1CI4A

The crystal structure of human barrier-to-autointegration factor (baf)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF))
publication title Structural basis of DNA bridging by barrier-to-autointegration factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1ci4A00
2EZYA 2ODGA 2BZFA 2EZXA 2EZZA 1QCKA 1CI4A
chains in the Genus database with same CATH superfamily
2K8CB 5B66U 1ZD2P 2V4RA 3PW7A 3ZDEA 8ICFA 4FZNA 5DBAA 3OTQA 4R65A 3HJEA 4M0AA 1ZD5A 2G0AA 3C2KA 1ZOLA 2FPKA 2QARA 4J9LA 5AIAA 2ISPA 1XO0A 1TAMA 1TE2A 2MSNA 4EEYA 4K4HA 5KT6A 9ICWA 2NRVA 4B9SA 4O3SA 4ECVA 3QYPA 4QWDA 5KFZA 2W9BB 4NM1A 3L4PA 5KAFU 1ZQUA 5DG9A 3T5KA 4PJ0U 3LWMA 4DF8A 2EANA 5DBBA 4I2GA 3M9NB 2KJ5A 3MGIA 2VA3A 1CRXA 4KMUA 4DSEA 3MR5A 3L3FX 2V4QA 7ICKA 1Q46A 5DGAA 2VA2A 1SB3C 1MSWD 4QWEA 3RH4A 2EZYA 5GTHU 5A0LA 2UVRA 2R8KA 1ZETA 3WK7A 4UW9A 4KN7A 4P0QA 8ICYA 2XIDA 2KD1A 2KOBA 1L7OA 2EZZA 5AI0A 1OUQA 1Q3VA 1OXJA 3PV8A 5EE3A 5J0OA 3SV3A 3QU7A 4DOAA 1GO3F 5AIBA 2XI9A 2BHNA 4F72A 2LMRA 4UBBA 9ICOA 4FBTA 2ES6A 2W3RA 4I29A 5J2DA 4C80A 4JV1A 3B9JA 4QZ8A 4GC7A 8ICIA 5L1KA 4US9A 4F5PA 1ZQBA 1MA7A 1SL1A 4DOCA 4IRDA 1KN5A 3RJEA 3ALRA 2BCQA 4EYHB 3PX6A 5KT4A 1DGJA 2W9MA 3RRGA 4RQ8A 2E8MA 4K4IA 1KEJA 2A1JB 3TAQA 1BPZA 5IIKA 3H7IA 5KFBA 4O0IA 3TAPA 1VDVA 3RB0A 1S0NA 4DCCA 5KFOA 1RXWA 4J9PA 2R8GA 2VA8A 1A76A 2BR0A 2HI0A 3F2DA 4M6WB 1X6IA 1FFVA 7ICTA 3C5GA 2W54A 2QB0B 5DQGA 4YG2A 2PFQA 4KLDA 1K1QA 4DSFA 3IDWA 3PSPA 2JXJA 1BPYA 2R8HA 4EEKA 3MGVA 4JWNA 1NJXA 2NV3A 4ELVA 2W3SA 2NRTA 1MC8A 4U6PA 5C0YA 4O3RA 1AQ6A 1F5SA 1V9PA 5J29A 3PW5A 5AKHA 4MF8A 3AM9A 9ICEA 4DL7A 9ICVA 2W43A 1RDFA 3MR3A 4F50A 3RJIA 2E8NA 3LVWA 5KL8B 4DQQA 2KV2A 2KFNA 2HHUA 1N2XA 4MFAA 3JPNA 5J2CA 3FM9A 1HJPA 3BQ2A 2WF7A 3GIJA 5ALYA 2ASJA 3C1ZA 2BCSA 2W8KA 4Y2UA 5L1JA 1SL2A 2IOHA 2FLLA 3WK8A 8ICOA 3N7SC 3SAFA 2YMMA 3QZ8A 1X2IA 8ICXA 3N7RC 2XGPA 2Y9UA 4QNLA 3SZ2A 4DFMA 3KOOA 4RQ4A 4QWAA 4Q8FA 1L6NA 3OHBA 4C8LA 5AM4A 3IN5A 5ALQA 2RLTA 5DDYA 4ED0A 4M9HA 4RQ0A 5KFUA 5AK5A 4ECQA 7ICEA 2P6RA 1WUDA 3D2QA 3K1RB 2W55A 3NRWA 5KFAA 2MA1A 1KLNA 1YZ7A 4ECWA 2ZIXA 1BGXT 7ICVA 3QUQA 2JHDA 4F4ZA 2PFPA 8ICAA 5AM0A 4EBEA 5JTIA 2C2DA 2BCUA 4BXOA 1SKWA 1SKRA 2XCPA 4C4TA 1PK1A 4KN4A 2JZBA 4DSIA 5J2HA 2F1HA 4O3MA 4DFPA 2EAMA 4DL3A 1S10A 2HHWA 4QZGA 2OEHA 4M9LA 3AL0B 4HYKA 1U48A 5KFPA 5DKWA 5DQHA 5CB1A 4O3OA 2XY6A 4DL2A 2CPRA 5HMLA 3V6JA 1FEZA 2OHFA 4PHEA 1X9WA 5CEHA 5DDMA 1BPXA 4F71A 1S77D 2PXIA 4P4MA 5D46A 4MFCA 5KFQA 2W9AA 2VIXA 2I5HA 1RZTA 1Z3EB 1LKYA 2Y0SF 1X9XA 1MN8A 1T8EA 1BVSA 2KZZA 1F0MA 3IG5A 5E79U 4M9NA 5FP0A 5CJ7A 4XRHA 2NRXA 4QZFA 2IHNA 5CHGA 4YFKA 3RTVA 2BPCA 1J2MA 3HRDD 1T7PA 4QZCA 2AH5A 4ECUA 4UB1A 3V72A 1XWLA 1B4FA 2XCAA 2I9GA 1NZPA 1JXLA 1LVHA 4C4RA 2IA6A 3BJYA 4C8NA 2FMPA 4UB5A 5BOLA 4OJ6A 4YMMA 1KDHA 4YR2A 4HAIA 1ZQMA 1SWWA 3GQCA 5J8YA 4KLLA 3QE9Y 2DPIA 5KAIU 5AICA 2OWOA 5ALHA 5AI4A 2PI4A 4I27A 1JIHA 2O6KA 4PGYA 3THVA 1N61A 2H3IA 4ACOA 7ICQA 3WK9A 1JALA 2NO5A 2E3TA 3V6HA 4IQVA 4NL9C 3ZD8A 2DWQA 2YY6A 4RPXA 3CNHA 2K4IA 4UAZA 3K75D 4FZMA 4I2AA 1ZQRA 5AKLA 5KFMA 1K5OA 2F8KA 3DV9A 5EE0A 9ICXA 3SV4A 2NRZA 5ALPA 4JWMA 3B0XA 4DSJA 5AKJA 5ALVA 3PW2A 2WTFA 2OXOA 4FS2A 4C8OA 3UXNA 2D8CA 1FO4A 4R64A 3ETRA 4KLOA 2W04A 3UXOA 5KFTA 3F5EA 3FYHA 4NLBA 3WKEA 2I6XA 2EAOA 2QKQA 4DWIA 2BQ3A 2HHTA 5CRXA 1TKDA 3EUB2 1JI7A 1XC9A 2F1IA 5AK4A 9ICHA 1TV9A 5AKGA 2C28A 2DFLA 2ZUCA 4JV0A 1L8OA 3UMCA 5ALLA 4TQRA 4LVSA 3RR8A 3KBBA 2K4HA 4KTQA 3M9MB 4QW8A 3SMVA 4FBUA 4O9MA 1DOQA 4BGDA 4YXJA 4MEYA 3QEBZ 1FIQA 2FE9A 5J2AA 2F2AB 3NASA 2A1AA 1XS9D 1HIWA 2NRWA 3SD7A 2GOLA 2A1JA 7ICGA 2R18A 2BQRA 3C2MA 4WJ3B 8ICBA 3F5AA 2H5XA 3GIKA 2HW3A 5ALTA 2F77X 1KTQA 1B22A 2BZFA 5DB7A 1ZQIA 3ED5A 2K4PA 2KNJA 3ISDA 1JRPA 3M8SA 5JU5A 4F4XA 2ALZA 5DGBA 5ALRA 3K1ZA 2QB0A 2ZIVA 3V7KA 4RT3A 3OJSA 1BPDA 1X40A 4J9NA 2HOQA 1Z4NA 4TUQA 4QZHA 4USAA 1ZQHA 5AI5A 4OCZA 1L3VA 2M0NA 2ZUDA 2MUTB 5L1IA 3RF9A 5BOMA 2KN7A 7ICRA 1BNPA 4Y2YA 1SV0C 2HCFA 4RQNA 2C2RA 2G09A 8ICWA 2KVCA 5L1LA 1ZQTA 4P0PB 4Z6CA 2YMPA 3RJHA 2PFNA 2ODGA 5J0TA 4ZH4A 3MGHA 3CYMA 5AM5A 3UQ0A 5KG4A 1S76D 2KTQA 2Q0ZX 1L8LA 5ALUA 4FS1A 3E0FA 3NS1A 1SIJA 4UAVA 2BDUA 3S6JA 1K1SA 3GIMA 2YB4A 5AM1A 1DK2A 2G07A 3HX0A 4UAYA 4TURA 4Y2SA 5J2FA 2DF4B 1DGSA 4NLZA 3AUOA 2LI6A 3ZDBA 2W9CB 5G5HA 1KFTA 5DLGA 2YB1A 4CE6A 2JEGA 2JH7A 3KTQA 2YMLA 4ED7A 3BDPA 4UATA 4NJ8A 2LKYA 5DG8A 2N1RA 4Z6DA 3GFKB 3RB3A 4CF3A 4TQSA 2L5YA 5T14A 1RQNA 1KQQA 5AKXA 3F2CA 2FLPA 5KFRA 3ETLA 2AQ0A 4UARA 3EPIA 3MABA 2M9NA 2UVWA 3H4BA 3T3FA 4F4KA 3M9OB 4RUAA 1ZRMA 3A0BU 2IOFK 3OGUA 2W11A 2UVUA 1A6SA 3NVYA 2OYYA 5DQIA 3H8SA 4RNOA 5ALFA 5ALNA 3M7DA 2WHEA 3BS5B 2DBYA 3MFHA 3PVXA 1NK7A 1SWVA 1ZYQA 3AU2A 5KG0A 8ICUA 3PMLA 1UHUA 3VC8A 2KSOA 4JB3A 3ONNA 4C0ZA 4O3NA 3R9KA 4JUZA 3UM9A 3RJGA 4KLIA 4QZAA 9ICMA 2HHVA 2JGAA 3SI8A 4ED8A 1XNSA 3WKDA 5KG7A 1X66A 3ISCA 4I2HA 1ZQJA 4RQ6A 1PVPA 1JMSA 3TADC 4DEZA 4P4OA 4XQ8A 4BDPA 3D6JA 5AM2A 4QWBA 1ZQNA 1HUOA 1NI3A 1SGGA 1Z00A 4TUPA 1ZRNA 4FZLA 2WB1C 5ALWA 5AKIA 5EOZA 3B0YA 2ZIWB 3OPXA 4M9JA 8ICSA 2ISOA 9ICKA 4C8KA 5J2IA 1WYGA 2EZXA 8ICLA 3DEEA 3JPRA 4K4GA 3KZXA 1JROA 3MDAA 2AHOB 2J6UA 1S5LU 4B9LA 1DXSA 4YD2A 4GFJA 5H2FU 9ICBA 3IV6A 3WU2U 4MFFA 1U9LA 9ICJA 2BCRA 4EENA 2KIWA 1ECWA 1NOMA 1RYUA 1S0OA 1XO1A 2MAXA 4GLXA 4Y2XA 3EZ5A 1BPBA 3GZFA 5AI9A 3ZDCA 2XC9A 1UQVA 4O3QA 4YR0A 1T3NA 3TANA 1TK0A 4QJFB 2H3QA 5J2GA 3C5FA 3IP4B 1Z19A 4F8RA 3QZ7A 2E8PA 5DB9A 1ZQFA 2IBKA 1RG6A 2W8LA 4YN4A 4YCXA 4KLUA 2RP5A 2VJ4A 4Y2VA 7ICOA 3NUQA 3PNCA 1L3UA 5J2KA 2VJ5A 3GDXA 2KIVA 4Y2TA 1ZJMA 1T3QA 5KFIA 1ZQSA 1CEZA 2QARB 4U7CA 5J2BA 1NZBA 3MDCA 1V85A 4G9BA 4P2HA 4F3OA 4RZRA 2JMGA 4DF4A 5AK3A 4NV0A 2ATLA 3TFSA 5J0RA 1T4GA 1UT8A 3I28A 4QZ9A 1OW5A 1NNLA 2F76X 7ICMA 2KVSA 2ZIUA 2I1QA 5KG1A 3C1YA 1J97A 4LJXA 4J9RA 2Y1JA 4CGZA 4M9GA 5GTIU 2RQ5A 3KHHA 2Y9TA 4UAUA 3PW4A 4Q8EA 4YMOA 2B0CA 3H4DA 4QZDA 2KJ9A 1IG6A 3WK5A 3TFRA 4KLMA 1ZQXA 7ICHA 3JPQA 4RQ7A 5JUMA 4EZ9A 4NM2A 3IRUA 2H3VA 5AKEA 1S0VA 4YP3A 1Z1VA 2DQNB 5K4LA 4NL9A 4GXJA 3PY8A 3RJJA 3PSTA 4F5OA 9ICCA 3QX7A 2AGPA 4MEXA 8ICNA 3Q8LA 5IIMA 2AQ4A 1MQ2A 1Q3UA 2JEJA 8ICQA 1ZXIA 4KITB 5D49A 4DSLA 2KEYA 4RQ5A 3GILA 4OJ5A 4R63A 2DKZA 3QNMA 1A0PA 2YMQA 9ICUA 1QSLA 3SYZA 3PZPA 3ZDAA 4P4PA 1JUDA 4EX6A 4Z6EA 4UBCA 1TK8A 1N60A 1N63A 3C2LA 1T94A 3Q8KA 4DS4A 3I1YA 3LVVA 5KT3A 3I76A 4UB2A 2NO4A 1O03A 3UXPA 4EYIB 4ED3A 4KMOB 4DQRA 4B9MA 1NK0A 2E8OA 1JN3A 1QSYA 2WF8A 4A8EA 9ICRA 3PSFA 1ZQPA 1ZQEA 4QIWC 1X9SA 1X9MA 3EYZA 2R8JA 1NKBA 1XSPA 5ALMA 1N5XA 3RH6A 3ZI4A 4QIWF 3SR6A 2W7PA 4DOBA 1RPLA 5CWRA 1EXNA 3VCBA 2ASDA 1CI4A 1SXEA 4DQSA 3GU3A 3PO4A 4ECSA 4M04A 3IG8A 4RQMA 2KZMA 1WWVA 3BQ0A 7ICNA 2H3ZA 1IV8A 2ZTEA 1RM6C 4C8MA 1WWUA 3LYSA 2HVIA 1L7MA 3H40A 2F1JA 4Q44A 2HBLA 5KFKA 4I2EA 1ZQOA 1IXRA 4PL2A 1TAUA 1M6YA 4ED1A 4F2SA 3N97B 2GLEA 2D6FC 3RAQA 2DPJA 1QLNA 2W9BA 3T5JA 2KP7A 2H3FA 2FLNA 3MBYA 3G6YA 2KKVA 2WF6A 2XICA 5KNIA 4PGXA 4OJLA 1ZQVA 1QTMA 5EWEA 2IOFA 1TAQA 3JPOA 2HHSA 1CUKA 3K4GA 1QQ7A 1KRPA 5AI6A 1ZQLA 5KG3A 2G5HB 1O08A 4UAWA 1J2NA 1N48A 5IILA 2ZTDA 4DL6A 1UA1A 1ZQCA 2C2EA 5KTQA 4IR9A 5ALOA 1SV0A 3FAHA 4NLGA 5KT2A 1UA0A 1COKA 2HBJA 5J0YA 7ICUA 1YZ6A 2VANA 2B6GA 4KLQA 1N5WA 3ORYA 1WCNA 4XA5A 3C28A 3WK4A 5G5GA 1LB2B 2KG5A 3UQ2A 3PX4A 4ED6A 1SXDA 4F91B 5F3XB 3UMBA 5F9NA 1SKSA 1ZD3A 3BS5A 3M6KA 3BQTA 2JR5A 1H38A 2J6TA 1ED1A 1L3TA 4KLSA 4ECXA 1D8BA 8ICVA 2HOIA 5EWFA 4PGQA 4F5RA 2ZIXB 4DQIA 1NK5A 3WKBA 3H8JA 1RQLA 1URJA 2HHQA 2HBKA 4ED2A 4M2YA 7ICIA 5KFGA 9ICAA 2K89A 2Y1IA 3HW8A 3BS7A 4NLNA 2HDOA 4FE3A 8ICTA 3OHAA 1HUZA 3T5HA 2RDJA 2GO7A 4IRCA 4FO6A 2RHFA 1SZPA 4CF5A 4NLCA 4M6WA 4OO1J 3M1YA 2AXTU 2OH2A 4BWJA 4TUSA 1KFDA 5TZVA 3QEAZ 3DDHA 5KG2A 3N7PD 2WF5A 3C29A 3E58A 1U47A 9ICTA 1KFSA 3PW0A 2R8IA 1XSNA 3SENA 3H0LB 4B9UA 1A77A 1B0XA 1ZQ1C 1ZJNA 7ICSA 2LYHA 8ICGA 5KFLA 4UB3A 2NYVA 4PPXA 5DB6A 4LZGA 1IM4A 3V7LA 3UPQA 2BCVA 5DBCA 5IIJA 4BWMA 4Z6FA 4IC9A 2FMSA 5KFNA 3TADA 1D9DA 2LYAA 5ALZA 3WKCA 3BQ7A 5TISU 5AK6A 3HP6A 5ALEA 3AN1A 4Y2PA 5ALIA 3ZD9A 2F8LA 3U26A 3QUBA 1SZHA 2YQEA 4NY8A 3D2SA 4MHVA 4UB6U 5J0UA 3RAXA 8ICMA 5L1MA 4FFDA 4IQUA 3GV5B 5AM3A 3N28A 4RPZA 3LK9A 3AQEA 3BQ1A 3O0FA 3QU2A 3CRXA 1ZQZA 3F2BA 2ZJ5A 4JMUA 8ICZA 2AJQA 4J9OA 1QSSA 4C7ZA 2WAQC 1UCVA 2HHXA 4JK1A 2W7OA 1KL9A 3RBDA 2WAQF 5JRTA 2Q4TA 3PR5B 2P35A 5C5JA 5KFJA 1FFUA 4DO9A 2QB1A 4KLFA 2BGWA 5IIOA 4BX9C 9ICSA 3KD3A 8ICRA 4O5EA 2WF9A 3PMNA 2MRLA 4O5CA 1ZQGA 8ICPA 5CP2A 1COOA 4Y2RA 1B43A 3A0HU 3KZIU 4PHAA 3HT3A 5HR7A 1L7PA 2LYBA 3OSNA 4R66A 5KFWA 1S97A 2XVTA 4QZBA 1Z1BA 3Q8SB 3KHGA 1ZQAA 4YVZA 1PUZA 5D4BA 3RB4A 1ZQYA 3EW9A 5HMMA 4RT2A 1LV5A 5J0XA 3HILA 2CN1A 3NVVA 4F4YA 1N62A 4YD1A 3V6KA 7ICFA 3TQ1A 5CA7A 4O5KA 2K60A 2P6UA 2EDUA 1C20A 4GIBA 2WB1F 2YN4A 5IIIA 3IM1A 1S8OA 3WK6A 5KFYA 2RRDA 1TVAA 8ICHA 3E2EA 4IR1A 4DL5A 2J6SA 2GH1A 4J9SA 3JPTA 1HEKA 2LM4A 4ECZA 1ZQDA 2KMDA 4KX5A 2HMXA 1ZQQA 3TACB 1S0MA 4JV2A 2VKQA 8ICEA 5ALGA 3NRZA 7ICPA 4KLHA 4R8UB 2DGZA 2XY5A 1RYRA 4MF2A 3QUCA 2E1EA 2EAPA 4RQ2A 2E5SA 5BPCA 1N56A 9ICIA 2LHTA 3SQIA 3PSIA 1NKCA 2ZIVB 4CNQA 5J0PA 4YR3A 4RQ1A 5KG6A 2B21A 4US8A 3MFIA 2KE7A 5AKYA 2LBOA 5KFXA 4GXIA 1D8LA 1BNOA 3D2NA 1Q8KA 4PH5A 2KJ8A 4IS7A 5KL1B 5HR6A 3M8RA 4X5VA 5KFSA 3C23A 3QUTA 3RRHA 4DS5A 3RH5A 3H0MB 1PZNA 5KT5A 2G5IB 4RU9A 4Y2QA 4RQ3A 4DFKA 5J0QA 2AU0A 5KFEA 2RDIA 4GC6A 5HHHA 2DUYA 3HWTA 2JRZA 4NWIA 9ICGA 4CCHA 3KHLA 3F53A 2JH1A 4CRXA 3TI0A 1KSPA 4YXMA 4EBCA 4IQTA 3QU4A 2WFAA 4IRKA 3GIIA 3NVZA 4QWCA 3KFUF 5L9XA 4UB8U 2DL0A 5KT7A 5AHXA 3HPOA 2C22A 2A3VA 1QQ5A 4EZ6A 4Q45A 5EE1A 4F2RA 3OSPA 1ZD4A 2ASLA 2FDRA 4F4WA 4RNNA 4PL1A 4J03A 4RUCA 4O3PA 3PX0A 4J9QA 3ICXA 5DG7A 3HKZC 5ALXA 4J9KA 1ZQWA 2ZUBA 3QXGA 3SAHA 4OJPA 2ZG6A 3HKZF 3V7JA 4Y2JA 3BZKA 9ICQA 3KHRA 4RNMA 4P0QB 1SL0A 4ECTA 3AEVA 8ICJA 3LDAA 4I2DA 1RYSA 4J9MA 3EWAA 2BPGA 2JV3A 1PVRA 4EBDA 1MQ3A 3RJKA 4QW9A 4G3IA 1KBUA 4DSKA 2FI1A 5J2JA 9ICPA 4F5NA 9ICFA 4I2FA 4RPYA 2KSOB 3H0RB 2AGOA 8ICCA 2PKEA 3Q8QB 2EQYA 4F93B 4CDGA 2A19A 1U4BA 3Q8MA 2BPFA 5J0WA 4ECYA 3T5LA 3RJFA 2HBMA 3T79A 4AP9A 9ICNA 4KLJA 1QCKA 2D3DA 4GXKA 1RXVA 1X6JA 4IQWA 5EE9A 3WKAA 5J0SA 2F3NA 1XSLA 5ALJA 4C7YA 1NK8A 1UT5A 2Y0SC 4YMNA 1KKXA 2MUTA 2HSZA 2E1FA 3UMGA 2KICA 4F5QA 1Z00B 3QU5A 5ALSA 2BKEA 2HVHA 1Z4OA 1JXEA 3JPSA 3MC1A 2Z7JA 3NTUA 2IHMA 2ZXHA 1YT3A 1BPEA 1U49A 2UVVA 4I2IA 4I2BA 4P0PA 3KKAA 4PHDA 5KG5A 2OM6A 3FDSA 5J2EA 2G08A 3PR4A 1NK9A 1NJYA 1QQ6A 4ELUA 4KLGA 2AGQA 3N4MB 4I2JA 1L5UA 1C7YA 2PI5A 3C21A 1UPHA 3J81j 4DLEA 4E0DA 2KHQA 2GWSA 2ZTCA 4DL4A 2F44A 1VJ5A 4NLKA 2OCEA 2KFZA 3G6VA 4AYBC 4EELA 5F9LA 4DQPA 2ZJAA 1AROP 2QLTA 4OJOA 3RR7A 1SV4A 2FJ6A 8ICKA 2XO7A 2P66A 5DB8A 2BDPA 2W9CA 4AYBF 4NXZA 4C4SA 4QZEA 3AMZA 2JEFA 4KLTA 4OD0A 3TKAA 4XUSA 2ESEA 3MR6A 1D9FA 2K4EA 2KHVA 3Q8PB 2CRXA 2JEIA 5AI8A 3AQFA 4ECRA 4B6JA 5HNKA 5HHIA 5AKKA 3M6ZA 2LM1A 3LWLA 2HOFA 3PO5A 1L7NA 5ALKA 3ZDDA 3AU6A 4I2CA 3L5KA 1TFRA 1V38A 3MR2A 4DFDA 1NKEA 3GV8B 4M47A 3BZCA 3H8MA 4YQWA 5CR0A 3CW2C 1PK3A 2YX8A 4B9VA 4ZOHC 3RB6A 3RFAA 4KLEA 2ZIUB 1XU4A 3OJUA 2G06A 1D8YA 4UASA 1X42A 2PFOA 4CF4A 3SEIA 3H8WA 4BXOB 3KKAC 3ISBA 2YTUA 4PZOA 3CP8A 2W03A 1PK1B 5KFVA 2JZBB 4Q43A 4PHPA 2IMWP 4DLGA 2V9WA 4BJQA 4B9TA 2FPLA 2FMQA 1QH9A 5AKZA 4UQGA 3Q8RB 2EH9A 2ZXIA 2ZIWA 2XGQA 2ZJ8A 5HP4A 5KFCA 5KFDA 7ICJA 1PVQA 9ICLA 3GV7B 7ICLA 4EX7A 4DFJA 3IHQB 3QU9A 1WCLA 1NK4A 4ELTA 3G6XA 2BQUA 3TARA 4ICAA 1ZQKA 5B5EU 5J8YC 4IL6U 2K8AA 2K8BB 4UB4A 1JX4A 5DLFA 3EPGA 1TK5A 5KFFA 4R8UA 3SAGA 4F92B 5IINA 1IIPA 1KW4A 3JPPA 2KKPA 4I28A 3NVWA 4PZNA 5ALDA 1L3SA 2FPMA 1LKYB 1S9FA 4QZIA 3FC4A 1Y88A 1NJZA 2KZ3A 1F44A 1V97A 3NGDA 2CXYA 2MU2A 2PMZC 1NK6A 4LZDA 1DK3A 4KX3A 2LPEA 1DRGA 5EWGA 3RBEA 4B9NA 2PMZF 1U45A 1WG8A 1VLBA 2DKXA 1P7DA 2KK0A 5KFHA 1NJWA 4BUGA 2XY7A
chains in the Genus database with same CATH topology
2EZYA 2ODGA 2BZFA 2EZXA 2EZZA 1QCKA 1CI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZY A;  2ODG A;  2BZF A;  2EZX A;  2EZZ A;  1QCK A;  1CI4 A; 
#chains in the Genus database with same CATH topology
 2K8C B;  5B66 U;  1ZD2 P;  2V4R A;  3PW7 A;  3ZDE A;  8ICF A;  4FZN A;  5DBA A;  3OTQ A;  4R65 A;  3HJE A;  4M0A A;  1ZD5 A;  2G0A A;  3C2K A;  1ZOL A;  2FPK A;  2QAR A;  4J9L A;  5AIA A;  2ISP A;  1XO0 A;  1TAM A;  1TE2 A;  2MSN A;  4EEY A;  4K4H A;  5KT6 A;  9ICW A;  2NRV A;  4B9S A;  4O3S A;  4ECV A;  3QYP A;  4QWD A;  5KFZ A;  2W9B B;  4NM1 A;  3L4P A;  5KAF U;  1ZQU A;  5DG9 A;  3T5K A;  4PJ0 U;  3LWM A;  4DF8 A;  2EAN A;  5DBB A;  4I2G A;  3M9N B;  2KJ5 A;  3MGI A;  2VA3 A;  1CRX A;  4KMU A;  4DSE A;  3MR5 A;  3L3F X;  2V4Q A;  7ICK A;  1Q46 A;  5DGA A;  2VA2 A;  1SB3 C;  1MSW D;  4QWE A;  3RH4 A;  2EZY A;  5GTH U;  5A0L A;  2UVR A;  2R8K A;  1ZET A;  3WK7 A;  4UW9 A;  4KN7 A;  4P0Q A;  8ICY A;  2XID A;  2KD1 A;  2KOB A;  1L7O A;  2EZZ A;  5AI0 A;  1OUQ A;  1Q3V A;  1OXJ A;  3PV8 A;  5EE3 A;  5J0O A;  3SV3 A;  3QU7 A;  4DOA A;  1GO3 F;  5AIB A;  2XI9 A;  2BHN A;  4F72 A;  2LMR A;  4UBB A;  9ICO A;  4FBT A;  2ES6 A;  2W3R A;  4I29 A;  5J2D A;  4C80 A;  4JV1 A;  3B9J A;  4QZ8 A;  4GC7 A;  8ICI A;  5L1K A;  4US9 A;  4F5P A;  1ZQB A;  1MA7 A;  1SL1 A;  4DOC A;  4IRD A;  1KN5 A;  3RJE A;  3ALR A;  2BCQ A;  4EYH B;  3PX6 A;  5KT4 A;  1DGJ A;  2W9M A;  3RRG A;  4RQ8 A;  2E8M A;  4K4I A;  1KEJ A;  2A1J B;  3TAQ A;  1BPZ A;  5IIK A;  3H7I A;  5KFB A;  4O0I A;  3TAP A;  1VDV A;  3RB0 A;  1S0N A;  4DCC A;  5KFO A;  1RXW A;  4J9P A;  2R8G A;  2VA8 A;  1A76 A;  2BR0 A;  2HI0 A;  3F2D A;  4M6W B;  1X6I A;  1FFV A;  7ICT A;  3C5G A;  2W54 A;  2QB0 B;  5DQG A;  4YG2 A;  2PFQ A;  4KLD A;  1K1Q A;  4DSF A;  3IDW A;  3PSP A;  2JXJ A;  1BPY A;  2R8H A;  4EEK A;  3MGV A;  4JWN A;  1NJX A;  2NV3 A;  4ELV A;  2W3S A;  2NRT A;  1MC8 A;  4U6P A;  5C0Y A;  4O3R A;  1AQ6 A;  1F5S A;  1V9P A;  5J29 A;  3PW5 A;  5AKH A;  4MF8 A;  3AM9 A;  9ICE A;  4DL7 A;  9ICV A;  2W43 A;  1RDF A;  3MR3 A;  4F50 A;  3RJI A;  2E8N A;  3LVW A;  5KL8 B;  4DQQ A;  2KV2 A;  2KFN A;  2HHU A;  1N2X A;  4MFA A;  3JPN A;  5J2C A;  3FM9 A;  1HJP A;  3BQ2 A;  2WF7 A;  3GIJ A;  5ALY A;  2ASJ A;  3C1Z A;  2BCS A;  2W8K A;  4Y2U A;  5L1J A;  1SL2 A;  2IOH A;  2FLL A;  3WK8 A;  8ICO A;  3N7S C;  3SAF A;  2YMM A;  3QZ8 A;  1X2I A;  8ICX A;  3N7R C;  2XGP A;  2Y9U A;  4QNL A;  3SZ2 A;  4DFM A;  3KOO A;  4RQ4 A;  4QWA A;  4Q8F A;  1L6N A;  3OHB A;  4C8L A;  5AM4 A;  3IN5 A;  5ALQ A;  2RLT A;  5DDY A;  4ED0 A;  4M9H A;  4RQ0 A;  5KFU A;  5AK5 A;  4ECQ A;  7ICE A;  2P6R A;  1WUD A;  3D2Q A;  3K1R B;  2W55 A;  3NRW A;  5KFA A;  2MA1 A;  1KLN A;  1YZ7 A;  4ECW A;  2ZIX A;  1BGX T;  7ICV A;  3QUQ A;  2JHD A;  4F4Z A;  2PFP A;  8ICA A;  5AM0 A;  4EBE A;  5JTI A;  2C2D A;  2BCU A;  4BXO A;  1SKW A;  1SKR A;  2XCP A;  4C4T A;  1PK1 A;  4KN4 A;  2JZB A;  4DSI A;  5J2H A;  2F1H A;  4O3M A;  4DFP A;  2EAM A;  4DL3 A;  1S10 A;  2HHW A;  4QZG A;  2OEH A;  4M9L A;  3AL0 B;  4HYK A;  1U48 A;  5KFP A;  5DKW A;  5DQH A;  5CB1 A;  4O3O A;  2XY6 A;  4DL2 A;  2CPR A;  5HML A;  3V6J A;  1FEZ A;  2OHF A;  4PHE A;  1X9W A;  5CEH A;  5DDM A;  1BPX A;  4F71 A;  1S77 D;  2PXI A;  4P4M A;  5D46 A;  4MFC A;  5KFQ A;  2W9A A;  2VIX A;  2I5H A;  1RZT A;  1Z3E B;  1LKY A;  2Y0S F;  1X9X A;  1MN8 A;  1T8E A;  1BVS A;  2KZZ A;  1F0M A;  3IG5 A;  5E79 U;  4M9N A;  5FP0 A;  5CJ7 A;  4XRH A;  2NRX A;  4QZF A;  2IHN A;  5CHG A;  4YFK A;  3RTV A;  2BPC A;  1J2M A;  3HRD D;  1T7P A;  4QZC A;  2AH5 A;  4ECU A;  4UB1 A;  3V72 A;  1XWL A;  1B4F A;  2XCA A;  2I9G A;  1NZP A;  1JXL A;  1LVH A;  4C4R A;  2IA6 A;  3BJY A;  4C8N A;  2FMP A;  4UB5 A;  5BOL A;  4OJ6 A;  4YMM A;  1KDH A;  4YR2 A;  4HAI A;  1ZQM A;  1SWW A;  3GQC A;  5J8Y A;  4KLL A;  3QE9 Y;  2DPI A;  5KAI U;  5AIC A;  2OWO A;  5ALH A;  5AI4 A;  2PI4 A;  4I27 A;  1JIH A;  2O6K A;  4PGY A;  3THV A;  1N61 A;  2H3I A;  4ACO A;  7ICQ A;  3WK9 A;  1JAL A;  2NO5 A;  2E3T A;  3V6H A;  4IQV A;  4NL9 C;  3ZD8 A;  2DWQ A;  2YY6 A;  4RPX A;  3CNH A;  2K4I A;  4UAZ A;  3K75 D;  4FZM A;  4I2A A;  1ZQR A;  5AKL A;  5KFM A;  1K5O A;  2F8K A;  3DV9 A;  5EE0 A;  9ICX A;  3SV4 A;  2NRZ A;  5ALP A;  4JWM A;  3B0X A;  4DSJ A;  5AKJ A;  5ALV A;  3PW2 A;  2WTF A;  2OXO A;  4FS2 A;  4C8O A;  3UXN A;  2D8C A;  1FO4 A;  4R64 A;  3ETR A;  4KLO A;  2W04 A;  3UXO A;  5KFT A;  3F5E A;  3FYH A;  4NLB A;  3WKE A;  2I6X A;  2EAO A;  2QKQ A;  4DWI A;  2BQ3 A;  2HHT A;  5CRX A;  1TKD A;  3EUB 2;  1JI7 A;  1XC9 A;  2F1I A;  5AK4 A;  9ICH A;  1TV9 A;  5AKG A;  2C28 A;  2DFL A;  2ZUC A;  4JV0 A;  1L8O A;  3UMC A;  5ALL A;  4TQR A;  4LVS A;  3RR8 A;  3KBB A;  2K4H A;  4KTQ A;  3M9M B;  4QW8 A;  3SMV A;  4FBU A;  4O9M A;  1DOQ A;  4BGD A;  4YXJ A;  4MEY A;  3QEB Z;  1FIQ A;  2FE9 A;  5J2A A;  2F2A B;  3NAS A;  2A1A A;  1XS9 D;  1HIW A;  2NRW A;  3SD7 A;  2GOL A;  2A1J A;  7ICG A;  2R18 A;  2BQR A;  3C2M A;  4WJ3 B;  8ICB A;  3F5A A;  2H5X A;  3GIK A;  2HW3 A;  5ALT A;  2F77 X;  1KTQ A;  1B22 A;  2BZF A;  5DB7 A;  1ZQI A;  3ED5 A;  2K4P A;  2KNJ A;  3ISD A;  1JRP A;  3M8S A;  5JU5 A;  4F4X A;  2ALZ A;  5DGB A;  5ALR A;  3K1Z A;  2QB0 A;  2ZIV A;  3V7K A;  4RT3 A;  3OJS A;  1BPD A;  1X40 A;  4J9N A;  2HOQ A;  1Z4N A;  4TUQ A;  4QZH A;  4USA A;  1ZQH A;  5AI5 A;  4OCZ A;  1L3V A;  2M0N A;  2ZUD A;  2MUT B;  5L1I A;  3RF9 A;  5BOM A;  2KN7 A;  7ICR A;  1BNP A;  4Y2Y A;  1SV0 C;  2HCF A;  4RQN A;  2C2R A;  2G09 A;  8ICW A;  2KVC A;  5L1L A;  1ZQT A;  4P0P B;  4Z6C A;  2YMP A;  3RJH A;  2PFN A;  2ODG A;  5J0T A;  4ZH4 A;  3MGH A;  3CYM A;  5AM5 A;  3UQ0 A;  5KG4 A;  1S76 D;  2KTQ A;  2Q0Z X;  1L8L A;  5ALU A;  4FS1 A;  3E0F A;  3NS1 A;  1SIJ A;  4UAV A;  2BDU A;  3S6J A;  1K1S A;  3GIM A;  2YB4 A;  5AM1 A;  1DK2 A;  2G07 A;  3HX0 A;  4UAY A;  4TUR A;  4Y2S A;  5J2F A;  2DF4 B;  1DGS A;  4NLZ A;  3AUO A;  2LI6 A;  3ZDB A;  2W9C B;  5G5H A;  1KFT A;  5DLG A;  2YB1 A;  4CE6 A;  2JEG A;  2JH7 A;  3KTQ A;  2YML A;  4ED7 A;  3BDP A;  4UAT A;  4NJ8 A;  2LKY A;  5DG8 A;  2N1R A;  4Z6D A;  3GFK B;  3RB3 A;  4CF3 A;  4TQS A;  2L5Y A;  5T14 A;  1RQN A;  1KQQ A;  5AKX A;  3F2C A;  2FLP A;  5KFR A;  3ETL A;  2AQ0 A;  4UAR A;  3EPI A;  3MAB A;  2M9N A;  2UVW A;  3H4B A;  3T3F A;  4F4K A;  3M9O B;  4RUA A;  1ZRM A;  3A0B U;  2IOF K;  3OGU A;  2W11 A;  2UVU A;  1A6S A;  3NVY A;  2OYY A;  5DQI A;  3H8S A;  4RNO A;  5ALF A;  5ALN A;  3M7D A;  2WHE A;  3BS5 B;  2DBY A;  3MFH A;  3PVX A;  1NK7 A;  1SWV A;  1ZYQ A;  3AU2 A;  5KG0 A;  8ICU A;  3PML A;  1UHU A;  3VC8 A;  2KSO A;  4JB3 A;  3ONN A;  4C0Z A;  4O3N A;  3R9K A;  4JUZ A;  3UM9 A;  3RJG A;  4KLI A;  4QZA A;  9ICM A;  2HHV A;  2JGA A;  3SI8 A;  4ED8 A;  1XNS A;  3WKD A;  5KG7 A;  1X66 A;  3ISC A;  4I2H A;  1ZQJ A;  4RQ6 A;  1PVP A;  1JMS A;  3TAD C;  4DEZ A;  4P4O A;  4XQ8 A;  4BDP A;  3D6J A;  5AM2 A;  4QWB A;  1ZQN A;  1HUO A;  1NI3 A;  1SGG A;  1Z00 A;  4TUP A;  1ZRN A;  4FZL A;  2WB1 C;  5ALW A;  5AKI A;  5EOZ A;  3B0Y A;  2ZIW B;  3OPX A;  4M9J A;  8ICS A;  2ISO A;  9ICK A;  4C8K A;  5J2I A;  1WYG A;  2EZX A;  8ICL A;  3DEE A;  3JPR A;  4K4G A;  3KZX A;  1JRO A;  3MDA A;  2AHO B;  2J6U A;  1S5L U;  4B9L A;  1DXS A;  4YD2 A;  4GFJ A;  5H2F U;  9ICB A;  3IV6 A;  3WU2 U;  4MFF A;  1U9L A;  9ICJ A;  2BCR A;  4EEN A;  2KIW A;  1ECW A;  1NOM A;  1RYU A;  1S0O A;  1XO1 A;  2MAX A;  4GLX A;  4Y2X A;  3EZ5 A;  1BPB A;  3GZF A;  5AI9 A;  3ZDC A;  2XC9 A;  1UQV A;  4O3Q A;  4YR0 A;  1T3N A;  3TAN A;  1TK0 A;  4QJF B;  2H3Q A;  5J2G A;  3C5F A;  3IP4 B;  1Z19 A;  4F8R A;  3QZ7 A;  2E8P A;  5DB9 A;  1ZQF A;  2IBK A;  1RG6 A;  2W8L A;  4YN4 A;  4YCX A;  4KLU A;  2RP5 A;  2VJ4 A;  4Y2V A;  7ICO A;  3NUQ A;  3PNC A;  1L3U A;  5J2K A;  2VJ5 A;  3GDX A;  2KIV A;  4Y2T A;  1ZJM A;  1T3Q A;  5KFI A;  1ZQS A;  1CEZ A;  2QAR B;  4U7C A;  5J2B A;  1NZB A;  3MDC A;  1V85 A;  4G9B A;  4P2H A;  4F3O A;  4RZR A;  2JMG A;  4DF4 A;  5AK3 A;  4NV0 A;  2ATL A;  3TFS A;  5J0R A;  1T4G A;  1UT8 A;  3I28 A;  4QZ9 A;  1OW5 A;  1NNL A;  2F76 X;  7ICM A;  2KVS A;  2ZIU A;  2I1Q A;  5KG1 A;  3C1Y A;  1J97 A;  4LJX A;  4J9R A;  2Y1J A;  4CGZ A;  4M9G A;  5GTI U;  2RQ5 A;  3KHH A;  2Y9T A;  4UAU A;  3PW4 A;  4Q8E A;  4YMO A;  2B0C A;  3H4D A;  4QZD A;  2KJ9 A;  1IG6 A;  3WK5 A;  3TFR A;  4KLM A;  1ZQX A;  7ICH A;  3JPQ A;  4RQ7 A;  5JUM A;  4EZ9 A;  4NM2 A;  3IRU A;  2H3V A;  5AKE A;  1S0V A;  4YP3 A;  1Z1V A;  2DQN B;  5K4L A;  4NL9 A;  4GXJ A;  3PY8 A;  3RJJ A;  3PST A;  4F5O A;  9ICC A;  3QX7 A;  2AGP A;  4MEX A;  8ICN A;  3Q8L A;  5IIM A;  2AQ4 A;  1MQ2 A;  1Q3U A;  2JEJ A;  8ICQ A;  1ZXI A;  4KIT B;  5D49 A;  4DSL A;  2KEY A;  4RQ5 A;  3GIL A;  4OJ5 A;  4R63 A;  2DKZ A;  3QNM A;  1A0P A;  2YMQ A;  9ICU A;  1QSL A;  3SYZ A;  3PZP A;  3ZDA A;  4P4P A;  1JUD A;  4EX6 A;  4Z6E A;  4UBC A;  1TK8 A;  1N60 A;  1N63 A;  3C2L A;  1T94 A;  3Q8K A;  4DS4 A;  3I1Y A;  3LVV A;  5KT3 A;  3I76 A;  4UB2 A;  2NO4 A;  1O03 A;  3UXP A;  4EYI B;  4ED3 A;  4KMO B;  4DQR A;  4B9M A;  1NK0 A;  2E8O A;  1JN3 A;  1QSY A;  2WF8 A;  4A8E A;  9ICR A;  3PSF A;  1ZQP A;  1ZQE A;  4QIW C;  1X9S A;  1X9M A;  3EYZ A;  2R8J A;  1NKB A;  1XSP A;  5ALM A;  1N5X A;  3RH6 A;  3ZI4 A;  4QIW F;  3SR6 A;  2W7P A;  4DOB A;  1RPL A;  5CWR A;  1EXN A;  3VCB A;  2ASD A;  1CI4 A;  1SXE A;  4DQS A;  3GU3 A;  3PO4 A;  4ECS A;  4M04 A;  3IG8 A;  4RQM A;  2KZM A;  1WWV A;  3BQ0 A;  7ICN A;  2H3Z A;  1IV8 A;  2ZTE A;  1RM6 C;  4C8M A;  1WWU A;  3LYS A;  2HVI A;  1L7M A;  3H40 A;  2F1J A;  4Q44 A;  2HBL A;  5KFK A;  4I2E A;  1ZQO A;  1IXR A;  4PL2 A;  1TAU A;  1M6Y A;  4ED1 A;  4F2S A;  3N97 B;  2GLE A;  2D6F C;  3RAQ A;  2DPJ A;  1QLN A;  2W9B A;  3T5J A;  2KP7 A;  2H3F A;  2FLN A;  3MBY A;  3G6Y A;  2KKV A;  2WF6 A;  2XIC A;  5KNI A;  4PGX A;  4OJL A;  1ZQV A;  1QTM A;  5EWE A;  2IOF A;  1TAQ A;  3JPO A;  2HHS A;  1CUK A;  3K4G A;  1QQ7 A;  1KRP A;  5AI6 A;  1ZQL A;  5KG3 A;  2G5H B;  1O08 A;  4UAW A;  1J2N A;  1N48 A;  5IIL A;  2ZTD A;  4DL6 A;  1UA1 A;  1ZQC A;  2C2E A;  5KTQ A;  4IR9 A;  5ALO A;  1SV0 A;  3FAH A;  4NLG A;  5KT2 A;  1UA0 A;  1COK A;  2HBJ A;  5J0Y A;  7ICU A;  1YZ6 A;  2VAN A;  2B6G A;  4KLQ A;  1N5W A;  3ORY A;  1WCN A;  4XA5 A;  3C28 A;  3WK4 A;  5G5G A;  1LB2 B;  2KG5 A;  3UQ2 A;  3PX4 A;  4ED6 A;  1SXD A;  4F91 B;  5F3X B;  3UMB A;  5F9N A;  1SKS A;  1ZD3 A;  3BS5 A;  3M6K A;  3BQT A;  2JR5 A;  1H38 A;  2J6T A;  1ED1 A;  1L3T A;  4KLS A;  4ECX A;  1D8B A;  8ICV A;  2HOI A;  5EWF A;  4PGQ A;  4F5R A;  2ZIX B;  4DQI A;  1NK5 A;  3WKB A;  3H8J A;  1RQL A;  1URJ A;  2HHQ A;  2HBK A;  4ED2 A;  4M2Y A;  7ICI A;  5KFG A;  9ICA A;  2K89 A;  2Y1I A;  3HW8 A;  3BS7 A;  4NLN A;  2HDO A;  4FE3 A;  8ICT A;  3OHA A;  1HUZ A;  3T5H A;  2RDJ A;  2GO7 A;  4IRC A;  4FO6 A;  2RHF A;  1SZP A;  4CF5 A;  4NLC A;  4M6W A;  4OO1 J;  3M1Y A;  2AXT U;  2OH2 A;  4BWJ A;  4TUS A;  1KFD A;  5TZV A;  3QEA Z;  3DDH A;  5KG2 A;  3N7P D;  2WF5 A;  3C29 A;  3E58 A;  1U47 A;  9ICT A;  1KFS A;  3PW0 A;  2R8I A;  1XSN A;  3SEN A;  3H0L B;  4B9U A;  1A77 A;  1B0X A;  1ZQ1 C;  1ZJN A;  7ICS A;  2LYH A;  8ICG A;  5KFL A;  4UB3 A;  2NYV A;  4PPX A;  5DB6 A;  4LZG A;  1IM4 A;  3V7L A;  3UPQ A;  2BCV A;  5DBC A;  5IIJ A;  4BWM A;  4Z6F A;  4IC9 A;  2FMS A;  5KFN A;  3TAD A;  1D9D A;  2LYA A;  5ALZ A;  3WKC A;  3BQ7 A;  5TIS U;  5AK6 A;  3HP6 A;  5ALE A;  3AN1 A;  4Y2P A;  5ALI A;  3ZD9 A;  2F8L A;  3U26 A;  3QUB A;  1SZH A;  2YQE A;  4NY8 A;  3D2S A;  4MHV A;  4UB6 U;  5J0U A;  3RAX A;  8ICM A;  5L1M A;  4FFD A;  4IQU A;  3GV5 B;  5AM3 A;  3N28 A;  4RPZ A;  3LK9 A;  3AQE A;  3BQ1 A;  3O0F A;  3QU2 A;  3CRX A;  1ZQZ A;  3F2B A;  2ZJ5 A;  4JMU A;  8ICZ A;  2AJQ A;  4J9O A;  1QSS A;  4C7Z A;  2WAQ C;  1UCV A;  2HHX A;  4JK1 A;  2W7O A;  1KL9 A;  3RBD A;  2WAQ F;  5JRT A;  2Q4T A;  3PR5 B;  2P35 A;  5C5J A;  5KFJ A;  1FFU A;  4DO9 A;  2QB1 A;  4KLF A;  2BGW A;  5IIO A;  4BX9 C;  9ICS A;  3KD3 A;  8ICR A;  4O5E A;  2WF9 A;  3PMN A;  2MRL A;  4O5C A;  1ZQG A;  8ICP A;  5CP2 A;  1COO A;  4Y2R A;  1B43 A;  3A0H U;  3KZI U;  4PHA A;  3HT3 A;  5HR7 A;  1L7P A;  2LYB A;  3OSN A;  4R66 A;  5KFW A;  1S97 A;  2XVT A;  4QZB A;  1Z1B A;  3Q8S B;  3KHG A;  1ZQA A;  4YVZ A;  1PUZ A;  5D4B A;  3RB4 A;  1ZQY A;  3EW9 A;  5HMM A;  4RT2 A;  1LV5 A;  5J0X A;  3HIL A;  2CN1 A;  3NVV A;  4F4Y A;  1N62 A;  4YD1 A;  3V6K A;  7ICF A;  3TQ1 A;  5CA7 A;  4O5K A;  2K60 A;  2P6U A;  2EDU A;  1C20 A;  4GIB A;  2WB1 F;  2YN4 A;  5III A;  3IM1 A;  1S8O A;  3WK6 A;  5KFY A;  2RRD A;  1TVA A;  8ICH A;  3E2E A;  4IR1 A;  4DL5 A;  2J6S A;  2GH1 A;  4J9S A;  3JPT A;  1HEK A;  2LM4 A;  4ECZ A;  1ZQD A;  2KMD A;  4KX5 A;  2HMX A;  1ZQQ A;  3TAC B;  1S0M A;  4JV2 A;  2VKQ A;  8ICE A;  5ALG A;  3NRZ A;  7ICP A;  4KLH A;  4R8U B;  2DGZ A;  2XY5 A;  1RYR A;  4MF2 A;  3QUC A;  2E1E A;  2EAP A;  4RQ2 A;  2E5S A;  5BPC A;  1N56 A;  9ICI A;  2LHT A;  3SQI A;  3PSI A;  1NKC A;  2ZIV B;  4CNQ A;  5J0P A;  4YR3 A;  4RQ1 A;  5KG6 A;  2B21 A;  4US8 A;  3MFI A;  2KE7 A;  5AKY A;  2LBO A;  5KFX A;  4GXI A;  1D8L A;  1BNO A;  3D2N A;  1Q8K A;  4PH5 A;  2KJ8 A;  4IS7 A;  5KL1 B;  5HR6 A;  3M8R A;  4X5V A;  5KFS A;  3C23 A;  3QUT A;  3RRH A;  4DS5 A;  3RH5 A;  3H0M B;  1PZN A;  5KT5 A;  2G5I B;  4RU9 A;  4Y2Q A;  4RQ3 A;  4DFK A;  5J0Q A;  2AU0 A;  5KFE A;  2RDI A;  4GC6 A;  5HHH A;  2DUY A;  3HWT A;  2JRZ A;  4NWI A;  9ICG A;  4CCH A;  3KHL A;  3F53 A;  2JH1 A;  4CRX A;  3TI0 A;  1KSP A;  4YXM A;  4EBC A;  4IQT A;  3QU4 A;  2WFA A;  4IRK A;  3GII A;  3NVZ A;  4QWC A;  3KFU F;  5L9X A;  4UB8 U;  2DL0 A;  5KT7 A;  5AHX A;  3HPO A;  2C22 A;  2A3V A;  1QQ5 A;  4EZ6 A;  4Q45 A;  5EE1 A;  4F2R A;  3OSP A;  1ZD4 A;  2ASL A;  2FDR A;  4F4W A;  4RNN A;  4PL1 A;  4J03 A;  4RUC A;  4O3P A;  3PX0 A;  4J9Q A;  3ICX A;  5DG7 A;  3HKZ C;  5ALX A;  4J9K A;  1ZQW A;  2ZUB A;  3QXG A;  3SAH A;  4OJP A;  2ZG6 A;  3HKZ F;  3V7J A;  4Y2J A;  3BZK A;  9ICQ A;  3KHR A;  4RNM A;  4P0Q B;  1SL0 A;  4ECT A;  3AEV A;  8ICJ A;  3LDA A;  4I2D A;  1RYS A;  4J9M A;  3EWA A;  2BPG A;  2JV3 A;  1PVR A;  4EBD A;  1MQ3 A;  3RJK A;  4QW9 A;  4G3I A;  1KBU A;  4DSK A;  2FI1 A;  5J2J A;  9ICP A;  4F5N A;  9ICF A;  4I2F A;  4RPY A;  2KSO B;  3H0R B;  2AGO A;  8ICC A;  2PKE A;  3Q8Q B;  2EQY A;  4F93 B;  4CDG A;  2A19 A;  1U4B A;  3Q8M A;  2BPF A;  5J0W A;  4ECY A;  3T5L A;  3RJF A;  2HBM A;  3T79 A;  4AP9 A;  9ICN A;  4KLJ A;  1QCK A;  2D3D A;  4GXK A;  1RXV A;  1X6J A;  4IQW A;  5EE9 A;  3WKA A;  5J0S A;  2F3N A;  1XSL A;  5ALJ A;  4C7Y A;  1NK8 A;  1UT5 A;  2Y0S C;  4YMN A;  1KKX A;  2MUT A;  2HSZ A;  2E1F A;  3UMG A;  2KIC A;  4F5Q A;  1Z00 B;  3QU5 A;  5ALS A;  2BKE A;  2HVH A;  1Z4O A;  1JXE A;  3JPS A;  3MC1 A;  2Z7J A;  3NTU A;  2IHM A;  2ZXH A;  1YT3 A;  1BPE A;  1U49 A;  2UVV A;  4I2I A;  4I2B A;  4P0P A;  3KKA A;  4PHD A;  5KG5 A;  2OM6 A;  3FDS A;  5J2E A;  2G08 A;  3PR4 A;  1NK9 A;  1NJY A;  1QQ6 A;  4ELU A;  4KLG A;  2AGQ A;  3N4M B;  4I2J A;  1L5U A;  1C7Y A;  2PI5 A;  3C21 A;  1UPH A;  3J81 j;  4DLE A;  4E0D A;  2KHQ A;  2GWS A;  2ZTC A;  4DL4 A;  2F44 A;  1VJ5 A;  4NLK A;  2OCE A;  2KFZ A;  3G6V A;  4AYB C;  4EEL A;  5F9L A;  4DQP A;  2ZJA A;  1ARO P;  2QLT A;  4OJO A;  3RR7 A;  1SV4 A;  2FJ6 A;  8ICK A;  2XO7 A;  2P66 A;  5DB8 A;  2BDP A;  2W9C A;  4AYB F;  4NXZ A;  4C4S A;  4QZE A;  3AMZ A;  2JEF A;  4KLT A;  4OD0 A;  3TKA A;  4XUS A;  2ESE A;  3MR6 A;  1D9F A;  2K4E A;  2KHV A;  3Q8P B;  2CRX A;  2JEI A;  5AI8 A;  3AQF A;  4ECR A;  4B6J A;  5HNK A;  5HHI A;  5AKK A;  3M6Z A;  2LM1 A;  3LWL A;  2HOF A;  3PO5 A;  1L7N A;  5ALK A;  3ZDD A;  3AU6 A;  4I2C A;  3L5K A;  1TFR A;  1V38 A;  3MR2 A;  4DFD A;  1NKE A;  3GV8 B;  4M47 A;  3BZC A;  3H8M A;  4YQW A;  5CR0 A;  3CW2 C;  1PK3 A;  2YX8 A;  4B9V A;  4ZOH C;  3RB6 A;  3RFA A;  4KLE A;  2ZIU B;  1XU4 A;  3OJU A;  2G06 A;  1D8Y A;  4UAS A;  1X42 A;  2PFO A;  4CF4 A;  3SEI A;  3H8W A;  4BXO B;  3KKA C;  3ISB A;  2YTU A;  4PZO A;  3CP8 A;  2W03 A;  1PK1 B;  5KFV A;  2JZB B;  4Q43 A;  4PHP A;  2IMW P;  4DLG A;  2V9W A;  4BJQ A;  4B9T A;  2FPL A;  2FMQ A;  1QH9 A;  5AKZ A;  4UQG A;  3Q8R B;  2EH9 A;  2ZXI A;  2ZIW A;  2XGQ A;  2ZJ8 A;  5HP4 A;  5KFC A;  5KFD A;  7ICJ A;  1PVQ A;  9ICL A;  3GV7 B;  7ICL A;  4EX7 A;  4DFJ A;  3IHQ B;  3QU9 A;  1WCL A;  1NK4 A;  4ELT A;  3G6X A;  2BQU A;  3TAR A;  4ICA A;  1ZQK A;  5B5E U;  5J8Y C;  4IL6 U;  2K8A A;  2K8B B;  4UB4 A;  1JX4 A;  5DLF A;  3EPG A;  1TK5 A;  5KFF A;  4R8U A;  3SAG A;  4F92 B;  5IIN A;  1IIP A;  1KW4 A;  3JPP A;  2KKP A;  4I28 A;  3NVW A;  4PZN A;  5ALD A;  1L3S A;  2FPM A;  1LKY B;  1S9F A;  4QZI A;  3FC4 A;  1Y88 A;  1NJZ A;  2KZ3 A;  1F44 A;  1V97 A;  3NGD A;  2CXY A;  2MU2 A;  2PMZ C;  1NK6 A;  4LZD A;  1DK3 A;  4KX3 A;  2LPE A;  1DRG A;  5EWG A;  3RBE A;  4B9N A;  2PMZ F;  1U45 A;  1WG8 A;  1VLB A;  2DKX A;  1P7D A;  2KK0 A;  5KFH A;  1NJW A;  4BUG A;  2XY7 A; 
#chains in the Genus database with same CATH homology
 2EZY A;  2ODG A;  2BZF A;  2EZX A;  2EZZ A;  1QCK A;  1CI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...