1PUZA

Solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
MMVFDDIAKRKIRFQTRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKIRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis reveals a distinct 5-helix bundle.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 20
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1puzA00
2LM4A 1X6JA 2JR5A 1X6IA 1PUZA
chains in the Genus database with same CATH superfamily
3MDCA 2KHQA 3AUOA 5KL1B 3THVA 3BS7A 1IIPA 3NTUA 4OD0A 5ALOA 7ICVA 4CF5A 3EPIA 1K1QA 9ICBA 2R8IA 4EX6A 4EYHB 2NRTA 4O5CA 2E3TA 2K4PA 2D6FC 2H3ZA 3GIJA 4QZAA 4BXOA 5CP2A 5DQHA 4DSFA 5GTHU 3M7DA 4O3SA 1ZRNA 4Y2RA 7ICKA 9ICTA 5IILA 2K8BB 3TI0A 3H8JA 4J9SA 3OSPA 5L1JA 3QZ7A 1LB2B 1TKDA 4FS2A 2RRDA 9ICKA 4UATA 3TFRA 3PX0A 2FLLA 2XIDA 3RRGA 4O3MA 4JWMA 4NWIA 2Z7JA 4XUSA 2KZZA 1T4GA 3JPOA 5DB6A 1FEZA 3AM9A 4J9KA 5CR0A 1ZQBA 4GXKA 1Q46A 5KFDA 3RTVA 1D8BA 3UMGA 4J9QA 7ICUA 3WU2U 2YTUA 4X5VA 4K4GA 4KN4A 5ALNA 4C8NA 4Q8EA 4M0AA 3EZ5A 4JWNA 9ICAA 2VJ5A 1ZQEA 3C1ZA 4B9MA 4O3RA 4LVSA 8ICXA 4RQNA 2A1AA 5ALHA 4QW8A 4UB5A 4R66A 2JH1A 7ICMA 5L1MA 5EOZA 3ETLA 4M9JA 5ALIA 3M9MB 8ICYA 4BX9C 2XI9A 1UPHA 3KKAA 5ALRA 1D9FA 5IIIA 2HHUA 2UVRA 2DPJA 3C2LA 3T5HA 3L4PA 2QARB 1HEKA 1NNLA 4NM1A 4O0IA 4KX3A 2LI6A 2HBMA 4M04A 3RJFA 1B22A 5AKKA 3BQ7A 4KLTA 4XQ8A 2DGZA 4C4SA 2F77X 1SL1A 2BCRA 1YZ7A 1Z1VA 2XGQA 3M6ZA 1QH9A 2LHTA 4Z6CA 4EENA 4J9OA 3U26A 4B9LA 2KFZA 1NJZA 2F1HA 3I76A 4ED8A 2P35A 1SV0C 3WKAA 2PKEA 1LKYB 2W3SA 1UT8A 2NRXA 1RXVA 1DRGA 1U48A 3MC1A 2ASLA 3MGHA 5L9XA 2K60A 3WKBA 1DK2A 4Y2YA 5ALZA 5KL8B 1MN8A 2PXIA 5G5GA 3M8RA 4KLQA 2WF6A 4M9HA 1BPZA 4PGXA 1Z1BA 4YQWA 1ZQAA 4Z6DA 2ZJ8A 2BR0A 4DF8A 2I1QA 1Z4OA 5CWRA 5AICA 2JEGA 4DSLA 3JPRA 2WAQC 8ICPA 5CA7A 2ZTDA 1NZBA 1MA7A 7ICHA 5AI0A 5DKWA 3MR2A 1ZJNA 5ALMA 5AK3A 4F4XA 2F44A 2DF4B 1N56A 1BGXT 4QJFB 4UARA 4RUCA 1ZRMA 4RQ2A 3OSNA 4I2DA 3KTQA 5AKIA 3QU5A 4MF8A 1QQ5A 7ICJA 3B9JA 4UBCA 7ICRA 4RQ0A 2AGPA 5F3XB 2DBYA 3PW2A 1JX4A 2K4EA 3Q8SB 1T94A 1FFVA 4PHAA 3HX0A 2GO7A 5HR7A 4P0PA 2G07A 2M0NA 1QLNA 1VLBA 1IXRA 3NRWA 5ALDA 1TAMA 3HRDD 3EW9A 4B9UA 3ZD9A 2FLPA 2VIXA 4YD2A 9ICFA 3MABA 5AKEA 1MQ3A 5KFUA 5ALKA 4NM2A 9ICLA 5C5JA 1S0MA 4ECUA 3MDAA 2JRZA 1S77D 4RPYA 5AI4A 4JV2A 4RNMA 4ED3A 4KITB 3AMZA 4M47A 1ZD3A 2LYHA 2WF7A 4I2JA 5KT5A 3L3FX 4RQ4A 1SKRA 2HBLA 5T14A 1TK8A 3SAGA 4FBUA 4FS1A 4IRCA 4ZOHC 5J0TA 3NVYA 5J0UA 2WTFA 1X6JA 1A6SA 4QNLA 1ZQDA 4KLJA 2XCPA 1NK6A 5AI6A 4DL6A 9ICNA 2BDPA 2PFOA 1ZQIA 2FMPA 5KFJA 3WKEA 3F2CA 8ICHA 3NS1A 4FO6A 4RU9A 3UPQA 1B0XA 5KFSA 1ZQOA 1FO4A 4O3OA 3LWLA 1X9MA 3PR4A 2YY6A 1TV9A 3T3FA 4PHDA 4DOCA 5AM3A 1JN3A 3SV4A 3QE9Y 1KRPA 5ALXA 1U47A 3V7JA 1PVRA 2OWOA 3Q8MA 1XNSA 3ORYA 2RHFA 5KG5A 4TURA 2XY7A 3T79A 2W8KA 4DQRA 8ICOA 4DFPA 5C0YA 2W9AA 1JI7A 4K4HA 1N2XA 3TACB 1SV4A 2V4RA 2W7OA 4Q44A 2CRXA 1DGJA 2LBOA 4EZ6A 2PMZF 3TADA 2ZG6A 3QX7A 5AKGA 4TQRA 2EANA 1Z3EB 1XSLA 2HHWA 3WK5A 2IA6A 4Z6EA 1UA1A 5ALTA 5D46A 4A8EA 5EE3A 1ZQ1C 4DQIA 3GIIA 5KFEA 2C2RA 4ED7A 1ZQJA 4ELVA 1QQ7A 3PX6A 3N7RC 4QZGA 4NY8A 4DFJA 2Y9TA 3BQ0A 5KFYA 9ICHA 4AP9A 7ICGA 7ICOA 1ZJMA 1L7MA 7ICEA 2R8HA 3C2MA 4FE3A 2NRWA 3WK8A 4ELTA 5JTIA 3ICXA 3CRXA 2QKQA 5KFWA 1L7NA 5EWGA 2DUYA 5AM2A 2HHTA 3NVZA 4UB3A 2LKYA 3K75D 3AEVA 2DFLA 2F1JA 2FI1A 3HWTA 2VJ4A 3F5AA 1HJPA 4B9SA 4FZMA 3GV5B 1XSNA 2R18A 3QUCA 3Q8QB 1TAQA 5BOLA 2C2DA 1IG6A 3SEIA 4F4ZA 1ZQHA 3BDPA 2IOFA 1KSPA 2YMPA 4OJ6A 4DFMA 1NJXA 3V7KA 2BPCA 3GU3A 5HNKA 4F5RA 4IS7A 3PNCA 2WB1C 3AN1A 5KNIA 2JMGA 1ZYQA 4C7ZA 1WCNA 3C1YA 1NK8A 5ALUA 2LM1A 3IG8A 2FDRA 1F44A 1JXEA 2DQNB 2RLTA 3VC8A 4NJ8A 2ZJAA 4F4KA 4KLUA 2YQEA 4RT3A 3MGIA 4I2HA 5J8YC 5KFNA 2YMLA 3D2SA 3BZKA 3UQ0A 1NZPA 4ED1A 2VA3A 4DOAA 1B43A 4YMNA 5KTQA 2JEIA 4US9A 1WCLA 4Q45A 4R64A 1X9WA 2ZTEA 4IQTA 2O6KA 4G3IA 3RH4A 1AROP 4QWAA 3RBDA 3ISCA 4QWEA 1IM4A 4NLBA 4KLFA 4YCXA 3S6JA 4DSKA 4QZFA 3OJSA 3K1ZA 3PVXA 5KFLA 1ZQRA 5HMMA 2UVVA 2LYBA 4UW9A 2WF9A 3HKZF 2VA8A 2VA2A 1SL2A 4PH5A 1ZD2P 2QB1A 4RQMA 1L3TA 1Y88A 8ICBA 2K8CB 2AU0A 5E79U 5DQGA 2BCVA 2JZBA 5KT3A 5AIBA 2KV2A 3RB4A 5DDYA 4DSIA 4F2RA 1JMSA 3Q8KA 1KW4A 4J9LA 3IHQB 2W11A 4GC6A 3H40A 1J2NA 4RQ1A 1SZHA 3HT3A 8ICSA 2GLEA 4OJPA 2D8CA 1KBUA 1C7YA 9ICUA 2XY6A 4IQVA 5IIMA 3D2QA 5JUMA 1FFUA 2VKQA 3H4BA 1NK5A 9ICPA 3EUB2 5J0SA 4P2HA 1N63A 5J2JA 2MA1A 4OJ5A 1PK1A 4Y2XA 2ZUDA 5AI9A 1YZ6A 2DPIA 2IOFK 1PK3A 3B0XA 2KICA 3ISDA 3OTQA 2HSZA 4F71A 2F8KA 3EWAA 3JPQA 4Y2SA 1V9PA 2M9NA 5F9NA 1Q3VA 3BZCA 5CB1A 5KT6A 3TQ1A 4QWDA 3QXGA 4YXMA 4Y2QA 4XA5A 2ODGA 2XO7A 1KKXA 3H8SA 5AKHA 4I27A 3C23A 4C8KA 5DLGA 3CW2C 8ICTA 2R8KA 2KZMA 4RQ8A 4KLGA 2N1RA 1WWUA 4F5OA 3N7PD 2LYAA 9ICQA 4P0QA 3GV8B 4HYKA 2ZUCA 4IC9A 2B21A 2ISPA 2E8PA 3IP4B 5KG4A 4OCZA 1KDHA 2HHQA 1J2MA 2AHOB 2DKXA 2HHVA 3F2BA 1D8YA 2ZIUB 4C8OA 2AH5A 1U9LA 5GTIU 2FMSA 2EDUA 2IHNA 7ICIA 8ICMA 2OHFA 3WK6A 1WWVA 1ZXIA 4US8A 3PSFA 2A19A 2WHEA 2HVIA 1HIWA 3M1YA 4EBEA 4R8UA 2IOHA 1A77A 1ZQZA 5J0OA 2J6TA 4QIWF 3V7LA 8ICCA 2KSOB 4DLEA 2AQ0A 1L7OA 5ALWA 1RM6C 4RZRA 5KAFU 2ZUBA 4DSJA 5IINA 1ZETA 3A0BU 2KZ3A 3KD3A 5L1KA 5KFVA 4Y2UA 5KFTA 1BNPA 3MFHA 1X66A 4QZ8A 3TKAA 1N5WA 8ICEA 3RAXA 4KLDA 5J2HA 1M6YA 2EQYA 3WK7A 3F2DA 4MEXA 9ICMA 4NL9C 3PW0A 4ECVA 4PHEA 4UAYA 1MC8A 2B6GA 2OXOA 2OYYA 9ICIA 4PHPA 2HBKA 2G06A 2RDIA 4DOBA 5DBCA 4EEKA 4P4PA 3TAPA 2JV3A 5AM1A 4NV0A 3QUQA 2EZZA 1T8EA 7ICNA 4F8RA 3KKAC 8ICAA 1YT3A 1V38A 4GXJA 3M8SA 1ZQPA 1A0PA 3WKCA 2KN7A 4M9NA 2W9CB 1JROA 4Y2PA 4FZNA 4MF2A 4O3NA 3QNMA 3Q8RB 2DWQA 2QLTA 4JK1A 1TVAA 4ECQA 2WFAA 2MSNA 4ECYA 3UXPA 4F92B 2Y0SF 1S8OA 2HMXA 5KFHA 1ZQLA 2PFPA 3BJYA 5EWFA 4PZNA 1UHUA 3B0YA 1CUKA 2C22A 5D4BA 3KHLA 4KTQA 1TK0A 4NLZA 5J0RA 1ZQSA 5AI8A 3ZDCA 1COOA 2H5XA 3ZDAA 2YX8A 4F4YA 4ECWA 3RJEA 1ZQNA 2BQ3A 3SQIA 4YMOA 1O08A 4B6JA 4IRKA 2YN4A 3HP6A 2ALZA 3BS5B 1PK1B 4GFJA 1X6IA 4P4MA 1SKWA 8ICIA 1NK4A 5AKXA 3C5GA 3O0FA 3PV8A 5DBBA 4R65A 2YB1A 5KFMA 2ZIXA 4RPZA 2ZJ5A 2BHNA 2K4HA 4P4OA 3V6JA 4B9TA 1RQNA 2I5HA 4I2EA 3V6HA 3KHHA 4GLXA 3RB0A 1O03A 4PGYA 5CJ7A 3PW7A 3LDAA 7ICTA 3C28A 5J2CA 3QYPA 1U4BA 2G5HB 1LKYA 1BPDA 4UAZA 4C4RA 3LVVA 3UMCA 4KLSA 2UVUA 2OCEA 2KJ9A 5AK5A 4UQGA 2AGOA 1S10A 4QWBA 2FPMA 2NYVA 4JV0A 4LZDA 3RB3A 1KFTA 1NKBA 2KE7A 2LPEA 5CHGA 2FPKA 2A3VA 5KFAA 2EZYA 3LK9A 1COKA 5EE1A 1RXWA 1OUQA 1XO1A 2W03A 1XC9A 2QARA 3TARA 3H7IA 3NVWA 4YR3A 5IIJA 4YN4A 1CRXA 3RJJA 5J2DA 3E58A 2HW3A 1URJA 2KVSA 2CPRA 3I28A 1BPEA 4YD1A 4DWIA 4I2BA 1KN5A 2MUTA 4QZHA 3ED5A 3H0RB 3KFUF 1NK9A 3RR8A 4UAUA 4CGZA 5J2BA 1RDFA 5AIAA 2W9BA 3MFIA 4RQ7A 1NKCA 4DQQA 4I2FA 5DB9A 2ASDA 3UXOA 3RAQA 3AQFA 4BWJA 3V6KA 2MAXA 4ACOA 5ALVA 4IL6U 3MR6A 4EBCA 4DF4A 3IG5A 3T5LA 4DLGA 3L5KA 4EBDA 4M6WB 4FFDA 1SWWA 3K1RB 2NRZA 1FIQA 3UQ2A 1BNOA 4DL3A 2IBKA 4Q43A 3NGDA 5K4LA 1T3QA 3QUBA 3GV7B 3KHRA 4XRHA 2FLNA 2BCQA 2GOLA 4BUGA 2A1JA 4UAVA 4LZGA 2E5SA 1PVPA 4CF3A 2WF8A 2GWSA 1UQVA 4I2IA 5ALQA 4KLHA 1K5OA 3QU9A 2G5IB 3KZXA 3GILA 1B4FA 3UXNA 3ALRA 3MGVA 3G6YA 4NLNA 3RH5A 1U49A 1ZD5A 1ZQTA 3QU4A 3NVVA 2BPFA 4UASA 2JXJA 2QB0B 4J9MA 4DL5A 1ZQGA 2BCUA 5KFQA 4Y2TA 2MRLA 2MU2A 5D49A 1WG8A 1SGGA 3AU6A 5KFGA 5KFOA 3BQ1A 4QZ9A 3M9OB 4FBTA 3PSTA 2KIWA 3NASA 2LMRA 1PUZA 1UCVA 2IMWP 2W9BB 2P66A 4ZH4A 3KZIU 1IV8A 4ECXA 1SXDA 7ICPA 1DK3A 2BPGA 1TFRA 4E0DA 2DKZA 1SXEA 2I9GA 9ICVA 3SENA 2EAMA 5IIOA 4CDGA 4I2GA 3DDHA 2KMDA 5CRXA 5KAIU 4KMOB 4DEZA 2E8MA 2W9MA 1DGSA 4F50A 1N62A 5KT4A 3SI8A 2KKPA 4RQ3A 3QEAZ 2HOQA 2K8AA 5DGAA 1ZQUA 3RH6A 1UA0A 4OJOA 4G9BA 4NLGA 4DL4A 2H3FA 2YB4A 3IN5A 5KG1A 1WUDA 3SAHA 4UB4A 4U6PA 2MUTB 1ZQQA 2P6RA 4I2CA 5J2KA 3HILA 4Z6FA 1NI3A 5KT2A 4EZ9A 2BDUA 2J6UA 3ZDBA 4BWMA 4BGDA 1Z19A 1KL9A 2ZXHA 1X9XA 1CEZA 2E1FA 2ASJA 4ED2A 2JHDA 4DS5A 4QZDA 4TUPA 2KSOA 3F5EA 5JRTA 1RYRA 3OJUA 4R8UB 4YR2A 5CEHA 1L5UA 9ICXA 3ETRA 4QZEA 4PL2A 1DOQA 2F3NA 2NV3A 2Y1JA 7ICLA 2NRVA 1XS9D 3FC4A 4CF4A 2G09A 2EAPA 2ZIUA 3MBYA 2KG5A 3PMNA 3C2KA 4DL2A 5B66U 5DLFA 4J9RA 2IHMA 3D2NA 3E2EA 2I6XA 4MFAA 3MR5A 4MFCA 3LVWA 4JB3A 5KG3A 2HBJA 4P0PB 5TISU 3V72A 4EEYA 1RPLA 1XO0A 2ESEA 4OO1J 2NO5A 8ICQA 1ZQVA 2D3DA 3RJGA 2RQ5A 3AQEA 4EELA 1N61A 1A76A 2HVHA 4K4IA 4PJ0U 2XGPA 3QZ8A 4ED0A 1QSLA 3PSPA 3RR7A 1VDVA 3E0FA 4DSEA 2WAQF 1SL0A 4NLCA 3F53A 1NJWA 1F0MA 1ZOLA 4NL9A 3H8MA 3PW4A 1SIJA 5ALYA 5AI5A 4QZCA 5KFKA 3RB6A 4KLMA 4F5QA 1T7PA 3DEEA 2C2EA 5EE0A 9ICEA 3IM1A 4AYBF 5B5EU 3TANA 2YMQA 3TAQA 2ZIVA 2V4QA 3PW5A 1S0OA 1RYSA 3QEBZ 5AKZA 4JUZA 4PL1A 1NOMA 2ZIWB 4CCHA 1SV0A 3FDSA 2AXTU 5J8YA 4ED6A 1L8OA 8ICVA 1SZPA 3RJHA 8ICGA 5J0PA 3C5FA 5DBAA 1V97A 1SKSA 3PY8A 4USAA 5G5HA 3QUTA 2B0CA 1S76D 1GO3F 4J9NA 4CE6A 1RYUA 4I2AA 5J2IA 2WF5A 3H0LB 4CNQA 1D8LA 3VCBA 5KG0A 3PX4A 3AU2A 5ALEA 2JEJA 4R63A 1DXSA 1ED1A 4NLKA 3GIMA 1JUDA 3C29A 3RBEA 1MSWD 4Y2JA 4QW9A 4ICAA 3RFAA 3FM9A 5AK4A 4DQPA 3JPNA 5DG7A 1PVQA 4U7CA 3Q8PB 3J81j 2HCFA 1X2IA 1V85A 3M9NB 1ZQCA 2W55A 1ZQWA 2F76X 2W04A 3OHAA 3JPSA 2HDOA 3CNHA 3K4GA 5TZVA 5AKJA 1ZQXA 4M6WA 2L5YA 5BPCA 1S5LU 2RP5A 5HHHA 2XY5A 4DL7A 1ZQKA 4KLEA 1C20A 5KFXA 3BQTA 2J6SA 2ZTCA 2EH9A 2CN1A 3HPOA 4KN7A 4UB1A 5KG6A 3PR5B 2G08A 4M9LA 5JU5A 4EYIB 5KFFA 4F5NA 1L3UA 4I28A 2OH2A 4F5PA 4F2SA 1TK5A 5DG8A 2PFNA 2KTQA 8ICUA 5ALFA 2UVWA 3HW8A 1QCKA 2PI4A 4O9MA 2KIVA 4P0QB 4WJ3B 4YR0A 1L3SA 8ICKA 2Q0ZX 4RPXA 1SWVA 2KJ5A 3H8WA 4C7YA 4TUSA 2BQRA 4UBBA 1NJYA 4OJLA 3R9KA 2E8NA 1JXLA 3RJIA 2AQ4A 3WK9A 2R8GA 4BJQA 5IIKA 3A0HU 5EE9A 2RDJA 2HOIA 3JPTA 3GDXA 2BCSA 4UB2A 3QU2A 4M9GA 4C8MA 4ELUA 2Y0SC 4HAIA 3WKDA 3ZDEA 2KFNA 4IRDA 2DL0A 2V9WA 2ES6A 5J2AA 2KK0A 4PPXA 1S97A 2XVTA 3CYMA 3PZPA 4DS4A 3G6VA 4JV1A 3M6KA 1KFDA 2KHVA 1J97A 4IQUA 4MHVA 3SV3A 3HKZC 2XCAA 2YMMA 4RNNA 2KD1A 1QSSA 5AKYA 2W54A 4O5KA 3NUQA 2ZIXB 2ZIWA 4UB8U 1KFSA 3PMLA 2P6UA 1BVSA 3AL0B 5J0XA 1NKEA 2A1JB 4IQWA 1XU4A 2KNJA 3BS5A 5DG9A 1TAUA 5ALLA 5KFCA 2JZBB 2FE9A 4UAWA 5J0QA 4DO9A 7ICFA 1ZQMA 4F72A 2W9CA 2H3IA 4YMMA 1ZQYA 1RG6A 1LVHA 4YVZA 1X42A 1D9DA 1TE2A 2AGQA 2GH1A 2H3VA 2BQUA 2JH7A 1OW5A 4UB6U 2EAOA 4GC7A 2G0AA 2JEFA 4YFKA 3N28A 1WYGA 3PSIA 2Y1IA 2XICA 4QZBA 3GZFA 3FYHA 1Z00A 2FPLA 5J0YA 5KFZA 2KVCA 4RNOA 4DQSA 9ICWA 4ECSA 1KEJA 5KFIA 2HOFA 4B9VA 5KFRA 3SZ2A 4C80A 2W3RA 9ICRA 1BPBA 1S9FA 5DQIA 1CI4A 3PO4A 2E8OA 1L7PA 3LWMA 5AM5A 1Z4NA 2ATLA 4KLOA 3ZI4A 4M2YA 2KJ8A 2WB1F 3SD7A 2FMQA 9ICSA 4B9NA 2JGAA 5AM4A 5KG2A 1H38A 3KBBA 2KKVA 5F9LA 5KFBA 5KFPA 4ECRA 1JIHA 1ZD4A 2BKEA 4PZOA 3LYSA 4GXIA 3IRUA 9ICCA 4IR1A 2C28A 1RQLA 8ICLA 1U45A 2F8LA 4JMUA 4O5EA 4DFDA 3H0MB 2HHXA 1MQ2A 3TADC 1KQQA 5FP0A 2XC9A 4KLIA 1QSYA 3T5JA 2ZIVB 1NK7A 5KT7A 4F91B 3GFKB 1ECWA 2PFQA 4AYBC 3OPXA 8ICFA 5BOMA 8ICRA 3Q8LA 1SB3C 5J29A 4YG2A 1T3NA 1Q3UA 2FJ6A 3I1YA 4C4TA 1XWLA 3RJKA 5J0WA 2ISOA 4TQSA 3JPPA 2HHSA 8ICWA 1S0VA 2KOBA 1EXNA 5DB8A 3DV9A 2KP7A 3IV6A 1HUZA 2HI0A 1JALA 1PZNA 2W8LA 3NRZA 1X40A 4NXZA 2BZFA 3N7SC 5AK6A 3EPGA 4QWCA 4J03A 1KLNA 3PO5A 1NK0A 3RRHA 3ZDDA 4IR9A 4I29A 4F4WA 2Y9UA 2H3QA 5H2FU 4MFFA 3ONNA 3KHGA 4RT2A 3SMVA 9ICJA 5A0LA 5ALSA 4C8LA 4Q8FA 2F1IA 5HP4A 1F5SA 8ICJA 4ECTA 4QZIA 7ICQA 3UM9A 3N4MB 2AJQA 2NO4A 4KX5A 4O3QA 1X9SA 4ECZA 5ALJA 3N97B 2QB0A 3QU7A 3OHBA 5J2FA 2OEHA 3FAHA 1BPYA 4F3OA 2W43A 2CXYA 3GQCA 1S0NA 3BQ2A 1OXJA 4LJXA 1LV5A 2EZXA 4QIWC 3MR3A 3WK4A 2VANA 2E1EA 1ZQFA 2PMZC 5DDMA 4Y2VA 4MEYA 3T5KA 4O3PA 1QTMA 1HUOA 5DB7A 2OM6A 4RQ6A 3RF9A 5HHIA 1P7DA 3ISBA 3C21A 3KOOA 3SYZA 7ICSA 1RZTA 4KMUA 4DFKA 5J2EA 4TUQA 8ICZA 1L6NA 3EYZA 5L1LA 2F2AB 4CRXA 2JR5A 4YXJA 2KEYA 3SR6A 1Z00B 4PGQA 1QQ6A 5AM0A 5HMLA 5KG7A 3IDWA 3D6JA 2BGWA 4DCCA 5J2GA 4RQ5A 9ICGA 4EX7A 2Q4TA 1KTQA 4KLLA 1XSPA 4C0ZA 1AQ6A 2K4IA 5ALGA 3UMBA 3G6XA 2PI5A 3OGUA 5AKLA 1K1SA 4BDPA 1UT5A 1N5XA 5L1IA 1N60A 5ALPA 2W7PA 2LM4A 3TFSA 4FZLA 5AHXA 1L8LA 4RUAA 3CP8A 4YP3A 9ICOA 4GIBA 2K89A 1N48A 4BXOB 2R8JA 1VJ5A 1BPXA 3SAFA 3ZD8A 1Q8KA 8ICNA 4F93B 3GIKA 4J9PA 5DGBA 3H4DA 1L3VA 5HR6A 1JRPA 5EWEA 2ZXIA 3HJEA
chains in the Genus database with same CATH topology
2LM4A 1X6JA 2JR5A 1X6IA 1PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM4 A;  1X6J A;  2JR5 A;  1X6I A;  1PUZ A; 
#chains in the Genus database with same CATH topology
 3MDC A;  2KHQ A;  3AUO A;  5KL1 B;  3THV A;  3BS7 A;  1IIP A;  3NTU A;  4OD0 A;  5ALO A;  7ICV A;  4CF5 A;  3EPI A;  1K1Q A;  9ICB A;  2R8I A;  4EX6 A;  4EYH B;  2NRT A;  4O5C A;  2E3T A;  2K4P A;  2D6F C;  2H3Z A;  3GIJ A;  4QZA A;  4BXO A;  5CP2 A;  5DQH A;  4DSF A;  5GTH U;  3M7D A;  4O3S A;  1ZRN A;  4Y2R A;  7ICK A;  9ICT A;  5IIL A;  2K8B B;  3TI0 A;  3H8J A;  4J9S A;  3OSP A;  5L1J A;  3QZ7 A;  1LB2 B;  1TKD A;  4FS2 A;  2RRD A;  9ICK A;  4UAT A;  3TFR A;  3PX0 A;  2FLL A;  2XID A;  3RRG A;  4O3M A;  4JWM A;  4NWI A;  2Z7J A;  4XUS A;  2KZZ A;  1T4G A;  3JPO A;  5DB6 A;  1FEZ A;  3AM9 A;  4J9K A;  5CR0 A;  1ZQB A;  4GXK A;  1Q46 A;  5KFD A;  3RTV A;  1D8B A;  3UMG A;  4J9Q A;  7ICU A;  3WU2 U;  2YTU A;  4X5V A;  4K4G A;  4KN4 A;  5ALN A;  4C8N A;  4Q8E A;  4M0A A;  3EZ5 A;  4JWN A;  9ICA A;  2VJ5 A;  1ZQE A;  3C1Z A;  4B9M A;  4O3R A;  4LVS A;  8ICX A;  4RQN A;  2A1A A;  5ALH A;  4QW8 A;  4UB5 A;  4R66 A;  2JH1 A;  7ICM A;  5L1M A;  5EOZ A;  3ETL A;  4M9J A;  5ALI A;  3M9M B;  8ICY A;  4BX9 C;  2XI9 A;  1UPH A;  3KKA A;  5ALR A;  1D9F A;  5III A;  2HHU A;  2UVR A;  2DPJ A;  3C2L A;  3T5H A;  3L4P A;  2QAR B;  1HEK A;  1NNL A;  4NM1 A;  4O0I A;  4KX3 A;  2LI6 A;  2HBM A;  4M04 A;  3RJF A;  1B22 A;  5AKK A;  3BQ7 A;  4KLT A;  4XQ8 A;  2DGZ A;  4C4S A;  2F77 X;  1SL1 A;  2BCR A;  1YZ7 A;  1Z1V A;  2XGQ A;  3M6Z A;  1QH9 A;  2LHT A;  4Z6C A;  4EEN A;  4J9O A;  3U26 A;  4B9L A;  2KFZ A;  1NJZ A;  2F1H A;  3I76 A;  4ED8 A;  2P35 A;  1SV0 C;  3WKA A;  2PKE A;  1LKY B;  2W3S A;  1UT8 A;  2NRX A;  1RXV A;  1DRG A;  1U48 A;  3MC1 A;  2ASL A;  3MGH A;  5L9X A;  2K60 A;  3WKB A;  1DK2 A;  4Y2Y A;  5ALZ A;  5KL8 B;  1MN8 A;  2PXI A;  5G5G A;  3M8R A;  4KLQ A;  2WF6 A;  4M9H A;  1BPZ A;  4PGX A;  1Z1B A;  4YQW A;  1ZQA A;  4Z6D A;  2ZJ8 A;  2BR0 A;  4DF8 A;  2I1Q A;  1Z4O A;  5CWR A;  5AIC A;  2JEG A;  4DSL A;  3JPR A;  2WAQ C;  8ICP A;  5CA7 A;  2ZTD A;  1NZB A;  1MA7 A;  7ICH A;  5AI0 A;  5DKW A;  3MR2 A;  1ZJN A;  5ALM A;  5AK3 A;  4F4X A;  2F44 A;  2DF4 B;  1N56 A;  1BGX T;  4QJF B;  4UAR A;  4RUC A;  1ZRM A;  4RQ2 A;  3OSN A;  4I2D A;  3KTQ A;  5AKI A;  3QU5 A;  4MF8 A;  1QQ5 A;  7ICJ A;  3B9J A;  4UBC A;  7ICR A;  4RQ0 A;  2AGP A;  5F3X B;  2DBY A;  3PW2 A;  1JX4 A;  2K4E A;  3Q8S B;  1T94 A;  1FFV A;  4PHA A;  3HX0 A;  2GO7 A;  5HR7 A;  4P0P A;  2G07 A;  2M0N A;  1QLN A;  1VLB A;  1IXR A;  3NRW A;  5ALD A;  1TAM A;  3HRD D;  3EW9 A;  4B9U A;  3ZD9 A;  2FLP A;  2VIX A;  4YD2 A;  9ICF A;  3MAB A;  5AKE A;  1MQ3 A;  5KFU A;  5ALK A;  4NM2 A;  9ICL A;  5C5J A;  1S0M A;  4ECU A;  3MDA A;  2JRZ A;  1S77 D;  4RPY A;  5AI4 A;  4JV2 A;  4RNM A;  4ED3 A;  4KIT B;  3AMZ A;  4M47 A;  1ZD3 A;  2LYH A;  2WF7 A;  4I2J A;  5KT5 A;  3L3F X;  4RQ4 A;  1SKR A;  2HBL A;  5T14 A;  1TK8 A;  3SAG A;  4FBU A;  4FS1 A;  4IRC A;  4ZOH C;  5J0T A;  3NVY A;  5J0U A;  2WTF A;  1X6J A;  1A6S A;  4QNL A;  1ZQD A;  4KLJ A;  2XCP A;  1NK6 A;  5AI6 A;  4DL6 A;  9ICN A;  2BDP A;  2PFO A;  1ZQI A;  2FMP A;  5KFJ A;  3WKE A;  3F2C A;  8ICH A;  3NS1 A;  4FO6 A;  4RU9 A;  3UPQ A;  1B0X A;  5KFS A;  1ZQO A;  1FO4 A;  4O3O A;  3LWL A;  1X9M A;  3PR4 A;  2YY6 A;  1TV9 A;  3T3F A;  4PHD A;  4DOC A;  5AM3 A;  1JN3 A;  3SV4 A;  3QE9 Y;  1KRP A;  5ALX A;  1U47 A;  3V7J A;  1PVR A;  2OWO A;  3Q8M A;  1XNS A;  3ORY A;  2RHF A;  5KG5 A;  4TUR A;  2XY7 A;  3T79 A;  2W8K A;  4DQR A;  8ICO A;  4DFP A;  5C0Y A;  2W9A A;  1JI7 A;  4K4H A;  1N2X A;  3TAC B;  1SV4 A;  2V4R A;  2W7O A;  4Q44 A;  2CRX A;  1DGJ A;  2LBO A;  4EZ6 A;  2PMZ F;  3TAD A;  2ZG6 A;  3QX7 A;  5AKG A;  4TQR A;  2EAN A;  1Z3E B;  1XSL A;  2HHW A;  3WK5 A;  2IA6 A;  4Z6E A;  1UA1 A;  5ALT A;  5D46 A;  4A8E A;  5EE3 A;  1ZQ1 C;  4DQI A;  3GII A;  5KFE A;  2C2R A;  4ED7 A;  1ZQJ A;  4ELV A;  1QQ7 A;  3PX6 A;  3N7R C;  4QZG A;  4NY8 A;  4DFJ A;  2Y9T A;  3BQ0 A;  5KFY A;  9ICH A;  4AP9 A;  7ICG A;  7ICO A;  1ZJM A;  1L7M A;  7ICE A;  2R8H A;  3C2M A;  4FE3 A;  2NRW A;  3WK8 A;  4ELT A;  5JTI A;  3ICX A;  3CRX A;  2QKQ A;  5KFW A;  1L7N A;  5EWG A;  2DUY A;  5AM2 A;  2HHT A;  3NVZ A;  4UB3 A;  2LKY A;  3K75 D;  3AEV A;  2DFL A;  2F1J A;  2FI1 A;  3HWT A;  2VJ4 A;  3F5A A;  1HJP A;  4B9S A;  4FZM A;  3GV5 B;  1XSN A;  2R18 A;  3QUC A;  3Q8Q B;  1TAQ A;  5BOL A;  2C2D A;  1IG6 A;  3SEI A;  4F4Z A;  1ZQH A;  3BDP A;  2IOF A;  1KSP A;  2YMP A;  4OJ6 A;  4DFM A;  1NJX A;  3V7K A;  2BPC A;  3GU3 A;  5HNK A;  4F5R A;  4IS7 A;  3PNC A;  2WB1 C;  3AN1 A;  5KNI A;  2JMG A;  1ZYQ A;  4C7Z A;  1WCN A;  3C1Y A;  1NK8 A;  5ALU A;  2LM1 A;  3IG8 A;  2FDR A;  1F44 A;  1JXE A;  2DQN B;  2RLT A;  3VC8 A;  4NJ8 A;  2ZJA A;  4F4K A;  4KLU A;  2YQE A;  4RT3 A;  3MGI A;  4I2H A;  5J8Y C;  5KFN A;  2YML A;  3D2S A;  3BZK A;  3UQ0 A;  1NZP A;  4ED1 A;  2VA3 A;  4DOA A;  1B43 A;  4YMN A;  5KTQ A;  2JEI A;  4US9 A;  1WCL A;  4Q45 A;  4R64 A;  1X9W A;  2ZTE A;  4IQT A;  2O6K A;  4G3I A;  3RH4 A;  1ARO P;  4QWA A;  3RBD A;  3ISC A;  4QWE A;  1IM4 A;  4NLB A;  4KLF A;  4YCX A;  3S6J A;  4DSK A;  4QZF A;  3OJS A;  3K1Z A;  3PVX A;  5KFL A;  1ZQR A;  5HMM A;  2UVV A;  2LYB A;  4UW9 A;  2WF9 A;  3HKZ F;  2VA8 A;  2VA2 A;  1SL2 A;  4PH5 A;  1ZD2 P;  2QB1 A;  4RQM A;  1L3T A;  1Y88 A;  8ICB A;  2K8C B;  2AU0 A;  5E79 U;  5DQG A;  2BCV A;  2JZB A;  5KT3 A;  5AIB A;  2KV2 A;  3RB4 A;  5DDY A;  4DSI A;  4F2R A;  1JMS A;  3Q8K A;  1KW4 A;  4J9L A;  3IHQ B;  2W11 A;  4GC6 A;  3H40 A;  1J2N A;  4RQ1 A;  1SZH A;  3HT3 A;  8ICS A;  2GLE A;  4OJP A;  2D8C A;  1KBU A;  1C7Y A;  9ICU A;  2XY6 A;  4IQV A;  5IIM A;  3D2Q A;  5JUM A;  1FFU A;  2VKQ A;  3H4B A;  1NK5 A;  9ICP A;  3EUB 2;  5J0S A;  4P2H A;  1N63 A;  5J2J A;  2MA1 A;  4OJ5 A;  1PK1 A;  4Y2X A;  2ZUD A;  5AI9 A;  1YZ6 A;  2DPI A;  2IOF K;  1PK3 A;  3B0X A;  2KIC A;  3ISD A;  3OTQ A;  2HSZ A;  4F71 A;  2F8K A;  3EWA A;  3JPQ A;  4Y2S A;  1V9P A;  2M9N A;  5F9N A;  1Q3V A;  3BZC A;  5CB1 A;  5KT6 A;  3TQ1 A;  4QWD A;  3QXG A;  4YXM A;  4Y2Q A;  4XA5 A;  2ODG A;  2XO7 A;  1KKX A;  3H8S A;  5AKH A;  4I27 A;  3C23 A;  4C8K A;  5DLG A;  3CW2 C;  8ICT A;  2R8K A;  2KZM A;  4RQ8 A;  4KLG A;  2N1R A;  1WWU A;  4F5O A;  3N7P D;  2LYA A;  9ICQ A;  4P0Q A;  3GV8 B;  4HYK A;  2ZUC A;  4IC9 A;  2B21 A;  2ISP A;  2E8P A;  3IP4 B;  5KG4 A;  4OCZ A;  1KDH A;  2HHQ A;  1J2M A;  2AHO B;  2DKX A;  2HHV A;  3F2B A;  1D8Y A;  2ZIU B;  4C8O A;  2AH5 A;  1U9L A;  5GTI U;  2FMS A;  2EDU A;  2IHN A;  7ICI A;  8ICM A;  2OHF A;  3WK6 A;  1WWV A;  1ZXI A;  4US8 A;  3PSF A;  2A19 A;  2WHE A;  2HVI A;  1HIW A;  3M1Y A;  4EBE A;  4R8U A;  2IOH A;  1A77 A;  1ZQZ A;  5J0O A;  2J6T A;  4QIW F;  3V7L A;  8ICC A;  2KSO B;  4DLE A;  2AQ0 A;  1L7O A;  5ALW A;  1RM6 C;  4RZR A;  5KAF U;  2ZUB A;  4DSJ A;  5IIN A;  1ZET A;  3A0B U;  2KZ3 A;  3KD3 A;  5L1K A;  5KFV A;  4Y2U A;  5KFT A;  1BNP A;  3MFH A;  1X66 A;  4QZ8 A;  3TKA A;  1N5W A;  8ICE A;  3RAX A;  4KLD A;  5J2H A;  1M6Y A;  2EQY A;  3WK7 A;  3F2D A;  4MEX A;  9ICM A;  4NL9 C;  3PW0 A;  4ECV A;  4PHE A;  4UAY A;  1MC8 A;  2B6G A;  2OXO A;  2OYY A;  9ICI A;  4PHP A;  2HBK A;  2G06 A;  2RDI A;  4DOB A;  5DBC A;  4EEK A;  4P4P A;  3TAP A;  2JV3 A;  5AM1 A;  4NV0 A;  3QUQ A;  2EZZ A;  1T8E A;  7ICN A;  4F8R A;  3KKA C;  8ICA A;  1YT3 A;  1V38 A;  4GXJ A;  3M8S A;  1ZQP A;  1A0P A;  3WKC A;  2KN7 A;  4M9N A;  2W9C B;  1JRO A;  4Y2P A;  4FZN A;  4MF2 A;  4O3N A;  3QNM A;  3Q8R B;  2DWQ A;  2QLT A;  4JK1 A;  1TVA A;  4ECQ A;  2WFA A;  2MSN A;  4ECY A;  3UXP A;  4F92 B;  2Y0S F;  1S8O A;  2HMX A;  5KFH A;  1ZQL A;  2PFP A;  3BJY A;  5EWF A;  4PZN A;  1UHU A;  3B0Y A;  1CUK A;  2C22 A;  5D4B A;  3KHL A;  4KTQ A;  1TK0 A;  4NLZ A;  5J0R A;  1ZQS A;  5AI8 A;  3ZDC A;  1COO A;  2H5X A;  3ZDA A;  2YX8 A;  4F4Y A;  4ECW A;  3RJE A;  1ZQN A;  2BQ3 A;  3SQI A;  4YMO A;  1O08 A;  4B6J A;  4IRK A;  2YN4 A;  3HP6 A;  2ALZ A;  3BS5 B;  1PK1 B;  4GFJ A;  1X6I A;  4P4M A;  1SKW A;  8ICI A;  1NK4 A;  5AKX A;  3C5G A;  3O0F A;  3PV8 A;  5DBB A;  4R65 A;  2YB1 A;  5KFM A;  2ZIX A;  4RPZ A;  2ZJ5 A;  2BHN A;  2K4H A;  4P4O A;  3V6J A;  4B9T A;  1RQN A;  2I5H A;  4I2E A;  3V6H A;  3KHH A;  4GLX A;  3RB0 A;  1O03 A;  4PGY A;  5CJ7 A;  3PW7 A;  3LDA A;  7ICT A;  3C28 A;  5J2C A;  3QYP A;  1U4B A;  2G5H B;  1LKY A;  1BPD A;  4UAZ A;  4C4R A;  3LVV A;  3UMC A;  4KLS A;  2UVU A;  2OCE A;  2KJ9 A;  5AK5 A;  4UQG A;  2AGO A;  1S10 A;  4QWB A;  2FPM A;  2NYV A;  4JV0 A;  4LZD A;  3RB3 A;  1KFT A;  1NKB A;  2KE7 A;  2LPE A;  5CHG A;  2FPK A;  2A3V A;  5KFA A;  2EZY A;  3LK9 A;  1COK A;  5EE1 A;  1RXW A;  1OUQ A;  1XO1 A;  2W03 A;  1XC9 A;  2QAR A;  3TAR A;  3H7I A;  3NVW A;  4YR3 A;  5IIJ A;  4YN4 A;  1CRX A;  3RJJ A;  5J2D A;  3E58 A;  2HW3 A;  1URJ A;  2KVS A;  2CPR A;  3I28 A;  1BPE A;  4YD1 A;  4DWI A;  4I2B A;  1KN5 A;  2MUT A;  4QZH A;  3ED5 A;  3H0R B;  3KFU F;  1NK9 A;  3RR8 A;  4UAU A;  4CGZ A;  5J2B A;  1RDF A;  5AIA A;  2W9B A;  3MFI A;  4RQ7 A;  1NKC A;  4DQQ A;  4I2F A;  5DB9 A;  2ASD A;  3UXO A;  3RAQ A;  3AQF A;  4BWJ A;  3V6K A;  2MAX A;  4ACO A;  5ALV A;  4IL6 U;  3MR6 A;  4EBC A;  4DF4 A;  3IG5 A;  3T5L A;  4DLG A;  3L5K A;  4EBD A;  4M6W B;  4FFD A;  1SWW A;  3K1R B;  2NRZ A;  1FIQ A;  3UQ2 A;  1BNO A;  4DL3 A;  2IBK A;  4Q43 A;  3NGD A;  5K4L A;  1T3Q A;  3QUB A;  3GV7 B;  3KHR A;  4XRH A;  2FLN A;  2BCQ A;  2GOL A;  4BUG A;  2A1J A;  4UAV A;  4LZG A;  2E5S A;  1PVP A;  4CF3 A;  2WF8 A;  2GWS A;  1UQV A;  4I2I A;  5ALQ A;  4KLH A;  1K5O A;  3QU9 A;  2G5I B;  3KZX A;  3GIL A;  1B4F A;  3UXN A;  3ALR A;  3MGV A;  3G6Y A;  4NLN A;  3RH5 A;  1U49 A;  1ZD5 A;  1ZQT A;  3QU4 A;  3NVV A;  2BPF A;  4UAS A;  2JXJ A;  2QB0 B;  4J9M A;  4DL5 A;  1ZQG A;  2BCU A;  5KFQ A;  4Y2T A;  2MRL A;  2MU2 A;  5D49 A;  1WG8 A;  1SGG A;  3AU6 A;  5KFG A;  5KFO A;  3BQ1 A;  4QZ9 A;  3M9O B;  4FBT A;  3PST A;  2KIW A;  3NAS A;  2LMR A;  1PUZ A;  1UCV A;  2IMW P;  2W9B B;  2P66 A;  4ZH4 A;  3KZI U;  1IV8 A;  4ECX A;  1SXD A;  7ICP A;  1DK3 A;  2BPG A;  1TFR A;  4E0D A;  2DKZ A;  1SXE A;  2I9G A;  9ICV A;  3SEN A;  2EAM A;  5IIO A;  4CDG A;  4I2G A;  3DDH A;  2KMD A;  5CRX A;  5KAI U;  4KMO B;  4DEZ A;  2E8M A;  2W9M A;  1DGS A;  4F50 A;  1N62 A;  5KT4 A;  3SI8 A;  2KKP A;  4RQ3 A;  3QEA Z;  2HOQ A;  2K8A A;  5DGA A;  1ZQU A;  3RH6 A;  1UA0 A;  4OJO A;  4G9B A;  4NLG A;  4DL4 A;  2H3F A;  2YB4 A;  3IN5 A;  5KG1 A;  1WUD A;  3SAH A;  4UB4 A;  4U6P A;  2MUT B;  1ZQQ A;  2P6R A;  4I2C A;  5J2K A;  3HIL A;  4Z6F A;  1NI3 A;  5KT2 A;  4EZ9 A;  2BDU A;  2J6U A;  3ZDB A;  4BWM A;  4BGD A;  1Z19 A;  1KL9 A;  2ZXH A;  1X9X A;  1CEZ A;  2E1F A;  2ASJ A;  4ED2 A;  2JHD A;  4DS5 A;  4QZD A;  4TUP A;  2KSO A;  3F5E A;  5JRT A;  1RYR A;  3OJU A;  4R8U B;  4YR2 A;  5CEH A;  1L5U A;  9ICX A;  3ETR A;  4QZE A;  4PL2 A;  1DOQ A;  2F3N A;  2NV3 A;  2Y1J A;  7ICL A;  2NRV A;  1XS9 D;  3FC4 A;  4CF4 A;  2G09 A;  2EAP A;  2ZIU A;  3MBY A;  2KG5 A;  3PMN A;  3C2K A;  4DL2 A;  5B66 U;  5DLF A;  4J9R A;  2IHM A;  3D2N A;  3E2E A;  2I6X A;  4MFA A;  3MR5 A;  4MFC A;  3LVW A;  4JB3 A;  5KG3 A;  2HBJ A;  4P0P B;  5TIS U;  3V72 A;  4EEY A;  1RPL A;  1XO0 A;  2ESE A;  4OO1 J;  2NO5 A;  8ICQ A;  1ZQV A;  2D3D A;  3RJG A;  2RQ5 A;  3AQE A;  4EEL A;  1N61 A;  1A76 A;  2HVH A;  4K4I A;  4PJ0 U;  2XGP A;  3QZ8 A;  4ED0 A;  1QSL A;  3PSP A;  3RR7 A;  1VDV A;  3E0F A;  4DSE A;  2WAQ F;  1SL0 A;  4NLC A;  3F53 A;  1NJW A;  1F0M A;  1ZOL A;  4NL9 A;  3H8M A;  3PW4 A;  1SIJ A;  5ALY A;  5AI5 A;  4QZC A;  5KFK A;  3RB6 A;  4KLM A;  4F5Q A;  1T7P A;  3DEE A;  2C2E A;  5EE0 A;  9ICE A;  3IM1 A;  4AYB F;  5B5E U;  3TAN A;  2YMQ A;  3TAQ A;  2ZIV A;  2V4Q A;  3PW5 A;  1S0O A;  1RYS A;  3QEB Z;  5AKZ A;  4JUZ A;  4PL1 A;  1NOM A;  2ZIW B;  4CCH A;  1SV0 A;  3FDS A;  2AXT U;  5J8Y A;  4ED6 A;  1L8O A;  8ICV A;  1SZP A;  3RJH A;  8ICG A;  5J0P A;  3C5F A;  5DBA A;  1V97 A;  1SKS A;  3PY8 A;  4USA A;  5G5H A;  3QUT A;  2B0C A;  1S76 D;  1GO3 F;  4J9N A;  4CE6 A;  1RYU A;  4I2A A;  5J2I A;  2WF5 A;  3H0L B;  4CNQ A;  1D8L A;  3VCB A;  5KG0 A;  3PX4 A;  3AU2 A;  5ALE A;  2JEJ A;  4R63 A;  1DXS A;  1ED1 A;  4NLK A;  3GIM A;  1JUD A;  3C29 A;  3RBE A;  1MSW D;  4Y2J A;  4QW9 A;  4ICA A;  3RFA A;  3FM9 A;  5AK4 A;  4DQP A;  3JPN A;  5DG7 A;  1PVQ A;  4U7C A;  3Q8P B;  3J81 j;  2HCF A;  1X2I A;  1V85 A;  3M9N B;  1ZQC A;  2W55 A;  1ZQW A;  2F76 X;  2W04 A;  3OHA A;  3JPS A;  2HDO A;  3CNH A;  3K4G A;  5TZV A;  5AKJ A;  1ZQX A;  4M6W A;  2L5Y A;  5BPC A;  1S5L U;  2RP5 A;  5HHH A;  2XY5 A;  4DL7 A;  1ZQK A;  4KLE A;  1C20 A;  5KFX A;  3BQT A;  2J6S A;  2ZTC A;  2EH9 A;  2CN1 A;  3HPO A;  4KN7 A;  4UB1 A;  5KG6 A;  3PR5 B;  2G08 A;  4M9L A;  5JU5 A;  4EYI B;  5KFF A;  4F5N A;  1L3U A;  4I28 A;  2OH2 A;  4F5P A;  4F2S A;  1TK5 A;  5DG8 A;  2PFN A;  2KTQ A;  8ICU A;  5ALF A;  2UVW A;  3HW8 A;  1QCK A;  2PI4 A;  4O9M A;  2KIV A;  4P0Q B;  4WJ3 B;  4YR0 A;  1L3S A;  8ICK A;  2Q0Z X;  4RPX A;  1SWV A;  2KJ5 A;  3H8W A;  4C7Y A;  4TUS A;  2BQR A;  4UBB A;  1NJY A;  4OJL A;  3R9K A;  2E8N A;  1JXL A;  3RJI A;  2AQ4 A;  3WK9 A;  2R8G A;  4BJQ A;  5IIK A;  3A0H U;  5EE9 A;  2RDJ A;  2HOI A;  3JPT A;  3GDX A;  2BCS A;  4UB2 A;  3QU2 A;  4M9G A;  4C8M A;  4ELU A;  2Y0S C;  4HAI A;  3WKD A;  3ZDE A;  2KFN A;  4IRD A;  2DL0 A;  2V9W A;  2ES6 A;  5J2A A;  2KK0 A;  4PPX A;  1S97 A;  2XVT A;  3CYM A;  3PZP A;  4DS4 A;  3G6V A;  4JV1 A;  3M6K A;  1KFD A;  2KHV A;  1J97 A;  4IQU A;  4MHV A;  3SV3 A;  3HKZ C;  2XCA A;  2YMM A;  4RNN A;  2KD1 A;  1QSS A;  5AKY A;  2W54 A;  4O5K A;  3NUQ A;  2ZIX B;  2ZIW A;  4UB8 U;  1KFS A;  3PML A;  2P6U A;  1BVS A;  3AL0 B;  5J0X A;  1NKE A;  2A1J B;  4IQW A;  1XU4 A;  2KNJ A;  3BS5 A;  5DG9 A;  1TAU A;  5ALL A;  5KFC A;  2JZB B;  2FE9 A;  4UAW A;  5J0Q A;  4DO9 A;  7ICF A;  1ZQM A;  4F72 A;  2W9C A;  2H3I A;  4YMM A;  1ZQY A;  1RG6 A;  1LVH A;  4YVZ A;  1X42 A;  1D9D A;  1TE2 A;  2AGQ A;  2GH1 A;  2H3V A;  2BQU A;  2JH7 A;  1OW5 A;  4UB6 U;  2EAO A;  4GC7 A;  2G0A A;  2JEF A;  4YFK A;  3N28 A;  1WYG A;  3PSI A;  2Y1I A;  2XIC A;  4QZB A;  3GZF A;  3FYH A;  1Z00 A;  2FPL A;  5J0Y A;  5KFZ A;  2KVC A;  4RNO A;  4DQS A;  9ICW A;  4ECS A;  1KEJ A;  5KFI A;  2HOF A;  4B9V A;  5KFR A;  3SZ2 A;  4C80 A;  2W3R A;  9ICR A;  1BPB A;  1S9F A;  5DQI A;  1CI4 A;  3PO4 A;  2E8O A;  1L7P A;  3LWM A;  5AM5 A;  1Z4N A;  2ATL A;  4KLO A;  3ZI4 A;  4M2Y A;  2KJ8 A;  2WB1 F;  3SD7 A;  2FMQ A;  9ICS A;  4B9N A;  2JGA A;  5AM4 A;  5KG2 A;  1H38 A;  3KBB A;  2KKV A;  5F9L A;  5KFB A;  5KFP A;  4ECR A;  1JIH A;  1ZD4 A;  2BKE A;  4PZO A;  3LYS A;  4GXI A;  3IRU A;  9ICC A;  4IR1 A;  2C28 A;  1RQL A;  8ICL A;  1U45 A;  2F8L A;  4JMU A;  4O5E A;  4DFD A;  3H0M B;  2HHX A;  1MQ2 A;  3TAD C;  1KQQ A;  5FP0 A;  2XC9 A;  4KLI A;  1QSY A;  3T5J A;  2ZIV B;  1NK7 A;  5KT7 A;  4F91 B;  3GFK B;  1ECW A;  2PFQ A;  4AYB C;  3OPX A;  8ICF A;  5BOM A;  8ICR A;  3Q8L A;  1SB3 C;  5J29 A;  4YG2 A;  1T3N A;  1Q3U A;  2FJ6 A;  3I1Y A;  4C4T A;  1XWL A;  3RJK A;  5J0W A;  2ISO A;  4TQS A;  3JPP A;  2HHS A;  8ICW A;  1S0V A;  2KOB A;  1EXN A;  5DB8 A;  3DV9 A;  2KP7 A;  3IV6 A;  1HUZ A;  2HI0 A;  1JAL A;  1PZN A;  2W8L A;  3NRZ A;  1X40 A;  4NXZ A;  2BZF A;  3N7S C;  5AK6 A;  3EPG A;  4QWC A;  4J03 A;  1KLN A;  3PO5 A;  1NK0 A;  3RRH A;  3ZDD A;  4IR9 A;  4I29 A;  4F4W A;  2Y9U A;  2H3Q A;  5H2F U;  4MFF A;  3ONN A;  3KHG A;  4RT2 A;  3SMV A;  9ICJ A;  5A0L A;  5ALS A;  4C8L A;  4Q8F A;  2F1I A;  5HP4 A;  1F5S A;  8ICJ A;  4ECT A;  4QZI A;  7ICQ A;  3UM9 A;  3N4M B;  2AJQ A;  2NO4 A;  4KX5 A;  4O3Q A;  1X9S A;  4ECZ A;  5ALJ A;  3N97 B;  2QB0 A;  3QU7 A;  3OHB A;  5J2F A;  2OEH A;  3FAH A;  1BPY A;  4F3O A;  2W43 A;  2CXY A;  3GQC A;  1S0N A;  3BQ2 A;  1OXJ A;  4LJX A;  1LV5 A;  2EZX A;  4QIW C;  3MR3 A;  3WK4 A;  2VAN A;  2E1E A;  1ZQF A;  2PMZ C;  5DDM A;  4Y2V A;  4MEY A;  3T5K A;  4O3P A;  1QTM A;  1HUO A;  5DB7 A;  2OM6 A;  4RQ6 A;  3RF9 A;  5HHI A;  1P7D A;  3ISB A;  3C21 A;  3KOO A;  3SYZ A;  7ICS A;  1RZT A;  4KMU A;  4DFK A;  5J2E A;  4TUQ A;  8ICZ A;  1L6N A;  3EYZ A;  5L1L A;  2F2A B;  4CRX A;  2JR5 A;  4YXJ A;  2KEY A;  3SR6 A;  1Z00 B;  4PGQ A;  1QQ6 A;  5AM0 A;  5HML A;  5KG7 A;  3IDW A;  3D6J A;  2BGW A;  4DCC A;  5J2G A;  4RQ5 A;  9ICG A;  4EX7 A;  2Q4T A;  1KTQ A;  4KLL A;  1XSP A;  4C0Z A;  1AQ6 A;  2K4I A;  5ALG A;  3UMB A;  3G6X A;  2PI5 A;  3OGU A;  5AKL A;  1K1S A;  4BDP A;  1UT5 A;  1N5X A;  5L1I A;  1N60 A;  5ALP A;  2W7P A;  2LM4 A;  3TFS A;  4FZL A;  5AHX A;  1L8L A;  4RUA A;  3CP8 A;  4YP3 A;  9ICO A;  4GIB A;  2K89 A;  1N48 A;  4BXO B;  2R8J A;  1VJ5 A;  1BPX A;  3SAF A;  3ZD8 A;  1Q8K A;  8ICN A;  4F93 B;  3GIK A;  4J9P A;  5DGB A;  3H4D A;  1L3V A;  5HR6 A;  1JRP A;  5EWE A;  2ZXI A;  3HJE A; 
#chains in the Genus database with same CATH homology
 2LM4 A;  1X6J A;  2JR5 A;  1X6I A;  1PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...