4BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*CP*AP*TP*GP*CP*AP*A)-3')
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4bdpA01
1BL3A 1PZNA 4FM0A 1NK5A 2X74A 1JXBA 3DRRA 3PMNA 2IHNA 4YMOA 4OGEA 4OGCA 3MFIA 2W9CA 2VA8A 1UAXA 3FDSA 4HHTA 3TQ1A 1ZQWA 5KFOA 1LB2B 4E7HA 2W9MA 2OWOA 1T8EA 1D9DA 5EOZA 3JPPA 2W9AA 3ULDA 4M04A 7ICEA 4R66A 4JRPA 1O1WA 3C21A 9ICTA 4FYDA 2Z1IA 3KD1E 8ICZA 4K8XA 2OPRA 4DOBA 4AHTA 3IRXA 1QTMA 5HHHA 4DOAA 4C8NA 4BDZA 4CIFA 2FLPA 5KFZA 4JRQA 2B4JA 3V9XA 1XSPA 8ICRA 8ICQA 5KFUA 7ICTA 7ICOA 4CHQA 1BPDA 1BCOA 4KB1A 5J0YA 1LAVA 3DRPA 3AVIA 4M41A 1CXQA 4HUGA 3GILA 5CZ2A 4YFUA 4FW1A 3ISCA 1BCMA 3N4MB 1DLOA 5KFMA 4RT2A 3G6XA 5DLGA 4NYNA 4XA5A 3DLHA 4FVMA 4LD0A 3L3VA 4I2BA 4M0AA 3U3YA 4YR3A 3NBPA 2XY8A 2FPKA 4KFBA 4YR2A 4FBUA 1TFRA 1YTAA 4EEYA 1HMVA 3V6JA 4ED6A 4YN4A 4K8ZA 1ZQAA 1QSLA 5KFRA 4RW8A 1HYSA 9ICQA 1WSHA 3KLGA 4PY5A 3RH4A 3F9KA 1JLFA 1RBSA 1QS4A 4J9SA 8ICJA 4RQ8A 4RT3A 1BPEA 5HMLA 4C8OA 3PY8A 4FS2A 3IS9A 4I2HA 3NCIA 2W9BB 4UBCA 4LSNA 4I2QA 4DF8A 2NRXA 4EP4A 1UT8A 5C5JA 4Z4CA 5K14A 3NHGA 4UB5A 2OPSA 4M3TA 1A5VA 2PYLA 3EZ5A 4RNNA 3DLEA 5KFFA 2W8KA 4ECYA 3Q8SB 1Y88A 3MABA 1XC9A 1DTTA 1ZJNA 4CJSA 5KFXA 1KFSA 4FS1A 4KTQA 1R0AA 4FLZA 2M9NA 3AVGA 1EX4A 3CFPA 3ASMA 4P4PA 5CJ7A 4DFKA 1ZQQA 1QQCA 4KHNA 2YNGA 4CESA 5HHIA 3VA0A 4AHSA 4IBNA 2ZTCA 2KQ2A 4KPYA 4KV8A 3PUFA 3GV8B 5IIMA 1RYRA 3AVMA 3AVLA 1LV5A 1QLNA 1BPYA 5KG1A 4Z4IA 3ZSYA 1Z00B 3VQAA 1RXWA 3THVA 1X2IA 5KFLA 2R8KA 2F1IA 3OYCA 4EZ9A 1U9LA 1ZQDA 1VRTA 4F5RA 2B21A 1W0HA 1MSWD 3NGZA 2G8KA 3C1YA 4EYIB 1WCNA 2NUBA 4GXKA 1LWEA 4QW9A 2DFHA 5J0OA 5KRTA 2HW3A 4RQ6A 2AQ4A 3AO3A 2BPCA 1KFDA 3JPSA 3HYFA 3GDXA 1ZQPA 4YFKA 4KITB 4LZDA 3T5HA 3KLIA 1NOMA 2AQ0A 5DGBA 4UB2A 4AH9A 5J0TA 2FLLA 2Z1GA 8ICNA 4HCBA 9ICVA 2PFPA 2DPJA 3CQ8A 4NLNA 3HP9A 5C24A 4EBEA 3HVTA 4CK3A 4ZH4A 1T3NA 5F9LA 2FBTA 1RCHA 1S6QA 2A1RA 4QZDA 4M3RA 3VQCA 3AVJA 4RQ2A 2ZJ8A 3G6YA 5KG4A 3ZSXA 1ZJMA 1X9WA 4DOCA 4BACA 3PR4A 4B9SA 4CJKA 1G15A 4ZTJA 3RMCA 4CECA 2IOCA 1TAUA 1VSHA 2YNIA 4I2JA 3OS2A 5D3GA 4DL2A 2ISOA 5HROA 1ZBHA 1SUQA 3DMJA 5KI6A 4CHNA 1C0UA 2AJQA 4C8LA 8ICPA 3DLRA 3LP2A 3NFAA 1KTQA 8ICWA 3IAYA 2R8IA 1RYSA 4BWJA 3ETLA 5HRRA 4JV2A 2B6AA 1RDAA 3KKRA 3K5NA 4E7KA 3RAXA 4CJFA 4J9RA 5KFKA 5D4BA 1L3VA 3T5LA 1SKWA 1L5UA 1NJWA 3CM5A 4J2EA 3VQ9A 1UT5A 4M3XA 4ECZA 9ICWA 3OYMA 5BPCA 4Q44A 2IS3A 1N48A 4DSFA 4QZ8A 3G10A 3Q8PB 1FKOA 3C95A 5DLFA 5L1KA 2ZJAA 4I2AA 4CGFA 8ICIA 1MQ3A 2HHUA 4IQTA 3AVNA 3QEBZ 1AROP 4Z0UA 5HLFA 4PHEA 8ICAA 1B9FA 2Q0ZX 3PW0A 2HHXA 2YKNA 5J2DA 2BQUA 2Z1JA 3TFSA 3RBDA 4CFCA 4CK2A 3UXPA 2BCSA 4CEOA 3GIIA 3I0SA 5L1IA 3BQ2A 1Q8IA 1U49A 2OZSA 2BQ3A 4M9LA 3WNGA 3MGIA 1EETA 4KN4A 3C2LA 3B0XA 3ZDEA 2W8LA 2JZBB 4AHCA 2KZZA 4IFVA 2XHBA 2GWSA 5DBCA 1REVA 5BOMA 4F92B 4ECUA 2FPLA 4E1MA 1NK0A 3O4NA 3DOLA 3KJVA 4RNMA 1NKEA 2VWKA 3OYGA 3EY1A 1WN7A 2E6LA 1UA0A 2C28A 7ICQA 4N56A 3PV8A 4DO9A 2JEFA 3K5LA 2H5XA 1JXEA 4ELUA 4CEFA 4YQWA 3NAEA 8ICCA 1DTQA 2LSNA 2PFOA 1D5AA 3AA3A 1L3TA 3MGHA 3H4DA 9ICUA 3L2VA 2QKBA 4CGDA 1BHLA 2BE2A 1T05A 3KLHA 9ICFA 1S1UA 4DL3A 2F96A 4UAZA 5HMMA 1RBVA 9ICJA 1WNSA 1J54A 5KFYA 4Z4FA 4CEQA 4KLFA 4QZIA 1CEZA 2VA3A 1ZQSA 2PI5A 2AGOA 4KI6A 3RR8A 1JLAA 1U04A 1Q9XA 1NK7A 4KRFA 7ICNA 4R65A 1NK9A 3QINA 4IG0A 4CEDA 4Q8FA 2PY5A 4G3IA 4UAWA 1B43A 3KHLA 3HO1A 4BE0A 2J6UA 1TKTA 5CR0A 4CGIA 2P6RA 3PO4A 7ICKA 2A1JB 5DB8A 4MEYA 4TUPA 3GV7B 3UXOA 1VSKA 4R8UA 3V7KA 3IG1A 4EZ6A 4ID5A 1S0NA 3AO1A 1B9DA 4FM2A 5J2AA 3SQ4A 4ED0A 5KGWA 4XRHA 4DTXA 3IHQB 3QEAZ 4FJ8A 4FXDA 1BPBA 1ZBFA 4QW8A 4LZGA 4ED7A 4FJXA 4KLHA 1S9EA 1K1QA 7ICPA 5TZVA 2XCAA 4GXIA 1VSLA 4ECWA 1HJPA 5HP4A 3S9HA 2KN7A 4QZEA 3V4IA 2G8UA 3V9WA 4DL4A 3OYAA 1IM4A 4TUSA 4OLBA 1RT1A 4K4IA 4FLTA 2UVUA 3SQ1A 3SPZA 1NK6A 3RTVA 4TUQA 5HP1A 4F5OA 1RNHA 3MXJA 2C22A 1A5XA 9ICIA 5I42A 1RT7A 3MR6A 4M47A 5J2MA 1ZQTA 4DTMA 4UB3A 2J6SA 4B3OA 1SKSA 3JYTA 1ASWA 3LZIA 3HPOA 3L2WA 2PFQA 3NF9A 4J9LA 1S1WA 8ICOA 4FBTA 1SKRA 5KG3A 4W5RA 4KLJA 3UQ2A 1LWCA 1X9MA 1IKVA 2QK9A 7ICHA 1NOYA 8ICSA 3AO5A 4HUFA 4N41A 1ZQIA 1QSSA 4JV0A 4GW6A 4F5PA 2BPFA 4RQ4A 4ED1A 1J9AA 3LANA 4YCXA 3VQ6A 3SUNA 1K6YA 2IAJA 4FZXC 4RZRA 4PGYA 1S1XA 3VQDA 4KLQA 2WTFA 2FBYA 5KG0A 3OJSA 1BIZA 2BQRA 5J2HA 1KVAA 3C6TA 1T7PA 9ICKA 4ELVA 3UIQA 5KTQA 8ICTA 2X78A 8ICMA 3B6PA 2E4LA 5DQHA 3KK2A 4FJKA 4QZHA 1SZPA 2C2DA 1ZQFA 3TAFA 4NY8A 5J2FA 4FJ9A 1F21A 4M6WA 4XQ8A 5J2PA 3PO5A 1VSMA 3G0ZA 2XRIA 4O5BA 2I9GA 1ZQMA 1C0TA 4HYKA 4MF2A 1TK8A 4DLGA 4W5OA 4BE1A 1QSYA 3P5JA 4KLDA 2R8JA 5DDMA 5HBMA 4E19A 5DDYA 5KFDA 2BKEA 5KFEA 1ZQBA 1HRHA 4UAYA 3QETA 3ZSVA 1J5OA 4YMNA 1JIHA 4FLVA 1XI1A 1KEJA 4PH5A 1SL2A 4IQVA 4E7LA 2G8WA 1HQUA 2ALZA 3KD5E 4ECQA 4B9TA 2Q3SA 1BIUA 4CFAA 4DFPA 5JS2A 4DQSA 2YHAA 3QIPA 4JS4A 2JEJA 4AHRA 4CIEA 1NOZA 4ECTA 4NLZA 3AA5X 1ZQXA 1SV5A 1A76A 1ZQOA 4MFBA 2IHMA 9ICPA 1KDHA 1S6PA 5DBBA 3SV3A 4NCBA 4E0DA 4CE9A 5KFIA 4FLYA 4NCAA 3C23A 3EW9A 3M9NB 1IKXA 1VSIA 3HPGA 1U4BA 4FK0A 3V7JA 1NJXA 7ICLA 1BI4A 4E3SA 2ISPA 3BQ0A 4GC6A 3S3MA 3JPRA 4M9HA 3Q8LA 5KFAA 4ICLA 2OPPA 7ICIA 4CJWA 4GLXA 1XU4A 3AU6A 4Z4HA 1MC8A 5J2QA 7ICGA 3OSPA 3ZDDA 2P51A 1RBUA 4KMUA 3MR5A 4BE2A 4CFBA 2ATLA 3K75D 2HVHA 5J0RA 1DOQA 4BXOB 1ZQYA 3CYMA 1ASVA 5IINA 2O4GA 1RT4A 4KTWA 2I1QA 3DLBA 3K5OA 3H8JA 4Y1DA 5C42A 2JEIA 4UB4A 9ICSA 2WOMA 2EHGA 4GC7A 3VQ5A 3ORYA 1DGSA 4N47A 2DFEA 2IDOA 3QO9A 1ZBLA 2E6MA 4M9GA 4CEBA 3LDAA 3FYHA 1TGOA 5EWGA 4ED8A 4CHZA 1J53A 1WAFA 3O3FA 4YR0A 4DQRA 4J9KA 2J6TA 4DTRA 1KSPA 1KFTA 2VANA 2OA8A 3MFHA 3MBYA 2HVIA 1RTHA 1WLJA 5FDLA 5CZ1A 1C0MA 3ZD9A 5IIIA 5SWMA 5JS1A 2IBKA 1JLEA 2HNYA 3C94A 2D0AA 3O3HA 3HWTA 1TV9A 3RRHA 5DG7A 3JPQA 1EXQA 2G8HA 1BGXT 3K4GA 4C8MA 4DTOA 5KFJA 4HTUA 5KFBA 4J9QA 1RBRA 1LAWA 4RNOA 3VQ8A 3A2FA 4CEAA 2HMIA 2ZE2A 1ZQCA 4Z6CA 1ZBIA 4Z4EA 4JK1A 5KGXA 4F4ZA 3HM9A 3O4QA 3ISBA 4IG3A 1FKPA 2D5RA 4PHAA 4O3SA 3AV9A 4B08A 2FBVA 4O44A 4JWNA 5DMRA 2PXIA 4MF8A 3V81A 1S10A 1NJYA 1TK0A 9ICAA 4KAZA 2ZD1A 3ZSQA 3EPIA 4KKOA 1JLCA 1C6VA 4N5SA 4F5NA 4C8KA 3QEVA 4P4MA 4PHPA 4Q43A 4KLLA 3AVAA 1D8YA 4KLEA 4QZCA 3KHRA 1HNVA 5KG6A 2DTUA 1JL1A 2W9CB 1X9SA 1C7YA 3AO4A 2W42A 4M3UA 3RH6A 2MAXA 3NF6A 5KFHA 1XO1A 2LYHA 4LH5A 1HUOA 4NM2A 4IKFA 2RDJA 4JUZA 2YNHA 4MFFA 4E89A 3KTQA 4W5QA 3SI6A 5KFGA 3NH1A 3RH5A 3H8WA 4M42A 3HXMA 1S97A 2F1JA 3ZT3A 4PPXA 3VQQA 4CF9A 3HJFA 2BGWA 5HRSA 3GIMA 3M8RA 4YXJA 1S9FA 3M9OB 3L2UA 4EBDA 3N97B 4J2DA 1MU2A 4Z4GA 3GIJA 3HPHA 2DFLA 4M45A 4HVJA 3OS0A 1UA1A 4I9LA 8ICBA 3LP0A 1S0VA 4I29A 2G8IA 5J0QA 4F5QA 4QZ9A 1RT2A 1ZBUA 3PW5A 3LDSA 1JMSA 1BI4B 4PGQA 1XSNA 2FBXA 2ZUBA 4DQQA 4CEEA 1Z25A 1ZQRA 4PHDA 1RZTA 3SNNA 4ECXA 4EYHB 4RG8A 4NLKA 5J2EA 1S5JA 4KHQA 4F4YA 2O4IA 4IQUA 4QZGA 4CGGA 4DMNA 3L8BA 4IDKA 3NGDA 3V7LA 1NK4A 3VQ4A 5DQGA 1RDDA 7ICFA 4TQSA 2FPMA 4DEZA 1HUZA 4L8RB 1H38A 4G1QA 2ASLA 1ZQGA 2PFNA 2PYJA 3I0RA 3ZCMA 1RPLA 2UVRA 3MXMA 1FXXA 4FK2A 2ZTEA 1ZQUA 5J0WA 1RT6A 1ZETA 4I2EA 5KT3A 4I2PA 2HHTA 5IIKA 4CJPA 2YKMA 2Y1IA 4RPXA 1UOCA 4CHYA 1WCLA 4BDYA 1YTUA 3JSMA 4F93B 2FMPA 1GOAA 7ICMA 4IR9A 3EPGA 3C5GA 4CJVA 5C25A 5J2IA 2ASJA 1JL2A 2BCUA 1TK5A 3SUQA 4NM1A 3HW8A 3RB4A 4CJ4A 4RQ0A 3ISNC 1B92A 4F91B 4CJUA 2BCQA 4DTJA 1GOCA 4FK4A 5J29A 2KTQA 2KFZA 1N6QA 5J2NA 3QZ8A 2WONA 4CHOA 4O9MA 4B8CA 4R5PA 4H4MA 2VG6A 3RJFA 3NE6A 3DOKA 1RT5A 4DQPA 4QOZB 3TWHA 3E01A 3ZT0A 1IKWA 3AVBA 4Q5VA 5KT6A 1WSFA 4RU9A 3MAQA 3ZSZA 3NH2A 2VG7A 4O5CA 3MDAA 3D0PA 3LALA 4J9MA 2BPGA 2XO7A 2MUTA 4FW2A 4KREA 1Z26A 8ICYA 4DQIA 5BOLA 2YHBA 4TQRA 8ICUA 3V9UA 4RPZA 3ZDAA 5CP2A 4FJJA 4UQGA 3PW4A 3RJEA 4B9VA 1HJRA 1NKCA 3ZDBA 2R7YA 3OS1A 2IA6A 3L3UA 3Q8QB 3PW2A 4F3OA 7ICJA 3QE9Y 2JEGA 4KHWA 5FRNA 4IRDA 3V6KA 3F73A 4KHSA 1S1TA 2Y1JA 5D46A 2PI4A 3JPNA 1Z3EB 3ZSRA 4I7FA 2P6UA 2PZSA 3V1OA 8ICFA 1CLQA 3ZSOA 4H4OA 2IGIA 1CZ9A 4QAGA 3HVRA 4MEXA 1GOBA 1KLMA 5KT2A 3OYEA 1WAJA 4KLTA 4DTSA 1BVSA 3BQTA 4ZTFA 4M3WA 1ZYQA 5EWEA 3KK1A 4MFAA 2HHSA 4M3ZA 1Q9YA 4RPYA 3HL8A 2GUIA 4Q0BA 3VQ7A 3V1QA 2HHQA 4YVZA 4KLSA 1ITGA 4JWMA 3TAGA 4R63A 3T19A 3K57A 3AVCA 1N5YA 5DB9A 9ICNA 4OPJA 4MFCA 1RT3A 3VQEA 3SJJA 4CJEA 4Q45A 4P2HA 2W9BA 3PX4A 4KLUA 4CF0A 1HQEA 4QWEA 4LH4A 1D8LA 4CJRA 3RMDA 2BCRA 4OVLA 3Q8MA 5J0SA 1JN3A 3MECA 4FLWA 2FMSA 3UQ0A 3DRSA 2NRWA 5J0UA 2DPIA 2C2RA 4AHUA 3DLGA 4E1NA 4KTZA 3HSTB 2OPQA 1KRPA 3K2PA 2P5GA 3BQ1A 4NLGA 2HNDA 3L2RA 2R8HA 4DL7A 1QHTA 4DSIA 4M3YA 3U6FA 4F4XA 2FC0A 3V6DA 5KT4A 1QE1A 1X1PA 3GFKB 3MR2A 1VK0A 2BR0A 1U47A 4Z6DA 4Z6FA 1KCFA 1TKXA 3WNFA 1RXVA 9ICGA 3OYKA 3LWLA 3DLKA 1RBTA 1Z00A 4QZBA 1KLNA 4FZZA 1W9HA 5L9XA 3SCXA 1BQMA 1RILA 3RR7A 2BDPA 4O5KA 4XIUA 1JXLA 2VA2A 3H08A 3AA4A 3AU2A 4I2IA 4JLHA 3QEWA 3GQCA 3TARA 4ELTA 9ICCA 5DB7A 4NXZA 4O0JA 1JLBA 1WSIA 3RBEA 2IMWP 5DK5A 3ZDCA 1HNIA 3RAQA 5J0PA 3OYLA 4J2BA 5DQIA 4DU4A 1L3UA 2V9WA 7ICSA 4FJ5A 1LWFA 1CZBA 4I2DA 9ICHA 1HYVA 4GXJA 2ITGA 5KT5A 3SYZA 3DI6A 4J9OA 4CERA 4OJRA 3QNNA 4P4OA 4IRKA 4YD1A 2XY7A 2DFFA 5CHGA 1BPZA 4KB0A 2D0CA 1RTDA 4CF8A 4DS4A 4M9JA 4PUOA 4J9PA 2MUTB 1JLQA 1IG9A 3HT3A 4FJ7A 4GVMA 5J2JA 2JGUA 3NTUA 3QLHA 1COOA 5J2BA 3PNCA 8ICLA 5DG8A 4DSLA 4FJMA 3H40A 4GMJB 4R8UB 1ZQHA 1TL3A 2XC9A 3C5FA 4B9LA 2IC3A 3LP3A 4YNQA 2P5OA 1WSGA 4RW6A 3NGIA 3LP1A 3LWMA 4OPKA 4QZFA 2BANA 1U48A 1CUKA 4O55A 3H8SA 4I2FA 1VSFA 3NGYA 5IILA 4QWBA 3M8QA 3ZT1A 3E2EA 2GBZA 4XUSA 1SL1A 3SI8A 3UPQA 3K58A 1XS9D 1TKDA 3OYFA 2GV9A 5CB1A 4ECSA 3TAPA 3IM1A 2F8SA 3KK3A 3ZD8A 3WNHA 4I28A 1JX4A 3OYJA 3SPYA 4DTNA 3RRGA 1ZQZA 1WSEA 4H8KA 2ZUCA 1N56A 3AO2A 4DU1A 2KZMA 3QERA 5SZTA 3RB3A 2BCVA 1EP4A 3TAQA 3NF7A 3V1RA 3FFIA 5DG9A 4KN7A 3G6VA 9ICRA 2HHWA 4FO6A 1RDBA 4F8RA 3O3GA 4KLGA 4I27A 3V9ZA 2JZBA 5E41A 4I2GA 4TSXA 1ZQJA 1XWLA 1TL1A 4DFJA 3M8SA 2ZUDA 4IR1A 5KG5A 3HP6A 3ITHA 4F4KA 5FRMA 3RMBA 4RW7A 3WNEA 4FM1A 3RJGA 3TABA 3CFOA 5KFWA 3M8PA 1BPXA 1RTIA 8ICEA 4F4WA 3GIKA 4DSKA 3NH0A 3KIOA 2HHVA 3MEGA 1TKZA 1XHZA 4PA1A 1L3SA 4DTUA 3PMLA 4LY7A 1TAQA 3H7IA 4M9NA 2G8FA 3V72A 1U45A 4NYFA 3TR8A 4IFYA 1IKYA 4CF1A 1RTJA 5KT7A 5CY4A 4CJQA 4ECVA 7ICUA 4I9QA 4M6WB 4BGDA 4UB1A 3QZ7A 3VN5A 4KI4A 3JPTA 2AGPA 3B0YA 1CXUA 9ICBA 2C2EA 2FLNA 3S3OA 1BQNA 2RN2A 2XY6A 1EKEA 2R8GA 3TANA 2P1JA 3VQPA 9ICMA 5KFVA 1S76D 3V9SA 3C2MA 5J2CA 1EXNA 2HNZA 4DFMA 3TAMA 4CEZA 5CA7A 3U3GA 4DS5A 3LPUA 4RUCA 3SUOA 3MXIA 4KLMA 3KKSA 4CJ5A 1Y97A 2A1JA 4B9NA 2XGPA 4F3TA 5KRSA 2FMQA 1TVRA 3RMAA 5KFCA 4O0IA 2VWJA 3OYDA 5FROA 1T03A 4QZAA 3ZT2A 4CJ3A 1WSJA 1ZQVA 3PX6A 5IIOA 5DB6A 3M9MB 3ALYA 4O3QA 4DLEA 1JLGA 4RW4A 3KHGA 4CJTA 4F2SA 4O3RA 3QNOA 4RQ3A 2RF2A 5J2KA 4AILC 4DF4A 2AU0A 4JS5A 5CYQA 4O3PA 2ATQA 1HPZA 1SL0A 3ZT4A 3P83D 3RWUA 5KFQA 4KLIA 1VSDA 5KFNA 3AVKA 1C1BA 1ZQKA 3P1GA 4OKJA 4B8AB 1I3AA 5I3UA 3VA3A 3T5KA 2F1HA 1TVAA 4IQWA 4NCGA 1LW2A 2QKKA 5EWFA 4FJHA 3VQBA 4DL6A 5JUMA 4TURA 4HCCA 4BWMA 4CIGA 3NDKA 4OKEA 4RQ5A 2NRZA 4FCYA 3PR5B 3LK9A 4LSLA 5DGAA 1A5WA 5L1JA 3TI0A 4ED3A 1RDCA 4QWCA 2OYQA 1BISA 4OLAA 4KO0A 5KG2A 2XY5A 3RB6A 3AVFA 2VG5A 4EP5A 4F2RA 3OY9A 4FJIA 2DY4A 4K4HA 2ETJA 2ZTDA 2BGGA 3PVXA 3SZ2A 9ICEA 2RKIA 3OHAA 1C1AA 3K59A 2RDIA 5HRPA 5DBAA 4FLXA 1S77D 3QIOA 3V6HA 3T3FA 2Z1HA 1K1SA 3OGUA 4B9MA 2G8VA 4DU3A 4DL5A 3OYIA 4OKKA 3AA2A 4JV1A 3SQ2A 3BGRA 4W5NA 5EU7A 1IO2A 1XSLA 1KVCA 3HK2A 4KLOA 4Y1CA 4Z6EA 4QWDA 2F8TA 4DSEA 3CFRA 2ZQBA 4PWDA 7ICVA 4WE1A 4HUEA 3H4BA 3SUPA 4KHUA 4R64A 4E7IA 2YV0X 3T1AA 3Q8KA 1NJZA 3B6OA 3MEEA 5DKWA 1ASUA 2EX3A 1A77A 5L1LA 4IRCA 3BDPA 3RJHA 5J0XA 1NK8A 2AGQA 4QWAA 4YD2A 4BDPA 2ZJ5A 3HX0A 1B22A 3ZSWA 2NRTA 5D49A 2V4RA 4E7JA 3EYZA 9ICLA 4RQ1A 3PW7A 4ECRA 4CFDA 5CYMA 3QESA 2ASDA 4N76A 1ZQEA 2X6SA 4YG2A 3CM6A 2YNFA 4CF2A 3KLFA 2B5JA 3OHBA 3OJUA 7ICRA 4RW9A 3KHHA 2BHNA 3OVNA 3QEPA 2KFNA 5HNKA 4CGJA 4DG1A 2XGQA 1HYZA 4KHYA 1VRUA 4LVSA 3I8DA 5IIJA 3T5JA 2KZ3A 1V9PA 1XHXA 3EWAA 3BJYA 4J9NA 8ICVA 1VSJA 3SQ0A 1T4GA 3S3NA 1FK9A 4FJLA 4RUAA 5KG7A 4FJNA 3OYNA 4QCLA 4DWIA 1MQ2A 1NKBA 3D45A 5KFPA 9ICOA 1IH7A 3MEDA 1YVUA 3ISDA 8ICKA 2XCPA 4YP3A 3OYBA 2D0BA 8ICHA 3LZJA 3RJKA 3LAKA 4EBCA 1D9FA 1UWBA 4O3NA 4RQ7A 3SV4A 3QEXA 4W5TA 2UVWA 4MQ3A 9ICXA 4BXOA 3C6UA 2X6NA 4CCHA 3AVHA 5CWRA 3UXNA 5J1EA 2QXFA 1LW0A 3L2QA 4K4GA 4Q8EA 4PQUA 2V4QA 5J2GA 4O3OA 1ZQLA 4O4GA 3TFRA 2HB5A 2UVVA 3MDCA 3RB0A 5T7BA 4DTPA 3NF8A 4B9UA 1KVBA 4PGXA 4ZHRA 3OSNA 3PX0A 4ID1A 4J2AA 3KLEA 4FZYA 1JKHA 4FLUA 1VSEA 3RJJA 3C1ZA 3MR3A 2P66A 4M2YA 4AHVA 5F9NA 2OZMA 3RJIA 3K5MA 4YXMA 2NRVA 4CJLA 3TAEA 5HRNA 1TV6A 1ZQNA 2KW4A 3DYAA 2A1SA 1C1CA 4X5VA 2JLEA 4FJGA 4DSJA 4F50A 2I5JA 3AUOA 4ED2A 3QEIA 3CG7A 1S0MA 3OYHA 1YT3A 3C2KA 8ICGA 3GV5B 3LPTA 2RPIA 1S0OA 3JPOA 5KFTA 1S9GA 5KFSA 4UBBA 1IXRA 4O5EA 1I39A 4I2CA 4YMMA 3Q8RB 3DM2A 4CK1A 8ICXA 3LAMA 1S1VA 4CGHA 4CHPA
chains in the Genus database with same CATH superfamily
1BL3A 1YSJA 1Z1BA 5LMUJ 2X74A 1JXBA 1GXLA 1RAEB 3DRRA 1IN0A 4DL0C 3PMNA 1G2EA 2W1BA 2ZITA 3H2UB 3L3CA 2HCFA 3W9HA 1UAXA 2ZBRA 1GX6A 2CZ9A 4QU6A 2FHMA 2DNHA 2HVDA 3PEHA 3MR7A 1H2TZ 2DNRA 3NKYA 3E66A 2IVOA 1P1LA 2MQPA 2ROEA 2W9AA 1VK3A 3ULDA 4U7CA 4FYDA 3KNAA 3KD1E 8ICZA 4IOCQ 3C65A 2OPRA 4DOBA 2NQPA 3IRXA 3VGLA 4AHTA 4C8NA 1KD1T 4BDZA 3MC1A 2V8VA 4DR6F 3V9XA 3JB9k 2Q97A 5CQGA 2E5IA 5H1SV 8ICRA 2VFVA 2BZ2A 3CCZA 2A10A 4KBIA 4RNFA 4DG1B 1OS5A 4FXVA 4RWTA 1BCOA 1QVGM 4KB1A 1R8HA 3AVIA 4I7FB 4WYLA 4HUGA 4U7UK 5AQHA 3NRBA 3TQEA 2ZH3A 3ONNA 4HAIA 1DLOA 2XZDB 1KAZA 3G6XA 4LD0A 3L3VA 2KVQE 2RLTA 3U3YA 5GAEI 2GUPA 2XY8A 2FPKA 1RE1B 4KFBA 2QE5A 1TFRA 1U8WA 4USIA 1HMVA 3V6JA 4YN4A 3GOIA 1QSLA 2HWHA 4PQAA 3UVJA 5KFRA 3JSYA 3ICXA 9ATCB 1WSHA 3FUYA 1VQ8S 3F9KA 3QWPA 1T9WA 1RBSA 4R0JA 5AI9A 4J9SA 8ICJA 3HVAA 1RT3B 2DY9A 2FIUA 2CNLB 2RVJA 4RT3A 5CABA 3J81O 4WYBA 3HJVA 2Q43A 1CC8A 3IS9A 1YXQA 2HHHF 5AM4A 2NXUA 2LXUA 2QX0A 3NHGA 4UB5A 2V9KA 3OL6A 2FZCB 4OL8A 3MM5A 3HFZB 1H6KX 1X4BA 4RNNA 5KFFA 1NU0A 4UT4A 4FF3A 4G1PA 5KFXA 1KFSA 3FMWA 1F3FA 2DH8A 4KTQA 1R0AA 4A61A 4I6AA 2M9NA 1CRXA 1EX4A 1UJ5A 2KE7A 4IKAA 2F8EX 1U2VA 4LBPA 4PZVA 2FI1A 2IOFK 1TE2A 1HD1A 1ZQQA 4KHNA 3P39A 2VPXB 4YOXA 2HNDB 3RVCA 3VA0A 2F44A 2Q66A 3OVSA 4IBNA 1PVRA 4PG4A 2OXOA 3JTPA 2PAVA 4CO0A 3LDLA 3BGUA 5HVFA 4ZKAA 1VISA 1ZAVA 4P7TA 2CPXA 4UOHA 1RYRA 3TTDA 1QLNA 1BPYA 4Z4IA 1YVFA 4BC3A 2H4WB 3VF0B 2F4FA 2KVIA 1FDDA 1X2IA 5KFLA 3H3OB 1BQMB 2I5JB 4EZ9A 4DR1J 3GG0A 2LMIA 4ID8A 1V5VA 1Q81T 4PZOA 1F3VA 2P9GA 3OFFA 2B21A 3R5CA 4URQU 3GFHA 3LW5C 1W0HA 1S7IA 1MSWD 2P9PA 4EYIB 4X4PA 2NUBA 2KKPA 1RU2A 2EFQA 4ZA1A 4GVEA 1LWFB 4UAVA 3OFHA 1Q4RA 1S1VB 4UY8T 1JJ2R 1AUDA 5ALGA 4YFKA 4DR5J 4P2MA 1B7YB 3IG5A 3KLIA 3QYPA 3DRRB 2AQ0A 5DGBA 1NOMA 4F0MA 3N7SC 2CPYA 1T6DA 3FZ2A 5F3ZA 5J0TA 2FLLA 4LQ9A 2PFPA 2DPJA 1U1NA 4EBEA 4K4SA 3HVTA 4CNZA 4ZP7A 2NXEA 2HMXA 2E5SA 2CQGA 2PBDA 4ZH4A 5F9LA 4DR4K 2AJ0A 1D09B 3VQCA 5EVZA 1YLXA 4RQ2A 1PJ6A 3CERA 3G6YA 3VPZA 4DZ6A 4CLTA 2A3VA 3ZSXA 3CSKA 1ZJMA 4BACA 4B1UB 4CJKA 1BXNA 4IOCL 2HSEB 3B78A 4CECA 1OMSA 1U1OA 2VWBA 4N8OA 3ZX3A 3EGNA 3IRXB 5AXKA 5HROA 3KZXA 1HNXK 4CLKA 4CHNA 1T9XA 3R7BB 2AJQA 2OFGX 4M5KA 2BUNA 4JKHA 1KTQA 2BANB 2R8IA 4BWJA 3ETLA 5KQ8A 5TKYA 4JV2A 5L9NA 3KKRA 3K5NA 4E7KA 4CJFA 5KFKA 4K4XA 4PWWA 1L3VA 4LVNP 4OX8A 3HSZA 1PC4A 5KQDA 2I2YA 2O8BA 3PHEA 4YDUC 2XB2D 4BHQA 9ICWA 4Q44A 4IH5A 4F36A 4KFBB 4DSFA 4QZ8A 3PM9A 3C95A 4WCEL 1HMVB 4YB5A 2ZJAA 2JFDA 4BROA 3UVJB 3A5NC 1VQ9S 1XMQF 2OFHX 4WPAA 1AROP 5HLFA 5AJ3J 2DPNA 1B9FA 3PW0A 2MKHA 3CEDA 2YKNA 2WBNA 3TFSA 5L46A 3AA9A 2P9EA 4OV6A 1EP4B 4DPTA 1M90O 5HR7A 3I0SA 3FEZA 3F2KA 1U49A 2WF6A 2BQ3A 4M9LA 3MGIA 3IBWA 5HAOA 3MM5B 3OVBA 3ZDEA 4AHCA 2XM3A 1FNOA 2KZZA 3SQOP 4IFVA 2XHBA 1VHIA 4C6AA 5DBCA 3S1TA 1WSVA 4E1MA 1NK0A 4B02A 3K5PA 2DNMA 3O4NA 2A18A 5ETLA 2ZOMA 2Q1NA 2FHJD 5HQMA 2RRNA 1IG8A 1WEYA 2OD4A 1UA0A 2C28A 7ICQA 3TO8A 2NYIA 4DO9A 5EY4A 1VQKN 4V19S 1RJJA 4CEFA 2QA2A 8ICCA 1N54B 5L1MA 1N5VA 1NRKA 1PIEA 3DXKB 4LF6K 3H4DA 2VASA 3L2VA 1DRGA 4CGDA 4IFYB 2WAQC 1RP5A 2W25A 9ICFA 2UU9K 2F96A 2DJWA 4UAZA 1J54A 4BRKA 5KFYA 3O4WA 2P35A 1LOUA 4KLFA 2KL8A 4KI6A 2JGAA 2ZG6A 1JLAA 5AM2A 2E9ZA 2XI9A 1Q9XA 3K8WA 3DLJA 2FVRA 5AKKA 3QINA 3UR0A 1SXEA 4DN9A 3SXLA 4Q8FA 1CPZA 3OHRA 2PY5A 4G3IA 1PK1A 2FY8A 3O44A 2G2ZA 3CCES 2D9PA 2P6RA 1UPHA 3KD3A 4BRNA 3GV7B 3AAQA 2J5AA 1HBUB 3CT9A 2LDYA 5A6WA 2IIRA 3I87A 4DV0K 1TUWA 1B9DA 4X66K 3SQ4A 7FD1A 4ED0A 3K9KA 3QEAZ 5AQRA 5A8WA 2Z2LA 5FLXO 2EBGA 4KLHA 2YN4A 1R6YA 1PAEX 2J8SA 4NXMK 4GXIA 1FFSB 2GO8A 5HP4A 4NLQA 3FVYA 3P38A 2KN7A 3OW2R 1AYEA 4JAXA 5HROB 2G8UA 1UVMA 2DKZA 3OYAA 1R0BG 2NPIA 3PNIA 2YHXA 1RWUA 2E8PA 1NPKA 1T9TA 1NDCA 2NSBA 3EVWA 3V5RA 4U8VA 1C1BB 1NK6A 2LM4A 1OYDA 3HCXA 3B82A 1GLLO 3GYGA 4F5OA 3CULA 2AV5A 4A8XA 1RDRA 4OHWA 4YB6A 2DWQA 9ICIA 3VTIA 1R8AA 1WSRA 3MR6A 2W7OA 4M47A 5J2MA 2KG1A 2GJ2A 4B3OA 2MLYA 2NLWA 1VQKS 5AR0A 1Z4UA 1A6LA 2B4VA 3LZIA 3L2WA 2PFQA 5LM7E 1PBAA 4J9LA 3HOTA 1SKRA 2RMLA 4W5RA 1DARA 3L95X 4H54A 4HT7A 3AD7C 2Q79A 3UQ2A 4DR5F 1LWCA 3R8EA 2K8BB 1IBKJ 2QK9A 7ICHA 1NOYA 8ICSA 4MKYA 2F8KA 4KO0B 4F71A 1ZQIA 5D4PA 3MMAA 1AFIA 2FSKA 4JV0A 1FT8A 1ZM9A 1FF2A 2VG5B 3M4XA 3K9JA 4NLYA 1J9AA 1R27B 3C3LA 3KUEA 2O8CB 3PIPL 1NJIO 1ECWA 4LBIA 3VQDA 2FBYA 5KG0A 2FJDB 3OJSA 4GO7X 5HO4A 1BIZA 1KVAA 5AT1B 4B3SF 2LYBA 2PA3A 2C1EB 2X78A 3WKEA 1OKJA 4A62A 2E2QA 1KOOA 4B1VA 4MT1A 1ZQFA 1YJWN 4FJ9A 3D54A 3IFRA 1OH7A 3HHDA 3GFZA 4YOTA 2K3IA 1VS3A 4GKJF 2ZVIA 3C14B 2VIXA 1Y10A 3PYFA 3VEOA 1VAZA 1SCJB 4U9RA 4DLGA 3SBMA 1QSYA 2WB4A 2YVSA 5JTIA 4KLDA 3U9ZA 4O23A 2R8JA 4E19A 3LF0A 5KFEA 3J7AN 3EX7B 5E3QA 1ZQBA 2D0OA 3EGWB 3Q8VA 5J1PA 4B17A 4YMNA 2RHSB 4H5WA 1NDPA 4BR7A 3H5XA 3WEEA 4CWBA 2ALZA 4ECQA 4B9TA 4LFBJ 3VALA 3MN6A 4DFPA 2XS5A 5JS2A 4JS4A 3DGVA 1SV5A 3KLFB 2OEJA 2OMOA 2DRAA 1WOPA 1FFWB 1KDHA 1GH8A 4QIWC 4Q2MA 3SV3A 1VRUB 3AY0A 4NCBA 5DS7A 4OPAA 3C23A 2XMUA 1WNEA 3EW9A 1X0FA 3M9NB 5EHHA 1GNKA 2J0XA 1U4BA 1FK9B 3V7JA 2LCWA 2IVYA 4F3QA 3S3MA 5ETKA 3VTHA 4IZ9A 5KFAA 4BRHA 4A8KA 5A8WB 1WB9A 2CXYA 1NLKL 1JWWA 2V8GA 4DR2K 3PCOB 1YI2S 1WC0A 2H5IB 4AD6A 2ATLA 3K75D 2QTDA 5BPLA 2C3MA 4IO9L 4BUGA 4Q7AA 1X7VA 1VRQC 3C6UB 4MTPA 3T6BA 4NYPA 1SJ1A 4A48A 3GL1A 1V3SA 1E3MA 4Y1DA 1W2IA 3FBCA 2HBZB 5J1EB 2EHGA 2VGMA 1L8OA 3VQ5A 1RGIA 3CCWA 1HNWF 3ORYA 2HGLA 1KW4A 5EE1A 4FF1A 2I0XA 1JXVA 3A4TA 3TUIC 5EWGA 3IP0A 2G0AA 4CHZA 1J53A 5J2MB 5ETPA 3KFWX 2N4CA 5ALRA 3HI0A 3UM9A 4ZHRB 4DQRA 1UVIA 2E5LK 1QQMA 1U25A 3F5TA 2HVIA 3D2WA 1WLJA 2IRXA 2NXNA 3GSDA 5M2UA 3ZD9A 5IIIA 1H2UX 4JI1F 1C0MA 5JS1A 1UPPA 2B3TB 3HWTA 2M4MA 2KICA 2CJBA 2HG4A 5DG7A 1M1HA 1Z4OA 3DYAB 1C1CB 4C8MA 4OJHA 5GINA 1TUGB 4OMFG 4XPCA 4DR7K 4RNOA 2HMIA 4R25A 4F4AA 3ISBA 3WK6A 3HSCA 2D5RA 4PHAA 2XMJA 1WC5A 3N01A 5DMRA 3NLCA 3ONQA 3PJ9A 1TTHB 1NBEB 1S10A 1NJYA 2LYAA 3BR8A 4KAZA 2NRHA 2HBKA 4LBHA 2GQ2A 4F5NA 4P4MA 4NLUA 3ENVA 2EAOA 3RJMB 3AVAA 3ZZRA 2J4RA 1RLCL 2QA4G 3AO4A 2W42A 5G5HA 4OI4A 5AFUH 3CCMS 4LH5A 1VQ4S 3VQSA 5EX5A 1QY7A 1C0GA 1HUOA 4NM2A 2ZOFA 2Z8QA 3QB0A 1X5OA 2YNHA 4MFFA 1UJ4A 4CZFA 4J7CA 4FF2A 4W5QA 3CJ4A 3M8ZA 4ILHA 3WEEB 5LT5A 4C3MA 3IDWA 4Y2KA 3WC0A 1I94F 2F1JA 2RHQB 4ZVFA 3JTNA 4PPXA 3W8GA 2F40A 1WF1A 3QGHA 2IVMA 3M8RA 4F9OA 2RDDA 4X4UA 5M2RA 1UA1A 4CRXA 2Y0BB 4I69A 2G8IA 2UUAJ 4DX5A 1LFWA 2K4IA 4QZ9A 1RT2A 4LF4K 3AM9A 3PW5A 4FWQA 4GVBA 2WSFC 4PGQA 1XSNA 2JL9A 4KE5A 3TA0A 2ZUBA 1WTFA 4CEEA 4L75A 1ZRNA 2XZWA 2KG5A 2E1MC 1FD8A 2YY3A 1R3NA 1S5JA 2RD5C 4F4YA 3CCQN 3AQEA 1QQ7A 1HYSB 3LPEA 4XH4A 5A8RA 3K7RA 4F7VA 4BRLA 1GTEA 3WXMB 3ID8A 4FVUA 4DEZA 2CZ4A 2O8EB 4X62K 4E98A 4WF9Q 1H38A 3KMQA 3OR1A 4G1QA 4MJKA 3H7HB 2PYJA 4MO5A 1QVFM 3M05A 3MXMA 4WFNL 1Q5YA 2ZTEA 4I2QB 4F25A 2KB2A 2V67A 4QIEA 1ZETA 2UV8G 2OPSB 1BUXA 3GJRB 4I2PA 4BRCA 3W2WA 2HHTA 3CCUN 2D69A 3FCVA 1BWVA 5BR9A 4CJPA 3MCSA 4ZLLA 4J91A 4CHYA 1YTUA 3VMFB 3JSMA 2FJXA 2ZUAA 2XWXA 2FMPA 3CGIA 3TTCA 7ICMA 1Y5LB 4CJVA 5C25A 4WFAL 1JL2A 3F41A 5FPNA 1N0UA 3E58A 5K5MA 2YNGB 3RB4A 4GKKK 4NMXA 2BCQA 4DTJA 3QATA 1K0VA 2KTQA 1V4SA 3NAIA 4A8EA 3A0HU 1IBLF 1CJUA 2LQJA 3D66A 4H4MA 2YJEA 3RJFA 1YUWA 1RT5A 3F0NA 3CC7N 3QUTA 3OBIA 2HMIB 2VICA 1XNRK 3ZT0A 4M63A 3ISND 2EBEA 2POKA 2HWIA 1WG1A 1F2GA 3MAQA 3NH2A 4O5CA 3D0PA 2XZTB 2K8GA 1YJVA 2QG9B 4NLWA 2VQEJ 3NGRA 4KREA 1Z26A 3QX7A 5BOLA 1N34K 4JI4F 3AOAA 2J0SD 4M5DA 3T9NA 4ZVPB 2A19A 3AODA 3C29A 3PW4A 1N5TA 2KOBA 2V2QA 1NKCA 4HEA9 1RHMB 4BX9C 2R7YA 3SENA 1A7GE 3PW2A 4ZCLA 4BC7A 2ZVSA 3GFXA 3QE9Y 2FGOA 4KHWA 1OYEA 3D2NA 1E6VA 4IRDA 2KMDA 3DHXA 3H98A 3F73A 1S1TA 1FEHA 1SAZA 1FA0A 5D46A 2PI4A 2YNHB 2KJ8A 3JPNA 3KOOA 4XO0A 4LFCJ 2AD9A 3T1HF 3O08A 3ZSRA 2P6UA 4X4OA 2PZSA 3W5XA 4RCHA 8ICFA 2W2OP 3Q8YA 3NCQA 2IGIA 3DU5A 5AM0A 1GOBA 2P9KA 2V68A 1N62A 5KT2A 2QXLA 4CLPA 4UTGA 5D3GB 4KLTA 3MPWA 3Q83A 1SUQB 1SH2A 4DTSA 3CCUS 4ZTFA 1KONA 3KK1A 2BTFA 3UB5A 4MYTA 3QYYA 2EVZA 3ZTPA 1NWKA 1SQKA 4AL7A 2GJFA 4FO0A 5IC4B 4YVZA 2KM8B 4R63A 2L5YA 2NUUG 2DF4B 4GVBB 1N5YA 3AVCA 5D4NA 4OPJA 5FLXU 2EKNA 2IM2A 4NE9C 1FJGJ 3MCAB 4WQ5A 2IMOA 2E2NA 4CLFA 2YMQA 3SJJA 3H59A 2F4VF 4DFDA 4Q45A 2BE9B 4P2HA 4BRMA 4JI3K 2Z7JA 4QWEA 2E5GA 3D0GE 3R1XA 3UCZP 4LH4A 4WQ4C 4BQZA 1D8LA 4CJRA 1RQNA 3Q8MA 1NEEA 3W9IA 3DAWA 5A8RB 3CC7S 4ES1A 4JI0J 4FLWA 3J7YP 2FMSA 2HVZA 5M1FA 2DR9A 2C2RA 1D8ZA 3DLGA 3OR1B 1U1MA 5BYSA 4E1NA 4RO0A 1XTZA 3LVWA 3H20A 5AKIA 2P5GA 2QO3A 4CLUA 2O1PA 2V69A 4JOUA 1N5XA 1QHTA 3W2WB 1WYGA 3V6DA 3R1HA 4A8YA 2EKYA 4ZVHA 3JSMB 3TADA 4HWIA 2DRDA 3TX8A 1Z00A 1KLNA 3AFGA 1W9HA 1VQNS 5C25B 4EAHD 4XIUA 1RISA 2WTUA 3C7NA 4MYUA 3MDQA 1JI7A 5F3XB 4I2IA 3G86A 3VZHA 3QEWA 4ELTA 3BPSP 3RBEA 1C4AA 3ZDCA 5DQIA 1KBRA 2UUAF 3QGPA 2VQFK 1DTQB 4DUTA 5HQ8A 2V0NA 4NLRA 4OX6A 1CJUB 4PPDA 5CZVA 4H4MB 4I2DA 5KAKA 2ITGA 1SKUB 5HMZA 2V50A 3DI6A 2XMAA 3KLHB 2E9RX 4OJRA 3R9LA 1M1KO 1WBBA 1IBCB 4CLYA 4ENOA 3CJRA 2C3UA 5CHGA 5AQNA 5ALFA 4L73A 2M52A 4B6JA 3OR2B 2IDLA 4CF8A 1Q8BA 3DLLQ 1K8AO 2MPUA 2MKKA 3BPDA 2XICA 4BRGA 3KK7A 1F0XA 3WX4A 1IG9A 1VIXA 1YAGA 5C7PA 4M5DB 2HIYA 3ET6A 1JJ2M 4ERDA 2JGUA 2QYGA 1X3NA 4FKXA 4QS8A 1ZD2P 1COOA 5J2BA 1UFLA 2KI2A 4DV7J 3TZYA 4K42A 1ZPWX 3I32A 4MK9A 1FRMA 3H40A 4BG9A 3O6QA 1E6VB 4ID5B 4RW6A 3QNWB 4XDCA 4X65J 4NMLA 2I6XA 3D2EB 4OPKA 1BC6A 5CEHA 1UVKA 4QQBA 3KWGA 4ZPBA 1XNQF 4PRFA 2ZF5O 3TZXA 1IUJA 4A2BA 1PK3A 1VSFA 3MTKA 5IILA 3NGYA 1SV0A 3CIPA 2QB1A 3WK4A 2QEXN 3HHLB 2ZUGA 3E2EA 3UPQA 1XS9D 3H0LB 3QT6A 2B7BB 5BPNA 1TKDA 3OYFA 5CB1A 1RT1B 1CG2A 4LIRA 3KK1B 1A0PA 4DUZJ 2MHNA 1T6CA 3WNHA 4I28A 5A2QO 1PBUA 4PKDB 1JX4A 4O8KA 2W41A 2UP1A 4F67A 4DTNA 3RRGA 3QUCA 2ZWPA 1Q3VA 3AAWB 5I42B 4H8KA 2HVEA 3CJSA 1UTAA 1RT7B 2FJVA 7AT1B 3BH7B 3QERA 4PPZA 3JYTB 1S3XA 1T0TV 3FFIA 3A3PB 9ICRA 1TFWA 4I27A 5E41A 1Y4ZB 2RU9A 4MHVA 1OH5A 1R6VA 3PKYA 4DFJA 4CO5A 1JK9B 2ZUDA 4IR1A 1FEEA 5JVHQ 1HL6A 1Q3UA 3DLGB 1WHXA 2CQHA 2ZH8A 4DU7A 4XDDA 5KFWA 2CQPA 2ZIVB 1HLWA 2DB1A 2ALYB 4X4TA 4IEEA 4LF8F 4K0KJ 4DR6K 4A8SA 2GVDA 4F4WA 2KJ9A 2IAJB 3R5GA 3DHWC 2HHVA 3JAMY 2RQ4A 3GJQB 5AK6A 1XHZA 1WC4A 2CGJA 1N8RT 5F8GA 2MDAA 5L39A 1SC1B 2J9DA 5GTHU 3P5BP 5IWAF 2VL1A 3V72A 1HBOB 4NYFA 1X9XA 1ESVA 1RTJA 5CY4A 4M6WB 5J2PB 4UB1A 3QZ7A 4P52A 4OJLA 1T9UA 3VN5A 2NZCA 2C2EA 1NZ8A 2FLNA 3S3OA 1BQNA 4L3QA 2RN2A 3TANA 1FXDA 3VQPA 9ICMA 2M3DA 1RHRB 3V9SA 3S7RA 3C2MA 1OSDA 2HNZA 3HJEA 4DOZA 3U26A 3TAMA 3AHPA 5CRXA 3JQJA 3HHNB 3CPWR 3L0QA 2V5HG 2A1JA 1J5OB 2HHHK 2BJ8A 2XGPA 3DGPB 5C2GA 5KRSA 1HQUB 4URGA 2ZKTA 1AUSL 3ULEA 4O0IA 2L3MA 3E51A 1PKUA 5D0HA 1N5WA 1FW6A 1GLBG 3PX6A 5IIOA 5MAOA 3POTA 2HFZA 2FJBB 1MN8A 3ALYA 3HHLD 4MFBB 1ZZNA 2RHKA 3IFEA 2MTLA 1JLGA 4CJTA 2MLZA 3NNCA 1LXNA 4P73A 3U27A 5LSLA 3QNOA 4JKCA 5J2KA 4DF4A 2HFNA 3FBFA 1RWXB 3CJ3A 3QJLA 3MM9A 1IKXB 2QSFA 3ZT4A 3H46O 3D7SB 4OJOA 2HSZA 2B6GA 5IV3A 2HPUA 4NASA 1FFGB 1RHJB 2OJ3A 5AKGA 1YRUA 3O0FA 1ZQKA 4ZJOA 5AI0A 1KHVA 3KYLA 8RUCA 1TVAA 2W43A 2DHSA 5I9EB 1KQSR 5EWFA 2HGMA 2VCPA 3A8JA 1U09A 1FNXH 4C0OC 3VGSA 3OW2M 5BN8A 3EICA 4LIWA 2NRZA 1RDFA 3CPEA 2Z57B 3CDAA 2XHWA 4NEYA 5DGAA 4DCOB 4ZVSB 4G9BA 3NRZA 1WC1A 4W98A 4PKHA 3AT1B 4IH7A 2J9CA 3MCOA 2IA0A 4EFHA 2W7AA 2FE9A 4CW7B 2XY5A 3IRUA 1UZHA 4P2XA 3IC1A 4KX3A 1WBDA 3CDUA 4FJIA 1PUZA 1H98A 1IBMJ 4PL1A 1EO1A 1HLUA 1TU0B 3A8IA 3MPYA 3CUNA 2X1BA 3ENQA 4DL5A 5F0UA 3ILJA 2QARA 3BO2A 3SQ2A 3QBWA 5EU7A 3C2PA 1IO2A 2YB4A 3RBXA 3KUGA 3TUJC 1QD1A 5B7WA 2NUHA 3EGVA 2RUGA 2Y1RI 2MZTA 4Z6EA 2HAFA 2KK0A 4RL1A 5IV4A 1FKPB 1N4LA 1DURA 2NZ4A 2ZQBA 4PWDA 1WORA 4WE1A 1S7HA 3H4BA 1SC4B 4IJAA 3P5TL 2A2CA 3SUPA 4KHUA 2QWPA 1S12A 1Y64A 1RAHB 2HKEA 2ZD1B 3VERA 3MEEA 4KKOB 1ASUA 1A77A 3W60A 4L3KA 4DR4J 4IRCA 5J0XA 4DUZF 3FE1A 3ZSWA 1JCFA 3D2FA 4BRPA 3NVWA 4RQ1A 3PW7A 1BQNB 4ECRA 1GLAG 1XMQK 2P9LA 2RE1A 2FQQB 4N76A 2R2UA 2W4PA 4CLSA 2X6SA 3UCUP 1Q7YO 4EIAA 2HNZB 1VJ5A 2DIVA 3Q22A 1HNXJ 3QEPA 5HNKA 4CGJA 2HS3A 4B9QA 4KHYA 1KC8T 8ATCB 3HT0A 2KZ3A 1V9PA 3MN7A 3EWAA 3BJYA 1FTCA 1WDDA 2GCFA 2CJYB 4ZDNA 5B09A 3S3NA 4RUAA 5KG7A 4DJBA 1HR0F 2MB0B 5IZHA 3FR0A 3POTB 4CNYA 1QCKA 1U2RA 2ZDOA 1HNZF 5ALEA 3KVGA 1JLGB 3ISDA 4IQXA 3HTVA 2WVFA 1TUUA 4NI2A 3OYBA 4KYZA 4O3NA 2DKXA 3OV7A 5AQJA 3SV4A 3F5EA 3MF5A 3QFWA 3GWCA 2E9TA 2Z2MA 1OQ3A 3FSYA 4CCHA 4M7YA 3HSJA 2X51A 2QXFA 4K4GA 4PQUA 5J2GA 2Z56B 4G6VB 3CC4N 3LVVA 4O4GA 2WB1D 2CNNB 4FWOA 1XO0A 4J9UE 1Q16B 3QFHA 1IR2A 2JSXA 1N33K 3LYSA 4XPEA 1BHNA 4B9UA 3OSNA 3PX0A 3KKFA 2DT9A 2NNWA 3P31A 1WEZA 2KH9A 3MK6A 2P66A 1QDUB 4YDUA 4AHVA 1RT6B 4ZPDA 3EVMA 2GWJA 4BR2A 1UW4A 2F8LA 1DGKN 2VOPA 4BR9A 3K5MA 3G9CA 4YXMA 2NRVA 4DPWA 2DNNA 3DXMA 4CJLA 3TJ8A 3HI9A 2YKMB 3MUTP 2G0CA 3AJDA 1NGBA 1FE0A 3TEGA 2G0JA 1HHQA 4PCQA 5D78A 4X5VA 4LF6J 4K4WA 3CG7A 3OYHA 1YT3A 4TY9A 2C2OB 3C2KA 8ICGA 3GV5B 1PVPA 2BACA 4F02A 2AZ1A 1S0OA 3THWB 3TJ9A 3QMQA 3PSPA 2UU9J 3PFOA 1S9GA 4UBBA 4O5EA 5J2NB 3TVKA 2XQCA 4W90B 2V8PA 2VG6B 1UCVA 2W55A 1C2PA 4GIBA 2FGCA 2ZKUA 1QZ6A 4C3KA 2G07A 1QHAA 4LRCA 4WFBL 1VQLN 1T3VA 5CCMA 3THTA 3SQGA 3EZWA 4OGEA 2NYVA 4OGCA 3EN9A 4WE1B 3MFIA 2W9CA 2FTRA 4PXDA 5TKWA 5K20B 2VA8A 3FDSA 2OEKA 3TQ1A 5B8HA 3SCJE 1X42A 4DV0J 2O01C 2A41A 1T8EA 1YITN 4ATNA 4X66J 2JWLA 1RACB 4ETXA 2HOFA 1HKCA 2R7TA 4OHYA 1CULA 4R66A 4IOXA 2E1PA 1Y7PA 2QL9B 1O1WA 3MM6B 9ICTA 4EFAC 4ZP9A 2GIRA 1H3DA 4NXMJ 5HHHA 3CC4S 4DR5K 5E0OA 2VHGA 3MOZA 5KFZA 4LR9A 1MMNA 2YWFA 2CAJA 2B4OA 5KFUA 1OIAA 1Y00A 3ZETA 1F5SA 2AT1B 2NXCA 4IFEA 1RHKB 5J0YA 1CXQA 3OBYA 1H7WA 4GV9A 2VJ4A 1IBMF 1LNQA 2DL0A 1MROA 4FW1A 1BCMA 3N4MB 5KFMA 4RT2A 2YJFA 3OVAA 4Y2IA 3QSYB 4M0AA 3NBPA 4B3SK 2KKHA 4FXWA 3VAHA 4YR2A 4FBUA 3H0PA 4EEYA 1VDHA 2BRKA 5DM6L 4K8ZA 3CC2S 2YXLA 1FRIA 1V5IB 1W25A 1OUQA 4Q0BB 4WTOB 4HH1A 3KLGA 4OYMA 4YY3J 4PY5A 3D28A 1JLFA 2K1RB 5GTIU 3D9BA 4GKJK 4N7TA 2ZIUA 1SH0A 3WKCA 5K8PA 3DXSX 1EHWA 3NCIA 4ALZA 1V85A 3GYNA 4DF8A 2BJ3A 1HQEB 1UT8A 4Z4CA 1UCNA 2D3ZA 2H5JB 4KH6A 1WI6A 1A5VA 5GMDA 1Q8KA 2AEFA 4DR4F 3KG1A 3N0VA 3Q8SB 4OZJA 1TL7A 5D4LA 2E88A 3MABA 2FVSA 1ZJNA 1IQTA 2IJNA 2GWKA 1VQLS 4FS1A 5C0YA 4FPRA 3W2VB 3SAGA 5A2QU 5DDPC 1CJTB 5GADI 2EG1A 4YOUA 3G82A 3ZZZA 4C8YA 4P4PA 5CJ7A 4DCJB 1YJNS 1QQCA 2IYIA 2PKEA 1HKBA 4CESA 5HHIA 2UUBJ 4AHSA 5JICA 5B0FA 1UEVA 2HBYB 2LYVA 1PGZA 3PUFA 2KP7A 3AVMA 3DJCA 5B0AA 4LREA 3AVLA 2G1DA 5KG1A 3ZSYA 3THVA 2E2OA 3VEWA 2ZJQQ 1TFYA 3G2XA 1LFPA 2R8KA 2F1IA 1U9LA 4J90A 3HF5A 1VRTA 3I33A 2IBOA 1OVYA 2OHDA 2DKOB 1E4GT 3WKAA 5E3CA 2F9JA 3TSPA 3C1YA 3SSQA 1EQMA 2IVNA 2AYMA 3R6GB 4GXKA 5ETTA 2WB1F 2GH1A 4BJQA 4QW9A 2DFHA 5J0OA 4GY2B 2I7PA 5KRTA 2AQ4A 1XQIA 2CQIA 4KITB 2GC8A 4LZDA 2JWNA 3QBXA 3SCLE 2ODGA 2HSTA 4LR7A 1VJWA 1RKIA 2RILA 1WTBA 3UDCA 9ICVA 4JV5F 1HNWK 4ZLJA 2JJ4D 2G06A 3ZTOA 2R7VA 3HP9A 3RZAA 1RTDB 1NGGA 5E79U 3TJAA 3O8WA 4CK3A 1T3NA 1N61A 2VC1A 2FBTA 3OBWA 2HK3A 1FWKA 1S6QA 5BXIA 4QZDA 5CA5A 2Y8WA 3CD5A 3QLHB 1X9WA 2AW0A 2DO4A 4B9SA 4ZTJA 3N28A 2DYAA 2YQ0A 1YJ7A 2YNIA 3KLVA 1PCAA 3MMVA 4DR2J 4LRFA 4JI1K 3OS2A 1OW5A 1RLDA 2ZBCA 2LA4A 2ISOA 3MUVP 4OYWA 3DMJA 2VBXA 2PMHA 3LP2A 4FWPA 3ILIA 3CMES 4LF9J 2N1RA 3NS7B 4KH1B 1X9JA 1HBMA 5D4BA 1RWNB 2FC9A 2YB1A 1KXPA 1N8RO 4KC5A 3BZQA 2PSZA 2BJ1A 5AK3A 3M8QB 3B9JA 5GADP 5G4DA 3BEXA 3A13A 3NBPB 4P2SA 3OYMA 4J8FA 1SIZA 2IS3A 1N48A 2K8AA 4EX7A 3G10A 3Q8PB 1FKOA 4CTAA 3CE8A 4E1JA 5L1KA 4I2AA 4HI1A 3KK3B 4CNQA 8ICIA 5ALQA 2E5LJ 2HHUA 5ELZA 4PHEA 2ACMA 3SSSA 3L5KA 1QZ5A 2BQUA 3NS1A 4K2XA 2Z1JA 2ZBQA 1N2XA 1JJHA 4U8YA 1J2MA 2CH6A 4CK2A 2BCSA 3GIIA 1ZXOA 4CF3A 2EH9A 3BQ2A 5L1IA 2OYYA 3WNGA 2BEFA 2LLZA 2W8LA 4PXBA 4Y2YA 4DR7J 4HTJA 3CXCR 2GWSA 4H4KC 3CJ1A 4FWSA 1REVA 5AFUA 4F92B 2FPLA 3DOLA 5JRTA 2QC3A 1I94K 1CLFA 3FGVA 3W5ZA 1NSAA 2VWKA 4HT5A 3OYGA 2E6LA 3A5MC 1IWGA 1M5SA 2KT3A 2O66A 2KIVA 1RTIB 5CZXA 1FRJA 2OSRA 1URRA 4QYZJ 4O3MA 5K4LA 3MEGB 4JI2F 1TKZB 4ELUA 4YHHF 3NAEA 1E6YB 3VESA 3L3FX 2LSNA 2PFOA 5LL6Z 3KG4A 5B0DA 4P74A 1YBUA 5ADZA 2RE2A 9ICUA 1IKYB 4K2JA 1DEJA 1BHLA 2YKAA 1F0MA 5AQUA 2QLFB 4IOAL 1VRTB 4QOTA 2DCUB 4DL3A 1Z05A 1WNSA 2HS0A 3KHYA 1HJOA 2PFFB 5F3TA 2V8DA 1CEZA 2EZZA 2PI5A 1IQZA 4YY3F 4AM6A 1ZD5A 4DV3F 3MMBA 2BOPA 3IO1A 2HYIB 7ICNA 1URJA 3HRDD 4CEDA 2MXYA 4Z7YA 4UZCA 3L7UA 1CQNA 3E8OA 1TKTA 4ILRA 3F2DA 2AXTU 4H5RA 1KKXA 2VH7A 5T7LA 4TUPA 5BR8F 2HURA 1TYQB 1FJEB 4JHDA 3I6PA 1TVRB 1VSKA 4R8UA 1N5QA 2BOAA 3IG1A 5AZIB 3AO1A 4FM2A 1G4CA 3AXMA 4ITSA 3M6ZA 4LF4J 4QIVA 4FSVA 5KGWA 3IHQB 4FJ8A 3KWIA 3OXFA 1E4FT 1G6BA 1HI1A 2C2KB 3J7ZT 4Y34A 2QA4S 4KPCA 3M6KA 2EG2A 4UOCA 7ICPA 5TZVA 2XCAA 4PXCA 1I6JA 4U95A 5HK4A 1U6ZA 1DY3A 1HJPA 4Y00A 1HWIA 3C6AA 3WKBA 3DDHA 4FWMA 3S9HA 2UUBF 1WOQA 4QZEA 3V4IA 3UKRB 2BKOA 3L7PA 3V9WA 3CRXA 4DL4A 4NYOA 4OLBA 3LP2B 1QQOA 3CCLN 3AQPA 2G4BA 4FLTA 2DGWA 4X62J 5ALWA 2ZIWB 5IQ6A 5ETOA 1JCGA 1IBLK 1Y11A 1DQ8A 1HBMB 3P49B 1QAIA 3MXJA 4ED4A 1GXUA 4NCGB 1MWZA 1LW2B 2BX6A 5AQWA 3GZFA 1MW7A 4YMEA 2J6SA 1X4GA 4CBXA 4P10A 4OJ6A 1ASWA 2KVCA 4A8WA 3GCWP 4ANCA 2ZHBA 2D4WA 4LSLB 1LEOA 4KLJA 4DR3F 4JI4K 3FNNA 2CQ0A 5B08A 3DDNA 1I3OB 1YIJN 2YKOA 2G08A 1AXQA 5LMNK 3G87A 4V19X 4TU9A 2VONA 3AO5A 4GKKJ 4HUFA 2OP5A 3TX0A 1HPMA 4H0OA 1Q0NA 1WACA 2XTJP 3SBTA 4GW6A 3M1YA 4F5PA 2DGSA 4ED1A 2MQNA 3MX5A 4PYDA 3VQ6A 1SJRA 5E26A 4JI8F 1NAQA 2EK6A 2ACYA 1KC8O 2AYBA 4DMZA 2LBOA 4PGYA 1S1XA 1SJ3P 3BF1A 4HDGA 4NLSA 2AIRB 2ZIXA 2J0WA 2WBRA 4EX6A 3C6TA 1REVB 3A3NB 4UUWA 1XNRJ 3T1HK 2VKRA 9ICKA 4ELVA 2EQYA 3QUBA 2ZHAA 5KTQA 8ICMA 3DOLB 2E4LA 1RAGB 3I82A 4QZHA 2C2DA 3E9PA 2P9UA 4KSEB 2EPIA 2ZBPA 4NY8A 4O4RA 5J2FA 1WF2A 2OTLS 3PO5A 3HZ6A 2LECA 2CPFA 1H0HB 4WTYA 1RHQB 4LF9F 5ALHA 3EZUA 1C0TA 2N82B 1TK8A 4BR4A 4BE1A 2VUGA 2XG8A 3OLBA 4AT1B 1XMBA 3ZTSA 3O2IA 1GO3F 2IRUA 1YGYA 5HBMA 3VAJA 1RAFB 4C3LA 3SSRA 5KFDA 2BKEA 3VENA 1UAWA 1X6IA 3F2CA 3J80Y 2F4VK 3X1LB 2VV5A 4CM2A 5TISU 3SFGA 2R7OA 4J03A 1YJRA 3CCLS 1W2BR 1XI1A 4PH5A 5ALLA 4IQVA 4E7LA 2Q6CA 5I3PA 2YX7A 2YTCA 3KD5E 2E5JA 1S5ZA 2Q3SA 1BIUA 2QM1A 1N60A 4CFAA 1NOZA 4NLZA 3AA5X 2YTUA 3RUBL 2ASOA 3IR6B 2B5JB 5E5NA 3HZGA 2KM8C 4RU2A 5IT9Y 1FRKA 3M7DA 1CJVA 4L76A 1S6PA 5DBBA 1G3OA 4W4MA 3T41A 3CPWM 3NRWA 1RWVB 3DU6A 3HLUA 3BP8A 3THXB 4AYBD 4K41A 3MMCB 4U6PA 1VSIA 1M0SA 3CETA 4HTIA 3HPGA 3CJ7A 1NJXA 5KAFU 2ISPA 3BQ0A 3H5SA 4GC6A 2W01A 1YIJS 3JPRA 4FWNA 4ICLA 1RG6A 3D7EO 2OPPA 4GLXA 1OXJA 3AU6A 3QUQA 4ZIVA 1MN7A 3BBFA 1RBUA 1VBKA 2KFYA 3A1YG 2E7XA 3D1HA 4BE2A 3UMGA 4JI3J 1UWBB 2U1AA 2F3JA 2EZXA 1NPPA 4RTFD 1VJQA 5J0RA 2E1AA 4BXOB 3UNYA 1ZQYA 1ASVA 1F1BB 5IINA 1RT4A 3BN7A 4KTWA 2B43A 4NRUA 2UUAK 4TYBA 3H8JA 4UB4A 2WOMA 1S6OA 3I76A 2DFEA 3QO9A 2E6MA 1NSKL 4M9GA 4CEBA 1B0XA 5JMVA 4DV5F 1KQSM 4NX9A 1SJQA 2N4DA 4YR0A 5G0RB 4J9KA 2J6TA 3G4SN 4PKGA 2DH9A 1JKHB 3MFHA 3MBYA 3EKSA 3ZX0A 3HKZF 1RTHA 5FDLA 2DR5A 2IBKA 2HNYA 3SDEA 3C94A 3O6WA 4US8A 5HR6A 2CQ4A 2ZH2A 2CJKA 5ALYA 2YX8A 3RRHA 4MO4A 4BCAA 2KSOA 2QT7A 4A8OA 1BGXT 3K4GA 2QW9A 4DTOA 1VYAA 6FD1A 2VQFJ 4DBQA 5KFBA 4J9QA 3BB5A 5IM0A 5A8KB 2K60A 3EJMA 3THYA 4Z4EA 4F4ZA 2XMTA 4WZMA 3GE9A 5C15A 3A3OB 1XNQK 2EC2A 1DRZA 2HHPA 2Y8YA 1Y3KA 3B8HA 3WQUA 1ZXIA 3BSOA 2PXIA 3V81A 3VC8A 5KOXA 9ICAA 2V8HA 1T44A 3SJHA 1JLCA 1KQFB 4N5SA 1S6UA 5LJ5Y 5AIAA 3C16A 2BW7A 3N6NA 4KHPK 1SB6A 2VD3A 1D8YA 4KLEA 1OY6A 5JU5A 2VFSA 5E7OB 4CZMA 1R8CA 1C0TB 3CJ5A 1JL1A 3O8MA 2ROGA 3DRXA 1OH6A 3QXGA 1M90T 2XLIA 4IKFA 3HHLC 5D77A 4E89A 1FX4A 3SI6A 2QFJA 5KFGA 2XS7A 3NH1A 3U9DA 4QBUA 5LJVA 5MLCQ 1S97A 3NG8A 3TYTA 3T79A 4FKYA 3SBGA 3VQQA 4C98A 3SMSA 4FZLA 4A57A 3SEIA 3C28A 1S9FA 5EOYA 5AHXA 3N97B 1RBAA 2E1RA 1MU2A 4Z4GA 4HVJA 4WQ5C 3OUYA 1FE4A 1NO8A 4NXNF 3DRPB 3LP0A 4I29A 2CNKB 1R8PA 3MAHA 4DV6J 5AQLA 4A5BA 4LF8K 5GAHI 4UASA 1ZBUA 2V4JB 4LJMA 3HRGA 1JMSA 4DCPB 2JC1A 3UDVA 3IDHA 3P4UB 1HX1A 1XNRF 2QN6B 4PHDA 3D6JA 3U7JA 3SNNA 4TY8A 4UUXA 4R79A 3VGMA 2OH2A 1V38A 1UZDA 1MMLA 1L8LA 5IWAK 4QZGA 1NM2A 4DMNA 3TTFA 2B9EA 2BJ7A 4D3HA 4M5HA 4ZITA 2NR0A 4PG5A 1RDDA 3K17A 1RHUB 2FPMA 3O1WA 3M5RA 1P1TA 4UY85 1SJFA 4KR0B 2XSFA 4Q2LA 1RT4B 1GT8A 1ZQGA 2PFNA 2UXCJ 3EUB2 2DHXA 4WJ3B 3QJPA 3AB2B 5K14B 4ISFA 2APOA 2V52B 4I2EA 1FTRA 1WC3A 3DLEB 1FKAF 2H3EB 4DHVA 5ALNA 4DR6J 4UOGA 1CS4B 5IIKA 3FKBA 2Y1IA 1DTTB 2PGCA 2HQ3A 1FVSA 4AYBF 1RSCA 1RDUA 3C5GA 1RAIB 2J9EA 2D3DA 5J2IA 1RTHB 2RAQA 4ANEA 2O8FA 3SUQA 1J2VA 3HW8A 3SDEB 3Q24A 4RQ0A 2PA8D 2WCXA 1B92A 4F91B 4CJUA 3F56A 2EZYA 1GOCA 2ASMA 2KFZA 5AQQA 1N6QA 4RQMA 4USUA 2KSOB 3CTRA 3L9ZA 1T02A 2D3O1 4B3MF 3WXLA 1SWVA 4M8LA 2B9WA 1JALA 1D9AA 3THYB 1AQ6A 3S41A 1IKWA 3AVBA 2C2NA 3JXOA 3N9UC 4AL6A 3OTQA 4RU9A 2LPEA 5AIBA 2VG7A 2YWGA 2HHHJ 1JUDA 5KL8B 2XO7A 1LWEB 1O5JA 2PFDA 2ES6A 2MQ8A 3ATUA 2LA6A 4AXJA 4TQRA 1SBRA 4WK3A 2P9IA 2D6FC 1T9YA 2KHVA 4FJJA 4UQGA 3RJEA 1HJRA 2VKQA 2IA6A 1LK7A 3IGVA 2DNKA 2JEGA 4I64A 1S4EA 3MI7X 3UN3A 1ZTWA 2ZBIA 3DOMB 2XLKA 3WQTA 1SV0C 1S57A 5ETNA 1RFQA 1TR0A 1NJIT 1BWEA 3F2BA 4I7FA 3A8KA 2OTJN 3V1OA 4NL9A 3HSGA 4AF1A 2HEKA 2MZRA 1S59A 2DVIA 1YG0A 3I9V9 3DXBA 1TP7A 1BVSA 3D6TB 2YMLA 5EWEA 4DHYA 4MFAA 4OJ1A 2HHSA 4M3ZA 1QQ6A 2B6AB 5EE0A 3CO9A 2FB0A 5SUHA 5EDWA 2WB1C 1ITGA 2P2CB 3K57A 1KBUA 3U1NA 4C8ZA 1RT3A 2FYXA 3WU2U 3VQEA 3ELHA 2NCKL 4CO4A 3PX4A 5IT0A 2BA9A 5AQMA 1DGJA 3OA9A 2BCRA 2Z0GA 4M94A 2E1FA 2GGPB 4WYWA 3MECA 2WMMA 3PHTA 1EWRA 5J0UA 1KS2A 4AHUA 3CIMA 5ITHA 3H1VX 4KTZA 3HSTB 1ACMB 1KRPA 3K2PA 3BQ1A 4CO3A 4NLGA 2HNDA 3L2RA 5K8NA 4DL7A 2DR6A 3Q86A 1BNPA 5ALDA 3G8TA 2FC0A 3D0IE 3ZZPA 1X1PA 3R3TA 3W64A 4A8MP 2BR0A 1X66A 4Z6DA 3CF5L 4YEAA 5THWA 1RXVA 1N36F 3OYKA 3LWLA 5AQGA 3KJVB 3ENWA 1BQMA 1RILA 5JMNA 1HR0K 1JXLA 2LEPA 3LM2A 3SAHA 4ZVTB 2BXJA 3AA4A 3AU2A 4USJC 1HNZK 4ER8A 9ICCA 5DB7A 2IDEA 4X4SA 4DV1F 2IMWP 5DK5A 4TVAB 5J0PA 1BA1A 2DNGA 1IXKA 1N6QB 2EAPA 4DV6F 2OTJS 4NJ8A 3QU7A 1LWFA 1EQ0A 4FJ5A 3P96A 3EGZA 2NPFA 4GXJA 3GLJA 2BE2B 2MSTA 3SYZA 1U7LA 4RWWA 1IKWB 4P4OA 4IRKA 4YD1A 4K50A 2XY7A 4ISEA 2AH5A 2VIHA 2VG7B 2AJ1A 5ETQA 2FC8A 2X7IA 4DS4A 4M9JA 3ILOA 4PUOA 4M95A 1U0HB 2A0FB 1EX8A 1XR5A 2JDJA 2WW8A 2E29A 5AXLA 2VF3A 2MKSA 5IFMA 3CJCA 4FJ7A 4X2BA 3NEKA 4GVMA 2P9IB 5AZJB 3NTUA 2UXCF 4KB7A 3PNCA 4C7QA 1TELA 5ALTA 5H9FK 2MJNA 4FJMA 1FFVA 5HQLA 5KOWA 1GLCG 3C5FA 2KHOA 4IJNA 2IC3A 2KT2A 5AM3A 2CPRA 2P5OA 1WSGA 4BC5A 2UXDF 2ZGZA 3CQXA 3NGIA 3WK9A 1DK3A 1KVKA 3LWMA 1AFJA 1PILA 4QZFA 2BANA 4IEIA 1CUKA 5K8OA 3BQ7A 2MJUA 1W7WA 2YI1A 1ZM3A 1S9EB 2CGLA 2A6AA 1BMQB 1G7CB 4P71A 2HK2A 4I2FA 5BYQA 1X4HA 5DO2A 4QWBA 3E9LA 1SL1A 3SI8A 2F8MA 1GFWB 4K4TA 3K58A 4HKQA 2KKZA 3HX9A 2Q2RA 3OL8A 1N33J 5MLCV 2GV9A 4ECSA 5E3RA 1QUPA 1SQEA 4YOYA 4WCEQ 1NSPA 2KXFA 1Q82O 3IUCA 1OSCA 5HP1B 4HI2A 3BGOP 3SPYA 2HQDA 4QS9A 2H1YA 2HZAA 3ZFVA 1DXSA 3BH6B 2GNKA 2ZUCA 2LXFA 2VBWA 3TW0A 2UUCF 1D8BA 2KZMA 5BRHA 3NCRA 2YMPA 4YDXA 2D41A 2AF6A 1QAJA 1EP4A 1NGIA 1U1QA 2MSNA 3BR9A 5CHCB 5AI6A 3J7A1 5DG9A 3IMXA 1S1WB 4KN7A 4FWKA 2NV3A 4FO6A 1RDBA 4ANDA 5ALJA 1U2CA 3NNHA 2F8HA 1ZQJA 3TNVA 1NNLA 1XWLA 3MECB 2ERRA 2JRSA 4CD1A 3HP6A 2A3JA 3PACA 3WNEA 3H25A 3Q89A 4B1WB 3GTYX 4H5TA 3CFOA 1WI8A 2NREA 3FZMA 3IBCB 2AX1A 2W03A 2AJFE 2PMZD 4DSKA 3NH0A 5HVGA 4HL9A 2XMMA 1L3SA 4DTUA 2AJ4A 3CXCM 4RUBA 3DXKA 3H7IA 4M9NA 2G8FA 1CI4A 1VQ9N 1IBMK 4YN3B 1UHUA 1U45A 3MN5A 3M8YA 4IFYA 5LSOA 4ECVA 7ICUA 4BC9A 1NGJA 4ISGA 2HRTA 2MA1A 2KRBA 1KWMA 4KI4A 1FXRA 3B0YA 4NYZA 9ICBA 2LU1A 2ESEA 5F8NA 2NO5A 3VGVA 5KFVA 2DTJA 1CZAN 3QWUA 4S0MA 2MKIA 2VYPA 2OELA 2AWZA 3BBCA 3WT0A 1FJ7A 3B4DA 1OJ4A 1LK5A 3TEHB 3LPUA 4RUCA 3PIOL 4KLMA 1NG9A 3OTOK 1K47A 4G65A 1RQ0A 4DQ8A 1VQPN 3IN5A 2L41A 5E2QA 2MU2A 4ES2A 4TYAA 2GQCA 2FMQA 5F2RA 2VZ9A 1HBUA 2FVPA 2DBBA 5GAEP 2VWJA 5GAGI 3ETRA 2YKPA 4PUOB 2PT0A 3OYDA 5A0YB 3ZT2A 4CJ3A 1WSJA 3ZO7A 1EJ7L 1ZQVA 1Q86O 3CCJN 2N3LA 1B4SA 1BDGA 2KXHA 1OQ6A 1O03A 1RAAB 4MLEA 3LOUA 1U26A 3Q7CA 4DLEA 1YJUA 4B3SJ 3KHGA 3W61A 2FHKA 4O3RA 4A8FA 3M6WA 2FXUA 2H54B 2K7KA 5AI8A 2RF2A 2GVZB 2AU0A 5CYQA 2GHVC 1HPZA 2IC3B 3P83D 3RWUA 5KFQA 4ACOA 2HBRB 3ENAA 2H3QA 3O5BA 4GKJJ 3I96A 2D0PA 3IP4B 1C1BA 5HVHA 2DCLA 1TQLA 4B8AB 1SC3B 1I3AA 1O8BA 1ZZFA 4L72B 4QPTA 2CPZA 4AE5A 1V97A 4WXOA 1XNSA 2KV2A 4GO5X 4OZ5A 3EUNA 3KJFB 3H0MB 4FJHA 2DHAA 3CCEN 4DL6A 2WUSA 3MURP 2EFVA 2O8DB 1GMUA 4HCCA 1J6ZA 2DGOA 1S72N 4BWMA 4CO2A 1VLYA 3CD6N 4RQ5A 2GO9A 4LJXA 5BRFA 3PR5B 5C42B 3N4WA 3MCMA 3ZI4A 2Q36A 1A5WA 3L6QA 3WKDA 3TI0A 4QIGA 4DCHA 3MXHP 4QWCA 1HBNB 1OWXA 3UO0A 4CP5A 3NASA 4JKDA 4KO0A 2X3GA 5KG2A 2CRLA 3ENHA 5IXUA 3RB6A 1AZSA 3TP2A 4JV5K 4C48A 1DBDA 2VG5A 3HMJG 3NP5A 2DY4A 3CMAS 5LOQA 3G6ES 2XULA 2YWWA 5AQTA 2O8CA 2ETJA 2ZTDA 4JI6K 2BGGA 4NLBA 3PIPQ 2RKIA 3OHAA 3O3LA 2E44A 5DBAA 1S77D 3VQTA 2Y1LB 1HARA 3T3FA 3X3UA 1K1SA 3OGUA 2G8VA 5U47A 4DU3A 3WXIA 1VQPS 4E8UA 2LFVA 2DNZA 3OYIA 1Y0HA 5F8HA 3DRYA 3BGRA 3DNCA 4WFYA 4W5NA 1HEKA 3I55S 1KVCA 3CCJS 3RW6A 3C14A 1NGFA 5GADU 5ADXH 2I6WA 4X4RA 3ISZA 1X4AA 1SS6A 4XTTA 4O44B 5D0RA 5BREA 2YQ1A 3CJ2A 3I5BA 1HNWJ 2CGKA 2K2PA 2JXJA 4E7IA 2DQNB 3W65A 3T1AA 2R7WA 4JKEA 3B6OA 5E33A 4I68A 1N33F 1AA1B 4CZKA 5L1LA 2CQCA 2JOQA 3RJHA 3BGLA 4BDPA 4YD2A 2VOOA 1CJKB 4BY9C 5GVQA 3D6HB 4DN0A 2I1RA 1HNVB 1J27A 4ZPWR 3VEVA 1UETA 3QESA 3MCNA 4U67Q 3HKZC 3VF2A 4US9A 3BREA 2YNFA 4JI1J 3KLFA 3OJUA 7ICRA 4OYIA 1F9EB 4BQLA 2KFNA 1S72S 1VRUA 5IIJA 1NI3A 3CD6S 5FJ4A 1MG7A 3T5JA 2E66A 2YX6A 2AYGA 3IRWP 4UATA 3FEYB 8ICVA 4RJVA 1VSJA 4Z94A 1W2BM 3SQ0A 1T4GA 1VBYA 1FK9A 2PMZF 2Y9HA 3OYNA 1V4TA 4X64K 3I4HX 3M6XA 9ICOA 1Z19A 2VODA 1IH7A 4LT6A 1SIJA 3FZKA 2CJQA 3R8YA 1WF0A 1UEKA 2GELA 2XCPA 2CDRB 2RF2B 3HKWA 3LAKA 1D9FA 2CJAA 3KG0A 3MEKA 1UPMB 2FUG9 3GONA 5CYQB 4W5TA 2FF3B 2IJFA 1HPZB 1FX2A 1I1GA 4IO9Q 1RTZA 3LPYA 4JI2K 3C6UA 4NL5A 3EM1A 2DUYA 4FYXB 4C9DA 4HHJA 5AKZA 4YHHK 3M1FA 1FNMA 5M1KA 4XH1A 4PEOA 5J1EA 4ZPCA 6FDRA 2EW9A 2MYFA 5HL7Q 2A42A 5ALVA 2DISA 3A8YA 2YBVA 1M1KT 1ZQLA 4IDKB 1FO4A 2M9KA 3U1MA 2JX2A 1XEZA 3WK7A 5CH7B 4C11B 3JS6A 1S99A 4DI6A 3GP9A 4ES3A 1VHXA 1K8AT 2MZSA 3KMSA 4PGXA 1MA7A 1U6BA 2MKCA 4ZHRA 2WVEA 4DUYJ 3KLEA 4ZVRB 4CZEA 1O13A 4FLUA 4YY3K 1ZC6A 1TAMA 2ZGYA 4DV3K 3RJJA 3C1ZA 1SXLA 1I94J 2ZH5A 3O9SA 2DGUA 3ENBA 3L09A 3NVVA 2AEJA 4IUFA 3RJIA 1OY9A 3LGHA 3AA8A 3CCSN 3UI3A 3TAEA 5HRNA 4UARA 4HDHA 2CQBA 2IFXA 1ZQNA 1BE4A 5BR8K 3NOCA 1AZSB 2QLXA 3DYAA 2A1SA 4FWLA 1YI2N 1P8GA 1C1CA 2VDHA 2JLEA 4FJGA 3HFKA 2GLEA 4OYAA 4DSJA 4ED2A 2RKIB 1S0MA 1D0EA 2DNYA 1U8SA 4WBFA 1GMVA 1YF5L 2RPIA 5AKEA 4EELA 3JPOA 5KFTA 4NZ6A 3UN2A 5CR4A 1IXRA 4P75A 4I2CA 5CXTA 2WONB 3NS6A 2HF3A 3LAMA 2UUBK 4H4KA 3MPDA 2E7VA 4CHPA 3BGRB 2B51A 3DOKB 5F1XA 1PZNA 3TRGA 2BM1A 3E01B 4L3NA 2XI2A 3OPXA 5M1PA 4NZ7A 4YMOA 5B66U 1IJFB 1TUVA 2KYXA 3L4IA 3ZLJA 3D6MB 1OY8A 1GLEG 3R9KA 5KFOA 1VK8A 3RBZA 2XYPB 1S5LU 2OWOA 1D9DA 4ZMMA 5EOZA 5FPEA 3BZCA 3PRBA 4U96A 2QV6A 2W24A 3OTCA 3DWLA 7ICEA 4ZCIA 5ALPA 1RA6A 4JRPA 5AQSA 3C21A 4AYBC 3CO0P 2Z1IA 1K9MO 2M8HA 4ZJLA 1RGVA 4JYAK 4U67L 4DR3K 4CIFA 4UOFA 4ZJQA 3Q0AA 4PG6A 4NLVA 2ZC3A 2YNFB 3T1YF 8ICQA 4H5NA 2MHEA 7ICTA 2XYGB 4CHQA 1BPDA 2UXBF 1LAVA 1SGGA 2BW2A 4H4OB 4JI8K 2VGNA 2QZ8A 1IBLJ 2DHGA 2DBYA 1KLMB 3K1RB 2YWHA 2FVCA 4XA5A 3DLHA 4FVMA 4WXWA 3JSBA 4YR3A 3FQKA 3CCSS 2I9SA 4PG7A 2CADA 3M6GA 3WBZA 1XK8A 1ZQAA 4RW8A 5F41A 4N8NA 1HYSA 3CCMN 1VQ4N 4OCZA 2GO7A 1F2HA 3SMZA 4FZNA 2O8EA 2RRBA 4JI4J 4LF9K 4PHTX 4RQ8A 5LMNJ 4C8OA 2C2ZB 4FS2A 4I2HA 4WFNQ 2W9BB 3W5YA 2R3VA 4I2QA 5HL7L 2NRXA 3WDOA 2OPSA 3V4MA 1BQXA 3D3BJ 3QPIA 2W8KA 1X3MA 4JK7A 2GTDA 4TLQA 1XC9A 1A0OB 1XQSC 3DRSB 3U02A 4DZDA 1F9HA 2AHOB 3QAEA 3AVGA 3TUZC 2V2KA 3KLEB 3CFPA 2Z30B 3T1HJ 4RLEA 3BDEA 2EFNA 2H65B 2OPQB 4WFAQ 4DU8A 4DFKA 5AM5A 2YNGA 3AL0B 2FDNA 3J81U 1QH9A 1QE1B 4KPYA 5FPMA 4KV8A 1N5SA 3GV8B 5AQVA 1LV5A 4ZP8A 5AXNA 4HACA 3SEOA 2AA4A 3DLKB 2R18A 3VQAA 2F2AB 4ZVEA 4L74A 3FZHA 3OYCA 1ZQDA