1PUZA

Solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
b'MMVFDDIAKRKIRFQTRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKIRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis reveals a distinct 5-helix bundle.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 20
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1puzA00
2LM4A 1PUZA 2JR5A 1X6JA 1X6IA
chains in the Genus database with same CATH superfamily
2ZIXB 5AKKA 4R8UA 2WF7A 2HHQA 4LVSA 2KEYA 4OD0A 4G9BA 4IS7A 5AHXA 5ALUA 5KT6A 4EELA 2IHMA 3HT3A 4ELTA 4UATA 1ZRMA 4JV1A 2FDRA 2NRTA 5KFTA 1X42A 3NVWA 3PW0A 2OEHA 1NK9A 4I2CA 1DXSA 4Y2VA 3D2SA 2F77X 3RB6A 1Z1VA 1KDHA 3RH5A 2WF8A 9ICPA 4RUAA 1LV5A 1Z00A 2IHNA 4PPXA 5K4LA 4DL4A 4IQVA 5F3XB 4O5EA 2AGOA 3TQ1A 9ICXA 2KNJA 3G6YA 5DGBA 4UBCA 2C2DA 3PX6A 2YMLA 1DRGA 9ICHA 3AL0B 1RQLA 3H8SA 4X5VA 3PW4A 1S5LU 5KG0A 5ALQA 3GU3A 4ACOA 4I2IA 4RUCA 1ZQCA 4Y2RA 4BUGA 2AJQA 3M7DA 3TAQA 4ECQA 2HMXA 3BS7A 4IQTA 4ED2A 2KSOA 3WKEA 4F4WA 3G6VA 8ICLA 5J8YC 2AU0A 2YN4A 1PVPA 4C8NA 5D46A 1A77A 3I28A 1B22A 4F4ZA 4YQWA 1JXLA 5J0RA 1ZQVA 1UCVA 3NRWA 1PVQA 4JV2A 7ICRA 4YFKA 2R8IA 3QNMA 3QEAZ 3Q8RB 5JRTA 4I2HA 5ALGA 1KEJA 2KVSA 2HVHA 3DEEA 3SAFA 3ONNA 4J9MA 1UHUA 3K1RB 3EUB2 3IHQB 4ED7A 7ICSA 3H0LB 3AEVA 3CW2C 3H7IA 3QE9Y 3KKAC 2JZBB 3ZD8A 3FDSA 1TAUA 4KLIA 3HX0A 4UAVA 2DPJA 4PGXA 4UB4A 4I2JA 1A6SA 4GXKA 3C2LA 3M9MB 5KAFU 3H4DA 5DB8A 2BCSA 3RRGA 1N63A 3K1ZA 2JXJA 2Y9UA 2FMSA 4JWNA 2RDIA 4DSJA 4DLGA 3WK4A 3N97B 1NKBA 5HR6A 2Y1JA 2NRWA 3A0HU 2J6TA 2PXIA 1F44A 1X9SA 5GTHU 2PMZF 1OUQA 4YMNA 4O9MA 3DV9A 2A1JB 5KFWA 5B66U 1JX4A 5CJ7A 1H38A 4UB3A 2LHTA 4F5RA 2F1IA 5T14A 3GV5B 3C1ZA 3MDCA 2D6FC 2DUYA 1AQ6A 4AP9A 4O5CA 7ICPA 2KHQA 1L8OA 4C8MA 4NM1A 4PGYA 5EE0A 3F2BA 5DG7A 2LM1A 4PH5A 1NK6A 1NK0A 1NJYA 2EQYA 2H3ZA 4UW9A 5AIAA 4JWMA 1MQ2A 3HRDD 7ICQA 4ECSA 3L4PA 4UASA 3UXPA 3HWTA 5AKHA 4WJ3B 2VIXA 1P7DA 4P0PA 1JN3A 1SZHA 4YR2A 4ECRA 3OSNA 4C4TA 3UXNA 3GIMA 5CA7A 4LZGA 3QXGA 2FPKA 4RQ2A 1FEZA 2HDOA 4QZGA 4UAUA 5DDMA 3SR6A 1WCNA 1Z4NA 1UT8A 4J9SA 3E0FA 1Z19A 4OJ6A 4F50A 3D2QA 4CGZA 2V4QA 1RYSA 1SL0A 9ICJA 5KFXA 2RDJA 3KD3A 1NJZA 5KG1A 1NK4A 2LMRA 1JROA 2MU2A 1L8LA 4ICAA 5AI6A 4ED6A 4R64A 4B9TA 3ZDDA 4PHAA 1ZQWA 4OO1J 2Y1IA 5KFVA 5BOMA 3TARA 5KTQA 2JEGA 2YX8A 7ICEA 2EZYA 1QLNA 2ZIXA 2HOIA 4UARA 3PX4A 4BJQA 9ICGA 3ICXA 2IBKA 3CRXA 4QWAA 3B0YA 5C0YA 3QUCA 2Z7JA 2JGAA 4TQRA 3BQ2A 2HI0A 5DGAA 1KQQA 3GZFA 3ISDA 2XVTA 3UMCA 4FBTA 3EPIA 4DOCA 5JU5A 3M1YA 1KLNA 5KT5A 1QSLA 1XC9A 2MSNA 3I1YA 3ISCA 2G07A 1RG6A 3MDAA 2GLEA 2CN1A 1XS9D 3HILA 4ECZA 4ECWA 2W7PA 2W7OA 4M47A 2Y0SC 3SEIA 1RPLA 4TURA 2KTQA 4Y2YA 5DQIA 3HP6A 5ALLA 4C7ZA 3QU2A 4JK1A 2I1QA 2OM6A 2E8OA 4M6WA 5J0PA 2BCVA 3PSTA 3PSIA 2K89A 5AM0A 4CDGA 4YMOA 4DQIA 2C28A 5ALFA 2YMPA 2UVWA 4U6PA 3BQ7A 8ICEA 1L6NA 3Q8MA 9ICWA 1J97A 1ZQBA 1NNLA 1Z00B 5J2GA 2ZJ8A 3UXOA 4DOBA 3TACB 4MF2A 1U49A 1D8BA 4I27A 4PHPA 1M6YA 3QU4A 3TAPA 4DL2A 1V9PA 3H8WA 2PKEA 4Z6CA 5H2FU 1ECWA 1L3UA 1URJA 9ICUA 1J2NA 1TV9A 4EZ9A 2KSOB 1WCLA 4M9LA 4NY8A 1SKSA 2JH7A 4F91B 4RT3A 4C80A 8ICPA 3ED5A 1U45A 2DQNB 1UA1A 2RHFA 5J29A 5A0LA 5DB9A 9ICNA 3UMGA 4I2FA 4ELVA 2JRZA 2LYBA 4FFDA 1L7PA 4QZEA 7ICMA 4HAIA 1V38A 2F1HA 4I28A 2ZJ5A 1D8YA 4RQ0A 3UPQA 4DS5A 1RYUA 2B6GA 2A1JA 1Q3UA 1MSWD 2KJ9A 1CUKA 5KFJA 2ZIUB 5B5EU 4C8LA 4RPZA 1N60A 1BPYA 2RP5A 1LVHA 4LJXA 2EANA 3WK9A 3RJGA 3SV4A 5BOLA 3TADA 1KW4A 1ZQNA 3RAXA 4UB5A 3PO4A 3IDWA 3RJEA 9ICAA 3N7PD 1C7YA 1MA7A 4QWCA 2K8BB 5KT2A 2ZUBA 2W9CB 2A1AA 3QYPA 5J0YA 2K8AA 5G5HA 4US9A 1K5OA 2YTUA 5J0QA 3AQEA 2J6SA 4EYIB 3L5KA 9ICQA 4NLBA 4PHDA 2DFLA 2BPFA 3SI8A 4XQ8A 4Y2UA 1B43A 5AI8A 2GH1A 3C28A 1ZQSA 2XIDA 4IRDA 2MUTA 5ALMA 4RU9A 2KOBA 2P6UA 3S6JA 4OCZA 1BNOA 4DEZA 3SV3A 4J9NA 2W54A 1N61A 2G08A 3ALRA 3A0BU 5AKIA 2DBYA 3QZ8A 2LPEA 9ICMA 4KLTA 4P2HA 3U26A 4FZNA 5J0SA 1Q8KA 2CPRA 3PO5A 3PMLA 4JB3A 5AM5A 3F5EA 4QW9A 4Q44A 4PZOA 2JEFA 3GV8B 4OJLA 2BQUA 5KFHA 3R9KA 5AI0A 4ZH4A 1NK8A 3KHHA 5E79U 4AYBC 3C1YA 1N2XA 4DQRA 2C2RA 8ICBA 5HP4A 2E8NA 3HKZC 4FO6A 2BDUA 1BPXA 4MEXA 4EX6A 4YD1A 1SV0A 5J2FA 2F76X 4IC9A 1BNPA 3SAHA 1IXRA 9ICTA 5FP0A 3Q8SB 4M9JA 4F93B 5ALJA 3ETRA 2IOFK 2MAXA 1XO0A 5EE1A 4Q8EA 5DQHA 1X9XA 2HVIA 1IV8A 5KFLA 4RQ8A 1L3TA 3LYSA 4KX3A 2FLNA 1U4BA 4Z6DA 1RQNA 2KE7A 4KLJA 3HJEA 5HHIA 5KFCA 5D4BA 4YXMA 1TAQA 4KMUA 2VA2A 5DQGA 1T4GA 2OYYA 1NI3A 5ALVA 3AMZA 2W11A 2KP7A 3PMNA 7ICVA 3KZXA 4PL2A 3K4GA 8ICSA 2FI1A 4DS4A 4PHEA 3F5AA 2LM4A 1EXNA 1ZQAA 1D9DA 2EDUA 3C5GA 3N4MB 4YN4A 4Q45A 5IIJA 2HBKA 1XO1A 4DCCA 4J9QA 3SMVA 5ALKA 1XSLA 3NS1A 2NO5A 4EBCA 5AK3A 1FFVA 4BX9C 4F5OA 5J0OA 3LDAA 1BVSA 8ICQA 5JUMA 4QIWC 4DLEA 4CRXA 2ZTEA 3M9NB 1SB3C 3SAGA 4A8EA 1SL1A 3NUQA 4C0ZA 2HBJA 8ICOA 4M6WB 3ZDAA 4GC6A 4NWIA 4F5QA 4F72A 1ZQOA 4YG2A 5AK4A 3QUTA 1O08A 3F2DA 4J9RA 5AICA 1K1QA 4FS1A 1O03A 2WTFA 5J2AA 1ED1A 3CNHA 3RJFA 4E0DA 1VLBA 2WF9A 4F4XA 3MR3A 4O3PA 4JMUA 7ICFA 2JEIA 1JRPA 2KV2A 4NLNA 3PSFA 2FPMA 4I29A 2QKQA 1ZQMA 5DBBA 2J6UA 5L1MA 4EZ6A 5DG9A 2ZIUA 4PL1A 3RF9A 5GTIU 8ICIA 2R8JA 3RJJA 2QLTA 2R18A 4EX7A 1CEZA 1L7OA 2WFAA 1RXVA 4UAYA 2QB0B 3KOOA 2E3TA 1L3VA 2K8CB 4KN7A 3WU2U 3MFHA 2B0CA 4NXZA 4DWIA 1JI7A 4OJOA 2W9CA 2WHEA 1ZD2P 5DLGA 4C8OA 1WWVA 4RZRA 2I6XA 4DFKA 4ELUA 1PK3A 3MFIA 3RB3A 2YMMA 5ALOA 4YCXA 2KIVA 1RM6C 2FJ6A 2WAQC 4JUZA 3RH4A 1B4FA 3KZIU 2W8LA 1SWWA 4IR9A 4BDPA 5KAIU 3QUBA 4BWJA 5IIKA 4DL7A 3V6KA 3D6JA 3JPQA 4DSKA 2YQEA 3J81j 2LBOA 2C2EA 1ZQPA 5AM2A 5DLFA 2GOLA 3MR6A 4ECVA 3PVXA 2KD1A 5DBAA 2XGPA 2E5SA 2UVRA 1ZQHA 8ICCA 2ESEA 2GO7A 3QEBZ 2W9BA 4RPXA 2RQ5A 3GDXA 5J2IA 4RNMA 3AQFA 5AM4A 1JALA 4RNNA 2PFQA 3Q8QB 4P0QB 1BPDA 5IIOA 3QUQA 5KFAA 5KFSA 4CF4A 2OHFA 1QTMA 4M9NA 3PZPA 4J9OA 3FYHA 3KHGA 3CP8A 2MUTB 4BWMA 3ZDCA 2BZFA 2KHVA 2LYHA 3JPNA 4M9GA 8ICXA 1LB2B 1QQ7A 4MFFA 3V6HA 3PW2A 3MBYA 2P66A 2HHUA 2JHDA 2H3VA 2YB4A 5AKJA 1ZQQA 1UT5A 1DOQA 1YT3A 5G5GA 8ICYA 1Y88A 3N7SC 1ZETA 4O3RA 5J2DA 3B9JA 4UBBA 3TI0A 1SGGA 4RQ4A 2EAPA 1XNSA 2AXTU 2KMDA 1J2MA 4Y2PA 1VJ5A 1MC8A 5KG2A 2H3QA 3RR7A 4QNLA 2F3NA 3WKDA 1S8OA 3HKZF 5AKZA 4UB1A 1JMSA 4TUSA 3IV6A 3ORYA 2UVVA 1SXDA 4I2EA 4K4HA 1RYRA 2HBMA 2KKVA 5ALTA 5KG4A 5J2KA 2EH9A 3GV7B 5KT7A 3UMBA 1ZQRA 3KTQA 2XO7A 2ODGA 3OGUA 4MEYA 2HHXA 2KVCA 5EE9A 3G6XA 3NVZA 1JIHA 3ISBA 1ZRNA 1TK0A 1ZJMA 5L1JA 4B9MA 3GIJA 3WKAA 2ZUDA 3MGIA 1BPBA 3HPOA 5J2JA 1D9FA 4J9KA 1U47A 5TZVA 8ICTA 1FFUA 1ZQUA 3GIKA 2FLPA 2ISOA 9ICBA 5J0TA 4DO9A 4Z6EA 1SXEA 2R8KA 3E2EA 2EAMA 4I2BA 3DDHA 1YZ7A 3LVVA 3TKAA 1VDVA 1S77D 3T5JA 1F5SA 1JUDA 4DL5A 4QZ8A 5J2HA 1OW5A 3FM9A 3BDPA 5L1LA 3Q8LA 1QH9A 5KG7A 5KNIA 1DK3A 1IG6A 4ED1A 4TQSA 3C29A 5KFUA 1TFRA 3AU2A 4PJ0U 4DF4A 4Y2XA 4QJFB 4QIWF 1KKXA 5AKEA 2QARA 2NYVA 4KLHA 3PSPA 4ECYA 4B9UA 4P4OA 3RBDA 8ICHA 4J03A 2HHSA 1NOMA 2E1EA 2CXYA 2P6RA 3BJYA 2ISPA 4C8KA 4KLEA 5KFZA 2E1FA 4F2SA 3ZDEA 4RQ5A 9ICFA 8ICAA 1KBUA 4EENA 1ZQLA 7ICHA 5KFKA 4B9LA 3KHRA 1RXWA 3SD7A 3WK8A 4EBDA 1FO4A 1COKA 2DPIA 3EW9A 4RQ6A 4GXJA 1ZQFA 3T3FA 4J9LA 1D8LA 1ZQYA 2BGWA 4F92B 5L9XA 2QB0A 1NKEA 1SV4A 5IIIA 4KN4A 4KLGA 1BPZA 2D3DA 2KZ3A 1KN5A 1KFDA 5EWGA 2AGPA 2RLTA 1KL9A 5EOZA 2W9AA 3OPXA 5CHGA 1L7MA 3M6KA 5AKXA 2ZG6A 2WF5A 4Y2JA 1NK5A 1ZYQA 3WKBA 4O3SA 1OXJA 5ALYA 7ICLA 1ZD3A 1Q46A 3IRUA 1X6IA 4RNOA 5ALSA 2ZXHA 3T5KA 4QWDA 4FZMA 8ICVA 4RPYA 4B6JA 3PY8A 4F8RA 2A19A 2W04A 3TADC 2XY6A 2ZJAA 1XSNA 4ECXA 3H4BA 1Z3EB 3ZD9A 4K4IA 5KFPA 4P4MA 4PGQA 3C2KA 7ICTA 4GLXA 5KFGA 2K60A 2KN7A 2ZUCA 4O0IA 2WAQF 2DF4B 5DB7A 3QU7A 5HNKA 2CRXA 2M0NA 4P0QA 3PX0A 4KLDA 2XGQA 3IG5A 2BKEA 3VCBA 2ZIWB 3SZ2A 4KLMA 2O6KA 3M9OB 4ED0A 2KFNA 3IN5A 1HEKA 4F2RA 4C4SA 4I2GA 1HIWA 3GILA 4DFPA 4IL6U 2HHTA 1CRXA 4QZCA 2D8CA 8ICRA 5JTIA 1WYGA 4DSEA 4ED8A 3V72A 4IQWA 5KG6A 2W9MA 1V85A 4QZ9A 4ECUA 2VANA 4GFJA 1DGSA 5IILA 1SIJA 2W9BB 1QQ6A 3SENA 2HSZA 2PI4A 8ICNA 4UAWA 1ZJNA 3MC1A 4O3QA 5EWFA 3BZKA 2H3FA 1L7NA 4UB2A 3JPRA 4I2AA 2V4RA 5ALPA 3QU9A 2AHOB 2ASDA 1N56A 4YXJA 2I9GA 4CE6A 1QSYA 1SV0C 4QWEA 4GIBA 1SKWA 7ICIA 4R63A 5KFDA 5IIMA 2OWOA 2BCQA 4QZAA 4DL6A 2WB1C 2GWSA 5AKGA 1HUZA 7ICJA 2BDPA 1N62A 5AKLA 4NJ8A 2VKQA 5KT4A 4HYKA 2VA3A 4Q43A 2BQRA 3T79A 2G5IB 3QZ7A 2ATLA 2PFPA 2YMQA 4NL9A 4RQ3A 3RRHA 1S9FA 4QZHA 1LKYA 4NLZA 4DOAA 4IR1A 1Z4OA 1X9WA 1TVAA 5KFQA 1SZPA 4CF5A 1K1SA 2AH5A 1NJWA 2ZIVB 3OHAA 4DL3A 1N5WA 4XRHA 3LWMA 2AGQA 1T94A 3K75D 2IA6A 3JPSA 1PK1A 4IRCA 1S0VA 3IP4B 3AU6A 2EZXA 1KTQA 1X9MA 2YB1A 4QZIA 3QU5A 1L3SA 4KTQA 5CEHA 2KICA 1S76D 4G3IA 2F1JA 2K4EA 2M9NA 1XSPA 5ALHA 3L3FX 5KFNA 2FE9A 5AK6A 3V7KA 2Y0SF 4M0AA 1DGJA 9ICRA 5ALNA 3GQCA 2DWQA 7ICUA 5EE3A 2W55A 2W03A 3BQ1A 4F4YA 1YZ6A 4Y2TA 4F4KA 1ZQTA 1B0XA 9ICCA 2VA8A 1T3QA 2KKPA 1NZPA 2XY5A 1ZQGA 2W8KA 8ICFA 2XCPA 3EYZA 1L5UA 3BS5A 9ICLA 9ICVA 4DSIA 2Y9TA 3OJSA 2H3IA 4CCHA 2F44A 5KFOA 4DFDA 4O5KA 4UB6U 4MFCA 2K4PA 4CF3A 5KL8B 2EAOA 4DFJA 3RJHA 3RBEA 2QARB 1ZOLA 1ZQKA 3RJIA 1TK5A 4F71A 3M8RA 4EBEA 4DSFA 4KMOB 3O0FA 3QX7A 2ZTDA 5J8YA 4KX5A 3KFUF 3UM9A 2PI5A 4C4RA 2ZTCA 2FMQA 2DKZA 3IG8A 3N7RC 1HUOA 1ZD5A 2KIWA 3UQ0A 3H40A 1RZTA 1TKDA 3OTQA 3RR8A 4KLLA 2BR0A 5KFFA 1QQ5A 3CYMA 2LYAA 2W3SA 1AROP 9ICSA 2E8PA 3E58A 1S10A 3AUOA 2PFNA 1ZQJA 4RQ7A 2FMPA 3C23A 3KKAA 1BPEA 3GIIA 3BQ0A 4B9VA 2IMWP 2ZIWA 3PR4A 4R66A 3WK7A 4YVZA 4DF8A 1UA0A 2UVUA 2AQ0A 4B9NA 3RTVA 9ICOA 3C5FA 4M2YA 5ALXA 3AM9A 3EZ5A 3VC8A 3H8JA 2H5XA 4QW8A 1COOA 9ICEA 3MR2A 4DSLA 5L1KA 1KFTA 3PNCA 1T8EA 3OJUA 5AKYA 2RRDA 3MGHA 3EWAA 2HHVA 1PVRA 2MA1A 1S0MA 2KJ5A 1X66A 2XI9A 4MF8A 4I2DA 3BZCA 5J0UA 4RQMA 4FS2A 7ICKA 4Z6FA 3LVWA 8ICWA 3EPGA 4MFAA 3NVVA 2IOHA 2NO4A 9ICKA 2I5HA 1TE2A 3C2MA 4ED3A 2KZMA 1BGXT 4BXOB 4XUSA 2NRXA 1S97A 4UAZA 4JV0A 3WK6A 3PW7A 9ICIA 4QZDA 2V9WA 2HOFA 2A3VA 1UPHA 3TANA 2F2AB 5KFBA 1MN8A 2Q0ZX 4XA5A 4AYBF 3UQ2A 3LWLA 5J0WA 5KG5A 3NGDA 4O3OA 4OJPA 1XU4A 2HCFA 2HBLA 1ZXIA 2B21A 3H0RB 3I76A 1SL2A 3Q8PB 2E8MA 4B9SA 2KK0A 3N28A 1ZQ1C 4KLOA 4KLSA 1WUDA 4NLKA 2KZZA 2WB1F 4GXIA 3PV8A 2ZIVA 5DG8A 3V7LA 4FZLA 4F5PA 2OH2A 4NV0A 2ZXIA 3M8SA 3ZI4A 4FBUA 5KG3A 2W43A 4M9HA 1NKCA 2F8KA 5ALEA 5DBCA 2KFZA 2EZZA 4DFMA 2P35A 5KL1B 2BQ3A 1KSPA 1LKYB 4KLFA 4YMMA 1ZQXA 4YD2A 1Z1BA 4YR3A 1A0PA 3GFKB 4QZBA 5HMMA 3PR5B 4YP3A 4NLCA 3RB0A 2OXOA 4QWBA 1PK1B 3Q8KA 2JV3A 3H0MB 2HOQA 2NV3A 5F9LA 1SWVA 3T5HA 4R8UB 1KFSA 4M04A 4OJ5A 1WG8A 5AIBA 1ZQDA 5AI4A 3NRZA 2BPCA 2BHNA 5AM1A 1WWUA 5ALIA 4RQ1A 1IM4A 1N48A 8ICZA 7ICGA 2QB1A 2G06A 5KFMA 1NZBA 2JR5A 4UB8U 3FAHA 3RAQA 1CI4A 3MGVA 2DGZA 4IQUA 4C7YA 1UQVA 5CP2A 3FC4A 3TFSA 2DKXA 2BPGA 2BCRA 2C22A 4Q8FA 5TISU 4RQNA 3BS5B 2HHWA 1Q3VA 2IOFA 3MR5A 2ASLA 5AM3A 4KLUA 2AQ4A 1NJXA 5CRXA 4KITB 4P4PA 1KRPA 2JZBA 4U7CA 3HW8A 5ALWA 2PFOA 2XY7A 8ICUA 1X2IA 3V6JA 8ICJA 1N5XA 1MQ3A 5KFRA 3NVYA 5J2BA 4RT2A 4KLQA 3RFAA 3F2CA 1ZQEA 4DQPA 5CB1A 2XICA 8ICGA 2JMGA 1U48A 5DDYA 5J2CA 4Y2QA 3ETLA 5ALDA 4FE3A 5KT3A 2Q4TA 5CR0A 1C20A 4DQSA 3JPOA 5HMLA 1A76A 3JPTA 4CNQA 5KFEA 4EEYA 2HW3A 2PMZC 2JH1A 1PZNA 1QCKA 3IM1A 3THVA 1XWLA 2G5HB 4GC7A 2K4IA 3BQTA 5ALRA 4UQGA 2OCEA 4BGDA 2NRZA 3M6ZA 4DQQA 5J0XA 1T7PA 2VJ4A 1X6JA 2R8HA 2DL0A 1QSSA 3OHBA 4O3MA 4NM2A 2LI6A 2G0AA 1F0MA 3T5LA 1S0NA 2W3RA 4BXOA 5J2EA 2F8LA 4O3NA 8ICKA 1TAMA 2R8GA 1PUZA 1V97A 4USAA 5D49A 2WF6A 2KJ8A 4Y2SA 3PW5A 2XCAA 3C21A 2G09A 1S0OA 3MABA 1NK7A 2ASJA 2FLLA 3SQIA 1U9LA 2YY6A 4NLGA 5HHHA 3RJKA 4TUPA 3JPPA 2BCUA 7ICOA 1X40A 5DKWA 2NRVA 1DK2A 3SYZA 1ZQIA 4R65A 2KG5A 4IRKA 4F5NA 2VJ5A 3F53A 5EWEA 4J9PA 4TUQA 2L5YA 5CWRA 3KHLA 3H8MA 5ALZA 5BPCA 3KBBA 1RDFA 4P0PB 3V7JA 5C5JA 5AK5A 2ES6A 8ICMA 1ZD4A 1FIQA 1TK8A 4F3OA 4PZNA 2LKYA 4QZFA 3ZDBA 3WK5A 4MHVA 5AI9A 3NTUA 3D2NA 7ICNA 3NASA 4US8A 5L1IA 4NL9C 3AN1A 2XC9A 5AI5A 1GO3F 4K4GA 4YR0A 5IINA 4LZDA 3B0XA 3RH6A 5HR7A 2MRLA 1JXEA 2ALZA 2JEJA 2N1RA 1ZQZA 1SKRA 5DB6A 3RB4A 1T3NA 3LK9A 3OSPA 4EYHB 3TFRA 5F9NA 1HJPA 4EEKA 2FPLA 3WKCA 2K4HA 1IIPA 4ZOHC 5KFIA 4ECTA 5KFYA
chains in the Genus database with same CATH topology
2LM4A 1PUZA 2JR5A 1X6JA 1X6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM4 A;  1PUZ A;  2JR5 A;  1X6J A;  1X6I A; 
#chains in the Genus database with same CATH topology
 2ZIX B;  5AKK A;  4R8U A;  2WF7 A;  2HHQ A;  4LVS A;  2KEY A;  4OD0 A;  4G9B A;  4IS7 A;  5AHX A;  5ALU A;  5KT6 A;  4EEL A;  2IHM A;  3HT3 A;  4ELT A;  4UAT A;  1ZRM A;  4JV1 A;  2FDR A;  2NRT A;  5KFT A;  1X42 A;  3NVW A;  3PW0 A;  2OEH A;  1NK9 A;  4I2C A;  1DXS A;  4Y2V A;  3D2S A;  2F77 X;  3RB6 A;  1Z1V A;  1KDH A;  3RH5 A;  2WF8 A;  9ICP A;  4RUA A;  1LV5 A;  1Z00 A;  2IHN A;  4PPX A;  5K4L A;  4DL4 A;  4IQV A;  5F3X B;  4O5E A;  2AGO A;  3TQ1 A;  9ICX A;  2KNJ A;  3G6Y A;  5DGB A;  4UBC A;  2C2D A;  3PX6 A;  2YML A;  1DRG A;  9ICH A;  3AL0 B;  1RQL A;  3H8S A;  4X5V A;  3PW4 A;  1S5L U;  5KG0 A;  5ALQ A;  3GU3 A;  4ACO A;  4I2I A;  4RUC A;  1ZQC A;  4Y2R A;  4BUG A;  2AJQ A;  3M7D A;  3TAQ A;  4ECQ A;  2HMX A;  3BS7 A;  4IQT A;  4ED2 A;  2KSO A;  3WKE A;  4F4W A;  3G6V A;  8ICL A;  5J8Y C;  2AU0 A;  2YN4 A;  1PVP A;  4C8N A;  5D46 A;  1A77 A;  3I28 A;  1B22 A;  4F4Z A;  4YQW A;  1JXL A;  5J0R A;  1ZQV A;  1UCV A;  3NRW A;  1PVQ A;  4JV2 A;  7ICR A;  4YFK A;  2R8I A;  3QNM A;  3QEA Z;  3Q8R B;  5JRT A;  4I2H A;  5ALG A;  1KEJ A;  2KVS A;  2HVH A;  3DEE A;  3SAF A;  3ONN A;  4J9M A;  1UHU A;  3K1R B;  3EUB 2;  3IHQ B;  4ED7 A;  7ICS A;  3H0L B;  3AEV A;  3CW2 C;  3H7I A;  3QE9 Y;  3KKA C;  2JZB B;  3ZD8 A;  3FDS A;  1TAU A;  4KLI A;  3HX0 A;  4UAV A;  2DPJ A;  4PGX A;  4UB4 A;  4I2J A;  1A6S A;  4GXK A;  3C2L A;  3M9M B;  5KAF U;  3H4D A;  5DB8 A;  2BCS A;  3RRG A;  1N63 A;  3K1Z A;  2JXJ A;  2Y9U A;  2FMS A;  4JWN A;  2RDI A;  4DSJ A;  4DLG A;  3WK4 A;  3N97 B;  1NKB A;  5HR6 A;  2Y1J A;  2NRW A;  3A0H U;  2J6T A;  2PXI A;  1F44 A;  1X9S A;  5GTH U;  2PMZ F;  1OUQ A;  4YMN A;  4O9M A;  3DV9 A;  2A1J B;  5KFW A;  5B66 U;  1JX4 A;  5CJ7 A;  1H38 A;  4UB3 A;  2LHT A;  4F5R A;  2F1I A;  5T14 A;  3GV5 B;  3C1Z A;  3MDC A;  2D6F C;  2DUY A;  1AQ6 A;  4AP9 A;  4O5C A;  7ICP A;  2KHQ A;  1L8O A;  4C8M A;  4NM1 A;  4PGY A;  5EE0 A;  3F2B A;  5DG7 A;  2LM1 A;  4PH5 A;  1NK6 A;  1NK0 A;  1NJY A;  2EQY A;  2H3Z A;  4UW9 A;  5AIA A;  4JWM A;  1MQ2 A;  3HRD D;  7ICQ A;  4ECS A;  3L4P A;  4UAS A;  3UXP A;  3HWT A;  5AKH A;  4WJ3 B;  2VIX A;  1P7D A;  4P0P A;  1JN3 A;  1SZH A;  4YR2 A;  4ECR A;  3OSN A;  4C4T A;  3UXN A;  3GIM A;  5CA7 A;  4LZG A;  3QXG A;  2FPK A;  4RQ2 A;  1FEZ A;  2HDO A;  4QZG A;  4UAU A;  5DDM A;  3SR6 A;  1WCN A;  1Z4N A;  1UT8 A;  4J9S A;  3E0F A;  1Z19 A;  4OJ6 A;  4F50 A;  3D2Q A;  4CGZ A;  2V4Q A;  1RYS A;  1SL0 A;  9ICJ A;  5KFX A;  2RDJ A;  3KD3 A;  1NJZ A;  5KG1 A;  1NK4 A;  2LMR A;  1JRO A;  2MU2 A;  1L8L A;  4ICA A;  5AI6 A;  4ED6 A;  4R64 A;  4B9T A;  3ZDD A;  4PHA A;  1ZQW A;  4OO1 J;  2Y1I A;  5KFV A;  5BOM A;  3TAR A;  5KTQ A;  2JEG A;  2YX8 A;  7ICE A;  2EZY A;  1QLN A;  2ZIX A;  2HOI A;  4UAR A;  3PX4 A;  4BJQ A;  9ICG A;  3ICX A;  2IBK A;  3CRX A;  4QWA A;  3B0Y A;  5C0Y A;  3QUC A;  2Z7J A;  2JGA A;  4TQR A;  3BQ2 A;  2HI0 A;  5DGA A;  1KQQ A;  3GZF A;  3ISD A;  2XVT A;  3UMC A;  4FBT A;  3EPI A;  4DOC A;  5JU5 A;  3M1Y A;  1KLN A;  5KT5 A;  1QSL A;  1XC9 A;  2MSN A;  3I1Y A;  3ISC A;  2G07 A;  1RG6 A;  3MDA A;  2GLE A;  2CN1 A;  1XS9 D;  3HIL A;  4ECZ A;  4ECW A;  2W7P A;  2W7O A;  4M47 A;  2Y0S C;  3SEI A;  1RPL A;  4TUR A;  2KTQ A;  4Y2Y A;  5DQI A;  3HP6 A;  5ALL A;  4C7Z A;  3QU2 A;  4JK1 A;  2I1Q A;  2OM6 A;  2E8O A;  4M6W A;  5J0P A;  2BCV A;  3PST A;  3PSI A;  2K89 A;  5AM0 A;  4CDG A;  4YMO A;  4DQI A;  2C28 A;  5ALF A;  2YMP A;  2UVW A;  4U6P A;  3BQ7 A;  8ICE A;  1L6N A;  3Q8M A;  9ICW A;  1J97 A;  1ZQB A;  1NNL A;  1Z00 B;  5J2G A;  2ZJ8 A;  3UXO A;  4DOB A;  3TAC B;  4MF2 A;  1U49 A;  1D8B A;  4I27 A;  4PHP A;  1M6Y A;  3QU4 A;  3TAP A;  4DL2 A;  1V9P A;  3H8W A;  2PKE A;  4Z6C A;  5H2F U;  1ECW A;  1L3U A;  1URJ A;  9ICU A;  1J2N A;  1TV9 A;  4EZ9 A;  2KSO B;  1WCL A;  4M9L A;  4NY8 A;  1SKS A;  2JH7 A;  4F91 B;  4RT3 A;  4C80 A;  8ICP A;  3ED5 A;  1U45 A;  2DQN B;  1UA1 A;  2RHF A;  5J29 A;  5A0L A;  5DB9 A;  9ICN A;  3UMG A;  4I2F A;  4ELV A;  2JRZ A;  2LYB A;  4FFD A;  1L7P A;  4QZE A;  7ICM A;  4HAI A;  1V38 A;  2F1H A;  4I28 A;  2ZJ5 A;  1D8Y A;  4RQ0 A;  3UPQ A;  4DS5 A;  1RYU A;  2B6G A;  2A1J A;  1Q3U A;  1MSW D;  2KJ9 A;  1CUK A;  5KFJ A;  2ZIU B;  5B5E U;  4C8L A;  4RPZ A;  1N60 A;  1BPY A;  2RP5 A;  1LVH A;  4LJX A;  2EAN A;  3WK9 A;  3RJG A;  3SV4 A;  5BOL A;  3TAD A;  1KW4 A;  1ZQN A;  3RAX A;  4UB5 A;  3PO4 A;  3IDW A;  3RJE A;  9ICA A;  3N7P D;  1C7Y A;  1MA7 A;  4QWC A;  2K8B B;  5KT2 A;  2ZUB A;  2W9C B;  2A1A A;  3QYP A;  5J0Y A;  2K8A A;  5G5H A;  4US9 A;  1K5O A;  2YTU A;  5J0Q A;  3AQE A;  2J6S A;  4EYI B;  3L5K A;  9ICQ A;  4NLB A;  4PHD A;  2DFL A;  2BPF A;  3SI8 A;  4XQ8 A;  4Y2U A;  1B43 A;  5AI8 A;  2GH1 A;  3C28 A;  1ZQS A;  2XID A;  4IRD A;  2MUT A;  5ALM A;  4RU9 A;  2KOB A;  2P6U A;  3S6J A;  4OCZ A;  1BNO A;  4DEZ A;  3SV3 A;  4J9N A;  2W54 A;  1N61 A;  2G08 A;  3ALR A;  3A0B U;  5AKI A;  2DBY A;  3QZ8 A;  2LPE A;  9ICM A;  4KLT A;  4P2H A;  3U26 A;  4FZN A;  5J0S A;  1Q8K A;  2CPR A;  3PO5 A;  3PML A;  4JB3 A;  5AM5 A;  3F5E A;  4QW9 A;  4Q44 A;  4PZO A;  2JEF A;  3GV8 B;  4OJL A;  2BQU A;  5KFH A;  3R9K A;  5AI0 A;  4ZH4 A;  1NK8 A;  3KHH A;  5E79 U;  4AYB C;  3C1Y A;  1N2X A;  4DQR A;  2C2R A;  8ICB A;  5HP4 A;  2E8N A;  3HKZ C;  4FO6 A;  2BDU A;  1BPX A;  4MEX A;  4EX6 A;  4YD1 A;  1SV0 A;  5J2F A;  2F76 X;  4IC9 A;  1BNP A;  3SAH A;  1IXR A;  9ICT A;  5FP0 A;  3Q8S B;  4M9J A;  4F93 B;  5ALJ A;  3ETR A;  2IOF K;  2MAX A;  1XO0 A;  5EE1 A;  4Q8E A;  5DQH A;  1X9X A;  2HVI A;  1IV8 A;  5KFL A;  4RQ8 A;  1L3T A;  3LYS A;  4KX3 A;  2FLN A;  1U4B A;  4Z6D A;  1RQN A;  2KE7 A;  4KLJ A;  3HJE A;  5HHI A;  5KFC A;  5D4B A;  4YXM A;  1TAQ A;  4KMU A;  2VA2 A;  5DQG A;  1T4G A;  2OYY A;  1NI3 A;  5ALV A;  3AMZ A;  2W11 A;  2KP7 A;  3PMN A;  7ICV A;  3KZX A;  4PL2 A;  3K4G A;  8ICS A;  2FI1 A;  4DS4 A;  4PHE A;  3F5A A;  2LM4 A;  1EXN A;  1ZQA A;  1D9D A;  2EDU A;  3C5G A;  3N4M B;  4YN4 A;  4Q45 A;  5IIJ A;  2HBK A;  1XO1 A;  4DCC A;  4J9Q A;  3SMV A;  5ALK A;  1XSL A;  3NS1 A;  2NO5 A;  4EBC A;  5AK3 A;  1FFV A;  4BX9 C;  4F5O A;  5J0O A;  3LDA A;  1BVS A;  8ICQ A;  5JUM A;  4QIW C;  4DLE A;  4CRX A;  2ZTE A;  3M9N B;  1SB3 C;  3SAG A;  4A8E A;  1SL1 A;  3NUQ A;  4C0Z A;  2HBJ A;  8ICO A;  4M6W B;  3ZDA A;  4GC6 A;  4NWI A;  4F5Q A;  4F72 A;  1ZQO A;  4YG2 A;  5AK4 A;  3QUT A;  1O08 A;  3F2D A;  4J9R A;  5AIC A;  1K1Q A;  4FS1 A;  1O03 A;  2WTF A;  5J2A A;  1ED1 A;  3CNH A;  3RJF A;  4E0D A;  1VLB A;  2WF9 A;  4F4X A;  3MR3 A;  4O3P A;  4JMU A;  7ICF A;  2JEI A;  1JRP A;  2KV2 A;  4NLN A;  3PSF A;  2FPM A;  4I29 A;  2QKQ A;  1ZQM A;  5DBB A;  2J6U A;  5L1M A;  4EZ6 A;  5DG9 A;  2ZIU A;  4PL1 A;  3RF9 A;  5GTI U;  8ICI A;  2R8J A;  3RJJ A;  2QLT A;  2R18 A;  4EX7 A;  1CEZ A;  1L7O A;  2WFA A;  1RXV A;  4UAY A;  2QB0 B;  3KOO A;  2E3T A;  1L3V A;  2K8C B;  4KN7 A;  3WU2 U;  3MFH A;  2B0C A;  4NXZ A;  4DWI A;  1JI7 A;  4OJO A;  2W9C A;  2WHE A;  1ZD2 P;  5DLG A;  4C8O A;  1WWV A;  4RZR A;  2I6X A;  4DFK A;  4ELU A;  1PK3 A;  3MFI A;  3RB3 A;  2YMM A;  5ALO A;  4YCX A;  2KIV A;  1RM6 C;  2FJ6 A;  2WAQ C;  4JUZ A;  3RH4 A;  1B4F A;  3KZI U;  2W8L A;  1SWW A;  4IR9 A;  4BDP A;  5KAI U;  3QUB A;  4BWJ A;  5IIK A;  4DL7 A;  3V6K A;  3D6J A;  3JPQ A;  4DSK A;  2YQE A;  3J81 j;  2LBO A;  2C2E A;  1ZQP A;  5AM2 A;  5DLF A;  2GOL A;  3MR6 A;  4ECV A;  3PVX A;  2KD1 A;  5DBA A;  2XGP A;  2E5S A;  2UVR A;  1ZQH A;  8ICC A;  2ESE A;  2GO7 A;  3QEB Z;  2W9B A;  4RPX A;  2RQ5 A;  3GDX A;  5J2I A;  4RNM A;  3AQF A;  5AM4 A;  1JAL A;  4RNN A;  2PFQ A;  3Q8Q B;  4P0Q B;  1BPD A;  5IIO A;  3QUQ A;  5KFA A;  5KFS A;  4CF4 A;  2OHF A;  1QTM A;  4M9N A;  3PZP A;  4J9O A;  3FYH A;  3KHG A;  3CP8 A;  2MUT B;  4BWM A;  3ZDC A;  2BZF A;  2KHV A;  2LYH A;  3JPN A;  4M9G A;  8ICX A;  1LB2 B;  1QQ7 A;  4MFF A;  3V6H A;  3PW2 A;  3MBY A;  2P66 A;  2HHU A;  2JHD A;  2H3V A;  2YB4 A;  5AKJ A;  1ZQQ A;  1UT5 A;  1DOQ A;  1YT3 A;  5G5G A;  8ICY A;  1Y88 A;  3N7S C;  1ZET A;  4O3R A;  5J2D A;  3B9J A;  4UBB A;  3TI0 A;  1SGG A;  4RQ4 A;  2EAP A;  1XNS A;  2AXT U;  2KMD A;  1J2M A;  4Y2P A;  1VJ5 A;  1MC8 A;  5KG2 A;  2H3Q A;  3RR7 A;  4QNL A;  2F3N A;  3WKD A;  1S8O A;  3HKZ F;  5AKZ A;  4UB1 A;  1JMS A;  4TUS A;  3IV6 A;  3ORY A;  2UVV A;  1SXD A;  4I2E A;  4K4H A;  1RYR A;  2HBM A;  2KKV A;  5ALT A;  5KG4 A;  5J2K A;  2EH9 A;  3GV7 B;  5KT7 A;  3UMB A;  1ZQR A;  3KTQ A;  2XO7 A;  2ODG A;  3OGU A;  4MEY A;  2HHX A;  2KVC A;  5EE9 A;  3G6X A;  3NVZ A;  1JIH A;  3ISB A;  1ZRN A;  1TK0 A;  1ZJM A;  5L1J A;  4B9M A;  3GIJ A;  3WKA A;  2ZUD A;  3MGI A;  1BPB A;  3HPO A;  5J2J A;  1D9F A;  4J9K A;  1U47 A;  5TZV A;  8ICT A;  1FFU A;  1ZQU A;  3GIK A;  2FLP A;  2ISO A;  9ICB A;  5J0T A;  4DO9 A;  4Z6E A;  1SXE A;  2R8K A;  3E2E A;  2EAM A;  4I2B A;  3DDH A;  1YZ7 A;  3LVV A;  3TKA A;  1VDV A;  1S77 D;  3T5J A;  1F5S A;  1JUD A;  4DL5 A;  4QZ8 A;  5J2H A;  1OW5 A;  3FM9 A;  3BDP A;  5L1L A;  3Q8L A;  1QH9 A;  5KG7 A;  5KNI A;  1DK3 A;  1IG6 A;  4ED1 A;  4TQS A;  3C29 A;  5KFU A;  1TFR A;  3AU2 A;  4PJ0 U;  4DF4 A;  4Y2X A;  4QJF B;  4QIW F;  1KKX A;  5AKE A;  2QAR A;  2NYV A;  4KLH A;  3PSP A;  4ECY A;  4B9U A;  4P4O A;  3RBD A;  8ICH A;  4J03 A;  2HHS A;  1NOM A;  2E1E A;  2CXY A;  2P6R A;  3BJY A;  2ISP A;  4C8K A;  4KLE A;  5KFZ A;  2E1F A;  4F2S A;  3ZDE A;  4RQ5 A;  9ICF A;  8ICA A;  1KBU A;  4EEN A;  1ZQL A;  7ICH A;  5KFK A;  4B9L A;  3KHR A;  1RXW A;  3SD7 A;  3WK8 A;  4EBD A;  1FO4 A;  1COK A;  2DPI A;  3EW9 A;  4RQ6 A;  4GXJ A;  1ZQF A;  3T3F A;  4J9L A;  1D8L A;  1ZQY A;  2BGW A;  4F92 B;  5L9X A;  2QB0 A;  1NKE A;  1SV4 A;  5III A;  4KN4 A;  4KLG A;  1BPZ A;  2D3D A;  2KZ3 A;  1KN5 A;  1KFD A;  5EWG A;  2AGP A;  2RLT A;  1KL9 A;  5EOZ A;  2W9A A;  3OPX A;  5CHG A;  1L7M A;  3M6K A;  5AKX A;  2ZG6 A;  2WF5 A;  4Y2J A;  1NK5 A;  1ZYQ A;  3WKB A;  4O3S A;  1OXJ A;  5ALY A;  7ICL A;  1ZD3 A;  1Q46 A;  3IRU A;  1X6I A;  4RNO A;  5ALS A;  2ZXH A;  3T5K A;  4QWD A;  4FZM A;  8ICV A;  4RPY A;  4B6J A;  3PY8 A;  4F8R A;  2A19 A;  2W04 A;  3TAD C;  2XY6 A;  2ZJA A;  1XSN A;  4ECX A;  3H4B A;  1Z3E B;  3ZD9 A;  4K4I A;  5KFP A;  4P4M A;  4PGQ A;  3C2K A;  7ICT A;  4GLX A;  5KFG A;  2K60 A;  2KN7 A;  2ZUC A;  4O0I A;  2WAQ F;  2DF4 B;  5DB7 A;  3QU7 A;  5HNK A;  2CRX A;  2M0N A;  4P0Q A;  3PX0 A;  4KLD A;  2XGQ A;  3IG5 A;  2BKE A;  3VCB A;  2ZIW B;  3SZ2 A;  4KLM A;  2O6K A;  3M9O B;  4ED0 A;  2KFN A;  3IN5 A;  1HEK A;  4F2R A;  4C4S A;  4I2G A;  1HIW A;  3GIL A;  4DFP A;  4IL6 U;  2HHT A;  1CRX A;  4QZC A;  2D8C A;  8ICR A;  5JTI A;  1WYG A;  4DSE A;  4ED8 A;  3V72 A;  4IQW A;  5KG6 A;  2W9M A;  1V85 A;  4QZ9 A;  4ECU A;  2VAN A;  4GFJ A;  1DGS A;  5IIL A;  1SIJ A;  2W9B B;  1QQ6 A;  3SEN A;  2HSZ A;  2PI4 A;  8ICN A;  4UAW A;  1ZJN A;  3MC1 A;  4O3Q A;  5EWF A;  3BZK A;  2H3F A;  1L7N A;  4UB2 A;  3JPR A;  4I2A A;  2V4R A;  5ALP A;  3QU9 A;  2AHO B;  2ASD A;  1N56 A;  4YXJ A;  2I9G A;  4CE6 A;  1QSY A;  1SV0 C;  4QWE A;  4GIB A;  1SKW A;  7ICI A;  4R63 A;  5KFD A;  5IIM A;  2OWO A;  2BCQ A;  4QZA A;  4DL6 A;  2WB1 C;  2GWS A;  5AKG A;  1HUZ A;  7ICJ A;  2BDP A;  1N62 A;  5AKL A;  4NJ8 A;  2VKQ A;  5KT4 A;  4HYK A;  2VA3 A;  4Q43 A;  2BQR A;  3T79 A;  2G5I B;  3QZ7 A;  2ATL A;  2PFP A;  2YMQ A;  4NL9 A;  4RQ3 A;  3RRH A;  1S9F A;  4QZH A;  1LKY A;  4NLZ A;  4DOA A;  4IR1 A;  1Z4O A;  1X9W A;  1TVA A;  5KFQ A;  1SZP A;  4CF5 A;  1K1S A;  2AH5 A;  1NJW A;  2ZIV B;  3OHA A;  4DL3 A;  1N5W A;  4XRH A;  3LWM A;  2AGQ A;  1T94 A;  3K75 D;  2IA6 A;  3JPS A;  1PK1 A;  4IRC A;  1S0V A;  3IP4 B;  3AU6 A;  2EZX A;  1KTQ A;  1X9M A;  2YB1 A;  4QZI A;  3QU5 A;  1L3S A;  4KTQ A;  5CEH A;  2KIC A;  1S76 D;  4G3I A;  2F1J A;  2K4E A;  2M9N A;  1XSP A;  5ALH A;  3L3F X;  5KFN A;  2FE9 A;  5AK6 A;  3V7K A;  2Y0S F;  4M0A A;  1DGJ A;  9ICR A;  5ALN A;  3GQC A;  2DWQ A;  7ICU A;  5EE3 A;  2W55 A;  2W03 A;  3BQ1 A;  4F4Y A;  1YZ6 A;  4Y2T A;  4F4K A;  1ZQT A;  1B0X A;  9ICC A;  2VA8 A;  1T3Q A;  2KKP A;  1NZP A;  2XY5 A;  1ZQG A;  2W8K A;  8ICF A;  2XCP A;  3EYZ A;  1L5U A;  3BS5 A;  9ICL A;  9ICV A;  4DSI A;  2Y9T A;  3OJS A;  2H3I A;  4CCH A;  2F44 A;  5KFO A;  4DFD A;  4O5K A;  4UB6 U;  4MFC A;  2K4P A;  4CF3 A;  5KL8 B;  2EAO A;  4DFJ A;  3RJH A;  3RBE A;  2QAR B;  1ZOL A;  1ZQK A;  3RJI A;  1TK5 A;  4F71 A;  3M8R A;  4EBE A;  4DSF A;  4KMO B;  3O0F A;  3QX7 A;  2ZTD A;  5J8Y A;  4KX5 A;  3KFU F;  3UM9 A;  2PI5 A;  4C4R A;  2ZTC A;  2FMQ A;  2DKZ A;  3IG8 A;  3N7R C;  1HUO A;  1ZD5 A;  2KIW A;  3UQ0 A;  3H40 A;  1RZT A;  1TKD A;  3OTQ A;  3RR8 A;  4KLL A;  2BR0 A;  5KFF A;  1QQ5 A;  3CYM A;  2LYA A;  2W3S A;  1ARO P;  9ICS A;  2E8P A;  3E58 A;  1S10 A;  3AUO A;  2PFN A;  1ZQJ A;  4RQ7 A;  2FMP A;  3C23 A;  3KKA A;  1BPE A;  3GII A;  3BQ0 A;  4B9V A;  2IMW P;  2ZIW A;  3PR4 A;  4R66 A;  3WK7 A;  4YVZ A;  4DF8 A;  1UA0 A;  2UVU A;  2AQ0 A;  4B9N A;  3RTV A;  9ICO A;  3C5F A;  4M2Y A;  5ALX A;  3AM9 A;  3EZ5 A;  3VC8 A;  3H8J A;  2H5X A;  4QW8 A;  1COO A;  9ICE A;  3MR2 A;  4DSL A;  5L1K A;  1KFT A;  3PNC A;  1T8E A;  3OJU A;  5AKY A;  2RRD A;  3MGH A;  3EWA A;  2HHV A;  1PVR A;  2MA1 A;  1S0M A;  2KJ5 A;  1X66 A;  2XI9 A;  4MF8 A;  4I2D A;  3BZC A;  5J0U A;  4RQM A;  4FS2 A;  7ICK A;  4Z6F A;  3LVW A;  8ICW A;  3EPG A;  4MFA A;  3NVV A;  2IOH A;  2NO4 A;  9ICK A;  2I5H A;  1TE2 A;  3C2M A;  4ED3 A;  2KZM A;  1BGX T;  4BXO B;  4XUS A;  2NRX A;  1S97 A;  4UAZ A;  4JV0 A;  3WK6 A;  3PW7 A;  9ICI A;  4QZD A;  2V9W A;  2HOF A;  2A3V A;  1UPH A;  3TAN A;  2F2A B;  5KFB A;  1MN8 A;  2Q0Z X;  4XA5 A;  4AYB F;  3UQ2 A;  3LWL A;  5J0W A;  5KG5 A;  3NGD A;  4O3O A;  4OJP A;  1XU4 A;  2HCF A;  2HBL A;  1ZXI A;  2B21 A;  3H0R B;  3I76 A;  1SL2 A;  3Q8P B;  2E8M A;  4B9S A;  2KK0 A;  3N28 A;  1ZQ1 C;  4KLO A;  4KLS A;  1WUD A;  4NLK A;  2KZZ A;  2WB1 F;  4GXI A;  3PV8 A;  2ZIV A;  5DG8 A;  3V7L A;  4FZL A;  4F5P A;  2OH2 A;  4NV0 A;  2ZXI A;  3M8S A;  3ZI4 A;  4FBU A;  5KG3 A;  2W43 A;  4M9H A;  1NKC A;  2F8K A;  5ALE A;  5DBC A;  2KFZ A;  2EZZ A;  4DFM A;  2P35 A;  5KL1 B;  2BQ3 A;  1KSP A;  1LKY B;  4KLF A;  4YMM A;  1ZQX A;  4YD2 A;  1Z1B A;  4YR3 A;  1A0P A;  3GFK B;  4QZB A;  5HMM A;  3PR5 B;  4YP3 A;  4NLC A;  3RB0 A;  2OXO A;  4QWB A;  1PK1 B;  3Q8K A;  2JV3 A;  3H0M B;  2HOQ A;  2NV3 A;  5F9L A;  1SWV A;  3T5H A;  4R8U B;  1KFS A;  4M04 A;  4OJ5 A;  1WG8 A;  5AIB A;  1ZQD A;  5AI4 A;  3NRZ A;  2BPC A;  2BHN A;  5AM1 A;  1WWU A;  5ALI A;  4RQ1 A;  1IM4 A;  1N48 A;  8ICZ A;  7ICG A;  2QB1 A;  2G06 A;  5KFM A;  1NZB A;  2JR5 A;  4UB8 U;  3FAH A;  3RAQ A;  1CI4 A;  3MGV A;  2DGZ A;  4IQU A;  4C7Y A;  1UQV A;  5CP2 A;  3FC4 A;  3TFS A;  2DKX A;  2BPG A;  2BCR A;  2C22 A;  4Q8F A;  5TIS U;  4RQN A;  3BS5 B;  2HHW A;  1Q3V A;  2IOF A;  3MR5 A;  2ASL A;  5AM3 A;  4KLU A;  2AQ4 A;  1NJX A;  5CRX A;  4KIT B;  4P4P A;  1KRP A;  2JZB A;  4U7C A;  3HW8 A;  5ALW A;  2PFO A;  2XY7 A;  8ICU A;  1X2I A;  3V6J A;  8ICJ A;  1N5X A;  1MQ3 A;  5KFR A;  3NVY A;  5J2B A;  4RT2 A;  4KLQ A;  3RFA A;  3F2C A;  1ZQE A;  4DQP A;  5CB1 A;  2XIC A;  8ICG A;  2JMG A;  1U48 A;  5DDY A;  5J2C A;  4Y2Q A;  3ETL A;  5ALD A;  4FE3 A;  5KT3 A;  2Q4T A;  5CR0 A;  1C20 A;  4DQS A;  3JPO A;  5HML A;  1A76 A;  3JPT A;  4CNQ A;  5KFE A;  4EEY A;  2HW3 A;  2PMZ C;  2JH1 A;  1PZN A;  1QCK A;  3IM1 A;  3THV A;  1XWL A;  2G5H B;  4GC7 A;  2K4I A;  3BQT A;  5ALR A;  4UQG A;  2OCE A;  4BGD A;  2NRZ A;  3M6Z A;  4DQQ A;  5J0X A;  1T7P A;  2VJ4 A;  1X6J A;  2R8H A;  2DL0 A;  1QSS A;  3OHB A;  4O3M A;  4NM2 A;  2LI6 A;  2G0A A;  1F0M A;  3T5L A;  1S0N A;  2W3R A;  4BXO A;  5J2E A;  2F8L A;  4O3N A;  8ICK A;  1TAM A;  2R8G A;  1PUZ A;  1V97 A;  4USA A;  5D49 A;  2WF6 A;  2KJ8 A;  4Y2S A;  3PW5 A;  2XCA A;  3C21 A;  2G09 A;  1S0O A;  3MAB A;  1NK7 A;  2ASJ A;  2FLL A;  3SQI A;  1U9L A;  2YY6 A;  4NLG A;  5HHH A;  3RJK A;  4TUP A;  3JPP A;  2BCU A;  7ICO A;  1X40 A;  5DKW A;  2NRV A;  1DK2 A;  3SYZ A;  1ZQI A;  4R65 A;  2KG5 A;  4IRK A;  4F5N A;  2VJ5 A;  3F53 A;  5EWE A;  4J9P A;  4TUQ A;  2L5Y A;  5CWR A;  3KHL A;  3H8M A;  5ALZ A;  5BPC A;  3KBB A;  1RDF A;  4P0P B;  3V7J A;  5C5J A;  5AK5 A;  2ES6 A;  8ICM A;  1ZD4 A;  1FIQ A;  1TK8 A;  4F3O A;  4PZN A;  2LKY A;  4QZF A;  3ZDB A;  3WK5 A;  4MHV A;  5AI9 A;  3NTU A;  3D2N A;  7ICN A;  3NAS A;  4US8 A;  5L1I A;  4NL9 C;  3AN1 A;  2XC9 A;  5AI5 A;  1GO3 F;  4K4G A;  4YR0 A;  5IIN A;  4LZD A;  3B0X A;  3RH6 A;  5HR7 A;  2MRL A;  1JXE A;  2ALZ A;  2JEJ A;  2N1R A;  1ZQZ A;  1SKR A;  5DB6 A;  3RB4 A;  1T3N A;  3LK9 A;  3OSP A;  4EYH B;  3TFR A;  5F9N A;  1HJP A;  4EEK A;  2FPL A;  3WKC A;  2K4H A;  1IIP A;  4ZOH C;  5KFI A;  4ECT A;  5KFY A; 
#chains in the Genus database with same CATH homology
 2LM4 A;  1PUZ A;  2JR5 A;  1X6J A;  1X6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...