4B9TA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -dc basepair in the post-insertion site.
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9tA01
2HMIA 3ZDEA 4KB0A 2R8KA 4F92B 3NF9A 2UVVA 3I0SA 5KFMA 3PVXA 1ZQYA 4PUOA 4E7HA 4MF8A 4KI6A 4KLEA 3DRRA 3ZCMA 5FROA 4F3TA 5K14A 3H7IA 3MGIA 5KFGA 4E1NA 8ICTA 1NJWA 4LH4A 3GQCA 2I5JA 1JIHA 2X6NA 2BGWA 1RDCA 3O4QA 4J9LA 4NCBA 4M3ZA 3QINA 2HHWA 4NLGA 4FBTA 3P1GA 4RZRA 3TAPA 4DMNA 1B43A 4YR3A 3SQ2A 2IOCA 5DQHA 4DU4A 9ICBA 9ICAA 1H38A 3LANA 4C8LA 3H8WA 3OS1A 4EBDA 4M47A 1ZQDA 1HMVA 4CIGA 4KLHA 3MEEA 4N41A 1MC8A 5KFIA 2BCRA 5J0TA 4QW8A 3MXMA 2YNHA 3HPOA 3RR7A 2ETJA 1ZQEA 2C22A 4LSNA 5KG3A 2AQ0A 1RPLA 3TFRA 3ISNC 4C8NA 4DSFA 2IMWP 3V72A 4F2RA 2MUTA 4Z6EA 4ECWA 4OPKA 3U6FA 2QKKA 9ICOA 2FMPA 1ZQMA 5KFYA 2XGPA 3AVJA 4CFAA 4HCCA 1N48A 3V81A 3K2PA 3VQQA 9ICTA 1TK0A 2RDJA 4IG3A 1XU4A 4FJXA 1U45A 4ECSA 1B22A 5KT2A 2HVIA 3C2MA 4YCXA 2FLNA 2DPJA 1QHTA 3ZT3A 5J0RA 4CJ4A 1BI4A 1WAJA 4ELTA 4EEYA 4RW6A 3PY8A 3VA3A 3QEVA 4CIEA 2HW3A 3OSNA 4F5NA 1AROP 4J2BA 2C2EA 1RBVA 5J0UA 3OHAA 4K4HA 4IQUA 4I2QA 4K8ZA 1NJXA 4XQ8A 4DOBA 4DS5A 1U47A 2HB5A 3ZDAA 4LVSA 1EX4A 4B3OA 5J0XA 2ASDA 4DO9A 4NCGA 3P83D 3GIKA 5HROA 4FK4A 1L3VA 1L3SA 1WSHA 2KZ3A 4F93B 3VQ9A 4IKFA 3V9UA 4Q5VA 2YHBA 1S6PA 4PQUA 1UAXA 4DTXA 1HYVA 4CF9A 4J9PA 3AVGA 2BHNA 4QZAA 1RBSA 5HMLA 2ZJ5A 4M6WB 1R0AA 1C7YA 3OYMA 1NKEA 3LALA 4TSXA 2PI5A 4R63A 3MR5A 3HT3A 2VWJA 1HJPA 3RRGA 2HHQA 4QWAA 1NOZA 2DPIA 5J2IA 1WAFA 4UBBA 4EP5A 3HPHA 4FK2A 3G6VA 1C1AA 4KI4A 1KSPA 2DFHA 1RYRA 4ED8A 3NAEA 1KFDA 4P4OA 1LW0A 2H5XA 3QZ7A 4UBCA 4KLLA 1HJRA 1CEZA 1RCHA 1U04A 3AVHA 3KKSA 1S9GA 3NH0A 3TI0A 4RQ8A 1BISA 1JKHA 4E0DA 3LDAA 1Q9YA 3QEPA 2OWOA 3RJFA 4FLZA 5KFEA 4RW4A 4I28A 4KLGA 4FXDA 3OJUA 4LZDA 4F4WA 3PW2A 3QNOA 4B08A 4ECVA 7ICQA 4LY7A 3C6UA 3K5OA 2J6TA 5BOLA 4UAWA 4FZZA 3UXOA 4C8MA 5KFFA 4FJIA 2ZJAA 3FYHA 4YVZA 2E4LA 4CGFA 3LP0A 4ZHRA 4F4YA 2BPFA 3OVNA 3QEWA 4NYNA 4GVMA 5DDYA 4GXIA 5TZVA 1XO1A 4W5TA 2IDOA 4GC7A 4CFDA 4M0AA 1L3TA 1B9FA 1X9MA 2OPRA 3KK2A 4E3SA 5HMMA 5L1JA 3UIQA 5IIIA 5HHHA 4J9KA 3BDPA 4C8KA 4CEDA 5I42A 1VSFA 4ZTFA 2VG6A 4QZ9A 4RQ2A 4GLXA 1KRPA 1RT4A 3VQDA 3OYNA 4R65A 4FJLA 4FM2A 3KHHA 4BGDA 1BL3A 3T5JA 1HRHA 1RTHA 4DTOA 5J2HA 5J2NA 1GOCA 3RBDA 1KCFA 2OPPA 4EP4A 1BPZA 1WSJA 4DL5A 4F4XA 4FJHA 4CK2A 3T5KA 4RQ7A 4RQ3A 4ECTA 8ICUA 3AVAA 3KD1E 1RT5A 2DFEA 3QESA 4KLUA 1VSKA 2Z1JA 3RH5A 5KFZA 4J2DA 5IIKA 3HWTA 3TAMA 3V9ZA 5J2DA 4DL6A 4NLNA 1NKBA 3SI6A 4UAZA 3PMNA 4IDKA 1SL1A 1S6QA 3HVRA 2AGOA 4BDPA 4MF2A 5EWFA 4KN7A 3HP6A 4CJVA 1QE1A 4FM0A 1TAQA 3AU2A 2F1JA 3VQ4A 3NF7A 5JS2A 4CESA 3GFKB 1NK0A 4CFBA 1JLBA 2XY7A 4LD0A 5KT3A 4M3XA 3ZDBA 4DQIA 1BIUA 4KKOA 1WLJA 3QNNA 3AVIA 2V4QA 2HNZA 2JZBB 1T05A 8ICEA 1J54A 3QIOA 9ICVA 4P2HA 2C2RA 3OYBA 4DU3A 3BGRA 4QZ8A 5KG2A 4RG8A 5C24A 4M41A 4N56A 1C1CA 3VQBA 1QLNA 3QEXA 4PGYA 2W42A 7ICUA 3OHBA 1ZETA 2XY5A 5CB1A 4DTNA 4L8RB 4PHEA 4IQWA 9ICUA 1K6YA 5J2JA 2XGQA 1D9FA 2PYLA 3JPPA 5C25A 8ICFA 2VANA 1ZQAA 4QZCA 1U4BA 2DTUA 3KTQA 2FBYA 4CEFA 3MR3A 2HHVA 1ZBFA 2IBKA 3PR5B 4GXKA 4AILC 4DF4A 4FW2A 3HJFA 3RMDA 1XSLA 1KDHA 5CP2A 3TR8A 2PYJA 3RAQA 5DLGA 2D5RA 2PY5A 4DTRA 4XIUA 4CEQA 4HTUA 2F8SA 9ICPA 3HM9A 1B92A 1NJYA 3NH2A 3C2LA 3HW8A 4BDZA 1TVAA 3JPOA 4IRDA 3VQEA 4DQRA 2P51A 5KFRA 3ZSRA 4DU1A 5J2EA 1NK9A 1IKWA 2BPGA 5KG5A 5DG9A 4UB4A 1RBTA 4RU9A 1EKEA 3VQ5A 4K4IA 4PWDA 4RQ4A 3ZDCA 1WSEA 3O3GA 3AVKA 4OGEA 2ZUBA 3TAGA 2DY4A 3RMAA 5L9XA 1ZQCA 1QSYA 4OGCA 4I2CA 2F96A 1IG9A 5DG7A 4XRHA 4CIFA 5J2MA 5BOMA 4BXOB 3RJKA 5I3UA 4QOZB 4ED3A 5HRRA 3S3NA 4M2YA 4TQRA 3C2KA 3TAFA 3SNNA 2Y1IA 2Z1IA 4KPYA 2O4GA 3KLFA 1KVAA 5DBCA 4J9QA 3C95A 4RW7A 1X9SA 4Q0BA 1T4GA 5J0PA 3VN5A 3VQPA 4BWMA 4Z4FA 1QSSA 5DB8A 3PW4A 4CJQA 4NYFA 2G8UA 3JPNA 3Q8MA 2ATQA 2VG5A 9ICFA 1HUOA 3QIPA 7ICGA 4ED0A 3ZSWA 3TWHA 5C42A 4RNMA 1C0TA 4GC6A 2X6SA 3V6JA 4IQVA 3T1AA 1U48A 4ECUA 4DTUA 9ICCA 1Z26A 5DB6A 1JXBA 2FLLA 1Z25A 2BCSA 1ZQTA 3BQTA 1RTIA 3K75D 4CHQA 4CECA 1B9DA 4E89A 3RJHA 3CM5A 3RH4A 4QW9A 5DB9A 4I2GA 1ZBHA 3KLIA 2XHBA 3NGIA 3D0PA 4CGJA 5CWRA 3KLGA 1S0OA 3HK2A 3RBEA 4JUZA 4M6WA 2NUBA 3PX0A 5KG7A 3C5GA 2PFPA 4RW8A 4DSJA 4UB2A 5KFKA 4FJJA 2FLPA 2FBTA 4O5CA 4OPJA 3TFSA 3NFAA 9ICKA 3KK1A 4UB5A 2AGPA 9ICWA 3ALYA 5DBAA 4KMUA 3ZSYA 1RTDA 2E6MA 4OJRA 4KLFA 9ICNA 1HPZA 4ED6A 1CZ9A 2R8GA 4DSKA 5KFNA 2ZD1A 4JS5A 2D0BA 4CJWA 2KW4A 3TABA 1A5XA 4CHOA 4UAYA 4KLIA 3LWLA 4KLJA 3DRSA 1LAWA 4OKKA 8ICKA 1C0MA 3HX0A 1JLFA 4I2IA 3C1ZA 8ICNA 3K58A 3SJJA 2R8IA 2YV0X 1IKYA 4W5QA 2IS3A 3A2FA 5CA7A 3VQCA 7ICJA 4QWEA 4TUQA 2PFNA 4O55A 3RB0A 3MFIA 3TAEA 1IM4A 1BPYA 4K4GA 1N6QA 3CFRA 4JS4A 3ULDA 4FS1A 8ICOA 3N4MB 3NH1A 1UA1A 3PX6A 3V6DA 3L2VA 3OYCA 4Q44A 4YN4A 1BVSA 1TFRA 9ICSA 1LW2A 3HPGA 2WOMA 3BQ0A 3HVTA 1HUZA 1NK6A 3PV8A 3VQAA 3L2QA 1DOQA 5KGXA 4CCHA 4QZDA 1JN3A 4BDYA 4MFFA 4DTMA 4KHWA 9ICQA 4J2EA 4E7LA 4R8UB 5IIJA 1BCMA 3PNCA 2ALZA 1VSMA 3OYDA 7ICLA 1S10A 2BANA 5IIOA 3AVMA 4CJSA 4ED7A 4J9SA 5D4BA 2UVWA 4XA5A 3C1YA 2BR0A 4Z6CA 4QCLA 4TUPA 2NRZA 3QO9A 4YMOA 3Q8RB 3VQ7A 4FO6A 3DLBA 2FPLA 4IR9A 2IAJA 1A5WA 3C6TA 1K1QA 5KG4A 3AU6A 2V9WA 2R8JA 3NF8A 4KO0A 1NK7A 2ATLA 5BPCA 3RJIA 3PO5A 3ZSXA 4IG0A 3SPYA 4YG2A 3MFHA 1JLQA 2A1RA 3GV8B 3DM2A 1Z00A 4F5OA 4O9MA 1ZQPA 2W8KA 3DMJA 2E6LA 3KLEA 1G15A 4O44A 4E1MA 4O3PA 1FKPA 3FFIA 4CHNA 4AHSA 3V7JA 5CJ7A 3PW7A 4M3TA 3OYKA 1FK9A 1KFTA 4H4MA 3AUOA 4FLVA 2QKBA 2C2DA 1C0UA 1S1VA 3G10A 4JLHA 2P6UA 5KFLA 1SL2A 4HUEA 4FJ9A 2KTQA 3OYHA 3GILA 2W9CB 9ICJA 1SZPA 9ICEA 3WNEA 5KT6A 3SV3A 3NGYA 2HHXA 3PW0A 4PH5A 1S1TA 2BCUA 3LPTA 2FPMA 3BQ2A 4BWJA 2B5JA 1SL0A 4JWNA 1V9PA 5IILA 2PI4A 2PFOA 4CGGA 3AA3A 3EPIA 4DFJA 2FBXA 2ZJ8A 2VWKA 2MAXA 2RF2A 3GIMA 4KLMA 1I3AA 2W9BA 4P4MA 1TL3A 2W8LA 4CF2A 7ICMA 4M45A 3I0RA 4H8KA 4DFPA 1TKDA 2ZUDA 4CJKA 3SQ4A 1MSWD 3VQ8A 1XSNA 3D45A 2BPCA 4KHYA 1SV5A 2YNFA 2XCPA 1RXWA 5J0QA 3QZ8A 3AVBA 4MEXA 2JEFA 1J9AA 1CXUA 2VG7A 2R8HA 3L2WA 4NM2A 4X5VA 5KFCA 3IHQB 4FJ7A 2QXFA 3ZT1A 1UOCA 2JEJA 4CERA 4CEAA 4EZ9A 5HP1A 4DWIA 4QZHA 4I2AA 1NOYA 2MUTB 7ICSA 3GDXA 1WSGA 4OKJA 4OLBA 1BHLA 3SV4A 2A1JA 1YTUA 1ITGA 5HBMA 5KFHA 3M9MB 3PW5A 2RKIA 3AVCA 5FRMA 1YVUA 4PHDA 1EP4A 4PGXA 8ICZA 4BXOA 1ASUA 4DG1A 4GW6A 4KAZA 4MQ3A 4YMMA 4DL4A 4YR2A 1XC9A 8ICSA 1Y97A 4O3RA 1VSDA 4NY8A 2AGQA 4BE0A 4E7IA 8ICQA 5DB7A 2UVRA 2G8FA 4YFKA 1VSHA 3G6YA 4KN4A 4UB1A 4KLQA 3L2RA 3DLRA 3P5JA 1BI4B 4B9SA 2ITGA 3HP9A 2G8VA 2ZTEA 9ICIA 1ZQSA 1ZQNA 4B9TA 3SPZA 4CF8A 4DEZA 1IKXA 5KFTA 1I39A 1HYZA 4RQ0A 3VQ6A 3TANA 3QEBZ 7ICHA 5KG6A 4DQSA 4YXMA 2KZZA 3F9KA 3ZSZA 3JPRA 4FZXC 1S9EA 4NM1A 3LK9A 4M9LA 1ZBIA 4DLEA 4N5SA 5IIMA 4YR0A 2Z1HA 2RN2A 1VRTA 2BQUA 4DFKA 4J9OA 5KG0A 3CFPA 2UVUA 3OGUA 3OYGA 4DOCA 3JYTA 3EY1A 1LV5A 4M42A 5CZ1A 1KTQA 1TGOA 2Y1JA 1RT3A 5DKWA 4RT2A 5HRSA 2FMSA 3AVFA 3DYAA 5J2CA 4P4PA 2P6RA 5CZ2A 1TAUA 2ZUCA 4Z4HA 8ICBA 3AO5A 2FBVA 2BGGA 7ICIA 1S1UA 3HSTB 4CJTA 5J2FA 5KFAA 5KFQA 5SZTA 4BE1A 1ZQFA 2BCVA 4IFVA 3EWAA 1U9LA 1ZQOA 1N5YA 2NRVA 4IFYA 2FMQA 4ECQA 3KK3A 4Q8FA 7ICVA 2J6SA 1W9HA 2ISPA 1A76A 4CHYA 3MEDA 1YTAA 3LDSA 4QZEA 4MFBA 4DOAA 3CQ8A 2WTFA 1S5JA 4IQTA 5EWGA 3B0YA 1HQEA 5J0YA 4DTJA 1RT2A 4XUSA 2W9AA 4CE9A 4M3UA 3NF6A 3L3UA 4I2DA 4HCBA 3AA5X 2OYQA 3NHGA 3K59A 2O4IA 3E2EA 8ICAA 4RPYA 4PY5A 4YMNA 4DL2A 4FJKA 4CF0A 2P1JA 4EYHB 4NLZA 4RUCA 3KHLA 3SI8A 4MFAA 2GWSA 1QTMA 4KTZA 2F8TA 1WCNA 4CHZA 1JMSA 1S97A 4DQQA 1VSIA 3QEIA 3EW9A 4CEOA 2ZTCA 1RYSA 4IRKA 4QZBA 4JV0A 3MR2A 4JWMA 3CM6A 1FKOA 7ICEA 4E19A 3AA4A 4OLAA 2BQRA 1UA0A 1BCOA 4K8XA 2JGUA 4FW1A 3C94A 2M9NA 3U3GA 4O3QA 3M9OB 9ICLA 3T3FA 1SKWA 5CY4A 3EZ5A 8ICLA 4O5EA 2JLEA 3OJSA 5HRPA 3CYMA 1RILA 1JL2A 4J9RA 5FRNA 5KT5A 1ZQZA 4F5QA 3EPGA 1IO2A 3H4BA 1S77D 1ZQIA 5KFUA 3NGDA 1L5UA 3MXJA 5KT7A 3V7LA 5J1EA 4AHRA 2LSNA 4CJEA 4CHPA 4B8AB 3IM1A 4QZFA 3AA2A 3Q8PB 4E7KA 3DI6A 3V1OA 4N76A 4W5RA 4RPXA 1ZQXA 3M9NB 4ED2A 4RQ5A 1SUQA 4FK0A 1S1WA 3RJEA 4RPZA 4O3SA 4O0IA 3DLEA 5DQGA 4FLXA 2IC3A 3I8DA 3ZDDA 5L1IA 4F4KA 4FCYA 1KFSA 3L3VA 3O3FA 4O3NA 1IKVA 1A5VA 2FC0A 1RT1A 4Y1CA 1DTQA 8ICCA 2I1QA 1T03A 2J6UA 1D8LA 1YT3A 3PX4A 4FZYA 3S3MA 1CLQA 1NK8A 3JPQA 1D8YA 2PXIA 3C5FA 4DSLA 1NOMA 1X1PA 3RMCA 1JLEA 3MDAA 1VK0A 4Z4CA 2GV9A 5JUMA 2KQ2A 3V6HA 3JPTA 4I2FA 3Q8SB 4PHPA 5DMRA 3SZ2A 5KRSA 1WNSA 1ASWA 3LAMA 4ICLA 5D3GA 4ED1A 1ASVA 4PA1A 3L2UA 4Z4GA 4FLYA 4N47A 4RT3A 3ZT2A 4QWBA 4IBNA 1NJZA 5IINA 3DOKA 1KEJA 1TK8A 3AO1A 4J2AA 1T7PA 4KHQA 3MAQA 2XRIA 1C1BA 1EXNA 4ECYA 3NE6A 4PHAA 8ICWA 2AU0A 3IAYA 1MU2A 3ZD9A 3LP2A 3SUPA 4F5RA 1O1WA 4KHUA 8ICRA 1Y88A 4M3RA 2DFLA 3DLKA 2OPQA 1ZQUA 4Q45A 3C23A 2G8KA 1K1SA 2HHTA 4O4GA 4CJPA 3MBYA 9ICMA 2VA8A 2KZMA 4AHVA 5J2KA 4TUSA 7ICRA 3DRPA 5D49A 4GXJA 9ICXA 4M04A 8ICMA 4O5BA 3HXMA 4R66A 2VA3A 1XSPA 5J2QA 4I27A 3LP3A 4ID5A 4CGHA 4ZH4A 5J2AA 1ZQRA 1VSLA 2EHGA 2R7YA 3KHRA 2OZMA 2KN7A 9ICRA 5L1LA 4CEBA 2HHUA 4B8CA 2IA6A 3OS0A 3ISCA 1SKRA 4JV2A 4KRFA 4B9VA 4R64A 1LWEA 8ICVA 4G1QA 4ELUA 3RB3A 3RB4A 4CJUA 5KRTA 2RPIA 4KV8A 4ECRA 3U3YA 5J2PA 3Q8QB 3V1QA 1JX4A 3HO1A 4RUAA 2G8WA 1JL1A 3LP1A 2XY8A 3GIIA 3Q8LA 5CR0A 4UB3A 1XHXA 1HNVA 3SQ1A 2A1SA 2YNGA 1JLAA 2KFNA 1JLCA 4FBUA 4QWDA 3ZT0A 3ASMA 4NXZA 2WONA 1NKCA 3KIOA 4B9MA 2B4JA 4M3YA 4YD2A 4YQWA 1TVRA 3T19A 4NLKA 4RQ1A 2OZSA 3SUOA 2G8HA 1ZQWA 3F73A 3H8JA 1COOA 2D0CA 3EYZA 5KFXA 4RNNA 1W0HA 1D9DA 8ICXA 5T7BA 3K57A 4DTPA 4KHNA 3KLHA 1DLOA 2YKNA 3V6KA 4CK1A 1PZNA 1LWFA 1TV6A 1RTJA 3CG7A 3SUQA 5KTQA 4WE1A 4KLDA 2ZTDA 4BE2A 4FLTA 1JXEA 3ORYA 3LZJA 2OPSA 4J9MA 2GBZA 2F1IA 5DGBA 2PZSA 2B21A 1BPEA 1LB2B 4AHUA 4DTSA 4DL3A 1QS4A 3AO4A 3M8PA 7ICOA 4LSLA 1TKZA 4HVJA 1DTTA 1WN7A 3AVNA 1XHZA 5FDLA 4E7JA 4MFCA 4YXJA 3OS2A 1ZQBA 2IHMA 2AJQA 5SWMA 2YNIA 2JZBA 1ZQVA 4DLGA 3IG1A 1ZJNA 3B0XA 4OVLA 4IRCA 3H08A 2NRWA 1C6VA 5KFOA 3ZD8A 1LAVA 1CZBA 3MR6A 3ZSVA 3PUFA 5DBBA 5E41A 1ZQKA 3NTUA 3QE9Y 3UXNA 1CXQA 1RDAA 4M9NA 9ICGA 2IHNA 4HUGA 4JK1A 2HNDA 2ZE2A 3M8RA 2HVHA 1TKTA 1XI1A 3SYZA 1IXRA 1ZQQA 5HHIA 4QZGA 4ECZA 1GOBA 5EOZA 1N56A 3HYFA 4RNOA 4GMJB 4I2EA 1D5AA 4FLWA 3V7KA 3UXPA 3LZIA 2RDIA 3IRXA 4O5KA 3H40A 4DQPA 9ICHA 3RTVA 3VA0A 1FXXA 2NRTA 8ICHA 1XWLA 3ZSOA 2Z1GA 4PGQA 4KLSA 3V9XA 5F9NA 4DSEA 4TURA 1UWBA 3UPQA 3ZT4A 1REVA 4O0JA 3K5MA 1HYSA 1TK5A 3V9WA 4BACA 4F50A 3KKRA 4YFUA 1HQUA 1KLMA 3K4GA 4M3WA 1RT6A 5KFBA 3MXIA 2G8IA 3MABA 1ZYQA 2QK9A 5EWEA 1KVCA 5DK5A 1Z3EB 1RXVA 4JV1A 4FS2A 1J5OA 1T3NA 8ICIA 3B6OA 8ICYA 5CHGA 5J0OA 1ZQLA 2ASJA 3G0ZA 1EXQA 4I9LA 4C8OA 4EZ6A 3MECA 5KFVA 1HNIA 4I2HA 2YKMA 2BKEA 2BCQA 3GV7B 1NK5A 4B9LA 4F4ZA 2YHAA 3NDKA 1X2IA 4PPXA 3ISBA 4F3OA 3WNGA 3V4IA 4FJMA 3BJYA 5HP4A 1T8EA 3MEGA 3OYAA 1QSLA 5EU7A 3RB6A 4Z4IA 3DLHA 3TQ1A 5DGAA 3MGHA 4ECXA 2HHSA 3OY9A 2NRXA 5JS1A 1RBRA 2X78A 3IS9A 4M9JA 3O4NA 1ZQGA 8ICPA 4TQSA 1S0VA 2FPKA 5KFJA 1QQCA 4M9HA 3LPUA 4KREA 5HRNA 5J0SA 4DL7A 2P66A 4DF8A 1S9FA 7ICPA 4CEEA 2P5GA 1BPDA 3RMBA 1A77A 3QERA 1VSEA 4AHTA 2Q3SA 2I9GA 4Z0UA 4Z6DA 5HNKA 5CYQA 3OSPA 1U49A 4I7FA 1RZTA 4I29A 3RR8A 4OKEA 8ICGA 2VA2A 1BIZA 1BPXA 3H8SA 3N97B 1J53A 4I2BA 3AVLA 2P5OA 3HL8A 3BQ1A 4CGIA 2Q0ZX 3ETLA 4FM1A 3O3HA 3CFOA 3JPSA 4CJLA 7ICNA 4CFCA 1WSIA 1Z00B 7ICKA 2JEIA 4FJ8A 4R5PA 3M8QA 4KITB 1BPBA 2LYHA 5DQIA 3SCXA 1ZQHA 3V9SA 4CJFA 2AQ4A 4AH9A 3NBPA 3DOLA 4EYIB 2ASLA 1MQ3A 7ICFA 2XC9A 4Q43A 3RJJA 3WNFA 3THVA 2XY6A 5KGWA 3PMLA 1JLGA 4UQGA 3QEAZ 4FJNA 1CUKA 3OYFA 1WSFA 2ZQBA 1ZBLA 1RT7A 3PR4A 3QLHA 3RWUA 3GV5B 3E01A 4Z4EA 4JRQA 1S0NA 1ZJMA 4LH5A 5DLFA 3V1RA 5KT4A 4YD1A 5KFDA 2BE2A 4ELVA 1VSJA 2HNYA 1UT8A 1S76D 2W9BB 3OYEA 4FJ5A 4CEZA 3JSMA 1SKSA 4QAGA 5J2GA 3S3OA 4KB1A 4CF1A 1RNHA 3AO2A 2KFZA 3NCIA 1LWCA 3AO3A 5D46A 3KHGA 1GOAA 3GIJA 4Y1DA 3T5HA 4CJ5A 4HYKA 3RH6A 1EETA 4KTWA 4I2JA 1F21A 4W5OA 1RBUA 4YNQA 1X9WA 3FDSA 4CJRA 3AV9A 5CYMA 2PFQA 3TAQA 4M9GA 4HUFA 3RJGA 5J29A 1RDBA 2IGIA 3ISDA 1S0MA 1XS9D 1KLNA 2OA8A 4FLUA 1DGSA 4KLTA 3SQ0A 1TKXA 4DS4A 2EX3A 2A1JB 3L8BA 3NGZA 5HLFA 2ISOA 3LWMA 1KVBA 2XCAA 2JEGA 2DFFA 4IR1A 4F2SA 5KFPA 4NCAA 3C21A 4EBEA 4YP3A 4J9NA 3TARA 4R8UA 4CJ3A 2B6AA 3QETA 3PO4A 3H4DA 1BGXT 4RW9A 4EBCA 4W5NA 3KJVA 5DDMA 1TL1A 3G6XA 3UQ2A 5L1KA 1TV9A 1BQMA 4H4OA 5C5JA 1ZBUA 4QWCA 2F1HA 4Z6FA 4AHCA 3S9HA 4F8RA 2BDPA 1UT5A 4B9UA 3OYLA 1IH7A 3LAKA 1VRUA 4B9NA 4Q8EA 3T5LA 5J0WA 2W9MA 1Q9XA 3RAXA 4DFMA 1WCLA 1Q8IA 2D0AA 3WNHA 5KFSA 1ZQJA 4QZIA 4RQ6A 3M8SA 4FVMA 3RRHA 2C28A 4LZGA 1S1XA 5KI6A 4KTQA 3Q8KA 4FYDA 5F9LA 1RDDA 4ZTJA 2V4RA 4CGDA 4KFBA 3B6PA 5KFWA 2XO7A 3UQ0A 4HHTA 4DSIA 3SUNA 2X74A 3OYIA 4ID1A 4I9QA 3ZSQA 1BQNA 3DLGA 3K5NA 4O3OA 3K5LA 4KLOA 3OYJA 1NK4A 2BQ3A 1MQ2A 3MDCA 1JXLA 4F5PA 7ICTA 2W9CA 2GUIA 4CK3A 3KD5E 4FJGA 1L3UA 4JRPA 5DG8A 8ICJA 5J2BA 3ITHA 4KHSA 4MEYA 4F91B 4G3IA 4I2PA 5KG1A
chains in the Genus database with same CATH superfamily
3SIPB 4KB0A 2KXHA 2R8KA 2DNHA 3AOCA 3L7OA 3BEGB 5CABA 3UKUA 5JLFA 3CCES 4PUOA 4E7HA 4A8XA 3AQFA 1FIQA 3I55S 3H7IA 1M5VC 4OZNA 2P9EA 4QU6A 2F7VA 2I5JA 3HILA 1EKRA 2X6NA 2XYHB 2EAOA 4J9LA 2VKRA 3QINA 2HHWA 4NLGA 2P9KB 3FZKA 2J5AA 4OHWA 3TAPA 3SQIA 1WC3A 2VWBA 3EO3A 2JH7A 3BR9A 3H90A 4OV1A 3SQ2A 4WK3A 3POTB 4JI2J 3VCDA 2IOCA 5DQHA 9ICBA 3ZNUA 5D0GA 9ICAA 5L46A 4OJLA 1R43A 2BOPA 1Z6RA 4C8LA 1YUWA 5L1MA 4EBDA 1HMVA 2F76X 3MEEA 2OEHA 1MC8A 4DV1K 4RCHA 5T41A 3C16A 3RR7A 4FWOA 4HH1A 1JJHA 2FDNA 3ENQA 5KG3A 2AQ0A 1G2EA 2Q79A 2IMWP 1S57A 1ZOTA 3C3LA 4F2RA 3QFHA 4X65F 2FVPA 4Z6EA 4ECWA 4U7CA 1X4BA 2BKPA 4OX9F 3U6FA 2HBYB 3MTKA 2KYZA 3OUYB 3CCWA 4XEIA 2XGPA 3B4DA 4ZLLA 2JOQA 5BR8J 2ZZMA 5F8LA 5AM4A 3OR2A 4MIBA 4JYAF 4USWA 1U26A 2RDJA 2ZH4A 2AEMA 1XU4A 2E8NA 3NRBA 1NSQA 2VGMA 1CULA 4Y00A 1RKIA 1SIWB 3CXCR 2QLXA 2HVIA 3SAGA 1C2PA 1RCXB 2D0OA 4WQ5C 1QHTA 1XMOF 3ZT3A 4CJ4A 1PBAA 3M6VA 2XIDA 4EEYA 4N8NA 2WHEA 4RW6A 3VA3A 1QH9A 4MKVA 3KLVA 1AROP 2PGCA 3GZFA 5GVQA 4J2BA 4BRMA 2YMQA 3Q22A 2NREA 4KY3A 5J0UA 3MI7X 2G07A 1RT1B 5AQPA 3R3TA 3WXLA 4I2QA 4X4SA 1T03B 3QGHA 4XQ8A 1NGJA 3BPSP 1U47A 2HB5A 5ALGA 3J7YP 1DEJA 3JXUA 3VEZA 4BCAA 3GIKA 1I1GA 1YKWA 2FE9A 2XG8A 4ES1A 5ETQA 2L08A 1KS2A 1S6PA 4ICLB 4ZVRB 5B0FA 5HMWA 4PQUA 1VRQC 1HYVA 3ENBA 4OFZA 2DQNB 3ZX2A 5T7LB 4LBHA 3R7NB 2DNLA 4NYPA 2GJ2A 2CPZA 2Z0GA 5TKWA 2QA4G 2ZJ5A 4M6WB 1OH7A 1NJIT 3M05A 4EAHD 3EGNA 3WBZA 3MAAB 3PYEA 3HT3A 3KG4A 1VC5A 2AX1A 3PRDA 3MM6B 3QMQA 4QWAA 2QWOA 2DPIA 2E1CA 2GZOA 1DJ0A 2HWIA 4EP5A 3DLKB 4A47A 4K25A 2AZ3A 4PKIA 3EGVA 4KI4A 2LA4A 3ZZOA 4PPDA 2MHEA 3NAEA 1ROFA 3G6ES 3DRPB 4AQYF 2PDAA 3ENOA 1HJRA 3BREA 3KKSA 3CJ5A 1PO6A 6AT1B 3NH0A 3JAMU 3TI0A 2OWOA 3RW6A 2DKXA 3QWUA 5ETKA 3QU9A 1WC1A 2JRSA 4I28A 1APSA 4KLGA 3ETRA 5M1NA 1TZ0A 4LZDA 3CO0P 4B08A 2QZ8A 5EE9A 1OY9A 3BBCA 3K5OA 1GH8A 2J6TA 3OTOJ 1GK8A 1MLAA 4KV8B 4C8MA 4USJC 5KFFA 4CJ7A 3TTDA 4OJ3A 1JK9B 3T6BA 2ZJAA 3IBFB 3HKZC 4PQAA 3AY9A 1N6QB 5M2UA 3L4PA 2Z58B 4DN9A 4NYNA 4GVMA 2IDOA 1JLCB 1VQ8S 4M0AA 1L3TA 2ROEA 4HH0A 4ATNA 4EI2A 4O3MA 3V2UC 1IQTA 2WAQC 3D6TB 4J9KA 2PO4A 2V94A 4OJ6A 2ZBQA 4H5WA 3MCNA 4ZTFA 2VG6A 1SZHA 2H9ZA 1RT4A 3OYNA 4FJLA 2LHTA 3K2YA 2P9LA 4FM2A 1B70B 1T02A 1SC6A 3R5JB 4BGDA 4DTOA 1U1PA 1GOCA 2MSSA 1HKBA 3KLHB 1DLOB 2UXDF 3C7NA 2RMLA 4RQ3A 1BU6O 3BPDA 8ICUA 3FJ2A 3AVAA 3KD1E 2DFEA 5BYSA 3QESA 3JXOA 1U1RA 2ZH3A 3RH5A 2AZ1A 4YN3B 2PIIA 3AGKA 2LFVA 3NS6A 1R27B 3V9ZA 4A62A 3DLJA 4K0KF 4DL6A 4NLNA 4WU3A 5CHCB 3I9V9 4DX6A 2LQJA 3T1HJ 3KYLA 3PMNA 1GLCG 1WACA 3I56N 1X4CA 1S6QA 3HVRA 4X64F 3F2BA 4KN7A 1AUSL 1QE1A 3PIPL 2K1RA 4ID8A 1S4FA 2ZWOA 3E9OA 5F41A 2HQIA 2F1JA 3KLEB 5D8HB 1C0FA 3NF7A 1HIWA 3THPA 3FFIB 4AL5A 4TLRA 3LDNA 4X2BA 5KT3A 2DRDA 1NSAA 1LCUA 4DX8H 2V4QA 2YNIB 3M2UB 2MEWA 4I64A 8ICEA 4OQJA 2CPEA 4P2HA 4J9UE 2C2RA 3OYBA 4DU3A 4QZ8A 3MMVA 3OR1A 2GA7A 5KG2A 3MCOA 5GAEU 4GY2B 3CD6S 5FPMA 1P8ZA 1C1CA 4H0PA 3VGUA 4GV6A 3OHBA 3SCIE 1N8RO 3DXBA 4L8RB 4NL9C 2V8GA 3M2RB 1AFJA 4ZVGA 4USHA 3PSIA 2IM0A 2XLIA 3D9BA 2K4PA 3JPPA 8ICFA 1UTAA 2E3TA 5B0CA 1R8PA 5AI6A 2EC0A 1U4BA 4WQ4A 3KTQA 1FWKA 2ZBIA 4CEFA 4BR5A 2V51B 5A8RB 4ISGA 3A0BU 3PR5B 4GXKA 3J80U 1GLLO 4AILC 1NH7A 2V2QA 3VAIA 4KE5A 1RGIA 4DR2F 2PYJA 3RAQA 4ALZA 4FXVA 4NRTA 3PEHA 1U6FA 2WMMA 3FCVA 2W41A 1GX5A 4O4RA 4P6QA 2BOAA 1KLMB 3HW8A 4BDZA 2CADA 1HKCA 1O6XA 2F8MA 2HS4A 2K7KA 1NPKA 1CC8A 3GLJA 5KFRA 4K2JA 5J2EA 3HOSA 1IKWA 2BPGA 2PMZD 2GWKA 3UO0A 4ANCA 4B3SF 3MECB 2ZHBA 4K4IA 4J7CA 4P52A 1I94J 2YKMB 3NVKA 3ZDCA 3BSOA 4RNHA 3AVKA 4C4WA 1ZQCA 4DCPB 2QEXN 2HGNA 5DG7A 3W62A 2ZZTA 5ALZA 3MEGB 4BXOB 3MMAB 1N36J 4NPOA 2BRKA 3S3NA 3EE3A 3UWTA 3MUMP 1XMQK 2HKEA 2WF9A 4TQRA 3TAFA 4YEAA 2E5GA 3OXFA 5J1PA 4KPYA 1Q81O 3KLFA 5DBCA 2HFZA 4BR2A 4XAKA 3GJRB 1K0TA 1T4GA 1IR2A 2UXCF 1NBWA 2KRBA 3E9LA 2CWXA 3C66A 3HSDA 4BROA 5AIBA 4OZ3A 3LDQA 3PW4A 4I68A 4CJQA 1S9EB 2KVCA 4L75A 2FZKB 4ER8A 3OW2R 4FL9A 2GGPB 7ICGA 2DEJA 2XVTA 3TWHA 2HOFA 2F3NA 4HR2A 3V6JA 2WBMA 3T1AA 1NNDA 4DTUA 2DO0A 3I32A 3MOJB 1K0VA 3BSAA 4CF3A 4B1XB 5AE2A 2F9DA 4USMA 2K8AA 1R89A 1FA0A 2PMHA 4QW9A 3UMGA 5M2RA 2XNRA 4BC7A 2VBXA 4OD0A 3D0PA 1S3XA 2ZM6F 3DOLB 2CWKA 2QSFA 1S0OA 3HK2A 2DO4A 4CVNE 2CQ2A 1U0SA 3RBEA 1UCVA 1S59A 4M6WA 4DV2J 1FVSA 1NLKL 4RW8A 3RG6A 3C15A 1JLGB 1KONA 1VOMA 1IBMF 2BH1A 2RQMA 2DD8S 3CERA 3ZETB 2FBTA 4DPUA 5AQZA 1DRZA 3TFSA 5JVHQ 4V19X 2Q3PA 3PM9A 3DXKA 3LL3A 2AGPA 1YIJS 1NAQA 1V97A 3MXHP 3UN3A 1HPZA 2B9XA 3ETOA 4PAAA 4JS5A 2LU2A 2KW4A 1A5XA 5B09A 4DR1J 3LWLA 2YX7A 2V4JB 1C0MA 4FE3A 1RJJA 1S4EA 3IWXA 2R8IA 1NZBA 1IKYA 3L7UA 4HDHA 4ZPCA 5EX0A 3A12A 3A2FA 3NGUA 2LMIA 2D3O1 1U8WA 3GE9A 1J5EF 3O0FA 1SS6A 5M1QA 2UXBJ 2KHQA 4YB7A 3MFIA 3W61A 4UZCA 2CQCA 3UE2A 2BW7A 4PKDB 1N6QA 5AM5A 2OD4A 2EEYA 1RUSA 2MY8A 5AXNA 4FS1A 1YJTA 3I5BA 3N4MB 1LNQA 3LDPA 3X1LB 3NH1A 4FFDA 3UDCA 4JI4F 2CFXA 2CUYA 4BRGA 1TFRA 1KHVA 1HUZA 3UD3P 2NCKL 4DHVA 4CBXA 1DOQA 2R7QA 1P8GA 4FWNA 3VGTA 4CCHA 3JAMY 2BJEA 1JN3A 4FVUA 4DTMA 2LECA 4A46A 3VESA 3G87A 4J2EA 5ETNA 5LL6d 4PL1A 1BCMA 3PSFA 2G08A 2D7SA 3OYDA 2H5IB 1J6ZA 3AVMA 5D4BA 4Y2TA 1TL1B 3KHYA 2PFUA 4HACA 2EANA 4MN4C 2NRZA 3R5DA 4PWWA 2KT5A 2YB1A 1F1BB 2V5HG 3PRVA 3QO9A 1NNLA 2KG1A 3Q8RB 3S1TA 3VQ7A 2FPLA 2IAJA 3E66A 4LF6F 3IR7B 3FBCA 3CGIA 5AM3A 3AU6A 2V9WA 3NF8A 1VHXA 1PG5B 1UMJA 4DCJB 1RBAA 2ATLA 1RQLA 4UARA 3PO5A 3ZSXA 1GNKA 3I1YA 1VJ5A 3WKBA 1OPIA 3SPYA 2FVCA 3GV8B 4F5OA 4O9MA 1ZQPA 2E6LA 3KLEA 2YQ1A 2F9WA 1FKPA 2WSFC 3FFIA 4A8OA 3ZXWA 2QRRA 1K9MO 1MN8A 3HT0A 3PW7A 3RZAA 5LMUF 4DR6J 4CRJA 1T94A 3BO3A 4TKTA 2YH0A 4JI6J 2C2DA 1OJ4A 2P6UA 1H2VZ 2ZZNA 2KTQA 3OYHA 2E8OA 1O5JA 1L8OA 3CDBA 3M32A 1VQ9S 3WNEA 4MJKA 1MA9B 2F9TA 3P45B 2CQ3A 1ATSA 4I4BA 2XHCA 1S1TA 4PG7A 1U2CA 2BCUA 4M5NA 4JI1K 4RUBA 3RBXA 4YDUC 4CLTA 3BQ2A 2OHDA 4ZVEA 2HZAA 3DN9A 3M2RA 3NCQA 1V9PA 1UWAA 4DV5J 4DV0J 3N0VA 4ZPTR 3EPIA 3NEKA 1IBKJ 5EXWA 2K7JA 2FBXA 5K14B 5HN0A 4I6AA 1HQ2A 2VWKA 1OIAA 1HL6A 1TTHB 5A8RA 2P9SB 2RP5A 5DDOC 1V85A 2LYAA 3I0RA 1B3TA 2W4DA 3U7JA 4LF8F 2C2NA 5DZ6A 4RTFD 3H0LB 2ZGZA 1NG9A 2ZKTA 3NP5A 1MSWD 4QS9A 3CMAN 3BS5A 4KHYA 2RRAA 1JNZB 2VFUA 3UCGA 3SJHA 3CI5A 2UV8A 3QZ8A 3AVBA 4ES3A 2JEFA 2RNEA 4NA2A 1SJ4P 4A8SA 1QY7A 5CRXA 1H72C 1PC5A 1UOCA 1TYQA 2V2ZA 1LKYB 4LF7K 1O51A 2UUAF 4LFCK 1T9WA 2WONB 4DWIA 3NCRA 2LVWA 5AKHA 1NOYA 3ISND 2KT3A 2EFVA 1C4AA 5ALVA 3P8BB 4URSA 4OKJA 5DDRC 4USIA 3LQVA 3OQ2A 3SCLE 4NJ8A 2BBEA 2KYXA 3SEIA 1ITGA 1P90A 1EIYB 4DXLA 3M9MB 4BHQA 1RM6C 3AVCA 5FRMA 4RQNA 3BM7A 4BXOA 2GVDB 4OPHA 3DHWC 3DWLA 4FWPA 3J80Y 3D6RA 3WIVA 2HI0A 8ICSA 3NWGA 2HQGA 2OGUA 1Y97A 4FP9A 1VSDA 4NY8A 2AGQA 2VV5A 2IIRA 1ZAWA 3F56A 4EEKA 8ICQA 5DB7A 2UVRA 2G8FA 5CD4H 4KN4A 3AD9C 2NRHA 4Y2VA 2IIHA 2MQOA 3DLRA 3HP9A 3CP8A 3OLBA 2G8VA 2K2PA 3C0BA 4DEZA 2NYVA 1Q5YA 3TANA 3QEBZ 4AXJA 1CJUB 4PCQA 1J2MA 5KG6A 3J7Z5 1LVHA 1X7VA 3M3ZA 3QT6A 3JPRA 1S9EA 4DUTA 4NM1A 1X6IA 1DTTB 4WPAA 2V69A 4V1Ak 5GMKa 4YR0A 3PXGa 2EWSA 4DFKA 3SDEA 4J9OA 2FJWA 5E0OA 5KG0A 3GG1A 4WFYA 2UVUA 3D0HE 4NCGB 3DU6A 4JI3J 3OYGA 3VTIA 5IQ6A 3JYTA 4M42A 2XS2A 5KQDA 2Y1JA 2KU7A 2CKWA 3TR5A 5A0YB 4RT2A 5HRSA 3AVFA 1Q53A 2DR6A 2P6RA 2PC6A 3QJLA 1TAUA 3GYXB 3DKDA 4L74A 1SPBP 2C3PA 3QBWA 4KRWA 4DJBA 5ALDA 4CJTA 5J2FA 1WD6A 1Z4UA 5ETOA 3L0QA 3NMAA 3HBTA 2CPHA 4IFVA 1ZQOA 3ZX3A 4H5TA 1DBDA 3GG4A 4Q8FA 1W9HA 2K4EA 3UFCX 1UJ6A 2WVCA 3UDLA 1M90T 3WIUA 4GKJF 3CQ8A 3KFWX 4JD2B 6FDRA 3Q7BA 1HQEA 5J0YA 5EY4A 2VZ9A 2W9AA 1RK8A 3M1VA 2PSZA 1SQGA 4KH0B 3N28A 1JKHB 1Q82T 2O4IA 2BEFA 1ZM3A 1EHWA 2HQ3A 5M1FA 3BS9A 1IN0A 3J7YU 4IH6A 4EYHB 5LSRA 4A8KA 4MFAA 2GWSA 4Y34A 2H5EA 4CHZA 1UVKA 4IUFA 3MMCA 5A8WA 4TU9A 1WWUA 1U8SA 3EW9A 4CZHA 3ET6B 2QLTA 1N32J 4ITSA 2PA8D 3OVAA 4ZMMA 3MR2A 2KM8C 1NPPA 4OJOA 4XH1A 2JGUA 2B51A 3M9OB 1RDRA 1FEZA 2XMJA 2W4PA 3EZ5A 4GKKK 2JLEA 2DH8A 4F3MA 2OTLS 2GFFA 3CYMA 3KK2B 3R7SB 4NXNK 5LOQA 2FGOA 5I42B 2GIFA 1L5UA 3ENWA 3MXJA 3I33A 1KDNA 1XNRF 3CE8A 4AHRA 2OTJN 1HNXF 4CHPA 1FD2A 3AA2A 3ADAC 1NJIO 2CQBA 3DI6A 5A8KB 5J2NB 3C6AA 4U8VA 3MGVA 2D3ZA 4F0HA 2CJBA 2QARB 4A8FA 5TKYA 4EHTA 1S1WA 1VBYA 2KKZA 3RJEA 3R6LB 2FHJD 4NZ0A 4O0IA 3DLEA 1W97L 4Y2JA 5GAHP 2OMOA 1X8DA 5L1IA 4F4KA 3IAM9 4O3NA 1LXNA 2FC0A 1I5OB 3MM7A 2IRYA 1DTQA 2CPXA 2HIQA 3EMTA 1ZD3A 3PX4A 1RDFA 4FZYA 1X5PA 5I3PA 2MQPA 3S3MA 1CLQA 4JI8K 1NK8A 4Y6IA 3JPQA 4UQTA 3MPWA 1X1PA 3WKDA 2H3GX 2FB0A 1VK0A 1U25A 3D66A 3EX7B 4IC9A 4I2FA 2QWQA 2K8BB 3Q8SB 3QXGA 1WKKA 5D3GA 4ED1A 1ASVA 2AJ2A 4OMFG 4FLYA 3VZHA 3IDWA 3THWB 4JK7A 2HNZB 1YHQS 3U1MA 3OLAA 1S99A 2NLXA 3Q8YA 1KEJA 3CD0A 3KMSA 1WC5A 2KJWA 5C24B 3MWPA 2NPFA 4PHAA 2AU0A 1GEHA 1VQMS 1MU2A 5AHXA 2B43A 3ZZRA 2KJ8A 1UVNA 4IO9Q 5RUBA 3SQGA 4WTYA 2LKYA 4F5RA 2AW0A 1O1WA 5KL8B 1W2BR 1FXRA 2J76E 4Q45A 1ZZFA 2G1DA 2ZGYA 3UPFA 4AHVA 4ZS6A 1FTRA 3JS9A 5AZIB 2JV3A 5C25B 1E3MA 5J2QA 2VA3A 4RWXA 1ED1A 1BNOA 1W25A 1VSLA 1WDDA 2NSCA 2O8FB 5G5GA 5K8PA 4FF2A 4CZEA 3U1LA 5L1LA 3MD1A 2ZH1A 3OS0A 1SKRA 4C0OC 4R64A 1LWEA 4ELUA 1PYOB 3RB4A 1LK5A 5H9FK 4CJUA 2RUGA 1RWPB 3HSJA 4IFEA 5KRTA 1ZM2A 3OFHA 5LM7E 3U3YA 5F3XB 2J0QD 2V34A 3AAWB 4ZN3A 2WVBA 3V1QA 1RYUA 2G8WA 2UYTA 3LP1A 1VMBA 2ZVIA 3E51A 3KWMA 4F02A 4UB3A 1HNVA 3LVWA 3MN5A 4DV1J 1JLAA 2KFNA 3PHTA 1LKYA 1PGZA 3O9UA 3ASMA 2MZQA 1WG4A 2WONA 1NKCA 4B3TF 4HTJA 4YD2A 3AQEA 5AZJA 1VQ7S 3CMEN 1TVRA 3EN9A 2M4MA 4DDFA 2ASMA 3MMJA 1D0EA 5SUHA 2MJNA 1NGCA 3N6LA 1Q95G 3H8JA 4P75A 1COOA 2KIWA 2A6OA 5F3ZA 1IG6A 3QJJA 3B6BA 1N52B 1Z4NA 2QN6B 1D9DA 4CLZA 3K8WA 5T7BA 3K57A 3CF5L 2CQDA 2YKNA 3V6KA 4CK1A 4JHDB 3CJ1A 1LWFA 2RB7A 3HM8A 3BQ7A 4JV5J 1V6HA 1T9TA 3CG7A 5KTQA 2BE9B 5AXMA 2EFOA 3A5MC 1SGGA 5BN9A 2AXTU 3I5CA 3VGVA 4ZVSB 1XNQF 1JXEA 3QPIA 5K8OA 2KDOA 4WZQA 2F1IA 4EENA 3CCZA 1YJRA 4XO0A 3BBFA 3EGZA 4DTSA 3NASA 1NDKA 1KVJA 2B4VA 2P9GA 3EXYA 2Q1LA 5E7OB 5F0XA 1SIZA 2F8EX 4HVJA 1DTTA 5AQOA 3GP9A 2BUNA 1P9QC 3AVNA 4JKGA 2KSOA 2WF7A 2RRDA 4B3MK 4DZ6A 3ONQA 4YXJA 3OS2A 5SWMA 4XH4A 3BKTA 2JZBA 1ZQVA 2L41A 4MKBA 3D4JA 1ZJNA 1MWQA 4YMEA 4HI2A 4OVLA 1FJEB 1C6VA 3THYA 5KFOA 1F5SA 2VKZG 4CNYA 1LAVA 3HRGA 3KLGB 3MR6A 3BO2A 1OS5A 2HQCA 4RU2A 4IJAA 4M5LA 1PKUA 3EVMA 2V8VA 1TFWA 1RDAA 2FF6A 4BQLA 2OH2A 3G4SS 4OHVA 2HVHA 1TKTA 3OL9A 3EXCX 4F9OA 2NZ4A 4ECZA 4NWBA 3GBTA 3KK1B 1WELA 4CTAA 3OBIA 3BZCA 1GOBA 1UFLA 1DFDA 1D5AA 3Q7CA 3LZIA 5F8NA 1FFGB 3W8GA 4O5KA 3H40A 2NQPA 1ZZNA 3BP8A 3ZSOA 1X4DA 4C4RA 4HHHA 3RUBL 1UWBA 2L3MA 3QYPA 4O0JA 4QS7A 1TK5A 4DPXA 3KKRA 4YFUA 3K4GA 4EWTA 3MXIA 2YBVA 2G8IA 4MTPA 2DNRA 4CBWA 1ZYQA 3FLCO 5DK5A 2DNOA 1J5OA 4QNLA 3FGUA 3C8YA 4LSNB 2QXLA 3PYDA 3P5TL 1M5SA 3I9ZA 4FPIA 3ZTSA 2DY1A 1NGEA 4I9LA 1YZ6A 3R9LA 3M8YA 3G9CA 2XWXA 3I4HX 3QU5A 3W9HA 5CAAA 1CSJA 4G6VB 2BM0A 3V6DB 1URRA 1VQ4S 1LW2B 3CJKB 2B7CB 3H5YA 3GL1A 4Z4IA 2D0PA 3DLHA 2W2OP 3G8SA 1K73T 2NRXA 4CLLA 5JS1A 2X78A 1AT1B 1SQKA 2HCFA 1EARA 1YRXA 5AK5A 5DRKA 8RUCA 1S0VA 2FPKA 5KFJA 3O3LA 4KREA 4DL7A 3JTPA 3CC7S 2WB1F 2P6TA 3HSZA 3A13A 2CG8A 4CEEA 1BPDA 3RMBA 3VCBA 3QERA 3DLLL 3D1OA 1FESA 8ATCB 4USAA 1JXVA 3Q23A 1SC1B 3J7ZT 1YGYA 3VOVA 2EZYA 3O6QA 2EH9A 4I7FA 1RZTA 4CW7B 2DF4B 2CGLA 3H1VX 4KO0B 3K0JA 1RWOB 2VASA 4MMOA 1BA0A 1BPXA 3H8SA 3N97B 1J53A 4I2BA 2P5OA 2Q0ZX 1S48A 3CFOA 3R5CA 3DMJB 1FJ7A 2JEIA 1ZRMA 2JDJA 3BKUA 1E6VA 1B7FA 3K1RB 3GPAA 3SCXA 3VAGA 4YY3K 3VVTA 3UVJA 3W2VB 4AH9A 3WDOA 3DRXA 3O1WA 4TN2A 3SLCA 1C0UB 4FWRA 1S1VB 4LF2A 3PFOA 3DC2A 4Q43A 4RBUA 3THVA 4ED5A 2ZIWB 3PMLA 3H46O 2VBWA 2F7TA 1WKLA 3LGHA 1VQNS 3OYFA 1WSFA 4DV6K 2MXYA 2WBNA 3NNHA 3RWUA 3E01A 1FTCA 1N5WA 1Z19A 3GFYA 2FJEB 3AH6A 3TUIC 1SXDA 2WBRA 4OZJA 3DEEA 2ZH5A 2EFNA 4HEA9 1LK7A 3CJQA 3T9NA 3V1RA 2DGZA 1U0HB 4M5DB 3PJXA 3CJCA 5AZIA 2BE2A 3HULA 2RF2B 3H59A 4TVAB 4UOFA 1T6CA 1SBRA 3VEYA 2W9BB 1TL3B 3HCXA 2R7OA 4O0NA 5G0RA 4C11B 1EO1A 2R2SA 1PVQA 3C6HA 2B8PA 1PYTA 3HHKA 5AJ3K 4RBVA 1ZPWX 4OO1J 2E7VA 2YNFB 1GOAA 4Y1DA 1QJHA 2FGCA 5ALMA 4ZVUB 4WTOB 3RH6A 3WK7A 1EETA 4ZN1A 1SV0C 4I2JA 2VG7B 1F21A 4JI2F 4CH0S 1RBUA 2K06A 3FDSA 4WQ5A 5CYMA 2PFQA 4K4SA 4M9GA 2G2OA 2QWRA 1OXJA 3LO3A 2IGIA 4E8UA 5LY3A 1S0MA 1NMDA 1KLNA 2OA8A 4FLUA 4K4WA 5IM0B 3MX5A 2OI2A 3J81U 4U67L 2DNNA 3NGZA 1PJ6A 4U7UD 1KTVA 5AXKA 1N0UA 1V38A 1RWKB 5GINA 1T9YA 3W65A 1XMQJ 4W92B 2YHWA 4EBEA 1N0VC 4KHPK 4QQBA 4J9NA 3TYTA 2QC3A 2Y9HA 2IVYA 3KUEA 1BGXT 4EBCA 5BR8F 2E1AA 2LDIA 4A5BA 3G6XA 1P1TA 2W55A 1BQMA 2IBOA 2F77X 2YKQA 5CCMA 3R9PA 1RE1B 2MLXA 4QWCA 5HR7A 3H0RB 4Z6FA 4F8RA 4BC9A 3LAKA 1SXLA 1VRUA 3IM8A 4Q8EA 4AUKA 1UPPA 4I6WA 2BVZA 2HIYA 1CJKB 2AEJA 3M8SA 4LZGA 2YMLA 1F3FA 5KI6A 4KTQA 4QIGA 4WFAL 1IBLK 3NVMA 4FYDA 3ZEUB 3IBPA 1J97A 3ENVA 4KFBA 2HHPA 3GYNA 2XO7A 4M7YA 1AFIA 4HHTA 4DSIA 4ZVTB 2X74A 4ID1A 1BUPA 1QAJA 4I9QA 4IOXA 3DLGA 4O3OA 1RHJB 2BV3A 4C80A 3HRDD 3DYAB 3OYJA 4AM7A 3N9UC 1LOUA 3VAHA 1MMNA 3OL8A 3MDCA 4P0QB 2W9CA 3ENHA 1CS4A 5KAIU 5D4OA 1FXDA 1D8BA 3DHXA 5J2BA 4RBTA 1YJVA 3DJCA 2HMIA 1ELOA 4HHUA 3ZDEA 4F92B 2UVVA 3I0SA 2JWKA 2KO1A 5KFMA 2MQQA 3PVXA 3KWGA 3TSUA 3N7PD 1KWMA 4A8QA 2ZJQL 4NZ6A 5FROA 4PZNA 3PDNA 1RWNB 4BRNA 1NU4A 2HOIA 3CPWM 2BGWA 1RDCA 3O4QA 4U95A 3WK4A 2O66A 4M3ZA 5U47A 1NB7A 2QW9A 4CI6A 1AB8A 1FVQA 4RZRA 4DMNA 2WB1D 1R8HA 4YR3A 4KGXB 4OYBA 3R5GA 2HFUA 2GQ2A 1KEKA 3L4BC 1VYAA 3LANA 2LP4A 4NYOA 3IMXA 3H8WA 3OS1A 3R3LA 4EO8A 4CRXA 1TL5A 5KFIA 3CC2N 1UZHA 1HWUA 3MXMA 3HPOA 1VQ6S 1ZQEA 2C22A 3NWRA 4LSNA 3VGLA 3OTOF 1B0VA 3ICLA 1BDGA 2XI9A 5EE1A 3V72A 4ZPDA 2D1CA 4B02A 5GAGP 4OPKA 2V50A 4WYWA 1KQQA 5I3UB 5KFYA 2HBLA 3AVJA 3WKAA 2BZFA 1PUZA 4U7BA 1GXTA 5J1EB 2XS7A 5CQGA 4IG3A 4FJXA 5AFUA 4ZVPB 4ECSA 2RVJA 4KGZB 1OPZA 3HHNB 3C2MA 2FLNA 1VISA 1BI4A 2YKPA 4USTA 4WBFA 1GMWD 4ELTA 3JAMO 5HJYA 4CIEA 3U9DA 5GTIU 2DGXA 2C2EA 1M90O 3W64A 1HD0A 4IQUA 2BW2A 1CJVA 3SCJE 1Q8KA 5ETTA 5C2CA 3MMBA 4LVSA 4NL9A 1EX4A 4BGBA 1Q82O 5JMNA 3KJQB 2GMJA 2A40A 1RTIB 3T1HF 2GMLA 1H0HB 3CW2C 1L3VA 4CNZA 4BRLA 1Q46A 1WSHA 4F93B 1YDLA 5THWA 3V9UA 2YHBA 4B3RK 4DTXA 2W04A 4HAIA 1FRIA 3FC4A 1OSCA 5C2GA 2BHNA 4TYBA 1XR6A 1RBSA 3AOAA 2Q2RA 3U26A 1C7YA 3Q86A 2YQEA 3OYMA 2NO5A 4NI2B 1NKEA 4ZJOA 2J7KA 3UD5A 4YORA 3MR5A 1F60B 2X1FA 2VWJA 3FAHA 5K20B 1Y5NB 3A1YG 3AXMA 5F8MA 1NOZA 3LP2B 4USVA 5AKJA 2B7BB 3ID8A 3N6NA 3AGRA 1WAFA 1XN9A 4JI1J 1R8CA 4O4GB 5GAHU 1QVGM 1RYRA 1Y5IB 4ED8A 4IH5A 3KBBA 1KFDA 4P4OA 2W7OA 3SBGA 2EC2A 3QZ7A 4UBCA 4KLLA 1CEZA 4BRHA 3FBFA 1U04A 1A7GE 2A5XA 2QTDA 3AVHA 3MCSA 5D6GA 2DHAA 2KXFA 4QU7A 1Q9YA 4F71A 1YJNS 2KKPA 2GVZB 3GE1A 2P9PA 5JLHA 4NASA 4NOHA 4IOAL 4F4WA 1KOHA 3QNOA 1RU2A 4ECVA 3DNCA 4KT0C 7ICQA 3C6UA 4DR7K 4G1QB 2H4WB 3CHWA 5BOLA 4UAWA 4FZZA 3AHPA 3HFKA 1PILA 3RAMA 2B8QA 2CH5A 2PMZC 5B8HA 2ZDOA 2DNGA 3O9SA 4R79A 4WF9L 2BABA 2E4LA 4CGFA 4F4YA 5HSPA 2QB0B 1PK3A 1Y4ZB 3OVNA 5DDYA 4GXIA 5TZVA 2WFBA 3FE1A 1K8KA 4LF7J 4LFCJ 3OHRA 3AN1A 4AXIA 2OPRA 3W5YA 4NB4A 5ADXH 5AR0A 3UIQA 4NO7A 2NYIA 4Y2XA 1DQ8A 4PJ0U 3BDPA 5IM0A 3JS6A 1KAZA 3IGNA 1I94F 1PVPA 1IJFB 3NVWA 2H3EB 1YJ7A 4CZJA 4QZ9A 4GLXA 3VQDA 3L09A 3KG1A 1RTHA 1QD1A 4R25A 3H1QA 3VENA 5J2HA 1NB2A 2N82B 3M1FA 2ALYB 2ILZA 1N36F 1KCFA 1OQ6A 1WSJA 2AMCB 4CP5A 1KVIA 2G5IB 4L73A 3NL0A 1RT5A 4KLUA 4WE1B 3J80O 1VSKA 2Z1JA 2GO8A 2QG9B 1M5PC 3D5MA 1BA1A 2EQYA 2VIHA 2VPZB 3MM8B 3D6HB 2X3GA 2Z2YB 5LMUK 4MO4A 1RISA 1NKBA 4IDKA 1SL1A 3PNIA 5F8HA 4BDPA 1GLAG 4MF2A 5EWFA 4CJVA 4CWBA 4FM0A 1TAQA 3VQ4A 3TW0A 1TKZB 3RYLA 4AYBF 2KP7A 4HLBA 3ZEUA 1NK0A 1R8AA 4CFBA 5FDLB 5E3QA 4LD0A 5KNIA 2UUCF 4M3XA 4DQIA 2FD2A 3BZKA 3OFEA 3AVIA 5KPRA 4CYUA 2FZGB 1NZAA 3HHLB 2JX2A 1FRKA 2JMGA 3BGRA 1WJ9A 3KOOA 3QFWA 2F40A 2E8AA 2JR5A 5IQQA 1RACB 3VQBA 3K7RA 3QEXA 2XY5A 3N01A 4A57A 3LDOA 5CB1A 4DTNA 5BREA 4PHEA 1OVYA 4IQWA 2HNDB 2ZE2B 3CIPA 5J2JA 4PHTX 4K4UA 1H7XA 4DV2F 3CCSS 1JI7A 2D9PA 3T6JA 1ZQAA 4QZCA 3QUBA 4M63C 2L9WA 2HHVA 1T3QA 1PBUA 2AX0A 1X5SA 3IRXB 1R6YA 5AQGA 2VF3A 3HJFA 1RU1A 1KDHA 4FWSA 3DRYA 2J9EA 2D5RA 3A0IX 3OTDA 2V2KA 1N5XA 4XIUA 1REVB 3M6ZA 3VEOA 4HTUA 2H51B 9ICPA 3HM9A 1B92A 4DR1F 3C2LA 4P10A 3MN9A 3PZPA 1O8BA 1REGX 1WOOA 4IRDA 2HF4A 2E44A 3R8EA 2P51A 3ZSRA 4DU1A 1XNSA 3I76A 2QI2A 4JP8A 1NK9A 4IQMA 4NXMK 2J9DE 1SB6A 1NHKL 2R7WA 5DG9A 4UB4A 2OXOA 2HWTA 3TQEA 2UXBF 4RQ4A 1B4SA 1FEEA 4ICAA 4LIWA 1NI3A 3F44A 2I7NA 4M5JA 4GKKJ 3O3GA 3KK7A 3TAGA 2DY4A 5HMXA 1IG9A 4UZBA 5J2MA 1VHFA 3ZFVA 4NXNJ 3EE8A 3KZIU 3RJKA 1WI6A 4I56A 5I3UA 1KXPA 4QOZB 4ED3A 5HRRA 2CNLB 1PAEX 1H7WA 2H3ZA 5EDWA 1F3VA 1DQAA 1WEZA 4LR7A 3CCLS 2Y1IA 2H5JB 2Z1IA 3K9KA 1FCAA 1KC8T 3ISZA 5F8JA 4J9QA 1SI9A 3M2VB 5ALKA 2CRXA 3C95A 4RW7A 1X9SA 1M1GA 4Q0BA 5C12A 4EX6A 4ZLPA 5J0PA 2P9IB 3TPQA 2IVNA 1NSPA 3LM2A 4Z4FA 3QBCA 3D2EB 2GX8A 4BRPA 1HA1A 2QM1A 3CCMS 5CYQB 3ZO7A 2IJNA 3JPNA 3TA1A 4CDIA 1JALA 2G8UA 1T0TV 4X66K 2VG5A 1HI1A 2CJYB 3N4PA 3QIPA 1U1LA 2WF6A 5C42A 5IV4A 1C0TA 3TUJC 3NNCA 4JI8J 3AJ1A 3D2QA 4YDUA 4H03B 1HNWK 3KJNB 2P9NA 1BHNA 2XYPB 1Z26A 2FLLA 3CNHA 2ZJPL 2BCSA 3HZEA 1V9OA 2ZUAA 1RTIA 4CECA 3M8QB 1HPMA 3CJ8A 3ZNJ1 4E89A 3RJHA 4HKQA 3CM5A 4P74A 5DB9A 3TZYA 1ZBHA 2XHBA 3NGIA 3EM1A 2XO6A 1U2VB 2GQQA 3H0PA 4OHZA 1Q8LA 4DR6F 4RJVA 3CDUA 3OVBA 3CRXA 4JI6F 5HK4A 2L5YA 1KAYA 2ZH9A 4UB2A 2G09A 5KFKA 3A8EA 5DS7A 1MW7A 5D4PA 2GIQA 4MYTA 3O2IA 1NHUA 2ZKUA 4OPJA 4MK8A 5AK4A 1HFEL 2GCFA 3G96A 3NFAA 2YY3A 1YITN 4C1NI 1VGYA 1VQPN 5A2QU 1K73O 1XERA 2P5VA 4OJRA 4KLFA 1T9XA 3FZLA 1Y0HA 4DUZK 4CO2A 1IWGA 1FFWB 4DV5F 3ZC4A 4DV0F 3HFZB 2ZD1A 1VQON 4CJWA 4K4XA 1IBKF 1L8LA 4UAYA 2KFYA 3DRSA 2DGVA 1JLFA 3C1ZA 8ICNA 3K58A 4V19J 3SJJA 3QFUA 4LR9A 1L7MA 1X5TA 1RTZA 2EXUA 1LWCB 5CA7A 2NUHA 5H9FJ 1HI8A 1Q8BA 2WVDA 2JLFA 3J7ZO 2KV2A 2R42A 3RB0A 3QDKA 2IVMA 2V52B 4ANDA 3PRBA 1TFYA 3MM5A 2LEPA 1VCTA 3O9QA 3ULDA 1GX6A 3D7EO 4AYBD 3EL2A 3IDHA 1R0CB 4XPEA 1R0BG 5ALYA 4OI4A 1UA1A 2I0XA 4IZ9A 3L2VA 1FO1A 5FLXU 1NGBA 2MZRA 1TKXB 5HLFB 3VQAA 2LEAA 2BJ7A 3L2QA 3TRGA 1V5IB 5M1PA 1EQMA 4J90A 1Q0NA 1FRXA 3QU4A 2XSJB 5GMDA 5AQRA 4KHWA 5JXSA 3QSIA 3BB5A 1NBEB 2DR9A 4R8UB 1X0FA 3CEDA 3SMPA 3H25A 4ED7A 1VHIA 3C1YA 3UI3A 4Z6CA 4K41A 2AD9A 4QCLA 1EB0A 1Y5LB 4H4OB 1GT8A 2O01C 4FO6A 4EMDA 3DLBA 2MKKA 1NGFA 1K1QA 5B0DA 1NNEA 4Q7AA 1DARA 1NK7A 3O80A 5BPCA 3RJIA 4M1KA 4B1UB 1FRMA 2UUTA 4WFZA 1S1XB 3HKZF 4H0OA 2L9DA 4OZ5A 2W8KA 1PK1A 4GO5X 4JI5K 2DL0A 4O44A 1G15A 4KMOB 2XZWA 2JH1A 2LA6A 4CHNA 4B3MJ 1WF1A 5CXTA 1BQNB 1FK9A 2CZVC 4Q2LA 3AUOA 4FLVA 2WAQF 5GIOA 3KKFA 2GAHC 2NV3A 2JVRA 4O8KA 1SL2A 4JI3F 5AKYA 4C23A 1FX2A 4TNOA 9ICEA 2R9LA 4OYOA 2CJXB 2OJ3A 3ITHB 3PW0A 4BY9C 1GTHA 5HVHA 1L7PA 2BJ8A 4LF5K 4ILHA 4CZCA 3F5TA 3ILJA 4M7XA 1IQZA 2FPMA 5HI7A 4WKRA 4BWJA 2B5JA 3GCXP 3NGSA 5GIPA 4DCHA 2PFOA 2DNYA 1TQLA 4CGGA 3LUYA 1RWWB 1FEHA 2ROGA 1C20A 4B9QA 1UJ5A 3PSPA 5BRDA 1N33K 2RHQB 3LPEA 3M4XA 3GIMA 4KLMA 3D7SB 3IXQA 1I3AA 4P4MA 2W8LA 4CF2A 2VFVA 4W90B 2QA4N 2ZUDA 2VJ5A 3CB4A 5JMVA 4M5GA 1XSNA 5F2RA 3D45A 1FE0A 3SR6A 1RDUA 3G2XA 1SV5A 3NKYA 1RXWA 5J0QA 3BGOP 2E88A 3KFUF 2ZH8A 1HMVB 3MEEB 5LT5A 3H98A 4DI6A 4NM2A 2D9OA 2QXFA 4M94A 1S6OA 2JEJA 3CDEA 4LBIA 5ETPA 4EZ9A 9ATCB 5HP1A 2B4UA 3MPVA 3B8AX 5BYQA 1N32F 1SZ2A 5IOLA 3GDXA 4LF1A 1CRXA 3DOMA 4OYXA 3KXDA 2GUPA 3BH7B 2FUG9 3HX9A 4PHDA 1NU0A 3MHYA 4PGXA 8ICZA 5DO2A 4KAZA 2FSKA 2P9UA 4FVCA 1WUDA 1PSDA 4DL4A 3OR2B 1XC9A 4P2FA 3CCJS 1TMJA 5IS2A 2J7WA 1RWUA 3VTHA 2PFFB 1RP5A 3ZTPA 1CULB 4E7IA 3M7VA 3ELHA 4KPCA 1JJ2M 4YFKA 3G6YA 4UB1A 3H45C 3OPXA 4B9SA 3WC2A 4RW6B 2LDYA 4B9TA 2E2PA 3UM9A 1IKXA 1VQLN 1I39A 4RQ0A 2MHNA 3FR0A 2L9NA 1V5VA 4LFBK 2KZZA 4YXMA 3OL6A 2KLAA 5CE3A 4Z2XA 4FZXC 4I2QB 5L39A 4YB1P 3LK9A 3VGSA 2P2CB 1WTFA 4KGVB 2BA9A 1ZBIA 4WZMA 4OIXA 1RAAB 3HDSA 4Y65A 2DGWA 3CFPA 3S8SA 2D3UA 5C2FA 4DOCA 2DRBA 3EY1A 5GAGU 3SFUA 1KTQA 5CZ1A 2ZJRQ 1RT3A 3BN7A 1S6PB 1YJ9N 5GAEI 4IKAA 4YY3J 4IOCL 5CZ2A 3UD4P 4YOTA 2CJ9A 3GSIA 1S1UA 4ISEA 2RHSB 4CD1A 1FX4A 2MKHA 4H4KC 1NZ8A 3BF1A 5SZTA 1VI7A 3N5BA 1TMMA 4ZVOB 2Z2ZA 4JKDA 3MWTA 4YOVA 4IFYA 3CMQA 3VAJA 2FMQA 5HO4A 4DV6J 2NSBA 5AM1A 1KN6A 2ISPA 4PG6A 4X4QA 3LDSA 4FXWA 4MFBA 4ZITA 3NGTA 4DOAA 2G9OA 2EAPA 5EWGA 1E6YA 3U9ZA 4M3UA 1G4CA 4I2DA 4DPOA 4OJHA 4JB8B 3AA5X 2QMUB 1XJWB 4PY5A 1WG5A 4YMNA 1HYSB 4DL2A 4FJKA 4CF0A 2P1JA 1N5QA 3UMBA 3HFVA 4L3NA 1YJWS 3SI8A 1T95A 4KTZA 2F8TA 4FYWB 1JMSA 5AJ3J 1S97A 4Y2IA 3HI0A 4CEOA 2M5YA 2MQLA 2LKZA 5L8RC 4IRKA 4QZBA 4JV0A 3CM6A 4E19A 4WU2A 2XLKA 4OLAA 2Q97A 1TL4A 3ZLJA 2M9NA 3U3GA 4O3QA 9ICLA 3RW7A 3IA0A 1IV8A 1ZH5A 1ITPA 4HHJA 4EUVA 2IA0A 3QIDA 4DV1F 3VEVA 5FRNA 2NNWA 2N3OA 5KFUA 1UPHA 5A2QY 2NRRA 5KT7A 3V7LA 2D74B 4ZCIA 4OCZA 2M3DA 2VG6B 2DGOA 4B8AB 3ONNA 2P9LB 2MRLA 3V1OA 4N76A 4W5RA 4KHPJ 4XDCA 1ZQXA 1F44A 2ZNZA 5FPEA 4ZLNA 4G9BA 4FK0A 2RIJA 1IIPA 5DQGA 5AQNA 2YMMA 4RL1A 4FLXA 3H42A 5EUHA 2IC3A 3ZDDA 3R1LA 1EAYC 2AJ0A 4FCYA 5B0EA 1KFSA 1HHTP 2XB2D 4ANEA 3L3VA 4ILRA 1IKVA 2E8PA 5AQKA 4Y1CA 4JV5F 8ICCA 2EVZA 3FNNA 1KD1T 1CZAN 3C2PA 1D8LA 1YT3A 3VWSA 3T79A 2YN4A 1QCKA 2CAJA 2K1RB 2PXIA 4TU7A 3RMCA 3MDAA 1WWVA 1HBOA 1IBLJ 4E2FB 4Z4CA 1X31C 2KQ2A 1VK3A 3JPTA 5D78A 2HZVA 5DMRA 5KRSA 1WNSA 1MROA 4CDGA 2KG5A 5FD1A 4Z4GA 2FDRA 3NBPB 4IBNA 2C3YA 4DR3K 1WG1A 3ETMA 4ACOA 3KVGA 2DHGA 2IRUA 4DU8A 1FWLA 1T7PA 4L6V3 3MAQA 2XRIA 1BQXA 3OR1B 3R6MA 2EBGA 1C1BA 4F67A 3H3OB 1FFUA 1C1CB 3F53A 3AA9A 4A2BA 3SMVA 4EX7A 1JJ4A 8ICRA 2IPOB 4M3RA 1YSJA 2DFLA 3U27A 2A41A 1K1SA 3TOQA 3MBYA 2VA8A 3QNWB 1DKGD 1D1UA 2KZMA 3M6KA 4TUSA 5D49A 9ICXA 2E5LK 8ICMA 4PL7A 1XSPA 1P9YA 3W66A 3I55N 4ID5A 1FDAA 3GB0A 2EHGA 1TP7A 1YRTA 2R7YA 3KHRA 2CZ9A 1NZPA 2DH9A 1BUXA 1CBKA 2HHUA 2IA6A 1U1KA 3PJWA 4ZOSA 5BPNA 1HNZK 4JV2A 4ILLA 2WRMA 2G0CA 2AP6A 2JC0A 2QWNA 3CC2S 4DX7A 2VGNA 4NLYA 4ZJQA 4NLTA 2QL9B 4BQZA 1KBUA 3R5BA 5J2PA 3A3OB 2O8DB 1JX4A 1NMNA 3HO1A 3WEEA 2CQ1A 3GIIA 3IAS9 5CR0A 1YWXA 3T1YK 3SQ1A 2A1SA 1IKWB 2YNGA 1IUJA 1X9XA 4WIQA 4O23A 4FBUA 1K44A 5D0RA 1YVNA 3KIOA 4B9MA 3MF5A 3C29A 4KQZA 1CVJA 5G4DA 2ASPA 2KD1A 4RQ1A 1YI2N 5ALTA 1ZQWA 2Z56B 3F73A 4DOZA 2YWFA 2HSZA 1HX1A 3EYZA 2V8PA 4F0KA 4U96A 4RNNA 2LYVA 3ZZZA 4HVZA 4DTPA 2W7PA 2A18A 3M6WA 3KLFB 1M0SA 1TV6A 1UPMB 3WZ0A 3VAMA 4KLDA 2ZTDA 1Y00A 1Q16B 4ZA1A 2DH7A 3ORYA 2V0NA 4ZPBA 2HFOA 2GBZA 3HD1A 2J0SD 1LB2B 3E58A 1WORA 4Y2KA 1QS4A 2GHVC 3AO4A 3DGVA 3AY0A 3M8PA 3TJ8A 2HGLA 2MA1A 2HFSA 4LSLA 3R9KA 3M5RA 3UN5A 3O4WA 3OD2A 4IJNA 3JSRA 4OPAA 4PZOA 1RLCL 3IG1A 4X4NA 1N34K 3H08A 4B3RJ 3UR0A 3ZD8A 3PIPQ 2G1HA 2W3SA 3ZSVA 2F4VK 2LQ8A 3DXSX 4HTLA 2FIUA 2M0NA 3TA2A 3ZZYA 4LF9K 1HBMB 5AI4A 3LGMA 3VQSA 2NPIA 4RW8B 4ZPWR 3C15B 4UB8U 1U09A 4UTGA 2IHNA 4JK1A 1UVMA 1XI1A 2VQFK 3TTFA 1HR0K 4DQ8A 2BKNA 5ALIA 1SV0A 1ZQQA 5HHIA 4QZGA 1N5TA 3DXKB 5AQWA 3E8OA 4YB5A 2E1RA 5EOZA 1Q86T 4DFDA 4RNOA 3DDKA 4MYUA 1Y3JA 3BN4A 3V7KA 2W7AA 3X3UA 1U24A 1HPZB 3OTCA 2RRBA 2OYYA 2B4PA 1WC6A 1RHQB 4DQPA 9ICHA 3KNGA 2EFPA 1KC8O 4UUXA 2IY5B 4KLSA 3V9XA 5F9NA 2C2KB 3R2DJ 4DSEA 4XTTA 4PRFA 3CJ9A 4OJ5A 3K5MA 2RUSA 1HYSA 2A0FB 1IKYB 5KL1B 1HQUA 1LWXA 1RT6A 3TJAA 1IJEB 4DR7J 4OZLA 3MABA 1YAGA 3P96A 5EWEA 1HD1A 1Z3EB 1RXVA 1RAFB 3CCRS 8ICIA 1QAXA 8ICYA 1ZQLA 1K47A 2E20A 4C8OA 5IZHA 1HNIA 2AJ4A 3IN5A 4I2HA 2QGFB 2F44A 4B9LA 1NK5A 2O8CA 2YHAA 2DPNA 2LEBA 1YXQA 1VQ8N 5EX3A 4KAIA 2IOFK 4FJMA 1T8EA 1GTEA 4K2XA 3OYAA 2QYCA 1XC3A 5EU7A 3RSEA 2MZJA 1FRJA 3SENA 1FNMA 4ECXA 5IC6B 3QBXA 1HKGA 3NLCA 4M9JA 5IT9Y 3O4NA 1ZQGA 1GQEA 1S5LU 4OI6A 2V8HA 5J0SA 1SC3B 4LIRA 2MSNA 1XMQF 4DF8A 3MZIA 7ICPA 4HACB 2P5GA 2KIVA 1S72S 3QO9B 3AT1B 4Z6DA 3TACB 2CDRB 2IAJB 4Z37A 1SH0A 1Q4RA 3H2LA 1Z1BA 1U49A 2VFSA 5B5EU 5LMUJ 2DUYA 4NEYA 2DGTA 2HRYA 3BQ1A 4DUYK 1F5AA 4CFCA 4FZMA 3PTWA 1WSIA 2BJ9A 4P2SA 2D3OR 2DJWA 4R5PA 1FKPB 2P8IA 3US5A 1X60A 3V9SA 4DX5A 2NR0A 2KVSA 2DNQA 3NBPA 1R0AB 2DT9A 3GDQA 4BC2A 3LPYA 4EYIB 1GLJO 2EKNA 1WUUA 2IJFA 3J81O 7ICFA 2XC9A 5K5MA 3FVYA 2VC0A 7AT1B 2HFVA 2OIHA 3M32B 3L7PA 3CD6N 4WFBL 4FJNA 4QJVA 1S1TB 2RAQA 4WYLA 3DGPA 4K4YA 3T69A 4FYVB 2Q1NA 2ZWHA 1RT7A 3QLHA 2KB2A 3F2DA 1S0NA 3N79A 3JQMA 2MLZA 4LH5A 2MMYA 1ILYA 2RILA 5DM6Q 5KT4A 3F2CA 1Q78A 2E5JA 1TL7B 1F9HA 5HQMA 2V6AA 1NPRA 3BY5A 4FSVA 1TU0B 4BLGA 4DL0C 3I0RB 3O44A 5B0BA 4KHRA 3J7YI 1KHWA 4CF1A 4EK2A 4BG8A 2KFZA 2HVZA 3BS5B 2CPDA 1NGDA 3KHGA 2ZBPA 2KMDA 3CJ2A 1X4AA 1U1QA 4HYKA 3AQPA 2H4YB 2E5SA 4BR0A 2GNKA 1PC4A 3S01A 2A19A 2HVEA 3MPDA 4YHHK 2LMRA 4KH6A 1A6SA 4YNQA 1P6TA 1X9WA 2O8DA 2A6MA 1TYQB 4CJRA 1QQ7A 2EI5A 2HDOA 1VQ5S 3RJGA 3L95X 5J29A 4NXMJ 3VAKA 1RDBA 3D2NA 1RSCA 2Y8WA 2O8BA 3VGMA 2LQ5A 2ES6A 2E1ZA 2DY9A 1KKXA 3UNGC 3W9IA 3THXA 5EE3A 1IV0A 2EX3A 1R31A 1MMLA 1DK3A 3I5AA 2DFFA 2GAGC 3C21A 3R6GB 4C7QA 2XSFA 1VAZA 3D54A 4YP3A 3H0MB 4CM0A 1URNA 3GU0A 2B6AA 3DDIA 3PO4A 3QETA 4RW9A 4W5NA 3VGKA 3KJVA 1M1KO 3UQ2A 3CULA 4DMZA 5LMNK 5LXRA 2A10A 3OV7A 4Z7CA 3P39A 4AHCA 2NZCA 3S9HA 2BDPA 1UT5A 4G65A 2UUCK 5IWAK 2MY7A 2VOOA 2W9MA 1VK8A 1Q9XA 2P35A 1ULRA 1Q8IA 3H5XA 2O67A 2D0AA 3WNHA 2YWHA 1ZM4A 1WI8A 3RRHA 2C28A 3NAHA 4X66J 4KHMA 1FDDA 3F5AA 2IM2A 5F9LA 1RDDA 2WVEA 3PLAA 2V4RA 4CO3A 3SDEB 1HNWJ 3JYTB 3K5NA 4DPYA 1EQYA 1JQGA 4NLPA 3D2FA 2HEKA 4C7YA 1MQ2A 4LJXA 1JXLA 5H1SV 1GMVA 2H3FA 1QDUB 3KD5E 4FJGA 1XO0A 5DG8A 5DM6L 4KBOA 4CI0B 4KHSA 4I2PA 3PYFA 2RHFA 3AL0B 4IFVB 1HBMA 3D1QA 2YMPA 1RDWX 3MN7A 1YITS 2BUPA 4C48A 3NF9A 3H7HB 2M9KA 1VDHA 2IJRA 1B99A 3NMRA 4MF8A 4KI6A 3DRRA 5CHIA 2OSRA 4PYAA 1NO8A 1U7LA 2AYEA 1VQOS 2RE2A 5KFGA 1WOSA 8ICTA 1YIJN 1NJWA 4LH4A 3GQCA 1X3MA 4JI1F 2ESEA 5FJ4A 1JIHA 1HQEB 1X5OA 2CA9A 3M1VB 2IHR1 4DUZJ 5E3AA 4FBTA 3FFKB 2J8SA 1CLFA 3HHLD 3NE6A 1ZD2P 3CPWR 2CPFA 5EX5A 2XLJA 3G8TA 4DU4A 3U1NA 1H38A 1WYGA 1NCLA 4CH1A 3MMCB 5A8WB 2RQKA 2J8AA 1NM1A 4KLHA 3PEJA 4FN5A 4N41A 3EZOA 3U02A 1WOQA 3CCUS 3T41A 4ZP8A 2W03A 2F8HA 2YNHA 1X3NA 4I67A 1RBLA 1KQFB 2RT3A 1EZZB 2MUTA 2WW8A 9ICOA 4NMXA 2FMPA 1D3WA 3HD2A 4LF7F 4CFAA 4LFCF 1IG8A 1N48A 3CCQS 3V81A 4Y2YA 3SBMA 1GAOA 3K2PA 1VQKS 1HLWA 9ICTA 3CJAA 1S79A 4B1WB 1X6JA 4I6YA 4ZIWA 5LJ3Y 4E98A 4BRDA 4JI7K 4FF3A 3DI6B 4OHYA 1U45A 2DGQA 3ZZ0A 1B22A 1OVQA 4EHUA 5KT2A 5J0RA 1S1WB 1VR6A 3QEVA 3DLEB 4F5NA 1FJGK 3R7BB 5HATA 4P71A 2A42A 3PCOB 3VALA 4WP8A 1RBVA 3OHAA 5AQUA 4UB6U 2JSXA 1AW0A 3MM7B 1DTQB 1FRHA 1BMQB 4UOGA 3TZZA 4K8ZA 1NJXA 1NXIA 4PXEA 2AF6A 1SV4A 4DOBA 3IR6B 3WXMB 2KL8A 4PEOA 4LRCA 4B3OA 1OQ3A 5J0XA 1P7DA 2MLYA 2VDIA 4DO9A 4K4ZA 3RFAA 5HROA 4FK4A 4JI5J 1L3SA 4ZVQB 2QKQA 2XI3A 3S41A 3VQ9A 4IKFA 3L3FX 3F9MA 5D3GB 2VPWB 1XIQA 2X3DA 4M63A 1VLOA 1ZAXA 3ED5A 4C4TA 1F0MA 4URQU 4BRFA 4Z7YA 2DWQA 4BVPA 4DV7K 3F41A 4CLYA 5HMLA 1R0AA 1JCGA 4IYQA 2O3DA 3WXIA 1RA7A 3LALA 3UDVA 4TSXA 1JB0C 4PL2A 1QQ5A 1MU2B 1HJPA 2JL9A 1VQ9N 2HHQA 1FE4A 4RWTA 3SQGB 1PYSB 2LM1A 5J2IA 4UAUA 4LF5J 3TUZC 4FK2A 1Y9OA 5GADP 2DFHA 4X4UA 3QX7A 4L3KA 4CO0A 1LW0A 2H5XA 4P2MA 5FPNA 5KPTA 5J2QB 1W2IA 1RCHA 1N33J 2D69A 1QVGR 3M30B 3J8AA 4RQ8A 1BISA 2JFDA 1TL7A 2LCWA 2KHDA 3FBEA 1HWJA 2C2ZB 4RW4A 2Q0UA 3LGNA 3KOAA 4TLQA 1VC6A 4FXDA 3EKSA 3PW2A 3JQKA 1ZOLA 5DM7L 2HHHK 1LWEB 3IRWP 4LY7A 3ULEB 5JTIA 5G5HA 1SIJA 2FHKA 4JKHA 4DV4K 3DU5A 1CQNA 4FJIA 2D1KA 1KD1O 3GJQB 3FYHA 4YVZA 3LP0A 4ZHRA 3LP1B 1HNVB 5AKZA 3P4IA 2FC8A 1JLAB 4GV9A 1H2TZ 2X51A 4GC7A 4CFDA 3LH2S 1X9MA 1EJ7L 1DURA 3UN2A 5L1JA 4CIOA 5IIIA 2YWGA 5HHHA 2YTUA 4LRAA 2R4FA 4LF4K 5AZJB 4CEDA 1TVRB 4ILMA 4C9DA 2Q36A 1KRPA 4RQ2A 2N4CA 3TNVA 2V9KA 4GKKF 2M8HA 1CG2A 2MZTA 3T5JA 1BL3A 2W01A 4NLSA 4ISFA 3RBDA 2HSEB 4NXNF 2OPPA 4LUBA 2YX8A 4DL5A 2YKNB 4X4TA 4F4XA 1F2HA 4CK2A 1FF2A 1VQLS 1LWFB 2H65B 3A3PB 4RQ7A 4I6MA 5IFMA 1VLYA 4ECTA 2DNKA 4G1PA 2VHGA 2QV6A 2VOPA 3QGIA 5JJBA 3FKBA 3P4UB 4J2DA 3TADC 1RLDA 2AJ1A 5IIKA 2VFTA 3WX4A 3TAMA 5T14A 5J2DA 2ADCA 3SI6A 4RKUC 2WSCC 2DXEA 3NOGA 2AGOA 2F1FA 4LFBJ 1B4FA 2IDEA 4W98A 2GS8A 4US8A 4C4SA 3VMFB 2UUBK 1YJUA 2ZIUB 2EZXA 1RZMA 3IV6A 2YX1A 4Q2MA