1SXEA

The solution structure of the pointed (pnt) domain from the transcrition factor erg
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
GSHMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator ERG
publication title Diversity in Structure and Function of the Ets Family PNT Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, signaling protein
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02198 SAM_PNT Sterile alpha motif (SAM)/Pointed domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sxeA00
2KMDA 3K1RB 1SXEA 2E8MA 3H8MA 4NJ8A 5JU5A 3HILA 1Z1VA 1PK1A 2EANA 4NL9A 1WWVA 4IS7A 5KNIA 1B0XA 2KIVA 5J8YA 3KKAC 5JRTA 1B4FA 2KSOB 2F8KA 1PK3A 1JI7A 4RQNA 1F0MA 1LKYA 1V85A 2D3DA 5JTIA 1SGGA 2LMRA 1SV0A 2JV3A 3BS5B 4RQMA 3SENA 2LPEA 2K4PA 2F3NA 3IDWA 2ES6A 2YTUA 2L5YA 3TADC 1OW5A 2KSOA 2DKXA 1KW4A 2QB1A 1RG6A 1SV4A 2DKZA 2E8NA 2DL0A 2E8OA 2B6GA 2Y9UA 3TACB 5L1MA 2D8CA 3KKAA 3BS5A 4PZOA 1SXDA 2QKQA 4PZNA 2KE7A 1UCVA 2F44A 2E8PA 5F3XB 4NL9C 2QB0B 1LKYB 3BQ7A 1DXSA 5J8YC 3TADA 2QARB 1X40A 2FE9A 4MHVA 2ESEA 2KG5A 1PK1B 1X66A 2EAOA 2EAPA 3BS7A 1OXJA 2GLEA 1WWUA 1SV0C 1UQVA 2Y9TA 1X9XA 2EAMA 3SEIA 2K60A 2QB0A 2QARA 1V38A 1COKA
chains in the Genus database with same CATH superfamily
2YMQA 4DL2A 1TFRA 2XY6A 2W55A 2IOFA 2KD1A 4Y2JA 4KLSA 3WK4A 2JXJA 5DLFA 3RB3A 1B4FA 5KL8B 4Z6FA 5EE3A 1NK8A 3WK6A 2I6XA 2FLLA 2WB1F 1DGJA 4QNLA 5IIOA 4C8KA 1ZQNA 2WHEA 3WKBA 5J2BA 3HX0A 4J9KA 5KT6A 2G5HB 5ALMA 2F3NA 1NK5A 3PSPA 3KTQA 5AKKA 2XI9A 3PSIA 5ALNA 1KFSA 2ZTEA 4B9TA 4R66A 3OJSA 1VLBA 4MFCA 5J0SA 4JWMA 5DG7A 2W8KA 3AU2A 3UQ0A 4QWBA 2F1IA 2AJQA 2B6GA 7ICUA 3SZ2A 1JXLA 3BS5A 1S0VA 3JPRA 3RH6A 3V6HA 4YXJA 5G5HA 5ALHA 2KTQA 5KFRA 1NNLA 1D9FA 1X9MA 1N61A 1DK3A 3MFHA 8ICOA 3WK7A 4TQRA 3EYZA 4MEXA 2JEFA 1AQ6A 1Q46A 8ICKA 4DQQA 4KMOB 4ECXA 2KHVA 1NJXA 3V6JA 4KLFA 5HNKA 4YP3A 2RHFA 1T3QA 3QUBA 1NOMA 1H38A 1SV0C 3GQCA 2CPRA 4UBBA 2MU2A 4DFJA 2EAMA 3AQFA 2H3VA 5TISU 4FS1A 1ZQYA 4YG2A 4F2SA 4C7YA 5KFWA 2MAXA 4R64A 3H8MA 1SIJA 2VJ4A 2WFAA 1Z1VA 5CHGA 1ZQOA 4LJXA 3N7RC 4K4IA 1L7PA 2YB1A 4Y2YA 5KFYA 3PW7A 8ICVA 4U6PA 1DGSA 5AICA 1ZD5A 4DWIA 4P0QB 3QNMA 3H8SA 3MABA 3KHHA 1WG8A 1T8EA 2H3QA 1XSLA 9ICAA 1L5UA 4FS2A 5KFTA 2BQRA 1KTQA 1UHUA 2MUTA 5AM0A 2F8LA 1KRPA 4B6JA 4O5CA 3CNHA 4UB5A 4PL2A 3Q8KA 3NS1A 4K4HA 4BXOB 4RNNA 3HP6A 4O3RA 2W43A 4RU9A 4R8UB 4EEKA 3IG8A 4UAVA 2VA2A 2HHWA 4A8EA 1HJPA 4R65A 9ICPA 2AH5A 3KBBA 1XSNA 8ICAA 4CF4A 3ZDAA 4RQ3A 4UQGA 1Q3UA 1M6YA 1S10A 1P7DA 4ECUA 1L6NA 1Z00A 3DDHA 5L1JA 2LI6A 2HDOA 1LVHA 2ZIXA 2KOBA 5DB9A 2JEIA 1X66A 3ALRA 2ALZA 5ALOA 4O5EA 1X9WA 2GO7A 5AI9A 2KK0A 2Y1IA 2FLPA 4JV0A 1ZD2P 1NK6A 2R8HA 2QARA 3D2SA 4FE3A 5AKLA 2ZIVB 5EE1A 2PI5A 1J2NA 3H40A 2ATLA 2PFNA 3PX0A 2EANA 1K1SA 3SAGA 2E1FA 3ETRA 1WUDA 7ICJA 5AK3A 4TUPA 2XICA 1B43A 2NRXA 3BDPA 5AKIA 4PPXA 1A0PA 3T5HA 4YN4A 3ONNA 4P4MA 4NLKA 3R9KA 2BCRA 1ZQGA 4ECVA 4F5PA 4DL5A 2W04A 1L8OA 1RDFA 1JALA 2ISPA 5L1LA 5DBBA 2L5YA 3H4DA 4P2HA 3AQEA 4DFDA 1ZQTA 5IIKA 2AXTU 5GTIU 2A3VA 8ICYA 1J2MA 3UQ2A 3B0YA 1RG6A 8ICUA 1ZRNA 3V7JA 5KFBA 4C7ZA 1IXRA 1SWVA 4MFAA 3TQ1A 1ZQ1C 4JV2A 5AM2A 8ICQA 5KT3A 3QYPA 2Q4TA 2E5SA 4O9MA 3A0BU 2ZJ5A 4O3PA 3GIMA 3T5JA 8ICFA 4C4SA 3L5KA 1X40A 3SQIA 4I2FA 2VJ5A 2O6KA 1TV9A 2R8IA 4B9VA 7ICEA 2W54A 1ZQRA 5KFGA 5J0TA 2K60A 4NY8A 4JV1A 2KVSA 1QQ7A 4Z6CA 2HCFA 8ICGA 2KMDA 3AMZA 3C2LA 2E8MA 4O3MA 3NRZA 4M9GA 3RFAA 5KAIU 1TE2A 3DEEA 2NRTA 5J0OA 4ECWA 3KKAC 5KFPA 3TFSA 5J0QA 3MR5A 4B9NA 3ORYA 1JROA 4I2EA 5DQHA 5DQGA 3FYHA 2FMQA 1L7MA 1BPDA 3KHGA 3RF9A 2JV3A 3C5FA 2K4PA 2OCEA 3MDCA 3D2NA 1UA1A 1U47A 4PJ0U 3TFRA 1MQ2A 5HR7A 3RBDA 1HUOA 3QZ7A 2XC9A 4O5KA 5KFCA 1KW4A 4NLBA 3M6KA 2QB1A 2K89A 1ZQEA 4YXMA 5J0RA 4KLOA 1QSSA 5KFXA 3M7DA 4RUCA 4ZOHC 4EBEA 2PFQA 5D4BA 1T3NA 1KBUA 3K1ZA 2PMZC 5KFSA 1ZETA 3IHQB 4RQ4A 1EXNA 8ICCA 3C28A 4C0ZA 4F5OA 5C5JA 4GLXA 2ZIUA 1LKYB 5GTHU 2V9WA 3CYMA 3RR7A 5ALLA 2FE9A 4QZ9A 3PZPA 1K1QA 4YD1A 3RH4A 2BHNA 3PMNA 1ZQHA 1LV5A 1MN8A 3V72A 2BGWA 2HHUA 3LWLA 2NRWA 5HR6A 2W9BB 1ZRMA 4US8A 3N7PD 4F5RA 2QB0A 4GIBA 1ZQSA 1QLNA 5AI4A 3OPXA 2BQ3A 4ED2A 4O3SA 2KKVA 2HBLA 2PFPA 3JPQA 4PHPA 7ICIA 5J8YA 2RDIA 5CP2A 3KFUF 3C2KA 2AGQA 2F8KA 1PK3A 1KEJA 3MDAA 4M9JA 9ICSA 3QUCA 3RB6A 1ZQCA 4RPZA 3HWTA 4XA5A 2HHVA 1ZQFA 4YQWA 4ELVA 2JZBA 4TQSA 3F5AA 4Q8EA 4BDPA 4DQPA 2BDUA 5AIAA 2AQ4A 4KLMA 4UAUA 5ALDA 3HT3A 3PW5A 2ASJA 3LVWA 2HBMA 1X6JA 3EZ5A 2YTUA 2HOIA 1N60A 1COOA 3RJEA 3HKZF 5T14A 2F77X 1N2XA 2ZIWB 2YB4A 2DKZA 2BCSA 5J2IA 3AN1A 9ICHA 4GFJA 2FPMA 2NYVA 5KTQA 1IV8A 4PGYA 1N56A 2OH2A 3U26A 3IRUA 2LYAA 5J2FA 4HYKA 3C2MA 4DL4A 1KSPA 4F93B 1SWWA 4NL9C 1S0OA 1Q8KA 1QSLA 3Q8RB 4P0PA 4U7CA 2W03A 1BPXA 4CF3A 1QCKA 7ICGA 2IOHA 2YX8A 5DG8A 1ZJNA 2K8AA 7ICOA 1PK1B 4TUQA 5EE9A 3MC1A 2KP7A 4F92B 1ZQUA 4FBTA 3AM9A 4Q45A 3MR2A 5AKYA 2DBYA 3PY8A 5KFLA 1JIHA 4LVSA 2A1JA 4US9A 4O3QA 2HOFA 4Q8FA 2FI1A 5JU5A 7ICMA 5L1KA 3RB0A 2OYYA 5AKGA 4ECRA 1KQQA 4KN4A 1KFTA 3AU6A 7ICTA 5AKHA 1XC9A 1BVSA 1S0NA 2OM6A 5KFHA 2RQ5A 5DBAA 5FP0A 4FO6A 3T79A 3M1YA 4QWEA 2WAQC 9ICIA 4RZRA 1SV0A 1HEKA 5HMLA 4BWMA 1GO3F 1DRGA 5CB1A 1FO4A 1ZOLA 5AKXA 3IG5A 1OUQA 4MF8A 8ICTA 2NRZA 5BOLA 1ZQKA 2KZZA 5KFNA 2Y0SC 5KG6A 3AUOA 1FEZA 4QZHA 4DS5A 2VA3A 4OJ5A 3RJIA 1V9PA 4IRKA 3RJFA 1J97A 4Y2TA 4Y2RA 4B9UA 3FDSA 4YR2A 2HHSA 4EYIB 3CW2C 3DV9A 4DFPA 5BOMA 3TAQA 3LK9A 4OCZA 4DSFA 9ICWA 2W9CB 1YZ7A 2YN4A 4XQ8A 4GC7A 3PSTA 8ICEA 1OXJA 2GLEA 4C80A 4UB2A 5J2DA 2DGZA 4USAA 1Z4NA 4FZNA 4DOBA 1IIPA 4IQTA 3UM9A 4Q44A 3BQ1A 4AP9A 4DS4A 2LBOA 5KFIA 1T4GA 3M8RA 4ELUA 3M9MB 3UPQA 2D6FC 3Q8SB 2E1EA 1Z4OA 2YQEA 3QEBZ 3UMGA 7ICSA 3UMBA 2V4QA 2BPGA 3A0HU 3KZXA 4QIWC 4NV0A 1NKEA 5AI5A 5KG0A 5KT2A 1L3UA 2BCQA 1TK8A 3EUB2 1CRXA 3Q8QB 5G5GA 2B0CA 4ED3A 4M9NA 4ECTA 2VANA 4UB6U 5ALJA 3PO4A 1F5SA 5AM3A 2XY5A 1ZQPA 2ZG6A 2XCPA 2Q0ZX 1N63A 4AYBF 1NJYA 1NK7A 2YMMA 5CR0A 3PR4A 1RXVA 4KLGA 2HBKA 2JEGA 3NGDA 4BJQA 2E8PA 1HIWA 2W9MA 4Y2VA 4K4GA 4IR1A 2H5XA 1D9DA 5ALYA 4KLQA 1WCNA 4R8UA 1X42A 2K4IA 4DLGA 3SI8A 5ALRA 3M8SA 1SKWA 4B9MA 1MC8A 4LZGA 4JMUA 3IM1A 5AI6A 3UXPA 3ISDA 1JXEA 1RYSA 5ALVA 2ZTCA 1NZPA 4DCCA 1X9XA 4NXZA 2W8LA 4YR3A 3TAPA 2DWQA 4FFDA 1SXEA 4UW9A 3WKAA 2HSZA 1N5XA 5KFMA 3WKEA 4Y2QA 5DDYA 2LM1A 3MR3A 3C5GA 1L3TA 3OGUA 4WJ3B 3GFKB 2OEHA 4DO9A 4DQRA 5L9XA 1N5WA 1ZXIA 1SL2A 2NO5A 1YT3A 1S5LU 1PZNA 4FZMA 1Z00B 7ICFA 8ICBA 1A77A 2ZIXB 3RR8A 4RUAA 5DB8A 4Z6EA 2BQUA 4RPXA 2K8BB 1RZTA 5EWGA 5HHHA 2FMPA 3WK9A 9ICUA 1ZQDA 3ZD9A 4J9QA 4EYHB 1N48A 4G3IA 2FPLA 2XGQA 3TACB 3KKAA 3PW2A 3WK5A 5KG1A 4UB3A 3SV4A 5JUMA 2Z7JA 1U45A 1O03A 2IA6A 1UT8A 3C29A 4TUSA 1KN5A 1WCLA 4MFFA 1U4BA 1MA7A 2P35A 1U9LA 3PR5B 2M9NA 2W3RA 3NVVA 2ASDA 4UARA 1CUKA 2OXOA 1IM4A 3ZDDA 2EAOA 3WK8A 3BS7A 2EZZA 4OD0A 2A1AA 3TANA 9ICRA 5KFDA 4UB4A 4MEYA 5ALXA 4M6WA 2K8CB 3VCBA 1NKBA 4NLCA 2AGPA 2W11A 4IL6U 2C22A 1QQ6A 2PI4A 5ALQA 2NO4A 5TZVA 2H3FA 1Z19A 4NWIA 5AKJA 4DEZA 2HI0A 4Y2XA 2KSOB 7ICRA 1TKDA 1JI7A 2DQNB 5AIBA 4RQNA 5KG3A 2KJ8A 1ZQVA 1KDHA 3NASA 2UVUA 5ALPA 4KLDA 5KG4A 4HAIA 2LKYA 3OHAA 2J6UA 5KFFA 2D3DA 1FFVA 1Y88A 2ZUDA 2WF7A 5CEHA 3PV8A 3BQ2A 3SENA 1RPLA 1WYGA 2R8GA 4OJLA 5EWFA 1ZYQA 4KLHA 5AM1A 4PHEA 2ZJ8A 3OJUA 4EBCA 4UB1A 1BNPA 4BGDA 1SV4A 4DL3A 4UAYA 2WAQF 2I5HA 4IR9A 2DL0A 2E8OA 5J0WA 2Y9UA 1ECWA 5L1IA 1SXDA 4PH5A 4OO1J 3RRHA 8ICHA 4YMNA 1ED1A 5A0LA 3ZI4A 3ISBA 3QZ8A 3LWMA 4KTQA 3ZDBA 2EDUA 2KIWA 5KFUA 2AQ0A 5EWEA 1MSWD 4JK1A 1TAMA 4F4ZA 4DL6A 2NRVA 4I28A 1TK5A 2G07A 2ESEA 4KLJA 3Q8PB 3GILA 5ALSA 5IIIA 7ICVA 3N4MB 1UA0A 4XUSA 1NK9A 1JX4A 4EELA 9ICXA 2KICA 1D8YA 4GXKA 2I1QA 2MSNA 1C7YA 5IILA 1SB3C 2OWOA 4NL9A 4I29A 4YMMA 2P66A 4B9SA 4KN7A 4ED8A 2UVWA 2WF6A 4QZFA 3QU2A 3C23A 2KZ3A 2BPFA 3BQ0A 2CRXA 1XO1A 2LPEA 3ZDEA 2C2RA 2AHOB 5HHIA 3GIJA 2F1JA 5KG5A 5J2KA 1UT5A 4DOCA 4P4PA 2F2AB 4DF4A 4NLZA 2I9GA 1ZQQA 4RQ6A 3WU2U 2KN7A 4F8RA 2HMXA 4NLNA 2J6TA 4PZOA 4M04A 2M0NA 3FC4A 4UATA 1K5OA 4ZH4A 2KFNA 3JPNA 2ZIWA 1S97A 4ECZA 1RQNA 2KEYA 5AM4A 1V97A 2P6RA 1UPHA 4EX7A 5AI0A 2IOFK 4RNOA 4CDGA 2HHTA 4PHDA 3MR6A 1TK0A 4I2DA 2ODGA 2KG5A 4KLUA 3SR6A 4ED0A 5DGAA 1QH9A 5K4LA 1NZBA 5DB7A 9ICEA 4UAWA 4EZ6A 2G06A 5H2FU 3QXGA 9ICOA 4F5QA 4Y2PA 1X2IA 5EOZA 2IHNA 1XSPA 2CN1A 2HOQA 5KFZA 3HW8A 4LZDA 2HBJA 4DSIA 1JUDA 4CCHA 3NTUA 1PK1A 3RJKA 1KL9A 3ED5A 2WF5A 1PVPA 2XVTA 3C1ZA 2F1HA 2K4HA 4DQIA 3EPIA 2FPKA 4C8NA 1C20A 4YVZA 4P0PB 2YMLA 5JTIA 4KITB 2FLNA 1SGGA 9ICTA 1ZQAA 4NM2A 8ICIA 3H4BA 5KFQA 3QU4A 2HW3A 3KOOA 3TADC 2GH1A 4RNMA 3GV7B 4F72A 4Y2UA 1ZQWA 2BR0A 5J0XA 4C4TA 2JH7A 8ICNA 1XU4A 2PKEA 3BJYA 4GXIA 5HP4A 4DFMA 4P4OA 2RP5A 1L3SA 5L1MA 8ICLA 3UXOA 1SZHA 4PZNA 4IRDA 9ICLA 2KZMA 1TVAA 1DK2A 3QE9Y 3N28A 4E0DA 5F3XB 5ALFA 3Q8MA 8ICWA 5J0UA 3BQTA 4YFKA 9ICVA 1ZJMA 3SV3A 4DQSA 5KT7A 1KKXA 2AGOA 3G6XA 4EENA 2J6SA 2VA8A 4I2GA 3PW4A 1U49A 4ICAA 5HMMA 3PNCA 4I2BA 2DFLA 3VC8A 1U48A 5ALUA 2MRLA 2RDJA 4I2CA 8ICPA 2KHQA 3C21A 5DB6A 3MBYA 4KLEA 2ZXHA 4NLGA 1L7NA 2CXYA 1BPZA 2WF8A 2W9CA 5AM5A 3GZFA 4JUZA 2XIDA 4YCXA 4F4KA 2KIVA 1NJWA 9ICQA 3NRWA 4G9BA 5J2EA 3D2QA 4QZ8A 4KMUA 4QZDA 4DL7A 3RAXA 4DSLA 5AK4A 3PW0A 3LYSA 2R8JA 1V85A 2B21A 4M9LA 5DKWA 3GU3A 4B9LA 5J2CA 3BS5B 4RQMA 5ALGA 4J9MA 3KHLA 5J2HA 3H0LB 5KFKA 3SAHA 2WTFA 4ECYA 2RRDA 1SKSA 1BPBA 1NI3A 2RLTA 2VIXA 5KT5A 1O08A 2Y1JA 2UVRA 3PMLA 3T5KA 8ICXA 3S6JA 1T94A 3HJEA 1S76D 1S0MA 5J29A 2D8CA 1NK0A 2HHQA 4EX6A 5ALZA 4CNQA 3MGVA 2ISOA 4PL1A 4M2YA 2ZUBA 2F44A 2XCAA 8ICMA 3TKAA 1BGXT 3H0RB 4F50A 4QZGA 3RB4A 4P0QA 4J03A 4FBUA 1X6IA 4BWJA 2BCUA 9ICFA 4F4WA 2YMPA 1XO0A 4RQ8A 4MHVA 5CJ7A 1BPYA 3ZDCA 3RTVA 2ZXIA 3I76A 4UAZA 1NKCA 2EAPA 5KT4A 3C1YA 3D6JA 3HKZC 4CE6A 1UQVA 2WF9A 1PVRA 3PX4A 4I2HA 4TURA 3RJHA 3AEVA 4ECQA 1V38A 2IBKA 2JR5A 1S9FA 4O3NA 3JPSA 2ASLA 2BDPA 4BXOA 5AK6A 3KD3A 4Q43A 2MA1A 4F3OA 1B0XA 3IN5A 2PMZF 2ZUCA 2ZTDA 3KZIU 2MUTB 5BPCA 5D46A 2W9AA 5DQIA 1QQ5A 2KVCA 4EBDA 3IV6A 1JN3A 1Q3VA 4J9LA 3FM9A 4PHAA 5J0PA 4I2JA 4QZCA 5KFJA 4DSEA 9ICCA 3OSPA 1XWLA 5AKEA 3F2BA 5B66U 2DF4B 2PXIA 2DKXA 2BZFA 1NK4A 4KLLA 1ZQBA 4C8OA 3H0MB 1URJA 5J2AA 4PGQA 2AU0A 2BPCA 5KG7A 5AI8A 1SL0A 2ZIVA 2H3IA 5IIMA 2LYBA 1PUZA 2QKQA 3OSNA 3TARA 5J2JA 3RJJA 4ACOA 5ALIA 3G6YA 1ZD3A 1ZQXA 2DPIA 1A76A 1TAUA 1DXSA 2QARB 2JH1A 1FIQA 3AL0B 3HRDD 2LYHA 3PSFA 1RYUA 4DFKA 2EH9A 3QU5A 2R8KA 1S77D 1AROP 1WWUA 5IIJA 2HHXA 2JMGA 2WB1C 4M47A 2W3SA 2ZJAA 3K1RB 3HPOA 4NJ8A 1BNOA 4M0AA 3RBEA 4GXJA 4JWNA 8ICSA 4EZ9A 2W7PA 4QZEA 5JRTA 3MGHA 5KFEA 3SMVA 1QSYA 1F0MA 4DSJA 1T7PA 3Q8LA 1RM6C 2PFOA 4C4RA 3EW9A 3T5LA 5KFVA 4QW8A 3ISCA 2W7OA 3QUQA 3JPTA 3K75D 4OJOA 2ES6A 9ICJA 2JGAA 3GIIA 4CRXA 4Y2SA 1QTMA 3H8WA 3NVWA 2KSOA 4IC9A 2KFZA 4X5VA 2JHDA 4M6WB 1XNSA 2DPJA 2BKEA 5B5EU 3J81j 1HUZA 2NV3A 3RJGA 3V7KA 2P6UA 4F71A 4J9OA 4MF2A 9ICNA 2DUYA 1SL1A 2G08A 1RXWA 3PO5A 3V6KA 3MFIA 3NUQA 4UB8U 3WKDA 3M9OB 3ZD8A 1L8LA 4QW9A 2HVHA 5DDMA 4F4XA 4BX9C 4BUGA 2EZXA 1PVQA 5F9LA 5IINA 5KFAA 1ZQZA 3SAFA 1L3VA 2GWSA 2F76X 1LB2B 3QU9A 2IHMA 3F5EA 3NVZA 4ECSA 4QZAA 1XS9D 3FAHA 4C8MA 1Z1BA 2N1RA 3LVVA 1ZQLA 3ICXA 4OJPA 4RQ0A 3LDAA 3QUTA 3KHRA 9ICKA 4I2IA 3RH5A 2XO7A 1ZQJA 3N97B 4AYBC 3N7SC 4DF8A 2Y0SF 4QZBA 2JRZA 5AHXA 3M9NB 3E0FA 4M9HA 1WWVA 4IQVA 4KLTA 3NVYA 5KNIA 1CEZA 1DOQA 5KAFU 1N62A 4I2AA 5J2GA 3F2DA 8ICJA 3UXNA 5ALEA 1LKYA 1B22A 1JMSA 3EWAA 3V7LA 5KFOA 3GV5B 4F4YA 4JB3A 4QWAA 2LMRA 2KV2A 2E3TA 4Z6DA 1SKRA 3IDWA 4ED6A 4F91B 4RQ2A 1L7OA 1OW5A 2W9BA 2GOLA 5EE0A 5CWRA 4IQUA 4CF5A 4DLEA 3I1YA 2H3ZA 1JRPA 2ZIUB 4O0IA 2KJ9A 2XGPA 2C28A 3GIKA 7ICQA 3G6VA 3OHBA 1Z3EB 2KE7A 4QWCA 2KNJA 2UVVA 5ALWA 4QWDA 1VDVA 3F53A 1UCVA 4YD2A 5F9NA 2IMWP 4XRHA 1ZD4A 3IP4B 3JPOA 4QJFB 3B9JA 1KFDA 3CRXA 2QB0B 8ICRA 1TAQA 3TADA 7ICHA 4QIWF 5DGBA 5DLGA 4UBCA 3RAQA 1NJZA 1IG6A 3WKCA 2VKQA 4GC6A 3L4PA 7ICPA 9ICMA 4KLIA 2JEJA 5E79U 5AK5A 4IQWA 5CRXA 2Y9TA 2K4EA 3SEIA 2OHFA 2EQYA 4CGZA 1ZQIA 1BPEA 4EEYA 4J9PA 4FZLA 4RPYA 2G09A 3H7IA 3OTQA 2JZBB 4YMOA 4PGXA 5C0YA 1D8LA 3HILA 3QU7A 1X9SA 1MQ3A 7ICKA 3PVXA 3MGIA 3GDXA 2G5IB 3H8JA 4IS7A 3PX6A 3B0XA 2QLTA 2YY6A 4F5NA 2KJ5A 3L3FX 4NM1A 4RQ5A 4UASA 3QX7A 3E58A 3THVA 4R63A 3UMCA 4DOAA 3JPPA 4RT3A 1VJ5A 4OJ6A 3K4GA 3O0FA 5J0YA 2FJ6A 2FMSA 4J9RA 4QZIA 5ALKA 3RRGA 1RYRA 2C2EA 5CA7A 2HVIA 4J9SA 3SYZA 2XY7A 1D8BA 2LHTA 3T3FA 1YZ6A 2E8NA 3CP8A 1S8OA 4KX3A 4ED1A 7ICNA 2R18A 2V4RA 3F2CA 5AKZA 4RQ1A 3GV8B 3TI0A 4C8LA 4YR0A 2C2DA 5KG2A 9ICBA 4RQ7A 3QEAZ 9ICGA 4J9NA 1A6SA 4DSKA 4F2RA 4O3OA 1KLNA 3BQ7A 1ZQMA 5J8YC 3BZCA 4RT2A 2A1JB 2KKPA 1SZPA 2G0AA 2BCVA 4KX5A 5DG9A 5KL1B 5D49A 2FDRA 1RQLA 1F44A 4ELTA 5ALTA 3E2EA 3ETLA 3BZKA 3M6ZA 4ED7A 5DBCA 4IRCA 8ICZA 3EPGA 2A19A 1CI4A 7ICLA 2EZYA 1FFUA 2LM4A 3SD7A 3I28A 4I27A 1COKA
chains in the Genus database with same CATH topology
2KMDA 3K1RB 1SXEA 2E8MA 3H8MA 4NJ8A 5JU5A 3HILA 1Z1VA 1PK1A 2EANA 4NL9A 1WWVA 4IS7A 5KNIA 1B0XA 2KIVA 5J8YA 3KKAC 5JRTA 1B4FA 2KSOB 2F8KA 1PK3A 1JI7A 4RQNA 1F0MA 1LKYA 1V85A 2D3DA 5JTIA 1SGGA 2LMRA 1SV0A 2JV3A 3BS5B 4RQMA 3SENA 2LPEA 2K4PA 2F3NA 3IDWA 2ES6A 2YTUA 2L5YA 3TADC 1OW5A 2KSOA 2DKXA 1KW4A 2QB1A 1RG6A 1SV4A 2DKZA 2E8NA 2DL0A 2E8OA 2B6GA 2Y9UA 3TACB 5L1MA 2D8CA 3KKAA 3BS5A 4PZOA 1SXDA 2QKQA 4PZNA 2KE7A 1UCVA 2F44A 2E8PA 5F3XB 4NL9C 2QB0B 1LKYB 3BQ7A 1DXSA 5J8YC 3TADA 2QARB 1X40A 2FE9A 4MHVA 2ESEA 2KG5A 1PK1B 1X66A 2EAOA 2EAPA 3BS7A 1OXJA 2GLEA 1WWUA 1SV0C 1UQVA 2Y9TA 1X9XA 2EAMA 3SEIA 2K60A 2QB0A 2QARA 1V38A 1COKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMD A;  3K1R B;  1SXE A;  2E8M A;  3H8M A;  4NJ8 A;  5JU5 A;  3HIL A;  1Z1V A;  1PK1 A;  2EAN A;  4NL9 A;  1WWV A;  4IS7 A;  5KNI A;  1B0X A;  2KIV A;  5J8Y A;  3KKA C;  5JRT A;  1B4F A;  2KSO B;  2F8K A;  1PK3 A;  1JI7 A;  4RQN A;  1F0M A;  1LKY A;  1V85 A;  2D3D A;  5JTI A;  1SGG A;  2LMR A;  1SV0 A;  2JV3 A;  3BS5 B;  4RQM A;  3SEN A;  2LPE A;  2K4P A;  2F3N A;  3IDW A;  2ES6 A;  2YTU A;  2L5Y A;  3TAD C;  1OW5 A;  2KSO A;  2DKX A;  1KW4 A;  2QB1 A;  1RG6 A;  1SV4 A;  2DKZ A;  2E8N A;  2DL0 A;  2E8O A;  2B6G A;  2Y9U A;  3TAC B;  5L1M A;  2D8C A;  3KKA A;  3BS5 A;  4PZO A;  1SXD A;  2QKQ A;  4PZN A;  2KE7 A;  1UCV A;  2F44 A;  2E8P A;  5F3X B;  4NL9 C;  2QB0 B;  1LKY B;  3BQ7 A;  1DXS A;  5J8Y C;  3TAD A;  2QAR B;  1X40 A;  2FE9 A;  4MHV A;  2ESE A;  2KG5 A;  1PK1 B;  1X66 A;  2EAO A;  2EAP A;  3BS7 A;  1OXJ A;  2GLE A;  1WWU A;  1SV0 C;  1UQV A;  2Y9T A;  1X9X A;  2EAM A;  3SEI A;  2K60 A;  2QB0 A;  2QAR A;  1V38 A;  1COK A; 
#chains in the Genus database with same CATH topology
 2YMQ A;  4DL2 A;  1TFR A;  2XY6 A;  2W55 A;  2IOF A;  2KD1 A;  4Y2J A;  4KLS A;  3WK4 A;  2JXJ A;  5DLF A;  3RB3 A;  1B4F A;  5KL8 B;  4Z6F A;  5EE3 A;  1NK8 A;  3WK6 A;  2I6X A;  2FLL A;  2WB1 F;  1DGJ A;  4QNL A;  5IIO A;  4C8K A;  1ZQN A;  2WHE A;  3WKB A;  5J2B A;  3HX0 A;  4J9K A;  5KT6 A;  2G5H B;  5ALM A;  2F3N A;  1NK5 A;  3PSP A;  3KTQ A;  5AKK A;  2XI9 A;  3PSI A;  5ALN A;  1KFS A;  2ZTE A;  4B9T A;  4R66 A;  3OJS A;  1VLB A;  4MFC A;  5J0S A;  4JWM A;  5DG7 A;  2W8K A;  3AU2 A;  3UQ0 A;  4QWB A;  2F1I A;  2AJQ A;  2B6G A;  7ICU A;  3SZ2 A;  1JXL A;  3BS5 A;  1S0V A;  3JPR A;  3RH6 A;  3V6H A;  4YXJ A;  5G5H A;  5ALH A;  2KTQ A;  5KFR A;  1NNL A;  1D9F A;  1X9M A;  1N61 A;  1DK3 A;  3MFH A;  8ICO A;  3WK7 A;  4TQR A;  3EYZ A;  4MEX A;  2JEF A;  1AQ6 A;  1Q46 A;  8ICK A;  4DQQ A;  4KMO B;  4ECX A;  2KHV A;  1NJX A;  3V6J A;  4KLF A;  5HNK A;  4YP3 A;  2RHF A;  1T3Q A;  3QUB A;  1NOM A;  1H38 A;  1SV0 C;  3GQC A;  2CPR A;  4UBB A;  2MU2 A;  4DFJ A;  2EAM A;  3AQF A;  2H3V A;  5TIS U;  4FS1 A;  1ZQY A;  4YG2 A;  4F2S A;  4C7Y A;  5KFW A;  2MAX A;  4R64 A;  3H8M A;  1SIJ A;  2VJ4 A;  2WFA A;  1Z1V A;  5CHG A;  1ZQO A;  4LJX A;  3N7R C;  4K4I A;  1L7P A;  2YB1 A;  4Y2Y A;  5KFY A;  3PW7 A;  8ICV A;  4U6P A;  1DGS A;  5AIC A;  1ZD5 A;  4DWI A;  4P0Q B;  3QNM A;  3H8S A;  3MAB A;  3KHH A;  1WG8 A;  1T8E A;  2H3Q A;  1XSL A;  9ICA A;  1L5U A;  4FS2 A;  5KFT A;  2BQR A;  1KTQ A;  1UHU A;  2MUT A;  5AM0 A;  2F8L A;  1KRP A;  4B6J A;  4O5C A;  3CNH A;  4UB5 A;  4PL2 A;  3Q8K A;  3NS1 A;  4K4H A;  4BXO B;  4RNN A;  3HP6 A;  4O3R A;  2W43 A;  4RU9 A;  4R8U B;  4EEK A;  3IG8 A;  4UAV A;  2VA2 A;  2HHW A;  4A8E A;  1HJP A;  4R65 A;  9ICP A;  2AH5 A;  3KBB A;  1XSN A;  8ICA A;  4CF4 A;  3ZDA A;  4RQ3 A;  4UQG A;  1Q3U A;  1M6Y A;  1S10 A;  1P7D A;  4ECU A;  1L6N A;  1Z00 A;  3DDH A;  5L1J A;  2LI6 A;  2HDO A;  1LVH A;  2ZIX A;  2KOB A;  5DB9 A;  2JEI A;  1X66 A;  3ALR A;  2ALZ A;  5ALO A;  4O5E A;  1X9W A;  2GO7 A;  5AI9 A;  2KK0 A;  2Y1I A;  2FLP A;  4JV0 A;  1ZD2 P;  1NK6 A;  2R8H A;  2QAR A;  3D2S A;  4FE3 A;  5AKL A;  2ZIV B;  5EE1 A;  2PI5 A;  1J2N A;  3H40 A;  2ATL A;  2PFN A;  3PX0 A;  2EAN A;  1K1S A;  3SAG A;  2E1F A;  3ETR A;  1WUD A;  7ICJ A;  5AK3 A;  4TUP A;  2XIC A;  1B43 A;  2NRX A;  3BDP A;  5AKI A;  4PPX A;  1A0P A;  3T5H A;  4YN4 A;  3ONN A;  4P4M A;  4NLK A;  3R9K A;  2BCR A;  1ZQG A;  4ECV A;  4F5P A;  4DL5 A;  2W04 A;  1L8O A;  1RDF A;  1JAL A;  2ISP A;  5L1L A;  5DBB A;  2L5Y A;  3H4D A;  4P2H A;  3AQE A;  4DFD A;  1ZQT A;  5IIK A;  2AXT U;  5GTI U;  2A3V A;  8ICY A;  1J2M A;  3UQ2 A;  3B0Y A;  1RG6 A;  8ICU A;  1ZRN A;  3V7J A;  5KFB A;  4C7Z A;  1IXR A;  1SWV A;  4MFA A;  3TQ1 A;  1ZQ1 C;  4JV2 A;  5AM2 A;  8ICQ A;  5KT3 A;  3QYP A;  2Q4T A;  2E5S A;  4O9M A;  3A0B U;  2ZJ5 A;  4O3P A;  3GIM A;  3T5J A;  8ICF A;  4C4S A;  3L5K A;  1X40 A;  3SQI A;  4I2F A;  2VJ5 A;  2O6K A;  1TV9 A;  2R8I A;  4B9V A;  7ICE A;  2W54 A;  1ZQR A;  5KFG A;  5J0T A;  2K60 A;  4NY8 A;  4JV1 A;  2KVS A;  1QQ7 A;  4Z6C A;  2HCF A;  8ICG A;  2KMD A;  3AMZ A;  3C2L A;  2E8M A;  4O3M A;  3NRZ A;  4M9G A;  3RFA A;  5KAI U;  1TE2 A;  3DEE A;  2NRT A;  5J0O A;  4ECW A;  3KKA C;  5KFP A;  3TFS A;  5J0Q A;  3MR5 A;  4B9N A;  3ORY A;  1JRO A;  4I2E A;  5DQH A;  5DQG A;  3FYH A;  2FMQ A;  1L7M A;  1BPD A;  3KHG A;  3RF9 A;  2JV3 A;  3C5F A;  2K4P A;  2OCE A;  3MDC A;  3D2N A;  1UA1 A;  1U47 A;  4PJ0 U;  3TFR A;  1MQ2 A;  5HR7 A;  3RBD A;  1HUO A;  3QZ7 A;  2XC9 A;  4O5K A;  5KFC A;  1KW4 A;  4NLB A;  3M6K A;  2QB1 A;  2K89 A;  1ZQE A;  4YXM A;  5J0R A;  4KLO A;  1QSS A;  5KFX A;  3M7D A;  4RUC A;  4ZOH C;  4EBE A;  2PFQ A;  5D4B A;  1T3N A;  1KBU A;  3K1Z A;  2PMZ C;  5KFS A;  1ZET A;  3IHQ B;  4RQ4 A;  1EXN A;  8ICC A;  3C28 A;  4C0Z A;  4F5O A;  5C5J A;  4GLX A;  2ZIU A;  1LKY B;  5GTH U;  2V9W A;  3CYM A;  3RR7 A;  5ALL A;  2FE9 A;  4QZ9 A;  3PZP A;  1K1Q A;  4YD1 A;  3RH4 A;  2BHN A;  3PMN A;  1ZQH A;  1LV5 A;  1MN8 A;  3V72 A;  2BGW A;  2HHU A;  3LWL A;  2NRW A;  5HR6 A;  2W9B B;  1ZRM A;  4US8 A;  3N7P D;  4F5R A;  2QB0 A;  4GIB A;  1ZQS A;  1QLN A;  5AI4 A;  3OPX A;  2BQ3 A;  4ED2 A;  4O3S A;  2KKV A;  2HBL A;  2PFP A;  3JPQ A;  4PHP A;  7ICI A;  5J8Y A;  2RDI A;  5CP2 A;  3KFU F;  3C2K A;  2AGQ A;  2F8K A;  1PK3 A;  1KEJ A;  3MDA A;  4M9J A;  9ICS A;  3QUC A;  3RB6 A;  1ZQC A;  4RPZ A;  3HWT A;  4XA5 A;  2HHV A;  1ZQF A;  4YQW A;  4ELV A;  2JZB A;  4TQS A;  3F5A A;  4Q8E A;  4BDP A;  4DQP A;  2BDU A;  5AIA A;  2AQ4 A;  4KLM A;  4UAU A;  5ALD A;  3HT3 A;  3PW5 A;  2ASJ A;  3LVW A;  2HBM A;  1X6J A;  3EZ5 A;  2YTU A;  2HOI A;  1N60 A;  1COO A;  3RJE A;  3HKZ F;  5T14 A;  2F77 X;  1N2X A;  2ZIW B;  2YB4 A;  2DKZ A;  2BCS A;  5J2I A;  3AN1 A;  9ICH A;  4GFJ A;  2FPM A;  2NYV A;  5KTQ A;  1IV8 A;  4PGY A;  1N56 A;  2OH2 A;  3U26 A;  3IRU A;  2LYA A;  5J2F A;  4HYK A;  3C2M A;  4DL4 A;  1KSP A;  4F93 B;  1SWW A;  4NL9 C;  1S0O A;  1Q8K A;  1QSL A;  3Q8R B;  4P0P A;  4U7C A;  2W03 A;  1BPX A;  4CF3 A;  1QCK A;  7ICG A;  2IOH A;  2YX8 A;  5DG8 A;  1ZJN A;  2K8A A;  7ICO A;  1PK1 B;  4TUQ A;  5EE9 A;  3MC1 A;  2KP7 A;  4F92 B;  1ZQU A;  4FBT A;  3AM9 A;  4Q45 A;  3MR2 A;  5AKY A;  2DBY A;  3PY8 A;  5KFL A;  1JIH A;  4LVS A;  2A1J A;  4US9 A;  4O3Q A;  2HOF A;  4Q8F A;  2FI1 A;  5JU5 A;  7ICM A;  5L1K A;  3RB0 A;  2OYY A;  5AKG A;  4ECR A;  1KQQ A;  4KN4 A;  1KFT A;  3AU6 A;  7ICT A;  5AKH A;  1XC9 A;  1BVS A;  1S0N A;  2OM6 A;  5KFH A;  2RQ5 A;  5DBA A;  5FP0 A;  4FO6 A;  3T79 A;  3M1Y A;  4QWE A;  2WAQ C;  9ICI A;  4RZR A;  1SV0 A;  1HEK A;  5HML A;  4BWM A;  1GO3 F;  1DRG A;  5CB1 A;  1FO4 A;  1ZOL A;  5AKX A;  3IG5 A;  1OUQ A;  4MF8 A;  8ICT A;  2NRZ A;  5BOL A;  1ZQK A;  2KZZ A;  5KFN A;  2Y0S C;  5KG6 A;  3AUO A;  1FEZ A;  4QZH A;  4DS5 A;  2VA3 A;  4OJ5 A;  3RJI A;  1V9P A;  4IRK A;  3RJF A;  1J97 A;  4Y2T A;  4Y2R A;  4B9U A;  3FDS A;  4YR2 A;  2HHS A;  4EYI B;  3CW2 C;  3DV9 A;  4DFP A;  5BOM A;  3TAQ A;  3LK9 A;  4OCZ A;  4DSF A;  9ICW A;  2W9C B;  1YZ7 A;  2YN4 A;  4XQ8 A;  4GC7 A;  3PST A;  8ICE A;  1OXJ A;  2GLE A;  4C80 A;  4UB2 A;  5J2D A;  2DGZ A;  4USA A;  1Z4N A;  4FZN A;  4DOB A;  1IIP A;  4IQT A;  3UM9 A;  4Q44 A;  3BQ1 A;  4AP9 A;  4DS4 A;  2LBO A;  5KFI A;  1T4G A;  3M8R A;  4ELU A;  3M9M B;  3UPQ A;  2D6F C;  3Q8S B;  2E1E A;  1Z4O A;  2YQE A;  3QEB Z;  3UMG A;  7ICS A;  3UMB A;  2V4Q A;  2BPG A;  3A0H U;  3KZX A;  4QIW C;  4NV0 A;  1NKE A;  5AI5 A;  5KG0 A;  5KT2 A;  1L3U A;  2BCQ A;  1TK8 A;  3EUB 2;  1CRX A;  3Q8Q B;  5G5G A;  2B0C A;  4ED3 A;  4M9N A;  4ECT A;  2VAN A;  4UB6 U;  5ALJ A;  3PO4 A;  1F5S A;  5AM3 A;  2XY5 A;  1ZQP A;  2ZG6 A;  2XCP A;  2Q0Z X;  1N63 A;  4AYB F;  1NJY A;  1NK7 A;  2YMM A;  5CR0 A;  3PR4 A;  1RXV A;  4KLG A;  2HBK A;  2JEG A;  3NGD A;  4BJQ A;  2E8P A;  1HIW A;  2W9M A;  4Y2V A;  4K4G A;  4IR1 A;  2H5X A;  1D9D A;  5ALY A;  4KLQ A;  1WCN A;  4R8U A;  1X42 A;  2K4I A;  4DLG A;  3SI8 A;  5ALR A;  3M8S A;  1SKW A;  4B9M A;  1MC8 A;  4LZG A;  4JMU A;  3IM1 A;  5AI6 A;  3UXP A;  3ISD A;  1JXE A;  1RYS A;  5ALV A;  2ZTC A;  1NZP A;  4DCC A;  1X9X A;  4NXZ A;  2W8L A;  4YR3 A;  3TAP A;  2DWQ A;  4FFD A;  1SXE A;  4UW9 A;  3WKA A;  2HSZ A;  1N5X A;  5KFM A;  3WKE A;  4Y2Q A;  5DDY A;  2LM1 A;  3MR3 A;  3C5G A;  1L3T A;  3OGU A;  4WJ3 B;  3GFK B;  2OEH A;  4DO9 A;  4DQR A;  5L9X A;  1N5W A;  1ZXI A;  1SL2 A;  2NO5 A;  1YT3 A;  1S5L U;  1PZN A;  4FZM A;  1Z00 B;  7ICF A;  8ICB A;  1A77 A;  2ZIX B;  3RR8 A;  4RUA A;  5DB8 A;  4Z6E A;  2BQU A;  4RPX A;  2K8B B;  1RZT A;  5EWG A;  5HHH A;  2FMP A;  3WK9 A;  9ICU A;  1ZQD A;  3ZD9 A;  4J9Q A;  4EYH B;  1N48 A;  4G3I A;  2FPL A;  2XGQ A;  3TAC B;  3KKA A;  3PW2 A;  3WK5 A;  5KG1 A;  4UB3 A;  3SV4 A;  5JUM A;  2Z7J A;  1U45 A;  1O03 A;  2IA6 A;  1UT8 A;  3C29 A;  4TUS A;  1KN5 A;  1WCL A;  4MFF A;  1U4B A;  1MA7 A;  2P35 A;  1U9L A;  3PR5 B;  2M9N A;  2W3R A;  3NVV A;  2ASD A;  4UAR A;  1CUK A;  2OXO A;  1IM4 A;  3ZDD A;  2EAO A;  3WK8 A;  3BS7 A;  2EZZ A;  4OD0 A;  2A1A A;  3TAN A;  9ICR A;  5KFD A;  4UB4 A;  4MEY A;  5ALX A;  4M6W A;  2K8C B;  3VCB A;  1NKB A;  4NLC A;  2AGP A;  2W11 A;  4IL6 U;  2C22 A;  1QQ6 A;  2PI4 A;  5ALQ A;  2NO4 A;  5TZV A;  2H3F A;  1Z19 A;  4NWI A;  5AKJ A;  4DEZ A;  2HI0 A;  4Y2X A;  2KSO B;  7ICR A;  1TKD A;  1JI7 A;  2DQN B;  5AIB A;  4RQN A;  5KG3 A;  2KJ8 A;  1ZQV A;  1KDH A;  3NAS A;  2UVU A;  5ALP A;  4KLD A;  5KG4 A;  4HAI A;  2LKY A;  3OHA A;  2J6U A;  5KFF A;  2D3D A;  1FFV A;  1Y88 A;  2ZUD A;  2WF7 A;  5CEH A;  3PV8 A;  3BQ2 A;  3SEN A;  1RPL A;  1WYG A;  2R8G A;  4OJL A;  5EWF A;  1ZYQ A;  4KLH A;  5AM1 A;  4PHE A;  2ZJ8 A;  3OJU A;  4EBC A;  4UB1 A;  1BNP A;  4BGD A;  1SV4 A;  4DL3 A;  4UAY A;  2WAQ F;  2I5H A;  4IR9 A;  2DL0 A;  2E8O A;  5J0W A;  2Y9U A;  1ECW A;  5L1I A;  1SXD A;  4PH5 A;  4OO1 J;  3RRH A;  8ICH A;  4YMN A;  1ED1 A;  5A0L A;  3ZI4 A;  3ISB A;  3QZ8 A;  3LWM A;  4KTQ A;  3ZDB A;  2EDU A;  2KIW A;  5KFU A;  2AQ0 A;  5EWE A;  1MSW D;  4JK1 A;  1TAM A;  4F4Z A;  4DL6 A;  2NRV A;  4I28 A;  1TK5 A;  2G07 A;  2ESE A;  4KLJ A;  3Q8P B;  3GIL A;  5ALS A;  5III A;  7ICV A;  3N4M B;  1UA0 A;  4XUS A;  1NK9 A;  1JX4 A;  4EEL A;  9ICX A;  2KIC A;  1D8Y A;  4GXK A;  2I1Q A;  2MSN A;  1C7Y A;  5IIL A;  1SB3 C;  2OWO A;  4NL9 A;  4I29 A;  4YMM A;  2P66 A;  4B9S A;  4KN7 A;  4ED8 A;  2UVW A;  2WF6 A;  4QZF A;  3QU2 A;  3C23 A;  2KZ3 A;  2BPF A;  3BQ0 A;  2CRX A;  1XO1 A;  2LPE A;  3ZDE A;  2C2R A;  2AHO B;  5HHI A;  3GIJ A;  2F1J A;  5KG5 A;  5J2K A;  1UT5 A;  4DOC A;  4P4P A;  2F2A B;  4DF4 A;  4NLZ A;  2I9G A;  1ZQQ A;  4RQ6 A;  3WU2 U;  2KN7 A;  4F8R A;  2HMX A;  4NLN A;  2J6T A;  4PZO A;  4M04 A;  2M0N A;  3FC4 A;  4UAT A;  1K5O A;  4ZH4 A;  2KFN A;  3JPN A;  2ZIW A;  1S97 A;  4ECZ A;  1RQN A;  2KEY A;  5AM4 A;  1V97 A;  2P6R A;  1UPH A;  4EX7 A;  5AI0 A;  2IOF K;  4RNO A;  4CDG A;  2HHT A;  4PHD A;  3MR6 A;  1TK0 A;  4I2D A;  2ODG A;  2KG5 A;  4KLU A;  3SR6 A;  4ED0 A;  5DGA A;  1QH9 A;  5K4L A;  1NZB A;  5DB7 A;  9ICE A;  4UAW A;  4EZ6 A;  2G06 A;  5H2F U;  3QXG A;  9ICO A;  4F5Q A;  4Y2P A;  1X2I A;  5EOZ A;  2IHN A;  1XSP A;  2CN1 A;  2HOQ A;  5KFZ A;  3HW8 A;  4LZD A;  2HBJ A;  4DSI A;  1JUD A;  4CCH A;  3NTU A;  1PK1 A;  3RJK A;  1KL9 A;  3ED5 A;  2WF5 A;  1PVP A;  2XVT A;  3C1Z A;  2F1H A;  2K4H A;  4DQI A;  3EPI A;  2FPK A;  4C8N A;  1C20 A;  4YVZ A;  4P0P B;  2YML A;  5JTI A;  4KIT B;  2FLN A;  1SGG A;  9ICT A;  1ZQA A;  4NM2 A;  8ICI A;  3H4B A;  5KFQ A;  3QU4 A;  2HW3 A;  3KOO A;  3TAD C;  2GH1 A;  4RNM A;  3GV7 B;  4F72 A;  4Y2U A;  1ZQW A;  2BR0 A;  5J0X A;  4C4T A;  2JH7 A;  8ICN A;  1XU4 A;  2PKE A;  3BJY A;  4GXI A;  5HP4 A;  4DFM A;  4P4O A;  2RP5 A;  1L3S A;  5L1M A;  8ICL A;  3UXO A;  1SZH A;  4PZN A;  4IRD A;  9ICL A;  2KZM A;  1TVA A;  1DK2 A;  3QE9 Y;  3N28 A;  4E0D A;  5F3X B;  5ALF A;  3Q8M A;  8ICW A;  5J0U A;  3BQT A;  4YFK A;  9ICV A;  1ZJM A;  3SV3 A;  4DQS A;  5KT7 A;  1KKX A;  2AGO A;  3G6X A;  4EEN A;  2J6S A;  2VA8 A;  4I2G A;  3PW4 A;  1U49 A;  4ICA A;  5HMM A;  3PNC A;  4I2B A;  2DFL A;  3VC8 A;  1U48 A;  5ALU A;  2MRL A;  2RDJ A;  4I2C A;  8ICP A;  2KHQ A;  3C21 A;  5DB6 A;  3MBY A;  4KLE A;  2ZXH A;  4NLG A;  1L7N A;  2CXY A;  1BPZ A;  2WF8 A;  2W9C A;  5AM5 A;  3GZF A;  4JUZ A;  2XID A;  4YCX A;  4F4K A;  2KIV A;  1NJW A;  9ICQ A;  3NRW A;  4G9B A;  5J2E A;  3D2Q A;  4QZ8 A;  4KMU A;  4QZD A;  4DL7 A;  3RAX A;  4DSL A;  5AK4 A;  3PW0 A;  3LYS A;  2R8J A;  1V85 A;  2B21 A;  4M9L A;  5DKW A;  3GU3 A;  4B9L A;  5J2C A;  3BS5 B;  4RQM A;  5ALG A;  4J9M A;  3KHL A;  5J2H A;  3H0L B;  5KFK A;  3SAH A;  2WTF A;  4ECY A;  2RRD A;  1SKS A;  1BPB A;  1NI3 A;  2RLT A;  2VIX A;  5KT5 A;  1O08 A;  2Y1J A;  2UVR A;  3PML A;  3T5K A;  8ICX A;  3S6J A;  1T94 A;  3HJE A;  1S76 D;  1S0M A;  5J29 A;  2D8C A;  1NK0 A;  2HHQ A;  4EX6 A;  5ALZ A;  4CNQ A;  3MGV A;  2ISO A;  4PL1 A;  4M2Y A;  2ZUB A;  2F44 A;  2XCA A;  8ICM A;  3TKA A;  1BGX T;  3H0R B;  4F50 A;  4QZG A;  3RB4 A;  4P0Q A;  4J03 A;  4FBU A;  1X6I A;  4BWJ A;  2BCU A;  9ICF A;  4F4W A;  2YMP A;  1XO0 A;  4RQ8 A;  4MHV A;  5CJ7 A;  1BPY A;  3ZDC A;  3RTV A;  2ZXI A;  3I76 A;  4UAZ A;  1NKC A;  2EAP A;  5KT4 A;  3C1Y A;  3D6J A;  3HKZ C;  4CE6 A;  1UQV A;  2WF9 A;  1PVR A;  3PX4 A;  4I2H A;  4TUR A;  3RJH A;  3AEV A;  4ECQ A;  1V38 A;  2IBK A;  2JR5 A;  1S9F A;  4O3N A;  3JPS A;  2ASL A;  2BDP A;  4BXO A;  5AK6 A;  3KD3 A;  4Q43 A;  2MA1 A;  4F3O A;  1B0X A;  3IN5 A;  2PMZ F;  2ZUC A;  2ZTD A;  3KZI U;  2MUT B;  5BPC A;  5D46 A;  2W9A A;  5DQI A;  1QQ5 A;  2KVC A;  4EBD A;  3IV6 A;  1JN3 A;  1Q3V A;  4J9L A;  3FM9 A;  4PHA A;  5J0P A;  4I2J A;  4QZC A;  5KFJ A;  4DSE A;  9ICC A;  3OSP A;  1XWL A;  5AKE A;  3F2B A;  5B66 U;  2DF4 B;  2PXI A;  2DKX A;  2BZF A;  1NK4 A;  4KLL A;  1ZQB A;  4C8O A;  3H0M B;  1URJ A;  5J2A A;  4PGQ A;  2AU0 A;  2BPC A;  5KG7 A;  5AI8 A;  1SL0 A;  2ZIV A;  2H3I A;  5IIM A;  2LYB A;  1PUZ A;  2QKQ A;  3OSN A;  3TAR A;  5J2J A;  3RJJ A;  4ACO A;  5ALI A;  3G6Y A;  1ZD3 A;  1ZQX A;  2DPI A;  1A76 A;  1TAU A;  1DXS A;  2QAR B;  2JH1 A;  1FIQ A;  3AL0 B;  3HRD D;  2LYH A;  3PSF A;  1RYU A;  4DFK A;  2EH9 A;  3QU5 A;  2R8K A;  1S77 D;  1ARO P;  1WWU A;  5IIJ A;  2HHX A;  2JMG A;  2WB1 C;  4M47 A;  2W3S A;  2ZJA A;  3K1R B;  3HPO A;  4NJ8 A;  1BNO A;  4M0A A;  3RBE A;  4GXJ A;  4JWN A;  8ICS A;  4EZ9 A;  2W7P A;  4QZE A;  5JRT A;  3MGH A;  5KFE A;  3SMV A;  1QSY A;  1F0M A;  4DSJ A;  1T7P A;  3Q8L A;  1RM6 C;  2PFO A;  4C4R A;  3EW9 A;  3T5L A;  5KFV A;  4QW8 A;  3ISC A;  2W7O A;  3QUQ A;  3JPT A;  3K75 D;  4OJO A;  2ES6 A;  9ICJ A;  2JGA A;  3GII A;  4CRX A;  4Y2S A;  1QTM A;  3H8W A;  3NVW A;  2KSO A;  4IC9 A;  2KFZ A;  4X5V A;  2JHD A;  4M6W B;  1XNS A;  2DPJ A;  2BKE A;  5B5E U;  3J81 j;  1HUZ A;  2NV3 A;  3RJG A;  3V7K A;  2P6U A;  4F71 A;  4J9O A;  4MF2 A;  9ICN A;  2DUY A;  1SL1 A;  2G08 A;  1RXW A;  3PO5 A;  3V6K A;  3MFI A;  3NUQ A;  4UB8 U;  3WKD A;  3M9O B;  3ZD8 A;  1L8L A;  4QW9 A;  2HVH A;  5DDM A;  4F4X A;  4BX9 C;  4BUG A;  2EZX A;  1PVQ A;  5F9L A;  5IIN A;  5KFA A;  1ZQZ A;  3SAF A;  1L3V A;  2GWS A;  2F76 X;  1LB2 B;  3QU9 A;  2IHM A;  3F5E A;  3NVZ A;  4ECS A;  4QZA A;  1XS9 D;  3FAH A;  4C8M A;  1Z1B A;  2N1R A;  3LVV A;  1ZQL A;  3ICX A;  4OJP A;  4RQ0 A;  3LDA A;  3QUT A;  3KHR A;  9ICK A;  4I2I A;  3RH5 A;  2XO7 A;  1ZQJ A;  3N97 B;  4AYB C;  3N7S C;  4DF8 A;  2Y0S F;  4QZB A;  2JRZ A;  5AHX A;  3M9N B;  3E0F A;  4M9H A;  1WWV A;  4IQV A;  4KLT A;  3NVY A;  5KNI A;  1CEZ A;  1DOQ A;  5KAF U;  1N62 A;  4I2A A;  5J2G A;  3F2D A;  8ICJ A;  3UXN A;  5ALE A;  1LKY A;  1B22 A;  1JMS A;  3EWA A;  3V7L A;  5KFO A;  3GV5 B;  4F4Y A;  4JB3 A;  4QWA A;  2LMR A;  2KV2 A;  2E3T A;  4Z6D A;  1SKR A;  3IDW A;  4ED6 A;  4F91 B;  4RQ2 A;  1L7O A;  1OW5 A;  2W9B A;  2GOL A;  5EE0 A;  5CWR A;  4IQU A;  4CF5 A;  4DLE A;  3I1Y A;  2H3Z A;  1JRP A;  2ZIU B;  4O0I A;  2KJ9 A;  2XGP A;  2C28 A;  3GIK A;  7ICQ A;  3G6V A;  3OHB A;  1Z3E B;  2KE7 A;  4QWC A;  2KNJ A;  2UVV A;  5ALW A;  4QWD A;  1VDV A;  3F53 A;  1UCV A;  4YD2 A;  5F9N A;  2IMW P;  4XRH A;  1ZD4 A;  3IP4 B;  3JPO A;  4QJF B;  3B9J A;  1KFD A;  3CRX A;  2QB0 B;  8ICR A;  1TAQ A;  3TAD A;  7ICH A;  4QIW F;  5DGB A;  5DLG A;  4UBC A;  3RAQ A;  1NJZ A;  1IG6 A;  3WKC A;  2VKQ A;  4GC6 A;  3L4P A;  7ICP A;  9ICM A;  4KLI A;  2JEJ A;  5E79 U;  5AK5 A;  4IQW A;  5CRX A;  2Y9T A;  2K4E A;  3SEI A;  2OHF A;  2EQY A;  4CGZ A;  1ZQI A;  1BPE A;  4EEY A;  4J9P A;  4FZL A;  4RPY A;  2G09 A;  3H7I A;  3OTQ A;  2JZB B;  4YMO A;  4PGX A;  5C0Y A;  1D8L A;  3HIL A;  3QU7 A;  1X9S A;  1MQ3 A;  7ICK A;  3PVX A;  3MGI A;  3GDX A;  2G5I B;  3H8J A;  4IS7 A;  3PX6 A;  3B0X A;  2QLT A;  2YY6 A;  4F5N A;  2KJ5 A;  3L3F X;  4NM1 A;  4RQ5 A;  4UAS A;  3QX7 A;  3E58 A;  3THV A;  4R63 A;  3UMC A;  4DOA A;  3JPP A;  4RT3 A;  1VJ5 A;  4OJ6 A;  3K4G A;  3O0F A;  5J0Y A;  2FJ6 A;  2FMS A;  4J9R A;  4QZI A;  5ALK A;  3RRG A;  1RYR A;  2C2E A;  5CA7 A;  2HVI A;  4J9S A;  3SYZ A;  2XY7 A;  1D8B A;  2LHT A;  3T3F A;  1YZ6 A;  2E8N A;  3CP8 A;  1S8O A;  4KX3 A;  4ED1 A;  7ICN A;  2R18 A;  2V4R A;  3F2C A;  5AKZ A;  4RQ1 A;  3GV8 B;  3TI0 A;  4C8L A;  4YR0 A;  2C2D A;  5KG2 A;  9ICB A;  4RQ7 A;  3QEA Z;  9ICG A;  4J9N A;  1A6S A;  4DSK A;  4F2R A;  4O3O A;  1KLN A;  3BQ7 A;  1ZQM A;  5J8Y C;  3BZC A;  4RT2 A;  2A1J B;  2KKP A;  1SZP A;  2G0A A;  2BCV A;  4KX5 A;  5DG9 A;  5KL1 B;  5D49 A;  2FDR A;  1RQL A;  1F44 A;  4ELT A;  5ALT A;  3E2E A;  3ETL A;  3BZK A;  3M6Z A;  4ED7 A;  5DBC A;  4IRC A;  8ICZ A;  3EPG A;  2A19 A;  1CI4 A;  7ICL A;  2EZY A;  1FFU A;  2LM4 A;  3SD7 A;  3I28 A;  4I27 A;  1COK A; 
#chains in the Genus database with same CATH homology
 2KMD A;  3K1R B;  1SXE A;  2E8M A;  3H8M A;  4NJ8 A;  5JU5 A;  3HIL A;  1Z1V A;  1PK1 A;  2EAN A;  4NL9 A;  1WWV A;  4IS7 A;  5KNI A;  1B0X A;  2KIV A;  5J8Y A;  3KKA C;  5JRT A;  1B4F A;  2KSO B;  2F8K A;  1PK3 A;  1JI7 A;  4RQN A;  1F0M A;  1LKY A;  1V85 A;  2D3D A;  5JTI A;  1SGG A;  2LMR A;  1SV0 A;  2JV3 A;  3BS5 B;  4RQM A;  3SEN A;  2LPE A;  2K4P A;  2F3N A;  3IDW A;  2ES6 A;  2YTU A;  2L5Y A;  3TAD C;  1OW5 A;  2KSO A;  2DKX A;  1KW4 A;  2QB1 A;  1RG6 A;  1SV4 A;  2DKZ A;  2E8N A;  2DL0 A;  2E8O A;  2B6G A;  2Y9U A;  3TAC B;  5L1M A;  2D8C A;  3KKA A;  3BS5 A;  4PZO A;  1SXD A;  2QKQ A;  4PZN A;  2KE7 A;  1UCV A;  2F44 A;  2E8P A;  5F3X B;  4NL9 C;  2QB0 B;  1LKY B;  3BQ7 A;  1DXS A;  5J8Y C;  3TAD A;  2QAR B;  1X40 A;  2FE9 A;  4MHV A;  2ESE A;  2KG5 A;  1PK1 B;  1X66 A;  2EAO A;  2EAP A;  3BS7 A;  1OXJ A;  2GLE A;  1WWU A;  1SV0 C;  1UQV A;  2Y9T A;  1X9X A;  2EAM A;  3SEI A;  2K60 A;  2QB0 A;  2QAR A;  1V38 A;  1COK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...