4B9TA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -dc basepair in the post-insertion site.
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9tA01
4O5CA 1C6VA 1LB2B 1CZBA 3JSMA 4M6WA 4K8ZA 2V4RA 1ZQVA 5J2CA 3MFIA 3T19A 4QCLA 3QLHA 4P4MA 3ZSXA 1YVUA 4KLIA 3RRGA 3K5OA 2ZQBA 4TURA 3LALA 1ZQFA 4DQRA 1SZPA 1KLNA 2XO7A 3RMDA 4DTRA 7ICMA 1L3VA 3PX6A 4EEYA 4DFJA 2BCRA 5IILA 1ZQKA 3VA3A 3TAPA 2GWSA 1TV9A 1N5YA 1RT1A 3K57A 5EWFA 2J6SA 2QKKA 3V7JA 5IIOA 4OJRA 3KKSA 1BPXA 3MDCA 4RW4A 4YR3A 3CFPA 1ZQGA 4AHRA 3BQTA 3S3NA 2RF2A 2W9CB 2XY6A 2A1RA 5DB6A 7ICTA 4M47A 2ZE2A 4OLAA 3UPQA 4CJWA 1TK8A 1IKVA 2V9WA 2BE2A 2IHMA 3SUQA 1Z00A 5DMRA 4NCGA 4PGXA 9ICCA 4YXJA 3RBEA 3V9ZA 3RWUA 4DFKA 1NK7A 3V81A 3VQ6A 4FM1A 3IHQB 2DY4A 1TK5A 4F2RA 4CFCA 4FJMA 3OYHA 4ZTFA 8ICTA 1XHZA 4UB3A 5J0UA 4DSJA 3HPOA 5HRPA 4DF4A 4J9QA 2ASLA 3AA4A 4CJ5A 2HW3A 3SI6A 2XY8A 4CK3A 4NLKA 4KLMA 1D8LA 4B9UA 1ZQNA 3PMLA 4P4OA 4LH5A 4RPZA 3L2VA 4NCBA 3L3UA 3ZDAA 3TFRA 2W8LA 3O4QA 4KLLA 5D49A 8ICPA 1D5AA 4MF8A 1ZBHA 4IFVA 4FXDA 5KRSA 4IBNA 4I27A 3VQAA 3C2LA 1UAXA 2OPQA 1WSFA 2PFOA 3SCXA 1NK5A 3NCIA 2MAXA 3EW9A 3KHLA 3THVA 3QO9A 3C21A 8ICYA 1RDCA 1WN7A 4KLUA 3DRRA 1Z3EB 2DPIA 5DKWA 4QWEA 1S1TA 4XUSA 2JZBA 4KLJA 2BQRA 3V6HA 4O3SA 3V9XA 3ZSYA 4ECUA 5E41A 5HHIA 1RCHA 1F21A 4LZDA 3QZ7A 1TV6A 2RN2A 5T7BA 4RQ6A 1ZQMA 1S5JA 1TKZA 3DOLA 2W9MA 4BDYA 2OWOA 4KPYA 3I0SA 4CGIA 1Y88A 1DLOA 3BQ2A 4JUZA 3C23A 4CK1A 3QNNA 1IH7A 2FMPA 3SYZA 2FLNA 3VQPA 4JWNA 3O4NA 1S6QA 1U45A 5KRTA 3HK2A 1QSSA 1Q9XA 1LW0A 8ICVA 2R7YA 2EHGA 3HP9A 1MQ2A 1ASVA 1GOBA 4H4OA 9ICRA 4FZYA 4DTPA 5KTQA 4ID1A 1WCNA 2AU0A 4DTXA 5KFOA 2ATQA 4RQ0A 4KN4A 1C7YA 2WONA 2XY7A 4QZFA 5J2BA 2ALZA 4CIEA 3O3GA 1NK0A 3OSPA 3TFSA 3C5GA 1B43A 5L1IA 1XSNA 2LSNA 3KIOA 5KG1A 3AA5X 2DFFA 2VA2A 3RAXA 3IG1A 3KLHA 4UB4A 4ECTA 4K4IA 3L2RA 4CEQA 5DK5A 4B9MA 5JS2A 1NJWA 3ORYA 4DOBA 5IIJA 4RQ5A 2FMSA 3IM1A 1U4BA 4I2FA 2ZTEA 8ICOA 8ICKA 3TAEA 4Q44A 2P6RA 2QKBA 4Q8EA 3K4GA 2XCPA 2C2DA 4QWDA 4M41A 4O3RA 1RTHA 3V1QA 1T3NA 4KHWA 1VSEA 1HYSA 4FZXC 1KRPA 4HCBA 1NKCA 5J2HA 5KG0A 4YFKA 4K8XA 3L8BA 2A1JB 1XSLA 4X5VA 8ICMA 2IA6A 4RUCA 4DL2A 1GOCA 4O44A 3NE6A 5I42A 4JRQA 1WNSA 4CERA 4F3OA 1FK9A 4KI4A 3KKRA 1FXXA 3WNGA 3KHHA 2P51A 3FFIA 1JMSA 2W9CA 4M45A 3KLGA 4I2QA 1Z25A 5KFKA 4O4GA 4KB0A 4CJLA 3O3FA 3V7LA 5F9NA 1ZJNA 1KVAA 4DL7A 1S1WA 4DFMA 1NKEA 1WLJA 1SKWA 2YNFA 3C5FA 3SQ4A 4DSEA 5J0YA 4YP3A 2R8KA 2IMWP 3OYNA 4KTQA 2KN7A 4ED3A 2RPIA 5J0SA 1JLFA 5BPCA 1RYSA 1S1VA 4E7KA 4H4MA 3UQ0A 5J2KA 4CF1A 2VWKA 1I3AA 3EPGA 4RQ7A 3MR5A 1RXVA 4IRKA 1FKPA 2MUTB 3QETA 3AVBA 3QEBZ 4FO6A 5EWGA 4I2GA 4CF8A 2G8HA 3Q8RB 2DFEA 2ZTCA 3ZT3A 3MECA 3GIJA 5J1EA 5KFIA 1JXBA 1TAQA 3K5MA 2UVUA 4UB2A 4O5BA 2VA3A 4FK0A 4RQ3A 4OLBA 4KLSA 2IC3A 1S77D 2ZD1A 2PI4A 2J6TA 3RB3A 1VK0A 3EPIA 3LDAA 1JLCA 4I2BA 4PH5A 2OPRA 3MXIA 4DQSA 4RNMA 3JPOA 3G0ZA 3C1YA 4CFDA 1ASUA 4CGGA 9ICAA 2VG6A 5KFSA 1V9PA 4W5RA 5DQHA 2IAJA 4J9SA 4M3YA 2ZJAA 3AA3A 4JLHA 2WTFA 3ZCMA 5J0WA 4E3SA 4ZH4A 3LZIA 2OYQA 4RG8A 1HUOA 3AO2A 2Q3SA 1HNVA 4CJRA 1LV5A 3SUOA 2Z1JA 2R8GA 1RT2A 5HRRA 1O1WA 4FJKA 1ZQHA 3GDXA 4M9NA 1K1SA 4KHNA 3AO3A 2UVVA 9ICNA 3HSTB 3MEGA 5L1LA 2G8UA 3N97B 4ECYA 2Z1HA 1IO2A 1S9EA 5CYMA 4KLQA 5KFNA 1CZ9A 1BPEA 2G8FA 5DDMA 1X9MA 1S0NA 2GBZA 3BDPA 2F1HA 3ULDA 4IRCA 1N6QA 4F5NA 1RBSA 2DFHA 4J2BA 4R5PA 4CFAA 4W5NA 5F9LA 4DO9A 1HQEA 3LZJA 5CWRA 2B5JA 3QIPA 2LYHA 2JEIA 4MFCA 1NOZA 4EBDA 4J9RA 4F91B 4ELVA 1RBTA 2DTUA 1U47A 1N48A 3B6OA 4F5OA 2XCAA 9ICHA 3T3FA 3CG7A 4R64A 3AVFA 4R65A 2A1SA 3KTQA 3T1AA 4I7FA 3JPTA 4CIGA 4M0AA 7ICKA 4DTUA 3LP3A 4ECSA 3M9OB 3G6XA 5C24A 4DTNA 9ICWA 3SPYA 2VG7A 3ITHA 5KFJA 3K5LA 2BHNA 3MR3A 3PVXA 3RJJA 2D0BA 2A1JA 1KLMA 1JN3A 2XC9A 3WNEA 3OYJA 3M8RA 5CHGA 5J29A 4BXOB 3SUPA 3DLEA 3KD1E 1TK0A 2FBTA 4XA5A 1WCLA 4JS4A 5C42A 2X74A 8ICCA 5IIIA 4O0IA 2O4IA 5DB9A 7ICPA 4DS4A 3ALYA 4UAYA 4Z0UA 3KJVA 1J53A 3AU2A 4CHOA 4F3TA 4IDKA 2R8HA 4Z4GA 4J2EA 4QAGA 2F1JA 4O9MA 9ICLA 2ZUCA 2W42A 4RZRA 3C6UA 4AILC 3V72A 3MEDA 1HYVA 3VQ5A 4P2HA 1EXNA 3TAFA 3HW8A 4DLEA 3MFHA 5KG6A 4FM0A 3U6FA 1ZQEA 4CF2A 4FJJA 1BISA 3OS1A 4KHQA 5CZ2A 2F8SA 4Q45A 4ED2A 3RB6A 3JPNA 3AA2A 5EWEA 3K58A 3KHGA 4OPKA 4MEYA 1D9DA 3DM2A 3M8QA 3QZ8A 3K2PA 3TAQA 2MUTA 1T7PA 2UVWA 4WE1A 4PQUA 1JLEA 4E19A 4OPJA 3HXMA 4E7JA 3ZDCA 3UQ2A 4KLGA 4QZGA 2XHBA 2XGQA 3ISCA 4CCHA 1D9FA 3H08A 3MXJA 4Z6DA 5J0OA 4M9GA 4E1MA 2AGQA 3MABA 2DPJA 8ICEA 4DTSA 1VSDA 4W5TA 1ZQPA 4O3QA 4NLZA 5JUMA 2BKEA 3P5JA 3H40A 4DF8A 4NYFA 4MEXA 4F4YA 2IOCA 1JKHA 4C8MA 4O3NA 4DL4A 8ICJA 2XRIA 2YNGA 4PA1A 1S97A 1XSPA 1UWBA 3ZT4A 5C25A 4FLWA 5HBMA 1QE1A 4PUOA 3LPUA 2NRVA 4DOAA 2HVHA 2KTQA 4B3OA 3NGDA 4FJ9A 4EYIB 2RKIA 4BWMA 3HVRA 4DSLA 3KLFA 4I2EA 4NXZA 5J2IA 1JX4A 4AHVA 3QESA 3ZSOA 9ICPA 2ZJ8A 2FMQA 5HMLA 1YTAA 4XRHA 3DLHA 5J0RA 4Y1CA 2FLLA 2C2EA 4KLOA 1SUQA 1NOMA 4RT2A 4NLGA 1VSLA 3RMCA 4J9KA 3VN5A 2HHSA 3EY1A 4FVMA 4AHTA 3RB4A 3JPPA 3G6VA 2YNHA 3T5HA 4B9LA 3SQ2A 8ICIA 3RJEA 5KFYA 3H4DA 1TAUA 1NJXA 4I28A 3AVCA 3ZDEA 4DWIA 2E6MA 4DQIA 4QWBA 1JL1A 3I0RA 9ICTA 3ZT0A 3VQ8A 1TVRA 2B21A 1WSIA 5KT4A 3QIOA 5D46A 3GILA 7ICOA 3Q8MA 5KT7A 4CJ4A 2PZSA 4RNNA 4QZDA 4YG2A 4C8KA 4GMJB 3O3HA 4DLGA 4EZ6A 1T4GA 5CR0A 1CUKA 1S10A 2F8TA 4YD1A 4O55A 4YQWA 4CEBA 3MGHA 2BQ3A 1C1CA 1NJYA 9ICGA 4UQGA 4B8CA 3OYLA 2R8IA 5KFGA 1ZQRA 5DQGA 4CJKA 1WAFA 3V6JA 7ICSA 3PW4A 1C0MA 4BXOA 4QZ8A 1D8YA 1HMVA 3L2QA 5KT2A 1TVAA 1BI4B 1EXQA 4KN7A 1EX4A 3CYMA 4CJ3A 5J2FA 4IQUA 4F5PA 3F9KA 5KG3A 4KFBA 3GV8B 4FJGA 1N56A 2AGPA 1CXQA 4Q5VA 4CGJA 3DLRA 2ZTDA 5KFTA 1QS4A 5EOZA 1UOCA 3K59A 4IQWA 5EU7A 4ECZA 4J9PA 3CFOA 2IBKA 4C8OA 3BGRA 3DRPA 4KI6A 2FBXA 3V6KA 3B6PA 4TUPA 3GFKB 1S0OA 1Q8IA 4K4GA 1EP4A 3S9HA 3BQ1A 2BCUA 2ISPA 3RR8A 2PYJA 4DTJA 4CEOA 1QHTA 2C28A 7ICJA 5SZTA 1HQUA 3LK9A 4YN4A 5L1KA 3T5LA 2RDJA 5SWMA 3H7IA 2VA8A 2IGIA 1LAWA 1RT5A 3HJFA 4FS1A 7ICFA 1DTQA 3HWTA 3T5KA 4CESA 3ZD8A 5CA7A 4O0JA 3RB0A 4I2HA 3UXPA 1L5UA 3VQQA 3PV8A 3HL8A 4CJPA 4CEAA 3IS9A 1RDAA 5J0QA 3OSNA 3NGZA 2P1JA 3RAQA 1B9DA 4BACA 3U3GA 2P5GA 4CEZA 4N41A 9ICUA 4MFBA 1AROP 4I2PA 4MFAA 4KREA 1Y97A 4E0DA 2FLPA 4F4KA 5KFAA 4N47A 1L3SA 5HMMA 2OZMA 5HLFA 3ZDBA 5DG9A 4OKEA 4ECQA 2B4JA 5HRSA 4Z4CA 4YD2A 3M8PA 1MQ3A 3DMJA 3RTVA 3RBDA 3LPTA 3AVMA 1ZQZA 2JGUA 4HVJA 2G8KA 3V4IA 2O4GA 1MC8A 1ZQYA 1FKOA 1UT5A 3V9WA 3OS2A 1ZBLA 3H8WA 1RNHA 5DBAA 5KFXA 4F93B 5J2JA 1SV5A 1UA1A 3MXMA 2V4QA 2I5JA 3VQDA 4YFUA 8ICBA 2KW4A 2BPCA 2I9GA 4FLXA 4RT3A 3SUNA 4IKFA 3Q8KA 1BPZA 4ECVA 3KK1A 4GC6A 4N76A 3K5NA 1RT6A 4JV0A 3PUFA 2BGGA 4M3WA 4YMMA 4LSNA 3AVIA 1IKWA 4EBCA 2BCSA 1XI1A 4GXJA 4ED1A 4O5KA 1B9FA 4DL5A 5CZ1A 4CJSA 1KCFA 4IG0A 1IKYA 2KFZA 9ICMA 5J0PA 1H38A 2I1QA 4FJ7A 3GV5B 8ICUA 4W5QA 4LSLA 5DG7A 1LW2A 4G3IA 4RQ2A 5DBBA 2X78A 4RW8A 2GUIA 5KG4A 2YKMA 1TKDA 2BR0A 3WNHA 2G8IA 2KZMA 4MQ3A 3H8SA 3PX0A 4RW6A 5HP1A 5J0TA 3ISNC 4GVMA 5KI6A 3UIQA 4J2DA 2XY5A 5J2DA 4E7LA 4PY5A 3RJGA 1QSLA 1JXLA 2FPKA 3NH0A 4UAZA 3DOKA 1U48A 3VQCA 1WAJA 2FPMA 3ZSWA 1HUZA 5KFFA 4HYKA 2PFQA 3B0YA 2PFPA 1XC9A 3NFAA 5J0XA 4CJTA 1CXUA 1VSHA 2ZJ5A 4B9NA 4FCYA 4DSIA 4I9LA 1GOAA 1XO1A 2P66A 4M2YA 1RDDA 4BE1A 2AQ0A 4M9HA 3QINA 4F5QA 3ISDA 1BI4A 3QE9Y 3PO5A 3KLEA 4FYDA 5DDYA 2AJQA 1X2IA 3VQ7A 1JLGA 4HHTA 4KAZA 2OPPA 7ICUA 4B9VA 4HUEA 9ICKA 3M8SA 3AUOA 1ZBIA 2YHAA 3PY8A 4UBCA 4ED7A 5IINA 3GIMA 3NGIA 4GW6A 9ICFA 1RBVA 5KFMA 4J9NA 5CJ7A 3HO1A 3PO4A 4FZZA 4NYNA 4CE9A 8ICWA 3RMAA 3HVTA 3JPQA 4HCCA 4KHSA 1TGOA 1S0MA 4FJ5A 1S9FA 3Q8QB 2ZUBA 4GXIA 3GQCA 4YR2A 1U9LA 5IIKA 1JIHA 3V9UA 3TARA 1ZETA 4DS5A 9ICBA 2YHBA 4RQ4A 2BPFA 2W9BB 1UT8A 4KTZA 5J2QA 1REVA 4KKOA 1CLQA 5D3GA 4YMOA 1BQNA 2G8WA 1ZYQA 4CHPA 3CQ8A 4RU9A 3NGYA 3ZSRA 2VG5A 2HNDA 4QZ9A 5CYQA 3RJIA 5L1JA 8ICQA 1KFDA 5KFLA 1RT4A 4IQVA 1WSJA 1LWFA 3F73A 1J54A 1BPBA 1EKEA 4Z4IA 3VQ9A 1DTTA 4FW1A 4XIUA 5DG8A 2FPLA 1NK9A 4KLDA 4BE0A 3DLBA 1SL0A 4DG1A 3L3VA 4F5RA 4PHAA 9ICOA 1A76A 2W9AA 5KFDA 3DRSA 4IQTA 3LWLA 3LWMA 3V1RA 1MSWD 4B9SA 5TZVA 5DGBA 4KHUA 4E7IA 5KFVA 4I2CA 5KGXA 2JEJA 8ICZA 3RH4A 4F4ZA 5KFZA 4LD0A 4EP4A 3Q8SB 4CJFA 1S0VA 9ICJA 3RJHA 3MR6A 4ICLA 4ED8A 1X1PA 2PXIA 4HUFA 4J2AA 2Z1GA 4RPYA 1ZQTA 3TR8A 8ICXA 2BDPA 4J9MA 2UVRA 4JRPA 4RNOA 4CGDA 4CECA 1JLBA 2Y1IA 5J2PA 1JXEA 3ETLA 4QZEA 1RT3A 5KFHA 5L9XA 4RUAA 2HHQA 2QK9A 3C94A 2OZSA 4M3RA 2E4LA 1ZQSA 3AVLA 4PPXA 4NY8A 1XWLA 3SV4A 4KITB 2ISOA 4PWDA 3RR7A 1T05A 3ASMA 3Q8LA 4FS2A 3IRXA 4I2AA 4YCXA 3TANA 3DLKA 4M42A 4Z4FA 4NM1A 3PW0A 2VANA 5KFRA 3JPRA 2WOMA 4RW9A 4FJNA 4F4XA 4CIFA 1BIZA 9ICIA 4RQ8A 3HT3A 1S6PA 7ICNA 4F50A 4H8KA 4KRFA 7ICLA 4TQSA 3ISBA 3SV3A 1MU2A 3OHBA 1A77A 4DSKA 1ZQDA 1LAVA 5HHHA 3U3YA 3RJKA 2Z1IA 3NDKA 3TWHA 2D0AA 1YTUA 4M9JA 5HROA 4LZGA 4LVSA 4OKKA 3A2FA 1R0AA 5HRNA 1RBRA 1A5WA 4CEDA 9ICEA 4DU1A 4KB1A 4CF0A 2PY5A 2PI5A 1ZQLA 9ICXA 3NHGA 4JS5A 1J5OA 3M9MB 2HNZA 2FBYA 5KFWA 1TFRA 3C6TA 5KFQA 5BOLA 4Q0BA 3AVGA 3MDAA 7ICQA 3AU6A 2EX3A 3OYIA 5CP2A 4M04A 3OS0A 1U04A 3VQ4A 4DQQA 1C0UA 1J9AA 3MBYA 3OYAA 4CEEA 1BL3A 1ZBUA 7ICVA 2NRXA 3S3MA 4KO0A 3OJSA 1BIUA 3RH6A 2FBVA 3SZ2A 1RTIA 4JWMA 5CB1A 4QWAA 4ECXA 1HRHA 4J9LA 2R8JA 4MFFA 4ZHRA 2X6SA 2BPGA 4O5EA 1COOA 1IXRA 4DTMA 3LP0A 2W9BA 4DMNA 3ZDDA 2NRWA 3AVJA 4RW7A 8ICSA 2NRZA 4FW2A 3QEVA 3G6YA 4FLTA 3PW2A 3MR2A 3OGUA 2KQ2A 4EYHB 2IHNA 8ICLA 3V6DA 2G8VA 5DBCA 5J2NA 4CHQA 5KFEA 1W0HA 2HHWA 4FJXA 1BPYA 1RT7A 3AO5A 1BCMA 4RQ1A 3LDSA 3KD5E 1RYRA 4CF9A 4I2DA 7ICIA 4YMNA 1ASWA 3GIIA 2ATLA 5KG5A 3OYGA 3MEEA 3K75D 5J2AA 5HNKA 1JLAA 1RXWA 4HTUA 3JYTA 1KDHA 4Z4HA 1BQMA 3VA0A 4KTWA 4UAWA 2BGWA 4Q8FA 4CHYA 2RDIA 3HPGA 2KFNA 1NK6A 2DFLA 3OYBA 8ICRA 5J2MA 3OYEA 1IG9A 4FJIA 4BWJA 4KLEA 4YVZA 3V1OA 3DI6A 3IAYA 1BHLA 5FRMA 2D0CA 3UXNA 5KT5A 1NK8A 1BPDA 2NUBA 3T5JA 2BCVA 7ICEA 2F96A 4TUSA 4LY7A 1X9SA 3ZT1A 3CM5A 1T8EA 4N56A 4AHCA 4DU4A 3NTUA 5HP4A 5KG7A 5KG2A 3B0XA 3OJUA 4LH4A 3PNCA 3QERA 4R66A 1PZNA 4O3PA 4AHSA 3C2MA 5JS1A 4QW8A 2W8KA 1QSYA 1HJRA 1S1UA 4I2JA 4Z6CA 3M9NB 1ZQXA 3QEWA 4CJEA 4IR1A 7ICRA 5I3UA 2HVIA 4UB1A 3CM6A 3MAQA 4I29A 4QW9A 4YNQA 4KLTA 3NF7A 4FM2A 1VRUA 1RDBA 4FBTA 1KSPA 2F1IA 5DQIA 4OKJA 5FROA 4TSXA 3S3OA 4F92B 1SL1A 2X6NA 2JLEA 3C1ZA 1SKSA 3ZT2A 4FK2A 4DOCA 2D5RA 1KFSA 4IG3A 4QOZB 3BJYA 4EBEA 3H4BA 3OYMA 3EZ5A 1VSMA 4BGDA 3OYKA 5J2GA 1IKXA 2BCQA 4DQPA 1RILA 8ICGA 4CHZA 2ASDA 1B22A 5KFUA 1VSKA 1TL3A 1NOYA 5KFBA 8ICNA 3PW7A 4NCAA 1XS9D 1T03A 1X9WA 1KVBA 4M3XA 3HX0A 4KHYA 4M9LA 4OGCA 4PHEA 8ICHA 1QTMA 3TAMA 4DTOA 4QZAA 4M3UA 4ZTJA 4GLXA 3HP6A 4B08A 1HPZA 4DL6A 2C2RA 4YXMA 2H5XA 4R63A 4MF2A 4ID5A 5C5JA 4ECWA 3TQ1A 4HUGA 1QQCA 1WSGA 3SPZA 1ZJMA 2YKNA 3N4MB 4OGEA 2GV9A 4CJUA 3AO4A 4ELUA 2HHTA 4F2SA 3CFRA 4QZBA 1TKXA 1RTJA 4DEZA 1W9HA 2FC0A 4I2IA 1ZQIA 2AQ4A 4FLZA 1G15A 1WSEA 3WNFA 1XHXA 5KFPA 5J2EA 2HNYA 3H8JA 4EP5A 1K1QA 3NBPA 3I8DA 4JV1A 4EZ9A 2C22A 1SL2A 3V9SA 3QEPA 4QZIA 4FLUA 4RPXA 2YV0X 1B92A 2P5OA 3MGIA 4AH9A 7ICHA 3AV9A 3LP1A 3TI0A 5KT3A 4M3ZA 1ZBFA 8ICFA 4YR0A 4R8UB 3TAGA 3DYAA 5K14A 1NJZA 1Q9YA 3P83D 3AVAA 2PYLA 1EETA 4E1NA 1S1XA 4F8RA 3D0PA 2Q0ZX 1IM4A 4M6WB 5DLFA 3JPSA 4DL3A 3P1GA 3HYFA 3ZSZA 1KTQA 4KLHA 1QLNA 1WSHA 3SI8A 4E7HA 4ECRA 2HHXA 4CGFA 2HB5A 2BANA 3L2WA 9ICVA 1ZQQA 5DGAA 3Q8PB 4E89A 3SQ0A 3AVKA 3EWAA 3OHAA 1LWEA 2OA8A 1DOQA 2HMIA 4Z6EA 5DB7A 3LAKA 2PFNA 4ED0A 2YNIA 4ED6A 2ASJA 3HM9A 4AHUA 3RH5A 4K4HA 3KK2A 2ETJA 1DGSA 2J6UA 1ITGA 4TUQA 1L3TA 1C1BA 4Y1DA 4IR9A 3KLIA 3PX4A 2JEFA 4DFPA 5DLGA 2AGOA 1Z00B 4PHDA 4L8RB 5FDLA 1KEJA 9ICQA 1S76D 1RTDA 4PGQA 1S9GA 3ZD9A 3NH1A 4QZHA 4F4WA 1RBUA 4CEFA 3PMNA 5FRNA 1XU4A 2QXFA 3RMBA 4CGHA 1ZQWA 1VSJA 4G1QA 3GV7B 4I9QA 4UBBA 4PHPA 2XGPA 3BQ0A 4BE2A 4DSFA 2ITGA 4FK4A 1ZQOA 5IIMA 4IRDA 4DU3A 4CJVA 3C95A 1A5XA 4W5OA 4Z6FA 1LWCA 2OPSA 3PR4A 1KFTA 2KZ3A 4TQRA 1U49A 4BDPA 1UA0A 3TABA 4CK2A 4B8AB 1TL1A 4P4PA 3FDSA 1C0TA 3KHRA 1L3UA 5DB8A 9ICSA 3OVNA 3UXOA 2B6AA 4C8NA 3OY9A 1ZQAA 4FJ8A 5BOMA 3SJJA 4NM2A 4C8LA 4J9OA 1C1AA 2JEGA 2HHUA 3ZSQA 3ZSVA 1NKBA 3V7KA 3SNNA 5CY4A 1I39A 3PR5B 2VWJA 3OYCA 1ZQCA 1VRTA 1K6YA 3QEIA 3E2EA 3LAMA 3QEAZ 2KZZA 4QZCA 1RZTA 4FLYA 4CFBA 4KMUA 1JL2A 4NLNA 3C2KA 5KFCA 3G10A 4Z4EA 3QNOA 3VQEA 2JZBB 1CEZA 2P6UA 3OYFA 4O3OA 1HNIA 1ZQBA 4Q43A 2M9NA 2NRTA 3LP2A 4IFYA 4KV8A 4N5SA 4PGYA 2BQUA 4QWCA 3NF8A 4CJQA 1NK4A 8ICAA 3AVHA 4KLFA 3VQBA 3SQ1A 3EYZA 3KK3A 2IS3A 4FJHA 1HJPA 1JLQA 3D45A 3RJFA 3NAEA 3LANA 4XQ8A 3PW5A 4ELTA 3DLGA 3QEXA 4JV2A 2HHVA 3OYDA 2ZUDA 2E6LA 1Z26A 3NF6A 1HYZA 2IDOA 5KT6A 4UB5A 4GXKA 4OVLA 3AO1A 4GC7A 4B9TA 2Y1JA 3GIKA 3E01A 3HPHA 3RRHA 4FBUA 4FJLA 5D4BA 4BDZA 4M3TA 1VSFA 1RPLA 1BGXT 1YT3A 1VSIA 1A5VA 1KVCA 1TKTA 5KGWA 1BCOA 1SKRA 3NF9A 4R8UA 3FYHA 4CHNA 4JK1A 7ICGA 4FLVA 3L2UA 1ZQUA 1ZQJA 1BVSA 3NH2A 3AVNA
chains in the Genus database with same CATH superfamily
4Z37A 2HS4A 2MKJA 1MW7A 1N32F 3VAJA 2XI3A 5J2CA 2VBZA 3A0HU 3BF1A 4HKQA 4QYRA 4X62J 8AT1B 4X2BA 2KV2A 4TU7A 3RRGA 2IOFK 4JI3F 2CYYA 1SZPA 1FERA 4QU7A 1MN9A 3KOOA 2WVEA 1E3MA 2MU2A 3M5RA 1ZQKA 3MCNA 1TV9A 1PVRA 5GAGI 1MA7A 2J6SA 2QKKA 4QOTA 1B7YB 5IIOA 4OI6A 4JKCA 3MDCA 1FK9B 3CFPA 1YJVA 1RWVB 4OX6A 3BQTA 2W9CB 3OA9A 4I2QB 2ZE2A 2RQ4A 4FYWB 2E7VA 2BE2A 1IKVA 2DEIA 4GMKA 3AH6A 4NA3A 1WWUA 2KNJA 1Q18A 4PGXA 3PIOL 2RS2A 4YXJA 4OX7A 3VMFB 3RBEA 4NX9A 1BE4A 4FM1A 2IVPA 2JWLA 2YNFB 5CZXA 2MKIA 2G0IA 4DSJA 5HRPA 3CDWA 1X4HA 4CK3A 4NLKA 3M2VB 4KLMA 1D8LA 4JB3A 3KZBA 2LA4A 3IP4B 2GHWA 2IA0A 3HKWA 1VQ7S 5B0BA 3CDUA 3D0GE 3QBCA 3ZDAA 4DJBA 2R2UA 2K8AA 2NQPA 2FJAB 2W8LA 2HZCA 1R6YA 1MWKA 4KLLA 5A8RA 1N33K 4V1Ak 4CM0A 1R7IA 3M8WA 1TTHB 3I4HX 1ZBHA 2DL0A 5GIPA 5KRSA 2FTRA 3T69A 4I27A 3ZEUB 4K5SA 3VQAA 2FF3B 3K9JA 4CNZA 3AA8A 1WSFA 2PFOA 1K0VA 3H0RB 2DHSA 5AM3A 3W1YC 5D0RA 3SEOA 4DUZK 2ILYA 4F36A 3SBMA 3Q0AA 3AA9A 4HACB 1WBBA 3QT8A 3FBFA 4XUSA 3UQSA 2JZBA 3VGLA 4OX9K 4O3SA 2YMPA 2P2CB 3ZSYA 1RCHA 3D1HA 2DKZA 3J80O 1TV6A 1GMUA 4C3KA 4WJBA 2W9MA 3C16A 1NSQA 1HWLA 2ZIWA 4Y2PA 4AE5A 2HIYA 1VAZA 1HARA 1OYDA 4JUZA 2FMPA 3SYZA 3BBCA 4XH4A 3VQPA 2F3NA 4JWNA 3O4NA 4DV2F 2R7SA 2RLTA 1RT2B 4CD1A 2VPYB 3HP9A 1MQ2A 3A8IA 3EXYA 5K4LA 2X51A 1ZQ1C 3MEGB 2PA3A 3ILJA 4C8YA 5FLXY 2ATQA 3ZZRA 4US8A 2WONA 4QZFA 2BUPA 2ALZA 5ALWA 1S57A 3DLLQ 3J7ZT 5F8NA 2G5HB 2BKOA 2WVDA 5L1IA 3MM8A 1VQPS 3KKAC 2P35A 2LSNA 2ZJPQ 4ZCMA 1NAQA 2EZYA 3WZ0A 3KBBA 1N8RT 2HSTA 3HFVA 2VH7A 3CJCA 1YBAA 2FLOA 1TFWA 4CEQA 3I55N 1EAYC 1NJWA 5E7OB 1UP1A 4RQ5A 3IM1A 3AQOA 1XMQJ 1YVNA 2VDIA 3F5AA 4WQ4C 5E2QA 3V2UC 4EEKA 1CJKB 5KPZA 3ILLA 4JKBA 4Q8EA 4I7FB 4PCQA 2XCPA 3T9ZA 3C28A 2H48B 1N63A 4EWTA 5C24B 2I6XA 3H45C 3T7ZA 2C2OB 1VSEA 2VG7B 3W60A 4ZCIA 2Q6BA 4UY8O 5KG0A 4EO8A 4K8XA 5BR9A 4P73A 2IHR1 1APSA 2MZSA 2IA6A 3W7BA 1WNSA 1FK9A 3EZOA 4KI4A 3WXIA 3MPYA 3GJQB 1FXXA 1XN9A 6FD1A 4XK8C 2W9CA 2DK2A 4NLVA 4I2QA 2RU3A 3DCAA 1Z25A 4BHQA 2KKZA 3D6HB 3O3FA 3QFHA 2WAQF 2EVZA 1VFJA 4AXIA 3U27A 4DX7A 2Z8QA 3KJVB 4HLBA 4DFMA 2WHEA 2PMWA 1WOOA 2YNFA 2K1RA 4DR1F 2DQNB 5J0YA 4Y00A 1Q95G 3SAHA 5B66U 4RWWA 4KTQA 5ALKA 2KN7A 3M2VA 2J7UA 4ED3A 3PYDA 3IFRA 5J0SA 4E7KA 3NS7B 3MM5B 3UQ0A 1WKKA 2QO3A 4CF1A 1OY8A 1I3AA 3FZ2A 1K5OA 3KK7A 4CZEA 3MR5A 4NLUA 1OPZA 3DM2B 4DU8A 1ZPVA 2WBNA 5IC4B 3QEBZ 1JLEB 1VLBA 2G8HA 4FF2A 3M32A 3ZEUA 1O6XA 2JRZA 3GIJA 2HQFA 1TAQA 4C0BA 3I9ZA 3K5MA 2I7NA 1FI4A 2UVUA 1G1XA 3IDHA 4DV6J 1FO1A 2Q2RA 1WEZA 4RQ3A 3OW2M 3DU5A 4HACA 3F2CA 4KLSA 1S77D 1S12A 2R7QA 2CA9A 1N36J 3GCWP 1VK0A 3KMSA 3IG5A 3D3BJ 4I2BA 2E5LJ 4KY3A 4DUYK 4FZVA 5D4LA 3G0ZA 4DB3A 2AJ4A 2HBLA 3ZX0A 9ICAA 2QA4S 2YNGB 1UFLA 3E9OA 2XG8A 2FJWA 4M3YA 4JLHA 2WTFA 4NWBA 4CD3A 3WK7A 5J0WA 1V38A 4JI2J 5C25B 1HUOA 3A0BU 3SUOA 4B3OB 2Z1JA 2YJEA 3QT6A 3OUYB 2RKIB 5C2GA 1RT2A 4ZCKA 2AW0A 3GDQA 4M9NA 2XMTA 4KHNA 3HSTB 3MEGA 5LMNJ 4FZNA 1WSVA 2YHYA 1UZHA 2HSEB 3VALA 4KLQA 5KFNA 1BO5O 4AP9A 1CZ9A 1SUQB 3IM9A 1M1KT 2B43A 4K0KK 1HEKA 3BDPA 2F1HA 3N6LA 4IRCA 4F5NA 4L76A 3VAFA 4NWIA 3LYSA 4J2BA 5CEHA 1HKBA 2HHHF 4CFAA 4USWA 4DO9A 4CF4A 2GIFA 3C19A 3TZWA 1FNOA 2QARB 4NV0A 2LYHA 1CZAN 4MFCA 3IP0A 2UUBF 4ELVA 2DTUA 2UUCF 1TVRB 1A9NB 4F5OA 5E3CA 3CG7A 4NEZA 5F0XA 4BVPA 2HSZA 1CJKA 3PIPQ 3KTQA 3T1AA 4I7FA 2H9ZA 2FIUA 4ECSA 5C24A 3LPYA 4DTNA 1RHJB 1Q8KA 4K4SA 4WQ5C 2Q97A 4CZKA 3RFAA 2VG7A 4YOXA 3ITHA 4BC4A 4H0PA 2H1YA 2MB0B 4P2XA 1NEEA 2ZITA 2E7XA 2HOFA 1Z6RA 2FJBB 2XZTB 4CBWA 2WB1D 1U8WA 2VPWB 1OXJA 5J29A 5AK3A 2D3DA 2G9OA 3KD1E 2QLWA 2KVCA 4XA5A 3WUHA 1NLKL 1RADB 2IVNA 5JLHA 1GLCG 2O4IA 1UW4A 5AK5A 3KJQB 4NLCA 4ED4A 3I56S 5BPNA 3KJVA 3QNMA 1VQPN 4UOCA 3AU2A 1TL5A 3WK9A 2R8HA 1Q3UA 1ZOLA 2F1JA 4BG8A 3VGUA 2PIIA 3DRPB 4CH1A 5D6GA 2W42A 2QA2A 1JI7A 4PXCA 1Y64A 4CLKA 1EP4B 4P2HA 3QFWA 2ZBCA 1RWNB 3KUHA 3QFUA 4PHTX 2OKQA 3O6QA 1ZQEA 3MM5A 4FJJA 1WC4A 5ETQA 2J7WA 2RQCA 1BISA 4LF4J 2E9ZA 4B1UB 3QYPA 5CZ2A 4OLPA 5KL8B 3UNGC 4ED2A 3GONA 3TUJC 1DTQB 3AA2A 3K58A 4OPKA 3DM2A 1TU0B 3SCIE 3DGPB 3JTPA 2UVWA 2HFNA 1JLEA 4E19A 2YB4A 3KFUF 1S48A 2NYIA 3WX4A 3SQIA 2BE9B 2R18A 1I3OB 1OW5A 4H0TB 5J0OA 1ZM4A 2LFVA 1IWGA 2V2VA 3HHLB 2UV8G 1VSDA 6FDRA 1NB7A 2MQQA 1S6OA 2HCFA 5HLFB 2BYCA 3P5JA 4J37A 3WEEB 1RACB 4MEXA 1R8CA 2K3KA 1JKHA 2DNOA 4O3NA 1N88A 2DR8A 2YNGA 3KD3A 2IRUA 4PA1A 2YH1A 3ZZOA 1WSRA 2RRNA 4Y2YA 1S97A 3CO0P 2H4YB 1FKOB 2JWKA 5C25A 1SKUB 3K89A 4PUOA 1YXQA 4YOUA 1NGGA 4B3OA 1RBLA 5ALYA 3OUYA 4O5FA 2FVSA 2RKIA 2ADCA 2ASPA 3NVKA 1ZZNA 2FHJD 3K17A 4ILMA 3BP8A 2ZIXB 2IJFA 1ATSA 1GMWD 1JX4A 4PYDA 4WF9Q 3QESA 3LDPA 1AB8A 4X64F 2FC9A 3BGFA 2R2RA 5J0RA 2UXCJ 3DNCA 2ZBIA 1SUQA 4QIWF 2BOPA 4FPAA 2DGSA 4NLGA 2ZWPA 3D2QA 2MTLA 2HHSA 1U26A 2JVOA 1IKWB 3RB4A 2MQ8A 5AKJA 3JPPA 1NZBA 4YDUA 3H4DA 2VFUA 1X6IA 3ZDEA 3R5AA 5LM7E 1ZC6A 2QARA 4XO0A 4QWBA 1OJ4A 3SCKE 1JL1A 2GO9A 3VQ8A 5G5GA 3L4QA 3VF4A 1NGHA 1TVRA 4LSLB 4GVLA 5KT4A 4LF8J 2QA4G 5KT7A 2M8DB 3R6LB 4QZDA 1IM6A 4C8KA 2DIUA 2QWQA 1YAGA 2F8HA 4DI6A 1VQOS 1PCAA 2BQ3A 1N54B 1NJYA 2A2CA 4UQGA 2D4WA 1S8OA 1D09B 1C0MA 2P9NB 1KKHA 4QZ8A 4CLSA 3IGVA 2C3OA 1OVQA 3T79A 1Z2LA 1BI4B 1KD1T 1HL6A 2ITMA 1NDCA 1QUVA 4Q5VA 4CGJA 3DLRA 1QS4A 5AM1A 1SWWA 5EU7A 3ENHA 2WRMA 3FJ2A 3DRPA 5HO4A 4YMEA 2FBXA 5EGYA 3V6KA 3B6PA 3ONQA 1EP4A 3HJEA 2P5VA 5B7WA 3BQ1A 2G06A 3HVTB 4DX6A 2BCUA 4DTJA 4CEOA 1HWJA 2BJ8A 1RUSA 2VONA 4UARA 1QHTA 2C28A 3LK9A 1YGYA 5ETSA 3T5LA 5SWMA 1AW0A 1N5XA 2K60A 4FS1A 1DTQA 3T5KA 4CESA 3CJBA 3EX7B 3R8EA 4WFNL 1TELA 2G0CA 4KKOB 5D3GB 3ZFVA 1BQNB 4EFHA 2L3MA 5IQQA 3HRGA 4U7UK 1NU4A 5CYQB 2GV1A 4CEAA 3R7NB 2CJKA 3DDKA 2M3DA 1B9DA 4BACA 2P5GA 4RPFA 2B9WA 2LQ5A 4MFBA 3HHLA 4MFAA 4TY8B 4KREA 3A0IX 4N47A 3VVUA 5HLFA 4BR2A 3VOVA 2LYAA 3WEEA 2MLXA 4DCHA 1XIQA 5HATA 3MTJA 4YD2A 4OFZA 1U24A 2ZZTA 3LPTA 3UMCA 4DCJB 2YWWA 2G8KA 4NZ7A 5IQ6A 1MC8A 4Y2QA 3RJMB 4ICLB 1RISA 1FKOA 3V9WA 3OS2A 1WDDA 2V8VA 1N33J 4CYUB 5L38A 2P9LB 2V8GA 5DBAA 5ETTA 3TADC 4PG6A 2IMOA 2MLZA 1N2XA 1IV0A 1HBMB 2Y8YA 4YFUA 1GX5A 4RT3A 4NXNF 4C80A 4DV5K 2R7OA 1BPZA 4ECVA 2NXJA 4PL8A 3PUFA 2M2BA 2VCPA 1RCXB 1IKWA 2D8CA 3CQXA 3IR6B 2KD1A 3CJ3A 3A5NC 1XI1A 2LMRA 4GXJA 3HDSA 4O5KA 1E4GT 4OX9J 3ADAC 2JMGA 1KCFA 3W9HA 1XMOF 2I1QA 1S6PB 2EWSA 2Q0UA 3NMUA 4LSLA 4G3IA 4RQ2A 5F3TA 2YQ1A 2GUIA 3IBCB 1JCGA 1TKDA 3CMAN 1KHWA 4UZBA 2ZG6A 1RHUB 4Y2AA 4MQ3A 3H8SA 2DH9A 2AEFA 3IA0A 3BO3A 2XIDA 5GAHI 2CQ4A 1H7XA 5GTIU 4UY85 2W4CA 2XEXA 4QIWD 5J2DA 4E7LA 4PY5A 3RJGA 1KN5A 1UVJA 4Y0WA 4CI6A 5BXIA 5HROB 3VQCA 5THWA 4NMXA 4PL1A 5JVGQ 2PFPA 1XC9A 4JB8B 4LF6F 2ZJ5A 4FCYA 4A8EA 3A5OC 4I9LA 4XPCA 1IBMK 4QPXA 2Q1LA 4B3TF 2YVSA 3FKBA 1DQAA 4LFAK 3G96A 1J5OB 4Z7CA 3HHKA 2PA8D 5ALRA 2HNZB 3H3NO 1BI4A 2PMZD 2YN4A 1KQQA 1WC0A 1T9UA 4BRQA 2GX9A 3PRVA 4Q0BB 4IS7A 2UU9F 1M5SA 3PXGa 4KR0B 3M8SA 1PUZA 3RSEB 1CI4A 2WF8A 4UBCA 5IINA 2FZKB 1CJUB 2A10A 4GW6A 4B3SJ 1KHVA 1SH2A 4NZ6A 1MA9B 3HO1A 2EKNA 3AAQA 4FZZA 1NSKL 1UJ6A 4NYNA 9RUBA 3HVTA 3JPQA 4HCCA 4FJ5A 3G86A 2ZUBA 2DY1A 4YR2A 4C4SA 2CFXA 4EENA 3M2UB 2W9BB 2MA1A 1DK3A 5HSPA 3CIZA 1VQON 4KKOA 5D3GA 1BQNA 4RW7B 4CHPA 3FZMA 4RU9A 3CQ8A 3NGYA 3ZSRA 5LJVA 1NGEA 3ZTRA 5CYQA 8ICQA 4MHVA 5C15A 1P6TA 1K9MO 3AB2B 4LBIA 3V6DB 1HNXK 4Z4IA 3E58A 2JC1A 4OYBA 3CERA 5J2NB 2UUTA 1BA0A 3CXCM 4TY8A 1YX2A 1RT7B 3T9NA 3O08A 1A76A 2W9AA 2MLYA 5AQFA 3TA2A 5E5NA 3N5FA 3VCBA 4IQTA 3TZYA 5E79U 1EQMA 4NPOA 4H0XB 3JS9A 4WP9A 1TAMA 1JLAB 2J9EA 3VEXA 4LD0A 2E8MA 3I5BA 4JYAK 1BQMB 4A8OA 4ICLA 4CT8A 5HVHA 3EWGA 4ED8A 2PXIA 4J2AA 4C23A 3GMGA 2R42A 4IOBA 4MO4A 4CYUA 2P9LA 4J9MA 2UVRA 4JRPA 1MMLA 4RNOA 3CVKA 4CECA 4UQTA 2IY5B 5E3AA 4JI7K 2JOQA 5ADXA 5JTIA 2IVMA 5TKWA 5LSLA 5L9XA 2CDRB 3FM9A 4RUAA 1HBMA 2OZSA 3ZNUA 4M3RA 1ZQSA 3AVLA 4CBXA 3SV4A 4KITB 3JTOA 4L74A 1GEHA 3KOAA 3RR7A 5L8RC 2KG5A 2G1DA 4I2AA 3L6QA 4DR6K 3LDNA 1S1UB 3N6MA 2PO4A 2EK6A 1QQ6A 4IWVA 2OFHX 1IQZA 1EX8A 2KN4A 1GXLA 4ZOHC 3VAMA 3S1TA 2ZIVB 3JPRA 1XNRJ 2IDLA 2O8EA 1P1TA 3OT9A 2GX8A 1UL3A 4FJNA 4DUYJ 1VRUB 4C3LA 1FRIA 4RQ8A 3HT3A 1S6PA 4GNIA 3ZO7A 4LFBK 4OO1J 3BH6B 4H8KA 4KRFA 2XS7A 4C11B 2GVDA 3UDEA 2F4FA 3DLLL 1ZQDA 1PKUA 2LEAA 2KLAA 4X4RA 5HHHA 4ZPBA 1LAVA 3U3YA 4NLWA 4FWQA 3K5PA 4BQLA 1YTUA 3BKTA 3H98A 2ZJPL 4M5JA 5HROA 4LZGA 2U1AA 2HBYB 2RH3A 4OKKA 1FRKA 3EO3A 1A5WA 9ICEA 3D0IE 4CNYA 2PY5A 3M4XA 4K0KJ 3GFXA 2QMUB 2OYYA 3NHGA 4JS5A 3CJ5A 1J5OA 2HNZA 1IBCB 1UTAA 3D68A 2H51B 1HPZB 1C0FA 3PSFA 5H9EJ 1PSDA 3SSRA 4Q0BA 3RSEA 3EMTA 1YJRA 3OYIA 2VF3A 1UEUA 1R0CB 2XI2A 1B4SA 1CJUA 3FFIB 2FJXA 4DQQA 4I0WA 1RTJB 3ATUA 1ZBUA 4ETXA 2NZTA 7ICVA 2NRXA 1FDAA 1WC5A 5CB1A 2OP5A 2ZXHA 2ZVSA 1Q7YO 2FZCB 4ATNA 3MI7X 4J9LA 2R8JA 3MN5A 1LKYB 1MNEA 3W5XA 3M2UA 2W9BA 1W26A 3QGPA 5B08A 4RW7A 3LP1B 4LJXA 2NRZA 2E2QA 3BEGB 1HR0K 1NHVA 4FLTA 4XDCA 3GE9A 2LKZA 4DR2K 2LU1A 2M7SA 1FJEB 3DYAB 2KQ2A 3TP2A 1NXIA 1C2PA 5K14B 3V6DA 4I67A 5LJ3Y 3CQYA 5J2NA 3I32A 4WTOB 5KFEA 4YHHK 4DL0C 3K9KA 3Q86A 2R7UA 1RT7A 4J5OA 3LDSA 2XB2D 1Q86T 1N32K 7ICIA 5EE1A 1M6YA 2C42A 2XSJB 3GIIA 5F8LA 3CGIA 2IPOB 4EI2A 5HNKA 1M1HA 1JLAA 4CRJA 3Q24A 1RXWA 1S5ZA 3H5UA 4JI3K 1AA1B 2IOHA 1BQMA 4LJMA 2GH1A 4JI5F 5AK6A 2W55A 5M2UA 2HMIB 1ED1A 5H9FK 1OQ6A 8ICRA 4FJIA 2Q79A 4RTFD 3MC1A 4C3MA 3MN6A 2UXDJ 2GLEA 3CC2S 3WQPA 3T5JA 1V4SA 1C1BB 1S5LU 3RF9A 1T8EA 2RHFA 1FX2A 5K8NA 3MHYA 3KLIB 5HP4A 3DDIA 5KG2A 4OI0A 3QERA 4B9QA 1PZNA 4AHSA 3R5JB 2GMHA 3Q89A 2W8KA 4YDXA 1QSYA 3FZBA 1S1UA 2DNQA 1T9XA 3NAIA 1ZQXA 1CBKA 2QI2A 2L48A 2ZIVA 7ICRA 4I29A 3CUNA 3ZXWA 4MO5A 4DPXA 4KLTA 2CNLB 3TNVA 1VRUA 4DX5A 3N6NA 1G4CA 1TL4A 5EY4A 1LWCB 2OPSB 1FESA 4OKJA 4YB7A 5FROA 2W54A 4F92B 1SL1A 2X6NA 1J27A 4FF4A 4X4VA 1C0TB 3C1ZA 1SKSA 4B1VA 4OZJA 4DOCA 4IG3A 4QOZB 1VSMA 2CQCA 3O5TB 4PXDA 1N5TA 2DNMA 2BCQA 2B8PA 3GJSB 4DQPA 2H3GX 1NU0A 3P6YC 2ASDA 2BX6A 2QX0A 2FY1A 4JV5F 4F67A 1REGX 4ZVUB 4NCAA 3AD9C 3WKCA 5J8YC 3CPWM 2GTDA 4M5GA 1VS3A 3R1HA 1RAOA 1L7OA 5JJBA 3HX0A 4M9LA 1H0HB 4OGCA 1WACA 4ZVPB 3PIPL 2IVYA 4M3UA 1VQKS 3SAFA 2OD4A 4IH7A 4B08A 1HNIB 4X84A 1HPZA 2E5JA 4DL6A 4WZMA 2C2RA 2H5XA 4ID5A 1N34F 4KV8B 4ECWA 1P90A 3TQ1A 3H5SA 4WIIA 4HUGA 1VRQC 4BRAA 3B54A 3TX0A 1KAYA 1WSGA 3SPZA 4J9VA 5CR4A 2DGVA 1ZAXA 1D0EA 1RTJA 4DEZA 3AJ1A 3QU7A 2Z4PA 3QX7A 3DLGB 3ULEB 4DV1F 2AQ4A 1DKGD 1WSEA 4DV2K 2GNKA 3CPEA 3WHIA 4OYZA 4EZ9A 2QSWA 4X4SA 1SQEA 3V9SA 3QEPA 3AT1B 2VB6A 1B92A 1OH7A 2P5OA 3MGIA 1JCEA 3LP1A 3TI0A 4M3ZA 1Q81T 4NJ8A 4R8UB 4YR0A 3CE8A 3DYAA 2ZH6A 4BR7A 4TU9A 4V19S 5K14A 1WEXA 4PPDA 2E20A 2PYLA 4E1NA 4F8RA 1VBZA 1U1QA 3D0PA 1JJ2M 1WEYA 3G87A 4M6WB 5DLFA 3A5MC 4FPRA 3JPSA 3SEIA 3HYFA 2FF6A 2K8CB 4C0ZA 3DLJA 1KNZA 3OL9A 2HQGA 2FJ6A 2ZNZA 3BGOP 5KQDA 1H1VA 2KRRA 1IN0A 3K7RA 2XLJA 1DOQA 2HMIA 4FWKA 5AKEA 1ZRNA 4OYMA 1RT1B 4ZJOA 3FE1A 4RNHA 2DNYA 3BYPA 3WK5A 2XMKA 2R2SA 4A8FA 4LF9F 2E88A 1QQ5A 2J6UA 1C1BA 3VAIA 3GU3A 4Y1DA 1N62A 1DRZA 2QRRA 5IFMA 4CZFA 4IR9A 3KLIA 4RBTA 3W63A 4DFPA 2W6KA 1HPMA 2MKHA 4HVZA 9ICQA 2YPZA 5HR6A 4PGQA 2A3ZA 4F4WA 3V81B 2CQGA 4Z94A 4CGHA 3P5BP 1HWUA 3E0FA 2HKEA 3GV7B 2Q0RA 4DR1K 5HMWA 1FD8A 3UB5A 5AM4A 1ZQOA 4DU3A 4CJVA 3Q23A 1A5XA 2HK2A 4MK8A 4BRPA 1FFGB 1LWCA 2OPSA 4WF9L 4M5HA 1TE2A 4C7ZA 4DX8H 4BDPA 1FXLA 3FDSA 1C0TA 1PYTA 1L3UA 1FJ7A 9ICSA 3OVNA 4R0EA 2KT3A 5BOMA 4TNOA 2ZH9A 4BR5A 3R5BA 4J9OA 1FEZA 1T0TV 3LTOA 4KE5A 4X66F 1EHWA 5AXNA 3DOMB 3HRDD 5CY4A 4BY9C 3RAMA 3PR5B 4DV4F 1WBDA 1EWQA 5DDQC 3CCES 1SWVA 2C3UA 2OSQA 4DV5J 1K6YA 1ULRA 3IFEA 3JTNA 3Q83A 2PEBA 3CC2N 1G6BA 3T1YF 3GWCA 4A8WA 5CYJA 4CFBA 4LMZA 3C2KA 5DETA 3G10A 1S1TB 3QNOA 3VQEA 3OXLA 1HNIA 2M9NA 2NRTA 4KV8A 3KZXA 4PGYA 2BQUA 4ETZA 2AZ1A 1NK4A 3OXGA 1TKZB 5BPLA 2CPFA 2E7WA 1HMVB 3IBWA 3RBZA 2QWPA 5AM5A 4AQYJ 2AIRB 3EYZA 4USAA 4PZNA 3I0SB 3KK3A 1DLOB 5FPDA 1HJPA 1JLQA 4NI2B 2RSQA 3ZYYX 3RJFA 1M5PC 4CO3A 3GR0A 5F1XA 3DLGA 2BE7D 3CJ0A 4JV2A 1U6FA 3ULEA 1VK8A 3N4PA 2NSBA 1L6NA 3J7ZO 1NZ8A 1KC8T 3IDWA 3U9ZA 4GY2B 1CULB 3BKUA 2IDOA 3LPEA 5KT6A 4EO6A 3J7YP 4B9TA 4EK2A 2Y1JA 1BU6O 3GIKA 3EE8A 3MX2A 1LVHA 2I2YA 1B70B 1T11A 1YT3A 4MT1A 1TUGB 3NRZA 5E3RA 2ZFHA 1SKRA 3CDEA 3EUB2 4LFAJ 4A2BA 4R8UA 1BWVA 2I1RA 1F5CA 2OEHA 1BVSA 1KQSM 3RW6A 2HHHK 1SV0C 5CHCB 3K8VA 4N8OA 4O5CA 1C6VA 3CCJN 3VHQA 4M6WA 4DR7F 3J81j 3W9IA 1ZQVA 3MURP 4DCOB 3O0FA 4DR4J 2UUBK 1VQKN 5AKGA 1DRGA 4P4MA 2UUCK 1UEVA 4P0QB 4F4AA 1OS5A 1ZQFA 2XO7A 3C14B 1YF5L 3RMDA 4DTRA 1L3VA 4EEYA 3TAPA 1YG0A 4OHVA 1VI7A 1WC6A 2BW7A 1RT1A 5EWFA 3R1LA 3V7JA 4O44B 1LEOA 5GAGP 1Q53A 3N28A 1L7NA 3FUYA 3FRYA 2A1RA 1WC3A 3TVZA 2WF7A 2B4OA 4OLAA 4CJWA 2BW2A 1PAUB 1TK8A 4JKEA 3BUZB 4KB7A 1VIOA 3SQGB 3ZTQA 1YJNN 4OV6A 3V9ZA 3RWUA 1JMTA 4U96A 1S1WB 2DGQA 4WU2A 3V81A 4P6QA 4U9RA 2KG0A 2ZKUA 2DY4A 1CS4B 4CFCA 5AE2A 3QGHA 4JD2B 3OYHA 1YRTA 8ICTA 2WW8A 1V9OA 2IVOA 4GVBB 4DV7F 3KK1B 2K2PA 1VQ5S 5D0HA 5DDRC 1RWUA 3G82B 3S8SA 1QAIA 1WG1A 3PMLA 4RPZA 1EB0A 1S1VB 4RWXA 3VZIA 4Y65A 2FQQB 2BTFA 4CO1A 3O4QA 5ALGA 8ICPA 2AJ0A 2CPYA 4MTPA 2M8HA 4OLOA 1FKPB 4JI7J 3MWTA 4I69A 1LW2B 3DOMA 2CPRA 3BEXA 3LDOA 1BD6A 5AIAA 2VKQA 2MQLA 2GMLA 4KGVB 3MECB 5J1EB 5GTHU 1YQHA 5AXKA 4DCPB 5HP1B 2X3DA 4NMLA 3P8BB 3KHLA 3THVA 4LF2A 1RDCA 3HSCA 1X5OA 2EFOA 1HWIA 4DR6J 1T9TA 3OTCA 3AQEA 1S1TA 4IZ9A 1BHNA 3FCHA 4IC9A 3SFUA 4FVCA 2DUYA 5HHIA 5FLXO 3QZ7A 1KKXA 2RN2A 5T7BA 2JHEA 1S5JA 1TKZA 4IKAA 5GAEI 2IYIA 3I0SA 2BJEA 2IAJB 4CGIA 1Y88A 3OL6A 1DLOA 2CQBA 3F2BA 2QV6A 3CD7A 4CZIA 3QNNA 1RZMA 2MMYA 4NI2A 1SIJA 2VOOA 2QWOA 3GU0A 3M1YA 1U45A 1NGCA 1MLAA 3G8TA 2F8EX 1RU2A 5KRTA 3P49B 3GFYA 1FRJA 2D3O1 5AXLA 2ZWHA 2WHOA 1RLCL 3SBTA 1GOBA 9ICRA 4OZ5A 3IRWP 2W01A 4DTPA 1WCNA 2G08A 5IWAF 4RQ0A 3PACA 1C7YA 4JK9A 5J2BA 4X64K 4CIEA 3R9LA 3O3GA 3SXLA 4WKRA 5AI0A 1CQNA 1YRUA 1B43A 3AAWB 1P27B 4QNLA 3KIOA 1J2MA 2HRTA 5KG1A 3RAXA 1XBWA 5B09A 2GA7A 3FEXB 1WNEA 3LGNA 3NMRA 2YCHA 1HQEB 4K4IA 5J2QB 1NHUA 4DV3F 3L2RA 4B9MA 3QGIA 4IXCA 1ECWA 1TUVA 2XWXA 4UTGA 1VC0A 1JROA 1U1LA 2AA4A 8ICKA 4RJVA 3DKDA 3UN2A 1VLOA 1M5KC 4P0QA 4Q44A 3R7BB 3K4GA 3GJRB 4P2MA 2C2DA 1RWPB 4ZA1A 4PR6A 4F04B 3C14A 4M41A 2HZAA 3A12A 2ZDOA 3VENA 2DR5A 4FZXC 1OMSA 5CA5A 1KRPA 5J2HA 4YFKA 2V69A 1KN6A 3L8BA 3DRSB 1H3DA 2A1JB 1KLMB 1XSLA 3I96A 4ED5A 4RBUA 4P9SA 2EAOA 4ISEA 3QICA 4RUCA 1YJWS 4DL2A 3RZAA 4ZN1A 2ZIUB 4O44A 3NE6A 4MAKA 3CC4N 1Q8LA 4CERA 2WVFA 1VGYA 4X62F 1W2BR 3DLEB 1WTBA 2VPXB 3PIOQ 2M5YA 3KHHA 3BF3A 1JMSA 5D15A 1VJQA 4HHUA 5KFKA 4D3GA 4KH0B 3ZZYA 1F60B 3SQGA 2VQEJ 1GTHA 1VBKA 1OPIA 5F9NA 4YHHJ 1ZJNA 1KVAA 4DL7A 1HKGA 1S1WA 2LCWA 3IWLA 1NKEA 2LXUA 5A6WA 1CS4A 1SKWA 4JD2A 5M1OA 1N32J 4GVBA 4IQMA 4YUDA 2R8KA 3C6UB 3NGKA 3G82A 3QT7A 2RPIA 1RCOB 4JI3J 1COKA 3I31A 1S1VA 2HWIA 4IOAL 2BV3A 4M1KA 5I3QA 3W64A 2VWKA 1F0MA 1GMVA 4ZVQB 5H9FJ 1WG5A 2HBMA 1FKPA 2MUTB 4FO6A 5D77A 3PEHA 3Q8RB 3G6ES 5MLCQ 4QIGA 3IWXA 4PAAA 5AJ3F 4O8KA 2EAMA 3ZT3A 3MECA 3RU0A 5J1EA 4D3HA 2EW9A 1FRMA 3KDOA 4UB2A 3P31A 2VA3A 4CLLA 3MD3A 4FPIA 3PLAA 4HWIA 3KWMA 4OLBA 3BB5A 3PFEA 4O23A 5GMKa 2PI4A 2J6TA 2V7ZA 2VGNA 1HFEL 3MXIA 1TFYA 4ZN3A 4DQSA 1O51A 2ATCB 3C1YA 2J8AA 2CH5A 2UP1A 3CCLN 3H8MA 4KX5A 1GXUA 4BX9C 1V9PA 3TSPA 5DQHA 2IAJA 3AA3A 7AT1B 4OYOA 2NPIA 4U7CA 1D8ZA 1QE1B 4L72B 3C46A 1LV5A 2UXBF 5KAIU 1X4AA 2R8GA 4BC3A 3BO4A 3TTCA 1IR1A 3MMAB 1YI2S 3K1ZA 2YX8A 1F9EB 4WQ4A 1ZQHA 3UE2A 2CPIA 4TVAB 1K1SA 2DY9A 3H5YA 2UVVA 9ICNA 4BROA 1TR0A 2X7IA 1KQKA 2Q3PA 3QUBA 2Z1HA 1IO2A 4NXNK 1KBRA 1BPEA 3M6VA 2G8FA 2FJDB 1S0NA 1HD0A 2GBZA 3NCPA 3VWSA 1OUQA 3ULDA 2DFHA 1RBSA 4A8SA 2YNHB 1OQ3A 4QR2A 1NPRA 4EX6A 5F9LA 2G13A 4W5NA 1A6LA 1IXKA 2YMMA 1HQEA 5CWRA 4X4UA 5IM0B 1NOZA 3M1FA 3I0RB 3QU9A 4OJ6A 4U8VA 5F3ZA 4F91B 1RBTA 1NSPA 5HMYA 4DR3F 3B6OA 9ICHA 2GAGC 1XMOK 4USTA 2K8BB 3QJLA 5AIBA 3AVFA 3IAS9 1W7WA 3AFGA 4R65A 4CIGA 3JPTA 1L7MA 3R6MA 3LP3A 1S4FA 3MAHA 2KHVA 2CNNB 3SPYA 3CI5A 1MMDA 2BUNA 2DNLA 3RJJA 4DV2J 4P74A 1I6JA 2HS3A 2D0BA 2A1JA 1KLMA 3DXBA 3T1HF 2OELA 1VQ6N 3UE5A 1URNA 4FOEA 2ZIUA 3M8RA 1XMQF 2WUSA 2H3IA 2K4EA 3SUPA 4LF6K 1RYUA 2KJ5A 2AEMA 3DLEA 2YWKA 2LLZA 1KD1O 3O8MA 5CE3A 2AX0A 4B3TK 1WCLA 1QQ7A 1GLFO 3QU4A 4JS4A 3ICLA 5CHIA 5E33A 3IBPA 4KH5A 2X74A 1VQYA 4KFBB 4E1JA 3CB4A 2ZM6F 4J91A 4DS4A 3PDNA 1WHYA 2MZQA 4OZ0A 2UU9K 4CHOA 4F3TA 5A6PA 4J2EA 2KM8C 3PFOA 4O9MA 9ICLA 2W25A 1U1NA 3PKYA 2QC3A 2KEYA 5K8MA 3C6UA 3LVWA 2LYVA 2J9CA 1DQ9A 5EOYA 3VQ5A 3TAFA 4I56A 1YIJN 2GW8A 4FM0A 3OS1A 2DGZA 1X5SA 2WF6A 2EH9A 4Q45A 2YX4A 2F8SA 3RB6A 1PG5B 4RCHA 1UZDA 3KHGA 4X4NA 1D9DA 1OVYA 2RILA 3K2PA 2MUTA 3O1WA 1T7PA 5MAOA 4UOHA 4KPCA 3UQ2A 3SMZA 4QZGA 2DRAA 3O9RA 2XGQA 2KYXA 1XEZA 4Z6DA 3V5RA 3HI9A 2MGZB 4CZMA 4CI0B 4CLWA 1X4GA 3W65A 1ZRMA 1YJWN 3IV6A 3OFEA 3MABA 3LL3A 3ENVA 2B3TB 3MK6A 1YJTA 5GAEU 4BC7A 4W5TA 4O3QA 3PM9A 2F9WA 4KQZA 2UUAF 1SQKA 4LF7J 2BKEA 4C0HA 4BS2A 4DF8A 4NYFA 4F4YA 5DJBA 2DGXA 1U0SA 4DR1J 1PK1B 2OUGA 5HL7L 3S01A 2XRIA 1UKUA 3W5YA 4H5NA 4WWSA 3TA0A 5A76A 3V4IB 1E6VB 4H5RA 3A3OB 2WB4A 1QE1A 3LPUA 2MRLA 3J7Z5 2HVHA 3C3LA 4FJ9A 1ZM2A 3MMAA 4EYIB 1WG8A 1RAJA 3GCXP 3MN9A 5KOWA 3K1RB 4I2EA 2I5JB 3ZSOA 2ZJ8A 4ZITA 1C4CA 2DCLA 1MROB 3TPQA 3CJAA 3DLHA 5BR8F 4WQ5A 3VZHA 3L4PA 2Z30B 3L95X 2ASMA 4KLOA 4DFDA 4RT2A 3NVYA 3RMCA 3EY1A 3FMWA 2E1EA 2K8GA 2YKQA 4WTYA 1XJWB 2PDAA 2CQ1A 2AYBA 2H5EA 2YNHA 5F8MA 5KFYA 1TAUA 2FI1A 2KL8A 1CC8A 2E6MA 1B99A 1IKYB 3CJ2A 1FJCA 3CWJA 3I0RA 4Z7YA 2ASOA 3AQFA 3DXSX 3ZT0A 4M63C 1N0UA 5LMNF 2Y9TA 2XWYA 5AQWA 4BRNA 4RW8B 2B21A 1R3NA 4UW9A 1SQFA 1RAIB 1WSIA 3KXDA 3PJXA 3CW2C 2QEXS 2GQCA 4V19J 4YG2A 4GMJB 5CR0A 1CUKA 1DXSA 3DDHA 2LI6A 5GADU 4YD1A 3FBEA 4CEBA 2FHMA 2B7BB 3DOKB 3O6WA 2F4VF 4FYXB 3O9SA 2BXJA 4MYTA 5DQGA 5EX3A 3V6JA 3PW4A 1G99A 1YI2N 2FVRA 1WDTA 3HCXA 1D8YA 2W4PA 1SC6A 2E1CA 1TMMA 1X66A 3GZ7A 1O5JA 4ILRA 4URQU 1EXQA 1EX4A 2HPUA 4NASA 4IQUA 4F5PA 3FAHA 5KG3A 4KFBA 1ZAVA 1NCLA 1M5OC 4DPUA 4TYBA 4X65F 4G6VB 1Z1BA 5EOZA 2BM0A 2NS1B 2UUBJ 3MGVA 3IBFB 4ECZA 4USHA 2IBKA 4C8OA 2DHAA 2EBGA 4CO2A 4KI6A 1GX6A 2GC8A 5G0RB 3GFKB 1S0OA 2MKSA 3E3XA 1Q8IA 4K4GA 2E1YA 3G71N 2DEJA 3HSDA 2ISPA 1YTYA 3RR8A 2PYJA 5AICA 1F5BA 4FWNA 5SZTA 1U2VB 3NVWA 3UKRB 2RMLA 2RDJA 3H7IA 2VA8A 2IGIA 4RO0A 1YLXA 3HJFA 2GS8A 3QAUA 4O0JA 3VGTA 2HFZA 5IS2A 1TYQB 2CGKA 4A5AA 5CCLA 3DC2A 3UCGA 1V5IB 2VG5B 2GJIA 3VQQA 1HNWF 2HNDB 3P96A 1IG6A 1F3FA 1RDAA 3H20A 4XH5A 2F3JA 3PSTA 2MGZA 1LWFB 2GOLA 3SMVA 1S99A 1DTTB 5M1NA 3LW5C 4CF3A 2DNZA 4DBQA 3LM9A 3OTDA 4LF4F 2RE2A 2FLPA 3ISND 5I3PA 1IJEB 1VIXA 1TMJA 2J0QD 1HJOA 1L3SA 2CJBA 1VQ9S 2OZMA 2JSXA 4OZNA 4USIA 3HSZA 2NV3A 3OR1B 1JRPA 2QLJB 2RVJA 4ECQA 2B4JA 5AQPA 2QYGA 1IR2A 5BN8A 2ZC3A 1PK1A 4UATA 3RTVA 1RFQA 2JDJA 1ZQZA 3TUIC 3V4IA 1E6VA 2PAVA 2P6TA 3OFHA 2P9KB 4JI5K 1O0PA 3H8WA 1OKJA 3MUTP 3IM8A 1P9YA 1LKZA 3QWPA 3HZEA 5AK4A 4F93B 3L3CA 1RT3B 2V8PA 1N5QA 5IOLA 2V4QA 2I5JA 1GT8A 3EXCX 2BPCA 2I9GA 2DT9A 1MROA 4A46A 4IKFA 3Q8KA 2QG9B 3MZIA 2B51A 4GC6A 3K5NA 1RHQB 2L41A 1OY6A 5JICA 4YMMA 2Z2LA 3IRXB 4EBCA 4EMDA 3ID6A 4UZCA 3F9MA 3FC4A 1MDUB 1N60A 2YI1A 5CZ1A 2YMLA 2LHTA 1IKYA 2AJ2A 4YY3F 1DHMA 3CETA 1BC6A 1SB3C 1RDUA 3MGJA 1ATNA 4RW8A 2P9SA 2NXEA 2OAUA 3ZZZA 1X8DA 4GKJJ 2BR0A 4NLTA 1TUWA 3RGIA 3M1VB 3UMBA 4GVMA 2QXLA 4J2DA 1YBUA 1QSLA 3MAAB 1JXLA 4MDAA 3NH0A 5LXRA 2FHKA 3DOKA 5GAHP 2FPMA 1FEEA 1DQ8A 3HHEA 4CO5A 3ZSWA 1HUZA 3IUCA 4HYKA 1R0AB 3B0YA 3WQTA 3NFAA 4IH6A 5A0LA 5J0XA 1VSHA 4JV5K 1RG6A 3KFWX 2XM3A 4X64J 4CZCA 4BE1A 4LF8F 2JVRA 2I9SA 3I9V9 4U7UD 4M9HA 2KKVA 3NOCA 1S49A 3QINA 4MKYA 3HOTA 4AYBC 4Y6IA 3CCRS 3ISDA 2VKZG 4PJ0U 4FYDA 5DDYA 3E8OA 2RHSB 3VQ7A 3J7A1 4KAZA 3AQPA 7ICUA 1RJJA 5HQLA 4HUEA 3N9UC 2E66A 4OIXA 3AUOA 3PY8A 1N34K 5AQHA 2KHCA 4LVOP 1KAZA 2ZOGA 4ED7A 2GJ2A 1U7LA 3NGIA 1HI8A 4IJAA 1QVFM 3NNHA 4J9NA 2GCFA 3AD7C 4DDFA 4B1WB 5G0RA 3K0SA 3R27A 3Q2TC 2EQYA 5BRHA 8ICWA 2VL1A 2V8HA 4FDFA 1RTIB 1B7FA 3N0VA 3JXOA 1U9LA 1U2VA 1NZAA 1JIHA 4DV1K 2FYXA 1ZETA 1WKJA 4IEEA 4DS5A 1FW6A 2QLTA 2BPFA 4DZ6A 1NNLA 3UDLA 4RKUC 1HKAA 2ZH8A 1TYQA 4C98A 2G8WA 4ITSA 2PN6A 1EKSA 2XI9A 2VG5A 2ES6A 2HNDA 5AKLA 4QZ9A 5L1MA 2AEJA 3DRYA 5KFLA 1N61A 3DXKB 3DRXA 3BZKA 4A4JA 4KH4A 1FDNA 4HDHA 1Q86O 1LWFA 2E8AA 3VQ9A 1DTTA 2DH8A 4FW1A 4XIUA 1NK9A 5AQOA 1IWAA 2E5GA 3DLBA 3EJMA 1DK2A 3NUQA 2Y9HA 2NXUA 3OQ2A 4I6AA 3OR1A 5KFDA 3D5MA 1I5OB 3QUTA 4HH0A 3V1RA 1MSWD 4DUTA 4B9SA 3R3TA 2GWKA 2FSJA 4WKYA 5KFVA 1SJFA 3JYTB 5KGXA 2N7YA 1CLFA 5IT9U 2PMZC 4UUWA 4RUBA 3DJCA 4IO8A 3MR6A 2P9KA 1X1PA 3CCZA 1O03A 2Z1GA 4OQJA 1ZQTA 3TR8A 3NS1A 1NH7A 1VOMA 2HDOA 2LM1A 3CC7S 1VBYA 3C29A 1RT3A 1V3RA 2QB0B 5AQMA 1RK8A 5KFHA 3AOBA 3CJ9A 4V19X 1NBWA 4LF9K 2QK9A 2E4LA 4PPXA 2EKYA 3WQUA 1JXVA 1UFWA 2ISOA 4PWDA 2BRKA 4ZP7A 1J5EF 3ASMA 1Q3VA 3C0BA 3E9LA 2K89A 4FS2A 4KHPF 3IRXA 3KUEA 1WTFA 4M42A 5GINA 4WYLA 2NR0A 2O1PA 2FB0A 2HURA 1SXLA 3PW0A 3VR1A 3D2SA 4USVA 3QJPA 4RW9A 1SJQA 3CDBA 1BIZA 5D4PA 7ICNA 1AXQA 1WKLA 2GJFA 3EL2A 1NGJA 5H1SQ 7ICLA 2D7SA 5ALFA 3KNGA 3N4WA 2AWZA 3M1VA 4DSKA 3N01A 4CH0S 3UPFA 3HTVA 1X42A 3CIMA 3MAAA 1R43A 2YKOA 1IKXB 2D0AA 4F0HA 1K8KB 5C2DA 1VBXA 2MY7A 2E1RA 4PYAA 4LVSA 1TL3B 4X66K 3A2FA 3EICA 1R0AA 4DV4K 1T03B 1FWKA 4KB1A 2ZH4A 2QGFB 2JFDA 4X4PA 1DJ0A 3T1YK 1S4EA 5IC6B 4YS2A 2MSTA 2XICA 5KFWA 4Y3CA 4FYVB 2Y1RI 3MCSA 4HT5A 5AM0A 2IVFB 1AUDA 3MDAA 3N79A 1U6ZA 2VQFJ 1B3TA 4M04A 4KHMA 5EN1A 4CP5A 3ENBA 3JQKA 3MMJA 2ZUGA 2F1FA 1OH6A 1XMOJ 1KL9A 3U4LA 2BJ3A 2ZEJA 1BL3A 5EVZA 3QUQA 4OHZA 3S3MA 1F0XA 1AZSB 2C2ZB 2JRSA 3BBBA 1RTIA 2I7PA 5AR0A 1NRKA 1HRHA 2ZHOA 2F9JA 1C0GA 2M52A 2HOQA 2K1RB 2Z2YB 2J76E 1RU1A 4MFFA 2BPGA 2ESEA 1IXRA 4C2MA 1H2VZ 3CCQS 3ZDDA 1RP5A 4KYZA 2W7OA 3DAWA 1PC4A 2QWRA 3QFPA 8ICSA 4B3SF 1FFSB 1RLDA 3QEVA 3G6YA 1QAJA 4B3TJ 3DXKA 2N3LA 3PW2A 3FBBA 3MR2A 2H5JB 2POKA 1UEKA 4EYHB 2IHNA 2G8VA 3R5CA 4NL5A 2OANA 1EETB 1JNZB 3FZLA 1S1XB 3D6JA 2CPDA 2L9NA 4IOXA 5TISU 1KVJA 5IV4A 2YJFA 3O1BA 1BCMA 4RQ1A 2NZ4A 2UU9J 1QHAA 3CCRN 2ZH2A 4NLXA 1NB2A 2B4PA 4WFBQ 3M32B 4DR7K 1WWVA 3HF5A 1KP6A 4AL6A 2BVZA 3U26A 2ATLA 5KG5A 3OYGA 4C7QA 3NGSA 5J2AA 4ZPCA 3V4MA 4HTUA 3JYTA 2W24A 3HJVA 1HLWA 4NEYA 1G3OA 3PSPA 3VA0A 3AOCA 3CT9A 4OV1A 2RDIA 3HPGA 2KFNA 1NK6A 2DFLA 3OYBA 2YNIB 1ACMB 4BWJA 4KLEA 1X7VA 4YVZA 3V1OA 2PE8A 1BHLA 3UXNA 5KT5A 2NUBA 2QB0A 7ICEA 2ZJRQ 2F96A 2MHEA 3ONNA 4TUSA 2QTWA 1X9SA 1WUAA 1GAOA 3AXMA 1U8SA 3NTUA 5KG7A 2ZOFA 3H3OB 2O5DA 3C2MA 4ZOSA 4OJLA 2Z7JA 3NGTA 1T3QA 4JI1F 2LKYA 3UR3C 1HJRA 1K47A 3POTB 1QVGM 5K5MA 3D67A 2BMBA 4G1QB 4UB1A 1UCVA 2VBYA 3CM6A 1VQLN 4YNQA 1I94F 4DV7K 1EQYA 2F1IA 2JZ5A 5DQIA 1SPBP 1KW4A 3C2PA 5LMUF 2JLEA 3ZT2A 2X1AA 4F25A 2CQ0A 2XYHB 3Q8UA 2B6AB 4FK2A 1BUPA 2D5RA 1KFSA 1PYSB 3MCPA 4BGAA 4XTTA 1B64A 2APOA 2NO5A 3OYMA 3EZ5A 1P7DA 3OYKA 5J2GA 1IKXA 2HFSA 5KL1B 2QJ3A 3M05A 1RILA 1K8KA 2YHXA 1XNRF 4WPAA 4CHZA 1NWKA 1TL3A 2HGMA 4QYZK 2XNRA 5M1QA 1FTCA 2FJVA 3ETRA 1T03A 1RKJA 2FSKA 2ZH7A 4ZP8A 1KVBA 2OEJA 1AT1B 1Y3KA 3CC7N 2CRXA 2NUUG 4JI8K 3TVYA 5ALTA 3ITHB 1B0XA 1FD2A 4W4MA 1QTMA 4O4RA 4DTOA 4ZTJA 1LOUA 1YJ9S 5J1NA 3HP6A 2RUSA 4DQ8A 2E3TA 2J9DE 5ETVA 4U8YA 4IFYB 2DITA 1BA1A 2QWNA 4B3RF 2AJFE 1QQCA 3Q2SC 2QFIA 4MH8A 4OGEA 1F2GA 2QMWA 4CJUA 2HHTA 2NUHA 4F2SA 3O1LA 4NRTA 4QZBA 3CFRA 1KC8O 1JJCB 4YB6A 4HI1A 4Y2JA 3FCWA 1AZSA 5AKYA 4I2IA 4I4BA 2FC0A 3NGRA 1WOPA 1RWWB 2G09A 1ZQIA 4LFCF 3ID8A 4FLZA 3WNFA 1XHXA 2BZ2A 3AGKA 2CIMA 2HNYA 4EP5A 1JJHA 3I8DA 3RYLA 1ZD5A 4JV1A 2C22A 3E01B 3B4MA 1SL2A 2UV8A 4NL9C 4QZIA 1X4EA 2LECA 3M6XA 5IWAK 4FLUA 3NLCA 1ZD2P 7ICHA 1XNSA 4YOYA 5KT3A 2O01C 2V2ZA 1ZBFA 3WK4A 1EO1A 4JI6J 1LCUA 3DV9A 1H2UX 3KVGA 3SMSA 3HULA 2HBKA 4ZK7M 4K4XA 2C2KB 1Y3JA 2L9DA 3M8YA 4C8ZA 1Q9YA 1A7GE 4PXEA 1EETA 3BS7A 1S1XA 3W5ZA 1NMEB 1XNQF 4ZPDA 5HANA 3JXUA 4OZ3A 4DV3K 3O2IA 4DL3A 2OLWA 5KPTA 1AQ6A 2LMIA 2JFKA 3QLHB 4IOCL 1QLNA 3I87A 1T9WA 2GIRA 3ENAA 2F5GA 1HD1A 2HHXA 3UFCX 4CGFA 5HJXA 3MCMA 3CNHA 1FHTA 4MJKA 3W2WB 1ZQQA 4E89A 3FSXA 3BS9A 3AVKA 3NVMA 1FXDA 4CE6A 2ZHBA 3A8YA 3NASA 4UAUA 4ZJLA 4XEIA 2PFNA 3GYNA 2YNIA 1JKHB 5DO2A 4K4HA 4RW4B 1PJ6A 5C7PA 1R8PA 4EUVA 4TUQA 1L3TA 3U1MA 2GO8A 4JK7A 5CD4H 4X62K 2E1AA 1SC3B 3ET6B 1RSCA 2A40A 4EAHD 3PX4A 2JEFA 1IVZA 3CCQN 3IG8A 4PUOB 4L8RB 1RAEB 2IDEA 4NCGB 2RAQA 1URRA 3ZD9A 4LBHA 1VQ7N 2W7AA 1XU4A 2QXFA 2IYGA 1Y5LB 5F8HA 3POTA 5LJWA 1ZQWA 3CCSS 5J8YA 4BCAA 4G1QA 4C4RA 4B1YB 2V51B 3O9UA 2NSCA 2UXDF 3M2RB 4FVUA 1YUWA 4PHPA 3BQ7A 4DSFA 4R79A 3I8BA 4CZJA 3C95A 4WCEL 4FE3A 4Z6FA 3MWBA 3EGZA 2CNOB 3ETMA 5EUHA 2QW9A 1U49A 4KJIA 4CK2A 4P4PA 3IAM9 5DB8A 3I33A 2B6AA 4CRXA 3CNQP 1ZQAA 4FJ8A 1FRLA 5C2CA 2ABYA 2RQKA 1C1AA 1WF1A 2JEGA 1YZ6A 1NKBA 4A8MP 4IFVB 2M88A 2J0SD 3TYTA 3OVAA 2VWJA 5JRTA 2Z56B 1VRTA 5AJ3K 3QEAZ 3HKZC 2KZZA 1TL7B 4QZCA 1OWXA 3HSGA 1JWWA 3DRRB 4KMUA 1RBOB 3EEQA 3O4WA 3HFKA 5KFCA 4B3MJ 3W66A 2P6UA 3OYFA 1RBAA 1DARA 2AXTU 4IFYA 4HH1A 2DH7A 8ICAA 1A0PA 3AVHA 4KLFA 3F53A 4F72A 4EU0A 4ZVGA 5AE3A 2J9DA 3PYGA 3NAEA 4OPAA 3B4DA 2UXBK 1LW0B 2VHGA 4GVEA 1XR5A 2YQ3A 3NF6A 3U02A 1LXJA 2IJNA 4H54A 3GBTA 3CRXA 4UB5A 3AO1A 2HAIA 3HZ6A 1K8AO 2F76X 3E01A 2CAJA 1N0VC 5D4BA 4BDZA 4JV5J 4M3TA 1VSIA 1A5VA 1KVCA 1YBTA 5DZ6A 1BCOA 4OHXA 3P4UB 2WSCC 2J5AA 2XMVA 2BACA 7ICGA 4FYYB 2XBPA 3KLHB 3IG1B 1GTEA 1ZQJA 3A8EA 4CLUA 3QU2A 4I6MB 2VASA 4ACOA 5FPEA 2WAQD 1TP7A 1LB2B 2HI0A 4K8ZA 2VGMA 1X4BA 2V4RA 3Q7CA 3MFIA 3ZC4A 2GHVC 3T19A 1YJ9N 4QCLA 5EE0A 3QLHA 5GMEA 4DR3K 4KLIA 3K5OA 2ZQBA 4TURA 3LALA 4L3QA 4FF3A 1HLUA 3W0LA 1RTHB 4MFBB 3W2WA 4UAVA 2VJVA 7ICMA 2D3OR 2FUG9 3EZUA 1HYSB 3PX6A 4DFJA 2CQHA 5EHHA 5IILA 2BABA 4Y2CA 2DRDA 4DV1J 1UAWA 5AM2A 3K57A 3KG0A 4K59A 3T1HK 3KKSA 5I42B 1BPXA 3F5EA 4M5MA 1SZHA 4RW4A 1QQNA 4ES2A 1ZQGA 1XMQK 1V85A 3CHWA 3CF5L 3S3NA 2RF2A 2WVBA 3ET6A 2XY6A 2P9CA 2KVIA 5DB6A 3CXCR 7ICTA 4BC2A 4O4GB 4LIWA 1UFKA 5G4DA 2IHMA 5DMRA 3H0MB 4NCGA 3BKFA 9ICCA 2E9RX 5AXMA 1AFJA 3HM8A 4DFKA 1NK7A 2ZM6K 4XAKA 3OTOJ 3VQ6A 1SS6A 3IHQB 2VBWA 3PRBA 1SH0A 2VZ9A 5GMDA 1CSJA 4ZTFA 2KJVA 1XHZA 3F2DA 5B0CA 3M2RA 1LQ9A 2ASLA 3AA4A 3SI6A 2HW3A 2XY8A 1QTNB 1YDLA 2QLXA 5F8JA 3GG1A 1VHFA 1PAEX 3DFEA 4P4OA 3KNAA 4LH5A 3MPDA 2DNKA 3CJQA 3L3UA 1H74A 4H4MB 1HIWA 3TFRA 1KTVA 3C66A 1D5AA 1V5VA 5AKXA 2RRDA 4P10A 4BUGA 4JKGB 4UASA 3H5XA 1HW8A 4WU3A 4IFVA 1K9MT 2EXUA 4FXDA 4KC5A 1J2NA 3C2LA 1W2IA 3NCIA 2MAXA 1TL7A 3I4PA 3QPIA 2QA4N 4NA2A 2Z0GA 4NLRA 3HX9A 2B8QA 3DRRA 1KEKA 3TZXA 1Z3EB 4OJOA 3ELHA 5DKWA 2IC3B 1F5SA 1WI6A 4JOUA 1RE1B 4KLJA 1EIYB 1CG2A 3CJRA 3V6HA 2K4PA 2UUAK 4H0OA 1JLCB 5E41A 3KDNA 4LZDA 1PYOB 2SXLA 3HD2A 3UCZP 4F0MA 4RQ6A 3CCWA 2VG6B 2OWOA 4AXJA 4KPYA 4GKKF 3BQ2A 3CCSN 5GAEP 3HSJA 1SV0A 2EC0A 2RS8A 3UMGA 3LM2A 1HNVB 1Z4NA 4FOIA 3ZZPA 1QSSA 3WXKA 4ALZA 1Q9XA 1LW0A 8ICVA 1NHKL 2R7YA 2EHGA 4FWOA 4JK8A 2G2ZA 3TSQA 5LJ5Y 1ASVA 4FZYA 5KTQA 4B1XB 2JHDA 4ZPAA 5AQLA 3RG6A 1UJ5A 1VCTA 4KN4A 4OYXA 4DV4J 2XY7A 1S9EB 5CYMB 3D7SB 4AQYF 5BR8K 3OSPA 3TFSA 2PGCA 2Q6CA 1PC5A 5ADXH 1N6QB 3RBXA 4F3MA 3T1YJ 4WFZA 2LYBA 1DURA 2VA2A 4WZQA 3KLHA 3IG1A 4R5PB 2EFNA 4I6MA 3ZTSA 2BJDA 2PT0A 1HIYA 4PQAA 1BOTO 5DK5A 5JS2A 3PNIA 1Y5IB 3ORYA 5IIJA 3PHEA 2RDDA 2FMSA 1BWEA 1T6CA 1U4BA 2JH3A 4I2FA 2ZTEA 8ICOA 5LMNK 4BR9A 2Q1NA 2AYGA 2VV5A 5HJYA 2QKBA 3D66A 4QWDA 4OI3A 3THXB 4P2FA 4O3RA 5SUHA 1RTHA 2ZF5O 5JU5A 1T3NA 4KIAA 3L0QA 1HYSA 3OFFA 4BQZA 3SBGA 3KMQA 4GV9A 2G5IB 1HBUB 2DKXA 1JCFA 4MLEA 4L75A 5E3PA 4MIAA 3BREA 2F4VK 2IFXA 1GOCA 2EDUA 3I56N 5I42A 4JRQA 4DR4F 2MPUA 4N77A 4F3OA 2Y0SF 4PKHA 4PG4A 3AAPA 3KKRA 3WNGA 4Y2XA 2ZGZA 3GP9A 5CZVA 2E5HA 4YEAA 2P9GA 3VETA 4CF5A 5D8HB 4O4GA 3QT5A 5C42B 4CJLA 2W1BA 5A8KB 3VF6A 1R27B 4XDDA 3K0JA 4IDKB 5HK4A 1WLJA 3UD4P 4ZJQA 4M5LA 3BBFA 3C5FA 4X65K 3FZHA 1NNDA 3M6GA 4DSEA 3BZQA 4DR7J 2FVCA 2JL9A 2ZKTA 2V68A 3HMJG 2DXFA 1U1MA 3MEDB 2A6AA 3OYNA 1QZ6A 2IM3A 2HOIA 1Q7YT 4DUZJ