4B9TA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -dc basepair in the post-insertion site.
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9tA01
1ZQQA 3PO5A 4DL7A 4BDZA 3V1RA 1C0MA 4NCGA 4RNMA 5HROA 1WLJA 2XY6A 3PX6A 2Y1JA 4Q43A 4I2IA 4B9VA 4DL2A 3EWAA 3QNNA 4HUEA 1SL2A 3ZD9A 3JPOA 2DFFA 5FRMA 3LP0A 4DOCA 1EXNA 3GIIA 1PZNA 5FROA 4KHYA 1HMVA 3S3MA 1HJPA 4M6WA 4DEZA 2ASJA 3B6PA 4RW9A 3TAQA 5SWMA 2JEFA 1S1XA 3S9HA 1U4BA 4JV2A 4FM2A 1JLAA 4Z6FA 3DLEA 4ELTA 3PW2A 4ZTJA 4RQ1A 3VQ8A 1RBUA 4C8MA 1EP4A 4DQPA 1LW2A 2XHBA 2JZBA 4YMOA 4KN7A 4YXMA 5DG8A 2P5GA 4CFAA 4JRPA 5IILA 1JLCA 1RDBA 4DFJA 2X78A 3LP2A 1HUZA 1FKPA 7ICGA 2QXFA 3HM9A 3TFRA 4DSEA 3SNNA 2X6SA 3MR5A 3LALA 1C6VA 3CM5A 3AA2A 1RBVA 2P66A 2FBXA 3L2VA 1SV5A 5FRNA 3ZT0A 4W5NA 4Q8EA 2QK9A 4E1MA 4B8AB 1VK0A 9ICFA 3MXJA 1JXEA 4KLIA 1CXQA 4BE0A 2DFEA 4I9LA 1TKTA 4RZRA 7ICSA 3THVA 4PHDA 4BWJA 3U6FA 3KD5E 4QCLA 4NM2A 5BOLA 4M3XA 5F9NA 4AILC 3KLHA 3QEAZ 4I2QA 4FJ9A 4CHOA 3QO9A 1HNIA 3GV7B 3NF8A 4MEYA 5J2PA 3SJJA 1NK4A 4KB0A 3N97B 3RJEA 4J9KA 4KLGA 3T5LA 2NRWA 4RT2A 3O3FA 4IKFA 1RBRA 1D9FA 5J0YA 5KFCA 3L2UA 4F5NA 4YVZA 5HRPA 4FJMA 1VRUA 4B9SA 4MF2A 3DRRA 4I2DA 4M0AA 4PGXA 2RDIA 1RDCA 4PA1A 1ZQUA 3O3GA 5KFZA 4DFPA 8ICJA 2A1RA 4JS5A 3HP6A 3Q8RB 4RW4A 4O3PA 3HX0A 1W9HA 1NK6A 4M04A 1NKCA 3PO4A 3D0PA 1W0HA 2LYHA 4KLTA 2KFZA 1J53A 1KVCA 4DF8A 1LAWA 1HYZA 1DTTA 9ICGA 1D5AA 4EBEA 3RJHA 2RDJA 3IHQB 4CF9A 3H4BA 5J2EA 5CJ7A 3C95A 2BKEA 2DPIA 2D0CA 4F3TA 5J0TA 5KFIA 3Q8QB 2G8KA 4H8KA 8ICCA 4KHWA 3NHGA 4KREA 1ZQRA 3DOKA 4JV0A 4F4KA 3K5NA 2OPRA 1U47A 4CFCA 2VA3A 1JLBA 5KFHA 4ECSA 4X5VA 1WSJA 2NRVA 4E7HA 4PPXA 3LP1A 1NK8A 3QERA 4CJKA 4DQQA 1C0TA 4AHRA 3A2FA 4DQSA 3MXMA 1ASVA 1BISA 4IQTA 4Y1CA 3CYMA 4KITB 3ZT4A 4M9JA 3LWLA 4ECQA 1ZQHA 4ELVA 4IQUA 4MFFA 5KFUA 7ICPA 4RW7A 3GIKA 1L3SA 9ICSA 2P6UA 3K5OA 4I2CA 4FS1A 4LH4A 2KZZA 1B22A 4OPJA 4I2HA 4CF8A 4EBCA 4Z4HA 2WONA 4CHZA 2FMQA 4KLLA 3CFOA 4KPYA 2HHQA 3KJVA 4KI6A 1D8YA 2UVUA 4N56A 3MECA 1KFTA 3RB6A 3RB4A 3VQEA 5KFLA 4Z4IA 4O4GA 3DLBA 1BPDA 3B0YA 1WAJA 3LWMA 1ZBLA 1NJYA 3GFKB 3V7LA 3PX4A 1TK5A 1WNSA 1Z3EB 3OYGA 3LDAA 2I9GA 4YR3A 4CEDA 5KRTA 4DL5A 3UIQA 5KFGA 3OYBA 4UB2A 4M9GA 5KG4A 4J9LA 4UB5A 2KFNA 5KG7A 4HVJA 2X74A 4YN4A 4YQWA 2FLLA 1VSMA 4AHCA 4O5KA 8ICSA 3P5JA 1HQUA 3OYHA 4EZ6A 3MBYA 4LZGA 4L8RB 2XCAA 9ICQA 3VA3A 3BQ0A 1ZQSA 2VG5A 4P2HA 2VWJA 4Z4GA 4B9UA 3C6TA 4ED0A 4CEAA 4PHPA 2GV9A 1WSFA 4QAGA 5KG0A 1N6QA 1RT2A 4NCAA 4CK1A 4B3OA 1T3NA 2W42A 4YFKA 3MFHA 1J5OA 3C21A 4E7LA 4G1QA 1JL2A 4RW6A 2KZ3A 3KIOA 1TKZA 1ZQCA 5CZ1A 3LAMA 4Q44A 2JGUA 1AROP 3GQCA 3AO1A 5KRSA 4QZIA 3HO1A 4NLNA 3BGRA 1VSIA 2PYLA 3HJFA 4ED7A 4EYIB 8ICGA 2PFOA 4IFVA 3SUNA 5KFFA 4KLQA 8ICPA 2FBVA 2HHUA 1S6PA 3B0XA 4QWEA 4DS4A 1Z26A 3RBEA 4KHQA 4ZTFA 3N4MB 4PGQA 3M8RA 1F21A 2ZUDA 1IO2A 4E19A 5KFSA 1JKHA 2VG7A 2IAJA 4UB4A 2J6UA 3QE9Y 4NYFA 4HTUA 4ECUA 2G8HA 3CQ8A 4Z0UA 4E7IA 1COOA 5HMMA 4CERA 4I2EA 4FLZA 2C2RA 4YMNA 9ICAA 2C22A 2I1QA 1HUOA 4OGEA 3HSTB 4CJWA 4PY5A 4FK2A 1TV6A 4NYNA 5KG6A 1L3TA 4W5TA 1C0UA 3SV4A 1WCNA 2XO7A 3RTVA 2AGOA 3RJGA 2Z1JA 4MEXA 4R8UB 2HNZA 4FM1A 5KFRA 1EETA 3VA0A 4ED2A 4FLVA 3CM6A 5EWFA 3RJIA 5D46A 3CG7A 2PI5A 1CLQA 2XGQA 1X9WA 2BANA 3QEWA 2BGGA 4F3OA 3RJFA 2FBTA 8ICTA 5DLFA 1ZQFA 3C2LA 4ED8A 3V72A 4XA5A 1ZYQA 2PYJA 3MR2A 3TAGA 4E0DA 1WAFA 1I39A 4FJLA 5I3UA 4GC7A 4JUZA 3RR8A 3V6HA 3NGIA 3PMNA 1S9GA 2J6SA 7ICFA 1GOCA 3QESA 2V4RA 3P1GA 2JZBB 4RQ8A 3PW5A 3NH0A 4DL3A 1Z00B 4Z4FA 3RB3A 3ZCMA 3O4QA 4RNOA 4O3QA 4YR2A 5HRNA 3C6UA 1BPZA 5JS2A 4RU9A 3IM1A 1RTJA 3K5LA 2VG6A 3MEGA 1S97A 1MQ2A 3VQ9A 5KI6A 2YNHA 4CEBA 4RQ2A 3MDAA 4GXKA 1L3UA 3I0SA 4EP4A 4CIGA 1NOMA 1N5YA 4MFCA 4IG3A 3VN5A 1RT6A 3C94A 5KFPA 2FBYA 2Z1IA 9ICCA 1DLOA 1S5JA 1RBTA 5EOZA 1R0AA 4JV1A 3QZ7A 4JWMA 1HPZA 3KLEA 4IQVA 4EP5A 1HQEA 2F1JA 1ZQDA 5CHGA 1CXUA 3TANA 5J0QA 3ORYA 3M9MB 3BQ2A 3UPQA 1A77A 4UB3A 4OGCA 1KFSA 1BGXT 1FXXA 3TABA 1S1UA 1XC9A 3C5FA 3RH4A 3S3NA 5DDYA 3K4GA 2AU0A 3QNOA 3HVRA 4FZZA 3OJUA 1T7PA 4CJVA 1S9FA 4ED1A 3M9OB 2BDPA 4W5RA 3TI0A 5KTQA 2OA8A 4Z4EA 5JUMA 9ICKA 3CFRA 3OJSA 1Y88A 3ZDEA 1RCHA 3RH6A 1KVBA 3OYMA 1RXVA 4ZHRA 3LK9A 2C2EA 3I8DA 4LVSA 3SUPA 1ZQNA 2ISOA 3ZSOA 2BCRA 2OYQA 3H7IA 4LZDA 1XI1A 5HRSA 5SZTA 3WNEA 2M9NA 4O44A 1IKYA 1KEJA 3DM2A 3L2QA 1HYVA 4M3WA 4AHTA 2XCPA 3SQ2A 1MU2A 1T4GA 1BIZA 2UVRA 4CJRA 2W8KA 2BCQA 4I2FA 3DRSA 3VQQA 4BWMA 3MDCA 4ICLA 3HPHA 4F5PA 5CR0A 2HHSA 5IIIA 4P4OA 4GC6A 5KG5A 7ICQA 3KHLA 1UA0A 2PI4A 3G6YA 3EPIA 1ZJMA 4KO0A 4PH5A 4YFUA 1V9PA 1TK0A 3EPGA 2NRXA 3H8JA 4F5OA 4ECXA 3OYFA 1TKDA 2VWKA 3OYAA 8ICAA 1U48A 4GVMA 1SZPA 4RPZA 3OYLA 1JL1A 1QS4A 2UVVA 2BPFA 1JLGA 2XRIA 3VQ6A 4QWBA 9ICTA 5J2BA 4PGYA 1A76A 4CJ3A 1KLMA 5CB1A 4K4HA 5CP2A 3K75D 2B6AA 3HL8A 1WSGA 2OPSA 3JYTA 4MF8A 2G8IA 5KFMA 3TAMA 1B9FA 3VQPA 5DK5A 7ICHA 4FM0A 4M9LA 5J2GA 2HMIA 4DOAA 9ICPA 3LPTA 3AUOA 2P51A 3MGHA 8ICLA 5I42A 1JXBA 3SV3A 1ZQVA 1SL1A 3V1QA 3ZT3A 4FLUA 4CGDA 3DLHA 4KTWA 9ICOA 5DBBA 5HP1A 4H4MA 4AHVA 2JEJA 7ICNA 3SUQA 3GDXA 1IKWA 3AVHA 4N41A 4JWNA 3RJKA 3TAPA 4TSXA 8ICWA 4CHNA 1T03A 3U3GA 3K58A 2BR0A 3RAQA 2W9BA 8ICNA 3EW9A 1BPYA 4GXJA 2EHGA 3O4NA 4OJRA 5JS1A 1ZQMA 1Z25A 3SCXA 4FYDA 4WE1A 3UQ0A 2YV0X 3OVNA 4N47A 2QKBA 4DQRA 4QZBA 1BCMA 3SPYA 4CF1A 4J9NA 4GXIA 1BQNA 2HNDA 4M3RA 4J2BA 4XIUA 5KFKA 4KB1A 1ZBHA 5DQIA 2R8KA 3EZ5A 3NAEA 1KLNA 3H8WA 8ICFA 1ZETA 4ECZA 2MAXA 2G8UA 4DTPA 2HVIA 3NGDA 4O3SA 4FZYA 2R8IA 2IHNA 3HP9A 1BPBA 1UWBA 3QINA 3KHHA 2E6LA 3G10A 7ICKA 4DQIA 2BGWA 4I7FA 4KLSA 3Q8LA 4UQGA 3KKSA 3OSNA 4CJ5A 3AU2A 4CEQA 2HHVA 4RW8A 4DLGA 4KKOA 1X9SA 5DBCA 5L1KA 1A5VA 4RG8A 4CGGA 1YTAA 2DFHA 1J54A 2Q3SA 4DL6A 3C1YA 1JX4A 1RYSA 4EBDA 3RMCA 3L2WA 1J9AA 8ICHA 1K1QA 2XGPA 3ISNC 4KLJA 1XWLA 8ICYA 4YCXA 4MFBA 1LAVA 1CZBA 3AA4A 1BHLA 2AJQA 1ZQYA 3RRHA 2A1JB 2IGIA 1LV5A 3AA5X 1LWFA 4GMJB 4FZXC 7ICUA 4HCCA 1BI4A 2DFLA 3HT3A 4DU4A 4M6WB 5KFDA 3V9UA 1JLFA 1CZ9A 4EZ9A 5J0UA 2BQ3A 7ICRA 1RILA 2B5JA 3ULDA 3Q8MA 2FC0A 2YNFA 5KT4A 2VANA 4IRDA 5J2KA 1BVSA 3QZ8A 1U49A 3JPTA 2PZSA 1I3AA 3V6DA 4CECA 3H4DA 3RWUA 1C1AA 3BDPA 4KLEA 5C42A 4QWAA 3SQ1A 4OKKA 2KN7A 3NCIA 4FXDA 4J9OA 4O55A 3QEVA 3DI6A 2BQUA 4I2AA 5CYMA 1VSHA 8ICOA 4JRQA 1EKEA 1TAQA 1VSEA 1S0VA 4QWCA 2A1JA 4YG2A 4M47A 1ZQLA 1RTHA 2OZSA 2V9WA 4DWIA 4DTRA 3OS2A 5KT7A 3T5KA 4RT3A 3L3VA 4LD0A 5KFWA 4FVMA 3AVMA 1XSPA 1NKBA 1SKRA 4FW2A 4FJ7A 4P4PA 4Y1DA 1XU4A 7ICIA 1YVUA 4DU3A 3PR5B 3ZSVA 1JMSA 1JLQA 4B9MA 3OYIA 4LY7A 2FLNA 1IG9A 5J0SA 1A5WA 4OKEA 4JLHA 3F9KA 4J9MA 3G6VA 2BCUA 4O3NA 5HRRA 4KHUA 2NRTA 1VSLA 1UT8A 2RPIA 4CEFA 4C8OA 5TZVA 1S0NA 3NGYA 3V9XA 3JPNA 1KTQA 4CF0A 1XO1A 3V6JA 4FJXA 1IKVA 2FPKA 4Z6CA 1TV9A 4B9TA 1Z00A 3AVNA 2AQ0A 4G3IA 1SKSA 4XRHA 1ZQIA 4BGDA 1KRPA 3ZDDA 4RPXA 4DF4A 5KFAA 5KFNA 2ALZA 3IRXA 1C1BA 3NDKA 4FLTA 2W9AA 3AO4A 3BQ1A 4ED6A 1ITGA 3KHGA 3AVFA 3ASMA 4LH5A 3JPRA 3AVIA 2HHWA 1KFDA 4DSIA 4QZEA 3AO3A 2IDOA 4J2EA 2ETJA 3MGIA 4KN4A 5BOMA 3KK2A 1UT5A 4RQ6A 4BXOA 3TAEA 1KSPA 1HNVA 3IS9A 4NLKA 3PY8A 3ZT2A 2YHBA 5FDLA 5BPCA 4FLWA 2LSNA 1DGSA 2ATLA 1C7YA 2IHMA 3ISDA 4OPKA 2ZTEA 1QSYA 4CFBA 2YKNA 4RQ5A 3DLKA 4CGIA 8ICVA 5CZ2A 2IS3A 5DMRA 3V1OA 3AVGA 7ICTA 3NF7A 3K57A 1X1PA 2AGQA 5DG7A 3TFSA 2W9BB 1EXQA 4ECYA 4O3RA 4J2DA 4UAZA 1ASUA 3ZDAA 2GBZA 3OGUA 4O9MA 2W9MA 5T7BA 3UXPA 4I2JA 5CY4A 4GLXA 2ZE2A 1ZJNA 5KT3A 4DTJA 1X9MA 2DY4A 3M8QA 1ZQKA 3NFAA 1RT4A 4BDYA 3NBPA 3RB0A 2KZMA 1BQMA 1S6QA 4YNQA 4F5RA 1S1TA 4W5QA 1QSSA 2F8SA 4M9NA 4RPYA 3PVXA 1TVAA 2P5OA 4M3UA 4AH9A 3VQ5A 2IC3A 1ZQOA 5L9XA 3LPUA 1Q9XA 1GOBA 4RQ7A 4CIEA 5K14A 1LWEA 4CHYA 4OLAA 4QWDA 3OYCA 5E41A 4UB1A 2V4QA 4FO6A 3PX0A 2UVWA 4ID1A 1IM4A 4CFDA 1BPEA 4NXZA 4IQWA 4KLDA 8ICBA 4C8LA 3QETA 3P83D 1KDHA 1HRHA 1TGOA 3K5MA 3AVJA 1FKOA 1K6YA 3I0RA 1DTQA 1S77D 1BI4B 3ALYA 1XSNA 4DSJA 3RH5A 3OHAA 4KLOA 3QEPA 4DSLA 1L5UA 4XUSA 3V7JA 3ZSQA 2ZUBA 5IIMA 4QW9A 5L1IA 1S1WA 3WNGA 4ECWA 3GV8B 5HHHA 4PQUA 4CEEA 1RDAA 4UBCA 3MR6A 3NF6A 5D3GA 5KFYA 1D9DA 2Z1HA 8ICKA 4E7KA 1B43A 1WN7A 4DL4A 3NF9A 4OLBA 4CJEA 4DFKA 4M9HA 3U3YA 3BQTA 1NOYA 2XY5A 4FJGA 1XS9D 5J0WA 3ZSXA 4O3OA 1S1VA 3UXNA 3M8SA 2ASDA 8ICZA 2G8FA 4E3SA 3VQDA 2NUBA 3V4IA 3LZJA 4TQRA 4PUOA 1CEZA 4J9SA 2PY5A 3IAYA 3B6OA 3CFPA 1S76D 4F2RA 3LDSA 2DTUA 4GW6A 4TUSA 3O3HA 5J2QA 5HMLA 3V81A 1UA1A 2VA8A 4UAYA 1IH7A 3NGZA 4M45A 1WSEA 4CE9A 5C25A 4O5CA 4KHNA 8ICXA 1EX4A 3HVTA 4QZHA 1YTUA 2ZJ5A 1N48A 9ICJA 4FJKA 4B8CA 4DG1A 4I27A 3WNFA 3V6KA 1ZBUA 2GWSA 3OYDA 2AGPA 3OYJA 4CGFA 4CHPA 4BDPA 4HUFA 5DQGA 4KV8A 2ZQBA 4I2GA 4DTUA 2HNYA 3SUOA 4CCHA 1TVRA 1N56A 1REVA 5HHIA 3TR8A 2XY8A 4QZCA 3C5GA 4IR1A 5IIOA 4OVLA 4F4YA 7ICLA 2R8HA 3OYEA 3C1ZA 1KCFA 4KTQA 4RQ0A 3MAQA 4HHTA 3UXOA 5KFBA 3SZ2A 2BCVA 4TURA 1ZQWA 3T5JA 4F4WA 3NH2A 2HHTA 4E89A 1UAXA 3LANA 7ICEA 3T1AA 4MFAA 5J2IA 1FK9A 2G8WA 8ICUA 4I9QA 1S0OA 2IOCA 5J2CA 4F93B 4ZH4A 3H08A 4J9PA 4R66A 2PFNA 3QEBZ 1TK8A 3SQ0A 4J9RA 1XSLA 3L2RA 3QEXA 4CJLA 5KG1A 5IIKA 1XHXA 4KLUA 2YNGA 4I2PA 1NOZA 4CJFA 1YT3A 4E7JA 2P1JA 3UQ2A 1JIHA 3OYNA 8ICRA 4IR9A 5KT2A 2O4IA 4I2BA 1RT5A 3MEDA 4Z6DA 3AV9A 3DLGA 2KW4A 1TL3A 1MQ3A 5DGBA 2QKKA 2C28A 2D0BA 4FS2A 3PW0A 1U45A 9ICIA 3KK1A 4HUGA 3GV5B 4M42A 5DLGA 3K2PA 4I28A 3JPQA 4NLGA 1NJXA 4CJSA 3EY1A 4FLYA 4CGHA 4RUAA 4R64A 4DSFA 3ZSRA 2I5JA 2OWOA 4TUPA 2HHXA 4NLZA 3D45A 3TARA 3KTQA 4TUQA 9ICEA 2BPGA 3F73A 5J2AA 4ECTA 4FK0A 3PW7A 3V9WA 4CJTA 8ICMA 2Q0ZX 5J2NA 4M3YA 4F8RA 5CYQA 3AO5A 4FK4A 3S3OA 2AQ4A 5HNKA 1O1WA 3G0ZA 3GILA 4QOZB 4DSKA 3HK2A 2Z1GA 2P6RA 4OKJA 3IG1A 2Y1IA 4NM1A 3NTUA 4CK3A 3VQ7A 4CJ4A 4Q0BA 1DOQA 2RKIA 2BQRA 1QHTA 1U04A 1BIUA 4CHQA 9ICWA 3OY9A 3V9SA 5J0OA 1Q8IA 3T3FA 4BXOB 3V9ZA 9ICNA 5D4BA 2XC9A 3GIJA 4ID5A 4M3ZA 4KRFA 4AHSA 2ISPA 4CJPA 3JSMA 5DB9A 3PV8A 2D0AA 5EWEA 3KLIA 3C2MA 5HBMA 2O4GA 3KKRA 1RXWA 4UBBA 5KGXA 4KMUA 2IMWP 3PNCA 4FW1A 4CF2A 3QEIA 4NCBA 4KHSA 8ICIA 3G6XA 1TAUA 3RRGA 4CJUA 4KLHA 3RBDA 5D49A 5KFQA 5KT5A 2FPMA 3PUFA 4CESA 8ICQA 4CIFA 2YNIA 1QSLA 5KT6A 2WTFA 2YKMA 4BACA 4DTOA 1XHZA 1VRTA 4FJIA 4H4OA 3QIOA 1BPXA 2J6TA 4DTXA 1TL1A 4KI4A 2ZJAA 1NK0A 2WOMA 1LWCA 3GIMA 3RJJA 3NE6A 2F96A 1A5XA 1JN3A 4FBTA 4EYHB 4Q8FA 3ETLA 4CJQA 4DU1A 1RYRA 1ZQEA 4IFYA 4C8KA 3AVCA 5KG2A 1QQCA 1NKEA 4LSNA 2R7YA 9ICRA 4O0IA 4DO9A 3PR4A 3OS0A 2B4JA 1GOAA 3HXMA 2ITGA 4BE1A 3PMLA 5KFXA 2FLPA 1ZBFA 1NK9A 3KLGA 4C8NA 1ZQBA 3TQ1A 2HB5A 3ZSZA 1WCLA 1MSWD 3QIPA 3VQBA 3FFIA 3LAKA 4YMMA 4M41A 4QZ9A 3DMJA 2ZD1A 3L3UA 5IINA 3KK3A 7ICMA 2RN2A 5J2DA 3ZDBA 1H38A 3E2EA 1RT7A 4J2AA 4KTZA 3MFIA 3Q8KA 3DOLA 4R5PA 7ICJA 5DB8A 1D8LA 2ATQA 3ISBA 5J0PA 1BL3A 4E1NA 1SL0A 3RR7A 1VSKA 4W5OA 4FJHA 4KLMA 5C5JA 5F9LA 4JS4A 4DTNA 4CK2A 9ICXA 4DFMA 4IBNA 1IKXA 3VQ4A 1RBSA 2A1SA 4QZGA 2BPCA 4M2YA 3C23A 1RPLA 2OZMA 3TAFA 4I29A 4ECRA 3MEEA 2G8VA 4QW8A 1TFRA 5L1JA 7ICVA 4K4IA 3FDSA 2EX3A 1ZQJA 3OS1A 4Q5VA 3DRPA 1CUKA 3ZSWA 2W9CB 2BHNA 1S9EA 4P4MA 1ASWA 3FYHA 3M8PA 3OSPA 1TKXA 5KG3A 3MR3A 1S0MA 9ICMA 1JXLA 4B9NA 4KLFA 3HW8A 1VSDA 2PXIA 2ASLA 4Z4CA 3KD1E 5J1EA 4MQ3A 2OPQA 3E01A 1MC8A 4CGJA 1VSJA 3DLRA 4FJ8A 5DKWA 1X2IA 3SQ4A 1KVAA 3AVLA 3SYZA 3WNHA 5DGAA 1NJZA 2R8JA 4YD1A 4K8XA 2KQ2A 5EWGA 7ICOA 4YD2A 2FPLA 3SPZA 1LB2B 3AVKA 4PHEA 3V7KA 5HLFA 5J2JA 3VQCA 4KAZA 3PW4A 2PFQA 4NY8A 4R63A 4IDKA 1HJRA 3KHRA 4DTSA 2R8GA 9ICUA 5KFTA 4QZ8A 1JLEA 4F92B 1B9DA 3SI8A 5DBAA 4M3TA 2JEIA 1ZQAA 2D5RA 1L3VA 2HVHA 4B08A 1C1CA 1U9LA 5DQHA 4F4XA 5KGWA 5J2FA 3C2KA 4YP3A 2FMSA 2E4LA 2IA6A 4FJNA 3T19A 4DTMA 4RUCA 1SKWA 4EEYA 1T05A 2F1IA 3K59A 4FLXA 4KFBA 3ZSYA 2C2DA 3H40A 5J0RA 3EYZA 4Q45A 2E6MA 2XY7A 1NK5A 4DS5A 1ZBIA 5KFOA 1G15A 2JEGA 4CEOA 2ZTCA 3HWTA 4Z6EA 4N76A 5KFVA 4TQSA 3AO2A 2W9CA 4FJ5A 3H8SA 4CEZA 1Q9YA 3OYKA 4DOBA 4FJJA 4FCYA 1RNHA 4YXJA 1IXRA 3ZDCA 3MXIA 5J2MA 1NJWA 3HYFA 3ITHA 1ZQTA 2H5XA 3KLFA 4DLEA 2MUTA 4RQ3A 5L1LA 1QTMA 4PHAA 2GUIA 4F50A 1RTIA 4K4GA 3LZIA 1RTDA 3AVAA 2ZTDA 4F2SA 2YHAA 4IG0A 3SI6A 1B92A 1LW0A 3ZD8A 1WSHA 1SUQA 1Y97A 4IRKA 5DB7A 4B9LA 2FMPA 2IBKA 1HYSA 2F1HA 3Q8PB 2JLEA 4LSLA 3VQAA 4ELUA 3JPPA 1RT3A 2F8TA 4O5BA 4HCBA 2PFPA 3Q8SB 4IRCA 3AVBA 9ICVA 2X6NA 3LP3A 4R65A 1K1SA 2KTQA 1RZTA 2ZUCA 1WSIA 2DPJA 4BE2A 5J0XA 4N5SA 9ICBA 3QLHA 1ZQXA 9ICHA 5EU7A 4O0JA 3RMDA 2W8LA 5IIJA 1NK7A 5CWRA 5DB6A 5HP4A 3MABA 5CA7A 3AA3A 1BCOA 4DMNA 4RNNA 1RT1A 4RQ4A 3M9NB 4F91B 2VA2A 1RDDA 3OHBA 1VSFA 2RF2A 1ZQGA 3RMBA 3JPSA 4QZDA 4QZAA 4PWDA 2HW3A 4UAWA 1S10A 8ICEA 2MUTB 3AU6A 5KFEA 3T5HA 2BE2A 4ECVA 1ZQPA 3NH1A 4JK1A 5C24A 4FBUA 4ED3A 5J2HA 1ZQZA 4J9QA 3ZT1A 4O5EA 5J29A 3BJYA 2B21A 2OPPA 1UOCA 4YR0A 2NRZA 3TWHA 4QZFA 5DG9A 3L8BA 4AHUA 3RMAA 5DDMA 2BCSA 2ZJ8A 1T8EA 3HPOA 1QE1A 4F4ZA 3RAXA 4K8ZA 4XQ8A 3DYAA 9ICLA 1QLNA 5KFJA 4F5QA 3ISCA 3HPGA 4HYKA 4R8UA
chains in the Genus database with same CATH superfamily
1TUGB 4DL7A 3V1RA 4NCGA 4BQLA 2HFSA 5AJ3F 4YOXA 2Y1JA 3I31A 4B9VA 3CD0A 3KJVB 3EWAA 1KLMB 3ZD9A 4QS9A 5A8RA 1FTRA 1AA1B 4NXNF 3TX8A 1WDDA 2HHHF 1PZNA 1FDNA 4DEZA 5GAHP 3O6WA 3TAQA 1FWKA 1S1XA 1U4BA 3D28A 4EHUA 3CC7N 1GMUA 2WK4A 1M90T 4ELTA 1U6ZA 4ZTJA 3VQ8A 2QB0B 4BREA 4YDDB 1S6PB 3PEHA 4DQPA 2BJ9A 2R7TA 3CVKA 4KN7A 3MF5A 4YXMA 2P5GA 4JRPA 5IILA 1T03B 3JSMB 2X78A 3LP2A 4FOEA 1FKPA 4E1JA 2W04A 3BF4A 2W7AA 4OV1A 2MZSA 3HHEA 3A5LC 1IBLK 2FBXA 1UMJA 2FHJD 5J2PB 4KY3A 1SV5A 4W5NA 1M1HA 1ZM3A 4Q8EA 4BC5A 2EK1A 2YJFA 4E1MA 2C1EB 1M6YA 2VJUA 3MPUB 2CYYA 5C2FA 2VQFK 4RO0A 3EE3A 2V8DA 3SENA 3KHYA 3QU4A 3EL2A 3RBXA 4QYZK 1K44A 2GEMA 2K8AA 5ADXH 3UCUP 4OZ5A 1RQLA 9RUBA 5HN0A 4BRHA 2FJVA 4M5HA 2LEPA 4M3XA 5F9NA 4AILC 4EK2A 5HMZA 3CCJS 1T02A 1AB8A 2A2DA 4OJGA 3J8AA 1HNIA 2H65B 1X4AA 2QZ8A 4KB0A 4J9KA 3OXGA 2GW8A 4RT2A 3MEKA 2DNMA 1RBRA 4NLRA 1D9FA 5J0YA 2AXTU 1RAIB 5HRPA 2EFOA 4B9SA 1ZD5A 2XHCA 2J9DA 3O3GA 1WOOA 4LFAJ 1EO1A 4LIRA 5AZIB 8ICJA 3F0NA 2XB2D 1BC6A 1VK8A 4JKGB 1N8RT 4M5IA 1ZS6A 1U0SA 3VGTA 1NK6A 2Y0SF 3CNQP 2LYVA 3D0PA 3U1LA 1IBMF 4OIXA 4UAVA 4DF8A 3MPDA 2P6SA 2F4VK 3C19A 4Y2KA 1TFYA 4JI0J 2MDAA 2V0NA 4RWWA 1VJWA 4UASA 5CJ7A 3C95A 2BKEA 2CGJA 4RBTA 2ZM6F 5KFIA 2G8KA 1X9JA 1XNQJ 1RA6A 2ZNZA 5EX5A 3QBWA 3EGNA 3CXCM 3K5NA 1RWXB 1JLBA 5KFHA 4X5VA 1HNZJ 1SCJB 2NRVA 4C4TA 3LP1A 2XHWA 4BGAA 4PR6A 4TY9A 1ZRMA 2RQKA 1XMQF 4D3HA 1E3MA 2NPIA 1ASVA 3F5AA 3KKAA 3IKMA 4JP8A 1JROA 2IVYA 3EVOA 5A8WB 1HFEL 4IQUA 3TEHB 4FZNA 4ITSA 2IJNA 3T1YF 1C1BB 4J9VA 4I2CA 4Q2LA 4FS1A 5A6WA 2V2ZA 2AJ0A 1VQ7N 5RUBA 2KMDA 4EBCA 4NXMK 4Z4HA 4CHZA 4KPYA 4PXDA 4KI6A 2MQOA 2YPYA 2P9SA 3THTA 4JI0K 4JKAA 1U1LA 1KEKA 3MECA 1IVZA 1NLKL 4ATNA 2DEIA 3RB4A 3VQEA 2XZDB 1FDAA 4O4GA 2JL9A 2YQ3A 4DR6F 3M2UB 2QA4S 4JHDA 2WHOA 2W4PA 1JCGA 2ALYB 3E8OA 1HHQA 2RU3A 2LQ9A 3GFKB 3PX4A 5AI9A 2QL9B 2YHXA 3NAHA 5BXIA 3D68A 3LDAA 3MCNA 4YR3A 1WUUA 4QIEA 4CEDA 4WKRA 4DL5A 3UIQA 4IOAL 1OKJA 3B8AX 3NL0A 5LSOA 2BJ7A 3IM8A 3CCQS 5ETLA 4USMA 2JHDA 3DKDA 1Q82T 2JJ4D 2R2SA 2RDDA 1VQKN 1VI7A 1DT9A 1N36K 2IBOA 4AM7A 1SJRA 3N5BA 3L4PA 2O8CB 4GKJF 4NJ8A 4X64K 2LA6A 4F4AA 3D67A 1J97A 2KG0A 5A2QO 3EGVA 5BYSA 3CJ9A 3VCBA 4LZGA 4B3SK 3LO3A 2IVFB 2PIIA 2EFGA 2V34A 1LOUA 3EJMA 2VWJA 4Z4GA 4B9UA 3C6TA 2DH9A 2J0WA 2E1PA 3D0HE 3MAHA 3NNCA 2HSEB 1WSFA 5KG0A 1X6IA 2HRTA 1UJ6A 3MMBB 3OD2A 3BGOP 1T3NA 2W42A 4YFKA 2WAQD 1J5OA 3QNMA 1FFWB 4G1QA 1ZZFA 1JL2A 2KZ3A 2BOAA 1G7CB 3CC2N 1YBTA 1ZQCA 1RWPB 4RBVA 4F02A 2HHPA 3KUHA 1YRXA 2PFOA 4WF9L 3KZXA 4KLQA 1FDBA 1G3OA 2HHUA 1S6PA 4JI4F 4QWEA 3AHPA 1N8RO 2VICA 2OD4A 3TZXA 4PGQA 4FYXB 3ZC4A 1QY7A 2GQCA 1N34F 1IO2A 2VODA 2J6UA 1X4HA 4M5LA 2M8DB 3H98A 4FKXA 3QJJA 3LP0B 4I2EA 4FLZA 3EXCX 2HQFA 3NGSA 5CR4A 4CJWA 5FD1A 1VLBA 4HT5A 3OVSA 2O8EA 3HX9A 1VC5A 3SV4A 3QT8A 4CO5A 2E5IA 4B02A 2W54A 2AGOA 4ZVPB 3RJGA 3CUNA 2Z1JA 3ET6A 1JWWA 5KFRA 3GJTB 3CM6A 1RP5A 5HJYA 4Y2VA 1FRLA 4CRJA 3DLJA 1LKZA 3J80O 1X9WA 4K41A 2BGGA 4UTGA 3LUYA 8AT1B 3LTOA 1ATNA 2PYJA 5E2QA 1KAXA 4U67Q 5ALSA 3TJ9A 1QQMA 3CC2S 1EAYC 2MSNA 2HHHJ 4LF7J 5BN9A 3PIPL 1NJIT 4UOCA 4FJLA 2ZIWB 2YY6A 2OP5A 1XMOJ 3PMNA 3BSCA 2J5AA 2J6SA 4JI8K 7ICFA 3H59A 3P6YC 1HWIA 1RU2A 4LT6A 3QFUA 3CGIA 2WUSA 4Y0WA 4LSZB 3O9QA 5AQVA 4RNOA 3DLEB 5HRNA 3MR7A 2K7KA 1OSCA 2JDJA 3QGIA 4DX7A 1XEZA 4KGMA 3PLAA 2VG6A 2DB1A 4WE1B 1S97A 3B9JA 4DHYA 2UU9K 3MD3A 1ZAVA 1T0TV 1S6QB 2EC0A 4RQ2A 4DX6A 5E5NA 1MWZA 1XQIA 1PG5B 4ZVHA 1L3UA 2DKOB 2VOPA 4TKTA 4QOTA 1NOMA 4MFCA 3ONNA 4MKVA 3KYLA 5AFUA 3GMGA 4OYPA 1QQ5A 4C4SA 3KLEA 4JWMA 2ZDPA 3R8YA 3A8JA 3GFYA 3K8VA 2LKYA 1KP6A 2QC3A 4NL9A 7FD1A 2ATCB 3CP8A 1KAZA 4X4QA 2U1AA 2ZZNA 3DOMB 3ORYA 2B4UA 4NLTA 2WFAA 3UPQA 1RHRB 2BXJA 4X4NA 1BGXT 4IJAA 4JI8J 5LT5A 1XC9A 3CC4N 3C5FA 3S3NA 2FVRA 5DDYA 1KS2A 2AU0A 1DQAA 5AZIA 3LVWA 4OZLA 1W2IA 1S9FA 2RIJA 4W5RA 2MQMA 2AJFE 3ZTPA 3OYMA 2BX6A 3QFPA 4ZHRA 4GKKJ 3LK9A 4M5DB 3W64A 3SUPA 1E4GT 4IUFA 3ZSOA 3IBWA 4LZDA 5F8LA 3KK1B 1XI1A 2L5YA 5SZTA 4JI2F 4CDIA 3CMAN 3DM2A 4YY3J 4CNQA 3L2QA 1HYVA 5HAOA 2V4JA 2R7QA 2Q0UA 4AHTA 4OJLA 1MU2A 1QQNA 4NLYA 3C6HA 4KMOB 2W3SA 2EZYA 3RU0A 2BCQA 4I2FA 1FKOB 3VAHA 5CR0A 2PAVA 3GYXB 2KDOA 5K9FA 5HQ8A 5ETVA 1XMOF 2E8MA 2ZHBA 2QWLA 3ISND 4KO0A 1WG4A 3L0QA 2XICA 3G4SN 4B3MF 1YIJN 1TK0A 2VKZG 4L76A 1KQSM 3BGLA 3S7RA 2JH1A 2ZH7A 1R8CA 2ASYA 4C4WA 2Y3YA 3HSDA 3UN5A 2IYGA 4C1NI 4GVMA 4A5BA 4I7FB 2EEYA 1MWMA 3H0PA 4BR0A 9ICTA 4PGYA 4KKOB 4C0OC 2Y9HA 4K4HA 5CP2A 3K75D 2PFUA 3HL8A 4QQBA 1E6VB 2DHHA 4HHUA 3JYTA 2KYZA 2G8IA 3MAAB 2EDUA 5KFMA 3TAMA 4GIBA 3TR5A 3VQPA 3TUZC 5DK5A 2K1RB 4PHTX 3C3LA 4ZOSA 7ICHA 2EC2A 3P39A 3CJ3A 4M5MA 2HMIA 2RUGA 4DOAA 2MQNA 3MX2A 2PEBA 1WF0A 3R5CA 5IT9Y 2P51A 8ICLA 2HBZB 4AQYF 4H0OA 5GMDA 3ZT3A 4L3QA 3CJ0A 2DD8S 2ZH1A 1LWFB 3DLHA 4KTWA 2IM1A 2O67A 5DBBA 4AHVA 2JEJA 3SUQA 3MECB 5CHIA 4YOTA 3RJKA 3LDQA 3LYSA 2D0PA 4CF5A 4CHNA 1T03A 5D78A 1M1GA 2V5HG 3U3GA 1J2MA 3UWTA 2BR0A 3KNAA 1UVIA 3CCRN 4K2XA 4DHVA 2OYYA 2AHOB 1HIWA 2K60A 2NRHA 1Z25A 2FGOA 1S1TB 3SCXA 1X66A 4FYDA 1BD6A 5M1FA 3PACA 1ZM9A 2RQ4A 3OVNA 4AE5A 2XMUA 4DR1J 3NGKA 2DBBA 3SFUA 5AQRA 2FDNA 2CQ0A 4NLWA 3SPYA 2HNDA 5LMNJ 2DHGA 2AEMA 3O0FA 3BSAA 5DQIA 1T94A 4NEYA 4ECZA 2XSJA 4Z94A 4AXJA 4P0PB 4DTPA 2E44A 3GB0A 4O3SA 3N4QA 3C65A 2KKPA 2IHNA 2B43A 3HP9A 3KHHA 2ES6A 4ZPTR 3G10A 1JRPA 3MAAA 2M8HA 5IT0A 2R3VA 3FSIA 4ZCMA 4UQGA 3GJRB 3KKSA 2OHFA 4CJ5A 1DARA 4DPTA 5B7WA 5AQQA 1ZTTA 4K59A 1A5VA 3DEEA 2LQJA 3DXMB 3IP4B 4BRDA 4DL6A 3FK4A 2N3OA 3W2VB 2FI1A 4WIIA 2WHEA 4MDAA 5BR9A 2IYIA 1J9AA 3NG8A 1K1QA 2XGPA 5IT9O 1XWLA 4MFBA 1KQGB 2G2ZA 1ZQYA 2C3YA 1Q8KA 2MZQA 2A1JB 2IGIA 4FYVB 3ILLA 3F53A 3FJ2A 2E5LJ 3FRYA 4HCCA 3HT3A 1FJEB 4BRLA 3C8YA 1WD6A 1JLFA 2Q6CA 5J0UA 2BQ3A 1RILA 1RSCA 1YJWN 4NA2A 2AJ4A 3Q8MA 2FHOB 3ICLA 2MZ1A 4P0QA 2YNFA 3QFHA 1SXDA 3N7SC 3DCAA 3ZTQA 3QZ8A 2FHKA 2MKCA 1U49A 1FRIA 2EK6A 5BRDA 4CECA 1FRHA 4KLEA 3JAMU 4QWAA 2CVEA 4XEIA 2OMLA 3B82A 1VQNS 1Q86O 4J9OA 1WELA 3QEVA 3DI6A 2BQUA 4I2AA 3CCZA 2CQDA 4D3GA 3ENAA 1TAQA 4LFCF 1W7WA 5EX0A 4YG2A 4R79A 2QWPA 1IQTA 1ZQLA 2OZSA 2V9WA 4DTRA 2XS5A 1KD1O 4E8UA 4RT3A 4DR1K 4LD0A 5EVZA 4FW2A 1Y3KA 5KAKA 4V1Ak 4BR9A 2JX2A 4O4GB 7ICIA 3KWIA 3AM9A 4BRCA 5MLCV 4KR0B 3TADA 3BZQA 2G06A 2V4JB 3OYIA 4LY7A 1A5WA 1T95A 2YNIB 4O3NA 4LR9A 4DR2K 3JQMA 3PDNA 1DQ9A 1VDHA 4FNHA 4XTTA 2JFDA 2HMXA 4C8OA 4KH6A 5TZVA 1PK1A 5FLXY 1SJ3P 2OI2A 3NGYA 1KTQA 3F41A 3Q2TC 3SQIA 1D8ZA 1RI7A 2DNNA 1OSDA 4B9TA 3GG1A 7AT1B 1O03A 3IR5B 3AVNA 1Q16B 4JKGA 3FEZA 3M6GA 5KFNA 1FESA 3K9KA 4M5JA 1RWUA 1XIQA 2CFXA 2KHDA 2X1BA 3MPVA 1CJTA 2ZH2A 2HBJA 3BQ1A 4IOXA 3DDNA 3ASMA 4LH5A 1IKYB 3SSRA 1KFDA 1N62A 1GX5A 4DSIA 5IT9U 5ALEA 2IDOA 3BH7B 4OJPA 3CWJA 2ETJA 3MGIA 4F0KA 3AO3A 3OL8A 4KN4A 1K9MT 5LMNK 4M63A 4PCQA 3QNWB 2DNZA 5E33A 4USTA 1X60A 4JI8F 2AJ2A 1RTHB 4ZCIA 3L09A 1YSJA 4FKYA 2LSNA 1DGSA 1SH3A 3AD9C 2ZTEA 5AXMA 1QSYA 1X5PA 1YJ7A 1Z1ZA 2HGNA 2XG8A 4CFBA 3V2UC 1F3FA 1T3QA 1S1UB 3DLKA 3QRPA 1T9XA 2GFFA 3O9SA 7ICTA 3QXGA 5EHHA 2AGQA 3TFSA 2CQCA 4PYDA 2VPYB 4TXSA 4J2DA 4NI2A 1NJIO 3DDIA 5T7BA 2D3ZA 3IWXA 5H9FK 3AOBA 4JKBA 1NPKA 1RYUA 1WWVA 2DCLA 4YY3F 4BDYA 2V67A 5JXSA 2K3KA 1E6YB 2JXJA 2KZMA 3IRWP 4YOYA 2P9SB 4FL9A 5AQJA 1QSSA 1AZSB 3IG1B 1JI7A 1SB6A 3D3CJ 3TRGA 3EEQA 4EGLA 1TL7A 1TVAA 5AJ3K 2GHVC 4AH9A 2IC3A 1X4EA 3CJQA 5L9XA 2VBZA 3LPUA 3BUZB 4RQ7A 2OTJN 1KQQA 3OTBA 3AGRA 4QWDA 3DXKB 2RQCA 1MU2B 3M2VA 5C0YA 3AL0B 4FE3A 3L3CA 2V51B 3QMLA 3CDBA 4OHXA 4JI4K 2CWKA 1VQPN 2DXEA 1BPEA 4NXZA 3KUEA 1D0EA 4IQWA 4JI7J 1KVKA 2DNGA 1VQ9N 4DUTA 4KYZA 4JV5F 5H2FU 3S6EA 3K5MA 2AT1B 4TU9A 2YWEA 3EDRB 2VQEK 1K6YA 3F2DA 3BBBA 3RH5A 2K4EA 4YOUA 4O23A 3QEPA 4WQ4C 1URNA 4XUSA 3ZSQA 2ZUBA 1OO0B 1SC4B 2CUYA 4CLYA 5AXNA 1ZAXA 1X4DA 4CEEA 1I6JA 3MR6A 1FJGF 4KH4A 2P9CA 4RKUC 1F2GA 4L74A 2NR0A 1WN7A 2FIUA 4JI5J 3CULA 2F9DA 3C7NA 4IO9L 4CJEA 3A0BU 1RQ0A 3AQEA 2XY5A 4UB8U 3IBCB 3MUVP 3ZSXA 4O3OA 3AB4B 2XI3A 1Q7LB 2KE7A 3M2RB 2N4CA 5F0UA 2AW0A 1KWMA 2PY5A 5B0DA 3IAYA 3BZKA 3LDSA 3HD1A 3O3HA 4JKFA 3DNCA 4IS7A 5HMLA 3VGUA 1FRMA 1F6TA 3OLBA 1U6BA 1WSEA 1VBYA 3HF5A 2R7RA 2MTLA 1T05B 1KN6A 1YTUA 1N48A 1NPRA 1V38A 1X4FA 2J76E 2XMJA 3WNFA 2MMYA 2Y1RI 1HQEB 3W2WA 2HK2A 3CXCR 1Z05A 4BDPA 3W5XA 2KKVA 4DV5J 1HPZB 2E7VA 3PRBA 4M63C 3MK6A 2W2QP 3VV2B 2QARB 3U8XA 5A8WA 1TVRA 2RSQA 3M1FA 1N56A 2ZBPA 2CGKA 2P9LA 5JLFA 3IAM9 2BJ1A 4UF4A 2R8HA 4X66F 3TEGA 3TW0A 1Y10A 4KTQA 5AXLA 1FNXH 4QJVA 3M6KA 1BG3A 1GLDG 1HNXF 3WXMB 3THXA 1ZXIA 2J4RA 4TURA 2B9EA 4F4WA 1RWVB 3UN3A 4E89A 4Y2CA 1FFSB 1N60A 4LQ9A 1UAXA 2GHWA 1V85A 2RHQB 4H0VB 2RNEA 2G0IA 5LSRA 4JI3K 3T1AA 1QE1B 5J2IA 3DOLB 1UZDA 2G8WA 3TQEA 5AK5A 1N5QA 2UV8G 4A8YA 4J9PA 2HFNA 5L38A 2KVIA 4JAXA 4FOIA 1KKXA 1F1BB 2H3IA 1PBUA 3H5SA 4DR5F 1TKXB 1WC6A 3L2RA 4ZVEA 1IG6A 3FC9A 4XH1A 5KG1A 2MQLA 3VAIA 4CVNE 1GMWA 4AQYK 2A1AA 1FJGJ 2MY7A 4I2PA 2P1JA 3UQ2A 1TTHB 4A2AA 1NSAA 1DQ8A 4URQU 2FVPA 5IZHA 2WSCC 3TPQA 1YRUA 3HOTA 2KW4A 1MQ3A 2QKKA 2C28A 2CQ4A 2Q43A 4K7QA 9ICIA 4HUGA 4A5AA 4CJSA 1UQVA 1LXJA 3H3NO 4OPAA 2HBLA 3CQXA 4DSFA 3ZSRA 2I5JA 3P4UB 2I2YA 2HHXA 1O6XA 4ZLLA 3RSEB 1X9XA 4I69A 4FXWA 5J2AA 4ECTA 3PW7A 4ZPBA 2OD6A 3K5PA 4USKA 5CYQA 5KPTA 4XPCA 4JI6J 3GILA 1LOTB 1NGHA 4OZ1A 2Y1IA 1NI3A 4NM1A 5C24B 2BZFA 3NTUA 2UYTA 2PMZC 4CJ4A 2ZKTA 4QU7A 4HAIA 2XMMA 2BQRA 3S6JA 2L9WA 3IG8A 1JUDA 3ZZ0A 2C3UA 2EBEA 3V9ZA 2XC9A 3GIJA 4ID5A 4U8YA 4C2MA 4M8LA 4KRFA 4OLPA 2ISPA 4AHSA 4CJPA 3OW2M 3IXQA 5DB9A 2NREA 2A40A 5BR8K 3PV8A 3KLIA 2R7XA 3C2MA 3ID8A 3MZIA 3SSSA 5HBMA 3RGIA 3VC8A 2WAQF 5KGXA 3H5YA 2HFOA 3H46O 4CF2A 1GX6A 2PMZD 4NCBA 4LVOP 2VBXA 3WXJA 1JLCB 4DV4K 1GXLA 5ALRA 4ZMMA 5D49A 1SIWB 3R1HA 2HI0A 1NZPA 5KPZA 8ICQA 3G71S 4B3RF 4CIFA 1QSLA 2HCFA 4DPWA 3N4WA 4DTOA 2WTFA 2FY1A 4JKEA 4FJIA 3GSIA 3LQVA 3QIOA 1BPXA 2J6TA 2QO3A 3QUBA 1WHWA 4BROA 3NE6A 3UNYA 2QYGA 3PTWA 2DGOA 3LW5C 4FBTA 3GJSB 1NH8A 3LGMA 1S59A 1FWLA 5F8GA 1Z1VA 3CSKA 3ETLA 2HVZA 4HI1A 4JBCA 1RYRA 4CT9A 3SAHA 2N3LA 4RNFA 5JMNA 2ITMA 2R7YA 5KNIA 4DUZK 3A8IA 1FO4A 3QYPA 2UU9J 2B4JA 1GOAA 1SJ1A 4BE1A 2FF3B 3PMLA 5TKWA 1L7PA 2BKOA 2ZZMA 3P4IA 2IA0A 3TQ1A 3RAMA 1CC7A 1UVLA 3NRZA 3D0IE 3ZNUA 1RABB 3LAKA 1C4AA 2GWJA 2PMHA 3V6DB 2ZH6A 3L3UA 3ULEA 1F0MA 4YN3B 3HSCA 2V63A 1CG2A 4LF9J 2RN2A 1Q7YT 5J2DA 3ZDBA 2VQFF 1UJ4A 4L6V3 4KTZA 3OA9A 4B1UB 4CLWA 2VFTA 3VGLA 3C16A 3LVVA 3L7UA 4C1NK 3GYNA 3S01A 1X6JA 3K17A 4JI5F 3OV7A 1BL3A 4E1NA 2QV6A 1R0AB 3IAS9 3RR7A 1QD1A 3OTOJ 9ICXA 2QX0A 4I6MA 2D0OA 4PL7A 4X84A 1WC4A 3F9MA 1RPLA 3H2UB 3TAFA 1RBOB 1W2BR 1CJKA 2G8VA 3L4QA 2MEWA 4IQMA 2EX3A 1ZQJA 2F77X 3FCHA 1CUKA 1DK3A 1RM6C 2BHNA 1SIJA 1FJCA 3PSFA 1Q46A 3SMPA 1VRUB 1RBLA 3OSPA 4C6AA 5F8IA 1IKWB 3D2EA 1F5AA 2JWLA 1HBUA 1GK8A 4DB3A 4CYUA 3D4JA 1BU6O 3HW8A 4M5NA 4DZ6A 4MK7A 3I56S 1VSDA 1UETA 4Z4CA 2RQMA 3BB5A 4LF8F 3E01A 1RTIB 2NYHA 3AD8C 2E1YA 3O4WA 1HQ2A 1VQOS 2ZUGA 1KVAA 2P9NB 3SQ4A 3AVLA 4HKQA 2NRRA 4CZJA 1OUQA 3VEOA 1ZOLA 4YD1A 5LJWA 4DR3J 1JNRB 1PJ5A 1X3MA 4CNYA 3H90A 4EELA 3SAFA 3PJXA 4KAZA 3PW4A 2EW9A 3IBFB 2R8GA 2F3JA 1DY3A 3CIPA 2YBVA 4Y2AA 3UPFA 3DAWA 4FPRA 3SI8A 4PYAA 2GVDA 4M3TA 2JEIA 2WRMA 2Y9TA 3QT6A 2JV3A 4ISFA 4C23A 1UVNA 1L3VA 2CPIA 5DQHA 1G2EA 2V7YA 5J2FA 1R0BG 2E29A 4YP3A 2E4LA 4QU6A 5GIOA 2IA6A 3R7NB 1YJUA 4DTMA 1S6UA 3UDVA 2J9CA 3QFWA 3SEOA 3VWSA 1NWKA 4JKCA 4C3LA 4FLXA 4KFBA 3ZSYA 3DN9A 1VK3A 2P9NA 3H40A 1UZHA 2HBRB 4NRUA 3WIUA 2G2OA 3G96A 2E9ZA 1VQ5N 2LEBA 4FXVA 2E6MA 3QMQA 3O3LA 4HDGA 3U26A 3OW2R 3HWTA 4Z6EA 4N76A 2RRDA 3Q83A 4HT7A 4WYBA 2QE5A 4CJ7A 3BH6B 4CEZA 1RHJB 4FYWB 4DOBA 3PSTA 3ETRA 4FCYA 1RNHA 4YXJA 4K4TA 2KOBA 2QI2A 2DR8A 2HMIB 2BMBA 1HNIB 2E7XA 3HHLA 5LM7E 2WZ1A 1X3NA 4FWNA 5L1LA 2Q1NA 2IVMA 4PHAA 1HBMA 1VR6A 5B0CA 1XMBA 4G1IA 2HIQA 1I94J 1LW0A 1SUQA 1RAEB 2F3NA 1JALA 1IR0A 2IVNA 2F1HA 3Q8PB 2Z2ZA 2JLEA 4LSLA 3SIPB 3VQTA 3BSOA 4H0TB 3VQAA 2F8TA 5LJ3Y 2YB4A 3GR0A 3AMZA 2YN4A 4ZOHC 3PYGA 3LP3A 4XO0A 5AQLA 1WSIA 4BE2A 4QS8A 5E26A 4N5SA 3GP9A 1U2CA 3QLHA 3MEGB 3OBWA 1RWMB 1FD2A 1K73T 3D6JA 3UDCA 4O0JA 4YY3K 4DG1B 5CWRA 5A0LA 3BN4A 5HP4A 3R5DA 2CKWA 4Z37A 1BCOA 5BYRA 2E9TA 1RT1A 4WQ4A 1COKA 3CJBA 1T6CA 4K5RA 3EDQB 2RF2A 1ZQGA 3RMBA 2L3MA 3BY5A 3CCUS 1UCVA 4H4KA 4FF3A 1S10A 5C25B 4OZ3A 2BE2A 2W2PP 2V69A 2A10A 2B9XA 5KQDA 1ZQZA 4J9QA 4IWVA 4IOCQ 4WU2A 5J29A 1JJCB 2B21A 4RL1A 4RLEA 5LJVA 4YR0A 2FVCA 1HNWK 2DGVA 1QVGM 3TWHA 1S72S 3QUCA 4JKDA 3L8BA 2ILYA 3KLGB 1U1QA 5DZ7A 2YTCA 3OTDA 2GO7A 2BCSA 4A2BA 2OKQA 1T8EA 2AX1A 3NNHA 4XQ8A 3TKAA 1WOPA 2AIRB 2XWXA 3VGKA 1QUPA 1PGZA 3PO5A 4RNMA 2MZJA 2YHWA 1WLJA 5C12A 2RD5C 3QIDA 1IXKA 2C3MA 3JPOA 3DU6A 5FRMA 2CRLA 3ZEUB 1DBDA 4DOCA 3RVCA 4QS7A 1SJQA 3ENBA 1VOMA 1CPZA 4KHYA 3BBFA 3PKMA 1HJPA 1C2PA 2BJ3A 4ZIVA 2ASJA 1R8AA 3HHLC 4RW9A 2G4BA 5SWMA 2DGSA 3CMEN 2H51B 3PYDA 1R3NA 4LBHA 4DJBA 3DLEA 1S5LU 1UAWA 1RLDA 3UDLA 4NRTA 1KN5A 2AV5A 1S79A 1EP4A 3MMJA 1RTJB 3IP0A 1WOQA 1LEOA 2BM1A 1M90O 5CYMB 1XNRF 2X7IA 3R3LA 2Z2LA 2ZGYA 5AKXA 1RDBA 2ZJPL 4KPCA 2PA3A 1F5BA 3HM9A 2ZOGA 3ISZA 2HF3A 3NOCA 3MR5A 4OJ6A 4U9RA 4HL9A 2N7CA 3AA2A 2V68A 4R5PB 1RBVA 3NRBA 2P66A 1YITN 1FWPA 3ZX2A 1KBUA 2WOMB 4ZP9A 5FRNA 3W3DA 3EVWA 3QU7A 2DRBA 3FBBA 1BA0A 1VQ8N 3HZ6A 1JLQB 3MXJA 2ZBQA 2DY1A 2WVCA 3MMCB 2I7NA 2P9GA 4KLIA 1CXQA 4BR7A 4BE0A 5ALNA 3ZO7A 4RZRA 2UXBJ 2VG7B 3T69A 3U6FA 5GAEU 1RKIA 1CVJA 4Y2MA 4NM2A 1TKZB 5BOLA 2KHQA 5M1NA 4Y3CA 4FJ9A 2OH2A 2H5JB 4CHOA 3GV7B 3SJJA 1CRXA 1ILYA 3DYAB 3N97B 1RBAA 2E1ZA 3FCVA 5FLXO 3TX0A 1Q86T 2XMKA 5AQKA 2NRWA 5KFCA 3KMQA 4MIWA 5F0XA 2M7SA 5JVGL 4M0AA 4PGXA 2HHHK 5D8HB 1F3VA 1X42A 2J0XA 4DFPA 3TWZA 2OXOA 5E84A 3L7PA 3GL1A 4JS5A 4CLLA 3HP6A 5F2RA 1RT5B 3MEDB 4O44B 1XN9A 4YDUC 1W9HA 3D2EB 2K8GA 3I55N 1NKCA 2V8HA 1IM6A 3AXKA 4DV5K 1NMDA 2RE2A 2MSTA 3BDEA 1KVCA 1HYZA 5ALTA 1DTTA 9ICGA 1D5AA 2WVDA 4NLDA 1SS6A 5E3PA 3D5MA 3H4BA 1Q5YA 1VQ6S 4OYXA 2J8AA 2P9PA 4QIGA 5J0TA 1FVQA 3F2KA 1F2HA 3KK7A 1HLUA 3QT7A 4GKKK 1TUVA 2JC1A 4PL1A 3VGMA 4KHWA 1RG6A 1ZQRA 3DOKA 4F4KA 2OPRA 4ECSA 1ATRA 3MOJB 4E7HA 4PPXA 4CJKA 2F63A 2DKXA 4DQQA 2VDHA 4AHRA 2AMCB 2YMQA 3OTCA 4DQSA 1VRTB 4P7VA 3MXMA 1U25A 3M2UA 4LF8K 1ZXOA 2FLOA 3NGUA 3LWLA 4OI6A 1LXNA 4USHA 1H0HB 2F4VF 5B0EA 4EIAA 3GIKA 1L3SA 5F8HA 2P6UA 2QT7A 1RU1A 2YNHB 2O3DA 4LH4A 4ZIWA 2G2YA 4KLLA 1X4CA 3CFOA 2F76X 1Q81O 5AI5A 4M5GA 4N56A 2A42A 4P2FA 4AM6A 1S7HA 3D6RA 4WJBA 5KFLA 1B3TA 4M7YA 4DR4J 4PXCA 3I76A 3CJAA 3D66A 4WTYA 4RU2A 3DLBA 4CBXA 4CZIA 3B0YA 4RQNA 2DEJA 3LWMA 3KLFB 3I4PA 1Z3EB 1H3DA 1VMBA 2AZ1A 3OYGA 4OX9F 4PPDA 2W24A 1RB0A 3AA9A 5KFGA 2EH9A 1OWXA 2FHJA 3OYBA 5D15A 4M9GA 2HZAA 4JD2A 3A3PB 3WKAA 4R0EA 5KG7A 4HVJA 1UPHA 4FNIA 4HVZA 5IV3A 4AHCA 2RJZA 1CJVB 3JQJA 2UUBF 4B3MJ 1P9YA 4PJ0U 3VA3A 1ZQSA 5J2MB 2PFFB 4Y2IA 4AYBF 4K42A 4MIAA 3NEKA 1HI1A 4BRFA 1F9EB 1AZSA 3M8YA 3NNAA 1FJGK 2GV9A 2C2KB 1VIXA 4QAGA 1N6QA 4EFHA 3VENA 3JAMO 3C15A 1IBLF 3AA8A 1M1KO 5AZJB 3VCDA 4CK1A 4NLPA 4DDFA 1N5VA 2NUHA 4EO8A 4OI4A 1L6NA 1TKZA 2V2KA 4USWA 1D8BA 1AUDA 1AROP 4DX8H 2ZH8A 4L73A 2LYAA 3R5BA 2B7CB 3AJ2A 3KFUF 1GLBG 2ZIXB 8ICGA 2XO6A 5DZ6A 5KQ8A 4P71A 5KFFA 3AN1A 1EP4B 2XLKA 1XNRK 1SQGA 1KQFB 1Z26A 3FKBA 2ZFHA 2R2TA 2GX8A 3N4MB 3M8RA 1LWXA 3IS9B 3LPYA 2CPDA 5AKZA 1DJ0A 3NGTA 4NYFA 4ECUA 2G8HA 3RUBL 1FEHA 1IBKJ 2MA1A 1COOA 4C8ZA 3R27A 1WACA 5KOWA 3BV8A 1NNDA 1RDFA 2BUNA 9ICAA 3FZMA 2LA4A 3NS1A 4OGEA 3HSTB 2Q3PA 2HS3A 1QJHA 1JLBB 1LFPA 1TV6A 3ONQA 4W5TA 1Q79A 4KHPF 5A2QY 2DNYA 3RTVA 3KVGA 5IWAF 3VA0A 1P1TA 3MMAA 3RJIA 3CG7A 5D46A 4ZK7M 1UP1A 1VQ5S 4U7BA 3FCWA 3MWPA 2VIHA 5AQIA 1HEKA 4MAKA 1NBEB 8ICTA 1BWVA 1RA7A 2OSQA 2YTUA 4IOCL 3C2LA 4ZVTB 4XA5A 1FXLA 3O1BA 4I67A 1NCLA 1MDUB 2HAIA 3VGVA 1I39A 5HL7L 3FUYA 1N5XA 1OH5A 4PEOA 1H1VA 4GC7A 3UE2A 5CHCB 2FXUA 3D1OA 3LL3A 4DV7J 2ZWPA 2JRSA 4RCHA 1Z4NA 2JRZA 1G99A 2G0AA 1L7MA 1U1MA 3I9V9 4MKBA 4CNZA 2K8CB 4EFAC 2E8OA 3TADC 1LK5A 3HFKA 2LDIA 4RQ8A 3ETOA 3NH0A 3RB3A 2DY9A 2OFHX 2DRDA 5B0GA 1NGAA 5HMXA 4OYBA 2KT2A 1BPZA 4DOZA 1T9WA 1U2RA 1M5SA 5LL6Z 1XBWA 4ZPCA 4LF6F 4LMZA 2KKZA 4NLSA 3QLHB 3MPYA 3MEGA 4JV5J 3VQ9A 5KI6A 5A0YA 5KAIU 2YNHA 3EN9A 4OHWA 2RUSA 1WG8A 2CDQA 1YKWA 4W98A 4GXKA 5ELZA 5L39A 1V6HA 3VEWA 2M0NA 1RT6A 3C94A 4DR7F 1DLOA 1NSQA 2XS2A 4KV8B 1HI8A 4DUZF 4B6JA 1HQEA 4LQ3A 4UOHA 3TANA 3ZZZA 1OIAA 4LVNP 2GO9A 2KVCA 3QDKA 2GTDA 2JH3A 4L72B 1YDLA 1KFSA 2JH7A 2IMOA 4TU7A 1FXXA 1PAEX 1WDTA 1VJ5A 4PRFA 3RH4A 4YB5A 4N77A 2F1FA 2QWNA 4FZZA 4XDDA 1T3VA 2Y9UA 4ED1A 4OJ1A 2BDPA 5C2CA 5KTQA 3LDLA 5JUMA 3ZDEA 1RCHA 1SAZA 1RADB 5IWAJ 4BY9C 1RXVA 3TUPA 4LVSA 1ED1A 4FWOA 3H7IA 2QA1A 4IZ9A 3NY0A 2AJ1A 3GFHA 4O44A 3T6BA 1FEZA 4KB7A 2XCPA 3SQ2A 1OXJA 1T4GA 2KP7A 2MQPA 2F4VJ 4CJRA 2W8KA 3K8WA 1NGBA 5IM0B 3KBBA 4BWMA 3MDCA 4ICLA 4TYAA 4DU7A 3HPHA 4F5PA 2HK3A 5IIIA 3ENVA 5KG5A 1ZJMA 2HRYA 5GADP 5HK4A 2CJQA 4PH5A 4HDHA 2MB0B 4NLVA 1J5EJ 3EPGA 4F5OA 2NRXA 2VFRA 2XYGB 3V4MA 4HTJA 1Z2ZA 4IO9Q 2VWKA 1C1CB 2QJ3A 4IG3B 2EKNA 2YCHA 1SZPA 2RP5A 1QS4A 2UVVA 2BPFA 3D1QA 2ZOFA 5F8NA 2ZBCA 1V4SA 5J2BA 1A76A 3GIRA 1KLMA 3ELHA 3CEDA 5L46A 2HIYA 4EU0A 2P9IB 3AT1B 2E9RX 1B9FA 3D6MB 4CTAA 2HBQB 2QLWA 2F8MA 5AE3A 2YKNB 1ZPVA 3IRUA 5C2DA 1B70B 3P96A 4IEEA 4FWPA 1A0OB 5H9FJ 1TAMA 2UUCJ 1S5ZA 3LPTA 3NBPB 3E01B 3IMXA 3MGHA 2FC9A 3PYFA 5I42A 1Y11A 1JXBA 6FD1A 1ZQVA 4WKYA 4AQYJ 2DH7A 3VVUA 1RQNA 4JYAJ 1HWKA 2Q66A 3VF0B 3KJNB 7ICNA 5CYQB 2DPNA 1IKWA 3TAPA 4FN5A 8ICWA 3MXHP 2W11A 1TVRB 7FDRA 1UW4A 3C16B 2Q79A 1OPIA 3CD7A 1K0TA 3C6AA 8ICNA 4FPAA 1BPYA 4GXJA 5AIAA 4ES3A 5GAEI 4OJRA 3J7ZT 4A8KA 3UQ0A 2C3OA 3HVTB 2O6KA 2QKBA 4A8FA 3Q8UA 4QZBA 2EXUA 3NVWA 3SQGA 1BCMA 2P9UA 2LQ8A 4GXIA 5AQUA 4NXMF 1K5OA 5KFKA 3Q22A 1ZBHA 3EZ5A 3H8WA 4U8VA 4LC9B 2P9LB 3M1VA 2CPJA 4C4RA 1ZETA 5EE9A 1IR2A 3SSQA 2HVIA 5ALFA 3GZFA 2W4DA 2HMPA 2NYVA 4BR4A 3QINA 4U95A 1IV8A 4ZVOB 4KLSA 3NWGA 4NA1A 3OSNA 3AXMA 4ERDA 2XZTB 4CEQA 2LXIA 4DLGA 1TQLA 5DBCA 3G82B 2FE9A 2ASOA 4CGGA 3ZLJA 1J54A 3FQKA 3ATVA 4K25A 3PIOL 2G5IB 1NGDA 1RYSA 2HLUA 3KKAC 3L2WA 4IC9A 1OH8A 3KWGA 4KLJA 8ICYA 3TNVA 3UN2A 1LAVA 1BHLA 3MX5A 1PJ7A 5AQOA 1HKAA 2BDUA 1DKGD 4B3TK 1IUJA 4BC9A 4L3NA 1I51B 5CD4H 2YH1A 2RHFA 3BSNA 4HR2A 4GMJB 4RWTA 7ICUA 2DFLA 1H7WA 3CMAS 3B8HA 3GONA 7ICRA 2KG1A 3CJCA 1SJ4P 2DNRA 5KT4A 2VANA 5ADXA 3KDNA 4IRDA 4DV2K 4RJVA 2RLTA 4BRAA 3JPTA 2PZSA 1BA1A 1RJJA 3BDPA 3SK3A 1FFVA 3CPEA 3SJHA 4IKAA 3QRQA 1GMWD 4YORA 8ICOA 2DGWA 1EKEA 3UKUA 1VSEA 1M5KC 1FERA 4M47A 1O08A 4LBPA 1BE4A 2PN6A 4PPZA 5AXKA 3T5KA 2WW8A 1I94F 1CJUA 2W2MP 2VPXB 4FVMA 4CLFA 1GLCG 3MMVA 3AVMA 5C10A 2A6AA 4HEA9 2Y0BB 1Q18A 2HZVA 4Y1DA 1YVUA 4DU3A 2PE8A 2R7VA 2E1FA 4B9MA 1NDLA 1Z19A 5B66U 3OLAA 5J0SA 1NZAA 1HYSB 1IG9A 4DPOA 1LQ9A 3AARA 1A9NB 4J5OA 3R8EA 1YITS 2XS7A 2QTDA 4KHUA 3N0VA 3QT5A 3D2FA 4GVEA 1FE0A 2KXNB 5IC6B 2W1BA 3QU5A 9ATCB 4CEFA 3QWUA 4JHDB 2ZH9A 4A46A 4NEZA 1S0NA 4ANDA 3O6QA 1R8HA 3HI9A 4LF6J 4G9BA 4HH1A 4P10A 5LMUF 4FJXA 2DNOA 2I5HA 5IOLA 2W2NP 2FPKA 1TV9A 2Y8YA 1DURA 1Z00A 3H45C 4G3IA 1SKSA 3BZCA 1KRPA 4MHVA 4RPXA 1RAFB 3QX7A 2ALZA 3SCJE 2YWHA 1YVNA 4JD2B 4FLTA 4U67L 3WK9A 5M1KA 4U6PA 3K2YA 3KHGA 2FJWA 3AVFA 2DXFA 4LSNB 3DM2B 4W90B 3I55S 4QZEA 2BV3A 3BS9A 3A4TA 3MUTP 4CT8A 4C11A 2KL8A 4EI2A 2B8PA 4RQ6A 4BXOA 3TAEA 3FGVA 4C7QA 3BQ7A 1S9GB 1IJJA 5AQTA 2QIFA 1HNVA 2GNKA 4NLKA 2UXDK 3ZT2A 2YHBA 1VJQA 2VOOA 1D3WA 5BPCA 2DIVA 2OEJA 2IHMA 4OPKA 2F8LA 1CULA 4CDGA 4BG8A 4WCEL 2YKNA 3EWGA 2BRKA 4C0ZA 4RQ5A 8ICVA 2VHGA 5CZ2A 2IS3A 1V9OA 2FZCB 1RLCL 2WB1F 4PWWA 2ZEJA 1DZ5A 1MMNA 1H74A 4ANEA 5DG7A 1EXQA 2KM8C 2HWIA 4JI6K 1PJ6A 4O3RA 4A8XA 2XSJB 5AK6A 1UEKA 4G9ZA 3EXYA 4DR3F 5AM0A 5F3XB 4I2JA 4GLXA 1ZJNA 1UFLA 3T1HK 3HHDA 1X9MA 5AICA 3M8QA 1EIYB 5DM7L 4ZCLA 3C66A 3K0JA 4RBUA 1VHXA 2D7SA 3CJSA 4F5RA 1S1TA 1HBOB 2IAJB 2LFVA 1ZQ1C 3VQ5A 1ZQOA 2J7KA 2O1PA 1J2VA 1OY6A 4CIEA 5AQGA 2JLGA 1PVRA 1SH0A 4KAIA 5E41A 2V4QA 3C29A 3GFXA 1ZD4A 4FO6A 3PX0A 4ID1A 4NWIA 1APSA 1WBBA 2R2UA 3DXMA 4DCPB 1Z1BA 4XAKA 1EZZB 2BRLA 2KI2A 4M5KA 2R18A 4C8LA 3N6MA 3QBXA 1TGOA 3Q86A 2V8PA 1DTQA 4ZVSB 3NRWA 5LJ5Y 1L5UA 3V7JA 2MU2A 4P0PA 4QW9A 5L1IA 1S1WA 3ZETB 2Z2YB 3KUGA 2XBPA 1MLAA 4QIWD 2CJ9A 1HD0A 4OZJA 2CZ4A 4CO1A 2ZITA 5KFYA 4XH4A 3F56A 1B4FA 4PABA 3AQPA 2HGMA 4E7KA 3WC2A 3D7EO 3UFCX 3L5KA 1NB7A 4IFEA 3NF9A 1F44A 1AXQA 1FT8A 5C42B 1KTVA 2D8CA 1JLFB 1HWJA 2GVDB 4I6AA 4O8UA 2ASDA 3M8SA 2RT3A 5HP1B 8ICZA 4E3SA 3VQDA 2NUBA 3CJ8A 4TQRA 4N8NA 3RW7A 1Q5VA 1R6YA 2DTUA 3DXSX 4TUSA 2YJEA 1BY9A 3V81A 1UA1A 1NGGA 2VA8A 1FNOA 3R7SB 4C7YA 3NGZA 5ALHA 4O5CA 4KH0B 4YB1P 3BR9A 1EX4A 4QZHA 3VAMA 1B0XA 4FJKA 4CLUA 4DV6J 4I27A 2G9OA 1UKUA 1ZBUA 2O8DA 3OYJA 4ER8A 4LF9F 3UCGA 1RGVA 3CE8A 4CHPA 1XMQK 1LK7A 2KEYA 1PYSB 1P8GA 2OUGA 2GIRA 2ZQBA 4DTUA 4M95A 3M1YA 2HNYA 4C98A 3R97A 3CD6S 2EZZA 2OHDA 1WUDA 3HI0A 3IC1A 1GTEA 4RW6B 1REVA 5HHIA 3IM9A 3TR8A 4H0XB 5E7OB 2KHVA 3THYB 3OPKA 4CZKA 5ETRA 3FBFA 2QWOA 2XVTA 1Q8LA 1VGYA 3I96A 3MAQA 4CO2A 3UXOA 5KFBA 3SZ2A 3I82A 1HI0P 4FF4A 4UZCA 3NH2A 4ETXA 2AP6A 1BQNB 4CE6A 4KC5A 2CDRB 2E1EA 5E0OA 1X5OA 3WIVA 2VCPA 3E9LA 4I68A 3W60A 5FP0A 4Y2JA 1N33J 2DIUA 4CIOA 8ICUA 4I9QA 1L7OA 5J2CA 3E58A 4ZH4A 4ZVGA 4DR7K 3U9ZA 3CD6N 1RAGB 2BBEA 2CRXA 4R66A 3WK6A 2JOQA 3RJMB 5AKGA 3UO0A 2YNFB 1CS4A 1XSLA 3CO0P 3R6MA 1NXIA 5IIKA 1N0VC 3TACB 1SJFA 2HS0A 2X1GA 5M2PA 1R8BA 4ZP8A 3P31A 4NMXA 3OYNA 5JU5A 1E6VA 5IC4B 1YJRA 3SFGA 3HT0A 3PEJA 3EKSA 1IBMK 1NU4A 4NI2B 5I3QA 3IN5A 4L75A 1RT5A 2CQBA 4CF3A 3MEDA 3JXOA 3PW0A 1C0UB 1U45A 3THYA 4IL6U 3C46A 2GC8A 1QTNB 4X62K 3K2PA 2IVPA 2FB0A 4NLGA 1NJXA 2IRUA 4BQZA 1N5SA 2LM4A 2EAMA 4CGHA 2WB1D 5LMNF 2I7PA 4DV7K 5HATA 1XNRJ 4TUPA 1VC6A 1U1NA 3TARA 3BS5B 3KTQA 9ICEA 2HFUA 3AJDA 3V9WA 5M1PA 5J2NA 1ROFA 2E1RA 3S3OA 5HNKA 1PK1B 1O1WA 4QOZB 1YUWA 2H4WB 3HK2A 2Z1GA 1RDUA 2P6RA 1C0TB 3IG1A 5DDOC 2VYPA 3CT9A 4UUWA 3VQ7A 3F5EA 5AK4A 4C3KA 3Q8VA 5BYQA 2RKIA 2KT5A 4CHQA 3KK2B 4LFBK 4IO8A 5LMUJ 2GGPB 3T3FA 2PC6A 2EG1A 3MM8B 2XEXA 2Z30B 2XLIA 3ZNJ1 4DPUA 4KHPJ 3J81Y 4HLBA 1N5YB 2BE2B 2QG9B 3NKYA 1S4EA 4NX9A 2Z2MA 1JB0C 2E88A 4OHZA 2B9WA 2O4GA 1RXWA 4UBBA 2E2OA 2IMWP 3ID6A 3PNCA 4DX5A 1TFWA 5HO4A 4KHSA 4ZPDA 2UUAF 2M3DA 5KT5A 3PUFA 1VBXA 3D1HA 4CH7A 2WF5A 1FXDA 1UTAA 1S49A 5KT6A 4BACA 3QJLA 2KJWA 1CSJA 2W6LA 4DTXA 2WF6A 3HSGA 2QWQA 3EVMA 2WOMA 3GIMA 1L8OA 1WC3A 1JN3A 3DRSB 2Y8WA 4OJHA 3CCTA 3Q24A 4DPXA 3C14A 4CJQA 1FE4A 2J7UA 3TTDA 4C8KA 1M5HA 1QQCA 9ICRA 2JHEA 3THWB 3OS0A 2VJ5A 1FX4A 1MROB 2YX4A 4GVBA 3HXMA 4Y34A 1XUPO 3BS7A 2B4OA 2YWGA 5KAFU 4ETZA 5J8YC 2EG2A 4G65A 3MM9A 1MSWD 2CQHA 4OV6A 4YMMA 4RW8B 2FJDB 1G4CA 5GAHI 4M41A 3DMJA 5AE2A 3U1MA 3VF2A 7ICMA 3OPXA 4CZEA 1H38A 4TY8B 3MFIA 1SQFA 5HVFA 2ABYA 3H42A 2KJ9A 3DOLA 4NLQA 3ISBA 3VOVA 2CQIA 3D6FB 2BANB 2DK2A 4TVAB 1VHIA 2VASA 1Y3JA 2A5XA 5LOQA 5F9LA 4DTNA 4DFMA 1IKXA 4QIVA 4ACOA 5J8YA 4TNOA 5GTHU 3C23A 4ECRA 2GO8A 1HR0K 1F60B 3CTRA 1R43A 3CCEN 5K8MA 3FDSA 4ZLPA 4MJKA 3ZSWA 2W9CB 3GR1A 2H5IB 1H2UX 1S1VB 1VQ4N 1S9EA 4R0JA 3K1ZA 3ILOA 2EFNA 4P4MA 3W8PA 1FCAA 4LJMA 1VIOA 5AM2A 1PYTA 3UE5A 4HH0A 3MR3A 9ICMA 2C2ZB 4G1QB 3QAUA 5A8RB 1L3KA 2F5GA 2XWYA 3MHYA 2PXIA 1JCEA 3KMSA 5J1EA 4H54A 4LF8J 2AEJA 1VSJA 4FJ8A 2NLWA 5DKWA 3NVKA 2YMLA 2VBYA 3WNHA 2QFIA 2E8PA 2NXEA 3T9ZA 2R8JA 3HHLB 3MMAB 4K8XA 2FSNA 4KRWA 3I0RB 4FVCA 1H6KX 3V7KA 2CPZA 5HLFA 4NY8A 4R63A 4DTSA 3EM1A 3UMBA 2G09A 4JI1F 9ICUA 3M30B 3IWNC 4JI1K 1JLEA 1DFDA 1B9DA 2ROGA 5DBAA 3JTNA 3QBCA 3EMTA 4EMDA 3MDQA 1ZQAA 2D5RA 1R6VA 3KJFB 4B08A 5D0EA 1SXLA 2LQ5A 5KGWA 3PFEA 2NNWA 3A3OB 1AQ6A 2Q2RA 1RTZA 5AHXA 2FMSA 3MCPA 2VV5A 3MM5B 1G1XA 4G1PA 3T19A 5HMWA 2D3UA 5BRHA 2EPIA 4YUDA 3KD3A 2NZCA 4FWSA 4EEYA 3DWLA 4EO6A 5J1EB 2F1IA 2VH7A 2ZDOA 1NGIA 1N32F 3O9TA 2HQDA 4DV0F 4PZVA 2A3ZA 3BM7A 4ZS6A 2UXDJ 5J0RA 2WB4A 3UVJA 4X4UA 4JI6F 5AQFA 5ALPA 4ICLB 1NK5A 3ZTSA 2YH0A 4FZMA 2WONB 5KFOA 2BTFA 2JEGA 2APOA 1ZM4A 5AM4A 1U1PA 5AQZA 3HJEA 4TQSA 3OUYA 1KAYA 3G6ES 4WFZA 1FX2A 3SMVA 3H0MB 4HI2A 3KFWX 3G4SS 5K5MA 1URJA 2H3VA 3ZDCA 5J2MA 1SWVA 2KLAA 4DV1F 4A8EA 8RUCA 3M3ZA 1RACB 3TVYA 3CD5A 3FRZA 4RQ3A 1QTMA 4IJNA 3IG5A 2ZOMA 4IOBA 5KL8B 1E6YA 5HR6A 1RTIA 4GO5X 4K4GA 4JYAF 3LZIA 2A1BA 4IG0A 2YHAA 3I5BA 1Y97A 3ZD8A 1WSHA 3VAJA 4GY2B 4ZA1A 3OVAA 1QZ5A 4USVA 2K1RA 2FMPA 2ZE2B 1GNKA 4ELUA 1RT3A 1Q7YO 2WSFC 2XMWA 4GMKA 2B56A 9ICVA 1GH8A 2BE7D 3CF5L 6AT1B 3NWRA 2C2MB 4R65A 3ZZTA 1F0XA 3OBIA 1RZTA 3BREA 4US9A 2DPJA 2MKKA 1AT1B 3SBMA 4B3OB 2YVSA 9ICHA 1OMSA 5EU7A 1CQNA 3UVJB 2MQ8A 1S1XB 3RMDA 4MDBA 2FQQB 5IIJA 1NK7A 3AB2B 5DB6A 3BYRA 3MABA 1MROA 2O8BA 3W9HA 3A8KA 4RQ4A 3JSBA 2UXDF 2I1RA 1G6BA 3OHBA 3DGPB 2AF6A 3PRVA 3E3XA 3VEYA 1KNZA 8ICEA 2MUTB 3T5HA 4ECVA 3IRXB 4RW9B 3CJRA 5C24A 4FBUA 3NMUA 1F9FA 4ED3A 2BH1A 1MWKA 2ESEA 2DNHA 3ZT1A 5EN1A 4OJ5A 4O5EA 3TYTA 4U96A 4FZLA 1TYQB 1UOCA 1ZPWX 1QCKA 4A59A 2VQFJ 2M2BA 4OZ2A 2CNLB 4OO1J 3HFVA 4C3MA 2ZM6K 3ZXWA 3RMAA 1NHUA 3DXBA 2LMRA 2ZJ8A 3RAXA 2FZGB 1S9EB 1QLNA 3JQKA 2Z8QA 4HYKA 1ZQQA 1UJ5A 4BDZA 1YI2N 3QGPA 5HROA 2CA9A 2A6OA 4O4RA 1IJEB 4I2IA 5D0RA 3BYPA 3VAGA 2CQ2A 2CPFA 4OL8A 1SL2A 1U1KA 2G1HA 4F04B 2DFFA 4QYRA 1OQ3A 3LP0A 3JB9k 1EXNA 4Y00A 3M7DA 4WFBL 5LL6d 5ALDA 1HMVA 3S3MA 3E0FA 4JN4A 4F0HA 2JEFA 3S9HA 1UVJA 2HOQA 2MGZA 4FM2A 1IBKK 4YB7A 2EI5A 2UXCK 3HVAA 4B1XB 4YDUA 4FO0A 2EAOA 1WI6A 3PW2A 4H03B 4QYZJ 1S3XA 1BO5O 4PKGA 2O8DB 2QFJA 3OBYA 4QR2A 4JEPA 2XHBA 2V9KA 1MN8A 2MSSA 3ICXA 3Q2SC 1DRGA 4CFAA 3OXLA 1JLCA 4DFJA 4AFFA 2QXFA 1NU0A 3TFRA 1XJWB 4DSEA 1KHWA 2X6SA 3CM5A 3G86A 3CHWA 1T3OA 1RCOB 3HKWA 1RZMA 1D09B 1AFJA 1NAQA 3I5AA 5ETMA 3RRKA 1DGKN 2F4FA 2GELA 5M1OA 2MRLA 1J6ZA 4B8AB 2ZD1B 1E4FT 2VG6B 1MNEA 5A6PA 5B08A 4I9LA 1TKTA 2DT9A 4DV3J 7ICSA 1IV0A 4LF5J 4RX6A 4UARA 2BEFA 3THVA 4PHDA 2VGMA 1WWUA 3KD5E 3DRPB 4QCLA 5GAGI 1UHUA 5IWAK 3KLHA 3DOKB 4I2QA 5E3AA 4B3SF 2AEFA 3AODA 3SR6A 5LXYA 3NF8A 4N8OA 2ZIXA 1NK4A 1HD1A 3CO9A 3RJEA 2VC0A 4KLGA 5B09A 3EE9A 1CS4B 2HVEA 2QA4G 2W6KA 3O3FA 1B7YB 2WVEA 4IKFA 1UVKA 3F2BA 3L2UA 3QRRA 4YVZA 1ZOTA 3DGVA 2QWRA 4H4MB 3D2NA 1VRUA 3T1YJ 1H72C 3K7RA 3DRRA 2K2PA 1GEHA 2RDIA 2I0XA 3Q7BA 4AYBD 4PA1A 1ZQUA 1CJTB 2F7VA 2R7UA 3QUTA 2WSEC 1TR0A 3SCLE 2A1RA 5HQLA 3GU3A 2HQ3A 3M32A 3N01A 3O44A 2OTLS 2WVBA 4RW4A 4O3PA 3HX0A 3FNNA 4M04A 4MFBB 2H3QA 4B1WB 2W3RA 3T41A 1W0HA 4KLTA 2KFZA 2VD3A 1J53A 1I94K 4PG6A 3RJHA 4UW9A 2RDJA 3IHQB 1L8LA 2YKOA 3HBTA 5J2EA 5KL1B 3L9ZA 4DU8A 4JI2J 3L4BC 2MLYA 1X40A 4DQ8A 3MM8A 4ZDNA 5IXUA 8ICCA 4FYYB 3OFGA 4X64J 4PZNA 4CFCA 2VA3A 4I0WA 1WSJA 3VF4A 3R1XA 3QERA 1CJVA 3E9PA 1C0TA 1C4CA 4ZPVR 3A2FA 4GV6A 3TUIC 2LDYA 4JB3A 5HOOA 4IQTA 1KW4A 3IR7B 4Y1CA 1BMQB 3NMAA 1FTCA 4KITB 4QNLA 4M9JA 2RQ5A 5AM1A 4ELVA 2QLBB 3ZX0A 3G8QA 9ICSA 4EUVA 1PYOB 2KJ5A 2IC3B 5DM6L 4OPJA 3G8TA 4ZVUB 2WONA 3MGVA 2FMQA 3M8ZA 2HHQA 3KJVA 1RE1B 4GFJA 2UVUA 4K4SA 3Q7CA 3A5NC 4DV1J 4DV6K 4DCOB 1UFKA 4PG8A 4CD3A 3H25A 1SC6A 4OI3A 2DWQA 2R7OA 3TAMB 2I6WA 3NVVA 2HOIA 2BA9A 3JXUA 1ZBLA 1DRZA 3V7LA 1S99A 4Y6IA 2LVWA 4ZVFA 1Y7PA 1HBUB 4NLCA 5G0RB 3OTQA 2I9GA 2KT3A 5KRTA 5AKIA 4C8YA 2DGXA 2HBYB 2A6MA 3MTJA 4PAAA 5BPNA 4M5DA 5AI6A 3FFKB 4UB5A 2YKPA 4GNIA 2X74A 1N2XA 4YQWA 2FLLA 3BP8A 1X4GA 3I1YA 3FLCO 3ZETA 4O5KA 8ICSA 4U7UD 2IFXA 4ZPAA 2DGUA 1MWQA 3OYHA 3MBYA 4L8RB 3BQ0A 2LXFA 4JI2K 4J90A 4CM0A 4CEAA 2FGCA 3LM2A 2MQQA 4DV1K 2ZXHA 1P90A 2HAFA 1RDRA 3CJTA 5F1XA 3E1YA 4Z7YA 2LMIA 4B3OA 1MW7A 1NRKA 3QYYA 2YY3A 3I6PA 4S0MA 4E7LA 5BPMA 4RW6A 1REVB 4B3MK 4BBYA 5CZ1A 3LAMA 4Q44A 2EBGA 3QUQA 3GG4A 3GQCA 4GO7X 5AQYA 5F41A 5KRSA 3MOZA 3HO1A 4NLNA 3BGRA 3QO9B 2K4PA 3W61A 4NZ7A 5JJBA 1SC3B 4IFVA 3SXLA 8ICPA 2FBVA 5DM7Q 3MM7B 2XM3A 4CI0B 2WCXA 3CRXA 3TZYA 1F21A 3KWMA 2NO5A 2ZUDA 3PNIA 4E19A 5KFSA 1JKHA 2VG7A 3FEXB 1VCTA 4IFYB 4OYWA 5C15A 3CQ8A