4BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*CP*AP*TP*GP*CP*AP*A)-3')
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdpA01
5DQHA 1ZQEA 2IBKA 2Q0ZX 3S3NA 4CGJA 2G8KA 2IMWP 5J0YA 4EP4A 3U6FA 1T8EA 1DTTA 2XC9A 4J2EA 3C21A 4O4GA 4KLLA 4LY7A 3VQ5A 4M45A 3DI6A 5J2MA 4YG2A 4NXZA 4C8MA 3THVA 3DM2A 2YKNA 7ICNA 4PUOA 4M3XA 5HBMA 4FJHA 2NUBA 1NOYA 3RB3A 2HB5A 2X6SA 4E7LA 3WNGA 1SL0A 1TK5A 4QZBA 4DOBA 1REVA 4Z6FA 4RZRA 4BDPA 9ICVA 4RQ0A 4EYIB 2BANA 3GQCA 4JS5A 4CJPA 5HRRA 1HQEA 5CA7A 3C2LA 9ICRA 4BE2A 4KLUA 1X9MA 3HT3A 1RTJA 4R8UA 3NF6A 3MR2A 4BGDA 1LAVA 5CP2A 4QWDA 1NK0A 2PI5A 4Z4IA 4Z6DA 3K75D 5KFWA 1EP4A 2HVIA 1WSEA 3MEGA 4UB3A 4FM1A 4YMMA 2YNIA 3VQ9A 4W5TA 4FJXA 1ITGA 3ZSXA 3G6YA 5D49A 3ORYA 4I2DA 4I2PA 1S0MA 4CECA 4LSNA 1ZQQA 4KLEA 2O4IA 5KFZA 4W5RA 3ZDDA 1ZETA 3VQ6A 3ISNC 3L2VA 4I2EA 4NM2A 2HHQA 1BCOA 4TQRA 3T5LA 4AHSA 4EYHB 5DK5A 4K4HA 4P4PA 1RDAA 4B9UA 4DTJA 2G8WA 2P6UA 1HUZA 4ZHRA 1BI4A 4QW8A 1ZQTA 2ZD1A 4KHNA 1NK9A 3TAGA 4NYNA 4CERA 1TFRA 4PWDA 3DRRA 4R64A 4ED3A 5L1IA 4M04A 3UPQA 3RB0A 4CHNA 4P4MA 4TQSA 3H4BA 4DEZA 3MAQA 2J6SA 1IKWA 3K5OA 4K4IA 3CM6A 8ICPA 1G15A 5KG5A 4N76A 4C8OA 4CJRA 4OJRA 3M8SA 5DQGA 1SZPA 5J0RA 2R8GA 4M41A 4M3ZA 5DDMA 5EOZA 4CHPA 4CFDA 2XY6A 1JLAA 2I9GA 1TVRA 3SNNA 3SUPA 3DLBA 4KLTA 4DOCA 4E7HA 4DSEA 3ZT3A 3RBEA 1RYSA 4E3SA 5J0SA 4TUSA 2ASJA 1ZQYA 3EWAA 2DPIA 3NGYA 3AO1A 2ZUDA 3NE6A 3K5MA 4CK2A 2QK9A 5HP1A 2RF2A 7ICIA 1BHLA 1ZQLA 2G8UA 3K58A 4YR0A 3GV7B 2YHBA 1HJPA 1XO1A 4OKEA 7ICEA 3K5LA 3BDPA 9ICXA 1ZBIA 2I1QA 1FKPA 2XY8A 3HPOA 5L9XA 3CFPA 7ICFA 3FFIA 2DFFA 3WNEA 2X74A 3LDAA 4O3NA 3JPSA 4FO6A 4M3YA 4W5OA 4BE0A 1RILA 2XGQA 4O5KA 4KMUA 4ECVA 5J2QA 4KPYA 2P5OA 3L2QA 3V6JA 4OLAA 3OSNA 1HNVA 1BQNA 4YXMA 4UAYA 1ZBFA 3IM1A 5KT6A 3DOKA 5DBCA 4C8LA 1S5JA 3I8DA 4KKOA 4KREA 3SJJA 2FLPA 1ZQDA 1ZQFA 4YMOA 3U3GA 4LVSA 2O4GA 3NH2A 1PZNA 4Z4GA 1RBUA 1NKCA 1WSJA 4CHOA 5KFAA 3SV3A 1X1PA 5HP4A 1QSYA 3C6TA 3NTUA 3AVNA 4H8KA 3SQ0A 1ZQRA 3VQ8A 2BR0A 4KLGA 4I2BA 1EKEA 3ISCA 4FW2A 1TAUA 3HW8A 3KK1A 4KITB 2RDIA 3BQTA 2VWKA 4I2GA 2YNGA 1UAXA 1EXQA 4O44A 2QKBA 2XO7A 8ICMA 4C8KA 2MUTB 1RT6A 1ZQGA 3CFRA 4O5CA 4ED7A 1X2IA 4UB4A 5KT3A 5BPCA 2XY5A 3SQ1A 4KHWA 7ICSA 1RNHA 3OS1A 3TAEA 5IIKA 1BQMA 5J0OA 4K8ZA 4BWMA 2AGQA 9ICWA 3GV5B 4E7KA 3RJGA 1RDDA 2IDOA 2W9BA 3JPRA 5KFOA 1ZBHA 1JLBA 3AVIA 2BQ3A 4XRHA 1ZQIA 1D9FA 2FLNA 4O5EA 3PY8A 4H4OA 1KLMA 2VA2A 4UB2A 1W0HA 2Z1HA 3HXMA 3PO4A 4ECSA 2A1SA 3HPHA 7ICJA 1CEZA 1HUOA 3V7JA 3GFKB 1UA1A 2FBTA 2BCUA 3WNFA 2PZSA 2AGPA 1C0UA 1GOAA 1CXQA 2JLEA 3KLEA 2NRZA 4I29A 4KLHA 2IHMA 3M8QA 3V9ZA 4HHTA 2V4QA 5FRMA 3RH6A 3SUOA 4K8XA 3O4QA 5J2JA 5DQIA 4FJKA 5CY4A 4HTUA 4DTSA 9ICOA 2C28A 5KFDA 3EPIA 1RT1A 4FLXA 4KI6A 3KLHA 2ZJ8A 4B9LA 3HJFA 1ZQXA 2W8LA 3QZ8A 4DFJA 4CIGA 3ULDA 4IG0A 3G0ZA 3DLEA 3ZSQA 5IINA 3RAXA 3K59A 5KFIA 3ZD9A 4KLQA 1NK4A 3SQ4A 4KLJA 4FJLA 5IIIA 3M9MB 4QAGA 4B9MA 4FM2A 3MGHA 3QEPA 3NH1A 5J0PA 4FLZA 2IHNA 3H7IA 3OGUA 4N56A 3KLGA 2KZZA 3OYJA 2ETJA 3GDXA 3PX0A 5CJ7A 5HHHA 1LW2A 5C25A 4JK1A 3TI0A 4ZH4A 2AQ0A 1S1UA 1JXEA 3PW4A 4QZDA 3L3UA 4RU9A 2A1RA 2ISOA 3MEEA 3DLHA 3KLIA 1KDHA 4IDKA 4RW6A 4QZGA 1NJXA 5J1EA 1NK7A 1B9FA 5DLFA 8ICSA 1S9EA 4QWBA 3RTVA 3VQBA 5KRTA 4Z6EA 1J5OA 3QESA 1W9HA 3Q8QB 5KI6A 4UB1A 1X9SA 1WN7A 2PYLA 2QKKA 5DB9A 4EZ9A 2OWOA 4N5SA 4FLWA 5KGWA 8ICVA 4I9LA 5IIJA 2R8IA 4FJ8A 3AVHA 3RJIA 1K1QA 5KFCA 3AO4A 1XHXA 1FXXA 2BQRA 3OYAA 4FZYA 1BIZA 3OVNA 2W8KA 5KFQA 1SL2A 4YFUA 4R5PA 1S76D 1LV5A 2P1JA 1VSLA 1D8LA 4Q8EA 3UQ2A 3AO3A 3SPYA 5J2NA 1QSSA 8ICOA 2ALZA 2IS3A 3JYTA 4RNMA 4CHQA 2W9BB 4JV2A 4CFAA 2NRVA 3Q8MA 1ZJNA 2DTUA 2A1JB 4IRKA 2D0BA 4ECXA 4CJLA 5HNKA 4M42A 1RXWA 5F9NA 4MF2A 3HK2A 4PHEA 4JV0A 3VQ4A 4B9VA 3I0RA 3DLGA 4PHDA 5IIOA 4YVZA 1QLNA 3B6OA 1VSEA 1Y97A 5CZ1A 3RBDA 4O9MA 1NOZA 4B3OA 4DS4A 4FLYA 1BGXT 3KTQA 3OYCA 3AU6A 2PXIA 1ZQAA 7ICRA 3V9XA 2OZSA 3C5FA 4R8UB 3RB4A 7ICGA 4CF1A 4CK1A 4DTRA 1Q9YA 3RJKA 3S3OA 1ZQSA 2ASLA 3WNHA 1TV9A 1ZQNA 3HP6A 3ZCMA 3B0YA 2I5JA 3NDKA 3QEWA 3ZT1A 5L1LA 2E4LA 7ICOA 2BCSA 4JWMA 1KCFA 1KEJA 4ED6A 9ICNA 4GXKA 4NCBA 3B0XA 2HHTA 3RWUA 3V7KA 2R8JA 4RQ8A 5DDYA 1SV5A 2VG5A 1RTIA 4KHUA 1JMSA 4DU1A 4YP3A 2KQ2A 2HHXA 3V6DA 4DL7A 4FBUA 4UAWA 3P1GA 4PA1A 1RBSA 1S9FA 1Z3EB 4NM1A 2DFEA 1S0OA 4F4WA 2C2RA 4M9JA 1HYSA 4ID1A 4ICLA 4FJMA 3PR4A 1QQCA 1RTHA 3NBPA 3V7LA 2OYQA 4CJ3A 3AVMA 4ELUA 4NCAA 3JPPA 5IIMA 1ZQMA 7ICMA 3VQAA 4IQUA 4FBTA 4F4XA 4OGEA 4J2BA 4YNQA 3RH4A 2ITGA 3V9SA 4IBNA 4F5PA 4RNNA 5J29A 3AVBA 1KRPA 4TURA 4CEAA 1EX4A 4JUZA 7ICKA 1YTAA 3OYNA 2KFNA 4AHCA 4QZAA 3TANA 1X9WA 2BCRA 5FRNA 2OA8A 1D8YA 3KKSA 2X78A 5SZTA 4G3IA 1ZQUA 4E1NA 5D3GA 2W9CA 1BISA 2NRWA 3KHLA 3V1OA 4IQVA 2RKIA 2B5JA 1TL3A 7ICTA 3ZSRA 3DLRA 3H40A 4QZ8A 4I2JA 2P51A 4B9TA 4M2YA 3PMNA 4PH5A 4RT2A 5KG2A 4FK4A 2PI4A 3JPOA 4NLZA 2AJQA 4OKKA 1RT2A 4CIFA 1QS4A 4CEOA 3O3HA 5JS2A 1JLEA 5KFUA 3Q8RB 4KLFA 2YKMA 1KVAA 4PHPA 2JEJA 4IR1A 4FJJA 3QO9A 4CGFA 5HMLA 1RBVA 3KD1E 4J9RA 2G8FA 4Q45A 1VSIA 1JLFA 4FJIA 2BCVA 4L8RB 1VRUA 5FROA 3SV4A 1ASVA 5DG9A 9ICPA 2LYHA 1L3TA 1L5UA 2Z1GA 3PW5A 3V6HA 2MAXA 1SUQA 4I2QA 3S9HA 3FDSA 3HPGA 3LAKA 4FK2A 3AA4A 3KHHA 3D0PA 4KRFA 1ZQCA 2KZ3A 2OPPA 3L2RA 3VQCA 4CJ5A 5F9LA 2BPFA 1MQ2A 4CJSA 4RQ5A 4F2RA 2A1JA 5DGBA 3VQEA 4CK3A 3PO5A 3N4MB 3F9KA 3TAFA 3HP9A 4Z0UA 4O3PA 1L3UA 4CCHA 5KFEA 1EXNA 3FYHA 3ZDEA 3KK3A 1S97A 2ASDA 1WSGA 4FJ5A 1JXBA 3NGIA 2GV9A 4DL4A 2JZBB 4UB5A 2HHSA 3IRXA 4DTPA 4QZHA 2W42A 3MGIA 3IS9A 5C42A 4F4ZA 4EBDA 2WOMA 7ICPA 2GWSA 3NGZA 3Q8PB 4DOAA 3OYIA 1VSKA 1KTQA 4R66A 3ZDCA 3MBYA 3KIOA 5HLFA 4M9GA 3AA5X 4OKJA 1UWBA 4NYFA 1K1SA 2BE2A 2XHBA 4CEFA 2HHVA 1RT5A 8ICNA 4RPZA 1S1WA 3ETLA 3SI6A 4CIEA 1JXLA 3ZSVA 3OYLA 2PY5A 4BWJA 4FM0A 4RQ6A 1NK5A 3MR5A 4XQ8A 3C1YA 3BJYA 4CGIA 4AILC 3I0SA 2PFNA 3MDAA 3EYZA 4ZTJA 4DSKA 9ICSA 3MECA 3H4DA 4F3OA 2R7YA 4O0JA 8ICAA 3DMJA 3P83D 4YCXA 3RR7A 1CZ9A 4LD0A 3ZDAA 4J9MA 1J54A 1NKEA 1S0VA 4KHYA 4F5OA 1NJWA 1HPZA 1DGSA 3IHQB 4QZEA 1J53A 1Z26A 3QNOA 4MF8A 4DTOA 4KN4A 3BGRA 1ZQZA 2JEGA 4N47A 4E7IA 1XHZA 2OZMA 4DFMA 5CYMA 4J9OA 4HCBA 4DU3A 4KTWA 3AA3A 2DPJA 4RNOA 3RR8A 4YXJA 4B9NA 2F96A 2UVVA 3TWHA 5EWFA 3AV9A 5KG0A 4RW8A 1XI1A 3OHBA 8ICKA 3AVCA 1ZBUA 3A2FA 4EP5A 4O3SA 3TARA 3AO2A 4I7FA 3LDSA 4Z4CA 2G8VA 3OYBA 2B21A 3HVRA 4IG3A 1O1WA 5EWEA 1JL2A 2B4JA 2VA8A 4CEZA 4CF2A 9ICAA 2HHUA 2E6LA 4UAZA 5KFYA 4FYDA 1QE1A 3TFRA 3SPZA 4I2FA 2NRTA 1Z25A 4RW4A 5J0UA 4CEEA 4FJGA 4BE1A 3KK2A 1KVCA 3HO1A 1VSFA 1ZQHA 4QZFA 4MQ3A 5KFXA 2PFQA 4TSXA 4F93B 1C0TA 4QWEA 2OPQA 1ZQJA 1UA0A 3V4IA 1YTUA 4J2AA 1K6YA 3M9NB 4DS5A 3HVTA 3AVKA 2KFZA 3MXMA 2RN2A 3T5HA 4KLSA 4I2IA 4DFKA 4KAZA 4CEDA 4M0AA 3KD5E 1B43A 2XRIA 2R8HA 3EPGA 2ZTEA 4FLVA 1HNIA 5FDLA 4DTXA 4TUQA 2BPGA 4YMNA 4F3TA 3LZIA 4ELTA 4QW9A 9ICMA 4CGDA 4GXIA 4OGCA 4HVJA 4YN4A 5KT4A 2D5RA 5KT7A 4BXOA 3OY9A 1VSJA 1JLGA 3RMCA 4O55A 4J9KA 3B6PA 4W5NA 3PMLA 3HX0A 2JZBA 3QINA 3OJSA 1MQ3A 8ICLA 5KGXA 5KG1A 2P66A 4DL5A 4CFBA 4J9NA 4DSLA 1N6QA 1B22A 3AVFA 1RT3A 1ASWA 5DB7A 1NK8A 1CUKA 2UVWA 1A5WA 2HNYA 5K14A 5DBBA 4M6WA 3KKRA 3GIJA 2C2DA 2EHGA 1HMVA 3RRHA 3V81A 9ICUA 3SUQA 4UQGA 3O3GA 4ZTFA 2IGIA 4GXJA 4M3UA 4M9HA 3GILA 4CF0A 3LWLA 2Q3SA 1KLNA 1C0MA 3S3MA 1WCNA 4KI4A 3LWMA 1DTQA 5J2GA 4KTQA 1A77A 3OHAA 4KLMA 3AVLA 3AVGA 3Q8SB 2D0AA 3PX4A 4B8CA 1TL1A 4ED0A 1KFDA 2C22A 5DB6A 1QHTA 4GW6A 4LH5A 3UXNA 1ZJMA 1Z00A 4G1QA 4FS1A 3O4NA 4YQWA 2R8KA 5HRNA 4MFBA 1S1TA 8ICHA 3QEVA 2DFLA 4UBCA 4E19A 3KJVA 2PFOA 4ECTA 3T3FA 5HRPA 2VA3A 3LP1A 3PW2A 1NJZA 5KRSA 3ZSOA 3C23A 4NY8A 3AU2A 1JKHA 1I3AA 3JPNA 3U3YA 3QEAZ 2F1HA 4XA5A 3O3FA 3DYAA 3NF8A 1C1CA 4KB0A 4FVMA 1T03A 4CJKA 3HSTB 1IKXA 3OYGA 4M9NA 1R0AA 2HNDA 4DQRA 3GIIA 3RJHA 5JUMA 1S1XA 4F92B 3C5GA 1S6QA 1Z00B 2AU0A 2IC3A 3NGDA 1JX4A 1KFTA 7ICVA 3AVJA 3ITHA 4KLOA 3LP3A 4NCGA 5KFLA 3EY1A 2ZUCA 1S9GA 2FPMA 2HNZA 2GBZA 2B6AA 4ED1A 5KFKA 2G8IA 3ASMA 1TVAA 4FJ7A 3H8JA 1QTMA 4YD2A 1TKDA 1XU4A 5J2KA 4P4OA 3CFOA 9ICLA 1T4GA 4Y1CA 2ISPA 1A5XA 3G10A 4ED8A 4DWIA 2G8HA 4C8NA 2M9NA 1IXRA 4OVLA 5D4BA 4DG1A 3GV8B 1EETA 3CYMA 4O3QA 4DO9A 2BQUA 3BQ2A 4FCYA 1T7PA 3NFAA 2DY4A 3PR5B 2RDJA 3VN5A 1ZBLA 1WSHA 2ZE2A 4F8RA 8ICJA 3M8PA 4J9SA 3Q8LA 4FLTA 5C5JA 4ECYA 1S77D 2VANA 3V6KA 4MFCA 2ZQBA 4CJ4A 3OYFA 1WCLA 1U9LA 5J2FA 4R63A 3VA0A 5KFSA 4NLNA 4CJFA 4DQQA 8ICQA 4RQ2A 5I3UA 5KFTA 3C2KA 2X6NA 3ZSZA 5E41A 2FLLA 2KW4A 4PPXA 4DL2A 4QZCA 8ICXA 2FC0A 1I39A 2W9MA 4CHYA 3CQ8A 4CF8A 5KFFA 3QNNA 3K57A 1T05A 4ECUA 4DU4A 3N97B 3MR6A 4AHTA 3GIMA 4E7JA 3MXIA 4I9QA 1SKWA 4N41A 8ICGA 5KFRA 3K5NA 4I2AA 1XC9A 3MDCA 4CEBA 1BCMA 4KLDA 2Z1IA 4I27A 4EZ6A 4Y1DA 2YV0X 4FJNA 1XSNA 1MC8A 4BDZA 4DQSA 4KB1A 4OPKA 3MABA 4J9LA 5DKWA 5TZVA 1S0NA 2V9WA 4FS2A 1H38A 4KFBA 1IM4A 3OYKA 4B9SA 2JGUA 5CYQA 2JEFA 1U45A 8ICCA 1COOA 3EZ5A 2VG6A 3G6VA 4K4GA 1SKSA 2ZTCA 3NF7A 2H5XA 2XGPA 3T1AA 4PHAA 1C1BA 1LWCA 5J2PA 3D45A 5KFJA 3VQPA 3VA3A 4M47A 4XIUA 1ZQPA 4EBCA 1HYVA 1HYZA 4KV8A 4W5QA 3QETA 4FK0A 1N5YA 3HM9A 5DLGA 3V9WA 1WAFA 4DLEA 1Y88A 5I42A 5BOMA 2RPIA 4PGQA 4HUEA 1N56A 1IH7A 4CF9A 5KG4A 4X5VA 9ICIA 4KHSA 4CGHA 1KFSA 4O0IA 1A5VA 3ZT0A 3TAMA 4CHZA 4DFPA 3OSPA 3C6UA 4IKFA 3IAYA 2FMPA 2ZJAA 1NOMA 1A76A 4CJQA 4CGGA 3L8BA 4RPXA 5KT2A 4GVMA 4DL3A 2ZJ5A 3RJEA 3MFHA 1RTDA 1RBRA 4MFFA 1TK0A 3ZT2A 1L3VA 3H08A 7ICHA 4UBBA 1RCHA 4AH9A 5CR0A 4RW7A 3DRSA 3GIKA 1WAJA 2ATLA 4DF8A 5KFBA 3SCXA 3K4GA 9ICQA 3VQDA 3QIOA 1LB2B 5J2HA 1SKRA 3ISBA 4GLXA 4TUPA 1BL3A 5HRSA 2PFPA 9ICKA 4RW9A 1VSDA 3DLKA 2HMIA 3OS2A 3CM5A 1BPYA 8ICRA 4JWNA 1BVSA 4O5BA 4CE9A 2NRXA 3KHGA 1DLOA 4Z4EA 2JEIA 3JPTA 4DQIA 9ICTA 1WSIA 3UXPA 3ZT4A 4RG8A 5KFPA 4Q8FA 5J0QA 1B9DA 1XWLA 4O3OA 4F5NA 3QLHA 1RDBA 5J2AA 3NH0A 8ICEA 1NJYA 1XSLA 1IKVA 5CWRA 1JL1A 4Q0BA 5DBAA 5J0XA 3NCIA 4M3WA 1IO2A 4NLKA 8ICIA 1ZQKA 2FMQA 4KO0A 1WLJA 2UVRA 3PW0A 4DF4A 2YHAA 1L3SA 2AGOA 4HYKA 4PQUA 1CXUA 1CLQA 1S6PA 4DMNA 3F73A 1ZQBA 5EWGA 4F91B 4DSJA 2V4RA 3LK9A 1ASUA 1RZTA 5DMRA 2ZUBA 4RQ1A 1BPEA 9ICCA 2PYJA 2W9AA 1S1VA 3QEXA 2Y1IA 1BI4B 2XCPA 3V1QA 4AHUA 3V72A 1F21A 4MEYA 4CJUA 3SUNA 3P5JA 4QZ9A 5KFVA 3RB6A 4F4KA 5EU7A 1TV6A 2IA6A 3V1RA 4DTMA 5T7BA 1BPBA 1RYRA 4CFCA 2BGGA 3QE9Y 1TKTA 2YNFA 3ALYA 1RPLA 3C1ZA 4LZDA 9ICBA 3MFIA 1J9AA 2WTFA 2VG7A 2OPRA 2KZMA 4Z4HA 1D5AA 3AA2A 3KHRA 4JS4A 4FJ9A 4YR2A 2GUIA 2F8SA 4AHRA 1MU2A 1YVUA 2E6MA 4JV1A 4IFVA 8ICWA 2XY7A 4B8AB 3RMAA 5KT5A 3C94A 3ZD8A 3IG1A 3OYDA 3PW7A 2BGWA 5DG8A 4RQ4A 2FBXA 4DQPA 3LZJA 4AHVA 1ZQWA 4KLIA 8ICUA 3PUFA 4JRQA 7ICLA 2FBYA 4J9PA 3JSMA 1UOCA 4I2HA 4QWAA 2FPLA 1UT8A 1C1AA 4RUCA 4H4MA 3E2EA 3HWTA 5L1KA 2KN7A 3ZSWA 5HHIA 4JRPA 4BDYA 4O3RA 1AROP 3LPUA 3OYEA 4ECQA 4CEQA 3RJFA 4DL6A 5CZ2A 2HVHA 5J2IA 3NHGA 3KLFA 3VQ7A 4HCCA 3SYZA 3TQ1A 5KTQA 3HL8A 4Q43A 2HHWA 1RT4A 3OYMA 3RAQA 1BPDA 4Z4FA 3SI8A 4GC6A 3T5JA 4HUFA 3M8RA 5HMMA 4ECWA 4IQWA 2EX3A 3TR8A 3UQ0A 4CJTA 4M3TA 5HROA 2BDPA 2F1JA 3NAEA 1BIUA 8ICBA 2ATQA 1JLCA 5J0TA 1IKYA 4OLBA 4MFAA 4CJEA 4IRCA 4LZGA 4MEXA 4IFYA 4YFKA 3C2MA 4FW1A 3L2UA 3AVAA 1HJRA 1YT3A 4CJWA 2IOCA 3QERA 2MUTA 3RH5A 5J2CA 4I2CA 1BPZA 4CESA 4RQ3A 4Q5VA 4QOZB 4F50A 9ICHA 3LP0A 4B08A 4RQ7A 1TGOA 1S10A 4ECRA 1VSMA 2DFHA 2C2EA 1VRTA 3RRGA 4M3RA 2J6TA 3ZDBA 5JS1A 3QEIA 1U47A 1RXVA 3VQQA 3DRPA 3M9OB 4RUAA 4DTNA 1TAQA 8ICFA 3UXOA 4RT3A 3HYFA 1VSHA 2LSNA 1T3NA 3QZ7A 1LW0A 2FMSA 4QCLA 1CZBA 3LANA 1XSPA 1RDCA 4FZXC 3V9UA 5DGAA 4HUGA 1KSPA 3SQ2A 5CHGA 2AQ4A 3OJUA 1D9DA 1V9PA 4P2HA 5KG3A 3ISDA 4BACA 3L2WA 1LWFA 4EBEA 4YD1A 2XCAA 2F8TA 3MR3A 2UVUA 3CG7A 7ICUA 1HQUA 4F2SA 1XS9D 4M9LA 1NKBA 5KFMA 5KFHA 5IILA 4Z6CA 2J6UA 2HW3A 4DSIA 1QSLA 1TK8A 1JN3A 5L1JA 4J2DA 4E1MA 3H8SA 2WONA 1ZQOA 4IQTA 4F5RA 4F4YA 1NK6A 8ICTA 1LAWA 2QXFA 2Z1JA 2BPCA 4JLHA 1C6VA 1SL1A 2FPKA 1ZYQA 4LSLA 3PNCA 3EW9A 4R65A 2IAJA 5DG7A 4GMJB 3PVXA 4EEYA 3C95A 9ICEA 1U04A 4RPYA 2W9CB 1Q8IA 8ICZA 4I28A 3H8WA 1RT7A 3PV8A 4NLGA 4DSFA 5J0WA 1BPXA 3E01A 1MSWD 3DOLA 1UT5A 4KTZA 3K2PA 3TAQA 1FK9A 5CB1A 9ICGA 3TAPA 4ED2A 4OPJA 4BXOB 3AUOA 5J2DA 4GC7A 2F1IA 4J9QA 4ID5A 1IG9A 4XUSA 3PX6A 8ICYA 3LALA 5J2BA 3SZ2A 4F5QA 4IR9A 9ICFA 7ICQA 1Q9XA 1TKXA 4KHQA 3RMBA 3L3VA 1KVBA 4E0DA 3UIQA 2Y1JA 4FLUA 3OYHA 3MEDA 3TFSA 4KN7A 4LH4A 3BQ1A 2D0CA 1FKOA 1DOQA 1RBTA 3AO5A 4M6WB 4PGYA 2BCQA 4DTUA 4Q44A 5C24A 5BOLA 9ICJA 4WE1A 4IRDA 3JPQA 3LPTA 1WSFA 3QEBZ 4FZZA 3QIPA 1TKZA 4ELVA 5SWMA 3T5KA 1HRHA 1JIHA 5KFNA 1GOCA 2P6RA 5KFGA 4QWCA 1VK0A 2ZTDA 3MXJA 3LP2A 3BQ0A 4YR3A 4PGXA 3OS0A 4CJVA 2VWJA 3G6XA 4FXDA 4E89A 2BKEA 1U49A 3NF9A 3RMDA 5DB8A 1C7YA 1N48A 2KTQA 3RJJA 1LWEA 1JLQA 1U4BA 2P5GA 2OPSA 5KG6A 5J2EA 4QZIA 4PY5A 1ZQVA 2BHNA 5D46A 5KG7A 4DLGA 3LAMA 1GOBA 2YNHA 3T19A 1U48A 2FBVA 3TABA 4ECZA 1B92A 1WNSA 3ZSYA 3Q8KA
chains in the Genus database with same CATH superfamily
3M2VB 2E5IA 2XSJA 3VF2A 3L4PA 2ZJQL 1N0UA 1ZQEA 3M8ZA 3S3NA 3MPVA 1XO0A 3FBCA 4CGJA 1BA0A 3M2UB 3AJ1A 4J2EA 2OTJN 1E4FT 4JKGA 2K3KA 4KLLA 4O4GA 1XBWA 1MU2B 1MN7A 1QH9A 4YG2A 1L8LA 2XVTA 3DM2A 4TYBA 1FF2A 2YKNA 5AQYA 1KWMA 2O8EB 1RCXB 2AJ1A 3J7A1 5B08A 4BDPA 2OEMA 4RX6A 4FPAA 4N77A 3DOMB 4JS5A 9ICRA 4BE2A 2B4PA 1SJ4P 2XB2D 1PJ5A 4IOBA 3GZFA 1X9MA 1RTJA 4YDDB 4R8UA 4V1Ak 4DX6A 3HKZD 4BGDA 1UKUA 2YWEA 1RAHB 4QWDA 4CWBA 3CETA 1NK0A 2DNOA 4IYQA 2J0SD 1HNWF 1MN9A 2HVIA 2ZG6A 4UB3A 4RBTA 4CZEA 2EFVA 2D3UA 2JC1A 1EO1A 3VQ9A 4AF1A 1ITGA 3LTOA 3ORYA 4I2PA 3MMBB 4LSNA 4ZS6A 4KLEA 2M5YA 2ATCB 3L2VA 1M5PC 4MHVA 1HW9A 3JTNA 4TQRA 1XR7A 5CH7B 3LGNA 3FZFA 3AY9A 1VI7A 1HNWK 2LCWA 2PC6A 5HQ8A 2P6UA 1BI4A 4QW8A 2HNZB 4Z94A 2ZD1A 3JQJA 4OL8A 1FJ7A 3TAGA 5C25B 1DHMA 2EEYA 4PWDA 1Q8KA 3PACA 4DR1F 1T11A 1HKBA 4YOVA 2P9SA 4CHNA 4TQSA 4M7XA 4DEZA 3CF5Q 1HARA 4U67Q 3CM6A 1U2CA 2X1GA 3LW5C 1G15A 5AZIB 2FJWA 1K8AT 1V4SA 4HTLA 3A8KA 3S41A 2VC0A 2N4DA 1FDNA 2A40A 4C8OA 1QQ7A 3CMAN 3U27A 5DQGA 1SZPA 1SC6A 1NUEA 5LSOA 2DGQA 4ZCLA 2K4PA 2R8GA 4M3ZA 5DDMA 3UO0A 2XQCA 2I9GA 2W4CA 3SNNA 5BN8A 4IEIA 3C66A 1UCNA 5ADXH 1WWUA 3HILA 4DOCA 4E7HA 4DSEA 2WW8A 5FLXO 1ZZNA 3AJDA 5J0SA 2DPIA 2QEXS 1WI8A 1YRUA 4WQ4A 5E79U 2G8UA 4U9RA 4YR0A 2ZM6J 2KVQE 3OTEA 4JB8B 3GWCA 4WFNQ 4R0JA 1OH6A 3FFKB 3C15A 3CCTA 3HPOA 5B0DA 5L9XA 3CFPA 4RWXA 1B70B 2DFFA 5F8MA 2Z2YB 4PYDA 3VGMA 4Y2JA 5CE3A 4FO6A 1KD1O 4LJMA 1ZTTA 1HNXF 2WAQF 2KIWA 4DV2J 2UUCF 5A8RB 2P5OA 2W2MP 2D6FC 1WEXA 4B3SF 4RKUC 4OHWA 1HNVA 1BQNA 1WWHA 3WX4A 1HBUA 3UD3P 2W1BA 1S59A 1S5JA 4KKOA 2XHCA 1VGYA 2LKZA 4YMOA 2K8GA 2G0CA 2M9KA 1NDLA 2VFVA 4Z4GA 3R9KA 1RBUA 1WDDA 4CHOA 2B43A 4N8OA 1X1PA 1QSYA 1JUDA 2MKSA 5A8KB 3JSBA 1C0FA 2M2BA 4O23A 1TAUA 3ZZUA 4G1QB 5CQGA 4I4BA 5I42B 3NG8A 2YTCA 2HHHJ 1H7XA 4J9VA 3ZZZA 2Q66A 1UAXA 4O44A 8ICMA 2GCFA 1MNEA 1ZQGA 3ALRA 4EFAC 5BN9A 4CRXA 5IT9U 4ED7A 1X2IA 2XY5A 3WU2U 1VQ8S 4KHWA 4H0PA 2IVFB 3TAEA 1TUUA 3NBPB 4K8ZA 3HLUA 4MT1A 3OR2A 5CYMB 4DV2F 2QN6B 2XEXA 4WYLA 1JCEA 2D4WA 5AQHA 1ZBHA 1JLBA 5EHHA 4XRHA 2FDNA 2FLNA 2G0JA 3T1YJ 5G0RB 2VA2A 3HXMA 3M32A 1K8KB 1BXNA 3HPHA 7ICJA 1HUOA 5JRTA 3D2EA 3AD7C 3GFKB 3D0IE 5A0YA 2BRKA 3QU2A 2DCUB 2R18A 2XYHB 1FNOA 4NLUA 4WPAA 2AGPA 4WFBQ 3FSXA 2XZTB 3KJFB 1BQXA 1D1UA 3RG6A 4I29A 1Z1BA 3LP2B 1Q4RA 4C0OC 3HM8A 4EU0A 4I6WA 3SUOA 4K8XA 3O4QA 5CY4A 4HTUA 4DTSA 4LF6K 1FJGF 3AODA 3AAQA 4KV8B 5DDOC 2HBYB 4WZMA 1H2TZ 3QICA 2FIUA 2V52B 3IM9A 3MM5A 3NGUA 4KI6A 3H2LA 2CGJA 1RHQB 2EQYA 3VAHA 4DZ6A 2GQCA 2HLUA 4MJKA 1RUSA 1S4FA 2DNYA 3SBTA 3ULDA 4IG0A 2DGXA 3MPUB 2HSZA 3ED5A 4XDCA 1H72C 3K59A 3ZD9A 1U1KA 1AW0A 3PXGa 1I94K 1AFJA 3RSEB 1P8GA 2C3YA 1PJ6A 3DHWC 3SQ4A 3T6BA 4LFCK 3TKAA 5IIIA 4FM2A 5AZIA 2PIIA 2A6OA 5J0PA 2IHNA 2UXDJ 1QHAA 1DKGD 1L7OA 2DGOA 1OKJA 1GAOA 4LF9K 1L7MA 4NYPA 1FFVA 5C25A 4G9ZA 1Y3JA 4ZH4A 3NOCA 3PW4A 4W90B 4LR8A 2A1RA 4JKDA 3LVVA 3KLIA 4QZGA 4H4KA 1NK7A 1HIWA 4QWBA 3RBXA 5KRTA 2VYPA 1J5OA 4F4AA 4KBIA 3Q8QB 5AM3A 4UB1A 2XMTA 1X9SA 3QIDA 2V8VA 1WN7A 1S72S 2P9EA 3FZKA 4N5SA 5BR8J 5K14B 4I9LA 4OHXA 4GMKA 5IIJA 1DJ0A 3LH2S 2NXNA 1HIYA 1XHXA 1FXXA 1BIZA 2EZYA 1P90A 2FTRA 4OYXA 2QA4S 2QLTA 2YKQA 4QQBA 4M5HA 4YFUA 1IVZA 6FDRA 2HS4A 2HBJA 5L1MA 1LV5A 2P1JA 4JI5J 3UQ2A 2O01C 1WSRA 2ALZA 2HZCA 4JI7J 4ZN3A 1IUJA 1SB6A 4JYAK 3JYTA 1H0HB 2W9BB 3KNAA 4NLQA 1UVIA 4H5NA 2NRVA 2DTUA 3DDKA 2ROGA 1C0GA 2D0BA 4ECXA 3O44A 3KJVB 2B4VA 4PHEA 5ETQA 3MOZA 2O8EA 2KHCA 1JROA 4B9VA 3VQ4A 4WFAL 3UR3C 5IIOA 1C1BB 4OX7A 4YVZA 2UUCK 1QLNA 1OVYA 2HVZA 1VSEA 3T6JA 5CZ1A 2AT1B 4HHUA 2F4VF 3KTQA 1OH5A 5TISU 3AU6A 1X6IA 1ZQAA 3FLCO 3C5FA 4R0EA 4R8UB 4CF1A 3S3OA 2DB1A 3WNHA 2QB0B 1TV9A 3W8GA 4Y65A 2FF6A 1VQMS 1HNZK 3B0YA 2I5JA 3SCKE 3AFGA 5L1LA 2E4LA 2GQ2A 2RRAA 2GO9A 2CRLA 2HEKA 4NOHA 1QE1B 2DJWA 4ED6A 1ZM3A 9ICNA 1M5KC 5KQ8A 2F77X 1HL6A 1XMOK 2QLFB 3V7KA 1GT8A 2YPZA 1NO8A 5LL6d 1AYEA 4KHUA 4DPXA 4DCOB 5AM0A 2HZVA 2HHXA 2KQ2A 3N5BA 4DL7A 1ECWA 4UAWA 4DHVA 4PA1A 3MAAA 2KJVA 2ZWOA 3RBZA 2LFVA 4PZOA 1V3RA 1ZS6A 1WUUA 1SGGA 4JKFA 1XNRF 3C7NA 1X4EA 2O8CB 1VAZA 3MEEB 3CCUN 4ID1A 1QQCA 1D0EA 1RHRB 2OFGX 3V7LA 5AJ3J 3T9ZA 4M5KA 4CJ3A 3MI7X 3AVMA 1ZQMA 2VBWA 2MKHA 1NGGA 1R59O 3AH6A 3VQAA 2CQ3A 1OY9A 3OBWA 3IAS9 4U96A 2VQEF 2FSKA 3K1RB 2K8BB 4H4OB 2ITGA 3JSRA 4CEAA 3D7SB 3DGPA 1MA9B 2YNFB 1KQFB 3JAMU 2NZCA 1EX4A 3QU5A 1K73T 1U7LA 7ICKA 3UCGA 1X9WA 1T95A 1NJIO 2RQKA 2ZGYA 1XMOF 3AT1B 2HAFA 2J0XA 3V1OA 2GLEA 1WORA 2RKIA 2FLOA 5LSLA 1Q79A 2EAOA 3H40A 4X4VA 2K8CB 2ZOGA 3O6WA 4X84A 1RDFA 4ZJQA 4DV3K 3OBYA 1LFWA 4DCHA 4PH5A 2GVDB 4RT2A 4KYZA 4OJ3A 3SFUA 2PI4A 2AJQA 5AZJB 4CIFA 1QS4A 4P10A 2JV3A 2PEHA 3KOAA 2IOFK 4IR1A 1PKUA 1HEKA 1RBVA 3KD1E 2F8MA 2G8FA 1KLMB 2RF2B 4M1KA 1U26A 4HKQA 5FROA 5FIIA 2IJFA 2GOLA 1PIEA 1ROFA 1ASVA 4AL5A 4FWQA 2LYHA 1GTEA 2Z1GA 3PW5A 2CG8A 3SSSA 2MAXA 1SUQA 4AYBD 2MSNA 3NASA 3ZTQA 3HPGA 5M1NA 4FK2A 1UVJA 3BSNA 3KFUF 3PFEA 3KNGA 4X64J 4Y2IA 2A3ZA 2WVEA 2DBBA 4DR6J 2OPPA 3L2RA 3VQCA 3EUNA 1JJCB 1NSKL 1IBLJ 1S1XB 4CJSA 5K20B 4RQ5A 4DR1K 3UR0A 1Q8BA 4CK3A 3PO5A 3N4MB 2GGPB 4Z0UA 2A1AA 4JI4J 1UEKA 3PIOL 1R43A 3C3LA 4CCHA 1EXNA 1XUPO 3ZDEA 5IQQA 1JXBA 1F9FA 3AB4B 4BRFA 1TL5A 4DR5F 5ETLA 4LF5J 2QWQA 1SH3A 3BPSP 3R2CJ 8AT1B 4DOAA 2NV3A 2YMPA 5H1SQ 3GJTB 2ZHOA 1E3MA 3PJ9A 2WVCA 5E3RA 4LR9A 4KFBB 3W65A 4OKJA 3TU5A 2Y0BB 1K1SA 5AK6A 1O13A 2BE2A 2E1MC 4CEFA 8ICNA 2DNLA 2W7AA 2ZF5O 4LF8K 3POTB 3L4IA 4HHJA 2F4VK 4QJFB 4CM0A 4B1XB 3U02A 4FM0A 3LOUA 3VWSA 3VVTA 2IVPA 5AQSA 3ZTSA 1HR0J 3C1YA 2B5JB 3HD2A 2XMVA 4ZTJA 4DSKA 1MW7A 4B3MJ 1YAGA 2R7YA 5ALRA 5ETSA 8ICAA 2WW4A 2BE7D 3LQVA 4CBUA 3LP0B 1CZ9A 4CLZA 4NA3A 5AXLA 5FPNA 3L5KA 4OHYA 2P9IB 3VZHA 4QZEA 4M63A 4MF8A 1OWXA 3L3FX 1XEZA 3EKSA 4ISEA 1GFWB 1F1BB 4ZP7A 5C2FA 4N7TA 3G8TA 1T9WA 4N47A 4A8EA 1NSAA 2Z2ZA 2YTUA 4DFMA 1K5OA 5CYMA 9ATCB 4DV0J 3EE3A 4CO5A 4HCBA 1DGJA 4K4TA 1X9XA 2DPJA 4RNOA 1OVQA 1S22A 3FZHA 5EOYA 1XNRK 1PVPA 2UVVA 2BJ8A 4K5RA 7FD1A 2WAQD 2FHJA 2CPHA 3TO8A 2IY5B 4NASA 3A2FA 1B0XA 3LF0A 5GAEI 4C4WA 2ADCA 1RTIB 5FPEA 1GX6A 5D0GA 4Z4CA 3OYBA 3BZCA 1K9MT 3KKAC 1FJEB 2B21A 3HVRA 3HRDD 1O1WA 5EWEA 2VA8A 4HDHA 3PIPQ 3V2UC 2HHUA 5I3QA 3SAFA 2G9OA 3C6HA 1KVIA 3N5FA 2DR9A 4JKAA 3NRWA 5HJYA 1Z25A 4RW4A 2YMMA 3KK2A 1N61A 2K60A 4C97A 4OYBA 4LF9F 4QZFA 5KFXA 5HAOA 3D2FB 4TSXA 4B1YB 5BRHA 2UXBJ 2JLFA 2AEMA 1ZQJA 2KT3A 4MMOA 3J81Y 1NI3A 1X4HA 3E9PA 2VQFK 3M9NB 5IT0A 5KPRA 1S6UA 2N7CA 4HI2A 4HWIA 4A8WA 3DDIA 4DFKA 1YSJA 5AXNA 4M0AA 3J81j 3KD5E 4R25A 1KTVA 1FRHA 1WF1A 2CPZA 1NZAA 2H1YA 4CZLA 2UUBF 2CVIA 3TTCA 4BC9A 2XMUA 2G13A 1RG6A 5B0CA 2KYXA 1Q1KA 1T3QA 2CQBA 2BPGA 4YMNA 4F3TA 2B8PA 2B6AB 1NGBA 1RTHB 2BUNA 1FJGK 1WWVA 2FF3B 1S6OA 2ZEJA 2YX7A 3GU0A 5C2DA 5KT7A 5AQJA 3OY9A 1F5CA 3LDPA 2DT9A 1NBEB 2VGMA 2J8AA 3GR1A 3GCWP 1BE4A 4I64A 3HX0A 3A0HU 4DV7J 3JSYA 3P38A 3W0LA 2I5JB 3PJWA 3OJSA 3VV2B 2EC0A 3UKUA 4JI0F 3ULEA 3DOKB 4J9NA 4DSLA 1B22A 5HN0A 3FEZA 2JLGA 1ASWA 1TUYA 2MQLA 3R8YA 1X5SA 2UVWA 6FD1A 4KJIA 1UETA 2CPFA 5FPDA 1GMVA 3CI5A 5BRDA 2HOQA 4P2FA 2JJ4D 4JI7K 1HMVA 1TUWA 2CUYA 1ZRMA 1GH8A 2A2DA 3H20A 2A2CA 4K0KJ 3QDKA 4IS7A 2EKYA 4BQZA 4M9HA 2H65B 4CF0A 3LWLA 2QL5B 1KQKA 1C0MA 3S3MA 3ZI4A 3CUNA 5CAAA 1LVHA 4KIAA 2V2VA 3K17A 2KE7A 2K8AA 3FGVA 1LKYB 1A0OB 1A77A 1S1TB 4KLMA 2UXCF 2D0AA 1TL1A 2IA0A 1KFDA 2C22A 2YKAA 2ZHBA 1NPPA 4HI1A 3CJKB 3IBFB 1QHTA 3PKYA 5M1PA 3BS7A 1HNXK 4EAHD 4FS1A 4YQWA 3VVUA 2R8KA 2K1RA 3ISND 5AE1A 3OTOJ 2DHXA 4HVZA 2VICA 2QMXA 4USKA 2HBMA 3ENAA 3TTDA 3ZETB 5HRPA 3NVMA 4BC3A 5AKKA 4ZCMA 3OVSA 2BJ1A 3FBBA 3ZSOA 3HHLA 3AU2A 1AZSA 1I3AA 1YJWN 3JPNA 3QEAZ 1V4TA 3O3FA 3R5JB 2PMZC 2CGKA 4PQUB 5M2PA 3NF8A 1Q5VA 2E8MA 2ZBPA 2MZRA 5C24B 3EO3A 1R0AA 2OCEA 4Y2VA 4TY8B 3MEKA 4FP9A 3DOMA 4IUFA 3H0RB 2I6WA 3L4QA 2OEHA 1QUPA 4G9BA 2IC3A 2XIDA 2K1RB 3AOBA 4JHDA 1NHUA 4KLOA 4RCHA 3LP3A 4KMOB 3HZGA 4I67A 2ZUCA 4LBIA 2F3JA 4GIBA 1R8AA 3ET6A 3I32A 5KFKA 3GG0A 3OFGA 4FJ7A 3MAHA 1LW0B 1QTMA 1TKDA 1IM6A 3IV6A 2ZFHA 3IMQJ 4KC5A 4Y3CA 1UVMA 3CFOA 3ZZTA 1T4GA 1A5XA 3CDBA 4DCPB 2LXUA 4ED8A 3D6MB 4DWIA 3GJSB 1IXRA 3J7ZO 1MMNA 1EETA 4BRCA 2BQUA 5G5GA 1SJQA 1UJ5A 3HVTB 3AY0A 3SAGA 1T7PA 3TZXA 4L76A 2R7UA 2DY4A 5E5NA 2VOOA 4CF4A 3DHXA 2XS2A 2ACMA 3M8PA 1KBUA 1LOUA 3I28A 3KUHA 4ECYA 3NLCA 4F72A 2DNKA 2YH1A 1ZM9A 3VGSA 1R0AB 3W1YC 3ULEB 2JVOA 2ZHAA 4WJBA 4NLNA 1OY8A 2FVSA 4O8UA 3TUZC 4CJFA 2CJYB 4DQQA 1S6QB 8ICQA 1RAIB 4RQ2A 1GTHA 4PKIA 5KAIU 1R7IA 5I3UA 1RB0A 3NNHA 5E41A 2KW4A 3A0IX 1X66A 2FC0A 1HWLA 3C46A 2GO8A 2KM8C 4DV1K 1FX4A 4OZJA 4CHYA 1T05A 3K57A 3QNNA 1FEZA 3OL6A 4DU4A 2BEFA 3M1VA 2KHOA 4ZLJA 3NXZA 3VEZA 2P9KB 1VQOS 3JB9k 4CD3A 4IWVA 3FBEA 1SKWA 3VQTA 4Y2UA 4N41A 8ICGA 4LQ3A 2BM1A 4K4VA 3E3XA 2Z1IA 1RYUA 3QRRA 1PCAA 4EZ6A 4DR4F 1M5SA 4KX5A 3VTHA 1VDVA 3S8SA 1XSNA 4NXNJ 2E1PA 1MC8A 1CJTA 3WQTA 5A8WB 3MABA 4J9LA 1S0NA 2P9NA 1SWVA 1IM4A 4O8KA 5HP1B 4DV2K 1FT8A 2LMRA 4NI2B 4C23A 2HBLA 4Y0FA 2ASMA 2YCHA 2ZTCA 3NF7A 3H0MB 2IVYA 2NPFA 2GHWA 3WIUA 2VG7B 2KO1A 1QY7A 4CO4A 3VAFA 4FYYB 1FEEA 4M47A 2CRXA 4ETZA 1ZQPA 2LYVA 2HQDA 4JI6J 4EBCA 5FDLB 3QETA 2ZVIA 4DR7K 2W7PA 3Q24A 2YNIB 2NXCA 2H48B 1QQMA 2ZH3A 1R89A 2CXEA 2K4IA 1V97A 4PGQA 1HPZB 4DBQA 4WQ5A 2MKKA 4NLYA 4CF9A 9ICIA 1B99A 3TAMA 3WKAA 4CHZA 4DFPA 2LEAA 3UNYA 3FM9A 4YORA 4PL1A 1RBLA 1M6YA 3PLAA 3HI9A 4WWSA 2VHGA 1FWLA 2H3VA 5KT2A 1CJVA 2BX6A 3QPIA 5BYSA 1WC4A 4I56A 1Q46A 5A0YB 2FHJD 1WKKA 1TK0A 2KVIA 1EJ7L 1L3VA 3H08A 2DKOB 4UBBA 3C19A 2G1HA 3L9ZA 1FXLA 1RT7B 4QZVB 4YHHK 5KFBA 3K4GA 2QL9B 4IH6A 2ROPA 9ICQA 1O51A 1YJNN 5AKIA 1SKRA 2K3IA 1BL3A 2WB1F 3OHRA 1J5EF 4TKTA 5M1QA 3V6DB 3D3BJ 4IDKB 5L9NA 3DLKA 2RE2A 2J0QD 2HMIA 3OS2A 8ICRA 3OR2B 4MO5A 2R7VA 2C2OB 4GY2B 3N7RC 1FESA 1DXSA 4CE9A 3J80O 2JEIA 2EFQA 4B1VA 4RG8A 3CF5L 2E1FA 4Q8FA 2B7CB 2B9YA 4YDUA 2HPUA 1B9DA 4FWKA 3EGZA 4YB5A 4BHQA 3MTKA 2WVFA 5J2AA 1RDBA 5AKYA 8ICEA 1XSLA 4NPOA 3VCBA 5DBAA 4DPOA 2QL7B 5K9FA 2H51B 1Q5YA 2FMQA 4KO0A 2AGOA 4CD1A 4K50A 3F73A 2KICA 3HKZC 4WF9Q 1FK9B 4OQJA 4RQ1A 1JNRB 2PYJA 2W9AA 1T9TA 1S1VA 3P96A 2VQFJ 2UUAJ 4M63C 3TRGA 1XMQJ 3SMPA 1NWKA 1K47A 3V1QA 4CJUA 3SUNA 1V6HA 3QO9B 3P5JA 4QZ9A 5AQXA 4P75A 1VJQA 1TV6A 5EU7A 3V1RA 2P9SB 1ZOTA 4DTMA 2BGGA 3QE9Y 4JEPA 1T9UA 3ALYA 1S72N 3C1ZA 4IOCQ 4X4PA 3UW1A 1J9AA 1KQSM 1ZA2B 2WTFA 2VG7A 1H2UX 2ZE2B 2KZMA 4JV5K 4CO0A 1TAMA 1ZM2A 3DXKA 2LM1A 5C42B 2GUIA 2F8SA 2VC1A 2QMWA 2EVZA 1DAXA 4AHRA 2P9KA 4IFVA 1IV8A 2E6MA 8ICWA 5KT5A 2OLWA 3QX7A 3OYDA 5K8MA 3PW7A 5DG8A 2LQBA 4ZLPA 2FBXA 4IG3B 4DQPA 3LZJA 3C14A 1JJ4A 3VZIA 3IRUA 1LKZA 4YEAA 4K59A 2FBYA 1UJ4A 4DUZJ 1U1NA 1WACA 1A7GE 5CA5A 1UOCA 1MMLA 5E2QA 3OTBA 2NXEA 4C4RA 4WXWA 4ILJA 3W3SA 2I9SA 4B1UB 4C98A 2FPLA 1RTJB 1B0VA 2G07A 2GJFA 4H4MA 5M2RA 3PRDA 2D9PA 1YX2A 2V8DA 4JRPA 4NL9C 1YI2S 3UQSA 3OYEA 5KPZA 3RJFA 3HKZF 3VALA 2C2NA 1GMWA 2HVHA 5A8WA 3ZZYA 3M7DA 1U2VB 3N4PA 3KLFA 4AFFA 3CMES 3SYZA 4Q43A 4CZMA 1FEHA 1IWAA 1TELA 1U6FA 2V9KA 2CADA 2E1AA 1XMOJ 2JH7A 4GC6A 3ID6A 4CF5A 5HMMA 4IQWA 5D78A 2MLXA 1RAFB 4LFCF 2RT3A 1PO6A 3T1YK 1IKYA 2G1DA 4IRCA 2QWRA 3QAEA 3HRGA 2WF6A 4IFYA 4F71A 4YFKA 4ILMA 1F0MA 4ALZA 3CJTA 1FI4A 1X4FA 3AVAA 1HJRA 3HT0A 1DRZA 1KDNA 1SS6A 4A2BA 1IKVB 3CCSN 4CJWA 3H6EA 3FFIB 3RH5A 4I2CA 2WB1C 1BPZA 4RUHA 4F50A 4B08A 3NAHA 4M5LA 2F8LA 1VQ6S 2PMWA 2RE1A 5IFMA 1VRTA 1YHQS 3L0QA 4WJ3B 2Y0SF 5MLCQ 3RRGA 4I1TA 2VIXA 4DG1B 4IEEA 1B64A 3VQQA 1WF2A 2Z7JA 5KL8B 1YWXA 1YJNS 3MWPA 4US8A 3EICA 5DZ6A 3PDNA 4RT3A 5IT9Y 5ALPA 2FJBB 3IFEA 1T3NA 3EVMA 2FMSA 4QCLA 3EN9A 1RDCA 5IZHA 3V9UA 3VEWA 2VOPA 4F26A 1CC7A 3HBTA 1EWRA 1V9PA 3WKEA 1WEZA 4YY3K 1DQ9A 3R7BB 5KG3A 5I9EB 2HGNA 2WOMB 3Q7CA 4LF7F 5AQLA 4BACA 3QYPA 5ALUA 3BGOP 1EWQA 4JI2K 2DHGA 3MR3A 2UVUA 2A5XA 1W26A 1HQUA 4F2SA 5AM2A 5HLFB 1XS9D 4M9LA 4FPIA 3CCMS 3SFGA 2XYPB 3NWGA 1J6ZA 2DYAA 1VQ7N 1QSLA 1TK8A 1QCKA 5L1JA 2NS1B 4GV9A 4J2DA 4E1MA 1B7FA 3EUB2 2QXFA 2HFSA 3A8YA 4WCEQ 3U8XA 1C6VA 1SL1A 5AQIA 1E6VB 4DOZA 1CJKB 2CQ4A 2VPXB 3WK5A 2ZNYA 5DG7A 2I6XA 2GV1A 2NRHA 3PVXA 3I31A 4OD0A 3NVWA 5DDRC 4NLRA 3CCEN 1GEHA 2PDAA 2DNGA 2UV8G 4ZVFA 2R7WA 1I3OB 5GTIU 1PUZA 3E01A 4DL0C 4RJVA 2QWMA 1UT5A 4C3MA 3K2PA 3TAQA 3CDUA 2XG8A 4CH1A 4F67A 1WUDA 4B3RF 3FCWA 5HO4A 5J2DA 5AFUA 2F1IA 4ID5A 1NGHA 3E66A 4XUSA 3LALA 3PX6A 8ICYA 2FYXA 4IR9A 3SZ2A 9ICFA 2JX2A 1TKXA 2IMOA 3RMBA 3FCHA 1KVBA 3UIQA 1F44A 4H4MB 5A2QY 1N33K 5JVGQ 1GNKA 3NP5A 3DXBA 4DU7A 3LVWA 1VQNS 2W54A 1NGEA 2OMLA 3TFSA 4LH4A 1Z1ZA 2EK6A 2D0CA 3F2BA 1FKOA 2NPIA 3AXKA 4M6WB 2F44A 1Z6RA 1YITN 3H2VE 2W43A 2XI2A 9ICJA 2HSTA 3I0SB 5LSRA 5ETOA 1X6JA 4Q0BB 3P5BP 4K25A 2FSNA 3LPTA 4CZCA 2APOA 2O8DB 3GJQB 5SWMA 1XR6A 1WKJA 3PM9A 2HF4A 3H90A 5KFNA 2KI2A 3G4SS 4OMFG 2BE9B 4WE1B 4YOUA 3P45B 3M6GA 4CDIA 3CPEA 1QVFM 1O6XA 2YQ3A 2PA3A 4OZ2A 3MK6A 1IKYB 1JALA 5DB8A 2KJ8A 1NH8A 1VQ9S 1LWEA 1JLQA 2ILZA 3FE1A 1JRPA 1U4BA 5KOXA 3U9DA 5GVQA 4QZIA 1VBYA 4BGAA 2KK0A 3HSDA 1LKYA 5KG7A 3LAMA 1JK9B 2YNHA 1GXLA 3T19A 3MN7A 2FBVA 3ZO7A 4KGVB 3EL2A 4BRHA 2Q0ZX 4BC7A 2G8KA 4EP4A 3U6FA 1WELA 1T8EA 4P73A 1AQ6A 1DTTA 1YJ7A 2AKWB 5CRXA 3C21A 2HBKA 3A4TA 4LY7A 4M45A 3D4JA 4OZNA 1N52B 4C8MA 3THVA 5DS7A 4PUOA 1Q82O 4TVAB 3JAMO 3OUYB 5RUBA 5HBMA 5ALMA 4FJHA 1SIWB 2CJKA 2LMIA 1QAXA 1GLBG 2X6SA 1SL0A 1U6ZA 3IS9B 4QZBA 4DOBA 5B09A 5ETPA 4Z6FA 2XM3A 2MKCA 3GQCA 2G08A 5HRRA 3T9NA 5CA7A 3C2LA 2W40A 3D3CJ 2CXYA 1TV6B 4ZHRB 4ZCIA 4LRAA 2YJFA 5ALGA 3BPDA 5HSPA 1H2VZ 4A48A 1ULRA 2I7NA 3H1VX 1U1MA 4Z4IA 4P74A 1EIYB 3K75D 4QYZK 3SD7A 4IJAA 1J5OB 3MEGA 3SLCA 5GAHP 4QIEA 1EB0A 4Y2SA 1PJ7A 3ZSXA 2FHKA 1H1VA 2UXBF 1WBDA 3TSPA 2VU5A 4CECA 1GLAG 5D4NA 1ZQQA 4G6VB 2O4IA 5KFZA 2AV5A 4A46A 4A4JA 1ZETA 3ENVA 4FXVA 2OSRA 5J1EB 2L08A 4BGBA 3PSTA 5HATA 2E1ZA 3KK2B 4EYHB 4K4HA 1R6YA 1QQNA 4DTJA 1OYEA 4P0QA 1HUZA 3PSPA 3DXKB 5FLXY 4Y0WA 4NYNA 4CERA 2E66A 1TFRA 2K89A 1Y11A 4M5JA 3O9SA 4BG9A 2HQFA 5L1IA 2PA8D 1EKRA 3H4BA 3JTOA 3MAQA 2R3VA 4K4IA 4BRKA 2ZKUA 1RSCA 1NNDA 5DETA 3VAIA 2FE9A 4C8YA 4ILRA 3WXJA 4N76A 3BH7B 1NCLA 2D3OR 1IBMF 3CCQS 1T3VA 2L48A 2CZ9A 2Z2MA 4M41A 5AXMA 1JLAA 3OVBA 5AK3A 2C42A 1SUQB 3DRPB 2I7PA 3CJ9A 4KLTA 1W2IA 3IO1A 2RDDA 2G0AA 4DV5K 3CO0P 3BV8A 1T9VA 2ASJA 1ZQYA 1QUVA 2FJAB 2B3TB 5DDPC 2ZH6A 4H0OA 3K5MA 3NE6A 4CK2A 2ZKTA 2RF2A 1ATNA 4B1WB 1N54B 7ICIA 2BOAA 3IN5A 1E6YA 2J7WA 1ZQLA 1SVDA 2DNZA 2E44A 3TVYA 3JAMY 7ICEA 1FJCA 1ZBIA 3JXOA 3GR0A 1DK3A 1FKPA 4LRCA 5D4PA 2X74A 4CBXA 3LDAA 4W5OA 1RLCL 3A12A 2J9DE 3V6JA 1J2NA 4NV0A 4IO8A 3Q8VA 4ZVQB 4RTFD 1ZBFA 9RUBA 5KT6A 4FZLA 1YBAA 2CZVC 2OKQA 4URSA 1H73A 3SJJA 1ZQDA 4IL6U 1ZQFA 3U3GA 5B8HA 3IDHA 3NH2A 2LKYA 3Q2TC 1WDTA 3TOQA 1NKCA 5HP4A 1ZQRA 2FDRA 4DI6A 1A6LA 2KMDA 4ENOA 3ISCA 3GYXB 3J80U 3AOCA 2Y8WA 1DGKN 3BQTA 2E8PA 2QI2A 3CD6S 3AGRA 2H5EA 2VWKA 5AI4A 1KN6A 3CXCR 3J7Z5 2KDOA 2YNGA 5LM7E 3CNQP 3UE2A 2DEIA 3CD5A 4RWWA 3OW2R 2OUGA 4ZVEA 4CRJA 2QKBA 2HF3A 4UATA 1OUQA 4C8KA 2MUTB 3KZXA 1HBOB 4NRTA 3CFRA 4O5CA 4ZPBA 2KJWA 4QR1A 3QGPA 4NLVA 5KT3A 2R7XA 4K42A 1DRGA 2MJNA 1KQGB 2BM0A 3C7NB 4BRGA 2Y3YA 2IJNA 3KDNA 3C16A 3OS1A 1HWIA 5IIKA 1BQMA 4DHYA 2GGPA 1D09B 1YZ7A 3AL0B 2ZH9A 4ZVSB 2AGQA 3NS7B 9ICWA 3GV5B 4YB7A 5A2QO 3WEEB 5H1SV 2ERRA 1CULA 3ILLA 4QIVA 2BQ3A 2UU9F 1PVQA 1Q8LA 3WHIA 1KLMA 3M2UA 1W0HA 4Y2KA 3SMVA 3DC2A 4ECSA 2VFRA 4CZGA 3LDQA 4TLRA 3UVJA 3V7JA 1JMTA 5HOOA 4JI0K 3QQCD 4ZVOB 3O5TB 2BCUA 2Z2LA 1N5TA 3QB0A 2JLEA 3B8HA 1BG3A 1XMQK 4JI5F 3M8QA 1RM6C 3W5YA 2UXBK 1DTQB 3W9JA 4NLSA 2F76X 2V4QA 3PNIA 5FRMA 3CD0A 1N32K 2A1BA 2VFSA 1FX2A 1SJ1A 3K5PA 4DV3J 1N88A 2KN4A 1SJFA 3OPKA 1RU2A 4NRUA 4W4MA 2KYZA 4B9LA 1SKUB 4LVNP 3IRWP 2WRMA 2ZWPA 3GFHA 2QMUB 4YOEA 1WD6A 3HTVA 3QZ8A 4DFJA 3KKFA 4CIGA 1VQPS 4OPAA 1AA1B 3FQKA 1Q81O 3O5BA 3BSAA 3HJVA 3G0ZA 1E4GT 3ZXWA 3HI0A 3UCZP 5KFIA 2UYTA 2YI1A 4KLQA 7FDRA 1NGIA 4JD2B 3O3LA 3LPYA 1VQ9N 2ESEA 4UW9A 3M9MB 4B9MA 3FC9A 1XJWB 3MGHA 1SBRA 2WSEC 3CCRS 2QLWA 3KLGA 4N56A 3MZIA 2KZZA 3OYJA 2ETJA 3L09A 2OI2A 3QSIA 3MM9A 2XBPA 4P0PB 1UFWA 2ZXHA 5HHHA 1VK3A 5MAOA 3B8AX 4OI1A 3TI0A 2AQ0A 2GH1A 3EJMA 1U25A 2MGZA 3MEEA 1P1LA 3C6TB 4FWRA 3MN6A 4A8MP 2E2PA 4ERDA 1IR1A 2BZ2A 1R8CA 4HH1A 8ICSA 1S9EA 3KDOA 5FJ4A 5KI6A 5AI6A 3MM8A 3KYLA 2E5LK 2JMGA 2OWOA 4FLWA 1ZH5A 3ZX3A 4JI6F 2E7WA 2W04A 2E5HA 3CJSA 1I6JA 3AQFA 3RJIA 3AO4A 3MN5A 1H3DA 4FZYA 3R9LA 4NLOA 3OVNA 2W8KA 5HJXA 1J2MA 1IBKJ 4JI8K 4P9SA 3DRSB 1S76D 2D74B 1REGX 2Y0SD 3R2DJ 1D8LA 3AO3A 1Z4NA 1WG4A 1F2HA 2ZIUB 2IS3A 2OP5A 5GMDA 2XMKA 4JV2A 1N5YB 1F6TA 1KQSR 4A8OA 1BC6A 1G2EA 1HKCA 5B0GA 5HNKA 4M42A 4PKDB 4MF2A 4JV0A 2Z56B 3A3NB 3NCRA 3IGVA 4L72B 5AR0A 4PHDA 1GLJO 4OIXA 4WP9A 2Z30B 3EVWA 2VONA 2FQQB 3B6OA 3DLLQ 4BR4A 4KH4A 4B3OA 4DS4A 2E3TA 4NEYA 1AZSB 2W3RA 2OZSA 1F5BA 1Q82T 2BVZA 1MROB 4CK1A 4DTRA 3RJKA 5CD4A 4V19X 1ZQSA 5J1NA 2BXJA 1ZQNA 3HP6A 1WJ9A 5HMZA 1NLKL 3ZT1A 2CPXA 4DR4J 4JI8F 3QT5A 4N8NA 4CT8A 1WC1A 2VD3A 1KEJA 2CNOB 3KG1A 4NCBA 2M0NA 3B0XA 4PEOA 4YY3J 4A62A 1OPIA 2R8JA 4DXLA 4RQ8A 5ADXA 2A3JA 4DR3K 1SV4A 3ILOA 3HOTA 1JMSA 2AJFE 4DU1A 2KXNB 3U26A 2Q3PA 1RBSA 3UCUP 4G1PA 1BY9A 5IT4A 3TPQA 3D28A 5AQTA 3QFWA 4NM1A 4Q2LA 3ZETA 2HCFA 4U7CA 3TA0A 4F4WA 2RLTA 4K41A 3PEHA 3PR4A 1RTHA 1S12A 3BDEA 3D6HB 1HBUB 3N0VA 1FD8A 4USTA 2OYQA 2ZJRL 2YJEA 3GFZA 2QM1A 3D2FA 3SSRA 5ALIA 2Y9UA 3MOJB 1HD1A 3GIRA 7ICMA 4FBTA 3W62A 5B66U 3IR6B 4CQ1A 2RILA 4J2BA 2IRYA 2QW9A 3V9SA 2VZ9A 5AI5A 4GKJK 4F5PA 3AVBA 2YB1A 1BU6O 3D2EB 3WQPA 5KAFU 4JUZA 4RQMA 5GIPA 2B9EA 2RS2A 1B3TA 4ATNA 1XN9A 3PSIA 5GADU 2OA8A 1D8YA 4BRLA 4IG0B 2X78A 4G3IA 4ZVRB 3I76A 1S1VB 3MGVA 4AQYK 4PXBA 4LF2A 2B5JA 7ICTA 4UZBA 1WOSA 4L3KA 1S57A 1M90O 5A8RA 2GMLA 1M90T 3E0FA 2ZIWA 4QZ8A 2PSZA 5D3GB 3UN5A 4I2JA 3N9UC 3IWXA 4B9TA 2V6AA 2BABA 5AXKA 4BC5A 3J7YP 4LIWA 1RWWB 4PWWA 3G82A 3ILIA 4I6YA 2HGMA 4OKKA 4IH7A 3F0NA 3L6QA 3O3HA 4JNEA 3WXKA 1JLEA 1YI2N 4KLFA 2YKMA 2V67A 2KG1A 1KVAA 4C9DA 5HANA 4UASA 3SJHA 1FRMA 4FVCA 2OTLN 3QO9A 4USUA 1LFPA 2CWXA 5HMLA 1RQ0A 1RDUA 1EQMA 2DK2A 4JI4K 5HL7Q 3M8YA 4FJIA 1NPRA 4L8RB 5ALNA 3PZPA 2FHMA 4BR5A 3VR1A 2ROEA 1K73O 1QQOA 4LREA 1GMUA 2XWYA 1L5UA 2VCPA 4PJ0U 3V6HA 2E5LF 2MU2A 3GCXP 2L5YA 1O5JA 1HHTP 4XO0A 1WUAA 2KKVA 4BBYA 4ICAA 2Y9HA 4CJ5A 5F9LA 4WKYA 3I1YA 2W2NP 3A3OB 4F2RA 2A1JA 5DGBA 4X66K 1MN8A 2JSXA 4ZVPB 3G86A 3F9KA 1X3MA 1JJ2M 3HSZA 4O3PA 1T05B 3FYHA 1AUDA 1S97A 2ASDA 5GINA 4CNZA 4LFBF 1XNQJ 1L6NA 3G8QA 2GV9A 2FJXA 4UAVA 1C0TB 5EN1A 2JZBB 3IRXA 4DTPA 4JK7A 1YG0A 3HSJA 4WFYA 2W42A 4TU9A 3IS9A 1TUVA 5A8KA 4F4ZA 1K9MO 7ICPA 1Q81T 3Q8PB 4MDAA 4NLXA 4R66A 4MKYA 1NXIA 2ZVSA 3KIOA 1VFJA 2VF3A 5U47A 3ONQA 1YDLA 4DV5F 4M9GA 3BKUA 4LSNB 5HROB 1UWBA 3GZ7A 1ATRA 2DNPA 4UB6U 1QM9A 2XHBA 1Q95G 2W4DA 2HHVA 3PEJA 3AJ2A 3TX0A 1Q86T 3SI6A 1JXLA 1IBMK 3OYLA 4BWJA 4RQ6A 4JKHA 4XQ8A 3MWBA 3PYEA 3TNVA 4CGIA 2BKPA 3I0SA 2PFNA 4AILC 3EYZA 9ICSA 1VQYA 4OPHA 5GMKa 1URRA 1XNRJ 3FZ2A 3DMJA 3CD7A 1RT6B 2CPIA 4HR2A 2VJ5A 4LF1A 4NEZA 5KAKA 1S0VA 4C11B 4F5OA 2M8DB 3N79A 1HPZA 4BR0A 2AMCB 1J53A 2R7RA 4DTOA 3QXGA 4KN4A 1DLOB 3IBWA 4OZLA 2ZD1B 2JEGA 4Y2RA 1EHWA 1QD1A 1X60A 1ICEB 4E7IA 2OZMA 4NMXA 5JICA 4TU7A 1RFQA 2EWHA 4R79A 2C1EB 4BRQA 4B9NA 6AT1B 2NSBA 3O9QA 3TWHA 4PUOB 4PG8A 3CCES 2F2AB 4RW8A 5KG0A 4EEKA 1VBKA 3AVCA 2CNKB 3FZMA 4OI3A 1HBNB 1P9YA 5HI7A 1RABB 3AO2A 1CZAN 1DURA 2G8VA 4KR0B 3NRZA 1WHXA 1JL2A 1Q78A 1XQSC 1WC0A 9ICAA 1OPZA 2CJ9A 4B3MK 4UAZA 5KFYA 4FYDA 1QE1A 3TFRA 4I2FA 1JLCB 2DY9A 1FW6A 4CEEA 4FJGA 2VODA 2AEFA 1WG8A 1KVCA 3HO1A 5IT9O 4JV5J 2OHDA 1N4LA 3TACB 4AQYF 2PFQA 1APSA 3M6KA 1ZPVA 4F93B 2OPQA 5AQKA 1UA0A 3V4IA 3CVKA 5D6GA 4J2AA 2RS8A 3MM6B 5HVGA 3BSOA 4DS5A 3HVTA 5SUHA 2MKIA 4NE9C 2GVDA 3GP9A 2FGOA 2DH9A 3CJ2A 4BRPA 2YXLA 4YUDA 2MGZB 2VKQA 1AUSL 4UUWA 4TN2A 1HNIA 2HHHF 2RRDA 1IBLF 1YUWA 4GRSA 4DTXA 4DR1J 4FSVA 4JI1J 4FO0A 4MKAA 2B51A 1ILYA 9ICMA 4QW9A 3JYTB 4M5DB 4HVJA 2P2CB 4YN4A 2DRBA 2D5RA 2J7KA 5AZJA 1CJUB 2ODGA 3VOVA 4J9KA 4DR7F 3B6PA 4W5NA 3ZTPA 4D3GA 3PMLA 1RBAA 3QINA 1NLVA 4ZVHA 5KGXA 1FDBA 3ZEUA 1U1PA 5D0HA 1ESVA 4BCAA 3MUTP 2YY3A 2H3ZA 5DB7A 1COKA 3FR0A 2YKNB 1IBLK 2EFOA 3MCNA 3GFYA 1A5WA 5K14A 1FVSA 3DEEA 4M6WA 3CIMA 3O2IA 4NLPA 3GIJA 2XO6A 2EHGA 2GX8A 4JI2F 2WHOA 2ASOA 2E7XA 3SUQA 2GX9A 4NLWA 3O3GA 2WBMA 2DGUA 1K44A 1KLNA 1HKGA 1WCNA 2ITMA 3IM8A 4KI4A 3MMVA 3LWMA 1DTQA 5J2GA 3EDRB 4KTQA 3KMQA 1Z1VA 1YJ9S 1F0XA 5DB6A 1SC1B 1FJGJ 2HQ3A 3HZ6A 4LH5A 3UXNA 3UKUB 3H98A 4I69A 3O4NA 3OFFA 3K89A 3EX7B 1UFKA 4MFBA 1IJJA 1S1TA 4ANDA 1HI1A 3KJVA 2MLZA 2PFOA 4XEIA 2DR5A 1SC4B 4DPWA 3PW2A 2F5GA 1S49A 4YN3B 4A8YA 3WEEA 1TKZB 4NY8A 2HFZA 3U3YA 4X2BA 2ABYA 5ALSA 2RQCA 3DYAA 3CXCM 1C1CA 4FVMA 1T03A 4CJKA 4C0BA 4FFDA 4LRDA 4IKAA 4UB8U 2E2OA 2A6AA 2FPHX 5IWAF 4YHHJ 3I55S 4DQRA 1TL1B 1KAYA 4WTOB 1ED1A 2F9WA 3NGDA 1JX4A 3UD5A 1RQLA 3FMBA 1UVNA 4NCGA 3EY1A 1S9GA 2CYYA 3M6ZA 2JNJA 1SPBP 1GXUA 2GBZA 2B6AA 1X4GA 1K8KA 4ILGB 2WAQC 3W9HA 3IXQA 2EBEA 1QJHA 1UJ6A 2AYEA 3CT9A 3ASMA 5AKZA 4LBPA 2AWZA 4JKBA 1FDAA 4Y2PA 5A2QU 1U0HB 4P2SA 1FFWB 4H0VB 3MCOA 3N6MA 4Y1CA 2ISPA 3G10A 3M6VA 2UUWA 4C8NA 2M9NA 3BR8A 4DG1A 2K06A 5ALXA 3CC2N 2N4CA 3WUHA 4O3QA 4DO9A 2KU7A 1H98A 3VF0B 5C12A 2A3VA 1D8BA 3SQOP 3W63A 2ZE2A 1N5VA 1R8HA 3OYFA 4MFCA 1IR2A 3HOSA 2JL9A 3L4BC 5IWAK 1FRJA 2YMLA 3V5RA 2RU3A 4CYUB 4EX6A 1BWEA 1F9HA 1EZZB 2V4JA 1REVB 2OYYA 4C80A 1M1GA 1VQ5S 3R6MA 5KFTA 3C2KA 3TSUA 3O80A 2FLLA 4PPXA 4DL2A 3DCAA 4QZCA 2W9MA 3MDQA 2CVEA 3CQ8A 5B5EU 1GXTA 2HAIA 4CF3A 4OJ1A 1HYSB 5D8HB 2FSJA 2HMIB 2QARB 4GV6A 1LOTB 3UD4P 2IHR1 2UUTA 5ALLA 1D3WA 3G87A 1N5XA 3MMAB 3CB4A 4FWLA 2CQCA 3O0FA 1O8BA 4I2AA 3MDCA 1S6PB 3NS5A 4I27A 2AEJA 2V8PA 1FKPB 5AKJA 2YV0X 1RISA 4K0KF 4LC9B 3KUGA 2EDUA 4CGZA 3H5XA 2LM4A 4Y28C 3MM7B 5J2NB 5DKWA 2LDIA 1WOOA 4HT5A 4KFBA 4QIWC 1LWXA 4USVA 2YH0A 3EZ5A 2MQQA 3A0BU 2P9LA 3CCLN 2B4UA 3DU6A 4K4GA 4C48A 3TR5A 3ZZPA 2XGPA 2MTLA 5T41A 3T1AA 3W2WB 3DDHA 1LWCA 5J2PA 2D0OA 3D45A 3CCUS 5KFJA 5GADP 1W2BM 3VQPA 3NCPA 3VA3A 1YQHA 4RO0A 4RPFA 4NZ0A 2OXOA 1N2XA 2HBRB 4KV8A 1HYZA 1HYVA 4W5QA 4AXIA 3HM9A 5DLGA 3V9WA 4Y2QA 2LLZA 3FBFA 4PG7A 3MX5A 4DLEA 2EANA 1Y88A 5I42A 4OV6A 1N56A 4CLWA 4B1ZA 4XK8C 4XPEA 3QLHB 3NEKA 1KFSA 2P9UB 2I1RA 3C6UA 2QT7A 2O8FA 3KOOA 3ZX2A 1A76A 4CJQA 2HFOA 2HQCA 3M32B 5JLHA 4RWTA 2AD9A 2RIJA 2VUGA 4DL3A 2ZJ5A 3MFHA 2CPDA 3KUEA 4MFFA 2JRSA 5AI8A 3ETOA 1Q7YO 1WG5A 7ICHA 5EX3A 2CDQA 4ZPCA 4BY9C 3DRSA 2CQHA 2ALYB 1B7YB 1TU0B 4DF8A 3THPA 3B82A 3W8PA 1WOPA 5AT1B 4B3TF 4NLDA 2ADBA 2FB0A 3ISBA 4TUPA 1QTNB 5J2QB 2PFPA 1PSDA 4C8ZA 3O1LA 1VSDA 4RW6B 4FZMA 1NGAA 3WXLA 3SBGA 3I9ZA 1CSJA 2YPYA 4QIGA 4OJOA 5LL6Z 2CKWA 4O3MA 2JWKA 3LDLA 3ZT4A 1QAYA 2KB2A 4DR2F 2YMQA 5LMUK 2R7OA 5AQOA 2LYBA 3OV7A 1KQQA 5CWRA 5BXIA 1JL1A 2OD4A 2EBGA 3QRPA 1M5HA 5EVZA 2LYAA 1P27B 2RH3A 3M2RB 2ZH7A 8ICIA 5K4LA 5F3TA 3DYAB 4K4YA 1CLQA 3AM9A 4CZHA 1HI0P 4DMNA 2E2NA 1ZQBA 1VS3A 3IA0A 4WTYA 1ASUA 2ZUBA 3BBFA 1BPEA 2YX8A 9ICCA 2ZBCA 3I96A 1RHKB 4PL8A 4H0YB 1S5ZA 4QJVA 4MIBA 4USHA 2MZTA 4EGLA 1BI4B 2XCPA 3EXYA 3VERA 3M6XA 3KHYA 3V72A 4FF2A 1S7HA 3DAWA 4USWA 4F4KA 1C0UB 5IM0A 1GLLO 2IA6A 5T7BA 4CFCA 3M6UA 2YNFA 2R4FA 3F41A 1JB0C 4LZDA 2LXFA 3BZQA 3CC2S 3CRXA 3KZBA 4ZDNA 1U8WA 2AX0A 4A5BA 3O9TA 3KHRA 1IQTA 4FJ9A 2HIYA 4YR2A 4DR2K 2OAUA 2IAJB 4BR9A 3JS9A 1HA1A 1B4FA 2MSTA 2RKIB 3TZZA 4FPRA 1MU2A 1T0TV 4B8AB 3RMAA 5GMEA 3NS6A 3C94A 2VQEK 3CC7N 1FRLA 4DUTA 3UMBA 2BGWA 1OQ6A 4RQ4A 3SCIE 4AHVA 4IOAL 1TE2A 3DDNA 2ZJQQ 4B3MF 1TR0A 4BLGA 3E58A 4JRQA 2HQGA 1RWOB 2XWXA 4WYWA 1RWKB 2HMPA 4ITSA 4I2HA 2P5VA 1X0FA 3QU4A 2G2OA 1UVLA 4QWAA 3QBCA 4YMEA 1C1AA 2MQ8A 4RUCA 1XERA 1N8RO 3CCVS 2GHVC 3QFUA 4E2FB 5L1KA 2KN7A 5IS2A 3EDQB 2LQ8A 2G5IB 4O3RA 3H42A 2WVDA 2Q6BA 1FFGB 2F63A 2OTLS 5GADI 2QB0A 2AJ0A 4LF8J 3NHGA 4J37A 4BG8A 4QS9A 3F9MA 1LK5A 3GJRB 4O4RA 3VQ7A 5MLCV 3TQ1A 3FC4A 5KTQA 3MMBA 4ZP9A 3HL8A 3KLVA 2ZIXB 5A6WA 3DI6B 1RT4A 3Q8YA 3OYMA 3IMXA 5AFUH 4A5AA 4XH5A 3T5JA 3UKRB 2F9TA 5AQZA 3TJ8A 3UQ0A 2IOHA 5ALWA 2BDPA 1BIUA 2KXHA 2ZOMA 3CNHA 4KPCA 2ATQA 5J0TA 4BS2A 4LZGA 4ZVUB 2RJZA 1KEKA 3W7BA 3VEOA 5LT5A 3D5MA 2IBOA 3L2UA 4NA2A 2QIFA 4F0KA 1YT3A 1NMDA 2MUTA 4JMUA 3IR7B 1X4DA 1SV5B 1HD0A 1U2VA 4DR3J 4RQ7A 1RA7A 4OJHA 3MD3A 1BHNA 4LRBA 2JXJA 2MSSA 4ES2A 2DFHA 4WFZA 1RKIA 3IFRA 1EAYC 2GJ2A 5BYQA 3ZDBA 1VJWA 1EETB 3QEIA 3VEXA 2F40A 1IBCB 5E3CA 4J9UE 4I6MA 4UOGA 2F8KA 4DTNA 1X8DA 1X4AA 3QJPA 2UZAA 4OHZA 3UXOA 4LVOP 2BA9A 4WBFA 1VSHA 3M2RA 4C0HA 3CJ1A 3MURP 2E5SA 3QZ7A 1IIPA 1LW0A 1X0PA 2R7QA 3CCJN 4J8FA 2NLXA 2YHWA 1W25A 2QA4G 4MH8A 3M7VA 1X5OA 1KSPA 4ETXA 1SJ3P 5CHGA 2DGTA 1Q53A 2Q1LA 3X1LB 3W3DA 4RBVA 3D2SA 1YKWA 5CR4A 2F3NA 3T79A 1Y9OA 3ISDA 5EDWA 2CQDA 4NXMF 4EBEA 2XCAA 4LFBJ 4OFZA 2OGUA 4WFXA 3AN1A 5DZ7A 4C4TA 2OD6A 1SIZA 3KMSA 7ICUA 5GAEP 2Z57B 3QT8A 1FCAA 4NL9A 4ER8A 3BSCA 2O6KA 4ZCKA 3BKTA 3H7HB 3UVJB 1JNZB 4DSIA 2GZOA 1YGYA 5D77A 1JN3A 3QBWA 4P7TA 2ASYA 1ZQOA 2PAVA 2L9WA 1LAWA 2IVNA 2H4YB 4JLHA 1ZYQA 4LSLA 2G0IA 3EW9A 4R65A 2IAJA 3W2VA 2OTJS 4GMJB 2V94A 3D66A 2E5LJ 3C95A 5GAGI 5GIOA 4UOCA 8ICZA 1SIJA 2Z0GA 3G96A 1RT7A 3PV8A 2RUGA 5JVHL 3DOLA 1NU0A 4FOEA 3DLGB 3CJKA 1FK9A 5DM6L 4OPJA 2Q6CA 4BXOB 4J03A 1NZBA 5IXUA 4DN0A 4GC7A 3OTCA 1OO0B 1Y10A 1T02A 5J2BA 4CLKA 4F5QA 1Q9XA 4KHQA 4CNQA 3VAJA 2DNQA 3L3VA 3AQEA 4E0DA 4P6QA 2Y1JA 2B0GA 1NH7A 4URGA 1YJWS 1BWVA 1VDHA 2ZJPL 1S5LU 4KN7A 3BQ1A 2DHSA 3KG4A 3AO5A 1JLAB 4IOXA 2JC0A 3L7PA 4KH6A 2BCQA 4RNHA 3AHPA 4WCEL 4Q44A 2L3MA 4OI4A 1AT1B 4DUZK 3SEOA 3WK4A 1SZHA 4FKXA 3G71S 4DCJB 4BRAA 4ELVA 1NBWA 2HNYB 1HRHA 4MTPA 3DLJA 5LOQA 3POTA 1GOCA 3UNGC 2P6RA 5ALOA 5KFGA 3F2CA 2Y1LB 2R42A 4DFDA 2ZTDA 3PRBA 2BYCA 1D8ZA 4NMLA 3CWJA 1FRXA 5AQMA 1A9NB 3LP2A 4LF7J 1FTCA 4YR3A 4PGXA 2Z4PA 5JU5A 4CJVA 2CIMA 1VIOA 3G6XA 2C3PA 2MB0B 2BKEA 3NF9A 3BF4A 5G0RA 2VFTA 1N48A 3RJJA 1ZD4A 1FRIA 2CNNB 5LY3A 1HWJA 3DV9A 5J2EA 4KHPK 2HKEA 2O66A 4CW7B 4PY5A 1ZQVA 4WU3A 4DLGA 2K4HA 1CJTB 2I8EA 2GO7A 1U48A 3TABA 4ECZA 1S9GB 1WNSA 3C2PA 4CM2A 1ZOLA 4ED5A 2SXLA 1IBMJ 1KXPA 3OUYA 2IBKA 2NQPA 1Q7LB 3H8MA 2HIQA 3VHQA 4EMDA 2FD2A 4PRFA 5T14A 1YZ6A 3R5BA 2E8AA 4NXZA 2WF8A 7ICNA 3Q0AA 1KKHA 4M3XA 3PYDA 4HDGA 3U7JA 1HBMA 2HB5A 1N8RT 2WBNA 3WNGA 1TK5A 4R5PB 1Y0HA 4ID8A 5H9EK 4RZRA 2F8HA 3MD1A 2GW8A 4OHVA 1VQ5N 9ICVA 4AL7A 4AM6A 4RQ0A 5AM1A 3H3NO 2BANA 5HVFA 3OR1B 2MZ1A 3HULA 2FVQA 2ZZMA 1HQEA 3R9PA 5AQRA 1HWKA 2VPWB 4KLUA 4C1NI 3HT3A 4P0QB 2QA4N 3L7OA 2WVBA 2RMLA 5IOLA 2MXYA 2BBEA 1NJIT 2LU1A 3NOGA 5L38A 1FXRA 1RWXB 1WSEA 5D15A 1KC8O 1JJHA 2EAPA 2YNIA 3D1OA 4W5TA 2GQQA 5D49A 5LMNF 2AP6A 3NMAA 3TTFA 2QZ8A 3Q8UA 4B17A 3VEYA 2MRLA 2KSOB 2YKOA 3HHDA 2MMYA 3FJ2A 2OANA 5F0XA 3CC4N 4NM2A 4EHTA 2DIVA 3T5LA 5DK5A 2A10A 4MFBB 4ZHRA 4Z7YA 4KHNA 4P2XA 3OQ2A 4RU2A 2E9ZA 4M5IA 4ED3A 3SSQA 4C3LA 4P4MA 1N36K 1VBXA 3CCWA 2VASA 2IC3B 3OFEA 2LHTA 2K2PA 8ICPA 3DGVA 5KG5A 2W01A 1GMWD 3IKMA 3FGUA 1U1RA 1NNLA 1YBUA 2VDIA 2BJEA 2DGSA 2BMBA 4X4SA 5KL1B 1KL9A 3NMUA 1KAZA 5BPMA 5J0RA 3PSFA 2V69A 5EOZA 4ES1A 4F3QA 2HMXA 1TVRA 2IVOA 5LMUF 4LF4F 1Y5LB 3SUPA 3DLBA 4U8YA 1SI9A 2PMZF 3P31A 1DFDA 2QLBB 3IGNA 3EWAA 3NGYA 1XR5A 3VAKA 3WX8A 2IRXA 1JLFB 2HLTA 4X4UA 3NGTA 2HVEA 5HP1A 5ELZA 1BHLA 5JVHQ 1GK8A 3K58A 5CYQB 3MEDB 2EK1A 1XO1A 4OKEA 2DY1A 4YDXA 3TWZA 1ELOA 5FP0A 2CPJA 4OJ6A 2F9DA 7ICFA 1X42A 1YK9A 4GKKJ 3WNEA 1MG7A 1X4BA 7AT1B 4OYOA 4BE0A 1LCUA 4WF9L 3UB5A 2E1EA 1RILA 4O5KA 1XK8A 4KPYA 3I82A 3H1QA 3L2QA 1TL7B 2HRTA 4OLAA 4UAYA 3E9OA 3NWRA 5DBCA 4C8LA 2KG5A 4UY8T 3O08A 3J7ZT 3U1MA 4LFAF 4NLCA 4LVSA 3RW7A 2F7VA 2PT0A 3VPZA 2NXUA 1WSJA 5KFAA 4PWUA 3C6TA 3NTUA 5H2FU 1YXQA 3AVNA 3MTJA 1XTZA 3VQ8A 3CO9A 2LVWA 1HBNA 4I2BA 2PFDA 1EKEA 4FW2A 2J0WA 3ET6B 4FF1A 2CQ1A 4KITB 3HHLD 4IQMA 5T7LA 2W03A 4CLFA 1HNIB 2VG6B