4B9TA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -dc basepair in the post-insertion site.
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9tA01
3DLHA 1L3UA 3AU2A 3NFAA 4G3IA 9ICXA 4CEZA 4F4KA 2P6UA 1TKTA 4DQPA 3D0PA 4KITB 3OYHA 4FO6A 4FVMA 3G6YA 4CERA 9ICFA 3AVGA 3OJUA 3AUOA 4M9HA 1EXNA 1FKOA 1CEZA 3QIOA 3L2RA 3RBEA 4R63A 4ECSA 3V1OA 1FK9A 3TANA 2AQ0A 4CJFA 4E0DA 1QSYA 1ZQYA 4FJ7A 1REVA 3OS1A 5CJ7A 3LP2A 4MF2A 1J53A 3NH0A 1HJPA 4KTWA 5KFGA 3RMBA 4KPYA 3WNEA 1N56A 2BCVA 2DY4A 2NRVA 1SKWA 4KLTA 3LPTA 2W9BA 1EP4A 4PQUA 4RW8A 3I0SA 4DTSA 3RAQA 3VQ4A 2IMWP 2ASDA 5KI6A 1JXEA 3CFOA 1TK5A 1MU2A 8ICJA 3ASMA 5KT7A 3RAXA 3LP1A 4RQ8A 4FLTA 2P1JA 2AGPA 7ICQA 1NJZA 4CEDA 3LAKA 4QZ9A 1LAVA 4FJKA 3Q8QB 4M42A 3V9WA 1XI1A 5C5JA 1MSWD 4F2SA 3KLIA 2V4RA 1S10A 4EZ6A 1LAWA 1Y97A 2HVHA 3NF9A 3Q8KA 4DF4A 3DLEA 3JYTA 2A1JB 1QSSA 4M04A 4DL2A 4R8UB 2M9NA 2X74A 4RQ1A 4RUCA 2KTQA 4FLYA 5DDMA 4M2YA 3ZSRA 4FJ9A 2UVWA 1RDCA 4AH9A 1QLNA 4GW6A 4CFAA 4M9JA 1WAJA 4XUSA 1UA1A 5DGBA 2BHNA 3LWMA 4B3OA 4OKEA 4DO9A 2OPRA 3F9KA 3K75D 4QZHA 9ICKA 4GXKA 5IIKA 4RT2A 3Q8RB 4YFKA 1L3TA 3LWLA 2JEJA 5L1IA 3AVKA 2F8SA 3RB4A 3U3GA 2NRXA 3EYZA 3PR5B 1COOA 9ICPA 2HHWA 5KFWA 3NAEA 3TI0A 4KREA 4CEQA 3VN5A 4JRPA 2G8HA 1ZQEA 2HHSA 1T05A 1HUOA 3AVLA 4C8KA 3AA3A 3TQ1A 4NLZA 4CGDA 1FKPA 1HQUA 4E1NA 4NXZA 1U4BA 1IKYA 2NRZA 3QZ8A 1ZQCA 2XCAA 3BQ0A 3C2LA 2KN7A 5DBCA 2C22A 3T5HA 3K5OA 1C1CA 2JLEA 3K59A 1GOBA 2FBVA 3LP0A 3T5LA 4CHNA 2VWJA 4LH5A 1Q9XA 1HQEA 4YD2A 2GWSA 5TZVA 5J0UA 5J2DA 2P5GA 3NH2A 4NCGA 4DG1A 2D0BA 5KG6A 4K4HA 3HW8A 3C95A 4FK0A 2J6UA 3MR5A 5C25A 3M9NB 3MR3A 3HPGA 3GDXA 1JLBA 3AVMA 1BL3A 3K5LA 1X9SA 2V4QA 2KFZA 2C28A 3QNNA 3PX0A 4E7LA 3N4MB 3DYAA 5J0TA 3AO1A 2A1SA 1KVBA 3M9MB 3T19A 3MEDA 3RBDA 1BVSA 1XSNA 1WCLA 4YD1A 5J2JA 3OHAA 4IBNA 3AU6A 2QK9A 4TUQA 3IRXA 2QKKA 4F3OA 1S1WA 4BWJA 3TARA 4CGHA 1SV5A 3HM9A 3CQ8A 4B9UA 3L2UA 3ORYA 8ICWA 1T03A 2F1IA 4O5BA 4ZTJA 1BQMA 4W5TA 4MF8A 3OVNA 3VQCA 4TQSA 3HWTA 1KFDA 8ICHA 3WNFA 2XCPA 1U04A 2D0AA 1C0MA 1Z25A 1ZQXA 5KT4A 2ITGA 3VQAA 3VQ8A 4YR0A 4MEXA 2MAXA 4O4GA 4FLXA 3QNOA 4J2BA 4EBEA 4IQUA 1VSJA 1C1BA 5D46A 4YCXA 4I2IA 7ICOA 1KVCA 2D0CA 3MFIA 3SPYA 4GVMA 2R8IA 3AA5X 3PY8A 3SNNA 5KRSA 3V6JA 1NKBA 4J9KA 1RYRA 4DL3A 4XIUA 4CHYA 5JS2A 4B9MA 4M3ZA 1T3NA 3SV4A 3CFPA 5EWGA 1JXBA 5F9LA 1C0UA 4JRQA 1JLCA 3JPOA 4F93B 3LZJA 1ZQOA 1J9AA 4LSLA 3U3YA 1ZQGA 3LDSA 2FC0A 1VSMA 1L5UA 2BE2A 4ED7A 1ZQJA 3SCXA 2XHBA 4KB0A 1BISA 2F1JA 4FM2A 4J9PA 4UB3A 8ICNA 5DK5A 4Y1CA 1LWCA 4FBTA 3IAYA 3OYEA 4FCYA 3GILA 3V6DA 2D5RA 3E2EA 1RILA 4F5QA 1J5OA 4YP3A 2IC3A 3ZSYA 4BDYA 1JL1A 2XY8A 3C5GA 4HUEA 4R66A 3KHRA 3FYHA 2P5OA 5DG9A 2Y1JA 3E01A 4CHZA 1RT6A 3HVTA 1VK0A 2VA8A 3KHGA 5DG7A 2F1HA 4BE2A 1U9LA 4R5PA 1HYVA 1RT7A 4KHQA 4O0IA 4QWBA 3EPIA 3BQTA 3PW5A 3L8BA 3GQCA 2G8WA 1DTQA 4QZDA 4LZGA 8ICOA 3DRPA 1U47A 3V9UA 4RPXA 1RYSA 4DOAA 4FJ5A 4FLVA 1WSGA 4OPJA 1RZTA 4CJLA 2HHXA 4H8KA 4LD0A 3KK1A 3QEBZ 3H4BA 1IXRA 1RTJA 2YNFA 3DLGA 4IRCA 1YT3A 1B9FA 5KFOA 4TURA 5KT6A 4KHSA 7ICPA 1U48A 4J9NA 3OYIA 4UQGA 1VRTA 3KJVA 4I2BA 4NM1A 4EBCA 4DWIA 2X6SA 1CXUA 2J6SA 5J0SA 3JPRA 4JLHA 4M6WA 3CYMA 1MQ3A 3TFSA 4DTUA 5J0QA 3OYCA 4KLDA 4J9MA 1NOZA 5DKWA 4GC6A 1KFSA 9ICJA 3RH6A 4UAZA 4O55A 1NOYA 5KFBA 4Z6FA 3ITHA 4M45A 1UT8A 2FPKA 2DFEA 3KK2A 4MFCA 5CYQA 4F4XA 5HMMA 3GFKB 5KG7A 7ICTA 3VQQA 4FM1A 3DMJA 2ISOA 4KLLA 4FK4A 5J2KA 4I2HA 1WAFA 3NGYA 1SZPA 5HRRA 4OLAA 2RKIA 1NJXA 3PX6A 9ICQA 1R0AA 1NK9A 4ZHRA 2FLLA 5JUMA 4RNOA 8ICTA 4FS2A 4K4IA 7ICMA 1UA0A 3DRRA 4QW8A 4B9VA 3C6TA 4F50A 3MEEA 2LSNA 3OHBA 2Y1IA 2BQ3A 3AO2A 1SUQA 2HNDA 4QZEA 3K5MA 1TK8A 1XHZA 1H38A 2HNYA 4DLGA 4F5RA 3RJIA 3UXPA 3VQ6A 3V81A 1HYZA 5KFYA 3V72A 2BPGA 3G10A 4FJJA 4O9MA 4JV1A 4DQRA 1VSLA 3MGIA 5E41A 4PGXA 3KKRA 7ICEA 4Z4FA 3Q8SB 3ZT4A 4ECVA 3AVCA 2FPMA 2NRWA 2IHNA 4YXMA 2HNZA 2XY6A 1ITGA 5BPCA 3MR6A 1S0VA 4TUPA 3DLKA 3IHQB 4CJ5A 3RB6A 3KLHA 3TAEA 3RMCA 1S6PA 2BKEA 5EWFA 2FMQA 4FJGA 1VSDA 3O4NA 2ASLA 3AV9A 4QAGA 4I2AA 1ZJNA 1ZQKA 4OVLA 5J2FA 2ZTEA 4RQ2A 1S9EA 1J54A 2C2EA 4YXJA 2P6RA 2BQUA 2HVIA 1WNSA 2W9CA 4J9OA 3KLGA 1V9PA 1NK8A 1TVAA 3G6VA 3ZCMA 4BE0A 3V9ZA 2VANA 4CK3A 5J2AA 3HPHA 4CJWA 4DTMA 1RDBA 5J1EA 3B6OA 1NKEA 4CJ3A 3LANA 5EU7A 3SJJA 2PZSA 3QEWA 1ZBHA 4CIFA 4DSFA 2DTUA 1ASWA 3O3HA 4NLGA 2XGPA 1T4GA 3EW9A 4RU9A 1XWLA 1LW0A 3FFIA 4CJSA 2KZ3A 9ICMA 4AHTA 4FLUA 5J0WA 4CESA 4BXOB 4LSNA 4XRHA 7ICFA 4RNMA 4CGGA 5HP1A 1C0TA 4CCHA 1ZBIA 4B08A 2EX3A 1K1QA 1NK7A 4F5PA 2PFQA 2OPSA 3V6KA 1D8LA 3TFRA 3TAQA 4UBCA 5DBAA 3JPSA 5SWMA 2HHTA 8ICUA 1D5AA 8ICFA 4CHQA 4DQIA 4QZIA 1QQCA 3PUFA 4KO0A 4J2DA 4KLUA 4DEZA 4QZFA 4B9TA 3GV8B 4I28A 4RT3A 3AVAA 1U49A 1TAQA 5KFDA 3RH5A 1IKVA 1WSJA 3TAPA 4CECA 4IR1A 4LY7A 2RDJA 4DSKA 4DSLA 4Z4HA 1ZQMA 7ICNA 3C1ZA 3C21A 1S77D 1CXQA 5F9NA 2BPFA 3MECA 3S3MA 4HCCA 3UQ0A 5DBBA 5BOMA 1SKSA 2IS3A 2ZD1A 1KSPA 2PI5A 3TAMA 5KFCA 4YVZA 4FLZA 3G6XA 3C1YA 4F8RA 4H4MA 3OYGA 3V1RA 5HRNA 4KFBA 4PH5A 3H40A 5L9XA 5IIJA 1RXVA 5KFUA 2KQ2A 3IS9A 4GXJA 1ZQDA 2NUBA 2XGQA 5T7BA 3L2QA 2ALZA 4DQQA 4UAYA 4N41A 3LPUA 4Z4GA 4R65A 3MEGA 4NLKA 1ZQAA 4KLHA 5FDLA 4BACA 2KZMA 3TAGA 3VQ5A 5KG3A 1ZQVA 4NY8A 4LVSA 3ZDAA 8ICZA 4FJXA 1XO1A 2FBYA 3P83D 1RT3A 3VQEA 1HMVA 3SI6A 5DGAA 5FRMA 1TKXA 4G1QA 4EP5A 2JZBA 5KFEA 4CFCA 4RPYA 2Z1IA 3KD1E 3QEAZ 4PPXA 4MFBA 1VSIA 4DFKA 2FLNA 2V9WA 4MQ3A 5KTQA 4FZZA 2FBXA 4EYIB 4DS4A 4ECZA 1BI4B 1VSFA 5HROA 3HXMA 4CFDA 3H7IA 4E7JA 1RT5A 4FW1A 3SQ2A 1NKCA 4RZRA 1S0NA 7ICHA 2G8IA 4F3TA 1A5XA 3JSMA 3ZSQA 3OYNA 3PNCA 1NK0A 3V9SA 1RPLA 5DLFA 1CZ9A 5C24A 3EY1A 5J0PA 2ASJA 4F92B 1S0MA 4DS5A 3MBYA 3PMLA 4CGJA 1S1XA 2ZTDA 4FZYA 3M8PA 4RW9A 1VRUA 4QWDA 1CUKA 3VA0A 4I2PA 4CJQA 3ZSXA 2HW3A 2AQ4A 4FJMA 4Q43A 4KKOA 4I7FA 2YHAA 1AROP 4CJUA 1XU4A 4UB1A 2ZJ5A 1ZBLA 2Q3SA 3AVIA 4I2DA 2ZUBA 1Q9YA 5DB7A 1JKHA 3PX4A 1S1VA 3SQ0A 3RJHA 4JS4A 3HVRA 2IBKA 2YNGA 3RJFA 2XO7A 3DM2A 3PO4A 4HVJA 2YNHA 2O4GA 3S3NA 1UWBA 1RTHA 3OYBA 4OJRA 4TSXA 5CHGA 1ZQSA 2YKMA 3OYLA 3F73A 9ICAA 2G8FA 2PY5A 5DG8A 3KD5E 1JLFA 1KRPA 2F8TA 5HNKA 3PVXA 2MUTB 3QE9Y 1TL3A 5KG2A 3RJJA 1JX4A 1XHXA 9ICVA 4O3NA 4UB2A 4NCBA 4YQWA 1RBUA 4Q8EA 4KTZA 2WTFA 1HJRA 3I8DA 2ETJA 4Q45A 4P4OA 3K4GA 2ZQBA 4RPZA 3HO1A 3PMNA 4CJEA 2R7YA 1ZQUA 1RDDA 2H5XA 4NYNA 4MFAA 4CF8A 5KFXA 4I2EA 3VQ7A 4C8OA 3V4IA 5J0XA 3QESA 3HK2A 1BCOA 3ZDEA 4CK1A 4Z6CA 4J2EA 1XS9D 4DL5A 1KLMA 2B5JA 4M3UA 3GIKA 5L1LA 5J2QA 1RT4A 1MC8A 4CJVA 2B21A 1TGOA 4DFMA 1KEJA 4DSEA 4CEBA 9ICWA 2HHUA 2AJQA 7ICVA 3HYFA 1IG9A 2I1QA 1JN3A 4P4MA 2BGGA 3ISDA 4ED1A 3AVJA 3ZD9A 3MABA 1JMSA 3H8JA 4P2HA 2XY7A 4OGCA 1L3VA 4O5EA 5J0RA 4E7IA 4C8MA 2OZMA 2B6AA 1TK0A 4DSIA 2JEFA 1EKEA 3EPGA 1IO2A 3QEIA 4DTNA 2PFPA 3OSPA 1KTQA 4NYFA 4KLMA 3JPTA 1LV5A 3GIJA 5CWRA 4IG0A 4KAZA 4I2FA 2AGOA 4F4YA 4KTQA 5J2HA 3SYZA 4E7HA 2WOMA 2ZJ8A 4O0JA 3S3OA 3T3FA 3ZDDA 3SPZA 3SV3A 1BPDA 4PHDA 4ELVA 4FZXC 7ICIA 8ICKA 3VQ9A 2ZE2A 5D3GA 9ICBA 2E6MA 4QZ8A 4JS5A 1SL0A 4MEYA 1Y88A 4F2RA 3BQ1A 3RJGA 4CK2A 1ZQQA 4E19A 2BCSA 4Z0UA 4GXIA 3GV5B 3BGRA 8ICAA 3LK9A 3GV7B 3L3UA 5I3UA 3HX0A 3OYDA 1Z3EB 5KT5A 5J2IA 4PUOA 1YTAA 1S1TA 3ZSOA 3NGIA 1KCFA 3RMDA 3V1QA 4L8RB 4KLSA 1DOQA 4ICLA 2ZUDA 3U6FA 1DGSA 3PW4A 4M41A 4IRKA 4HYKA 3I0RA 3KHLA 3ISNC 4J2AA 1JLGA 1ZQLA 3NBPA 2Z1GA 1Z00A 4M47A 3PR4A 1WSIA 5JS1A 3PW0A 4OPKA 2JEGA 3JPPA 4DU3A 2JZBB 4CHPA 4J9LA 3AA4A 1C6VA 1JLQA 4KI6A 4YMMA 3S9HA 3H8SA 2WONA 4PGQA 2AGQA 4QZGA 4KLGA 1D9FA 2Z1HA 1F21A 5L1KA 4EEYA 3LP3A 2C2DA 2OPQA 3AO3A 2RF2A 4CEAA 1TL1A 3V7KA 3V6HA 2LYHA 1LWFA 4JWNA 4E1MA 5KFNA 4XQ8A 1ZQNA 3AVBA 1BGXT 4DL7A 5DDYA 1NJYA 5HRPA 1S97A 4CJRA 4M3YA 3TABA 3OYJA 3JPNA 1ZQPA 2ISPA 4KN7A 1S9FA 3EZ5A 2BGWA 5HRSA 8ICQA 5I42A 5J2PA 4EYHB 1BQNA 2ZUCA 4BE1A 4IQVA 4BDPA 5J2GA 3VQPA 3SI8A 4CJKA 3OSNA 2RDIA 3T1AA 5KT3A 1D9DA 4PHEA 3KLFA 1SL1A 4YN4A 4ED6A 1X9MA 4I29A 5DB6A 4GMJB 1MQ2A 4KLFA 1JL2A 2BR0A 4CJTA 2PI4A 1U45A 4RQ4A 4RW4A 3UIQA 3WNGA 1HRHA 2FMSA 1L3SA 1W9HA 4W5NA 1N6QA 4AHUA 3L2VA 1WSEA 3B0YA 5IIIA 7ICJA 4F91B 1I39A 3PV8A 3MXMA 3H4DA 3CM5A 4DLEA 4DTXA 8ICLA 3ZD8A 3BQ2A 3C94A 4I27A 2UVUA 2VG6A 4O5CA 1IKWA 4XA5A 5KFAA 2P66A 4CJ4A 4ED2A 3DLRA 4DL4A 1RBVA 4PWDA 3ZSVA 2IGIA 4E89A 5J0OA 3QEVA 4CJPA 1VSKA 4CF9A 3ISBA 3O3GA 4QZAA 4HUFA 2YNIA 4JUZA 3MDCA 2PXIA 4OGEA 2BANA 3ETLA 4GC7A 9ICEA 1BI4A 5CZ1A 1IH7A 3HP9A 2PFNA 2XY5A 3SQ1A 4CHOA 4Z6DA 4J9RA 4CGIA 5KRTA 1S9GA 3RRHA 4FJHA 5DQHA 1B22A 4HHTA 1I3AA 1ZQZA 4WE1A 4RW7A 3CFRA 3QIPA 4Z4EA 1XC9A 4K4GA 4R8UA 4ID5A 2OPPA 5J2MA 2UVVA 3M8QA 2PYLA 3RR8A 5KFTA 1HPZA 5DQGA 5FROA 5KG1A 3B6PA 5KT2A 4CGFA 4DTJA 4F5NA 2XRIA 3CG7A 1BCMA 2DPJA 3M8SA 3JPQA 2I5JA 2X6NA 1HUZA 1GOCA 4AHVA 4DTOA 2Q0ZX 4M3WA 1RCHA 1TKZA 5CR0A 4P4PA 4FJNA 4PGYA 4N47A 1QTMA 4ECUA 4UBBA 4W5OA 3PO5A 4OKKA 4Q0BA 3RH4A 4I2JA 1EETA 2HHVA 2A1RA 4FXDA 2IOCA 1ZETA 2E4LA 3OYMA 1B9DA 1BPEA 2IAJA 5KG0A 1LW2A 8ICSA 4BGDA 4KHUA 3V7LA 3M8RA 4DOBA 1B43A 3C2MA 4CEEA 1N5YA 4DQSA 2OWOA 4RUAA 1X1PA 1A76A 2PFOA 1BIUA 2QKBA 3RJEA 5IIMA 4M0AA 1S1UA 1HYSA 4B9NA 2Z1JA 5IILA 2YHBA 8ICBA 3NH1A 4FW2A 4YR3A 4B9SA 2IHMA 3NF8A 9ICLA 1W0HA 4F5OA 1TKDA 9ICGA 4QCLA 3MFHA 5J2NA 4FS1A 1EXQA 3KK3A 2PYJA 4IDKA 4DFPA 1ZJMA 1WSFA 3NHGA 3UXOA 5KFVA 5HHHA 3GIIA 4FJ8A 4OKJA 4J9SA 2HMIA 4ED3A 1K6YA 5DQIA 3C6UA 3EWAA 4DF8A 4QOZB 3TR8A 4Y1DA 2GUIA 5CYMA 4C8NA 1ZQBA 4QWCA 1X9WA 2O4IA 8ICGA 1JXLA 2ATQA 3SUNA 5HLFA 3NGZA 2EHGA 1CZBA 3A2FA 4I9QA 1ZBUA 4W5RA 5CP2A 4DTPA 5KFRA 3V9XA 1WN7A 3RRGA 2JGUA 1S76D 3O4QA 1ZYQA 4K8XA 2R8GA 1A5WA 8ICXA 7ICLA 5KFSA 5L1JA 2G8UA 4KB1A 3RB3A 3M9OB 3SZ2A 3HPOA 4ECQA 1JIHA 8ICEA 1A77A 1QHTA 2W9CB 5SZTA 1ZQRA 1IKXA 3THVA 2RPIA 1N48A 5KGXA 2R8KA 1TAUA 3QEPA 2W8LA 1ZQTA 2BCQA 4AHCA 4PHAA 3NGDA 4DSJA 5KG4A 5IINA 1S6QA 2G8KA 5CA7A 4IFVA 4ELTA 3SUPA 2ATLA 4JV2A 1RBSA 2FBTA 4PA1A 4M9LA 3LDAA 4RNNA 4IG3A 4EBDA 2IDOA 4N76A 3GIMA 4ED8A 4ID1A 4UB5A 4NCAA 4I9LA 3OYKA 3SUOA 4FBUA 2KZZA 1T8EA 4B9LA 3KKSA 1TV9A 1BIZA 3OJSA 8ICRA 2MUTA 4ED0A 3ZSZA 3LZIA 1TVRA 1G15A 2VA3A 1UT5A 3RJKA 1RNHA 3L3VA 5KFQA 3QEXA 1ZQFA 1QS4A 1UOCA 1RT2A 4PHPA 4B8CA 1A5VA 9ICRA 3K2PA 3MGHA 5J2EA 3TAFA 2HB5A 4CIGA 4IKFA 9ICUA 3PW2A 3NDKA 5KFIA 4RQ3A 4TQRA 3IM1A 5J2CA 5J2BA 9ICNA 1IM4A 2KFNA 4RW6A 4AHSA 2GBZA 4K8ZA 5EWEA 4HTUA 4Z4CA 3RTVA 2R8JA 5DB8A 3QETA 2BPCA 3DI6A 4LH4A 4FM0A 3H08A 3CM6A 1WLJA 4IQTA 8ICMA 4Q8FA 2P51A 2IA6A 4E7KA 5HBMA 1RT1A 3T5KA 1Z00B 4RG8A 1X2IA 1XSPA 5CB1A 3G0ZA 4TUSA 3DLBA 5HHIA 1SKRA 8ICVA 4CF2A 1RXWA 7ICUA 3UQ2A 4YG2A 3NF6A 4M9NA 4CE9A 3H8WA 4ECRA 2NRTA 3Q8LA 2ZJAA 4O5KA 2F96A 1ASUA 4FLWA 1BPZA 3MDAA 4CIEA 1C7YA 4YMNA 4DMNA 3SUQA 3MAQA 3ZT0A 1TFRA 1JLEA 3C5FA 1C1AA 3OS0A 2VWKA 2GV9A 9ICSA 2G8VA 4DL6A 8ICYA 3SQ4A 3OYFA 3VA3A 3AO4A 3VQBA 4LZDA 4QW9A 4KI4A 5CY4A 2J6TA 4HCBA 5KFJA 3RMAA 4KHYA 2OA8A 3L2WA 4I2CA 3KHHA 1QSLA 4YR2A 5DLGA 3ZDBA 2YKNA 1K1SA 4F4WA 4B8AB 4JV0A 4R64A 2FPLA 1BPXA 2W8KA 1ZQHA 4ZH4A 2ZTCA 4IR9A 1DTTA 3QLHA 2X78A 5KFKA 3ZT3A 1BPYA 3O3FA 8ICCA 1QE1A 2HHQA 1DLOA 1NOMA 5KFZA 1RTIA 3ZSWA 7ICKA 2XC9A 5D49A 4KLOA 2DFLA 4O3SA 3AA2A 3ZT2A 2VG7A 3KIOA 1O1WA 4DU4A 1S0OA 1Z26A 2DPIA 3BJYA 4FK2A 3HL8A 4QZBA 1UAXA 1NK6A 5HMLA 1BPBA 4M6WB 3K57A 4FJLA 2R8HA 4N5SA 1FXXA 4AILC 4Z6EA 4KRFA 2JEIA 4W5QA 3DOKA 4GLXA 1NK5A 3B0XA 4O3PA 7ICSA 4M3TA 9ICTA 1GOAA 4CFBA 4RQ7A 4EP4A 1JLAA 4O3OA 1YVUA 1WCNA 4YNQA 4RQ5A 3WNHA 3QO9A 4QWEA 4M3RA 9ICHA 2C2RA 3NE6A 3QINA 3DRSA 3UPQA 3NTUA 1SL2A 5FRNA 4Q5VA 1CLQA 1LB2B 2I9GA 2BQRA 5DMRA 4NLNA 4ECWA 2AU0A 4YMOA 3P1GA 4IFYA 4ECYA 4X5VA 3OYAA 4ECXA 1KVAA 4O3RA 5EOZA 3RWUA 7ICGA 4C8LA 4OLBA 1VSHA 2FLPA 4UB4A 4HUGA 4CF1A 2A1JA 4UAWA 5KGWA 4O3QA 3ULDA 3Q8PB 3ISCA 5KFMA 9ICOA 1WSHA 4DOCA 4Z4IA 4FJIA 2RN2A 3OGUA 4N56A 3IG1A 3BDPA 9ICIA 4CEOA 4EZ9A 4BDZA 5KFPA 3ZT1A 4F4ZA 2B4JA 3FDSA 1RBTA 4YFUA 1RTDA 1ZBFA 4BXOA 3AVFA 5BOLA 8ICPA 3RB0A 1KFTA 3MXIA 4O44A 5KFLA 4DU1A 4ZTFA 5DB9A 1PZNA 1NJWA 4E3SA 5C42A 3HSTB 1ZQWA 4CEFA 2W9BB 3C23A 3NCIA 1RBRA 9ICCA 3K58A 4KLIA 4KLJA 2W42A 4JWMA 1KDHA 3MXJA 1ZQIA 1D8YA 7ICRA 5KFHA 3OY9A 4KN4A 1HNVA 1ASVA 3AVNA 4DFJA 1B92A 1BHLA 4M3XA 5J29A 3DOLA 3V7JA 4QWAA 5IIOA 2YV0X 2UVRA 4BWMA 3KLEA 1YTUA 2VA2A 4JK1A 2BDPA 4CF0A 8ICIA 3TWHA 4Q44A 4H4OA 3QZ7A 4KMUA 2DFHA 1TV6A 5KG5A 3HT3A 2FMPA 4QZCA 4PY5A 4ELUA 4KLEA 3K5NA 3ZDCA 3LALA 5D4BA 2BCRA 3NF7A 1T7PA 1S5JA 1LWEA 3C2KA 3HJFA 5HP4A 4NM2A 3HP6A 1EX4A 1KLNA 4KLQA 4ECTA 2W9AA 2DFFA 1NK4A 4FYDA 1VSEA 2KW4A 2BCUA 2VG5A 5K14A 5CZ2A 3QERA 1RDAA 3AVHA 4J9QA 3MR2A 3UXNA 1Q8IA 3VQDA 4KV8A 5KFFA 4RQ0A 3N97B 3T5JA 1XSLA 3Q8MA 4IRDA 1HNIA 4KHWA 2OYQA 4AHRA 4DTRA 4MFFA 3RR7A 4M9GA 4I2QA 2OZSA 4IQWA 3LAMA 3AO5A 2E6LA 3PW7A 3OS2A 4RQ6A 4I2GA 3KTQA 4KHNA 2QXFA 2W9MA 5J0YA 3P5JA 3ALYA 3D45A
chains in the Genus database with same CATH superfamily
3DLHA 5C0YA 3NFAA 1FDDA 4ZPWR 2A6MA 3O1LA 4DQPA 3J7YP 4KGMA 2X3GA 4KITB 1TTHB 3BKUA 4RR5A 4X66J 1TUWA 3G6YA 4LQ9A 1YLXA 1XMOK 3OJUA 4H4OB 4PKDB 3GDQA 2AJ0A 5LY3A 4J37A 1QCKA 3KK3B 3V1OA 3W66A 2QL5B 1ESVA 2AQ0A 5EXWA 2APOA 3NS1A 4E0DA 1QSYA 1KEKA 2WTUA 1WDDA 3M8PB 1M90O 2DGXA 3SFUA 1BU6O 2XLIA 5KFGA 3NMRA 3F44A 5JRTA 1R8BA 1S4EA 2ZBRA 3I32A 3CC4N 1OY6A 4KLTA 3W0LA 2W9BA 4JI6K 4PQUA 3O2IA 2C2MB 4J9UE 2W3RA 5M1OA 2AMCB 1MU2A 8ICJA 5KT7A 5LJVA 2E2OA 4PG4A 2P1JA 2AGPA 2BJ1A 2GO8A 1SJFA 1ZOTA 3F5AA 4NJ8A 3NLCA 4MN4C 3Q8QB 1RLDA 4U8VA 3L3FX 2EAPA 3T1HK 2RE2A 3IXQA 3OTQA 5BRHA 3DKDA 2HVHA 1HBUA 3Q8KA 1S1WB 2OLWA 1U2VB 1YJNS 2AX0A 5F3XB 4PJ0U 4R8UB 2OEHA 1EKRA 2XLJA 4OYAA 4M5DA 1EQYA 4FYXB 4CFAA 4YOWA 5BYRA 5K14B 4XUSA 3MCAB 1P8ZA 4JI8J 1IWGA 2BHNA 3QYPA 4B3OA 2OPRA 5ETTA 3KXDA 1IBLK 3H3OB 3PIPL 1NPKA 2I2YA 4QZHA 9ICKA 2O6KA 2HSEB 4YFKA 2M0NA 4P10A 3AVKA 2G0CA 2ZC3A 3U3GA 3PR5B 1IV8A 2LEBA 1W2IA 3PRVA 3VGTA 3MUMP 4OHYA 3P8BB 2G8HA 1T05A 2VKQA 4F71A 1RYUA 4Y2PA 4NLZA 5CH7B 3TTCA 4BGBA 3TU5A 4ZVFA 1I94J 3NRWA 3RZAA 3BQ0A 3RU0A 2D0OA 3D2FB 4GNIA 4ILRA 3T5HA 1UJ5A 3PJXA 5D4PA 4JI2F 4CHNA 2VWJA 5JVGL 2GWSA 2P5GA 1CJVA 2QLXA 2BZ2A 1UVNA 2YKNB 5SUHA 2DKXA 3GCWP 4DBQA 3HW8A 2IVMA 5AICA 3CP8A 4QYZJ 1VQON 1NZ8A 1QQNA 2LMIA 1KL9A 2ZITA 2JDJA 3HPGA 3CQYA 2Q1LA 1JLBA 4NLSA 3GCXP 3K5LA 4C11A 3QNNA 1HMVB 3GJTB 1PJ6A 1C20A 1ZS6A 4MAKA 4PL2A 1WC5A 1N36F 3PYGA 4JYAK 2RQ4A 3QT8A 2NNWA 5J1EB 3CJ0A 1HW8A 3NGUA 4PKIA 1XSNA 2GMJA 4YD1A 4KHRA 2OD4A 2VG7B 4R79A 1MWQA 2QK9A 3MM5B 4ZPCA 3IRXA 2A2DA 2QKKA 3VF4A 4BWJA 3TARA 4CGHA 2DNRA 3L2UA 1B64A 2EKYA 1U6ZA 3R9LA 1WOSA 4O5BA 4ZTJA 4BRDA 5HVGA 4W5TA 4MF8A 2J9EA 1DTTB 3VEOA 1WEXA 3HWTA 1RBAA 4MT1A 1Q1KA 3VALA 2EG2A 1YX2A 1NH8A 3NS6A 1KFDA 3WNFA 4DPXA 4P2FA 2D0AA 1P27B 1NZAA 2NZCA 3CCTA 4LSZB 5KT4A 2EQYA 1M1KO 2VASA 4GVEA 3QNOA 4KHPK 4EBEA 1RBLA 3H46O 4I2IA 4A2BA 4GVMA 2R8IA 3N4PA 5F2RA 1SB3C 2FXUA 3V6JA 1RYRA 4USHA 5JS2A 4FWKA 2RAQA 1JLGB 2CAJA 2EZXA 3FCHA 4FYYB 4B9MA 2IJNA 5GIOA 4CJ7A 2ZIVA 1GXTA 2FJWA 1U1PA 2JRZA 5EWGA 3ZZRA 1IN0A 1C0UA 4KH6A 1JLCA 1LKYA 1Q81O 3JYTB 3AODA 1S1TB 4UQTA 4JI2J 3LZJA 2KEYA 2DGTA 2ZIUB 2KYXA 3U3YA 1NDKA 3R5DA 3SBGA 5AM0A 3QRQA 1SC4B 1ZQJA 3SCXA 1YJ9S 4FM2A 4UB3A 3DRRB 2H3EB 3RW6A 1LWCA 2CKWA 3IAYA 3OYEA 2QRRA 4F7VA 3ATUA 4FF2A 3E2EA 1J5OA 2XMAA 1V38A 3CJSA 3C5GA 4HUEA 4CRJA 4BRLA 1URNA 2Y1JA 3MWPA 5CD4H 4HACA 3DGVA 3E01A 2EFNA 2MQOA 1YDLA 2HFZA 3EL2A 3JTPA 2AX1A 2VA8A 2CZ9A 3KHGA 4I2QB 4X4SA 4J8FA 1JALA 2D6FC 1BE4A 1R31A 4X62F 3CCQS 4BE2A 3UE2A 4R5PA 2CNNB 3MPYA 2HGLA 3UQSA 4O0IA 4JKGB 3EPIA 3PW5A 3GQCA 4PZVA 4Y2KA 1DTQA 4ZCLA 3PM9A 5RUBA 3DRPA 2OAUA 1D9AA 2MKYA 3L4PA 2RILA 3LDPA 2LQ8A 5IC4B 2HEKA 2XI9A 1C0TB 3EE8A 4CJLA 3P39A 4BC9A 3MHYA 4H8KA 3OTCA 4LD0A 3KK1A 4WXOA 3Q23A 2CRLA 3D2WA 4JD2A 3WEEA 1IXRA 4DCCA 4C8YA 2VPYB 2Z57B 3EWGA 3DLGA 5D0HA 1B0XA 2IRXA 3F0NA 1YT3A 2VIHA 1SH0A 3EUNA 4OQJA 4LF7J 5KT6A 4RX6A 7ICPA 1GO3F 3T1YF 2CPZA 4CT9A 1VRTA 4Q2MA 4I2BA 3KK1B 1Y5IB 4UY8T 1SIJA 3FZBA 4IKAA 2X6SA 1N32K 2GX8A 5F8JA 3GU0A 3JPRA 3T7ZA 5IXUA 2MY8A 3CYMA 2D3UA 2CJAA 4BC3A 3CJKA 5H9FJ 3TFSA 3OYCA 2JWNA 2L48A 3CCRN 3ZTSA 3FMBA 9ICJA 3RH6A 5L46A 4UAZA 4O55A 3ITHA 4MKYA 2XYPB 4MFCA 5CYQA 2HRTA 5LXYA 2UXBF 4NE9C 3O4WA 2YWEA 7FD1A 5EGYA 4C3KA 5K20B 4BC4A 4UAUA 3C6UB 4KLLA 5AKGA 1YRTA 1H73A 3EEQA 5D15A 3PX6A 4NA2A 4B1XB 3E51A 4LVOP 1R0AA 4U95A 4ZP8A 5AI5A 2HFSA 3NCPA 7ICMA 4RW8B 4QW8A 2YWWA 4FVCA 5JVHL 2KKVA 3MEEA 2LSNA 3U1MA 2Y1IA 2NO4A 3FKBA 4PL7A 3SBMA 3TX0A 2R7QA 3VGLA 5HL7Q 3K5MA 1TK8A 1SWWA 2QEXS 1ZM4A 4RUBA 2CQ3A 1HYZA 4QIWD 3V72A 2YX1A 1GEHA 3G10A 1Q4RA 2W4CA 4JV1A 2DKZA 4DQRA 3CF5Q 4U6PA 2OTLN 4Z4FA 1RCOB 3Q8SB 1FK9B 3PCOB 2FPMA 3L5KA 3BDEA 2PGCA 2IHNA 1NHUA 4YXMA 4DXLA 1ITGA 1S0VA 4ZVPB 2K8CB 2WMMA 3CD6N 2BKPA 3U26A 2MKCA 2VG5B 1LCUA 3IHQB 4U7UD 2ROEA 3KLHA 3RMCA 2KVIA 4ZHRB 1JJ2R 5CYMB 1WWHA 3D68A 2GO7A 3O4NA 2PMZF 4I2AA 1ZJNA 3GONA 4RQNA 3GFYA 1GMVA 5AXKA 4ZVHA 3CCEN 3EXYA 2ZTEA 2MZQA 3FQKA 5AI6A 4A8OA 3NVMA 3C65A 2MRLA 2C2EA 2XZWA 5AQFA 2DL0A 2V52B 3VAIA 4LC9B 1T0TV 3PKMA 4PYAA 2YHXA 3THTA 3OQ2A 8AT1B 1YJRA 1RE1B 1TVAA 1HKBA 2E1AA 4B1UB 5F8GA 1AT1B 3FE1A 4LFAF 4K4YA 3NEKA 3MM9B 1ZD2P 1K0TA 3FBEA 2H51B 4DR3J 3CMQA 1MNEA 4DSFA 1NH7A 3O3HA 4NLGA 2DEIA 4IEIA 1T4GA 4RU9A 4LF9F 1Q3VA 5AXMA 4Q0BB 1NO8A 2GQ2A 3HHEA 4CGZA 4EENA 4IOAL 7ICFA 2O66A 2RKIB 4CCHA 1K1QA 2OPSA 4DQ8A 3TFRA 4OZJA 4ZVSB 5DBAA 1DQ9A 4WYLA 5SWMA 2HHTA 4DV6K 3D6HB 2CJKA 4NV0A 4GIBA 5ALGA 2LU2A 1RT3B 1S4FA 2FTRA 2O8DB 2MY7A 3MURP 4YOYA 3FM9A 2MKHA 4QZFA 4OJOA 3K8WA 4ZA1A 2FVSA 2ILZA 4BROA 4W4MA 3AVAA 1RAGB 1QQOA 2KVSA 4KE5A 4LBIA 4UUXA 3TAPA 2RDJA 3O9QA 4Z4HA 3PXGa 1XTZA 4FWNA 1ZQMA 3EGZA 1S77D 5F9NA 2BPFA 1N5QA 1TL7B 4HCCA 1KN5A 4OX9J 2E5LJ 2IS3A 3P38A 2WK4A 2CQ2A 3TAMA 2RS2A 2FGOA 4JN4A 3BSAA 4OFZA 5T14A 3LQVA 3V1RA 3IWLA 2BOPA 2FZGB 5HRNA 4GV3A 3IMXA 2O8FA 2HI0A 1BD6A 3FCVA 2YX7A 5L9XA 3MM9A 1RXVA 2V8DA 3Q89A 3WKBA 1W26A 5T7BA 3U1LA 5BR8F 3QYYA 4DN0A 4N41A 5ALQA 4RQMA 5HATA 1E6VA 3MEGA 5L38A 4NLKA 1ZQAA 2ACMA 2QA2A 1B4SA 2GJFA 2XO6A 4BACA 2KZMA 3N6MA 8ICZA 2FSJA 3Q24A 4FJXA 1NLKL 3VQEA 3WK4A 1HKGA 3CDBA 3MX5A 3MMAA 5DGAA 2ZG6A 3FAHA 4UOGA 2ZGZA 1TKXA 5A6PA 1X4HA 2DXFA 2K1RA 2JWLA 4CFCA 1C4CA 1X5PA 5E3PA 5I3QA 1FRLA 2DHXA 3TACB 2FBXA 5HROA 3FFIB 3HF5A 3MECB 3H7IA 1RT5A 4RZRA 3VEXA 3JSMA 3KZXA 3DN9A 4PXDA 3AQFA 3SD7A 5C24A 3HKZD 2GJ2A 4C9DA 3SCIE 3MM8A 2JRSA 1S0MA 4PUOB 4M5IA 1Q8KA 3PMLA 1RHQB 2CWKA 3GP9A 1HNXF 3THXB 4YEAA 3H59A 1CUKA 2FVQA 4I2PA 2HW3A 2CGLA 2AQ4A 4Q43A 2RRDA 1AROP 3DYAB 1MA7A 1KAYA 2Q3SA 2BEFA 2ZUBA 3KZIU 1VQ8N 2QTDA 3P5TL 5DB7A 1ZXIA 1TL4A 1JKHA 2F3JA 4FNHA 5CZXA 5GADI 2IBKA 1V5VA 1YAGA 3RJFA 1HBMA 3DM2A 4I7FB 4HVJA 5CXTA 3SQIA 1UWBA 5LJ3Y 4OJRA 1QM9A 3OVBA 2HBJA 3FEYB 1U0HA 5AKLA 3LH2S 3IMQJ 3ENOA 3F73A 3CCVS 2YMQA 3UE5A 2DNZA 3EN9A 3NBPB 4DV7J 4D3HA 2YX6A 1JLFA 1KRPA 5GMDA 1C1CB 1ZZFA 3FCWA 2ATCB 1EQMA 4EEKA 1Z4OA 4UASA 2IM1A 3BH7B 4FYWB 4ZVUB 1HBOA 4HDHA 4C23A 2KJ8A 3IAM9 2IPOB 1RT7B 9ICVA 2BJ8A 2MU2A 4UB2A 4YQWA 4Q8EA 3ONQA 2VQFJ 1UKUA 4C0OC 5F0XA 2WTFA 1N34K 4CO0A 3ZEUA 1U8WA 3K4GA 4Y0FA 2R7YA 1ZQUA 1J97A 2H5XA 5K8PA 4CF8A 3ICLA 1DRGA 2A6OA 4C8OA 3MXHP 1EJ7L 2CNKB 1B70B 3CD6S 1K5OA 4AQYF 2QWMA 3FZHA 2KI2A 3HK2A 2HLUA 4KGKA 2HVZA 1XK8A 4DCHA 3QGHA 4F9OA 4M3UA 4NLUA 3DMJB 1F6TA 2ASYA 4CJVA 2GNKA 2IIRA 2KT2A 2V8PA 4KT0C 3E9LA 2C42A 1YQHA 3KVGA 4DFMA 4JKBA 2MQNA 3FBBA 9ICWA 5HQ8A 4CEBA 2CXYA 1DTQB 3ZI4A 4JI0K 4KGVB 2E2QA 3AVJA 3ZD9A 2GELA 4DL0C 1JMSA 1Q5YA 3H8JA 3CJ9A 2XY7A 4ZPBA 4OGCA 1L3VA 4O5EA 2X7IA 4Z94A 2AV5A 1IBMJ 3D6TB 3MZIA 2AJ2A 4A8FA 1D0EA 1QUVA 5BPMA 2IBOA 3GG0A 1R43A 3GIJA 4OX9F 4I2FA 2E5GA 1Z1BA 2EBEA 1X4GA 2ZIXB 3OA9A 2Z30B 4E7HA 2WOMA 2ZJ8A 4O0JA 1AB8A 3C16A 2UUAF 4H5NA 3SV3A 3A4TA 2MLXA 3PIOQ 2DRDA 1VBZA 3P6YC 1V3RA 4FZXC 5F3ZA 2ZE2A 2RQMA 1CULB 3S8SA 1NBEB 2XLKA 4DR6J 1N0UA 3BQ1A 4QS7A 1ZQQA 1HWKA 2BCSA 4PRFA 4U7BA 3BGRA 3BGOP 2LXIA 1Q82O 3ZETB 1R8CA 2CPRA 3KLEB 5I3UA 5D4LA 2GVDB 3OYDA 1C0UB 5KT5A 4QPTA 2GVZA 2QSFA 3IG5A 3BEXA 3PLAA 1YTAA 1S1TA 4FOIA 2WF8A 3SMZA 2RIJA 1XMOF 3RMDA 4NLWA 4CTAA 4EX7A 3OR2A 2B9XA 1SXDA 2FDRA 1UMJA 2ZUDA 1BWEA 3U6FA 2YHYA 2CVIA 2XMJA 1UTAA 2WSFC 4HYKA 4KV8B 3ISNC 3BO2A 1N61A 2NYVA 2AIRB 1Y0HA 4CH0S 2HQIA 2P6SA 4Y2QA 4BQZA 3H8YA 1WSIA 3P31A 3G71S 2JEGA 4URSA 2JZBB 1U1QA 5AQTA 3WC0A 2C2ZB 1KP6A 2A40A 3H5SA 3IFEA 4EGLA 2UXBJ 1D9FA 2O8EB 1YJNN 3LP3A 3UPFA 2F9DA 3W2WA 1HARA 2QT7A 3V7KA 3V6HA 5M1KA 4O4RA 1GLDG 1VHIA 2B9EA 4KQZA 4C1NI 4MYTA 3LVVA 4XQ8A 2E3TA 3AVBA 2YI1A 3TABA 3JPNA 4UF4A 1FJ7A 3CUNA 1PC5A 1ZQPA 2ISPA 1WC4A 2UXCK 2ZVSA 2E88A 5HRSA 1DHMA 2B0CA 1FJCA 3A1YG 2VHGA 4EYHB 1HW9A 1BQNA 3UFCX 9RUBA 1DFDA 5FP0A 1RDRA 5GAEP 1VLOA 3OSNA 2JJ4D 3T1AA 1D9DA 2DUYA 1OH7A 2CGJA 3N28A 1JCFA 1HR0K 1E3MA 3HJEA 2K3KA 2YNIB 4YN4A 1FW6A 1X9MA 3EZWA 4GMJB 3WQUA 5ALYA 4KLFA 1EIYB 3A8IA 2PI4A 2QSWA 2P9SA 5AZJB 3WNGA 4O5FA 3QU5A 4W5NA 3JAMU 4AHUA 2KE7A 3L2VA 5K9FA 3VF6A 5IIIA 4F91B 2QC3A 3AB2B 4Y6IA 3HX9A 3RBZA 4ZJQA 1PYOB 2MHNA 4DTXA 4NEZA 1NSQA 1FRKA 2UVUA 3QBCA 2Z2MA 2A42A 3D1OA 2P66A 2GFFA 2ZJPL 4LJMA 4DL4A 4PWDA 1IR1A 4FDFA 3M8ZA 4JI7J 3KWGA 4E89A 4A59A 5J0OA 3H90A 3QEVA 4CJPA 2DO4A 4CF9A 3ISBA 2LKZA 3DLJA 4QZAA 1RZMA 1XN9A 2EPIA 2BANA 3IS9B 5HVFA 1KD1T 3W62A 1Z05A 4ISGA 4HT5A 4NL9C 1IBKK 5AXLA 1R8HA 2P9NB 3HBTA 2GV1A 4ANCA 3SIPB 4WFNQ 4OX8A 3UD5A 4FJHA 5DQHA 1B22A 4C3MA 1I3AA 1UW4A 3QAEA 4WE1A 2QX0A 4PWDB 4RW7A 3CFRA 3K17A 2N82B 4OJ3A 3BBFA 3AAWB 4Z4EA 3N7RC 1RWWB 1E6YA 2OPPA 1LWFB 3GIRA 2CIMA 2ALYB 2MMYA 3LP0B 4CGFA 2OGUA 1BCMA 5AI8A 4KR0B 3M8SA 2X6NA 1M90T 3W5ZA 2D1CA 4DTOA 2HQCA 5AFUA 4GVBA 1KVJA 2W01A 1TKZA 1XJWB 2HQGA 4FJNA 4UOFA 1AUSL 2KXFA 5AQGA 3CT9A 4OKKA 4GKKF 2LU1A 4I2JA 1RSCA 1PBUA 3GG4A 2HHVA 3MR7A 4NYPA 2JSXA 2LFVA 3DRXA 3GZFA 4O23A 2D3OR 2MZTA 1IBMF 2E4LA 1UETA 3OYMA 2P9UB 4QNLA 1LW2A 3C7NB 3C28A 1SJRA 3H0PA 3C2MA 4YHHJ 2H3GX 2GVDA 4YHHF 3AQEA 5EE1A 2OWOA 4RUAA 2G07A 3AAPA 2PFOA 3OL6A 5E3QA 1O5JA 1RB0A 1QZ6A 1FF2A 4M0AA 2FDNA 5JU5A 4HH0A 3RSEB 3U7JA 1GLBG 1NI3A 5G0RB 1PVPA 2PT0A 2YHBA 8ICBA 2BOAA 4FW2A 4YR3A 2OELA 9ICLA 4ZP9A 1YKWA 1W0HA 4F5OA 1TKDA 5A8WA 4BVPA 1T05B 2BH1A 3C19A 2PYJA 1NM2A 2FPHX 1ZJMA 1H2UX 1RT4B 3KKAC 3NHGA 4Y2MA 1KBRA 3GIIA 5D0GA 5MAOA 3EDQB 3I33A 4OKJA 1VQKS 1YRUA 2DRBA 1F44A 2J7WA 2HMIA 2ASMA 3KLFB 1K6YA 3CCMN 4QOZB 4H0VB 4USKA 1B0VA 1F9EB 1JXLA 2NXJA 1HNZK 2QXLA 1L8OA 5CP2A 4PG8A 2WFAA 5K5MA 1HR0F 1SZHA 2BKNA 3V9XA 2JGUA 3O4QA 1ZYQA 3D67A 3ZTOA 2VGNA 2MKKA 2R8GA 1V85A 8ICXA 5D4OA 2MPUA 4NA3A 5AQIA 5AIAA 5LL6Z 5BN8A 4WPAA 4KB1A 5GIPA 2W2OP 1VIXA 1QHTA 3UN3A 5ALZA 5SZTA 3VV2B 5HBMB 2RPIA 5KGXA 3U27A 2R8KA 1TAUA 2VG6B 1W7AA 2MJUA 1EQ0A 4XEIA 2LQ5A 5KG4A 2G8KA 2WBRA 5TKWA 4FPAA 1A6SA 4IFVA 5J2QB 3EE3A 3WIUA 3OXLA 2ATLA 1ULRA 4MDAA 2ROPA 4AP9A 3CC2S 4MO4A 1R0CB 3Q7CA 4RNNA 4LFAJ 4IG3A 2ZXIA 4N76A 3GIMA 1NSPA 4NCAA 4I9LA 1V5IB 2UXDF 2DGWA 2BDUA 4AL6A 5ADZA 1ATSA 2IDEA 4UT4A 1LK5A 6FDRA 3OJSA 4ED0A 2C3UA 4OV1A 2VA3A 3RJKA 1LOTB 1NDLA 1F9FA 3G4SS 3ZTQA 1QS4A 1M1KT 4PHPA 9ICRA 1Z1ZA 2OEMA 2VIXA 3BV8A 3MCSA 3VHQA 2Q2RA 1RDUA 2CG4A 2HB5A 4OZ2A 2W04A 4BLGA 4IOCL 1VLBA 3PW2A 4RQ3A 3IM1A 1KAXA 2FVRA 4KSEB 4FWLA 3FC9A 3PDNA 3ZTRA 4RW6A 2GBZA 3PRDA 5EWEA 1FXDA 4G1QB 4Z4CA 2QYGA 2DR8A 1D3WA 4PEOA 3DI6A 4LH4A 1SI9A 8ICMA 2M70A 1WNEA 2IA6A 1EO1A 2UXBK 3FGUA 5HBMA 2JH3A 3LPYA 1CC8A 1Q0NA 4RG8A 4GKKK 3EICA 3QNMA 4TUSA 3DLBA 5HHIA 4GKJK 4CF2A 4AXJA 4GRSA 1AXQA 2P9PA 2CPEA 3NF6A 5ALVA 5H9EK 4FSVA 4CE9A 4DUZF 3MN5A 1IBMK 4KPCA 2CQDA 1ASUA 4ZCKA 4HR2A 4NLYA 1UPHA 1C7YA 2XMVA 2YMLA 5AIBA 1GT8A 4DV5F 3HLUA 4M5KA 3SUQA 4EU0A 4IO8A 1OXJA 3ZT0A 1ECWA 5HR6A 5L9NA 4QIEA 3OS0A 3C5FA 2VWKA 3OTBA 4URGA 2B43A 9ICSA 3MAAA 2IVFB 2HFNA 3IR7B 1SZ2A 4FE3A 4OHWA 3OYFA 5AQYA 3AO4A 1FFSB 4LZDA 2WC9A 1NPRA 4OYXA 5T7LB 1NGDA 1E4FT 1X5OA 4X66K 2D3ZA 5CY4A 5E3CA 3RMAA 4KHYA 4Y2XA 3R8YA 2WOMB 1QSLA 4YR2A 4Y2SA 5DLGA 2V34A 3H45C 4DR6K 4OX7A 4JV0A 4J9VA 2WBMA 1ZQHA 3OVSA 4KB7A 4IR9A 2QTWA 1UZHA 3G25A 5CYQB 5B08A 5KFKA 1LWCB 2ZH7A 2BJ3A 4KGXB 2CDRB 1JXVA 3O3FA 2HG4A 2G1HA 1QE1B 3RJMB 1U7LA 1WHVA 2DR9A 2ZH4A 3CNHA 3ID6A 2J0WA 1ZOLA 5ALEA 4NEYA 1S0OA 1Z26A 1LQ9A 1PK1B 4FK2A 4QZBA 4JI6J 3DDHA 3K57A 4FJLA 1SB6A 4N5SA 1FXXA 4Z6EA 4KRFA 5BRFA 1DZ5A 4CYUA 4X4PA 2XBPA 4O3PA 4O44B 1HBNA 3WKDA 4O3OA 2QWNA 1WCNA 3QIDA 2VH7A 2FD2A 3QO9A 2HMPA 2E8NA 3CE8A 4QWEA 3K9JA 3M8WA 3QRRA 2HK2A 5I4MA 2XNRA 3UPQA 4U67Q 1SL2A 2XWYA 2I9GA 4O4GB 3R1XA 2AU0A 1IJJA 5EN1A 4ECXA 3TUIC 1BXNA 2YKQA 4IH7A 5GTIU 2HIQA 4OLBA 3HRDD 4GVLA 1WF0A 2VWBA 3B6BA 2A1JA 1ZXOA 5KGWA 4O3QA 2FF3B 3ULDA 3J81j 2HLTA 1WSHA 4DOCA 1TUVA 4PPDA 3AJ1A 4FJIA 4OJLA 3JTNA 1VQNS 2HHPA 4N56A 2XI2A 1C0FA 4XO0A 3BZKA 5BREA 5ALDA 4CEOA 2ZVIA 2KG0A 1NLVA 2A0FB 3D5MA 1NMNA 1RTDA 2HQ3A 2ZIXA 1WWVA 5BOLA 1KFTA 4CDGA 4I6AA 4DUZJ 4ZTFA 5DB9A 2EWSA 3H25A 3CC2N 2J9CA 1PZNA 1IBCB 3DOKB 3HSTB 4CRXA 4CEFA 3KNGA 4LFCK 3LDOA 1SQEA 3X3UA 9ICCA 2FY8A 2IA0A 2WB1D 2BUPA 4KLJA 1K9MT 2W42A 2GAHC 4DV7F 1D8YA 7ICRA 2M9KA 1SH3A 2DHAA 5FPDA 3ZX0A 2VDHA 1AZSB 2LXFA 4M3XA 1JROA 3GL1A 2DNPA 1GX6A 4BWMA 3ZC4A 3P4IA 1YTUA 1FD8A 2GGPA 1ZD5A 3VAHA 4C4WA 5F3TA 4O8KA 1X9JA 2VA2A 3N4WA 2BDPA 2PSZA 3GSDA 2E1MC 4PYDA 3ONNA 1BWVA 3QJLA 1T3QA 3NG8A 2ZWOA 4KFBB 3HT3A 5KG5A 4MK9A 4JB8B 4PY5A 1HFEL 4F4AA 3NAHA 4UZBA 3LALA 3K5NA 3KKAA 3NF7A 2EXUA 1KD1O 3I56S 3C2KA 2QIFA 3BF1A 2KL8A 1RADB 1NNEA 3CCUS 2JFDA 3M1VB 4ITSA 4I6MA 2DFFA 1NK4A 2GHVC 3G4SN 5AK3A 4USJC 3O08A 1H74A 1VMBA 2M0GB 5CR4A 4WK3A 3A3NB 4J9QA 3H2LA 3MR2A 2ZH1A 1PG5B 1VGYA 5GAGI 2WRMA 3GOIA 1FFUA 2G09A 4IFEA 1Z2LA 2MQMA 2HMXA 4JI8K 1GFWB 2OYQA 3D2EA 4MFFA 3RR7A 4TXSA 1DY3A 2RF2B 2FSKA 3LAMA 2VPWB 3AO5A 2FJVA 2ZH5A 1RTZA 1M6YA 1TVRB 3P5JA 5EE0A 1YJWN 1W25A 3ALYA 3AARA 1CJKB 4I6MB 3AU2A 4NLDA 2W25A 9ICXA 4M5MA 1KWMA 2M2BA 2XMKA 6FD1A 1TKTA 2Y8WA 1N8RO 1YI2N 2ITMA 2VPXB 3ELHA 1WOOA 1ZD3A 3BO4A 3HKZC 2HZCA 3QQCD 2QARA 4Y3CA 1EXNA 3QIOA 3M2VA 3N7PD 4H0YB 5CQGA 4R63A 1TMJA 3TANA 2QLJB 4CJFA 3SAFA 1KC8T 2RNEA 4OV6A 2ZJRL 1XIQA 4FXVA 3LP2A 2RU3A 2WVEA 4IO9Q 3NH0A 2KN4A 3RMBA 2XEXA 3B54A 3W7BA 2DY4A 3SSSA 2LI6A 3QATA 1D1UA 4KGZB 5E3RA 3LPTA 1V3ZA 4E98A 2F5GA 4DTSA 2ASDA 3J81Y 5KI6A 1KDNA 1JXEA 1KVIA 2EZYA 2DNNA 3LGHA 2DGQA 1TK5A 4K4XA 2YH1A 3CFOA 1R3NA 2G0AA 3CCSN 3B8HA 1H1VA 4DDFA 7ICQA 1NJZA 2POKA 2YJEA 4G65A 1VC6A 1LAVA 4FJKA 4LFBJ 3M6KA 3MK6A 4ZMMA 4XDDA 1FWPA 3OXGA 2BV3A 1F0XA 2WB1C 4F2SA 1S1UB 1HYSB 5GVQA 4X65K 1FXLA 4DV4F 5J2NB 1H2VZ 3HULA 4ETZA 2A19A 3DLEA 3JYTA 1CJKA 2A1JB 4M04A 2KD1A 2CPHA 1WF1A 1U6BA 1Q81T 4F0MA 2M9NA 4XPCA 1BUXA 4FLYA 5DDMA 3DXBA 5HAOA 2QLWA 1UA1A 3BH6B 5DGBA 2XIDA 2L08A 3P49B 2YPZA 3WDOA 1DGJA 1RM6C 3F9KA 3K1RB 1R6VA 3QMQA 3R8EA 4GXKA 1GXUA 4DR3F 2VONA 5IIKA 3I87A 4CW7B 4M7XA 3LWLA 2JEJA 2HK3A 2DWQA 1Q7YO 1HD1A 3EYZA 2AWZA 9ICPA 5KFWA 3TI0A 2G2YA 1RTHB 4KREA 4CEQA 2F9JA 3VTHA 4JRPA 4P0PA 1M5HA 5IT0A 1VS3A 3D66A 3AVLA 4C8KA 1WHYA 1SQFA 4CGDA 1PYSB 1ZBTA 1FKPA 4NXZA 1I94F 1U4BA 1ZQCA 3C2LA 1RJJA 5KQDA 2ZJRQ 2C22A 5HMYA 4P71A 4ILHA 1E4GT 3CJ8A 2OKQA 4L74A 1HQEA 4YD2A 1A6LA 2Z2LA 2ZNZA 5J2DA 3ALRA 5E3AA 1P90A 2K4HA 5JXSA 2F77X 2D0BA 5KG6A 1VQ4N 4FK0A 1N4LA 1Z4UA 5J8YC 3M9NB 3CIMA 2ESEA 2Q6BA 4M63A 4BY9C 4OJ5A 1K8AO 4Y2JA 4GV6A 1X9SA 4BHQA 3LM9A 2C28A 2U1AA 4E7LA 4NOHA 4LF6F 2WZ1A 5J0TA 2HOEA 4IG3B 3AO1A 2DBBA 3OTOJ 2A1SA 3C0BA 3M9MB 4CIOA 3MEDA 2R18A 3RBDA 3BO3A 3TOQA 4UB6U 4V19S 1YJVA 5ALWA 1TFWA 2UU9K 2LM4A 4IBNA 3AU6A 5M1NA 4TUQA 1EX8A 3VGMA 3CQ8A 3HM9A 3KWIA 1HUXA 3ADAC 1DLOB 5A8RA 4JI4F 1X0FA 4YDDB 3EM1A 4NZ7A 3SDEB 2JVRA 4W92B 3DRSB 4ZVRB 1O08A 4TN2A 4B9QA 5JICA 1C0MA 1Z25A 5D77A 2EFGA 2ITGA 3VQAA 3VQ8A 4B6JA 1S6QB 2MAXA 1G3OA 3DJCA 4FLXA 3K2YA 2F8HA 4IQUA 4LMZA 1YG0A 1NGIA 2L5YA 4GMKA 4JI2K 4YCXA 4N8OA 5DDOC 5EY4A 1Z1VA 1WB9A 3PY8A 3SNNA 4J9KA 4XIUA 1S72S 3AJ2A 2WFBA 1KQGB 3D2SA 1EARA 1VJQA 1QAXA 5GINA 1FFVA 3HHLC 3CFPA 5M1QA 1OH8A 1OY8A 4CM2A 1N52B 1DK3A 3Q2TC 5F9LA 4CLTA 2FC9A 5D78A 5H1SV 2XSJA 4F93B 2P35A 2YKAA 1J9AA 4FL9A 4CLUA 4G6VB 1HD0A 2FC0A 3F5TA 1VSMA 4ED7A 5CRXA 3W60A 2WSEC 4EHUA 3OFEA 2W24A 4ZLJA 4KRWA 3U9ZA 1FRMA 4Y2TA 2MB0B 4FWPA 5C15A 4WJ3B 2PA8D 4QJVA 2K4PA 3EKUA 3MGJA 1R27B 2EC2A 4QU6A 3GILA 3TZWA 3V6DA 1WC6A 2K7JA 3KYLA 2RQKA 4BDYA 1N33J 2D74B 4K0KJ 1VQSA 2XY8A 4TY9A 3NGTA 4R66A 3KHRA 4JP8A 3KJQB 2Y8YA 5DG9A 5GAHI 1ZPWX 4CHZA 1RT6A 3HVTA 1VK0A 3V2UC 2F1HA 1I6JA 2VBXA 2ZBIA 1J5OB 3CCWA 2OM6A 3GYNA 1RT7A 1U02A 3EGNA 1HYVA 3JS6A 3QWPA 4G9BA 4WWSA 3D0IE 4QWBA 3HRGA 3BSCA 3OL7A 2P9PB 2Q3PA 2B0GA 5CHCB 4EMDA 4QZDA 2RHFA 1RUSA 1T6DA 4CLSA 1BA1A 2DNYA 2HBYB 3ZZTA 3T69A 1IKYB 3CJ2A 3V9UA 1WG8A 5M2RA 4DR5J 3VETA 1WSGA 4ZPTR 4AL7A 2HHXA 2IC3B 2QLFB 3O0FA 1OQ3A 2P9SB 3DV9A 1V3SA 3QEBZ 3H4BA 1RTJA 4HEA9 3BP8A 4OMFG 1B9FA 2LBOA 1COKA 1HNXJ 2HIYA 4TURA 4KHSA 3WK8A 2ZUGA 1M5KC 4K4VA 4J9NA 5LMUF 3HM8A 3IDWA 3KJVA 4NM1A 2LEPA 1NNLA 5FD1A 4EWTA 1VRQC 1IG6A 1CXUA 1XNSA 2NCKL 3DU6A 4B3MJ 2XNQA 3CF5L 4BJQA 1YITS 4N7TA 2OH2A 3EE9A 2R3VA 1JQGA 2XZTB 3SLCA 4CT8A 2XG8A 4MIAA 1I51B 3JQJA 1RAEB 4LF2A 4LF6K 2ES6A 1ZRMA 1B3TA 1SV0C 2KVQE 1WOPA 1WUAA 4JI7F 1T94A 1DJ0A 2HBLA 1X6IA 3OT9A 1UT8A 3G8TA 1SV5B 2FPKA 4FPRA 5C42B 2O8EA 2ZIWA 1EHWA 1TZ0A 3VQQA 1M5PC 4LF5J 3CJAA 1S6PB 3QXGA 4F02A 3TPQA 3VERA 1M1GA 2ZBQA 5J2KA 4I2HA 3NGYA 1SZPA 2RE1A 1IWAA 2RKIA 3DXMB 4J03A 4JI4K 9ICQA 3CDAA 1NK9A 4ZHRA 2FLLA 2ZIWB 3A8YA 2IM3A 4KY3A 2G06A 3DRRA 4LR7A 2H65B 3A0IX 2AA4A 4F50A 4Z37A 1O0PA 1UVKA 4K59A 3OW2R 3OHBA 3AO2A 3EXCX 1SUQA 4QZEA 2QW9A 2NXEA 4UW2A 3ZZUA 3CCVN 1XHZA 4BRKA 1RAOA 4DLGA 3VAFA 3RJIA 3V81A 1QAYA 3DXKB 4TNOA 2BPGA 2VJUA 3QT6A 4O9MA 2MKIA 1EB0A 5AE1A 3PACA 3I9V9 1VSLA 7ICEA 3ZT4A 5KQ8A 3UO0A 2NRWA 3AD8C 3KJVB 3NMUA 2H5IB 2ROGA 3MR6A 2LYBA 3AH6A 4NLTA 3QUBA 4QU7A 1VQ5S 2YNHB 2VB6A 3SCLE 2D0PA 2JHDA 2QKQA 1J5EK 5A8WB 4QAGA 2J8AA 1N0VC 1VBKA 1YHQS 5ALNA 1TU0B 3PYEA 4KBIA 3E66A 1OH6A 1R89A 4DZ6A 4DPTA 4OVLA 2F65A 3DLGB 4DR5F 1J54A 3GMGA 4AFFA 2OI2A 5ALKA 3JSRA 4YXJA 4G1PA 2HVIA 1WNSA 3KLGA 2OEJA 3A8EA 2K3IA 4CK3A 5J2AA 3NWGA 3DLLQ 4PL1A 2CQPA 2DY1A 4ZJLA 5J1EA 5A8KA 1NKEA 1SIZA 4CJ3A 3QEWA 3E0FA 5EX3A 3AD9C 4QIWF 3HHDA 4CIFA 2DTUA 4P0QB 1FRHA 1HR0J 3HVAA 3EW9A 1IG8A 2OCEA 5U47A 2HCFA 3MWTA 1K73O 2GJIA 3FFIA 1YGYA 2Z58B 4CESA 2A10A 4XRHA 5CCMA 3M05A 3HHLB 4WZQA 2G5HB 1UVIA 3HSCA 1CG2A 1YHQN 3NXZA 1ZBIA 2EX3A 3PHEA 1D8LA 5FDLB 3CPWR 4CZFA 1ZQ1C 1IIPA 8ICUA 4OLOA 8ICFA 3TJ9A 2KHVA 1RA7A 4CHQA 2P9LA 4F72A 4QZIA 1WD6A 2GTDA 4AQYJ 1QQCA 3PUFA 1DT9A 4J2DA 4DEZA 3SR6A 4BR9A 5JMVA 2PMZD 3O6QA 4PWWA 2XZDB 2G1DA 1U49A 2VOPA 3RH5A 2QG9B 3D54A 2P9LB 1IKVA 2XHCA 4DSKA 2F8LA 4GKJF 3WXLA 2VJ4A 1B4FA 1S5LU 1CXQA 2CQ4A 1M5SA 4JHDB 3S3MA 1ZTTA 1U26A 3QIPB 4BRCA 3FMWA 2ZD1A 1RAAB 4OD0A 2LYVA 2PI5A 4WIQA 4YVZA 2ZH2A 3G6XA 3K7RA 3ZXWA 1FDBA 5B0BA 5EVZA 3EZUA 4ZIVA 3EVWA 4H4MA 1M5VC 3VZIA 5C12A 4KFBA 4PH5A 3H40A 1TL7A 2XGQA 2J5AA 4USMA 3L2QA 1CBKA 3LPUA 2QB0A 3N5FA 1B7FA 4KLHA 2HF4A 3WXIA 1BC6A 3UDEA 1NGAA 1ZM3A 5KG3A 2FBYA 1RT3A 3O5BA 3FGVA 1SBRA 4JI3F 3TA0A 1L7PA 5FRMA 5CA5A 3I31A 2OTJN 3CCJS 4WCEQ 3L09A 3O8WA 4OYIA 2K8AA 5KFEA 3NVYA 3CW2C 4PPXA 2H3VA 1Q7YT 2FLNA 3PEJA 1VSIA 4MKVA 3NRZA 4EYIB 4DS4A 4O3MA 4OZ0A 2J0SD 4NLBA 1NKCA 3MAAB 3D2NA 1YITN 1S0NA 7ICHA 4K42A 2G8IA 2E20A 4F3TA 3ZSQA 3OYNA 3B8AX 4X4UA 3FZMA 2B4UA 3OL8A 5GAEI 2DYAA 1RP5A 3R3TA 4K5RA 3LVWA 5J0PA 4DPOA 3D2FA 2Z7JA 1SIWB 4HT7A 5IV3A 1S9EB 1VCTA 4CGJA 1S1XA 4JI4J 4LF7F 1TAMA 3M8PA 5A8RB 2BM1A 4RW9A 3VAJA 4QWDA 2YKMB 2JC1A 4KX3A 3FZFA 4YOTA 4CJQA 3ZSXA 1OPIA 4FJMA 1NDCA 1HLUA 4DR5K 3QUTA 4CJUA 1XU4A 5E26A 4UB1A 2ZJ5A 1XMQF 1ZBLA 3HKZF 4I2DA 3NUQA 3H1VX 2CNLB 3RW7A 3FZLA 2NZTA 1VQ6S 2UP1A 3SQ0A 3J81O 4JS4A 3HVRA 3RYLA 4DR2K 2XO7A 2ZM6K 3QWUA 3ZZPA 2QO3A 1KKXA 1RTHA 4OZLA 5KPZA 2GGPB 2YKMA 5JVGQ 3SFGA 4ZN1A 2G8FA 5DG8A 3A5NC 3KD5E 4QOTA 2RJZA 1BA0A 3PVXA 3M1FA 2G0JA 3QE9Y 2MUTB 4NXNK 3RJJA 4F25A 2MSSA 1OSCA 3OVAA 1VFJA 4NCBA 2VDIA 1RBUA 4M5DB 3O9SA 2AYEA 3NVZA 2Q0UA 3QPIA 3I8DA 4P4OA 3PRBA 4DV3F 1X9XA 3VEZA 3ILOA 3OLAA 4RPZA 3HO1A 4UB8U 4DR7F 3QICA 4MFAA 3G2XA 4I2EA 3H20A 5LSOA 3IV6A 2Z2ZA 3TEHB 2IRYA 5J0XA 1FE4A 2AJFE 1BCOA 2YJFA 2GLEA 4JKEA 1OUQA 2HSZA 1VQYA 5E0OA 4M5NA 2B5JA 3GIKA 1NUEA 1MC8A 3M6VA 1NGEA 5AQSA 2B21A 4IC9A 1KEJA 4DSEA 2HHUA 7ICVA 1U1MA 3DHWC 3J80U 2VD3A 4DR3K 2BGGA 3NCRA 3ISDA 3T79A 2F63A 1X60A 2HFOA 4P2HA 4B17A 2E9TA 1HI0P 5J0RA 2I7PA 2OZMA 4X4TA 2BTFA 3PFEA 4DSIA 1JLFB 2JEFA 5FLXO 3EPGA 2PFPA 3MMCA 5CCLA 3OSPA 1KTQA 2KJVA 4KLMA 1UQVA 3JPTA 2ZNYA 3HSDA 4WF9Q 2AZ1A 4ZVGA 2ZWHA 2F40A 5HQMA 4BRPA 4YB6A 2JOQA 4KAZA 3NNAA 2OFHX 2BE9B 3DI6B 1ZRNA 5J2HA 3M30A 1XERA 1U0SA 2LDYA 5FPEA 1SS6A 3BF4A 3T3FA 3ZDDA 1N34J 1BPDA 2XMWA 2MGZA 1WC0A 4PHDA 4ELVA 1KONA 7ICIA 1TUUA 4JI3K 3THYB 9ICBA 2E6MA 4JS5A 1SL0A 4MEYA 4F2RA 2B7BB 2VFRA 3L4QA 4Z0UA 2KHCA 3GV5B 3UMBA 4JV5F 3L3UA 2C2NA 1R59O 5AM3A 1WC1A 4Y2CA 2HNYB 5ETPA 2ZDPA 4TU8A 3DCAA 4X64J 4M95A 2AW0A 2HWIA 4L8RB 1UVMA 4ZCMA 2E1FA 1DOQA 1MMLA 2BBEA 4BREA 4ICLA 1KC8O 1HQ2A 1HA1A 3WXMB 2C1EB 3M1VA 4C4TA 4M41A 4IRKA 1O51A 2MQLA 1BQXA 5DDPC 3BN4A 1RI7A 4J2AA 4D3GA 3THYA 1PAEX 1J2VA 5GTHU 1KOHA 5J8YA 1OYDA 3NBPA 1PSDA 3M3ZA 4M47A 4LF7K 1LXNA 3C7NA 4WFYA 1RHUB 5JS1A 1D09B 1FJGJ 3JPPA 4DU3A 4FO0A 4CHPA 3AA4A 2MQPA 4OI4A 1JLQA 4KI6A 3H8SA 1X4EA 3AB4B 4RCHA 5L1KA 1Q7LB 3RF9A 2RF2A 1VQOS 1M5OC 3AO3A 1TL1A 4OX9K 1HL6A 1FX4A 4JK9A 4TKTA 2NXUA 5J2MB 4IJAA 3TEGA 4USAA 1SC1B 3I4HX 3ENBA 2OP5A 4DR2F 5DDYA 3OYJA 4X4OA 4JKGA 4DKWA 4KN7A 1S9FA 1QVFR 2BGWA 1CS4B 4BRQA 4W98A 1OVYA 3MM7A 2ZUCA 1XR5A 1B0PA 4IQVA 3JXUA 3QSYB 3RUBL 3VQPA 3SI8A 3A0BU 4DR7J 2JV3A 3FSXA 1AFIA 1N32F 5KT3A 4WXWA 4JI5J 4NXNF 3KDOA 3B9JA 2WCXA 4PHEA 4DN9A 2MDAA 3KLFA 4ED6A 4HI2A 2V4JA 5BYSA 4ETXA 2DK2A 1J5EJ 2PE8A 4PPZA 1JL2A 2HRYA 1N5SA 2BR0A 3R5AA 3VAMA 1QQ6A 4RQ4A 3M2UB 3KK7A 4DV3K 1WEYA 2E2NA 3IWNC 4NLVA 3LM2A 1Y10A 1ATNA 1W9HA 4AF1A 1URRA 3VWSA 3J8AA 2ZZTA 2XS5A 1SWVA 4QS8A 5IQ6A 2VOOA 2EBGA 3VQSA 1WI6A 2OMLA 3VC8A 3C94A 2VG6A 3NASA 3BB5A 3OL9A 5KFAA 2FF6A 1JWWA 3W2WB 3M32A 3PSPA 2I7NA 1CULA 4I64A 2I1RA 1RBVA 2IGIA 5KL8B 3IA0A 3LTOA 1VSKA 1JI7A 3D28A 3T41A 2CXEA 3MMJA 3MDCA 1OW5A 2ODGA 3MF5A 4K43A 2V51B 4C4RA 2I8EA 3MCNA 4WFNL 4W90B 2E8MA 1GK8A 4CO1A 2V9KA 1N33F 5CZ1A 3HP9A 2PFNA 4KHPJ 3VCDA 3VGVA 4ZS6A 3M5RA 1VAZA 4CHOA 4Z6DA 1JLBB 1S9GA 3RRHA 1A0PA 1HX1A 4HHTA 1PVQA 1VQ9S 3ETRA 2ZUAA 1ZQZA 3MMAB 1PUZA 3TSQA 4ID5A 3M8QA 2PYLA 2KRRA 2XYGB 3RR8A 3C6HA 2NZ4A 1RACB 1DQ8A 5KG1A 3B6PA 3CG7A 3CCQN 1TQLA 2VQEK 4C0HA 1AYEA 4J7CA 2V2VA 3L4BC 2BYCA 2IIHA 8RUCA 2YMMA 1HNVB 2V7ZA 2YN4A 5HP1B 4PGYA 1QTMA 1SCJB 4Z2XA 2CPYA 2UU9F 2P9KB 3PO5A 2G9OA 2DQNB 4Q0BA 3RH4A 2DNLA 4B3TF 3GFHA 3GU3A 2OPSB 3SMVA 5AKEA 4NX9A 2A1RA 1MN9A 1ACMB 3LP1B 2IOCA 2D3O1 5ALPA 1B9DA 1HI8A 5KG0A 2KB2A 2W2MP 3V7LA 3FBFA 2R7RA 4DOBA 1A76A 5AKKA 2R2RA 1ZM2A 3I5BA 3MD3A 5AKHA 3C2PA 5IIMA 2Z0GA 4CBUA 3UD4P 3CVKA 2A2CA 5AQXA 3OTOK 4BG9A 2CQBA 3VVUA 4USWA 2WW8A 3NF8A 1F5AA 2Q1NA 4QCLA 1HBUB 2PA3A 2IHR1 2CYYA 3UNGC 2UU9J 3KK3A 2W4DA 4YB5A 4USVA 1WSFA 3W8PA 4A8SA 5HHHA 3KWMA 2DD8S 2LDIA 4DV0K 3A8JA 2U2FA 2AEFA 3M6GA 4KH4A 2LVWA 5DQIA 3C6UA 4OJHA 4KYZA 2R7VA 2GWKA 4DF8A 3TR8A 5CYMA 4C8NA 3QMLA 4QWCA 1FVSA 1WTBA 8ICGA 4ZP6A 3SUNA 5HLFA 3NGZA 3CSKA 4I9QA 4W5RA 1NEEA 3D6MB 3RRGA 2WF9A 4RWTA 2YKPA 5IT4A 3P4UB 5L1JA 3R5JB 5D0RA 2G8UA 2W2NP 2NPFA 1XMOJ 2CDQA 4LRCA 5F41A 2DH7A 8ICEA 3ISND 2BVZA 2WB1F 4FOEA 3B82A 5AQUA 1T03B 3BM7A 3AOCA 3QEPA 2W8LA 1ZQTA 2BCQA 1UWBB 2FB0A 4AHCA 2CZVC 2KIWA 1RAIB 5IINA 3K0SA 1X0PA 3NVKA 5CA7A 1PVRA 4YOVA 5AJ3F 2EDUA 5JLHA 1VQ8S 4JV2A 4IYQA 4PA1A 5KAFU 1NRKA 4K50A 1S22A 4JKAA 1RCXB 1IV0A 4ID1A 3SMPA 2FYXA 1KXPA 4FBUA 2KZZA 2HQDA 1FCAA 4CQ1A 2XQCA 3I6PA 2DKOB 4B9LA 2IVYA 3KKSA 2VL1A 2KOBA 1W2BM 8ICRA 1CRXA 2MUTA 5ALUA 1H72C 4LF5K 2AXTU 1SPBP 1G15A 1FTCA 4CF3A 2XS2A 5A0YB 5GADU 2DPNA 4P75A 3QEXA 5E2QA 3TW0A 2FVPA 1UOCA 2K8GA 1RHKB 3FZKA 3UNYA 1A5VA 2H3IA 4IS7A 5B0DA 4FF4A 4HWIA 5J2EA 3AT1B 4IKFA 3I8BA 3NNCA 5IV4A 5KFIA 3ZZYA 4TQRA 1RT6B 1RWVB 2RRBA 2GUPA 2O1PA 1KQSM 4GKJJ 4AHSA 5EE9A 1RDWX 2RHQB 3WEEB 2R8JA 1WJ9A 5DB8A 2PN6A 3TADC 2RMLA 2HWHA 2BPCA 2YKOA 2DJWA 1WLJA 2FZCB 4JKFA 1IBLJ 3VPZA 2BMBA 4OJ6A 4WIIA 4DJBA 3CCLN 1ZTWA 1Z00B 1X2IA 4F3QA 3CJQA 1SKRA 2ABYA 3N4QA 4KKOB 3CC7N 4X4RA 3UQ2A 4M9NA 2RP5A 4ECRA 1JJ4A 1R7IA 3OD2A 2WF6A 3C15B 1EKSA 4LF1A 4RW9B 4A5AA 5DDQC 3R7NB 3E3XA 1FKAF 2B8QA 3NMAA 2ZIVB 4MK8A 3B4MA 4YMNA 3F5EA 1FERA 3MAQA 2DH9A 3FK4A 1NG9A 2HBZB 5IWAJ 2G8VA 1HBMB 3SQ4A 3DGPB 1ZH5A 3CRXA 1HLWA 3IBPA 2LYAA 2ASOA 2P8IA 5B7WA 4H5WA 3EVOA 3TAMB 4I2CA 4BRNA 4WFAQ 2VKZG 1T44A 3ZDBA 2F76X 1K1SA 4B8AB 1WBBA 2C3PA 4R64A 2FPLA 4ZH4A 4YN3B 4CZKA 1DTTA 1B0TA 1TE2A 2LQBA 1HPZB 3Q8YA 3MN7A 3F56A 5FLXU 3ZT3A 2HHQA 1DLOA 1NOMA 1ZAWA 2DFLA 1X8DA 2KM8C 2Q36A 3H5UA 2YQ0A 3MM8B 1J5EF 3KIOA 1O1WA 3MEGB 4LSLB 1RABB 2DPIA 3BJYA 1Y00A 1T9UA 4K5SA 3UCUP 4ANEA 2VU5A 1NK6A 5HMLA 3NOGA 2M52A 2R8HA 1E6YB 2UV8G 4W5QA 2MSNA 1DBDA 4GLXA 2DHGA 5F8LA 7ICSA 1RAHB 2VBWA 1GOAA 3E58A 1JLAA 4EP4A 3Q8VA 5KAIU 1EAYC 1S9GB 1I3OB 3CCJN 4RQ5A 4JNEA 3OUYA 3LO3A 2ZC4A 4M3RA 9ICHA 4B02A 2KXNB 3NE6A 3QINA 3NTUA 1GLEG 5B66U 4YMEA 5FRNA 3PYFA 3OXFA 1LB2B 4H5RA 3LP2B 1RTIB 1BQNB 2CN1A 4UW9A 5IZHA 4ECYA 1WEZA 3OYAA 4J90A 1KVAA 3RWUA 1J2NA 7ICGA 2DR7A 4C8LA 3TJAA 3GG1A 2FLPA 1FIQA 4UB4A 4PG5A 4CF1A 3O9TA 2L9WA 4KMOB 6AT1B 5AKYA 5TKYA 2PEBA 1VQ7S 1NNDA 2RN2A 3CCZA 3BDPA 3AJDA 4OPAA 3JAMO 4CO4A 4WJBA 2YWGA 2J7KA 9ICIA 1NZPA 4WBFA 5AQMA 4BRGA 2HOIA 1YZ7A 3TSPA 4BDZA 5KFPA 2FHJD 4JI5K 1L7OA 2C3MA 1RBTA 4ZVTB 1MLAA 3KFUF 3FEZA 4BXOA 3HD2A 3AVFA 3QDKA 3MXIA 2RLTA 5KFLA 2DGOA 1VQPN 3BGLA 3CTRA 1SV0A 1EETB 4CYUB 4E1JA 1KKHA 3N9UC 3WIVA 3K58A 3ILIA 5I42B 1Z6RA 2F9TA 1KDHA 1ZQIA 4CLPA 2O8BA 1FEHA 3CCRS 4DX5A 4EK2A 8ATCB 2O8CB 3BGUA 3QGIA 2WUSA 3AVNA 4H4KC 1B92A 3CQXA 5JTIA 4BRMA 2VPZB 3KLEA 2F4VF 1HNWF 4CZIA 2BKOA 4CNYA 2N3LA 3UDCA 1WG1A 4L75A 3MDFA 1VDVA 3N5BA 2I6WA 1VHXA 1L6NA 5HOOA 4A5BA 4CF0A 5IFMA 3IM9A 3BGFA 8ICIA 4Q44A 1Y5NB 4CO3A 2P9GA 4KMUA 3X1LB 1TV6A 3W5YA 2RHKA 2YWKA 1CQMA 1KTVA 3ZDCA 5D4BA 2BCRA 2HNZB 1Z2ZA 1Y5LB 2BACA 4CZJA 4NM2A 1Q82T 1ITPA 5J1NA 2E5SA 4YOXA 4CDIA 3HP6A 3A12A 2AP1A 1P8GA 1Q79A 1QQMA 1EP4B 2CJ9A 1XNRF 1VSEA 1UP1A 4P74A 2VG5A 5CZ2A 2J8SA 3QERA 2PD1A 3HSJA 1RDAA 2H1YA 3UXNA 2DCUB 2E7VA 1L7NA 5KFFA 1X4CA 1U2FA 3N97B 3T5JA 1HNIB 3JTOA 3ZETA 2IVOA 2YMPA 3P45B 1T3VA 2FJBB 2J9DA 4KHWA 3L4IA 2KHDA 4DTRA 1QHAA 4I2QA 1Q8LA 4B1VA 5J1PA 4QIVA 3OS2A 4RQ6A 2HFUA 4KHNA 2HNDB 5J0YA 4DOZA 3T1HF 3H6EA 5AM4A 2OPQB 2NSBA 4C98A 1N6QB 1NHKL 4G3IA 2QLBB 5E33A 4CEZA 4NWIA 2AEMA 4F4KA 1AUDA 3J81U 1BNOA 4ANDA 1KR4A 5AQVA 4IDHA 3D0PA 2HQFA 1HJOA 1JKHB 4ZITA 4TLRA 1K44A 4FO6A 2E5JA 4RBTA 4CERA 3AUOA 3MOJB 4HKQA 1RISA 3BUZB 5D8HB 1FKOA 5ETOA 4DV5J 3L2RA 1LFPA 1FK9A 2Q31A 1MROA 1VLYA 4U8YA 1KQKA 1H7WA 1ZQYA 3ULEA 3LW5C 4FJ7A 3IC1A 3UR0A 3OS1A 5CJ7A 4MF2A 4QS9A 1HJPA 2K06A 2ZM6F 1EWQA 3TVZA 2GWJA 2ILYA 4KPYA 3WNEA 1N56A 2NYHA 1APSA 4DCOB 2FHKA 2V50A 3L7PA 4DV6J 4B3RF 1U24A 5GMEA 4PXBA 1UFWA 4FN5A 3ZZOA 4BVOA 1EP4A 4RW8A 3VQ4A 3OBYA 4U67L 2KJ9A 2OJ3A 3ISZA 4B1ZA 5DDRC 4RJVA 4DMZA 2QWLA 4L3KA 3ASMA 1MU2B 2HS3A 2MXYA 2CJYB 4RQ8A 4CM0A 4CF4A 1LWXA 5AXNA 4CEDA 3JXOA 3ZZ0A 3J7YI 3EZOA 1M0SA 3V9WA 2JHEA 4ER8A 2F8EX 2W41A 1MSWD 1S12A 4AT1B 2H54B 4EZ6A 1LAWA 1Y97A 2G08A 3NF9A 5ALFA 2O67A 3IRXB 5I3PA 3L0QA 3GLJA 2VZ9A 4QPXA 1QSSA 3U4LA 1XR6A 3BY5A 2F44A 4DV1J 4IQXA 2HBKA 4RUCA 4RQ1A 1DEJA 4XPEA 4PL8A 3ZSRA 4AH9A 1HWIA 2E5HA 5DO2A 2P9IA 4M9JA 1WAJA 2G2ZA 3TWZA 2WBNA 1ZA2B 2C2OB 5HK4A 1UJ6A 2JNJA 4OKEA 2DISA 1EWRA 4DO9A 1A9NB 3BKFA 4OJ1A 3G96A 4ATNA 2CPXA 3V6DB 3O44A 4RT2A 5IQQA 4DUTA 4Y2IA 1L3TA 1S1VB 4IOBA 1HNXK 5L1IA 2F8SA 3RB4A 2E1ZA 3QU9A 4OZ3A 5HN0A 2DNQA 1COOA 2BANB 3A3PB 2P9NA 1JNZB 1QUPA 4K2XA 2ZXHA 3VN5A 1X4DA 1ZQEA 1T6CA 2HHSA 3H0LB 3PKYA 5AM5A 3MUVP 4Y0WA 1FEZA 2J0XA 3TQ1A 2EI5A 4ZVOB 1RU2A 2K4EA 4UOHA 1JMTA 1X5SA 1HQUA 2LEAA 4E1NA 1S57A 5AT1B 2LKYA 1IKYA 2NRZA 3AY0A 4CE6A 2XCAA 2KN7A 5ALRA 4WE1B 3R5BA 3K5OA 4KHPF 4V1Ak 3K59A 1GOBA 4XH5A 2CJXB 2FBVA 3LP0A 3PZPA 2UUBJ 3GTYX 3JSMB 1XNRK 3RBXA 3CMAN 2COLA 2AYMA 4BRAA 2V6AA 4JKDA 3DOMA 4MMOA 3H1QA 3NH2A 4NCGA 3HI9A 3CXCR 5F8IA 4K4HA 2IAJB 3IM8A 4MFBB 5C25A 2DHSA 2E7WA 2JLFA 3MR3A 5KAKA 3GDXA 4K0KK 3IO1A 2BW2A 2J76E 2GMLA 4DV2F 2V4QA 2KFZA 3MWBA 3CMES 3PX0A 3N4MB 5AK5A 4NYOA 1RHJB 3DYAA 1VQ5N 1JLEB 3HDSA 4MKAA 4BRIA 1KVBA 1PJ7A 1RT2B 2RRAA 3DDIA 3N0VA 4DR1J 1IBLF 2GIRA 4EELA 1XNQK 2K4IA 3MM6A 2F2AB 4LVNP 1WCLA 2QB0B