2FJ6A

Solution nmr structure of the upf0346 protein yoze from bacillus subtilis. northeast structural genomics target sr391.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
b'MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGRLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0346 protein yozE
publication title Solution NMR structure of the UPF0346 protein yozE from Bacillus subtilis. Northeast Structural Genomics target SR391.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2fj6A01
2KVSA 2FJ6A 2O6KA
chains in the Genus database with same CATH superfamily
5AM0A 1PVRA 4KITB 1NK7A 4F91B 4O3PA 4CF4A 3H8SA 3BQTA 3T79A 4OJPA 4BXOA 3SMVA 2ZTEA 4I27A 4Y2VA 4YD1A 4ED2A 5GTHU 1Z00B 4Y2SA 1SV4A 4NY8A 5AK5A 4UQGA 4AP9A 8ICVA 1IG6A 4B6JA 4KLSA 5AHXA 3IV6A 4I29A 3AQFA 8ICLA 2VJ4A 2A1JB 4DL2A 4CCHA 5AKZA 2VA2A 2Q0ZX 5AI8A 1L7OA 5L1MA 4I2HA 7ICRA 4PL1A 2WTFA 1KN5A 2RQ5A 3C23A 2KG5A 1EXNA 2E8PA 5DKWA 4USAA 2A1AA 2XCAA 4UB1A 2BPCA 4TQRA 5HP4A 5AI4A 1ZXIA 2V9WA 1NZPA 1L3TA 3M1YA 3MDAA 5AM3A 7ICLA 5KFBA 2BCUA 1ED1A 5DB7A 4R66A 4M6WA 3C2KA 1ZJNA 4ED0A 2EH9A 1LVHA 2P6RA 1KFTA 2FJ6A 2WFAA 1FEZA 2MU2A 2CPRA 1ZQCA 4QZGA 5KAIU 1YZ6A 4C8NA 1XSLA 4ELUA 5L1JA 1X9SA 2KVCA 4NLNA 5ALZA 5ALUA 3QZ8A 2HHSA 2XI9A 1QTMA 4BUGA 4P2HA 4NL9A 3SAFA 2ZG6A 1UT8A 2QKQA 4FZNA 5E79U 5TISU 2FI1A 5ALDA 4Y2PA 1ZD2P 1X9XA 4MEYA 2LM4A 4C8LA 4PZNA 2PFQA 1KRPA 4CF5A 3NUQA 3Q8SB 2BDUA 3RH4A 1HIWA 3E0FA 3FC4A 3GU3A 4F8RA 4B9NA 2AU0A 3IG5A 1NOMA 7ICVA 2ZUBA 3RR7A 2A19A 3OHAA 5ALHA 3BJYA 1ZD3A 5ALKA 5L1IA 5J0PA 3BQ0A 2EAMA 1RQNA 2RHFA 3L5KA 3TI0A 4QWDA 3PVXA 4DSIA 1TK0A 4IQUA 4YXJA 3SV3A 2C2EA 1NK6A 9ICCA 4GC6A 1ZQDA 4IL6U 1KW4A 4Y2YA 2AHOB 2HDOA 2F1JA 5KFSA 4ED6A 4KLGA 1NK0A 1QSLA 1D9FA 2WAQC 5C5JA 2KHQA 1QSYA 2W3SA 3F2CA 2K4HA 4QZDA 4KLFA 1UQVA 1JROA 3QXGA 1S0MA 4C8KA 1ZQAA 4F72A 4KLHA 2OXOA 1KEJA 3MBYA 1ZQLA 4Q8FA 3KKAA 4C7YA 1XU4A 1KQQA 5KL8B 4RQ3A 4J9OA 7ICIA 1RM6C 3O0FA 3V7JA 4MF2A 4KLOA 2LMRA 4IQVA 4DL4A 1T7PA 4C80A 3MR3A 1QCKA 3SD7A 3A0HU 5AKGA 4QIWC 1L3SA 2AGQA 1ZQQA 3QUTA 1A76A 3E58A 5KFYA 4DQPA 5T14A 5ALPA 3OSPA 1K5OA 1KSPA 3AM9A 2FE9A 4GXJA 3MR2A 2DF4B 5J0XA 8ICOA 3N7SC 2IHMA 3GQCA 1XS9D 2BR0A 1SIJA 2RRDA 2H3QA 2L5YA 4YG2A 5ALFA 1Q8KA 2BPGA 1SZHA 4NV0A 5AI6A 2KVSA 7ICHA 2Y0SC 1KBUA 2PFOA 4DF8A 1KL9A 5DG8A 1X2IA 3H0LB 2K4IA 2C2DA 4UB3A 2P66A 2QB0A 3QYPA 4JMUA 4U7CA 3C5GA 2JZBA 2OM6A 3H0MB 4RU9A 1KLNA 1OXJA 1PK1B 2RDJA 4DF4A 1S97A 2ATLA 1RYUA 4RPYA 2GWSA 3JPPA 3TKAA 1X6IA 8ICYA 3LK9A 3LWMA 4TUSA 4IQTA 3H8JA 1X6JA 5AIAA 4UB8U 2YMQA 3MFHA 1SKSA 2G09A 9ICQA 4DSJA 3PSFA 3PX0A 5D49A 3WK6A 5AKYA 4K4IA 3H8WA 2G0AA 1NK4A 2EZYA 1ZETA 3TAPA 1Z00A 3Q8KA 1QQ7A 4I2EA 1X9WA 3EYZA 4O5KA 1WCLA 1N61A 5J8YC 1XNSA 3QUBA 3VC8A 4M04A 4FZMA 1JMSA 3N7PD 2A1JA 3RJEA 3SQIA 8ICIA 3B0YA 4DS4A 1KTQA 4O5EA 1TAUA 1M6YA 1Z3EB 1Y88A 4LZGA 1BPBA 5EE3A 2C2RA 1NK8A 1DGSA 1K1QA 4I2IA 1XC9A 1T94A 2K4EA 5KT5A 2NRXA 3IRUA 9ICMA 4R63A 3C29A 1J97A 3ZDBA 3H4BA 4C8MA 5J29A 4O3NA 4O0IA 3NRWA 2XVTA 4EYIB 2HHWA 3RAXA 2ES6A 4Y2RA 5AK6A 1PK3A 1ZRMA 5AI0A 4DEZA 3RRHA 5L1LA 3AUOA 2ZXHA 2CRXA 2JEIA 4OJLA 9ICHA 5KFPA 2XCPA 2B0CA 4UW9A 3PX4A 4KMOB 4KLDA 2YB1A 1NKBA 4NL9C 4DFJA 2DBYA 3D2QA 3M8RA 2Y1JA 4EEYA 4C7ZA 2NRZA 4ZOHC 4YD2A 3Q8RB 1S0VA 9ICPA 3IM1A 4BJQA 4F5PA 7ICQA 1UHUA 9ICIA 3Q8PB 3OJUA 1ECWA 4J9KA 2WB1C 1SKWA 4C4RA 3OPXA 2BQ3A 2H3VA 2Y9TA 3ZDDA 4F71A 4F2SA 2HBJA 3RAQA 4EELA 4CNQA 5AICA 2AH5A 4F4KA 1D8BA 5KFLA 4NM1A 1MC8A 4ACOA 2R8HA 1TE2A 3C1YA 5J2AA 4ECXA 1MA7A 5B5EU 3GIIA 9ICXA 3QUCA 3MR5A 2BDPA 2JEGA 3C2MA 3G6XA 5HR6A 1SL0A 5JUMA 5KG0A 5KFKA 4GFJA 1L8OA 1SB3C 4US8A 2QLTA 4GC7A 3WK5A 4X5VA 9ICEA 4B9TA 2PMZF 1ZQBA 3ZDAA 2XIDA 1X40A 5J0UA 4UAVA 4QWCA 3UMGA 5DBBA 1AROP 2MA1A 3T5HA 1RQLA 2FLNA 2FPKA 4ICAA 3ZD8A 3QU4A 2HHUA 2QARB 4MEXA 1S10A 3TACB 5AKHA 4IQWA 5GTIU 2UVVA 1SWVA 5CA7A 3M8SA 3ORYA 1ZJMA 5AI5A 2E1EA 2WHEA 2KEYA 5KFEA 2DKXA 1F5SA 5KFTA 1N5XA 2I5HA 3KHLA 3MFIA 3PSTA 1PVPA 9ICAA 1WWVA 3FDSA 1QSSA 3F5AA 4F50A 4I2AA 2HBLA 1T4GA 5AM1A 5K4LA 3PW7A 4NXZA 5DB8A 3LYSA 5IIKA 4XUSA 4UB4A 5HMLA 8ICMA 5DLFA 1U49A 5ALWA 1L3VA 2DKZA 4M9LA 4QWAA 9ICBA 4TURA 4DL3A 5J2DA 3WK7A 1HEKA 1L3UA 3NS1A 3V7KA 4DL7A 3GV7B 4ECSA 1OUQA 2FMQA 2AQ4A 3NASA 4CE6A 4CDGA 4J9RA 4QZ9A 2KE7A 1Q46A 4UATA 3RFAA 1DK2A 5G5GA 2ZJAA 5ALGA 5CP2A 2K60A 1P7DA 2XY5A 4RQ1A 3H4DA 9ICLA 4EENA 1IXRA 4PPXA 5KFZA 4YVZA 1ZQHA 5J8YA 1BPXA 2W9CB 3F2DA 1CRXA 5F9LA 4PH5A 3CNHA 4LJXA 1RXVA 2R8KA 1JN3A 3H8MA 3OHBA 1Z1VA 1X9MA 2KFZA 4PHDA 1F0MA 2AXTU 3RJHA 1BPEA 3Q8QB 1N56A 8ICFA 1RZTA 1BPYA 3WKEA 1NJWA 1U4BA 5KFHA 5KFFA 4EBEA 5BPCA 3N97B 2P35A 1S8OA 5J2GA 4J03A 5TZVA 2KJ5A 5AKXA 4FBTA 4F5OA 4NM2A 2HHTA 5JTIA 5J2BA 2OCEA 3KBBA 4ZH4A 1WG8A 3L4PA 4PHPA 4JB3A 5KFNA 2KK0A 2MAXA 2FMPA 4UASA 1T3QA 3RJFA 4YP3A 5DG7A 4AYBC 1U48A 3EW9A 7ICNA 2M9NA 2BCSA 1ZQWA 3HT3A 5EE9A 5IIJA 2KSOA 2W7PA 4DFMA 2KZMA 3N4MB 4NLZA 4G9BA 2YMMA 2EANA 3B0XA 2E3TA 1VLBA 5KFUA 3M6ZA 3AU6A 3RB3A 2VA3A 1MSWD 4M9GA 2MUTA 3ZDEA 3IDWA 5J0RA 3T3FA 2KFNA 2KKPA 4BWMA 2NRTA 2XICA 3GZFA 5ALEA 5DB9A 5DLGA 2H3IA 2R18A 3EZ5A 9ICRA 4YMMA 3QU9A 1BGXT 3BZCA 5A0LA 4M47A 1ZQUA 3AL0B 9ICNA 3UM9A 4M9JA 4Y2XA 2H5XA 3RB6A 5ALNA 5DBAA 3GIMA 3HWTA 2F44A 3V6KA 4K4HA 2ZIWA 2KJ9A 5DDMA 3CW2C 3WKDA 7ICEA 5KT6A 5CB1A 3RH6A 5EE1A 5D4BA 4MHVA 1BVSA 3AU2A 8ICTA 4WJ3B 2ESEA 4BX9C 1ZOLA 4MFCA 3JPSA 4NWIA 2JR5A 3M9NB 3UXPA 4ELVA 2VA8A 5CWRA 2HHVA 7ICJA 5ALXA 2ZUDA 2HCFA 3QNMA 3AMZA 2F1HA 5EWEA 1L7NA 4DQRA 4Y2QA 4M0AA 2YMPA 3HILA 4M9NA 2Y9UA 2EAPA 2G5IB 2KD1A 4Z6CA 2HVHA 2PXIA 1T3NA 2JRZA 2WAQF 1J2NA 2JH1A 2LHTA 2AQ0A 3SAHA 3QEAZ 2ODGA 3I76A 3D2SA 2ASDA 5KT4A 4TUQA 2M0NA 2XY6A 4JWNA 4F4ZA 3SR6A 5AIBA 5J2JA 4ECWA 4O3MA 2JHDA 1V97A 4QZBA 1U47A 4P0PB 5F9NA 2QARA 4B9LA 5B66U 3K75D 1URJA 1RG6A 4QIWF 2XGPA 3HW8A 7ICPA 5J2CA 4IRDA 1ZQEA 2HI0A 3AQEA 2GH1A 1S0OA 3LDAA 1ZQZA 1ZQFA 4ELTA 4RT2A 1XSNA 2WF9A 2K8AA 8ICGA 2F8LA 4OD0A 1LKYB 3ISCA 4B9SA 5J2FA 5AM2A 1ZD4A 2Y0SF 1Z19A 1PUZA 3TANA 1COKA 4QZEA 2ZJ8A 1RYRA 3MGHA 4HYKA 3UQ2A 2NYVA 2FPLA 2HW3A 4GIBA 2HHQA 2ZIXB 5DB6A 1AQ6A 3UMCA 7ICOA 3OSNA 4UBCA 4PGYA 1ZQIA 3QZ7A 4RPXA 5J0SA 3G6YA 5J2EA 4I2JA 1DGJA 4FE3A 4R8UB 4YR2A 2Q4TA 4Z6FA 4ECVA 4F4WA 2JEFA 4K4GA 5ALYA 3JPOA 3FAHA 4U6PA 3RJJA 2W43A 2W7OA 4PL2A 5KFXA 3F2BA 4O3QA 2GO7A 4RQ7A 1ZQVA 4ED8A 4I2CA 2ZIVB 2IOFK 3RRGA 2JV3A 1DK3A 2KN7A 2F77X 3G6VA 4JV1A 5KFIA 5KG6A 1XO1A 4BDPA 1XO0A 1L7MA 4ECQA 4O3RA 4QNLA 3KFUF 5J0QA 3GV5B 5G5HA 4DOBA 5KFRA 4J9PA 1FFVA 2XO7A 3JPNA 4B9UA 3CYMA 2UVRA 4YXMA 3S6JA 4DSEA 4R64A 3T5KA 1IIPA 4DSFA 3DEEA 4KLEA 1ZQYA 1DOQA 5AKLA 4RNMA 3NRZA 2R8GA 3C21A 2ASLA 4US9A 1D8LA 4Z6DA 4QZIA 2BHNA 2BKEA 1D8YA 9ICOA 3VCBA 8ICAA 3M9OB 4YFKA 2AGPA 1JALA 2A3VA 1B43A 1WWUA 2J6SA 1B22A 4F5QA 4P4MA 2EDUA 1S0NA 4F4YA 4I28A 3T5LA 3QUQA 1Q3UA 4DSLA 4J9SA 4EYHB 3C28A 4IR9A 2H3FA 3MGIA 1N2XA 2LYBA 5IINA 1JRPA 4PGQA 1B0XA 2NO5A 5JRTA 4QZ8A 3JPQA 4DS5A 1NJZA 5DDYA 1SZPA 1N63A 4C4SA 2B6GA 1ZYQA 2J6TA 3MDCA 4P0QB 2YN4A 4F92B 2BCVA 1UT5A 2E8MA 2KHVA 3KHRA 3H0RB 3RTVA 1TKDA 4FS1A 7ICUA 3D6JA 4A8EA 3IG8A 1CEZA 9ICJA 3EPGA 1BNOA 8ICEA 1TVAA 4ED7A 8ICUA 1KKXA 4F5NA 2IMWP 3K1RB 1IM4A 8ICRA 3I28A 4Y2TA 1Q3VA 3E2EA 4F2RA 2ZIUB 3NVWA 2WB1F 3C2LA 4F93B 4EX6A 3H40A 4KLLA 4IS7A 4LVSA 3IN5A 8ICKA 4QWBA 4FS2A 2DWQA 3NVZA 3WKAA 5AK3A 2W9AA 4M2YA 2KOBA 4DQSA 2LI6A 2AGOA 4OJ5A 4Q8EA 2DFLA 1RYSA 3HKZC 5EE0A 2IOHA 4DWIA 4C4TA 4QZAA 4NJ8A 4MF8A 1PZNA 4PHEA 4M9HA 5DGBA 2KIVA 2LM1A 4ECYA 3B9JA 4UARA 1TV9A 1ZQTA 3PR4A 2EZZA 2YB4A 2K8BB 2DPIA 2KZZA 2V4RA 2VANA 4NLGA 3QU5A 5EOZA 4DSKA 2KMDA 4UAUA 1V9PA 5HHIA 3D2NA 1SV0C 5ALLA 4RQ6A 1ZQKA 2JEJA 4IR1A 2Z7JA 1RPLA 3J81j 4J9MA 3FM9A 1BPZA 4Q44A 5ALRA 4F5RA 2OWOA 5KG1A 2BQUA 1KDHA 3ISBA 4DCCA 2DL0A 8ICBA 5ALJA 4Q45A 2KKVA 3N28A 1NZBA 3PW5A 5AKKA 5HR7A 4P0PA 2HOFA 3PW2A 4I2BA 4PGXA 4C8OA 3WU2U 3PO5A 4FFDA 1ZD5A 2KNJA 7ICSA 1QH9A 3RJIA 1VJ5A 3PW0A 3PR5B 1BPDA 2W3RA 4RT3A 4DL6A 3PX6A 1LV5A 1WUDA 3HJEA 1UCVA 2IBKA 3NGDA 4DFDA 5BOLA 3ZD9A 2QB0B 1NJYA 3BZKA 2G5HB 2P6UA 3F53A 1H38A 4IC9A 2JZBB 2HVIA 2EQYA 1LKYA 5KT2A 4QW8A 2KZ3A 2VKQA 8ICHA 3TARA 2MSNA 1PK1A 2UVWA 5KAFU 4I2DA 3OGUA 4J9QA 4HAIA 5ALOA 3SEIA 2VIXA 5KFVA 8ICJA 2ZIXA 3WKCA 4YN4A 2YQEA 5J2IA 3PSIA 2AJQA 4ED1A 2N1RA 1ZQXA 4QJFB 1V85A 2OH2A 1OW5A 3PO4A 3PY8A 2RDIA 2W9MA 4R8UA 3RH5A 2ZTDA 4Q43A 1SL1A 2W03A 5KFDA 3R9KA 3ETRA 3QU7A 4R65A 1HJPA 1ZQOA 3QEBZ 2FLLA 4QZCA 4J9LA 3KZXA 4KX3A 5FP0A 8ICPA 3WK4A 1MQ3A 3ETLA 5CR0A 2UVUA 2ZIVA 3HX0A 3MABA 3RB4A 2NO4A 4JWMA 4GXIA 1NK9A 3V72A 4Y2JA 3LWLA 1HUZA 4O3OA 4ED3A 1V38A 5DQHA 4DFPA 4JV2A 4EEKA 2G06A 2J6UA 4CRXA 2OYYA 3IP4B 1SKRA 1ZQ1C 2HHXA 3RB0A 2DPJA 2PFPA 3MR6A 1ZQMA 1MQ2A 3BQ7A 2DGZA 4ECUA 3RBEA 3ONNA 3SENA 5KT7A 2LPEA 5C0YA 3NTUA 5KFMA 3WKBA 8ICSA 5EWFA 3BS5B 9ICWA 3ZDCA 3ISDA 4DOAA 1COOA 2YX8A 2HMXA 2NRWA 3PNCA 5J2KA 2YY6A 2QB1A 2ASJA 1FIQA 4MFAA 5IIOA 2C22A 4RQ5A 3AN1A 1A77A 3UMBA 4F4XA 5J0YA 1L6NA 3PV8A 1SWWA 3KTQA 4AYBF 2F1IA 3QX7A 4GXKA 3NVVA 1PVQA 7ICFA 4UAZA 4KLIA 3AEVA 4RUAA 1UPHA 3KZIU 5D46A 1ZRNA 1S76D 1X66A 1NNLA 2E5SA 3OJSA 2W11A 3NVYA 4O3SA 2H3ZA 2G07A 2IOFA 1O03A 2JH7A 4P0QA 1GO3F 5AM4A 1NJXA 2XGQA 1TFRA 1N5WA 1Z1BA 1L5UA 4GLXA 2FPMA 3EPIA 2OHFA 1NK5A 4B9VA 1JXEA 2F76X 1TAMA 2MRLA 5HHHA 7ICMA 3UXNA 2KTQA 2ZIUA 5KT3A 4UB2A 5CHGA 5ALSA 5HNKA 2JXJA 3K1ZA 2XC9A 3TFRA 4MFFA 8ICWA 1CUKA 2CN1A 4YR0A 3GFKB 2WF8A 4RQ0A 4J9NA 2DQNB 2OEHA 5KFCA 4EX7A 2NV3A 5KG2A 3I1YA 1JI7A 2ALZA 3RF9A 4Z6EA 5AKJA 3MC1A 1ZQSA 4ECZA 4JK1A 2GLEA 1A6SA 4PZOA 1SV0A 3M7DA 1SGGA 2O6KA 5EWGA 4KLMA 5F3XB 4RUCA 1CI4A 5KFAA 9ICTA 1SXEA 2HBKA 3WK9A 9ICGA 1ZQRA 1NI3A 3UPQA 3N7RC 2W8LA 2W9BB 4Y2UA 3RJKA 3CP8A 4RQ2A 4KLJA 1SL2A 3ICXA 4RPZA 3QE9Y 3PW4A 4FZLA 2W04A 2D8CA 5ALQA 4EBCA 2BGWA 5AI9A 2G08A 4RQNA 5KFWA 1ZQJA 1B4FA 2NRVA 3RBDA 4O9MA 3BS7A 4OO1J 4IRKA 3M6KA 8ICZA 1JX4A 3LVWA 5DBCA 2E8NA 4DO9A 3TADC 7ICGA 1XWLA 5AK4A 4EZ6A 1LB2B 1A0PA 5H2FU 5KG7A 2ZXIA 3LVVA 4BWJA 2FMSA 4DQQA 4JUZA 1RDFA 3EUB2 1YT3A 4KN7A 2RP5A 3CRXA 3KOOA 3HRDD 1MN8A 2Y1IA 2D6FC 2XY7A 4BXOB 1KFDA 2BZFA 4NLKA 3T5JA 1NKEA 3SV4A 4NLCA 5J0WA 3TQ1A 5CRXA 2D3DA 9ICKA 2BCRA 3H7IA 2F3NA 2BQRA 2V4QA 2IHNA 5L1KA 5IILA 2ZJ5A 1WCNA 3GILA 2PFNA 4KX5A 5HMMA 4RQ4A 3K4GA 5KL1B 2LBOA 5J2HA 1X42A 3JPRA 3IHQB 2YTUA 2I9GA 2W9CA 5ALIA 4YCXA 4P4PA 3EWAA 2LKYA 7ICKA 2K8CB 4QWEA 5J0OA 4TUPA 5KNIA 3TFSA 1VDVA 3GIJA 3SZ2A 4G3IA 4YQWA 4DQIA 4ECRA 3RJGA 5IIMA 1T8EA 3SAGA 2RLTA 3KHHA 1S9FA 1TK5A 1S77D 4FBUA 4C0ZA 8ICQA 1HUOA 1JUDA 2E8OA 4P4OA 5AKEA 4M6WB 5KFGA 2ISOA 5AKIA 4B9MA 1WYGA 2ISPA 3WK8A 3GDXA 4UAWA 2ZTCA 5DQGA 5KG4A 3BS5A 4DL5A 3Q8LA 2JGAA 3HPOA 2E1FA 3SI8A 4OJOA 2W55A 5KFQA 2YMLA 1U9LA 2KSOB 1NKCA 5KG5A 2GOLA 2WF5A 4E0DA 4RZRA 3HP6A 2KP7A 3A0BU 1ZQGA 1C7YA 9ICSA 4RQMA 4DOCA 2PI5A 4KMUA 1RXWA 8ICNA 5BOMA 2I6XA 1SXDA 1DRGA 4O5CA 2HBMA 1QQ5A 2MUTB 3U26A 4I2FA 1O08A 2C28A 3FYHA 2F8KA 3UXOA 4UB6U 3ALRA 3TAQA 4RQ8A 2PKEA 1Z4OA 5CEHA 2K89A 5J0TA 2WF7A 1ZQNA 4EZ9A 2K4PA 3Q8MA 9ICUA 2EAOA 3PZPA 2EZXA 1DXSA 1N48A 4I2GA 3OTQA 3SYZA 2ZIWB 1N62A 5KG3A 4RNNA 2FLPA 8ICXA 4EBDA 3JPTA 1F44A 1JIHA 2LYAA 2KIWA 5DG9A 4UAYA 2WF6A 4YR3A 5ALTA 1D9DA 4CGZA 3L3FX 3GIKA 2HOIA 4CF3A 3F5EA 5CJ7A 3QU2A 5KTQA 3HKZF 2PMZC 3UQ0A 1QQ6A 3GV8B 4QZFA 2FDRA 3V6HA 2KICA 2R8JA 1TK8A 2I1QA 4PHAA 2BPFA 2JMGA 1U45A 3BQ2A 1N60A 4DLGA 3KKAC 4UBBA 1UA0A 2IA6A 5JU5A 3KHGA 4XQ8A 2CXYA 5KFOA 8ICCA 2B21A 3ZI4A 7ICTA 2F2AB 1JXLA 2BCQA 2PI4A 4RNOA 4TQSA 3MGVA 5ALMA 5DQIA 1S5LU 4F3OA 4YMNA 1ZQPA 3C5FA 1C20A 4OJ6A 4OCZA 3DV9A 4ECTA 4KN4A 3PSPA 3PMNA 1K1SA 3BDPA 2HSZA 2LYHA 5DGAA 3RR8A 4KLUA 1YZ7A 4QZHA 5L9XA 2KJ8A 2W9BA 9ICFA 1QLNA 3DDHA 1FFUA 2VJ5A 4YMOA 2DUYA 4DFKA 3V7LA 5ALVA 3KD3A 4IRCA 4PJ0U 1KFSA 1IV8A 4NLBA 4XA5A 3BQ1A 1FO4A 4KLQA 5AM5A 4DLEA 9ICVA 3THVA 3TADA 4KTQA 3C1ZA 1TAQA 4XRHA 4QW9A 4JV0A 3PMLA 1XSPA 1Z4NA 3V6JA 2W8KA 5IIIA 4KLTA 4UB5A 5KFJA 2ZUCA 3ED5A 1BNPA 2R8IA 1L7PA 2HOQA 2KV2A 4LZDA 4BGDA 1L8LA 3M9MB 1J2MA 4FO6A 2W54A 1UA1A
chains in the Genus database with same CATH topology
2KVSA 2FJ6A 2O6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVS A;  2FJ6 A;  2O6K A; 
#chains in the Genus database with same CATH topology
 5AM0 A;  1PVR A;  4KIT B;  1NK7 A;  4F91 B;  4O3P A;  4CF4 A;  3H8S A;  3BQT A;  3T79 A;  4OJP A;  4BXO A;  3SMV A;  2ZTE A;  4I27 A;  4Y2V A;  4YD1 A;  4ED2 A;  5GTH U;  1Z00 B;  4Y2S A;  1SV4 A;  4NY8 A;  5AK5 A;  4UQG A;  4AP9 A;  8ICV A;  1IG6 A;  4B6J A;  4KLS A;  5AHX A;  3IV6 A;  4I29 A;  3AQF A;  8ICL A;  2VJ4 A;  2A1J B;  4DL2 A;  4CCH A;  5AKZ A;  2VA2 A;  2Q0Z X;  5AI8 A;  1L7O A;  5L1M A;  4I2H A;  7ICR A;  4PL1 A;  2WTF A;  1KN5 A;  2RQ5 A;  3C23 A;  2KG5 A;  1EXN A;  2E8P A;  5DKW A;  4USA A;  2A1A A;  2XCA A;  4UB1 A;  2BPC A;  4TQR A;  5HP4 A;  5AI4 A;  1ZXI A;  2V9W A;  1NZP A;  1L3T A;  3M1Y A;  3MDA A;  5AM3 A;  7ICL A;  5KFB A;  2BCU A;  1ED1 A;  5DB7 A;  4R66 A;  4M6W A;  3C2K A;  1ZJN A;  4ED0 A;  2EH9 A;  1LVH A;  2P6R A;  1KFT A;  2FJ6 A;  2WFA A;  1FEZ A;  2MU2 A;  2CPR A;  1ZQC A;  4QZG A;  5KAI U;  1YZ6 A;  4C8N A;  1XSL A;  4ELU A;  5L1J A;  1X9S A;  2KVC A;  4NLN A;  5ALZ A;  5ALU A;  3QZ8 A;  2HHS A;  2XI9 A;  1QTM A;  4BUG A;  4P2H A;  4NL9 A;  3SAF A;  2ZG6 A;  1UT8 A;  2QKQ A;  4FZN A;  5E79 U;  5TIS U;  2FI1 A;  5ALD A;  4Y2P A;  1ZD2 P;  1X9X A;  4MEY A;  2LM4 A;  4C8L A;  4PZN A;  2PFQ A;  1KRP A;  4CF5 A;  3NUQ A;  3Q8S B;  2BDU A;  3RH4 A;  1HIW A;  3E0F A;  3FC4 A;  3GU3 A;  4F8R A;  4B9N A;  2AU0 A;  3IG5 A;  1NOM A;  7ICV A;  2ZUB A;  3RR7 A;  2A19 A;  3OHA A;  5ALH A;  3BJY A;  1ZD3 A;  5ALK A;  5L1I A;  5J0P A;  3BQ0 A;  2EAM A;  1RQN A;  2RHF A;  3L5K A;  3TI0 A;  4QWD A;  3PVX A;  4DSI A;  1TK0 A;  4IQU A;  4YXJ A;  3SV3 A;  2C2E A;  1NK6 A;  9ICC A;  4GC6 A;  1ZQD A;  4IL6 U;  1KW4 A;  4Y2Y A;  2AHO B;  2HDO A;  2F1J A;  5KFS A;  4ED6 A;  4KLG A;  1NK0 A;  1QSL A;  1D9F A;  2WAQ C;  5C5J A;  2KHQ A;  1QSY A;  2W3S A;  3F2C A;  2K4H A;  4QZD A;  4KLF A;  1UQV A;  1JRO A;  3QXG A;  1S0M A;  4C8K A;  1ZQA A;  4F72 A;  4KLH A;  2OXO A;  1KEJ A;  3MBY A;  1ZQL A;  4Q8F A;  3KKA A;  4C7Y A;  1XU4 A;  1KQQ A;  5KL8 B;  4RQ3 A;  4J9O A;  7ICI A;  1RM6 C;  3O0F A;  3V7J A;  4MF2 A;  4KLO A;  2LMR A;  4IQV A;  4DL4 A;  1T7P A;  4C80 A;  3MR3 A;  1QCK A;  3SD7 A;  3A0H U;  5AKG A;  4QIW C;  1L3S A;  2AGQ A;  1ZQQ A;  3QUT A;  1A76 A;  3E58 A;  5KFY A;  4DQP A;  5T14 A;  5ALP A;  3OSP A;  1K5O A;  1KSP A;  3AM9 A;  2FE9 A;  4GXJ A;  3MR2 A;  2DF4 B;  5J0X A;  8ICO A;  3N7S C;  2IHM A;  3GQC A;  1XS9 D;  2BR0 A;  1SIJ A;  2RRD A;  2H3Q A;  2L5Y A;  4YG2 A;  5ALF A;  1Q8K A;  2BPG A;  1SZH A;  4NV0 A;  5AI6 A;  2KVS A;  7ICH A;  2Y0S C;  1KBU A;  2PFO A;  4DF8 A;  1KL9 A;  5DG8 A;  1X2I A;  3H0L B;  2K4I A;  2C2D A;  4UB3 A;  2P66 A;  2QB0 A;  3QYP A;  4JMU A;  4U7C A;  3C5G A;  2JZB A;  2OM6 A;  3H0M B;  4RU9 A;  1KLN A;  1OXJ A;  1PK1 B;  2RDJ A;  4DF4 A;  1S97 A;  2ATL A;  1RYU A;  4RPY A;  2GWS A;  3JPP A;  3TKA A;  1X6I A;  8ICY A;  3LK9 A;  3LWM A;  4TUS A;  4IQT A;  3H8J A;  1X6J A;  5AIA A;  4UB8 U;  2YMQ A;  3MFH A;  1SKS A;  2G09 A;  9ICQ A;  4DSJ A;  3PSF A;  3PX0 A;  5D49 A;  3WK6 A;  5AKY A;  4K4I A;  3H8W A;  2G0A A;  1NK4 A;  2EZY A;  1ZET A;  3TAP A;  1Z00 A;  3Q8K A;  1QQ7 A;  4I2E A;  1X9W A;  3EYZ A;  4O5K A;  1WCL A;  1N61 A;  5J8Y C;  1XNS A;  3QUB A;  3VC8 A;  4M04 A;  4FZM A;  1JMS A;  3N7P D;  2A1J A;  3RJE A;  3SQI A;  8ICI A;  3B0Y A;  4DS4 A;  1KTQ A;  4O5E A;  1TAU A;  1M6Y A;  1Z3E B;  1Y88 A;  4LZG A;  1BPB A;  5EE3 A;  2C2R A;  1NK8 A;  1DGS A;  1K1Q A;  4I2I A;  1XC9 A;  1T94 A;  2K4E A;  5KT5 A;  2NRX A;  3IRU A;  9ICM A;  4R63 A;  3C29 A;  1J97 A;  3ZDB A;  3H4B A;  4C8M A;  5J29 A;  4O3N A;  4O0I A;  3NRW A;  2XVT A;  4EYI B;  2HHW A;  3RAX A;  2ES6 A;  4Y2R A;  5AK6 A;  1PK3 A;  1ZRM A;  5AI0 A;  4DEZ A;  3RRH A;  5L1L A;  3AUO A;  2ZXH A;  2CRX A;  2JEI A;  4OJL A;  9ICH A;  5KFP A;  2XCP A;  2B0C A;  4UW9 A;  3PX4 A;  4KMO B;  4KLD A;  2YB1 A;  1NKB A;  4NL9 C;  4DFJ A;  2DBY A;  3D2Q A;  3M8R A;  2Y1J A;  4EEY A;  4C7Z A;  2NRZ A;  4ZOH C;  4YD2 A;  3Q8R B;  1S0V A;  9ICP A;  3IM1 A;  4BJQ A;  4F5P A;  7ICQ A;  1UHU A;  9ICI A;  3Q8P B;  3OJU A;  1ECW A;  4J9K A;  2WB1 C;  1SKW A;  4C4R A;  3OPX A;  2BQ3 A;  2H3V A;  2Y9T A;  3ZDD A;  4F71 A;  4F2S A;  2HBJ A;  3RAQ A;  4EEL A;  4CNQ A;  5AIC A;  2AH5 A;  4F4K A;  1D8B A;  5KFL A;  4NM1 A;  1MC8 A;  4ACO A;  2R8H A;  1TE2 A;  3C1Y A;  5J2A A;  4ECX A;  1MA7 A;  5B5E U;  3GII A;  9ICX A;  3QUC A;  3MR5 A;  2BDP A;  2JEG A;  3C2M A;  3G6X A;  5HR6 A;  1SL0 A;  5JUM A;  5KG0 A;  5KFK A;  4GFJ A;  1L8O A;  1SB3 C;  4US8 A;  2QLT A;  4GC7 A;  3WK5 A;  4X5V A;  9ICE A;  4B9T A;  2PMZ F;  1ZQB A;  3ZDA A;  2XID A;  1X40 A;  5J0U A;  4UAV A;  4QWC A;  3UMG A;  5DBB A;  1ARO P;  2MA1 A;  3T5H A;  1RQL A;  2FLN A;  2FPK A;  4ICA A;  3ZD8 A;  3QU4 A;  2HHU A;  2QAR B;  4MEX A;  1S10 A;  3TAC B;  5AKH A;  4IQW A;  5GTI U;  2UVV A;  1SWV A;  5CA7 A;  3M8S A;  3ORY A;  1ZJM A;  5AI5 A;  2E1E A;  2WHE A;  2KEY A;  5KFE A;  2DKX A;  1F5S A;  5KFT A;  1N5X A;  2I5H A;  3KHL A;  3MFI A;  3PST A;  1PVP A;  9ICA A;  1WWV A;  3FDS A;  1QSS A;  3F5A A;  4F50 A;  4I2A A;  2HBL A;  1T4G A;  5AM1 A;  5K4L A;  3PW7 A;  4NXZ A;  5DB8 A;  3LYS A;  5IIK A;  4XUS A;  4UB4 A;  5HML A;  8ICM A;  5DLF A;  1U49 A;  5ALW A;  1L3V A;  2DKZ A;  4M9L A;  4QWA A;  9ICB A;  4TUR A;  4DL3 A;  5J2D A;  3WK7 A;  1HEK A;  1L3U A;  3NS1 A;  3V7K A;  4DL7 A;  3GV7 B;  4ECS A;  1OUQ A;  2FMQ A;  2AQ4 A;  3NAS A;  4CE6 A;  4CDG A;  4J9R A;  4QZ9 A;  2KE7 A;  1Q46 A;  4UAT A;  3RFA A;  1DK2 A;  5G5G A;  2ZJA A;  5ALG A;  5CP2 A;  2K60 A;  1P7D A;  2XY5 A;  4RQ1 A;  3H4D A;  9ICL A;  4EEN A;  1IXR A;  4PPX A;  5KFZ A;  4YVZ A;  1ZQH A;  5J8Y A;  1BPX A;  2W9C B;  3F2D A;  1CRX A;  5F9L A;  4PH5 A;  3CNH A;  4LJX A;  1RXV A;  2R8K A;  1JN3 A;  3H8M A;  3OHB A;  1Z1V A;  1X9M A;  2KFZ A;  4PHD A;  1F0M A;  2AXT U;  3RJH A;  1BPE A;  3Q8Q B;  1N56 A;  8ICF A;  1RZT A;  1BPY A;  3WKE A;  1NJW A;  1U4B A;  5KFH A;  5KFF A;  4EBE A;  5BPC A;  3N97 B;  2P35 A;  1S8O A;  5J2G A;  4J03 A;  5TZV A;  2KJ5 A;  5AKX A;  4FBT A;  4F5O A;  4NM2 A;  2HHT A;  5JTI A;  5J2B A;  2OCE A;  3KBB A;  4ZH4 A;  1WG8 A;  3L4P A;  4PHP A;  4JB3 A;  5KFN A;  2KK0 A;  2MAX A;  2FMP A;  4UAS A;  1T3Q A;  3RJF A;  4YP3 A;  5DG7 A;  4AYB C;  1U48 A;  3EW9 A;  7ICN A;  2M9N A;  2BCS A;  1ZQW A;  3HT3 A;  5EE9 A;  5IIJ A;  2KSO A;  2W7P A;  4DFM A;  2KZM A;  3N4M B;  4NLZ A;  4G9B A;  2YMM A;  2EAN A;  3B0X A;  2E3T A;  1VLB A;  5KFU A;  3M6Z A;  3AU6 A;  3RB3 A;  2VA3 A;  1MSW D;  4M9G A;  2MUT A;  3ZDE A;  3IDW A;  5J0R A;  3T3F A;  2KFN A;  2KKP A;  4BWM A;  2NRT A;  2XIC A;  3GZF A;  5ALE A;  5DB9 A;  5DLG A;  2H3I A;  2R18 A;  3EZ5 A;  9ICR A;  4YMM A;  3QU9 A;  1BGX T;  3BZC A;  5A0L A;  4M47 A;  1ZQU A;  3AL0 B;  9ICN A;  3UM9 A;  4M9J A;  4Y2X A;  2H5X A;  3RB6 A;  5ALN A;  5DBA A;  3GIM A;  3HWT A;  2F44 A;  3V6K A;  4K4H A;  2ZIW A;  2KJ9 A;  5DDM A;  3CW2 C;  3WKD A;  7ICE A;  5KT6 A;  5CB1 A;  3RH6 A;  5EE1 A;  5D4B A;  4MHV A;  1BVS A;  3AU2 A;  8ICT A;  4WJ3 B;  2ESE A;  4BX9 C;  1ZOL A;  4MFC A;  3JPS A;  4NWI A;  2JR5 A;  3M9N B;  3UXP A;  4ELV A;  2VA8 A;  5CWR A;  2HHV A;  7ICJ A;  5ALX A;  2ZUD A;  2HCF A;  3QNM A;  3AMZ A;  2F1H A;  5EWE A;  1L7N A;  4DQR A;  4Y2Q A;  4M0A A;  2YMP A;  3HIL A;  4M9N A;  2Y9U A;  2EAP A;  2G5I B;  2KD1 A;  4Z6C A;  2HVH A;  2PXI A;  1T3N A;  2JRZ A;  2WAQ F;  1J2N A;  2JH1 A;  2LHT A;  2AQ0 A;  3SAH A;  3QEA Z;  2ODG A;  3I76 A;  3D2S A;  2ASD A;  5KT4 A;  4TUQ A;  2M0N A;  2XY6 A;  4JWN A;  4F4Z A;  3SR6 A;  5AIB A;  5J2J A;  4ECW A;  4O3M A;  2JHD A;  1V97 A;  4QZB A;  1U47 A;  4P0P B;  5F9N A;  2QAR A;  4B9L A;  5B66 U;  3K75 D;  1URJ A;  1RG6 A;  4QIW F;  2XGP A;  3HW8 A;  7ICP A;  5J2C A;  4IRD A;  1ZQE A;  2HI0 A;  3AQE A;  2GH1 A;  1S0O A;  3LDA A;  1ZQZ A;  1ZQF A;  4ELT A;  4RT2 A;  1XSN A;  2WF9 A;  2K8A A;  8ICG A;  2F8L A;  4OD0 A;  1LKY B;  3ISC A;  4B9S A;  5J2F A;  5AM2 A;  1ZD4 A;  2Y0S F;  1Z19 A;  1PUZ A;  3TAN A;  1COK A;  4QZE A;  2ZJ8 A;  1RYR A;  3MGH A;  4HYK A;  3UQ2 A;  2NYV A;  2FPL A;  2HW3 A;  4GIB A;  2HHQ A;  2ZIX B;  5DB6 A;  1AQ6 A;  3UMC A;  7ICO A;  3OSN A;  4UBC A;  4PGY A;  1ZQI A;  3QZ7 A;  4RPX A;  5J0S A;  3G6Y A;  5J2E A;  4I2J A;  1DGJ A;  4FE3 A;  4R8U B;  4YR2 A;  2Q4T A;  4Z6F A;  4ECV A;  4F4W A;  2JEF A;  4K4G A;  5ALY A;  3JPO A;  3FAH A;  4U6P A;  3RJJ A;  2W43 A;  2W7O A;  4PL2 A;  5KFX A;  3F2B A;  4O3Q A;  2GO7 A;  4RQ7 A;  1ZQV A;  4ED8 A;  4I2C A;  2ZIV B;  2IOF K;  3RRG A;  2JV3 A;  1DK3 A;  2KN7 A;  2F77 X;  3G6V A;  4JV1 A;  5KFI A;  5KG6 A;  1XO1 A;  4BDP A;  1XO0 A;  1L7M A;  4ECQ A;  4O3R A;  4QNL A;  3KFU F;  5J0Q A;  3GV5 B;  5G5H A;  4DOB A;  5KFR A;  4J9P A;  1FFV A;  2XO7 A;  3JPN A;  4B9U A;  3CYM A;  2UVR A;  4YXM A;  3S6J A;  4DSE A;  4R64 A;  3T5K A;  1IIP A;  4DSF A;  3DEE A;  4KLE A;  1ZQY A;  1DOQ A;  5AKL A;  4RNM A;  3NRZ A;  2R8G A;  3C21 A;  2ASL A;  4US9 A;  1D8L A;  4Z6D A;  4QZI A;  2BHN A;  2BKE A;  1D8Y A;  9ICO A;  3VCB A;  8ICA A;  3M9O B;  4YFK A;  2AGP A;  1JAL A;  2A3V A;  1B43 A;  1WWU A;  2J6S A;  1B22 A;  4F5Q A;  4P4M A;  2EDU A;  1S0N A;  4F4Y A;  4I28 A;  3T5L A;  3QUQ A;  1Q3U A;  4DSL A;  4J9S A;  4EYH B;  3C28 A;  4IR9 A;  2H3F A;  3MGI A;  1N2X A;  2LYB A;  5IIN A;  1JRP A;  4PGQ A;  1B0X A;  2NO5 A;  5JRT A;  4QZ8 A;  3JPQ A;  4DS5 A;  1NJZ A;  5DDY A;  1SZP A;  1N63 A;  4C4S A;  2B6G A;  1ZYQ A;  2J6T A;  3MDC A;  4P0Q B;  2YN4 A;  4F92 B;  2BCV A;  1UT5 A;  2E8M A;  2KHV A;  3KHR A;  3H0R B;  3RTV A;  1TKD A;  4FS1 A;  7ICU A;  3D6J A;  4A8E A;  3IG8 A;  1CEZ A;  9ICJ A;  3EPG A;  1BNO A;  8ICE A;  1TVA A;  4ED7 A;  8ICU A;  1KKX A;  4F5N A;  2IMW P;  3K1R B;  1IM4 A;  8ICR A;  3I28 A;  4Y2T A;  1Q3V A;  3E2E A;  4F2R A;  2ZIU B;  3NVW A;  2WB1 F;  3C2L A;  4F93 B;  4EX6 A;  3H40 A;  4KLL A;  4IS7 A;  4LVS A;  3IN5 A;  8ICK A;  4QWB A;  4FS2 A;  2DWQ A;  3NVZ A;  3WKA A;  5AK3 A;  2W9A A;  4M2Y A;  2KOB A;  4DQS A;  2LI6 A;  2AGO A;  4OJ5 A;  4Q8E A;  2DFL A;  1RYS A;  3HKZ C;  5EE0 A;  2IOH A;  4DWI A;  4C4T A;  4QZA A;  4NJ8 A;  4MF8 A;  1PZN A;  4PHE A;  4M9H A;  5DGB A;  2KIV A;  2LM1 A;  4ECY A;  3B9J A;  4UAR A;  1TV9 A;  1ZQT A;  3PR4 A;  2EZZ A;  2YB4 A;  2K8B B;  2DPI A;  2KZZ A;  2V4R A;  2VAN A;  4NLG A;  3QU5 A;  5EOZ A;  4DSK A;  2KMD A;  4UAU A;  1V9P A;  5HHI A;  3D2N A;  1SV0 C;  5ALL A;  4RQ6 A;  1ZQK A;  2JEJ A;  4IR1 A;  2Z7J A;  1RPL A;  3J81 j;  4J9M A;  3FM9 A;  1BPZ A;  4Q44 A;  5ALR A;  4F5R A;  2OWO A;  5KG1 A;  2BQU A;  1KDH A;  3ISB A;  4DCC A;  2DL0 A;  8ICB A;  5ALJ A;  4Q45 A;  2KKV A;  3N28 A;  1NZB A;  3PW5 A;  5AKK A;  5HR7 A;  4P0P A;  2HOF A;  3PW2 A;  4I2B A;  4PGX A;  4C8O A;  3WU2 U;  3PO5 A;  4FFD A;  1ZD5 A;  2KNJ A;  7ICS A;  1QH9 A;  3RJI A;  1VJ5 A;  3PW0 A;  3PR5 B;  1BPD A;  2W3R A;  4RT3 A;  4DL6 A;  3PX6 A;  1LV5 A;  1WUD A;  3HJE A;  1UCV A;  2IBK A;  3NGD A;  4DFD A;  5BOL A;  3ZD9 A;  2QB0 B;  1NJY A;  3BZK A;  2G5H B;  2P6U A;  3F53 A;  1H38 A;  4IC9 A;  2JZB B;  2HVI A;  2EQY A;  1LKY A;  5KT2 A;  4QW8 A;  2KZ3 A;  2VKQ A;  8ICH A;  3TAR A;  2MSN A;  1PK1 A;  2UVW A;  5KAF U;  4I2D A;  3OGU A;  4J9Q A;  4HAI A;  5ALO A;  3SEI A;  2VIX A;  5KFV A;  8ICJ A;  2ZIX A;  3WKC A;  4YN4 A;  2YQE A;  5J2I A;  3PSI A;  2AJQ A;  4ED1 A;  2N1R A;  1ZQX A;  4QJF B;  1V85 A;  2OH2 A;  1OW5 A;  3PO4 A;  3PY8 A;  2RDI A;  2W9M A;  4R8U A;  3RH5 A;  2ZTD A;  4Q43 A;  1SL1 A;  2W03 A;  5KFD A;  3R9K A;  3ETR A;  3QU7 A;  4R65 A;  1HJP A;  1ZQO A;  3QEB Z;  2FLL A;  4QZC A;  4J9L A;  3KZX A;  4KX3 A;  5FP0 A;  8ICP A;  3WK4 A;  1MQ3 A;  3ETL A;  5CR0 A;  2UVU A;  2ZIV A;  3HX0 A;  3MAB A;  3RB4 A;  2NO4 A;  4JWM A;  4GXI A;  1NK9 A;  3V72 A;  4Y2J A;  3LWL A;  1HUZ A;  4O3O A;  4ED3 A;  1V38 A;  5DQH A;  4DFP A;  4JV2 A;  4EEK A;  2G06 A;  2J6U A;  4CRX A;  2OYY A;  3IP4 B;  1SKR A;  1ZQ1 C;  2HHX A;  3RB0 A;  2DPJ A;  2PFP A;  3MR6 A;  1ZQM A;  1MQ2 A;  3BQ7 A;  2DGZ A;  4ECU A;  3RBE A;  3ONN A;  3SEN A;  5KT7 A;  2LPE A;  5C0Y A;  3NTU A;  5KFM A;  3WKB A;  8ICS A;  5EWF A;  3BS5 B;  9ICW A;  3ZDC A;  3ISD A;  4DOA A;  1COO A;  2YX8 A;  2HMX A;  2NRW A;  3PNC A;  5J2K A;  2YY6 A;  2QB1 A;  2ASJ A;  1FIQ A;  4MFA A;  5IIO A;  2C22 A;  4RQ5 A;  3AN1 A;  1A77 A;  3UMB A;  4F4X A;  5J0Y A;  1L6N A;  3PV8 A;  1SWW A;  3KTQ A;  4AYB F;  2F1I A;  3QX7 A;  4GXK A;  3NVV A;  1PVQ A;  7ICF A;  4UAZ A;  4KLI A;  3AEV A;  4RUA A;  1UPH A;  3KZI U;  5D46 A;  1ZRN A;  1S76 D;  1X66 A;  1NNL A;  2E5S A;  3OJS A;  2W11 A;  3NVY A;  4O3S A;  2H3Z A;  2G07 A;  2IOF A;  1O03 A;  2JH7 A;  4P0Q A;  1GO3 F;  5AM4 A;  1NJX A;  2XGQ A;  1TFR A;  1N5W A;  1Z1B A;  1L5U A;  4GLX A;  2FPM A;  3EPI A;  2OHF A;  1NK5 A;  4B9V A;  1JXE A;  2F76 X;  1TAM A;  2MRL A;  5HHH A;  7ICM A;  3UXN A;  2KTQ A;  2ZIU A;  5KT3 A;  4UB2 A;  5CHG A;  5ALS A;  5HNK A;  2JXJ A;  3K1Z A;  2XC9 A;  3TFR A;  4MFF A;  8ICW A;  1CUK A;  2CN1 A;  4YR0 A;  3GFK B;  2WF8 A;  4RQ0 A;  4J9N A;  2DQN B;  2OEH A;  5KFC A;  4EX7 A;  2NV3 A;  5KG2 A;  3I1Y A;  1JI7 A;  2ALZ A;  3RF9 A;  4Z6E A;  5AKJ A;  3MC1 A;  1ZQS A;  4ECZ A;  4JK1 A;  2GLE A;  1A6S A;  4PZO A;  1SV0 A;  3M7D A;  1SGG A;  2O6K A;  5EWG A;  4KLM A;  5F3X B;  4RUC A;  1CI4 A;  5KFA A;  9ICT A;  1SXE A;  2HBK A;  3WK9 A;  9ICG A;  1ZQR A;  1NI3 A;  3UPQ A;  3N7R C;  2W8L A;  2W9B B;  4Y2U A;  3RJK A;  3CP8 A;  4RQ2 A;  4KLJ A;  1SL2 A;  3ICX A;  4RPZ A;  3QE9 Y;  3PW4 A;  4FZL A;  2W04 A;  2D8C A;  5ALQ A;  4EBC A;  2BGW A;  5AI9 A;  2G08 A;  4RQN A;  5KFW A;  1ZQJ A;  1B4F A;  2NRV A;  3RBD A;  4O9M A;  3BS7 A;  4OO1 J;  4IRK A;  3M6K A;  8ICZ A;  1JX4 A;  3LVW A;  5DBC A;  2E8N A;  4DO9 A;  3TAD C;  7ICG A;  1XWL A;  5AK4 A;  4EZ6 A;  1LB2 B;  1A0P A;  5H2F U;  5KG7 A;  2ZXI A;  3LVV A;  4BWJ A;  2FMS A;  4DQQ A;  4JUZ A;  1RDF A;  3EUB 2;  1YT3 A;  4KN7 A;  2RP5 A;  3CRX A;  3KOO A;  3HRD D;  1MN8 A;  2Y1I A;  2D6F C;  2XY7 A;  4BXO B;  1KFD A;  2BZF A;  4NLK A;  3T5J A;  1NKE A;  3SV4 A;  4NLC A;  5J0W A;  3TQ1 A;  5CRX A;  2D3D A;  9ICK A;  2BCR A;  3H7I A;  2F3N A;  2BQR A;  2V4Q A;  2IHN A;  5L1K A;  5IIL A;  2ZJ5 A;  1WCN A;  3GIL A;  2PFN A;  4KX5 A;  5HMM A;  4RQ4 A;  3K4G A;  5KL1 B;  2LBO A;  5J2H A;  1X42 A;  3JPR A;  3IHQ B;  2YTU A;  2I9G A;  2W9C A;  5ALI A;  4YCX A;  4P4P A;  3EWA A;  2LKY A;  7ICK A;  2K8C B;  4QWE A;  5J0O A;  4TUP A;  5KNI A;  3TFS A;  1VDV A;  3GIJ A;  3SZ2 A;  4G3I A;  4YQW A;  4DQI A;  4ECR A;  3RJG A;  5IIM A;  1T8E A;  3SAG A;  2RLT A;  3KHH A;  1S9F A;  1TK5 A;  1S77 D;  4FBU A;  4C0Z A;  8ICQ A;  1HUO A;  1JUD A;  2E8O A;  4P4O A;  5AKE A;  4M6W B;  5KFG A;  2ISO A;  5AKI A;  4B9M A;  1WYG A;  2ISP A;  3WK8 A;  3GDX A;  4UAW A;  2ZTC A;  5DQG A;  5KG4 A;  3BS5 A;  4DL5 A;  3Q8L A;  2JGA A;  3HPO A;  2E1F A;  3SI8 A;  4OJO A;  2W55 A;  5KFQ A;  2YML A;  1U9L A;  2KSO B;  1NKC A;  5KG5 A;  2GOL A;  2WF5 A;  4E0D A;  4RZR A;  3HP6 A;  2KP7 A;  3A0B U;  1ZQG A;  1C7Y A;  9ICS A;  4RQM A;  4DOC A;  2PI5 A;  4KMU A;  1RXW A;  8ICN A;  5BOM A;  2I6X A;  1SXD A;  1DRG A;  4O5C A;  2HBM A;  1QQ5 A;  2MUT B;  3U26 A;  4I2F A;  1O08 A;  2C28 A;  3FYH A;  2F8K A;  3UXO A;  4UB6 U;  3ALR A;  3TAQ A;  4RQ8 A;  2PKE A;  1Z4O A;  5CEH A;  2K89 A;  5J0T A;  2WF7 A;  1ZQN A;  4EZ9 A;  2K4P A;  3Q8M A;  9ICU A;  2EAO A;  3PZP A;  2EZX A;  1DXS A;  1N48 A;  4I2G A;  3OTQ A;  3SYZ A;  2ZIW B;  1N62 A;  5KG3 A;  4RNN A;  2FLP A;  8ICX A;  4EBD A;  3JPT A;  1F44 A;  1JIH A;  2LYA A;  2KIW A;  5DG9 A;  4UAY A;  2WF6 A;  4YR3 A;  5ALT A;  1D9D A;  4CGZ A;  3L3F X;  3GIK A;  2HOI A;  4CF3 A;  3F5E A;  5CJ7 A;  3QU2 A;  5KTQ A;  3HKZ F;  2PMZ C;  3UQ0 A;  1QQ6 A;  3GV8 B;  4QZF A;  2FDR A;  3V6H A;  2KIC A;  2R8J A;  1TK8 A;  2I1Q A;  4PHA A;  2BPF A;  2JMG A;  1U45 A;  3BQ2 A;  1N60 A;  4DLG A;  3KKA C;  4UBB A;  1UA0 A;  2IA6 A;  5JU5 A;  3KHG A;  4XQ8 A;  2CXY A;  5KFO A;  8ICC A;  2B21 A;  3ZI4 A;  7ICT A;  2F2A B;  1JXL A;  2BCQ A;  2PI4 A;  4RNO A;  4TQS A;  3MGV A;  5ALM A;  5DQI A;  1S5L U;  4F3O A;  4YMN A;  1ZQP A;  3C5F A;  1C20 A;  4OJ6 A;  4OCZ A;  3DV9 A;  4ECT A;  4KN4 A;  3PSP A;  3PMN A;  1K1S A;  3BDP A;  2HSZ A;  2LYH A;  5DGA A;  3RR8 A;  4KLU A;  1YZ7 A;  4QZH A;  5L9X A;  2KJ8 A;  2W9B A;  9ICF A;  1QLN A;  3DDH A;  1FFU A;  2VJ5 A;  4YMO A;  2DUY A;  4DFK A;  3V7L A;  5ALV A;  3KD3 A;  4IRC A;  4PJ0 U;  1KFS A;  1IV8 A;  4NLB A;  4XA5 A;  3BQ1 A;  1FO4 A;  4KLQ A;  5AM5 A;  4DLE A;  9ICV A;  3THV A;  3TAD A;  4KTQ A;  3C1Z A;  1TAQ A;  4XRH A;  4QW9 A;  4JV0 A;  3PML A;  1XSP A;  1Z4N A;  3V6J A;  2W8K A;  5III A;  4KLT A;  4UB5 A;  5KFJ A;  2ZUC A;  3ED5 A;  1BNP A;  2R8I A;  1L7P A;  2HOQ A;  2KV2 A;  4LZD A;  4BGD A;  1L8L A;  3M9M B;  1J2M A;  4FO6 A;  2W54 A;  1UA1 A; 
#chains in the Genus database with same CATH homology
 2KVS A;  2FJ6 A;  2O6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...