1CI4A

The crystal structure of human barrier-to-autointegration factor (baf)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of DNA bridging by barrier-to-autointegration factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF))
total genus 29
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1ci4A00
2ODGA 2BZFA 1QCKA 1CI4A 2EZYA 2EZXA 2EZZA
chains in the Genus database with same CATH superfamily
2PKEA 2K60A 4EX7A 3WKBA 3KHHA 4J9QA 2ZIWB 3TARA 9ICPA 2M9NA 2EDUA 1TAQA 5DB9A 1X42A 4FZMA 5H2FU 4YMNA 2Y9TA 3OSNA 3RAXA 3C1ZA 4X5VA 1SZHA 3QU7A 1NK8A 3ONNA 1IV8A 4J9RA 2AU0A 2QB0B 4RQ7A 1U49A 2DUYA 1TK0A 3M8SA 1PZNA 2PMZC 2D8CA 2HBKA 4QIWC 4KN7A 2E8OA 4DSIA 4DF4A 1LVHA 3O0FA 3EZ5A 2R8JA 5AK4A 2ISPA 2IBKA 2K89A 1ZRMA 5KFSA 4B9LA 1ZQLA 1ZXIA 4QZHA 4PHAA 2I5HA 1IG6A 1S9FA 1BPBA 1U47A 4UB3A 1S0VA 5KFQA 1ZQSA 2ZIVB 1D9FA 3TI0A 2XI9A 1TV9A 5HNKA 3Q8QB 3C5FA 5F3XB 8ICKA 4ECXA 5CA7A 2W9CB 3HWTA 3HPOA 1SWVA 1HEKA 2EAMA 1FFVA 2AXTU 3BQ2A 3IHQB 2E1FA 2VANA 2HHXA 3GFKB 5EE0A 4C4RA 3EPIA 5CRXA 2F77X 2KSOB 4Y2JA 4PZNA 2BCUA 4KLOA 2H5XA 4P0PB 3UMGA 9ICGA 5BOLA 4HYKA 2KTQA 3IV6A 2HHVA 4XQ8A 2VJ5A 4OJ5A 1COKA 8ICYA 4EYIB 4GC6A 4IQUA 2NRZA 7ICPA 1L7OA 8ICPA 5KFCA 4F4KA 2J6TA 4KLMA 3UMBA 2ZJ5A 3H8SA 5J0WA 2NRVA 1NKBA 4KLIA 5ALOA 7ICUA 3GIJA 3K1ZA 4QZ9A 4M9GA 5HR7A 3MFIA 2WF9A 1N48A 4ELVA 3RB3A 4I2BA 4WJ3B 4DLEA 5K4LA 5KFUA 1WG8A 4JB3A 4K4IA 3PSTA 3OPXA 2ZIUB 1JALA 9ICQA 1S76D 2L5YA 1MN8A 1Y88A 4EEYA 2J6UA 1QH9A 9ICXA 4DQPA 1UCVA 5ALKA 3C28A 4ECRA 5AM0A 3FC4A 5KG7A 3J81j 1ZQWA 2A1JB 2G07A 5IIKA 4Q8FA 4BGDA 5L9XA 1RQLA 1J97A 3KKAA 3Q8LA 1Q46A 2ZIWA 5AK6A 4GC7A 5ALQA 1Z4OA 3T5JA 1O08A 2JEGA 2NRXA 4DS5A 1X40A 3ZDEA 1K1SA 3TADA 2PI4A 4NV0A 3IM1A 1RXWA 9ICLA 2Z7JA 3QUQA 1TVAA 2UVWA 2JEIA 5JU5A 1L7PA 1ZJMA 1UT5A 5CB1A 1BNPA 1Z00B 3TQ1A 5IIIA 4ECYA 4DWIA 1ZD4A 4F50A 4EBEA 5J0SA 2W7OA 4QWCA 1QLNA 1J2NA 1A0PA 2K4PA 2LKYA 1YZ7A 2W8KA 5AIBA 4IQWA 2KHVA 3TFSA 5ALUA 2W11A 2WAQC 4QW9A 2RDJA 9ICFA 2P66A 4NL9C 8ICJA 1Q3UA 5AK5A 4BXOA 3RJKA 3UXOA 3UQ2A 2NRTA 5ALJA 4KLEA 1JMSA 2W9CA 2QB0A 3R9KA 3PV8A 4O3QA 5KFHA 4R65A 3OSPA 1HJPA 5CEHA 3PR4A 5EE9A 1L6NA 2RLTA 4QZFA 3HRDD 1L7NA 2D6FC 4UB5A 2M0NA 1TAMA 1K1QA 4B9VA 4DSJA 1A6SA 3SENA 2HW3A 2EZXA 2GH1A 1JRPA 4MF8A 3PW2A 3TFRA 1XWLA 2V4RA 3PR5B 1L8OA 2NO5A 4CF5A 4C8OA 5KFNA 2BQ3A 3TAQA 1COOA 5KG3A 2K8AA 2DFLA 7ICLA 3WU2U 2BCQA 4MEXA 4QZDA 3V72A 1RZTA 8ICAA 1DGSA 4ECVA 3D2SA 2V9WA 5KFVA 2I9GA 4EBDA 7ICEA 4YXJA 1S0MA 2ZIUA 1S77D 4F5NA 3KOOA 2BHNA 3B0XA 4PJ0U 2OHFA 3VC8A 5JUMA 1U4BA 4BWMA 3G6YA 2JH7A 4JV2A 8ICRA 3ZD8A 5KFTA 5KFMA 1TKDA 3QU9A 4A8EA 3PMNA 2HHTA 4TUQA 1JI7A 3TACB 3SAFA 3F2CA 4OD0A 7ICMA 3LDAA 5J8YA 4FO6A 3MFHA 5J2FA 5D49A 4R66A 4JK1A 4I2AA 1ZQPA 4DSFA 5KFEA 2W7PA 5JTIA 4R64A 2JRZA 3GIKA 7ICRA 3DEEA 4P4OA 4NLZA 3RRHA 4ECTA 1PVQA 2HMXA 4F72A 5ALGA 1L7MA 4J9KA 4I27A 2KZ3A 2YY6A 1NZBA 4F5RA 3K75D 2XICA 5KG4A 2WF6A 2B0CA 5EWFA 4CCHA 1VJ5A 2E1EA 4M9HA 1BVSA 3EWAA 3N4MB 3NS1A 2BPCA 1Z00A 2LM4A 5KL1B 2XGPA 1ZQMA 4C7ZA 3LVWA 4Y2XA 4RQ4A 2JHDA 2KG5A 5ALSA 1SL2A 3Q8PB 1ZQOA 4NLNA 1JIHA 5AICA 4RQ1A 4ED7A 4F91B 5AM1A 3H40A 4YR2A 4GIBA 4RQ2A 1RYSA 2OWOA 3K1RB 3OHAA 2FMSA 4YG2A 3N7RC 3A0BU 9ICUA 9ICWA 3QEAZ 2FPKA 5ALWA 4CF3A 2MA1A 4JWMA 1DXSA 1TK8A 2W9BB 2F3NA 4RT3A 2C2DA 3KD3A 3MR3A 9ICSA 4P0QA 3M9NB 5AI5A 3RH5A 2UVRA 2JR5A 4QWBA 1JX4A 1NK0A 1URJA 1L3VA 2W3SA 3M9MB 1QQ5A 1ZD2P 2WF7A 4FFDA 1MSWD 2BCRA 4EBCA 4QJFB 9ICOA 2PFPA 4EX6A 1F5SA 3WK8A 3M8RA 2ZXHA 4O5EA 3RFAA 4KLUA 2F1JA 4I2CA 3ISBA 2DGZA 3MABA 4FS1A 4IRKA 4B9TA 4BX9C 2C28A 1ZQEA 3PMLA 1B0XA 5ALZA 4IS7A 1PK1A 1WCNA 3RJEA 2VJ4A 2MUTA 2YMQA 3H4BA 1N62A 2XY5A 1SKRA 1M6YA 2DL0A 4JV0A 3B0YA 1T3NA 4BXOB 5KFRA 3MC1A 2G08A 5ALIA 5KG6A 3I1YA 4IRCA 3JPTA 3SEIA 3N28A 4GXIA 5KFLA 1IXRA 3WK5A 3SI8A 3E2EA 4PH5A 2KVCA 2KN7A 1TK5A 5G5GA 3BQ0A 1ZQBA 1RYUA 3NVVA 4DSEA 1BPZA 1Q3VA 5J0PA 4GXJA 3M9OB 3PSIA 4YR3A 4O3RA 1KDHA 1ZQKA 3RJHA 2WF5A 3KHGA 3IRUA 2IHMA 1Z19A 9ICRA 1IM4A 4QZAA 5AI9A 4C8NA 2KK0A 3B9JA 1S8OA 7ICVA 2W8LA 2QARA 1UA1A 4ED1A 4PHDA 5DBBA 3C29A 3HKZC 1WCLA 2G5IB 4K4HA 3IDWA 2KZMA 3H7IA 2G0AA 5DKWA 3RJGA 4R8UA 3U26A 2VA8A 1SWWA 7ICQA 2ES6A 1T4GA 5CHGA 8ICVA 4R63A 2ZUBA 3AUOA 3D2QA 5F9LA 2F2AB 1XC9A 1ZQVA 3MR6A 2W3RA 3WKCA 5DQHA 1S10A 5AKZA 2IOHA 4O0IA 4RPXA 3Q8RB 4NLKA 7ICSA 5AK3A 3PW4A 2R18A 1N60A 4YN4A 5AM2A 5T14A 3QZ8A 4ELTA 2AQ4A 3NGDA 4J9LA 4RQ8A 4UAWA 2HVIA 2GWSA 1ZQQA 2QKQA 3N7PD 3H8WA 4FS2A 4OCZA 2LBOA 3BS5B 4KX5A 3M7DA 4ECWA 5EWGA 4ELUA 2HOQA 3WKDA 3F53A 4DOBA 2VA2A 1DK3A 3PX0A 2H3QA 3LK9A 4DL2A 5TISU 2XC9A 4FBUA 5AKYA 4KLLA 3C21A 4O3OA 1XU4A 3BQ7A 3RJFA 1KFTA 4F8RA 2F8KA 5IINA 8ICCA 1S0NA 1VLBA 3RB4A 2YB4A 2EH9A 3KZIU 1CEZA 5BPCA 4OO1J 2E5SA 5L1IA 4AYBF 2HOFA 2BPGA 3Q8MA 2UVUA 1Z4NA 1SKWA 2FLPA 2Y0SF 2IA6A 4UB8U 2Q4TA 1PK1B 4NWIA 4Q8EA 3MBYA 3G6XA 2EAOA 2HVHA 5KFBA 1HUOA 4FE3A 2NV3A 4UAVA 7ICFA 3H0MB 5HP4A 1BPDA 4I2HA 3LWMA 3AQFA 4RPYA 2HOIA 4DOCA 2JEFA 4US9A 2DBYA 2FLNA 1ZQ1C 8ICSA 4YD2A 5KNIA 4B9MA 2KIVA 2A3VA 7ICJA 2BZFA 5J2IA 4QZGA 2QB1A 4M2YA 2AH5A 4U6PA 4DL3A 3MGVA 2CPRA 4Y2RA 1EXNA 2FI1A 9ICNA 4Y2YA 2PFNA 2Y9UA 2KZZA 3JPOA 2XCAA 3JPPA 3MGHA 8ICHA 2W43A 2DKXA 2AGQA 1ZQCA 2ODGA 4BJQA 2OM6A 4F3OA 5EOZA 5ALNA 4J9MA 3PX6A 1ZJNA 4DSLA 2PI5A 1YZ6A 3H8MA 4UAYA 3SD7A 4CF4A 4UB6U 4DSKA 2MUTB 2DWQA 4ED2A 3WK4A 3HT3A 4US8A 4CDGA 1NNLA 2G5HB 3PY8A 2ALZA 3BZCA 2XVTA 1X6JA 2YX8A 5ALRA 5ALPA 2VIXA 4Z6EA 1PVPA 2F1HA 5AKGA 3FAHA 1SZPA 2W54A 1ZQAA 3E58A 1DK2A 1AQ6A 1LKYB 3QX7A 4XUSA 5IIJA 4LJXA 4IQVA 5DBCA 4UQGA 1Z1BA 1RG6A 2FJ6A 1SL0A 3FYHA 3SMVA 3NVWA 5AHXA 2R8IA 2HHUA 4DEZA 1RXVA 4JUZA 1XS9D 4TUPA 1NJZA 3ALRA 4IL6U 1T3QA 2BGWA 4IC9A 2LYBA 3BS5A 3SV3A 3I28A 5A0LA 1QSSA 5HHHA 3RF9A 4RPZA 4ED3A 3RJIA 1RDFA 1YT3A 3C2KA 1DGJA 1OW5A 2K8CB 3WKAA 3UPQA 1DRGA 3C2LA 5KFIA 4F5PA 5DB7A 2NRWA 1KSPA 4BDPA 4UASA 4DL6A 2A19A 3T5LA 4PPXA 4TUSA 5KG1A 3EYZA 3QE9Y 3EUB2 1Q8KA 5J0QA 8ICIA 4CE6A 5ALMA 3CNHA 1VDVA 3QUTA 3NASA 4F4ZA 5ALYA 3EW9A 4P4MA 2E8NA 1T7PA 3ZDAA 5J0TA 4YCXA 3BQTA 2ASDA 1NK4A 2LI6A 4C8KA 2MRLA 4DQQA 2K4IA 2AHOB 2FDRA 1TAUA 1N56A 4PZOA 2YMLA 2HCFA 5IIOA 1ZQNA 2JZBB 3RR7A 3OJSA 1C7YA 5J2DA 3G6VA 1JROA 1MQ2A 1ZQUA 3FM9A 1ZQRA 4M47A 5ALXA 3H4DA 3QU2A 7ICKA 4G9BA 2DF4B 8ICMA 5KT4A 3ZDDA 2QLTA 2RRDA 1X66A 3CW2C 3WK9A 4ECZA 3NUQA 4F93B 5CR0A 4C8MA 9ICCA 2P6RA 4HAIA 5DBAA 4UATA 4RQ5A 4O5CA 4I2FA 4KLFA 4F4YA 3H8JA 4UB4A 3AL0B 5KT6A 4J9OA 5AKXA 3VCBA 2ZTDA 2ZUCA 2XIDA 1KEJA 4QNLA 1TFRA 3SR6A 3JPQA 3WK7A 4Y2UA 1J2MA 1NJXA 2W9BA 3RRGA 4RQ0A 1SV4A 9ICAA 3T79A 2FPMA 2MSNA 5DGAA 2JXJA 2ZG6A 4OJLA 2B21A 5L1MA 1FO4A 1NK9A 3N97B 3QUCA 1KN5A 1X9SA 4ECSA 3PSPA 2ZTEA 4IQTA 3GIMA 1D8YA 4UB2A 1S0OA 1NKCA 2GLEA 4NY8A 5DLFA 3NTUA 4LVSA 4J03A 1U9LA 2HBMA 4RQNA 5AI8A 2RP5A 4U7CA 2O6KA 5ALTA 4C7YA 3AMZA 3ZI4A 3M1YA 2LYHA 2R8GA 1BPYA 4G3IA 4MEYA 2LPEA 1A76A 1K5OA 4OJ6A 4YQWA 2FE9A 1T94A 4IR9A 5KFKA 3I76A 4F5OA 2ZIXA 3SZ2A 1AROP 3PW5A 1RYRA 3JPNA 4KLDA 4NLCA 1MC8A 4Z6CA 5AI6A 3RAQA 4JWNA 1DOQA 5G5HA 4XRHA 4ED6A 2BR0A 1NJWA 2FMQA 1XSNA 5TZVA 8ICBA 5KAIU 1U48A 1WUDA 5J2HA 1B22A 4F4WA 3DDHA 3A0HU 4Y2VA 5D46A 5HMMA 4UBCA 1NK5A 5HR6A 8ICLA 3GV5B 2F44A 5DB6A 1FFUA 3MR2A 5KFOA 4NM1A 3S6JA 2E8PA 2PXIA 3UXNA 1LV5A 2ESEA 2FLLA 1JN3A 3BJYA 1ZQDA 4DCCA 4Q43A 2PFQA 3QYPA 3V6KA 7ICNA 2EAPA 5L1KA 3SYZA 5EE1A 1L3TA 5HMLA 2ASLA 3CRXA 4MFCA 4ED8A 1UPHA 4DOAA 5AM4A 2UVVA 4ECQA 1SV0C 4PGXA 8ICWA 4F71A 3M6KA 5KFYA 4ZOHC 4DO9A 5J2CA 1KTQA 1N61A 3T5HA 3ETLA 2BPFA 3TANA 3PO4A 4UAZA 4RZRA 5GTIU 4R8UB 4DF8A 1H38A 3KHLA 4KLQA 3V7KA 3AU2A 5AIAA 5AKEA 3RB0A 4AYBC 3H0LB 1CUKA 3F5AA 2BKEA 5B66U 3RR8A 2W9AA 2WHEA 4OJOA 5KAFU 5KFWA 4ICAA 4C8LA 5E79U 4P4PA 1QTMA 5KFPA 3GZFA 4Y2QA 4O3SA 1QQ6A 3QU4A 2W55A 4Q44A 2EANA 2C22A 2NO4A 1UA0A 3N7SC 3FDSA 5L1JA 2V4QA 2F8LA 5B5EU 4RNMA 3H0RB 3QXGA 4KLHA 4F2RA 1JXEA 2FMPA 2WB1C 5DLGA 8ICTA 4B9SA 1UT8A 1TE2A 1ZQZA 4PHPA 2OXOA 4UAUA 5CWRA 3UMCA 1P7DA 1CRXA 7ICGA 1Z3EB 1HIWA 2JZBA 4C4TA 1JXLA 4QWEA 1X9WA 2ZJAA 5KFXA 1GO3F 5DQGA 2AJQA 5AKLA 1NI3A 1XNSA 8ICNA 4FZNA 1ECWA 2CRXA 3TADC 1A77A 2HBLA 1NKEA 4I29A 2OYYA 1SB3C 8ICOA 3L3FX 3L5KA 2KMDA 1QSLA 1PVRA 4EZ9A 1D8BA 4KLJA 5CP2A 4KLGA 4DFPA 4KLTA 3ORYA 5FP0A 3BQ1A 2WFAA 3UQ0A 4QZIA 4KLSA 7ICHA 2G09A 2KIWA 7ICOA 2JH1A 5AKJA 1KLNA 4DQRA 3UXPA 5KFGA 4MHVA 2KOBA 4Z6FA 3F2BA 2ZTCA 5HHIA 3AN1A 1ZD5A 4TQRA 3SAHA 5KFZA 8ICGA 5AM3A 4CNQA 4KITB 4KTQA 2WF8A 1IIPA 5KT5A 3IG5A 1ZOLA 5C0YA 4RUCA 3K4GA 2F1IA 1SXEA 2RQ5A 4UB1A 2KHQA 4CGZA 4YMOA 1ZQGA 3IN5A 5KT3A 4O9MA 3NVZA 1ZQYA 4DS4A 1KFDA 4YP3A 4LZGA 5F9NA 5J0YA 1N5XA 3OJUA 3IP4B 1MA7A 4O3NA 4QWAA 3RH4A 3UM9A 4I28A 1OXJA 3HX0A 5J2GA 4M9NA 3SV4A 4ACOA 2XGQA 2KVSA 1SKSA 1SL1A 3TAPA 4M9LA 1KQQA 2H3IA 3Q8KA 1KKXA 2JGAA 4TQSA 9ICTA 1SXDA 3PO5A 1KW4A 1RQNA 2BQUA 5L1LA 4DQIA 4RQ6A 5C5JA 1FIQA 2DPJA 4NLBA 2ZXIA 4M9JA 4J9SA 4J9NA 1KBUA 2VA3A 2W04A 4YR0A 1ZQHA 2XCPA 4I2DA 3RH6A 3V7JA 3EPGA 1L5UA 4F92B 1CI4A 2BDUA 4O3MA 1ZYQA 2XY6A 4DL4A 2C2EA 2KFNA 2BDPA 5DB8A 2KJ5A 3QZ7A 4EELA 1X9MA 7ICTA 4Z6DA 4YFKA 2K4HA 4NLGA 3AEVA 2VKQA 3WK6A 4QIWF 5J8YC 5DGBA 5IILA 1ZQXA 1BPEA 4I2JA 5DG9A 4DQSA 2RDIA 4XA5A 5KG2A 2WTFA 2AGPA 1ZQIA 3V6JA 1SGGA 3ICXA 3RBEA 1NOMA 2ZIVA 4KX3A 4UARA 2BCVA 3ZDBA 3RJJA 3GDXA 4C0ZA 2XY7A 4YXMA 2BCSA 4BUGA 4Y2PA 2F76X 4B9UA 8ICZA 2BQRA 3M6ZA 1SIJA 4QW8A 3ISDA 2H3FA 2FPLA 3LVVA 2LMRA 5DDMA 1X6IA 3QUBA 5J2EA 1ZQJA 4P0PA 5KL8B 2LYAA 4KMUA 5ALLA 1OUQA 9ICEA 2R8HA 4QWDA 2KP7A 3GU3A 1HUZA 4F5QA 5DG7A 1FEZA 3RTVA 5AI4A 4RUAA 4GLXA 3PZPA 1U45A 5CJ7A 2YB1A 2DQNB 2K8BB 2I1QA 3C2MA 4DFMA 2IOFA 5ALHA 1KL9A 1BNOA 3HW8A 3THVA 1D8LA 3WKEA 4NXZA 4GFJA 4RU9A 1ZRNA 2HSZA 2LHTA 2N1RA 3QU5A 2OEHA 4J9PA 2OCEA 2KNJA 3ZDCA 4C4SA 4EENA 3ED5A 1V38A 2P35A 2LM1A 4JV1A 2JEJA 5ALEA 1WWVA 5AM5A 5J0UA 2KJ8A 3D6JA 1L3SA 3QEBZ 5KT2A 4M6WA 3RBDA 3HJEA 7ICIA 2W03A 4KN4A 4GXKA 4PGYA 4UBBA 3OGUA 5DDYA 1LB2B 2KV2A 2E8MA 2ZJ8A 1NZPA 1JUDA 5J29A 5JRTA 2KICA 4CRXA 1NK7A 4Y2TA 5J2JA 3MR5A 2HDOA 1N63A 8ICQA 3GV8B 1RM6C 4O5KA 2WB1F 5J2BA 1NJYA 2Y1IA 4DL5A 2HHWA 4LZDA 1PUZA 2OH2A 2KD1A 1C20A 1XSLA 4MF2A 4DFKA 5IIMA 5AKIA 1O03A 1NK6A 5KFJA 2GOLA 2ZUDA 3SAGA 2PMZF 2HBJA 4JMUA 4RQMA 4DLGA 1UQVA 8ICEA 2KEYA 1WWUA 2ZIXB 3HP6A 4MFAA 2ASJA 3AM9A 4P2HA 2QARB 2EQYA 3E0FA 4DL7A 1L3UA 2JV3A 3C1YA 3C5GA 4DFJA 5D4BA 3OTQA 4O3PA 2H3VA 4ZH4A 1XSPA 4RT2A 5J0XA 3GV7B 1SV0A 8ICFA 1ZQFA 4EYHB 2DPIA 2J6SA 3PNCA 4K4GA 2Q0ZX 2HHSA 2GO7A 2JMGA 2NYVA 3LYSA 9ICBA 2Y0SC 1F0MA 2R8KA 2HHQA 5KFDA 3ISCA 4FZLA 3PSFA 3QNMA 4I2GA 4EZ6A 4NM2A 5ALVA 4EEKA 4C80A 5AKHA 3OHBA 3PVXA 2KFZA 3KZXA 1KRPA 3F5EA 2YN4A 1MQ3A 4PGQA 4OJPA 5KT7A 1Z1VA 5J0OA 5ALFA 3GILA 1T8EA 2EZYA 4QZBA 3BZKA 4YVZA 1ZQTA 4B9NA 3SQIA 3V6HA 5J0RA 5KFFA 3IG8A 1D9DA 2I6XA 2EZZA 1F44A 1BGXT 5GTHU 4YMMA 1N5WA 4QZCA 3KFUF 1WYGA 2KKVA 3CP8A 4RQ3A 9ICJA 4BWJA 2C2RA 2AQ0A 2YQEA 1V85A 5ALDA 1X2IA 2KSOA 2W9MA 4QZ8A 3HKZF 5KFAA 2Y1JA 3CYMA 1XO0A 2IMWP 2MAXA 4Q45A 4ED0A 2P6UA 2IOFK 3D2NA 4ECUA 4M6WB 2ATLA 1QSYA 1ZD3A 1LKYA 3T3FA 1PK3A 3PW7A 3MDAA 3TKAA 3GQCA 1KFSA 9ICIA 5EE3A 2MU2A 4NL9A 2YTUA 5DQIA 3JPRA 3V7LA 3KTQA 1QQ7A 2KE7A 5KG0A 2H3ZA 1X9XA 2IHNA 4PL1A 3GIIA 1UHUA 8ICXA 5AI0A 4PHEA 5AKKA 1QCKA 5DG8A 2D3DA 3C23A 3RB6A 4IR1A 8ICUA 2RHFA 2E3TA 3BDPA 4IRDA 2KKPA 2XO7A 3ETRA 4TURA 3AU6A 2B6GA 4NJ8A 2AGOA 9ICKA 3Q8SB 1ZETA 4AP9A 2G06A 9ICVA 9ICMA 2HI0A 5J2KA 3PX4A 3MGIA 3KBBA 2ISOA 3LWLA 4E0DA 4PL2A 1B43A 3MDCA 2CN1A 2YMMA 4M04A 4I2EA 2PFOA 3BS7A 3JPSA 3NRWA 1RPLA 4I2IA 3T5KA 4F4XA 2YMPA 1N2XA 3KKAC 4M0AA 3NVYA 4UW9A 2K4EA 1V9PA 3ZD9A 5EWEA 3HILA 4QZEA 3NRZA 1S97A 1V97A 2DKZA 1XO1A 5J2AA 3PW0A 3L4PA 4B6JA 4DFDA 4YD1A 1S5LU 4P0QB 2A1AA 3DV9A 2KJ9A 2WAQF 4F2SA 1BPXA 3F2DA 4USAA 5BOMA 4RNOA 4KMOB 1L8LA 4MFFA 3AQEA 4RNNA 4Y2SA 2A1JA 5KG5A 3KHRA 1B4FA 5KTQA 1ED1A 2CXYA 9ICHA 4FBTA
chains in the Genus database with same CATH topology
2ODGA 2BZFA 1QCKA 1CI4A 2EZYA 2EZXA 2EZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODG A;  2BZF A;  1QCK A;  1CI4 A;  2EZY A;  2EZX A;  2EZZ A; 
#chains in the Genus database with same CATH topology
 2PKE A;  2K60 A;  4EX7 A;  3WKB A;  3KHH A;  4J9Q A;  2ZIW B;  3TAR A;  9ICP A;  2M9N A;  2EDU A;  1TAQ A;  5DB9 A;  1X42 A;  4FZM A;  5H2F U;  4YMN A;  2Y9T A;  3OSN A;  3RAX A;  3C1Z A;  4X5V A;  1SZH A;  3QU7 A;  1NK8 A;  3ONN A;  1IV8 A;  4J9R A;  2AU0 A;  2QB0 B;  4RQ7 A;  1U49 A;  2DUY A;  1TK0 A;  3M8S A;  1PZN A;  2PMZ C;  2D8C A;  2HBK A;  4QIW C;  4KN7 A;  2E8O A;  4DSI A;  4DF4 A;  1LVH A;  3O0F A;  3EZ5 A;  2R8J A;  5AK4 A;  2ISP A;  2IBK A;  2K89 A;  1ZRM A;  5KFS A;  4B9L A;  1ZQL A;  1ZXI A;  4QZH A;  4PHA A;  2I5H A;  1IG6 A;  1S9F A;  1BPB A;  1U47 A;  4UB3 A;  1S0V A;  5KFQ A;  1ZQS A;  2ZIV B;  1D9F A;  3TI0 A;  2XI9 A;  1TV9 A;  5HNK A;  3Q8Q B;  3C5F A;  5F3X B;  8ICK A;  4ECX A;  5CA7 A;  2W9C B;  3HWT A;  3HPO A;  1SWV A;  1HEK A;  2EAM A;  1FFV A;  2AXT U;  3BQ2 A;  3IHQ B;  2E1F A;  2VAN A;  2HHX A;  3GFK B;  5EE0 A;  4C4R A;  3EPI A;  5CRX A;  2F77 X;  2KSO B;  4Y2J A;  4PZN A;  2BCU A;  4KLO A;  2H5X A;  4P0P B;  3UMG A;  9ICG A;  5BOL A;  4HYK A;  2KTQ A;  3IV6 A;  2HHV A;  4XQ8 A;  2VJ5 A;  4OJ5 A;  1COK A;  8ICY A;  4EYI B;  4GC6 A;  4IQU A;  2NRZ A;  7ICP A;  1L7O A;  8ICP A;  5KFC A;  4F4K A;  2J6T A;  4KLM A;  3UMB A;  2ZJ5 A;  3H8S A;  5J0W A;  2NRV A;  1NKB A;  4KLI A;  5ALO A;  7ICU A;  3GIJ A;  3K1Z A;  4QZ9 A;  4M9G A;  5HR7 A;  3MFI A;  2WF9 A;  1N48 A;  4ELV A;  3RB3 A;  4I2B A;  4WJ3 B;  4DLE A;  5K4L A;  5KFU A;  1WG8 A;  4JB3 A;  4K4I A;  3PST A;  3OPX A;  2ZIU B;  1JAL A;  9ICQ A;  1S76 D;  2L5Y A;  1MN8 A;  1Y88 A;  4EEY A;  2J6U A;  1QH9 A;  9ICX A;  4DQP A;  1UCV A;  5ALK A;  3C28 A;  4ECR A;  5AM0 A;  3FC4 A;  5KG7 A;  3J81 j;  1ZQW A;  2A1J B;  2G07 A;  5IIK A;  4Q8F A;  4BGD A;  5L9X A;  1RQL A;  1J97 A;  3KKA A;  3Q8L A;  1Q46 A;  2ZIW A;  5AK6 A;  4GC7 A;  5ALQ A;  1Z4O A;  3T5J A;  1O08 A;  2JEG A;  2NRX A;  4DS5 A;  1X40 A;  3ZDE A;  1K1S A;  3TAD A;  2PI4 A;  4NV0 A;  3IM1 A;  1RXW A;  9ICL A;  2Z7J A;  3QUQ A;  1TVA A;  2UVW A;  2JEI A;  5JU5 A;  1L7P A;  1ZJM A;  1UT5 A;  5CB1 A;  1BNP A;  1Z00 B;  3TQ1 A;  5III A;  4ECY A;  4DWI A;  1ZD4 A;  4F50 A;  4EBE A;  5J0S A;  2W7O A;  4QWC A;  1QLN A;  1J2N A;  1A0P A;  2K4P A;  2LKY A;  1YZ7 A;  2W8K A;  5AIB A;  4IQW A;  2KHV A;  3TFS A;  5ALU A;  2W11 A;  2WAQ C;  4QW9 A;  2RDJ A;  9ICF A;  2P66 A;  4NL9 C;  8ICJ A;  1Q3U A;  5AK5 A;  4BXO A;  3RJK A;  3UXO A;  3UQ2 A;  2NRT A;  5ALJ A;  4KLE A;  1JMS A;  2W9C A;  2QB0 A;  3R9K A;  3PV8 A;  4O3Q A;  5KFH A;  4R65 A;  3OSP A;  1HJP A;  5CEH A;  3PR4 A;  5EE9 A;  1L6N A;  2RLT A;  4QZF A;  3HRD D;  1L7N A;  2D6F C;  4UB5 A;  2M0N A;  1TAM A;  1K1Q A;  4B9V A;  4DSJ A;  1A6S A;  3SEN A;  2HW3 A;  2EZX A;  2GH1 A;  1JRP A;  4MF8 A;  3PW2 A;  3TFR A;  1XWL A;  2V4R A;  3PR5 B;  1L8O A;  2NO5 A;  4CF5 A;  4C8O A;  5KFN A;  2BQ3 A;  3TAQ A;  1COO A;  5KG3 A;  2K8A A;  2DFL A;  7ICL A;  3WU2 U;  2BCQ A;  4MEX A;  4QZD A;  3V72 A;  1RZT A;  8ICA A;  1DGS A;  4ECV A;  3D2S A;  2V9W A;  5KFV A;  2I9G A;  4EBD A;  7ICE A;  4YXJ A;  1S0M A;  2ZIU A;  1S77 D;  4F5N A;  3KOO A;  2BHN A;  3B0X A;  4PJ0 U;  2OHF A;  3VC8 A;  5JUM A;  1U4B A;  4BWM A;  3G6Y A;  2JH7 A;  4JV2 A;  8ICR A;  3ZD8 A;  5KFT A;  5KFM A;  1TKD A;  3QU9 A;  4A8E A;  3PMN A;  2HHT A;  4TUQ A;  1JI7 A;  3TAC B;  3SAF A;  3F2C A;  4OD0 A;  7ICM A;  3LDA A;  5J8Y A;  4FO6 A;  3MFH A;  5J2F A;  5D49 A;  4R66 A;  4JK1 A;  4I2A A;  1ZQP A;  4DSF A;  5KFE A;  2W7P A;  5JTI A;  4R64 A;  2JRZ A;  3GIK A;  7ICR A;  3DEE A;  4P4O A;  4NLZ A;  3RRH A;  4ECT A;  1PVQ A;  2HMX A;  4F72 A;  5ALG A;  1L7M A;  4J9K A;  4I27 A;  2KZ3 A;  2YY6 A;  1NZB A;  4F5R A;  3K75 D;  2XIC A;  5KG4 A;  2WF6 A;  2B0C A;  5EWF A;  4CCH A;  1VJ5 A;  2E1E A;  4M9H A;  1BVS A;  3EWA A;  3N4M B;  3NS1 A;  2BPC A;  1Z00 A;  2LM4 A;  5KL1 B;  2XGP A;  1ZQM A;  4C7Z A;  3LVW A;  4Y2X A;  4RQ4 A;  2JHD A;  2KG5 A;  5ALS A;  1SL2 A;  3Q8P B;  1ZQO A;  4NLN A;  1JIH A;  5AIC A;  4RQ1 A;  4ED7 A;  4F91 B;  5AM1 A;  3H40 A;  4YR2 A;  4GIB A;  4RQ2 A;  1RYS A;  2OWO A;  3K1R B;  3OHA A;  2FMS A;  4YG2 A;  3N7R C;  3A0B U;  9ICU A;  9ICW A;  3QEA Z;  2FPK A;  5ALW A;  4CF3 A;  2MA1 A;  4JWM A;  1DXS A;  1TK8 A;  2W9B B;  2F3N A;  4RT3 A;  2C2D A;  3KD3 A;  3MR3 A;  9ICS A;  4P0Q A;  3M9N B;  5AI5 A;  3RH5 A;  2UVR A;  2JR5 A;  4QWB A;  1JX4 A;  1NK0 A;  1URJ A;  1L3V A;  2W3S A;  3M9M B;  1QQ5 A;  1ZD2 P;  2WF7 A;  4FFD A;  1MSW D;  2BCR A;  4EBC A;  4QJF B;  9ICO A;  2PFP A;  4EX6 A;  1F5S A;  3WK8 A;  3M8R A;  2ZXH A;  4O5E A;  3RFA A;  4KLU A;  2F1J A;  4I2C A;  3ISB A;  2DGZ A;  3MAB A;  4FS1 A;  4IRK A;  4B9T A;  4BX9 C;  2C28 A;  1ZQE A;  3PML A;  1B0X A;  5ALZ A;  4IS7 A;  1PK1 A;  1WCN A;  3RJE A;  2VJ4 A;  2MUT A;  2YMQ A;  3H4B A;  1N62 A;  2XY5 A;  1SKR A;  1M6Y A;  2DL0 A;  4JV0 A;  3B0Y A;  1T3N A;  4BXO B;  5KFR A;  3MC1 A;  2G08 A;  5ALI A;  5KG6 A;  3I1Y A;  4IRC A;  3JPT A;  3SEI A;  3N28 A;  4GXI A;  5KFL A;  1IXR A;  3WK5 A;  3SI8 A;  3E2E A;  4PH5 A;  2KVC A;  2KN7 A;  1TK5 A;  5G5G A;  3BQ0 A;  1ZQB A;  1RYU A;  3NVV A;  4DSE A;  1BPZ A;  1Q3V A;  5J0P A;  4GXJ A;  3M9O B;  3PSI A;  4YR3 A;  4O3R A;  1KDH A;  1ZQK A;  3RJH A;  2WF5 A;  3KHG A;  3IRU A;  2IHM A;  1Z19 A;  9ICR A;  1IM4 A;  4QZA A;  5AI9 A;  4C8N A;  2KK0 A;  3B9J A;  1S8O A;  7ICV A;  2W8L A;  2QAR A;  1UA1 A;  4ED1 A;  4PHD A;  5DBB A;  3C29 A;  3HKZ C;  1WCL A;  2G5I B;  4K4H A;  3IDW A;  2KZM A;  3H7I A;  2G0A A;  5DKW A;  3RJG A;  4R8U A;  3U26 A;  2VA8 A;  1SWW A;  7ICQ A;  2ES6 A;  1T4G A;  5CHG A;  8ICV A;  4R63 A;  2ZUB A;  3AUO A;  3D2Q A;  5F9L A;  2F2A B;  1XC9 A;  1ZQV A;  3MR6 A;  2W3R A;  3WKC A;  5DQH A;  1S10 A;  5AKZ A;  2IOH A;  4O0I A;  4RPX A;  3Q8R B;  4NLK A;  7ICS A;  5AK3 A;  3PW4 A;  2R18 A;  1N60 A;  4YN4 A;  5AM2 A;  5T14 A;  3QZ8 A;  4ELT A;  2AQ4 A;  3NGD A;  4J9L A;  4RQ8 A;  4UAW A;  2HVI A;  2GWS A;  1ZQQ A;  2QKQ A;  3N7P D;  3H8W A;  4FS2 A;  4OCZ A;  2LBO A;  3BS5 B;  4KX5 A;  3M7D A;  4ECW A;  5EWG A;  4ELU A;  2HOQ A;  3WKD A;  3F53 A;  4DOB A;  2VA2 A;  1DK3 A;  3PX0 A;  2H3Q A;  3LK9 A;  4DL2 A;  5TIS U;  2XC9 A;  4FBU A;  5AKY A;  4KLL A;  3C21 A;  4O3O A;  1XU4 A;  3BQ7 A;  3RJF A;  1KFT A;  4F8R A;  2F8K A;  5IIN A;  8ICC A;  1S0N A;  1VLB A;  3RB4 A;  2YB4 A;  2EH9 A;  3KZI U;  1CEZ A;  5BPC A;  4OO1 J;  2E5S A;  5L1I A;  4AYB F;  2HOF A;  2BPG A;  3Q8M A;  2UVU A;  1Z4N A;  1SKW A;  2FLP A;  2Y0S F;  2IA6 A;  4UB8 U;  2Q4T A;  1PK1 B;  4NWI A;  4Q8E A;  3MBY A;  3G6X A;  2EAO A;  2HVH A;  5KFB A;  1HUO A;  4FE3 A;  2NV3 A;  4UAV A;  7ICF A;  3H0M B;  5HP4 A;  1BPD A;  4I2H A;  3LWM A;  3AQF A;  4RPY A;  2HOI A;  4DOC A;  2JEF A;  4US9 A;  2DBY A;  2FLN A;  1ZQ1 C;  8ICS A;  4YD2 A;  5KNI A;  4B9M A;  2KIV A;  2A3V A;  7ICJ A;  2BZF A;  5J2I A;  4QZG A;  2QB1 A;  4M2Y A;  2AH5 A;  4U6P A;  4DL3 A;  3MGV A;  2CPR A;  4Y2R A;  1EXN A;  2FI1 A;  9ICN A;  4Y2Y A;  2PFN A;  2Y9U A;  2KZZ A;  3JPO A;  2XCA A;  3JPP A;  3MGH A;  8ICH A;  2W43 A;  2DKX A;  2AGQ A;  1ZQC A;  2ODG A;  4BJQ A;  2OM6 A;  4F3O A;  5EOZ A;  5ALN A;  4J9M A;  3PX6 A;  1ZJN A;  4DSL A;  2PI5 A;  1YZ6 A;  3H8M A;  4UAY A;  3SD7 A;  4CF4 A;  4UB6 U;  4DSK A;  2MUT B;  2DWQ A;  4ED2 A;  3WK4 A;  3HT3 A;  4US8 A;  4CDG A;  1NNL A;  2G5H B;  3PY8 A;  2ALZ A;  3BZC A;  2XVT A;  1X6J A;  2YX8 A;  5ALR A;  5ALP A;  2VIX A;  4Z6E A;  1PVP A;  2F1H A;  5AKG A;  3FAH A;  1SZP A;  2W54 A;  1ZQA A;  3E58 A;  1DK2 A;  1AQ6 A;  1LKY B;  3QX7 A;  4XUS A;  5IIJ A;  4LJX A;  4IQV A;  5DBC A;  4UQG A;  1Z1B A;  1RG6 A;  2FJ6 A;  1SL0 A;  3FYH A;  3SMV A;  3NVW A;  5AHX A;  2R8I A;  2HHU A;  4DEZ A;  1RXV A;  4JUZ A;  1XS9 D;  4TUP A;  1NJZ A;  3ALR A;  4IL6 U;  1T3Q A;  2BGW A;  4IC9 A;  2LYB A;  3BS5 A;  3SV3 A;  3I28 A;  5A0L A;  1QSS A;  5HHH A;  3RF9 A;  4RPZ A;  4ED3 A;  3RJI A;  1RDF A;  1YT3 A;  3C2K A;  1DGJ A;  1OW5 A;  2K8C B;  3WKA A;  3UPQ A;  1DRG A;  3C2L A;  5KFI A;  4F5P A;  5DB7 A;  2NRW A;  1KSP A;  4BDP A;  4UAS A;  4DL6 A;  2A19 A;  3T5L A;  4PPX A;  4TUS A;  5KG1 A;  3EYZ A;  3QE9 Y;  3EUB 2;  1Q8K A;  5J0Q A;  8ICI A;  4CE6 A;  5ALM A;  3CNH A;  1VDV A;  3QUT A;  3NAS A;  4F4Z A;  5ALY A;  3EW9 A;  4P4M A;  2E8N A;  1T7P A;  3ZDA A;  5J0T A;  4YCX A;  3BQT A;  2ASD A;  1NK4 A;  2LI6 A;  4C8K A;  2MRL A;  4DQQ A;  2K4I A;  2AHO B;  2FDR A;  1TAU A;  1N56 A;  4PZO A;  2YML A;  2HCF A;  5IIO A;  1ZQN A;  2JZB B;  3RR7 A;  3OJS A;  1C7Y A;  5J2D A;  3G6V A;  1JRO A;  1MQ2 A;  1ZQU A;  3FM9 A;  1ZQR A;  4M47 A;  5ALX A;  3H4D A;  3QU2 A;  7ICK A;  4G9B A;  2DF4 B;  8ICM A;  5KT4 A;  3ZDD A;  2QLT A;  2RRD A;  1X66 A;  3CW2 C;  3WK9 A;  4ECZ A;  3NUQ A;  4F93 B;  5CR0 A;  4C8M A;  9ICC A;  2P6R A;  4HAI A;  5DBA A;  4UAT A;  4RQ5 A;  4O5C A;  4I2F A;  4KLF A;  4F4Y A;  3H8J A;  4UB4 A;  3AL0 B;  5KT6 A;  4J9O A;  5AKX A;  3VCB A;  2ZTD A;  2ZUC A;  2XID A;  1KEJ A;  4QNL A;  1TFR A;  3SR6 A;  3JPQ A;  3WK7 A;  4Y2U A;  1J2M A;  1NJX A;  2W9B A;  3RRG A;  4RQ0 A;  1SV4 A;  9ICA A;  3T79 A;  2FPM A;  2MSN A;  5DGA A;  2JXJ A;  2ZG6 A;  4OJL A;  2B21 A;  5L1M A;  1FO4 A;  1NK9 A;  3N97 B;  3QUC A;  1KN5 A;  1X9S A;  4ECS A;  3PSP A;  2ZTE A;  4IQT A;  3GIM A;  1D8Y A;  4UB2 A;  1S0O A;  1NKC A;  2GLE A;  4NY8 A;  5DLF A;  3NTU A;  4LVS A;  4J03 A;  1U9L A;  2HBM A;  4RQN A;  5AI8 A;  2RP5 A;  4U7C A;  2O6K A;  5ALT A;  4C7Y A;  3AMZ A;  3ZI4 A;  3M1Y A;  2LYH A;  2R8G A;  1BPY A;  4G3I A;  4MEY A;  2LPE A;  1A76 A;  1K5O A;  4OJ6 A;  4YQW A;  2FE9 A;  1T94 A;  4IR9 A;  5KFK A;  3I76 A;  4F5O A;  2ZIX A;  3SZ2 A;  1ARO P;  3PW5 A;  1RYR A;  3JPN A;  4KLD A;  4NLC A;  1MC8 A;  4Z6C A;  5AI6 A;  3RAQ A;  4JWN A;  1DOQ A;  5G5H A;  4XRH A;  4ED6 A;  2BR0 A;  1NJW A;  2FMQ A;  1XSN A;  5TZV A;  8ICB A;  5KAI U;  1U48 A;  1WUD A;  5J2H A;  1B22 A;  4F4W A;  3DDH A;  3A0H U;  4Y2V A;  5D46 A;  5HMM A;  4UBC A;  1NK5 A;  5HR6 A;  8ICL A;  3GV5 B;  2F44 A;  5DB6 A;  1FFU A;  3MR2 A;  5KFO A;  4NM1 A;  3S6J A;  2E8P A;  2PXI A;  3UXN A;  1LV5 A;  2ESE A;  2FLL A;  1JN3 A;  3BJY A;  1ZQD A;  4DCC A;  4Q43 A;  2PFQ A;  3QYP A;  3V6K A;  7ICN A;  2EAP A;  5L1K A;  3SYZ A;  5EE1 A;  1L3T A;  5HML A;  2ASL A;  3CRX A;  4MFC A;  4ED8 A;  1UPH A;  4DOA A;  5AM4 A;  2UVV A;  4ECQ A;  1SV0 C;  4PGX A;  8ICW A;  4F71 A;  3M6K A;  5KFY A;  4ZOH C;  4DO9 A;  5J2C A;  1KTQ A;  1N61 A;  3T5H A;  3ETL A;  2BPF A;  3TAN A;  3PO4 A;  4UAZ A;  4RZR A;  5GTI U;  4R8U B;  4DF8 A;  1H38 A;  3KHL A;  4KLQ A;  3V7K A;  3AU2 A;  5AIA A;  5AKE A;  3RB0 A;  4AYB C;  3H0L B;  1CUK A;  3F5A A;  2BKE A;  5B66 U;  3RR8 A;  2W9A A;  2WHE A;  4OJO A;  5KAF U;  5KFW A;  4ICA A;  4C8L A;  5E79 U;  4P4P A;  1QTM A;  5KFP A;  3GZF A;  4Y2Q A;  4O3S A;  1QQ6 A;  3QU4 A;  2W55 A;  4Q44 A;  2EAN A;  2C22 A;  2NO4 A;  1UA0 A;  3N7S C;  3FDS A;  5L1J A;  2V4Q A;  2F8L A;  5B5E U;  4RNM A;  3H0R B;  3QXG A;  4KLH A;  4F2R A;  1JXE A;  2FMP A;  2WB1 C;  5DLG A;  8ICT A;  4B9S A;  1UT8 A;  1TE2 A;  1ZQZ A;  4PHP A;  2OXO A;  4UAU A;  5CWR A;  3UMC A;  1P7D A;  1CRX A;  7ICG A;  1Z3E B;  1HIW A;  2JZB A;  4C4T A;  1JXL A;  4QWE A;  1X9W A;  2ZJA A;  5KFX A;  1GO3 F;  5DQG A;  2AJQ A;  5AKL A;  1NI3 A;  1XNS A;  8ICN A;  4FZN A;  1ECW A;  2CRX A;  3TAD C;  1A77 A;  2HBL A;  1NKE A;  4I29 A;  2OYY A;  1SB3 C;  8ICO A;  3L3F X;  3L5K A;  2KMD A;  1QSL A;  1PVR A;  4EZ9 A;  1D8B A;  4KLJ A;  5CP2 A;  4KLG A;  4DFP A;  4KLT A;  3ORY A;  5FP0 A;  3BQ1 A;  2WFA A;  3UQ0 A;  4QZI A;  4KLS A;  7ICH A;  2G09 A;  2KIW A;  7ICO A;  2JH1 A;  5AKJ A;  1KLN A;  4DQR A;  3UXP A;  5KFG A;  4MHV A;  2KOB A;  4Z6F A;  3F2B A;  2ZTC A;  5HHI A;  3AN1 A;  1ZD5 A;  4TQR A;  3SAH A;  5KFZ A;  8ICG A;  5AM3 A;  4CNQ A;  4KIT B;  4KTQ A;  2WF8 A;  1IIP A;  5KT5 A;  3IG5 A;  1ZOL A;  5C0Y A;  4RUC A;  3K4G A;  2F1I A;  1SXE A;  2RQ5 A;  4UB1 A;  2KHQ A;  4CGZ A;  4YMO A;  1ZQG A;  3IN5 A;  5KT3 A;  4O9M A;  3NVZ A;  1ZQY A;  4DS4 A;  1KFD A;  4YP3 A;  4LZG A;  5F9N A;  5J0Y A;  1N5X A;  3OJU A;  3IP4 B;  1MA7 A;  4O3N A;  4QWA A;  3RH4 A;  3UM9 A;  4I28 A;  1OXJ A;  3HX0 A;  5J2G A;  4M9N A;  3SV4 A;  4ACO A;  2XGQ A;  2KVS A;  1SKS A;  1SL1 A;  3TAP A;  4M9L A;  1KQQ A;  2H3I A;  3Q8K A;  1KKX A;  2JGA A;  4TQS A;  9ICT A;  1SXD A;  3PO5 A;  1KW4 A;  1RQN A;  2BQU A;  5L1L A;  4DQI A;  4RQ6 A;  5C5J A;  1FIQ A;  2DPJ A;  4NLB A;  2ZXI A;  4M9J A;  4J9S A;  4J9N A;  1KBU A;  2VA3 A;  2W04 A;  4YR0 A;  1ZQH A;  2XCP A;  4I2D A;  3RH6 A;  3V7J A;  3EPG A;  1L5U A;  4F92 B;  1CI4 A;  2BDU A;  4O3M A;  1ZYQ A;  2XY6 A;  4DL4 A;  2C2E A;  2KFN A;  2BDP A;  5DB8 A;  2KJ5 A;  3QZ7 A;  4EEL A;  1X9M A;  7ICT A;  4Z6D A;  4YFK A;  2K4H A;  4NLG A;  3AEV A;  2VKQ A;  3WK6 A;  4QIW F;  5J8Y C;  5DGB A;  5IIL A;  1ZQX A;  1BPE A;  4I2J A;  5DG9 A;  4DQS A;  2RDI A;  4XA5 A;  5KG2 A;  2WTF A;  2AGP A;  1ZQI A;  3V6J A;  1SGG A;  3ICX A;  3RBE A;  1NOM A;  2ZIV A;  4KX3 A;  4UAR A;  2BCV A;  3ZDB A;  3RJJ A;  3GDX A;  4C0Z A;  2XY7 A;  4YXM A;  2BCS A;  4BUG A;  4Y2P A;  2F76 X;  4B9U A;  8ICZ A;  2BQR A;  3M6Z A;  1SIJ A;  4QW8 A;  3ISD A;  2H3F A;  2FPL A;  3LVV A;  2LMR A;  5DDM A;  1X6I A;  3QUB A;  5J2E A;  1ZQJ A;  4P0P A;  5KL8 B;  2LYA A;  4KMU A;  5ALL A;  1OUQ A;  9ICE A;  2R8H A;  4QWD A;  2KP7 A;  3GU3 A;  1HUZ A;  4F5Q A;  5DG7 A;  1FEZ A;  3RTV A;  5AI4 A;  4RUA A;  4GLX A;  3PZP A;  1U45 A;  5CJ7 A;  2YB1 A;  2DQN B;  2K8B B;  2I1Q A;  3C2M A;  4DFM A;  2IOF A;  5ALH A;  1KL9 A;  1BNO A;  3HW8 A;  3THV A;  1D8L A;  3WKE A;  4NXZ A;  4GFJ A;  4RU9 A;  1ZRN A;  2HSZ A;  2LHT A;  2N1R A;  3QU5 A;  2OEH A;  4J9P A;  2OCE A;  2KNJ A;  3ZDC A;  4C4S A;  4EEN A;  3ED5 A;  1V38 A;  2P35 A;  2LM1 A;  4JV1 A;  2JEJ A;  5ALE A;  1WWV A;  5AM5 A;  5J0U A;  2KJ8 A;  3D6J A;  1L3S A;  3QEB Z;  5KT2 A;  4M6W A;  3RBD A;  3HJE A;  7ICI A;  2W03 A;  4KN4 A;  4GXK A;  4PGY A;  4UBB A;  3OGU A;  5DDY A;  1LB2 B;  2KV2 A;  2E8M A;  2ZJ8 A;  1NZP A;  1JUD A;  5J29 A;  5JRT A;  2KIC A;  4CRX A;  1NK7 A;  4Y2T A;  5J2J A;  3MR5 A;  2HDO A;  1N63 A;  8ICQ A;  3GV8 B;  1RM6 C;  4O5K A;  2WB1 F;  5J2B A;  1NJY A;  2Y1I A;  4DL5 A;  2HHW A;  4LZD A;  1PUZ A;  2OH2 A;  2KD1 A;  1C20 A;  1XSL A;  4MF2 A;  4DFK A;  5IIM A;  5AKI A;  1O03 A;  1NK6 A;  5KFJ A;  2GOL A;  2ZUD A;  3SAG A;  2PMZ F;  2HBJ A;  4JMU A;  4RQM A;  4DLG A;  1UQV A;  8ICE A;  2KEY A;  1WWU A;  2ZIX B;  3HP6 A;  4MFA A;  2ASJ A;  3AM9 A;  4P2H A;  2QAR B;  2EQY A;  3E0F A;  4DL7 A;  1L3U A;  2JV3 A;  3C1Y A;  3C5G A;  4DFJ A;  5D4B A;  3OTQ A;  4O3P A;  2H3V A;  4ZH4 A;  1XSP A;  4RT2 A;  5J0X A;  3GV7 B;  1SV0 A;  8ICF A;  1ZQF A;  4EYH B;  2DPI A;  2J6S A;  3PNC A;  4K4G A;  2Q0Z X;  2HHS A;  2GO7 A;  2JMG A;  2NYV A;  3LYS A;  9ICB A;  2Y0S C;  1F0M A;  2R8K A;  2HHQ A;  5KFD A;  3ISC A;  4FZL A;  3PSF A;  3QNM A;  4I2G A;  4EZ6 A;  4NM2 A;  5ALV A;  4EEK A;  4C80 A;  5AKH A;  3OHB A;  3PVX A;  2KFZ A;  3KZX A;  1KRP A;  3F5E A;  2YN4 A;  1MQ3 A;  4PGQ A;  4OJP A;  5KT7 A;  1Z1V A;  5J0O A;  5ALF A;  3GIL A;  1T8E A;  2EZY A;  4QZB A;  3BZK A;  4YVZ A;  1ZQT A;  4B9N A;  3SQI A;  3V6H A;  5J0R A;  5KFF A;  3IG8 A;  1D9D A;  2I6X A;  2EZZ A;  1F44 A;  1BGX T;  5GTH U;  4YMM A;  1N5W A;  4QZC A;  3KFU F;  1WYG A;  2KKV A;  3CP8 A;  4RQ3 A;  9ICJ A;  4BWJ A;  2C2R A;  2AQ0 A;  2YQE A;  1V85 A;  5ALD A;  1X2I A;  2KSO A;  2W9M A;  4QZ8 A;  3HKZ F;  5KFA A;  2Y1J A;  3CYM A;  1XO0 A;  2IMW P;  2MAX A;  4Q45 A;  4ED0 A;  2P6U A;  2IOF K;  3D2N A;  4ECU A;  4M6W B;  2ATL A;  1QSY A;  1ZD3 A;  1LKY A;  3T3F A;  1PK3 A;  3PW7 A;  3MDA A;  3TKA A;  3GQC A;  1KFS A;  9ICI A;  5EE3 A;  2MU2 A;  4NL9 A;  2YTU A;  5DQI A;  3JPR A;  3V7L A;  3KTQ A;  1QQ7 A;  2KE7 A;  5KG0 A;  2H3Z A;  1X9X A;  2IHN A;  4PL1 A;  3GII A;  1UHU A;  8ICX A;  5AI0 A;  4PHE A;  5AKK A;  1QCK A;  5DG8 A;  2D3D A;  3C23 A;  3RB6 A;  4IR1 A;  8ICU A;  2RHF A;  2E3T A;  3BDP A;  4IRD A;  2KKP A;  2XO7 A;  3ETR A;  4TUR A;  3AU6 A;  2B6G A;  4NJ8 A;  2AGO A;  9ICK A;  3Q8S B;  1ZET A;  4AP9 A;  2G06 A;  9ICV A;  9ICM A;  2HI0 A;  5J2K A;  3PX4 A;  3MGI A;  3KBB A;  2ISO A;  3LWL A;  4E0D A;  4PL2 A;  1B43 A;  3MDC A;  2CN1 A;  2YMM A;  4M04 A;  4I2E A;  2PFO A;  3BS7 A;  3JPS A;  3NRW A;  1RPL A;  4I2I A;  3T5K A;  4F4X A;  2YMP A;  1N2X A;  3KKA C;  4M0A A;  3NVY A;  4UW9 A;  2K4E A;  1V9P A;  3ZD9 A;  5EWE A;  3HIL A;  4QZE A;  3NRZ A;  1S97 A;  1V97 A;  2DKZ A;  1XO1 A;  5J2A A;  3PW0 A;  3L4P A;  4B6J A;  4DFD A;  4YD1 A;  1S5L U;  4P0Q B;  2A1A A;  3DV9 A;  2KJ9 A;  2WAQ F;  4F2S A;  1BPX A;  3F2D A;  4USA A;  5BOM A;  4RNO A;  4KMO B;  1L8L A;  4MFF A;  3AQE A;  4RNN A;  4Y2S A;  2A1J A;  5KG5 A;  3KHR A;  1B4F A;  5KTQ A;  1ED1 A;  2CXY A;  9ICH A;  4FBT A; 
#chains in the Genus database with same CATH homology
 2ODG A;  2BZF A;  1QCK A;  1CI4 A;  2EZY A;  2EZX A;  2EZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...