1SXEA

The solution structure of the pointed (pnt) domain from the transcrition factor erg
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
GSHMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription, signaling protein
molecule keywords Transcriptional regulator ERG
publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxeA00
3KKAC 2QARA 1UQVA 1B0XA 1LKYB 1B4FA 5J8YA 2EANA 4RQNA 2B6GA 2E8NA 5JRTA 2DL0A 1RG6A 2QARB 3BS5A 1OW5A 2JV3A 1SXEA 5J8YC 2EAMA 4IS7A 2DKZA 2DKXA 2F3NA 3BS5B 2K4PA 2QB0A 5L1MA 1COKA 1V38A 2KMDA 4MHVA 4NL9A 1KW4A 2LMRA 2KIVA 2YTUA 5JU5A 3TADA 1WWVA 1SGGA 5KNIA 1X9XA 2QB0B 2F8KA 3TACB 1X66A 1Z1VA 2EAOA 4NL9C 3IDWA 2F44A 3BQ7A 5F3XB 3TADC 2KSOA 2QB1A 1WWUA 2D8CA 1UCVA 1PK1A 2ES6A 5JTIA 2D3DA 1SV0A 3H8MA 1X40A 1SXDA 1JI7A 2KSOB 1V85A 2GLEA 1PK1B 3BS7A 4PZOA 1DXSA 1SV0C 2E8MA 3SEIA 2L5YA 2Y9UA 4PZNA 2FE9A 3K1RB 2KE7A 2K60A 2E8PA 3SENA 3KKAA 1PK3A 2EAPA 2ESEA 2LPEA 2QKQA 1LKYA 4RQMA 3HILA 1SV4A 1OXJA 2E8OA 2Y9TA 1F0MA 2KG5A 4NJ8A
chains in the Genus database with same CATH superfamily
5HP4A 8ICOA 5DKWA 3GIJA 4F2SA 4FZMA 2VA8A 3F5AA 4YD1A 3EUB2 2WF8A 3ZDEA 2BPGA 2Y1JA 2W3RA 5AI8A 3PSFA 5KG7A 3DV9A 1L5UA 5KTQA 3UPQA 1FFUA 2IBKA 4ECVA 1KLNA 2NO5A 1A0PA 5AKJA 3RBDA 9ICBA 5ALQA 4ED0A 2NYVA 2DPJA 4ZH4A 4OCZA 2LMRA 3DDHA 2IOFK 2KIVA 4R64A 4M0AA 1ZQXA 4U7CA 2FPKA 4M9NA 2MUTA 4J9KA 3SQIA 1PZNA 1JUDA 1BPEA 2F44A 3MR2A 4DO9A 2UVVA 4MEYA 2KP7A 1U45A 2H5XA 3JPPA 1WUDA 2KJ9A 1URJA 3PMNA 3PVXA 2PXIA 4C8KA 3E0FA 3KZIU 2RP5A 2VANA 2R8HA 3A0HU 2ZXIA 5BOLA 8ICHA 5L9XA 1N48A 3ZDAA 3VC8A 3H4BA 8ICQA 2HHWA 3E58A 1SL2A 2P35A 4MF8A 4PZNA 2WHEA 3V6HA 3D2NA 1ZQKA 4RPXA 5AIBA 4QWCA 7ICPA 3QEBZ 2K60A 4DOBA 1BVSA 1Y88A 2E8PA 2NV3A 4BUGA 2AHOB 2HHQA 1JN3A 1IIPA 4JWMA 2LYHA 4RNOA 4E0DA 2XCPA 2DFLA 7ICNA 3RRHA 4FE3A 1Z4OA 4ICAA 8ICBA 1DGJA 4U6PA 3HX0A 1QQ7A 1D8YA 1MQ3A 4NLGA 4F2RA 2KIWA 1D9DA 3AEVA 1HUZA 5DB7A 5ALTA 3RH5A 5ALRA 4RQ1A 3PY8A 3LK9A 4TUQA 1ZXIA 1L3VA 3NVZA 4QIWF 1NJXA 2B21A 4ED1A 3EYZA 5L1KA 5AM2A 1DOQA 4P0QA 3PW0A 9ICLA 1N62A 4UBCA 1BPXA 4YQWA 4IRCA 2WAQC 2KMDA 2YQEA 3ISCA 4Z6EA 3TANA 1RM6C 1ZQSA 1NOMA 3RTVA 8ICIA 3RAQA 2BR0A 1SKSA 4DLGA 5DG8A 1Z1VA 4NL9C 8ICYA 5J2FA 4F4YA 1COOA 5AKGA 3QU7A 3CW2C 1PK1A 2BDUA 2YMPA 1S5LU 2RLTA 2E1EA 1NKBA 2PFNA 1C20A 2Z7JA 2FPMA 9ICVA 1ZQUA 5KG4A 5CR0A 1N5WA 4ECQA 4F4KA 3GQCA 5D49A 1N61A 4OJ6A 5KFAA 2XO7A 5KFBA 3M8RA 2WF7A 3ICXA 3AUOA 2J6SA 2C2DA 4RQMA 1NK5A 4RPYA 3NVWA 2G09A 2D6FC 2LBOA 1K1SA 3KKAC 1XO1A 4Z6FA 5L1LA 4NLCA 3DEEA 5DG7A 3FAHA 2HBKA 2KD1A 3NVVA 5JRTA 4ELTA 2JZBA 2W7OA 2H3ZA 2W54A 5T14A 1JROA 2IMWP 4LJXA 3PZPA 4QW8A 4RUAA 5C5JA 1KFSA 5KFUA 3H8SA 5IIKA 9ICIA 5J2EA 5AK4A 3NASA 5J0RA 2PI5A 4I27A 4KLIA 5AI9A 2ZUDA 3ONNA 4P0QB 5IIMA 4B9VA 4KLLA 5CEHA 2H3VA 2E5SA 2K8AA 4IL6U 2J6TA 5AKEA 2HHTA 4Y2XA 4JV2A 5KAIU 4FS1A 4PL2A 2PFPA 4UASA 1ZD2P 1TK8A 4YR3A 1JXEA 5ALGA 1SKWA 1BGXT 4GFJA 2KFNA 5EE1A 5KFHA 3AMZA 1PK1B 4CF3A 3MGIA 1ED1A 7ICGA 1VLBA 5ALWA 3OGUA 3ZI4A 4QZCA 4PH5A 2BCQA 3UXOA 3V7LA 4I2AA 1NK7A 4F91B 3BQ2A 3RJFA 4NXZA 2JRZA 4QJFB 2G06A 5J0PA 2M9NA 4O0IA 4O3PA 1TE2A 3ZD9A 2DBYA 2FLNA 3N4MB 1ZQTA 2AXTU 3C29A 4QZDA 4Y2SA 4NLNA 3N97B 5ALHA 1LKYA 1RYUA 3LVVA 3RRGA 4IC9A 2FMQA 2YMQA 2Y0SC 3S6JA 4C4TA 4C8NA 2F76X 3M8SA 1BPYA 1DK2A 4ECYA 5J8YA 2ZIUA 4RQNA 3EPIA 4UB1A 4RT2A 2W9AA 9ICNA 5D4BA 2KVSA 4DL4A 3NVYA 5KFEA 2JZBB 2DKXA 2WFAA 9ICTA 3RJIA 1X42A 5J0TA 3WK5A 5J2AA 2W9CB 1KKXA 2P66A 4FBTA 3D2QA 5DB9A 9ICFA 1T8EA 2KV2A 1A77A 3EWAA 4RU9A 3MR5A 2UVUA 1WWVA 5DG9A 4ECWA 5EWFA 4DF8A 3SAFA 1QH9A 4EEKA 7ICTA 2XY6A 3TQ1A 1Z1BA 4Q44A 4O5EA 3WK8A 4DS5A 1S0MA 8ICCA 7ICSA 1RQNA 1L3SA 5J29A 3M6ZA 2I9GA 2KJ5A 1IG6A 3T5JA 1DXSA 1CRXA 3UM9A 9ICWA 2YX8A 2BGWA 4I2FA 7ICVA 5J2IA 1KBUA 1UHUA 3ED5A 2XGQA 2HOFA 4AP9A 1WCLA 4DOAA 1XO0A 3NRZA 4US8A 4XRHA 4ECXA 7ICHA 1NI3A 5KG6A 4RQ8A 4GXIA 5KL1B 2HOQA 4ECRA 8ICJA 1S0NA 2QARA 3LWMA 3Q8LA 1LKYB 2OCEA 2XIDA 5J0YA 3MFHA 2PMZC 4O3MA 4DQPA 3QU4A 4YR0A 1NKEA 2LM1A 1X9MA 3IRUA 1J97A 2ZIUB 1X6JA 1QSLA 4KX3A 4JV1A 5AKLA 5H2FU 4KTQA 2RHFA 3NUQA 5L1MA 4DSLA 2YY6A 5B66U 1M6YA 5HR6A 4QZBA 4YMOA 1NK6A 4B9SA 4DCCA 1ZQQA 4JMUA 3F2BA 4P0PB 3RB6A 1XS9D 3TACB 4MFCA 3QEAZ 1HEKA 3IP4B 2ZIVA 5KT3A 4RQ6A 1L7OA 4Q45A 4MFAA 3O0FA 2AU0A 9ICXA 4KX5A 3M9NB 3PO5A 2AH5A 1L3TA 3QUCA 4C7ZA 3QYPA 1RYRA 9ICRA 1HUOA 5KFCA 3QZ7A 4YMNA 2LYBA 1ZQFA 4Y2YA 3QUBA 4Q8FA 2NO4A 2AQ0A 2R8JA 3KTQA 2R18A 1SV0C 2YB4A 4DFDA 2VJ4A 4TUPA 3OJUA 5DGAA 2ZXHA 4FZLA 4RQ0A 2HBMA 3AU6A 3UQ0A 3T5LA 2KE7A 4DQQA 1QSYA 2RRDA 3TKAA 1UA1A 4R8UA 1B22A 3IG5A 2EAPA 4UB5A 3V7JA 2MU2A 1Q3VA 1QQ6A 3A0BU 5AICA 8ICGA 2BDPA 2KG5A 7ICIA 2KICA 5KFTA 5DQHA 1B4FA 4J9QA 1QTMA 5K4LA 1RG6A 2QARB 4DS4A 8ICWA 4UB8U 1XSPA 2OEHA 3ZD8A 1UT8A 4TQRA 2C2RA 3RB0A 1MQ2A 3OSNA 2KN7A 3T3FA 2PFQA 1N56A 1Q8KA 4FS2A 4B9MA 4UARA 2ZTCA 2EZYA 2E3TA 3QE9Y 3HRDD 3QU5A 5ALXA 7ICJA 4OJPA 4YXMA 3BZKA 4I2JA 3Q8KA 8ICVA 2ISPA 4OJLA 3GV8B 1JX4A 4NLBA 3UQ2A 9ICPA 5EWGA 2KSOA 2ES6A 5HNKA 4YN4A 3V6KA 3HWTA 2BCVA 2ZJAA 4PHPA 4K4HA 7ICMA 1V85A 2RQ5A 2KZZA 7ICOA 3GU3A 5EE0A 3IG8A 3H0LB 4J9RA 5J0QA 3M7DA 5G5HA 3D6JA 1XWLA 2W43A 4IQVA 1RDFA 3Q8SB 5CRXA 3SMVA 2ZIXA 5EE3A 9ICOA 5EWEA 2WF6A 5KFFA 4IRKA 3PV8A 5DLGA 1SV4A 5ALMA 3SV4A 4R8UB 4ED2A 2IOHA 2K4EA 3EZ5A 2W11A 1Z00A 2A1JA 3T5HA 3C21A 7ICKA 4F5NA 3IHQB 4PGYA 5ALSA 1EXNA 2KOBA 9ICAA 5ALDA 5ALKA 2HW3A 1JIHA 1UPHA 2ZG6A 3EW9A 1ZQLA 1MC8A 3UXNA 2LM4A 3C5GA 2HSZA 4AYBF 5AI4A 2DGZA 4PGQA 2G0AA 2O6KA 2EAMA 1VDVA 4HYKA 5EE9A 1T3NA 3JPRA 2HBLA 2VIXA 1S97A 3G6YA 1T3QA 4QZ8A 1ZQRA 1KW4A 3NGDA 1NZPA 5CWRA 2G5HB 3NRWA 3TADA 4QWAA 1XSNA 1C7YA 2OWOA 3GIMA 9ICHA 3N7RC 1ZJNA 4QZHA 2KZMA 2HHXA 3V72A 3RR7A 1ZQEA 3J81j 5GTHU 3RF9A 3E2EA 4I2HA 1SXDA 5CHGA 7ICLA 2KSOB 4F5OA 5F9NA 2AGPA 1L6NA 4P2HA 1X2IA 4KMOB 4UQGA 8ICFA 2ASJA 4B9TA 4F4WA 4KN4A 2MUTB 5ALUA 4QIWC 3F2CA 1SB3C 3C28A 4G3IA 2V4QA 1NK9A 2HOIA 3PO4A 4EZ6A 5D46A 2NRTA 3SD7A 2K8BB 5J2JA 9ICUA 3UMGA 3G6XA 1WYGA 2Y9TA 3GIKA 2W8LA 4BDPA 5KFOA 3T79A 2ZIXB 5AM0A 5CB1A 4O5KA 2HBJA 3WKCA 4I2BA 5KFIA 2BHNA 1SZHA 3WKDA 2EANA 4CGZA 5AKXA 5AI5A 2EH9A 9ICMA 3RFAA 3UXPA 1KEJA 1XSLA 3BS5A 4M9GA 1Z00B 2A1JB 5KG0A 3JPSA 2BPCA 1S76D 1DGSA 2ZTEA 2WB1F 2I5HA 5AM1A 2DKZA 2Y1IA 2DPIA 3Q8QB 4KLJA 1ZQOA 4RUCA 3N7PD 5ALEA 1KL9A 4XUSA 3VCBA 1S9FA 5AM3A 3U26A 4J03A 3BQ1A 2BPFA 4PHDA 2HHUA 5IINA 1SGGA 1RZTA 1U47A 5ALIA 3Q8MA 3PW5A 3LWLA 1ZRNA 4UAWA 1TFRA 4DFKA 4J9PA 4ECTA 1MN8A 2D8CA 5J0UA 3M9MB 3RH4A 3B0XA 1ZQDA 2V9WA 2H3FA 2LKYA 2OYYA 3BQ0A 4J9LA 2PKEA 4PZOA 2KK0A 5HMLA 1ZD4A 1N2XA 3FM9A 3ORYA 4EENA 5KG3A 1KRPA 3K1RB 5KFKA 3SENA 1S8OA 2C2EA 2HHVA 4OJ5A 4ZOHC 1ZYQA 2QLTA 3HKZF 1ZQCA 1SZPA 2MSNA 3GV5B 2HI0A 5G5GA 2EZXA 3K4GA 3AU2A 2NRXA 1F0MA 1N5XA 2NRVA 2ATLA 4DL2A 1DRGA 4DL6A 1TK5A 1B0XA 1A6SA 2ZJ8A 2B6GA 2EQYA 5AM5A 4QZEA 3GZFA 4BGDA 2WF9A 4DQSA 4KLSA 4EYIB 3RJGA 4BX9C 4J9NA 5IIIA 1ZD5A 4KMUA 2P6RA 1FO4A 2ZUCA 1KSPA 4IS7A 1NKCA 3MDAA 3MGHA 4JV0A 3BS5B 2F2AB 1MSWD 2K4PA 1COKA 2YB1A 4FFDA 1RXWA 4QWDA 4YMMA 5CA7A 5HR7A 2XGPA 5KFWA 4Y2UA 4TQSA 4BJQA 2W9BA 3THVA 3F5EA 1J2MA 1ZQHA 4Y2RA 3SYZA 1Q46A 3H4DA 5KFGA 1UCVA 5DB6A 4NM1A 1X9WA 1X40A 3I28A 1QCKA 3F2DA 2F1HA 2JEFA 5DDMA 3CRXA 3BS7A 4DFJA 3M6KA 4DL5A 5KG1A 1YT3A 3GDXA 5KFXA 2OM6A 2PFOA 4GC6A 1X6IA 4GC7A 4YXJA 4Z6CA 1HIWA 4EZ9A 4F5QA 2F1JA 2AGOA 4RZRA 5CJ7A 8ICRA 4EX6A 4M2YA 1UQVA 2JH7A 5ALVA 4B9NA 4O3OA 3OTQA 2JEGA 2K4HA 4I29A 5ALZA 2DF4B 2M0NA 4PPXA 3N28A 3CNHA 5KAFU 1N63A 1SKRA 1DK3A 1CUKA 3HT3A 1J2NA 8ICEA 5AKZA 1AROP 5HHHA 8ICNA 5AI6A 2DQNB 1NK4A 2CXYA 4YD2A 4KLHA 4C8MA 5IIJA 3AN1A 4R66A 5KT5A 3NS1A 2BCSA 3PSTA 1VJ5A 2HVHA 3ETRA 3PSIA 3L5KA 3H0RB 5AK5A 2HVIA 3HJEA 4J9SA 4GXJA 4Q8EA 4LZGA 1ZQPA 5DQGA 1QSSA 4RQ4A 4MFFA 2VA3A 1ZQAA 1WWUA 4NV0A 5AKYA 2CN1A 2W9BB 3H40A 2YMMA 3H8MA 3GV7B 3K75D 4KLUA 4I2GA 1JMSA 2LYAA 3BQTA 9ICGA 3RJHA 2XICA 1UA0A 1WCNA 2UVRA 2FPLA 4GXKA 3PW4A 2YMLA 4ELUA 1JRPA 3ETLA 5HHIA 3QUTA 1TKDA 2ZJ5A 3C1YA 3ZDDA 8ICKA 3B9JA 2HMXA 5ALLA 3MR3A 4C8OA 5JUMA 3OHAA 4YVZA 1OXJA 7ICEA 1ZQWA 4O3NA 2GH1A 4EEYA 1KQQA 4YR2A 1ECWA 5KFNA 4OD0A 2IA6A 2R8IA 2KNJA 1ZQNA 4QZIA 4KLTA 3D2SA 5J8YC 3QXGA 2GWSA 4RQ3A 1TAMA 9ICSA 4F50A 3C23A 1ZQJA 3AQFA 4NL9A 5TISU 1Q3UA 2NRWA 2JMGA 2J6UA 4M9LA 4C4SA 1L8LA 5KNIA 3Q8RB 2ALZA 5KG2A 4M9JA 4R63A 1X66A 4I2IA 1N60A 3CYMA 2A3VA 2ISOA 1K1QA 3KD3A 5F3XB 3HW8A 4UB6U 9ICEA 3OPXA 4P4MA 1D8BA 3PX6A 3RH6A 3RB4A 4GLXA 1ZETA 1XNSA 5KFZA 1JI7A 4NY8A 1AQ6A 3TFRA 5KFYA 1PVRA 1RPLA 1S0OA 3SEIA 4DSFA 5KG5A 2L5YA 1S77D 1JALA 4BXOA 1PUZA 3FC4A 3LVWA 3WKBA 4F71A 2F1IA 3PSPA 2OH2A 4NLKA 2ZIVB 8ICZA 5AI0A 1B43A 4JWNA 5KT7A 4OO1J 4Y2TA 1L7NA 1SL0A 3KKAA 2LHTA 4F4ZA 4DFPA 5ALNA 3ZDBA 2ZIWA 1RXVA 2P6UA 2XI9A 3SAHA 3C2MA 4LZDA 2FMSA 4UBBA 4B9LA 1BNPA 4NJ8A 2A19A 4I28A 3KBBA 2R8GA 3L3FX 3AM9A 1KTQA 4RNMA 1H38A 1ZOLA 4DSIA 5AM4A 4QWBA 5HMMA 8ICPA 8ICXA 4CRXA 5ALYA 2C22A 1QLNA 2VA2A 1F5SA 4PHAA 3KOOA 2DUYA 2KKVA 3N7SC 3PW7A 5GTIU 5AK3A 2BCUA 7ICQA 4LVSA 2JEIA 4WJ3B 1TVAA 2CRXA 2YTUA 4Y2VA 2R8KA 3PR5B 4Y2JA 2KHQA 3WU2U 4DEZA 3TAQA 2W55A 3R9KA 2BQ3A 4M47A 3SAGA 3GILA 1NK8A 1NK0A 1RQLA 3RJKA 3UMCA 5KFMA 1XU4A 1D8LA 4IQUA 3EPGA 4YP3A 2BKEA 2A1AA 2GLEA 4IR1A 2BQRA 2W04A 5AKHA 3KHGA 3HP6A 2WAQF 3TI0A 2MA1A 3OSPA 4TURA 4M6WA 3GFKB 7ICFA 5F9LA 2FLPA 4K4GA 4AYBC 9ICKA 1Z3EB 2Q4TA 2IHNA 5ALOA 4KLQA 3H0MB 3MABA 4QZGA 2I6XA 4ECSA 4BXOB 4ED8A 4A8EA 1ZQYA 3PR4A 3JPNA 3TARA 4C8LA 2BQUA 2W3SA 2OHFA 3QZ8A 5J2KA 1O08A 2G5IB 2H3QA 2ZIWB 3NTUA 2GO7A 2JEJA 1S0VA 2E1FA 1TV9A 4UAZA 5AK6A 4DQIA 4C0ZA 3MDCA 3JPOA 5KT4A 1OW5A 4KLDA 5J2GA 4RQ5A 3MBYA 1TK0A 2VKQA 2XVTA 4TUSA 1IXRA 2F3NA 1ZQZA 2RDJA 2VJ5A 2XCAA 3KZXA 1V38A 2K89A 2WF5A 2V4RA 5J2HA 4UW9A 1X9XA 2F8KA 4C7YA 1XC9A 3L4PA 1YZ7A 1SWWA 1ZQIA 4GIBA 8ICSA 1BPBA 1F44A 3TFSA 4ACOA 2FDRA 5FP0A 2KJ8A 4IQWA 8ICUA 1LV5A 4CNQA 4PJ0U 2ZTDA 4JUZA 2K4IA 4J9MA 3RAXA 3IN5A 4XQ8A 4Z6DA 1NJZA 4BWJA 4ECZA 3MFIA 4JB3A 2N1RA 4RT3A 1NJYA 5J0WA 1LB2B 4O9MA 4PGXA 3LDAA 5KT6A 4CF5A 3ISDA 1FIQA 1RYSA 3JPQA 4P4OA 1ZQGA 1NZBA 1FEZA 5KFQA 2WB1C 2FE9A 2JXJA 2GOLA 4QZAA 4DLEA 4F4XA 4M6WB 4DQRA 9ICJA 3T5KA 2YN4A 3FYHA 4P4PA 7ICRA 2W9CA 3QUQA 1Z4NA 1PK3A 3H7IA 3C5FA 4UAVA 1O03A 4F93B 3M9OB 3WKEA 4ELVA 1LVHA 2JR5A 3PX4A 2KKPA 3HILA 7ICUA 4QNLA 2AGQA 2E8OA 4YCXA 3C2LA 2C28A 3PW2A 4ED6A 1T94A 4HAIA 5ALPA 1CI4A 3BJYA 2ASDA 2K8CB 5AKIA 4Y2QA 1ZQMA 3SZ2A 4CCHA 2PI4A 3GIIA 3RJEA 3QNMA 5J2DA 4CF4A 1PVQA 3RB3A 5J0SA 2QB0A 5C0YA 3KHHA 3ALRA 4MHVA 5TZVA 1YZ6A 4C4RA 4M9HA 1L7MA 5KFDA 4B9UA 4I2CA 2Y0SF 1HJPA 2JHDA 1CEZA 4RPZA 1BNOA 1T7PA 1NJWA 8ICAA 5DLFA 4QWEA 3HKZC 3TADC 3WK6A 2IOFA 4KLOA 4O5CA 4UAUA 3TAPA 3WK7A 4RNNA 4EYHB 2HHSA 2BZFA 1ZJMA 1SV0A 1U48A 4O3RA 1WG8A 5BPCA 5A0LA 3OHBA 4NM2A 1U9LA 5J2CA 2Q0ZX 3KHRA 4KLMA 4CE6A 2E8MA 3CP8A 4ED7A 3AQEA 4EBDA 2W8KA 5KL8B 5J2BA 5L1JA 4DFMA 1D9FA 3G6VA 4Y2PA 5KT2A 3ISBA 4BWMA 4X5VA 3QX7A 5DBCA 4YFKA 5L1IA 2RDIA 4MF2A 1P7DA 2BCRA 5IILA 4P0PA 4UAYA 2KEYA 5KFSA 3BDPA 8ICTA 3IM1A 2E8NA 4KITB 4F3OA 5CP2A 3LYSA 2WTFA 4F8RA 1A76A 1BPDA 1L3UA 1IV8A 5J0OA 3KFUF 1SXEA 3I76A 3H8WA 5DBBA 2EZZA 5AIAA 3PNCA 1ZD3A 2ASLA 4PHEA 2FLLA 3Q8PB 4KLGA 8ICMA 1GO3F 4EX7A 1V97A 2H3IA 3FDSA 2KFZA 1K5OA 5JU5A 5DQIA 3I1YA 2QB0B 2XY5A 4KLFA 3PMLA 4DOCA 2DWQA 1S10A 1PVPA 4UB4A 4UB3A 4FO6A 2G08A 3BZCA 2W03A 3SR6A 2PMZF 3WK9A 3MC1A 5KFPA 4DWIA 2HCFA 3ZDCA 5KFRA 2KHVA 3M1YA 5B5EU 2QB1A 4DSEA 9ICCA 1L8OA 2JGAA 3MR6A 1T4GA 2D3DA 1SIJA 4QZFA 4USAA 3UMBA 1KFTA 3SI8A 3HPOA 1KDHA 1ZRMA 4MEXA 1Z19A 2XC9A 4F72A 2W7PA 4ED3A 4YG2A 4FZNA 4RQ7A 8ICLA 2FJ6A 3B0YA 4ECUA 4KN7A 5J0XA 2NRZA 1SWVA 2ESEA 2KVCA 2LPEA 2AQ4A 4F5RA 5AHXA 1MA7A 5AKKA 2LI6A 2FMPA 2UVWA 3MGVA 3RR8A 3IV6A 1L7PA 4XA5A 2W9MA 4IRDA 4RQ2A 4UB2A 5DGBA 4J9OA 4UATA 4DF4A 3PX0A 3AL0B 2B0CA 3C2KA 2DL0A 2OXOA 1V9PA 2IHMA 4F92B 2JV3A 3V7KA 4JK1A 1OUQA 1NNLA 3RJJA 1U49A 3V6JA 4DSKA 2KTQA 2MRLA 3WK4A 5DDYA 1UT5A 3QU9A 4OJOA 9ICQA 4PL1A 4IQTA 4QZ9A 1X9SA 3RBEA 3F53A 1BPZA 2FI1A 3C1ZA 5ALFA 1U4BA 4C80A 3H8JA 1ZQ1C 2XY7A 2ZUBA 2JH1A 2I1QA 4FBUA 4I2DA 3OJSA 5E79U 4R65A 2EAOA 3IDWA 5DB8A 3BQ7A 4QW9A 1TAUA 2EDUA 2MAXA 4K4IA 3QU2A 5BOMA 3K1ZA 5ALJA 4DL3A 5JTIA 5KFJA 4EBEA 5DBAA 4M04A 4O3SA 3SV3A 4EBCA 3WKAA 1KFDA 1ZQBA 2ODGA 2KZ3A 2AJQA 4O3QA 4G9BA 4EELA 2F8LA 5EOZA 4US9A 4NWIA 1QQ5A 2Y9UA 2G07A 3KHLA 4IR9A 4DL7A 4B6JA 4I2EA 5IIOA 4KLEA 1KN5A 1TAQA 2F77X 4CDGA 1JXLA 4F5PA 2QKQA 1ZQVA 2HDOA 2CPRA 1SL1A 4Q43A 4NLZA 1FFVA 3JPTA 5KFLA 1IM4A 5KFVA 4DSJA
chains in the Genus database with same CATH topology
3KKAC 2QARA 1UQVA 1B0XA 1LKYB 1B4FA 5J8YA 2EANA 4RQNA 2B6GA 2E8NA 5JRTA 2DL0A 1RG6A 2QARB 3BS5A 1OW5A 2JV3A 1SXEA 5J8YC 2EAMA 4IS7A 2DKZA 2DKXA 2F3NA 3BS5B 2K4PA 2QB0A 5L1MA 1COKA 1V38A 2KMDA 4MHVA 4NL9A 1KW4A 2LMRA 2KIVA 2YTUA 5JU5A 3TADA 1WWVA 1SGGA 5KNIA 1X9XA 2QB0B 2F8KA 3TACB 1X66A 1Z1VA 2EAOA 4NL9C 3IDWA 2F44A 3BQ7A 5F3XB 3TADC 2KSOA 2QB1A 1WWUA 2D8CA 1UCVA 1PK1A 2ES6A 5JTIA 2D3DA 1SV0A 3H8MA 1X40A 1SXDA 1JI7A 2KSOB 1V85A 2GLEA 1PK1B 3BS7A 4PZOA 1DXSA 1SV0C 2E8MA 3SEIA 2L5YA 2Y9UA 4PZNA 2FE9A 3K1RB 2KE7A 2K60A 2E8PA 3SENA 3KKAA 1PK3A 2EAPA 2ESEA 2LPEA 2QKQA 1LKYA 4RQMA 3HILA 1SV4A 1OXJA 2E8OA 2Y9TA 1F0MA 2KG5A 4NJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKA C;  2QAR A;  1UQV A;  1B0X A;  1LKY B;  1B4F A;  5J8Y A;  2EAN A;  4RQN A;  2B6G A;  2E8N A;  5JRT A;  2DL0 A;  1RG6 A;  2QAR B;  3BS5 A;  1OW5 A;  2JV3 A;  1SXE A;  5J8Y C;  2EAM A;  4IS7 A;  2DKZ A;  2DKX A;  2F3N A;  3BS5 B;  2K4P A;  2QB0 A;  5L1M A;  1COK A;  1V38 A;  2KMD A;  4MHV A;  4NL9 A;  1KW4 A;  2LMR A;  2KIV A;  2YTU A;  5JU5 A;  3TAD A;  1WWV A;  1SGG A;  5KNI A;  1X9X A;  2QB0 B;  2F8K A;  3TAC B;  1X66 A;  1Z1V A;  2EAO A;  4NL9 C;  3IDW A;  2F44 A;  3BQ7 A;  5F3X B;  3TAD C;  2KSO A;  2QB1 A;  1WWU A;  2D8C A;  1UCV A;  1PK1 A;  2ES6 A;  5JTI A;  2D3D A;  1SV0 A;  3H8M A;  1X40 A;  1SXD A;  1JI7 A;  2KSO B;  1V85 A;  2GLE A;  1PK1 B;  3BS7 A;  4PZO A;  1DXS A;  1SV0 C;  2E8M A;  3SEI A;  2L5Y A;  2Y9U A;  4PZN A;  2FE9 A;  3K1R B;  2KE7 A;  2K60 A;  2E8P A;  3SEN A;  3KKA A;  1PK3 A;  2EAP A;  2ESE A;  2LPE A;  2QKQ A;  1LKY A;  4RQM A;  3HIL A;  1SV4 A;  1OXJ A;  2E8O A;  2Y9T A;  1F0M A;  2KG5 A;  4NJ8 A; 
#chains in the Genus database with same CATH topology
 5HP4 A;  8ICO A;  5DKW A;  3GIJ A;  4F2S A;  4FZM A;  2VA8 A;  3F5A A;  4YD1 A;  3EUB 2;  2WF8 A;  3ZDE A;  2BPG A;  2Y1J A;  2W3R A;  5AI8 A;  3PSF A;  5KG7 A;  3DV9 A;  1L5U A;  5KTQ A;  3UPQ A;  1FFU A;  2IBK A;  4ECV A;  1KLN A;  2NO5 A;  1A0P A;  5AKJ A;  3RBD A;  9ICB A;  5ALQ A;  4ED0 A;  2NYV A;  2DPJ A;  4ZH4 A;  4OCZ A;  2LMR A;  3DDH A;  2IOF K;  2KIV A;  4R64 A;  4M0A A;  1ZQX A;  4U7C A;  2FPK A;  4M9N A;  2MUT A;  4J9K A;  3SQI A;  1PZN A;  1JUD A;  1BPE A;  2F44 A;  3MR2 A;  4DO9 A;  2UVV A;  4MEY A;  2KP7 A;  1U45 A;  2H5X A;  3JPP A;  1WUD A;  2KJ9 A;  1URJ A;  3PMN A;  3PVX A;  2PXI A;  4C8K A;  3E0F A;  3KZI U;  2RP5 A;  2VAN A;  2R8H A;  3A0H U;  2ZXI A;  5BOL A;  8ICH A;  5L9X A;  1N48 A;  3ZDA A;  3VC8 A;  3H4B A;  8ICQ A;  2HHW A;  3E58 A;  1SL2 A;  2P35 A;  4MF8 A;  4PZN A;  2WHE A;  3V6H A;  3D2N A;  1ZQK A;  4RPX A;  5AIB A;  4QWC A;  7ICP A;  3QEB Z;  2K60 A;  4DOB A;  1BVS A;  1Y88 A;  2E8P A;  2NV3 A;  4BUG A;  2AHO B;  2HHQ A;  1JN3 A;  1IIP A;  4JWM A;  2LYH A;  4RNO A;  4E0D A;  2XCP A;  2DFL A;  7ICN A;  3RRH A;  4FE3 A;  1Z4O A;  4ICA A;  8ICB A;  1DGJ A;  4U6P A;  3HX0 A;  1QQ7 A;  1D8Y A;  1MQ3 A;  4NLG A;  4F2R A;  2KIW A;  1D9D A;  3AEV A;  1HUZ A;  5DB7 A;  5ALT A;  3RH5 A;  5ALR A;  4RQ1 A;  3PY8 A;  3LK9 A;  4TUQ A;  1ZXI A;  1L3V A;  3NVZ A;  4QIW F;  1NJX A;  2B21 A;  4ED1 A;  3EYZ A;  5L1K A;  5AM2 A;  1DOQ A;  4P0Q A;  3PW0 A;  9ICL A;  1N62 A;  4UBC A;  1BPX A;  4YQW A;  4IRC A;  2WAQ C;  2KMD A;  2YQE A;  3ISC A;  4Z6E A;  3TAN A;  1RM6 C;  1ZQS A;  1NOM A;  3RTV A;  8ICI A;  3RAQ A;  2BR0 A;  1SKS A;  4DLG A;  5DG8 A;  1Z1V A;  4NL9 C;  8ICY A;  5J2F A;  4F4Y A;  1COO A;  5AKG A;  3QU7 A;  3CW2 C;  1PK1 A;  2BDU A;  2YMP A;  1S5L U;  2RLT A;  2E1E A;  1NKB A;  2PFN A;  1C20 A;  2Z7J A;  2FPM A;  9ICV A;  1ZQU A;  5KG4 A;  5CR0 A;  1N5W A;  4ECQ A;  4F4K A;  3GQC A;  5D49 A;  1N61 A;  4OJ6 A;  5KFA A;  2XO7 A;  5KFB A;  3M8R A;  2WF7 A;  3ICX A;  3AUO A;  2J6S A;  2C2D A;  4RQM A;  1NK5 A;  4RPY A;  3NVW A;  2G09 A;  2D6F C;  2LBO A;  1K1S A;  3KKA C;  1XO1 A;  4Z6F A;  5L1L A;  4NLC A;  3DEE A;  5DG7 A;  3FAH A;  2HBK A;  2KD1 A;  3NVV A;  5JRT A;  4ELT A;  2JZB A;  2W7O A;  2H3Z A;  2W54 A;  5T14 A;  1JRO A;  2IMW P;  4LJX A;  3PZP A;  4QW8 A;  4RUA A;  5C5J A;  1KFS A;  5KFU A;  3H8S A;  5IIK A;  9ICI A;  5J2E A;  5AK4 A;  3NAS A;  5J0R A;  2PI5 A;  4I27 A;  4KLI A;  5AI9 A;  2ZUD A;  3ONN A;  4P0Q B;  5IIM A;  4B9V A;  4KLL A;  5CEH A;  2H3V A;  2E5S A;  2K8A A;  4IL6 U;  2J6T A;  5AKE A;  2HHT A;  4Y2X A;  4JV2 A;  5KAI U;  4FS1 A;  4PL2 A;  2PFP A;  4UAS A;  1ZD2 P;  1TK8 A;  4YR3 A;  1JXE A;  5ALG A;  1SKW A;  1BGX T;  4GFJ A;  2KFN A;  5EE1 A;  5KFH A;  3AMZ A;  1PK1 B;  4CF3 A;  3MGI A;  1ED1 A;  7ICG A;  1VLB A;  5ALW A;  3OGU A;  3ZI4 A;  4QZC A;  4PH5 A;  2BCQ A;  3UXO A;  3V7L A;  4I2A A;  1NK7 A;  4F91 B;  3BQ2 A;  3RJF A;  4NXZ A;  2JRZ A;  4QJF B;  2G06 A;  5J0P A;  2M9N A;  4O0I A;  4O3P A;  1TE2 A;  3ZD9 A;  2DBY A;  2FLN A;  3N4M B;  1ZQT A;  2AXT U;  3C29 A;  4QZD A;  4Y2S A;  4NLN A;  3N97 B;  5ALH A;  1LKY A;  1RYU A;  3LVV A;  3RRG A;  4IC9 A;  2FMQ A;  2YMQ A;  2Y0S C;  3S6J A;  4C4T A;  4C8N A;  2F76 X;  3M8S A;  1BPY A;  1DK2 A;  4ECY A;  5J8Y A;  2ZIU A;  4RQN A;  3EPI A;  4UB1 A;  4RT2 A;  2W9A A;  9ICN A;  5D4B A;  2KVS A;  4DL4 A;  3NVY A;  5KFE A;  2JZB B;  2DKX A;  2WFA A;  9ICT A;  3RJI A;  1X42 A;  5J0T A;  3WK5 A;  5J2A A;  2W9C B;  1KKX A;  2P66 A;  4FBT A;  3D2Q A;  5DB9 A;  9ICF A;  1T8E A;  2KV2 A;  1A77 A;  3EWA A;  4RU9 A;  3MR5 A;  2UVU A;  1WWV A;  5DG9 A;  4ECW A;  5EWF A;  4DF8 A;  3SAF A;  1QH9 A;  4EEK A;  7ICT A;  2XY6 A;  3TQ1 A;  1Z1B A;  4Q44 A;  4O5E A;  3WK8 A;  4DS5 A;  1S0M A;  8ICC A;  7ICS A;  1RQN A;  1L3S A;  5J29 A;  3M6Z A;  2I9G A;  2KJ5 A;  1IG6 A;  3T5J A;  1DXS A;  1CRX A;  3UM9 A;  9ICW A;  2YX8 A;  2BGW A;  4I2F A;  7ICV A;  5J2I A;  1KBU A;  1UHU A;  3ED5 A;  2XGQ A;  2HOF A;  4AP9 A;  1WCL A;  4DOA A;  1XO0 A;  3NRZ A;  4US8 A;  4XRH A;  4ECX A;  7ICH A;  1NI3 A;  5KG6 A;  4RQ8 A;  4GXI A;  5KL1 B;  2HOQ A;  4ECR A;  8ICJ A;  1S0N A;  2QAR A;  3LWM A;  3Q8L A;  1LKY B;  2OCE A;  2XID A;  5J0Y A;  3MFH A;  2PMZ C;  4O3M A;  4DQP A;  3QU4 A;  4YR0 A;  1NKE A;  2LM1 A;  1X9M A;  3IRU A;  1J97 A;  2ZIU B;  1X6J A;  1QSL A;  4KX3 A;  4JV1 A;  5AKL A;  5H2F U;  4KTQ A;  2RHF A;  3NUQ A;  5L1M A;  4DSL A;  2YY6 A;  5B66 U;  1M6Y A;  5HR6 A;  4QZB A;  4YMO A;  1NK6 A;  4B9S A;  4DCC A;  1ZQQ A;  4JMU A;  3F2B A;  4P0P B;  3RB6 A;  1XS9 D;  3TAC B;  4MFC A;  3QEA Z;  1HEK A;  3IP4 B;  2ZIV A;  5KT3 A;  4RQ6 A;  1L7O A;  4Q45 A;  4MFA A;  3O0F A;  2AU0 A;  9ICX A;  4KX5 A;  3M9N B;  3PO5 A;  2AH5 A;  1L3T A;  3QUC A;  4C7Z A;  3QYP A;  1RYR A;  9ICR A;  1HUO A;  5KFC A;  3QZ7 A;  4YMN A;  2LYB A;  1ZQF A;  4Y2Y A;  3QUB A;  4Q8F A;  2NO4 A;  2AQ0 A;  2R8J A;  3KTQ A;  2R18 A;  1SV0 C;  2YB4 A;  4DFD A;  2VJ4 A;  4TUP A;  3OJU A;  5DGA A;  2ZXH A;  4FZL A;  4RQ0 A;  2HBM A;  3AU6 A;  3UQ0 A;  3T5L A;  2KE7 A;  4DQQ A;  1QSY A;  2RRD A;  3TKA A;  1UA1 A;  4R8U A;  1B22 A;  3IG5 A;  2EAP A;  4UB5 A;  3V7J A;  2MU2 A;  1Q3V A;  1QQ6 A;  3A0B U;  5AIC A;  8ICG A;  2BDP A;  2KG5 A;  7ICI A;  2KIC A;  5KFT A;  5DQH A;  1B4F A;  4J9Q A;  1QTM A;  5K4L A;  1RG6 A;  2QAR B;  4DS4 A;  8ICW A;  4UB8 U;  1XSP A;  2OEH A;  3ZD8 A;  1UT8 A;  4TQR A;  2C2R A;  3RB0 A;  1MQ2 A;  3OSN A;  2KN7 A;  3T3F A;  2PFQ A;  1N56 A;  1Q8K A;  4FS2 A;  4B9M A;  4UAR A;  2ZTC A;  2EZY A;  2E3T A;  3QE9 Y;  3HRD D;  3QU5 A;  5ALX A;  7ICJ A;  4OJP A;  4YXM A;  3BZK A;  4I2J A;  3Q8K A;  8ICV A;  2ISP A;  4OJL A;  3GV8 B;  1JX4 A;  4NLB A;  3UQ2 A;  9ICP A;  5EWG A;  2KSO A;  2ES6 A;  5HNK A;  4YN4 A;  3V6K A;  3HWT A;  2BCV A;  2ZJA A;  4PHP A;  4K4H A;  7ICM A;  1V85 A;  2RQ5 A;  2KZZ A;  7ICO A;  3GU3 A;  5EE0 A;  3IG8 A;  3H0L B;  4J9R A;  5J0Q A;  3M7D A;  5G5H A;  3D6J A;  1XWL A;  2W43 A;  4IQV A;  1RDF A;  3Q8S B;  5CRX A;  3SMV A;  2ZIX A;  5EE3 A;  9ICO A;  5EWE A;  2WF6 A;  5KFF A;  4IRK A;  3PV8 A;  5DLG A;  1SV4 A;  5ALM A;  3SV4 A;  4R8U B;  4ED2 A;  2IOH A;  2K4E A;  3EZ5 A;  2W11 A;  1Z00 A;  2A1J A;  3T5H A;  3C21 A;  7ICK A;  4F5N A;  3IHQ B;  4PGY A;  5ALS A;  1EXN A;  2KOB A;  9ICA A;  5ALD A;  5ALK A;  2HW3 A;  1JIH A;  1UPH A;  2ZG6 A;  3EW9 A;  1ZQL A;  1MC8 A;  3UXN A;  2LM4 A;  3C5G A;  2HSZ A;  4AYB F;  5AI4 A;  2DGZ A;  4PGQ A;  2G0A A;  2O6K A;  2EAM A;  1VDV A;  4HYK A;  5EE9 A;  1T3N A;  3JPR A;  2HBL A;  2VIX A;  1S97 A;  3G6Y A;  1T3Q A;  4QZ8 A;  1ZQR A;  1KW4 A;  3NGD A;  1NZP A;  5CWR A;  2G5H B;  3NRW A;  3TAD A;  4QWA A;  1XSN A;  1C7Y A;  2OWO A;  3GIM A;  9ICH A;  3N7R C;  1ZJN A;  4QZH A;  2KZM A;  2HHX A;  3V72 A;  3RR7 A;  1ZQE A;  3J81 j;  5GTH U;  3RF9 A;  3E2E A;  4I2H A;  1SXD A;  5CHG A;  7ICL A;  2KSO B;  4F5O A;  5F9N A;  2AGP A;  1L6N A;  4P2H A;  1X2I A;  4KMO B;  4UQG A;  8ICF A;  2ASJ A;  4B9T A;  4F4W A;  4KN4 A;  2MUT B;  5ALU A;  4QIW C;  3F2C A;  1SB3 C;  3C28 A;  4G3I A;  2V4Q A;  1NK9 A;  2HOI A;  3PO4 A;  4EZ6 A;  5D46 A;  2NRT A;  3SD7 A;  2K8B B;  5J2J A;  9ICU A;  3UMG A;  3G6X A;  1WYG A;  2Y9T A;  3GIK A;  2W8L A;  4BDP A;  5KFO A;  3T79 A;  2ZIX B;  5AM0 A;  5CB1 A;  4O5K A;  2HBJ A;  3WKC A;  4I2B A;  5KFI A;  2BHN A;  1SZH A;  3WKD A;  2EAN A;  4CGZ A;  5AKX A;  5AI5 A;  2EH9 A;  9ICM A;  3RFA A;  3UXP A;  1KEJ A;  1XSL A;  3BS5 A;  4M9G A;  1Z00 B;  2A1J B;  5KG0 A;  3JPS A;  2BPC A;  1S76 D;  1DGS A;  2ZTE A;  2WB1 F;  2I5H A;  5AM1 A;  2DKZ A;  2Y1I A;  2DPI A;  3Q8Q B;  4KLJ A;  1ZQO A;  4RUC A;  3N7P D;  5ALE A;  1KL9 A;  4XUS A;  3VCB A;  1S9F A;  5AM3 A;  3U26 A;  4J03 A;  3BQ1 A;  2BPF A;  4PHD A;  2HHU A;  5IIN A;  1SGG A;  1RZT A;  1U47 A;  5ALI A;  3Q8M A;  3PW5 A;  3LWL A;  1ZRN A;  4UAW A;  1TFR A;  4DFK A;  4J9P A;  4ECT A;  1MN8 A;  2D8C A;  5J0U A;  3M9M B;  3RH4 A;  3B0X A;  1ZQD A;  2V9W A;  2H3F A;  2LKY A;  2OYY A;  3BQ0 A;  4J9L A;  2PKE A;  4PZO A;  2KK0 A;  5HML A;  1ZD4 A;  1N2X A;  3FM9 A;  3ORY A;  4EEN A;  5KG3 A;  1KRP A;  3K1R B;  5KFK A;  3SEN A;  1S8O A;  2C2E A;  2HHV A;  4OJ5 A;  4ZOH C;  1ZYQ A;  2QLT A;  3HKZ F;  1ZQC A;  1SZP A;  2MSN A;  3GV5 B;  2HI0 A;  5G5G A;  2EZX A;  3K4G A;  3AU2 A;  2NRX A;  1F0M A;  1N5X A;  2NRV A;  2ATL A;  4DL2 A;  1DRG A;  4DL6 A;  1TK5 A;  1B0X A;  1A6S A;  2ZJ8 A;  2B6G A;  2EQY A;  5AM5 A;  4QZE A;  3GZF A;  4BGD A;  2WF9 A;  4DQS A;  4KLS A;  4EYI B;  3RJG A;  4BX9 C;  4J9N A;  5III A;  1ZD5 A;  4KMU A;  2P6R A;  1FO4 A;  2ZUC A;  1KSP A;  4IS7 A;  1NKC A;  3MDA A;  3MGH A;  4JV0 A;  3BS5 B;  2F2A B;  1MSW D;  2K4P A;  1COK A;  2YB1 A;  4FFD A;  1RXW A;  4QWD A;  4YMM A;  5CA7 A;  5HR7 A;  2XGP A;  5KFW A;  4Y2U A;  4TQS A;  4BJQ A;  2W9B A;  3THV A;  3F5E A;  1J2M A;  1ZQH A;  4Y2R A;  3SYZ A;  1Q46 A;  3H4D A;  5KFG A;  1UCV A;  5DB6 A;  4NM1 A;  1X9W A;  1X40 A;  3I28 A;  1QCK A;  3F2D A;  2F1H A;  2JEF A;  5DDM A;  3CRX A;  3BS7 A;  4DFJ A;  3M6K A;  4DL5 A;  5KG1 A;  1YT3 A;  3GDX A;  5KFX A;  2OM6 A;  2PFO A;  4GC6 A;  1X6I A;  4GC7 A;  4YXJ A;  4Z6C A;  1HIW A;  4EZ9 A;  4F5Q A;  2F1J A;  2AGO A;  4RZR A;  5CJ7 A;  8ICR A;  4EX6 A;  4M2Y A;  1UQV A;  2JH7 A;  5ALV A;  4B9N A;  4O3O A;  3OTQ A;  2JEG A;  2K4H A;  4I29 A;  5ALZ A;  2DF4 B;  2M0N A;  4PPX A;  3N28 A;  3CNH A;  5KAF U;  1N63 A;  1SKR A;  1DK3 A;  1CUK A;  3HT3 A;  1J2N A;  8ICE A;  5AKZ A;  1ARO P;  5HHH A;  8ICN A;  5AI6 A;  2DQN B;  1NK4 A;  2CXY A;  4YD2 A;  4KLH A;  4C8M A;  5IIJ A;  3AN1 A;  4R66 A;  5KT5 A;  3NS1 A;  2BCS A;  3PST A;  1VJ5 A;  2HVH A;  3ETR A;  3PSI A;  3L5K A;  3H0R B;  5AK5 A;  2HVI A;  3HJE A;  4J9S A;  4GXJ A;  4Q8E A;  4LZG A;  1ZQP A;  5DQG A;  1QSS A;  4RQ4 A;  4MFF A;  2VA3 A;  1ZQA A;  1WWU A;  4NV0 A;  5AKY A;  2CN1 A;  2W9B B;  3H40 A;  2YMM A;  3H8M A;  3GV7 B;  3K75 D;  4KLU A;  4I2G A;  1JMS A;  2LYA A;  3BQT A;  9ICG A;  3RJH A;  2XIC A;  1UA0 A;  1WCN A;  2UVR A;  2FPL A;  4GXK A;  3PW4 A;  2YML A;  4ELU A;  1JRP A;  3ETL A;  5HHI A;  3QUT A;  1TKD A;  2ZJ5 A;  3C1Y A;  3ZDD A;  8ICK A;  3B9J A;  2HMX A;  5ALL A;  3MR3 A;  4C8O A;  5JUM A;  3OHA A;  4YVZ A;  1OXJ A;  7ICE A;  1ZQW A;  4O3N A;  2GH1 A;  4EEY A;  1KQQ A;  4YR2 A;  1ECW A;  5KFN A;  4OD0 A;  2IA6 A;  2R8I A;  2KNJ A;  1ZQN A;  4QZI A;  4KLT A;  3D2S A;  5J8Y C;  3QXG A;  2GWS A;  4RQ3 A;  1TAM A;  9ICS A;  4F50 A;  3C23 A;  1ZQJ A;  3AQF A;  4NL9 A;  5TIS U;  1Q3U A;  2NRW A;  2JMG A;  2J6U A;  4M9L A;  4C4S A;  1L8L A;  5KNI A;  3Q8R B;  2ALZ A;  5KG2 A;  4M9J A;  4R63 A;  1X66 A;  4I2I A;  1N60 A;  3CYM A;  2A3V A;  2ISO A;  1K1Q A;  3KD3 A;  5F3X B;  3HW8 A;  4UB6 U;  9ICE A;  3OPX A;  4P4M A;  1D8B A;  3PX6 A;  3RH6 A;  3RB4 A;  4GLX A;  1ZET A;  1XNS A;  5KFZ A;  1JI7 A;  4NY8 A;  1AQ6 A;  3TFR A;  5KFY A;  1PVR A;  1RPL A;  1S0O A;  3SEI A;  4DSF A;  5KG5 A;  2L5Y A;  1S77 D;  1JAL A;  4BXO A;  1PUZ A;  3FC4 A;  3LVW A;  3WKB A;  4F71 A;  2F1I A;  3PSP A;  2OH2 A;  4NLK A;  2ZIV B;  8ICZ A;  5AI0 A;  1B43 A;  4JWN A;  5KT7 A;  4OO1 J;  4Y2T A;  1L7N A;  1SL0 A;  3KKA A;  2LHT A;  4F4Z A;  4DFP A;  5ALN A;  3ZDB A;  2ZIW A;  1RXV A;  2P6U A;  2XI9 A;  3SAH A;  3C2M A;  4LZD A;  2FMS A;  4UBB A;  4B9L A;  1BNP A;  4NJ8 A;  2A19 A;  4I28 A;  3KBB A;  2R8G A;  3L3F X;  3AM9 A;  1KTQ A;  4RNM A;  1H38 A;  1ZOL A;  4DSI A;  5AM4 A;  4QWB A;  5HMM A;  8ICP A;  8ICX A;  4CRX A;  5ALY A;  2C22 A;  1QLN A;  2VA2 A;  1F5S A;  4PHA A;  3KOO A;  2DUY A;  2KKV A;  3N7S C;  3PW7 A;  5GTI U;  5AK3 A;  2BCU A;  7ICQ A;  4LVS A;  2JEI A;  4WJ3 B;  1TVA A;  2CRX A;  2YTU A;  4Y2V A;  2R8K A;  3PR5 B;  4Y2J A;  2KHQ A;  3WU2 U;  4DEZ A;  3TAQ A;  2W55 A;  3R9K A;  2BQ3 A;  4M47 A;  3SAG A;  3GIL A;  1NK8 A;  1NK0 A;  1RQL A;  3RJK A;  3UMC A;  5KFM A;  1XU4 A;  1D8L A;  4IQU A;  3EPG A;  4YP3 A;  2BKE A;  2A1A A;  2GLE A;  4IR1 A;  2BQR A;  2W04 A;  5AKH A;  3KHG A;  3HP6 A;  2WAQ F;  3TI0 A;  2MA1 A;  3OSP A;  4TUR A;  4M6W A;  3GFK B;  7ICF A;  5F9L A;  2FLP A;  4K4G A;  4AYB C;  9ICK A;  1Z3E B;  2Q4T A;  2IHN A;  5ALO A;  4KLQ A;  3H0M B;  3MAB A;  4QZG A;  2I6X A;  4ECS A;  4BXO B;  4ED8 A;  4A8E A;  1ZQY A;  3PR4 A;  3JPN A;  3TAR A;  4C8L A;  2BQU A;  2W3S A;  2OHF A;  3QZ8 A;  5J2K A;  1O08 A;  2G5I B;  2H3Q A;  2ZIW B;  3NTU A;  2GO7 A;  2JEJ A;  1S0V A;  2E1F A;  1TV9 A;  4UAZ A;  5AK6 A;  4DQI A;  4C0Z A;  3MDC A;  3JPO A;  5KT4 A;  1OW5 A;  4KLD A;  5J2G A;  4RQ5 A;  3MBY A;  1TK0 A;  2VKQ A;  2XVT A;  4TUS A;  1IXR A;  2F3N A;  1ZQZ A;  2RDJ A;  2VJ5 A;  2XCA A;  3KZX A;  1V38 A;  2K89 A;  2WF5 A;  2V4R A;  5J2H A;  4UW9 A;  1X9X A;  2F8K A;  4C7Y A;  1XC9 A;  3L4P A;  1YZ7 A;  1SWW A;  1ZQI A;  4GIB A;  8ICS A;  1BPB A;  1F44 A;  3TFS A;  4ACO A;  2FDR A;  5FP0 A;  2KJ8 A;  4IQW A;  8ICU A;  1LV5 A;  4CNQ A;  4PJ0 U;  2ZTD A;  4JUZ A;  2K4I A;  4J9M A;  3RAX A;  3IN5 A;  4XQ8 A;  4Z6D A;  1NJZ A;  4BWJ A;  4ECZ A;  3MFI A;  4JB3 A;  2N1R A;  4RT3 A;  1NJY A;  5J0W A;  1LB2 B;  4O9M A;  4PGX A;  3LDA A;  5KT6 A;  4CF5 A;  3ISD A;  1FIQ A;  1RYS A;  3JPQ A;  4P4O A;  1ZQG A;  1NZB A;  1FEZ A;  5KFQ A;  2WB1 C;  2FE9 A;  2JXJ A;  2GOL A;  4QZA A;  4DLE A;  4F4X A;  4M6W B;  4DQR A;  9ICJ A;  3T5K A;  2YN4 A;  3FYH A;  4P4P A;  7ICR A;  2W9C A;  3QUQ A;  1Z4N A;  1PK3 A;  3H7I A;  3C5F A;  4UAV A;  1O03 A;  4F93 B;  3M9O B;  3WKE A;  4ELV A;  1LVH A;  2JR5 A;  3PX4 A;  2KKP A;  3HIL A;  7ICU A;  4QNL A;  2AGQ A;  2E8O A;  4YCX A;  3C2L A;  2C28 A;  3PW2 A;  4ED6 A;  1T94 A;  4HAI A;  5ALP A;  1CI4 A;  3BJY A;  2ASD A;  2K8C B;  5AKI A;  4Y2Q A;  1ZQM A;  3SZ2 A;  4CCH A;  2PI4 A;  3GII A;  3RJE A;  3QNM A;  5J2D A;  4CF4 A;  1PVQ A;  3RB3 A;  5J0S A;  2QB0 A;  5C0Y A;  3KHH A;  3ALR A;  4MHV A;  5TZV A;  1YZ6 A;  4C4R A;  4M9H A;  1L7M A;  5KFD A;  4B9U A;  4I2C A;  2Y0S F;  1HJP A;  2JHD A;  1CEZ A;  4RPZ A;  1BNO A;  1T7P A;  1NJW A;  8ICA A;  5DLF A;  4QWE A;  3HKZ C;  3TAD C;  3WK6 A;  2IOF A;  4KLO A;  4O5C A;  4UAU A;  3TAP A;  3WK7 A;  4RNN A;  4EYH B;  2HHS A;  2BZF A;  1ZJM A;  1SV0 A;  1U48 A;  4O3R A;  1WG8 A;  5BPC A;  5A0L A;  3OHB A;  4NM2 A;  1U9L A;  5J2C A;  2Q0Z X;  3KHR A;  4KLM A;  4CE6 A;  2E8M A;  3CP8 A;  4ED7 A;  3AQE A;  4EBD A;  2W8K A;  5KL8 B;  5J2B A;  5L1J A;  4DFM A;  1D9F A;  3G6V A;  4Y2P A;  5KT2 A;  3ISB A;  4BWM A;  4X5V A;  3QX7 A;  5DBC A;  4YFK A;  5L1I A;  2RDI A;  4MF2 A;  1P7D A;  2BCR A;  5IIL A;  4P0P A;  4UAY A;  2KEY A;  5KFS A;  3BDP A;  8ICT A;  3IM1 A;  2E8N A;  4KIT B;  4F3O A;  5CP2 A;  3LYS A;  2WTF A;  4F8R A;  1A76 A;  1BPD A;  1L3U A;  1IV8 A;  5J0O A;  3KFU F;  1SXE A;  3I76 A;  3H8W A;  5DBB A;  2EZZ A;  5AIA A;  3PNC A;  1ZD3 A;  2ASL A;  4PHE A;  2FLL A;  3Q8P B;  4KLG A;  8ICM A;  1GO3 F;  4EX7 A;  1V97 A;  2H3I A;  3FDS A;  2KFZ A;  1K5O A;  5JU5 A;  5DQI A;  3I1Y A;  2QB0 B;  2XY5 A;  4KLF A;  3PML A;  4DOC A;  2DWQ A;  1S10 A;  1PVP A;  4UB4 A;  4UB3 A;  4FO6 A;  2G08 A;  3BZC A;  2W03 A;  3SR6 A;  2PMZ F;  3WK9 A;  3MC1 A;  5KFP A;  4DWI A;  2HCF A;  3ZDC A;  5KFR A;  2KHV A;  3M1Y A;  5B5E U;  2QB1 A;  4DSE A;  9ICC A;  1L8O A;  2JGA A;  3MR6 A;  1T4G A;  2D3D A;  1SIJ A;  4QZF A;  4USA A;  3UMB A;  1KFT A;  3SI8 A;  3HPO A;  1KDH A;  1ZRM A;  4MEX A;  1Z19 A;  2XC9 A;  4F72 A;  2W7P A;  4ED3 A;  4YG2 A;  4FZN A;  4RQ7 A;  8ICL A;  2FJ6 A;  3B0Y A;  4ECU A;  4KN7 A;  5J0X A;  2NRZ A;  1SWV A;  2ESE A;  2KVC A;  2LPE A;  2AQ4 A;  4F5R A;  5AHX A;  1MA7 A;  5AKK A;  2LI6 A;  2FMP A;  2UVW A;  3MGV A;  3RR8 A;  3IV6 A;  1L7P A;  4XA5 A;  2W9M A;  4IRD A;  4RQ2 A;  4UB2 A;  5DGB A;  4J9O A;  4UAT A;  4DF4 A;  3PX0 A;  3AL0 B;  2B0C A;  3C2K A;  2DL0 A;  2OXO A;  1V9P A;  2IHM A;  4F92 B;  2JV3 A;  3V7K A;  4JK1 A;  1OUQ A;  1NNL A;  3RJJ A;  1U49 A;  3V6J A;  4DSK A;  2KTQ A;  2MRL A;  3WK4 A;  5DDY A;  1UT5 A;  3QU9 A;  4OJO A;  9ICQ A;  4PL1 A;  4IQT A;  4QZ9 A;  1X9S A;  3RBE A;  3F53 A;  1BPZ A;  2FI1 A;  3C1Z A;  5ALF A;  1U4B A;  4C80 A;  3H8J A;  1ZQ1 C;  2XY7 A;  2ZUB A;  2JH1 A;  2I1Q A;  4FBU A;  4I2D A;  3OJS A;  5E79 U;  4R65 A;  2EAO A;  3IDW A;  5DB8 A;  3BQ7 A;  4QW9 A;  1TAU A;  2EDU A;  2MAX A;  4K4I A;  3QU2 A;  5BOM A;  3K1Z A;  5ALJ A;  4DL3 A;  5JTI A;  5KFJ A;  4EBE A;  5DBA A;  4M04 A;  4O3S A;  3SV3 A;  4EBC A;  3WKA A;  1KFD A;  1ZQB A;  2ODG A;  2KZ3 A;  2AJQ A;  4O3Q A;  4G9B A;  4EEL A;  2F8L A;  5EOZ A;  4US9 A;  4NWI A;  1QQ5 A;  2Y9U A;  2G07 A;  3KHL A;  4IR9 A;  4DL7 A;  4B6J A;  4I2E A;  5IIO A;  4KLE A;  1KN5 A;  1TAQ A;  2F77 X;  4CDG A;  1JXL A;  4F5P A;  2QKQ A;  1ZQV A;  2HDO A;  2CPR A;  1SL1 A;  4Q43 A;  4NLZ A;  1FFV A;  3JPT A;  5KFL A;  1IM4 A;  5KFV A;  4DSJ A; 
#chains in the Genus database with same CATH homology
 3KKA C;  2QAR A;  1UQV A;  1B0X A;  1LKY B;  1B4F A;  5J8Y A;  2EAN A;  4RQN A;  2B6G A;  2E8N A;  5JRT A;  2DL0 A;  1RG6 A;  2QAR B;  3BS5 A;  1OW5 A;  2JV3 A;  1SXE A;  5J8Y C;  2EAM A;  4IS7 A;  2DKZ A;  2DKX A;  2F3N A;  3BS5 B;  2K4P A;  2QB0 A;  5L1M A;  1COK A;  1V38 A;  2KMD A;  4MHV A;  4NL9 A;  1KW4 A;  2LMR A;  2KIV A;  2YTU A;  5JU5 A;  3TAD A;  1WWV A;  1SGG A;  5KNI A;  1X9X A;  2QB0 B;  2F8K A;  3TAC B;  1X66 A;  1Z1V A;  2EAO A;  4NL9 C;  3IDW A;  2F44 A;  3BQ7 A;  5F3X B;  3TAD C;  2KSO A;  2QB1 A;  1WWU A;  2D8C A;  1UCV A;  1PK1 A;  2ES6 A;  5JTI A;  2D3D A;  1SV0 A;  3H8M A;  1X40 A;  1SXD A;  1JI7 A;  2KSO B;  1V85 A;  2GLE A;  1PK1 B;  3BS7 A;  4PZO A;  1DXS A;  1SV0 C;  2E8M A;  3SEI A;  2L5Y A;  2Y9U A;  4PZN A;  2FE9 A;  3K1R B;  2KE7 A;  2K60 A;  2E8P A;  3SEN A;  3KKA A;  1PK3 A;  2EAP A;  2ESE A;  2LPE A;  2QKQ A;  1LKY A;  4RQM A;  3HIL A;  1SV4 A;  1OXJ A;  2E8O A;  2Y9T A;  1F0M A;  2KG5 A;  4NJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...