4BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*AP*TP*CP*AP*TP*GP*CP*AP*A)-3')
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdpA01
3KKRA 1S6QA 3UXPA 4CGJA 1WSFA 4PQUA 2PZSA 4I2PA 3K5NA 4CK1A 2UVUA 3NTUA 3O3GA 1ZBHA 2LSNA 1EKEA 4CHQA 5DGAA 4QCLA 3RB0A 4CJLA 1WSHA 3DLKA 4DTJA 4O5KA 5DBAA 4NY8A 2I9GA 3S3MA 4QZCA 1KLNA 4G3IA 5KG4A 2BQUA 2G8FA 3MGHA 1NK9A 2I5JA 3UXNA 1S9FA 5KFQA 2YHBA 3V6HA 2P6UA 4I2BA 8ICXA 3OY9A 2KTQA 2A1RA 1JLGA 3LZJA 1Z3EB 2O4IA 5J2IA 3RH4A 3MXMA 4F5RA 4ECYA 1JX4A 5J2NA 4YMOA 2P66A 1DTTA 3NGZA 3VQ7A 1ZQTA 4RQ4A 1XC9A 4DSJA 2ASLA 4TURA 3RRHA 3LALA 4AILC 4F50A 1HUOA 5CP2A 4O55A 4JRQA 4BE2A 1BIUA 3GV5B 3Q8LA 4EBEA 4RNNA 2W9BA 1Y97A 3CG7A 3ULDA 4AHUA 4J9QA 1RT7A 7ICUA 3ISNC 1ZBFA 2X6SA 3OYHA 3CM5A 1B43A 4Z6EA 4YR0A 2WOMA 3HK2A 3G6VA 3GDXA 3VN5A 4GC6A 4CF1A 1TV6A 1GOBA 4M6WA 2PYLA 3VA3A 3DLBA 3MR6A 5KFUA 2ATLA 1ZQUA 3RJFA 4F92B 5J0YA 3GIIA 3RB4A 2BCUA 2IMWP 4CCHA 3HW8A 4PGQA 4ECXA 4Z4FA 1UT8A 5KFEA 2IHMA 3DRSA 4F4WA 3SUPA 1S77D 1TK0A 4MFCA 3GQCA 3ZSQA 2VG7A 3MABA 4MEXA 5DMRA 2AGOA 1X9MA 3OYKA 3B6PA 5DLGA 4DFKA 3BDPA 1UOCA 4XRHA 5KFPA 2G8IA 5EOZA 2M9NA 5KFSA 4CHYA 1MQ3A 3VQ9A 3TAMA 2X74A 3MEEA 4CIFA 2FPKA 4RQ5A 5KG3A 1JLEA 4FK4A 4JV1A 3PO4A 2HHUA 4M9JA 4N47A 4QZHA 3AUOA 4L8RB 4J9OA 4RW9A 1REVA 3Q8MA 1W9HA 3KLFA 8ICTA 4RPXA 2PXIA 4IQWA 3HT3A 9ICCA 5DGBA 3K5MA 1BISA 2YKNA 1VSKA 4KLQA 4CJWA 1BCMA 4P4PA 4NCAA 5KRTA 7ICVA 1QQCA 4I29A 3UQ0A 4CGIA 5K14A 8ICCA 2Z1GA 1QSSA 7ICEA 3TAFA 3UXOA 5DB6A 4YNQA 5KFIA 9ICVA 3TAPA 2W42A 4J9PA 4TQSA 3DLGA 4CGFA 4YXJA 3C5GA 8ICSA 4DL5A 1JKHA 3C2LA 1TL3A 5J2GA 4CGHA 4M2YA 4K8XA 4OGEA 1RXWA 1J54A 1WCNA 1G15A 4CJRA 5DG8A 3QEBZ 1SL1A 4Y1CA 4QZEA 1LAVA 4H8KA 3K75D 1SUQA 3OYFA 1T7PA 3KLEA 4AHCA 5L1KA 4Q43A 3OVNA 3H8JA 4GC7A 2G8WA 4CEAA 4HCBA 3PY8A 2D0CA 4DQPA 1UAXA 1CXQA 9ICTA 4BACA 3SQ2A 5KFAA 3JPQA 3VQPA 1BPEA 2HMIA 3CFPA 2VG5A 3S3OA 4FO6A 3ZDDA 5SZTA 8ICLA 4B3OA 1WN7A 1RTIA 1S0VA 5J2HA 3H4DA 2X78A 1C0UA 4CEEA 4OJRA 2DPJA 1Z00A 3BQ2A 3OS0A 1CXUA 1MSWD 1HYVA 9ICLA 2W8KA 4FJIA 8ICVA 5KFZA 2E4LA 4QWAA 3ISBA 2W9BB 2IHNA 4Z4EA 3EYZA 4RW7A 4UAWA 4IRCA 2C28A 3RJGA 3B6OA 3U3GA 5KFRA 1RT5A 2O4GA 1TFRA 4CECA 1FXXA 3V6KA 5HHIA 1NKBA 4RW4A 5DB7A 4O4GA 2QK9A 3GV7B 4CESA 4JWNA 1MU2A 1L3SA 1H38A 4CHPA 4BE0A 3RMBA 5KFTA 7ICPA 4ED1A 1IKXA 3QZ7A 2KZMA 3PW2A 4CHOA 4F93B 4RQ3A 1NJZA 1UWBA 5KTQA 1XI1A 3GIJA 4DSLA 5J2DA 3VQQA 4FJMA 2R8GA 5IINA 3JPTA 4DO9A 4B8CA 3C95A 4QZAA 1ZQDA 1IM4A 4GXKA 4Z6CA 5KFVA 4O9MA 1S1TA 3ZD8A 3KHRA 4W5OA 5SWMA 3P1GA 8ICYA 1WSGA 2DY4A 5KT3A 3VQ4A 5DQHA 1ZQGA 5DG7A 3M8RA 4DL7A 2KQ2A 1DGSA 4I2QA 4FLWA 1HQUA 1A76A 4DMNA 3P5JA 5DBCA 4KLEA 4WE1A 2Q0ZX 4KI6A 5D49A 1T05A 1BHLA 4FBUA 5DKWA 1KCFA 2G8KA 4Z4GA 3JPSA 1KLMA 1RDAA 4R8UB 5CR0A 2BHNA 3H4BA 4GVMA 4DL3A 1QLNA 4I2AA 1ZQCA 1S97A 4N76A 2R8IA 3Q8SB 2F1HA 3AU6A 1FKOA 3PMNA 3OYBA 4DU1A 3MXIA 2XCPA 1NKEA 3RJIA 3TAQA 3I0SA 3LDAA 1XS9D 1TL1A 3ZDEA 7ICFA 1UT5A 4FLZA 2JZBB 2VA8A 1WLJA 2ITGA 3BQTA 1NK6A 7ICJA 4ECRA 4E7HA 2D0AA 3ZSVA 2NRXA 3Q8PB 4MFAA 2BPGA 1JLQA 1NOYA 2B6AA 4EEYA 4CEOA 1KVCA 4YVZA 3EY1A 2OZSA 1JXEA 3OYDA 3QE9Y 5L1LA 3QINA 1RT6A 1NJXA 1ZQPA 4IG0A 4DL6A 3NGYA 5CZ1A 3K4GA 4YCXA 3OGUA 1RILA 3ZDBA 8ICPA 5CYMA 2X6NA 4DG1A 2PFNA 4CFCA 3SQ4A 5CY4A 4CERA 2GUIA 3V7LA 4M47A 4FJKA 4KLSA 3OYEA 4DWIA 1C6VA 1U04A 4ECUA 3OYGA 7ICRA 1VK0A 7ICSA 3HM9A 3VQ8A 1TV9A 2XHBA 3OS2A 4KB1A 4O5BA 3KJVA 9ICKA 2GV9A 4CJQA 3IRXA 1SKSA 1RT3A 1HYSA 1KTQA 4R66A 1I39A 4FJ5A 3KHHA 4M41A 3QERA 1Z00B 4M3UA 4E7IA 2ASDA 4C8KA 3NDKA 1BQMA 2PI4A 5KT2A 3ZSXA 4PWDA 5IILA 5CWRA 3RWUA 2W9AA 5KG7A 4ECTA 1HYZA 4DTMA 4PPXA 4F5NA 1KEJA 1ZQZA 1ZQOA 3KTQA 4P4OA 4RZRA 4ZHRA 4CHZA 3SCXA 5J1EA 5HRPA 4CJKA 1TGOA 5KFGA 3RH6A 1S0OA 2C2EA 3CQ8A 3AO4A 2BDPA 1RT1A 2J6TA 4KHUA 1O1WA 2ZUBA 4Z4CA 3EZ5A 3WNHA 5HROA 5D4BA 5DLFA 3KLHA 1KFSA 5L1JA 3KD1E 4CEBA 3OJSA 4I28A 2XY8A 4FJJA 4DLEA 2HVHA 8ICIA 3LZIA 3LK9A 1YTUA 1UA1A 3DOKA 5KGWA 3GV8B 3ZSOA 4YP3A 3DOLA 4RNOA 4DEZA 7ICOA 4M9LA 3RR8A 5F9LA 3TAEA 4UB1A 2FLNA 3RRGA 3NH1A 4JUZA 4EYIB 2H5XA 4I2CA 4J9RA 3V9UA 4KLDA 3SPYA 4YFUA 2EX3A 5TZVA 5J2AA 4CF0A 1Y88A 3IHQB 3T1AA 3BQ1A 3C2KA 3CYMA 4B9SA 4I2FA 1NJWA 5BOMA 3VQCA 4RU9A 3H40A 3DLEA 4CFBA 4ECQA 4FLXA 1TVRA 4FYDA 1QSYA 3SZ2A 1KRPA 3SUNA 3NF8A 3OSPA 3HP9A 1TKTA 2XY7A 3NBPA 2NRTA 4NLNA 1TAUA 4M9GA 2HNYA 3AA5X 1WSJA 4DFMA 4JS4A 5HP1A 4Q5VA 4CF9A 2ETJA 4KB0A 3SI8A 2C22A 4LSLA 5KFNA 3V72A 3MR3A 1ZQNA 3HVRA 1BCOA 3LPTA 4OLBA 1K1QA 1IKYA 1BQNA 3MFIA 1Z26A 3GIKA 4KTWA 4OLAA 1N5YA 3QEWA 2OWOA 5KFXA 2FMPA 4RUAA 3MEDA 4NCBA 3V9XA 2Z1HA 5DK5A 4ID1A 2AQ0A 4GW6A 1XSLA 3HP6A 3RMAA 3ITHA 2AGPA 5IIJA 3AVLA 5J0RA 4DF8A 3L8BA 4MFBA 4FZXC 4KRFA 1TKXA 3SJJA 5DDMA 4KLUA 3LP0A 5FRNA 1XSNA 4PHPA 5KFDA 4IG3A 3SQ0A 4M3XA 3HPOA 4I2HA 2MUTB 4E7KA 1A5VA 2OZMA 1ASUA 4J9KA 5JS1A 2P5OA 1WAJA 4AHRA 3IAYA 4IQVA 3PVXA 4CF8A 3V81A 4Z0UA 5BOLA 2IOCA 4B9MA 3AA4A 1RTJA 1DOQA 3EPIA 2C2DA 1ASWA 3T19A 3VQDA 4OPJA 4RUCA 3ZT3A 3PW5A 1V9PA 2EHGA 3SUQA 4TUPA 4KTQA 1LW0A 4NLZA 3LAMA 4GXJA 4E7LA 3HJFA 2NRZA 1RDCA 1JLCA 4QAGA 4JWMA 3OYAA 4KPYA 2B4JA 2NUBA 4UBBA 1U48A 5HBMA 3CFRA 3RH5A 3RTVA 3QEPA 3ZT2A 4LVSA 4K8ZA 1ZQIA 4RQ6A 3C6TA 5C42A 2PY5A 1S0MA 2A1JB 3L2UA 9ICAA 1D8LA 3BJYA 1NKCA 3U3YA 3ZT1A 3G10A 2VWJA 2E6LA 8ICHA 3I0RA 3RAXA 1GOAA 3N97B 1HQEA 4CEFA 4FLYA 2QKKA 2UVWA 1YT3A 4R8UA 3SUOA 3UQ2A 1JL1A 4KHNA 4E89A 4QW8A 3PX4A 1D8YA 3JPOA 4ID5A 4MF2A 3DRRA 4KTZA 4KREA 2R8KA 4O3SA 5I42A 4DL2A 2DFLA 4CF2A 3SQ1A 2BANA 1NJYA 4CIEA 4IDKA 1FKPA 3CFOA 2HHSA 1LWFA 1L5UA 2JZBA 9ICJA 4E0DA 4HCCA 1VSLA 2NRWA 1JLBA 3HWTA 1NK0A 3K5OA 5J0OA 8ICBA 1C7YA 1LB2B 1VSJA 2YNFA 4B9TA 2OYQA 2XGQA 4M3TA 2BKEA 1L3TA 3PNCA 4QOZB 5KFLA 3OHBA 1YTAA 5FDLA 4FJHA 3QETA 9ICMA 5J2MA 3AVNA 4W5TA 1RDBA 4KLOA 4J2BA 4CJ4A 4CJ3A 4CIGA 4RQ7A 3VA0A 1C0MA 5KG1A 2FPMA 4IKFA 4Q0BA 2AQ4A 1ZQHA 3U6FA 3PV8A 3HPHA 5T7BA 3G0ZA 1RXVA 5L1IA 1W0HA 4NYNA 4AH9A 4C8OA 2ISPA 3MDAA 1RYRA 1YVUA 4FJ9A 2AJQA 4YR2A 3DMJA 4I2DA 3HXMA 4RT3A 5KT5A 4XIUA 3V6DA 4O3RA 4KHSA 1TKZA 3SV3A 3KK2A 1N56A 3SNNA 4CJFA 3QEIA 2DFFA 2WTFA 1S10A 3NF6A 3ASMA 4ECZA 2XGPA 2LYHA 2GWSA 1T8EA 3TANA 5J2JA 3NHGA 4I27A 4E7JA 4PHDA 1WAFA 4IQTA 4F8RA 1S5JA 3ZCMA 4RT2A 2HHWA 3V1OA 5J0QA 2FMQA 4W5QA 3IS9A 3V9WA 3V1RA 4K4GA 3LDSA 3K58A 4YQWA 4UB2A 3M9NB 1WCLA 3LANA 4EBCA 1IKWA 4ED7A 5F9NA 3SPZA 1BPXA 1PZNA 1JLFA 2YNHA 1COOA 1LWEA 5CYQA 4E3SA 4IRDA 1S1UA 2BE2A 2YKMA 3WNEA 4ELTA 1J5OA 3KHGA 1AROP 2JEIA 1LW2A 3ZDCA 1L3VA 5J0PA 4UAYA 1ZQWA 3THVA 3LP3A 3MBYA 2VANA 1ZETA 4CFAA 4KLMA 4EYHB 5J2PA 2FBVA 2V9WA 4KKOA 4CK2A 2IA6A 2FPLA 4FVMA 1U9LA 4FS2A 4FLUA 1ZQAA 2VA2A 4O5CA 4B9UA 3V7KA 5KFMA 1BI4B 3LWLA 5KG5A 3V4IA 5J2EA 4Y1DA 2XO7A 3LP2A 3QEXA 2ZTCA 2HHTA 5KFOA 7ICMA 4RW8A 2KZ3A 8ICKA 4YD2A 1S0NA 4P2HA 2KN7A 5J0UA 4DQSA 1LV5A 4RW6A 1XHZA 1B9DA 4FM2A 3C5FA 5KT4A 2ZTEA 4B9LA 3OJUA 4GLXA 3T5JA 2OPRA 8ICJA 4QZBA 3PW4A 4LSNA 4YD1A 4KI4A 1VRUA 3DM2A 1KFDA 8ICEA 2KZZA 2XY6A 4DTOA 3TABA 1JN3A 4HYKA 3ETLA 4J9NA 1ZQSA 3EWAA 3V9SA 3S9HA 4QZFA 4RQ0A 2R8HA 3ZDAA 2IAJA 3HPGA 4BXOB 1L3UA 2VWKA 1ZQYA 2ALZA 4IQUA 1T3NA 4B8AB 5JUMA 2R8JA 1S6PA 3RAQA 3E01A 5JS2A 1KVBA 2ZJ8A 4DSEA 4ECWA 4JLHA 2ZJAA 4PHEA 3AA3A 3VQEA 2ZQBA 4EZ6A 1IG9A 3RJHA 7ICTA 9ICUA 3MAQA 4UAZA 5KT7A 2BCQA 4HHTA 5DQIA 4AHTA 2V4QA 1R0AA 1WSEA 4DOCA 1HPZA 3AA2A 3QEAZ 4KLTA 4XUSA 4QZ9A 2AGQA 2BCSA 1NOZA 3TR8A 4CFDA 2F96A 1S9EA 5C25A 1X9WA 5J0SA 1RTHA 3AO1A 4HUEA 3Q8RB 3JPRA 4C8LA 5IIKA 4CHNA 3NGIA 5D46A 1JIHA 1TKDA 1XU4A 5J2QA 3ZSZA 3RBEA 4DS5A 1VSMA 4CJ5A 2MUTA 3V6JA 1EP4A 3ZT0A 5J2BA 1BPBA 4OKEA 4JK1A 3RMDA 3MR2A 1RBVA 2VA3A 4OPKA 3UIQA 4LZDA 1Z25A 1NK7A 4M9NA 4BGDA 3AVBA 3QEVA 1SKRA 4NLGA 1VSHA 9ICWA 2QKBA 3L3VA 3MGIA 3TFRA 4N56A 2ZD1A 1UA0A 4DTNA 1RT2A 5KG2A 3TAGA 3NAEA 4IBNA 1WNSA 2PFOA 2HNDA 5J2KA 1S1WA 5C24A 1S1XA 5CB1A 2I1QA 4KLLA 1CEZA 4I2IA 2A1JA 1SV5A 4O44A 1T4GA 1SL2A 4TUQA 3CM6A 1A5XA 2IGIA 4LD0A 4M3ZA 5E41A 3RR7A 4IRKA 3RB3A 4F5PA 8ICRA 1S1VA 4DU3A 2W8LA 3VQ5A 4N41A 1BIZA 4O3PA 4KO0A 4KAZA 1TK8A 4ELUA 2J6SA 3NGDA 1TVAA 2IS3A 4UQGA 3AU2A 1BGXT 5FROA 2IBKA 2R7YA 1RNHA 4QWDA 3O4QA 3QIPA 2MAXA 4KMUA 4F4YA 2JLEA 2HVIA 3IM1A 3PO5A 1JL2A 3O3HA 3ISDA 1IKVA 3KIOA 4W5NA 2JGUA 8ICQA 8ICFA 3DLHA 1BL3A 3OHAA 4F5QA 4IR9A 4YR3A 4CEDA 4KLIA 3FDSA 5KFWA 2P1JA 4FW1A 2BQRA 4QWCA 1RT4A 2P51A 4ICLA 4DOBA 4EP5A 3ALYA 5J2CA 1ZQFA 1FK9A 3L2RA 2W9MA 3F9KA 2OA8A 1ZJMA 2Z1IA 5J2FA 1X2IA 4ED2A 5KFHA 1GOCA 1I3AA 5EWGA 4DSKA 4YG2A 2ASJA 4M0AA 3OSNA 2Y1JA 1U49A 5HNKA 1RYSA 2J6UA 4C8NA 3FYHA 4KLJA 1A5WA 1ZQRA 4K4HA 1NK4A 2HHQA 4F4KA 5DB9A 4DF4A 4DU4A 2F1JA 4AHVA 4R64A 4E19A 4CK3A 3GILA 4CEQA 3V7JA 4OKKA 5KFBA 4I2JA 5J0XA 1K1SA 5KRSA 1S9GA 4DTUA 3HL8A 1HMVA 3UPQA 2FBTA 1A77A 3M8PA 3NE6A 3PW7A 2D0BA 5DQGA 1JLAA 4CJTA 3RMCA 3C2MA 4ED3A 4Z4IA 1BPZA 7ICHA 3NCIA 1EXQA 4FJ7A 2RF2A 3AVIA 4LH5A 3KK3A 9ICGA 4FZYA 4UB4A 3DLRA 5HMMA 4LH4A 3Q8KA 3E2EA 3PX0A 4KV8A 3VQ6A 4RPZA 2FLLA 1NK8A 1C1CA 4QWBA 3ISCA 8ICWA 2YV0X 3HO1A 2BGWA 3OYMA 3RB6A 4QZGA 4UB5A 1D5AA 1RCHA 4KHWA 4KLHA 4HUFA 1Q9XA 4QZDA 1ZQLA 5HMLA 4NM1A 4KHQA 1X9SA 4KHYA 4QZIA 4BDZA 1QSLA 7ICLA 4MQ3A 1DLOA 3IG1A 3PR5B 4H4MA 8ICGA 3NH0A 1LWCA 5HRSA 1J9AA 4PHAA 2FMSA 4NLKA 3QO9A 2RKIA 4XA5A 4EBDA 3PX6A 1JXLA 2DFEA 2XCAA 4G1QA 3TWHA 4DTSA 4E1NA 4DOAA 4I7FA 1BPYA 1B92A 1SL0A 3H7IA 3TFSA 2WONA 4ZTJA 2PYJA 1VSEA 3I8DA 3H8WA 4B9VA 1HUZA 1CLQA 8ICUA 3QNOA 3OS1A 1BI4A 2P6RA 4JRPA 1JXBA 4I2GA 5KFJA 1EX4A 3NF9A 2F8TA 1CZ9A 7ICNA 3F73A 3ORYA 4C8MA 4DLGA 3HX0A 3AO2A 5KG0A 4RPYA 2RDIA 4HVJA 2W9CB 2RDJA 4FK2A 5I3UA 2G8UA 2E6MA 1WSIA 1MC8A 5EWEA 1U45A 4M9HA 3JSMA 2BR0A 1ZBIA 1RDDA 4FJ8A 3C1YA 5DBBA 3AVHA 3QZ8A 4FJLA 4NM2A 1ZQXA 3D45A 3B0YA 3GIMA 4YMMA 3L2WA 3NF7A 2RPIA 4KLGA 3DRPA 3TARA 4DQRA 4F3OA 9ICXA 1CUKA 3AVAA 3MECA 4UBCA 3G6YA 4KITB 2DPIA 1ZJNA 4TUSA 4BXOA 4O3QA 4CJEA 4YFKA 4R65A 4JV2A 1KFTA 4FBTA 3PUFA 4YMNA 8ICZA 5HP4A 1HJRA 2IDOA 4ED6A 2PFQA 9ICHA 3V9ZA 3EW9A 3HSTB 3T5KA 4QW9A 3MEGA 1ZBLA 5IIMA 1K6YA 1X1PA 4J2EA 8ICOA 5KFKA 2D5RA 2ZJ5A 2B21A 2YNGA 5CJ7A 4BE1A 3D0PA 1ZQEA 3L2VA 1EXNA 8ICAA 2ZUCA 4J9SA 4HUGA 3JYTA 2C2RA 2HW3A 1XWLA 4UB3A 2BPCA 3AVCA 3VQBA 2UVVA 1BVSA 4TQRA 1XSPA 1ZQVA 1XO1A 4K4IA 3EPGA 5D3GA 4IFYA 3K5LA 4Q8FA 2XRIA 1XHXA 5CHGA 3QLHA 5BPCA 4BDPA 1SZPA 3Q8QB 1ITGA 2XY5A 1EETA 4JV0A 4FS1A 3BGRA 4CJUA 1IXRA 1N6QA 3PMLA 4LZGA 2HHXA 4TSXA 4DQQA 4BWJA 9ICBA 5HRNA 2FBYA 2YHAA 3SI6A 4KLFA 4DSIA 2ZUDA 1C0TA 2FLPA 3HVTA 1ZQMA 2BCVA 3SV4A 4Q45A 4DS4A 1ZQKA 3AVMA 9ICNA 2P5GA 4CE9A 2HNZA 4EP4A 2RN2A 2KW4A 3LP1A 4BWMA 1D9DA 1VSDA 3H8SA 2Z1JA 3OYLA 5IIIA 7ICGA 1T03A 1J53A 4DSFA 1ZQQA 3FFIA 3L3UA 1KVAA 8ICNA 1Q8IA 1ZYQA 4Z6FA 1U47A 3K59A 2V4RA 1S76D 1ZBUA 1HNIA 2GBZA 1N48A 1C1BA 3C1ZA 1TAQA 5FRMA 4JS5A 4FJNA 3P83D 4O5EA 3AVKA 5KGXA 4ZTFA 2ISOA 9ICIA 4Q44A 4F2SA 1F21A 4QZ8A 2OPSA 4M6WB 1QE1A 3QIOA 5HRRA 4DL4A 3KKSA 4O3OA 4F4ZA 4O0JA 5KG6A 1U4BA 4FM0A 1RTDA 2F8SA 2A1SA 1IH7A 4EZ9A 3O4NA 1LAWA 1B9FA 2B5JA 1QTMA 3OYIA 2DFHA 5J0TA 4MF8A 3TQ1A 4J2DA 2G8VA 1RBRA 3AO3A 3ZT4A 5EWFA 9ICFA 7ICQA 4RQ2A 1C1AA 7ICIA 5DB8A 2NRVA 1Q9YA 3OYNA 2PI5A 2KFNA 4DTPA 3LWMA 2Y1IA 1IO2A 4FXDA 5EU7A 9ICPA 4KN7A 3T5LA 3O3FA 3KD5E 5DG9A 3V1QA 3MFHA 3RJJA 2ATQA 3ZSYA 3OYCA 2VG6A 1KDHA 3M9MB 2IC3A 3H08A 3RJEA 1ZQBA 4CJPA 3C21A 1HJPA 4N5SA 1JMSA 1NOMA 4O3NA 2OPPA 3MDCA 4MFFA 4FZZA 2BPFA 3PR4A 3C94A 1VRTA 1RBUA 5KI6A 4CGGA 5KT6A 3S3NA 3SYZA 4FK0A 4M04A 4RQ8A 4ELVA 3ZD9A 9ICRA 2UVRA 1RBTA 4FJXA 4DFJA 4IFVA 4RQ1A 1BPDA 4FM1A 3QNNA 4IR1A 1RPLA 3K57A 5J29A 2PFPA 4I9LA 2JEGA 2BCRA 5KFFA 4PA1A 4RNMA 4DTRA 4FLVA 4FJGA 3KK1A 1SKWA 3RJKA 3T5HA 4I9QA 4PH5A 4YN4A 1VSIA 3M8QA 3AO5A 4E1MA 4B9NA 3LAKA 3NH2A 5HLFA 4CGDA 3WNFA 3JPNA 9ICOA 2AU0A 3JPPA 3NFAA 4F4XA 5KFCA 4Q8EA 4NYFA 4AHSA 4GMJB 4CJSA 3AV9A 4F91B 4J2AA 4Z6DA 2KFZA 3G6XA 2HHVA 2HB5A 1KSPA 3C23A 4ED0A 2QXFA 5CA7A 7ICKA 1RZTA 4DTXA 4DFPA 9ICEA 4R5PA 4KFBA 4YXMA 1CZBA 5IIOA 3N4MB 4OVLA 4QWEA 3C6UA 4NXZA 5KFYA 2ZTDA 4MEYA 4J9LA 4NCGA 5C5JA 4M3YA 5J0WA 2JEFA 4OGCA 4H4OA 3GFKB 2XC9A 4DQIA 1MQ2A 2OPQA 3A2FA 2Q3SA 4ZH4A 4PGYA 4R63A 3KLIA 4CJVA 3OYJA 4FW2A 4KN4A 3VQAA 4HTUA 1RBSA 4FLTA 2DTUA 5CZ2A 4ED8A 1TK5A 4PUOA 3ZSRA 2FC0A 1ASVA 4Z4HA 4PGXA 8ICMA 4B08A 1VSFA 3B0XA 2BQ3A 4LY7A 1HRHA 4OKJA 3AVJA 5DDYA 3MR5A 1NK5A 2YNIA 3QESA 3KLGA 3DI6A 3AVFA 1DTQA 3TI0A 2W9CA 1HNVA 4RG8A 1QHTA 3RBDA 4BDYA 5L9XA 4J9MA 4PY5A 3M8SA 3AVGA 4M45A 3BQ0A 4FCYA 4M3WA 3PW0A 4CEZA 4XQ8A 4M3RA 4M42A 2ZE2A 3DYAA 4F3TA 3L2QA 2F1IA 9ICSA 9ICQA 2FBXA 4ECSA 2G8HA 4I2EA 4F5OA 3K2PA 1ZQJA 3MXJA 3LPUA 4GXIA 4ECVA 3HYFA 3T3FA 1D9FA 2JEJA 4P4MA 1B22A 5HHHA 4O0IA 3M9OB 2BGGA 3WNGA 3KHLA 4X5VA 1QS4A 3ZSWA 4W5RA 4F2RA
chains in the Genus database with same CATH superfamily
3BBFA 1Q82T 3KKRA 1T94A 4I2PA 4CNZA 3K5NA 2GQ2A 1FKOB 2Q2RA 3L9ZA 3VGTA 4JEPA 1TQLA 3TX8A 3J81U 2LSNA 2IJNA 5DGAA 3M6ZA 2R7XA 4QCLA 3B4DA 1NLVA 4OI3A 3CCLN 4Y2VA 1NO8A 3QT6A 3L7OA 2I9GA 4RJVA 1MW7A 3S3MA 4QZCA 1KLNA 4G3IA 5TKYA 5AIAA 1RT6B 5BJRA 2V2KA 3R5GA 2G8FA 3C19A 3MUTP 3R7SB 3G4SS 5KFQA 4ZVGA 1U6ZA 3V6HA 2JWKA 3MMCA 3KJFB 3CJ5A 3FZLA 3OY9A 2A1RA 1JLGA 5HANA 4FWOA 3LZJA 4ZVTB 3RH4A 5FD1A 2W2NP 3MXMA 4CLTA 1JX4A 2CNLB 2YMLA 4ISEA 1L7NA 2C3MA 3NGZA 1R8BA 3UM9A 3AQEA 5AXNA 3ZNUA 2ASLA 2CDRB 2R18A 4CQ1A 3DRXA 4F3QA 2JSXA 4AILC 3GU0A 1HUOA 4FYXB 3OFEA 5AKLA 3L0QA 3Q8LA 4RNNA 4LF7J 2F77X 3IMQJ 4AXIA 3CG7A 4KFBB 2IVMA 3B9JA 1IXKA 4DX6A 4USVA 5D4OA 1ZBFA 2QG9B 2WOMA 4R0EA 1UW4A 4DR7K 4OV1A 3VN5A 3D2WA 3NCPA 4CF1A 2E5LJ 3P6YC 2KNJA 3IA0A 2OH2A 3MR6A 4CLYA 1ZQUA 3HKWA 4H4KC 4F92B 5J0YA 3GIIA 2BCUA 1CULA 1U6FA 3LW5C 2BABA 5K9FA 2HS0A 3CIPA 1FVSA 5IT9Y 2H3ZA 4IDHA 4Z4FA 1YRTA 4AQYF 4P73A 2QA4G 1WDDA 5JTIA 2HLTA 1VJQA 5DDPC 3ZO7A 3DXKA 1TK0A 3TEHB 3C15A 1ZD5A 4NLBA 2EPIA 5HROB 4WKYA 3EKUA 4DZDA 5DLGA 4BCAA 5HVGA 2OHDA 3PKYA 4XRHA 3KDNA 3GZ7A 3T9ZA 2RH3A 5KFPA 5FLXY 1ZPWX 3OTEA 1X5SA 5KFSA 4IUFA 1PVPA 1Q95G 3VQ9A 2X74A 3MEEA 2CQGA 5BR8J 1OQ3A 4FK4A 4WFNQ 4N47A 3AUOA 2L41A 1YG0A 3A13A 3ZZUA 3VQSA 2PT0A 2F4VF 1AYEA 1NU0A 2MKCA 4RPXA 2RHFA 4JN4A 2PXIA 4UTGA 3HT3A 2MQMA 2Q43A 5DGBA 3CMES 2GHWA 3H7HB 1VSKA 1V38A 5CA5A 3DLJA 1L7OA 1TL7B 2ABYA 3BQ7A 2XMTA 1YBUA 5KRTA 4DR2F 4I64A 4CGIA 2YX4A 2F40A 3AOAA 4FWPA 3LVVA 2PEBA 1QSSA 4LRAA 7ICEA 3UXOA 5DB6A 4URSA 3O1BA 4Y2XA 3TAPA 3WKCA 3KFWX 5ALEA 4PZNA 4NASA 4K2JA 4YXJA 3C5GA 2AJ4A 4KH1B 3CRXA 3I9ZA 4DL5A 1GH8A 5K20B 3C2LA 1TL3A 2NUUG 5M1OA 2CJBA 1G15A 2IDEA 5DG8A 3QEBZ 4O8KA 5HP1B 4DUZJ 5HR7A 1SUQA 4CZFA 3TA1A 4BR0A 2N7CA 3M6UA 1HLWA 4JK8A 4LFAK 2HDOA 4K4TA 3MZIA 1HNXK 4HCBA 5ETLA 1GXTA 1CXQA 9ICTA 2P9EA 4RO0A 4XDCA 1IBLF 2HMIA 2O8EA 3M32A 4DR1F 4WQ5C 3TJ8A 3MEDB 4FO6A 2QFIA 2WBMA 2KK0A 1DTTB 2B7CB 2YKOA 5AE1A 4DR3K 1S0VA 1Q86O 3H4DA 2X78A 1DRZA 4DPTA 3QFHA 2WF7A 4MYUA 3NRZA 1Z00A 3HZ6A 3L09A 1CXUA 2IVOA 5KFZA 2UUAK 2E4LA 4QWAA 3CCJN 2W9BB 2NZTA 4UAWA 2C28A 4P9SA 4X65K 1QTNB 2G06A 3C65A 1U02A 5ALWA 3BBBA 5DB7A 2QK9A 2JV3A 4LIWA 1YUWA 1L3SA 1H38A 2V63A 1ZRMA 4BE0A 1ZAVA 1TUWA 5KFTA 1V3SA 4FN5A 3I9V9 1WHWA 4QYZJ 1FTRA 4FKYA 1NJZA 1XI1A 1F0XA 5DDRC 4ZVOB 1IWGA 3VAFA 2Q1NA 2G0CA 1X4HA 4PWUA 3JPTA 4M63C 1YX2A 3C95A 4QZAA 4Y2RA 4NLWA 1ZQDA 1IM4A 4ZJOA 1VQ6N 4W98A 2BEFA 4JKAA 4DR5J 1L7MA 1S1TA 3KHRA 2XMKA 2ZNYA 5AJ3K 4R25A 2M8DB 4BRLA 1FXDA 5DQHA 3IG8A 4URQU 1W26A 1R43A 4M7YA 1D1UA 1DGSA 2LQJA 1VDVA 1ZTWA 1VMBA 3P5JA 4V1Ak 3CO0P 4KI6A 3WK5A 5D49A 3VCBA 3L4BC 5L39A 1FVQA 4FF1A 2A42A 1O5JA 2CZ4A 4R8UB 2ASMA 5CR0A 2JH7A 4A61A 3H4BA 2IA0A 1X9XA 3UKRA 3BKUA 4N76A 4YOWA 5AQNA 3Q8SB 3PEHA 3AU6A 1FKOA 3JSBA 7AT1B 1YITS 4LF4J 3AY9A 3MXIA 2A10A 4GVLA 5AQZA 4D3HA 5A6WA 3OTOJ 2G2ZA 1A0PA 1TL1A 1J5EK 5K14B 4FLZA 2RSQA 2RHSB 4OX7A 3HHKA 1NAQA 2YJEA 4IOAQ 2NRXA 4MFAA 1IBKF 1YITN 2M0NA 1GX5A 3UNGC 1Q8BA 3QINA 1RT6A 1ZQPA 1NDCA 4WU3A 5IQQA 1VLYA 4XO0A 3D9BA 4CBXA 4CFCA 3SQ4A 3EGWB 5K8PA 1ATRA 2GW8A 2XMVA 2FC8A 3V7LA 2GUIA 5AQQA 5A76A 1PAEX 4KLSA 3FMBA 4K4WA 2DNGA 4ECUA 3GG4A 4NXMJ 2C2ZB 2HSEB 3ZZYA 3Q2SC 2CJAA 2XHBA 3OS2A 1NZAA 1QJHA 1X4EA 3P5BP 2M5YA 1PK3A 2R7WA 3DMJB 4NI2B 3GFHA 3GJQB 4I68A 4LF5F 4FJ5A 3MAHA 3E58A 4KH0B 2HFNA 5CD4A 3VAGA 3E8OA 3L7PA 2F2AB 3POTB 2ASDA 1FE0A 2HBKA 3TZZA 2ZZTA 3ZSXA 2V50A 5IILA 2QRRA 2W9AA 3L7UA 1HYZA 5ADXH 1WG5A 4DTMA 3RW6A 3SLCA 3IS9B 1MN9A 1ZQOA 2ZUAA 3MN7A 3KTQA 3AOBA 4RZRA 5IV3A 1KKHA 4B3MF 4CHZA 5HRPA 2NYVA 1F9HA 1XR6A 1S0OA 2C2EA 3CQ8A 5GIPA 2R4FA 3HOTA 3LDNA 4KHUA 4JI2K 2ZUBA 1YQHA 4Z4CA 3ISZA 3MMBB 4ID8A 2P35A 2XZTB 3HDSA 5HROA 1KQFB 3D6HB 3FEYB 3PNIA 2P9LB 5D4BA 5DLFA 2P9PB 3N4PA 3CCEN 3PYGA 3OJSA 1N0UA 2XY8A 1COKA 3CULA 3LZIA 4WBFA 5J2PB 5CE3A 5CYJA 4KKOB 4HDGA 2WUSA 5AE2A 3MD1A 3BEXA 2F8HA 4DV0K 4KSEB 5D0EA 3RR8A 4NMLA 3S8SA 3LP2B 2KN4A 4C7YA 4L3QA 2R7UA 3A1YG 4CF0A 1Y88A 3BS9A 2K2PA 4BC3A 3O6WA 1SQFA 3I5BA 3T1AA 3G8QA 1ITPA 1SXLA 2AEMA 3CYMA 2MB0B 4I2FA 2OPRB 4CZJA 4RL1A 1AXQA 4JI1J 4RU9A 3DLEA 4CFBA 3VTHA 4ECQA 4FLXA 1TVRA 2J0WA 1Y3KA 2D3UA 4FYDA 3OL9A 2UUBK 3OSPA 1N0VC 3QMLA 3NBPA 4CLLA 3OVSA 2UUCF 2IAJB 3CXCM 1TAUA 3DAWA 1C20A 2ZBQA 5HP1A 3UDEA 3TZWA 3QICA 2VU5A 3JXUA 1M1GA 1YJVA 3E01B 4YY3J 2ZOFA 5KFNA 4IG0B 4LF8J 3QATA 1QCKA 1YAGA 5ETRA 2B9EA 3D66A 2ACYA 5AFUH 2HFZA 5AQVA 3M05A 3C29A 3J7AP 3DXSX 4OLAA 2BJEA 5KFXA 4P0QB 3MEDA 4OJOA 3V9XA 3TADC 2R7OA 2P9UA 3MCMA 2F5GA 3K89A 1N32K 2LKYA 3HP6A 3RMAA 4Y28C 4KHPK 5KAKA 3CSKA 5IIJA 2ZBPA 3NRBA 3D0HE 4LR9A 5J0RA 2IRYA 3KJVB 4NYZA 4C98A 1IBMK 1RE1B 3L8BA 4DCOB 3NNCA 4ZLJA 1FF2A 3T9NA 4DUYF 4ZA1A 5HJYA 2PE8A 3SJJA 4KLUA 4NLCA 4K59A 1R8AA 3CD5A 5EOYA 1LFPA 5IXUA 2Y0SD 2LI6A 2ZIVB 2DYAA 5JS1A 2OHFA 3JXOA 3GE1A 5BXIA 1B4FA 2C3YA 1BUPA 1PILA 2HVZA 3TWZA 3TZXA 2IOCA 4B9MA 2K8BB 4OJ6A 2FJXA 3KNGA 4Y00A 3ZNJ1 2AH5A 3T19A 5AKYA 3VQDA 3HD2A 3QAEA 3ZT3A 1UVJA 2ZKTA 3DGPA 2XHCA 4JKFA 3SMVA 2EHGA 3HI0A 1B0XA 3SUQA 1LW0A 3FSYA 1VHIA 4MDBA 4E7LA 4ITSA 2VPXB 2ASPA 2W40A 3W9JA 1NJIO 1NPKA 1OVYA 5K8NA 4QAGA 1S1WB 2B4JA 3TSPA 3S1TA 1RHKB 4UBBA 1T9WA 2OEKA 4K4SA 4Y2TA 2CJYB 3ZT1A 3G10A 2VWJA 3R5BA 3PKMA 1K44A 8ICHA 1H98A 3RAXA 1GOAA 2GJ2A 1S1VB 2HHHK 1YI2S 1J97A 4NLQA 4C97A 1YT3A 4R8UA 3ATUA 2XO6A 3IAM9 2HMXA 2OANA 2E1FA 1D8YA 3D1OA 1NGFA 1FFGB 2DHHA 2BJ1A 4DMZA 3H25A 4GV3A 2HRYA 4KREA 1FESA 3TTDA 4TY8B 4QJFB 1YI2N 2APOA 1ZXIA 2G13A 1L5UA 4X66F 2E9TA 9ICJA 3OXFA 1VSLA 2CKWA 3HWTA 1NK0A 3K5OA 4X2BA 5J0OA 8ICBA 2ASOA 3O0FA 5CZVA 1UL3A 2OYQA 4YHHF 2VKZG 2XGQA 3T6BA 1L3TA 4ILLA 2EC0A 4TYBA 4K4ZA 3NKYA 3TW0A 4L73A 4WZMA 4B3SK 2BRKA 2LBOA 4FJHA 2HGLA 3CHWA 5GAHU 2C42A 3WKAA 4W5TA 2DKOB 5LMNK 4UW2A 3SBTA 5AQOA 2KL8A 1MWQA 1VAZA 2VFUA 1CG2A 1PGZA 3HHLC 3G0ZA 1QQMA 4Q2LA 4NYNA 1IKYB 1JWWA 2ZJPL 3OTBA 3HSCA 2DXFA 4BJQA 3AJDA 4KGZB 2AJQA 1HMVB 4YR2A 3DMJA 4RT3A 5KT5A 4NI2A 4ZPVR 3L6QA 4C6AA 1AQ6A 2KSOA 1N60A 2HBQB 2F9TA 3W65A 2DFFA 1S10A 3NF6A 2CPZA 3ASMA 2GWSA 4DPOA 1GLLO 3UMGA 3AAPA 5AR0A 2C1EB 2RRAA 5M1FA 4I27A 4WJ3B 1CQNA 2FIUA 1KWMA 4KV8B 4HKQA 4IQTA 1S5JA 2HHWA 2LYVA 2OGUA 2HYIB 3IS9A 2ZVSA 2DB1A 3C16A 1HHTP 2WB4A 4LRCA 1BU6O 2P9GA 3RZAA 3PRBA 3M9NB 4LRFA 3MAAB 2H3IA 3KMQA 2DNYA 2MMYA 1RP5A 3RUBL 4H5VA 2MPUA 2FZGB 1COOA 2UXDJ 3D2EB 2IVPA 4WFZA 3H8YA 3MMBA 2O8BB 3T41A 1WOQA 3KHGA 2E7VA 4QIFA 3ZDCA 2CQ1A 2P9PA 2P9LA 1MWYA 5ALRA 2XMMA 4M5JA 2VQFJ 2CRXA 2X7IA 1SS6A 4NXNF 1JLCB 2G2OA 1WI6A 5B0BA 5EUHA 2VANA 3IP4B 3D1HA 3AGRA 5J2PA 2FBVA 1HWJA 4KKOA 2BJ7A 2FPLA 4FVMA 3Q8VA 4CI0B 2BE7D 3LGHA 3RGIA 4O5CA 4B9UA 5KFMA 2HPUA 3LWLA 3QT5A 3BO3A 1YZ6A 2LA6A 2KT2A 3LP2A 3QEXA 2QA1A 2I6WA 2W43A 1Q79A 2ZTCA 2HHTA 1APSA 1RBOB 2KZ3A 2E2OA 2L9NA 2HF3A 4YD2A 2V67A 4P2HA 1SH2A 3DXBA 1LV5A 2NCKL 3M8WA 4FM2A 1SAZA 4LF9J 5KT4A 3SCJE 3T5JA 2OPRA 8ICJA 4EFHA 1SV0C 1Q16B 2J9DA 3HHDA 4YD1A 1CVJA 5ADZA 3OD2A 3QX7A 2VBYA 2KZZA 4CI6A 2MZ1A 4DTOA 3TABA 1PVQA 4HYKA 2QW9A 3ETLA 5JJBA 4RQ0A 2ZWOA 2FLOA 2IAJA 1F3VA 1L3UA 2CPDA 3UDCA 2H3FA 3ZFVA 1Y4ZB 2ALZA 1SXEA 1ZA2B 1HKGA 4P71A 5IC6B 4B8AB 4IWVA 3PJXA 1M5VC 3E01A 3D3CJ 3MPUB 1KVBA 5MLCQ 4DV5J 2JLFA 4G9ZA 4EZ6A 2VH7A 1FXRA 5G5HA 3JYTB 2G0IA 1URJA 2M4MA 4HHTA 5DQIA 2QGFB 1LVHA 2H3EB 2V4QA 1R0AA 4P0QA 4CO2A 4DOCA 4OX6A 5GAHP 3AA2A 4PG5A 5ALLA 2OMLA 3GWCA 4XUSA 3G6ES 2NXNA 3VOVA 2VF3A 3HMJG 5HQLA 3GJSB 2AGQA 2BCSA 1Y9OA 3TR8A 1Q4RA 2F96A 4OYMA 4RBTA 5D3GB 2WAQF 5LSRA 2AKWB 1X9WA 2DNLA 4UATA 1RCOB 2DEJA 3V5RA 1CBKA 3J7YI 1U2VA 2KXNB 4C8LA 4FWRA 4CHNA 2NUHA 5D46A 3G6EN 3IDWA 3CPWM 5J2QA 3P45B 3MEKA 3PXGa 4FYYB 2FJBB 1X4GA 2X3GA 2IOFK 2EFNA 2I9SA 2FQQB 2QL9B 2HG4A 3VAMA 3RMDA 1RBVA 2VA3A 4JYAF 3UIQA 1Z25A 1NK7A 1GMUA 1P6TA 2CZVC 2NXUA 2Q6CA 2WB1D 3WKBA 4CYUB 2XS7A 1SKRA 2ERRA 1ZOLA 3FFIB 3ONNA 2QKBA 1UVMA 3MGIA 3HFVA 4DTNA 1RT2A 3NUQA 5KG2A 3FVYA 5EXWA 1JCEA 2QSFA 1KKXA 2HNDA 1S1WA 2QJ3A 3A8EA 2HBYB 1LKZA 2EAPA 1I6JA 1CEZA 1K8AO 3EO3A 4QU6A 1WKLA 1J5OB 2W7PA 2PFUA 2ZM6K 4DU8A 2QWLA 4PKHA 3GBTA 1SL2A 2OPSB 4LR7A 1NH8A 4PXEA 2FY1A 4M3ZA 5DDOC 5E41A 1NHVA 4DPUA 1RWOB 2DO0A 5GMDA 1S1VA 2ZFHA 1YJWN 2W8LA 2D7SA 3VQ5A 4N41A 1V85A 4LF7K 2RUSA 5M1PA 4BR4A 2MKSA 2H65B 4B1XB 2NQPA 2DGUA 4B3TK 4UQGA 3AU2A 1BGXT 3AFGA 2VOPA 2IBKA 5MLCV 4FYVB 2KIWA 4QWDA 3MM7B 2NRHA 4F4YA 3JQMA 1N34F 2C2MB 5BPNA 2E5LK 2M3DA 3PO5A 4WFNL 1X40A 3AJ1A 1IKVA 3MCNA 1H7WA 2JGUA 2M70A 3DLHA 5K8OA 2VDHA 5EX5A 4LBIA 3FDSA 1Y5NB 3GSDA 3SAGA 3A8YA 5DRKA 3F2BA 2BQRA 2CG8A 1RT4A 3FGVA 4EP5A 3OVAA 3ALYA 1QVGM 3DLLQ 2IPOB 2EAMA 2ASYA 4AL6A 4AUKA 4FF3A 2Z1IA 1DRGA 3EZWA 1K9MO 3B6BA 4YG2A 2V7YA 4BREA 2Y1JA 1PAUB 3EVMA 4K50A 2BJ9A 1LXJA 2MY8A 2W3SA 2J6UA 4C8NA 2ROPA 4NLPA 3FYHA 1J2MA 2G07A 4OX9F 1NK4A 5C2CA 5LMUF 4DF4A 4DU4A 2YX8A 4Y2AA 2F1JA 4KT0C 5BR8K 4R64A 4E19A 4NV0A 5D0HA 2EKNA 5K8MA 3FQLA 2QARB 1HMVA 1A6SA 1KW4A 4C11B 5DQGA 1JLAA 4CJTA 1O0PA 5C2DA 5AQSA 1BPZA 2E20A 1YXQA 3AVIA 5GAHI 2VPWB 4UB4A 3DLRA 5FPDA 2NSCA 2MZSA 5HMMA 4KV8A 4RPZA 1HEKA 2XEXA 3MM9B 2DHSA 1X3NA 1Z6RA 2BGWA 3NMRA 3OYMA 4QZGA 2PEHA 5CXTA 1WC5A 5ETMA 2DD8S 4KLHA 4TLRA 1EP4B 1VBYA 2GO9A 1ZQLA 5HMLA 1PJ7A 2Z0GA 3ZZPA 4KHYA 3MAAA 4R5PB 1RJJA 2DIVA 1QSLA 4JI5J 1RWXB 3JQKA 1IBCB 2KV2A 4DUZK 4MQ3A 1YSJA 3PR5B 3FC4A 4PHAA 1S5ZA 5F0XA 3QO9A 3CDUA 5LT5A 4U6PA 3PX6A 4JI8F 2XCAA 4C7QA 1W25A 2DFEA 4DTSA 4X64J 3BGOP 4DOAA 2V94A 2XYGB 4EFAC 1X4CA 1SL0A 4ZTJA 3TFSA 5F8GA 2KG0A 2MZQA 1XNRJ 2PYJA 1S1XB 1WG8A 3OHRA 4JHDB 3H8WA 3BY5A 3QGGA 1VHXA 8ICUA 2JH1A 5AK4A 1S7IA 4B1VA 3OS1A 3PYFA 5KFJA 3HHNB 1EX4A 1J2NA 4OZ5A 3WX4A 2GO8A 1BG3A 2VKQA 4C8MA 1H74A 3DI6B 4A8EA 3O1WA 5EHHA 3L4PA 3HULA 1HNVB 4FK2A 3M6VA 2VWBA 2YWHA 1MC8A 5EDWA 1M5KC 1U45A 1NZBA 3D3BJ 1D3WA 1FI4A 4JOUA 2RUGA 1XQSC 2ZG6A 3QZ8A 4NM2A 2UV8A 1ZQXA 1FJ7A 4YMMA 2ZE2B 1SCJB 2FVPA 2RPIA 2F8EX 1Z4UA 1A0OB 1CUKA 4DCHA 1FRMA 2FHJD 3I33A 2FC9A 3T7ZA 4JI3J 4JAXA 4QYZK 2KM8C 2FUG9 2YMMA 1RCXB 2FHKA 2RU9A 4O3QA 3UCUP 1H2VZ 2DVIA 4JV2A 1QDUB 3MI7X 3SFUA 4AP9A 4FBTA 4KHRA 3O4WA 2W04A 2GGPB 1HJRA 4JI0J 4NLOA 1BO5O 3CJ1A 3G8TA 3AOCA 1X1PA 4DR5K 8ICOA 2EI5A 2D5RA 1F5CA 4U67Q 1S6QB 1Q7LB 1S22A 1TYQA 2Y0BB 3JYTA 1NMDA 2CPHA 4IOAL 3KXDA 3IM9A 3D0IE 2IJRA 3VGLA 1L7PA 4OX8A 3VQBA 3VETA 1BVSA 2AZ3A 9ATCB 1QAIA 3E66A 1ZQVA 2YWFA 2V2VA 5AQRA 2JVOA 5D3GA 2Y1LB 1SJRA 1N8RT 2VJ5A 1PIEA 2HZVA 1SZPA 2E8OA 3O1LA 4ZS6A 4CRXA 1HBNA 2I5JB 3PMLA 4TSXA 4LF4K 1RABB 3BF4A 1N33J 3Q8UA 4H0XB 9ICBA 5HRNA 3OTOK 4B3RJ 2YHAA 3WIUA 2ZUDA 3OR2B 4LFAF 2V4JB 4WP9A 4Q45A 3I5CA 5J2NB 2J7WA 3AVMA 2AXTU 2KHVA 1HNXF 9ICNA 1SC4B 2ZVIA 4OJHA 4CE9A 4GKKK 2R2RA 4H5TA 4EP4A 2RN2A 1NHUA 1VSDA 3DNCA 7ICGA 1HKBA 4DSFA 3FFIA 2HS3A 4A2BA 1NGCA 3N4WA 3NY0A 5L8RC 1ZBUA 2FVRA 3HZEA 2R2SA 5AI4A 4DR4J 1YK9A 1TAQA 1KBRA 4NYOA 4JS5A 2DCLA 2HRTA 4C2MA 3SMPA 3P83D 4O5EA 3AVKA 5KGXA 4NXMK 3R27A 4G1QB 1F21A 4TN2A 4QZ8A 4MO4A 2OPSA 1SZHA 5H2FU 4I7FB 2VODA 4Y65A 3KKSA 4O3OA 4X65F 1U4BA 3ILJA 3JTOA 1RSCA 3MUMP 1RTDA 4B9QA 2F8SA 1IH7A 1LAWA 2MXYA 5GVQA 3EE9A 4DHVA 1OWXA 2JHDA 4LFBJ 4RQ2A 3JSYA 3P5TL 2ZBCA 2NRVA 1Q9YA 5I3UB 3LDLA 1SJFA 1IO2A 4DV2J 1HBMB 2UXBJ 2VJ4A 3MM8B 1NBEB 2YKQA 1WELA 1G4CA 4JK9A 1VI7A 2ATQA 3TAMB 1FHTA 2GTDA 3VENA 5F0WA 4H54A 5AJ3F 3H08A 2NPIA 2BXJA 5D78A 4KH5A 1ZQBA 3ENQA 4RW9B 2QYCA 1OIAA 2OELA 4MFFA 3F2DA 2ZOMA 2BPFA 3PCOB 5EY4A 2FE9A 2OEJA 4CO0A 5ALFA 2P2CB 4CGGA 5BN9A 1HNZJ 5M1KA 1Q81O 2W11A 3SYZA 1GNKA 3KG4A 1RHMB 2VB6A 3MEGB 3E9LA 1RQ0A 1XJWB 2A2DA 3MD3A 1ZAXA 1IQZA 3LL3A 2UVRA 3SBMA 4WIIA 3J7Z5 1RBTA 4FM1A 3IG5A 4I9LA 3J8AA 2WF8A 3HRGA 4C11A 4DTRA 1J5EF 4WU2A 4FJGA 2Q0RA 4PAAA 3CDBA 3T5HA 4PPZA 5IWAF 4YN4A 5M2RA 3M2VB 1VQ7S 4JI4J 2YTCA 4WIQA 3QRQA 4CGDA 2UU9F 3VAIA 5EVZA 3JPNA 3BGRB 1S72S 9ICOA 2MTLA 2AJ1A 4FPRA 1N6QB 4NYFA 4Q8EA 1VBZA 4GMJB 3AV9A 4Z6DA 1FRHA 1ESVA 1VQ7N 3NRWA 5KL1B 1N5XA 1KSPA 4XPEA 2NSBA 7ICKA 1RZTA 2V52B 2W01A 3IR6B 3JSRA 9ICEA 3O44A 4R5PA 5A2QO 1U26A 4FPIA 1RTIB 1YJTA 3ZETB 1S72N 2HNZB 3N4MB 3W1YC 4ZLLA 5ALNA 1BHNA 5RUBA 2ZKUA 3VGMA 4DKWA 3CVKA 4NCGA 1T03B 1FRIA 4LF8K 5DETA 1S49A 3GFKB 1FD8A 2ACMA 4AL7A 4ZH4A 4R63A 3VEOA 1ILYA 4BRIA 4B1ZA 4MT1A 4HTUA 3QWUA 4A46A 3QJJA 4JHDA 1RBSA 4JD2A 2JX2A 4P6QA 3FSXA 3IXQA 4ATNA 1ASVA 4B08A 2GELA 4CNQA 2WF9A 2MQNA 2A3ZA 1D09B 2KDOA 2BKNA 2BVZA 2K7KA 2V8HA 3DI6A 3AVFA 1HNVA 1XNQF 4DV1K 3J80Y 6FD1A 1H3DA 1UZDA 2B5JB 4PYAA 1MROA 4NJ8A 3FQKA 1YKWA 3BQ0A 3W2VB 5A8RB 1HHSA 5CAAA 2J8AA 3CDWA 2QLTA 5ALGA 5DO2A 1J27A 3EGVA 4FE3A 2WSFC 3PW0A 3EGNA 4BC5A 5D4NA 3J7ZT 2ZE2A 3NAHA 3DYAA 4F3TA 3KKAC 2F1IA 2W3RA 4FVCA 2XSFA 3T79A 3WXMB 1RADB 4I2EA 2Z30B 2K1RA 3AH6A 5E26A 4ECVA 4WE1B 2GHVC 2H4YB 1OYDA 1T05B 3DU5A 4Z94A 3H46O 4WXOA 3GYXB 3J81j 3M9OB 3D68A 2D41A 4Y2IA 2Q3PA 5BR9A 4PYDA 1ULRA 1TTHB 1S6QA 2VHGA 4CGJA 1I51B 2NLXA 2QO3A 1QQ7A 3OXLA 2XLIA 4A8SA 1KAZA 3R1XA 4NWBA 3D6JA 3Q8YA 3T1YJ 3JAMY 2KEYA 3PIOQ 3N6MA 1OH6A 2N3LA 4H0VB 2JNJA 3CCUN 3KJQB 3MWTA 4DTJA 4PG4A 1VR6A 2KKVA 2RQ4A 3ZC4A 3PYDA 5DBAA 3DFEA 2UUBF 3M8ZA 2HWHA 4Y2YA 2DY1A 2JL9A 4J7CA 2I5JA 4XAKA 2AD9A 2UYTA 4BRDA 2YHBA 1ATSA 1ZRNA 1NGEA 4MN4C 4YOUA 2KTQA 4UF4A 3FBCA 3TTFA 5J2IA 2V4JA 4P2XA 2EFVA 4ECYA 5J2NA 4FF4A 1IV0A 1XC9A 1C4AA 2I1RA 3WK7A 3K8VA 2YPZA 3TNVA 5JRTA 4Y2KA 1T9VA 4O55A 4JRQA 1HI1A 3RYLA 4EBEA 3LA0A 2KXFA 3SCLE 3JS6A 3ULDA 2N7YA 3TEGA 4ZITA 5HN0A 1RT7A 3IFEA 2E1YA 3GR1A 4KHPF 2X6SA 4CJ7A 3EKSA 1B43A 4Z6EA 3M4XA 2A5XA 4IEEA 4KAIA 4NMXA 4UOGA 4MTPA 3GDXA 4JV5J 1IBMF 4GC6A 4KH4A 1CSJA 4H4OB 3M2RB 1GOBA 1BQMB 3VA3A 4HACB 5KFUA 2BKPA 3S01A 3RJFA 2Y0SF 4DR6K 1DHMA 2NXCA 1QAYA 2D1KA 4C7ZA 4CCHA 3C6AA 1KEKA 4CH7A 3QU2A 4CLFA 3C14A 4RUBA 4ZHRB 3F53A 1UT8A 4GKJF 5KFEA 2Q66A 2IHMA 3DRSA 4HT7A 2NNWA 3SUPA 3O2IA 4MFCA 2QN6B 3GQCA 3R5CA 3KLGB 3HHEA 1DTQB 3ZSQA 4EEKA 1H73A 2XWYA 3DDNA 4MEXA 5GAGU 1X9MA 3OYKA 3MN6A 4DFKA 4RQMA 2CADA 4CDGA 1DQ9A 4JKGB 2G8IA 5EOZA 1CPZA 3VEXA 3GIRA 1LKYB 2BACA 2G08A 3TAMA 4CIFA 2PN6A 2FPKA 4RQ5A 5KG3A 3W62A 5E79U 1HBOB 4JV1A 2QTDA 1U09A 4QZHA 4L8RB 3OTQA 2VASA 4RW9A 2MQOA 4GV6A 2W4CA 3SMSA 8ICTA 1FFSB 1P90A 4IQWA 2VQEJ 2HHHF 3NVWA 3KUHA 2VQFK 1E6VA 2CQDA 4P4PA 3B8AX 4NCAA 3K8WA 1WBBA 1QQCA 4I29A 2KJ8A 2ZBIA 3UQ0A 1T0TV 3OTCA 2H5EA 8ICCA 2Z1GA 3R6GB 3TX0A 3W9IA 1HR0F 4TQSA 3DLGA 2DBYA 8ICSA 4UUXA 5M1QA 4DV3J 4CZLA 2B4VA 1JKHA 2ZWPA 3BPSP 3ENHA 2YQEA 4USMA 3N28A 4DV6K 1J54A 3QSIA 1WCNA 4Y1CA 3KK7A 1LAVA 3T1HK 3OYFA 1GLDG 1AB8A 2FGCA 4LF9K 3KLEA 5AQFA 4H5RA 2KKZA 1O08A 4Q43A 2J5AA 4DR7J 3NVVA 4B3SF 2DGQA 2B7BB 4M1KA 2D0CA 1G6BA 4DQPA 4L76A 5U47A 1NGGA 4BACA 2X1FA 4A8QA 1CJVB 3JPQA 5LMNF 3VQPA 2LM4A 2HWIA 2JMGA 3CFPA 4PWWA 1PJ5A 3S3OA 3ZDDA 1WN7A 4K41A 3FZKA 1RTIA 1ZD3A 5J2HA 4IOXA 3TP2A 1PO6A 4C80A 5DZ6A 5L1MA 4M8LA 1A7GE 3BQ2A 1ZM9A 3K0SA 2MKIA 1KHWA 2W8KA 4DN0A 8ICVA 2J76E 2VL1A 3UMCA 3MMAA 3BH7B 2ZHBA 1TKXB 1IWAA 3EYZA 1R7IA 4ZPAA 4QR2A 2LECA 2PO4A 2VV5A 4HVZA 3I55N 3UR3C 4RW4A 3PSFA 5F1XA 4QIWD 3F5TA 3TTCA 4CO3A 1MU2A 2XI3A 1RTJB 4ED1A 3EUNA 3C7NB 4M5GA 4CHOA 2PBDA 4F93B 4RQ3A 3FEXB 2MZTA 1UWBA 3CNHA 1VC6A 3GIJA 4DSLA 4P0PB 5A8RA 3W2VA 4FOIA 4FJMA 2R8GA 1KVKA 2QWNA 3PRVA 2PFDA 5B0GA 1FO4A 2VG7B 5KFVA 4O9MA 2HQFA 2VC0A 4F0MA 3KG1A 2IM1A 2R2TA 4WZQA 3W60A 3P1GA 2P9SA 3C6TB 5KT3A 3PHTA 1ZQGA 4OHYA 3UE2A 3M8RA 5ALKA 4DL7A 2KQ2A 2DGWA 1RWWB 3SFGA 1HIWA 4I2QA 5GAGP 5D77A 3L3FX 1M90T 1EKRA 4WE1A 2CAJA 3ALRA 2Q0ZX 3F5AA 5FIIA 1T05A 4BC7A 1JLEB 1NGAA 2G8KA 1HI0P 3QUCA 2BW2A 1HKAA 1RBAA 4G1IA 4HI2A 3OV7A 2H3GX 1QQOA 4GVMA 1T9YA 1REVB 3H1VX 1QLNA 3KLFB 2IMOA 3SMZA 1W7AA 2F1HA 1W2IA 2HFUA 1H1VA 2CQ0A 2YKNB 4K7QA 1NKEA 2ZIXB 3RJIA 5M1NA 4UZBA 3DLLL 5B8HA 3MPWA 4IDKB 3QWPA 2ZJQQ 2QLBB 2E9RX 2CQ2A 2IJFA 3IV6A 7ICFA 1UT5A 2VA8A 1NK6A 2Z2MA 2WCXA 1E6YB 1T3VA 4DR3J 1WKKA 2IIRA 3Q8PB 1QUVA 2V7ZA 1JLQA 4LQ9A 4CEOA 1KVCA 2OZSA 1JXEA 3QE9Y 1FERA 2UUAJ 2COLA 5CZ1A 5FDLB 3ZDBA 2R42A 1BUXA 1NLKL 4ZP9A 4K0KK 5CY4A 2UZAA 1YBAA 4QS8A 3Q86A 4DWIA 1C6VA 1U04A 1EZZB 4Q0BB 1C0FA 4A5AA 2WF5A 2IHR1 7ICRA 1TAMA 3I1YA 1N5VA 7ICSA 3HM9A 1VK0A 2KHQA 4LF1A 3WK4A 3BYRA 4Z7CA 3CJ4A 2Y9TA 1U1MA 4O5BA 5ETSA 5D0GA 9ICKA 2VG5B 2M7SA 2V8GA 4DV7K 4B3OB 1QAXA 1P1LA 4FPAA 2LYAA 4ZPDA 3DWLA 4BRKA 4OZ1A 1I39A 2ZC3A 5BYSA 2V34A 4M3UA 2CJ9A 2A6MA 1B70B 1P9QC 4E7IA 5JLFA 3VVUA 5AHXA 3M2RA 1RKIA 1LQ9A 4L74A 1BQMA 4PWDA 5CWRA 4HI1A 3RWUA 4HACA 1TUGB 3CWJA 5KG7A 4ECTA 2I5HA 3O3LA 4KYZA 1OQ6A 4PPXA 4F5NA 2LMRA 4KR0B 5J1PA 1ZQZA 3UVJB 1TL4A 2YQ0A 4ZPTR 4ZHRA 3SCXA 1NCLA 1TGOA 3D6TB 2WB1F 3CUNA 4X4TA 3AO4A 3VGUA 3KUGA 1O1WA 3EZ5A 3NG8A 5AQJA 5CYQB 2RAQA 2BE2B 4HHJA 1KFSA 2F9DA 5L1JA 2XYPB 5L38A 4JKGA 2KXHA 2E2NA 1LKYA 2DITA 2YI1A 1HD1A 1YTUA 1UA1A 3NS5A 1T44A 3ZTOA 2RS8A 3DOKA 3NVKA 4A62A 3H2LA 1VRQC 1HBOA 4OHVA 5JICA 4DPXA 3WC2A 4MYTA 4RNOA 4DEZA 4X4VA 4M9LA 3AY0A 3GTYX 3OPKA 5F9LA 1ZM3A 1HX1A 3NH1A 4JUZA 2J8SA 2HBLA 3GONA 5HATA 4KLDA 2QX0A 4LF7F 2EX3A 4I6MB 4X64K 2G0AA 4IFEA 2HMPA 4RW6B 4BROA 4ZN1A 3KMSA 2O1PA 2SXLA 3J81Y 4CT9A 3VMFB 3BQ1A 1XNRK 2NYHA 3EJMA 3C2KA 4FXVA 1O6XA 1XR5A 5GAEU 3VALA 2E5LF 3ULEB 5F8LA 2E2QA 4YOXA 1NSKL 4CE6A 1S4FA 4JKHA 1K0TA 3I0SB 2D69A 1B3TA 4KBIA 1FWKA 2XY7A 3H8MA 4JKDA 4NLNA 4QZVB 3BS5B 1R8CA 3O9SA 4M9GA 3CETA 1CRXA 3P96A 4XTTA 2LQ9A 3UE5A 1RDRA 2A41A 4ANCA 4RTFD 5T41A 4V19S 3V2UC 1NMNA 1ZC6A 3WXIA 1CZAN 2KP7A 3DXMB 3V72A 3MR3A 1RZMA 3RAMA 2JLGA 1NXIA 2JWNA 5CYMB 4OLBA 1K1QA 1CJVA 2FJ6A 2HIYA 4JI3K 3GIKA 4KTWA 1N5YA 1UPMB 3QEWA 5F41A 3DC2A 4NCBA 1LWXA 5AK5A 2KYZA 1HPZB 1QVGR 1F44A 3RSEA 3M30A 2MSNA 4JI0K 5GMEA 3SSRA 2B43A 3MX2A 2DGSA 4MFBA 4YOEA 1WYGA 4KRFA 3IGNA 4JI2J 1RT3B 5AQHA 2G0JA 1HPMA 1TKXA 2MY7A 5FRNA 4LSZB 3SQ0A 4M3XA 4LJMA 4E7KA 7FDRA 1Y00A 1A5VA 1VC0A 2L9WA 1BWEA 4U8VA 2QWOA 2IM2A 3EZOA 5KOXA 3MN9A 1ZM2A 4CF5A 2OP5A 4Z0UA 4I6YA 1RTJA 2DCUB 3AA4A 3C7NA 3EPIA 4DV0J 3HHLB 3HVWA 2D0PA 3KJNB 4AD6A 5IT0A 2XICA 1RA6A 4P0PA 3E1YA 2IVFB 1HUXA 2LQ8A 5J1EB 1Y11A 2W2OP 1SI9A 3HJFA 5I9EB 1ACMB 1RDCA 3OYAA 2NO5A 2JC0A 5AQIA 1FFVA 3QEPA 1KAYA 3C6TA 1RDWX 5IV4A 3I31A 3KBBA 3L2UA 1MN7A 2E1MC 2P9IB 1D8LA 3BJYA 1GT8A 2OKQA 3CCMS 3I0RA 1NUEA 2DISA 4W4MA 2F3JA 2MU2A 1FD2A 3PSIA 4AM6A 1RM6C 4E89A 4EUVA 4QW8A 1GX6A 3DHXA 2K7JA 4MF2A 2ZJRQ 1BC6A 2JWLA 3M5RA 2Q79A 1NGJA 3QIPB 4J5OA 2W6KA 2R8KA 4O3SA 5I42A 1UVLA 4Z37A 1NJYA 1P1TA 2KVQE 2VBWA 3W5XA 1UMJA 4IDKA 2J7KA 3EVOA 2HHSA 2DQNB 3LGMA 5ETKA 1ECWA 2G5HB 2K8CB 3DRYA 1VHFA 1JLBA 2RT3A 1JK9B 3G96A 5IFMA 1VSJA 2JOQA 1N32J 4N7TA 5J1NA 3SEIA 1SJ3P 4LFBK 2BKEA 4MDAA 5CHIA 5GAEP 2AT1B 3OHBA 3I28A 5FDLA 3VF0B 9ICMA 5ETTA 2UXBK 4Q2MA 1RDBA 4KLOA 1BOTO 5B0AA 4CJ4A 4CIGA 3IP0A 5KG1A 3AQOA 4OO1J 4DR5F 4USAA 4Q0BA 2AQ4A 1ZQHA 3U6FA 2O66A 2PMZD 1RXVA 1XQIA 1W0HA 2QLXA 5F3ZA 1RYRA 1YVUA 2AEFA 4FJ9A 5AM2A 2CQHA 5E3QA 2F63A 2VDIA 3CEDA 2KRRA 4I2DA 3M8PB 4Y2CA 4MIBA 4JKBA 3S6JA 4YUDA 1NM1A 3D7EO 2UXCJ 3SNNA 1HNZK 4F3MA 4HTJA 3X3UA 4ECZA 1I5OB 5AQUA 3ZI4A 1T8EA 3BSNA 4FWMA 3U26A 3OT9A 1XMQJ 3H1QA 2F9JA 3I32A 3BEGB 2V8PA 2B9YA 3LP0B 3V1OA 4LF4F 5J0QA 4W5QA 3WK9A 3MUVP 1YJRA 1RAJA 4RWXA 3V1RA 3OTOF 3ICXA 1S5LU 4IH6A 5F8MA 2WHOA 4K4GA 3K58A 2CPFA 4ZIVA 1PG5B 3CCSS 2IRXA 3LANA 4EBCA 4JI4K 3V81B 5F9NA 4USHA 1TFWA 3SPZA 1PZNA 2DNRA 1RAAB 4C1NK 1ZPVA 1LWEA 1M90O 5CYQA 4E3SA 2BE2A 4CD1A 4ELTA 2QI2A 1LW2A 1Q86T 2CIMA 1L3VA 4I56A 3PACA 1ZQWA 1IUJA 3THVA 2HGMA 2YKPA 3DU6A 2WONB 4F67A 3NCRA 1U8SA 1ZETA 4CFAA 4EYHB 5KL8B 3A5MC 4CK2A 3THTA 4FS2A 4FLUA 1NDLA 1X0PA 4NXMF 3U1LA 1WI8A 3WX8A 3OBWA 4FP9A 2DKZA 3F44A 2HAFA 1SWWA 3HBTA 5KFOA 1HQEB 2XNRA 1E4GT 3IBCB 1BQXA 4I6MA 3MK6A 2GC8A 3NVZA 2KN7A 4DQSA 3AODA 4RW6A 1XHZA 2LM1A 4ZOSA 1KBUA 3F0NA 4K5SA 3UMBA 2ZTEA 3OJUA 3QJPA 4GLXA 5H9EJ 2DHAA 2PDAA 1OH8A 3DCAA 3OL6A 3ULEA 1KAXA 1KOHA 2L9DA 2BANB 2XY6A 1K8KB 3DRPB 1WOOA 4RLEA 1RACB 2QA4N 4J9NA 2F76X 1ZQSA 3G87A 2GWKA 1FKPB 3V9SA 2Q31A 5AM1A 5IT4A 3VZHA 4OMFG 5B09A 5HL7Q 2VWKA 4FWSA 3CC4S 1CC8A 2HQCA 1ZQYA 2WFBA 3UCZP 2YNFB 5C0YA 4X62K 1V6HA 2FY8A 3NWRA 4WTOB 5C12A 3BSAA 4DSEA 3DXMA 4JLHA 4PHEA 4OYPA 1RDFA 3VQEA 2GQCA 2YNGB 7ICTA 3CC4N 1X6JA 3MAQA 5GAEI 5KT7A 3QUBA 5D15A 4O23A 2FSKA 2BCQA 2YWWA 1T02A 4AHTA 4AF1A 1IG8A 1HPZA 4KLTA 2KVIA 4QR1A 4QZ9A 1AUSL 2CDQA 4Y3CA 3O80A 1I94J 1NOZA 2MQPA 3R1HA 4AE5A 2GVZB 2XWXA 4WFAL 5C25A 2ZJPQ 2XM3A 5J0SA 2VYPA 1IJEB 4LVNP 3R9KA 5THWA 1VQLN 4JK7A 1TUUA 3JPRA 4RR5A 1FW6A 4FO0A 1XU4A 5ALSA 3W8PA 3NAIA 1NPRA 3RBEA 4DS5A 1VSMA 4CJ5A 2I8EA 3T1YK 2V9KA 1WEZA 5J2BA 4JNEA 4C48A 4J9UE 3LDQA 2CQPA 3SQGB 3KZBA 2W6LA 2F65A 4OPKA 4JI1F 1BE4A 4LZDA 3C46A 3SR6A 4QQBA 4LMZA 3DHWC 1NRKA 1S3XA 4DBQA 3AD7C 4NLGA 3CF5L 2AJ0A 1KXPA 1OSDA 1Y5IB 2BJ3A 1EARA 3MM5B 1HNIB 5ALHA 3JS9A 4CF4A 4ZP7A 1MMLA 3FMWA 4IBNA 2A6AA 4AM7A 2PFOA 1C1BB 2RILA 3NL0A 2EFPA 5A8KB 2XMUA 2I1QA 2YNHB 2RE2A 4KMOB 4YY3F 3AXMA 2YVSA 2H51B 4OQJA 2E1ZA 2QXLA 1S1UB 4LF8F 3UD4P 4DB3A 4BRHA 3P31A 1T4GA 3CD6S 1V3ZA 1QE1B 2F9WA 2P9IA 3VF4A 2RHQB 3CM6A 4F72A 4B1WB 4BVPA 4LD0A 4IRKA 5CH7B 1NMEB 1SXDA 2VOOA 2OD6A 4PG6A 4WQ4A 2MGZA 2GMJA 4O3PA 1TE2A 2B8PA 3NGDA 2K60A 2GJIA 5C15A 4GO5X 2RJZA 1RNHA 3I56S 5A8WB 4ETXA 3QIPA 4L3KA 2JLEA 4BRQA 2O8CB 2LU2A 1X0FA 3H0RB 5AQTA 1JL2A 3O3HA 4M5DB 2Z2ZA 4F5QA 3FLCO 3VR1A 4NLRA 4CEDA 4P72A 2M0GB 3H20A 4LSNB 2IOFA 3I56N 4FW1A 3CJAA 2XZDB 3L2RA 3TVZA 2QMXA 3QB0A 3FZFA 3QNMA 2OPPB 1X2IA 1IN0A 3NVYA 3F41A 1I3AA 1GOCA 4FNIA 1X5OA 4DI6A 3WT0A 1VRTB 4MAKA 3MM6B 1YLXA 3R6MA 3R97A 5HNKA 1S6PB 3MCPA 1Q7YO 4KLJA 3GFYA 1FJGF 1A5WA 2E8PA 1IG6A 2D3ZA 4YORA 3CCZA 1XUPO 2GMLA 4BC4A 5BPLA 3V7JA 1JNZB 2WK4A 4I2JA 3Q7BA 5J0XA 3ZX0A 2K06A 3BDEA 4FPBA 4DTUA 4X4RA 3UPQA 3W63A 3M8PA 4UOFA 4JBCA 2D0BA 4ED3A 2H4WB 2VQEK 1F2HA 3KK1B 1R89A 3NCIA 2KM8B 4WCEL 1EXQA 1X4BA 5L9NA 3IBWA 4LH5A 1S9EB 4YDXA 5E7OB 2DEIA 5HLFB 4BR7A 1TUYA 3A3OB 3Q8KA 3E2EA 3R6LB 3VQ6A 1IQTA 1FKAF 1WG4A 3NP5A 3JTNA 2ZM6J 3SQOP 3G4SN 2IOHA 3H90A 3LDOA 1D5AA 3UN5A 3A5LC 4KHWA 4DV3K 3H5UA 3AD9C 1DXSA 2WVBA 2XLJA 1YJ9S 4AQYK 2V6AA 2PSZA 4IS7A 4EO6A 3THPA 5LJVA 1IV8A 2EAOA 1NU4A 3MPYA 4H4MA 8ICGA 4B3TJ 3SIPB 3NH0A 2QL7B 2FMSA 4NLKA 3EDQB 4H0TB 2RKIA 4U7UK 2HBMA 4LFCJ 3CJ8A 2OLWA 4U7UD 4ZN3A 2YMPA 2WONA 4DXLA 1VCTA 5C24B 2BUNA 3I8DA 4DX5A 1OVQA 2W24A 3IGVA 2WC9A 2M88A 3HILA 2CQCA 2P6RA 1HWKA 1SV5B 3TU5A 1JXBA 3NF9A 4QIWC 4MLHA 7ICNA 4OJ3A 4BRGA 1VQ4S 1KTVA 4HVJA 2RDJA 1JXVA 1S48A 2DH7A 3O9RA 2BX6A 5EWEA 2AYMA 3BF3A 2D4WA 3HKZD 4YOTA 5KAFU 3JSMA 2BR0A 4PXCA 1ZBIA 3PYEA 3C1YA 4RUHA 2NPFA 2I6XA 3RRKA 3HSGA 3AVHA 3KVGA 4FJLA 3S7RA 3B0YA 1RQNA 1P8GA 5KPTA 3A8KA 1R6YA 4TU9A 5AQGA 3B54A 5AZIA 3DRPA 3TARA 4DQRA 1NJIT 3DDIA 3G6YA 4A8YA 4OYWA 4C4SA 5ALDA 3D2QA 1ZZFA 3TUPA 3A0IX 1M1HA 4FF2A 2ES6A 3OVBA 3QRRA 1KFTA 1NB2A 4YMNA 1H7XA 5IZHA 4OJ5A 3KFUF 3EW9A 1B4SA 1FK9B 3M2UB 3T5KA 2ZJQL 2BDUA 1V9OA 2UXDF 4OYOA 1KD1O 5A2QU 5BN8A 3AA8A 2YNGA 4BE1A 4PQUB 4EX6A 5ALMA 4USKA 4JI6J 2GEMA 1IBLK 3CMEN 4RBUA 4OD0A 2VQFF 4DR1K 1XWLA 4P7VA 4UB3A 2BPCA 4PXBA 3GP9A 4F7VA 1X4DA 5GADU 4WFBL 1BY9A 1XO1A 2MKKA 2AJFE 3EPGA 1TELA 4IFYA 4A8MP 4Q8FA 2LP4A 2D3O1 3R8EA 2FHOB 1U1RA 4GV9A 1ITGA 4FS1A 3ZEUB 4CJUA 2WHEA 5ALIA 2J4RA 5CR4A 1XK8A 5CEHA 3I6PA 3HOSA 4BWJA 2CGJA 2FBYA 2DO4A 4XDDA 2E1CA 4RQNA 1Q53A 2CXEA 2FLPA 1ZBSA 3HVTA 1ZQMA 3SV4A 5ALPA 1C1CB 3SQGA 4C0HA 4DS4A 5MAOA 4LF6F 1IR2A 4WP3A 2P5GA 2V8VA 4GMKA 2FHJA 2J0SD 3HVAA 1KL9A 3H5YA 1G99A 4FXWA 3CJ9A 3NEKA 4JI7J 4USIA 4Z6FA 1U47A 3MM5A 2DH8A 1HNIA 5CABA 1C1BA 3C1ZA 1DLOB 1WD6A 1PJ6A 5AQXA 4FJNA 3WHIA 4DV5F 3BB5A 4ZTFA 4I67A 3W2WA 4DV4F 4OYXA 3LM2A 3TZYA 5AM5A 1RISA 1QE1A 5HRRA 1CS4A 2FPHX 4IEIA 1XEZA 1SZ2A 4FM0A 3QBWA 2HQGA 2C3UA 4Y6IA 4QIWF 1KS2A 4ILJA 4EZ9A 3O4NA 4UW9A 2LQBA 2AA4A 1QTMA 2DFHA 3SAFA 5J0TA 4MF8A 3THWA 3TQ1A 3R3LA 3FCWA 4IYQA 1NH7A 1WBDA 5EWFA 9ICFA 7ICQA 2MLYA 4RU2A 5A8WA 2XI2A 7ICIA 2HOQA 3OYNA 2PI5A 4DTPA 1HW8A 1FFUA 2Y1IA 1IR1A 4RNHA 4CO1A 4FXDA 2D1CA 1O8BA 4M5DA 2EK1A 1XMOJ 4KN7A 4DHYA 5BRFA 1JCFA 4QBUA 3K9KA 5E3RA 1WUDA 3CQXA 1RYUA 4CZIA 3MFHA 3RJJA 4ILHA 1IJFB 2ATCB 3M9MB 1P27B 3PM9A 1WORA 4QS7A 2K4HA 3C21A 1HJPA 4TU7A 1JMSA 2OPPA 4E8UA 1N5SA 2ZH2A 1FJCA 4FZZA 3C94A 1VRTA 1RBUA 1VK8A 4BGAA 1RFQA 4ZOHC 3ZLJA 2FJEB 5KI6A 3N0VA 4GVBB 4NZ7A 1KC8O 4FK0A 2Z8QA 2O6KA 4A59A 1SV4A 5IT9O 4A8FA 1VQYA 4DFJA 2LMIA 3UD3P 3QNNA 4IR1A 3QSYB 3G8SA 4FWKA 1ZS6A 5HMWA 4GKKJ 3IR5B 2CJQA 3K57A 2BMBA 5J29A 2W41A 2JEGA 3IM8A 4A4JA 4FLVA 1VIOA 5C7PA 5H1SV 3EZUA 3T6JA 3KK1A 1VQ8S 4I9QA 1PC5A 3LGNA 3AO5A 4E1MA 4B9NA 3LAKA 1VYAA 3NH2A 1CJTB 4G6VB 5HLFA 2J7UA 5GADP 5FLXO 3WNFA 2W2MP 5GIOA 4NLDA 5B5EU 3BZCA 2KHOA 3NFAA 1SGGA 5GMKa 4O4RA 1GTHA 4UY8O 3C23A 4ED0A 1EAYC 2QXFA 1U25A 3GJTB 4DTXA 1C0TB 2P9NB 4HHHA 4KFBA 1CZBA 1ICEB 5IIOA 1F1BB 3GCXP 4NXZA 5KFYA 2YH1A 2FSJA 4J9LA 2QFJA 2C2KB 4M3YA 2GMHA 2LFVA 3CE8A 1U24A 4DQIA 3DJCA 2Q3SA 3AEVA 3TJ9A 3CC2S 2DNHA 3D67A 4C9DA 3SEOA 5BREA 3VQAA 1RT5B 2DTUA 5AXMA 3R5AA 5T7LB 1X66A 3W0LA 3ZSRA 4PGXA 4O4GB 1YRXA 4OZNA 4NEZA 2GH1A 4LY7A 1UWAA 3CJ7A 3MR5A 3GU3A 3UDLA 1PYTA 1IKXB 2DNZA 2RDDA 2E5SA 1RXOB 2E1AA 2H54B 4WF9L 1HJOA 1MA9B 3RBDA 1QHTA 3M8SA 3AVGA 1HW9A 4C4TA 3R5DA 4FCYA 2VUGA 2Z2YB 3UNYA 3ZYYX 1UPPA 4XQ8A 1TR0A 2JXJA 4NLSA 2A3JA 2DNMA 1GMWA 9ICQA 4C0BA 3EX7B 3QUTA 3U9ZA 3MWBA 1WHXA 4EI2A 1VOMA 2G8HA 4F5OA 1DY3A 5HQMA 4Z7YA 1ZQJA 4JKEA 1DK2A 2HQIA 3H0PA 3EE3A 2ZJRL 1HQUB 1S7HA 2UUCK 2CGKA 4GXIA 1K8AT 3UR0A 3CJ0A 1D9FA 4LT6A 1GMVA 3EM1A 1B22A 4JI5F 3D28A 3TUJC 4C3KA 2BGGA 1TL7A 1YF5L 3M2UA 2W2QP 4X5VA 1Q78A 1U1KA 1U6BA 1Q8LA 1QS4A 3ZSWA 4W5RA 2E3TA 1LK5A 3UXPA 1WSFA 4PQUA 3EGZA 1Z1BA 1OMSA 4CK1A 4X64F 2UVUA 3NTUA 3O3GA 4PQAA 4CZEA 4QIGA 1XNRF 4CHQA 2HOFA 1S12A 1UEVA 4ICAA 3RB0A 4CH1A 1LNQA 3NOCA 2MQ8A 4Y2PA 5B0EA 2OTLS 4CIOA 4FOEA 1AT1B 1XR7A 3U27A 4CLSA 4NY8A 3PLAA 2B6AB 3SDEB 4DPYA 2QWRA 4DUYK 4I69A 3MGHA 3FKBA 3Q89A 3VAKA 3PEJA 4TYAA 4TVAB 2EWHA 2YQ1A 3UXNA 1S9FA 1CJUB 2HEKA 2OFGX 2P6UA 3ZXWA 2MKHA 4A8WA 1QQ6A 4I2BA 4US9A 8ICXA 2CQBA 3OUYB 1JJ2M 1K9MT 2O4IA 4CNYA 3CMAS 1DTTA 5GADI 2FJVA 2WBRA 2BM0A 3VQ7A 1ZQTA 1ZD4A 4RQ4A 5AI0A 4DSJA 4JI3F 3RRHA 3CCWA 3M8YA 1VJ5A 5EE9A 4NLYA 4USUA 3B4MA 3KWIA 3IRXB 4DV1J 3GV5B 1HYSB 2W9BA 3CNQP 2KH9A 4FFDA 2DRBA 4XH1A 3CMAN 4J9QA 7ICUA 1X8DA 3ISNC 3IWNC 2D3DA 3C6UB 3OYHA 1AFIA 3HK2A 3TUZC 4NL9A 2E66A 3G6VA 4NRTA 3E3XA 4CTAB 1LK7A 2J0XA 4OJGA 2OPQB 4I6AA 3ENBA 1CQMA 2ZIUB 3DLBA 2ATLA 1Z05A 2O01C 5ETQA 2IMWP 1FRLA 2EFQA 5CD4H 3WXLA 3HW8A 2F8KA 4PGQA 3B82A 3UQSA 2WSEC 2OD4A 2UXCK 4AL5A 4EELA 5LJ3Y 4BC2A 2ODGA 3K7RA 2DWQA 1VBKA 1XMQK 3MABA 5JVHQ 2EH9A 3B78A 2H1YA 5DMRA 2JC1A 2AGOA 3R9LA 1K0VA 3BDPA 1AZSB 2AP6A 3UCGA 1N33F 1UOCA 4NLUA 3NGUA 3DEEA 4P75A 1HIYA 4B3RF 1RGVA 4CHYA 2GIFA 3ED5A 4M94A 2QE5A 4YHHK 1S8OA 3DOLB 2ZH5A 4PL8A 4J9OA 4AT1B 3Q8MA 6AT1B 1W9HA 4YDUA 2O8DB 4CRJA 4ANDA 2J0QD 2KJVA 2KE7A 4QPXA 9ICCA 2OJ3A 3K5PA 1BISA 2CUYA 3ZX3A 4GVBA 4DR4F 1KDNA 2P6SA 2CH5A 3OL7A 5K14A 1EQ0A 3QGPA 1YJUA 4HWIA 5HL7L 3TAFA 2KJ9A 1VBXA 1BA1A 9ICVA 3F2CA 1SB6A 1M6YA 2PMHA 4J9PA 4BG8A 3D54A 1RLCL 3VCDA 2AW0A 1RAIB 2C2NA 3HSZA 5J2GA 1FDBA 4CGHA 2KRBA 3HCXA 3L5KA 2HNYB 4CJRA 2DGXA 3OXGA 4QZEA 2DK2A 4H8KA 4DCCA 1CJTA 2FJDB 3QGIA 4LFBF 5H9EK 4AHCA 5I4MA 5L1KA 2CNOB 1N36F 3H8JA 2EQYA 3CCTA 2G8WA 3PY8A 4DV2F 1UAXA 2UUTA 4KPCA 4HH0A 4BRNA 3SQ2A 1SQEA 5KFAA 2UXBF 3MMCB 1BPEA 3KG0A 4FKXA 4DR6J 3PHEA 4X4PA 3A5NC 2P9NA 2PMZF 5SZTA 1RAGB 4DU7A 2RB7A 2WAQC 3SSSA 3HJVA 1WC4A 4C4WA 3M6XA 2OIHA 3U7JA 4XEIA 4OJRA 4OZ3A 2O8FB 2G4BA 4U7BA 1MSWD 1HYVA 3EDRB 9ICLA 3POTA 4FJIA 3OFGA 2LXUA 1UFWA 1UAWA 2IHNA 2CPXA 4YB5A 3NOGA 1NNDA 2CPYA 4IRCA 1N63A 1HNZF 2D8CA 3AA9A 5KFRA 1RT5A 2O4GA 4IG3B 1TFRA 1FXXA 3AMZA 5HHIA 1NKBA 3WXJA 4U95A </