1CI4A

The crystal structure of human barrier-to-autointegration factor (baf)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
b'MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF))
molecule tags Dna binding protein
source organism Homo sapiens
publication title Structural basis of DNA bridging by barrier-to-autointegration factor.
pubmed doi rcsb
total genus 29
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1ci4A00
2ODGA 2BZFA 1CI4A 1QCKA 2EZXA 2EZZA 2EZYA
chains in the Genus database with same CATH superfamily
1MC8A 4G9BA 4J9MA 5AK6A 1N63A 2EDUA 1ZQAA 4GLXA 3KZIU 9ICJA 2BCQA 2H3VA 5KFJA 1MA7A 3FYHA 1ZQFA 3B0YA 3F5EA 4RZRA 4Z6FA 1SL1A 5AI4A 2KVSA 3Q8QB 5EWFA 3M7DA 4DLGA 2E1EA 2KKPA 3GIIA 7ICOA 3H4BA 1NK4A 2WF6A 1UHUA 3M8RA 3OGUA 3ORYA 4M0AA 3SENA 1JXLA 5ALHA 1RQNA 4J9QA 2G06A 3D2QA 2GWSA 2OEHA 4RUCA 1Z1VA 3N7RC 3GQCA 4F5OA 2J6TA 3IP4B 4XUSA 4F4YA 8ICTA 1S8OA 4UB6U 2HHVA 4R66A 3M9OB 1ED1A 1KFDA 3PZPA 3RH5A 8ICAA 4QWDA 4DFJA 3G6YA 2JGAA 1ZD5A 2HBLA 2JRZA 4PZOA 3KZXA 2KKVA 2RQ5A 5G5GA 3KD3A 1ZQKA 4QW8A 4MF2A 3AN1A 1ZQGA 1Z4NA 1T94A 5BOMA 3NVVA 3RJFA 1DGJA 2F1IA 2YMQA 2UVWA 5AM4A 3TACB 2LM4A 4QZDA 1SV0C 2GH1A 5KFRA 5AM3A 4DSEA 3HKZC 1JUDA 3PNCA 3WU2U 5ALQA 5L1KA 1MQ2A 5ALPA 2K8AA 5AI6A 4CE6A 5KG7A 2XGQA 4J9PA 3WKDA 4NL9A 1BPXA 2AJQA 5DBCA 3C28A 5AM2A 3RBDA 3RJHA 2ZTDA 1YZ6A 4TQSA 1IIPA 2A1JA 2NRXA 2KP7A 1VDVA 1J2MA 1QSSA 1L8LA 4K4IA 1HUOA 2K4HA 5AKJA 2NRTA 3LVWA 4F5NA 3OSPA 3D6JA 2J6UA 1N62A 3N97B 2Y0SC 5C0YA 2PFNA 3E2EA 9ICUA 1DK2A 2DKXA 5CR0A 1HJPA 2FMQA 5GTIU 1DK3A 4FFDA 2WF9A 2BPGA 4I2BA 2XY5A 1L7PA 1SV4A 4ECSA 5AK4A 2IA6A 2FLNA 3FM9A 1RYRA 2KE7A 4HYKA 5CHGA 4G3IA 3BQTA 4M6WB 4DOAA 4UARA 5DDYA 4F2RA 2VA8A 1N5WA 3Q8KA 2G5IB 3ONNA 2M0NA 2FPKA 2XVTA 5D4BA 1U4BA 4KLJA 4UBBA 4QZ8A 2KFZA 3CP8A 1L7OA 3QUQA 2UVUA 8ICGA 4YVZA 1BNOA 5ALRA 1SZPA 1ZRNA 2BZFA 9ICXA 4NLZA 2DFLA 1D8LA 3RJGA 2QARB 9ICIA 2H3QA 3RB0A 3D2NA 4Z6EA 4R65A 2W9BA 3PSIA 3B0XA 2W9AA 4YD1A 3BZKA 8ICWA 1ECWA 1SL0A 2NO5A 2FMPA 1F44A 3NVYA 4UAWA 3H40A 3S6JA 5J2DA 1ZQMA 4O3RA 3RFAA 5L1JA 4PH5A 5DG7A 2KIVA 9ICFA 1ZQPA 3TARA 1QQ5A 1U45A 3IM1A 5B5EU 2WHEA 5AM0A 2EZXA 2C2EA 2HHXA 4BDPA 4MEXA 2OYYA 4RPYA 1ZJMA 1RG6A 2V4RA 2J6SA 3KFUF 5J0WA 2HW3A 2PI5A 2HCFA 3BQ1A 3N7SC 4C4SA 5AHXA 3KBBA 4Y2JA 4ED8A 1X42A 2GO7A 4RQNA 1B22A 2A1JB 5ALSA 5KG5A 3EYZA 2I9GA 3LYSA 3GIMA 4I2AA 3WKBA 9ICEA 1Q3UA 1Z1BA 5KG0A 3BS5A 1MN8A 9ICTA 4JK1A 5J0RA 4BXOA 3LK9A 4B9MA 4M9LA 4QZBA 4M9NA 4M47A 5DGAA 5IILA 3THVA 2JMGA 2AQ4A 3JPQA 2E5SA 1UA0A 4YR2A 5KFAA 5CJ7A 1WYGA 3EWAA 4KLUA 4UATA 2VA2A 4C8MA 2QKQA 3MR5A 1C7YA 1WWVA 2AGOA 2FPLA 2WF7A 4DF4A 7ICNA 4US8A 3NRZA 2OXOA 3GV5B 2F44A 3O0FA 2QARA 1HEKA 1U9LA 3SAHA 3AM9A 1ZYQA 4LZDA 2N1RA 2XC9A 3JPSA 8ICCA 5DG9A 3B9JA 3NS1A 4NXZA 9ICPA 2ES6A 1L3SA 4PHPA 1Q46A 5CB1A 4R8UB 3GIJA 2G5HB 7ICVA 1ZQUA 2CPRA 4ELUA 4BWMA 2KN7A 2BKEA 3T3FA 2LBOA 4NWIA 4KMUA 4OJOA 4EELA 4F4ZA 4DLEA 5KL8B 2HOIA 4UB8U 2KTQA 7ICPA 4KLQA 1XO0A 4Z6CA 3V7LA 2BCUA 8ICEA 5KFHA 1XWLA 5F9LA 2PFOA 2KFNA 2VIXA 1NJYA 4O5CA 2FI1A 2Y1IA 5KT6A 3PY8A 3AL0B 5C5JA 3QU5A 4YR0A 2KICA 1K1QA 3SV3A 2BQRA 4FBUA 4I2DA 3F2CA 1FFUA 2NV3A 2I1QA 2F1HA 4XA5A 7ICIA 3MR6A 3HWTA 3SV4A 3H0RB 2K60A 1ZQQA 2ZXIA 1B4FA 2OM6A 4ECZA 1YT3A 2ZIXA 3V6KA 4YQWA 3LDAA 3T79A 4DO9A 3ETRA 5J2BA 1TK5A 1L3UA 4K4HA 4YMMA 4KLTA 4KLGA 1ZQBA 2ZIVB 4EX7A 2G0AA 1T3NA 1NK9A 1ZQTA 1QLNA 5F9NA 1BPZA 5JU5A 4M9GA 1KBUA 5DB8A 1V85A 4TQRA 4PJ0U 2PFQA 4DF8A 2W04A 3KKAC 2C2DA 2E8PA 1ZRMA 4ELTA 4P0PA 5KFVA 1RM6C 4UB4A 4CDGA 1X9MA 4CF3A 3NRWA 2YX8A 2QLTA 2XCAA 5EWEA 1PK3A 3WK8A 4NL9C 1JRPA 3ZDCA 4PHAA 3GU3A 5ALTA 4FZLA 3OJSA 1WWUA 2NRWA 4RQ1A 2DQNB 1M6YA 3AQFA 5ALMA 2BCRA 2BPCA 4DSIA 1S97A 2XICA 3L4PA 5CRXA 2IOHA 1UT8A 3IHQB 2XCPA 5J0YA 2QB0B 3MDAA 1NK7A 4QIWC 5DGBA 8ICKA 2BQUA 4XQ8A 4ECYA 1IG6A 3PVXA 4QIWF 3HRDD 1YZ7A 1ZQOA 1JMSA 3AU2A 5EWGA 4RQ0A 3SZ2A 1PVRA 1J97A 1ZXIA 8ICRA 5ALXA 2DPIA 2DUYA 5AKZA 3M1YA 5DQHA 3JPRA 2QB0A 5K4LA 1KRPA 4P4PA 2I6XA 1KFTA 4J9KA 2KK0A 4GC6A 3OHAA 4ECWA 3T5HA 3IG8A 3Q8MA 4Y2VA 2KHQA 3TFSA 8ICFA 1JN3A 5AKKA 2ASLA 4I2JA 2HHSA 4DWIA 2MAXA 1A76A 1KL9A 4RPXA 4DQQA 4RNMA 4NLKA 4ECTA 1FFVA 4GFJA 1JIHA 2AGQA 2WB1F 3PX6A 3T5LA 5G5HA 3QUTA 1L6NA 1BPDA 2NYVA 2ZTEA 3GZFA 4QZHA 5J8YC 4ECQA 4UB2A 4OJ5A 3WK6A 4EBCA 2ISOA 3Q8LA 2KZZA 3MR2A 3RB4A 3T5KA 5IIIA 3RB6A 4RT2A 4DFKA 4F71A 2YQEA 2VA3A 9ICNA 3PW4A 2C2RA 4UAUA 1SWVA 3AQEA 4KMOB 2D8CA 2LM1A 4JV1A 3HILA 4PGQA 5ALLA 4O3MA 2XI9A 4QZEA 1ZQSA 1K5OA 3PMLA 3RJJA 2RRDA 4IR9A 3L3FX 4DL3A 4O3PA 4X5VA 1UCVA 1KSPA 5F3XB 1XO1A 5ALKA 5E79U 4KLEA 1ZQVA 4F4XA 4DQRA 3I1YA 3QUCA 3LWMA 1ZQLA 4C8OA 4I2CA 1OW5A 3UQ0A 9ICWA 2HHQA 1H38A 1SWWA 5KFWA 4FO6A 2LYAA 5IIKA 1J2NA 4NLCA 4R63A 3JPPA 5KT5A 4OJLA 4I2EA 1RYUA 4OD0A 3PX4A 4J9NA 2JV3A 2YY6A 1FIQA 4B9NA 1NK8A 2PKEA 1JXEA 1TKDA 4R8UA 4Y2PA 5DBAA 3HX0A 3AMZA 2Z7JA 2H5XA 3KTQA 2K89A 4Y2YA 1KEJA 1DXSA 3TFRA 3C23A 3PW7A 5ALZA 4KLMA 4GXIA 2ZIXB 3A0BU 5EOZA 2MUTB 2FE9A 4IC9A 4GC7A 1RDFA 4LVSA 3SEIA 3IG5A 2EZZA 5J2AA 3WKEA 3U26A 1ZQIA 3BZCA 2V4QA 5EE0A 2YN4A 2ATLA 3QXGA 2MU2A 2ZIUB 3KKAA 4QWAA 1XC9A 2W8LA 1B0XA 4TUPA 2AGPA 2WB1C 5TISU 3HPOA 2BR0A 3KHLA 3HT3A 3H8WA 3RJEA 3UM9A 4F8RA 2BCSA 4DSKA 4A8EA 3GDXA 1A0PA 9ICGA 2ZUBA 4IQWA 4RQ6A 1Z19A 4UB5A 1DRGA 3MGIA 2KMDA 8ICPA 9ICKA 4ED0A 2MRLA 1NKBA 2ZIVA 5AKXA 5KFPA 5AICA 3SMVA 3G6XA 2EAPA 1NJZA 4EYIB 4B9UA 1F5SA 4QZ9A 4EYHB 7ICKA 2FLLA 1IV8A 5AKGA 1VJ5A 1RQLA 1COOA 4YN4A 4ACOA 3UPQA 3IDWA 4Z6DA 8ICHA 1T7PA 4NJ8A 3WKAA 4RQ3A 1QSLA 1LVHA 2HHTA 3J81j 4UB3A 2VJ4A 3IRUA 4BX9C 4C8KA 2DL0A 2W7PA 2EAMA 3GV8B 4M2YA 5AI8A 4Q43A 1VLBA 4JUZA 4MFCA 2F76X 2AU0A 3V7KA 3G6VA 5KG4A 2YMMA 4DOBA 4MF8A 1S5LU 4NLNA 7ICQA 1S77D 1K1SA 2BDPA 8ICOA 4AP9A 4BUGA 4JB3A 2JXJA 5HMMA 1BPBA 4PPXA 1SIJA 4Y2TA 1RYSA 4CNQA 4RUAA 7ICUA 4O3SA 1JALA 5KFOA 1GO3F 3OSNA 3PW2A 3SQIA 2R8JA 4QZCA 5IIMA 1TAQA 2W9MA 8ICLA 3KHHA 5KFIA 5DG8A 3RH4A 3M9MB 3ZD9A 3QNMA 3EPGA 2B0CA 4KLHA 4O0IA 5ALFA 3C1ZA 4R64A 1T4GA 1BPYA 2OH2A 4DL4A 1HIWA 2ZUCA 2KVCA 4DCCA 3QE9Y 5AI9A 2HDOA 2ODGA 5EE1A 1P7DA 4QZFA 2Y9UA 7ICEA 4RQ8A 3BS7A 3TQ1A 2K4PA 4ECUA 1PK1A 4IRKA 4JV0A 4DQPA 2RDIA 1LKYB 4PZNA 1ZQCA 1N48A 2RLTA 3WK4A 1L3TA 4B9LA 4IRCA 3H4DA 4YFKA 2HMXA 1X2IA 4KX3A 2K4EA 2IOFA 4O3NA 3EUB2 3MFIA 4YMOA 4I29A 3F2BA 4PGYA 3MFHA 4JV2A 2FJ6A 2KOBA 3NGDA 2K8BB 1ZQXA 4DL5A 1TK8A 3DV9A 5DBBA 4GXJA 4RT3A 2EZYA 7ICJA 3K75D 4YG2A 3HP6A 2HOQA 3WKCA 3HKZF 4ECXA 2W55A 2NRZA 2W11A 1X40A 3SYZA 3FC4A 2WFAA 3BS5B 3QYPA 3NVWA 2ZIWB 3AEVA 1SKWA 2P35A 4QWBA 3RRGA 1ZQNA 5DQIA 3PW0A 3A0HU 1BPEA 2JH1A 1KLNA 1LV5A 5AKYA 4J9OA 3C1YA 5DQGA 4Q8FA 5KTQA 3WK7A 4UAYA 1NNLA 2BHNA 3DDHA 2K8CB 4J9RA 2P6UA 3WK5A 1S0MA 2JEGA 2A3VA 2L5YA 5KFFA 5HMLA 2FMSA 4M9HA 3UXNA 1L8OA 1V9PA 2B6GA 4C4RA 5KFNA 4DSFA 1COKA 2KD1A 3RAQA 1KDHA 2ZJAA 4NLBA 4Y2QA 9ICAA 4E0DA 2ISPA 2IBKA 3QU4A 4LZGA 4EEKA 2PI4A 4BXOB 2AH5A 1Z3EB 1A77A 4BGDA 4CCHA 2HBMA 3VC8A 4KLDA 9ICBA 1ZD3A 1QH9A 5KT7A 4P4MA 4J9LA 4NM2A 2R18A 3QEBZ 1QTMA 1Z4OA 5CA7A 3RH6A 3C2LA 4KLOA 3ZD8A 1RPLA 2MA1A 1KKXA 4QZIA 5EE3A 4BJQA 4I2IA 3EZ5A 4Y2XA 3QU9A 2VJ5A 4KN7A 3JPNA 4DL7A 3F5AA 4C4TA 1D8BA 3ZDEA 5KG2A 3H8MA 1EXNA 4KITB 1SXDA 2KJ9A 8ICJA 1WCLA 5KFXA 2PMZF 5TZVA 1PVPA 4RQ7A 1HUZA 7ICHA 5KT3A 5L9XA 5J0SA 4NM1A 4UAVA 3QZ7A 3HJEA 2W9CA 4GIBA 2C22A 4MFAA 5KT2A 5JUMA 2AQ0A 1MQ3A 3ZDAA 2RP5A 1U48A 2IHNA 4Q44A 3PO5A 1QCKA 5HR6A 2F3NA 2W43A 5J0XA 4IRDA 3RTVA 5KG1A 1T3QA 2HSZA 1SXEA 7ICMA 8ICVA 1LKYA 1CRXA 5KT4A 1D9DA 2MUTA 2M9NA 4UQGA 2Y9TA 4C8NA 5KFBA 5CWRA 4QJFB 2KZ3A 5AI0A 4HAIA 1XSNA 4F5QA 2HVHA 1KW4A 2ZJ5A 1L7MA 1XNSA 4QZGA 2W3RA 5KFUA 1Q8KA 3SAFA 1TVAA 4TUSA 2HHUA 4F4KA 5DDMA 8ICSA 4O5KA 1X9WA 1ZQHA 2E8OA 3VCBA 3JPTA 2DKZA 4I2GA 8ICYA 5DB9A 5KFZA 3RF9A 5KG3A 1KFSA 8ICIA 3PV8A 4BWJA 3NASA 1N56A 2XY6A 2XO7A 2WF5A 8ICMA 2ALZA 4YXJA 2E1FA 5ALOA 5AKIA 4YP3A 1RXVA 3UMBA 5KFSA 2Y0SF 4ED7A 5J8YA 5D46A 2I5HA 5J2GA 4DS5A 3BQ2A 4ED2A 3C2MA 2W9BB 4DEZA 5AKHA 4KLFA 1N60A 2CXYA 5J29A 3QZ8A 3OTQA 4QWEA 3CYMA 4EENA 2RHFA 4C80A 4KN4A 3QUBA 3WK9A 1O03A 1ZQWA 4ECRA 3CW2C 5AKEA 9ICSA 3KHGA 4DSLA 4U7CA 1DGSA 3H8SA 3RJIA 5DB6A 3PSFA 2CRXA 4RPZA 3H0MB 2PXIA 4NV0A 1NK5A 4F3OA 2DGZA 1ZQZA 5D49A 1QQ7A 4IL6U 3RB3A 2YB4A 3ZI4A 2OCEA 4F4WA 2LKYA 3TI0A 3ED5A 1A6SA 4Y2RA 5J2HA 3UXOA 5J0TA 1SGGA 3OPXA 2KSOB 5ALJA 2NRVA 5AKLA 4IQVA 5J2CA 1ZD2P 4EX6A 5J0PA 1WCNA 2ZIUA 3TANA 1V97A 3ISCA 3BJYA 4ZH4A 5B66U 2A1AA 1KTQA 1ZQYA 4IR1A 4RQ5A 4O3OA 4P2HA 5J2KA 4DSJA 4RQ4A 1NI3A 5HHHA 3GIKA 1IM4A 3M6ZA 2W54A 1ZETA 2ASDA 4IS7A 5KAIU 3PR5B 3CNHA 4XRHA 2HVIA 2ZTCA 2F1JA 5ALGA 3NTUA 5HHIA 5BPCA 4AYBF 4DOCA 4C8LA 5ALNA 2GOLA 4GXKA 1NKCA 5H2FU 5KAFU 7ICGA 4K4GA 4TURA 4I28A 2BGWA 4O9MA 3UXPA 2K4IA 2EH9A 1D8YA 1OXJA 5ALIA 2DF4B 5CEHA 5J2FA 4ED1A 1RXWA 1QSYA 1ZQRA 1ZOLA 2O6KA 4B9VA 4UASA 2JR5A 2JZBA 3H0LB 4O3QA 3MDCA 3FAHA 2RDJA 3N28A 1TAUA 3D2SA 2YMLA 5AM5A 4F92B 2Q4TA 4OCZA 4QZAA 2KJ5A 2R8GA 3OHBA 4USAA 5ALWA 7ICTA 5AK5A 1Y88A 5AM1A 5JTIA 1UA1A 1ZQDA 3SD7A 1TFRA 1S9FA 2H3ZA 2LPEA 1NJXA 1FEZA 2BCVA 1Z00A 3E0FA 2R8KA 3L5KA 5KFDA 1L7NA 8ICBA 4Y2SA 3RR8A 5DLGA 5BOLA 4FZNA 4RNOA 4M6WA 4CF4A 5DLFA 1TE2A 2YMPA 9ICCA 1UT5A 4DL6A 5T14A 4CF5A 2AHOB 3PMNA 1S0VA 4F91B 3FDSA 3KOOA 2WTFA 2W9CB 1NK0A 4DQIA 9ICHA 1U47A 3V7JA 5J2IA 3SAGA 2HBKA 3IN5A 4DL2A 1FO4A 4JMUA 5ALUA 2W03A 4C7YA 1URJA 1BVSA 1X6JA 4P4OA 3V6JA 1SKSA 4KLSA 2IOFK 4B6JA 4U6PA 2R8IA 1JROA 1D9FA 5AIBA 2W7OA 4ZOHC 1SKRA 1ZQ1C 2ZG6A 4RNNA 5KFMA 3C29A 3TAQA 3M8SA 4Q8EA 4NY8A 4LJXA 5JRTA 2UVRA 2DBYA 1PUZA 2XY7A 3QEAZ 1T8EA 3ALRA 1ZQEA 4J9SA 4ED3A 3PW5A 2JEIA 1JI7A 2JHDA 4YMNA 4ECVA 4MFFA 3Q8RB 4DFPA 1MSWD 1S0OA 4QWCA 1ZJNA 5J2EA 3RJKA 4KLLA 2PFPA 4EZ9A 1UQVA 1XSLA 1S0NA 4OO1J 2JZBB 5HP4A 4UAZA 3AU6A 4FS1A 7ICSA 3M6KA 2OWOA 5KFTA 2EANA 2CN1A 2V9WA 3NVZA 2H3FA 3MGHA 2XGPA 1XU4A 4CRXA 8ICQA 3C5FA 2DPJA 2G09A 1X66A 2KSOA 5KFEA 4YD2A 2MSNA 5IINA 5J0OA 2ZJ8A 4KLIA 1BGXT 5IIOA 4PL2A 3OJUA 2HBJA 4FZMA 3EW9A 2ASJA 1L5UA 4TUQA 3BQ7A 3AUOA 3PR4A 9ICMA 4PL1A 2DWQA 3N4MB 2BPFA 1Q3VA 2F2AB 1AROP 4PHEA 9ICQA 1N61A 5J0UA 3BQ0A 2NO4A 3ETLA 2VANA 5KNIA 1C20A 2LYHA 1TV9A 1X9SA 1QQ6A 2B21A 3C5GA 2BDUA 2KNJA 1LB2B 4M9JA 4JWMA 3QU2A 3TKAA 5J0QA 1SL2A 4IQTA 4P0PB 4EEYA 1NZPA 3E58A 4F72A 2LI6A 4PGXA 8ICNA 4UB1A 1KQQA 4RQMA 3UMCA 3PSTA 2FDRA 4F5PA 3R9KA 2HI0A 4C0ZA 5ALYA 1F0MA 1OUQA 5AI5A 4KTQA 3SR6A 4QW9A 4NLGA 3RAXA 3RBEA 4ED6A 2YTUA 3UQ2A 2E3TA 3V6HA 1DOQA 2EQYA 3TADC 1N2XA 3MBYA 3I76A 4YR3A 2BQ3A 1SZHA 4US9A 2WAQC 1Z00B 5AIAA 1NOMA 2AXTU 2C28A 3MC1A 3MGVA 3C2KA 5KFYA 2D6FC 1X9XA 8ICXA 2W8KA 3NUQA 7ICLA 2IMWP 3ZDDA 1CUKA 4Y2UA 2IHMA 4I2HA 3LVVA 1JX4A 3MR3A 1NKEA 3M9NB 4RU9A 3LWLA 3GV7B 3EPIA 5L1IA 5IIJA 3V72A 2ZUDA 4F5RA 3HW8A 4KX5A 3ICXA 3K4GA 3TAPA 9ICLA 1O08A 5J2JA 3PO4A 4FBTA 2KJ8A 5KFGA 4B9TA 2H3IA 4AYBC 3ISBA 3PX0A 1PVQA 4QNLA 2LYBA 2JH7A 1L3VA 4IQUA 5L1MA 4J03A 3H7IA 3GFKB 3C21A 3Q8PB 7ICFA 5HNKA 3UMGA 2D3DA 3KHRA 3TADA 3DEEA 4P0QB 4FE3A 1CI4A 2F8KA 2PMZC 1U49A 2LHTA 3Q8SB 2KV2A 5A0LA 4DQSA 5KFQA 1UPHA 3CRXA 2W3SA 1SB3C 5ALEA 4M04A 1B43A 4ELVA 1BNPA 2E8MA 1IXRA 1XS9D 2KEYA 3JPOA 1XSPA 1NK6A 4F2SA 3T5JA 2KZMA 4DFDA 2G08A 4B9SA 5ALVA 3QU7A 2ESEA 3QX7A 4FS2A 2JEJA 2E8NA 4RQ2A 4OJPA 1RZTA 2KHVA 4YCXA 1SV0A 3K1ZA 8ICUA 3IV6A 4C7ZA 2HOFA 4WJ3B 2XIDA 5L1LA 4P0QA 3PSPA 4UW9A 5KL1B 2P6RA 5ALDA 3F53A 4O5EA 3I28A 3N7PD 4EBEA 4I2FA 1N5XA 2YB1A 4DS4A 2HHWA 4UBCA 5EE9A 2ZXHA 2P66A 4YXMA 4CGZA 3K1RB 2F8LA 1ZD4A 3RR7A 4EZ6A 3SI8A 3RRHA 1CEZA 1V38A 4DFMA 5KFCA 5KFLA 2Y1JA 1NZBA 2WAQF 1S10A 2GLEA 3GILA 2OHFA 5DB7A 4EBDA 1ZQJA 2VKQA 2QB1A 2JEFA 2FLPA 2Q0ZX 2KG5A 4F50A 3F2DA 1WG8A 3ZDBA 2G07A 3H8JA 9ICVA 5AK3A 1AQ6A 1PZNA 4ICAA 2UVVA 5DKWA 7ICRA 1X6IA 5KG6A 2KIWA 2R8HA 3ISDA 1KN5A 9ICOA 4MHVA 4MEYA 2LMRA 2WF8A 1PK1B 4Q45A 5KFKA 2F77X 4PHDA 5GTHU 5HR7A 4OJ6A 5CP2A 4JWNA 2A19A 1S76D 1NJWA 4F93B 3BDPA 1WUDA 1TAMA 2EAOA 8ICZA 3MABA 1TK0A 9ICRA 5FP0A 4I27A 2FPMA 2ZIWA
chains in the Genus database with same CATH topology
2ODGA 2BZFA 1CI4A 1QCKA 2EZXA 2EZZA 2EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODG A;  2BZF A;  1CI4 A;  1QCK A;  2EZX A;  2EZZ A;  2EZY A; 
#chains in the Genus database with same CATH topology
 1MC8 A;  4G9B A;  4J9M A;  5AK6 A;  1N63 A;  2EDU A;  1ZQA A;  4GLX A;  3KZI U;  9ICJ A;  2BCQ A;  2H3V A;  5KFJ A;  1MA7 A;  3FYH A;  1ZQF A;  3B0Y A;  3F5E A;  4RZR A;  4Z6F A;  1SL1 A;  5AI4 A;  2KVS A;  3Q8Q B;  5EWF A;  3M7D A;  4DLG A;  2E1E A;  2KKP A;  3GII A;  7ICO A;  3H4B A;  1NK4 A;  2WF6 A;  1UHU A;  3M8R A;  3OGU A;  3ORY A;  4M0A A;  3SEN A;  1JXL A;  5ALH A;  1RQN A;  4J9Q A;  2G06 A;  3D2Q A;  2GWS A;  2OEH A;  4RUC A;  1Z1V A;  3N7R C;  3GQC A;  4F5O A;  2J6T A;  3IP4 B;  4XUS A;  4F4Y A;  8ICT A;  1S8O A;  4UB6 U;  2HHV A;  4R66 A;  3M9O B;  1ED1 A;  1KFD A;  3PZP A;  3RH5 A;  8ICA A;  4QWD A;  4DFJ A;  3G6Y A;  2JGA A;  1ZD5 A;  2HBL A;  2JRZ A;  4PZO A;  3KZX A;  2KKV A;  2RQ5 A;  5G5G A;  3KD3 A;  1ZQK A;  4QW8 A;  4MF2 A;  3AN1 A;  1ZQG A;  1Z4N A;  1T94 A;  5BOM A;  3NVV A;  3RJF A;  1DGJ A;  2F1I A;  2YMQ A;  2UVW A;  5AM4 A;  3TAC B;  2LM4 A;  4QZD A;  1SV0 C;  2GH1 A;  5KFR A;  5AM3 A;  4DSE A;  3HKZ C;  1JUD A;  3PNC A;  3WU2 U;  5ALQ A;  5L1K A;  1MQ2 A;  5ALP A;  2K8A A;  5AI6 A;  4CE6 A;  5KG7 A;  2XGQ A;  4J9P A;  3WKD A;  4NL9 A;  1BPX A;  2AJQ A;  5DBC A;  3C28 A;  5AM2 A;  3RBD A;  3RJH A;  2ZTD A;  1YZ6 A;  4TQS A;  1IIP A;  2A1J A;  2NRX A;  2KP7 A;  1VDV A;  1J2M A;  1QSS A;  1L8L A;  4K4I A;  1HUO A;  2K4H A;  5AKJ A;  2NRT A;  3LVW A;  4F5N A;  3OSP A;  3D6J A;  2J6U A;  1N62 A;  3N97 B;  2Y0S C;  5C0Y A;  2PFN A;  3E2E A;  9ICU A;  1DK2 A;  2DKX A;  5CR0 A;  1HJP A;  2FMQ A;  5GTI U;  1DK3 A;  4FFD A;  2WF9 A;  2BPG A;  4I2B A;  2XY5 A;  1L7P A;  1SV4 A;  4ECS A;  5AK4 A;  2IA6 A;  2FLN A;  3FM9 A;  1RYR A;  2KE7 A;  4HYK A;  5CHG A;  4G3I A;  3BQT A;  4M6W B;  4DOA A;  4UAR A;  5DDY A;  4F2R A;  2VA8 A;  1N5W A;  3Q8K A;  2G5I B;  3ONN A;  2M0N A;  2FPK A;  2XVT A;  5D4B A;  1U4B A;  4KLJ A;  4UBB A;  4QZ8 A;  2KFZ A;  3CP8 A;  1L7O A;  3QUQ A;  2UVU A;  8ICG A;  4YVZ A;  1BNO A;  5ALR A;  1SZP A;  1ZRN A;  2BZF A;  9ICX A;  4NLZ A;  2DFL A;  1D8L A;  3RJG A;  2QAR B;  9ICI A;  2H3Q A;  3RB0 A;  3D2N A;  4Z6E A;  4R65 A;  2W9B A;  3PSI A;  3B0X A;  2W9A A;  4YD1 A;  3BZK A;  8ICW A;  1ECW A;  1SL0 A;  2NO5 A;  2FMP A;  1F44 A;  3NVY A;  4UAW A;  3H40 A;  3S6J A;  5J2D A;  1ZQM A;  4O3R A;  3RFA A;  5L1J A;  4PH5 A;  5DG7 A;  2KIV A;  9ICF A;  1ZQP A;  3TAR A;  1QQ5 A;  1U45 A;  3IM1 A;  5B5E U;  2WHE A;  5AM0 A;  2EZX A;  2C2E A;  2HHX A;  4BDP A;  4MEX A;  2OYY A;  4RPY A;  1ZJM A;  1RG6 A;  2V4R A;  2J6S A;  3KFU F;  5J0W A;  2HW3 A;  2PI5 A;  2HCF A;  3BQ1 A;  3N7S C;  4C4S A;  5AHX A;  3KBB A;  4Y2J A;  4ED8 A;  1X42 A;  2GO7 A;  4RQN A;  1B22 A;  2A1J B;  5ALS A;  5KG5 A;  3EYZ A;  2I9G A;  3LYS A;  3GIM A;  4I2A A;  3WKB A;  9ICE A;  1Q3U A;  1Z1B A;  5KG0 A;  3BS5 A;  1MN8 A;  9ICT A;  4JK1 A;  5J0R A;  4BXO A;  3LK9 A;  4B9M A;  4M9L A;  4QZB A;  4M9N A;  4M47 A;  5DGA A;  5IIL A;  3THV A;  2JMG A;  2AQ4 A;  3JPQ A;  2E5S A;  1UA0 A;  4YR2 A;  5KFA A;  5CJ7 A;  1WYG A;  3EWA A;  4KLU A;  4UAT A;  2VA2 A;  4C8M A;  2QKQ A;  3MR5 A;  1C7Y A;  1WWV A;  2AGO A;  2FPL A;  2WF7 A;  4DF4 A;  7ICN A;  4US8 A;  3NRZ A;  2OXO A;  3GV5 B;  2F44 A;  3O0F A;  2QAR A;  1HEK A;  1U9L A;  3SAH A;  3AM9 A;  1ZYQ A;  4LZD A;  2N1R A;  2XC9 A;  3JPS A;  8ICC A;  5DG9 A;  3B9J A;  3NS1 A;  4NXZ A;  9ICP A;  2ES6 A;  1L3S A;  4PHP A;  1Q46 A;  5CB1 A;  4R8U B;  3GIJ A;  2G5H B;  7ICV A;  1ZQU A;  2CPR A;  4ELU A;  4BWM A;  2KN7 A;  2BKE A;  3T3F A;  2LBO A;  4NWI A;  4KMU A;  4OJO A;  4EEL A;  4F4Z A;  4DLE A;  5KL8 B;  2HOI A;  4UB8 U;  2KTQ A;  7ICP A;  4KLQ A;  1XO0 A;  4Z6C A;  3V7L A;  2BCU A;  8ICE A;  5KFH A;  1XWL A;  5F9L A;  2PFO A;  2KFN A;  2VIX A;  1NJY A;  4O5C A;  2FI1 A;  2Y1I A;  5KT6 A;  3PY8 A;  3AL0 B;  5C5J A;  3QU5 A;  4YR0 A;  2KIC A;  1K1Q A;  3SV3 A;  2BQR A;  4FBU A;  4I2D A;  3F2C A;  1FFU A;  2NV3 A;  2I1Q A;  2F1H A;  4XA5 A;  7ICI A;  3MR6 A;  3HWT A;  3SV4 A;  3H0R B;  2K60 A;  1ZQQ A;  2ZXI A;  1B4F A;  2OM6 A;  4ECZ A;  1YT3 A;  2ZIX A;  3V6K A;  4YQW A;  3LDA A;  3T79 A;  4DO9 A;  3ETR A;  5J2B A;  1TK5 A;  1L3U A;  4K4H A;  4YMM A;  4KLT A;  4KLG A;  1ZQB A;  2ZIV B;  4EX7 A;  2G0A A;  1T3N A;  1NK9 A;  1ZQT A;  1QLN A;  5F9N A;  1BPZ A;  5JU5 A;  4M9G A;  1KBU A;  5DB8 A;  1V85 A;  4TQR A;  4PJ0 U;  2PFQ A;  4DF8 A;  2W04 A;  3KKA C;  2C2D A;  2E8P A;  1ZRM A;  4ELT A;  4P0P A;  5KFV A;  1RM6 C;  4UB4 A;  4CDG A;  1X9M A;  4CF3 A;  3NRW A;  2YX8 A;  2QLT A;  2XCA A;  5EWE A;  1PK3 A;  3WK8 A;  4NL9 C;  1JRP A;  3ZDC A;  4PHA A;  3GU3 A;  5ALT A;  4FZL A;  3OJS A;  1WWU A;  2NRW A;  4RQ1 A;  2DQN B;  1M6Y A;  3AQF A;  5ALM A;  2BCR A;  2BPC A;  4DSI A;  1S97 A;  2XIC A;  3L4P A;  5CRX A;  2IOH A;  1UT8 A;  3IHQ B;  2XCP A;  5J0Y A;  2QB0 B;  3MDA A;  1NK7 A;  4QIW C;  5DGB A;  8ICK A;  2BQU A;  4XQ8 A;  4ECY A;  1IG6 A;  3PVX A;  4QIW F;  3HRD D;  1YZ7 A;  1ZQO A;  1JMS A;  3AU2 A;  5EWG A;  4RQ0 A;  3SZ2 A;  1PVR A;  1J97 A;  1ZXI A;  8ICR A;  5ALX A;  2DPI A;  2DUY A;  5AKZ A;  3M1Y A;  5DQH A;  3JPR A;  2QB0 A;  5K4L A;  1KRP A;  4P4P A;  2I6X A;  1KFT A;  4J9K A;  2KK0 A;  4GC6 A;  3OHA A;  4ECW A;  3T5H A;  3IG8 A;  3Q8M A;  4Y2V A;  2KHQ A;  3TFS A;  8ICF A;  1JN3 A;  5AKK A;  2ASL A;  4I2J A;  2HHS A;  4DWI A;  2MAX A;  1A76 A;  1KL9 A;  4RPX A;  4DQQ A;  4RNM A;  4NLK A;  4ECT A;  1FFV A;  4GFJ A;  1JIH A;  2AGQ A;  2WB1 F;  3PX6 A;  3T5L A;  5G5H A;  3QUT A;  1L6N A;  1BPD A;  2NYV A;  2ZTE A;  3GZF A;  4QZH A;  5J8Y C;  4ECQ A;  4UB2 A;  4OJ5 A;  3WK6 A;  4EBC A;  2ISO A;  3Q8L A;  2KZZ A;  3MR2 A;  3RB4 A;  3T5K A;  5III A;  3RB6 A;  4RT2 A;  4DFK A;  4F71 A;  2YQE A;  2VA3 A;  9ICN A;  3PW4 A;  2C2R A;  4UAU A;  1SWV A;  3AQE A;  4KMO B;  2D8C A;  2LM1 A;  4JV1 A;  3HIL A;  4PGQ A;  5ALL A;  4O3M A;  2XI9 A;  4QZE A;  1ZQS A;  1K5O A;  3PML A;  3RJJ A;  2RRD A;  4IR9 A;  3L3F X;  4DL3 A;  4O3P A;  4X5V A;  1UCV A;  1KSP A;  5F3X B;  1XO1 A;  5ALK A;  5E79 U;  4KLE A;  1ZQV A;  4F4X A;  4DQR A;  3I1Y A;  3QUC A;  3LWM A;  1ZQL A;  4C8O A;  4I2C A;  1OW5 A;  3UQ0 A;  9ICW A;  2HHQ A;  1H38 A;  1SWW A;  5KFW A;  4FO6 A;  2LYA A;  5IIK A;  1J2N A;  4NLC A;  4R63 A;  3JPP A;  5KT5 A;  4OJL A;  4I2E A;  1RYU A;  4OD0 A;  3PX4 A;  4J9N A;  2JV3 A;  2YY6 A;  1FIQ A;  4B9N A;  1NK8 A;  2PKE A;  1JXE A;  1TKD A;  4R8U A;  4Y2P A;  5DBA A;  3HX0 A;  3AMZ A;  2Z7J A;  2H5X A;  3KTQ A;  2K89 A;  4Y2Y A;  1KEJ A;  1DXS A;  3TFR A;  3C23 A;  3PW7 A;  5ALZ A;  4KLM A;  4GXI A;  2ZIX B;  3A0B U;  5EOZ A;  2MUT B;  2FE9 A;  4IC9 A;  4GC7 A;  1RDF A;  4LVS A;  3SEI A;  3IG5 A;  2EZZ A;  5J2A A;  3WKE A;  3U26 A;  1ZQI A;  3BZC A;  2V4Q A;  5EE0 A;  2YN4 A;  2ATL A;  3QXG A;  2MU2 A;  2ZIU B;  3KKA A;  4QWA A;  1XC9 A;  2W8L A;  1B0X A;  4TUP A;  2AGP A;  2WB1 C;  5TIS U;  3HPO A;  2BR0 A;  3KHL A;  3HT3 A;  3H8W A;  3RJE A;  3UM9 A;  4F8R A;  2BCS A;  4DSK A;  4A8E A;  3GDX A;  1A0P A;  9ICG A;  2ZUB A;  4IQW A;  4RQ6 A;  1Z19 A;  4UB5 A;  1DRG A;  3MGI A;  2KMD A;  8ICP A;  9ICK A;  4ED0 A;  2MRL A;  1NKB A;  2ZIV A;  5AKX A;  5KFP A;  5AIC A;  3SMV A;  3G6X A;  2EAP A;  1NJZ A;  4EYI B;  4B9U A;  1F5S A;  4QZ9 A;  4EYH B;  7ICK A;  2FLL A;  1IV8 A;  5AKG A;  1VJ5 A;  1RQL A;  1COO A;  4YN4 A;  4ACO A;  3UPQ A;  3IDW A;  4Z6D A;  8ICH A;  1T7P A;  4NJ8 A;  3WKA A;  4RQ3 A;  1QSL A;  1LVH A;  2HHT A;  3J81 j;  4UB3 A;  2VJ4 A;  3IRU A;  4BX9 C;  4C8K A;  2DL0 A;  2W7P A;  2EAM A;  3GV8 B;  4M2Y A;  5AI8 A;  4Q43 A;  1VLB A;  4JUZ A;  4MFC A;  2F76 X;  2AU0 A;  3V7K A;  3G6V A;  5KG4 A;  2YMM A;  4DOB A;  4MF8 A;  1S5L U;  4NLN A;  7ICQ A;  1S77 D;  1K1S A;  2BDP A;  8ICO A;  4AP9 A;  4BUG A;  4JB3 A;  2JXJ A;  5HMM A;  1BPB A;  4PPX A;  1SIJ A;  4Y2T A;  1RYS A;  4CNQ A;  4RUA A;  7ICU A;  4O3S A;  1JAL A;  5KFO A;  1GO3 F;  3OSN A;  3PW2 A;  3SQI A;  2R8J A;  4QZC A;  5IIM A;  1TAQ A;  2W9M A;  8ICL A;  3KHH A;  5KFI A;  5DG8 A;  3RH4 A;  3M9M B;  3ZD9 A;  3QNM A;  3EPG A;  2B0C A;  4KLH A;  4O0I A;  5ALF A;  3C1Z A;  4R64 A;  1T4G A;  1BPY A;  2OH2 A;  4DL4 A;  1HIW A;  2ZUC A;  2KVC A;  4DCC A;  3QE9 Y;  5AI9 A;  2HDO A;  2ODG A;  5EE1 A;  1P7D A;  4QZF A;  2Y9U A;  7ICE A;  4RQ8 A;  3BS7 A;  3TQ1 A;  2K4P A;  4ECU A;  1PK1 A;  4IRK A;  4JV0 A;  4DQP A;  2RDI A;  1LKY B;  4PZN A;  1ZQC A;  1N48 A;  2RLT A;  3WK4 A;  1L3T A;  4B9L A;  4IRC A;  3H4D A;  4YFK A;  2HMX A;  1X2I A;  4KX3 A;  2K4E A;  2IOF A;  4O3N A;  3EUB 2;  3MFI A;  4YMO A;  4I29 A;  3F2B A;  4PGY A;  3MFH A;  4JV2 A;  2FJ6 A;  2KOB A;  3NGD A;  2K8B B;  1ZQX A;  4DL5 A;  1TK8 A;  3DV9 A;  5DBB A;  4GXJ A;  4RT3 A;  2EZY A;  7ICJ A;  3K75 D;  4YG2 A;  3HP6 A;  2HOQ A;  3WKC A;  3HKZ F;  4ECX A;  2W55 A;  2NRZ A;  2W11 A;  1X40 A;  3SYZ A;  3FC4 A;  2WFA A;  3BS5 B;  3QYP A;  3NVW A;  2ZIW B;  3AEV A;  1SKW A;  2P35 A;  4QWB A;  3RRG A;  1ZQN A;  5DQI A;  3PW0 A;  3A0H U;  1BPE A;  2JH1 A;  1KLN A;  1LV5 A;  5AKY A;  4J9O A;  3C1Y A;  5DQG A;  4Q8F A;  5KTQ A;  3WK7 A;  4UAY A;  1NNL A;  2BHN A;  3DDH A;  2K8C B;  4J9R A;  2P6U A;  3WK5 A;  1S0M A;  2JEG A;  2A3V A;  2L5Y A;  5KFF A;  5HML A;  2FMS A;  4M9H A;  3UXN A;  1L8O A;  1V9P A;  2B6G A;  4C4R A;  5KFN A;  4DSF A;  1COK A;  2KD1 A;  3RAQ A;  1KDH A;  2ZJA A;  4NLB A;  4Y2Q A;  9ICA A;  4E0D A;  2ISP A;  2IBK A;  3QU4 A;  4LZG A;  4EEK A;  2PI4 A;  4BXO B;  2AH5 A;  1Z3E B;  1A77 A;  4BGD A;  4CCH A;  2HBM A;  3VC8 A;  4KLD A;  9ICB A;  1ZD3 A;  1QH9 A;  5KT7 A;  4P4M A;  4J9L A;  4NM2 A;  2R18 A;  3QEB Z;  1QTM A;  1Z4O A;  5CA7 A;  3RH6 A;  3C2L A;  4KLO A;  3ZD8 A;  1RPL A;  2MA1 A;  1KKX A;  4QZI A;  5EE3 A;  4BJQ A;  4I2I A;  3EZ5 A;  4Y2X A;  3QU9 A;  2VJ5 A;  4KN7 A;  3JPN A;  4DL7 A;  3F5A A;  4C4T A;  1D8B A;  3ZDE A;  5KG2 A;  3H8M A;  1EXN A;  4KIT B;  1SXD A;  2KJ9 A;  8ICJ A;  1WCL A;  5KFX A;  2PMZ F;  5TZV A;  1PVP A;  4RQ7 A;  1HUZ A;  7ICH A;  5KT3 A;  5L9X A;  5J0S A;  4NM1 A;  4UAV A;  3QZ7 A;  3HJE A;  2W9C A;  4GIB A;  2C22 A;  4MFA A;  5KT2 A;  5JUM A;  2AQ0 A;  1MQ3 A;  3ZDA A;  2RP5 A;  1U48 A;  2IHN A;  4Q44 A;  3PO5 A;  1QCK A;  5HR6 A;  2F3N A;  2W43 A;  5J0X A;  4IRD A;  3RTV A;  5KG1 A;  1T3Q A;  2HSZ A;  1SXE A;  7ICM A;  8ICV A;  1LKY A;  1CRX A;  5KT4 A;  1D9D A;  2MUT A;  2M9N A;  4UQG A;  2Y9T A;  4C8N A;  5KFB A;  5CWR A;  4QJF B;  2KZ3 A;  5AI0 A;  4HAI A;  1XSN A;  4F5Q A;  2HVH A;  1KW4 A;  2ZJ5 A;  1L7M A;  1XNS A;  4QZG A;  2W3R A;  5KFU A;  1Q8K A;  3SAF A;  1TVA A;  4TUS A;  2HHU A;  4F4K A;  5DDM A;  8ICS A;  4O5K A;  1X9W A;  1ZQH A;  2E8O A;  3VCB A;  3JPT A;  2DKZ A;  4I2G A;  8ICY A;  5DB9 A;  5KFZ A;  3RF9 A;  5KG3 A;  1KFS A;  8ICI A;  3PV8 A;  4BWJ A;  3NAS A;  1N56 A;  2XY6 A;  2XO7 A;  2WF5 A;  8ICM A;  2ALZ A;  4YXJ A;  2E1F A;  5ALO A;  5AKI A;  4YP3 A;  1RXV A;  3UMB A;  5KFS A;  2Y0S F;  4ED7 A;  5J8Y A;  5D46 A;  2I5H A;  5J2G A;  4DS5 A;  3BQ2 A;  4ED2 A;  3C2M A;  2W9B B;  4DEZ A;  5AKH A;  4KLF A;  1N60 A;  2CXY A;  5J29 A;  3QZ8 A;  3OTQ A;  4QWE A;  3CYM A;  4EEN A;  2RHF A;  4C80 A;  4KN4 A;  3QUB A;  3WK9 A;  1O03 A;  1ZQW A;  4ECR A;  3CW2 C;  5AKE A;  9ICS A;  3KHG A;  4DSL A;  4U7C A;  1DGS A;  3H8S A;  3RJI A;  5DB6 A;  3PSF A;  2CRX A;  4RPZ A;  3H0M B;  2PXI A;  4NV0 A;  1NK5 A;  4F3O A;  2DGZ A;  1ZQZ A;  5D49 A;  1QQ7 A;  4IL6 U;  3RB3 A;  2YB4 A;  3ZI4 A;  2OCE A;  4F4W A;  2LKY A;  3TI0 A;  3ED5 A;  1A6S A;  4Y2R A;  5J2H A;  3UXO A;  5J0T A;  1SGG A;  3OPX A;  2KSO B;  5ALJ A;  2NRV A;  5AKL A;  4IQV A;  5J2C A;  1ZD2 P;  4EX6 A;  5J0P A;  1WCN A;  2ZIU A;  3TAN A;  1V97 A;  3ISC A;  3BJY A;  4ZH4 A;  5B66 U;  2A1A A;  1KTQ A;  1ZQY A;  4IR1 A;  4RQ5 A;  4O3O A;  4P2H A;  5J2K A;  4DSJ A;  4RQ4 A;  1NI3 A;  5HHH A;  3GIK A;  1IM4 A;  3M6Z A;  2W54 A;  1ZET A;  2ASD A;  4IS7 A;  5KAI U;  3PR5 B;  3CNH A;  4XRH A;  2HVI A;  2ZTC A;  2F1J A;  5ALG A;  3NTU A;  5HHI A;  5BPC A;  4AYB F;  4DOC A;  4C8L A;  5ALN A;  2GOL A;  4GXK A;  1NKC A;  5H2F U;  5KAF U;  7ICG A;  4K4G A;  4TUR A;  4I28 A;  2BGW A;  4O9M A;  3UXP A;  2K4I A;  2EH9 A;  1D8Y A;  1OXJ A;  5ALI A;  2DF4 B;  5CEH A;  5J2F A;  4ED1 A;  1RXW A;  1QSY A;  1ZQR A;  1ZOL A;  2O6K A;  4B9V A;  4UAS A;  2JR5 A;  2JZB A;  3H0L B;  4O3Q A;  3MDC A;  3FAH A;  2RDJ A;  3N28 A;  1TAU A;  3D2S A;  2YML A;  5AM5 A;  4F92 B;  2Q4T A;  4OCZ A;  4QZA A;  2KJ5 A;  2R8G A;  3OHB A;  4USA A;  5ALW A;  7ICT A;  5AK5 A;  1Y88 A;  5AM1 A;  5JTI A;  1UA1 A;  1ZQD A;  3SD7 A;  1TFR A;  1S9F A;  2H3Z A;  2LPE A;  1NJX A;  1FEZ A;  2BCV A;  1Z00 A;  3E0F A;  2R8K A;  3L5K A;  5KFD A;  1L7N A;  8ICB A;  4Y2S A;  3RR8 A;  5DLG A;  5BOL A;  4FZN A;  4RNO A;  4M6W A;  4CF4 A;  5DLF A;  1TE2 A;  2YMP A;  9ICC A;  1UT5 A;  4DL6 A;  5T14 A;  4CF5 A;  2AHO B;  3PMN A;  1S0V A;  4F91 B;  3FDS A;  3KOO A;  2WTF A;  2W9C B;  1NK0 A;  4DQI A;  9ICH A;  1U47 A;  3V7J A;  5J2I A;  3SAG A;  2HBK A;  3IN5 A;  4DL2 A;  1FO4 A;  4JMU A;  5ALU A;  2W03 A;  4C7Y A;  1URJ A;  1BVS A;  1X6J A;  4P4O A;  3V6J A;  1SKS A;  4KLS A;  2IOF K;  4B6J A;  4U6P A;  2R8I A;  1JRO A;  1D9F A;  5AIB A;  2W7O A;  4ZOH C;  1SKR A;  1ZQ1 C;  2ZG6 A;  4RNN A;  5KFM A;  3C29 A;  3TAQ A;  3M8S A;  4Q8E A;  4NY8 A;  4LJX A;  5JRT A;  2UVR A;  2DBY A;  1PUZ A;  2XY7 A;  3QEA Z;  1T8E A;  3ALR A;  1ZQE A;  4J9S A;  4ED3 A;  3PW5 A;  2JEI A;  1JI7 A;  2JHD A;  4YMN A;  4ECV A;  4MFF A;  3Q8R B;  4DFP A;  1MSW D;  1S0O A;  4QWC A;  1ZJN A;  5J2E A;  3RJK A;  4KLL A;  2PFP A;  4EZ9 A;  1UQV A;  1XSL A;  1S0N A;  4OO1 J;  2JZB B;  5HP4 A;  4UAZ A;  3AU6 A;  4FS1 A;  7ICS A;  3M6K A;  2OWO A;  5KFT A;  2EAN A;  2CN1 A;  2V9W A;  3NVZ A;  2H3F A;  3MGH A;  2XGP A;  1XU4 A;  4CRX A;  8ICQ A;  3C5F A;  2DPJ A;  2G09 A;  1X66 A;  2KSO A;  5KFE A;  4YD2 A;  2MSN A;  5IIN A;  5J0O A;  2ZJ8 A;  4KLI A;  1BGX T;  5IIO A;  4PL2 A;  3OJU A;  2HBJ A;  4FZM A;  3EW9 A;  2ASJ A;  1L5U A;  4TUQ A;  3BQ7 A;  3AUO A;  3PR4 A;  9ICM A;  4PL1 A;  2DWQ A;  3N4M B;  2BPF A;  1Q3V A;  2F2A B;  1ARO P;  4PHE A;  9ICQ A;  1N61 A;  5J0U A;  3BQ0 A;  2NO4 A;  3ETL A;  2VAN A;  5KNI A;  1C20 A;  2LYH A;  1TV9 A;  1X9S A;  1QQ6 A;  2B21 A;  3C5G A;  2BDU A;  2KNJ A;  1LB2 B;  4M9J A;  4JWM A;  3QU2 A;  3TKA A;  5J0Q A;  1SL2 A;  4IQT A;  4P0P B;  4EEY A;  1NZP A;  3E58 A;  4F72 A;  2LI6 A;  4PGX A;  8ICN A;  4UB1 A;  1KQQ A;  4RQM A;  3UMC A;  3PST A;  2FDR A;  4F5P A;  3R9K A;  2HI0 A;  4C0Z A;  5ALY A;  1F0M A;  1OUQ A;  5AI5 A;  4KTQ A;  3SR6 A;  4QW9 A;  4NLG A;  3RAX A;  3RBE A;  4ED6 A;  2YTU A;  3UQ2 A;  2E3T A;  3V6H A;  1DOQ A;  2EQY A;  3TAD C;  1N2X A;  3MBY A;  3I76 A;  4YR3 A;  2BQ3 A;  1SZH A;  4US9 A;  2WAQ C;  1Z00 B;  5AIA A;  1NOM A;  2AXT U;  2C28 A;  3MC1 A;  3MGV A;  3C2K A;  5KFY A;  2D6F C;  1X9X A;  8ICX A;  2W8K A;  3NUQ A;  7ICL A;  2IMW P;  3ZDD A;  1CUK A;  4Y2U A;  2IHM A;  4I2H A;  3LVV A;  1JX4 A;  3MR3 A;  1NKE A;  3M9N B;  4RU9 A;  3LWL A;  3GV7 B;  3EPI A;  5L1I A;  5IIJ A;  3V72 A;  2ZUD A;  4F5R A;  3HW8 A;  4KX5 A;  3ICX A;  3K4G A;  3TAP A;  9ICL A;  1O08 A;  5J2J A;  3PO4 A;  4FBT A;  2KJ8 A;  5KFG A;  4B9T A;  2H3I A;  4AYB C;  3ISB A;  3PX0 A;  1PVQ A;  4QNL A;  2LYB A;  2JH7 A;  1L3V A;  4IQU A;  5L1M A;  4J03 A;  3H7I A;  3GFK B;  3C21 A;  3Q8P B;  7ICF A;  5HNK A;  3UMG A;  2D3D A;  3KHR A;  3TAD A;  3DEE A;  4P0Q B;  4FE3 A;  1CI4 A;  2F8K A;  2PMZ C;  1U49 A;  2LHT A;  3Q8S B;  2KV2 A;  5A0L A;  4DQS A;  5KFQ A;  1UPH A;  3CRX A;  2W3S A;  1SB3 C;  5ALE A;  4M04 A;  1B43 A;  4ELV A;  1BNP A;  2E8M A;  1IXR A;  1XS9 D;  2KEY A;  3JPO A;  1XSP A;  1NK6 A;  4F2S A;  3T5J A;  2KZM A;  4DFD A;  2G08 A;  4B9S A;  5ALV A;  3QU7 A;  2ESE A;  3QX7 A;  4FS2 A;  2JEJ A;  2E8N A;  4RQ2 A;  4OJP A;  1RZT A;  2KHV A;  4YCX A;  1SV0 A;  3K1Z A;  8ICU A;  3IV6 A;  4C7Z A;  2HOF A;  4WJ3 B;  2XID A;  5L1L A;  4P0Q A;  3PSP A;  4UW9 A;  5KL1 B;  2P6R A;  5ALD A;  3F53 A;  4O5E A;  3I28 A;  3N7P D;  4EBE A;  4I2F A;  1N5X A;  2YB1 A;  4DS4 A;  2HHW A;  4UBC A;  5EE9 A;  2ZXH A;  2P66 A;  4YXM A;  4CGZ A;  3K1R B;  2F8L A;  1ZD4 A;  3RR7 A;  4EZ6 A;  3SI8 A;  3RRH A;  1CEZ A;  1V38 A;  4DFM A;  5KFC A;  5KFL A;  2Y1J A;  1NZB A;  2WAQ F;  1S10 A;  2GLE A;  3GIL A;  2OHF A;  5DB7 A;  4EBD A;  1ZQJ A;  2VKQ A;  2QB1 A;  2JEF A;  2FLP A;  2Q0Z X;  2KG5 A;  4F50 A;  3F2D A;  1WG8 A;  3ZDB A;  2G07 A;  3H8J A;  9ICV A;  5AK3 A;  1AQ6 A;  1PZN A;  4ICA A;  2UVV A;  5DKW A;  7ICR A;  1X6I A;  5KG6 A;  2KIW A;  2R8H A;  3ISD A;  1KN5 A;  9ICO A;  4MHV A;  4MEY A;  2LMR A;  2WF8 A;  1PK1 B;  4Q45 A;  5KFK A;  2F77 X;  4PHD A;  5GTH U;  5HR7 A;  4OJ6 A;  5CP2 A;  4JWN A;  2A19 A;  1S76 D;  1NJW A;  4F93 B;  3BDP A;  1WUD A;  1TAM A;  2EAO A;  8ICZ A;  3MAB A;  1TK0 A;  9ICR A;  5FP0 A;  4I27 A;  2FPM A;  2ZIW A; 
#chains in the Genus database with same CATH homology
 2ODG A;  2BZF A;  1CI4 A;  1QCK A;  2EZX A;  2EZZ A;  2EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...