4BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*CP*AP*TP*GP*CP*AP*A)-3')
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdpA01
2PFOA 2P6RA 4Z4CA 2RF2A 2BQUA 3SNNA 3SQ1A 7ICHA 4J9LA 4YG2A 5CZ1A 4ECZA 1MQ3A 3HYFA 4CJKA 4Z6EA 4LH4A 2OWOA 2C22A 1VRUA 3CG7A 1TVRA 3M9NB 5DLFA 1SL1A 3NF8A 1CEZA 3LPUA 4EZ9A 3L2RA 4PY5A 2WONA 5CB1A 1D5AA 2F8SA 3DOLA 1RTDA 1GOBA 1IKVA 8ICAA 3HVRA 2W9BA 2VG5A 4DTPA 1TL1A 2AQ0A 5J2AA 4O4GA 3V7JA 4RQ3A 3RH5A 3UQ2A 4F4YA 1ZQTA 9ICTA 3JPOA 4DSEA 4YFKA 1DOQA 4B9MA 3RJFA 3BGRA 3T3FA 4F50A 3RBEA 2Y1JA 2FBXA 1JKHA 2D0CA 3ETLA 5KT6A 7ICFA 4AHUA 1T7PA 2LYHA 4CF8A 2X6NA 4ECQA 2GV9A 4YD1A 2FBVA 3LP2A 5KFEA 4MFBA 1X9SA 1EXNA 5DB6A 5KFIA 4PHAA 3AVCA 4LVSA 2ETJA 5HP1A 3ISDA 5HROA 2C2EA 4DL6A 4E0DA 4YMMA 4FXDA 4C8NA 4XRHA 3C94A 1S9FA 4FJ8A 4CK1A 1KVCA 4CGFA 3OYCA 4IQTA 3LDSA 3AO2A 3TAFA 3H7IA 4CF9A 4ZTFA 3OVNA 4B9LA 3VQDA 3NCIA 3FDSA 4UB4A 5KG4A 4C8LA 4DL5A 1ZQZA 3ZSVA 3EY1A 2M9NA 1ASVA 4AHCA 3HO1A 2BCSA 5DBBA 4O9MA 4F92B 2AJQA 1A77A 5DK5A 1NKCA 4RW7A 1TGOA 3O3FA 3ZDCA 4JV2A 3I8DA 4XUSA 3Q8RB 3SZ2A 4W5QA 3K5NA 4E3SA 3OHBA 5IIIA 4LD0A 2XY6A 4F2RA 1JMSA 3OY9A 5J29A 3ZDBA 2XY7A 3E01A 5TZVA 1RBTA 9ICCA 9ICHA 3ZD8A 4FK2A 1RTJA 1KRPA 1ZBHA 2ZUDA 3VQ6A 3NDKA 4DL7A 2ZTCA 1BIUA 2ZJ5A 4HCBA 4R5PA 3L2QA 4QZCA 2KZ3A 1NJWA 4ELTA 1KFTA 1L3SA 5CZ2A 1U47A 4ED7A 4CIGA 1NK6A 2OA8A 1BPDA 2VG7A 1T05A 1CLQA 3PX4A 4FJMA 1L5UA 4DEZA 1N48A 4CK3A 4DSFA 3RH6A 4PGQA 1NK8A 3KD5E 1C7YA 1WN7A 4ED1A 1XSNA 1JLEA 3MECA 4FK4A 4F3OA 3K57A 1COOA 3DRRA 4CGHA 1IH7A 3AA4A 4KHSA 5KFKA 4Q45A 2F1HA 3ISNC 3MAQA 3VN5A 4KN4A 3I0SA 2BKEA 4DQIA 4G1QA 4PGYA 1SL2A 3SQ2A 3WNGA 3OJUA 1TAUA 4DU3A 4R63A 2ITGA 5DKWA 1RYRA 4FCYA 2JZBA 4B9UA 4QZFA 4RQ1A 3TFRA 5KFNA 1RT5A 1Z25A 4FJIA 4Q8EA 3V7KA 4FS2A 1CZ9A 8ICLA 1TKZA 3PW2A 3C23A 2A1JA 3OYGA 1JXBA 2NRWA 1EXQA 4ELUA 2W9CB 5HMMA 4GVMA 5KG1A 4ICLA 3A2FA 1T3NA 2PXIA 3QERA 4RZRA 1U49A 4DFJA 3AU6A 1ZQPA 4KLUA 2G8VA 4KFBA 2HNDA 1QQCA 1N6QA 2BE2A 4IBNA 3MGIA 1B22A 4O5EA 2OZSA 3Q8SB 2I1QA 3U3YA 3RR8A 3HP6A 3PUFA 4QWDA 3V6DA 1TK5A 5KG7A 4KTWA 2UVWA 4CF1A 4Z4IA 1ZQVA 1FXXA 3OGUA 2XC9A 4FO6A 3DYAA 4C8MA 5D3GA 4BACA 4O5CA 5J2GA 1ZETA 4QZGA 5IIJA 4P2HA 4FM1A 4B9NA 5FRMA 1BHLA 5KT4A 5KT7A 1JLBA 3SI6A 5EOZA 2PZSA 2KTQA 3V1QA 3GV8B 3RRHA 4RQ2A 4FM0A 4QZ8A 4KHNA 4CJQA 4YD2A 4AHRA 1TKXA 2MAXA 4PHEA 2PI5A 1BVSA 4BXOB 4QAGA 3DLHA 1VSHA 1UA0A 1UOCA 1AROP 1S5JA 4CEDA 4N41A 3SUPA 3H8SA 3M9OB 1IKWA 1DGSA 4XA5A 5BOLA 1C0MA 3KLGA 8ICJA 1Z26A 2XY8A 3U3GA 2IGIA 1X1PA 1FKPA 5SWMA 5EU7A 1QS4A 4M9GA 4OKEA 3RR7A 1QLNA 4E7LA 2V4RA 3AUOA 2R7YA 4YN4A 4NM2A 3JPNA 4E89A 5DG9A 9ICQA 1KVBA 1LW2A 4OKJA 4GC7A 4FBUA 5DLGA 5L1JA 4F4WA 1HMVA 4DQRA 4RW8A 5J2PA 4FLWA 4NY8A 2OPPA 5D49A 1RDCA 1UA1A 5I3UA 1NOZA 1C0TA 4Q0BA 9ICXA 2P51A 2BCUA 3NH1A 3AVBA 3LK9A 3VQEA 1JXLA 2JEJA 4MFAA 2BDPA 4CFBA 4TUSA 3PW0A 3RAXA 5HHIA 4IQVA 1S0MA 4CGIA 4YFUA 2LSNA 9ICVA 4CK2A 1BL3A 2BCRA 2HHVA 3NGDA 3KJVA 2W9MA 4ID5A 3C95A 4CECA 3SPYA 2OYQA 4FW2A 1ZQHA 3THVA 2XCPA 3S3MA 2OPRA 7ICTA 4HUGA 4RT2A 4RQ0A 2HHTA 3DI6A 4EYIB 5D46A 1J54A 3AO1A 3CM5A 5KFPA 2WOMA 3QESA 3OYAA 1WSEA 4P4MA 4P4PA 3B0YA 4O44A 4QZIA 1B92A 2PFPA 1VSEA 3AA2A 9ICAA 4CFAA 1ZQNA 3V9SA 5J0QA 1S97A 4DF4A 5DGAA 5IIMA 4RW9A 5DDYA 2XY5A 1VSLA 8ICMA 3ZSOA 3K5LA 4DTXA 3QNNA 2ATLA 4ED8A 2KFZA 4W5OA 2VA8A 4N76A 3AVKA 1Q8IA 3OHAA 3LZIA 2IA6A 4F4XA 4CJLA 4CEOA 1JLAA 5KFTA 4M3RA 5J2DA 2JEIA 5KFRA 4F91B 3E2EA 3OSPA 5HRRA 5J0RA 3L2VA 4RPZA 5JS2A 4E1MA 4FBTA 4O3NA 2HHUA 4DO9A 3L2WA 2ASLA 9ICJA 2Z1HA 3ZDEA 1JXEA 2KFNA 4B9SA 4KPYA 2B4JA 1U48A 4M9LA 3MR2A 1HUZA 2B21A 4K4IA 4IKFA 4J2EA 3LAKA 4IRKA 3I0RA 4BE1A 3QNOA 4J9SA 1BCOA 4TSXA 5KGWA 2QK9A 5HBMA 4I2HA 1D9DA 3H40A 8ICSA 3P83D 1O1WA 4NYFA 4IG3A 4NLKA 3ASMA 2XO7A 4KLMA 2UVVA 3RMDA 4KLJA 2UVRA 3HPHA 4P4OA 1RT2A 1S0VA 4WE1A 4DWIA 3RB4A 2VWKA 7ICRA 2HVIA 1JLFA 4R66A 1RILA 5KFCA 3ITHA 3HP9A 3S9HA 4KHUA 1Z00B 3VQ7A 3OYJA 2DFFA 4KAZA 1C1CA 2R8KA 3BQ2A 4QZ9A 4KLIA 3T5JA 3RAQA 4O5BA 3BQ0A 1EETA 3L3UA 3LP3A 7ICPA 3TABA 1YTUA 1LV5A 3TAQA 4CJ5A 7ICOA 4YNQA 1S1WA 1XS9D 4DF8A 3RH4A 2E4LA 4J2AA 4C8KA 4CHPA 4ECYA 4R64A 4BDYA 3ZCMA 5DBCA 2BHNA 4TQSA 4B08A 3CYMA 3GIMA 7ICJA 7ICNA 1BPXA 1HYVA 4BDPA 4MF8A 2ISPA 2P5GA 4ED3A 3TARA 3NF6A 3VQCA 8ICHA 4FZYA 4BWJA 3G6YA 1NJZA 3CFPA 4FLYA 4OGEA 5KG6A 4ZTJA 2RN2A 4ID1A 4NCBA 9ICMA 5J2JA 2NUBA 4UB2A 4PPXA 2BQ3A 4CJFA 1JN3A 5HMLA 1NJXA 4KLTA 3L3VA 3AVFA 2GUIA 4DTUA 2BPGA 3RJEA 3LAMA 3GIKA 8ICVA 1GOAA 3DLBA 3AVAA 4Z4FA 4Z4EA 8ICZA 9ICNA 4CE9A 4DG1A 4YXMA 2B5JA 4KRFA 5CYQA 1TKTA 1N5YA 5J0UA 4PGXA 3VQBA 3VQ8A 3KKRA 4ED0A 3PX0A 1RBVA 4BE2A 5C24A 1XC9A 3ZT0A 3AVGA 5DB7A 2P66A 3NH2A 9ICPA 2A1RA 1WSJA 4CEZA 1MC8A 3V1OA 1XSLA 4FLXA 3SYZA 1B9DA 4EEYA 4I28A 3BQTA 5E41A 3V9ZA 4EBCA 2ZQBA 5L1KA 1IO2A 4RUAA 5KFZA 5F9LA 3MDAA 5KFAA 3MR5A 3HK2A 5BPCA 4I2JA 3OYNA 1TKDA 4FJLA 5DQIA 3UXNA 3D45A 1XI1A 4FLTA 1EP4A 5BOMA 4O3OA 4EZ6A 2RDIA 4KITB 4CERA 4DTOA 3NTUA 4ED2A 9ICOA 1NK9A 1J5OA 2XGPA 8ICBA 4ECVA 4FYDA 3UXPA 3IS9A 1YTAA 1TV6A 4KB0A 3OYMA 1ZQAA 4CJEA 4JUZA 4Q8FA 4FLZA 1NK0A 3AA5X 4HHTA 3T19A 3AVMA 2DFEA 3TAPA 4GMJB 4DSKA 4OJRA 5CHGA 1RBSA 4CF2A 4FJJA 3EYZA 4CGDA 3PR5B 1DLOA 4M42A 4IQUA 3O4QA 3JPPA 1RT6A 3KHHA 3VQ9A 1ZQXA 3EWAA 4DTSA 3OJSA 2ZUCA 1G15A 3WNHA 7ICLA 2YNFA 4F8RA 3QLHA 3PO5A 5L1IA 2A1SA 3QIPA 1K1QA 4M6WA 4F4ZA 4QZDA 4M41A 2HNZA 3OYFA 4CIFA 2P6UA 4LH5A 4KTQA 2HHXA 2QXFA 4QWAA 1BPBA 4F5NA 4M6WB 4EP4A 4F4KA 1S0NA 3M8SA 5J0YA 1HJPA 1RTIA 4XQ8A 4H8KA 4I27A 4M9NA 1ZJMA 4DQQA 4LZDA 3B6OA 1RBRA 2O4GA 5J2NA 3ISBA 5FRNA 1SUQA 4K8ZA 1ZQQA 2IMWP 3RJIA 3NFAA 1RXVA 2NRVA 1IG9A 5KFHA 4CHOA 2KZZA 4MF2A 3T5HA 2YKMA 3OYDA 1WNSA 5IIOA 2OPSA 4KLLA 1RDAA 3QZ8A 3AO4A 2B6AA 4RNNA 4GLXA 4J9RA 4R8UA 3ALYA 5K14A 3C1YA 4E7IA 4Z6DA 4RPXA 3WNEA 4PHDA 1I39A 2P5OA 3AO5A 4LSLA 3KK1A 4Q5VA 2XGQA 4HVJA 2BGGA 3AVHA 4CEQA 3LDAA 1TVAA 7ICGA 3C6TA 4PH5A 4YXJA 3GDXA 1S9GA 4PA1A 5KRSA 4FK0A 4OGCA 4QZAA 2IS3A 1NK7A 2O4IA 5J0TA 3O4NA 5KFOA 1WSFA 3VQ5A 4GXIA 8ICPA 4OPKA 3KK3A 4YVZA 3CFOA 3VA3A 3CM6A 4GXKA 1BPYA 4CJ4A 4CGJA 3UPQA 2YHAA 1ZQEA 3F9KA 3V72A 3C5GA 7ICEA 8ICFA 4NXZA 2BCVA 4CFCA 3RMBA 2YV0X 3S3OA 3ZDAA 4UAWA 1J53A 1L3UA 4L8RB 2HW3A 4IFYA 3IHQB 3SUOA 3MEGA 4IR9A 5T7BA 3T1AA 4MQ3A 4EBEA 7ICUA 4RQ8A 4OVLA 5J2HA 2FMSA 3GV5B 2R8IA 1ZQGA 1EKEA 4IRCA 4M47A 3N4MB 3Q8KA 3ZSQA 4NLGA 1RT3A 2BCQA 4DQPA 1Q9XA 4QZEA 2F8TA 1RXWA 1NKEA 2BPFA 3BDPA 2A1JB 4Z4GA 3GQCA 4DTMA 3TAGA 3RTVA 3QEAZ 3JPQA 4I9QA 3RJKA 4EP5A 2KN7A 1SKRA 3IG1A 3KTQA 4I2GA 4KI4A 3L2UA 2W8LA 2P1JA 2JGUA 5J0OA 2G8FA 2JEFA 3RMCA 1YT3A 1KFDA 1ASUA 4KN7A 4E7JA 4FJ7A 4RUCA 2OZMA 1HNVA 1VSFA 1QE1A 7ICMA 3RMAA 4QOZB 9ICEA 4JV1A 1UWBA 4RNOA 9ICIA 3JPTA 4QWEA 4KV8A 3S3NA 3OYIA 4F2SA 2JZBB 3QEBZ 1JX4A 3RBDA 1Z00A 1CUKA 5CYMA 4OLAA 4CHQA 1ZQOA 2HHSA 3MABA 3PVXA 4LSNA 4Q44A 3H8JA 3L8BA 3Q8QB 3RB3A 3UXOA 3NF9A 3SV4A 1ZQLA 4M3TA 4DSLA 4N56A 3VQ4A 2ASJA 1ZQMA 3LANA 4CJUA 4FJGA 4R8UB 5KFYA 4Y1CA 4EBDA 1LW0A 4DSIA 1D9FA 1SL0A 1YVUA 4I2IA 1S1UA 3UQ0A 4RW4A 1XU4A 1A5VA 4KLGA 3TQ1A 9ICFA 5KFLA 4OKKA 3TAMA 4HYKA 1QSYA 2YNHA 1D8YA 5KG5A 5DG7A 3GFKB 3TANA 4EYHB 5CY4A 4CFDA 1WCNA 1UT5A 8ICGA 3LWMA 4CEEA 1T8EA 2MUTA 3HWTA 4OPJA 3LZJA 3H8WA 1KCFA 1B43A 4E1NA 1IM4A 2DPIA 1C6VA 1RT4A 1HNIA 4M3ZA 4GW6A 5J2MA 2NRXA 8ICCA 2W8KA 2G8UA 1TFRA 2UVUA 3RB6A 1BPZA 2Q3SA 3NGZA 1S10A 4CCHA 4Q43A 5F9NA 5DMRA 3VA0A 2IAJA 8ICWA 4JS4A 3V4IA 4N47A 4UB5A 2D5RA 3NHGA 4FLVA 3NGYA 3C1ZA 3QIOA 1ZYQA 3LPTA 2IDOA 1L3VA 1A76A 2ATQA 3K5MA 3MXIA 5FROA 4RW6A 5C25A 8ICRA 3EPGA 3HL8A 5KRTA 2R8HA 4CJRA 4FVMA 4X5VA 2AGPA 3TI0A 1WAFA 4JRPA 1NK4A 2Q0ZX 2GBZA 2W42A 4DU4A 4I2QA 2XCAA 4F5OA 4DTRA 3V6KA 1IKYA 5DG8A 2FMPA 3ZDDA 4CHYA 4BGDA 3T5KA 2YHBA 4HUFA 2FC0A 2AQ4A 1RZTA 1IXRA 2H5XA 3QEWA 1L3TA 4DMNA 1BCMA 2J6SA 1JL1A 4CHZA 5L1LA 1LWCA 3TAEA 4ED6A 3DRSA 1RT7A 5DQGA 1HUOA 1D8LA 4NCGA 2X78A 7ICVA 1RCHA 1BI4B 1A5XA 1NOYA 3PY8A 5DB9A 1BQMA 1UAXA 3H4BA 4I2FA 4M3UA 2AGOA 1RTHA 2ISOA 4O3RA 1MSWD 8ICIA 2KQ2A 4I9LA 3WNFA 5J2KA 4DL3A 1CXQA 1NJYA 4KHWA 4O3PA 1VSIA 3QEIA 1TK8A 1RNHA 4MFFA 5J2CA 4FS1A 4ECSA 8ICTA 4UB3A 2IC3A 3NBPA 3NAEA 4ELVA 4I2BA 1SKSA 2FPLA 4IRDA 4CEFA 1VSMA 5KFUA 4W5TA 4KHQA 5I42A 4KLEA 4M45A 3PW7A 4E19A 3KHLA 3PV8A 4RQ6A 4KLHA 2DTUA 3G0ZA 2X74A 4LZGA 3DLEA 1RDDA 9ICGA 4JRQA 4KLOA 1S76D 3C21A 3JPRA 1WAJA 3UIQA 1ZQJA 3H4DA 3TWHA 2PYJA 3QZ7A 4O0IA 2ZUBA 1VRTA 4RQ4A 1RDBA 5KG2A 5J2FA 1ZQIA 1HYZA 5J2IA 1UT8A 2PYLA 4J9NA 3KHRA 4J2DA 3KLEA 1LAWA 3ZSXA 4FW1A 5CWRA 4F93B 2VG6A 5KFBA 3M8PA 3MXJA 1U4BA 4I2EA 4YMNA 3RB0A 4PUOA 4DLGA 2YKNA 3SCXA 2F1IA 3G10A 3PX6A 1ZQUA 3ZT2A 1CXUA 1S1VA 1WSHA 4J9MA 3QINA 5DB8A 5IINA 5J1EA 5KFWA 4FZXC 1ZQCA 1VK0A 4M3WA 5J0XA 1QSSA 4UAZA 3CQ8A 4CGGA 5D4BA 4PQUA 2IHNA 3NE6A 2FBYA 5C5JA 3HPGA 1FK9A 3ISCA 3ZSZA 4JWNA 4FJXA 2EX3A 3V9XA 1X2IA 1I3AA 2I5JA 1ZBLA 3DLKA 2WTFA 5JUMA 1XO1A 4DOBA 8ICNA 4IFVA 1Q9YA 3DLGA 3DM2A 4AH9A 3HW8A 1J9AA 2RDJA 4KKOA 4JS5A 5C42A 2J6TA 2VWJA 3C2KA 4QWCA 4CJSA 3K58A 8ICOA 1RBUA 3JSMA 5KFVA 1HRHA 1RT1A 4KLDA 3OS2A 2C2RA 3NGIA 1RPLA 2YNGA 4F3TA 2VA2A 3C6UA 4YQWA 4AHVA 3HJFA 2Z1IA 4RNMA 3PNCA 4K4HA 1K6YA 1SZPA 4CJTA 5EWGA 4MEXA 1X9MA 1ZQSA 3MFHA 3RJHA 3TR8A 4CESA 2C2DA 2I9GA 2FPKA 3ZSYA 4W5RA 3GIJA 4FJ5A 3P1GA 4DLEA 3RJJA 2DPJA 5CP2A 3HM9A 4F5QA 2XHBA 2AGQA 1XSPA 5J0PA 8ICEA 4I2CA 4PWDA 3IRXA 1KEJA 1T4GA 2G8IA 4Z4HA 1S1TA 2PY5A 2RKIA 1BQNA 8ICXA 3C2LA 1TL3A 3KKSA 4MEYA 1LWFA 4CEAA 4IQWA 3SJJA 3Q8PB 8ICUA 1S9EA 5J0WA 1LWEA 4QZHA 4YP3A 5SZTA 4FJHA 3SPZA 1ZBUA 2GWSA 2HVHA 3F73A 2HHQA 5KFXA 3HT3A 2R8JA 2Z1JA 3OYKA 3JYTA 4M9HA 4R65A 9ICUA 2ZE2A 2KZMA 1C1AA 1LAVA 4B8CA 2V4QA 1KSPA 1XWLA 1SV5A 7ICSA 4I2PA 5KFQA 3IM1A 3AV9A 3DMJA 3V81A 4FJ9A 2BR0A 1ASWA 3LALA 4DFKA 2ZTDA 1HPZA 1VSKA 3V9WA 2Z1GA 4O3QA 2IBKA 3ZT3A 3ZSWA 2F96A 3RRGA 2DFLA 2DFHA 1ZQRA 1TAQA 2AU0A 2F1JA 2BANA 2ZJAA 4FLUA 5HRNA 1XHXA 2EHGA 1BIZA 1LB2B 5DGBA 3QETA 9ICLA 1WSIA 1N56A 5DQHA 3PMLA 1BGXT 4I7FA 1JLGA 4JK1A 5KFFA 1ZQFA 1KFSA 1JLQA 4JLHA 4NCAA 4FZZA 2IHMA 1XHZA 2NRTA 5KFGA 4MFCA 3C2MA 3ZSRA 3KIOA 3PR4A 2ALZA 8ICQA 3B6PA 5DBAA 1ZBFA 3MEDA 4JV0A 3FYHA 1S6QA 5KTQA 4QCLA 3FFIA 4DL4A 2G8HA 3K5OA 4E7KA 8ICKA 1KVAA 1TV9A 3G6VA 2ZD1A 4JWMA 7ICIA 2FLPA 3O3GA 4NLZA 4J9OA 3OSNA 3M8QA 5KT5A 3EZ5A 4DQSA 4TUPA 3NF7A 4CJWA 1VSJA 3HXMA 1U04A 1NK5A 3P5JA 2YNIA 3M9MB 3SUNA 5J2QA 3AA3A 3QO9A 1DTTA 3HPOA 2HB5A 4M2YA 3C5FA 5KG3A 2XRIA 9ICKA 4N5SA 5IIKA 2NRZA 4CHNA 4YR0A 3OYHA 4H4OA 4DFPA 5L9XA 3LP0A 4O0JA 3O3HA 3ZD9A 4M3XA 5CA7A 1HJRA 4RPYA 1HYSA 4ZH4A 4ZHRA 3K59A 4M9JA 4KHYA 3AU2A 2PI4A 3EPIA 3MDCA 4FM2A 2JLEA 3NH0A 2RPIA 5HRSA 3VQPA 4KREA 5KT3A 3TFSA 1KTQA 5KGXA 1WSGA 1HQEA 1S77D 3V6HA 1TK0A 1W0HA 4GXJA 4KLSA 3CFRA 2W9AA 5JS1A 1ZJNA 1EX4A 4DFMA 2BGWA 3MFIA 3KD1E 4NYNA 3AVLA 1MU2A 5J2EA 4PHPA 3KLHA 4TURA 2ZTEA 4QWBA 1IKXA 5KT2A 4DU1A 4TUQA 3HX0A 3KHGA 3RJGA 4CF0A 3JPSA 1JLCA 3ORYA 3G6XA 5KFDA 4J2BA 1U45A 3KLIA 3BQ1A 2PFNA 4M04A 4RG8A 3SV3A 1C0UA 3T5LA 1BI4A 4K8XA 9ICBA 1JL2A 3Q8LA 3HVTA 4AHSA 4Z6CA 3AO3A 2QKBA 4KMUA 4I2AA 4KLQA 4H4MA 3QEPA 3LWLA 4ECXA 4CIEA 1WCLA 7ICKA 3V7LA 1ZQBA 3PO4A 4QW9A 5EWEA 3OS0A 9ICSA 4O55A 3ULDA 2E6MA 4FJKA 5KI6A 1ZQKA 4BE0A 4J9PA 4YR3A 4KTZA 4RQ5A 1NKBA 1GOCA 4J9KA 1CZBA 4QW8A 9ICRA 3PW4A 4BXOA 4KLFA 2FPMA 3MBYA 4NLNA 4DTJA 3AVJA 1X9WA 4UB1A 4ECTA 9ICWA 4HTUA 5J2BA 4FJNA 3SUQA 3MR3A 4DS5A 2DY4A 2IOCA 3MXMA 1QHTA 4AILC 4W5NA 1QTMA 4O5KA 3K2PA 3MEEA 2HNYA 2FLNA 4YCXA 1ZQWA 1HQUA 1BPEA 5HLFA 8ICYA 3GILA 4DSJA 4Z0UA 1R0AA 3OYLA 1S0OA 7ICQA 2BQRA 1ZBIA 4QZBA 4IG0A 1K1SA 2D0BA 2V9WA 2VA3A 3GV7B 5IILA 1KLMA 4Y1DA 3V6JA 1JIHA 4UAYA 4I2DA 4IR1A 4KI6A 3N97B 3RWUA 2ASDA 4C8OA 3AVIA 3AVNA 2QKKA 5CR0A 4ECWA 1QSLA 4DOAA 5KFSA 1Y88A 4CJPA 4RU9A 1S6PA 1REVA 4ECRA 3MR6A 2W9BB 4HUEA 4YR2A 5J0SA 4CEBA 3SI8A 3BJYA 2E6LA 1Z3EB 3K4GA 2PFQA 3DRPA 1FKOA 4YMOA 4NM1A 4ECUA 1NOMA 3M8RA 2FLLA 5DDMA 4I29A 3PMNA 3OS1A 2KW4A 2FBTA 4BDZA 1WLJA 5CJ7A 3QEVA 1B9FA 2G8WA 4KB1A 5HRPA 4DOCA 5KG0A 4B9VA 1Y97A 3H08A 1BISA 3DOKA 4B8AB 3HSTB 3GIIA 4TQRA 5EWFA 1W9HA 4B3OA 4BWMA 3VQQA 4CJ3A 3B0XA 2MUTB 4UQGA 2J6UA 2G8KA 2X6SA 4RQ7A 4Z6FA 2BPCA 4XIUA 5KFJA 3KLFA 3ZT1A 1C1BA 3SQ4A 5HP4A 5HHHA 1KLNA 4GC6A 1KDHA 4M0AA 1A5WA 4CJVA 4F5RA 3OYBA 3OYEA 3DLRA 2R8GA 3MGHA 4M3YA 4KO0A 4E7HA 4DS4A 2JEGA 3V9UA 3ZT4A 3U6FA 3KK2A 3SQ0A 4O3SA 3Q8MA 1MQ2A 3QEXA 3PW5A 3VQAA 1H38A 1SKWA 1RYSA 4UBCA 3LP1A 4J9QA 3D0PA 4G3IA 3V1RA 1ZQYA 2ZJ8A 4LY7A 1DTQA 4F5PA 5HNKA 1VSDA 2Y1IA 2D0AA 4OLBA 2OPQA 3EW9A 4DTNA 4B9TA 4HCCA 1V9PA 2HMIA 4DL2A 4RT3A 5FDLA 4AHTA 1ZQDA 4IDKA 4UBBA 4K4GA 1S1XA 2C28A 1F21A 2HHWA 2VANA 3QE9Y 1T03A 2FMQA 3K75D 2W9CA 3IAYA 1ITGA 5KFMA 1PZNA 1U9LA
chains in the Genus database with same CATH superfamily
2RF2A 4DX6A 2EFOA 1P90A 1XMOK 3SQ1A 4KHRA 1B0XA 4CJKA 3HYFA 1UPPA 4OHYA 3FZMA 1TUVA 1VRUA 1Z1ZA 3UCZP 1CEZA 4S0MA 4I1TA 2B9WA 3LPUA 2HG4A 4LF6K 1VJWA 3DLKB 3L2RA 1F0MA 1EQ0A 3IR6B 1RTDA 2XMVA 1IV8A 1GOBA 3QQCD 5AXKA 3O08A 2AQ0A 5DDPC 3M1FA 4O4GA 2JH3A 3A8IA 3RH5A 3GP9A 1VQNS 3UQ2A 2LKYA 1FNOA 4U7BA 3BM7A 4BJQA 3QUTA 3JPOA 4DSEA 4YFKA 4Z37A 3NAIA 3BGRA 2H65B 3QUQA 4F50A 1IJJA 1JKHA 2D0CA 1SH0A 7ICFA 5C2FA 1GLEG 1T7PA 4AHUA 2CPRA 2EK6A 2GV9A 5KFEA 2BJ1A 2P9IA 4MFBA 2R7SA 1F9FA 3I1YA 2DBYA 4X64J 4I56A 1KHVA 2CQHA 2YQ1A 3CDEA 4AF1A 2ETJA 1CULB 2C2EA 2VPYB 4ACOA 4CNZA 1S57A 2KHCA 4U8VA 3D2FB 4FXDA 1RLCL 3UKUB 1RLDA 4HL9A 2E2OA 1WC3A 4P6QA 3MX5A 4IQTA 2EG1A 2I2YA 4AUKA 4OX9F 4CF9A 1V9OA 3DN9A 3NCIA 2KH9A 4C8LA 2RUGA 2KHOA 3M4XA 1C1CB 5D4LA 3EY1A 1S1TB 2BKPA 3WXKA 2YMLA 1T95A 3QFWA 4U7CA 1A77A 2VYPA 5DK5A 4KYZA 2LQBA 4JV2A 2MKSA 1U2CA 4XUSA 3I8DA 4PWDB 1IBLJ 3W60A 1HNWF 5HSPA 4H4KC 1RHMB 3BGUA 2ITMA 1X9JA 1SAZA 1Q4RA 4FKXA 3VESA 3OFFA 2BW2A 4OJ5A 4NLWA 3OY9A 3FRYA 3ZDBA 3WU2U 5IWAF 9ICCA 1NXIA 1F2GA 3ZD8A 1A0OB 4ZVRB 4FK2A 2X1FA 3NMRA 3CB4A 3NDKA 2NSCA 4DL7A 1Q16B 3N7PD 2ZJ5A 2HFNA 3HHKA 4R5PA 2E1MC 1NJWA 2KKPA 2FVCA 3N6NA 3CTRA 3MM8A 3CETA 4QPXA 4BRNA 2CA9A 2E5SA 2UUBF 4QS7A 1JK9B 4KH6A 4CK3A 5FPMA 2DEJA 1NK8A 1GLLO 1HD0A 1WN7A 1S49A 4P71A 2P6SA 3BGOP 1FXDA 3DLEB 4M5MA 1NGEA 2Q0UA 1JLEA 4B3MK 5D4OA 5ALEA 1DJ0A 1XC3A 3AA4A 3ISNC 2FJEB 4UUWA 2VDHA 4FPAA 1T9VA 2F4VF 2RQMA 3S8SA 2H3EB 2BKEA 1BY9A 4G1QA 1JRPA 4OYBA 4NMXA 1F5SA 2FJBB 3CCVN 2JZBA 4QZFA 2RHKA 1YWXA 5KFNA 4IO1A 4FJIA 4Q8EA 4NEZA 3PW2A 2VC1A 2PEBA 2KD1A 3VC8A 4KBIA 4UOCA 2PMZD 1EARA 1X5PA 2ZBRA 4A5BA 2AYBA 3QERA 3CJTA 4DV2K 1QM9A 3S6EA 2DGVA 4Q0BB 5ETNA 2QEXN 4DR5K 4NXMJ 4L3KA 3VAJA 2BJ3A 4J91A 3LDPA 2ES6A 3JAMU 3NGSA 2I1QA 5JJBA 2KEYA 3U3YA 1FO1A 1TU0B 1WWHA 1KWMA 4FZVA 2ZM6K 5IV4A 4QWDA 4DPTA 2R2SA 3CJ7A 3C16B 4I2PB 3IRUA 3O5TB 5FLXO 1WYGA 3THXB 4Z4IA 3OGUA 4FO6A 4LR9A 1SQFA 4C8MA 3O1LA 4O5CA 5J2GA 4CO1A 4QZGA 5KPZA 3EVWA 2XHCA 2HFVA 1UVMA 5KT7A 1EWQA 3CCTA 1BXNA 1LKYB 1VI7A 5AQGA 1UFKA 2LI6A 1JI7A 4QZ8A 4YHHK 4CJQA 4V19S 4IO8A 4AHRA 4B3RF 2KFYA 1TKXA 4NLTA 2RQKA 4GV9A 3KXDA 1BVSA 1RU1A 4X62J 2VU5A 3DLHA 3EEQA 3AB2B 1U1OA 2Y1LB 2E5HA 3TACB 1Y3KA 5IQQA 1UOCA 1AROP 4CEDA 4ZP7A 2R7RA 4JHDB 2ZJPL 3SUPA 3T1HF 3AL0B 4XA5A 5BOLA 2MKCA 2M70A 3O9SA 5ALYA 2XY8A 4NZ0A 5A0YA 3K9KA 3U3GA 2IGIA 3CJSA 4X4VA 5EU7A 4M9GA 3TVZA 2G2YA 2K4EA 4YOUA 4KT0C 3RR7A 2MLYA 3O6WA 1KAXA 3C2PA 5KPRA 2R7YA 2HHHF 3SEIA 2CYYA 2FY8A 4LFBK 1AA1B 3K7RA 4U9RA 1JJHA 1UVLA 2X1BA 4OKJA 4FBUA 4NO7A 4Z2XA 1V3SA 2AYGA 3L6QA 5BN8A 2Q36A 4ALZA 2O66A 1YIJN 1F3VA 2DH7A 3PJ9A 4NY8A 2XMKA 3BEXA 4BX9C 1UA1A 4PYAA 1VQ9N 4NLDA 4X4SA 2GOLA 5I3UA 3ULEA 1NOZA 1X4AA 1T9YA 5JLHA 2P51A 2BCUA 1YRTA 4FPIA 3H5XA 3LK9A 4LF7F 1N62A 1Y5NB 4DHVA 5CYQB 3MUVP 3JB9k 2OTLN 2A2DA 2BDPA 2RP5A 2YVSA 5ALKA 1QAJA 4CFBA 4TUSA 3PW0A 3HRDD 4IQVA 2GH1A 4WTOB 3CXCM 4CGIA 1JJ4A 4DV7J 3CMAN 2KO1A 4CLKA 1L8OA 4CK2A 1S6QB 3FMWA 2HAIA 4CLLA 4CZCA 1PYSB 1FRJA 2ABYA 1ZQHA 3CQXA 4GV3A 1N60A 1VK3A 1UHUA 1VBYA 4M63C 4RQ0A 3I56S 4EYIB 3QESA 3OYAA 5A8KB 4P4PA 1UMJA 3B0YA 2ZH1A 3QMLA 1L7PA 2KJVA 4AQYF 2W3SA 1BOTO 3EUB2 3T1YJ 1ZQNA 4F7VA 3GOIA 1OWXA 5J0QA 1S97A 4NV0A 2ROEA 5CYJA 4RW9A 2XY5A 4ZPAA 4HVZA 4CBXA 3ZSOA 3QMQA 2W01A 1MWQA 4W5OA 3IBPA 2E5LJ 3BDEA 3CXCR 2P9UA 2V2KA 1UEVA 1TV6B 4OHVA 2HIQA 3B8HA 1HJOA 5HR6A 1W2BM 2F76X 3OSPA 2YX8A 5J0RA 1YITS 2MJNA 1P7DA 1N54B 3TTFA 4HTIA 1N5YB 4FBTA 2HHUA 2BX6A 4I6WA 4DV6F 5BPNA 4H4OB 3KG4A 3OR2B 4DR2F 4CDIA 1DHMA 2Z1HA 4BRAA 4QBUA 1HBOA 2OEKA 2EFNA 1HHQA 4FVCA 1NB2A 1F5AA 1HUZA 4IO9L 3LAKA 3VAFA 4IRKA 3I0RA 4JKGA 4CE6A 3ET6A 4DCHA 3W62A 1TMJA 1BCOA 5JLFA 5BR8F 2HMIB 1R0AB 4TSXA 5KGWA 2NZ4A 1D9AA 4PUOB 4I2HA 8ICSA 3P83D 1O1WA 3MAHA 2EI5A 2J7UA 2XO7A 4BR7A 4QU7A 1HKGA 3TJ9A 3JSMB 3BSOA 4P4OA 2FYXA 1FKAF 2G1HA 1JLAB 4K59A 4LRCA 2HVIA 5AICA 2BOPA 3THWA 5KFCA 4JI5F 2D1KA 2JFDA 3U26A 3FSXA 3OYJA 4B3RK 1B7FA 4K4WA 4BRFA 5D0GA 4EEKA 2E1CA 4KLIA 3KJNB 2D3UA 3LP3A 2KHQA 2QX0A 7ICPA 3TABA 4PXEA 3IP0A 1YTUA 1W2BR 2MTLA 4US9A 3M3ZA 4YNQA 1YHQN 3CD6N 3QUCA 3J7A1 4J2AA 2W4DA 2WF9A 2XMUA 5DBCA 3NWGA 4DKWA 4B08A 5LY3A 2Z7JA 3GIMA 4CLWA 2HSTA 7ICNA 1BPXA 5I4MA 2DL0A 1OPIA 4ATNA 2GMHA 4BDPA 1QE1B 1Q53A 2LM1A 5BYRA 5DM7L 2QRRA 2VL1A 3JSYA 2Y9HA 1R89A 1OVQA 3I32A 4FZYA 3BUZB 2W11A 4JI3F 4ZTJA 5J2JA 5BR8J 3TZZA 2NRRA 1U0HA 5DDQC 1ZXIA 4KLTA 1YVNA 3L3VA 1HI0P 1NJIT 3AVFA 3THYB 2QMWA 2JSXA 2HYIB 2L5YA 4IEIA 3CD7A 5TKYA 4YORA 4Z4EA 4BRGA 4DG1A 3QBWA 4YXMA 4KRFA 5CYQA 1TKTA 3WK5A 5A2QO 1I94K 2UXDK 2MKJA 2BZFA 3VQBA 1G3OA 1HWLA 3OR1A 3VQ8A 2DH8A 3D2QA 3MWTA 1WHWA 1JWWA 3PX0A 1FDAA 2N7YA 2K06A 2XULA 1XC9A 4BY9C 3QAUA 5ALJA 1T0TV 1PAUB 1XIQA 2A1RA 1WSJA 3FM9A 3BREA 5HR7A 1MN8A 5E41A 1NZAA 1RAEB 4OX7A 3E01B 4EBCA 2ZQBA 5AXNA 1CJVB 4Y2TA 4TNOA 3W2WA 2MQMA 3EKUA 2VKRA 1IO2A 5GMEA 4K5SA 4OJPA 4BVPA 3MDAA 2O8EB 3UKUA 5KFAA 5ALPA 2IVFB 3HK2A 4FJLA 1TKDA 1Y4ZB 5AM2A 3TWZA 1SV0A 1V3RA 2R2RA 4WBFA 3W5YA 3CC4S 4JNEA 2EFVA 4EZ6A 3T6BA 2RDIA 5AM4A 4KITB 3K0SA 2JMGA 3HVAA 1RBOB 2XQCA 4P72A 2ZD1B 8ICBA 4ECVA 4FYDA 3IS9A 2CADA 4J90A 3CCUS 1YTAA 1BNOA 4KB0A 2G13A 3WEEA 3ZEUB 1M0SA 4KH1B 5AKJA 2DHHA 5L1MA 1YJ7A 4ZITA 5KNIA 3TAPA 4E2FB 1M1KT 2KV2A 2AW0A 4FJJA 3EYZA 5JMVA 4WTYA 2DCLA 2YXLA 3PR5B 2W40A 4IQUA 3JPPA 3VQ9A 3KHHA 2JWNA 4DTSA 3UE2A 1G15A 4PXBA 3WNHA 2WOMB 7ICLA 2YNFA 1WWUA 1HNXK 3GBTA 2A1SA 3QIPA 2JFKA 1F5BA 4X4TA 4B1ZA 3OYFA 4CIFA 2CQCA 4GIBA 3E0FA 2VF3A 5BYQA 1BPBA 5BRFA 4M6WB 4JK9A 1KQGB 1FFUA 1N32J 3U1MA 1S0NA 1H2VZ 4ZP9A 5HQ8A 3OTEA 4ZDNA 1RBRA 2O4GA 3N6LA 4Y2RA 3FBBA 3THTA 1Q7LB 5AQXA 3L9ZA 2P9EA 4ZOSA 3U02A 5DETA 4MK9A 3BZKA 2V8GA 1IG9A 4DZ6A 5AQJA 4CHOA 4H0VB 5I9EB 1GNKA 2K2PA 2LXUA 5IIOA 1RDAA 1TL5A 3MC1A 4H5VA 3H59A 4EGLA 4DPOA 1J2MA 4R8UA 3CE8A 3ALYA 1YJ9S 1WC5A 1RI7A 3CRXA 5K5MA 4BG8A 4JMUA 1NPRA 1GK8A 4LSLA 2YTCA 2XGQA 4HI2A 1JB0C 4M5KA 4JI7J 3PSTA 2AYMA 2P9PB 2KJWA 1JLCB 3C6TA 4RO0A 3AN1A 3HFVA 2WAQD 2KL8A 2BDUA 1DAXA 2KIVA 1G6BA 2J0QD 3O4NA 5CYMB 1WSFA 4ETXA 2N4CA 4OPKA 3KK3A 3CHWA 3OUYB 4GXKA 4GKKK 4CGJA 3QYYA 3UPQA 2YHAA 3O3LA 2ILZA 2OMLA 5B7WA 3F9KA 1F44A 1P8GA 4KMOB 2WCXA 4NXZA 4A2AA 3RMBA 4IDKB 2FZCB 2G0IA 3IHQB 2FVRA 3MEGA 4YB6A 4IR9A 2I0XA 5G0RA 2GTDA 4QR0A 7ICUA 4RQ8A 1AT1B 5J2HA 1ZQGA 2V8DA 4NLGA 1RT3A 4DQPA 4QZEA 1HPMA 5C7PA 4CH0S 1W7WA 3HOTA 4C0HA 2P9KB 3GQCA 2DNOA 3VETA 4V19J 2P8IA 3JPQA 3ZO7A 4FF1A 4EP5A 1Q3UA 3KTQA 3PKYA 1RGVA 3QU9A 5AK3A 2WF8A 1S48A 3KK3B 4KV8B 3UMBA 4RUCA 1HNVA 5LJ5Y 1VSFA 3RZAA 3RMAA 2GO9A 3HDSA 1YJRA 9ICIA 2VOOA 3S3NA 2QARB 2RUSA 4J5OA 4ZVSB 4C7QA 1OQ3A 1CJTA 3RBDA 4OLAA 1ZQOA 2HK2A 3MABA 3PVXA 1RJJA 1S1XB 1RT7B 3GCXP 7AT1B 3RB3A 2K3KA 5L8RC 3DKDA 2CWKA 1DGJA 4DCJB 3UD4P 4H5NA 5EVZA 2ASJA 1JJCB 3LANA 2B7CB 1Q7YT 2V2ZA 4FJGA 4R8UB 5DS7A 4J9UE 3ZZRA 4DV5K 4EBDA 2CG4A 4K0KJ 2YN4A 3G2XA 4I2IA 4Y0FA 2M2BA 3UQ0A 2VWBA 3C46A 3DM2B 4DR6K 4RNHA 3FZBA 2E20A 1TZ0A 3UPFA 1U1MA 5GADI 4O44B 4MIBA 2HF3A 4AFFA 2BE2B 4NWIA 4C4WA 5E26A 3CNQP 4DV1F 3BSCA 3LZJA 3H8WA 1KCFA 4PL2A 2FSNA 4YOXA 1NCLA 1C6VA 4M3ZA 3O6QA 2NRXA 3GL1A 1WWVA 1E6YA 2KRBA 3WQTA 2CNLB 2YHXA 3U8XA 4DUYK 3L4IA 2PA8D 5C42B 4CCHA 5F9NA 4AYBC 3VA0A 8ICWA 4JS4A 2A6OA 4N47A 2D5RA 3CD0A 2RJZA 1Q81O 2LU1A 3LPTA 1KONA 1YI2N 2ZG6A 4RW6A 4ZN3A 2BJEA 1ZTTA 5AE1A 5C25A 5FPDA 2W7OA 2PSZA 5K14B 5KRTA 1NU4A 3QO9B 4CJRA 3T1HK 3PIOL 1VK8A 3D28A 2KG0A 2B6AB 3TI0A 1FFWB 2AX1A 5TISU 1CQMA 3MEDB 4AM7A 2HFOA 5ETLA 2GBZA 2VDIA 3O9TA 1W25A 4LC9B 5AQPA 3CULA 1IKYA 1NGHA 4BGDA 3KK1B 2HMPA 2DWQA 1JLQB 2QO3A 2KB2A 5HROB 3CJ9A 3DI6B 4DMNA 3SEOA 1NDPA 5J2MB 4LR7A 1ATSA 4LF1A 2W2QP 1HBMA 5L1LA 1LWCA 4BHQA 3PKMA 4DCCA 3DRSA 3OTOK 2IHR1 5DQGA 2NSBA 2WBMA 5D0RA 2HF4A 1PILA 2Q79A 3EJMA 4A5AA 5CCMA 1BQMA 2DB1A 1UAXA 4I2FA 1ZOLA 1RTHA 4O3RA 8ICIA 4AXJA 1ZM2A 1KC8T 5IQ6A 1CXQA 1NJYA 3DXMA 4IJNA 1VSIA 3FEZA 2QLJB 4C97A 4V19X 3VEXA 2IC3A 3LGNA 2EDUA 2IAJB 4ZKAA 2DCUB 4G1IA 2DR9A 3TUIC 5F2RA 4BRKA 3IUCA 2QW9A 4CP5A 4DV3J 4IRDA 2V69A 1QZ5A 4KHQA 4M5LA 4DG1B 1VQ7N 4MK8A 3KHLA 4IXCA 4USMA 6AT1B 1XNSA 2X74A 3DLEA 9ICGA 1S76D 1FJ7A 1WOOA 4H0TB 1DLOB 1ZQJA 1RP5A 2KI2A 2PYJA 4DUZK 4O0IA 1VRTA 2AIRB 2AV5A 1RDBA 4ID5B 5ALSA 4JKAA 1ZD4A 2D8CA 4B1YB 3I76A 5F41A 1HYZA 1ICEB 4BR4A 1KQSM 4MN4C 2E8OA 4J2DA 2KNJA 2BTFA 1LAWA 1FEZA 2VG6A 3OLAA 2A5XA 3Q8VA 1CJKA 3MXJA 1J5OB 9ATCB 4YMNA 2OSQA 4CZFA 4PUOA 4C3MA 3C14A 2YKNA 4Z94A 3SCXA 4RBVA 3QU7A 4F02A 3PX6A 1ZQUA 3VTHA 4KAIA 1VISA 4NWBA 3HT0A 2VBWA 5DB8A 5FDLB 3QINA 5AE3A 4IKAA 3MX2A 1M5KC 3AXKA 1J97A 1R8HA 4CD1A 3MM6B 1HBOB 4JI2K 2IRYA 1VK0A 4NLSA 2CPHA 3DWLA 3N7SC 3POTA 5D4BA 3J81U 2IHNA 1LW0B 3C66A 4DR7K 2H4WB 3TJAA 4WQ5A 2W2MP 1VJ5A 1T3OA 1I3AA 4KR0B 2I5JA 1RWVB 1ZBLA 1HLWA 2WVDA 1B99A 2WTFA 3IAS9 5LL6d 4IFVA 3DLGA 3HW8A 1LW2B 1AUDA 2ZE2B 3AMZA 2GO8A 1J9AA 2I9SA 2MKYA 2Z57B 4KKOA 4JS5A 1MN9A 3CJCA 3P96A 4P2FA 1RBUA 1IBKK 1WOQA 4PJ0U 3H42A 4U96A 4BC5A 1VLBA 1UFWA 3BBCA 4F3TA 1JCFA 4DV0F 1LOUA 3LOUA 2JL9A 2Z1IA 3DXKA 1K6YA 4CVNE 3SJHA 4CJTA 2R7QA 8AT1B 4K2JA 2DGSA 1ZQSA 3SQIA 3JTOA 1NBWA 5T7LB 2M4MA 4KGZB 5GIOA 1GLFO 3MOZA 4W5RA 4I7FB 1CJUA 5IT9U 2WB1F 2IYGA 2XYGB 4XH5A 4MLEA 2DPJA 5IWAK 1EO1A 5CP2A 4P75A 2EAMA 4R25A 1MW7A 1K9MO 5B8HA 4DR3K 4YY3K 2J5AA 1XSPA 2H51B 3D6RA 2DGUA 4DL0C 3Q89A 4PWDA 4FKYA 3JS6A 3T7ZA 1S1TA 2QLXA 1BQNA 2P9GA 1QAIA 3KKSA 1EETB 1OH8A 1U02A 1BUPA 3RW7A 3Q8PB 8ICUA 4ES3A 2EWHA 4QZHA 2VIXA 5DRKA 3KKFA 3ZZPA 1WELA 3SPZA 2GS8A 4QYRA 3FCHA 1NNEA 1WHYA 4DV4F 3HT3A 2FB0A 1X6JA 2ZH4A 3MN5A 2YWGA 3VALA 3JYTA 2YKQA 3DLLL 2A2CA 1C1AA 3AY0A 2GIRA 2G07A 7ICSA 1SV5A 3OQ2A 4PG5A 2ZITA 4I4BA 5ALTA 2FHJD 4FJ9A 4BUGA 3FZ2A 3ZZZA 4DFKA 5CR4A 1U6BA 4P0QA 5LMNK 2Z1GA 4AP9A 3R5GA 2IBKA 5AKKA 4NI2B 5IM0A 1DQAA 1T9TA 1ZQRA 4YOEA 1TAQA 2AU0A 3O8WA 1XHXA 4DV0K 2QLTA 5DGBA 1VQKS 1WSIA 1N56A 1VQSA 2UUAJ 1TL7A 5C25B 3E66A 4I7FA 4JLHA 4QIWD 5AKYA 5C12A 1SIZA 3VGSA 2GVZB 3BKFA 3BQ7A 3R1XA 2OTJS 2VFRA 3BYRA 3R1LA 1RAOA 1ZBFA 3PHEA 3CDWA 3CJ4A 5AQSA 1N5QA 2GIQA 1YJWN 2C1EB 2ZD1A 3ZNJ1 2FLPA 2ADCA 5EXWA 1N32F 1QVFM 2F65A 4O3MA 1N34J 2A42A 2DHSA 1NGDA 2QWPA 1RHUB 1U04A 2YNIA 3M9MB 3H6EA 3RAMA 2ZJRL 1K5OA 3QO9A 1DTTA 3HPOA 2HB5A 3IFEA 2IIHA 1PJ6A 4TLRA 9ICKA 5H9FK 4KGVB 2MY7A 4CHNA 4DPXA 4Y0WA 3POTB 1XMOJ 3LP0A 2A41A 2ZF5O 1HJRA 4AT1B 4RPYA 4ZPCA 4M9JA 1Q82T 3SCIE 1HIYA 4DV4K 4J37A 5HVGA 3HZEA 3N28A 1ZRNA 2XEXA 2KT5A 1S77D 3V6HA 3HCXA 2D3OR 5ALFA 2H48B 3CFRA 3I55S 1ZH5A 1NDLA 3K8WA 1QQ7A 4DFMA 4WP9A 3MF5A 4NYNA 2QA2A 2HDOA 2HLTA 3AVLA 4TURA 2ZTEA 5KT2A 4DU1A 2OTLS 1XMQF 2Z2YB 3RJGA 3JPSA 2LCWA 1D3WA 4OYPA 4ILJA 5KFDA 3PEHA 2XSFA 4C1NI 2LXFA 2VFVA 2BW7A 4M04A 4RG8A 3PG9A 2AJ1A 5ALRA 1C0UA 4RJVA 1BI4A 4K8XA 1JL2A 5CAAA 3Q8LA 4C98A 1U8SA 1N33F 1SB3C 1RWUA 2E8NA 4IOXA 4KLQA 2NXEA 4CIEA 1RT3B 1VHXA 5J2QB 2CPJA 2HKEA 1YHQS 3CD6S 3OXGA 2FZKB 2YWHA 2F4FA 4ZVHA 5EWEA 4E1JA 2LFVA 4NYZA 1H2TZ 3M05A 1AUSL 3OTQA 5BN9A 6FD1A 4CYUB 4HWIA 2BANB 2GQ2A 1ZQKA 2W2PP 2H4YB 4B3TJ 4O8UA 3HVWA 4C23A 9ICRA 2F9WA 3F2DA 1HNVB 2PC6A 3OV7A 2JJ4D 5J2BA 3FBEA 4FJNA 4OZ0A 2MA1A 2FF6A 3SUQA 3MR3A 2D4WA 2DPNA 2H5IB 3C6HA 2M7SA 4RPFA 1O13A 4O5KA 4IH7A 1HQUA 5HLFA 1Q5VA 3GILA 2HS0A 3OFGA 3I8BA 3OYLA 1S0OA 4IG0A 2F9JA 2M88A 3I6PA 2IFXA 3U9ZA 2P9UB 2VA3A 3GV7B 4Y1DA 4H0XB 1KXPA 4BGAA 3CJ5A 3GB0A 4KO0B 3RWUA 3GCWP 2ASDA 2HK3A 3AVIA 2YCHA 3MDFA 1E6VB 4ECWA 1O0PA 1S1WB 4RU9A 1REVA 3WXMB 3IV6A 4ES2A 3NVKA 4JKGB 2CQ4A 2XSJB 3QT7A 3EKSA 4CZIA 5M2UA 2KE7A 3K4GA 4DR6F 4CLFA 1FKOA 3AXMA 3MM5B 1M5SA 5HOOA 3HKWA 3M8RA 2RE1A 1WI8A 1J2NA 5G5HA 4RBTA 5CJ7A 2JRSA 3DOKB 2G8WA 1KVKA 3AOBA 5CA5A 4P74A 4U95A 2JDJA 5KG0A 1Y97A 5JVHL 4ZVPB 4PL8A 3CERA 1OSCA 1RUSA 3S01A 5JVGQ 4H5WA 4B8AB 3HSTB 2ZH3A 4TQRA 5EWFA 5FJ4A 2UZAA 2NYVA 2UUTA 3PZPA 4B3OA 3JSBA 2QSWA 2ZXIA 4P0PA 3QSYB 3B0XA 2J6UA 2G8KA 2MZ1A 4Z6FA 2W41A 4XIUA 2LP4A 5KFJA 4B17A 3KLFA 8ATCB 1IR2A 3DFEA 1FJGK 3SQ4A 2B4OA 5B0BA 3BPDA 1D8BA 2A0FB 1EQYA 3D2EA 3OYEA 3CO9A 1IIPA 3PFEA 3NVVA 3MPUB 1RDWX 3M7VA 1N63A 3KLVA 5BR9A 1XNQK 3KK2A 5ALLA 3DCAA 4O3SA 1MQ2A 3QEXA 3FGVA 2WVBA 4USUA 2HRYA 2Z30B 3EUNA 4BRQA 1WBBA 1PG5B 2VJVA 3D0HE 3DRRB 3UQSA 2R2UA 2VQEJ 2ZHAA 3FQLA 4LF7K 2RRAA 2AF6A 1OY6A 1RT2B 2OPQA 1Y00A 5JICA 1NRKA 1TUYA 4HCCA 1V9PA 5D6GA 4DL2A 2LBOA 3OBIA 2GWKA 5AIAA 3RGIA 2HHWA 2DNYA 2W9CA 1ITGA 4OX8A 3MCAB 4RW6B 2BQUA 5HBMB 3SNNA 2GW8A 3HRGA 3CJBA 2BVZA 2WBRA 5IZHA 4QNLA 1AYEA 2H3ZA 1E4GT 3CG7A 1TVRA 3M9NB 2VFUA 1H7WA 2XVTA 1X60A 4TXSA 5B0DA 5K8NA 2FJWA 3GFHA 4EZ9A 3OL7A 3J7ZO 2E8PA 2QE5A 2WONA 1D5AA 1COKA 8ICAA 2FTRA 2RE2A 1ZXOA 2PMZC 2RILA 3H2LA 2VG5A 2Y0BB 3D6TB 4YN3B 3V7JA 2I6XA 2A1BA 4RQ3A 3QNWB 1HHTP 3C16A 1Q86T 9ICTA 3R7NB 3NOCA 2UYTA 1DOQA 1A7GE 2QL9B 2VQFK 2FD2A 3T3FA 3VOVA 3RBEA 5HLFB 2Y1JA 2UP1A 5KT6A 1DRGA 1LXJA 1HR0F 2X6NA 4YD1A 3V2UC 1EXNA 3QBCA 1U0HB 3RBXA 4C48A 4EU0A 3N0VA 3AVCA 2VBXA 1HWUA 3ISDA 2CJXB 3TU5A 2M0GB 4IC9A 4NZ6A 3NVMA 1S9FA 4I6AA 2WMMA 2LYBA 5T41A 1XNRF 2E2QA 4JKBA 4CK1A 1L7MA 1KD1T 4CGFA 3AO2A 2O8DB 4USHA 3UNYA 2X3DA 3H7IA 3VCBA 3E58A 4UB4A 1OQ6A 2O8CA 1ZQZA 2ZNZA 1RA6A 2QEXS 4PEOA 2WZ1A 1VC5A 3CCSN 3N4QA 2KRRA 3J81j 4X4NA 4JI4K 2E2PA 4OYAA 2H9ZA 4NA3A 2EZZA 4HR2A 2AJQA 3QATA 3QWUA 4CT8A 1NKCA 1Y11A 4RW7A 3O3FA 1SZHA 2AH5A 1IR1A 3Q8RB 4WIQA 4PABA 1ZPWX 4CF4A 3VEWA 3BKUA 3OHBA 2N3LA 2XY6A 4F2RA 2E88A 2M9KA 2BKNA 3QNMA 3M32B 2ERRA 5KAFU 5AQMA 1S59A 1URNA 5TZVA 2JGAA 2QL7B 9ICHA 5GAEU 1GX6A 2ASPA 3ZZUA 2WONB 3M2VB 5K9FA 4UF4A 2ZUDA 3AJ1A 2E9ZA 4UT4A 1NZ8A 2P35A 3AQPA 4AD6A 3L2QA 1MN7A 3G96A 1VC6A 1DKGD 5CZ2A 2XYPB 1Z4NA 2O8FB 2YMQA 5LXYA 5KQ8A 4ED7A 2ZIUB 3TR5A 3WEEB 3ZEUA 1NK6A 3GPAA 1BPDA 3R5DA 2GIFA 2VG7A 1T05A 3ONNA 2DD8S 4TKTA 7FDRA 4FJMA 3FFIB 3H2UB 1N48A 2O1PA 3RH6A 4PGQA 1FRMA 4K2XA 1U2VA 2VOPA 3EVMA 4ED1A 2K8AA 2B4PA 1MLAA 2P9IB 3MECA 2YTUA 4M5JA 4MLHA 4F3OA 4WJ3B 3DRRA 2DYAA 3Q8YA 4CGHA 1IH7A 4CZJA 1WC6A 4KHSA 1XMQK 3BGRB 4DDFA 3UM9A 2CDQA 3QWPA 2ZWOA 3VN5A 4M5IA 2R7XA 2F63A 4DV3F 3DYAB 4JKFA 2EFQA 4NYPA 3WNGA 3KHYA 4RQ1A 4JI8K 4LRFA 1UPHA 8ICLA 2AZ1A 2JC1A 2WSFC 1JXBA 4ELUA 2W9CB 2ZIWA 2G06A 5KG1A 4ICLA 1VRUB 2P5VA 4M7YA 4LJMA 3NWRA 4ZP6A 2AJ0A 5AQWA 2PXIA 2H54B 4RZRA 1UVIA 3AU6A 3P5BP 4DV6K 4UZBA 4DQ8A 4N7TA 4B3RJ 4ISFA 2W2NP 5F8IA 3N01A 4CLTA 1QQCA 2BE2A 2NR0A 1FRKA 1B22A 2WAQF 2OZSA 4ERDA 1LFWA 5IT9O 4WQ5C 3FGUA 4BC2A 3HP6A 3PUFA 1Q5YA 2HQ3A 3V6DA 2YJFA 1SC6A 4F72A 2AA4A 3SSSA 1IKXB 1TK5A 1G2EA 3LTOA 2K4IA 5BRHA 2UVWA 2OCEA 1FXXA 3DYAA 4WQ4C 4U67Q 3LDLA 3FR0A 4Y6IA 4FM1A 4XPEA 5D0EA 4K50A 5FRMA 1JLBA 5D0HA 3V1QA 2QB0B 1HNWJ 3QXGA 3EWGA 2E7XA 4WK1A 2HBLA 4KHNA 5AM3A 3PM9A 4Y65A 2PI5A 3UNGC 2LYVA 2HBZB 3ULEB 4BXOB 1VSHA 1BNPA 3SFGA 3MPYA 2QT7A 1UA0A 4DX8H 4IUFA 4N41A 4PCQA 2JV3A 2IM3A 2QA4S 4DR2K 3MM7B 1RHJB 1J27A 4JI1K 5AK5A 1C0MA 1BHNA 4QOTA 4F3MA 4BRLA 4UAUA 1A0PA 5SWMA 3CC2S 2YQ3A 4NLBA 5D15A 4G9BA 3CMAS 5IOLA 1B64A 2CH5A 4E7LA 2X7IA 4YN4A 1XTZA 3BB5A 3LDOA 5H9EJ 2UV8A 3P38A 1KVBA 1LW2A 3CIMA 2HMXA 5DLGA 4D3GA 3P4UB 5M1PA 3NCPA 1V5VA 1E6VA 1U26A 1AFIA 5ETSA 2WW4A 3Q8UA 4DQRA 2HSEB 3RW6A 5J2PA 2LQJA 4FLWA 4AQYJ 3KOAA 1RDCA 1G99A 2A3ZA 4XPCA 3AD8C 1C0TA 4Q0BA 2Y3YA 3S1TA 2IJFA 4OYZA 4C0ZA 3VF0B 3HSJA 1JXLA 3I9ZA 4RKUC 1SZ2A 3JQJA 4F26A 3QIDA 3MUMP 3RAXA 2CJ9A 4A2BA 3ZTRA 3MN7A 5FIIA 5MLCV 2AJ2A 5U47A 4EK2A 1SIJA 3SCKE 3MM8B 2WF5A 2LA4A 4YFUA 1FDNA 9ICVA 5CCLA 2HHVA 3NGDA 3J8AA 2R2TA 3LDQA 3C95A 5EE9A 4NLRA 2DO4A 4LIRA 2PAVA 1G7CB 1LNQA 4PKIA 5G5GA 4CLZA 1NSAA 1YX2A 3IWXA 3J7ZT 4HUGA 2HHTA 2HHPA 1ZD3A 3ET6B 2VG6B 5B0CA 4P4MA 1UEKA 5M1QA 4X4PA 1HNXJ 1B92A 2PFPA 3AA2A 4UUXA 3GJRB 5A6WA 4CFAA 1Y3JA 1XJWB 4EO6A 1UJ4A 3R6GB 5DGAA 1PUZA 4NLOA 4WYBA 4P9SA 3G9CA 3KOOA 1GMUA 3P5TL 3QJJA 2EEYA 1Z05A 1QHAA 4OZ5A 3OHAA 2AYEA 2MQLA 3LZIA 2IA6A 4WFAL 3HHLC 4CJLA 3DRPB 1JLAA 5KFTA 5J2PB 1NMDA 1Y5IB 5F3TA 1FCAA 3E2EA 1D1UA 2X1GA 5HRRA 3L2VA 1HKCA 3D66A 3OT9A 3ZYYX 1RFQA 2WVFA 4JI2F 1EIYB 1KQKA 2V7ZA 3L2WA 4NL9A 1GTEA 3BO2A 3ZDEA 2K8GA 2IC3B 4NE9C 2PE8A 4KPYA 3FLCO 4NXNK 3CCRS 3RUBL 4K4IA 5DZ6A 5B0EA 5B0FA 2FZGB 4BE1A 3CCMS 1K8AO 1X8DA 2E44A 1C20A 2CJAA 2FJXA 4NRTA 5HBMA 2NRHA 4NYFA 4HT5A 4GVEA 1HUXA 2CQ1A 2CNNB 2QLWA 3WXJA 4KLMA 3RMDA 4YUDA 2UVRA 1L8LA 3HPHA 1RT2A 2OPQB 3D7SB 1S0VA 4WE1A 2HVEA 3RB4A 3Q2SC 3P45B 7ICRA 2ZIXB 4R66A 1RILA 1I5OB 3S9HA 2XI2A 5ALOA 1KLMB 3VQ7A 5HMYA 1OVYA 1ZD5A 4LVOP 1C1CA 4QR1A 2R8KA 1S72S 1HKBA 3BQ2A 3MK6A 3WQUA 3T5JA 1X42A 3L3UA 3R9PA 1LWEB 1LV5A 1QVGR 1X4GA 3MM9A 2HNZB 4F36A 4MAKA 3FCWA 2QZ8A 3PSPA 4C8KA 4CHPA 4R64A 1N88A 4TQSA 4XK8C 5CHCB 1NHKL 4KC5A 7ICJA 1WD6A 1T11A 2G2ZA 2ZGZA 5FPNA 2VODA 2QXLA 1HYVA 3G6ES 4MHVA 5CD4A 3G8SA 5LMNF 3TARA 1ZM4A 3NF6A 1E6YB 2WB1C 4JYAK 3NCQA 4ZVQB 4YDUC 1NJZA 2CGJA 4GNIA 1IWGA 5AI6A 4NCBA 9ICMA 1PJ5A 5A8WA 4RUBA 2D0PA 2J4RA 3CD5A 1YVFA 5GTIU 3VAMA 2GUIA 4UB6U 3GIKA 1F6TA 1RWPB 3T1YF 3BZQA 3DLBA 1LWXA 3AVAA 2BA9A 8ICZA 9ICNA 1SV5B 4CE9A 2XIDA 2B5JA 3ZTSA 3NAHA 1K8KB 4DHYA 1FIQA 3E9PA 3QT5A 4Y2AA 5J0UA 4RQNA 4C11B 2MXYA 4CO5A 4ED0A 3NNHA 5AIBA 2DVIA 4CDGA 4N8NA 2UUCJ 1WNEA 2ACYA 4KHPF 5BREA 2XMTA 2ADBA 1OMSA 5GAGU 3WIUA 3NH2A 1RZMA 4LFAF 4DV5J 1VQPS 2OD4A 1EAYC 1YK9A 4FLXA 3SYZA 4KH5A 1FHTA 2OHFA 3H90A 3QRPA 4MFBB 3OA9A 2HBMA 2NCKL 2YNGB 4RUAA 3W9JA 3NRZA 3CF5Q 4IOAQ 5BPCA 4A8XA 3OYNA 5DQIA 4TYAA 3UMCA 4PRFA 1JROA 1PO6A 4F9OA 2ZH9A 2F77X 2H5EA 3ZX0A 4DR1J 2E1FA 1YTYA 4HHHA 1NK9A 3JYTB 2MGZA 2XGPA 4LF6J 3UKRB 3RSEA 1FK9B 5M1OA 3PRDA 5A76A 4JUZA 1DRZA 3TPQA 3M6ZA 1WACA 2DFEA 3AVMA 2ZXHA 4X65J 4OJRA 4OI3A 4TU8A 4CF2A 3E51A 4M94A 1SJRA 3O4QA 4XDDA 5G0RB 1VDHA 4EX6A 1QH9A 2GNKA 1K73T 1RT6A 2MY8A 1ZQXA 3EWAA 3H1VX 4U8YA 3R5JB 2J0XA 4XDCA 2FHOB 3F2CA 1LQ9A 3C19A 3PO5A 5L1IA 5BYSA 1K1QA 2PN6A 5FD1A 3VEVA 3R5AA 1C0UB 4ZLNA 2QXFA 4ZVOB 1P8ZA 4RW8B 2DNNA 3LDNA 3C28A 4EP4A 4F4KA 4OL8A 2NLWA 2BKOA 2OH2A 2HFZA 3MWPA 3A5OC 4XQ8A 4H8KA 2G0AA 1XNRK 4DQQA 2KHVA 2QWNA 2YKAA 2XS7A 1EHWA 4OX9K 1ZQQA 3D6FB 3RJIA 3BPSP 3NFAA 3M32A 5ALNA 3K8VA 1TP7A 3KNGA 3BS9A 4MF2A 5GMDA 3ITHB 1WNSA 4ZCIA 2DEIA 4KLLA 2EC2A 3MI7X 2MZRA 2DXEA 2FPHX 1NHUA 1NZBA 5J8YC 2DT9A 3VGKA 3IKMA 3H1QA 1DARA 5BPMA 1P6TA 1I39A 1RWXB 4DB3A 2PDAA 3AO5A 1M5PC 4Q5VA 1QY7A 1LWCB 4HVJA 1C0GA 2KLAA 2D9OA 2G5IB 3B82A 3TTDA 1TVAA 4RNFA 2M52A 2DJWA 2UV8G 7ICGA 1KKXA 3OVBA 1S7IA 4YXJA 4PA1A 1CULA 5KL1B 2IS3A 2OTJN 1NK7A 1J5EK 2ZBQA 5HVHA 2C2OB 4GXIA 3NKYA 1S22A 3CFOA 2KOBA 3FSYA 3CM6A 1KAZA 3KZXA 3V72A 8ICFA 3GYNA 3DXMB 3GWCA 4ZMMA 2BCVA 2DNHA 4GMKA 1YJWS 2HRTA 3AD9C 3S3OA 1VRQC 3VCDA 1UKUA 4ISEA 1J53A 1L3UA 3GIRA 4EIAA 1V4TA 3HZ6A 3OHRA 3AOCA 3BR8A 3UDEA 4RUHA 5HANA 5ALZA 1FFSB 4EBEA 2C2ZB 3VEYA 1RHRB 1I3OB 4IRCA 3N4MB 4DBQA 3Q8KA 2QMUB 2Q6CA 1JNRB 4Z4GA 2A1JB 3KJQB 2BM0A 4ILHA 4LFCF 1Q8LA 3NCRA 4ZHRB 2CKWA 1ZAXA 1B3TA 4R0EA 3PYEA 2QYGA 3QEAZ 4ZPVR 3QJLA 2NLXA 3OPKA 3RJKA 4B3MJ 4ZPDA 2XZDB 3ID6A 1V6HA 1VQON 2JEFA 3RMCA 4JI3K 3G8TA 1ASUA 4E7JA 1R43A 4FJ7A 1T3QA 1WUUA 4USWA 3NL0A 3H3OB 1ILYA 4RNOA 4TU7A 3QIPB 3HKZD 3I87A 3RFAA 2W03A 2YWFA 4H03B 1JX4A 2CPFA 1Z00A 1CUKA 1XR5A 2ZHBA 1KBUA 2RNEA 2O8BA 1OYDA 2ZDOA 4WYLA 1O6XA 4M3TA 4N56A 4UARA 5TKWA 4BG9A 1ZQMA 5IS2A 2R3VA 2D7SA 1CI4A 4Y1CA 3AGKA 3MEKA 5LJ3Y 4Y3CA 1SL0A 2RQCA 3J81Y 2Z2LA 1YKWA 1A5VA 3IDHA 5B66U 4LBPA 3TQ1A 5KFLA 4OKKA 2R7VA 3R6MA 4HYKA 2MZTA 2ZEJA 2YNHA 1D8YA 2Y0SC 5KG5A 4UOGA 2ASOA 1QQMA 1RBLA 4ZVUB 4NLPA 4URSA 3TANA 4YY3J 4EYHB 5CY4A 2E9RX 8ICGA 2JWKA 4CEEA 2F3JA 1T8EA 3DGPA 1KNZA 3HWTA 5H2FU 3P3DA 1B43A 3VGUA 3U27A 4NL5A 2V51B 5GADP 2ZVSA 7FD1A 3DDIA 1RT4A 1PCAA 3O9UA 2UXCF 4GW6A 3WK7A 3BO4A 1KL9A 3CUNA 2UVUA 2IDLA 3RB6A 3UR3C 3KLFB 5IXUA 4Q43A 1BMQB 1EWRA 4CZGA 1WOPA 4F0MA 2RRBA 4DV2J 3NGYA 3C1ZA 2V4JB 4LF4F 3FEXB 4B3OB 2IDOA 1L3VA 1ZZFA 1BDGA 3GJSB 3THYA 3CJ1A 4DX7A 3EPGA 4USKA 2Q6BA 3QUBA 1RSCA 2Y8WA 2PBDA 2FQQB 4X5VA 4DUZF 3C0BA 2E8MA 4LRDA 1NK4A 4CF5A 2G5HB 2C3OA 2NUHA 4GKKF 4QIEA 2ODGA 4DTRA 3IRXB 2FMPA 4CHYA 2AQ4A 1SBRA 2YMPA 4ZVGA 1RZTA 2H5XA 2ZNYA 5AKIA 1FVSA 2L48A 3AB4B 1FKOB 2EXUA 1FTRA 4CHZA 1DTQB 4Z7CA 3ADAC 1RWKB 1RT7A 4KKOB 1HUOA 4FYYB 2FHKA 2X78A 2ZOMA 3O44A 3SBGA 1T3VA 1WEXA 1VQ7S 3H7HB 1NOYA 3PY8A 2AGOA 3EL2A 1MSWD 4TN2A 4JV5F 4I9LA 3IM8A 3WNFA 2ZOFA 1IBKF 1BUXA 5KL8B 2KYZA 2U1AA 4Y2JA 5E7OB 3G87A 2JRZA 1PKUA 2QG9B 1TK8A 5J2CA 1KD1O 4ECSA 4ILRA 3TAMB 2FVSA 2HLUA 1M5VC 4I2BA 1C0TB 2CVEA 4FP9A 4OJ6A 1L7NA 2HOEA 4CEFA 5KFUA 1F1BB 4LSZB 3PW7A 1F2HA 1RKJA 4DV7K 2MB0B 3M1YA 3PV8A 4J9VA 2YHYA 2Q3PA 3LGMA 3C6TB 4NJ8A 2N4DA 4LFBJ 2XWXA 4L3QA 5AZIB 2SXLA 1PK1B 3D54A 4KLOA 3C21A 2PFDA 4K8RA 4JKDA 3UB5A 1NMEB 2HQGA 4FWMA 1WAJA 1SXDA 2HQCA 3THPA 4QIWF 3QZ7A 2OD6A 3E8OA 2ZUBA 4FZLA 4RQ4A 2KVSA 1XR6A 2PFUA 4FL9A 2YNFB 3A5MC 3TSUA 3W2VB 4J9NA 3KLEA 4OQJA 3ZSXA 1VS3A 1Z19A 3F56A 2Y0SF 4I67A 3K1ZA 3F5EA 3RB0A 2VB6A 1VYAA 5E79U 2E5LK 1DTTB 1SV4A 3G10A 5HL7L 2E1ZA 3C6UB 4M5GA 1CXUA 1S1VA 2BJ8A 4J9MA 2XNRA 4L75A 2KM8C 3UN5A 3PLAA 3B78A 5LM7E 5J1EA 3PSIA 4KPCA 5LOQA 4JV5J 1HEKA 1FDBA 1X5TA 1QSSA 2E1EA 2YNIB 2FDNA 1SH3A 4UAZA 4FSVA 1NGFA 3EMTA 4Y2IA 1T6CA 2FBYA 4NI2A 3ISCA 1FK9A 3ZSZA 4IOBA 4EWTA 1NU0A 3V9XA 1K0TA 1X2IA 5DM7Q 4C80A 4CZMA 3HSDA 1RAIB 2UUBK 1IBMJ 1XO1A 1Q9YA 4BLGA 2KP7A 3BS5B 1KS2A 1RU2A 2OSRA 1U7LA 4WU2A 5C42A 4JP8A 4CD3A 2MLXA 3QLHB 4QS8A 4CJSA 3CT9A 4MKVA 2MKHA 5IT9Y 3N6MA 4M5DB 3DDNA 5KFVA 2O01C 4HH1A 2YNGA 1Q82O 4O5FA 2OFGX 4MTPA 1EKSA 4RNMA 4K4HA 3A0HU 4ER8A 1IR0A 1X9MA 3RJHA 2LQ8A 4CESA 4Y2VA 3W5XA 3JTPA 3NS7B 3DLLQ 3GIJA 3AQOA 1MWMA 2QA4N 1FRIA 4DLEA 4A47A 1E3MA 4PPDA 4YOYA 3ZXWA 3CJKA 3ILJA 4JI4F 4A4JA 1B7YB 2AGQA 5J0PA 2QTWA 3X3UA 1KEJA 4NMLA 3ATUA 2W1BA 2G8IA 4AE5A 2PY5A 2KSOA 4PQAA 8ICXA 5K8PA 1TL3A 2K4HA 4MEYA 4IQWA 1LWEA 3GYGA 1ZBUA 4PZOA 2GWSA 1BD6A 2HVHA 3F73A 2QWRA 2CPIA 4P2SA 1XN9A 1PGZA 2MPUA 2Z1JA 1GT8A 4WXOA 3HVTB 3IBFB 4FF2A 2ZE2A 1N2XA 1LAVA 5J1EB 3GFXA 4HLBA 4HEA9 4I2PA 3IFRA 3AV9A 2CPDA 2CJBA 2F3NA 3V81A 1V3ZA 1S8OA 3LALA 4FYXB 3V9WA 2ZBIA 2VH7A 4DR4K 5ALVA 2DRAA 2DNLA 3RRGA 4J03A 2FJDB 5ALMA 3MM9B 2ZJAA 2KDOA 2RRDA 1NBEB 4E98A 1AZSA 1BE4A 2P9KA 1OY9A 1LB2B 9ICLA 4H4MB 3J7YU 1X66A 5DQHA 3G4SN 3AJDA 2YQ0A 3VF4A 4PYDA 5IFMA 4NCAA 2AEFA 1ZQFA 4YDUA 4C1NK 4A8FA 1GXLA 5FP0A 3HSCA 3CCLS 3C2MA 1REVB 2CIMA 4DN9A 3KIOA 3VWSA 3VAIA 1C4CA 2PFFB 2GC8A 1PK1A 4MYTA 1QAXA 3SDEB 4M1KA 1FE0A 2EKNA 3N5BA 4LBHA 4HDHA 4DPUA 5KTQA 1VQ5S 4P7TA 5HMWA 5JTIA 2QFIA 3FFIA 4DL4A 5HATA 1JMTA 4W90B 2NXCA 2CPEA 1FXLA 8ICKA 3J7AP 1FO4A 1KVAA 1ELOA 3G6VA 4JWMA 7ICIA 2DY1A 3O3GA 1UZHA 5CD4H 4NLZA 4LSNB 3OBYA 4J9OA 5LMUF 4B1XB 1HQUB 4MO4A 2V94A 1K9MT 3CMEN 1NNLA 3NF7A 1DT9A 1IKVB 1NK5A 3P5JA 3C29A 1RWOB 4LF9F 2Q2RA 3T79A 1U1LA 3FSIA 4CWBA 1X9XA 3Q2TC 4LIWA 2J8SA 5KG3A 4RW4B 2NXNA 2ZH6A 3EE3A 5HAOA 5L9XA 4O0JA 3O3HA 3ZD9A 3MN9A 4GRSA 4M3XA 5CA7A 4DR1F 2HRUA 1NGAA 3MOJB 1XMOF 4KHYA 3AU2A 2PI4A 1WOSA 4FM2A 3GSDA 3NH0A 3VQPA 4KREA 5KT3A 4WP8A 2ZJQQ 1KTQA 5KGXA 3Q7BA 1HQEA 4GXJA 2A1AA 4KLSA 2M0NA 2CG8A 3FZLA 5JS1A 2HVDA 1EX4A 5AM1A 1UCNA 2BRLA 4OMFG 3M8PB 3EICA 2R7TA 3VQTA 5AXLA 5J2EA 3KLHA 4NL9C 2E7WA 2JVRA 4QWBA 2HHHJ 3DHXA 4TUQA 1KOOA 2MSNA 1JLCA 3ORYA 3G6XA 1U45A 1A6LA 1JNZB 3KLIA 2UUCF 2FJAB 3BQ1A 2PFNA 1F9EB 2I6WA 2GAHC 1Q1KA 2O8DA 3HVTA 4BS2A 4Z6CA 3AO3A 4AHSA 3PYDA 4B6JA 4CIOA 3BO3A 3KJFB 4H0YB 1IQTA 3HHLB 5GADU 4H4MA 3LWLA 3MWBA 3CMQA 4JKHA 1JLBB 1X5OA 2IJNA 3QU4A 5LSLA 6FDRA 2UU9J 3CIPA 5LSOA 3A12A 9ICSA 4O55A 2PIIA 3NRWA 1ZBSA 5ETKA 2CAJA 4YR3A 4KTZA 1NKBA 4LF5F 3FNNA 4R0JA 1RTDB 4OYWA 1VQNN 4QW8A 4UTGA 4FWPA 4BXOA 3TQEA 4NLNA 1C0FA 4DTJA 3HM8A 4UB1A 1WKLA 1WHXA 1S5LU 4WF9L 1LWFB 1OJ4A 4HTUA 3TNVA 3V81B 2ZZNA 5M1FA 4FZMA 1QHTA 4W5NA 3T69A 1QTMA 3IG1B 1T44A 1ZQWA 2J9EA 1BPEA 1TUGB 4Z0UA 1NWKA 3OXLA 2HFUA 7ICQA 4QZBA 2V9WA 5ETVA 3ZX2A 3KUGA 3GZ7A 3HHDA 4LREA 1JIHA 1MMNA 1VQ6S 1Z2ZA 1WKKA 4IR1A 2G2OA 1NGCA 3N97B 2QKKA 5CR0A 3SMSA 2XG8A 3W8PA 1QSLA 2YX6A 4DOAA 2KXNB 2EBEA 5KFSA 1GMWD 3C6AA 3QFHA 4MKBA 4CJPA 2CZVC 3IXQA 4ECRA 4JI7K 4MYUA 2RSQA 5ADZA 4ILGB 4CEBA 2PMZF 2VPWB 1UFLA 2O3DA 4KH0B 5C0YA 3B4MA 5F0UA 2OPRB 3MCMA 5HI7A 2FLLA 1U8WA 5DDMA 4DMZA 4I29A 1WI6A 3PMNA 1CC7A 4Y2QA 4CH1A 2WVCA 2K1RA 4ANEA 4LF4K 4LF8K 4BDZA 3WZ0A 1S4FA 3DXSX 1LOTB 3NEKA 1DFDA 4Y2SA 1UWAA 3VGVA 5HRPA 1HR0K 3QGGA 2HGMA 2DXDA 1Q46A 3I5AA 1HNIB 3DOKA 3GIIA 3CCVS 3AODA 4A8QA 4BWMA 1O03A 3KKAC 3R7BB 3VQQA 1OPZA 4CJ3A 3J7Z5 2JZ5A 2DGZA 3NVYA 2BPCA 2ILYA 1C1BA 3KUHA 4H0OA 5HP4A 3DMJB 1HBNA 4O0NA 3OW2R 4GC6A 3FVYA 3IG5A 4GO5X 2IDEA 2VQFF 4Y2KA 1HI1A 1WHVA 3W64A 1U2VB 4KO0A 4E7HA 2VQEF 5AQVA 1TYQB 3ZT4A 3V9UA 3MR7A 1ZBTA 3TEHB 4A8WA 2JVOA 2GCFA 2AMCB 5B09A 1F60B 3VZHA 1VFJA 1H38A 1SKWA 2N7CA 4UBCA 4QZVB 1PVPA 3MMAB 3ZZTA 2MZJA 3D0PA 3V1RA 1ZQYA 1XUPO 1H3DA 1FWLA 3ZZYA 4F5PA 3SQGB 4B1WB 5AJ3K 3M8QB 1NNDA 4PG4A 4BQZA 3TZWA 3EW9A 2XI9A 1NM1A 3B9JA 1BQXA 1YBAA 5FDLA 3SK3A 4UBBA 2KVQE 1S1XA 2ZFHA 2DBBA 3QE9Y 2DISA 1T03A 2LQ9A 1U1NA 4C2MA 5KFMA 1PZNA 1YF5L 5K8OA 2PFOA 2P6RA 3MEGB 1V5IB 3LM2A 1Z4UA 1CLFA 7ICHA 2WW8A 4KRWA 1F5CA 1MQ3A 2W43A 1UVKA 1DZ5A 4LH4A 1WEZA 2X51A 4JI0K 4L72B 5DLFA 5C10A 1SL1A 3OPXA 3EX7B 3NF8A 4WKRA 3KLIB 3T1HJ 1S99A 5E0OA 1X0PA 5KAIU 4PY5A 2HBRB 1IJEB 5CB1A 4CLPA 3DOLA 1IKVA 3ZTOA 3DHWC 3HVRA 4X64K 2KJ8A 4DTPA 1TL1A 2GGPB 4OI0A 3DJCA 3DRYA 1N33K 3PJXA 1ZQTA 1KVIA 3EVOA 3GZFA 2UXBK 4B9MA 2OI2A 1W7AA 3RJFA 3DXBA 2OJ3A 2P9CA 3L4PA 2FBXA 1ZOTA 3NOGA 2LYHA 3D7EO 4ECQA 5E3CA 2FBVA 3B8AX 4QJVA 1X9SA 4JI5J 1MMLA 2ZJPQ 3NMAA 5DB6A 1IG8A 1MROB 2A18A 3OTOF 2KU7A 4PKGA 3P49B 2BXJA 4PL1A 2QLBB 1P9QC 3RSEB 4DL6A 2RH3A 2AKWB 3PYGA 4Q7AA 4UB8U 1G4CA 5EUHA 2KICA 4YMMA 4ZVFA 4FE3A 4C8NA 3VZIA 2MGZB 2E7VA 4HH0A 3KWIA 1LXNA 1TMMA 3BN4A 3BYPA 2KG1A 2CQIA 1AFJA 2IA0A 5LL6Z 4USVA 3KBBA 4KE5A 1WC1A 4B9LA 3FDSA 5KG4A 4IFYB 4DL5A 2JX2A 3R1HA 1B0PA 2QIFA 3ZSVA 3L09A 1WBDA 1HFEL 2DNRA 3VVTA 2FXUA 4AHCA 4W98A 3HBTA 2ZZMA 3WK8A 4PHTX 2BCSA 3GTYX 1P9YA 2P9PA 2VD3A 4WK3A 1RDUA 2ZGYA 1NI3A 3ZLJA 2OEHA 3M8ZA 1TGOA 3WXIA 2GZOA 1RTIB 4LSLB 3SZ2A 3I0SB 4E3SA 5IIIA 2D1CA 3FEYB 4LD0A 1YRXA 3HFZB 5M1NA 5AZJA 2CQ2A 4BGBA 1JUDA 3U4LA 5J29A 1TVRB 3GFZA 1SXLA 2YWWA 2OYYA 2VBZA 3E01A 3GJQB 1UJ5A 1RBTA 2NZCA 5HQLA 1IV0A 2Y9TA 3KG1A 3A0IX 1RTJA 1ZBHA 4RR5A 5H1SV 1TL7B 1DURA 5F0XA 2ZTCA 1BIUA 3D2FA 4KX5A 4FFDA 4HCBA 4MO5A 4QZCA 4ELTA 1WSVA 2QTDA 1TKZB 1U47A 1FX2A 3M6WA 2ZM6F 2XZTB 2ZUAA 3IP4B 1YIJS 4YB5A 1IJFB 1CLQA 1L5UA 5BPLA 3W2WB 2HWTA 2V34A 3FC9A 3KD5E 5DZ7A 1C7YA 4JD2A 1XSNA 2YBVA 3AD7C 4UQTA 4ANDA 2IRUA 1COOA 3K57A 1YRUA 4NXNJ 2QA4G 1CS4A 2F1HA 3MAQA 2XLIA 4K41A 1R8AA 2G0JA 3KNAA 1HMVB 1MNEA 3I0SA 4DZDA 2KK0A 3TA2A 3D3CJ 1O5JA 4C8ZA 3OJUA 1TAUA 4NCGB 5DKWA 1RYRA 4FCYA 4B9UA 2DIVA 4F25A 2HZVA 1NLVA 1NSQA 1CZ9A 3V7KA 4NXMK 2G09A 3EO3A 2HZCA 4EHUA 4QYZJ 4IQMA 4LFBF 1TKZA 1K0VA 2A1JA 2N3OA 3OYGA 1EXQA 4LF9K 1CJUB 1YBTA 1RTJB 3BF1A 4C8YA 2GELA 1T3NA 4ZVEA 1U09A 3BY5A 3ULHA 2Z8QA 5IC4B 4DFJA 2MDAA 4BRDA 4KLUA 3QU5A 4YB7A 2FY1A 4KFBA 1FD8A 4LFCK 4FPRA 1N6QA 4IBNA 3HI9A 3MGIA 1YJVA 1CJVA 3Q8SB 2XLKA 5L38A 3C15B 5L9NA 3MM5A 2KVCA 1J5EF 4F67A 3NS5A 4XH4A 3C8YA 4RWXA 4GVBB 1UPMB 4YHHF 3KMSA 5KG7A 3SCJE 4KTWA 4CF1A 3DLGB 2PT0A 3DNCA 3LYSA 2MQOA 2Q1NA 1N5TA 2B8QA 4DN0A 5IIJA 3MZIA 4B9NA 2QSFA 1BHLA 2RS8A 2I5HA 5LMNJ 5D3GB 2AXTU 3F53A 2KTQA 2ZM6J 3GV8B 4G9ZA 2GO7A 3M30B 4RQ2A 2DRDA 5AQLA 3KYLA 1NPPA 1RTZA 1Y64A 3R9LA 2MYFA 3SAFA 3ED5A 1M5OC 2MAXA 4PHEA 2R7OA 3V4IB 4AYBF 4NLXA 5HMXA 2VJ5A 1S5JA 1SS6A 2BJDA 3H8SA 1IKWA 1DGSA 3M2UA 2YX4A 3P39A 5GAEI 4K42A 1FKPA 2NQPA 4BRCA 4YHHJ 1FXRA 2G0CA 2DNQA 1IKWB 4OKEA 2UU9F 2WBNA 3EZUA 2Q43A 3R3LA 2ZKUA 4HAIA 2V4RA 3AUOA 4NM2A 3JPNA 1RT1B 1X6IA