2WB1F

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
90
Chain Sequence
SVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITPDEVRSILIMDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 13
structure length 90
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2wb1F02
2PMZF 2Y0SF 3HKZF 2WAQF 2WB1F 4AYBF
chains in the Genus database with same CATH superfamily
3IG5A 4I2DA 1O08A 5KT4A 4F5QA 3IHQB 2C22A 4YMMA 9ICBA 2NRVA 2R18A 4IL6U 1UCVA 2HBJA 3RTVA 3NVYA 1QSSA 3CRXA 1PZNA 2F1JA 3PW5A 1U4BA 4C7YA 1L7MA 4R64A 4B9TA 5DDMA 1ZQYA 4KN7A 1D8BA 4DOCA 2MU2A 1JXLA 1KTQA 2HSZA 4O5KA 2JH7A 9ICMA 5KFIA 2PI5A 2KVCA 1XU4A 3ED5A 4DFKA 4GLXA 1QSLA 1AROP 3FYHA 5CRXA 2P66A 5D49A 3BS7A 1XO1A 2LYBA 2OYYA 3JPRA 4DSFA 2LHTA 4J9OA 1KFSA 1T3NA 1UQVA 4RQ7A 4FE3A 4ECQA 1HJPA 1KN5A 4Y2JA 3KKAC 5ALXA 4QJFB 3PVXA 2NRTA 1A76A 2RQ5A 2P6UA 1N5XA 5AK5A 3TADC 4CE6A 4Z6CA 4DFDA 5JRTA 4M47A 4C8OA 4ECSA 4CCHA 5KFLA 5AM0A 4QZCA 2JV3A 4JB3A 5EWFA 2J6TA 2K4HA 5KFDA 5KG2A 1RXVA 1MQ3A 3PO5A 2NRWA 4B9VA 4KLUA 2HBKA 3NGDA 2FDRA 2I1QA 2K4PA 1JRPA 2E3TA 2WF9A 4UQGA 3OHAA 3C5FA 1WCNA 2F1IA 4Y2PA 4PHAA 4M6WB 3RFAA 2AH5A 3GQCA 1TV9A 2YMLA 3SV3A 3BQ7A 4R63A 4NLKA 3LDAA 1Q3UA 5T14A 2HW3A 4RQ0A 2J6SA 3MC1A 5GTIU 3NASA 3Q8MA 2OM6A 5KFAA 3M9NB 8ICNA 2EANA 4U7CA 1ZQXA 1QQ7A 4RT3A 3EYZA 3SAGA 7ICEA 2QB0A 1RYSA 1ZQFA 2KV2A 2G07A 4UARA 3JPTA 1TAQA 9ICEA 2XY5A 2VA2A 1S0NA 5H2FU 4KLQA 3QNMA 1NK0A 5DBBA 3M7DA 3PX0A 4DL5A 1RYRA 2IOFK 3M6KA 3AQEA 8ICQA 5HP4A 2PFQA 3GV7B 4Y2SA 5DB8A 2K8CB 4KX5A 4O3OA 4O3RA 4OD0A 5F3XB 4DOAA 2AU0A 1ZQQA 4RQ2A 1DGSA 1XWLA 3L4PA 2K8BB 4O3MA 4YR2A 5KFVA 7ICQA 4KLJA 3BDPA 4DQIA 3IP4B 3QUQA 3QUBA 8ICCA 2YY6A 3F53A 4PZNA 4DL3A 4EZ9A 4TUSA 3B0XA 4BWMA 2F1HA 4O5CA 1PUZA 8ICUA 1Q8KA 3E58A 2E8OA 4ED3A 3RB6A 9ICNA 4BXOA 1BGXT 2CRXA 5AK3A 1X9SA 4ECWA 3MGHA 3MDCA 3ALRA 3WU2U 2JEGA 9ICGA 5J0OA 1VJ5A 1PK1B 4IS7A 4US8A 1ZQ1C 3MGVA 2BPGA 2HOIA 2FE9A 4LZDA 1BPXA 1XNSA 5ALVA 1L6NA 4M9LA 3K1ZA 4M0AA 4DL4A 4R8UA 3R9KA 4B6JA 5KFBA 1ZQBA 2GLEA 1ZQIA 3THVA 4P4PA 1SWWA 4IR9A 5HR7A 2MUTA 2ZXHA 4QW8A 4M2YA 4F5OA 3KTQA 4CF4A 3LVVA 3SYZA 4MF2A 3QUTA 3RAXA 5HMLA 2YMQA 4EEYA 2RP5A 4X5VA 4G9BA 4MFCA 9ICKA 2FLLA 2KZZA 8ICLA 3AM9A 5BPCA 1MQ2A 3NVVA 3SR6A 9ICWA 5DDYA 1OXJA 2MUTB 1ZQKA 4KLMA 9ICFA 3BQ2A 3T5KA 4F2SA 5KG6A 4NLBA 3PR5B 2BQRA 4R8UB 5J8YC 3RJHA 4PL2A 2HHVA 4JUZA 2KKPA 2ESEA 2KNJA 4PHEA 4UAYA 2R8JA 3V6HA 5J0QA 4UBCA 1Z1VA 4AYBC 5CWRA 4BGDA 4IQUA 1S76D 2YX8A 5CA7A 4R65A 7ICRA 4I2IA 2YMMA 5L9XA 3CP8A 1SKWA 4NM2A 5KFGA 4KLSA 1BPDA 2AJQA 2DUYA 3NS1A 2W54A 2I5HA 1KQQA 3H8WA 4DL7A 4ED0A 1TKDA 4ECRA 7ICGA 2BPCA 2E5SA 3SMVA 3PO4A 2VIXA 1ZQPA 2ZXIA 2G0AA 4KTQA 3LYSA 3NVWA 2W9MA 4O3PA 5F9NA 5KFMA 2Y1IA 3OGUA 4DF4A 1ZQDA 1FFUA 3TKAA 5KG7A 5KFWA 4PJ0U 1C7YA 1WUDA 2YB4A 3ISCA 5L1LA 1S9FA 3RJFA 3HT3A 3KD3A 7ICFA 5C0YA 3E0FA 3PZPA 3RH6A 1U45A 2YQEA 3V6KA 5KT2A 1L3TA 4F93B 2LI6A 4C4RA 3KHLA 2ZIXA 3WK8A 2W43A 1BVSA 1WCLA 2KIVA 1RDFA 4NL9C 1L5UA 5AM2A 4I2AA 2DPIA 2ODGA 4GC7A 2LYHA 2KHQA 4RNNA 3ZDBA 4Y2QA 3BS5A 1U47A 4I2HA 3SI8A 3PV8A 1ZQOA 2NO4A 2G09A 1QQ5A 2ASJA 2HMXA 1IIPA 1YT3A 1KKXA 4WJ3B 5IIKA 3T3FA 4UB4A 8ICKA 2ISPA 4QZHA 3QEAZ 1VLBA 1KDHA 4KLTA 1ED1A 1NKBA 3PY8A 3RF9A 1ZQWA 3Q8PB 1SIJA 4KLGA 2CXYA 1BPEA 5EWEA 2F2AB 2I9GA 4I2GA 4YG2A 4UB3A 3TARA 3GIIA 4BUGA 3FDSA 4F4KA 3ZDDA 4CDGA 2DL0A 3DDHA 4OO1J 3FC4A 2KFNA 4RZRA 3D2QA 2XO7A 2YB1A 4Y2RA 4F3OA 7ICUA 5J2KA 1LVHA 4QIWC 4QWAA 3J81j 4F92B 3B0YA 2KSOB 4NLZA 2ZJ8A 1T4GA 2W55A 7ICPA 3SAHA 4NM1A 2FI1A 4C8KA 4YN4A 1KRPA 2ALZA 2UVVA 3Q8LA 2GOLA 4CRXA 4KLFA 4EYIB 3RJJA 1Z4OA 4KLOA 5AKEA 2K4IA 1WG8A 1ZD4A 2ES6A 2WAQC 3WKAA 4CF5A 5EE9A 3WK5A 3VC8A 8ICRA 1UPHA 4PZOA 3N7PD 2BZFA 1ZD5A 3ZI4A 1PVRA 2ZIWB 1KFTA 4QZGA 1BPZA 3UQ2A 3SAFA 1JIHA 5ALDA 2RRDA 5KFZA 2XY6A 5AKYA 9ICLA 4F4WA 2F8LA 2XY7A 1CRXA 1PK3A 3CW2C 4FO6A 5KFJA 5KG0A 3E2EA 1N62A 1URJA 2W9BA 4Y2YA 2EQYA 3SQIA 1XSLA 3HWTA 3KFUF 5AI5A 4P4MA 3RR8A 2DKZA 1UA1A 1KFDA 4ECTA 4K4HA 7ICJA 1ZRNA 2UVUA 3RB4A 1T94A 4FBUA 4J9QA 5IIJA 1S5LU 3ZDEA 1ZQHA 1RXWA 3RBDA 2ZJAA 5ALTA 1OW5A 1X9XA 3GZFA 5ALHA 4YR3A 1WWVA 3V6JA 2ZIXB 4DL2A 5DKWA 2QLTA 5DQIA 7ICLA 2QB0B 1N48A 3V7LA 7ICMA 4QZIA 1SKSA 3CYMA 4QWDA 4Z6DA 1O03A 4TUPA 2BDUA 2GH1A 4NLNA 1Z00B 2AGOA 4FBTA 4JMUA 4ZH4A 4ECYA 4IQTA 2JMGA 1T3QA 2KJ9A 8ICVA 3AL0B 3K1RB 1RG6A 3TAQA 3SENA 5DG9A 2P35A 1TVAA 3BZKA 2QB1A 1FEZA 2FPMA 3HPOA 1L7PA 4QZ9A 2RDJA 4P0QB 2FMSA 4DQRA 3H0MB 1T7PA 4I2EA 1PVPA 4A8EA 5J0PA 2DKXA 5ALJA 1KBUA 4O5EA 2DBYA 5ALZA 1DK2A 3F2BA 2RHFA 4QWBA 1NK5A 2Y0SC 3F2CA 5AKZA 4EELA 4KLHA 3A0HU 2MSNA 2H3IA 2K8AA 4K4GA 4ELTA 3BQTA 5L1JA 4QZ8A 5J2HA 2ZUBA 4PH5A 3SZ2A 3GIMA 2XC9A 3QYPA 1ZQZA 4TQSA 5AKHA 1L3VA 2NRZA 4QNLA 4C4SA 3BQ0A 1F44A 2Y9TA 4ECZA 2JEJA 1Z4NA 3GDXA 5IINA 2EZYA 2D6FC 3IN5A 2FJ6A 4FZMA 3PSIA 2CN1A 1N5WA 2BCVA 3M9OB 1HEKA 1XC9A 2XI9A 2W3RA 2G5IB 4C7ZA 5ALLA 2RDIA 3WKBA 1Z19A 5J0XA 1ZJNA 2B6GA 5CEHA 1ZXIA 5J2GA 5KFRA 3V7KA 4YXMA 1BNPA 1KW4A 3WK9A 2HDOA 3AUOA 3QZ7A 5KG4A 1QH9A 3EPIA 2NO5A 3JPSA 4US9A 4DQPA 4EX7A 4J9RA 1S8OA 4YQWA 4MF8A 4CNQA 3MFIA 1EXNA 2LM1A 3TFSA 3BZCA 2V9WA 4UAWA 2IMWP 3PSTA 3ISDA 3PR4A 4DSKA 3OJSA 5ALQA 1UT8A 4F72A 4RUCA 4RQNA 1NJZA 5CP2A 5AI4A 1A0PA 8ICXA 1MN8A 3UM9A 5KT5A 1N60A 3QU9A 2H5XA 1B0XA 5K4LA 5D46A 3PW7A 3C21A 8ICWA 3QU7A 1SGGA 5J0RA 1NI3A 3N4MB 4BXOB 3C2KA 4NJ8A 5KL1B 4PPXA 1F0MA 2EAOA 5ALNA 4EBCA 1XS9D 2UVRA 5AKGA 5KNIA 5HHIA 5ALPA 1XSPA 2OWOA 2K89A 5HMMA 4DSIA 5DBAA 3NRWA 3ZD9A 3GILA 3SD7A 2FMPA 4NL9A 2W03A 4IRCA 4EBDA 2KEYA 5D4BA 3AMZA 1ZD2P 3D6JA 3PW0A 4C8MA 3HILA 1JALA 5F9LA 2DGZA 4PHDA 3PSFA 4RQ5A 1RM6C 2KKVA 1K1QA 1ZQCA 5A0LA 1X66A 4EBEA 4KMOB 3Q8RB 1NJWA 5J0WA 5AM5A 2DF4B 4YD1A 3HKZC 3UXPA 1B22A 2NRXA 2WHEA 4DCCA 3M8SA 1SV0A 1CI4A 1RPLA 9ICUA 3UXOA 3LK9A 3AQFA 9ICVA 3UMCA 1CUKA 4IRDA 4IQVA 4KLEA 2Z7JA 3AN1A 5AI8A 4I2BA 3CNHA 3GIJA 4O3QA 1L7OA 4J9PA 1COKA 3RJGA 2LBOA 1SZHA 3QUCA 3SV4A 2PI4A 3H8MA 4RPZA 2WF6A 1OUQA 5AKJA 4AP9A 3MGIA 2DWQA 3OHBA 3GFKB 4QWEA 1NK4A 3T5HA 4DSLA 2XGQA 1ZQMA 2LYAA 5ALYA 1J2NA 2XGPA 1SV0C 1B4FA 2F76X 2JR5A 4YXJA 5DQHA 3BJYA 1KLNA 1S10A 8ICOA 1XSNA 1L3SA 2KN7A 2P6RA 3NTUA 4MFAA 1JROA 2O6KA 4GC6A 2V4RA 2C2RA 1ZQRA 2OXOA 3TAPA 5KFSA 4UB6U 1QQ6A 1J2MA 1HIWA 1GO3F 3TFRA 2JHDA 2FLPA 4FS2A 2W9CA 7ICSA 3RBEA 4G3IA 3AEVA 4O3SA 4ED8A 4Y2UA 1DOQA 3F5EA 9ICPA 1JN3A 3RB3A 4KLLA 4PHPA 1LB2B 1HUOA 2EH9A 3PNCA 3ETLA 4GIBA 3OSNA 3ETRA 5GTHU 4XUSA 2OH2A 4YD2A 8ICPA 4JWMA 2K60A 2ZIWA 2JH1A 3UQ0A 3OTQA 3C2LA 1U9LA 2W9CB 2L5YA 7ICHA 1H38A 2JZBB 3VCBA 4O0IA 3H4DA 3ICXA 4Y2VA 3A0BU 4Q43A 4M9HA 5KT6A 2KG5A 4UAZA 5L1KA 4NLCA 2R8GA 5AM1A 2W04A 1NKEA 5KFFA 4KX3A 4RQ4A 4XRHA 2ASLA 2BQUA 3ORYA 5DB9A 1MSWD 4XQ8A 2QARB 5AM4A 5EE0A 3C1ZA 3TANA 2NYVA 3F5AA 5KFKA 5AK6A 1A77A 2IA6A 1ZD3A 3RH4A 3C1YA 2ASDA 9ICXA 5J2FA 1UHUA 3KHHA 2GO7A 5KFPA 1ZQTA 4F5PA 2A3VA 8ICAA 4I27A 2R8HA 3UXNA 4M9JA 5AICA 5FP0A 4OJ6A 2KP7A 4F50A 4CF3A 1N56A 1ZQLA 5DG7A 4C8LA 1DGJA 4C0ZA 5J2AA 2J6UA 2FLNA 2KMDA 5J2BA 4RT2A 2WAQF 4BJQA 3Q8SB 1D9DA 3RRGA 4QIWF 2VJ5A 3H8JA 2KK0A 1QCKA 5J2CA 1WWUA 3H0RB 4BDPA 4MEXA 5DQGA 9ICHA 4ECVA 2KD1A 1B43A 4ED1A 3RAQA 4O3NA 4OJPA 3MR2A 4DFPA 8ICZA 2ZIVB 1TK5A 7ICTA 5BOLA 3MABA 3DV9A 1ZYQA 1S77D 1DRGA 4OJOA 3OJUA 2B0CA 2H3VA 1WYGA 3QU4A 2XCPA 3SEIA 2PXIA 1X42A 5ALMA 4M6WA 3TACB 5CHGA 5AI6A 2VJ4A 4YCXA 2FPLA 3NUQA 1IG6A 2MAXA 4PGQA 3QU2A 4P0QA 3ZDAA 1V97A 2EDUA 4C8NA 3KHRA 3C5GA 3C2MA 3FAHA 4QZDA 1S0MA 2BCRA 5EWGA 4I28A 3QEBZ 2KOBA 4JK1A 1JX4A 5CR0A 2WF8A 1PK1A 3ONNA 2W8LA 2ZUCA 1ZQGA 4MHVA 1D8LA 3WK7A 5KAFU 3KKAA 1ZOLA 2KVSA 1JXEA 2KJ8A 5JTIA 4YP3A 5KFQA 5KTQA 3IDWA 2IHMA 4HAIA 4KLIA 2YMPA 2ZTDA 4UAVA 5L1IA 2PMZF 2G5HB 4QW9A 3MR6A 3EWAA 5CJ7A 3EZ5A 2G06A 4B9NA 3UPQA 4ED7A 4F5NA 5IIIA 8ICSA 1M6YA 2V4QA 5AKKA 3GV8B 4GXIA 2HCFA 2ISOA 4U6PA 3H0LB 3QX7A 4KITB 2JEFA 2BQ3A 4DSJA 2ZJ5A 5ALIA 5IILA 4QZFA 5ALWA 1TAUA 4P2HA 8ICHA 5E79U 3V72A 2HOQA 5KFEA 2KICA 1NZBA 4LZGA 1NK7A 4EZ6A 3PW2A 2Q0ZX 1V38A 3H7IA 4UASA 5KFUA 5J29A 3H4BA 2IBKA 9ICIA 2M0NA 1NK6A 5CB1A 3T5LA 3IV6A 4DS4A 4DEZA 3ISBA 4QZEA 5J0SA 4NV0A 5AI9A 5DLGA 3K4GA 2PFNA 4YR0A 4I2JA 4J9LA 4UW9A 1BPYA 3RJKA 5ALFA 2Y0SF 3OPXA 4DSEA 4J9MA 4C80A 3KOOA 1ZQJA 1JI7A 5G5HA 2HVHA 1ZQVA 1Z3EB 2E8NA 4BWJA 4P0PA 2PFOA 2AHOB 5KG3A 1ECWA 2A1JA 2KJ5A 4F5RA 4F91B 2VANA 4DLEA 3H40A 1L7NA 3WKCA 2WF7A 5J2IA 4Y2TA 2KZMA 2BKEA 2ZG6A 1NK9A 5AK4A 1ZQUA 1J97A 5HNKA 3M8RA 1SXDA 2KHVA 1Y88A 2VKQA 4I2FA 2RLTA 2FMQA 2BHNA 4Z6EA 3JPNA 4M04A 2W3SA 5ALKA 3UMBA 5ALGA 3MBYA 3HRDD 2BCUA 5KFOA 4B9LA 4QZAA 4Q45A 5EE3A 3D2SA 5J2DA 5ALRA 1S97A 4I2CA 4OJLA 3K75D 2LMRA 1YZ6A 4M9GA 1TE2A 2W11A 4I29A 2KTQA 3MR5A 3N97B 1SXEA 2K4EA 4OJ5A 2JZBA 2W9BB 2F8KA 4F2RA 1XO0A 4NWIA 5DB6A 3PX6A 3JPQA 2QARA 4F4YA 2H3ZA 5J0TA 3KZXA 2D3DA 2H3FA 5IIOA 4B9UA 3HX0A 3AU2A 2F77X 5B66U 4NY8A 1UA0A 2ZIUA 1SL1A 5DBCA 2BR0A 3HW8A 5EE1A 3BQ1A 1V85A 5KFXA 1Q3VA 4P0PB 4RU9A 4RNMA 3QU5A 5KFNA 3PMLA 2AQ0A 1X40A 3C28A 2JXJA 4ECXA 3IM1A 7ICVA 4HYKA 2HOFA 4MEYA 4B9MA 1KEJA 5KFYA 2IOFA 4YMOA 4FZLA 3GU3A 1KL9A 3C29A 4KMUA 3UMGA 2OEHA 4UB5A 3PSPA 1ZQEA 1Q46A 4RQ1A 1A6SA 3T79A 3G6YA 1RQNA 2W7PA 4EYHB 5KG5A 1K1SA 2HHXA 1X6IA 4DQQA 3M1YA 2AQ4A 1S0OA 1AQ6A 4TQRA 1K5OA 3KHGA 3HKZF 5ALEA 1IV8A 2GWSA 1V9PA 5AIAA 3ZDCA 8ICTA 3M9MB 2YTUA 2A1AA 4JV0A 4DO9A 4QZBA 1TFRA 9ICOA 3QZ8A 8ICEA 4YVZA 2EAMA 4FZNA 5ALOA 2HHTA 1QTMA 2ZTEA 4AYBF 1ZQSA 9ICAA 2HVIA 5J8YA 1X9MA 3TADA 2D8CA 1IXRA 2WTFA 2E1EA 5JUMA 1SL2A 1D9FA 1NNLA 1NK8A 2WF5A 1LKYA 3PMNA 4IR1A 1PVQA 2JGAA 2A19A 2W7OA 3OSPA 4QWCA 2Q4TA 2WB1C 1C20A 3NRZA 3QXGA 5DB7A 4DLGA 2QKQA 4TURA 3JPPA 1D8YA 3LVWA 4DQSA 2VA3A 2DPJA 4UBBA 3I76A 8ICMA 3KBBA 9ICRA 2PFPA 2BPFA 2OHFA 4OCZA 2HHQA 9ICTA 1ZRMA 1RZTA 2G08A 2NV3A 4IC9A 3Q8KA 1LV5A 5AM3A 1BPBA 1X2IA 1IM4A 3H8SA 8ICYA 4GFJA 1NJXA 1TK0A 5ALSA 4DWIA 4DS5A 4RQ6A 4K4IA 1U49A 3RB0A 2ZUDA 4XA5A 8ICGA 4TUQA 2YN4A 2C28A 5TZVA 3RRHA 2HI0A 2I6XA 1UT5A 2M9NA 3RH5A 4UB8U 4Q8EA 2MA1A 3DEEA 2KZ3A 4DF8A 2XVTA 1Z1BA 7ICNA 3B9JA 3O0FA 4LVSA 5J0UA 2AGPA 2R8KA 3C23A 2UVWA 4E0DA 1SWVA 2C2DA 5AKXA 2Y9UA 3IRUA 4UB2A 5KFHA 5J2EA 5AIBA 1MC8A 4F4ZA 2KSOA 4RPXA 3RJEA 2KE7A 1FIQA 3V7JA 5KAIU 1ZETA 3FM9A 1JMSA 1NZPA 8ICJA 2LPEA 1X6JA 8ICIA 4CGZA 1DK3A 5L1MA 7ICIA 3N7SC 4Q8FA 2LM4A 2Y1JA 3MR3A 4RPYA 4JV2A 1COOA 1U48A 4UATA 2HBMA 2H3QA 4FFDA 2W9AA 4J9SA 4ICAA 3KZIU 2ZTCA 3G6VA 3EUB2 5KT3A 5J2JA 3L3FX 3NVZA 3RR7A 2F44A 4EEKA 2IOHA 4RQ3A 4ZOHC 2N1RA 4J9NA 4USAA 4IRKA 4EX6A 4IQWA 3U26A 2F3NA 2BCSA 2E1FA 1JUDA 3F2DA 2XICA 4J9KA 1KSPA 2OCEA 3N7RC 3ZD8A 3GIKA 3N28A 3HP6A 2IHNA 2DQNB 4F71A 1T8EA 3MFHA 2CPRA 2WB1F 4ELVA 1RYUA 4YMNA 9ICQA 1RQLA 1ZJMA 4UAUA 2AXTU 3Q8QB 5BOMA 4DL6A 8ICBA 1HUZA 1SB3C 1F5SA 2EZXA 4GXKA 4RNOA 4MFFA 2BCQA 3LWLA 2KIWA 1NKCA 4JV1A 3PX4A 3TI0A 5DGAA 4EENA 4DFMA 3EW9A 3G6XA 3I28A 1TK8A 7ICOA 1FO4A 1L8OA 1VDVA 2PMZC 2HHUA 8ICFA 5EOZA 3WK6A 2EZZA 2XIDA 3TQ1A 1N61A 3S6JA 1YZ7A 2HBLA 5ALUA 5DLFA 4ED2A 4PGYA 1N2XA 2ZIUB 9ICCA 4PL1A 4O9MA 1TAMA 1ZQAA 4FS1A 2JEIA 2XCAA 4F8RA 3LWMA 2ATLA 4RQ8A 2VA8A 1SZPA 2DFLA 1NOMA 4F4XA 1Z00A 1SKRA 4R66A 7ICKA 9ICSA 1FFVA 4ED6A 5KT7A 3WKDA 1P7DA 4PGXA 2R8IA 2BGWA 5JU5A 2JRZA 3QE9Y 3HJEA 2HHSA 5C5JA 2AGQA 5AKLA 1SV4A 4J03A 1X9WA 2FPKA 5DGBA 2BDPA 4DFJA 1DXSA 4DOBA 3AU6A 1S0VA 4ACOA 4BX9C 5HR6A 1N63A 5IIMA 3PW4A 3I1YA 1MA7A 5AI0A 1QLNA 4KN4A 2LKYA 4C4TA 3RJIA 1LKYB 5AHXA 4B9SA 2HHWA 2W8KA 3WK4A 2ZIVA 4Z6FA 5DG8A 1QSYA 5KL8B 4NXZA 4UB1A 4JWNA 4NLGA 4RUAA 3BS5B 5KFCA 2C2EA 1L8LA 5G5GA 2WFAA 4P4OA 5J0YA 4Y2XA 1BNOA 4KLDA 2B21A 3WKEA 3MDAA 1CEZA 2E8PA 5HHHA 4RQMA 4ECUA 4GXJA 5KG1A 3T5JA 2PKEA 5AKIA 1L3UA 2A1JB 5KFTA 1NJYA 3EPGA 1ZQNA 3IG8A 3JPOA 4Q44A 9ICJA 3GV5B 3L5KA 2E8MA 4YFKA 1SL0A 2MRLA 3D2NA 5TISU 2EAPA 3M6ZA 4M9NA 2KFZA 4LJXA 4ELUA 5B5EU
chains in the Genus database with same CATH topology
2A3VA 3NRWA 2ZG6A 3RF9A 4QNLA 4FZLA 1F44A 3IG5A 3GU3A 3L3FX 3RFAA 2YX8A 2KJ8A 4OJ6A 2W03A 2F2AB 2KEYA 3C29A 2G08A 2N1RA 2NV3A 4IC9A 2CRXA 2D6FC 3IN5A 1T94A 2R18A 3PSPA 3CP8A 4FZMA 3PSIA 2HBJA 2CN1A 2PMZF 1A6SA 2G5HB 2E1FA 4BUGA 4C0ZA 3F2DA 3T79A 1Q3UA 1P7DA 3ALRA 2KHVA 1HEKA 2XICA 5T14A 2WAQF 2XI9A 4BJQA 3N7RC 2G06A 2OXOA 4CDGA 2W7PA 3CRXA 2G5IB 4QIWF 4OO1J 2VJ5A 4GFJA 3GZFA 1HIWA 1GO3F 2VKQA 2JHDA 3D2QA 2YB1A 2DGZA 2ZIXB 1Z19A 2OM6A 2DQNB 3H0RB 3PSFA 1D8BA 1ZQ1C 3MGVA 4U7CA 2KKVA 2HOIA 2CPRA 3HKZF 5A0LA 4U6PA 2E5SA 3H0LB 4KMOB 3SMVA 4QIWC 2KD1A 2VIXA 2WB1F 1XNSA 2JH7A 1L6NA 3SAGA 4OJPA 2KVCA 2ZXIA 3D2SA 3CYMA 2DF4B 4ACOA 2G0AA 3K1ZA 2ZIVB 4BX9C 3SAHA 3LYSA 5HR6A 2BDUA 2GH1A 3HKZC 5CRXA 2HOQA 2KICA 2KV2A 3F5EA 1NZBA 2G07A 4JMUA 4OJLA 2MA1A 3DEEA 2GOLA 2LYBA 2OYYA 1MA7A 2XVTA 4CRXA 1Z1BA 5HR7A 2LKYA 2JMGA 2ZXHA 2LHTA 4FZNA 2KJ9A 3AQFA 3O0FA 2M0NA 3PSTA 4AYBF 2OH2A 3AL0B 3LVVA 1DRGA 2KIWA 4OJOA 2K4EA 4FE3A 4OJ5A 1WUDA 2YB4A 2K4IA 2ZIVA 4AYBC 2H3VA 2Z7JA 3M7DA 5KL8B 2WAQC 4QJFB 2RP5A 2ZIWA 2E1EA 2JH1A 1XO0A 4NWIA 3VC8A 5C0YA 3E0FA 3PZPA 1UPHA 1PVRA 3N7PD 4NV0A 3VCBA 4P0QB 3M6KA 3AQEA 2ZIWB 2H3ZA 1A0PA 2VJ4A 3H0MB 3KZXA 2H3FA 2K8CB 3ICXA 4KX5A 2ZIXA 1PVPA 3SAFA 4A8EA 2LBOA 2RRDA 2Y0SF 3OPXA 3NUQA 1SZHA 1PVQA 1KBUA 2F77X 2JGAA 4NLCA 2PMZC 2ZIUA 3F2BA 2W04A 2RHFA 2W7OA 2KHQA 4CGZA 4P0QA 2K8BB 3N7SC 4KX3A 4O3MA 2Q4TA 2WB1C 2Y0SC 5KL1B 3F2CA 2G09A 2XIDA 1OUQA 4NLBA 4P0PA 1Q3VA 2HMXA 4P0PB 1IIPA 1YT3A 2F8LA 2K4HA 4PL2A 3LVWA 1ECWA 4WJ3B 3IG8A 2KJ5A 2H3IA 2K8AA 1CRXA 3F5AA 2HBLA 3C28A 3IP4B 2HBKA 2LYAA 2ZIUB 3F53A 2HBMA 2H3QA 2MRLA 2KOBA 3D2NA 1URJA 4PL1A 2KKPA 1TAMA 1ED1A 3M6ZA 2KNJA 3SQIA 2HOFA 3ONNA 3KFUF 2K89A 4ICAA 2F76X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ F;  2Y0S F;  3HKZ F;  2WAQ F;  2WB1 F;  4AYB F; 
#chains in the Genus database with same CATH topology
 3IG5 A;  4I2D A;  1O08 A;  5KT4 A;  4F5Q A;  3IHQ B;  2C22 A;  4YMM A;  9ICB A;  2NRV A;  2R18 A;  4IL6 U;  1UCV A;  2HBJ A;  3RTV A;  3NVY A;  1QSS A;  3CRX A;  1PZN A;  2F1J A;  3PW5 A;  1U4B A;  4C7Y A;  1L7M A;  4R64 A;  4B9T A;  5DDM A;  1ZQY A;  4KN7 A;  1D8B A;  4DOC A;  2MU2 A;  1JXL A;  1KTQ A;  2HSZ A;  4O5K A;  2JH7 A;  9ICM A;  5KFI A;  2PI5 A;  2KVC A;  1XU4 A;  3ED5 A;  4DFK A;  4GLX A;  1QSL A;  1ARO P;  3FYH A;  5CRX A;  2P66 A;  5D49 A;  3BS7 A;  1XO1 A;  2LYB A;  2OYY A;  3JPR A;  4DSF A;  2LHT A;  4J9O A;  1KFS A;  1T3N A;  1UQV A;  4RQ7 A;  4FE3 A;  4ECQ A;  1HJP A;  1KN5 A;  4Y2J A;  3KKA C;  5ALX A;  4QJF B;  3PVX A;  2NRT A;  1A76 A;  2RQ5 A;  2P6U A;  1N5X A;  5AK5 A;  3TAD C;  4CE6 A;  4Z6C A;  4DFD A;  5JRT A;  4M47 A;  4C8O A;  4ECS A;  4CCH A;  5KFL A;  5AM0 A;  4QZC A;  2JV3 A;  4JB3 A;  5EWF A;  2J6T A;  2K4H A;  5KFD A;  5KG2 A;  1RXV A;  1MQ3 A;  3PO5 A;  2NRW A;  4B9V A;  4KLU A;  2HBK A;  3NGD A;  2FDR A;  2I1Q A;  2K4P A;  1JRP A;  2E3T A;  2WF9 A;  4UQG A;  3OHA A;  3C5F A;  1WCN A;  2F1I A;  4Y2P A;  4PHA A;  4M6W B;  3RFA A;  2AH5 A;  3GQC A;  1TV9 A;  2YML A;  3SV3 A;  3BQ7 A;  4R63 A;  4NLK A;  3LDA A;  1Q3U A;  5T14 A;  2HW3 A;  4RQ0 A;  2J6S A;  3MC1 A;  5GTI U;  3NAS A;  3Q8M A;  2OM6 A;  5KFA A;  3M9N B;  8ICN A;  2EAN A;  4U7C A;  1ZQX A;  1QQ7 A;  4RT3 A;  3EYZ A;  3SAG A;  7ICE A;  2QB0 A;  1RYS A;  1ZQF A;  2KV2 A;  2G07 A;  4UAR A;  3JPT A;  1TAQ A;  9ICE A;  2XY5 A;  2VA2 A;  1S0N A;  5H2F U;  4KLQ A;  3QNM A;  1NK0 A;  5DBB A;  3M7D A;  3PX0 A;  4DL5 A;  1RYR A;  2IOF K;  3M6K A;  3AQE A;  8ICQ A;  5HP4 A;  2PFQ A;  3GV7 B;  4Y2S A;  5DB8 A;  2K8C B;  4KX5 A;  4O3O A;  4O3R A;  4OD0 A;  5F3X B;  4DOA A;  2AU0 A;  1ZQQ A;  4RQ2 A;  1DGS A;  1XWL A;  3L4P A;  2K8B B;  4O3M A;  4YR2 A;  5KFV A;  7ICQ A;  4KLJ A;  3BDP A;  4DQI A;  3IP4 B;  3QUQ A;  3QUB A;  8ICC A;  2YY6 A;  3F53 A;  4PZN A;  4DL3 A;  4EZ9 A;  4TUS A;  3B0X A;  4BWM A;  2F1H A;  4O5C A;  1PUZ A;  8ICU A;  1Q8K A;  3E58 A;  2E8O A;  4ED3 A;  3RB6 A;  9ICN A;  4BXO A;  1BGX T;  2CRX A;  5AK3 A;  1X9S A;  4ECW A;  3MGH A;  3MDC A;  3ALR A;  3WU2 U;  2JEG A;  9ICG A;  5J0O A;  1VJ5 A;  1PK1 B;  4IS7 A;  4US8 A;  1ZQ1 C;  3MGV A;  2BPG A;  2HOI A;  2FE9 A;  4LZD A;  1BPX A;  1XNS A;  5ALV A;  1L6N A;  4M9L A;  3K1Z A;  4M0A A;  4DL4 A;  4R8U A;  3R9K A;  4B6J A;  5KFB A;  1ZQB A;  2GLE A;  1ZQI A;  3THV A;  4P4P A;  1SWW A;  4IR9 A;  5HR7 A;  2MUT A;  2ZXH A;  4QW8 A;  4M2Y A;  4F5O A;  3KTQ A;  4CF4 A;  3LVV A;  3SYZ A;  4MF2 A;  3QUT A;  3RAX A;  5HML A;  2YMQ A;  4EEY A;  2RP5 A;  4X5V A;  4G9B A;  4MFC A;  9ICK A;  2FLL A;  2KZZ A;  8ICL A;  3AM9 A;  5BPC A;  1MQ2 A;  3NVV A;  3SR6 A;  9ICW A;  5DDY A;  1OXJ A;  2MUT B;  1ZQK A;  4KLM A;  9ICF A;  3BQ2 A;  3T5K A;  4F2S A;  5KG6 A;  4NLB A;  3PR5 B;  2BQR A;  4R8U B;  5J8Y C;  3RJH A;  4PL2 A;  2HHV A;  4JUZ A;  2KKP A;  2ESE A;  2KNJ A;  4PHE A;  4UAY A;  2R8J A;  3V6H A;  5J0Q A;  4UBC A;  1Z1V A;  4AYB C;  5CWR A;  4BGD A;  4IQU A;  1S76 D;  2YX8 A;  5CA7 A;  4R65 A;  7ICR A;  4I2I A;  2YMM A;  5L9X A;  3CP8 A;  1SKW A;  4NM2 A;  5KFG A;  4KLS A;  1BPD A;  2AJQ A;  2DUY A;  3NS1 A;  2W54 A;  2I5H A;  1KQQ A;  3H8W A;  4DL7 A;  4ED0 A;  1TKD A;  4ECR A;  7ICG A;  2BPC A;  2E5S A;  3SMV A;  3PO4 A;  2VIX A;  1ZQP A;  2ZXI A;  2G0A A;  4KTQ A;  3LYS A;  3NVW A;  2W9M A;  4O3P A;  5F9N A;  5KFM A;  2Y1I A;  3OGU A;  4DF4 A;  1ZQD A;  1FFU A;  3TKA A;  5KG7 A;  5KFW A;  4PJ0 U;  1C7Y A;  1WUD A;  2YB4 A;  3ISC A;  5L1L A;  1S9F A;  3RJF A;  3HT3 A;  3KD3 A;  7ICF A;  5C0Y A;  3E0F A;  3PZP A;  3RH6 A;  1U45 A;  2YQE A;  3V6K A;  5KT2 A;  1L3T A;  4F93 B;  2LI6 A;  4C4R A;  3KHL A;  2ZIX A;  3WK8 A;  2W43 A;  1BVS A;  1WCL A;  2KIV A;  1RDF A;  4NL9 C;  1L5U A;  5AM2 A;  4I2A A;  2DPI A;  2ODG A;  4GC7 A;  2LYH A;  2KHQ A;  4RNN A;  3ZDB A;  4Y2Q A;  3BS5 A;  1U47 A;  4I2H A;  3SI8 A;  3PV8 A;  1ZQO A;  2NO4 A;  2G09 A;  1QQ5 A;  2ASJ A;  2HMX A;  1IIP A;  1YT3 A;  1KKX A;  4WJ3 B;  5IIK A;  3T3F A;  4UB4 A;  8ICK A;  2ISP A;  4QZH A;  3QEA Z;  1VLB A;  1KDH A;  4KLT A;  1ED1 A;  1NKB A;  3PY8 A;  3RF9 A;  1ZQW A;  3Q8P B;  1SIJ A;  4KLG A;  2CXY A;  1BPE A;  5EWE A;  2F2A B;  2I9G A;  4I2G A;  4YG2 A;  4UB3 A;  3TAR A;  3GII A;  4BUG A;  3FDS A;  4F4K A;  3ZDD A;  4CDG A;  2DL0 A;  3DDH A;  4OO1 J;  3FC4 A;  2KFN A;  4RZR A;  3D2Q A;  2XO7 A;  2YB1 A;  4Y2R A;  4F3O A;  7ICU A;  5J2K A;  1LVH A;  4QIW C;  4QWA A;  3J81 j;  4F92 B;  3B0Y A;  2KSO B;  4NLZ A;  2ZJ8 A;  1T4G A;  2W55 A;  7ICP A;  3SAH A;  4NM1 A;  2FI1 A;  4C8K A;  4YN4 A;  1KRP A;  2ALZ A;  2UVV A;  3Q8L A;  2GOL A;  4CRX A;  4KLF A;  4EYI B;  3RJJ A;  1Z4O A;  4KLO A;  5AKE A;  2K4I A;  1WG8 A;  1ZD4 A;  2ES6 A;  2WAQ C;  3WKA A;  4CF5 A;  5EE9 A;  3WK5 A;  3VC8 A;  8ICR A;  1UPH A;  4PZO A;  3N7P D;  2BZF A;  1ZD5 A;  3ZI4 A;  1PVR A;  2ZIW B;  1KFT A;  4QZG A;  1BPZ A;  3UQ2 A;  3SAF A;  1JIH A;  5ALD A;  2RRD A;  5KFZ A;  2XY6 A;  5AKY A;  9ICL A;  4F4W A;  2F8L A;  2XY7 A;  1CRX A;  1PK3 A;  3CW2 C;  4FO6 A;  5KFJ A;  5KG0 A;  3E2E A;  1N62 A;  1URJ A;  2W9B A;  4Y2Y A;  2EQY A;  3SQI A;  1XSL A;  3HWT A;  3KFU F;  5AI5 A;  4P4M A;  3RR8 A;  2DKZ A;  1UA1 A;  1KFD A;  4ECT A;  4K4H A;  7ICJ A;  1ZRN A;  2UVU A;  3RB4 A;  1T94 A;  4FBU A;  4J9Q A;  5IIJ A;  1S5L U;  3ZDE A;  1ZQH A;  1RXW A;  3RBD A;  2ZJA A;  5ALT A;  1OW5 A;  1X9X A;  3GZF A;  5ALH A;  4YR3 A;  1WWV A;  3V6J A;  2ZIX B;  4DL2 A;  5DKW A;  2QLT A;  5DQI A;  7ICL A;  2QB0 B;  1N48 A;  3V7L A;  7ICM A;  4QZI A;  1SKS A;  3CYM A;  4QWD A;  4Z6D A;  1O03 A;  4TUP A;  2BDU A;  2GH1 A;  4NLN A;  1Z00 B;  2AGO A;  4FBT A;  4JMU A;  4ZH4 A;  4ECY A;  4IQT A;  2JMG A;  1T3Q A;  2KJ9 A;  8ICV A;  3AL0 B;  3K1R B;  1RG6 A;  3TAQ A;  3SEN A;  5DG9 A;  2P35 A;  1TVA A;  3BZK A;  2QB1 A;  1FEZ A;  2FPM A;  3HPO A;  1L7P A;  4QZ9 A;  2RDJ A;  4P0Q B;  2FMS A;  4DQR A;  3H0M B;  1T7P A;  4I2E A;  1PVP A;  4A8E A;  5J0P A;  2DKX A;  5ALJ A;  1KBU A;  4O5E A;  2DBY A;  5ALZ A;  1DK2 A;  3F2B A;  2RHF A;  4QWB A;  1NK5 A;  2Y0S C;  3F2C A;  5AKZ A;  4EEL A;  4KLH A;  3A0H U;  2MSN A;  2H3I A;  2K8A A;  4K4G A;  4ELT A;  3BQT A;  5L1J A;  4QZ8 A;  5J2H A;  2ZUB A;  4PH5 A;  3SZ2 A;  3GIM A;  2XC9 A;  3QYP A;  1ZQZ A;  4TQS A;  5AKH A;  1L3V A;  2NRZ A;  4QNL A;  4C4S A;  3BQ0 A;  1F44 A;  2Y9T A;  4ECZ A;  2JEJ A;  1Z4N A;  3GDX A;  5IIN A;  2EZY A;  2D6F C;  3IN5 A;  2FJ6 A;  4FZM A;  3PSI A;  2CN1 A;  1N5W A;  2BCV A;  3M9O B;  1HEK A;  1XC9 A;  2XI9 A;  2W3R A;  2G5I B;  4C7Z A;  5ALL A;  2RDI A;  3WKB A;  1Z19 A;  5J0X A;  1ZJN A;  2B6G A;  5CEH A;  1ZXI A;  5J2G A;  5KFR A;  3V7K A;  4YXM A;  1BNP A;  1KW4 A;  3WK9 A;  2HDO A;  3AUO A;  3QZ7 A;  5KG4 A;  1QH9 A;  3EPI A;  2NO5 A;  3JPS A;  4US9 A;  4DQP A;  4EX7 A;  4J9R A;  1S8O A;  4YQW A;  4MF8 A;  4CNQ A;  3MFI A;  1EXN A;  2LM1 A;  3TFS A;  3BZC A;  2V9W A;  4UAW A;  2IMW P;  3PST A;  3ISD A;  3PR4 A;  4DSK A;  3OJS A;  5ALQ A;  1UT8 A;  4F72 A;  4RUC A;  4RQN A;  1NJZ A;  5CP2 A;  5AI4 A;  1A0P A;  8ICX A;  1MN8 A;  3UM9 A;  5KT5 A;  1N60 A;  3QU9 A;  2H5X A;  1B0X A;  5K4L A;  5D46 A;  3PW7 A;  3C21 A;  8ICW A;  3QU7 A;  1SGG A;  5J0R A;  1NI3 A;  3N4M B;  4BXO B;  3C2K A;  4NJ8 A;  5KL1 B;  4PPX A;  1F0M A;  2EAO A;  5ALN A;  4EBC A;  1XS9 D;  2UVR A;  5AKG A;  5KNI A;  5HHI A;  5ALP A;  1XSP A;  2OWO A;  2K89 A;  5HMM A;  4DSI A;  5DBA A;  3NRW A;  3ZD9 A;  3GIL A;  3SD7 A;  2FMP A;  4NL9 A;  2W03 A;  4IRC A;  4EBD A;  2KEY A;  5D4B A;  3AMZ A;  1ZD2 P;  3D6J A;  3PW0 A;  4C8M A;  3HIL A;  1JAL A;  5F9L A;  2DGZ A;  4PHD A;  3PSF A;  4RQ5 A;  1RM6 C;  2KKV A;  1K1Q A;  1ZQC A;  5A0L A;  1X66 A;  4EBE A;  4KMO B;  3Q8R B;  1NJW A;  5J0W A;  5AM5 A;  2DF4 B;  4YD1 A;  3HKZ C;  3UXP A;  1B22 A;  2NRX A;  2WHE A;  4DCC A;  3M8S A;  1SV0 A;  1CI4 A;  1RPL A;  9ICU A;  3UXO A;  3LK9 A;  3AQF A;  9ICV A;  3UMC A;  1CUK A;  4IRD A;  4IQV A;  4KLE A;  2Z7J A;  3AN1 A;  5AI8 A;  4I2B A;  3CNH A;  3GIJ A;  4O3Q A;  1L7O A;  4J9P A;  1COK A;  3RJG A;  2LBO A;  1SZH A;  3QUC A;  3SV4 A;  2PI4 A;  3H8M A;  4RPZ A;  2WF6 A;  1OUQ A;  5AKJ A;  4AP9 A;  3MGI A;  2DWQ A;  3OHB A;  3GFK B;  4QWE A;  1NK4 A;  3T5H A;  4DSL A;  2XGQ A;  1ZQM A;  2LYA A;  5ALY A;  1J2N A;  2XGP A;  1SV0 C;  1B4F A;  2F76 X;  2JR5 A;  4YXJ A;  5DQH A;  3BJY A;  1KLN A;  1S10 A;  8ICO A;  1XSN A;  1L3S A;  2KN7 A;  2P6R A;  3NTU A;  4MFA A;  1JRO A;  2O6K A;  4GC6 A;  2V4R A;  2C2R A;  1ZQR A;  2OXO A;  3TAP A;  5KFS A;  4UB6 U;  1QQ6 A;  1J2M A;  1HIW A;  1GO3 F;  3TFR A;  2JHD A;  2FLP A;  4FS2 A;  2W9C A;  7ICS A;  3RBE A;  4G3I A;  3AEV A;  4O3S A;  4ED8 A;  4Y2U A;  1DOQ A;  3F5E A;  9ICP A;  1JN3 A;  3RB3 A;  4KLL A;  4PHP A;  1LB2 B;  1HUO A;  2EH9 A;  3PNC A;  3ETL A;  4GIB A;  3OSN A;  3ETR A;  5GTH U;  4XUS A;  2OH2 A;  4YD2 A;  8ICP A;  4JWM A;  2K60 A;  2ZIW A;  2JH1 A;  3UQ0 A;  3OTQ A;  3C2L A;  1U9L A;  2W9C B;  2L5Y A;  7ICH A;  1H38 A;  2JZB B;  3VCB A;  4O0I A;  3H4D A;  3ICX A;  4Y2V A;  3A0B U;  4Q43 A;  4M9H A;  5KT6 A;  2KG5 A;  4UAZ A;  5L1K A;  4NLC A;  2R8G A;  5AM1 A;  2W04 A;  1NKE A;  5KFF A;  4KX3 A;  4RQ4 A;  4XRH A;  2ASL A;  2BQU A;  3ORY A;  5DB9 A;  1MSW D;  4XQ8 A;  2QAR B;  5AM4 A;  5EE0 A;  3C1Z A;  3TAN A;  2NYV A;  3F5A A;  5KFK A;  5AK6 A;  1A77 A;  2IA6 A;  1ZD3 A;  3RH4 A;  3C1Y A;  2ASD A;  9ICX A;  5J2F A;  1UHU A;  3KHH A;  2GO7 A;  5KFP A;  1ZQT A;  4F5P A;  2A3V A;  8ICA A;  4I27 A;  2R8H A;  3UXN A;  4M9J A;  5AIC A;  5FP0 A;  4OJ6 A;  2KP7 A;  4F50 A;  4CF3 A;  1N56 A;  1ZQL A;  5DG7 A;  4C8L A;  1DGJ A;  4C0Z A;  5J2A A;  2J6U A;  2FLN A;  2KMD A;  5J2B A;  4RT2 A;  2WAQ F;  4BJQ A;  3Q8S B;  1D9D A;  3RRG A;  4QIW F;  2VJ5 A;  3H8J A;  2KK0 A;  1QCK A;  5J2C A;  1WWU A;  3H0R B;  4BDP A;  4MEX A;  5DQG A;  9ICH A;  4ECV A;  2KD1 A;  1B43 A;  4ED1 A;  3RAQ A;  4O3N A;  4OJP A;  3MR2 A;  4DFP A;  8ICZ A;  2ZIV B;  1TK5 A;  7ICT A;  5BOL A;  3MAB A;  3DV9 A;  1ZYQ A;  1S77 D;  1DRG A;  4OJO A;  3OJU A;  2B0C A;  2H3V A;  1WYG A;  3QU4 A;  2XCP A;  3SEI A;  2PXI A;  1X42 A;  5ALM A;  4M6W A;  3TAC B;  5CHG A;  5AI6 A;  2VJ4 A;  4YCX A;  2FPL A;  3NUQ A;  1IG6 A;  2MAX A;  4PGQ A;  3QU2 A;  4P0Q A;  3ZDA A;  1V97 A;  2EDU A;  4C8N A;  3KHR A;  3C5G A;  3C2M A;  3FAH A;  4QZD A;  1S0M A;  2BCR A;  5EWG A;  4I28 A;  3QEB Z;  2KOB A;  4JK1 A;  1JX4 A;  5CR0 A;  2WF8 A;  1PK1 A;  3ONN A;  2W8L A;  2ZUC A;  1ZQG A;  4MHV A;  1D8L A;  3WK7 A;  5KAF U;  3KKA A;  1ZOL A;  2KVS A;  1JXE A;  2KJ8 A;  5JTI A;  4YP3 A;  5KFQ A;  5KTQ A;  3IDW A;  2IHM A;  4HAI A;  4KLI A;  2YMP A;  2ZTD A;  4UAV A;  5L1I A;  2PMZ F;  2G5H B;  4QW9 A;  3MR6 A;  3EWA A;  5CJ7 A;  3EZ5 A;  2G06 A;  4B9N A;  3UPQ A;  4ED7 A;  4F5N A;  5III A;  8ICS A;  1M6Y A;  2V4Q A;  5AKK A;  3GV8 B;  4GXI A;  2HCF A;  2ISO A;  4U6P A;  3H0L B;  3QX7 A;  4KIT B;  2JEF A;  2BQ3 A;  4DSJ A;  2ZJ5 A;  5ALI A;  5IIL A;  4QZF A;  5ALW A;  1TAU A;  4P2H A;  8ICH A;  5E79 U;  3V72 A;  2HOQ A;  5KFE A;  2KIC A;  1NZB A;  4LZG A;  1NK7 A;  4EZ6 A;  3PW2 A;  2Q0Z X;  1V38 A;  3H7I A;  4UAS A;  5KFU A;  5J29 A;  3H4B A;  2IBK A;  9ICI A;  2M0N A;  1NK6 A;  5CB1 A;  3T5L A;  3IV6 A;  4DS4 A;  4DEZ A;  3ISB A;  4QZE A;  5J0S A;  4NV0 A;  5AI9 A;  5DLG A;  3K4G A;  2PFN A;  4YR0 A;  4I2J A;  4J9L A;  4UW9 A;  1BPY A;  3RJK A;  5ALF A;  2Y0S F;  3OPX A;  4DSE A;  4J9M A;  4C80 A;  3KOO A;  1ZQJ A;  1JI7 A;  5G5H A;  2HVH A;  1ZQV A;  1Z3E B;  2E8N A;  4BWJ A;  4P0P A;  2PFO A;  2AHO B;  5KG3 A;  1ECW A;  2A1J A;  2KJ5 A;  4F5R A;  4F91 B;  2VAN A;  4DLE A;  3H40 A;  1L7N A;  3WKC A;  2WF7 A;  5J2I A;  4Y2T A;  2KZM A;  2BKE A;  2ZG6 A;  1NK9 A;  5AK4 A;  1ZQU A;  1J97 A;  5HNK A;  3M8R A;  1SXD A;  2KHV A;  1Y88 A;  2VKQ A;  4I2F A;  2RLT A;  2FMQ A;  2BHN A;  4Z6E A;  3JPN A;  4M04 A;  2W3S A;  5ALK A;  3UMB A;  5ALG A;  3MBY A;  3HRD D;  2BCU A;  5KFO A;  4B9L A;  4QZA A;  4Q45 A;  5EE3 A;  3D2S A;  5J2D A;  5ALR A;  1S97 A;  4I2C A;  4OJL A;  3K75 D;  2LMR A;  1YZ6 A;  4M9G A;  1TE2 A;  2W11 A;  4I29 A;  2KTQ A;  3MR5 A;  3N97 B;  1SXE A;  2K4E A;  4OJ5 A;  2JZB A;  2W9B B;  2F8K A;  4F2R A;  1XO0 A;  4NWI A;  5DB6 A;  3PX6 A;  3JPQ A;  2QAR A;  4F4Y A;  2H3Z A;  5J0T A;  3KZX A;  2D3D A;  2H3F A;  5IIO A;  4B9U A;  3HX0 A;  3AU2 A;  2F77 X;  5B66 U;  4NY8 A;  1UA0 A;  2ZIU A;  1SL1 A;  5DBC A;  2BR0 A;  3HW8 A;  5EE1 A;  3BQ1 A;  1V85 A;  5KFX A;  1Q3V A;  4P0P B;  4RU9 A;  4RNM A;  3QU5 A;  5KFN A;  3PML A;  2AQ0 A;  1X40 A;  3C28 A;  2JXJ A;  4ECX A;  3IM1 A;  7ICV A;  4HYK A;  2HOF A;  4MEY A;  4B9M A;  1KEJ A;  5KFY A;  2IOF A;  4YMO A;  4FZL A;  3GU3 A;  1KL9 A;  3C29 A;  4KMU A;  3UMG A;  2OEH A;  4UB5 A;  3PSP A;  1ZQE A;  1Q46 A;  4RQ1 A;  1A6S A;  3T79 A;  3G6Y A;  1RQN A;  2W7P A;  4EYH B;  5KG5 A;  1K1S A;  2HHX A;  1X6I A;  4DQQ A;  3M1Y A;  2AQ4 A;  1S0O A;  1AQ6 A;  4TQR A;  1K5O A;  3KHG A;  3HKZ F;  5ALE A;  1IV8 A;  2GWS A;  1V9P A;  5AIA A;  3ZDC A;  8ICT A;  3M9M B;  2YTU A;  2A1A A;  4JV0 A;  4DO9 A;  4QZB A;  1TFR A;  9ICO A;  3QZ8 A;  8ICE A;  4YVZ A;  2EAM A;  4FZN A;  5ALO A;  2HHT A;  1QTM A;  2ZTE A;  4AYB F;  1ZQS A;  9ICA A;  2HVI A;  5J8Y A;  1X9M A;  3TAD A;  2D8C A;  1IXR A;  2WTF A;  2E1E A;  5JUM A;  1SL2 A;  1D9F A;  1NNL A;  1NK8 A;  2WF5 A;  1LKY A;  3PMN A;  4IR1 A;  1PVQ A;  2JGA A;  2A19 A;  2W7O A;  3OSP A;  4QWC A;  2Q4T A;  2WB1 C;  1C20 A;  3NRZ A;  3QXG A;  5DB7 A;  4DLG A;  2QKQ A;  4TUR A;  3JPP A;  1D8Y A;  3LVW A;  4DQS A;  2VA3 A;  2DPJ A;  4UBB A;  3I76 A;  8ICM A;  3KBB A;  9ICR A;  2PFP A;  2BPF A;  2OHF A;  4OCZ A;  2HHQ A;  9ICT A;  1ZRM A;  1RZT A;  2G08 A;  2NV3 A;  4IC9 A;  3Q8K A;  1LV5 A;  5AM3 A;  1BPB A;  1X2I A;  1IM4 A;  3H8S A;  8ICY A;  4GFJ A;  1NJX A;  1TK0 A;  5ALS A;  4DWI A;  4DS5 A;  4RQ6 A;  4K4I A;  1U49 A;  3RB0 A;  2ZUD A;  4XA5 A;  8ICG A;  4TUQ A;  2YN4 A;  2C28 A;  5TZV A;  3RRH A;  2HI0 A;  2I6X A;  1UT5 A;  2M9N A;  3RH5 A;  4UB8 U;  4Q8E A;  2MA1 A;  3DEE A;  2KZ3 A;  4DF8 A;  2XVT A;  1Z1B A;  7ICN A;  3B9J A;  3O0F A;  4LVS A;  5J0U A;  2AGP A;  2R8K A;  3C23 A;  2UVW A;  4E0D A;  1SWV A;  2C2D A;  5AKX A;  2Y9U A;  3IRU A;  4UB2 A;  5KFH A;  5J2E A;  5AIB A;  1MC8 A;  4F4Z A;  2KSO A;  4RPX A;  3RJE A;  2KE7 A;  1FIQ A;  3V7J A;  5KAI U;  1ZET A;  3FM9 A;  1JMS A;  1NZP A;  8ICJ A;  2LPE A;  1X6J A;  8ICI A;  4CGZ A;  1DK3 A;  5L1M A;  7ICI A;  3N7S C;  4Q8F A;  2LM4 A;  2Y1J A;  3MR3 A;  4RPY A;  4JV2 A;  1COO A;  1U48 A;  4UAT A;  2HBM A;  2H3Q A;  4FFD A;  2W9A A;  4J9S A;  4ICA A;  3KZI U;  2ZTC A;  3G6V A;  3EUB 2;  5KT3 A;  5J2J A;  3L3F X;  3NVZ A;  3RR7 A;  2F44 A;  4EEK A;  2IOH A;  4RQ3 A;  4ZOH C;  2N1R A;  4J9N A;  4USA A;  4IRK A;  4EX6 A;  4IQW A;  3U26 A;  2F3N A;  2BCS A;  2E1F A;  1JUD A;  3F2D A;  2XIC A;  4J9K A;  1KSP A;  2OCE A;  3N7R C;  3ZD8 A;  3GIK A;  3N28 A;  3HP6 A;  2IHN A;  2DQN B;  4F71 A;  1T8E A;  3MFH A;  2CPR A;  2WB1 F;  4ELV A;  1RYU A;  4YMN A;  9ICQ A;  1RQL A;  1ZJM A;  4UAU A;  2AXT U;  3Q8Q B;  5BOM A;  4DL6 A;  8ICB A;  1HUZ A;  1SB3 C;  1F5S A;  2EZX A;  4GXK A;  4RNO A;  4MFF A;  2BCQ A;  3LWL A;  2KIW A;  1NKC A;  4JV1 A;  3PX4 A;  3TI0 A;  5DGA A;  4EEN A;  4DFM A;  3EW9 A;  3G6X A;  3I28 A;  1TK8 A;  7ICO A;  1FO4 A;  1L8O A;  1VDV A;  2PMZ C;  2HHU A;  8ICF A;  5EOZ A;  3WK6 A;  2EZZ A;  2XID A;  3TQ1 A;  1N61 A;  3S6J A;  1YZ7 A;  2HBL A;  5ALU A;  5DLF A;  4ED2 A;  4PGY A;  1N2X A;  2ZIU B;  9ICC A;  4PL1 A;  4O9M A;  1TAM A;  1ZQA A;  4FS1 A;  2JEI A;  2XCA A;  4F8R A;  3LWM A;  2ATL A;  4RQ8 A;  2VA8 A;  1SZP A;  2DFL A;  1NOM A;  4F4X A;  1Z00 A;  1SKR A;  4R66 A;  7ICK A;  9ICS A;  1FFV A;  4ED6 A;  5KT7 A;  3WKD A;  1P7D A;  4PGX A;  2R8I A;  2BGW A;  5JU5 A;  2JRZ A;  3QE9 Y;  3HJE A;  2HHS A;  5C5J A;  2AGQ A;  5AKL A;  1SV4 A;  4J03 A;  1X9W A;  2FPK A;  5DGB A;  2BDP A;  4DFJ A;  1DXS A;  4DOB A;  3AU6 A;  1S0V A;  4ACO A;  4BX9 C;  5HR6 A;  1N63 A;  5IIM A;  3PW4 A;  3I1Y A;  1MA7 A;  5AI0 A;  1QLN A;  4KN4 A;  2LKY A;  4C4T A;  3RJI A;  1LKY B;  5AHX A;  4B9S A;  2HHW A;  2W8K A;  3WK4 A;  2ZIV A;  4Z6F A;  5DG8 A;  1QSY A;  5KL8 B;  4NXZ A;  4UB1 A;  4JWN A;  4NLG A;  4RUA A;  3BS5 B;  5KFC A;  2C2E A;  1L8L A;  5G5G A;  2WFA A;  4P4O A;  5J0Y A;  4Y2X A;  1BNO A;  4KLD A;  2B21 A;  3WKE A;  3MDA A;  1CEZ A;  2E8P A;  5HHH A;  4RQM A;  4ECU A;  4GXJ A;  5KG1 A;  3T5J A;  2PKE A;  5AKI A;  1L3U A;  2A1J B;  5KFT A;  1NJY A;  3EPG A;  1ZQN A;  3IG8 A;  3JPO A;  4Q44 A;  9ICJ A;  3GV5 B;  3L5K A;  2E8M A;  4YFK A;  1SL0 A;  2MRL A;  3D2N A;  5TIS U;  2EAP A;  3M6Z A;  4M9N A;  2KFZ A;  4LJX A;  4ELU A;  5B5E U; 
#chains in the Genus database with same CATH homology
 2A3V A;  3NRW A;  2ZG6 A;  3RF9 A;  4QNL A;  4FZL A;  1F44 A;  3IG5 A;  3GU3 A;  3L3F X;  3RFA A;  2YX8 A;  2KJ8 A;  4OJ6 A;  2W03 A;  2F2A B;  2KEY A;  3C29 A;  2G08 A;  2N1R A;  2NV3 A;  4IC9 A;  2CRX A;  2D6F C;  3IN5 A;  1T94 A;  2R18 A;  3PSP A;  3CP8 A;  4FZM A;  3PSI A;  2HBJ A;  2CN1 A;  2PMZ F;  1A6S A;  2G5H B;  2E1F A;  4BUG A;  4C0Z A;  3F2D A;  3T79 A;  1Q3U A;  1P7D A;  3ALR A;  2KHV A;  1HEK A;  2XIC A;  5T14 A;  2WAQ F;  2XI9 A;  4BJQ A;  3N7R C;  2G06 A;  2OXO A;  4CDG A;  2W7P A;  3CRX A;  2G5I B;  4QIW F;  4OO1 J;  2VJ5 A;  4GFJ A;  3GZF A;  1HIW A;  1GO3 F;  2VKQ A;  2JHD A;  3D2Q A;  2YB1 A;  2DGZ A;  2ZIX B;  1Z19 A;  2OM6 A;  2DQN B;  3H0R B;  3PSF A;  1D8B A;  1ZQ1 C;  3MGV A;  4U7C A;  2KKV A;  2HOI A;  2CPR A;  3HKZ F;  5A0L A;  4U6P A;  2E5S A;  3H0L B;  4KMO B;  3SMV A;  4QIW C;  2KD1 A;  2VIX A;  2WB1 F;  1XNS A;  2JH7 A;  1L6N A;  3SAG A;  4OJP A;  2KVC A;  2ZXI A;  3D2S A;  3CYM A;  2DF4 B;  4ACO A;  2G0A A;  3K1Z A;  2ZIV B;  4BX9 C;  3SAH A;  3LYS A;  5HR6 A;  2BDU A;  2GH1 A;  3HKZ C;  5CRX A;  2HOQ A;  2KIC A;  2KV2 A;  3F5E A;  1NZB A;  2G07 A;  4JMU A;  4OJL A;  2MA1 A;  3DEE A;  2GOL A;  2LYB A;  2OYY A;  1MA7 A;  2XVT A;  4CRX A;  1Z1B A;  5HR7 A;  2LKY A;  2JMG A;  2ZXH A;  2LHT A;  4FZN A;  2KJ9 A;  3AQF A;  3O0F A;  2M0N A;  3PST A;  4AYB F;  2OH2 A;  3AL0 B;  3LVV A;  1DRG A;  2KIW A;  4OJO A;  2K4E A;  4FE3 A;  4OJ5 A;  1WUD A;  2YB4 A;  2K4I A;  2ZIV A;  4AYB C;  2H3V A;  2Z7J A;  3M7D A;  5KL8 B;  2WAQ C;  4QJF B;  2RP5 A;  2ZIW A;  2E1E A;  2JH1 A;  1XO0 A;  4NWI A;  3VC8 A;  5C0Y A;  3E0F A;  3PZP A;  1UPH A;  1PVR A;  3N7P D;  4NV0 A;  3VCB A;  4P0Q B;  3M6K A;  3AQE A;  2ZIW B;  2H3Z A;  1A0P A;  2VJ4 A;  3H0M B;  3KZX A;  2H3F A;  2K8C B;  3ICX A;  4KX5 A;  2ZIX A;  1PVP A;  3SAF A;  4A8E A;  2LBO A;  2RRD A;  2Y0S F;  3OPX A;  3NUQ A;  1SZH A;  1PVQ A;  1KBU A;  2F77 X;  2JGA A;  4NLC A;  2PMZ C;  2ZIU A;  3F2B A;  2W04 A;  2RHF A;  2W7O A;  2KHQ A;  4CGZ A;  4P0Q A;  2K8B B;  3N7S C;  4KX3 A;  4O3M A;  2Q4T A;  2WB1 C;  2Y0S C;  5KL1 B;  3F2C A;  2G09 A;  2XID A;  1OUQ A;  4NLB A;  4P0P A;  1Q3V A;  2HMX A;  4P0P B;  1IIP A;  1YT3 A;  2F8L A;  2K4H A;  4PL2 A;  3LVW A;  1ECW A;  4WJ3 B;  3IG8 A;  2KJ5 A;  2H3I A;  2K8A A;  1CRX A;  3F5A A;  2HBL A;  3C28 A;  3IP4 B;  2HBK A;  2LYA A;  2ZIU B;  3F53 A;  2HBM A;  2H3Q A;  2MRL A;  2KOB A;  3D2N A;  1URJ A;  4PL1 A;  2KKP A;  1TAM A;  1ED1 A;  3M6Z A;  2KNJ A;  3SQI A;  2HOF A;  3ONN A;  3KFU F;  2K89 A;  4ICA A;  2F76 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...