2FJ6A

Solution nmr structure of the upf0346 protein yoze from bacillus subtilis. northeast structural genomics target sr391.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0346 protein yozE
publication title Solution NMR structure of the UPF0346 protein yozE from Bacillus subtilis. Northeast Structural Genomics target SR391.
rcsb
source organism Bacillus subtilis
total genus 23
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2fj6A01
2KVSA 2O6KA 2FJ6A
chains in the Genus database with same CATH superfamily
2W9MA 3PMNA 5KFAA 2NV3A 3KHLA 4EELA 2KIWA 2YX8A 4DSIA 5J2KA 3AN1A 2KV2A 3GV8B 3PW0A 4RQ8A 2W04A 1JI7A 4B9SA 1QLNA 2KD1A 5HNKA 5DG8A 4ICAA 4QZAA 2DGZA 3KHGA 1NZPA 1CI4A 5CP2A 2OM6A 4RQ2A 4F2RA 3F2CA 2EQYA 1XC9A 3MR5A 3T5LA 3UQ2A 2H3FA 3QXGA 4C7YA 2H5XA 3GIKA 1T3NA 3WK4A 3JPPA 4KMOB 4RZRA 2XVTA 1WWVA 9ICEA 2F1JA 2WF7A 3TADC 1ZQHA 2HMXA 2G09A 1DXSA 1ZQ1C 3OGUA 3MBYA 4NLBA 2MAXA 3NRZA 1VLBA 1OXJA 5D46A 1U49A 4I2CA 3N7RC 4YR3A 4RUAA 4U7CA 4XRHA 4GXIA 3TAPA 4IRKA 1JRPA 2G0AA 3NTUA 5ALPA 3EPIA 5HHHA 5DB8A 1A0PA 1FEZA 3PSPA 5GTHU 1N5WA 3QE9Y 2HHUA 1JXLA 2QB0A 2E3TA 2WTFA 5ALQA 5J0YA 2F76X 2WF8A 4F4YA 2I1QA 3Q8PB 2MU2A 1A77A 2NRTA 1SL0A 1IG6A 4QZBA 2Y9TA 1U9LA 4R64A 2KFZA 3PY8A 3Q8LA 1UA1A 2EDUA 2F3NA 3RTVA 1JMSA 4QWAA 4ECYA 4GLXA 4YMMA 2W43A 3IDWA 5C5JA 4Y2RA 5KTQA 2D3DA 1ZQVA 3WK8A 2EZYA 3UQ0A 3OSNA 2H3ZA 3I28A 4C8OA 4DQSA 2AQ4A 5B5EU 2E1FA 5ALDA 3QEBZ 3SMVA 3K75D 3BS7A 4ED3A 4Z6DA 5TZVA 4P2HA 2XGQA 4KLTA 7ICFA 1RYSA 1B0XA 2NO4A 4J9SA 2K8BB 4QWEA 3QYPA 3M1YA 2KZZA 4F5OA 1KSPA 3ZDCA 2KSOA 1PVQA 5KFPA 1NI3A 3C2LA 2Q4TA 3CW2C 4PHPA 5AK5A 1NK6A 4HYKA 2Y0SF 9ICLA 5L1MA 3RAQA 2XY7A 4UB6U 2IOFK 1DK2A 1AQ6A 1PK3A 2AQ0A 5J29A 1YZ7A 1CRXA 2F77X 2CXYA 4IS7A 2IA6A 3SAHA 1KFDA 4YD1A 3UPQA 2MRLA 2FLLA 1KDHA 4YXMA 2QB0B 4QZEA 1BNPA 1ZQPA 2BPFA 1JROA 5AM5A 2ALZA 5ALVA 1Q46A 3I1YA 3H7IA 4O3OA 1UHUA 2DBYA 4DFDA 3I76A 1S77D 5CWRA 8ICNA 3BQ2A 1ZD4A 4YFKA 4QWDA 3EUB2 2XO7A 4Z6FA 1M6YA 2G07A 2IHNA 3ZDBA 2W7PA 2W8KA 4Y2UA 1UPHA 2FMSA 2HHSA 5KFNA 1ZETA 3H0RB 2BHNA 5ALYA 4KLFA 4EZ9A 2FLPA 3HW8A 3IHQB 1C7YA 2MUTB 2VKQA 3UMBA 1NJZA 1HUOA 2JH1A 4NLKA 4O3QA 4BUGA 5CEHA 1PUZA 1COOA 2K8CB 2N1RA 4FS2A 2KVCA 3H8WA 2R18A 4OJLA 4IQTA 2EANA 5KT7A 3R9KA 4LZDA 5KT2A 7ICEA 2ZUCA 1NOMA 1ZD3A 1RYUA 3NUQA 3N7PD 4R63A 3QUQA 4DLEA 2BKEA 4YN4A 3BQ1A 2Q0ZX 1ZQEA 1EXNA 1QCKA 5J8YA 2HSZA 3EZ5A 1TVAA 5DQGA 7ICKA 3RBEA 2ZJAA 2HOIA 1XWLA 2YTUA 3RB4A 1X9WA 4KLJA 2F1HA 3E58A 5KFVA 2E8NA 4BJQA 9ICXA 5J2CA 2Y1JA 1KKXA 4TUQA 5IIKA 2QLTA 4ZH4A 3WKCA 1L6NA 3SQIA 2LM4A 2PKEA 4J9QA 1ZJMA 1NK0A 2HVIA 4I2DA 5AKXA 4NLZA 1XS9D 2H3QA 2JH7A 1PVPA 4I28A 2J6SA 3MFIA 1ZJNA 4UB3A 4KTQA 8ICZA 5ALGA 7ICPA 2UVVA 2AHOB 5KFKA 3H4BA 3DV9A 4LZGA 3PV8A 3GFKB 1T8EA 2MA1A 3MC1A 1NK5A 3HWTA 2ATLA 4MF2A 3KOOA 1SWWA 3WK9A 3RFAA 3N4MB 3C1ZA 4UB2A 2IOHA 4I2FA 5AK6A 1Y88A 4QJFB 2JZBA 9ICMA 3WK6A 3BS5B 5ALRA 3WKDA 1N48A 4M2YA 2DFLA 2I5HA 4TQRA 4DL3A 3EW9A 4RQNA 3NRWA 2F44A 1FFVA 4ZOHC 4KLSA 1T7PA 1ZQFA 3QU2A 1LVHA 4PGXA 3AU6A 4AYBF 3LWLA 2KHQA 1ZQIA 1S10A 3T5HA 4YVZA 4KLDA 9ICOA 1T94A 2XY6A 2CRXA 1ZYQA 1ZQDA 2ODGA 5DKWA 1NK9A 3C5GA 2JXJA 3Q8SB 3M9NB 3F5AA 5KG0A 4O9MA 3TANA 2RRDA 4BWJA 3UXOA 1Z1VA 8ICCA 2PFNA 4QWBA 1QSSA 5KG1A 4YR2A 3TARA 5A0LA 4Y2SA 4ED2A 2E1EA 4RPXA 3S6JA 4J9NA 4CDGA 2W11A 4Q8EA 1U48A 4NLGA 1B43A 1SKRA 1TK5A 1UA0A 4JB3A 1SZHA 2BZFA 4Q8FA 3OTQA 1XU4A 2JEIA 5AI8A 3D2SA 3JPNA 2NRZA 5IILA 2RQ5A 2KJ9A 4OD0A 4EYHB 2AJQA 1D8BA 2BPCA 2FE9A 4UAWA 4JWMA 3EWAA 1S0MA 1QSLA 4CE6A 3RJKA 2P35A 4NM1A 4GFJA 2OH2A 1X42A 3MR6A 2KE7A 4UB5A 4I2BA 3LDAA 4XQ8A 1DGJA 4RQ7A 3LYSA 2B0CA 2HHWA 5DGBA 7ICNA 3F2DA 2KMDA 1XNSA 3FYHA 3RJJA 2GOLA 2Y0SC 4Q45A 5L1LA 2LMRA 3GV5B 5EWGA 1HIWA 5AIBA 4PHAA 3PR5B 1N5XA 5F9LA 3NASA 1NJWA 1ECWA 4B9LA 5KFXA 3V72A 5J0TA 1L7OA 4RNOA 2JEFA 2ASJA 2OWOA 4NL9A 8ICJA 1H38A 3KBBA 3THVA 1BGXT 2RDIA 3RJEA 1ZQGA 4DL6A 2YY6A 5J2EA 3D2QA 2NRXA 5AK4A 7ICHA 2PI4A 4DSLA 4DFPA 1JUDA 5AM4A 1S0OA 2P6UA 1ZQTA 2FLNA 2VA3A 1ZQAA 4RQ0A 2DL0A 2W7OA 1LV5A 9ICKA 4DL5A 2KICA 4Y2JA 4F8RA 5AKIA 5J0QA 2WFAA 4RT2A 2D6FC 4QZ9A 4I2EA 3HKZC 8ICBA 8ICOA 5G5GA 3U26A 1XSNA 4QWCA 2HDOA 2C2RA 4R66A 4KLHA 2IBKA 1RQNA 3OPXA 2KK0A 4MEXA 1V97A 2FDRA 4DSJA 1ZQCA 2DKXA 2ZXHA 3ED5A 1HUZA 1RDFA 2BCQA 4UAZA 2K4EA 5J0PA 5KFCA 3LVVA 4ECXA 3M9MB 1MSWD 1TAQA 7ICLA 5KFBA 1RYRA 2G08A 2VJ5A 4FBTA 1SV0C 3MR3A 9ICFA 5KFLA 1OW5A 2LI6A 1PVRA 4TURA 1KFSA 2ESEA 2ASDA 3DEEA 4C80A 5H2FU 5L9XA 4M9GA 5CA7A 2JMGA 5KL8B 4M47A 5L1KA 1QQ6A 3EYZA 4P4OA 2EH9A 5ALSA 4C7ZA 3KTQA 3QZ8A 2YB4A 5KFTA 4KLMA 3HPOA 4NY8A 1K5OA 4M9NA 4YMNA 3TKAA 3ZDAA 5EOZA 4DL4A 3QU9A 3BQ7A 3MABA 4X5VA 3QZ7A 2ZUBA 4UB1A 1MA7A 4WJ3B 1WWUA 1NKCA 3H8SA 4J9LA 2Z7JA 4DWIA 4P0PB 2C22A 3MFHA 4YG2A 1TFRA 5ALKA 3V7LA 2NO5A 5E79U 9ICGA 4YQWA 2V4QA 2E8PA 3NVVA 1TK8A 1KRPA 5KFHA 4BGDA 3L5KA 1BPZA 4OJ5A 1TE2A 5KFUA 2KTQA 5CR0A 3RJIA 2BGWA 8ICWA 4DEZA 4Y2QA 5J2FA 3HT3A 5KT6A 3WK5A 2AXTU 5G5HA 3RR7A 5J8YC 3OHAA 2R8HA 5B66U 1RM6C 2ZIXB 1RXVA 2DPJA 4AYBC 3IG8A 3ALRA 2HHQA 3H4DA 4J9MA 3BQTA 1ZQUA 2FPLA 2JEJA 2YQEA 2KJ5A 4I29A 3KZIU 3WKBA 1Q8KA 4FO6A 1VDVA 5ALJA 4YP3A 2WAQC 2MUTA 3SI8A 4KX3A 4JWNA 2BPGA 2KG5A 3ONNA 5AIAA 2ES6A 3LWMA 1TAUA 5J2DA 1NK7A 3SZ2A 2BCSA 3JPQA 5IIJA 1N2XA 2W9BB 4DQQA 3ZD8A 5J0RA 3VC8A 1Z4OA 1Z3EB 1ZQOA 4QIWC 4Y2PA 5K4LA 5JTIA 5DQIA 1MN8A 7ICQA 5DBCA 4U6PA 2BCUA 5AK3A 2E8OA 1V85A 2ZTCA 1Z4NA 1ZQQA 1FIQA 1JN3A 5HHIA 1SV0A 4DQPA 4JMUA 9ICCA 4NV0A 1S8OA 4PGYA 4I2AA 2KEYA 5KG7A 4IC9A 1T4GA 4M04A 2DPIA 4ED0A 3B9JA 4O3PA 1S0NA 4XA5A 5J0XA 2V9WA 5AKHA 4AP9A 3V6HA 3OJUA 1KEJA 5AKJA 2MSNA 3TQ1A 4CRXA 1D9DA 3AMZA 3MGVA 4FBUA 4UBCA 4QNLA 1L5UA 3RR8A 3NS1A 3V6KA 4I2GA 3KHRA 3FAHA 2W8LA 5KFMA 1SIJA 8ICQA 3RJGA 4I2IA 3BQ0A 2HBKA 3E0FA 3V7KA 2XCPA 5IIIA 4QZFA 2M9NA 4KLEA 3FC4A 5EE0A 5KFYA 3BJYA 2HHTA 3HKZF 3BS5A 3D2NA 1X66A 4Q43A 3ISBA 1OUQA 3E2EA 4QZ8A 3A0BU 2HOQA 3TFSA 3UMCA 2IMWP 2EAOA 5KAFU 2XC9A 4KLIA 1JIHA 1FFUA 3KZXA 2RDJA 2EAMA 3PW2A 1BVSA 4UQGA 1TV9A 2BCRA 2CN1A 2J6UA 3ORYA 4NLCA 3VCBA 2KJ8A 3PW7A 1JX4A 3HILA 4MF8A 2OYYA 5ALOA 5IINA 3T5KA 4MFCA 3JPRA 1YT3A 4G9BA 5KFJA 2XCAA 4C4TA 3QEAZ 4KLOA 8ICFA 3GQCA 2G5IB 5AKYA 1NKEA 2BQUA 4K4HA 1L3TA 4Z6CA 3ISCA 2JV3A 4NWIA 2JGAA 3H0MB 1K1QA 2BQ3A 3K1ZA 2FMPA 3V7JA 4PL2A 1ZD2P 2W54A 2AU0A 3OHBA 4JK1A 4O3MA 4E0DA 4C8KA 4NL9C 1IV8A 2KKVA 5HMMA 4DS4A 3PZPA 5KFOA 9ICRA 5TISU 1DOQA 2UVRA 2V4RA 1LKYB 2C2EA 3G6YA 1PK1B 9ICQA 5KG2A 1FO4A 1KLNA 3ZDEA 2DF4B 2ZIWB 4UW9A 5ALFA 5BOLA 2ZIVB 4DSKA 4P4PA 4EX7A 3UXPA 5KAIU 4PH5A 2OHFA 3UM9A 5IIOA 1SV4A 4ECSA 3SR6A 4PGQA 3QX7A 4Z6EA 4O3RA 4RNMA 8ICLA 4B9TA 1SXDA 2KNJA 7ICJA 2AGPA 5JRTA 4O3NA 4XUSA 3G6XA 4F71A 3TACB 3PR4A 5J2IA 3RJFA 9ICTA 3ICXA 4CNQA 3WK7A 8ICSA 2WF6A 4MHVA 5KFQA 4IL6U 2YMLA 4F4WA 8ICHA 4F2SA 4MFAA 5J2BA 4IR9A 4PPXA 2FPMA 4F4ZA 5T14A 2WAQF 3PX6A 3HJEA 1X2IA 2A1JA 1ZQBA 3B0YA 4PZOA 4DSEA 1S5LU 4P0QB 5J0UA 2K60A 3BZKA 2GWSA 7ICVA 5AI6A 4I2HA 5BPCA 2ZJ5A 3PX4A 3N7SC 4PZNA 1SWVA 3ZI4A 4J9PA 1ZRNA 4YR0A 4I2JA 5DBAA 4RPYA 1CEZA 5AKGA 1CUKA 3TFRA 2KVSA 2ZXIA 4Y2XA 2F8LA 2R8IA 2I6XA 4RQMA 4QW9A 4F4KA 4QIWF 4GXKA 2B6GA 9ICVA 9ICWA 3F5EA 3CNHA 3ISDA 1F5SA 5EE9A 2KZ3A 1N56A 4GXJA 1Q3VA 9ICIA 4C8NA 1DGSA 3QUBA 1ZQYA 1WG8A 5ALEA 5J0OA 3MGHA 2W9AA 8ICKA 8ICAA 3M8RA 8ICEA 2ZTDA 4Q44A 4Y2VA 1A6SA 5AM2A 2R8JA 5DG7A 2VA2A 1J97A 1SB3C 1L7MA 1URJA 2HCFA 8ICMA 3CYMA 4DS5A 1VJ5A 7ICOA 2QARA 3LVWA 4J03A 3GILA 4ED6A 2UVWA 2AGQA 4HAIA 4UB8U 4GC7A 1TK0A 4G3IA 5HMLA 5KG4A 4DCCA 2J6TA 2YMMA 2HVHA 4C4SA 1ZOLA 1ZQXA 8ICVA 2BQRA 1BNOA 4A8EA 1Z00B 3UMGA 4P0PA 4RQ3A 4CF4A 3QU4A 4UBBA 3BDPA 5DLFA 1NK4A 4IR1A 2A1JB 2F1IA 3NGDA 2HBLA 5FP0A 2JHDA 1WYGA 2VJ4A 4BWMA 4RQ5A 1SL1A 1DK3A 4J9OA 4TUPA 3F2BA 1J2MA 8ICRA 2GH1A 4KX5A 4M6WA 5DGAA 3B0XA 1A76A 3V6JA 4QW8A 3SV4A 4KLLA 1ZD5A 2C28A 2KP7A 4JV0A 4DFKA 5AKZA 4M9LA 3IV6A 3KD3A 2D8CA 4JUZA 4F93B 1S9FA 3ZD9A 3C28A 2ZIXA 3PVXA 3RRGA 3QUCA 3AQEA 1LB2B 5EE3A 1X6JA 3UXNA 5KFEA 3GIIA 3IP4B 5CHGA 1IXRA 2IOFA 1BPXA 5KFGA 4DO9A 5HR6A 4OJOA 2H3IA 4UAYA 3C5FA 1ED1A 1HEKA 4YXJA 2KHVA 2ISOA 1SXEA 2ZJ8A 3KHHA 2A1AA 1HJPA 1WCLA 1SGGA 1PZNA 4TUSA 2JR5A 5KFDA 4ECZA 4C8LA 8ICYA 5AICA 1KL9A 4C0ZA 4PHDA 2HBJA 4B9UA 5DB7A 3WKAA 2ASLA 1D9FA 1BPYA 2DQNB 5IIMA 5CJ7A 1Z19A 4RQ4A 4F5PA 4F50A 4KLGA 4BX9C 9ICJA 2QARB 4RPZA 3QNMA 2W9BA 4IQUA 8ICXA 5KT4A 3M6KA 3AM9A 5KFRA 2AH5A 2PFOA 3CP8A 3SYZA 9ICAA 9ICBA 1NK8A 1F0MA 3RH4A 4R8UA 3ETRA 2NRWA 5KL1B 5KFFA 1KBUA 2F8KA 5ALNA 5DLGA 5F3XB 2A3VA 4RQ1A 4F4XA 4M9JA 4YMOA 2VIXA 4GC6A 3T79A 4PJ0U 5AHXA 1WCNA 3GDXA 1JXEA 3RF9A 1L8LA 2G06A 4F5NA 1U45A 5KNIA 4DLGA 2OXOA 1XSPA 5DDMA 2WB1C 1QH9A 4RT3A 4B9MA 2HOFA 4EEKA 1ZQSA 1J2NA 2F2AB 2ZIUB 4KMUA 4ECVA 8ICIA 4BXOB 2BDUA 3HRDD 1F44A 5ALMA 2PFPA 2LKYA 3H8JA 4M6WB 4P4MA 1XO1A 5AKKA 1O03A 4FZMA 4K4GA 1S76D 9ICSA 8ICGA 2YN4A 4QZGA 1ZQMA 2LYAA 2KZMA 4FFDA 2W9CB 2RLTA 1X9MA 4ED7A 1KTQA 1JALA 3QU7A 1X6IA 2W3RA 4OJ6A 4DL2A 2YMQA 4ACOA 4UAVA 3MDCA 1D8YA 5ALLA 3RRHA 1MQ2A 9ICNA 4QZHA 2CPRA 2QKQA 3QUTA 3Q8MA 3M8SA 7ICGA 2ZG6A 3K1RB 3H40A 3Q8KA 2HHVA 2EZZA 2WF9A 1ZQKA 2W03A 2VA8A 4MFFA 4M0AA 4RQ6A 7ICUA 5L1IA 5D4BA 3BZCA 3O0FA 1QSYA 2PMZC 3PO4A 3H8MA 4RU9A 2B21A 2P66A 2BR0A 1RXWA 2P6RA 2XICA 4KN7A 5ALIA 3WKEA 1NJYA 1L7NA 1ZQJA 5KT5A 3MGIA 4R8UB 1MC8A 2I9GA 3KKAA 1SZPA 3WU2U 3SD7A 3NVWA 2JEGA 2W3SA 1KN5A 5CRXA 4Y2YA 2XI9A 5L1JA 3RJHA 1ZQWA 3GV7B 4R65A 2R8GA 3PW5A 1AROP 4GIBA 5J0WA 3RAXA 1ZRMA 2G5HB 2DKZA 4EEYA 3ZDDA 3D6JA 4USAA 2PXIA 5AKEA 4UB4A 3JPTA 1LKYA 1QTMA 1PK1A 5ALTA 2K4HA 1L3UA 2ZUDA 2ZIWA 3GIJA 3IG5A 5EE1A 3LK9A 2ZIVA 2WHEA 5AM3A 5AI5A 8ICTA 4F91B 4ED8A 1WUDA 3ETLA 2UVUA 1B4FA 9ICUA 3FDSA 3AEVA 2VANA 1IIPA 3AUOA 1V9PA 5KG5A 4MEYA 4TQSA 2XY5A 4ELVA 3RB3A 4DSFA 1V38A 4KLQA 2HBMA 4C8MA 2LYHA 5DDYA 2H3VA 1SKSA 4CF5A 2W55A 3TADA 4UATA 4OJPA 3JPOA 4NLNA 3RH6A 2O6KA 3EPGA 5C0YA 4QZDA 1SKWA 4DF4A 3JPSA 2Y9UA 1X9XA 4DF8A 4F3OA 1IM4A 5J2GA 2EZXA 3PW4A 3SAFA 3AL0B 3PNCA 3G6VA 3L4PA 5AM1A 2XIDA 1ZQZA 2L5YA 3SV3A 1RZTA 3Q8QB 7ICSA 4O0IA 2R8KA 3MDAA 1TKDA 2FMQA 2OCEA 4UARA 1MQ3A 1B22A 3TAQA 4P0QA 1N60A 1ZQRA 9ICPA 3C21A 2ISPA 3Q8RB 2RHFA 4EBCA 1L8OA 4PHEA 4EYIB 4JV2A 5HR7A 1S0VA 3M6ZA 3C2KA 3N97B 1BPBA 1N63A 3RBDA 2DWQA 2KFNA 2KSOB 4NJ8A 1X9SA 1UQVA 4IRCA 1RG6A 2EAPA 5DB9A 3GU3A 2BDPA 5D49A 4DOCA 1RQLA 4DL7A 2GO7A 5BOMA 5DBBA 4F5RA 4O5KA 4NXZA 2OEHA 4UAUA 1Q3UA 1NNLA 3HP6A 2HHXA 4RNNA 4KLUA 4ECQA 3A0HU 1BPDA 3IRUA 5J2HA 2WB1F 2FJ6A 5ALWA 4RUCA 2LBOA 3PX0A 3C2MA 4ECWA 2PI5A 5AI9A 2BCVA 4YD2A 1N61A 2KKPA 3N28A 4BDPA 3AQFA 4CGZA 2LHTA 3OJSA 3QU5A 5J2AA 4J9KA 4Y2TA 5JUMA 5ALUA 5DB6A 3NVYA 2K8AA 2FPKA 2GLEA 3C23A 4IQWA 4OO1J 4CCHA 1DRGA 5AI0A 5ALXA 2LYBA 1Z00A 5CB1A 2NYVA 1L3SA 4QZCA 3C29A 4DOAA 3OSPA 5JU5A 1L3VA 3K4GA 2LM1A 3CRXA 3PSIA 3FM9A 4ECRA 3IM1A 3T5JA 1XSLA 7ICTA 2YMPA 1N62A 3PSFA 4DQIA 2NRVA 5KFIA 2PMZF 3NVZA 4B6JA 3TI0A 2ZTEA 4US9A 1KFTA 3IN5A 4J9RA 5KG6A 4OCZA 4DQRA 1ZQLA 3GIMA 8ICUA 4KITB 2Y1IA 1ZQNA 3RB6A 2FI1A 4B9VA 2M0NA 4LJXA 4QZIA 4ELTA 1D8LA 2K89A 3KFUF 4KN4A 4ECUA 4ECTA 3RB0A 4M9HA 5EWEA 1TAMA 2YB1A 2PFQA 1Z1BA 4FZNA 1X40A 3J81j 1UCVA 2QB1A 3GZFA 4F5QA 1NJXA 4IRDA 5KFZA 4I27A 3H0LB 3MR2A 4IQVA 4FE3A 4FS1A 1GO3F 1BPEA 2E8MA 3SENA 3F53A 1XO0A 4C4RA 4US8A 5GTIU 1KW4A 2JZBB 2AGOA 2KIVA 4UASA 2K4PA 4DFJA 1UT8A 5HP4A 3RH5A 5AI4A 1QQ7A 1U47A 5KG3A 9ICHA 4YCXA 2KOBA 5KT3A 3C1YA 3M9OB 2XGPA 2K4IA 3M7DA 7ICIA 1U4BA 2HI0A 4DFMA 4JV1A 4EBEA 7ICRA 7ICMA 1RPLA 2ZIUA 4O5CA 2RP5A 4ED1A 4BXOA 3PSTA 4O3SA 8ICPA 1COKA 3PMLA 5J0SA 4FZLA 2HW3A 4F92B 2JRZA 3SEIA 4EBDA 5ALZA 1S97A 4PL1A 5DQHA 1KQQA 1L7PA 5EWFA 1K1SA 5F9NA 1NKBA 5AM0A 5J2JA 1QQ5A 4F72A 2W9CA 4LVSA 4B9NA 4DOBA 3SAGA 3DDHA 3L3FX 4K4IA 1T3QA 2A19A 5ALHA 4EZ6A 1UT5A 3KKAC 4EX6A 2IHMA 2DUYA 5AKLA 4ELUA 1NZBA 2LPEA 2C2DA 3PO5A 1O08A 1SL2A 2E5SA 3AU2A 4NM2A 5DG9A 2WF5A 2KN7A 5KFSA 1C20A 4CF3A 3HX0A 1P7DA 4EENA 5KFWA 1YZ6A 1ZXIA 4O5EA 3T3FA
chains in the Genus database with same CATH topology
2KVSA 2O6KA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVS A;  2O6K A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 2W9M A;  3PMN A;  5KFA A;  2NV3 A;  3KHL A;  4EEL A;  2KIW A;  2YX8 A;  4DSI A;  5J2K A;  3AN1 A;  2KV2 A;  3GV8 B;  3PW0 A;  4RQ8 A;  2W04 A;  1JI7 A;  4B9S A;  1QLN A;  2KD1 A;  5HNK A;  5DG8 A;  4ICA A;  4QZA A;  2DGZ A;  3KHG A;  1NZP A;  1CI4 A;  5CP2 A;  2OM6 A;  4RQ2 A;  4F2R A;  3F2C A;  2EQY A;  1XC9 A;  3MR5 A;  3T5L A;  3UQ2 A;  2H3F A;  3QXG A;  4C7Y A;  2H5X A;  3GIK A;  1T3N A;  3WK4 A;  3JPP A;  4KMO B;  4RZR A;  2XVT A;  1WWV A;  9ICE A;  2F1J A;  2WF7 A;  3TAD C;  1ZQH A;  2HMX A;  2G09 A;  1DXS A;  1ZQ1 C;  3OGU A;  3MBY A;  4NLB A;  2MAX A;  3NRZ A;  1VLB A;  1OXJ A;  5D46 A;  1U49 A;  4I2C A;  3N7R C;  4YR3 A;  4RUA A;  4U7C A;  4XRH A;  4GXI A;  3TAP A;  4IRK A;  1JRP A;  2G0A A;  3NTU A;  5ALP A;  3EPI A;  5HHH A;  5DB8 A;  1A0P A;  1FEZ A;  3PSP A;  5GTH U;  1N5W A;  3QE9 Y;  2HHU A;  1JXL A;  2QB0 A;  2E3T A;  2WTF A;  5ALQ A;  5J0Y A;  2F76 X;  2WF8 A;  4F4Y A;  2I1Q A;  3Q8P B;  2MU2 A;  1A77 A;  2NRT A;  1SL0 A;  1IG6 A;  4QZB A;  2Y9T A;  1U9L A;  4R64 A;  2KFZ A;  3PY8 A;  3Q8L A;  1UA1 A;  2EDU A;  2F3N A;  3RTV A;  1JMS A;  4QWA A;  4ECY A;  4GLX A;  4YMM A;  2W43 A;  3IDW A;  5C5J A;  4Y2R A;  5KTQ A;  2D3D A;  1ZQV A;  3WK8 A;  2EZY A;  3UQ0 A;  3OSN A;  2H3Z A;  3I28 A;  4C8O A;  4DQS A;  2AQ4 A;  5B5E U;  2E1F A;  5ALD A;  3QEB Z;  3SMV A;  3K75 D;  3BS7 A;  4ED3 A;  4Z6D A;  5TZV A;  4P2H A;  2XGQ A;  4KLT A;  7ICF A;  1RYS A;  1B0X A;  2NO4 A;  4J9S A;  2K8B B;  4QWE A;  3QYP A;  3M1Y A;  2KZZ A;  4F5O A;  1KSP A;  3ZDC A;  2KSO A;  1PVQ A;  5KFP A;  1NI3 A;  3C2L A;  2Q4T A;  3CW2 C;  4PHP A;  5AK5 A;  1NK6 A;  4HYK A;  2Y0S F;  9ICL A;  5L1M A;  3RAQ A;  2XY7 A;  4UB6 U;  2IOF K;  1DK2 A;  1AQ6 A;  1PK3 A;  2AQ0 A;  5J29 A;  1YZ7 A;  1CRX A;  2F77 X;  2CXY A;  4IS7 A;  2IA6 A;  3SAH A;  1KFD A;  4YD1 A;  3UPQ A;  2MRL A;  2FLL A;  1KDH A;  4YXM A;  2QB0 B;  4QZE A;  1BNP A;  1ZQP A;  2BPF A;  1JRO A;  5AM5 A;  2ALZ A;  5ALV A;  1Q46 A;  3I1Y A;  3H7I A;  4O3O A;  1UHU A;  2DBY A;  4DFD A;  3I76 A;  1S77 D;  5CWR A;  8ICN A;  3BQ2 A;  1ZD4 A;  4YFK A;  4QWD A;  3EUB 2;  2XO7 A;  4Z6F A;  1M6Y A;  2G07 A;  2IHN A;  3ZDB A;  2W7P A;  2W8K A;  4Y2U A;  1UPH A;  2FMS A;  2HHS A;  5KFN A;  1ZET A;  3H0R B;  2BHN A;  5ALY A;  4KLF A;  4EZ9 A;  2FLP A;  3HW8 A;  3IHQ B;  1C7Y A;  2MUT B;  2VKQ A;  3UMB A;  1NJZ A;  1HUO A;  2JH1 A;  4NLK A;  4O3Q A;  4BUG A;  5CEH A;  1PUZ A;  1COO A;  2K8C B;  2N1R A;  4FS2 A;  2KVC A;  3H8W A;  2R18 A;  4OJL A;  4IQT A;  2EAN A;  5KT7 A;  3R9K A;  4LZD A;  5KT2 A;  7ICE A;  2ZUC A;  1NOM A;  1ZD3 A;  1RYU A;  3NUQ A;  3N7P D;  4R63 A;  3QUQ A;  4DLE A;  2BKE A;  4YN4 A;  3BQ1 A;  2Q0Z X;  1ZQE A;  1EXN A;  1QCK A;  5J8Y A;  2HSZ A;  3EZ5 A;  1TVA A;  5DQG A;  7ICK A;  3RBE A;  2ZJA A;  2HOI A;  1XWL A;  2YTU A;  3RB4 A;  1X9W A;  4KLJ A;  2F1H A;  3E58 A;  5KFV A;  2E8N A;  4BJQ A;  9ICX A;  5J2C A;  2Y1J A;  1KKX A;  4TUQ A;  5IIK A;  2QLT A;  4ZH4 A;  3WKC A;  1L6N A;  3SQI A;  2LM4 A;  2PKE A;  4J9Q A;  1ZJM A;  1NK0 A;  2HVI A;  4I2D A;  5AKX A;  4NLZ A;  1XS9 D;  2H3Q A;  2JH7 A;  1PVP A;  4I28 A;  2J6S A;  3MFI A;  1ZJN A;  4UB3 A;  4KTQ A;  8ICZ A;  5ALG A;  7ICP A;  2UVV A;  2AHO B;  5KFK A;  3H4B A;  3DV9 A;  4LZG A;  3PV8 A;  3GFK B;  1T8E A;  2MA1 A;  3MC1 A;  1NK5 A;  3HWT A;  2ATL A;  4MF2 A;  3KOO A;  1SWW A;  3WK9 A;  3RFA A;  3N4M B;  3C1Z A;  4UB2 A;  2IOH A;  4I2F A;  5AK6 A;  1Y88 A;  4QJF B;  2JZB A;  9ICM A;  3WK6 A;  3BS5 B;  5ALR A;  3WKD A;  1N48 A;  4M2Y A;  2DFL A;  2I5H A;  4TQR A;  4DL3 A;  3EW9 A;  4RQN A;  3NRW A;  2F44 A;  1FFV A;  4ZOH C;  4KLS A;  1T7P A;  1ZQF A;  3QU2 A;  1LVH A;  4PGX A;  3AU6 A;  4AYB F;  3LWL A;  2KHQ A;  1ZQI A;  1S10 A;  3T5H A;  4YVZ A;  4KLD A;  9ICO A;  1T94 A;  2XY6 A;  2CRX A;  1ZYQ A;  1ZQD A;  2ODG A;  5DKW A;  1NK9 A;  3C5G A;  2JXJ A;  3Q8S B;  3M9N B;  3F5A A;  5KG0 A;  4O9M A;  3TAN A;  2RRD A;  4BWJ A;  3UXO A;  1Z1V A;  8ICC A;  2PFN A;  4QWB A;  1QSS A;  5KG1 A;  4YR2 A;  3TAR A;  5A0L A;  4Y2S A;  4ED2 A;  2E1E A;  4RPX A;  3S6J A;  4J9N A;  4CDG A;  2W11 A;  4Q8E A;  1U48 A;  4NLG A;  1B43 A;  1SKR A;  1TK5 A;  1UA0 A;  4JB3 A;  1SZH A;  2BZF A;  4Q8F A;  3OTQ A;  1XU4 A;  2JEI A;  5AI8 A;  3D2S A;  3JPN A;  2NRZ A;  5IIL A;  2RQ5 A;  2KJ9 A;  4OD0 A;  4EYH B;  2AJQ A;  1D8B A;  2BPC A;  2FE9 A;  4UAW A;  4JWM A;  3EWA A;  1S0M A;  1QSL A;  4CE6 A;  3RJK A;  2P35 A;  4NM1 A;  4GFJ A;  2OH2 A;  1X42 A;  3MR6 A;  2KE7 A;  4UB5 A;  4I2B A;  3LDA A;  4XQ8 A;  1DGJ A;  4RQ7 A;  3LYS A;  2B0C A;  2HHW A;  5DGB A;  7ICN A;  3F2D A;  2KMD A;  1XNS A;  3FYH A;  3RJJ A;  2GOL A;  2Y0S C;  4Q45 A;  5L1L A;  2LMR A;  3GV5 B;  5EWG A;  1HIW A;  5AIB A;  4PHA A;  3PR5 B;  1N5X A;  5F9L A;  3NAS A;  1NJW A;  1ECW A;  4B9L A;  5KFX A;  3V72 A;  5J0T A;  1L7O A;  4RNO A;  2JEF A;  2ASJ A;  2OWO A;  4NL9 A;  8ICJ A;  1H38 A;  3KBB A;  3THV A;  1BGX T;  2RDI A;  3RJE A;  1ZQG A;  4DL6 A;  2YY6 A;  5J2E A;  3D2Q A;  2NRX A;  5AK4 A;  7ICH A;  2PI4 A;  4DSL A;  4DFP A;  1JUD A;  5AM4 A;  1S0O A;  2P6U A;  1ZQT A;  2FLN A;  2VA3 A;  1ZQA A;  4RQ0 A;  2DL0 A;  2W7O A;  1LV5 A;  9ICK A;  4DL5 A;  2KIC A;  4Y2J A;  4F8R A;  5AKI A;  5J0Q A;  2WFA A;  4RT2 A;  2D6F C;  4QZ9 A;  4I2E A;  3HKZ C;  8ICB A;  8ICO A;  5G5G A;  3U26 A;  1XSN A;  4QWC A;  2HDO A;  2C2R A;  4R66 A;  4KLH A;  2IBK A;  1RQN A;  3OPX A;  2KK0 A;  4MEX A;  1V97 A;  2FDR A;  4DSJ A;  1ZQC A;  2DKX A;  2ZXH A;  3ED5 A;  1HUZ A;  1RDF A;  2BCQ A;  4UAZ A;  2K4E A;  5J0P A;  5KFC A;  3LVV A;  4ECX A;  3M9M B;  1MSW D;  1TAQ A;  7ICL A;  5KFB A;  1RYR A;  2G08 A;  2VJ5 A;  4FBT A;  1SV0 C;  3MR3 A;  9ICF A;  5KFL A;  1OW5 A;  2LI6 A;  1PVR A;  4TUR A;  1KFS A;  2ESE A;  2ASD A;  3DEE A;  4C80 A;  5H2F U;  5L9X A;  4M9G A;  5CA7 A;  2JMG A;  5KL8 B;  4M47 A;  5L1K A;  1QQ6 A;  3EYZ A;  4P4O A;  2EH9 A;  5ALS A;  4C7Z A;  3KTQ A;  3QZ8 A;  2YB4 A;  5KFT A;  4KLM A;  3HPO A;  4NY8 A;  1K5O A;  4M9N A;  4YMN A;  3TKA A;  3ZDA A;  5EOZ A;  4DL4 A;  3QU9 A;  3BQ7 A;  3MAB A;  4X5V A;  3QZ7 A;  2ZUB A;  4UB1 A;  1MA7 A;  4WJ3 B;  1WWU A;  1NKC A;  3H8S A;  4J9L A;  2Z7J A;  4DWI A;  4P0P B;  2C22 A;  3MFH A;  4YG2 A;  1TFR A;  5ALK A;  3V7L A;  2NO5 A;  5E79 U;  9ICG A;  4YQW A;  2V4Q A;  2E8P A;  3NVV A;  1TK8 A;  1KRP A;  5KFH A;  4BGD A;  3L5K A;  1BPZ A;  4OJ5 A;  1TE2 A;  5KFU A;  2KTQ A;  5CR0 A;  3RJI A;  2BGW A;  8ICW A;  4DEZ A;  4Y2Q A;  5J2F A;  3HT3 A;  5KT6 A;  3WK5 A;  2AXT U;  5G5H A;  3RR7 A;  5J8Y C;  3OHA A;  2R8H A;  5B66 U;  1RM6 C;  2ZIX B;  1RXV A;  2DPJ A;  4AYB C;  3IG8 A;  3ALR A;  2HHQ A;  3H4D A;  4J9M A;  3BQT A;  1ZQU A;  2FPL A;  2JEJ A;  2YQE A;  2KJ5 A;  4I29 A;  3KZI U;  3WKB A;  1Q8K A;  4FO6 A;  1VDV A;  5ALJ A;  4YP3 A;  2WAQ C;  2MUT A;  3SI8 A;  4KX3 A;  4JWN A;  2BPG A;  2KG5 A;  3ONN A;  5AIA A;  2ES6 A;  3LWM A;  1TAU A;  5J2D A;  1NK7 A;  3SZ2 A;  2BCS A;  3JPQ A;  5IIJ A;  1N2X A;  2W9B B;  4DQQ A;  3ZD8 A;  5J0R A;  3VC8 A;  1Z4O A;  1Z3E B;  1ZQO A;  4QIW C;  4Y2P A;  5K4L A;  5JTI A;  5DQI A;  1MN8 A;  7ICQ A;  5DBC A;  4U6P A;  2BCU A;  5AK3 A;  2E8O A;  1V85 A;  2ZTC A;  1Z4N A;  1ZQQ A;  1FIQ A;  1JN3 A;  5HHI A;  1SV0 A;  4DQP A;  4JMU A;  9ICC A;  4NV0 A;  1S8O A;  4PGY A;  4I2A A;  2KEY A;  5KG7 A;  4IC9 A;  1T4G A;  4M04 A;  2DPI A;  4ED0 A;  3B9J A;  4O3P A;  1S0N A;  4XA5 A;  5J0X A;  2V9W A;  5AKH A;  4AP9 A;  3V6H A;  3OJU A;  1KEJ A;  5AKJ A;  2MSN A;  3TQ1 A;  4CRX A;  1D9D A;  3AMZ A;  3MGV A;  4FBU A;  4UBC A;  4QNL A;  1L5U A;  3RR8 A;  3NS1 A;  3V6K A;  4I2G A;  3KHR A;  3FAH A;  2W8L A;  5KFM A;  1SIJ A;  8ICQ A;  3RJG A;  4I2I A;  3BQ0 A;  2HBK A;  3E0F A;  3V7K A;  2XCP A;  5III A;  4QZF A;  2M9N A;  4KLE A;  3FC4 A;  5EE0 A;  5KFY A;  3BJY A;  2HHT A;  3HKZ F;  3BS5 A;  3D2N A;  1X66 A;  4Q43 A;  3ISB A;  1OUQ A;  3E2E A;  4QZ8 A;  3A0B U;  2HOQ A;  3TFS A;  3UMC A;  2IMW P;  2EAO A;  5KAF U;  2XC9 A;  4KLI A;  1JIH A;  1FFU A;  3KZX A;  2RDJ A;  2EAM A;  3PW2 A;  1BVS A;  4UQG A;  1TV9 A;  2BCR A;  2CN1 A;  2J6U A;  3ORY A;  4NLC A;  3VCB A;  2KJ8 A;  3PW7 A;  1JX4 A;  3HIL A;  4MF8 A;  2OYY A;  5ALO A;  5IIN A;  3T5K A;  4MFC A;  3JPR A;  1YT3 A;  4G9B A;  5KFJ A;  2XCA A;  4C4T A;  3QEA Z;  4KLO A;  8ICF A;  3GQC A;  2G5I B;  5AKY A;  1NKE A;  2BQU A;  4K4H A;  1L3T A;  4Z6C A;  3ISC A;  2JV3 A;  4NWI A;  2JGA A;  3H0M B;  1K1Q A;  2BQ3 A;  3K1Z A;  2FMP A;  3V7J A;  4PL2 A;  1ZD2 P;  2W54 A;  2AU0 A;  3OHB A;  4JK1 A;  4O3M A;  4E0D A;  4C8K A;  4NL9 C;  1IV8 A;  2KKV A;  5HMM A;  4DS4 A;  3PZP A;  5KFO A;  9ICR A;  5TIS U;  1DOQ A;  2UVR A;  2V4R A;  1LKY B;  2C2E A;  3G6Y A;  1PK1 B;  9ICQ A;  5KG2 A;  1FO4 A;  1KLN A;  3ZDE A;  2DF4 B;  2ZIW B;  4UW9 A;  5ALF A;  5BOL A;  2ZIV B;  4DSK A;  4P4P A;  4EX7 A;  3UXP A;  5KAI U;  4PH5 A;  2OHF A;  3UM9 A;  5IIO A;  1SV4 A;  4ECS A;  3SR6 A;  4PGQ A;  3QX7 A;  4Z6E A;  4O3R A;  4RNM A;  8ICL A;  4B9T A;  1SXD A;  2KNJ A;  7ICJ A;  2AGP A;  5JRT A;  4O3N A;  4XUS A;  3G6X A;  4F71 A;  3TAC B;  3PR4 A;  5J2I A;  3RJF A;  9ICT A;  3ICX A;  4CNQ A;  3WK7 A;  8ICS A;  2WF6 A;  4MHV A;  5KFQ A;  4IL6 U;  2YML A;  4F4W A;  8ICH A;  4F2S A;  4MFA A;  5J2B A;  4IR9 A;  4PPX A;  2FPM A;  4F4Z A;  5T14 A;  2WAQ F;  3PX6 A;  3HJE A;  1X2I A;  2A1J A;  1ZQB A;  3B0Y A;  4PZO A;  4DSE A;  1S5L U;  4P0Q B;  5J0U A;  2K60 A;  3BZK A;  2GWS A;  7ICV A;  5AI6 A;  4I2H A;  5BPC A;  2ZJ5 A;  3PX4 A;  3N7S C;  4PZN A;  1SWV A;  3ZI4 A;  4J9P A;  1ZRN A;  4YR0 A;  4I2J A;  5DBA A;  4RPY A;  1CEZ A;  5AKG A;  1CUK A;  3TFR A;  2KVS A;  2ZXI A;  4Y2X A;  2F8L A;  2R8I A;  2I6X A;  4RQM A;  4QW9 A;  4F4K A;  4QIW F;  4GXK A;  2B6G A;  9ICV A;  9ICW A;  3F5E A;  3CNH A;  3ISD A;  1F5S A;  5EE9 A;  2KZ3 A;  1N56 A;  4GXJ A;  1Q3V A;  9ICI A;  4C8N A;  1DGS A;  3QUB A;  1ZQY A;  1WG8 A;  5ALE A;  5J0O A;  3MGH A;  2W9A A;  8ICK A;  8ICA A;  3M8R A;  8ICE A;  2ZTD A;  4Q44 A;  4Y2V A;  1A6S A;  5AM2 A;  2R8J A;  5DG7 A;  2VA2 A;  1J97 A;  1SB3 C;  1L7M A;  1URJ A;  2HCF A;  8ICM A;  3CYM A;  4DS5 A;  1VJ5 A;  7ICO A;  2QAR A;  3LVW A;  4J03 A;  3GIL A;  4ED6 A;  2UVW A;  2AGQ A;  4HAI A;  4UB8 U;  4GC7 A;  1TK0 A;  4G3I A;  5HML A;  5KG4 A;  4DCC A;  2J6T A;  2YMM A;  2HVH A;  4C4S A;  1ZOL A;  1ZQX A;  8ICV A;  2BQR A;  1BNO A;  4A8E A;  1Z00 B;  3UMG A;  4P0P A;  4RQ3 A;  4CF4 A;  3QU4 A;  4UBB A;  3BDP A;  5DLF A;  1NK4 A;  4IR1 A;  2A1J B;  2F1I A;  3NGD A;  2HBL A;  5FP0 A;  2JHD A;  1WYG A;  2VJ4 A;  4BWM A;  4RQ5 A;  1SL1 A;  1DK3 A;  4J9O A;  4TUP A;  3F2B A;  1J2M A;  8ICR A;  2GH1 A;  4KX5 A;  4M6W A;  5DGA A;  3B0X A;  1A76 A;  3V6J A;  4QW8 A;  3SV4 A;  4KLL A;  1ZD5 A;  2C28 A;  2KP7 A;  4JV0 A;  4DFK A;  5AKZ A;  4M9L A;  3IV6 A;  3KD3 A;  2D8C A;  4JUZ A;  4F93 B;  1S9F A;  3ZD9 A;  3C28 A;  2ZIX A;  3PVX A;  3RRG A;  3QUC A;  3AQE A;  1LB2 B;  5EE3 A;  1X6J A;  3UXN A;  5KFE A;  3GII A;  3IP4 B;  5CHG A;  1IXR A;  2IOF A;  1BPX A;  5KFG A;  4DO9 A;  5HR6 A;  4OJO A;  2H3I A;  4UAY A;  3C5F A;  1ED1 A;  1HEK A;  4YXJ A;  2KHV A;  2ISO A;  1SXE A;  2ZJ8 A;  3KHH A;  2A1A A;  1HJP A;  1WCL A;  1SGG A;  1PZN A;  4TUS A;  2JR5 A;  5KFD A;  4ECZ A;  4C8L A;  8ICY A;  5AIC A;  1KL9 A;  4C0Z A;  4PHD A;  2HBJ A;  4B9U A;  5DB7 A;  3WKA A;  2ASL A;  1D9F A;  1BPY A;  2DQN B;  5IIM A;  5CJ7 A;  1Z19 A;  4RQ4 A;  4F5P A;  4F50 A;  4KLG A;  4BX9 C;  9ICJ A;  2QAR B;  4RPZ A;  3QNM A;  2W9B A;  4IQU A;  8ICX A;  5KT4 A;  3M6K A;  3AM9 A;  5KFR A;  2AH5 A;  2PFO A;  3CP8 A;  3SYZ A;  9ICA A;  9ICB A;  1NK8 A;  1F0M A;  3RH4 A;  4R8U A;  3ETR A;  2NRW A;  5KL1 B;  5KFF A;  1KBU A;  2F8K A;  5ALN A;  5DLG A;  5F3X B;  2A3V A;  4RQ1 A;  4F4X A;  4M9J A;  4YMO A;  2VIX A;  4GC6 A;  3T79 A;  4PJ0 U;  5AHX A;  1WCN A;  3GDX A;  1JXE A;  3RF9 A;  1L8L A;  2G06 A;  4F5N A;  1U45 A;  5KNI A;  4DLG A;  2OXO A;  1XSP A;  5DDM A;  2WB1 C;  1QH9 A;  4RT3 A;  4B9M A;  2HOF A;  4EEK A;  1ZQS A;  1J2N A;  2F2A B;  2ZIU B;  4KMU A;  4ECV A;  8ICI A;  4BXO B;  2BDU A;  3HRD D;  1F44 A;  5ALM A;  2PFP A;  2LKY A;  3H8J A;  4M6W B;  4P4M A;  1XO1 A;  5AKK A;  1O03 A;  4FZM A;  4K4G A;  1S76 D;  9ICS A;  8ICG A;  2YN4 A;  4QZG A;  1ZQM A;  2LYA A;  2KZM A;  4FFD A;  2W9C B;  2RLT A;  1X9M A;  4ED7 A;  1KTQ A;  1JAL A;  3QU7 A;  1X6I A;  2W3R A;  4OJ6 A;  4DL2 A;  2YMQ A;  4ACO A;  4UAV A;  3MDC A;  1D8Y A;  5ALL A;  3RRH A;  1MQ2 A;  9ICN A;  4QZH A;  2CPR A;  2QKQ A;  3QUT A;  3Q8M A;  3M8S A;  7ICG A;  2ZG6 A;  3K1R B;  3H40 A;  3Q8K A;  2HHV A;  2EZZ A;  2WF9 A;  1ZQK A;  2W03 A;  2VA8 A;  4MFF A;  4M0A A;  4RQ6 A;  7ICU A;  5L1I A;  5D4B A;  3BZC A;  3O0F A;  1QSY A;  2PMZ C;  3PO4 A;  3H8M A;  4RU9 A;  2B21 A;  2P66 A;  2BR0 A;  1RXW A;  2P6R A;  2XIC A;  4KN7 A;  5ALI A;  3WKE A;  1NJY A;  1L7N A;  1ZQJ A;  5KT5 A;  3MGI A;  4R8U B;  1MC8 A;  2I9G A;  3KKA A;  1SZP A;  3WU2 U;  3SD7 A;  3NVW A;  2JEG A;  2W3S A;  1KN5 A;  5CRX A;  4Y2Y A;  2XI9 A;  5L1J A;  3RJH A;  1ZQW A;  3GV7 B;  4R65 A;  2R8G A;  3PW5 A;  1ARO P;  4GIB A;  5J0W A;  3RAX A;  1ZRM A;  2G5H B;  2DKZ A;  4EEY A;  3ZDD A;  3D6J A;  4USA A;  2PXI A;  5AKE A;  4UB4 A;  3JPT A;  1LKY A;  1QTM A;  1PK1 A;  5ALT A;  2K4H A;  1L3U A;  2ZUD A;  2ZIW A;  3GIJ A;  3IG5 A;  5EE1 A;  3LK9 A;  2ZIV A;  2WHE A;  5AM3 A;  5AI5 A;  8ICT A;  4F91 B;  4ED8 A;  1WUD A;  3ETL A;  2UVU A;  1B4F A;  9ICU A;  3FDS A;  3AEV A;  2VAN A;  1IIP A;  3AUO A;  1V9P A;  5KG5 A;  4MEY A;  4TQS A;  2XY5 A;  4ELV A;  3RB3 A;  4DSF A;  1V38 A;  4KLQ A;  2HBM A;  4C8M A;  2LYH A;  5DDY A;  2H3V A;  1SKS A;  4CF5 A;  2W55 A;  3TAD A;  4UAT A;  4OJP A;  3JPO A;  4NLN A;  3RH6 A;  2O6K A;  3EPG A;  5C0Y A;  4QZD A;  1SKW A;  4DF4 A;  3JPS A;  2Y9U A;  1X9X A;  4DF8 A;  4F3O A;  1IM4 A;  5J2G A;  2EZX A;  3PW4 A;  3SAF A;  3AL0 B;  3PNC A;  3G6V A;  3L4P A;  5AM1 A;  2XID A;  1ZQZ A;  2L5Y A;  3SV3 A;  1RZT A;  3Q8Q B;  7ICS A;  4O0I A;  2R8K A;  3MDA A;  1TKD A;  2FMQ A;  2OCE A;  4UAR A;  1MQ3 A;  1B22 A;  3TAQ A;  4P0Q A;  1N60 A;  1ZQR A;  9ICP A;  3C21 A;  2ISP A;  3Q8R B;  2RHF A;  4EBC A;  1L8O A;  4PHE A;  4EYI B;  4JV2 A;  5HR7 A;  1S0V A;  3M6Z A;  3C2K A;  3N97 B;  1BPB A;  1N63 A;  3RBD A;  2DWQ A;  2KFN A;  2KSO B;  4NJ8 A;  1X9S A;  1UQV A;  4IRC A;  1RG6 A;  2EAP A;  5DB9 A;  3GU3 A;  2BDP A;  5D49 A;  4DOC A;  1RQL A;  4DL7 A;  2GO7 A;  5BOM A;  5DBB A;  4F5R A;  4O5K A;  4NXZ A;  2OEH A;  4UAU A;  1Q3U A;  1NNL A;  3HP6 A;  2HHX A;  4RNN A;  4KLU A;  4ECQ A;  3A0H U;  1BPD A;  3IRU A;  5J2H A;  2WB1 F;  2FJ6 A;  5ALW A;  4RUC A;  2LBO A;  3PX0 A;  3C2M A;  4ECW A;  2PI5 A;  5AI9 A;  2BCV A;  4YD2 A;  1N61 A;  2KKP A;  3N28 A;  4BDP A;  3AQF A;  4CGZ A;  2LHT A;  3OJS A;  3QU5 A;  5J2A A;  4J9K A;  4Y2T A;  5JUM A;  5ALU A;  5DB6 A;  3NVY A;  2K8A A;  2FPK A;  2GLE A;  3C23 A;  4IQW A;  4OO1 J;  4CCH A;  1DRG A;  5AI0 A;  5ALX A;  2LYB A;  1Z00 A;  5CB1 A;  2NYV A;  1L3S A;  4QZC A;  3C29 A;  4DOA A;  3OSP A;  5JU5 A;  1L3V A;  3K4G A;  2LM1 A;  3CRX A;  3PSI A;  3FM9 A;  4ECR A;  3IM1 A;  3T5J A;  1XSL A;  7ICT A;  2YMP A;  1N62 A;  3PSF A;  4DQI A;  2NRV A;  5KFI A;  2PMZ F;  3NVZ A;  4B6J A;  3TI0 A;  2ZTE A;  4US9 A;  1KFT A;  3IN5 A;  4J9R A;  5KG6 A;  4OCZ A;  4DQR A;  1ZQL A;  3GIM A;  8ICU A;  4KIT B;  2Y1I A;  1ZQN A;  3RB6 A;  2FI1 A;  4B9V A;  2M0N A;  4LJX A;  4QZI A;  4ELT A;  1D8L A;  2K89 A;  3KFU F;  4KN4 A;  4ECU A;  4ECT A;  3RB0 A;  4M9H A;  5EWE A;  1TAM A;  2YB1 A;  2PFQ A;  1Z1B A;  4FZN A;  1X40 A;  3J81 j;  1UCV A;  2QB1 A;  3GZF A;  4F5Q A;  1NJX A;  4IRD A;  5KFZ A;  4I27 A;  3H0L B;  3MR2 A;  4IQV A;  4FE3 A;  4FS1 A;  1GO3 F;  1BPE A;  2E8M A;  3SEN A;  3F53 A;  1XO0 A;  4C4R A;  4US8 A;  5GTI U;  1KW4 A;  2JZB B;  2AGO A;  2KIV A;  4UAS A;  2K4P A;  4DFJ A;  1UT8 A;  5HP4 A;  3RH5 A;  5AI4 A;  1QQ7 A;  1U47 A;  5KG3 A;  9ICH A;  4YCX A;  2KOB A;  5KT3 A;  3C1Y A;  3M9O B;  2XGP A;  2K4I A;  3M7D A;  7ICI A;  1U4B A;  2HI0 A;  4DFM A;  4JV1 A;  4EBE A;  7ICR A;  7ICM A;  1RPL A;  2ZIU A;  4O5C A;  2RP5 A;  4ED1 A;  4BXO A;  3PST A;  4O3S A;  8ICP A;  1COK A;  3PML A;  5J0S A;  4FZL A;  2HW3 A;  4F92 B;  2JRZ A;  3SEI A;  4EBD A;  5ALZ A;  1S97 A;  4PL1 A;  5DQH A;  1KQQ A;  1L7P A;  5EWF A;  1K1S A;  5F9N A;  1NKB A;  5AM0 A;  5J2J A;  1QQ5 A;  4F72 A;  2W9C A;  4LVS A;  4B9N A;  4DOB A;  3SAG A;  3DDH A;  3L3F X;  4K4I A;  1T3Q A;  2A19 A;  5ALH A;  4EZ6 A;  1UT5 A;  3KKA C;  4EX6 A;  2IHM A;  2DUY A;  5AKL A;  4ELU A;  1NZB A;  2LPE A;  2C2D A;  3PO5 A;  1O08 A;  1SL2 A;  2E5S A;  3AU2 A;  4NM2 A;  5DG9 A;  2WF5 A;  2KN7 A;  5KFS A;  1C20 A;  4CF3 A;  3HX0 A;  1P7D A;  4EEN A;  5KFW A;  1YZ6 A;  1ZXI A;  4O5E A;  3T3F A; 
#chains in the Genus database with same CATH homology
 2KVS A;  2O6K A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...