2FJ6A

Solution nmr structure of the upf0346 protein yoze from bacillus subtilis. northeast structural genomics target sr391.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0346 protein yozE
publication title Solution NMR structure of the UPF0346 protein yozE from Bacillus subtilis. Northeast Structural Genomics target SR391.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2fj6A01
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH superfamily
5TZVA 2PI4A 5J0OA 5KFOA 1ZD2P 4JV0A 5ALVA 4OJLA 5DG8A 8ICIA 4IQWA 4TUPA 2V9WA 3LK9A 1B43A 2KICA 5JRTA 1S8OA 3M9NB 2ZIUA 5KG0A 5ALZA 1RYUA 8ICJA 4DL5A 5BPCA 2QLTA 3PW7A 5AK4A 1NJZA 1LVHA 1N60A 4FBTA 3F5AA 2LBOA 9ICXA 4RU9A 3QUBA 5J0XA 4EX6A 3TANA 4DS5A 3B0XA 2DBYA 3LVVA 5KL1B 5DB6A 2EZZA 5J0TA 5ALQA 1S77D 1ZXIA 5AKXA 2ZIWA 9ICKA 4FS1A 1JMSA 8ICZA 3PR5B 2ODGA 2KSOA 2CPRA 1X40A 9ICBA 7ICTA 3KOOA 1COKA 1Z4NA 2C28A 4OO1J 4KLIA 3WKDA 4C7ZA 4NM2A 2KE7A 2IOFK 3IM1A 4UB6U 4YMNA 1N5XA 3QU7A 4NLBA 3KKAC 1ZQHA 4US9A 2KZ3A 2XGPA 3PW4A 4KN4A 4F2RA 2RRDA 3TKAA 1ZQOA 3MR5A 1U47A 2HBMA 4RNNA 4PHPA 2DPIA 4CDGA 5DKWA 1ZQYA 5AK6A 3PSFA 5AK5A 2ZTCA 4P4MA 1T3QA 5DBCA 4C80A 2JEJA 8ICFA 4NV0A 4KLJA 4YCXA 1FIQA 2MRLA 3RRGA 1DXSA 2ISOA 4FZMA 2E8PA 2YMQA 5J0PA 5L1LA 2D8CA 4QZHA 2VJ4A 3OTQA 9ICJA 3V72A 2QB0A 2KHQA 1ZQAA 1ZETA 4O3NA 1UCVA 4IRDA 3EW9A 2A3VA 5CA7A 4I28A 1L5UA 3HP6A 1NNLA 1S76D 1BGXT 2WFAA 1NJWA 1CRXA 2AGPA 1SKRA 3ZDEA 2EANA 4YD2A 4P4OA 3H4DA 1JN3A 4RZRA 2F3NA 1OW5A 4TURA 3FC4A 4ED8A 8ICMA 3V7JA 2BGWA 1TK8A 3PSIA 4I2FA 3GV8B 3DV9A 4J9PA 3FM9A 2H3FA 1JIHA 1A6SA 2D3DA 3QUCA 2E8NA 5D46A 5J0RA 4KMUA 5AI6A 1B0XA 2EH9A 2ZUBA 2W9CA 1CI4A 2N1RA 2LMRA 2HHQA 3Q8LA 4J9RA 2K60A 4GC6A 5AKEA 1MA7A 1NK4A 4NM1A 2V4QA 3C2LA 1N63A 3QX7A 3RJGA 3JPNA 4UAZA 4AP9A 1F0MA 3PMLA 1ZJNA 3D2QA 4KLOA 2HCFA 4J9SA 4RQ8A 9ICFA 3AMZA 9ICMA 2XICA 4RQ5A 1SL1A 4Q44A 5KFBA 1V97A 1H38A 3QUTA 2KJ8A 2XY6A 3QZ8A 5AI5A 4O9MA 3V6JA 1IG6A 3TADA 2ASJA 2AXTU 2HW3A 3IDWA 1XSNA 1KSPA 3M9MB 3RB6A 4Y2JA 3DDHA 5J2CA 3R9KA 2ALZA 1WYGA 4ED6A 4DL3A 4RQ0A 2EAMA 2XI9A 4Y2SA 5J2JA 3LDAA 4BXOA 1L3SA 3HWTA 4C8LA 1O03A 2DPJA 2DQNB 3N7RC 4RQ4A 4P0QA 3QEBZ 2ZXIA 1WUDA 4K4HA 2I6XA 5KFCA 3N4MB 4DSLA 7ICHA 5KT2A 2C22A 2K4IA 2R8HA 4PPXA 5AM2A 3N7SC 2W3SA 3H0LB 7ICKA 2C2RA 4F5NA 5HNKA 4TUSA 1SB3C 2PFPA 5DQIA 4PGXA 1BPYA 3RJHA 2IA6A 2JR5A 3SZ2A 2I5HA 2F44A 5KT3A 1URJA 3QU5A 5ALGA 2OYYA 2A1JA 1A0PA 4B9SA 3ETLA 4F8RA 2NO4A 1FFUA 1KTQA 2HBJA 4MFFA 2FMQA 5G5HA 4DSKA 4O3MA 4KLLA 5AHXA 3SAHA 3N7PD 2R8GA 2JV3A 5AI0A 1SXDA 1PZNA 2KD1A 4UB1A 4YG2A 2PKEA 2KTQA 2LHTA 3QU2A 4DFPA 2PMZF 1U9LA 4CF3A 3MFHA 2P66A 3SAFA 3G6XA 5KG1A 4QWAA 5HMMA 4B9VA 2JHDA 3FAHA 1S97A 5KFKA 1TK0A 8ICXA 3TADC 4ED2A 4ELVA 4KLFA 3MR6A 4ECXA 1ECWA 2YX8A 3MR2A 3WK6A 3M6KA 1J2NA 2PFQA 3H40A 3HRDD 3PR4A 2A19A 1B22A 4C8KA 2MUTB 5L9XA 1KRPA 4F4KA 1TAQA 3HJEA 2M9NA 4GXJA 3UQ2A 2FE9A 1PK3A 2B0CA 1PK1A 4NLNA 4ECYA 3SD7A 5AIBA 2ASLA 3K4GA 4JUZA 1PVQA 1RQLA 1NK5A 1PVRA 9ICHA 1JI7A 2KK0A 4ECRA 5AKHA 2ZTDA 1O08A 1UA0A 3BQTA 4EYIB 5CEHA 2KFNA 1IXRA 3Q8MA 4QZ9A 1ZQNA 1TFRA 4CCHA 4QZGA 2BCVA 2OCEA 1YT3A 4F92B 5D4BA 5J2GA 1BNOA 4UASA 9ICUA 1S0VA 3AUOA 4Q43A 3CW2C 4Y2PA 5EWFA 4EEYA 2C2DA 4BDPA 5C0YA 2BPFA 5G5GA 9ICRA 5KT6A 5ALTA 4J9QA 3BZCA 3L4PA 2ZUCA 4C8NA 1SIJA 1ZQRA 1S10A 3S6JA 4DSFA 4DL2A 4IQTA 1QQ7A 4PHAA 3C21A 2GH1A 5C5JA 2O6KA 1Q46A 2QB1A 2F1JA 5KFUA 5ALDA 4EYHB 4YMOA 3TFRA 4DFDA 3OJSA 4G9BA 2Y1IA 4KX3A 1J2MA 1A76A 1XU4A 3E0FA 4QIWC 4KITB 3RRHA 8ICUA 5ALIA 3GILA 3NTUA 2V4RA 3RB0A 4IQUA 3RH5A 3NVZA 4MEYA 5DLFA 1X2IA 1NK0A 3M7DA 1V85A 3SMVA 5H2FU 2PMZC 4F4XA 4NJ8A 1X9MA 4ED1A 3WK4A 1Q8KA 2AQ0A 4YFKA 3H8MA 4MFAA 3TI0A 5AKIA 2NO5A 4Q8FA 4XUSA 5IIMA 3LVWA 3H8SA 1KQQA 3C23A 3L3FX 5J8YA 1ZYQA 4PH5A 1Z1VA 3QU4A 4RQNA 3C1YA 1TE2A 4ZOHC 5A0LA 3PW2A 2R18A 1MSWD 2RHFA 1SL0A 3AU6A 3G6VA 5DQGA 1L3UA 1ZQBA 4OCZA 3ICXA 2ZG6A 5B66U 2AHOB 2XCAA 2M0NA 3RFAA 4YQWA 4GXIA 3DEEA 1IIPA 2OWOA 2F8LA 1ZQDA 3WK5A 2OH2A 1L7NA 1HUOA 1ZQTA 9ICSA 3SV4A 3RAQA 4CRXA 3Q8PB 1BNPA 2KOBA 2BPCA 3IP4B 4PL2A 4DF4A 4NLCA 1Z3EB 3TACB 1ZQLA 2FMPA 4HYKA 4RNOA 4IRKA 4CF4A 9ICWA 3AL0B 3SQIA 3SV3A 2WF8A 1TV9A 4O5CA 5AM0A 2FI1A 4ELUA 2PXIA 1BPBA 5KT5A 4QNLA 8ICBA 3WU2U 1Z00A 1KKXA 3C2MA 3H0RB 3UXPA 2IMWP 1XO0A 3KHHA 1FEZA 1S0MA 4BGDA 2ASDA 3KTQA 3OGUA 4M6WA 4GIBA 3AEVA 1FFVA 4DOCA 2VA3A 1QSLA 2W9BA 3D6JA 2OEHA 5KT7A 3WKCA 3M8RA 1B4FA 3KZXA 3IV6A 4PZNA 3JPPA 2Q0ZX 1L8OA 4BWJA 8ICVA 4CE6A 3H8WA 4F93B 4BXOB 4OJOA 4EZ6A 4B6JA 1HUZA 5CRXA 1COOA 3U26A 1ZQMA 4KLQA 3RH6A 4TQSA 4QZBA 2ZIVA 3OHBA 1JUDA 2ZJ8A 4P0QB 3J81j 2FPKA 2G5HB 2AH5A 1WCNA 5J8YC 1T3NA 2GO7A 2KZMA 4X5VA 3K1RB 2JXJA 1T94A 2HHWA 5K4LA 4JWNA 2HVIA 4DLGA 2Q4TA 5ALLA 1UA1A 2AGOA 5AICA 1NI3A 2YN4A 4KLGA 2HHXA 1JROA 7ICEA 1ZQPA 2HDOA 4QZCA 4UQGA 1D8BA 4UAYA 1VLBA 3FDSA 3NVYA 4J9MA 5D49A 9ICGA 4F91B 5DBBA 5AKGA 5AKYA 5J0WA 4RPYA 4M0AA 1RM6C 2DL0A 2VANA 3KBBA 4F2SA 2ZTEA 5AK3A 5KAFU 3MGVA 2JMGA 1RQNA 3ORYA 1N2XA 2YMPA 1ZRNA 7ICMA 4KLHA 5DDMA 4J9KA 1S9FA 4QWEA 2E1EA 5F3XB 2F77X 3E58A 5EOZA 8ICHA 2K8CB 2F1HA 2BKEA 2BCUA 3I1YA 3T3FA 2E1FA 4LZDA 2F8KA 1ZD5A 2FMSA 2KN7A 1NK7A 4P0PA 5ALXA 2K8AA 1KL9A 4ECZA 2W43A 4ED7A 1ZQQA 2MSNA 2W8KA 3KHRA 2CN1A 2ZIXA 1FO4A 4E0DA 5KG2A 1ZRMA 4DL7A 3PSPA 1Z1BA 2XGQA 1QQ5A 2R8JA 2JH1A 1NK9A 3BQ1A 1PK1B 2OXOA 4DFJA 5HHIA 2RQ5A 4YXMA 3VC8A 1J97A 3NASA 1RPLA 3Q8SB 4IR1A 5DB9A 1NKEA 4UAWA 3RJKA 5HR7A 4I2JA 3T79A 8ICQA 4R63A 7ICGA 3QYPA 1U4BA 5AKLA 3A0BU 5HP4A 4B9MA 1U45A 1ZQUA 1NK6A 4R8UA 5J2FA 2W11A 3UMCA 5AM5A 9ICQA 2ZUDA 3PSTA 2FLNA 4EEKA 5JU5A 2H3VA 4U7CA 5KAIU 2HVHA 3C2KA 5J2IA 5EWEA 4RT2A 4DS4A 5KFYA 3F5EA 1KFTA 5KFVA 3RJEA 5L1MA 4OJ5A 2DFLA 5ALHA 4A8EA 7ICUA 5L1JA 5IIIA 3BZKA 5J2EA 1RXVA 3HKZF 2WB1F 2YB4A 2W9AA 2NYVA 5T14A 1UT5A 4QW9A 1N56A 3GZFA 3ISCA 2ZXHA 4DQPA 2EQYA 1NZPA 4YP3A 5ALFA 5L1IA 3TQ1A 3BS5A 5KFPA 5KNIA 4DOBA 4O5EA 3WK8A 2LYAA 5KFJA 1BPXA 5KT4A 8ICWA 2AU0A 5IINA 4Y2QA 3KHLA 2RDIA 1C20A 3CNHA 4J9NA 2XO7A 1F44A 2WF7A 2FPMA 3WK7A 5EE0A 4DL4A 2W55A 3BQ0A 4O5KA 1Z4OA 3C1ZA 3JPSA 4K4IA 1T8EA 1NOMA 2BCRA 1TAMA 1X9XA 1SWVA 5ALNA 3QU9A 3E2EA 4DCCA 5AKZA 5EE3A 2WF9A 2BR0A 1U48A 1X9SA 2FLLA 4IL6U 4ECTA 1ZD4A 2W04A 2HOFA 3RTVA 4G3IA 4IC9A 3JPOA 1X9WA 4RUAA 3ONNA 3H7IA 2KVSA 4DLEA 4EX7A 4M9GA 1ZD3A 4QWDA 3EPIA 3PZPA 2KP7A 2JZBB 1TK5A 4Q8EA 3O0FA 5AKJA 4DFMA 2VA2A 3T5JA 1D9FA 3NGDA 3UXNA 2R8KA 4KLSA 5F9LA 3AN1A 5KFEA 1SXEA 5ALSA 4RPXA 5TISU 4DSEA 1N62A 5ALYA 2KG5A 1SWWA 3MGIA 1ZQIA 2HOIA 4NL9A 3NUQA 1XS9D 5AM4A 2VKQA 4KX5A 2KZZA 3HX0A 3ETRA 2KFZA 2BHNA 2ES6A 4DQQA 2DUYA 1K1SA 5GTHU 4KMOB 4B9NA 3MFIA 4F5RA 8ICOA 1UHUA 4EENA 3MDCA 1SZPA 1ED1A 3UQ0A 2XY7A 5B5EU 3EUB2 1DGSA 5CJ7A 1ZQEA 4GLXA 1ZQKA 3SI8A 4O3OA 4FS2A 4PL1A 2KKPA 2UVWA 2NRWA 2D6FC 2XVTA 3Q8RB 1KW4A 2H3ZA 2ZIUB 3ZDBA 1HIWA 4JWMA 4M9HA 4UB3A 5F9NA 8ICPA 3HKZC 3PW5A 1RG6A 3GFKB 2WB1C 2G08A 2YMMA 5DDYA 3M9OB 3ZI4A 1L7MA 4CF5A 1EXNA 3GQCA 2JH7A 4M47A 3T5LA 2E5SA 2J6SA 3F2BA 3SR6A 2YQEA 3QXGA 1K5OA 1QQ6A 3K75D 5KG3A 4GXKA 2BCQA 1L7OA 4FFDA 1JRPA 2WAQF 2DF4B 4I2DA 5IIOA 4RPZA 2ZIWB 1WG8A 4YMMA 4US8A 5AI4A 2ZIVB 3PMNA 2ESEA 2KSOB 4UARA 3RAXA 5DB7A 5EWGA 1ZQJA 2JRZA 5JUMA 3HPOA 2HHVA 2NRXA 3H4BA 4ACOA 5KFRA 3V7LA 4I2GA 4ECUA 2KHVA 1RZTA 9ICAA 3ISBA 2WF6A 5EE9A 4Z6CA 4DQRA 2FJ6A 4Z6FA 5AI9A 3RBDA 1ZQFA 1L7PA 4C0ZA 3M6ZA 5ALMA 3IG8A 1N5WA 2G09A 4NL9C 4UB8U 2LI6A 4I2HA 2KEYA 4PZOA 4Y2VA 4M9NA 2YB1A 3TAPA 2VIXA 9ICNA 1RDFA 5DLGA 2DGZA 3GIMA 4M9LA 2EZYA 2W9MA 4NLKA 4QZ8A 3V7KA 2MAXA 9ICEA 5ALJA 3M8SA 1T4GA 1AROP 2GLEA 5DB8A 4M9JA 1TAUA 1CUKA 2H5XA 3UMGA 4C4SA 2QB0B 4EBCA 4DOAA 5KFIA 1HJPA 1MN8A 2F1IA 3PW0A 1KEJA 4AYBF 3QEAZ 2QARA 4LJXA 5HHHA 1U49A 5EE1A 3IRUA 3IN5A 2LM4A 2EZXA 4I2BA 2H3IA 5BOLA 4LZGA 3MABA 5JTIA 5ALKA 2I9GA 2WTFA 7ICNA 1TVAA 1X6IA 3Q8QB 4QZAA 1SZHA 2UVUA 1WWUA 1ZQCA 2KNJA 2BDUA 3QNMA 4BWMA 4UB5A 1DK2A 4P0PB 4Q45A 2Y9UA 2KVCA 4F4ZA 1NKCA 3ZD8A 3PV8A 1X66A 2Z7JA 2ZIXB 4JK1A 1KDHA 2W9CB 3AU2A 2PFNA 5KFLA 3T5HA 4IRCA 5AI8A 3D2SA 3V6HA 3CYMA 3QE9Y 1AQ6A 1C7YA 2PFOA 8ICTA 4XA5A 3HILA 5CHGA 5KG5A 2VJ5A 3NRWA 3A0HU 4YD1A 1Y88A 1SKSA 2P6UA 5AIAA 2F76X 5ALEA 5KL8B 3UMBA 2WAQC 2J6UA 2IBKA 5KFAA 4Z6DA 1SV4A 2EAOA 5KFHA 4EZ9A 4IR9A 3AM9A 5J0SA 4YR2A 3THVA 2AGQA 5AM3A 2MUTA 2K4HA 3ALRA 3C28A 4DFKA 1JX4A 8ICGA 1ZJMA 4FE3A 3UXOA 4ED0A 3OSNA 1Z19A 2H3QA 5CWRA 1LKYA 2VA8A 2OM6A 3ZDDA 2LM1A 2KV2A 3BS5B 3GV7B 1TKDA 7ICJA 1BPDA 2XY5A 3Q8KA 4CNQA 4CGZA 3HT3A 1WWVA 2RP5A 3EYZA 3SENA 2G5IB 9ICOA 1PUZA 9ICCA 4KN7A 1L3VA 2Y1JA 4UW9A 2E8MA 3RF9A 2AQ4A 2JEGA 1ZQGA 5DGBA 3OPXA 3PNCA 4PHDA 2MA1A 2NRZA 4AYBC 4TQRA 3UM9A 2BQRA 4F3OA 2RDJA 3SYZA 2K8BB 3RJIA 1ZQXA 5DG9A 3PX4A 2BPGA 4Y2TA 1L3TA 3MDAA 4JMUA 1WCLA 3HW8A 1D9DA 2F2AB 4KLUA 4F5PA 5DQHA 2A1JB 2IOFA 3CP8A 4F5QA 1NJYA 5J0YA 4B9TA 3OSPA 5CR0A 4QJFB 2HHUA 1KFDA 2L5YA 5J0QA 2IOHA 5KFNA 1JALA 3BJYA 4XRHA 7ICIA 1KLNA 5BOMA 1X42A 4NY8A 4NXZA 4R65A 4ECWA 3LWLA 4Y2XA 5ALPA 8ICRA 4J9LA 2WF5A 1L8LA 4JV2A 1N61A 3K1ZA 3C29A 1Q3VA 4C8OA 4ELTA 2NRTA 3RB4A 2W54A 4YN4A 4KTQA 2LKYA 3WKAA 1SV0A 1XO1A 2RLTA 9ICTA 9ICLA 3RR8A 5J2DA 2EAPA 5ALUA 7ICQA 2YY6A 3QUQA 4F72A 3I28A 4I2AA 5KFTA 1ZOLA 3BS7A 4OD0A 4ECVA 4KLDA 3RB3A 1XWLA 1NK8A 2UVVA 2W7OA 3MR3A 1SGGA 4UB2A 4QWBA 3CRXA 3T5KA 4O3RA 2GWSA 4PJ0U 1XSLA 1VDVA 3FYHA 3GIIA 1RYRA 3ZDAA 4ECSA 7ICPA 4MF8A 3TAQA 1DK3A 5DGAA 4MEXA 2KJ5A 8ICCA 1V9PA 1XNSA 4DF8A 1QSSA 1QLNA 1CEZA 4YR0A 3ZDCA 2Y0SF 3WK9A 7ICOA 3MC1A 5KFQA 2K4EA 3C5GA 2P6RA 1XC9A 1UPHA 2HHTA 2HOQA 3KD3A 3WKEA 3RR7A 3SAGA 4RQ3A 4DSIA 3KZIU 5GTIU 3D2NA 4DSJA 2XIDA 5ALRA 2P35A 4UBBA 3N28A 3F2CA 1ZQ1C 3QZ7A 5CP2A 3OHAA 4UBCA 2XC9A 1LB2B 1SKWA 4C8MA 4P4PA 5AM1A 4KLMA 5KTQA 2B6GA 4PGYA 2B21A 2W03A 1DOQA 3PO4A 4OJPA 3I76A 3ISDA 3SEIA 3RJFA 2DKZA 5CB1A 2YMLA 1NJXA 1LV5A 4DO9A 4UAVA 1KN5A 5HR6A 4C4TA 7ICLA 5KFGA 4HAIA 4BJQA 3GIKA 1QSYA 5KG7A 3JPRA 3RH4A 4O3PA 1SV0C 2GOLA 1PVPA 5DG7A 1S0NA 4F71A 3NVVA 1OUQA 1BVSA 4KLEA 3JPQA 4YR3A 2HBKA 3TARA 2BQ3A 3GV5B 2QARB 3L5KA 1IV8A 4TUQA 8ICKA 4XQ8A 4FO6A 5ALOA 1KFSA 4ZH4A 4I27A 1K1QA 4USAA 8ICSA 4NLZA 2KMDA 3PX0A 5E79U 3TFSA 7ICRA 4DWIA 2BQUA 4DEZA 5KG6A 1MQ3A 2BZFA 4UAUA 4R66A 4DQSA 2AJQA 2NV3A 3F2DA 3NS1A 4I29A 4I2IA 2K4PA 4Z6EA 4QZFA 4ECQA 1QTMA 1V38A 3KHGA 3EZ5A 4LVSA 8ICLA 1JXEA 1BPZA 5ALWA 3ZD9A 4JB3A 2UVRA 4QIWF 2E3TA 3V6KA 5IIKA 1OXJA 9ICIA 2R8IA 4F5OA 2BCSA 2EDUA 4B9LA 2I1QA 1UQVA 4RQ2A 2LYBA 4EBEA 5KFFA 4IQVA 4ED3A 4RNMA 4EELA 2Y0SC 4BUGA 3MBYA 2W8LA 3AQEA 5FP0A 1RXWA 1NZBA 1ZQZA 3KFUF 5KFSA 1Z00B 2ATLA 4UB4A 4F4WA 2HI0A 4RT3A 5J2AA 3F53A 3BQ7A 4I2CA 4M04A 3B9JA 4M6WB 2DKXA 1YZ7A 2G06A 2W9BB 1D8LA 2ZJAA 4ICAA 4Y2YA 3AQFA 4O3SA 3BQ2A 2CXYA 1YZ6A 4PGQA 1VJ5A 4MF2A 1LKYB 2ISPA 1L6NA 2DWQA 4GFJA 2KKVA 1QCKA 3RJJA 1ZQSA 5HMLA 2KJ9A 5J0UA 4F50A 4B9UA 1QH9A 7ICFA 4U6PA 3PX6A 5KFWA 1SL2A 4JV1A 2KIWA 2KIVA 1UT8A 3H8JA 3WKBA 3M1YA 3N97B 2YTUA 2QKQA 3IHQB 3IG5A 2G07A 4RQ1A 4YXJA 5J2HA 8ICAA 2CRXA 3LWMA 3GDXA 4GC7A 2W3RA 5KFXA 1P7DA 1A77A 3B0YA 5KFZA 5DBAA 4RQ7A 3VCBA 2A1AA 2IHNA 1JXLA 4KLTA 1DRGA 3EPGA 1F5SA 4F4YA 8ICEA 4EBDA 1N48A 5IIJA 5KFDA 5J2KA 1S5LU 4O3QA 5J2BA 3BDPA 1ZQWA 5IILA 3NRZA 3JPTA 4FBUA 4R64A 4O0IA 2XCPA 4DQIA 1HEKA 1Q3UA 1DGJA 5L1KA 2W7PA 2JEIA 2OHFA 2FDRA 3GIJA 2BDPA 2G0AA 1S0OA 1MQ2A 3EWAA 3C5FA 2HMXA 2NRVA 2Y9TA 4QZDA 1MC8A 4IS7A 4BX9C 1ZQVA 5KFMA 1RYSA 3RBEA 4QZIA 1T7PA 2HSZA 4QW8A 4PHEA 4MHVA 4RQMA 3PO5A 3H0MB 3PY8A 3LYSA 5AKKA 3GU3A 2LYHA 2PI5A 4FZNA 4YVZA 2WHEA 4DL6A 2IHMA 4P2HA 3OJUA 2E8OA 2J6TA 8ICYA 2K89A 2JGAA 2ZJ5A 3NVWA 4C4RA 2FPLA 4K4GA 8ICNA 2JZBA 4QZEA 4Y2UA 7ICSA 2HBLA 3KKAA 1XSPA 2FLPA 1X6JA 4NLGA 1BPEA 4Y2RA 2C2EA 1NKBA 2JEFA 4M2YA 7ICVA 4MFCA 1GO3F 3MGHA 4FZLA 1IM4A 4NWIA 4C7YA 3ED5A 9ICPA 3G6YA 5KG4A 3UPQA 4J9OA 1M6YA 2LPEA 4UATA 2MU2A 1D8YA 4I2EA 2HHSA 4RQ6A 4WJ3B 5J29A 4R8UB 4RUCA 9ICVA 4OJ6A 1KBUA 4J03A 3PVXA 4QWCA
chains in the Genus database with same CATH topology
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6K A;  2KVS A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 5TZV A;  2PI4 A;  5J0O A;  5KFO A;  1ZD2 P;  4JV0 A;  5ALV A;  4OJL A;  5DG8 A;  8ICI A;  4IQW A;  4TUP A;  2V9W A;  3LK9 A;  1B43 A;  2KIC A;  5JRT A;  1S8O A;  3M9N B;  2ZIU A;  5KG0 A;  5ALZ A;  1RYU A;  8ICJ A;  4DL5 A;  5BPC A;  2QLT A;  3PW7 A;  5AK4 A;  1NJZ A;  1LVH A;  1N60 A;  4FBT A;  3F5A A;  2LBO A;  9ICX A;  4RU9 A;  3QUB A;  5J0X A;  4EX6 A;  3TAN A;  4DS5 A;  3B0X A;  2DBY A;  3LVV A;  5KL1 B;  5DB6 A;  2EZZ A;  5J0T A;  5ALQ A;  1S77 D;  1ZXI A;  5AKX A;  2ZIW A;  9ICK A;  4FS1 A;  1JMS A;  8ICZ A;  3PR5 B;  2ODG A;  2KSO A;  2CPR A;  1X40 A;  9ICB A;  7ICT A;  3KOO A;  1COK A;  1Z4N A;  2C28 A;  4OO1 J;  4KLI A;  3WKD A;  4C7Z A;  4NM2 A;  2KE7 A;  2IOF K;  3IM1 A;  4UB6 U;  4YMN A;  1N5X A;  3QU7 A;  4NLB A;  3KKA C;  1ZQH A;  4US9 A;  2KZ3 A;  2XGP A;  3PW4 A;  4KN4 A;  4F2R A;  2RRD A;  3TKA A;  1ZQO A;  3MR5 A;  1U47 A;  2HBM A;  4RNN A;  4PHP A;  2DPI A;  4CDG A;  5DKW A;  1ZQY A;  5AK6 A;  3PSF A;  5AK5 A;  2ZTC A;  4P4M A;  1T3Q A;  5DBC A;  4C80 A;  2JEJ A;  8ICF A;  4NV0 A;  4KLJ A;  4YCX A;  1FIQ A;  2MRL A;  3RRG A;  1DXS A;  2ISO A;  4FZM A;  2E8P A;  2YMQ A;  5J0P A;  5L1L A;  2D8C A;  4QZH A;  2VJ4 A;  3OTQ A;  9ICJ A;  3V72 A;  2QB0 A;  2KHQ A;  1ZQA A;  1ZET A;  4O3N A;  1UCV A;  4IRD A;  3EW9 A;  2A3V A;  5CA7 A;  4I28 A;  1L5U A;  3HP6 A;  1NNL A;  1S76 D;  1BGX T;  2WFA A;  1NJW A;  1CRX A;  2AGP A;  1SKR A;  3ZDE A;  2EAN A;  4YD2 A;  4P4O A;  3H4D A;  1JN3 A;  4RZR A;  2F3N A;  1OW5 A;  4TUR A;  3FC4 A;  4ED8 A;  8ICM A;  3V7J A;  2BGW A;  1TK8 A;  3PSI A;  4I2F A;  3GV8 B;  3DV9 A;  4J9P A;  3FM9 A;  2H3F A;  1JIH A;  1A6S A;  2D3D A;  3QUC A;  2E8N A;  5D46 A;  5J0R A;  4KMU A;  5AI6 A;  1B0X A;  2EH9 A;  2ZUB A;  2W9C A;  1CI4 A;  2N1R A;  2LMR A;  2HHQ A;  3Q8L A;  4J9R A;  2K60 A;  4GC6 A;  5AKE A;  1MA7 A;  1NK4 A;  4NM1 A;  2V4Q A;  3C2L A;  1N63 A;  3QX7 A;  3RJG A;  3JPN A;  4UAZ A;  4AP9 A;  1F0M A;  3PML A;  1ZJN A;  3D2Q A;  4KLO A;  2HCF A;  4J9S A;  4RQ8 A;  9ICF A;  3AMZ A;  9ICM A;  2XIC A;  4RQ5 A;  1SL1 A;  4Q44 A;  5KFB A;  1V97 A;  1H38 A;  3QUT A;  2KJ8 A;  2XY6 A;  3QZ8 A;  5AI5 A;  4O9M A;  3V6J A;  1IG6 A;  3TAD A;  2ASJ A;  2AXT U;  2HW3 A;  3IDW A;  1XSN A;  1KSP A;  3M9M B;  3RB6 A;  4Y2J A;  3DDH A;  5J2C A;  3R9K A;  2ALZ A;  1WYG A;  4ED6 A;  4DL3 A;  4RQ0 A;  2EAM A;  2XI9 A;  4Y2S A;  5J2J A;  3LDA A;  4BXO A;  1L3S A;  3HWT A;  4C8L A;  1O03 A;  2DPJ A;  2DQN B;  3N7R C;  4RQ4 A;  4P0Q A;  3QEB Z;  2ZXI A;  1WUD A;  4K4H A;  2I6X A;  5KFC A;  3N4M B;  4DSL A;  7ICH A;  5KT2 A;  2C22 A;  2K4I A;  2R8H A;  4PPX A;  5AM2 A;  3N7S C;  2W3S A;  3H0L B;  7ICK A;  2C2R A;  4F5N A;  5HNK A;  4TUS A;  1SB3 C;  2PFP A;  5DQI A;  4PGX A;  1BPY A;  3RJH A;  2IA6 A;  2JR5 A;  3SZ2 A;  2I5H A;  2F44 A;  5KT3 A;  1URJ A;  3QU5 A;  5ALG A;  2OYY A;  2A1J A;  1A0P A;  4B9S A;  3ETL A;  4F8R A;  2NO4 A;  1FFU A;  1KTQ A;  2HBJ A;  4MFF A;  2FMQ A;  5G5H A;  4DSK A;  4O3M A;  4KLL A;  5AHX A;  3SAH A;  3N7P D;  2R8G A;  2JV3 A;  5AI0 A;  1SXD A;  1PZN A;  2KD1 A;  4UB1 A;  4YG2 A;  2PKE A;  2KTQ A;  2LHT A;  3QU2 A;  4DFP A;  2PMZ F;  1U9L A;  4CF3 A;  3MFH A;  2P66 A;  3SAF A;  3G6X A;  5KG1 A;  4QWA A;  5HMM A;  4B9V A;  2JHD A;  3FAH A;  1S97 A;  5KFK A;  1TK0 A;  8ICX A;  3TAD C;  4ED2 A;  4ELV A;  4KLF A;  3MR6 A;  4ECX A;  1ECW A;  2YX8 A;  3MR2 A;  3WK6 A;  3M6K A;  1J2N A;  2PFQ A;  3H40 A;  3HRD D;  3PR4 A;  2A19 A;  1B22 A;  4C8K A;  2MUT B;  5L9X A;  1KRP A;  4F4K A;  1TAQ A;  3HJE A;  2M9N A;  4GXJ A;  3UQ2 A;  2FE9 A;  1PK3 A;  2B0C A;  1PK1 A;  4NLN A;  4ECY A;  3SD7 A;  5AIB A;  2ASL A;  3K4G A;  4JUZ A;  1PVQ A;  1RQL A;  1NK5 A;  1PVR A;  9ICH A;  1JI7 A;  2KK0 A;  4ECR A;  5AKH A;  2ZTD A;  1O08 A;  1UA0 A;  3BQT A;  4EYI B;  5CEH A;  2KFN A;  1IXR A;  3Q8M A;  4QZ9 A;  1ZQN A;  1TFR A;  4CCH A;  4QZG A;  2BCV A;  2OCE A;  1YT3 A;  4F92 B;  5D4B A;  5J2G A;  1BNO A;  4UAS A;  9ICU A;  1S0V A;  3AUO A;  4Q43 A;  3CW2 C;  4Y2P A;  5EWF A;  4EEY A;  2C2D A;  4BDP A;  5C0Y A;  2BPF A;  5G5G A;  9ICR A;  5KT6 A;  5ALT A;  4J9Q A;  3BZC A;  3L4P A;  2ZUC A;  4C8N A;  1SIJ A;  1ZQR A;  1S10 A;  3S6J A;  4DSF A;  4DL2 A;  4IQT A;  1QQ7 A;  4PHA A;  3C21 A;  2GH1 A;  5C5J A;  2O6K A;  1Q46 A;  2QB1 A;  2F1J A;  5KFU A;  5ALD A;  4EYH B;  4YMO A;  3TFR A;  4DFD A;  3OJS A;  4G9B A;  2Y1I A;  4KX3 A;  1J2M A;  1A76 A;  1XU4 A;  3E0F A;  4QIW C;  4KIT B;  3RRH A;  8ICU A;  5ALI A;  3GIL A;  3NTU A;  2V4R A;  3RB0 A;  4IQU A;  3RH5 A;  3NVZ A;  4MEY A;  5DLF A;  1X2I A;  1NK0 A;  3M7D A;  1V85 A;  3SMV A;  5H2F U;  2PMZ C;  4F4X A;  4NJ8 A;  1X9M A;  4ED1 A;  3WK4 A;  1Q8K A;  2AQ0 A;  4YFK A;  3H8M A;  4MFA A;  3TI0 A;  5AKI A;  2NO5 A;  4Q8F A;  4XUS A;  5IIM A;  3LVW A;  3H8S A;  1KQQ A;  3C23 A;  3L3F X;  5J8Y A;  1ZYQ A;  4PH5 A;  1Z1V A;  3QU4 A;  4RQN A;  3C1Y A;  1TE2 A;  4ZOH C;  5A0L A;  3PW2 A;  2R18 A;  1MSW D;  2RHF A;  1SL0 A;  3AU6 A;  3G6V A;  5DQG A;  1L3U A;  1ZQB A;  4OCZ A;  3ICX A;  2ZG6 A;  5B66 U;  2AHO B;  2XCA A;  2M0N A;  3RFA A;  4YQW A;  4GXI A;  3DEE A;  1IIP A;  2OWO A;  2F8L A;  1ZQD A;  3WK5 A;  2OH2 A;  1L7N A;  1HUO A;  1ZQT A;  9ICS A;  3SV4 A;  3RAQ A;  4CRX A;  3Q8P B;  1BNP A;  2KOB A;  2BPC A;  3IP4 B;  4PL2 A;  4DF4 A;  4NLC A;  1Z3E B;  3TAC B;  1ZQL A;  2FMP A;  4HYK A;  4RNO A;  4IRK A;  4CF4 A;  9ICW A;  3AL0 B;  3SQI A;  3SV3 A;  2WF8 A;  1TV9 A;  4O5C A;  5AM0 A;  2FI1 A;  4ELU A;  2PXI A;  1BPB A;  5KT5 A;  4QNL A;  8ICB A;  3WU2 U;  1Z00 A;  1KKX A;  3C2M A;  3H0R B;  3UXP A;  2IMW P;  1XO0 A;  3KHH A;  1FEZ A;  1S0M A;  4BGD A;  2ASD A;  3KTQ A;  3OGU A;  4M6W A;  4GIB A;  3AEV A;  1FFV A;  4DOC A;  2VA3 A;  1QSL A;  2W9B A;  3D6J A;  2OEH A;  5KT7 A;  3WKC A;  3M8R A;  1B4F A;  3KZX A;  3IV6 A;  4PZN A;  3JPP A;  2Q0Z X;  1L8O A;  4BWJ A;  8ICV A;  4CE6 A;  3H8W A;  4F93 B;  4BXO B;  4OJO A;  4EZ6 A;  4B6J A;  1HUZ A;  5CRX A;  1COO A;  3U26 A;  1ZQM A;  4KLQ A;  3RH6 A;  4TQS A;  4QZB A;  2ZIV A;  3OHB A;  1JUD A;  2ZJ8 A;  4P0Q B;  3J81 j;  2FPK A;  2G5H B;  2AH5 A;  1WCN A;  5J8Y C;  1T3N A;  2GO7 A;  2KZM A;  4X5V A;  3K1R B;  2JXJ A;  1T94 A;  2HHW A;  5K4L A;  4JWN A;  2HVI A;  4DLG A;  2Q4T A;  5ALL A;  1UA1 A;  2AGO A;  5AIC A;  1NI3 A;  2YN4 A;  4KLG A;  2HHX A;  1JRO A;  7ICE A;  1ZQP A;  2HDO A;  4QZC A;  4UQG A;  1D8B A;  4UAY A;  1VLB A;  3FDS A;  3NVY A;  4J9M A;  5D49 A;  9ICG A;  4F91 B;  5DBB A;  5AKG A;  5AKY A;  5J0W A;  4RPY A;  4M0A A;  1RM6 C;  2DL0 A;  2VAN A;  3KBB A;  4F2S A;  2ZTE A;  5AK3 A;  5KAF U;  3MGV A;  2JMG A;  1RQN A;  3ORY A;  1N2X A;  2YMP A;  1ZRN A;  7ICM A;  4KLH A;  5DDM A;  4J9K A;  1S9F A;  4QWE A;  2E1E A;  5F3X B;  2F77 X;  3E58 A;  5EOZ A;  8ICH A;  2K8C B;  2F1H A;  2BKE A;  2BCU A;  3I1Y A;  3T3F A;  2E1F A;  4LZD A;  2F8K A;  1ZD5 A;  2FMS A;  2KN7 A;  1NK7 A;  4P0P A;  5ALX A;  2K8A A;  1KL9 A;  4ECZ A;  2W43 A;  4ED7 A;  1ZQQ A;  2MSN A;  2W8K A;  3KHR A;  2CN1 A;  2ZIX A;  1FO4 A;  4E0D A;  5KG2 A;  1ZRM A;  4DL7 A;  3PSP A;  1Z1B A;  2XGQ A;  1QQ5 A;  2R8J A;  2JH1 A;  1NK9 A;  3BQ1 A;  1PK1 B;  2OXO A;  4DFJ A;  5HHI A;  2RQ5 A;  4YXM A;  3VC8 A;  1J97 A;  3NAS A;  1RPL A;  3Q8S B;  4IR1 A;  5DB9 A;  1NKE A;  4UAW A;  3RJK A;  5HR7 A;  4I2J A;  3T79 A;  8ICQ A;  4R63 A;  7ICG A;  3QYP A;  1U4B A;  5AKL A;  3A0B U;  5HP4 A;  4B9M A;  1U45 A;  1ZQU A;  1NK6 A;  4R8U A;  5J2F A;  2W11 A;  3UMC A;  5AM5 A;  9ICQ A;  2ZUD A;  3PST A;  2FLN A;  4EEK A;  5JU5 A;  2H3V A;  4U7C A;  5KAI U;  2HVH A;  3C2K A;  5J2I A;  5EWE A;  4RT2 A;  4DS4 A;  5KFY A;  3F5E A;  1KFT A;  5KFV A;  3RJE A;  5L1M A;  4OJ5 A;  2DFL A;  5ALH A;  4A8E A;  7ICU A;  5L1J A;  5III A;  3BZK A;  5J2E A;  1RXV A;  3HKZ F;  2WB1 F;  2YB4 A;  2W9A A;  2NYV A;  5T14 A;  1UT5 A;  4QW9 A;  1N56 A;  3GZF A;  3ISC A;  2ZXH A;  4DQP A;  2EQY A;  1NZP A;  4YP3 A;  5ALF A;  5L1I A;  3TQ1 A;  3BS5 A;  5KFP A;  5KNI A;  4DOB A;  4O5E A;  3WK8 A;  2LYA A;  5KFJ A;  1BPX A;  5KT4 A;  8ICW A;  2AU0 A;  5IIN A;  4Y2Q A;  3KHL A;  2RDI A;  1C20 A;  3CNH A;  4J9N A;  2XO7 A;  1F44 A;  2WF7 A;  2FPM A;  3WK7 A;  5EE0 A;  4DL4 A;  2W55 A;  3BQ0 A;  4O5K A;  1Z4O A;  3C1Z A;  3JPS A;  4K4I A;  1T8E A;  1NOM A;  2BCR A;  1TAM A;  1X9X A;  1SWV A;  5ALN A;  3QU9 A;  3E2E A;  4DCC A;  5AKZ A;  5EE3 A;  2WF9 A;  2BR0 A;  1U48 A;  1X9S A;  2FLL A;  4IL6 U;  4ECT A;  1ZD4 A;  2W04 A;  2HOF A;  3RTV A;  4G3I A;  4IC9 A;  3JPO A;  1X9W A;  4RUA A;  3ONN A;  3H7I A;  2KVS A;  4DLE A;  4EX7 A;  4M9G A;  1ZD3 A;  4QWD A;  3EPI A;  3PZP A;  2KP7 A;  2JZB B;  1TK5 A;  4Q8E A;  3O0F A;  5AKJ A;  4DFM A;  2VA2 A;  3T5J A;  1D9F A;  3NGD A;  3UXN A;  2R8K A;  4KLS A;  5F9L A;  3AN1 A;  5KFE A;  1SXE A;  5ALS A;  4RPX A;  5TIS U;  4DSE A;  1N62 A;  5ALY A;  2KG5 A;  1SWW A;  3MGI A;  1ZQI A;  2HOI A;  4NL9 A;  3NUQ A;  1XS9 D;  5AM4 A;  2VKQ A;  4KX5 A;  2KZZ A;  3HX0 A;  3ETR A;  2KFZ A;  2BHN A;  2ES6 A;  4DQQ A;  2DUY A;  1K1S A;  5GTH U;  4KMO B;  4B9N A;  3MFI A;  4F5R A;  8ICO A;  1UHU A;  4EEN A;  3MDC A;  1SZP A;  1ED1 A;  3UQ0 A;  2XY7 A;  5B5E U;  3EUB 2;  1DGS A;  5CJ7 A;  1ZQE A;  4GLX A;  1ZQK A;  3SI8 A;  4O3O A;  4FS2 A;  4PL1 A;  2KKP A;  2UVW A;  2NRW A;  2D6F C;  2XVT A;  3Q8R B;  1KW4 A;  2H3Z A;  2ZIU B;  3ZDB A;  1HIW A;  4JWM A;  4M9H A;  4UB3 A;  5F9N A;  8ICP A;  3HKZ C;  3PW5 A;  1RG6 A;  3GFK B;  2WB1 C;  2G08 A;  2YMM A;  5DDY A;  3M9O B;  3ZI4 A;  1L7M A;  4CF5 A;  1EXN A;  3GQC A;  2JH7 A;  4M47 A;  3T5L A;  2E5S A;  2J6S A;  3F2B A;  3SR6 A;  2YQE A;  3QXG A;  1K5O A;  1QQ6 A;  3K75 D;  5KG3 A;  4GXK A;  2BCQ A;  1L7O A;  4FFD A;  1JRP A;  2WAQ F;  2DF4 B;  4I2D A;  5IIO A;  4RPZ A;  2ZIW B;  1WG8 A;  4YMM A;  4US8 A;  5AI4 A;  2ZIV B;  3PMN A;  2ESE A;  2KSO B;  4UAR A;  3RAX A;  5DB7 A;  5EWG A;  1ZQJ A;  2JRZ A;  5JUM A;  3HPO A;  2HHV A;  2NRX A;  3H4B A;  4ACO A;  5KFR A;  3V7L A;  4I2G A;  4ECU A;  2KHV A;  1RZT A;  9ICA A;  3ISB A;  2WF6 A;  5EE9 A;  4Z6C A;  4DQR A;  2FJ6 A;  4Z6F A;  5AI9 A;  3RBD A;  1ZQF A;  1L7P A;  4C0Z A;  3M6Z A;  5ALM A;  3IG8 A;  1N5W A;  2G09 A;  4NL9 C;  4UB8 U;  2LI6 A;  4I2H A;  2KEY A;  4PZO A;  4Y2V A;  4M9N A;  2YB1 A;  3TAP A;  2VIX A;  9ICN A;  1RDF A;  5DLG A;  2DGZ A;  3GIM A;  4M9L A;  2EZY A;  2W9M A;  4NLK A;  4QZ8 A;  3V7K A;  2MAX A;  9ICE A;  5ALJ A;  3M8S A;  1T4G A;  1ARO P;  2GLE A;  5DB8 A;  4M9J A;  1TAU A;  1CUK A;  2H5X A;  3UMG A;  4C4S A;  2QB0 B;  4EBC A;  4DOA A;  5KFI A;  1HJP A;  1MN8 A;  2F1I A;  3PW0 A;  1KEJ A;  4AYB F;  3QEA Z;  2QAR A;  4LJX A;  5HHH A;  1U49 A;  5EE1 A;  3IRU A;  3IN5 A;  2LM4 A;  2EZX A;  4I2B A;  2H3I A;  5BOL A;  4LZG A;  3MAB A;  5JTI A;  5ALK A;  2I9G A;  2WTF A;  7ICN A;  1TVA A;  1X6I A;  3Q8Q B;  4QZA A;  1SZH A;  2UVU A;  1WWU A;  1ZQC A;  2KNJ A;  2BDU A;  3QNM A;  4BWM A;  4UB5 A;  1DK2 A;  4P0P B;  4Q45 A;  2Y9U A;  2KVC A;  4F4Z A;  1NKC A;  3ZD8 A;  3PV8 A;  1X66 A;  2Z7J A;  2ZIX B;  4JK1 A;  1KDH A;  2W9C B;  3AU2 A;  2PFN A;  5KFL A;  3T5H A;  4IRC A;  5AI8 A;  3D2S A;  3V6H A;  3CYM A;  3QE9 Y;  1AQ6 A;  1C7Y A;  2PFO A;  8ICT A;  4XA5 A;  3HIL A;  5CHG A;  5KG5 A;  2VJ5 A;  3NRW A;  3A0H U;  4YD1 A;  1Y88 A;  1SKS A;  2P6U A;  5AIA A;  2F76 X;  5ALE A;  5KL8 B;  3UMB A;  2WAQ C;  2J6U A;  2IBK A;  5KFA A;  4Z6D A;  1SV4 A;  2EAO A;  5KFH A;  4EZ9 A;  4IR9 A;  3AM9 A;  5J0S A;  4YR2 A;  3THV A;  2AGQ A;  5AM3 A;  2MUT A;  2K4H A;  3ALR A;  3C28 A;  4DFK A;  1JX4 A;  8ICG A;  1ZJM A;  4FE3 A;  3UXO A;  4ED0 A;  3OSN A;  1Z19 A;  2H3Q A;  5CWR A;  1LKY A;  2VA8 A;  2OM6 A;  3ZDD A;  2LM1 A;  2KV2 A;  3BS5 B;  3GV7 B;  1TKD A;  7ICJ A;  1BPD A;  2XY5 A;  3Q8K A;  4CNQ A;  4CGZ A;  3HT3 A;  1WWV A;  2RP5 A;  3EYZ A;  3SEN A;  2G5I B;  9ICO A;  1PUZ A;  9ICC A;  4KN7 A;  1L3V A;  2Y1J A;  4UW9 A;  2E8M A;  3RF9 A;  2AQ4 A;  2JEG A;  1ZQG A;  5DGB A;  3OPX A;  3PNC A;  4PHD A;  2MA1 A;  2NRZ A;  4AYB C;  4TQR A;  3UM9 A;  2BQR A;  4F3O A;  2RDJ A;  3SYZ A;  2K8B B;  3RJI A;  1ZQX A;  5DG9 A;  3PX4 A;  2BPG A;  4Y2T A;  1L3T A;  3MDA A;  4JMU A;  1WCL A;  3HW8 A;  1D9D A;  2F2A B;  4KLU A;  4F5P A;  5DQH A;  2A1J B;  2IOF A;  3CP8 A;  4F5Q A;  1NJY A;  5J0Y A;  4B9T A;  3OSP A;  5CR0 A;  4QJF B;  2HHU A;  1KFD A;  2L5Y A;  5J0Q A;  2IOH A;  5KFN A;  1JAL A;  3BJY A;  4XRH A;  7ICI A;  1KLN A;  5BOM A;  1X42 A;  4NY8 A;  4NXZ A;  4R65 A;  4ECW A;  3LWL A;  4Y2X A;  5ALP A;  8ICR A;  4J9L A;  2WF5 A;  1L8L A;  4JV2 A;  1N61 A;  3K1Z A;  3C29 A;  1Q3V A;  4C8O A;  4ELT A;  2NRT A;  3RB4 A;  2W54 A;  4YN4 A;  4KTQ A;  2LKY A;  3WKA A;  1SV0 A;  1XO1 A;  2RLT A;  9ICT A;  9ICL A;  3RR8 A;  5J2D A;  2EAP A;  5ALU A;  7ICQ A;  2YY6 A;  3QUQ A;  4F72 A;  3I28 A;  4I2A A;  5KFT A;  1ZOL A;  3BS7 A;  4OD0 A;  4ECV A;  4KLD A;  3RB3 A;  1XWL A;  1NK8 A;  2UVV A;  2W7O A;  3MR3 A;  1SGG A;  4UB2 A;  4QWB A;  3CRX A;  3T5K A;  4O3R A;  2GWS A;  4PJ0 U;  1XSL A;  1VDV A;  3FYH A;  3GII A;  1RYR A;  3ZDA A;  4ECS A;  7ICP A;  4MF8 A;  3TAQ A;  1DK3 A;  5DGA A;  4MEX A;  2KJ5 A;  8ICC A;  1V9P A;  1XNS A;  4DF8 A;  1QSS A;  1QLN A;  1CEZ A;  4YR0 A;  3ZDC A;  2Y0S F;  3WK9 A;  7ICO A;  3MC1 A;  5KFQ A;  2K4E A;  3C5G A;  2P6R A;  1XC9 A;  1UPH A;  2HHT A;  2HOQ A;  3KD3 A;  3WKE A;  3RR7 A;  3SAG A;  4RQ3 A;  4DSI A;  3KZI U;  5GTI U;  3D2N A;  4DSJ A;  2XID A;  5ALR A;  2P35 A;  4UBB A;  3N28 A;  3F2C A;  1ZQ1 C;  3QZ7 A;  5CP2 A;  3OHA A;  4UBC A;  2XC9 A;  1LB2 B;  1SKW A;  4C8M A;  4P4P A;  5AM1 A;  4KLM A;  5KTQ A;  2B6G A;  4PGY A;  2B21 A;  2W03 A;  1DOQ A;  3PO4 A;  4OJP A;  3I76 A;  3ISD A;  3SEI A;  3RJF A;  2DKZ A;  5CB1 A;  2YML A;  1NJX A;  1LV5 A;  4DO9 A;  4UAV A;  1KN5 A;  5HR6 A;  4C4T A;  7ICL A;  5KFG A;  4HAI A;  4BJQ A;  3GIK A;  1QSY A;  5KG7 A;  3JPR A;  3RH4 A;  4O3P A;  1SV0 C;  2GOL A;  1PVP A;  5DG7 A;  1S0N A;  4F71 A;  3NVV A;  1OUQ A;  1BVS A;  4KLE A;  3JPQ A;  4YR3 A;  2HBK A;  3TAR A;  2BQ3 A;  3GV5 B;  2QAR B;  3L5K A;  1IV8 A;  4TUQ A;  8ICK A;  4XQ8 A;  4FO6 A;  5ALO A;  1KFS A;  4ZH4 A;  4I27 A;  1K1Q A;  4USA A;  8ICS A;  4NLZ A;  2KMD A;  3PX0 A;  5E79 U;  3TFS A;  7ICR A;  4DWI A;  2BQU A;  4DEZ A;  5KG6 A;  1MQ3 A;  2BZF A;  4UAU A;  4R66 A;  4DQS A;  2AJQ A;  2NV3 A;  3F2D A;  3NS1 A;  4I29 A;  4I2I A;  2K4P A;  4Z6E A;  4QZF A;  4ECQ A;  1QTM A;  1V38 A;  3KHG A;  3EZ5 A;  4LVS A;  8ICL A;  1JXE A;  1BPZ A;  5ALW A;  3ZD9 A;  4JB3 A;  2UVR A;  4QIW F;  2E3T A;  3V6K A;  5IIK A;  1OXJ A;  9ICI A;  2R8I A;  4F5O A;  2BCS A;  2EDU A;  4B9L A;  2I1Q A;  1UQV A;  4RQ2 A;  2LYB A;  4EBE A;  5KFF A;  4IQV A;  4ED3 A;  4RNM A;  4EEL A;  2Y0S C;  4BUG A;  3MBY A;  2W8L A;  3AQE A;  5FP0 A;  1RXW A;  1NZB A;  1ZQZ A;  3KFU F;  5KFS A;  1Z00 B;  2ATL A;  4UB4 A;  4F4W A;  2HI0 A;  4RT3 A;  5J2A A;  3F53 A;  3BQ7 A;  4I2C A;  4M04 A;  3B9J A;  4M6W B;  2DKX A;  1YZ7 A;  2G06 A;  2W9B B;  1D8L A;  2ZJA A;  4ICA A;  4Y2Y A;  3AQF A;  4O3S A;  3BQ2 A;  2CXY A;  1YZ6 A;  4PGQ A;  1VJ5 A;  4MF2 A;  1LKY B;  2ISP A;  1L6N A;  2DWQ A;  4GFJ A;  2KKV A;  1QCK A;  3RJJ A;  1ZQS A;  5HML A;  2KJ9 A;  5J0U A;  4F50 A;  4B9U A;  1QH9 A;  7ICF A;  4U6P A;  3PX6 A;  5KFW A;  1SL2 A;  4JV1 A;  2KIW A;  2KIV A;  1UT8 A;  3H8J A;  3WKB A;  3M1Y A;  3N97 B;  2YTU A;  2QKQ A;  3IHQ B;  3IG5 A;  2G07 A;  4RQ1 A;  4YXJ A;  5J2H A;  8ICA A;  2CRX A;  3LWM A;  3GDX A;  4GC7 A;  2W3R A;  5KFX A;  1P7D A;  1A77 A;  3B0Y A;  5KFZ A;  5DBA A;  4RQ7 A;  3VCB A;  2A1A A;  2IHN A;  1JXL A;  4KLT A;  1DRG A;  3EPG A;  1F5S A;  4F4Y A;  8ICE A;  4EBD A;  1N48 A;  5IIJ A;  5KFD A;  5J2K A;  1S5L U;  4O3Q A;  5J2B A;  3BDP A;  1ZQW A;  5IIL A;  3NRZ A;  3JPT A;  4FBU A;  4R64 A;  4O0I A;  2XCP A;  4DQI A;  1HEK A;  1Q3U A;  1DGJ A;  5L1K A;  2W7P A;  2JEI A;  2OHF A;  2FDR A;  3GIJ A;  2BDP A;  2G0A A;  1S0O A;  1MQ2 A;  3EWA A;  3C5F A;  2HMX A;  2NRV A;  2Y9T A;  4QZD A;  1MC8 A;  4IS7 A;  4BX9 C;  1ZQV A;  5KFM A;  1RYS A;  3RBE A;  4QZI A;  1T7P A;  2HSZ A;  4QW8 A;  4PHE A;  4MHV A;  4RQM A;  3PO5 A;  3H0M B;  3PY8 A;  3LYS A;  5AKK A;  3GU3 A;  2LYH A;  2PI5 A;  4FZN A;  4YVZ A;  2WHE A;  4DL6 A;  2IHM A;  4P2H A;  3OJU A;  2E8O A;  2J6T A;  8ICY A;  2K89 A;  2JGA A;  2ZJ5 A;  3NVW A;  4C4R A;  2FPL A;  4K4G A;  8ICN A;  2JZB A;  4QZE A;  4Y2U A;  7ICS A;  2HBL A;  3KKA A;  1XSP A;  2FLP A;  1X6J A;  4NLG A;  1BPE A;  4Y2R A;  2C2E A;  1NKB A;  2JEF A;  4M2Y A;  7ICV A;  4MFC A;  1GO3 F;  3MGH A;  4FZL A;  1IM4 A;  4NWI A;  4C7Y A;  3ED5 A;  9ICP A;  3G6Y A;  5KG4 A;  3UPQ A;  4J9O A;  1M6Y A;  2LPE A;  4UAT A;  2MU2 A;  1D8Y A;  4I2E A;  2HHS A;  4RQ6 A;  4WJ3 B;  5J29 A;  4R8U B;  4RUC A;  9ICV A;  4OJ6 A;  1KBU A;  4J03 A;  3PVX A;  4QWC A; 
#chains in the Genus database with same CATH homology
 2O6K A;  2KVS A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...