4B9TA

Structure of the high fidelity dna polymerase i with an oxidative formamidopyrimidine-dg dna lesion -dc basepair in the post-insertion site.
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9tA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9tA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9tA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9tA01
4CHOA 1JLCA 2AQ4A 4N47A 4DSIA 3AA4A 7ICUA 2PYJA 3C23A 3ZD9A 2NUBA 5DQIA 4R5PA 3HW8A 2PY5A 3MR5A 2UVWA 2P5OA 4E7LA 2OA8A 4KTWA 1L3TA 3L2QA 3KD5E 3ZSXA 1RTIA 2GUIA 4DS5A 5KFGA 2PFNA 1Z25A 4LSLA 3C6UA 4QOZB 8ICQA 1DGSA 4I28A 4OKEA 4CF2A 4KREA 4ECSA 3P5JA 3OYMA 4MFFA 4GVMA 1RT5A 2FBYA 3U6FA 1J9AA 2ZTDA 4CJFA 1IKXA 2F8SA 4OLAA 3C94A 4NLZA 5J0QA 3JPNA 4J2AA 2HW3A 7ICJA 5KI6A 5KG2A 3IRXA 4AHCA 2C28A 4RQ7A 1U49A 5C5JA 3OYIA 4TQRA 3U3GA 1ZQXA 3RAXA 7ICKA 3OSPA 4YR2A 5DB8A 4RU9A 1BIUA 2P6RA 5EU7A 2FMSA 5DBAA 3ORYA 4O9MA 1KFDA 3ZDAA 4E7KA 2PFPA 2X74A 4O0IA 3ISDA 3RJJA 3O3FA 4M47A 2P66A 4BWMA 4CK3A 4DWIA 4RQ8A 5J2DA 2AU0A 3NBPA 4CJVA 9ICGA 1YVUA 4ZHRA 3Q8RB 4TSXA 1CEZA 1TVRA 3VA0A 4R63A 4Q45A 2Y1JA 1JLBA 1JLFA 3PX0A 4KTQA 4DLGA 4NLGA 4CJTA 4E89A 4YR0A 3MEDA 4NYFA 3HWTA 2OZSA 4YVZA 2G8KA 4R66A 2GWSA 3LPUA 5DMRA 4CIGA 4NY8A 2PYLA 4FJ8A 1NJXA 4O5BA 2FPMA 4AHSA 3SUOA 4H4OA 4ECTA 1RTDA 3ZSWA 3QNNA 2W9MA 4C8OA 5SZTA 3GFKB 1ZQGA 3AA2A 2BPFA 4Y1CA 4KLTA 4WE1A 3FFIA 4W5TA 4KPYA 1ZQPA 4F92B 1KVCA 5JS2A 2NRWA 4Z4GA 1HYVA 1Q8IA 3JPRA 1SL1A 3M9OB 5KFNA 1TL3A 4JS4A 4GC7A 5KFPA 4UBBA 4PH5A 3NGIA 3RAQA 1D9DA 8ICSA 3IHQB 5KFWA 3QEIA 3QO9A 4EZ6A 3LWMA 3L3VA 5J0UA 3KLFA 3GQCA 2ZQBA 5KFBA 4I9QA 5KFXA 2J6UA 3SI6A 2HMIA 1X9WA 4MFCA 1L5UA 3CG7A 1JLEA 3KIOA 5KFUA 4FYDA 1EETA 1T7PA 2PXIA 1UAXA 4FJNA 1ZQZA 3HPOA 4FM1A 2X78A 5KFAA 3F9KA 4F4XA 1KVAA 3L2RA 2W9BA 4DU4A 2BQ3A 4KKOA 2ZE2A 4FK0A 3C1ZA 4DQPA 3NF9A 9ICSA 1LWCA 1S1TA 5KFQA 3SQ2A 1U45A 4I2QA 1S77D 1WLJA 1JMSA 3EW9A 1T8EA 3BJYA 1IKYA 4DEZA 3ISNC 4E0DA 1C0UA 3OYNA 3QESA 4DQQA 1VSEA 2ATLA 1ZQEA 3OHBA 1XC9A 3C5GA 2RDJA 4M3UA 4CJSA 2WONA 2OYQA 4RT3A 4PGQA 1L3UA 5J2NA 4PQUA 1SL0A 5J0RA 1KTQA 4XA5A 8ICCA 3MECA 7ICQA 4RNNA 3NGYA 1MQ2A 3KK1A 2DPIA 1ZQJA 4QWEA 2XCPA 4F8RA 4RT2A 2B21A 4DTSA 3QEXA 2D0CA 4C8MA 1S1XA 1HRHA 4N5SA 1TVAA 3LP2A 3ZDBA 1HUOA 2YNHA 4OPKA 1GOAA 5SWMA 3T19A 5KT3A 3MFIA 1D5AA 3ZSYA 5DKWA 4QW8A 1BISA 4IQUA 5KFTA 1I3AA 4P4PA 3T5JA 3PMNA 3AVBA 3NGDA 1A5WA 5DB6A 4PGYA 2UVVA 4Z4CA 1WAJA 3V4IA 5HRPA 1N5YA 2KZMA 2QKBA 3E2EA 8ICHA 3P83D 4CEFA 4BE2A 5J0SA 5DG9A 3NTUA 4DFMA 9ICVA 4K4HA 1WSEA 3G10A 2IDOA 4GLXA 2W9CA 5DG8A 3PW4A 2VA3A 4Z4EA 8ICFA 3S9HA 1QHTA 4BACA 1KVBA 2GBZA 4YR3A 1BHLA 2J6TA 3V7JA 2ZUBA 4CJLA 4KMUA 2VG7A 1WNSA 4HUEA 3KTQA 3T1AA 3HL8A 4QCLA 3HM9A 2W8KA 4DO9A 3AVLA 1KFSA 1ZQFA 1BVSA 1YTAA 4KLOA 4RPZA 3KK3A 1TKDA 4F4KA 3VA3A 4KLDA 4YFUA 1Y88A 3G6XA 4Z4FA 2C2DA 3PW5A 2PFQA 3MEEA 8ICZA 3KKSA 4QZHA 5C42A 1VSKA 2DFHA 1NKBA 5HP1A 3OHAA 4RW7A 4MEYA 5HRSA 5KFFA 1XHZA 1RTJA 4GW6A 4IRCA 3RTVA 4GXIA 4YMNA 4BWJA 4M3YA 2XHBA 3HSTB 3V1QA 3FYHA 4XIUA 3K5LA 7ICPA 3QEWA 4YQWA 4ED0A 1VRTA 2D0AA 3HPGA 1KEJA 4MFBA 4FW1A 4M04A 3KK2A 4KLHA 2BDPA 4W5QA 1ZQOA 1HQEA 3MXMA 4TUQA 3NH2A 3LDSA 4CECA 3QEVA 2XGPA 1ZBHA 3OYFA 4XRHA 2V4RA 3RB4A 2BCRA 3VQBA 1CLQA 2VWKA 4DS4A 4RQ3A 5HHIA 5IIKA 1RYRA 4FVMA 3AU6A 1C1AA 3B0XA 4LZDA 4QWAA 2DFFA 4FJKA 4B3OA 1W0HA 1XSPA 3AO5A 3SCXA 2R8JA 3HK2A 4IR1A 7ICRA 3H7IA 3LP3A 3LPTA 3OS2A 1RBRA 5KG5A 3AVMA 1JIHA 1S76D 4KV8A 4RW9A 4ECXA 2FMQA 4QZBA 9ICWA 4CEOA 3JPSA 5L1IA 4M42A 4CEEA 1JL2A 3H8WA 3O3HA 4M3TA 4RNOA 3SUQA 1YT3A 2ISOA 4IQTA 2NRXA 4F2SA 4O4GA 1QSSA 1RDAA 8ICWA 1QSYA 3OYCA 2ASJA 2FC0A 3NF8A 4Z6DA 3ISBA 2W42A 4CJ3A 4O5KA 4YD2A 5J2IA 2P6UA 1BQNA 1VRUA 4PHPA 3C2KA 4QZ8A 4FLYA 8ICVA 2OPPA 1MSWD 4CGDA 2PFOA 4Q5VA 4CFCA 1D9FA 4AHTA 4N76A 2RDIA 2YHBA 3SZ2A 2I5JA 3RB3A 1LWEA 2JLEA 1JXBA 2A1RA 1XO1A 3T5HA 2HNZA 7ICFA 3AO2A 1NOMA 4YMMA 3B6OA 2AGQA 4B9NA 4M3WA 4QZDA 5HROA 4F5RA 4EYHB 1NK8A 3BGRA 5J2JA 4UAYA 5D4BA 3VQ9A 5J2CA 2MAXA 4ED2A 1BQMA 3LZIA 2QKKA 3DMJA 1BCMA 1EKEA 4KLJA 8ICIA 4DF4A 1S0NA 3PNCA 2VANA 3T5KA 5KT5A 4Z0UA 3WNEA 4J2DA 3AUOA 4ECYA 5I3UA 3M9MB 3RRHA 4FLWA 2G8VA 4MQ3A 3MAQA 4CGHA 4CHYA 2KZZA 5FDLA 5DGAA 3AVHA 4FZZA 5D49A 8ICJA 1LB2B 3Q8KA 4RQ5A 4CF8A 5IIMA 2G8FA 3O4NA 5HLFA 3KHLA 5KFKA 4KI6A 1HYSA 3LP1A 3S3NA 3RWUA 2PI5A 1S10A 1DTQA 4IDKA 1CXQA 4F5QA 1RBVA 2OWOA 3C6TA 3HPHA 4ECZA 5DG7A 2ATQA 3SV4A 1SV5A 2GV9A 9ICLA 5HRNA 2BCQA 4LH5A 3T3FA 3V7LA 1RPLA 5TZVA 3F73A 3GDXA 3PO4A 5CJ7A 2JEGA 4OJRA 1BPDA 4XUSA 3M8PA 3NGZA 5EWEA 5KT4A 2C2EA 4PPXA 2G8IA 1S0MA 4Z4IA 1JLGA 3HXMA 4FS2A 1RXVA 2BANA 9ICOA 3PX6A 4KAZA 8ICMA 1QTMA 4I2HA 3AA3A 5KFYA 4FJMA 2HNYA 1ZQDA 1ZQLA 4EZ9A 2F8TA 2YKMA 2W8LA 9ICQA 4I9LA 2O4IA 1C7YA 3M8RA 1XI1A 1TKZA 3KLIA 2XY6A 2EX3A 3VQ5A 2FBVA 4CGFA 5BPCA 9ICRA 4RPYA 5KFVA 4NLNA 3NHGA 4FZYA 3BDPA 4O3QA 4DTUA 1BPYA 3HJFA 3ASMA 4M3RA 3H8JA 3CFRA 3DRSA 4R65A 1NJZA 1X2IA 3DLHA 2Z1IA 5DDYA 5DDMA 3JPPA 2BGWA 2IHNA 3QETA 4FK2A 3MFHA 3PV8A 4DL5A 2R8KA 3MGHA 1BCOA 2XRIA 2E4LA 3VQPA 3NH0A 3ZSRA 2AGPA 3V9SA 2H5XA 3RBEA 4FJLA 4HUGA 2XY8A 3SI8A 4CK1A 1S6PA 4CF0A 3LDAA 4I2JA 3GV7B 1X9MA 1MC8A 1CXUA 4F93B 2HHVA 4M9JA 4JK1A 4CHQA 2ZTCA 8ICEA 4DMNA 3AVKA 1S0VA 1XHXA 1WAFA 4BE0A 9ICKA 3H8SA 3QEPA 4QWBA 3QIPA 3OYJA 1NOYA 4J9MA 4KN7A 3K4GA 3N97B 5CYQA 5K14A 4I2IA 2A1SA 1RDDA 1R0AA 4QZAA 4UAZA 4I7FA 4FLVA 1UA0A 3MDAA 1BGXT 3LZJA 8ICTA 1T4GA 4DU3A 1ZQKA 4KLFA 2XC9A 2VG5A 4CEBA 3NH1A 4PHAA 1UOCA 4JLHA 3S3OA 4I2EA 8ICNA 5KFCA 3C21A 1RT1A 3MXIA 3EY1A 3PW0A 1RBUA 4N41A 4MF8A 5J0YA 3CM6A 1WSFA 4IFYA 4K8ZA 3RBDA 7ICTA 1RILA 3RH6A 5J0XA 4ECQA 2BR0A 4FO6A 1IH7A 4DTOA 4ZH4A 1D8YA 3UIQA 3K5OA 2J6SA 4F2RA 3AVGA 1SKRA 2AGOA 1UT8A 3WNFA 1XSLA 1ZBLA 3K2PA 4RW4A 5C24A 3K59A 3O3GA 2AQ0A 4E7HA 2E6LA 3VN5A 4IR9A 2V4QA 2ZTEA 4ED3A 2IS3A 4FS1A 1FKPA 1V9PA 1NK0A 1BPXA 3SQ0A 5KFDA 1NK7A 3KLGA 5E41A 2FMPA 4IQWA 2ZD1A 4YMOA 4DTPA 2Z1JA 2V9WA 5HBMA 2OPQA 4B9MA 4Y1DA 4DL6A 4M6WA 4YP3A 3M8SA 4DOCA 4YXJA 3NF6A 1B9FA 1U9LA 3ZDEA 1SUQA 2FPKA 1TV6A 1HMVA 1Q9YA 4UBCA 4H8KA 3FDSA 4KFBA 1NKCA 4CFBA 4KHQA 9ICXA 5FROA 4IBNA 2WTFA 4NM2A 4IFVA 4CJ4A 3OJUA 1LV5A 4JV1A 3L3UA 3QNOA 4G1QA 3RJFA 4YG2A 3L2VA 1RT4A 2P51A 5J2BA 3VQAA 3OYLA 4CERA 4QZCA 4CJWA 5DK5A 1RT3A 3KLHA 1RBSA 2F96A 3GILA 3V9XA 3AO3A 1ZYQA 3VQEA 4DFKA 4R8UB 2HHXA 3OGUA 4NCBA 3VQ8A 3G6VA 1PZNA 3C2LA 3UQ2A 4NCAA 1RTHA 4FLTA 2EHGA 3ZT4A 4GXJA 8ICYA 4DSEA 3RMBA 1BPEA 4KLSA 3TFRA 7ICEA 4FCYA 1LAVA 4O55A 3QZ7A 3HX0A 3VQCA 1B9DA 2E6MA 4W5OA 4DF8A 4LD0A 5HRRA 4KB1A 4PGXA 4B8AB 3TWHA 2BCVA 5C25A 3QERA 4QAGA 5KG4A 1GOCA 5CR0A 8ICPA 9ICBA 4BDPA 2FPLA 3IM1A 5IIOA 1ZBFA 5BOMA 4FLZA 4Q8FA 5L1JA 2F1HA 1DLOA 4J9QA 8ICAA 4KN4A 1C1CA 2WOMA 4I29A 3PX4A 2VWJA 5KFRA 4RQ4A 3OSNA 2Q0ZX 9ICIA 3QEAZ 5KFSA 5D3GA 4M0AA 4BXOA 1RXWA 2YNGA 5EWFA 3MGIA 2IMWP 5DB7A 2FLPA 4O3SA 2JEIA 4UAWA 2JEJA 2KTQA 3KD1E 4UB3A 4FLXA 4YNQA 4KHSA 4CGIA 3V6DA 3OYAA 3AV9A 1S6QA 4Z6FA 4CIEA 1BPZA 4KLGA 4AILC 2G8WA 4ELTA 1QQCA 1BIZA 3OYKA 2A1JB 5KFMA 1X1PA 4NCGA 4DQRA 2RPIA 1A5VA 4XQ8A 4IRKA 1CUKA 4FXDA 5KG0A 1L3SA 3UQ0A 3A2FA 2O4GA 1T3NA 3RH5A 3RJKA 4CJRA 1VSDA 4P4MA 3PO5A 4ID1A 2Z1GA 1TFRA 1ZQMA 1FXXA 4FJHA 2X6SA 1RZTA 3T5LA 4HCCA 5KGXA 3RMCA 2OPRA 3DOKA 2M9NA 4IKFA 3HP6A 4AH9A 1A76A 2PZSA 3ALYA 3TQ1A 5J0PA 4I2AA 3SV3A 5IILA 4AHRA 5F9LA 3GV5B 5DQHA 1U48A 4RUAA 4J9SA 2BGGA 1B43A 4W5RA 1IG9A 8ICBA 2IGIA 3L2UA 4IG0A 3SNNA 3KHGA 4RZRA 3CFPA 4YXMA 4YD1A 1NK9A 3OVNA 3OJSA 2FLLA 4Q8EA 4F4WA 4K4IA 1T05A 4HUFA 1IKWA 4EBCA 1ZQCA 3BQTA 4EBDA 1VSFA 1I39A 5D46A 3G0ZA 4JWNA 2HB5A 1JXLA 4EP5A 4P2HA 1TL1A 8ICOA 3ZSQA 2FBXA 1J53A 2F1IA 4RQ2A 9ICHA 2BQRA 4F91B 3PY8A 4KLLA 4HCBA 3V6JA 9ICMA 1HNIA 2YNIA 2BQUA 2LYHA 2ASDA 2B6AA 4UB5A 4DL4A 1ZBUA 3QLHA 4UB2A 4ECRA 3BQ0A 1IXRA 1WSHA 2XO7A 3NFAA 4CF1A 1KFTA 2DY4A 4E1MA 3OY9A 1QS4A 1WSJA 2B5JA 4ELVA 2HHWA 2JGUA 1N56A 4MEXA 4CFDA 4CJ5A 4KLQA 4F3TA 3ZD8A 4LVSA 3H4DA 3ULDA 1S1WA 3OS0A 3TFSA 1GOBA 3RB6A 2IOCA 4QZ9A 2LSNA 3I0RA 1K1SA 4QW9A 3ZDCA 3ZT3A 1N6QA 2XGQA 4M9HA 1QSLA 3ZT1A 1NK4A 4RNMA 8ICRA 1NK6A 4PA1A 7ICVA 3O4QA 4I2PA 1JXEA 4DTXA 2R8GA 4OPJA 4O3NA 4DSFA 1ZQBA 2MUTA 3RJIA 5DBBA 1RDBA 4K8XA 3DYAA 3AO1A 3RRGA 3BQ1A 3OS1A 3I8DA 4KO0A 4I2FA 1HQUA 5J2EA 2DFEA 4CHNA 1NJYA 2KFNA 1VK0A 2JZBA 3Q8MA 3KHHA 5DB9A 2JEFA 3GIIA 4FJGA 4RG8A 4F4ZA 3AVNA 1RNHA 3K57A 3OYHA 5BOLA 5HMLA 4DQSA 3C5FA 4O5EA 4B8CA 2G8HA 3V9UA 9ICFA 4Q44A 4QWDA 2I9GA 2OZMA 3PUFA 4R8UA 3LK9A 3ZT0A 4CEAA 1HJPA 4HVJA 3H4BA 4HHTA 2I1QA 5L9XA 4DLEA 3N4MB 4KB0A 2BPCA 5KG7A 5J2PA 2X6NA 3ZCMA 4CGGA 1XS9D 9ICUA 2BPGA 3ZSOA 4H4MA 3RJGA 2VA8A 4CJEA 1ZQYA 4B9TA 4CEDA 4BXOB 3DLGA 7ICGA 1MQ3A 4JV2A 2BCUA 3RB0A 1N48A 1CZBA 4E1NA 3SPZA 5KFIA 2ITGA 3Q8QB 2Q3SA 3HT3A 2RF2A 1EXQA 5DQGA 4FBTA 3ZT2A 9ICNA 1BI4A 1HNVA 7ICOA 4FM0A 3VQDA 5HP4A 3LANA 3AU2A 4ZTFA 3PR4A 7ICIA 5KG6A 1S9FA 2ZJAA 3SPYA 4EYIB 4M41A 1VSIA 2IA6A 1ZQQA 1TKXA 4ZTJA 4JUZA 3THVA 5DGBA 9ICEA 2ETJA 4KLUA 3V1OA 2BHNA 3RJEA 2PI4A 2HHSA 3K58A 3I0SA 2P5GA 3B0YA 2ZUDA 4QZEA 4DOBA 1XU4A 3GIMA 5KFOA 1WCLA 1REVA 2IAJA 3IAYA 1ZQRA 4J9OA 2ALZA 1ZBIA 4EEYA 3DLRA 1JN3A 3OYDA 9ICAA 4GC6A 4PUOA 1TK5A 3DM2A 2G8UA 5CWRA 4FLUA 1W9HA 4O0JA 1TGOA 1LW0A 4C8NA 5FRMA 3RH4A 4C8KA 4LSNA 4IG3A 4J9KA 4DSJA 4EBEA 3MDCA 4Z6CA 4J2BA 2YKNA 5J29A 3UXPA 4M9GA 3OYBA 4DQIA 3JPOA 2Z1HA 4LH4A 1J54A 4DTMA 4DOAA 5HNKA 1ZETA 2BCSA 1LWFA 1ASVA 5J2AA 4KHNA 1ZQNA 3WNGA 4CJKA 4TUPA 5KTQA 4TURA 1AROP 3BQ2A 4K4GA 1Z3EB 5J0WA 1TV9A 3GIJA 4B08A 2KQ2A 4FK4A 4DTJA 4J9NA 3TAPA 1WN7A 1WCNA 3KLEA 2C22A 4Q0BA 3EZ5A 7ICHA 5CA7A 5DLGA 2UVUA 4QZGA 4DL3A 3D45A 3PW2A 1SL2A 3MR2A 1WSGA 1QE1A 1VSMA 1VSHA 3PR5B 2VA2A 2RN2A 4ID5A 1UT5A 2A1JA 3NF7A 2FLNA 1H38A 1ZJMA 3QINA 2XY5A 2OPSA 5KFJA 3C1YA 3MXJA 2C2RA 3MABA 4O3RA 3H08A 3Q8PB 4X5VA 4DSLA 4JS5A 4M9LA 2AJQA 1LAWA 4OGCA 5KFHA 4QZFA 1WSIA 3RJHA 4LY7A 3V9ZA 4E7JA 3SYZA 4N56A 3UXOA 4I2GA 1SKSA 8ICLA 1F21A 2XCAA 4IQVA 3K5MA 3VQ4A 3EPIA 1RCHA 8ICGA 2NRZA 4FJ5A 3TAFA 4KITB 4NXZA 1X9SA 2ZJ5A 2IC3A 1TK8A 3UXNA 4RQ0A 4M3ZA 4B9VA 4RW8A 5JUMA 4FM2A 5CHGA 3LAMA 5J1EA 3U3YA 3TARA 5J2KA 4CHPA 5KT6A 2XY7A 4PWDA 1BL3A 4PHDA 4BDYA 4HTUA 1KRPA 3TAEA 1L3VA 5KT2A 4P4OA 3B6PA 1COOA 5IIIA 1BPBA 4O3PA 1S9GA 4BGDA 5J0OA 2ZUCA 3PW7A 4F5NA 2UVRA 3SUPA 4BDZA 1FK9A 3AVAA 4L8RB 3LALA 4OGEA 5IINA 1DOQA 1K1QA 4Q43A 1JLAA 4FW2A 3TR8A 1C1BA 4I2BA 3NAEA 4KLMA 2HVIA 3HYFA 5J0TA 3JPTA 2DPJA 2P1JA 4FJ7A 1KLMA 3EYZA 4M45A 3AVJA 3QEBZ 3RMDA 3AO4A 2QXFA 4YFKA 1K6YA 5KG1A 1RT6A 1S0OA 3AA5X 4DG1A 4W5NA 1C6VA 2NRTA 4GMJB 3TAGA 3QZ8A 4NYNA 4OVLA 4ED1A 4JWMA 3HO1A 3K75D 3V7KA 4ED6A 4FZXC 5FRNA 4J2EA 3OYEA 1B22A 3IG1A 3AVIA 1BI4B 3JYTA 3SQ4A 4I2CA 3Q8LA 3L8BA 5CB1A 1ZQSA 7ICLA 2DTUA 3SJJA 2ASLA 1HUZA 3GIKA 1B92A 1C0TA 3PVXA 2YV0X 4F5OA 3MR3A 8ICXA 1DTTA 3CYMA 5F9NA 3KHRA 4CF9A 1EX4A 4LZGA 4OKKA 3NDKA 3LAKA 4YN4A 1S5JA 4CESA 2MUTB 2JZBB 2R8HA 1NJWA 3RR8A 3VQQA 4UB1A 2YHAA 4RPXA 3CM5A 3WNHA 4E3SA 5J2FA 2Y1IA 5KFZA 1YTUA 4DTNA 1ASUA 4ECVA 2HHTA 5KGWA 3VQ6A 3DOLA 3KJVA 2BKEA 3TANA 4RQ6A 3DI6A 3V6HA 4I27A 4MFAA 1NK5A 2HHQA 1VSJA 3L2WA 2DFLA 4UQGA 1TAQA 4PHEA 4FBUA 2W9AA 5IIJA 2KN7A 4DFPA 4FJXA 2IHMA 3VQ7A 4CEQA 1XWLA 4GXKA 3PMLA 2D5RA 4O44A 1ASWA 5CZ1A 4TUSA 1IO2A 1ZJNA 4DL2A 3MEGA 5L1LA 8ICKA 3DLEA 3LWLA 1KCFA 3CFOA 3LP0A 3M8QA 4TQSA 1RT2A 2F1JA 3MR6A 1ZQUA 3DRPA 4R64A 3V9WA 4FJIA 4CCHA 4M2YA 1NKEA 2D0BA 4J9RA 4ED8A 3SUNA 4ICLA 4JV0A 1Z26A 1UWBA 1FKOA 4M9NA 4NLKA 5DLFA 2FBTA 1VSLA 4RUCA 4KHWA 4CIFA 1UA1A 5KRSA 1C0MA 1KDHA 4CJPA 4KHYA 9ICTA 4FJ9A 2W9BB 4Z4HA 1HJRA 2HNDA 5JS1A 4O5CA 3P1GA 1TAUA 1SZPA 1TKTA 4CHZA 4ECWA 4CK2A 3ZSVA 1Z00A 2BE2A 1S97A 5KRTA 4OLBA 2IBKA 3HVTA 5KG3A 3HVRA 4JRPA 1HPZA 3DLKA 2HHUA 1MU2A 2HVHA 2KW4A 3K5NA 1J5OA 3ISCA 4KRFA 1KSPA 2R7YA 1HYZA 9ICCA 1LW2A 3IS9A 3KKRA 3EPGA 3C2MA 5J2GA 3S3MA 1S9EA 4C8LA 1IKVA 3H40A 1S1UA 1IM4A 1SKWA 7ICMA 4F4YA 4NM1A 4O3OA 5DBCA 4AHVA 5KFLA 4HYKA 4IRDA 4KLIA 1A5XA 1S1VA 3MBYA 4QZIA 5CY4A 4QWCA 3JSMA 9ICJA 4FJJA 2R8IA 1T03A 5CP2A 3D0PA 3V72A 3Q8SB 4B9LA 1KLNA 4J9PA 5HHHA 3ITHA 8ICUA 1ZQHA 1D8LA 4ECUA 7ICSA 5J2MA 4KLEA 3OYGA 1RT7A 4PY5A 5HMMA 3V81A 3ZDDA 2QK9A 1ZQIA 4MF2A 4CE9A 4F3OA 2W9CB 5J2QA 2ZJ8A 4UB4A 3G6YA 4RQ1A 4BE1A 3ETLA 1JLQA 1ZQTA 4AHUA 4M3XA 4E19A 1U04A 1ITGA 4JRQA 1O1WA 4CJQA 1CZ9A 1RBTA 3TI0A 5KFEA 5CYMA 4J9LA 4I2DA 1Q9XA 4B9SA 3AVFA 3C95A 3GV8B 4B9UA 4CJUA 4ELUA 1JKHA 1RYSA 1NOZA 4G3IA 4KI4A 3RR7A 1U47A 3DRRA 4CGJA 4M6WB 4Z6EA 4DU1A 3E01A 3RMAA 1JL1A 3UPQA 4OKJA 3ZSZA 3EWAA 4DFJA 2NRVA 3AVCA 3M9NB 3TABA 3SQ1A 9ICPA 1ZQWA 1Y97A 2RKIA 1XSNA 5EOZA 4YCXA 3TAMA 4KTZA 4ED7A 1ZQVA 5J2HA 1TK0A 3HP9A 2B4JA 3QIOA 1U4BA 3TAQA 4F50A 5I42A 1QLNA 2KZ3A 2YNFA 1RDCA 5EWGA 3JPQA 4DL7A 4DSKA 4KHUA 2VG6A 3NE6A 4F5PA 2ISPA 1EXNA 2KFZA 1EP4A 1G15A 4CEZA 3QE9Y 3V1RA 4RW6A 1A77A 4E7IA 1JX4A 3V6KA 5T7BA 3CQ8A 3DLBA 5CZ2A 5KT7A 1Z00B 3NCIA 5L1KA 4CFAA 1ZQAA 7ICNA 4DTRA 4EP4A
chains in the Genus database with same CATH superfamily
3BDEA 1JLCA 4DSIA 7ICUA 2UZAA 3PJ9A 3M1VB 1HQEB 3C23A 3ZD9A 2VIXA 3T7ZA 3I5AA 5IQ6A 4UASA 4OYPA 3HW8A 4R5PA 4IO9Q 1IBLF 2EAMA 1GLJO 2ZJRQ 2P5OA 2OA8A 3M8YA 3NLCA 1Q8BA 3NAHA 1NNEA 3KD5E 4QIWD 2F40A 2MU2A 2PFNA 4LF7F 3ZTRA 4OKEA 3OPKA 4JI3F 4CE6A 1FKAF 5LT5A 4GVMA 2XSJB 2YI1A 2AEMA 1J9AA 3ZI4A 4A46A 2J9EA 3CCVS 4NI2B 3O08A 1CQNA 3TWZA 3JPNA 2MSSA 7ICJA 1HNWJ 3I31A 2BOPA 1RWXB 4U7UD 4AHCA 2C28A 3WXMB 1RAFB 2W2PP 3MX5A 1U49A 4ZVEA 2K4IA 1XTZA 3R7SB 3OYIA 2LMIA 1RCOB 4ZIWA 1O08A 2E66A 3EVOA 4JB8B 4TYBA 4JEPA 4YR2A 3HSGA 3L7UA 4KIAA 3CHWA 2F76X 2KRBA 2VICA 1U8WA 3WHIA 5ETNA 1U6ZA 1RAIB 3J81j 4FPIA 4O0IA 2E44A 3ISDA 2CGJA 4M47A 2I6XA 3FR0A 2HFOA 1QM9A 3IG8A 2P66A 2U1AA 2ATCB 1T9YA 4RQ8A 1VC6A 2QA4G 3QSIA 1RBLA 3Q8RB 4NA1A 2BABA 3WKEA 1TVRA 2MRLA 4Q45A 1VFJA 5DS7A 5T14A 3A5MC 3MDQA 2ZIUB 3VF0B 1EAYC 4DR5F 3PX0A 1GTHA 4P52A 3MEDA 1J97A 2Z30B 2OZSA 4EGLA 1HPZB 2G8KA 2Q4TA 1IUJA 2GWSA 5DMRA 1F9EB 4CIGA 2A42A 1ZTTA 2JWLA 4YOYA 4K0KJ 2D3DA 4CT9A 1NJXA 2QI2A 4UARA 4AHSA 4H4OA 1H2VZ 2UU9J 1KQQA 3AA2A 2BPFA 4DUYK 4OPAA 4Y1CA 1NWKA 4FO0A 4KPYA 1ZQPA 3LP0B 3QU9A 4F92B 2N3LA 3ITHB 4K2XA 2NRWA 1KVCA 4DV4F 4DPXA 5F8MA 4L3KA 2HVEA 3JPRA 1V6HA 1SL1A 2CZ9A 5KFPA 1S1VB 4X4TA 5BRHA 3PTWA 1PK1A 8ICSA 1G7CB 3IHQB 3QEIA 4EZ6A 3LWMA 3BGFA 1RT2B 1UEVA 1JNZB 5KFXA 3SI6A 5AM5A 1VQ9S 3KIOA 2JLFA 4ZPDA 4G1IA 1L8LA 2HMPA 1Q4RA 2LPEA 1ZQZA 4LQ9A 1KVAA 2CXYA 1YG0A 2KICA 2ZE2A 4FK0A 4DQPA 2ZJPL 2ASPA 2B0CA 5K4LA 3SQ2A 1WLJA 3EW9A 2FHMA 2G2YA 3LGHA 1RI7A 3BJYA 1MWMA 4GVBB 3H3NO 2DITA 2OMOA 2GOLA 1CC8A 4DQQA 4ZN3A 1N5XA 2A3VA 2QLFB 1MU2B 2I2YA 2VPXB 2WONA 2QSFA 4BX9C 4X4QA 4RT3A 3MM9A 1L3UA 2ES6A 2Q79A 2LFVA 3R3TA 3SSSA 4MYUA 2G0JA 5D0RA 3OTOF 1SL0A 1PKUA 4XA5A 1T44A 3MECA 3MM7B 1K8KB 2Z0GA 2OPRB 2NXEA 3I87A 1LXNA 4RO0A 4CVNE 2DPIA 3QPIA 2F9WA 2DNQA 4UY85 4I68A 4DZDA 2DGVA 2B21A 4JV5F 2D0CA 5D4NA 4N5SA 3EGWB 1TVAA 3CULA 3SDEA 1UVKA 2YNHA 3QFHA 4NLVA 1RHJB 1GOAA 5SWMA 5FJ4A 4I6MB 1GQEA 3MFIA 5CR4A 1GH8A 5AQMA 2EFPA 2JFKA 4IH5A 5DKWA 4ES1A 1Y3JA 3M2RA 3SMSA 3SLCA 2KXHA 3N79A 1OY9A 4Z4CA 4Y2XA 3IMQJ 4JYAJ 5D78A 3DDNA 3RAMA 5HRPA 2KZMA 3FCVA 3P83D 4CEFA 3AXMA 4QR1A 1WNEA 5DG9A 2H54B 3G8SA 3MM8A 3G10A 3A13A 3H1QA 2OXOA 2IDOA 3LOUA 4A8OA 4OJPA 2K2PA 2MHEA 1JKHB 5DG8A 4K5RA 4JKEA 4Z4EA 5G4DA 3HBTA 4BACA 1KVBA 5C2FA 2GBZA 4YR3A 4KHPF 3V7JA 3FBFA 3SFUA 2KKVA 2NXUA 3B9JA 3I56S 2VG7A 2GWJA 2GVDA 5AQKA 3KTQA 1YHQS 3T1AA 5GAHP 1Q95G 2RKIB 2W8KA 4DO9A 1E6YB 3NKYA 1KFSA 1VQMN 3KUGA 1O03A 1ED1A 2HK3A 1Y88A 1N33F 4RQMA 4IS7A 1OQ3A 1CULB 2E20A 5F3ZA 5A8KB 1P7DA 3MEEA 4QZHA 4KGMA 4X4PA 2KJVA 2BJ1A 5C24B 4RW7A 2RMLA 2IHR1 2F7VA 4OYAA 4EELA 3CCSS 3F2BA 4AM6A 2XQCA 2PEBA 3NUQA 2GAHC 4UQTA 2AJ0A 5ETTA 1WEYA 3BREA 3SIPB 2QTWA 2V94A 4B3MK 2KD1A 3HPGA 1KEJA 1ACMB 3BGUA 4MFBA 3GTYX 5HK4A 2M2BA 2ZIWA 3C6HA 2FTRA 5EVZA 1ZQOA 4W5QA 4C0HA 4BRKA 3NH2A 5BYQA 3W9IA 3QEVA 4XRHA 2V4RA 2BCRA 4US9A 2O5DA 1KQSR 3UR3C 2WAQD 8RUCA 2DNPA 4RQ3A 2E1AA 3SQOP 5IIKA 1RYRA 3T1HF 2IRXA 1M6YA 3RSEA 1SUQB 4LZDA 4PYAA 2DFFA 4AXJA 4C4RA 4ZVUB 4Y28C 4A8KA 5BR9A 2EVZA 1BE4A 4N77A 4IR1A 4QIVA 1PK1B 1MWKA 5DDOC 2DKXA 3OQ2A 2KMDA 4IFVB 2ASYA 1UFWA 3GZ7A 5LMNF 2P9IB 5L1IA 4FKYA 2XG8A 1JL2A 4DCHA 3K0JA 5J8YC 2HHHF 4CZLA 2ISOA 4K4ZA 2NRXA 1NZ8A 3CIPA 1QSSA 8ICWA 2B7CB 2UV8G 3T9ZA 3I33A 4CJ3A 1GFWB 2QO3A 2XVTA 2IOFA 5LMUJ 1WC6A 2WOMB 3CJ0A 3WQPA 2HZAA 2R2TA 4QZ8A 4B9QA 4CGDA 3CXCM 4Q5VA 3CDUA 4CFCA 1D9FA 4AHTA 1HKGA 3WKCA 2E2NA 1YVFA 2BKOA 3SZ2A 2GJ2A 2VJ4A 2JLEA 2A1RA 7ICFA 2WONB 3RW7A 3WXKA 2V51B 5AJ3F 3M8ZA 4CF4A 4QZDA 5JJBA 4BC7A 3M6UA 3F5AA 3BGRA 4UAYA 2Q1NA 2XZTB 1HX1A 1BQMA 1FTCA 3MPWA 1BCMA 4MKBA 4Z7YA 1X4HA 3AD7C 3A8JA 2OTJN 2QE5A 4DF4A 1AW0A 2VANA 3CW2C 1NLVA 2YKAA 1FEHA 4OYIA 5KT5A 3ICLA 4Z0UA 3AUOA 3W7BA 1ZM2A 4ECYA 3M9MB 3RRHA 4OZ2A 4FLWA 2G8VA 3CSKA 4G1QB 4DR6J 3AVHA 4KBIA 2P9SB 3EZUA 1XMOK 4ZLJA 5IIMA 5I3PA 2G8FA 3W2VB 3Q2TC 2F8EX 2KE7A 2VGMA 3D0GE 3S3NA 3RWUA 2PN6A 2PI5A 4GY2B 3DI6B 4KE5A 1J5EF 3OL8A 2AT1B 4XK8C 1JLEB 1WC3A 2XMAA 1W2IA 2PDAA 1RT6B 3SV4A 1N61A 2OUGA 3KJVB 2BCQA 4Y34A 2L9DA 4PEOA 3KZXA 3L4IA 4DV1F 3NGKA 3WBZA 3V7LA 5ALNA 5TZVA 4O3MA 3F73A 3BS5B 5CJ7A 4KKOB 2FJWA 3PACA 4ZPAA 1NGDA 4ERDA 4JK8A 2K8BB 1KKHA 5EWEA 5KT4A 1JQGA 4AQYJ 4NA2A 3EL2A 1VQ4N 4WTOB 1RXVA 2BANA 1KQGB 9ICOA 4P74A 4KAZA 2D6FC 2ZFHA 8ICMA 3G25A 3AA3A 3QU7A 2IPOB 2FC9A 5KFYA 4KGZB 3MGVA 2HNYA 4MHVA 1ZQLA 4I9LA 5EHHA 1C0TB 1C7YA 3M8RA 1R31A 1TKZA 3KLIA 2XY6A 3GONA 2EX3A 1SI9A 1X5PA 2MJUA 4CGFA 3HVAA 4RW7B 3UWTA 2DCLA 1U24A 5BPCA 2DBBA 3KKAC 4NLNA 2KJ9A 1JB0C 1BPYA 3H8JA 4H03B 3I32A 4LF6F 4MKVA 1SS6A 4Y2MA 1K0TA 3VEOA 2BGWA 1WWUA 2IHNA 3E01B 4DUZK 5ETLA 2R2SA 5DM7Q 2W54A 3BR8A 4DL5A 1KQKA 1BCOA 3NH0A 1M1GA 3ET6A 3SEIA 1BG3A 2PA3A 2K3IA 3TVYA 3OL9A 2M52A 4LFCK 1CXUA 1HNWF 2UUCJ 1UETA 2ZTCA 2ZH1A 4H5NA 8ICEA 3AVKA 1SWWA 3GR1A 1YLXA 3K7RA 3M6VA 4MH8A 1W2BR 2WZ1A 4OI1A 2GEMA 4UOHA 1NOYA 4JKCA 3RBXA 3N97B 2V69A 2ZC4A 3CJ2A 2E5GA 3SK3A 4QZAA 5AKYA 2CIMA 4FLVA 2Q0UA 1BGXT 1RU1A 1N5YB 1JCFA 2B3TB 2VG5A 4OHWA 1IBLJ 4CEBA 3MTKA 2WSEC 4CLUA 2FC8A 5KFCA 4K41A 2CQHA 1VQKS 2H3GX 3CC7N 2O8CB 5A0LA 4N41A 4PXCA 1KONA 2ZZTA 1WSFA 3IFRA 3CIZA 4W4MA 2BR0A 1IH7A 4DTOA 4KGXB 4ZH4A 4LF5K 3UIQA 4DKWA 3ZEUB 2ZH5A 1UT8A 2NQPA 1XSLA 6FDRA 1E4GT 3HKZF 4EUVA 1D0EA 5HVGA 1RG6A 4PKGA 3J8AA 1S72N 3K2PA 3L7OA 3AQOA 2QB0B 4NX9A 4RLEA 4G9ZA 2XZDB 4BS2A 1HD1A 2W2OP 2E6LA 5G5GA 4BR9A 5THWA 5C42B 4ETXA 3UO0A 1F44A 1TP7A 2FMPA 3VV2B 2WW4A 2V9WA 2V52B 4KYZA 5HROB 2OPQA 4DL6A 4M6WA 5B5EU 2BXJA 3OD2A 4DOCA 3KJFB 3ENQA 4YXJA 2JFDA 3L09A 3VQSA 3NF6A 3K17A 4W98A 1U9LA 1PIEA 2FZCB 2G4BA 3ISZA 1PVPA 2N3OA 2KXFA 1Y7PA 1HMVA 2CRLA 3TEGA 2IDLA 1V3SA 2QA4S 2D7SA 2HVDA 2Y0SD 4ED4A 4PWUA 3MPYA 2WTFA 3UR0A 5C12A 4NM2A 1CJTB 4PABA 4JV1A 2ZF5O 2KKZA 5J2BA 1RBOB 3VQAA 2OELA 1RHMB 1S22A 2O8BA 4HLBA 2XMUA 5DK5A 5JVHL 2RHFA 3U26A 4CW7B 4CRXA 3GILA 3PJWA 1CS4A 1V9OA 1TU0B 4NCBA 3MMAA 2ZWHA 4OHVA 1PZNA 4ZJLA 2LEBA 5JTIA 1N54B 3UQ2A 4NCAA 4FLTA 1CC7A 3A0BU 2QSWA 5K20B 4GXJA 3RMBA 4KLSA 3TFRA 1MW7A 7ICEA 4DV3J 4F3MA 2NYIA 3O9SA 4O55A 4FCYA 2DNGA 3AAQA 4A8MP 3HX0A 3VQCA 4LD0A 5HRRA 3AAWB 4PGXA 4B8AB 4ZIVA 3TWHA 1FRJA 2W2MP 5DJBA 1IR2A 1VLOA 8ICPA 1F9HA 4FLZA 2E2OA 2DVIA 5HQLA 2JVRA 4J9QA 4I29A 4FXVA 3PX4A 4IFYB 3M30A 2UXDJ 5FPEA 3VEZA 3P31A 3A5LC 3QEAZ 3FBBA 4KX3A 4M0AA 1HNVB 3T1YJ 1U2CA 2VHGA 3JTNA 2DBYA 2JEIA 2HQIA 4QR0A 1N0UA 3UNGC 3UMCA 1KW4A 3MURP 1QQ7A 3FZMA 1PGZA 4YNQA 4KHSA 2YMLA 2E8MA 3V6DA 5C2DA 1S6QA 4Z6FA 4B3MJ 4CIEA 4KGVB 3FC9A 1G3OA 3GOIA 1VQ8N 3JQMA 1BQMB 1HNZF 1QQCA 2JSXA 4BRCA 1T9WA 3P3DA 3ONNA 2DR9A 4RPFA 3A8IA 4PYDA 3QQCD 4DQRA 4DN0A 5LSOA 1N34K 3AB2B 2GH1A 4XQ8A 4IRKA 4IXCA 4DBQA 1XMQJ 5KG0A 1L3SA 3D54A 4F36A 2KHCA 3LP1B 2RB7A 2ZIXB 3W65A 2GQQA 5E3CA 4P4MA 3DHXA 2Z57B 3ZTQA 3EXYA 4B3SF 2MEWA 3HVWA 2ZBIA 2KKPA 3D2QA 4IKFA 4AH9A 4AL7A 5J0PA 4BG9A 4RR5A 5IILA 4AHRA 5J2PB 4M5HA 1ZA2B 1U48A 3UDEA 1XJWB 4JI6K 2R7VA 5ETOA 1IG9A 8ICBA 3EE3A 3EKUA 1I5OB 3TEHB 3KHGA 1M1HA 5B66U 4HTJA 2QYCA 3OTBA 3NWGA 2JDJA 2LQJA 5AI8A 3R1HA 3OVNA 3OJSA 1D1UA 3UD4P 4K4IA 4BJQA 4EBCA 1U0HA 2JV3A 1X5OA 2KT5A 3IA0A 2DYAA 3L5KA 3CGIA 3NNCA 1VIXA 4WFBQ 1TL1A 3ZSQA 5AQWA 3W9HA 4LFBK 4RQ2A 3QIDA 3PY8A 5AQVA 1HWKA 9ICMA 4WP8A 1Y0HA 3CJ8A 1KN6A 1QD1A 3JAMY 4OZ0A 1TR0A 3N28A 1IXRA 4B3SJ 4OJLA 1NPRA 3D1OA 4IOCL 2XO7A 4DV0K 3H5XA 4CF1A 3L4QA 3OY9A 1QE1B 2R42A 2JGUA 2UXBJ 1F5AA 3BS7A 4CJ5A 1WHWA 3ZC4A 2FSJA 2W4CA 3VZHA 3ZD8A 2ZOMA 5D3GB 1ATRA 4DJBA 2ZE2B 1GOBA 4LRBA 3I0RA 2PGCA 3Q7CA 1UFKA 5F41A 2F4FA 3TADC 3C15B 4M9HA 3M8WA 3CWJA 2CQ2A 1QSLA 2ZWPA 5HBMB 4TYAA 2YB1A 3V6DB 3CRXA 2BE7D 4LRFA 3O4QA 3O80A 4PKIA 5B09A 2CN1A 3JYTB 2K1RB 4DTXA 1UW4A 3MM7A 3VEXA 3ZZUA 1DKGD 2AD9A 4OZJA 5DBBA 4MK7A 4P2SA 3DYAA 5E84A 4OX7A 3LDLA 1Y5IB 4A61A 3MM9B 1RDFA 4I2FA 4LRAA 1Q53A 2XLIA 2QLJB 2WVFA 3O8WA 1U09A 3AA9A 4CHNA 1XK8A 3EE8A 3S7RA 2KM8C 4CP5A 2JZBA 3Q8MA 2I8EA 3KHHA 4Z94A 4F4ZA 4DDFA 1RNHA 4OJ3A 3NVMA 3K57A 5HMLA 1U8SA 5DETA 2G8HA 2D1KA 2XSJA 1EETB 3QO9B 3V9UA 2XIDA 2I9GA 2OZMA 3C8YA 5IWAK 5F0XA 1HJPA 2DNZA 4HT5A 1IQZA 2E5HA 5L9XA 5ETVA 2BPCA 4EU0A 5J2PA 2LCWA 5JVGL 9ICUA 1WHXA 3TJAA 3CC4S 2BPGA 4UOCA 3AGKA 3RJGA 1XNRK 2VA8A 4CJEA 3CQYA 1D09B 2VQEJ 1UVLA 4N7TA 4C8YA 4B9TA 4CEDA 1RQLA 1IBKF 2A18A 2QFIA 4CO2A 4JV2A 5ELZA 2DR5A 1WF1A 3RB0A 1N48A 1G99A 4O4GB 5KFIA 1X4GA 1IBMJ 2HGNA 3HHDA 2ITGA 2G1DA 4WQ5A 4NPOA 3PNIA 5FPDA 1WF0A 1YJRA 1FO1A 2IM3A 3AB4B 5L1MA 1LFWA 3IWNC 1KOOA 2KNJA 1ZTWA 5HP4A 4QOTA 3FQLA 3TUPA 5AT1B 3PR4A 4WF9Q 3FLCO 1YSJA 1VSIA 2UUCK 3ZZPA 5ITHA 2ETJA 2YMPA 4ZJQA 4JB3A 3L3CA 3K58A 2Z2YB 2DIUA 4QZEA 2XHCA 2QA4N 3AOCA 3G9CA 3I4HX 4XPEA 1A9NB 3D1HA 2QWNA 2XNQA 4C7ZA 5KFOA 2YKOA 4ZVGA 3HDSA 2OMLA 4MFBB 3UVJB 4J9OA 3CCEN 3DLRA 3SCJE 1HWLA 3M6KA 3KFUF 5EE3A 4ZPTR 4NXMF 2OO4A 1IBLK 3OYDA 1HBNB 1X4AA 4MMOA 1X5TA 2XI2A 1ZOTA 5I4MA 1TGOA 1RAAB 3CJRA 4ZPVR 1NSAA 5IZHA 3F44A 4J9KA 1HNWK 3MDCA 4Z6CA 3OFHA 4J2BA 4DPWA 3UXPA 4M9GA 2C2ZB 1VQ6S 4AQYF 1RQNA 2M4MA 4FZMA 2HWHA 2KVSA 4DOAA 2DHHA 3DLEB 1KTVA 1U2FA 2ZNZA 4KHNA 2A19A 3GSIA 4PZNA 1HBMA 3UW1A 1RYUA 4IEIA 3QU5A 2F5GA 2IVMA 3ZNUA 1I94F 4K4GA 3P5BP 1ZPVA 1TV9A 1MMDA 4OQJA 5JMNA 3C19A 2IJFA 1Q5VA 3TAPA 5CABA 3VGKA 5A8KA 4WFZA 1NI3A 7ICHA 3RRKA 5CA7A 2M0NA 4MIAA 4OYOA 4WFBL 2UUCF 1SPBP 5B08A 4GKJK 1HNIB 1NDCA 2OFHX 2VL1A 1WSGA 1VSHA 2VA2A 4ID5A 3I55S 2B6AB 1Z4UA 4I67A 2A1JA 1UVMA 2FLNA 2B7BB 3ZNJ1 2HHHJ 3WIVA 2XY5A 2OPSA 1I94J 1CJVB 3D9BA 3VESA 4CIOA 4X5VA 3LL3A 1HKCA 2FSNA 2V2KA 2N1RA 2VGNA 3DXMB 4A47A 1WSIA 4LY7A 2QWLA 3EEQA 2WF6A 1RHUB 1YJTA 1HBOA 1F21A 1N5SA 3K5MA 3EPIA 1J6ZA 2HGLA 3TUIC 2NRZA 1VJWA 4NXZA 3SDEB 2JJ4D 4M3ZA 3GYXB 1X31C 3D6HB 3DXKB 4FM2A 2P35A 5CHGA 1WKJA 3HFVA 2GO8A 4CHPA 5KT6A 1Q7YT 3GCXP 1BL3A 4U7UK 2QFJA 4YDUC 4HTUA 4QYRA 4QU7A 3HCXA 1KRPA 5IC6B 4CH0S 1J5OB 3QFPA 3HOTA 5GAGP 4NOHA 5KT2A 2HLUA 3CCES 3B6PA 1COOA 5IIIA 4PG7A 1P8ZA 1MG7A 2EDUA 4BGDA 4URQU 1P6TA 3OR2B 3G6ES 3CCSN 1TYQB 3NNAA 2Y0BB 4JI8J 2DB1A 4NB4A 1NMNA 4ANEA 4JI5F 3C6TB 3NAEA 1NM1A 4KLMA 5L8RC 2HVIA 3GLJA 1YK9A 1L8OA 5J0TA 1HWUA 4NWBA 3HYFA 4J9VA 1T03B 3GBTA 2PAVA 1DHMA 1HKBA 2G0AA 3EYZA 2AJ2A 2LQBA 4PCQA 4M45A 3QLHB 2XM3A 3QEBZ 4L75A 2QXFA 2YB4A 5FPNA 4YFKA 4LRDA 3GL1A 4DV6J 2VB6A 2APOA 4USKA 1K6YA 5AFUH 1HNZJ 1XC3A 1KXPA 3BEXA 3MM6B 4GMJB 1DT9A 4IQMA 1LOTB 3QZ8A 3MMBB 1LCUA 2ZHBA 4NYNA 2L9WA 5HMWA 1HI1A 4TN2A 1JALA 3FE1A 1QQ5A 1VHFA 2HNYB 2CQCA 3V7KA 2HYIB 2G5HB 2E1ZA 4Y2TA 1TKZB 3MCPA 3OYEA 1LQ9A 3IRXB 3PZPA 3CCMN 4ILJA 1HPMA 3SQ4A 3Q8LA 2HSZA 3SQIA 1UZHA 4K4YA 1NH8A 4C0BA 2LM1A 1L7PA 3AQEA 2DGZA 1HLWA 5AKZA 1RSCA 1XEZA 2EK6A 2E88A 4ID5B 2FXUA 2P9KA 1VGYA 2ASLA 1U7LA 2MKYA 2QB1A 2M0GB 1C0TA 3O3LA 3X3UA 1U0SA 1ZD4A 4F5OA 5AQUA 4FYWB 4IO8A 4OJOA 1CRXA 4PPDA 3D3BJ 1NJIT 1V3ZA 2RS2A 1AUDA 3EICA 1KEKA 4YN4A 4W92B 5IXUA 2H3QA 3TUZC 3Q89A 3I6PA 3ET6B 1Q46A 3GG4A 3ENWA 5H9EK 2YHAA 3U9DA 4RPXA 4JOUA 4BHQA 5J2FA 3HJEA 5KFZA 2QIFA 4DQ8A 1ASUA 5KGWA 4OYXA 2BJ8A 3DOLA 5AQZA 4K50A 4RQ6A 2CQGA 2GIFA 3V6HA 4HVZA 1NK5A 3DC2A 2YX7A 1N62A 1ZA1B 1TAQA 1REGX 2CH6A 5ALWA 2VPYB 3WT0A 5IIJA 2KN7A 3N4QA 4FJXA 1XWLA 4H4MB 4GXKA 3AODA 3QMQA 1BD6A 1ASWA 4A8EA 2AYEA 5CZ1A 3N5BA 2QEXS 2QN6B 3GFHA 3R5JB 2QTDA 2YJEA 1H1VA 1H73A 2W1BA 2HGMA 3H46O 3BSCA 3ZTPA 3M8QA 3BV8A 2G06A 4I6AA 2I0XA 2RF2B 2MKCA 5M2PA 5EE9A 4Y2YA 3MR6A 1URNA 2J9CA 4C3LA 3UE5A 3VCBA 5AQXA 2UXCF 4CCHA 1Q16B 2IM0A 4Y00A 5K8MA 2HOEA 2R7QA 4J9RA 4RUBA 2DL0A 4YB7A 3D6FB 3J7YP 4EFHA 1FKOA 4GVEA 3Q7BA 2KIWA 1WI6A 2WBRA 1VSLA 4M5JA 3EUB2 5IV3A 4CIFA 4X65K 2MMYA 4M5LA 4JKDA 1M5KC 2JXJA 3L4BC 5KOXA 2W04A 4FJ9A 1HL6A 2W4DA 2PO4A 2HWTA 4DL0C 3D2NA 1FEEA 2Z2ZA 1HEKA 5AI9A 1HFEL 4O5CA 4IEEA 1WEXA 1LKZA 5SUHA 5HVHA 3RVCA 2OYYA 3D2SA 1DK3A 1GT8A 3G96A 1TFYA 4WK3A 5AQYA 2IBKA 2I6WA 4PWDB 4WFNQ 2DK2A 2DKOB 2E1MC 1YBUA 3H0PA 4X66K 3CDAA 1RKIA 3KKRA 5J2GA 4KGKA 3FQKA 1S9EA 3QIPB 5M2RA 3EMTA 3PXGa 3CO0P 5IOLA 2D74B 2A3JA 1FRMA 4O3OA 2PE8A 4AHVA 5KFLA 2K7KA 4NXNK 1BXNA 3H0LB 3JSMA 9ICJA 2NSBA 3G82B 5CP2A 3D0PA 1Y64A 3MMAB 1DQ8A 3ILIA 3ITHA 3PSFA 3PSPA 3ZETB 3OTEA 5J2MA 4PY5A 5AKGA 4X65F 1Q81T 4NLXA 1HNXJ 1DJ0A 1LK7A 5D0EA 2ZJ8A 3G6YA 3H59A 1VLBA 4CLFA 2RUGA 1QQNA 3JQJA 3A3NB 1RBTA 3EXCX 3TI0A 1HJOA 5BPNA 4CLWA 5AICA 4U95A 7FDRA 5FLXO 3KDOA 4B9SA 3L0QA 4PL1A 3GV8B 2X51A 3VEYA 1NOZA 1N34F 4KI4A 1U47A 4M6WB 4BQZA 3O8MA 3E01A 5ALJA 4QIFA 5G0RA 3ENBA 1ZS6A 3EWAA 3PIPL 4DFJA 4WU2A 3NVVA 2O67A 3R5CA 3AD8C 3Q86A 4DV5J 4YCXA 3TAMA 3US5A 3ICXA 2CZ4A 1DURA 4FF1A 5HL7Q 1ZQVA 5J2HA 3HP9A 3ETRA 4AFFA 3DEEA 2RILA 4Y0FA 2F8MA 5I42A 1MA9B 2WSFC 1QLNA 2KZ3A 4NXNF 1S6QB 4DPUA 2W40A 3TO8A 2VG6A 3CJSA 4F5PA 2ISPA 3IBCB 1J27A 4ZCKA 2X7IA 1EP4A 4CEZA 3L95X 4WE1B 3V1RA 3DDKA 3FFIB 3FVYA 4USWA 3E9OA 2MGZA 4E7IA 4IH7A 3IM8A 5KT7A 2BE2B 3IMXA 2HF4A 1CJUA 5L1KA 4CFAA 4WBFA 4TU7A 1URRA 3FSYA 4EP4A 3CC2N 4CHOA 1N32K 2AQ4A 5CCLA 3AJDA 1U1QA 1SH0A 1VK8A 4U67Q 2NUBA 4RL1A 5BPMA 2HMIB 1VK3A 3NMRA 3BBCA 3NGUA 3IGVA 1UJ6A 1IKVB 2JR5A 5HQMA 1L3TA 2GS8A 1H98A 3L2QA 3D2EB 2HVZA 3MTJA 3ZSXA 2Z4PA 4RCHA 2CWXA 1JCEA 5KFGA 3C6UA 4QOZB 4M5NA 3NVYA 2HAFA 3TPQA 2YNGB 3R7NB 1QDUB 2QB0A 3HOSA 5E5NA 4F04B 4A8WA 3P5JA 2VG7B 2FBYA 2YWHA 4PZVA 3DOMA 1S3XA 1D4XA 4LBIA 1K73O 2F8SA 5J0QA 5M1OA 2HW3A 3KMSA 2XMMA 5KI6A 5KG2A 2QLXA 4RQ7A 1UWBB 1LOUA 5C5JA 2HQCA 3A5NC 3M7VA 2DD8S 4J91A 4RU9A 1H2UX 4B1WB 4DU7A 4CWBA 1N52B 2FMSA 4B17A 2UYTA 1KFDA 3ZDAA 3MAAA 2KRRA 2U2FA 1IBCB 3O6QA 3EUNA 4M5IA 2UUAF 1R6YA 4C11A 5AQGA 2WFBA 2KHQA 2MSTA 3VEVA 5J2DA 3CXCR 4NCGB 3BPDA 2MKSA 9ICGA 2VWBA 3IFEA 3CERA 4ER8A 2NYVA 1R59O 1Q7YO 1FA0A 4KFBB 1NDLA 1JLFA 4KTQA 2B8QA 4DV2F 5HN0A 1JJ2M 2AIRB 4CJTA 4OI3A 3BPSP 4H5TA 3BB5A 5KPTA 4WFAQ 3L6QA 4NYFA 3RU0A 4YB5A 3H5UA 1ULRA 4YVZA 3DLKB 3VAGA 2Q36A 4F3QA 1SZHA 4R66A 1NSPA 5A2QU 3LPUA 3U27A 4HTIA 4CYUA 5CE3A 4CNYA 2MYFA 1OH8A 4FJ8A 4O5BA 4F71A 3SUOA 5AK6A 4LF5J 3QNNA 4C8OA 5SZTA 2AMCB 3GFKB 3NASA 1VQ8S 4LREA 3GE1A 4A8SA 1YJNN 3FFIA 1VQ5S 3HZ6A 3UN5A 2FY1A 1Q86T 2RU3A 3CCJS 3TP2A 3M9OB 2ZEJA 1TL3A 4JS4A 4GC7A 1GNKA 4PH5A 4OL8A 3NGIA 4ZVRB 1HHSA 5KFWA 4ZP8A 3KVGA 4B1VA 1DRZA 4X4SA 1BWFO 7AT1B 5K8NA 3GQCA 4Y2IA 2P9IA 5KFBA 4PL8A 2ROEA 2J6UA 2HMIA 3KG4A 1L5UA 1NHKL 3CG7A 4B1UB 4CBXA 5CYJA 3HSCA 2YHWA 2HBKA 1EETA 1T7PA 3W1YC 4GMKA 2QLBB 4JI6F 4FM1A 5GAHU 3OBIA 3PM9A 5KFAA 3NOGA 3L2RA 5B0FA 2W9BA 1JLGB 3C6UB 1SIWB 3IWXA 2DQNB 1GXLA 1GK8A 4FXWA 2V8DA 1OY8A 4OX9F 4DCCA 4RX6A 1T11A 4DPYA 1S1TA 2F4VF 5KFQA 2MB0B 2DGXA 4I2QA 1S77D 2KT3A 2CPIA 1IG8A 4NI2A 1T8EA 3FRZA 1Z19A 1GMUA 2CPHA 2UU9K 3C16B 4E0DA 4YOUA 4X62J 1MN9A 4ETZA 3MMJA 3TX8A 4I6YA 1FJEB 4BREA 1VSEA 3P45B 4Z37A 2ATLA 1XC9A 3C5GA 4NXMK 4JI6J 3VF6A 5LY3A 1Q82O 1N33K 3FZLA 2ZH4A 1UEKA 4WFXA 5E3PA 3B4DA 3H2VE 4PQUA 3MAAB 3S6EA 2Y3YA 1GLFO 3AOAA 1HQUB 1P27B 4FVUA 8ICCA 3O9RA 1EP4B 1QQOA 4RNNA 3NGYA 1MQ2A 1NMDA 3PG9A 1U6FA 3DMJB 2NUUG 3A3OB 4QWEA 2BM0A 2XCPA 4F8RA 4RT2A 2L3MA 4KH4A 4JHDB 2ZH6A 2DPNA 4C8MA 1S1XA 1FFVA 3QU2A 3E51A 2D1CA 4KSEB 3T19A 2HFUA 3N6NA 3ONQA 4ZPBA 1HBNA 4QW8A 4IQUA 3QYPA 3T79A 3PMNA 3NGDA 1EQ0A 2O1PA 4PGYA 1CLFA 2DGUA 4C7YA 2PA8D 1RHKB 1VQMS 3V4IA 3H25A 5T7LA 2KEYA 5M1PA 4BLGA 1QVGR 8ICHA 2QKBA 3ZLJA 3PSIA 4K4HA 2HRTA 1BLUA 4GLXA 2W9CA 3G8QA 2DH9A 4MDAA 4I7FB 2BACA 2FDNA 8ICFA 2CXEA 1AYEA 2OTLN 3AARA 3FMBA 1S72S 1BHLA 3TTCA 2J6TA 3MWTA 2GVZB 4CJLA 4DU8A 2ZDPA 3EZOA 3SMZA 1WNSA 4NYZA 2KVCA 2K4PA 4HUEA 3PHEA 5ALLA 1BQXA 1N5WA 3EO3A 2D3UA 1KAYA 1H6KX 1D8BA 4KLOA 3ILOA 3KK3A 4KLDA 3MAHA 2FE9A 4YFUA 3SCLE 1E6VA 4OHZA 5AM2A 3PW5A 3VGUA 1NGIA 4P2MA 4MEYA 2ZBPA 5HRSA 1FVQA 4G9BA 2ZNYA 3DXMA 2D9PA 4YMNA 4BWJA 2HCFA 2XHBA 4X66J 2F9JA 1YITS 5FDLB 3NBPB 4DX7A 7ICPA 2E9RX 2DNHA 2CH5A 3TQEA 5C0YA 3J7AP 5MLCQ 3MK6A 1HQEA 3BGLA 4P72A 1M1KT 3DXKA 3J7YI 3MXMA 5B7WA 2Z2MA 5JLFA 4BC2A 4YN3B 1K8AT 1ZBHA 3HRDD 1RTDB 3RB4A 1ZD2P 1CLQA 2HK2A 1TUUA 3JS6A 2KP7A 1H3DA 1W0HA 1T9XA 3BSNA 3AO5A 4C3MA 1M90T 2ZOFA 1N8RT 3W2WA 4USUA 3H7IA 2QX0A 4OI0A 2LBOA 2BV3A 1VBXA 2MKKA 3DFEA 3UE2A 1IV8A 1JI7A 2X1AA 1RBRA 2YNHB 1W2BM 1RDWX 1JIHA 2WB4A 1FJGJ 4ECXA 3JPSA 1DAXA 2KYXA 4CEEA 2KSOB 1X4DA 4RWWA 4M3TA 3N4WA 3WIUA 4PL7A 3QT6A 4IQTA 4O4GA 2PFDA 3E1YA 1RDAA 2AWZA 3UDVA 2VF3A 4WYLA 4DV0F 2ASJA 5CD4H 2YQ1A 4WQ4C 3TUJC 4DR6K 3I4PA 3ISBA 1P1TA 4UUXA 4OI6A 1ECWA 2J0SD 1ZZNA 5J2IA 5ETMA 2P6UA 4I2QB 4OMFG 4PHPA 2VPZB 1ZAVA 1U1MA 4BR4A 8ICVA 1LEOA 2VASA 3CCJN 3EX7B 2BE9B 1AZSB 3HSDA 4OJGA 3RB3A 1HIYA 5AM4A 1LWEA 1JXBA 1XO1A 5EDWA 4FWPA 4FYYB 4EYHB 1NK8A 5B0CA 4JI2K 1M1KO 5J2JA 3T1HK 2IAJB 5D4BA 3LZIA 1FFGB 1OO0B 2JOQA 3RG6A 3DMJA 2G5IB 4QS8A 3HULA 2V34A 8ICIA 3H42A 5AI4A 1O5JA 3PNCA 3T5KA 1Y5LB 3WNEA 5DRKA 4J2DA 2QZ8A 1WC1A 2XLKA 5I3UA 4FOIA 3OR2A 3R5DA 3MAQA 4CGHA 5C10A 2WVCA 1O8BA 1TV6B 2BKNA 5DGAA 5FDLA 2LMRA 3AEVA 4BGBA 3Q8KA 3KWGA 4CF8A 5LMUK 4EENA 5HLFA 2AF6A 2DO0A 3KHLA 1Y10A 2HS0A 5EN1A 2RQ5A 3AL0B 1HYSA 1C0GA 5AM0A 3SSRA 4F02A 3C14B 1CQMA 1DTQA 4LF2A 1H7WA 1RBVA 2NCKL 3HPHA 1B64A 1P9QC 3QUQA 4DUZJ 1WUAA 2ATQA 4ILHA 2IJNA 1SV5A 3VEWA 4Q2MA 5HR6A 5A8RA 3O5BA 1JJHA 2XNRA 2DNRA 3CJ7A 1LFPA 3L4PA 1QY7A 4CI0B 4TU8A 1BPDA 4ES2A 1LXJA 2CJAA 1HQ2A 1QVFR 1FXLA 1I51B 2KHVA 2WSCC 1FJ7A 4OJ1A 3HXMA 3PX6A 1RLDA 1QTMA 4K4TA 2AEJA 4JMUA 1T3VA 1ZQDA 2GHVC 1VQSA 2F8TA 9ICQA 3O9QA 2O4IA 4BRAA 1WELA 1XI1A 3FCWA 3CMQA 4UB6U 2YKQA 3NMAA 4RPYA 5KFVA 2ZG6A 1R27B 1O6XA 4O3QA 3WQUA 3DLLQ 3MOZA 4M3RA 2L08A 4K0KF 5LL6Z 3DRSA 4R65A 1NJZA 4Y2CA 1X2IA 7FD1A 3N01A 5DDYA 3JPPA 5DDMA 2BW2A 1IBKJ 3QETA 2JH1A 2HFVA 4NASA 4FK2A 2W2QP 3H45C 5AQPA 2E4LA 2AGPA 3BKTA 2H5XA 2HS3A 3BF3A 5GAEU 4Z2XA 3C66A 2KJ8A 3LDAA 3GV7B 2RLTA 1X9MA 4F93B 5AI5A 4FE3A 2K8CB 4U7CA 2F8KA 1OMSA 1JROA 4B3TJ 4CHQA 4NZ7A 4AQYK 1T3OA 3JSRA 3TA2A 5F0UA 9ICKA 5D6GA 2WHOA 4EHTA 3QIPA 3OYJA 4WCEL 3K4GA 5K14A 4I2IA 1M5VC 1R0AA 4IG0B 3D66A 1TAMA 4PHTX 3D3CJ 8ICTA 1T4GA 1BC6A 4KLFA 1UOCA 2NLXA 8ICNA 2ASOA 3C21A 3G71S 3MXIA 1R89A 3AJ2A 1F5CA 2A3ZA 1BHNA 5ADXA 3BQ7A 2FJDB 4X62F 2BZFA 3S8SA 4ID8A 2PMWA 3K5OA 5ALQA 1OH7A 4DUYJ 1VDVA 4CZMA 2AGOA 2RRNA 4ITSA 2Y9UA 3WNFA 4LT6A 2HG4A 2D3O1 2LA6A 4Y3CA 1N4LA 4RW4A 1ITPA 1TUGB 3K59A 3VR1A 2MLYA 3P38A 3TTFA 3O3GA 4P9SA 3VMFB 2L48A 4X4UA 4E7HA 2ZXIA 5KAIU 1VQYA 3CCZA 2AP6A 5DDRC 4BRPA 3NCQA 3ENAA 2Y8WA 2DXFA 2BANB 3O5TB 1DQAA 1NK7A 2C2KB 1TKTB 1FJCA 5E41A 4IQWA 4J5OA 2ZD1A 4DX5A 2DO4A 5HBMA 4URGA 4OI4A 4B9MA 1VQPS 3E8OA 4Y1DA 4H4KC 1HA1A 2IJRA 5M1KA 4ZOSA 2X3DA 1NPKA 3GE9A 3I0RB 4XEIA 1B9FA 4DHVA 1YJ9S 1SUQA 3NS5A 2FPKA 1TV6A 1FCAA 4HH1A 1G4CA 5A0YA 3HHNB 5KAKA 5HSPA 2N7CA 5EX3A 4F0HA 1JXVA 3FDSA 2DRBA 1NKCA 3T1YK 3JSMB 4KHQA 4PG6A 1QQMA 1HYSB 4DV4K 4CJ4A 3OJUA 1LV5A 2HSEB 4ZP7A 2DHAA 4M63A 3U02A 1HARA 4LF1A 3OYLA 1TMJA 2LQ8A 3KLHA 2WHEA 5AKIA 1RBSA 5AM1A 3ED5A 3VQEA 4DFKA 3KG0A 3G6VA 5GTHU 2CJBA 1RTHA 2F9TA 3BGOP 1XBWA 3KK7A 3QFUA 3ZT4A 8ICYA 1SB3C 1BPEA 3GJQB 3CF5L 2YHXA 4LJMA 5CYMB 1T3QA 4DF8A 5H1SQ 2EWSA 1U1KA 1NJIO 4KB1A 3U1MA 2ZM6J 1XMQF 5C25A 2J4RA 3QERA 4QAGA 5CR0A 9ICBA 4H0XB 4BQLA 3DLJA 3IM1A 5IIOA 3RW6A 3CCLN 1FKOB 1WDDA 3O9UA 2HIQA 1VAZA 4KN4A 1H2TZ 2WOMA 1VISA 3KBBA 5ETRA 2VWJA 5KFRA 4C9DA 2Q0ZX 2QKQA 3MD3A 2DXEA 2MY8A 2QV6A 3THYA 1S1WB 2YNGA 5EWFA 3OVAA 2NPFA 5DB7A 5KL1B 2FLPA 3VHQA 5K8OA 4AUKA 2A0FB 3KD1E 3CE8A 1N6QB 1F0MA 4UB3A 3NWRA 4HL9A 4FLXA 5AZIB 2BRLA 3AV9A 3TJ8A 1SCJB 4LFAF 4Y2PA 3DCAA 5KFMA 3QWPA 1OPIA 5K8PA 3Q8UA 4GV3A 2CPRA 4K25A 4KO0B 2R2UA 4DN9A 4ATNA 2UUBJ 2A10A 1CUKA 4YOXA 5E3QA 4DV2J 4USMA 2O4GA 1V85A 1GMWA 4L3NA 1T3NA 1VS3A 5A8WA 3RH5A 5J1EB 2BJ9A 1VSDA 3HRGA 3PO5A 3R5BA 1RP5A 1TFRA 5EX0A 4PRFA 4FJHA 2X6SA 1F5BA 4B1YB 2XSFA 3TZZA 3ZYYX 1WYGA 1EKSA 4PKDB 3HHLB 2KLAA 4NO7A 1MROB 5AHXA 1FRIA 2FLOA 1B43A 3QICA 1X7VA 5ALHA 3BZCA 1WHVA 4KH0B 2MDAA 2FLLA 3ZX2A 1BWEA 1T05A 2CNLB 1TL3B 1PC5A 4HUFA 2O8BB 1ZQCA 1OVQA 4WU3A 2DEIA 4NE9C 5F8NA 5D46A 1YJ7A 1HBMB 3FC4A 1Q8LA 3F2KA 4FDFA 4IH6A 2FBXA 5GIPA 1WG1A 4RUHA 4LIWA 1RTHB 2JX2A 2E2PA 2FVSA 5C15A 2BQRA 1X6IA 4F91B 4PG4A 4HCBA 3V6JA 1HNIA 2BQUA 2MLXA 5DM7L 4BRDA 4DL4A 4ECRA 1CZAN 4AM7A 3QDKA 1GLLO 3TAMB 4C2MA 3VAKA 1KVIA 4E1MA 1B0VA 1WSJA 4ELVA 6FD1A 2P6TA 4MEXA 3CPEA 3H4DA 4OZ1A 1CJVA 2B9YA 1S1WA 4FWNA 1SC1B 4USIA 4HWIA 1SQKA 4QZ9A 4CNQA 2IOCA 2LSNA 2WVBA 4HEA9 3ZZOA 1JMTA 1N6QA 4X66F 3JAMO 2F77X 5BN8A 1RAEB 2IM1A 2PMHA 4NLYA 5FP0A 1NK4A 3AQPA 4EWTA 2YY6A 2ZBQA 4RNMA 8ATCB 2EZYA 5AZIA 3CB4A 7ICVA 4C97A 4NXNJ 2GNKA 4BCAA 2OJ3A 3CI5A 1JXEA 3DM2B 2W55A 5HOOA 4OPJA 1ZQBA 2MUTA 3RJIA 1UKUA 1WUUA 1RDBA 5IV4A 2HZVA 4MO4A 3BQ1A 3ALRA 3CD6S 3BM7A 4F9OA 3RYLA 4CGZA 2M70A 3LQVA 5TKYA 2A1AA 1HQUA 5DDPC 1B4FA 5J2EA 1WTBA 1NJYA 2ZIVA 1VK0A 1A0OB 2P6SA 5DB9A 2JEFA 3GIIA 5KQDA 4FJGA 1Q79A 4WXOA 3AVNA 4DV0J 1OJ4A 3VC8A 1WBBA 2LU2A 3UMBA 1AQ6A 2E1YA 2CNNB 1VJQA 5ALDA 5GAEI 4FYVB 1FFSB 4QWDA 2MQPA 3VGVA 4R8UA 4HACA 4DR5J 1JLAB 2R7UA 2V8PA 3H4BA 4IO1A 4HHTA 3N4MB 2E5JA 1BA1A 1KDNA 1PILA 5KG7A 3TOQA 3Q24A 2CPZA 2M8HA 1TQLA 1UL3A 1UMJA 1VI7A 4X4OA 4OPHA 2JL9A 2AA4A 1WDTA 2OSQA 1ZQYA 2HMXA 4OFZA 3W62A 4BXOB 2AYGA 2G0IA 4NYOA 3LVWA 4OZ5A 1NM2A 3SPZA 3THXA 3VGLA 1WC5A 2ZOGA 4RWTA 3CCLS 1NGCA 2KVQE 3HM8A 2AJ4A 1EXQA 2G07A 4FBTA 2PSZA 2VDHA 2MZRA 7ICOA 4FM0A 1QJHA 4ZDNA 2RDDA 2FZKB 6AT1B 1M0SA 2DNNA 4JI1J 1YDLA 3U8XA 2ZJAA 3CC4N 5J8YA 2LYVA 5HO4A 4CBWA 1ICEB 4EYIB 2ESEA 4Z7CA 3IN5A 1N2XA 4ZTJA 2HI0A 1ZOLA 2XMKA 2JRZA 3KNAA 2VKRA 3RJEA 2PI4A 3UM9A 2HHSA 4M5DB 5A8WB 2ZBCA 3GB0A 2OIHA 1XU4A 4J9UE 4DR2K 4ILGB 3LUYA 3H8YA 3O4WA 1NHUA 3OL7A 2QC3A 1ZBIA 5ALKA 1NEEA 4DV3F 3HHLA 1JN3A 3OBYA 4JKGB 9ICAA 4GC6A 3MUVP 4YHHJ 3D28A 1TK5A 1WWHA 2E1EA 5CWRA 1TL5A 2RJZA 3T6BA 4O0JA 3AN1A 1IBMK 2DNMA 4C8NA 3KMQA 5FRMA 4M5KA 4IG3A 4DSJA 2A6MA 1Q8KA 2B56A 2D41A 4LF4J 2ZH8A 3IBWA 2BYCA 2OGUA 3OYBA 1ZBTA 5JICA 2UUTA 4LH4A 3VQTA 1J54A 2GVZA 4DTMA 1ZETA 3MN9A 3TA1A 3JTOA 1LWFA 3KWMA 2E8NA 5J2AA 1ZQNA 1P9YA 1YI2N 1JWWA 5EUHA 1N33J 2RQ4A 5KTQA 1AROP 4FF3A 1GX5A 3DRXA 5B0EA 1KNZA 2F8HA 3W2WB 1YBTA 4H5WA 3GIJA 3QT8A 3VAFA 1KAZA 4OX8A 4OV6A 5C2GA 1WCNA 3AD9C 2C22A 4AL5A 3IDHA 1XMOJ 3PYFA 2UVUA 4UB8U 1TUVA 4Y2SA 1X9JA 5KAFU 5D77A 4NLWA 2E1CA 1HIWA 4FPBA 1T0TV 5H2FU 1H38A 5J1PA 1M5OC 3C1YA 2EFGA 3MABA 4O3RA 3TKAA 3Q8PB 4DSLA 4JS5A 2E5LK 2DGOA 3THXB 4OGCA 5KFHA 2K7JA 3V9ZA 2V8VA 3UXOA 1UP1A 4BC5A 3THPA 4USHA 2MSNA 1SKSA 1FWKA 4CLPA 1ZD3A 2VU5A 2UV8A 5IQQA 1K0VA 3G6EN 1RDRA 4YEAA 3BO4A 3NAIA 8ICGA 5I3QA 1X9SA 1TK8A 1R7IA 4QR2A 3R2DJ 3UXNA 3K5PA 1UQVA 2K4HA 4B9VA 3UNYA 2UUWA 2H4WB 1QHAA 1YX2A 2H5EA 1OW5A 3LAMA 1V38A 5EXWA 3U3YA 3TARA 5J2KA 4PWDA 3O44A 4PHDA 3QGGA 4F72A 1SJFA 4BDYA 1S7IA 1JK9B 5E0OA 1BWVA 1KC8T 2V8GA 1ZZFA 1HKAA 3CMAS 2FIUA 4O3PA 1S9GA 3GFXA 4F5NA 3SAHA 1G6BA 4DPTA 3SUPA 5KNIA 2P9GA 4BDZA 5GMKa 2KL8A 3THTA 4L8RB 4P71A 4ZA1A 5IINA 4CZCA 4Q43A 3SQGA 1JLAA 5MAOA 4JKGA 5C7PA 4IOBA 5LJVA 5J2MB 4L3QA 2NNWA 3S01A 1ZC6A 3UN3A 1WD6A 3FZ2A 1JLCB 1M90O 2WVDA 2KI2A 4FJ7A 1KLMA 2BZ2A 2P9LB 4K5SA 1S6OA 4XPCA 3PEHA 3AO4A 4IDKB 1XR7A 2FVQA 2Z56B 1JRPA 1RAHB 1K8AO 2JLGA 2GV1A 4BR5A 1S0OA 2FJBB 2GHPA 3I55N 4FP9A 4DG1A 3M6WA 1C6VA 2EQYA 1VMBA 2CKWA 4PWWA 3TAGA 5F8IA 4OVLA 3IWLA 3N0VA 3R1XA 2W11A 1KP6A 4ED1A 1UHUA 4JWMA 3NGRA 3JSBA 2KN4A 4NJ8A 4FZXC 1VQLN 2ABYA 4J2EA 2VONA 1B22A 4I2CA 4DV2K 3L8BA 2QLTA 5CB1A 1ZQSA 7ICLA 5IT9O 3TYTA 1B92A 4UOFA 1U1NA 3PVXA 4I0WA 2YV0X 5D4LA 3MR3A 3M5RA 4G1PA 3CYMA 3KHRA 2KT2A 5LSLA 1AUSL 4M95A 4GVLA 3LAKA 4CRJA 1NZBA 4IYQA 1NJWA 4UB1A 4B6JA 1WOOA 2MTLA 1X3NA 3CM5A 3WNHA 4E3SA 3FBEA 1REVB 2G2ZA 2MPUA 4QIWF 3IP0A 3VQ6A 2HHTA 4RJVA 4FPRA 4NLBA 2CQ3A 1IR0A 3FSXA 3ETMA 2LM4A 1ZQ1C 1YIJS 2HZCA 1TE2A 1EWRA 4YOEA 4MFAA 4OJHA 2HHQA 1VSJA 2DFLA 1YZ6A 5L9NA 3CCUN 2QG9B 3CD5A 4FBUA 2GX8A 3HKZC 2GELA 4DFPA 2IHMA 2GWKA 3BN4A 3MHYA 4XH5A 4OYMA 3P39A 4DL2A 3FM9A 2KB2A 3KD3A 3ILLA 1SXEA 4WPAA 2RAQA 4FNIA 4LVOP 1KCFA 3CFOA 2MJNA 3LP0A 4QBUA 3NVKA 2F1JA 2CG8A 5B0BA 4JD2A 2FPHX 1NDPA 3W8PA 3A5OC 1Q7LB 1EQYA 1IXKA 2DNKA 2ZKTA 1WG5A 4ZLNA 1T95A 4BC4A 2ACMA 3DRPA 2K8GA 3NRBA 2F4VK 1SQFA 3KXDA 4FJIA 4M2YA 4IDHA 1NKEA 3O0FA 2HQFA 2G2OA 2D0BA 2LDIA 3SUNA 4ICLA 3MCMA 1DFDA 1B99A 2ZXHA 1UWBA 4NLKA 1UJ5A 3TACB 2FBTA 1DLOB 3HSZA 1PK3A 4EMDA 2M7SA 4RUCA 2EPIA 3CJAA 3TZYA 3H90A 3EVWA 4DG1B 4CJPA 4KHYA 1UZDA 4YDDB 4I56A 4USJC 1NLKL 1OWXA 3CNHA 4Z4HA 1HJRA 1TAUA 1VIOA 4ECWA 1KR4A 5TKWA 3CMEN 1QAYA 1FD2A 3NOCA 2CDRB 4ZVSB 2QWPA 2WF9A 1SC3B 3CTRA 1Z00A 1SXLA 3C6AA 3SMPA 1KWMA 2VJ5A 2P9NA 3CMES 3HVTA 4B3SK 3P8BB 5KG3A 3HVRA 4Y2QA 1HPZA 3L9ZA 1DARA 3W2VA 1ZAWA 2HHUA 2KW4A 3K5NA 2RUSA 4H5VA 3ISCA 2EK1A 1HYZA 3BZKA 2QT7A 9ICCA 3GP9A 2HSTA 5HQ8A 3ZX0A 1PC4A 2LA4A 4K43A 4YDUA 3ZO7A 4C8LA 3MECB 3H40A 1T9VA 2DHSA 5J1NA 2QM1A 1OYDA 2B4UA 5CEHA 1ZM3A 4DR5K 2K4EA 1AT1B 2V2VA 1B3TA 5GVQA 2IDEA 4OO1J 4LF4F 1A5XA 3CDWA 1S1VA 3MBYA 4QZIA 5DDQC 4QWCA 5CY4A 4FWRA 4C48A 2ZKUA 1Q86O 4E2FB 5HHHA 1BUXA 1ZQHA 2BVZA 3R7BB 1D8LA 1C1BB 2MXYA 1RT7A 2Z2LA 5G5HA 1X0FA 1YBAA 4MF2A 1SIZA 2XYGB 5J2QA 4UB4A 1HR0F 1ESVA 3TTDA 4M3XA 2H3ZA 4E19A 2RQCA 5AIBA 4CT8A 2CG4A 1O1WA 1BNPA 1CZ9A 4ZCIA 5KFEA 5CYMA 5ALYA 1S1TB 4DR1K 3CCUS 4ZVPB 3AVFA 1W26A 4CJUA 1JKHA 4G3IA 3A8YA 1RAOA 4CGJA 3B6BA 3F2CA 3UQSA 3PIPQ 4PKHA 1Z4NA 1GEHA 4MIWA 3ZSZA 2CPXA 1PYTA 3KLGB 1U02A 3HKZD 4KHMA 4EFAC 3M9NB 3TABA 2HOIA 1ZQWA 1Y97A 4B3MF 3G2XA 2PMZD 3W60A 4OV1A 4KTZA 1L7NA 2B5JB 2MQLA 1TK0A 3QNWB 3UDLA 5A76A 4MK9A 3QIOA 4YB6A 2R2RA 3FBCA 3OLAA 5EWGA 4DL7A 3NE6A 1KAXA 3QGPA 4DUZF 3DXSX 3CCTA 3HJVA 4RNFA 3J80Y 4LF4K 3D7EO 4P0QB 5T7BA 3CQ8A 3S1TA 1RT4B 4ZVTB 1SKUB 1EHWA 1ZQAA 1S9GB 4FF2A 3ULEB 4JK9A 3UDCA 3OTOK 1XR6A 5HMXA 3N9UC 4N47A 3QNMA 2PYJA 4B1XB 4XTTA 3H5YA 3V4IB 4OJ6A 4ILMA 1FE4A 2HDOA 1WWVA 1WBDA 3MR5A 3MM8B 2UVWA 3PFOA 2O8FA 1GLCG 4E7LA 4KTWA 4CM0A 4UT4A 3SCIE 2GUIA 4X4VA 4FWSA 1WOPA 1OVYA 1LKYA 2XYHB 2NRRA 2IMOA 1DGSA 3IC1A 4I28A 1FRLA 3D6JA 1I1GA 3MD1A 4CF2A 4KREA 4ECSA 2D0OA 4MFFA 3G82A 3BO2A 1EIYB 3HLUA 4IOCQ 4ZP6A 2ZTDA 1IKXA 4OLAA 3C94A 1Q78A 4NLZA 2WF5A 5AE3A 3O2IA 4K7QA 3HFZB 3MDFA 1H74A 1HLUA 3DJCA 4XH4A 1VQON 3U3GA 3RAXA 1CULA 2DNLA 4ENOA 3OSPA 2Q43A 4NLPA 5AXKA 1QZ5A 2P6RA 2ZH7A 5DBAA 4O9MA 2D3ZA 4E7KA 2PFPA 2X74A 2HNDB 5AKHA 2V4JB 2YKPA 4AT1B 5CHIA 3RJJA 1RE1B 1FNMA 2EZZA 8AT1B 5K9FA 4CK3A 4DWIA 4MKAA 1FFUA 4N8OA 3NBPA 4K4VA 4CJVA 2NYHA 3LM2A 4PPZA 2PIIA 4TSXA 3EWGA 1CEZA 3VA0A 4R63A 1VQ5N 4U9RA 4GKJJ 2IA0A 1XNRJ 1YRXA 4YR0A 4DV6F 2VC0A 3N5FA 3CJKA 1X40A 3G71N 3TZXA 5L46A 2XMTA 3F41A 3IXQA 2PYLA 4OX9J 4HI2A 1DY3A 4I2PB 1RTDA 3ZSWA 3CPWM 3CD0A 3EE9A 1ZQGA 4LC9B 4KLTA 4WE1A 4GV9A 5ALIA 4KHPJ 2LDYA 5JS2A 1B4SA 4Z4GA 5HAOA 1S5LU 1Q8IA 5LJ3Y 1HYVA 5KFNA 3W64A 3OLBA 2OM6A 1VQLS 3RAQA 1VYAA 3QO9A 5BYSA 5D4OA 3L3VA 5J0UA 4RW9B 2ZQBA 4I9QA 3ZXWA 2EFQA 3OUYA 2W24A 4MFCA 1RWOB 1JLEA 2C3MA 5KFUA 2YTCA 2O8FB 4PJ0U 1UAXA 4WFNL 2E5SA 3EN9A 2QA1A 2X78A 3QX7A 2UXDF 4LR8A 1RISA 2PBDA 5ADXH 2KO1A 4ICLB 4Y2UA 3ID6A 3J7ZO 1RWMB 2FGOA 5AK3A 3C2PA 3GU0A 1R6VA 3NF9A 1A6LA 1APSA 4V19J 3D4JA 4ZMMA 4JN4A 4JAXA 1FWPA 2YTUA 1IKYA 1TELA 4DEZA 3ISNC 1C0UA 4F25A 2V63A 3QESA 4CNZA 3Q22A 2K8AA 2EG1A 4JKFA 3A1YG 2IIRA 3HILA 2B6GA 3OHBA 5IS2A 2E8OA 4DV6K 1F6TA 4M3UA 2CJYB 3VF2A 4DB3A 2DJWA 3JXOA 5J2NA 2R4FA 5J0RA 5ALEA 1KTQA 4U7BA 7ICQA 2ZIVB 1B7FA 4NL9A 3ZZTA 4CH1A 1TL7B 4C98A 1Q3UA 4YMEA 3RBZA 4M7YA 4H54A 2CUYA 4UY8T 5CHCB 4PQAA 1DZ5A 2YPZA 3J7A1 3WXLA 2LP4A 2H5IB 3BKUA 2DCUB 4RW6B 3LH2S 5KT3A 1D5AA 3VGSA 2GMLA 2RVJA 3J81Y 1FX4A 4LF5F 5KFTA 5B0GA 4RQNA 3T5JA 4USTA 4MKYA 1B70B 4WXWA 3HKWA 2IY5B 1X5SA 3H5SA 2FHJA 1WAJA 4H0YB 4RU2A 1QTNB 4DR7F 4J03A 3DV9A 4WYBA 2W4PA 2FJVA 5J0SA 4DFMA 9ICVA 3V4MA 5LXYA 4NXMJ