA 2HHWA 3AEVA 4DQRA 3H8SA 4QIWF 1S76D 3TFSA 1MQ3A 2KZ3A 2XIDA 2AHOB 4CGZA 2BKEA 1Y88A 5CRXA 4UBCA 4DL6A 2Y9TA 2IA6A 3G6YA 5ALKA 1B0XA 4RPZA 1VDVA 7ICOA 2A1AA 2HCFA 1N61A 1L7OA 1X9MA 2DUYA 3AU6A 1V85A 3D2SA 1Q46A 4XUSA 5KFLA 2BPCA 4UAYA 1PK1B 2KJ9A 3KTQA 1AQ6A 2HMXA 1U4BA 5ALXA 3S6JA 3BJYA 2EZXA 5KTQA 5DKWA 3ZD9A 4F50A 3BS5A 2WF7A 4ECSA 1LKYB 7ICTA 3JPOA 2KIWA 4C4SA 4IRKA 5EOZA 2DBYA 2AXTU 4Q8FA 5ALMA 1NKEA 5DGBA 3SYZA 3QUBA 1KN5A 2XCPA 1RYSA 4ELUA 2KV2A 9ICHA 2YX8A 8ICYA 3RH4A 3M9MB 4FE3A 1WCLA 3WK4A 4F2SA 3EPIA 4B9LA 1ZQDA 5J0QA 2LM4A 1T4GA 5G5HA 3VCBA 3ZDEA 1DGJA 3SAFA 2WF6A 1L5UA 3I28A 2GOLA 1X6IA 4NXZA 1N48A 4NLCA 1X66A 4JMUA 2YMPA 2PI5A 2EAPA 2K8BB 5J2AA 4QZFA 3SV3A 2IOHA 2ZIVB 1B4FA 2E3TA 4IC9A 4JK1A 5J0RA 5KAIU 5J2KA 3N7PD 5JRTA 4F5RA 4ELVA 1PZNA 2D3DA 4IQWA 2LM1A 5CWRA 4YMOA 2B6GA 1NKBA 2CRXA 1JUDA 5ALFA 1ZRNA 2K4EA 2WF9A 4UB5A 4R8UA 2FI1A 2QB0B 4KLTA 4QW9A 5AKYA 1A76A 4I2IA 2OXOA 1QSLA 1IG6A 4EX6A 4RQ1A 5EE0A 1TAMA 2L5YA 4QWEA 3NVWA 4JV0A 4IR9A 1KTQA 3MC1A 2FJ6A 1XNSA 4Y2YA 4NM1A 3D2QA 1SIJA 1XSNA 2P6RA 4FZMA 5J2EA 2JMGA 4MFCA 2A19A 5EE3A 4KLLA 4DQQA 1ZETA 3SD7A 2ATLA 1TK5A 2BDUA 4RQ4A 1IM4A 3LVWA 3HRDD 8ICFA 2KZZA 5IIJA 1ZQ1C 2I1QA 1DK2A 4P0QB 4FO6A 4NLGA 5EWGA 5J0PA 5J0TA 1N56A 4HYKA 2IOFA 9ICOA 7ICQA 5AKJA 5AM4A 2ZIXB 2LYAA 2A1JB 5JTIA 4KLSA 8ICMA 3NASA 4O3PA 8ICPA 4ICAA 4CCHA 5DG8A 4G3IA 4KLEA 8ICVA 3WKCA 1ZQSA 3TKAA 4ZH4A 2FDRA 4QZAA 2LYBA 2FLPA 4RQ0A 4I28A 9ICCA 4UBBA 4J9SA 1NZPA 1L8LA 1ZD5A 1DOQA 2FMQA 3RBDA 4NWIA 5AM5A 4QWBA 2G5IB 1TK0A 4UASA 2M9NA 5L9XA 1KW4A 1L3VA 3GILA 1J2MA 3SENA 4YMMA 3C29A 5KT2A 4ED3A 3UXNA 2ALZA 2ASDA 1ZQOA 1S5LU 4KN7A 3BQTA 1X9WA 4KLFA 1L6NA 1OUQA 5KT5A 4WJ3B 3V6JA 4UAWA 2VA8A 3QUCA 2KZMA 1A77A 2H3VA 2KE7A 5KL1B 5DB6A 2ZIWA 4LZDA 2MRLA 2C2DA 1L7PA 1K1QA 1RQLA 9ICJA 4RZRA 2C22A 4YCXA 3KHLA 2PXIA 3V72A 1BPXA 5L1KA 2YB4A 4DSKA 1TAQA 2G0AA 2UVUA 2W8LA 3M6KA 5KFWA 3M9NB 3JPTA 7ICRA 2ES6A 4A8EA 3PZPA 1S97A 2P66A 5HR7A 2DPJA 4JV1A 1F0MA 5ALSA 3JPSA 3QUTA 3RR7A 3DV9A 5AHXA 4Y2RA 5DQIA 4PH5A 5AK6A 5ALRA 5AKIA 3PVXA 3LK9A 2W04A 4NV0A 3C28A 3EYZA 3THVA 3H7IA 2JZBA 3PW0A 5KFZA 3BS5B 7ICPA 4YR2A 2ZIUB 4ECRA 2BCVA 3E2EA 2E8MA 8ICUA 2BHNA 1EXNA 3RJEA 2R18A 3Q8MA 2VA3A 2F2AB 4F3OA 4OCZA 5C5JA 2KKPA 5KT4A 4RUCA 4F8RA 5AIBA 3G6VA 2V4QA 4NY8A 1BPDA 4YP3A 3KFUF 2FPMA 3F2CA 3UMBA 4YR0A 3GQCA 1XSPA 1FFVA 1A6SA 3PO5A 4USAA 5KFVA 9ICXA 4O5KA 2W9CA 3N4MB 1BPYA 1UA0A 2AH5A 1VLBA 3GIKA 2IHMA 2F77X 1XO1A 4R65A 1NJYA 5JU5A 2UVWA 2DKXA 1SL1A 3MGIA 3PW5A 2E8NA 4YMNA 8ICJA 3JPRA 5ALNA 3T5HA 1HIWA 3GV7B 1V38A 4PL1A 4PL2A 3NUQA 3IRUA 1YT3A 4R8UB 1L3SA 1L3UA 3GZFA 2HW3A 2W3SA 5ALLA 5KFDA 3PW2A 3AMZA 4J03A 4X5VA 4C4TA 4P4MA 5TZVA 8ICNA 4Y2QA 4DSJA 3B0YA 4J9PA 1ZQNA 1TAUA 2DQNB 2O6KA 2AU0A 3QU7A 2P6UA 4RT2A 3ZDDA 3BS7A 4F71A 1PVQA 2W43A 2WHEA 4CF3A 4GXIA 1OXJA 2XICA 1U9LA 4J9KA 3H40A 3BQ1A 3WK7A 5J29A 3ZDBA 5KFHA 2BCSA 3HWTA 4KLDA 2YB1A 1JROA 3A0BU 3GV5B 2R8IA 5ALTA 3KBBA 3SZ2A 7ICFA 3IG5A 5DBBA 1TFRA 1FIQA 5ALYA 5AK4A 3IV6A 3J81j 2WAQF 3MDAA 3MR2A 1FO4A 4QNLA 3HJEA 1IIPA 4M9NA 3ED5A 1SXEA 3RJHA 1ZQZA 1X9XA 3UPQA 4EBDA 9ICEA 4YVZA 5AKHA 5KG7A 3EPGA 2PMZC 1BGXT 4K4HA 3FAHA 2C28A 4O3RA 4IQUA 5AI9A 1RZTA 5DG7A 4QWDA 1O03A 8ICTA 3AM9A 1ZXIA 4BWJA 1SL2A 4O3SA 3M8SA 2AGOA 2MAXA 9ICUA 2ZUCA 3AL0B 3IDWA 1JXEA 4QZIA 2ASJA 3TARA 2HHSA 5J0UA 5AK3A 1RYUA 1NJWA 3N7RC 1HUZA 1SWWA 1KKXA 5L1LA 1U48A 1ZQWA 2VANA 3NS1A 3QX7A 2XGQA 1RPLA 4ED1A 1L3TA 1T7PA 5TISU 5KFUA 1MQ2A 4FFDA 2LBOA 4RQ3A 3LVVA 2KMDA 7ICJA 4GLXA 3PV8A 2Y1JA 3HPOA 3QYPA 1C20A 4Q44A 5KFGA 3RB0A 3FDSA 5AM3A 5ALQA 1LB2B 1JX4A 1KDHA 3UM9A 9ICQA 2RDIA 1TVAA 8ICQA 4JUZA 5HP4A 4DF4A 2KD1A 3T5KA 5HHIA 2BDPA 2MU2A 2A3VA 5AKXA 1NJZA 2BR0A 1T94A 4BX9C 3PO4A 3FC4A 2LHTA 4GXKA 2KJ5A 4QJFB 4Y2PA 2F76X 5J2GA 2ASLA 4QZCA 2EAMA 5ALHA 2HBLA 1NOMA 3K1RB 3ETLA 4OJOA 3WK8A 2YMMA 2KHVA 1ZQFA 3DEEA 3I76A 4DQIA 1ZQBA 3QUQA 1O08A 3SAHA 1NK7A 2JZBB 2GH1A 5ALPA 4GC7A 3SV4A 1PVRA 4R66A 8ICSA 1ECWA 1N2XA 2HI0A 4DSLA 4TUPA 4I2FA 4UATA 4UAVA 4LVSA 1FFUA 1UQVA 2XY6A 3H8JA 3IHQB 8ICGA 1KRPA 4DS4A 2BQ3A 1CI4A 3H4DA 4F5OA 4F5PA 3NVYA 4QWAA 1RM6C 1X2IA 4UB3A 2HHVA 3EZ5A 1KFTA 2J6UA 3IM1A 1JALA 4EBCA 8ICXA 1TV9A 4BDPA 2G07A 3GIMA 2ISOA 4CNQA 3OHBA 1ZJNA 3CYMA 3SEIA 3PX6A 4K4IA 5KFRA 5IIIA 2W9CB 4UB8U 1SL0A 3H4BA 3RAXA 1A0PA 4F72A 2F1HA 2W54A 4EZ9A 4F4KA 9ICFA 4EX7A 1FEZA 1N5XA 3HP6A 4Q45A 4J9MA 4MHVA 1UT8A 5AKEA 4US8A 1XO0A 2BCQA 1Q3UA 3O0FA 4DSIA 1NNLA 4OD0A 4UAZA 3M6ZA 4EEKA 5KFPA 4TQRA 4O9MA 5HHHA 2BCRA 2ODGA 4KLQA 3QU5A 3OSNA 4RNOA 4KLJA 2Q0ZX 4RU9A 2LYHA 4MF8A 4ED7A 1U49A 2E8PA 2QLTA 3H8MA 4BGDA 3OGUA 4ECVA 7ICUA 3UMCA 3PW7A 5KFTA 3KZXA 3C21A 1ZJMA 1PVPA 3C2KA 3IG8A 1S0OA 4TUQA 4PGYA 3Q8PB 1L8OA 4O5CA 4P0PB 2HHXA 1ZQIA 4GIBA 1L7NA 3QU2A 2V9WA 2H3FA 4RQ2A 4FS2A 4I2EA 3CW2C 1KFSA 1K5OA 3MR5A 4RQNA 2JEGA 1B22A 1SB3C 2K60A 5ALDA 3IP4B 5G5GA 3PMNA 3L5KA 3KHRA 3AN1A 5D4BA 2OYYA 4AYBF 4F4XA 2UVRA 9ICMA 4KMOB 2OWOA 2QB1A 5DB9A 5J0WA 3M8RA 4C8MA 3BZCA 4CF4A 2R8JA 2AQ0A 4DQPA 5L1MA 4M9JA 4B6JA 4KITB 4PHEA 1X9SA 2DF4B 5J2JA 4DL3A 1QSSA 2PFOA 1LV5A 3CNHA 3MGHA 1BPBA 2HBKA 5DG9A 1JXLA 9ICSA 5D46A 2ZXIA
chains in the Genus database with same CATH topology
2KD1A 4NLBA 4U7CA 2A3VA 2WAQF 3D2QA 1L6NA 1Q3VA 1OUQA 1MA7A 2LKYA 2WAQC 4FZMA 3VC8A 1T94A 4BX9C 4QNLA 2RP5A 3T79A 3KFUF 4WJ3B 4CDGA 1XO0A 2JMGA 1IIPA 2LHTA 2KIWA 3SQIA 2MA1A 2H3ZA 3F5AA 3O0FA 3F2CA 1Q3UA 1DRGA 2W7OA 2ZIWB 2KJ5A 3M6ZA 4QJFB 2F76X 1NZBA 2H3VA 2HOQA 5KL1B 4OO1J 5KL8B 2ZXHA 4U6PA 1A6SA 2HBLA 2PMZF 5T14A 2ZIWA 2CPRA 2MRLA 2OM6A 2PMZC 4OJOA 2BDUA 3LVWA 1UPHA 2CN1A 3LYSA 4BJQA 2KV2A 2HBMA 3H0MB 2W7PA 2YX8A 4BUGA 2KHVA 3K1ZA 1ZQ1C 2HOIA 3D2NA 2F77X 2OH2A 3DEEA 1Z19A 4P0QB 5C0YA 1GO3F 2K4HA 2KHQA 1URJA 2G09A 2JHDA 2YB4A 2ZG6A 4FE3A 3SAHA 1Z1BA 3ONNA 2XI9A 2G0AA 3OPXA 3CP8A 3M6KA 2GH1A 4OJLA 2KVCA 3KZXA 2DGZA 3ICXA 1PVRA 2M0NA 2K8CB 1ECWA 4OJPA 3L3FX 3VCBA 4A8EA 3F2DA 3H0LB 3PZPA 1PVPA 3MGVA 3AL0B 3E0FA 3F53A 3IG8A 5HR7A 1HIWA 3SAFA 2ZIXB 2LYAA 3PSTA 4PL1A 3RFAA 2D6FC 4PL2A 3NUQA 2HOFA 4ACOA 2GOLA 4P0PB 1YT3A 3PSPA 2KOBA 1CRXA 4ICAA 2F8LA 4NLCA 4QIWF 4AYBC 4JMUA 2VIXA 4QIWC 1F44A 3GZFA 2E1FA 2H3IA 2XIDA 2W03A 2KEYA 2G06A 2HBJA 3N7RC 2G08A 2H3FA 4P0PA 2E5SA 4CGZA 2K8BB 2WB1F 2K89A 4OJ6A 5HR6A 2RHFA 2WB1C 4P0QA 2W04A 2VKQA 2G5HB 2ZIVB 4FZNA 2KKVA 2RRDA 4FZLA 5CRXA 4GFJA 2JH7A 4NV0A 4IC9A 2KJ8A 2K4IA 3C28A 3AQFA 3GU3A 3IP4B 2LYBA 3PSFA 3N7PD 2DQNB 2JGAA 2VJ5A 3SAGA 2XVTA 1KBUA 2KICA 2LBOA 1D8BA 2OYYA 3LVVA 4AYBF 2VJ4A 1PVQA 2CRXA 2ZIUB 2ZIXA 4KMOB 3HKZF 2XICA 4NWIA 2G5IB 3F2BA 3CRXA 2K4EA 2G07A 3HKZC 1ED1A 3N7SC 3SMVA 3CYMA 2E1EA 2KNJA 2R18A 2ZIUA 3D2SA 2NV3A 2JH1A 4KX5A 4C0ZA 2YB1A 4CRXA 2OXOA 3ALRA 3C29A 2Q4TA 2Y0SF 2N1RA 4KX3A 2Z7JA 3M7DA 3PSIA 2Y0SC 5A0LA 1A0PA 2DF4B 3NRWA 1TAMA 1SZHA 4O3MA 2H3QA 3F5EA 1HEKA 2KJ9A 2F2AB 4OJ5A 2ZIVA 3RF9A 2HBKA 2HMXA 2KKPA 3H0RB 1P7DA 3AQEA 2K8AA 3IG5A 1WUDA 3IN5A 1XNSA 2ZXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  2WAQ F;  2WB1 F;  3HKZ F;  2PMZ F;  4AYB F; 
#chains in the Genus database with same CATH topology
 9ICL A;  4U7C A;  1QQ7 A;  2MUT A;  4PZO A;  3RAQ A;  3MR6 A;  4J9O A;  3SQI A;  1DK3 A;  2EH9 A;  3SR6 A;  2R8K A;  2PKE A;  2F1J A;  3NRZ A;  1QQ6 A;  3LYS A;  4DLE A;  5KFN A;  2YMQ A;  2HOI A;  5BPC A;  5J0O A;  4EEL A;  2WF5 A;  1Z1B A;  3QNM A;  1UT5 A;  4KLM A;  5ALU A;  4UQG A;  4TUR A;  1X6J A;  3F2D A;  3WKA A;  3V6H A;  4QZ9 A;  1J97 A;  3ZDC A;  2GWS A;  1WYG A;  5B66 U;  3PSP A;  1CRX A;  3H8W A;  2YY6 A;  1ZQY A;  4YXJ A;  4MFA A;  4DOA A;  2E5S A;  4F91 B;  2K89 A;  4IRD A;  2W3R A;  3U26 A;  1U47 A;  2FLL A;  4DSE A;  3TAQ A;  2KJ8 A;  3FYH A;  5KFX A;  2NRX A;  2VJ5 A;  8ICB A;  4EZ6 A;  4DSF A;  1D8B A;  2LI6 A;  4RQ6 A;  3ETR A;  1ZQX A;  3RB3 A;  4C4R A;  3BZK A;  5KT6 A;  4YQW A;  8ICI A;  2E1E A;  1S10 A;  3TAD C;  3GV8 B;  1K1S A;  9ICN A;  3RJG A;  4UAR A;  5L1I A;  3M7D A;  4O5E A;  4I29 A;  7ICE A;  5AIA A;  4XA5 A;  5DBA A;  4KMU A;  2AJQ A;  1MA7 A;  3KKA C;  1NJX A;  4KLI A;  4DFD A;  2C2E A;  4Q8E A;  1BNP A;  1QQ5 A;  1DRG A;  1ZQJ A;  4RNN A;  4F4W A;  2F44 A;  4MF2 A;  4I2A A;  1ZQM A;  5KFY A;  1TK8 A;  2CN1 A;  2PFN A;  2HBM A;  3K75 D;  3UMG A;  5J2C A;  4NJ8 A;  1SWV A;  3K1Z A;  4YFK A;  2KIV A;  5ALG A;  5C0Y A;  2KK0 A;  2WF8 A;  5KFA A;  4CE6 A;  4Y2S A;  5AI6 A;  4RPX A;  3OPX A;  3CP8 A;  4DOC A;  1S0M A;  5BOL A;  7ICH A;  1Z00 A;  4IL6 U;  2LPE A;  5IIN A;  1ZQC A;  5KFO A;  2HSZ A;  3WK6 A;  3F53 A;  1QSY A;  2AQ4 A;  1SKS A;  1HJP A;  5DLF A;  4ECU A;  2KFN A;  1KEJ A;  4IQT A;  1ZQK A;  4F4Y A;  4QW8 A;  5J0Y A;  1N62 A;  2W03 A;  2G06 A;  1WG8 A;  3NTU A;  4OJ6 A;  2B21 A;  1SV0 A;  2WB1 C;  3PR5 B;  5KG2 A;  8ICO A;  2KN7 A;  1XWL A;  4ECY A;  2H5X A;  4FZL A;  4RQM A;  1KL9 A;  2JH7 A;  4HAI A;  4UB1 A;  2JGA A;  2BGW A;  1KBU A;  2KIC A;  1N63 A;  1ZQH A;  4RNM A;  1RXV A;  1ZQV A;  4XQ8 A;  5AM2 A;  4QZ8 A;  3CRX A;  2JEJ A;  1QCK A;  3HKZ C;  4C7Z A;  4QZD A;  5KFI A;  2JR5 A;  2AGQ A;  2HVH A;  2Q4T A;  4KX3 A;  3R9K A;  2Y0S C;  5CHG A;  4FS1 A;  4BXO A;  1UCV A;  3WKE A;  5AIC A;  5AI4 A;  5DQH A;  4NLB A;  2FMP A;  3EWA A;  3DDH A;  4O0I A;  2DPI A;  4PGX A;  2R8G A;  2QKQ A;  2PFP A;  2P35 A;  3F5A A;  3KD3 A;  2W7O A;  4YR3 A;  5T14 A;  4TQS A;  2CPR A;  5J2F A;  5KFB A;  2KTQ A;  3H0M B;  2W7P A;  8ICW A;  3ORY A;  5IIO A;  5D49 A;  5DDM A;  1COK A;  2OH2 A;  3L4P A;  1S8O A;  1ZQP A;  1Z3E B;  1NK4 A;  1ZQQ A;  2W9B A;  3ICX A;  3EW9 A;  4CF5 A;  1SV0 C;  3RFA A;  5ALO A;  5KG1 A;  3HT3 A;  1XC9 A;  2HOF A;  4ACO A;  5J8Y C;  4ED0 A;  4ECZ A;  3RR8 A;  5AM1 A;  4NLZ A;  2A1J A;  4QIW C;  4ED8 A;  2XCA A;  9ICW A;  3KHH A;  5KT3 A;  1DGS A;  4PJ0 U;  2RHF A;  7ICI A;  5HR6 A;  5CEH A;  4B9U A;  2NO4 A;  2UVV A;  1WCN A;  4ZOH C;  3GU3 A;  3PSF A;  3V7J A;  2IHN A;  4UB4 A;  3QZ8 A;  7ICL A;  2WFA A;  4DF8 A;  2ZTE A;  3EUB 2;  1U45 A;  4P4O A;  2VJ4 A;  3UQ2 A;  1ZQA A;  4M9L A;  4JWM A;  4ED2 A;  4Q43 A;  2KVS A;  2Y1I A;  3C5G A;  3WK5 A;  3GII A;  2JXJ A;  4M47 A;  3PW4 A;  1PUZ A;  3ALR A;  4EYI B;  3PSI A;  4M0A A;  1Q8K A;  1SZH A;  2H3Q A;  4Y2X A;  1D8Y A;  4OJ5 A;  3RF9 A;  2AGP A;  1P7D A;  4ELT A;  3C1Y A;  1KQQ A;  2DL0 A;  5HNK A;  3NGD A;  2FPK A;  5ALW A;  2MA1 A;  2H3Z A;  5F9N A;  4JWN A;  3OHA A;  3QU4 A;  4PHD A;  2ZIW B;  2JV3 A;  5IIK A;  1IXR A;  1MN8 A;  4ECW A;  1TE2 A;  2PMZ F;  5DBC A;  5KFC A;  8ICZ A;  4M04 A;  1BVS A;  5KG3 A;  4US9 A;  3D2N A;  2E8O A;  2EAO A;  1RXW A;  3MFI A;  4PGQ A;  2LMR A;  5AI0 A;  3QZ7 A;  4ECX A;  5AKG A;  4DWI A;  5IIL A;  1JIH A;  2W9M A;  1SGG A;  3GIJ A;  4NL9 A;  2MSN A;  2DGZ A;  1Z4N A;  3C2M A;  1RDF A;  2ESE A;  3UXO A;  3T5L A;  7ICV A;  4RT3 A;  3PST A;  9ICA A;  3GFK B;  4KLO A;  2ZUD A;  2VIX A;  4Y2V A;  2NYV A;  2KEY A;  8ICR A;  1NK9 A;  2BCU A;  3NVZ A;  1M6Y A;  2KKV A;  4NM2 A;  4I2D A;  5J2I A;  2K4I A;  3QXG A;  3C23 A;  5HML A;  3UQ0 A;  2JEF A;  4K4G A;  3RBE A;  5CR0 A;  7ICG A;  2XY5 A;  3SI8 A;  1SV4 A;  3AU2 A;  1YZ7 A;  4Z6F A;  4YD2 A;  1S77 D;  2IMW P;  3ZD8 A;  3MDC A;  4C80 A;  3KZI U;  2ZIU A;  4F93 B;  4KX5 A;  4CRX A;  3PY8 A;  3T3F A;  2PFQ A;  9ICI A;  3NRW A;  5H2F U;  4QZE A;  2R8H A;  2XY7 A;  2KSO A;  4O3O A;  4RUA A;  5CJ7 A;  5KNI A;  2RQ5 A;  2I6X A;  4C8O A;  4M9H A;  1KLN A;  2RP5 A;  1Z00 B;  1RYR A;  4Z6E A;  5F9L A;  5KFQ A;  2YTU A;  5GTI U;  3MR3 A;  5JUM A;  1ZRM A;  2XC9 A;  4DFM A;  3OJU A;  2BPG A;  5AKZ A;  3RRG A;  4FBU A;  1RG6 A;  1JI7 A;  5FP0 A;  1B43 A;  1YZ6 A;  4BJQ A;  4JB3 A;  4O3N A;  4NL9 C;  3ZI4 A;  5ALZ A;  4J9Q A;  4KLH A;  3E58 A;  4P2H A;  1C7Y A;  4QZG A;  2B0C A;  1GO3 F;  2YML A;  1LVH A;  2FLN A;  2G09 A;  2JHD A;  4J9L A;  1SKW A;  3G6X A;  4O3Q A;  5ALE A;  3ONN A;  3LDA A;  5AM0 A;  4I2B A;  3UXP A;  3B9J A;  1JN3 A;  3NVV A;  3QEA Z;  4Y2U A;  4R63 A;  1NK5 A;  3ZDA A;  2M0N A;  2K8C B;  2Y9U A;  3H0L B;  1D8L A;  3A0H U;  1JMS A;  5F3X B;  4M9G A;  4F5N A;  4JV2 A;  4AYB C;  1ZQU A;  4I2C A;  4DOB A;  2GLE A;  2OCE A;  1N5W A;  2E1F A;  2I9G A;  3JPN A;  5EWF A;  5L1J A;  2HBJ A;  2NO5 A;  5J0S A;  3QU9 A;  5KFF A;  1KSP A;  9ICV A;  5KG5 A;  1DXS A;  4BXO B;  9ICP A;  2W9A A;  2VKQ A;  5KFJ A;  2QAR A;  9ICB A;  7ICM A;  5J2H A;  4DQS A;  1D9F A;  4DL7 A;  1JRP A;  2V4R A;  9ICK A;  4DL4 A;  2ISP A;  5BOM A;  1CUK A;  3WK9 A;  1XS9 D;  4LJX A;  2EZZ A;  3D6J A;  4M6W A;  2J6T A;  2W55 A;  3N7S C;  3V7K A;  1MSW D;  1V97 A;  1ZQG A;  2KG5 A;  1BPE A;  2PI4 A;  2N1R A;  4RPY A;  5IIM A;  2BZF A;  4B9M A;  5KG4 A;  4O3M A;  3F5E A;  1NK6 A;  4J9N A;  2K8A A;  1UHU A;  1IV8 A;  4EEN A;  4B9V A;  2W9B B;  4DL2 A;  1J2N A;  2EAN A;  5KFM A;  2DWQ A;  4C7Y A;  2OHF A;  4RQ8 A;  8ICH A;  9ICT A;  2HOQ A;  4U6P A;  3JPQ A;  3MFH A;  5K4L A;  3TAC B;  3N28 A;  3TAD A;  4BUG A;  3HX0 A;  4DCC A;  3PX4 A;  4LZG A;  2KHQ A;  2HHQ A;  4GXJ A;  1BPZ A;  3JPP A;  4DFP A;  4F5Q A;  2HHU A;  4F4Z A;  2JEI A;  3V7L A;  4OJL A;  2EQY A;  2BPF A;  2KVC A;  3HIL A;  2ZJ8 A;  4OJP A;  1ZD3 A;  2F3N A;  4PHA A;  3KKA A;  5AKK A;  3FM9 A;  1HUO A;  1X40 A;  2KOB A;  2F8L A;  1F44 A;  5KAF U;  2HHT A;  3TI0 A;  2ZJ5 A;  5HMM A;  2I5H A;  5DB8 A;  1BNO A;  1Z4O A;  5E79 U;  4FZN A;  2RRD A;  2VA2 A;  3Q8L A;  1VJ5 A;  4GFJ A;  1T3Q A;  3AQF A;  3C1Z A;  3BQ2 A;  4B9T A;  2W8K A;  3LWL A;  2EDU A;  2YN4 A;  3C5F A;  2J6S A;  4I2J A;  3TFR A;  4EBE A;  2KNJ A;  1NKC A;  4MEX A;  2F8K A;  4C8N A;  4IQV A;  7ICN A;  4P4P A;  4QZB A;  1N60 A;  2XO7 A;  5DLG A;  3M1Y A;  1HEK A;  3AQE A;  5AI8 A;  1XU4 A;  3OSP A;  4MFF A;  3IN5 A;  4OO1 J;  4EEY A;  3MAB A;  3T5J A;  3OJS A;  1Q3V A;  2XGP A;  4KN4 A;  1F5S A;  4YXM A;  4IRC A;  4F2R A;  2YQE A;  4G9B A;  5DGA A;  1SKR A;  1NZB A;  1ZQE A;  2ZXH A;  3RTV A;  2ZUB A;  2W11 A;  2F1I A;  2OM6 A;  5EWE A;  1UPH A;  3MBY A;  1PK1 A;  4UB6 U;  5CB1 A;  1OW5 A;  1Z19 A;  5J2D A;  4PHP A;  1URJ A;  2ZG6 A;  4TUS A;  1XSL A;  3TQ1 A;  5DQG A;  3BDP A;  3PX0 A;  4I2H A;  1LKY A;  1NK8 A;  1WWV A;  2KP7 A;  1L7M A;  3BQ7 A;  1ZQL A;  2RLT A;  4M2Y A;  4DO9 A;  1QLN A;  3RB6 A;  5CP2 A;  2H3I A;  4RQ5 A;  4IR1 A;  2G08 A;  4DL5 A;  3RJF A;  4QZH A;  3RH5 A;  3WKB A;  3RJK A;  2KSO B;  8ICE A;  2DFL A;  4YD1 A;  2JRZ A;  3AUO A;  5AK5 A;  5ALJ A;  4KLU A;  1S0N A;  2IBK A;  9ICG A;  1ZQT A;  1COO A;  2HVI A;  8ICL A;  1T3N A;  8ICC A;  3KOO A;  3SMV A;  3WU2 U;  5EE1 A;  2NV3 A;  2JH1 A;  4C0Z A;  2NRZ A;  4BWM A;  5J8Y A;  2K4P A;  5A0L A;  1NK0 A;  3PNC A;  4Y2J A;  4PZN A;  4FBT A;  4Z6D A;  2ZIV A;  3RJI A;  1TKD A;  1Z1V A;  3H0R B;  3I1Y A;  5GTH U;  7ICS A;  3RJJ A;  1WUD A;  4PPX A;  3PML A;  2FE9 A;  1X42 A;  1MC8 A;  5ALV A;  2CXY A;  2WAQ C;  5AI5 A;  2NRW A;  4I2G A;  3T79 A;  4DFK A;  3WKD A;  1QH9 A;  8ICK A;  4GC6 A;  1CEZ A;  4YN4 A;  3ISD A;  2FPL A;  5KL8 B;  4UB2 A;  3QEB Z;  2QB0 A;  4E0D A;  3PR4 A;  4XRH A;  5CA7 A;  2IOF K;  4J9R A;  4EYH B;  4R64 A;  5DDY A;  3RH6 A;  4UAU A;  5J0X A;  4KTQ A;  2QAR B;  7ICK A;  4YG2 A;  2WTF A;  2XI9 A;  1S0V A;  4NLN A;  4UW9 A;  4DEZ A;  4Z6C A;  2RDJ A;  5KT7 A;  3OTQ A;  3L3F X;  3MGV A;  4C8L A;  2D6F C;  1D9D A;  3N97 B;  4M6W B;  3GDX A;  3Q8S B;  5KFS A;  8ICA A;  2HDO A;  1ZQR A;  1SZP A;  5B5E U;  4P0P A;  1ZD2 P;  9ICR A;  2WB1 F;  4P0Q A;  1ARO P;  2G5H B;  3RB4 A;  1T8E A;  1NI3 A;  1ZD4 A;  4DS5 A;  3SAG A;  3C2L A;  2XVT A;  4QWC A;  3LWM A;  3ISC A;  1SXD A;  2ZIX A;  4NLK A;  3HKZ F;  3F2B A;  3V6K A;  4ECQ A;  2D8C A;  1ED1 A;  4DFJ A;  2ZTD A;  4C8K A;  2Y0S F;  4DLG A;  2Z7J A;  3K4G A;  2EZY A;  1S9F A;  3B0X A;  2MUT B;  5KFK A;  4B9N A;  2NRV A;  3Q8Q B;  4B9S A;  3KHG A;  5J2B A;  4IS7 A;  2LKY A;  2OEH A;  5ALI A;  3VC8 A;  3QE9 Y;  1RQN A;  4CDG A;  4ED6 A;  1V9P A;  2GO7 A;  3TAN A;  2DKZ A;  5AKL A;  4ECT A;  3TAP A;  3Q8K A;  2ZTC A;  1ZYQ A;  1WWU A;  5KG0 A;  5EE9 A;  2C2R A;  1PK3 A;  5KFE A;  4I27 A;  1KFD A;  4KLG A;  4Y2T A;  3RRH A;  2BQU A;  4F92 B;  2ZJA A;  4MEY A;  3M9O B;  1H38 A;  3Q8R B;  2NRT A;  5DB7 A;  2BQR A;  2K4H A;  3ISB A;  4RQ7 A;  1UA1 A;  3BQ0 A;  1QTM A;  1ZOL A;  3HW8 A;  4AP9 A;  2FMS A;  2KFZ A;  5KG6 A;  3E0F A;  2HHW A;  3AEV A;  4DQR A;  3H8S A;  4QIW F;  1S76 D;  3TFS A;  1MQ3 A;  2KZ3 A;  2XID A;  2AHO B;  4CGZ A;  2BKE A;  1Y88 A;  5CRX A;  4UBC A;  4DL6 A;  2Y9T A;  2IA6 A;  3G6Y A;  5ALK A;  1B0X A;  4RPZ A;  1VDV A;  7ICO A;  2A1A A;  2HCF A;  1N61 A;  1L7O A;  1X9M A;  2DUY A;  3AU6 A;  1V85 A;  3D2S A;  1Q46 A;  4XUS A;  5KFL A;  2BPC A;  4UAY A;  1PK1 B;  2KJ9 A;  3KTQ A;  1AQ6 A;  2HMX A;  1U4B A;  5ALX A;  3S6J A;  3BJY A;  2EZX A;  5KTQ A;  5DKW A;  3ZD9 A;  4F50 A;  3BS5 A;  2WF7 A;  4ECS A;  1LKY B;  7ICT A;  3JPO A;  2KIW A;  4C4S A;  4IRK A;  5EOZ A;  2DBY A;  2AXT U;  4Q8F A;  5ALM A;  1NKE A;  5DGB A;  3SYZ A;  3QUB A;  1KN5 A;  2XCP A;  1RYS A;  4ELU A;  2KV2 A;  9ICH A;  2YX8 A;  8ICY A;  3RH4 A;  3M9M B;  4FE3 A;  1WCL A;  3WK4 A;  4F2S A;  3EPI A;  4B9L A;  1ZQD A;  5J0Q A;  2LM4 A;  1T4G A;  5G5H A;  3VCB A;  3ZDE A;  1DGJ A;  3SAF A;  2WF6 A;  1L5U A;  3I28 A;  2GOL A;  1X6I A;  4NXZ A;  1N48 A;  4NLC A;  1X66 A;  4JMU A;  2YMP A;  2PI5 A;  2EAP A;  2K8B B;  5J2A A;  4QZF A;  3SV3 A;  2IOH A;  2ZIV B;  1B4F A;  2E3T A;  4IC9 A;  4JK1 A;  5J0R A;  5KAI U;  5J2K A;  3N7P D;  5JRT A;  4F5R A;  4ELV A;  1PZN A;  2D3D A;  4IQW A;  2LM1 A;  5CWR A;  4YMO A;  2B6G A;  1NKB A;  2CRX A;  1JUD A;  5ALF A;  1ZRN A;  2K4E A;  2WF9 A;  4UB5 A;  4R8U A;  2FI1 A;  2QB0 B;  4KLT A;  4QW9 A;  5AKY A;  1A76 A;  4I2I A;  2OXO A;  1QSL A;  1IG6 A;  4EX6 A;  4RQ1 A;  5EE0 A;  1TAM A;  2L5Y A;  4QWE A;  3NVW A;  4JV0 A;  4IR9 A;  1KTQ A;  3MC1 A;  2FJ6 A;  1XNS A;  4Y2Y A;  4NM1 A;  3D2Q A;  1SIJ A;  1XSN A;  2P6R A;  4FZM A;  5J2E A;  2JMG A;  4MFC A;  2A19 A;  5EE3 A;  4KLL A;  4DQQ A;  1ZET A;  3SD7 A;  2ATL A;  1TK5 A;  2BDU A;  4RQ4 A;  1IM4 A;  3LVW A;  3HRD D;  8ICF A;  2KZZ A;  5IIJ A;  1ZQ1 C;  2I1Q A;  1DK2 A;  4P0Q B;  4FO6 A;  4NLG A;  5EWG A;  5J0P A;  5J0T A;  1N56 A;  4HYK A;  2IOF A;  9ICO A;  7ICQ A;  5AKJ A;  5AM4 A;  2ZIX B;  2LYA A;  2A1J B;  5JTI A;  4KLS A;  8ICM A;  3NAS A;  4O3P A;  8ICP A;  4ICA A;  4CCH A;  5DG8 A;  4G3I A;  4KLE A;  8ICV A;  3WKC A;  1ZQS A;  3TKA A;  4ZH4 A;  2FDR A;  4QZA A;  2LYB A;  2FLP A;  4RQ0 A;  4I28 A;  9ICC A;  4UBB A;  4J9S A;  1NZP A;  1L8L A;  1ZD5 A;  1DOQ A;  2FMQ A;  3RBD A;  4NWI A;  5AM5 A;  4QWB A;  2G5I B;  1TK0 A;  4UAS A;  2M9N A;  5L9X A;  1KW4 A;  1L3V A;  3GIL A;  1J2M A;  3SEN A;  4YMM A;  3C29 A;  5KT2 A;  4ED3 A;  3UXN A;  2ALZ A;  2ASD A;  1ZQO A;  1S5L U;  4KN7 A;  3BQT A;  1X9W A;  4KLF A;  1L6N A;  1OUQ A;  5KT5 A;  4WJ3 B;  3V6J A;  4UAW A;  2VA8 A;  3QUC A;  2KZM A;  1A77 A;  2H3V A;  2KE7 A;  5KL1 B;  5DB6 A;  2ZIW A;  4LZD A;  2MRL A;  2C2D A;  1L7P A;  1K1Q A;  1RQL A;  9ICJ A;  4RZR A;  2C22 A;  4YCX A;  3KHL A;  2PXI A;  3V72 A;  1BPX A;  5L1K A;  2YB4 A;  4DSK A;  1TAQ A;  2G0A A;  2UVU A;  2W8L A;  3M6K A;  5KFW A;  3M9N B;  3JPT A;  7ICR A;  2ES6 A;  4A8E A;  3PZP A;  1S97 A;  2P66 A;  5HR7 A;  2DPJ A;  4JV1 A;  1F0M A;  5ALS A;  3JPS A;  3QUT A;  3RR7 A;  3DV9 A;  5AHX A;  4Y2R A;  5DQI A;  4PH5 A;  5AK6 A;  5ALR A;  5AKI A;  3PVX A;  3LK9 A;  2W04 A;  4NV0 A;  3C28 A;  3EYZ A;  3THV A;  3H7I A;  2JZB A;  3PW0 A;  5KFZ A;  3BS5 B;  7ICP A;  4YR2 A;  2ZIU B;  4ECR A;  2BCV A;  3E2E A;  2E8M A;  8ICU A;  2BHN A;  1EXN A;  3RJE A;  2R18 A;  3Q8M A;  2VA3 A;  2F2A B;  4F3O A;  4OCZ A;  5C5J A;  2KKP A;  5KT4 A;  4RUC A;  4F8R A;  5AIB A;  3G6V A;  2V4Q A;  4NY8 A;  1BPD A;  4YP3 A;  3KFU F;  2FPM A;  3F2C A;  3UMB A;  4YR0 A;  3GQC A;  1XSP A;  1FFV A;  1A6S A;  3PO5 A;  4USA A;  5KFV A;  9ICX A;  4O5K A;  2W9C A;  3N4M B;  1BPY A;  1UA0 A;  2AH5 A;  1VLB A;  3GIK A;  2IHM A;  2F77 X;  1XO1 A;  4R65 A;  1NJY A;  5JU5 A;  2UVW A;  2DKX A;  1SL1 A;  3MGI A;  3PW5 A;  2E8N A;  4YMN A;  8ICJ A;  3JPR A;  5ALN A;  3T5H A;  1HIW A;  3GV7 B;  1V38 A;  4PL1 A;  4PL2 A;  3NUQ A;  3IRU A;  1YT3 A;  4R8U B;  1L3S A;  1L3U A;  3GZF A;  2HW3 A;  2W3S A;  5ALL A;  5KFD A;  3PW2 A;  3AMZ A;  4J03 A;  4X5V A;  4C4T A;  4P4M A;  5TZV A;  8ICN A;  4Y2Q A;  4DSJ A;  3B0Y A;  4J9P A;  1ZQN A;  1TAU A;  2DQN B;  2O6K A;  2AU0 A;  3QU7 A;  2P6U A;  4RT2 A;  3ZDD A;  3BS7 A;  4F71 A;  1PVQ A;  2W43 A;  2WHE A;  4CF3 A;  4GXI A;  1OXJ A;  2XIC A;  1U9L A;  4J9K A;  3H40 A;  3BQ1 A;  3WK7 A;  5J29 A;  3ZDB A;  5KFH A;  2BCS A;  3HWT A;  4KLD A;  2YB1 A;  1JRO A;  3A0B U;  3GV5 B;  2R8I A;  5ALT A;  3KBB A;  3SZ2 A;  7ICF A;  3IG5 A;  5DBB A;  1TFR A;  1FIQ A;  5ALY A;  5AK4 A;  3IV6 A;  3J81 j;  2WAQ F;  3MDA A;  3MR2 A;  1FO4 A;  4QNL A;  3HJE A;  1IIP A;  4M9N A;  3ED5 A;  1SXE A;  3RJH A;  1ZQZ A;  1X9X A;  3UPQ A;  4EBD A;  9ICE A;  4YVZ A;  5AKH A;  5KG7 A;  3EPG A;  2PMZ C;  1BGX T;  4K4H A;  3FAH A;  2C28 A;  4O3R A;  4IQU A;  5AI9 A;  1RZT A;  5DG7 A;  4QWD A;  1O03 A;  8ICT A;  3AM9 A;  1ZXI A;  4BWJ A;  1SL2 A;  4O3S A;  3M8S A;  2AGO A;  2MAX A;  9ICU A;  2ZUC A;  3AL0 B;  3IDW A;  1JXE A;  4QZI A;  2ASJ A;  3TAR A;  2HHS A;  5J0U A;  5AK3 A;  1RYU A;  1NJW A;  3N7R C;  1HUZ A;  1SWW A;  1KKX A;  5L1L A;  1U48 A;  1ZQW A;  2VAN A;  3NS1 A;  3QX7 A;  2XGQ A;  1RPL A;  4ED1 A;  1L3T A;  1T7P A;  5TIS U;  5KFU A;  1MQ2 A;  4FFD A;  2LBO A;  4RQ3 A;  3LVV A;  2KMD A;  7ICJ A;  4GLX A;  3PV8 A;  2Y1J A;  3HPO A;  3QYP A;  1C20 A;  4Q44 A;  5KFG A;  3RB0 A;  3FDS A;  5AM3 A;  5ALQ A;  1LB2 B;  1JX4 A;  1KDH A;  3UM9 A;  9ICQ A;  2RDI A;  1TVA A;  8ICQ A;  4JUZ A;  5HP4 A;  4DF4 A;  2KD1 A;  3T5K A;  5HHI A;  2BDP A;  2MU2 A;  2A3V A;  5AKX A;  1NJZ A;  2BR0 A;  1T94 A;  4BX9 C;  3PO4 A;  3FC4 A;  2LHT A;  4GXK A;  2KJ5 A;  4QJF B;  4Y2P A;  2F76 X;  5J2G A;  2ASL A;  4QZC A;  2EAM A;  5ALH A;  2HBL A;  1NOM A;  3K1R B;  3ETL A;  4OJO A;  3WK8 A;  2YMM A;  2KHV A;  1ZQF A;  3DEE A;  3I76 A;  4DQI A;  1ZQB A;  3QUQ A;  1O08 A;  3SAH A;  1NK7 A;  2JZB B;  2GH1 A;  5ALP A;  4GC7 A;  3SV4 A;  1PVR A;  4R66 A;  8ICS A;  1ECW A;  1N2X A;  2HI0 A;  4DSL A;  4TUP A;  4I2F A;  4UAT A;  4UAV A;  4LVS A;  1FFU A;  1UQV A;  2XY6 A;  3H8J A;  3IHQ B;  8ICG A;  1KRP A;  4DS4 A;  2BQ3 A;  1CI4 A;  3H4D A;  4F5O A;  4F5P A;  3NVY A;  4QWA A;  1RM6 C;  1X2I A;  4UB3 A;  2HHV A;  3EZ5 A;  1KFT A;  2J6U A;  3IM1 A;  1JAL A;  4EBC A;  8ICX A;  1TV9 A;  4BDP A;  2G07 A;  3GIM A;  2ISO A;  4CNQ A;  3OHB A;  1ZJN A;  3CYM A;  3SEI A;  3PX6 A;  4K4I A;  5KFR A;  5III A;  2W9C B;  4UB8 U;  1SL0 A;  3H4B A;  3RAX A;  1A0P A;  4F72 A;  2F1H A;  2W54 A;  4EZ9 A;  4F4K A;  9ICF A;  4EX7 A;  1FEZ A;  1N5X A;  3HP6 A;  4Q45 A;  4J9M A;  4MHV A;  1UT8 A;  5AKE A;  4US8 A;  1XO0 A;  2BCQ A;  1Q3U A;  3O0F A;  4DSI A;  1NNL A;  4OD0 A;  4UAZ A;  3M6Z A;  4EEK A;  5KFP A;  4TQR A;  4O9M A;  5HHH A;  2BCR A;  2ODG A;  4KLQ A;  3QU5 A;  3OSN A;  4RNO A;  4KLJ A;  2Q0Z X;  4RU9 A;  2LYH A;  4MF8 A;  4ED7 A;  1U49 A;  2E8P A;  2QLT A;  3H8M A;  4BGD A;  3OGU A;  4ECV A;  7ICU A;  3UMC A;  3PW7 A;  5KFT A;  3KZX A;  3C21 A;  1ZJM A;  1PVP A;  3C2K A;  3IG8 A;  1S0O A;  4TUQ A;  4PGY A;  3Q8P B;  1L8O A;  4O5C A;  4P0P B;  2HHX A;  1ZQI A;  4GIB A;  1L7N A;  3QU2 A;  2V9W A;  2H3F A;  4RQ2 A;  4FS2 A;  4I2E A;  3CW2 C;  1KFS A;  1K5O A;  3MR5 A;  4RQN A;  2JEG A;  1B22 A;  1SB3 C;  2K60 A;  5ALD A;  3IP4 B;  5G5G A;  3PMN A;  3L5K A;  3KHR A;  3AN1 A;  5D4B A;  2OYY A;  4AYB F;  4F4X A;  2UVR A;  9ICM A;  4KMO B;  2OWO A;  2QB1 A;  5DB9 A;  5J0W A;  3M8R A;  4C8M A;  3BZC A;  4CF4 A;  2R8J A;  2AQ0 A;  4DQP A;  5L1M A;  4M9J A;  4B6J A;  4KIT B;  4PHE A;  1X9S A;  2DF4 B;  5J2J A;  4DL3 A;  1QSS A;  2PFO A;  1LV5 A;  3CNH A;  3MGH A;  1BPB A;  2HBK A;  5DG9 A;  1JXL A;  9ICS A;  5D46 A;  2ZXI A; 
#chains in the Genus database with same CATH homology
 2KD1 A;  4NLB A;  4U7C A;  2A3V A;  2WAQ F;  3D2Q A;  1L6N A;  1Q3V A;  1OUQ A;  1MA7 A;  2LKY A;  2WAQ C;  4FZM A;  3VC8 A;  1T94 A;  4BX9 C;  4QNL A;  2RP5 A;  3T79 A;  3KFU F;  4WJ3 B;  4CDG A;  1XO0 A;  2JMG A;  1IIP A;  2LHT A;  2KIW A;  3SQI A;  2MA1 A;  2H3Z A;  3F5A A;  3O0F A;  3F2C A;  1Q3U A;  1DRG A;  2W7O A;  2ZIW B;  2KJ5 A;  3M6Z A;  4QJF B;  2F76 X;  1NZB A;  2H3V A;  2HOQ A;  5KL1 B;  4OO1 J;  5KL8 B;  2ZXH A;  4U6P A;  1A6S A;  2HBL A;  2PMZ F;  5T14 A;  2ZIW A;  2CPR A;  2MRL A;  2OM6 A;  2PMZ C;  4OJO A;  2BDU A;  3LVW A;  1UPH A;  2CN1 A;  3LYS A;  4BJQ A;  2KV2 A;  2HBM A;  3H0M B;  2W7P A;  2YX8 A;  4BUG A;  2KHV A;  3K1Z A;  1ZQ1 C;  2HOI A;  3D2N A;  2F77 X;  2OH2 A;  3DEE A;  1Z19 A;  4P0Q B;  5C0Y A;  1GO3 F;  2K4H A;  2KHQ A;  1URJ A;  2G09 A;  2JHD A;  2YB4 A;  2ZG6 A;  4FE3 A;  3SAH A;  1Z1B A;  3ONN A;  2XI9 A;  2G0A A;  3OPX A;  3CP8 A;  3M6K A;  2GH1 A;  4OJL A;  2KVC A;  3KZX A;  2DGZ A;  3ICX A;  1PVR A;  2M0N A;  2K8C B;  1ECW A;  4OJP A;  3L3F X;  3VCB A;  4A8E A;  3F2D A;  3H0L B;  3PZP A;  1PVP A;  3MGV A;  3AL0 B;  3E0F A;  3F53 A;  3IG8 A;  5HR7 A;  1HIW A;  3SAF A;  2ZIX B;  2LYA A;  3PST A;  4PL1 A;  3RFA A;  2D6F C;  4PL2 A;  3NUQ A;  2HOF A;  4ACO A;  2GOL A;  4P0P B;  1YT3 A;  3PSP A;  2KOB A;  1CRX A;  4ICA A;  2F8L A;  4NLC A;  4QIW F;  4AYB C;  4JMU A;  2VIX A;  4QIW C;  1F44 A;  3GZF A;  2E1F A;  2H3I A;  2XID A;  2W03 A;  2KEY A;  2G06 A;  2HBJ A;  3N7R C;  2G08 A;  2H3F A;  4P0P A;  2E5S A;  4CGZ A;  2K8B B;  2WB1 F;  2K89 A;  4OJ6 A;  5HR6 A;  2RHF A;  2WB1 C;  4P0Q A;  2W04 A;  2VKQ A;  2G5H B;  2ZIV B;  4FZN A;  2KKV A;  2RRD A;  4FZL A;  5CRX A;  4GFJ A;  2JH7 A;  4NV0 A;  4IC9 A;  2KJ8 A;  2K4I A;  3C28 A;  3AQF A;  3GU3 A;  3IP4 B;  2LYB A;  3PSF A;  3N7P D;  2DQN B;  2JGA A;  2VJ5 A;  3SAG A;  2XVT A;  1KBU A;  2KIC A;  2LBO A;  1D8B A;  2OYY A;  3LVV A;  4AYB F;  2VJ4 A;  1PVQ A;  2CRX A;  2ZIU B;  2ZIX A;  4KMO B;  3HKZ F;  2XIC A;  4NWI A;  2G5I B;  3F2B A;  3CRX A;  2K4E A;  2G07 A;  3HKZ C;  1ED1 A;  3N7S C;  3SMV A;  3CYM A;  2E1E A;  2KNJ A;  2R18 A;  2ZIU A;  3D2S A;  2NV3 A;  2JH1 A;  4KX5 A;  4C0Z A;  2YB1 A;  4CRX A;  2OXO A;  3ALR A;  3C29 A;  2Q4T A;  2Y0S F;  2N1R A;  4KX3 A;  2Z7J A;  3M7D A;  3PSI A;  2Y0S C;  5A0L A;  1A0P A;  2DF4 B;  3NRW A;  1TAM A;  1SZH A;  4O3M A;  2H3Q A;  3F5E A;  1HEK A;  2KJ9 A;  2F2A B;  4OJ5 A;  2ZIV A;  3RF9 A;  2HBK A;  2HMX A;  2KKP A;  3H0R B;  1P7D A;  3AQE A;  2K8A A;  3IG5 A;  1WUD A;  3IN5 A;  1XNS A;  2ZXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...