1PUZA

Solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
82
Chain Sequence
MMVFDDIAKRKIRFQTRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKIRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis reveals a distinct 5-helix bundle.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 20
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1puzA00
2JR5A 2LM4A 1X6JA 1X6IA 1PUZA
chains in the Genus database with same CATH superfamily
4M6WA 2HHXA 1DGJA 3F5EA 4MF8A 1JUDA 4USAA 3PR4A 4I2BA 3B0YA 8ICCA 4F2RA 2FJ6A 3SV3A 4US9A 3AMZA 2BPFA 4C4SA 3N7RC 4GC6A 1ZD3A 3QEAZ 4AP9A 5ALRA 9ICCA 4R8UA 3WKDA 2DUYA 3KTQA 1NKBA 2RP5A 5J0OA 1Q3UA 7ICSA 4I27A 2JRZA 5IIJA 3Q8RB 1Q3VA 1K1SA 2KG5A 4O3NA 2AGOA 3H8JA 7ICMA 5AKJA 2F77X 2WF8A 4CGZA 3M9MB 2LHTA 2BCRA 5KFYA 2KOBA 4NWIA 2ZIXA 4BX9C 9ICTA 3WU2U 2KKVA 3HJEA 1SWVA 5AKHA 3JPPA 2DKXA 1ZQXA 8ICYA 2CN1A 2ZIUB 2KEYA 4OO1J 1KL9A 1COOA 3SAGA 5KFKA 2NYVA 4Y2UA 7ICUA 1HJPA 7ICFA 4MEYA 5ALGA 3ZDCA 4M9JA 9ICPA 2WF5A 4DLEA 3CW2C 5KFVA 1ZQRA 2W9MA 4QZ8A 4ECXA 9ICOA 4RQ2A 2R8IA 1KTQA 5J8YC 2QB1A 2HHTA 2ISPA 4B9MA 2QARA 1ZXIA 2AHOB 3IDWA 2FDRA 4PL2A 9ICGA 1D8LA 1NK9A 1LKYB 2K4HA 5CB1A 5KG5A 1WYGA 4ZH4A 9ICBA 4PZOA 9ICIA 2WF6A 4P4PA 2KN7A 4NLZA 2MAXA 2XY6A 1ZQAA 2JEIA 4FFDA 5L9XA 1UHUA 3RJGA 4P0PB 3QU2A 2VJ5A 4ED8A 5DBBA 2DPIA 1PK1B 2ALZA 4YMMA 3OGUA 3KBBA 1Z00A 3ETLA 4RNOA 2N1RA 3OJUA 1FO4A 1XSPA 3KFUF 4F5PA 2H3ZA 2A1JB 1V38A 4F92B 1KFSA 1K1QA 2PFPA 3IRUA 5AKZA 3QU4A 1ZQEA 2WF9A 1L3SA 1T8EA 5G5HA 2XGPA 3H7IA 4QZ9A 4KLSA 4MFAA 3QYPA 5CWRA 4ECTA 2UVVA 4PGQA 1NJYA 3NRZA 5HHIA 1ZOLA 3H0MB 2W04A 1L7PA 4XA5A 2F44A 2W03A 2E1FA 4UB3A 5AM4A 4GLXA 5IILA 3UMCA 1HUOA 4J9MA 4DOAA 2H5XA 4RQ5A 4ELUA 3H4DA 1N48A 4C4RA 3TANA 3OSNA 2MSNA 2W8LA 1ZQSA 1TK0A 5DB6A 1XU4A 4WJ3B 4YCXA 2BDPA 1SV4A 4I2GA 3RJIA 2BDUA 3SENA 1TV9A 1PVPA 1S0MA 9ICNA 2P6RA 8ICUA 4IQTA 1BPBA 3NTUA 5J2HA 1D9DA 4R66A 2HOQA 1SV0C 3RJHA 2PXIA 3HP6A 2PMZC 1BPXA 1F44A 2K8AA 3RBDA 2F1HA 1UA1A 7ICPA 1SIJA 4F2SA 3V6HA 3G6VA 2ODGA 4F4ZA 3PR5B 9ICVA 1O03A 3PX0A 4KLFA 1GO3F 1TAMA 5A0LA 5DBCA 3PO4A 4Y2VA 3RB0A 4IQWA 4O5KA 1FEZA 4KLJA 3OJSA 2EQYA 2F3NA 1N5XA 9ICXA 1DK2A 3PW4A 5ALQA 1S10A 3BS5B 5BOLA 4UQGA 3BQ1A 4C80A 2BCSA 1NK7A 9ICUA 2KZZA 4M9LA 1ZD4A 2EH9A 4C8NA 1SL0A 2IMWP 8ICZA 4RQ8A 1MQ2A 4FZNA 4M9NA 3M6KA 4QZDA 4DSKA 3UQ2A 4UB4A 2KMDA 4KLTA 2KD1A 2HDOA 4GFJA 1J97A 2YMMA 1L8OA 8ICBA 3N28A 4GXKA 5DB8A 2KJ9A 2W8KA 1WG8A 3BJYA 1XO0A 4YXMA 4KLIA 2FLPA 2BGWA 2D6FC 4NLNA 1X9MA 2QB0A 4IRKA 2JEFA 2ZJ8A 4EZ6A 4KITB 4DL5A 2VJ4A 1KQQA 5J2CA 3RRGA 3MC1A 3TFRA 4E0DA 3LWLA 1Z4NA 1LV5A 1N5WA 1L3VA 3GFKB 1JRPA 5KG6A 1NOMA 3M7DA 1FFUA 2NRVA 2W3SA 4M6WB 4RQMA 1L5UA 3KHLA 3F53A 4ED1A 5CRXA 4QZGA 1S5LU 5AKGA 1N56A 5C5JA 3D2NA 1LKYA 5D49A 5AICA 2HCFA 2BR0A 3GQCA 1IIPA 1RQLA 5ALMA 4RQ0A 3IP4B 2LM4A 1SL1A 2HHSA 9ICJA 1RYSA 2KIWA 1Z3EB 2OH2A 1N62A 1S0NA 4MFCA 3KZXA 3UPQA 2HBKA 4EEYA 3JPRA 4R8UB 1ZQUA 4IR9A 3RB3A 5AI0A 5AM1A 3RB4A 1PK1A 2V9WA 3GILA 4EZ9A 4IR1A 4QWAA 4Y2JA 1U47A 5J0UA 2A1JA 3AM9A 3NVVA 4RQ7A 5HR7A 4QZBA 2AQ0A 2ZIXB 4IQUA 2XC9A 4K4IA 1SXDA 4IS7A 2JV3A 4KMUA 2W3RA 3O0FA 4QW8A 9ICLA 2DQNB 1J2MA 3THVA 2FMPA 2Y0SC 4DL6A 1JALA 4ECUA 4DL3A 4DSIA 1ZQZA 1X66A 1X2IA 4RT2A 1ZQDA 4UAZA 4XQ8A 1N61A 2EAPA 5AI6A 4RPXA 1J2NA 2AGPA 4F71A 4MEXA 1V9PA 1BNPA 4ECWA 4O3MA 3OTQA 7ICNA 1N2XA 2GO7A 2EAMA 3CP8A 4KX3A 1B0XA 1A77A 5J2BA 2QARB 8ICPA 5T14A 2F8LA 4X5VA 4F4YA 3BQ2A 4UB2A 1Z19A 1ZETA 1KLNA 3KKAA 5KL8B 4J9NA 2YX8A 3MDCA 5AKEA 3RR7A 2NV3A 3FDSA 1TKDA 3Q8KA 1MQ3A 1RYUA 4M9GA 2XCPA 5HHHA 1SGGA 2HHVA 3F2DA 2ISOA 3NVYA 4AYBF 4DF8A 5J0QA 4I2JA 5DQHA 3PMNA 1PK3A 4EELA 1ZQIA 1L3TA 4JB3A 1CUKA 3F2CA 1NI3A 2HBLA 4RNMA 4J9KA 2ZIWA 4LZDA 4KX5A 1YT3A 2VA2A 2PFQA 1QSLA 4KLHA 4F4XA 1T7PA 8ICMA 3UMBA 3V6KA 2K8CB 2YTUA 1YZ6A 1NK8A 3RJEA 4RNNA 4PPXA 4EBDA 2W7OA 4J9LA 2PI5A 4ELTA 4RUAA 4RQ1A 4KTQA 1ECWA 2ESEA 4OD0A 2JHDA 3ZD9A 1PVRA 2JGAA 2RLTA 2WTFA 4Q43A 2OYYA 2E3TA 3HKZC 1RXWA 4IRCA 4QZEA 4YR2A 3K1RB 1QCKA 4DFJA 5J2DA 4YD1A 3NS1A 3EZ5A 4YN4A 2MA1A 4I2EA 4A8EA 3Q8MA 3RAXA 1Z1BA 3LVVA 2ZTEA 3WKBA 4DFMA 2F8KA 2KFNA 4OJLA 4FBTA 1BPDA 8ICJA 2XICA 1X6JA 1IXRA 9ICRA 5JU5A 5KG4A 1JROA 1H38A 4CCHA 5HR6A 4QZHA 4QZCA 5L1IA 3GIJA 5KFCA 5KG0A 4C4TA 2DBYA 5AM2A 5DB9A 4NJ8A 2HOIA 8ICGA 4JK1A 2RHFA 5KFSA 1ZQGA 4LVSA 2DL0A 1X9WA 1NZBA 1TVAA 1NK4A 3C2KA 4DQQA 2PKEA 4BGDA 1ZQVA 4ECRA 5DDMA 3V7LA 2NRWA 2YY6A 4FE3A 1VLBA 2ASLA 9ICMA 5DQIA 1VJ5A 2IOFK 2D3DA 5EE0A 4DQPA 2VA8A 1U48A 3Q8PB 5KFEA 4NV0A 4TURA 5KG7A 3PY8A 5EWEA 2HHUA 5AK3A 1PZNA 4DOBA 3I28A 3G6YA 2EDUA 1L6NA 3N7SC 3F5AA 1X9SA 5EOZA 2PFOA 2H3IA 3MGIA 3PW2A 2PMZF 7ICTA 1UPHA 2DGZA 3T5KA 4AYBC 5AKKA 2FE9A 4I2HA 4K4GA 3KOOA 1A6SA 2YQEA 2NO5A 4UBBA 4QW9A 3ORYA 2KFZA 3RAQA 1NJWA 2QB0B 1TFRA 4CF4A 4OCZA 4KLOA 5ALSA 1BPYA 3C29A 1EXNA 4F4KA 4C7ZA 4Y2SA 1BPEA 3IG8A 1T3NA 4QWCA 5IIIA 9ICHA 2FPMA 3CYMA 2YMLA 3OPXA 2XGQA 4Y2PA 2C2DA 2OWOA 1D8YA 5KFTA 4ED6A 1NKEA 1AQ6A 3BQTA 3RJKA 8ICKA 3WKCA 3LYSA 3FM9A 5AKYA 1U45A 5DG9A 2RQ5A 1KW4A 3QE9Y 4NXZA 4DWIA 3RBEA 2BKEA 4GXIA 2ZJAA 4F4WA 2F2AB 1S97A 2KVCA 4P4OA 3QU7A 2EANA 2IOFA 4ECQA 5D4BA 4RQ4A 1L3UA 2BQ3A 4KLDA 3SV4A 1B22A 2M0NA 8ICLA 1SKWA 3MBYA 2HVHA 2R18A 2XCAA 2PI4A 2J6SA 5ALKA 4UAUA 3QUBA 3EPGA 1U4BA 2ZXIA 2CPRA 5ALPA 5ALWA 1MN8A 3SMVA 1ZQQA 3KHHA 5KFXA 1X42A 2B21A 1NJZA 1ZQPA 2NO4A 1ZQFA 7ICLA 4ED2A 2XI9A 2JEGA 2I1QA 2GWSA 4O3QA 4M2YA 1X6IA 4ECZA 3KKAC 1BGXT 1XO1A 5DLFA 4YD2A 2R8HA 3V7JA 3DEEA 1SKSA 4Z6FA 4ELVA 4ACOA 3GV8B 9ICFA 4EEKA 5DG8A 2RDIA 2OEHA 5JTIA 1XSNA 1OXJA 3WK9A 3C21A 3MR3A 3PW5A 3N4MB 1JX4A 4J03A 3EW9A 4Z6EA 5ALFA 2IHNA 1V85A 2NRZA 2I9GA 3LWMA 2CXYA 2F1JA 2OM6A 3QXGA 3N97B 1BPZA 4P2HA 2XVTA 3NVWA 3L4PA 5AI5A 3M8SA 5IIMA 1JN3A 5ALLA 1HEKA 3QX7A 3H40A 1B43A 3MGVA 1C7YA 4I2FA 2LI6A 3CRXA 3IV6A 4O5EA 5ALDA 2Y0SF 3KHGA 3E2EA 4Y2RA 5EE1A 4DL2A 1ZD2P 5KT5A 4QWBA 2BPGA 3SD7A 5L1MA 3FYHA 2Y1IA 3FC4A 2R8JA 4RPZA 2ZIWB 4I29A 4UBCA 2AJQA 1N63A 5J0SA 3ISDA 1A0PA 1UCVA 3SYZA 2A3VA 5J29A 4ZOHC 2ES6A 4YR3A 2JXJA 4M47A 2JH7A 1KFDA 2VKQA 3NASA 8ICVA 2BCQA 5K4LA 5CP2A 2DF4B 1ZQOA 5KAIU 4NM1A 4RQ3A 1L7OA 5AI4A 2C2RA 2W9BA 4PGYA 2FLLA 4LZGA 2F76X 3AL0B 3PZPA 4PL1A 4O3PA 4Q45A 3WK5A 4F72A 3PNCA 3L5KA 3PV8A 8ICEA 5J0TA 1RG6A 1TK5A 3EWAA 3HILA 5ALZA 3QUCA 3Q8QB 2W9AA 1F0MA 5D46A 3HX0A 4QIWC 2ASJA 5KFLA 5KFIA 2G08A 9ICSA 3MFHA 2DKZA 2GOLA 2ZJ5A 2HHQA 2CRXA 1S8OA 4FZMA 3HW8A 4Y2QA 5J2FA 2BPCA 3GV5B 2RRDA 2HBMA 1S76D 3ALRA 1QQ6A 4NM2A 3OHAA 4O0IA 3ICXA 5CHGA 1ZQMA 3BQ7A 1KN5A 1N60A 3V6JA 4ED3A 3ED5A 2KJ8A 2LYAA 1TAUA 3UXPA 5L1KA 3RFAA 4EBEA 3SR6A 1DXSA 4NL9A 2B6GA 4DSJA 3D2QA 4DL7A 2V4RA 3HKZF 5EE3A 2M9NA 3KD3A 1ZQ1C 4I2DA 5BOMA 3C2MA 5AKIA 2G06A 1X9XA 1Q8KA 2KJ5A 3MR2A 5KNIA 1QSYA 3JPQA 4NLCA 4Z6DA 1UT8A 2Q0ZX 2VIXA 4UASA 3G6XA 3ZDDA 1WWUA 3WK7A 2A1AA 1OUQA 3AU2A 2ASDA 2LMRA 1S0OA 2JMGA 3EUB2 1S9FA 3T5HA 1KEJA 5J0XA 1V97A 4YMNA 3OSPA 2XY5A 2MU2A 5EWFA 5AKLA 3C5FA 1JXLA 1JMSA 5IIKA 1ZJMA 4YP3A 5AKXA 5AIBA 9ICEA 2HBJA 1ZQBA 4B9SA 3H8MA 2H3VA 2YB4A 5KFUA 3C1YA 3C1ZA 4JWMA 4OJ5A 5ALYA 2WHEA 4JV2A 4Z6CA 2WB1F 5ALXA 2EZZA 1XS9D 8ICNA 5G5GA 2LKYA 1QSSA 3TARA 1RM6C 2BCUA 2K60A 2AQ4A 2IOHA 7ICJA 2BQRA 2ZG6A 1DGSA 1UA0A 3C5GA 5KFPA 2KE7A 4RZRA 3RH4A 4QZFA 3AUOA 4PHPA 5ALTA 2K89A 4F93B 3TKAA 1S77D 4UB1A 5AIAA 2C28A 4Q8FA 5ALEA 2AXTU 5CEHA 5KFBA 4F50A 3RH6A 3B9JA 4DFDA 2KICA 3UM9A 1NK5A 3WKEA 5ALVA 2H3FA 3K75D 5KT6A 4JUZA 4IL6U 5KFHA 5DBAA 1RXVA 3TFSA 4P4MA 3PMLA 2K4PA 1ZRNA 2JZBB 4DQRA 5DG7A 3JPTA 8ICFA 4MHVA 4B9NA 1Z1VA 2AGQA 1ZQTA 3H0RB 1B4FA 3MDAA 2K4IA 1JXEA 3A0HU 1T4GA 2F1IA 2G5IB 5JUMA 2PFNA 4EENA 7ICGA 4TQRA 3PSIA 3ZDAA 4PHEA 1NK0A 2Y9UA 2HHWA 4KLQA 4LJXA 1QQ7A 4M0AA 3K1ZA 4IRDA 1L8LA 1BVSA 2KV2A 5DGBA 4PH5A 5BPCA 1O08A 3U26A 4FS2A 4DF4A 3VCBA 2A19A 2BQUA 3GIIA 2LM1A 3C2LA 2QLTA 4Q8EA 2LBOA 1TAQA 4F3OA 3PX6A 2MRLA 4C8MA 3MGHA 4DL4A 1XSLA 2XY7A 3PSPA 4R65A 1IM4A 4JV1A 9ICKA 5C0YA 4B9TA 4MF2A 1ZJNA 4GC7A 3GDXA 3RJJA 1VDVA 1ZYQA 3UMGA 5EE9A 4KLGA 7ICEA 3C28A 2FLNA 1MSWD 3AN1A 1L7MA 4Q44A 3RJFA 4I2IA 4UB8U 1DK3A 2WAQC 1FFVA 1ZQKA 2G5HB 1FIQA 2WB1C 2J6UA 4I28A 2ZTCA 2FPLA 1CI4A 5HP4A 3TADA 3LVWA 1U49A 3OHBA 1NK6A 1QTMA 3PSTA 4C8OA 3TAPA 3WKAA 2XIDA 1MC8A 4ED7A 2AH5A 3AU6A 2W9BB 2KZMA 2EAOA 4DSLA 5KG2A 4C8LA 7ICVA 3KZIU 3SZ2A 4QZIA 5J2EA 1S0VA 3HRDD 3JPOA 5DQGA 4QNLA 4F5QA 2ZIVA 3NRWA 1AROP 3BDPA 3EYZA 4RQ6A 1KKXA 4TQSA 2Y1JA 5H2FU 3MR6A 2FMSA 2E5SA 5KFFA 5DLGA 3Q8LA 4UATA 2K8BB 2KSOA 5ALHA 4NY8A 2W43A 3QZ7A 4I2CA 3ZDBA 5AM3A 1T94A 4ECYA 4G3IA 3H8WA 3T5JA 5HMMA 5CA7A 2W9CA 4YXJA 4NL9C 1ZQJA 2Z7JA 4CE6A 4M04A 2G09A 2YN4A 1JI7A 3GIMA 4FZLA 3IN5A 1WUDA 4RUCA 3H8SA 5KFDA 3TQ1A 4O5CA 5J2JA 5KT2A 2G0AA 4Y2YA 5J0RA 1XWLA 2W55A 4PJ0U 2C22A 3ZDEA 4RQNA 1Z4OA 3PW0A 5KFQA 3QNMA 4P0QA 3T79A 1D8BA 2YB1A 5KFMA 2IA6A 5AM0A 7ICRA 2RDJA 3QU9A 4O3RA 5KAFU 1LVHA 1SKRA 3QU5A 3PO5A 7ICKA 3E58A 1ED1A 1U9LA 3M6ZA 1SWWA 4UAWA 3GU3A 5ALJA 4NLGA 2GH1A 2H3QA 4QIWF 2UVUA 4C0ZA 2JH1A 7ICIA 4KN7A 8ICSA 2P35A 3DDHA 5KTQA 1NZPA 1ZQCA 8ICHA 4CNQA 3TAQA 4QWDA 4B9VA 4HAIA 2YMQA 3T5LA 1TK8A 2KZ3A 8ICAA 1WCNA 4JMUA 4MFFA 2JZBA 1ZQLA 2E8MA 3KHRA 2AU0A 1RZTA 2K4EA 3NVZA 4DS4A 5ALUA 3RRHA 2E8OA 5F9NA 5KFNA 2P6UA 3AQFA 4OJPA 4F5OA 4B9LA 2KNJA 3EPIA 1MA7A 3S6JA 3WK4A 1QH9A 3RH5A 2NRTA 4Y2TA 2KVSA 3PSFA 2LYBA 1DOQA 2BZFA 8ICXA 2JR5A 4TUSA 1M6YA 3IHQB 2O6KA 2WF7A 5KFWA 2MUTA 1SZPA 1BNOA 3J81j 4J9QA 3LK9A 3M9NB 2HOFA 4YMOA 3IG5A 2IHMA 3RR8A 5AK5A 2W7PA 4F8RA 3RF9A 3WK8A 4BXOA 4G9BA 5KG3A 3UXNA 3CNHA 5KFZA 3DV9A 1CRXA 4BDPA 3PX4A 8ICWA 2WFAA 2ZUDA 5KFAA 4BUGA 3ONNA 3IM1A 3V72A 4DQIA 7ICQA 5J2KA 1ZQYA 4QZAA 7ICOA 2Y9TA 1HUZA 2GLEA 9ICAA 4GXJA 3B0XA 2W11A 4DEZA 2E1EA 4UW9A 4DSFA 1D9FA 3SAFA 3VC8A 1Y88A 4PZNA 1A76A 1YZ7A 4ED0A 2DFLA 2KHVA 1RDFA 3C23A 4CF5A 3GV7B 3NGDA 2VANA 4OJ6A 5ALIA 5J2GA 9ICQA 2JEJA 1CEZA 5AM5A 4OJOA 2V4QA 2OHFA 5KT3A 2B0CA 2EZXA 4IC9A 5AK6A 1PUZA 3MFIA 1SXEA 4XUSA 3I1YA 3LDAA 3RB6A 1T3QA 8ICIA 4DO9A 1UQVA 5HNKA 5B66U 5E79U 5KFJA 4EX6A 2UVRA 2KP7A 3I76A 4R64A 4F5NA 5DDYA 2L5YA 4UAVA 3UXOA 2Q4TA 2ZUBA 8ICQA 4ICAA 5L1LA 2KKPA 3AEVA 3BS7A 4UARA 5J0YA 3ISBA 2ZIUA 4TUQA 4YG2A 4NLKA 1SL2A 3TADC 4DCCA 2HVIA 5AK4A 1HIWA 3WK6A 5IIOA 5TISU 2E8NA 2LPEA 2D8CA 5KFRA 3HT3A 3MR5A 3R9KA 3TACB 2YMPA 1SB3C 3ETRA 2I6XA 1ZQNA 5TZVA 3MABA 3T3FA 2HW3A 1COKA 1QLNA 1URJA 3L3FX 1ZRMA 1KSPA 3HWTA 1DRGA 3RTVA 2J6TA 8ICTA 2UVWA 4XRHA 5FP0A 4O3SA 2FI1A 1KRPA 5IINA 1K5OA 4K4HA 1ZQHA 1PVQA 3HPOA 2R8KA 5AHXA 4U6PA 3PW7A 4UB5A 5KL1B 1NNLA 1NKCA 4DFPA 3QZ8A 4PHAA 3E0FA 1IG6A 2ZUCA 5ALNA 4R63A 2R8GA 2ZIVB 3ISCA 5KFGA 4P0PA 2IBKA 5J8YA 2DWQA 4J9SA 1WWVA 4HYKA 4I2AA 5J2IA 2KSOB 2HMXA 4RT3A 1WCLA 1OW5A 4ECSA 4DSEA 1L7NA 5DKWA 2W9CB 3QUTA 1C20A 4FS1A 3JPSA 4US8A 2E8PA 4YFKA 2C2EA 3SQIA 2FPKA 3ZD8A 4PHDA 4TUPA 1P7DA 2KHQA 5DGAA 4B9UA 2QKQA 2LYHA 3N7PD 2WAQF 1F5SA 4PGXA 2HI0A 3SAHA 2XO7A 4CRXA 5F9LA 4F5RA 5HMLA 3SI8A 3AQEA 1QQ5A 4CDGA 1NJXA 2KTQA 4BWMA 4RU9A 1KBUA 1SZHA 3BQ0A 3D2SA 4P0QB 4J9PA 2ZXHA 4BWJA 3A0BU 3D6JA 2W54A 2FMQA 1IV8A 4DS5A 1KDHA 5KT7A 4KLUA 1RPLA 2G07A 2EZYA 1ZD5A 2ZTDA 3BZKA 4EX7A 7ICHA 2BHNA 3GZFA 2ATLA 3M1YA 3QEBZ 4EYIB 2VA3A 4J9OA 5GTIU 1ZQWA 5GTHU 3M9OB 4DQSA 2DPJA 8ICRA 5KG1A 9ICWA 3UQ0A 3K4GA 4QJFB 3V7KA 4CF3A 5DB7A 4M9HA 4B6JA 3PVXA 3QUQA 5CJ7A 5J0PA 3H0LB 1KFTA 3ZI4A 5AI9A 1Z00B 5CR0A 2KIVA 4KLMA 1X40A 4KN4A 4O3OA 4C8KA 4KMOB 1XC9A 1TE2A 4YQWA 4NLBA 4U7CA 2P66A 1RQNA 1Q46A 1SV0A 3SEIA 4F91B 1RYRA 4RPYA 4JV0A 5KT4A 3BS5A 3FAHA 3TI0A 5KFOA 4QWEA 4DLGA 4KLLA 8ICOA 4YR0A 3M8RA 5B5EU 4J9RA 2MUTB 5JRTA 2HSZA 4KLEA 3NUQA 4UB6U 4UAYA 4DFKA 4YVZA 5J2AA 3BZCA 4JWNA 4BJQA 2BCVA 4FO6A 4BXOB 5AI8A 5ALOA 5EWGA 2NRXA 4ECVA 4EYHB 3F2BA 2OXOA 4C7YA 4O9MA 3H4BA 1LB2B 4Y2XA 3GIKA 5J0WA 3Q8SB 2OCEA 4FBUA 2KK0A 4GIBA 1UT5A 5L1JA 1JIHA 3JPNA 2I5HA 4IQVA 5F3XB 1XNSA 4DOCA 4EBCA
chains in the Genus database with same CATH topology
2JR5A 2LM4A 1X6JA 1X6IA 1PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR5 A;  2LM4 A;  1X6J A;  1X6I A;  1PUZ A; 
#chains in the Genus database with same CATH topology
 4M6W A;  2HHX A;  1DGJ A;  3F5E A;  4MF8 A;  1JUD A;  4USA A;  3PR4 A;  4I2B A;  3B0Y A;  8ICC A;  4F2R A;  2FJ6 A;  3SV3 A;  4US9 A;  3AMZ A;  2BPF A;  4C4S A;  3N7R C;  4GC6 A;  1ZD3 A;  3QEA Z;  4AP9 A;  5ALR A;  9ICC A;  4R8U A;  3WKD A;  2DUY A;  3KTQ A;  1NKB A;  2RP5 A;  5J0O A;  1Q3U A;  7ICS A;  4I27 A;  2JRZ A;  5IIJ A;  3Q8R B;  1Q3V A;  1K1S A;  2KG5 A;  4O3N A;  2AGO A;  3H8J A;  7ICM A;  5AKJ A;  2F77 X;  2WF8 A;  4CGZ A;  3M9M B;  2LHT A;  2BCR A;  5KFY A;  2KOB A;  4NWI A;  2ZIX A;  4BX9 C;  9ICT A;  3WU2 U;  2KKV A;  3HJE A;  1SWV A;  5AKH A;  3JPP A;  2DKX A;  1ZQX A;  8ICY A;  2CN1 A;  2ZIU B;  2KEY A;  4OO1 J;  1KL9 A;  1COO A;  3SAG A;  5KFK A;  2NYV A;  4Y2U A;  7ICU A;  1HJP A;  7ICF A;  4MEY A;  5ALG A;  3ZDC A;  4M9J A;  9ICP A;  2WF5 A;  4DLE A;  3CW2 C;  5KFV A;  1ZQR A;  2W9M A;  4QZ8 A;  4ECX A;  9ICO A;  4RQ2 A;  2R8I A;  1KTQ A;  5J8Y C;  2QB1 A;  2HHT A;  2ISP A;  4B9M A;  2QAR A;  1ZXI A;  2AHO B;  3IDW A;  2FDR A;  4PL2 A;  9ICG A;  1D8L A;  1NK9 A;  1LKY B;  2K4H A;  5CB1 A;  5KG5 A;  1WYG A;  4ZH4 A;  9ICB A;  4PZO A;  9ICI A;  2WF6 A;  4P4P A;  2KN7 A;  4NLZ A;  2MAX A;  2XY6 A;  1ZQA A;  2JEI A;  4FFD A;  5L9X A;  1UHU A;  3RJG A;  4P0P B;  3QU2 A;  2VJ5 A;  4ED8 A;  5DBB A;  2DPI A;  1PK1 B;  2ALZ A;  4YMM A;  3OGU A;  3KBB A;  1Z00 A;  3ETL A;  4RNO A;  2N1R A;  3OJU A;  1FO4 A;  1XSP A;  3KFU F;  4F5P A;  2H3Z A;  2A1J B;  1V38 A;  4F92 B;  1KFS A;  1K1Q A;  2PFP A;  3IRU A;  5AKZ A;  3QU4 A;  1ZQE A;  2WF9 A;  1L3S A;  1T8E A;  5G5H A;  2XGP A;  3H7I A;  4QZ9 A;  4KLS A;  4MFA A;  3QYP A;  5CWR A;  4ECT A;  2UVV A;  4PGQ A;  1NJY A;  3NRZ A;  5HHI A;  1ZOL A;  3H0M B;  2W04 A;  1L7P A;  4XA5 A;  2F44 A;  2W03 A;  2E1F A;  4UB3 A;  5AM4 A;  4GLX A;  5IIL A;  3UMC A;  1HUO A;  4J9M A;  4DOA A;  2H5X A;  4RQ5 A;  4ELU A;  3H4D A;  1N48 A;  4C4R A;  3TAN A;  3OSN A;  2MSN A;  2W8L A;  1ZQS A;  1TK0 A;  5DB6 A;  1XU4 A;  4WJ3 B;  4YCX A;  2BDP A;  1SV4 A;  4I2G A;  3RJI A;  2BDU A;  3SEN A;  1TV9 A;  1PVP A;  1S0M A;  9ICN A;  2P6R A;  8ICU A;  4IQT A;  1BPB A;  3NTU A;  5J2H A;  1D9D A;  4R66 A;  2HOQ A;  1SV0 C;  3RJH A;  2PXI A;  3HP6 A;  2PMZ C;  1BPX A;  1F44 A;  2K8A A;  3RBD A;  2F1H A;  1UA1 A;  7ICP A;  1SIJ A;  4F2S A;  3V6H A;  3G6V A;  2ODG A;  4F4Z A;  3PR5 B;  9ICV A;  1O03 A;  3PX0 A;  4KLF A;  1GO3 F;  1TAM A;  5A0L A;  5DBC A;  3PO4 A;  4Y2V A;  3RB0 A;  4IQW A;  4O5K A;  1FEZ A;  4KLJ A;  3OJS A;  2EQY A;  2F3N A;  1N5X A;  9ICX A;  1DK2 A;  3PW4 A;  5ALQ A;  1S10 A;  3BS5 B;  5BOL A;  4UQG A;  3BQ1 A;  4C80 A;  2BCS A;  1NK7 A;  9ICU A;  2KZZ A;  4M9L A;  1ZD4 A;  2EH9 A;  4C8N A;  1SL0 A;  2IMW P;  8ICZ A;  4RQ8 A;  1MQ2 A;  4FZN A;  4M9N A;  3M6K A;  4QZD A;  4DSK A;  3UQ2 A;  4UB4 A;  2KMD A;  4KLT A;  2KD1 A;  2HDO A;  4GFJ A;  1J97 A;  2YMM A;  1L8O A;  8ICB A;  3N28 A;  4GXK A;  5DB8 A;  2KJ9 A;  2W8K A;  1WG8 A;  3BJY A;  1XO0 A;  4YXM A;  4KLI A;  2FLP A;  2BGW A;  2D6F C;  4NLN A;  1X9M A;  2QB0 A;  4IRK A;  2JEF A;  2ZJ8 A;  4EZ6 A;  4KIT B;  4DL5 A;  2VJ4 A;  1KQQ A;  5J2C A;  3RRG A;  3MC1 A;  3TFR A;  4E0D A;  3LWL A;  1Z4N A;  1LV5 A;  1N5W A;  1L3V A;  3GFK B;  1JRP A;  5KG6 A;  1NOM A;  3M7D A;  1FFU A;  2NRV A;  2W3S A;  4M6W B;  4RQM A;  1L5U A;  3KHL A;  3F53 A;  4ED1 A;  5CRX A;  4QZG A;  1S5L U;  5AKG A;  1N56 A;  5C5J A;  3D2N A;  1LKY A;  5D49 A;  5AIC A;  2HCF A;  2BR0 A;  3GQC A;  1IIP A;  1RQL A;  5ALM A;  4RQ0 A;  3IP4 B;  2LM4 A;  1SL1 A;  2HHS A;  9ICJ A;  1RYS A;  2KIW A;  1Z3E B;  2OH2 A;  1N62 A;  1S0N A;  4MFC A;  3KZX A;  3UPQ A;  2HBK A;  4EEY A;  3JPR A;  4R8U B;  1ZQU A;  4IR9 A;  3RB3 A;  5AI0 A;  5AM1 A;  3RB4 A;  1PK1 A;  2V9W A;  3GIL A;  4EZ9 A;  4IR1 A;  4QWA A;  4Y2J A;  1U47 A;  5J0U A;  2A1J A;  3AM9 A;  3NVV A;  4RQ7 A;  5HR7 A;  4QZB A;  2AQ0 A;  2ZIX B;  4IQU A;  2XC9 A;  4K4I A;  1SXD A;  4IS7 A;  2JV3 A;  4KMU A;  2W3R A;  3O0F A;  4QW8 A;  9ICL A;  2DQN B;  1J2M A;  3THV A;  2FMP A;  2Y0S C;  4DL6 A;  1JAL A;  4ECU A;  4DL3 A;  4DSI A;  1ZQZ A;  1X66 A;  1X2I A;  4RT2 A;  1ZQD A;  4UAZ A;  4XQ8 A;  1N61 A;  2EAP A;  5AI6 A;  4RPX A;  1J2N A;  2AGP A;  4F71 A;  4MEX A;  1V9P A;  1BNP A;  4ECW A;  4O3M A;  3OTQ A;  7ICN A;  1N2X A;  2GO7 A;  2EAM A;  3CP8 A;  4KX3 A;  1B0X A;  1A77 A;  5J2B A;  2QAR B;  8ICP A;  5T14 A;  2F8L A;  4X5V A;  4F4Y A;  3BQ2 A;  4UB2 A;  1Z19 A;  1ZET A;  1KLN A;  3KKA A;  5KL8 B;  4J9N A;  2YX8 A;  3MDC A;  5AKE A;  3RR7 A;  2NV3 A;  3FDS A;  1TKD A;  3Q8K A;  1MQ3 A;  1RYU A;  4M9G A;  2XCP A;  5HHH A;  1SGG A;  2HHV A;  3F2D A;  2ISO A;  3NVY A;  4AYB F;  4DF8 A;  5J0Q A;  4I2J A;  5DQH A;  3PMN A;  1PK3 A;  4EEL A;  1ZQI A;  1L3T A;  4JB3 A;  1CUK A;  3F2C A;  1NI3 A;  2HBL A;  4RNM A;  4J9K A;  2ZIW A;  4LZD A;  4KX5 A;  1YT3 A;  2VA2 A;  2PFQ A;  1QSL A;  4KLH A;  4F4X A;  1T7P A;  8ICM A;  3UMB A;  3V6K A;  2K8C B;  2YTU A;  1YZ6 A;  1NK8 A;  3RJE A;  4RNN A;  4PPX A;  4EBD A;  2W7O A;  4J9L A;  2PI5 A;  4ELT A;  4RUA A;  4RQ1 A;  4KTQ A;  1ECW A;  2ESE A;  4OD0 A;  2JHD A;  3ZD9 A;  1PVR A;  2JGA A;  2RLT A;  2WTF A;  4Q43 A;  2OYY A;  2E3T A;  3HKZ C;  1RXW A;  4IRC A;  4QZE A;  4YR2 A;  3K1R B;  1QCK A;  4DFJ A;  5J2D A;  4YD1 A;  3NS1 A;  3EZ5 A;  4YN4 A;  2MA1 A;  4I2E A;  4A8E A;  3Q8M A;  3RAX A;  1Z1B A;  3LVV A;  2ZTE A;  3WKB A;  4DFM A;  2F8K A;  2KFN A;  4OJL A;  4FBT A;  1BPD A;  8ICJ A;  2XIC A;  1X6J A;  1IXR A;  9ICR A;  5JU5 A;  5KG4 A;  1JRO A;  1H38 A;  4CCH A;  5HR6 A;  4QZH A;  4QZC A;  5L1I A;  3GIJ A;  5KFC A;  5KG0 A;  4C4T A;  2DBY A;  5AM2 A;  5DB9 A;  4NJ8 A;  2HOI A;  8ICG A;  4JK1 A;  2RHF A;  5KFS A;  1ZQG A;  4LVS A;  2DL0 A;  1X9W A;  1NZB A;  1TVA A;  1NK4 A;  3C2K A;  4DQQ A;  2PKE A;  4BGD A;  1ZQV A;  4ECR A;  5DDM A;  3V7L A;  2NRW A;  2YY6 A;  4FE3 A;  1VLB A;  2ASL A;  9ICM A;  5DQI A;  1VJ5 A;  2IOF K;  2D3D A;  5EE0 A;  4DQP A;  2VA8 A;  1U48 A;  3Q8P B;  5KFE A;  4NV0 A;  4TUR A;  5KG7 A;  3PY8 A;  5EWE A;  2HHU A;  5AK3 A;  1PZN A;  4DOB A;  3I28 A;  3G6Y A;  2EDU A;  1L6N A;  3N7S C;  3F5A A;  1X9S A;  5EOZ A;  2PFO A;  2H3I A;  3MGI A;  3PW2 A;  2PMZ F;  7ICT A;  1UPH A;  2DGZ A;  3T5K A;  4AYB C;  5AKK A;  2FE9 A;  4I2H A;  4K4G A;  3KOO A;  1A6S A;  2YQE A;  2NO5 A;  4UBB A;  4QW9 A;  3ORY A;  2KFZ A;  3RAQ A;  1NJW A;  2QB0 B;  1TFR A;  4CF4 A;  4OCZ A;  4KLO A;  5ALS A;  1BPY A;  3C29 A;  1EXN A;  4F4K A;  4C7Z A;  4Y2S A;  1BPE A;  3IG8 A;  1T3N A;  4QWC A;  5III A;  9ICH A;  2FPM A;  3CYM A;  2YML A;  3OPX A;  2XGQ A;  4Y2P A;  2C2D A;  2OWO A;  1D8Y A;  5KFT A;  4ED6 A;  1NKE A;  1AQ6 A;  3BQT A;  3RJK A;  8ICK A;  3WKC A;  3LYS A;  3FM9 A;  5AKY A;  1U45 A;  5DG9 A;  2RQ5 A;  1KW4 A;  3QE9 Y;  4NXZ A;  4DWI A;  3RBE A;  2BKE A;  4GXI A;  2ZJA A;  4F4W A;  2F2A B;  1S97 A;  2KVC A;  4P4O A;  3QU7 A;  2EAN A;  2IOF A;  4ECQ A;  5D4B A;  4RQ4 A;  1L3U A;  2BQ3 A;  4KLD A;  3SV4 A;  1B22 A;  2M0N A;  8ICL A;  1SKW A;  3MBY A;  2HVH A;  2R18 A;  2XCA A;  2PI4 A;  2J6S A;  5ALK A;  4UAU A;  3QUB A;  3EPG A;  1U4B A;  2ZXI A;  2CPR A;  5ALP A;  5ALW A;  1MN8 A;  3SMV A;  1ZQQ A;  3KHH A;  5KFX A;  1X42 A;  2B21 A;  1NJZ A;  1ZQP A;  2NO4 A;  1ZQF A;  7ICL A;  4ED2 A;  2XI9 A;  2JEG A;  2I1Q A;  2GWS A;  4O3Q A;  4M2Y A;  1X6I A;  4ECZ A;  3KKA C;  1BGX T;  1XO1 A;  5DLF A;  4YD2 A;  2R8H A;  3V7J A;  3DEE A;  1SKS A;  4Z6F A;  4ELV A;  4ACO A;  3GV8 B;  9ICF A;  4EEK A;  5DG8 A;  2RDI A;  2OEH A;  5JTI A;  1XSN A;  1OXJ A;  3WK9 A;  3C21 A;  3MR3 A;  3PW5 A;  3N4M B;  1JX4 A;  4J03 A;  3EW9 A;  4Z6E A;  5ALF A;  2IHN A;  1V85 A;  2NRZ A;  2I9G A;  3LWM A;  2CXY A;  2F1J A;  2OM6 A;  3QXG A;  3N97 B;  1BPZ A;  4P2H A;  2XVT A;  3NVW A;  3L4P A;  5AI5 A;  3M8S A;  5IIM A;  1JN3 A;  5ALL A;  1HEK A;  3QX7 A;  3H40 A;  1B43 A;  3MGV A;  1C7Y A;  4I2F A;  2LI6 A;  3CRX A;  3IV6 A;  4O5E A;  5ALD A;  2Y0S F;  3KHG A;  3E2E A;  4Y2R A;  5EE1 A;  4DL2 A;  1ZD2 P;  5KT5 A;  4QWB A;  2BPG A;  3SD7 A;  5L1M A;  3FYH A;  2Y1I A;  3FC4 A;  2R8J A;  4RPZ A;  2ZIW B;  4I29 A;  4UBC A;  2AJQ A;  1N63 A;  5J0S A;  3ISD A;  1A0P A;  1UCV A;  3SYZ A;  2A3V A;  5J29 A;  4ZOH C;  2ES6 A;  4YR3 A;  2JXJ A;  4M47 A;  2JH7 A;  1KFD A;  2VKQ A;  3NAS A;  8ICV A;  2BCQ A;  5K4L A;  5CP2 A;  2DF4 B;  1ZQO A;  5KAI U;  4NM1 A;  4RQ3 A;  1L7O A;  5AI4 A;  2C2R A;  2W9B A;  4PGY A;  2FLL A;  4LZG A;  2F76 X;  3AL0 B;  3PZP A;  4PL1 A;  4O3P A;  4Q45 A;  3WK5 A;  4F72 A;  3PNC A;  3L5K A;  3PV8 A;  8ICE A;  5J0T A;  1RG6 A;  1TK5 A;  3EWA A;  3HIL A;  5ALZ A;  3QUC A;  3Q8Q B;  2W9A A;  1F0M A;  5D46 A;  3HX0 A;  4QIW C;  2ASJ A;  5KFL A;  5KFI A;  2G08 A;  9ICS A;  3MFH A;  2DKZ A;  2GOL A;  2ZJ5 A;  2HHQ A;  2CRX A;  1S8O A;  4FZM A;  3HW8 A;  4Y2Q A;  5J2F A;  2BPC A;  3GV5 B;  2RRD A;  2HBM A;  1S76 D;  3ALR A;  1QQ6 A;  4NM2 A;  3OHA A;  4O0I A;  3ICX A;  5CHG A;  1ZQM A;  3BQ7 A;  1KN5 A;  1N60 A;  3V6J A;  4ED3 A;  3ED5 A;  2KJ8 A;  2LYA A;  1TAU A;  3UXP A;  5L1K A;  3RFA A;  4EBE A;  3SR6 A;  1DXS A;  4NL9 A;  2B6G A;  4DSJ A;  3D2Q A;  4DL7 A;  2V4R A;  3HKZ F;  5EE3 A;  2M9N A;  3KD3 A;  1ZQ1 C;  4I2D A;  5BOM A;  3C2M A;  5AKI A;  2G06 A;  1X9X A;  1Q8K A;  2KJ5 A;  3MR2 A;  5KNI A;  1QSY A;  3JPQ A;  4NLC A;  4Z6D A;  1UT8 A;  2Q0Z X;  2VIX A;  4UAS A;  3G6X A;  3ZDD A;  1WWU A;  3WK7 A;  2A1A A;  1OUQ A;  3AU2 A;  2ASD A;  2LMR A;  1S0O A;  2JMG A;  3EUB 2;  1S9F A;  3T5H A;  1KEJ A;  5J0X A;  1V97 A;  4YMN A;  3OSP A;  2XY5 A;  2MU2 A;  5EWF A;  5AKL A;  3C5F A;  1JXL A;  1JMS A;  5IIK A;  1ZJM A;  4YP3 A;  5AKX A;  5AIB A;  9ICE A;  2HBJ A;  1ZQB A;  4B9S A;  3H8M A;  2H3V A;  2YB4 A;  5KFU A;  3C1Y A;  3C1Z A;  4JWM A;  4OJ5 A;  5ALY A;  2WHE A;  4JV2 A;  4Z6C A;  2WB1 F;  5ALX A;  2EZZ A;  1XS9 D;  8ICN A;  5G5G A;  2LKY A;  1QSS A;  3TAR A;  1RM6 C;  2BCU A;  2K60 A;  2AQ4 A;  2IOH A;  7ICJ A;  2BQR A;  2ZG6 A;  1DGS A;  1UA0 A;  3C5G A;  5KFP A;  2KE7 A;  4RZR A;  3RH4 A;  4QZF A;  3AUO A;  4PHP A;  5ALT A;  2K89 A;  4F93 B;  3TKA A;  1S77 D;  4UB1 A;  5AIA A;  2C28 A;  4Q8F A;  5ALE A;  2AXT U;  5CEH A;  5KFB A;  4F50 A;  3RH6 A;  3B9J A;  4DFD A;  2KIC A;  3UM9 A;  1NK5 A;  3WKE A;  5ALV A;  2H3F A;  3K75 D;  5KT6 A;  4JUZ A;  4IL6 U;  5KFH A;  5DBA A;  1RXV A;  3TFS A;  4P4M A;  3PML A;  2K4P A;  1ZRN A;  2JZB B;  4DQR A;  5DG7 A;  3JPT A;  8ICF A;  4MHV A;  4B9N A;  1Z1V A;  2AGQ A;  1ZQT A;  3H0R B;  1B4F A;  3MDA A;  2K4I A;  1JXE A;  3A0H U;  1T4G A;  2F1I A;  2G5I B;  5JUM A;  2PFN A;  4EEN A;  7ICG A;  4TQR A;  3PSI A;  3ZDA A;  4PHE A;  1NK0 A;  2Y9U A;  2HHW A;  4KLQ A;  4LJX A;  1QQ7 A;  4M0A A;  3K1Z A;  4IRD A;  1L8L A;  1BVS A;  2KV2 A;  5DGB A;  4PH5 A;  5BPC A;  1O08 A;  3U26 A;  4FS2 A;  4DF4 A;  3VCB A;  2A19 A;  2BQU A;  3GII A;  2LM1 A;  3C2L A;  2QLT A;  4Q8E A;  2LBO A;  1TAQ A;  4F3O A;  3PX6 A;  2MRL A;  4C8M A;  3MGH A;  4DL4 A;  1XSL A;  2XY7 A;  3PSP A;  4R65 A;  1IM4 A;  4JV1 A;  9ICK A;  5C0Y A;  4B9T A;  4MF2 A;  1ZJN A;  4GC7 A;  3GDX A;  3RJJ A;  1VDV A;  1ZYQ A;  3UMG A;  5EE9 A;  4KLG A;  7ICE A;  3C28 A;  2FLN A;  1MSW D;  3AN1 A;  1L7M A;  4Q44 A;  3RJF A;  4I2I A;  4UB8 U;  1DK3 A;  2WAQ C;  1FFV A;  1ZQK A;  2G5H B;  1FIQ A;  2WB1 C;  2J6U A;  4I28 A;  2ZTC A;  2FPL A;  1CI4 A;  5HP4 A;  3TAD A;  3LVW A;  1U49 A;  3OHB A;  1NK6 A;  1QTM A;  3PST A;  4C8O A;  3TAP A;  3WKA A;  2XID A;  1MC8 A;  4ED7 A;  2AH5 A;  3AU6 A;  2W9B B;  2KZM A;  2EAO A;  4DSL A;  5KG2 A;  4C8L A;  7ICV A;  3KZI U;  3SZ2 A;  4QZI A;  5J2E A;  1S0V A;  3HRD D;  3JPO A;  5DQG A;  4QNL A;  4F5Q A;  2ZIV A;  3NRW A;  1ARO P;  3BDP A;  3EYZ A;  4RQ6 A;  1KKX A;  4TQS A;  2Y1J A;  5H2F U;  3MR6 A;  2FMS A;  2E5S A;  5KFF A;  5DLG A;  3Q8L A;  4UAT A;  2K8B B;  2KSO A;  5ALH A;  4NY8 A;  2W43 A;  3QZ7 A;  4I2C A;  3ZDB A;  5AM3 A;  1T94 A;  4ECY A;  4G3I A;  3H8W A;  3T5J A;  5HMM A;  5CA7 A;  2W9C A;  4YXJ A;  4NL9 C;  1ZQJ A;  2Z7J A;  4CE6 A;  4M04 A;  2G09 A;  2YN4 A;  1JI7 A;  3GIM A;  4FZL A;  3IN5 A;  1WUD A;  4RUC A;  3H8S A;  5KFD A;  3TQ1 A;  4O5C A;  5J2J A;  5KT2 A;  2G0A A;  4Y2Y A;  5J0R A;  1XWL A;  2W55 A;  4PJ0 U;  2C22 A;  3ZDE A;  4RQN A;  1Z4O A;  3PW0 A;  5KFQ A;  3QNM A;  4P0Q A;  3T79 A;  1D8B A;  2YB1 A;  5KFM A;  2IA6 A;  5AM0 A;  7ICR A;  2RDJ A;  3QU9 A;  4O3R A;  5KAF U;  1LVH A;  1SKR A;  3QU5 A;  3PO5 A;  7ICK A;  3E58 A;  1ED1 A;  1U9L A;  3M6Z A;  1SWW A;  4UAW A;  3GU3 A;  5ALJ A;  4NLG A;  2GH1 A;  2H3Q A;  4QIW F;  2UVU A;  4C0Z A;  2JH1 A;  7ICI A;  4KN7 A;  8ICS A;  2P35 A;  3DDH A;  5KTQ A;  1NZP A;  1ZQC A;  8ICH A;  4CNQ A;  3TAQ A;  4QWD A;  4B9V A;  4HAI A;  2YMQ A;  3T5L A;  1TK8 A;  2KZ3 A;  8ICA A;  1WCN A;  4JMU A;  4MFF A;  2JZB A;  1ZQL A;  2E8M A;  3KHR A;  2AU0 A;  1RZT A;  2K4E A;  3NVZ A;  4DS4 A;  5ALU A;  3RRH A;  2E8O A;  5F9N A;  5KFN A;  2P6U A;  3AQF A;  4OJP A;  4F5O A;  4B9L A;  2KNJ A;  3EPI A;  1MA7 A;  3S6J A;  3WK4 A;  1QH9 A;  3RH5 A;  2NRT A;  4Y2T A;  2KVS A;  3PSF A;  2LYB A;  1DOQ A;  2BZF A;  8ICX A;  2JR5 A;  4TUS A;  1M6Y A;  3IHQ B;  2O6K A;  2WF7 A;  5KFW A;  2MUT A;  1SZP A;  1BNO A;  3J81 j;  4J9Q A;  3LK9 A;  3M9N B;  2HOF A;  4YMO A;  3IG5 A;  2IHM A;  3RR8 A;  5AK5 A;  2W7P A;  4F8R A;  3RF9 A;  3WK8 A;  4BXO A;  4G9B A;  5KG3 A;  3UXN A;  3CNH A;  5KFZ A;  3DV9 A;  1CRX A;  4BDP A;  3PX4 A;  8ICW A;  2WFA A;  2ZUD A;  5KFA A;  4BUG A;  3ONN A;  3IM1 A;  3V72 A;  4DQI A;  7ICQ A;  5J2K A;  1ZQY A;  4QZA A;  7ICO A;  2Y9T A;  1HUZ A;  2GLE A;  9ICA A;  4GXJ A;  3B0X A;  2W11 A;  4DEZ A;  2E1E A;  4UW9 A;  4DSF A;  1D9F A;  3SAF A;  3VC8 A;  1Y88 A;  4PZN A;  1A76 A;  1YZ7 A;  4ED0 A;  2DFL A;  2KHV A;  1RDF A;  3C23 A;  4CF5 A;  3GV7 B;  3NGD A;  2VAN A;  4OJ6 A;  5ALI A;  5J2G A;  9ICQ A;  2JEJ A;  1CEZ A;  5AM5 A;  4OJO A;  2V4Q A;  2OHF A;  5KT3 A;  2B0C A;  2EZX A;  4IC9 A;  5AK6 A;  1PUZ A;  3MFI A;  1SXE A;  4XUS A;  3I1Y A;  3LDA A;  3RB6 A;  1T3Q A;  8ICI A;  4DO9 A;  1UQV A;  5HNK A;  5B66 U;  5E79 U;  5KFJ A;  4EX6 A;  2UVR A;  2KP7 A;  3I76 A;  4R64 A;  4F5N A;  5DDY A;  2L5Y A;  4UAV A;  3UXO A;  2Q4T A;  2ZUB A;  8ICQ A;  4ICA A;  5L1L A;  2KKP A;  3AEV A;  3BS7 A;  4UAR A;  5J0Y A;  3ISB A;  2ZIU A;  4TUQ A;  4YG2 A;  4NLK A;  1SL2 A;  3TAD C;  4DCC A;  2HVI A;  5AK4 A;  1HIW A;  3WK6 A;  5IIO A;  5TIS U;  2E8N A;  2LPE A;  2D8C A;  5KFR A;  3HT3 A;  3MR5 A;  3R9K A;  3TAC B;  2YMP A;  1SB3 C;  3ETR A;  2I6X A;  1ZQN A;  5TZV A;  3MAB A;  3T3F A;  2HW3 A;  1COK A;  1QLN A;  1URJ A;  3L3F X;  1ZRM A;  1KSP A;  3HWT A;  1DRG A;  3RTV A;  2J6T A;  8ICT A;  2UVW A;  4XRH A;  5FP0 A;  4O3S A;  2FI1 A;  1KRP A;  5IIN A;  1K5O A;  4K4H A;  1ZQH A;  1PVQ A;  3HPO A;  2R8K A;  5AHX A;  4U6P A;  3PW7 A;  4UB5 A;  5KL1 B;  1NNL A;  1NKC A;  4DFP A;  3QZ8 A;  4PHA A;  3E0F A;  1IG6 A;  2ZUC A;  5ALN A;  4R63 A;  2R8G A;  2ZIV B;  3ISC A;  5KFG A;  4P0P A;  2IBK A;  5J8Y A;  2DWQ A;  4J9S A;  1WWV A;  4HYK A;  4I2A A;  5J2I A;  2KSO B;  2HMX A;  4RT3 A;  1WCL A;  1OW5 A;  4ECS A;  4DSE A;  1L7N A;  5DKW A;  2W9C B;  3QUT A;  1C20 A;  4FS1 A;  3JPS A;  4US8 A;  2E8P A;  4YFK A;  2C2E A;  3SQI A;  2FPK A;  3ZD8 A;  4PHD A;  4TUP A;  1P7D A;  2KHQ A;  5DGA A;  4B9U A;  2QKQ A;  2LYH A;  3N7P D;  2WAQ F;  1F5S A;  4PGX A;  2HI0 A;  3SAH A;  2XO7 A;  4CRX A;  5F9L A;  4F5R A;  5HML A;  3SI8 A;  3AQE A;  1QQ5 A;  4CDG A;  1NJX A;  2KTQ A;  4BWM A;  4RU9 A;  1KBU A;  1SZH A;  3BQ0 A;  3D2S A;  4P0Q B;  4J9P A;  2ZXH A;  4BWJ A;  3A0B U;  3D6J A;  2W54 A;  2FMQ A;  1IV8 A;  4DS5 A;  1KDH A;  5KT7 A;  4KLU A;  1RPL A;  2G07 A;  2EZY A;  1ZD5 A;  2ZTD A;  3BZK A;  4EX7 A;  7ICH A;  2BHN A;  3GZF A;  2ATL A;  3M1Y A;  3QEB Z;  4EYI B;  2VA3 A;  4J9O A;  5GTI U;  1ZQW A;  5GTH U;  3M9O B;  4DQS A;  2DPJ A;  8ICR A;  5KG1 A;  9ICW A;  3UQ0 A;  3K4G A;  4QJF B;  3V7K A;  4CF3 A;  5DB7 A;  4M9H A;  4B6J A;  3PVX A;  3QUQ A;  5CJ7 A;  5J0P A;  3H0L B;  1KFT A;  3ZI4 A;  5AI9 A;  1Z00 B;  5CR0 A;  2KIV A;  4KLM A;  1X40 A;  4KN4 A;  4O3O A;  4C8K A;  4KMO B;  1XC9 A;  1TE2 A;  4YQW A;  4NLB A;  4U7C A;  2P66 A;  1RQN A;  1Q46 A;  1SV0 A;  3SEI A;  4F91 B;  1RYR A;  4RPY A;  4JV0 A;  5KT4 A;  3BS5 A;  3FAH A;  3TI0 A;  5KFO A;  4QWE A;  4DLG A;  4KLL A;  8ICO A;  4YR0 A;  3M8R A;  5B5E U;  4J9R A;  2MUT B;  5JRT A;  2HSZ A;  4KLE A;  3NUQ A;  4UB6 U;  4UAY A;  4DFK A;  4YVZ A;  5J2A A;  3BZC A;  4JWN A;  4BJQ A;  2BCV A;  4FO6 A;  4BXO B;  5AI8 A;  5ALO A;  5EWG A;  2NRX A;  4ECV A;  4EYH B;  3F2B A;  2OXO A;  4C7Y A;  4O9M A;  3H4B A;  1LB2 B;  4Y2X A;  3GIK A;  5J0W A;  3Q8S B;  2OCE A;  4FBU A;  2KK0 A;  4GIB A;  1UT5 A;  5L1J A;  1JIH A;  3JPN A;  2I5H A;  4IQV A;  5F3X B;  1XNS A;  4DOC A;  4EBC A; 
#chains in the Genus database with same CATH homology
 2JR5 A;  2LM4 A;  1X6J A;  1X6I A;  1PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...