1CI4A

The crystal structure of human barrier-to-autointegration factor (baf)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
b'MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF))
publication title Structural basis of DNA bridging by barrier-to-autointegration factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1ci4A00
2EZYA 2ODGA 2EZXA 1CI4A 1QCKA 2EZZA 2BZFA
chains in the Genus database with same CATH superfamily
4C8MA 2FLPA 5J2IA 3BQ1A 1SZHA 2HHVA 7ICJA 2PFQA 3B9JA 5B5EU 1ZD2P 1XSLA 3BQTA 2O6KA 4NY8A 4QWCA 4KLGA 1T94A 1DGJA 1D8YA 5AKYA 4F5RA 3PX4A 2XICA 3SAGA 5KFFA 4UB3A 4ED1A 3RJGA 4OCZA 5CWRA 4DO9A 2BDPA 3QXGA 1X42A 7ICTA 3SEIA 4F4XA 1BNOA 2ALZA 5ALYA 3TARA 4KX3A 5E79U 5ALFA 2HHXA 3OSPA 2ZJ8A 2KSOA 3O0FA 1XU4A 4OJPA 3KKAA 4YCXA 3K75D 3K4GA 4ECVA 2QLTA 5ALTA 2A3VA 4YMMA 5CHGA 2Y1IA 3ISCA 3PR4A 5TZVA 5ALRA 1AROP 1COOA 1RXVA 2F8KA 1X6JA 2E8OA 3BS7A 5ALGA 4CCHA 4ECWA 4C80A 4I2HA 4J9KA 5KAIU 4RU9A 5TISU 3ZD8A 4U7CA 1B22A 1KW4A 3PX6A 4QZBA 2BCQA 2I5HA 3N97B 4GXIA 2AU0A 8ICQA 3NASA 4UAWA 2B6GA 3M8SA 3PO4A 4FO6A 4G9BA 3MR6A 2XIDA 2M0NA 4QZIA 1V9PA 5KL1B 3M9NB 4ECXA 1UA1A 3GV8B 5KFCA 4JV0A 4ACOA 2W54A 4C0ZA 5AKXA 5DBAA 4I2IA 3T79A 3WKDA 2Z7JA 4F50A 5ALEA 3QX7A 2W7PA 4B9UA 2GO7A 1ZXIA 5HR6A 4KLEA 5KFUA 3V6JA 2Y1JA 5ALVA 4LJXA 4Q44A 7ICSA 7ICVA 3RJEA 4PGQA 4RQMA 2HSZA 2RHFA 2KG5A 3M9OB 4Y2VA 1ZQQA 1NJWA 4USAA 2FLNA 1F5SA 3GIIA 3ETLA 2AQ4A 4RQNA 2DF4B 2KSOB 4IR9A 4RQ4A 3NVYA 4Y2PA 4C4SA 3OSNA 4RPXA 4NLNA 1IV8A 9ICOA 5ALNA 1QCKA 4EEKA 4PH5A 3AM9A 4Y2RA 5KFPA 4EYHB 4YMNA 1ZD4A 2YTUA 9ICMA 5KG5A 5FP0A 3RFAA 3RB4A 1SZPA 3WU2U 2M9NA 3QZ7A 2E3TA 1BPDA 1KTQA 5AKJA 4EZ6A 4K4HA 1S0MA 3C23A 5EE0A 5JU5A 5DLGA 1Y88A 5DDMA 3PO5A 3I1YA 2W9AA 2F44A 4JK1A 2E1FA 4DS4A 4CGZA 5DBCA 1QQ6A 2FPKA 5AI4A 5J2AA 1S97A 5KT2A 4NL9C 4NWIA 2IMWP 4J9LA 5EE9A 1IG6A 3GZFA 3AMZA 7ICFA 4KN4A 2K8AA 4NLZA 2ZTCA 1ZQUA 2OH2A 3N7RC 4P0QA 3SI8A 3CRXA 1ZQZA 2H5XA 2JEIA 2BHNA 1HUZA 4LVSA 3C21A 2XGPA 4P4MA 3ZDAA 5AK4A 4J9PA 5KFMA 1ZQYA 1ZQSA 1ZQCA 1B43A 4LZDA 2HBKA 2H3QA 4IQUA 3H8SA 2WTFA 2W04A 4DFJA 1QQ5A 2CXYA 4F92B 4UARA 2YMPA 4MEYA 7ICOA 1ZQLA 2JXJA 1SV4A 4I2EA 1BNPA 1UCVA 3NGDA 1JXLA 2LI6A 2ZIUA 2A19A 4IS7A 1A6SA 4LZGA 3AQFA 3KHLA 2LKYA 3QU5A 3MFHA 4F2SA 1RPLA 5KFTA 4G3IA 3SZ2A 2P6UA 1JI7A 3PSPA 4PL1A 2BCSA 5AKLA 3HPOA 1L3TA 4Y2JA 4NLKA 1DOQA 5IILA 4DWIA 1T3NA 4RPZA 1LV5A 2WF9A 5AICA 4KLOA 1Q3VA 1V38A 3WK4A 4PHDA 5AM5A 5DG9A 4DS5A 3OJSA 5L1KA 3G6VA 1L7MA 4UB8U 3TFRA 1PVQA 2BDUA 5KT3A 4NJ8A 2BQRA 3H0MB 4IRDA 5DBBA 3RB6A 1L8LA 3NS1A 3RH6A 5KL8B 4B9MA 2BCUA 1SGGA 2GOLA 4O5KA 1JN3A 4DSFA 2MU2A 9ICBA 2P35A 9ICHA 5IIIA 2ESEA 4CDGA 9ICIA 3A0BU 4A8EA 2YMQA 3TADA 2HMXA 4P0QB 5AK3A 3LWMA 1U47A 8ICZA 2H3VA 4QNLA 4QWDA 2W8LA 4DFPA 3EPIA 1X9XA 4ED7A 5KFJA 5DDYA 1Q46A 2ZXHA 4F4KA 4F71A 5EWGA 5ALSA 2PI5A 4DL5A 1IXRA 5EE1A 2KIWA 2GLEA 3TKAA 1X40A 4J03A 4PJ0U 2PFPA 4UB4A 8ICHA 3NVWA 2ZIUB 5DQGA 5JUMA 3OGUA 4AP9A 1Q3UA 2OM6A 4IQWA 5HMMA 4M9LA 4QW9A 2KOBA 1A77A 5IIMA 2JEFA 1WUDA 4ZOHC 5KFIA 5DB8A 2ZTEA 2W9BA 5IIOA 1SV0A 2VA8A 2UVUA 4ECUA 2EAPA 2BPCA 1L5UA 2C2DA 5KT7A 3B0YA 3EW9A 3VC8A 9ICSA 5AI8A 8ICBA 4C8KA 2ZUDA 4UB5A 4DL4A 4R66A 3M8RA 1N61A 1L7PA 1ZD5A 1N60A 2R18A 1QH9A 4I2BA 2WFAA 2VIXA 4B9VA 5T14A 1N56A 3G6YA 2DL0A 4UB6U 4Q45A 3RJJA 1BGXT 3V6HA 3MC1A 5J2CA 4QZFA 2KJ8A 7ICGA 4Z6FA 1Z4OA 4QZGA 4RZRA 3RBEA 1X9MA 1T7PA 4DF8A 2V4RA 1TVAA 4M9NA 1ZQGA 1L7NA 2W8KA 1ZQDA 3ZDCA 4ECTA 5EWEA 2LMRA 4I2FA 5J0SA 5AKIA 2W3RA 4DLGA 4O3SA 2BGWA 7ICUA 1CRXA 5D46A 1XO0A 5CB1A 1SXEA 4R65A 3QUCA 2W43A 4KTQA 1U45A 1O08A 2KKPA 4X5VA 4US8A 4O9MA 5KFSA 2FPLA 4DSEA 4O3MA 1XWLA 4RNMA 3ED5A 2RP5A 1DXSA 2LYAA 4F91B 1AQ6A 4C8NA 4I2GA 4Q8EA 3K1ZA 1HUOA 1NNLA 2R8GA 7ICEA 2W9BB 1NK0A 1N2XA 2P6RA 4IRKA 3F5AA 4RNNA 1Z19A 3QEAZ 5DG7A 3BJYA 1X66A 3AN1A 3V7JA 4I2AA 4EZ9A 1TK0A 3OHBA 1ZQKA 9ICXA 4QZEA 4EYIB 1MQ3A 2NRTA 4BXOA 2ZIWB 1S10A 2LM1A 5HHHA 2H3FA 2BQ3A 1NI3A 1XSNA 2EANA 5AM2A 1JX4A 4MEXA 4F2RA 4JUZA 2WF5A 2KD1A 3PW2A 7ICNA 9ICWA 3RJKA 3Q8PB 3TFSA 1NK8A 4OJ5A 4DQIA 5ALKA 3C5GA 5KG7A 3EUB2 4Q8FA 5J8YC 1X9SA 5HMLA 3MR2A 1OUQA 5KFEA 3Q8SB 5J0QA 5KFDA 3L5KA 2G08A 5AM1A 3M1YA 1BPBA 2HW3A 4IR1A 1HEKA 4CF5A 2HDOA 1KQQA 1S5LU 2ASJA 3T3FA 4MF8A 1ZETA 3A0HU 4KLUA 2HBJA 2K4IA 1KN5A 4EBCA 3KTQA 7ICRA 8ICAA 4IRCA 3MR5A 4FBUA 4ED0A 4C7ZA 4KLLA 3C29A 3U26A 4E0DA 3PW5A 4ECZA 4PHEA 1L3UA 5AIBA 5CA7A 1Z4NA 1H38A 4J9MA 3PV8A 2HBMA 5KFAA 3LVWA 1CEZA 2WAQC 2KJ5A 4F5OA 4DOAA 1XS9D 4YN4A 1ZQTA 2MA1A 4ED2A 3SD7A 1L6NA 5ALOA 2C2RA 3KZIU 5L1IA 1JALA 1ZRNA 4ED3A 4AYBC 4UBBA 3HP6A 5ALPA 3MFIA 3M6KA 3LYSA 1S8OA 3C1YA 3IM1A 4B6JA 2OXOA 2E1EA 2HVHA 2BCVA 2KE7A 1WWVA 4BXOB 4RT2A 5DGBA 4UASA 3C2KA 2KFNA 2FE9A 2KZ3A 2EAOA 2H3IA 2RDJA 1L3VA 4MF2A 2G5IB 3NVVA 4YD1A 1NJXA 8ICFA 2IOFK 2W11A 1TK8A 4KITB 5J2FA 5KG0A 3TAPA 4O5CA 1NJYA 2JMGA 2W03A 1UT5A 1NK7A 2WF8A 2FMSA 1XO1A 3V7LA 2HOIA 3IDWA 5H2FU 5CP2A 5J0OA 1TAUA 9ICTA 1JRPA 4B9LA 3QNMA 4RQ5A 2I6XA 4C4RA 2JEGA 4GXKA 3Q8RB 1B4FA 1T4GA 1NK9A 4CNQA 3QU9A 1SL0A 2J6SA 2ZJ5A 5AI6A 4F5NA 3RB0A 3WKAA 3LK9A 3C28A 2K8CB 5J0TA 1ZQWA 3D2SA 2W9MA 5IINA 2W7OA 4WJ3B 8ICEA 3RH4A 4QZAA 9ICJA 8ICOA 5AKKA 4BWJA 1NJZA 5KG3A 2KVSA 3MABA 1SWWA 4RQ3A 3C1ZA 4M9HA 8ICYA 1Z3EB 3H8JA 3RJHA 2VJ4A 2A1JA 2WF6A 4B9NA 2L5YA 5EWFA 2KKVA 1ZQNA 5J2BA 5KT6A 4P4OA 1BPEA 4CF4A 2W9CA 2ZIXA 2XC9A 1ZQAA 9ICFA 1S0NA 2K4HA 2WHEA 1X2IA 1N62A 2KHVA 7ICIA 1QSYA 1KSPA 2MSNA 1XC9A 4Q43A 1K1SA 3H8MA 3GV7B 2HOFA 4JB3A 1ZOLA 1K1QA 5F3XB 5F9LA 4F72A 3PR5B 4DOCA 1N48A 4M9GA 4I29A 3GIMA 2FDRA 4ED6A 3TQ1A 4M9JA 4U6PA 5D49A 4HAIA 3ZI4A 9ICUA 2KTQA 3J81j 2ODGA 2DPIA 5ALUA 2LM4A 4TUPA 3H0RB 4GC7A 4OO1J 2MUTA 3T5JA 4FZLA 1BPZA 2H3ZA 1RYSA 4JV1A 4EBEA 5J2HA 3RH5A 3H8WA 4O3PA 3RAQA 1O03A 3UMGA 1WCNA 4F4ZA 1U4BA 5ALMA 3RR8A 4ECSA 4KLFA 3MDCA 8ICMA 5DB7A 4DFKA 3E0FA 2NV3A 1MSWD 1PK1A 3GU3A 3ORYA 3T5HA 3B0XA 4TURA 3OHAA 2ZTDA 2QB0A 4RQ0A 5ALXA 2AHOB 4OJLA 2V4QA 4YP3A 2F1JA 5J0RA 4NM2A 1N5WA 4J9OA 1XSPA 5AI9A 3RR7A 4Y2QA 2KZMA 1V97A 1ZD3A 2RLTA 4GIBA 3HKZC 3UXOA 5BOMA 2KICA 2F8LA 2W9CB 2KP7A 1DRGA 1S77D 4C4TA 2ZIXB 1J97A 1BPYA 2DKXA 4J9RA 1UPHA 1X6IA 4US9A 4YR2A 5KG2A 1OW5A 7ICMA 3F2DA 3TAQA 2ASLA 3M6ZA 1COKA 4DSLA 2PMZC 2EQYA 1YZ7A 3KHRA 1WCLA 2QARA 3FDSA 4DL2A 3QUTA 1JUDA 5C0YA 3RTVA 5KFGA 3H7IA 2YN4A 3Q8QB 4UAZA 3AU6A 3BZKA 3E58A 2KK0A 2MUTB 4DFDA 2XI9A 1GO3F 3F2CA 2V9WA 2PI4A 3Q8MA 3PY8A 3ETRA 2E8MA 3T5LA 4F93B 5KFWA 3HWTA 2OEHA 3IG8A 1MA7A 1F0MA 4YQWA 5ALIA 2IOFA 5B66U 3HILA 2JZBA 3DV9A 5DQHA 5J0WA 2Y9TA 2KNJA 4M04A 4F8RA 4OD0A 3MDAA 1PK1B 1UHUA 4RQ8A 3E2EA 2FI1A 2QB0B 2N1RA 4PZNA 5KFRA 3TADC 4YXJA 3D2NA 8ICGA 3KHGA 1N63A 1ZJMA 2R8JA 4DLEA 2ASDA 3IP4B 5ALDA 2K89A 3LVVA 2ZIVA 1NZPA 3SV3A 2UVWA 2LHTA 5AKGA 3CP8A 4PHAA 4EEYA 4M2YA 9ICKA 4NLGA 2DPJA 2F76X 5J0XA 2Q4TA 2F3NA 1D9DA 2MRLA 5J2DA 1HIWA 4QW8A 4BWMA 4YR3A 2ZG6A 1ZJNA 3H40A 4QJFB 4NXZA 2KN7A 1ZQRA 5J0YA 3IN5A 2NYVA 4OJOA 5BPCA 2NRXA 5KFKA 2YB4A 3DDHA 1RQNA 5HHIA 2G09A 4O5EA 3SQIA 3M7DA 4Y2TA 4ELTA 2QARB 8ICRA 3KZXA 2XY7A 1MN8A 3HW8A 1ZQPA 9ICQA 4XQ8A 3H4BA 1UQVA 1BVSA 1SV0C 4QZCA 5AI0A 2WAQF 2EAMA 4O3RA 3LDAA 2UVVA 4C8OA 2HCFA 4EX7A 2OCEA 7ICKA 1VLBA 2ZUCA 3DEEA 3GIJA 1RG6A 4AYBF 5J29A 4RUCA 2E5SA 3WKCA 1IIPA 4MFAA 4QWBA 2Y0SC 4BJQA 2KEYA 5CRXA 1ZQJA 4UATA 4R8UA 4KLHA 2JZBB 2D8CA 2AXTU 2E8PA 3F53A 2E8NA 8ICXA 1VJ5A 1IM4A 1SKWA 1TV9A 2DBYA 1KFSA 1WYGA 4YD2A 4QIWC 4FZNA 2FJ6A 2KMDA 3L3FX 4O3QA 2HI0A 5KT4A 4PGXA 5AIAA 2BPFA 3SYZA 2C2EA 4BDPA 1A76A 2ZIVB 4JMUA 4QZ9A 3N4MB 2F1HA 2LYBA 5ALJA 2CRXA 3MBYA 3CYMA 4B9SA 1WWUA 3SENA 3WKBA 1TFRA 3UMCA 1QSSA 4Y2UA 4DOBA 3T5KA 2HHTA 2PFNA 4DSIA 2B0CA 5KG1A 1TK5A 5HP4A 1TKDA 1L3SA 3R9KA 2XCPA 5AM4A 3MGIA 5AM0A 3PSIA 5BOLA 1J2MA 3N7PD 3UXNA 4JWNA 2KV2A 3JPRA 2FLLA 4M47A 3WK8A 4ECYA 1P7DA 4YR0A 2R8IA 4DSKA 1TE2A 1NKBA 1ZQXA 8ICJA 3QUBA 4DQPA 2F77X 5G5HA 2IOHA 4YXMA 3VCBA 9ICGA 3AQEA 2VJ5A 4EBDA 2ZJAA 4PL2A 5ALZA 1RXWA 5IIKA 1ZQHA 3C2MA 2R8KA 4XUSA 5F9NA 1RM6C 4DEZA 1KL9A 1ZQFA 3GV5B 3RBDA 4KLJA 4R8UB 4DL7A 5KFNA 3PMLA 5J2JA 4YG2A 1YZ6A 1PUZA 1BPXA 3OJUA 2YQEA 4PHPA 1NK6A 2JH7A 4YFKA 3M9MB 2G07A 2AJQA 1NZBA 3HJEA 3TI0A 3ONNA 4GC6A 2CPRA 1FFUA 4HYKA 1FIQA 1NKCA 3UMBA 9ICVA 1DGSA 3KFUF 4QZ8A 4Y2XA 2J6UA 2HOQA 3EPGA 2WB1C 4K4GA 4ELUA 5DB6A 2DFLA 2Y9UA 1LKYA 4ZH4A 2NRZA 4F4WA 1CI4A 4RPYA 4DL3A 5J2GA 2J6TA 3ZD9A 5J0UA 1TAQA 1L7OA 2IHNA 1SL1A 1DK3A 4BUGA 4PGYA 1U48A 2YMMA 4ECRA 4GFJA 4XA5A 3TACB 4Z6EA 2AH5A 5K4LA 2BQUA 2XO7A 2ZXIA 5JTIA 3NTUA 3KKAC 1CUKA 2OHFA 2ZUBA 5KFVA 8ICTA 4PPXA 4EX6A 5L1LA 4ECQA 3FYHA 1QSLA 4TQSA 2DUYA 1ZQ1C 4M0AA 4J9QA 2LYHA 4RQ2A 3IRUA 3HKZF 3BZCA 5CEHA 3V6KA 3QEBZ 4JWMA 5C5JA 4KLDA 4DQRA 1NKEA 2HVIA 3OTQA 3RF9A 4Y2SA 1ZYQA 1SL2A 4CRXA 3WK9A 2BR0A 1QQ7A 1ZQVA 4XRHA 3ICXA 4C8LA 1YT3A 4KLMA 4DCCA 1Z1BA 2AQ0A 3PW0A 3PW4A 1KFDA 4FE3A 3K1RB 4FS2A 4O3OA 2UVRA 4R64A 1PZNA 2PMZF 3SMVA 3RRGA 2BPGA 3GDXA 1FO4A 5AHXA 3AUOA 3OPXA 2Q0ZX 3AU2A 1TAMA 3HX0A 4RQ7A 3IG5A 3S6JA 2D6FC 4O3NA 4QZHA 3V72A 4DL6A 1C7YA 5JRTA 5KTQA 2EZZA 2ES6A 1Z1VA 1SKRA 4KLSA 4KX5A 1LKYB 5J0PA 1SWVA 1JROA 5KFHA 5KFYA 4RQ1A 3IHQB 1MQ2A 5EE3A 9ICCA 5GTIU 2NO4A 1EXNA 4QWEA 3PW7A 4IL6U 2HHUA 3PX0A 3UM9A 3Q8LA 1KEJA 4UAVA 4JV2A 2LBOA 1KFTA 2XVTA 1C20A 1KKXA 3NRWA 4GXJA 3H0LB 3SAHA 4I2JA 1T8EA 1QTMA 5CR0A 2BKEA 2XCAA 5DQIA 3HT3A 4MFCA 2D3DA 4B9TA 2NRVA 4NL9A 5CJ7A 4YMOA 5KFQA 4FZMA 3RRHA 9ICNA 4BX9C 2GWSA 3NVZA 3N28A 2R8HA 4DSJA 5KFBA 3KD3A 4QZDA 3EWAA 3GQCA 4MFFA 2DKZA 2G5HB 7ICLA 3BQ7A 2VA3A 4KLQA 3C5FA 2P66A 1FEZA 3V7KA 8ICKA 3UQ0A 4CF3A 3G6XA 1F44A 4EENA 8ICWA 2CN1A 2ATLA 8ICLA 5A0LA 5ALLA 3JPOA 3QU4A 4FBTA 5AM3A 9ICRA 3WK6A 5KAFU 4DQQA 5IIJA 3I76A 5KFLA 4J9NA 4NM1A 3PVXA 1ECWA 2RDIA 8ICPA 2EH9A 3FC4A 5AKZA 1S76D 1V85A 2FMQA 4BGDA 4UBCA 2K60A 4DF4A 5DGAA 2Y0SF 2A1JB 2HHQA 2IHMA 1Z00A 3MGHA 4ED8A 4EELA 1VDVA 4QWAA 7ICPA 2DGZA 4UB1A 4RNOA 5ALHA 1DK2A 4TUSA 3D6JA 1J2NA 5L1JA 1ZQMA 2NRWA 2OYYA 3PSTA 2F2AB 1KDHA 4QIWF 4NLBA 3UPQA 1RQLA 2HHWA 1SB3C 3IV6A 3WKEA 3MGVA 3BQ0A 2JR5A 3SAFA 1ZQOA 1JXEA 3UQ2A 8ICVA 4TQRA 1D8LA 1FFVA 4GLXA 5J2KA 3JPQA 2F1IA 2C28A 4NV0A 2ISOA 5AKEA 4Z6DA 2W3SA 3EZ5A 4I28A 1MC8A 3RB3A 2KZZA 5KG4A 1U9LA 3SR6A 1NK4A 2KFZA 3BS5A 4F5PA 3THVA 5GTHU 5DG8A 2W55A 1T3QA 3TANA 2AGQA 5KFOA 8ICIA 2JRZA 1ED1A 1QLNA 5KT5A 1KBUA 3QUQA 1JMSA 2RQ5A 2QKQA 3RAXA 4F3OA 4Z6CA 1M6YA 2KJ9A 1Q8KA 3QZ8A 2HBLA 1XNSA 3PSFA 2DQNB 3JPSA 2JH1A 3N7SC 3JPTA 1JIHA 3Q8KA 1PK3A 1L8OA 4I27A 5HR7A 3UXPA 3BDPA 1X9WA 3AEVA 3KHHA 3QU7A 2KVCA 3WK7A 3NRZA 5L1MA 1ZQEA 2HHSA 1Z00B 2KIVA 4M6WA 2K4PA 4IQTA 5KFZA 1SIJA 9ICPA 2EZYA 5D4BA 2JGAA 2EDUA 1U49A 3NUQA 1S9FA 3L4PA 3QYPA 4P0PA 1RYUA 2YX8A 5ALWA 4ELVA 4KLTA 5L9XA 5AKHA 1KRPA 3FM9A 1OXJA 3GIKA 8ICCA 2VANA 2WF7A 3MR3A 3D2QA 4I2DA 4MHVA 4O0IA 2KHQA 3CNHA 1UT8A 2NO5A 3GILA 3PMNA 4FS1A 1HJPA 9ICAA 2K8BB 3C2LA 7ICQA 2WB1F 2BZFA 4YVZA 1RDFA 3F2BA 3GFKB 2IA6A 3ZDEA 4RUAA 3BS5B 3AL0B 1K5OA 2C22A 1A0PA 4UW9A 3KOOA 8ICSA 5G5GA 3ZDDA 2ZIWA 5AK5A 2G06A 3WK5A 3JPPA 4UAYA 3PNCA 4J9SA 4OJ6A 3FAHA 4Y2YA 3QE9Y 1RYRA 4UAUA 4UB2A 2JEJA 5DB9A 3ISBA 2G0AA 3I28A 4NLCA 2ISPA 4CE6A 3ISDA 1UA0A 4C7YA 2EZXA 1S0VA 3RJIA 4TUQA 1PVRA 5AI5A 2GH1A 2LPEA 4UQGA 5KFXA 2VKQA 5EOZA 4F5QA 2I1QA 4K4IA 2IBKA 3SV4A 2XY6A 2FPMA 4KMUA 3LWLA 2XGQA 4IQVA 9ICLA 8ICUA 4P4PA 5DLFA 5ALQA 5J2EA 1D8BA 4KMOB 4RQ6A 2DWQA 4M6WB 9ICEA 2YY6A 4KN7A 2OWOA 4I2CA 3KBBA 2YB1A 3BQ2A 4ICAA 4P0PB 3EYZA 2K4EA 2AGPA 4KLIA 2BCRA 7ICHA 5KNIA 2RRDA 3F5EA 2JV3A 1N5XA 1SKSA 4FFDA 2AGOA 2PXIA 1ZRMA 3HRDD 2VA2A 2MAXA 2FMPA 8ICNA 1LVHA 4P2HA 4DQSA 3QU2A 4IC9A 1SXDA 2B21A 5HNKA 1B0XA 1NK5A 4DFMA 1ZQBA 2JHDA 3PZPA 1S0OA 4R63A 1D9FA 1NOMA 2PKEA 1WG8A 2XY5A 1PVPA 2PFOA 2I9GA 5J8YA 1LB2B 3ALRA 3H4DA 4RT3A 3RJFA 2A1AA 3CW2C 3ZDBA 4PZOA 5AK6A 5DKWA 2QB1A 2YMLA 4F4YA 1KLNA 1RZTA 1URJA 5KG6A 3JPNA 1ZQIA
chains in the Genus database with same CATH topology
2EZYA 2ODGA 2EZXA 1CI4A 1QCKA 2EZZA 2BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZY A;  2ODG A;  2EZX A;  1CI4 A;  1QCK A;  2EZZ A;  2BZF A; 
#chains in the Genus database with same CATH topology
 4C8M A;  2FLP A;  5J2I A;  3BQ1 A;  1SZH A;  2HHV A;  7ICJ A;  2PFQ A;  3B9J A;  5B5E U;  1ZD2 P;  1XSL A;  3BQT A;  2O6K A;  4NY8 A;  4QWC A;  4KLG A;  1T94 A;  1DGJ A;  1D8Y A;  5AKY A;  4F5R A;  3PX4 A;  2XIC A;  3SAG A;  5KFF A;  4UB3 A;  4ED1 A;  3RJG A;  4OCZ A;  5CWR A;  4DO9 A;  2BDP A;  3QXG A;  1X42 A;  7ICT A;  3SEI A;  4F4X A;  1BNO A;  2ALZ A;  5ALY A;  3TAR A;  4KX3 A;  5E79 U;  5ALF A;  2HHX A;  3OSP A;  2ZJ8 A;  2KSO A;  3O0F A;  1XU4 A;  4OJP A;  3KKA A;  4YCX A;  3K75 D;  3K4G A;  4ECV A;  2QLT A;  5ALT A;  2A3V A;  4YMM A;  5CHG A;  2Y1I A;  3ISC A;  3PR4 A;  5TZV A;  5ALR A;  1ARO P;  1COO A;  1RXV A;  2F8K A;  1X6J A;  2E8O A;  3BS7 A;  5ALG A;  4CCH A;  4ECW A;  4C80 A;  4I2H A;  4J9K A;  5KAI U;  4RU9 A;  5TIS U;  3ZD8 A;  4U7C A;  1B22 A;  1KW4 A;  3PX6 A;  4QZB A;  2BCQ A;  2I5H A;  3N97 B;  4GXI A;  2AU0 A;  8ICQ A;  3NAS A;  4UAW A;  2B6G A;  3M8S A;  3PO4 A;  4FO6 A;  4G9B A;  3MR6 A;  2XID A;  2M0N A;  4QZI A;  1V9P A;  5KL1 B;  3M9N B;  4ECX A;  1UA1 A;  3GV8 B;  5KFC A;  4JV0 A;  4ACO A;  2W54 A;  4C0Z A;  5AKX A;  5DBA A;  4I2I A;  3T79 A;  3WKD A;  2Z7J A;  4F50 A;  5ALE A;  3QX7 A;  2W7P A;  4B9U A;  2GO7 A;  1ZXI A;  5HR6 A;  4KLE A;  5KFU A;  3V6J A;  2Y1J A;  5ALV A;  4LJX A;  4Q44 A;  7ICS A;  7ICV A;  3RJE A;  4PGQ A;  4RQM A;  2HSZ A;  2RHF A;  2KG5 A;  3M9O B;  4Y2V A;  1ZQQ A;  1NJW A;  4USA A;  2FLN A;  1F5S A;  3GII A;  3ETL A;  2AQ4 A;  4RQN A;  2DF4 B;  2KSO B;  4IR9 A;  4RQ4 A;  3NVY A;  4Y2P A;  4C4S A;  3OSN A;  4RPX A;  4NLN A;  1IV8 A;  9ICO A;  5ALN A;  1QCK A;  4EEK A;  4PH5 A;  3AM9 A;  4Y2R A;  5KFP A;  4EYH B;  4YMN A;  1ZD4 A;  2YTU A;  9ICM A;  5KG5 A;  5FP0 A;  3RFA A;  3RB4 A;  1SZP A;  3WU2 U;  2M9N A;  3QZ7 A;  2E3T A;  1BPD A;  1KTQ A;  5AKJ A;  4EZ6 A;  4K4H A;  1S0M A;  3C23 A;  5EE0 A;  5JU5 A;  5DLG A;  1Y88 A;  5DDM A;  3PO5 A;  3I1Y A;  2W9A A;  2F44 A;  4JK1 A;  2E1F A;  4DS4 A;  4CGZ A;  5DBC A;  1QQ6 A;  2FPK A;  5AI4 A;  5J2A A;  1S97 A;  5KT2 A;  4NL9 C;  4NWI A;  2IMW P;  4J9L A;  5EE9 A;  1IG6 A;  3GZF A;  3AMZ A;  7ICF A;  4KN4 A;  2K8A A;  4NLZ A;  2ZTC A;  1ZQU A;  2OH2 A;  3N7R C;  4P0Q A;  3SI8 A;  3CRX A;  1ZQZ A;  2H5X A;  2JEI A;  2BHN A;  1HUZ A;  4LVS A;  3C21 A;  2XGP A;  4P4M A;  3ZDA A;  5AK4 A;  4J9P A;  5KFM A;  1ZQY A;  1ZQS A;  1ZQC A;  1B43 A;  4LZD A;  2HBK A;  2H3Q A;  4IQU A;  3H8S A;  2WTF A;  2W04 A;  4DFJ A;  1QQ5 A;  2CXY A;  4F92 B;  4UAR A;  2YMP A;  4MEY A;  7ICO A;  1ZQL A;  2JXJ A;  1SV4 A;  4I2E A;  1BNP A;  1UCV A;  3NGD A;  1JXL A;  2LI6 A;  2ZIU A;  2A19 A;  4IS7 A;  1A6S A;  4LZG A;  3AQF A;  3KHL A;  2LKY A;  3QU5 A;  3MFH A;  4F2S A;  1RPL A;  5KFT A;  4G3I A;  3SZ2 A;  2P6U A;  1JI7 A;  3PSP A;  4PL1 A;  2BCS A;  5AKL A;  3HPO A;  1L3T A;  4Y2J A;  4NLK A;  1DOQ A;  5IIL A;  4DWI A;  1T3N A;  4RPZ A;  1LV5 A;  2WF9 A;  5AIC A;  4KLO A;  1Q3V A;  1V38 A;  3WK4 A;  4PHD A;  5AM5 A;  5DG9 A;  4DS5 A;  3OJS A;  5L1K A;  3G6V A;  1L7M A;  4UB8 U;  3TFR A;  1PVQ A;  2BDU A;  5KT3 A;  4NJ8 A;  2BQR A;  3H0M B;  4IRD A;  5DBB A;  3RB6 A;  1L8L A;  3NS1 A;  3RH6 A;  5KL8 B;  4B9M A;  2BCU A;  1SGG A;  2GOL A;  4O5K A;  1JN3 A;  4DSF A;  2MU2 A;  9ICB A;  2P35 A;  9ICH A;  5III A;  2ESE A;  4CDG A;  9ICI A;  3A0B U;  4A8E A;  2YMQ A;  3TAD A;  2HMX A;  4P0Q B;  5AK3 A;  3LWM A;  1U47 A;  8ICZ A;  2H3V A;  4QNL A;  4QWD A;  2W8L A;  4DFP A;  3EPI A;  1X9X A;  4ED7 A;  5KFJ A;  5DDY A;  1Q46 A;  2ZXH A;  4F4K A;  4F71 A;  5EWG A;  5ALS A;  2PI5 A;  4DL5 A;  1IXR A;  5EE1 A;  2KIW A;  2GLE A;  3TKA A;  1X40 A;  4J03 A;  4PJ0 U;  2PFP A;  4UB4 A;  8ICH A;  3NVW A;  2ZIU B;  5DQG A;  5JUM A;  3OGU A;  4AP9 A;  1Q3U A;  2OM6 A;  4IQW A;  5HMM A;  4M9L A;  4QW9 A;  2KOB A;  1A77 A;  5IIM A;  2JEF A;  1WUD A;  4ZOH C;  5KFI A;  5DB8 A;  2ZTE A;  2W9B A;  5IIO A;  1SV0 A;  2VA8 A;  2UVU A;  4ECU A;  2EAP A;  2BPC A;  1L5U A;  2C2D A;  5KT7 A;  3B0Y A;  3EW9 A;  3VC8 A;  9ICS A;  5AI8 A;  8ICB A;  4C8K A;  2ZUD A;  4UB5 A;  4DL4 A;  4R66 A;  3M8R A;  1N61 A;  1L7P A;  1ZD5 A;  1N60 A;  2R18 A;  1QH9 A;  4I2B A;  2WFA A;  2VIX A;  4B9V A;  5T14 A;  1N56 A;  3G6Y A;  2DL0 A;  4UB6 U;  4Q45 A;  3RJJ A;  1BGX T;  3V6H A;  3MC1 A;  5J2C A;  4QZF A;  2KJ8 A;  7ICG A;  4Z6F A;  1Z4O A;  4QZG A;  4RZR A;  3RBE A;  1X9M A;  1T7P A;  4DF8 A;  2V4R A;  1TVA A;  4M9N A;  1ZQG A;  1L7N A;  2W8K A;  1ZQD A;  3ZDC A;  4ECT A;  5EWE A;  2LMR A;  4I2F A;  5J0S A;  5AKI A;  2W3R A;  4DLG A;  4O3S A;  2BGW A;  7ICU A;  1CRX A;  5D46 A;  1XO0 A;  5CB1 A;  1SXE A;  4R65 A;  3QUC A;  2W43 A;  4KTQ A;  1U45 A;  1O08 A;  2KKP A;  4X5V A;  4US8 A;  4O9M A;  5KFS A;  2FPL A;  4DSE A;  4O3M A;  1XWL A;  4RNM A;  3ED5 A;  2RP5 A;  1DXS A;  2LYA A;  4F91 B;  1AQ6 A;  4C8N A;  4I2G A;  4Q8E A;  3K1Z A;  1HUO A;  1NNL A;  2R8G A;  7ICE A;  2W9B B;  1NK0 A;  1N2X A;  2P6R A;  4IRK A;  3F5A A;  4RNN A;  1Z19 A;  3QEA Z;  5DG7 A;  3BJY A;  1X66 A;  3AN1 A;  3V7J A;  4I2A A;  4EZ9 A;  1TK0 A;  3OHB A;  1ZQK A;  9ICX A;  4QZE A;  4EYI B;  1MQ3 A;  2NRT A;  4BXO A;  2ZIW B;  1S10 A;  2LM1 A;  5HHH A;  2H3F A;  2BQ3 A;  1NI3 A;  1XSN A;  2EAN A;  5AM2 A;  1JX4 A;  4MEX A;  4F2R A;  4JUZ A;  2WF5 A;  2KD1 A;  3PW2 A;  7ICN A;  9ICW A;  3RJK A;  3Q8P B;  3TFS A;  1NK8 A;  4OJ5 A;  4DQI A;  5ALK A;  3C5G A;  5KG7 A;  3EUB 2;  4Q8F A;  5J8Y C;  1X9S A;  5HML A;  3MR2 A;  1OUQ A;  5KFE A;  3Q8S B;  5J0Q A;  5KFD A;  3L5K A;  2G08 A;  5AM1 A;  3M1Y A;  1BPB A;  2HW3 A;  4IR1 A;  1HEK A;  4CF5 A;  2HDO A;  1KQQ A;  1S5L U;  2ASJ A;  3T3F A;  4MF8 A;  1ZET A;  3A0H U;  4KLU A;  2HBJ A;  2K4I A;  1KN5 A;  4EBC A;  3KTQ A;  7ICR A;  8ICA A;  4IRC A;  3MR5 A;  4FBU A;  4ED0 A;  4C7Z A;  4KLL A;  3C29 A;  3U26 A;  4E0D A;  3PW5 A;  4ECZ A;  4PHE A;  1L3U A;  5AIB A;  5CA7 A;  1Z4N A;  1H38 A;  4J9M A;  3PV8 A;  2HBM A;  5KFA A;  3LVW A;  1CEZ A;  2WAQ C;  2KJ5 A;  4F5O A;  4DOA A;  1XS9 D;  4YN4 A;  1ZQT A;  2MA1 A;  4ED2 A;  3SD7 A;  1L6N A;  5ALO A;  2C2R A;  3KZI U;  5L1I A;  1JAL A;  1ZRN A;  4ED3 A;  4AYB C;  4UBB A;  3HP6 A;  5ALP A;  3MFI A;  3M6K A;  3LYS A;  1S8O A;  3C1Y A;  3IM1 A;  4B6J A;  2OXO A;  2E1E A;  2HVH A;  2BCV A;  2KE7 A;  1WWV A;  4BXO B;  4RT2 A;  5DGB A;  4UAS A;  3C2K A;  2KFN A;  2FE9 A;  2KZ3 A;  2EAO A;  2H3I A;  2RDJ A;  1L3V A;  4MF2 A;  2G5I B;  3NVV A;  4YD1 A;  1NJX A;  8ICF A;  2IOF K;  2W11 A;  1TK8 A;  4KIT B;  5J2F A;  5KG0 A;  3TAP A;  4O5C A;  1NJY A;  2JMG A;  2W03 A;  1UT5 A;  1NK7 A;  2WF8 A;  2FMS A;  1XO1 A;  3V7L A;  2HOI A;  3IDW A;  5H2F U;  5CP2 A;  5J0O A;  1TAU A;  9ICT A;  1JRP A;  4B9L A;  3QNM A;  4RQ5 A;  2I6X A;  4C4R A;  2JEG A;  4GXK A;  3Q8R B;  1B4F A;  1T4G A;  1NK9 A;  4CNQ A;  3QU9 A;  1SL0 A;  2J6S A;  2ZJ5 A;  5AI6 A;  4F5N A;  3RB0 A;  3WKA A;  3LK9 A;  3C28 A;  2K8C B;  5J0T A;  1ZQW A;  3D2S A;  2W9M A;  5IIN A;  2W7O A;  4WJ3 B;  8ICE A;  3RH4 A;  4QZA A;  9ICJ A;  8ICO A;  5AKK A;  4BWJ A;  1NJZ A;  5KG3 A;  2KVS A;  3MAB A;  1SWW A;  4RQ3 A;  3C1Z A;  4M9H A;  8ICY A;  1Z3E B;  3H8J A;  3RJH A;  2VJ4 A;  2A1J A;  2WF6 A;  4B9N A;  2L5Y A;  5EWF A;  2KKV A;  1ZQN A;  5J2B A;  5KT6 A;  4P4O A;  1BPE A;  4CF4 A;  2W9C A;  2ZIX A;  2XC9 A;  1ZQA A;  9ICF A;  1S0N A;  2K4H A;  2WHE A;  1X2I A;  1N62 A;  2KHV A;  7ICI A;  1QSY A;  1KSP A;  2MSN A;  1XC9 A;  4Q43 A;  1K1S A;  3H8M A;  3GV7 B;  2HOF A;  4JB3 A;  1ZOL A;  1K1Q A;  5F3X B;  5F9L A;  4F72 A;  3PR5 B;  4DOC A;  1N48 A;  4M9G A;  4I29 A;  3GIM A;  2FDR A;  4ED6 A;  3TQ1 A;  4M9J A;  4U6P A;  5D49 A;  4HAI A;  3ZI4 A;  9ICU A;  2KTQ A;  3J81 j;  2ODG A;  2DPI A;  5ALU A;  2LM4 A;  4TUP A;  3H0R B;  4GC7 A;  4OO1 J;  2MUT A;  3T5J A;  4FZL A;  1BPZ A;  2H3Z A;  1RYS A;  4JV1 A;  4EBE A;  5J2H A;  3RH5 A;  3H8W A;  4O3P A;  3RAQ A;  1O03 A;  3UMG A;  1WCN A;  4F4Z A;  1U4B A;  5ALM A;  3RR8 A;  4ECS A;  4KLF A;  3MDC A;  8ICM A;  5DB7 A;  4DFK A;  3E0F A;  2NV3 A;  1MSW D;  1PK1 A;  3GU3 A;  3ORY A;  3T5H A;  3B0X A;  4TUR A;  3OHA A;  2ZTD A;  2QB0 A;  4RQ0 A;  5ALX A;  2AHO B;  4OJL A;  2V4Q A;  4YP3 A;  2F1J A;  5J0R A;  4NM2 A;  1N5W A;  4J9O A;  1XSP A;  5AI9 A;  3RR7 A;  4Y2Q A;  2KZM A;  1V97 A;  1ZD3 A;  2RLT A;  4GIB A;  3HKZ C;  3UXO A;  5BOM A;  2KIC A;  2F8L A;  2W9C B;  2KP7 A;  1DRG A;  1S77 D;  4C4T A;  2ZIX B;  1J97 A;  1BPY A;  2DKX A;  4J9R A;  1UPH A;  1X6I A;  4US9 A;  4YR2 A;  5KG2 A;  1OW5 A;  7ICM A;  3F2D A;  3TAQ A;  2ASL A;  3M6Z A;  1COK A;  4DSL A;  2PMZ C;  2EQY A;  1YZ7 A;  3KHR A;  1WCL A;  2QAR A;  3FDS A;  4DL2 A;  3QUT A;  1JUD A;  5C0Y A;  3RTV A;  5KFG A;  3H7I A;  2YN4 A;  3Q8Q B;  4UAZ A;  3AU6 A;  3BZK A;  3E58 A;  2KK0 A;  2MUT B;  4DFD A;  2XI9 A;  1GO3 F;  3F2C A;  2V9W A;  2PI4 A;  3Q8M A;  3PY8 A;  3ETR A;  2E8M A;  3T5L A;  4F93 B;  5KFW A;  3HWT A;  2OEH A;  3IG8 A;  1MA7 A;  1F0M A;  4YQW A;  5ALI A;  2IOF A;  5B66 U;  3HIL A;  2JZB A;  3DV9 A;  5DQH A;  5J0W A;  2Y9T A;  2KNJ A;  4M04 A;  4F8R A;  4OD0 A;  3MDA A;  1PK1 B;  1UHU A;  4RQ8 A;  3E2E A;  2FI1 A;  2QB0 B;  2N1R A;  4PZN A;  5KFR A;  3TAD C;  4YXJ A;  3D2N A;  8ICG A;  3KHG A;  1N63 A;  1ZJM A;  2R8J A;  4DLE A;  2ASD A;  3IP4 B;  5ALD A;  2K89 A;  3LVV A;  2ZIV A;  1NZP A;  3SV3 A;  2UVW A;  2LHT A;  5AKG A;  3CP8 A;  4PHA A;  4EEY A;  4M2Y A;  9ICK A;  4NLG A;  2DPJ A;  2F76 X;  5J0X A;  2Q4T A;  2F3N A;  1D9D A;  2MRL A;  5J2D A;  1HIW A;  4QW8 A;  4BWM A;  4YR3 A;  2ZG6 A;  1ZJN A;  3H40 A;  4QJF B;  4NXZ A;  2KN7 A;  1ZQR A;  5J0Y A;  3IN5 A;  2NYV A;  4OJO A;  5BPC A;  2NRX A;  5KFK A;  2YB4 A;  3DDH A;  1RQN A;  5HHI A;  2G09 A;  4O5E A;  3SQI A;  3M7D A;  4Y2T A;  4ELT A;  2QAR B;  8ICR A;  3KZX A;  2XY7 A;  1MN8 A;  3HW8 A;  1ZQP A;  9ICQ A;  4XQ8 A;  3H4B A;  1UQV A;  1BVS A;  1SV0 C;  4QZC A;  5AI0 A;  2WAQ F;  2EAM A;  4O3R A;  3LDA A;  2UVV A;  4C8O A;  2HCF A;  4EX7 A;  2OCE A;  7ICK A;  1VLB A;  2ZUC A;  3DEE A;  3GIJ A;  1RG6 A;  4AYB F;  5J29 A;  4RUC A;  2E5S A;  3WKC A;  1IIP A;  4MFA A;  4QWB A;  2Y0S C;  4BJQ A;  2KEY A;  5CRX A;  1ZQJ A;  4UAT A;  4R8U A;  4KLH A;  2JZB B;  2D8C A;  2AXT U;  2E8P A;  3F53 A;  2E8N A;  8ICX A;  1VJ5 A;  1IM4 A;  1SKW A;  1TV9 A;  2DBY A;  1KFS A;  1WYG A;  4YD2 A;  4QIW C;  4FZN A;  2FJ6 A;  2KMD A;  3L3F X;  4O3Q A;  2HI0 A;  5KT4 A;  4PGX A;  5AIA A;  2BPF A;  3SYZ A;  2C2E A;  4BDP A;  1A76 A;  2ZIV B;  4JMU A;  4QZ9 A;  3N4M B;  2F1H A;  2LYB A;  5ALJ A;  2CRX A;  3MBY A;  3CYM A;  4B9S A;  1WWU A;  3SEN A;  3WKB A;  1TFR A;  3UMC A;  1QSS A;  4Y2U A;  4DOB A;  3T5K A;  2HHT A;  2PFN A;  4DSI A;  2B0C A;  5KG1 A;  1TK5 A;  5HP4 A;  1TKD A;  1L3S A;  3R9K A;  2XCP A;  5AM4 A;  3MGI A;  5AM0 A;  3PSI A;  5BOL A;  1J2M A;  3N7P D;  3UXN A;  4JWN A;  2KV2 A;  3JPR A;  2FLL A;  4M47 A;  3WK8 A;  4ECY A;  1P7D A;  4YR0 A;  2R8I A;  4DSK A;  1TE2 A;  1NKB A;  1ZQX A;  8ICJ A;  3QUB A;  4DQP A;  2F77 X;  5G5H A;  2IOH A;  4YXM A;  3VCB A;  9ICG A;  3AQE A;  2VJ5 A;  4EBD A;  2ZJA A;  4PL2 A;  5ALZ A;  1RXW A;  5IIK A;  1ZQH A;  3C2M A;  2R8K A;  4XUS A;  5F9N A;  1RM6 C;  4DEZ A;  1KL9 A;  1ZQF A;  3GV5 B;  3RBD A;  4KLJ A;  4R8U B;  4DL7 A;  5KFN A;  3PML A;  5J2J A;  4YG2 A;  1YZ6 A;  1PUZ A;  1BPX A;  3OJU A;  2YQE A;  4PHP A;  1NK6 A;  2JH7 A;  4YFK A;  3M9M B;  2G07 A;  2AJQ A;  1NZB A;  3HJE A;  3TI0 A;  3ONN A;  4GC6 A;  2CPR A;  1FFU A;  4HYK A;  1FIQ A;  1NKC A;  3UMB A;  9ICV A;  1DGS A;  3KFU F;  4QZ8 A;  4Y2X A;  2J6U A;  2HOQ A;  3EPG A;  2WB1 C;  4K4G A;  4ELU A;  5DB6 A;  2DFL A;  2Y9U A;  1LKY A;  4ZH4 A;  2NRZ A;  4F4W A;  1CI4 A;  4RPY A;  4DL3 A;  5J2G A;  2J6T A;  3ZD9 A;  5J0U A;  1TAQ A;  1L7O A;  2IHN A;  1SL1 A;  1DK3 A;  4BUG A;  4PGY A;  1U48 A;  2YMM A;  4ECR A;  4GFJ A;  4XA5 A;  3TAC B;  4Z6E A;  2AH5 A;  5K4L A;  2BQU A;  2XO7 A;  2ZXI A;  5JTI A;  3NTU A;  3KKA C;  1CUK A;  2OHF A;  2ZUB A;  5KFV A;  8ICT A;  4PPX A;  4EX6 A;  5L1L A;  4ECQ A;  3FYH A;  1QSL A;  4TQS A;  2DUY A;  1ZQ1 C;  4M0A A;  4J9Q A;  2LYH A;  4RQ2 A;  3IRU A;  3HKZ F;  3BZC A;  5CEH A;  3V6K A;  3QEB Z;  4JWM A;  5C5J A;  4KLD A;  4DQR A;  1NKE A;  2HVI A;  3OTQ A;  3RF9 A;  4Y2S A;  1ZYQ A;  1SL2 A;  4CRX A;  3WK9 A;  2BR0 A;  1QQ7 A;  1ZQV A;  4XRH A;  3ICX A;  4C8L A;  1YT3 A;  4KLM A;  4DCC A;  1Z1B A;  2AQ0 A;  3PW0 A;  3PW4 A;  1KFD A;  4FE3 A;  3K1R B;  4FS2 A;  4O3O A;  2UVR A;  4R64 A;  1PZN A;  2PMZ F;  3SMV A;  3RRG A;  2BPG A;  3GDX A;  1FO4 A;  5AHX A;  3AUO A;  3OPX A;  2Q0Z X;  3AU2 A;  1TAM A;  3HX0 A;  4RQ7 A;  3IG5 A;  3S6J A;  2D6F C;  4O3N A;  4QZH A;  3V72 A;  4DL6 A;  1C7Y A;  5JRT A;  5KTQ A;  2EZZ A;  2ES6 A;  1Z1V A;  1SKR A;  4KLS A;  4KX5 A;  1LKY B;  5J0P A;  1SWV A;  1JRO A;  5KFH A;  5KFY A;  4RQ1 A;  3IHQ B;  1MQ2 A;  5EE3 A;  9ICC A;  5GTI U;  2NO4 A;  1EXN A;  4QWE A;  3PW7 A;  4IL6 U;  2HHU A;  3PX0 A;  3UM9 A;  3Q8L A;  1KEJ A;  4UAV A;  4JV2 A;  2LBO A;  1KFT A;  2XVT A;  1C20 A;  1KKX A;  3NRW A;  4GXJ A;  3H0L B;  3SAH A;  4I2J A;  1T8E A;  1QTM A;  5CR0 A;  2BKE A;  2XCA A;  5DQI A;  3HT3 A;  4MFC A;  2D3D A;  4B9T A;  2NRV A;  4NL9 A;  5CJ7 A;  4YMO A;  5KFQ A;  4FZM A;  3RRH A;  9ICN A;  4BX9 C;  2GWS A;  3NVZ A;  3N28 A;  2R8H A;  4DSJ A;  5KFB A;  3KD3 A;  4QZD A;  3EWA A;  3GQC A;  4MFF A;  2DKZ A;  2G5H B;  7ICL A;  3BQ7 A;  2VA3 A;  4KLQ A;  3C5F A;  2P66 A;  1FEZ A;  3V7K A;  8ICK A;  3UQ0 A;  4CF3 A;  3G6X A;  1F44 A;  4EEN A;  8ICW A;  2CN1 A;  2ATL A;  8ICL A;  5A0L A;  5ALL A;  3JPO A;  3QU4 A;  4FBT A;  5AM3 A;  9ICR A;  3WK6 A;  5KAF U;  4DQQ A;  5IIJ A;  3I76 A;  5KFL A;  4J9N A;  4NM1 A;  3PVX A;  1ECW A;  2RDI A;  8ICP A;  2EH9 A;  3FC4 A;  5AKZ A;  1S76 D;  1V85 A;  2FMQ A;  4BGD A;  4UBC A;  2K60 A;  4DF4 A;  5DGA A;  2Y0S F;  2A1J B;  2HHQ A;  2IHM A;  1Z00 A;  3MGH A;  4ED8 A;  4EEL A;  1VDV A;  4QWA A;  7ICP A;  2DGZ A;  4UB1 A;  4RNO A;  5ALH A;  1DK2 A;  4TUS A;  3D6J A;  1J2N A;  5L1J A;  1ZQM A;  2NRW A;  2OYY A;  3PST A;  2F2A B;  1KDH A;  4QIW F;  4NLB A;  3UPQ A;  1RQL A;  2HHW A;  1SB3 C;  3IV6 A;  3WKE A;  3MGV A;  3BQ0 A;  2JR5 A;  3SAF A;  1ZQO A;  1JXE A;  3UQ2 A;  8ICV A;  4TQR A;  1D8L A;  1FFV A;  4GLX A;  5J2K A;  3JPQ A;  2F1I A;  2C28 A;  4NV0 A;  2ISO A;  5AKE A;  4Z6D A;  2W3S A;  3EZ5 A;  4I28 A;  1MC8 A;  3RB3 A;  2KZZ A;  5KG4 A;  1U9L A;  3SR6 A;  1NK4 A;  2KFZ A;  3BS5 A;  4F5P A;  3THV A;  5GTH U;  5DG8 A;  2W55 A;  1T3Q A;  3TAN A;  2AGQ A;  5KFO A;  8ICI A;  2JRZ A;  1ED1 A;  1QLN A;  5KT5 A;  1KBU A;  3QUQ A;  1JMS A;  2RQ5 A;  2QKQ A;  3RAX A;  4F3O A;  4Z6C A;  1M6Y A;  2KJ9 A;  1Q8K A;  3QZ8 A;  2HBL A;  1XNS A;  3PSF A;  2DQN B;  3JPS A;  2JH1 A;  3N7S C;  3JPT A;  1JIH A;  3Q8K A;  1PK3 A;  1L8O A;  4I27 A;  5HR7 A;  3UXP A;  3BDP A;  1X9W A;  3AEV A;  3KHH A;  3QU7 A;  2KVC A;  3WK7 A;  3NRZ A;  5L1M A;  1ZQE A;  2HHS A;  1Z00 B;  2KIV A;  4M6W A;  2K4P A;  4IQT A;  5KFZ A;  1SIJ A;  9ICP A;  2EZY A;  5D4B A;  2JGA A;  2EDU A;  1U49 A;  3NUQ A;  1S9F A;  3L4P A;  3QYP A;  4P0P A;  1RYU A;  2YX8 A;  5ALW A;  4ELV A;  4KLT A;  5L9X A;  5AKH A;  1KRP A;  3FM9 A;  1OXJ A;  3GIK A;  8ICC A;  2VAN A;  2WF7 A;  3MR3 A;  3D2Q A;  4I2D A;  4MHV A;  4O0I A;  2KHQ A;  3CNH A;  1UT8 A;  2NO5 A;  3GIL A;  3PMN A;  4FS1 A;  1HJP A;  9ICA A;  2K8B B;  3C2L A;  7ICQ A;  2WB1 F;  2BZF A;  4YVZ A;  1RDF A;  3F2B A;  3GFK B;  2IA6 A;  3ZDE A;  4RUA A;  3BS5 B;  3AL0 B;  1K5O A;  2C22 A;  1A0P A;  4UW9 A;  3KOO A;  8ICS A;  5G5G A;  3ZDD A;  2ZIW A;  5AK5 A;  2G06 A;  3WK5 A;  3JPP A;  4UAY A;  3PNC A;  4J9S A;  4OJ6 A;  3FAH A;  4Y2Y A;  3QE9 Y;  1RYR A;  4UAU A;  4UB2 A;  2JEJ A;  5DB9 A;  3ISB A;  2G0A A;  3I28 A;  4NLC A;  2ISP A;  4CE6 A;  3ISD A;  1UA0 A;  4C7Y A;  2EZX A;  1S0V A;  3RJI A;  4TUQ A;  1PVR A;  5AI5 A;  2GH1 A;  2LPE A;  4UQG A;  5KFX A;  2VKQ A;  5EOZ A;  4F5Q A;  2I1Q A;  4K4I A;  2IBK A;  3SV4 A;  2XY6 A;  2FPM A;  4KMU A;  3LWL A;  2XGQ A;  4IQV A;  9ICL A;  8ICU A;  4P4P A;  5DLF A;  5ALQ A;  5J2E A;  1D8B A;  4KMO B;  4RQ6 A;  2DWQ A;  4M6W B;  9ICE A;  2YY6 A;  4KN7 A;  2OWO A;  4I2C A;  3KBB A;  2YB1 A;  3BQ2 A;  4ICA A;  4P0P B;  3EYZ A;  2K4E A;  2AGP A;  4KLI A;  2BCR A;  7ICH A;  5KNI A;  2RRD A;  3F5E A;  2JV3 A;  1N5X A;  1SKS A;  4FFD A;  2AGO A;  2PXI A;  1ZRM A;  3HRD D;  2VA2 A;  2MAX A;  2FMP A;  8ICN A;  1LVH A;  4P2H A;  4DQS A;  3QU2 A;  4IC9 A;  1SXD A;  2B21 A;  5HNK A;  1B0X A;  1NK5 A;  4DFM A;  1ZQB A;  2JHD A;  3PZP A;  1S0O A;  4R63 A;  1D9F A;  1NOM A;  2PKE A;  1WG8 A;  2XY5 A;  1PVP A;  2PFO A;  2I9G A;  5J8Y A;  1LB2 B;  3ALR A;  3H4D A;  4RT3 A;  3RJF A;  2A1A A;  3CW2 C;  3ZDB A;  4PZO A;  5AK6 A;  5DKW A;  2QB1 A;  2YML A;  4F4Y A;  1KLN A;  1RZT A;  1URJ A;  5KG6 A;  3JPN A;  1ZQI A; 
#chains in the Genus database with same CATH homology
 2EZY A;  2ODG A;  2EZX A;  1CI4 A;  1QCK A;  2EZZ A;  2BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...