1CI4A

The crystal structure of human barrier-to-autointegration factor (baf)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF))
publication title Structural basis of DNA bridging by barrier-to-autointegration factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1ci4A00
2EZYA 1QCKA 2EZXA 2EZZA 1CI4A 2ODGA 2BZFA
chains in the Genus database with same CATH superfamily
4PGQA 3QU2A 1S0OA 2W9BB 5EWEA 4DCCA 8ICUA 1L7MA 3C21A 4GXIA 5BPCA 5AIBA 5KL1B 1JX4A 2DBYA 1XNSA 1UT5A 2MUTB 4B9NA 2LM4A 3WK8A 4DL6A 8ICFA 2HOQA 3UQ2A 4HAIA 3WKDA 4FZNA 1ZOLA 4F50A 1KQQA 9ICUA 4OJPA 2AGOA 4PHEA 3DV9A 1ZJNA 4QWAA 5IIJA 7ICSA 4QIWC 4ZH4A 2H3VA 3NRWA 3RJGA 2PMZC 4GXKA 4F72A 1Z1VA 4BUGA 3BJYA 1ZQIA 2M9NA 4YD1A 1X9WA 4RQMA 2ZIUB 2WAQF 5HR7A 3PSFA 1PVPA 7ICNA 3I76A 3QZ7A 3HX0A 5AKYA 3SMVA 1Y88A 1ZQOA 1NZBA 3N7RC 3M1YA 4BWJA 4F71A 2YN4A 9ICFA 2LBOA 1NK0A 4EELA 2C22A 3L5KA 2NRWA 5KFDA 1SWWA 3UXOA 4RT2A 1D9FA 4GXJA 5KFHA 3NTUA 1ZQQA 4PHDA 1B22A 8ICYA 1JN3A 2DUYA 2BKEA 2D8CA 4KLUA 1ZQLA 2J6UA 4UAYA 4CCHA 2BR0A 2Y0SC 4G9BA 3WKEA 4PPXA 3T5JA 2ATLA 4C4TA 3ZD8A 4KMOB 1ZQFA 2F1HA 1JALA 1QQ6A 4NM1A 5KFKA 1S77D 2JH1A 2QB0A 2K8CB 2K8AA 3H7IA 2KOBA 1LB2B 2JEGA 1M6YA 5E79U 7ICHA 1KFTA 3C29A 1F0MA 4Q8EA 1ZQHA 1HEKA 3RJHA 1JI7A 3GV5B 3KOOA 3K1RB 3RRGA 3OJUA 4O3SA 4RPYA 2HVIA 4UAWA 1WWVA 1ECWA 3FC4A 1OXJA 2KN7A 5J2HA 5ALJA 1FO4A 2HBKA 1SZHA 3WKAA 4Q8FA 2BCUA 3C2MA 2UVRA 3GILA 2P66A 4QZCA 4MFCA 2FLPA 3CYMA 8ICXA 2A1JA 3QEAZ 2ZIXA 5ALOA 5B5EU 3NS1A 2FLNA 2MAXA 1D8BA 3NVYA 3TFSA 2HBMA 3QUTA 1T8EA 4LJXA 2RP5A 3J81j 2D3DA 1L6NA 1YZ6A 1NKBA 7ICTA 4O3MA 1C7YA 9ICVA 5JU5A 5KNIA 4BWMA 1ZQNA 3LVWA 4PHAA 4I28A 5DG9A 5KG2A 4YXMA 3Q8MA 1NZPA 1AQ6A 2E5SA 9ICQA 5KG5A 1S9FA 2KMDA 2DKZA 4F8RA 4YMMA 2GH1A 2PFOA 3V7KA 3ETLA 2VANA 2HHVA 4I29A 4ZOHC 4AP9A 3JPRA 1L7NA 1Z4NA 2HOIA 2JXJA 1NK7A 5TZVA 4J9SA 3TADA 5ALEA 1TKDA 2EZXA 1F5SA 5J2EA 2WTFA 1KEJA 4KLIA 2BQUA 5KG1A 3T79A 4O3NA 5ALTA 2IBKA 2Y1IA 3Q8QB 3RH4A 2BCSA 2ASDA 2EANA 2ESEA 3LWMA 5KFUA 2KZMA 2W03A 3QNMA 2K4IA 4M47A 2M0NA 2BGWA 3PW5A 5KFWA 4KLDA 3D2QA 3AQFA 4DL7A 4Y2TA 1SWVA 4UASA 4QZ9A 4F5RA 3N4MB 4EX7A 3Q8LA 3D2SA 5DQGA 3HP6A 3C5FA 4Y2RA 2Q4TA 1ZQSA 2AJQA 3ISDA 4G3IA 3OGUA 3IN5A 3GIMA 4JV1A 3JPTA 4KLJA 5KFCA 5DB6A 4R65A 3VC8A 3C23A 4NY8A 4IRKA 9ICNA 3ETRA 1ZQRA 1RPLA 2FI1A 1KL9A 1Q3UA 4MEXA 1N63A 5AK6A 2Y0SF 8ICMA 1XO0A 5J2FA 3IRUA 2WF8A 1KKXA 5EE9A 8ICIA 2EH9A 5J0OA 1A6SA 4PJ0U 4UB6U 2OCEA 2HHXA 4USAA 2W9CB 3M9MB 3OSPA 5EE0A 3QX7A 2HHQA 3MR6A 3UXNA 1ZQBA 2CRXA 2KD1A 4CF4A 4ECTA 3RJKA 3BS5B 4YFKA 3F2DA 1B4FA 4GFJA 7ICPA 2QB1A 3TI0A 3NVZA 4E0DA 3ICXA 1SIJA 5ALFA 4YVZA 1TAUA 1K1QA 3OHBA 1SV0A 1GO3F 2ASJA 2ISPA 4M0AA 3MFIA 1ZQWA 4ED8A 1YT3A 4Z6EA 1N60A 3OSNA 1O03A 2H3FA 2B21A 2BDUA 1XSLA 3H40A 2H5XA 4YQWA 4QZAA 3SAFA 3SEIA 3M6ZA 3RH6A 4TQRA 8ICKA 3KHLA 3C1YA 5D4BA 2KFZA 4OJ5A 5KFGA 3EYZA 2KV2A 4R66A 2WF7A 1O08A 3IG5A 5KFPA 4OJLA 2HOFA 3DEEA 1CI4A 2WAQC 3VCBA 4JV0A 2RRDA 4Y2UA 1L7OA 2E1EA 5ALXA 5JUMA 4MFFA 4ED0A 2WF9A 8ICJA 1K5OA 4ECXA 3PW4A 4GLXA 1LV5A 4NJ8A 1S0MA 4DLGA 4K4HA 1WYGA 1MC8A 5KFBA 3K4GA 4BXOB 4YN4A 4DOAA 5L1JA 2W11A 4MF2A 5G5GA 4TUSA 5KL8B 1NOMA 1LVHA 2BQ3A 1XC9A 5EE3A 3PSTA 3RB6A 1DGJA 3TKAA 2JHDA 4DEZA 2G08A 3SQIA 3C2LA 2KFNA 1PK3A 4F4ZA 1FEZA 2LKYA 4ED2A 5KFZA 3V6JA 2JEIA 2W54A 4XRHA 2KSOA 4ED7A 4O0IA 8ICPA 4UARA 4P0QB 8ICEA 3D2NA 3SAGA 4YMNA 3AL0B 3UMBA 1X9SA 1ZQTA 5ALRA 5IIOA 4QW8A 2JR5A 3M8RA 2AU0A 4PHPA 2HHSA 5KFXA 4M9GA 5KFJA 1B43A 3MBYA 2HSZA 3GV8B 2DQNB 2BHNA 2MRLA 5F9NA 9ICIA 5ALPA 4B9TA 2HCFA 2JEFA 4DO9A 3ALRA 3BZKA 4ECQA 3V7LA 4JMUA 4RQ7A 4GIBA 1NKEA 4O3QA 3N7PD 3BQ1A 3PX0A 3N97B 1ZQCA 4Y2XA 4PL1A 5AM4A 2K89A 3JPOA 5KFTA 4F4KA 4EZ9A 3UM9A 3CW2C 3RAXA 2K4HA 3UMGA 5CB1A 2MA1A 3V6KA 4JWNA 3LWLA 5HP4A 4ECWA 1QSYA 2ZTEA 2FMSA 1MQ3A 3FYHA 3JPQA 4QZHA 2C2EA 3AMZA 2FPKA 4NLGA 7ICVA 2VA3A 1KFDA 3RR7A 4DL4A 3TACB 3WU2U 8ICBA 5KG4A 1ZQKA 4DSLA 4O3PA 4EX6A 4OCZA 2VJ5A 3PSIA 5J0RA 2EZZA 4KN4A 1XSPA 1N56A 1FFUA 3S6JA 5AHXA 4F91B 3HT3A 2IMWP 1KSPA 2WF6A 4CE6A 3BQTA 4O5CA 7ICFA 5DB8A 4FBUA 3H4BA 4QWEA 1SL0A 1PK1A 1FFVA 4RZRA 3KBBA 1NKCA 4YD2A 4UBCA 3TQ1A 2VIXA 4EEYA 1PUZA 4BJQA 2QARB 3KZIU 2DGZA 3A0BU 4J9LA 4F4XA 4B9VA 3GIIA 3EW9A 3PR4A 1ZQJA 4DFDA 1Q3VA 5KG0A 4RQ8A 4I2HA 4RQ1A 3OTQA 3PO5A 4IRDA 4Y2JA 2XO7A 4X5VA 2ZTDA 4DFMA 2W8LA 4NLZA 5J2JA 3PSPA 5J0YA 4Q43A 4K4GA 3GIKA 8ICRA 1X9XA 3ZI4A 2V4RA 2HHWA 2OWOA 3KHGA 2W04A 3GU3A 4IL6U 4YMOA 1WUDA 5KFRA 3C1ZA 3ZD9A 3H0RB 4UW9A 1RXWA 1D8YA 3PR5B 4ICAA 2E3TA 3UMCA 2AQ0A 3I28A 4NL9C 2HBLA 2FLLA 2AGQA 1NK4A 3KTQA 2KJ8A 2ZIWB 2XICA 2K60A 3LK9A 3EPIA 1J2NA 2E8OA 4M04A 2R8JA 5B66U 2JEJA 1Z1BA 1U4BA 3H8SA 3ZDAA 2DPIA 4KLLA 4DL5A 4NWIA 5KFNA 2F1JA 3PZPA 3TAQA 3IHQB 4TUPA 4P0PA 2E8MA 3SYZA 1NJYA 4JV2A 5J0SA 5TISU 2AHOB 2IOFK 3RBEA 4O5EA 4NV0A 1RG6A 5J0XA 9ICMA 5AKZA 4IS7A 1KN5A 4YR2A 1RYRA 2B0CA 1C20A 3M6KA 2A19A 3NGDA 2ZIVB 5J2IA 1Z4OA 1PVQA 1Z00A 2BCQA 2F77X 4DL2A 3WKBA 5HMMA 4XUSA 1ZQDA 2PFPA 2HHUA 4F93B 1A0PA 2OYYA 4JWMA 1ZQVA 1LKYA 1UQVA 3RAQA 2JH7A 5H2FU 3BS7A 4I2CA 5AKGA 4LZDA 2GO7A 8ICOA 4J9KA 3PX4A 4IQWA 2AH5A 1L3UA 1XU4A 1OW5A 4F4WA 1T7PA 1ZQUA 2G5HB 5C0YA 3WK9A 2E8PA 2BPGA 3PW7A 1BVSA 4DFPA 7ICRA 4B6JA 3U26A 3BQ0A 1S8OA 4P4MA 3RRHA 1U48A 4XA5A 5ALVA 4F5QA 4M6WB 3PW2A 2B6GA 1J2MA 5L1LA 1N2XA 8ICHA 3SENA 4R8UB 1MSWD 3PMLA 1PZNA 2O6KA 3HJEA 3H0LB 3PVXA 4I2FA 2EZYA 5HHHA 3JPSA 3KD3A 5J2BA 5KG6A 4IQUA 5DQIA 2G5IB 4QWDA 4JK1A 3ZDDA 1D8LA 4IR1A 4CGZA 4YR3A 3MGVA 5L1KA 5CA7A 2FPMA 3RJEA 4UB4A 4Z6DA 1ZRMA 3FDSA 2JZBB 7ICLA 4DF8A 3H8JA 2K4PA 2K8BB 4IR9A 4RPXA 1QSLA 8ICZA 2LHTA 9ICGA 3ZDCA 3NRZA 4F2SA 1DXSA 5ALSA 5DLFA 8ICNA 4UB8U 2I9GA 5AM1A 1UA0A 5KFEA 5HNKA 4YR0A 9ICRA 4NLCA 4ED1A 1L3VA 1NK9A 5J0TA 5DB7A 4Z6FA 4NLBA 4RQ0A 3T5HA 2BCVA 2YQEA 3ISCA 3OPXA 2W55A 1IG6A 3C5GA 2VA8A 3PY8A 3ONNA 3B0XA 2ZJAA 3AM9A 4U6PA 4I27A 1AROP 1HIWA 1ZQGA 4EENA 3BQ2A 5D46A 3HKZF 2W9BA 4ECYA 4C8KA 4ECZA 1JUDA 4YP3A 4KN7A 2JRZA 3B0YA 5AKHA 5L1IA 3KKAC 3TARA 4QZ8A 4F5OA 1MN8A 4UAUA 2MUTA 1DGSA 1JROA 4CF3A 1SL1A 1S97A 2Y9TA 2V9WA 4C8LA 1RQNA 2OHFA 4J9NA 5AI5A 3RTVA 4TURA 2BPCA 1VLBA 3GDXA 2XI9A 1ZD4A 2YY6A 5KFLA 4J9OA 2YTUA 2F44A 4M9NA 3AEVA 2DWQA 1ZD2P 3UQ0A 1X2IA 3AN1A 4O3OA 3FM9A 2ZIUA 5J0QA 2R8IA 4MF8A 2NV3A 3G6VA 1UCVA 3V72A 3H8MA 2ZJ5A 3SV4A 5AM3A 3V7JA 1ED1A 2KHQA 3R9KA 4QWBA 1IXRA 1X6IA 4KLSA 2YMLA 1ZETA 1RDFA 1SB3C 4RNNA 4FO6A 2XGPA 5DGAA 9ICSA 5K4LA 1JRPA 9ICWA 1HUZA 5ALKA 1RYUA 5J2AA 5ALGA 4B9UA 4OD0A 2ZG6A 1ZQZA 1UHUA 4FFDA 5DBBA 1BPZA 5AKLA 3Q8PB 4I2GA 3IV6A 2ZJ8A 3T3FA 4C4RA 3RR8A 1FIQA 5ALUA 4UATA 3AQEA 3F53A 5DDYA 4DS5A 2LYBA 5BOMA 2BDPA 5AKXA 1Z19A 4IRCA 4DFJA 5HR6A 2W9AA 2MU2A 1RZTA 4P4OA 3KHHA 4F5NA 5JRTA 1XSNA 4ECSA 2VKQA 3FAHA 2BZFA 2DKXA 3L4PA 2G09A 2W7PA 1KFSA 4LZGA 4Q45A 3A0HU 2JMGA 4AYBF 4XQ8A 1L8OA 3M8SA 1WWUA 4FS1A 2DL0A 5GTHU 3WK5A 2W3RA 2QB0B 5AICA 3OJSA 2LMRA 2PKEA 5ALNA 2XGQA 5F9LA 2KKPA 2NRZA 8ICTA 5G5HA 4UB3A 4C80A 3OHAA 2ODGA 3PV8A 2ASLA 4B9LA 2XY7A 4J9MA 4U7CA 1N5WA 3TAPA 4EYHB 2XIDA 4HYKA 1DK2A 4DSKA 4UAVA 4QZGA 1L8LA 3UXPA 3TFRA 1EXNA 3THVA 4M9HA 5ALYA 2W8KA 5J8YA 9ICCA 2J6TA 2H3QA 3B9JA 4YCXA 4M9LA 2KG5A 3UPQA 4RQ6A 2MSNA 4J9RA 2WB1C 2Q0ZX 1P7DA 1BPYA 5KFQA 5FP0A 2FPLA 2V4QA 8ICCA 7ICOA 2A1JB 2KE7A 3V6HA 2ZIXB 1BNPA 4KLQA 9ICBA 1V85A 3Q8KA 5KFVA 4K4IA 3GZFA 1J97A 3ZDEA 4ELTA 5KAIU 4UBBA 2YMQA 5KFOA 9ICTA 2PI4A 2W9MA 3HRDD 1UA1A 2RDIA 2W43A 1NJXA 2KVSA 1IV8A 4RQ3A 3ORYA 1ZD3A 4C7ZA 7ICKA 2EDUA 1BPXA 4QW9A 2R8KA 2KNJA 1KW4A 3SAHA 5IIMA 5AK3A 4UAZA 2R18A 4PGYA 3G6XA 2ZXIA 1TAQA 2KIVA 4OJOA 3QZ8A 5J2CA 1WG8A 3NUQA 4MEYA 4QNLA 1SGGA 3AU2A 1ZRNA 2XY6A 4WJ3B 2VJ4A 3MR2A 4ED3A 1QTMA 2FMQA 9ICPA 1U49A 2QKQA 1NI3A 2ZUBA 8ICLA 4B9MA 2YMPA 2F8LA 2IHNA 2HHTA 2H3ZA 4C7YA 5KFFA 3GQCA 4I2JA 5KT2A 4I2DA 1NNLA 1DOQA 1QQ5A 1UPHA 2KKVA 4EYIB 4GC7A 1U47A 1RYSA 5KG3A 4UB1A 4O9MA 3QU7A 3NVVA 2G06A 1D9DA 7ICUA 1S76D 1TAMA 1K1SA 3WKCA 3H0MB 1N61A 4M9JA 2C2DA 2NRVA 1B0XA 2EAMA 5CWRA 1DRGA 1HJPA 5L1MA 2NO4A 4ACOA 3QU4A 3RF9A 2ZXHA 1XO1A 2A1AA 2IOHA 3M9NB 2W9CA 4RQ2A 2P6RA 4F2RA 1NK5A 1SXDA 4C8NA 1CRXA 4ED6A 4EBDA 4J9QA 3G6YA 1QH9A 3BS5A 2KHVA 4CDGA 1COKA 3HKZC 5EOZA 2LI6A 4F4YA 5ALHA 1TK0A 3AU6A 2XCPA 4ELUA 7ICMA 2UVWA 1JXEA 1TK5A 2CPRA 4RQ5A 2FMPA 1A76A 1YZ7A 4Y2QA 1SKRA 3C28A 4DL3A 8ICGA 2F76X 2IHMA 8ICAA 5IIIA 1S5LU 4RT3A 9ICHA 5J2DA 2G07A 4RPZA 3H4DA 2NRXA 5J0PA 4O3RA 1V38A 2Y1JA 1BPBA 3GIJA 5CR0A 4PZNA 2WB1F 4Q44A 1KTQA 2JV3A 3MR5A 4J9PA 3E58A 5ALZA 2ES6A 3EPGA 5ALWA 1QQ7A 1T3QA 1NJZA 4NL9A 2QLTA 2DF4B 4RU9A 1TV9A 3HILA 1U9LA 5AI6A 4UB5A 1L7PA 1TFRA 2UVUA 3MR3A 3KHRA 2JGAA 4I2IA 2XY5A 4DSIA 3JPNA 7ICEA 2CN1A 3KZXA 3T5LA 5ALQA 9ICOA 2BPFA 3WK7A 3QUBA 3NASA 4YG2A 1WCLA 4MFAA 2RHFA 5AIAA 1RXVA 1QSSA 5J0WA 4BXOA 1VDVA 5T14A 3QUCA 2R8GA 2Y9UA 5AKJA 5KT6A 5L9XA 5A0LA 3C2KA 4LVSA 4DF4A 4KLGA 5D49A 1CUKA 4KLMA 2WHEA 3WK4A 4A8EA 3PNCA 4EBEA 2AQ4A 1N48A 2YB4A 4QZFA 4Y2YA 4TUQA 1X40A 3K75D 1RQLA 2ZUDA 4R64A 1V9PA 4EEKA 2KZ3A 1OUQA 3MABA 4JUZA 2ISOA 4RNOA 4F3OA 3AUOA 3M7DA 4NXZA 4P0QA 9ICJA 2F8KA 4US9A 1TVAA 2KSOB 4CRXA 5DB9A 4TQSA 2NRTA 1ZQMA 4BGDA 2EQYA 4KTQA 4DOCA 2WFAA 2KP7A 5C5JA 1XWLA 3WK6A 2KICA 3HPOA 1MA7A 4KLFA 5HHIA 3IP4B 4J03A 1NK8A 2KVCA 2DFLA 5CHGA 4QZEA 4ECRA 4JB3A 1BPDA 2KEYA 2BQRA 4AYBC 1X9MA 2D6FC 1NJWA 2HVHA 1VJ5A 2PI5A 1KBUA 5ALDA 3T5KA 1ZQAA 4I2BA 5HMLA 3TADC 2R8HA 5J29A 2LYHA 5DBAA 2P6UA 3IG8A 4RUAA 4ECVA 4KLEA 2AGPA 3QXGA 1KDHA 5CP2A 3IDWA 4YXJA 4QIWF 1X66A 3DDHA 4FE3A 3RB3A 4KMUA 9ICKA 4I2AA 2F1IA 2PMZF 5AKIA 4OO1J 5CRXA 4RQNA 5GTIU 3O0FA 2C28A 1H38A 1UT8A 1ZQYA 4FS2A 1QLNA 3QEBZ 3CRXA 5KFMA 5CJ7A 7ICGA 2HW3A 3PO4A 4PZOA 1Z3EB 3RB0A 5EWFA 4RUCA 1HUOA 2HI0A 3QU5A 4IQVA 5KFIA 2G0AA 1XS9D 1CEZA 5ALLA 3KFUF 5KT5A 3ZDBA 3LDAA 4CNQA 3EWAA 5KT7A 3MDCA 2RLTA 2OM6A 1JMSA 4Y2VA 4DQQA 3HWTA 3PX6A 5KTQA 5EWGA 2VA2A 5DKWA 1PK1B 3MC1A 4DSJA 9ICLA 4EBCA 2QARA 2NYVA 1ZJMA 9ICXA 5DGBA 1IIPA 4F5PA 3N28A 1SKSA 5F3XB 4FZMA 2PFQA 4C8OA 2GWSA 4DFKA 1T4GA 3GV7B 4DWIA 3LVVA 3E0FA 3KKAA 3RFAA 3BDPA 4QZBA 5IINA 8ICQA 2LM1A 4DOBA 5J0UA 1L3TA 5J2GA 5KFAA 1SV0C 2YX8A 1TE2A 9ICEA 2F3NA 1L3SA 5AK5A 3M9OB 5ALMA 4QZIA 1X6JA 4US8A 5AI4A 1PVRA 4DQIA 3EUB2 3L3FX 3BQ7A 1BPEA 3F5EA 2KK0A 7ICJA 1ZQ1C 2W7OA 1N5XA 1QCKA 5DLGA 4ECUA 3SV3A 3SR6A 4PGXA 9ICAA 2ZIWA 5ALIA 3RH5A 1ZQEA 2UVVA 3MFHA 3BZCA 4RQ4A 1JIHA 2J6SA 5AKEA 5DG8A 4BX9C 2Z7JA 1ZQPA 4BDPA 3Q8RB 1BNOA 1Q46A 3ED5A 1S10A 2RDJA 3IM1A 1IM4A 2ZUCA 5AKKA 2YB1A 1WCNA 4F92B 5KAFU 3Q8SB 2EAOA 5DBCA 4IC9A 4O5KA 8ICSA 3N7SC 7ICIA 4CF5A 3MGHA 5AM0A 4P0PB 3QE9Y 3QYPA 4KITB 2H3IA 5CEHA 5DQHA 3JPPA 1SV4A 5BOLA 1T94A 1URJA 2ZIVA 2ZTCA 1X42A 2FJ6A 4NLKA 2IOFA 4Z6CA 4EZ6A 4PL2A 1T3NA 1ZYQA 5DDMA 1Z00B 1V97A 1TK8A 2WF5A 5AM2A 8ICVA 3F2CA 5JTIA 2N1RA 3QU9A 1SZPA 4Y2SA 2A3VA 4KX5A 4Y2PA 4GC6A 1N62A 2HDOA 2RQ5A 5J8YC 3RBDA 2FE9A 1ZD5A 1JXLA 1LKYB 1L5UA 4IQTA 1RM6C 1U45A 4B9SA 2PXIA 2OH2A 4KLOA 2XC9A 2OXOA 3CP8A 4FZLA 2I1QA 3CNHA 3HW8A 3RJJA 4KLHA 4DLEA 2KJ9A 4DQSA 4R63A 4DSEA 2IA6A 2KJ5A 1BGXT 3RJIA 5KT3A 4QJFB 5IIKA 4QWCA 2C2RA 8ICWA 1DK3A 1S0NA 5AI8A 4ELVA 1SL2A 2KTQA 4M6WA 5IILA 4DQRA 1KRPA 4P2HA 2AXTU 3EZ5A 1ZXIA 2W3SA 5KFYA 4R8UA 2CXYA 2E1FA 3K1ZA 3RJFA 4FBTA 3E2EA 5KG7A 4C4SA 4UB2A 2HMXA 2PFNA 3SZ2A 3H8WA 1F44A 3RB4A 1COOA 3PMNA 2XVTA 4NM2A 1A77A 4OJ6A 4DS4A 2GLEA 3ISBA 2E8NA 2I5HA 1MQ2A 4I2EA 3LYSA 4MHVA 3QUQA 4KX3A 3NVWA 2KIWA 4C8MA 3MGIA 3F5AA 2OEHA 1SXEA 2JZBA 3SD7A 1S0VA 2L5YA 2LPEA 2P35A 3D6JA 4QZDA 3GFKB 5AI9A 1ZQXA 2K4EA 5J2KA 4M2YA 2XCAA 7ICQA 3I1YA 3PW0A 3F2BA 4P4PA 2YMMA 1KLNA 1NK6A 2ALZA 2KZZA 2HBJA 4DSFA 2EAPA 4UQGA 2DPJA 2BCRA 5DG7A 5AK4A 1Q8KA 5AI0A 4PH5A 5KT4A 5KFSA 2LYAA 5AM5A 2FDRA 4C0ZA 4RNMA 3TANA 3MDAA 4NLNA 5EE1A 2I6XA 2NO5A 1SKWA 4KLTA 2F2AB 3SI8A 2GOLA 4DQPA
chains in the Genus database with same CATH topology
2EZYA 1QCKA 2EZXA 2EZZA 1CI4A 2ODGA 2BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZY A;  1QCK A;  2EZX A;  2EZZ A;  1CI4 A;  2ODG A;  2BZF A; 
#chains in the Genus database with same CATH topology
 4PGQ A;  3QU2 A;  1S0O A;  2W9B B;  5EWE A;  4DCC A;  8ICU A;  1L7M A;  3C21 A;  4GXI A;  5BPC A;  5AIB A;  5KL1 B;  1JX4 A;  2DBY A;  1XNS A;  1UT5 A;  2MUT B;  4B9N A;  2LM4 A;  3WK8 A;  4DL6 A;  8ICF A;  2HOQ A;  3UQ2 A;  4HAI A;  3WKD A;  4FZN A;  1ZOL A;  4F50 A;  1KQQ A;  9ICU A;  4OJP A;  2AGO A;  4PHE A;  3DV9 A;  1ZJN A;  4QWA A;  5IIJ A;  7ICS A;  4QIW C;  4ZH4 A;  2H3V A;  3NRW A;  3RJG A;  2PMZ C;  4GXK A;  4F72 A;  1Z1V A;  4BUG A;  3BJY A;  1ZQI A;  2M9N A;  4YD1 A;  1X9W A;  4RQM A;  2ZIU B;  2WAQ F;  5HR7 A;  3PSF A;  1PVP A;  7ICN A;  3I76 A;  3QZ7 A;  3HX0 A;  5AKY A;  3SMV A;  1Y88 A;  1ZQO A;  1NZB A;  3N7R C;  3M1Y A;  4BWJ A;  4F71 A;  2YN4 A;  9ICF A;  2LBO A;  1NK0 A;  4EEL A;  2C22 A;  3L5K A;  2NRW A;  5KFD A;  1SWW A;  3UXO A;  4RT2 A;  1D9F A;  4GXJ A;  5KFH A;  3NTU A;  1ZQQ A;  4PHD A;  1B22 A;  8ICY A;  1JN3 A;  2DUY A;  2BKE A;  2D8C A;  4KLU A;  1ZQL A;  2J6U A;  4UAY A;  4CCH A;  2BR0 A;  2Y0S C;  4G9B A;  3WKE A;  4PPX A;  3T5J A;  2ATL A;  4C4T A;  3ZD8 A;  4KMO B;  1ZQF A;  2F1H A;  1JAL A;  1QQ6 A;  4NM1 A;  5KFK A;  1S77 D;  2JH1 A;  2QB0 A;  2K8C B;  2K8A A;  3H7I A;  2KOB A;  1LB2 B;  2JEG A;  1M6Y A;  5E79 U;  7ICH A;  1KFT A;  3C29 A;  1F0M A;  4Q8E A;  1ZQH A;  1HEK A;  3RJH A;  1JI7 A;  3GV5 B;  3KOO A;  3K1R B;  3RRG A;  3OJU A;  4O3S A;  4RPY A;  2HVI A;  4UAW A;  1WWV A;  1ECW A;  3FC4 A;  1OXJ A;  2KN7 A;  5J2H A;  5ALJ A;  1FO4 A;  2HBK A;  1SZH A;  3WKA A;  4Q8F A;  2BCU A;  3C2M A;  2UVR A;  3GIL A;  2P66 A;  4QZC A;  4MFC A;  2FLP A;  3CYM A;  8ICX A;  2A1J A;  3QEA Z;  2ZIX A;  5ALO A;  5B5E U;  3NS1 A;  2FLN A;  2MAX A;  1D8B A;  3NVY A;  3TFS A;  2HBM A;  3QUT A;  1T8E A;  4LJX A;  2RP5 A;  3J81 j;  2D3D A;  1L6N A;  1YZ6 A;  1NKB A;  7ICT A;  4O3M A;  1C7Y A;  9ICV A;  5JU5 A;  5KNI A;  4BWM A;  1ZQN A;  3LVW A;  4PHA A;  4I28 A;  5DG9 A;  5KG2 A;  4YXM A;  3Q8M A;  1NZP A;  1AQ6 A;  2E5S A;  9ICQ A;  5KG5 A;  1S9F A;  2KMD A;  2DKZ A;  4F8R A;  4YMM A;  2GH1 A;  2PFO A;  3V7K A;  3ETL A;  2VAN A;  2HHV A;  4I29 A;  4ZOH C;  4AP9 A;  3JPR A;  1L7N A;  1Z4N A;  2HOI A;  2JXJ A;  1NK7 A;  5TZV A;  4J9S A;  3TAD A;  5ALE A;  1TKD A;  2EZX A;  1F5S A;  5J2E A;  2WTF A;  1KEJ A;  4KLI A;  2BQU A;  5KG1 A;  3T79 A;  4O3N A;  5ALT A;  2IBK A;  2Y1I A;  3Q8Q B;  3RH4 A;  2BCS A;  2ASD A;  2EAN A;  2ESE A;  3LWM A;  5KFU A;  2KZM A;  2W03 A;  3QNM A;  2K4I A;  4M47 A;  2M0N A;  2BGW A;  3PW5 A;  5KFW A;  4KLD A;  3D2Q A;  3AQF A;  4DL7 A;  4Y2T A;  1SWV A;  4UAS A;  4QZ9 A;  4F5R A;  3N4M B;  4EX7 A;  3Q8L A;  3D2S A;  5DQG A;  3HP6 A;  3C5F A;  4Y2R A;  2Q4T A;  1ZQS A;  2AJQ A;  3ISD A;  4G3I A;  3OGU A;  3IN5 A;  3GIM A;  4JV1 A;  3JPT A;  4KLJ A;  5KFC A;  5DB6 A;  4R65 A;  3VC8 A;  3C23 A;  4NY8 A;  4IRK A;  9ICN A;  3ETR A;  1ZQR A;  1RPL A;  2FI1 A;  1KL9 A;  1Q3U A;  4MEX A;  1N63 A;  5AK6 A;  2Y0S F;  8ICM A;  1XO0 A;  5J2F A;  3IRU A;  2WF8 A;  1KKX A;  5EE9 A;  8ICI A;  2EH9 A;  5J0O A;  1A6S A;  4PJ0 U;  4UB6 U;  2OCE A;  2HHX A;  4USA A;  2W9C B;  3M9M B;  3OSP A;  5EE0 A;  3QX7 A;  2HHQ A;  3MR6 A;  3UXN A;  1ZQB A;  2CRX A;  2KD1 A;  4CF4 A;  4ECT A;  3RJK A;  3BS5 B;  4YFK A;  3F2D A;  1B4F A;  4GFJ A;  7ICP A;  2QB1 A;  3TI0 A;  3NVZ A;  4E0D A;  3ICX A;  1SIJ A;  5ALF A;  4YVZ A;  1TAU A;  1K1Q A;  3OHB A;  1SV0 A;  1GO3 F;  2ASJ A;  2ISP A;  4M0A A;  3MFI A;  1ZQW A;  4ED8 A;  1YT3 A;  4Z6E A;  1N60 A;  3OSN A;  1O03 A;  2H3F A;  2B21 A;  2BDU A;  1XSL A;  3H40 A;  2H5X A;  4YQW A;  4QZA A;  3SAF A;  3SEI A;  3M6Z A;  3RH6 A;  4TQR A;  8ICK A;  3KHL A;  3C1Y A;  5D4B A;  2KFZ A;  4OJ5 A;  5KFG A;  3EYZ A;  2KV2 A;  4R66 A;  2WF7 A;  1O08 A;  3IG5 A;  5KFP A;  4OJL A;  2HOF A;  3DEE A;  1CI4 A;  2WAQ C;  3VCB A;  4JV0 A;  2RRD A;  4Y2U A;  1L7O A;  2E1E A;  5ALX A;  5JUM A;  4MFF A;  4ED0 A;  2WF9 A;  8ICJ A;  1K5O A;  4ECX A;  3PW4 A;  4GLX A;  1LV5 A;  4NJ8 A;  1S0M A;  4DLG A;  4K4H A;  1WYG A;  1MC8 A;  5KFB A;  3K4G A;  4BXO B;  4YN4 A;  4DOA A;  5L1J A;  2W11 A;  4MF2 A;  5G5G A;  4TUS A;  5KL8 B;  1NOM A;  1LVH A;  2BQ3 A;  1XC9 A;  5EE3 A;  3PST A;  3RB6 A;  1DGJ A;  3TKA A;  2JHD A;  4DEZ A;  2G08 A;  3SQI A;  3C2L A;  2KFN A;  1PK3 A;  4F4Z A;  1FEZ A;  2LKY A;  4ED2 A;  5KFZ A;  3V6J A;  2JEI A;  2W54 A;  4XRH A;  2KSO A;  4ED7 A;  4O0I A;  8ICP A;  4UAR A;  4P0Q B;  8ICE A;  3D2N A;  3SAG A;  4YMN A;  3AL0 B;  3UMB A;  1X9S A;  1ZQT A;  5ALR A;  5IIO A;  4QW8 A;  2JR5 A;  3M8R A;  2AU0 A;  4PHP A;  2HHS A;  5KFX A;  4M9G A;  5KFJ A;  1B43 A;  3MBY A;  2HSZ A;  3GV8 B;  2DQN B;  2BHN A;  2MRL A;  5F9N A;  9ICI A;  5ALP A;  4B9T A;  2HCF A;  2JEF A;  4DO9 A;  3ALR A;  3BZK A;  4ECQ A;  3V7L A;  4JMU A;  4RQ7 A;  4GIB A;  1NKE A;  4O3Q A;  3N7P D;  3BQ1 A;  3PX0 A;  3N97 B;  1ZQC A;  4Y2X A;  4PL1 A;  5AM4 A;  2K89 A;  3JPO A;  5KFT A;  4F4K A;  4EZ9 A;  3UM9 A;  3CW2 C;  3RAX A;  2K4H A;  3UMG A;  5CB1 A;  2MA1 A;  3V6K A;  4JWN A;  3LWL A;  5HP4 A;  4ECW A;  1QSY A;  2ZTE A;  2FMS A;  1MQ3 A;  3FYH A;  3JPQ A;  4QZH A;  2C2E A;  3AMZ A;  2FPK A;  4NLG A;  7ICV A;  2VA3 A;  1KFD A;  3RR7 A;  4DL4 A;  3TAC B;  3WU2 U;  8ICB A;  5KG4 A;  1ZQK A;  4DSL A;  4O3P A;  4EX6 A;  4OCZ A;  2VJ5 A;  3PSI A;  5J0R A;  2EZZ A;  4KN4 A;  1XSP A;  1N56 A;  1FFU A;  3S6J A;  5AHX A;  4F91 B;  3HT3 A;  2IMW P;  1KSP A;  2WF6 A;  4CE6 A;  3BQT A;  4O5C A;  7ICF A;  5DB8 A;  4FBU A;  3H4B A;  4QWE A;  1SL0 A;  1PK1 A;  1FFV A;  4RZR A;  3KBB A;  1NKC A;  4YD2 A;  4UBC A;  3TQ1 A;  2VIX A;  4EEY A;  1PUZ A;  4BJQ A;  2QAR B;  3KZI U;  2DGZ A;  3A0B U;  4J9L A;  4F4X A;  4B9V A;  3GII A;  3EW9 A;  3PR4 A;  1ZQJ A;  4DFD A;  1Q3V A;  5KG0 A;  4RQ8 A;  4I2H A;  4RQ1 A;  3OTQ A;  3PO5 A;  4IRD A;  4Y2J A;  2XO7 A;  4X5V A;  2ZTD A;  4DFM A;  2W8L A;  4NLZ A;  5J2J A;  3PSP A;  5J0Y A;  4Q43 A;  4K4G A;  3GIK A;  8ICR A;  1X9X A;  3ZI4 A;  2V4R A;  2HHW A;  2OWO A;  3KHG A;  2W04 A;  3GU3 A;  4IL6 U;  4YMO A;  1WUD A;  5KFR A;  3C1Z A;  3ZD9 A;  3H0R B;  4UW9 A;  1RXW A;  1D8Y A;  3PR5 B;  4ICA A;  2E3T A;  3UMC A;  2AQ0 A;  3I28 A;  4NL9 C;  2HBL A;  2FLL A;  2AGQ A;  1NK4 A;  3KTQ A;  2KJ8 A;  2ZIW B;  2XIC A;  2K60 A;  3LK9 A;  3EPI A;  1J2N A;  2E8O A;  4M04 A;  2R8J A;  5B66 U;  2JEJ A;  1Z1B A;  1U4B A;  3H8S A;  3ZDA A;  2DPI A;  4KLL A;  4DL5 A;  4NWI A;  5KFN A;  2F1J A;  3PZP A;  3TAQ A;  3IHQ B;  4TUP A;  4P0P A;  2E8M A;  3SYZ A;  1NJY A;  4JV2 A;  5J0S A;  5TIS U;  2AHO B;  2IOF K;  3RBE A;  4O5E A;  4NV0 A;  1RG6 A;  5J0X A;  9ICM A;  5AKZ A;  4IS7 A;  1KN5 A;  4YR2 A;  1RYR A;  2B0C A;  1C20 A;  3M6K A;  2A19 A;  3NGD A;  2ZIV B;  5J2I A;  1Z4O A;  1PVQ A;  1Z00 A;  2BCQ A;  2F77 X;  4DL2 A;  3WKB A;  5HMM A;  4XUS A;  1ZQD A;  2PFP A;  2HHU A;  4F93 B;  1A0P A;  2OYY A;  4JWM A;  1ZQV A;  1LKY A;  1UQV A;  3RAQ A;  2JH7 A;  5H2F U;  3BS7 A;  4I2C A;  5AKG A;  4LZD A;  2GO7 A;  8ICO A;  4J9K A;  3PX4 A;  4IQW A;  2AH5 A;  1L3U A;  1XU4 A;  1OW5 A;  4F4W A;  1T7P A;  1ZQU A;  2G5H B;  5C0Y A;  3WK9 A;  2E8P A;  2BPG A;  3PW7 A;  1BVS A;  4DFP A;  7ICR A;  4B6J A;  3U26 A;  3BQ0 A;  1S8O A;  4P4M A;  3RRH A;  1U48 A;  4XA5 A;  5ALV A;  4F5Q A;  4M6W B;  3PW2 A;  2B6G A;  1J2M A;  5L1L A;  1N2X A;  8ICH A;  3SEN A;  4R8U B;  1MSW D;  3PML A;  1PZN A;  2O6K A;  3HJE A;  3H0L B;  3PVX A;  4I2F A;  2EZY A;  5HHH A;  3JPS A;  3KD3 A;  5J2B A;  5KG6 A;  4IQU A;  5DQI A;  2G5I B;  4QWD A;  4JK1 A;  3ZDD A;  1D8L A;  4IR1 A;  4CGZ A;  4YR3 A;  3MGV A;  5L1K A;  5CA7 A;  2FPM A;  3RJE A;  4UB4 A;  4Z6D A;  1ZRM A;  3FDS A;  2JZB B;  7ICL A;  4DF8 A;  3H8J A;  2K4P A;  2K8B B;  4IR9 A;  4RPX A;  1QSL A;  8ICZ A;  2LHT A;  9ICG A;  3ZDC A;  3NRZ A;  4F2S A;  1DXS A;  5ALS A;  5DLF A;  8ICN A;  4UB8 U;  2I9G A;  5AM1 A;  1UA0 A;  5KFE A;  5HNK A;  4YR0 A;  9ICR A;  4NLC A;  4ED1 A;  1L3V A;  1NK9 A;  5J0T A;  5DB7 A;  4Z6F A;  4NLB A;  4RQ0 A;  3T5H A;  2BCV A;  2YQE A;  3ISC A;  3OPX A;  2W55 A;  1IG6 A;  3C5G A;  2VA8 A;  3PY8 A;  3ONN A;  3B0X A;  2ZJA A;  3AM9 A;  4U6P A;  4I27 A;  1ARO P;  1HIW A;  1ZQG A;  4EEN A;  3BQ2 A;  5D46 A;  3HKZ F;  2W9B A;  4ECY A;  4C8K A;  4ECZ A;  1JUD A;  4YP3 A;  4KN7 A;  2JRZ A;  3B0Y A;  5AKH A;  5L1I A;  3KKA C;  3TAR A;  4QZ8 A;  4F5O A;  1MN8 A;  4UAU A;  2MUT A;  1DGS A;  1JRO A;  4CF3 A;  1SL1 A;  1S97 A;  2Y9T A;  2V9W A;  4C8L A;  1RQN A;  2OHF A;  4J9N A;  5AI5 A;  3RTV A;  4TUR A;  2BPC A;  1VLB A;  3GDX A;  2XI9 A;  1ZD4 A;  2YY6 A;  5KFL A;  4J9O A;  2YTU A;  2F44 A;  4M9N A;  3AEV A;  2DWQ A;  1ZD2 P;  3UQ0 A;  1X2I A;  3AN1 A;  4O3O A;  3FM9 A;  2ZIU A;  5J0Q A;  2R8I A;  4MF8 A;  2NV3 A;  3G6V A;  1UCV A;  3V72 A;  3H8M A;  2ZJ5 A;  3SV4 A;  5AM3 A;  3V7J A;  1ED1 A;  2KHQ A;  3R9K A;  4QWB A;  1IXR A;  1X6I A;  4KLS A;  2YML A;  1ZET A;  1RDF A;  1SB3 C;  4RNN A;  4FO6 A;  2XGP A;  5DGA A;  9ICS A;  5K4L A;  1JRP A;  9ICW A;  1HUZ A;  5ALK A;  1RYU A;  5J2A A;  5ALG A;  4B9U A;  4OD0 A;  2ZG6 A;  1ZQZ A;  1UHU A;  4FFD A;  5DBB A;  1BPZ A;  5AKL A;  3Q8P B;  4I2G A;  3IV6 A;  2ZJ8 A;  3T3F A;  4C4R A;  3RR8 A;  1FIQ A;  5ALU A;  4UAT A;  3AQE A;  3F53 A;  5DDY A;  4DS5 A;  2LYB A;  5BOM A;  2BDP A;  5AKX A;  1Z19 A;  4IRC A;  4DFJ A;  5HR6 A;  2W9A A;  2MU2 A;  1RZT A;  4P4O A;  3KHH A;  4F5N A;  5JRT A;  1XSN A;  4ECS A;  2VKQ A;  3FAH A;  2BZF A;  2DKX A;  3L4P A;  2G09 A;  2W7P A;  1KFS A;  4LZG A;  4Q45 A;  3A0H U;  2JMG A;  4AYB F;  4XQ8 A;  1L8O A;  3M8S A;  1WWU A;  4FS1 A;  2DL0 A;  5GTH U;  3WK5 A;  2W3R A;  2QB0 B;  5AIC A;  3OJS A;  2LMR A;  2PKE A;  5ALN A;  2XGQ A;  5F9L A;  2KKP A;  2NRZ A;  8ICT A;  5G5H A;  4UB3 A;  4C80 A;  3OHA A;  2ODG A;  3PV8 A;  2ASL A;  4B9L A;  2XY7 A;  4J9M A;  4U7C A;  1N5W A;  3TAP A;  4EYH B;  2XID A;  4HYK A;  1DK2 A;  4DSK A;  4UAV A;  4QZG A;  1L8L A;  3UXP A;  3TFR A;  1EXN A;  3THV A;  4M9H A;  5ALY A;  2W8K A;  5J8Y A;  9ICC A;  2J6T A;  2H3Q A;  3B9J A;  4YCX A;  4M9L A;  2KG5 A;  3UPQ A;  4RQ6 A;  2MSN A;  4J9R A;  2WB1 C;  2Q0Z X;  1P7D A;  1BPY A;  5KFQ A;  5FP0 A;  2FPL A;  2V4Q A;  8ICC A;  7ICO A;  2A1J B;  2KE7 A;  3V6H A;  2ZIX B;  1BNP A;  4KLQ A;  9ICB A;  1V85 A;  3Q8K A;  5KFV A;  4K4I A;  3GZF A;  1J97 A;  3ZDE A;  4ELT A;  5KAI U;  4UBB A;  2YMQ A;  5KFO A;  9ICT A;  2PI4 A;  2W9M A;  3HRD D;  1UA1 A;  2RDI A;  2W43 A;  1NJX A;  2KVS A;  1IV8 A;  4RQ3 A;  3ORY A;  1ZD3 A;  4C7Z A;  7ICK A;  2EDU A;  1BPX A;  4QW9 A;  2R8K A;  2KNJ A;  1KW4 A;  3SAH A;  5IIM A;  5AK3 A;  4UAZ A;  2R18 A;  4PGY A;  3G6X A;  2ZXI A;  1TAQ A;  2KIV A;  4OJO A;  3QZ8 A;  5J2C A;  1WG8 A;  3NUQ A;  4MEY A;  4QNL A;  1SGG A;  3AU2 A;  1ZRN A;  2XY6 A;  4WJ3 B;  2VJ4 A;  3MR2 A;  4ED3 A;  1QTM A;  2FMQ A;  9ICP A;  1U49 A;  2QKQ A;  1NI3 A;  2ZUB A;  8ICL A;  4B9M A;  2YMP A;  2F8L A;  2IHN A;  2HHT A;  2H3Z A;  4C7Y A;  5KFF A;  3GQC A;  4I2J A;  5KT2 A;  4I2D A;  1NNL A;  1DOQ A;  1QQ5 A;  1UPH A;  2KKV A;  4EYI B;  4GC7 A;  1U47 A;  1RYS A;  5KG3 A;  4UB1 A;  4O9M A;  3QU7 A;  3NVV A;  2G06 A;  1D9D A;  7ICU A;  1S76 D;  1TAM A;  1K1S A;  3WKC A;  3H0M B;  1N61 A;  4M9J A;  2C2D A;  2NRV A;  1B0X A;  2EAM A;  5CWR A;  1DRG A;  1HJP A;  5L1M A;  2NO4 A;  4ACO A;  3QU4 A;  3RF9 A;  2ZXH A;  1XO1 A;  2A1A A;  2IOH A;  3M9N B;  2W9C A;  4RQ2 A;  2P6R A;  4F2R A;  1NK5 A;  1SXD A;  4C8N A;  1CRX A;  4ED6 A;  4EBD A;  4J9Q A;  3G6Y A;  1QH9 A;  3BS5 A;  2KHV A;  4CDG A;  1COK A;  3HKZ C;  5EOZ A;  2LI6 A;  4F4Y A;  5ALH A;  1TK0 A;  3AU6 A;  2XCP A;  4ELU A;  7ICM A;  2UVW A;  1JXE A;  1TK5 A;  2CPR A;  4RQ5 A;  2FMP A;  1A76 A;  1YZ7 A;  4Y2Q A;  1SKR A;  3C28 A;  4DL3 A;  8ICG A;  2F76 X;  2IHM A;  8ICA A;  5III A;  1S5L U;  4RT3 A;  9ICH A;  5J2D A;  2G07 A;  4RPZ A;  3H4D A;  2NRX A;  5J0P A;  4O3R A;  1V38 A;  2Y1J A;  1BPB A;  3GIJ A;  5CR0 A;  4PZN A;  2WB1 F;  4Q44 A;  1KTQ A;  2JV3 A;  3MR5 A;  4J9P A;  3E58 A;  5ALZ A;  2ES6 A;  3EPG A;  5ALW A;  1QQ7 A;  1T3Q A;  1NJZ A;  4NL9 A;  2QLT A;  2DF4 B;  4RU9 A;  1TV9 A;  3HIL A;  1U9L A;  5AI6 A;  4UB5 A;  1L7P A;  1TFR A;  2UVU A;  3MR3 A;  3KHR A;  2JGA A;  4I2I A;  2XY5 A;  4DSI A;  3JPN A;  7ICE A;  2CN1 A;  3KZX A;  3T5L A;  5ALQ A;  9ICO A;  2BPF A;  3WK7 A;  3QUB A;  3NAS A;  4YG2 A;  1WCL A;  4MFA A;  2RHF A;  5AIA A;  1RXV A;  1QSS A;  5J0W A;  4BXO A;  1VDV A;  5T14 A;  3QUC A;  2R8G A;  2Y9U A;  5AKJ A;  5KT6 A;  5L9X A;  5A0L A;  3C2K A;  4LVS A;  4DF4 A;  4KLG A;  5D49 A;  1CUK A;  4KLM A;  2WHE A;  3WK4 A;  4A8E A;  3PNC A;  4EBE A;  2AQ4 A;  1N48 A;  2YB4 A;  4QZF A;  4Y2Y A;  4TUQ A;  1X40 A;  3K75 D;  1RQL A;  2ZUD A;  4R64 A;  1V9P A;  4EEK A;  2KZ3 A;  1OUQ A;  3MAB A;  4JUZ A;  2ISO A;  4RNO A;  4F3O A;  3AUO A;  3M7D A;  4NXZ A;  4P0Q A;  9ICJ A;  2F8K A;  4US9 A;  1TVA A;  2KSO B;  4CRX A;  5DB9 A;  4TQS A;  2NRT A;  1ZQM A;  4BGD A;  2EQY A;  4KTQ A;  4DOC A;  2WFA A;  2KP7 A;  5C5J A;  1XWL A;  3WK6 A;  2KIC A;  3HPO A;  1MA7 A;  4KLF A;  5HHI A;  3IP4 B;  4J03 A;  1NK8 A;  2KVC A;  2DFL A;  5CHG A;  4QZE A;  4ECR A;  4JB3 A;  1BPD A;  2KEY A;  2BQR A;  4AYB C;  1X9M A;  2D6F C;  1NJW A;  2HVH A;  1VJ5 A;  2PI5 A;  1KBU A;  5ALD A;  3T5K A;  1ZQA A;  4I2B A;  5HML A;  3TAD C;  2R8H A;  5J29 A;  2LYH A;  5DBA A;  2P6U A;  3IG8 A;  4RUA A;  4ECV A;  4KLE A;  2AGP A;  3QXG A;  1KDH A;  5CP2 A;  3IDW A;  4YXJ A;  4QIW F;  1X66 A;  3DDH A;  4FE3 A;  3RB3 A;  4KMU A;  9ICK A;  4I2A A;  2F1I A;  2PMZ F;  5AKI A;  4OO1 J;  5CRX A;  4RQN A;  5GTI U;  3O0F A;  2C28 A;  1H38 A;  1UT8 A;  1ZQY A;  4FS2 A;  1QLN A;  3QEB Z;  3CRX A;  5KFM A;  5CJ7 A;  7ICG A;  2HW3 A;  3PO4 A;  4PZO A;  1Z3E B;  3RB0 A;  5EWF A;  4RUC A;  1HUO A;  2HI0 A;  3QU5 A;  4IQV A;  5KFI A;  2G0A A;  1XS9 D;  1CEZ A;  5ALL A;  3KFU F;  5KT5 A;  3ZDB A;  3LDA A;  4CNQ A;  3EWA A;  5KT7 A;  3MDC A;  2RLT A;  2OM6 A;  1JMS A;  4Y2V A;  4DQQ A;  3HWT A;  3PX6 A;  5KTQ A;  5EWG A;  2VA2 A;  5DKW A;  1PK1 B;  3MC1 A;  4DSJ A;  9ICL A;  4EBC A;  2QAR A;  2NYV A;  1ZJM A;  9ICX A;  5DGB A;  1IIP A;  4F5P A;  3N28 A;  1SKS A;  5F3X B;  4FZM A;  2PFQ A;  4C8O A;  2GWS A;  4DFK A;  1T4G A;  3GV7 B;  4DWI A;  3LVV A;  3E0F A;  3KKA A;  3RFA A;  3BDP A;  4QZB A;  5IIN A;  8ICQ A;  2LM1 A;  4DOB A;  5J0U A;  1L3T A;  5J2G A;  5KFA A;  1SV0 C;  2YX8 A;  1TE2 A;  9ICE A;  2F3N A;  1L3S A;  5AK5 A;  3M9O B;  5ALM A;  4QZI A;  1X6J A;  4US8 A;  5AI4 A;  1PVR A;  4DQI A;  3EUB 2;  3L3F X;  3BQ7 A;  1BPE A;  3F5E A;  2KK0 A;  7ICJ A;  1ZQ1 C;  2W7O A;  1N5X A;  1QCK A;  5DLG A;  4ECU A;  3SV3 A;  3SR6 A;  4PGX A;  9ICA A;  2ZIW A;  5ALI A;  3RH5 A;  1ZQE A;  2UVV A;  3MFH A;  3BZC A;  4RQ4 A;  1JIH A;  2J6S A;  5AKE A;  5DG8 A;  4BX9 C;  2Z7J A;  1ZQP A;  4BDP A;  3Q8R B;  1BNO A;  1Q46 A;  3ED5 A;  1S10 A;  2RDJ A;  3IM1 A;  1IM4 A;  2ZUC A;  5AKK A;  2YB1 A;  1WCN A;  4F92 B;  5KAF U;  3Q8S B;  2EAO A;  5DBC A;  4IC9 A;  4O5K A;  8ICS A;  3N7S C;  7ICI A;  4CF5 A;  3MGH A;  5AM0 A;  4P0P B;  3QE9 Y;  3QYP A;  4KIT B;  2H3I A;  5CEH A;  5DQH A;  3JPP A;  1SV4 A;  5BOL A;  1T94 A;  1URJ A;  2ZIV A;  2ZTC A;  1X42 A;  2FJ6 A;  4NLK A;  2IOF A;  4Z6C A;  4EZ6 A;  4PL2 A;  1T3N A;  1ZYQ A;  5DDM A;  1Z00 B;  1V97 A;  1TK8 A;  2WF5 A;  5AM2 A;  8ICV A;  3F2C A;  5JTI A;  2N1R A;  3QU9 A;  1SZP A;  4Y2S A;  2A3V A;  4KX5 A;  4Y2P A;  4GC6 A;  1N62 A;  2HDO A;  2RQ5 A;  5J8Y C;  3RBD A;  2FE9 A;  1ZD5 A;  1JXL A;  1LKY B;  1L5U A;  4IQT A;  1RM6 C;  1U45 A;  4B9S A;  2PXI A;  2OH2 A;  4KLO A;  2XC9 A;  2OXO A;  3CP8 A;  4FZL A;  2I1Q A;  3CNH A;  3HW8 A;  3RJJ A;  4KLH A;  4DLE A;  2KJ9 A;  4DQS A;  4R63 A;  4DSE A;  2IA6 A;  2KJ5 A;  1BGX T;  3RJI A;  5KT3 A;  4QJF B;  5IIK A;  4QWC A;  2C2R A;  8ICW A;  1DK3 A;  1S0N A;  5AI8 A;  4ELV A;  1SL2 A;  2KTQ A;  4M6W A;  5IIL A;  4DQR A;  1KRP A;  4P2H A;  2AXT U;  3EZ5 A;  1ZXI A;  2W3S A;  5KFY A;  4R8U A;  2CXY A;  2E1F A;  3K1Z A;  3RJF A;  4FBT A;  3E2E A;  5KG7 A;  4C4S A;  4UB2 A;  2HMX A;  2PFN A;  3SZ2 A;  3H8W A;  1F44 A;  3RB4 A;  1COO A;  3PMN A;  2XVT A;  4NM2 A;  1A77 A;  4OJ6 A;  4DS4 A;  2GLE A;  3ISB A;  2E8N A;  2I5H A;  1MQ2 A;  4I2E A;  3LYS A;  4MHV A;  3QUQ A;  4KX3 A;  3NVW A;  2KIW A;  4C8M A;  3MGI A;  3F5A A;  2OEH A;  1SXE A;  2JZB A;  3SD7 A;  1S0V A;  2L5Y A;  2LPE A;  2P35 A;  3D6J A;  4QZD A;  3GFK B;  5AI9 A;  1ZQX A;  2K4E A;  5J2K A;  4M2Y A;  2XCA A;  7ICQ A;  3I1Y A;  3PW0 A;  3F2B A;  4P4P A;  2YMM A;  1KLN A;  1NK6 A;  2ALZ A;  2KZZ A;  2HBJ A;  4DSF A;  2EAP A;  4UQG A;  2DPJ A;  2BCR A;  5DG7 A;  5AK4 A;  1Q8K A;  5AI0 A;  4PH5 A;  5KT4 A;  5KFS A;  2LYA A;  5AM5 A;  2FDR A;  4C0Z A;  4RNM A;  3TAN A;  3MDA A;  4NLN A;  5EE1 A;  2I6X A;  2NO5 A;  1SKW A;  4KLT A;  2F2A B;  3SI8 A;  2GOL A;  4DQP A; 
#chains in the Genus database with same CATH homology
 2EZY A;  1QCK A;  2EZX A;  2EZZ A;  1CI4 A;  2ODG A;  2BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...