1PUZA

Solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
MMVFDDIAKRKIRFQTRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKIRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis reveals a distinct 5-helix bundle.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 20
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1puzA00
2JR5A 1X6JA 1X6IA 2LM4A 1PUZA
chains in the Genus database with same CATH superfamily
4R64A 8ICLA 2VANA 5IIJA 1B4FA 1YT3A 4M47A 1S10A 4J9KA 1LVHA 1N2XA 3H0LB 2EAOA 4O5CA 3N28A 4YXMA 4DQRA 3TACB 3M7DA 5KFQA 3NUQA 1QSSA 1UHUA 4RQ2A 2F1HA 4B6JA 3QZ7A 1KFDA 1BPXA 5EWGA 1OUQA 4IRCA 3Q8PB 3RJKA 5EWFA 1MC8A 4ECXA 4Y2VA 4UAZA 2VJ4A 4US9A 3WKEA 1ZETA 7ICNA 3ICXA 1SB3C 2IOFK 2OEHA 1TK8A 4ELUA 5BPCA 5J0XA 1T8EA 1KEJA 3TAPA 2BQRA 4C8OA 2DPIA 3D2SA 4UB2A 4I2GA 3MFHA 5JUMA 4IRKA 4M6WB 5F9LA 4MEXA 2BCRA 1X6IA 2KK0A 4RNNA 1XNSA 4P0PA 3PSFA 2K8CB 1ZD5A 1PUZA 4I2JA 1ZQBA 4O3MA 5D49A 4DOCA 2ZUDA 3ISDA 2W11A 2P6UA 4U7CA 5ALJA 4I2AA 2UVVA 3OJUA 4YG2A 2OYYA 1XSNA 3OHAA 1NJWA 3AEVA 4KX3A 2XIDA 2YN4A 2DF4B 5DLFA 3M8SA 2NO4A 4F71A 5J0YA 3M9NB 4USAA 2KEYA 4OJ5A 2ZTDA 2OCEA 2VIXA 8ICUA 2KJ5A 4O3RA 3RTVA 4F92B 1SGGA 4I2HA 5DG7A 1CEZA 1SL2A 2C22A 3B9JA 4DFMA 4C8KA 3PSTA 5IIMA 5AM0A 3ZD8A 2PMZC 3NGDA 8ICEA 2V4QA 3ETLA 5TZVA 4BXOB 2Y0SC 2HBJA 2LYAA 2E5SA 1A77A 3T3FA 2HI0A 3L5KA 1ZQHA 2AQ0A 3MDAA 3AQFA 3VC8A 4RT2A 3C2KA 5CRXA 1KFSA 3RB0A 1O08A 4RQNA 2XGQA 4CF4A 3ZDAA 9ICIA 4FFDA 1S5LU 2H3QA 3RBEA 4PZOA 2NO5A 2MSNA 1C20A 2NRWA 5IINA 3BQ2A 4MFFA 1K1QA 1SV0C 2DPJA 3UXOA 3QX7A 2I1QA 9ICBA 1DGJA 2KV2A 2MA1A 2UVUA 2KD1A 3HW8A 3UMGA 2LPEA 2BDPA 8ICCA 3HILA 3H0RB 2JXJA 2XC9A 1K1SA 1SXEA 2LI6A 2OHFA 5CJ7A 2AGPA 3RJIA 1T7PA 5AM3A 3LVWA 4J9LA 5G5GA 2FPKA 1TK5A 4NLGA 5IIIA 3UXPA 1PK3A 3QEBZ 3MR2A 1ZD2P 2B21A 5KFYA 4RQ5A 4BXOA 2DBYA 5ALQA 2KG5A 5EE0A 7ICTA 2ZTCA 3TANA 3KZXA 5AKKA 1N48A 2WB1F 3PMNA 4YXJA 5AI8A 3PX4A 1YZ7A 7ICFA 4YR0A 5DG9A 4Y2SA 5E79U 4PGXA 5L1JA 4XA5A 1SIJA 8ICNA 2KN7A 4ECUA 1COOA 4BWMA 4R8UB 1NK9A 2NV3A 2KFZA 7ICOA 4ZH4A 3V6HA 2BCQA 1KBUA 3PW0A 3N7SC 4GFJA 1JI7A 4UB4A 2HVIA 2KOBA 1MN8A 4FZLA 3N97B 1MA7A 2NRXA 3GU3A 3BQ1A 2HOFA 8ICVA 1QSYA 2NRTA 2KIWA 5CB1A 4EENA 2KSOB 3WK4A 2E3TA 4M9HA 2FMSA 2YMQA 3PW4A 3MABA 4DFKA 3UQ0A 3PO5A 1QQ7A 4R63A 4QZIA 2LKYA 3V6KA 4F93B 2HHQA 2HBMA 2LHTA 3GV5B 1ECWA 2DKZA 1TAQA 3FDSA 1U47A 2RDIA 3AU6A 5AI0A 2W3RA 5J2EA 4YCXA 1L6NA 2JGAA 5J2BA 1EXNA 1ZQLA 4BX9C 1MSWD 3H4BA 2KTQA 4IQUA 4DFPA 3BZKA 2KZ3A 4J9OA 5ALWA 3T5HA 2GLEA 1BPYA 5KFXA 3MFIA 4MFCA 9ICKA 1XO1A 4NXZA 4AYBC 3D6JA 1T3QA 3EPIA 2LM1A 2OXOA 2J6SA 2AJQA 2YMLA 4B9NA 1X42A 4Y2JA 3D2QA 4FBUA 4P0QA 2BPCA 4UAUA 5AI6A 1XO0A 1QLNA 3H0MB 2XCAA 4XQ8A 1BNPA 1X2IA 1KFTA 2E8OA 9ICXA 1Q8KA 5J0RA 5KFRA 2F77X 3IRUA 8ICAA 2VA2A 5IIKA 4PL2A 2Y1JA 1COKA 4DL4A 2KJ8A 4C80A 3UMBA 1ZQVA 5AKYA 4F72A 2VA3A 4KLDA 2F3NA 3AU2A 1ZJMA 4Q8FA 2QB0A 1JMSA 2W7PA 3M6KA 1UCVA 1SL0A 4DLGA 2KICA 3GFKB 2H5XA 1WUDA 4DQIA 4RQ8A 1N61A 3IG8A 4KLEA 2KZMA 2PFNA 3SQIA 1B22A 4US8A 4TUSA 2H3VA 3BQ7A 3QUTA 4ICAA 1T94A 4UBCA 2FJ6A 5BOLA 3RH4A 4NWIA 2KHVA 2D8CA 2W9BA 2HMXA 5HHHA 4C4TA 5KG3A 4YN4A 7ICKA 5HR6A 2F8LA 4RQ0A 2PFPA 4ECTA 3GV7B 4KTQA 2KP7A 3HPOA 4BWJA 5AI5A 1A6SA 1Z00B 4O3SA 4RPXA 2WF9A 5KFGA 2W43A 1L3UA 4RQ1A 1AQ6A 5AK4A 2EAPA 3H4DA 3WK8A 4PL1A 5L1LA 1D8BA 8ICHA 5ALHA 5J0WA 4KLHA 4YR3A 1SXDA 1N56A 1PVPA 3TFSA 5ALTA 2KHQA 3NVZA 3UM9A 4M04A 4NLZA 2E8MA 3GIKA 4EX7A 8ICGA 3KKAC 7ICGA 1X6JA 1KDHA 4ELVA 1D8LA 5J2AA 4IQVA 1XU4A 4KLSA 3LYSA 2A3VA 3NRZA 1SZPA 5IILA 9ICFA 4F8RA 2M9NA 4LJXA 2OWOA 1S8OA 4ELTA 1MQ3A 3JPPA 3L4PA 2OM6A 2K8AA 4QZGA 2YB4A 5A0LA 5JTIA 3ORYA 5KT3A 3OSNA 2ZIVB 5H2FU 1QCKA 3NS1A 4IS7A 4CE6A 5ALYA 3MR6A 2ESEA 4F5NA 2YMPA 4EX6A 1JX4A 3AM9A 3Q8QB 4DLEA 4C4SA 1XS9D 2MU2A 4C4RA 5KG0A 1ZQXA 4TUPA 4J9QA 7ICLA 1WCLA 3TKAA 5AIBA 4DOBA 1L5UA 2FMPA 2PFOA 4CCHA 2KE7A 4RQ3A 2BDUA 4NM1A 4DL3A 2WF8A 3M9MB 2QARA 4FS1A 2J6UA 2YB1A 4UW9A 3MDCA 1S0OA 2D6FC 3WK6A 3I76A 2W04A 3MGVA 3T5LA 2KJ9A 1WG8A 3NRWA 5EWEA 2EQYA 1Z1BA 4QWDA 2BPGA 1S97A 9ICPA 5KT2A 4CF3A 4O5EA 1UPHA 1FIQA 1FO4A 3FC4A 4RUAA 1M6YA 4FZNA 3QE9Y 2PFQA 4M9LA 4PGQA 4CF5A 2ZIVA 5DQIA 1NI3A 2J6TA 4O3QA 2BCSA 3JPTA 2HOIA 5HR7A 1N5XA 9ICCA 5KT7A 3OJSA 3PY8A 4PHPA 2ZIXA 1ZQEA 2EZYA 3CRXA 4ED3A 4TQRA 1PZNA 3QU7A 2JHDA 5KFLA 4XRHA 3IN5A 4B9TA 2WHEA 7ICSA 4UB5A 1T3NA 1TKDA 2IOHA 4Q8EA 5CEHA 3MBYA 3WK9A 3WK7A 1PVRA 3AN1A 4I2DA 2XY5A 3EW9A 1X9WA 3HJEA 1Z1VA 3SMVA 3RR8A 9ICWA 4QWAA 3IG5A 2WB1C 2HDOA 2EZXA 1CUKA 1LKYB 1BNOA 2B0CA 5AKEA 3TARA 2Y9TA 5J2FA 1RXWA 3F2BA 1F5SA 3RB6A 1ED1A 5KG2A 4MFAA 1T4GA 3TI0A 2BQ3A 3IHQB 5CHGA 1X9XA 4MEYA 3F5EA 1AROP 1NZPA 2BCUA 5DGBA 5DB9A 3RRGA 4ECWA 4KLUA 5KNIA 3WK5A 2JEJA 4NLNA 4FO6A 3MGHA 1UT8A 5TISU 3IP4B 5ALSA 1ZQKA 3H7IA 2V4RA 2BR0A 3TADC 3RJEA 5KFIA 1YZ6A 5HHIA 8ICYA 1ZQPA 4F5RA 1ZQZA 2N1RA 2Q0ZX 3HRDD 3SV3A 4B9UA 3CP8A 4NJ8A 1XC9A 1D9DA 4DS5A 1ZRNA 4Y2YA 1S0NA 7ICRA 3IDWA 1ZD3A 4KMUA 3I28A 4F3OA 2G5HB 2W54A 5DQGA 4Y2PA 2AHOB 9ICRA 2BQUA 1KKXA 4U6PA 2VA8A 1RQNA 4YQWA 3SI8A 1NK6A 1PVQA 1LKYA 2PI4A 4B9LA 1TAMA 4JV0A 4NL9A 2Z7JA 7ICMA 1SZHA 2Q4TA 5L9XA 1UT5A 2B6GA 4DSKA 4M6WA 2K4IA 4A8EA 5AKJA 5HMLA 4C0ZA 4ECYA 1URJA 4ECZA 3E0FA 5L1MA 5KFFA 3OGUA 4OJOA 3K1RB 2R18A 4IL6U 1J97A 2ZXHA 2E8PA 2AGOA 2I9GA 1TVAA 4QW9A 3ZDCA 2HHSA 2HHVA 4M0AA 2VKQA 3ISCA 4PHAA 2HHTA 7ICQA 4DQQA 1Z19A 1O03A 7ICHA 2DUYA 1BPEA 4QWBA 2WAQC 3J81j 3SYZA 4ED6A 2HHWA 5KT6A 2EDUA 9ICGA 2M0NA 1K5OA 4GC7A 5AK5A 4P2HA 2AU0A 2E8NA 2R8KA 5DB7A 2RQ5A 4PPXA 7ICJA 3RJGA 4YFKA 4G9BA 2AH5A 3TQ1A 3ZDBA 2XICA 4QZ9A 4O9MA 1CRXA 3O0FA 3VCBA 3Q8KA 2C2DA 2HW3A 1N60A 2IOFA 4QZHA 4YD1A 4TURA 1CI4A 4QZBA 2XGPA 4DL5A 5KFMA 2XY6A 2ZXIA 4F50A 5ALRA 3R9KA 1C7YA 4I2IA 1RG6A 4F5OA 4DL6A 4HAIA 3SAHA 4IQTA 2DQNB 2FI1A 5ALDA 4KLJA 3FAHA 1DRGA 3PR5B 3E58A 2OH2A 1RYRA 2JH1A 4EELA 1Q46A 3QYPA 2CRXA 5G5HA 3T5JA 2WTFA 4KLIA 1ZQNA 5ALZA 1S9FA 8ICSA 5DB8A 1KQQA 4I28A 2ES6A 2H3FA 4CRXA 3BQ0A 2KMDA 1KSPA 5J0OA 9ICSA 4YMMA 5KFZA 3C5FA 3QNMA 4I2CA 2RLTA 8ICPA 2MAXA 1FEZA 4P4MA 4DF8A 3PW2A 5KAIU 4LZDA 4DSEA 4C7YA 4OJ6A 4DL7A 3LDAA 1ZQJA 3GZFA 2W9CB 1A76A 4EEKA 3LWMA 2A1AA 3NASA 1J2NA 9ICOA 3F5AA 1RDFA 4DSLA 3OSPA 1MQ2A 5J2IA 1PK1B 3AQEA 3F2DA 3E2EA 5C5JA 2W8KA 9ICVA 8ICKA 5ALMA 1XWLA 3NVVA 1D8YA 1JALA 5J0TA 3BDPA 3ISBA 1TAUA 2HSZA 4EZ6A 2ZJAA 1L7OA 4YVZA 1OW5A 2ALZA 4QZ8A 3Q8MA 3RB4A 4KLLA 3IM1A 2XCPA 4OD0A 3SEIA 2ZJ5A 4YD2A 2KZZA 5AKIA 4Q43A 2ATLA 4UAVA 4R8UA 4P4OA 2RHFA 2R8IA 2PMZF 4Y2RA 5J0UA 4ECQA 1SV0A 3UMCA 2JZBB 2EH9A 3RAXA 4O3NA 4PHEA 8ICBA 1FFUA 2YX8A 1QTMA 2F76X 4QZDA 3BQTA 2XVTA 3C23A 4DFDA 2F8KA 5EE3A 1XSLA 8ICOA 4NLCA 2KSOA 2O6KA 4GLXA 4AP9A 2W9CA 3BS5B 9ICNA 4TQSA 3M1YA 3G6XA 4DOAA 1HUZA 1NKCA 2G09A 1HEKA 1BPZA 2HOQA 4PH5A 1KW4A 4YP3A 1PK1A 4KX5A 2FPMA 7ICIA 5HMMA 4X5VA 1QH9A 3QU2A 3V6JA 1IIPA 4UATA 2C28A 4EYIB 4QW8A 4F5PA 5CWRA 2F1JA 3RAQA 2BKEA 3CW2C 2K4EA 5J2HA 9ICHA 4F2RA 5B66U 5J2DA 1B0XA 4RNMA 3B0XA 3MGIA 4F2SA 3HX0A 2YTUA 3FYHA 3F53A 4KN7A 2JZBA 3G6YA 4NV0A 4RPZA 5KFDA 4B9SA 5JU5A 4RQMA 1ZQQA 1X9SA 5ALEA 2RP5A 2NYVA 3KOOA 5D46A 2DGZA 3WU2U 2FDRA 2G06A 2YY6A 1TE2A 2GO7A 4J03A 5AKXA 1HJPA 4ACOA 1LV5A 2HBKA 5AHXA 2BPFA 1U4BA 5KT5A 5F3XB 4JV1A 2ASLA 9ICTA 5K4LA 4BUGA 4KLGA 2IHMA 3IV6A 4FS2A 3OHBA 2G5IB 1DK2A 1Z4NA 4WJ3B 2RRDA 1F0MA 4HYKA 5AK6A 1J2MA 5L1IA 3JPOA 2BZFA 3Q8LA 3PMLA 1ZQUA 2EZZA 2H3IA 3M9OB 1JXEA 3T79A 4XUSA 1JIHA 3SZ2A 1XSPA 3C28A 3C21A 2L5YA 4NM2A 2JH7A 1RYSA 2P6RA 1ZQCA 3QU4A 1ZD4A 4Y2QA 1Z00A 4NLBA 5J0SA 3AMZA 2MUTB 2CN1A 2ZIUB 2W3SA 3WKAA 4BDPA 1KL9A 5AICA 5KFAA 2KVCA 4RPYA 5AKZA 1JRPA 3K75D 4K4GA 5CP2A 2FMQA 5DGAA 1S0MA 3K4GA 4KLMA 1JN3A 4MF8A 2K60A 3PX0A 1VDVA 3V7JA 3MR3A 4LZGA 1NK5A 4DL2A 4DQPA 1NJXA 7ICEA 2DWQA 9ICQA 4J9PA 3N7PD 4YMOA 3GIIA 3K1ZA 3QUBA 4IC9A 4M9NA 2XO7A 2W03A 4PZNA 1NZBA 5KFVA 4BJQA 4RT3A 3RBDA 9ICAA 5C0YA 4IQWA 3RRHA 4O0IA 4QWCA 4LVSA 1NJYA 4NL9C 2G07A 4EBEA 3MC1A 3ONNA 9ICLA 1KRPA 1OXJA 3ZD9A 2AGQA 3DEEA 4R65A 5ALPA 2RDJA 3OTQA 5F9NA 4UB6U 3ALRA 1KTQA 1JXLA 2D3DA 1V85A 2ZIUA 3Q8RB 2IBKA 8ICIA 2F1IA 2DL0A 4UB3A 1Q3VA 1ZQWA 4O3PA 2BGWA 2H3ZA 2HHUA 2HVHA 5J2CA 5GTIU 8ICZA 5J2KA 2FPLA 4JUZA 3EZ5A 2ODGA 3N4MB 1KN5A 3RR7A 3KKAA 1N63A 4M9GA 2R8JA 5AK3A 5HNKA 3C1ZA 3LVVA 5ALFA 5EOZA 5KFEA 2BHNA 2GH1A 3C2LA 2KIVA 2E1FA 4KLTA 9ICMA 3RH5A 2IA6A 4B9MA 2NRVA 1L8LA 4R66A 3KHGA 1A0PA 2LMRA 3QU5A 4JK1A 3C1YA 1ZQGA 4RQ7A 3Q8SB 1QSLA 3KTQA 1L3TA 4PHDA 1X40A 5ALGA 3QXGA 4DWIA 2JV3A 4Y2XA 4QIWF 4DSFA 1IM4A 4GC6A 4I2BA 4QNLA 1GO3F 2YMMA 1ZQMA 1B43A 4Q44A 2W55A 4P4PA 3EWAA 4DCCA 4F4ZA 2DFLA 3B0YA 3HKZF 1L8OA 3S6JA 2P35A 4ECVA 1TK0A 3ZI4A 5KFNA 5KFCA 3RJFA 4I27A 5KL1B 1ZQTA 4CGZA 5KT4A 4ECSA 3NTUA 2KVSA 2ZUCA 5AKGA 2W7OA 5J8YA 4RU9A 2PXIA 5KTQA 3KHLA 2ZJ8A 3C2MA 4IRDA 5DB6A 4UAWA 1TV9A 7ICUA 1NOMA 2JEIA 2P66A 4CNQA 4QWEA 4KLFA 3QZ8A 3H8SA 5EE1A 2NRZA 4ECRA 3RJJA 1VJ5A 2JMGA 4B9VA 1WCNA 3M6ZA 3QUQA 5KL8B 5J0PA 4J9NA 1N5WA 3BS7A 1SKWA 1IXRA 4QZFA 5AIAA 1ZQIA 3PR4A 4OCZA 3TFRA 1NKEA 3RF9A 2ZIWB 5ALUA 4ED2A 2R8GA 4KMOB 1FFVA 3KBBA 5KFKA 4EYHB 3AUOA 2AQ4A 2W8LA 4ED1A 5CR0A 2Y1IA 1RZTA 3KFUF 1ZQOA 4O5KA 1HUOA 3EUB2 4JWMA 3M8RA 4RZRA 3SV4A 3QUCA 1D9FA 1QQ5A 3LWLA 2KKVA 3KD3A 4J9RA 2ASJA 4FBTA 4ED8A 4JB3A 2GWSA 3RJHA 5AI9A 3PW7A 3L3FX 4EZ9A 3WKCA 3GDXA 8ICXA 4JMUA 1RXVA 2V9WA 4F91B 1SV4A 2PKEA 2AXTU 2KKPA 2K8BB 5AM4A 1IG6A 4DSIA 2CPRA 5KG5A 5DKWA 4Z6FA 4OJLA 3EYZA 1UA1A 5KFWA 2ISPA 4ZOHC 1RM6C 9ICEA 3SAFA 3C29A 2JEGA 4K4HA 3SD7A 4DSJA 9ICJA 1L7NA 1RQLA 5AI4A 3ZDEA 2JR5A 1WWVA 5JRTA 4DFJA 3NVYA 5KG4A 5J2JA 3JPQA 1ZQYA 3UQ2A 4C8NA 7ICVA 3H40A 4DQSA 3SR6A 1Q3UA 2ZIWA 3GQCA 4GXIA 4MF2A 1RYUA 8ICMA 3G6VA 2W9AA 5D4BA 3TADA 5AKLA 1JUDA 3KZIU 5KFOA 3HP6A 3FM9A 5KFSA 4TUQA 3HT3A 3ZDDA 3DDHA 1NJZA 4BGDA 5DG8A 3CYMA 3UPQA 5AKHA 3ED5A 1ZQDA 1X66A 3C5GA 4Y2TA 8ICTA 3BZCA 7ICPA 5ALOA 1NNLA 5KFJA 4P0QB 2KFNA 1V38A 1KLNA 2ASDA 2G0AA 4I29A 2YQEA 5KG1A 2MRLA 1S77D 1SKSA 2G08A 3LK9A 1ZXIA 3UXNA 1NK4A 3EPGA 4KITB 1Z3EB 4QZCA 4Z6DA 4GXJA 1NK0A 3PZPA 1DXSA 5DBBA 4EBCA 1H38A 4OO1J 3ETRA 3PO4A 4KLOA 4FZMA 4CDGA 4C7ZA 1V97A 4PJ0U 2QB0B 3PW5A 4YR2A 4KLQA 3F2CA 3AL0B 5J0QA 4C8MA 4E0DA 1X9MA 1S76D 5CA7A 4ED7A 1ZRMA 5GTHU 2JRZA 3JPNA 2FLLA 5KFUA 1NKBA 5ALNA 2KNJA 2W9BB 2Y0SF 5ALVA 4J9MA 4GXKA 1S0VA 4F5QA 1NK7A 1DGSA 1N62A 4QJFB 2R8HA 4ED0A 1SL1A 2C2RA 8ICRA 2K89A 3QEAZ 1L7MA 2FE9A 3V72A 2XY7A 1RPLA 1ZJNA 8ICWA 1Y88A 2F2AB 5KG7A 4J9SA 2IHNA 4IR9A 3SENA 5IIOA 1UQVA 4Q45A 2UVWA 8ICFA 4DS4A 2XI9A 1TFRA 2A19A 5KFPA 2QKQA 1U49A 5J29A 4IR1A 5J2GA 2WAQF 3DV9A 1JROA 1ZQAA 2CXYA 3CNHA 2HBLA 5KAFU 4UBBA 1ZQRA 2LBOA 1L7PA 1QQ6A 4O3OA 2ZG6A 5T14A 3THVA 5DLGA 1HIWA 4KN4A 2EAMA 2I6XA 4UB8U 1P7DA 2QB1A 1L3VA 5ALLA 3RB3A 5DQHA 3T5KA 4F4XA 1UA0A 4YMNA 1NK8A 3A0HU 3HWTA 5KFBA 5ALKA 4UAYA 3V7KA 3NVWA 3WKDA 4DEZA 4QZAA 2EANA 5DBAA 4NLKA 8ICQA 3BS5A 5DBCA 2UVRA 4G3IA 1Z4OA 3H8JA 5B5EU 2QARB 4C8LA 2F44A 5KFHA 2A1JB 1V9PA 4M9JA 5FP0A 1U48A 3H8MA 2WFAA 1ZQFA 3GILA 2JEFA 1ZQ1C 3N7RC 1ZYQA 3MR5A 2K4HA 2ZUBA 4GIBA 4UARA 2QLTA 2WF5A 5AM2A 4F4KA 2K4PA 5ALXA 3RH6A 4F4WA 4QIWC 1BGXT 4I2EA 3PNCA 2WF6A 3D2NA 1IV8A 2VJ5A 4RQ6A 8ICJA 2WF7A 4K4IA 3BJYA 3HKZC 4QZEA 3SAGA 3OPXA 4F4YA 2W9MA 4UB1A 3JPRA 1ZQSA 3QU9A 2DKXA 1VLBA 4Z6CA 1DOQA 5AM1A 3PSPA 1WWUA 2ZIXB 4OJPA 3TAQA 5KFTA 4EBDA 1LB2B 4RNOA 4JWNA 3PV8A 5BOMA 4RQ4A 5AM5A 4JV2A 2FLNA 3A0BU 3KHHA 1WYGA 1SWVA 3GIJA 4AYBF 5KG6A 1ZOLA 5HP4A 3GV8B 3PVXA 1BPBA 3WKBA 2A1JA 1BPDA 3U26A 2PI5A 3RFAA 2ZTEA 2LM4A 4FE3A 1SKRA 5L1KA 2LYHA 5J8YC 4M2YA 2C2EA 4I2FA 4MHVA 3GIMA 4Z6EA 1SWWA 2HCFA 5ALIA 2BCVA 1L3SA 4EEYA 1F44A 2I5HA 5DDMA 2IMWP 2E1EA 2Y9UA 3H8WA 3I1YA 1BVSA 3V7LA 9ICUA 4RUCA 4P0PB 2LYBA 3JPSA 1U9LA 4DF4A 4NY8A 2HHXA 2FLPA 4PGYA 4Y2UA 4UQGA 2MUTA 5DDYA 2ISOA 3PSIA 4UASA 1U45A 1DK3A 2GOLA 3KHRA 3PX6A 5EE9A 4DO9A
chains in the Genus database with same CATH topology
2JR5A 1X6JA 1X6IA 2LM4A 1PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR5 A;  1X6J A;  1X6I A;  2LM4 A;  1PUZ A; 
#chains in the Genus database with same CATH topology
 4R64 A;  8ICL A;  2VAN A;  5IIJ A;  1B4F A;  1YT3 A;  4M47 A;  1S10 A;  4J9K A;  1LVH A;  1N2X A;  3H0L B;  2EAO A;  4O5C A;  3N28 A;  4YXM A;  4DQR A;  3TAC B;  3M7D A;  5KFQ A;  3NUQ A;  1QSS A;  1UHU A;  4RQ2 A;  2F1H A;  4B6J A;  3QZ7 A;  1KFD A;  1BPX A;  5EWG A;  1OUQ A;  4IRC A;  3Q8P B;  3RJK A;  5EWF A;  1MC8 A;  4ECX A;  4Y2V A;  4UAZ A;  2VJ4 A;  4US9 A;  3WKE A;  1ZET A;  7ICN A;  3ICX A;  1SB3 C;  2IOF K;  2OEH A;  1TK8 A;  4ELU A;  5BPC A;  5J0X A;  1T8E A;  1KEJ A;  3TAP A;  2BQR A;  4C8O A;  2DPI A;  3D2S A;  4UB2 A;  4I2G A;  3MFH A;  5JUM A;  4IRK A;  4M6W B;  5F9L A;  4MEX A;  2BCR A;  1X6I A;  2KK0 A;  4RNN A;  1XNS A;  4P0P A;  3PSF A;  2K8C B;  1ZD5 A;  1PUZ A;  4I2J A;  1ZQB A;  4O3M A;  5D49 A;  4DOC A;  2ZUD A;  3ISD A;  2W11 A;  2P6U A;  4U7C A;  5ALJ A;  4I2A A;  2UVV A;  3OJU A;  4YG2 A;  2OYY A;  1XSN A;  3OHA A;  1NJW A;  3AEV A;  4KX3 A;  2XID A;  2YN4 A;  2DF4 B;  5DLF A;  3M8S A;  2NO4 A;  4F71 A;  5J0Y A;  3M9N B;  4USA A;  2KEY A;  4OJ5 A;  2ZTD A;  2OCE A;  2VIX A;  8ICU A;  2KJ5 A;  4O3R A;  3RTV A;  4F92 B;  1SGG A;  4I2H A;  5DG7 A;  1CEZ A;  1SL2 A;  2C22 A;  3B9J A;  4DFM A;  4C8K A;  3PST A;  5IIM A;  5AM0 A;  3ZD8 A;  2PMZ C;  3NGD A;  8ICE A;  2V4Q A;  3ETL A;  5TZV A;  4BXO B;  2Y0S C;  2HBJ A;  2LYA A;  2E5S A;  1A77 A;  3T3F A;  2HI0 A;  3L5K A;  1ZQH A;  2AQ0 A;  3MDA A;  3AQF A;  3VC8 A;  4RT2 A;  3C2K A;  5CRX A;  1KFS A;  3RB0 A;  1O08 A;  4RQN A;  2XGQ A;  4CF4 A;  3ZDA A;  9ICI A;  4FFD A;  1S5L U;  2H3Q A;  3RBE A;  4PZO A;  2NO5 A;  2MSN A;  1C20 A;  2NRW A;  5IIN A;  3BQ2 A;  4MFF A;  1K1Q A;  1SV0 C;  2DPJ A;  3UXO A;  3QX7 A;  2I1Q A;  9ICB A;  1DGJ A;  2KV2 A;  2MA1 A;  2UVU A;  2KD1 A;  3HW8 A;  3UMG A;  2LPE A;  2BDP A;  8ICC A;  3HIL A;  3H0R B;  2JXJ A;  2XC9 A;  1K1S A;  1SXE A;  2LI6 A;  2OHF A;  5CJ7 A;  2AGP A;  3RJI A;  1T7P A;  5AM3 A;  3LVW A;  4J9L A;  5G5G A;  2FPK A;  1TK5 A;  4NLG A;  5III A;  3UXP A;  1PK3 A;  3QEB Z;  3MR2 A;  1ZD2 P;  2B21 A;  5KFY A;  4RQ5 A;  4BXO A;  2DBY A;  5ALQ A;  2KG5 A;  5EE0 A;  7ICT A;  2ZTC A;  3TAN A;  3KZX A;  5AKK A;  1N48 A;  2WB1 F;  3PMN A;  4YXJ A;  5AI8 A;  3PX4 A;  1YZ7 A;  7ICF A;  4YR0 A;  5DG9 A;  4Y2S A;  5E79 U;  4PGX A;  5L1J A;  4XA5 A;  1SIJ A;  8ICN A;  2KN7 A;  4ECU A;  1COO A;  4BWM A;  4R8U B;  1NK9 A;  2NV3 A;  2KFZ A;  7ICO A;  4ZH4 A;  3V6H A;  2BCQ A;  1KBU A;  3PW0 A;  3N7S C;  4GFJ A;  1JI7 A;  4UB4 A;  2HVI A;  2KOB A;  1MN8 A;  4FZL A;  3N97 B;  1MA7 A;  2NRX A;  3GU3 A;  3BQ1 A;  2HOF A;  8ICV A;  1QSY A;  2NRT A;  2KIW A;  5CB1 A;  4EEN A;  2KSO B;  3WK4 A;  2E3T A;  4M9H A;  2FMS A;  2YMQ A;  3PW4 A;  3MAB A;  4DFK A;  3UQ0 A;  3PO5 A;  1QQ7 A;  4R63 A;  4QZI A;  2LKY A;  3V6K A;  4F93 B;  2HHQ A;  2HBM A;  2LHT A;  3GV5 B;  1ECW A;  2DKZ A;  1TAQ A;  3FDS A;  1U47 A;  2RDI A;  3AU6 A;  5AI0 A;  2W3R A;  5J2E A;  4YCX A;  1L6N A;  2JGA A;  5J2B A;  1EXN A;  1ZQL A;  4BX9 C;  1MSW D;  3H4B A;  2KTQ A;  4IQU A;  4DFP A;  3BZK A;  2KZ3 A;  4J9O A;  5ALW A;  3T5H A;  2GLE A;  1BPY A;  5KFX A;  3MFI A;  4MFC A;  9ICK A;  1XO1 A;  4NXZ A;  4AYB C;  3D6J A;  1T3Q A;  3EPI A;  2LM1 A;  2OXO A;  2J6S A;  2AJQ A;  2YML A;  4B9N A;  1X42 A;  4Y2J A;  3D2Q A;  4FBU A;  4P0Q A;  2BPC A;  4UAU A;  5AI6 A;  1XO0 A;  1QLN A;  3H0M B;  2XCA A;  4XQ8 A;  1BNP A;  1X2I A;  1KFT A;  2E8O A;  9ICX A;  1Q8K A;  5J0R A;  5KFR A;  2F77 X;  3IRU A;  8ICA A;  2VA2 A;  5IIK A;  4PL2 A;  2Y1J A;  1COK A;  4DL4 A;  2KJ8 A;  4C80 A;  3UMB A;  1ZQV A;  5AKY A;  4F72 A;  2VA3 A;  4KLD A;  2F3N A;  3AU2 A;  1ZJM A;  4Q8F A;  2QB0 A;  1JMS A;  2W7P A;  3M6K A;  1UCV A;  1SL0 A;  4DLG A;  2KIC A;  3GFK B;  2H5X A;  1WUD A;  4DQI A;  4RQ8 A;  1N61 A;  3IG8 A;  4KLE A;  2KZM A;  2PFN A;  3SQI A;  1B22 A;  4US8 A;  4TUS A;  2H3V A;  3BQ7 A;  3QUT A;  4ICA A;  1T94 A;  4UBC A;  2FJ6 A;  5BOL A;  3RH4 A;  4NWI A;  2KHV A;  2D8C A;  2W9B A;  2HMX A;  5HHH A;  4C4T A;  5KG3 A;  4YN4 A;  7ICK A;  5HR6 A;  2F8L A;  4RQ0 A;  2PFP A;  4ECT A;  3GV7 B;  4KTQ A;  2KP7 A;  3HPO A;  4BWJ A;  5AI5 A;  1A6S A;  1Z00 B;  4O3S A;  4RPX A;  2WF9 A;  5KFG A;  2W43 A;  1L3U A;  4RQ1 A;  1AQ6 A;  5AK4 A;  2EAP A;  3H4D A;  3WK8 A;  4PL1 A;  5L1L A;  1D8B A;  8ICH A;  5ALH A;  5J0W A;  4KLH A;  4YR3 A;  1SXD A;  1N56 A;  1PVP A;  3TFS A;  5ALT A;  2KHQ A;  3NVZ A;  3UM9 A;  4M04 A;  4NLZ A;  2E8M A;  3GIK A;  4EX7 A;  8ICG A;  3KKA C;  7ICG A;  1X6J A;  1KDH A;  4ELV A;  1D8L A;  5J2A A;  4IQV A;  1XU4 A;  4KLS A;  3LYS A;  2A3V A;  3NRZ A;  1SZP A;  5IIL A;  9ICF A;  4F8R A;  2M9N A;  4LJX A;  2OWO A;  1S8O A;  4ELT A;  1MQ3 A;  3JPP A;  3L4P A;  2OM6 A;  2K8A A;  4QZG A;  2YB4 A;  5A0L A;  5JTI A;  3ORY A;  5KT3 A;  3OSN A;  2ZIV B;  5H2F U;  1QCK A;  3NS1 A;  4IS7 A;  4CE6 A;  5ALY A;  3MR6 A;  2ESE A;  4F5N A;  2YMP A;  4EX6 A;  1JX4 A;  3AM9 A;  3Q8Q B;  4DLE A;  4C4S A;  1XS9 D;  2MU2 A;  4C4R A;  5KG0 A;  1ZQX A;  4TUP A;  4J9Q A;  7ICL A;  1WCL A;  3TKA A;  5AIB A;  4DOB A;  1L5U A;  2FMP A;  2PFO A;  4CCH A;  2KE7 A;  4RQ3 A;  2BDU A;  4NM1 A;  4DL3 A;  2WF8 A;  3M9M B;  2QAR A;  4FS1 A;  2J6U A;  2YB1 A;  4UW9 A;  3MDC A;  1S0O A;  2D6F C;  3WK6 A;  3I76 A;  2W04 A;  3MGV A;  3T5L A;  2KJ9 A;  1WG8 A;  3NRW A;  5EWE A;  2EQY A;  1Z1B A;  4QWD A;  2BPG A;  1S97 A;  9ICP A;  5KT2 A;  4CF3 A;  4O5E A;  1UPH A;  1FIQ A;  1FO4 A;  3FC4 A;  4RUA A;  1M6Y A;  4FZN A;  3QE9 Y;  2PFQ A;  4M9L A;  4PGQ A;  4CF5 A;  2ZIV A;  5DQI A;  1NI3 A;  2J6T A;  4O3Q A;  2BCS A;  3JPT A;  2HOI A;  5HR7 A;  1N5X A;  9ICC A;  5KT7 A;  3OJS A;  3PY8 A;  4PHP A;  2ZIX A;  1ZQE A;  2EZY A;  3CRX A;  4ED3 A;  4TQR A;  1PZN A;  3QU7 A;  2JHD A;  5KFL A;  4XRH A;  3IN5 A;  4B9T A;  2WHE A;  7ICS A;  4UB5 A;  1T3N A;  1TKD A;  2IOH A;  4Q8E A;  5CEH A;  3MBY A;  3WK9 A;  3WK7 A;  1PVR A;  3AN1 A;  4I2D A;  2XY5 A;  3EW9 A;  1X9W A;  3HJE A;  1Z1V A;  3SMV A;  3RR8 A;  9ICW A;  4QWA A;  3IG5 A;  2WB1 C;  2HDO A;  2EZX A;  1CUK A;  1LKY B;  1BNO A;  2B0C A;  5AKE A;  3TAR A;  2Y9T A;  5J2F A;  1RXW A;  3F2B A;  1F5S A;  3RB6 A;  1ED1 A;  5KG2 A;  4MFA A;  1T4G A;  3TI0 A;  2BQ3 A;  3IHQ B;  5CHG A;  1X9X A;  4MEY A;  3F5E A;  1ARO P;  1NZP A;  2BCU A;  5DGB A;  5DB9 A;  3RRG A;  4ECW A;  4KLU A;  5KNI A;  3WK5 A;  2JEJ A;  4NLN A;  4FO6 A;  3MGH A;  1UT8 A;  5TIS U;  3IP4 B;  5ALS A;  1ZQK A;  3H7I A;  2V4R A;  2BR0 A;  3TAD C;  3RJE A;  5KFI A;  1YZ6 A;  5HHI A;  8ICY A;  1ZQP A;  4F5R A;  1ZQZ A;  2N1R A;  2Q0Z X;  3HRD D;  3SV3 A;  4B9U A;  3CP8 A;  4NJ8 A;  1XC9 A;  1D9D A;  4DS5 A;  1ZRN A;  4Y2Y A;  1S0N A;  7ICR A;  3IDW A;  1ZD3 A;  4KMU A;  3I28 A;  4F3O A;  2G5H B;  2W54 A;  5DQG A;  4Y2P A;  2AHO B;  9ICR A;  2BQU A;  1KKX A;  4U6P A;  2VA8 A;  1RQN A;  4YQW A;  3SI8 A;  1NK6 A;  1PVQ A;  1LKY A;  2PI4 A;  4B9L A;  1TAM A;  4JV0 A;  4NL9 A;  2Z7J A;  7ICM A;  1SZH A;  2Q4T A;  5L9X A;  1UT5 A;  2B6G A;  4DSK A;  4M6W A;  2K4I A;  4A8E A;  5AKJ A;  5HML A;  4C0Z A;  4ECY A;  1URJ A;  4ECZ A;  3E0F A;  5L1M A;  5KFF A;  3OGU A;  4OJO A;  3K1R B;  2R18 A;  4IL6 U;  1J97 A;  2ZXH A;  2E8P A;  2AGO A;  2I9G A;  1TVA A;  4QW9 A;  3ZDC A;  2HHS A;  2HHV A;  4M0A A;  2VKQ A;  3ISC A;  4PHA A;  2HHT A;  7ICQ A;  4DQQ A;  1Z19 A;  1O03 A;  7ICH A;  2DUY A;  1BPE A;  4QWB A;  2WAQ C;  3J81 j;  3SYZ A;  4ED6 A;  2HHW A;  5KT6 A;  2EDU A;  9ICG A;  2M0N A;  1K5O A;  4GC7 A;  5AK5 A;  4P2H A;  2AU0 A;  2E8N A;  2R8K A;  5DB7 A;  2RQ5 A;  4PPX A;  7ICJ A;  3RJG A;  4YFK A;  4G9B A;  2AH5 A;  3TQ1 A;  3ZDB A;  2XIC A;  4QZ9 A;  4O9M A;  1CRX A;  3O0F A;  3VCB A;  3Q8K A;  2C2D A;  2HW3 A;  1N60 A;  2IOF A;  4QZH A;  4YD1 A;  4TUR A;  1CI4 A;  4QZB A;  2XGP A;  4DL5 A;  5KFM A;  2XY6 A;  2ZXI A;  4F50 A;  5ALR A;  3R9K A;  1C7Y A;  4I2I A;  1RG6 A;  4F5O A;  4DL6 A;  4HAI A;  3SAH A;  4IQT A;  2DQN B;  2FI1 A;  5ALD A;  4KLJ A;  3FAH A;  1DRG A;  3PR5 B;  3E58 A;  2OH2 A;  1RYR A;  2JH1 A;  4EEL A;  1Q46 A;  3QYP A;  2CRX A;  5G5H A;  3T5J A;  2WTF A;  4KLI A;  1ZQN A;  5ALZ A;  1S9F A;  8ICS A;  5DB8 A;  1KQQ A;  4I28 A;  2ES6 A;  2H3F A;  4CRX A;  3BQ0 A;  2KMD A;  1KSP A;  5J0O A;  9ICS A;  4YMM A;  5KFZ A;  3C5F A;  3QNM A;  4I2C A;  2RLT A;  8ICP A;  2MAX A;  1FEZ A;  4P4M A;  4DF8 A;  3PW2 A;  5KAI U;  4LZD A;  4DSE A;  4C7Y A;  4OJ6 A;  4DL7 A;  3LDA A;  1ZQJ A;  3GZF A;  2W9C B;  1A76 A;  4EEK A;  3LWM A;  2A1A A;  3NAS A;  1J2N A;  9ICO A;  3F5A A;  1RDF A;  4DSL A;  3OSP A;  1MQ2 A;  5J2I A;  1PK1 B;  3AQE A;  3F2D A;  3E2E A;  5C5J A;  2W8K A;  9ICV A;  8ICK A;  5ALM A;  1XWL A;  3NVV A;  1D8Y A;  1JAL A;  5J0T A;  3BDP A;  3ISB A;  1TAU A;  2HSZ A;  4EZ6 A;  2ZJA A;  1L7O A;  4YVZ A;  1OW5 A;  2ALZ A;  4QZ8 A;  3Q8M A;  3RB4 A;  4KLL A;  3IM1 A;  2XCP A;  4OD0 A;  3SEI A;  2ZJ5 A;  4YD2 A;  2KZZ A;  5AKI A;  4Q43 A;  2ATL A;  4UAV A;  4R8U A;  4P4O A;  2RHF A;  2R8I A;  2PMZ F;  4Y2R A;  5J0U A;  4ECQ A;  1SV0 A;  3UMC A;  2JZB B;  2EH9 A;  3RAX A;  4O3N A;  4PHE A;  8ICB A;  1FFU A;  2YX8 A;  1QTM A;  2F76 X;  4QZD A;  3BQT A;  2XVT A;  3C23 A;  4DFD A;  2F8K A;  5EE3 A;  1XSL A;  8ICO A;  4NLC A;  2KSO A;  2O6K A;  4GLX A;  4AP9 A;  2W9C A;  3BS5 B;  9ICN A;  4TQS A;  3M1Y A;  3G6X A;  4DOA A;  1HUZ A;  1NKC A;  2G09 A;  1HEK A;  1BPZ A;  2HOQ A;  4PH5 A;  1KW4 A;  4YP3 A;  1PK1 A;  4KX5 A;  2FPM A;  7ICI A;  5HMM A;  4X5V A;  1QH9 A;  3QU2 A;  3V6J A;  1IIP A;  4UAT A;  2C28 A;  4EYI B;  4QW8 A;  4F5P A;  5CWR A;  2F1J A;  3RAQ A;  2BKE A;  3CW2 C;  2K4E A;  5J2H A;  9ICH A;  4F2R A;  5B66 U;  5J2D A;  1B0X A;  4RNM A;  3B0X A;  3MGI A;  4F2S A;  3HX0 A;  2YTU A;  3FYH A;  3F53 A;  4KN7 A;  2JZB A;  3G6Y A;  4NV0 A;  4RPZ A;  5KFD A;  4B9S A;  5JU5 A;  4RQM A;  1ZQQ A;  1X9S A;  5ALE A;  2RP5 A;  2NYV A;  3KOO A;  5D46 A;  2DGZ A;  3WU2 U;  2FDR A;  2G06 A;  2YY6 A;  1TE2 A;  2GO7 A;  4J03 A;  5AKX A;  1HJP A;  4ACO A;  1LV5 A;  2HBK A;  5AHX A;  2BPF A;  1U4B A;  5KT5 A;  5F3X B;  4JV1 A;  2ASL A;  9ICT A;  5K4L A;  4BUG A;  4KLG A;  2IHM A;  3IV6 A;  4FS2 A;  3OHB A;  2G5I B;  1DK2 A;  1Z4N A;  4WJ3 B;  2RRD A;  1F0M A;  4HYK A;  5AK6 A;  1J2M A;  5L1I A;  3JPO A;  2BZF A;  3Q8L A;  3PML A;  1ZQU A;  2EZZ A;  2H3I A;  3M9O B;  1JXE A;  3T79 A;  4XUS A;  1JIH A;  3SZ2 A;  1XSP A;  3C28 A;  3C21 A;  2L5Y A;  4NM2 A;  2JH7 A;  1RYS A;  2P6R A;  1ZQC A;  3QU4 A;  1ZD4 A;  4Y2Q A;  1Z00 A;  4NLB A;  5J0S A;  3AMZ A;  2MUT B;  2CN1 A;  2ZIU B;  2W3S A;  3WKA A;  4BDP A;  1KL9 A;  5AIC A;  5KFA A;  2KVC A;  4RPY A;  5AKZ A;  1JRP A;  3K75 D;  4K4G A;  5CP2 A;  2FMQ A;  5DGA A;  1S0M A;  3K4G A;  4KLM A;  1JN3 A;  4MF8 A;  2K60 A;  3PX0 A;  1VDV A;  3V7J A;  3MR3 A;  4LZG A;  1NK5 A;  4DL2 A;  4DQP A;  1NJX A;  7ICE A;  2DWQ A;  9ICQ A;  4J9P A;  3N7P D;  4YMO A;  3GII A;  3K1Z A;  3QUB A;  4IC9 A;  4M9N A;  2XO7 A;  2W03 A;  4PZN A;  1NZB A;  5KFV A;  4BJQ A;  4RT3 A;  3RBD A;  9ICA A;  5C0Y A;  4IQW A;  3RRH A;  4O0I A;  4QWC A;  4LVS A;  1NJY A;  4NL9 C;  2G07 A;  4EBE A;  3MC1 A;  3ONN A;  9ICL A;  1KRP A;  1OXJ A;  3ZD9 A;  2AGQ A;  3DEE A;  4R65 A;  5ALP A;  2RDJ A;  3OTQ A;  5F9N A;  4UB6 U;  3ALR A;  1KTQ A;  1JXL A;  2D3D A;  1V85 A;  2ZIU A;  3Q8R B;  2IBK A;  8ICI A;  2F1I A;  2DL0 A;  4UB3 A;  1Q3V A;  1ZQW A;  4O3P A;  2BGW A;  2H3Z A;  2HHU A;  2HVH A;  5J2C A;  5GTI U;  8ICZ A;  5J2K A;  2FPL A;  4JUZ A;  3EZ5 A;  2ODG A;  3N4M B;  1KN5 A;  3RR7 A;  3KKA A;  1N63 A;  4M9G A;  2R8J A;  5AK3 A;  5HNK A;  3C1Z A;  3LVV A;  5ALF A;  5EOZ A;  5KFE A;  2BHN A;  2GH1 A;  3C2L A;  2KIV A;  2E1F A;  4KLT A;  9ICM A;  3RH5 A;  2IA6 A;  4B9M A;  2NRV A;  1L8L A;  4R66 A;  3KHG A;  1A0P A;  2LMR A;  3QU5 A;  4JK1 A;  3C1Y A;  1ZQG A;  4RQ7 A;  3Q8S B;  1QSL A;  3KTQ A;  1L3T A;  4PHD A;  1X40 A;  5ALG A;  3QXG A;  4DWI A;  2JV3 A;  4Y2X A;  4QIW F;  4DSF A;  1IM4 A;  4GC6 A;  4I2B A;  4QNL A;  1GO3 F;  2YMM A;  1ZQM A;  1B43 A;  4Q44 A;  2W55 A;  4P4P A;  3EWA A;  4DCC A;  4F4Z A;  2DFL A;  3B0Y A;  3HKZ F;  1L8O A;  3S6J A;  2P35 A;  4ECV A;  1TK0 A;  3ZI4 A;  5KFN A;  5KFC A;  3RJF A;  4I27 A;  5KL1 B;  1ZQT A;  4CGZ A;  5KT4 A;  4ECS A;  3NTU A;  2KVS A;  2ZUC A;  5AKG A;  2W7O A;  5J8Y A;  4RU9 A;  2PXI A;  5KTQ A;  3KHL A;  2ZJ8 A;  3C2M A;  4IRD A;  5DB6 A;  4UAW A;  1TV9 A;  7ICU A;  1NOM A;  2JEI A;  2P66 A;  4CNQ A;  4QWE A;  4KLF A;  3QZ8 A;  3H8S A;  5EE1 A;  2NRZ A;  4ECR A;  3RJJ A;  1VJ5 A;  2JMG A;  4B9V A;  1WCN A;  3M6Z A;  3QUQ A;  5KL8 B;  5J0P A;  4J9N A;  1N5W A;  3BS7 A;  1SKW A;  1IXR A;  4QZF A;  5AIA A;  1ZQI A;  3PR4 A;  4OCZ A;  3TFR A;  1NKE A;  3RF9 A;  2ZIW B;  5ALU A;  4ED2 A;  2R8G A;  4KMO B;  1FFV A;  3KBB A;  5KFK A;  4EYH B;  3AUO A;  2AQ4 A;  2W8L A;  4ED1 A;  5CR0 A;  2Y1I A;  1RZT A;  3KFU F;  1ZQO A;  4O5K A;  1HUO A;  3EUB 2;  4JWM A;  3M8R A;  4RZR A;  3SV4 A;  3QUC A;  1D9F A;  1QQ5 A;  3LWL A;  2KKV A;  3KD3 A;  4J9R A;  2ASJ A;  4FBT A;  4ED8 A;  4JB3 A;  2GWS A;  3RJH A;  5AI9 A;  3PW7 A;  3L3F X;  4EZ9 A;  3WKC A;  3GDX A;  8ICX A;  4JMU A;  1RXV A;  2V9W A;  4F91 B;  1SV4 A;  2PKE A;  2AXT U;  2KKP A;  2K8B B;  5AM4 A;  1IG6 A;  4DSI A;  2CPR A;  5KG5 A;  5DKW A;  4Z6F A;  4OJL A;  3EYZ A;  1UA1 A;  5KFW A;  2ISP A;  4ZOH C;  1RM6 C;  9ICE A;  3SAF A;  3C29 A;  2JEG A;  4K4H A;  3SD7 A;  4DSJ A;  9ICJ A;  1L7N A;  1RQL A;  5AI4 A;  3ZDE A;  2JR5 A;  1WWV A;  5JRT A;  4DFJ A;  3NVY A;  5KG4 A;  5J2J A;  3JPQ A;  1ZQY A;  3UQ2 A;  4C8N A;  7ICV A;  3H40 A;  4DQS A;  3SR6 A;  1Q3U A;  2ZIW A;  3GQC A;  4GXI A;  4MF2 A;  1RYU A;  8ICM A;  3G6V A;  2W9A A;  5D4B A;  3TAD A;  5AKL A;  1JUD A;  3KZI U;  5KFO A;  3HP6 A;  3FM9 A;  5KFS A;  4TUQ A;  3HT3 A;  3ZDD A;  3DDH A;  1NJZ A;  4BGD A;  5DG8 A;  3CYM A;  3UPQ A;  5AKH A;  3ED5 A;  1ZQD A;  1X66 A;  3C5G A;  4Y2T A;  8ICT A;  3BZC A;  7ICP A;  5ALO A;  1NNL A;  5KFJ A;  4P0Q B;  2KFN A;  1V38 A;  1KLN A;  2ASD A;  2G0A A;  4I29 A;  2YQE A;  5KG1 A;  2MRL A;  1S77 D;  1SKS A;  2G08 A;  3LK9 A;  1ZXI A;  3UXN A;  1NK4 A;  3EPG A;  4KIT B;  1Z3E B;  4QZC A;  4Z6D A;  4GXJ A;  1NK0 A;  3PZP A;  1DXS A;  5DBB A;  4EBC A;  1H38 A;  4OO1 J;  3ETR A;  3PO4 A;  4KLO A;  4FZM A;  4CDG A;  4C7Z A;  1V97 A;  4PJ0 U;  2QB0 B;  3PW5 A;  4YR2 A;  4KLQ A;  3F2C A;  3AL0 B;  5J0Q A;  4C8M A;  4E0D A;  1X9M A;  1S76 D;  5CA7 A;  4ED7 A;  1ZRM A;  5GTH U;  2JRZ A;  3JPN A;  2FLL A;  5KFU A;  1NKB A;  5ALN A;  2KNJ A;  2W9B B;  2Y0S F;  5ALV A;  4J9M A;  4GXK A;  1S0V A;  4F5Q A;  1NK7 A;  1DGS A;  1N62 A;  4QJF B;  2R8H A;  4ED0 A;  1SL1 A;  2C2R A;  8ICR A;  2K89 A;  3QEA Z;  1L7M A;  2FE9 A;  3V72 A;  2XY7 A;  1RPL A;  1ZJN A;  8ICW A;  1Y88 A;  2F2A B;  5KG7 A;  4J9S A;  2IHN A;  4IR9 A;  3SEN A;  5IIO A;  1UQV A;  4Q45 A;  2UVW A;  8ICF A;  4DS4 A;  2XI9 A;  1TFR A;  2A19 A;  5KFP A;  2QKQ A;  1U49 A;  5J29 A;  4IR1 A;  5J2G A;  2WAQ F;  3DV9 A;  1JRO A;  1ZQA A;  2CXY A;  3CNH A;  2HBL A;  5KAF U;  4UBB A;  1ZQR A;  2LBO A;  1L7P A;  1QQ6 A;  4O3O A;  2ZG6 A;  5T14 A;  3THV A;  5DLG A;  1HIW A;  4KN4 A;  2EAM A;  2I6X A;  4UB8 U;  1P7D A;  2QB1 A;  1L3V A;  5ALL A;  3RB3 A;  5DQH A;  3T5K A;  4F4X A;  1UA0 A;  4YMN A;  1NK8 A;  3A0H U;  3HWT A;  5KFB A;  5ALK A;  4UAY A;  3V7K A;  3NVW A;  3WKD A;  4DEZ A;  4QZA A;  2EAN A;  5DBA A;  4NLK A;  8ICQ A;  3BS5 A;  5DBC A;  2UVR A;  4G3I A;  1Z4O A;  3H8J A;  5B5E U;  2QAR B;  4C8L A;  2F44 A;  5KFH A;  2A1J B;  1V9P A;  4M9J A;  5FP0 A;  1U48 A;  3H8M A;  2WFA A;  1ZQF A;  3GIL A;  2JEF A;  1ZQ1 C;  3N7R C;  1ZYQ A;  3MR5 A;  2K4H A;  2ZUB A;  4GIB A;  4UAR A;  2QLT A;  2WF5 A;  5AM2 A;  4F4K A;  2K4P A;  5ALX A;  3RH6 A;  4F4W A;  4QIW C;  1BGX T;  4I2E A;  3PNC A;  2WF6 A;  3D2N A;  1IV8 A;  2VJ5 A;  4RQ6 A;  8ICJ A;  2WF7 A;  4K4I A;  3BJY A;  3HKZ C;  4QZE A;  3SAG A;  3OPX A;  4F4Y A;  2W9M A;  4UB1 A;  3JPR A;  1ZQS A;  3QU9 A;  2DKX A;  1VLB A;  4Z6C A;  1DOQ A;  5AM1 A;  3PSP A;  1WWU A;  2ZIX B;  4OJP A;  3TAQ A;  5KFT A;  4EBD A;  1LB2 B;  4RNO A;  4JWN A;  3PV8 A;  5BOM A;  4RQ4 A;  5AM5 A;  4JV2 A;  2FLN A;  3A0B U;  3KHH A;  1WYG A;  1SWV A;  3GIJ A;  4AYB F;  5KG6 A;  1ZOL A;  5HP4 A;  3GV8 B;  3PVX A;  1BPB A;  3WKB A;  2A1J A;  1BPD A;  3U26 A;  2PI5 A;  3RFA A;  2ZTE A;  2LM4 A;  4FE3 A;  1SKR A;  5L1K A;  2LYH A;  5J8Y C;  4M2Y A;  2C2E A;  4I2F A;  4MHV A;  3GIM A;  4Z6E A;  1SWW A;  2HCF A;  5ALI A;  2BCV A;  1L3S A;  4EEY A;  1F44 A;  2I5H A;  5DDM A;  2IMW P;  2E1E A;  2Y9U A;  3H8W A;  3I1Y A;  1BVS A;  3V7L A;  9ICU A;  4RUC A;  4P0P B;  2LYB A;  3JPS A;  1U9L A;  4DF4 A;  4NY8 A;  2HHX A;  2FLP A;  4PGY A;  4Y2U A;  4UQG A;  2MUT A;  5DDY A;  2ISO A;  3PSI A;  4UAS A;  1U45 A;  1DK3 A;  2GOL A;  3KHR A;  3PX6 A;  5EE9 A;  4DO9 A; 
#chains in the Genus database with same CATH homology
 2JR5 A;  1X6J A;  1X6I A;  2LM4 A;  1PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...